2PCQA

Crystal structure of putative dihydrodipicolinate synthase (ttha0737) from thermus thermophilus hb8
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
MILPPIPTPFDREGRLDEEAFRELAQALEPLVDGLLVYGSNGEGVHLTPEERARGLRALRPRKPFLVGLMEETLPQAEGALLEAKAAGAMALLATPPRYYHGSLGAGLLRYYEALAEKMPLFLYHVPQNTKVDLPLEAVEALAPHPNVLGIKDSSGDLSRIAFYQARLQEFRVYTGHAPTFLGALALGAEGGILAAANLAPRAYRALLDHFREGRLAEAQELQKKLFPLGDLLAKGGVPLLKQALRHLGLPAGYPRPPYPAESPLWERFLPVLEGLKEEGWVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative dihydrodipicolinate synthase
publication title Crystal structure of putative dihydrodipicolinate synthase (TTHA0737) from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 101
structure length 283
sequence length 283
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2pcqA00
1QPOA 4WJEA 5D2VA 5CZTA 1LBMA 4MVAA 2EHHA 1RZMA 2H3DA 4N9BA 2OT1A 4MYXA 4JIQA 2QCHA 3ANYA 1H1YA 1RQBA 1TO3A 1LM1A 4JTJA 5K3VA 2QCLA 4MPQA 5F2MA 2OJPA 3CWNA 1H61A 4FNQA 1D3HA 5CGQA 2ZDRA 4EVZA 2CFFA 3C3NA 1K7EA 2DZVA 3G3MA 1EWDA 3EKZA 4XUGA 4NJIA 1LROA 1OYAA 2IQTA 4BWLA 3W23A 3T78A 3S6DA 5F2IA 4TX9A 4DO5A 1QNVA 4IXXA 4JY9A 2FLIA 3NQAA 3TU9A 1MXSA 2WKJA 4Z1DA 3EWYA 3NNTA 5HR7A 2ZRWA 4AMAA 3NA8A 3G1FA 3SJ3A 4MFDA 1TPUA 4NNAA 3STCA 1AMKA 1W0MA 3R12A 3BG9A 1XKYA 4TMBA 3G1AA 1VLWA 5CZ0A 5CZSA 3H54A 3TCEA 1BKSA 1XL9A 1JCXA 3FJLA 4ZQRA 1X1ZA 1KFEA 4HKPA 1KM1A 1SUXA 3NQCA 4ONVA 3W7JA 1X7FA 1JUEA 2WNNA 3N73A 1AL7A 5LHEA 1XI3A 3O16A 3NQMA 3KAOA 1Y0EA 4E2DA 3GYEA 3W1XA 3STFA 1HO4A 3TMLA 4OBTA 4NQ1A 5AHIA 4DEFA 2Q3OA 3W7MA 3P60A 2J9YA 4GNJA 1MEIA 4IMFA 3L2IA 4CNPA 3ATZA 3NL6A 5AHNA 2WSYA 2V0TA 3UWVA 2HTMA 3L66A 3R8RA 4GWEA 4HIBA 1PHQA 3TFCA 1FCBA 1T8XA 3SIZA 2ZA3A 1LRNA 4PL2A 4LC6A 1PE1A 4JX5A 4JDYA 3W76A 4LW7A 3B04A 5IBXA 1J2WA 3W75A 3MI2A 4XBSA 2WPBA 2NX9A 2J24A 3W2NA 3W7RA 4NJGA 2X1UA 3B0PA 1Q45A 1OX4A 3GAYA 4I7VA 3W70A 5FF2A 3W7OA 3QSRA 4DO4A 1G7VA 3GR8A 5KITA 5IM51 3HG2A 5T26A 2RKXA 4MJZA 5ABTA 1P4CA 3QM3A 3LCHA 4KWWA 1ZY9A 2RDUA 3V1PA 3NPUA 1KV5A 1FWTA 3TSMA 2G5WA 2BLEA 3QW3A 1V7YA 2ZTJA 4JYEA 1DQWA 2QR6A 1ZAIA 1SO5A 4FX6M 1Z42A 3QJAA 5K4ZA 3SW6A 3MP5A 1KLYA 3GDTA 1KV8A 4XKYA 4DXVA 1BTMA 3W1RA 2TYSA 3HJZA 2H3BA 3HPZA 1EP1A 3HGSA 4ZQCA 1M6JA 4Y6GA 3PULA 3B06A 2HS6A 4LS2A 4EWND 4N9EA 1F74A 1TPC1 3QC3A 1OFBA 3OVQA 5J5RA 5U7SA 2I9EA 2QCGA 2VOMA 1TRIA 4ADSA 3W86A 5DCDA 1G67A 2P0OA 4OV9A 1KM2A 2A1YA 5BW6A 4LWWA 3Q2DA 4LS1A 1YPFA 3THAA 3ZWSA 4E38A 4MY1A 3TAOA 1WV2A 4M7TA 4N4PA 4C1KA 1GVOA 2NXGA 2NXIA 3DKJA 3T40A 1OX5A 2YYUA 4O18A 2X2GA 4ZVJA 3VE7A 1Z48A 4XWUA 3KXQA 1TPWA 2DZTA 1TV5A 3TFXA 4A29A 1KFLA 3WJXA 1HG3A 1SZEA 1IXNA 1TTJA 1RR2A 3LCLA 4RR4A 1L6YA 3DZ1A 1H7XA 1LRQA 2DZPA 2PRLA 3S1WA 2Y85A 3CHVA 2GPTA 1GYNA 3NDOA 4IX0A 3NAVA 3NG3A 5DBUA 3C0JA 4GFSA 1ZNNA 2Q8LA 2CZFA 3PF3A 4O50A 4GJ1A 3PBWA 1KW1A 3MUXA 3W7CA 1B4KA 3H53A 1S3HA 4IX2A 2TPSA 1H7OA 1LLZA 3RK8A 1DORA 1D3GA 2QUTA 1WXJA 3P80A 4LVDA 5C55A 2DJXA 3ABOA 4AAJA 3NL2A 1KTCA 3G1XA 5EMUA 3VE9A 2GQAA 1TPVA 5D02A 4GBUA 4LT9A 5LGZA 5D32A 2V81A 4O54A 4ORMA 3F4NA 2YXGA 1F6PA 3FKRA 1TQXA 2J6XA 3LHUA 3IVTA 3HIJA 1WYIA 1FY6A 1W8SA 2GJLA 3RLUA 4UCGA 1X1OA 1SFJA 1W37A 3GDRA 3ABSA 3M7WA 3PB0A 2C19A 3FYPA 3DENA 1SW7A 4NJJA 4O1AA 1AW1A 2BTMA 3TK7A 2V2HA 1VC4A 2ISSA 1EPXA 1TTQA 3L5LA 4IMCA 4KFNA 3FA5A 5BRBA 2OZ0A 3WK0A 3PUOA 1LYXA 3TR2A 1YTEA 3P81A 2A4AA 1P5BA 1XBZA 1NF0A 5KTLA 1U83A 1VZWA 2TMDA 3JS3A 4I7WA 5D2YA 5I3GA 5BMXA 1M5WA 2A21A 1VH7A 3NM1A 4LNYA 3QQ1A 1H7NA 3GDLA 4A22A 4HNVA 4WY0B 5HR6A 2YSWA 4NJKA 1OX6A 4O16A 4ZQPA 1XC4A 1OG0A 3Q94A 5LKYA 1LORA 4LVFA 2FTPA 1TPDA 1LOLA 4CQ9A 3GKAA 1TCDA 4OGZA 1NVMA 1OJXA 3NQGA 3P8IA 1K3UA 4LOCA 1KFCA 2ATMA 1W54A 2ZYFA 2WQPA 3TSBA 3NO5A 4FXRA 3W1UA 3BVJA 1WX0A 1X8FA 4NJHA 3R13A 5G5IA 3MP3A 3IVUA 3P74A 3MYOA 4DF0A 4L4MA 4UMAA 3LLDA 3W1TA 4NNBA 4AWTA 3E49A 4JNMA 3EXRA 5CZJA 4RCXA 1H1ZA 3LBCA 4W9TA 1F05A 1GJPA 4WZHA 3E02A 3E12A 1SFLA 2HSAA 5HINA 1QMLA 4M6QA 3MYPA 1K8XA 4BI6A 4NT0A 3BV4A 4DBDA 4JTLA 3O07A 1IXQA 1RQEA 3BGJA 3O05A 1K03A 2HS8A 4O4WA 5H2ZA 2PC4A 1JRBA 5F4WA 3MHGA 3S5NA 3NQ8A 4UMCA 1XXXA 3KVLA 2JK2A 2YW4A 1GZGA 4YL2A 2GQ9A 1HTIA 2XN0A 3TMQA 1Q3NA 1ZALA 2Y70A 3GK0A 3GXTA 2H90A 3MBFA 3PS7A 1G4SA 3HGRA 1MZHA 1KM6A 2X1RA 1G7UA 3G1YA 3UD6A 3BG3A 2QDHA 4OWGA 2QJGA 1XDMA 5LGXA 2P10A 4FNSA 4FNUA 3WK3A 3P62A 3BK0A 3GX9A 3O6CA 4NU7A 3NL3A 4GXMA 4UFJA 4UTJA 1OFAA 2F84A 3NPWA 1LTDA 1UCWA 3A5FA 2X1SA 3CQ0A 2VFEA 1XM3A 3SR7A 4POCA 2W6RA 4YWIA 3FIGA 3QQ0A 4O4VA 3KVKA 2FDSA 2QUUA 1PCKA 3GNNA 3EX4A 5AHEA 5K9XA 2CU0A 3LTYA 3TJXA 3M43A 1QO2A 1YDNA 4UTWA 4NX5A 3LCFA 4AWSA 4Q32A 4D2JA 3E96A 4O19A 2FJKA 4KFPA 3SECA 3NQDA 5F4SA 1W1ZA 3UWYA 1Z41A 1OK4A 4FHAA 3C2RA 4MYAA 2Y7FA 3WJYA 1KFKA 1M7PA 1S5VA 4L4LA 3MO7A 3PVFA 5LZLA 5D04C 2F7FA 3GIYA 4UFLA 1VCVA 1MO0A 3DGRA 4K37A 4LRSA 4RZ5A 3DXIA 4HSNA 3P61A 1N7KA 2YGYA 5AC6A 5AHFA 1RQHA 3TXZA 1EWEA 1DJQA 1IGSA 3H55A 4JN6A 4K38A 4DF2A 2CLFA 4UTKA 2C18A 2GOUA 4UTIA 1SZGA 4X9SA 2ZZ5A 3PB2A 4JTUA 3G22A 1T0OA 3LCIA 3L5MA 3KRZA 2PE4A 2RHGA 4I9AA 4KWVA 4X2RA 3LBMA 3OVRA 3STEA 4YCPA 3NQEA 2GVJA 5AYZA 1NEYA 