4HK6A

Crystal structure of cordyceps militaris idcase in complex with 5-nitro-uracil
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
369
structure length
369
Chain Sequence
PVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-5-carboxylate decarboxylase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
total genus 133
structure length 369
sequence length 369
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.66: Uracil-5-carboxylate decarboxylase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4hk6A00
4IG2B 1POJA 1FWIC 1RJQA 1PSCA 2VUNA 5FSEC 2I5GA 4ERGA 1J6OA 2PUZA 4GBDA 3WYZA 2GWNA 3GIPA 4ERAA 2Z2AA 2VM8A 3MVIA 1FWCC 4H9UA 3SFWA 4GOAA 1YBQA 3URNA 3N2CA 2R1PA 3GU9A 4M51A 4LEFA 2HNHA 2BB0A 4MUPA 4XAGA 2D2JA 4DNMA 1J5SA 4CEXC 1P6CA 3E0FA 3O0FA 2YZ5A 3QY7A 1EJWC 1POKA 3A3XA 5E5CA 1M7JA 4ZSUA 3GTHA 3MKVA 3EWCA 1NDWA 2GWGA 3A3WA 3OODA 4C65A 4NI8A 1A4LA 4C5YA 3F2BA 4B92A 4HA0A 4IGMA 1W1IE 4IF2A 1IE7C 5G4HC 4IFRA 4WGXA 5HMEA 4RE0A 4INFA 4PBFA 1ONXA 4LALA 4KETA 2FTWA 4IFKB 2GOKA 4CNUA 3O7UA 4B90A 2WJDA 5A6TC 4GC3A 4KQNA 5LXXA 3RCMA 1VFLA 4RZBA 4HK7A 1YNYA 3FDGA 2PLMA 2D2GA 4GY7A 2HPIA 2IMRA 3GG7A 3QY6A 4C6QA 4LAMA 4GX8A 2P50A 3B0YA 3JZEA 3IACA 3T81A 2Q01A 2QPXA 4H9MA 4LCSA 1NDVA 4G7EB 3AU6A 1UIOA 2Z25A 3URBA 4CQBA 4GY1A 4DIAA 1E9YB 4IFOA 1RK5A 2Z00A 3EGJA 4EPDC 4CEUC 4Z42C 3UR5A 2YXOA 1FWFC 4HJWA 4KIRA 4XD3A 4L6DA 3K5XA 4UB9A 2EG7A 3EWDA 4I6KA 3PNZA 4H00A 3GIQA 3T8LA 4JOMA 4QSFA 1K1DA 2E25A 2HBXA 4F0SA 4C6FA 4WVXA 1EF2A 3WZ0E 4C6DA 3LA4A 2ICSA 3A4JA 3MPGA 5AKQA 2YB4A 1J6PA 3IGHX 1RJPA 4ERIA 1ITQA 3AUOA 4QRNA 4C6PA 2I9UA 3WMLA 4PCNA 4C6EA 1ONWA 4EPBC 4EPEC 4RDWA 2KAUC 1E9ZB 3IPWA 2WM1A 1QW7A 2O4MA 4GZ7A 4KERA 4DYKA 4GXWA 2P53A 2OQLA 3GTXA 3LGDA 3LSBA 3IV8A 1EYWA 2O4QA 3S4TA 4C6IA 1M68A 4H9ZA 3T1GA 1XWYA 3E2VA 3CJPA 1HZYA 1KRCC 3ORWA 4H9VA 3TN3A 5FSDC 4I6VA 1GKPA 4D8LA 1WXZA 4R88A 4PCPA 4DLFA 1FWBC 1YRRA 1V51A 3C86A 3NQBA 4GYFA 2Q09A 1PTAA 4IG2A 1M65A 4KEZA 1R9ZA 4F0LA 2Y1HA 1P6BA 4V1YA 3CAKA 2E1WA 4QS5A 4C6LA 2QT3A 3IJ6A 4DI8A 2OGJA 4J2MA 2PAJA 4L9XA 5CH9A 2Z29A 3TNBA 2ZC1A 3TN5A 3E74A 3F2DA 3F4CA 1DPMA 1ITUA 4R85A 3DCPA 4C6JA 4C6CA 4NG3A 4RDZA 3NURA 1ZZMA 3F4DA 2R1NA 2GZXA 3TN4A 4EP8C 3LSCA 4TQTA 1A4MA 1EJXC 1S3TC 2F6KA 4OFCA 1R9YA 3RYSA 3S2NA 1RK6A 1FWJC 3K4WA 2HPMA 1EJUC 4YIWA 4UBPC 4CNSA 3MSRA 3LU2A 4XAZA 1UIPA 1FWEC 2R1MA 4XD4A 3LNPA 2WJEA 2HBVA 2FTYA 4IGNA 1KCXA 2AMXA 1A5LC 1EJVC 3URAA 1V79A 4RDYA 2Z4GA 3KM8A 3MVTA 2Z7GA 3S2LA 4IFKA 4XD6A 3D6NA 2ADAA 1A5NC 2Z28A 3E3HA 4GX9A 3F2CA 3DUGA 4LCRA 2Z2BA 3IARA 1RJRA 4KF1A 2FVMA 2W9MA 4C6BA 4WHBA 1FWDC 1V4YA 3ID7A 1RA5A 1XRTA 2OODA 2AQVA 4KEUA 4P5UA 5HMFA 4H01A 3UBPC 4G7EA 1PO9A 4F0RA 3OJGA 4AC7C 4IQJA 3GUWA 1A5MC 4E3TA 3UR2A 1PB0A 1YBQB 3RN6A 1R9XA 5HMDA 2BGNE 4CQCA 3IRSA 1XGEA 1O5RA 4ZSTA 1EJRC 2VC7A 2DVXA 4KEVA 4C6MA 1KRBC 4PE8A 3BE7A 1UBPC 3B0XA 3MDUA 4DO7A 3ITCA 1FWHC 3HPAA 3FEQA 4GY0A 3K2GA 2UBPC 2FFIA 2PGRA 4C5ZA 3ISIX 3V7PA 2D2HA 4QS6A 4ICMA 4BY3A 4G2DA 2FVKA 4C6OA 3GU1A 2DVUA 4LCQA 4B91A 1I0DA 2VC5A 2YB1A 1NDYA 1JGMA 4XAYA 1K70A 3GTFA 3E38A 3HM7A 2EG6A 3PNUA 3OQEA 2CZVA 4C60A 2QS8A 2UZ9A 3PAOA 4C6KA 4DZHA 3G77A 3GRIA 4HK5A 4QTGA 3OVGA 4EPKA 2DVTA 4RDVA 4PBEA 2A3LA 1A5KC 3LGGA 4DZIA 1NFGA 1NDZA 3URQA 1GKQA 1GKRA 2XIOA 3DC8A 1J79A 4H9XA 3HTWA 3QGKC 4BKNA 3GTIA 3MTWA 1UMLA 3PANA 1EJSC 2ANUA 4IH3A 4KESA 2G3FA 3CS2A 3MJMA 1WXYA 2EG8A 2WJFA 3TN6A 4GK8A 2VR2A 2R1LA 2OOFA 1A5OC 2Z26A 3FDKA 1FKXA 4H9TA 4H9YA 3LS9A 1EZ2A 4CNTA 4AQLA 4DLMA 1KRMA 3GU2A 2Z24A 4XAFA 2OB3A 4BJHA 4LAOA 2QVNA 1ADDA 3E0LA 3R0DA 3OOQA 4J5NA 1K6WA 3S2JA 3LY0A 3RHGA 2AQOA 2Z27A 4LANA 2HQAA 3PBMA 4V1XA 3OU8A 3UF9A 1QXLA 4C6NA 3AU2A 1KRAC 4J35A 1FWAC 1YMYA 2GSEA 1O12A 1I0BA 2PGFA 2R1KA 3UPMA 2RAGA 1BF6A 3NEHA 4CQDA 1V77A 1EJTC 1P1MA 1RAKA 4R7WA 1YIXA 4B3ZA 4QROA 1FWGC 4LH8A 4HK6A 4DI9A 3QY8A 4LFYA 1XRFA 3MDWA 3SO7A 1RA0A 4NP7A 3ICJA 1FKWA 4LAKA 3B40A 4XD5A 3S2MA 2VHLA 1V7AA 3QGAC
chains in the Genus database with same CATH superfamily
4GUIA 4IG2B 2Q8ZA 4WDUA 4UTMA 1KM4A 1OM0A 1LBFA 5I77A 2E3ZA 3EYPA 4TX9A 2Z2AA 1FWCC 4OVXA 2QJJA 1U30A 3B4UA 4RE3A 3GU9A 4AZCB 3APGA 1OF6A 3LZ5A 1Q6OA 5LSMA 2DFAA 2POZA 4H2HA 3LD5A 1EPVA 3W2JA 2FLIA 2Z7KA 4NXSA 3CLWA 3MKVA 1NJJA 3ANUA 3MUAA 3BLIA 1HT6A 3PBVA 3OODA 1GHSA 4TR9A 4E4PA 1KBIA 3B8WA 1DJYA 1JFHA 2IUZA 3M16A 5IDZA 5FJTA 1GORA 5XINA 5CBBA 2IW0A 3C8FA 4JQ4A 5AN7A 1K77A 3CHCA 1XSIA 3WLPA 1K7EA 1AMYA 3H12A 2GK1A 7REQB 3RCMA 2QUMA 1ZAJA 5D09A 3D0CA 1VQTA 4RZ4A 2QJGA 5DBTA 2BWGA 1PX4A 5D2TA 2VDGA 3CT2A 2XFRA 1SR0A 1LDCA 3A5FA 3GNDA 5K9XA 5DN1A 4FIQA 3G22A 2WVTA 1TWWA 4DZ5A 1A5UA 1D9EA 4BWLC 1SR9A 1Q85A 4BEUA 3H2OA 5HBFA 1MW3A 3BCFA 4JOMA 1ZJBA 2P0OA 4WR3A 4PUEA 3FA4A 1GWJA 1JDEA 4S38A 3GHRA 2PCEA 2YCLA 2NLIA 4QNWA 3H7UA 2DSWA 1MUWA 2YFOA 3DGRA 3C2YA 4XBSA 4IMEA 3ELFA 2O4QA 2WZEA 4D2JA 2VEGA 4Z2HA 2FMOA 3T1GA 1E3ZA 2BY0A 3GY1A 1BRLA 3S5YA 1QK2A 5HQLA 3CGTA 3GW0A 3LZ3A 3M6DA 4AZHA 1SZNA 3N6QA 3USZA 2MNRA 3E74A 4HBKA 2XH4A 3PVFA 4Q7NA 4CU6A 3H2NA 1E3XA 5I07A 1EH9A 