2PCQA

Crystal structure of putative dihydrodipicolinate synthase (ttha0737) from thermus thermophilus hb8
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
MILPPIPTPFDREGRLDEEAFRELAQALEPLVDGLLVYGSNGEGVHLTPEERARGLRALRPRKPFLVGLMEETLPQAEGALLEAKAAGAMALLATPPRYYHGSLGAGLLRYYEALAEKMPLFLYHVPQNTKVDLPLEAVEALAPHPNVLGIKDSSGDLSRIAFYQARLQEFRVYTGHAPTFLGALALGAEGGILAAANLAPRAYRALLDHFREGRLAEAQELQKKLFPLGDLLAKGGVPLLKQALRHLGLPAGYPRPPYPAESPLWERFLPVLEGLKEEGWVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dihydrodipicolinate synthase
publication title Crystal structure of putative dihydrodipicolinate synthase (TTHA0737) from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 101
structure length 283
sequence length 283
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2pcqA00
4JY8A 1SO6A 5CG7A 3TROA 3H53A 1F76A 5G2HA 1JCJA 2VENA 4LUIA 5CZ0A 3OVRA 3R12A 2F84A 1VCFA 3CC1A 5U7SA 4AVFA 2QCLA 3L5LA 2C1HA 4RJEA 3LB0A 4A21A 1AL7A 5D09A 3TX9A 1ME8A 3G1SA 3TSDA 3EB2A 3LCGA 4CCEA 3B8DA 4IMGA 1DKWA 1OFRA 4FNTA 4MFEA 1LDCA 5C55A 3U8GA 5I3IA 3FS2A 1K3UA 3BO9A 3L5MA 3VE9A 3EWWA 1B4KA 1FDYA 1TMHA 3HG4A 3C8FA 5E1QA 1O94A 3ANYA 1YXDA 2GOUA 1KM5A 4LC8A 3OG3A 4CQ9A 1KFBA 5BW6A 3UYCA 2UV8G 3C2EA 1GYLA 1GG0A 2YCEA 3GR7A 1YADA 3JRKA 3NL6A 2QCMA 4AWTA 3S1WA 4LRSA 4O1CA 4UTJA 3BARA 3NGJA 1OK4A 2GPTA 2XN1A 4N9CA 4JX4A 2Z0IA 2GQ9A 1R30A 2CLLA 3JS3A 4KFOA 1VR6A 4RK8A 3G1YA 3A23A 4LWWA 1W5QA 1GTHA 1TQJA 2FQIA 1TPB1 1FCUA 1KM3A 2O7QA 3LV6A 4ZZ9A 2QCEA 3MWAA 4N9BA 1VCGA 1SO4A 2A4AA 3O07A 2ZZ4A 2A7PA 1SU5A 1ZCOA 3WK1A 4XUGA 4EF8A 2ATMA 3A22A 1F7BA 1XL9A 3QSRA 4ALDA 3NM3A 3O6YX 4BK9A 4PH6A 3EX1A 1FWWA 3HPZA 2GVLA 4O11A 1KFKA 2XN2A 1TCDA 4CQAA 1TO3A 4H3DA 3THAA 1Q3NA 1VHNA 4CCCA 3W23A 4XKYA 5HUPA 3W6YA 5K9XA 1YTEA 2BXVA 4GBUA 1GZGA 2CW6A 3HGSA 3USBA 1XBZA 3TNOA 1PHWA 1TRIA 4OV4A 3NQFA 4IMDA 4HN4A 5AHNA 3B03A 5U4NA 4MY8A 2YDAA 4IX0A 3LHZA 4TO8A 3WJZA 3LERA 3MMTA 3R2GA 4Z0SA 4MYXA 2QCGA 5KSWA 4A2RA 2G97A 5E0KA 3IIZA 4GNJA 5D2WA 1PCKA 2DJXA 3LCXA 4O18A 4NQ1A 5TBOA 4GRSA 4AH7A 3W7JA 3MW7A 1HUVA 2PC4A 1OYBA 2YFOA 3S8HA 4ZQNA 2WNNA 1DORA 3ABRA 1J5TA 4NVTA 2ISSA 3P82A 4Q32A 3B0UX 1FWNA 4IOTA 1J2WA 4X2RA 5FF2A 4OWGA 1A50A 4AAJA 1Z48A 4BI5A 5DCDA 3W9ZA 3GYEA 4KFNA 5HUOA 5K4XA 1DQWA 4LW7A 3MYPA 4H6KA 5FESA 4M6QA 1IXQA 3NQ6A 3W2NA 5K3VA 4WY0F 3I7RA 3KVKA 1C8VA 3LHWA 3HF3A 2QKFA 5GVJA 1DJQA 1KLYA 3GDTA 3B0PA 3DKLA 1XDLA 4LV4A 2AAMA 4UTWA 1GVQA 3LXCA 2Q3RA 1KV8A 1IXNA 1OFEA 1H60A 1T8XA 4J9JA 2Y63A 2RDTA 1U5JA 4JN6A 4PL1A 3LCIA 3C52A 3TUUA 3DFPA 3L21A 1QPRA 1VQTA 2A85A 2FB3A 2WNQA 5AOUA 5HMSA 4ML9A 4Z0JA 3W1MA 5AYZA 3GAYA 4JX6A 1ML1A 3PB2A 1YDNA 2FTPA 3R5EA 5AC7A 5I3GA 3BW3A 3LTSA 1VC4A 3PBYA 4RV8A 1K8YA 2QAFA 1TPFA 2GVGA 4QISA 4GJ1A 3NPVA 3VI2A 3W74A 2JKPA 5IBXC 2VXNA 4CQ8A 5CPNA 4LS1A 4MZ1A 3NDOA 4LOCA 3P80A 4FX7A 1OFPA 3PSWA 4TR9A 1KM4A 3BGJA 3W22A 3HOJA 2NX9A 1NFBA 1PV8A 3P60A 2HS8A 3ABOA 2YX0A 4QJ1A 3W3OA 4ZL1A 3EWYA 4HHPA 1A5SA 3WJYA 2ZRUA 4QNEA 1GTEA 3M5VA 4JR5A 2ZDRA 3OHIA 1H63A 3S1XA 5EA9A 2TPSA 5LZLA 4WQ6A 4PL2A 1VPXA 4NUWA 1WDWA 1HG3A 1O5KA 3EWBX 3DZ1A 2DZUA 2XN0A 3NZRA 2QCHA 3L2IA 1R47A 3O15A 3L65A 1JVNA 4AHOA 2WSQA 4BWLC 3B0VC 3FOKA 3KVMA 1JULA 2Z6IA 2C15A 2DZWA 2P0OA 3OEXA 4A29A 3CTLA 3O06A 1OJXA 2OX1A 3M0ZA 3ABSA 2ZTKA 2ZZ5A 3EKLA 5FEZA 4K37A 1W37A 5DXYA 4ZQMA 2WQPA 2B4GA 2RDWA 2FDSA 3C6CA 1XUZA 2Q3OA 5KITA 4BFAA 3LBCA 1B3OA 3VFLA 3L9CA 5DCBA 4XTDA 4S2BA 2AGKA 1F73A 3S5ZA 2R94A 4ICNA 1EIXA 3O16A 4K8EA 2Z6JA 5FEPA 1HL2A 4Y96A 5BMWA 3S5OA 2WSRA 3RK8A 3E0IA 1FQ0A 2X1SA 3U2OA 1W5NA 2DP3A 4HNVA 1W5MA 2CLMA 1CI1A 2FPTA 3N9RA 2DZVA 3AJXA 3W2UA 4JTEA 2ZZ2A 2HS6A 2A0NA 1O5XA 1TPC1 4MJZA 1RR2A 5LNRA 1X6UA 1LRQA 1H7RA 3MHGA 2DZSA 3WFAA 4NJHA 3N34A 5TQLA 3JR2A 2Y61A 3NEVA 3GAKA 3QW3A 2HSAA 4NJJA 1LOSA 4UTHA 4XTIA 3PVFA 1W3IA 1JCMP 4UTLA 2H8XA 3MI6A 3P62A 4AHQA 5LNWA 4YXGA 4FX8A 3W7OA 2A2IA 3BG3A 2V2DA 2VEIA 3TA6A 5CGQA 1KTCA 4DBEA 4FO4A 2VEMA 1QR7A 4PA8A 1SO5A 3L66A 3W7LA 3QC3A 4TIMA 3W2JA 1JQVA 1DV7A 2CZFA 2PE4A 1JCYA 1RZMA 3E96A 4MVAA 4AMAA 2BWGA 3IIVA 1F05A 1VYSX 2I14A 3NQAA 4O4VA 1DQXA 3G0XA 2QDHA 5BOOA 2GUUA 4IJBA 1RVGA 2YXGA 3W71A 2ZRYA 3LI1A 3LXAA 1RPXA 3WK3A 2ZA2A 3EXRA 3CQ0A 3HGJA 3UWWA 1FCBA 1P4CA 3HQ1A 4MPQA 3W1NA 3PG8A 1UB3A 4WXZA 3G1DA 4N4QA 3ZWSA 3C0JA 4W9TA 1H7XA 3CIWA 5D04C 2BX7A 1I2RA 4CNNA 1FDZA 5FF7A 1WXJA 4DO4A 4U4MA 1K7XA 4O1DA 4WY0A 2Q8LA 3L0GA 2NUWA 1SFLA 1JRCA 3EWXA 1R2SA 4HIBA 3DFOA 3TW6A 3C4UA 4YMZA 5K9CA 3HJZA 5D33A 3W1XA 2R14A 5HJLA 1MO0A 2ZYFA 1LTDA 4QIUA 4FNQA 4RXFA 1GPWA 3UXDA 1ZAJA 3NQ7A 4O1BA 3W7QA 3G0UA 3MO7A 2B7QA 4JTLA 3KRSA 2E6FA 3NPUA 3GKFA 1LBMA 5FEWA 2TSYA 2Y88A 5J5DA 4HNTA 3QZEA 3LX9A 2O7SA 3LM7A 1XXXA 1BKSA 4FIQA 3TQKA 2E6DA 4JYDA 2D73A 2LLEA 3G0SA 3TKFA 1LBFA 2RHGA 2YYUA 3UNDA 1KFJA 2XFWA 4I9AA 1H7PA 2ZQ0A 3BLFA 1EPXA 1VRDA 5AHIA 3R89A 1JCNA 1XUUA 2BZNA 2FFCA 3L67A 3FIGA 3G8RA 2V0TA 1E51A 2WO5A 3CEPA 3PF3A 2NX3A 3LV5A 3O8AA 4XKYB 5T26A 2CZDA 1D9EA 2E6YA 3CT7A 2WKJA 3O63A 3VCRA 1YXCA 5TIMA 5AN7A 2GJNA 2PCQA 5HINA 3OA3A 1B9BA 4ZQRA 1VGAA 3Q37A 1D3HA 1T96A 1EUNA 3KX6A 1QO2A 