1H1YA

The structure of the cytosolic d-ribulose-5-phosphate 3-epimerase from rice complexed with sulfate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
219
Chain Sequence
b'AAKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSLRKHTKAYLDCHLMVTNPSDYVEPLAKAGASGFTFHIEVSRDNWQELIQSIKAKGMRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-RIBULOSE-5-PHOSPHATE 3-EPIMERASE
publication title Structure and Catalytic Mechanism of the Cytosolic D-Ribulose-5-Phosphate 3-Epimerase from Rice
pubmed doi rcsb
source organism Oryza sativa
molecule tags Isomerase
total genus 76
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1h1yA00
1KFBA 1EEPA 2QCDB 3I6RA 3EX2A 2GUUA 2H8ZA 2ZRUA 5CZTA 1TPVA 3LCHA 3TV8A 5KZEA 1EP3A 2OT1A 3W7HA 1KFEA 4AH7A 2V30A 5CPNA 3S5ZA 1LROA 3W7LA 1JCJA 4JYEA 3IVTA 3G1FA 4KKXA 1ML1A 1BWLA 2YZRA 4ZZ9A 2NX3A 3DFNA 1ALDA 3PF3A 3UPWA 4UTLA 2V5LA 1QPOA 4HIBA 4NJHA 4OGZA 1DL3A 2FJKA 3PUDA 4AHQA 5K4ZA 3KVJA 3L5AA 1HO1A 3EXSA 4LC6A 3MBDA 3NPVA 3DFTA 1ZY9A 4O12A 3QM3A 2BTMA 3C8FA 3T44A 1MXSA 4TMBA 3P5YA 2X1TA 1DQXA 2W6RA 4YL2A 2RH9A 2EKCA 3TKFA 1QO2A 4UMAA 2PRLA 4QISA 3FYPA 3FLUA 3N3MA 3L5LA 4NJGA 1DJQA 2ZDRA 3M16A 3WK2A 2X1RA 2QCCA 4BWLA 4LT9A 1KTCA 1QDSA 3ABQA 1LOSA 6TIMA 4XWUA 5CGQA 2B7QA 5EL1A 5HWJA 4JYFA 2CFFA 4WD0A 3M6YA 1JRBA 1VS1A 3STGA 3DXIA 2J88A 3SGUA 4UTTA 3ZWSA 4FNUA 3W88A 1DVJA 1YLVA 5AN7A 4LRSA 1JCNA 2ZZ2A 4U4MA 1TV7A 3T78A 3UY8A 4MIMA 4DXVA 2G96A 2Y6ZA 5C2XA 3FEMA 5AB3A 1NF0A 2E6YA 1JQVA 3LI0A 3NQDA 3FJ6A 3QH2A 3ATZA 3PY2A 4MY1A 4YCOA 2E6AA 1XUUA 3TK7A 4LC8A 4XKYA 2Y62A 4JTJA 1IXPA 3B06A 4GE8A 1OX4B 2Z0IA 2E77A 1OABA 4AHPA 3LCFA 2V2DA 1XDLA 4JNMA 4DQWA 3PUOA 1KFCA 1G69A 3IIZA 3SZ8A 2JBMA 2TSYA 4I7UA 1P1XA 2XN1A 5E0KA 1KA9F 5DBUA 4C1KA 5D02A 1ZHAA 3QSRA 1LZOA 3W2LA 1GVFA 3ZWTA 1ME9A 2OJPA 2QKFA 2C16A 3LCGA 4JEQA 4NX0A 2Y7GA 2DJXA 4FX7A 3I7QA 1TTPA 1YXYA 1K3UA 1Q3NA 2C18A 4BF9A 2PRHA 3EX1A 1SW3A 3K30A 1RD5A 2J27A 5HJLA 3T40A 2HS8A 1O4UA 1TTJA 4KWVA 2Y7FA 2FLIA 3L2IA 3SW6A 3TMLA 3O05A 5EBUA 3JR2A 3IIOA 4R33A 3WJWA 4CNOA 1LTDA 3TJLA 3GR7A 3NNTA 4QQ3A 3W7OA 4X2RA 5AHNA 2DZWA 3GDLA 3TH6A 2JGQA 4UR7A 1Q6QA 4Q32A 4O57A 5IBXA 4IMEA 1F05A 2WV8A 3A5FA 3F4WA 3FS2A 3FKRA 5AYXA 5K4XA 1KW1A 4QSHA 2HMCA 1PS9A 5I3KA 3PBYA 1P4CA 1LBMA 1G4PA 2ZZ3A 1JCMP 1LDCA 1Z48A 3W83A 3FKKA 4KFNA 5CPOA 1FWNA 3MP5A 2E5BA 2ZZ7A 3BGJA 1JCXA 4LRTA 3DKJA 2IQTA 3PWAA 3D0CA 1DBTA 1FCVA 3OEXA 2ZYFA 1W56A 1R2TA 3LCLA 3O6YX 4MYAA 2WPBA 1GVOA 3UWWA 4RXFA 5F2GA 1ME8A 4GUHA 2CZ5A 2Z1BA 5AYZA 3UWQA 1E51A 1ZAIA 1TQJA 4ZQRA 1L6WA 3P61A 1CI1A 3TSBA 5D33A 1W5PA 1WA3A 4JN6A 2XN2A 4RV8A 2HSAA 3LV5A 4NNAA 3IVUA 3F1QA 5MHBA 3IVSA 1HTIA 4MZYA 2YW3A 2OCZA 5FEPA 3INPA 1OYAA 2B4GA 2ZFAA 3GDTA 2ZA2A 3M41A 1UB3A 1H51A 2ZZ4A 1EWDA 4K8EA 4ZQNA 1C29A 2V2HA 3WK0A 1O95A 3MUXA 3MI3A 4S1FA 3O8AA 3QPYA 2I9EA 2RDUA 3PB2A 3MHUA 1ICPA 2CLHA 2BZNA 3TQVA 1G4SA 3G3DA 1F2JA 3UXDA 3B05A 1LP6A 5F4WA 3NQVA 4HNUA 3M5VA 3M5YA 1BKSA 4RLIA 1S5TA 2YCEA 4NNCA 2YFOA 1H61A 3AO0A 4ZVJA 4XTDA 1OK4A 2AGKA 2VFGA 4Y9AA 4UMBA 4OWGA 4DO6A 1KFLA 1G4EA 4IX2A 4EIVA 1KFJA 2NV2A 4PFMA 3HBLA 4LVGA 1RQBA 3QZEA 4QNEA 4BWLC 3LI1A 4H6KA 2VXNA 1XKYA 3W1XA 5CKSA 3S0CA 4JTKA 3W7NA 4CLMA 4JY8A 4EF8A 4LUIA 2B7PA 1TCDA 3G18A 4MZ8A 4UTTC 3W73A 3O07A 5ABTA 2ZCGA 4N02A 4MZ1A 3ELFA 4NUWA 1NSJA 3C2VA 4HHPA 4FHAA 1HFBA 5FF4A 1WXJA 4JTHA 3SIZA 1SO6A 3C52A 4FNTA 1R30A 2RDWA 3W7KA 3EXRA 4A2RA 1OFEA 4QAIA 3PSWA 5GVJA 5HUPA 3TC6A 4LNYA 3R5EA 4CCEA 3W7JA 5FEWA 1OX6A 1VC4A 4FB7A 4LY8A 4FIQA 1OFAA 2RFGA 5AC6A 3G0XA 1LM1A 1FX6A 5I3HA 5TIMA 8TIMA 3G1YA 1LYXA 4Z08A 4RJEA 5FF2A 1O60A 2ZTJA 3Q2DA 4GJ1A 4OV9A 3TR2A 1FWRA 2QEZA 5G4EA 1J2WA 3O6CA 4O10A 4IXXA 3NGJA 2GJNA 4ZL1A 3IGXA 4OU1A 2EF9A 1OX4A 1G4TA 1CW2A 3LBCA 3NPUA 3UQNA 1A50A 3NPXA 2EGZA 2CLMA 3CTLA 2X30A 3DU0A 1F7BA 3EKLA 3ATYA 3KXQA 3P7YA 3S5NA 1C9DA 4GUGA 1ICSA 4LV9A 2YSWA 2QJHA 4P2VA 2BLEA 1GOXA 1KTNA 2C13A 2TRSA 2J9ZA 4K39A 1W8SA 2RDTA 4IGHA 4E0CA 4K38A 3W1NA 2FPVA 1IGSA 4E2DA 1PVNA 4LTSA 5LNUA 1JUEA 1VZWA 4PH6A 3U6WA 5C6MA 2HS6A 1KM5A 3UD6A 4JX6A 3UZ5A 5AHFA 3UPBA 3BLFA 1PCKA 1GWJA 3GK0A 5CSRA 4HNNA 3VKJA 1A5SA 4FIRA 3HB9A 4WUIA 3QMRA 1YADA 3LXCA 1EWEA 2FTPA 1S5VA 4NXKA 1XBYA 3LCXA 4S2CA 1AW5A 1SZFA 4TIMA 5CZSA 2C6QA 4ICNA 4WJEA 4IWWA 1F74A 4POCA 4N9CA 2DORA 4O8RA 2CWNA 5FESA 1OFQA 4CCCA 2J9YA 2NUXA 3GKFA 3W2JA 2O7QA 1EA0A 1XL9A 3LCIA 2ZRZA 1JR1A 3W75A 3S6DA 3TIMA 1H7OA 3C2EA 5AHMA 2QUUA 1LOLA 3T55A 1B4EA 1IF2A 1K7EA 3QQ0A 4NJKA 1XXXA 3LOTA 4N2YA 3I7RA 4OBTA 1D3GA 5HR7A 3QC3A 4ML9A 1VYSX 4Z0SA 3NQ7A 3A24A 5IM51 5K3VA 3GLCA 1H62A 3RU6A 4K37A 3DH7A 1VYPX 3NL2A 3GIYA 4QITA 1VCVA 3W1QA 4RXGA 3VNDA 1GG1A 4U28A 4FF7A 2WO5A 5A8GA 3USBA 4AB4A 2CLFA 5AHEA 3MP3A 4FX6M 2C1HA 3FFSA 4PEKA 2NV1A 1TPEA 3EWWA 3G0SA 3W85A 1M6JA 2R8WA 1WBJA 1XBZA 3O16A 4OQVA 3NR0A 1D3HA 1Y0EA 3L9CA 1ADOA 4K36A 3UWZA 3VFLA 3TMQA 3GDKA 4JTTA 3OA3A 4IQLA 3R12A 4RCXA 1HUVA 2A7RA 4NU7A 2ALDA 3O15A 4UCGA 3W7CA 4LVAA 3NQGA 5F4SA 3N9SA 1QMLA 4LS1A 3HPXA 4L4MA 1O5XA 2ZRYA 4O17A 3M47A 1SZEA 3LHTA 4X22A 2DZTA 1W5OA 5HQEA 