1H1YA

The structure of the cytosolic d-ribulose-5-phosphate 3-epimerase from rice complexed with sulfate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
219
Chain Sequence
AAKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSLRKHTKAYLDCHLMVTNPSDYVEPLAKAGASGFTFHIEVSRDNWQELIQSIKAKGMRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-RIBULOSE-5-PHOSPHATE 3-EPIMERASE
publication title Structure and Catalytic Mechanism of the Cytosolic D-Ribulose-5-Phosphate 3-Epimerase from Rice
pubmed doi rcsb
source organism Oryza sativa
molecule tags Isomerase
total genus 76
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1h1yA00
1Z44A 5TQLA 1TTPA 3W85A 3HGRA 1FWWA 1Q6OA 5E93A 3W3OA 2TYSA 2QF7A 1LDCA 3KVJA 1EB3A 4UNKA 3LV5A 3P8IA 4GUHA 1OG0A 1SUXA 1GJPA 4FNPA 1YXCA 4YL2A 2GVJA 5DCBA 4O8RA 5IBXA 4LOCA 3EX2A 1XBYA 5AC7A 1DORA 3W1XA 3KRUA 4UMCA 3S5NA 3QJAA 3SGUA 2ZTJA 4CQ9A 1VHNA 3WK3A 1EP2A 3EXSA 3QF0A 2GQ8A 4XZ9A 1JCMP 4FNQA 4CQAA 4QISA 4K7VA 1T8XA 4WUIA 4PA8A 2RDTA 3IRDA 4IJBA 1FBAA 4DF2A 2QUVA 3S8HA 3ZR4A 1OFPA 3PSVA 1K8YA 4U4MA 2X30A 3LCXA 2B4GA 5G1TA 3E02A 2HMCA 3PBYA 2TMDA 2NLIA 3DI1A 4DQWA 1C29A 3NG3A 4JN6A 4N9CA 3EXRA 4PFMA 1SQ7A 1ICQA 5D38A 3L2IA 1F5ZA 1JCYA 3B4UA 2WOQA 1X7FA 1ZNNA 3W7NA 4YLWA 3BW4A 3P84A 4N2YA 3NQ2A 4A2RA 4K36A 2A0NA 1LBLA 3L68A 5F4WA 1GQNA 3SECA 5CPMA 3BPWA 1OK6A 3MHUA 4AMAA 4HPJA 2DZVA 4LUIA 3BV4A 3D0CA 1W5OA 3G1YA 3M44A 1ICPA 2E6YA 1SO3A 1V5XA 2CZFA 2ZFAA 1Q3NA 3FOKA 1I8JA 3IIPA 1F05A 3T44A 2QDHA 4JX5A 4WD0A 1A5CA 5D33A 2YYTA 5D2TA 1Q6QA 4MUZA 5DELA 2ZRWA 2NX9A 4N4PA 4UTJA 4UFMA 1WAUA 3FEMA 5EMUA 3QQ1A 1HO1A 2CLLA 3MJYA 3G0XA 4U28A 2RKXA 4QNWA 3PUEA 3I7QA 2GQ9A 4N4QA 5AHLA 4MOZA 5K2ZA 5F1VA 3PS7A 3O63A 1ZAJA 5KSWA 3KVMA 1A53A 4LVGA 4O52A 5AN7A 5K4XA 2C1HA 1AL8A 2X1SA 3DHDA 2VFFA 3WK1A 3C4UA 5AHMA 2NWSA 3UQNA 3M5VA 1LM1A 2E6FA 1MEWA 2B7QA 1QO5A 1O5XA 3S1VA 1ZCOA 5H91A 5D37A 5CZSA 2X16A 3CHVA 1J5TA 4ALDA 3TUUA 2ATSA 2WKJA 4EIVA 1I2OA 3BW2A 5H2ZA 1UASA 3LHWA 1JCNA 4N6EA 4MJMA 3DGRA 1XXXA 3W6YA 2DZXA 3C2OA 1VH7A 3E0IA 1M5WA 3NL3A 1LTDA 1V7YA 3TMLA 1ONRA 4LV9A 1OYBA 1TJRA 4ZMGA 4JTIA 4NNBA 3O15A 2OZ0A 1GVRA 4O28A 4NX0A 1XUZA 1LZOA 3MHGA 5A8GA 1LYXA 4JTFA 4BWLC 2NZLA 3TROA 4FX6M 3PBVA 1KFEA 1YXDA 3NVTA 3W7LA 4NZJA 4MFDA 3W75A 3P80A 4GUIA 1TPWA 1GG1A 3T55A 2V30A 5J5RA 2QCCA 1SO4A 1W54A 3MP5A 4JTLA 5LNVA 3H55A 3TXVA 4WOZA 3FYPA 1H5YA 1Q6RA 3K30A 2UV8G 2E6DA 1ZAIA 3G1AA 3M1ZA 5K9DA 5AYXA 2CZ5A 3OG3A 4R33A 3STCA 2ZZ2A 1O5KA 5G2WA 4UR7A 4LRTA 4UTUA 1QPOA 2VEKA 4O12A 1MSSA 3FKKA 4MLRA 5F4SA 3STEA 2GQAA 4DELA 1GYLA 3HO8A 3VNDA 3VFLA 2O7QA 5J5DA 1WOBA 1R2RA 2OT0A 5DY3A 1XL9A 2B7PA 3W72A 3QW3A 4S2CA 3MW7A 1VZWA 3LCLA 1C8VA 3NQVA 4Y8FA 4AB4A 2WPBA 4N9BA 2EKCA 4FNSA 1TYGA 3DHFA 1LRQA 4WOQA 3HJZA 3NQ8A 1QOPA 2H3BA 4AXKA 2B0MA 3FJ6A 3FFSA 4XTDA 2C16A 1W3IA 3LCIA 4ORIA 4Z1CA 3IGUA 5EBUA 1AW2A 1VYPX 4OV9A 3WJWA 1K3UA 3NL6A 4NXKA 2ZBTA 1SPQA 2DU2A 2VEMA 3A24A 3LXAA 2WQPA 4WJEA 1DL3A 3LCHA 4CNPA 3I6RA 4C1KA 1LCOA 4DF0A 3LB0A 4UFKA 1H63A 5FI8A 2VEPA 1G69A 1TREA 3CEPA 3LOTA 4Z0JA 1GTHA 2Z1BA 1GOXA 1ME7A 4JTGA 4TX9A 1LOLA 3B05A 3TMQA 3B04A 4M19A 3MI6A 4BI7A 1DBTA 1I4NA 3B06A 4JYDA 2Y6ZA 2TRSA 3DXIA 5FEWA 1UBSA 4O15A 3HG2A 4UTIA 3MBFA 1GVFA 2P1FA 2J9YA 3N14A 4JR5A 4O4WA 1TTJA 2XFWA 3TFCA 1RQEA 2J88A 2BZNA 4X2RA 5EA9A 3DH7A 4ZQCA 3M5YA 3LHUA 4UMAA 1SW7A 1PE1A 4RXFA 1SZFA 3KX6A 3LX9A 4JEQA 4O11A 5KITA 1FCQA 3SGZA 4EOUA 1BKSA 4JX4A 2HS6A 1ZAHA 3C61A 1FDZA 2FQIA 3CQ0A 4O18A 5CGQA 1VS1A 3W9ZA 3W7MA 4TIMA 2YGYA 3LLDA 1AK5A 4PH6A 1RVGA 1NF0A 1OX4A 1KFKA 1HTIA 3PG8A 3T40A 3MP3A 1K02A 4ONVA 4GUJA 1DQXA 4WZHA 5IBXC 2AAMA 2W0UA 2Q8LA 3FLUA 3W71A 1TRDA 2X1TA 1TQJA 2Y70A 4IUOA 3VCRA 1BTMA 1G6CA 1TPB1 4IWWA 1TRIA 2V5LA 3MWAA 1W37A 3S5YA 1O94A 4LC6A 2ZZ4A 3TSDA 4Z1DA 5DN1A 3N19B 3NL2A 3RLVA 2A7RA 1R30A 1TPFA 3E49A 8TIMA 5CPLA 2I14A 1W5NA 3S42A 5C55A 2GVGA 1PVNA 1F7BA 1YTEA 1VCGA 2B7NA 3QYQA 1G4SA 3PR2A 4OU1A 3GK0A 3R89A 3E96A 3F4NA 3T78A 3S1XA 3WFAA 2PRMA 4NNCA 5AOUA 4O57A 2ZZ5A 5K3VA 2F7FA 1VCFA 3EWYA 3C2VA 1UUOA 4O53A 3PM6A 1HO4A 3LERA 4AWSA 4AH7A 3GNDA 5F4XA 1SSGA 4HNTA 1TV8A 1LRNA 3G1DA 3UWWA 4JTEA 3LHTA 1VRDA 5A5WA 4UUIA 3UZJA 5EYWA 4I7VA 2VOMA 1W5PA 1A5AA 1GEQA 1UUMA 1NF7A 2A6NA 4YWIA 2X1UA 3G1XA 3M47A 4DBEA 3EX1A 1NSJA 4K39A 1YTKA 5AHEA 1S5WA 4O1AA 5F1UA 4LUJA 1P4CA 2CLEA 3IVUA 1XDLA 1K7EA 2ZQ0A 1EP1A 2J6XA 1VLIA 1NFBA 1F6PA 3NQGA 3TJLA 1H7OA 2HTMA 1YTDA 2W79A 2YYUA 3AO0A 2NUYA 3C8FA 2YCEA 1ME8A 4PTNA 5AC6A 3TA6A 2CLKA 4EF8A 3W1UA 1R2TA 1YLVA 3A21A 3CWOX 3IV3A 4HPXA 4FEZA 3PB0A 1QO2A 2Y7FA 4R53A 4M6QA 5DXYA 2FB3A 4OHQA 4PODA 3VKJA 1SZGA 2QCMA 5AHFA 3LDVA 4MJZA 5I3GA 3MUXA 1A50A 5C2XA 1KM6A 2JKEA 4KWWA 2YSWA 3TQ0A 1AMKA 2PE4A 2QCDA 1F74A 5ABTA 2E77A 3HGOA 2CZEA 4NZFA 3DFTA 5D04C 3IIXA 2GPTA 4DO6A 5U7SA 3W1LA 3DFQA 1KFJA 3V1PA 5D30A 4IX2A 3W76A 3QQ0A 3EKLA 3MBDA 2ZRXA 4O0KA 4QITA 5LSMA 4R7JA 3G24A 3C6CA 3BLFA 1XCFA 3ELFA 1OYCA 4BR1A 3N34A 3LLFA 3P60A 3THAA 3LBMA 1JQXA 2CLOA 3UNDA 1AW5A 4L4LA 4LVFA 2H90A 3GB6A 1M7OA 2G5WA 1K8ZA 4CNOA 4GBUA 2B7OA 