2PCQA

Crystal structure of putative dihydrodipicolinate synthase (ttha0737) from thermus thermophilus hb8
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
MILPPIPTPFDREGRLDEEAFRELAQALEPLVDGLLVYGSNGEGVHLTPEERARGLRALRPRKPFLVGLMEETLPQAEGALLEAKAAGAMALLATPPRYYHGSLGAGLLRYYEALAEKMPLFLYHVPQNTKVDLPLEAVEALAPHPNVLGIKDSSGDLSRIAFYQARLQEFRVYTGHAPTFLGALALGAEGGILAAANLAPRAYRALLDHFREGRLAEAQELQKKLFPLGDLLAKGGVPLLKQALRHLGLPAGYPRPPYPAESPLWERFLPVLEGLKEEGWVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dihydrodipicolinate synthase
publication title Crystal structure of putative dihydrodipicolinate synthase (TTHA0737) from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 101
structure length 283
sequence length 283
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2pcqA00
3DGRA 1XC4A 3DBPA 1O95A 3IVSA 1VCGA 2Y85A 2ZTJA 5ABTA 1SO4A 4IPIA 1KLZA 3G3MA 2VXNA 3NL5A 4NUWA 4UC5A 5DBUA 2CLKA 5K4XA 1VLIA 4KWWA 4K37A 4P2VA 1EP2A 3IEBA 5H91A 1TMHA 1OJXA 4GUJA 5BNKA 1JRBA 1TTJA 8TIMA 5FEXA 1AW5A 1L9WA 1XXXA 4QIUA 1GEQA 3GR8A 4WY0B 4ZQPA 4UTTC 1F74A 3LRLA 1WOAA 3UWQA 3LXCA 3O63A 3PBWA 3TQVA 5K7JA 3C6CA 3QFEA 3W7QA 1GVRA 1XBXA 4K8HA 4O15A 2VELA 4BK9A 4FNUA 2QJIA 4ZL1A 1VYPX 2ZRVA 3KHJA 3M6YA 1U83A 4YCOA 3NQCA 3FYPA 2RDTA 3EB2A 1KM6A 1G6CA 1XL9A 3M7WA 1JUBA 3TUUA 4FX8A 4M7TA 5HWJA 4HNNA 2J88A 4M19A 4MLRA 5D38A 5LHFA 2NV1A 3LI0A 2Q3RA 4QISA 1M7PA 4AB4A 2OMAA 4AF0A 3LCLA 4R7JA 2E5BA 4ML9A 3TH6A 3DFOA 1OX4B 2VC6A 4K36A 3B05A 3RFAA 3SGZA 4MKNA 3S1XA 2Y7EA 4PCFA 3QSRA 3MYPA 4X9SA 3DH7A 1DORA 1X1ZA 3W84A 2QAPA 4ZQCA 3PVFA 3MHUA 3M16A 3PSWA 4FB7A 3W7CA 2B7PA 3CIXA 4N9CA 2FPTA 4ZQOA 1G67A 2JGQA 4RX0A 4Y9AA 2VKZG 3PY2A 3GDRA 1C8VA 3NAVA 4Z1AA 3UD6A 2GQAA 2YW4A 4DEFA 3P8JA 4FX6M 1SFJA 1DVJA 5A8GA 1YDVA 3ATZA 1UB3A 2X16A 1A5BA 1ONRA 3FIGA 4M5PA 3WJXA 1JR1A 3I7QA 3QW3A 2WNNA 2FDSA 1NEYA 1ZAIA 5TIMA 2CLMA 1DJNA 1EA0A 3GLCA 2JKEA 2P0OA 1GQNA 1ME7A 1WV2A 3STCA 3STGA 1RQHA 5HMSA 4HHPA 1IF2A 2ZRYA 4JS3A 1XBYA 4Q32A 4JGDA 4IMDA 3DHDA 1OX5A 3W7RA 4UMBA 1SR9A 3VNDA 1QO5A 3FA5A 3NOEA 1EP3A 3MO7A 1QOPA 2PRMA 2DZXA 1TREA 4IMGA 2E77A 1XBZA 1SZFA 5AC8A 3EX1A 1EEPA 3DKJA 3L65A 4NXSA 3T55A 4BI5A 3W9ZA 3O8AA 1H1ZA 4PEKA 1DQWA 1ZAJA 2TRSA 3UQNA 1JUEA 3KXQA 1O5KA 2ZDRA 3I65A 4Z0JA 3HG2A 5DY2A 3W1QA 1CI1A 1ME9A 2QDHA 1ZCOA 4WZHA 2C13A 4HN4A 1Q6RA 3THQA 1C9DA 1OFQA 3EWUA 4AVFA 1H7XA 3PG8A 2QR6A 1W3NA 2ZZ7A 3BW4A 3TQ0A 4AXKA 3R89A 2DP3A 3L67A 3PB2A 2QDGA 4WUIA 1UUMA 2ZRWA 2WO5A 1UJPA 1FWNA 2KZHA 1KTCA 3O6DA 5I3HA 1SW0A 3NL3A 2BSLA 3M5ZA 4XWUA 3PUDA 5FEZA 2OZ0A 1K7FA 2F7FA 2E6AA 1W5PA 3I6RA 2FPVA 3C3NA 4FNTA 1B9BA 1LROA 3H53A 2TMDA 3PR2A 2VFHA 2A0NA 2V0TA 4AWTA 2ISWA 2H3DA 1HFBA 3O6YX 3L68A 1OFDA 2WOQA 1LRTA 2V2CA 2FPYA 3BG5A 4O11A 3GR7A 3S1UA 2QJGA 5FESA 2YZRA 5LNUA 4O8RA 1IIGA 5FEWA 3P7YA 3LM7A 1W8SA 3NEVA 3NQVA 1SZNA 2EKCA 5D09A 3VI2A 4IMCA 1SO6A 5K9DA 5CZ0A 1V5XA 5EKYA 3TMLA 4AEOA 3NR0A 3UNDA 1PHQA 2BWGA 3HG5A 4JYFA 1Q6QA 1H7OA 5CSRA 2ISSA 3S5ZA 3W88A 5AHMA 4AHQA 3TC6A 4NJIA 3OEXA 3ABRA 2DZPA 5G4EA 3SY5A 1VRDA 2ATSA 2FQIA 3O07A 4JTLA 1AMKA 3PBYA 1KFLA 4O0KA 3LDVA 3P84A 3LHWA 1JCMP 4RJEA 4CCEA 4MZYA 2QUUA 2WSRA 4DPQA 4K39A 1MEWA 3PUOA 4LTSA 3HOJA 3DHFA 3TFCA 4GUIA 1JJKA 2ZQ0A 2BX7A 5CPLA 1AW2A 4JIPA 3NQEA 5KZMA 3W2NA 3W2JA 4JICA 3C2RA 4AHOA 1W1ZA 1FX6A 1H62A 1JCLA 4RXGA 4B5NA 4TX9A 2QJHA 3ZS4A 5E93A 2YDAA 3DXIA 3MP3A 3W1NA 1OF6A 1J2WA 4OT7A 1P5BA 4R53A 1B57A 4LV9A 4OWGA 1SPQA 2EGZA 1KLYA 3IIZA 4UNKA 3MI2A 4G1KA 3FLUA 3GDKA 2CZ5A 2J9XA 3SSJA 5I3JA 4JTHA 3FJ6A 3GNDA 3FYOA 4E38A 1SO3A 2QCFA 5DXYA 3EXSA 4GFSA 3UY8A 3M5YA 2JKPA 3TK7A 1HO4A 3C0JA 3L21A 1WOBA 3TAKA 1FY6A 2ZZ6A 3TR2A 3CM4A 3W7LA 1YXCA 2P1FA 2QCEA 1FWWA 5F4XA 4UTWC 4JD4A 3IIOA 4NVTA 3A23A 2WSQA 3E96A 3V75A 4Z0SA 2ISVA 1GYNA 1K8ZA 2QCGA 3BGJA 2QKFA 4BWLC 3JRKA 1GVSA 3SR7A 1TPFA 4LS2A 3GXNA 3AO0A 3LGEA 1JVNA 4GUFA 1D9EA 1PCWA 1ZENA 2ZCGA 4WY0A 3S5NA 4AWUA 4UTLA 3N9RA 5DXXA 3PBVA 3R5EA 4IPJA 4XBKA 4NNBA 4A3UA 3CEPA 2E6FA 4MYAA 4WXYA 3QQ1A 4DF0A 3HG4A 5FEPA 4BFAA 4R34A 4L4LA 4O12A 3PS7A 5L6UA 4QNWA 1TO3A 5HWMA 2GUUA 4UR8A 1KTNA 1U5JA 2C16A 1QPNA 3P62A 3GNNA 5HQEA 4CCDA 1ADOA 2NLIA 3G1DA 3NG3A 2Z1BA 4LS0A 2ZFAA 4HNVA 3B0VC 3L5LA 3W2LA 1I2NA 3W1UA 4H4IA 1QNVA 2FFCA 3HJZA 2G96A 2HTMA 1VJIA 2Y6ZA 5HR6A 2ZA2A 1H51A 1GVOA 3QQ0A 4N6FA 1W0MA 3G1YA 1OX4A 1KM3A 3YPIA 1J4EA 4X22A 1SU5A 4XBSA 5KMYA 5K9CA 4K38A 4ZQMA 3S1VA 1LLWA 2QCMA 1TV5A 3TIMA 2Y63A 1YTDA 4N9DA 1LP6A 2A4AA 2X30A 1CW2A 1VPXA 5C6MA 3OBKA 3W7JA 3W7IA 1XFBA 4LVFA 1VC4A 2NX1A 1SW7A 1YDNA 3NNTA 1WA3A 4LC6A 4M7SA 1NVMA 2C1HA 1P1XA 1LYXA 3HPZA 4IOTA 1SZEA 2A6LA 2ZZ2A 4MY9A 1GJPA 1VHNA 4LRTA 4X2RA 2QUTA 2FB3A 2VEKA 4XTDA 3LCFA 3MI6A 1VLWA 3MWAA 4WQ6A 2Y7GA 1DOSA 3CIWA 3NO5A 2ZTKA 2X1SA 3GAKA 2RH9A 5L9FA 3LHZA 1G4TA 1RZMA 2A6NA 4UTMA 1OVDA 4O4WA 2FB2A 2E6DA 4DO4A 4OBTA 1N55A 5AB3A 3BO9A 1EUAA 4NJJA 3W6YA 1EX5A 3M41A 4MFEA 4IJBA 2E68A 1KV5A 4NQ1A 1KM0A 1N7KA 1TPUA 3C52A 2R14A 3L66A 1C29A 1KW1A 1TPB1 1A5CA 4HNUA 1MEHA 3QJAA 2A1YA 2CLEA 4E2BA 1K8YA 4LUJA 4ORMA 3BLIA 1DHPA 2CLIA 3H55A 1OFEA 2GOUA 3G1FA 4FEZA 2P10A 