2V2DA 1HVXA 4PUKA 1W3KA 2F6KA 1SSGA 2A3BA 4BQ2A 4IP4A 4YIWA 2DT0A 3NO1A 4ZE4A 4ICNA 1SM9A 2OTDA 2B7QA 4H7CA 4GYKA 3WO8A 2HBVA 1R0MA 5HR6A 3P62A 1NP2A 4DO4A 2PI6A 3LHYA 4DUXA 4XQ6A 5LGZA 3AS2A 2DSUA 4PTWA 5HK4A 4RDYA 3VGHA 3MVTA 3A24A 4B5SA 3HQPA 2OYKA 4XD6A 1XSKA 3V16A 1RH9A 3ARTA 5L6UA 3GDTA 1R3RA 2UY2A 1XBVA 4R27A 4EWND 4OV9A 2J7DA 3VUSA 3IARA 3KBNA 1UP3A 4LV9A 2DSZA 4M80A 3C0QA 3NAVA 2WWDA 2OODA 3R0KA 4IXXA 1H5YA 4XIAA 4NX0A 1W3IA 4XBKA 3VOHA 4F0RA 2HTMA 2BDQA 4S39A 1UR4A 2KX9A 4D6CA 3UR2A 2GYIA 1V3HA 3GVWA 2Q02A 1ZAIA 1O5RA 5HR7A 5DY2A 5SWUA 1M7OA 2A3EA 4MWAB 3WQEA 3PZUA 1R5YA 3CQJA 1FWHC 3FEQA 3P8IA 4FNSA 1ENUA 3UXAA 3WUEA 1J0IA 2NXGA 2YDSA 3BV7A 3C2VA 3LPGA 3GB6A 1TTJA 4CD5A 1LJYA 2V5CA 3R6IA 1NSJA 5EFFA 3HIJA 3AYVA 1W1PA 3DESA 2X2GA 2AL2B 2QNEA 3CWNA 3GFZA 1ISZA 3PWAA 3KXQA 1OGGA 4LW7A 4U10A 3O6CA 2YCEA 1TUFA 4FXFA 1YQ2A 2FZDA 2NWRA 3N12A 1KM1A 4I3GA 1DXFA 4MYAA 4OJYA 4ZOEA 2JKAA 5IDIA 3REQA 3FKRA 2BHUA 2F2KA 3HV9A 5G5IA 1EJSC 1QI0A 4B5WA 3BMWA 3MJMA 2QAPA 2CYGA 4C7GA 5D2YA 1F4AA 4Q22A 3WFZA 3LG3A 1W3JA 2FB2A 2C1HA 3G6LA 5I79A 4ZENA 2EO7A 3WD1A 1XG3A 4MNMA 4A22A 2FGZA 1K7XA 1WAWA 4RNFA 4AXNA 3QLLA 3KRUA 1RV8A 2VD9A 2QKFA 3BOXA 1L9WA 1LQ2A 3TKFA 3QR1A 4YTTA 3M0YA 1Q8AA 2HQAA 4KFOA 4FNQA 1EC7A 2XVLA 4PRWA 2BHZA 2P0IA 1EUAA 5HPCA 5D9MA 5HJYA 1B9ZA 2GSEA 4WOZA 4HPHA 1QCWA 2WMKA 4PMRA 1R7AA 4Y7EA 3UPMA 4GQQA 3M1ZA 1BSLA 3LMYA 3QMTA 3QGVA 1UASA 4WD0A 3OHIA 1UD3A 2QV4A 4LOCA 1T99A 3AWNA 3L12A 3IIPA 1QI3A 4R5EA 3INPA 4NNBA 3PZOA 3EOUA 4DI9A 2Y85A 3ICJA 5AHMA 3V4BA 2YL6A 3DYPA 4PRRA 2QR6A 3U6WA 3UG4A 4KCUA 2TRSA 3KVJA 1A5BA 1J6OA 3TZNA 1JNEA 4LBSA 1LWJA 1ZBCA 4NZ1A 4KFNA 3MVIA 5IM51 2QIWA 2OKOA 3N2CA 2L5HA 2R1PA 3AHZA 1O4UA 2DP3A 4Z2JA 1A0DA 4QJ3B 1YNQA 2EGZA 1KFCA 5CPOA 1EGMA 3IJ8A 3WD2A 5CAHA 4ZSUA 1D3CA 2CKSA 5DQPA 4XZMX 2FDSA 4KT2A 1ZBKA 4LXFA 5HNUA 5FAJA 2AAMA 1F8MA 3AHYA 4INFA 2E6DA 4MIMA 3SRDA 3RU8X 1TRDA 5DELA 1SO6A 1M9HA 1OQFA 4CD8A 1RCQA 4RZBA 1O1HA 3CUIA 1NP0A 3VGDA 2H3DA 2P88A 4DF0A 4L5ZA 4LGXA 2DIEA 2GQ8A 3CPRA 3QY6A 4E38A 4LRSA 1QUMA 4JGDA 1HKKA 3ZJKA 3SRHA 1JF5A 2YZRA 5A8MA 5AC4A 3VKKA 4XKMA 1EBGA 3N18A 5F2LA 3W7JA 4EXQA 2OQHA 2B0MA 1E71M 1EHNA 3EZ4A 4I8DA 5J8LA 1P0DA 1K8XA 1KBLA 3NQFA 2E6FA 4JTTA 3R1ZA 3C2RA 3M0IA 3R10A 4XD3A 3N25A 2P8BA 2EG7A 3R7MA 2GDQA 4QJ1A 5DMYA 4TV6A 3SQSA 2GGJA 3CV6A 1D7KA 1M41A 1BWKA 4KCVA 1EF2A 4AZGA 2W27A 3RITA 5HJLA 1MZRA 1J6PA 3C2FA 1ITQA 3S5OA 4EPBC 1DQUA 5DY3A 2EPKX 4DYKA 1SZFA 1XXXA 2YBUA 4FR6A 3JU2A 3W1NA 4IJBA 1XYAA 3ABXA 1ISWA 5MKGB 3HGSA 2OEMA 1F9CA 3W7HA 4AW7A 1YTDA 3MCNA 3MV01 4ES4A 1JCMP 2PDNA 5U7SA 3VNZA 2JIWA 1HIZA 1PE1A 1J2BA 1YRRA 3IANA 5H8PA 1CZ1A 3C86A 4JTRA 4G56A 2VWSA 1BXBA 4IG2A 2AGKA 3VZXA 1E0VA 2Y1HA 4QSHA 5FKYA 4B2DD 3U2OA 3NQCA 3NQ6A 5I3GA 1TPEA 2JF7A 4L1GA 3AYRA 1J0HA 4PB3A 4AZCA 1O5XA 3UPBA 5T9CE 4BQ5A 1T41A 4WIWA 1QNPA 2ZUNA 1VB9A 5CSSA 3RYSA 3QR3A 4GYJA 4M3PA 3K4WA 3H2AA 2UY5A 2HPMA 1E6SM 1HO1A 3MYPA 5JXQA 4ATLA 5G1YA 3MI2A 1IT8A 3N19B 4GXPA 4XAZA 2XM1A 1FWEC 4Q8NA 2WM0A 3W1RA 4AIEA 4X9SA 3SGUA 1L0PA 1X38A 3TA6A 1VZWA 1EP1A 2EQDA 1OFPA 3G1HA 3DDMA 4Z2LA 1NOUA 2G50A 4S3EA 3LEPA 1VBUA 3D6NA 5E9AA 3WH5A 1FHUA 3KVKA 5BROA 2HWGA 1DJGA 3P60A 1UWTA 7REQA 4UZSA 2XDFA 3GH4A 1ZU8A 2JBMA 4ATDA 2QJMA 1V4YA 1XRTA 4JCMA 4JQ3A 1FX6A 1VYRA 4HU0A 1EPXA 4HNUA 1GJUA 3ABOA 2VC9A 1OWQA 5F2MA 4M8UA 4F48A 5I3FA 4AC7C 3UEQA 4FXRA 4D9PA 1A5MC 1XV8A 2LLEA 3GXTA 3QW4B 4CQCA 1BSIA 4HU8A 1WO2A 5I3DA 4NI3A 5GNYA 3WQ6A 2XYLA 1CXLA 3SIMA 1HQTA 5LNUA 2F61A 4XTIA 4O4WA 1XIEA 3QYQA 1ZL1A 2BOGX 3FIGA 4F9JA 5CKSA 4QG8A 4M6VA 2PRLA 1TELA 5C9ZA 1B9BA 4A2RA 2QMJA 2W79A 4FLSA 4XAYA 4LVAA 5LIKX 4IIFA 3BCDA 3VMPA 3AIBA 3OZPA 2QCGA 3GRIA 1MRAA 2OWXA 1WZLA 2CLMA 3BARA 1HKMA 1SZGA 2HJPA 3TA9A 1SJCA 3OIHA 2BG5A 4MPQA 3BL3A 4ZFCA 1UMLA 1KKOA 2NQLA 3L4ZA 4QQUA 2HNEA 1JUKA 1EC9A 3Q94A 3KDNA 5HXMA 1VRDA 3LV6A 4AQLA 3B0VC 5JUVA 1FCQA 3DECA 1PPIA 4LB4A 1PIIA 3S1VA 5FL0A 1ADDA 3FJ4A 3VM5A 2YX0A 5I24A 3GWQA 2PZNA 3GNOA 4OZOA 3N4FA 4MADA 3JUGA 4P7OA 1XCFA 4JBRA 1GCYA 4DJEA 4UOJA 5C2CA 1EJTC 1P1MA 3OGSA 2D73A 3KRZA 2G41A 3WQDA 1CLKA 3IGXA 1Q5MA 4B3ZA 3CEPA 5CPNA 3L4XA 1A5SA 5EMLA 3TQPA 3NPXA 3GFYA 1U33A 1F05A 4FMVA 1TPWA 3CZ8A 3IIZA 3QR0A 5G4WA 1G69A 4XD5A 2JK2A 2DQXA 3KWSA 3SRKA 1FXPA 1ECQA 2XU2A 3FGCA 3W70A 1RD6A 3KCLA 4ERAA 3RLUA 1DE6A 2XINA 4GI6A 3B06A 4S3GA 4ZTYA 3GNPA 3NOYA 2J88A 2D2JA 1ZB5A 1DJNA 1P6CA 4HCHA 3F4VA 4A8NA 4YVPA 1SYTA 3E6EA 4MWAA 2AAAA 2BFGA 3GTHA 4C1KA 3W7NA 4JTGA 2ZADA 4GNJA 4C5YA 4B92A 4HA0A 2BBFA 3SCWA 5C9WA 3KS6A 1D8CA 4RE0A 3S83A 2J8TA 3WEOA 3VKJA 1WUFA 2QCMA 1V0LA 3ONBA 3M4HA 1Y5XA 3MBDA 3L21A 1LUCB 1MO0A 1K8CA 4TIMA 4F40A 2FJUB 3WLKX 3A64A 4JTJA 3HQ1A 1OBAA 2G3NA 4HD5A 2CETA 1EA0A 3UCQA 1PCWA 1ZSXA 3TC3A 1T6MA 3VX0A 3QW3A 4GY1A 1RLCL 1EIBA 4R7OA 5CC5A 4LBUA 3PUOA 1VH7A 2QPSA 4MB4A 2X2YA 4EPDC 2ZRZA 2XSAA 2VDIA 2PP3A 4HJWA 2EJAA 1FTXA 4JIHA 3FY1A 3PHAA 2G97A 3KAOA 1HKWA 2YBTA 2INEA 2ZDRA 2WC3A 4O13A 3HGRA 2XPKA 3FNDA 1RPKA 3A4JA 1OFOA 4FX7A 2VRQA 4I7UA 4JQAA 1XLEA 3L2IA 1XICA 4LVGA 