4HK6A

Crystal structure of cordyceps militaris idcase in complex with 5-nitro-uracil
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
369
structure length
369
Chain Sequence
PVVVDIHTHMYPPSYIAMLEKRQTIPLVRTFPQADEPRLILLSSELAALDAALADPAAKLPGRPLSTHFASLAQKMHFMDTNGIRVSVISLANPWFDFLAPDEAPGIADAVNAEFSDMCAQHVGRLFFFAALPLSAPVDAVKASIERVKNLKYCRGIILGTSGLGKGLDDPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGPRSEEYGHVLPLALGFPMETTIAVARMYMAGVFDHVRNLQMLLAHSGGTLPFLAGRIESCIVHDGHLVKTGKVPKDRRTIWTVLKEQIYLDAVIYSEVGLQAAIASSGADRLMFGTDHPFFPPIEEDVQGPWDSSRLNAQAVIKAVGEGSSDAAAVMGLNAVRVLSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-5-carboxylate decarboxylase
publication title Crystal structures of isoorotate decarboxylases reveal a novel catalytic mechanism of 5-carboxyl-uracil decarboxylation and shed light on the search for DNA decarboxylase.
pubmed doi rcsb
source organism Cordyceps militaris
molecule tags Lyase
total genus 133
structure length 369
sequence length 369
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.66: Uracil-5-carboxylate decarboxylase.
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4hk6A00
3B0XA 3UR5A 4HK7A 1RA0A 4G2DA 4GOAA 4C60A 1A5NC 1RA5A 2FVKA 4B3ZA 2DVUA 4IGMA 3IACA 1YMYA 2QVNA 2VM8A 3OJGA 2E1WA 3LSBA 2Z4GA 2RAGA 4IFKA 1FWBC 2VC7A 3SFWA 4LALA 4OFCA 4LCSA 3GTIA 1QXLA 1A4LA 4HK6A 4DI9A 3A3XA 1WXYA 3URAA 3ITCA 4C6KA 3S4TA 2YZ5A 1VFLA 3LS9A 4GBDA 4CEUC 4C6DA 4WGXA 4XD6A 4DLMA 3LU2A 3DUGA 3TN6A 4I6KA 3EWCA 3RN6A 2R1LA 3ORWA 4PBFA 3S2MA 5AKQA 4C6FA 3GG7A 3E0LA 4LANA 1R9ZA 1PO9A 3GIQA 1RJPA 4IFRA 4WVXA 3LNPA 4EP8C 1XGEA 4HA0A 3WZ0E 1A5KC 3UR2A 1UIPA 4Z42C 3IV8A 2G3FA 4J2MA 4C5ZA 4ICMA 2D2GA 2BB0A 1P6BA 3F2BA 3F4DA 4H9UA 4KETA 2EG6A 4WHBA 3E74A 4KESA 3GTFA 4AC7C 2PLMA 4GK8A 4C6IA 4DZHA 1ONXA 3EWDA 2AQOA 1PB0A 3GTXA 3GIPA 3GU1A 4DIAA 3T81A 1GKQA 1KRBC 1RK5A 3WYZA 4H9XA 2PUZA 1EZ2A 2GZXA 2Q01A 3HTWA 3A4JA 4LAOA 3PNUA 3BE7A 1NFGA 1RJRA 1FWIC 3OQEA 4DZIA 4ZSTA 1P1MA 1FWEC 2XIOA 3O0FA 2Z2BA 2R1MA 1NDWA 4QS6A 2OOFA 1YIXA 4QRNA 1V4YA 3MVIA 3ID7A 3TN3A 4GZ7A 3S2LA 2FFIA 4C6PA 2HBXA 3OU8A 1ADDA 3DC8A 3MJMA 4EPDC 4LCRA 4C5YA 1W1IE 2YB1A 1FWDC 3GTHA 4KEVA 3HPAA 2AMXA 2Z29A 2VR2A 1FWFC 2FTYA 4GYFA 3LY0A 3QGKC 4I6VA 1M68A 1NDVA 1UIOA 4IH3A 4B91A 1NDYA 4ERGA 1FKXA 4XAGA 3FDKA 4EPEC 1V79A 2WJFA 4CQCA 4LFYA 2F6KA 4KEUA 1J6OA 4R7WA 2FTWA 2GWNA 3E0FA 4B92A 2AQVA 4KF1A 3LSCA 5FSDC 4QROA 1ONWA 4BY3A 1YBQA 3QY7A 1FWCC 2ZC1A 1HZYA 3MKVA 3PBMA 1XRTA 3O7UA 1KRCC 2WJEA 3GUWA 1EJUC 3CAKA 2Z24A 4PE8A 4J35A 1EJSC 2QT3A 1EYWA 3K4WA 4H01A 3OOQA 4QS5A 4V1YA 1EF2A 3TN5A 4F0LA 3E3HA 1O12A 4GY7A 5HMEA 4G7EA 1XRFA 2A3LA 4DI8A 3LGGA 1KRAC 3URQA 2CZVA 1KCXA 3FEQA 2DVTA 2HBVA 3B0YA 3NQBA 4JOMA 4F0RA 2BGNE 4CNUA 4PBEA 2OGJA 4BJHA 3G77A 3T1GA 4XAFA 4PCPA 4GY1A 4PCNA 1A5OC 4C6BA 2PGFA 2VC5A 3MVTA 3RHGA 3T8LA 4RDYA 1ITUA 1EJWC 3K2GA 4CNSA 2HPMA 4TQTA 3GU2A 2OODA 2R1PA 4IQJA 4H00A 3MDUA 3PAOA 4INFA 3IRSA 4DLFA 2D2JA 4UB9A 3QY8A 2I5GA 4H9VA 1PTAA 1FWHC 3OVGA 4H9YA 4IG2A 4CQBA 3NEHA 4DYKA 2ADAA 2R1KA 2O4MA 2IMRA 1ITQA 1V51A 4LAKA 5E5CA 1RK6A 2HPIA 4R85A 1A4MA 4RE0A 1M65A 3WMLA 5A6TC 5HMDA 1POJA 2OQLA 1YNYA 4GX9A 5LXXA 4EPKA 4C6JA 4XAZA 3CS2A 2P50A 4KEZA 3MTWA 1R9YA 1A5MC 2KAUC 3TNBA 4XD5A 3MDWA 1IE7C 4B90A 1EJTC 4RDZA 1EJVC 2R1NA 3A3WA 1S3TC 3JZEA 1O5RA 3EGJA 4C6CA 3UF9A 2HNHA 2Z25A 4MUPA 3LA4A 1V7AA 2P53A 4NP7A 1UMLA 1GKRA 4V1XA 3URBA 2WJDA 3UBPC 1NDZA 1XWYA 2Q09A 2EG8A 2Z00A 1WXZA 3LGDA 5HMFA 2Z26A 4C6LA 2GOKA 3RCMA 3AUOA 2UBPC 4KIRA 3QGAC 2DVXA 5FSEC 1E9YB 4GX8A 2HQAA 3OODA 2D2HA 2E25A 4NG3A 3NURA 3B40A 4HJWA 3IGHX 4CQDA 2GWGA 4AQLA 1EJXC 2YXOA 2Z7GA 4IFKB 1FWAC 1RAKA 4P5UA 2FVMA 4C65A 4M51A 4L9XA 4J5NA 3F2DA 2PGRA 1YBQB 3ICJA 4CEXC 3RYSA 3GU9A 3E2VA 4XAYA 1BF6A 3AU2A 3GRIA 4NI8A 1PSCA 4IGNA 4IF2A 1R9XA 2W9MA 2Z27A 4HK5A 4BKNA 4H9TA 2ICSA 1GKPA 2Y1HA 1YRRA 4RDWA 4QTGA 2QPXA 3FDGA 3CJPA 3MSRA 4H9MA 2QS8A 2I9UA 4G7EB 4GY0A 2PAJA 4LAMA 1K70A 4LEFA 4GXWA 3E38A 4CNTA 4ERIA 2ANUA 1E9ZB 3AU6A 3F4CA 1M7JA 4QSFA 2VHLA 1J6PA 4ERAA 1FWGC 4DNMA 1K1DA 3KM8A 1POKA 1UBPC 1I0BA 3QY6A 3SO7A 3UPMA 3URNA 4C6MA 2EG7A 4H9ZA 3PNZA 4DO7A 4C6QA 2OB3A 2VUNA 4LCQA 1EJRC 1ZZMA 3V7PA 1J79A 1K6WA 2YB4A 2UZ9A 4YIWA 2Z2AA 2O4QA 3C86A 3HM7A 3IPWA 4RDVA 4R88A 4UBPC 3S2NA 1V77A 4EPBC 1RJQA 4LH8A 3F2CA 5CH9A 3R0DA 4C6EA 4IFOA 3TN4A 1J5SA 1I0DA 4IG2B 3DCPA 1KRMA 3MPGA 4L6DA 4ZSUA 1DPMA 4D8LA 2GSEA 3S2JA 1FKWA 1A5LC 4C6OA 3ISIX 1JGMA 2WM1A 4E3TA 1QW7A 4F0SA 5G4HC 3IJ6A 1FWJC 4XD3A 4RZBA 3PANA 3K5XA 4KQNA 4GC3A 4C6NA 4XD4A 3IARA 4KERA 2Z28A 1P6CA 3N2CA 3D6NA
chains in the Genus database with same CATH superfamily