3K30A 3PB0A 2C14A 1GYNA 4XQ6A 2QJGA 2V9DA 4JXCA 4JDYA 5LKYA 1XBYA 3MHUA 4PEKA 2V5BA 4IXHA 4OT7A 2DORA 3BGGA 1X1OA 4DF1A 2NV2A 2FLIA 3FFSA 1RV8A 4E38A 4WJEA 1FWRA 3PM6A 3WJSA 2V82A 5KINA 3SECA 1FX6A 4OQVA 3LCHA 1LROA 1NAL1 4LS0A 3PULA 1GQNA 3MHFA 1KBIA 1Y0EA 5CSSA 1DJNA 1PCWA 1V5XA 5DCEA 1H7WA 3LBMA 3QF0A 2I9EA 2J9YA 4RZ6A 5F4XA 2CZEA 2TMDA 2ZZ1A 2FPYA 1DBTA 1TYGA 2ZA3A 5EPDA 4CNOA 4LTSA 4KWWA 1B4EA 3C2FA 3G18A 3CEUA 2C3ZA 3U6WA 3LCWA 3N19B 4QM1A 4L4LA 5F2IA 3NQ2A 1WQ5A 4DXVA 2DZPA 3G1AA 1KA9F 3M41A 2PRLA 5AC6A 1ME9A 5AHLA 1X1ZA 4Z08A 1EWEA 3PUOA 5AC8A 5A5WA 3TJXA 3I7SA 3SZ8A 2NWRA 3INPA 2I1OA 5FF3A 5KZDA 3M5XA 1M7OA 1L6YA 2QUTA 1W5PA 3FA5A 3OVQA 1DHPA 3LTPA 1W1ZA 5K9DA 4NZJA 4MLRA 5FI8A 2QCFA 1HFBA 3Q2DA 1QDSA 5D30A 2YYTA 2VEKA 4LC6A 2V2CA 1QAPA 4IUOA 1SW3A 1OF6A 3DU0A 3FYPA 3BVJA 3T7VA 3FEMA 1EWDA 2QUVA 2YGYA 1IXPA 5KZEA 1RQBA 1TPDA 3G1FA 4UTWC 3W7CA 3P8IA 3HPXA 4IPJA 3LHYA 3S9YA 4O12A 5CZTA 3C2RA 3VKJA 1LOQA 2VFEA 4UCGA 2PRHA 3WK2A 2Y62A 3W73A 4Z1BA 3IGSA 4ZQCA 5G1YA 1AW5A 5KZMA 1TREA 4HNNA 5DN1A 1YPIA 4Y90A 2EPHA 1Z42A 4K7YA 3NYZA 4Z1CA 4JTSA 1K7FA 3IVUA 2G5WA 3TR2A 5CSRA 1SO3A 4AEOA 5I3JA 5DELA 5FEXA 3W7DA 5K4ZA 1ZHAA 1PIIA 2NXIA 5KMYA 4NT0A 5D05A 2EF9A 2RFGA 4DO5A 3NQEA 4K7VA 3NNTA 1Q6OA 3RLUA 2X1TA 3SI9A 5D37A 5D2TA 2AQWA 3WJXA 1YDVA 4L4MA 5C5YA 2WV8A 3DI0A 5D2YA 3UQNA 4JS3A 5D03A 3I7QA 2A6LA 1OFQA 2V2HA 1QCWA 1RQHA 3W7HA 1KM1A 1KM2A 1NF0A 3C2VA 3KVJA 1LYXA 1W5OA 5LNSA 1SSGA 2VFGA 3RLVA 4Y8FA 4UMAA 1L6SA 1FWTA 2BSLA 4LVDA 3F4WA 2YW3A 3FKKA 1VJIA 4M7TA 3DBPA 3N73A 4TU1A 4X22A 2GJLA 3H54A 5HNRA 2X16A 2WJZA 4UTIA 1UASA 1PS9A 5EMUA 1NSJA 3UXAA 3LXBA 1I45A 5EL1A 3PC0A 4HSNA 4DO6A 3M43A 4UTMA 1JUEA 2Q8ZA 4IWWA 1TPVA 4R34A 5DBTA 3W1AA 4JEQA 3STEA 3QPZA 4MLJA 5EYWA 2FIQA 3I6RA 4UFHA 3DAQA 4NZFA 2H8ZA 1DOSA 4KWVA 3CB8A 3HIJA 1ONRA 2QCDA 1Q6QA 2W6RA 1M5WA 1SW0A 1KV5A 3FJLA 4HT3A 1XI3A 1LLWA 3LRMA 5HWJA 5HWMA 5D32A 1M7PA 4KFPA 4FXRA 4AWSA 5D2VA 3ABQA 3W76A 3W7IA 2B7OA 5LHEA 2YR1A 3HG2A 4Q4KA 1EUAA 3NL2A 1G4PA 1XKYA 1F6PA 3LHUA 3M5ZA 1TPUA 1GVSA 1MZHA 3P7YA 2OZ0A 4FNRA 4O57A 1D3GA 3W7MA 4FNSA 2Z1BA 3QFEA 4LNYA 1WYIA 3S5YA 1X7FA 3M1ZA 1G4TA 4GUJA 4MZYA 2JBMA 4JD4A 4JTJA 3QSTA 4PODA 4XWUA 5J5RA 3QH2A 1LRTA 4FNPA 3W1QA 1ZENA 3G3DA 3V1PA 2P10A 3P5YA 4UTUA 3UWVA 1G7UA 4LT9A 2Y85A 4CLMA 3A9IA 1TB3A 1PE1A 3IV3A 4FNUA 3P84A 1VZWA 3QQ1A 2X1RA 4MY1A 1M6JA 4O16A 2DU2A 4ADTA 4E2DA 4WY0B 3UZJA 1QMLA 1NEYA 4NNBA 1SFJA 2QF7A 1H1YA 3G1VA 2QUUA 3FLUA 1MEIA 3W70A 1KFEA 3PBVA 4M5PA 7TIMA 1I2QA 3E12A 3PWAA 1SZGA 3M16A 3HMJG 3GB6A 3TSMA 5BRBA 5AHMA 1KTBA 1JQXA 1BWLA 3G22A 3CWNA 4AF0B 2ZTJA 4UFLA 5EY5A 4TMCA 1JJKA 3R8RA 1XDMA 4ADUA 2R8WA 2RH9A 1G4EA 1QOPA 2E68A 2ISVA 3P5ZA 3LHTA 4GC4A 3LTYA 4JTUA 5AYYA 3KOFA 3RNDA 1H5YA 3SIZA 1H51A 3W2KA 3D0CA 3BPWA 1KFCA 4MFDA 5AB3A 5LNUA 1VLIA 2QR6A 3A21A 1F6KA 3OIXA 1W3NA 1NVMA 3B04A 3DH7A 2VOMA 1QWGA 1ME7A 2Y6ZA 2EAWA 1GWJA 1SZFA 4N6EA 1QO5A 3TE9A 2VFIA 5CPLA 2ATSA 3W83A 3MBFA 2ZFAA 1PVNA 1PHQA 3YPIA 4K38A 3CHVA 3EX4A 1PL9A 3W7KA 4R53A 1XM3A 4UFJA 4D2JA 3GX9A 2JGYA 3CPRA 1FXPA 3W87A 3F4NA 2VFDA 4DQWA 2W79A 3FKRA 1SSDA 3IRDA 3LRKA 4JTTA 3QW4B 1L6WA 3MI3A 5LNVA 3ZR4A 1EX5A 5FF0A 1F74A 1TQXA 1IF2A 4NXSA 1A5BA 4A3UA 5H91A 1BWKA 1GT8A 2NUXA 3OVPA 4UR7A 3W85A 5BMXA 1YXYA 1W0MA 4N2YA 1OFOA 1FDJA 4ZQOA 4JIPA 4LVFA 4RCXA 1OHLA 3LI0A 1IIGA 2RKXA 3UWZA 3NQGA 5DY3A 1J4EA 2G96A 5LGZA 1TIMA 5G2IA 3GDKA 3GNNA 2JK2A 3I68A 3KFTA 2R91A 1VLWA 1JR1A 4AHPA 3NG3A 4HKPA 4IMFA 4N9DA 4EIVA 3MI2A 3S42A 1B57A 2BLEA 3MBDA 3EEGA 1G67A 2C16A 4UFIA 4A22A 3TAOA 1RQEA 3GXPA 5CZJA 3B05A 3THQA 4ONVA 1LM1A 3PG9A 4UNKA 5DBUA 5CPOA 2IQTA 1G6CA 1WBJA 4BI6A 3WK0A 3S1UA 4IX2A 1JCXA 1W54A 3GDRA 2NXHA 4M6VA 4DBDA 2CU0A 2CLOA 3VNDA 3EXTA 1ZJIA 4O53A 4IPIA 2H3BA 4GXMA 3LDVA 4RXGA 1Z41A 1H7OA 1F2JA 1QPNA 3NA8A 3E02A 4WZHA 3B4UA 1KBJA 3GDMA 3QEZA 6ALDA 4OE7A 2QCNA 4PFMA 2ALDA 3NQDA 4AF0A 2OJPA 3DHFA 4S2CA 2CFFA 5SWUA 1L2UA 2WSYA 1QNVA 4MUZA 4BI7A 5CZSA 2VKZG 1LZOA 1LLZA 3BW4A 4ORIA 3SY5A 1TJPA 3PAJA 3BG5A 1LRNA 4UNLA 1OG0A 1K7EA 4UUIA 4BF9A 1VHCA 3QQ0A 1HO4A 2FPVA 2C19A 3BLEA 3NPXA 4IGHA 3BG9A 4OV9A 3KRUA 4X3ZA 1SZEA 3PUEA 1AG1O 4K6AA 3M47A 4NX5A 1HO1A 1KLZA 1O4UA 3NQ8A 3W1LA 1WA3A 4JY9A 5IM51 2ZZ7A 5DLCA 1YTKA 3HBLA 3M44A 3TFXA 4QSHA 3MYOA 1Q45A 1KFLA 4YCPA 4C1LA 1OF8A 4FF7A 1LORA 1JUKA 3T78A 5C2XA 3TXZA 1OX4B 3TXVA 1TV8A 5F1UA 4O50A 3NZ1A 1H62A 2DJLA 4RKAA 3H55A 3R13A 3T4CA 4DPPA 4RLIA 2CWNA 3GIYA 3VE7A 3V75A 4GUGA 1TV7A 1SR9A 5LSMA 2Z2UA 1MEWA 3B06A 4S1FA 1OFDA 3MUXA 4YLWA 4C1KA 4NNAA 2NV1A 4O14A 3GXTA 1EA0A 4FIRA 3STCA 2A21A 2B7PA 1I4NA 2J24A 4QQ3A 5G4WA 3W7PA 3KXQA 4I7VA 1W31A 4RX0A 2OMAA 3C61A 3C56A 3TMQA 1MEHA 1I8JA 2A5HA 2RDUA 4MYAA 3GR8A 1KTNA 4JTKA 1AW2A 3G1HA 5HWNA 4NU7A 3T40A 4U28A 4DEFA 4O13A 1OX6A 3W1PA 4EWND 3LGEA 4UXDA 1CW2A 3PY2A 1VH7A 3HPSA 3LOTA 1U83A 2KZHA 3SFKA 2G95A 1EEPA 3S6DA 4LVGA 4AXKA 2WOQA 2PRMA 1OFAA 2QCCA 4M7SA 2QJIA 2QCDB 4Z1AA 1Q6LA 4JDBA 2C6QA 1ALDA 4UC5A 3NM1A 3CWOX 3RU6A 3QM3A 5D2XA 4B5NA 4HSOA 2WNZA 4MKNA 4YL2A 1HTIA 2FB2A 3TFCA 1UCWA 3ZS4A 3ZWTA 4MY9A 4OU1A 