3W74A 1SW0A 4Z1AA 1KA9F 4O50A 4HNVA 3TK7A 5C5YA 3PC0A 3PAJA 3KOFA 4Y96A 4BK9A 4O19A 3HIJA 3KVKA 1W31A 3TNOA 3OHIA 1NAL1 1WQ5A 4FIQA 1QPNA 1PV8A 3EEGA 4CCCA 3HPSA 3ABSA 3W7JA 4A29A 2ZRVA 5CPNA 3RK8A 3G1SA 3QH2A 4P2VA 3PBUA 1N7KA 1QR7A 1BWKA 3S1WA 1U5JA 3GKFA 3R5EA 3G0SA 1FCUA 5I3HA 1PIIA 1JCJA 3W7OA 3DAQA 4KWVA 5LZLA 4HN4A 3G3MA 3HG4A 4LC8A 3NDOA 1HG3A 1N55A 5AYZA 2VFHA 4JIQA 2DP3A 3LTSA 3HGJA 4NJHA 4NJGA 4OQVA 3W86A 1I2PA 1TPEA 3OBKA 4MZYA 1OX5A 4UFHA 4E0CA 3B03A 2G96A 2WV8A 1VLWA 3BARA 4Z08A 2ISSA 2RH9A 3GKAA 3L5AA 1KTBA 4UNLA 3C0JA 1H61A 4E38A 4NJIA 1VYSX 4JTSA 4IMCA 3QMTA 3W7QA 4QJ1A 2A85A 3V75A 1VQTA 5TBOA 5D05A 5DBUA 3G18A 3FIGA 1S5TA 4OT7A 1MEIA 2EHHA 3EXTA 1ZJIA 3NA8A 2R8WA 5FF3A 1TCDA 2DZTA 4D2JA 5AFDA 1ZENA 3W7DA 1G4EA 4IXHA 4WXYA 2YZRA 3IIVA 3QC3A 3ZFHA 4CCDA 3TJXA 4LWWA 2ALDA 1X6UA 2VFGA 3HPZA 5DCEA 2ZZ7A 1AW1A 3WJYA 3NEVA 4JS3A 3O07A 4WY0B 1IGSA 4NT0A 3YPIA 1FX6A 2GOUA 4H4IA 4JDBA 1WX0A 1XBZA 1M7PA 4NU7A 1TIMA 1BEUA 6TIMA 3A5FA 2AGKA 3SY5A 5KZEA 3ABOA 3QM3A 1JR1A 3HBLA 5HR6A 4IPIA 3E12A 4LW7A 2DZUA 2ZCGA 3W2NA 4N9EA 3QEZA 4TMBA 4YCOA 2V5BA 4H3DA 2GJNA 4K7YA 3GDLA 4WY0A 3CTLA 3G22A 1GWJA 1P0KA 4EWND 1JCXA 4RZ4A 3A23A 3ZS4A 1JJKA 1FXPA 3H53A 4JXCA 4RX0A 2A6LA 3USBA 4RZ5A 2Y63A 2EGZA 1W8SA 3C56A 3W7EA 4RV8A 2DZSA 5EKYA 2ATMA 2XN1A 3DFPA 1B57A 3UXDA 3P67A 3W73A 2BSLA 3HG5A 5D2XA 3IEBA 1KTNA 2EF9A 1EP3A 3NQAA 3OVRA 3LHVA 3KAOA 4FIRA 5HWMA 1WA3A 3R13A 2ABAA 2A7NA 2E09A 1TO3A 1K7XA 4MYXA 3TSBA 3SFKA 1KFCA 1QAPA 3S5ZA 2QCEA 4I7UA 1EX5A 1U83A 4JYEA 3NOEA 4AWTA 1EWEA 4PC8A 3EWBX 5L9FA 3EWZA 3LTYA 3STFA 1ZHAA 5G2HA 3L67A 3BG5A 2QJGA 4MIMA 4S2BA 3L65A 1QPQA 1TQXA 3GXNA 3FKRA 2OJPA 4A2SA 1DVJA 1O95A 5DCDA 3UPBA 3SZ8A 1K7FA 3TW6A 3C2RA 3QSRA 3LCWA 4UTWA 2J24A 2X2GA 1TPVA 3FA5A 2WSYA 4FNTA 1YDVA 4OGZA 5FEZA 1P1XA 3IGXA 4UCGA 3W70A 4EVZA 1AL7A 3N9SA 3LHYA 4C1LA 3NPUA 1J2WA 5FF2A 3W1TA 4A3UA 3Q37A 3OEXA 3PBWA 5F2GA 4TMCA 3CLMA 4JTKA 3W22A 1SFJA 3F03K 1KW1A 3QRHA 4M6VA 5I3IA 3S9YA 4O13A 1VGAA 3NZRA 4CNNA 2FPYA 2DZWA 1LLZA 4LVBA 2WSRA 5FF7A 2C19A 1KFLA 2Q3RA 4ML9A 3TU9A 3NZ1A 5EY5A 2CW6A 4HNUA 1SFLA 3QPYA 3EWWA 4FXSA 3DI0A 3W07A 1XDMA 1W0MA 2Q8ZA 4A22A 3C2FA 3GDMA 4DXVA 1YYAA 2V0TA 5LGXA 3W1NA 4CLMA 3PULA 1F73A 5BMWA 3STGA 1FQ0A 4RK8A 3W7IA 5D32A 2FTPA 1IXNA 4BF9A 3M5ZA 3QMSA 1FY6A 2Y62A 4AWUA 5C54A 3TSMA 3QPZA 4PCFA 5DY2A 1LORA 3OIXA 4MLJA 5FESA 2NX3A 2BXVA 3EB2A 1LRTA 1LLWA 4UTLA 3TFXA 4DPPA 2YPIA 4ADUA 3GX9A 1E51A 3W2MA 1TV7A 1FWTA 4N9DA 2I1OA 4HKPA 2E5BA 3Q2DA 2W6RA 4AEOA 4XBSA 3RMJA 3TE9A 1LBFA 2Y88A 1DOSA 3SSJA 2Z0IA 4X9SA 1YPFA 2C3ZA 3WJXA 1BWLA 4J9JA 4ZL1A 3C52A 1GVOA 3DKJA 2DORA 3G1HA 1QOQA 1H60A 2EPHA 1VCVA 3C2EA 3SIZA 1UB3A 1JVNA 3U8GA 1CI1A 4LS2A 4FB7A 1Z41A 4O16A 1TPUA 4O17A 2H8XA 3M0ZA 3O6DA 4FXRA 3CC1A 2V82A 4FX7A 1DQWA 4QQ3A 4LNYA 3BW3A 4MZ1A 1OYAA 3LRMA 3ZWSA 3MI2A 2VFDA 5MHBA 2YXGA 1H7NA 2YDAA 4MVAA 1Z48A 5LNWA 1OF6A 4TO8A 5U4NA 3NPXA 1H62A 3UD6A 3VE7A 1TSIA 3L0GA 4LT9A 2JKPA 1QMLA 4LY8A 3U6WA 4IMGA 3LI1A 2QCNA 4RR4A 1RQHA 4BFAA 2PRLA 4RXGA 2XN0A 4CQ8A 5LHFA 3NPWA 1UCWA 2VENA 3EKZA 3W83A 1VPXA 1GVQA 3TKFA 1RV8A 3EX6A 4GJ1A 4RZ6A 1P0NA 1HUVA 4QM1A 5T26A 4QSHA 1H7WA 3W84A 1IXOA 1RR2A 1L6SA 3Q94A 5BOOA 3PWAA 2OX1A 2NV1A 3ABQA 4ZVJA 7TIMA 1EEPA 4Q33A 5G2IA 3GDRA 2Y61A 4HSOA 3RNDA 5I3FA 1VJIA 1LOSA 1QNVA 5F2IA 2CLHA 2A5HA 3N73A 1R47A 1H7PA 1KLZA 4QNEA 4DEFA 2YX0A 3WJZA 3PSWA 3GVGA 1W3TA 2ZDRA 2FLIA 4ZQNA 1KV5A 3LRLA 1FWNA 3P5ZA 1NVMA 3KRZA 1MO0A 1SR9A 1TMHA 3IGSA 4ICNA 5D2VA 2ZYFA 4MY1A 4XBKA 3GR7A 3LCGA 3F1QA 3QFEA 2NV2A 1W5MA 1B3OA 4GFSA 5DXXA 3NPVA 4M7TA 1KM5A 3DFSA 4JY9A 1EWDA 4N6FA 1F6KA 3NM1A 4N02A 4YXGA 2NX1A 1QCWA 1ZY9A 3W1MA 1IIGA 4IQLA 5G4WA 4UFJA 4XUGA 2I9EA 4MY9A 3GXTA 3TAKA 4WX2A 3GDTA 4AHOA 4GWEA 2WNZA 1OJXA 2QAPA 2FFCA 3IIZA 5FF0A 1OVDA 1R46A 3L0NA 4ZQRA 2FPVA 3UZ5A 2J9XA 4KFOA 4LTSA 4Z1BA 3LV6A 3PG9A 3BGGA 3JRKA 2A1YA 2YW3A 4JTTA 3ZWTA 2WSQA 1QWGA 4NUWA 4WXZA 1XUUA 3LGEA 3WK0A 5G5IA 4UTMA 2OT1A 3A5VA 3NNTA 1PCWA 1G4TA 1PL9A 3MO7A 3G3DA 2FJKA 3NGJA 1D3GA 2G95A 1WYIA 4O54A 5TIMA 3KRSA 1KTCA 3FS2A 3PVFA 3GNNA 2V2CA 3GAKA 1UJPA 1GPWA 4JY8A 2RHGA 1WXJA 1R2SA 2Z6JA 1F76A 5HUOA 2C0AA 4RKAA 4FNRA 2V2DA 3VI2A 1FUYA 4JICA 4PL1A 4QAIA 4MY8A 1TPC1 2PURA 1Q6LA 3G1VA 2ABBA 5AB3A 2QJHA 1W3NA 4M7SA 3S0CA 1S5VA 4W9TA 3KFTA 4UFLA 4B5NA 3B0PA 4O4VA 2X1RA 1JRCA 4YMZA 1JCLA 1OHLA 1TV5A 1A5BA 3QZEA 2YR1A 4CCEA 5E0KA 4M6PA 5D03A 3KHJA 5KINA 1T96A 1CX9A 3G8EA 4RJEA 1ZALA 1X1OA 2R94A 4OBTA 4UTHA 2VEIA 2BLEA 4IMFA 5CSRA 1ML1A 3UWYA 4UIOA 2ZA2A 1XBVA 3A9IA 3LRKA 4LV4A 2R91A 4MZ8A 1XM3A 1RD5A 5BNKA 3NQMA 4GUGA 3DZ1A 1TTIA 1FCBA 4O0ZA 3GR8A 3W1PA 1EUAA 1M6JA 1TPH1 5K9CA 3LI0A 1XFBA 3NXFA 3JR2A 1P5BA 3GLCA 3HOJA 1K03A 3TXZA 1S3HA 4MYAA 2NUXA 3CT7A 1K8XA 4KFPA 4JTJA 1RQBA 5HQEA 3RFAA 2HSAA 5HJLA 3CIXA 1KM1A 1W5QA 3UWVA 3O6CA 3AJXA 4KFNA 1Q45A 3MYPA 2NXIA 1PHQA 3RF9A 1O4UA 3HB9A 3NM3A 3M5XA 5CZTA 4ADTA 2DZPA 3N2XA 1OFBA 2WO5A 3HMJG 2FPTA 3MI3A 1JRBA 4UTWC 4DPQA 1FDYA 5AHNA 5CG7A 1Z42A 3LCFA 3EX4A 3E9AA 2JK2A 4PL2A 1OFQA 3KVLA 3TR2A 3UY8A 3HF3A 5HWNA 