1H1YA

The structure of the cytosolic d-ribulose-5-phosphate 3-epimerase from rice complexed with sulfate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
219
Chain Sequence
AAKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSLRKHTKAYLDCHLMVTNPSDYVEPLAKAGASGFTFHIEVSRDNWQELIQSIKAKGMRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-RIBULOSE-5-PHOSPHATE 3-EPIMERASE
publication title Structure and Catalytic Mechanism of the Cytosolic D-Ribulose-5-Phosphate 3-Epimerase from Rice
pubmed doi rcsb
source organism Oryza sativa
molecule tags Isomerase
total genus 76
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1h1yA00
1D9EA 1IF2A 3BW3A 3UPWA 3S5YA 2CLFA 5G5IA 2P10A 1VYSX 1OYAA 3Q58A 2E5DA 1WOBA 2B7NA 1QR7A 3KRZA 3RNDA 4LWWA 1E51A 1A5CA 2AQWA 3W9ZA 4MYXA 3W2MA 4UFJA 1FCBA 1H50A 3PF3A 3QJAA 5EMUA 1Z48A 4AH7A 4I7WA 4FNRA 1JCYA 1JUEA 5FF7A 5TBOA 3R8RA 3L5LA 3W23A 3I68A 3NQVA 1KLZA 3G1SA 4Y9AA 1XBXA 1TTPA 1FCUA 4ZVJA 3STGA 4LVGA 3VFLA 3QC3A 3NQ2A 1PCWA 3B4UA 2QCMA 4DO5A 1NEYA 4EF9A 3QPYA 3TROA 3EX2A 1TTJA 2DZUA 5CSRA 3C8FA 3PB0A 4GNJA 2JK2A 2ZRVA 4WY0B 5HWMA 4U4MA 1AL8A 3EWBX 3EX3A 1FY6A 3EWWA 1I2OA 2ZA1A 3ZWSA 2ABBA 4ZQMA 5E1QA 1Q45A 1ZAIA 2Y7GA 3BLIA 2PE4A 3NQAA 2OCZA 3KVJA 1IIHA 5F2LA 3W1MA 2ZTJA 3THAA 3I7SA 3HGSA 3I6RA 2WO5A 5FF4A 4O0KA 3GK0A 2QCFA 1WV2A 1XM3A 1BWKA 2C19A 3O63A 4Q32A 4X2RA 5HUPA 3TV8A 1RQBA 2Q8LA 3FJLA 3O8AA 3W7HA 3TXZA 3KAOA 2NX1A 1EWEA 3W7LA 3B0UX 1GQNA 4HNTA 1IXQA 2VFEA 4UC5A 2Y7DA 4U28A 3HGRA 2GJNA 1KM6A 2EGZA 4QSHA 4NJGA 2VELA 2Y6ZA 1LYXA 4AWUA 1OFQA 1YXDA 4CCEA 2WQPA 1Z44A 1SO6A 1JRBA 1EP2A 5AFDA 4K36A 4OV9A 2NX3A 5DLCA 4NZFA 5HR6A 1W8SA 3W75A 1QOQA 1R2RA 1OFPA 3B06A 3CIWA 2OT0A 2ZZ1A 3QQ0A 2ATSA 3L68A 1QDSA 3ABRA 3TDFA 1LM1A 3NOEA 1FWNA 4UR8A 3W7MA 5LNRA 2WSYA 4IXHA 2X30A 1XBZA 3W7NA 1TQXA 3QSRA 1D3GA 1KFCA 1QMLA 4IUOA 3YPIA 3B05A 4GXMA 4A29A 3O16A 5BMWA 3UWYA 1LZOA 1WAUA 5F2GA 2Y63A 4AF0A 4XTDA 4LVDA 3W1QA 3RK8A 1R2TA 1SQ7A 2TSYA 1Q3NA 3NQ6A 4ADTA 2YPIA 3MP4A 3I7QA 3C2OA 3PSVA 3E96A 1RZMA 4AHQA 4K37A 4FIRA 2P0OA 4YCPA 1OK4A 3PWAA 1X7FA 1HO4A 4IMDA 2ZZ3A 3LTSA 2HMCA 3T7VA 2ZZ2A 3T40A 1OFDA 2QJGA 3ABSA 3MBDA 1GT8A 3HG5A 3CEUA 2Z2UA 2DZTA 3NEVA 2EKCA 5EA9A 3LCWA 4IMEA 3NAVA 1CI1A 1YLVA 1FCVA 1S5VA 3ZS4A 3EWXA 2XFWA 1KM1A 1EPXA 1QWGA 3F4WA 1MEWA 3B04A 2DZSA 3PSWA 3L67A 1NF0A 2FFCA 3P8IA 1YYAA 4EWND 4OWGA 5CSSA 2R91A 3KFTA 4GFSA 4WY0A 4WX2A 3LM7A 3UD6A 1W5QA 3FYOA 3F4NA 4GJ1A 2YYTA 3M0ZA 3CC1A 5U4NA 1W3NA 3RF9A 1R2SA 4OQVA 1KM0A 2J9XA 3A5VA 1H7XA 2ISVA 1LP6A 4QAIA 2YCEA 4GWEA 4UFKA 4S2CA 3TSDA 4K8EA 1KV5A 1H7WA 4FO4A 4O53A 4XBSA 2H8XA 4LV9A 3EKLA 3UY8A 4GC4A 1T8XA 2A1YA 1NSJA 3VKJA 3JS3A 3VNDA 2RKXA 2V9DA 3QYQA 2E6AA 3SGUA 1ZJIA 2VENA 1OJXA 1PE1A 5FEWA 3GAKA 3N2XA 4WZHA 5I3HA 2ZZ7A 2RDWA 3T55A 4UTTA 3MJYA 1Q6LA 2X1TA 4NZJA 2TYSA 1JUBA 3GZ3A 2RFGA 5D05A 2QJHA 3HQ1A 5FF0A 2PURA 4R34A 3P5ZA 3W7DA 1G6CA 4NJJA 3Q2DA 4C1LA 4ZQCA 1SW7A 3GDTA 1DHPA 3HO8A 3G3DA 3FYPA 4DQWA 5HINA 1Z42A 4UCGA 4J9JA 3UXAA 1GVQA 3QQ1A 1DJNA 4O57A 1F5ZA 4LV4A 1P5BA 2YDAA 1I8JA 2ZRUA 1L6SA 1LCOA 5EBUA 3SGZA 5U7SA 1KM4A 3M16A 3C52A 4DPQA 3L0GA 3DH7A 1LDCA 2PCQA 2HS6A 2PRMA 5DBUA 4HIBA 3PULA 1GEQA 4FNUA 1K7EA 5KMYA 4NVTA 2CZDA 1RQEA 4CLMA 1FXPA 1HO1A 3W07A 3TQVA 4LC6A 3C2RA 3OIXA 2HSAA 3M9YA 3LRMA 1D3HA 1F73A 1KFKA 4LS2A 1KBJA 2BZNA 3OHIA 3RMJA 3QF0A 3NXFA 3HGJA 4O16A 6ALDA 1GVSA 2G97A 1O5XA 2GQ9A 3DGRA 1O4UA 3GXPA 5CPOA 3WFAA 4R33A 4N9DA 4EOUA 3ELFA 1YDNA 1WOAA 1OFAA 4NNAA 3LCFA 1L9WA 3MYPA 4MJZA 4K39A 2FPYA 4IMGA 1H7RA 1AK5A 4M7TA 3NVTA 4UTMA 2VOMA 1TYGA 3PBUA 1JCXA 4HPXA 1EIXA 1TREA 4DXVA 3PVFA 3EX6A 2O7QA 3GXTA 4JXCA 1B57A 1F76A 3A5FA 4A3UA 3N19B 3DFPA 3G1AA 1O60A 4FX7A 2EPHA 1W54A 3W87A 4OT7A 2CLKA 1G4PA 1J2WA 3S1VA 3W70A 3LXAA 5AYXA 3L5MA 4O10A 1Q6QA 3IVUA 3LI0A 4IPJA 3MYOA 4QNEA 4HKPA 2R94A 1EP3A 1TCDA 3C3NA 5G2WA 3QZEA 2KZHA 4JIPA 4K7VA 3QW3A 1JCMP 3UZJA 1PCKA 4ORIA 4LT9A 1FX6A 3TC6A 4ZQPA 3I7RA 1TSIA 2B7QA 4JYDA 4Z1AA 2WNNA 1K8ZA 3CLMA 5DXXA 1P1XA 2OMAA 2BTMA 3G22A 3S1WA 1V7YA 1R46A 2CZ5A 7TIMA 5EPDA 4M6VA 2BLEA 5KZDA 1X6UA 2X2GA 4MY9A 5D2WA 5HMSA 2WV8A 1DBTA 2DJXA 2QF7A 3PG9A 4ONVA 4UR7A 1XFBA 2EF9A 3WJXA 3MMTA 5AHEA 1GOXA 3DFSA 3QPZA 4CCDA 2QCEA 3P8JA 3HG4A 4JY8A 2AGKA 5FEPA 2E5CA 3O1NA 4UTWA 1KFJA 4RXGA 1QFEA 2ZRXA 4OV4A 3U2OA 2JGQA 4MYAA 5LNSA 4BK9A 4WOQA 3LRKA 2A6LA 3HBLA 2GPTA 2C6QA 5FESA 1EEPA 3S0CA 1ADOA 3TX9A 1JULA 1OK6A 3W72A 3W7OA 5D04C 5GVJA 2DORA 3TAOA 4PL1A 3R2GA 3LLFA 4ZQRA 5HWNA 3S5NA 4LS0A 1K02A 3BW2A 3TIMA 1B3OA 4OGZA 3SW6A 3R89A 4KWVA 5BW6A 4HNUA 1TPEA 1WBHA 4GBUA 3B03A 4MPQA 2X1UA 4NU7A 1A53A 1TRIA 2ZRYA 1FWTA 1JJKA 4O28A 2WPBA 3RFAA 4UFLA 5IBXC 1PS9A 1F2JA 3CU2A 4P61A 3FA5A 4LTSA 3WK0A 4FXRA 3KX6A 5LSMA 4RV8A 3TQ0A 2DU2A 1JQVA 3NZ1A 3PUEA 3P61A 3STFA 1L6WA 4HN4A 5HR7A 1TJPA 2NLIA 4FNSA 3HGOA 3MP5A 3K30A 4DEFA 3A22A 4WXZA 3W1NA 1TPDA 3BLEA 1H7OA 2CZEA 2B0MA 4NXSA 2QCHA 2GJLA 4UTJA 1CW2A 3LXCA 3GXNA 4HPJA 3NQEA 4O11A 2PC4A 4MY1A 5G4EA 3PB2A 5L6UA 4JTJA 5AHIA 3A24A 1FCQA 1VHCA 1VRDA 4ZMGA 3LGEA 3GDRA 5G4WA 1DQWA 