3NQVA 1WX0A 2VELA 4JIQA 3NPWA 2NX1A 2J6XA 3NOEA 1UBSA 4O54A 4GUFA 1R2RA 1QPOA 1I2NA 1THFD 1BEUA 1SW7A 4ADSA 5C54A 1FUYA 2ZZ6A 1ICPA 3A5VA 3UZ5A 2Y70A 2DZXA 2HTMA 1ZNNA 3PS7A 3P74A 3L68A 2YFNA 5EBUA 2X30A 3SW6A 1SPQA 1W8SA 4GWEA 3NL5A 1ZALA 3QMRA 1JUBA 3SJ3A 1SZNA 4O1AA 3TIMA 1R46A 1I2PA 2GQAA 2Y7GA 2NZLA 3O6DA 2ZA1A 2FJKA 1BTMA 4E0CA 3W72A 1MXSA 1YPFA 1VYPX 2TRSA 4NJIA 1VS1A 1ZAIA 1FY6A 4WOQA 3DGRA 1DVJA 3W7RA 4QAIA 1F5ZA 2GVJA 3ATYA 4Y6GA 3M6YA 1EB3A 2EKCA 1ZFJA 3GVGA 2QJHA 1SQ7A 3NO5A 3E49A 4ZQPA 1A53A 3NQMA 3NXFA 5HQEA 3N3MA 3RMJA 1GEQA 1OX4A 3DHDA 4N9EA 2B0MA 5AYXA 4ORMA 1LP6A 5F4SA 3UWUA 2C0AA 1TPH1 1MSSA 1K02A 3BLIA 3T44A 1S3HA 2YSWA 2W0UA 3Q94A 1DL3A 1FCVA 4GFSA 4JX5A 4EF9A 1QOQA 2ZCGA 3N2XA 4IMEA 2H3DA 3SGZA 3T55A 3DFSA 1TTIA 4IXXA 2ZBTA 1FBAA 4O52A 3G24A 1YTDA 2V30A 3IIOA 5CKSA 1ZAHA 1AL8A 4PCFA 2V81A 2C13A 2E1DA 3IIXA 2CLEA 1XC4A 3NQCA 2YPIA 1JCLA 1AK5A 2ABAA 3N14A 3IVSA 3C3NA 2A1YA 4JTFA 3HO8A 4MOZA 1TRDA 5L9FA 2J9ZA 5F4WA 1X8FA 2Y7FA 4IMCA 3KAOA 2JKEA 2EGZA 5DY2A 4LS2A 5EKYA 2NLIA 3FYOA 3TQ0A 2ABBA 5D38A 1WOBA 2Y89A 3EWZA 3QYQA 1UUMA 4XBKA 2Y7DA 3TC6A 3S0CA 1FCQA 2CZ5A 3PBUA 3C2OA 1XBXA 1IGSA 1N8FA 4HPXA 5G2WA 1EP2A 5A8GA 1RD5A 4ZVJA 5G1TA 1KW1A 1IIHA 2H6RA 4NNCA 4EOUA 5AFDA 4M6PA 1K03A 4ZMGA 1OK6A 3AO0A 5HR6A 2J88A 5MHBA 4RZ4A 1G7VA 3MJYA 3TQVA 1VYRA 3LHVA 3TU9A 2CLKA 2E6AA 4UTTC 5FF4A 2VFFA 4N4PA 2E77A 4LUJA 1TSIA 3RF9A 3PUDA 2J27A 3HGRA 4R33A 1LCOA 3QRHA 3W1RA 1ZY9A 4JYEA 3W88A 4YWIA 3GK0A 5I3FA 4UFMA 4POCA 2ZRZA 4O0ZA 4H4IA 3W1TA 3UWQA 3G1XA 1A5CA 4N02A 4LVBA 4R7JA 3STFA 4FB7A 1VCVA 4LVAA 3N9SA 4RR4A 4JICA 2V5LA 2VEPA 4NX0A 3S1VA 3EXSA 5CPMA 4WD0A 5KTLA 5AHFA 4O10A 1KM6A 3EWUA 1GJPA 3W07A 3NVTA 1P1XA 3KVLA 3W1UA 3LLDA 3UPWA 3HG5A 1QFEA 3UPBA 1OABA 3MP5A 2QDGA 1WAUA 2A6NA 4LU0A 5LHFA 4FHAA 3IIPA 3W84A 1KM0A 2ZRWA 4WUIA 2YZRA 5F2GA 3MP3A 2DZTA 1ADOA 3MP4A 1YDOA 3IGUA 1YLVA 3DKJA 4TMBA 4O28A 3W7NA 4FEZA 4N6FA 2E5CA 4JTHA 1P0KA 4PC8A 3A24A 3E9AA 2X1UA 1O95A 3GKAA 2OT0A 4MIMA 4UIOA 3EX6A 3BK0A 3LLFA 4CCDA 3QMSA 3EX3A 4K36A 5F2MA 3P61A 5F2LA 3CIXA 4JTGA 2E09A 2YW4A 3F1QA 5I3HA 3W2MA 1ICQA 3ZFHA 2HMCA 5G5IA 4LY8A 1FWSA 2E5DA 5K2ZA 3KHJA 1TV5A 2VC6A 1EP3A 2OT1A 4O4WA 4JNMA 3TJLA 3GDLA 3DENA 1P5BA 2JGQA 2Y7EA 4OGZA 3BW2A 3L0KA 3L5AA 4OHQA 5D02A 3TH6A 3NR0A 3O1NA 4E2BA 3HB9A 4O0KA 4AWUA 3EKZA 4GE8A 4M19A 1XFBA 2EHHA 3IVTA 4O19A 3NL3A 4UR8A 4JTIA 1H50A 3TDFA 3CU2A 2H90A 3P81A 2A7RA 5AHEA 1O60A 2BTMA 1FXQA 2NUYA 4WX2A 3TSBA 3M7WA 3W7EA 3W86A 6TIMA 4MJMA 3ELFA 4UTTA 4K39A 2GQ8A 4WOZA 1C9DA 1ICSA 1IXOA 4DF0A 2OCZA 4QITA 3DFTA 1UUOA 1OX5A 1GOXA 1TJRA 1A5AA 1S5TA 4HPJA 4TX9A 4BR1A 2WPBA 4PTNA 2QEZA 3GLCA 3P67A 3O05A 4OBTA 3SR7A 3UY7A 3HG3A 4UFKA 5IBXA 1GVRA 3Q58A 4K8HA 3TW7A 4EVZA 1XCFA 3CM4A 5G4EA 5H2ZA 2ZRVA 1N7KA 2B7NA 1Z44A 3S5NA 4P61A 3W75A 1S5VA 4Q33A 1UJPA 3W2LA 1N55A 1H7NA 1AMKA 2NXGA 1TPEA 3DFQA 4UTKA 1WBHA 4JYFA 4XBSA 2CLHA 4NJKA 3N2MA 2NWSA 2ISWA 1P0NA 2QAPA 8TIMA 4RZ5A 5DXXA 4IQLA 3UD6A 1T0OA 4O8RA 4AB4A 3RFAA 3ATZA 3IGXA 3TC7A 4P2VA 1TTJA 1GVOA 4GUIA 3IEBA 3SGUA 1G69A 4O17A 4HNUA 1WV2A 3LCLA 1TPWA 4BWLA 3W7GA 4LRTA 2V8ZA 1K8ZA 3LRLA 4I7WA 4G1KA 1NF7A 2A7NA 3EX2A 3DFNA 2CLIA 1K8XA 3PBWA 5BNKA 2TYSA 3HGOA 3G8EA 4NXKA 4Y9AA 2X2GA 3OBKA 4GUHA 1S5WA 3FJ6A 4A2SA 3QPYA 3QJAA 3TK7A 1H1ZA 3A5FA 3TAKA 2JKAA 1LBLA 1Q6RA 3M9YA 3TMLA 2CLFA 3F03K 1OYAA 1TTPA 3GZ3A 5ABTA 1W3TA 1WOAA 3GNDA 1C29A 4I7UA 2J9XA 4X9SA 3WJWA 2F7FA 2P1FA 1CX9A 1JRBA 3CLMA 4LV9A 3GXNA 3NAVA 4UMBA 1EP1A 3TCEA 2E5BA 1AW1A 3PSVA 1W56A 5LGXA 3O6CA 5HR7A 1G4SA 4Z1DA 1GVFA 1QPQA 4FX6M 5E93A 1TTQA 1SUXA 2PURA 3LCFA 3STGA 3TV8A 2ZZ3A 4JGDA 3PR2A 2ZRXA 1OVDA 3G3MA 1R2TA 2C18A 4MZ8A 4WXYA 3KRZA 1GG1A 4QNWA 5K7JA 4XZ9A 3UY8A 1OFBA 4DPQA 3P8JA 4UMCA 4FXSA 4CNPA 5F1VA 4DELA 5C6MA 4YCOA 4KKXA 1V7YA 3BV4A 3I65A 5I3KA 3UWYA 1I2OA 1LOLA 5HULA 1L9WA 3L0NA 5L6UA 4DF2A 1T99A 1XBVA 1YYAA 1OYCA 1H61A 3SSJA 4NJGA 3QMTA 3M5YA 4O15A 3DXIA 3DI1A 2VFHA
chains in the Genus database with same CATH superfamily
4JY8A 1SO6A 3LBOA 5C9WA 3H53A 1JCJA 2VENA 4LUIA 5JBFA 5CZ0A 3CC1A 1G1YA 2R1PA 1SVDA 3C2YA 2ICSA 1QRQA 4XBJA 3PAOA 3G1SA 3TSDA 4CCEA 4IMGA 5KEZA 2EPOA 1OFRA 4WSHA 4MFEA 1LDCA 1NQ6A 4Q4PA 3RPMA 1GJUA 2F6UA 3EWWA 1TMHA 4HMCA 4INFA 2QGYA 3OYZA 3WMBA 3OG3A 2UY2A 5BW6A 4Z2GA 4KT2A 3F4VA 2GUBA 3GR7A 3MWCA 2YKKA 3W81A 1J0ZA 4LRSA 1G0CA 3BARA 4PCSA 2OLSA 4U3AA 2FGBA 3DECA 3N29A 2OFJA 1EZWA 1R30A 3JS3A 1W5QA 2D2HA 5DMNA 1GTHA 1JZ4A 1TQJA 4V2XA 2FQIA 3QHOA 1LWHA 3VGFA 2PDUA 1FCUA 2O7QA 3LV6A 1MMFA 3T0TA 1PB0A 4RNIA 5LA0A 4N9BA 2WZMA 3O07A 2ZZ4A 1E1EA 4EF8A 3A22A 1F7BA 3QSRA 4ZO9A 1KXQA 3EX1A 1OT2A 3BOLA 1JPIA 4D1JA 1TCDA 1S3TC 2ZUVA 4G8TA 1CZ1A 5K9XA 4GBUA 3GM8A 3USBA 1JXKA 3WNNA 1SJCA 4OZOA 3MJMA 1KWKA 6TAAA 4Y9MA 4HU0A 1XQKA 4MDOA 4Y7EA 8RUCA 3B03A 2YDAA 3LHZA 2DSUA 4JIRA 5LIYX 2TAAA 4Z0SA 4O8AA 2CPUA 4Q8PA 4MYXA 3IIZA 1M53A 5D2WA 2DJXA 3N2BA 1PKYA 3WLOA 3SCOA 1M9HA 3IUDA 1U1JA 4PMRA 1AH4A 1AFSA 1FFRA 4ZQNA 2WNNA 3H2MA 1V3IA 4JCMA 3KZSA 1P0DA 2A3BA 4NVTA 3A4XA 2IKJA 4NI8A 4Q32A 4M51A 1BLIA 1CDGA 1J2WA 3UVIA 4JPGA 1Z48A 