4NVTA 5EMUA 3W86A 1P0KA 3HMJG 1TSIA 3O6DA 1LBLA 3BW3A 2DZUA 3N14A 1D9EA 2P10A 3UY7A 2CZDA 2EHHA 4K7VA 1BTMA 4X9SA 3N2XA 4BI7A 2I14A 3W2MA 1NVMA 2PRMA 1TV8A 3BO9A 1I4NA 1VYRA 1R47A 3QMSA 1HL2A 4K8HA 3UYCA 2OT0A 3CM4A 2V0TA 4CCDA 4LWWA 2C3ZA 3V1PA 2G95A 3DGRA 5AFDA 3HGJA 2Q8LA 5BMWA 3M7WA 5L9FA 5H2ZA 3LERA 1UUMA 2V9DA 3ZS4A 3GX9A 2A4AA 5C5YA 1SW0A 1VQTA 2A2IA 3UWYA 3DFSA 1QOPA 1LORA 1LLWA 5KINA 1R2SA 4JDYA 1YPIA 3NQ6A 3NOEA 3CU2A 3CC1A 3G1SA 1O94A 3PAJA 4UTUA 2OMAA 2Y70A 5HMSA 4NJIA 1QWGA 1ZNNA 1NFBA 3E9AA 1OJXA 1Q6OA 4O4WA 4AWTA 2V2CA 3CIXA 3LTYA 3NQEA 3CT7A 4R7JA 3ZFHA 3MI2A 1GVRA 1SW7A 1XBXA 3LX9A 3MI6A 4MYXA 3HQ1A 3W07A 1LRQA 5CSSA 3SGZA 4C1LA 1QPRA 4Z1BA 3WFAA 4R34A 2H3DA 2Y89A 3M43A 1TRDA 4JTSA 1IIGA 1L6SA 4YCPA 3QJAA 3EWBX 5HWNA 4IOTA 1YTEA 2ZQ0A 1WOAA 4LW7A 2DZXA 3OVQA 1GQNA 1SSGA 4EF9A 5G5IA 3B0VC 4RZ4A 4ADSA 4ORIA 3E12A 3FJLA 4WXZA 3DI1A 4KFPA 3TAOA 3NQ8A 1NF7A 1H60A 3EEGA 4DPPA 3IIVA 4CQ9A 1X8FA 3HG2A 3KVLA 4BFAA 1TPUA 1XUZA 4RK8A 2WSYA 5F1VA 3EWYA 4M7TA 4TMCA 3NQAA 2QCLA 3RLVA 3W70A 1K8XA 1OHLA 2H8XA 3NAVA 1FWWA 5DY3A 3W71A 2DP3A 5KZDA 2YPIA 3T4CA 3QQ1A 5EYWA 4FEZA 1YTKA 2VFFA 3NQFA 2Y85A 3NEVA 3I7SA 1T96A 2FQIA 1IXOA 3P81A 2VOMA 1DKWA 2JKPA 2YYUA 1JUKA 1OF8A 4GBUA 4UIOA 1QPQA 2CLKA 4H4IA 2NWSA 1PE1A 4HNTA 3M5ZA 2ISVA 3W1MA 1X1ZA 2DU2A 1OFBA 4O52A 1LRTA 3Q94A 3LM7A 1OFOA 3N34A 5CPLA 3PM6A 4FNPA 1YTDA 2VFEA 1CX9A 4P61A 1H7PA 3VE7A 4ONVA 1TPB1 1KBIA 1FWSA 2I1OA 3F03K 3IIPA 4LVBA 2Y88A 1KLYA 1WOBA 2Z2UA 3HG4A 3QF0A 4IUOA 2GQ9A 4NT0A 1ZFJA 3GXPA 1W31A 3FA5A 4UNKA 1QPNA 1AK5A 4WY0B 3U8GA 3H55A 4MVAA 3JS3A 5DCEA 5SWUA 3TFXA 4GNJA 1JULA 4BR1A 3LBMA 2A0NA 1TREA 1XDMA 1B57A 1KV8A 3TROA 1VHCA 1I2PA 1W3IA 4DEFA 3BV4A 3EWUA 1J5TA 1YDNA 1QO5A 1LCOA 3ABOA 3MMTA 1AG1O 1ME7A 3L0KA 1P5BA 3P84A 5FF3A 3IEBA 4TR9A 4HSOA 3UXAA 3O1NA 3KVKA 3QYQA 3KOFA 5LGXA 3R8RA 3S1WA 4JYDA 3C61A 3LHWA 2ABBA 1LBFA 5D05A 1B4KA 4AXKA 1GTHA 4O53A 1MO0A 5G1TA 1H7XA 3KAOA 3UWUA 1SO5A 4UC5A 5C54A 4DO4A 2NWRA 5K2ZA 4WOZA 1RVGA 3NPWA 1WQ5A 4OHQA 4IMFA 5EY5A 3S1XA 2QCNA 2ATSA 2DZVA 1VGAA 3CLMA 4IMDA 4JIQA 3W7RA 1O5KA 3GNDA 2TPSA 3P8IA 4JGDA 3M5XA 4HKPA 2QCDA 4MLJA 4O1AA 3C2OA 4YWIA 5BMXA 5AC7A 4JTIA 3B0PA 4WX2A 1H7RA 3Q58A 1L2UA 1SQ7A 3P5ZA 1TPC1 4JXCA 4M19A 1GYLA 2ZA1A 3RFAA 3T7VA 2PURA 3FYOA 4IX0A 1AL8A 4GUIA 4LVDA 3LB0A 4O0ZA 4BI5A 3IGSA 2R94A 4XTIA 4WY0F 3PSVA 2C19A 3PBVA 4RR4A 2FPYA 4BK9A 1VRDA 5F1UA 4QIUA 3TC7A 2NUWA 4X3ZA 4AVFA 3TXZA 1Z42A 4GXMA 5BW6A 2NX1A 1UJPA 4UTMA 3NO5A 3ABSA 3MJYA 2BSLA 5LNWA 1AMKA 3NQCA 4UFKA 3NA8A 3BARA 1H7WA 2E1DA 4HNVA 3SI9A 1ZALA 2VFDA 2YGYA 5HWMA 4UNLA 3BVJA 2X16A 1SFJA 4WZHA 4Q4KA 4UTKA 1VJIA 4NZJA 3G1AA 1W5MA 2NXHA 3MYOA 4Z1DA 1OYBA 1RR2A 5CZJA 3RLUA 2J6XA 4MFDA 5HINA 1BEUA 4N6FA 5AC8A 1NEYA 1DV7A 3LRLA 1JQXA 4MJZA 3W74A 4DF2A 3W1UA 3SSJA 4JR5A 3M44A 1WAUA 1OG0A 3EWXA 1MEWA 3SECA 1QCWA 2NXGA 5I3GA 2BXVA 2VELA 3W22A 4XUGA 3W9ZA 1ZENA 3FOKA 1QR7A 3LXBA 4AHOA 3L68A 1H63A 4S2BA 3DHFA 5KZMA 4W9TA 4XBSA 2NLIA 3BLEA 1PCWA 3LDVA 3G1VA 3PBUA 4GRSA 3WJSA 2FDSA 4LV4A 4UFLA 2A85A 2DZPA 3EX6A 3JRKA 2AAMA 3CWNA 3PBWA 2G5WA 1GJPA 4EVZA 3G1XA 3W7PA 3QW4B 4O1CA 5DCBA 2YFNA 1T8XA 3RF9A 1XC4A 2CLOA 3L21A 2JGYA 1JCLA 2ZRVA 3PG9A 4UTJA 3C2FA 2WSRA 5FF0A 1RZMA 4HPXA 3LGEA 1DQWA 3UWVA 2E5DA 1S5WA 3HPZA 3LCWA 2ZZ5A 1LOQA 2KZHA 3DENA 2O7SA 1EPXA 1I8JA 5BNKA 4IXHA 3C0JA 4O19A 1FXQA 1QOQA 1F5ZA 1UASA 2Y63A 4N9BA 5D37A 1FQ0A 3DZ1A 4JX4A 5T26A 3W1RA 3THAA 5G2IA 1TQXA 2GOUA 1T0OA 1R46A 4XKYB 2ISSA 2E6FA 3P60A 2NX9A 2Z6JA 3HG5A 3E49A 5HULA 2A21A 3NL6A 2RKXA 5EA9A 2YDAA 4L4LA 4MJMA 1G7VA 3QEZA 4UFMA 5F2LA 4TX9A 3ABRA 3GZ3A 2Y7EA 1FBAA 4AWSA 1LRNA 5D38A 2TMDA 3NG3A 1SSDA 2QJGA 2X1SA 4O11A 2DZSA 2JKEA 3HO8A 1F73A 3KRSA 4JDBA 1FUYA 1OFDA 4K7YA 1FCUA 3GVGA 1QAPA 1R2RA 3DI0A 1WDWA 2OZ0A 3DFQA 4ORMA 1KM6A 5K9DA 1Z41A 1ZCOA 3U2OA 3YPIA 3CWOX 1AW1A 3HGOA 4PODA 5DY2A 2NZLA 2CU0A 3LLFA 4UMCA 3S8HA 1WV2A 4UTIA 3W87A 1TTIA 3QPZA 4WQ6A 4E38A 2R14A 5G2WA 5DLCA 3W7MA 4B5NA 3C6CA 2W79A 2CZFA 3WJXA 1VCFA 4WOQA 2RHGA 4JY9A 4M5PA 3C2RA 1RV8A 5F2MA 3W7QA 3G1DA 4Z0JA 1L9WA 1VLIA 3B03A 5FI8A 4PCFA 3S5YA 3P74A 3LLDA 4FO4A 4MFEA 2A6LA 3W7GA 2R91A 3TXVA 1GTEA 1YPFA 5K9XA 4YMZA 4LS0A 4NNBA 3TQKA 3W1TA 5BRBA 1S3HA 4LOCA 4O15A 1YYAA 3TFCA 4CNNA 1TMHA 3PVFA 3CB8A 3PC0A 5DELA 1YXCA 2BWGA 3MYPA 1H1YA 2A7NA 3NYZA 5D2XA 1KFKA 2ATMA 2E5CA 4MUZA 5D32A 2HTMA 3NZRA 4MPQA 2JK2A 4A22A 3PULA 3LTSA 1LLZA 1SPQA 2B0MA 1THFD 1GVSA 1OFRA 3PG8A 3W72A 4LVFA 3OHIA 3LRKA 5AYYA 1U83A 2D73A 2V5BA 1PL9A 1W54A 3Q37A 2NXIA 2X2GA 5D2VA 3BK0A 4UTHA 4I7VA 3HGRA 5H91A 3ANYA 1UBSA 3HF3A 3O06A 3BG5A 1N7KA 3VE9A 1KTBA 4ADTA 3S42A 2YX0A 1F76A 3OBKA 4RKAA 3A23A 5J5RA 3W7DA 4EOUA 2WQPA 2ZTKA 1TYGA 2QDGA 3W1LA 2Y61A 1MEIA 1GVQA 1SUXA 1IXQA 4IPJA 5KSWA 3GAYA 1VLWA 1W0MA 4TO8A 4O1DA 1X7FA 1PHWA 2Z6IA 4UUIA 2Y7DA 1VHNA 5LSMA 1QFEA 1W37A 4HSNA 3R13A 2CZEA 3W6YA 3CEUA 5A5WA 1OFPA 2W0UA 5G4WA 2VFIA 3A21A 4AMAA 4JTFA 4O16A 5AOUA 3N19B 1SZNA 4NQ1A 3PR2A 4M6QA 3MHFA 3EX3A 1XCFA 2QCMA 2UV8G 1XM3A 1OYCA 4NJJA 3LHYA 5DN1A 1GG0A 2QUVA 5D09A 1G6CA 