2PCQA

Crystal structure of putative dihydrodipicolinate synthase (ttha0737) from thermus thermophilus hb8
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
b'MILPPIPTPFDREGRLDEEAFRELAQALEPLVDGLLVYGSNGEGVHLTPEERARGLRALRPRKPFLVGLMEETLPQAEGALLEAKAAGAMALLATPPRYYHGSLGAGLLRYYEALAEKMPLFLYHVPQNTKVDLPLEAVEALAPHPNVLGIKDSSGDLSRIAFYQARLQEFRVYTGHAPTFLGALALGAEGGILAAANLAPRAYRALLDHFREGRLAEAQELQKKLFPLGDLLAKGGVPLLKQALRHLGLPAGYPRPPYPAESPLWERFLPVLEGLKEEGWVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dihydrodipicolinate synthase
molecule tags Lyase
source organism Thermus thermophilus
publication title Crystal structure of putative dihydrodipicolinate synthase (TTHA0737) from Thermus Thermophilus HB8
rcsb
total genus 101
structure length 283
sequence length 283
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2pcqA00
3G3MA 4JNMA 1UB3A 2G5WA 5D09A 2WNZA 5D32A 1EWEA 1L2UA 4CNOA 4UMBA 3HB9A 5KSWA 3LLFA 1AMKA 1W5QA 2WOQA 3W7IA 1GVQA 2X16A 3NO5A 4AWUA 1LRNA 3KAOA 4I9AA 1PE1A 1TQJA 1H7PA 1MO0A 3OHIA 2YFOA 3FLUA 1FQ0A 1E51A 4OWGA 4Y8FA 5C55A 3LHYA 2VEMA 4JTUA 2F84A 1WBHA 1PHQA 2Y89A 3F1QA 2GPTA 1VLIA 4RCXA 1F76A 2ZA2A 1GT8A 3GDTA 3PBWA 3IGUA 3ZWTA 1YPIA 3P67A 4CNNA 1TB3A 2LLEA 5ABTA 3S8HA 2Y85A 2TSYA 1GVOA 1XBXA 1Q6LA 2VEPA 3S9YA 3PS7A 1OG0A 4MZ8A 2Y70A 2ZRVA 3W2JA 4MJMA 3DBPA 3W75A 1EWDA 5SWUA 1QWGA 2A85A 3QMSA 4LOCA 2VFDA 1DV7A 3ZR4A 3DXIA 1OYAA 3LDVA 3CB8A 5E0KA 4PC8A 1WDWA 3OVQA 1VCFA 3OVRA 1THFD 1S3HA 2NV1A 4UR7A 3GAYA 2PRHA 3NL6A 5TQLA 3C52A 3SECA 2A1YA 4FXRA 3GLCA 3FS2A 2ZTJA 4FEZA 4ORMA 4EF8A 2H3BA 3B0VC 1JJKA 1YTKA 4L4LA 3W07A 1VHCA 3G0XA 5CPMA 3UD6A 3LCHA 3GK0A 4AH7A 1YYAA 4XKYB 3P8JA 3IGSA 5EPDA 3WJZA 3CWNA 3I7SA 1A50A 1BTMA 1K7FA 2C13A 4RZ6A 1KLZA 5IBXC 4O4VA 1WOBA 1NAL1 4DF1A 3L9CA 4J9JA 2VEKA 2Y6ZA 1NFBA 4BI5A 2BZNA 3VE9A 3LBCA 3HIJA 3T4CA 3LERA 1SO5A 3AO0A 5I3FA 3LX9A 4LVBA 4PL1A 2J9XA 1R2SA 2DP3A 1X1ZA 2CW6A 2EAWA 4IOTA 3PB0A 2TYSA 4DO6A 4R7JA 4BR1A 1MXSA 3KX6A 4GUFA 4DQWA 3L5LA 1KBJA 1QOQA 2V30A 3NQVA 1CW2A 3M5VA 3MP3A 3TQKA 3W23A 1TO3A 2ZRXA 3IIVA 5A8GA 5HINA 3U6WA 4QSHA 1EEPA 2J6XA 2Q3RA 1H7RA 4ADTA 3BG5A 4TU1A 1T96A 3CM4A 5BRBA 3A23A 3HJZA 2NXIA 3TMLA 2QR6A 5AHMA 2OMAA 2Y7EA 3MJYA 3S1VA 4Z0JA 1EP2A 2V0TA 3QW3A 4IX0A 4DPPA 3E49A 1TPH1 1MSSA 1DVJA 5HMSA 3C2VA 1QPNA 1A5AA 2PE4A 3LV6A 2A0NA 4N2YA 1TTQA 3NA8A 2PRMA 2YPIA 4JXCA 2HS8A 3MHGA 2V2DA 2WNNA 5F4XA 4IMEA 2WSYA 2A7NA 4AWTA 3THQA 4G1KA 1YDNA 2CFFA 2QAPA 1XUUA 3V1PA 5HWMA 1TPVA 5LGZA 1GZGA 3THAA 2NXHA 1AK5A 1Q45A 3LRLA 3W7JA 3NL3A 3C8FA 1QPRA 2ZZ4A 1G69A 4RV8A 1GVSA 2Z6IA 3G1YA 1VHNA 5AYYA 1UUMA 4O1DA 3HGSA 4ALDA 5H91A 1RV8A 5AB3A 3W2MA 2CLHA 2XN1A 2YSWA 3W1UA 1FWSA 5FF3A 5DCEA 2I9EA 3LCXA 1PS9A 1A5CA 4HN4A 4XQ6A 4OV9A 1CI1A 4JR5A 1KV5A 2QCHA 1W54A 5I3GA 4E2DA 1HG3A 3GDRA 5EMUA 3KVKA 1SFLA 4M19A 4DO5A 6ALDA 3PF3A 3P62A 3W7DA 3PUEA 5K9DA 5G2IA 3U8GA 4N6EA 4DXVA 3O63A 1SFJA 2FFCA 4O16A 3Q94A 1W31A 4KKXA 1TPDA 5BMWA 3KFTA 1TPEA 1K7XA 1ADOA 1FCUA 1H1YA 1XBYA 3MI3A 5I3KA 1FDYA 2WQPA 3M5ZA 2ZZ7A 3IVTA 4IPJA 4Y9AA 5AFDA 5C5YA 4Q32A 4LVFA 3OEXA 3N14A 1MEIA 1XXXA 2E68A 3QFEA 5A5WA 5KMYA 2H3DA 3CEUA 2ABAA 2ZRZA 5D2VA 4I7VA 4DELA 1TMHA 2QCDA 1KFKA 3W1LA 2DORA 1QPQA 4HSOA 4FO4A 2GQ9A 2FQIA 2Z1BA 1Z44A 1FDJA 2FLIA 3HOJA 1J5TA 2PCQA 3UWZA 4NNAA 3E12A 3VE7A 2FIQA 3HG2A 2QCDB 4DBEA 1KFLA 1FBAA 4JTFA 3CLMA 1ICPA 3UXAA 1LDCA 4CCDA 4CCEA 4LRTA 1S5VA 4O54A 4W9TA 2ZZ5A 2GVLA 3RF9A 3TMQA 3QEZA 1OVDA 3W84A 4NUWA 3TE9A 3QRHA 3P74A 4K8HA 3TAKA 3LCIA 3EX2A 5K2ZA 3RMJA 4KWWA 4IWWA 1OX4B 1VLWA 4CQAA 4AF0A 3C2RA 1ALDA 4JTJA 1T99A 4O12A 3UPBA 3TH6A 3H55A 3TQ0A 4MFDA 4IMFA 4D2JA 3FKKA 4Q33A 5FF7A 1RPXA 1H7WA 1DBTA 1UJPA 5CZ0A 1EPXA 4OV4A 3NQ7A 3SY5A 2NXGA 3CC1A 1VGAA 2YW3A 3DFSA 3L0KA 2TRSA 1TPFA 1LOQA 2VFFA 1WOAA 1TYGA 1EIXA 2QDGA 5CKSA 1GYLA 4ML9A 4XBKA 4NJJA 1YDVA 3B04A 4ZMGA 3E9AA 4IUOA 1VRDA 1WAUA 5AHLA 4AHPA 1R30A 4AEOA 2QJGA 1WQ5A 3PULA 4Z08A 1GG0A 3EWBX 5CPOA 2PRLA 1EUAA 3ELFA 3NQ8A 3M0ZA 3IV3A 4IX2A 1SSGA 1XL9A 3PUOA 3QSRA 2QDHA 3DHDA 4FHAA 3HPXA 4BF9A 5K7JA 5KZMA 1KV8A 3CPRA 1PIIA 3MI2A 3P5YA 4LV4A 1J4EA 3QSTA 4OU1A 3N3MA 4PTNA 1RQHA 5HULA 1X8FA 3KVLA 5HJLA 1XDLA 4GNJA 4JTGA 3O6CA 4M7TA 3CWOX 4O1BA 2UV8G 4PL2A 4WXYA 3T78A 3N9RA 2JGQA 4TR9A 5EYWA 2GUUA 5HWNA 1W5NA 3VFLA 3M7WA 1ME7A 1TRDA 2B7QA 3F4WA 3BLEA 3EX1A 1FCQA 3MWAA 1AW1A 4X9SA 4BI6A 1RD5A 3LHUA 3NDOA 1KM1A 5AC6A 3QH2A 5C2XA 4DPQA 3NYZA 3HF3A 3B8DA 1OYBA 3DU0A 1H7NA 2GJNA 2C3ZA 4UC5A 4M6VA 1FUYA 5F4WA 1JVNA 3DH7A 3IGXA 1AL7A 2P10A 4NQ1A 4YL2A 2WSQA 2B7OA 3H53A 4ADUA 3GDMA 4XBSA 3BW2A 1XKYA 4LC6A 4K36A 4LC8A 4A21A 3I7QA 4FX7A 3LOTA 3VNDA 4Z1AA 2FPTA 2E6DA 4PFMA 1G4TA 1W5MA 4IQLA 4O11A 2V2CA 3NQMA 3W7PA 3BW4A 4AAJA 1GOXA 4KFOA 3PM6A 2RKXA 2FPVA 4MY8A 4LVDA 4MKNA 3S6DA 4Y90A 3GDLA 4AHOA 3RLUA 5J5RA 1VR6A 4XTDA 1W1ZA 1TPB1 4K8EA 4WZHA 3C61A 4EWND 4Y6GA 2QKFA 3M44A 4M6QA 4BWLC 4FNQA 4WJEA 5DCDA 1AL8A 4H3DA 5CSSA 3FIGA 3GDKA 4UMCA 4UFHA 1O5KA 1YADA 3L65A 2QCCA 5DN1A 3S0CA 1OFOA 1W3NA 4JICA 4YCOA 4ZVJA 4MLRA 5I3IA 4NNCA 2YW4A 3NAVA 4QISA 1H50A 3TX9A 1M7PA 1N55A 5D02A 5FESA 1SPQA 