1H1YA

The structure of the cytosolic d-ribulose-5-phosphate 3-epimerase from rice complexed with sulfate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
219
Chain Sequence
AAKIAPSMLSSDFANLAAEADRMVRLGADWLHMDIMDGHFVPNLTIGAPVIQSLRKHTKAYLDCHLMVTNPSDYVEPLAKAGASGFTFHIEVSRDNWQELIQSIKAKGMRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords D-RIBULOSE-5-PHOSPHATE 3-EPIMERASE
publication title Structure and Catalytic Mechanism of the Cytosolic D-Ribulose-5-Phosphate 3-Epimerase from Rice
pubmed doi rcsb
source organism Oryza sativa
total genus 76
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1h1yA00
1YLVA 4LVBA 4N9DA 5E0KA 1S3HA 2VFHA 4RXGA 4PC8A 3LGEA 4CNOA 1GPWA 3RF9A 3O6DA 2GOUA 1K8YA 4IQLA 3CT7A 1XFBA 4JGDA 2WJZA 4E2BA 2Q8ZA 4G1KA 5K9CA 3LBMA 1BTMA 3NEVA 2V8ZA 3NOEA 4N2YA 2QCNA 4N9EA 3DFQA 3R8RA 3SZ8A 4NJGA 3GDMA 2GQAA 3W7NA 4NU7A 1H5YA 5KZMA 3QQ1A 4ZQNA 1TO3A 1C9DA 5U4NA 4UTHA 1QOQA 2CLFA 3GLCA 5DXYA 1WA3A 5C6MA 1ML1A 1MEWA 3KFTA 4AH7A 1KLYA 2ZQ0A 2W0UA 2WNQA 3DBPA 5HWMA 3QMRA 3HQ1A 1KBJA 2C3ZA 3IGUA 3DFPA 4YCPA 1F76A 1G7VA 3STCA 3CC1A 5FI8A 3HPZA 3W73A 4HNTA 3MW7A 3QPZA 4RK8A 4LV4A 3TK7A 1M6JA 4YMZA 4JX4A 2J9YA 3DKLA 1SPQA 2C6QA 2V82A 3EWYA 4ZZ9A 4XBKA 3EX1A 3LX9A 2Y7DA 4TIMA 1CI1A 3KX6A 4FNQA 3IV3A 1GTHA 4GRSA 1G69A 3PBUA 4JNMA 3OEXA 3LHZA 3PVFA 1JQXA 2RDTA 2ZZ5A 5HR6A 2C0AA 3P67A 2PRHA 4M19A 1K02A 4FNSA 1TTIA 2IQTA 1HL2A 2YX0A 3BVJA 4NT0A 2G95A 3F1QA 1X8FA 1E51A 3EX4A 4OQVA 3W7DA 4XQ6A 5AC6A 2FB3A 1GVQA 5H91A 4OHQA 3S1UA 2C16A 4N4QA 3W7GA 4LUIA 4X3ZA 3RFAA 3FS2A 2G5WA 4HIBA 4O14A 4UTWC 3LV5A 3MO7A 2DZTA 5DLCA 3TQVA 5J5RA 1XDMA 1N8FA 2OCZA 3FIGA 1GVSA 4CCEA 1OFBA 5CGQA 2B7OA 5D33A 1T99A 3NDOA 2WNNA 3HGRA 1DJNA 5D30A 1QO2A 5A8GA 3SI9A 3UZJA 1JUBA 2EAWA 3QF0A 4UNLA 4E2DA 3HO8A 4K36A 4ONVA 1H62A 2NX9A 1OX4A 3NM3A 3WJXA 2RH9A 2BLEA 2QCGA 1OFDA 4UFLA 4LV9A 3M43A 3E9AA 3HG2A 3NQFA 4MKNA 3WJYA 1SW3A 2HS6A 1TPVA 3DFSA 5IBXA 4OE7A 2FQIA 3EKLA 3Q94A 3BK0A 2QCMA 3G1AA 3BGGA 4D2JA 4H3DA 4MUZA 2E6DA 2JKEA 2V2DA 4BR1A 1TMHA 1ADOA 4MZ1A 1W3IA 4K37A 4JX5A 1H7WA 3CPRA 3M16A 1NSJA 3BG5A 4FO4A 5F1VA 2F7FA 1KV5A 3HF3A 5DXXA 3W9ZA 4AHPA 3R5EA 3SIZA 4BI7A 2VFEA 1HO1A 3TAOA 3L2IA 1ALDA 1A5CA 3E02A 2Y62A 1O4UA 2EGZA 3G0SA 3W7MA 3SECA 2ZA3A 4JN6A 2ZRXA 1SR9A 3TX9A 4MVAA 4QNEA 4BF9A 3W7RA 3W7EA 1B4KA 3FKRA 2X2GA 4O19A 4UTTA 1NAL1 2EHHA 3C2OA 1G4SA 2CLOA 8TIMA 3B4UA 1LOLA 1L6YA 3C0JA 4O10A 4HKPA 2ZRUA 4LRTA 1LYXA 2Q8LA 2VFIA 3L67A 3CEPA 3MBDA 1NF7A 3B05A 3O1NA 3W2NA 3O07A 1THFD 1TPUA 4OBTA 3M5VA 1DOSA 1OG0A 2WSRA 3L5MA 3PY2A 4O0ZA 4JYEA 3VCRA 2ABAA 1SSDA 2YPIA 5A5WA 1MXSA 2J9XA 1TQJA 5CZSA 5L6UA 3S5YA 3I68A 1AMKA 3THQA 1YTEA 2F84A 5EYWA 3L68A 3LERA 4BFAA 1L6WA 1W0MA 1A5AA 3W7OA 4ZQRA 3EWBX 4JTKA 1LBFA 1FWRA 3W7HA 4CQAA 3BW4A 1WQ5A 4O1DA 5CPLA 3PB0A 4ZMGA 5U7SA 2ZZ3A 3U8GA 5BNKA 3DXIA 3M47A 4OT7A 5HNRA 2AQWA 3M7WA 3NVTA 2EKCA 4MY9A 2VEIA 2ABBA 2ZRWA 3ZS4A 1TJRA 3O63A 4TU1A 4HT3A 4O4WA 3N14A 3R89A 2C1HA 2YCEA 3GYEA 3QSTA 4HNUA 2GVLA 3I65A 3UQNA 4DPPA 2X30A 1YDVA 3MHUA 4UMCA 4CLMA 7TIMA 5FF4A 1KFBA 3G1VA 4YXGA 1LORA 1XC4A 4O13A 3NQEA 4RZ5A 3W1PA 5G2WA 3NQCA 3F4WA 4M6VA 4GUHA 3UPBA 1D3GA 2UV8G 3HG4A 5CKSA 5J5DA 3S42A 2FJKA 4Y90A 3KVLA 4LVGA 2X1TA 1RR2A 3GKAA 2ZZ7A 1F6KA 3TIMA 4DQWA 3M5ZA 2CZ5A 4AWTA 2YDAA 3NZ1A 3C2VA 4L4LA 4UMBA 4POCA 1FX6A 5D2XA 2P10A 3TSBA 5CSRA 4XBSA 2DJXA 4RLIA 4XZ9A 3GB6A 2WV8A 4Z1AA 3GXTA 4JDBA 1FUYA 3EX3A 4HN4A 1SZNA 4WX2A 1FBAA 4NZFA 2FDSA 4QJ1A 3LTYA 1Z41A 1JCYA 1KM5A 2DZVA 2BX7A 3TW7A 1KBIA 4M6QA 3C2FA 1QFEA 4PODA 2H3DA 3W1RA 1VHNA 1K8XA 4H4IA 5CPOA 3PR2A 1K8ZA 2ISVA 2NV2A 4LUJA 5F2LA 5LKYA 3CHVA 3DFOA 1T0OA 3C6CA 1B3OA 1GT8A 2TPSA 3BLIA 1EWEA 4RXFA 4E0CA 3W2JA 1KTNA 5T26A 5DY3A 1WXJA 3WK3A 3G1YA 4TMBA 3IIZA 1JULA 2QDGA 3A21A 3ABOA 1KM6A 4ORIA 5HR7A 3ATYA 5LGZA 5ABTA 3KXQA 3NZRA 4LW7A 4ICNA 4MFEA 1GZGA 1NVMA 3MMTA 5F4WA 1V7YA 3DH7A 2X1UA 3W2MA 1UUOA 2V5BA 2TYSA 1LDCA 4AB4A 3SGUA 4QNWA 1ZALA 2J24A 4RCXA 4FX8A 2CU0A 3G24A 3N3MA 3DI0A 4FIQA 1OYAA 3IVUA 3MUXA 2BSLA 1YXCA 3QW4B 1VYSX 2H3BA 3GXNA 3QC3A 3TQKA 5D04C 1LROA 2Y61A 3TMQA 3E0IA 4JX6A 3PBVA 3NQDA 4WJEA 4Z08A 1YTKA 5HQEA 2B4GA 3W1AA 5D2TA 3UNDA 3CTLA 3FA5A 5KTLA 3FOKA 1G67A 4O8RA 3RLVA 1QPRA 1ICQA 3P84A 2QEZA 2VKZG 3L0KA 1OJXA 3G3MA 1F73A 1TPDA 4IXXA 1FXPA 3N34A 1W5QA 1GTEA 4LWWA 3S8HA 4GBUA 1KLZA 3LI0A 2H6RA 1WOBA 2GPTA 1LCOA 5CZTA 4O28A 1XKYA 5LGXA 1FDJA 3KVMA 1EWDA 3N73A 4EOUA 1ONRA 2V2HA 3EWUA 2NWRA 4JY9A 3TMLA 4GC4A 1AW1A 4RKAA 1XM3A 1FQ0A 2JBMA 4GXMA 3MP5A 3W70A 2PRMA 1FCBA 1S5VA 3IIPA 3QYQA 4NUWA 5KMYA 3T55A 3TSMA 3DHFA 3N9RA 4MZ8A 1XUZA 1BWKA 4OV9A 4WXZA 2Y89A 1K7FA 4IMDA 1XBYA 5BW6A 2ZRZA 3CB8A 2NX3A 3LHWA 1UCWA 1PS9A 2E68A 3RNDA 3W1QA 5HULA 4UTUA 2Y88A 2RFGA 1R2SA 4FX7A 3W87A 3P82A 2PURA 1OF8A 4CQ8A 3RU6A 1QO5A 1I2RA 1VYPX 4Q33A 4JDYA 1F5ZA 2FB2A 1G4TA 1TPFA 2CZFA 2DORA 3NXFA 4ALDA 1FCQA 3F4NA 3USBA 2A7RA 3YPIA 2BWGA 3LCWA 4AMAA 1SZEA 1QR7A 3WJSA 5HWJA 5D03A 5DCEA 5F1UA 1CW2A 4HPJA 4AVFA 1JUEA 4WY0F 1H7PA 2NXGA 5D2VA 3UWVA 1JCJA 5KZDA 2ATMA 1FCUA 3PF3A 1EIXA 1LOSA 