2WNQA 1KBJA 3IV3A 3G8EA 3WK3A 2G97A 1K7XA 5G2HA 5FF7A 2QAPA 1W3NA 4H3DA 3B4UA 2YXGA 1FY6A 6ALDA 1FDYA 2CLIA 3BW2A 3BG9A 3NZ1A 3EKZA 2FPTA 4Y8FA 2ZZ1A 4JS3A 2GVJA 4LU0A 5HR6A 1FCQA 2X1UA 4GWEA 1V5XA 2XN0A 3V75A 1SR9A 5CZ0A 5DXXA 3BW4A 1JUBA 2QR6A 4OE7A 1DORA 1XBVA 1HG3A 4WXYA 4AF0B 2E68A 3RK8A 4Z1AA 4O0KA 3BGGA 3BLIA 4RZ6A 3EB2A 2Q3RA 1AL7A 1GZGA 1K03A 5LNVA 2QF7A 3IIXA 3TA6A 4OV4A 3CIWA 3LXAA 3E0IA 4UFJA 3SJ3A 3DFPA 2GVLA 4JTUA 1ZAJA 3KRUA 4JTGA 2E6DA 3NM1A 3P80A 4ZQCA 3GYEA 1G7UA 1K7FA 2DJLA 1Q6RA 1DJNA 1FWTA 2PE4A 1H7NA 1WYIA 2BX7A 4DF1A 1KLZA 3TW6A 2TYSA 2V8ZA 1OX5A 2QCHA 1FDJA 2E09A 1TJRA 3E02A 4DPQA 1GT8A 3STCA 3HPSA 3N9RA 2A6NA 3HOJA 3LHZA 1N55A 5I3IA 3L0GA 4O50A 1JJKA 4Y90A 4UTWA 4J9JA 3DFOA 2VEKA 5D2YA 2XFWA 2WJZA 1KM3A 2VFHA 3HJZA 3GKAA 3E96A 3DAQA 2C15A 1VPXA 1C8VA 3BPWA 1KM4A 1KM0A 5E93A 3CHVA 5HNRA 4NXSA 1I2RA 4R53A 1HO4A 3STEA 1B9BA 1X1OA 4A3UA 5FEXA 2A7PA 1SU5A 3ZR4A 1MEHA 5LNSA 3CQ0A 3NDOA 4XQ6A 3UZJA 3GXNA 4O28A 2WOQA 4QM1A 1J4EA 3KHJA 3TQ0A 1KM1A 2B7NA 1TPFA 1EUNA 2FB3A 1EUAA 4CQAA 4K6AA 4PL1A 2GPTA 3M0ZA 4FNQA 4A21A 3QRHA 2H6RA 4KWWA 1TPWA 1FXPA 3UNDA 5FEZA 3C56A 3W76A 3EXTA 3NL5A 2B7OA 4FX8A 4LS2A 1IXNA 3W7IA 4PL2A 3NVTA 3TDFA 3W23A 1TPDA 1TRIA 3H53A 5D2WA 1VR6A 4PTNA 4IMGA 2YR1A 2YW4A 1SFLA 4O4VA 4O14A 3NXFA 4CQ8A 1SO3A 4ZQPA 1X6UA 5LZLA 1Z44A 2EPHA 2A5HA 4HT3A 2ABAA 3I68A 1OVDA 5CPMA 4Z1CA 5I3JA 4MOZA 4ALDA 1GYNA 1I2OA 1K8ZA 3CEPA 1A5BA 4YLWA 1K02A 3NL3A 3G3MA 5DXYA 5TQLA 4JTLA 3R89A 4IPIA 4Y6GA 3MO7A 2WSQA 1RPXA 3A5VA 5TBOA 3LV6A 3G1HA 5U4NA 2QUTA 3OVRA 4I9AA 4ZQOA 3WJYA 4FNRA 3HG3A 3TSDA 2QCFA 3LHVA 4DBDA 1YXDA 2VENA 4NX5A 4UR8A 3HGSA 4N4PA 4UFIA 3GB6A 4EWND 4JTEA 2CLLA 2VEIA 4O1BA 4AEOA 4A29A 3RNDA 5L6UA 3THQA 4JIPA 1RQEA 3SY5A 1A5CA 1NAL1 4O18A 3P67A 1M7OA 4ADUA 4IJBA 3QSTA 4NZFA 3OG3A 5EPDA 3G24A 2EAWA 1MZHA 2FB2A 3RMJA 3GXTA 2ZRXA 3KFTA 2Q8ZA 3KRZA 5U7SA 3VCRA 3LRMA 1FDZA 2GQ8A 4N9DA 4AAJA 3DHDA 5E1QA 4RX0A 4FXSA 1DHPA 3DBPA 4MY8A 1WX0A 3W2UA 3TW7A 1L6YA 3TSMA 2ISWA 2QCGA 7TIMA 3FIGA 2C0AA 4PC8A 3L5MA 1GPWA 3GNNA 1TV5A 1PHQA 2NUYA 5G1YA 4DO5A 2GQAA 4FNSA 4G1KA 1TB3A 3W1AA 1YDVA 2WNZA 4BI6A 1G67A 4HN4A 1EIXA 3IGUA 3I65A 1PV8A 4RZ5A 5BOOA 4AF0A 1TJPA 3F4NA 4UXDA 4D2JA 1EP1A 5CG7A 5DCDA 4ZQMA 3QMTA 1K8YA 1Q45A 2GJLA 5DBTA 5I3FA 2PCQA 5AHIA 3EX4A 2F7FA 3MW7A 4OT7A 4A2SA 4O13A 1ONRA 3QW3A 1H1ZA 3QFEA 4XZ9A 3B04A 4PA8A 1DOSA 3C3NA 2VKZG 2LLEA 5D2TA 3LHUA 3L0NA 4GFSA 2P0OA 4M6VA 1A5AA 4Y96A 1FCBA 4UTWC 5F4XA 2H3BA 3WJZA 5K7JA 3PUEA 1W5NA 3PS7A 4M6PA 2ZA3A 1ZJIA 3CPRA 3L67A 1ICQA 5KMYA 3TUUA 3S1VA 2VEMA 5LHFA 2PC4A 3NQ2A 4JX5A 2V82A 3GDRA 4DF0A 5F2IA 3NM3A 4XBKA 1M7PA 4AWUA 1RQHA 5LNRA 2ZBTA 4N4QA 1KV5A 5AHLA 4YXGA 2VEPA 4JD4A 1P0NA 3TU9A 3GAKA 3W2NA 2VC6A 3W3OA 3L66A 1I2NA 1IIHA 4M7SA 5LHEA 3P62A 3TAKA 4WY0A 3STFA 2YYTA 5EKYA 1N8FA 1UUOA 4N6EA 5J5DA 2P1FA 5IBXC 1I45A 3KX6A 4KFOA 4CNPA 4DBEA 3PB0A 1H50A 4FXRA 3W2KA 4GUFA 3W84A 3TJXA 2AQWA 3W1PA 4GC4A 4MKNA 1VH7A 2ZZ6A 1QNVA 1VCGA 2ZRWA 3P82A 1SZGA 4TU1A 3L65A 1TO3A 4LUJA 3TCEA 3M9YA 1KM2A 2QCEA 2GVGA 1YDOA 1U5JA 3VI2A 2QDHA 5LKYA 5KTLA 1W5QA 3P8JA 2FIQA 1GEQA 2CW6A 4ZMGA 5K9CA 3G22A 1F6PA 1V7YA 4MLRA 1UCWA 3M1ZA 3MBFA 3GR8A 1B3OA 3TNOA 3B0UX 2QJIA 1ZAHA 1EX5A 4HPJA 1I2QA 1TTQA 3BG3A 3EWZA 3NQMA 3TX9A 1M5WA 3C4UA 1T99A 4GUJA 1SO4A 2V81A 2QAFA 1TIMA 1W3TA 3AJXA 1XFBA 3O63A 3R2GA 4DELA 1JVNA 1WBHA 4QNWA 3HIJA 4Q33A 5KITA 1JRCA 1OF6A 2J24A 3IRDA 2CLEA 4I7WA 1EP2A 3KVMA 4N9EA 3OIXA 1JCYA 1F6KA 2Q3OA 3SR7A 5LGZA 1H5YA 4MY9A 1EB3A 1AW2A 1Q6LA 2A1YA 2OX1A 3GDMA 3S5OA 1W1ZA 3LTPA 1MSSA 3MP4A 3N73A 3MHGA 4O54A 4QJ1A 3MWAA 4UFHA 4IMCA 5D04C 3S9YA 5D03A 1XI3A 3B8DA 1PIIA 5C55A 4JICA 2H90A 3A9IA 3DKLA 3H54A 3N2MA 2WKJA 3OVPA 5D30A 4E2BA 2J9XA 3W7EA 2F84A 3A22A 2WNNA 2C14A 3TE9A 3WK1A 1TPH1 3G8RA 1OK6A 3G0UA 5HUOA 2JKAA 3SFKA 1A53A 1BWKA 2FFCA 3S1UA
chains in the Genus database with same CATH superfamily
1KFBA 4G56A 4Y8EA 2YA1A 1BF6A 3V7PA 1WKDA 2H8ZA 3QGAC 4AIBA 1UP3A 1XDJA 2FGZA 4WDTA 2G3MA 1EXBA 1XV8A 2XM1A 2EPKX 3W7LA 1PZ1A 3VOFA 3CHDA 5G1MA 1ZCCA 3IJDA 3IVTA 1Q2RA 1E4MM 1EYEA 1J12A 4RDYA 3UGVA 2BOEX 4J3TA 2YZRA 3LK6A 3CMGA 5IOBA 3BQ5A 3GHSA 3OYXA 4NJHA 1HKIA 1JYNA 3K13A 3DCPA 4FLQA 5K4ZA 3WLIA 3KVJA 1QK0A 4QLLA 3AYVA 1HO1A 4LC6A 3VC5A 3NPVA 4O12A 3QM3A 2BTMA 3C8FA 4BF7A 3NYDA 4UR9A 2W6RA 4YL2A 1SJDA 3HZ3A 2X8RA 1QO2A 2J7HA 4QISA 3FYPA 4DLMA 2EEXA 3ZQ9A 1UBPC 3FGCA 3UZXA 1DJQA 3TYUA 2X1RA 2WB5A 3LNPA 2YA2A 2NVDA 2GGJA 3LQGA 1K9TA 1QWKA 1LOSA 6TIMA 3T2OA 1JDEA 3CS2A 3POCA 1JF6A 1ZBCA 1KXVA 3UZYA 3PJXA 3SGUA 2FTYA 3ZWSA 4L6HA 1S2UA 4NZ4A 1JCNA 3KL5A 3I4EA 2BMBA 2IPWA 1S5MA 3VNIA 4DXVA 1U22A 3RDKA 2Y6ZA 3AWOA 4AC1X 4IMAA 2BFGA 5C2XA 3FEMA 5AB3A 1NF0A 2E6YA 3H2EA 2QS8A 3LI0A 4MY1A 4DO7A 2E6AA 3JZUA 3R8GA 2ZUNA 4XKYA 1IXPA 1KQYA 3GTXA 2E77A 2V2DA 1XDLA 2HXUA 1K9EA 1NELA 4CD7A 3EWCA 2TSYA 1NWTA 1E4IA 3A6OA 5E0KA 4B5WA 3Q67A 5D02A 4Z2IA 3QSRA 4WKHA 1QNSA 5D8ZA 1ME9A 5BOFA 2QKFA 4E2OA 1FWFC 1V8EA 4JEQA 3VD4A 3WNPA 1Q3NA 1W1YA 1E15A 2C18A 4LB3A 2V5JA 4FLOA 3O9NA 3EDEA 1WP6A 4A8IA 1RD5A 