3M43A 5DELA 3SY5A 3W7GA 2RDTA 1C29A 3WJYA 3UQNA 1AMKA 2BXVA 3LV5A 2Y7EA 3O6DA 4UMBA 2FPTA 4YCOA 3H55A 5IM51 5F4WA 5A5WA 4MFEA 4O8RA 4NJKA 2E6DA 3W2JA 3QMRA 4IOTA 1VQTA 4HT3A 5CPLA 1LROA 3TJXA 3QFEA 3P5YA 1SO3A 1X8FA 2WOQA 3TH6A 1PHQA 5C6MA 3ATZA 1QPNA 3BVJA 4RJEA 4JS3A 4QIUA 1YTDA 3DXIA 1XDMA 2ZFAA 3GAYA 1XBVA 3G0SA 1Z41A 1W37A 4MY8A 3NM1A 1PL9A 1KW1A 4UMCA 4UMAA 1H51A 1UB3A 4DF0A 2X1SA 2BSLA 3Q94A 2Q3OA 4MJMA 4FXSA 3DZ1A 5FF2A 4C1KA 5EL1A 3O05A 4TIMA 4KFPA 4ORMA 5AC8A 1M6JA 1B9BA 1OX5A 2NWSA 3S42A 3NL6A 4DO6A 2YFOA 1H62A 4QM1A 4AWTA 2PRLA 1EUNA 3TQKA 5BMXA 1KA9F 1JVNA 4ADSA 3IRDA 4Z0SA 2YFNA 2IQTA 4DF2A 3S5OA 3GKFA 3FJ6A 1T96A 2YR1A 4P2VA 3VI2A 4Z0JA 2H3BA 3T4CA 1S5TA 4IX0A 1VCGA 4XTIA 1C9DA 1KBIA 2WNZA 3IVTA 2ZZ6A 4FIQA 4PODA 3G0XA 3N2MA 2CW6A 4Z08A 5HQEA 1CX9A 5AHNA 2DZVA 3MUXA 1QPRA 3BGGA 3LTYA 1VLIA 3F1QA 4UIOA 4H4IA 1DJQA 5F1UA 2E6FA 1FDZA 1ME8A 1KTNA 3L5AA 4AHPA 2GOUA 3W1RA 2GVLA 4FX8A 5CZTA 2V8ZA 1OX4B 5CGQA 2P1FA 1EX5A 3LCIA 4UUIA 2J27A 5IBXA 3BARA 1TPB1 1G67A 3NM3A 4YMZA 4GUIA 3LB0A 1XUUA 3G1VA 4CNOA 5AB3A 1FQ0A 2A7NA 2C1HA 2LLEA 3EB2A 2ZRWA 1VZWA 2A5HA 3N73A 1MXSA 3C6CA 4UNKA 3HG2A 4YWIA 1DOSA 1B4EA 3A21A 3TU9A 3Q37A 5G2HA 3TFCA 1TPH1 6TIMA 3ABQA 3P60A 3PR2A 4ALDA 3M5YA 4XUGA 4LUJA 3T78A 5KTLA 4XBKA 3V75A 3IIOA 2NXGA 5AOUA 3CPRA 4Q4KA 1ZNNA 2F84A 1ZY9A 1G69A 2YW4A 5J5DA 5CG7A 3OEXA 3QSTA 4NJIA 4GUGA 3GVGA 4QISA 2YSWA 3BV4A 4BWLC 2VEPA 4JYEA 3MHFA 4O14A 4M6QA 3N34A 4PH6A 4JN6A 4MKNA 1AW1A 1LOQA 4X3ZA 2QDHA 2V2DA 2ZTKA 1VGAA 4RCXA 4QNWA 1XL9A 3B0PA 2VXNA 1GTEA 1I2NA 3FIGA 4K38A 3MHUA 3UY7A 4MIMA 3H53A 4PCFA 3IV3A 3TAKA 3LHWA 4HSOA 4MZ8A 3M5XA 3GDKA 1ZFJA 4L4MA 5LNUA 4O19A 4Y96A 2TMDA 1UASA 2NUXA 1N8FA 3E0IA 3N9RA 2QUTA 1P4CA 1ONRA 3MI6A 4EF8A 4O54A 3BG5A 1A5AA 5DBTA 3KOFA 2RH9A 3SZ8A 8TIMA 2BWGA 4LU0A 2Z1BA 1WX0A 1SW3A 1TPWA 4JNMA 4A2RA 2TPSA 2C16A 2VEKA 5F2IA 3P80A 3W1AA 3S1XA 5F2MA 2JBMA 3LHTA 1H1YA 2CWNA 5I3KA 1OFRA 1O94A 1IXPA 3GNNA 3HPXA 1R47A 3TA6A 4A22A 1GVRA 4JEQA 2H90A 2Y7FA 4NJHA 1J4EA 3L21A 2CZFA 4JDBA 3L66A 4O0ZA 2YZRA 3UWWA 3O06A 4MUZA 4PC8A 1W5NA 5G1TA 4JTSA 3LHVA 1W5MA 5H2ZA 4JICA 4O17A 2Y88A 3RLUA 5KINA 4IMFA 4YLWA 1OVDA 4DBEA 3NA8A 1SO4A 3SSJA 2JKAA 3UNDA 3CIXA 1TQJA 2O7SA 3G1DA 3NL5A 1GG1A 3QMTA 1XKYA 3PUOA 5K7JA 1LOSA 3MHGA 3MO7A 2JGYA 4OE7A 3BG9A 3C56A 1ALDA 4LNYA 3E02A 1FWSA 1OX4A 1VLWA 3LLDA 3W1TA 4CQ8A 2FIQA 5D30A 3C61A 3W1PA 4BI7A 3E49A 3GYEA 3GR8A 1SZFA 3MI2A 1M7PA 1GZGA 2Y70A 3DFNA 2CLMA 1MEIA 2OZ0A 5HNRA 4Z1CA 2ZZ5A 4MLJA 4N6FA 3NG3A 5D2XA 5DY3A 4E38A 1LBLA 4BI6A 1YXCA 4LY8A 5D2YA 1G7UA 3W2LA 5HULA 1QPQA 4Y90A 2X16A 4HNNA 1H7PA 5KZEA 2A2IA 2X1RA 4N4QA 3TSBA 5AHFA 1GVFA 3HPZA 4FX6M 2XN2A 3E12A 2CFFA 3U8GA 5AHLA 3H54A 5TIMA 2C13A 1JCLA 3UPBA 4UTKA 3UWUA 1NFBA 1H61A 3QM3A 4H6KA 2PRHA 4NNBA 1YDVA 3T44A 3W1LA 3EWZA 2GQ8A 1VS1A 1MZHA 1AL7A 4NT0A 5LNVA 1WDWA 1SFLA 2W6RA 2CLLA 3SIZA 3W74A 3R5EA 1KTBA 3EEGA 3W73A 2ALDA 4N4PA 4I7UA 3DU0A 1YADA 2WKJA 3LBMA 3LDVA 3NZRA 2Q3RA 3W7IA 1FXQA 1XXXA 1I4NA 3GIYA 5HJLA 1N7KA 1XDLA 5DCDA 1XUZA 4M7SA 4B5NA 1OFEA 2EHHA 2DP3A 3KVKA 4A21A 3PBWA 3G0UA 3VE7A 1YPFA 1I2PA 3R12A 4N9CA 3HMJG 3EXSA 5AYZA 2QCLA 3IGUA 3W7KA 4M5PA 4CQAA 2Z6JA 1UCWA 4XWUA 1OABA 2E09A 2A21A 3DKJA 3MP3A 1M7OA 4CCCA 1OFBA 1PVNA 2GVJA 4DO4A 1RQHA 3M5VA 1VHNA 5G2IA 3S8HA 3HIJA 1VC4A 4IQLA 2C14A 3W7JA 3BPWA 1NVMA 1C8VA 4N6EA 2E5BA 4FHAA 4LW7A 5K3VA 1UUOA 4MOZA 3TNOA 3GLCA 3JRKA 3CT7A 2V82A 1UUMA 4TMBA 4TMCA 4AB4A 3M44A 1ML1A 3W88A 3FKRA 5KZMA 2YYUA 3OVPA 1H7NA 1NF7A 3LCHA 3EX4A 3IEBA 2V5LA 3TC7A 3FFSA 2E77A 1KFEA 3KRUA 1P0NA 3QEZA 2R14A 1HG3A 4YL2A 4Q33A 2OX1A 4IGHA 2NX9A 3DFTA 4O18A 4RZ5A 5KSWA 4S2BA 4DBDA 3IIZA 3TJLA 3W7RA 4NX0A 3G1HA 4TR9A 5AC7A 1U5JA 3GDMA 1ZAHA 2A85A 4K6AA 5I3JA 3W2KA 1ZENA 1TTQA 3IIVA 3TMLA 1J5TA 5AN7A 3C0JA 1N55A 3A9IA 3NR0A 3INPA 3M47A 2YGYA 1WXJA 1X1OA 1QO5A 3TE9A 3G1YA 4K8HA 4XZ9A 1EA0A 2DZXA 5CPNA 1WBJA 2FDSA 5D09A 2FLIA 4MZYA 4JR5A 1F7BA 3TW6A 3NL3A 4HNVA 3I65A 1XBYA 3WJZA 3DI0A 3DHDA 3M1ZA 4QJ1A 4GUJA 3PAJA 4O1CA 4LRSA 4X9SA 1ZHAA 4I7VA 1JRCA 2ZZ4A 3HPSA 1KV8A 3S5ZA 4OU1A 3PC0A 1P0KA 1H5YA 2QCCA 1FWWA 5BNKA 1DQXA 1GYLA 4X22A 4TO8A 1XI3A 2VFDA 1OYCA 1HL2A 5DN1A 3C2EA 1KM5A 1FUYA 1K3UA 4AMAA 2G96A 4BFAA 2ZBTA 1LTDA 4IX2A 1TRDA 4AAJA 3IGXA 3WK3A 2ATMA 1LLWA 1WA3A 1R30A 1KM2A 3W84A 4GE8A 1RD5A 3F03K 1OX6A 4LVFA 1TB3A 3HG3A 1RR2A 2VFFA 3UWQA 1W5OA 1VCVA 4ZQNA 1HFBA 4IMCA 4RKAA 1SPQA 5FF3A 3SI9A 5F4SA 3TCEA 1A5SA 1JUKA 3MI3A 1RV8A 4K7YA 4G1KA 1JQXA 1I45A 2C0AA 3M6YA 5CZJA 3W7EA 2NUWA 1TTIA 1LORA 5CZ0A 1GWJA 5BOOA 5I3FA 2QKFA 1AW2A 1GPWA 4PL2A 3W7CA 1YPIA 2Q8ZA 2V2CA 4UFHA 3DHFA 1IXNA 5D2VA 3STEA 2WSRA 2FPVA 1THFD 3N3MA 2FB3A 3E9AA 4XKYB 4PTNA 1O95A 2W79A 1BTMA 3RU6A 4AEOA 3PM6A 1ICSA 3CM4A 5D33A 3B8DA 2E68A 2J6XA 1OF8A 1IGSA 4JTTA 3NQGA 1SO5A 4YXGA 1TPUA 2QDGA 3L9CA 3LHUA 1W3TA 1AW5A 5I3IA 4LUIA 4CNNA 1Q6OA 1ME9A 4NNCA 1QOPA 2ABAA 4R53A 3DBPA 3LRLA 5LNWA 4O15A 1L2UA 1QNVA 3MWAA 1QPOA 5FEZA 2ZQ0A 3G18A 3CHVA 5FI8A 2WNQA 4JD4A 1EUAA 3S9YA 4I9AA 4A2SA 3CWOX 3W85A 2NXHA 5EY5A 3NQMA 3KRSA 3M41A 