2PCQA

Crystal structure of putative dihydrodipicolinate synthase (ttha0737) from thermus thermophilus hb8
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
283
structure length
283
Chain Sequence
b'MILPPIPTPFDREGRLDEEAFRELAQALEPLVDGLLVYGSNGEGVHLTPEERARGLRALRPRKPFLVGLMEETLPQAEGALLEAKAAGAMALLATPPRYYHGSLGAGLLRYYEALAEKMPLFLYHVPQNTKVDLPLEAVEALAPHPNVLGIKDSSGDLSRIAFYQARLQEFRVYTGHAPTFLGALALGAEGGILAAANLAPRAYRALLDHFREGRLAEAQELQKKLFPLGDLLAKGGVPLLKQALRHLGLPAGYPRPPYPAESPLWERFLPVLEGLKEEGWVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dihydrodipicolinate synthase
publication title Crystal structure of putative dihydrodipicolinate synthase (TTHA0737) from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 101
structure length 283
sequence length 283
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2pcqA00
3UD6A 4OBTA 1LDCA 1ICQA 1SW7A 3N2XA 3USBA 1ALDA 2VEIA 3C0JA 1LM1A 4DQWA 3JS3A 1ZNNA 3HO8A 4M7SA 3HMJG 2FIQA 5F2MA 5KZMA 3N9RA 3S1WA 2X2GA 3B06A 3GVGA 3THAA 2Q3RA 4MIMA 3LCHA 3G1HA 4MFDA 3WJXA 3DFTA 3QW4B 3GZ3A 2B7OA 5CZSA 4DEFA 2ZTKA 1Q45A 1BWLA 3OVRA 1WYIA 3CU2A 4FIQA 3G3DA 1C29A 2TYSA 5F2IA 3IGUA 1QWGA 3WK2A 3HBLA 2H6RA 3S6DA 4OHQA 3TA6A 3TQ0A 4EIVA 5LSMA 2J9ZA 1MEHA 2X30A 4RXFA 4JTHA 1FDJA 3BGJA 3C2VA 4C1KA 3A24A 1RPXA 2OT0A 3FA5A 3G22A 5AC7A 4GNJA 1I2RA 4JYDA 5LKYA 2XN1A 2DJLA 1K8YA 3UWYA 3BGGA 4HNVA 4UTTC 2ABBA 3MP3A 3UWQA 4NQ1A 4Z0JA 1LTDA 4XBSA 3W7CA 4PEKA 1P5BA 2A21A 4JNMA 3HG5A 3IVUA 4WOZA 2I1OA 4LVFA 2RFGA 3W1XA 1ZJIA 4R53A 4S2CA 1TPC1 2VENA 3BO9A 3IV3A 3JRKA 2VFHA 4JX4A 1OF8A 1DVJA 2VEPA 4M6VA 1G7VA 4JICA 2VFDA 3TSBA 2QCMA 4NX0A 1TPVA 1GVOA 3W1LA 3SW6A 4U28A 3H53A 1LBFA 4OGZA 3G1SA 3L65A 3A21A 3NVTA 2ATSA 3QZEA 5K4XA 1W8SA 2GOUA 4O4WA 2VKZG 1YXCA 3LRLA 1JQVA 1G4PA 5L9FA 1F5ZA 5DCDA 1FUYA 1FXQA 4K7YA 2CZEA 2VOMA 3QQ1A 1C8VA 2PRHA 3O6YX 1Q6QA 3P5ZA 4O15A 3UWZA 3IVSA 3UWWA 1DJNA 2HS8A 1KV8A 2B4GA 4I7UA 1ZENA 2C15A 5KINA 1ZY9A 4GXMA 5CKSA 1ME9A 1YYAA 1T8XA 4FXRA 4RLIA 1SSDA 2YX0A 4WJEA 3Q58A 4DXVA 4JTFA 5GVJA 3MHFA 3DGRA 3W70A 4ZL1A 2ZTJA 4IPIA 3W73A 4TMCA 4NZFA 3W7KA 2QDHA 2G5WA 2V0TA 1WBHA 4K36A 4O0ZA 1G4TA 1QR7A 3S5OA 1Q3NA 3W7MA 3M1ZA 4I9AA 1B4EA 1DQXA 1XM3A 1G7UA 1X7FA 2FQIA 2B7PA 3TMLA 1KLYA 4GJ1A 2XN2A 5G1TA 4Z1DA 3NQCA 3GDLA 1KFEA 1TTJA 4FF7A 4LVAA 4IMDA 3VCRA 1FBAA 1B9BA 1KM3A 3QPZA 5EYWA 3W7OA 2CLIA 3FOKA 4O11A 3DU0A 1LRTA 1QPRA 4FO4A 2C3ZA 3T55A 3W3OA 3TAKA 5DXXA 3FJLA 4K8HA 1RQBA 4UFLA 3QEZA 5D32A 1GPWA 4L4LA 3V1PA 2TRSA 4BFAA 2QEZA 2EKCA 3BG5A 3KAOA 1BTMA 4XWUA 3B0PA 5AHIA 2ZZ7A 1H7WA 2J9XA 1FDZA 4A21A 1Z42A 3UQNA 3P84A 4AHOA 1LROA 1XI3A 2NLIA 2AAMA 4IX2A 3LTPA 4YXGA 1JCLA 4UFHA 3TUUA 3B04A 3FYOA 4MYAA 4RZ4A 1AL7A 5DCEA 3M5VA 2VFEA 2NV1A 4Z0SA 1XL9A 2Z2UA 3TJLA 3W1AA 1K8XA 1KFLA 2Y61A 1XBXA 3F1QA 5CSRA 5EMUA 4OQVA 4MZ8A 1EUNA 1OFRA 4Z08A 4A3UA 4IMGA 4ZQRA 4FX7A 1KA9F 4M7TA 2G96A 1VQTA 3GKFA 3M16A 4HPXA 3P81A 5J5DA 2OZ0A 1L6WA 2P1FA 3OA3A 3HJZA 3M5XA 4DBEA 1SU5A 3P74A 1WXJA 4EVZA 2RDUA 4ZQNA 3WJSA 3S8HA 2ZRWA 3CIXA 4AHQA 1OFPA 3BARA 1VH7A 2Y7EA 3TC6A 3W2NA 4DF2A 5AHNA 3ABSA 5HR7A 5TIMA 3S0CA 4UMBA 2VC6A 3GX9A 1H61A 3M43A 3W07A 2NX3A 1SO3A 3V75A 5U7SA 3DKLA 3C8FA 5AHFA 3EWYA 3GIYA 1PL9A 1MZHA 4AH7A 2CW6A 2FFCA 2I9EA 3RLUA 2ZRYA 1TPB1 1XXXA 1GVFA 3NQ2A 1KV5A 2JGQA 3HPSA 3UXAA 4X3ZA 3TMQA 3R2GA 4FEZA 4IJBA 1P0KA 1TSIA 1EB3A 1IXNA 1PIIA 4MOZA 3IVTA 3PB0A 4AXKA 3FYPA 4ALDA 3G1XA 2QDGA 4BWLA 4N6EA 1QPQA 3NPUA 2ZFAA 3LTYA 2JKPA 1EP2A 2WQPA 3I68A 1OVDA 4O54A 1FX6A 4XTDA 4LU0A 5DXYA 3EWBX 2VXNA 1JRCA 2NV2A 4UTUA 4H3DA 1PHWA 1VHCA 4MY8A 2W0UA 1B4KA 4QJ1A 2RDTA 1KM1A 4U4MA 3OG3A 4UR7A 1LCOA 3IGSA 4S1FA 5CZJA 2Z1BA 4BI7A 5BRBA 1VJIA 2Q8ZA 3W84A 3U8GA 3KRUA 3TSMA 2ZBTA 1FWNA 5CPMA 4AVFA 4M6PA 2A1YA 3BK0A 1TMHA 3I7RA 5LNSA 4K38A 4IGHA 2ZZ2A 1XDLA 1P0NA 3KVLA 3W7NA 2ZYFA 1K8ZA 3NQFA 2CLLA 4AF0B 4JTIA 1OFOA 4NUWA 4JTLA 1U5JA 4OV9A 2VEKA 1VR6A 3LHWA 3GK0A 3L0NA 3S1UA 1W31A 3NXFA 3M44A 5G4WA 2BWGA 1W54A 3N3MA 4PC8A 4FHAA 1W3TA 1YDNA 2Y7DA 4LVDA 4Y90A 4LUJA 5CPLA 1EA0A 2QCFA 3NDOA 5A8GA 3UNDA 4JTJA 4DF0A 5DBTA 1TPWA 4FNSA 4Q33A 4M5PA 2PRMA 1OX6A 3PBVA 4OE7A 2Z6IA 2V9DA 4UFIA 4FXSA 1F76A 3NL3A 2ZCGA 3ZR4A 3P80A 1H7OA 3EWZA 3TH6A 2QCLA 3LM7A 3LB0A 3VE9A 3TR2A 1D3HA 4EF8A 2NWSA 5AHMA 4KWVA 1FXPA 2V8ZA 1GVRA 4BK9A 3BG9A 3L5MA 4DF1A 4YCPA 3PC0A 3L66A 1UUOA 1ME7A 1VHNA 1VLWA 3TE9A 5TQLA 2KZHA 1KLZA 5U4NA 3PS7A 3GDRA 2FPTA 3W72A 1X1ZA 5HQEA 3G0SA 4UCGA 3TQVA 4IOTA 1SO5A 5LNVA 2BSLA 1OX4B 4A29A 1A53A 1SUXA 2FTPA 4UTJA 2CLFA 3ATZA 3F4NA 2Y7GA 2ZQ0A 2YYUA 3E0IA 2Y70A 2WSQA 3IRDA 4K39A 4BI5A 2DZXA 1CW2A 2DZPA 3P61A 4UR8A 1M7OA 4Z1BA 2E6FA 3WFAA 4ORMA 4HNTA 4QITA 4JTKA 3MJYA 4O28A 4O16A 2YW4A 3EX6A 3KRSA 4O1DA 3O1NA 3CIWA 1OYBA 2F84A 1VCVA 1JCMP 3TCEA 4AB4A 4NJGA 3T78A 2PE4A 2B7QA 3QMTA 2G95A 4IXXA 5AHEA 4L4MA 2OCZA 3GYEA 1YPFA 2BXVA 3EXTA 1YXYA 5BW6A 4AWSA 4O57A 2GVJA 4WUIA 1NEYA 3E9AA 5KITA 4AAJA 1LRQA 4IXHA 1TRIA 4NXSA 1AK5A 4R7JA 2V5LA 3NQ6A 2LLEA 1TPFA 3C56A 1RVGA 2C18A 2J9YA 1QOQA 3MMTA 1YADA 4EWND 4UTKA 2FB3A 3YPIA 1TPEA 2FLIA 3PUDA 1LOQA 5HJLA 3EX1A 3LBCA 1ZHAA 1ZAJA 