4HJFA 1DJXA 2OU4A 3COTA 4UWMA 5HUOA 1P7TA 1TUXA 4LW7A 5FESA 1N82A 1FTXA 3NQ6A 1DJIA 2ZICA 5LIXX 4NF7A 3WL0A 1X98A 4WY0F 3MU7A 3LHWA 3HF3A 2QKFA 1D7FA 1B5TA 1XDLA 1X96A 5GNYA 3N13A 2Q3RA 1IXNA 1T8XA 1RP9A 3AS0A 2WVUA 1U5JA 5BXSA 1TFVA 1MQQA 1QPRA 1VQTA 2HV5A 2A85A 4D6JA 2FB3A 2WNQA 4ML9A 3W1MA 1A5LC 1EHAA 3CZKA 1VFUA 4JX6A 3SIMA 3H2CA 3PBYA 4RV8A 1K8YA 1VEOA 4QISA 1PX3A 1QVBA 3VI2A 3W74A 2PLKA 4IT1A 2VXNA 1OZQA 3GNPA 3WLTA 4DUVA 4PUUA 1QJWA 2NW0A 1IR2A 5EGRA 1NFBA 2HZGA 3P60A 1KCLA 3FGCA 3ABOA 3W3OA 3EWYA 1BQGA 4LYRA 4OIFA 2OX4A 3S1XA 1H1NA 2PUZA 4WQ6A 3MDWA 2GDVA 1KQZA 3VPLA 1O5KA 3DZ1A 3IK2A 3IJDA 3MKKA 1B90A 3VUPA 3L65A 5A1AA 1JVNA 4AHOA 5LIWX 3FOKA 1LQ2A 3KVMA 2C15A 3FDKA 3OEXA 3CTLA 3WBEA 1FHDA 3O06A 1A47A 1UQZA 3EKLA 2JIEA 4A05A 4K37A 1W37A 3MZNA 1XR2A 2B4GA 2Q3OA 3P6LA 3LBCA 2FHFA 5A3HA 4HU4A 4XTDA 2WWDA 1RLCL 1XF0A 1E55A 1BWVA 1EO7A 1J12A 3C0SA 1HL2A 3AIVA 2HBVA 3SCSA 4IFKA 4HZ6A 3MA8A 3H2NA 3N15A 1Q4NX 4XVEA 1CI1A 4H7ZA 3LQLA 3AJXA 3W2UA 2ZZ2A 2VR5A 4ZB5A 4LANA 1M04A 2A0NA 1X6UA 3CHDA 1JI2A 4L1GA 5E5CA 1H7RA 3WFAA 5TQLA 3WQ5A 3JR2A 2CHOA 2Y61A 2WVSA 4H41A 4XTIA 2G4JA 3MI6A 1EJVC 3N4EA 4FX8A 1TVPA 2HBXA 3UJEA 3GNRA 4BF5A 1J6OA 2PB1A 4HYVA 3VM7A 1TWDA 1A5MC 4DWSD 2O9OA 5CGQA 1KTCA 1QXLA 4FO4A 2VEMA 2XZ7A 4PA8A 4AD0A 4FOUA 1UC5A 2QPSA 3W7LA 3QC3A 3KBVA 3ARRA 1RCQA 1UW9A 1ZBKA 1JCYA 2CZFA 3VVGA 1E6RA 1M7XA 3HQOA 4BQ5A 1VYSX 3UJ2A 3OQEA 3TYAA 3H2AA 2X0SA 5H1WA 1DE6A 3ITCA 2QDHA 2PCEA 2ZRYA 4GZ7A 3LXAA 3S2NA 1EL3A 1RPXA 1ZTVA 3ARVA 3BUVA 3T8QA 1P4CA 1R3QA 4QE5A 4WXZA 3G1DA 1HZYA 4W9TA 5HMDA 3USZA 1I2RA 5LA2A 4DO4A 4O1DA 4WY0A 4FALA 2NUWA 1V02A 3EWXA 2IKIA 4HIBA 5FJRA 3HJZA 5D33A 4QIUA 3GRIA 3ZR6A 4FNQA 4P8UA 4PMZA 2QXWA 1Q13A 5D4YA 2WMHA 4P5UA 2PDCA 1L0PA 3KRSA 2X8RA 3ZLFA 3NPUA 3QV8A 3GKFA 5JUVA 1LBMA 2PDHA 4JCLA 1B3VA 2QVNA 4MG4A 5BZAA 4HNTA 2GYIA 3LX9A 2W61A 5CPSA 2E4TA 2HVMA 3TQKA 3WQCA 4JYDA 3SB0A 2D73A 3G0SA 1RP8A 4EACA 1LBFA 3UNDA 1LWJA 4JOMA 4I9AA 4OTKA 1XYAA 1ZS2A 2CNCA 2BDQA 2J77A 3L67A 2QJMA 3WBXA 4H00A 1E51A 1IEXA 4C65A 4GVHA 5T26A 2Z1XA 1DIOA 1D9EA 4NASA 3WF3A 2GWGA 2WKJA 3O63A 2PZ0A 1QI5A 9XIMA 1CGUA 4ZQRA 3Q37A 1D3HA 1EUNA 1IEQA 3K30A 2VRJA 3RLGA 1Z9AA 2QJGA 4I5RA 5LKYA 4O1EA 3MHUA 4PEKA 1HJWA 1QASA 2CBVA 3UR8A 4KETA 2NV2A 3WQFA 1OZMA 1J0HA 3CZLA 1GQNA 3DUGA 5CSSA 1DJNA 4C1NB 1ZL1A 1HKWA 4JNZA 1PCWA 2A3AA 2P3EA 1WUFA 3MCMA 1V5XA 1J18A 1DJHA 1VAHA 3POCA 1WZKA 5CBIA 3SUVA 5F4XA 2CZEA 4PRRA 3KP0A 1TJ2A 4ZEPA 5A95A 2ZA3A 4LTSA 2AOSA 5FOOA 3PJTA 3AIBA 1XLFA 3ZJ7A 3LSCA 3U6WA 2VR4A 1M1BA 5ENLA 5IXEA 1TMQA 2J7GA 1E56A 3G1AA 1EBGA 1EFZA 1EWEA 1VBJA 1E15A 5AC8A 1EGMA 1OWQA 3UZXA 3INPA 3R79A 2CYGA 2I1OA 4JQ2A 1Z7AA 4L6DA 5FF3A 3TZNA 4GCAA 1QI4A 2YCLA 3B9AA 2Y24A 3LTPA 4NZJA 4WGXA 4AIBA 1RBLA 3Q2DA 5D30A 2VDGA 4XAGA 1J93A 4LC6A 3AWNA 1E1CA 2VR2A 3T8LA 2ASHA 1TWIA 3FEMA 4L5ZA 4W85A 2YGYA 1RQBA 3KLKA 2HROA 2PWDA 4AVOA 1B3XA 3HPXA 3S9YA 5CZTA 1LOQA 2VFEA 4Z1BA 1SGJA 1BVNP 3GW0A 3N6HA 1Z32X 1TREA 4HNNA 4XX6A 1YPIA 5DN1A 1HJQA 2I5IA 4F9DA 4KWOA 4HU3A 4JTSA 3QVQA 1SO3A 4V27A 5DELA 3KUMA 5FEXA 5K4ZA 1TV4A 1ZHAA 3PPCA 2W9MA 3TW9A 1CTNA 2Q09A 3DESA 2YDRA 3T0CA 3KTSA 1Q6OA 1WDRA 1KR0A 2QIWA 3AHZA 4FXFA 4FSAA 3FK4A 1YDVA 3DI0A 3P93A 4H9MA 2WJEA 4D8ZA 3UQNA 3CZGA 3I7QA 4OUEA 1Y5VA 1RQHA 3W7HA 3T81A 1NF0A 2DUXA 3H2FA 1SSGA 2VFGA 3AU2A 4UMAA 1L6SA 2Z24A 2YW3A 2HJPA 3DOPA 1FWEC 3VYLA 2XZ9A 1U1HA 4TV6A 3VCNA 4RNHA 2QYGA 1TX2A 5TNVA 2GJXB 1KFWA 3VX1A 3H54A 5HNRA 2X16A 5EMUA 1NSJA 3UXAA 3LXBA 4YTRA 2ZDSA 4UZUA 2PDNA 3M43A 4ZODA 2VNCA 1QUMA 3O0FA 3VC5A 1TPVA 5DBTA 4CN1A 4YHGA 1R5YA 1VFFA 3N9KA 4F0HA 4AMCA 1E6ZA 3STEA 1E9YB 3QGVA 4GGHA 4GH1A 4HMEA 2UY4A 3DAQA 7PTDA 3EDDA 2PC8A 4HHHA 1ONRA 1Q6QA 2W6RA 1J9YA 4B9ZA 5FD0A 5HWJA 5D32A 2V3DA 1FHVA 3VNMA 4XZWA 3ABQA 3QY7A 1XV8A 3CV6A 3N2CA 1QK2A 3W7IA 2FFIA 2YR1A 1F07A 1EUAA 1C8XA 2BGSA 1S1PA 1TVNA 1D3GA 4W84A 3S2MA 4LNCA 3S5YA 2F61A 4MZYA 2DZAA 3AALA 4XWUA 4I5UA 4A3QA 3W1QA 3V3WA 4UTUA 3UWVA 1G7UA 4LT9A 2Y85A 1Q7QA 4C6PA 1QBBA 4IIDA 3WLKX 4G5DA 1GOMA 4DXKA 5A2AA 5MKGA 2PAJA 1BRLB 3URNA 4ADTA 4E2DA 3SEPA 3RM4A 4Z2LA 2QUUA 1EC7A 3W70A 2E9BA 1UA7A 2Y5SA 2NQJA 3M16A 3LQGA 3GVQA 5GJNA 4IJRA 2OQLA 1QW8A 2XM1A 3R6IA 2P5NA 2E9MA 2GGEA 1JDEA 2VP8A 1JZ8A 3G22A 3CWNA 4UFLA 4GY7A 1JJKA 1DXIA 4L61A 3WF0A 1PXGA 2ZIDA 4ADUA 3U57A 2UBPC 1O7AA 1JEZA 3EYPA 3P5ZA 3LHTA 1US2A 2J79A 1J0YA 8A3HA 4HK7A 2VWSA 4C6NA 3KOFA 3N11A 1BD0A 5I3DA 4F0RA 4YTQA 5FJJA 4Q6XA 2QR6A 1F6KA 3OIXA 1W3NA 3UERA 4C7GA 2BHUA 3ZR5A 4HTBA 5DQPA 5C9UA 3S2JA 4HVXA 2Y6ZA 1KB3A 1SZFA 3JZUA 4NG3A 4XK2A 4N6EA 1QO5A 1A3HA 3W83A 1E4MM 2WB5A 1HL8A 3MBFA 2ZFAA 4URIA 3VDCA 3BMWA 4K38A 1ESWA 3W7KA 1K9TA 2EPKX 3SCTA 3MS8A 3GX9A 4TUFA 1EJWC 3NOYA 1DPMA 4KGJA 1FXPA 3W87A 2W79A 3ONBA 2FJUB 3TLLA 1J8VA 3IRDA 5I03A 2DVUA 1QT1A 2BG5A 1VFTA 2ESCA 3QW4B 3BSMA 3MI3A 5FF0A 2CLPA 2X40A 2NSOA 2OWXA 5H91A 3T9PA 1BWKA 2ZX9A 2NUXA 5A8QA 5AC5A 5BMXA 3S47A 1YXYA 3T08A 4N2YA 3WD0A 3S6TA 1FDJA 1M68A 3K4DA 2Z1SA 4JIPA 1GOOA 4LVFA 3LI0A 4FR1A 2ISDA 3IACA 3TLQA 1FH8A 5DY3A 1UWIA 1EBHA 3WF2A 2BVWA 3I68A 2R91A 