1TJRA 5E0KA 4NX5A 2EAWA 4GRSA 3DAQA 2VFIA 3FS2A 4MLRA 4AWSA 2NV2A 2NWRA 1VYPX 2AAMA 3NQFA 3OVQA 4O1AA 1LBMA 2XN1A 2V2HA 3HOJA 5F4XA 4KFOA 4E2BA 2QUVA 4BR1A 4LRTA 3W1XA 3KVMA 3P7YA 1WYIA 5EYWA 3UXDA 3LERA 4ICNA 5H91A 5DCEA 1GYNA 4O4VA 3G8RA 4O50A 2BX7A 2NUYA 4O1BA 2QCNA 4CNPA 3NPWA 3NDOA 3WJWA 1TO3A 3P74A 1ME7A 4UTTC 3NPXA 3OBKA 3LCXA 1EWDA 3G3MA 4UNLA 5HUOA 1K8XA 1XC4A 4JDYA 4XQ6A 1DL3A 1H60A 1T99A 5FEXA 4MVAA 3P82A 1GG0A 2J9ZA 3MBFA 4WOZA 5TQLA 4MFDA 2Y89A 3P81A 2VKZG 1A50A 1VPXA 2WSQA 3N9SA 2Z6IA 2I9EA 2D73A 3CWNA 3HF3A 2B4GA 1KFLA 1W1ZA 1KFBA 3TK7A 2CLIA 1F6KA 1PHWA 4FB7A 1W31A 4RZ4A 3W83A 3PUDA 5SWUA 4FNTA 4JYFA 1TPFA 2CLEA 3W2NA 4HHPA 2ZYFA 4JTHA 1TPVA 4IPIA 2ZDRA 2Y61A 3GX9A 1SU5A 2V81A 3WK1A 4EVZA 1LLZA 4POCA 2G5WA 4R7JA 2DJLA 3FOKA 1S3HA 3LOTA 3P62A 2B7PA 3KXQA 4RLIA 2QCDB 2FB2A 3L0NA 2DZWA 1W56A 4N02A 1FDJA 1I2RA 4Y8FA 3BO9A 1KLYA 5HWJA 4JGDA 1O5KA 2E6YA 1I2QA 4RR4A 3OVRA 3LXBA 5D37A 5F1VA 1VYRA 3MW7A 3FEMA 5LZLA 4O52A 2QUUA 3M5ZA 2VEMA 4O13A 1IXOA 5D38A 1MSSA 2A0NA 3TXVA 4LC8A 2GUUA 1UBSA 3NYZA 1GTHA 1WQ5A 3NQDA 3W22A 3EWUA 3OA3A 3NPUA 1Y0EA 3C2FA 4CQ9A 2V5BA 4FEZA 5K4ZA 4GUFA 3LHZA 4S1FA 1SZNA 4XKYA 4GUHA 4WXYA 3P84A 2WJZA 2ZRZA 4AXKA 5EKYA 4M19A 4OBTA 2VC6A 3GNDA 5LHEA 2CU0A 3THQA 3ATYA 2TRSA 4HSNA 1TV7A 3N14A 1K8YA 4MZ1A 1W3IA 3PS7A 2NZLA 3IIPA 1K03A 3TKFA 3M7WA 2H8ZA 3W3OA 4FF7A 5BRBA 4NQ1A 4FNQA 4M6PA 3USBA 4AHOA 4N9BA 3EKZA 5MHBA 1SUXA 3BLFA 4Z1DA 2JKEA 3BG3A 5K9XA 3LBCA 3R13A 1DV7A 1DVJA 1TV5A 2E1DA 3CB8A 5C2XA 3S6DA 4ADUA 4O1DA 3S1UA 5J5RA 1QO2A 3NPVA 1FBAA 4IJBA 2QAPA 3UZ5A 4N9EA 2YW3A 1V5XA 5I3GA 4O4WA 1W0MA 1Q6RA 1BWLA 5L9FA 3LI1A 3W1UA 1YDOA 2VFGA 5ABTA 3NO5A 5K2ZA 4WD0A 4E0CA 1GVOA 1JR1A 1TPC1 3QH2A 2W0UA 3W6YA 4BF9A 3DFOA 1SZEA 4ML9A 3QRHA 4LOCA 3G8EA 1G4EA 4KFNA 4BI5A 4WQ6A 1QCWA 2I14A 2ISWA 4JTFA 2VEIA 1MEHA 3AO0A 1KM3A 1LRTA 1ZALA 4JTUA 5AYYA 3TW7A 2OT1A 4UTWC 4Z1BA 3DKLA 3GKAA 2QCGA 2VFHA 4JTLA 3ZFHA 3LCGA 3ANYA 1DKWA 1JCNA 1YTEA 5T26A 1SR9A 4JX6A 4WJEA 5K4XA 3P67A 1SFJA 2OJPA 1U83A 1K7FA 3O6YX 4UFMA 1K7XA 2I1OA 1G4TA 3O07A 1PIIA 1SW0A 3TMQA 4JX4A 3DENA 2Z0IA 3C2VA 2R8WA 4AVFA 5D02A 3ZR4A 4RX0A 1OFOA 3STCA 2Y85A 1VH7A 3L0KA 2GQAA 1XCFA 4W9TA 2J9YA 4JTIA 3OG3A 3EXTA 4JX5A 3W86A 1X1ZA 3D0CA 4ZL1A 1F6PA 3QMSA 1LRNA 1L6YA 4UTHA 4JY9A 4JIQA 4BWLA 1S5WA 1TIMA 2XN0A 1SSGA 3BW4A 3W2UA 4RZ6A 3DI1A 3CQ0A 2QCDA 3DFQA 1H63A 3GDLA 4N2YA 3NQ7A 4KKXA 3L65A 1OYBA 5G1YA 2CLOA 3FLUA 2A7RA 3U6WA 2F7FA 3NNTA 1F74A 3ZWTA 2HS8A 3G1FA 5CZSA 3EXRA 3IIXA 1YXYA 1B4KA 3LV6A 3GB6A 3VE9A 5C54A 1IIGA 1JCJA 5DY2A 3NQCA 4QITA 4RK8A 2H6RA 2ZA2A 4NUWA 3RLVA 1FWRA 3AJXA 1AG1O 4WY0F 2A6NA 2J88A 3VCRA 1W5PA 3LCLA 1G4SA 4WUIA 3JR2A 3TSMA 3EX1A 4JTEA 3UWZA 4EIVA 1UJPA 1KTCA 4IXXA 3WK2A 3O15A 3GR7A 3HB9A 5C5YA 2YXGA 4TX9A 3SR7A 1VR6A 3PBYA 4FNPA 2QEZA 5AHMA 3A23A 1OHLA 5E93A 3LX9A 4RXFA 4KWWA 4D2JA 4DF1A 5D03A 4LVAA 3UYCA 1ICQA 4NXKA 4PFMA 1T0OA 5LGXA 2UV8G 3W7PA 3W7QA 2QAFA 1HTIA 2QR6A 1SZGA 5CPMA 5KITA 4TU1A 3SJ3A 3KHJA 1QAPA 4ZQOA 3HJZA 1ICPA 2CLHA 3TUUA 1LBFA 2V0TA 5LHFA 2RDUA 4ZZ9A 1MO0A 1GJPA 4UXDA 1PV8A 3TFXA 2HTMA 1M5WA 1LOLA 2ISSA 4DELA 2DZPA 1RVGA 1LRQA 1NAL1 4UTLA 3O6CA 1A5BA 5D32A 5AC6A 3G24A 5K9DA 5C55A 4UFIA 2A7PA 1HUVA 4JTKA 3B0VC 2GVGA 1TV8A 1EB3A 4QQ3A 1VCFA 2V30A 1ZCOA 3CEPA 3CTLA 3SECA 3C4UA 3LTPA 3PG8A 2ZCGA 5DCBA 3PY2A 1RPXA 1SSDA 1F05A 3FKKA 1FDYA 3ABOA 5DXYA 1H1ZA 5A8GA 2NV1A 3BGJA 1G7VA 4OHQA 2RHGA 4L4LA 4DPPA 3V1PA 2Y62A 1OF6A 4LVBA 3TR2A 3NGJA 4IWWA 4PEKA 3BK0A 2FJKA 2A4AA 2NXIA 4PA8A 1YTKA 3G1XA 2C15A 3EWYA 2H3DA 2JKPA 2B7OA 3W71A 4UTUA 3PBVA 4E2DA 3KVLA 5CKSA 2G95A 1OG0A 3NQ8A 3L2IA 4JTGA 3SFKA 4H3DA 1VJIA 2YX0A 1TMHA 1ZAJA 1EP1A 3IGSA 3W76A 5K9CA 3WJSA 4UTIA 2ZA3A 1DORA 2C18A 2C3ZA 2FQIA 1BEUA 3NL2A 4O12A 4Y6GA 5LKYA 2FTPA 5LGZA 4LS1A 5D2TA 4AF0B 2J24A 3LHYA 1BKSA 3IVSA 3QW4B 3UWVA 2QJIA
chains in the Genus database with same CATH superfamily
1HJXA 3IS4A 3PZTA 1WZMA 2YKKA 1CT5A 4F2TA 1FWEC 5JH2A 2CLFA 1KBBA 2P10A 4PRRA 2OWXA 1F07A 1AZ1A 2E5DA 4A05A 3U5YA 1QR7A 1BVNP 3RNDA 4X0NA 1V08A 1V79A 4B2DD 1UWTA 1A5CA 3MU7A 4CU7A 3KWSA 4F40A 3LSCA 3AROA 1UQYA 3AYRA 5I78A 3B9AA 1JGIA 2R9RA 4OFCA 1FWGC 4K3ZA 4I7WA 1JCYA 3TA9A 3LZ5A 1R3VA 3XIMA 1Q63A 4GY7A 1KLZA 4YTUA 1GOIA 2F2HA 4FSAA 4LVGA 3QC3A 4IGMA 1VFMA 1PCWA 4W87A 1BXCA 4DO5A 1XGEA 2DSZA 3QPYA 3RMEA 3EX2A 1TTJA 2QV4A 4AD2A 2PF0A 3PB0A 3CUZA 2JK2A 1B31A 3MO4A 4WY0B 3C5QA 1DJIA 2C1IA 3EX3A 3EWWA 4DVOA 1I2OA 5E1QA 3GHSA 1Q45A 3S2JA 1AODA 1XSJA 1IIHA 3UETA 3F2CA 4FOJA 4IIDA 4LFYA 3I7SA 3HGSA 3I6RA 2IKIA 3H8AA 2W3ZA 2PDUA 1WV2A 1YEYA 2QV5A 1RJPA 4JFUA 1FOBA 1XYCA 1OIMA 3B0UX 4EXQA 1DHKA 4YIWA 4ZE4A 4H6EA 1IXQA 4L1WA 4NZ3A 3A9BA 4EX4A 2Y7DA 4D8LA 2ZXAA 4GXWA 2AOSA 2PDKA 1LYXA 4AWUA 4DI9A 6PTDA 4AZCB 1DJWA 1YXDA 1IEVA 4Y2WA 1A4LA 1GKRA 2ZUUA 2PTDA 3OQEA 2ZUVA 5KETA 3N2OA 3VIKA 3CQIA 1XSIA 4OV9A 1UYQA 4REQA 1CB2A 1WPCA 4FI4A 2DT1A 4A6GA 1QOQA 3O7UA 1P6WA 3TTSA 4DJDC 2OT0A 1C8YA 4A3HA 1QDSA 5I24A 4AX6A 3W6MA 1FWNA 2VM8A 3BURA 4UR8A 1GVIA 2GUYA 3WQCA 1KFCA 1QMLA 3YPIA 3II1A 4A29A 3I4EA 