2IXUA 3K4AA 4HVXA 2NXIA 2J24A 5CXPA 3UJRA 3G18A 3RIKA 4LEQA 1TX0A 1PS9A 3H2EA 3KTSA 4Y6GA 3FS2A 3LGDA 3LSBA 3EPNA 4H6KA 4WSHA 5D37A 1GVIA 2QGHA 4PA8A 3H21A 5F1VA 4NRRA 1YPFA 4LNYA 2NQ9A 1Q6RA 2CHOA 4LBRA 4LS1A 1FWBC 1JDFA 3P81A 3WQCA 1HNYA 3SQMA 3CAKA 4NASA 1AZ1A 5E6YA 5AHNA 3LK6A 2PAJA 3KBMA 2VWTA 4BS0A 3N2XA 3STGA 1IWBA 4E4UA 1TV2A 1Q66A 3LCHA 4KRTA 3WQ4A 2XSXA 3TTEA 4RDZA 3CZGA 1ZZMA 4HU3A 4OKDA 5FD0A 2J47A 2EAWA 1A4MA 3NR0A 5TBOA 2WZMA 1I2RA 1IWAA 4OWGA 3AJ7A 2E9LA 2NX1A 3LU2A 3VNKA 3A5VA 3VDGA 3RFAA 4MZYA 2BVDA 1BXCA 3ARXA 2DJLA 4UNIA 4F3HA 4V15A 1OZQA 2V0TA 4AMAA 2XIJA 5J04A 3UNTA 1D8WA 3PZTA 4JYDA 2HMCA 3UERA 1TKKA 2FTPA 4GXMA 4B16A 4OECA 3TYUA 1KLYA 4M1BA 3P0XA 4QCFA 3E3HA 5CQ1A 1CW2A 1PKYA 4IICA 2HXUA 2X1RA 1W31A 3CO4A 2V3GA 2DEPA 1G1YA 1HG3A 3ID7A 1FDJA 2X0YA 3IVTA 4MPKA 3W1QA 3TV8A 3WN6A 4LTSA 2CHRA 5HNRA 2CWXA 3CTLA 2WLYA 1YLVA 3WMCA 3R8GA 2QJIA 4OBRA 3HFTA 5XIAA 1IZJA 3HZ3A 5C55A 3BZJA 3PFMA 3A4XA 4C6MA 1YADA 2I57A 3AIQA 4AEFA 4YVVA 1TV4A 3P84A 3R4IA 1TCMA 4QXIA 3VINA 1EO5A 2Q3OA 2PA6A 3ISIX 3KL0A 3BLFA 1WCGA 4ICMA 3ZLFA 3OYZA 1S5VA 1V08A 3K30A 2P5NA 1RQHA 1RALA 2QF7A 2X7VA 4JNMA 1IXQA 3PJTA 1CGYA 1K70A 3GTFA 3TR2A 1GZJA 2OSYA 1RY8A 3LHUA 3AZSA 3AO0A 3I10A 3T6CA 4HMNA 4JX4A 1R2RA 3OVGA 2YR1A 5MKGA 4MNJA 4TX6A 3VILA 4UTWC 1IXPA 2RFGA 1Q2RA 3IJLA 1ZJAA 3WSUA 1J79A 4UTLA 3CZKA 4IH3A 1RSCA 3IJQA 4JIEA 1AMKA 5I0DA 1GVOA 5AC7A 1G4SA 3B0PA 3W2MA 1XIDA 4PN2A 4LF2A 1BAGA 3KBSA 5CZ0A 5AYXA 1J8VA 4FSAA 4QE5A 3TCEA 3AXXA 4O54A 4AU0A 3OOQA 1PUDA 1UR3M 1JZ8A 1OT1A 3TE9A 3WNPA 1AW2A 3SJ3A 2C13A 2WZHA 3OU8A 4H6RA 1G01A 1GTHA 4LAZA 1UR0A 2W62A 1DTUA 2PGFA 4O19A 1R85A 2BASA 1EX5A 3UWUA 4GO8A 3FSUA 1W9BM 4N0RA 3RNDA 4IPIA 4IL2A 1MQQA 2QDHA 2VEPA 1V6VA 1VIWA 1XRFA 1EA9C 2YDAA 3AYSA 1H1NA 3GM8A 1UWAA 1YXCA 4CU7A 1V7AA 3QGAC 4GRSA 3V1HA 3VDBA 3DXIA 2VURA 3ZYZA 1AA1B 1CLVA 3M5XA 1TIWA 1QO5A 4Y96A 3MMWA 3ZR5A 1JQXA 1SJDA 2EKCA 1DP0A 3W9ZA 3DH7A 3Q45A 2EPOA 2Y0FA 3QY7A 4W8AA 4HA4A 1R3VA 4N7QA 3PAJA 4URIA 3EX2A 1OX5A 4C1LA 2AKZA 3W01A 2YL8A 3KEHA 4NZJA 4M5PA 1W1IE 4PB5A 3V35A 4E8CA 1U83A 5HMEA 5ABTA 3N6HA 2WSPA 1O95A 3ZM8A 1VFOA 4LUSB 3C2EA 2ISFA 2OZTA 3KDOA 4QGCA 2WJDA 2V5DA 2KZHA 3UYCA 1QU4A 3PWGA 4D6DA 2HPIA 3M7WA 4FHAA 3AYTA 3S5SA 5GNZA 1RBAA 4GYPA 4IPLA 2P50A 1A5AA 4QJ5B 3QXBA 2F84A 2XH7A 4UNLA 1FHVA 2A2IA 4BI5A 1TQXA 4LCSA 2JALA 3K8KA 4IJCA 4J9JA 4NX5A 3VO0A 1Q6QA 4A2SA 5DRCA 2Z00A 1H0GA 3ALFA 4CN1A 1Q7MA 2H9AB 3W7GA 5CGMA 2YGYA 4DZAA 3W00A 4H00A 3GIQA 3APYA 4MZ8A 6ENLA 2E8ZA 4Z1AA 2QCNA 3CWHA 1P7TA 1N8WA 4WVXA 4JCLA 1QJWA 4WXYA 1KXHA 3WK0A 1VCFA 1EEPA 1YPXA 2ICSA 2VTFA 1JG9A 2RDTA 4CU8A 1B0IA 1B3YA 2ALRA 1UZ4A 2VGIA 3VCRA 4C6PA 3VE7A 2OQYA 1QATA 3CTTA 3GXMA 4RDWA 4B4HA 2PE4A 1QWKA 1NARA 4GUHA 3OLIA 4IPNB 3MUXA 1BXNA 2WC7A 4DWSD 1WKEA 4F2UA 1TV8A 3ZWSA 5KINA 5CPMA 5LNSA 4HGXA 4M1RA 1M68A 3M64A 3E49A 3TN3A 2CW6A 1DKWA 2PB1A 2PEVA 1JAEA 4YJ5A 2PF8A 2D23A 5LKYA 3FK4A 1HKVA 1ZCOA 2QDEA 4PCPA 2DV0A 3I68A 4Y8FA 1B3OA 4JTQA 3CMFA 1M65A 2PBGA 3C0LA 1OCJA 4RNHA 4E0CA 3UWVA 2E1WA 5CBIA 1TWSA 3K1DA 5CH9A 3WH7A 4FF5A 3TNBA 2D24A 3ZWTA 2IPGA 5E09A 4C6JA 3TYBA 1M03A 1TWZA 2O7SA 2GZXA 3LM7A 3P5YA 2BTMA 4O28A 1RK6A 3MS8A 4S3CA 1TUXA 2BS9A 3AHTA 1G0CA 4CNSA 4O15A 1Q6LA 4PMUA 1XI3A 3LHWA 4GFIA 1GK8A 2DT3A 4LUTB 3EB2A 4JQ1A 1XR2A 4ZQRA 2W61A 1ZJIA 5CZKA 1WQ5A 3VGGA 1LUCA 2BGQA 2C1GA 5EGRA 4C6BA 1GOMA 3R8HA 4Q4OA 5A6MA 3CQKA 2BXZA 4I9MA 5F7UA 4HHPA 3W26A 4MFDA 3I7SA 3MQTA 2OWWA 1AL8A 4B4FA 9XIAA 1PO9A 1SO5A 3NM3A 1QPRA 2VYOA 2ZIDA 3VDAA 1ADSA 1YBQB 3RN6A 4DJDA 1PKMA 3AMGA 2WZIA 3WD0A 3RJXA 3SCSA 1VCVA 1PDYA 4ZE5A 5A8NA 4JICA 3H23A 3II1A 3T0CA 1WYIA 3DI0A 3H24A 4D8AA 4JR5A 2V81A 2ISWA 3E5PA 4ZXOA 2PCQA 3TK7A 3VOGA 4ALDA 2MUCA 2FVKA 2A21A 4LC8A 4A3YA 2GSHA 3R43A 2XJ7A 4QLKA 3W28A 1BFNA 1QMLA 4LF1A 1YNPA 1NDYA 3BLPX 3OP2A 1GQLA 1EX1A 1I2PA 1OD0A 3PNUA 3UA3A 5M3WA 2E4TA 4NL1A 1NELA 3GR8A 5EMJA 4UTKA 1J0KA 2WC4A 3CHFA 2DVTA 4HYWA 4E2OA 3E5BA 1VFTA 1U5HA 3BLLA 3AZTA 3H70A 3QV7A 3WFLA 2BVWA 1GKRA 3NQDA 3GHSA 3VIIA 3VI2A 2VO5A 1J10A 1Q6FA 2EXOA 4ZB5A 1ZJHA 1AJ2A 2E7FA 2G3FA 3PC0A 2TMDA 3TN6A 3LGEA 1VBGA 3N1AA 1MXDA 2C16A 3J7HA 6XIMA 5I3IA 3LPOA 3H2CA 3RU6A 3W7KA 1KRMA 3LMZA 2Y7GA 3VD4A 3CEUA 3CAVA 3DENA 5IRPA 3MY9A 5KEZA 1X8CA 3ARRA 3UJ2A 1GZ1A 3LUTA 2Z27A 1M7XA 4JKLA 2CZFA 1H63A 5B7ZA 1TVNA 4K1WA 2CBJA 4N9CA 1LROA 3RRAA 2FYMA 4N6FA 3SECA 5FCZA 2VCCA 1DWAM 3NWRA 4R9XA 3E0WA 3TC7A 5CGTA 1WZAA 2P10A 3MDWA 3P6LA 1KWKA 4NP7A 3T2OA 3T44A 3B04A 4UXDA 1GEHA 1E9LA 2I16A 4B5NA 4OOUA 4ACZB 3UPWA 5DMNA 3KOZA 3O3RA 5FACA 1BGAA 2WQPA 3HGOA 3TAKA 2RJGA 3EWZA 4IWWA 3PK7A 3CH9A 5G2WA 3URNA 4L6OA 3UG8A 2HNHA 1E0UA 1BWVA 3B03A 3HMJG 1CXHA 2X40A 1KXTA 1W3TA 4Z2GA 4AX7A 5M5DA 4QITA 3U2EA 1TREA 3ZSTA 4PMQA 3CLMA 4WRHA 4GVHA 1A47A 2O92A 2G5WA 1IE7C 5FEPA 3WMSA 2GGHA 1OGBA 4LALA 1UKQA 3OZOA 4NZFA 2VGBA 5G2IA 3UESA 4MY9A 1W1B1 2I56A 3NQ7A 5H8UA 2ZZ5A 1VFLA 2NUYA 3P67A 5LNWA 1MEIA 1K9FA 3WG6A 2PWDA 8XIAA 3MUZ1 1KWGA 3TLQA 1QRQA 4I5UA 1QOPA 4ZODA 4UWMA 4CN6A 4NNAA 5K4ZA 1AQMA 4MB1A 1GPFA 