4QJ1A 4DPPA 4CQAA 1TV7A 1AG1O 1NSJA 1R2RA 1VPXA 4S2CA 3T4CA 1FXQA 2JKPA 4MOZA 5KZEA 4UUIA 3S8HA 3LCXA 4AF0A 3AO0A 2NXHA 3BARA 1OFDA 3LRKA 2DU2A 2ALDA 4BR1A 3NZ1A 2B7OA 2Z6JA 4Z0SA 1I2QA 2V8ZA 2A5HA 4H3DA 4HPJA 5CPOA 2O7QA 3GXNA 1GG0A 2FQIA 1ICQA 4R33A 3JR2A 3N2MA 2VEMA 4K7YA 3P82A 2KZHA 1F6KA 1ME9A 3ABQA 4AH7A 3DI1A 2NLIA 3OVPA 5AB3A 2Z1BA 3LOTA 4TR9A 2CZEA 2ZZ3A 3T7VA 1DQXA 2O7SA 4TU1A 3W2UA 1TQJA 1ICSA 4NVTA 5EPDA 1BWLA 2YCEA 3EWZA 1TTIA 3GNDA 1H7PA 3EXTA 3PUDA 1GOXA 1KM4A 4NUWA 3I68A 4K8EA 1TTPA 4CQ8A 4R53A 2Y88A 2E6AA 3LXCA 2BZNA 5G2HA 3W2KA 3KVMA 4O0KA 5I3IA 5HWJA 1WQ5A 5AYXA 5DN1A 1ZAJA 2DZWA 5EBUA 2ZRVA 1T99A 3NXFA 4AHPA 4CCCA 1LP6A 3L65A 2VEIA 1EIXA 2JKEA 3W85A 4NNCA 1XDLA 2OCZA 2BX7A 1UUOA 2A0NA 3E9AA 1FWSA 3LERA 3VCRA 2ZZ7A 1O5KA 1ICPA 4ZL1A 3TE9A 1R2TA 3BLEA 1G6CA 4YCOA 3TUUA 2C3ZA 4GUFA 4PEKA 3KHJA 3B03A 1EX5A 3UXDA 1C29A 2A7NA 2Y63A 1R47A 3KX6A 4MZ8A 4WOZA 5J5DA 1OFQA 3CIXA 2E5DA 3DH7A 4KKXA 4Y96A 1VYSX 2Y89A 3WK2A 3MBDA 1FBAA 1DVJA 5FESA 3CB8A 2ZBTA 4LU0A 4O53A 4AHOA 2ZZ1A 1GVQA 2A6NA 4IOTA 4JX6A 1PV8A 2PURA 3O6YX 4OU1A 1OYCA 2FPVA 2VFIA 3IIOA 4UXDA 2Y62A 1H50A 1VS1A 3PBVA 4A3UA 4NXKA 3HBLA 3UPWA 3UYCA 1W3TA 2VXNA 1OK6A 2A7RA 3BLFA 3N34A 4RV8A 3IRDA 1IF2A 2ISVA 2NUWA 2PRHA 4JD4A 3NEVA 1B3OA 3RF9A 3W7LA 1GTHA 3I7RA 3TSDA 1QDSA 5LHFA 3DI0A 1TRDA 3TV8A 1Q6LA 4WD0A 4QISA 3CIWA 1VYPX 5DLCA 4FO4A 1FDZA 4FF7A 2OT0A 2Q8ZA 2VEKA 3PR2A 1LDCA 1YXDA 1FDJA 1Z44A 1ZJIA 1JCLA 2ABBA 2E1DA 2P1FA 3G0UA 2YZRA 4EF8A 4JTFA 2QCDA 3DHFA 3HMJG 3BG5A 1K7FA 1ZFJA 5C5YA 1LLWA 1O94A 2BWGA 3QRHA 1KFBA 2CZDA 4BWLC 3W71A 1XCFA 3MWAA 2A6LA 1FWNA 1TYGA 4JDBA 3G3DA 3W7HA 1W5QA 1X6UA 3S1VA 2XFWA 3ELFA 5K9DA 1R46A 4H4IA 4JXCA 1RPXA 4O15A 3CPRA 5C2XA 3WJSA 4O10A 1AW2A 4N6FA 5FEWA 5KZDA 2W0UA 4FNTA 2NZLA 3F1QA 2CW6A 4UFKA 3B0UX 4WXZA 5D09A 5U4NA 3YPIA 1OYBA 3W9ZA 2Q3RA 2DJLA 4JY8A 4DBEA 3B05A 4RZ6A 6TIMA 4LV9A 2RH9A 5K9CA 3U8GA 1L6SA 1XFBA 5EL1A 2UV8G 4MLRA 1BEUA 1TPEA 2VEPA 4PCFA 2QCCA 3CEUA 2CZ5A 4J9JA 4O0ZA 4QNWA 4AVFA 2QAPA 3W07A 3EKLA 1MSSA 3I6RA 5LNVA 3M47A 3W7DA 3LM7A 3KVJA 3VNDA 1JR1A 3NQFA 3LCWA 2ATSA 5MHBA 5FI8A 2QJHA 1WOAA 4MZ1A 1JUKA 1LOSA 4A21A 4Z08A 5D30A 3W1QA 2WOQA 3W84A 3NQ6A 3GDMA 3IVSA 4HN4A 4ZQMA 1S5WA 1Q6QA 4UTTC 5DY3A 1TJPA 4IXHA 4MKNA 4RJEA 5AHLA 3TH6A 4AB4A 1XBXA 4X3ZA 3UZJA 2VENA 2VFDA 1UBSA 2ZZ2A 1H5YA 2QKFA 3GLCA 5LNSA 1TB3A 1IXPA 1F76A 4FXSA 1VRDA 1A5CA 5A8GA 4DQWA 2VFFA 1OX4B 1KA9F 3CWOX 1J4EA 5DCEA 3THQA 2QCDB 4B5NA 4M6PA 5HMSA 1ZCOA 3PG8A 4O1DA 1HUVA 3GVGA 4JTEA 1JRCA 5I3JA 2TSYA 3LDVA 1G69A 3EX3A 3FLUA 2CLKA 1FWWA 2RDTA 5D2TA 1Q6RA 1I2PA 4UMBA 5HULA 4IMEA 4RX0A 1MEWA 3QF0A 2B7QA 3R5EA 3QZEA 2JGQA 4OHQA 3A24A 4OE7A 4BI5A 4QIUA 4NX0A 4XKYB 3EWBX 1QPQA 3A21A 2E6YA 1A53A 4R34A 3TW6A 1GVRA 3L0GA 4LUIA 6ALDA 4JEQA 3T55A 1YDVA 4LVAA 3HGJA 1K8YA 3G24A 4G1KA 1WAUA 1EB3A 4UNLA 5FF3A 3GR7A 2VKZG 5HWMA 3EX6A 1AL8A 1R2SA 1D9EA 4XQ6A 2DP3A 1GPWA 4XTDA 3AJXA 4YMZA 1K8ZA 3RLVA 2C0AA 5FEZA 5DY2A 3F03K 4K39A 2G97A 4ZQOA 3SY5A 5D37A 5DCBA 3O15A 3BPWA 5I3KA 1O95A 4ADTA 3QW4B 3LHTA 3LTSA 4MY8A 1P0KA 3GZ3A 5I3FA 3PM6A 4LY8A 4RXGA 3UWZA 3O63A 2YW3A 3M0ZA 2FPTA 1ONRA 4P2VA 1G4PA 3UNDA 1GTEA 4N02A 4A2RA 4YLWA 1PS9A 1JVNA 5CPLA 1JCMP 5KMYA 3WFAA 4BI7A 4CCDA 3HPXA 4ZMGA 4K6AA 3HQ1A 3W2JA 1YLVA 3HG5A 4QM1A 1QO5A 3FKKA 3USBA 3MHFA 3S5OA 5K2ZA 1A50A 2B0MA 3N3MA 2A7PA 1PHWA 2I1OA 5AHMA 5D03A 1TREA 3QEZA 3LHVA 3S0CA 3OEXA 5AC7A 1EUNA 1CI1A 2ABAA 1HFBA 2DORA 3NPVA 1DOSA 1DBTA 4JX4A 5D33A 1TPH1 1JCNA 2QF7A 5CPNA 3Q58A 1KM3A 1C8VA 3S42A 2GVLA 5BNKA 2NWRA 3S1UA 1DV7A 2ZRUA 2E6FA 4MUZA 1TSIA 2YDAA 1Q6OA 3ZFHA 3RNDA 5HNRA 2RFGA 3HOJA 4WOQA 4NXSA 3NR0A 5G4WA 3RMJA 4PFMA 2R14A 2Y7GA 1L9WA 5L6UA 4DPQA 3S5ZA 2E68A 3L67A 3QPZA 3W74A 3NL5A 3DFSA 2Z6IA 3C2FA 3EXSA 3OHIA 4K8HA 2ISWA 4WX2A 4WUIA 5BOOA 1AK5A 1ME8A 2CLOA 3W87A 1KTBA 3KRUA 3SI9A 4JTIA 1JCJA 2JGYA 4JGDA 2X16A 1EP2A 5EKYA 4CNOA 3TROA 4HNUA 5KINA 2BSLA 3C56A 4A2SA 1H63A 2AGKA 3P8JA 1S5TA 2VELA 3MP4A 3IEBA 2CLMA 1SSGA 2J88A 3L5AA 5HUPA 2ZA2A 1OF8A 4KFOA 1RVGA 5I3HA 3LX9A 1UASA 4CNNA 3EX2A 4Z1BA 1IXOA 1W5PA 2DZXA 4O52A 3G1SA 4GRSA 1JUBA 2HMCA 4Y9AA 3WK1A 1FUYA 3LV5A 1CW2A 3TW7A 2ZRYA 3I7SA 1F5ZA 1XUZA 1OFRA 1ZAHA 5E93A 4Q33A 3W2MA 5G1TA 1H7WA 3LXAA 3W1MA 3IIVA 5EY5A 1H51A 4O11A 2Y6ZA 2ZRXA 3OIXA 5LNUA 3M5ZA 3W73A 3PAJA 1XBVA 3UWWA 2OMAA 1SPQA 3IGUA 3CC1A 4UTMA 5K4XA 2FB2A 4M5PA 3CT7A 2QJIA 1OHLA 3W6YA 1W5MA 1FXPA 3GAKA 4N9CA 4U4MA 2V82A 2YR1A 5DBTA 3SGZA 1L2UA 4Y8FA 4QAIA 3S9YA 2YX0A 1WBHA 1ME7A 1UB3A 4IUOA 4LTSA 2A2IA 1YPIA 1NAL1 3LV6A 4E0CA 4O17A 2G95A 3LCGA 1THFD 2WNZA 3O8AA 3SSJA 2PCQA 4RKAA 3I65A 5F2LA 5A5WA 1I2NA 4Q4KA 3QPYA 1PIIA 1SO6A 4GUGA 1EA0A 8TIMA 3UXAA 2FB3A 3ZR4A 4HSOA 2GQ8A 2QCNA 3EX1A 4UIOA 3DFQA 3TQKA 3OBKA 3ZS4A 1GVFA 4M19A 3LRLA 3NQ2A 3UWQA 4HT3A 1H60A 4LVBA 1EEPA 2QEZA 1T96A 2V2CA 2V5BA 2LLEA 3SGUA 1WDWA 3HF3A 3PBUA 5CSRA 4HHPA 3Q37A 3DFPA 3VFLA 3W1NA 3M16A 1GT8A 4GUIA 1KM5A 3JRKA 2NV1A 3W72A 3S5YA 1OF6A 2J27A 3NZRA 4PTNA 1F7BA 4AHQA 1A5AA 1TV8A 1SW0A 4ORIA 4GUJA 2ZTKA 5TQLA 2E09A 1OFOA 4QSHA 4UTWC 1SO4A 5AYYA 1JQXA 