5I77A 1LZOA 1WAUA 4LVDA 5T91A 3W1QA 4J2PA 4AEEA 1SQ7A 1IWPA 3QV7A 3NQ6A 2OKTA 2YPIA 4WJXA 3BH4A 1RZMA 4FIRA 2PCEA 3MANA 4HJWA 4S39A 3GVWA 1KCZA 1TWZA 1X7FA 1K9FA 5A3HA 1EC7A 1G9HA 1ISZA 3UR8A 4FXFA 4IMDA 2WK2A 2ZZ3A 3WQ4A 2HMCA 2ZZ2A 1GZJA 3T40A 2IPFA 1OFDA 4LSBA 2TAAA 3ALFA 5CAHA 3HG5A 1U5HA 5AC4A 1YQ2A 2WVVB 4QGCA 5EA9A 3NAVA 1CI1A 1SR0A 1FCVA 1S5VA 3ZS4A 2Z00A 1PO9A 2PU0A 3CWHA 5BXTA 1W17A 4ROPA 1EPXA 4ATWA 2CKSA 1EOKA 3F4WA 3B04A 3R4IA 3ITLA 4TVDA 1JD9A 4EWND 3TONA 1XLHA 2ZUNA 3H4XA 4QX4A 3BQ6A 3IJDA 4YS1A 4QCEA 4S3AA 3RJXA 1HX0A 2L5HA 4S2CA 4E8DA 5C2GA 3U2EA 4LV9A 4HBKA 4PBGA 4GC4A 2PDIA 5LIKX 1J01A 1T8XA 3RAOA 5CBBA 1BAGA 3JS3A 4RPQA 1ODUA 1UKSA 2E28A 2E6AA 1ZJIA 1NOUA 1GUVA 1QRQA 2ZZ7A 2RDWA 3T55A 3UWEA 2WZTA 2FKPA 2BFGA 1Q6LA 5EMJA 4JHZA 2TYSA 4LANA 2OOGA 3GZ3A 2HK1A 5FL0A 3VOIA 3EA3A 4NY2A 5B7YA 2VCAA 4R34A 1Q5MA 3L4TA 4D6DA 1QXLA 3W7DA 1G6CA 1KWKA 1MNZA 2R1NA 3L2LA 3Q2DA 2XZ7A 1UQZA 5T8GA 3GDTA 3M46A 4LAUA 3IUIA 1OCBA 3VKAA 3FYPA 4DQWA 1XWYA 1AZ2A 4HOZA 4LYPA 2DSKA 3BZGA 1DJNA 2IPGA 4GQQA 4LV4A 2YDAA 1I8JA 5I7GA 3MUCA 1L6SA 2WJFA 1LCOA 2HVOA 4CN6A 5EBUA 1EJWC 2P50A 3C52A 2NQLA 1OCJA 4DPQA 4CVWA 4LBSA 3L0GA 2G50A 1LDCA 4QP0A 2HS6A 2PCQA 2PRMA 4D1IA 1N82A 4LAZA 4AD1A 1R8LA 2WMFA 3N3TA 3L7RA 1H09A 3NQBA 5KMYA 3HTWA 4HPGA 1ZJHA 1HO1A 1QATA 1YHTA 4A3RA 4IT1A 1TA3B 1D3HA 1MNSA 1KFKA 4ZSTA 3HGJA 3LU2A 4CQCA 2G97A 3FVDA 3JZUA 4KGJA 3D47A 4R33A 3ELFA 1ONWA 4IIFA 5CSUA 5JBEA 3LCFA 1L9WA 3MYPA 1UOKA 3LY0A 1EIXA 1HGWA 1W1YA 2EJAA 4DXVA 2O7QA 3GXTA 3R79A 3A5FA 1RBLA 4WKAA 2ISDA 3TVAA 2EPHA 3M0HA 3B0YA 2CITA 1ZU8A 3OTRA 1J2WA 3LXAA 4EAYA 3VDHA 2Z7GA 1Q6QA 4NZ4A 3LPGA 2R94A 1TG7A 4QBXA 2KZHA 4JIPA 3U57A 4QTGA 5AZ0A 4H01A 2XSXA 3E38A 3TC6A 4ZQPA 3R43A 1TSIA 4QHRA 2OQHA 4Z1AA 2WNNA 1K8ZA 4FP1A 1VBRA 3G22A 3S1WA 1GQJA 2CZ5A 7TIMA 3LK6A 5EPDA 1XLKA 2ZUWA 2X2GA 3G5EA 3KW3A 3GG1A 5D2WA 1EEXA 3W4RA 1KCKA 3B4YA 4IH3A 4HNLA 4LEFA 1XFBA 3WJXA 4C5ZA 3TP4A 4IQJA 5AHEA 1DIEA 2QT3A 3QPZA 2QCEA 3T2OA 4PEEA 3HV8A 4QSFA 2OWWA 5LXXA 2PI6A 3O1NA 2F8QA 1KRAC 1TV3A 5FSDC 1Q8AA 3V5OA 2VGGA 1QVBA 5LNSA 3LRKA 3SB0A 4FAMA 3WF3A 3VC6A 3W25A 5AKQA 3W72A 4L9XA 5GVJA 4KH2A 1HJUA 1UD8A 1PZ0A 3S5NA 3LPFA 3NSXA 3H2CA 4XK2A 2WBKA 3WKZA 1FHVA 3R94A 1BSIA 4MPQA 1GQLA 2WPBA 2DV0A 1PS9A 1F2JA 4P61A 3VAVA 4XX6A 2VX6A 3TQ0A 4DWDA 1P48A 2JE8A 3SCNA 1E0XA 3PUEA 3FY1A 1B3VA 1V51A 2GLKA 5CPQA 3HGOA 3UEQA 3HFYA 4DJFD 1TPDA 2WMJA 3ZLGA 2QCHA 4UTJA 1CW2A 4URIA 3LXCA 4J4KA 1LQ0A 1JD7A 1XRSA 2GJPA 2VHLA 3A24A 3WNLA 4L5ZA 5CJ5A 3VGGA 3MQTA 4LAMA 1XD0A 4HMEA 5EMYA 3SY5A 3WJYA 1WAWA 1EDGA 2VX5A 2FPTA 4YCOA 4MSSA 5E6ZA 1FHLA 4IGNA 3VX1A 1IR1A 1ZTVA 2GJRA 3RU8X 1GQKA 3E0FA 5CG0A 1VQTA 1A47A 4HT3A 1LROA 2ACSA 3WMSA 2OG9A 3TH6A 5HANA 3GE7A 1V03A 4GG9A 3RM8A 1DP0A 1TZ7A 1U5VA 3QR1A 4JS3A 1J6OA 3URQA 1JPIA 1XDMA 4ZO6A 3W0KA 1W37A 3DHUA 1U1HA 1KW1A 4LNCA 1F8MA 5D8WA 2Q3OA 2DEPA 4GYPA 4MF4A 4D8ZA 5EL1A 3G2GA 3R8GA 4KCWA 3C3UA 3SM0A 4GVFA 1RPKA 1WXZA 2E8YA 3P93A 1YIXA 2EPLX 1H62A 3FAWA 3ONCA 3VZZA 3C0SA 4ADSA 4B5SA 4Z0SA 2YFNA 2VUNA 5A8QA 3V0SA 3LMYA 3VNZA 3NCOA 2H3BA 4UQAA 2WNZA 3UERA 3SO7A 4XV0A 3UFYA 1KRMA 2DZVA 4HMNA 3AZTA 2HVMA 4UIOA 4H41A 4DWSA 2E6FA 2FMNA 1ME8A 1KTNA 2R1KA 2GOUA 3CMJA 2GVLA 3R1ZA 4MADA 4S3CA 3H2NA 3K1GA 3OB8A 3FX4A 4Z1YA 4CGTA 4GUIA 3LB0A 4WVXA 1TKKA 2WC7A 1CDGA 2DIJA 4EPKA 4DYJA 3OHMB 3Q45A 1ZLPA 4B90A 4DJFC 1AQFA 3K4DA 2VZSA 4UNKA 3OOQA 3HG2A 1V3KA 5BRQA 4YWIA 4RE3A 1B4EA 1MMFA 3A21A 3VKKA 1VKFA 3R11A 4V27A 2ZE0A 1ITUA 4S3FA 3PR2A 4ALDA 1Q6EA 3M6DA 1CXHA 1XLAA 1Z8AA 1TIWA 1V8EA 4XBKA 3WLIA 4EACA 1VFFA 3LQLA 4ZA0A 3CH0A 1ZY9A 1G69A 2V67A 3QSTA 4GUGA 4QISA 1R9ZA 1E1EA 3K8MA 1C90A 2VEPA 3VD4A 1Q6DA 2QZRA 5ECUA 3N34A 4MKNA 1J0HA 1M04A 3RJYA 1LOQA 3S46A 4H8HA 4ZOBA 4AZIA 2QDHA 5M03A 1IT0A 3W02A 4Q8WA 5AY7A 4C1NB 2HJPA 2DQXA 4MIMA 4K2SA 1S3TC 1EJSC 1V93A 4MZ8A 4F0SA 3M5XA 4TX6A 3DGBA 3ITOA 1E9IA 5CEWA 1PX3A 4L9YA 5TD4A 5LNUA 4IM4A 1O5RA 1XLCA 1YBQA 2O0TA 1QJWA 3E74A 1E3ZA 3N9RA 1N8FA 2RDXA 2XU2A 4O54A 2QUMA 3PZIA 2BWGA 5M3WA 1WX0A 1SW3A 1QOXA 4JNMA 1J2BA 2C16A 2OFJA 1QI2A 2REQA 3W1AA 4YYCA 3PNUA 1Q66A 3MSYA 1OFRA 3BAIA 1D8WA 3HPXA 2PDYA 4A22A 4HHHA 4NJHA 2CZFA 4JDBA 4D6JA 2GDQA 3VC5A 4MUZA 4PC8A 4CD4A 1W5MA 1DQUA 2XH0A 1PYFA 5H2ZA 4JICA 2Y88A 3WQ5A 5H1WA 4CKQA 4H1ZA 3RX2A 3SSJA 3OGRA 3CL6A 3UNDA 4GX8A 3NURA 1TQJA 3M0XA 1E43A 1H4PA 2ZX5A 4N7QA 1ITQA 5M17A 4Q8PA 1XKYA 1E5NA 4PULA 4OE7A 4WDWA 4LNYA 1FWSA 1Q6GA 3LLDA 4CCZA 4X2PA 3KCJA 1XYAA 5A8OA 3TEVA 1LJYA 5D30A 2BMBA 4BI7A 4TOQA 1SZFA 3BAXA 1M7PA 1GZGA 2VDGA 3B9OA 4Z1CA 1W9BM 4N6FA 2ZIDA 2PC8A 4DZ5A 1ONXA 4UWMA 4B2DA 4GX9A 4IICA 1G7UA 4ZTYA 1QPQA 3CBWA 3V5FA 2BG5A 4IIGA 2I5IA 3UJFA 5AHFA 1NFPA 1GVFA 4PZVA 4FX6M 2JF7A 2RAGA 1FP8A 2CFFA 5AHLA 1QTWA 5FJRA 5TIMA 5GJPA 1JCLA 4A8IA 2VCBA 4JQ1A 4G7EB 1NFBA 4IFOA 1YDVA 4IIBA 3T44A 3W1LA 2XIJA 3EWZA 3MSDA 1VS1A 4NT0A 4Y9MA 5XINA 3R5EA 4YVPA 5REQA 4AMCA 3HU7A 3WL1A 3K13A 4N4PA 4I7UA 3BLKA 3PNZA 2WKJA 8XIMA 1I4NA 4KT2A 1HKJA 3H24A 4Q4RA 4L56A 1DWJM 1XDLA 4GH3A 2GK1B 3RDKA 1OFEA 4B92A 3AS0A 1YRRA 