4HK6A

Crystal structure of cordyceps militaris idcase in complex with 5-nitro-uracil
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
369
structure length
369
Chain Sequence
PVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uracil-5-carboxylate decarboxylase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
total genus 133
structure length 369
sequence length 369
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.66: Uracil-5-carboxylate decarboxylase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4hk6A00
2OQLA 4ERAA 1W1IE 3B40A 4PCPA 1JGMA 1YBQA 1ADDA 2RAGA 4G7EA 4QROA 3QY6A 4XAFA 2YZ5A 1EJUC 2AQOA 1KRBC 4CNTA 2R1NA 2WJEA 2P50A 4C65A 3DCPA 4LCQA 3N2CA 3EWDA 1FKXA 3A3XA 4XAGA 4PBEA 3EWCA 2DVUA 4UBPC 1POKA 4H00A 2Q09A 4KIRA 4AQLA 2A3LA 1RK5A 3AU2A 4CQBA 4Z42C 2HQAA 4IFKB 4V1YA 3LA4A 4H9YA 3OJGA 3HPAA 5AKQA 2EG6A 4GZ7A 2GWGA 4C6OA 4UB9A 4CNSA 1NDYA 1YNYA 4B90A 4BKNA 4F0RA 3GIPA 2FTWA 4WVXA 1KRCC 4LANA 3LGDA 1NFGA 1EJTC 2VUNA 3F2DA 3LY0A 1GKRA 2PUZA 3S4TA 3E3HA 4B3ZA 2F6KA 2AMXA 2P53A 3A4JA 3MPGA 3UPMA 3DUGA 4F0SA 4C60A 3QY7A 4B91A 1O5RA 3JZEA 4H9XA 1A5MC 1VFLA 1V4YA 2VR2A 1PB0A 4KEUA 1GKQA 1I0BA 4LCRA 2QT3A 4C6EA 4IGNA 2R1KA 3GIQA 2EG7A 4IG2A 3SO7A 2VC7A 1BF6A 4GBDA 2YB1A 4B92A 1J79A 4QS5A 2HBXA 1K70A 2KAUC 2Z28A 4LEFA 1I0DA 1DPMA 4GYFA 3GU2A 3B0YA 3E74A 2WJFA 2PAJA 3G77A 3GTIA 3ISIX 3LGGA 1QW7A 3NURA 4LCSA 4XAZA 3F4DA 3OQEA 4C6CA 3AUOA 5CH9A 1ONWA 4C6NA 2HPIA 3DC8A 2IMRA 1R9ZA 1S3TC 2Z7GA 4KETA 2Y1HA 3T81A 2FVMA 1EJRC 4EP8C 4C6PA 3MTWA 2FVKA 1A5OC 3QGKC 4OFCA 4DZIA 4LAMA 1P6CA 4LFYA 4C6DA 2OGJA 3D6NA 3E38A 2Z00A 4KESA 4J5NA 4C6KA 2Z25A 4NG3A 1FWJC 1FWFC 1YBQB 1EJVC 4LALA 4CQDA 3MSRA 4G7EB 4XAYA 1NDWA 4C6BA 3HM7A 4IF2A 4XD3A 5A6TC 4PCNA 1KRMA 1J6OA 3PANA 3PBMA 4LAKA 2G3FA 5LXXA 1M65A 4EPKA 2Q01A 1EJSC 2D2HA 4HK5A 3IV8A 3TN6A 3E2VA 1FKWA 4R88A 4L9XA 4WGXA 4KERA 4C6FA 2D2GA 2Z27A 1A5LC 1RA0A 3GU1A 4DI9A 3MKVA 4GX8A 1UMLA 4C6QA 4HK7A 3UR2A 1FWEC 3MJMA 4C6LA 1EF2A 4QS6A 3E0LA 4M51A 4JOMA 4P5UA 3GTFA 3IJ6A 1KRAC 3V7PA 4I6KA 2ZC1A 2PGFA 3E0FA 4TQTA 4GOAA 4F0LA 1QXLA 3T8LA 4DLFA 4GY1A 2EG8A 4INFA 3LS9A 3FDGA 3F4CA 3S2JA 4NI8A 4ZSTA 4RDWA 3F2CA 2VC5A 2FTYA 2AQVA 1EJXC 3O0FA 4PE8A 1A4MA 4KF1A 3UBPC 3K2GA 1YIXA 4QSFA 4NP7A 4QRNA 1GKPA 1HZYA 1UIOA 3LSBA 1M68A 3IGHX 4ERGA 3PAOA 2OOFA 1RJQA 4H9ZA 3URNA 1XGEA 4IG2B 1RJRA 4H9VA 5FSEC 3RN6A 4GX9A 3ID7A 2Z26A 4G2DA 4I6VA 3MDUA 3RYSA 1EYWA 4PBFA 3HTWA 1ONXA 1A4LA 3NQBA 3LSCA 3IRSA 3O7UA 4LH8A 4YIWA 4C6JA 4CNUA 2YB4A 3LU2A 3MDWA 4DLMA 4GY0A 4IFOA 2QPXA 2XIOA 2DVTA 3TNBA 3WMLA 2E25A 2PLMA 1V51A 2R1MA 3QGAC 3AU6A 4MUPA 4EPBC 3BE7A 1A5NC 4L6DA 4HJWA 3URAA 3RHGA 1FWHC 1XRFA 2HBVA 1R9YA 3ITCA 4J35A 4IFRA 3CJPA 4RDYA 1ITQA 2D2JA 4IQJA 1FWAC 3A3WA 1XRTA 4H9UA 2E1WA 3F2BA 4GXWA 2UBPC 4XD4A 3ORWA 4DO7A 2HNHA 4ICMA 1NDZA 4C5YA 4C6IA 3GU9A 4RDZA 2ADAA 4CQCA 4C5ZA 2GWNA 3TN3A 1FWIC 2WJDA 4BJHA 2O4MA 1J5SA 2UZ9A 3URBA 3OVGA 3S2NA 4BY3A 2ANUA 2ICSA 3GTHA 2W9MA 2R1PA 4IH3A 2VHLA 4KEVA 4DYKA 1E9ZB 5FSDC 1RAKA 2GZXA 2VM8A 4EPEC 5HMDA 1POJA 2GOKA 1V77A 1FWGC 2OODA 1A5KC 1J6PA 4XD5A 4AC7C 3KM8A 3CS2A 1E9YB 2Z29A 2I5GA 3RCMA 4V1XA 4H9MA 2GSEA 4IFKA 4XD6A 3LNPA 3GTXA 4H9TA 1K1DA 4LAOA 4H01A 3CAKA 3IPWA 3K4WA 3OU8A 4RDVA 1FWDC 1RK6A 2DVXA 1XWYA 2QVNA 3IACA 3URQA 2YXOA 1EJWC 4GC3A 4RE0A 2OB3A 3UF9A 1NDVA 1PTAA 4HA0A 4DI8A 3OODA 4GY7A 2I9UA 1RA5A 1R9XA 1M7JA 1YRRA 2CZVA 4R85A 4DNMA 4RZBA 5HMFA 4ERIA 5G4HC 1PO9A 3TN5A 2FFIA 1V79A 3B0XA 3C86A 3TN4A 4E3TA 4ZSUA 1O12A 3MVTA 3PNUA 3T1GA 1WXYA 3IARA 2QS8A 4WHBA 4QTGA 4CEUC 3UR5A 2WM1A 1P6BA 2Z2AA 3S2MA 1WXZA 4HK6A 5E5CA 2BB0A 3S2LA 2O4QA 1IE7C 1FWCC 1P1MA 1K6WA 3K5XA 2Z24A 4J2MA 4IGMA 3PNZA 3GRIA 4GK8A 3GUWA 4EPDC 1RJPA 1V7AA 4D8LA 2BGNE 1KCXA 3OOQA 3EGJA 2HPMA 1EZ2A 1ITUA 2Z2BA 3QY8A 1ZZMA 4KEZA 1FWBC 3MVIA 3WYZA 4CEXC 2PGRA 4R7WA 3GG7A 4DZHA 1UIPA 2Z4GA 5HMEA 3SFWA 4KQNA 1PSCA 3ICJA 3R0DA 4C6MA 3FEQA 2R1LA 3WZ0E 1YMYA 1UBPC 4DIAA 3FDKA 3NEHA
chains in the Genus database with same CATH superfamily
4FR6A 4O19A 1Q85A 1R87A 4PA8A 4FB7A 1XG3A 2V0TA 3DHFA 3INPA 3USBA 3UPWA 1W37A 3KBVA 1XIMA 2WM0A 4E5TA 4M56A 1Q7QA 1E40A 1U30A 3DH7A 1WKEA 5D09A 1HFBA 4DBWA 2NQJA 1C3FA 2CESA 4HYRA 1IXQA 3QQWA 4F2BA 3PP7A 2Q8ZA 3WLTA 5CBIA 5KITA 4IIEA 1FY6A 4DRSA 4O15A 2Z2UA 1C91A 3CV7A 1S46A 2QIIA 4B90A 1JI2A 1PXGA 4ATWA 4B3KA 3WG6A 1G9HA 2GPTA 2E28A 3CAWA 3CASA 1IQ8A 1KQYA 3K4DA 4B91A 1KNWA 1QR7A 3IIXA 3IS4A 3JZEA 3PBYA 1TJ2A 1H62A 1ONEA 2WQDA 2WK2A 1UH2A 2E5DA 5AC8A 4IGNA 4C1KA 3D0CA 3LNMA 4O1FA 4PFHA 1A5CA 1PX8A 2DORA 5C5YA 3T0TA 1PTGA 1GT8A 5AYXA 4JL2A 4IHCA 4Y90A 1KFWA 1J0HA 3VOGA 3CNYA 1QNQA 1RHCA 3F5LA 2E1DA 4IT1A 3VD4A 4MFDA 3UZJA 2ZOXA 1RH9A 3WQPA 4ATDA 1KQZA 3ITOA 1UA3A 3H55A 3ZJ7A 1OYAA 2E09A 3B03A 2XIQA 2YCLA 3NPXA 4R34A 2DV0A 2ISWA 5A6SA 4H6EA 1AK5A 1D3CA 1HN1A 4FS9A 4BS0A 4AXNA 1Q8AA 1DKWA 3VNDA 4GKTA 3CIXA 3RU8X 1VQTA 1EEXA 1UROA 4HPNA 2WSQA 2XH4A 3MSRA 3G6LA 3GUGA 3V3WA 4AB4A 1KM5A 5EMJA 4ACYA 3W37A 3W7PA 4W5ZA 3PANA 3VIIA 3W7LA 2V5DA 1FTXA 2V63A 1FFQA 3KLLA 