5FF2A 1VCFA 3TROA 3WJYA 2FPYA 1L6YA 5CZTA 3ZWTA 5H2ZA 1TO3A 3BLEA 1IIGA 2A5HA 3STFA 3EWXA 1K7FA 3BW2A 2X16A 3DKJA 3HGSA 5BNKA 4MLJA 2NX9A 3W2UA 3LOTA 3C6CA 4OWGA 4NU7A 1G4EA 5EL1A 3T4CA 2X1SA 1QCWA 1F05A 3I7SA 2V5BA 3IGXA 4WZHA 2BTMA 1YTDA 3W9ZA 1EWDA 3SJ3A 2JKEA 3EXRA 1VPXA 1VYSX 2R94A 4N6FA 1JQXA 1R47A 2WV8A 5I3KA 3QM3A 3B0VC 2VFGA 2HTMA 5D04C 1O5KA 4JY8A 2YPIA 5HINA 1KTNA 5DLCA 1ZAHA 5J5RA 5D37A 2C14A 1KM4A 4MPQA 4AWUA 3TW7A 3LCFA 4NJKA 4HSNA 3DAQA 1N55A 3STGA 5K7JA 3W75A 5DY2A 1SZEA 2C13A 1ME8A 2WKJA 3PG8A 3UWUA 5MHBA 3ELFA 1XC4A 5I3JA 4FNQA 1MSSA 3R13A 5HMSA 1U83A 5FI8A 3NO5A 1GOXA 1V5XA 3PWAA 2YYTA 3DENA 3B05A 3HOJA 1FQ0A 2YSWA 1GTEA 1KM6A 2A6NA 4UTHA 2V2CA 5I3FA 1EIXA 4EF9A 4LVGA 4O19A 2TPSA 1IXPA 1O94A 1I45A 3DXIA 3CB8A 1TV8A 2QCDB 5F2GA 3DHFA 1DJQA 2ISWA 4Y9AA 4AF0A 3NQMA 2ZRXA 2H90A 3EX2A 3UZJA 1J4EA 4FB7A 3PBUA 3PR2A 2JGYA 3BPWA 3W1TA 4N02A 3W7QA 3NPWA 2YFNA 1I2PA 4JS3A 3L21A 3N9SA 4AWTA 3R12A 3W7IA 4Y96A 3CHVA 5CPOA 2WNZA 4MZ1A 5FF3A 2PRLA 1N7KA 4XKYB 1AG1O 1A5SA 3FJ6A 2JBMA 2QCGA 1O4UA 1YDVA 1QDSA 3JR2A 3NAVA 5I3GA 1DKWA 4H4IA 4PCFA 4FNUA 2E6DA 3DFQA 4LRTA 2OJPA 4RZ6A 1TQJA 3N2MA 2DZTA 4NJJA 1H7PA 1JUKA 2D73A 1AL8A 1TPUA 2Q3OA 4CNPA 2WSRA 4PL2A 4O52A 5FEPA 3T40A 2VFFA 2NXHA 3P8IA 4QISA 3SZ8A 4LS1A 4ONVA 1W5NA 5I3HA 5LNUA 2Y85A 2R8WA 2CZDA 1W5PA 5AC6A 1XUZA 3CWOX 1LP6A 3M7WA 1XBZA 6ALDA 1V7YA 5EKYA 1OABA 3HQ1A 4LV9A 4WQ6A 4NXKA 2E77A 1UCWA 5KZDA 4PH6A 5C5YA 1DV7A 5F2LA 3GDTA 4HNUA 5D09A 4JTGA 3FLUA 1SW0A 1J2WA 4QAIA 2CZFA 5C2XA 1T96A 1K7XA 4UTTA 3LRMA 4UNLA 4NX5A 2ZRVA 4JY9A 2QCEA 3Q94A 4XZ9A 2PURA 5HUPA 4P2VA 3G1VA 2QUVA 1R2RA 1OX4A 4O10A 4JYFA 3B03A 3N19B 4Y8FA 2ZRZA 4GE8A 1GVSA 2A2IA 3KHJA 1UUMA 3QFEA 1WAUA 5CGQA 3NA8A 3G1YA 1UJPA 5K9CA 3MYOA 2DZWA 5LHEA 3QSTA 4NT0A 5K2ZA 2ZZ4A 3LHVA 1OK4A 4TMBA 5D2XA 3DBPA 3NQAA 2O7QA 5G2HA 4IMEA 3W7RA 1F7BA 3DI0A 4TX9A 3IEBA 3S5ZA 4AMAA 3NPXA 4MJZA 1L2UA 4LWWA 4PL1A 4ADSA 1Z41A 4GRSA 2YCEA 7TIMA 1FCVA 5EPDA 3HGOA 1O95A 3P82A 1QNVA 1IXQA 2QUTA 3LERA 3N14A 5C6MA 3R8RA 1SZNA 2H8XA 1H62A 2E68A 1GYLA 3W1MA 2FDSA 2EAWA 1VRDA 1GG0A 3QJAA 2PC4A 2OMAA 3B0UX 1ZALA 2CWNA 3L0GA 2GVLA 3GB6A 4BI6A 3PUOA 1W0MA 4MZYA 1Q6LA 3NOEA 3G0XA 4JX5A 3SGUA 1NFBA 1H7XA 4N4QA 4UFMA 3C61A 3NPVA 1GT8A 4MJMA 3NZ1A 1H63A 5K9XA 3M0ZA 3EKZA 4D2JA 1ML1A 4HN4A 3U6WA 4LC8A 3GR8A 3S9YA 3FFSA 4NJIA 2QCHA 1D3GA 3W7GA 5D2WA 4I7VA 4W9TA 1KBJA 3TJXA 1S5VA 1TQXA 1MO0A 2A0NA 1NF7A 2W6RA 3DHDA 1KTBA 4LS2A 3QH2A 4MY9A 4O13A 1JCXA 1K3UA 4ML9A 4IWWA 1WOBA 2NWRA 3LGEA 1TTQA 1XCFA 5F4XA 1YPIA 3UY8A 2Y63A 5D38A 4P61A 3RK8A 1WA3A 4FX6M 2DU2A 4LV4A 1CI1A 3UPBA 3EX4A 4ZQOA 3TDFA 3P62A 2H8ZA 5DCBA 1VLIA 2H3BA 1JR1A 3MUXA 3W1QA 4LOCA 4A2SA 3STCA 1IXOA 2EPHA 2QKFA 2A7RA 1TTIA 3CEPA 3KXQA 3W1PA 3VI2A 3NL6A 3W83A 1QO2A 4IX0A 3SGZA 2QCDA 3B8DA 5TBOA 2X1RA 2GJLA 3KVKA 4MVAA 5D33A 2Q8LA 2NXGA 3IIVA 2B7NA 4DPQA 2CLOA 3W2LA 3W7DA 3LHYA 1G67A 3FEMA 1RD5A 3L2IA 3INPA 2ZZ1A 4A2RA 1UBSA 3N73A 3LHZA 5EY5A 4MKNA 3NQDA 2ZZ3A 1TJRA 3LI1A 1XFBA 1QAPA 1X8FA 3SIZA 1H51A 1KFKA 4K7VA 5E1QA 1O60A 3RLVA 3LBMA 1TPH1 3LV5A 4AHPA 3AJXA 5D03A 2F7FA 1XBYA 1VS1A 4NNAA 4DBDA 2GJNA 3OEXA 1GYNA 4B5NA 4OT7A 1P4CA 3W1RA 4K6AA 3KX6A 3E96A 4EOUA 1SR9A 3C3NA 4GUFA 3QQ0A 5I3IA 5FF7A 1EWEA 3K30A 3PB2A 2V30A 3ZFHA 1KM0A 1EP3A 1GVQA 3CPRA 2CFFA 4UXDA 2YXGA 4ZVJA 3TV8A 4O12A 3PULA 4GWEA 4RCXA 5AFDA 3PSVA 2RHGA 2ISVA 1W56A 3L68A 4YLWA 1DL3A 3S42A 3LDVA 2FJKA 2QR6A 3GAYA 1R2TA 3C4UA 3NEVA 3QW3A 1GEQA 1KFBA 3AO0A 3HG2A 3E12A 3S5NA 3WK0A 1DQWA 3Q2DA 2ZA2A 4UTIA 5AHLA 1OFDA 3L5LA 4JTEA 5KZEA 3STEA 4XQ6A 5CG7A 4Y6GA 4YCOA 2TMDA 3HG3A 4JX6A 1FWSA 2C6QA 2DORA 4XUGA 1M6JA 1I2NA 4N9BA 2GQAA 3LCXA 1FY6A 2E09A 1JVNA 1OHLA 1OJXA 3GNDA 3MI2A 2BLEA 3MYPA 1H1YA 1PE1A 1TV7A 4QM1A 2V82A 3CM4A 3R89A 3UPWA 3M9YA 4WOQA 3DZ1A 1DBTA 3ATYA 3NG3A 3CEUA 1Q6OA 3E02A 3A22A 3DFNA 4UFKA 4UFJA 1F6PA 2OT1A 3CTLA 1JRBA 3DI1A 1EUAA 3BVJA 1X1OA 3QRHA 2V81A 4JTUA 4M19A 3C2OA 4MUZA 3H55A 5D02A 2QCCA 3C2FA 4NVTA 4DPPA 2ALDA 4LC6A 3I7QA 3M41A 1EPXA 4MYXA 5HWJA 3WJWA 4E2DA 2R14A 1HO4A 1S5TA 2EF9A 1TCDA 3RF9A 5K3VA 3MBDA 4YMZA 1Q6RA 4N9CA 4NJHA 3S1VA 5K4ZA 1OG0A 3A9IA 5T26A 1TV5A 1HUVA 4ORIA 2J24A 4N4PA 4LVBA 4KKXA 2CLHA 3W7PA 1E51A 4WD0A 4ZMGA 3HF3A 5AYYA 3WK3A 3O07A 3QYQA 1RR2A 4DELA 4OU1A 5D05A 1TTPA 3LI0A 4HNNA 5FESA 2QJHA 1W5MA 4YWIA 2GUUA 1W37A 3MBFA 1AW2A 1A5AA 1LOSA 1C9DA 2XFWA 4WXYA 1RQHA 2V2DA 3RFAA 3G18A 1MEWA 3G8RA 2E5CA 5DELA 3NR0A 2WNNA 1H7RA 3O6DA 1LLZA 3BLFA 4C1LA 3LHUA 2GQ8A 3TIMA 2EHHA 4LW7A 3M6YA 4RX0A 3MP4A 1NF0A 2ISSA 3M47A 4IPJA 5BOOA 2E5DA 1H60A 3TK7A 4GBUA 1QFEA 4ADUA 2TSYA 4UUIA 4O4VA 3LHTA 1FWTA 4CCCA 3P60A 3P67A 5F4WA 1IGSA 1JUEA 3SECA 1VC4A 1BKSA 5E93A 1A50A 3NM3A 4RZ5A 5F1VA 3W88A 4LY8A 2Z6JA 2ZZ5A 1W1ZA 1F74A 1AW1A 3IIOA 3Q37A 5DY3A 1HTIA 3G3MA 2YGYA 3UZ5A 2BZNA 4AEOA 1JCNA 3FKRA 1KTCA 3W22A 1YTKA 3HG4A 2YFOA 5E0KA 1AMKA 3G8EA 2Y7FA 5AC8A 3O05A 3LTSA 1GZGA 3FKKA 2HMCA 3QPYA 4PODA 3CLMA 2QF7A 5CSSA 1PHQA 1X6UA 3FS2A 3O06A 4UMAA 4O1AA 1AW5A 3GDMA 4CQ8A 5CZ0A 5SWUA 1T0OA 1SQ7A 3LXAA 2HSAA 1I2QA 1H50A 1S3HA 5KMYA 2QCNA 1TYGA 