4JL2A 1E73M 4AISA 1XRVA 1H7RA 4LUJA 1QI2A 3TR9A 3GG0A 3T8LA 1K1DA 4DJFA 1EQCA 2XFWA 4RR4A 2YLLA 3ES7A 1XRSA 2C0AA 2TAAA 1Q63A 1QR7A 1MQRA 1MDRA 4I8YA 1LRNA 1T7LA 3U5YA 2DJXA 3S5ZA 3NEVA 1W9VA 4FALA 1H5VA 2ZTKA 4FXJA 3I3EA 5T91A 2WSKA 1GW1A 1FHDA 3S6OA 3TOYA 1JXKA 4GISA 5DXYA 3PY2A 3SN0A 1C90A 2CBIA 3IV8A 1EYWA 5D33A 3OA5A 3ORWA 3WDJA 3UWZA 3DN5A 4I6VA 1WNOA 3IUDA 1RP9A 3N34A 4JFWA 4S2BA 3S9IA 3MW7A 1O94A 2A3AA 1V51A 2Q09A 4Q8UA 1AFSA 2YXXA 1W9DM 5DFAA 4K36A 1ZHAA 3F4CA 3MO4A 1ZRQA 4L4PA 1HJSA 3U8GA 2GVGA 2PDGA 1QPOA 2R24A 3EA2A 1S46A 3BJSA 3EX6A 4B5TA 4IGSA 1PWLA 4RPPA 4H04A 1Q6CA 3R12A 1RUSA 3TIMA 2XWDA 3BAJA 4L4LA 3PZIA 4ZZ9A 1KM3A 3SZ8A 1LLWA 3MA8A 3GS6A 2PC8A 4AFYA 3WMBA 3KM8A 4PMJA 1V7YA 4LUSA 5HQEA 4JFUA 5F1UA 4QG6A 1X6NA 5DT7A 1FQ0A 2BOEX 3TNOA 3DUGA 1XFBA 1YDVA 5A95A 1UD2A 1KFEA 1EKOA 3AIWA 4GMEA 4PTXA 4ICCX 3U7BA 1R7OA 2DQWA 5HULA 1MW2A 2VP8A 4X3ZA 2ZYFA 3CNYA 1JCJA 1X1ZA 1V03A 3OBAA 4AY1A 2Z6JA 4H01A 3BG9A 3MI3A 1KV8A 2W4XA 3OJGA 4JDBA 5M03A 2R9RA 1PB0A 1R9XA 3I6RA 4US5D 4DB7A 1ZNNA 4X60A 4ZSTA 1DXEA 1V6YA 3CHVA 1SU5A 2VC7A 1ZUAX 5CPTA 2ACSA 4RNJA 4L4MA 5C9RA 1XYCA 2J75A 2Y8KA 4NYUA 1HP5A 3HPAA 1XKYA 3QBUA 1HJVA 2HVOA 1CXKA 4MHBA 1E6XM 4IMAA 1VBHA 1XCWA 4GUJA 3AOFA 4G2DA 1CBGA 3R89A 4UQDA 2PC4A 1JGMA 5A94A 1R46A 2V63A 5GPRA 3T9PA 2UZ9A 3KHJA 3GYCA 3WK1A 3S46A 4XISA 3DYMA 4QTGA 4XIMA 1EEXA 3ZZ1A 1V6WA 4OIFA 4JQ2A 4BR1A 3HPSA 1NDZA 3IJ9A 3URQA 2IPFA 1S38A 3V75A 2I1OA 4P7QA 1FA2A 1XFCA 1JYVA 3MTWA 2YDQA 1XIGA 2WYSA 1I1XA 1AQ0A 4WEVX 4JIQA 1JULA 4DWSC 3NQGA 2EG8A 2WJFA 3P82A 3VABA 4HQVA 2A7RA 3FDKA 1FKXA 4Q4RA 3SM0A 2VFGA 3UU0A 3B8DA 1ESWA 2V5JA 3OVQA 4JX6A 3FFSA 2OB3A 2WO5A 4BJHA 1GOKA 1VAHA 4Q8TA 2C15A 1KCZA 1VJIA 2CLPA 2VDHA 2Y5JA 1EC8A 3LCWA 1M5WA 5KITA 1S5TA 1QOQA 3L5LA 4MVAA 3FJLA 3RHGA 5ENLA 1HFBA 2JF6A 4E2DA 3AU2A 5I6SA 4JTUA 1CPUA 4AZ7A 4LUTA 1WP6A 4BZYA 4MKSA 5TF0A 4CLMA 5F4SA 3F5LA 4Z1YA 3GYEA 4LH8A 4N4PA 2DZUA 1JCYA 4MB5A 3R13A 1W5PA 2GGGA 3WK3A 2OG9A 3F03K 3M5YA 3SFKA 3S2MA 1FUYA 4YYFA 2G3IA 3VCCA 1UJQA 4AVNA 3WL1A 1NOFA 4QDMA 1TVLA 3SSJA 1O6IA 1O1ZA 5AOUA 3VZYA 1VPQA 3EOSA 3NFUA 1XH1A 1YBQA 2YOCA 4UFIA 2HDJA 2BB0A 4MUPA 2VENA 2IQDA 3A9BA 1E15A 3OA3A 2E9MA 3HPZA 3BQ5A 3WDIA 3WH8A 4PFHA 4HPJA 4JN8A 2R94A 3F4WA 3ITOA 3WKZA 1NDWA 3NDYA 4YTRA 1UZDA 3A3WA 3CZEA 2GLKA 4O14A 3OBEA 2PGWA 3DFYA 5IOBA 4KGJA 3USBA 1SGJA 4UQBA 4IFRA 4O57A 2B7PA 3FN9A 4AZ6A 2BVTA 4BHYA 3EB3A 3T0TA 3MYOA 1TZ7A 1IQ8A 1LOQA 4BA0A 2QQ6A 3CYJA 1KBKA 2V5BA 2WMHA 4KQNA 1PCKA 3V36A 3VKBA 3N4AA 2XVPA 3T55A 3N9KA 2CZ5A 3W86A 3F7JA 1XLJA 5CZJA 5TNVA 1XH2A 3YPIA 1DWJM 3UY8A 4BF9A 4DN1A 2I14A 2IS7A 3BMXA 1VPXA 4JHMA 3W38A 1XS2A 2XGIA 4UTIA 2OWCA 4AHPA 2D69A 4ZEPA 3AMKA 3UJEA 2D0HA 4AEOA 4QEEA 2R8WA 3U9IA 3SB0A 4IXHA 4LC6A 1DJQA 3BWWA 1JYXA 1K03A 1KTCA 2OSXA 2RDWA 3WBWA 2J79A 2V3DA 3IGHX 1RJPA 3LLDA 3NL6A 1CB7B 3ZJ6A 2GVEA 1DIEA 5EYWA 4ILSA 4CNNA 3HB9A 4GKTA 2YBVA 4KERA 4GIAA 3A12A 4Y9AA 3VA8A 2CKRA 3C2OA 4UQEA 4HZ7A 1TJ2A 3CJPA 2W67A 3KOWA 2XN0A 2A3HA 1GVYA 2TPSA 3SUWA 4DLFA 4IT1A 4UR9A 4K3ZA 3WENA 1QNOA 1EDQA 4OBTA 1BYBA 5A1AA 2QHAA 4S3FA 4XZLX 3CZLA 3TN5A 5E6ZA 4GE8A 3RUBL 2GJNA 2GUUA 3FJ6A 5LHFA 3TW6A 4U5IA 1SVDA 3T2PA 1UA7A 2FJKA 4Q8PA 4NUWA 1K4GA 3H53A 4QEHA 4A35A 1YTEA 3W0KA 1IEVA 4ADSA 1W1TA 3S6TA 1JYWA 3ATYA 3QSTA 3OZYA 3DFNA 3MANA 5FJPA 5G1TA 3L67A 2F9RA 3W7CA 3WLOA 3PPGA 3WLIA 4G9PA 1NH6A 1XUZA 1E1CB 3W1UA 1V02A 2DGAA 1XIMA 3S8HA 4P7RA 2VX7A 4AD2A 1QW8A 1GZGA 4O17A 2WB5A 4MDOA 1RJRA 3BAYA 2ZZ1A 2HZGA 1FWDC 3G0XA 3XISA 2E9BA 2WHMA 3ZFHA 4P5UA 4AXKA 3CL8A 1OFDA 1CCWB 4HSNA 3DAQA 3U5UA 4ZQCA 3T2QA 2DY3A 5I23A 5C5YA 5AECA 1OG6A 1OVDA 3MUCA 2PTZA 2V30A 2ZWZA 1XLLA 3SGZA 3W23A 2J6VA 3H22A 1KCKA 1REQB 2NVCA 2DVXA 2WSYA 4KEVA 2B7OA 3DG7A 2G95A 3GAKA 4PTMA 3B97A 4FNRA 4O16A 1H50A 3W1XA 5DLCA 1WDWA 4HZ8A 3UR7A 5EBUA 2PGRA 2ZRVA 3U2CA 4J27A 3V7PA 4JPGA 3CPGA 3TONA 3W24A 1BTMA 4GWEA 3GU1A 1H7NA 3I65A 3EA1A 4LCQA 4DBEA 2PDYA 5K9CA 1XYBA 4AIBA 3ANYA 3F5JA 1H09A 6A3HA 4JHZA 1ZQ5A 4WY0F 1A0CA 4HK5A 5ABHA 2ZUVA 4U31A 1A5KC 3L4WA 4MG4A 3UETA 3WFAA 3K1GA 4XTDA 3HTWA 1FY6A 5HATA 2OO0A 2PRHA 1L6WA 2IKHA 3AFBA 1UG6A 5CPQA 5KETA 3CUFA 3KOYA 1K7FA 1CTNA 3AZRA 5A6KA 3VMOA 3WLLA 2XZ9A 4QE4A 2WHJA 4W9TA 1PZ3A 3LI0A 1QHOA 1FCVA 3SCRA 4YCOA 1UD5A 1U1UA 2R6OA 4LJ3A 1W2VA 2WNNA 1PX8A 1E6PA 1OEPA 1QAPA 1W1YA 3EDEA 1O12A 3I7QA 2ACQA 3MSGA 1CGTA 5DRIA 3BGJA 1TR9A 2VT0A 3QLDA 1YXDA 2EF9A 1V77A 4C90A 4HNLA 1V3MA 3BANA 2E6YA 3QC3A 3AXHA 4JTEA 3G1YA 3N2OA 3B9NA 4TOQA 1RPXA 4J40A 1ZLPA 3LXAA 2DORA 3TYZA 4E8GA 5A6BD 4LAKA 3EWUA 3PPHA 2VUNA 1H1ZA 2ZA3A 2PUZA 4J7RA 3LCIA 5ECVA 3DX5A 2A6NA 2J8FA 3GH7A 1UZ1A 5IFPA 3BK0A 1WB0A 4HNNA 1L6SA 1W6TA 4NIRA 1I4NA 3BJFA 1G6CA 2VEFA 1CXIA 5D9PA 2FPTA 5AYYA 4ADUA 3VOIA 3IK2A 3E1F1 1PHQA 4YL2A 4PEEA 2PWGA 1JYNA 1POKA 3NA8A 3KHDA 4D1IA 1XISA 1W5QA 2QZRA 3LB0A 3A47A 1O5QA 1GW9A 2P3EA 1TB3A 4IGMA 4H19A 2VR5A 4LUIA 3P2VA 3AJXA 3MI6A 5KZEA 3HBLA 3UVIA 4R7JA 3NZGA 4LY8A 2PDFA 4CNUA 2F38A 3ZQ9A 2OR2A 3I6EA 5BXRA 1MUMA 1CGVA 4XZNX 3FCPA 1P43A 2GOUA 