2BHZA 4AHPA 3T1GA 2VZTA 4N9DA 1RK5A 3MI2A 5A94A 3UFYA 1TA3B 2ZUNA 5CZJA 3THQA 4H2HA 3IJLA 2WLZA 2C0HA 1XX1A 3VMOA 3PG9A 4UNKA 3HN3A 4BI6A 1VJZA 2D2GA 3WK0A 3WEMA 3TNBA 1JCXA 1JF5A 2DUAA 3EXTA 4O53A 4NSBA 2DIEA 4GXMA 5CBBA 3SCRA 2OZ3A 5IFPA 1PTAA 3SQSA 1ZRQA 4PMQA 4JTAA 1OC7A 4L6OA 4M29A 4KCVA 5IHRA 2CFFA 1L2UA 2WSYA 3CO4A 1XCXA 2BY1A 5CZSA 1F3TA 5CLWA 1LLZA 3BW4A 3SY5A 1TZ7A 1ZGDA 3HV9A 2WBKA 1XKJA 2WVVB 3L4ZA 2QT3A 3NPXA 9CGTA 1AD4A 3KRUA 3CZJA 3AQUA 4DJEA 4KH2A 4NX5A 3NQ8A 5DLCA 3ZJ6A 3M44A 1BVZA 1WDQA 1OF8A 4FF7A 4GCXA 4A8NA 1JUKA 4B4FA 1OX4B 4NAEA 1TV8A 4B5TA 4O50A 1V0KA 4F0MA 4EPKA 5C8BB 3T4CA 1OQFA 4RLIA 2CWNA 3KTXA 3VE7A 4GUGA 1SR9A 4X9YA 3E2RA 1MYRA 1OFDA 3WLRA 4C1KA 1DP0A 2W91A 1J0JA 3ARQA 1ISWA 2CXGA 2FZNA 4J35A 2A21A 1PWMA 3IARA 4HPHA 4QQ3A 3U2ZA 3WF4A 4NAFB 4AY8A 1BG4A 2OMAA 3H26A 2A5HA 1H0IA 2RDUA 3GR8A 1KTNA 2X1IA 3T40A 4DEFA 1HX0A 1XIHA 3H2OA 4H9YA 4O13A 2NQHA 4EWND 1LL6A 3LGEA 4UXDA 5ECUA 1CW2A 3PY2A 3HPSA 3LOTA 5JBEA 4PR4A 3SFKA 2GSEA 3E6EA 3S6DA 3E3HA 2WANA 4M7SA 5HNUA 2QJIA 2I17A 1Q6LA 4H01A 1ALDA 1I0BA 4UC5A 1C3FA 3CWOX 1XIEA 3RU6A 1P43A 5D2XA 3T2QA 5XIAA 1CIUA 1PJ9A 3ZWTA 4GLEA 4DM2A 1JNDA 1YNPA 3CL8A 4GIEA 4PTVA 1UD8A 1PKMA 4R9XA 3VKAA 4A4AA 3VIOA 3O0KA 3FXGA 4NZ1A 3A5VA 3UZ5A 2DDXA 4EXAA 1G94A 4MKSA 1W1PA 4RPQA 2HTMA 3P74A 5EBUA 5IDZA 3ZSTA 2Q8XA 5IDIA 1W8SA 1O1ZA 1KBLA 3PANA 1R46A 3GG8A 4J3TA 2GLKA 3TWAA 3WLLA 3BQ6A 2EG6A 1I2PA 2VGBA 1BTMA 2OSYA 1YNYA 3M0IA 4E0CA 3BURA 4MGGA 1MXSA 3VD7A 4HYRA 1YPFA 1VYPX 4RL3A 2ZC8A 4IPNB 1JDAA 5E09A 3M6YA 1EB3A 2EKCA 1ZFJA 3TN3A 1NELA 4REQB 2PTYA 3MV11 3SCWA 3N3MA 1GEQA 3UZZA 1S2UA 2W63A 2IKHA 2B0MA 2VDHA 1CGTA 4W7VA 2AL2B 2V3FA 1E0WA 2NQZA 1K02A 1XLGA 2YSWA 2Y4SA 3J7HA 2YL8A 3N2XA 4IMEA 5A8PA 4GX8A 3T55A 2NLYA 3L7RA 1UR1A 1FBAA 4GINA 3G24A 4O52A 3GHTA 4DAIA 1ZAHA 3W38A 3CL7A 2BASA 5LYRA 3IIXA 2X7WA 2YPIA 1GVYA 3N14A 1FVPA 2YLLA 1AJZA 2XIMA 2WMIB 4JFVA 2BV9A 4GYPC 1XP3A 2Y7FA 3KAOA 2EGZA 5JU6A 2NLIA 5D38A 1WOBA 1BXCA 2Y89A 3RLHA 3TTEA 4XBKA 3WFZA 3RR1A 1GKQA 2G41A 1QOXA 2BXYA 1UZHA 4PB3A 4JQAA 3C2OA 1XBXA 1IGSA 1N8FA 4P7RA 4QGCA 3RHGA 3CH0A 4G2DA 4NNCA 5AFDA 2Z7GA 5T9BG 5HR6A 4EXBA 2OVLA 1NDVA 9XIAA 1VYRA 3LHVA 3TU9A 4LAMA 4UTTC 4Z2KA 1WE5A 4N4PA 4B3LA 3RXZA 1QU4A 4J28A 2RGMA 1VIWA 1LCOA 4E3TA 4IFOA 1FWJC 4J1OA 4YWIA 4Q3MA 5C2CA 2PBOA 4B15A 3W1TA 2X05A 3QV6A 2J7BA 3N2TA 1C7TA 3STFA 4F2UA 1JZ2A 4UOQA 3QLDA 3GFZA 3UR7A 4PB5A 1YQ2A 3EWUA 3W07A 1Q7ZA 4Q7NA 1WB0A 3UPBA 2DEPA 1N8WA 1WAUA 2A6NA 2XIJA 2ISFA 1RALA 4ZFMA 4DZ5A 3MANA 1KM0A 2VWTA 3MSGA 1XSIA 2Q02A 1ZJBA 2HEJA 2HK0A 2ZVRA 3DKJA 5DF0A 4TMBA 4O28A 3WLMA 3EDJA 5LIKX 3WQWA 2FH8A 4IPLA 1P0KA 3A24A 1X8CA 2OT0A 4MIMA 4UIOA 3EX6A 3LLFA 3OYXA 5F2LA 4B92A 3CIXA 3TVAA 4C6EA 4WDXA 1I9CB 5I3HA 1BYAA 5G5IA 2J7HA 1FWSA 2E5DA 3BAJA 5K2ZA 3KHJA 1TV5A 3RRXA 2OT1A 2NQLA 4O4WA 4LUSA 3GDLA 2HPIA 1E73M 3APYA 1UH4A 2BMBA 4ROPA 4L9XA 1O12A 1XLHA 4Y9NA 3R8GA 3A13A 3QKZA 3ZT6A 1F3WA 4F0KA 4M19A 1XFBA 2EHHA 3IVTA 3NL3A 2F8QA 1DXFA 2GDQA 4LY4A 4UQAA 3P81A 3VGDA 1VBUA 1XIIA 2A7RA 1NDZA 2BTMA 1FXQA 3LMZA 3W7EA 4ATWA 1PZ0A 4MJMA 3ELFA 4AEEA 1GKRA 5EU9A 1ICSA 4Z2JA 4C5ZA 1J11A 1S2TA 4AX7A 1O68A 4ILSA 1UUOA 3M4HA 3WN6A 3HMCA 2J75A 1W1B1 1ONEA 4AQLA 5A2CA 1US3A 1V3MA 3SCPA 3GLCA 2QMKA 3N3TA 4UFKA 1MDRA 2IPWA 4XSLA 1XLKA 5CGTA 3DDMA 1N7KA 2QDDA 3URQA 1A4MA 4NRSA 3W2LA 1EX1A 3PNUA 1I1XA 4OOZA 4WSJA 3DFQA 4JQ1A 4UTKA 1WBHA 4L6HA 4XBSA 2CLHA 3N2MA 2NWSA 4GNVA 2ISWA 2XFRA 4CUCA 2QAPA 3WEZA 3EDFA 4RZ5A 5A8MA 4MPKA 4IQLA 3UD6A 4DB7A 4AB4A 4ACZA 4OECA 1U22A 2POZA 1TTJA 2DQWA 4GUIA 3WDHA 4KIEA 2PA6A 1G69A 4EPBC 1BHGA 1WV2A 3CAVA 4GIYA 1WO2A 1K8ZA 3UEQA 4I7WA 2FHBA 1NF7A 3EX2A 3B9DA 3SCNA 4PTWA 1VBGA 1N2VA 2WYSA 1ZPTA 2WC7A 3HGOA 3II1A 2X2GA 2REQA 3OBKA 4GUHA 2E0PA 3FJ6A 4A2SA 2KAUC 4QBXA 5CSUA 4XD4A 3S46A 1Q6RA 3M9YA 3V0UA 3F03K 1MNSA 1F6YA 2WJFA 2DVXA 1E5NA 1WOAA 2HWGA 3WYZA 3WJWA 1SYTA 4H9VA 4G7EA 4UMBA 5HBFA 1KCXA 3SCVA 4D6FA 4AFYA 3TJ4A 2YBVA 2X0YA 3BAYA 3PSVA 3ARXA 5LGXA 1R0MA 4Z1DA 1QPQA 4X63A 4CD7A 2FGZA 4FX6M 4GVGA 1EF3A 1T8QA 1L2QA 4B2DD 4JGDA 4H04A 1UR4A 1V4YA 1CGXA 2DV0A 3G3MA 1U5HA 4WXYA 3GNXA 3KRZA 3UY8A 1S46A 4DPQA 4CNPA 1V7YA 3U0HA 3BV4A 3FNDA 4UR9A 3UWYA 1JYVA 3P3BA 1OD8A 4B90A 1V6VA 3VOCA 4DF2A 1T99A 3OW1A 2P53A 3TTOA 1OYCA 4NJGA 3QMTA 1S5MA 4QXIA 4O15A 4F4RA 5C70A 3DI1A 3DG3A 3TROA 3B8VA 3PTKA 5G2HA 2WKLA 3H2EA 2OR2A 3R12A 2OQHA 4JFSA 2QCLA 3S6OA 3W4RA 2C1HA 4RJEA 4A21A 3LYEA 2PGRA 4UQEA 4HPNA 3TX9A 1MDLA 3EB2A 3B8DA 1DKWA 4FNTA 4LH8A 4EAYA 2PDWA 5C55A 3U8GA 2BOGX 1ZJHA 4E8DA 1W1YA 1R38A 2FZBA 1JZ5A 4IP4A 1AD1A 5E1QA 2VL4A 3PBGA 3SQMA 1R86A 1NU5A 2GOUA 4US5A 4CQ9A 3TN6A 3UYCA 1H2JA 1GYLA 2PWUA 4DYEA 2YCEA 1W3KA 5JBDA 3JRKA 3NL6A 3S1WA 4YVPA 2ON3A 4Q7IA 2J7CA 4WKFA 2I5QA 1UR0A 1E1FA 2Z0IA 3TZFA 4GKLA 1VR6A 4RK8A 3A23A 1HGYA 2PTDA 3TYEA 2JEPA 4X60A 3VZXA 3DYOA 4XSMA 3KOXA 3KZPA 1UR9A 4ERAA 2ZE3A 4WJ8A 1XL9A 4RZBA 4QFUA 2HDJA 4PH6A 1FWWA 3HPZA 4AEFA 3BXWA 5DANA 4O11A 1E4LA 3UG5A 1B2YA 2XN2A 1TO3A 2G3MA 4PFHA 2QF8A 3A47A 3THAA 1Q3NA 1E6XM 1VHNA 3PJXA 4Y9OA 5DEZA 3JZEA 2FTYA 