3NAVA 2GJNA 3NR0A 2QKFA 3W76A 2A5HA 4UNKA 1DKWA 4O15A 3LV6A 1RQHA 3NQ8A 3ELFA 3TC6A 1KA9F 1W1ZA 1S5WA 1FWSA 1Z48A 1W5MA 3GXPA 4X9SA 1L2UA 3L0GA 4BWLC 5LNWA 4A2SA 3SFKA 3WK1A 4JXCA 1OX6A 3SJ3A 2QJHA 3M0ZA 3M5YA 4C1LA 1RZMA 3H54A 1HTIA 5AOUA 3STFA 3EEGA 1KFCA 1SO6A 1LRTA 5D09A 3A24A 3HGJA 3ZFHA 4LS1A 3L66A 5KSWA 4I9AA 4KKXA 1HFBA 4LS2A 3UPWA 2C13A 4IJBA 4M7TA 2VENA 4UFMA 4Q4KA 2TMDA 3PULA 4IX2A 2TRSA 3W7JA 2GVJA 2PCQA 3W7IA 5D02A 3QSRA 4O1CA 1TV5A 3TE9A 3LXCA 3UY7A 2RKXA 1P5BA 1ZNNA 1AK5A 2Z0IA 4DO4A 2DU2A 3QQ0A 3TJLA 3W7CA 4U28A 3DGRA 4FB7A 1TV8A 1FWTA 3TROA 1X1ZA 1YTDA 1QPNA 3H55A 4FNTA 1QWGA 1RVGA 3MJYA 3PC0A 1TQXA 1Q6OA 3HG3A 1AL8A 3NL2A 1VZWA 1PCKA 2C19A 4Q32A 3A23A 1H1YA 2CLMA 1XCFA 1VQTA 3NL3A 2ATSA 4QM1A 2NX1A 4JTEA 3KRZA 3SSJA 2RDWA 3H53A 1JRCA 4JTHA 3CIXA 5AHIA 3IRDA 3L9CA 1AG1O 2GJLA 3TDFA 5AYYA 3R2GA 1ZAIA 3UWYA 1EA0A 4XUGA 2BXVA 2PRLA 4LVFA 1UBSA 2W6RA 4FF7A 3BW3A 3TC7A 4R7JA 1D3HA 2X16A 3LTSA 1FDYA 3TFCA 4NZJA 1M5WA 1TTQA 5BMXA 5D37A 4DF2A 1SSGA 3QPYA 5CPMA 3EXTA 5I3GA 1Q6RA 1DJQA 4JIQA 2Y7FA 3S6DA 5AHFA 1SW0A 4O54A 3CU2A 1SO3A 1R46A 1H7NA 4A29A 1U83A 2EPHA 2R94A 3S5NA 3ABSA 1QPOA 1S5TA 2H8ZA 1X1OA 3RLUA 3P80A 2V30A 2ISSA 5IBXC 4IMFA 3G0XA 1UUMA 3W3OA 1T96A 5EBUA 4JYDA 1F74A 4UR8A 4FHAA 3STEA 2R91A 3DENA 1O95A 4PH6A 3EWZA 3LRKA 1W8SA 4M7SA 4MFDA 1P0KA 3SY5A 3QRHA 4UIOA 4BK9A 4CCDA 3TV8A 2O7SA 2RDUA 3RMJA 3S1VA 1OFOA 3O15A 5CZJA 3VI2A 3CLMA 1F05A 3OBKA 1W31A 4E38A 1TTPA 3LCGA 4NJKA 1I2OA 1OK4A 3BLFA 5AHMA 1ZFJA 2CLKA 1UASA 5I3JA 1YXDA 3IVSA 2V5LA 4FXRA 2ZTJA 1RQBA 4LC8A 4QISA 3W1XA 1ZAJA 2YW3A 5AB3A 1WAUA 3QEZA 1H50A 3A5VA 1H7OA 3C4UA 4IMGA 3ZWSA 3OVPA 3QW3A 1TPWA 4ML9A 1GJPA 1Q3NA 3LLDA 1OVDA 3IGSA 4UTTC 3BG9A 2GQ8A 2Z6IA 4EIVA 1OFAA 2XN0A 2E5CA 6ALDA 4BI5A 1IXNA 2J27A 3EKZA 1WV2A 1ME9A 4S2CA 3LCLA 1TRDA 3F03K 3W2UA 1VH7A 1KM1A 1KM4A 3L5AA 4EF9A 1RQEA 3W2KA 4KWVA 4DBDA 1B57A 3FYPA 4FNRA 1VHCA 4WD0A 2ZYFA 3GKFA 1QMLA 2J6XA 2QJGA 3BLEA 4DO6A 1AL7A 6TIMA 1F2JA 4Z0JA 4DEFA 3M44A 3O06A 2OJPA 5C2XA 1ME8A 4XKYB 5HJLA 1VJIA 1RV8A 3GDRA 2E6AA 1ZY9A 2DZUA 2E77A 3WJWA 3OIXA 4IGHA 2YYTA 1EP1A 4TX9A 3QJAA 3MHGA 3AJXA 4PL2A 4UFHA 2FFCA 1PV8A 1OYBA 3S5ZA 5TIMA 1JVNA 4IXHA 4UTKA 1GYNA 5EY5A 5KINA 1WYIA 2OZ0A 3VKJA 5AHNA 3BPWA 4DF0A 4RZ6A 3P5YA 3GDTA 3EWWA 4N4PA 3VFLA 5F2GA 1KTCA 2QCHA 1DV7A 1I8JA 2E5DA 3P8JA 3TXZA 4AWUA 4WY0A 3W1UA 1FWWA 1Y0EA 3CQ0A 3W1MA 5K2ZA 5HUOA 4YWIA 3IIVA 3E12A 4UTLA 1JQVA 2HS8A 5G1TA 2HTMA 4JTLA 3W07A 4FX6M 2CZEA 4JTJA 5LNRA 4ADSA 1EEPA 2WSYA 2YSWA 1GG1A 4JD4A 3LCXA 3QFEA 1GWJA 2QUUA 3C52A 4O12A 1JR1A 3UXAA 4A22A 3GR8A 4NX0A 4Y8FA 4WZHA 4UTJA 2QUVA 1AW2A 5G4WA 2YFOA 5K9DA 4IPIA 5FF2A 2WOQA 4M5PA 4ZL1A 4GUIA 1SUXA 4JTIA 1ICSA 4B5NA 1QNVA 5G2HA 3PB2A 4LRSA 1LTDA 2E1DA 5G4EA 1T8XA 4MYXA 4GUJA 1KFLA 2DZSA 4A3UA 3O05A 3P62A 4IUOA 5DELA 1W54A 3ABRA 3IEBA 4O18A 4FEZA 2Y7EA 3DHDA 3P8IA 1WDWA 1VPXA 2VEKA 3HMJG 3TW6A 4GE8A 3EXSA 1HUVA 3BV4A 1C29A 5E93A 3BGJA 4U4MA 3BG3A 3GX9A 2R8WA 1UJPA 5DBTA 4TR9A 2VXNA 3V75A 2A4AA 3FJ6A 1UB3A 3VE7A 4N9BA 4GUFA 3TH6A 3C2EA 1J5TA 3B06A 3G1SA 4R53A 3B03A 1YPIA 1A5SA 2CLHA 5I3HA 3O16A 3UZ5A 2PE4A 4JYFA 4LVAA 1LBLA 4EVZA 5FEPA 4WQ6A 2G96A 1GEQA 1DQXA 2B0MA 2A85A 4Y6GA 3LRMA 3THAA 2WNZA 3HPXA 4CNNA 4WOQA 4C1KA 2PC4A 3KRUA 4OGZA 2JKAA 4XTDA 4LS0A 1SO5A 1X7FA 4UTMA 3GVGA 4QIUA 2NLIA 1W3NA 5EMUA 3DKJA 2LLEA 4AF0B 1RD5A 2NUYA 5F2IA 3I7RA 4O57A 4HSNA 2GQ9A 4RR4A 2QCCA 3UD6A 3UWUA 2ZRVA 2QUTA 2A21A 3CM4A 1QCWA 4FNUA 4P2VA 3W71A 3TSDA 4TMCA 2V9DA 1MEHA 3FKKA 2ZZ2A 3WJZA 1VYRA 3ABQA 3MI6A 3W7LA 3S5OA 2ZCGA 5K9XA 1SQ7A 2ALDA 4LC6A 3W75A 4AWSA 4Z1BA 3W85A 2I1OA 1Q6LA 3P81A 4A2RA 1KFEA 3LHUA 1VLWA 3C61A 2H8XA 1IXQA 3ZWTA 2YFNA 4O0KA 4WOZA 2A2IA 4PCFA 1DL3A 2JGQA 3NQ7A 2VOMA 1YXYA 2E09A 4OWGA 3P60A 1PHWA 1KM0A 3FJLA 4I7WA 2VEPA 1J4EA 5LHFA 5AHEA 1I2PA 2YR1A 4R34A 4ZQPA 3G1HA 2CFFA 3NYZA 1WX0A 4LVDA 2DZPA 4X22A 2I14A 1KFJA 3G8RA 4O1BA 1K3UA 3T44A 4XKYA 2V81A 3FYOA 3DFNA 2Z2UA 4O4VA 5I3KA 1IXPA 1JCNA 1O60A 2C18A 2Y7GA 4LY8A 5DBUA 1NEYA 1EX5A 1Z42A 1YDOA 3A22A 3OVQA 2DZXA 4IPJA 5TBOA 1N55A 4WUIA 3BW2A 3CWNA 3OHIA 3PS7A 3N2XA 4Y9AA 2ZA2A 2QCFA 2JK2A 4K38A 2CW6A 5LHEA 3W88A 4KWWA 3LOTA 5HMSA 1XI3A 3MP4A 1XDLA 3TCEA 2B7QA 2ZTKA 3LCFA 2ZBTA 1OYCA 4GNJA 1OX5A 4GJ1A 4OU1A 3UWQA 4PL1A 3M5XA 4K7YA 2NXHA 4NNBA 1W5NA 3HBLA 4QSHA 2H90A 3CWOX 3TR2A 2JGYA 2A0NA 4M6PA 1TPH1 5EPDA 2OT1A 1B4EA 1Z44A 3TU9A 2NZLA 3UWWA 1OFPA 4ZQMA 2WO5A 1TRIA 3DAQA 3KHJA 4BWLA 3PWAA 3DFTA 4O16A 1W56A 3W22A 5I3IA 5EA9A 2P0OA 1OABA 2Y63A 3LHTA 4UUIA 2W79A 3ZR4A 3OVRA 1P1XA 3NNTA 5IM51 1LOQA 1I45A 4DPQA 2C14A 3HGOA 2WPBA 1H7RA 3MI2A 1KW1A 2CLIA 3NG3A 1GQNA 1K7EA 3W1TA 3L65A 4UMAA 4AXKA 1N7KA 3M9YA 3QMTA 3P7YA 3B0VC 3I7QA 4WY0B 3C56A 5AC7A 2DZWA 2QCDB 5KZEA 2Z1BA 2TSYA 1CX9A 4JTUA 4ADTA 2VFGA 3EXRA 3G1XA 4PEKA 1LLWA 4QITA 1TPC1 3GIYA 4AHQA 2ZRYA 4O53A 1LBMA 2Z6JA 4LNYA 2Y85A 2FTPA 2OX1A 1SW7A 3PSVA 2ZFAA 3Q2DA 2DJLA 1LP6A 3N2MA 1TV7A 5GVJA 3UWZA 4AHOA 1P0NA 4R33A 1MEIA 4FXSA 3TFXA 1G6CA 3W1NA 4IMEA 4K39A 3UY8A 3NPWA 2P1FA 1IF2A 5E1QA 5MHBA 4NJIA 