2QDGA 2ZFAA 3O6DA 4YXGA 2VC6A 3C2EA 1JULA 4RXFA 3LRMA 2CLHA 3P67A 4UC5A 5CG7A 3LB0A 1QPRA 3C2OA 5C6MA 5AC8A 5HUOA 1N8FA 5DELA 3P84A 3KOFA 3BGGA 3HO8A 1KBIA 1TPB1 1I2OA 1UUMA 3W7KA 3TDFA 1RV8A 2FFCA 3EEGA 2C14A 3QSTA 3EB2A 4JS3A 1VLIA 4O28A 4AWUA 4UFIA 1V5XA 1PL9A 4PA8A 4IMDA 5FEPA 1YXYA 1GYLA 3C4UA 4FIQA 3ABRA 4AF0B 3LHWA 4JTTA 3DFNA 2WJZA 1A5BA 2YPIA 4X22A 3PBYA 1I4NA 3OG3A 3BLIA 3GKFA 1JCYA 4CCEA 4LS0A 3W2LA 1HO1A 4N6EA 3C52A 3HG3A 2E5CA 5FF4A 3N9SA 4DF1A 3P5YA 2EF9A 2XN2A 1EUAA 3I7QA 4ALDA 3W1PA 5CPMA 1FWRA 1QR7A 2V2DA 4O14A 4TIMA 4UR8A 1SSDA 3DFTA 4PODA 3U2OA 1ADOA 1VQTA 4HNTA 4UTTA 3G8EA 2ZQ0A 2CWNA 4ADUA 1DHPA 1P0NA 4WQ6A 3TA6A 3EWXA 3M6YA 4LV4A 4C1LA 5K7JA 3MW7A 4CLMA 2ZZ4A 2NX3A 5EA9A 3SZ8A 3NM3A 3UQNA 1ZENA 3MI6A 2WO5A 1R30A 2E5BA 2WV8A 3D0CA 3CTLA 4GC4A 5FF0A 2YFOA 3W7NA 1B9BA 1TPFA 3K30A 1EP3A 1CX9A 3UWUA 3DU0A 3IIPA 1LBLA 4O1CA 4DO6A 4E2BA 3VI2A 3MI3A 3G1DA 1SO3A 2NUYA 1VYRA 2QCEA 5F4XA 3W3OA 1GG1A 1QFEA 3CEPA 3P5ZA 4IPIA 1G4TA 1QOPA 1O4UA 4EF9A 4LVGA 4MJMA 5KSWA 1VCFA 4UNKA 2C15A 3LI0A 1DKWA 3C8FA 2YFNA 3OA3A 4IPJA 1ALDA 1F73A 3B8DA 2A85A 4M6VA 4O8RA 4DELA 2ZRZA 3C61A 4Y90A 1W3IA 3QMSA 4AXKA 3BW4A 1DJNA 5C54A 3LHZA 3F4WA 5F1UA 2E77A 2Y61A 5HWNA 2H8ZA 4O57A 4FIRA 4FNRA 1GVSA 1W31A 5BMWA 4PL1A 3FFSA 3UPBA 3FEMA 2R8WA 5LNWA 5EYWA 1ZHAA 1LZOA 3HPSA 3V75A 3SFKA 1W5NA 2C6QA 1WA3A 3GB6A 3FYOA 1FDYA 3M9YA 2QCFA 2WSQA 3P7YA 2NWSA 1YTDA 4TMCA 4UTHA 3M44A 3N14A 4BFAA 1FQ0A 1KFJA 1KM0A 2J9ZA 3GDKA 4N9DA 1QWGA 2NX1A 1W56A 3MJYA 1SZFA 3W7EA 5E1QA 3WJZA 1N55A 3W7IA 2DZSA 2EPHA 4EIVA 3E0IA 3TNOA 5IBXC 1KLZA 2QAFA 1FCQA 2X30A 3DKLA 3NYZA 3FJ6A 3INPA 3TJLA 1UJPA 5G1YA 3NQVA 2R94A 4IQLA 5G2IA 4OV4A 4OQVA 1GWJA 1PCWA 4UTLA 3M5XA 4PC8A 3VKJA 2B7NA 1JJKA 3KFTA 3RU6A 3TC6A 4IGHA 3NVTA 1WBJA 3NGJA 4WY0A 3T44A 3KRSA 3N19B 1QOQA 4O1BA 1YTKA 2FPYA 4JTKA 1LOQA 1LRTA 5LNRA 2CLEA 1MEHA 3RFAA 1J5TA 1QPNA 4GUHA 1LCOA 2X1TA 1ML1A 4UFHA 1SU5A 4RZ4A 3A23A 1WOBA 3O06A 1YADA 3G0XA 4FB7A 3IV3A 2J9XA 4JR5A 4I7UA 3TKFA 4BF9A 1SQ7A 3L21A 3MMTA 1BWKA 3M1ZA 1IIHA 4RLIA 1P1XA 1SR9A 3PWAA 3W83A 3W7GA 1K7XA 1AW5A 3G1HA 1IIGA 3CM4A 4Z1AA 4NZFA 3UY8A 4JIPA 1KTNA 4LRTA 1O5XA 2ZZ6A 5FEXA 2OX1A 1K02A 5D2XA 3BO9A 3LLFA 3TQ0A 4N4QA 3PSVA 2E6DA 4JTGA 4XBKA 3R2GA 1B4EA 1VCGA 2JBMA 4UFMA 1FCVA 2EKCA 1OABA 1KBJA 1YXCA 1W5OA 3LI1A 3N9RA 4QQ3A 4OT7A 3G1VA 3CLMA 1OFEA 1TIMA 3M5YA 4O12A 3QYQA 4ICNA 3O1NA 4UTUA 5E0KA 4ML9A 4EOUA 2AAMA 3G18A 3TXVA 1TJRA 3G8RA 3IIZA 2GVGA 3W1LA 2CLLA 4H6KA 3HGOA 3DFOA 4LC8A 4M7SA 5KZMA 4PH6A 2DZUA 5D38A 4JTHA 3W7PA 3DAQA 3STGA 4LUJA 1SZNA 3CU2A 1M7OA 2H6RA 4FEZA 4U28A 3HG4A 4UR7A 1DL3A 3A22A 4JYFA 3TIMA 3GXPA 3PUEA 1I8JA 3LXBA 2Z2UA 2FIQA 2C13A 1XBYA 3EWUA 4K36A 1I45A 4MLJA 5CKSA 2RDWA 2NV2A 5AN7A 4IJBA 5CSSA 1LBFA 3NOEA 5TBOA 2H8XA 2R91A 3QFEA 1VHCA 3FS2A 3LHYA 2Z0IA 4HNNA 5GVJA 1C9DA 1JQVA 1H62A 1XUUA 4MZYA 1SW3A 3PY2A 4O13A 3TQVA 1QCWA 4ZZ9A 2EAWA 3W22A 3TX9A 7TIMA 4S1FA 3IIXA 3IGXA 2W79A 3W88A 5FF7A 5DXYA 2CLIA 5AFDA 3UZ5A 1NFBA 3S1XA 3IGSA 4XTIA 4P61A 1FX6A 2NUXA 2C1HA 3ATYA 2EGZA 3L9CA 2Y7EA 1W3NA 3BW2A 3WJWA 5DXXA 3A5VA 3M5VA 3R89A 1GEQA 4WY0F 3G0SA 1VHNA 2GUUA 2GJNA 1TMHA 2XN1A 5D2WA 1G4EA 2V5LA 4Z0JA 3C2VA 4Z1CA 4ZQNA 2Y7DA 4FNPA 4GE8A 3TAKA 1VGAA 4WXYA 1A5SA 3W7QA 3LTPA 4MY9A 1F2JA 2VFGA 3M41A 2C16A 4QITA 2QCMA 3C6CA 4MFEA 3B4UA 3TC7A 3L0KA 1YDOA 4JTSA 3FOKA 1U5JA 1H7RA 3NQ7A 3A9IA 1GQNA 5AOUA 4QNEA 4TO8A 1B57A 1VJIA 4S2BA 4FX8A 1L6WA 4XZ9A 2AQWA 4AEOA 2B7PA 1E51A 1FCUA 1HL2A 5G2WA 3DBPA 4RK8A 3QMTA 2TRSA 1NF7A 3MHUA 2ZCGA 3PSWA 3QMRA 4MIMA 5LSMA 1RD5A 4N2YA 3U6WA 1YYAA 5F1VA 1PVNA 3HB9A 2WNQA 2PRMA 1OVDA 5TIMA 3UY7A 2YYTA 3B0VC 3W1AA 3LGEA 2VFHA 3BW3A 4BK9A 1O60A 2G96A 1I2RA 5HQEA 2V30A 3NPXA 4HPXA 3PG9A 5F2GA 4JYDA 4IMGA 3EWWA 5L9FA 2WSRA 4FX7A 2B4GA 3ZWTA 3PC0A 4IWWA 1QAPA 1OFPA 3L68A 3QH2A 4JICA 5HJLA 5SWUA 4R7JA 5H91A 2QUVA 2V9DA 2ZA1A 2D73A 4NZJA 5G4EA 5D05A 3N2XA 2BXVA 3DHDA 2I14A 4K7VA 2JKAA 3L0NA 1VR6A
chains in the Genus database with same CATH superfamily
2DIEA 5D2VA 1OSEA 4XKMA 3WZ0E 3PWIA 3MY9A 1H1YA 1RQBA 2CETA 3W24A 4CQDA 1SFTA 3PBMA 4JPGA 3NOYA 3SN4A 4YN5A 1D3HA 4H9VA 4A3YA 5CGQA 4OZOA 3QR1A 2Z00A 2ZE3A 4EVZA 5EMLA 2DZVA 4PMQA 3WQ4A 2QDDA 2WLZA 3VNKA 3KBMA 4XUGA 3ARUA 2IQTA 4BWLA 1AJ0A 3T78A 1A5UA 1QNVA 3D3AA 4IXXA 2C8NA 1OT1A 5C7VA 3SUUA 3GFXA 2WKJA 1TKKA 1U2YA 4HJWA 4MWAD 3WG6A 5HR7A 1B30A 4MFDA 1EC7A 1TPUA 1V3HA 3DG3A 3TTSA 2DQWA 1JDFA 1UPPA 3RXZA 3BG9A 4D6DA 4GYPC 3N4EA 1F07A 5CZ0A 1HKJA 3GXDA 3FJLA 1MQPA 4PTDA 4GIYA 3C5QA 2OR2A 2PMQA 1ZSXA 2GJXB 4HKPA 4GYKA 4CNTA 1X7FA 1AL7A 5LHEA 3KAOA 1Y0EA 2NQHA 3GYEA 4E2DA 4F4RA 4NQ1A 2HDJA 1S2AA 3CUZA 3CZGA 1A3WA 1KR1A 4MNKA 2OO6A 2YBVA 4IMFA 3CGTA 2E9BA 3F5JA 3UWVA 2PZNA 1Q63A 4FP1A 2HTMA 4GZIA 3H4XA 3SY1A 1KWGA 3T0AA 4HIBA 1FWJC 2PTZA 3THUA 3TFCA 4S38A 1FCBA 1T8XA 4O8AA 1I60A 2ZA3A 3UF9A 1RCQA 4IFOA 3OLEA 4JDYA 1K4HA 5CJ5A 2IMRA 3VKAA 3B04A 1KBLA 2XH2A 4EXQA 3MI2A 2NX9A 3DESA 2J24A 3N13A 2ZX8A 2XWEA 3W2NA 4NJGA 3VOJA 4GACA 1Q45A 4L4PA 4UOQA 1OGSA 3GAYA 3QSRA 1IT7A 3GR8A 4NP7A 3HG2A 5C9XA 2WKGA 2RKXA 1QNSA 