4HHHA 4Q8NA 3CWHA 1JG9A 2HROA 4L9XA 1ISZA 3AXXA 1HUVA 1DJXA 4X61A 3VC5A 3N11A 3PAJA 2A2IA 2WZTA 3VDBA 4H04A 4DI9A 3DBNA 1EEPA 1YLVA 1S5TA 1RR2A 3OQ8A 4UQAA 3SGGA 3EA2A 5F4XA 4I6KA 3DZ1A 3OVRA 2H3DA 4GOAA 1X6UA 4QLLA 4GY1A 2EG8A 3HQPA 3VILA 4F0MA 2OU4A 1I8JA 4NZ4A 4BQ3A 4Z1BA 5FJJA 3EKZA 4HNTA 5CSYA 1A5BA 2DDXA 2Y7FA 4CN1A 1R30A 1V3IA 3AMCA 4TX6A 4QHRA 4DHGA 2DH3A 2J7FA 5G1TA 4O8RA 3RLUA 2PDXA 1DVJA 4D6JA 1DIKA 3CUXA 1MXGA 2EEXA 1YDNA 5I7GA 2OFJA 3TDFA 3BARA 4N0RA 3O6DA 4GUIA 1TV3A 3TYBA 3BXWA 2GK1B 3H7UA 3QYQA 1NP0A 4QE4A 2VOMA 3QM3A 1KBJA 4K1WA 4GY0A 2PBOA 4IFOA 1U33A 2R24A 4UFKA 2G37A 1FWNA 3TNBA 3H4XA 4HMNA 4JFSA 4BI7A 3CUZA 4RKAA 3QZAA 1WAWA 4PUJA 4EPBC 3BE7A 3E9AA 1FWHC 3NZRA 1R9YA 1WE5A 3DGRA 1XH0A 5B7ZA 1TQXA 4XD4A 3HO8A 1GW1A 4IJBA 2RDUA 1UD4A 3H7VA 1V3JA 4DAFA 3LHYA 4XB3A 3EPOA 3E1F1 3W81A 1EQPA 1HVQA 2XJ7A 3DFQA 5BWFA 3AIQA 3A21A 1MZRA 1CGWA 1EH9A 4I3GA 4PTVA 5DCEA 1JCTA 1S39A 1T5AA 4IIDA 4N42A 1POJA 4LUSB 4O17A 4ZB2A 1V77A 1LORA 2WMFA 3BGJA 1UUOA 3CT7A 5L9FA 5HWJA 4NJKA 1XBVA 3KRSA 5AZ1A 3TTOA 4GZJA 1LF1A 1UYQA 3L0KA 4WF7A 3LTPA 3GDBA 2WMIA 5KETA 2DJXA 4S39A 4G9PA 1R9XA 5BROA 3TV8A 3RR4A 1M7JA 4KWVA 4DNMA 2Y8UA 1V5XA 1XINA 1J0KA 1PO9A 1EUNA 1K4GA 1AQ0A 1XSIA 1EF3A 4ZSUA 2ZUMA 3FSUA 4YTQA 4KH2A 5GNYA 3WH7A 2I1OA 4CUCA 2DZPA 3ARWA 2DQWA 4PBGA 4PMOA 1FCVA 4Y9AA 2VX5A 1SO4A 4M1BA 3BW2A 3OGSA 2XINA 5AYZA 2Z1VA 3FGCA 4KBXA 2DZAA 4UTIA 1P48A 3VMNA 1A3XA 2V67A 2Z2BA 1V93A 3W6MA 5I0DA 4KKXA 3HU7A 4JZ5A 3OLDA 1FCBA 3JZUA 4UNLA 2X1TA 1Q6LA 4OV4A 1ZJAA 4QITA 2XGIA 1LQ0A 2V5CA 1FDZA 3HMJG 1RPXA 2ZC8A 3R94A 2AAMA 4F79A 3SUSA 5A8PA 4XKYB 3T2QA 1NF7A 1NSJA 2CZEA 2OLHA 1SFSA 3B40A 4BWLA 1OM0A 4Y7EA 3VNMA 3QTPA 1VBRA 1F4AA 3W71A 4LS0A 1F07A 3QY6A 4A3QA 3KLKA 2AQOA 2VCCA 3S6TA 4ZB0A 5IM51 2WKJA 2P50A 1TTQA 5H91A 3WD0A 3DCPA 3RCNA 3AAMA 1RP8A 1GVFA 4K37A 1Q4NX 2BOGX 3CTLA 4Q6JA 1RK5A 3BWWA 3S1XA 4E4PA 5D04C 3STPA 3ATZA 4H9YA 3OJGA 3T0DA 5AYIA 1XLMA 3NNTA 3WH6A 5HNRA 2IPJA 1YNYA 2J78A 3QR0A 4O0KA 4AWSA 4JX5A 2OEKA 4MYXA 3M7SA 1W3NA 3BAYA 1XH1A 2BGQA 3H24A 4Z17A 4V15A 3C0JA 4R5EA 5F4SA 2ZKMX 2YGYA 4Z1DA 3LGEA 4B5VA 4UNKA 1I0BA 2ISFA 4J4KA 4BEQA 3K1DA 3SGUA 3P82A 4BEUA 4PRRA 6XIAA 2J7EA 3A47A 3OTRA 4LEFA 1O68A 4DO6A 1LOLA 1QNVA 4B9ZA 4AWUA 4NL1A 4M7TA 3KRUA 3BMWA 4NNCA 4QAWA 2RH9A 4QDPA 1CNVA 1XYBA 4XG1A 1HKMA 5HNNA 1Q13A 1L6FA 2EF9A 3WLPA 3W1PA 1B3ZA 3GDLA 3VD9A 4OFCA 1A5OC 1E0XA 4QM1A 4F9DA 1IR2A 3R79A 3P2VA 3VGBA 1JAEA 4DX3A 4PTMA 4LEQA 1PX4A 3BVJA 4Q8PA 1QO2A 4IF2A 1GVRA 3K13A 1KRMA 1WKDA 4IPIA 1J6OA 4P7LA 1TPB1 3KHJA 1W6TA 3P81A 3NCOA 1M65A 7XIMA 3WL1A 1SZFA 2WC4A 1TWDA 3DESA 4DWSC 4X22A 1EJSC 1GG0A 3H12A 4AXKA 4J3TA 8CGTA 3ES8A 3TR9A 1SR9A 5C54A 3MKVA 2JEPA 1UMLA 4HK7A 4RLIA 4PGLA 3KS5A 2G3MA 1W5PA 4DLFA 1UD5A 4FP1A 3SY5A 1GG1A 2CLIA 3WDIA 2ALDA 3RCYA 1DP0A 1W3HA 2NQHA 4FALA 1DJYA 3STCA 3R10A 1JFXA 1EJXC 3O0FA 3P6LA 3T42A 1JCJA 4LYKA 1KXTA 3VABA 1F3WA 1NAL1 3VIJA 1MMFA 3CU2A 3WH9A 3UYIA 4MAVA 2CLMA 4NILA 9XIMA 4NAEB 2C8NA 4CNPA 3I3DA 5J04A 2G3NA 5G2HA 4GI9A 1RSCA 3AFBA 2R14A 1JZ4A 1VCVA 2QCFA 3VKBA 3LHVA 3NZ1A 1VENA 2POTA 3WLSA 3ME3A 3K8LA 5HNTA 4MKNA 1TJRA 4MSSA 4Z2IA 3WQ5A 3VA8A 1YE6A 2Z1KA 4I7WA 3B9AA 1OVDA 3H2MA 2QJIA 4JR5A 2D73A 4L1GA 4U5KA 1DOSA 1V7YA 1SJBA 5FJIA 1EDGA 4ZTXA 3CZ8A 3M1ZA 3RHGA 1F61A 3NEVA 3RLHA 4OT7A 4YYFA 1VJIA 3M0LA 4C1NA 4B2DD 2KZHA 3W7HA 2A85A 1CXIA 3S47A 2RDTA 2YZRA 3MP4A 3W75A 1OWQA 3KFTA 3LZ3A 3G22A 1FWIC 3HPFA 2OT1A 1HVXA 1GQJA 1L6WA 1FDJA 3W7CA 1V02A 1UP0A 3KTXA 4GNKB 2CFFA 2P8BA 4DQWA 1JPIA 3G1HA 1EPXA 1E9ZB 3MMUA 3MUY1 1AMKA 3WD4A 1K8ZA 2I5IA 4MZYA 4PMNA 3QH2A 4WRHA 2VELA 3LZ5A 4H9MA 4LC6A 2VI0A 2OX4A 1WA3A 1CDGA 3BQ6A 2YDQA 3T05A 1N8FA 2PTDA 5K3VA 1BTCA 4MB1A 2QEZA 4KW2A 3UJ2A 4H19A 3ENLA 2VWTA 2W66A 3HG3A 4L1WA 2GYIA 3S5NA 2QCHA 1DXFA 1OFAA 1JZ3A 3GXFA 3SB0A 1H7WA 1OABA 3F4NA 2FFIA 3S1WA 1HO1A 3S2CA 1V79A 1B1YA 2RGMA 4L9YA 3UCCA 2DIEA 3MVTA 4K2SA 3QN3A 3W01A 4PL1A 5ABGA 3AOFA 1B54A 1BEUA 1O95A 2QF8A 2QMJA 4LVFA 3BURA 3L12A 4D9PA 4RPQA 2O4QA 3GVQA 4UFMA 4PSPA 4GNJA 3O6CA 3G24A 2GK1A 1UR0A 2DZVA 3UXIA 2J88A 2VDGA 4RE4A 2XIJA 4FX8A 2YL8A 1J4EA 3MYPA 2INFA 3FJNA 4ONVA 1ITUA 3CZLA 5A5WA 3GG7A 2ASHA 4RV3A 3DFOA 3S3GA 2P0IA 3NZGA 4E38A 2OWXA 4S23A 1QO5A 5DRIA 1SZRA 5EMYA 4B5SA 3IIPA 3SCQA 3BLPX 2H9AA 3HQNA 1XIIA 3M0YA 3MI3A 3GXIA 1DXIA 3G8RA 3MA8A 3F1QA 3E5PA 3BQ5A 3ABSA 3L4VA 2ZX6A 2X7WA 3LV6A 2Y5JA 3P84A 4QJ3B 1FKXA 4PUNA 4U33A 4WJ8A 3LCHA 1C7TA 4JHOA 1Q6CA 2A3LA 2C19A 2BZNA 2MNRA 3BSHA 4F0HA 3OVQA 2NUWA 5F2LA 4PCSA 4GZ7A 3GB6A 3I6RA 3M7WA 5LIXX 5MHBA 3UGVA 3W1TA 2VX7A 1TVLA 2GGEA 1ITCA 5GPRA 5HPOA 4O18A 1LT8A 2PD5A 1TKKA 4RNHA 1MNZA 3LENA 1I45A 3NR0A 2PEVA 3A4JA 1G69A 4AAJA 4NQ1A 2OOGA 2V81A 1A5MC 2OQYA 3WNMA 3RFAA 2J74A 4MYAA 1XCWA 3BSGA 3CBWA 4MKVA 3WN6A 3C2OA 3PWAA 4OV9A 3WX7A 2XGZA 3GIQA 4Y9MA 1RP9A 3AMLA 5FL0A 3GX9A 4AIUA 5D2VA 3CH9A 4QS5A 3NUKA 3A5VA 4NX0A 3LX9A 3M0VA 4WOQA 1UWIA 5TBOA 5EMKA 4IISA 1TMLA 2R6OA 3ZXWA 3WFLA 3NA8A 1EQCA 2OMAA 4AD3A 3T4WA 4TV5A 5AHFA 2FGZA 3VI2A 4AIEA 4GBUA 3QHOA 