2B7QA 3G0SA 1BKSA 3N34A 3DFSA 2NUWA 2ALDA 1Z48A 2CW6A 2R94A 3MP5A 4LU0A 2AAMA 4Q4KA 3Q37A 2FIQA 5LNVA 1VH7A 4AH7A 1W54A 4H3DA 5G2WA 1G4SA 2TYSA 4RZ6A 2V8ZA 3HF3A 4WJEA 3B04A 1Z44A 2PC4A 3SIZA 1JCJA 1YADA 3V1PA 3IRDA 5F4SA 3DI0A 4JY8A 4A2SA 2H8ZA 3W1LA 3THAA 4UTTA 3W7KA 4JDYA 3AJXA 5D2TA 3I7SA 5U7SA 5HINA 3USBA 4O52A 2OT0A 3BLFA 3PG9A 1W31A 3FKKA 1UASA 4DELA 2VFGA 3LOTA 4LC8A 1YPIA 2TPSA 2WNZA 3ELFA 3W75A 1ZALA 3W1PA 2YXGA 5MHBA 1WX0A 4O19A 2IQTA 1I2PA 2DU2A 1X6UA 3EWZA 1OK4A 1ZJIA 2QEZA 1IXNA 4O57A 4JR5A 1HG3A 4JIQA 4LVGA 4S2CA 4U28A 1HTIA 3VE7A 5F2GA 3CTLA 3NQFA 3UXDA 3A21A 3HIJA 4Q33A 1OYBA 1OYCA 2NX3A 3W85A 2ZA3A 3R2GA 1TQXA 3QMTA 5FF7A 4ADUA 1Z41A 3TW6A 1EIXA 4P61A 4DBDA 4X3ZA 3WJYA 1FWSA 1UCWA 2C18A 1XDLA 4IMFA 3EWYA 1E51A 1H7NA 3T44A 2OCZA 3IIPA 3A5FA 3W2UA 4RLIA 3A5VA 4IGHA 3FKRA 4JN6A 2CWNA 3W7DA 4IUOA 2ZRUA 3W7MA 2ZA1A 1JULA 4Y8FA 1H5YA 3WJWA 4MLJA 2BZNA 3LI1A 3NL2A 1GZGA 4DXVA 1KFEA 5AN7A 3TJLA 1SSGA 4O16A 4LRSA 4JYEA 4LUIA 3NQ2A 1S3HA 4GRSA 1KM5A 2WV8A 3NPVA 3TA6A 4XKYB 2ZZ3A 3IVTA 4TU1A 3OG3A 2JK2A 2PRLA 3NQAA 3G3DA 3S8HA 2YX0A 3P5ZA 1MZHA 3W7NA 1YTKA 3LTYA 3GVGA 3CC1A 1I2QA 3GKAA 3C2EA 4GE8A 4LS1A 3PM6A 1XM3A 1R2SA 3CQ0A 4MY1A 2VFDA 5DN1A 4O53A 1KBIA 4HNTA 2V5LA 4GNJA 4UMAA 2YSWA 3W07A 5LGXA 4RV8A 5AC6A 4GUHA 3QMRA 2XFWA 1FXQA 4WXZA 4EF8A 1L2UA 5HR7A 1JCNA 1KV8A 3U6WA 4DQWA 3BG9A 1QPOA 1ZAHA 4JEQA 5EL1A 3ZR4A 3W2MA 5F1VA 2QF7A 1WBJA 2I1OA 4YMZA 3W1RA 6ALDA 2EPHA 3LCHA 1OFPA 3A24A 3G22A 5EY5A 1J5TA 2VFFA 3LBMA 3LLDA 3QSTA 1G69A 3C61A 4MOZA 3UPBA 2O7QA 1GPWA 4UTJA 3S0CA 3W22A 5LGZA 3T40A 1BWKA 3P61A 3SJ3A 5GVJA 3ZWTA 3M0ZA 5SWUA 2RFGA 5F1UA 3IGXA 1TPVA 4TR9A 2WNQA 3FOKA 2E09A 3E12A 2NZLA 3F03K 3MI3A 4FO4A 3W2KA 2QCDB 1LBMA 3HB9A 2ATMA 5AC7A 1GWJA 3LB0A 4K8EA 5KZEA 3LXBA 3KOFA 2Y61A 4JTKA 1DBTA 3BW3A 3ATYA 2B7NA 1QR7A 4MUZA 1K7XA 2ZBTA 3VFLA 3B4UA 1O94A 4OQVA 2PURA 5D2XA 3E9AA 1PHWA 3RNDA 3TKFA 3TROA 3HBLA 4HSNA 4FIQA 4JTIA 4WOZA 3VCRA 3HGOA 1OHLA 1TPWA 1OABA 1FBAA 3DFTA 2AQWA 3UZJA 3G8EA 2W6RA 3G1SA 4EWND 1G7VA 1HO1A 2VFIA 1DQXA 2V9DA 3STEA 3GYEA 4ZZ9A 1TPEA 3LCXA 5K2ZA 5IBXA 1NF7A 3R12A 4N02A 4EOUA 1VCFA 4I9AA 2A5HA 2FTPA 3WK3A 4DF2A 1I4NA 1S5WA 3G1VA 3TMQA 4I7WA 2V82A 3LXAA 1L6SA 3MMTA 4HT3A 4IXHA 3NM3A 3TV8A 1OK6A 2ZRZA 4CNPA 1OFBA 2HS8A 5D2YA 5H2ZA 1A50A 1JQVA 1H60A 4CQ8A 3PSVA 1O60A 3TSBA 2Q3OA 4UNLA 4O10A 1YYAA 1TJPA 2WPBA 2PCQA 1F6KA 5F2MA 5DLCA 5I3FA 4O4VA 1OFRA 2X1RA 3QPYA 1TB3A 1T0OA 1WDWA 1TYGA 3T4CA 1I8JA 1ICPA 1K8XA 5HULA 2AGKA 2PRHA 1KA9F 4RZ4A 5CZTA 3KFTA 2B4GA 2O7SA 4AMAA 3ANYA 1KTBA 3N2MA 4LNYA 4O17A 3S1WA 4JTJA 4HIBA 5EYWA 2GVLA 3C56A 1A53A 3HPXA 1YXDA 3TNOA 1ZNNA 1DKWA 1PE1A 2J9YA 4A22A 3MP4A 4LVAA 4KFNA 5FF4A 5J5DA 4JX5A 2CZDA 3C2VA 3B06A 5G5IA 2RHGA 1FDYA 4GC4A 1H7RA 1TPH1 5LSMA 3SFKA 3N9SA 1FCUA 1YLVA 1R30A 4FXSA 1FCQA 3P8IA 1GYLA 2G5WA 1YXYA 5EPDA 4GWEA 3CPRA 4JTEA 2QAFA 1AG1O 4A29A 1TRDA 4O18A 3HG3A 4RKAA 5I3GA 3EKZA 3M9YA 4NJKA 2C0AA 3M43A 5CPMA 4O50A 1R47A 4K6AA 3VE9A 3PULA 1BTMA 3S6DA 3WK2A 3P81A 3DFQA 3NDOA 4OGZA 4NJHA 3LV5A 4UFIA 4Y90A 2DZTA 1LBLA 4UTWA 3RF9A 4Y96A 1L6WA 1X8FA 1MXSA 4O1BA 1B4EA 3PC0A 2GQ8A 5CPNA 4O54A 5E1QA 4MY8A 4BR1A 3G1HA 4FNRA 5AYZA 4CNNA 2YCEA 3LHUA 2ZYFA 3S5YA 4NT0A 3LHYA 3QMSA 4XUGA 3L0KA 3M5VA 5G1YA 3W23A 2OT1A 2QCHA 2X1UA 4QSHA 3W70A 1WXJA 2Y89A 1SW3A 1VQTA 4FXRA 4MVAA 3SGUA 1P0NA 3W86A 1QPRA 4YXGA 1KFKA 3N14A 2R8WA 3IIVA 5CPOA 3DKLA 3PWAA 4K7YA 4NU7A 1LBFA 4TMBA 1ZHAA 4HPXA 3SW6A 3G24A 3KX6A 4UR7A 3PB0A 4RK8A 3L2IA 1XDMA 1OFAA 2J24A 4UMCA 2H8XA 3CB8A 4K7VA 1O4UA 3NM1A 2OJPA 1LRQA 2VEMA 3JS3A 4RZ5A 1RD5A 2EAWA 2JKAA 4L4MA 4MYXA 5CZSA 3WJZA 3ZWSA 3TDFA 3DAQA 2B0MA 4EIVA 1ZY9A 3DI1A 3TXVA 2WKJA 2D73A 1T99A 3LCGA 3GXTA 3O15A 1I2OA 3L0NA 1A5SA 1MEIA 3GXPA 4FNSA 5D2VA 3PAJA 1R2TA 1W5NA 1QMLA 3EX6A 1OFOA 3RLVA 5T26A 3ABSA 1QPQA 4E2DA 5K9XA 2JGYA 2YYUA 2XN0A 3GB6A 1TPC1 4N6EA 5F2IA 3HGSA 1UBSA 5CZJA 4ORIA 2DJXA 1KBJA 2TSYA 4JY9A 2UV8G 5HJLA 1M6JA 1TQJA 2HSAA 2Z2UA 3HMJG 4GBUA 2E6YA 1RR2A 4FNPA 5HNRA 3MHFA 5F4WA 1QAPA 2C6QA 3W72A 1I2RA 1TTIA 2I9EA 3F4WA 4HSOA 4M6VA 1MO0A 2Z6IA 3W7OA 3EXRA 3N73A 1GTHA 4XKYA 2CU0A 2A21A 1SFLA 3T78A 3MYOA 4N4QA 3C8FA 4POCA 1B4KA 5KSWA 3G1AA 3Q94A 5FI8A 5C55A 3O16A 1TRIA 5LNSA 3LCWA 1KFJA 2CLLA 1WAUA 5G2HA 4JX6A 2A2IA 2NWRA 3CHVA 1F73A 3I68A 1SUXA 4U4MA 4NZJA 2QUVA 3G1XA 2WJZA 2FJKA 1H1YA 1PCKA 3PUEA 4KFOA 3BK0A 4KKXA 4QQ3A 4CQ9A 4EVZA 5AFDA 3T7VA 1LOQA 4FF7A 2QCLA 4AHPA 5KTLA 3TE9A 5EMUA 4ZVJA 5LKYA 5AYXA 5IM51 3BGGA 3OVQA 4UFHA 2C3ZA 3TSMA 4MFDA 3QF0A 4PODA 3W73A 3MUXA 1TCDA 2CLFA 3R8RA 2NXGA 1F6PA 2DZWA 2NV2A 4AAJA 1IXOA 5FF0A 3UWVA 3MW7A 4UFLA 2CZFA 1VZWA 1PVNA 3OIXA 3W71A 2GJLA 4MIMA 3U2OA 3F4NA 4JTSA 4LW7A 1FCBA 2QCNA 1O5XA 3QZEA 4HPJA 5BRBA 1GTEA 5G2IA 1IGSA 4PTNA 5CSSA 4QJ1A 5E0KA 3N19B 3L5MA 5DY3A 1H61A 3PBUA 1XUZA 3L5AA 3UWUA 2RDWA 5D2WA 3W87A 3U8GA 2GPTA 4TMCA 2VEPA 3P5YA 2QCDA 5D05A 3SECA 4YWIA 1ICSA 1FWTA 4ONVA 3B0UX 3DZ1A 5BMXA 5TQLA 3EWXA 1FQ0A 4ADSA 1M7OA 2YW3A 1OF8A 3KRUA 4JX4A 2NUXA 5K3VA 3NXFA 4NNAA 4OE7A 1FDZA 1BEUA 1LORA 3NGJA 4DF1A 3LBCA 2HS6A 5DCDA 