2YDAA 3PSWA 1TB3A 1KW1A 4JEQA 3KRZA 4KFPA 3NL5A 5HUOA 4FNPA 3ABQA 3TX9A 2ZRUA 3G1AA 3W1UA 2RDWA 1LOLA 2B0MA 2C0AA 3S5YA 4CNOA 3PBYA 1EP1A 4E2BA 5IM51 2DP3A 3O15A 1VZWA 2WOQA 3M5ZA 4X2RA 5A5WA 1OYAA 2ZZ6A 4HIBA 6TIMA 4JDYA 2XN0A 3KVJA 1OFAA 1UASA 1A5BA 4GFSA 1LLWA 4NNCA 1G4SA 2CZ5A 2GPTA 2WPBA 3O63A 5G5IA 3W76A 5L6UA 1SZFA 3PAJA 2P10A 4XTIA 1O5XA 4HT3A 1L6SA 3O16A 5HR6A 5AYZA 1R2SA 3LXCA 1G6CA 4GUJA 4TIMA 3WJZA 3HIJA 5F1UA 4LRSA 1XDMA 4QQ3A 1NSJA 3DFSA 5G2WA 4E0CA 1JUBA 1DHPA 3VFLA 1EX5A 4A22A 3LCIA 1GJPA 1VGAA 1PS9A 1YXDA 3M5YA 3THQA 1T99A 3KVMA 1F6KA 4HSOA 1WX0A 3CQ0A 3BG3A 1RQEA 3H54A 1UB3A 3GR7A 1SPQA 1W5OA 2X1TA 4S2BA 2P0OA 1PCWA 2CU0A 3GNNA 2NX1A 4CQ9A 4FNTA 3W1NA 1YDOA 4LT9A 1F73A 1LRNA 5D2YA 4WX2A 1DOSA 4UTMA 5FF0A 4N2YA 1WQ5A 3LCGA 4MFEA 3OIXA 4WY0B 3GLCA 1EEPA 4Z1AA 3HPXA 5CPNA 3EWUA 4KFOA 3W2MA 3NZRA 3OVQA 2Y62A 4RJEA 1SFJA 1GG1A 4O1CA 1XBVA 3NGJA 2G97A 3U2OA 1B57A 1TJPA 3RU6A 3MWAA 3LRKA 3W2JA 1QMLA 3BLIA 2WO5A 5KSWA 3W7HA 1MEIA 3HB9A 3O8AA 1H5YA 3RMJA 1L9WA 2WNQA 4JDBA 2A85A 2ABAA 3PVFA 4JGDA 4XBKA 4X9SA 4KFNA 4YL2A 3W86A 3EB2A 5D2TA 1HG3A 3TC7A 4QIUA 1J5TA 3IIPA 4RV8A 3TW6A 4BWLC 4IMCA 1PV8A 3F4WA 4QNEA 1HL2A 4JXCA 1B3OA 4N9EA 4N9DA 2X1UA 3HGRA 3I65A 1F2JA 4RKAA 3L5AA 1TREA 4G1KA 3UWVA 2RKXA 4WXZA 1IF2A 5AYXA 1FCUA 4Q4KA 4DO4A 4RK8A 3C52A 3SR7A 2OX1A 3PG9A 1WV2A 4O50A 5LNRA 1W3NA 2EGZA 5HNRA 3VNDA 4H6KA 5F4SA 3NQ7A 1YTEA 1WOAA 2CLEA 4UTLA 2BX7A 3TSDA 1K7EA 3TKFA 1MXSA 4LUIA 2C16A 3MHUA 1ZCOA 3MP5A 1FWWA 2E5BA 1FCQA 3TNOA 1BWKA 1Z44A 3EWWA 4UTWC 3GXTA 3ABRA 1BEUA 4JR5A 3G1DA 3BV4A 4ZQMA 1FWRA 1QOPA 4PA8A 3BW3A 4JD4A 3EXSA 2YR1A 1JCYA 3TFXA 1H1ZA 2C19A 3TXZA 3L67A 1CX9A 4TO8A 2Z0IA 2NXIA 1NAL1 1ZFJA 4MY1A 4O14A 1I2OA 1JULA 3UXDA 1FDYA 1QPOA 4JYEA 2Y89A 3GAKA 3SY5A 3P5YA 4DO5A 5ABTA 3ZWSA 1OFEA 1R30A 3KFTA 5G4EA 1LBLA 2I14A 4JIQA 1JCJA 2A4AA 3LXBA 5HULA 3FIGA 2DZSA 1LZOA 4ZQCA 1GWJA 1SFLA 5EA9A 1OFQA 2WSYA 1G69A 1VYPX 3NQEA 4O17A 5G1YA 1VYRA 3W23A 2J88A 5LNWA 3SFKA 5IBXC 4QNWA 3CWNA 1KM2A 1VCGA 3TQKA 1RZMA 1TIMA 3O6CA 3A5FA 4JIPA 3LLFA 2QUUA 5G2IA 4WY0F 2A7PA 3DFOA 4I7WA 3RNDA 3T7VA 3NYZA 1OFBA 1ICSA 3ABOA 1THFD 3NNTA 1I8JA 4HHPA 1OK6A 3WK1A 2FPVA 2QAFA 2ZA1A 3NM1A 3UY7A 1DORA 3TFCA 1TPDA 3W87A 1QPNA 1K03A 3A23A 3W71A 4BF9A 1HFBA 4UIOA 5AN7A 3ANYA 3OVPA 3S1XA 4IUOA 4O8RA 3BW4A 3PM6A 4GUHA 4MLRA 1RV8A 3OHIA 3TAOA 2J27A 2AQWA 2YW3A 5KTLA 3T44A 1LORA 2Y88A 3IIXA 1SO6A 4UC5A 3MO7A 5HWNA 4K37A 1W3IA 1M5WA 5LGXA 1R46A 4POCA 4XKYA 3DFPA 4K8EA 4M6QA 3EKLA 2UV8G 1KFJA 1TRDA 3QMRA 5D30A 3W85A 3TXVA 3VE7A 2HS6A 4QSHA 2J6XA 3VKJA 2AGKA 5C55A 4LNYA 4O1BA 4ZQPA 3L9CA 1Y0EA 2W79A 1LBMA 4CCEA 2E6AA 1P1XA 2VEMA 4UTWA 2QJGA 3ZS4A 3W2KA 2DJXA 3DH7A 4O18A 5HWMA 2E1DA 3CT7A 3LLDA 4KWWA 4IQLA 5LZLA 3EX3A 1QO5A 1PVNA 2NUWA 5AB3A 4ICNA 1A5CA 2GVGA 1S5WA 1KM5A 4O53A 1SW3A 3N34A 4NZJA 1W5QA 3P7YA 4E38A 3SSJA 4UMCA 3EEGA 1M7PA 4FX8A 3QC3A 3W7LA 2DZUA 3LX9A 3NQ8A 2JK2A 4JTSA 4O0KA 4OV4A 5H91A 5D2VA 2ZDRA 4WY0A 5IBXA 5BMWA 3L0KA 2NZLA 2A7NA 3GXNA 5AOUA 3NQVA 2Y6ZA 1OF6A 3QSRA 2V2HA 2VELA 3B4UA 2ATMA 1Z48A 3LCLA 1KFCA 1OYCA 3UYCA 5C54A 4RR4A 1NVMA 3KOFA 1LYXA 4JTTA 1FCBA 4FNRA 4RXGA 5FEXA 1XKYA 4CNNA 4HPJA 4GUIA 2QJIA 3PY2A 4LS0A 3W7JA 5K9DA 2IQTA 1H7NA 3PUEA 1ZAIA 2NUYA 2CLKA 3TU9A 1D9EA 2RH9A 1K02A 2C1HA 2CLMA 8TIMA 2DZVA 4FIRA 3NL2A 1HO1A 3G1FA 3P8JA 2YZRA 2VFIA 3HPZA 2H3DA 3PF3A 1SSGA 1WBJA 3PBWA 2GQ9A 3MI6A 3C2EA 3SI9A 1GQNA 1OX5A 1GTHA 4JN6A 2WJZA 1I4NA 4ADTA 5LGZA 1XUUA 3I6RA 1JJKA 3W74A 4R33A 1N8FA 5LHFA 5EBUA 1WDWA 1SO4A 2R91A 3CC1A 4Q32A 5FF4A 3W7EA 4TU1A 4CCDA 2E6YA 3MI3A 4IMFA 1ADOA 3GKAA 3OBKA 3QF0A 3C2RA 1ONRA 3A5VA 3G0UA 4GC4A 1YLVA 4CQAA 4PTNA 2NUXA 1IIHA 3GXPA 2A6LA 3GDKA 4NNBA 4X22A 5DN1A 5DBUA 3E49A 4UNKA 3G24A 3HGJA 4R34A 4ZZ9A 2FB2A 1SZGA 3IIZA 4TR9A 3MW7A 3F03K 4DO6A 1ICPA 1PCKA 5BMXA 3LV6A 3QMSA 2O7SA 3W6YA 3D0CA 4BR1A 2PCQA 4LTSA 1KBIA 4CLMA 4GUGA 4Z1CA 2QAPA 3R5EA 4HKPA 4PFMA 3NQGA 5FEWA 5FEZA 2JKAA 3MHGA 2ZA3A 4J9JA 3LCWA
chains in the Genus database with same CATH superfamily
4C65A 3KEHA 3TOYA 1SW7A 3EPOA 1KKOA 1HJWA 1TE1A 2VEIA 4Q8PA 1J12A 2ZX5A 1ZNNA 3PBMA 2YJQA 3HO8A 1V02E 5F2MA 3F4VA 3OZYA 3B06A 2Q3RA 4MIMA 3UGVA 4AD0A 3G1HA 2OWWA 3DFTA 3QW4B 4U2YA 3GZ3A 2UY5A 3OYXA 1I9CB 2ZTKA 1BWLA 1WYIA 3CU2A 3IGUA 3WK2A 1VFSA 4YTQA 3CAQA 1UD4A 2XINA 5LSMA 1NDVA 1XPYA 1NFPA 3GXFA 3BGJA 3N2BA 5DANA 4DJDD 5AC7A 4GNJA 5XIAA 2EJAA 2PPGA 2J8FA 2XN1A 3CH0A 3ZOAA 3UWYA 3BGGA 2HXTA 2J7FA 2O4QA 3EYPA 5M17A 4OKDA 2PTZA 4IIFA 4FOJA 4XBSA 3TTQA 3PK7A 4F0SA 2RFGA 3QYSA 3GC4A 4R53A 4S2CA 2VENA 3BO9A 4B92A 2VFHA 1OGSA 1OF8A 1DXFA 1PSCA 2WHJA 3QOKA 2Q02A 3BLKA 3MV01 2W27A 4JQAA 4AZGA 3KP0A 4JN8A 4B16A 2Y8KA 2C79A 3AIBA 1OB0A 3SW6A 4U28A 3HFTA 1M53A 4ZOBA 3H53A 1LBFA 3ITOA 3G1SA 3AU2A 3NVTA 5IRPA 4F0KA 4NP7A 3VNKA 1V77A 3RCMA 1C8QA 2GOUA 3MKCA 3EMQA 3VZZA 1JQVA 1G4PA 3LS9A 5H6HA 3AHVA 1FUYA 4K7YA 3QQ1A 1TA3B 4AZ5A 3UWWA 2HS8A 3EOEA 2AMXA 3II1A 1ZENA 3ZLFA 1EC9A 3ZJ6A 1ZY9A 2IQDA 2EG8A 5HMFA 1IE7C 1GZJA 3QN3A 3QLLA 4XX6A 3Q58A 4N42A 1TJ1A 2BODX 4DYJA 5GVJA 4JCMA 4MB1A 1E71M 5EMYA 