3A9IA 2FZBA 5F2IA 3HF3A 1JNEA 2ZVRA 2P88A 1E4IA 2EPHA 3S9ZA 1HP5A 3N3MA 1OT1A 2PLCA 1HKVA 1H5VA 5AY7A 1JR1A 2VO5A 2ZX9A 2RUSA 4O0ZA 1K02A 3DERA 2FB3A 2CETA 3WUBA 2IKHA 2QVHA 2WYSA 1NDWA 1C8QA 4UQCA 2VNCA 4UR9A 4LS2A 4Z1YA 3XINA 3OZYA 3VOJA 2WBGA 5D03A 1VFUA 1G7UA 3DFNA 2VEPA 2B81A 2YBUA 2QJJA 3SN4A 1W3LA 1RA0A 3AS3A 3FA3A 3NQ2A 2W3ZA 4GJ1A 1SO6A 4UUIA 1YPFA 1A5AA 1M3UA 2V5BA 1RALA 4OKDA 1GVEA 2HK1A 2ODOA 4GC4A 1REQB 4QIUA 3OGRA 3VE9A 4JN7A 1IEXA 4TQTA 3B97A 3W00A 2PDJA 2W27A 4ZFMA 4O8AA 4RDWA 3KOFA 4RW5A 2VC5A 5D9OA 3M0IA 1CYGA 3PTKA 5D32A 3RO8A 4EXAA 5FEXA 1HZYA 3LHTA 4ZR8A 1UIOA 3NQEA 4PB5A 2NQ5A 3FJLA 1E51A 2AMGA 4MNMA 1N8IA 3GK0A 1LP6A 4JKLA 5BWAA 3S6OA 4D71A 3RYSA 4B3LA 4HSOA 3RPMA 3PJXA 1X1OA 5E70A 4GVHA 1TX2A 3C2VA 1A47A 3KOYA 3PPCA 1KM3A 5C71A 2CHRA 1VP5A 3M5YA 5KZDA 4JNZA 4BR1A 2FZDA 2QJHA 1LWJA 2BHZA 2DEPA 2ATMA 1JYWA 1XKYA 1TIMA 4MIMA 3SRKA 3C0LA 4WDXA 4R53A 3LMYA 3W7MA 1SR0A 4HOZA 2PMQA 2PDWA 1S2AA 2ZX5A 1OD8A 3GVVA 4UTWC 1N55A 1MVYA 1Q6EA 3W53A 1X1NA 3L65A 4WZHA 2UY5A 1TZ7A 3LI1A 3EX6A 3VMPA 2XM1A 2FDSA 4KEVA 5REQA 1BKSA 4EWJA 2OJPA 1B9BA 5HMDA 2WVUA 3TQVA 3T08A 2QUMA 4OUEA 1E1CB 2H8ZA 1A5KC 1ZJIA 3KM8A 3VKAA 1OK6A 3D47A 3QFWA 3W2NA 1ZALA 4HHPA 3FS2A 3WK1A 3S6DA 1LQ2A 4LAOA 1K1DA 3BW4A 1PYMA 4MY8A 1XKJA 1H5YA 1ME8A 4QCFA 5CJNA 2J4GA 3A4WA 1AH0A 1E5JA 1PTAA 3CAQA 1QBAA 3REQB 4LAUA 3VVGA 2BXZA 4GVFA 3NVDA 2OR2A 4DJED 1V3KA 3BMXA 1O66A 5C9ZA 4PN2A 4X0NA 4DBSA 1XLEA 4QDMA 4E3TA 4HZ7A 3MJYA 3T1GA 1NQ6A 1G4TA 3W1AA 1TB3A 2BX7A 1Q2RA 1FP9A 4GI4A 3FAWA 4YN5A 5E5CA 3NIYA 4IICA 3NO3A 1QASA 1XYCA 4QG8A 3CXOA 3DIPA 3VD5A 4PMDA 5DRCA 3GUWA 4JIRA 4EPDC 4JTKA 2ZXBA 3PTDA 3JS3A 2YLAA 1O7AA 2ZA3A 1D3GA 1XFBA 1L8NA 1WDDA 4J1OA 2WNQA 1XYMA 1ZAHA 5HMEA 3CO8A 1JGIA 2E9BA 4QAIA 2GJXA 1UP2A 4IUGA 2BG5A 4K39A 1BPLB 3WLRA 3NDZA 1J8VA 2WZHA 1LM1A 3OBKA 4GCXA 4AY8A 4KWSA 2RAGA 4G7EA 1J11A 3U4FA 4CNTA 4CD5A 1F9CA 2D23A 3R0KA 4LCQA 3VCCA 4H4IA 1POKA 5BU6A 2Q09A 1Q6RA 3N9RA 4M24A 4MB3A 3G0UA 3P0WA 1OB0A 2GVEA 2ESCA 4WOZA 5JH2A 4GZEA 4AHQA 3LA4A 1XV8A 1NF0A 1RVKA 1JZ6A 4C6OA 4O53A 2TYSA 2NV2A 3RMJA 4BKNA 1P1XA 4CQ9A 3G1XA 1LRNA 2RJGA 2VZVA 3EXSA 1UC4A 1IF2A 2WZEA 4ORMA 3COTA 4W86A 3V0SA 2AMXA 1JQXA 5BU9A 1M6JA 1KM2A 1NEYA 1L6SA 1V4YA 4KEUA 3WLHA 4RE3A 3TKFA 3WNOA 3MMWA 3G0XA 2BOEX 2R1KA 4ASTA 1SMAA 1K9TA 2P3EA 3ARYA 4S3DA 1K8YA 4IIGA 4GZIA 2FJUB 1I60A 5FEZA 2NVCA 1K70A 1Y5VA 1FXPA 3GAKA 3CTTA 2Z28A 3T40A 1ISXA 3UY7A 3B0YA 4IJRA 4PUWA 2ZA1A 3FEMA 3BPWA 3G77A 3H6OA 3N2MA 4XO6A 5EMMA 3LGGA 3DKJA 1IIHA 3UW6A 3ABZA 1PKLA 3UT0A 4FAMA 5CH9A 3THUA 2WCAA 4M80A 4NZ3A 1D7FA 2QUUA 1T40A 4P8VA 4PMJA 4A8RA 4KFNA 5T9BG 4BQ4A 3W72A 1QI5A 2DSVA 3NQGA 1M04A 4JX4A 2B7OA 3L23A 4AEOA 5M5DA 1UWQA 2ZZ5A 2OKOA 1PZ3A 1FOBA 1HIZA 4EWND 4B2DA 3SW6A 4HMEA 5DBUA 4TX9A 4NZFA 1AH4A 3BCJA 5D8ZA 5A6TC 3VCNA 1TMHA 2OZTA 3P3BA 3CB8A 1TPVA 2OYKA 5EA9A 3RNDA 3PZIA 4KIEA 4ZXLA 1P0KA 2PI6A 1CB7B 1ODZA 1I6NA 5CLTA 1KR0A 4LW7A 1EL3A 3PY2A 3TXZA 4EXBA 1ZBKA 1VS1A 2GVJA 2MUCA 4UZUA 3OZPA 4M51A 3W1UA 2H3BA 4H3DA 3V7PA 2FHCA 4J7RA 3AIWA 2VFFA 4J3ZA 2QJMA 3AMGA 3LS9A 3F4CA 3HV9A 4JTUA 5I5RA 5D30A 3ZVIA 4KGLA 2AQVA 2PRHA 3UY8A 1UA7A 1EO5A 1VAHA 1H60A 4HA3A 4CCDA 4DWSB 2QMKA 3LPPA 3DI0A 3V5CA 5EMLA 2V2HA 4TVUA 1J0ZA 2JGQA 5KINA 3ZR4A 4A3UA 3SCVA 3P62A 3TA9A 4H2CA 4LTSA 3IJIA 4FEZA 2J9YA 1C8XA 3KTCA 1WZAA 1B4KA 2OVLA 4FHAA 3ZR6A 5GVJA 1MW1A 3FW6A 4O1DA 3POCA 2PRLA 3GLCA 3QLDA 1D9EA 1WBHA 2OWWA 2YB4A 3AMDA 4BI6A 4AWTA 4YTSA 3WH8A 4J3XA 3G2GA 5XIMA 1WP6A 1TREA 1L9WA 5M17A 4L6DA 3AZRA 4JY9A 3OPSA 3HG2A 4L4MA 1S5VA 3FCPA 8A3HA 5EU9A 2YR1A 3B9OA 2E8YA 3PVFA 4GXWA 4DPPA 3W1LA 2PLKA 1MDLA 4QLKA 4GISA 4UMBA 3W02A 2OSXA 5D2YA 2ZZ3A 4TX8A 1CT5A 3WBEA 3U5YA 3WD3A 2B31A 2NZLA 3KBJA 2Z1XA 5EB8A 3W87A 4B5UA 3WEMA 1O1HA 3DG7A 4DYKA 1XCFA 1V6VA 4LY4A 1PPIA 1WKYA 1O1ZA 1XDLA 4ACZB 4XUYA 1ZBWA 3UA4A 1I2NA 3GG8A 4XD5A 3ZLFA 2WBKA 1MW2A 3UYCA 5C7HA 3CMFA 5EFDA 3NOYA 3ZOAA 3C8NA 1TR9A 2IQ0A 1XBZA 4JCLA 3SZ8A 1PZ0A 1VHCA 1JL8A 1BWKA 1VLIA 4Y9PA 3VOHA 5AC5A 3VDGA 2HVOA 2JQXA 4CD8A 2CZVA 1HJWA 4W85A 4BF9A 2VUYA 1YTEA 3NYDA 3FV9A 3AWNA 5FA5A 5AHIA 1W1B1 1O94A 5LHEA 5IBXA 2NWRA 2OSWA 4RL3A 2ACRA 2C15A 2ZICA 1QT1A 3IARA 3WF1A 1GZJA 2YA0A 2VZOA 1GVQA 3WLOA 3GNDA 2XN2A 4W4QA 1IZJA 4PMVA 2Z6IA 3AYSA 1H2JA 3BJTA 3VMOA 3TQPA 5CC7A 3IJLA 2Z7KA 3GRIA 1JRBA 1W3JA 2BGNE 1YPIA 3OOQA 3OGVA 3LM7A 1E0VA 3HIJA 4E2OA 3S1GA 5CG7A 2HE5A 1OCJA 1A49A 4JYDA 2BP1A 3KS6A 1THFD 3BOFA 1UPPA 3UZWA 1EZWA 4LB4A 1E43A 2QNEA 3SAZA 3IUIA 3LCFA 4UR7A 1EPVA 4ERAA 4XBJA 3TAOA 4Q4KA 3S0CA 1Z9AA 2NLIA 3LCWA 3MO4A 1JGMA 5F7UA 1K3UA 4U3AA 4LYQA 3M47A 5DMMA 4ZZ9A 3TCEA 1W54A 4NY2A 3WJYA 4CNOA 1E55A 2YDAA 2C0AA 5A1AA 2CKSA 3TYEA 4FNRA 4DXXA 3O1NA 2WMGA 3V1HA 3FXGA 4W7VA 4YJ5A 4FNUA 1OADA 3MCNA 5HQMA 4LV4A 3GDMA 4N9EA 2CLPA 3MWCA 4YMZA 3H2NA 1YYAA 4CKQA 5BOEA 3VIPA 4DY1A 4FPSA 4F0KA 1G6CA 3GIPA 2WKLA 5C2XA 5JU6A 1XL9A 4KPLA 3BJFA 1B3YA 3RU6A 1UUQA 3LB0A 4MDOA 3O3RA 3MPGA 4OOUA 1ZTVA 3OB8A 1W1A1 4C91A 1CI1A 2R94A 1WKFA 3MHGA 4HZ8A 1OFRA 3T2OA 1L2QA 1ECQA 2OLAA 