2CW6A 1XBZA 1TRIA 3ZOAA 3HPAA 1MZRA 3ZXWA 4GGBA 4N0RA 4IMDA 4J5NA 4K1GA 1V6UA 5U4NA 3RJXA 4TO8A 3WJZA 3LERA 2R1MA 1Z6KA 1UWRA 4A3YA 3MT1A 5KSWA 2QCGA 4A2RA 2G97A 2Z25A 5M2FX 5BROA 3VIMA 3URBA 3F2DA 1K4HA 5TBOA 2CCRA 3W7JA 2FDMA 3LUTA 2ACSA 4LAKA 2VGGA 4I6KA 1OYBA 3S8HA 1GQLA 1WXZA 2PDGA 4N42A 2ISSA 5CGMA 3B0UX 4B5UA 4IOTA 5LXEA 1T7LA 3KBWA 3AXXA 3CL6A 3W9ZA 4WSKA 4KFNA 1DQWA 3KWXA 3AICA 3MYPA 5LA1A 4BQ3A 1QNRA 4H6KA 2W67A 1S2VA 4M6QA 1IXQA 4AG0A 3O7UA 3W2NA 3I3DA 3AJ7A 3WCZA 2HVOA 3KVKA 2IPFA 4X0VA 5GVJA 1DJQA 1VP5A 3DKLA 3C8NA 3SRFA 3LXCA 1F4HA 1KV8A 4WJXA 2Y63A 1UP2A 1XH0A 3LZ3A 2VYOA 3BCDA 1C92A 3L21A 2VURA 3Q45A 5HMSA 1ADSA 4Z0JA 4Q8OA 1E0TA 1HP4A 5I3GA 3LTSA 3W6LA 2QAFA 1TPFA 2GVGA 4AD1A 4R9OA 5IBXC 4CQ8A 4LS1A 4LOCA 4HD5A 3VNZA 4CVUA 4ICCX 2YZ5A 3PZQA 4AIEA 2PFHA 4HNOA 4TR9A 3R11A 1V3KA 3BGJA 1XRFA 3W22A 3ARZA 1IR1A 3VKCA 3KCJA 4LBRA 2HS8A 4QJ1A 4ZL1A 3ARSA 4HHPA 2IXUA 4IF2A 3WQGA 3CH9A 4QNEA 1H63A 5EFFA 4PL2A 1VPXA 3PZOA 4NUWA 3EWBX 3ID7A 3CNYA 4Q22A 2XN0A 3CO8A 3VIKA 3M07A 2QCHA 3UWEA 5DMMA 4HP5A 2WW5A 3MB9A 4CN4A 3T09A 2P0OA 2OEJA 4PUJA 4R3UA 5HK4A 2XVNA 2J74A 4PULA 1OJXA 1OGSA 3ABSA 3MO4A 3KS5A 3SY1A 3FXYA 2UZ9A 4LYQA 3LEPA 4PUWA 1IEWA 2PWHA 2WQPA 4X61A 4DAFA 2RDWA 3GXIA 3BWWA 5A6LA 4JL1A 3GTNA 4DXXA 4BFAA 4QQUA 1R3WA 1M3UA 1B3OA 1A4LA 5DCBA 2G37A 1F73A 5FJUA 4V1XA 3P14A 2GGGA 1EIXA 5AYIA 2VM8A 5FEPA 3HQPA 1J6PA 3LM3A 2WSRA 1ISVA 3DC8A 1MXDA 1W5NA 2DP3A 1BXNA 2QW5A 1EOMA 4U2ZA 2FPTA 4UQCA 2DZVA 4E2OA 4LCRA 5LNRA 1RR2A 3CBWA 3N34A 3NEVA 3QW3A 4NJJA 2HSAA 4RDYA 1LOSA 3SRDA 4UTHA 3AISA 1JCMP 3F5JA 2H8XA 2ZWZA 4YXGA 3OU8A 3W7OA 2A2IA 3BG3A 3VK5A 3AMCA 1U5VA 1RY0A 4DBEA 1R7OA 4YJ5A 1E0VA 3L66A 2GGHA 2PE4A 4FOJA 1JYWA 5H8MA 2BWGA 3IIVA 4DJFC 1F05A 3WD2A 4FP1A 3G0XA 5BOOA 1EJTC 4IJBA 2GQ3A 5J8LA 3EGJA 3MDUA 1CXEA 3UWWA 2C91A 1FCBA 4FPSA 1ZLPA 3W1NA 4N4QA 1VBRA 1P48A 5D04C 2BX7A 3GQYA 1FDZA 1CBGA 1W9XA 4RNJA 5FF7A 1WXJA 4U4MA 3HU7A 1LL4A 2Q8LA 3IJ7A 4GI9A 1JRCA 4ZO7A 3DFOA 3PZVA 3GVWA 3C4UA 4YMZA 2DSZA 1MO0A 4RXFA 3GYCA 1GPWA 1QPKA 1CLVA 1ZAJA 2CIPA 1TR9A 2BP1A 5T91A 1R9XA 1IEIA 2TSYA 3SCUA 3GHUA 3AROA 1X1NA 4HMNA 1HVQA 1IWAA 4D8LA 3LM7A 2Z7KA 3N17A 4A3RA 3N4AA 5CH9A 4PBEA 1YE6A 5AY7A 2UY5A 3F4CA 3GG7A 3TKFA 2YYUA 3C0LA 2XFWA 2ZQ0A 4DBSA 1EPXA 1NIUA 1XPGA 2DUZA 2FFCA 1XDJA 2BZNA 4MJ2A 3G8RA 2OGYA 2V0TA 4HSHA 5KZ6A 3O9NA 1ZQ5A 2WO5A 3CEPA 3OO2A 5HDRA 2CZDA 3G6MA 1QI2A 2E6YA 4QDWA 3VCRA 4J3ZA 4CD4A 1YXCA 3T6CA 4GZJA 4XUYA 5H8UA 3BMVA 5TIMA 3S4TA 4AY7A 5C9RA 3OIHA 5HINA 3GHSA 3OA3A 1B9BA 4AVNA 1VGAA 4E2VA 1T96A 3KX6A 1QO2A 4PMVA 4CNSA 7REQA 2D0FA 1DWAM 3VOGA 3PZ9A 3R0DA 2V9DA 3A6OA 1H0GA 4JDYA 1DIEA 3ZJKA 4GZEA 4IXHA 4OT7A 2DORA 1WPCA 3BGGA 1LWIA 4XD3A 1RV8A 3EPMA 3GXFA 1S1RA 3KM8A 2V82A 3SECA 1FX6A 4W8LA 1NAL1 4LS0A 3MHFA 1Y0EA 5IOBA 4D72A 4M56A 4CU6A 1H7WA 3LBMA 1UWUA 2J9YA 1EDTA 4RZ6A 3FEQA 1J79A 4CN6A 3TEVA 4HA0A 4LAZA 1DBTA 1TYGA 4KEUA 3LK6A 4CNOA 5EPDA 4R5EA 3RX3A 1B4EA 1FWBC 1IHIA 3W29A 3N19B 1EXBA 1XLLA 3QPEA 5F2IA 3G5EA 4TV5A 4DXVA 2XINA 2DZPA 1ME9A 1RD6A 5AHLA 3SGGA 4HK6A 3R7MA 4JTDA 2W27A 3PUOA 3IGHX 1W9DM 5A5WA 3KS6A 4YYCA 3I7SA 1Q8AA 3SZ8A 3EAUA 2PEVA 4FS9A 4GZIA 4L80A 2F2HA 5KZDA 2J6VA 5A6SA 5M1TA 3BQ5A 2OB3A 3U2CA 1DHPA 1W1ZA 3OLDA 4MLRA 4OUIA 1M7JA 3MKVA 5CAKA 4US6A 4W88A 1WKDA 2V2CA 1SW3A 1YE4A 3DU0A 3AYVA 3FYPA 3BVJA 3EDEA 3WMSA 2ZX6A 4H8VA 1EWDA 2GGIA 4W4QA 3IJ8A 1XJBA 2PDMA 3ONCA 3W7CA 2ZC1A 4XVDA 1I1WA 4IPJA 4O12A 3DG7A 3C2RA 3WK2A 3RILA 3IGSA 4WR3A 3OQ8A 2R6OA 1U2YA 3FGCB 2VCCA 4ML4A 3FYYA 2EPHA 1Z42A 3WQ8A 5J04A 4M1RA 2PTZA 1K7FA 3TR2A 6PTDA 2Y8KA 1LT7A 2PLJA 2NVAA 3CUXA 1PIIA 4EKJA 1RJPA 2GFTA 4LXFA 3RN6A 3XINA 5D05A 3GVRA 2EF9A 4HZMA 4DO5A 1A49A 3NQEA 3W26A 2J8TA 3PK7A 3SI9A 3SN0A 1TCMA 3VNYA 4PCTA 1TUFA 5C5YA 2WV8A 5D2YA 1XRVA 1W3JA 4D6IA 1QCWA 2XVLA 3KVJA 3CIVA 4EPEC 3WUFA 1W5OA 4M1BA 1HJXA 3IAQA 3RLVA 2C1IA 1VKFA 4JFWA 3FKKA 1VJIA 4PCPA 1TG7A 3ISIX 5BOEA 1I75A 4PMXA 4FAMA 3P2VA 4DRSA 1CB7B 2CWXA 4TU1A 4C1NA 4L64A 3K4WA 3WSUA 5JH2A 2JF6A 1I45A 1UZDA 4XD6A 4HSNA 3CUFA 4IFKB 4P7NA 2YXXA 3NEHA 3LGGA 4JEQA 4H9UA 3IS4A 5EYWA 3ARWA 3CMJA 1B3YA 3I6RA 1DJZA 3MZ2A 3A3HA 3HJEA 4AW7A 3CB8A 4DWSB 5REQB 4GQQA 4A8LA 3WUGA 1M5WA 1HW6A 2WSPA 3FJLA 4HT3A 1LLWA 4ZB2A 4GO9A 3VA8A 1EEXA 1Q6DA 3B0XA 4FXRA 3RG6A 5HQLA 1XYLA 1LG2A 4Q4KA 3WFLA 4C6KA 3NL2A 2DW7A 4ZOBA 3FDGA 3M5ZA 1NWSA 2VO5A 1MZHA 3P7YA 3MSRA 3ZVHA 4FNRA 4B5SA 3W7MA 3IJQA 3QFEA 3QYSA 4LNYA 5JIWA 2F2KA 3V7PA 1G4TA 4YTUA 3M0HA 2JBMA 4JD4A 4GQGA 3QSTA 4PODA 5J5RA 4FNPA 1TX0A 1Q5MA 1ZENA 3G3DA 3V1PA 3P5YA 2VX6A 1TB3A 1LLOA 2XU2A 1AQ0A 3KEHA 3P84A 3QQ1A 2W92A 2CC0A 3QV9A 3E0VA 3H7VA 1JGMA 4EK7A 3PTDA 4GOAA 5TF0A 4WY0B 3UZJA 1NJJA 2XWEA 1PSCA 4B16A 3G1VA 3T05A 2ZUWA 3FLUA 3W28A 4DM1A 1MEIA 3B8WA 3UGVA 1OT1A 7TIMA 3GB6A 5BRBA 4IG2A 6A3HA 1JQXA 3WQ6A 3VD5A 4AF0B 1O1HA 2ZTJA 5EY5A 2QUNA 3R8RA 3CUZA 3EOUA 2Z1WA 2RH9A 3AYTA 2E68A 4TX8A 1V6YA 1MUMA 3WX7A 6XIMA 3UCQA 5AYYA 3E2VA 4GD0A 1BQCA 1PEZA 3RNDA 1H5YA 1JYXA 4FOKA 3W2KA 3D0CA 3OLGA 3U7BA 3VABA 5EB8A 3WF1A 1OM0A 5HAOA 1NVMA 4HBKA 4MUPA 4EAMA 2VOMA 