2O4MA 4IPIA 1JNDA 1XYMA 2IPFA 1MFUA 3SQMA 4NZFA 2V0TA 4ENLA 1WBHA 1D7FA 4K36A 1G4TA 4C6BA 3RJXA 5JBEA 1Q3NA 3JU2A 4M29A 2VZSA 3GTNA 3M1ZA 4G5DA 4I9AA 3U48A 1E6XM 1XM3A 4GBDA 1G7UA 1MI3A 2FQIA 4KWUA 3TMLA 3FVMA 3WQVA 2ZADA 1EO7A 2GL5A 3UP8A 1KFEA 1XLMA 3WY1A 4H9YA 2BVYA 5T8GA 1FBAA 1B9BA 5TAOA 4XZIA 3T08A 2Y5JA 4LSBA 3FOKA 3DU0A 4EANA 4FO4A 4E2OA 3T55A 1FVPA 1NWTA 3TAKA 3UVIA 1P6WA 3KTSA 3UG3A 1RQBA 1NOWA 1GPWA 3RIKA 2DH2A 2TRSA 2PZNA 2QEZA 3KAOA 4XWUA 5AHIA 1FKWA 3O0FA 5IFTA 2J9XA 5LIUX 4DM1A 3F5KA 1Z42A 4DJEA 3UQNA 3DOPA 4AHOA 1XYCA 3SRHA 4GGHA 4FOKA 4KWSA 1JCLA 3B04A 4Q4MA 2BBFA 5FJTA 5GNYA 2NV1A 4TOQA 1YKWA 1HQTA 1OT1A 4S39A 2FYMA 3F1QA 5EMUA 1WPCA 3H21A 4IMGA 4E8DA 4M7TA 1VQTA 3CZLA 1E15A 3GKFA 4LFYA 4HPXA 3C0LA 4MWAE 3M5XA 4CD6A 1NWRA 3P74A 2PDKA 4GNKB 2PI6A 1OFPA 3NURA 3HM7A 3OHMB 5AHNA 3ABSA 5TIMA 4XZLX 4ML4A 1KXTA 1RK6A 4M51A 1UD6A 2GJXB 3MUY1 5AHFA 1V3KA 3VOJA 1QW7A 4LAUA 1UWSA 1XR2A 1E0UA 1MZHA 3I10A 3S1GA 2I9EA 2ZRYA 2V63A 3BXWA 4F79A 4GYPA 4W84A 1XXXA 3CHCA 4KBXA 3TYBA 1O5QA 1P0KA 1IT7A 2QMKA 4MOZA 3PB0A 2GGHA 2QUNA 4AXKA 4MNLA 4ALDA 5LIWX 3MDUA 1ZBCA 1E4NA 4HCDA 2ZFAA 5DRCA 4F0HA 1A5UA 1P0DA 3V1HA 1OVDA 1CZ1A 1NQ6A 4S3BA 1FX6A 1DWIM 3RO6A 4LU0A 3W28A 1R9YA 4CD5A 1Y5WA 4UTUA 1VHCA 4CU8A 3IJIA 1O66A 3OZMA 4MY8A 4QJ3B 1QK2A 3H7UA 3LENA 4QJ1A 1KB3A 2OQLA 3OG3A 1LQAA 3FDGA 4UR7A 3IUIA 4KGJA 1CLXA 1LCOA 3IGSA 4S1FA 3MUZ1 1CPUA 3VNLA 5BRBA 4L7ZA 3VGEA 1VJIA 2Q8ZA 1B3XA 1IR1A 4XD5A 5I78A 5CPMA 4M6PA 1EDGA 1W1A1 4R7WA 1GVYA 5C9XA 4US5A 2ZZ2A 3W7NA 3ITTA 2ZYFA 1PO9A 3NQFA 2CLLA 4ZA0A 4AF0B 4AZCB 1U5JA 1H49A 3L0NA 5HATA 3WG6A 3KUMA 3NXFA 3CT2A 4DWSB 1EO5A 3KL0A 1W54A 1B31A 4PC8A 2AQOA 3H2OA 4FHAA 3VGHA 1F3XA 1FWCC 4LVDA 1QW9A 5C9UA 1V6UA 4CVWA 4LUJA 4UQEA 2QCFA 1QASA 2VVSA 4UQAA 5A8GA 3ARQA 2GYIA 1OZMA 1I1XA 4HHLA 1TPWA 4FNSA 4Q33A 4Q22A 5JUVA 2Z6IA 4MGGA 1GCYA 4BJHA 1RBLA 3P80A 1EC7A 1H7OA 2I56A 1OEPA 3LB0A 1N8IA 3VE9A 4DO7A 5A2BA 5AHMA 2V8ZA 3GU9A 3THUA 4RPPA 3VMPA 3L5MA 1EJRC 1QU4A 3PC0A 4GI8A 1ME7A 4IQEA 4KEZA 3CQJA 3PS7A 3WLSA 1X1ZA 1FRBA 5A95A 1YQ2A 3LLXA 4UCGA 3TQVA 4D71A 4IOTA 5LNVA 4MWAD 2HE8A 3WNPA 1XIMA 2UBPC 4MB4A 1J01A 3WUGA 3ATZA 2Y7GA 4V27A 3MUAA 2Y70A 1FWGC 2WSQA 2PF8A 1K9DA 3LNPA 1XYZA 4RNJA 4QITA 3KDNA 3PFMA 6REQA 3SDOA 4O16A 3KRSA 3RN6A 2ZX6A 3O1NA 1JYXA 2GUBA 1JZ3A 4B4FA 3ZMRA 2G95A 5AHEA 2EJ1A 1LF1A 3FEQA 4Q6JA 3GYEA 2DPEA 1YPFA 2BXVA 4PCTA 1XLJA 2BFGA 4HZ7A 4WUIA 1NEYA 3E9AA 4AAJA 4CEXC 2NT1A 1LRQA 2O9RA 4IXHA 3W25A 1AK5A 3F2BA 2LLEA 1TPFA 3VNYA 2BB0A 1RVGA 4JL2A 4MWAC 1QOQA 1YADA 3RX4A 4UTKA 2FLIA 3EX1A 4J3UA 3N15A 3QGVA 3BCJA 5HPOA 5CAKA 5FF2A 1QJWA 5CZTA 1MRAA 3ZWTA 1GUVA 2A5HA 1M68A 3EWXA 2X16A 5BNKA 2FKPA 5XINA 1UZ4A 4W85A 2YDRA 3H7RA 3OU8A 4H83A 3MMDA 1XIIA 3SAZA 1G9HA 3TZNA 4W8LA 1YTDA 3ZSSA 4WIWA 4M0XA 1LUCA 4PB4A 1R47A 5I3KA 5C70A 4QFUA 4C90A 1ZAHA 4EAYA 2C14A 4AWUA 3TW7A 2ZXBA 3LCFA 4HSNA 1KC7A 4LBRA 4DJED 5FL1A 4LEQA 3GU2A 2C13A 1NIUA 1BYCA 2WKJA 3PG8A 1BWVA 2QW5A 1MSSA 3ITLA 1U83A 4LALA 5FI8A 3NO5A 1V5XA 3PWAA 2YYTA 4XAPA 4U33A 3DFYA 3HOJA 1FQ0A 1EIXA 2C1GA 3OYZA 1TMLA 1O94A 1B3ZA 1TV8A 3DHFA 3A12A 2ISWA 1JF6A 4OBSA 4C6FA 4PMZA 2ZRXA 3NUKA 3UZJA 1PTGA 3WDPP 4F3HA 4MAVA 3PR2A 3SN4A 4Y2WA 3BPWA 5JBFA 1VIZA 3AXXA 3N9SA 1XHGA 3H23A 2GGJA 4AWTA 1F3WA 1H2JA 1WP6A 4Y96A 1EGMA 2PRLA 4XKYB 1A5SA 4A3YA 1HXJA 3DG3A 4LGXA 2WK2A 2VX5A 3N2MA 1FOBA 2DZTA 3QY6A 6A3HA 3N2OA 2BG5A 2HBXA 3PJTA 4CNPA 4TVCA 2WSRA 5FEPA 3T40A 2NXHA 4QISA 2G4JA 4LS1A 2Y85A 4W86A 5AC6A 3BC9A 1FH9A 1LP6A 3BGAA 1OABA 4LV9A 1GORA 4H6EA 2PMQA 4PH6A 1H41A 4NZ1A 3TJ4A 4D6DA 1K9EA 4IFOA 2YCJA 2CZFA 1JDEA 1EL3A 5C2XA 2OX4A 2POZA 5GNZA 1NM9A 4HOZA 1NY1A 3H6OA 1R2RA 4O10A 4JYFA 2ZRZA 1F3TA 3BAIA 2A2IA 3B8IA 4OUEA 2PA6A 2QLYA 3KHJA 3R8GA 1CXLA 3V0TA 3BAJA 3NA8A 3G1YA 1HP5A 3AIEA 3VINA 3RX2A 1ADSA 4I9MA 5D2XA 3NDYA 1F7BA 3DI0A 4F0RA 3ARTA 2ASHA 2Y8VA 4XBJA 4AMAA 1TJ0A 2HROA 2OYLA 4JTCA 1SJAA 4LB4A 4ADSA 4L4PA 3RILA 2YCEA 3EA3A 5EPDA 3LPPA 5BXRA 5C6MA 3V5OA 3R8RA 1SZNA 1H62A 3HU7A 1GYLA 3H4XA 3ISIX 3QQWA 4QSFA 1IWPA 3REQB 3B9DA 4GLEA 3QJAA 4AZ7A 2PC4A 3S5SA 3H22A 3L23A 4MZYA 1Q6LA 3G0XA 4JX5A 3M7SA 5GNXA 1X97A 4HCHA 3WD2A 3C61A 3TJIA 4MJMA 4IL2A 4HZ6A 3EKZA 1A80A 3CUHA 4DLFA 4HN4A 3FFSA 3ME3A 1E4MM 3L7RA 1W3LA 2EXOA 4JN7A 1KGXA 3TJXA 1TQXA 4FLRA 4NI8A 1MO0A 1NF7A 4HA0A 3DHDA 1KTBA 3GR4A 1PZ1A 4MY9A 3GG1A 1JCXA 2CHRA 1K3UA 3B0YA 4DB7A 4IGMA 3MUIA 1OADA 3WLPA 5CBBA 4ZCWA 4ML9A 4GKTA 3RITA 3ZO9A 1TTQA 4ZO7A 1J10A 2VUYA 4I6KA 5F4XA 3UY8A 2Y63A 1PIFA 4YHGA 4LV4A 3UPBA 3EDEA 3VKBA 4C60A 1L6FA 3R7MA 5A6LA 2VVNA 1KGUA 1TIWA 5DCBA 2H3BA 3W1QA 1IXOA 4P8VA 4G7EB 3CEPA 1TTIA 3VI2A 4IX0A 2QCDA 2XGZA 3RM8A 3S2NA 1XD1A 3RRAA 2FVKA 4A2RA 3N73A 4L9ZA 1GYMA 2PB1A 2ZUMA 4FLOA 3OOQA 2BHZA 1H51A 2XZ7A 3PZUA 5E1QA 1KXVA 2PEVA 1TPH1 3PWIA 4W5ZA 1VEPA 2F7FA 4E6MA 4DHGA 1VS1A 1MVYA 1YX1A 4OT7A 4J40A 3KX6A 2DY3A 3E96A 4GIRA 1HJSA 1XV8A 3QQ0A 3ZVIA 3UWEA 3K30A 2QQ6A 3ZFHA 1KM0A 1FHDA 3GG0A 1MQRA 2I7GA 4O12A 2OG9A 3PUGA 4RCXA 3WH6A 1W56A 4DUXA 3L68A 4MUPA 4YLWA 3L4TA 3R0UA 2FJKA 1HW6A 3WLMA 2QR6A 3C4UA 1F9CA 