1XI3A 3DGRA 4AWSA 5DXXA 3MBDA 3I68A 4Q4KA 1QMLA 4GE8A 1DHPA 1WA3A 2WPBA 4UTHA 1GTHA 3EWUA 1OFBA 1LLWA 3R13A 3VCRA 3LHVA 4UFJA 3G1XA 1R2TA 4H6KA 2CLMA 2FDSA 2V8ZA 2VELA 3CEPA 1I45A 5HR6A 2HTMA 3A9IA 4MLJA 2DZSA 1TTIA 3LCGA 1F5ZA 4FXSA 4UR8A 3IEBA 1SW0A 3PR2A 1KFEA 2GQAA 3DFPA 4ZQMA 1JCMP 5LSMA 3PSWA 3E02A 3BLIA 1UASA 1K7EA 2WJZA 4PH6A 4QQ3A 1IXOA 3G0SA 4M7SA 2YX0A 1X7FA 4LNYA 4FIQA 2NV2A 1A5BA 1KM3A 4HT3A 4ONVA 2X2GA 1W5OA 2H6RA 1G67A 1VYSX 5D38A 4RK8A 3T44A 3JS3A 1B57A 4N9CA 4NZJA 3W73A 3P81A 4LVAA 3TAOA 5CZTA 3GZ3A 3LRMA 3UWQA 1ZFJA 1PL9A 1V7YA 3NNTA 4Y96A 1H5YA 3S42A 2VFEA 2VKZG 3O6YX 3PBYA 1GVRA 3TNOA 4HIBA 3G8RA 4O4WA 4RJEA 3QPZA 5I3HA 1OFQA 2Y63A 4HNTA 4DEFA 5I3JA 4XWUA 3L5MA 3QF0A 3L2IA 3R89A 3STGA 5FEPA 5LKYA 3MUXA 3GKFA 4QM1A 2CU0A 2DZTA 3R5EA 4NU7A 1DOSA 3SIZA 3W85A 5K9XA 1I2RA 1VYRA 5G4EA 1F73A 3NZ1A 3EB2A 4K7VA 4O0KA 1NEYA 3BO9A 1TTPA 1SO3A 3WK0A 4MZ1A 4TX9A 2QJHA 4UFKA 1MZHA 3MYOA 2QF7A 1DQWA 1FWTA 5EL1A 4KFPA 3M43A 1YXDA 2J9YA 1OFEA 2ZA1A 1LTDA 1GJPA 4M5PA 1R46A 3PSVA 1K3UA 4GBUA 3T55A 4MZYA 4UTJA 5AN7A 4GUIA 3NXFA 5T26A 1OHLA 3SFKA 1H60A 4JIPA 3WJWA 3KVJA 3UNDA 1NF0A 4OT7A 1FWWA 4DF2A 5KINA 5DELA 3T40A 3KRSA 3NPVA 3DFNA 3S5ZA 4GFSA 1W0MA 4FNUA 1EX5A 2QCLA 1QR7A 3MBFA 2CLEA 3CIXA 4O1CA 4P2VA 3A5FA 3NQEA 1FWNA 1LROA 5DY2A 4PEKA 3KRZA 2AQWA 2XN2A 4O18A 4ICNA 4OQVA 4K38A 4JN6A 1L9WA 3M1ZA 3EEGA 1JCXA 1K02A 3UWVA 1Q3NA 4JYEA 3B0UX 2KZHA 5HR7A 2RDWA 3NPWA 4WY0B 3G24A 5CSRA 2ZCGA 1AW2A 2QCNA 1O5XA 2YYTA 3TKFA 1GQNA 2DZPA 5G2HA 1OFPA 3TFCA 2OX1A 1KTNA 3F4NA 1DKWA 1B4KA 1TJPA 3IIXA 5J5DA 4FNTA 4NX0A 5AHFA 2V2HA 1QAPA 2GOUA 1K03A 2X1RA 1JRBA 4MFEA 4B5NA 4WQ6A 3NQAA 3I6RA 3LBMA 4ZQCA 3ZWSA 5GVJA 4HKPA 3L0GA 2VFIA 3UY7A 4LS1A 3A22A 4IXHA 4JDBA 1KFCA 3HGOA 5BMXA 2RHGA 3W1RA 3NL5A 3TW7A 2G95A 3TUUA 1DJQA 1W56A 2VENA 4RX0A 3SGUA 1FX6A 2OT1A 3P61A 4YMZA 2ISSA 3G18A 4O52A 4UTLA 1VH7A 2X30A 4NJHA 1SZEA 4U4MA 2E5BA 1CX9A 1N7KA 4LV9A 1P1XA 1LORA 3QZEA 3D0CA 5AYXA 1TSIA 3L0NA 3MW7A 3EKLA 4LTSA 3Q58A 1LBLA 1ME8A 1AW5A 2E09A 4YCPA 3B0PA 2WV8A 1JUEA 3YPIA 1QCWA 3LHTA 3KOFA 3O6DA 1U83A 1EA0A 1IGSA 1QNVA 3GXTA 4JTKA 4UFIA 3UY8A 2C19A 5LNSA 1UBSA 2W79A 1BWKA 1F05A 3DFQA 3G1AA 5BNKA 3BG9A 1HTIA 2J88A 4Z1BA 3PBUA 3RFAA 2E1DA 3TK7A 3UWWA 3DFTA 3F03K 3SJ3A 3W2NA 4POCA 1QOPA 5G5IA 1DORA 4YLWA 5CG7A 5D2YA 1K8ZA 1Q6RA 1IXPA 1D3HA 1H1ZA 1DQXA 1QPOA 3C3NA 1S5TA 5KTLA 5F1VA 1G4SA 3ABOA 1JULA 4O10A 5DBUA 5LNVA 3P7YA 1TV8A 2A7RA 1OFDA 3FKRA 3LV5A 3NPUA 1H61A 5AHEA 5U7SA 3BGJA 4HPJA 3S1UA 3O8AA 4UMAA 1C8VA 1JRCA 4O8RA 3O06A 1ZAIA 5DBTA 3W1TA 3UXDA 3B05A 2E5CA 3M5XA 3NL2A 8TIMA 3PG9A 3W3OA 4ORIA 4BWLA 4HPXA 4A29A 3W71A 4JEQA 4JTSA 1KM4A 4YXGA 2DZWA 2W6RA 1FY6A 3NG3A 2ZRWA 2YDAA 1JCLA 4JYDA 3HG5A 3SI9A 1XM3A 1NVMA 4CLMA 2VEIA 1SZNA 4Z1DA 3H54A 1VQTA 4ZQNA 3P84A 3O16A 4JY9A 1A5SA 4O28A 1OF8A 4JTIA 5F4SA 3FYOA 2NX1A 2I1OA 4NNBA 2EGZA 4LVGA 2VFHA 2OT0A 3MMTA 3STEA 3P5ZA 3MI6A 4DBDA 2E6FA 4TMBA 5G1TA 1FCVA 1GEQA 1PCWA 3TIMA 2FB2A 5HNRA 3E0IA 4EIVA 4CQ8A 2WKJA 3W22A 1LM1A 4ZQRA 1GWJA 2WO5A 4IMGA 3GXNA 2D73A 3W72A 3TC6A 3W7RA 4WY0F 3ZS4A 3NVTA 1V5XA 5LHFA 1SUXA 1WBJA 3W6YA 4Z0SA 2NUWA 1LCOA 2ZZ1A 5D2TA 4QNWA 3EWXA 4R34A 5CZJA 4AMAA 2X1SA 2ZRYA 3O15A 3P80A 3C2EA 3JR2A 3LXAA 4TMCA 4EVZA 4NXSA 1W37A 2HS6A 1ZY9A 2A7PA 4N9BA 2JKAA 3M16A 2YCEA 3UWUA 3KRUA 4GWEA 2VOMA 4GXMA 2TPSA 5LNUA 4UTMA 1EB3A 1D9EA 1M5WA 5F2GA 1KBIA 3TXZA 4OBTA 3WJSA 1IF2A 3QM3A 3PB2A 4GC4A 1M6JA 2C18A 1P0NA 2Y7DA 1HFBA 3A24A 4C1LA 5LNRA 3N2MA 1ZALA 4LRSA 2JGYA 3N9SA 2E6AA 3W87A 3W74A 3DI0A 1JCJA 4RXFA 1YTDA 2AAMA 3EX3A 3W2UA 3LRKA 3A21A 3OVPA 2VXNA 4O50A 2A5HA 2Y7GA 3I65A 5H2ZA 2Y88A 1OFAA 1XC4A 1KA9F 1O4UA 1VCGA 2X1UA 1SO6A 1FCBA 5EKYA 3M6YA 3W7KA 2DZUA 4LT9A 5C54A 2B7NA 3DAQA 4K37A 1TIMA 2CZEA 4QAIA 3C0JA 3G1SA 1KM5A 1VPXA 3N19B 4C1KA 4MY1A 4UTUA 3W9ZA 4JGDA 5FF4A 3LCFA 4GUJA 3EWWA 2OJPA 4XZ9A 3MO7A 3GR8A 4PCFA 2DZVA 4N02A 3TSBA 3G1VA 4KFNA 4NVTA 3W1MA 4OGZA 3W1PA 1SU5A 1R2RA 4YWIA 2YR1A 2BXVA 4QJ1A 3NM1A 3W2LA 3NQ2A 3HMJG 4EOUA 1GPWA 1IXQA 5LZLA 5F2LA 2I14A 3HG3A 3WJYA 4FNPA 2JBMA 3OG3A 2C16A 4NZFA 5G2WA 1FXPA 5D30A 4E2BA 3EXRA 3W7CA 1H63A 1B4EA 3BARA 1VCVA 2NUXA 3MHUA 1IXNA 1W5PA 4U28A 3B4UA 4MPQA 3QJAA 4A2SA 3GYEA 2PC4A 2J9ZA 3NOEA 1W3IA 3CU2A 3L68A 1ZCOA 4IXXA 1HL2A 4RZ5A 3GIYA 3O1NA 3PY2A 3W7QA 1P5BA 4N4PA 3FFSA 3QMTA 3W1NA 6TIMA 3W70A 1C29A 1YXCA 3DKJA 1TV5A 2XFWA 5DY3A 4GJ1A 3SGZA 2BX7A 1H7OA 1G7UA 3GVGA 1JCNA 4XUGA 4UNLA 3DHFA 4I7UA 5TBOA 1VZWA 1Q6OA 4RZ4A 4ADSA 1QFEA 4O19A 3IVSA 3U2OA 4WD0A 2W0UA 1LP6A 5FI8A 5KZDA 2ZZ2A 3LHWA 3DFOA 4K6AA 3SSJA 1RQEA 4AVFA 2G96A 2JK2A 1ZAJA 2V82A 2EPHA 1ZJIA 3O05A 2ZRUA 4JDYA 3EKZA 4RKAA 1VYPX 1BEUA 4HSNA 3G22A 1TQXA 2O7QA 1OJXA 2QCMA 5DLCA 2QCFA 4MUZA 3EX4A 5IM51 2EHHA 3ANYA 3RU6A 4MOZA 5D03A 1KM6A 3FJLA 4HNUA 5MHBA 3UPWA 7TIMA 1MEWA 4JTEA 3TC7A 5K9CA 2DJXA 3LXCA 1R47A 3G0UA 3IRDA 3P60A 3CQ0A 1HO4A 4N9DA 3N73A 1F7BA 4O13A 3S5YA 1JR1A 4LUJA 3LXBA 1TPUA 2P1FA 2Q8LA 3VI2A 1XCFA 2E77A 3M5YA 4MY9A 5G1YA 3QMRA 1ZENA 2YXGA 1F6KA 2PURA 2NZLA 3NGJA 3UZ5A 4UNKA 4UFLA 2Z2UA 2E6YA 3TSDA 2NUYA 2QCGA 