1G7VA 3O6YX 1TPDA 2NUWA 2O7SA 3QSTA 3BO9A 5AYYA 2ZZ6A 1XC4A 4QIUA 4ZQMA 1KFBA 1I2RA 3M16A 2A21A 2H8ZA 4R34A 2CU0A 3R8RA 3BGJA 1H7XA 1OK4A 1SSDA 1O60A 2ZA3A 1TB3A 4ZZ9A 3S6DA 4MKNA 3BLEA 1EUNA 3W7GA 2VFEA 2RDUA 4O1CA 3TV8A 3NQEA 4IPJA 4ZQPA 4O1BA 2CZDA 1SU5A 1QPRA 1QDSA 1DKWA 4NQ1A 5FEXA 1XBXA 3IVSA 4O14A 1IIHA 3MYOA 3PF3A 2Z6IA 2Y7EA 4UXDA 5C6MA 3NL5A 3EWXA 3OVQA 2QCFA 3I7RA 3WK2A 2P0OA 3O1NA 2TPSA 1OFOA 3GDKA 1FWSA 1KM2A 4FO4A 2V9DA 1EA0A 3L5LA 1GT8A 3ANYA 1IXQA 5BMXA 2EAWA 1SO5A 4PEKA 1TTQA 5EL1A 5KZDA 3S5OA 2QAFA 5LNUA 5LNSA 1OFRA 1KM3A 1FXQA 4JD4A 3ATYA 3OVPA 2V8ZA 3H54A 1OF8A 2DJXA 3HQ1A 3W7RA 5HR7A 2F84A 3NO5A 1T0OA 3G1FA 1VR6A 1HFBA 4JGDA 1A5SA 5FF4A 1KM4A 4NJJA 1IXPA 4EF9A 3UWQA 3HGSA 1GG0A 2XN2A 4OE7A 3VE9A 3TDFA 2QCHA 2RFGA 4GNJA 4POCA 4NXSA 3CIWA 4GRSA 1HL2A 2C14A 4HIBA 2Y89A 5CZ0A 1H1ZA 1D3HA 4AHPA 2C13A 4H6KA 4FF7A 4Z0SA 3GXPA 4WQ6A 3UPWA 2JBMA 2LLEA 3PY2A 4UTTA 4Y90A 5FEPA 1MZHA 4DBDA 4NX5A 4X22A 2QCLA 1GZGA 3P61A 3G8RA 4JYFA 4K38A 4UTKA 2PRHA 3N9RA 4IMDA 1B9BA 2NXGA 3TCEA 2ZZ1A 3LM7A 4JIPA 4LVDA 2BTMA 4GC4A 3WJSA 4AAJA 3UY7A 4IGHA 5F2MA 1CW2A 1JUEA 3TC7A 4I9AA 4I7WA 2A2IA 3BG9A 3W88A 3B0UX 1OFDA 3L9CA 1KV8A 4L4MA 2WNQA 1MXSA 4LS1A 3THQA 1J4EA 2Q3OA 2AQWA 3ABRA 1X1ZA 4IXXA 4M5PA 3UWZA 1Y0EA 3PB2A 2CLFA 4JTUA 4XQ6A 5I3JA 2WNNA 3L5MA 2PCQA 2ZA1A 5HMSA 4AVFA 5CZJA 2YFOA 1EPXA 1KBJA 3CB8A 3NQ6A 2C18A 2VXNA 4UFIA 3GZ3A 4O1DA 1WDWA 2ZRUA 3O8AA 4A21A 1RZMA 2FIQA 3U2OA 1H7RA 5E1QA 1T99A 5I3KA 4Y6GA 5CPOA 2VFIA 1YADA 2YW4A 3ATZA 1VC4A 3NQFA 3TC6A 3KXQA 3INPA 3NQDA 3W1AA 5BRBA 2NWRA 3C3NA 3CPRA 1N8FA 4X3ZA 2JKAA 1FCVA 1L9WA 4RCXA 4HT3A 1XI3A 1L6YA 1SZEA 4Q32A 1LOQA 4ADSA 3PUOA 3BK0A 3UXAA 2HS8A 4IX0A 3NYZA 2QDGA 3A22A 1RPXA 2QUUA 4AHQA 1H1YA 1JUBA 1YXYA 3O06A 3T4CA 1GYNA 4LU0A 3HPXA 4DF1A 3DBPA 1ME9A 4AF0B 3R2GA 3NQ7A 5K9XA 4YCPA 1JULA 1GTEA 3I7SA 1SZNA 1YPIA 2PC4A 1KBIA 3UWUA 4LS0A 1G67A 3MHFA 1I2QA 2E5CA 3L21A 3LXBA 1PS9A 2H3DA 3OA3A 4KKXA 2Y7GA 5SWUA 1PCKA 5D02A 1ALDA 3W87A 4AF0A 1OFAA 2E1DA 2KZHA 1WV2A 3P82A 4HHPA 3M6YA 1DHPA 3LXCA 2P10A 2R14A 3BVJA 3DU0A 1THFD 1AG1O 3EX3A 3P81A 2Y85A 4E2DA 4IOTA 3BLIA 3G0UA 3P7YA 2JGYA 3LBCA 2QJIA 3S1UA 3W7PA 3W7CA 3O16A 3W2JA 2WJZA 3M43A 3FYOA 1L6WA 2CWNA 3F4WA 4IMEA 5K4ZA 5HWJA 3N2MA 3JS3A 3SI9A 2IQTA 1OX4B 4Y9AA 2TSYA 2J27A 2C15A 2NXHA 2CLMA 2V2HA 4JNMA 5HNRA 4UMBA 4BI6A 2VC6A 3M9YA 4K8HA 4JTHA 5EPDA 3GAYA 2BX7A 1NEYA 1W56A 3NR0A 1LBMA 1SO6A 1DV7A 3DFOA 1G4PA 5CKSA 4ORMA 2YFNA 3M7WA 2G97A 2H6RA 3CU2A 2CLIA 3L66A 1L2UA 1DJNA 4BWLA 5D09A 1FWRA 5KZMA 1VYRA 5DLCA 5GVJA 4K6AA 2V81A 1LROA 2GVLA 5G1YA 3FJLA 3SJ3A 4JDYA 2D73A 5IM51 1X8FA 4UR8A 4DO5A 1ZFJA 4JX6A 1LP6A 3SW6A 5L6UA 1YDOA 3QW4B 1B4KA 2Z2UA 1YDNA 4FHAA 4MFEA 2QEZA 4OV4A 4ZQOA 2ZZ3A 4K37A 1XKYA 4TR9A 3RU6A 3IIOA 3EWUA 1C9DA 5LGZA 4FX8A 3TX9A 1OX6A 1KM0A 2J9ZA 5HULA 2FB2A 4XKYB 4NJKA 3TQVA 2E5DA 4GE8A 4GXMA 3HG3A 5AC8A 5F2LA 3GYEA 5HINA 4HNNA 3MMTA 4OWGA 3W7HA 4Q4KA 4P61A 1H50A 1IF2A 3I68A 4GUFA 2FDSA 3BG3A 2DJLA 3TH6A 4XKYA 3SR7A 4BI5A 5KTLA 3TW7A 3L0KA 3DKLA 1SW3A 5AHIA 2A7PA 2QCGA 2VELA 1GVSA 3CWNA 2ZRZA 4O10A 4TU1A 3IVTA 2QUTA 3W2UA 2ISVA 1H51A 1WBHA 1WBJA 3O05A 4XWUA 5LKYA 3PUDA 3UYCA 3LTPA 5DBTA 1OABA 3LHZA 5LHEA 3TQKA 3GIYA 1DJQA 3NQCA 2E6AA 4HSNA 1EIXA 4FNUA 3W7KA 1QFEA 4MPQA 2QKFA 4UC5A 2ISWA 3B8DA 2OCZA 6ALDA 3W1RA 2ZRYA 3N3MA 3CEUA 3W1QA 4RLIA 2ZTKA 1TJPA 3DENA 4NVTA 4NNAA 4S1FA 1F2JA 4LRSA 1JQVA 1W1ZA 3P62A 2GJLA 5K7JA 4E2BA 3TIMA 2BWGA 1G7UA 2QCDB 3R12A 3W2KA 3W2LA 1KLYA 1MEHA 2QR6A 4DO4A 3P5YA 1ADOA 3M41A 5LNRA 3T7VA 2CFFA 1D9EA 1PHWA 3CM4A 5KMYA 3P74A 1VHCA 2E68A 2GUUA 2C6QA 4WY0F 3Q58A 3TAOA 3W23A 4G1KA 1ICSA 2RDWA 5G4EA 5HUPA 2JGQA 3QMRA 3I65A 3MP4A 1OFEA 4XTIA 2VKZG 1I2NA 2A4AA 1WOAA 5D2WA 5CSSA 4LVAA 3NAVA 2OMAA 1JUKA 1I45A 4K8EA 5BW6A 1FDJA 2Y7DA 3P8JA 4UTTC 3B0VC 1B4EA 3RLUA 3DFNA 5D2YA
chains in the Genus database with same CATH superfamily
1F3XA 1TTPA 1UC4A 1TA3A 4M8UA 2QF7A 3H24A 4J27A 2OGJA 4CNUA 2CXGA 3P8IA 4NAFB 1OG0A 1GJPA 5CCZA 1MXGA 3GUWA 4YL2A 1PX4A 1A3XA 3BJFA 4O8RA 4MWAA 3EX2A 2A3LA 3OBEA 1WKDA 3S5NA 3QJAA 3SGUA 2R1LA 1EP2A 2AL2B 4AQLA 2GQ8A 4WUIA 2RDTA 3IRDA 3QHOA 4IJBA 1FBAA 2V67A 3S8HA 1NP2A 1WB0A 3PSVA 3WELA 2B4GA 4Z17A 4NRRA 2Z27A 1FKXA 3EA1A 3IUHA 4WJXA 4JN6A 4PFMA 1Q85A 1SQ7A 4DJDA 1TMQA 1ICQA 3N2CA 3BOXA 5D38A 4Q8QA 3L2IA 4AZ6A 4IUGA 4N2YA 4FLOA 3NQ2A 4A2RA 4H8HA 5C9XA 3PZ9A 4K36A 3L68A 2WZIA 3MU7A 3V36A 3BPWA 5DANA 2DZVA 3PPHA 2YCKX 3AS2A 1W5OA 3G1YA 2NQHA 1ICPA 1XJBA 2CZFA 2ZFAA 1Q3NA 3T1GA 2J7FA 1I8JA 5A6TC 4C6FA 1F05A 1FWJC 1GVYA 2YYTA 1Q6QA 4MUZA 5DELA 1I6NA 1XLJA 1JPIA 1WAUA 3N13A 4QLLA 3VIHA 2FZNA 2CLLA 3G0XA 2GK1B 3AXMA 3W28A 3I7QA 2XSAA 5K2ZA 1EHNA 3O63A 3KOZA 1A53A 3JUGA 4KEMA 4HCDA 2VCAA 5CPTA 2X1SA 3B8UA 2VFFA 3WK1A 4RPQA 1JPKA 4ATLA 1PBGA 2RDXA 1LM1A 4TTGA 2OFJA 1PDYA 3VNJA 2B7QA 1QO5A 4B9ZA 1TUXA 3MKVA 5G4HC 5H91A 5BXRA 1NWUA 3PWIA 1UWQA 1I2OA 4MJMA 3DGRA 3W6YA 2EPOA 1GUVA 1V7YA 4DZ5A 1OYBA 4ZMGA 3H21A 1ZP4A 1JZ7A 1HP5A 4NX0A 4HGXA 1BRLA 4ICMA 4WDWA 1DPMA 5A8GA 3VIPA 1Z3NA 4HPNA 4IZGA 