1VYSX 2V5BA 3CT7A 3TQKA 1S5VA 3KVMA 1VGAA 1NFBA 1D3GA 3CLMA 1FXPA 3GDMA 5AHIA 2BTMA 2LLEA 4Z1DA 4W9TA 3EX4A 3R13A 3LLFA 4CLMA 1VYRA 4UFMA 3MBFA 3W1XA 4ZQNA 3RU6A 4FX7A 1Q6LA 2V2HA 1FCVA 1FUYA 2GJNA 3C2OA 4RXFA 4BI7A 4D2JA 1Q3NA 3UY7A 3BV4A 2E5DA 1QDSA 1KM1A 2QCCA 5LNWA 4QNEA 4YCPA 3TJXA 1W5OA 1B3OA 4OU1A 4IQLA 1A5AA 4PFMA 1PV8A 3M5XA 3I7RA 1TTQA 1LRNA 5CKSA 5LNRA 2H90A 4NZFA 3H54A 2Y70A 4KWVA 3WK0A 4S1FA 5EA9A 4BI6A 3MJYA 1YTEA 3HQ1A 3UYCA 1R46A 2NWSA 3E0IA 1K02A 1LCOA 4H6KA 2W0UA 1R2RA 2XN1A 1KFBA 3LRKA 2NXIA 1SQ7A 2W79A 1Y0EA 1L6YA 3GDLA 3TCEA 3TFXA 1JCYA 1SSDA 2CFFA 3P82A 3TW7A 3BG3A 3KVKA 1W37A 2VEIA 2GQ9A 3W1AA 1K03A 3HGJA 2CZEA 4UTKA 3ABOA 4LT9A 1AW1A 3NZ1A 2VFEA 1NSJA 1NAL1 1EPXA 3NYZA 1K7EA 4NX0A 3S5OA 1AL7A 3UZ5A 2EHHA 4ALDA 4JXCA 3NQGA 5A5WA 3MBDA 1F7BA 1IIHA 1W5MA 1WBHA 1W5QA 1JQXA 4OV4A 3QEZA 1TV8A 4GXMA 1XKYA 1TTPA 4UTUA 4YLWA 1RPXA 4IX0A 3GAYA 5HUPA 3LCIA 4WOQA 1G4EA 1LTDA 2ABBA 4CCCA 3GKFA 1AK5A 3LTSA 1LM1A 4MPQA 3LTPA 3NVTA 4IXXA 3QC3A 1QO2A 3G18A 2JBMA 3D0CA 3WK1A 3KAOA 2C19A 4Z1BA 5I3KA 3WFAA 3HPSA 4O0ZA 1N8FA 3M44A 3B03A 3QPZA 2CLOA 5DBTA 3SI9A 1OG0A 3DENA 3FEMA 4AWSA 2VOMA 4R33A 1IXQA 2YPIA 2V81A 3EKLA 5EBUA 4BF9A 4S2BA 1P4CA 4DO5A 4UIOA 5HUOA 3EXTA 4RR4A 2PE4A 3E49A 4UFKA 5LZLA 3P67A 4M6PA 1RV8A 5J5RA 4ADTA 2ABAA 4NX5A 4ICNA 2BLEA 1HUVA 3W74A 1D3HA 1YPFA 3LRMA 5KITA 1M5WA 2X1TA 3TU9A 2V2DA 3GDTA 5C54A 4RCXA 1XI3A 3TX9A 1OX6A 3GK0A 4AF0B 2G95A 3B0PA 5U4NA 1GG0A 4NNCA 4LY8A 5KINA 2Y88A 2EF9A 3W7EA 3QW4B 3DFPA 2Y7DA 2X2GA 3OVPA 4QITA 2J6XA 1X1OA 4WX2A 2WQPA 4E0CA 4EF9A 1DL3A 4MZ1A 3PF3A 1Q6OA 5AHEA 5FF3A 2ZZ4A 5LHEA 3NQDA 6TIMA 3G0XA 1H63A 4I7UA 1PL9A 4JNMA 4Z08A 5IBXC 3IGSA 4IWWA 5D32A 4DPPA 4C1LA 1PS9A 2YGYA 3NPUA 3VKJA 1SZGA 3F1QA 3G0UA 4GUGA 1QCWA 3GZ3A 4ZMGA 4XQ6A 3UXAA 1H7PA 4JTGA 4PL1A 1NF0A 3GIYA 3CWNA 4I7VA 4O14A 3O6CA 2YFNA 5BW6A 4DBEA 1EB3A 4MJMA 2NUYA 1G7UA 5DCBA 4LVBA 5HWNA 5AHLA 3B8DA 2DORA 2YR1A 3NQ6A 2E1DA 4TIMA 4A2RA 4LVDA 2CLHA 5AOUA 3W76A 4PC8A 3KRSA 3A9IA 4Y6GA 3FJLA 2I14A 3TXZA 1OYAA 5G4WA 4O1DA 2RKXA 1EUNA 1T8XA 3P60A 2J9ZA 3L0GA 3C4UA 3BLEA 3NZRA 4C1KA 4WY0F 1MSSA 4YL2A 3W7PA 3WJSA 3ABQA 3O1NA 4NXKA 5AYYA 4GJ1A 1F76A 1QWGA 4UFJA 5DCEA 1EWEA 3UWYA 4FHAA 1GG1A 3DU0A 3BPWA 3LX9A 4O28A 1QOQA 4O13A 1RQBA 4OHQA 3OA3A 5BMWA 2DZUA 3W1TA 3QYQA 3SZ8A 4N9BA 2Q8LA 1TSIA 1AL8A 2ZZ1A 4HKPA 1TJRA 1LOLA 5FF2A 5I3IA 3RLUA 1EP1A 1VHCA 1SO5A 3M47A 5CGQA 1PIIA 2NXHA 3E02A 2GVGA 5K4ZA 1FWRA 2A7NA 2DZVA 3C2FA 2H3BA 4A21A 1S5TA 2FLIA 2XN2A 2B7OA 1KM2A 1YDOA 3W7GA 3IV3A 1DV7A 1QFEA 1X7FA 2Y7FA 5F2LA 3FS2A 7TIMA 1P0KA 4OV9A 4UUIA 2GVJA 3RK8A 5C5YA 1IXPA 4PL2A 4BWLA 3N2XA 4FIRA 1JRCA 1VS1A 1LLZA 4CQAA 1ICQA 2RDUA 2ZZ5A 5D37A 3LERA 1GVQA 5AHFA 4O1AA 3GX9A 4IMEA 3QH2A 4LWWA 2YFOA 3L9CA 1JUKA 4JDBA 2Q8ZA 1XBVA 4QAIA 5G1TA 2OX1A 3W1MA 1ALDA 1TPDA 1THFD 3LHTA 5D33A 1UUOA 2BXVA 4JTUA 2C15A 3EX2A 3KRZA 1KM4A 1W3TA 1GOXA 4LOCA 5BOOA 1XUUA 4J9JA 1Q45A 3OVRA 2DZSA 2Y62A 4TO8A 1DJQA 3BARA 4UTHA 2NX9A 3W7HA 4O1CA 2E5CA 1KFCA 3STFA 3IIXA 1Z42A 3UPWA 3P80A 1F2JA 2H6RA 2Z6JA 3BVJA 3CWOX 3INPA 3LV6A 3KVLA 2F84A 4ZQRA 3CEUA 4PH6A 4FNQA 4DO6A 3TC7A 4M6QA 3S42A 3Q2DA 2J27A 3LHVA 4JYDA 2A7PA 2Z0IA 3EWWA 5D03A 4Z1CA 3UWWA 1RQEA 1V7YA 4XZ9A 3FFSA 5C2XA 3G8RA 1LZOA 3NL6A 3S9YA 2DJLA 3UWZA 3IGUA 3NQ7A 3RMJA 2YYTA 4N2YA 4JTFA 5D02A 3HO8A 1GT8A 3K30A 4N4PA 5D04C 4MZ8A 3O05A 5AHNA 5DELA 3TSDA 3P74A 4QM1A 3Q58A 1K3UA 1H50A 3NPWA 1I45A 1LDCA 1F5ZA 3NPXA 3QRHA 2V30A 1GVFA 3MHGA 2A7RA 2ZRXA 1ZFJA 3BW2A 3OHIA 2HMCA 3M1ZA 3NQ8A 1BWLA 1WQ5A 1RVGA 2G97A 3ZFHA 3KVJA 5D30A 1W3IA 1VR6A 1W56A 2A85A 4UTIA 3JR2A 4KFPA 1TIMA 1XCFA 3O06A 3EX3A 3N3MA 1ME8A 1EWDA 4LV4A 3DFNA 3NQMA 4MJZA 1G4PA 1JCXA 3A22A 1T96A 3EEGA 1VCVA 3TAOA 3W3OA 1LOSA 1HL2A 4PA8A 4UXDA 3HGRA 1CX9A 2C14A 3CU2A 4N9EA 4CNOA 2R91A 1H7WA 3IVUA 2WSYA 3QM3A 4NJGA 4XTIA 1WYIA 5CG7A 1TV7A 2VENA 3NA8A 1FDJA 1F05A 4IX2A 5KZDA 5TBOA 4WD0A 4JTTA 4UCGA 3W83A 3EWBX 1ML1A
chains in the Genus database with same CATH superfamily
2ZUSA 4XD4A 3VMPA 1O95A 3WEOA 2W92A 3T6CA 3TC3A 2Y85A 4P5UA 2ZTJA 2CLPA 3G3MA 1W1TA 3FSUA 2VXNA 5LIUX 1WZMA 1A5MC 1J6PA 4GGHA 5DBUA 5K4XA 4K37A 4QLLA 3GG0A 3RITA 8TIMA 2HPMA 2PUZA 1A3HA 3TTSA 1EJWC 1SJAA 2DUXA 3KTCA 4ZQPA 4UTTC 5D8WA 1F74A 1H09A 3PBWA 3C6CA 4BK9A 2QJIA 1VYPX 1Z32X 2TAAA 4IJCA 1U83A 3ZJ7A 2XH4A 1KM6A 1JUBA 3AMKA 3S47A 3TUUA 1QJWA 5CJMA 1TR1A 2UZ9A 2J88A 4M19A 3VIPA 4D6FA 2OQYA 1XG4A 2NV1A 2YCIX 4UZUA 3QGAC 4QISA 3OP2A 4ML9A 1GVYA 2WBKA 1NARA 3CIVA 5I2UA 4MDPA 1OX4B 4KH2A 2OSXA 2AQVA 4E3TA 3TZNA 1GOQA 4GXPA 1R5YA 2W91A 4X9SA 4WSJA 3GD6A 3PSWA 1CBGA 1YNQA 3ONBA 5D9MA 3W7CA 5MKGB 1K9FA 4GIEA 3VZXA 3CIXA 1HXJA 4ZQOA 1RD6A 2JGQA 4RX0A 4Y9AA 3SIMA 5A8PA 1R3YA 1UD4A 2VKZG 3GDRA 3ZJ8A 1C8VA 2VQTA 4IQEA 2J6VA 4DEFA 4D72A 1SFJA 3ITGA 3AIWA 5A8GA 3I6TA 4P8UA 4JIIX 1GJUA 1UH4A 1ONRA 3FIGA 3QY6A 4C6CA 2ZXQA 1JR1A 3QW3A 2Q8XA 1QNOA 2PDLA 3AHTA 4HZMA 2WNNA 1GVEA 3BAXA 1NEYA 3TLQA 2VCBA 1ME7A 3S83A 3V5OA 1Q6GA 1US2A 3STGA 2NQ9A 2VO5A 2Y5JA 5A2AA 1VRXA 3IJQA 1POKA 3AQUA 1UR9A 2X41A 2BOFX 3MWCA 3W7RA 4M8UA 3VNDA 