2WSRA 3C2FA 5CGQA 1ML1A 5E93A 4ZQPA 1LOSA 4X2RA 3W1XA 1H7XA 2GVJA 3BW3A 1TRIA 3GR7A 2DJLA 1NSJA 3LCLA 2VC6A 4O57A 2RH9A 3OBKA 4UFMA 1PVNA 1O95A 1SQ7A 4N6FA 5HUOA 2GVGA 3DZ1A 4NT0A 2A6LA 4CNPA 3G8EA 3NQGA 1JQVA 3NQ6A 3TR2A 2QAFA 4UXDA 1TTJA 4L4MA 4IPIA 3S1WA 1WX0A 2Q3OA 3P82A 2H90A 4MYAA 1RR2A 2NX3A 5AYZA 1PV8A 3WJXA 4FX6M 2BLEA 1WV2A 1KM0A 2DU2A 3M47A 3M41A 4CQ9A 1BWLA 3ATYA 4ZZ9A 2X1TA 4AHQA 3M9YA 4Z1CA 4RR4A 1LRTA 3LM7A 5TIMA 1SW7A 5F2IA 3GAKA 3W88A 3STFA 5AC8A 3W7LA 1LOLA 4O14A 3LI0A 4UTWC 5HUPA 1G7VA 3AJXA 4WOZA 2ALDA 5FEXA 2C0AA 1HUVA 2J24A 4K7YA 4UTKA 4ZQOA 1FDZA 2NX9A 2BSLA 3TJXA 2ZZ3A 2NWSA 1F74A 3W7OA 3TW6A 1GTEA 2ZZ6A 5CZSA 4XKYA 3MYPA 1OABA 4S2CA 2OZ0A 1L6SA 1KTBA 3ABRA 4S2BA 5AHIA 3VKJA 1XFBA 2YZRA 4LU0A 1IIHA 3UZJA 1VC4A 4TIMA 2CZDA 4JS3A 1BKSA 2EF9A 4O1AA 2R14A 2B0MA 5IBXA 4O15A 2GJLA 3ABQA 1L6WA 3A5VA 3BPWA 4BFAA 5K4XA 1OX5A 1WYIA 3GXPA 4MVAA 3HPSA 1GYNA 3NEVA 2BWGA 5KITA 1X6UA 3BK0A 2ZDRA 4DF0A 3R8RA 2CWNA 2ABBA 1FXQA 1QO5A 3G3DA 5AOUA 2YFNA 2QUVA 5EA9A 3G1DA 4X3ZA 4JX6A 4S1FA 1G6CA 4AB4A 1Q6QA 3UWYA 1SZGA 5AC7A 3W7NA 3TDFA 2NLIA 1NF7A 3FA5A 4R33A 1GG1A 1RQBA 4A3UA 3LI1A 3S5NA 1LYXA 1Y0EA 2CZ5A 3W7EA 5FF0A 4N4QA 1KTCA 1WXJA 4JX4A 5CPNA 2DZXA 3QQ0A 5F2MA 1TPWA 3BVJA 3GX9A 1UUOA 1PHWA 5F1UA 3BV4A 1LLZA 3FOKA 2R8WA 4GUGA 1SR9A 4A2RA 5LGXA 3N2XA 4MJZA 4CCCA 1U5JA 4IMDA 3W7MA 4LS2A 3TV8A 3HPZA 4MIMA 4LW7A 1LRQA 4WXZA 2JKPA 2YYUA 2HMCA 2B4GA 1YDOA 3IVUA 1OFRA 3C2OA 4R53A 2YGYA 3TQVA 4NJIA 1QO2A 5E1QA 4HNNA 4JY8A 4JIQA 4WOQA 1H51A 3BLFA 4A22A 3W76A 4DO4A 3NZRA 4LWWA 3I7RA 4QNEA 2B7PA 1YTEA 1VS1A 2ZYFA 3HQ1A 3TCEA 1ONRA 4BI7A 1RVGA 1JQXA 4AF0B 4PA8A 1F2JA 1IIGA 2A6NA 3KHJA 2F7FA 3WFAA 1G4PA 3TFXA 1OK6A 2Q8ZA 1XBVA 2QCEA 2ZFAA 2BTMA 4GUHA 1I8JA 3SR7A 2IQTA 4IJBA 3ATZA 3W2KA 3L66A 1XDMA 2ZQ0A 3CTLA 4UTIA 3LHZA 4BK9A 1XUZA 1PCKA 1ZAHA 2HSAA 3QC3A 2FTPA 3FJ6A 1N8FA 4JTLA 5D2WA 2XN0A 1YXYA 1LZOA 4NJGA 4NXKA 1OX6A 4UTTC 1YPFA 2QUUA 4FX8A 1HO1A 2ISVA 3LLDA 4FB7A 4FNRA 1TREA 2QUTA 3PC0A 1SW3A 2Y61A 1KFJA 1B9BA 2ZA3A 2A4AA 1ZNNA 2FPYA 5G4WA 1I2QA 2VFGA 1I2OA 3GNNA 1M7OA 1T8XA 2JKEA 1L6YA 1P0KA 1JUKA 1O60A 2C1HA 2ATSA 1A53A 1B3OA 2C14A 1I2NA 2V5BA 4LY8A 4LS0A 3GB6A 4EF9A 5HQEA 3STCA 4H4IA 3OIXA 1OYCA 3INPA 3W7GA 4E0CA 2R94A 4OHQA 1KM2A 3TSMA 3C6CA 1G4EA 5CPLA 5L6UA 5K3VA 3WK3A 1ICSA 2AGKA 3RK8A 3L5AA 2ZBTA 4HNVA 3WK2A 4GRSA 3LTYA 3FEMA 4AXKA 1XBZA 5D33A 1AG1O 1S5WA 4UTTA 1ZHAA 3P8IA 2H8XA 3SW6A 3MP5A 1Z48A 3G1FA 3L21A 4E38A 3LB0A 4TO8A 4O53A 3N34A 3TROA 1Z42A 4M6PA 1K8YA 3C4UA 3R12A 1K8XA 4X22A 5BOOA 1TCDA 1KW1A 3NQCA 2H8ZA 3W1AA 1VJIA 3IIZA 1T0OA 1UCWA 1TJRA 3L67A 3MP4A 4JYFA 2V5LA 3TA6A 3FYPA 1GVFA 3B06A 2QJIA 3BG3A 4FIRA 3GKAA 2Z6JA 3PUDA 4MYXA 2C6QA 1LBFA 3KVMA 3HG4A 3PBVA 3NM3A 1O94A 2FJKA 3PG8A 4UTWA 2EKCA 2A2IA 2Y7FA 3HO8A 2C15A 5FEZA 5L9FA 1TPC1 2OCZA 2E5DA 5D2XA 1F6PA 2CLOA 2R91A 3EXTA 1W3TA 3V75A 3HBLA 3BGGA 3USBA 1DL3A 4XTIA 4LUIA 1RZMA 4PODA 1LBMA 1ME9A 4WUIA 3Q2DA 3EX6A 1I4NA 1OX4A 2NWRA 3OA3A 4WY0A 5EY5A 3LGEA 2CLLA 2G97A 1SZFA 4IGHA 3C56A 2CLIA 3UQNA 3MHFA 3LTSA 1X1OA 3ABSA 1J2WA 1P4CA 3LTPA 3NR0A 3RLVA 1W8SA 2CZFA 4QIUA 1YLVA 5U4NA 2TMDA 4FF7A 1TV7A 3WK1A 1EP3A 2V81A 2Z0IA 3B03A 2CLFA 5HWJA 3HGJA 3KXQA 4K39A 3CHVA 3W86A 3QQ1A 1JUBA 2P0OA 3K30A 3QYQA 4IMCA 5D04C 3IIPA 4JTHA 1I2PA 3DI1A 4HHPA 2WNQA 4ZL1A 5C6MA 4UUIA 3TU9A 4RXGA 3CIWA 1C9DA 1MEHA 3EXSA 1ICQA 3PAJA 3ZFHA 5KZEA 4FNSA 5FEWA 3T7VA 1FWRA 5K4ZA 4UIOA 3RNDA 4O0ZA 4QITA 3TXVA 2A21A 5D37A 4KWVA 3Q37A 2ZTKA 3W83A 5AHNA 4NX5A 5FF2A 3S5OA 1DJNA 5EBUA 3LCWA 4NJKA 3CT7A 4O17A 3TJLA 3W7HA 3DKLA 3PWAA 3JRKA 2ATMA 2RDUA 4OE7A 3O07A 3EWYA 3NPXA 1EP1A 1OK4A 4JD4A 2RFGA 4P61A 3R2GA 1OF6A 5DXYA 3UYCA 1EUNA 3QW4B 4WX2A 4N9EA 5DCBA 3EWZA 3NQFA 1SO4A 3SZ8A 5LNWA 3QPYA 4I7WA 3GNDA 3PVFA 3G1HA 2RDTA 3IIOA 5D05A 2FB3A 2ISWA 2CLKA 2GQ8A 3NQDA 5BW6A 3DENA 3S1XA 1D3GA 1JCYA 5LHEA 1H62A 2J27A 4JTTA 1KLYA 4UCGA 4RLIA 3W1QA 2Y62A 1KFBA 2O7SA 2V9DA 1QDSA 2QEZA 3HGRA 1Z41A 4JX5A 1SSDA 3E96A
chains in the Genus database with same CATH superfamily
1Q8JA 3GU9A 4D9PA 1WKFA 1W2PA 2WNZA 4XBJA 1UJQA 1EWEA 1L2UA 1PX3A 2CYGA 2EPMX 4GVGA 2WVVA 3HB9A 2FVKA 1W5QA 3NO5A 1RA5A 1LRNA 2YFOA 3ARXA 3WBWA 3K8KA 4Y8FA 4MWAA 2G4FA 5A2BA 1GT8A 3PBWA 3IGUA 3GXMA 4M24A 2LLEA 1ENUA 1P0EA 3FY1A 4NI3A 4UQDA 1Q6LA 4ZXOA 1BVZA 3SSZA 3VKBA 3WQOA 1M1BA 3GD6A 2PZ0A 3WD1A 2XHYA 2NW0A 2J77A 2Z2BA 5CJNA 2VFDA 3LDVA 5E0KA 3CB8A 4ZE4A 3CH0A 3OVRA 1MW1A 3NDZA 2GYIA 3TOPA 2DSVA 3NL6A 4LALA 4C6FA 4PBEA 4NAEB 4W93A 5BOFA 3FS2A 2QJNA 2JALA 1Q6FA 3VGEA 1BQGA 2UY5A 2Y8VA 1K4HA 4L4LA 3UCDA 3UD6A 3GXDA 4AH7A 1YYAA 2TAAA 1VPYA 4XKYB 2DW6A 2BV9A 3MSDA 2W5FA 1RBLA 2P3ZA 1W8GA 1BTMA 1DIEA 4L6DA 4RZ6A 4GZIA 2Z24A 3WEZA 1WOBA 1NAL1 3PAOA 4I5XA 4JBRA 4PUDA 2OYKA 1SMAA 2VEKA 1NFBA 1J0KA 3VE9A 1US3A 3LBCA 3V0TA 1AJ2A 4LVBA 2J9XA 1Q6DA 2DP3A 1X1ZA 4IOTA 1FHDA 3HPFA 2OG9A 4DO6A 3VOCA 1XIMA 2V30A 3HU7A 2BHUA 3NQVA 1P0BA 1CW2A 1ONEA 1VJSA 2OR2A 5CXPA 2ZRXA 5A8GA 3CZ8A 1R3VA 4KERA 1QJWA 1XIEA 2Q3RA 4ADTA 4TU1A 1K1DA 2DVUA 4MB1A 3KOXA 4LPCA 4Z2GA 4MJ4A 1EP2A 4ZB0A 4MAVA 1EDTA 3UNTA 