2H9AA 3G0UA 2J7EA 1XF0A 2Z6JA 3T6CA 1UCWA 4XWUA 1OABA 2A21A 3MP3A 2FZ8A 4F48A 1P1MA 1JEZA 5G2IA 5CGTA 1UD6A 2OQYA 3RLGA 4JN7A 3WBXA 2OODA 3HMCA 1F3EA 1Y5WA 3JRKA 1JNDA 2V82A 3CT7A 3BAYA 3T2PA 2OVLA 3B9EA 3W88A 5JH1A 2YYUA 4FS9A 3OVPA 4LEQA 3ARZA 3IEBA 4NI3A 4QDPA 4U3CA 3U4FA 3PPFA 1HG3A 1K8CA 2OX1A 3QKZA 3DFTA 4RZ5A 1JG9A 2E67A 1UMYA 2RUSA 5JVLA 3E1F1 3G1HA 4TR9A 1FA2A 4CEUC 5E09A 4B9YA 4GI6A 4XISA 1S5MA 4A3YA 2A85A 2R1PA 3GUGA 3ZOAA 3KZPA 3W2KA 1TTQA 1B5TA 3IIVA 4JFWA 3CGTA 1J5TA 5CH9A 3EGJA 3NR0A 4IG2B 3OP2A 3M47A 1CLVA 1SVDA 5CBJA 3VMNA 1KO0A 3G1YA 3VMOA 4XZ9A 1EA0A 1R3QA 5D09A 2VTFA 4KEUA 2WNWA 4MZYA 3TW6A 3GNXA 3DI0A 4QJ1A 1AJZA 4S3EA 4LRSA 1MQQA 4PMDA 3S5ZA 1GHRA 4TVUA 4OU1A 1HZYA 1LQ2A 1GYLA 4E5TA 3WLSA 3QLDA 1HL2A 1S39A 2JIEA 4DBSA 5ABHA 2G96A 4BFAA 3PUGA 2ZBTA 1LTDA 3ZVIA 1W9XA 2O9OA 1KBKA 2ATMA 1I9CB 1E0VA 4EXAA 3F03K 3U3HA 4LVFA 1TB3A 4DAIA 4QFUA 3HG3A 1DWIM 2VFFA 2YL9A 1OBAA 1W5OA 1VCVA 3UWQA 1HFBA 4RKAA 5FF3A 3VOJA 1HVQA 3SI9A 2V69A 4G1KA 1RCOB 1WKFA 2Y24A 2UY3A 1TTIA 1AFSA 2P3EA 3QVQA 4G56A 4PL2A 3W7CA 1YPIA 3GH5A 2Q8ZA 3P0WA 3DHFA 2ZUMA 2WSRA 4W8LA 1THFD 2W79A 3WG6A 4BS0A 3VNIA 1JPDX 1P43A 3UBPC 1HQTA 3LN3A 4YXGA 3LHUA 4H04A 4J5NA 3U2CA 3SCSA 3TWBA 4OZOA 1ZJAA 2ISFA 3CK5A 1JZ7A 4QR6A 3PWIA 4KIRA 3WF2A 1E56A 1HXJA 3LRLA 1J18A 3CHVA 2OLHA 4C5YA 2CXEA 4JD4A 1EUAA 4GIEA 4A2SA 3CWOX 1HJWA 5EY5A 4OIFA 1FKWA 1M03A 3KRSA 4HK6A 5C7HA 2NVDA 4I5UA 4GRSA 3FS2A 4MLRA 4DYEA 1XP3A 3AHTA 2NWRA 3M0IA 4GI4A 4JTAA 2XN1A 4W88A 2Z1SA 3SN1A 2OGJA 3DX5A 4KFOA 2PD5A 5DCEA 4R7WA 2WCAA 3G8RA 5JBFA 2BX7A 2D2GA 4O1BA 2VZUA 2Y5EA 3NDOA 4MM1A 4UTTC 1X6NA 2PP0A 4ZCWA 3ERPA 4H8VA 3LCXA 3G3MA 4XQ6A 2VRJA 4I8YA 5BROA 4Y7EA 3CL8A 1WDSA 2J9ZA 4WSHA 1PYMA 4MFDA 1NFGA 3WLQA 2X8RA 2Y89A 2VKZG 5LA0A 4HK5A 3N9SA 2KAUC 3CWNA 3HF3A 2FVKA 3S6TA 2ZC8A 3WNMA 4V28A 1F6KA 1PHWA 4C7DA 2OTDA 3CB3A 4RZ4A 1JZ6A 3IK2A 3W83A 4ES4A 1I1WA 4HHPA 3VNKA 3PTDA 4CD6A 1TPVA 5JQ9A 3GVQA 2V81A 1X39A 3A3WA 3FOKA 3S9ZA 3AAMA 3P62A 3SRFA 2QCDB 1KGXA 5AECA 4N02A 1I2RA 1W6TA 2PLJA 4C6NA 3TYCA 3RX3A 3CL7A 5F1VA 4R88A 3UVAA 1UIPA 4O52A 2QUUA 2ON3A 3PZMA 4O13A 2PDCA 1MSSA 3OJGA 2A0NA 3A3HA 3N15A 3RX4A 3NQDA 1J0YA 3OA3A 2X2YA 2OLSA 1A0EA 4E6MA 3GHTA 4PUWA 4WXYA 3QZ6A 4A8LA 3WD0A 4AXKA 4M19A 3H7UA 2CZVA 8XIAA 4OVXA 2NSOA 3THQA 2XVGA 1W3IA 4EANA 5ABGA 1S1RA 3CV7A 4P8UA 3M7WA 4OTKA 3USBA 4M6PA 5FL1A 1OC7A 4N9BA 3EKZA 1SUXA 5CCZA 2FDMA 3GD6A 1M68A 1TMQA 3R13A 4ADUA 4O1DA 3S1UA 1CECA 1KXHA 1QO2A 3H7RA 2WLZA 1FBAA 5FKYA 2QAPA 5EB8A 5I3GA 4HN8A 1AH4A 4O4WA 5E6YA 3ZVHB 1NH6A 3NO5A 4PTXA 4DZIA 3QH2A 1JR1A 4JIEA 4HYVA 2A79A 1BYDA 3QRHA 4LOCA 3G8EA 3ARUA 4WQ6A 3WMBA 4D72A 2D69A 4QG9A 2ISWA 2ANUA 2ZXDA 4C65A 4XSLA 1KM3A 4JTUA 1UWRA 5AYYA 1RBAA 4KQNA 1R3YA 2QLYA 3LMZA 4DJFA 2VFHA 5ENLA 4JX6A 1X1NA 2PDGA 4RW5A 3AUJA 3E2QA 1I1XA 1K7FA 1K7XA 3H4WA 3G1RA 1P6CA 1HKKA 3DENA 4AC7C 5D02A 3ZR4A 1K77A 1VH7A 2GJXB 1DIOA 1D2KA 2GQAA 2W27A 1V4YA 1A5UA 1X1ZA 3D0CA 3MKKA 4ZL1A 1VJZA 3WLJA 2VYOA 3WUFA 2VQUA 1TIMA 2PLMA 4QEEA 3DI1A 3ISIX 2AL2A 1LWIA 4N2YA 3ITCA 3L65A 2OEMA 5G1YA 3FLUA 3COTA 1IT8A 2F7FA 2YL5A 1KWGA 2X09A 2PODA 4W84A 5CZSA 3KBJA 3MT1A 1FP9A 1PWLA 3D5HA 2OYKA 1YXYA 3ZR6A 1KRCC 1E6ZA 4J3ZA 3GB6A 3VE9A 5C54A 3R0KA 2FZ9A 4LAOA 5DY2A 3UZZA 3CZ8A 4QITA 3V35A 3RLVA 2YL6A 1FWRA 3IUDA 3NTYA 3CQKA 4HB7A 2A6NA 1X8CA 1W5PA 3Q67A 1FVPA 4WUIA 3AHYA 3AMDA 3UWZA 3O2LA 3QHMA 3I6EA 4HTBA 4I5RA 5DQPA 3VM7A 1MWOA 4AC1X 2XH4A 4S3KA 1JZ2A 2AMGA 4FNPA 1WDDA 5HNTA 3A23A 2OSYA 5E93A 3LX9A 4ATDA 3UYCA 1ICQA 2XUCA 5LGXA 2XDFA 3W7PA 3W7QA 2QAFA 2QR6A 1SZGA 2Q8XA 3KBNA 4IMAA 1ZPTA 5KITA 3ENLA 2G3NA 2F6UA 1IE7C 1QAPA 5CZKA 2J7BA 3TUUA 5LHFA 2V0TA 5TNVA 2P53A 4HNCA 2GGEA 4PUMA 3TFXA 3RILA 1LOLA 4F0RA 4E3TA 1ISYA 3BC9A 1JAEA 3O6CA 4LB3A 3KUMA 4P7QA 1A5BA 5D32A 4AZGA 4JTKA 1TV8A 3TNBA 1EB3A 1DJXA 3CEPA 4Y9PA 3PG8A 4HP5A 2ZVIA 4RDWA 3PY2A 2OPJA 3ABOA 5DXYA 3DDMA 5I00A 4DPPA 1W3JA 3P0XA 2QDEA 4LVBA 3NGJA 4LCQA 2V68A 3BMXA 3BK0A 4REQB 1F3TA 2A4AA 2GGJA 2Z2AA 3A4JA 1QASA 2B7OA 3RM4A 5XIMA 4P7RA 3KVLA 5CKSA 2GYIA 1BHGA 2G95A 3RCNA 1OG0A 5MKGA 4DN1A 2PWEA 3SFKA 3R0DA 3IGSA 5K9CA 1LT8A 1MDRA 1VFSA 2DY3A 3AYVA 1XISA 4AFYA 1ECQA 2FQIA 3NL2A 4RNJA 3CXOA 2Q71A 4Y9NA 5D2TA 1Q7QA 3LHYA 3KOZA 3S5YA 1UWSA 5G5IA 1EYWA 1RAKA 1OYAA 3Q58A 1WOBA 3T9PA 3IJLA 1K9EA 3R8HA 4BQ4A 3FEQA 1VPYA 3P6LA 5HMFA 1XR2A 2WBGA 3AZRA 3QZAA 3GFYA 4R9OA 4UFJA 6CGTA 4IGSA 3OG2A 3QJAA 1TVPA 4AH7A 4FNRA 3O6AA 1A5LC 1JUEA 5FF7A 3CMGA 5A8PA 3L5LA 3W23A 4WSKA 1XQLA 3WZ0E 5C9XA 1W9PA 5A2AA 1CXIA 1QI0A 3NQ2A 3GNRA 3WQDA 4V33A 3B0XA 5BU9A 1RK5A 1R9YA 3EWBX 2ZA1A 4ZQMA 3N4FA 3SQLA 1ZAIA 3BLIA 2PE4A 1XYLA 2F6XA 5F2LA 4NASA 3F4DA 1J0ZA 2IKGA 1WDQA 1CPUA 5HQLA 1EL3A 2WC4A 5FF4A 1RJRA 4O0KA 7REQA 1JI1A 1XM3A 2ADAA 4AISA 2C19A 4Q32A 3BMVA 4XAZA 1XH2A 2QQ6A 5BWFA 3FJLA 3O8AA 4IZGA 3TXZA 1UHVA 1EWEA 3FK4A 4L9ZA 3VGFA 1V02E 4HNTA 3G6MA 5HPCA 2BHZA 2VELA 3O9NA 2XSBA 2Y6ZA 2V3FA 3LGGA 1CXFA 3BLLA 4Q22A 3UR7A 1VFUA 1C7SA 1CBGA 4PCNA 4AG0A 5AVNA 1TVNA 1Z44A 3AU6A 3QV6A 1POKA 1JRBA 3PK7A 3ZJ6A 2E0PA 1IZCA 