1HTIA 2PDLA 1KM2A 3QZ6A 9RUBA 5TAOA 4NU7A 3STFA 4RLIA 5D2VA 3PTQA 4C6QA 3SCVA 2RDUA 2XH2A 4UR8A 3VIKA 1NDVA 5CCZA 2X16A 1MEHA 2D3LA 2PDCA 1CGWA 1GEQA 1Z3NA 4OQVA 2NT0A 2WK2A 4CVUA 2PWUA 3DFTA 4OU1A 4QQ3A 1EIXA 3ZO9A 2XGZA 3S1UA 1R3SA 2E8YA 3WNMA 5I06A 1ONEA 3H55A 1P6WA 3L4TA 3EOLA 1K3UA 3B8TA 3VKCA 1EOMA 2TODA 4GG9A 1IEQA 4Y8EA 3W1AA 4WJEA 1RVKA 4G6CA 2ZUSA 2W91A 3SUUA 1C7SA 4FLRA 3QC0A 3VAVA 4C6EA 2W0UA 4Z17A 4EPEC 4FX6M 2ZA2A 2PBOA 2PTYA 5CPSA 2KAUC 2ISVA 2WM1A 4WCJA 3VDHA 4K68A 4W86A 1X6UA 1HN1A 2D0GA 5LYRA 4XUGA 5AVNA 3TAOA 4HOZA 3B8IA 3UZ5A 3EWBX 3E2VA 4ZQPA 1N8FA 3GXIA 4QCEA 3CMGA 4JTLA 4PCFA 4R88A 2BY1A 3TLLA 2UY4A 3HQOA 1E51A 1PTAA 3PTDA 5IBXC 3W3OA 1HUVA 4AVFA 3WQFA 2PGEA 4I9AA 1TTQA 3LCLA 1XYLA 1QI5A 1ITUA 1LLZA 2A7NA 4JTKA 1AVAA 3NURA 4CUCA 5HDRA 4GJJA 4OFCA 3CPUA 1HGYA 2IKIA 4QFUA 1UWSA 2WCAA 4QHRA 5LIYX 2WOQA 1UHVA 2WKGA 4ZMGA 3SGGA 1M01A 2XVNA 3ABZA 3TJIA 3S1WA 5A8GA 3W7DA 4YCPA 4GIEA 4A29A 4N02A 3FJNA 4XV0A 5EB8A 4ZGYA 1ALDA 2PTWA 1T8XA 1QNSA 3L9CA 4I9JA 2JE8A 3WNKA 1R47A 4LCRA 1F7BA 2BXVA 4BF5A 3PTMA 1E0WA 3LBOA 3M6YA 4Y9PA 4UOQA 1E1FA 2YKKA 3UBPC 2X7WA 1WV2A 4XO7A 3T0BA 3WJWA 2E28A 4J3VA 3L0NA 1ECEA 4QBXA 5FEZA 3LHVA 1IF2A 5ABGA 1E43A 1KQYA 3B8SA 3QHNA 3NM1A 1EF3A 2EJ1A 1R3QA 2EBNA 3L68A 4MWAE 4UTUA 3T05A 4WKFA 5D9NA 1PZ1A 4MY1A 1V5XA 3RM9A 1S5WA 4F9DA 3TQKA 3IVSA 4RE4A 3ZT7A 4DUVA 3WBAA 1YKWA 3LCGA 4O0KA 3W7MA 1WDDA 3W25A 2VELA 3PPCA 2DH2A 3GDLA 3G77A 3D47A 4RZ5A 3W84A 2TSYA 5BMXA 4RDVA 1LG2A 2OT1A 3RX4A 4UUIA 3P61A 4RL3A 4NJKA 3TYEA 2QLYA 3LGGA 3N2TA 3WBEA 4OTKA 1X96A 2YPIA 3GD6A 1ME9A 4LYQA 1OC5A 1W1VA 2Y62A 3ITVA 3GTIA 2RJHA 2ANUA 3CS2A 6CGTA 4GK8A 4KCWA 3GUGA 5HWMA 4PUDA 5HPOA 2ZX9A 1L8NA 5DXXA 3MMTA 5HA7A 1G5AA 1S39A 3IUIA 4J3SA 2OYLA 3H7RA 3WDRA 3AALA 1IGSA 1UKSA 1VLIA 4CCDA 4PMNA 1FH7A 5T8GA 4KCTA 5A8QA 4J2PA 4ZXLA 3LY0A 2DU2A 4GUFA 1NFBA 1PIFA 4S2CA 1UB3A 1FXQA 5HUPA 1IHIA 4GINA 3TWAA 1QXLA 3ITXA 2P76A 4Q7IA 5IXEA 4DF2A 4B9YA 1V93A 2CZDA 3O07A 3OLGA 4GQGA 1E1CA 4XO6A 3RCYA 1EB3A 4HHMA 1XBZA 1YIXA 4KH2A 4ADTA 3TOPA 3H4XA 4AY7A 4GZJA 3PFRA 3NSNA 4MOZA 4RW5A 3T8QA 1VEOA 1JF6A 1VLWA 1ZPTA 4KWOA 3CM4A 1UH3A 3BG3A 5CBJA 4ZQNA 3LCXA 1POJA 4O4VA 1PSCA 3B8VA 1TPFA 4FPSA 5D04C 3TROA 4ZFMA 3B8UA 1SMDA 1S2CA 2VQUA 2AGTA 1AUSL 4YS1A 4GOAA 1E5NA 4C7FA 1V6XA 4KS0A 9XIMA 2ZUTA 5BU9A 1TMQA 1PTDA 1Q45A 4FOUA 5FIPA 1J5SA 4CEXC 3RILA 4Z1CA 1EJWC 3D46A 1W91A 3QOMA 1M7JA 3FKKA 5ABEA 2GUBA 2GWGA 2F2HA 2NQ5A 2CPUA 2GJRA 3G1VA 4JYEA 1SPQA 3JVAA 4Q8VA 1Z8AA 2WW5A 2C79A 4AWEA 2QDDA 4GD0A 4IHCA 1WAUA 3PZQA 3QMRA 4LSBA 4LV4A 3WLHA 3ALGA 2ZE0A 1MRQA 1OFEA 3OG2A 1D2KA 2H90A 3EDJA 1KFKA 3EKGA 3PZNA 1VRXA 5E93A 2OX1A 3AC0A 2IMRA 3EMCA 4X9YA 3OPSA 2VFHA 2ODOA 4YMZA 4DYJA 1K9DA 2WMGA 5TD4A 3B0UX 2CLIA 1R2SA 3B0YA 2VFEA 4F0HA 4AMCA 3UWWA 3W6LA 4S3JA 3DBPA 5FEXA 1PHWA 4YTSA 2VR4A 3BLDA 2V68A 1SQ7A 1UW9A 3KVLA 4GNKB 4L6DA 1LYXA 3AS1A 4FLOA 1KR0A 1FFQA 1CGUA 4JKKA 2ZXAA 1Z44A 1WPCA 1VCGA 3ZT6A 2EPHA 3WUFA 4B5UA 3ZXWA 4WDTA 1AZ2A 1XLIA 1HGWA 3MMDA 3M9YA 2OEJA 2A3CA 4GACA 1S2UA 2WHLA 1ONWA 2Q71A 1GQJA 4K6AA 1E9ZB 3IPWA 4GUGA 3EXSA 1E4LA 3RK8A 4MJZA 3NJ3A 1XSJA 4Q8OA 4HHHA 1VENA 2F6UA 3M0MA 4J3XA 4H9VA 3G1AA 4H8VA 3W2KA 1FWSA 3PBGA 2G96A 2OYMA 2ZZ3A 3SEPA 4JNZA 4E3VA 4BQ3A 3KZPA 3G24A 1NVMA 4L4OA 3LLFA 1FH8A 1TR1A 2ALDA 3N11A 2WCSA 4GKLA 5DCBA 1G7VA 3WJXA 3W2LA 2V9DA 4EANA 1EO7A 3F2DA 1WDSA 2DPEA 4UTWA 3N13A 1DPMA 3APTA 2O9OA 1XG4A 3FLUA 3MP3A 3UT0A 3OVRA 3EX3A 3VUPA 3F4DA 3B05A 3DC0A 2NQZA 1H60A 4L6HA 3LSCA 1LZOA 4E8DA 2ZZ2A 3IS4A 2XN2A 3EDFA 1F73A 4UCGA 5EMUA 2W92A 3WLMA 3ITTA 4REQB 2CNCA 4IMGA 1UD8A 3HU7A 5JVLA 3NPVA 3QQ0A 1H2JA 5G2HA 1W3NA 4AY8A 3LYEA 5LHEA 3S2LA 4QNEA 4RV8A 4QLLA 2ADAA 1LORA 1E40A 4W7WA 2NXHA 4B2DA 4GX9A 3F2CA 3ABRA 4JTSA 4MAZA 1DWGM 1TA3B 2VUYA 4HNVA 5CSYA 4WGHA 1GYNA 3CYVA 1RA5A 3QZAA 3W22A 3S9ZA 3KBWA 4GVFA 3ITYA 1F6YA 3SBFA 1UOKA 1MUCA 4X0VA 2E77A 4GI9A 3MCMA 4H7ZA 4CD6A 1AJ0A 1XLFA 5EPDA 3M44A 2X42A 3FAWA 1ZFJA 2J9YA 1JDCA 4UIOA 1XD1A 4HA1A 1UYQA 3SCPA 1E72M 1C7TA 1OADA 4LT9A 3L5AA 3ITCA 4NJJA 1GVSA 3FHAA 4PMOA 4JTCA 2BLEA 2VRJA 1K6AA 2OLHA 4LY4A 2WBKA 1W5NA 4O50A 1EGVA 4UQAA 4C6OA 4B91A 2CCRA 1I8JA 3E2RA 4RCXA 2YB1A 3LENA 4OHQA 3E38A 2CZVA 4OOZA 3HG3A 4DUOA 1W17A 2DUAA 4WZHA 3STEA 3VD5A 1CLXA 3AAMA 4TUFA 4J28A 4GI8A 3G1FA 4DZIA 1HJWA 3MHUA 1UC4A 1XLKA 2UV8G 1EBHA 4HTBA 3S2CA 3WD4A 4RUBA 5E0CA 2J7EA 1JI2A 2C91A 2CFFA 3HFYA 4PFMA 3B9OA 4DRSA 3LS9A 1LBMA 3FXGA 4F66A 1R8LA 1P0EA 3CV7A 1QT1A 4XAFA 3IJ7A 4AH7A 2J7GA 2F7FA 1K6WA 1LF1A 3ARQA 2ZX8A 5A69A 1AQHA 1TCDA 4DM2A 3ES8A 1FDYA 4PUJA 3WDHA 1QASA 1M53A 3PJXA 4BK9A 1JZ7A 4MM1A 1KFLA 4F2TA 3MHGA 4FF7A 3K8LA 4LNCA 4EAMA 2RAGA 4EXAA 3QN3A 2Z1KA 1R6WA 4JFTA 2XZ7A 1K9TA 3SRFA 4H1ZA 1EXBA 3TW9A 4R7WA 3A9IA 1V3KA 1VFMA 1P1XA 4I90A 3AS3A 1W9XA 2FQIA 1DYSA 4OT7A 3ATZA 2EPLX 1OCNA 2PLKA 1GVEA 3E9AA 1FWIC 2W66A 4W87A 1R2TA 4Q6XA 1Q4NX 3MP4A 3M47A 5DCEA 5CLWA 4O1FA 1UH2A 3DEQA 2GWNA 1CWYA 4BQ4A 2JGYA 2VKZG 3GDBA 3BGGA 4DUWA 4HSHA 1JDDA 4KWSA 1UPMB 3GKAA 1C9DA 2Q6ZA 3Q58A 3W74A 