4XZNX 5AZ0A 2NSOA 4C7DA 4Z42C 2VVNA 2A0NA 2ZUMA 4LXFA 2OODA 4L80A 3NA8A 2YXOA 3BH4A 2CBIA 2HS8A 3MHGA 5F4XA 4IMEA 2PDIA 3RRAA 3K13A 2V3GA 5C70A 4RDVA 5D9PA 1V3IA 3ZSSA 3AIVA 4LF1A 2AMXA 1TPVA 2NXHA 1Q45A 3QR3A 3ZR5A 4F2TA 2PWFA 5I0DA 3DX5A 1S5NA 2DH3A 2QYGA 1QPRA 2ZZ4A 3EAUA 3PTQA 2Z6IA 3G1YA 5AYYA 5GJMA 2AL2B 5XINA 3VAVA 3DFHA 4H7ZA 3HGSA 1Q7QA 4YU1A 4AX7A 5HDRA 7CGTA 5DCEA 2BFGA 4JN7A 1YW1A 4XG1A 3KTCA 4XQ6A 5FIPA 1UWSA 3HA1A 2QCHA 1W54A 4W7VA 4IG2B 1L6FA 3WKZA 1GGOA 3IPWA 4FS9A 2XFRA 5G2IA 1E70M 4REQB 3NZPA 1TPEA 4PB3A 1K7XA 2G3FA 2DQWA 3MI3A 2BS9A 4WSJA 3IVTA 4Y9AA 4Q32A 3OEXA 3BOXA 1MEIA 3DFYA 1UWIA 4NKCA 3CMGA 2F6KA 1KXVA 3OP2A 2CITA 4PMJA 4DELA 1YHTA 4GYJA 1JNDA 5TAOA 2Z1BA 3VIMA 1EHAA 1Z44A 3HOJA 2FIQA 3HG2A 2QCDB 2QPSA 1FBAA 3UXAA 4DZAA 1S5VA 2PDHA 4L61A 1XINA 4AZCB 3HM7A 4OJYA 3WLOA 4ZFCA 3AHVA 1A49A 3QRHA 4K8HA 2UBPC 2HBXA 1VFHA 3WF4A 4H9UA 3ZXWA 3LCIA 3OW1A 1ZP3A 2OX4A 3B40A 4S3EA 1OX4B 1VLWA 3WLLA 2C79A 1TZ7A 4JTJA 3WQ8A 1ODZA 3CZGA 3VIGA 3UPBA 4UQ9A 4V27A 2IKJA 4HU3A 1P48A 3TQ0A 3RPDA 5ABHA 5M3WA 3V0UA 1RPXA 3KBSA 2O9PA 1X1NA 1JDAA 1CPUA 4BZYA 2NXGA 2DEPA 3N2BA 4K2SA 3GVRA 2GUYA 2J62A 3N4FA 4LUSB 1QNPA 2PDXA 2VMFA 1WDPA 1QU4A 1GYLA 2WW5A 1Y5XA 1JGMA 1YDVA 4IUOA 1VRDA 1WAUA 2HXUA 4HA3A 4PMYA 2QJGA 3BOFA 1WQ5A 3PULA 4K68A 2BVWA 2PRLA 1EUAA 3DGBA 3IV3A 4FP1A 1UZ1A 3KLKA 5BOEA 3CV7A 3TYEA 2QDHA 3VIIA 3HPXA 3J7HA 4EAMA 4GIRA 3ZOAA 3FXYA 1PIIA 4KCVA 3TW9A 4PUWA 4OU1A 1ZB5A 7XIMA 5HULA 2JF7A 3URNA 3NOYA 4ZO9A 1X8FA 3F7JA 5HJLA 4JTGA 4CUCA 3N13A 3V5OA 2Z7KA 3T78A 1NP0A 1JCTA 3VFLA 1UZDA 3F4VA 1TRDA 2B7QA 3F4WA 4HSHA 3EX1A 1TWDA 3RMEA 1KM1A 5C2XA 1E4NA 3WNNA 2R9RA 4UC5A 4D1IA 4BQ2A 1JIBA 3MU7A 1BLIA 1XISA 1FUYA 4KCUA 3U7VA 3S6OA 3M0LA 4XVEA 3DH7A 2WZEA 2VTFA 1UD6A 4LC8A 3LOTA 4U5KA 4O11A 2D3NA 4AC1X 2GUBA 4AZ6A 3BW4A 2WC7A 3LS9A 4AAJA 5A8MA 1GOXA 4KFOA 3PM6A 1X98A 2VP8A 4IGSA 3VNLA 9XIAA 1UR8A 3URQA 2AOSA 4JKKA 3GDLA 5J5RA 1VR6A 1XQKA 2C0HA 2D2JA 4XTDA 4I6VA 1PBGA 4D71A 5HATA 2Q6ZA 1BXNA 1TMLA 5T8GA 2FH8A 4I5RA 4H3DA 4MM1A 3GDKA 3WIJA 2QCCA 4MF4A 3S0CA 1XYMA 4ZVJA 4MLRA 1KNWA 4NNCA 1OCBA 2J7EA 4UZUA 1M7PA 2PMQA 2IXUA 1K6AA 1YNYA 3NIYA 1SPQA 3MVTA 3OA5A 4UCFA 4AWSA 2OEMA 3I68A 1DHPA 1BXBA 2GK1A 3KUMA 4Z2LA 3LHVA 4E8GA 4UFJA 2OLAA 3FA3A 3OLEA 4H6KA 2Z25A 1BRLB 3MC5A 1PJ9A 2JIWA 2RUSA 4R9XA 3CH9A 4L6HA 4PEEA 2HXTA 1MXGA 1I45A 1M7JA 2HTMA 4MLJA 2FJUB 3ITXA 4NRRA 3CWHA 4LAKA 1TTIA 3LCGA 4UR8A 4JL1A 1HKWA 3PR2A 1KFEA 2GQAA 2J74A 4ZQMA 3E02A 1K7EA 2WJZA 4J40A 1IXOA 3G0SA 4JHMA 4OIFA 2OYLA 2YX0A 2NT1A 2BHYA 2NV2A 1H49A 4C6DA 2FVMA 4HT3A 3N2TA 1W5OA 1G67A 4CD7A 1YNPA 5JUVA 1RA0A 4DJEA 1AVAA 2JEQA 4QHRA 3W73A 4KW2A 4AZ5A 3TAOA 1M3UA 3VXGA 1ZFJA 4LX4A 1TR1A 1V7YA 3NNTA 3S42A 3O6YX 3PBYA 2DH2A 5I3HA 2Y63A 3FYYA 4HNTA 5I3JA 4KEZA 3VMPA 3UGRA 4DO7A 3QF0A 4PB5A 4HJFA 3STGA 5FEPA 3I6TA 5I07A 1A5KC 4CU7A 3GTFA 1VYRA 3LYEA 1R3SA 4O0KA 2NSXA 2QLYA 1NEYA 3N12A 3EGJA 4A8LA 2PDJA 4C6KA 1HW6A 1XC6A 4YS1A 4E4PA 1W9UA 5EL1A 1FWTA 3GBEA 3STPA 3M43A 4D6HA 3T55A 1XPGA 2ZXDA 4AISA 1OHLA 1E6SM 4JIPA 3WJWA 3KVJA 2INFA 3UNDA 1FWWA 4DF2A 3CT2A 3WUBA 1W9XA 1C7SA 3ZJ6A 4LAZA 2CBJA 3KRSA 2YLLA 1Q7MA 3BAWA 4IIEA 3UFYA 1Z32X 1CBGA 1JEZA 5ABFB 2PUZA 5F7UA 2CLEA 3CIXA 2YA0A 3ZJKA 2FZBA 3N6JA 1QNOA 2AQWA 2XN2A 4M8UA 3UU0A 5C9XA 4TXEA 2H9AB 4HU4A 2VDIA 3AS0A 3W02A 4GI9A 1TJ0A 1JCXA 5A1AA 3UWVA 3MUCA 1OSEA 1EF2A 2RDWA 4MB3A 1FH9A 4ERIA 1UW9A 2QCNA 1OFPA 1Y65A 3L4XA 1B4KA 4I3GA 1I1XA 3IIXA 5J5DA 2MNRA 2V2HA 1QAPA 4DYKA 1EJUC 3E1F1 1A0EA 4YHEA 1V0NA 3AHXA 2WLZA 3ITLA 5CBBA 2Z1VA 3L0GA 3VIJA 1TWZA 2UY4A 1FHLA 5DO8A 3UERA 3HGOA 2EG8A 1V6WA 3VNZA 5CG0A 3BANA 4B2DA 1DJQA 3H4GA 4V1YA 4OTKA 3MVIA 1A3XA 3G18A 3K8MA 1VH7A 1SZEA 1J96A 3BWWA 5GNXA 4IL2A 4I8YA 4LV9A 4H6RA 1LORA 3QZEA 3WQVA 5AYXA 2PWDA 3ITVA 1Q4WA 1LBLA 2VC9A 1IE7C 4C65A 1JUEA 2PLKA 3LHTA 7ODCA 3IS4A 4EPBC 1VKFA 1F05A 3PZNA 3DFQA 3CJPA 1R87A 1BHGA 2IPWA 3SRHA 1J2BA 3BG9A 4HMCA 4HMDA 3RFAA 2E1DA 2V69A 5REQB 4EXQA 1BGGA 1O5QA 3CAKA 4POCA 5CG7A 3PPFA 1Q6RA 1GCYA 1H1ZA 3WNOA 3PNUA 1J8VA 1JULA 5LNVA 1FRBA 4D1JA 3NPUA 1V0KA 2O56A 5AHEA 5U7SA 3BGJA 4UMAA 3AMDA 3LM3A 1I6NA 4O8RA 1AUSL 3W1TA 3BL3A 4ORIA 1KCLA 3RPMA 3DERA 4HPXA 1XLDA 1R9XA 4PTMA 4JEQA 1PZ1A 3GQYA 2ZRWA 2F2KA 3QBUA 6XIMA 3F5KA 1B3YA 1NVMA 3AU2A 3B8SA 1PXGA 3H54A 4ZQNA 1PYMA 4HPHA 3O16A 5DMYA 2OZ3A 2GSHA 2NX1A 3QV8A 4L65A 2XWEA 2EGZA 3T09A 3STEA 4S3GA 4BS0A 3MI6A 3WLTA 1OCNA 5G1TA 4KH2A 1FCVA 1GEQA 5I03A 4LCQA 2QXWA 4ZB5A 4XUYA 3CS2A 3E0IA 1GOKA 4GKLA 3G1RA 1LM1A 1UWUA 4PMQA 3TN3A 3TC6A 5AC5A 4WY0F 3ZS4A 3NVTA 4NAFB 2GLKA 4NASA 1SMDA 3EWXA 3WDHA 4R34A 4J3ZA 4AMAA 3O15A 3P80A 1CXEA 3C2EA 1MW2A 1VB9A 3JR2A 4HK7A 4EVZA 2FHCA 3UJSA 2QMJA 1HL8A 1E0WA 4N9BA 2JKAA 3UVIA 3KRUA 3KZSA 2VOMA 1ECQA 2W63A 3VD9A 2GFTA 1KBIA 2JE8A 1UD4A 1U1HA 1OINA 4OBTA 3QM3A 5CQ1A 2O4QA 2FGLA 3DC8A 2C71A 3I10A 3W74A 3EOOA 1H0GA 3F2CA 1HKVA 2CHOA 3VABA 3LRKA 3CYJA 1V3LA 4IP5A 3E0WA 4O50A 2A5HA 3IJ8A 3RO6A 1NDYA 4DLMA 1TG7A 2BOGX 1OFAA 4MWAE 3VMOA 1KA9F 4F2UA 4ATDA 1A47A 2X1UA 1LWIA 2FMOA 1QTWA 5I2UA 1J5SA 3TYCA 3VCCA 1UD8A 