3GG0A 4E2OA 2X0SA 3U7VA 2WVTA 2J7CA 1OFPA 3CIWA 3RHGA 3QQ0A 2ATSA 3TDFA 4KERA 4IJCA 2BVDA 3W7MA 5LNRA 4IXHA 4FPSA 3W7NA 1GVYA 1TQXA 1A0DA 1MXDA 3BOFA 1EJ7L 2A3LA 3QSRA 1D3GA 3TN6A 4IUOA 1XG3A 1ECEA 3IAPA 4GXMA 2VR5A 5BMWA 5F2GA 3RK8A 1R2TA 2XVLA 2G3MA 1Q3NA 4XB3A 4DIAA 4ERGA 2Z1WA 3MP4A 3RR4A 3N18A 2EG7A 1W9DM 3E96A 4AHQA 2P0OA 4YCPA 5CQ1A 3PWAA 1XDJA 3UXIA 2C79A 3CT2A 3VUPA 3LTSA 2HPMA 3BL3A 2J8TA 2QJGA 3MBDA 4TV6A 2DZTA 1RSCA 1A5MC 1YLVA 3F2DA 1UR9A 3EWXA 2X7WA 1OG6A 3LQGA 5E9XA 1YX1A 3PSWA 3SUVA 1UKPA 1YYAA 4OWGA 1HKMA 4WX2A 1JNEA 3UD6A 4DNMA 1W5QA 3CC1A 4P5UA 1W3NA 2PGFA 1R2SA 4OQVA 2J9XA 3NDYA 1H7XA 2ISVA 1FWAC 3AIBA 1LP6A 4L6OA 4F0KA 4E4FA 4AQLA 4Q8QA 4UFKA 3TSDA 4AZHA 1H7WA 4FO4A 4O53A 2ACRA 2XPKA 3UY8A 3WUEA 5DF0A 2A1YA 2XIMA 2O9PA 3VKJA 3OA5A 1OCQA 1RVKA 4TVCA 5CC3A 1LT7A 3SGUA 2VENA 3WDRA 1PE1A 3TC3A 4UCFA 1UUQA 3DG7A 1QNPA 4UTTA 2HXTA 3WH9A 3OYZA 1JYWA 4ZENA 3C86A 2WJEA 1BGGA 1CLXA 4DX3A 3Q4DA 1GOKA 4HMCA 5FF0A 5I0DA 3P5ZA 1YNYA 1Z6KA 4ZB5A 2I57A 1UR0A 4NJJA 4W5UA 4HZMA 2VC7A 4C1LA 1OINA 3HJEA 4L80A 1JDFA 2J25A 3QR0A 4J9JA 3VD5A 3UXAA 1GVQA 3QQ1A 4C6EA 2ZX8A 1R7AA 3N4AA 3MWCA 5U7SA 1WKYA 1OWQA 3GHRA 1KM4A 1Q7MA 1AH3A 3SCPA 2XISA 1J0JA 1V3JA 1XD1A 3ALGA 3WO8A 1EO7A 3BCDA 1NJJA 1ZS2A 1K7EA 4AZBA 1SJBA 1FXPA 3W07A 2FZBA 1H1NA 2OZ3A 2Y5JA 3LRMA 3GU1A 1E0WA 4LS2A 5D8ZA 3CUFA 2BZNA 4CD8A 5GPRA 4O16A 3DN5A 2YB4A 3DGRA 1UG6A 2D22A 1ODZA 4GQGA 3WFAA 4GVIA 4N9DA 1YDNA 4KWOA 2J7HA 3PP7A 2E9BA 1ZP4A 4BKNA 4IMGA 2G3JA 4PSPA 2VOMA 3PBUA 4R5EA 3PVFA 2IMRA 2OGYA 4JXCA 1B57A 4PYSA 3G1AA 4H9XA 1SFSA 3H12A 1W54A 3M64A 4OT7A 3T8QA 1EJXC 1G4PA 1P6BA 5AYXA 3IVUA 4IPJA 2WXDM 1EJTC 3QV8A 2PU1A 5G2WA 3AMGA 1CYGA 1PCKA 3ZMRA 1UA3A 3I3DA 2WVUA 1WO2A 3AXMA 3DC0A 3I7RA 5HDRA 2B7QA 2J79A 3CZLA 4Q8OA 1PEZA 1XG4A 4Q4MA 1J96A 2OMAA 1RALA 3GQYA 1V7YA 4H6RA 5I03A 5KZDA 1X6UA 3OBEA 4XG1A 5HMSA 3BICA 4ONVA 1H11A 3MMTA 2WZMA 2FVMA 1DXIA 3CUJA 4HHLA 4CCDA 2VJXA 1CGVA 2F6KA 3RITA 2FGBA 5FEPA 1NWTA 3ZT5A 5A2CA 1KFJA 2PPGA 1QFEA 2ZRXA 3SUTA 3BAJA 2JGQA 2A6LA 3HBLA 5FAGA 4A3QA 1GYMA 2QNEA 5FESA 1EEPA 3V1HA 3S0CA 4Q8UA 3IACA 5DRIA 3LM3A 3H23A 4DWSB 1M65A 3DECA 2WMKA 4PL1A 4ZQRA 5HWNA 1PB0A 1K02A 2P3ZA 3BW2A 1N8WA 4UTFA 2W62A 3K4WA 3SW6A 3R89A 3KTCA 4KWVA 1RCXB 3PTMA 4UOJA 4JNYA 1WBHA 5XIAA 2JEPA 1AJ0A 3REQA 1A53A 4D8AA 1FWTA 4Q6JA 3CAKA 1Z69A 4O28A 3MJMA 4LYRA 2UY5A 1CENA 3RFAA 3W26A 4LTSA 2OEJA 3WK0A 2IQ0A 3LS9A 4RDYA 4FXRA 5LSMA 3XISA 5D9NA 4G6CA 3KTSA 4YN5A 4AYGA 1TJPA 3SQSA 4AD3A 3MP5A 3C8NA 3GHUA 4WXZA 4IL0A 3BLEA 1W1B1 2B0MA 2EPKX 1Q8JA 3R25A 1QBAA 3NQEA 2CKRA 4O11A 4MY1A 5G4EA 1OT2A 5AHIA 1X7IA 3U7BA 3A6OA 1VHCA 4A35A 3LGEA 3GDRA 1PKYA 1DQWA 2WMIA 4BQ2A 1OD0A 2HNEA 2RDTA 3DCPA 3KL5A 1C29A 5HNUA 2Y7EA 3TR9A 4GC3A 1W32A 1R3RA 4MFEA 4O8RA 1DXFA 3W2JA 1H2JA 4A8NA 2VZOA 1RA0A 4HZ6A 5J8LA 1PX8A 3MKCA 4GO9A 3TJXA 5CPLA 3UR5A 3QFEA 3P5YA 3CHFA 1CNVA 1SO3A 4TX8A 2WOQA 4B3ZA 5CLWA 4IFRA 3BGAA 3KBVA 3AS2A 3ATZA 1QPNA 4LH8A 4QIUA 1YBQB 1BG9A 1YTDA 4JOMA 5LIWX 5DANA 4MY8A 2BY3A 1PL9A 1E71M 2X1SA 2BSLA 4MJMA 4FXSA 2ONEA 4C1KA 2REQB 1E4MM 3O05A 4I90A 4TIMA 4EPEC 5KEZA 2O9TA 1M6JA 1B9BA 1X97A 3CZEA 4PFHA 4Q4QA 4QM1A 4AWTA 1EZWA 2C8NA 1EDTA 3TYEA 5BMXA 1KA9F 2FGZA 5ABFA 3IRDA 4ZO8A 4IJRA 2IQTA 4DF2A 3EA1A 3W37A 3QN3A 5GQBA 2CWXA 1A5KC 4FLOA 3SN4A 4OBSA 4Z0JA 3T4CA 6ENLA 4FIQA 4JQAA 1E6PA 3N2MA 1ZB5A 3KBSA 1FRBA 5AHNA 3VFCA 4FF5A 4HHMA 3LTYA 1VLIA 4HA1A 4H4IA 2I17A 1PZ3A 3F4CA 3MMDA 4X61A 1UZHA 3LCIA 5IBXA 4JZ5A 1TUFA 4FR1A 1G67A 4FALA 3AOFA 1SGJA 2WM0A 3TTEA 5A95A 3SCRA 1VENA 2C1HA 1EZ2A 2ZRWA 3CPGA 1VZWA 2V5DA 3DC8A 3N73A 1FWIC 4JL1A 4L6HA 3ANVA 1UWQA 3Q37A 6TIMA 1Z3NA 4C7FA 3P60A 2Z4GA 3BE7A 1GKQA 2DUXA 4XUGA 3A4WA 3T78A 3UPMA 4MG4A 1XC6A 3IIOA 2WPGA 4G8TA 1ZNNA 2YW4A 3OEXA 2QULA 1HJQA 2HVNA 1V0KA 3UA4A 2YSWA 3WDIA 5REQB 3MHFA 4ZFMA 2CPUA 3AI0A 5FOOA 1OM0A 3MCMA 3AS1A 4X3ZA 3USZA 1DWFM 2EPNA 3TWAA 3LLXA 1MW3A 4QNWA 3ZIZA 1JZ5A 4E3VA 5M2FX 2XYLA 4CQDA 2VXNA 2G8ZA 3LSBA 1GTEA 1I2NA 3AXHA 3FIGA 3K1DA 4WDTA 3WBWA 3IV3A 2H9AB 2J8GA 2XIBA 3SSZA 3VINA 4N42A 2Z7KA 3TN5A 2AQOA 2Z25A 1O6IA 4J7RA 2E40A 1I75A 2NUXA 2JQXA 3KP1A 1C8QA 4AIUA 1JYNA 3MI6A 3BG5A 2PMQA 1GOOA 2RH9A 8TIMA 3BMWA 3FN9A 1I0BA 2Z1BA 1JYXA 1AMYA 1TPWA 4A2RA 2TPSA 2VEKA 2Z1VA 1RP8A 1ISWA 3FDGA 5I3KA 1O94A 3KL3A 4F4RA 2VZVA 3GNNA 1GVRA 7TAAA 5A6BD 2W67A 1J4EA 3L21A 4XKMA 4GGBA 3ID7A 1SJAA 3S5SA 5CXPA 2UWFA 3E6EA 3L66A 4O0ZA 2YZRA 3UZXA 3UESA 2GOKA 3LHVA 2PDHA 2W63A 4LB4A 5JUVA 2PEVA 2YCLA 4IMFA 4AZCA 4J1OA 4HK7A 1HVXA 3R0UA 3CV6A 1US2A 1UZ4A 3DFHA 4ZO9A 4Z2JA 3TCSA 2VD9A 2O7SA 4ECLA 4XVDA 3NL5A 3QMTA 2DPEA 4J3VA 1Q4WA 4EPBC 2PDPA 2PZNA 3VOFA 3WEMA 3CYJA 1QT1A 1YE6A 3PZGA 1OX4A 1ENUA 3WQWA 1YPXA 3C61A 3W1PA 3NDZA 1XYZA 3GYEA 3GR8A 3CPUA 2PTWA 1EF2A 3IJQA 1N8IA 3H2OA 2NSXA 1OADA 4Q7IA 3V16A 2W61A 4YYFA 2ZZ5A 4GVGA 4MLJA 4PUEA 1LBLA 1B1YA 4J40A 1MVYA 1YXCA 3FGCA 3UG8A 5D2YA 2WZEA 3VIIA 1L8NA 2X16A 3E0WA 1DEDA 2PZ0A 2PGWA 1H7PA 5FJPA 3S3GA 1CXKA 2A2IA 3TSBA 4GBDA 2QPUA 1XIIA 4W4QA 3HPZA 3N6JA 1C3FA 2DT0A 2XHYA 3UPBA 1ADSA 