3Q65A 4H2HA 1OSEA 1EJWC 3XISA 3I3BA 1E1CA 2FMOA 1TTJA 3WUGA 2FLIA 5EBUA 4C60A 1ELSA 4R33A 1LTDA 3WD2A 2CYGA 3GR7A 2XVGA 1IHIA 4PYSA 2JGQA 1A47A 1JXKA 4G7EA 3VX0A 4O57A 4ZR8A 2XU2A 3BSHA 5IBXA 1F05A 1QPKA 2WHLA 2WMGA 2G8ZA 4I8DA 4AYSA 3F2DA 4W87A 1GJWA 2HRWA 4PBGA 1IE7C 4KFNA 4BQ2A 1A5KC 3LPFA 3T09A 1FWNA 4GZJA 2ZZ7A 4B5XA 5FL1A 3I3EA 1DBTA 2GWGA 4J2PA 1FCVA 2HE5A 2QJJA 3WF2A 4RXFA 2ZUSA 5F2GA 3DESA 4E2VA 1HJQA 3LA4A 1E51A 1XQLA 2P8BA 4DJDD 4GQ0A 4F66A 3P61A 3SRDA 3WLMA 4LEQA 3K4WA 3B8WA 2WMIA 3LV5A 4NNAA 2PDLA 3P14A 1HTIA 3QQWA 3TTQA 3KBMA 3INPA 1OYAA 2ZFAA 1NQKA 3GDTA 4DBSA 3M41A 4ZQNA 1UD6A 3WK0A 1WAWA 3N17A 9CGTA 2XHYA 4GC3A 3AMDA 2JFEX 3QPYA 2INEA 2I9EA 2RDUA 3PB2A 4LF1A 2F6XA 4DI8A 4B4FA 1W32A 3G3DA 3VIHA 3UXDA 2DVXA 3B05A 1LP6A 3VUPA 2W3ZA 4AD3A 3CBWA 1H1NA 3MUIA 3M5VA 3M5YA 1BKSA 2OSXA 4MADA 1S5TA 3ITLA 1TR9A 4HMNA 1E6PA 3A12A 2PDBA 3PBMA 2VFGA 3DG3A 4UMBA 4OWGA 3LS9A 4KRTA 1G4EA 1KFJA 3PPFA 4PFMA 3LMYA 4KRUA 3F2CA 3CAQA 3ITGA 1KR1A 3VD5A 2VQTA 1FKXA 4DNHA 1HGYA 2B7PA 4MZ8A 3W73A 1TVPA 4HYRA 4H7CA 4MZ1A 1HKMA 3CB3A 2I5QA 2R1NA 3C2VA 3CZGA 4FHAA 1TMLA 1D7KA 3NDYA 2D2JA 3WDRA 1R30A 3HURA 4A8NA 2RDWA 3W7KA 4LCRA 1BG4A 1V93A 3N1AA 3CMFA 1U33A 2NVAA 1XLIA 3MMWA 2FFIA 4F9DA 3WLTA 2GUBA 4EPBC 2ACSA 1ITQA 4MB3A 4DJFD 3IJ7A 1LYXA 2YCLB 3B9AA 4ATWA 1WE5A 4PUJA 3VOHA 5H8MA 3KDOA 1JGMA 4C1NB 5HXMA 4O10A 4IXXA 3IGXA 1Z6KA 3BLKA 3NPUA 4PUUA 3UQNA 1A50A 4ACZA 3UJFA 2ZX9A 4Q8OA 1KRAC 3DU0A 3ATYA 5I03A 1ISVA 5CC7A 2YSWA 2QJHA 1M68A 1KTNA 3IJ9A 4K39A 4IGHA 2RDTA 4F0MA 5M3WA 1JPKA 3UETA 1MW3A 3NIYA 2P3EA 3UCDA 1IGSA 1N2VA 1VFLA 4LTSA 3RCNA 1VZWA 4PH6A 5C6MA 1W1A1 2HS6A 2XGBA 5GJPA 4D8AA 3KLKA 2QYGA 1TFVA 4EAMA 1KD0A 4FS9A 3VDAA 3BLFA 4RPQA 4M1RA 3E2QA 4DNMA 4KETA 4WUIA 1TVLA 3QMRA 2FTPA 2AL1A 1PEZA 2I16A 4FMVA 4S38A 4LNCA 2WJDA 4POCA 3RPTA 3W24A 3H26A 4O8RA 2WMKA 2J4GA 2NUXA 3GKFA 1NOFA 4LB4A 1RHCA 1UWRA 3WMCA 3ZT7A 1ONXA 4ZBCA 1R3YA 3W75A 4JTRA 4IG2A 3ARVA 1H7OA 4OZOA 3C2EA 3SUSA 3URBA 1Q66A 1AUSL 1VF8A 1K7EA 3LOTA 3I7RA 1Q7MA 1WO2A 2OZ3A 4ML9A 4Z0SA 4DUOA 4AZ7A 4C6DA 4B91A 2VGIA 1FH8A 3GLCA 1VYPX 3NL2A 2PTXA 1JPDX 2XJ7A 2FHBA 1EJSC 1UR1A 1VCVA 2Y24A 1A4MA 4RXGA 3AAMA 5I07A 1KCLA 2WO5A 3DUGA 3R4IA 3IK4A 5AHEA 3H4WA 3FFSA 1BG9A 2NV1A 3B40A 1BGAA 3UVAA 3O16A 4TVCA 1JDCA 3IJIA 4B90A 1D3HA 5CSUA 4IP4A 1HJUA 3LEPA 3TMQA 3OA3A 3A4XA 3R12A 4PMRA 4Y7EA 1HUVA 2A7RA 3CWHA 4CN1A 2P0IA 5M03A 4UCGA 2OYKA 2XWDA 2DUAA 3W7CA 1JZ4A 4DAIA 2VGFA 4LS1A 1S3TC 2ONEA 3M47A 4GIEA 4MKSA 4X22A 2OWWA 1F61A 1P0KA 2XVNA 3HMJG 3S46A 1KCZA 4PB3A 4EXAA 2VJXA 1RCOB 3O6DA 3BW3A 2DZUA 2QMJA 1D9EA 3VD7A 4X9SA 3N2XA 4BI7A 3UCCA 4H01A 1TV8A 1I4NA 2OT0A 1EZ2A 1OIFA 5A8MA 1LG2A 4CCDA 5CGTA 4LWWA 5KEZA 3V1PA 1V3MA 3DGRA 3HGJA 5AFDA 1BXNA 3L4VA 4HGXA 5H2ZA 2EPNA 2E8YA 1V6YA 5D9PA 1VQTA 5JXQA 1YNYA 3DFSA 4TV6A 5A8NA 3CAVA 4MUPA 3NOEA 3LZ3A 3G1SA 2WC3A 3FN9A 5A6BA 1E0VA 5XIMA 5C0QA 4AWTA 2V2CA 3LENA 4XUYA 2OFJA 3URQA 4CU6A 3WQPA 1HVXA 3SO7A 3BICA 4BS0A 1QPRA 4L7ZA 1EYWA 4Z1BA 4R34A 1FWAC 1TRDA 2FDMA 1IIGA 4YCPA 3QJAA 1XIDA 3V1HA 4Z2GA 1A3HA 1V02E 2WLZA 1E70M 2DZXA 2MUCA 5AKQA 4M6UA 2D23A 2V68A 4RZ4A 3OYZA 4ORIA 2QPUA 2ZX8A 5XINA 3DI1A 3GFXA 4C6JA 4DI9A 3F7JA 1NF7A 4PSRA 4EK7A 1MQRA 3HV8A 2QDDA 3IIVA 1M01A 5LIKX 2GDUA 4JCMA 1BXBA 3KVLA 4GO9A 2WSYA 3T0AA 3GR4A 3RLVA 2OLSA 2PGFA 3NAVA 3PPHA 3W71A 3H12A 3QQ1A 4L80A 3BAWA 4QJ3B 3AICA 1FHUA 4J3VA 2AQOA 2FQIA 3A9BA 3P81A 3USZA 2V3GA 2CLKA 2D2GA 4H4IA 1PE1A 4HNTA 1BVWA 4XV0A 2ISVA 1WCGA 1OCNA 4O52A 4MWAC 3TVAA 5CPLA 3N13A 4FNPA 3W29A 1E1FA 5I06A 1W1VA 5IDIA 4HZ6A 3G1RA 2YB1A 1H7PA 1GQIA 3VE7A 3CXOA 4U33A 4CU8A 4H6EA 1M03A 2W67A 3QF0A 3SQLA 2VZVA 3AUOA 3FA5A 3ZLHA 2EQDA 4IIDA 4WY0B 3U8GA 4MVAA 4GX8A 3P0XA 1TREA 3RUBL 1TG7A 1XDMA 4YTQA 1GW9A 4P7OA 1PTGA 3PUGA 1AG1O 1ME7A 1E6ZA 4PMJA 4ZGYA 4TR9A 1RJQA 3O1NA 3QYQA 1X8CA 2VX7A 1MNZA 3C61A 3LHWA 5HAOA 3M0YA 7XIMA 1B4KA 4AXKA 3W4RA 2V5DA 1GTHA 1XLHA 5G1TA 2XFYA 1MNSA 7REQA 5B7YA 2BOFX 4DO4A 2F6KA 1FA2A 1LWHA 4IMFA 2ZXBA 3S1XA 3GUGA 1VGAA 2A3BA 3CLMA 4JIQA 2NQ9A 3P8IA 5BMXA 3B0PA 2FGLA 4I5RA 4QQUA 3OW1A 5HMDA 2CITA 1TPC1 4JXCA 8XIMA 1GPFA 1PX3A 3RFAA 3AMGA 3RHGA 5T9BG 4GQRA 3NSXA 4PCSA 2A3LA 4D6DA 4BI5A 1IT8A 4XTIA 1GQLA 1MMFA 5BU9A 2C19A 2J7FA 2FPYA 1VRDA 2DIKA 2HK0A 4QIUA 2NUWA 4AVFA 1Z42A 3PN8A 3NO5A 3WF4A 3AIQA 1AMKA 1V0LA 4J3SA 2QT3A 3D47A 3WNLA 1H7WA 3QKEA 3SI9A 2YIHA 2YGYA 4YTUA 3KTSA 4KGLA 2BVDA 3GSMA 4MHBA 1SFJA 3M0MA 5BOEA 1K8CA 4YVVA 1VBJA 3WNMA 1OYBA 4ATDA 4C6FA 5CZJA 1XRTA 2J6XA 5HINA 1VRXA 3BZJA 1NEYA 1DV7A 2NSOA 2CXEA 3S83A 2V3DA 3M44A 2H9AB 1WAUA 4DN1A 3R11A 1QCWA 1XR2A 3W6MA 3LN3A 5HNUA 4XZBA 4JIIX 3L68A 3DHFA 2NLIA 3BLEA 3CZKA 4C91A 3G1VA 4HU3A 3UXIA 4XD3A 3GH4A 2A85A 3EX6A 1C8XA 3JRKA 3QXBA 4GYFA 3GNRA 3K5XA 3PBWA 1DJWA 3G1XA 3W7PA 1AODA 3QW4B 4IL0A 2CLOA 2ACUA 3L21A 1BF2A 1JCLA 2OQHA 1MWOA 4B5SA 2G37A 2WSRA 1GGOA 1RZMA 4IIHA 3LGEA 3T8QA 2E5DA 1S5WA 3EWDA 1JXJA 3LCWA 2ZZ5A 2O7SA 1EPXA 2PGEA 1ZP4A 4AZ5A 5BNKA 4IXHA 1FXQA 1V7AA 2YCKX 1F5ZA 1XW8A 3VM5A 2Y63A 3TYBA 4N9BA 3WQGA 3TLLA 1PXGA 3SDOA 