4KPLA 2PGEA 4GE8A 3RM9A 3CV2A 1A5NC 3PWIA 1XFBA 3N1AA 1Y5XA 2VRKA 3AYTA 5DX7A 2QYGA 3OJGA 3GXIA 1L6YA 2X40A 5HAOA 1MW1A 1CI1A 4XX6A 3Q58A 4JTCA 1HXJA 1TQXA 2OT0A 3MCMA 4O1DA 1R6WA 2QQ6A 4R9OA 1WXYA 1BG9A 3STEA 4AXNA 4CEUC 4JNMA 1TR1A 4HA4A 2AGKA 3QV8A 1DIEA 1T8QA 4ZR8A 1A50A 1LM1A 4QIUA 5HQMA 4GYPC 4QG9A 2EPKX 1RJPA 1LBLA 1IYXA 1OF6A 1UUMA 3EX4A 1D3CA 2WKJA 1GTEA 1TIWA 4RW3A 4RXGA 1RCQA 3APTA 2VOMA 1DV7A 4AZCA 1P6BA 2UY5A 3S8HA 1AODA 1DTNA 3DIPA 1TPDA 3PJXA 1Q6FA 4TX8A 3POHA 4NZ3A 3ARZA 4JCMA 1QVBA 1OBAA 3SURA 4AMAA 1DTUA 4CQ9A 2NVAA 4QCEA 4D2JA 1NH6A 4F48A 4ADTA 4TU1A 2QJIA 3HTWA 2OKTA 3A4JA 5HWMA 3GE7A 3W1RA 3BE7A 3W25A 2A6LA 3EZ4A 4Q7IA 3UESA 3WDQA 3GH5A 4C6PA 4O1EA 1LBFA 5CG7A 1KFEA 1IWBA 1F76A 4GUHA 1XIBA 3ZLHA 4D6GA 4GI9A 2RDXA 3LCLA 1J9YA 1XBZA 5M3WA 4L7ZA 1MXGA 3RMJA 3KP0A 3LUTA 3WLJA 4JTFA 1OVDA 3TEVA 1UUQA 5T91A 4NZFA 5TAOA 2RDUA 5FJTA 1BTCA 1TPB1 1CXKA 4UOJA 3W6LA 4Y9NA 3PJUA 4Q4PA 5KZDA 3WLTA 4E2VA 5EPDA 3N9SA 5A3HA 3UPWA 4FX6M 1S2TA 3GYCA 4OQVA 1EIXA 3TONA 4ATDA 3W27A 3H2FA 2VYOA 4YLWA 3O7UA 7TIMA 3MS8A 1GJPA 4QLKA 1GEHA 1PDYA 1EJUC 3I7SA 4UR9A 2YW3A 3W0KA 2PI6A 3AXHA 2HXTA 4KMQA 4QX4A 5I2UA 4XKMA 5EBUA 3W6MA 5AZ1A 3GD6A 4FLOA 3TJXA 1M7XA 3WX7A 4H8UA 2RKXA 3AICA 4DUVA 3GNRA 3KZSA 2RHGA 2WJZA 4IMFA 1JPIA 3TC6A 2DT1A 4FALA 1UB3A 4FOUA 4YN5A 4Q6JA 3VD7A 4DWSC 1KXQA 1PTAA 1PS9A 2GVGA 3I3EA 4JZ5A 5AHIA 3GDBA 2I9EA 4CQAA 2GJPA 4N2YA 4AZCB 1US3A 4M7TA 1TYGA 1EEPA 3L4YA 4Q8NA 3W2UA 2IMRA 1YW1A 3ITOA 1F3TA 2V81A 3UNTA 4P7NA 3OVRA 2BFGA 5E9AA 3DYMA 3FXYA 1OZQA 1W56A 3A6OA 1TA3A 2E8ZA 3BW2A 3O6YX 2VGBA 3IGSA 2NVDA 3ITVA 2UY2A 2Y0FA 3GWQA 1FP9A 2CLOA 3S5ZA 3MDWA 1GT8A 1BXNA 4OZOA 4JTAA 3U9IA 3C2FA 1O5RA 1I2OA 4C6CA 1F3EA 1WAWA 5DBUA 3KCOA 5EMYA 2QDEA 1KWKA 4YCOA 3MMTA 3ZM8A 1CGXA 3E2QA 4ZQCA 4DUOA 1LOSA 2OZ0A 2FGLA 5CAHA 1L9WA 4GPNA 4ADSA 2FZDA 2C14A 4DNHA 2ZXAA 1WNOA 1KTNA 2QDHA 4C6LA 5XINA 4OOUA 3NPUA 3GG8A 3C2RA 2G8ZA 4AX7A 1W8SA 5H6HA 4AZBA 3BCDA 5AFDA 1V6XA 4LVFA 4K8HA 4IFKB 3OEXA 5LIXX 4HJFA 4QGCA 3IGUA 3LZ3A 1H5VA 1EL3A 1CLVA 3K1DA 3QH2A 4GVFA 5AYBA 2P1FA 3GU9A 2NWRA 2POZA 1Q6RA 1EJ7L 3FN9A 1ZBVA 1X8FA 3KTCA 2VCBA 4IF2A 4XG1A 3N14A 4BZYA 3BAYA 1JCLA 4GCXA 3TFCA 1KR1A 4TX9A 3VKAA 1QR7A 4PMZA 2Z1SA 5FACA 4M19A 4LAMA 3G0SA 2PP3A 3AHXA 2ANUA 1E9ZB 2BNJA 4QDMA 3UXKA 4AG0A 1QI2A 1RUSA 4OBSA 2DSVA 3AC0A 4R7OA 1NARA 1XG3A 3FLUA 3R25A 3UZWA 4OUIA 2O4QA 2CLMA 3NO3A 4WX2A 5LNUA 4LS0A 4KFNA 3CEPA 1Y5VA 5LHEA 1TZ7A 1W3NA 3E12A 3N3MA 2XVKA 4M29A 4LRSA 1E6ZA 4IMCA 3CZLA 4HNNA 2W91A 4L6DA 1DORA 1VJZA 3M9YA 3VM7A 4D8LA 1VF8A 4C6OA 3PN8A 4WJXA 2FJKA 3ANUA 4NAFA 1CIUA 1NP0A 1VKFA 1J10A 2X30A 3KOWA 4HSOA 4YJ5A 5IBXA 4I5XA 2GQ8A 1GVYA 2PDCA 4GC3A 4I5RA 2IPGA 4MMWA 1PTGA 1UKSA 2VR4A 3TIMA 2CERA 4YTTA 4YTSA 2DVUA 2GGIA 4D8ZA 3USBA 3LERA 1YMYA 3PHAA 4DVOA 1G01A 1MW2A 4B5VA 1FWNA 2PDJA 2XISA 5AYIA 4I8YA 1WPCA 3PTDA 3T4WA 2DW6A 2E4TA 2HZGA 4FIRA 3FYPA 4DPPA 3PFMA 5BXSA 2XSXA 1VLIA 4OT7A 3WLPA 1ZSXA 4CNNA 3TCEA 4LYKA 1O5XA 1W1B1 3QR3A 3UG4A 5KZEA 4KCUA 3BO9A 4IFRA 4WVXA 4NZJA 3H70A 3ALFA 4FNRA 2VGGA 4GQGA 2VC9A 4ZB2A 3WH8A 3NWRA 4LSBA 1UROA 4H9UA 4GABA 2Y61A 4IXHA 4Z0SA 2A1YA 4XBJA 4GYJA 3EDFA 3W7CA 5JUVA 4IL2A 2YA0A 3MUIA 1PBGA 3G2GA 4AYGA 2XIMA 4ML9A 4QLJA 3MUAA 3W6YA 2QJHA 2J9XA 2O56A 1Z48A 3AZRA 3LBOA 3CUXA 1W5OA 2XIOA 1RPKA 2OVLA 3WQCA 3CPGA 3FV9A 4QRNA 1S39A 3UZXA 3LQLA 4GGBA 3VDHA 1KM1A 4XBSA 3TKFA 3ABQA 1E0VA 7PTDA 2XHYA 3M44A 3KOFA 3VTRA 1RH9A 2WVUA 2VR2A 3PG8A 1FP8A 1MNZA 1O7AA 2OOGA 4K39A 1KM6A 1OY0A 3ARPA 1AMYA 1U1HA 3TYAA 2DGAA 4FMVA 4ATWA 1JDFA 3E02A 2A85A 4WSKA 4PRWA 3MBDA 1U5JA 3T42A 4OU1A 3C8NA 1Q6DA 1L8NA 3P5YA 5HR6A 3CH0A 3CWNA 3H2NA 1J6OA 2QCFA 1JR1A 4MPKA 3SJ3A 3EPOA 1GWJA 1AUSL 3B97A 4B92A 4JIRA 1P5BA 2YA2A 5A8PA 3GR8A 3SUVA 2ZC1A 1E0UA 3REQB 3HMCA 1TREA 2I14A 1I8JA 1TUFA 1T0OA 3GHSA 1HJWA 2XTKA 1B3VA 2FZNA 2OX4A 3AZTA 1NU5A 2QT3A 2JIEA 1S2WA 3LTSA 4Y9OA 1G5AA 4XTDA 3JS3A 4OV4A 1B57A 3GNNA 1B3YA 4TUFA 3GX9A 1NF7A 3UXDA 1MQQA 1Z44A 1DOSA 1L6SA 3POCA 4R3UA 4IIDA 2VX7A 4H6EA 4NXSA 2DT3A 1SSGA 3PJWA 2AL1A 2CBUA 1IXQA 1DIOA 1CXEA 1E6RA 1MXDA 3GW3A 1JGIA 1OFDA 2J79A 2QJJA 3P84A 1SYTA 4EF9A 5BOOA 3QBUA 1JZ7A 1KLZA 4DYEA 2I57A 2R1KA 3C2EA 4D1IA 1JYVA 3SCUA 1FDYA 2WC3A 3QTPA 2PDFA 1ZBWA 1ECEA 4WK9A 1C8XA 1NTHA 5LXXA 3I6RA 5HATA 1OZMA 1QHOA 5G1YA 3M0JA 3N25A 3TTSA 1FTXA 3GH4A 4TVCA 3ZS4A 4CNPA 2ZRXA 1IT7A 2HK0A 3R12A 1V3IA 2VRJA 1X6NA 3WUGA 2FHBA 4A8LA 4W5ZA 4BF7A 4DQWA 2Q02A 4K36A 4Q4SA 3FVMA 4PMJA 3VDBA 3L4UA 5FSEC 3MWAA 1US2A 3BMVA 2DZSA 4O11A 1RP9A 3CL7A 1KM0A 1JFHA 4HJWA 2WXDM 2QUVA 1TTQA 1Z41A 2ESCA 3M0MA 1W5QA 4HMNA 4PYSA 4L6HA 1V02E 5CPSA 1Q5MA 3NFUA 5XIAA 1VR6A 1W37A 3QW3A 2IPWA 2ZRZA 5E93A 1BF6A 1QHZA 1R38A 4IQLA 5DO8A 4HK5A 4ROPA 3I7RA 2QCNA 1ZS2A 1GKPA 2OT1A 1W54A 3ANVA 3CAWA 2QPXA 4QG8A 1KB3A 4LUJA 1W9BM 1QFEA 3CIWA 3BLFA 4P7LA 3MW7A 2YX0A 3UWQA 1PE1A 3HV8A 4ERAA 1GQLA 3KM8A 1GK8A 1KR0A 3URNA 5L6UA 4HB7A 5BRPA 4JQAA 3TLQA 2DSUA 3RGTA 9XIMA 3W2NA 3HPFA 2BG5A 3S2NA 2YCIX 1G7UA 3ZR6A 3VDAA 1QPOA 5G1MA 4Z2GA 2REQA 1YPFA 3NO5A 4GVGA 1RBLA 2PS2A 2FIQA 2PE4A 5G4EA 4WKHA 2DZUA 3VOJA 1Q4NX 3GNDA 2AQWA 3VZYA 3WLOA 2GUUA 3LPPA 1D7FA 2YDQA 1KKOA 1TE1A 1IEVA 1F07A 1WDPA 2RDWA 4PTXA 4NL1A 1A0CA 3RFAA 4ACZA 1TRIA 1OD8A 4DN1A 2PD5A 4HT3A 2DQXA 1PTDA 1TV2A 4G7FA 3WNNA 4AWEA 3EKGA 2ISSA 1WQ5A 3SRFA 3OIXA 4JTHA 3PZQA 3O06A 1OGBA 3P67A 4YPJA 1GG0A 4E6MA 1FWBC 2PDPA 2PRMA 2PTWA 2FVLA 2PC4A 3L0GA 4DAFA 2WMGA 1WDWA 2ZZ6A 2WZHA 2DU2A 3S0CA 1ZP4A 1BSLA 1KFBA 3LU2A 1HX0A 4DJFD 2INZA 3EDKA 2CHRA 2RGLA 4G1NA 3ZSTA 4WDTA 3G1XA 3SJNA 3OVQA 3OG2A 2R94A 2FDMA 1T99A 