4PCNA 1KFBA 3HG2A 4WKHA 3KCJA 4UTIA 1OFDA 3VX1A 3I4EA 5CG7A 2D23A 3B9AA 4N0RA 3H70A 6XIMA 1XYFA 2DORA 1I0DA 1M6JA 5AVHA 4OIFA 1QNSA 2GK1B 4ICMA 4PR4A 3GNDA 4S3GA 1EJSC 1A4LA 1NARA 3MI2A 3WBYA 2BLEA 1U1UA 1H1YA 1PE1A 3CM4A 3M9YA 4KEVA 3USZA 4ASTA 2IPGA 3SEPA 3NG3A 1Q6OA 4UFKA 4UFJA 2AAAA 3MVTA 1JRBA 2EPMX 4JTUA 2VP8A 3C2OA 3IS4A 3GD6A 4Z2IA 1KRMA 4DPPA 2F6UA 3OLIA 1VFOA 3I7QA 4JQ1A 4W5UA 4J35A 4TV5A 3EOUA 2R14A 2VZUA 1S5TA 4LUSB 4YMZA 3S1VA 3A9IA 3U5YA 1EFZA 1TV5A 3RM9A 4KKXA 3AIWA 4Y9OA 3HF3A 3VDBA 4Q3MA 3FGCA 5A6MA 3DYPA 4OU1A 2XIMA 1TWWA 5M5DA 5BWFA 1A5AA 2GJXA 3V0SA 3U3HA 2NQ9A 3BOFA 4FALA 4DX3A 4QBXA 3RFAA 1ISWA 1MEWA 3G8RA 1RPKA 3VIMA 3MMWA 2A79A 2O56A 4GQ0A 4YVVA 3CBWA 3O6DA 1LLZA 4XAGA 4C1LA 3LHUA 1IYXA 4EXAA 1NF0A 4IPJA 3OVGA 1H60A 2GGIA 3A47A 3U4FA 1XLHA 2TSYA 3ZJKA 1IGSA 1UG6A 1VC4A 5E93A 5CC5A 1UWUA 5D8WA 5FJOA 3NM3A 3BSGA 4RZ5A 2QHAA 3CMFA 4LY8A 2Z6JA 3W88A 1E5NA 2X0YA 3P6LA 3CL6A 1XCXA 3W22A 2R1PA 3HG4A 3POHA 4FLQA 5E0KA 1AMKA 3DG6A 2VRJA 1JI1A 4PODA 1X38A 4XZWA 3NWRA 4GQQA 4UMAA 4O1AA 3GDMA 3SO7A 1XRFA 3M64A 2ONEA 5GPRA 5BROA 1FFQA 5KMYA 3M6DA 1GGOA 1MW0A 4J5NA 3WLRA 5FAJA 2W4XA 4LF1A 4O1FA 2Y2WA 2VZOA 1GHSA 1ZBVA 1V3IA 3ARYA 5HUOA 4FNPA 3ABQA 3WENA 1OSEA 4A3RA 3BCDA 4HTBA 3E3HA 2B0MA 2C0AA 3CK5A 4E2BA 2YBVA 4DN1A 2PBOA 4GX9A 3WDHA 4Z2JA 3D5HA 3AUOA 1VZWA 2CBUA 2WOQA 3M5ZA 4HIBA 5HMEA 2XN0A 1UASA 2HV5A 3F7JA 2WPBA 4Q4RA 1MFVA 5L6UA 3PAJA 2Z00A 1O5XA 4HT3A 4UQCA 3O16A 3LMYA 3LXCA 3AMDA 3K1DA 4QXIA 2H9AB 3HIJA 1P0EA 3WQEA 2QULA 4E0CA 1EX5A 4A22A 3T9PA 1R7OA 4AYGA 3ANUA 3U0HA 4S3DA 3KDOA 1KWGA 3KVMA 3Q4DA 1OD8A 4MPKA 3CQ0A 3BG3A 2B31A 3ONCA 3H54A 1MW1A 3OBEA 1UB3A 3GR7A 4JIIX 4AEEA 1SPQA 4DAIA 1EYWA 4S2BA 1WCGA 4ZBCA 3K5XA 3KBNA 1VFMA 1A5OC 2VX4A 1JNEA 1RP8A 3WLKX 1ZB5A 4CQ9A 1ZSXA 2DT0A 4FNTA 3CJPA 4GO8A 3E1F1 1YDOA 2GFTA 4C7DA 4ACZA 2INZA 3ITCA 1FH7A 1QT1A 3BCFA 3W6MA 3LCGA 1XIHA 1FTXA 4NZCA 3HPXA 2ZVIA 2A3AA 2X05A 2D2OA 2Y62A 4RJEA 4O1CA 1XBVA 3TYCA 1TJPA 3MWAA 3LRKA 3W2JA 3BLIA 2OVLA 1S5MA 1XIEA 5JBDA 3W7HA 1V03A 3OGRA 2PLCA 4YVXA 1BKHA 2WNQA 3GYCA 2ABAA 3KWSA 4ZSUA 1Q5MA 3NCOA 2ZUWA 3OQ8A 5D2TA 4IICA 2I5IA 3UU0A 3UZWA 3ARWA 3F4WA 3ENLA 2WVTA 3ECQA 3HGRA 3L5AA 5EGRA 4PMUA 5H1WA 3RCYA 1FCUA 4Q4KA 1P1MA 3SR7A 3PG9A 1WV2A 4O50A 2INFA 1EJVC 1C8XA 3G2GA 3VNDA 4H6KA 4AD5A 3VVGA 2YXXA 1UWIA 1WOAA 1UR3M 1H0IA 3AMLA 4M1BA 4XAZA 4DUVA 1RLCL 3M0KA 1ZCOA 3JVAA 2YOCA 3H2MA 3MP5A 2Z24A 1FCQA 4C1NB 2AL1A 1Z44A 2XM2A 4ZQMA 2YKKA 1QOPA 4JZ5A 3EDFA 2YR1A 3FW6A 3S2CA 2PD9A 3TQPA 4O14A 4A3HA 3W38A 1I2OA 1JULA 1FDYA 1XFCA 1QPOA 1WZMA 5D9MA 1W91A 3P5YA 4W7WA 5ABTA 1UOZA 4JHZA 2I14A 1JCJA 5HULA 3FIGA 3H12A 1R7AA 4M24A 3LN3A 3OP2A 1OFQA 4J3WA 1BG9A 4MF4A 4S3EA 3SFKA 3F4DA 2D22A 1AQMA 1VCGA 1RZMA 3KCOA 3A5FA 4JIPA 3VMNA 3LLFA 2A7PA 5TF0A 4I7WA 4WSJA 3QZAA 4GH1A 4L4OA 3WK1A 3SQLA 4ICCX 2BP1A 1IT8A 4YU1A 2V6AA 1AFSA 2WHMA 3DHPA 4DRSA 3UNTA 2PU1A 4M80A 2QS8A 4HSHA 3RO8A 4O8RA 4GUHA 4AIUA 4OFCA 1RV8A 3TAOA 2AQWA 2YW3A 2J7EA 5HDRA 3O2LA 4YTSA 2Z2AA 2YL6A 5CAHA 3N4AA 1SO6A 3CQIA 2OR2A 1AODA 3MO7A 5HWNA 2I57A 5E0CA 3ES8A 1M5WA 4XKYA 3BAWA 1JD7A 3DFPA 4M6QA 3EKLA 5FJJA 3N13A 3L4ZA 2CC0A 3GZAA 3L9CA 4KGLA 1R38A 1ITCA 3GTHA 1DJGA 4Q4QA 3TYUA 4ACYA 4KCUA 4NI3A 4F2TA 3HQNA 3CT7A 4KWWA 1JEZA 1QO5A 3MKKA 4BZYA 4EXBA 1UR1A 2GVGA 1S5WA 4W87A 3KS6A 3VUPA 3N34A 4QR6A 2FZMA 5EMJA 4UMCA 3WKZA 2PDNA 3LX9A 2JK2A 4F48A 1TWSA 4WY0A 2HBVA 1PIGA 5BMWA 3L0KA 3VOHA 4QDPA 1DYSA 1NDYA 3TONA 4UTFA 4DYEA 3URBA 1J96A 4JTTA 4FNRA 1NP0A 4BQ2A 1XLBA 2GDVA 3WDIA 4HPJA 5A94A 3PY2A 5I7GA 3VKKA 1RBAA 5K9DA 1XS2A 2IQTA 1H7NA 1YPXA 2NUYA 3A4XA 4JL1A 5H8UA 5C7HA 2VZVA 2VYOA 4URIA 1OINA 4Q8OA 4CD4A 2Y24A 2CLPA 2DUXA 4L1WA 1GQNA 3UJRA 4DWSD 1VF8A 4JN6A 3VGDA 4Z2KA 1DIEA 1ZTVA 1I4NA 3CLWA 5LGZA 2OB3A 4NSBA 1D2KA 4HK7A 3CH9A 8RUCA 3LD5A 3SUVA 4JKKA 3UJEA 1SO4A 1J6OA 2R91A 2E6YA 5E9XA 3TA9A 2WMIA 1E6RA 2E3ZA 2FHFA 3C2RA 1YLVA 3ZZ1A 4PMYA 4WJ8A 1KQZA 2DW7A 5FOOA 5DBUA 3C2YA 4UNKA 1H4PA 4ZTXA 4QQUA 3MW7A 4MDOA 1PCKA 1CXEA 2AKMA 1DWHM 3QMSA 2IUZA 3W6YA 1XIDA 4NHVA 5GJPA 1JF5A 2BMBA 3GFYA 3H2NA 1S46A 4KH2A 3ZLGA 4DWSC 4A8LA 3RGTA 1XSJA 2ZA3A 1ONEA 4OBTA 1CECA 3USBA 1ALDA 1O7AA 3C0JA 1LM1A 4Q8MA 1E1EA 2WVVB 1TELA 3HMJG 2FIQA 1MQPA 1JG9A 4DBUA 5KZMA 3N9RA 3QKEA 1V0NA 3THAA 4YTUA 1K1DA 3QGAC 1JZ7A 5HQMA 4O1EA 4MFDA 3WJXA 2DFAA 4CU6A 4TVUA 3CZ8A 4H9TA 4DEFA 4G7EA 5EMLA 4FIQA 3G3DA 3LYEA 3RDKA 1C29A 4NAEA 5F2IA 2XFYA 4OHQA 5A1AA 1ITXA 3PNZA 1TR1A 2YCIX 4HNOA 4ERIA 3GH4A 3RXZA 3TN3A 3UA3A 3C2VA 2DZAA 2WJDA 1KGWA 2OT0A 3FA5A 2YDQA 4H7VA 1EH9A 5D9OA 1P0BA 1WDPA 1J8VA 3NTYA 2DV0A 4UTTC 3ANVA 3AXMA 5CXPA 3KBSA 1RD6A 1ZP4A 4V2XA 2IKHA 2A21A 4JNMA 2P0IA 1PDYA 4WOZA 4V28A 4H9VA 3WSUA 3W1XA 1ZJIA 1TPC1 3IV3A 2OLAA 4JX4A 1DVJA 4M6VA 1R9XA 4JICA 5C2GA 1JXJA 2VFDA 4ECLA 3N9KA 1GVOA 1LL7A 2J75A 1LG1A 5AECA 1YDYA 4GZEA 2ATSA 4WF7A 1IR2A 1TR9A 3BLDA 4Q4SA 5K4XA 3BMVA 4O4WA 3NO1A 3U7VA 1F8IA 4P8WA 2VKZG 3S83A 3TOPA 2CZEA 2VOMA 1AJ0A 1C8VA 2PRHA 4IM4A 3OQEA 3UCDA 3WEZA 4I7UA 2PDJA 3IAQA 2XIIA 4H9ZA 5KINA 1NJJA 3ZXWA 5CKSA 1ME9A 1F4AA 1T8XA 1FWBC 4KPLA 