4M0XA 4AZ6A 3AHVA 1MZRA 1AFSA 2E8ZA 1TQXA 2WSPA 2GOUA 1WDDA 1K6AA 2QQ6A 4S3EA 2PBOA 3P60A 1FOBA 3E49A 4GNKB 5EA9A 3VKKA 1B3WA 4JFVA 4TX9A 5F2LA 4AWSA 2XGZA 1SSDA 2FVMA 2QJGA 1BLIA 3UR5A 4NHVA 1HNYA 3D46A 3KRSA 4JDBA 1E5NA 1FUYA 3KS5A 3APTA 1QAPA 3VVGA 3S5SA 3EDJA 3DFQA 2ZC8A 1KM6A 1Z41A 3GYCA 3OG2A 3YPIA 3CWOX 3DYMA 4H83A 1AZ1A 3RM4A 3VOCA 4PODA 3ZJKA 4OOUA 1T41A 3LLFA 4S23A 4UMCA 3W87A 3VZXA 2G3JA 3EPOA 2R14A 3QV9A 2VVNA 3BOLA 1PIFA 2OKTA 5DLCA 2O9PA 5EFDA 2R1KA 1WUEA 4A8RA 4JY9A 3C2RA 1RV8A 4DLFA 5F2MA 4ZENA 3W7QA 5JBEA 3G1DA 1L9WA 1IR1A 1XLGA 1F8MA 1IEVA 3S5YA 4FO4A 4MFEA 4CVUA 2CHNA 3H22A 1YPFA 3TJ4A 4LS0A 3QPEA 3TQKA 2YBVA 1YYAA 5LXXA 1TMHA 1G0CA 1B5TA 4FR1A 2A7NA 3TN5A 3NYZA 4GI9A 2GGEA 4B5VA 4MUZA 2GJXB 1GCYA 1XIFA 3PULA 1PKLA 2CKSA 4ERAA 1LLZA 1SPQA 1THFD 3U7BA 4LVFA 3MO4A 4Y9PA 3LRKA 4LUSB 1IYXA 3N2CA 1U83A 3QFWA 4KCVA 4Q4QA 1V0NA 4XO6A 1CXHA 4Z42C 5D2VA 4JNZA 3WY1A 4JTQA 3O06A 4L1XA 1QTWA 2VR5A 1N7KA 3VE9A 1WZKA 4RKAA 4BQ4A 3V5CA 3VKAA 2WQPA 1P0EA 1MXDA 4FK9A 1HL8A 5KSWA 1KRCC 1TV4A 1UH3A 1X7FA 4H9YA 4PTDA 1VHNA 1XIMA 1PB0A 5LSMA 2PCEA 3ZSTA 3QR3A 3UERA 3R13A 1RCXB 3TYZA 3ARQA 2CEQA 3R0KA 1E0UA 3W6YA 1J10A 3BLPX 1P7TA 4JTFA 4ZOEA 2POZA 4US5A 4M6QA 3VCNA 2WCAA 4NJJA 1PO9A 4YTRA 7CGTA 1IQ8A 5RUBA 3QLDA 4W5ZA 3QN3A 2O4QA 3WEMA 1KBJA 5GJNA 2DT3A 3VU2A 3WQ4A 3BJFA 3EOLA 3KZPA 2OODA 4LJ3A 1QT1A 3RGTA 2IKHA 1FY6A 4V2XA 3FY1A 3BW2A 3BG9A 5D4YA 4YHEA 3RILA 1D7FA 1ZSXA 4Y8FA 4GG9A 2OQYA 4LU0A 1NFPA 2J47A 1NDYA 2VCCA 1V6XA 1O6IA 5AC4A 3V75A 4MDPA 4C6QA 1K1DA 4C6NA 3D6NA 2QZRA 3OQ8A 3POHA 1T5AA 4DM2A 1PX8A 4OE7A 3TWAA 3DBNA 3PZOA 3U2CA 2E68A 2NVCA 2QMKA 1OC5A 2VHLA 2MNRA 1GZGA 5LNVA 3UGRA 2IXVA 3TA6A 4S3GA 2J25A 3LXAA 1QI0A 4LY4A 2EPOA 4HPNA 1I75A 3AFBA 3DFPA 1EL3A 4F0LA 2DH2A 1U5HA 1JAEA 3SJNA 4ZQCA 1EDQA 2OEMA 1FWTA 2VGGA 3GTFA 1J0HA 4R7OA 1H7NA 2BX7A 3AROA 1KLZA 2PMQA 3REQB 4HZMA 3TW6A 2TYSA 3VZYA 1OX5A 4BCEA 1FDJA 1ZQ5A 1TJRA 3E02A 2BG5A 1TUFA 3HPSA 2DGAA 3N9RA 2GSEA 1A3XA 2VR2A 3HOJA 1PKMA 4ZFCA 1J9YA 2WHMA 2ZUWA 1V03A 5I3IA 1Q65A 4IQDA 4O50A 3RCMA 1Y5WA 2VFHA 2X40A 2HPIA 1AQFA 3DAQA 2C15A 4ZA0A 1MUCA 4HZ8A 1SR0A 4DWSA 1KM4A 1RY0A 1KM0A 1EC9A 5EGRA 5E93A 1I2RA 4KS0A 3S4TA 4R53A 4DYJA 3CJPA 2WSKA 5LNSA 3CQ0A 4O28A 2WOQA 1OZQA 3W00A 1TUXA 3DX5A 2F6UA 4AD4A 2HROA 1XLEA 4JN7A 2YL5A 2X09A 4PL1A 4FNQA 2WZHA 3F2BA 1G5AA 1QI3A 4QXIA 2B7OA 4FX8A 4LS2A 1IXNA 3W7IA 3WLOA 5MF5A 3F4DA 1TRIA 2W62A 5D2WA 4F0SA 9XIMA 1EGVA 1ZLPA 1SO3A 1XLKA 1X6UA 1ONWA 4C6BA 4XVEA 2P8CA 2P76A 3K1GA 2A5HA 2Y2WA 1HXJA 3U0HA 4LX4A 4Z1CA 1K8ZA 3CEPA 2GVYA 5I2UA 3V5FA 2D24A 4IUGA 5ABFB 5DXYA 3BOFA 4RDWA 3R89A 3M6DA 2PA6A 1POJA 4HA3A 3A5VA 4KPLA 5TBOA 5U4NA 3IARA 2Z2AA 1C7TA 4I9AA 3ZR5A 3WJYA 1QNRA 4LYRA 4FNRA 3WMSA 2A3EA 5D8WA 1MW2A 1FRBA 4M29A 2VENA 3QC0A 4UR8A 4L56A 4N4PA 4FLSA 1NM9A 2CLLA 2VEIA 3E0VA 2QVHA 1RP9A 5AY7A 3SN0A 4JIPA 3SY5A 3WBAA 1A5CA 4HU8A 1M7OA 5FA5A 4ADUA 3OG3A 4X63A 1JGIA 2XSBA 2BNJA 4NSBA 3JU2A 1IEIA 1WZAA 2ZRXA 1U1UA 2Q8ZA 1NWRA 5U7SA 4AZIA 3QTPA 3VCRA 3BAJA 1XC6A 3BCFA 1LQAA 4MY8A 1WX0A 2Z00A 3W2UA 1DJIA 1E9LA 2VZUA 2ISWA 4J2MA 4JCLA 7TIMA 2V5CA 3FIGA 2C0AA 4OOZA 4PC8A 2OO6A 3FV9A 1OCQA 3ME3A 3AYSA 2V5KA 3WD0A 1XH2A 3F5KA 2J7GA 4ZO8A 4DJDA 1GPWA 3H7VA 1E3XA 2O56A 3PTQA 4FNSA 3M0KA 2WWCA 4QE1A 2WNZA 4PULA 3WQCA 4PTXA 2RGLA 1E6QM 4HN4A 3IGUA 3I65A 1G9HA 5BOOA 3BV7A 2WVVA 4PUNA 3P0WA 4GQBA 3RM8A 3TN3A 4FOJA 5DCDA 2PDUA 2Q02A 2PCQA 2O0TA 5I7GA 5CAHA 4OFCA 1GQJA 2PP3A 1J18A 2QXWA 2Y5JA 3CHCA 3ITYA 3LPOA 4PUDA 1H1ZA 3RLGA 7PTDA 3B04A 4XZLX 2J8FA 2VKZG 4GFSA 5HBFA 2D0FA 1FCBA 1JYXA 1YNPA 5E0FA 2EJ1A 3MJMA 4Q22A 4L5ZA 2ZA3A 1BHGA 4NY2A 3T42A 4JTAA 4NILA 4MNKA 3M46A 5LHFA 4QSFA 3UG3A 3GDRA 1PDYA 4DF0A 4O0QA 5F2IA 3WBYA 1UWUA 1M7PA 4N4QA 1KV5A 3RM9A 4PFHA 4Q4RA 3FVMA 3KOZA 4M7SA 1W2PA 1X39A 5EKYA 1N8FA 1UUOA 1FFRA 3HU7A 1JYVA 4ILSA 4KFOA 5I79A 1PUDA 5AZ1A 4GUFA 3QV8A 1KBLA 3TJXA 3HPFA 1DJGA 1FWCC 3CAKA 4PUWA 4B5TA 4GC4A 2YA0A 3HQPA 1VH7A 1KKRA 2EBNA 2YDSA 4KT2A 3M9YA 1KM2A 1A0DA 2QCEA 1U5JA 1DHKA 1X6NA 1W5QA 3P8JA 1E1CB 3N18A 2PDIA 1V7YA 3M1ZA 3MBFA 2Z1SA 1B3OA 3B0UX 4DIAA 3TC3A 3PFRA 1ZAHA 1EX5A 4HPJA 3RJXA 3AS2A 1Q5MA 3PPCA 3TOPA 2CHOA 4ROQA 5CLWA 3QR0A 1TIMA 5A6MA 3O63A 4DELA 1JVNA 1WBHA 1J2BA 1GK8A 5KITA 4NKCA 4H1ZA 4I7WA 2Q3OA 5LGZA 3GVRA 3AC0A 1JCTA 5BZAA 2A1YA 4ZOBA 3U2ZA 3ZLGA 4TVDA 3MQTA 3P93A 1J5SA 2HNHA 2ON3A 3MZ2A 3QY8A 3MWAA 4UFHA 1E56A 1KC7A 3S9YA 1YQ2A 5IHRA 3NXLA 1JPHA 1S38A 4J3XA 3VNKA 1ESWA 1XLDA 1VB9A 1EJUC 3N2MA 3ORWA 3GTHA 5D30A 3GNOA 4PMVA 4E2BA 2F84A 3FHQA 4H9UA 3WK1A 3G8RA 1OK6A 1SJAA 3G0UA 5HUOA 3RN6A 1IGWA 4ERGA 4XD5A 2QCDB 3I6RA 3EX2A 5REQA 2YLAA 3KL0A 3QHOA 1EF3A 2ZRUA 3NZPA 1TPVA 3ZT6A 3PPGA 3WH7A 3WUBA 4ZCWA 4Z2HA 3KRBA 3CASA 1UKSA 1QW8A 3N3TA 1KFEA 4AH7A 2V30A 4DJDC 3E6EA 5A8QA 1PDZA 3UT0A 2D0GA 2VRKA 1H0IA 1D8CA 3G1FA 4KKXA 4V27A 4YJ5A 2BDQA 2DZAA 1POKA 1XPGA 1ONEA 2NX3A 1ALDA 3UXLA 4WGXA 1AMYA 4HIBA 4GQGA 4AIUA 1ZJHA 1PZ3A 4OGZA 3RPDA 1Y5VA 1B3VA 4QE5A 1ENUA 1NDZA 3EMCA 4FF5A 5A6TC 4LFYA 1RJRA 4JHOA 3ENLA 3DFTA 3EB4A 3IGHX 4HOZA 