2OELA 3ZVHB 2NZLA 4AUBA 3TROA 3UWEA 4BWLC 4HCHA 3PBVA 1YXDA 1U5VA 3T55A 3GQYA 3WMSA 1SO4A 1B5TA 3MP5A 4QS6A 4EAYA 4B5UA 3WFLA 3DHPA 1EO5A 3MUY1 3G1AA 4JHOA 2CZ5A 4B15A 2X0SA 3U7BA 3NWRA 4OTKA 4F48A 1E6PA 1MSSA 4CD4A 3STEA 4LUYA 5F4SA 2GQAA 2F8QA 4HK6A 3VNDA 2J47A 1LWHA 5J5DA 1BXCA 3A6OA 1XL9A 2QPSA 2B7PA 3P0XA 3U2CA 3A4XA 2PDHA 4S2CA 5HK4A 1YNPA 1US2A 1T40A 4AB4A 4Y8FA 2GUBA 1X98A 2WPBA 2EKCA 2OWXA 4FOJA 1TYGA 3WH8A 4MJ2A 4WOQA 3NQ8A 4XTDA 3V0SA 2J79A 4IQEA 3K13A 1VD6A 1W3IA 3IGUA 2E1WA 2J7DA 5EBUA 1AW2A 3VGHA 4OV9A 1JF5A 3RHGA 3DC0A 1FWIC 2OYKA 3LXAA 2WQPA 4I90A 3KCLA 1CLKA 4C1KA 3LB0A 1FHUA 5FI8A 2VEPA 2BGNE 4MDOA 4OBRA 3CEPA 1XLHA 3AS0A 4Z0JA 2YXXA 4Q8VA 4TXEA 1A3HA 4JTGA 5E9XA 3B05A 5A94A 1DBTA 4YVVA 1FWEC 4C6DA 3KOYA 2JF7A 1XD1A 3LENA 5FEWA 3NSMA 4UTIA 2WQDA 3VOHA 1Y8BA 2VVNA 1LQAA 3N29A 1EC9A 3AICA 1NFPA 3TFCA 3OZPA 2BZNA 2PDIA 3DH7A 3WD0A 3M5YA 1R3TA 1HQTA 1VP5A 3TYDA 3SGZA 1PXGA 3CQ0A 2FQIA 2QJNA 4LEQA 3ITYA 1O7AA 3CO4A 5CGQA 3RJXA 2YGYA 3AALA 3LLDA 4HVXA 3LPFA 1WDDA 3MUCA 2E9LA 1KFKA 2ZWZA 4ZBCA 2XYLA 1BF6A 2R1NA 5H6HA 3A4AA 1E6NA 1RP8A 3ZLFA 3V7PA 2VDHA 3FAWA 1RAKA 4DWSD 3W71A 2Y70A 2FHBA 3VCRA 1J0HA 1BTMA 4WF7A 3ARVA 4D8LA 1HNYA 1E3XA 4Q8NA 2VWTA 5DN1A 3RLVA 2PODA 2D2OA 3QN3A 2A7RA 4X61A 4IQJA 2CZVA 4C6NA 1XLAA 2IXVA 5CPLA 1W5NA 1PDZA 3KTSA 2GVGA 1PVNA 1VCGA 1YTEA 4H7ZA 3QYQA 2PBOA 4NAEA 1W8GA 2PZNA 4HCLA 3GK0A 3R89A 2D0FA 3F4NA 3T78A 3S1XA 3FNDA 2ZUTA 3WDJA 2ZZ5A 4QG9A 3VC5A 4AH7A 5F4XA 4IFRA 3OO2A 3ZIZA 3GFYA 1KCXA 1KRCC 1SMDA 5EYWA 3RGTA 3ZXWA 4I7VA 1R9XA 1W5PA 1UUMA 2X09A 5E9AA 3EBVA 1XLKA 4YWIA 2X1UA 1NTHA 1BD0A 2BOFX 4AD4A 4QROA 2JEQA 2BY1A 4DBEA 1NSJA 1YTKA 2CBUA 2ESCA 4MB3A 2CLEA 3GD6A 1C9WA 2X2YA 2UZ9A 3EOUA 4A4AA 1F6PA 3GH7A 4CU7A 3NQGA 1HKMA 3TJLA 4PGLA 4H9UA 5E0CA 1SJAA 3AO0A 2NUYA 2OODA 5AC6A 2WZEA 1DXFA 1R2TA 1YLVA 4LAUA 2O92A 3MT1A 4M6QA 5DXYA 4XZNX 3OQ8A 2DUXA 3F4CA 2W91A 1Q5MA 2AAAA 3EOLA 2IMRA 2DT1A 4KWWA 4F66A 4RE2A 1HX0A 1AMKA 5EFDA 3TQ0A 2QCDA 3WF3A 4C6QA 3T2QA 3HGOA 2CZEA 5D04C 2OPJA 3B8WA 3FW6A 2CNCA 4F2UA 1RJQA 3MUZ1 3EKLA 4OKDA 4C6BA 4HPHA 4R7JA 3BLFA 2EEXA 1JNEA 1OYCA 1NARA 1S2CA 4PCTA 3P60A 4Q6XA 1EZ2A 1UP3A 1XLGA 3LBMA 4JNZA 2O0TA 1C3FA 3C0SA 1JQXA 4L4LA 4QEEA 2QT3A 3TTQA 2VOTA 1K8ZA 2DFAA 5DO8A 4PUWA 2B7OA 2OGYA 1A5UA 1XC6A 3WQVA 5ABHA 1WZAA 4O50A 3W26A 3VKKA 5C5YA 4HOZA 1RXOB 3TC3A 3R94A 5GQBA 1TWWA 2BOGX 4E8CA 5TAOA 3KVKA 4CD6A 1NAL1 1WQ5A 4FIQA 3EEGA 3RO8A 5A6BD 2J13A 5A3HA 3OLIA 4A29A 5CPNA 3RK8A 3G1SA 1NOWA 3QTGA 3EB3A 3KL0A 1VEOA 3GKFA 3VUSA 5F7UA 1FCUA 1PIIA 5LZLA 1A4LA 1UKPA 2I5GA 4HN4A 3NDOA 1N55A 4AZCA 3GM8A 3LTSA 4NJHA 4E2OA 3MWCA 3W86A 1TPEA 1XSJA 1WKEA 4MZYA 3QYSA 4RE4A 2G96A 1X7IA 2PWFA 3L5AA 3SCSA 4UNLA 3XINA 1P0EA 3IK4A 1H61A 1JZ3A 4NJIA 1VYSX 1RCQA 1XINA 4LJ3A 4QJ1A 1NJJA 2OG9A 2A85A 3TYCA 3WDQA 2VM8A 5XIAA 2D3LA 4I5XA 4W84A 4XZBA 3NA8A 1Y65A 3EWDA 1PIGA 2R8WA 5AFDA 1A5LC 4H8VA 1ZENA 3W7DA 1QHZA 1G4EA 4IXHA 1QW8A 3IIVA 3I3DA 1R3QA 5DCEA 1C8YA 4Q8MA 3QR1A 2ZZ7A 3WJYA 2CKSA 3NEVA 3O07A 3R6IA 1UW9A 4WY0B 1IGSA 1RJPA 1M68A 1FX6A 2GOUA 4JDBA 2EPLX 3PFMA 1OCQA 4NU7A 3FXGA 3ABOA 1JR1A 4IF2A 3MJMA 3HBLA 4R9OA 1R6WA 4Z42C 5AC5A 2ZCGA 3W2NA 2G50A 3VUPA 4H3DA 1PX8A 2QVHA 4IG2A 3CTLA 3G22A 4HNCA 1GWJA 2WW5A 2ZUNA 3RITA 1CGWA 3A23A 3ZS4A 2A6LA 4LB4A 3VGDA 3J7HA 1KBBA 2Y63A 5I77A 2BGSA 1BF2A 3LY0A 2ATMA 1GORA 2XN1A 1B57A 3UXDA 3P67A 3KL3A 2P3ZA 3TTOA 4JNYA 1E72M 1XHGA 2E25A 1E0VA 4WDTA 2BSLA 2MNRA 1BVNP 2EF9A 2HZGA 3NQAA 4MMWA 3LHVA 2BVTA 2E09A 1K7XA 3SFKA 2G8ZA 4GABA 5C9UA 1KFCA 4I7UA 1EX5A 3ITTA 3RM4A 3FXYA 3NOEA 4AWTA 3LTYA 1ZHAA 5G2HA 1E70M 5HBFA 3KUMA 1MQPA 4MIMA 1DYSA 5AC4A 4YIWA 2AQVA 1TQXA 1EDGA 2OJPA 3RO6A 3ZZ1A 1AQHA 3DHUA 3SZ8A 3U9IA 4ZEPA 1K7FA 3TW6A 1UHVA 5I23A 4UOZA 3C2RA 4BA0A 1TPVA 3NO3A 2WSYA 4FNTA 2CC0A 1YDVA 1FWGC 3AYVA 4OGZA 2JIEA 2CHRA 3VMOA 3IGXA 5I3DA 5I5RA 4C1LA 3N9SA 3LHYA 3CHEA 1J2WA 3W1TA 4A3UA 2F6KA 3Q37A 1KWKA 3PBWA 5F2GA 3SCRA 4CKQA 2VURA 3LU2A 5I3IA 4M6VA 3S9YA 1G9HA 4GNVA 1M41A 1GOOA 2FPYA 4LVBA 2AKMA 5FF7A 1V0MA 2Q3RA 4DWSC 3NZ1A 4QG8A 1SFLA 1UZDA 3PFRA 4FXSA 4X2PA 1Y5XA 3B0YA 3GTNA 1PWLA 4RW3A 3R8GA 3TA9A 1UWSA 2PC8A 4UQAA 3KHDA 2VQUA 3STGA 1UR2A 1SVDA 3W7IA 1IXNA 4BF9A 3QMSA 1XQLA 4Y8EA 1LWIA 2A3HA 5E70A 3AIWA 4PCFA 5DY2A 1Q8JA 3QV9A 4A35A 4V27A 5FESA 2NX3A 2BXVA 3PP7A 1LRTA 3ICJA 3CMGA 1Q6FA 4DBWA 3Q2DA 1TFVA 2PDNA 1LF1A 1ZL1A 4XBSA 1I75A 3CZLA 1LT8A 1DOSA 1AODA 2Z0IA 1HF6A 3H2CA 4X9SA 3VIFA 3GC2A 4I5UA 8RUCA 1QJWA 1BWLA 4J9JA 6TAAA 5J8LA 1KXTA 3EDEA 2XZ9A 1QOQA 1H60A 3C2EA 3U8GA 1EGVA 4LS2A 3NUKA 1XPGA 1TPUA 1GOKA 2H8XA 4WLCA 4C65A 3M0ZA 3O6DA 4FXRA 5D9PA 4PRRA 2UY4A 3LRMA 2YXGA 1H7NA 4IH3A 2FH6A 5LNWA 3WY1A 4TO8A 5JXQA 1TV3A 3VE7A 3VKCA 3RILA 2XM1A 3MY9A 3L0GA 3UXKA 2JKPA 4IGSA 3WIJA 3H26A 1CT5A 1T8QA 3LI1A 3E2RA 3V18A 4C1NA 1LUCB 3AIQA 4I3GA 5LA0A 2XM2A 1CBGA 3NPWA 3WUFA 4CNTA 3C0LA 3VNYA 4RZ6A 5T26A 4QSHA 2PFHA 1H7WA 2V38A 5CC7A 3Q94A 1TVLA 2OX1A 5LA1A 3IAQA 2PWUA 4ZVJA 4LNCA 1KXQA 1AZ1A 3RNDA 1OQFA 2DEPA 1VJIA 3LMZA 3AHVA 3GH5A 4XZIA 1KLZA 5HMDA 2HVMA 4PBGA 