5CBIA 1AMYA 1QO5A 3LK6A 3S2CA 3NOEA 1E4IA 2XHYA 1EP3A 2PGWA 5A6BD 1W91A 1TREA 4AD4A 1SFSA 1XBZA 4B2DA 3R0KA 4F0SA 4QJ3B 4ZTXA 3L65A 3T55A 1XYCA 5AECA 1DJHA 3O8AA 5DQPA 1JF5A 3UQNA 2ZDRA 3HG2A 5DY2A 2MUCA 1ME9A 4ATDA 2YLLA 3FHQA 4DVOA 4IMAA 4AYGA 1C9DA 2XZ9A 3PG8A 4IIBA 2QR6A 2ZZ7A 4V2XA 4B5VA 4UQ9A 3B8IA 4KQNA 3L67A 2QDGA 2E7FA 5J04A 3PTMA 4H9UA 2BSLA 1CLKA 3N15A 1ZS2A 1B1YA 1YW1A 1EC9A 3CQJA 3STPA 4X2PA 3GSMA 5T9CE 2XFFA 2A0NA 3UA3A 2V0TA 1PUDA 4AWTA 2ISWA 2XSXA 1HFBA 2DH2A 3O6YX 2I57A 4QG9A 1LRTA 2V2CA 2FPYA 1QNRA 3T8QA 4PUMA 4O11A 1K9TA 3EZ4A 3B8WA 1EJVC 1PO9A 2IS7A 4UQEA 1PJ9A 3PHAA 4HA0A 4HZ7A 1EYWA 2ZICA 1SZNA 1XR2A 3VI2A 3ARQA 1SO6A 5K9DA 1V5XA 1I1XA 4CD4A 1BSLA 4ZOAA 3CZKA 2D0GA 2P76A 2YIHA 1C7TA 3NDZA 3HG5A 1Q6QA 1H7OA 5CSRA 2XU2A 4PMUA 4DJFA 1NOFA 4A3HA 2DZPA 2XIMA 4L6DA 5HNUA 2BG5A 3SY5A 1VRDA 3I4EA 5BXRA 4JTLA 4Q8OA 1KFLA 4L4PA 5REQB 1JCMP 1B3ZA 2QUUA 2WSRA 5I3DA 4HZ8A 4BY3A 2ZUTA 1MEWA 3HPAA 3WENA 3HOJA 5A6MA 3GIQA 3TFCA 4C60A 4RDWA 3W26A 2BX7A 5CPLA 4GFIA 4JIPA 3NQEA 5M1TA 3CZGA 1J6OA 1FX6A 1Q8AA 2ASHA 4PMOA 1DJGA 4O1EA 1V6YA 3DXIA 1J2WA 1JI1A 4YN5A 4R53A 1EXPA 4WGXA 3GNOA 3EWCA 3IIZA 3KL5A 4LYRA 3MI2A 1UWUA 5JU6A 3FLUA 3IWPA 2CZ5A 3KBVA 4J27A 3VUPA 3FJ6A 1P7TB 3VKBA 3FAWA 1IEIA 5DXYA 4Q6JA 3EXSA 4AD2A 5XINA 3AICA 4GQGA 4JBRA 1WOBA 4PSRA 1R3RA 1FWWA 1HKWA 3L4UA 4B2DD 5C2CA 4PRRA 5C2GA 3A23A 2VGBA 2ISVA 3RPTA 2QCGA 2VVSA 2JALA 1OT2A 1GVSA 2YL9A 3JRKA 3VXGA 3SR7A 1IZCA 3GXDA 4LAUA 3LGEA 4JAWA 2D2HA 4ASTA 4FOUA 1V7AA 2E25A 4BQ2A 1NTHA 1PCWA 3GW0A 3PBVA 4J1OA 4MTVA 3AUJA 3OO2A 3QOKA 3PZ9A 1GEHA 4NNBA 3IRSA 1G01A 1IR1A 4R34A 1BHGA 1TZ9A 3VKDA 1RY0A 2E4TA 5HPOA 3ARVA 4CCDA 1ADOA 3G1DA 1IWPA 2YDQA 2ZFAA 3C2YA 3W2LA 1NOWA 4MG4A 4OBSA 4I5RA 1I2NA 2XGZA 1XRSA 2G96A 2GJXB 5HR6A 5JVLA 1BXBA 1LG2A 3H70A 1GVOA 1W0MA 1BFNA 2MANA 1OX4A 2XISA 4X22A 1QW8A 5KMYA 5K9CA 3NCOA 4C6KA 3S1VA 3U7VA 1RBOB 1TV5A 3OVGA 4GZIA 1E0VA 3GXFA 5C6MA 5MKGA 4AW7A 3M0VA 1E6PA 1FFQA 2C1HA 1LYXA 1YHTA 1SZEA 3GHSA 1VIWA 1GJPA 2J74A 5A8QA 4LRTA 2PDBA 3LCFA 3MI6A 4HK6A 4GMEA 4WQ6A 3GE7A 1CLXA 2X1SA 2R1PA 3GAKA 5BU6A 3M07A 5L9FA 3GH7A 4C1NB 1RZMA 3AHYA 1EBHA 2A6NA 4UTMA 2QV4A 4DO4A 4EPKA 2CBVA 1IEXA 2CBIA 4MFEA 4QCEA 4PMVA 3F2DA 1N7KA 3C52A 3L66A 1A5OC 1A5CA 1JL8A 4XISA 1W6TA 1V02A 1K8YA 4WSHA 2CLIA 1OFEA 5CBJA 2ESCA 3LPOA 4Z2IA 3N2TA 3CV1A 3POHA 4QG6A 2VUYA 2R94A 3USZA 1OB0A 3L7RA 5LNVA 2WVUA 4H3DA 1SM9A 2ACQA 5G2WA 4DAIA 2EPOA 1GZJA 4RZ6A 4DX3A 4Q7BA 3HF3A 2PDXA 1Z44A 4OZOA 3SIZA 1JCJA 3AIUA 2WYSA 3DI0A 2C7FA 4JY8A 1A3XA 2H8ZA 4CNSA 1KQYA 1XCWA 1UR1A 4UTTA 3I7SA 5DMNA 1ODUA 5U7SA 5HINA 3QV7A 3BLFA 3PG9A 5F7UA 1W31A 5LA0A 5CLWA 2HJPA 4LC8A 2GGHA 1UMYA 4O19A 4CD6A 1I2PA 1X6UA 1OK4A 4M1RA 1HGWA 1IXNA 2W3ZA 1ZGDA 3QKEA 2FHFA 4S2CA 4ACZB 1XS2A 5F2GA 3NQFA 1RHCA 2Z26A 3GVRA 1ZP3A 5BXPA 5CC3A 1OYCA 2NX3A 5HNNA 3RN6A 1HKIA 1Z41A 4CD7A 1MQQA 1QRQA 2F8QA 3M0YA 1XDLA 4IMFA 3T44A 1XLBA 4URIA 1BPLB 3IIPA 3A5FA 2DVTA 4BQ5A 3BAYA 4L1WA 3A5VA 3JUGA 3GU1A 3T0CA 2I9UA 1S38A 3FKRA 3R6IA 5I07A 4Y8FA 1WKYA 2Z00A 4C6MA 4TVCA 4DXVA 1XH0A 4KCTA 3CYJA 5TD4A 5DT7A 4LRSA 4GRSA 5A6JA 4M3PA 4XKYB 5DFAA 1V0LA 2JK2A 3GNRA 1IV8A 1ZJHA 3PNZA 2D2OA 3M6DA 2YX0A 3P5ZA 2CNCA 2OEKA 2PWVA 5ECUA 4XZNX 4AQLA 4O1FA 3C2EA 3N6QA 4S23A 4LS1A 1UOKA 2ZVIA 2VFDA 3L23A 1NELA 5LYRA 1E4NA 2AL2B 2WKGA 4FALA 4HNTA 2V5LA 1C93A 4UMAA 2YSWA 3W07A 1Z69A 2W62A 5AC6A 2BXZA 1X96A 5REQA 1L2UA 5HR7A 1TWDA 3EOUA 3BG9A 4GQ0A 1E43A 3E0WA 3W2MA 3SSZA 3OU8A 4JZ5A 3W1RA 2REQB 5GJNA 3QC0A 4MHBA 4JN7A 3A6OA 3FXGA 4DYJA 4G9PA 3WF0A 3WQDA 3PTKA 4C65A 2PP3A 4DUWA 1TWIA 3UG3A 1GPWA 1UKOA 3T4WA 3T40A 2Z7KA 3ZWTA 1CNVA 1XGDA 4GH3A 1TZZA 3FOKA 3URNA 3F03K 4FO4A 2NZLA 1P7TA 2VCAA 1LBMA 5D9NA 3GW3A 2VWSA 3HQPA 4BJHA 4PMQA 1C91A 3LB0A 1QUMA 4HSHA 3T9PA 3H2NA 2VRQA 3AXHA 2P8CA 2Y61A 4JTKA 1DBTA 4QP0A 3BW3A 4DUOA 3SY8A 3RMEA 2NVDA 1HIZA 3B4UA 4RPPA 1IYXA 3AYSA 4JTIA 1JAEA 1KB3A 3UZJA 4MMWA 2RUSA 3S5SA 3VZYA 1W1A1 3FW6A 2VFIA 1NDZA 4H6QA 3STEA 4AZ6A 3E0LA 2GSHA 5HJYA 3EDFA 1NU5A 1Q8JA 4C90A 3WEMA 1KKOA 1XD1A 1VCFA 1WB0A 4QBXA 1I4NA 3V4BA 3G1VA 3PFMA 4KRZA 1WP6A 2ZRZA 2XSBA 7ODCA 4IHCA 2ICSA 2HS8A 5D2YA 4M6UA 4RDZA 1UC4A 2EPMX 1H60A 4CQ8A 4M80A 4Z2LA 2AKZA 4HU4A 4FMVA 3ZR6A 4EP8C 4HPHA 5DLCA 4O4VA 1OFRA 2B81A 4Q4SA 5A6TC 1UD5A 1T0OA 3QXBA 1TYGA 1IQ8A 5HULA 1XIDA 1XLAA 2PRHA 1KA9F 1KKRA 4HTBA 1E9YB 2CIPA 3BJTA 4J2MA 3WLTA 2O7SA 2FDMA 1QHOA 1KTBA 1I9CB 3EA1A 3LYEA 4TUFA 3S1WA 4JIRA 3M64A 1GGOA 5ABFB 3GHRA 1X97A 3TNOA 1ZNNA 1GQIA 1PE1A 5E6ZA 4F0RA 3AS3A 3U5UA 1PIGA 5FF4A 3TR9A 4JX5A 3BAWA 3C2VA 3B06A 5G5IA 2Y5EA 2YBUA 1H7RA 4A35A 5LSMA 3AWNA 4WJXA 4JFWA 1OCJA 1YQ2A 1FCUA 1R30A 4FXSA 3ZVHB 4C1NA 4A8NA 4GG9A 3OZPA 3H23A 2XTKA 5EPDA 4GWEA 1PWMA 1ZL1A 1NWUA 2QAFA 1TRDA 4GY1A 3HJEA 2OPJA 4AIEA 3HG3A 5LA1A 3IUDA 3VGFA 1HGYA 1FWFC 2YCKX 4MNMA 2C0AA 3M43A 5HANA 4O50A 4U31A 4K6AA 3EOSA 1EJSC 3PJUA 4NJHA 3CO4A 5IOBA 4ZTYA 2DZTA 4Y9NA 3RF9A 2FZ8A 1RJPA 3BQ5A 5BWFA 1X8FA 2PDMA 1L6GA 1MW2A 4TXEA 3KOXA 5CPNA 1DE5A 1EHNA 1AD1A 4BR1A 3G1HA 4J3ZA 5AYZA 4CNNA 3S5YA 4NT0A 1UIPA 3LHYA 4S39A 