2W5FA 1RALA 4D8LA 3TC3A 1Y5VA 2E1WA 1Z6KA 3QY7A 3NQBA 4A05A 5I02A 1E9IA 1WAWA 3LG3A 3N25A 3DGRA 3KM8A 2PGRA 4GZIA 3HZ3A 4TMCA 1RSCA 4HQVA 1V3MA 3N1AA 4O0ZA 1KRAC 3APYA 1A49A 1B4EA 1DQXA 4JBRA 3GH7A 1KLYA 3IJQA 4GYPC 1QNRA 1J6PA 3COTA 2XN2A 5G1TA 3WF4A 1JAEA 1PB0A 3DN5A 3W26A 3SGGA 5I07A 3VCRA 3ZVHB 1GOKA 4GVGA 2GSJA 1EJXC 3PZQA 1WE5A 3QV8A 4CU7A 2BY0A 4KESA 3FJLA 3GRIA 4FOUA 3V1PA 1W9XA 4DXXA 4BFAA 3WLNA 3CS2A 2NQ5A 3BG5A 4K2SA 1NFGA 3CAWA 1H7WA 1FDZA 4GI6A 4L6HA 4D8AA 2NLIA 4MHBA 3LTPA 3QVQA 2PCEA 2ZC8A 1ESWA 3VGGA 5FSEC 1AL7A 4IPNB 3M5VA 1ZL1A 3TJLA 4GMEA 3SIMA 7TAAA 1KFLA 2Y61A 4XZHA 3U2EA 3BQ6A 4WDWA 1JPHA 4OQVA 4MZ8A 1EUNA 4XO7A 3QLDA 1EYEA 3TNBA 2XVNA 3AXKA 1XKJA 4A8NA 3M16A 5J5DA 1L6WA 2P1FA 3OA3A 4DBEA 3QHMA 1EX1A 2X7WA 3CIXA 1RA0A 3IK4A 1XGEA 4XSMA 2PTYA 1M04A 2Y7EA 5HR7A 3L4YA 2D0GA 4UMBA 3GX9A 1H61A 4IFKA 2ZUVA 3W07A 1GOQA 1W8GA 2NX3A 5G4HC 1E0XA 3V75A 4PMRA 4QE1A 4PUEA 3TWAA 3EWYA 3TTEA 3T8QA 1POKA 4C6LA 2CNCA 2HPIA 3RJYA 1R3WA 4RNHA 4J3TA 2V69A 1TPB1 1TE6A 3EDDA 2WBGA 5A6BD 1KV5A 3HV9A 3UXAA 1WZLA 3TMQA 5CSYA 4GXPA 4HPNA 2YLAA 1XQKA 4FEZA 2ZX7A 1BYAA 1MUWA 1CGUA 4AEFA 5I23A 4J2MA 3V4BA 4AY7A 2Q6ZA 4JTRA 3NIYA 3BAKA 3E74A 3MC5A 1V93A 3FCPA 4N6EA 4YVPA 3LTYA 4J28A 4B5UA 2VEGA 3AU6A 3N4FA 1JRCA 2NV2A 2G0WA 2YA1A 5D9PA 3PZTA 1KM1A 4IGNA 3B8VA 4C6NA 2PWGA 3AISA 4NL1A 3WQFA 5CZJA 2Z4GA 5B7YA 4ZB5A 3W84A 4H8HA 1HNYA 5M2FX 4GQRA 1FWNA 3CV2A 1U1JA 1W9VA 1CGYA 5C9RA 4K38A 3TTOA 1P0NA 3KP1A 4CQBA 2PLJA 1ZCCA 1Z3NA 4JTLA 5HNTA 1TV4A 4OV9A 1EF2A 2BV9A 2VEKA 3WN6A 3WDQA 3MU7A 5G4WA 3LPFA 1A4MA 2HVOA 3LQGA 1W3TA 1YDNA 5AC5A 4W8BA 4GOAA 4H8UA 4GKLA 3FY1A 3ARVA 1UKOA 4JTJA 4DF0A 1MW3A 4KETA 3M0LA 1BF6A 4M5PA 2PRMA 1OX6A 3EGJA 1PKLA 1TVNA 4WHBA 4H9UA 4YJ5A 4I9TA 2E9MA 4C6EA 2DVXA 3TH6A 3A4JA 4REQB 3TR2A 3N04A 3K2GA 3JW7A 3WLTA 1EHAA 1GVRA 1OT2A 3AJ7A 1G1YA 1QBBA 3BG9A 2BNJA 1FWIC 1UH2A 4P5UA 4XVDA 1EXPA 3S9ZA 4M82A 3THCA 1HVXA 3W72A 2Z7GA 5HQEA 3IARA 4M81A 1GQKA 2BSLA 3WNOA 4RDVA 4C7GA 1OX4B 4Z42C 4X0VA 1A53A 1SUXA 3ITVA 2CLFA 4PBFA 1LG2A 1TVPA 2DIEA 2ZQ0A 1OD0A 2WCSA 3B9EA 2DSVA 1RHCA 4K39A 4AX6A 2DZXA 1DXIA 2DZPA 4DYKA 4C6QA 2Y8UA 4Q7BA 2Z2BA 3RUBL 1BYBA 1M7OA 5JH1A 1K9TA 4AWEA 5A2CA 4HNTA 1PTAA 3BSMA 3MJYA 1XH0A 2YW4A 3WQWA 3R8HA 4O1DA 4AZ6A 2R1MA 3CIWA 3BV7A 2F84A 2I5QA 1VCVA 4MNMA 4NJGA 3T78A 1WDSA 4XD4A 3AIQA 3PZ9A 3AYRA 3J7HA 3KBJA 2B7QA 2OCZA 1X6LA 2FVMA 2CYGA 3I4KA 4IF2A 3VKAA 4HU8A 1DTUA 3AIVA 1BSIA 4U5KA 1E5JA 2EPLX 2V5LA 3C56A 4EWND 1E43A 3UG5A 4GQGA 1VCFA 3WJYA 2FPYA 5H2ZA 4A4AA 3HGSA 4MLJA 3E6EA 1XGZA 4OWGA 1S2CA 1G4EA 1RA5A 1Z69A 4E4FA 1B3YA 1W1VA 5CLTA 1US3A 3RPTA 3I7SA 3KRBA 3UYIA 1EWDA 3QTGA 3SJ3A 1VPXA 3W02A 1MQQA 1VYSX 2R94A 4CCZA 1CGVA 1JQXA 4ZGYA 2SFPA 2VFGA 5D04C 1O5KA 1LLOA 5HINA 2OQYA 5J5RA 4JNZA 3P3BA 4LF2A 1KM4A 2BHUA 3GW3A 3EDKA 4WEVX 3TN6A 1N55A 5K7JA 5DY2A 3T07A 1RAKA 1FFRA 4PRRA 1XDJA 1JFHA 5I3JA 4QE4A 2QUMA 5GJNA 2OWXA 2G8ZA 3E0LA 3K4WA 1XG3A 3DENA 2YSWA 1GTEA 1KM6A 4UTHA 5I3FA 1NH6A 2REQB 2QXWA 4B3ZA 2JIEA 1EJUC 2TPSA 1M41A 1I45A 3CB8A 4QS5A 2XZ9A 4GY0A 2X1IA 1DJQA 4PTWA 3NQMA 3AALA 4LAMA 5T9CE 2H90A 2RUSA 1LQ0A 1E55A 4R85A 4ZO6A 2JGYA 1Q7QA 5CJNA 2C1IA 2RAGA 1RJRA 3R12A 1RCOB 4HTYA 4INFA 3FAWA 1CGTA 3CPUA 5FF3A 2FFIA 2X40A 1DJWA 2P3EA 4DUOA 3FJ6A 2JBMA 3BOXA 1GKRA 4HYRA 9XIMA 1O4UA 3CYVA 1YDVA 1QDSA 3D46A 3NAVA 3SCSA 5I3GA 4PCFA 2E6DA 4LRTA 3KLLA 4GO9A 5LA2A 3FDKA 3T2OA 1TPUA 2Q3OA 1C8YA 1U30A 3P8IA 4C6OA 4ONVA 1W5NA 1ZBKA 4B3KA 2VOTA 5LNUA 2R8WA 3KLKA 4IPLA 3W24A 4HK6A 3UFYA 4DWDA 3FSUA 4JKLA 3MCNA 4Q8UA 5EKYA 2E77A 4U31A 4JHOA 5BOEA 4J3XA 3FLUA 2CESA 1U5VA 1HT6A 4QAIA 2YL9A 4AUBA 2G50A 5D9NA 4Q8WA 1T96A 2CHNA 1L2QA 4S3AA 3LRMA 2ZRVA 4JY9A 2CERA 3Q94A 4XZ9A 4QP0A 1EEXA 2QUVA 2QPUA 1TUXA 4Y8FA 4GE8A 3VU2A 3W6LA 1AUSL 1PDZA 4QJ5B 3V5FA 2UY4A 1UKTA 1WAUA 5CGQA 1S1RA 5K9CA 3T0BA 3MYOA 3L2MA 2WHKA 1EQPA 1NTHA 5K2ZA 3LHVA 1B1YA 1V3HA 1DEDA 2Z1SA 5HPCA 2RGLA 3NQAA 5G2HA 4WLCA 3W7RA 4TX9A 3IEBA 3WBWA 3PBGA 1GOOA 1TZZA 4NASA 3A6OA 3N6HA 5HQLA 3E5PA 3LA4A 2E67A 1L2UA 2O9TA 4PL1A 1SJCA 1B9ZA 4GRSA 1BGGA 3P82A 1ZU8A 4NZ5A 1OWQA 2QV5A 1IXQA 2OOFA 1Y8BA 2WZHA 5A2AA 2DT1A 2FDSA 1G01A 2EAWA 1VRDA 1XH2A 4KRZA 4Y7EA 1XLCA 5E0FA 2OMAA 4R9OA 1ZALA 3SCQA 3L0GA 4BI6A 2W91A 1GHRA 3PPFA 1KNWA 1NFBA 4UFMA 4N4QA 4ZXLA 3NPVA 1GT8A 2QVHA 1H11A 3NZ1A 1BF2A 4ZOCA 1H63A 4D1JA 3M0ZA 3WNMA 4KCVA 4LC8A 1ZP3A 3S9YA 1R9ZA 2QCHA 4I7VA 3WZ0E 3OZPA 3PTDA 1E9LA 5EMKA 4GPNA 1Q4NX 2CPUA 5IDZA 4GI4A 3HURA 5CPSA 4D6EA 2DVUA 2F9RA 2W6RA 3SCTA 4ZO8A 3GS6A 3VOFA 2WAGA 4O13A 3PFRA 4AZIA 4MG4A 1TX2A 1S1PA 2CXGA 4ZXOA 5DRIA 3BAXA 8A3HA 4DJFD 4MAZA 5M1TA 9XIAA 1XLKA 5D38A 4L65A 2GWGA 3O6AA 1BXNA 1WA3A 1TV2A 3RLHA 4AYSA 3WF2A 4PUDA 3DEQA 2H8ZA 4MDPA 4A2SA 1UQYA 3GBEA 2A7RA 4FI4A 2TAAA 2WB5A 3W1PA 3VIIA 2ACSA 2R24A 1PZ2A 3SGZA 4HYVA 4IIHA 2YCKX 2GJLA 4W89A 2Q8LA 2NXGA 4AXNA 2B7NA 2OSYA 3NDZA 4Q8TA 2YB4A 3ARUA 3W2LA 1G67A 3WF0A 1RD5A 3L2IA 1GQLA 2XH4A 1QI4A 2ZZ1A 3PNUA 1UBSA 4LYPA 1FWAC 1ELSA 3RMEA 1XW8A 1Q85A 3GNRA 1TJRA 5FIPA 1XFBA 4TXEA 3H26A 1QAPA 2YB1A 3MSDA 1XD0A 4K7VA 5EBAA 3MO4A 