3NQBA 5BROA 2HWGA 2YX0A 3PSWA 3L4TA 4DZHA 4O1FA 1QI5A 1W3TA 3GTHA 2FLIA 4ZQNA 4JEJA 5EMKA 3SEPA 3FAXA 2XJ7A 2HVOA 4PZVA 1W5MA 5E5CA 3NPVA 3KS5A 1KM5A 2V5KA 4JY9A 4N6FA 4YXGA 3NM1A 4N02A 4HNLA 3VCNA 2NX1A 1ZY9A 1IIGA 4IQLA 2I9EA 3GXTA 4LUTB 3TAKA 1RJRA 1W9BM 2JIWA 4AHOA 2FZ8A 2WNZA 1OJXA 2G3FA 4DWSA 3MCOA 5FF0A 1OVDA 1OCNA 4C6PA 4Z1BA 3BGGA 2DY3A 3JRKA 2YW3A 1KKRA 2WSQA 1QWGA 1JYVA 4WXZA 1IGWA 4H00A 2Z1KA 4TX6A 3EDKA 5G5IA 2OT1A 3GC5A 4INFA 1E15A 1R87A 1PL9A 4F40A 3NGJA 5AVHA 1WYIA 3KRSA 1R0MA 2J7CA 1JXKA 2XGBA 2V2CA 7TAAA 2G37A 3AHTA 2OLAA 1PTDA 1R2SA 2Z6JA 1F76A 5HUOA 2V2DA 3N11A 2HXTA 4MY8A 1TJ0A 4P7NA 5AZ1A 2ABBA 3RPTA 1UPPA 6REQA 1IT7A 5AB3A 3W6MA 4W9TA 4C60A 4B5NA 3K8KA 4YU1A 3AAMA 4GZEA 4O4VA 2VD9A 2EPNA 1JRCA 3CK5A 4Q4OA 1MYRA 3CL6A 3FGCB 1TV5A 1UKOA 4JIHA 5E0KA 1E1EA 2HXUA 3KHJA 3W24A 1CX9A 3G8EA 2XSXA 2R94A 4ZA0A 4B90A 2VQTA 4JQAA 2PDFA 3IJ7A 1ML1A 1GQKA 1HIZA 2QQ6A 3IWPA 3UWYA 1QHPA 2EG6A 4LV4A 3CV7A 1FWFC 1XM3A 5BNKA 1JZ6A 2DUAA 3WD2A 4XD5A 3GR8A 3W1PA 3WD3A 1TPH1 1XFBA 3JR2A 2VI0A 1K03A 2F9RA 3TXZA 5IHSA 4KT2A 1X6NA 3CT7A 1W6TA 1CB7B 1K8XA 1P48A 3GTIA 2YB4A 5I7GA 3RFAA 2HSAA 4M82A 2Z1SA 1U5HA 3ME3A 3O6CA 3V4BA 4FLRA 4H9TA 1PHQA 1CYGA 1O4UA 4FALA 3HB9A 3M5XA 5CZTA 5GJMA 4TUFA 1W9UA 1YDYA 1MUCA 3N2XA 1Y5VA 4UTWC 2G4JA 4F3HA 3LCFA 2VC7A 4TTUA 3E9AA 7A3HA 2JK2A 4P8UA 4PL2A 3WNLA 3AIRA 3KVLA 3TR2A 8XIAA 1G7VA 2O7SA 1UR4A 3BO9A 3QZAA 2ZZ6A 4M0XA 3KM8A 1XC4A 2W62A 4GI4A 1NU5A 4R7OA 3CQJA 1R5YA 1NELA 4FPSA 5DMNA 2DH3A 3MSDA 1EJRC 3LQLA 4REQB 1J0YA 3FEQA 4Q6JA 2WHJA 1V3KA 5D8ZA 2QIWA 4HA1A 3AS3A 4CEXC 2VFEA 2RDUA 1XW8A 3TV8A 2P53A 3DFHA 4ZQPA 5JQ9A 2F6UA 4CQBA 3URQA 5A6BA 2YOCA 1QDSA 1KO0A 2HK1A 3QY7A 3AYSA 3WZ0E 4L4OA 1IIHA 3MYOA 1JI1A 3MVTA 3OVQA 4D1IA 3AU2A 2QCFA 3I7RA 3E2QA 4KCUA 5HAOA 4LAOA 1CEOA 3B4YA 1KM2A 2BB0A 2XDFA 3MB9A 4DIAA 4L9ZA 4CNSA 4DWDA 4CQCA 1EA0A 1O68A 4KGJA 1OT2A 1K8CA 4PEKA 2ACRA 3LMYA 5AVNA 2DVUA 4PCSA 3ZYZA 1M65A 1HVQA 5ABEA 4ZB0A 4CD7A 2F84A 3NO5A 4DJED 3G1FA 1FTXA 4QR6A 4NJJA 2YIHA 1TCMA 1U1HA 3QOMA 4XK2A 4C6CA 2W27A 4AZIA 3P0WA 4EP8C 4GNJA 3M64A 4GRSA 1HL2A 2NVAA 4H6QA 4GJJA 5CZ0A 1E0WA 1CPUA 3DIPA 4R27A 4FF7A 4JN7A 4S3GA 4Z0SA 3GXPA 3ITVA 4WQ6A 3PAOA 3UPWA 5CG0A 3N15A 1MVYA 1VIWA 3PY2A 1F6YA 4NX5A 3EDFA 1GZGA 5CGMA 1M3UA 1PZ3A 4L9YA 3CASA 4JYFA 4K38A 3D46A 4G2DA 3S9IA 2PRHA 4R88A 4IMDA 3NIYA 1B9BA 1FHDA 2A3AA 2RJHA 4GCXA 4AAJA 4IGHA 1E5NA 5F2MA 1CW2A 3TC7A 4GX9A 4I7WA 5C71A 3F5JA 4S3CA 1OFDA 3L9CA 2GL5A 3M0YA 4MG4A 1RK5A 2WNQA 3LD5A 4M1RA 1MMFA 2VZVA 2Q3OA 1E43A 2CESA 2ADAA 1Y0EA 1JIBA 4LALA 4XQ6A 1A80A 2WNNA 3L5MA 2NVDA 1AH3A 1EPXA 1O1ZA 5I02A 3LG3A 4TVCA 4Q4MA 1E9ZB 3CAKA 3MQTA 3UXIA 1PKLA 4D6FA 2BGQA 3O2LA 1PKYA 3NTYA 3OLDA 1ZPTA 4HJFA 1KC7A 1DTUA 2FDMA 1B30A 4XAPA 2WVVB 5LIUX 4RCXA 4Q32A 2WMKA 4DUXA 3BK0A 3UXAA 1R85A 5JIPA 3A22A 3AMLA 4AHQA 4N0RA 3N4AA 3T4CA 4ACZB 4WSHA 4LU0A 4M81A 4WKAA 1ME9A 3W38A 2VX6A 3ARWA 3B8SA 1JULA 3I7SA 2CLPA 4C6EA 3MHFA 2E5CA 1G1YA 3LXBA 1E55A 4H7VA 1EBGA 4XIAA 1PCKA 5SWUA 3W87A 3HTWA 1OFAA 2E1DA 3URNA 3LXCA 3BVJA 3DU0A 4JZ5A 3APGA 3HQPA 3BLKA 1GCYA 3MZ2A 5G1MA 1FWCC 4E2DA 3HA1A 3QV7A 4FAMA 2WMJA 2WBKA 3O16A 1VPYA 2WJZA 3ENLA 3FYOA 1Q65A 1VBGA 1XYMA 1F3WA 3JS3A 3ZMRA 2ZOXA 1QU4A 2PP3A 1MNSA 4RV3A 3N25A 2C15A 3DOPA 5GJPA 2VC6A 4CGTA 4J40A 5ECUA 5DX7A 1NEYA 3NR0A 3N3TA 4US5D 4A6GA 4ORMA 3M7WA 3TVAA 4DRSA 2ZUUA 2C1IA 4LSBA 5KZMA 4V2XA 2GJXB 3FJLA 4E6MA 4DNMA 4JDYA 2PP0A 6XIMA 4UR8A 4NYUA 1BHGA 1YDOA 1B4KA 4E3TA 1YDNA 4KMQA 4ZQOA 1W9PA 2NQJA 3HPAA 4JCLA 3GXFA 1BYAA 4RL3A 4TR9A 4FX8A 2PDLA 3RX3A 1TE1A 4GZIA 4XKYB 2YL6A 4JIEA 4JFSA 3WQWA 3MMTA 4OWGA 3B8VA 1LG1A 4NG3A 1DWGM 4GH1A 4GUFA 3OYZA 3CQIA 2FDSA 4H9MA 3BG3A 1LL4A 4XUYA 4WDXA 1LLOA 3PNZA 1R86A 1V0NA 4BI5A 3STPA 2BG5A 5IHRA 1SW3A 4GHRA 4MHBA 2NV9A 4EXBA 1B54A 2QCGA 1GVSA 2QZRA 2ZRZA 2WJEA 3IVTA 1XYBA 1L8PA 3E0WA 3W2UA 3VKDA 4QQUA 4X0VA 1WBJA 5CC6A 1Q7ZA 3O05A 1XIBA 5A1AA 2Z25A 5FL0A 3UYCA 3LTPA 3HV9A 5D8WA 5DBTA 1U1JA 3M0JA 2D1ZA 3LHZA 5A2CA 3C0QA 4ACYA 1EIXA 2ISWA 1RHCA 5TNVA 3B8DA 3THCA 6ALDA 4GXPA 2ZRYA 3CEUA 3DENA 2VRQA 4NVTA 2QUMA 1DIEA 2GSEA 3GR4A 5M1TA 2QNEA 4JFVA 1KLYA 1XFCA 3VX1A 4NP7A 3I4KA 4D9PA 3M41A 3BGAA 5LNRA 1V3IA 2PDPA 3P74A 1VHCA 4BY3A 4D8ZA 4KGLA 3R0DA 3Q58A 1MI3A 4DJFD 2R1PA 1XIGA 3I4EA 1EOKA 2RDWA 5HUPA 1E1CB 2JGQA 4CVUA 1QOXA 1OC5A 1H5VA 1P6CA 4LUSA 3MV01 1IZJA 1TA3B 4WSJA 1UR1A 3KWXA 3BAJA 3UFYA 2WB5A 2FTYA 5CSSA 4QHRA 2OX4A 4F9DA 1R9YA 2ON3A 2J77A 2VC9A 2RJGA 1AQMA 5EB8A 2Y7DA 3NOYA 2ACSA 2XSBA 4ZENA 5D2YA 1Z44A 1ONXA 2PWDA 5E93A 3WDPP 1LDCA 2R1MA 3RG6A 5CBIA 4UNKA 2BFGA 5IBXA 4LOCA 1AQ0A 3W1XA 1S2VA 1UZHA 4UMCA 4DJEC 4WIWA 3WK3A 4C6JA 3EXSA 2VCCA 1IR2A 3DCPA 3W53A 3C2YA 3SIMA 4QISA 3ARYA 3GZAA 2ZUVA 4PMJA 2V3EA 2YCLA 3KOXA 3WL0A 2VP8A 1K8YA 2X30A 3LCXA 2VRKA 5G1TA 1O66A 4Z2GA 4LQ1A 2NLIA 3DI1A 1DJYA 3OGVA 5BU9A 1C29A 2G3JA 3NG3A 4H04A 1V6VA 4N9CA 2YL8A 4D72A 2PUZA 4HK7A 1OADA 2J7EA 1AFSA 3B4UA 9RUBA 5CXPA 4PUEA 2PGWA 3P84A 4QP0A 2FYMA 1AH0A 1EBHA 3H4XA 3WLPA 3IGHX 1LBLA 1GQNA 4I6KA 3MMWA 3NGFA 2PDWA 4LH8A 