5ABTA 3CV1A 3QM3A 4KWWA 1ZY9A 1JNEA 3NPUA 3UERA 1CXLA 1YW1A 3GIPA 3QW3A 3VGDA 1S38A 4AISA 2Y0FA 4JYEA 1VEOA 4DLMA 4MWAB 3VD5A 5K4ZA 2PDBA 4RNHA 1KLYA 4LSBA 4XKYA 1R3VA 3W1RA 4Q8TA 4C6MA 1EP1A 3HGSA 1XD1A 2HS6A 2D69A 2PDFA 4N9EA 1NIUA 1TPC1 3OVQA 4YJ5A 5I02A 5DEZA 2QCGA 2G3FA 1UUQA 2WXDM 1C91A 4ADSA 4HA1A 3UCQA 2CWXA 4OUEA 2P0OA 4ERAA 4ZO9A 3N6JA 1M04A 2XFRA 4KGJA 2VQTA 4E38A 1A3HA 3TAOA 1WV2A 1HJWA 2F9RA 2NXGA 2NXIA 3VD7A 1CGUA 2PDIA 3AMGA 1RSCA 5CXPA 2BGSA 1KFLA 4DUOA 4CVUA 2XZ7A 1IXNA 4JTAA 3N2OA 1XIFA 3DZ1A 3LD5A 1H7XA 3SCPA 3VILA 1LRQA 2NQJA 3S1WA 2B81A 2E28A 1HP4A 2Y85A 3EOLA 4IISA 5LIKX 4RE3A 3NAVA 5KZ6A 2EO7A 4F0MA 2CZFA 4RZBA 3MV01 1KW1A 1Z6KA 3MUXA 1ZBCA 3RO8A 1V77A 4GNKB 1DORA 3P80A 1BTCA 4LVDA 4WDWA 3ABOA 4AAJA 1XIDA 1KTCA 3DYPA 3VE9A 1TPVA 4KETA 3Q67A 4LT9A 3ZLHA 5E0FA 3LGGA 3TYDA 4KF1A 4PRTA 2QULA 4HCDA 3WDQA 1TQXA 5A6MA 3ZO9A 1GVEA 3HIJA 3IJ8A 3WL0A 4J7RA 1W8SA 3JU2A 3UW6A 1KB3A 4RUBA 3AYRA 1H41A 1SGJA 1IHIA 3M7WA 1CENA 4XB3A 2C19A 2Z7GA 2WMJA 3OBEA 2PU0A 3A3HA 4O1AA 1AW1A 3CJPA 3REQA 3TK7A 4Z42C 1VC4A 2ISSA 4GQGA 2JF6A 3OP2A 5DF0A 2OZ0A 4QLJA 3S3GA 1AFSA 4WK9A 3IJ7A 4GH1A 3GHUA 4X9YA 1JYNA 2A4AA 1XBZA 3MKCA 1NF0A 3BSHA 1VZWA 2OO0A 2VCBA 1RLDA 5I3GA 2EPOA 3M46A 5EB8A 2NQ5A 2YBUA 1FWBC 3QQ1A 4D71A 1H7NA 3NUKA 3GYCA 4L1GA 1WDRA 1MW1A 4HOWA 5LIWX 3ARYA 5ECVA 2BHUA 1QOXA 3ZJ7A 1Q8JA 1LORA 3IARA 3TQPA 1EIBA 1OWQA 3FA4A 1KCXA 1OJXA 1PO9A 3P8IA 1K3UA 1TWWA 3W00A 2ZYFA 8XIAA 3TSBA 3W1UA 3VMNA 4FI4A 4JAWA 3R13A 3MP3A 3P74A 3IGHX 3MYOA 4DF0A 3TTQA 4C6EA 4B4HA 5CC3A 4W9TA 2R9RA 1PUDA 1RA5A 1VFMA 3AU2A 3H70A 5HINA 2PWDA 1UG6A 3MYPA 3QC0A 4NT0A 5FJIA 3VD9A 4JTLA 1PEZA 3R8HA 2ZWZA 1NDYA 1IXQA 1RQEA 3BGJA 1Z3NA 2FZBA 1GOMA 2HS8A 3IAPA 1JRBA 1XLFA 1CLVA 3NQ8A 4YL2A 5D4YA 3DG6A 1NQ6A 4MG4A 3GXTA 2H90A 1X39A 4F9DA 1TX2A 1MZHA 1KM6A 2PDUA 1G7UA 2X1RA 3G1YA 3BG3A 2A3HA 2P10A 3UJFA 4FNSA 3GNRA 5IFTA 1E15A 5FD0A 1REQB 1MUCA 3BK0A 1TIWA 4Z2HA 1UKOA 3V16A 3NPWA 4HK5A 1KRMA 2W6RA 1V0KA 1HIZA 4O0QA 4CQCA 3IAQA 3QQ0A 1TWZA 3P14A 3NWRA 2QUUA 3EX4A 4B9YA 2CU0A 1EZWA 3TJXA 3M43A 3SQLA 2XSAA 5AECA 4ZODA 1YDNA 3EBVA 4QSFA 1U1HA 4KFPA 1UBPC 4GI8A 1W1ZA 4NKCA 1VFTA 3C2RA 3WJYA 4DBWA 3PVFA 5LZLA 5I00A 1AH0A 3GIYA 5FSDC 3DGRA 4LRSA 3H2FA 4RZ5A 2BVDA 3P61A 2AL2B 2DVTA 4YYCA 3UJ2A 1RQHA 3TXZA 1DJIA 4QE1A 1V02E 2ZZ5A 3PB2A 4GIAA 5HPOA 1D8WA 1IEQA 3G22A 4MTVA 4XO6A 3LCIA 4X2RA 2RHGA 1IWBA 1E1CB 2VC9A 2NT0A 3NQEA 2HK0A 1R7AA 3MSRA 2OPJA 3WH9A 3GHSA 5AYZA 4ZENA 1NEYA 1EBHA 1NSJA 1R2RA 1FXQA 2E8ZA 1LUCB 2Y1HA 2J7HA 3EKGA 4MOZA 5KZEA 4S3DA 3PZMA 4IL0A 3ZZ1A 3BARA 1OFDA 3SURA 2DU2A 2A5HA 2YL9A 4RE4A 5CPOA 4DJEA 1GG0A 2E4TA 4BZYA 5JUVA 3H2MA 3JR2A 3N2MA 4KIRA 1GONA 3TYEA 1ME9A 3MB9A 5AB3A 2ZUVA 3WLKX 1DQXA 3WDJA 3W2UA 5EPDA 2YCEA 4HGXA 1H7PA 4AC7C 1KM4A 3CUJA 4NUWA 2NT1A 1BXCA 2Y88A 4ZEPA 2Y24A 5I77A 2Y8VA 3W2KA 1CIUA 1D7FA 2X1IA 3P2VA 4S3KA 4EX4A 2V3DA 4BQ3A 4Q7IA 2C1IA 4GHRA 2OWCA 2GSEA 3GBDA 3RLGA 3L65A 1WO2A 2VEIA 2VGFA 3T0BA 4MJ4A 3VNMA 2BX7A 3V5FA 4NZ1A 4C6OA 3LERA 4Q4MA 1GW9A 1O5KA 1ICPA 3TE9A 2P3EA 1P48A 4YCOA 3VNYA 2C3ZA 1JYXA 5CSYA 3TWAA 4ZFMA 1EX5A 5BROA 1UD6A 4QR6A 1HL9A 4QE4A 2FVKA 1WDDA 1R47A 4KWUA 2OFJA 3KX6A 3FVDA 3CIXA 1DJHA 4KKXA 1VYSX 3ZSTA 3MVTA 3VZYA 4A35A 4FOJA 3UXKA 3CZEA 7TAAA 2QIWA 3JZEA 4YWSA 4O53A 4C1NA 4JX6A 3ITTA 3P3BA 2PWVA 1LJYA 3RAOA 3V0TA 4NXKA 4C6QA 1RY0A 3LQGA 1W3TA 2HCVA 3BLFA 3N34A 4RV8A 2NUWA 1WAWA 2F2HA 3ITXA 2VP8A 3I7RA 1QDSA 3OODA 2PLMA 1E72M 1Q6LA 3CMJA 4Z2KA 3CIWA 3N2BA 4REQA 5ENLA 5HATA 5E6YA 5FJUA 5BYWA 1Q85A 2D0FA 1FDZA 1RCXB 4V15A 2PDWA 1KO0A 4JL1A 2MANA 1LDCA 2GWNA 5I06A 1ZL1A 1VFFA 4DXXA 3HN3A 3ONBA 2VX7A 3RO6A 3M6DA 3PN8A 4LB4A 3LPGA 3S9ZA 1K7FA 1ZFJA 3V5OA 5C5YA 1KFBA 2CZDA 2P53A 3W71A 1XCFA 3MWAA 4UQEA 1LWJA 1TYGA 3VDGA 2XH4A 1JXKA 3E1F1 4WDXA 4WGXA 3MV11 4WEVX 1W9DM 4MSSA 1R46A 1F3TA 2QZRA 4EACA 4FNTA 4MNMA 4H7VA 3B0UX 3WKZA 3ITYA 2DT3A 1GNXA 4ZXLA 4GZJA 3E38A 4RZ6A 3OGRA 5K9CA 2ZE0A 2VDHA 1XFBA 1L6SA 3C3UA 3WLQA 1TPEA 2VEPA 4PCFA 2QCCA 3CEUA 5A6BA 2CZ5A 3WBEA 2HVMA 3W07A 2D2HA 3I6RA 1QNRA 4TV5A 3LM7A 3VNDA 3LCWA 2ATSA 5FI8A 3VCNA 2DUAA 1EQCA 4G6CA 1JUKA 4A21A 3EZ4A 1E4LA 1ZLPA 4HN4A 4QGCA 3P0WA 1I0DA 4UTTC 2AL1A 4D6EA 1TJPA 4IXHA 4DRSA 2C79A 3TH6A 1OCQA 1XBXA 5EGRA 3UZJA 2HBVA 1ZTVA 2OEKA 1UBSA 2VFDA 5E9XA 2D0HA 4MB1A 4P7OA 4RL3A 1OX4B 2ZX9A 1EJXC 1XYBA 4W93A 5M03A 2QUNA 3KCLA 1GUVA 2Q71A 2WMHA 4M6PA 2WM0A 4O1DA 1JEZA 4Q8WA 2PU1A 2TSYA 1G69A 3URNA 2UY4A 1IZJA 1PX3A 1FWWA 3GTNA 5DMMA 4MKVA 1Q6GA 1TE1A 2PBGA 1S2WA 3O0KA 1LG2A 5HULA 3UGRA 1W3KA 2VR2A 2CBUA 3R5EA 2JGQA 1E6RA 1PKMA 3UR5A 3H4WA 1QPQA 3A21A 4H9ZA 4MDOA 4R34A 2AQOA 3TW6A 1GVRA 3AALA 1V7AA 4GD0A 2IXUA 3T55A 1YDVA 1GHSA 4A8NA 3WQ8A 3GFZA 1WAUA 4Q22A 2CYGA 4R9XA 5HWMA 2IXVA 2PTYA 2GGJA 1EGZA 1XSIA 1D9EA 2PWEA 5TF0A 4XQ6A 3TONA 1CXFA 2VC5A 5DY2A 2PWUA 2EPLX 2E8YA 2HK1A 1ITQA 4ZQOA 3SY5A 2WPGA 3VPLA 3O15A 1RJQA 5I3KA 1O95A 4PUWA 1U5VA 1IYXA 1XCXA 5H8MA 1JYVA 3WSUA 3BOXA 4LY8A 4RXGA 4LF1A 2OLAA 3MUAA 2FGZA 4YHEA 2POZA 2A3CA 1XYZA 1HT6A 2WWDA 4A2RA 1IWAA 4Q7BA 5CPLA 1JCMP 3WFAA 4BI7A 