1Y5VA 4PL2A 4DWSB 5C2XA 3QM3A 4WUIA 2NZLA 2OXNA 3NSMA 4EACA 3EWCA 1EOKA 2J9ZA 3HMCA 4O11A 3VGEA 4OUIA 1AQFA 5AZ0A 2BV9A 4C65A 2DH3A 1P5BA 3V18A 5A6AA 1Q3NA 1DXIA 4AIOA 4PBFA 1US0A 3WNNA 4KETA 3W73A 1M6JA 4IFKB 3WJYA 2Y24A 1XLMA 3PZVA 2Z1SA 4W8LA 1LL7A 4KEMA 3NQAA 3CQ0A 1YNYA 1XDLA 3K46A 4GY7A 3DKLA 3QRHA 4BI7A 3T4WA 1MEWA 4H83A 3WQPA 1JR1A 3QV6A 1PDZA 1B30A 1UR8A 4WF7A 1H61A 2FFCA 4G7EB 3URBA 3SI9A 5JBEA 1N55A 1BLIA 3SSZA 4CGTA 3LXBA 2NX9A 3EGJA 3ECQA 3BSMA 4UB9A 1Q6GA 4O0ZA 3TJXA 2QJNA 3MJYA 1LT8A 2E25A 4PMVA 2OVLA 4ENLA 2JGQA 3LERA 4Q6JA 4M7TA 4XWUA 4I7VA 4A8RA 4YYCA 1IYXA 2J62A 1TPDA 1NQ6A 1DBTA 1UBSA 1W9UA 4Z1DA 2HVNA 4ERIA 4Z0JA 3GC5A 1WBHA 2YW4A 4PCNA 1YDYA 4N6EA 2NLYA 3M5ZA 2G3JA 3EXRA 1JZ5A 1R3TA 4GBUA 4F79A 3T0AA 3BAWA 3POCA 2I9EA 1EJ7L 1TVPA 2XFFA 3GDMA 4DYEA 3RDKA 3ONCA 8TIMA 1KNWA 3TQ0A 4HMDA 3UZWA 3FA3A 3AIVA 1CX9A 1Z6KA 2OT0A 4B3LA 5AC8A 3PG8A 3WLQA 3WNLA 2YA1A 1F3XA 8RUCA 1ISXA 1UUOA 5TIMA 1E1EA 1JCXA 2Z1VA 4KEZA 1BHGA 1O66A 4K37A 3N2BA 4FNUA 3UQNA 2QUNA 3N14A 4MGGA 3LI1A 3K4DA 4XSLA 1S2VA 2ZRWA 2FGBA 3UJFA 3DCPA 2CESA 4X2RA 4S3BA 3W71A 1UA3A 7ENLA 4I9TA 2BMBA 3CAQA 2GJXB 4QDWA 5KZMA 3SW6A 1R9YA 1ZY9A 3NVDA 1US2A 4G1NA 4JAWA 4H4IA 1Z42A 1XLDA 3O15A 3IIOA 2QYGA 2AMXA 3UXKA 3WQOA 4HIBA 1OJXA 1LWHA 2XSBA 5CG0A 3OW1A 1IIHA 4W8BA 1BVWA 2V82A 2Z28A 1GPWA 1US3A 3G0UA 2BVYA 2ZZ6A 4DBSA 4H8NA 3N4EA 3IGSA 3OLDA 2ZKMX 3RG6A 3QJAA 1B2YA 4KEUA 1XGDA 2E0PA 5HMFA 3U48A 2Y7FA 4H6QA 2VVSA 3S9YA 1AW5A 1SFSA 3N04A 2A85A 3IV3A 5C8BB 1OYCA 3ARUA 3MWCA 1V0MA 3NL3A 2QUVA 3UWQA 3RPDA 3WIJA 1Z89A 3TJ4A 3E12A 1H51A 4I5XA 4IUOA 3BE7A 5BU6A 3ARWA 4DO7A 4JY8A 1GHRA 1IIGA 2PF0A 3VIPA 3TJLA 1X98A 1LLOA 1GOXA 5C9XA 4JL1A 5BYWA 3KBJA 3QQWA 2DVUA 5K7JA 3GFXA 3H7VA 5DT5A 2ZE3A 2W63A 4Y9MA 3IAQA 1C91A 3W2UA 3KL5A 4DZHA 1KTNA 1MNZA 1RQEA 1F3TA 1JCNA 1W1A1 4H7VA 2ZFAA 3SY1A 4PBEA 5D30A 4NSBA 3QPEA 5GVJA 1J9YA 1TV5A 3VK5A 3QOKA 3QZEA 4QLJA 5HUOA 1DWIM 5A6JA 6XIAA 1MI3A 3P5ZA 1WXYA 1F3WA 3CUZA 3G3DA 1K4HA 2AL2A 2CLLA 2Z26A 2ATSA 4HKPA 3NVTA 4H9YA 4FLQA 4CNTA 1Y65A 2ZCGA 2VRKA 3BH4A 2Z24A 3N3TA 1UZHA 3NZ1A 4JTAA 2YYTA 1XPGA 4L9YA 1R87A 2BZNA 1J11A 1BF2A 4PUMA 3HA1A 3M0LA 3PPFA 1G94A 4LANA 2E1DA 3XIMA 4TVDA 3M0ZA 4DPPA 3TTYA 3UCCA 1S5NA 3TYCA 2QAFA 2IPWA 1EP3A 1C8QA 4REQA 4YTUA 2OKTA 3D5HA 4DJFC 5C2GA 4CQDA 7PTDA 4U3AA 4IQEA 2VFFA 1R3WA 1W8GA 1PVNA 1KFBA 4QROA 3Q65A 3A21A 2ESCA 4LFYA 4DX3A 1NU5A 2CXGA 3GDKA 5E0FA 3TZFA 2AL1A 3KRBA 1TA3A 1TZZA 3U57A 3C3NA 4QM1A 1WDPA 1XGZA 4NYYA 4UNKA 2E5CA 1A53A 1E6NA 4POCA 1HF6A 4O1EA 3MBFA 3MHFA 3GIPA 2C3ZA 2QPUA 1ITCA 1I2OA 3FAXA 3W37A 1ME7A 2QIIA 1I45A 3OQ8A 4AIUA 3S0CA 1FCUA 1GQIA 4G5DA 4DNMA 4Q4SA 4IMDA 3IIXA 4XBJA 3A3HA 1EDGA 3NOEA 2E09A 2O9RA 2ZICA 2QV5A 3UNDA 5M2FX 1EYEA 5AHIA 4Q33A 1NWRA 5E70A 1DIDA 1PIGA 1Z32X 2NT1A 1JL8A 4MJ4A 5DBUA 2GUYA 5RUBA 1B3ZA 1SZEA 4HYRA 3VM7A 2WANA 1ONXA 3ZSSA 1QWGA 2VOMA 3FVMA 1W8SA 1GT8A 3FW6A 3PWIA 2DZXA 1YPIA 3MCOA 1MDLA 2W5FA 5D03A 2WAGA 4WOQA 3BAIA 2PWVA 3EWWA 3GVRA 2QF8A 3KZSA 1FVPA 3HG5A 2PTDA 2YIHA 2Y5SA 7XIMA 1NOWA 1XX1A 4H9MA 3EPMA 4UFLA 2WHKA 1E9YB 4M6UA 3UZYA 1GVQA 1Z9AA 4PTNA 1OF8A 2PODA 2ZUMA 3M0JA 3PS7A 2NWSA 4UR7A 4W4QA 3W7QA 3MSYA 3VGFA 3P14A 2OZ8A 4W7UA 4Y9OA 1T0OA 4IL0A 4N2YA 4XAPA 1SJBA 4FNTA 2XTKA 4LX4A 4P8VA 1XKJA 3RMEA 5K2ZA 2QXWA 4RXGA 4PUNA 3GXDA 1F07A 1IEWA 3HJZA 4HOXA 3KBVA 1JXJA 1U2YA 1IXOA 4IPJA 3NDZA 3V1PA 1WDQA 1PZ2A 3VCNA 2GL5A 2Y89A 3UXDA 4LWWA 3IIVA 4MJ2A 4DAIA 1JCLA 1DHPA 2OFJA 3M43A 3GTXA 1NFPA 3KVMA 4PGLA 3KOFA 2XIBA 1QO2A 2VXNA 1OFQA 5CSRA 3VNYA 4GGBA 4UC5A 1HZYA 1KRCC 3WQ5A 4NNCA 1MNSA 4KW2A 4D8LA 3WQGA 5CEWA 2NV9A 3THQA 3NQBA 9CGTA 1ZBVA 3E0VA 2PWEA 5FL1A 1R9ZA 4CQ9A 5CJMA 1G9HA 4WDWA 2WCGA 3U2ZA 4KFPA 4KKXA 4KIEA 4FB7A 2FHCA 4ZA0A 2FH6A 4FOKA 4ZBCA 5I5RA 4R85A 4NHVA 3KP1A 3S6DA 3PP7A 4K39A 2DZAA 5LIWX 3TN4A 4TMCA 4EP8C 3TSBA 3IEBA 1S3TC 1HL9A 3NGFA 4DWSA 4JEQA 1BQGA 1XYZA 5D4YA 1GUVA 1X7FA 1ZAHA 2BHYA 2EKGA 2R1MA 4GC4A 4ML9A 2JQXA 3CU2A 3WEMA 3P0WA 3NYZA 3IWPA 1XUUA 2PDBA 1PAMA 3VPLA 3THCA 4P2VA 1AODA 4M56A 1UKPA 4IFKA 3WQ8A 1K8ZA 1RBLA 2J9XA 3AHXA 4B9ZA 5BZAA 2IQ0A 2NX3A 3WCZA 3GLCA 4A8IA 1WBJA 4CNPA 4V27A 4PTVA 1JD7A 3A13A 2ZZ7A 1GYMA 3OBKA 1HJQA 3NL5A 2I17A 2V2HA 5F4XA 3BG5A 4UMCA 4LAUA 3P3BA 1FWTA 1CXEA 4G7EA 1H1YA 4DHGA 3VNJA 3CB8A 4OE7A 1W0MA 5CSUA 2ZX7A 3WBYA 2JEPA 5A2CA 2NQHA 3B9EA 4RX0A 1WZMA 2BGNE 1F6PA 1GOIA 3N73A 3MUY1 2ABAA 4NJHA 5EFDA 4JS3A 1LOLA 1EJRC 1TPH1 5EU9A 4MMWA 3LRMA 1VKFA 4GIYA 4W5UA 1S2AA 3F4NA 4IOTA 2IPJA 3BV4A 3TDFA 3K2GA 1YEYA 3L5MA 3H54A 4LB3A 2FFIA 4MB3A 4J1OA 2D2HA 1H11A 2X0SA 2OSWA 3EX1A 3QKZA 3SUSA 1DOSA 4PH6A 4TVCA 4JFSA 1WUEA 1VEMA 4TV5A 2VC5A 2V8ZA 2GSJA 4O8RA 4W7VA 4C6KA 4KWWA 4UFHA 1PYFA 4DM1A 1KM6A 1KA9F 3CUHA 3PJUA 5C70A 4P8XA 2E5DA 1XC4A 2J27A 4EPKA 4JD4A 4TTGA 2W6RA 2WSRA 2E68A 2QDGA 5BWFA 4B3KA 3UGRA 1MMFA 4X2PA 1GKQA 3WL0A 4Z2KA 4HHLA 1F5ZA 2BGSA 3E2SA 1UP0A 2HISA 3V0TA 3TU9A 7TIMA 3D3FA 3CHDA 4GNVA 2OOFA 5FESA 2PP0A 2A4AA 3EEGA 3V5CA 7A3HA 1R30A 1EZ2A 1TTIA 1HKIA 1G4PA 4DY1A 4FIRA 4AG0A 1EUNA 