1MXSA 1S1PA 5EFFA 1XF0A 3PZGA 2J8GA 5E09A 2W91A 3W37A 1D3CA 2RH9A 2EKCA 1NDWA 1B3XA 2X42A 4XO7A 4UMAA 2DPEA 5FJUA 3FLUA 3IJ8A 1BGGA 4NJGA 2O9RA 1T6MA 3M16A 3WK2A 3GO2A 1EJVC 1PPIA 3ID7A 4CD6A 2VC7A 3CH0A 4BWLA 4LT9A 1QDSA 1Q85A 2PBGA 1UJQA 2B7QA 4WD0A 4FOKA 1VS1A 1GHRA 4DRSA 4LUTA 2Y1HA 2Q71A 4X0VA 1DVJA 5AN7A 4LRSA 4U4MA 2OGJA 1TV7A 2G96A 2DY3A 4U10A 3TYCA 2R1PA 1I1XA 3FJ6A 3QH2A 4YCOA 4IFKB 3CK5A 4GY7A 2Z1KA 1B54A 4Z2KA 4LC8A 4JTJA 1B30A 4OVXA 1OABA 4LPCA 3LCFA 3PBGA 3N4AA 3WCZA 2BBFA 4EXBA 1FHLA 4JNMA 1RA0A 1G69A 1Q63A 4F0RA 4JIHA 3SZ8A 3DC0A 4I7UA 2C91A 1KA9F 5A2BA 4PMOA 5DBUA 4C1KA 1GVFA 2OJPA 3NSNA 2QGHA 3MVIA 3UA3A 4DBWA 1V0MA 2F8QA 1HN1A 1S1RA 4XSLA 2Y7GA 4FX7A 5EMKA 3EX1A 1SW3A 3K30A 4GYJA 1AH0A 4K1WA 3WMBA 5HJLA 1ADSA 3TTYA 4KWVA 3SW6A 3L12A 5ECVA 3JR2A 3UNTA 4CNOA 8XIAA 3E1F1 3UR2A 5IFPA 3M64A 4QQ3A 2BHZA 5AHNA 1R5YA 4UR7A 4L4OA 2XIJA 3WNNA 2WV8A 4GGBA 4GBDA 3WO8A 2QULA 5K4XA 3L23A 1KW1A 5I3KA 3TNBA 1Z8AA 1DTNA 1V77A 1E3ZA 4U31A 1JCMP 1Z48A 4MWAB 3IACA 3MP5A 3MY9A 3BCDA 2VC5A 4GZEA 3PWAA 4IFOA 3EA2A 4MYAA 4URIA 5FL0A 4Q8VA 3LGDA 5DMMA 2WPBA 1ZGDA 3UWWA 1ME8A 2CZ5A 4OIFA 3NZQA 3KS6A 4ZEPA 1L6GA 1V4YA 3MKKA 1C9WA 1XLBA 1L6WA 3TSBA 5D33A 1J8VA 1JDFA 1VP5A 2XN2A 3N4FA 4QEHA 4MZYA 3SAZA 4LBRA 2OPJA 5FEPA 1EO7A 2B4GA 2CXGA 1DWHM 3S9IA 2ZA2A 4I5UA 4K8EA 4QGCA 4AX6A 2NT1A 2V2HA 3CYJA 1O95A 1TA3A 4EPDC 3IS4A 1GOKA 5BRQA 1R0MA 5GNZA 3V0UA 1S2CA 3SUVA 4GVHA 4Q7IA 1O68A 1ICPA 3H2AA 2CLHA 1FWBC 3DYPA 3VIIA 1ISZA 4MNJA 1RCQA 4NZCA 1GKRA 1GJUA 4YVPA 4RLIA 4ZODA 4NNCA 4IF2A 5IXEA 2WVSA 5JIPA 1JYWA 4ZVJA 1E4NA 1OK4A 3GBDA 1OIMA 2HVMA 4EE9A 1CGTA 3EB3A 2NV2A 2WANA 5FD0A 1VBGA 1RQBA 3HA1A 2E7FA 4QNEA 4BWLC 3LI1A 4XD6A 4ASTA 2PFHA 3UCQA 3WQ5A 5A6AA 1XIIA 4EF8A 1TCDA 3TN4A 3O07A 3VGHA 4N02A 1R7AA 4A6GA 4GI4A 2QVNA 1TCMA 4FXFA 1QW7A 4ZO7A 1F9CA 1WXJA 1OB0A 4GI8A 5A1AA 2VD9A 4D1JA 3ARUA 3TN6A 4A2RA 2NW0A 5M2FX 2A3CA 5HUPA 4WIWA 3TC6A 4LNYA 5FEWA 4JZ5A 3W7JA 1VC4A 1VIZA 4FB7A 4FSAA 4LY8A 4FIQA 3KWXA 1OFAA 4AVOA 1LM1A 3S2JA 3T05A 3PZ9A 2PDHA 4Z08A 5FF2A 2DSVA 1XISA 2ZTJA 4GJ1A 3VNYA 5G4EA 4HZ7A 1J2WA 1YKWA 3GUWA 1J0ZA 3O6CA 2BGQA 3NGJA 2GJNA 4ZL1A 1M7XA 1Y5XA 3RIKA 3PZNA 2ZE0A 4Q4MA 1OX4A 3MV11 1CW2A 4WHBA 3OU8A 2CLMA 3WYZA 3DECA 1F7BA 3P7YA 3S5NA 2PC8A 3OB8A 4P2VA 1GOXA 2TRSA 2J9ZA 4J1OA 4KW2A 2DIJA 4K38A 3CZEA 2DDXA 3AALA 4E2DA 5LNUA 1L6FA 4NAFB 1V02A 4H6RA 1KM5A 3UD6A 7ODCA 1UQYA 3ZR6A 2WVTA 4JAWA 4JX6A 2DVTA 1PCKA 5CSRA 3LXCA 3GFZA 1EWEA 4IISA 1AW5A 1SZFA 1H4PA 1ISYA 1Z69A 2C6QA 3W28A 1KRMA 2BHYA 4YTSA 3M0LA 5GPRA 4PUMA 1RP8A 2QUNA 1EJ7L 4C6OA 2GLKA 2O7QA 1EA0A 1KO0A 4D71A 4LAKA 3MV01 3S6DA 3VIKA 4PTVA 1BPLB 3R79A 1HJWA 2WZEA 3M0IA 2DW7A 4C6KA 3T55A 1QBBA 3QQ0A 1XLAA 4DB7A 4N2YA 3NEHA 5ABHA 3QC3A 2JF6A 4LF2A 3MUCA 1VYSX 2ZUVA 3A24A 5K3VA 3WL1A 1H41A 3M0VA 4K37A 3RU6A 3DH7A 3TTOA 4QITA 4W8AA 3VNDA 3WEZA 3B4YA 1EPVA 2PS2A 2C1HA 1LUCA 1RH9A 1CWYA 4WKAA 1R8LA 2TODA 4Z17A 2DUZA 5A6BD 1J6OA 1WBJA 1XBZA 3PANA 4C6EA 5CEWA 4M3PA 5CBIA 2AGTA 1Y0EA 2AL2B 3DG7A 4G5DA 3KBVA 5A6JA 4RCXA 4NL1A 3PP7A 3VNMA 2ALDA 3E5PA 3MSGA 4AEEA 3GHRA 4LVAA 1VBHA 5DO8A 2BP1A 1C92A 3LHTA 5HQEA 4NVTA 3G77A 5EMUA 4B5UA 4B9YA 4E8GA 4EX4A 3AWNA 2GVEA 3A47A 4JKMA 2CZDA 3VD3A 4K7VA 4K2SA 3T9PA 4L9ZA 3H21A 2PRMA 5D9MA 3BO9A 3FEQA 4JIEA 1VYRA 3TQPA 2J13A 4Z2JA 3BAIA 3SY1A 3TTEA 4QLJA 1LJYA 3SCPA 3CM4A 1UZDA 5E9AA 2XZ7A 4Q3MA 1BD0A 5BMWA 5L9FA 2CKRA 5GNYA 3GX9A 2A2IA 4EANA 3SFWA 2KAUC 5KINA 1R2SA 1SZRA 3PZMA 3CU2A 1OGBA 1RJPA 2Y70A 4I5XA 4NZ1A 4PMUA 1QWGA 4H8VA 1ZNNA 3SRHA 1NFBA 1WXZA 3E9AA 4W93A 1NWSA 5I23A 1CLVA 3CIXA 3LTYA 3CT7A 4R7JA 3MI2A 1GVRA 3LX9A 4GIRA 4MYXA 2B31A 3W07A 1LRQA 2V3FA 3SGZA 4C1LA 4QTGA 4P7RA 3URAA 3S2NA 4B4HA 1CGXA 3KW3A 3VIJA 1HF6A 2C71A 5DRIA 1YE6A 5DF0A 1VFFA 4IOTA 3S6OA 1E72M 3OVQA 1SSGA 2VCAA 2DEPA 4EF9A 2FHFA 3N15A 3UJ2A 2Z27A 3CNYA 4ADSA 2GK1B 3E12A 3WLSA 2DSKA 4AZCA 4HHHA 4WXZA 4BHYA 3TAOA 4KIEA 1UH4A 2CHRA 1X8FA 2C7FA 1TPUA 3RLHA 3NQAA 2XINA 4PMYA 5HQMA 4KWUA 2OR2A 1K8XA 1JNEA 1XKJA 2DP3A 2HNEA 4US6A 1KKOA 1E71M 4LCQA 3NEVA 3L4YA 1T96A 3UF9A 3VGBA 1IXOA 1FP9A 3WFZA 1XICA 1DKWA 1NU5A 2WM0A 3VIOA 2ZWYA 1JUKA 4UIOA 1QPQA 3VOGA 4FZIA 3W1MA 4CVWA 1LRTA 3Q94A 3ZO9A 3LM7A 1OFOA 3NWRA 3N34A 4LYPA 4CNSA 4LAMA 3PM6A 4N42A 4UCFA 2VFEA 1CX9A 4P61A 2Z7GA 3CH9A 4AEFA 4ONVA 4YIWA 1FWSA 2I1OA 4LVBA 1CYGA 5JH2A 3NFUA 1KLYA 1W1TA 1OINA 2WZTA 2Z2UA 2OYMA 2EG7A 2GQ9A 3WENA 4NT0A 2X0HA 1YX1A 1W8GA 2ZX7A 2G3IA 1AK5A 5SWUA 3BJTA 4J7RA 4GNJA 3AMCA 2A0NA 3CLWA 3NSMA 2PLCA 3TROA 1YRRA 3V3WA 3A4AA 3BV4A 1O66A 2VWSA 1CGVA 1V3IA 1YDNA 4AD1A 1LCOA 3MMTA 4RV3A 2I7GA 5BXSA 1QU4A 1V51A 2F38A 2PTDA 4Q4SA 4ROPA 5FF3A 3IEBA 2OZ8A 3GW3A 1V6UA 1BVZA 2XH4A 3KVKA 3KOFA 1W9UA 2Z2BA 4KH2A 2D22A 4GI6A 1EOMA 1S5NA 5D05A 3C3UA 5AECA 4Q6XA 4WGHA 3K8KA 3KAOA 3EDFA 3UWUA 1SO5A 1JZ3A 5MKGA 1EJXC 5K2ZA 4WOZA 3PAOA 1W9DM 2HVOA 5D9NA 4D6HA 1WQ5A 4OHQA 4AX7A 1CLKA 1O12A 1RLDA 4ZOCA 2ATSA 4IMDA 3W7RA 1O5KA 4R9OA 1VJSA 2VTFA 3M5XA 3N12A 4HKPA 3GU9A 3MSDA 3C2OA 3MA8A 2UY4A 4JTIA 2OOFA 1H7RA 5TNVA 3N2BA 1XSJA 2XYLA 