5FF7A 1QDSA 4MPQA 3LRLA 4MLJA 1MO0A 1DORA 5SWUA 4HNVA 4GFSA 4NXSA 1PL9A 1D9EA 3LTPA 5BRBA 3W83A 1OFQA 3GNNA 3W23A 4AF0A 1W5OA 4UTWA 3M1ZA 3IGXA 2G97A 3S1WA 1R2RA 2CZDA 4EWND 2QAFA 1OK6A 2X1RA 3W7KA 1FDZA 1H1ZA 2B7NA 3E49A 2E6FA 3TAKA 1VRDA 2QDHA 1JJKA 3NGJA 4KFOA 1SU5A 3OA3A 4ZQOA 1P4CA 4JTFA 4N6EA 2NWSA 4JY8A 1KV8A 3S0CA 1TTJA 3W7PA 5FEZA 3HG5A 4Z1DA 2ZZ1A 5AFDA 1JCXA 1SFJA 1SZGA 1GYLA 3B8DA 1EP2A 1AW5A 4FIRA 3B04A 3O6CA 5F2MA 5LSMA 4MJMA 1H61A 1VCGA 4O52A 3NQVA 1TCDA 1OHLA 1B9BA 5FESA 1O5XA 3C8FA 2VELA 4JICA 5HUPA 3I6RA 3NPVA 5CG7A 4RJEA 2VEMA 2D73A 5AYXA 4W9TA 1JCMP 3A9IA 1DBTA 3LLFA 3KVJA 4UFKA 3PBYA 2BZNA 3MYPA 4NVTA 1KFKA 3L5LA 5D05A 1GVFA 1DHPA 4JIPA 3LM7A 3G1DA 3T78A 4X2RA 5D38A 3G18A 4S2BA 1IIHA 3M41A 4NQ1A 2OMAA 2NUWA 3KAOA 1JCLA 3INPA 2Y70A 3PSWA 1GVRA 4JTGA 2J88A 3WFAA 3LI1A 1TJPA 3W74A 2VFFA 1G7UA 2C15A 3NQGA 3GR7A 3GDKA 3MHFA 1ZAHA 2NV1A 3G22A 2AGKA 2HMCA 1PHQA 2KZHA 3CIWA 1GOXA 1VS1A 4MZYA 3U2OA 5AHLA 2XN1A 3LCHA 2FLIA 2A7PA 3N19B 2DP3A 4RV8A 2BTMA 3HOJA 1QAPA 1TPB1 1XBVA 4XWUA 3UYCA 3VNDA 5H2ZA 2YXGA 2WKJA 3W6YA 1A50A 2Q3RA 1QPQA 3VE9A 3IVTA 3WK0A 4O11A 1NFBA 5FF0A 2CLLA 4KFNA 5HWNA 5C5YA 2YZRA 4CCCA 1F6PA 3PAJA 2XN2A 3O6YX 3LBCA 4LT9A 1K7XA 3WK2A 1PCWA 5K3VA 3R13A 3EB2A 4N9CA 4NXKA 3Q58A 1YDNA 2YYUA 1R47A 1WOAA 2FPYA 3W7QA 3T40A 3GAYA 3PBWA 3DU0A 3I7SA 4UFJA 4I7UA 1W3TA 3TJXA 3PUEA 4O17A 4K8EA 4MJZA 3SGZA 5BMWA 1ICPA 2NUXA 5LNSA 3IIXA 1LZOA 3O8AA 5DCBA 2VC6A 2YGYA 4HSOA 3EX6A 1FY6A 3FLUA 4YL2A 3GAKA 1FWNA 1H51A 3C3NA 1ZHAA 5DY2A 1VLIA 1M7PA 4NJJA 3FEMA 2NXIA 3E96A 3TXVA 4JTSA 2XFWA 3P74A 5K4XA 4PFMA 5K7JA 3MBFA 4UTIA 2QCDA 3NQMA 3G8EA 3MP3A 3JRKA 1ZENA 2J9ZA 5L9FA 4CQ9A 4JTTA 3IIOA 3L0NA 5DCDA 1TYGA 5C55A 5AC8A 4ZQCA 1PIIA 1YPFA 4BI6A 3TNOA 3TUUA 1G4EA 4N02A 3HPSA 1J2WA 4FNPA 2AAMA 4J9JA 4I7VA 3KVKA 4OV4A 1WBHA 3P5ZA 3N9SA 5EL1A 2Q3OA 4AEOA 4LU0A 4MY1A 3D0CA 3DI1A 4ORMA 2E5BA 4AAJA 3BO9A 1GG0A 1IIGA 3SW6A 4DO5A 1EUAA 1A5BA 1OFEA 5LNUA 3T7VA 3W72A 3EX2A 1I2QA 2O7QA 3A5FA 4ADUA 4UC5A 3OG3A 2GUUA 1VCFA 3QM3A 3S1XA 5CZ0A 1QOPA 2QCLA 3PM6A 3NA8A 1IXOA 5AN7A 5BOOA 2FPVA 5CSSA 5I3FA 1SO4A 3LHVA 3R12A 3TQ0A 3LCIA 1W5PA 1TREA 1EP3A 3NM1A 4Y96A 3KOFA 3BARA 4ZVJA 1O5KA 1NF0A 5LZLA 1U5JA 5G2IA 3KRSA 3NQ2A 3QMSA 4PA8A 1EPXA 1R2TA 3PG9A 5AYZA 2QAPA 3W84A 2A1YA 2A6LA 5FF3A 1V5XA 4PTNA 1XL9A 1DVJA 1Q45A 1KTBA 3MYOA 3QH2A 4IMCA 4XTIA 4JR5A 3MI3A 2ZA1A 3LXAA 4IWWA 1JUKA 2V0TA 4Z0SA 4P61A 1EUNA 5F4SA 1KM3A 2QF7A 3NPUA 5D2YA 1YADA 4UCGA 1ME7A 2B7PA 4KFPA 1IGSA 2WSQA 3W2LA 3RK8A 3GNDA 5K4ZA 1L9WA 2ZDRA 3GK0A 3G3DA 3P61A 3L21A 3W1LA 3NL6A 3JS3A 1X6UA 1XBXA 3STGA 1VC4A 2GVGA 2VFDA 5G1YA 1RPXA 3B0PA 4UFIA 4DF1A 3MWAA 2QJIA 2I9EA 5CPNA 4MIMA 4HPXA 1FCVA 1M7OA 2ISWA 4TO8A 3LXBA 3Q37A 3B0UX 2HSAA 2JKPA 4K8HA 4MOZA 4GWEA 2ZZ4A 1TIMA 4IOTA 4DXVA 4K7VA 2FIQA 3S9YA 1DQWA 1LRQA 4JS3A 3LDVA 3SR7A 3G1FA 3V1PA 1LLZA 2Y6ZA 5F4XA 4DELA 4YCOA 3HIJA 1C8VA 4IX0A 4RX0A 1HG3A 2QR6A 1PVNA 1O94A 2E6YA 5KITA 1KM2A 1OF6A 1FXQA 3PUDA 1OFRA 4NNCA 1SFLA 3PG8A 1TPEA 4NJHA 4QQ3A 4O1AA 1MSSA 2QCEA 4MYAA 1VR6A 3U6WA 5TQLA 3HGSA 1XBZA 4LOCA 3DZ1A 2X1SA 1H63A 1SZFA 3CEUA 4N6FA 4S1FA 1ZCOA 1W37A 1BKSA 1TB3A 3PUOA 2YW4A 4NX5A 5G5IA 4DBEA 3TKFA 3UXDA 3ANYA 2OT0A 3C2RA 3LB0A 5C54A 1OX4B 1R30A 3ATZA 4RZ4A 1GVOA 5FEWA 4LTSA 1G4PA 1LM1A 1WBJA 1XUUA 3W86A 4HHPA 2CLEA 5LNVA 3QZEA 1K03A 3M6YA 3FFSA 1PE1A 4L4MA 1I4NA 4CNPA 1EB3A 3NQ6A 4HNNA 1JRBA 4NNAA 3HB9A 1BWLA 3EWXA 4H6KA 2CWNA 1A53A 1VCVA 3LHYA 3GDLA 2WQPA 5FEXA 1MZHA 2EF9A 2R14A 2FPTA 2A6NA 3K30A 4O50A 1VGAA 4JEQA 1LRNA 3TA6A 1HO4A 5D2WA 5HINA 4YLWA 1H60A 1TSIA 2V2CA 3NQAA 4EF8A 4A21A 1YYAA 1ZJIA 1H7XA 2A7NA 1Q6QA 3G0UA 2ZZ6A 1F7BA 3HJZA 4MY8A 4UXDA 5D32A 4Z1CA 1XXXA 4K6AA 3T4CA 3NO5A 2RHGA 5EKYA 1L6SA 3JR2A 1BEUA 4QAIA 4WXYA 4UR7A 5DN1A 4MLRA 3GZ3A 3AO0A 4GUGA 3NL5A 3NPXA 1I2NA
chains in the Genus database with same CATH superfamily
4FOJA 2Q09A 4LNCA 4N9DA 5E0KA 3H6OA 4DB7A 4F66A 1Q7MA 3QY7A 1B1YA 2NV9A 3GNOA 3UZWA 2I57A 3EB4A 1XFBA 2VUNA 1LWIA 4E2BA 2Q8ZA 3SN4A 1QK2A 3PZUA 3ARRA 1BTMA 4C6CA 3NOEA 4NG3A 1XS2A 3UG5A 2PF0A 3TQPA 2QCNA 3VD7A 1CLVA 1MI3A 3RYSA 4NJGA 4MWAB 4PULA 2E40A 3GDMA 5PTDA 3W6MA 4AY1A 5CBJA 3VIOA 4NU7A 5KZMA 3QQ1A 3VIMA 4ZQNA 5DMYA 1A5UA 1KCZA 1QOQA 1UKSA 1WA3A 1HKVA 1ML1A 2DGAA 3ECQA 1J2BA 1XRVA 3DBPA 2PLKA 3PAOA 3QMRA 1ONEA 3HQ1A 1RCXB 3BH4A 4YCPA 1G7VA 3V5OA 5C9RA 3N11A 3STCA 3W25A 3CC1A 4TV5A 1TJ1A 4LCQA 3HPZA 3W73A 3MW7A 4LV4A 4YMZA 3A4WA 3DKLA 2V82A 2C6QA 4ZZ9A 3ITXA 2GDQA 3LX9A 1N8IA 3KX6A 3IV3A 1G69A 2GUYA 1TUFA 3B40A 3R94A 3FEQA 4DZ5A 1UPPA 2VR4A 1JQXA 5HR6A 3P67A 2WXDM 1MW1A 2PRHA 3E2SA 3STPA 1MRAA 2QULA 5J04A 1W2PA 3KTCA 1K70A 4I9JA 2BGSA 4NT0A 1E51A 4IP5A 3H7VA 2IXUA 2XVGA 5AC6A 4I5UA 4R85A 3MSRA 4N4QA 3IACA 4O14A 1PIFA 4Z1YA 3MO7A 2DZTA 1MMFA 1HVQA 5DLCA 8XIMA 1E1CA 3FIGA 3VKAA 1S5NA 3TLQA 1CXFA 1OFBA 1HJQA 4AY7A 3NVDA 2OOGA 4PUNA 5D33A 1XRFA 2WMIB 3FJNA 4C6FA 1H2JA 3KZPA 3R0DA 4KRZA 1HF6A 1BLIA 1W1YA 4E2DA 1Q85A 3K4AA 4G5DA 4K36A 1H62A 1FWDC 2RH9A 3OBAA 4C5YA 3AHXA 2QCGA 4DUVA 2YZ5A 2DVXA 2VZOA 