2DIKA 1JCTA 5FF4A 1TZ9A 1C9WA 2V67A 4B5XA 2GJXA 5EBAA 2HXTA 4J5NA 3S2JA 2WKLA 3TTQA 4GZEA 2PTXA 1DHKA 3QMSA 1GG1A 1RBOB 5C7VA 4YHGA 3GC4A 1XHGA 3HOJA 4AHQA 2C19A 2FGLA 1GQKA 5FA5A 1AG1O 3RXZA 4TX8A 2DW7A 5H8MA 1CNVA 2WMFA 3FGCB 1FCBA 3TTOA 2QJHA 4QAWA 3UD6A 5G4EA 5HAOA 2ZRUA 2PMQA 4HYVA 2VMFA 3QY8A 1F4HA 3GXFA 4DEFA 3M07A 4M29A 1C29A 5LNRA 3ARZA 1B31A 4BKNA 2PDKA 5C7HA 4O10A 5E9XA 3WQVA 4ERGA 5FSEC 2FZ9A 2PDMA 3DGBA 4JHOA 3ZS4A 4GCXA 3N3MA 4X0NA 3WYZA 3B9AA 4CD4A 1DJHA 4DBWA 5KMYA 2NQJA 1UD6A 4Y9NA 1QNRA 1QNVA 1XF0A 1WOAA 3AUJA 5IHSA 3UWYA 2HVMA 1JIBA 3DERA 3QV9A 3W81A 1UPPA 3O0FA 3GE7A 1XCXA 4UTTA 2V3EA 3IJDA 3A3XA 4PSRA 5FF2A 4BCEA 3SY8A 1ELSA 3TQVA 1J93A 3C61A 3C0SA 4NJGA 3KP0A 3R5EA 3ZVIA 2INZA 1G4EA 4NI8A 4E5TA 3F2BA 2DZVA 1TMHA 2E67A 4IJRA 1Y8BA 4PC8A 4L80A 2NSOA 1TG7A 1XBXA 3FA5A 3ARYA 5A2AA 3UA4A 1FBAA 1V02E 2CLFA 4HZMA 4YTQA 5IFTA 1HJXA 1JPIA 4KWVA 1IT0A 5M17A 4GC3A 3UY7A 2OJPA 3GKFA 2BP1A 4DAFA 1XP3A 2HS8A 4NZ3A 2VZVA 3BSHA 3NQEA 1ODZA 1QW9A 2WJZA 4LAMA 1M04A 4GX8A 4BFAA 1JRCA 1SZRA 1B57A 3OHMB 3AU6A 1DWFM 1UIOA 4OGZA 4QJ4B 1SW0A 3NTYA 3OGRA 3RJYA 2V38A 1OX4B 3KX6A 4DPQA 1KD0A 4Z42C 3BW3A 3E2QA 1DIOA 1GOWA 3EWDA 1H7OA 4N4QA 2J74A 2ZBTA 1X97A 1MW0A 4QISA 2NV2A 2HBXA 1S2WA 1KGUA 3BO9A 3UZJA 2VGFA 1XLGA 3ZOAA 4HN8A 1Q6DA 5BWAA 1EL3A 2FVLA 4WK9A 3BLKA 2CERA 1QW7A 1TTPA 1TWDA 2FDMA 1E0TA 1OC6A 4XZWA 5BOEA 1AH4A 2PLJA 3MC5A 4GXWA 4XB3A 4DQWA 3SURA 3NZRA 3NQVA 1B3VA 4R53A 3VGBA 3NXLA 3WLRA 4JIPA 4TMBA 2ZRYA 1HO4A 5EMYA 3DHFA 3AMDA 3P74A 1XDMA 1NY1A 5EY5A 3ARVA 4PTDA 3NO3A 1MVYA 3N29A 4HCLA 1ICPA 3O2LA 4HP5A 2FZ8A 2QT3A 4IIGA 1UQZA 4EWJA 4L9XA 4O1AA 3H26A 1XYFA 1F76A 2ZC1A 2Y7EA 1XLHA 5LA0A 3WLSA 4GGHA 3BAKA 4RE2A 3LX9A 4IMCA 2R1NA 1JZ3A 6REQB 4S3KA 4M81A 1H49A 3KFTA 2HK0A 2IKGA 2HE8A 2ZDSA 2BNJA 2GVLA 3MSRA 1PL9A 2J7CA 3KW3A 4A3RA 4US6A 1KCXA 1EJVC 1V79A 2EPNA 3AMLA 3QHMA 1KGXA 3JRKA 2PU1A 5BMWA 1UWUA 4WSKA 2VFIA 4HPNA 5FAGA 1A5NC 3F1QA 3UYIA 4NZ4A 4LPCA 3EXTA 4J3ZA 3WLTA 3MKCA 1Q6EA 2Z2BA 1BYCA 5CJNA 2R91A 3H6OA 2DZWA 3VZZA 3EAUA 2AQWA 4AD1A 3W1TA 3G1DA 4Q3MA 1J18A 3WF1A 2DZBA 4PRTA 3QHOA 3AIUA 1IT7A 3N15A 3MZNA 4EIVA 1LL6A 3LDVA 4AAJA 3UXLA 1RXOB 3AXMA 1EWEA 3IRSA 3RAOA 1EDTA 4GVIA 3DHUA 1I6NA 1NIUA 1PEZA 1BVZA 1DL3A 4ONVA 2CWNA 3VIOA 1UBPC 5AVHA 3MDUA 5CPLA 4U33A 3RR1A 1DQXA 4DXKA 4BEQA 2PDIA 3ARSA 2D2OA 4NQ1A 3GBDA 3C6CA 2ACUA 3GTNA 3QF0A 1V6UA 2B81A 3GAYA 3V0SA 2B7NA 3L65A 5CAKA 3OEXA 3EDDA 3V0UA 3W82A 1E4IA 2VL4A 1TJ0A 2GGEA 3GQYA 1RZMA 4PCSA 4FX8A 4C60A 4N9EA 1H4PA 3E0IA 3EOOA 3QSRA 2OO6A 3CT7A 1IGWA 1EP2A 2E40A 1YXYA 4US5A 3BC9A 1DJXA 4WX2A 2V6AA 3DC8A 4LRTA 1VYPX 1F6KA 1AD4A 5CZTA 4JEJA 2ONEA 1AL7A 3C5QA 3V5FA 4FK9A 1KLZA 3CUGA 4IZGA 1LRQA 5A6SA 1R38A 3G3MA 3OO2A 3GNNA 3CWOX 1NWTA 5CGQA 1IZKA 4HB7A 4TTUA 1JEZA 1Q65A 2QCHA 5A2BA 1EWDA 2HK1A 1JZ6A 3WLNA 4MJMA 3A4AA 4X22A 1Y0EA 2XFYA 4TVUA 5BRBA 4XZHA 3ZMRA 4MZ1A 1PV8A 1OFBA 4UOZA 4XZBA 3MMUA 3OYXA 5DANA 1BQCA 4W5ZA 4AD4A 1GTEA 1XD0A 1M1BA 3GG8A 1DJWA 1QK0A 1C8VA 4QX4A 2XUCA 1W37A 1W56A 2IKJA 3UZZA 2VZOA 3FEMA 3SO7A 6ALDA 2R82A 1DJZA 1FKWA 2VHLA 1CEOA 2QUTA 4W84A 1KQZA 5D05A 2PLCA 3LTSA 2DZSA 1DORA 1S3HA 1IWPA 1GVRA 4BI6A 4DVOA 3HO8A 4KMQA 4W93A 5GJMA 3WK2A 4JN6A 4Q8WA 2WWCA 3GX9A 5AYIA 2J77A 1B4EA 4AZIA 4ZR8A 4PMDA 2J7BA 5ABFB 3N9RA 2OZ0A 3O6YX 4OUEA 1RR2A 2HEJA 4N42A 4WJ8A 5BW6A 4IGHA 3W85A 1FP9A 3E0FA 4GI4A 2DUZA 5IBXA 1N2VA 3VFCA 3W4RA 4IISA 3M41A 1QBAA 4B15A 2XGBA 3GZAA 2GJPA 3QPYA 5D8ZA 2QCCA 1ZTVA 4CQ8A 1PWMA 1UMYA 4PUWA 4JTIA 3W72A 4WGXA 3P8JA 3CIWA 3OZMA 3M0HA 2P8CA 4B90A 4ZOBA 2PDHA 3QTPA 1JUEA 1D3HA 1MWOA 4DBUA 5MHBA 4PZVA 5A3HA 3QYSA 2D2GA 1E5JA 4AWUA 3TEVA 1ZENA 2POTA 2WSQA 2X09A 3CHEA 1P7TB 1J2WA 4DNHA 3NSXA 3FYOA 3KL3A 1C93A 1F61A 2VZUA 1YDNA 5D9OA 4MDPA 3IRDA 5PTDA 3R8RA 3M5VA 2ABBA 3O9NA 2OOGA 4DIAA 1RK5A 3WF2A 3CBWA 3VYLA 1DIKA 4CEUC 2ZUUA 3W07A 2CEQA 3K5XA 2XG9A 3W7OA 6TIMA 4Y2WA 4XG1A 1I75A 1DWHM 3VIFA 4C6FA 3Q4DA 5FOOA 1SMAA 5BXTA 5JH1A 3R58A 3CQHA 2HCVA 4XX6A 4ZOAA 5AKQA 3WJZA 1QHZA 2I9UA 2FHFA 3WMLA 4FNPA 3GXPA 4HOWA 3I6TA 1QHPA 3BQ6A 3IAPA 2H9AA 1B5TA 1XYMA 4PSPA 3T40A 3O1NA 3W7RA 2GPTA 1ME8A 2Z6IA 1KXVA 3SDOA 4H9ZA 3VNLA 1RVGA 5CZSA 2GFTA 1T96A 3HG2A 3HV8A 4PL1A 1TX2A 1ZBWA 4A3QA 3SUTA 3PZMA 1PX3A 1OFAA 1XM3A 1ZALA 2JKEA 1P6BA 3AQUA 1ODUA 3FXYA 4MF4A 3WEZA 3SADA 2NVDA 4EOUA 1A3XA 2BODX 3P93A 4ZVJA 5FI8A 1X39A 4NG3A 3FYPA 2WBGA 2BX7A 1EZWA 1KFWA 3UVAA 2BSLA 2Q3RA 4DXVA 2QCDB 4CVWA 5AYZA 1FWJC 3ZIZA 2G37A 1UQYA 4UBPC 3GSMA 1BD0A 1CB2A 5KZ6A 2GQ3A 1VP5A 3LNPA 5BRPA 1LT7A 2OGYA 2X1SA 2HROA 1XIHA 3RO6A 3AXKA 4O18A 1VD6A 1ICQA 1E6ZA 3TTSA 2Y8UA 2VZTA 3MSDA 3I7RA 3KOXA 5I2UA 1EGZA 1MW1A 2Y6ZA 3LTYA 1E6QM 4Y90A 4BWLA 2X05A 3GW3A 4HT3A 2C14A 2Y70A 4KPLA 5HWNA 5AY7A 1UC5A 5FJIA 2QGYA 1E4MM 3QTGA 1F8IA 2CBUA 4IQJA 3EWXA 1I60A 4E3TA 4Q32A 4EE9A 1OX4A 3NO5A 3T07A 4ZB2A 2Y61A 1G67A 3UGVA 4FA3A 2QCLA 3VIGA 2TYSA 5EA9A 3A23A 4AWTA 1KO0A 4C91A 3XINA 3DIPA 2J78A 5DCDA 4GY0A 4DXXA 4D72A 2UBPC 1Z7AA 1TWIA 3MB9A 4QS6A 2QCEA 4PCTA 3VNIA 1VBJA 1A50A 4K1GA 3HGJA 