2Z2AA 3HPXA 4ZMGA 2BHYA 3WH5A 3USBA 1PYMA 3N6QA 4US6A 2VM8A 3MHFA 2B0MA 1JZ2A 2A7PA 3S0CA 1XLCA 3OEXA 2D3LA 1W91A 2BNJA 1HFBA 1MDLA 3UPMA 2FH8A 2DORA 2DFAA 1DOSA 1JFXA 4JX4A 2QF7A 3VU2A 1UD2A 5CPNA 3Q58A 4PTVA 2YL5A 2NWRA 4AU0A 2ZRUA 4PMYA 4ACZA 2CIPA 4EE9A 1B90A 2YDAA 3PTQA 3RNDA 5HNRA 2CZVA 4GABA 4FAMA 4AD0A 5G4WA 4LUTA 4PFMA 4IH3A 3AIEA 3QY8A 1TV4A 2WM1A 3FDKA 4H6EA 2UY5A 3KWXA 4WX2A 4K1GA 3FJ4A 1PKNA 3OJGA 3W87A 3FXGA 2PA6A 1V6XA 3KRUA 4J3TA 1O1ZA 2JGYA 4NG3A 4JGDA 4AC1X 2Y5EA 2XM2A 3WLSA 1EP2A 3CUHA 5EKYA 2PDYA 1WKDA 5CBBA 1IGWA 3C56A 5CJMA 1UHVA 1ZUAX 2I56A 1ZJHA 3MP4A 3IEBA 4NSBA 1SSGA 4GINA 4UZSA 3KEHA 5I3HA 2IW0A 3B97A 4U31A 4Q7NA 1JUBA 2HMCA 1EPVA 4NZ5A 5FAGA 2OSYA 3I7SA 3K2GA 3GM8A 3OGSA 2BB0A 1Y65A 2ZKMX 4TX8A 3IIVA 4F0SA 1DWFM 3AWNA 4HPHA 1KKOA 3OIXA 3P93A 3W73A 3LSBA 1S2UA 1FH7A 3KOWA 2OMAA 3IGUA 3EPMA 2DIJA 4M5PA 1JIBA 5DMLA 3W6YA 1BXNA 1FXPA 3UA3A 5HBFA 4N9CA 3S9YA 3SGZA 1WNOA 2IPFA 3KOYA 1UB3A 4F0RA 3PZUA 3R0DA 4PB3A 1FHLA 9RUBA 4ZA0A 4Z17A 1YPIA 1NAL1 4XIAA 1QNPA 2PP1A 4O17A 1W3HA 1OC7A 4D1JA 3O8AA 1EDGA 5HNUA 1JDAA 2I5QA 5IOBA 1WUEA 3VGFA 3ZJKA 3RM8A 1B54A 2XU2A 3UA4A 4ZE4A 4GUGA 1KFWA 2V6AA 3BWWA 3DC0A 8TIMA 1BPLB 2XUCA 3WBXA 4S23A 2GQ8A 2GJXA 2MNRA 1V51A 2QCNA 2VD9A 3DFQA 1IEVA 1U1UA 3K8MA 3H8AA 3ZS4A 3S2LA 2BXZA 4AIEA 4M19A 3LRLA 3AWOA 3BMWA 2QEZA 1T96A 3GH7A 2LLEA 1V3KA 4HHPA 4H9XA 4NZCA 3CT2A 3SCUA 3RDKA 1KM5A 1YEYA 1XLEA 2J27A 3KL5A 3NZRA 1K4GA 4AHQA 1A5AA 1TV8A 3AXXA 1OFOA 4UTWC 1UP0A 1JQXA 2QDGA 3O6DA 3BMVA 2HWGA 3KS5A 2VC6A 1J12A 1JULA 3W02A 4UC5A 1QPRA 2R1LA 3C2OA 4J3XA 4CD7A 3QR3A 5HUOA 3U4AA 3P84A 3KOFA 4BCEA 4EP8C 3FXYA 4BHYA 5A1AA 4J35A 3QSTA 3OLDA 1X38A 4O28A 4PMOA 4UFIA 4LAOA 1PZ2A 4DM2A 5FEPA 4UOZA 4C6DA 2PGWA 3TYCA 1FH8A 2QLYA 4AF0B 3L23A 2D2OA 1X8CA 3ABZA 3DFNA 4B2DD 3GBEA 1A4MA 2VURA 3HM7A 2Q09A 4EAMA 3PBYA 3GKFA 3AIWA 4CCEA 4QCEA 1UR1A 1TMQA 3NTYA 1Q7QA 3U5UA 4DF1A 2XN2A 1OZMA 4C7GA 1UKPA 2NVDA 3WNPA 2DDXA 1IEXA 5I09A 3GG0A 3RMEA 4PODA 5I2UA 2J13A 2VL4A 3G8EA 2ZQ0A 3TLLA 3TA6A 3EWXA 2FGBA 4LV4A 4C1LA 3MW7A 4CLMA 3R6IA 1S5MA 3SZ8A 3UQNA 4N0RA 4INFA 1R3YA 4FOKA 1GCYA 3O7UA 1F61A 3WMCA 2X0HA 3MI6A 4GY1A 2PP3A 3S47A 2F6XA 1R30A 2E5BA 2WV8A 3W7NA 3MANA 3GG7A 3N2TA 3K30A 3SCNA 3UWUA 2FVMA 4E8GA 3G1DA 2ON3A 4ZOCA 1ZGDA 3HV8A 3CEPA 1BGAA 2W3ZA 4AIOA 1O4UA 4KEVA 1UZHA 4MJMA 4UNKA 1HP5A 1MDRA 1G0CA 3GNOA 1ALDA 1FTXA 2FH6A 3VOCA 3B8DA 1FHUA 2A85A 1U33A 4M6VA 1E56A 1OINA 3RCMA 4ZBCA 3VIOA 3GE7A 4GVFA 4LB3A 5HWNA 4W84A 4PULA 3B8VA 1ZQ5A 1LWIA 1WCGA 3E6EA 3URQA 3PUGA 3NZGA 5BMWA 3WENA 3FFSA 3ALFA 1VIWA 4V33A 4FA3A 1L0PA 3CUGA 3V75A 2C6QA 1WA3A 2WC7A 3GB6A 2EQDA 3ES7A 1FDYA 1H4PA 2QCFA 4DHGA 5E9AA 1K9TA 1RHCA 4PTWA 1Q6EA 4UTHA 3M44A 1KFJA 4YVPA 4AEEA 1ZZMA 3KZPA 1SZFA 3E2QA 2GYIA 3WJZA 2W67A 1PXGA 1RLCL 1UZ1A 3S83A 3ARSA 3DKLA 2QAFA 3FJ6A 4LBSA 1CPUA 5I7GA 1JG9A 1BVZA 4FLOA 4PC8A 3FYYA 3TC6A 5EFDA 1KXTA 3AMDA 3UXIA 3N18A 4M1RA 2ISFA 3N04A 1E6PA 2AMXA 3P6LA 2OGJA 4O1BA 2XYLA 2VCCA 3AHZA 4XD4A 4S3CA 1V08A 1ZCCA 4GQRA 4W8BA 3FAXA 2NQ9A 3CL6A 1XV8A 5CC6A 3SRKA 1RJRA 3APYA 3B0XA 3S6TA 1LCOA 3AMCA 4PCSA 2HRWA 2CHOA 1CXEA 1WOBA 1YADA 4FB7A 4JR5A 4C6BA 1BWKA 4RLIA 1P1XA 5AY7A 3AFBA 1JXJA 3RPDA 2V5JA 2QPXA 3GS6A 3CM4A 3FJNA 4H8NA 1W9UA 1YIXA 1V79A 5LXEA 3BQ5A 4TX6A 1EHAA 2OX1A 3LM3A 5D2XA 4IG2B 3BO9A 3AIRA 4D6JA 1R0MA 2E6DA 4JTGA 4XBKA 3GQYA 4UFMA 3RG6A 1JZ7A 4M24A 3N9RA 3E3HA 4QFUA 2D23A 5LA2A 3R25A 2KAUC 4O12A 1IEIA 1REQA 3AZRA 3KBJA 1I1WA 1FWDC 4PFHA 3A64A 1XSKA 1XLMA 2GVGA 3NSMA 2CLLA 2HPIA 2E9MA 4LC8A 2OODA 2DZUA 4R27A 3STGA 3TCSA 3DERA 4OUIA 1SZNA 4UR7A 1YNQA 1DL3A 4TOQA 1CWYA 2V63A 5I3DA 3TIMA 3SCVA 3PP7A 1TVPA 3PUEA 3U7VA 2OZ8A 3CHEA 3WD0A 2BASA 1FWHC 1XBYA 5CKSA 1I45A 3TN6A 3CQHA 4CQBA 1UD5A 1CNVA 4FPSA 4HNNA 5GVJA 1J11A 2Z0IA 4IICA 1JQVA 3R8GA 1SW3A 2E7FA 4MF4A 4IPNB 3POCA 2AL2A 3W22A 3TX9A 4S1FA 4I9JA 3O3RA 3TOYA 3IGXA 1LT7A 2CBVA 2VOTA 1F3WA 1QK0A 3MDUA 5AFDA 3S1XA 3WDIA 3CO4A 4DJDD 1DPMA 1CCWB 2G3NA 3B8IA 1E1CA 3TYUA 2XINA 2YCLB 2XSBA 1UJQA 1Z7AA 3BW2A 1NOFA 3VA8A 4M8UA 1O6IA 3R89A 1E1EA 1LUCA 3LUTA 2Z25A 2GFTA 1LF1A 2GJNA 1TMHA 2XN1A 1GPFA 3GVWA 4Z0JA 3A9BA 2JEQA 4QLKA 4ZQNA 4FNPA 2WVSA 5T9CE 2VMFA 1ITUA 4QITA 2ICSA 3BJSA 3TC7A 1FH9A 2J6VA 3L0KA 3RU8X 1U5JA 3ARWA 4CNUA 4AZ6A 1XCWA 1GQNA 2XH7A 3WDPP 1UH3A 2AQWA 3WF4A 4DIAA 4IUGA 1V6WA 3DBPA 4RK8A 2EG6A 1NF7A 2Z26A 3MHUA 1AODA 1GQLA 3AQUA 1WDQA 5LSMA 2YA1A 4AD1A 4JL2A 2I57A 2WNQA 1OVDA 3UY7A 4LAUA 4RE0A 5HQLA 2WHJA 3LGEA 1I2RA 2V30A 4NAEB 3NPXA 3PG9A 1JAKA 3WN6A 2B4GA 3ZWTA 2CPUA 2OXNA 4IWWA 3QZ6A 5HJLA 5SWUA 2IPWA 4AY7A 4R7JA 3C0LA 2E25A 1BQCA 3KRBA 2VZUA 4PUUA 2I14A 4LF2A 1DJWA 1M7XA 4CCZA 1QPOA 4RNIA 3SUWA 2YL6A 2YKKA 5CZTA 3WFZA 4W88A 1LBMA 2EHHA 2QMJA 2H3DA 3NVDA 3B9AA 2QCHA 3ANYA 4JTDA 1TO3A 4JTJA 1VAHA 3RR1A 4MPQA 4NI3A 1KRCC 2DH3A 3GTFA 1DIDA 1TFVA 2OJPA 1XISA 3CWNA 1H61A 4FNQA 2G41A 3HPAA 3MSGA 1E6NA 4DAIA 4QDPA 1VENA 3C3NA 2I7GA 2OOFA 2F2KA 1OYAA 1EL3A 2O9OA 4LAZA 1VBGA 2DSWA 2DT0A 3NQBA 4C6LA 2IPJA 5BXTA 2P5NA 3VNJA 2WVTA 3NA8A 3SJ3A 3U2ZA 2WWCA 4G2DA 4GK8A 4P8XA 3BAIA 3G1AA 