3NQFA 4FMVA 4AZ5A 4AISA 3MWCA 1TPVA 3DFSA 5IBXA 1VBUA 1UR0A 4FLSA 2JF7A 1EGVA 2QGYA 2EPNA 4LQ1A 3BGGA 4MUZA 1T6MA 2V2DA 4BR1A 4MZ1A 1SVDA 1RSCA 5FJJA 1UR2A 4IPLA 4JQ3A 1LQ2A 4AHPA 3CUJA 3VNZA 4ZOCA 1GGOA 4PTDA 3L2IA 4LAZA 1JPIA 3E02A 4GO8A 3PTMA 3EDFA 1VIWA 2YKKA 1XX1A 2Q02A 3WQEA 1O4UA 2DV0A 2NQZA 3SECA 2ZA3A 3TX9A 1ESWA 1E40A 3MQTA 4V33A 1SYTA 3H24A 4PMVA 4GQRA 4MF4A 1YX1A 5M5DA 3UA4A 1FKWA 4UTTA 3H2MA 3C2OA 5D8ZA 4HOXA 3B4UA 1LOLA 1L6YA 1KRAC 3KP0A 4O10A 1E0XA 1LYXA 3A6OA 1C8YA 3B05A 1JAEA 3K46A 2WHLA 3FHQA 4C6QA 1XF0A 3O7UA 1DOSA 4A6GA 4YU1A 3L5MA 3SBFA 5JMUA 2FJUB 3C0LA 5HPCA 2YPIA 5A5WA 1MXSA 1VENA 3FDGA 1XLJA 5L6UA 3S5YA 1PXGA 1JD7A 3THQA 1YTEA 3VABA 4AUBA 3L68A 2JEQA 3SCWA 3TYDA 2Q71A 3OYZA 4ZQRA 4NL1A 4JTKA 3AHTA 3H4GA 4LF1A 3RMEA 1FWRA 1UHVA 5EMYA 3U8GA 2DUZA 4HJWA 3VGFA 3SRKA 1K9EA 5HNRA 4GIRA 3EBVA 2FGLA 4DJDA 3M7WA 2EG7A 3VX0A 2ABBA 4QG9A 5FJPA 1TJRA 4IICA 4G2DA 4O4WA 3M0JA 2INFA 3NJ3A 3GYEA 3AQUA 4QEEA 3I65A 3UQNA 2X30A 1YDVA 1JXJA 2EKGA 5BXRA 2GZXA 4UMCA 1E6ZA 4NZ1A 1XC4A 1QHZA 2YLLA 4IP7A 2X1IA 4F0LA 1D3GA 3HG4A 1AA1B 2YCLA 5DMLA 4H8VA 4LVGA 1PZ0A 3GKAA 1SGJA 4RL3A 2IQDA 4LUSA 4W5ZA 3VKKA 4D8ZA 1ZGDA 4PTMA 2VRKA 4AWTA 2YDAA 3NZ1A 4UMBA 4POCA 1FX6A 4C6BA 3TSBA 5A8MA 4GH1A 3VIHA 2DJXA 5GPRA 1OT2A 4JDBA 4ILSA 3UETA 3M6DA 9XIMA 4GOAA 1Q2RA 1CBGA 3S6OA 3OZOA 4NAEA 1Z41A 1KM5A 4GVFA 3TW7A 4CNUA 3DFYA 1CGUA 2OXNA 1X6LA 4Q4MA 1XYMA 3U0HA 1IEXA 1S2VA 1OB0A 1VHNA 3VGGA 2PU1A 2VWTA 4P7OA 1K8ZA 3FXGA 2PDBA 3VK5A 4L1GA 5LKYA 4IL2A 4YTUA 1BSIA 3C6CA 4E0CA 1GT8A 1K8CA 4WGXA 1KB3A 4AD4A 2DPEA 3OODA 1A3XA 4YPJA 2QDGA 3WKZA 1QT1A 4ORIA 5LA0A 5LGZA 1X7IA 5ABTA 1HJVA 1R0MA 4MFEA 1NIUA 1PB0A 5A6BD 2X1UA 4CN1A 1K1DA 1CCWB 2V5BA 1S2UA 4AB4A 1UKOA 2PODA 4QNWA 2GJPA 4Q4PA 2GGGA 4Q8QA 1VFFA 3WLKX 2VURA 3GXNA 3QC3A 3TQKA 2VRJA 4KWSA 3ZO9A 4XO6A 2A3EA 3WENA 2CEQA 4WSJA 4YN5A 1RBAA 1A80A 1IEVA 4JIHA 1QHPA 5KTLA 1G67A 1QASA 1QPRA 1JPKA 2VKZG 3G3MA 2QMJA 1XHGA 4EXBA 3PN8A 2EEXA 3URAA 4U5IA 2EJ1A 2H6RA 5CZTA 1R3VA 1OZMA 4CD6A 2YL6A 1YDYA 5FACA 4MNJA 1QBBA 3E2QA 3KVMA 3N73A 1RK5A 3EWUA 3NGFA 1XYZA 3TMLA 4GC4A 4RKAA 2A3LA 2RGMA 4WCJA 3MP5A 3WO8A 1FCBA 1Y7VA 4NUWA 5KMYA 3T55A 4PFHA 2XM1A 4Q7BA 4MZ8A 2OU4A 1IT0A 2DVUA 2NX3A 3NURA 3RNDA 2E68A 3W1QA 3MY9A 2OODA 5HULA 4UTUA 3QC0A 3N4AA 1GOOA 4CKQA 1HL8A 3RU6A 1VYPX 1I2RA 4FP1A 4BEUA 4X2PA 4W8AA 1ONXA 2CZFA 2OEKA 1E4NA 1FCQA 4Q6JA 1T8QA 2A7RA 5I24A 3LCWA 1F8IA 1QR7A 2NQLA 1K4GA 3LLXA 1CW2A 4HPJA 4AVFA 1JUEA 3TYBA 1BG4A 2NXGA 5D2VA 2ZXBA 3D5HA 3MVIA 1FCUA 5E5CA 3AXKA 4X0VA 2QKFA 5D9MA 2A5HA 4UNKA 4O15A 5KETA 4LFYA 4C5ZA 1KA9F 1W1ZA 5A6AA 3V3WA 5GNYA 4X9SA 3IRSA 1L2UA 5LNWA 2OKOA 4BWLC 1WO2A 2DZAA 3MV01 2GOKA 1JPDX 3M0ZA 4C1LA 1FWBC 1XH0A 4C6JA 5AZ0A 4KW2A 3RN6A 1HTIA 3EEGA 1KFCA 4ERGA 2BB0A 1LRTA 1RJPA 3KTSA 2ZX7A 5KSWA 4ZB0A 3KUMA 4DY1A 2AGTA 3AIBA 2TMDA 1JDCA 3PULA 2GVJA 1AH3A 2PCQA 2UY3A 3QSRA 1DTNA 3UY7A 3OQ8A 3G2GA 1ZNNA 1VEOA 2Z0IA 4GIYA 1OCNA 1WP6A 1UMLA 1XYAA 4FB7A 4D6GA 3WY1A 4Z2JA 5JVLA 1BXNA 3FY1A 1FOBA 4TV6A 2VHLA 1WNOA 2OLSA 3M0KA 4K1WA 4RUBA 1QWGA 5JUVA 4LAOA 4K1GA 3HPFA 1XD1A 3NL2A 2E28A 2WJEA 4BQ5A 4P7RA 4Q32A 1H1YA 4DZIA 4Q8TA 3NL3A 1XINA 4QM1A 4HQVA 4C7FA 3SDOA 2RDWA 3H53A 4MWAE 3CIXA 3UVAA 3I3DA 3MUY1 4JTRA 2V3EA 1U2YA 3R2GA 4XUGA 2AMXA 2PRLA 1UBSA 4FF7A 1XLBA 4QSFA 3DYMA 4ERIA 2JF6A 4HA0A 4NZJA 5BMXA 2QUMA 2VD9A 1XRTA 2WZEA 1Z3NA 3MKCA 4PUJA 3CPGA 4EX4A 1DJQA 4JIQA 1EXBA 1SW0A 4GA8A 4GQ0A 2WZIA 1U83A 2R94A 3U7BA 1X6NA 3BLOA 2FKPA 4PMZA 3PK7A 1AH0A 4H9YA 4MNLA 3CAKA 1H0IA 3P3BA 2F2KA 5IBXC 1ZQ5A 3CUFA 3G0XA 5A6JA 5EBUA 3RJYA 1F74A 4DXXA 4A3YA 3RO8A 3II1A 1IT7A 1JAKA 3DENA 3EWZA 1W8SA 1BRLB 3SY5A 4LB3A 3UFYA 2ZADA 3D6NA 1PX3A 2HK0A 1XIBA 3R0UA 2ICSA 3S47A 3VIGA 1AQHA 4E38A 1OK4A 2WMJA 4KCTA 1BVWA 2RJGA 2XVPA 3GC4A 1FH9A 1NP2A 5A6SA 4R7WA 2YW3A 2F8QA 1H50A 3ONCA 3W53A 3C4UA 3WH5A 2DEPA 1EEXA 4X0NA 4RW3A 1R3TA 3IGSA 4D71A 4UTTC 3T6CA 3PZVA 1J93A 5DT5A 5DQPA 6ALDA 3EKZA 1WV2A 1ME9A 3WD2A 3F03K 1KM1A 1XIHA 1QNOA 3MT1A 1VIZA 4EF9A 1AFSA 3W2KA 4GVHA 1KXQA 1B57A 3FYPA 3MJMA 4FNRA 3EOLA 1M04A 3BLEA 1AL7A 2NW0A 4KEUA 4Y9MA 3WYZA 3O06A 1Q4WA 1W9VA 3WBXA 1RV8A 1ZY9A 3TWBA 4IGHA 1XLFA 4TX9A 3QJAA 2Z4GA 3AWOA 2G50A 2FH8A 3XINA 2FFCA 2BNJA 4J2MA 4IXHA 1GYNA 4FLQA 3M64A 2ASHA 5AHNA 4RZ6A 3P5YA 2W3ZA 2HBVA 2G4FA 4XD6A 1DV7A 3LS9A 1LL7A 1HGWA 4GX8A 4DJDC 4HPHA 3MVTA 3URNA 4MDOA 2VP8A 2QVHA 4WY0A 3KM8A 1FWWA 1Y0EA 3DGBA 4JPGA 1AQFA 1BFNA 2FTWA 1L8NA 1EJWC 3IIVA 4UTLA 1JQVA 3QTPA 3WBWA 1DWHM 5G1TA 3KL0A 3W07A 2BASA 1EEPA 1ZS2A 2VYOA 2DIKA 1E4IA 1GWJA 2PDKA 1Q7QA 1RBLA 1B3ZA 3N2OA 1JR1A 4A22A 1YNYA 5E9XA 4WZHA 9RUBA 3VD9A 4S39A 4C6NA 5BOEA 3SRFA 1NP0A 2V63A 1QI0A 1SUXA 3R10A 1ICSA 4B5NA 5G2HA 4LRSA 3T0TA 4AG0A 1IEIA 5G4EA 5FJRA 4GUJA 2J6VA 1KFLA 2D0FA 1XCWA 4J3TA 5DELA 3IEBA 4LB4A 1BYAA 4FEZA 2Y7EA 2Y8VA 2VEKA 1SM9A 2OQLA 3BV4A 1C29A 1WDDA 3PFRA 1UR1A 3WQVA 1UOZA 3GVQA 1BTCA 3GX9A 4UQDA 3BURA 3WNPA 3AIUA 1LLOA 2CC0A 1UB3A 3AMKA 1UWIA 2VT0A 3RGTA 1Y65A 3B06A 3G1SA 1RLCL 5I07A 2D0GA 3NXLA 3BOFA 4KRUA 4LVAA 1HZYA 