3PP7A 2RJHA 3VDAA 2B7NA 2PDLA 3AFBA 3DAQA 1QW8A 4JTCA 3VOFA 1KM5A 4PMVA 4MY1A 3S2LA 5I23A 4JGDA 1UC5A 5FF4A 2BVYA 2VUNA 3QHNA 1AODA 4F40A 2OJPA 2AGTA 4XZ9A 4TVUA 1ISVA 3N29A 2DZVA 4N02A 4D72A 2WK2A 4NVTA 3U2ZA 1JYNA 5CAHA 1SU5A 3QZAA 5C9RA 1R2RA 3LA4A 3NM1A 3K4AA 3NQ2A 3RGTA 4EOUA 3ZJ8A 5LZLA 3ZT7A 5F2LA 2I14A 1NELA 5XIAA 2UWFA 2JBMA 4LYRA 5IHRA 4NZFA 5D30A 3M07A 3W7CA 4TVDA 2NUXA 4LF2A 4K8GA 1RY8A 5D8ZA 4XAZA 3QQWA 2YA1A 4PTVA 1W3IA 3MY9A 4IIGA 3L68A 4IXXA 1NU5A 3T6CA 2KAUC 4D6EA 3MCMA 2DUAA 4RZ5A 3GIYA 4QJ5B 2DVXA 2G3NA 3FFSA 6TIMA 1CCWB 3W70A 1YXCA 5FAJA 3GHRA 1XS2A 3WFLA 5DY3A 3SGZA 2XTKA 2C7FA 4H01A 3HQNA 1G7UA 5A94A 1X97A 5TBOA 3VM5A 5JBEA 3K4DA 2GJPA 2DY3A 2W0UA 3RM4A 5FI8A 2WMFA 2ZZ2A 1RQEA 5A2CA 2V82A 2EPHA 4AY8A 1DJGA 1ZJIA 3O05A 3EKZA 4HYVA 1VYPX 1NTHA 1BEUA 2IPFA 1EXBA 3GHTA 3GW0A 2QCMA 1QBBA 3L2MA 4MUZA 4C6PA 3EYPA 1C7TA 3UR2A 5C8BB 4MOZA 5E0CA 1KM6A 2CBUA 1M68A 4DJEC 3AC0A 3RJXA 4XD4A 1V0LA 3BE7A 3OZPA 3UZXA 1F7BA 1EJVC 1JR1A 2BXYA 4H83A 1C3FA 2C8NA 1Q7ZA 1ZENA 4UFLA 2Z2UA 1FKXA 1R3RA 2QCGA 2VZUA 2WSRA 3C2FA 3MDWA 3N18A 3W1XA 1H7XA 3BW3A 3WYZA 2PSNA 4GO9A 3SN0A 2EJ1A 1EEXA 1PVNA 1SQ7A 1DJWA 4FLSA 4NT0A 4KIEA 3EKGA 5JU6A 2G3JA 4GIAA 4S3AA 3TR2A 2QAFA 2ZUVA 1TR9A 5GJNA 1PDYA 3WG6A 1WX0A 3S1WA 1RR2A 1M7XA 5AYZA 3ITGA 1PV8A 4W7UA 1R7OA 3AXIA 1CXLA 5AC4A 4XISA 2X2YA 3TLQA 1QI2A 3M47A 4CQCA 1BWLA 5AKQA 5HPOA 3ATYA 3M9YA 1PKNA 3MUZ1 3LM7A 5TIMA 3VNIA 2R82A 1SW7A 1GJWA 3BZGA 5AC8A 4O14A 4UTWC 1H3GA 4MG4A 4CGTA 3ZMRA 4Q4PA 3VX0A 3VC6A 5IDIA 1RCXB 5FEXA 1MUMA 3LPPA 4UTKA 4ZQOA 2NX9A 3TJXA 1D2KA 2ZZ3A 1AQFA 3I3BA 4IIDA 2ZC8A 2XJ7A 4S2CA 2OZ0A 4YYCA 2A3EA 2PGEA 1PTGA 4M81A 3WNKA 5I5RA 1VC4A 2IKHA 3DECA 3IUIA 2PF0A 2PCEA 3UZWA 2EF9A 4A3QA 2R14A 4O15A 1CECA 3WLKX 3BJTA 3ARVA 2O55A 3VX1A 5K4XA 3VNKA 3GXPA 2FZNA 3ARSA 3HPSA 3NEVA 4H8VA 1X6UA 1RXOB 4JTQA 2FZ9A 1JGIA 4B15A 3BAKA 2X05A 4MNKA 2ISDA 1QO5A 2PD5A 1FHUA 1MI3A 4DAFA 4X3ZA 1CXIA 3WD3A 3UWYA 3EEZA 4EACA 3W7NA 1NF7A 4ICCX 2WHJA 3LI1A 4LAMA 1W91A 2WWDA 1KXHA 3GG0A 3RCMA 4L1WA 2DZXA 3O7UA 2VGFA 3LNPA 1UUOA 5A8QA 2E9MA 1HKMA 3BV4A 1LLZA 3FOKA 2R8WA 4A2RA 2ZVRA 2OEJA 3N2XA 4CCCA 3EB3A 3EA2A 2XSBA 3KOYA 3N6HA 2DSWA 1JPKA 2YYUA 2WC4A 1A80A 2HMCA 1CIUA 3BZJA 1WKEA 2CC0A 3RPTA 4NJIA 1QO2A 4C7GA 4HNNA 2Y5EA 4IP4A 2NQ9A 3W76A 1OQFA 4LWWA 3I7RA 1K9FA 5CC5A 4LEQA 4QNEA 3TCEA 1H1NA 4J1OA 1C90A 3NZGA 1RVGA 4GGBA 1PKMA 2FYMA 3UGVA 1F2JA 1OY0A 1PWLA 1WDDA 4GNKB 2Q09A 1G4PA 1G9HA 2EJAA 3M46A 2BTMA 2XVPA 3ATZA 1DXFA 1UPPA 1MVYA 1U1JA 3ARTA 3CTLA 1UHVA 2W9MA 4HGXA 4Q4SA 3VPLA 3LHZA 2EQDA 4IJRA 3SY8A 2G37A 1ZCCA 5D2WA 4AQLA 3S5SA 3TOYA 4NAFA 3MMUA 4IIHA 5BRPA 4FX8A 4LSBA 1WE5A 1J12A 2VD9A 5HJXA 1VFMA 1DWIM 4G2DA 1EH9A 2FDMA 1NDWA 3IWPA 1M7OA 1NY1A 2GGIA 1T8XA 3AS2A 4M51A 3BAYA 1P0KA 3GM8A 1JUKA 3MKCA 4ZOEA 4F0KA 1I2NA 2V5BA 4DY1A 4H4IA 3ARRA 3INPA 1F9CA 1JPIA 4OHQA 1KM2A 3R4IA 1A5UA 2VL4A 3GR4A 3FVMA 4Q3MA 1QW9A 2AGKA 3WK2A 3M0MA 3USZA 4Y9OA 4GRSA 3PZTA 3FEMA 5KZ6A 1FH7A 1XBZA 5LIWX 4ZO7A 4WF7A 3P93A 3FDKA 4AZHA 2HISA 2R24A 4BEQA 3VZXA 2VRQA 4TX8A 4E38A 1UOZA 3BGAA 1GK8A 4X22A 1TCDA 2J4GA 1JXKA 3HPAA 3C5QA 4KCTA 1T0OA 1KCKA 3WH8A 3EA1A 5BWFA 3L67A 1CWYA 3FYPA 3SRDA 3B06A 3BG3A 1IT0A 3PUDA 1LBFA 4H9XA 5A95A 3QV9A 5G4HC 3DYOA 3F4CA 1F6PA 1XLKA 3V36A 3V75A 3BGGA 4S3DA 2RJGA 1UZHA 2WQDA 4PODA 4JQAA 3H70A 3M0HA 3KBMA 4DLFA 1KQZA 3ZR6A 3OA3A 1BPLB 5EY5A 1TVPA 3XINA 2G97A 4D6IA 1XG3A 3AIBA 4KEMA 3ARUA 3KP0A 2BMBA 3LTSA 1TVNA 1X1OA 3VYLA 4GI8A 2XM1A 2VDGA 3TQPA 3VTRA 1WB0A 4FF7A 3I3DA 4NF7A 2YBUA 2Z0IA 3RCNA 5HWJA 4U2YA 4WRHA 2R1LA 4U2ZA 2FMNA 5CGMA 3K30A 3UG8A 2Y5SA 4R27A 3IIPA 4JTHA 5FJUA 4HHPA 4AIBA 3SCUA 1BYBA 3G6MA 1KFWA 3GIQA 1C9DA 1EJXC 5FEWA 1PKLA 1ZQ5A 4UIOA 3RNDA 1J18A 3KOWA 4KWVA 3WH7A 4E3VA 2P8BA 5A6MA 1XIBA 3GE7A 1W1TA 4H6QA 1H5VA 3TJLA 4IHCA 1VFFA 3JRKA 2RDUA 1XKJA 2PLJA 3R43A 1JI1A 2QJJA 3R25A 1RK5A 1OF6A 1EUNA 1P7TA 3QV6A 5DCBA 3OYXA 1ZBVA 4W5UA 3GTHA 4MUPA 4I7WA 2V5CA 2RDTA 1MQPA 4HMEA 1WKYA 2FB3A 2ISWA 3L23A 4AW7A 3DENA 3S1XA 4ZFMA 1JCYA 1KLYA 2Y62A 1JDDA 4DJDC 2DDXA 1QDSA 2QEZA 2PTXA 2YL6A 3G3MA 2G5WA 3GY1A 4Z2JA 3O6AA 2I5GA 5DT5A 4CNOA 4US5A 1FWHC 1AMKA 1DJHA 2WOQA 4JFTA 4AWUA 1PE1A 1TQJA 1MO0A 1E0XA 3ZVHA 4GISA 1E51A 1EQCA 1CGVA 2Y89A 1EO5A 1NM9A 3BQ5A 4RCXA 1F76A 4Y2WA 1XRSA 3WQGA 1X6NA 1YPIA 1DP0A 3N1AA 3TLLA 1D7FA 3DYMA 2Y85A 1GVOA 3G77A 2CWXA 3T0AA 2PP0A 3PS7A 4W88A 1W9PA 4XIMA 3A9BA 2Y70A 2ZRVA 3DBPA 1TUXA 4MNMA 2DT3A 2A85A 3VKAA 4EWJA 1GOWA 3ZR4A 3DXIA 1OYAA 4J27A 1TV4A 3EMZA 2W61A 1WDWA 3OVQA 1VCFA 3NEHA 4AYSA 2I5IA 1PUDA 1FWBC 2XH4A 3CUXA 4EPKA 4F0SA 2A3HA 4Y9MA 2ZTJA 2OO6A 4FEZA 1MNSA 2QVHA 1XD1A 3P14A 3ITOA 1M04A 2H3BA 3B0VC 3WF0A 3IRSA 3KCOA 1EKOA 1VHCA 2HCVA 3GS6A 3GK0A 4LUYA 4WR3A 3IGSA 5EPDA 3UJ2A 3VA8A 1B31A 4B9ZA 1GKRA 1TWSA 3QLDA 2HK0A 4P8XA 2R1MA 4B92A 4DF1A 4J9JA 1GYMA 4QR6A 3A13A 4BI5A 2Y6ZA 2BZNA 1W17A 3HIJA 3LERA 4IGNA 1SO5A 3H2FA 2ICSA 5A6LA 4PL1A 3BMVA 1KCXA 3N17A 3LZ3A 3FEQA 3PB0A 1YNQA 4LBUA 4GUFA 5HAOA 1P7TB 3EOEA 3DESA 3M5VA 3W23A 1TO3A 1SZRA 3IIVA 4LJ3A 1TKKA 2O9RA 2BHZA 4QSHA 2J6XA 2QT3A 