4LUIA 3ITOA 3D0CA 2Y8VA 4Q4QA 2E6YA 2VEFA 3FOKA 1GZ1A 3WQDA 2R6OA 2O55A 1A5MC 4WD0A 1A5CA 1DP0A 1SFSA 3NEHA 2P76A 3OIHA 1S3TC 3VK5A 4UTJA 1KGXA 4KF1A 4KCTA 2ZADA 1F3EA 5EMUA 1HKJA 1HO1A 1YBQB 1P6WA 1Q4NX 3VINA 3CZ8A 5HQLA 2GQ9A 4C5ZA 3MV11 3L2MA 1V08A 3UF9A 1ZAJA 3FDKA 3KVMA 2XVGA 3QZ6A 4H8UA 2C1HA 1VFMA 2Y8KA 3C4UA 3K2GA 4D6EA 3CJPA 5H8MA 3UZXA 1MEWA 3GXDA 3WLSA 2NT0A 3UCQA 4HMCA 5D37A 4NASA 3CHVA 4ZSUA 5I24A 3TUUA 5H2ZA 4HNOA 5T91A 1UASA 3LHWA 2DZXA 3E0IA 3WL1A 2FH8A 1ONRA 2A79A 5FAJA 4LV9A 4AXNA 1TJRA 3C86A 2VGGA 2ZX8A 4YVPA 2V68A 3VX0A 1CGYA 3WMLA 1WKYA 1PIFA 1XUZA 3MHGA 3N6JA 3NYDA 4FX6M 4F9JA 3W7LA 3P80A 2VUNA 4JTLA 1VEPA 3BMWA 3TXVA 4UBPC 2YDSA 4DJEA 1Q6RA 3K30A 3DBNA 1ZAIA 3M1ZA 1G0CA 3S6OA 1EFZA 2IXUA 4JOMA 4V1YA 4LRTA 3OGRA 4NZ4A 1GKRA 2G3MA 4MLRA 1GYLA 4RE0A 3HO8A 4A8LA 2INFA 5CAHA 1R2RA 2OT0A 4ZSTA 1IYXA 3BAKA 3AROA 1BGGA 1QBBA 4J3WA 3QW3A 3T0AA 3R4IA 1JPMA 5GNYA 2V5DA 3MW7A 3T6CA 1FP9A 3LCLA 1C8VA 4MF4A 3T08A 1EJXC 3PPFA 6A3HA 2OLSA 1QOPA 1BYDA 2H3BA 4AXKA 1NQ6A 3FJ6A 2UWFA 2WMFA 1WZLA 3A9BA 1TMLA 2X8RA 4OOZA 3LCIA 1PYMA 1MQRA 1PO9A 1Z8AA 3HQOA 2BHYA 5AYBA 3U57A 3A3HA 1LJYA 1K3UA 2BODX 4KCWA 4NXKA 1JGMA 2B81A 1EEXA 2VEMA 3A24A 1KXVA 3B9DA 3WQPA 3LCHA 2Q02A 3RU8X 3VNLA 1XR2A 2WANA 3I6RA 3TZNA 3RN6A 2OSWA 2FHFA 4UFKA 2NQ9A 1H63A 3WF2A 3TTEA 4V28A 5FJRA 4J28A 3LOTA 2IS7A 1G5AA 1RCXB 1GOXA 1ME7A 4OVXA 1K6WA 4FR6A 4K8GA 4GY7A 4M80A 4BI7A 3UR5A 2QPUA 2X05A 4AIBA 4GQ0A 4JYDA 3QQWA 3CYVA 4EXQA 1WPCA 2FFIA 2POTA 1QNSA 4GQQA 4C7DA 3GNRA 2ZVRA 2J7HA 4KRUA 1HGYA 2DZAA 2J9YA 1BTCA 1ODUA 4PUKA 1CXFA 2XFWA 5FCZA 1LG2A 5EA9A 3N6QA 2J62A 5KEZA 3P3BA 1A49A 4ZQCA 3TEVA 4DXXA 1SW7A 1PE1A 3KX6A 3LX9A 1S1PA 3U3HA 5KITA 5I0DA 3TYBA 1RY8A 4HTYA 4G7EA 3PTKA 1VS1A 2PF8A 3W9ZA 3QY6A 4PH6A 1RVGA 2EJ1A 4O1EA 4KERA 3AZSA 1MRQA 5FL1A 3PG8A 1DQXA 3OODA 1XPYA 3S83A 5M17A 4DM1A 1ZTVA 2F2KA 4IM4A 4YHGA 4BQ4A 3OOQA 3D47A 3LUTA 4PULA 2YL5A 3B9OA 1CXKA 3FLUA 1WDSA 1TRDA 1HJWA 4DB7A 2X1TA 1TQJA 4IWWA 4DJFC 2NSOA 3MWAA 2O9RA 3NZGA 1CXEA 1ZGDA 1G01A 4Z1DA 3NL2A 1XLLA 4U31A 3WF1A 1K1DA 1XIIA 5H8UA 3TN5A 2WVTA 1F7BA 4BQ2A 2B7NA 3N4EA 1S39A 4RDVA 4TQTA 3PR2A 2O9TA 1I1WA 3PPCA 1YQ2A 2BVDA 4AZBA 3FSUA 3VIJA 3H2EA 2ODOA 4DM2A 3M0VA 1E4LA 3RLGA 3LERA 4LYQA 4IGMA 4HNTA 1TV8A 1LRNA 2IPFA 3S46A 2I56A 3H7RA 4OFCA 5A5WA 3W4RA 2D3NA 1A5AA 1EC8A 1GEQA 3COTA 3DG7A 4GYFA 2A6NA 4EWJA 3GC4A 4B5SA 1LL7A 2OKTA 4GO9A 4QLJA 2QUNA 3EWCA 5AHEA 1BAGA 4O1AA 2YZ5A 3PZVA 1B1YA 4HU0A 3PZIA 5A8PA 4IL0A 1K70A 3NO1A 3EMQA 3CNYA 1H7OA 1YTDA 2GGGA 1CCWB 3C8FA 4P7QA 2YCEA 1M9HA 1VEMA 1XRTA 1PAMA 4R3UA 1RBAA 3SCVA 3W1UA 1SZRA 2CPUA 3WEOA 2Y2WA 3LK6A 1M01A 4JFWA 4Q8PA 3H6OA 4H83A 4KWSA 3LDVA 7XIMA 4FLSA 4MJZA 5HJYA 4FSAA 1KM6A 2JKEA 2XVLA 5HPCA 2QMJA 1QI0A 3ITLA 1FHLA 3KL5A 1CGUA 1KFJA 3M07A 4AZHA 1PUDA 1K9EA 5D30A 1XGZA 3W76A 4F0HA 2HE5A 4M29A 3VABA 5JH2A 3E5BA 4QITA 4KPLA 4H9XA 2VO5A 1XCFA 3ELFA 3N34A 3WX7A 3THAA 4GO8A 2PLJA 1Z7AA 1A0EA 5JIWA 1ONWA 1CTNA 2H90A 4DBUA 3GB6A 3A12A 1S1RA 2G5WA 1J2BA 1TG7A 1SW0A 3U2EA 3T0CA 3AIEA 2OEMA 3AOFA 1JZ2A 1XYFA 4URIA 1UP0A 5T9CE 4HNVA 4C7GA 3TK7A 3PZMA 3EKGA 4NAFA 4BK9A 2I7GA 2Q01A 3OHIA 1QPNA 1PV8A 1A5OC 4AZCB 4CCCA 3U7VA 3ABSA 4ZO9A 3UGVA 4P2VA 3PBUA 4B4HA 5BYWA 3M0LA 1QR7A 4G8TA 5CC3A 1E40A 1EJUC 3R5EA 1J18A 3K5XA 3KBMA 5I3HA 3VNZA 4I9TA 3WFZA 3HG4A 3TYUA 4LC8A 1Q4WA 3MDUA 1HG3A 4CU8A 4IP4A 3BWWA 2J8GA 2VHLA 4OQVA 1ADDA 3TLQA 4GGHA 1OX5A 2PTYA 5CJMA 1E4MM 2WV8A 3F4DA 1AMYA 1VLWA 2W61A 3SFWA 2RH9A 3BE7A 1KTBA 3C0JA 3UJEA 4IFKB 4UQ9A 1SJCA 4E38A 4JTSA 4IMCA 3WF4A 4HOWA 3L12A 3W7QA 3V75A 5TBOA 3PTQA 1EO7A 5JVLA 3QR3A 2CWXA 2EHHA 3EXTA 4JN8A 1ZJIA 3S2JA 2HISA 1L6GA 2F38A 2DZTA 4D2JA 4KEVA 1DJIA 4DYKA 3QC3A 3ZFHA 4CCDA 2D2JA 3W02A 2ALDA 2VFGA 3HPZA 3PZTA 1UMYA 4IG2B 4IP7A 1CB2A 2PS2A 3VOGA 3YPIA 1H0GA 1XBZA 2PDYA 4LX4A 5JH1A 3AC0A 3QM3A 3TCSA 4IPIA 1VFUA 3RXZA 4LW7A 2DZUA 5C7VA 4N9EA 1J0KA 4TMBA 2Y4SA 3H4WA 5HDRA 4YCOA 1XWYA 4K7YA 4J4KA 3GDLA 4AY8A 1J10A 1JPDX 3FA4A 3F2DA 4YN5A 1B2YA 1JYXA 4OBSA 2OEKA 2PPGA 3GUGA 5HQMA 1ISVA 2DZSA 5EKYA 2V3FA 3KZSA 5CBJA 2VDIA 3V1HA 3BAXA 4LCSA 3LNMA 2FZDA 3W73A 3IJDA 4NF7A 3IEBA 4A05A 3KAOA 4PMNA 1WA3A 3R13A 2ABAA 3RM8A 2A7NA 4MYXA 3CIVA 1QAPA 3EEZA 1EWEA 4S3KA 2Z00A 4C7FA 4PC8A 3WLNA 3ZVHA 3R58A 3EWZA 1ZLPA 3L67A 4H8NA 3CHCA 1WNOA 2GYIA 7REQA 2ACQA 3L65A 2Y5JA 3GXNA 3FKRA 4JKLA 5IFPA 2OOGA 5I6SA 2HNEA 1V4YA 3R0UA 2C71A 3LCWA 4PUJA 3BZGA 5LA2A 2X2GA 3FA5A 1EL3A 1TZ9A 3CB3A 4YPJA 3POHA 1UOZA 5FEZA 1P1XA 1Q63A 1J0JA 4UCGA 5LIWX 3W70A 4GQRA 5FF2A 4W5ZA 3OEXA 4TMCA 3WUGA 2E67A 3CLMA 3F03K 3QRHA 4I6VA 4YYCA 1VGAA 5DT5A 1IR1A 3F5KA 1LLZA 2D20A 2WSRA 3OLEA 1KFLA 4ML9A 3FCPA 3Q65A 5EY5A 2CW6A 3QPYA 3W07A 3C2FA 3MZNA 1E6QM 4W7WA 1GVEA 5LGXA 1BLIA 1F73A 3NSXA 3T0DA 4J3UA 1FQ0A 3L23A 2FTPA 3M5ZA 2HROA 1PTGA 4PMVA 5C54A 1OC6A 1EJVC 3OIXA 1BPLB 5CAKA 1RVKA 4P7LA 4J3ZA 3THDA 3CHFA 3TFXA 4DPPA 3ZJ6A 4YTRA 1DJZA 1W1PA 3BLPX 1E51A 2I1OA 2G3IA 4HKPA 4FR1A 1MXDA 2W6RA 4AEOA 3RMJA 3U48A 1TWIA 2J7BA 1LBFA 3SSJA 5FSDC 3EZ4A 1YPFA 1EJSC 4YJ5A 3ERPA 