1ZP4A 4WJXA 3R11A 3OO2A 1XC6A 3H54A 3OU8A 3BLLA 2FZ9A 3QFWA 2PODA 1OGGA 3MCNA 3TTYA 3N17A 2EJ1A 3C8NA 2OB3A 4DYJA 1GJWA 3WQ6A 3MZ2A 3CZKA 4ONVA 2WVUA 3W7JA 3IV8A 1KGWA 1XI3A 3FDGA 1GQJA 1IZCA 1OBAA 3STFA 3S4TA 5AHIA 1J2BA 1DWJM 3P60A 1XRVA 2J9YA 4PMXA 2V0TA 3MCMA 5I07A 2XFYA 3K46A 4D72A 4LYQA 4AY8A 4YNGA 3W01A 4V28A 1Q66A 3SIZA 4LC6A 5A8NA 4JX5A 4EWJA 4AG0A 3W76A 2EG7A 3W75A 3VGGA 2WPBA 1MXGA 1RUSA 2YLAA 1W6TA 5DX7A 3GR4A 1IWPA 1UH4A 2X1UA 1JL8A 1S46A 3LK6A 2GVYA 2J7GA 4X63A 1OX4A 3RJYA 3W7OA 5FF2A 4DO4A 3AXMA 1TZ7A 1OCBA 3OG2A 5T26A 1DIOA 3WQCA 4GIRA 1F6YA 3TSMA 4AWEA 2BLEA 2ZXQA 4GZ7A 2CHNA 2ZTJA 1ISZA 2QR6A 4FX6M 1SO5A 4OJYA 7CGTA 4UZUA 1Z42A 2VDGA 4UTFA 3B4YA 1BTMA 2X09A 2I5IA 1B3WA 4MDPA 4HYRA 1H11A 2BP1A 1M6JA 2QS8A 3HV9A 3PULA 4CU6A 1H3GA 3GRIA 4LS2A 2YCKX 4EK7A 1EJRC 3QC3A 3K5XA 5TNVA 3K1GA 2I9EA 2AKMA 4NZ3A 3PZ9A 2UZ9A 4OV9A 5LXXA 4M81A 5A6TC 4W85A 4J2MA 3ZWSA 1CB7B 4NRSA 2YZ5A 3GTXA 4NAFA 4DM1A 3CAKA 3VE7A 1PZ1A 3E0VA 3H2AA 3KXQA 4J2PA 3PPHA 5JH2A 2ZXDA 3G6LA 1QHOA 1WKYA 1SZEA 2PF0A 3LCLA 2QUMA 3T2QA 1XYFA 5FOOA 2VZVA 2GPTA 1GYNA 3NDOA 1K77A 1OY0A 2ZUWA 1CXKA 3PF3A 2O9RA 4GJ1A 4DX3A 3PBWA 5AVNA 1B5TA 1B4KA 3GNPA 1GORA 5CZKA 2TPSA 1C8YA 1QBAA 1QI5A 2QUTA 2X7VA 3NL2A 4GI9A 2Q6ZA 3NDZA 2GQAA 5D02A 3UJRA 1V93A 5LGZA 5D32A 2V81A 2HV5A 3A3WA 3VINA 2V5KA 1KXHA 4I9TA 1F6PA 3QY6A 3LHUA 3LPFA 3RM4A 1WYIA 3FX4A 4I9MA 1FY6A 2WCAA 1LQ2A 4JHMA 3ABSA 5FJRA 1FOBA 3MZNA 4A4AA 1SW7A 1SMAA 3JVAA 3ERPA 4NJJA 4GX8A 2D1ZA 1EPXA 1PX4A 2P3ZA 2XGBA 3H2NA 3L5LA 4IMCA 5BRBA 5AVHA 5C9RA 2POTA 1QNQA 4WGHA 3R1ZA 2XHYA 1D2KA 5KTLA 3W27A 2P8BA 4I7WA 3ZJ8A 4CD6A 5JIPA 4LNYA 1ZJBA 3QN3A 2W9MA 3GDLA 5JIWA 5HR6A 3KDOA 4NJKA 5M5DA 3A4XA 4O16A 2WHKA 1OADA 4ZQPA 1XC4A 1OG0A 3DHPA 1Q13A 1FP9A 2X41A 2OWXA 1TPDA 4ZGYA 1TCDA 4OTKA 2Y8UA 1AQMA 2ATMA 5HA7A 3NO5A 4FXRA 1WX0A 3IUHA 5G5IA 1OZQA 4M0XA 4HVXA 4UMAA 3VKKA 3LLDA 3W1TA 4AWTA 3E49A 2BFGA 4DUWA 1H1ZA 1CT5A 3LBCA 2PPGA 4WZHA 3WUEA 2GK1B 3CTTA 3E12A 1SFLA 1EH9A 4Q6JA 2OSXA 1IZKA 3O07A 1GGOA 4O4WA 3ITLA 2PC4A 3D46A 4GQBA 5DRIA 3S5NA 3QV9A 1XXXA 4UMCA 1P1MA 4PMVA 3A4JA 1XH0A 4C65A 2JK2A 1GZGA 4C5YA 2QJJA 1HTIA 1SR0A 2XN0A 3MS8A 1BF6A 1ZALA 4D6CA 2QVHA 1BWVA 2G3IA 4NY2A 1A4LA 2DIKA 1J0KA 3KDNA 4E2VA 4KEMA 3MBFA 3PS7A 1G4SA 5I6SA 3OZYA 3GZAA 3UD6A 2QJGA 1RJPA 1XDMA 5LGXA 5E70A 4FR1A 3WK3A 3GX9A 1S3TC 3NL3A 4AEFA 1OFAA 2O9TA 4Z2JA 1UCWA 2DGAA 3QTGA 1JZ6A 1XM3A 3SR7A 1UWSA 2YXOA 1IEWA 1QI0A 4F2UA 3FIGA 4O4VA 3H26A 3N6HA 3HFYA 3KVKA 4RW3A 5XINA 5AHEA 4F0HA 3ZM8A 3B8TA 4UTWA 4NX5A 4PN2A 3L12A 4D2JA 3E96A 3NQDA 4IF2A 2QV5A 4JHOA 3UWYA 1OK4A 2W5FA 4XAYA 4MPKA 1ITCA 4MYAA 4WDTA 2G4JA 1UWQA 2L5HA 3F4CA 2D2JA 2F7FA 1P6CA 4PGLA 2VUNA 4D6GA 4W4QA 4D8ZA 1US3A 5AC6A 2W92A 5AHFA 3WUFA 3RN6A 1DJQA 4JN6A 4GNVA 4UTIA 2DSUA 4JTUA 1PZ0A 1W8GA 1BGGA 3GW3A 3L5MA 2PE4A 4I9AA 3GH5A 4P8WA 3NYDA 5T91A 1VRXA 3QHOA 2WCGA 4JHZA 1HL8A 3GXFA 4L9ZA 3F4VA 4CQAA 4TVDA 2JE8A 4Q4RA 3VOGA 1VPXA 2QF8A 4AMCA 3GH4A 4UUIA 3S8HA 3LCXA 4YTRA 4AF0A 3AO0A 1VFUA 2D22A 2MUCA 3UBPC 4PMZA 1I75A 3LRKA 4YTTA 1TJ1A 1I2QA 3LGDA 3BLOA 1ICQA 3H22A 3AXIA 4R33A 1IR1A 1J0YA 2VEMA 1QT1A 3ITCA 3QV7A 4J4KA 3SIMA 3M0JA 4ZSTA 1W1B1 4TR9A 4HA3A 2QQ6A 3T7VA 5DMNA 3OYZA 1WXYA 4KIEA 1ICSA 1DJGA 4NVTA 4BEUA 1BWLA 8CGTA 3NJ3A 3GNDA 3AXHA 1P0DA 1W3LA 3EXTA 1PWLA 2W63A 1GOXA 4L61A 1XIBA 4JNYA 4K8EA 1TTPA 4CQ8A 5A2AA 1BRLB 4R53A 1N8WA 2E6AA 3CIVA 4JN8A 1H49A 3I4KA 5D9PA 5I3IA 1XG4A 1VJZA 2DZWA 4MHBA 4GXPA 3NXFA 2BOGX 2CESA 1MNZA 4YIWA 2VZOA 1MZRA 1C92A 2J7BA 2Y5JA 1XDLA 2OCZA 2BY0A 5XIMA 2O56A 1PTDA 1UUOA 2Z1SA 1XIHA 3BE7A 1R2TA 1UKTA 1G6CA 4ERIA 3UVIA 1AJ2A 3KHJA 4XBJA 1XH2A 3URBA 3WQDA 1EO7A 5BU9A 3CPUA 2A7NA 1EF3A 1E40A 4MZ8A 3MPGA 5J5DA 1OFQA 4LCQA 5FL1A 2E5DA 3DH7A 4B5VA 5M1TA 3MBDA 3WUGA 3CB8A 4AIUA 1U30A 4LEFA 2PDLA 4AUBA 2ZZ1A 3SN0A 2A6NA 2PURA 3O6YX 3DX5A 3WLMA 2FPVA 1H2JA 5C0QA 2Y62A 3CAWA 4LBRA 4A3UA 4GI4A 3MDWA 3I3DA 2W66A 4L65A 3WQGA 4B2DA 3IRDA 2ISVA 4I8YA 2PRHA 3NEVA 1CGVA 1KXQA 3RCNA 1WZMA 1GTHA 3W7LA 1GOKA 4QISA 4AZCA 1O1HA 5DLCA 2PDGA 4Q4OA 3RX2A 2VCAA 4AYSA 4FO4A 4DWDA 4KW2A 1W1A1 1EJUC 2VEKA 1V0MA 1YXDA 4XG1A 2Z28A 3PPCA 2ABBA 1UR0A 3G0UA 2YZRA 4E4UA 4QS6A 3DHFA 1FVPA 1LLWA 3FY1A 2Z7KA 4JQAA 2VYOA 1FWNA 3VNIA 1YNPA 3W7HA 2J78A 3XISA 4DJFD 3AOFA 3S1VA 4H4IA 4GFIA 2XVKA 3W6LA 4GH3A 5I5RA 3JUGA 4O15A 1AW2A 2GL5A 3UZYA 1X6LA 4S3AA 5A6BD 1HZYA 5U4NA 1YBQB 1QNOA 1OYBA 3W9ZA 2Q3RA 4XZBA 4ROPA 3B05A 4LUYA 6TIMA 4CKQA 3U8GA 4MWAE 5DANA 4MLRA 1BEUA 1CDGA 4ZO8A 2ZOXA 5EU9A 4C1NB 4EXBA 3MO4A 4US5D 3EKLA 1MSSA 1TV2A 3M47A 2FFIA 3R43A 1R3QA 4PTMA 4Q4SA 4Y8EA 5DRCA 2QJHA 3OLGA 1SVDA 4C5ZA 4EXAA 2IKGA 3NQ6A 1AJZA 1HQTA 2FTYA 3GDMA 3IVSA 2V3FA 3F4DA 5DY3A 1IQ8A 4I6VA 4MKNA 4RJEA 4AB4A 4FXJA 3F5LA 5DT7A 3ICJA 4X3ZA 5FACA 3WMLA 4IG2A 2ZZ2A 2QKFA 3GLCA 5D8WA 1TB3A 3MU7A 3MMUA 3CWOX 4BEQA 3THQA 3WD4A 4B5NA 1B0IA 1ZCOA 3PANA 2VZTA 4RW5A 1HUVA 3GVGA 3LDVA 3FLUA 2J7CA 1EJTC 3VABA 5D2TA 1G9HA 4L5ZA 2J7FA 1I2PA 4UMBA 4IMEA 3QF0A 5C2GA 4QROA 3A4WA 3QZEA 4OHQA 4OE7A 4BI5A 1L2QA 2OQYA 3BICA 4UBPC 2J79A 1V0NA 1U5HA 2WBKA 