1KRMA 1H7RA 3BG5A 1T96A 5BRBA 3HJZA 2NXIA 1JZ5A 4E8CA 5REQA 3FSTA 4CD6A 2Y7EA 3MJYA 4L1XA 1D7KA 3HFYA 2HVNA 1R86A 3T2OA 1DXEA 4DPPA 2DSZA 2YDQA 1DVJA 4ZSTA 2VEGA 3GXFA 3HJEA 1E1CB 4N2YA 1TTQA 1WDQA 3GHUA 1EJWC 4HU8A 4JXCA 3QY8A 2V2DA 2VRJA 1SJBA 4YN5A 1ISXA 3UCQA 3VZYA 2OWXA 4KBXA 1P1MA 4H9TA 3THQA 4DBWA 4H8HA 1YDNA 2CFFA 2QAPA 1XUUA 5LGZA 1GZGA 3THAA 1PYFA 2Q02A 2XIIA 1G69A 4RV8A 1ZUAX 1V8EA 2C1GA 1XF0A 1VHNA 3W6MA 1B0IA 2Z26A 4ALDA 5H91A 1RV8A 3B0YA 3W2MA 1CT5A 3PTKA 1FWSA 5FF3A 3PPHA 2HDJA 3LMYA 4Q8TA 1A5CA 3SCNA 1CI1A 3T81A 1WDRA 1NQ6A 1KV5A 3S9IA 4QEHA 4PUUA 2WCSA 1D8CA 1HG3A 3EDKA 1E6QM 4LAUA 1A0DA 3S2JA 1VFTA 4M19A 4DO5A 3PF3A 1EZ2A 3W7DA 2NQ5A 2WZMA 1W1VA 4N6EA 4D6FA 4KKXA 1W31A 1KWKA 4GJJA 4L4PA 3KFTA 1HL9A 5FA5A 3TNBA 1H1YA 3WFZA 3GC4A 1FDYA 2ZZ7A 1IZCA 4FPSA 5C5YA 1QNQA 3QZ6A 4P8WA 2VX7A 3QFEA 2E68A 4U31A 4X60A 3CEUA 1UQYA 2HROA 2ABAA 3NJ3A 1RJRA 1GW1A 2ZRZA 3MTWA 1TMHA 2DORA 4HSOA 4FO4A 3MSRA 2GQ9A 4HHLA 1E3ZA 1WUEA 3TJIA 2YA2A 4PMUA 3GFXA 3UWZA 5BXSA 2VR4A 4NNAA 3VVGA 2VR5A 3KZPA 1RSCA 4DBEA 1L6GA 1ZTVA 1DJYA 4JTFA 1V6YA 3S47A 4ML4A 1W3KA 4CCEA 5HMFA 4F9DA 4LRTA 2Y8UA 2POTA 3TMQA 4ZSUA 2WMIB 3TAKA 5K2ZA 2XIMA 3CMFA 3GW3A 4IWWA 5A6SA 2AAAA 4AF0A 4Q7BA 3TA9A 3C2RA 2ZXAA 2A3BA 2P88A 4MFDA 4IMFA 4ZA0A 4DJDA 8A3HA 3AHTA 2I7GA 3WUEA 4WGXA 1WNOA 1EPXA 4J4KA 1JZ7A 5BZAA 3NQ7A 2IKGA 4L1GA 4RNFA 4F79A 3RAOA 2XIJA 3DFSA 2TRSA 2VFFA 1TYGA 1F3WA 5IOBA 4QBXA 3POHA 4DRSA 4ML9A 2AKMA 4AHPA 1R30A 2ADAA 2DGAA 1GG0A 2J7CA 3I4KA 1JYVA 4AFYA 2OQHA 3M0ZA 4P7NA 4HZ6A 1XGDA 3L2LA 4C5ZA 3KL5A 3UJRA 4UZSA 1IR1A 4GCAA 4TTGA 2P0IA 3A64A 2KX9A 2YL8A 1QVBA 1KV8A 3CPRA 2QNEA 2D69A 5BXRA 3PZQA 3UETA 2HPMA 3N3MA 4PTNA 2Z28A 2D22A 3VDBA 3KVLA 4QFUA 1KXQA 3O6CA 3SCVA 3ICJA 1Z69A 4IPLA 3Q4DA 3N9RA 3ONCA 2JGQA 4TR9A 2I57A 2HVMA 5DMMA 3WEOA 5HWNA 1W5NA 1ME7A 3OODA 1RUSA 3BJSA 4Y9NA 3ISIX 3MWAA 2ZX8A 4FXJA 1GNXA 4BI6A 3LHUA 4GA8A 3B8TA 3KEHA 3HF3A 3B8DA 4DUVA 1SM9A 2DIJA 3KBJA 2C3ZA 4M6VA 2NQLA 5C2GA 2OSXA 4GQRA 3WH5A 4GI4A 3R10A 1T7LA 3OHMB 1JVNA 4HPNA 2B7OA 3VIOA 3H53A 4ADUA 3AIWA 3BW2A 1XKYA 1XCXA 4LC6A 4FX7A 3CQKA 3VILA 4Z1AA 2FPTA 4I8DA 2J7GA 3FDGA 3CUJA 5FACA 2VZSA 4L9XA 1MW0A 3NQMA 1VRXA 3W7PA 3SCRA 1QPKA 1YDYA 3WNPA 2RKXA 4M3PA 3S6DA 3MS8A 1ESWA 4R85A 3VD7A 4XKMA 1W1ZA 3LU2A 2CXGA 1TPB1 4K8EA 4WZHA 3C61A 6TAAA 4EWND 1FTXA 3M44A 4FNQA 4UB9A 5CSSA 3FIGA 4UMCA 3IV8A 1YADA 3L65A 1I75A 4JICA 1T8QA 2VWTA 1TWIA 1V6UA 4UQEA 2VRKA 1NIUA 4HD5A 5FESA 3DGRA 4HZMA 1VEOA 1V77A 2WPBA 4QSFA 1GTHA 3EWUA 3AUJA 1LLWA 4BQ4A 4PRTA 4B16A 1ZGDA 4R9OA 1R2TA 2CLMA 4GIYA 3CPGA 3COTA 2NVAA 3CAVA 5J8LA 1QXLA 3L4YA 5I02A 2V8ZA 4DVOA 3MV11 3LPOA 3RUBL 1ZJAA 1UOKA 2BOFX 4FXSA 3IEBA 4JHZA 2R1PA 3S6TA 2ACSA 4B3KA 4QQ3A 2VVSA 1X7FA 2HE8A 2Y0FA 1F8MA 4FIQA 5T91A 1A5BA 3K5XA 3VKCA 2D2GA 1VYSX 1GONA 4MAZA 3VKKA 3T44A 4XD3A 1B57A 3DHUA 4GOAA 4N9CA 4GQBA 5CZTA 3GZ3A 4PSPA 2YCKX 4M1BA 3H7UA 3UWQA 3TWBA 3EMCA 2WVVB 4Y96A 1H0IA 3TYBA 4XSLA 2VFEA 1S2VA 3BUVA 3TNOA 4HIBA 3QPZA 2EPNA 1G0CA 3D47A 4XWUA 3K2GA 3CZLA 3L4TA 4M56A 2QDDA 3IJQA 5LKYA 3H4XA 1E1CA 3B9OA 1MRAA 1BKHA 3SIZA 5K9XA 1F73A 3EB2A 1KB3A 1TV3A 1PPIA 4S23A 3EDEA 4MZ1A 4TX9A 2QJHA 4UFKA 1MZHA 1SJCA 3WQ4A 3GC2A 1OG6A 2E67A 1E72M 4D6GA 4KWUA 4KFPA 2J9YA 4AZCA 1RJPA 1LTDA 2WLYA 1R46A 3PSVA 4GBUA 3FJ4A 4UTJA 1K77A 3NXFA 1XIJA 5T26A 3SFKA 2OU4A 4FAMA 4C1NA 1NF0A 4OT7A 1ZBCA 5JIWA 1VIZA 4IH3A 1Q5MA 3NO3A 3OVGA 5KINA 2GL5A 3NURA 1XWYA 1F6YA 3S5ZA 2WB5A 2ZDSA 3BQ6A 3TTOA 3S2NA 3MBFA 4O1CA 3KDNA 3KRZA 3K46A 3ALGA 4JQ2A 5EGRA 4ICNA 4OQVA 1T6MA 4JN6A 2WHLA 1L9WA 3M1ZA 3EEGA 3QV7A 1K02A 4PGLA 1CTNA 3RO8A 4H1ZA 1KKRA 3NPWA 4WY0B 2J7BA 1AW2A 2PTWA 2DZPA 3T42A 3T0CA 3SADA 1TJPA 1TIWA 4GXWA 4NX0A 1KBKA 3W38A 5E9AA 4QXIA 4A3HA 2PBGA 2GOUA 3LD5A 4E2OA 1W3LA 2A3AA 1UZ4A 3I6RA 4ZQCA 5HANA 3NGFA 1A5MC 1LT7A 3RIKA 3RLGA 1YBQB 2VFIA 1QRQA 4LS1A 1KFCA 1EC9A 4LAOA 5BMXA 3KWXA 3KBWA 4P8UA 3TUUA 3T2PA 2VENA 4RX0A 4AZ7A 1TJ2A 2OT1A 2EO7A 4GX8A 2ISSA 4UTLA 4U4MA 4XIAA 1P1XA 3MCOA 2W91A 4GABA 2OGJA 3D5HA 3MW7A 3KLLA 2XH2A 3Q58A 1AW5A 1OIMA 2GWNA 2W66A 1AQ0A 3R0DA 1DJXA 3AIUA 4ROQA 3ARQA 4XB3A 3YPIA 1QCWA 3KOFA 1RCQA 1IGSA 3PWIA 3E2VA 1J0HA 1QNVA 4UFIA 4JTKA 5GNYA 3UY8A 4QEEA 3TVAA 1BWKA 3PZOA 5C71A 3M4HA 3LLXA 5TF0A 4Z1BA 3PBUA 1QI3A 1NWRA 3UWWA 3DFTA 1UD2A 3UR5A 1VFUA 1QOPA 1NOUA 1EGZA 1IXPA 1LG1A 3A4JA 1DQXA 1QPOA 3C3NA 1S5TA 5F1VA 4O10A 3VGGA 1TV8A 2A7RA 3WDJA 5JH1A 1K9DA 1V02A 2PDQA 3S1UA 4R3UA 1C8VA 1YE6A 1PAMA 3O06A 4HA0A 4QAWA 3OGVA 3U4AA 3M5XA 8TIMA 3PG9A 4Q8NA 4DAIA 2QMKA 2NV9A 4BWLA 2QVNA 3BAJA 2IQDA 4ATLA 3SO7A 3V18A 3ZM8A 2WCGA 1JCLA 3D3FA 3AWNA 3TONA 3DHPA 1F61A 4CLMA 2VEIA 1SZNA 1VQTA 1R38A 4QLLA 4O28A 1A5SA 1OF8A 1J11A 1HJWA 5F4SA 5CC7A 1JPHA 5CCZA 4B4FA 1UA3A 3WMCA 2ZXBA 3WLRA 3THUA 3A47A 1XLCA 2V38A 4A05A 3QR0A 3O0KA 7REQA 1W1YA 5HNRA 3U48A 4EIVA 4CQ8A 1WZLA 2TODA 2WKJA 2CHRA 1MQRA 1V5XA 5LHFA 1SUXA 4WSHA 4TUFA 3GNOA 5IFPA 4HTBA 5CBIA 5CZJA 4HP5A 4JFWA 1R3YA 2ZRYA 3RYSA 3LXAA 4KF1A 2V3FA 3T08A 2A7PA 3LY0A 3M16A 3KBVA 2YCEA 3UWUA 2XINA 3E0VA 3VFCA 1MUCA 4GXMA 1MWOA 4H9ZA 5LNUA 4UTMA 