3FNDA 3LPPA 4EACA 3FYOA 2W5FA 1AL8A 4GUIA 3LB0A 3KDNA 3IGSA 2R94A 1KB3A 4AYGA 5CPQA 1JPMA 2XIMA 1EQCA 3TC7A 4F2UA 3TXZA 3KZSA 2J77A 5CGMA 2PDKA 1S2AA 3SCVA 1XLFA 3MJYA 5TF0A 5CPSA 4E4FA 1XQKA 3AXIA 1H49A 2UY3A 4TXEA 1CECA 4HNVA 2VFDA 1XIHA 4OKDA 1R3VA 3VO0A 2X16A 1UW9A 1VJIA 5C7HA 3THUA 4IQJA 3QGKC 4GLEA 4L1GA 1OG6A 1J11A 1NARA 4Z1DA 3IJ6A 4K3ZA 1EEXA 1WKFA 3A3WA 4N6FA 3E2RA 2JIEA 1VENA 3LRLA 4GJJA 5AYIA 1X98A 3W74A 1P7TB 4DF2A 3SSJA 4JR5A 2GGHA 3WF3A 3CUXA 3RG6A 3SECA 3OODA 5I3GA 2BXVA 3AU6A 2VD8A 1CENA 1KRBC 2E1WA 1ZENA 3FOKA 3SN4A 1R86A 4KGJA 4AIOA 3U57A 5KZMA 1PKYA 2QV5A 3PBUA 4HMEA 4DZ5A 2FDSA 4UFLA 2DZPA 2PDPA 1QUMA 1YMYA 4YYCA 2G5WA 1GJPA 5EU9A 4EVZA 1XPYA 5DCBA 2YFNA 1XC4A 2VX4A 3PG9A 4YNGA 4UTJA 3AJ7A 4M24A 4XG1A 4CNUA 5DRCA 3UWVA 4GISA 3VYLA 1LOQA 4GACA 2KZHA 3WLPA 2VC9A 4O19A 1TJ0A 2XH2A 5I6SA 1GKQA 5D37A 2AMGA 4JX4A 4DY1A 4R88A 4D6GA 3DYOA 3W1RA 3THAA 2BOGX 1R46A 2ISSA 2NX9A 4ATLA 3HG5A 3WBXA 2A21A 2YDAA 2J6VA 5CC6A 3QEZA 5M1TA 3ZYZA 3ABRA 3B9NA 2XTKA 3O7UA 3GZ3A 4NI3A 3AQUA 3EYPA 2CBJA 2DZSA 3HO8A 5CJNA 5C9WA 4B9ZA 1I0DA 1OFDA 2VUYA 4RNFA 4WEVX 1FCUA 4S3FA 1GYMA 2GUYA 4NP7A 4DVOA 1DQUA 3DHUA 1W1PA 5K9DA 1ZCOA 3U2OA 3ZJ6A 3HGOA 4KQNA 1U5VA 5M5DA 1R9ZA 3CYVA 5DY2A 4LQ1A 2Z29A 3GIPA 3OPSA 4E8DA 2AKZA 1WV2A 3QPZA 2QW5A 5G2WA 3RYSA 1N82A 4Q6JA 1UG6A 3WJXA 2E9BA 3WLLA 1VCFA 1LL6A 3B0YA 1UOZA 2D3NA 4AZHA 4ZB0A 4V1YA 3WZ0E 4Z0JA 2GYIA 4REQB 4A4AA 5FI8A 3WH8A 4QFUA 4HNCA 2PEVA 4US5D 5K9XA 4YMZA 1UROA 3W1TA 5BRBA 4LOCA 4O15A 3TFCA 3CB8A 4LANA 5DELA 3VX1A 2NQJA 1H1YA 5FOOA 4AVNA 1TJ1A 3CZ8A 5D2XA 1KFKA 3NZRA 5T9CE 4A22A 3LTSA 1FTXA 2I17A 3PG8A 4CEUC 3OHIA 1AH3A 1RBLA 3AIRA 5I00A 2VZSA 4UB9A 1NJJA 4IIBA 3BK0A 3ZJ8A 1VD6A 4S3AA 3AS1A 3OBAA 4IIEA 3VDCA 3BG5A 1PJ9A 1HW6A 3FXYA 4JTDA 3WLRA 4J4KA 4JN8A 4XD4A 4CNTA 3S42A 1VAHA 2YX0A 1XWYA 1AA1B 4EOUA 1EDTA 1VPQA 3AIWA 3BLOA 3LYEA 3W1LA 1MEIA 5BRPA 3SURA 1GVQA 1EH9A 3GAYA 1FWJC 1VLWA 2NQ5A 4O1DA 1UOKA 3EMQA 1NP0A 1MUWA 3FAXA 1W37A 4ML4A 3AUJA 2FH8A 4B92A 3BAYA 4RNIA 2R24A 2DH3A 3NO3A 1RA5A 5EMYA 2VFIA 3A21A 2YL9A 3KCLA 4O16A 5AOUA 1SZNA 4NQ1A 3PR2A 4Q4PA 3MHFA 1XCFA 1Z3NA 4FALA 1XM3A 5DN1A 1G6CA 1UIPA 4Q8MA 2BXZA 3IV3A 2YCLA 3G8EA 4NZ5A 2G97A 1F3TA 2W61A 3CTTA 2PDNA 2VZOA 5FF7A 2J74A 1DTUA 4H9VA 3R94A 3VFCA 2YXGA 4C1NA 1Q4NX 1A80A 3BC9A 1XIBA 1EO5A 4XISA 1PYMA 3NZ1A 3UG5A 3U5UA 4RDVA 4DWSD 3BL3A 2GVJA 3GH7A 1FCQA 1ITUA 2DW6A 3K46A 3H70A 1EHNA 1JUBA 2QF8A 2QR6A 1XSIA 1DORA 4J27A 5DFAA 2ZDSA 1VEMA 2Q3RA 1RD6A 2QF7A 5TAOA 3IIXA 1YIXA 1DP0A 4OV4A 3ALFA 1N8WA 3HN3A 1ZU8A 3SJ3A 3N25A 3GDBA 4MWAE 5J8LA 4NAEA 1NOWA 2E6DA 3NM1A 1E73M 3GYEA 3CQKA 2DJLA 2J7CA 1Q6RA 3TWBA 3WQDA 2PD5A 4DF1A 4P7NA 5E6YA 1CXFA 3VD9A 1ZUAX 1C7SA 1OCBA 3LBOA 2DFAA 1J93A 1H3GA 1N55A 4UQEA 3GRIA 2IPGA 4GXWA 4EWJA 3IK2A 1ZJAA 1TWIA 2UBPC 5GQBA 3GBEA 4J9JA 2VRQA 2WJZA 3HJZA 3GKAA 3E96A 4RNHA 1TWSA 2A79A 4XAFA 3LLXA 3BPWA 1KGUA 1QOXA 3C5QA 3CHVA 4NXSA 6TAAA 2GWNA 4V1XA 3BTNA 5FEXA 3ZR4A 1MEHA 3E0WA 3ITTA 4ZFMA 1KM1A 1TPFA 2FB3A 4JQ1A 4JQAA 4J35A 5G4HC 3AS0A 4A21A 1UHVA 4Q7BA 4KWWA 1TPWA 2BODX 3W76A 3EXTA 4E6MA 5FSDC 3CT2A 2L5HA 1LT7A 1EKOA 3H53A 4K1GA 1VR6A 4PTNA 4IMGA 2YR1A 2YW4A 1SFLA 2W27A 1M65A 1JNDA 4O14A 3NXFA 4F8XA 4ZQPA 5LZLA 3QV6A 1CPUA 1JZ8A 2ABAA 3I68A 3UR8A 4KCUA 1IT0A 4ALDA 1I2OA 3URNA 4GZ7A 3WSUA 1AJZA 4Y6GA 4L6OA 4PB4A 3MO7A 3GHUA 4NIRA 1XJBA 2BY3A 2EXOA 2GOKA 3C8NA 4GX9A 2EO7A 3TSDA 1EJTC 1YBQB 4QG6A 2QCFA 2W66A 3LHVA 3T07A 3WNOA 2D2HA 4UFIA 2ISFA 3GB6A 4EWND 3BLDA 4O1BA 4H9MA 4L64A 3SQSA 1RBAA 2PF0A 1O7AA 1V3JA 4WRHA 5L6UA 4F9JA 3SM0A 2XVPA 4O18A 4B3ZA 3VDBA 5F7UA 1EX1A 1WKYA 4IJBA 3QSTA 4NZFA 4TTUA 4QDWA 3RJYA 3UVIA 3G2GA 5C9UA 3LRMA 5B7ZA 4O1FA 4XAZA 5E1QA 3DBPA 2P88A 1MXGA 2OKOA 1L6YA 3TSMA 4UQBA 2ASHA 4Z1YA 4GHRA 3WDQA 4P8XA 2XZ9A 3NDZA 1GZJA 3THCA 1G67A 2ZXDA 3IRSA 4CGTA 1JAKA 1PV8A 4AF0A 1TJPA 4RUBA 2OXNA 2DT1A 2HK1A 4ZQMA 3QMTA 1K8YA 1Q45A 2GJLA 5I3FA 3RRAA 5LIYX 4D72A 3MW7A 4R3UA 4O13A 2W9MA 1ONRA 3WIJA 4PA8A 1DOSA 4IICA 6XIMA 1OZMA 5D2TA 4J3ZA 3L0NA 2UZ9A 4ZE4A 3V0SA 2H3BA 3WJZA 3PUEA 1W5NA 3WF0A 3T4WA 4HNLA 2Y5SA 1ZJIA 3WFLA 1US2A 3TUUA 2VEMA 3NQ2A 2V82A 2QUMA 3C2YA 3NM3A 1KFWA 5DMLA 4H00A 3LGGA 5DQPA 1R3TA 1RQHA 2ZBTA 5AHLA 3HV9A 4JD4A 1SJBA 3BLLA 3VMOA 5C9XA 3P62A 3TAKA 3MUAA 4WY0A 3KBNA 2PWFA 2YYTA 1A0CA 1UD3A 3R6IA 5IBXC 4BF5A 3KBJA 1W17A 3KX6A 3GS6A 4UZSA 5I0DA 1QJWA 3PB0A 4V15A 3W84A 4DUWA 2AQWA 3FJ4A 3IUIA 4PBEA 1IWBA 4JTCA 4H7VA 2ZZ6A 3KCOA 4LUJA 3TCEA 1YDOA 1JIBA 5C9ZA 1GEQA 2CW6A 1XLMA 4MDOA 4KEMA 1LWIA 2CCRA 3G22A 4LYQA 4QS6A 3T0BA 2QJIA 4V33A 1KGWA 1QW9A 3BG3A 3NQMA 2WKGA 3EWZA 4C90A 3BMWA 3OZYA 4GUJA 1KR0A 1O5RA 2V81A 3SCUA 1W3TA 1P6CA 1XFBA 3N4EA 4B2DA 3HIJA 3B9EA 4Q33A 1OF6A 2J24A 1AH4A 2HV5A 1EP2A 1F6KA 3SR7A 3T0TA 1H5YA 1XHGA 1HL9A 1AW2A 1Q6LA 5DT7A 2OX1A 1W1ZA 2EPMX 1MSSA 1D8WA 4QJ1A 3H2OA 3H2NA 4IMCA 5D03A 5C55A 2UWFA 3RX2A 2JQXA 3DKLA 3W02A 4S3KA 4AU0A 3H54A 4CD8A 5A6KA 3OVPA 2J9XA 1FWGC 1VBRA 4DUVA 2C14A 2XIOA 2CIPA 4GGHA 3TE9A 4GFIA 4ZO9A 4AW7A 1A53A 1BWKA 3S1UA 3ABXA 3O0FA 2GUUA 2VX6A 