3HQOA 4XUYA 2R1MA 4JEQA 4H6RA 1QI4A 3R10A 1YNYA 3G24A 2FHBA 1J10A 1UIOA 3GR7A 1WE5A 3GHRA 4S3GA 5A8PA 8RUCA 3O0FA 2PDXA 1CLKA 3M4HA 4XTDA 3QV8A 1A5LC 3RLVA 2Z2BA 1MQRA 4KCUA 4K39A 1OIMA 1Q6DA 2G97A 4G5DA 1KKRA 4A3HA 4IGNA 4XAZA 3AIVA 3OTRA 5D37A 3GG8A 5DCBA 3LY0A 5CAHA 3LHTA 4WSHA 4DLFA 2VEFA 5I3FA 3LMZA 3PM6A 3UWZA 2YW3A 3ORWA 2YCLA 2HNHA 3EWDA 4ZOAA 3DBNA 3BGAA 4YLWA 1XGDA 4IT1A 3AHXA 5HJXA 4CCDA 1AH3A 1H0IA 5MF5A 4K6AA 3AISA 3W2JA 1YLVA 3HG5A 4QM1A 3P0XA 3A12A 3DYMA 3E74A 1ZJAA 1A50A 2W4XA 3N3MA 4WDUA 1PHWA 1TUXA 2I1OA 1TREA 3U2EA 2VC7A 1L8PA 1DJZA 1KCZA 4PMRA 2ABAA 3MSDA 3R0KA 1EJSC 4KRTA 1BYDA 3WLPA 1DBTA 3OW1A 1XIJA 1JFHA 3S1UA 1DV7A 3N4AA 1TA3B 5HQMA 1AQHA 2WMFA 9XIMA 4YTUA 4NXSA 3VM5A 1A0DA 3HTWA 3AXKA 3TWBA 3HA1A 4H8HA 4DPQA 3S5ZA 3L67A 2QV4A 3NL5A 2Z6IA 1E3ZA 4HMNA 3C2FA 3OHIA 4NAEA 3KBWA 3T4WA 1DIEA 3VUSA 1E0WA 4LXFA 4WUIA 4LCSA 4QEHA 2JFEX 3QZAA 4LJ3A 3AROA 4HJFA 4C6IA 3PZIA 4JTIA 1E1FA 1JCJA 1XIGA 5T8GA 1PJ9A 1HJUA 2GGHA 3O6AA 4NYUA 2OEJA 4KCWA 1IE7C 4ZFCA 3L5AA 1K70A 2IKJA 2J88A 2BS9A 4HZMA 1OF8A 1UASA 5A6LA 3EX2A 5CJNA 4Z1BA 4C91A 1IXOA 1EEXA 1W5PA 2DZXA 3QLDA 4GRSA 3HU7A 1C8QA 4Y9AA 1Z69A 4J3WA 1A0CA 3UYIA 3TW7A 2ZRYA 3CV7A 5EMMA 1XUZA 1ZAHA 5E93A 4A8IA 5G1TA 3LXAA 3T0TA 2QW5A 1UOZA 2ZRXA 4A8RA 5LNUA 4F40A 3PAJA 4L9XA 5E09A 1LQ0A 3OVGA 1B1YA 1SPQA 1Z8AA 4IHCA 2QJIA 4FMVA 2JF7A 5JU6A 4GYJA 1W5MA 3OA5A 4P7LA 4JFTA 2V82A 3AS0A 3NIYA 5DO8A 3LPOA 1WBHA 1PZ3A 4V27A 1JI1A 3AS3A 2PFHA 3M0YA 4QRNA 1NOUA 1GJUA 3MUZ1 2A2IA 3S1GA 4E0CA 2G95A 2WJDA 1EC8A 3KE0A 3LCGA 1NDZA 1XX1A 2PCQA 1T41A 2P88A 5A5WA 4DI9A 4MNLA 3QPYA 3VUPA 1UC5A 5EMYA 1EA0A 3FEQA 2VR4A 2OQLA 3LQLA 3UXAA 2FB3A 4AZ5A 2WZTA 4EPBC 3A47A 3EX1A 4HNOA 1D3CA 3CH0A 3TTOA 2VR5A 3EOOA 1HN1A 1VBRA 2V2CA 3WUBA 4IIGA 1WDWA 5CSRA 1VP5A 3WQOA 4XISA 3Q37A 2HZGA 2PDMA 3EDJA 3FNDA 3BTNA 3BLKA 3M16A 4G7FA 4BS0A 4DYEA 3JRKA 2NV1A 2ZC1A 1XRSA 3UR2A 1SW0A 1EYWA 4GUJA 1A5NC 5TQLA 4QSHA 3EA1A 4MMWA 3U5YA 4GIEA 3WQWA 3C2EA 4QG6A 4NRRA 2PWHA 2CLHA 4KMQA 3NDYA 3S2MA 1LT8A 4E3VA 2J25A 2V3GA 5DELA 3M0MA 1UC4A 3HO8A 4NYYA 3UZWA 4CN4A 3VOHA 1TPB1 3SQSA 3TDFA 2OYLA 2PSNA 3EEGA 3POHA 2OGYA 2X2YA 1VLIA 5DMYA 1PL9A 4PA8A 1YXYA 2HPMA 4IP5A 1ZP3A 3CH9A 2J75A 3CK5A 4DNHA 4FALA 3LHWA 4GVHA 2WJZA 1A5BA 4X22A 1MUMA 3WDHA 2AGTA 3UNTA 8A3HA 3OZPA 3MA8A 1HO1A 2PC8A 4B91A 3HG3A 3BAXA 3ARQA 3FW6A 5FF4A 2P0IA 2CCRA 4IIFA 3UP8A 1EUAA 4ALDA 1FWRA 3ARZA 4O14A 4UR8A 3SO7A 3DFTA 1NARA 3LNMA 1XYLA 4QCFA 4LPCA 2CWNA 2WANA 4ADUA 4B16A 1UD8A 1DHPA 4WQ6A 2X8RA 5C8BB 5K7JA 3L4UA 1QW8A 4B5XA 1E9IA 2ZZ4A 4JN7A 4S39A 4AZ7A 1W32A 1EKOA 1PKLA 4MUPA 1ZENA 3RIKA 2WO5A 4B5WA 3D0CA 4GC4A 5FF0A 3PWGA 1B9BA 3OZMA 1TPFA 1EP3A 2D3NA 1RAKA 2Z1KA 2EXOA 3K8LA 4O1CA 3WBYA 4E2BA 3VI2A 4JIHA 1LQAA 4YHGA 3M0KA 2NUYA 1VYRA 3I3EA 4DO7A 3TYAA 2PCEA 1GG1A 3W3OA 4IPIA 3WQVA 2JEPA 3OOQA 3QYSA 1VCFA 5FAJA 1DKWA 2HJPA 1E71M 3OA3A 5IHRA 3WNKA 1F73A 3UEQA 3E2VA 3PAOA 3C61A 4HB7A 3QMSA 4AXKA 1DJNA 4D1IA 5C54A 1PIGA 3EWCA 4GXWA 3F4WA 5F1UA 4O57A 4XAFA 1MFUA 3H7RA 4FNRA 3T2PA 1EDQA 1TR9A 3J7HA 1W31A 4HK6A 3T0CA 4QS5A 3FEMA 3BLPX 4JCMA 5EYWA 3HPSA 4B92A 4JIEA 4E8DA 4GYFA 3O2LA 3P7YA 3CASA 4QHRA 3H12A 3PPGA 1YTDA 1WDPA 4TMCA 1ISWA 4XVDA 3AIUA 4FR6A 1KM0A 4MB3A 3I6EA 3GDKA 2KX9A 1QI3A 1QWGA 3K13A 3WBWA 3MJYA 1F4HA 1GZ1A 3F7JA 1QUMA 2EPHA 3E0IA 3TNOA 3WMSA 2BVTA 3INPA 2XH0A 4M1BA 1VIZA 3NQVA 4OIFA 3Q4DA 4OV4A 4OQVA 4J3VA 1PCWA 4UTLA 4PUDA 1NFPA 5LYRA 3B9DA 1ESWA 3RU6A 1OCJA 4IGHA 3U7BA 3GNXA 5E0CA 4WSKA 2PAJA 2OLHA 3KRSA 2WMKA 1QOQA 4GO9A 3TJIA 1ODUA 3CL8A 1W9XA 3WLOA 1LOQA 1Q8AA 1LRTA 4KWSA 3EYPA 4XZLX 1XLJA 5LNRA 2CLEA 3SCTA 4WHBA 3GVQA 3IJ9A 7REQB 2ANUA 1R86A 3FAWA 5CH9A 2PDQA 1XYAA 4KRZA 3WLIA 2GGGA 1T6MA 3KWSA 1XGZA 1DTUA 5HMEA 3KUMA 3A23A 3O06A 3XIMA 3T09A 3QOMA 1TJ2A 1SQ7A 3U4FA 4FLSA 3H4GA 3MMTA 2GK1A 1IIHA 1YRRA 3AHVA 3BOLA 1M68A 1SR9A 3PWAA 3I4EA 1K7XA 4DZHA 1AW5A 4Z1AA 3L4WA 5EMKA 3QKEA 3UY8A 1HJQA 3W28A 3SN1A 1V4YA 3ABXA 1ZU8A 3RX3A 2ACUA 4FOUA 4M6UA 5FEXA 6REQA 2Q01A 1K02A 2GSHA 3EDKA 4N4QA 3PSVA 3GD6A 4Y9PA 3HMCA 5A8QA 3BAWA 4M56A 2UY3A 1F3XA 2EKCA 2DT2A 4HNCA 3N4FA 1KBJA 3B8SA 4UQDA 1YXCA 2PS2A 4X0NA 1CTNA 3KL0A 3G1VA 3BZGA 1OFEA 1TIMA 3M5YA 3MT1A 4FXFA 4DI8A 3F2CA 3O1NA 5E0KA 3G18A 3G8RA 3IIZA 3SUTA 4QLLA 2EPKX 2GDQA 3W1LA 4H6KA 4M7SA 4PH6A 5D38A 4JTHA 2XIOA 1Q65A 3DIPA 3CU2A 3GC4A 4YS1A 3KM8A 4JYFA 2DVXA 3GXPA 1I8JA 5G1MA 1FP8A 4K36A 2RDWA 1N82A 3VNZA 2Y4SA 1BFNA 5AN7A 5CSSA 1LBFA 1V02A 3WQFA 2H8XA 4XD5A 1VHCA 3LHYA 1C9DA 3WO8A 4O13A 4MZYA 3TQVA 3BURA 4NHVA 3WH8A 1A0EA 1K6WA 2I9UA 3E0LA 4W7WA 4U2YA 2YB4A 2RGMA 5DXYA 4P61A 2G50A 3QPEA 2BDQA 1E4NA 2C1HA 4B5UA 3MQTA 3BCFA 1LL7A 3KCOA 5KETA 5FJTA 2NVCA 3U57A 4HMDA 1C93A 1CYGA 9XIAA 4EKJA 4WY0F 4I5RA 4MGGA 1TUFA 2GUUA 1BAGA 4JFSA 2V5LA 3USZA 3C2VA 4Z1CA 2Y7DA 3TAKA 3TNBA 4WXYA 4BQ2A 4FSAA 3LTPA 4LY4A 5ABHA 2JIWA 2VFGA 3M41A 2I5GA 2O4MA 1US2A 3GSMA 2DQXA 1GVYA 4AD4A 3C6CA 5CPSA 3H6OA 1DJXA 3BC9A 4JTSA 3FOKA 4I5XA 3AI0A 2Z27A 3NQ7A 3A9IA 3L4YA 4ILSA 2PWGA 3CUFA 3VD3A 1L6WA 4AEOA 3EDDA 4YU1A 2HQAA 1HL2A 1BRLA 4PCPA 1CBGA 