3G5EA 1TV7A 4O50A 5M2FX 2JK2A 3NDYA 1EBGA 3QLDA 3VD4A 1Z6KA 3WH5A 2DFAA 5D30A 1TVLA 1XLLA 4IQEA 2XFWA 1RCXB 3WLQA 4IICA 3KTSA 2ZQ0A 2HXUA 1UP2A 5CKSA 2UV8G 1RJRA 1UR0A 4HIBA 3RR4A 1NWTA 1FWEC 2OYLA 3ITLA 3O0FA 3DFTA 3CQ0A 3FJ4A 3RAOA 4KRUA 1HL8A 4ACYA 4DBSA 3BCFA 3LYEA 4MDPA 3QSTA 3N4AA 5ABGA 3GC4A 5JH1A 1C29A 4J3SA 4JCLA 4TVDA 2O55A 4Q32A 4A22A 2X0YA 1UH2A 1Q6QA 1XF0A 3A4XA 5F4WA 3LY0A 1RSCA 2ZZ2A 4O4WA 2BHYA 2YLLA 3QMTA 4Q4KA 3WQVA 4LC6A 4WSJA 5KINA 2WW5A 1HKWA 4AD0A 4CNOA 2X09A 6ENLA 5CC6A 1FFRA 2WJFA 4DBWA 2CXGA 1AQMA 4FNUA 2A79A 4Q7NA 1UD4A 1LYXA 3AXKA 2FTWA 4UQAA 1IHIA 4QROA 4BY3A 4JS3A 4M82A 6CGTA 2HE5A 4ACZB 4B5NA 3V0SA 2ZWYA 2G50A 3VK5A 4J4KA 1A3XA 3RLHA 1M6JA 2DZVA 1KBJA 1W2PA 2V3GA 3TN5A 5CSYA 5AC8A 2IKGA 2AMGA 1KFCA 2NT0A 2A7PA 3B8TA 3W2KA 1QNVA 1KRAC 3UVAA 1M9HA 3EOSA 1AJ2A 2DVTA 2WMJA 3HGJA 4MLRA 1WDSA 3BLLA 3OGVA 5DELA 3PZMA 3VCNA 1BPLB 4V15A 3L0KA 1UP3A 4YMZA 4PCNA 4GFIA 1PKNA 3RHGA 2V3DA 4GNKB 2ZZ4A 2WCSA 1JRBA 4DO5A 3BGAA 3WF2A 3LXAA 1VFHA 4S2CA 1UWTA 2EAWA 2ZE0A 2D69A 1FDJA 5A2CA 1HKJA 4F8XA 3DI1A 5T26A 1OYAA 3BGJA 3S5OA 1LJYA 1WZKA 1GVOA 3BVJA 4CQBA 1ADSA 3NEHA 2PBOA 4L4PA 5FF7A 1ITQA 3FJ6A 4A35A 1GW9A 5CZ0A 3NQGA 2BOGX 3QRHA 3EMQA 3VNZA 3IJIA 4HCHA 1DVJA 2DUAA 4IGSA 2BVWA 1PKMA 3LDVA 1VYPX 1JF5A 1OHLA 2J66A 1A5BA 4C6JA 1MZHA 3EDJA 3LI0A 1FHUA 3EOEA 4QE4A 5G5IA 1R7OA 4AD1A 5L9FA 1A5UA 4GIAA 4RDZA 2OU4A 2ZZ1A 3H23A 3HMJG 5AOUA 2V6AA 3L4TA 1XLJA 4JIEA 3BOFA 4MHBA 1LUCA 2Q3OA 3C0JA 3EKZA 3OLDA 1X1ZA 3T05A 4Z2IA 4MAZA 3IS4A 3MP4A 2GOKA 4DBDA 2VEKA 3NYDA 1SZRA 4K8GA 2VQUA 3WJXA 3TJLA 3DKLA 2D2HA 3SQSA 1VYRA 1DEDA 4UUIA 4CQDA 2AAAA 2C19A 1JDAA 2ZRWA 3SIMA 4YVPA 2XGIA 4LNCA 1EJXC 1X39A 2YXOA 1FH7A 3L4VA 1R47A 4JTUA 5A6SA 3RPTA 1W9DM 3TMLA 1P43A 1VBUA 4GQ0A 5HWJA 3TC3A 3QHNA 2PGRA 5EFDA 2NV1A 4O28A 3RUBL 2XIBA 4DJDD 2P3ZA 1ZL1A 1G4PA 3GRIA 5CJNA 3KZPA 3DDMA 1J0KA 3EMCA 4LBSA 1EB3A 4FAMA 2ICSA 2Y1HA 2Q8XA 4A3HA 1XW8A 4QTGA 4GI4A 4DY1A 3FDGA 3WQDA 4E4PA 1R3SA 5LIKX 1RBOB 3WL1A 1EC7A 3ECQA 4LEFA 3PK7A 3TMQA 1YTKA 2O9OA 4KWOA 3FIGA 2I7GA 1K1DA 2V82A 3SO7A 1DWJM 2FHFA 2PDQA 3SN4A 1TVNA 5TBOA 3TP4A 4RNFA 2QUNA 1RV8A 2UZ9A 3CPRA 4E4FA 3WY1A 2OELA 4YS1A 3U6WA 2WHJA 2Z2UA 3W37A 4EXQA 5BMWA 4O8AA 3SCPA 3WJWA 1G6CA 4DEFA 3Q65A 4GI8A 3EWZA 4QE5A 1CB2A 1UMYA 4AHOA 5I3JA 4PUEA 3T07A 2VZSA 1JI2A 3IARA 3M0ZA 2IPJA 4O8RA 2JE8A 3K13A 3UR5A 3VGEA 4HK7A 4DBEA 3BTNA 6XIAA 3MHUA 1RZMA 4I9JA 4WJ8A 1J0JA 2Y8KA 1UD3A 1V08A 5I6SA 2RUSA 1GUVA 2OPJA 2Z4GA 2BXYA 3MY9A 3IWPA 1H5YA 1XSJA 4QAIA 2VZUA 5BU6A 1LDCA 4LVBA 1DE5A 1QU4A 3WLRA 1FCBA 1LUCB 1P1XA 2PC8A 3WDPP 5C2CA 3BZGA 1SM9A 1FVPA 4I6KA 1XKYA 2YL6A 3M0VA 1H49A 1F5ZA 4AZHA 4ORIA 1UWQA 3I10A 3HZ3A 1FRBA 3TTYA 3UR7A 1XICA 3WZ0E 4MY1A 1BVNP 2QAFA 1ECQA 5KETA 4EIVA 4J2MA 1F61A 4D6DA 5DRCA 3IIOA 1QATA 4UQCA 1IIGA 3W53A 2OMAA 1QOQA 3W7JA 4HPGA 1FWWA 4LNYA 1EYEA 3IIPA 4GUFA 1HKVA 2OCZA 1N8WA 2XFYA 3GU1A 3F5LA 4HN4A 5BWAA 3B9AA 1KM5A 3LD5A 4M56A 5CSSA 3W74A 3BJFA 3AMGA 3SN0A 4MZ1A 1MQPA 4MWAB 1EDTA 2Z2BA 1VHNA 4M7SA 2YJQA 5JBDA 1FWRA 4L9YA 2J88A 2E5DA 4H7VA 3ID7A 4UMCA 3A21A 3A5VA 3UGVA 1TQJA 4XQ6A 4TX6A 2X2GA 4C5YA 1EEXA 1X7FA 5HDRA 2PZ0A 1BEUA 1HJSA 3G1HA 1G94A 1A49A 3FA5A 4F0MA 1LP6A 4O17A 1Y5WA 3ARTA 4J3VA 4XVDA 3TQKA 1EQCA 1EKOA 4FB7A 2F38A 2CEQA 2WWDA 3VOGA 2QF8A 3VNIA 4GJJA 3N9RA 3DKJA 3B04A 4GGHA 5U7SA 2GJXA 1HG3A 1UWIA 1J0YA 1H50A 2W61A 2ZC8A 4KF1A 1DQWA 1W31A 2VWTA 3NQAA 4HYRA 3WQ4A 1QNQA 1XIDA 3FKKA 3F4NA 3TWBA 4IM4A 1K4HA 4IJRA 4CU8A 1HUVA 1AH4A 1AW2A 1A0EA 1V3KA 3SGZA 4V1YA 3SZ8A 1EGVA 4XZLX 2QMJA 3VDGA 3TK7A 3CUFA 4ZFMA 3PFRA 4P8VA 1XRFA 1XRSA 4BWLA 4OKDA 3SECA 3N6HA 3HQNA 3QVQA 1YX1A 1TELA 2BGNE 1BYCA 2VVNA 1TVPA 3LI1A 1AH0A 4M5PA 1SMAA 1W8GA 4NKCA 3VE7A 4AIOA 4GUJA 1E3XA 1IF2A 5I7GA 2VEMA 4JYDA 2HSAA 4UWMA 3PC0A 4JQ4A 2FJUB 1R86A 1K7XA 2IXUA 2Q71A 4WF7A 3QY8A 4FR6A 4U31A 2DZTA 2Q8LA 1UPPA 1UWRA 2YCLA 5FJJA 3VCCA 2QF7A 1W9PA 1S5WA 1UBSA 1W3JA 3L12A 3OLGA 2O4MA 4V27A 3GR7A 1PX3A 2Z0IA 3LN3A 4OGZA 3M7SA 2OX1A 3FSTA 3PZIA 1UP0A 1YNYA 1E6QM 2PU1A 2PTXA 4IMGA 1HFBA 2OWWA 4LT9A 2YDRA 4CN1A 3MTWA 3NGJA 1ICQA 1EJTC 2HE8A 3N4FA 4AEOA 4OV9A 5FF3A 3EGJA 2VFDA 4ENLA 3N2XA 3ARYA 3CUIA 1ZAJA 4N9CA 4O12A 2QV4A 3CMFA 5FAGA 3CC1A 2WNNA 1CEOA 5C9RA 2XZ9A 1MI3A 3WF1A 1V5XA 1V03A 1T6MA 3THUA 2QJNA 3RJYA 3DENA 3A23A 4A3YA 4WGHA 1RALA 2OWCA 1CGUA 4FO4A 4JDBA 3CL6A 1FWAC 1K9EA 2HWGA 1EP1A 5E0KA 4L9XA 3TYCA 5CZJA 3PBWA 2Z1WA 3U2OA 3RYSA 3LHVA 1TTIA 3VIJA 5LGXA 2NQLA 4IGNA 1TO3A 3DX5A 3SUUA 4S23A 3CXOA 3SFKA 4X9SA 2OEJA 4ZQNA 4DF2A 5FEWA 2ABAA 2WMHA 4ATLA 4H9MA 3WG6A 3VMNA 3EWXA 1K70A 2DUZA 4PFHA 3M5ZA 3G8EA 4A2RA 5LKYA 1ISXA 4QSFA 1CNVA 4CD6A 2INFA 3AYSA 1KTCA 1IQ8A 1NFPA 4W8AA 1EHAA 2ZX8A 1XLAA 1EJRC 3TSDA 3F5KA 3T9PA 2ZRYA 4X0VA 2PDLA 1VC4A 2DJXA 4HTBA 4A8IA 5AHNA 2OZTA 3T4CA 3CO8A 1MSSA 3NOYA 3FKRA 3WENA 3PUEA 3NCOA 3CQJA 4JKMA 1P0DA 3RLGA 2YCLB 3WLHA 2WNQA 4HP5A 3U5YA 4MADA 4US5D 4EWJA 3C2OA 2PD9A 1PHWA 4ZQOA 3AISA 4MZ8A 4KQNA 1XL9A 3N2CA 4W8BA 4EK7A 3N04A 3O6DA 3S47A 4NZ1A 4PCFA 3PULA 2VO5A 2EPHA 4FA3A 3OVPA 3VPLA 3TTEA 2YXGA 1RVGA 1FXPA 1MO0A 6TAAA 5DQPA 1GGOA 4Z1BA 2XN1A 