3LCHA 2FMNA 1BYBA 1A5NC 5KZEA 1EP3A 1V0KA 4IPLA 1IEWA 3K8LA 1F6YA 3W7HA 1E1EA 5CPNA 1JCJA 4QE4A 4B16A 1TVNA 1LLOA 1EC8A 3KM8A 4IH3A 1IWAA 4MB5A 4F40A 3DFNA 3PF3A 3UPWA 1BYCA 3UA4A 3ZLFA 1J0IA 1YNQA 2VX5A 2V5LA 2F9RA 5JMUA 2H9AA 3OIHA 1DL3A 5E6ZA 3L5AA 1J01A 3CPGA 4FA3A 3QR1A 3EXSA 3TP4A 3ZVHB 3MBDA 5JBFA 2BV9A 4Q4OA 5CJMA 3LZ5A 3ALGA 4TMBA 1W9PA 2X1TA 3P5YA 1DJYA 1K9FA 2R1LA 3UESA 3TKFA 3FSTA 2PRLA 4YU1A 2PDWA 1CXIA 1B3ZA 3CV2A 9RUBA 1Z9AA 3N3MA 2WJEA 1W9BM 2ZDRA 4C7GA 2QCCA 4C6PA 4WR3A 2RJGA 3ABQA 1I0BA 3P6LA 4XWUA 5CGQA 4WSHA 2PLKA 5HWJA 3AXXA 4JYFA 1PSCA 1JRBA 3STGA 3ARXA 3DXIA 1A5MC 2J88A 4UTTA 2WQDA 4FNUA 4M81A 4CQBA 3ARPA 2PODA 3QZ6A 3MCOA 3N6QA 5EMLA 3OGVA 1DIEA 2V3EA 3NQDA 2OTDA 2QIIA 3PY2A 2XIBA 3VKCA 3SB0A 3NOYA 1MVYA 3TK7A 2Y62A 2CETA 1F07A 3B06A 1OX4B 2OB3A 3CQJA 1QK2A 1TR1A 2Z0IA 1UA3A 1JD9A 2ADAA 4AHPA 2J7DA 4DQWA 1KFCA 3IIZA 4JFTA 2PZNA 4Y2WA 1P1XA 4M80A 3F4CA 2F2HA 3LPGA 3P2VA 4XZIA 2QGYA 1LZOA 1R85A 3L4ZA 3DERA 3GVVA 3K4AA 2VR4A 3ZT5A 5CC3A 4HBKA 3N9KA 4I9TA 3VIMA 2IQDA 4XAPA 4BA0A 1MDRA 4NX0A 4C7FA 1VFTA 3FAWA 4YS1A 1TTPA 1YXYA 1K3UA 3VXGA 4DWDA 1PZ2A 4BF9A 2PRHA 1NOUA 4GYPA 3Q4DA 3SUWA 3VDHA 3E0LA 2PGWA 1XIJA 4Q8WA 2J27A 4IIGA 3PJUA 4XK2A 3T40A 2HS8A 3VZZA 4EKJA 2HVNA 3L2IA 3S2MA 2Q8XA 3MSRA 3ITVA 4GJIA 5LA2A 1A49A 2VO5A 3WDHA 3WUFA 1HKJA 1IEXA 2CZVA 1Q6QA 2D2OA 4A35A 4Q32A 5FCZA 4ZE5A 4JHMA 1Q6FA 4IMEA 3T6CA 3A5FA 3QOKA 3F4WA 3FS2A 1L2QA 4Z2LA 1EZWA 3VIPA 5AYXA 3GM8A 3EA1A 4QSHA 2HMCA 3U4AA 1MFUA 2DT2A 4DJED 3R1ZA 1LBMA 3W83A 3FKKA 3CHFA 2WMFA 3BGJA 4QJ5B 1XSKA 2GJXA 3D0CA 3IAQA 2ODOA 3OEXA 2ZYFA 3O6YX 1R2TA 3LCLA 4HQVA 4LUSA 2PDGA 4HSHA 3BCJA 4X9YA 3UWQA 3BSMA 4H9TA 4XIMA 2YOCA 1FH9A 1TQJA 4ZQRA 3KTCA 5I24A 1P6WA 4JN6A 3F1QA 5MHBA 2P3ZA 3T81A 3IVSA 4MPKA 5PTDA 1OD0A 2OCZA 3MSYA 2JEQA 4ZXLA 1GOIA 4U3AA 1JI1A 1UB3A 1H51A 3CUGA 1EWDA 4HP5A 3UR7A 1C29A 2CBUA 1XG3A 1R87A 4QCFA 2CNCA 3N29A 3XIMA 4S1FA 4RNJA 4LAZA 4PGLA 3O8AA 4Y9NA 3AYTA 2XH7A 2BZNA 4IFRA 3SCTA 1VFUA 2Y4SA 4IQEA 4FI4A 1F2JA 2I56A 2X2YA 4L61A 3L4XA 1OEPA 5F4WA 3PWIA 3CV6A 1JFXA 2WVUA 4HA1A 4YTTA 1EHAA 2YFOA 4G7FA 5EBAA 2ISDA 1AZ2A 4XTDA 2AGKA 2ANUA 4HCHA 4R9XA 1KFLA 1XH0A 1HX0A 4IX2A 4PZVA 1XYCA 1QI5A 4JPGA 3HBLA 3KLLA 3E74A 1GKPA 3QZEA 3F5JA 4H6KA 2VXNA 1XKYA 5CKSA 3A3HA 4C5YA 2WPGA 3L4TA 3W7NA 4CLMA 4FAMA 4JY8A 4H04A 5A6LA 4BKNA 4UZUA 4C6IA 1R3WA 3G18A 1XD0A 4UTTC 5ABTA 1GQKA 1V08A 1VPYA 3ANVA 3ELFA 2Y8VA 4F2BA 2XIIA 2BY0A 2AMXA 2ESCA 4HHPA 1HFBA 5FF4A 4GXPA 2IUZA 3NCOA 3SIZA 1SO6A 2C1GA 2G3NA 4WSKA 3W0KA 3PSWA 5GVJA 3BAKA 4CCEA 3R5EA 4NYYA 1OX6A 4GOAA 3TZNA 3N2OA 5CZKA 1NH6A 4FLRA 5IDZA 3UWEA 2OQLA 4GD0A 2VOTA 5I3HA 3SRKA 8TIMA 3G1YA 1B90A 2ZX6A 1UD4A 1IZKA 5A8OA 3Q2DA 2CERA 4R5EA 1FWRA 4KMQA 3GG8A 5LIWX 1M9HA 3MKVA 1UH2A 5BWFA 3WD4A 3LBCA 3REQA 3S3GA 2EGZA 3CTLA 5JH1A 2X30A 3EKLA 2Z26A 4CD4A 1L0PA 4HPGA 1C9DA 1ICSA 2BLEA 1NTHA 1W8SA 4E0CA 4H8UA 3W1NA 2P50A 1PVNA 2V69A 1JUEA 5BROA 3ISIX 4XVDA 1TZ7A 5AHFA 3UPBA 3ARZA 1GWJA 3VKJA 1A5SA 1YADA 5C2CA 4NXKA 3N6JA 1XBYA 5D9OA 1RUSA 5CZSA 3ARWA 4ICNA 5DT5A 4WJEA 4TVUA 4IWWA 4N9CA 2DORA 5FESA 1AD1A 5BXRA 1OFQA 1KWKA 4CCCA 2J9YA 3W2JA 5DX7A 1GVYA 3GU1A 3JUGA 2PTWA 1UMYA 5AHMA 1DIKA 1UR4A 2QUUA 1HJVA 2FTWA 4OBTA 1MW0A 4NJKA 1XXXA 5HR7A 1D3GA 4AZBA 3CUIA 3T0DA 3PZTA 3FDGA 3NQ7A 5BCAA 3AHYA 1H62A 2J8TA 3H4XA 1BQCA 3GIYA 4LALA 5BYWA 4H19A 1GG1A 1ZPTA 2X05A 2NLYA 5A8GA 3USBA 4AB4A 5H8PA 4FX6M 1HP4A 4LCSA 4PEKA 5HJXA 1FP8A 3BE7A 1TPEA 3EWWA 3W85A 5ABFA 2R8WA 3NR0A 4HHLA 1T8QA 1XIGA 3L9CA 3VFLA 3GDKA 3GFYA 4JTTA 2G50A 2PWHA 4NU7A 3O15A 4TOQA 3VNLA 3NQGA 3HM7A 4JKKA 4WSJA 3K8MA 4XZMX 1QMLA 1XYLA 4L4MA 4GVGA 2ZRYA 2JF7A 1SZEA 2DZTA 1W1B1 1VEPA 3W86A 4XX6A 1X96A 5IFTA 2DSWA 3GNPA 4UQAA 2WYSA 3N14A 3M4HA 1Q2SA 4PRWA 4RW5A 1BTMA 4F2TA 2E4TA 4TV5A 1ZB5A 1NVMA 3CQHA 4WJXA 1QVBA 3FA4A 3QMSA 5CPTA 1BAGA 3MANA 1HL2A 4K8HA 5HK4A 2J66A 3C86A 2G95A 2Q8LA 1H2JA 2G0WA 2PWEA 3EA3A 1S2VA 1UUMA 3WQVA 2O4MA 3ZS4A 1U2YA 1M3UA 2Y5EA 1QOPA 4UQDA 1LORA 1O1ZA 1WPCA 4JDYA 1YPIA 4K68A 4UOQA 1O94A 4JKLA 4UTUA 2DSZA 3M0HA 2OMAA 3WLQA 1ODUA 4NJIA 1UMLA 4PCTA 1OJXA 4O4WA 1KQZA 1TE1A 7TAAA 1SW7A 1XBXA 3MI6A 2Q01A 2PPGA 5CSSA 3BZGA 1KGXA 3KOYA 2H3DA 2Y89A 2YCJA 3CQIA 3PZVA 4N7QA 3EWBX 5HWNA 3OGSA 1YTEA 2ZQ0A 1WOAA 3NVDA 1W9VA 4HYVA 3B0VC 3FJLA 3D3FA 4HPHA 3NQ8A 1H60A 3ERPA 3WLKX 4DPPA 4CQ9A 4CQDA 4F0HA 3EGJA 1XLCA 5F1VA 3EWYA 1HP5A 1QNOA 3EOUA 3RCYA 3GG7A 1PTAA 1W9XA 1XP3A 3W70A 1OHLA 2H8XA 4JEJA 5DY3A 1TX2A 1CLXA 1UIOA 1TV2A 4FEZA 1CBGA 3ICJA 1XLJA 1F3WA 3GG1A 2REQB 1P0BA 1SYTA 2JKPA 3AIBA 2WLYA 1OF8A 4GBUA 4GMEA 3QBUA 3OVGA 4KEVA 1ITCA 1H09A 1OFBA 4HNOA 3NZGA 5EMJA 2YXXA 3QHMA 2PDCA 3RAOA 1YTDA 4EXQA 1TPB1 2VEFA 2Y88A 3H2CA 4W84A 3GU2A 3RX4A 2ZOXA 3HG4A 3AS3A 3WQ8A 4IUOA 3R25A 4I6KA 3GXPA 1UZ4A 2JE8A 4G2DA 5LXEA 2FJUB 1ODZA 3WUEA 1LL7A 3SBFA 3SN1A 3BMVA 3LBMA 2I9UA 1YDYA 1B57A 1F3EA 4MSSA 1I2PA 4R85A 1CTNA 4DEFA 3EWUA 1J5TA 4QLKA 2BXYA 1F8IA 4CD5A 3TCSA 3SQMA 1JI2A 3L0KA 1ADDA 5HOSA 4FR6A 3P84A 2GL5A 2WHJA 2DIEA 4HSOA 3OJGA 3SEPA 3PTKA 3R8RA 3S1WA </