3IUDA 2YCEA 4DJFA 3JRKA 3QBUA 3W1RA 1F6KA 2BBFA 1BYBA 3NQ8A 3TW9A 2QCDA 2HBXA 4BWLC 3W7RA 2HS8A 2PDUA 2EJAA 3TJLA 4MFEA 1MQRA 3C2RA 1JDDA 3N25A 1F2JA 3AHVA 3PBGA 1XIHA 2DT0A 2NX9A 1SM9A 4WXYA 1R9ZA 3PPGA 4MAZA 5DX7A 4LYPA 2WLYA 1AZ1A 2Y1HA 5C70A 2OXNA 4OTKA 4AZ7A 3LCGA 1OFQA 3HOJA 3LTSA 1ZP4A 3KUMA 4Y9OA 1KTCA 1P43A 1RVGA 3QGKC 7ODCA 1EA0A 1MXSA 2WW5A 5K2ZA 3E38A 4IGHA 1RLDA 3ZIZA 1JPKA 4CQAA 2JIWA 4RE2A 2P3ZA 1W5NA 4TR9A 2E0PA 4JQ3A 2CBVA 3UJFA 1R7AA 2J47A 3G1DA 1PZ1A 3T0CA 3UCQA 2ZRZA 2CW6A 4JKKA 2FGBA 5CEWA 1ZPTA 2Y70A 2VENA 1GORA 4JIPA 4JTIA 1QVBA 3HA1A 2VFIA 3TONA 3E2VA 3QW3A 3BG9A 3UQNA 4PTDA 3F4VA 4MY9A 3PBWA 4CQ8A 4AY1A 1J2WA 3KL3A 2FHFA 2QF7A 1VBGA 4M6QA 4QS6A 3E0LA 3B8VA 4KRZA 3IJ6A 3SQMA 4FIRA 4H6KA 3V4BA 4DF2A 2D24A 1W9BM 1GONA 3GWQA 4LPCA 2QCGA 8XIMA 3H2CA 3N1AA 4NI8A 1TPDA 1UP3A 3C3UA 3LV5A 3R25A 1FH9A 3M0HA 3L5LA 4EANA 4MWAC 1YIXA 2E68A 4P7NA 1DBTA 3FN9A 1M68A 4ERGA 1R3TA 1PIIA 4O16A 1RCQA 3DFPA 1XYZA 3GG1A 1V0LA 1H1NA 2QDEA 3W7QA 3O9NA 3ID7A 3MDUA 4D6FA 3B06A 4HSHA 3GS6A 1ICQA 3NQBA 4YWIA 3WLLA 2JIEA 3WNNA 1CXKA 4C6JA 3W83A 2GJNA 4E8CA 4O1CA 2TODA 2HE8A 1QI4A 1B0IA 4YTUA 1GZGA 1ECEA 4WEVX 5KEZA 3QGAC 4H7VA 1R2SA 2D0FA 3MS8A 2UV8G 5AYBA 4ZQOA 1ZENA 1OZQA 2CBJA 3ITCA 1XRFA 2O9PA 4TXEA 3CJPA 2BTMA 2P8CA 1A50A 1P7TB 3A3WA 1HKKA 2CXEA 4JCMA 4D6HA 4DO5A 4PTNA 3GNNA 4HMDA 2F6XA 3U57A 3WD2A 4AZCB 4ICMA 3AZTA 3U5UA 6A3HA 3VGGA 2B7QA 4MM1A 3VZXA 1W3KA 1FCQA 1HGWA 3LG3A 3BAJA 3OG3A 2ZUUA 1V6WA 4AH7A 2XIIA 1FBAA 2ZADA 4IH3A 3WLIA 5M1TA 3APYA 1BLIA 4HPHA 1HTIA 3WDQA 4C1LA 1OIFA 2CLOA 3WSUA 2VD9A 2INEA 3L0NA 4IPLA 4TMBA 1UR9A 1HKIA 4O12A 1FFRA 1L0PA 4H9TA 4YL2A 4OQVA 3O06A 3GG0A 2DVXA 1A0CA 3DHDA 2DJLA 1GJWA 5I79A 4RE0A 2YX0A 4A8LA 4P8UA 1UR3M 3DOPA 4HCHA 1H51A 1B3WA 1X97A 4H6RA 4NKCA 3QR3A 1V3MA 1YX1A 1HO4A 1XI3A 2PDQA 2ZYFA 1Q66A 3IAQA 3NSXA 3LI0A 2QS8A 3V5OA 5EMUA 1UKSA 4JHMA 1SFLA 1UZDA 4HNNA 4D6CA 2VDHA 4S38A 3TH6A 1MQPA 2ATSA 2GSJA 2BXYA 4J3WA 2VT0A 5U4NA 1K9DA 4J9JA 1W9XA 4GK8A 3F03K 4D6EA 1GZ1A 1NM9A 1RJPA 1EIBA 3L2IA 1AA1B 4M6UA 5FF4A 1A5UA 1WZKA 4D1IA 4ADTA 7ENLA 3I3EA 3QY8A 4DXKA 1E4NA 4KEZA 4S2BA 1KFKA 4HYWA 5HINA 2ZTKA 3TROA 3RIKA 4NJJA 1UIPA 4AZBA 2DGAA 1X7FA 3KVLA 4R33A 2W4XA 3KVMA 4PRWA 1J96A 4UTKA 3QTGA 3WZ0E 2H90A 1QBBA 4DO4A 2IQDA 2OQLA 3MWAA 2GQ9A 1GVYA 2B4GA 1YTDA 3GDKA 1Z44A 3QV9A 1DYSA 1K8XA 1KW1A 4F48A 4WK9A 3KP1A 6REQB 3V0TA 3CZKA 1F7BA 2F8QA 4IMDA 1BYAA 3A3XA 3ZJ6A 1M53A 6PTDA 1C29A 4Z08A 1CZ1A 4AQLA 5JXQA 3WLNA 5ABFB 5I3HA 4GUJA 2HQAA 4FF7A 3W2JA 4E4UA 3CPRA 2J6XA 1K8CA 3ABRA 1E6XM 3AUJA 3V1PA 5IFPA 4GA8A 2FTWA 2GUYA 4ZQCA 3TSDA 4IX0A 3XIMA 2X0YA 2JGYA 5K4XA 4S3KA 1OSEA 3HPXA 1GOWA 1VFLA 2XSXA 1CEOA 4LCRA 1FHUA 3O16A 3ZVHA 3PM6A 1XLGA 4IG2A 4V2XA 2I14A 3GXNA 1QNRA 3MB9A 2ZX8A 5G1YA 2FZ9A 4GI8A 4AVOA 3WDRA 3VTRA 5AHMA 4JFVA 2WHKA 3RMEA 2F61A 2NT0A 3NL5A 1SFJA 1OF6A 3MSGA 4ZO9A 2A7PA 3F4DA 4HPJA 4EACA 4DZ5A 4P7OA 1H7PA 1ONWA 4GJIA 3UJSA 3KX6A 2Y89A 1NVMA 3ZJKA 3PBVA 3PJUA 1F6YA 4KETA 2EQDA 6CGTA 3T81A 2EXOA 3CYJA 4M19A 3N6HA 4C6PA 2VFGA 4M7SA 4DZIA 2BY2A 3HV8A 1P6CA 1OX6A 4GUGA 1TRDA 1TPH1 2HVMA 1JAKA 1EC7A 3Q67A 1OHLA 3FOKA 3BAWA 1ZQ5A 2ISDA 3EMQA 3KBWA 4DBEA 2BXVA 4XIAA 4YU1A 3W74A 2ZUSA 1XFCA 4S3FA 3W1XA 1QNOA 1XSJA 2PBGA 3WCZA 4EE9A 3VKJA 2XZ9A 4ZOBA 3OA5A 7A3HA 1Q65A 2DSKA 2ZUWA 4HK5A 3UWZA 5LNUA 4WGXA 4C6FA 3KE0A 2D2GA 1XQKA 2Y2WA 4LBRA 4XAPA 4HN4A 1DJGA 4S3BA 5C9RA 4S3JA 5CPTA 1M1BA 3E02A 3L4WA 1HQTA 4PB3A 2PGFA 1BQCA 1LL6A 4F0LA 1QXLA 3DC0A 3NM1A 2BODX 4MG4A 4HOWA 1KFBA 2GQ3A 1OGGA 4EKJA 2J8GA 1VF8A 2WXDM 2YCKX 3LHZA 1MDRA 2OOFA 3QXBA 2B0MA 3N6JA 2ZXDA 1Q2SA 1UD3A 1MZHA 1Q63A 3H53A 4H9VA 3UZZA 1Z6KA 4JIHA 2W62A 2FHBA 1M01A 1XSKA 3SECA 3SGZA 3KBSA 2PA6A 2Z1BA 4G8TA 2AKZA 3TJ4A 2I17A 3PTQA 4TU1A 3RXZA 2XIOA 3L4XA 5BOFA 5CXPA 3WMLA 5GNZA 3TZFA 3AU6A 3GHUA 4DUVA 1L2UA 2Y5EA 2YCLB 4QEHA 4H8VA 1OX4A 5LKYA 4DUXA 4O10A 1CLXA 3BUVA 2PODA 3BV7A 4Q6XA 1S2UA 3M0XA 3VE7A 1OG6A 4OE7A 1I1XA 2FB2A 3RGTA 1E6PA 1KR1A 4JIEA 2PDGA 3EWBX 1TJPA 1Z8AA 3E12A 3MYOA 5BCAA 4O1AA 3ABQA 3T0AA 3W28A 4MJZA 1EXPA 4KEMA 1GHRA 3WQVA 2I57A 2FGLA 1XLFA 1CIUA 3VD7A 1NIUA 1JPDX 4NYUA 1SZNA 2O55A 1EGMA 1J0YA 2X05A 2WC3A 2PTYA 1XM3A 1JIBA 4DPQA 4A8IA 3WFZA 4UFIA 1F8IA 3WQ4A 4MWAE 2WNNA 4HHLA 2VFHA 2VVSA 3GNPA 5KTLA 2NW0A 1ZBVA 4IFKA 1DWGM 5DELA 1X6LA 1B3VA 4MMWA 4HOXA 3KWSA 4R9XA 1U83A 4DWSD 1MEIA 4GC3A 3WQ8A 3NFUA 1RXOB 4ML9A 1TFVA 2PZNA 1V6UA 1KWKA 4RZBA 4XX6A 3QW4B 4PMXA 3NPUA 2W5FA 2QDGA 3NQCA 1JUBA 4MUZA 3SRDA 5C9XA 1M7PA 4UTTA 4Y8EA 2WJZA 2AGKA 3FJ4A 3EMZA 3P14A 1ZCOA 5DLCA 3ZJ8A 3IJQA 2QCLA 3MHUA 2HDJA 2VP8A 3BK0A 3NQVA 1EKOA 2HSAA 3UA3A 4Q8UA 1QOQA 3T0BA 4L4PA 3DFHA 2BVWA 2XU2A 1TJ1A 4LVDA 3LCXA 4ZMGA 4PODA 3U6WA 1HF6A 1EZ2A 3C0QA 4IPJA 4JTHA 4B4HA 5K9DA 1XLHA 3A4XA 5IFTA 4UZSA 2F9RA 4AVFA 6XIMA 4B5TA 3GHSA 4S1FA 5DBTA 5D2WA 1TUFA 1VB9A 5G5IA 8XIAA 4PMUA 3WJWA 3LRKA 3E0IA 5B80A 1YXDA 2R1LA 5DN1A 1UPMB 1WZLA 4DIAA 1LDCA 1G0CA 5DY3A 4PCPA 1YBQA 5AC7A 3VFCA 1DWJM 1VIZA 1KCZA 4AD5A 4GKLA 2YW3A 2IKGA 3VU2A 2R1NA 1JZ7A 4ZO8A 