4LGXA 1JL8A 4P7OA 3NSNA 5A8MA 3WIJA 4NNBA 5LNVA 1WDWA 1SFLA 3URBA 3WL0A 1YNPA 1TVLA 1IZJA 5H8MA 1QHPA 3EEGA 3W73A 1UD4A 3ECQA 1HP4A 2PP3A 2NVAA 1UKTA 3LDVA 3NZRA 5IDIA 3W7IA 1FXQA 1XXXA 4PRWA 3RUBL 3KRBA 4U33A 1GJUA 4NRSA 1VAHA 1N7KA 5DCDA 1W9UA 2BDQA 1MW1A 2VNCA 4B5NA 1BVZA 4C6BA 3THUA 5FJTA 3GTHA 4A21A 3W6LA 2PWDA 2PA6A 3HZ3A 3SEPA 4GNVA 3R12A 1KXVA 4PB3A 5AYZA 2DSUA 1B90A 4M5PA 3WY1A 2E09A 4LBUA 3WYZA 2GVJA 4DO4A 2G0WA 4CD7A 1JZ4A 1HGYA 4ENLA 3HIJA 3I6TA 3M0JA 3BPWA 1NVMA 4CNSA 4N6EA 2E5BA 5HNNA 4JQ2A 3NVDA 3MUIA 3GDBA 2GVYA 4MOZA 3TNOA 2WWDA 3GLCA 4J3TA 3E3HA 2TODA 3APYA 2WSPA 3ARTA 3TC7A 3GVRA 7XIMA 4GVHA 3QEZA 2R14A 3N25A 2WHKA 4AZ7A 3QOMA 4Q3MA 4MNLA 1XLEA 3AHVA 5C2CA 4DUWA 3WMLA 5C8BB 3IIZA 2BVWA 1T5AA 1M7XA 1U5JA 4H9VA 1VIZA 1ZENA 1US0A 2CESA 3TMLA 1TFVA 1B3ZA 1CLKA 3MCNA 4WSJA 3SUSA 3U9IA 1XLBA 3T0CA 1QO5A 2J6VA 4PMOA 3TE9A 2FZNA 4K8HA 2P5NA 5EFDA 5CPNA 1WBJA 4F2BA 1RJQA 1R86A 1JPHA 4HNVA 3CNYA 4JCLA 2OB3A 3M1ZA 5FD0A 3PAJA 1J8VA 1ZHAA 4TV5A 4I7VA 5DFAA 2UBPC 3HPSA 4Z2GA 1KV8A 2BGNE 2FH6A 1H5YA 4AY1A 1FWWA 2Y4SA 1M53A 3CAWA 3D3FA 1MYRA 3L4YA 5I23A 4TO8A 4DJDD 1R3SA 3C2EA 4G5DA 3BANA 3L2MA 4H8UA 4Z2HA 2DVXA 1VBGA 1YE4A 1K3UA 3V7PA 4IX2A 4AAJA 3IGXA 1R30A 4NAEA 1HNYA 4WKHA 5AYIA 3W84A 3PTQA 2Z2BA 1S2UA 1RR2A 4ZQNA 3QY8A 2J75A 3CUXA 5F4SA 1L0PA 1A5SA 4K7YA 3VIMA 3N29A 4H2CA 4HOXA 5CZJA 1WNOA 1OGBA 5I79A 2NUWA 2WVSA 1LORA 3DG3A 5CZ0A 1AQHA 3FDKA 2QKFA 1AW2A 2V3GA 1GPWA 1OGSA 4HA0A 3QV9A 2PDJA 5JBDA 2FPVA 3N3MA 2FB3A 3N9KA 1JF6A 3ZJ7A 1E9YB 4PCPA 4NYYA 3RU6A 1EDQA 3PM6A 1ZZMA 3MKVA 1ICSA 4DZAA 3CM4A 1KCXA 3B8DA 2E68A 1MUCA 2CHNA 1IGSA 3NQGA 4IFKA 3L9CA 3VO0A 4IP4A 2WMGA 4CNNA 1Q6OA 3H2EA 4ZGYA 1QOPA 3HA1A 4NSBA 2NQ5A 3CQHA 5LNWA 3ZM8A 4O15A 1VF8A 3GSMA 4C7GA 3NSMA 1L2UA 1QNVA 4M0XA 4MDOA 3JW7A 2D23A 1Z7AA 1QPOA 5FEZA 1V0MA 1HKWA 4YHGA 2OSWA 3VOHA 2WNQA 3S9YA 2NXHA 1E73M 3BXWA 3VIOA 3M41A 3S2LA 5E0KA 1WKDA 3W38A 4RV3A 3K8LA 2BS9A 3NQFA 1LBMA 1UA7A 2V2HA 3HOJA 2C91A 5F4XA 1IYXA 3CV1A 3VDCA 3QY6A 4LRTA 3W1XA 5H91A 4O4VA 3VX0A 3LYEA 2E9MA 1XH0A 3QYSA 3CUIA 2NUYA 4CNPA 3CJPA 3NPWA 1TO3A 3P74A 2P8BA 2A3AA 3NPXA 5A2BA 2FMOA 2XGBA 1NDYA 1IT7A 1EWDA 9RUBA 5HUOA 2P0IA 4DUVA 3GO2A 1J11A 2RJGA 4PUJA 4MVAA 1KB3A 4D6FA 4WOZA 4KCTA 3O0KA 1BTCA 1W91A 1OZMA 3KLKA 2WSQA 3WDJA 2I9EA 2D73A 2B4GA 1OY0A 1XFCA 4XZLX 3TK7A 1R0MA 2D3NA 4FB7A 1M41A 3MTWA 1BPLB 2CLEA 1ZSXA 2FVLA 3OLIA 2ZDRA 4V15A 3F5LA 1XHGA 3GX9A 1XINA 1BXNA 4EVZA 4JHOA 1LLZA 3ES8A 4POCA 4DUXA 3HV9A 4R7JA 3T2QA 3S9IA 2DJLA 4HCLA 3CHCA 5E5CA 3LOTA 3ABXA 1V3LA 4M81A 3GXDA 3W53A 1M01A 3KXQA 2O56A 1Y5VA 4MPKA 4RLIA 2AL2B 2OX4A 3L0NA 4BEUA 3EDFA 1FDJA 3DG6A 1KLYA 3GNOA 3BJFA 4JGDA 2XFYA 1S38A 3BAKA 3IK4A 3IANA 2E6YA 3HM7A 1I2QA 3I10A 4RR4A 3LXBA 3RG6A 2VRQA 5D37A 4XAFA 1VYRA 1ZBCA 1UP0A 4HGXA 4AVNA 3TXVA 1FH7A 3D6NA 1W1VA 3LD5A 4LC8A 2GUUA 4QROA 3SJNA 3NPUA 1JDEA 1WCGA 3C2FA 3GXFA 4CQ9A 1GW9A 4K8GA 2JFEX 2PWFA 4HQVA 4FOKA 4S1FA 4XKYA 6TAAA 2WJZA 2ZRZA 3EOLA 2D1ZA 2CYGA 4OBTA 1MDLA 3UU0A 1EXBA 3ATYA 2TRSA 3A64A 2CERA 4ILSA 3N14A 1K8YA 3ZZ1A 3PS7A 3IIPA 4OBRA 1K03A 4PBFA 5A6AA 3TKFA 2Z28A 4FNQA 1RXOB 4AHOA 5MHBA 3BLFA 5ECVA 1JAKA 5K9XA 3BG3A 1U30A 1DV7A 1DVJA 3EB3A 3KHDA 1AD4A 3WLLA 2BBFA 1W0MA 4M3PA 1NDVA 1BWLA 5L9FA 1F61A 5ABTA 2CHRA 4WD0A 2W0UA 1FWBC 5FJIA 3DFOA 4XZHA 2A3CA 3DFYA 4GA8A 1R85A 1PKNA 4KWUA 2P8CA 4Q7BA 4BI5A 4FLRA 2I14A 3EWCA 1EBHA 4JTFA 3URAA 3N12A 1ZALA 3TW7A 1WB0A 3RLHA 9XIMA 4Q4OA 4PUNA 1Y5XA 3ARPA 2O92A 2QCGA 4JTLA 1WZLA 1GW1A 3ZFHA 3ANYA 3OO2A 1YTEA 4WJEA 2OJPA 4GGHA 4UFMA 3TMQA 4JX4A 2Y8KA 2Z0IA 2R8WA 2GGGA 1G01A 4UB9A 5MKGB 4RX0A 3ARRA 3S6OA 3STCA 1ITCA 1CGTA 2EJ1A 3L0KA 2VC9A 1HJVA 3JZEA 2J9YA 4JTIA 4JCMA 5I2UA 1R9XA 4XZBA 2NQZA 1UROA 2Z27A 4UTHA 4O0QA 2A3BA 1SSGA 1NTHA 3BW4A 4KESA 3W2UA 3DFQA 1FWCC 3GDLA 2F2KA 4KKXA 1OYBA 4JNZA 2A7RA 3U6WA 2INEA 1QI3A 1A0CA 4F8XA 1F74A 3T81A 3G1FA 4HCHA 1AH0A 4NHVA 3EXRA 4JTQA 4PTWA 4G2DA 3BOLA 2NV9A 3GXIA 4JIIX 1LL4A 1VFTA 1IIGA 1Z89A 3NQCA 4GKTA 4RK8A 3T1GA 4NUWA 3P2VA 3OQ8A 3WELA 1QUMA 4C6QA 1SMAA 4WY0F 1E4IA 1AD1A 2J88A 3VCRA 1GGOA 3LCLA 5DMMA 3MDUA 3KDNA 3T0DA 4IF2A 2OYLA 3DYPA 3WK2A 3NGFA 4GYKA 2X41A 2D3LA 1VR6A 1C92A 4RXFA 4KWWA 4DF1A 4LVAA 4GO8A 2PD9A 2BOEX 2UV8G 4DZHA 1HTIA 1ITXA 1IV8A 4UNIA 1BSLA 1TMLA 7REQB 1EYEA 4DXXA 2ESCA 1DPMA 4D6GA 2CLHA 1LBFA 4TTUA 2J66A 1JXKA 2XVNA 4MWAA 3SUWA 4UXDA 4DELA 3AMKA 1JCTA 1RHCA 3WF0A 3AIWA 4KIEA 4HPNA 2A7PA 2EPMX 2GVGA 2OR2A 4GKLA 4B91A 4D6IA 3LTPA 2W4XA 2ZCGA 4JKLA 1F05A 3FKKA 1FDYA 5CGMA 1DE6A 1OF6A 1XLLA 4ZOAA 4NZ1A 2NXIA 6REQA 1EX1A 1QI4A 2VZTA 3WLRA 1E72M 3EWYA 3EDDA 2JKPA 2QIWA 4LF1A 4R3UA 1MQRA 2YDQA 1F3XA 8CGTA 4E2DA 3L2IA 4JTGA 3OYXA 2AMXA 2GFTA 2VCCA 4H3DA 1VJIA 3E5BA 1EP1A 3W76A 4HMDA 4QJ5B 4GQBA 3APTA 1BEUA 4MNKA 4LS1A 2VX7A 1HW6A 4CN1A 3UWVA 1D9EA 3BW3A 4ZB2A 1A4MA 1PZ2A 3UG4A 1J93A 1MI3A 1UD5A 1VYSX 2E9LA 2BXYA 5IRPA 2B7NA 1A5NC 2YBVA 4RDZA 4ATLA 4RDVA 2O4QA 1IEXA 3EDEA 2BY0A 3UR2A 1ZBKA 4MYXA 1X96A 3W2MA 3N2TA 3L4ZA 1RLDA 3H2FA 3RRAA 5DMNA 1FCBA 1H50A 3PF3A 1S2VA 3KCOA 5EMUA 1JPKA 