1I0DA 3LXCA 3WY1A 2O0TA 1K02A 3JS3A 2I5IA 1DEDA 3R2GA 3G8EA 3JR2A 2F8QA 4MUZA 1LWIA 4DJED 2G4JA 4LU0A 3NNTA 1U5JA 3UW6A 3LN3A 1SW3A 4LVDA 1NF0A 1YHTA 2PSNA 4D6HA 3WH6A 3GXNA 1UKOA 4IIEA 4WKHA 4Z1BA 3U0HA 2IQTA 3UCDA 4GFSA 4RKAA 3SCUA 1MZHA 1XH0A 2YYUA 3A6OA 2ATMA 4H9TA 1UP2A 2RKXA 1TIMA 4C7DA 5KZDA 1LP6A 5G1MA 4PEKA 3GU2A 1IR2A 3T7VA 2QVNA 2B31A 2NSXA 4A21A 6REQA 3O06A 4DF1A 2HE5A 1C92A 2I5QA 3UF9A 3PBUA 1ITXA 3RO8A 1N82A 3G8RA 4Q8MA 3NUKA 2G4FA 4LS2A 3CIVA 2G8ZA 3NEHA 3FOKA 4MWAD 3PB0A 4M0XA 4KBXA 3IUHA 1L8PA 1V3JA 3N17A 4GQRA 1L2QA 5B7YA 3CV1A 1TYGA 1QTWA 4DO5A 4R9OA 4JXCA 4O53A 1OYBA 1A3HA 2XH0A 1NWSA 5GJPA 2PWHA 2J7HA 2ZX6A 3KWXA 2WVUA 3R79A 4W88A 3K13A 4S23A 3GVVA 5FJRA 4G7FA 4Z08A 3DFPA 2CLHA 4XZIA 1HXJA 3MKKA 3FSTA 3RR4A 4M51A 5HNTA 1WX0A 5GNXA 4TXEA 3W53A 3B9DA 3L66A 5H6HA 1XLCA 3NIYA 4ACZA 1GQNA 1QPQA 1OY0A 4WLCA 3KCJA 3GO2A 3G2GA 3WQWA 2ISDA 1YX1A 1EFZA 2HV5A 2YDRA 4GH1A 5A6BA 2X1IA 3O0KA 2FTWA 3EEZA 1A3WA 5LA1A 4IP5A 2CZEA 1P48A 1KKRA 2WNWA 2CU0A 5LIXX 1KBBA 3VC5A 2ON3A 3RM4A 3O63A 4GA8A 4MLJA 4MKNA 3KS5A 4CKQA 3IACA 3T81A 4JYFA 2Z25A 4D6IA 1SFLA 2WNQA 3RX2A 1VHNA 1KR1A 5M1TA 2C8NA 4YWIA 1T5AA 5CG7A 5JQ9A 4KIRA 1P0BA 2DT2A 3Q37A 2ZRXA 3LHTA 4QSFA 2FPYA 4F0SA 3AROA 3U4AA 4P8WA 3U3HA 1IEXA 3W83A 3O6DA 4K7YA 4C6DA 3LA4A 2EHHA 2OPJA 3DKJA 3MPGA 1SSDA 3DG6A 5I7GA 1RCOB 1KV5A 1K9EA 1RCXB 5DEZA 4KRUA 5D2WA 2GDVA 4UFMA 1SO3A 3THAA 3WH9A 1M7PA 2J6XA 2OQLA 2H8ZA 3W2NA 3COTA 4ROPA 4CQAA 4RW3A 5DF0A 3TH6A 1XC6A 1X6LA 3U7VA 1JZ2A 1W3LA 2A7PA 2EEXA 2DT1A 4V1YA 1V0NA 1CXFA 1TPB1 2XVGA 4W85A 3TXZA 2FHBA 3IJ6A 1OK6A 5D38A 2FPVA 3EKZA 4AZBA 5ABFA 5LA2A 3DHPA 2GVYA 3PZGA 4GH3A 4ORIA 4DELA 1KM5A 2A5HA 4CNOA 7ODCA 1ICSA 1J5TA 1E6RA 3EKLA 1O5KA 5A5WA 3BLEA 4LYKA 5LXEA 2OLAA 4D6JA 1WA3A 3PG9A 1VFFA 2OCZA 3OVPA 5DMMA 3TSDA 2I7GA 1VIZA 2VVNA 4FZIA 2ZZ4A 3URAA 2GQ9A 4H41A 4IM4A 2ZTJA 5CC7A 4E6MA 3W27A 5T26A 1DV7A 3W76A 2V2CA 2XM2A 3HPXA 3QQ1A 3B4YA 4JIRA 1WE5A 4C1NB 4F2BA 2JFEX 2RUSA 3THDA 4RXFA 1H0IA 4KF1A 3CAWA 4Q4PA 2FVMA 1LTDA 1NM9A 1RHCA 3TFXA 2W9MA 3TFCA 1NTHA 2PDQA 2AQVA 2DZTA 1U1JA 4A8LA 1GJWA 3GG1A 3GNRA 4P7LA 3S42A 2QEZA 5FJJA 4GHRA 4M6QA 2YFNA 3C0JA 3LQLA 1GVFA 1ONRA 3RCNA 1M3UA 4M24A 1B90A 1I1WA 1XGEA 1KXQA 1W54A 3SIZA 1BYAA 2PU0A 4AX6A 1WZKA 3BPWA 3Q2DA 4MLRA 3ITGA 3LPFA 5BXPA 8A3HA 3MU7A 3WX7A 4Q8QA 2BY2A 4LQ1A 1X1OA 1HX0A 3RLHA 2CC0A 1TE1A 2MANA 1XIBA 4XVDA 1OCQA 1H3GA 3GK0A 3UJSA 1BG4A 4IP7A 4JNYA 2GJLA 2EG6A 4L9ZA 4WKAA 4JN7A 1QNQA 1MQPA 4NILA 3VIMA 5CJ5A 4HN4A 3G1XA 3MO7A 4AYGA 4GJIA 3HF3A 4G8TA 1E4NA 4AD3A 2XIOA 4EK7A 4H9XA 3TSMA 3NYDA 4MSSA 3GBEA 4EKJA 5AC6A 1N8IA 1S1RA 1OIFA 3KUMA 4CD7A 2RH9A 1AD1A 1C8XA 3P7YA 4DLMA 2CLKA 2J4GA 4QR6A 2EPMX 5HMSA 3R0DA 4XK2A 2QCDA 1XDJA 2AQOA 3GDRA 4PMZA 1JUBA 1KRAC 4J35A 1FWAC 2ZXQA 3GH5A 1TPC1 4UMBA 4A4AA 4PYSA 2J13A 4ZO9A 2ZWYA 5AYBA 4IIHA 2VCBA 1BKSA 2YL5A 3WLJA 1LBLA 3MP5A 4H6EA 1B54A 2GGIA 3LBCA 2G0WA 1VEPA 5D2XA 1XL9A 3W7LA 1GOQA 1RA0A 4FOJA 2FIQA 1TJ1A 4EF9A 3R0UA 2QCFA 4S3AA 4JX5A 2I5GA 2AKMA 4GBDA 1HL8A 4PULA 2VI0A 1VS1A 4H9UA 2AMGA 4U4MA 3M7SA 1HW6A 5CC3A 3S1GA 4LEFA 1BYDA 2PDXA 2CITA 5DX7A 4GLEA 2ZA1A 4XAGA 1MXGA 3WUBA 3VOJA 1UUQA 4ZO8A 3ZVHB 5HQMA 1LG1A 1A49A 2H8XA 4K8GA 2VOTA 1SW7A 4JY9A 3I3DA 2UWFA 4K38A 1FDZA 2V5KA 1JZ4A 1YE6A 5C6MA 5FF0A 3TYDA 3VNMA 2VJXA 2VCAA 5EMMA 2ASHA 1RLDA 4FS9A 1QOXA 5ECUA 3KLLA 4F0KA 4O12A 1MSSA 2GOKA 2OELA 3BJTA 4R33A 3UG3A 5DMLA 5A6TC 1IV8A 4GO9A 5LXXA 1JNDA 1OGSA 3FDGA 4DO6A 3G1SA 1NAL1 4AZ5A 7CGTA 4D1JA 1ML1A 3D3AA 4Z2IA 3GG7A 2PURA 2VX4A 5AZ1A 4CCCA 3ARPA 1RD5A 2WVVB 1XJBA 5F4WA 3VVGA 1TJRA 3AIEA 4HNOA 2QW5A 2QPXA 3NPUA 3SCTA 5I3HA 2J25A 4QG9A 5LIUX 4CQBA 1AH0A 1WKDA 4JIIX 4IFOA 2C71A 1Q7QA 1TQJA 3WBXA 4J4KA 1C3FA 3NL2A 1FWFC 1W32A 4UMAA 4DJEC 3FHQA 1GG0A 4OBSA 1JGIA 3S3GA 2GQAA 4IX2A 2OU4A 1DTNA 1LQAA 4JKMA 1QFEA 3WZ0E 2QMKA 1GONA 1W1ZA 2YB4A 1N7KA 3EPOA 5JIPA 1LOSA 2WPGA 1D3GA 1VF8A 3IGUA 2GVJA 5AHEA 4A05A 3SJNA 3R94A 4NT0A 1UUMA 2AOSA 2W3ZA 1K8YA 3H4GA 4GVGA 5D32A 1KBJA 2Z1XA 3EB4A 4GZ7A 2Y88A 1H7PA 1VFUA 2XHYA 3W1LA 4RV3A 5I3JA 3S4TA 3WNOA 3BICA 5JU6A 1E9IA 1WKYA 3AIRA 3KTXA 3ITLA 3FV9A 3LHZA 4JFVA 1MXSA 4Q4MA 1CI1A 5B80A 1UOZA 3RGTA 4MWAC 3EX4A 2ACRA 3L4UA 4NKCA 4DI8A 1IR1A 2OGJA 1ZCCA 1B4KA 4J2MA 3ZJ8A 3ZJ7A 4Q4QA 2WPBA 1CDGA 2NV1A 3QV8A 4YLWA 1Q7ZA 2VNCA 4YVXA 4YPJA 4LUYA 4C6CA 4JTDA 1SO4A 2VX5A 1EJXC 4OV4A 5BOFA 4UFKA 4AEEA 3S2NA 3UZXA 1BVNP 1BEUA 3AMCA 3CUXA 3RX3A 4PMXA 3SCQA 1FWRA 4DJDD 4AB4A 3VX1A 4XD4A 1IEIA 4KWUA 2FTYA 2GDUA 3TXVA 1J01A 3TWBA 3RLVA 2ZOXA 1DE5A 1ZS2A 2Z4GA 1H7WA 1V3LA 2Z7GA 4GQ0A 3STCA 3EOEA 3CL6A 1LL4A 5JIWA 3F5KA 3V3WA 2A79A 4LVFA 1W5MA 1NWUA 1W9PA 3UP8A 1SJAA 1PKLA 3SN1A 2D1ZA 4R34A 1CT5A 2YLAA 3EMQA 3BOFA 3RPMA 1PXGA 1LRTA 3GVQA 1J4EA 1OT2A 5TQLA 1XIJA 3W7EA 2NUXA 2XWEA 1UCWA 4K2SA 3SY5A 1FH9A 4RZ6A 5IHRA 3KLKA 3BUVA 4AF0B 2Y2WA 1OHLA 5E1QA 3DFSA 3W87A 4UFJA 2FZBA 4Z0SA 3R25A 3B0XA 2UY3A 1VR6A 4X61A 2BY3A 1QDSA 2Y4SA 1L6FA 3PUEA 4L1XA 1EQPA 3S1XA 3G1RA 3SN4A 3PULA 3DU0A 1OK4A 1ZP3A 3BCJA 5I3KA 3LV5A 3NGJA 3C4U