3HFYA 3MO7A 1PV8A 3W1QA 1KKRA 4EK7A 5C55A 4H00A 1K9EA 2ZZ2A 2VQUA 4B5WA 1F3EA 3A4AA 4P8XA 1HL2A 2D20A 1EX1A 3AU2A 1W1PA 1SFTA 1JI1A 3BAXA 3OEXA 4RZ5A 5BXSA 3HPAA 4X63A 4E2BA 4PCTA 3DYPA 4F0RA 3Q4DA 3FYYA 2PS2A 2WMIB 3LGDA 2WPGA 3T9PA 2QR6A 4LRTA 4WIWA 4FO4A 3SUVA 5EBAA 1OJXA 4GQBA 4XZBA 4O11A 2R82A 1K7FA 1ZU8A 5FF2A 1XLCA 4ZVJA 3B8SA 4GGHA 2CWNA 1UWUA 5A69A 3T09A 3HGOA 4PTXA 1XG4A 2O7SA 4PULA 4AFYA 1YNPA 3C2EA 3W7NA 1CCWB 3IVTA 4D6IA 2P76A 4G7FA 2V5KA 3Q65A 1AMYA 4GQGA 3CLWA 3S5SA 1MEWA 4GYFA 2W6RA 2VX6A 1IR1A 3UPBA 2X09A 2PWGA 3PUOA 4W7WA 2XPKA 3PTMA 1FWTA 1GEQA 3TVAA 3A5FA 1XRSA 5AHEA 4LBSA 3GTNA 2G97A 3L68A 1SVDA 2NV9A 3W86A 3U0HA 1W2VA 2PDPA 5KZ6A 3P60A 3UGRA 2REQA 1AW1A 5H8PA 1B3XA 2X2YA 4HP5A 1E4LA 4JTSA 1FWJC 1S3HA 3W6LA 3WMSA 3RX3A 3KCLA 1HJXA 4JS3A 5DCBA 3W7IA 2HZGA 4QBXA 3BMVA 3OHIA 3LLDA 3M5ZA 1MNSA 1FKWA 1OIMA 4R88A 4YVVA 2Z27A 4EIVA 3L0GA 4O4VA 2VEFA 3VKDA 1SQ7A 3UR7A 4C6LA 2Z6JA 3NDYA 4X2PA 1JF5A 5A8QA 2E4TA 4HKPA 1QPOA 1QPNA 3E0FA 5G2IA 2YDRA 1TV8A 4NXKA 3IUHA 3I7QA 3GYCA 4RX0A 2G95A 2NUXA 4EVZA 1WOBA 3F2CA 3ANUA 1VD6A 4W5UA 1A4MA 1QUMA 1M9HA 2QV4A 3TQ0A 4DUOA 3R5EA 3TOPA 3RO6A 1RD5A 1G94A 3PAOA 4JQAA 1UCWA 4H9ZA 1K03A 1RJRA 5FSEC 5A6BD 4OVXA 2PWEA 3L2LA 4GX9A 4NZ5A 1KFCA 1LUCA 1GYNA 1A4LA 4OECA 3B9DA 4GYPC 3O63A 4WX2A 3EZ4A 5G1MA 2OYLA 4H41A 1QNPA 2PURA 1PCWA 5JUVA 5A6MA 4D2JA 1XJBA 1H7XA 3H2AA 1PDYA 2PLMA 1W9VA 1O60A 3QRHA 3FXYA 2I16A 3VD3A 1UD8A 4ZB5A 4AZIA 1J18A 3AHTA 3EDEA 3TP4A 3L7RA 5BXTA 3CIWA 1YNQA 1FWAC 4H8NA 3UG8A 2OX1A 1AJ2A 3KZSA 1MUWA 5EY5A 1YDYA 1I2QA 3CHFA 2CC0A 5C0QA 3EB3A 4N9DA 3DAQA 2J6VA 3GIYA 3TC6A 2PTXA 3R7MA 2RDXA 1A53A 1UH4A 5CGQA 1L6GA 4LX4A 2CZFA 3ALFA 3LEPA 1JJKA 4EAYA 2CLFA 5D2TA 2ICSA 3GC5A 3W26A 1CXHA 4C90A 5D8WA 1KTNA 4GH1A 1WBJA 1HJVA 3VDHA 1GGOA 2VM8A 4WLCA 3QFEA 4JNYA 1H7RA 3N19B 2NWSA 1IEIA 2Z29A 1J9YA 2GSEA 4G56A 2OG9A 4B16A 2G4FA 4AG0A 2C79A 3H2EA 1RK6A 1UWSA 3NL2A 3NVTA 2H6RA 1UWAA 3N2BA 2YCIX 1UASA 2E6AA 3EOLA 3TUUA 2V5LA 2PWVA 5A8GA 1LG1A 1YRRA 1QHOA 5HMFA 4JTGA 4L65A 1K6AA 3VM5A 1DTNA 4PUEA 1JYXA 4UCFA 1GTHA 2FH6A 2CZ5A 4PSRA 4YTRA 1IZCA 1ISYA 3TN4A 1JFHA 3ITVA 2DZBA 5HPCA 3R0UA 4QE1A 3G18A 1E0TA 3AHZA 1EFZA 4WHBA 3LCLA 4UFLA 4Z2HA 2WZMA 3UR5A 1BXNA 3UG3A 1P6BA 5JQ9A 4P61A 2HK0A 5I6SA 4WJXA 3GDRA 4A21A 1ICSA 4JY8A 1WDQA 1FDYA 1NH6A 4K8GA 2KX9A 4S3EA 2CLHA 4I9AA 2POZA 4Q8WA 1TA3A 4NI3A 5DO8A 1GOMA 1E9LA 1A3WA 2GUBA 3D46A 4NF7A 2HPMA 3UWWA 1OFBA 3M6YA 4QFUA 2PGRA 4J3VA 3NGFA 4JNMA 4Q4OA 3TTSA 4C1NB 3OZMA 4FNQA 3WF3A 4Z2JA 4N2YA 1D8CA 4MDPA 3IV3A 3QV8A 1AW5A 1XHGA 2CIPA 5JBEA 2F38A 3SUUA 2ISVA 3NSNA 4D6DA 3FDKA 3N2OA 3WK3A 3NEHA 5CPLA 3LBCA 2BASA 4QISA 5KMYA 4Q22A 2QUNA 3E49A 3WQGA 1HG3A 3GBEA 4HPXA 3QMSA 3WF0A 2GQ8A 3W24A 1S2TA 5AYYA 3STEA 1P0DA 1UB3A 3EBVA 3PG9A 3M44A 1C9WA 4LUIA 4M6VA 2JE8A 4N02A 1BRLA 1VFHA 4IWWA 5IBXC 1E70M 4N4PA 3SSZA 2J66A 1BTMA 3ZR5A 3ZWSA 2WSYA 1IV8A 1BYDA 3GR4A 3M5VA 2EG6A 4HCDA 3QHNA 4AD2A 2ISSA 4GQRA 2PWDA 5HAOA 8RUCA 1XGDA 3B8DA 1DJWA 4HCLA 1H1ZA 4LVBA 3WLKX 2Y24A 1EB3A 3JVAA 5EYWA 3RILA 3LERA 2A21A 3TIMA 2G0WA 4FXJA 4ICCX 3L4YA 4C60A 5CC5A 3A24A 3M64A 3QY7A 1YHTA 3D3AA 1FA2A 1KFJA 5LA2A 2NXHA 1F74A 3EDJA 3HFTA 2C71A 4D6GA 1DQXA 2GDUA 2DZUA 1VCFA 9RUBA 3DECA 2NVAA 4RZ6A 2QCEA 1GCYA 4REQA 3RJXA 1EOMA 2YB1A 4JPGA 3SADA 1P5BA 4B92A 3VIOA 1E6RA 2GJPA 3E2QA 4YHGA 3QF0A 4PMZA 1YTKA 4P7RA 2JKEA 1GEHA 1G5AA 4OGZA 1AZ2A 3IJ9A 2XSAA 4CN6A 2OZ3A 3KXQA 4DXVA 4LT9A 5HJYA 4D72A 3USZA 3WBYA 1RQHA 1JZ2A 3EYPA 1BWVA 4L7ZA 1JXJA 1WXJA 3VGHA 2E5BA 1EJRC 4AC1X 1IIGA 2DP3A 3T4CA 3ZZ1A 4LAMA 4PYSA 2QUVA 1ESWA 3NYZA 2Z25A 2CERA 5K9CA 3CHEA 2WPBA 2H9AB 2Y62A 2J7DA 1R8LA 6TAAA 3C5QA 2F6UA 2OELA 4XD3A 1K7XA 1OINA 5CGMA 3CV6A 1X7IA 3KVKA 3POHA 3R1ZA 4NASA 4YNGA 3FA5A 2D2HA 1XPYA 4LVGA 4BF5A 4KERA 2XDFA 3EXRA 1HKWA 2ZWYA 4DJFC 2VD8A 2HVNA 4FSAA 2JF6A 3EDKA 2V3EA 5FESA 2C1IA 4TTUA 2D22A 1BGGA 2VR5A 1R47A 3OO2A 4P5UA 3T2PA 2ZZ7A 4HNLA 5CPQA 4BHYA 1AODA 3T8LA 1P6WA 3HQOA 3N29A 5I3KA 4QDWA 1W3IA 3W27A 3PZQA 3TJXA 3H54A 4RNFA 5AFDA 2NT1A 1GPFA 1GOQA 4UFJA 4OBSA 1SW0A 3GW0A 4IM4A 3QSRA 3M5XA 1K9FA 3SI9A 3U7VA 5HANA 1KO0A 4LUTA 3SCTA 5LNVA 3LTYA 2RGLA 4KFOA 4GIYA 1GJUA 3MV01 3KRBA 3MUAA 2NVDA 2QXWA 4PBFA 1LBMA 3PB2A 4MZ1A 2PP3A 1ONXA 3EB2A 3EWYA 3ZO9A 4DELA 3O7UA 5E0KA 5BRQA 3ITYA 1Y7VA 2CHOA 2D0HA 5D05A 3LXBA 3C8FA 4KT2A 1HXJA 1PEZA 3QKZA 3IVUA 4A8NA 3MCMA 1ZAIA 3RRAA 1ITQA 4HU4A 1VRDA 2YL6A 3LYEA 4AMAA 3CEUA 2UBPC 3ORWA 2PWUA 2Y6ZA 1PWMA 1LL4A 3U4AA 1I1WA 3HJZA 4QEEA 3BSMA 4GH3A 1NDZA 4NAFA 1A3HA 4C6IA 3WLQA 1X6NA 3GU9A 4CQCA 1W9PA 5CC6A 3PZNA 1QI2A 1VH7A 1H11A 3HURA 2ZWZA 4QXIA 2PCEA 1FH7A 4AHPA 2GL5A 3BTNA 3V5FA 1I2OA 2AOSA 2GZXA 4EPEC 1W5MA 1XYFA 1QDSA 3VIKA 2WHLA 1QWKA 1D2KA 1OF8A 3UFYA 1T41A 1SJDA 3NAVA 3PFMA 2OB3A 4FNSA 4DI8A 3OODA 1LQAA 3EEGA 4G5DA 2Y7DA 3WF4A 1XR2A 1XC4A 1MEHA 2J9XA 4GE8A 4NJIA 4M5PA 3B4UA 3L9CA 2OZ8A 2QV5A 2BMBA 3TN5A 3EPMA 1GQLA 1IWBA 5I06A 3KBNA 1NOWA 3PNUA 1N82A 2E77A 2FPTA 2W91A 2G50A 1CGUA 1LJYA 4NU7A 2BS9A 1J01A 1WXZA 4MLJA 3SSJA 2BB0A 1Z7AA 