3H7UA 1RUSA 4I8DA 3DKJA 2E0PA 2DORA 4JTCA 3ZM8A 2XVKA 1VCVA 1UB3A 3RRAA 1CI1A 3S5SA 3CWHA 1JZ4A 1AZ2A 1JDEA 3B97A 3OGSA 3URAA 2V82A 1DQWA 3FJNA 4QQ3A 1VJZA 1MRAA 5C8BB 3BW3A 3M4HA 1W1TA 3KP1A 3T42A 4MVAA 1L8NA 1Z48A 3NPXA 5CEWA 3UD6A 4UQBA 3W81A 4LT9A 1W9XA 3V5FA 3U6WA 1RQHA 4BFAA 4ATDA 2PRLA 4RXGA 1DHKA 4WCJA 3H2MA 1LQ2A 1GVQA 3G6MA 3EX6A 1ZBWA 2ZXAA 3VPLA 3ZOAA 1IXOA 3ARXA 1L6SA 1EGZA 1J8VA 2CKRA 1NY1A 3RPDA 1M04A 2QDDA 2Y61A 5I3FA 1LOSA 1OGSA 4XAZA 4CEUC 5F2IA 2X40A 1FFRA 1JF6A 1R47A 4UQCA 4QNEA 1UD6A 1YRRA 1Z69A 4NZ3A 4LAMA 3H23A 4QEHA 3FV9A 3GVGA 4ZO7A 2ISFA 5AKQA 1KNWA 4K1WA 1KV5A 4B5VA 1TV4A 4Q4SA 5FJUA 4DWSB 1MO0A 1SR9A 1TMHA 4XBKA 4QJ4B 1ADSA 1JXJA 2F61A 3EA2A 4AISA 2E8YA 1UWTA 4PB5A 1QCWA 4J3VA 2INZA 2WLZA 4XUGA 3CLWA 3S2MA 4TOQA 4WX2A 3GDTA 1VFOA 5CC5A 1EA9C 5HJXA 4O0QA 3L0NA 2ACUA 2FPVA 3IAPA 1RY0A 2J9XA 3UZ5A 2AKZA 3V5OA 1KWGA 5ABFA 2DV0A 4PMRA 3WLQA 2A1YA 4JTTA 3WQ4A 4NUWA 3JVAA 1E9LA 1RH9A 2OQYA 2FGZA 5XIMA 3AXKA 3HN3A 4FF5A 1MFUA 1GEHA 4Y9PA 1G4TA 5E09A 4F8XA 3CZEA 1HT6A 1EDQA 1WUEA 2O9PA 1KXHA 3VVGA 4XZWA 3DYPA 2G95A 2XFFA 3SUSA 4QS5A 4XAFA 2WC4A 3EYPA 1GPWA 4JY8A 2RHGA 4Y2WA 4Z2JA 4PB4A 2WJDA 4RKAA 4FNRA 1DQUA 4PL1A 4QAIA 4PFHA 1PZ0A 4PTWA 3SGGA 1H3GA 4RUBA 4C6OA 4Y7EA 3WLMA 2QJHA 1W3NA 1S5VA 3ALFA 4DLFA 1NDZA 5EMJA 2XH4A 4FMVA 5EBAA 3WF0A 2X1RA 4YMZA 1JCLA 4XAYA 1YNYA 1W1IE 1A5BA 4CCEA 3WNNA 3IJ6A 4LCQA 3N2TA 5KINA 3WO8A 3OJGA 3A3XA 2DQWA 2VEIA 2BLEA 2FKPA 3BZJA 4DO7A 4WGHA 4EAMA 4EPDC 4UIOA 2ZA2A 2FHCA 4HHLA 1XBVA 1ZQ5A 3LRKA 4S3AA 2R91A 2YA2A 3NQMA 2PWHA 4GUGA 2IPWA 3PZGA 4J3SA 4O0ZA 4NI3A 1EUAA 1QBAA 3MMDA 4U3CA 4W87A 4H01A 4MYAA 3GTXA 2D0HA 5HJLA 4FS9A 3CIXA 1KM1A 3UWVA 2WC3A 1Q45A 2NXIA 3PJUA 5BCAA 4J2PA 3RF9A 2DSWA 4LF1A 2DZPA 3TJIA 2WO5A 3MI3A 1J6OA 3WLHA 2W5FA 5CG7A 3R43A 3CGTA 1B3YA 3EX4A 5HATA 4QXIA 1EX1A 1OFQA 3CH0A 5HWNA 3HF3A 3E0LA 5A8QA 4PSPA 1TPDA 2PDCA 2NUWA 3FA3A 3QSTA 4KETA 2DSKA 1UZ1A 1KFBA 5AYIA 1I2RA 1MW3A 3LPOA 2DT3A 2H8ZA 4R34A 3MKKA 2PSNA 3WLLA 3UR2A 3JU2A 1H7XA 1OK4A 1K4HA 2ALRA 1O60A 2ZA3A 3SRDA 3T8LA 3SCUA 4YWSA 4ERIA 1HL9A 3G6LA 1EUNA 2PWGA 3W7GA 4O1CA 3NQEA 4IPJA 4ATWA 3CBWA 4O1BA 3APTA 1E3ZA 5A6JA 5ABGA 1HVXA 4NQ1A 4GBDA 1EH9A 4JAWA 2DIKA 2Z6IA 1VPQA 1W9VA 2NT1A 3ARUA 3NL5A 5IDIA 5A6MA 3N9KA 2DVXA 2IQ0A 3PJWA 3TLLA 1KR1A 3ALGA 3L4XA 3I3BA 3O1NA 4JHMA 1IT8A 2GGHA 3GDKA 1FWSA 3BMXA 4AYSA 1VFSA 3SUUA 2QVNA 1JI2A 1BYBA 1S5NA 2XIQA 3L5LA 4D6HA 1GT8A 2DQXA 3KCOA 3PJXA 2QAFA 1FRBA 3ARSA 1KM3A 1FXQA 4KCVA 3HJEA 5HR7A 2VMFA 2HQAA 4JGDA 5FF4A 1IXPA 4C5YA 1GG0A 3E38A 4OECA 3UESA 3VE9A 4TV6A 3SY8A 1FWHC 4NXSA 1EYEA 4HIBA 4MKVA 2WMIB 1H1ZA 3SQLA 3ZLGA 4AHPA 2C13A 4E8GA 1ITCA 4ES4A 3BLDA 3SCQA 2G3NA 2WCSA 4OUIA 2GGIA 4MJ4A 4OUEA 4I5RA 2X7VA 4XD6A 1M7JA 1FKWA 3KBSA 1EDTA 3CL7A 3GSMA 3WEZA 1C7TA 4UTKA 4AEFA 1VKFA 3LM7A 4YTUA 2BTMA 1WCGA 1RBLA 5A69A 3DYMA 4I9AA 4JFUA 2QLYA 3EMZA 2PD9A 4P7OA 4M5PA 3PB2A 2CLFA 3OU8A 5I3JA 2PCQA 4KRZA 3T4WA 5I07A 1AJ0A 3EOEA 4R9XA 1KBJA 3NQ6A 4IIBA 4UFIA 4O1DA 1WDWA 1JCTA 3O8AA 3VIOA 1RZMA 4ZCWA 2QJMA 5E1QA 3WYZA 1F4HA 2YW4A 1YADA 3ATZA 3E2SA 3SSZA 4HQVA 2P88A 1QI4A 5BRBA 2NWRA 3ITXA 3GVWA 1JZ5A 2FVLA 1N8FA 1FCVA 1L9WA 2YL9A 4HT3A 4Q8OA 3PZOA 1XI3A 4M56A 4KEUA 1SZEA 4ADSA 5BOFA 1C90A 4QDPA 2GGJA 3H4GA 3R25A 4ZXLA 1Q7MA 3MC5A 1RPXA 4GH3A 3O06A 1YXYA 4QTGA 3HFYA 5AECA 5HOSA 2HBVA 2WZTA 3H8AA 1FH7A 4DF1A 3DBPA 4EPKA 5IDZA 3GNXA 3UJRA 2XIJA 2D69A 4JTQA 3QLLA 4H2CA 3GIPA 3SRHA 4DUVA 3UWUA 3G2GA 1PS9A 2I17A 5JMUA 2W66A 2XTKA 1E73M 1A47A 4KKXA 5HNUA 4AD5A 1ALDA 4UWMA 4DAIA 3M0IA 2J74A 3AXXA 4HPGA 2P10A 1NDYA 1W1YA 4HD5A 1THFD 3VZXA 4BQ5A 2J8FA 1RLCL 4L1GA 1U33A 5C9ZA 1OBAA 3G0UA 3V0TA 2JGYA 2QJIA 4U5KA 3W7PA 3W7CA 3GHRA 3M43A 3SURA 2CWNA 4G6CA 3PTMA 3SI9A 3WLJA 1OX4B 3OZMA 1NM9A 4BJHA 4MTVA 3WH5A 4PRTA 3RX4A 2NXHA 3EPOA 4JNMA 4UMBA 1KR0A 4YS1A 5HNTA 3QGKC 2BY0A 1ZJBA 2VX7A 2G97A 3W82A 2H6RA 2CLIA 1L2UA 1PWMA 4BWLA 1FWRA 2PDUA 1VYRA 4K6AA 1LROA 5G1YA 2P0IA 4D71A 4MUPA 3SJ3A 1LUCA 4DO5A 3LZ3A 1LP6A 3SW6A 3P6LA 1J96A 2YCJA 1XCWA 3MS8A 4W7UA 1GQJA 4BF7A 1UQYA 4OV4A 1OGGA 1PX3A 2ZZ3A 1FFQA 4K37A 1XKYA 1Q13A 3IIOA 3RU6A 3EWUA 1DJHA 3VKAA 1OX6A 2J9ZA 5FJOA 3WKZA 2AL1A 4NJKA 3TQVA 1EZWA 2E5DA 3KS6A 1A0DA 1PB0A 4GD0A 3CZKA 1H4PA 1LT7A 3AFBA 5HINA 3VIMA 1QATA 4Q4KA 4OZOA 1XISA 3GXIA 1IF2A 2Z2AA 2DUZA 1K4GA 4E4PA 4AY1A 3DESA 4F2BA 1L0PA 2DJLA 2OQHA 3TH6A 3VA8A 3SR7A 4DYJA 5KTLA 3TW7A 1JFXA 3CH9A 2WCGA 3L0KA 3DKLA 1HJXA 5AHIA 1QNQA 3R11A 4O10A 1XIJA 3LBOA 1FWDC 3ZSSA 1H51A 4PEEA 1YKWA 3MCNA 3ANUA 4XWUA 5LKYA 5EMLA 1V0KA 3NQCA 4A3QA 4MNMA 4MPQA 1XQKA 1I9CB 3VOJA 2EBNA 4NL1A 3W1RA 3N3MA 4RLIA 1FH9A 1P7TA 1TJPA 2WWDA 2ZTKA 1HXJA 4S1FA 1V93A 4D8AA 1F2JA 4LRSA 4ZO6A 4DLMA 1H2JA 4GK8A 2WCAA 2GJLA 3VIGA 1X1NA 5A6SA 2BWGA 1G7UA 3R12A 3W2KA 4JQ4A 4LUSB 3P5YA 2A3CA 4FOKA 2H9AA 1PHWA 3L4WA 3H2FA 2GUUA 3SN4A 2GGEA 4AVOA 3TAOA 3W23A 3AMDA 4RNHA 1ICSA 2PLMA 3ABXA 4S3BA 5G4EA 4E5TA 1ZBVA 3N12A 1OFEA 3GO2A 4AW7A 3RIKA 1I2NA 2A4AA 3AWOA 2QMKA 1H0IA 5BRPA 1V3JA 1NQKA 4WHBA 4D6CA 4LVAA 1MDLA 3CMFA 3TYEA 3M0MA 2VR5A 