3ITCA 4JEQA 3LS9A 5FA5A 1UUOA 4UNLA 3VNKA 3SCOA 4F4RA 1BQCA 1V93A 2PDHA 4HZ7A 3WF4A 3D47A 1V3HA 9RUBA 4PTVA 3QC3A 4JIHA 3LMZA 4UFMA 1ESWA 3LGEA 3MHGA 3KBSA 2KZHA 4MIMA 1O4UA 1GJWA 1E4IA 3DFYA 1TTPA 3DN5A 2WSRA 3VXGA 3W4RA 1R3TA 2XYLA 2HS6A 3W88A 1X7IA 3UD6A 3W3OA 4AHQA 5I78A 4HMDA 4A3UA 1PB0A 5H2ZA 3UA4A 4GXMA 3VFCA 3W7LA 2C91A 1EHNA 2BVYA 1F9CA 1SVDA 1DWAM 3PNUA 5CJMA 3OP2A 4MB5A 4Q8TA 4IIHA 3SIZA 4Q4OA 1XFCA 3W7QA 1NDWA 2ZX9A 3GQYA 5K9XA 3W83A 2DT2A 3E1F1 1V4YA 2TAAA 4FOKA 1S38A 1OCNA 2J62A 1JQXA 4KT2A 1N82A 2P10A 4EPDC 1U1UA 2G3JA 1CLKA 1XDMA 3LHZA 3PR2A 3UXAA 2E6YA 4K8EA 3QGKC 4L1XA 4M80A 1VPYA 4H04A 4DO4A 1AFSA 1AQFA 3AIEA 3ZOAA 1QNOA 3NQMA 2PMQA 3H2CA 3W1PA 1V79A 4OECA 4LFYA 1O68A 1VPQA 4KEUA 2C15A 4WQ6A 3F7JA 1DJQA 5BZAA 3RCNA 1UKPA 2GWNA 4PMRA 1M03A 1BRLA 1ONWA 9CGTA 3XINA 1K9DA 3DGBA 3W28A 5IFPA 2HK1A 2NXGA 4XZWA 5KEZA 1S1RA 4LTSA 3EXTA 4GNJA 1VRXA 3BLDA 4PE8A 1H7XA 2PWEA 1VQTA 1H4PA 3CHDA 3S46A 3L67A 3FGCA 3BOXA 2E6AA 1Z9AA 3AWOA 1XCXA 2AOSA 2F9RA 2IKIA 3BW4A 4YTQA 3LOTA 1D8CA 1DJXA 4YCPA 5D8ZA 4PC8A 4HHPA 1NOFA 4O0QA 4D6EA 1NQ6A 1WOAA 2ACQA 1ITUA 3K2GA 4CNSA 1TV3A 4AW7A 2X7VA 3GBEA 1UZHA 4LQ1A 3LMYA 1R0MA 1R8LA 4IP5A 3WDJA 1VGAA 2CCRA 1R3YA 3ERPA 4IMEA 1KFWA 4QJ5B 1EH9A 1XLIA 2D20A 1RK6A 3ZR5A 1BLIA 4MGGA 3HG2A 3H2OA 1EDGA 2ZZ5A 1EIBA 5T9BG 1YDOA 4FX8A 1V6TA 4GX9A 4BR1A 3WK2A 3LV6A 3VI2A 4Y8EA 2GOUA 5G2WA 5D04C 1W3LA 1R9YA 3W2LA 3S1GA 1XISA 2OJPA 4JKLA 4ML4A 1IEWA 2DUXA 2HS8A 5CLTA 3L0NA 3ZMRA 2ZICA 1Y8BA 4AD5A 2ODOA 4RJEA 1SMDA 1RCOB 3PWGA 1OWQA 3V4BA 2PWGA 4AYSA 4RCXA 5BXRA 1WXZA 4UNIA 4A2SA 1IEXA 1UA7A 3ZSSA 3U48A 1Q2SA 1LOLA 1XLGA 3LCWA 4MM1A 2E25A 1NJJA 3T6CA 2H90A 2GL5A 5D38A 4UOQA 1U30A 4HN8A 2FH6A 1E0XA 2B7QA 3CV7A 2A3EA 3CIXA 4BQ5A 4PTMA 2B0MA 4EACA 1NFBA 2W63A 4UCGA 2ISWA 1BRLB 6XIMA 2YBVA 3NO1A 2BVTA 2VXNA 4N6EA 5HQEA 3EXSA 1JFXA 4H6QA 1GOIA 3KLLA 3SCTA 2GUYA 3BICA 4QM1A 3FYOA 1ME9A 5I3HA 5BOEA 2JKAA 1O95A 3R1ZA 1HW6A 4L1WA 3Q2DA 1P7TB 1GEQA 1Q6GA 1KCKA 4L80A 1KA9F 2VJXA 1MDRA 1AA1B 3MA8A 3F4CA 1H60A 2V8ZA 4EKJA 3OQ8A 2C3ZA 1JYNA 3UXIA 3LEPA 1REQA 2J7DA 4O18A 1S2UA 3HURA 4JYEA 1C93A 1EGMA 2OXNA 3MHFA 3PTKA 4O52A 1KFLA 1QT1A 2ISVA 1TG7A 2NZLA 4DHGA 3QLLA 4PUKA 3TW9A 3LZ5A 4K1GA 3WQ8A 3RX4A 3O63A 4WDXA 1TPEA 2A0NA 1XYMA 3A4WA 4POCA 1U5VA 2DZBA 4W7WA 2GSEA 2Z1BA 2NQ5A 3ISIX 1QW7A 4GZJA 5FF4A 2OO6A 5SWUA 3M47A 5C6MA 1TCDA 2ZVIA 3K5XA 2R9RA 4IUOA 2JEQA 3QKEA 4H3DA 3EOUA 5TNVA 2MANA 3E2SA 1BVWA 3L2IA 1FXQA 2WHKA 3UZZA 5DANA 3M7WA 2ZIDA 4WUIA 3IJQA 1LBMA 3W1LA 2JGYA 3PZVA 3PTMA 1KQYA 3CMJA 4O53A 4N4PA 4D8AA 2ISFA 5HQLA 4HK6A 5TIMA 4DI9A 1OB0A 2YZ5A 1VFLA 2YZRA 3N13A 1WUFA 3A4AA 2ZBTA 7TAAA 5A8NA 8CGTA 1EF3A 1NWRA 3M07A 2R1LA 3GG7A 4GWEA 3UG5A 1E6PA 4LVDA 4F9DA 5I02A 3GTNA 1XINA 2NWSA 3IK4A 4J1OA 4GQBA 1F6KA 4CQ8A 1A5CA 3C0QA 4LBUA 4W7UA 4YXGA 4JR5A 5DXYA 1YXDA 3L68A 3H12A 2AGTA 1YNPA 1B4EA 2ONEA 4ZO8A 1GVEA 1PXGA 3RIKA 4IIEA 1UD8A 2G5WA 1ZJIA 5F4SA 1T8XA 4AC7C 3TYUA 4D6FA 5I06A 4NAEB 3IVSA 1IGWA 2VURA 2E09A 1OFPA 3STPA 1GYNA 5CG0A 4HD5A 2O92A 5EMUA 1ZCCA 2WQPA 4IX0A 5REQA 3QOMA 3NL2A 2Q01A 4DF1A 4EE9A 1VLWA 3OQEA 1HGWA 4ICNA 1Q13A 5CC3A 1ZJBA 1XYAA 2ON3A 4HNUA 1U22A 3PAJA 1JCTA 3RLVA 3BSMA 3WDRA 1CCWB 2OR2A 3FXGA 5HK4A 3IJLA 1REQB 1J2WA 3E5PA 3AJ7A 3L65A 4BI5A 3P0WA 1K4GA 4O1CA 3HQOA 2QCDB 2E8YA 3HPAA 3TYDA 4NJIA 1FWFC 2CITA 2ZUMA 4H8VA 4M6UA 2P8CA 3MKCA 4NSBA 5I07A 4A6GA 3I3BA 3R0UA 1QHPA 1YE6A 1M1BA 1XC4A 2WHMA 3KBVA 3L23A 3VD5A 1CZ1A 2C8NA 4KWUA 2EPLX 4EPEC 3U4AA 2ZUTA 3V5FA 5F2MA 3KRBA 2X41A 4L5ZA 1PCWA 3LNMA 2W67A 2TMDA 3VC5A 4OUEA 3G3MA 3WDIA 3GAKA 4PMXA 1A3HA 2A4AA 3WBXA 1UC4A 1E4LA 1TSIA 3WQ6A 1H11A 3P8IA 4GACA 3IAPA 2BP1A 3KUMA 5KTLA 4FLQA 2WSPA 5DLCA 4Q7BA 1VEOA 4DJFA 3LXBA 2QAPA 3P6LA 1DYSA 1VBRA 5CPTA 4E2BA 1LQ0A 3EBVA 4AISA 4HYWA 2YFOA 2OGJA 4J2PA 1VEMA 3SCVA 3T1GA 1SJDA 4K7VA 3VZXA 2ZRVA 2V5KA 2J8TA 4GXPA 4ZOBA 1PZ2A 2GQAA 4TTUA 3TW6A 2IKHA 3W7IA 3ARQA 1SR9A 2E77A 3UT0A 2WCGA 4UTWC 1TPWA 4GO9A 4WZHA 1SZEA 2WVVA 4XUGA 4HYVA 3EWYA 1BWKA 4S38A 3AOFA 5AC4A 1J5TA 4IUGA 3TROA 5BRBA 1L6GA 5IBXC 2IXVA 2MUCA 4K2SA 1JVNA 4AVOA 3QPYA 5A6TC 3OLIA 1KV5A 3PF3A 4O1AA 1Y7VA 5REQB 5DMYA 2H3DA 4KCVA 3AHVA 4QQ3A 4NHVA 4JYFA 2J78A 2UY4A 3EA2A 2P50A 1HVQA 1OX5A 2TYSA 3VGGA 4EVZA 3W23A 3DXIA 5ECUA 3CTTA 3BSHA 4B4FA 2D22A 2R1NA 4PN2A 3R0KA 1XKJA 3JZEA 4DWSB 5D9NA 1SJAA 3PPGA 4IPJA 1UHVA 2Y7DA 4QDPA 1I6NA 2RJGA 4J27A 4DZAA 3C61A 1QO2A 1NDZA 4ZQRA 4MJ4A 1R3RA 3CWHA 3FCPA 3L9CA 5AY7A 3QPZA 4JDYA 5D9PA 3TSBA 1E9YB 3GAYA 1XH0A 4W89A 2I5IA 4ZCWA 4NG3A 4X2PA 5BU9A 4NVTA 3BAXA 3G1FA 1ZHAA 4U10A 1R2TA 5EMKA 3I4KA 1ZRQA 4UMBA 1Q8JA 3VKBA 1EZWA 4NJHA 1QTWA 2VDGA 3F2DA 5HNNA 3ES8A 2TRSA 2PODA 1PHQA 3BK0A 4XAYA 3KS5A 4RE4A 4D6IA 4BQ2A 2W9MA 5CPLA 3OA3A 4HBKA 3E0IA 5C2XA 4GNVA 4U5IA 3E38A 2CC0A 2VX4A 4HHMA 3AU6A 1M7JA 3NZ1A 1WA3A 1E1CA 3MUCA 4TMBA 3LCXA 3QY6A 1QCWA 5HJXA 3MO4A 4Q8MA 1KV8A 6REQA 4H9ZA 1TUXA 5BCAA 3R10A 2PFHA 3UXLA 3VAVA 3TOYA 2PA6A 1MRQA 1KFKA 2VEFA 5CSUA 3ZT5A 4R5EA 3S5SA 2XVGA 3R0DA 3VX1A 5I77A 3TNOA 1QW8A 5HJYA 3VNMA 2XZ7A 2WVVB 3KAOA 1UCWA 5ABHA 4LUYA 4ZSUA 2CWXA 3W2MA 3TUUA 4YYCA 4AVFA 