1JYVA 4W84A 3M41A 4A2RA 1C93A 4K68A 4J3SA 3BGGA 5E93A 2H8XA 1Q7ZA 4I5RA 3QC0A 2EHHA 3TA6A 4QSHA 4CCCA 3WYZA 1Q6GA 3MCOA 3UVAA 1GQIA 4Q4QA 1EA9C 4UMAA 4GYJA 1M03A 3W7EA 3SY8A 5CPMA 3BDKA 5C2GA 4F66A 3BLIA 3O2LA 4LNYA 4XO7A 4W8AA 2Y5SA 3EWZA 4ZODA 2V38A 3IVSA 2JKAA 3RJYA 2EJ1A 3C56A 3TCSA 4XSMA 5HK4A 3BLLA 5U7SA 3IGXA 5HWMA 1LLZA 5REQB 4CD4A 2DUXA 1XC6A 3VIFA 2J75A 5CG0A 1T96A 3SCRA 3MANA 3EWDA 2V8ZA 1TV7A 4PBEA 1MRAA 5D33A 5CAHA 2OPJA 3CZJA 4K8HA 4DBUA 1KD0A 1CWYA 2TAAA 4O1EA 4RNJA 3PPFA 3TOYA 2DW7A 5FJRA 4JQ4A 4L61A 2EPKX 4C7DA 3JUGA 4AWEA 2BVDA 2GGJA 4LAZA 1OCNA 1V03A 1R5YA 1FWWA 3SIMA 3SRFA 3DU0A 2QKFA 2F6KA 3RITA 3FJ6A 3PS7A 1E1EA 3N2XA 4MOZA 4V33A 3QZEA 3N15A 3WJZA 3VOFA 4YPJA 2GOUA 2VR2A 5CZTA 2PGEA 4CD7A 4C6EA 2YKKA 4BFAA 1ZY9A 4IX2A 4XK2A 5A6BA 3N12A 4WY0A 4ZOCA 2XIMA 3H21A 3B8IA 4ADSA 4LV9A 4V27A 1I0DA 4UC5A 1OZMA 3E74A 4F3HA 2JFEX 1SGJA 3G8EA 1H1YA 3MSDA 2Y63A 4KS0A 5PTDA 3AUOA 4UQ9A 1CLKA 3KOZA 3THDA 1R3WA 3CV1A 1S3TC 4LYRA 4RXGA 4US5D 3VO0A 5G4EA 1KFEA 3H4GA 3SJNA 3GHRA 4JTFA 2FFCA 1YDVA 3BLEA 2FVKA 2GJXB 2XH2A 5DXXA 4Q7NA 1XIGA 3L66A 1J5TA 5FF0A 3SCPA 3L5AA 1EJVC 4G7EB 4XAYA 5BRPA 1TO3A 4S3GA 1DQWA 3WL0A 1XPGA 2I5QA 1PS9A 2G41A 1TTJA 5I3IA 4DM2A 1NU5A 3W7OA 2ZRUA 4NYYA 1C92A 3AIUA 5LXEA 2WVSA 2WSKA 1FH8A 2X1SA 3UR2A 1YEYA 3P61A 2O7QA 4DB7A 2IKIA 1JYNA 1OFDA 5ABEA 1XLIA 3KRZA 3PZMA 3UWQA 1ICPA 1QCWA 2OO0A 3W29A 3S2JA 4GUFA 4HSNA 4ZSTA 3PHAA 2X7VA 3ZFHA 5FEPA 5DMNA 4QSFA 1LRTA 1RJQA 4Q7IA 2CU0A 1SMDA 1CLVA 5DANA 3EX1A 1UKTA 2A5HA 5C9WA 5FI8A 4I7UA 3GC2A 5K7JA 1OFOA 3SEPA 4UOZA 3KCOA 3ZSTA 4US6A 3LU2A 4LRSA 5FACA 5LNWA 4P8WA 2QPXA 3SQLA 1W1VA 3VXGA 2DVTA 1J93A 5HQEA 2E25A 3VGDA 4Q32A 1V51A 1KBBA 3WQOA 1RD6A 1HKJA 2PWFA 3AIEA 5CJ5A 4GABA 2RHGA 4ZQPA 3MP3A 4IFRA 4BQ5A 3GH5A 3WNPA 1QOXA 5LIKX 3NSMA 3PJWA 4IL0A 1H61A 2PDCA 3C4UA 1DEDA 5FF7A 3EAUA 4JTRA 4YS1A 2BVYA 4TUFA 3UZYA 4W7UA 4RDZA 5HNUA 1WDSA 3UWEA 5DY2A 5DXYA 3LXAA 2UZ9A 1MFVA 1CPUA 3E2RA 1HNYA 3P8IA 3A6OA 4DZAA 1W2PA 1Y8BA 2R1PA 3R13A 5LSMA 4ZQMA 5AHLA 1CX9A 4W93A 1KM6A 1XIFA 4AVNA 1AVAA 1O4UA 1ELSA 3G1VA 3DFTA 3GYEA 2DIJA 3IANA 4IIBA 4UTWA 3IPWA 3NO5A 3K4WA 2O56A 4K7YA 3IACA 4GYKA 1NDVA 1RA5A 5JBDA 3TWAA 2ZZ1A 3TXVA 2FH8A 2DSWA 1TYGA 5G4HC 1C7SA 1S5MA 2E5CA 4J3UA 2VC9A 4ILSA 4HYVA 4O52A 1O12A 4HNCA 1BWLA 4IMFA 1XCXA 4K6AA 2YL5A 4AY7A 4OBRA 4NX5A 3T07A 3P0XA 3V75A 1X96A 4ZBCA 4X60A 4MWAD 1RBOB 4IGMA 4W8LA 4JAWA 2DY3A 2QYGA 2JEQA 4V28A 4YCPA 2A3CA 3WIJA 5HA7A 2QPUA 2WOQA 3UESA 2WWCA 4AX6A 1NARA 4FX7A 4RXFA 3MVIA 4CEXC 2W63A 5D37A 2E7FA 4PMQA 2IS7A 4A6GA 2NXGA 4JN8A 3MKCA 2VZTA 1PSCA 1H4PA 2XVNA 3FKRA 4I9MA 4R9OA 4MZ8A 3NQAA 4U2YA 5TAOA 4QLJA 4L5ZA 1W56A 1KM4A 3APGA 4LUYA 3VX0A 4K1GA 2J13A 4QROA 3TX9A 2ZFAA 4WDWA 3UXDA 1XISA 2VXNA 4FOJA 3STGA 4XAGA 2FKPA 3FNDA 4KWOA 3TK7A 4HJFA 4O57A 3B0UX 5CSSA 3A9BA 4UTTC 1EC8A 3BW3A 3UWUA 1GQKA 1DWFM 4O50A 5BMWA 7PTDA 5M3WA 3MZ2A 3AWOA 4CNSA 1NDYA 3H26A 2PTWA 1I75A 5K9XA 1Y5WA 4ZL1A 1W9UA 1LBLA 1QWGA 4N6FA 1TZZA 3NXLA 5FJUA 3WUEA 3PG8A 3MUXA 4TIMA 3F4WA 2GJLA 3WKZA 1ZGDA 4H9XA 1RPKA 3L4TA 4M81A 1F8MA 1PB0A 1QI0A 4J27A 5JH1A 1LWHA 5AHNA 2X0SA 1B2YA 3SO7A 4LF1A 2AL2A 2VC7A 3ABOA 8TIMA 2ZE0A 1Z89A 1CENA 2HTMA 3UWYA 1C8YA 4L80A 3AJXA 2J27A 2E9MA 1G67A 3WNLA 1AUSL 4YHEA 4Q7BA 4Z0JA 4OU1A 1W17A 5TF0A 2VGIA 4MJ4A 5DF0A 3UXKA 2PP0A 4HU0A 2IMRA 3CUJA 1LT7A 5LA1A 3O6AA 4WKAA 3VC6A 1A0DA 3RAOA 3EB4A 4ZEPA 3KHDA 1ME7A 4K38A 1FWFC 2NQLA 1VFMA 3GZ3A 4CU8A 2RKXA 4Z2KA 1X8CA 3NQ7A 4KWUA 1CGXA 5B7YA 5LXXA 3GY1A 1Z32X 1U1HA 1H09A 1Q8JA 1YXYA 4WSJA 4G6CA 3OLGA 2Q01A 4JX6A 2W67A 3TN6A 4IOTA 1YW1A 3BOXA 5T26A 1IEVA 2C7FA 3W0KA 1OFEA 3F5JA 1XLJA 1UC5A 3PZTA 3T8QA 1VIWA 3M0ZA 1QNSA 3IK4A 4Q33A 4MLRA 4E0CA 4JOMA 1GVOA 1S5NA 3U2EA 4IIFA 1Q7MA 1ISWA 5H1WA 5L6UA 2VRQA 2WO5A 3NL6A 4XBSA 2XWDA 2EAWA 5I07A 3TLLA 4INFA 3VINA 2YFOA 4QCEA 3I6TA 2FVLA 3UCDA 1NQKA 1D3HA 4NZ1A 1X38A 3ABXA 2A0NA 3PK7A 3H2OA 3PC0A 4EXQA 5FCZA 1LWIA 1VZWA 2A1YA 1KV5A 4UR8A 2QAPA 4R27A 3RPDA 3VUSA 3WLJA 3TQKA 4I9JA 2QCDB 3WQCA 3RK8A 1C9DA 1EWDA 4RPPA 2DT2A 3EOOA 2YDSA 4PC8A 4FZIA 2PLJA 2X16A 2ZA2A 3NWRA 1DQUA 1VYPX 5I3GA 1JPMA 1P4CA 3PUEA 1GOOA 3DN5A 4I5XA 5D02A 3B8TA 3FYOA 1BSLA 4L64A 4MUPA 2FZMA 5CQ1A 4Z2GA 3N13A 4HJWA 3AYVA 4N6EA 4DEFA 2QGYA 3WF2A 1UWTA 2PDIA 4Q4RA 4H9UA 4FMVA 1KGXA 5TQLA 3Q94A 4TO8A 2VWSA 3A23A 4KGJA 2WB5A 4X9YA 1KLZA 4NNAA 7REQA 4JEJA 3CQ0A 3VNZA 5SWUA 4H1ZA 3OVGA 2XFYA 3ELFA 2OT0A 5F1VA 4YVPA 4FXRA 3B9NA 1CGTA 1UMYA 4HA4A 1T8QA 2GVYA 2R91A 2OSYA 3DYOA 4DYEA 1LLWA 3FLUA 3M0JA 1ZHAA 3CEPA 2JK2A 5BZAA 1B5TA 1TJ0A 1ENUA 1PL9A 2XFRA 4U5IA 3VOCA 2VKZG 3LUTA 4PH6A 3RCMA 4V1XA 3RRXA 1AG1O 1F76A 1ML1A 2ABBA 2F2KA 3CT2A 2XVPA 3GTXA 2FPVA 4E4FA 2WVTA 3N6QA 1XP3A 3W82A 3N14A 1IWPA 3P5YA 4IUOA 3TYCA 5HWNA 3P80A 2DIKA 3LRLA 4HA0A 3U2CA 3KZPA 3QQ1A 2NSXA 1PKNA 2NX3A 1QFEA 2A6NA 2O9TA 1JQVA 4O54A 1TV4A 4IP5A 3QR1A 4GFIA 4X0VA 3W76A 3VNLA 1Z69A 1B31A 1FX6A 3G1RA 3CIVA 4FLSA 3EWXA 3VX1A 4Q8QA 1MQQA 3S9IA 2HWGA 5ENLA 2Q8LA 3Q45A 3P8JA 1VBUA 2Q3OA 1OD0A 1LYXA 1V3LA 2W92A 2YSWA 