1FDJA 2ZX7A 3P8JA 4E2VA 4UTTC 4UZUA 2AGTA 2HJPA 3MANA 3XIMA 3SO7A 1ZB5A 5TQLA 3W85A 3DFYA 2GUYA 3WLOA 1Q6OA 5CPQA 2TYSA 2YDRA 2BDQA 3KVJA 1J0ZA 3SB0A 2WYSA 5LYRA 2YCLB 4FNPA 3OA5A 2GVJA 4IIFA 5DCBA 3PK7A 4L1XA 6PTDA 5AC7A 3UYIA 3VZZA 3IJLA 4HHHA 2PBGA 2Z29A 1VHNA 2ZTJA 2Y5SA 4CQ9A 3QF0A 2BHUA 2CHOA 4DN1A 3GXMA 4XZ9A 1JCMP 2WBGA 5T8GA 4FNQA 4CQAA 4K7VA 4QAWA 4AX6A 4P8XA 5B7YA 4PA8A 4ZOBA 4DF2A 2QUVA 4Q4PA 1XV8A 1MW2A 1OFPA 4U4MA 1UYQA 2HMCA 4OIFA 3PBYA 4MB5A 1BSIA 4DQWA 1GGOA 3EXRA 3V3WA 1KRMA 1W2VA 4A8NA 1W91A 5I00A 5LXXA 4MB1A 4BQ3A 1GYMA 4ZB5A 1JCYA 4RPPA 1X7FA 3W7NA 4YLWA 3BW4A 1N8WA 1GZJA 4AMCA 3CQHA 4PMOA 5F4WA 1AD1A 3SECA 1UIPA 3VFCA 2JF6A 4GY0A 1OK6A 3MHUA 4HPJA 9CGTA 3BV4A 4XZMX 5REQA 3M44A 1SO3A 1V5XA 3C5QA 4S3DA 2WM1A 3CL8A 4HYRA 1UC5A 4S3EA 1L2QA 4AIEA 5JBDA 5D33A 5D2TA 2NX9A 4N4PA 4PCNA 1IEWA 1UWRA 4QG6A 3PJTA 3I6TA 4UFMA 1UR3M 3FEMA 2FZMA 4A8IA 3QQ1A 3MJYA 5M3WA 3KOWA 4U28A 2RKXA 3H12A 1TIWA 3PUEA 3UG3A 4MOZA 4HN8A 4R5EA 1VENA 3PS7A 1KGWA 3E2VA 4LVGA 4O52A 5AN7A 5GPRA 3SN0A 1MFVA 4PUMA 5HA7A 3PANA 3E0FA 5AHMA 2NWSA 3M5VA 3NVDA 2UBPC 2VZSA 1XLIA 3S1VA 5CZSA 4ZO8A 1J5TA 1A3WA 4O8AA 2WKJA 3BW2A 2ZX5A 1RA5A 4GISA 3WLIA 1XXXA 3D3FA 3C2OA 1VH7A 4K3ZA 1M5WA 2J4GA 4J5NA 4TVUA 2XIMA 4HU4A 4QSFA 3TMLA 3TQPA 1CGVA 1QK2A 5I03A 1XGDA 1D7FA 1V79A 4O28A 1JAEA 1D3CA 1DXEA 4PUDA 4YHEA 1LZOA 1XS2A 1LYXA 4AY7A 5ENLA 3NVTA 2PDBA 4MFDA 1V6YA 1XYZA 1TPWA 1XIHA 1W54A 4GI6A 5LNVA 2PP1A 4KW2A 4IIHA 4WOZA 4X60A 3FYPA 1H5YA 1WXZA 2UV8G 5K9DA 1MW1A 1I60A 5AYXA 7CGTA 4R33A 1J6PA 2F2HA 1O5KA 3RMEA 4UR7A 4A3HA 4UTUA 1Q6GA 1QK0A 4O12A 2VL4A 3NDZA 2UY5A 4DELA 4L5ZA 1UG6A 4C6IA 4LBUA 3V5CA 2O7QA 1WOBA 1ZS2A 2QHAA 3UJSA 1X6LA 4J7RA 2W3ZA 3BXWA 1DIDA 3VGGA 1VZWA 1E0UA 2PF0A 1ONEA 1KQYA 1CDGA 3RM9A 3KDOA 2OWWA 4FNSA 4Z2LA 1LRQA 1LWJA 2B0MA 2P3EA 1YE6A 1TX2A 2C16A 1T6MA 5GJNA 3A3WA 3R7MA 4ORIA 1SR0A 3ZJ8A 2VEGA 4EE9A 4PBEA 2OOFA 2ZBTA 1SPQA 4WJEA 3CPUA 1DL3A 4XO6A 3VMNA 1OIMA 1W9DM 4JQ2A 3SQSA 3AHXA 2UY3A 5AZ0A 4GZ7A 4W5UA 2PTWA 4UOQA 2WHLA 2WVUA 3HURA 1QTWA 2Z1BA 1EJTC 4TX9A 3UR7A 1H11A 4HHMA 4U2YA 4H9VA 1VFHA 2YXOA 3MI6A 2ZUWA 1UA7A 2WZMA 3IARA 4MSSA 5XINA 3GG8A 2VWSA 3GIQA 2JFEX 2TRSA 3DXIA 4O15A 3ARQA 1GVFA 4G7EB 2P1FA 4L56A 2ZUMA 3CQKA 4GKTA 1TTJA 1RQEA 2J88A 4X2RA 4FK9A 3PN8A 1GVIA 1JD9A 1KFWA 1WDQA 4G9PA 4LBRA 1JL8A 1PSCA 2DIJA 4JEQA 1OCBA 1FCQA 2YJQA 1BKSA 4JX4A 2HS6A 4ZOCA 1ZAHA 4AEEA 1FDZA 2FZBA 4O18A 2UY2A 3BTNA 4TIMA 1AK5A 2I5QA 3CMJA 4X9YA 4TVDA 2HDJA 2VX5A 3OYXA 2VR2A 3T40A 4PR4A 3H22A 4ONVA 3APYA 4GUJA 4RDZA 3LA4A 4WKFA 3T2OA 2W0UA 1FVPA 5FACA 3MUAA 5LIXX 3F7JA 1TPB1 2V5LA 4ICCX 4J2MA 1GJUA 3VXGA 1O94A 3N6HA 1J12A 2ZZ4A 4BS0A 1P43A 1XSKA 1R30A 3MTWA 1J11A 3E3HA 4Y9OA 4F0LA 3PBGA 2EJAA 4F0RA 8TIMA 4W4QA 5C55A 3QXBA 3VD7A 2P8CA 4GZJA 3OTRA 4B91A 4C90A 3E96A 4JPGA 1R3RA 5AOUA 3HU7A 1E9IA 3CUFA 3EWYA 1UUOA 4ZODA 3PM6A 1UH2A 4E3VA 5LIYX 1HO4A 4DNHA 4L4PA 3GNDA 1AUSL 1SSGA 3G1DA 3UWWA 3CS2A 3LHTA 1VRDA 2PTXA 4UUIA 3UZJA 1BFNA 4IICA 1W2PA 4IP5A 3MA8A 5JUVA 3G1XA 3M47A 3U4FA 2W4XA 3VIKA 3EX1A 1CENA 4NZ1A 4Z2HA 4K39A 2PDKA 4Q22A 1IWBA 4GLEA 3GWQA 4LUJA 3LSBA 1K7EA 3IPWA 3USZA 3OZOA 3ES7A 2WAGA 2J6XA 1D7KA 1VLIA 3CT2A 1NFBA 4Q7BA 2BS9A 4XD3A 2HTMA 2CETA 3HQNA 2YYUA 3QFWA 4MPKA 1ME8A 4N7QA 2EG8A 3W01A 2ZC8A 3WEMA 3VGFA 4DYEA 4EF8A 3UNTA 3A21A 3CWOX 4PBFA 4HPXA 1IQ8A 3PB0A 1ZZMA 1QO2A 1NOUA 3IRSA 1ZSXA 4CN4A 1S5MA 4GQGA 3VKJA 1SZGA 2QCMA 1SMAA 3M7SA 2EPKX 1R3YA 3WQCA 1A50A 5C2XA 1NWSA 3GH4A 2PE4A 2E77A 2QDEA 2CCRA 3IIXA 4C91A 5U7SA 3SRKA 1P6BA 3DN5A 2X0HA 2OO0A 3MBDA 1UD5A 4O0KA 1XYAA 3BJSA 3C6CA 1YX1A 2CIPA 1B9ZA 4BR1A 4H6RA 1GKPA 3WBEA 1AW5A 1EPVA 2OQLA 2ZVIA 3B9EA 1M7OA 3LPPA 3E6EA 4ML4A 3BAWA 2D22A 4LAZA 1DIOA 4JHZA 1G94A 3PC0A 4WEVX 3IJ9A 3KOFA 4Y96A 4O19A 3AIBA 5FOOA 2ZXQA 2PLCA 3HPSA 4D6JA 2J75A 3QH2A 2E9BA 1YPXA 3AIUA 1N7KA 3MO4A 1BWKA 1U5JA 2XVPA 1KBLA 3WQ6A 1IEXA 3SJNA 3MDWA 3W7OA 3T8QA 1XIMA 4ZOAA 3DAQA 3G3MA 1X97A 4B5TA 2TODA 2WSKA 3VOFA 5AYZA 2VFHA 4JCMA 1NH6A 1RALA 3SY1A 3HGJA 4NJGA 1OG6A 1V0LA 3OBKA 4UQEA 2QW5A 3EAUA 3B03A 4E0CA 3E74A 3BARA 4PB3A 4Z08A 2BY3A 2ISSA 1KCKA 1Q2SA 4DZIA 4XBJA 2PDXA 2PU0A 1Z6KA 1VQTA 5D05A 5DBUA 4WRHA 1OSEA 1S5TA 4QE5A 3SUTA 1U2YA 4QE4A 1C91A 2PZ0A 1VJSA 1UPMB 4MB4A 5PTDA 2TAAA 4WXYA 2YZRA 2J66A 3B8IA 3ITGA 4D6GA 1VIZA 4E4FA 3RRXA 1NIUA 1FOBA 1WE5A 1AW1A 4JS3A 2RAGA 3BANA 4B3LA 1OC7A 5B80A 3BAIA 4NT0A 4B5WA 3A5FA 2AGKA 5FJPA 5KZEA 1RCOB 4HA4A 4Z2IA 5HR6A 1YBQA 3E12A 3V0UA 2XGZA 4JKMA 3TONA 5DMYA 2RGLA 1P0KA 1KQZA 1KKOA 1TJ2A 1REQA 3USBA 4RZ5A 1W32A 1M53A 2EGZA 1W8SA 3PZNA 3W7EA 4RV8A 3E5PA 3QTPA 4I9JA 2D2GA 3VGEA 2XFYA 2B31A 1ESWA 3FDGA 2ONEA 1RP9A 1QNRA 2WK2A 5D2XA 3AMKA 4XD4A 1EP3A 2Y1HA 4WSKA 2VUYA 3OVRA 3NZQA 7REQB 5DRIA 4FIRA 2KAUC 4GCAA 2PB1A 3AMGA 3S5ZA 3I6EA 2GSJA 3LPGA 2OYMA 2RUSA 2ZX9A 3EWBX 5L9FA 2DSUA 3STFA 1IHIA 4P7RA 3AS1A 3WBXA 4S2BA 4ZR8A 4G5DA 5E6ZA 2BOEX 1UR8A 3C8NA 1DVJA 1O95A 5DCDA 3UPBA 3C3UA 3LNPA 3GBDA 1JD7A 2EPMX 3MUIA 4UOJA 2GLKA 3DG3A 4NI8A 3QSRA 4UTWA 4GFIA 2GSHA 1Q7QA 4B2DD 3SBFA 3AJ7A 3EB4A