1W1IE 1GWJA 1M65A 3BJTA 2YA2A 2E7FA 1FKWA 3I3EA 1IE7C 4YVVA 3YPIA 2OEKA 2GK1A 4R53A 1V0NA 1XM3A 1JD9A 4D2JA 5HPCA 4WIWA 4R7OA 4L9YA 2PD5A 2WJDA 1W2VA 3F4NA 1SSDA 1HVXA 2G8ZA 1ELSA 4JTTA 3S1GA 4W86A 1L6WA 1D2KA 4KF1A 4QHRA 3ZR4A 1EX5A 5JQ9A 4GI4A 1TQXA 1IF2A 4HCLA 4KGLA 3SURA 2C1GA 1A5BA 4A3UA 2WLYA 2CERA 3OVPA 4UR7A 4XO7A 4JBRA 4YU1A 3MUIA 1QATA 1WDDA 4ZQOA 4F2TA 1J01A 4Q4RA 4JNYA 4OJYA 2Q71A 1E5JA 1UC4A 3GBDA 2G96A 1TIMA 2P3ZA 4AC1X 3KFTA 3SM0A 1JR1A 3NG3A 2PPGA 4IMFA 1B57A 5F7UA 5HNNA 2BLEA 4UNIA 2C16A 4UFIA 4AUBA 2NQ9A 1GOKA 3EPNA 2WPGA 4FR6A 3LU2A 2OOFA 3E5PA 2VD9A 4E4FA 1XICA 1LM1A 3GD6A 3BZGA 1XHGA 5CPOA 2YCLB 2Y5JA 1G6CA 4UQDA 1BRLA 2OODA 3S1UA 1W54A 2P50A 3GDRA 3LNPA 2BGNE 4IISA 1ZJIA 3OVGA 1UG6A 1E1CB 3B4YA 3G77A 4XZNX 5I09A 4RXGA 1Z41A 1H7OA 1F2JA 1QPNA 1EH9A 4YS1A 4WZHA 4XG1A 5E0CA 3QEZA 3QZ6A 6ALDA 3CPUA 1C8QA 5BWAA 2ALDA 1AQFA 3R25A 1KRAC 3D6NA 5SWUA 3NJ3A 2Y2WA 3PZIA 3KE0A 4WVXA 2CHNA 4H7VA 1LZOA 4C91A 1LRNA 1OG0A 3NURA 4BF9A 3QOMA 3M0LA 4QTGA 1Y5WA 1GQIA 4IGHA 3GXDA 4OV9A 3DGBA 2HISA 3L4XA 1XISA 1HO1A 1KLZA 3W1LA 1WA3A 4JY9A 4PUDA 5I23A 3NZGA 3TFXA 1V7AA 4QSHA 5DX7A 1Q45A 1KFLA 1X6LA 4LUTB 4Z2HA 2J8GA 3AYSA 3CUGA 5CC5A 2BFGA 3TXZA 2V3EA 1WZLA 1Y7VA 2Z2BA 2DJLA 3R13A 3GH5A 3N18A 1K77A 6CGTA 3V75A 1TV7A 3GO2A 3MCNA 3H7RA 2Z2UA 1MEWA 4IGSA 2JALA 1H3GA 3B06A 4S1FA 4YLWA 1GQKA 3S9IA 1O6IA 1XIFA 1B9ZA 4UBPC 5D8ZA 1KRMA 3STCA 3RIKA 2B7PA 4W89A 1YKWA 3W7PA 2VTFA 3L2LA 1YIXA 1Q65A 1W31A 2WBGA 4KCTA 1GONA 1I8JA 3VTRA 4JTKA 1AW2A 4NU7A 1IT8A 3WDPP 5G1MA 3WDJA 4U28A 5FJOA 1OX6A 3W1PA 2O55A 5H8PA 1VH7A 1GK8A 3N1AA 2G95A 4QDPA 3W37A 1WNOA 3OPSA 4BEUA 4LVGA 4PTMA 2PRMA 4AZGA 4YYFA 5DRCA 1UD4A 4DJFD 2J66A 1TA3A 4JDBA 4GG9A 4G9PA 3GFYA 4GVIA 4YL2A 1OC5A 3QY8A 3ZS4A 4MY9A 1B3ZA 1GOWA 4O1FA 3NQVA 4BF7A 4WDWA 4JIQA 3M0MA 3R1ZA 1H4PA 3NPWA 1FA2A 1O5QA 4O54A 3H4XA 1QPOA 4ENLA 1LL7A 1I2NA 1SW7A 1UIPA 1QNQA 2XIBA 1MQRA 4OFCA 3PFMA 2YB4A 2NVCA 1UH2A 1ZNNA 4PMYA 3L68A 2DT1A 4DNMA 4EX4A 2X30A 1SPQA 4D6GA 1BGAA 2ZVIA 3JW7A 2A3EA 3WDQA 5MKGB 4JAWA 1SZNA 4XB3A 4J3WA 3TIMA 3UJFA 1HT6A 4ACYA 3ENLA 2D22A 2Y7GA 5B7ZA 2NZLA 3O6DA 2ZA1A 2FJKA 1J0IA 2WVVA 1UZ1A 3PZTA 4J40A 1XCWA 2PDYA 2O4MA 4AC7C 4LQ1A 4AD3A 3BSGA 4CGTA 4CEUC 5C9ZA 2GVJA 3NTYA 4Y6GA 1CGYA 3NO5A 1QNPA 3E49A 1KGUA 3PHAA 3NFUA 4XKMA 5HQEA 4GJJA 1OX4A 3AMKA 3DHPA 3S5SA 3H8AA 4J2MA 1W2PA 1TVLA 4ORMA 1LP6A 3TTQA 3D46A 4IL2A 5F4SA 3SUWA 3CWHA 4KEVA 4LF2A 1S3HA 5FA5A 3LG3A 1GUVA 4H6EA 3V16A 4ZCWA 4EXQA 1ZUAX 4GFSA 4LPCA 4MKVA 1YTDA 3C5QA 4P7OA 3QLLA 4G7FA 1HN1A 4RDVA 3QXBA 4PCFA 2D1ZA 3ORWA 3B97A 3V5CA 2CLEA 3IV8A 4WF7A 1AK5A 4QDMA 3EMZA 2E8YA 2A1YA 4AX6A 7ENLA 4MOZA 5BXRA 3QGAC 4KRTA 4W8BA 4JFUA 4H6QA 1U1UA 4IGNA 2J9ZA 4H6RA 5F4WA 4GYKA 3SDOA 4IMCA 3B8SA 2QPXA 3WNPA 3GXMA 3TQ0A 2ABBA 4QS5A 3LPOA 3QYQA 3VZZA 4L65A 1WKFA 4AYGA 3OGSA 4TVCA 1XRSA 3WD4A 3PBUA 3ZLHA 5C7HA 2MANA 2O9PA 1QNOA 5G4HC 5A8GA 4HJWA 4F79A 2WZEA 4PRWA 1IIHA 1E6PA 4M6PA 1B31A 1G5AA 2BBFA 4RE3A 4ZMGA 2J88A 1BF2A 2RGLA 1QWKA 1G7VA 3AU6A 2POTA 3MJYA 4KEZA 4HA1A 1EDQA 2CLKA 1NFPA 4LUJA 1JDDA 3SADA 1VJSA 4AZ7A 3QRHA 1ZY9A 3GK0A 1UD6A 4UCFA 5I3FA 2DY3A 4PEEA 3ICJA 4PUNA 1FRBA 2NT0A 1UOKA 3CZ8A 4H4IA 4R85A 1P1MA 1UQYA 4L7ZA 3G1XA 2ZADA 1W9PA 1Q85A 4R7JA 4RE4A 4FB7A 1VENA 3CJPA 3EWDA 4FF5A 1GKPA 3V5OA 2VEPA 3S1VA 4E5TA 3KWSA 2DT2A 3EXSA 4WD0A 5AHFA 4O10A 1CWYA 3BH4A 1EIBA 3KVLA 3HG5A 3MP5A 3EEZA 2HXTA 2FHCA 5LHFA 2BOFX 3W84A 3IIPA 2ZRWA 2YZRA 3MP3A 1ADOA 4J3XA 3PWGA 2VI0A 1A5UA 1VF8A 2EPMX 3VDHA 3A64A 5BU9A 3PJWA 3D47A 4PC8A 3E9AA 1AODA 2X1UA 2W5FA 3GKAA 4QAWA 3BK0A 3GZAA 4CCDA 3QMSA 1C8YA 1EOKA 4HK5A 5F2MA 2E09A 3F1QA 3UU0A 2D20A 3W2MA 4Q8TA 4QJ4B 1ICQA 4NAEB 2HMCA 5E6ZA 3KBJA 4LAOA 1KCZA 1AJ0A 1E40A 3OA5A 4DJEC 3TJLA 1P5BA 1XINA 3R0UA 2WMIA 3NR0A 3O1NA 1YX1A 3M0VA 5CZKA 4E2BA 2V5CA 4O0KA 4NILA 4GXWA 4O19A 3EA1A 4PBGA 1XPYA 2H9AA 1PX4A 4UQ9A 4UR8A 4JTIA 3E0FA 3CU2A 3VGHA 3IANA 4J4KA 5AHEA 1Q4WA 3VUSA 1PKNA 1TJ0A 4UTTA 2IPJA 4WOZA 2XHYA 2XIOA 2VOTA 3VOIA 4DF0A 3KLLA 4HHMA 4FA3A 4QLJA 3RX4A 2A3CA 2QJJA 4QITA 5JH1A 1A5AA 2HRWA 1CCWB 4PTNA 2QEZA 3P67A 4OBTA 1PKLA 3SR7A 2XIIA 1JI1A 3Q58A 1T5AA 1XC6A 3TW7A 1XYBA 1XCFA 5H2ZA 4UOZA 3OZYA 2VRQA 3W75A 1S5VA 5HATA 1K6WA 1H7NA 3WH6A 3HV8A 2NXGA 2Z1KA 1TPEA 4JYFA 5BXTA 4JFTA 1TIWA 3WELA 7ODCA 4HOWA 1KR1A 3NSNA 1UMYA 3ARTA 2EQDA 4NYUA 4RW3A 5DXXA 3UA4A 4O8RA 3GG0A 1PIFA 1TE6A 3SY8A 3IGXA 3TC7A 1GVOA 5GQBA 1MUCA 1KRCC 4DBWA 3BZJA 1GORA 5A8NA 3LCLA 5AZ1A 3WL1A 4BWLA 3GDBA 2V8ZA 4S3KA 5E70A 1QK0A 2QVHA 2A7NA 3PZMA 5HANA 3DFNA 1MW0A 1IWBA 1KNWA 4S3FA 3EA3A 3OP2A 4XAZA 3G8EA 3FHQA 3V0TA 4XZLX 1H5VA 4XZHA 1JG9A 1S5WA 2FVKA 3EWCA 1FHUA 1W6TA 3VILA 1RAKA 1OD0A 1XS2A 3QJAA 3TAKA 1LBLA 5IHSA 1EJUC 2D3LA 2XG9A 2BB0A 1G9HA 5ABTA 3EOOA 3T07A 2EJ1A 4RDZA 1C29A 2F7FA 3CS2A 1S5NA 2GUYA 3CLMA 4QSFA 1CPUA 3GTHA 1EHNA 1ZB5A 3AHVA 3SAZA 1BYDA 3R4IA 3TCEA 1AW1A 4GO8A 1W56A 2WC4A 3TOYA 4ATLA 3NYDA 4IZGA 4L1WA 1VEPA 1BAGA 2DGAA 2QLYA 1GCYA 1WAWA 5B80A 2PURA 1IZCA 2QQ6A 4WKAA 3PZNA 1G01A 2ZZ3A 3TV8A 4TQTA 2WMGA 2ZRXA 1OVDA 4PGLA 1R2TA 5C2GA 3QHMA 4GABA 