4TIMA 4MKSA 1PV8A 1XH1A 4QJ3B 4KCWA 5EFFA 3TC7A 1MRAA 2JBMA 1V3MA 3RR1A 1KD0A 3QSRA 5CZKA 2XFFA 2NLYA 1ZLPA 4ZEPA 4C90A 1WKYA 1LROA 3U5UA 4B3ZA 4PB5A 3MP3A 5MHBA 4DZ5A 2PF8A 1G67A 3T7VA 4LRTA 4D6JA 1FFQA 1KNWA 4GUGA 3RRXA 5CSRA 5FJOA 4LGXA 3R8RA 1XH2A 2F61A 4H7CA 2DSKA 3CMGA 4LXFA 4EXBA 1PZ3A 5H8PA 1GQNA 4PRTA 4LANA 2BODX 1EP2A 5AZ0A 2ATSA 2ZX7A 3ZWSA 1E1FA 4PB4A 4EP8C 4GI6A 3JW7A 5BW6A 5DF0A 2V0TA 2G96A 1Z69A 2ABBA 4DJDA 3VD3A 4J3WA 4B2DD 4MWAD 3GXPA 2P0OA 2EG6A 4ONVA 5RUBA 2VGFA 5HULA 2G4JA 3GTXA 4GZEA 4HU0A 3UW6A 3LM3A 3AYRA 2YL8A 4DX3A 1WKDA 4HTYA 5LA0A 1FHDA 4GFSA 3R94A 4OHQA 4ZSTA 4K38A 1V6WA 2R1MA 4JN8A 4NNBA 1S5VA 1XYBA 4C1NB 4B3KA 2QR6A 3MQTA 2FFIA 3ARXA 4XVEA 4FZIA 1JNEA 3ZT7A 4WIWA 4RNJA 4LCRA 2ALDA 2YCEA 3EWWA 1FWDC 2CYGA 3TVAA 3B9EA 2WMFA 2PU0A 1NDVA 3NM1A 4KW2A 4JQ2A 1I2PA 1TWDA 2ZZ3A 3GHUA 2Y8VA 1E40A 4NT0A 4CQCA 3AS2A 1VFOA 1OFOA 5H8MA 1CENA 3TOPA 2Y7GA 4XSMA 3LCFA 1JCYA 3KOZA 1C91A 3RITA 1C8QA 2A3HA 2ATMA 1QI4A 1FWCC 1E4MM 1KRCC 4DO6A 3VIHA 3W86A 4Y9AA 3OTRA 2XGZA 4XZIA 5G2HA 5M03A 3AXXA 3SCWA 2POTA 1MXSA 5LXEA 3TE9A 3O1NA 3M43A 4F66A 1W3HA 4H01A 5TF0A 3BQ5A 4MNLA 3GDLA 3V1HA 3AS1A 3D5HA 4ZXLA 1TZZA 3WD2A 5F7UA 1OC5A 3TAKA 1KCXA 3NSXA 2OG9A 4GKTA 2YGYA 4I3GA 3W26A 3S1XA 4E2OA 4V2XA 2P5NA 1A3WA 1LG2A 1JD7A 3GYEA 1R2RA 3WJZA 4R34A 1JAEA 1ENUA 3W07A 4CUCA 3UWEA 2Y70A 3RO6A 3BAWA 4C1LA 1EBHA 3WQ5A 1LCOA 4KS0A 5KZMA 3CZGA 4FLRA 3BOLA 3U0HA 1JAKA 4ZENA 2HV5A 3GVVA 4GBUA 4BI6A 3NEVA 1JZ4A 1WB0A 4LEQA 4JN7A 5CJ5A 3DYPA 3HPSA 4UQDA 1DQUA 3CYVA 5E5CA 2YL5A 1E43A 3CLWA 4R85A 1L6FA 2J25A 2V2HA 4PODA 2X05A 2AKMA 3N73A 3ZFHA 3R8GA 2FPYA 3G1AA 2OQLA 4LU0A 5FEXA 4EPKA 3R11A 2RDTA 2DZWA 1W1TA 5A1AA 1XDLA 3KWXA 3MU7A 2PWHA 3OGSA 5IRPA 1S3TC 3QV7A 4HHLA 1EDQA 1ONEA 4S3CA 4X9YA 3PPFA 3CH9A 4AIEA 3PZOA 1V7AA 1F7BA 3ZVHA 3SM0A 3THCA 5D2YA 1Z89A 2EG8A 2W62A 2Z00A 3LGDA 5HMFA 3PJTA 2PDXA 2ZVRA 5ENLA 1TJ0A 1DL3A 3H2MA 2JALA 5A8GA 5GJPA 3B8UA 1E0WA 4JPGA 3NURA 2VENA 3B40A 3TLLA 4GC4A 5I03A 2FMOA 4DUWA 5FJUA 5DCEA 2BLEA 2EJAA 1UD5A 3BWWA 4NYUA 4P5UA 1DWFM 3NL3A 3OPSA 3BG9A 3RILA 3WD1A 1ZBKA 3CZKA 2YA1A 2Y62A 1ZY9A 1JYWA 2X42A 2ZUNA 1JDDA 2WHLA 3G3DA 3VGDA 3QR0A 4MKVA 2W27A 3UNDA 4ALDA 2J7CA 2ZUVA 1K8YA 1XQLA 4I7VA 2PP1A 3H22A 1HL2A 3QJAA 4MB3A 5AYYA 1LZOA 5F2GA 2AL2B 4MOZA 4H8NA 2NXHA 2I9UA 3T2QA 2ZA3A 4GY0A 2PAJA 4PTWA 1ZAIA 1DJZA 3QN3A 1W2VA 4HZ6A 4IPNB 2GFTA 5C7HA 1WE5A 2ZX6A 5LIYX 2BGSA 2VWSA 4IMAA 4O0ZA 1VYSX 4NJGA 4RPPA 1UH3A 1FH8A 3DFSA 1E70M 3CAVA 4KWWA 4NYYA 1ZBCA 3F5JA 3GVWA 2YB4A 3WKZA 2INEA 4W7VA 4R88A 4NU7A 3QPEA 3NYZA 4YWIA 2B7PA 3AO0A 4A8RA 3ONBA 3BC9A 4PSRA 4B5UA 1F4AA 1WDDA 2V68A 4GO8A 1VBHA 3OHMB 4LB4A 5EB8A 2E6FA 3M0HA 3VIKA 4JAWA 2C1HA 4IP7A 5C54A 2WM1A 2A21A 3PSVA 4IJBA 2QCMA 2DH3A 1WCGA 1OT2A 5D02A 1KGUA 3JRKA 1TJPA 3CHFA 1GZ1A 4KERA 2W6RA 4L9ZA 1HJXA 3AUJA 1GVSA 3H53A 1JCNA 4IPIA 2JKPA 4M1RA 2DQWA 1XYFA 2WQDA 4W85A 5B7YA 4HHHA 3HG5A 1XBVA 4ZOAA 4IFKA 3OZYA 5MF5A 1XS2A 1W1ZA 5HPOA 3AROA 3ZVHB 5JH2A 4OIFA 4X61A 3BSGA 3S4TA 4TV6A 4WGXA 5IHRA 1H7PA 3FK4A 3IEBA 3KRZA 3EWCA 2ZTKA 4UTUA 5I3GA 2VCAA 1TPUA 1GNXA 4NQ1A 4M1BA 4RPQA 4HCDA 1XIHA 1XLBA 4E3VA 3R5EA 1QNRA 2CXEA 2NQZA 3GY1A 1UIPA 3JR2A 3B3DA 1AZ2A 1RPXA 1GYMA 3UZJA 4PGLA 2A5HA 3T2OA 2CHNA 4YTRA 3W1MA 3P8JA 1KLYA 4GK8A 3M41A 3XIMA 1VIZA 2Z6IA 3WK3A 1ONXA 3EWDA 4B4HA 1BSIA 3HV9A 3BUVA 3B8WA 3TYEA 2D0FA 3QEZA 3WNOA 3T81A 5BYWA 3S2CA 2E67A 3WYZA 4X60A 4I9AA 4NX5A 3ABZA 1QI0A 4LYPA 4FPSA 3M0XA 3NSMA 1HQTA 2V69A 3GFZA 3KLKA 2PDYA 3W1AA 1TMHA 4UQEA 3ZO9A 4I7WA 1PX4A 3FVDA 3FA3A 3P61A 1V3LA 4MKNA 3NA8A 3VILA 3CV6A 4LBRA 1A53A 3KTXA 1ZB5A 3S1VA 3KBWA 2FZMA 2ZZ7A 3OU8A 5K9CA 3LXCA 3NOEA 3OW1A 1AMKA 3RMEA 1OYBA 1ZPTA 4U2YA 4KEVA 4Z1YA 8A3HA 1E15A 3IUDA 3GKAA 4GYFA 3CLMA 2YIHA 4I6VA 4UFLA 1ZUAX 2OYMA 4IH3A 2Q6ZA 3QC0A 4N9DA 3BLPX 5A8QA 1N8FA 4XAGA 1V6VA 2VRQA 4DJEC 4L4MA 4US5A 1C7TA 4IL0A 3TA9A 2CZDA 1HN1A 3KDOA 1FA2A 3VOFA 3Q37A 4G5DA 4DYJA 1TE6A 3LHWA 3LSCA 1XD1A 4MB1A 4I8DA 3A24A 2C1IA 3APYA 3A9BA 2YFNA 3M6YA 2WJEA 3EOOA 5IXEA 4BQ3A 3MYOA 4LS2A 2VZTA 1GOMA 1JXJA 2X0HA 4R27A 4GVHA 3H7RA 1E6SM 1XG4A 5T9CE 4GY7A 1Q8AA 4JTEA 2YYTA 4A8NA 3SCSA 1VCFA 4LVGA 2D1ZA 3G1SA 2JEPA 2DPEA 1BQGA 3ITGA 4MSSA 1XR2A 3AMKA 3K46A 3G0XA 5C0QA 4QFUA 4F0RA 1VFTA 4XAPA 2GDUA 1KBIA 4E0CA 1JF6A 1TWWA 4X2RA 4XAFA 2ZUSA 3DC0A 3H24A 3IAQA 5MKGA 2WSKA 2QJGA 2OGYA 1JZ5A 3NQEA 2VL4A 4QJ4B 1CYGA 2PTZA 4S2BA 4GJ1A 3AMCA 3W7OA 3M0IA 2ZDSA 3M4HA 3DESA 4YVVA 4OBTA 1OM0A 1O1ZA 4LV9A 1P0EA 4NIRA 5FJIA 3UYIA 2Q3RA 4C7DA 3LHYA 1M53A 1J12A 1EFZA 4N02A 1ZAHA 4NX0A 4HNTA 5A8MA 4WOZA 1JDCA 2I16A 3G6MA 5KITA 3SN1A 1SUXA 3NZQA 3MYPA 3OHIA 1B2YA 2FPTA 3D0CA 1LWJA 3H26A 1KXHA 5E09A 3UCDA 5IDIA 6A3HA 4U33A 4U3CA 1S46A 4AFYA 3TNBA 4B90A 2OWXA 4EX4A 5C7VA 3F4WA 2XIQA 1B1YA 3GNOA 1FWSA 1C90A 1IXOA 3CHCA 1UMLA 4GVIA 2J7GA 1YXCA 1EWEA 3HGRA 3REQA 4TVUA 4ZL1A 1X38A 1VHCA 3G1DA 4BQ4A 3G24A 4KBXA 2X1TA 4P2VA 1B3XA 3WLIA 2NVCA 3EDEA 3SBFA 2DH2A 5E1QA 4M3PA 2ZCGA 1XD0A 1RLCL 2CLFA 1KKRA 2VFHA 4F2UA 3KS6A 1Q7MA 3GS6A 4RZ6A 1PJ9A 4Z1CA 4JTSA 1UKTA 1XLCA 4REQA 4HSHA 5A95A 5C9XA 1PYFA 3UPBA 3TXZA 5LSMA 