4TUFA 3C86A 1OG6A 4G56A 1PPIA 1B3VA 1NOWA 3PSWA 3L7RA 3KCJA 1DP0A 1XPYA 1B3ZA 1YYAA 1J6PA 2PRMA 3CHFA 4AD5A 5GQBA 4KEUA 2YYTA 4RNFA 4D8LA 2D2GA 3W1AA 2VFHA 1RK5A 1EDTA 1MYRA 2HISA 3QTPA 4WIWA 4R9OA 2DW7A 3EWWA 1VKFA 1XGEA 3NURA 5JVLA 1JCTA 3ARTA 2QJNA 1OFPA 3L68A 3GTIA 2WZMA 3GU2A 5H91A 2ALRA 2V9DA 4H6QA 4NZJA 5G4EA 1YQ2A 2CKSA 2FZNA 3AMKA 5GPRA 1ISXA 1RPKA 4K7VA 1J5SA 3NGFA 3UG8A 2ASHA 4MVAA 1RZMA 4P5UA 2OT1A 1HGWA 4MYXA 3TZNA 3I10A 2J4GA 1LM1A 3UVAA 5K3VA 2QCLA 2EPNA 1FWEC 5BXSA 4YTSA 1RH9A 2ZXAA 2GGEA 4NZ4A 1J0HA 2FHCA 1S1PA 2ZDRA 4DUXA 2GDUA 3TYZA 3U3HA 1K7EA 1LROA 5AYBA 5F2IA 1GOIA 4DO5A 1UQYA 1RD6A 3F5KA 1M1BA 3MKKA 2E67A 4UQBA 3EWYA 3WL1A 4AMAA 4JTRA 3VIPA 2J77A 4BQ4A 4PYSA 4GMEA 4GG9A 2J8GA 4NNAA 4XVEA 3STCA 1L8NA 1AMKA 3R12A 2OX4A 4TMBA 3T0DA 3AAMA 2BBFA 3VO0A 1BKSA 4GJJA 1XL9A 1PTGA 5JMUA 2AMGA 1X1ZA 1OCNA 3T8LA 1KM1A 1YBQA 1SUXA 2OYKA 3WNNA 3N73A 5J8LA 1HO4A 3TMLA 4OBTA 2CBIA 5A95A 2UY2A 2XIIA 4X0VA 1QPKA 2Q3OA 4M80A 1M65A 2HROA 2VGIA 3WF1A 1F9CA 3L2IA 4CNPA 4CEUC 5AHNA 2WSYA 4JIIX 4DYKA 5AC4A 5FL0A 3R8RA 1GYMA 3WF3A 3LYEA 4GWEA 4H9UA 2EKGA 4LNCA 3TJ4A 1K6AA 3G77A 1LRNA 4PL2A 1PE1A 2A3LA 1YMYA 5IBXA 1MI3A 5IXEA 1KNWA 1GKPA 3UGVA 1KR0A 3B0PA 4S3FA 2J7EA 2ZX6A 4I7VA 3W70A 3T05A 3WD2A 1CGXA 1M03A 1VFLA 4HP5A 1XSJA 2VNCA 3DFHA 1BSLA 3OLIA 1R3SA 2F6UA 4MJZA 4IIHA 1P4CA 1BVNP 3V1PA 1KV5A 4Y9MA 2G5WA 2DZAA 4QE5A 3MVIA 1UWRA 3CV2A 4GBDA 1E0UA 1H0GA 3A13A 3QJAA 3DC8A 3VKCA 3MP5A 2X42A 3V18A 3GDTA 3HQNA 1E0VA 1KV8A 1WKFA 3GXIA 2TYSA 4H9TA 3HJZA 5C70A 3H2CA 4DJFA 4ZQCA 4WKFA 4HCLA 4P7NA 4EWND 2P76A 3W29A 3W82A 3GXMA 2BV9A 3EMCA 2VOMA 1R8LA 4HYWA 1TRIA 4GI6A 3WQPA 3W86A 5DCDA 1G67A 4GISA 1KM2A 2RJGA 4LWWA 1YPFA 3THAA 2FHFA 4MY1A 4A3QA 4M7TA 4N4PA 4C1KA 1F4AA 1V6UA 3DDMA 1OX5A 2VDIA 2YYUA 4QDWA 4O18A 2X2GA 4ZVJA 4QX4A 4US5A 5M17A 4XWUA 4V1XA 2GSJA 1TV5A 2WHLA 1Y5XA 2ZX7A 2O4QA 1CEOA 1JGIA 1XIIA 4RR4A 5REQA 2PRLA 3CHVA 1PTAA 1KCLA 1UKQA 4IX0A 1A80A 5AC5A 2HEJA 3C0JA 3W4RA 2Q8LA 3TYBA 4O50A 3R79A 5JBFA 6PTDA 4XD3A 1S3HA 2FMNA 2VRQA 1H7OA 1LLZA 1HF6A 1D3GA 1N8IA 5C55A 1Z9AA 5CQ1A 4ZB0A 4D8AA 4H9YA 5AKQA 1HNYA 3U48A 3G1XA 2CITA 5EMUA 3CQIA 5PTDA 1DHKA 4HMCA 1XP3A 4O54A 2QGHA 2DVUA 3F4NA 2YXGA 3FKRA 2ODOA 4K1WA 1FFRA 2HE8A 2XVLA 2GJLA 3RLUA 4UCGA 3UG3A 3WBAA 3WELA 1TA3A 1E5NA 1SFJA 1W37A 4OVXA 3FYPA 3DENA 1JZ3A 4QEEA 2NLYA 2BTMA 4S3EA 4WVXA 1FHDA 5D9MA 1TTQA 2PD9A 2YDQA 4KFNA 2CC0A 1Q4WA 4NAFB 3PUOA 3VMOA 3WEMA 4WF7A 4AVOA 1D8CA 4PUNA 3RPTA 1U83A 2TMDA 3JS3A 5D2YA 1EGMA 1DXEA 5BMXA 1Q2RA 2YLLA 2A21A 1VH7A 1XRFA 4H83A 1JZ5A 3NM1A 3SSZA 3GU1A 1TWDA 4A22A 4HNVA 4WY0B 4PTXA 3II1A 1FWGC 5IHSA 3Q94A 5LKYA 1LOLA 4ES4A 4OGZA 4TV6A 4QJ3B 2XVPA 3NQGA 1XRTA 3QHMA 4LOCA 4KH2A 3W25A 1KFCA 4NF7A 1W54A 1OD0A 3IVUA 1IR2A 4Q8MA 3MUIA 1R5YA 5CZJA 3GWQA 1Z89A 2PDKA 9CGTA 1GJPA 1A49A 2AAAA 4QTGA 4N7QA 3DUGA 3EDEA 3LS9A 3UR7A 4DBDA 4XZMX 4FLQA 1L6FA 3O05A 3BMXA 1AD1A 3RM9A 3ZVIA 1K03A 2ZUNA 5H2ZA 5BWFA 3MHGA 3WNLA 3KVLA 1M01A 2YDRA 2YW4A 2GQ9A 4X60A 4XV0A 1X96A 1Q3NA 2Y70A 3EMQA 3ZSSA 3AJ7A 1EJVC 3GK0A 4W89A 1Y5WA 2HE5A 3BAJA 3HGRA 4OWGA 4FNUA 3UZXA 4HNLA 3WH6A 4GXMA 4UTJA 1OB0A 4LAMA 2CBJA 1LTDA 3A5FA 1XKJA 2X1SA 3CQ0A 2OG9A 1TELA 2R1NA 3T2OA 3SADA 1O66A 5ABEA 3U2CA 4QJ5B 1XQKA 3GNNA 3LTYA 3RLHA 4YPJA 2G4FA 1WZAA 3B9EA 1QO2A 4AWSA 2QJMA 4PRRA 4B4FA 1CECA 4CUCA 3SECA 3TLQA 2DSVA 1ODZA 1Z41A 4DWSB 1E3XA 2Y7FA 1KFKA 4H8VA 1S5VA 4DBSA 3MO7A 2ZUUA 4K37A 4E8CA 1XIMA 3DXIA 2J8FA 4HSNA 4KGLA 4DWSC 2YGYA 3WNOA 7A3HA 1IGSA 3H55A 4DF2A 2VX4A 4PUJA 1HW6A 1VFHA 2C18A 2CLFA 2GOUA 1UA3A 4P8VA 7ENLA 5BCAA 1T0OA 3UU0A 3KRZA 1R3TA 1B2YA 3LBMA 5GJNA 3N3TA 3STEA 4YCPA 2WMGA 3BH4A 4GYPA 3HPFA 3V5CA 1XQLA 2GVJA 4S3JA 2XZ9A 1WZKA 3RCYA 3FVMA 3RGTA 1AG1O 2BVWA 4YYFA 1Y7VA 2ALDA 4IGSA 3NZ1A 2B7OA 2PTXA 4HPJA 4Q3MA 2A3BA 4JQ3A 4OOZA 4AZHA 3V3WA 4K7YA 2KZHA 3EOSA 4RPPA 2WJEA 3DI1A 2NLIA 4WRHA 4IIBA 4OBSA 2WCSA 3KOXA 2WW5A 1HKIA 5CLTA 4TU1A 5T9BG 1TQJA 3H2OA 1SJCA 3FGCA 1TTIA 3GC5A 4JTQA 5BZAA 2BOEX 2YXXA 2ZDSA 1NJJA 3IPWA 4KCTA 4AD2A 3FHQA 4PMJA 3I68A 3CQJA 8XIMA 1UWAA 3ARRA 2VVSA 3LXCA 2BZNA 5G2HA 4O0KA 5DN1A 1ZAJA 3FN9A 5EBUA 4AHPA 2XTKA 3EEZA 3L2LA 3GVRA 4F79A 4H41A 4HYVA 1MFVA 3W85A 3CLWA 3IJIA 1ONXA 1TR1A 1XJBA 1OGBA 4B5SA 1QU4A 3E9AA 5CCZA 1QBBA 3WF0A 1NWSA 4ZL1A 1TE6A 3BLEA 3TUUA 3T81A 1PYFA 3B03A 1XFCA 4XD6A 4MJ2A 1XHGA 1C29A 1EXBA 3XINA 2WVVB 4KBXA 2Y63A 2R1KA 3UESA 3VIFA 4WOZA 3BOFA 3VOIA 4E3TA 4XZWA 3M0HA 2IQDA 1FBAA 2J8TA 3AIQA 2ZBTA 1B9ZA 2VWTA 2D20A 1DWHM 4YTQA 2I17A 4IOTA 4HD5A 1DJYA 3IIOA 1H50A 1VS1A 3OIHA 4E4FA 3E2RA 1UP3A 4PZVA 3CV6A 3HBLA 3UPWA 1W9PA 4H7CA 2VQUA 1J01A 2VXNA 1OK6A 3S46A 2OU4A 1IF2A 1KD0A 4JD4A 1JD7A 4E2OA 1UROA 1B3OA 3GU9A 5LHFA 2PGRA 3DI0A 3TV8A 4WD0A 2EBNA 2QYGA 4G8TA 3SGGA 5JBDA 5IRPA 4D6HA 1M41A 3VDBA 2OT0A 2Q8ZA 2BGNE 4ICMA 3N12A 2E1DA 2P1FA 3W26A 4EF8A 4JTFA 2QCDA 3HMJG 1FWIC 3VDHA 1W1PA 4GCAA 1O94A 4W8AA 5JQ9A 2EPMX 1IT8A 5A94A 1SZRA 1W5QA 1UW9A 4RDVA 3VIGA 1CLXA 3PJWA 4IFRA 4N6FA 5FEWA 2PWFA 3ZLFA 5KZDA 4A8LA 3BZJA 5HNNA 4ZTYA 4UFKA 3PJTA 1MW0A 4WXZA 2DZBA 5D09A 4QG9A 4FLRA