2H9AB 2PGRA 3MUCA 2ZXAA 3CTTA 2ODOA 1ZZMA 3W23A 4QSHA 1WXJA 4QS6A 3WH5A 1SW3A 4ZODA 1BYAA 4MVAA 3SGUA 3W86A 4QTGA 1CYGA 1KFKA 3QR1A 3CH0A 3KBSA 3E5BA 3DDMA 5KZ6A 2VI0A 3W53A 4HPXA 1REQB 1PKMA 3B97A 2ZC8A 3L2IA 4RK8A 1OFAA 3OBEA 3J7HA 3QKZA 1EO7A 3ZJKA 2H8XA 3CB8A 1MFVA 1O4UA 4G56A 5I7GA 2VEMA 1EGZA 3TNBA 3W01A 2WZMA 3ITLA 1F3XA 3ITOA 3QZ6A 2GUYA 4PMRA 1OZMA 3GXTA 4EWJA 4PEEA 1U2YA 1MEIA 5D2VA 3ISIX 3VNKA 1WUFA 1E6ZA 4KWUA 5T26A 4HK7A 3A4JA 2XN0A 3QTPA 1KBJA 2ZE3A 3DECA 2E9BA 4NRSA 5J8LA 3PPCA 4WSKA 3MHFA 2C6QA 1I2RA 1TTIA 3F4WA 3UVIA 1IEVA 4F9JA 3W7OA 3N73A 4XKYA 2Y2WA 2CU0A 2XVKA 3OPSA 5LIKX 3SGGA 4W86A 3VU2A 3Q4DA 5A6LA 1E0UA 2UBPC 5AYIA 1LT8A 1WDSA 3H4GA 5LNSA 4HOZA 2Q02A 4JX6A 4X61A 4AXNA 2A2IA 2NWRA 1SUXA 4U4MA 5I24A 1GKPA 1Q6CA 2AL2A 2J7DA 2FJKA 1E40A 1I1WA 2ZC1A 3T08A 4BEQA 4QDWA 4QQ3A 4CQ9A 4FF7A 1CWYA 1D3CA 3OODA 5AYXA 3S3GA 2REQA 2CLFA 2NXGA 1XGEA 4KPLA 2GJRA 2QV5A 4S3DA 4Q8WA 4JTCA 3ZOAA 4GZEA 4H19A 4ENLA 3W71A 2GJLA 4LBSA 3MMWA 5FJIA 1L0PA 2YA2A 3QZEA 4WEVX 3W37A 5BRBA 1EH9A 1ZJAA 3SQLA 1GTEA 4PTNA 5CSSA 4QJ1A 1DJWA 4OUIA 1QT1A 3U8GA 2GPTA 1NP2A 1JPKA 3P5YA 4PUNA 5D05A 4D6CA 1XKJA 4NZ3A 2VTFA 3CHDA 1FQ0A 4AWEA 2ZADA 1IEQA 5K3VA 3HV8A 3NXFA 4K68A 1BEUA 3HTWA 1LORA 1TA3B 2HS6A 1ZCCA 2CHNA 1R3VA 1D3GA 3BUVA 1L6FA 1H11A 3KWSA 1ELSA 2LLEA 1BVNP 2WHLA 4QS5A 4JIHA 4WJ8A 1VYRA 1YDYA 3V1HA 1AQMA 2JF6A 2V2HA 3CH9A 2GJNA 3C2OA 3WLIA 2SFPA 3VD3A 1EF2A 2WVVB 4BI7A 2E5DA 4R85A 2XIOA 3EDDA 4Z2GA 2PLCA 3TYBA 3WLHA 1E55A 1JD9A 1HKVA 5LNRA 4JOMA 1E5NA 2V5DA 3WK0A 1H1NA 2VR5A 4S1FA 3O0KA 3U48A 2HE5A 3UYCA 3EPNA 1PZ2A 1XIBA 3E0IA 2XM2A 1K02A 2QS8A 4KCVA 2FVLA 2VZUA 5IFTA 4LF2A 3GR4A 3WCZA 1JCYA 1RLCL 3P82A 4MB4A 4QE5A 3K8MA 4JHZA 3W1AA 3WLRA 4H9TA 3HU7A 1NQ6A 2DEPA 3ABOA 4V28A 4Z2HA 2PEVA 3U57A 3VNJA 4DI8A 3UZ5A 4MM1A 4ALDA 4JXCA 5A5WA 3CMJA 1SFTA 4XB3A 4YVXA 1W5QA 3KBMA 7TAAA 1P1MA 5GNYA 4DZ5A 3ZVHA 1TV8A 3NZQA 1M68A 1MYRA 1XLMA 3V5FA 3GAYA 2P53A 1UIOA 3CXOA 3LCIA 1G4EA 1LTDA 3GC5A 3GKFA 1QI0A 1E4MM 4OTKA 2JBMA 4GO9A 2O4MA 3WFAA 3M44A 1GNXA 1UQZA 2CLOA 3SI9A 2POZA 1OG0A 2VOMA 1O6IA 1P6BA 1W3HA 4NASA 4JQ4A 4D8ZA 2V38A 4CN6A 3IK2A 1J93A 2H9AA 4V27A 4HNOA 1RV8A 1UPMB 5J5RA 4ADTA 4NX5A 1OBAA 1CXEA 2A3BA 1M5WA 3VMNA 4GK8A 4RCXA 5C54A 4GH1A 2GK1B 4XZBA 2R82A 2PDKA 3GK0A 4GCAA 1DIEA 4AF0B 1LQ0A 1DWAM 2G95A 5U4NA 4TV6A 3CB3A 1BF6A 2EF9A 2FFIA 3W7EA 1R87A 2Y7DA 3OVPA 2VD9A 2J6XA 4E0CA 4C6OA 1G1YA 1Q6OA 2W27A 2ZZ4A 2V3FA 4DZAA 4I7UA 1PL9A 2J66A 3ZQ9A 3N13A 4IWWA 5D32A 2ACRA 2WK2A 1Q4NX 1PS9A 1TIWA 1W2PA 2R24A 3NPUA 3VKJA 3RDKA 1SZGA 3TN4A 4P7RA 3CJPA 3GZ3A 4ZMGA 3WQEA 4JCLA 3ZSSA 4QXIA 4XIMA 3UXAA 3VILA 3VVGA 2VC9A 3AYRA 4HD5A 1EHAA 1C8XA 2YFNA 4PUDA 4MJMA 1F3TA 1V6UA 5DCBA 1RY8A 3R58A 2P50A 2YR1A 3NQ6A 2E1DA 2WMKA 4A2RA 1RLDA 3CT2A 3TLLA 3W76A 3A9IA 1QVBA 3FJLA 3PZUA 1YNPA 1ZUAX 4O1DA 4DXXA 1FHLA 1MFUA 3P60A 3L0GA 3NZRA 4WY0F 1MSSA 3WJSA 1AZ1A 3FJNA 4L5ZA 5E70A 3CZEA 1RA5A 4UFJA 1JZ2A 3UWYA 4FHAA 1TG7A 3SAZA 3KBWA 4O13A 3V16A 1RQBA 4IGNA 4FF5A 2JEPA 5M2FX 4KIEA 3SZ8A 3LLXA 3UG4A 2Y5SA 1TJRA 1V02E 1QPKA 4IL2A 5I3IA 3RLUA 5T91A 2XWEA 3S4TA 4GO8A 1PIIA 2NXHA 4L9XA 3E74A 3MA8A 1HKJA 2DZVA 3C2FA 5E9XA 5KETA 2B7OA 1KM2A 3ITXA 3T09A 4J40A 1DV7A 4AY1A 4MPKA 1QFEA 4OV9A 4PN2A 3F7JA 2DH3A 4ZB2A 1XIHA 5B80A 1VS1A 2D23A 1LLZA 1HVXA 1ICQA 4GX8A 4PBFA 2ZZ5A 5D37A 4GY0A 1TE1A 4O1AA 2ZX9A 4YYFA 3GXMA 1CB7B 1UPPA 1VPYA 3MSDA 1THFD 1KCKA 4L61A 1UUOA 4ECLA 3OYZA 1QBAA 2OZ3A 4KW2A 1W3TA 3OQEA 1GOXA 1XUUA 3KRBA 4J9JA 1CXLA 1Q45A 2DZSA 2BHZA 2DQWA 1QHZA 3I3DA 4R9OA 1Q6DA 2A3AA 1F61A 4O1CA 4DWSB 3QV9A 1M1BA 2VMFA 3P80A 2FHCA 2ZOXA 3II1A 2QGYA 1TA3A 4I5XA 4FNQA 4DO6A 4YNGA 2J27A 2A7PA 3EWWA 5HDRA 4Z1CA 2A79A 3LM3A 4XZ9A 3FFSA 4IQDA 5C2XA 1ZRQA 4B9YA 5JH1A 1E9ZB 1IEWA 1DTUA 1J11A 2WVVA 4PMZA 1AODA 4U5KA 2G3MA 2YYTA 4N2YA 5D02A 1TCMA 3E2VA 3T05A 3REQB 2YB4A 4N4PA 4R7OA 3KWXA 1I6NA 3P74A 4QM1A 5IXEA 4ERAA 1I45A 1F8MA 1F5ZA 4JFUA 2BY0A 2V30A 1GVFA 5XIAA 2A7RA 3T0DA 1LWHA 4S3KA 2KX9A 2ANUA 3PPFA 3RO6A 2Z2BA 3PZVA 3AHXA 2D1ZA 4KFPA 1V3MA 3EX3A 2PGEA 3IJ9A 3DG6A 2RGMA 4GNKB 1XLJA 4MJZA 5JIPA 1JCXA 3CL8A 2PDGA 4RDYA 3WF4A 3EEGA 1IT0A 4KBXA 4P7LA 1XP3A 1CX9A 1LL4A 3AIBA 4N9EA 2EPLX 2VDHA 4L6OA 5CG7A 1TV7A 5CBBA 3U2ZA 1QOXA 2QW5A 1F9CA 4I3GA 4YPJA 4ZA0A 3H2FA 3W83A 1PAMA 1RCXB 3DGRA 3M4HA 3VGEA 4IIFA 4XSLA 4HYRA 1VCGA 1GCYA 5ABTA 3LBOA 4S3JA 1R38A 4IPIA 9CGTA 3FA4A 5FAJA 2V68A 4ZB0A 3BCDA 4KWWA 3IEBA 4ROPA 1OJXA 2F6XA 3HURA 3SUSA 5BNKA 1TTJA 2XPKA 3ZT6A 1XXXA 1UZHA 3GR8A 3SB0A 4WY0B 4CCZA 3KDOA 5JUVA 1XV8A 2OWWA 4HOXA 2HQAA 3UWQA 3TQVA 5TNVA 3QFEA 4LUYA 2CZVA 4H2HA 2VP8A 4ZL1A 4C6EA 1P48A 2WVSA 1IWBA 3IJIA 3FYPA 3EA3A 3RM8A 6XIAA 2G3NA 5FJOA 1XL9A 3M7WA 4LY4A 1A0CA 4FX8A 7XIMA 3TVAA 5HWJA 4X63A 4MLRA 5D38A 5LHFA 4Z2JA 1EC7A 3NFUA 3WSUA 2OMAA 3WLMA 4AF0A 4NAEB 3LCLA 4R7JA 1S2CA 1RUSA 3E3HA 3MSYA 4NP7A 4XO7A 2BV9A 4FR1A 3URAA 1QI2A 4TVDA 3KCOA 3KOWA 4EANA 1DORA 3QGVA 2QAPA 1EJRC 4OIFA 2PWFA 4GYJA 2B7PA 5DRCA 4N9CA 4ROQA 1UKPA 5BYWA 4AD5A 1AQHA 3PY2A 3CMGA 3NAVA 3ARXA 4ZO6A 1FWAC 3AMLA 4GVHA 2CERA 3MMDA 5CPTA 