4G9PA 1JYXA 3HG3A 1E72M 4DUXA 3UU0A 1MW0A 5D37A 3QMSA 4FP1A 2NUXA 1W1VA 3BW3A 3N19B 3N4EA 4Q4QA 3N2MA 2EXOA 3LRLA 4XO6A 1W9XA 3P2VA 2WNZA 3K8KA 1UBPC 4P8WA 4IJCA 3K1GA 1OG6A 3FYYA 2EG7A 3C3NA 1LRNA 4LCQA 2J7BA 3GNPA 4X3ZA 5MKGB 5CC5A 1XLDA 2BVDA 4JTJA 3HM7A 1G69A 5LNVA 3VVGA 1PKYA 4GZIA 3B9DA 1M04A 5D9MA 4JFUA 3AIVA 1OJXA 3MMWA 1I0DA 3DCPA 1W91A 3BPWA 1BVZA 4MZYA 3W84A 3C0SA 4DB7A 4O13A 2CPUA 4E3TA 1H1YA 4LX4A 1O6IA 1KM2A 4F0SA 3GVGA 3IJ6A 1FWJC 1TX2A 4XD3A 4HPXA 3P3BA 3OZPA 4U5KA 3W01A 3T40A 2PDMA 3UJEA 2H8ZA 2X1RA 1AQHA 2VEPA 3FAXA 5D2XA 1PYMA 4GKLA 1S2VA 3CQIA 2FVKA 3UFYA 1O60A 1OIFA 4AD4A 4LV4A 2E1WA 5DMMA 1NY1A 4J40A 3MUZ1 2ZXQA 1OCJA 2VC7A 3SFWA 3NQDA 3RU8X 3HJZA 3TV8A 1EX5A 4UTLA 4DPQA 1DHKA 2V2DA 3W70A 3ARVA 3URAA 3VZZA 1C3FA 5GNYA 3B06A 3GFYA 3VKJA 3LX9A 1O5KA 2PDGA 2VEGA 3TN6A 3LCIA 4JHZA 4HU3A 3WD4A 5I3DA 2R14A 2BX7A 4RV8A 1PO9A 3GIQA 1VFUA 1BYBA 3OZOA 4QCFA 2PLJA 4NY2A 4W87A 1E71M 1XGEA 1JIBA 4HA0A 2WZEA 4QHRA 3SRDA 1V6UA 1W3TA 2HROA 4QNWA 4Z42C 4MG4A 3V36A 2G3FA 5AB3A 1RQEA 1J18A 1WZAA 5C55A 1ISYA 4WHBA 4C6IA 1AVAA 4HU4A 4REQB 4MY8A 1FUYA 3IANA 3GDMA 2E40A 2PEVA 3GIPA 3VA8A 2H3BA 4W9TA 4B15A 1UW9A 3UG8A 3SCRA 2ZADA 1VFSA 1WDQA 3W1TA 3PM6A 1N7KA 3VOIA 3O07A 1HNYA 2HBXA 2LLEA 5CPNA 2ALRA 1MFVA 3DG6A 4ZQMA 1ICSA 4GQRA 3NNTA 1QNSA 2Z29A 4RLIA 3U7BA 5DFAA 2ZFAA 1GVFA 3BARA 1DXIA 3SW6A 4ASTA 4BI7A 1IGSA 2F6UA 2W0UA 2X0SA 1QI5A 2EQDA 2UY3A 3FDKA 4ZQPA 1Z3NA 5E6YA 3EOLA 3USZA 3DHDA 1QPQA 1K03A 2D0GA 2OQYA 4O57A 1ME8A 3NG3A 3R2GA 1E5NA 2VNCA 4AHPA 4S3AA 1BG4A 5FSDC 2EPNA 3MKVA 3AZSA 3I4EA 3C5QA 3UJRA 1YHTA 4FXJA 1UZ4A 4P61A 1B9BA 1LRTA 3IGXA 1LT7A 3OOQA 4QS5A 2O7QA 4L61A 1Q4WA 2A3LA 1UD2A 4H19A 5HOSA 3NDZA 2WV8A 1X96A 4G8TA 1H0IA 4FI4A 5CC7A 1XI3A 1LOQA 2G95A 3W00A 3ARSA 1EXPA 2ACUA 4GA8A 2OO0A 3PTQA 4B5WA 4CNUA 1HVXA 1K6AA 4IX2A 3ZZ1A 1Q66A 2O7SA 1ZJAA 4KFPA 3MBFA 8XIMA 3NQVA 2CIPA 2X1SA 2PGFA 1HIZA 3GDKA 3DFOA 2BOFX 1VCGA 1LORA 1BFNA 2VEIA 2WC4A 4ZODA 5CXPA 4UOZA 1T40A 1RHCA 4X63A 2WM0A 2QCCA 3TR2A 3CGTA 1D3HA 4ZBCA 3FW6A 4QR6A 3GDRA 2X1IA 5HNUA 4LAKA 3SGGA 4DWSD 2IQTA 1CGWA 3SCQA 3PB2A 1XHGA 4AIUA 1UJQA 4BFAA 1A4MA 3DFNA 2Y88A 3A64A 3HU7A 3UZYA 5IFTA 3PPHA 4O14A 1PCKA 1ITXA 3VGFA 9XIAA 4HOXA 5JBFA 2P8BA 4R53A 4RZ4A 3WL0A 5LHFA 5JVLA 4M6VA 1LG1A 4HNLA 2KX9A 3NAVA 1T96A 1VFFA 3BLIA 4ES4A 4LS1A 1V0LA 2DZXA 1EJVC 1A5AA 3UETA 2NXIA 3KOYA 3OA5A 4US6A 2WZIA 5I3KA 5G4WA 2ZXDA 4IIBA 5FEPA 2YXXA 4AZ7A 4AZIA 1F6PA 2DY3A 4DJED 3RCMA 3CNYA 3QGAC 2J13A 4DAIA 1K7EA 1KFJA 3DGRA 3DOPA 4JHMA 1KCZA 3ES7A 3C3UA 3W38A 4IT1A 1QPKA 4JTQA 1U33A 5AVNA 4AQLA 3C4UA 4GUIA 3QV6A 4V33A 3CHEA 1SPQA 2J9YA 2HEJA 3EB2A 1QRQA 3VKDA 3H2AA 3WQEA 3OB8A 2EEXA 5BMXA 4K7YA 3E2VA 4WLCA 4O4VA 2W3ZA 1ZJHA 4NI8A 1JCXA 3S9YA 3MCNA 4QQUA 3QZEA 1F3XA 1OGSA 4JL2A 5I79A 4DBUA 5ABTA 3H54A 1IT8A 2QPSA 3CU2A 2VX6A 4CNTA 5I09A 5LYRA 4N4QA 4CN4A 2VHLA 3N34A 1XUUA 4ZGYA 4UTFA 2WYSA 3O6AA 1UR8A 1J79A 4FEZA 2PDWA 1IXPA 2P76A 2CZ5A 3C86A 1XV8A 3PZTA 3IPWA 4UBPC 1RJQA 1NEYA 3F2CA 1BF2A 3EPNA 3VGBA 4JTDA 4MDOA 2BY3A 4B9ZA 4JN6A 4ZO7A 4BF9A 1X97A 1OK6A 3VABA 3SY8A 1HKMA 3DEQA 3PG9A 1FY6A 1P6WA 1DIDA 4DWDA 2HMCA 3T08A 4HZ8A 4D72A 3FHQA 1P6CA 3B0XA 1OF8A 4RNHA 4G2DA 3QM3A 3NPXA 1GZJA 4UMAA 1XLHA 2NT1A 2QVNA 2VFIA 1QWKA 3KVKA 3W2JA 1HKIA 1AZ1A 1Q85A 2J47A 3CEUA 1PEZA 4LCSA 1A4LA 3VMOA 4Q8OA 4C6KA 1ZTVA 3WH9A 3BG5A 3T0DA 3VM5A 1W9UA 4I5UA 2GVLA 3PZ9A 3HGSA 3SDOA 3BAKA 5A6JA 3TZNA 1H1NA 4AD2A 1GONA 1J11A 3ME3A 4AEEA 4PBFA 5CBJA 5C9WA 1Q7QA 3WQFA 3RK8A 4WEVX 1WV2A 2FMNA 1RD5A 3S5YA 2DDXA 3JZUA 3LNPA 6ALDA 3BAIA 4ZOEA 5JBEA 2ACSA 2Y2WA 2DIEA 3L4ZA 3QFEA 2D2GA 1B3ZA 2OEMA 1V8EA 3F4DA 1E4NA 1GVIA 3GTFA 1WUEA 1CX9A 2E68A 1UD6A 1NWUA 5XIMA 3EX1A 2BV9A 1OT1A 1KRBC 3O2LA 4H9XA 4F0HA 4URIA 3AYVA 1JPDX 1UPMB 4Z0JA 3LB0A 3G18A 2JIWA 4M6PA 1P1MA 5LA2A 1EGZA 3A5FA 2JFEX 4JTRA 2V3FA 1UWSA 1ZQ5A 1WXJA 4PL1A 1W1IE 3GTHA 4FOJA 2FYMA 5HJLA 3MCOA 1QNPA 2OLSA 2XN0A 1PZ0A 4FF7A 2A6NA 5BXTA 2FDSA 4M24A 3I6TA 1YXYA 1YTEA 3VGHA 3V75A 2V5JA 3T2PA 2OFJA 1UOKA 3ATYA 3M5VA 4P7OA 1EX1A 3HA1A 2HRWA 4QITA 1Q63A 1WAUA 1CXIA 1J0ZA 3E0FA 1TPC1 5H8UA 1RQBA 1TIMA 1WDRA 3NQ2A 4G56A 1U83A 2E5CA 3I68A 1YBQA 3GM8A 1SW7A 2GPTA 3W7KA 4CCDA 1E6XM 1UJPA 2DT0A 1QMLA 5D8WA 1OG0A 4HOZA 3R58A 1R3WA 4N7QA 1DWIM 4ZO9A 4UZSA 2Y89A 3NZPA 2GK1A 2E9LA 3NQ8A 1WBJA 1IR2A 1A5SA 1HT6A 5AHFA 3C2VA 2NV9A 1F74A 1VIWA 1XRVA 3INPA 5DT7A 3MV11 3W24A 3O15A 2YW4A 1A47A 3PWAA 3RLUA 2J4GA 3GG0A 1M3UA 1NSJA 1QK0A 4GIYA 3UYCA 1BTMA 2V38A 4RE3A 2PCQA 4AD3A 3AWNA 3N18A 4GIRA 3T8LA 1N55A 1EJWC 3EKLA 5HNRA 4TQTA 3GU2A 4B2DA 2FB2A 3IUIA 4MWAA 4H00A 4IQJA 3KP1A 3LM7A 3WK1A 2D2JA 5HNTA 5I00A 4C91A 2I5GA 4H9VA 4N9BA 3PPCA 3YPIA 3L2LA 4ZB5A 1O5QA 3MZNA 4FIQA 4KIEA 1JUEA 1ME7A 3ZYZA 2ADAA 3IV3A 5IHSA 3VNLA 3WIJA 4IMDA 3KFTA 1H3GA 2HJPA 4XKYA 2HPIA 4H2CA 3WMLA 1EP3A 1E3ZA 3C2YA 4QLLA 4Z2LA 1GOKA 3TDFA 3T0TA 2QV5A 3W7GA 4P8XA 4IZGA 3UVIA 3STGA 1IEIA 1Q6EA 3EX6A 3A22A 4FS9A 4NUWA 4AAJA 4AC1X 1CLXA 1KW1A 3M16A 5GVJA 1GQJA 4UFIA 4B5SA 4FR1A 1JPMA 3TQ0A 5EMJA 3WEZA 3E9AA 2WLZA 1H2JA 3M5YA 1XCWA 4JFTA 1QOXA 1H7WA 3RO8A 4RUBA 3CQHA 1H41A 3RM8A 