3BMWA 4DJFC 4GHRA 3WQCA 3UJFA 3F2CA 3LV5A 3AJXA 5D03A 4DAFA 3FX4A 1XBYA 4F40A 4IMAA 2GJNA 1GYNA 4B5NA 1P4CA 1CENA 4K6AA 1QI2A 3TN5A 2ZVRA 3FAXA 4ERGA 3C3NA 1L6GA 4GUFA 1Q13A 1GOIA 4BHYA 1EP3A 3CPRA 2CFFA 2YXGA 4MJ2A 1M65A 1V02A 2WW5A 1NQKA 2ISVA 4YPJA 1UIOA 2I17A 3U9IA 1DL3A 4Y8EA 1QBAA 3EB3A 4WR3A 2R9RA 3LDVA 3CUGA 3NEVA 2NV9A 3QW3A 3WDJA 3S5NA 2OGJA 3Q2DA 1QHOA 4L1XA 5AHLA 3L5LA 4RPQA 1MRQA 3STEA 4HMDA 1UP0A 1TZ7A 3JZEA 3HG3A 1FWSA 1JZ6A 1CEOA 1I2NA 9RUBA 1FY6A 4I3GA 3ZR6A 2WSKA 3MYPA 1TKKA 5LIYX 1TV7A 4QM1A 4B2DA 3WQOA 3EOSA 7CGTA 4ZO9A 3VCNA 4F0MA 5TD4A 3LZ5A 2R1NA 3CEUA 3DFNA 2YL8A 3C0SA 1F6PA 2OT1A 3CTLA 3STPA 3BVJA 3WELA 1R5YA 3BTNA 3IJ7A 3E2RA 1WO2A 2CBJA 4K1WA 2ALDA 1XH1A 4MYXA 5HWJA 3WQGA 4GI9A 2XH2A 5K3VA 1Q6RA 4N9CA 4NJHA 1OG0A 3M0MA 5REQB 3D6NA 1ITQA 3SCRA 2J24A 1Q7ZA 4EPKA 2CLHA 2YXOA 1B54A 5DO8A 1E51A 1P43A 1DE6A 1AH0A 4ZMGA 3T0DA 5AYYA 5DEZA 3O07A 4LYKA 3KZSA 2BGSA 4A3QA 2YLLA 1RR2A 4DELA 4XZMX 3HQOA 2QIIA 4ZEPA 1TTPA 1YW1A 4JIRA 2QJHA 4AVNA 1W5MA 4NYYA 2PDXA 3WQ6A 1KR1A 3IACA 3NGFA 9CGTA 1V08A 4QLKA 4WXYA 1RQHA 3G18A 3CV1A 3OGSA 5DELA 2D1ZA 1AVAA 4S3JA 3BLFA 4B15A 2DW6A 1J0ZA 3TIMA 4IT1A 2D0HA 3M47A 1M1BA 4J3SA 3TK7A 5FJIA 4HU3A 2ZKMX 4O4VA 3LHTA 2O55A 3P60A 4QLLA 4BF5A 3SECA 1JI2A 4LUYA 5T91A 2RJGA 1EF3A 4W8AA 4PMVA 1A50A 1W1ZA 3RG6A 3MCOA 2KX9A 2X8RA 3G3MA 2BZNA 6CGTA 1T6MA 1JAKA 3E0WA 3S2JA 1UWAA 1ZUAX 2D2GA 2YFOA 2VWTA 1SMAA 1W6TA 2Y7FA 5AC8A 3CHDA 3FKKA 3V36A 3GUWA 4KERA 4IISA 1U5HA 3H8AA 4PRTA 3FS2A 1AW5A 1PYFA 4D8ZA 1I75A 4XAYA 1J0YA 1T0OA 3LXAA 1I2QA 1H50A 4DVOA 3VIKA 3CL7A 2QCNA 3A3XA 3PSWA 1TB3A 4PTXA 3UBPC 5C8BB 2J6VA 1CXFA 4JEJA 4LANA 1Y5XA 1XIGA 3NL5A 3BWWA 3VIOA 2WMKA 2J13A 2ZRUA 3G1AA 1K77A 4ZFCA 1O5RA 3S5YA 5B80A 3SN0A 4CNOA 3S6OA 1EP1A 3BQ5A 1HJUA 1Z7AA 5IM51 3V0UA 3O15A 5LXXA 1DPMA 4HA1A 1UWRA 2QIWA 1UMLA 1OYAA 6TIMA 5LA0A 4GFSA 4NNCA 4NY2A 5FKYA 1G4SA 1UQZA 1EGVA 3O63A 5G5IA 2G3IA 4JQ2A 3S6TA 3VIHA 4MWAA 2P10A 3UPMA 5HR6A 4MB3A 4AC7C 5AYZA 4LQ1A 1G6CA 3WJZA 5F1UA 4LRSA 1XDMA 1FH8A 4QQ3A 5KZ6A 2DIKA 4YNGA 4XVEA 1DHPA 1CIUA 3JUGA 1GJPA 1VGAA 3ALGA 2IMRA 1PS9A 3FV9A 3THQA 4REQA 3UR2A 4LUTA 1F6KA 4AIBA 3MS8A 3CL8A 3T1GA 3TTSA 3V18A 4S3KA 3BUVA 1NOFA 2P0OA 2Z29A 1PCWA 2CU0A 3GNNA 3NXLA 3SBFA 1WDDA 1TWIA 5HBFA 1A5KC 1GZ1A 2XHYA 5D2YA 1DOSA 3K4DA 4C6PA 3BL3A 3WQ5A 3GLCA 3TR9A 1EEPA 5CPNA 2Z25A 3W2MA 4HPGA 4DXKA 1I60A 7PTDA 4GYFA 2J7DA 2G97A 3O7UA 3RU6A 5ABHA 4HNCA 1E4LA 2BOEX 3BJSA 3FK4A 1QUMA 3HB9A 3O8AA 1X6NA 4JDBA 3PJWA 1V79A 1KCLA 1Q6FA 4UNIA 1QI3A 3SURA 4ROQA 3VM7A 3EB2A 1HG3A 2VEFA 3WH5A 2G37A 4BWLC 1FA2A 1HL2A 1B3OA 3FA3A 2E9BA 1V6YA 2UZ9A 4FLSA 4GG9A 3OG2A 1TREA 4OJYA 4WXZA 5AYXA 4BF7A 3K4AA 3GUGA 3AYSA 3LSCA 4EP8C 4TQTA 2OX1A 1FHUA 2QJJA 4HZ8A 5F4SA 2CLEA 4UTLA 2BX7A 1FWJC 3TKFA 2W67A 2C16A 2YZ5A 2HWGA 3WO8A 3B9NA 2ANUA 2OYMA 1KO0A 1FWWA 2FGLA 3WD3A 1BWKA 3G1DA 1M9HA 3BV4A 1FWRA 4JD4A 3EXSA 4UOJA 1W17A 4TO8A 2Z0IA 2NXIA 1ZFJA 4MY1A 4TX6A 2PU0A 4JYEA 2Y89A 3GAKA 3SY5A 4DO5A 4Q6XA 1W9UA 3ZWSA 1R30A 5G4EA 4C6IA 3LXBA 2RDXA 4B2DD 2AKZA 2DZSA 1LZOA 5CCZA 2OFJA 1UWQA 4ZQCA 1SFLA 5EA9A 4DZIA 1QNPA 1G69A 5G1YA 2BVDA 1R0MA 5EFDA 2J88A 4QNWA 1H09A 1AA1B 1OCNA 2NQZA 3VC6A 3O6CA 3L2LA 1JYWA 2QUUA 5G2IA 2EKGA 2WWDA 3DFOA 3RNDA 3FSTA 3N18A 3NYZA 2ZC1A 4OECA 2XSBA 1OFBA 1THFD 3HA1A 2OZ8A 5D8ZA 2QAFA 4UQBA 3TYZA 3VPLA 1DORA 4DNMA 3W87A 1VBGA 4QCFA 2QDEA 3W71A 5LIKX 4PMDA 3QHNA 1JZ2A 1CDGA 3ARSA 2XIBA 2HJPA 3AHYA 3UXIA 3A3HA 4IUOA 1F4HA 1GW1A 2QPSA 3LMZA 2Y1HA 3BW4A 3VFCA 3PM6A 4MLRA 4AG0A 3OHIA 2J27A 8XIAA 2VRKA 5KTLA 4B5XA 1OGGA 3OO2A 4P7NA 3IIXA 3CUIA 1C7TA 4FAMA 4K37A 1W3IA 2J7HA 1EJ7L 4JTQA 2DH3A 4DNHA 3M07A 3W01A 2OKOA 3UR5A 5D30A 3W85A 2GGEA 3K1GA 4I90A 3VKJA 4ZQPA 2W79A 4CNSA 1LBMA 2VEMA 1VJZA 2QJGA 3OJGA 3ZS4A 3QGKC 2DJXA 5HWMA 3QR0A 2DSZA 1XPGA 4GQBA 4AMCA 3LLDA 1PBGA 4IL0A 3EX3A 1UKPA 1O1HA 4PBGA 1E6QM 4ICNA 3SCPA 1A5CA 5ENLA 5ABFB 1KM5A 3WBXA 3T8LA 3DBNA 3P7YA 1JDCA 3CYJA 2CIPA 3AS1A 1M7PA 4B91A 3UW6A 3GXDA 4Q7IA 4ZENA 1JZ5A 2VR2A 3NQ8A 1H5VA 4OV4A 3VD5A 1OQFA 1XSKA 5IBXA 1CBGA 3U7BA 2PZ0A 1UWTA 4ZB2A 3PZNA 2Y6ZA 2XM1A 3CUXA 2V2HA 3TCSA 3WBAA 3B4UA 1KFCA 1OYCA 5C54A 4GIEA 1NVMA 1FCBA 1JIBA 5FEXA 1X8CA 1XKYA 4GUIA 1S2UA 3W7JA 6TAAA 1V0LA 1VBHA 3B8TA 1ZAIA 3G6LA 4KF1A 5IHRA 1UZDA 4ZE5A 2CLKA 1W9PA 2HK1A 2RH9A 4X0NA 1K02A 2C1HA 1YE4A 4FIRA 2HQAA 1XLFA 1RJQA 4GK8A 1SSGA 2E0PA 3PBWA 2GQ9A 2E8ZA 4E8GA 1D8CA 1AQ0A 2GJRA 4XZBA 4Q8NA 2AL2B 1WXYA 3VDGA 4HHMA 1RK5A 2VX7A 4ROPA 1XISA 4JFVA 2JE8A 7ODCA 4WKAA 4H8NA 4DZHA 1ZLPA 1JJKA 3W74A 3E5BA 1N8FA 3CC1A 5FF4A 3KOZA 4TU1A 2VQTA 3MI3A 2XIJA 4IMFA 1HKIA 3GKAA 3OBKA 1WNOA 4PUNA 1ONRA 3A5VA 1R6WA 5HJYA 1IEWA 1I6NA 1IIHA 5FACA 4WK9A 2A6LA 4X22A 2PTWA 3MSRA 5GJMA 3HGJA 4HHHA 3IIZA 4J4KA 4TR9A 3WNKA 1HGYA 1RP9A 3H7VA 4UQDA 4BR1A 1F8MA 2CEQA 2PD5A 2ISDA 4GUGA 4Z1CA 2QAPA 3R5EA 2ZUTA 1V6XA 2JKAA 3UD6A 3BZJA 1LDCA 1ICQA 2HISA 1XF0A 2ZICA 2J7BA 3M0JA 3WQ4A 3JS3A 4JFWA 1EZ2A 3S1WA 2ZX9A 4Y9PA 3GVGA 3KOYA 3ITYA 4F66A 2F38A 3N6JA 1E0TA 2IKGA 5HANA 5FA5A 3PPCA 1Q45A 3GHUA 2RJHA 2VNCA 2TYSA 1QWGA 3HJEA 1W1IE 