4AZGA 2Z1WA 1VKFA 4G1NA 4XQ6A 3BLDA 1R38A 3WELA 3MUZ1 4HTBA 1KBIA 2Y8KA 3BCDA 4YCOA 3N3TA 3LK6A 4MTVA 1RBLA 2V6AA 4US5A 4D8ZA 4NJGA 1V0MA 1KGUA 1WNOA 3N9KA 3I65A 2E3ZA 1EOKA 3CHDA 3S8HA 1MSSA 3GQYA 3MC5A 4EAMA 4ATLA 3BAIA 5GQBA 1ADDA 3IAPA 4MB5A 5FJPA 1M7OA 2XWEA 3CQHA 3E0WA 4I8YA 1BAGA 1UOKA 3IJDA 1XICA 4L4OA 3B05A 1TV2A 3SQSA 4RR4A 2DZTA 1VHNA 5KZEA 5AKQA 2OWCA 3RUBL 3PWIA 3XISA 3OIHA 2VEKA 4GO8A 4C7FA 4CVWA 1OYCA 4IMAA 3ZLGA 1XIBA 1QMLA 4XKMA 2PP1A 1YQ2A 2VVNA 3MZNA 1O5KA 4DJDD 1B30A 1BHGA 3PUGA 5FOOA 3G1FA 3UPMA 4WR3A 3N34A 4TOQA 1ZUAX 3FIGA 2OO6A 2V2DA 2VCBA 4I90A 1KXHA 4J2PA 5BW6A 2W0UA 3VCRA 3VFLA 6ALDA 4TMCA 4GBDA 4WDTA 1ADSA 1TMQA 1J79A 4MF4A 1YPXA 3GU2A 1TCMA 1N2VA 2J7BA 3KP0A 3R12A 3GAYA 5D4YA 3KOWA 5CLWA 5ABTA 4HMCA 4I8DA 3EKGA 1CXLA 3WMBA 2XISA 5KSWA 3BZGA 3N9SA 4Q4MA 1RQEA 5BOOA 3EDFA 2CCRA 5DCDA 4HT3A 4EP8C 4BI5A 1S5WA 3KL5A 3MTWA 2IXUA 1D8WA 1FRBA 1R2TA 3OVPA 1EDTA 4ZO6A 2PTZA 1WX0A 3WEZA 3CWOX 2OEMA 3CPGA 3VDCA 4XWUA 1TTIA 3C61A 4NNBA 2G3FA 2PDKA 3W85A 3GXDA 4KWWA 9CGTA 1XW8A 3TU9A 1EP3A 2ZZ4A 1B4EA 1Q6QA 2ZUNA 3IV8A 3GNRA 2IKJA 3AQUA 3AS2A 1V8EA 3G1AA 3QJAA 1BVNP 2GLKA 2I7GA 2D3NA 3AYTA 4GX8A 4U2ZA 3ZMRA 2J7CA 4PCFA 1E4MM 4RUBA 2FMNA 1FWEC 3MJMA 1MXDA 1F73A 1QHPA 5TIMA 2E6YA 3GFXA 1KCLA 1ZRQA 1PE1A 1W91A 3SIZA 3QOMA 1AH3A 1QPRA 2WSRA 4WSHA 5I02A 3OG2A 3FDGA 1U5JA 2ZZ6A 3QMTA 2V3DA 2FTYA 1XIDA 2E6DA 3GVWA 1LTDA 3ZWTA 3TMQA 4QRNA 3IEBA 4CN4A 2BSLA 4Y9NA 5I3FA 4AF0A 1KLYA 4MNKA 4JQ2A 1ZS2A 1GVSA 3ZVHB 3R4IA 2IPFA 5HJLA 4IG2B 3CQIA 1IT7A 4OOZA 3RM8A 5TD4A 1TWWA 4M0XA 1TE1A 2V68A 1DE6A 2J62A 4ORIA 3G6MA 5M03A 3N4EA 3HTWA 3CQJA 2O9RA 3ITXA 3TEVA 3ARZA 4CD6A 3PPHA 4XV0A 4LH8A 5D9PA 3W38A 2PU0A 2G8ZA 3VAVA 4A2SA 1GOIA 5GJMA 2AAAA 1GTEA 2B7PA 4H8UA 4MWAA 4RV8A 4NRSA 3ZLHA 4DF0A 3GSMA 3B9EA 1NELA 3ARPA 3EEZA 2AQWA 4QJ1A 4U31A 4O4WA 1JPHA 4TVDA 3VUPA 3PUDA 1C90A 3R8HA 3SCOA 1VPYA 1OG0A 3PZVA 2W79A 5A8OA 2F84A 2G4JA 4DO7A 3SCNA 2BY0A 2EKGA 4D1JA 4IP7A 3LXCA 3V18A 4AD4A 2WMKA 3W25A 1VBHA 5XINA 4UIOA 1QATA 1DIOA 1H3GA 4JDBA 1B90A 3CL6A 5JIWA 2CBUA 4C5ZA 1TPC1 1TTPA 1J5SA 2EPNA 2TRSA 3QV7A 3CM4A 1VYSX 4U4MA 2VL4A 3S2NA 1SPQA 3W6YA 4BY3A 2ANUA 1N7KA 4S3CA 5LZLA 2Y4SA 1XX1A 4JICA 4URIA 1HGYA 3TYUA 2BY1A 1GUVA 4Q3MA 5F1UA 3MQTA 2VZSA 2YA2A 1E56A 2OODA 3BG5A 5HJXA 4AEFA 2YL9A 2D1ZA 3CS2A 1DJZA 2ZX7A 3B0PA 1QHZA 5LNSA 3S1VA 4AZHA 3DENA 1V6XA 3W88A 1AW2A 3YPIA 4XUGA 4ROQA 3CAKA 1I2PA 3VM7A 3P93A 3HPZA 4LVAA 4ZOAA 1IEWA 1UKOA 2DZSA 3DYMA 1LOQA 3EOSA 3VPLA 4NJHA 3H70A 5LYRA 5DT7A 3RR1A 1EP1A 4HU3A 3NZQA 1Q45A 4FIQA 1UKPA 5CSUA 1XH2A 4OWGA 4MJ2A 3W1NA 2OGYA 1WXYA 2QULA 1W0MA 2X8RA 3S2MA 1Q6FA 1CXEA 2GDVA 2E9LA 3G3MA 3M4HA 3WBWA 7TAAA 3GXMA 3AYRA 4AMCA 4JFUA 3VNYA 3R11A 1BVWA 3QYSA 4I5UA 1OX4B 1V7AA 4Z1AA 4JTTA 3ALGA 1S2CA 4GXMA 1V08A 3TYZA 1V6TA 3PSWA 3UWVA 1UR2A 1VFOA 1LLOA 1XLBA 4DZHA 3PB0A 2YLLA 3KWXA 3IGSA 2Y7EA 3GC4A 5J8LA 1IT8A 3PZOA 4QJ4B 1PKMA 4AISA 5FAGA 5ECUA 1Y5XA 3ZT6A 5CZJA 2WNWA 3KCJA 4Q4SA 4NIRA 4B15A 4QJ5B 2HCVA 4JBRA 3P74A 1CB2A 3JW7A 3ECQA 1VJSA 1OEPA 2J8TA 4UTUA 5D9NA 1V0KA 1DV7A 3UU0A 1SW3A 5LA0A 3QPYA 1AD1A 3MSYA 4JTLA 5FEWA 1H63A 3DDMA 1H7NA 3CQKA 1H49A 3UG4A 1JVNA 4Z42C 4ZO7A 1I4NA 1IXNA 4IFKB 5HATA 2DU2A 4UB9A 1DJNA 3LCIA 2QQ6A 4ZQNA 1B3OA 1NJJA 1UZHA 2R8WA 4A3HA 5BNKA 1S1RA 1NFGA 2X1IA 3M9YA 2PUZA 1GJPA 2ZDRA 2C6QA 5LNRA 2HJPA 3CZEA 1VGAA 1CGYA 3LM3A 3GXPA 1LCOA 5HMSA 4DJEA 2PE4A 4WUIA 1XIEA 4WKFA 1R7OA 3PZGA 2DFAA 3II1A 3Q58A 1XYLA 4M3PA 3P5ZA 1WCGA 5EBUA 2XTKA 1FHVA 2FMOA 4RCXA 4XAZA 4CLMA 1Q4WA 4C6CA 4GPNA 4DNHA 4ENLA 1RLCL 2HPIA 1GHSA 2I9EA 2A7RA 3LHWA 3TSMA 1UHVA 1EHNA 2WHMA 1BG4A 2OGJA 5FAJA 1KXQA 3M43A 1TV5A 4KESA 1U22A 4UCGA 3MI2A 1WUFA 3PJTA 2EPMX 4GACA 5AVHA 1OGSA 1YBQB 4NRRA 3TJIA 4CQDA 3ARVA 3N04A 3BANA 2INZA 5C9UA 3O8AA 4IXXA 3CH0A 3NZPA 3KBMA 4UWMA 3HGSA 3EOUA 1E73M 3W22A 3P7YA 5E09A 5HR7A 4BF7A 2VEMA 3APTA 3BAKA 2CLKA 1CBGA 1PJ9A 1RBAA 4UNIA 4XSLA 3M16A 4IJCA 1R6WA 3GU1A 2WVVB 1NOUA 2C14A 1DORA 3MY9A 5A8NA 5KZMA 1EF2A 4LUSA 1V3HA 7CGTA 4I9TA 1WZMA 1NP2A 4XZHA 3B8WA 5LGZA 4GLEA 2GVGA 1SYTA 3GR7A 2YXGA 4Q8TA 4RK8A 3CUGA 3SN0A 3UXAA 2FYMA 1GKPA 4JYFA 2BDQA 4JTJA 3IGHX 5FF3A 3SFKA 1WOAA 1TX0A 1W3TA 5I77A 4QGCA 2NQ9A 1EGVA 2WV8A 1TUXA 1VEPA 4G2DA 2C16A 1EYWA 1PIFA 2WANA 3GM8A 4BCEA 1ZL1A 4CVUA 2CYGA 4POCA 1FWRA 4CNUA 4F8XA 1WQ5A 2A3EA 2DZWA 3AXKA 4IMCA 4GVGA 2WNZA 1BD0A 2XVKA 2PDYA 3I6EA 3U48A 2HXUA 2Q71A 3PSVA 1IGSA 2JALA 2R1MA 4D8AA 4Y8FA 5JMUA 1KFLA 3U8GA 5MF5A 1G1YA 3W2MA 1QI3A 2FZ8A 2FLIA 1WB0A 4O13A 1E6NA 2REQB 3CUIA 3BOLA 2WQPA 4J35A 2D2JA 1TR1A 4ADUA 1OCBA 3MMTA 1XRTA 3AROA 1OC6A 2HNHA 3R8RA 3BV4A 4M6PA 3SCSA 4FLOA 5EL1A 2A3AA 3WBXA 4PB4A 4XKYA 1LOSA 1UUMA 4FNPA 3PULA 4BQ2A 2C18A 2C1GA 1PCKA 1RUSA 3TFXA 3TC3A 3EMCA 3KEHA 4LBUA 1BGAA 1KXVA 3EX4A 2VHLA 4XVEA 3WJXA 3QPZA 3TNOA 1R86A 4W89A 4WCJA 2FJKA 2DW6A 1DIDA 3IIVA 1E9YB 1MRQA 5LIYX 4H2HA 4MHBA 1KV8A 3IJ8A 5A3HA 3W2LA 4AEEA 3AJ7A 2QVNA 3URQA 4ZOEA 1US0A 1A5SA 1EJWC 3S46A 3ARXA 4DJFD 4H7CA 2CLLA 1JUEA 4DJDA 2ZRYA 2BGSA 3QV6A 1AQFA 2Y7GA 5E1QA 