5FIPA 3LGDA 4M5PA 1RH9A 2IPFA 3ZLHA 1ZAIA 1P43A 1A5NC 1PEZA 2CLMA 3KBJA 3MMUA 5TIMA 2DSWA 1EA0A 3VKKA 1A4MA 2X09A 1GQNA 3CQKA 1G94A 3HFTA 4HHPA 2FTWA 3GVQA 3PBGA 1HT6A 4UMBA 5C7HA 2QLYA 3FA5A 1YNYA 4H41A 4C91A 3MO7A 2O9PA 3RGTA 1QOPA 1FOBA 3K4AA 4RE0A 1SZFA 3IS4A 3EX1A 1HX0A 5CSUA 3W9ZA 1H1ZA 2TRSA 5JBEA 1UR4A 2OGJA 1TX2A 4ATWA 3KXQA 4GACA 1ECQA 1GQJA 3I65A 4Z0JA 2PTYA 2QDHA 1W9UA 1ZCOA 4HN4A 3DHUA 5CH9A 2F61A 1OFQA 5A6KA 4N0RA 4IQJA 3WL1A 1FWDC 1UUMA 2ZRWA 1FWNA 1FHDA 2KZHA 1KTCA 3ZLFA 3O6DA 3EPOA 1JDEA 2GL5A 5I3HA 1SW0A 1WDQA 4LBRA 2J77A 3M5ZA 1EGMA 2FYMA 1W9XA 2PDUA 1BQGA 4KIRA 4PRWA 2E6AA 4AD1A 1ISVA 3K8LA 1OQFA 2FPVA 5EB8A 1B9BA 1LROA 2YCJA 4BKNA 2ZWZA 2TMDA 1OD8A 3A4AA 2AOSA 3N17A 2WJFA 1B3VA 5H6HA 1VJSA 1OFDA 2J25A 2OEJA 2WOQA 4GBDA 2XG9A 3S1UA 3WMCA 2HV5A 5LNUA 4X60A 4DWSA 3B8TA 3P7YA 4J3TA 4LQ1A 3LM7A 3GNXA 4Y2WA 2EKCA 4G7EA 1KXVA 3ALGA 2PFHA 1XLLA 4K3ZA 1H41A 2P3ZA 4FAMA 5CZ0A 3A3HA 4PMYA 3GH5A 2DSUA 3MPGA 1XLIA 4WDWA 1N8IA 4CKQA 4A3QA 3S5ZA 4YTRA 1Y5VA 5T9BG 5GNZA 2NT0A 3TC6A 3REQA 3FGCA 4GJJA 1PX3A 4AVOA 2ATSA 1W9DM 1GW9A 3UJ2A 3BLOA 3PWIA 3RXZA 3LDVA 3BOXA 3P84A 4QHRA 1SJDA 2FZBA 3B9EA 3WQ5A 4IG2B 4RJEA 3EEZA 4GI9A 4LTSA 2YL6A 3DHFA 1U33A 3UR5A 1WDDA 2J7GA 2ZQ0A 5XIMA 3LU2A 1AW2A 2ZKMX 1Q7MA 3SN4A 3VPLA 3W6LA 5KZMA 3W2JA 4AHOA 4AZHA 4MAVA 5HQMA 1W1ZA 4B5NA 2ZUWA 2YDAA 3W1NA 1OF6A 2ZE0A 1Y65A 1XC6A 2L5HA 1SPQA 4UNKA 2V3EA 3THCA 3GDKA 2VDIA 3CPGA 3PPGA 2DSKA 4E38A 1SO3A 3OQ8A 4GFSA 3UY8A 4YU1A 1PYMA 4IL0A 1HO4A 5IDZA 3L21A 4ZO7A 2INEA 3E38A 3TAKA 3CHCA 2OODA 2ZZ6A 3VNIA 2P1FA 2QCEA 2YLAA 4UTWC 3PAOA 4JTQA 3TTEA 4E4UA 4W84A 1VIZA 3SEPA 1I0DA 1IGWA 4Z0SA 5FAGA 1GYNA 1KQZA 1K8ZA 1DJYA 4PTXA 3BGJA 2VJXA 2E0PA 4KT2A 1TPFA 1ZP4A 1XH1A 1S2VA 4ZB5A 2ZCGA 4WY0A 3RRAA 3S5NA 4AWUA 2YJQA 4UTLA 1KGWA 3N9RA 5DXXA 4AEEA 3EKGA 3R5EA 3TN3A 4IPJA 2WPGA 4A3UA 3UU0A 3QQ1A 4QG8A 1W2VA 5FEPA 4L4LA 4O12A 5L6UA 4QNWA 1TO3A 3F2CA 4D6EA 3KTXA 2GUUA 4UR8A 1OZQA 2C16A 1LUCB 5HQEA 2NLIA 3SCSA 1Z9AA 1UZDA 3B0VC 3W1UA 2HTMA 3ALFA 3ENLA 1VJIA 1UKQA 4NAEA 1H51A 3ZMRA 3QQ0A 4F4RA 1KM3A 4HGXA 4L1GA 1SU5A 4K38A 2GWNA 4P8XA 1DXEA 1Z7AA 2HNEA 2PPGA 2QCMA 3A4XA 3TIMA 4DWSD 1BYDA 3HN3A 4LVFA 1YDNA 4LC6A 4M7SA 3JVAA 1EBGA 3HPZA 4IOTA 5H8PA 2WAGA 1M53A 4MY9A 4CVWA 4NRRA 4X2RA 2EG8A 4NZ4A 3UR8A 4XTDA 3RM9A 3MWAA 4LYKA 1MZRA 3ITTA 3CIWA 3LGGA 3LY0A 4JKMA 4CD5A 5GJMA 1WAWA 1G4TA 2DIEA 1OVDA 4O4WA 3T0AA 2FB2A 1OGSA 1G0CA 4ZGYA 1CGWA 4U33A 3BO9A 1W32A 1ISWA 1H0IA 2XH7A 5CSYA 4IJBA 1UWQA 1JD7A 1TPUA 3PZQA 2Q6ZA 3GBDA 5AC5A 5CAKA 1NQKA 2YB1A 3QJAA 2CLEA 4E2BA 5JIWA 1GKRA 4LUJA 3KEHA 1TV2A 3U0HA 1UUQA 4CNUA 3G0SA 1Z48A 3MP5A 1BLIA 2EG7A 3FNDA 4V1XA 1UBPC 2FIQA 4AH7A 1XFCA 1G4SA 1UR0A 3B04A 4I9MA 4WJEA 4NZ5A 1Q65A 3V1PA 3IRDA 1E0TA 3LQLA 3VD4A 5H1WA 5M17A 1R7OA 1IT7A 4NF7A 2ACSA 1HQTA 3AALA 5FACA 4LYPA 1UZ1A 3GG8A 5LA2A 1UASA 4DELA 1JYVA 2GDQA 2F6KA 4B4HA 2TPSA 4WCJA 4F8XA 2YXGA 4D6JA 1WX0A 3SCOA 3EWZA 2QEZA 1B31A 2X42A 4JIQA 4LVGA 4U28A 1UP2A 4KWSA 3CTLA 1J10A 4UB9A 3A21A 3ZO9A 3SRFA 4NKCA 3PZGA 9XIAA 4FPSA 1TQXA 5DMLA 1A5UA 3MS8A 4M24A 4ZO8A 3SCQA 1N8WA 2BVWA 4AC7C 3WJYA 3A3WA 1UCWA 1HKKA 1Y8BA 2C18A 4HMCA 4A8RA 4RLIA 3NOYA 4W5ZA 4LFYA 2V67A 3VNMA 2CWNA 3BE7A 3W7DA 4IUOA 1JULA 3VC6A 3TW9A 1H5YA 1NH6A 2FZMA 2BZNA 1CXFA 3NL2A 1C3FA 1GZGA 3PZMA 3CHFA 2ISDA 1IZJA 3VIOA 3NXLA 1XSJA 4LUIA 2XFYA 1J79A 1JFHA 5JXQA 4PRTA 4K1WA 4PCPA 3UR2A 3FSTA 3IVTA 3OG3A 4A3YA 3G3DA 3ARPA 4JFSA 1MZHA 1AQFA 3VIGA 1DYSA 3GVGA 1AUSL 3CC1A 3RCNA 2WMGA 1KC7A 4IIGA 2Z2AA 1ITQA 1RAKA 3EGJA 2G3JA 3ONCA 1X7IA 4GNJA 5LGXA 3QMRA 1FXQA 4IG2A 4EF8A 3CHEA 1JCNA 5AVHA 4MAZA 2VZVA 1ZLPA 3UVAA 1V8EA 3ZR4A 3EYPA 4R9XA 4N42A 1DXFA 4YMZA 6ALDA 3W82A 4H1ZA 1UD8A 2EPHA 1PZ3A 1OFPA 3A24A 5EY5A 1J5TA 2Y8UA 2VFFA 4AU0A 3QHOA 3KLLA 4C6BA 1SJCA 3TJIA 4MOZA 3UPBA 2O7QA 1GQLA 4F2BA 3P0XA 5LGZA 1BWKA 3AYTA 5GVJA 5SWUA 2GDUA 4HU3A 5F1UA 3IGXA 4KEVA 2WNQA 4TR9A 1OSEA 4P7QA 3S6OA 3E12A 3MI3A 3W2KA 2QCDB 3HB9A 1LT7A 4C6FA 2ATMA 3WQWA 5AC7A 1GWJA 5AZ0A 1EQCA 4XX6A 3LXBA 2WCSA 3VM5A 1AJZA 3RAOA 4PE8A 3ECQA 4OBRA 2B7NA 5B7YA 4ERIA 1K7XA 3BLKA 1R3SA 3VFLA 3F4CA 1GUVA 2GUBA 1XRTA 2XYLA 3LPGA 2F2KA 4YTUA 2EJ1A 1VFHA 3HBLA 2INZA 4FIQA 3VCRA 1ZBVA 3GZAA 1OHLA 1OABA 3DFTA 2AQWA 4EWND 2EBNA 5E9AA 4ZZ9A 1TPEA 4LBUA 4MNLA 1NF7A 2GVEA 4N02A 1XH2A 2FTPA 3WK3A 4DF2A 4YTQA 2OWXA 4GISA 1S5WA 4B5WA 2V82A 3LXAA 4HP5A 4QGCA 3URBA 1OK6A 4CNPA 1MNSA 3WQOA 1LWIA 1OFBA 1UWRA 3CMFA 1BAGA 2GGIA 4IGSA 1LLOA 1JQVA 1LUCA 1MW3A 3N4FA 1O60A 1M04A 1GOIA 4YIWA 4LH8A 1F6KA 5F2MA 3QPYA 5KEZA 3MV11 2FGBA 3KCLA 5HPCA 1FWIC 1I8JA 3N2BA 3LPFA 2DT1A 3D3AA 5CZTA 4RE3A 2B4GA 2WC7A 4YTSA 3IJ6A 1FHUA 4C6LA 3OIHA 3FEQA 4L7ZA 4GQRA 4QR6A 2GVLA 3HPXA 3A64A 1MDRA 1UJQA 3S9ZA 2J9YA 4A22A 1JNEA 4DJFC 4LALA 4FOJA 4DBSA 3CUZA 2CZDA 3RCYA 4UWMA 1FDYA 4XAPA 3WH6A 2XSAA 3IAPA 2OEMA 4I9TA 1WKDA 2ZDSA 1GYLA 2NQ5A 2G5WA 1XF0A 4HK5A 4B90A 3PUGA 1YXYA 4YWSA 3LSBA 4H6EA 1AG1O 5C9XA 5A69A 4U3AA 3CO8A 3EKZA 4NJKA 3V3WA 5HMDA 2OLHA 1R47A 2VM8A 3PULA 3WK2A 3P81A 4BQ4A 3R11A 3DIPA 3DFQA 2IXUA 4UTWA 3WNOA 2D2GA 1L6WA 