4LANA 1LBLA 3A4XA 1ZP4A 4Y9NA 5FEPA 1V3IA 4GGHA 4EVZA 2B0MA 4ML4A 3LRMA 3DX5A 3U5UA 4F0SA 2ON3A 4M6UA 4UTFA 2POZA 3MUCA 2UBPC 4C1KA 4KT2A 4ACYA 4QDPA 2FGBA 2FMNA 2AL1A 3VMOA 4IGMA 4AF0B 4HZMA 2OZ8A 2NUYA 3T42A 3M0IA 2GVYA 4O57A 3L4WA 2Q8XA 4HSNA 4K3ZA 2GQ9A 1OG6A 3CBWA 3VMNA 2PWGA 1ZJHA 1NWTA 2WANA 4P2VA 3EDDA 1IV8A 4TMCA 3FKKA 2ZZ2A 1UWAA 3UCDA 5B7ZA 5T8GA 3W7LA 4GHRA 3P6LA 3W75A 1V3MA 3SCTA 5FJOA 4W7VA 2ZXDA 2PWDA 1W2VA 2CKSA 4UWMA 3W85A 4IFOA 4DYJA 1JZ3A 3LHUA 3BSHA 3PZGA 4R88A 3IGHX 1M7JA 2C7FA 4IG2B 1KWGA 2ZWZA 3GZAA 1B3YA 2QV4A 1EJTC 4WOZA 2OOFA 2PGFA 3QHOA 2JGQA 3NQ7A 5ABFA 3QV6A 5BWFA 4OWGA 1PHWA 4I7WA 1J4EA 2YXOA 3WX7A 3EMQA 5E0CA 1UA3A 4A35A 5DANA 1WX0A 4QJ4B 5LIYX 1KFJA 4PMNA 2ZVRA 1OINA 4ACZA 4XKYA 4DVOA 1ZRQA 2V81A 3BUVA 2Z27A 2PTZA 2WBKA 3IJLA 1O60A 2C18A 2Y7GA 1G1YA 2W67A 4LY8A 3RM9A 1TMLA 3A22A 2PDGA 2DZXA 4GZJA 2GYIA 1DXFA 3BW2A 2D23A 1V6WA 3PS7A 4L7ZA 4EPKA 3CV7A 3BAJA 2NLYA 4PUEA 3MMDA 2JK2A 3ID7A 5CC6A 5LHEA 2UZ9A 1EL3A 3W88A 4KWWA 1O7AA 3NQBA 3F5KA 4NI3A 2XIQA 1XDLA 1KR1A 1TCMA 3JVAA 2ZTKA 1O5QA 1OYCA 1ADSA 4URIA 4OU1A 3WEMA 3UWQA 2G3JA 5IOBA 3T08A 1OSEA 4K7YA 7REQA 1NH6A 3WLPA 4FOUA 2E0PA 1E4LA 2NVCA 1B4EA 3GM8A 3SO7A 2WC3A 1CWYA 3LENA 1FTXA 4E5TA 1TRIA 3TYEA 3HV9A 3KHJA 3VOGA 2GJRA 1QI4A 3BSGA 5EMJA 5ABEA 3E38A 3S9IA 3R1ZA 3RCMA 4GYPA 1XP3A 4UUIA 1KO0A 3NNTA 5IM51 1LOQA 4DPQA 1H7RA 1KW1A 3WLOA 1V0KA 1CIUA 5CPQA 2VR5A 4AXKA 1N7KA 1E6XM 3B0VC 1LUCB 1CGTA 1GCYA 3UW6A 4WY0B 1UIOA 4PUMA 4KIRA 5AC7A 2C79A 1GW1A 4UQBA 4M56A 4JFVA 2TSYA 5AYBA 3RM4A 1IE7C 1H11A 1LLWA 1RP9A 1TPC1 1XIMA 1DJGA 3C2YA 3NYDA 4QDMA 2Z6JA 3LZ5A 3HQPA 1K9TA 4LNYA 1L6FA 3Q2DA 4G1NA 1S38A 2DJLA 4BQ4A 3N2MA 4L5ZA 1P0NA 4R33A 1XISA 4IMEA 3UY8A 3REQB 3NPWA 2P1FA 4NJIA 1QDSA 1HJUA 3AXHA 2R1KA 3VILA 3DC0A 3PBMA 4DZAA 2VEFA 5SWUA 2XGBA 4GFSA 4D8AA 5BRBA 3PZQA 3GHSA 3W83A 3D46A 1OFQA 3W23A 1A5LC 5EGRA 3FXYA 4UTWA 3UZZA 4GZEA 1R85A 3WEZA 3IGXA 2G97A 3B9OA 1Q4NX 2QAFA 5HA7A 2G8ZA 1SFSA 3TAKA 5I02A 4ZQOA 4J3ZA 4S38A 4JY8A 4WGHA 5IDZA 1TTJA 3UGVA 3WF0A 4Q4QA 1H49A 5M03A 1F8MA 7CGTA 1J18A 1SZGA 2PWVA 3CQKA 2WW5A 2OVLA 5LSMA 1VCGA 2QIWA 3ANUA 4CQCA 1TCDA 1OHLA 1B9BA 3GFXA 2VELA 4W7WA 4JICA 3NPVA 3FA3A 5I5RA 2Y5SA 3V5CA 4W9TA 4CD5A 3LLFA 3KVJA 2ODOA 1RVKA 4GKTA 1KFKA 3L5LA 5D9NA 5A94A 3S2LA 3ARUA 3LM7A 1YNQA 4X2RA 4PTXA 2OMAA 3KAOA 5A6BA 3K5XA 1IR1A 2Y70A 4J7RA 1Z7AA 4I6VA 1FP9A 3K1GA 2VFFA 1G7UA 3NQGA 2VCBA 5FJIA 2AGKA 3RAOA 2GDUA 2HISA 2XN1A 3LCHA 3AWNA 2OZ3A 1KGXA 1KKOA 2VX5A 3TTYA 4HBKA 4GQBA 4ZEPA 3VUSA 4LAMA 1XBVA 4XWUA 2WVVA 3WUGA 3N2BA 3O0FA 5LXEA 3VE9A 1FA2A 3AHYA 3WK0A 4O11A 1B0IA 2CLLA 1WZKA 4DUOA 3PAJA 3O6YX 4LT9A 1T5AA 1K7XA 4PTVA 1PCWA 3NO1A 1OGBA 4CNTA 1MXGA 4N9CA 4M3PA 2YYUA 3AMGA 5EMLA 3B8SA 4XAPA 1WOAA 3CAQA 4M1BA 4PMUA 4F48A 4TXEA 3I7SA 4H8HA 3TJXA 1CXHA 3PUEA 4MJZA 1V6YA 2JIWA 1ICPA 3U48A 2C0HA 3WLJA 5HNUA 1CXLA 2WLZA 1ZTVA 3EX6A 5I0DA 4JL1A 3F7JA 1V7AA 1X39A 3CO4A 2PTYA 3RR1A 3GAKA 3FA4A 1ZHAA 1RHCA 4GXPA 4Q8PA 4NJJA 4KERA 4HNOA 3FEMA 4JTSA 4B92A 2XUCA 5K7JA 3MBFA 1FH8A 2V3GA 3G8EA 4H9UA 3JRKA 1ZENA 3GWQA 3IIOA 2VDIA 4C1NA 1PIIA 2GSJA 3AHZA 3TNOA 3TUUA 2PTXA 3HPSA 2VZSA 2AAMA 1J5SA 4J9JA 4I7VA 3P5ZA 4JIRA 4AEOA 4MY1A 1TKKA 1ITUA 1F3TA 4AAJA 3BQ6A 2VX6A 1E5JA 1IIGA 2NVAA 1VFHA 1ELSA 4GI4A 4ADUA 4REQB 1CGWA 3VVGA 3E1F1 3QM3A 2HEJA 3KCJA 3PM6A 1AJ0A 5AN7A 3VGEA 1REQB 1OEPA 1SO4A 3LHVA 4JFTA 3TQ0A 2VMFA 2AKZA 2OG9A 1XYCA 3KOFA 2PF8A 2ZICA 1A0DA 1XLKA 3QMSA 1W91A 2XTKA 5AYZA 3W84A 1V5XA 1KTBA 4XTIA 3DOPA 3N6QA 2ZA1A 3LXAA 4GYJA 4IWWA 1SMAA 4QROA 1DJHA 4P61A 3Q45A 1KM3A 1NDYA 2PWEA 5M1TA 1XLAA 1EA9C 2B7PA 4KFPA 1IGSA 1TVPA 4XVDA 8CGTA 3VIIA 3RK8A 2PLJA 2ZDRA 5BROA 4B5SA 3VDGA 3L21A 3NL6A 3JS3A 5A95A 3AMDA 2OKTA 4UFIA 2PWHA 1QUMA 3MWAA 3EDJA 2I9EA 4LH8A 3GH7A 4EANA 2QDDA 3HFTA 4IOTA 4IFRA 4DXVA 1LRQA 3SR7A 5GQBA 4AIOA 3BMWA 4IX0A 1HG3A 3O9NA 2PDQA 5LXXA 1O94A 1OF6A 4LX4A 4B5XA 1FXQA 2INZA 3OW1A 1ZZMA 4NNCA 3PG8A 4GIAA 1QU4A 4MYAA 2XSXA 1VR6A 4L1WA 3U6WA 1UD2A 4W5UA 4H6RA 2X1SA 1SZFA 1HKMA 4S1FA 1TG7A 2EPOA 2POTA 1DJWA 1EQPA 2YW4A 1MQPA 3TKFA 3UXDA 1TX0A 2WVSA 3N1AA 1G4PA 1XUUA 4HHPA 2CLEA 3IS4A 3M6YA 2A3CA 1WKYA 1TE1A 1I4NA 2MUCA 3QV7A 5BU9A 1OD0A 1LQ0A 2VZUA 4RDYA 3WF4A 4H6KA 2CWNA 2J62A 1A53A 1E15A 3LHYA 5M2FX 3UJFA 4E2VA 2JQXA 2EF9A 3K30A 1VGAA 3N13A 4JEQA 2W5FA 4EF8A 4MY8A 3G0UA 5D32A 1Q6QA 1EC8A 4UXDA 5I00A 3WBYA 4XZWA 2REQA 1A3HA 1TJ2A 3I6EA 3VDCA 4UR7A 4MLRA 3AO0A 1V51A 4DX3A 2J47A 4GUGA 3DI0A 3NPXA 4U2YA 4LVBA 1S3HA 2VFHA 3LGEA 1RBOB 1Z6KA 5I79A 3CH0A 4CNOA 3IUHA 3RF9A 3BMVA 3AU6A 1BYBA 1K8YA 3CT7A 3OVGA 1JDFA 2FTYA 4XIAA 1ISYA 1Q63A 3RPMA 4G1KA 3F5LA 5K9CA 3NEVA 2FFIA 3DDMA 4P5UA 2KAUC 5DFAA 3T9PA 2FH6A 3R8RA 3HMCA 2DIJA 4PRTA 1FFRA 2E8ZA 1Q2SA 1HW6A 1UD8A 1GUVA 3MCMA 2E7FA 4FXFA 1WB0A 5CSYA 5C6MA 3B9AA 3KFTA 1V93A 4GYPC 3RX4A 3GTHA 4P7LA 2WNQA 3UXLA 2OLAA 2YJQA 5HWMA 1FWFC 1KWKA 3LBOA 1P0EA 4H8NA 1TZ7A 3IGUA 3CB3A 4KH2A 5D9PA 2PDJA 3EOOA 5FI8A 4GX9A 3NDZA 1CENA 4HNTA 1FWIC 3QPZA 4C1NB 3AS3A 1M6JA 1QI5A 1W1VA 1QK0A 1ZUAX 2JFEX 3I6TA 3TEVA 