2X09A 1D9EA 4F0HA 1CNVA 3EPNA 3SM0A 2G41A 1AA1B 3NCOA 5CEWA 3GDBA 4C1LA 2Z1XA 4LRSA 1K4GA 4DUXA 4N42A 1FWIC 4HZ7A 3W87A 1GOOA 3D6NA 4RUBA 3VIKA 2V63A 1YTDA 3EX3A 3A21A 3SCQA 3OVPA 4JIRA 1XPYA 5IRPA 2FKPA 2VXNA 1P0DA 1J9YA 2R1NA 3I65A 1OWQA 3L7RA 4DJFD 4RW3A 4DJFA 3W00A 4DZHA 2GZXA 3W7KA 4B4HA 5LIYX 4QAIA 3KBNA 3N04A 4C6LA 3CASA 2Z1SA 3D3AA 4YJ5A 4L5ZA 2OZTA 3BLLA 3OG2A 3SUVA 1XIGA 3LCFA 1U5VA 5E09A 2D2OA 3EWWA 3FHQA 3GR8A 4PCFA 4GG9A 4P5UA 3TSBA 3VUPA 5HPCA 3W1MA 4OGZA 3FNDA 4U3CA 3A3WA 4QJ1A 4IISA 3V4BA 4HOXA 2D3LA 1XLAA 4URIA 1GPWA 4ZENA 2FGZA 1IXQA 4PCPA 2WAGA 1ZSXA 4FNPA 2PC8A 3N2CA 3EXRA 3IGHX 5I3DA 5ABFA 3AIQA 1I9CB 3R0UA 4J2MA 4U28A 3B4UA 4A2SA 4GYPA 1Q2RA 3GYEA 2CZVA 4R88A 1S1PA 4DWSC 3NOEA 2EPKX 4JPGA 4CN4A 1VP5A 3O1NA 3PY2A 3W7QA 4N4PA 1Q4NX 1CXHA 3JZEA 2FVLA 4GJ1A 2VNCA 2GK1B 4BEUA 6CGTA 4XUGA 3DHFA 1XDJA 4RZ4A 4ADSA 2VEFA 3U9IA 4ILSA 3U2OA 4WD0A 3E2QA 3UESA 3WCZA 4JFSA 3SSJA 2G96A 2JK2A 1J0ZA 3SQSA 1ZAJA 2EXOA 2PDCA 2E40A 2E28A 4J2PA 2PI6A 4HK5A 2WHKA 3IAPA 1EGVA 2YJQA 1UKPA 5JBDA 1JD7A 5A6JA 1LQAA 1XYAA 2EHHA 1BG4A 3H6OA 1QW7A 3JU2A 4IFKA 3RU6A 4LANA 2PPGA 5D03A 3SRKA 4HNUA 3U3HA 4B2DD 3H7VA 3GH4A 5K9CA 1R47A 5A6AA 3G0UA 3A6OA 4W4QA 1HO4A 2OKOA 1LJYA 4N9DA 8XIMA 3V3WA 2PWVA 1TZ9A 1ZS2A 3UCCA 1YQ2A 3S5YA 3LXBA 3DN5A 3M5YA 3ARWA 1RD6A 4E3TA 5HQLA 3QPEA 4WCJA 3QMRA 3SBFA 1LWJA 3VNJA 4GIEA 4EP8C 3V0SA 2VZTA 3M0YA 2E6YA 1BYCA 2I16A 1VENA 5A8NA 1TRIA 5DF0A 4A35A 3NO1A 1NSJA 4GCXA 2VC6A 2RH9A 3OBKA 3TTYA 3DZ1A 4XD5A 2ON3A 3L4ZA 4CNPA 3NQGA 2XIBA 2DT2A 2XIQA 6A3HA 3GHSA 4IPIA 4LCSA 4XO6A 3WJXA 3WQ5A 2BLEA 2WWCA 3M41A 4S3KA 1FWGC 2YKKA 4JCMA 4AXNA 1BF6A 2V3EA 2ZUNA 3C86A 4ZZ9A 1BAGA 4D8AA 5F2IA 4REQA 2ZX9A 2VT0A 4G7EB 3LI0A 1FP8A 1G7VA 2PBOA 3XIMA 2CXEA 3AJXA 3UPMA 2ALDA 1PIGA 4E6MA 3KTXA 5AZ1A 4RNHA 1HUVA 2ALRA 2BSLA 3W7OA 3VM7A 4XKYA 3ITTA 1DWFM 1B3VA 1L6SA 4LBRA 3ABRA 3IUDA 2DQXA 3VKJA 1XLJA 2PD9A 4DUOA 3CZJA 1BKSA 4O1AA 4ACZB 1NQKA 2PDMA 4V33A 8RUCA 5E0FA 4HZ8A 1CGWA 4AY7A 1CGYA 4UOQA 5ENLA 4KIRA 2NQHA 1NOWA 4DN1A 1GVEA 2BWGA 5KITA 3VU2A 6XIAA 1UWQA 4Q8MA 4DF0A 4M1RA 3KL3A 2ABBA 3B8WA 4DWSD 1VBGA 5AOUA 1QHZA 1HJUA 3G1DA 1U5HA 4JX6A 4AB4A 1G6CA 4IQJA 2PB1A 5A6BD 4NILA 3QY6A 2NLIA 3ALFA 1JG9A 4C60A 4R33A 1RQBA 3MZ2A 1H09A 4A3UA 1XYZA 1RPKA 4PUJA 4WKHA 1KTCA 4AU0A 4LB4A 1TPWA 4Q7NA 1PHWA 4GUGA 1FWEC 2HPIA 3QHMA 4ERAA 4PFHA 4IMDA 5I00A 1QUMA 3LMZA 4MIMA 5EMMA 3PTMA 3PZVA 4WXZA 4HPGA 5B7YA 2A3LA 2J8GA 2B4GA 3IVUA 1OFRA 3C2OA 1FWDC 1XLBA 2VCAA 5A69A 4OBRA 1GVYA 4R53A 3TQVA 1UR0A 1EX1A 3GTXA 2E9LA 3OLIA 3IK2A 4JY8A 4L9YA 3GNXA 4JIQA 4WOQA 1H51A 3L4WA 4A22A 3QKEA 1Q66A 4BI7A 1UC4A 1ONRA 5CJ5A 4AF0B 4PA8A 3SJNA 5LA1A 1IIGA 2A6NA 3OBEA 1EBGA 4YTSA 2Q8ZA 4L56A 1XYLA 4KQNA 2ZFAA 3VGBA 5CLWA 3RILA 1OCJA 1Q13A 2CLPA 2QGYA 1EDGA 3BLKA 1EJRC 2W62A 1IQ8A 2OOFA 3W2KA 4WVXA 1CLKA 4BK9A 2UY3A 3VC5A 4FLRA 2CESA 1B54A 2FTPA 4JTLA 1N8FA 4HQVA 3EDFA 2XN0A 1YXYA 4KWOA 1LZOA 3ARPA 3RHGA 3DBNA 2EG6A 1HNYA 1OX6A 2VOTA 4I9MA 1F4AA 3WMSA 1PEZA 1SW3A 3VO0A 1OC7A 2Y61A 1KFJA 4GLEA 1ZNNA 2PTYA 3MUY1 4E5TA 1DHKA 1I2QA 3M7SA 3H2NA 1BSIA 1I2OA 3GNNA 4AUBA 2GWGA 4YVPA 1KR0A 2ZWZA 1L6YA 3VOGA 1YEYA 3SUUA 5H6HA 1GZ1A 1Q65A 5A6KA 4LY8A 5M03A 4LS0A 3GB6A 1RLDA 4N0RA 1OYCA 4E0CA 2R94A 3TSMA 5JH2A 4BF5A 3C6CA 4FOJA 3E2SA 3N3TA 1G4EA 3D46A 5PTDA 4LNCA 2E0PA 2E1WA 3RK8A 1ZBWA 2PFHA 4HNVA 1XW8A 1VPQA 4KPLA 3EB4A 3THCA 4GK8A 4GQQA 4H7VA 3KE0A 2H8XA 4O0QA 3E74A 3SW6A 3L21A 3LB0A 3NWRA 5E6ZA 4O53A 3N34A 4M6PA 2PGRA 3CGTA 1K8YA 3C4UA 3CO4A 1KW1A 4ZOCA 1EIBA 3NQCA 3GUGA 3W1AA 1VJIA 2BB0A 1ZZMA 3SEPA 1DWAM 3MPGA 1A4LA 3MP4A 4JYFA 1RH9A 2QJIA 2WM0A 4FIRA 3GKAA 3KVMA 3U4FA 4ZO8A 4AIEA 4UTWA 2Y7FA 3HO8A 5FL1A 2NVCA 1TPC1 3W25A 2OCZA 3U5UA 2E5DA 3EXTA 1Q6GA 2R91A 1W3TA 2INEA 4NI8A 4DUWA 4V28A 2O9TA 3FX4A 1LBMA 1ME9A 2VYOA 2DW7A 3TN6A 1UBPC 3WLPA 1P6CA 4AIUA 1OX4A 3TYZA 4JZ5A 1PX4A 4WY0A 2V6AA 2XYLA 2CLLA 1UKSA 2CLIA 1H11A 1C91A 1Z9AA 3W26A 1XSJA 1ZRQA 1J2WA 4FR1A 4QIUA 3MQTA 1JZ4A 4GY7A 4IP7A 1J0IA 1D8WA 1EP3A 3EMQA 1IEWA 2CLFA 3WLQA 4WDWA 8CGTA 4KRZA 3KXQA 2HEJA 4JKMA 4DWSB 1AD4A 1JUBA 2P0OA 2VC7A 4IMCA 5D04C 2WNQA 4ZL1A 5C6MA 1E1EA 4UUIA 3HTWA 1B90A 4LEFA 3OQ8A 4OFCA 1S3TC 1ICQA 4XSMA 4LY4A 3H8AA 3T7VA 1VEPA 5K4ZA 3OLGA 3TXVA 3CHFA 3CZEA 5D37A 4PRWA 3Q37A 2WBKA 3W83A 4QG6A 4FK9A 4IFKB 3LCWA 4NJKA 4NSBA 3S83A 4OE7A 3F5LA 1NARA 2ZX5A 4CNTA 3EWYA 1WXYA 4RZBA 5FAGA 1OK4A 1WZAA 4JD4A 4ACYA 4AZBA 3ABXA 3R11A 1JL8A 4ZXLA 3HN3A 5DXYA 3RX3A 4N9EA 3SZ8A 5LNWA 4OVXA 3G1HA 4J3SA 4PUKA 2QZRA 3B9EA 5D05A 2HNHA 3E5PA 5FSEC 1VJZA 3CQHA 1D3GA 5LHEA 2J27A 4PMRA 1W9BM 4UCGA 4RLIA 5JMUA 2I56A 1V08A 1Z41A 4JX5A 3AHYA 4PBFA 4JNMA 4DWDA 5BYWA 1JZ8A 5KSWA 3QGVA 1KCZA 1GVQA 2X16A 1UKQA 3N2OA 2VX5A 4Z2IA 4I9AA 1H7PA 2VI0A 3OHIA 3FLUA 1VF8A 5C55A 1O7AA 3LHYA 2VEMA 4JTUA 2F84A 1WBHA 1HXJA 2PAJA 1OZQA 1PHQA 3JW7A 2GPTA 1WUFA 1VLIA 4HHHA 1R8LA 2CKSA 2ZA2A 3T07A 3GDTA 3P67A 4CNNA 4JIHA 3VDHA 3ES8A 4GZJA 4ZB2A 3H2CA 3FAWA 1QWKA 4U10A 1OG0A 3ORWA 4MJMA 2XSXA 3H23A 5SWUA 1RBAA 3WMLA 2OWWA 3EPMA 2YIHA 4LOCA 2P76A 3SCOA 1DV7A 5DFAA 4LQ1A 4UR7A 