2PSNA 3M46A 3STFA 3V3WA 1NP2A 3MI3A 3AALA 3HIJA 3P80A 3N3TA 1EOMA 1PZ1A 2NUYA 2Y5SA 3IGHX 3T0AA 4RK8A 4HMCA 5A2AA 1NQKA 5J5DA 1AK5A 4RX0A 8RUCA 3R6IA 1SO5A 5HINA 4PMYA 2A2IA 3ANYA 1YBQB 3ZLGA 3BAJA 3VIPA 1TV5A 1LWHA 3MB9A 4HNOA 2WLYA 5GQBA 3LTPA 3O9NA 5ABEA 5EY5A 3ARWA 1SQ7A 4H9TA 3AXIA 1XSKA 2GK1B 1EA9C 1E1EA 4GLEA 2QS8A 2XN2A 4FSAA 5LNSA 3T09A 1Z42A 3GZAA 3W75A 4L56A 1POKA 4JIIX 1I0BA 1BGAA 4F40A 4F2BA 1ZCOA 4C6QA 2V30A 3W22A 2VUNA 3WK0A 4MF4A 2PWDA 3S1UA 1K6WA 1XIIA 1DJNA 3GNXA 1MQRA 5BXPA 5B80A 5CCZA 2XVPA 3UWUA 3KX6A 2QKFA 3S5NA 4P8UA 2H6RA 3WQWA 1GCYA 3V0UA 2FGBA 3TN4A 1DE6A 3BZJA 1OFAA 3U8GA 4LWWA 2CLIA 1KRMA 4JKKA 4Q4RA 4WY0F 2W79A 2J77A 3NPVA 1XGDA 4H2HA 2QUTA 1W5MA 1FKWA 4G6CA 1TB3A 5HPCA 4S3DA 3B4UA 1JGMA 4PUDA 3UQNA 1PPIA 4UCFA 4CU7A 1R46A 5G4HC 4IOTA 5CZTA 2BSLA 4RZBA 4XKYB 3RF9A 3NQCA 4TV5A 4XD4A 3OO2A 3WELA 3CBWA 3D6NA 1LLZA 3B8DA 2YYUA 2VGIA 4AIBA 1UZDA 1VH7A 3THDA 3MUY1 4RXFA 3O3RA 3LSBA 4NRSA 4LPCA 4DJFC 1FHLA 4NXKA 4LALA 5K7JA 3B0PA 3ZIZA 4ADUA 2XUCA 2PTYA 3IIXA 4O1FA 2CLHA 1DHPA 2P3EA 3GUGA 4XSLA 1B90A 1F2JA 4NNAA 3U3HA 1JPKA 3SQMA 4DRSA 4E38A 4UTJA 3WBAA 4J9JA 1G4TA 2XU2A 2VQTA 2FLIA 3UG3A 3QQWA 5D4YA 1R30A 4YHEA 2NUWA 3KCJA 1IV8A 3P7YA 3VIGA 4FF5A 4ZE5A 3UJFA 3EAUA 2E9MA 4IXXA 3UWYA 4DZHA 3M0YA 4A3QA 3WBYA 2HISA 2XSBA 3MSGA 2FKPA 4AX6A 4JHOA 3QZ6A 1GKQA 2J7FA 1AL7A 5CPQA 2G3MA 4E4UA 4HOWA 1E6NA 2ZTJA 3ZR4A 2CHOA 5BNKA 1V02A 3MWCA 2ISDA 5I0DA 3A12A 2YLAA 4CCCA 1FWIC 4ZE4A 2E9BA 1ADOA 1OCQA 4TXEA 4Y90A 4JXCA 2GDQA 5HBFA 1UWAA 1G4EA 4UTWA 3P81A 3CAQA 4OJYA 2H9AA 1RXOB 1S3HA 4QAWA 3TA6A 4IHCA 2VELA 2AMXA 3WUBA 1J8VA 2QUMA 1CGVA 4AWSA 1MMFA 1M68A 1TA3B 1JDEA 1WZMA 4AUBA 3L66A 4Z2KA 1FKXA 3CB3A 3DG7A 4JL1A 2GYIA 4WY0A 2DEPA 4V28A 2F6KA 5CGQA 3U2ZA 5F4XA 5GJMA 4UTMA 1ALDA 1NVMA 4IWWA 2XGBA 2AQVA 4HPHA 4MWAE 4BEUA 1GPFA 1XIFA 2GVEA 3FJNA 4Z2JA 1SO4A 2TODA 3B0UX 1LL6A 4D9PA 3HQ1A 3VC6A 4L1GA 1EOKA 2X2YA 4DXKA 2BY2A 1W0MA 3K4WA 4YU1A 1V3JA 2Y8UA 4Q6XA 4O1BA 1B3WA 2OZ8A 4UTTC 3Q45A 3SRKA 3MUXA 2V3EA 1LTDA 4ECLA 5LNRA 2FPVA 3LPOA 1XYCA 2R6OA 5GPRA 4YNGA 3ITYA 1VBGA 3WNLA 3TJIA 4PRRA 2D2OA 5A6LA 1QUMA 4C6BA 1V0MA 1P0NA 3AFBA 5JMUA 4E2DA 4RDYA 1XDJA 3QR1A 2HVMA 4N42A 3GC5A 1E55A 3OLEA 3EDDA 3FOKA 4W84A 3TQVA 2A3CA 4ZMGA 1I75A 5C2GA 2CBVA 3TU9A 1MEHA 3ZWTA 4S3KA 5I24A 1BWVA 3WCZA 1VJSA 2BTMA 3VIIA 2R82A 1Q7ZA 2DSZA 4WD0A 1OIMA 1P0KA 3CUZA 1L6WA 7ODCA 3L4XA 1IZKA 1D2KA 2GDVA 1M65A 2GGJA 3WH6A 2WANA 2E28A 3K4DA 2VD8A 2BWGA 1ZALA 4JY8A 4M0XA 3WN6A 1UQZA 3SY5A 1FH9A 1A5MC 3KE0A 3QYQA 1QWGA 4DM1A 3LG3A 1K9FA 1TWIA 3EYPA 3ZQ9A 1XIEA 4MUPA 3LA4A 2H9AB 1GKRA 4V1XA 3W02A 4OBRA 4NAFB 3LENA 2WJDA 4B9YA 1ZNNA 3VIFA 2GVYA 3O0KA 3KBNA 3W1QA 2VFGA 5K9DA 1EPVA 2V9DA 1K3UA 1UR3M 3U4FA 1G0CA 1UASA 3MP5A 2Z1VA 4WY0B 3BGGA 4XZNX 2GWGA 3EX3A 5CAKA 2PB1A 1C7SA 3GC2A 4DJDC 1JRCA 1WBHA 4I90A 1C8YA 3BXWA 2Z6JA 1LL7A 1JG9A 2GLKA 3GSMA 3K8MA 4J5NA 1WYIA 1H7RA 1BKHA 1UZ1A 5DY2A 3VUPA 1OABA 1VEPA 2CU0A 4OOZA 3NVDA 3AU2A 3EEZA 4JFVA 3DZ1A 1BAGA 4LJ3A 4Q8QA 4BKNA 1H0GA 3VYLA 4RDWA 1QBBA 1KGXA 1OC7A 3LK6A 4LOCA 5D2TA 3W76A 2QIIA 2I17A 2G97A 3ATZA 2BBFA 3QYSA 5FOOA 4PEKA 2JF6A 3W29A 5M5DA 3L5LA 3OYZA 3PNZA 2E7FA 3V7PA 4A21A 1U1JA 1AJZA 4EANA 2Z2AA 3HOJA 3SR7A 5AECA 5KSWA 5KMYA 4JTTA 1V6YA 1N2VA 3P14A 1OSEA 4O10A 2ACRA 1DJHA 2NSOA 3N2OA 1FOBA 2ZWZA 1E73M 2A7RA 1O1HA 3KW3A 2EO7A 3PY2A 5CQ1A 1LQAA 1OCBA 4UTHA 1DPMA 2CESA 3S2JA 1TJ2A 2PDIA 1GOXA 2VI0A 3FFSA 4E5TA 3ZT6A 3IJ7A 5CEWA 2QDGA 2PBGA 4JNYA 3N2TA 5D9OA 1QASA 3AS3A 1TV8A 3EB4A 2YPIA 3W7MA 1KGWA 3DERA 1VS1A 3CV1A 4C60A 3WFZA 3ZJ8A 1F73A 3FHAA 3IACA 5KZ6A 1E9LA 2C0HA 2VM8A 1VZWA 2PWUA 1I4NA 3WDHA 1XGZA 2DORA 4FHAA 3VIOA 5DT5A 3ZLFA 2QJMA 4OFCA 2ZOXA 1HO4A 1PWMA 1QXLA 3WLMA 1FCUA 3ELFA 3G22A 2GSJA 2J9ZA 1MWOA 4GBDA 3BG3A 2JQXA 3WH7A 5LGZA 3VMPA 1GOOA 4PUNA 3ABSA 3E0VA 1Z32X 5AN7A 1SW0A 5AKQA 2QCGA 2R24A 1P7TA 2J7HA 5T8GA 1SZFA 5EGRA 5D33A 2GJLA 4RW5A 1U5HA 3LCHA 1B54A 1G4SA 3IJDA 1DXEA 4KGLA 2WAGA 3UCCA 4HVXA 1F3WA 7XIMA 2YDSA 1UC5A 4DIAA 2W92A 3R8HA 3WNPA 1WKFA 5AC6A 1TV4A 3W82A 1EZ2A 4LAOA 3W85A 1W9VA 1CDGA 4L65A 1EPXA 3IJ8A 3HO8A 3LBCA 1XYLA 3T78A 3PUDA 2CETA 5I5RA 4P7QA 5B7ZA 3TTOA 4RNIA 1C9DA 3WF3A 2E6DA 3R7MA 3AS0A 3AIUA 4MUZA 1L2UA 1CWYA 3BLOA 4B91A 4AMCA 3TFXA 4S3FA 1DJGA 4GINA 4CLMA 3WO8A 2FH8A 4L6OA 3D3AA 4XTIA 3N9KA 3H8AA 1TMQA 3UJ2A 4J28A 1F8MA 4R7WA 4D71A 2NX9A 1KM3A 4LYQA 1OINA 1H51A 4Z1AA 5D09A 4LF1A 2Y7EA 1TZ9A 2CBIA 4NZCA 4KCTA 3QGVA 1XIJA 1GHRA 4TMCA 1TKKA 3B8VA 3UWZA 2YBUA 4TTGA 3C6CA 3W73A 3WFLA 2MNRA 1RR2A 4BK9A 1JZ8A 1C9WA 2XJ7A 1IWPA 4C7FA 1K77A 1X6LA 3MMDA 4WDWA 2Y6ZA 4NAEA 1QO5A 3F4VA 1FQ0A 1TTJA 4PBEA 4QP0A 4FXSA 4PCPA 4GY1A 4R9XA 3NZRA 1JUKA 2TSYA 3ZJ6A 3MMUA 2VP8A 4GYPA 1GPWA 2OODA 2R1PA 3GXFA 2VVSA 3PAOA 4DLFA 1M01A 3WMBA 2NSXA 3CQKA 3HFYA 1RY8A 1IWAA 4BS0A 3PSWA 4HGXA 1S5NA 1HGYA 4HNCA 1JI1A 3B05A 3AMDA 1M41A 5D32A 3BJTA 1V51A 2QCDA 4MTVA 4PMNA 4RE2A 1QAPA 3HG4A 5J04A 5CZSA 3UCQA 5AHLA 4JGDA 1VBJA 3P82A 4S1FA 5J5RA 1POJA 3AHZA 1K7FA 3K4AA 4DELA 2O0TA 4HA3A 4K3ZA 1OX4A 1MZRA 2FTPA 4Z08A 1FHVA 2KAUC 2PF0A 3H4XA 1I1XA 2CBJA 3P62A 4XD5A 1J01A 2REQB 