1OQFA 2WKLA 2Y7DA 1W9PA 4TIMA 4BS0A 3PTDA 4FNQA 3BTNA 1PBGA 1Z89A 3TJ4A 5HOSA 1E0TA 5DRCA 3MMUA 3ZJ8A 3WLRA 4OTKA 4YIWA 4HCDA 4TVDA 4FNSA 1UP3A 1JZ4A 2DQWA 4OZOA 1S1PA 2HE5A 3W7DA 4XQ6A 3N3TA 3SCRA 1PTGA 3S1UA 3ZQ9A 2C16A 3FS2A 2G5WA 4HIBA 5BU6A 4UTWC 1HVXA 1XDMA 4XK2A 3VNLA 2OCZA 4S3KA 4F2BA 5CGQA 2B7OA 4O0QA 1WZMA 3NDOA 3HGRA 3UBPC 1UR9A 1DJNA 3WQFA 1QO2A 4XD4A 3SI9A 3UZJA 3FV9A 3VPLA 5H8MA 1JUBA 1XPYA 4UNLA 3TTQA 4ONVA 1EZ2A 4B3LA 2EPLX 3WJXA 3KL5A 4UFLA 2XPKA 2O92A 2IMRA 2ZX6A 3GRIA 4GINA 3WLIA 4OE7A 3RLHA 2FQIA 1UBPC 3Q94A 3BK0A 1OD8A 4B5TA 3ARPA 4OOZA 2E6DA 3L2MA 1TMHA 4AX7A 1AVAA 1QI3A 1BSLA 2CZVA 4EAYA 3M16A 3APTA 5F1VA 2F7FA 3F4CA 3HF3A 2GL5A 5DXXA 3W9ZA 2P88A 2BG5A 3RX2A 1W3HA 1OC6A 1HO1A 3TAOA 1A5CA 1R9ZA 3ZJKA 2Y62A 4DJED 5HBFA 2EGZA 4DAIA 4B3ZA 3G0SA 2ZRXA 3AXXA 4QNEA 3QLDA 2J78A 3W7RA 3W7EA 4GI9A 3V5FA 1B4KA 1BG9A 3DHPA 3LNMA 3WH8A 4KRTA 5CBBA 3GTIA 4O19A 5ENLA 4MDPA 1G4SA 2CLOA 1NOWA 1LT8A 4AY8A 1FP8A 3CEPA 3O1NA 1CYGA 1SR0A 4OUEA 2GGHA 2GSEA 2XWEA 3NSXA 4OBTA 3M5VA 5JBDA 1OG0A 1CB2A 3PY2A 5I77A 4KEMA 3VCRA 4GYKA 1OZQA 3W26A 1BXBA 5EFDA 2QHAA 5JQ9A 1TQJA 5A8NA 3I68A 4P8VA 3TOYA 4GG9A 1FWJC 3R79A 3GC2A 5EYWA 3LERA 1W0MA 1A5AA 2V69A 4IPNB 3W7HA 4LJ3A 2OX4A 4ZMGA 1Q13A 2ZUNA 1XGDA 4C90A 1NDVA 3LYEA 4IFKA 3NVTA 2YXXA 2VEIA 1OT1A 1E6SM 1V6TA 3R89A 2DT3A 3AIVA 2Z2AA 3MS8A 2ZUTA 3F2DA 4Z2GA 2GVLA 1HKWA 3FAXA 5CJMA 3MHUA 3AS1A 1YQ2A 4CLMA 3EA3A 3KCOA 3SB0A 4WKAA 5FF4A 1KFBA 3G1VA 1LORA 1PZ3A 1E71M 1GK8A 1V3KA 2PU0A 3W1PA 3E5BA 2XG9A 3NQCA 3F4WA 3M0VA 5REQB 3UPBA 2ACSA 3S42A 2FJKA 3KVLA 3WCZA 2X1TA 3ALGA 1T41A 3QGVA 3GTNA 3VNIA 2DT0A 1GHRA 3M5ZA 2CZ5A 3C2VA 5EB8A 5D2XA 2P10A 3A3XA 5CSRA 2W63A 1UKPA 4UQAA 3BLDA 1N82A 3V0TA 3GFZA 3ZJ6A 3EA2A 1C8QA 4HN4A 1SZNA 4GY0A 3A9BA 3PWIA 3GU9A 1TR9A 4NIRA 1R9XA 4JAWA 3VZXA 3B8WA 4B9ZA 2DZVA 4CCZA 4AZHA 3L4XA 3W1RA 2YL5A 4XZHA 2HVOA 4R5EA 2ZX8A 2VZTA 4GCXA 4LUYA 2Y5EA 2PDNA 1GVEA 3BLIA 3SUVA 2VVSA 1EWEA 3KBJA 4H7VA 1KTNA 3KTXA 2CBJA 2EQDA 3LN3A 3WK3A 5HQMA 3IIZA 3A21A 3UJ2A 2PDUA 5HPOA 1NVMA 4HA4A 5F4WA 3W2MA 1KCXA 1VBGA 1BYCA 3MCOA 1MW0A 3MPGA 1ZALA 1QNSA 1DTUA 4IGNA 3G24A 2O9OA 4MB3A 3SIMA 5GJNA 2OB3A 3NWRA 4FIQA 2QGHA 1OYAA 3MUXA 2D3NA 2H3BA 1W9DM 4TQTA 5D04C 2XWDA 2WJFA 4CN4A 2ZOXA 1VKFA 3GH5A 3VOCA 1MRQA 4Z08A 2B4GA 4ROQA 1X8CA 3W1AA 5D2TA 1PYMA 3UNDA 4Y8EA 3FA5A 4O8RA 4AYSA 3P84A 2QEZA 1PWMA 3L0KA 1TPDA 1BQCA 1FXPA 4DJFA 3N34A 5CQ1A 4GBUA 3LD5A 4JNZA 3ABXA 4O28A 1OCBA 4WJ8A 3MUIA 1FDJA 2Z29A 4U33A 2ZX9A 1EWDA 1EO7A 2XU2A 3ERPA 4NZ3A 1ONRA 2V2HA 1ONWA 1V6VA 1E0VA 1AW1A 3I10A 1FQ0A 1N8WA 2PP1A 2P5NA 3PJUA 1S5VA 3N9RA 2Y5JA 1YEYA 2CBUA 2PDYA 4G7FA 2CITA 1XBYA 4AZGA 5BW6A 2ZRZA 3LHWA 2PURA 2ONEA 1QO5A 1US2A 2VGGA 2WPGA 1G4TA 3U2EA 3V36A 1YKWA 1H09A 3NXFA 4XAGA 4YVVA 3VXGA 4Q4OA 1QI2A 3Q65A 3QYSA 3YPIA 3WJSA 1IWAA 4ZE4A 3CV1A 2YA0A 3XIMA 2WZHA 3H7RA 4HHMA 1R7AA 3AZTA 4JNYA 3QY8A 1RD6A 4YHGA 4GJIA 1PJ9A 2HBXA 2OGYA 3IK2A 1V77A 4XZMX 2CHOA 1QPKA 1CZ1A 2WWDA 4UCFA 1RQHA 3OGVA 5GJPA 3TC6A 3ES8A 3BAXA 3L0GA 4A2SA 3WK1A 1R3WA 1CLXA 1OX6A 4ZE5A 2GWGA 1P1MA 1J12A 4IQDA 1RZMA 4DUXA 4ATDA 4DBWA 3KHDA 1JGIA 5AOUA 4G9PA 3B0XA 3WEOA 4I9AA 3KBMA 3ZMRA 1O66A 3KE0A 5C2CA 1A5NC 4LS2A 3UPWA 1A0CA 4M7TA 2DUXA 2RJHA 1CPUA 3THDA 3VTRA 4IX2A 1UPMB 3CHEA 3EB3A 3WBAA 4O1CA 1TV5A 1NJJA 3TE9A 3LXCA 3N9KA 1P5BA 4KGJA 1AK5A 3TJLA 4H6EA 4H9ZA 4F0RA 1NFGA 4N0RA 3WZ0E 3TROA 4W86A 1ZP3A 1F61A 2GJXA 4XSMA 1O12A 4ZR8A 2CXGA 1XSKA 1RCQA 2VCCA 4MB5A 3I4KA 1PCKA 1TUXA 4LCRA 4HN8A 2WCAA 1V0MA 3JZEA 2CLMA 1FVPA 3I4EA 2ATSA 4LYRA 3IV8A 1WZAA 4HMEA 4ZO6A 2XJ7A 1KXHA 4JTHA 2QXWA 2XIIA 3U5YA 3BSMA 4HP5A 2EPMX 4US6A 5AYYA 1ZAIA 2J7BA 3K4WA 1WXYA 4LSBA 4Y2WA 3T2PA 1G0CA 3OJGA 2W6RA 1UYQA 2XVKA 2NSOA 3TC7A 3AALA 4R7JA 3WL1A 3AIWA 3LTSA 1K6WA 1M5WA 1SSGA 2VQTA 3PFMA 3SM0A 4C6MA 4ZO8A 3CASA 1R3YA 3AYSA 3SQSA 1TWZA 2Y7FA 4O54A 4HOWA 3FGCB 2EPHA 2L5HA 2PLCA 1S5TA 4GH3A 2H8ZA 1X1OA 3RLUA 3WMLA 1JF5A 2OELA 1T96A 1TFVA 5IHSA 4FHAA 3M0XA 1O95A 4RW5A 2X09A 3LG3A 3W82A 3LRKA 4GC3A 1P0KA 2RGLA 4BK9A 4JKMA 4LYKA 2RDUA 3RMJA 3S1VA 1RCOB 1PEZA 5CGMA 5CZJA 2QS8A 1IT8A 3LA4A 1F4HA 2P8CA 4PB4A 3BLFA 3AYRA 4GQGA 1ZFJA 4GD0A 1XYFA 5I3JA 2D2OA 1GZ1A 2D2GA 2ZUVA 2CCRA 3ITOA 2ZTJA 1W1A1 1RQBA 1DJZA 5AB3A 3A5VA 4IMGA 3ZWSA 3ITTA 5BRQA 3AIEA 1Q3NA 4HB7A 1EGZA 2O4MA 3LGDA 3VO0A 2AOSA 3ARQA 4NYYA 1IXNA 4X60A 4BI5A 2WZMA 4Q4SA 3HZ3A 3JW7A 3W2UA 1VH7A 3DUGA 2GDVA 2XFYA 3N15A 4GY7A 4WVXA 4QBXA 3CTTA 4ENLA 2PP3A 1MUMA 1QMLA 2QJGA 4J4KA 4H1ZA 3N2TA 4Z0JA 4FAMA 2H9AA 1GQJA 4RNHA 5D4YA 5C2XA 3M46A 3WJWA 1QW8A 4MKSA 4FA3A 1EP1A 1JL8A 4PL2A 3KOXA 4UTKA 5EY5A 2HVMA 2P76A 1GZJA 5KINA 1WYIA 3CIVA 3BPWA 1QRQA 3GDTA 4N4PA 5F2GA 5CPSA 3WDQA 3WF2A 3GG1A 1VB9A 4OUIA 3KL3A 2E5DA 4IISA 3WQ6A 3PJTA 2HNHA 2ADAA 2HQAA 5M3WA 4YWIA 3QHMA 2HTMA 4FX6M 3RO6A 4A8LA 3POCA 3CMFA 2WSYA 1GG1A 1P7TB 4JD4A 1Z32X 1EJVC 1YRRA 4BA0A 1M65A 1KQZA 4NX0A 4UTJA 2YFOA 4IPIA 5FF2A 1R6WA 2WOQA 2C1GA 1NELA 3M0YA 1EJXC 5I78A 3HTWA 1FWGC 5FL0A 1QNVA 2PDFA 4JOMA 4JFUA 1RH9A 3WF1A 1LTDA 4BF7A 1T8XA 3ZVHA 3AMCA 