2NV1A 3KOZA 3GAYA 5TQLA 3C52A 5CZKA 3KW3A 2J7FA 3ME3A 2A1YA 5FJJA 1I60A 5HJYA 4NZ4A 4HA4A 4ORMA 5HXMA 2XZ7A 1AMYA 3W82A 3QY7A 1E6ZA 3GH7A 2O0TA 3I6EA 5AVNA 1P43A 1YTKA 1EF3A 4AVNA 1VFSA 5CPMA 3LCHA 3PK7A 3B4YA 4UTFA 3P8JA 3AIEA 4GX9A 3CWNA 3GVQA 1S2WA 3GH5A 4AG0A 1K7FA 4QGCA 1KLZA 5IBXC 2J79A 4O4VA 3L9CA 2VR2A 2P5NA 4MDOA 1GOQA 1ISZA 1MUWA 2W27A 3T4CA 1F07A 2O4MA 4FF5A 2XPKA 1R2SA 4OKDA 3R6IA 2EAWA 3UXLA 2WC3A 4H8NA 1RJQA 2TYSA 4BR1A 1EJSC 1VD6A 1MXSA 3KX6A 4DQWA 3CUGA 3H22A 1QOQA 3Q45A 4M29A 3TQKA 3OZMA 4DX3A 1UD3A 3CUFA 1PIFA 1DPMA 3U6WA 2ZKMX 5LYRA 4CN6A 5MF5A 1E15A 4P7LA 3TMLA 2QR6A 3HV9A 3WF3A 5AHMA 3PJUA 5GQBA 3QHOA 1NWTA 1MW3A 2OMAA 2ZX7A 4IX0A 4LYKA 2PF8A 3T8LA 3WLJA 1PTAA 2HVOA 4KEVA 1IHIA 1GW9A 4UQAA 1JYWA 1A5AA 2PE4A 5EU9A 3N11A 1KBBA 2QIIA 1HJVA 2PRMA 5M2FX 4AC7C 1AZ2A 5BCAA 3PNZA 1R3QA 2WSYA 4AWTA 3I4EA 3PANA 3VNYA 3GO2A 4G1KA 5HWMA 1OEPA 4MADA 3W7JA 3SCPA 2IQ0A 3C8FA 4NZ3A 3RR4A 2NQZA 1DEDA 1F3EA 1GVSA 1ADSA 4JEJA 1W32A 1UUMA 4FLOA 4O1DA 3APYA 4M0XA 5AB3A 2CLHA 1S38A 2XN1A 4MWAD 3BLDA 4QDPA 4GH3A 1QK2A 2I9EA 3LCXA 4OV9A 2H9AA 2WMGA 3SUSA 4Q8QA 5I3GA 4E2DA 1F3TA 3LBOA 3BMXA 1V3KA 3VMNA 1V93A 2W3ZA 3PUEA 5K9DA 3U8GA 4DXVA 1XJBA 1EOKA 3AALA 4DXXA 1ITUA 4PCNA 1CGUA 1V7AA 5I7GA 1E9LA 3U2CA 1ADOA 1FCUA 1WAWA 5I3KA 1NWUA 2WQPA 3GU2A 3M5ZA 4LGXA 1BVNP 1H41A 4IPJA 3DEQA 3C0LA 3SUWA 3HQOA 4LVFA 3N14A 3SUTA 1XXXA 1MDLA 2ZVIA 3KWSA 1O1HA 2YDSA 5KMYA 5CC6A 3SQLA 1AH3A 3E38A 3NYDA 3POCA 1OD0A 2OXNA 4IIBA 4H00A 3W37A 4I7VA 1MDRA 1JPMA 2EG7A 3NTYA 3B8IA 3II1A 4Q6XA 1XG4A 4GACA 1B9ZA 2FQIA 2YXXA 2WXDM 1LWHA 4AEFA 3CBWA 3IARA 3TJ4A 3E12A 3VE7A 4B90A 3FSUA 1HKJA 1WPCA 3CLMA 1ICPA 2VZOA 1LDCA 3QTGA 3VDCA 4S39A 3CK5A 4CCDA 1VIWA 4W9TA 2ZZ5A 1XIDA 1BG9A 3QEZA 1OVDA 3W84A 3ZSTA 1LF1A 3GIPA 1GQLA 3P74A 2C1IA 1WXZA 4WGHA 4CQAA 1QNSA 3UXIA 1ALDA 1T99A 3TH6A 2VURA 1UWAA 3H55A 3VGDA 4D2JA 3FKKA 4Q33A 5FF7A 1H7WA 3C2YA 4OV4A 3SY5A 1X38A 3CC1A 1VGAA 3PFRA 4B5TA 5EMLA 4GI6A 2YW3A 3GTIA 3L0KA 3AXKA 3WX7A 4V1XA 1TPFA 1WOAA 5ABGA 2PEVA 4H04A 5CKSA 2CKRA 3T05A 3N4EA 4XBKA 3RX2A 4NJJA 3B04A 3WO8A 4ZMGA 2FTYA 3KS5A 2GSJA 1UR4A 4AEOA 3MUAA 4CD4A 4Z08A 3EWBX 4I9JA 9RUBA 5A6TC 5I24A 3NQ8A 1S1RA 4WKFA 1MXDA 1Q8AA 5GPRA 1BQCA 4KT2A 1XL9A 2YCLA 3PUOA 1AQMA 3QSRA 3DHDA 1RHCA 4CVWA 4BF9A 1N2VA 4MNLA 3KM8A 2PA6A 1HP4A 4H8UA 3QOMA 2VM8A 1HP5A 6PTDA 1BGAA 1DQUA 2BG5A 1J01A 4ZOBA 1RQHA 1S2AA 1YPXA 4GNJA 1KD0A 1BF2A 3GG7A 1FP9A 2UV8G 4WXYA 3TC3A 1U30A 3AISA 5EYWA 2GUUA 2WVUA 3M7WA 5FJTA 4JQ3A 1FCQA 1AW1A 4XZHA 4W5ZA 4X9SA 1XD0A 1RD5A 3NDOA 4GZEA 4HTYA 4DPQA 3A12A 1B5TA 4P7RA 5C9UA 1H7NA 2GJNA 1UMYA 4GQGA 2G3MA 2V68A 5F4WA 2BY2A 3WY1A 1IEXA 4G1NA 1MZRA 1JF5A 4IFOA 1AL7A 2GDQA 3FK4A 3GDMA 4XBSA 4K36A 4A21A 4LCRA 1AQHA 3WH9A 1HQTA 4FI4A 2E6DA 4PFMA 4EXBA 3ZVIA 1G4TA 1W5MA 4PMDA 4IQLA 3A4XA 2V2CA 3T8QA 1TWWA 1B3XA 1B2YA 4C7FA 3CB3A 3AMCA 1P6WA 4MY8A 4LVDA 4MKNA 2PODA 3KDOA 5JQ9A 4DI9A 5AY7A 4Y90A 4YIWA 4AHOA 3CQIA 3AS3A 3G2GA 4M6QA 4BWLC 1O68A 1QHPA 1K8CA 4WJEA 5DCDA 1AL8A 2GGGA 1SJDA 1UKTA 5H8UA 4J3UA 4F3HA 1W3NA 4YCOA 5G1MA 4NAEA 1XGZA 4H7CA 3AS1A 3NAVA 1RP9A 1H50A 3TX9A 4FXFA 1N55A 4Z1YA 5D02A 3W0KA 4GZ7A 1UR3M 1QMLA 3AU6A 3P2VA 1WA3A 1CLVA 4UTHA 2QIWA 1JZ3A 1OFBA 3R13A 3VCRA 5AYBA 3G1XA 3VNMA 2VCBA 1LL6A 1XGEA 5GNZA 4HYRA 3WSUA 2FDSA 1OT2A 3SN4A 4L6OA 5HR6A 3BTNA 5CJMA 4J3TA 1F5ZA 4KEUA 3TYDA 1EYWA 5CBJA 4L4OA 1JCMP 5LSMA 3AZTA 3PSWA 4GJIA 3BLIA 1UASA 3A3XA 2XFFA 2Z1KA 3CPUA 1XRTA 4M7SA 1BD0A 4GVHA 4LNYA 1XLIA 3TR9A 4S3BA 4PE8A 2WZIA 5EB8A 1SR0A 2REQB 1QNRA 4XO7A 4RK8A 3L4VA 3JS3A 7REQB 1TJ1A 3P81A 4LVAA 2G0WA 5D9MA 3BC9A 1GOMA 4PR4A 1EGMA 2RGLA 3LRMA 4F9JA 1PL9A 5EFFA 1OB0A 1H5YA 3QFWA 2QS8A 3DC0A 1GVRA 2OSYA 1EXPA 3G8RA 4RJEA 9XIMA 4DEFA 2X0SA 4PCTA 3L5MA 4C6CA 1A5LC 3R89A 3MUXA 3GKFA 4QM1A 2CU0A 3RR1A 1UG6A 4NU7A 1QOXA 3W85A 4PB4A 4XAPA 3E0LA 2XH0A 3NZ1A 1W2VA 3BLOA 4RE4A 1GQIA 1L8NA 4US5D 1CENA 1TTPA 1SO3A 3W6LA 1KO0A 1NFPA 4YYFA 3MYOA 2POZA 2XM2A 2QF7A 1H2JA 3WQCA 1RK6A 1OFEA 3ARZA 4M5PA 5T9CE 1DIDA 1UYQA 2DIKA 1AFSA 3RLHA 1V6VA 3AXMA 4MZYA 3BDKA 1ONXA 5GJPA 3RITA 4EXAA 1H60A 3MANA 3VOHA 1KGUA 3AXXA 4HBKA 4HA1A 1N8WA 2YOCA 1V0MA 4X0VA 3RM8A 2E8YA 3NPVA 2IUZA 2WVSA 4C1NB 3DFNA 4YNGA 2PZNA 4GFSA 1W0MA 4HMNA 4FNUA 1FWFC 1CDGA 3RJYA 2QCLA 1QR7A 2VHLA 3EOUA 4P2VA 3NQEA 3RRXA 2X1IA 1FWNA 1ZJHA 2WBGA 4YTRA 3SN1A 3DOPA 4NHVA 3R0KA 2KZHA 3SIMA 4JIIX 3FGCA 3KP1A 5BU6A 3G24A 2XISA 4HB7A 3UA3A 1O5XA 4DJDD 3HFTA 3TKFA 5G2HA 5DRIA 2XDFA 1KTNA 3F4NA 1DKWA 5FL0A 2WANA 1V51A 4J3XA 4ATWA 4DZIA 1OGSA 1K03A 4QE5A 4MFEA 5LIXX 4A6GA 2VDHA 2PDNA 3LBMA 2JIEA 1OADA 1UR2A 2I9UA 2DFAA 3AMGA 3FVDA 2OWCA 4BJHA 1IT7A 4IQDA 3UY7A 3QKZA 3A22A 5HA7A 2FTWA 2GVEA 3AMLA 1DXIA 3W1RA 2ZUSA 3SGUA 2EEXA 3ZLHA 4NG3A 3P61A 4E8DA 4O52A 4JTRA 1E6RA 4NJHA 4D8LA 4K1GA 1CX9A 3UR8A 4I5UA 2ZC1A 3D0CA 1VBUA 3L0NA 1M01A 4LTSA 1ME8A 3FHAA 2OELA 3DG6A 2VGBA 2CERA 3B0PA 2ZADA 1AJ0A 3GXIA 4DM2A 3B97A 2PDKA 3UWEA 1G94A 3TYUA 1OC5A 3O6DA 1J6OA 2ASHA 3GXTA 2VC5A 2C19A 1GKQA 2W79A 4L64A 1S2CA 1GPFA 2O92A 1HTIA 3O0FA 3P0XA 5C7HA 3TK7A 2GDUA 3SJ3A 3GFZA <