2YLAA 4Z17A 1GG1A 4QNWA 4XZ9A 2RDXA 3WNKA 4FXSA 4DELA 1ZP3A 3GW3A 1E3ZA 1RPKA 3KOWA 5I3KA 3GH7A 1I2OA 1LOLA 4H8HA 5HULA 4GI8A 5L6UA 1TWZA 2CXEA 1VBHA 2WCGA 4EP8C 4BCEA 2G3JA 3M5YA 5I24A 3VIHA 3CHFA 3AI0A 2ACUA 3TTYA 4H83A 1WDSA 4C60A 1TWSA 5AYBA 3VINA 3R58A 5U7SA 4H9TA 3L5LA 3LB0A 1TMLA 1K1DA 1ME8A 2WNWA 3BJFA 4HNCA 2C8NA 3ZQ9A 5I3IA 1JIBA 2X2YA 4GY1A 1K3UA 3BO9A 3L5MA 1UJQA 1S2CA 4MDPA 1E9ZB 3HG4A 2INEA 3C8FA 2ZXQA 4MWAA 2OLAA 3K8LA 1O94A 3ANYA 4OBRA 4IUGA 1KM5A 4LC8A 1KFBA 3MSYA 3THUA 2UV8G 3C2EA 4MWAD 1VPQA 1MWOA 3WZ0E 4KBXA 5CJNA 1GG0A 1XWYA 3V36A 2QCMA 4AWTA 1L8PA 4UTJA 3NGJA 1OK4A 2NT1A 2GQ9A 3G1YA 1W17A 2AMXA 4JN8A 1L6FA 3WH9A 3GC5A 2O9TA 2J4GA 1BTCA 1KM3A 1HKJA 3H12A 1ISZA 1VCGA 2A4AA 5FACA 1SU5A 1ZCOA 4XUGA 4JIIX 2ATMA 4H8NA 2ZXDA 3O6YX 2OOGA 1PZ2A 3KOZA 2VX5A 3K8MA 1JAKA 1YHTA 1KFKA 3PZGA 4KRUA 3DFHA 3RMEA 2PZNA 4QJ3B 2BOEX 4CCCA 2MNRA 4XZBA 1REQA 4XKYA 5HUPA 3W6YA 2A79A 2BXVA 3W27A 1PHWA 3REQB 3NQFA 2Y0FA 4HN4A 2BNJA 4HA3A 2P8CA 3N04A 2F9RA 1E9IA 3CB3A 4EWJA 4MY8A 1PZ1A 2QS8A 4PUKA 4C6JA 2NQ5A 3MMTA 4A8RA 1PAMA 4DYJA 4HTYA 4C6MA 2DQXA 3D3FA 4ZO8A 2XWDA 1PCKA 4LUSB 4O18A 2O4QA 4NQ1A 4GRSA 2QMJA 3HQNA 4AH7A 3TN4A 2FGLA 2BXZA 3QGKC 4S23A 2XGZA 2YFOA 2JE8A 3ABRA 3ZJ8A 4C5YA 1QHPA 1J5TA 1UKSA 2FMNA 3P82A 1WKEA 1PZ3A 1FWNA 2HPMA 4X2RA 1XD0A 4OWGA 1JD7A 4D6CA 4I8DA 1AA1B 1SJBA 3GYEA 1MNZA 5K4XA 2O9RA 1E0XA 2J47A 3UT0A 4KWUA 1UWTA 2BVTA 2F6KA 3IJ6A 3L4TA 1C8VA 2V6AA 1JZ3A 3GDTA 4W7UA 4UTWA 2J62A 3SSZA 1NOWA 4WKHA 4JN6A 3UJRA 3LCIA 3A4WA 3C52A 3L23A 3DFPA 5AOUA 3M7SA 1NP2A 1ML1A 4IP5A 3PB2A 3UESA 1YDNA 3R5EA 5AC7A 4ICMA 4AD4A 4GJ1A 1WCGA 3NPVA 2JKPA 2C71A 5FKYA 2XUCA 4MZ1A 4JQ4A 2PWGA 4ACZB 3P80A 1XLAA 3BE7A 4QP0A 1J10A 4FX7A 4HHLA 4NL1A 5CBJA 4DUXA 1Q7MA 2OTDA 5CXPA 3PSWA 2XVKA 1V3HA 4MHBA 4QJ5B 2NX9A 2P8BA 3MUY1 1PV8A 1W1TA 2YX0A 4GBDA 5HQMA 2DT3A 1A5SA 2ZRUA 1GTEA 2BS9A 4JR5A 1Q6EA 3OHIA 3U4FA 5LZLA 2TPSA 1OADA 5DO8A 2DZUA 5AKQA 3W53A 1YPXA 3K4AA 3NZRA 1SMDA 2B31A 3THDA 3L2IA 1MQPA 2BODX 3CUJA 1NDWA 3B9NA 3V5FA 2DZWA 4A29A 2HK1A 2QULA 1V6XA 1MRQA 3M0ZA 2OZTA 1E9LA 4G7EB 2ZTKA 2ZZ5A 3GHRA 5FEZA 5D9NA 3DX5A 2BY2A 5DXYA 3TWBA 4ZQMA 3H22A 2F6XA 2OG9A 1XUZA 2WQDA 3PBMA 3VU2A 1KXVA 2JFEX 4F9JA 4S2BA 2AGKA 1BVWA 3LN3A 3VNLA 3BMXA 3O16A 4K8EA 2Z6JA 1HKKA 1JGIA 4J2PA 1HKVA 4Y96A 5BMWA 1X39A 3C3UA 2PI6A 3RK8A 3E0IA 5DT5A 3KL5A 3SRKA 1W5MA 3FA3A 2CKSA 1XSKA 1OGBA 1ITQA 2HS6A 1VIZA 4MJZA 1O5XA 1TPC1 1LRQA 1R3SA 1EJRC 3MHGA 2DZSA 3IPWA 3ZIZA 3GAKA 1DTUA 3P0WA 1MUWA 4UTLA 3P62A 2CBUA 4AHQA 1C90A 1LJYA 1R87A 2V2DA 4MB4A 4MB1A 3TA6A 1QR7A 1IEVA 4PCNA 1FKXA 3MV01 3W2JA 4ATDA 1JQVA 3WD3A 4AD2A 3ZVIA 4F0LA 3UYIA 4H1ZA 3VM5A 4WCJA 1EQPA 1CT5A 4ZENA 4A35A 4O4VA 3VD4A 1C9WA 4AWEA 2IMRA 2GUUA 2YXGA 2R1LA 2ZA2A 3HQ1A 5CJMA 1UB3A 3ZWSA 3C0JA 3H70A 3CIWA 3UZYA 1RBOB 2OSXA 4CNNA 3BLOA 3H4GA 4CU7A 1K7XA 3NCOA 3NO1A 3JUGA 3L0GA 4DJDA 3ZYZA 3N4FA 4DIAA 2ZYFA 1QBAA 3CV2A 3UXDA 4DJDD 3W7QA 3HTWA 2PWFA 3G0UA 3MO7A 1JZ6A 4CCZA 8XIMA 4L9ZA 2Y88A 5J5DA 3BAIA 2VZVA 2VC7A 4AZHA 2RAGA 2E6DA 1ZCCA 3LSBA 3L4YA 2RHGA 1XH2A 2EJAA 4AD5A 3BLFA 1XQLA 3ZZ1A 3R89A 1JCNA 1UWSA 3NQBA 1XUUA 3UNTA 2R82A 2Y8UA 3PF3A 1E70M 2NX3A 1F8MA 2PLCA 3LV5A 3O8AA 3GG1A 4DJED 1JDFA 1X6NA 1FH7A 5AN7A 4WDUA 2G3NA 4ZBCA 4Q6JA 5EMLA 4PSPA 4L1XA 1UPMB 3PB0A 5FJIA 4JXCA 3SJNA 3XIMA 2V5BA 3D5HA 1WP6A 1XIDA 3EDKA 1X1OA 2VEFA 3FFSA 4DO7A 4WJEA 1FWRA 3TYCA 2EG8A 3WJSA 2WSKA 3O2LA 5KINA 2J25A 1KBIA 1UROA 2XGBA 2QIIA 1EYEA 2PDBA 2FZDA 3IUIA 2QPUA 1HJUA 3GUGA 1ZBCA 4C7DA 3FSTA 4LGXA 3GR4A 1XYFA 4OVXA 2I57A 4AZCA 2ZZ1A 4QEHA 1SFSA 1RHCA 2P0IA 4KWWA 3C2FA 2R1NA 8XIAA 5EBAA 3G18A 3CEUA 1S38A 4TVDA 9RUBA 3WENA 2C3ZA 5XINA 4L4LA 3NQ2A 1WQ5A 2ADAA 2WZHA 3VKKA 3VOFA 2PRLA 2XVPA 1MW2A 1X1ZA 1ZU8A 4HA4A 1XG3A 1E6QM 4C6CA 2V38A 3TJXA 1CXKA 4HCHA 3WQDA 2PTWA 3VIJA 1ZJAA 4YWSA 3ABXA 3M5XA 1L6YA 4JTCA 4CVWA 4IL0A 2RJHA 1EQCA 5K9DA 3UG4A 2QCFA 1KXHA 1I60A 4F8XA 1QDSA 3ZM8A 4WHBA 3F5KA 2E25A 3F5LA 3M0YA 3A9BA 3LENA 4IUOA 4OBSA 2WK2A 1P0BA 3IJIA 5KZEA 1H09A 1TPDA 1F8IA 2YBTA 5LXXA 3P8IA 4LBSA 1R9ZA 1JCTA 2GL5A 2V3GA 3VKJA 3ARUA 2PRHA 1PX8A 5AC4A 2VC9A 4LSBA 3W73A 2EPLX 2OZ8A 2XH4A 4ZQCA 4IQEA 1UD3A 5KZMA 2PDXA 4Y90A 4H2CA 4K7YA 4Z1CA 3NYZA 2PDFA 5CSRA 3IVUA 5I3JA 4AEOA 5FSDC 3O6AA 2INFA 1YBQB 3E38A 3T0DA 3VCCA 1TJ1A 3S83A 2PP0A 3WLQA 1R3VA 2RFGA 2I5GA 3CK5A 4K7VA 3NNTA 3RLUA 3C86A 4FLOA 1QTWA 1FOBA 5D2TA 2IUZA 3WJXA 4L4MA 2XTKA 5D03A 4S38A 1FP8A 1KM2A 1KM1A 1V0MA 1LYXA 1WUEA 5LNSA 1XIGA 3WKZA 4LVDA 3F4WA 5I77A 3UBPC 4X2PA 5A6KA 3DBPA 3DBNA 3MUCA 3GTXA 4GQBA 3I4EA 5A2BA 3LPFA 3N73A 4X22A 4NRRA 2GJLA 3T2OA 3WEOA 2X7VA 1GHRA 1H11A 2WJZA 1UASA 2ZUUA 1PS9A 3U4AA 2J7DA 2PODA 3PC0A 2FZ8A 5HJYA 4IWWA 3W1AA 2WHLA 1O5RA 2NV9A 2DSVA 3I6EA 2VZSA 1XYZA 3QPZA 4CKQA 3VDAA 4UFHA 4NZFA 3WNOA 1DOSA 1A5NC 3AMLA 4KMQA 5C7VA 4ROQA 2GJPA 3B0YA 4KWVA 2PDKA 3HIJA 2PWVA 2QCDA 1TWWA 4M82A 4ZOCA 3EMCA 4JHOA 3LRMA 3IAPA 4KFPA 5D2VA 3W76A 3SRHA 3AIEA 4JZ5A 4IQDA 2B7OA 1UOZA 3PTMA 1G4PA 1XKYA 1F6PA 4DLMA 1TPUA 2OZ0A 3RO8A 3K1DA 4FNSA 5DT7A 2Z1BA 4IQJA 3UCCA 3ME3A 3M1ZA 4GUJA