4H19A 3TQ0A 4EIVA 3M0VA 1MEHA 4QJ4B 1FDJA 1J0JA 3KOWA 3VGBA 4HCLA 4AD1A 1I2RA 4FP1A 1V8EA 5LKYA 2DJLA 2GOKA 1K8YA 4HNVA 3A9BA 2ABBA 3NSNA 3QXBA 4Z0JA 1LTDA 5ABEA 3W7CA 4PSRA 1SYTA 2F61A 2I1OA 4LVFA 3JRKA 1K4GA 1TUFA 1C93A 4ZFMA 2E40A 1K9FA 4KEUA 4TVDA 3H2FA 5JXQA 1EC8A 1A0EA 1PX8A 1P7TB 1EKOA 3L65A 3A21A 2XVLA 3QZEA 3XIMA 2B81A 1YXCA 3LRLA 1F5ZA 3CUFA 3SCWA 4LPCA 4FPSA 4D6HA 3V7PA 1Q6QA 1HKWA 3WL0A 2B4GA 3WD1A 5DFAA 4GXMA 3CMGA 4P8XA 4RNFA 3L4VA 8CGTA 1IZKA 4FXRA 4AFYA 1SSDA 3XINA 2FTYA 2DVTA 3B97A 3AICA 1L8PA 1QRQA 1Q2SA 2YL5A 2VR5A 2E28A 4FF5A 4DXVA 2XDFA 4JTFA 3WF1A 4B5SA 3VYLA 4JAWA 1ODUA 2MNRA 2ZTJA 3PZMA 1G94A 1FWFC 2QDHA 2G5WA 2KAUC 1QR7A 1PWMA 3S5OA 3RU8X 3R1ZA 4R7OA 3NSMA 3W7MA 1Z8AA 2OEMA 1CT5A 3VKDA 2PDWA 4W88A 4E8CA 1ECQA 3GVQA 4ATWA 4EXQA 3P2VA 3BJFA 2B7PA 3PZGA 4GJ1A 2W9MA 2OGYA 5MF5A 3NQCA 3GDLA 4LVAA 4IMDA 3QPZA 5EYWA 3W7OA 1T5AA 2CLIA 1UOKA 4O11A 3EDJA 1LRTA 1QPRA 4YTRA 2BS9A 1A3HA 4WGHA 4NF7A 3W3OA 5DQPA 3V35A 4QEHA 2IKJA 2CWXA 4UFLA 1ZRQA 5D32A 5I00A 4P7LA 3RRXA 5A6SA 4AVOA 3OBAA 2EKCA 1D8WA 4B3LA 1BTMA 3RPMA 3B0PA 2ZZ7A 1HGWA 4A21A 2QNEA 4H41A 3P84A 5KEZA 1XI3A 1AD4A 1SJBA 2AAMA 4NZ3A 1Q66A 3PN8A 3LSBA 3TUUA 3WLLA 3FYOA 4MYAA 4RZ4A 1P6BA 3EOOA 4H01A 4Z0SA 1UR9A 2Z2UA 1K8XA 4UOQA 1KCZA 4MNKA 2J8TA 2PDFA 2ZXQA 5CSRA 4IIDA 1BAGA 1DP0A 1OFRA 4GYKA 4XV0A 4Z08A 2G96A 6REQB 2P50A 2IQ0A 1US0A 1SU5A 1WXJA 4EVZA 1WZAA 1GOWA 4ZQNA 3S8HA 2ZRWA 2XVPA 5DT7A 3BJTA 4AHQA 1N8WA 3BARA 4OVXA 3F5JA 3TC6A 3S0CA 3I6EA 3VX0A 1EXBA 1N82A 3HV8A 3EWCA 1PKNA 4JFTA 4LJ3A 5U7SA 3DKLA 3C8FA 4OOZA 1OC6A 3EEZA 1PL9A 2DUAA 3SCOA 4AH7A 2CW6A 3AI0A 4HMEA 1ECEA 3ABXA 1XYLA 5IDIA 3W4RA 4IJRA 1JD9A 1EOKA 3NQ2A 2JGQA 3K46A 4W4QA 4X3ZA 3LPGA 3KL3A 3R2GA 4ILSA 4IJBA 2PDCA 1EB3A 3VNJA 1IXNA 1PIIA 1H0GA 1ZGDA 3IVTA 4KCWA 4QTGA 2VQUA 1SM9A 3CTTA 1AH3A 4W7UA 2DIJA 3FHAA 1Y7VA 4NKCA 3G1XA 1V6VA 1XLAA 2QDGA 3VDHA 3UJSA 1QPQA 3KBWA 4I5UA 1EP2A 4BEQA 4O54A 4XTDA 1KQYA 3EWBX 2VXNA 1AD1A 5M03A 1PHWA 2O92A 4QG8A 1B4KA 4IIBA 1QXLA 2POTA 3AHZA 1BVWA 1OCJA 1LL4A 4JCLA 3XISA 4HMNA 2Z1BA 4BI7A 2W61A 1TA3A 2WC7A 1S2VA 1E1CB 3TSMA 1B2YA 3W82A 3GXMA 3I7RA 1UC5A 5LNSA 4IGHA 3K8MA 4GGBA 3KVLA 1UZ1A 4AIOA 2R6OA 1UD8A 4JTIA 4E2VA 5AC4A 4WGXA 5IOBA 2NW0A 3T2PA 1VR6A 1JDFA 3LHWA 3GK0A 4IIEA 4MADA 5LIXX 1AQHA 3M44A 1XLLA 2F2HA 5AKQA 3URNA 4NZ4A 3N3MA 2VGIA 4ZOAA 2Y7DA 2PDYA 4Y9MA 1ZZMA 1J0KA 2NVCA 3NDOA 3SADA 1JYVA 1CB2A 3CUJA 4ZB0A 3I3BA 1WXZA 3H4WA 2V9DA 4CKQA 5DT5A 3VZYA 3NL3A 2ZCGA 3ZR4A 3ABZA 4AD2A 4L61A 3EWZA 2A3HA 2QCLA 3LM7A 1QWKA 4UB9A 2PDPA 3PZVA 4EF8A 2NWSA 3JZUA 2V5JA 1E72M 4KWVA 1FXPA 4BK9A 3FXGA 4DM2A 3L66A 4LCQA 1UUOA 1G5AA 5JMUA 1VHNA 4MB5A 1OBAA 5C9ZA 1VLWA 3TE9A 2KZHA 1KLZA 4RDWA 5U4NA 3FXYA 3G0SA 2ISFA 5A6JA 3NSXA 1HJXA 2E9LA 3LBOA 3V16A 2PFHA 3AHXA 2VD8A 1KKRA 3IRDA 5EMMA 2CXEA 3BAYA 5I24A 4BI5A 3DX5A 3IRSA 2Z1VA 3GFZA 1F61A 2V3DA 4UR8A 3WFAA 2PP3A 3GNOA 4JTKA 3VD9A 1XRSA 2WZMA 3ITGA 3DG7A 5FCZA 1V3LA 1JCMP 4A6GA 5CJMA 4I6VA 2V5KA 4PZVA 5DF0A 2X41A 2PE4A 2WWCA 4IXXA 1DIKA 2VWSA 4I9JA 1Q6DA 2WKGA 3BURA 2PP0A 3EMZA 3EXTA 5BW6A 1YXYA 4O57A 2GVJA 3KBMA 5KITA 4YYFA 1WUEA 1TRIA 4NXSA 2P8BA 4R7JA 5I06A 3NQ6A 4HA3A 3MMTA 5BZAA 3UZYA 1EDTA 2FB3A 3YPIA 2WBKA 3PUDA 1LOQA 3LBCA 2QJMA 1ZAJA 2A3LA 3TROA 2V5DA 4PMOA 1REQB 3L4WA 3BLEA 1IIGA 3V3WA 1K7FA 1RBOB 2NX9A 1E9ZB 1DWGM 1CWYA 2VDIA 2G3NA 3C6CA 3NOYA 5EL1A 3T4CA 2X1SA 1QCWA 1F05A 2I5GA 2V5BA 5FJRA 1ISZA 5CGMA 4EAMA 3EXRA 3QOMA 4N6FA 1W9DM 4HPHA 2FMNA 1AZ2A 3B0VC 4D6FA 2HTMA 3CGTA 2YPIA 5DLCA 4NIRA 4HU4A 4MPQA 1R3RA 1E6ZA 4NJKA 1MUCA 3DIPA 3M0HA 1SZEA 5BWAA 1UP2A 4FXFA 4QCEA 1KBLA 3EZ4A 1EGZA 2UY2A 2PWHA 3UWUA 5MHBA 2BOFX 2E7FA 1Q4WA 3ELFA 4FNQA 1KWKA 5HMSA 3M0IA 1GOXA 1TWZA 4EKJA 3B05A 2V2CA 4B5WA 3H2CA 4LVGA 3G77A 1B30A 4ATLA 3DXIA 2IW0A 4YN5A 2FVLA 2QCDB 5F2GA 4Y9AA 4GYJA 1BQGA 4AF0A 5ABFA 3RX3A 4AZCA 1W32A 1F6YA 4FB7A 2PODA 2WMFA 3WD0A 3UEQA 3W1TA 3W7QA 4DJDC 2JFEX 2YFNA 4AU0A 2PGFA 4DWSA 1IWAA 3VIPA 1R87A 1QW8A 1LQ2A 4GACA 2WNZA 4MZ1A 1N7KA 1BFNA 4X9YA 3HPFA 4J27A 3MKVA 3JR2A 2GLKA 3ORWA 4H4IA 4FNUA 3DFQA 4RZ6A 1TQJA 3IWPA 1UJQA 4RUBA 1JUKA 3W37A 3IJ9A 3PPGA 4O52A 4S23A 5I3HA 3L4UA 1TX0A 1OY0A 2CZDA 1W5PA 3N17A 1XIBA 3M46A 3BE7A 2BXZA 2VMFA 1V7YA 3HQ1A 4WQ6A 4NXKA 2GVEA 3VKCA 1UCWA 1O6IA 1QNOA 1KCKA 4HNUA 2PDGA 3E2SA 4R5EA 4JTGA 2AL2A 4AIEA 1X39A 2VR4A 2BASA 3GDBA 4UTTA 2X2YA 4NX5A 4Z17A 2PURA 2GVYA 5HUPA 3GC5A 3G1VA 3R4IA 1AJ2A 1VB9A 4RDYA 3EAUA 2PP1A 4XAFA 2NT0A 4AISA 4OUIA 3IPWA 3WF3A 4PCPA 2D2HA 4WSHA 3ZLHA 3PWGA 4HNLA 1UUMA 1FP9A 1ADDA 3VK5A 1JPMA 1BRLB 3FNDA 2DZWA 3QSTA 4IJCA 2ZZ4A 4OZOA 4PE8A 4TMBA 2AOSA 3D47A 3DBPA 5A8NA 4XO6A 4L80A 1C7SA 3QHOA 3S5ZA 3NZPA 1NWUA 3NPXA 3OW1A 4MJZA 4QDWA 1HZYA 7A3HA 1EBGA 7TIMA 3HGOA 1AQFA 1O95A 1QNVA 3WUBA 2QUTA 4TTUA 2EG6A 2H8XA 5EB8A 1XQLA 3W53A 4C6DA 3W1MA 2VDGA 1GG0A 4QGCA 4Y9NA 3DESA 3B0UX 2CWNA 3VC5A 5C2CA 1NDWA 4E4PA 3GB6A 3PUOA 1W0MA 2G3JA 3QPEA 3HFYA 5D4YA 1M03A 3AUJA 4JFSA 1HKMA 3FGCB 1U22A 1PZ0A 1AJZA 4D2JA 3VDAA 3NVDA 2ZXDA 4E4UA 1MNSA 4RE4A 3W7GA 4V33A 3NEHA 1MXGA 4W9TA 1KBJA 2EBNA 3SQSA 1S5VA