3VCNA 4B5UA 2Z24A 1ZU8A 4IGMA 2GQ8A 4R5EA 4O54A 1YBQB 2MNRA 5E1QA 4FNRA 3VOHA 1RPKA 4KETA 3LHUA 1XIMA 5FSEC 2EO7A 3L0KA 3M5VA 3E0FA 1M9HA 3W70A 4DWDA 3MO4A 1VQTA 1UR3M 1P0NA 4J3WA 4CU6A 4HA1A 3IIVA 5CPOA 5A8MA 3THDA 1EZ2A 4J3XA 2AL1A 4K7YA 3N18A 2PLMA 1ZHAA 3RX3A 3SW6A 3PB0A 4IZGA 3PJWA 3GH4A 3U4AA 3DX5A 4L56A 4R27A 4RNJA 1LRQA 3VOCA 2R1NA 1RD5A 3R0DA 3B3DA 1CXKA 4WKFA 4GYFA 3WJZA 3ZWSA 3DAQA 4EIVA 3GG7A 3AS1A 1BD0A 2WKJA 1E6QM 3SBFA 1V3LA 1YX1A 1XYBA 5C8BB 4FA3A 3O15A 1F4AA 1I2OA 3MU7A 4XZHA 1A5SA 3R1ZA 4XAYA 1EJXC 2X1IA 1R2TA 3UESA 1W5NA 1QMLA 3EX6A 4ZSTA 1OFOA 4Q8PA 4HJWA 1EYEA 4XK2A 4E2DA 2OR2A 4RL3A 2YYUA 2DFAA 2DJXA 2TSYA 1M6JA 1TQJA 1Q5MA 2HSAA 1OCQA 1Q6FA 1J5SA 4FNPA 1PB0A 5F4WA 1U5VA 3W0KA 3O7UA 3VIKA 4HSOA 3VIJA 2CWXA 4ZE5A 3EXRA 1GTHA 2XJ7A 2WLZA 1VBRA 2A21A 1SFLA 1MVYA 3KW3A 1O1ZA 3T78A 1G5AA 3MYOA 3RPDA 3O16A 1V03A 1E9IA 1JIBA 3LCWA 2FMOA 2CLLA 1WAUA 3CQHA 1L8PA 1TE6A 1F73A 1XLGA 4Y7EA 3SM0A 3VGHA 1PCKA 2QT3A 4GJIA 2PF0A 4EVZA 1PWLA 2HROA 1JXJA 1XWYA 5BWAA 2RDXA 1LOQA 2QCLA 4AHPA 5AZ1A 5KTLA 5EMUA 4L6HA 3BGGA 2XM1A 2WWCA 4MFDA 3NEHA 1F6PA 2DZWA 3EOLA 4PCTA 2CZFA 2Z28A 3CZ8A 3WH8A 4L1XA 4TVUA 3U2OA 3F4NA 2GYIA 4I5UA 4KRTA 1E9LA 5G2IA 5E0KA 3N19B 4DO7A 3L5MA 1XLCA 2PDNA 1XUZA 3FY1A 5D2WA 3H6OA 3CAQA 1Q7QA 2QCDA 1CGYA 1PKYA 1A0DA 1XLFA 3EWXA 4CQCA 4LB3A 5BRQA 3OLIA 1M7OA 4DY1A 2ZXBA 4GQBA 4DLMA 3KRUA 2NVAA 2Z1SA 4JX4A 3NSMA 4NNAA 1HNYA 1KNWA 3WNMA 3MUY1 1VYSX 2V5BA 3TQKA 1J0IA 1VGAA 4GIRA 3CLMA 3GDMA 3WNKA 3EX4A 2E9LA 3JZUA 3LLFA 3S9IA 3LENA 3MBFA 4AUBA 4FX7A 5EBAA 3N3TA 4RXFA 3B9AA 2VEGA 2VX6A 4J4KA 3BCFA 3MCNA 1UD3A 4QEHA 2OWCA 2HK1A 1KM1A 4LX4A 3UXIA 3GFXA 4GABA 4J3VA 3TJXA 1W5OA 5I77A 1V4YA 3SRDA 1A5AA 4PFMA 4U2ZA 3M5XA 5PTDA 2DV0A 1LRNA 5CKSA 3N12A 4WDXA 4BI6A 1YTEA 1R46A 5BOEA 2WM0A 1Q63A 2PSNA 1EQPA 1R9YA 1LCOA 1YIXA 3WQGA 1BGGA 1R2RA 2XN1A 4F79A 3LRKA 2W9MA 1OWQA 2WMJA 1XYMA 3ITCA 3TCEA 2CBUA 5HBFA 3TFXA 3LS9A 1U1HA 4PUWA 3P2VA 3BG3A 5I03A 4S3FA 3QGKC 1DJXA 2W61A 2CETA 3ITYA 3NQBA 1KR0A 4B5SA 2YBTA 4JFVA 4WKHA 2O9RA 2OXNA 5C7VA 3AJ7A 1K7EA 4OOUA 4NX0A 3VAVA 5FJPA 3E2QA 1RA0A 2D24A 1F7BA 1X38A 2YBVA 1IIHA 3ORWA 1W5MA 2HEJA 1JQXA 5A1AA 1CDGA 1K9EA 4UOZA 2WJDA 3WNPA 1B0IA 3PK7A 4HJFA 1RPXA 4IX0A 4WOQA 1B54A 4GHRA 5LXEA 2ZUNA 1GK8A 3NVDA 1LM1A 4MPQA 4XSMA 3AFBA 3LTPA 4IXXA 1QO2A 3G18A 4HTYA 1YPXA 3WK1A 4Z1BA 4M29A 5I3KA 4IT1A 5IHSA 1RK6A 4FXFA 3DENA 4AWSA 4R33A 3L4TA 2BVTA 3B8VA 2VZTA 1IXQA 1JEZA 1P4CA 3QBUA 1YBQA 4DO5A 3CGTA 5HUOA 1B3WA 1GKQA 4RR4A 3E49A 4PMNA 3W27A 3LQGA 4DXKA 4HNCA 4P8VA 3CPUA 6PTDA 2BLEA 1D3HA 1YPFA 3LRMA 5KITA 3MCOA 4CD8A 3WBXA 3TU9A 1LL6A 4AISA 3SCPA 4RDVA 1GG0A 3EDJA 4LY8A 1ITUA 4BS0A 4E5TA 1WKEA 2Y88A 4BQ3A 3GRIA 2DGAA 4AY7A 3SURA 3BJFA 4EF9A 3VDAA 4MZ1A 4RUBA 3PF3A 3WUEA 3RILA 5HXMA 6TIMA 3G0XA 1H63A 3RO8A 1ZSXA 4UOQA 1NIUA 3NYDA 3IGSA 4H9VA 4AIUA 3ZLGA 3KOYA 4LUTB 1UP0A 3T2OA 3UWEA 1VBHA 3G0UA 1QCWA 3VGDA 3BSGA 3SADA 3S6TA 4S3CA 3K2GA 3CWNA 1W8GA 4O14A 3WMLA 1PXGA 3XIMA 1XYZA 5JQ9A 1TVPA 1CGVA 1X1NA 3TOYA 2QPXA 3B8DA 4TIMA 1ADSA 2CLHA 5AOUA 3KRSA 1E6SM 3BWWA 2YCLB 5G4WA 3AS2A 4KEUA 3WQ6A 2C8NA 2J9ZA 4C1KA 2J7FA 2A3LA 4YL2A 4QAWA 2OOGA 3EDEA 2NQZA 3ABQA 5ABEA 3APGA 3L4VA 4IFKA 5AYYA 2A3HA 4B3ZA 3WEZA 1EWEA 3BPWA 1DIOA 4O28A 3EMQA 1QOQA 4G8TA 1S1RA 1NJJA 3R8HA 4AZIA 4OHQA 1PDYA 3OA3A 5BMWA 2XH0A 3VIHA 3W1TA 3VFCA 4N9BA 2Q8LA 1TSIA 1AL8A 4HKPA 1EP1A 6ENLA 1US3A 1VHCA 2ON3A 2Q71A 1SO5A 1V3JA 1V51A 1MXGA 3WLKX 3MKCA 4JTAA 2FLIA 4F48A 3THUA 1J0YA 1YDOA 3IARA 3EBVA 1NDVA 1WUEA 3QV8A 4PZVA 7TIMA 1MW0A 1V6VA 1IXPA 4BWLA 3CAWA 4DUVA 3UW6A 2ALRA 4JN8A 4REQA 3CAKA 3VOIA 1BVWA 3LERA 1H4PA 1GVQA 2G3FA 3FYYA 1CXIA 1ZBWA 2VCCA 5I06A 5IDIA 3L9CA 1JUKA 2YZ5A 1XBVA 3NSNA 5G1TA 2OX1A 3W1MA 5D33A 3O3RA 5BXTA 1EO5A 4IIDA 2DSZA 3EX2A 3SCWA 1DJIA 1KM4A 3KRZA 3NO3A 3AUOA 1F3WA 3H24A 4AMCA 3WD4A 2Y62A 4TO8A 2EPKX 3SQMA 1DJQA 3BARA 2NX9A 1FH7A 2E5CA 1KFCA 1F2JA 3IUIA 2H6RA 3BMVA 3O6AA 3ZM8A 3CWOX 3INPA 1R7AA 2QGHA 2F84A 4ZQRA 4PH6A 3TC7A 3S42A 1UH3A 4JYDA 5D03A 2BMBA 1L2QA 4NG3A 1J96A 3UWWA 2WHKA 4DYEA 1RQEA 1V7YA 2PWDA 1NOUA 4IH3A 1XCXA 3G8RA 3NL6A 7REQA 2WW5A 2PTDA 3RMJA 4Q7IA 1GT8A 1UKTA 4HQVA 4US6A 5D04C 1W9PA 2AGTA 4QJ4B 3OZOA 3NPWA 3CAVA 4DJEA 2INFA 1PSCA 3NPXA 4IP4A 3BICA 2X8RA 3QRHA 1BXCA 3MHGA 2ZRXA 1ZFJA 1K6WA 3BW2A 3TZFA 2HMCA 3DUGA 3IJ8A 3M1ZA 1E6NA 1W1PA 2HVOA 4XO6A 1WQ5A 2G97A 2VL4A 4M0XA 1E70M 4UTIA 3Q67A 1XJBA 3JR2A 2HVMA 1XCFA 2VDGA 5CZKA 4V1YA 1EWDA 4LV4A 1DXIA 3DFNA 2AQOA 2HE8A 2EKGA 5GQBA 2QDEA 5D9PA 3CL6A 3A22A 2I5IA 1VKFA 4C6QA 1HL2A 1DHKA 4DJFD 4DJDA 2W67A 4UXDA 3CZLA 1S46A 1W1IE 4CNOA 2R91A 3QM3A 4XTIA 4UNIA 3GTHA 2VENA 3FV9A 3L2LA 3TP4A 4JTTA 1VB9A 1XC4A 4Y8EA 1WDRA 2WVTA 3DN5A 5JBFA 3WY1A 3NL5A 2OQLA 2GSEA 4UC5A 2PDPA 3RIKA 1VLIA 1UOZA 4P2VA 1EP2A 2PDYA 3GM8A 5H91A 1TMHA 3ARRA 4GUJA 1JRBA 3OB8A 1AW5A 1L9WA 4QIUA 2BY3A 1GEQA 1S5MA 3LRLA 1FHVA 1WOAA 1AFSA 3O63A 5K7JA 1QASA 3V35A 3UJSA 4U5IA 1GVRA 3W7QA 1XBXA 2PBGA 4K8HA 4O15A 3R7MA 2ZRVA 3M6YA 2WSPA 2RDTA 2B31A 2QUMA 5JH2A 1KCLA 4WRHA 4U3CA 1EF3A 4HNNA 4S3BA 4D9PA 1B30A 3LI0A 