4A3UA 4BF5A 3O05A 1W54A 4O18A 3DHDA 1BHGA 3P8IA 1KBKA 1WDWA 1VPXA 3TN5A 1W6TA 3TW6A 5E09A 4GE8A 3EXSA 1HUVA 2VVNA 3UERA 3UG8A 4H9XA 5HK4A 5MKGA 4NAFB 1RJQA 3SAZA 1UWSA 3PPHA 2ZWYA 4TR9A 2GVEA 2PDHA 2HPMA 3TZNA 3V75A 3CL6A 5FD0A 4GUFA 1VP5A 3TH6A 2IXVA 1YPIA 1A5SA 1DPMA 2CLHA 3DHUA 5I3HA 1LL4A 2XIMA 1QTWA 2MANA 1G94A 5I06A 3FX4A 4UBPC 4WQ6A 2G96A 3AUJA 2BP1A 2ZIDA 4MTVA 5EBAA 1D2KA 1DIEA 3HPXA 1V03A 4RE2A 2PC4A 4OGZA 3UWEA 4AYGA 1SO5A 4HCHA 4GY1A 2R9RA 4QIUA 4QTGA 3DKJA 2LLEA 3CQIA 3I7RA 4GI8A 6CGTA 3WQPA 2G41A 3UD6A 2ZRVA 3CM4A 5FJTA 3USZA 1DWFM 1GHSA 3MI6A 1U1HA 5K9XA 4NP7A 2PGRA 5TAOA 4Z1BA 2P3EA 1SJDA 2X41A 1VLWA 3APGA 3C61A 1UD4A 3ZWTA 1J11A 3P0XA 3FDKA 4O0KA 1EZWA 1K6AA 4H2CA 1DL3A 2VOMA 1YXYA 2QF8A 3EDKA 1AD1A 2E09A 4DJFC 3LPGA 1R86A 3V1HA 2VEPA 1AD4A 4CU8A 3QR1A 5AHEA 1TVNA 3CZKA 4JIEA 4DBUA 4PSPA 1XCXA 2WYSA 4ZQPA 1FH7A 5C7HA 3G1HA 2CFFA 4LVDA 4NASA 4O1BA 3T44A 1M1BA 4WK9A 3FYOA 3K4DA 4GACA 2Z2UA 4O4VA 4GI6A 1JCNA 4I90A 4GKLA 3KDOA 3CS2A 1BWVA 3S1GA 4JFWA 3OVQA 4IPJA 3TN4A 4DUWA 5TBOA 3HM7A 4WUIA 5FKYA 4UZUA 1QXLA 1JI2A 1W1IE 2QCFA 1C7TA 4CD7A 3BC9A 3GBDA 2R1MA 1XI3A 3MP4A 2P3ZA 1AZ2A 1JPMA 1GORA 3KZSA 1OX5A 2DDXA 6REQA 1E0UA 2WAGA 1WDPA 4NNBA 1W5NA 4QSHA 3CWOX 2ZUWA 2YBTA 3TR2A 4AZCA 4DZHA 2X05A 4FR6A 1IEWA 1UA7A 2GK1B 4Q6XA 4C6IA 2JGYA 3GHTA 1UZDA 3A4AA 5EPDA 4Z2IA 2WB5A 1Z44A 4EE9A 3UWWA 3HQNA 2WO5A 2QPSA 3A3HA 1Q7ZA 3CV2A 3DAQA 1BKHA 4BWLA 4HD5A 3DFTA 4B2DA 3IK4A 1W56A 4IIGA 2OYLA 1XSIA 5EA9A 1OABA 3O2LA 5A6KA 3VIFA 1QBAA 2C14A 3HA1A 4PMYA 3HGOA 2CLIA 3NG3A 1YIXA 5AVHA 1CTNA 1K7EA 4GQQA 1O68A 3BMXA 1C7SA 2GUBA 2XIOA 4ZCWA 5CXPA 3C56A 3ANVA 3KEHA 3N25A 1A4MA 2IPGA 2Z1BA 3F4DA 2D1ZA 1CX9A 4L64A 2YBVA 3G1XA 1J79A 4AHQA 2ZRYA 2Y85A 2FTPA 4OIFA 4J2PA 1DXIA 4CD8A 2WVUA 4MG4A 1LP6A 3LK6A 4B90A 3UWZA 1PYFA 3WDRA 3VUPA 4NSBA 1MEIA 1HJSA 4TOQA 4FXSA 1G6CA 2O9TA 2DSVA 3QHNA 3N04A 1U33A 2J7CA 3GR4A 1VFTA 3DCPA 3LEPA 4MPQA 4MLJA 4ZSTA 1MO0A 1L0PA 4HNVA 1D9EA 3LTPA 1AJZA 2PBGA 2WHJA 3SCPA 3GNNA 4F0HA 3WNKA 4NF7A 3S1WA 3EGJA 3I3BA 4EWND 2X1RA 3ZVHB 1H1ZA 2B7NA 4HNLA 3KOZA 2E6FA 4XD5A 2QDHA 1SU5A 3G6LA 1P4CA 2I5QA 2D0HA 5KZ6A 3UJEA 1A5OC 3S0CA 1TA3A 4JBRA 3U9IA 3DECA 5FEZA 3HG5A 3DBNA 5AFDA 1SFJA 1EJSC 2J13A 4J27A 1AW5A 3IJQA 3O6CA 3ONBA 3SEPA 4O52A 3ZJ7A 3D3FA 5FESA 1O5XA 1ZJAA 1O1HA 3I6RA 4RJEA 2VEMA 5HJXA 1EJRC 3CQJA 4UFKA 5I03A 3PBYA 2BZNA 2Y2WA 3MYPA 7XIMA 1GVFA 1DHPA 2CYGA 3N12A 4S2BA 1ZPTA 3QTGA 1ZL1A 2DFAA 5IFPA 4JCLA 4PCTA 3CT2A 3T0BA 3PSWA 2EPKX 2HE8A 1DIDA 4GISA 1HL9A 3LI1A 4DWSA 4FLOA 3GR7A 3GDKA 3G22A 2KZHA 3CIWA 3U2OA 1VS1A 1XFCA 2FLIA 3N19B 3OPSA 3B9NA 2GGEA 4BEQA 5BRPA 2J77A 3MTWA 1PDYA 2YXGA 1A50A 1QPQA 2JE8A 3RDKA 3CMGA 1NFBA 4JN7A 2YZRA 2XN2A 5K3VA 3OZYA 1E6QM 3R13A 3WH7A 2HROA 3VD3A 1PX4A 3R11A 5T91A 2Y1HA 1V02A 1R47A 4LF2A 1XLLA 1TV3A 3GAYA 4UFJA 1W3TA 4O17A 2NUXA 4QFUA 3O8AA 1WKEA 2VC6A 1M3UA 1FY6A 4J3WA 3Q4DA 3V0UA 4D6JA 3WSUA 4MSSA 2UWFA 1XLHA 1JDEA 2WMGA 1FWNA 3C3NA 4GK8A 4LYPA 4IIHA 1M7PA 4ATLA 1VBRA 2E4TA 4UTIA 5CC3A 2QCDA 2DVTA 4JTTA 1TV2A 4ZQCA 4S23A 4BI6A 1Q65A 3RPDA 1G4EA 1NQKA 2BGQA 4B5WA 4FNPA 3T2QA 2FZ8A 4QLLA 2Z00A 4ZO7A 1PKLA 2PSNA 5EL1A 3DI1A 2E5BA 3A12A 1MUWA 3S9ZA 3BE7A 3SW6A 1EUAA 2QLYA 3T7VA 3W72A 2XDFA 1I2QA 4UC5A 2QPXA 2OSXA 4ZFMA 4ZXLA 3ZSTA 4LCSA 2QCLA 1WZLA 4FSAA 5BOOA 4RE0A 5I3FA 1X96A 4V28A 3PANA 5DEZA 3N6HA 3GU1A 1W5PA 1F3XA 4JN8A 1WKDA 1EP3A 1B5TA 1YNPA 4X63A 2ISDA 3GY1A 1QW7A 2Z28A 5JH2A 3ZR5A 3AZRA 3ES7A 3WFLA 4ZVJA 3WLMA 2VX4A 5LZLA 5G2IA 1I60A 3NQ2A 2V5KA 4EPEC 3OB8A 4HTBA 1EPXA 4PA8A 1R2TA 4JFSA 4MJ4A 3D47A 1FKXA 3PG9A 4LBRA 1XL9A 4MPKA 1DVJA 3MI3A 4JKKA 4MB1A 4GGBA 2XVNA 3NPUA 5D2YA 4E4UA 1M41A 9CGTA 3W2LA 5K4ZA 3MU7A 3GK0A 3WMBA 4D9PA 3W1LA 1VC4A 4D6CA 5HMEA 4B5VA 1GEHA 2PD9A 1RPXA 3B0PA 2VM8A 4DF1A 1EGMA 5CPNA 2D22A 1FCVA 2ISWA 2HSAA 4DO7A 2OO0A 1KXVA 4GWEA 1UKTA 3OLDA 5JIPA 2BOFX 2J7HA 3GH4A 2FIQA 2VTFA 3S9YA 2FVLA 1DQWA 3EZ4A 3OLIA 1BVZA 3V1PA 4Y9PA 2Y6ZA 3PZ9A 2QR6A 1PVNA 2W92A 3SN1A 3PUDA 5CJNA 3UR7A 1SFLA 2DW6A 3TP4A 1E1CB 3JZUA 4NJHA 4QQ3A 4U10A 3VM5A 2PS2A 2QCEA 1P0DA 2QQ6A 1R3SA 2C1IA 4RDVA 2YL8A 1XBZA 1JZ7A 4AIBA 1BKSA 1TB3A 3PUOA 4PN2A 1TV4A 4XZLX 3IWPA 1M68A 3RPTA 1R30A 4S3GA 3ATZA 5EMMA 4HMDA 2J79A 4RZ4A 1GVOA 4XIMA 4J5NA 1WBJA 3W86A 5IRPA 3QZEA 1EC7A 3FFSA 2BVDA 4L4MA 1XIEA 2X0SA 4HNNA 3CPUA 2BY2A 3B97A 3LY0A 4JKLA 3PJWA 3EWXA 1OGGA 4H9TA 4XO7A 1UQYA 2DSWA 1MZHA 4DHGA 1JYNA 1LRNA 3TA6A 2AMGA 4PUUA 5HINA 2WCSA 2O9PA 2I16A 3NQAA 1XR2A 3EA1A 4A21A 1YYAA 1ZJIA 3HJZA 2ZZ6A 1S1RA 2BMBA 3WLHA 1XXXA 4DJDD 4K6AA 2YDQA 5DRIA 3PP7A 3NO5A 1XGEA 2PAJA 3JR2A 3NUKA 4AEFA 4RNIA 1ZBKA 1I2NA 3GNRA 2C91A 1V79A 2ESCA 2NQ5A 4FZIA 4RXGA 2OO6A 3W38A 1J0ZA 3COTA 1KCLA 1IZCA 4P8XA 3BZGA 1XWYA 1HKJA 3LQLA 1WDRA 3T4WA 3P14A 4PUKA 3LBMA 4EK7A 1ZU8A 3SUUA 2V8ZA 3HQOA 1HKIA 1CXEA 3WLSA 1W9XA 4I3GA 3SZ8A 2Q01A 3B3DA 1GOQA 4P8UA 3TYUA 1XPGA 3CUHA 1XH1A 1TO3A 3VNKA 2FZNA 2XSBA 1C9DA 5U4NA 1XG4A 4IIBA 2CLFA 3GLCA 5DXYA 5CAHA 1MEWA 1X98A 4AH7A 2ZQ0A 3ARXA 5CLWA 2BVYA 3JU2A 1S39A 1J10A 4K2SA 1LL6A 4PMDA 2XVLA 