1QNRA 3AHXA 2E4TA 3R8RA 3S2NA 4PMXA 3NQVA 2PDWA 4Y9AA 4TUFA 5A6BA 4ZVJA 4E4UA 3STGA 2YXOA 4KCUA 3VKDA 3LA4A 4GXPA 3TROA 3B8WA 2YIHA 4GNJA 5HWMA 1AL8A 4NYUA 1FY6A 4MKVA 4L1XA 3ZWSA 2ABBA 1PSCA 3MUAA 3KVJA 2POTA 1ADDA 3W1MA 3THAA 1C91A 4GIAA 1Q2RA 3EPOA 2WO5A 3SCOA 2BHYA 3GK0A 3VIJA 4YJ5A 1BWKA 3OPSA 3UF9A 1V3IA 5HUPA 3TV8A 1RQBA 3W7HA 3KAOA 3WMCA 3O3RA 3GG7A 3S2CA 2ODOA 3W7LA 1ZP3A 2VFEA 4AW7A 3CHEA 2GJNA 4HA4A 4QSHA 1LG2A 4NJGA 4QDWA 3PWGA 3ARVA 3AICA 1EJUC 4WLCA 1KR0A 2NT0A 3NO1A 4CCEA 2WQPA 1SO6A 1EGMA 4EP8C 1UBPC 3VKBA 1JI2A 3ME3A 1EP2A 2CNCA 3FJNA 1I6NA 5HR6A 4NZFA 1G94A 3W75A 2X7VA 1R2RA 1LWHA 3TTYA 4FA3A 2JIWA 3VTRA 2ZZ1A 1GOMA 4LALA 3THCA 1RY8A 4GMEA 1AQMA 4H83A 4DY1A 3L68A 4HSHA 2OOFA 3ABRA 4U5KA 2WSYA 1VP5A 2X30A 4JTDA 4KEZA 2YXXA 3OZMA 1O7AA 2E7FA 4PMNA 2QVHA 3POCA 3S1GA 3UJSA 3O16A 1EGZA 5HMDA 2Y63A 4AF0A 4XTDA 3G77A 1G1YA 5FACA 4AUBA 3VOGA 2TSYA 2PTXA 3UW6A 3FV9A 4ADTA 4YU1A 3C2OA 1OK4A 3EOUA 4JFSA 8RUCA 2OEKA 2YLAA 1HO4A 3R10A 2OSXA 4US6A 4MJ2A 3T7VA 3GW3A 3CEUA 4DXKA 1XW8A 3NEHA 3LCWA 2DIEA 4QRNA 1K4HA 4L6DA 3VCCA 1DJGA 1S2AA 3BDKA 3PZ9A 3T42A 3MDWA 3GY1A 1QWGA 1NQKA 5EMMA 1MEWA 2DZSA 2JF6A 3ARYA 2FFCA 2EBNA 3P8IA 5CSSA 3KFTA 3EMZA 3VDAA 3LM7A 1E55A 4IHCA 3RYSA 1S2CA 3FYOA 3F4NA 2YYTA 4F0MA 3KTXA 3LGDA 4M29A 3CZKA 4PUUA 1KM0A 4GWEA 1J0IA 4EPDC 2UZ9A 2H8XA 3EKLA 3OVGA 4CEXC 2X0HA 3SCQA 5GNYA 4S3DA 4WCJA 1O68A 4ACZA 1NSJA 2QYGA 3ES7A 1J9YA 5C9RA 3VNDA 3G6LA 1O5QA 1WUEA 1OJXA 5FEWA 3GAKA 3N2XA 5I3HA 3MJYA 4GI9A 3VILA 2CETA 4J3UA 1QI5A 4GHRA 5DEZA 2J7DA 1P0DA 1JUBA 4UOQA 3CO4A 5D05A 1DXEA 1BWVA 1VEPA 1CGWA 2FYMA 3GC2A 4YNGA 3S83A 2OZ8A 4DHGA 3TYUA 4TQTA 4XZNX 4DJDA 4ZQCA 1V6YA 5GNZA 1SW7A 4LUTA 4CVUA 1DHPA 3HO8A 4UCGA 4XVEA 5JU6A 2PGEA 4W7UA 3SY8A 1P5BA 1ZJBA 3AIRA 3AFBA 1ZL1A 1QNQA 1XYMA 3GFXA 4KETA 3M16A 1CEOA 1PTGA 2IS7A 3DH7A 4DWSD 5BOFA 1QK0A 1EC8A 1XQKA 3PULA 4FNUA 1Q65A 3DESA 2CZDA 3POHA 1XLGA 2PDBA 2HSAA 3B40A 3OHIA 3RMJA 1AA1B 3NXFA 6ALDA 1O5XA 4KWSA 1O4UA 1V3HA 1K6WA 3GS6A 3N13A 4EOUA 4E8GA 1XICA 3AXIA 1OFAA 4NNAA 2WMIB 3BSGA 1W1TA 4K39A 2J77A 1H7RA 5EBAA 3BLPX 3VD7A 4QG8A 2V5KA 3M4HA 4M7TA 3NVTA 4UTMA 3QGVA 1OC6A 1TREA 1HN1A 1HKIA 1WKEA 3WD3A 4M82A 2KX9A 1UC4A 4A3UA 3CUHA 3TYBA 1O60A 1M1BA 2B81A 2Y8VA 3PZVA 4J3XA 2INFA 4WJ8A 2CLKA 3BJSA 3S1VA 3W70A 2WMHA 3L5MA 1J10A 3CTTA 3LI0A 4QNEA 3ZO9A 1J0KA 1TCDA 4MMWA 2WLYA 3QZEA 1HIZA 4K7VA 3GC4A 3DERA 1JCMP 1W1IE 4LT9A 1KFWA 1NM9A 1IEQA 1E9LA 2HPIA 3WEZA 1EOMA 3EMQA 1TX0A 4W93A 4IL2A 5AYBA 4JYDA 4M1BA 3HFTA 3CLMA 1P1XA 2BTMA 2DVTA 3ZSSA 4W85A 4AY8A 5I09A 2BLEA 2PDXA 4AX7A 4MY9A 3GW0A 1DBTA 2DJXA 4US5D 2QF7A 3D46A 1BRLA 3PG9A 3F4VA 4MKSA 1GOWA 4KW2A 1GOXA 3BCFA 1A80A 4JY8A 1HP5A 3ONBA 3GTNA 4GH1A 3DYOA 3HQOA 3LNPA 3W82A 2D0HA 3KZSA 3VMPA 3U2OA 4WOQA 5HBFA 1QPKA 1TZZA 2C6QA 3KCLA 6XIMA 4HYRA 3KOYA 4C90A 1JULA 1OK6A 1VPQA 2WKGA 2WSKA 3NWRA 4MTVA 3W7OA 3WDQA 2DORA 3OW1A 4JPGA 3LLFA 3ZQ9A 3EAUA 4ICMA 3U2ZA 1IWAA 4ZE5A 1NWUA 3KOXA 4OGZA 2GSEA 4HNUA 2BVYA 4DWSC 3DUGA 4GBUA 5BXSA 3B03A 3EBVA 4NU7A 4ZXLA 1PIGA 2D24A 1NOWA 1JJKA 3LBOA 4PUKA 3TJIA 2VGFA 2R6OA 1MFVA 4D6CA 4QG6A 3KLLA 2DU2A 4Z2LA 4LUSA 4OUEA 3STFA 2WZIA 3WX7A 4HN4A 5HR7A 2NLIA 3PJTA 4MB4A 3A22A 3W1NA 1H7OA 2ICSA 2CZEA 1LUCA 3BV7A 4JEJA 4IIHA 4B4FA 5L6UA 4C91A 4S3JA 1G5AA 1TWWA 1P0EA 4ZMGA 3M43A 2QW5A 3M0YA 5DT5A 3AYTA 3SBFA 3DHPA 5I3DA 1AMKA 1B3WA 2V38A 3GM8A 3O6DA 4UMBA 2Y5SA 1XH1A 2CXGA 3H55A 5LA1A 5IM51 5A5WA 3AXKA 4NJKA 2X42A 3AWNA 2CEQA 1R3WA 5GJNA 2A3EA 3FYYA 1X8FA 3EPMA 4MWAE 1PHQA 3BVJA 1FKXA 2Z24A 1V0NA 4GZJA 3DXIA 3S2MA 1VBJA 3UG5A 1Z41A 3GWQA 2ZX9A 4V1XA 1L6GA 1L6FA 1H51A 4H9YA 5C0QA 5MF5A 5GNXA 3FHAA 5T9CE 3Q94A 2W91A 4HU3A 3DZ1A 5FF2A 3W29A 4KFPA 5AC8A 3ZXWA 1OX5A 3NL6A 2R1LA 4K1WA 3KM8A 2WQDA 2PRLA 3TQKA 1UR1A 2HEJA 1JVNA 2VO5A 5LXEA 3S5OA 3GKFA 3FJ6A 4WRHA 2YCLB 2X05A 3VI2A 3NZPA 1MW2A 1VCGA 4XTIA 1C9DA 3UJEA 3IVTA 4MB5A 3G0XA 3OZYA 1UC5A 5DRCA 1FFQA 4Z08A 1CX9A 1XKJA 3MUXA 3QGAC 1QPRA 3GU2A 4FLSA 1DJQA 5F1UA 1FDZA 3L23A 2C1GA 5A1AA 3SFWA 5CZTA 2V8ZA 1OX4B 3LUTA 1EX5A 2BOFX 3N04A 5CPSA 2X1IA 3BAWA 2WW5A 4UUIA 2J27A 3BARA 3TJ4A 4EK7A 3G1VA 4CNOA 1I60A 2VL4A 1FQ0A 4NRRA 2A7NA 1VB9A 2LLEA 1Z9AA 2QUNA 3EB2A 1D8CA 3FGCB 5A6MA 2A5HA 3C6CA 3NOYA 2YA0A 1DOSA 2I5QA 2YBTA 1QW8A 3TU9A 4GYFA 3TOPA 4AD5A 3I4KA 1V6UA 2ZWYA 3KBWA 2PLKA 4Q4SA 1XLFA 1UW9A 5KTLA 4ICCX 5AOUA 4ROQA 4DYKA 1W1A1 2F84A 4RE4A 4CU6A 5J5DA 2XVPA 4UQ9A 3ZYZA 3GVGA 4IISA 3SY1A 3KE0A 3GH4A 1XV8A 3PHAA 3ABZA 4O14A 4M6QA 4KMQA 2AGTA 4JN6A 3CYVA 2FHCA 3UZWA 5M5DA 3F5JA 2ZVRA 2OLAA 4RCXA 1XL9A 1XGDA 3R7MA 2G4FA 4K38A 3MHUA 1XIMA 2MANA 3EOSA 5TF0A 3H53A 3TAKA 3UJRA 3WCZA 3GDKA 1ZFJA 4O19A 4XBJA 1IHIA 4Y96A 5CBIA 2TMDA 2HWGA 1UASA 3E0IA 2QUTA 3UVIA 1VD6A 2DFAA 4QLJA 3OODA 5I07A 3SZ8A 1XCWA 3SIMA 4LU0A 1CIUA 4LYKA 1P7TB 2GGHA 2NQ9A 2JBMA 3LHTA 1H1YA 1F8IA 2CWNA 1IXPA 2V3EA 4JEQA 2HBXA 3B9NA 1DJYA 1W8GA 3QHNA 2Y7FA 1GVEA 3PJXA 1W2VA 3AJ7A 4QXIA 2MNRA 1FWFC 1BF6A 3O06A 4KS0A 1J79A 4JTSA 1BYCA 4ZR8A 1U1UA 3WLMA 3RLUA 1OVDA 3VDBA 4KRUA 1OIFA 1SO4A 1QNOA 2BNJA 3VGEA