3KVLA 1W5NA 1EUAA 3LLFA 2VT0A 2Z25A 4AY7A 3A13A 4ROQA 3Q4DA 2E1DA 3ITTA 4NNCA 3AHTA 4OE7A 3UBPC 3TYZA 2WMIA 3E49A 1Q6LA 4HA1A 1H62A 3W7PA 1LQ2A 1MEIA 2WPBA 1Q6CA 4XZ9A 3GH7A 1X6UA 2WBKA 1AD4A 4GX8A 2D23A 1I1WA 1YDYA 3LRMA 4ZO6A 2A3AA 3LPFA 4QDWA 5AVHA 3APGA 3FAWA 3LBMA 4UQ9A 3KVJA 2CWNA 3WUFA 1TR9A 4XBKA 2Z7GA 2UWFA 2FVMA 3DFQA 1JJKA 2A3BA 1Q6OA 2DV0A 3FEMA 3NL5A 1BGGA 2JF7A 4F9JA 4JY9A 1R3VA 3TQPA 1XQKA 2WOQA 2CZFA 1E56A 4BF5A 3OBAA 4KKXA 1YRRA 1X1OA 1BD0A 4H6KA 4PULA 2Z1KA 4MNMA 4Y96A 1FCQA 1J6PA 3AI0A 3TZFA 4DNMA 3N6JA 3P93A 3CIVA 2QHAA 3GHRA 1ZU8A 3S9ZA 3EWUA 3D46A 3SSZA 3OBKA 2VCCA 4ZFCA 3WQPA 3H4WA 1BYDA 3KXQA 5HMSA 2XH7A 1TPFA 3CUJA 4U28A 5A8OA 4DXVA 1AD1A 2W66A 2OLHA 5E0FA 4DWSA 4H1ZA 4LC8A 1H7NA 2X7WA 3M6DA 4A29A 1L2QA 1CTNA 3BL3A 1QPRA 1RD6A 1A5LC 5BROA 4MVAA 1I45A 3UR8A 2J74A 1CXFA 2PLCA 2ZUWA 2GQ9A 2C16A 1X8CA 4Y9PA 5IDZA 1W5PA 3GLCA 2ZA2A 1YKWA 3I65A 2HDJA 1TX0A 3LV5A 3RRAA 3NJ3A 1D8WA 1NWSA 1RA5A 1OX4B 4IGMA 4LB3A 4JTKA 4GYKA 1YYAA 4LF2A 4UFHA 4MB4A 1J2BA 4PTDA 4S3BA 2DJLA 3TTQA 4L4LA 2C79A 3PZGA 4NF7A 3LRKA 4ZOCA 3VINA 2XH0A 3AIBA 3GTIA 4DJEA 4Q8PA 3S6TA 5IOBA 3C52A 3A3XA 4AXKA 3RCYA 2YR1A 4C6DA 5CGTA 2WMIB 3GKFA 4IISA 3C56A 1FX6A 3S42A 5ABFA 4K1WA 5D05A 3ORWA 3RN6A 1KC7A 4PUUA 1VCVA 1YTDA 3S2MA 4YYFA 5F2LA 1B4KA 1H61A 1H7OA 5TD4A 3TX9A 4AZ5A 2G3NA 4QG6A 4OTKA 4A4AA 2YOCA 3KEHA 3LPGA 4S3EA 3I6EA 4W5UA 1EO5A 2WZTA 3THAA 3W9ZA 1ISWA 4XV0A 1SZNA 1XJBA 4U2ZA 3TJ4A 4BEQA 2BB0A 3PS7A 3F2BA 4KETA 1LLOA 4KESA 2OTDA 4S3GA 4UIOA 3STCA 1XX1A 4A3RA 2WK2A 4PMDA 3DFHA 2Y85A 4WOQA 2PUZA 2GZXA 5FJRA 3W81A 1HO1A 3MI2A 2G37A 1XSIA 5AYXA 3W1NA 2OOFA 5EL1A 1YIXA 3N29A 2ASHA 3MVIA 3C0LA 2PCEA 3U2CA 4Y6GA 3DC8A 3MJMA 5DBTA 2G0WA 1SFTA 3WMSA 3Q94A 3G6LA 1XP3A 2VZVA 3SAZA 5A69A 3TWAA 1B31A 2BXVA 3BANA 3KVMA 7CGTA 1B30A 8XIAA 4IQDA 2PGWA 5EKYA 1UYQA 1LLWA 2Q8ZA 4IPPA 1E5JA 2QCEA 5TQLA 2IW0A 4HMEA 4U3AA 3GBDA 3T44A 3QW4B 3GIYA 1BKSA 2CLEA 1EC8A 3M5XA 3T0CA 3WSUA 1BHGA 3MI6A 1AQ0A 3WF0A 1XRTA 4J7RA 4YL2A 1XCFA 4ZTYA 3MANA 3ABOA 2QEZA 1YPXA 1U2YA 1WX0A 3WLLA 3WEMA 1J96A 2Z24A 5BOFA 4J35A 1EJSC 1EYWA 4XZBA 3LTYA 4W86A 3MSYA 3M64A 1DWHM 3GXNA 4Q8WA 2Z7KA 4F0LA 3L7RA 3E3HA 4UTIA 4G7EA 3L21A 3FNDA 3MO7A 4UFKA 3URQA 3CYJA 3K30A 4JQ1A 4MNKA 3NQBA 3GK0A 4PBGA 1T7LA 1XC6A 1KBLA 5FESA 1JPHA 2NLIA 5ABFB 4JNZA 3ABRA 2E5BA 4AH7A 3MVTA 3UWVA 1LF1A 1DKWA 1C92A 3P74A 5DXXA 4INFA 3IRSA 4C1NA 1DJIA 1Q65A 1FWHC 5PTDA 5A6BA 1PAMA 2VX5A 2D73A 3SQLA 1NOWA 1MDLA 1UKQA 3KHDA 1J0IA 1W6TA 4WRHA 4CGTA 1CT5A 4UTKA 4JQ3A 4Z1DA 1KO0A 4AY8A 1S2AA 1RBAA 3GW0A 2Y63A 2ZYFA 5HXMA 1K02A 4LUTA 3EWBX 3GR4A 4FXFA 2CLKA 2F84A 2J24A 2V5BA 3NDOA 3B0VC 1BYAA 4Q3MA 3AHYA 3LCGA 3DH7A 4WKFA 1YPIA 2VFFA 2QZRA 1RLDA 3ARRA 3PBGA 5LA1A 3GVQA 4MLJA 3S6DA 3BQ6A 3ZVIA 3RXZA 1BWLA 1LT8A 2DIKA 2WPGA 2BDQA 2BY1A 4RR4A 3AUOA 4F79A 4XIAA 5DMLA 3M1ZA 2FZ9A 2I1OA 4Q33A 3MSDA 3OODA 4KWVA 2CZEA 3NSNA 3H6OA 3TCSA 4J3UA 1RQHA 2ZXBA 1JULA 3S1WA 1JNDA 2G3IA 2QULA 4H7ZA 1AH3A 2QLYA 2EPMX 2EPOA 3IVTA 3NM3A 1IZCA 2QCLA 1MUCA 4CD8A 2CKRA 3G1RA 3GZ3A 4K68A 2C18A 1PL9A 4HU8A 5C9ZA 3N11A 2PDNA 3CZEA 3SSJA 2XWDA 1CGTA 1OQFA 2XDFA 3MSRA 4G7EB 4NJJA 4ORMA 3ZJ7A 3SRHA 4PUJA 1IT0A 4EAYA 5F2IA 5M17A 1NF0A 4NI3A 1TCMA 3KRSA 4KWSA 3KDNA 2WZMA 2J7EA 3RDKA 3OIHA 4W4QA 3S6OA 4B5XA 3VKKA 3VO0A 5FKYA 1FDZA 4CD4A 3PUGA 5DMNA 3NGFA 2EJ1A 1F4HA 1YQ2A 1TJRA 4EPBC 1ICPA 2V67A 1G1YA 1H09A 3WD0A 2XVLA 4C6EA 5A5WA 3VFLA 5BWFA 2A7NA 3UEQA 1DJWA 1FWTA 5HWNA 2CNCA 4N9EA 2WCAA 1OYCA 1R87A 3WLNA 3H4GA 3W1XA 1PIGA 4C6NA 5DCDA 3GXMA 4RV3A 3W7HA 3IUHA 4TOQA 1CGYA 5A6KA 1UKOA 4LUTB 2PRLA 4M8UA 4Y8FA 1H1ZA 2B7NA 4UQBA 3UERA 3MKKA 2RAGA 4QEEA 1J0HA 1I9CB 1MW3A 3QMRA 3SEPA 4PSPA 4AZGA 1N8IA 1MYRA 2GJXB 2AKZA 3L5MA 3DUGA 4JTIA 4MJZA 3MC5A 4Y7EA 2PRHA 3KL3A 1VP5A 4EAMA 3PUOA 2AL2A 1R9ZA 4GRSA 2B31A 2VMFA 2IQDA 4AWTA 2VR5A 3QZAA 1NIUA 1A5KC 2AAMA 5FI8A 4CKQA 2NQJA 2RGMA 2QDDA 1KXVA 4IIGA 3QQ1A 4WKAA 4DXXA 3IIZA 5A2BA 3TR9A 1QPNA 1G9HA 3A3HA 1RK5A 1X1NA 1HP4A 2RJHA 3O05A 3QF0A 5D2VA 3DBNA 3CM4A 1NFGA 3W1UA 2PPGA 1GJUA 4GH1A 2X8RA 4PEEA 2C6QA 2JGQA 1V7YA 4IPLA 3QQ0A 3SB0A 2QGYA 1D9EA 4GZ7A 4PMQA 2GJRA 3S2LA 1B0IA 3BMWA 4ZB0A 4JFWA 3CT2A 2X16A 3BLKA 3D3FA 3R43A 4W8LA 1IEQA 2YB1A 5FAJA 3AAMA 4JD4A 2WC7A 3NTYA 3FY1A 3NQFA 1SW3A 2XG9A 1F6YA 3HPXA 4Q22A 3UWWA 4D6HA 1TWZA 1K8CA 2VDIA 5JU6A 2GGHA 1E9IA 1XXXA 5LIUX 2XWEA 3JU2A 3O6CA 4EXAA 4YWSA 3QKZA 3AMLA 3EX2A 3V18A 1OFRA 4NILA 4ILSA 2XIIA 4FNSA 4XUYA 3DHPA 4FNTA 5JQ9A 1ZGDA 3IK2A 2J75A 3B4YA 3QY7A 3IVUA 1YADA 3PBMA 2BOEX 2RFGA 1R3QA 4H83A 4EF8A 2GVJA 3PZUA 4Z17A 2QNEA 3GUWA 3CAKA 2VDHA 1J4EA 1UWUA 2WVSA 5HA7A 2TPSA 4WXZA 1CPUA 1EF2A 3NPWA 4FX7A 4BHYA 4C7GA 2C7FA 5IM51 3PP7A 1CXLA 2C0AA 2CZVA 3FEQA 3F03K 4PMUA 3TH6A 3TAOA 2V5LA 4O0KA 1CBGA 3SI9A 2D24A 3NIYA 1MUMA 5HUOA 4J3TA 2XH2A 1HF6A 2L5HA 3AQUA 1YNQA 2GUBA 4JX4A 4AVNA 1PVNA 2B81A 4ZA0A 4U4MA 2GSHA 4GG9A 1DJYA 1YDVA 3BMXA 2HVOA 3OVGA 1M7OA 1TWSA 4I9MA 2EHHA 3PBUA 2QW5A 3THQA 1WOBA 1S1PA 5AHMA 4YTUA 2V5DA 4WR3A 1C8VA 1IXNA 3PB0A 4GHRA 3BLEA 3E0WA 2R8WA 2V5CA 1VPXA 4PL2A 3VDCA 2NQHA 3FX4A 1OD0A 1D7KA 3HJEA 4R7JA 2BHZA 1EQP