3AFBA 4RZBA 1J0IA 4MUPA 4UNIA 1KBJA 1V08A 4RK8A 4RDWA 3WNOA 2ZE3A 3CMJA 1W3LA 4XBKA 7A3HA 3EX1A 2J66A 1NDZA 4ROPA 1Q66A 3E3HA 3M07A 3WG6A 1GTHA 5IXEA 2NT1A 4A4AA 3LQGA 3ALFA 3OEXA 3LHZA 2OGJA 3PVFA 4LBUA 2XIBA 2YCLB 1LWJA 3GXIA 4F8XA 1K02A 2J7EA 1TTIA 4Q3MA 3SUTA 2YX0A 3K8MA 4HU3A 1JNEA 2G37A 1X8FA 4LUSB 2HVNA 2E8YA 4OQVA 2VWSA 2EBNA 2WHMA 1SJAA 3PHAA 4RE3A 1B90A 2FB3A 1GVQA 5H91A 4OHQA 6XIMA 4UOJA 3W7GA 4X3ZA 3WDIA 2XGIA 2I7GA 4Q8VA 1V3LA 4HVXA 3LV5A 5J5RA 3TQVA 1BAGA 1PIGA 4J1OA 2EO7A 1C91A 4WRHA 1GVSA 3SN0A 1UH2A 5LA2A 5RUBA 4S3BA 2WNNA 5C70A 4YVXA 1NWSA 1OC5A 2W9MA 3P93A 4NAEB 3CHDA 1G9HA 5A3HA 2NX9A 1OX4A 3NM3A 4ICCX 1OFDA 3GXFA 3CAWA 4LV9A 3M43A 3E9AA 3HURA 3WJYA 3R43A 4XG1A 3CHFA 1GOKA 1UROA 3KS6A 4S3DA 4A8RA 3DYOA 5BWAA 3EOSA 3KP1A 2PUZA 1ZBWA 1V3HA 2JIEA 1JFXA 4H7CA 4D2JA 2F9RA 4H3DA 3UU0A 2JKEA 4GJJA 3GTXA 4W88A 3E0LA 4PZVA 1W3IA 4K37A 3RITA 1ENUA 4NILA 1P0BA 4CU6A 3H2FA 4U3AA 5BXSA 1JYVA 2Z25A 1NSJA 1KV5A 3R5EA 3SIZA 4BI7A 3H12A 2X40A 4NZ4A 3B8TA 4W4QA 2OYMA 3QZ6A 3NZGA 5IFTA 1EBGA 4DWSC 4MNKA 4MADA 3GIPA 4I8DA 2WM0A 1R3RA 1B2YA 4MVAA 4DYKA 2J7GA 4BF9A 3G1RA 4NKCA 4UQ9A 2X2GA 4L80A 2EHHA 4ATWA 3UXKA 3BAWA 4QE5A 4HKPA 2ZRUA 4LRTA 2VO5A 2VFIA 5AKQA 1UIPA 3H70A 1HGYA 3W2NA 3O07A 1TPUA 3PTKA 4MWAA 3THUA 1J0HA 2WSRA 2ABAA 1SSDA 1CLKA 5CZSA 1Q8AA 2YIHA 3OGSA 4PBGA 5BXPA 3H2EA 2BODX 3E6EA 3G6MA 3NTYA 1L6WA 1EX1A 3WIJA 3MZ2A 1QNPA 3EWBX 4AZ6A 1XGZA 1LBFA 5HMFA 3VNMA 1WQ5A 4O1DA 4ZENA 3PB0A 1R5YA 3N17A 5U7SA 3CK5A 5BNKA 3DXIA 2PDCA 3M47A 4OT7A 3FVMA 1ZCCA 2EKCA 4W89A 4AIEA 1PO9A 3ZS4A 4F9DA 4XBJA 4GLEA 1O1ZA 1L6GA 4PMQA 2YCEA 3IUDA 3QSTA 3DEQA 3OG2A 1FFQA 3BQ5A 3RRAA 3ZXWA 4L1XA 7TIMA 4KWUA 4YXGA 1KGUA 3QV8A 2PLMA 4TVUA 4ZB2A 1P43A 3NQEA 4RZ5A 3WNMA 3WQ5A 4M6VA 4GUHA 2E67A 1AH4A 3OLGA 2RDXA 5CKSA 4IM4A 1H5VA 4CUCA 1RR2A 4PCPA 2JEPA 1F6KA 1VFLA 1JNDA 5CBIA 3KWXA 3GSMA 3TIMA 4U2ZA 1OCJA 4F4RA 1VFMA 4XBSA 3GB6A 1UD3A 3PPFA 1M7XA 3VD5A 3F2BA 4Z1AA 3GXTA 2F2HA 4CQBA 4H8UA 3AI0A 1FUYA 1U1JA 2PWFA 3WD1A 1Z8AA 4GZIA 2PDMA 2QYGA 2E1WA 2WMIA 4NZFA 2FDSA 4QJ1A 3LTYA 4QR6A 1W32A 1GKQA 3M0MA 1J8VA 2BX7A 1KBIA 1PSCA 4M6QA 3VGDA 3C2FA 1QFEA 4PODA 3BJTA 4WSHA 4H4IA 3KBNA 5CPOA 2D24A 2W61A 3PR2A 3GO2A 4O1FA 5C7VA 1RPKA 1T0OA 1B3OA 2TPSA 2XH7A 2Y4SA 3W2JA 3BCDA 4PMXA 2A79A 5T26A 5DY3A 1IHIA 2QUNA 3G1YA 3ME3A 1AODA 1W9BM 3QY6A 1JULA 4UQEA 3VDAA 1E5NA 3ABOA 1KM6A 3ITLA 1HP5A 4ICNA 1PZ1A 4Z17A 1GZGA 1PKNA 3MMTA 1MXDA 1V7YA 2Z2BA 1MVYA 3R4IA 3HU7A 3WH6A 3MO4A 3V18A 5HJYA 1E9IA 2J24A 3PZNA 4F40A 3GU2A 4FX8A 2CU0A 1R7OA 1K77A 3VU2A 5A8QA 1YMYA 1I9CB 3N3MA 2FYMA 4QLKA 3K8LA 2IPJA 1CNVA 3OQEA 3IVUA 1YXCA 1VYSX 2W4XA 3RUBL 3A47A 4L9YA 1KNWA 3WNLA 1LROA 1V0LA 4Z2LA 3TMQA 1C3FA 4C6OA 4WJEA 4ZODA 5HQEA 2FGZA 3TJIA 3FOKA 4F2UA 3RLVA 1BD0A 3RILA 4IXXA 3WUFA 3W81A 1Q6FA 1W5QA 3BAYA 4Q8NA 1U5HA 3S8HA 3R0KA 5HMDA 3E0FA 4AD1A 1O6IA 3GD6A 1KLZA 3LI0A 2GPTA 3ZLFA 1XKYA 5LGXA 4KGLA 2YDSA 4EOUA 2NWRA 4C6EA 4ZOAA 1XM3A 4QCFA 1W1TA 4PB5A 3QYQA 1AMYA 1TIWA 2WCGA 3DHFA 1ITXA 4QE1A 4JTAA 1XUZA 4OV9A 3SFWA 3KWSA 1K7FA 4GYFA 3CB8A 3ZT5A 1UCWA 1PS9A 1Y5WA 3TVAA 2RFGA 1R2SA 2XFFA 2GWNA 4FX7A 2DY3A 4CQ8A 4YJ5A 4DYEA 1F5ZA 2FB2A 2NT0A 1E3XA 2DORA 4ALDA 3AS0A 3F4NA 4R7OA 4S3JA 1GOWA 3QPEA 5CEWA 1MYRA 1SZEA 1SZRA 5HWJA 2PZ0A 5D03A 1C9WA 3BDKA 3OOQA 3TN3A 3WLQA 2IQ0A 1PKMA 1JCJA 4H41A 5KZDA 2ATMA 1DQUA 3VX1A 2FVKA 1LOSA 4L6OA 2CBIA 3BGAA 3NR0A 1UR8A 3W76A 2AL2A 1B31A 3NQ8A 3ELFA 1Z48A 3E2RA 2DSUA 3XISA 1W5MA 2DH2A 4MAVA 2QT3A 1Y5VA 1R9YA 3VGBA 5D9OA 3GXDA 1D3CA 4U5KA 1SO6A 3HGJA 3ZFHA 4CQDA 4D6IA 5M17A 5FOOA 4KPLA 3CZ8A 1L8PA 3L66A 4R9OA 4YVPA 1HFBA 1EQCA 4L61A 2C13A 2J7DA 2XM2A 2VENA 4UFMA 4Q4KA 1CXIA 1W1PA 3SCNA 3S2CA 3PJXA 4YTSA 2EG6A 2DT1A 4KQNA 4XD3A 5J8LA 4WDXA 2RKXA 3VOFA 1BQGA 4Z2KA 2DU2A 3W7CA 4U28A 5C0QA 3DGRA 1UUQA 3DG7A 1MZRA 3JUGA 3H55A 2INEA 3MJYA 3IAQA 1Q6OA 3HG3A 1VZWA 4L65A 4RNJA 1SMDA 3IJ6A 3EEZA 2Z24A 1XCFA 3KW3A 2NX1A 1TWIA 4JTEA 3KRZA 5ECVA 2PBOA 2VC7A 3SSJA 4W87A 1V02E 2GSHA 3WDPP 3VMPA 5BYWA 1JEZA 5AHIA 3U2CA 2GJLA 3TDFA 3UWYA 5JBEA 1EA0A 4ZFCA 1E56A 5FIPA 3L4ZA 1D3HA 2A3BA 2ALRA 3MKKA 1OBAA 3S6TA 1FDYA 4EXQA 1S5MA 2WMKA 1UC5A 3QPYA 4M24A 2VL4A 3S6DA 2XISA 3S2JA 1SO3A 2DUAA 1H7NA 3U57A 1IGWA 1QPOA 1S3TC 2X2YA 3FCPA 2HK1A 2IUZA 3CV6A 4F3HA 2E9BA 1MFUA 3F4VA 3OGRA 2ISSA 1RALA 4GVGA 4ZSUA 3VCCA 4IMFA 3VDHA 4H19A 4DWDA 1XIIA 3WNNA 1P6BA 3CYVA 4MFDA 1XSJA 3QRHA 4UIOA 1DE5A 2OQYA 5BXTA 1E72M 3MDUA 1TE6A 3TV8A 1WAWA 3C86A 4HYWA 3UG3A 1QATA 3GDBA 1OFOA 3E5PA 3MC5A 3VI2A 5XIMA 4QG8A 1DWIM 3K1DA 2E25A 2I5GA 3LCGA 4XB3A 1VEPA 2PC8A 5GJMA 1AQ0A 5AHMA 4IJRA 2CLKA 1YXDA 2VDGA 4QP0A 2QPUA 3IVSA 2V5LA 4JEJA 3VOHA 3W1XA 3R58A 1WAUA 4B3KA 1DEDA 4HU0A 3QW3A 1B3XA 2QZRA 3UA3A 3K8KA 3D3AA 4HYVA 3LLDA 1OVDA 3BG9A 2GQ8A 4AD5A 4EIVA 2XN0A 2E5CA 1JI1A 3IANA 4ICMA 1W9UA 3FVDA 4S2CA 3A64A 3LCLA 1TRDA 5ABFB 3L5AA 3LSCA 3VKCA 4DBDA 3B8UA 3BJFA 4WD0A 2ZYFA 1FWHC 2V68A 1LT7A 3MMWA 4MWAC 5C9XA 3NZPA 2J6XA 4Q22A 6TIMA 4DEFA 4M81A 2XHYA 2OSYA 4ACZB 4XKYB 1EOKA 1VJIA 3GDRA 1O5RA 3AOFA 3MUAA 4CEXC