4AB4A 1M7PA 1A0EA 4L4OA 3DFOA 4QRNA 4K36A 3B05A 2G37A 4MKNA 1K77A 3S1XA 3OA5A 2Y7EA 2C71A 4E8GA 3QSRA 3N2OA 3L4WA 5AVNA 2XVGA 5AYBA 4DZHA 4EKJA 1YKWA 1X1ZA 4Q6XA 3TYDA 3W84A 3PVFA 3MHUA 4FB7A 1E4LA 4I6VA 3K4DA 1PZ0A 3ARSA 4LUTA 2FPTA 1AD4A 1XINA 1PZ1A 3NUKA 4ZBCA 1Q13A 3GUWA 3IAQA 2YW4A 1E3ZA 3P8JA 4FX6M 1DTNA 2PMQA 3C5QA 4H83A 1UMLA 1YDVA 1MMFA 2X7WA 1UB3A 1A5BA 1ODZA 3WJXA 4RNIA 3I7QA 3CASA 2FDSA 3WZ0E 5CEWA 2O92A 5H8UA 1OC6A 2YCLA 2JKEA 2P0OA 2CHOA 4PUKA 1M01A 1RJQA 5HMSA 2GJPA 1IF2A 1X6LA 4JS3A 4PTWA 1XBYA 2WMFA 1Q4WA 1OX5A 3DHDA 3RLGA 4DJED 3ABZA 4WHBA 3B9DA 1JG9A 2X0SA 2Z1XA 3N2CA 1EA9C 4JIEA 2PRMA 2DZXA 4IMGA 3GC4A 1EEXA 5AC8A 1TMQA 3N4EA 3V36A 3W81A 2DT2A 3M0MA 4LNCA 1S2WA 4NXSA 3GDBA 1DQWA 2C79A 4H01A 1ZAJA 3UT0A 3WBWA 3WLLA 2J47A 2QNEA 4FP1A 3MTWA 2VUNA 1CI1A 3JU2A 3N29A 4WZHA 2C13A 1Q6RA 2JEQA 4DJDD 1NDWA 3THQA 3EWUA 4AVFA 3VOJA 4A6GA 3BSMA 1W3NA 4NY2A 3BW4A 2E1WA 3TQ0A 3R89A 2PDQA 1UJPA 4JHMA 4Q3MA 3SCNA 4LSBA 2G0WA 4PCNA 4XWUA 1HVQA 5FEZA 1KGUA 3I6RA 1TVNA 3MB9A 2HXTA 3C3NA 4FNTA 4HPNA 2WQDA 4W7VA 4IFOA 1T40A 1UH2A 1AQ0A 3AROA 3BZJA 1UKSA 3L68A 3D5HA 2GVYA 3E1F1 4Z2KA 4UQBA 3AXKA 3H2EA 2E28A 1O7AA 2HXUA 4PCSA 3GR7A 2OLSA 5FESA 4ZOCA 1R9XA 2XIIA 3HMCA 3VDHA 1IIGA 4B3LA 1W8SA 3NEVA 5I78A 1CGXA 5D09A 3H7UA 3GYCA 4CU8A 4W87A 4L65A 3ICJA 2IKIA 5EKYA 1M7XA 1D7KA 4NAFB 4AD3A 3TMLA 4FK9A 1MUWA 4HB7A 1PHQA 5GPRA 4B5XA 2WNWA 3OLGA 4TX6A 3DFHA 3W88A 5CCZA 4AHQA 2IXVA 4QDPA 4UQDA 5EMYA 3OEXA 3ABRA 3N6JA 3VA8A 1V3HA 2FQIA 3O07A 1KD0A 2AMXA 4G2DA 2G3IA 1AMKA 2OELA 5FL1A 3WQ8A 1QNQA 5CGMA 4G6CA 3LHWA 3S2NA 1KO0A 4CCEA 4MZYA 1KRAC 3ARTA 1W3JA 5I6SA 4GUIA 1JZ7A 5CXPA 3W2NA 4YHEA 4JICA 5BCAA 3CZJA 2BHUA 1JCLA 4TX9A 2X05A 5E93A 4E3VA 3MP3A 3MZNA 4OT7A 1EX1A 1DIDA 2OGYA 4G1KA 4QCFA 1FWJC 2J9XA 5I3JA 4KCUA 4LAMA 4JTHA 3I4KA 3A9BA 8XIMA 3FYOA 2QCFA 1Z89A 3H26A 3WQCA 2DW7A 3C0JA 4HHMA 3CUHA 1FY6A 3TTQA 3TR2A 3CM4A 1YXCA 4XZMX 3WDJA 3MC5A 3MKKA 4JD4A 1XLEA 4NVTA 2F2HA 3C0QA 2WSQA 3V75A 4HA4A 2W63A 5ENLA 3WDIA 3BZGA 1OCBA 3WD2A 3U5YA 2V5CA 4LS2A 4PBEA 3GXNA 3AO0A 3C3UA 2PZ0A 1S3TC 1JVNA 3KBNA 1ZENA 3H2OA 4Q8VA 4JQ3A 4TOQA 1NDYA 3TYZA 3CEPA 4MYAA 1XX1A 5DMYA 4M56A 4DF0A 4BFAA 1TMLA 4C7DA 3FA3A 2Z1WA 4ICMA 2ZVRA 5HWMA 1PDZA 3VDCA 1KTNA 4HU0A 3RJYA 2ZIDA 1T7LA 3GNNA 1Q7ZA 2BGQA 3NG3A 2Z1BA 3KL0A 4LS0A 1QTWA 2D0FA 2QMKA 3L5LA 3IJDA 5I5RA 3LMZA 1QNVA 2PP0A 4HMDA 4A8LA 2ZA2A 4JKLA 4N6FA 1TELA 3G1YA 3YPIA 5DEZA 3KCJA 4XBSA 4FSAA 4JQ2A 1VFTA 1KXQA 3WF3A 4R3UA 1R8LA 3UP8A 2CEQA 2Y63A 4N9DA 2X30A 2PI6A 2GGGA 2PZNA 4GVGA 2QMJA 3W7JA 1XFBA 4JQAA 1VC4A 3BLDA 4GNVA 2NX1A 1SW7A 3NNTA 1WA3A 3ERPA 4LAKA 5DO8A 1VHNA 4W8AA 2QUTA 1ZBKA 2FB3A 2VEKA 1VLWA 3ABXA 2Y7GA 1DOSA 2BP1A 2J78A 3NO5A 1J8VA 3OW1A 1CTNA 3DGBA 1R86A 1WZLA 2RH9A 1V0NA 2OFJA 3B9OA 2GWGA 4JTRA 4BZYA 4PTMA 2XINA 1MWOA 4LCQA 3VMOA 2E6DA 1UWAA 2D20A 1EUAA 4NJJA 3W6YA 4D6IA 2HNHA 1EX5A 1RCQA 3M41A 1DJZA 1KV5A 3Q65A 4NQ1A 1KM0A 2R14A 1C29A 1KW1A 4HNUA 3M0IA 4NILA 3VX0A 1WXZA 4ORMA 3ZZ1A 2PDIA 2ZX8A 4FEZA 1BKSA 1VD6A 4LF1A 2NUWA 2ALDA 2HVNA 3AU6A 4LU0A 4XD6A 3Q37A 3BSHA 5HAOA 3UETA 4F9DA 5DX7A 1JCTA 3FCPA 3QYSA 4DRSA 1TUFA 2OG9A 2PC4A 4H8HA 1YADA 3BAIA 3CBWA 4A2SA 2CBJA 3W1LA 3THAA 3PANA 1GOMA 3W7KA 4JDYA 3AJXA 1W9BM 4S3EA 2AMGA 4O52A 3HQOA 3FKKA 3WLPA 4XVEA 4GC3A 2D2JA 2Y24A 2WNZA 1ZALA 3W1PA 5BZAA 1FVPA 2DU2A 2FH8A 3BL3A 1ZJIA 2WC3A 2OX4A 1HG3A 3LZ5A 3VE7A 1EJ7L 3MZ2A 4PYSA 4Q33A 4ZOEA 1OYBA 2GLKA 1VFOA 4EX4A 3DYOA 2ZA3A 1QATA 1YEYA 2OKOA 4WGHA 4AEFA 3S2LA 1FWCC 3AAMA 1ZQ5A 4X3ZA 3UEQA 1FWSA 2ZX7A 3U3HA 1UA7A 1H7NA 1H49A 1A4LA 4XD3A 3FHAA 3I3EA 1XLDA 3MY9A 3VTRA 3HM7A 2J7HA 4B9ZA 3UG8A 3W7MA 9RUBA 2ZA1A 3KM8A 3WJWA 4Q8UA 4E2VA 4MLJA 1OT1A 2VNCA 1KFEA 5AN7A 4GLEA 1GYMA 1SSGA 1RBAA 3DYPA 4GYKA 1S3HA 4AC1X 1KM5A 3VGBA 2WV8A 4C5YA 3NPVA 2D3NA 4DNHA 3E2RA 4NAFA 1J18A 2PRLA 3VX1A 3C8NA 3MSRA 1A49A 5FA5A 1DWIM 4XVDA 1B5TA 1YTKA 3D6NA 1GW1A 2NQLA 3G5EA 3Q45A 3WIJA 4MY1A 3LNPA 5DN1A 4O53A 4HA3A 1E15A 4J35A 1JPIA 1EZWA 4RV8A 4GUHA 4IPNB 1RP8A 5CQ1A 3SDOA 2PA6A 4Q8MA 3UNTA 3I3BA 1KV8A 5EL1A 3SUTA 4QDMA 5F1VA 1WBJA 3SQSA 3G22A 2JIWA 1XYLA 3WQFA 1A47A 4KWOA 1XG3A 3LLDA 5G4HC 1G69A 1BRLB 3WBYA 3LN3A 4UTJA 4QJ5B 3S0CA 3GFYA 3EPMA 1B90A 3P61A 4GPNA 1FWHC 3M0ZA 2J8FA 3KZSA 2XDFA 1TPVA 2PDFA 3AMCA 2E09A 3NO1A 1YMYA 4BF7A 1UR8A 1FH8A 1EOKA 5EFFA 3WD3A 5M3WA 2ISFA 3WLOA 3ATYA 2ZXDA 1A5LC 2ZBTA 3GG1A 2ZX6A 2OTDA 4OQVA 5D2XA 5FJTA 1PHWA 3TROA 4HSNA 4WOZA 3F5KA 2BXYA 3HGOA 3NIYA 4GZ7A 1TPWA 3ZT7A 1FBAA 4HCDA 3WLNA 3G1SA 4UOJA 1DQXA 4F0MA 2V9DA 3LCXA 5IBXA 4JNZA 3DYMA 4EPEC 4DBWA 4MDOA 3L4ZA 2CITA 2A5HA 3BC9A 3TMQA 3FK4A 3VC5A 3MMTA 4IXHA 1SZRA 1FP8A 3NM3A 3TV8A 3A13A 3BJSA 4LYQA 3PTQA 4GXWA 4Q4MA 3CWHA 4MNJA 4P7OA 5H2ZA 4E8DA 1IR2A 2BGSA 1VBUA 2Q09A 4H8UA 3TSBA 1WXYA 4DWSC 4UNLA 3QOMA 2WPBA 4MADA 1O66A 5FJJA 3CUIA 4QX4A 3AWOA 3SRHA 3FVMA 4N7QA 1K8XA 5C9UA 2E40A 3KFTA 3ANYA 2E67A 1NM9A 3VZZA 4JTJA 3OTRA 5EYWA 5I00A 1O5RA 3C56A 1A53A 2Z1VA 1V93A 1DKWA 4EXBA 2YL8A 1W1B1 5TAOA 3TQPA 5FSDC 4ZSUA 4LVAA 4KFNA 4CEUC 4GIAA 4OVXA 1XHGA 2RHGA 3PZTA 2PF8A 4AZGA