1LUCB 1XD1A 2VR4A 4MNLA 5HR6A 1JCXA 4CEUC 3R43A 4Y6GA 4DUWA 4R7JA 4OHQA 3F5KA 4HK6A 4AIOA 1G7VA 4JXCA 1TWIA 4S3AA 2A79A 4HTYA 3CB3A 4GG9A 1QAPA 3HGJA 3HN3A 5BRBA 2HEJA 2XN1A 2CEQA 1YKWA 1XLKA 4LOCA 1EUAA 4R7WA 3EX2A 2WCGA 4O28A 3VDAA 3CLMA 4B4FA 3LMZA 3GO2A 5CPOA 2WMHA 1U5HA 4X2RA 9XIAA 1YMYA 1LRQA 5TNVA 4W8BA 1IXOA 4HB7A 3WUGA 2RJHA 3PFRA 2QUTA 3CV2A 2IXVA 2YZ5A 1PHQA 1H0IA 5HUOA 3S5YA 3KTSA 4C65A 5F2MA 1PZ2A 2XSBA 1P0NA 1ONRA 2DVUA 3C2FA 3KW3A 4KIRA 1GNXA 4WD0A 3GFYA 2V3FA 2ONEA 4LS1A 4GD0A 3KOXA 5IXEA 3AXIA 2AL1A 5DQPA 1IXPA 3S1UA 1OCQA 1TPEA 1OFPA 4DAIA 4WVXA 1JDCA 1KRCC 4Q8OA 1JNDA 1AL7A 4DVOA 1E6SM 4AD0A 4F9JA 2O92A 2VEIA 1J10A 3S4TA 4U3CA 1YDOA 2P53A 3O0KA 3NQ6A 2O9OA 2NV1A 4L4LA 3GZAA 1J12A 1SU5A 4HZ6A 3QPEA 1SZEA 1TG7A 1NWUA 2CZDA 2C0HA 1G01A 1PAMA 4DF1A 4NAEA 3UZ5A 3KAOA 2J79A 1F6PA 3TTYA 4BZYA 1UR4A 3SCUA 3A12A 2ZE3A 2Y61A 2HMCA 3AO0A 2WWDA 4JEQA 1TA3B 3GH4A 1ZBCA 5GJNA 4JDYA 1I9CB 3QHMA 3OQEA 3IRDA 4GVIA 5AN7A 4MJMA 3PWGA 4GI6A 2Z7GA 1GPWA 3LD5A 5J5RA 4UOJA 2P10A 2OQHA 3CWNA 3LN3A 3WFAA 1OC5A 1SSDA 4NG3A 1DWIM 3NM3A 3KVJA 2ACQA 2GDQA 4L6HA 3BCFA 3HM7A 3AS1A 4YTTA 1UQYA 3C52A 4JIQA 4FLRA 3ITLA 3W07A 2ZBTA 3GXTA 2LLEA 1BRLB 1CXFA 2PPGA 3DHPA 3B8UA 2XH0A 4CU6A 1B57A 1SJAA 4PUMA 4Z1CA 3AXHA 5AC6A 1NOFA 2V69A 3R58A 2OEJA 3M6DA 2QDHA 1MYRA 1UW9A 3ONBA 1US3A 1BVZA 1UD2A 1KRAC 5A2AA 2ZC1A 3NXFA 1Z41A 4LC8A 2DPEA 3T6CA 3SBFA 1IYXA 3LRMA 4WJEA 4HNOA 3UNDA 2PCQA 4LUJA 4GQ0A 4PMYA 2VQTA 3EX3A 4PR4A 4NP7A 1JF6A 1IGWA 3I4KA 1FQ0A 3WH5A 3L4UA 3K1GA 4K8EA 1Q5MA 1TIWA 3MP5A 3FAXA 2VTFA 4JKMA 4RNIA 4TV6A 2J25A 3I7RA 4REQB 4XZ9A 2ZTJA 1ME9A 3T7VA 2Z26A 3DXIA 4AUBA 4I6VA 3AC0A 1DHPA 1R0MA 4LXFA 3CUHA 2FDMA 3NQDA 1G4EA 1QPQA 4FR1A 1QPKA 1XD0A 3MBDA 1KBKA 4XBKA 4LY8A 1E72M 1L8PA 4DLMA 4JFWA 3MBFA 2CKRA 1SUXA 4WSKA 4HVXA 5FJOA 3EDDA 4J40A 1TCDA 3BG3A 1PIGA 4JTQA 4GO9A 3WDPP 1UWRA 3VK5A 4FX6M 3HBLA 2DQXA 4YXGA 1JULA 1LROA 3N4AA 2E8ZA 4XIMA 1EBGA 5I00A 5C6MA 3OIXA 4GYPA 4K3ZA 4QE5A 1KBLA 4XISA 2ON3A 3OP2A 5MKGB 3AIRA 2XVGA 1W9DM 3HGRA 4LNCA 3QC3A 2VCAA 2E40A 3V16A 5EPDA 3K30A 1OX5A 2HNEA 3GW3A 3TN3A 1QK2A 2O4MA 4B5XA 4MNJA 1DJHA 1VCGA 5AVNA 5HUPA 2XYLA 1VR6A 1PDZA 2WCSA 3CZGA 2W9MA 1M5WA 4XVDA 3WEOA 4M29A 1KM0A 3ES7A 3STFA 3J7HA 2XGBA 1QW9A 3VOIA 2GOKA 1MO0A 2E67A 3PZUA 1OC7A 3W7JA 4TTGA 5T9CE 2EO7A 3S9YA 2I5GA 3CL7A 1V0NA 2ZUTA 2WVVA 3L2MA 3GH7A 3OU8A 1WV2A 4RDVA 1FWDC 2OYMA 2DUAA 3HPSA 3QLLA 4LWWA 4CCZA 1PBGA 2WZIA 2V5JA 3EWWA 3UF9A 2I9UA 2CXGA 3VGFA 1ZB5A 4LUTB 3LPGA 5A2CA 4XZMX 3D3FA 2XFFA 1WUEA 3NDOA 1U1UA 2XN0A 3TYDA 2D2OA 2E6FA 1C8VA 4U10A 3RG6A 1V02E 2BWGA 2C91A 3UP8A 1UBSA 3DEQA 3UERA 3OHMB 3B0VC 2Z2AA 1BG9A 4A29A 3KDNA 1E1FA 1RQBA 3S2LA 3M46A 4PFMA 1P0BA 1GOKA 1IE7C 5AOUA 4QG6A 1SJCA 5A2BA 1W1YA 3GHTA 1F3XA 2YFNA 1ZFJA 2ACUA 3KDOA 5GNXA 4MVAA 3HG5A 1E15A 3LBMA 1LL7A 3EGJA 1VC4A 3SN1A 2FTPA 2YYUA 3WBAA 3UVIA 2DT1A 4GIEA 1WDPA 3DX5A 1DJQA 4JD4A 4A4AA 3H23A 3ERPA 4Q4PA 2NLYA 3C3NA 2C1HA 3SFWA 4KQNA 2ZIDA 1UQZA 6TIMA 4NAFB 2A4AA 4N4QA 2YPIA 1R3VA 1ZNNA 5LGXA 1QTWA 2DSZA 1FUYA 3LOTA 3UETA 3AXMA 1M41A 3SR7A 3FSTA 4X3ZA 3QZ6A 4NZCA 4IMGA 2QCCA 1EP2A 4EF9A 1CECA 2WJEA 1FWSA 3GVGA 2Y88A 3GR8A 4NXSA 5XIAA 3QGVA 2ZRXA 3N2CA 4HPGA 1PWLA 2V82A 1JDAA 4NT0A 4UBPC 1ZSXA 4IL2A 1JCNA 4P2VA 1BF2A 5CSRA 1ZP3A 3ZT5A 1W1TA 3M07A 5DFAA 2SFPA 4IQDA 3CAVA 3RX2A 5E6ZA 1UZ1A 3TYAA 1KGWA 2GWGA 2PRMA 2VOTA 5BYWA 2PB1A 3DFYA 2X2GA 3L67A 1UJPA 4HN8A 1UKQA 2JKPA 3EKLA 1REQA 2QDDA 3W3OA 4JFTA 2VUNA 1GKRA 2YIHA 2VGBA 4GJJA 3BL3A 4Z0SA 3E3HA 5AECA 4FK9A 3BLFA 4H8HA 1R3RA 2ZRVA 3R89A 3G1SA 2ZVIA 4RJEA 4F0SA 4IP4A 1HW6A 1NFPA 3O6YX 3W2UA 3RM9A 3BZJA 5F4WA 1KC7A 3HZ3A 5A95A 1U2YA 5EFFA 2CITA 3EA3A 3QVQA 3K8MA 2OCZA 1GKQA 4N9BA 2CWXA 1OQFA 2D69A 4PEKA 2EG7A 2QJGA 3C2YA 3CHVA 3G3DA 1XLDA 2G96A 4GCAA 1JD9A 5CPNA 5CBJA 3E96A 3GKAA 4UOQA 3PR2A 1DPMA 1UD6A 2HISA 1DHKA 4XZIA 3NJ3A 4ZXOA 2BVTA 1DWAM 2Y8VA 3ZS4A 4IIHA 3NURA 1QW7A 3THCA 3EWUA 4LCSA 5LIUX 3OBAA 3WDHA 3ZSSA 4QP0A 3DGBA 3W4RA 4C6NA 1ZJHA 3AI0A 1XLAA 3DC8A 1JCLA 2J8FA 2D0GA 3GNXA 1E3ZA 2FVMA 4A22A 5DMYA 1WPCA 1O6IA 4LFYA 4C6DA 4E6MA 3D6NA 1RZMA 1GOXA 3A3HA 2TPSA 1BXCA 1QW8A 3Q2DA 4J5NA 2NSOA 1FVPA 4UTJA 1HL9A 5I78A 3B3DA 5CZSA 4GXPA 5CZ0A 2GFTA 3WJSA 5E6YA 4C6BA 1S2VA 3RM4A 2PDMA 4PCNA 1IEQA 4Y96A 3PBMA 4LAKA 1JUKA 4H6QA 5GJPA 4MKSA 3SY1A 3U2OA 3AZSA 5A6KA 5CPSA 2ZRWA 3CYVA 3NTYA 4NZJA 3NL3A 2CNCA 3HQ1A 3QMRA 2OKTA 4LU0A 2J7HA 1TVPA 2TMDA 3T78A 1P0EA 3UR8A 1RCOB 2QLYA 4CGTA 3R2GA 1AL8A 3GTFA 6ENLA 3EPNA 1E1CA 3A22A 2JBMA 1HT6A 2O0TA 5M2FX 4WKHA 1DE5A 4MADA 1JCMP 3MHFA 4JQ1A 1BYCA 4GFSA 3CL8A 3LPOA 2WKGA 4KF1A 2DSUA 1MFUA 2GSHA 4DN1A 5JIPA 1DWHM 2BNJA 2PSNA 1W1ZA 1RY8A 1AQMA 1EIXA 3REQA 4YYCA 4PRTA 3AIVA 4XZLX 3O05A 4CCEA 1GW9A 1XGEA 3H8AA 2HS6A 5CC3A 4WY0B 3N17A 3R6IA 5DEZA 1GVIA 3WUFA 3M0MA 4FI4A 1XIJA 4JTDA 2HRWA 2B7NA 3BO9A 1SO3A 3IRSA 2BFGA 1Y65A 3VKCA 1JXKA 1WDRA 3ARTA 3RDKA 3UEQA 2QW5A 1XGZA 2VEGA 4CU7A 4G1KA 3URAA 1HL8A 3MMDA 5CJMA 2HBVA 2GJRA 4ZCWA 1WAUA 4HIBA 3WQFA 1KTBA 3O07A 4HD5A 4IQJA 2J9ZA 4ALDA