3QSTA

Crystal structure of trichomonas vaginalis triosephosphate isomerase tvag_096350 gene (val-45 variant)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
251
structure length
251
Chain Sequence
b'RTFFVGGNWKANPKTVQEAEKLVEMLNGAKVEGNVEVVVAAPFVFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEAGFINIVNSNVHSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase, putative
publication title Crystal structure of Trichomonas vaginalis triosephosphate isomerase TVAG_096350 gene
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 86
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qstA00
3ANYA 2B4GA 2ZYFA 3IIVA 3NL3A 2EAWA 3C2FA 4O14A 5AC7A 5I3HA 3UXDA 2V8ZA 1W54A 2Z1BA 2VC6A 3GNDA 1KLZA 3LRKA 1VHNA 2JBMA 3G1YA 4RXGA 2C16A 4JR5A 1JQXA 3M5XA 3O6DA 3P74A 3BV4A 3Q2DA 2VFIA 2NX3A 3LOTA 4H3DA 4HPXA 3W1QA 4JICA 5FEWA 2HMCA 1UCWA 5G2HA 3EWUA 3O6YX 1OFQA 3S1WA 3NDOA 1DVJA 4RLIA 2WJZA 3ELFA 4GNJA 4LVAA 4LWWA 1PS9A 4HKPA 2ZZ6A 5DELA 2ZRWA 1K03A 3TFCA 2B7PA 1GVSA 1XBVA 3LDVA 2H3BA 4O28A 2NUYA 2R14A 2VEMA 3LHVA 2VFEA 2E6FA 1SSDA 3N19B 5E0KA 4XBKA 1C8VA 1SZFA 3SR7A 3KVJA 4HPJA 4XQ6A 3DFPA 5G2IA 2AQWA 4IWWA 3BW4A 1F6KA 1J5TA 3S5NA 1QNVA 3PF3A 3MMTA 1S5WA 2DORA 3PAJA 1DV7A 1W3IA 4M6QA 1OABA 1X1ZA 3S8HA 2BXVA 1TMHA 4X2RA 3W75A 5DLCA 2JGQA 3DFTA 4N9DA 3UPWA 2VFHA 4ONVA 3W1UA 2V2DA 4O1AA 2X1UA 5E1QA 1K8ZA 2DZPA 1Z42A 1TREA 3W84A 4Q4KA 1R2SA 4N2YA 4FF7A 1PE1A 1H7WA 2BZNA 4LOCA 4O17A 2A4AA 5EA9A 1VLWA 1VQTA 1KM5A 1TPC1 3STGA 2OCZA 5A5WA 3WK0A 3F4WA 5C2XA 2Y7GA 4FNPA 1QO5A 3W7LA 1DOSA 1TTIA 1LBLA 2DJLA 3NQ2A 3E0IA 1AL7A 1O5XA 2JKAA 2JGYA 2WOQA 4LV4A 4O1CA 2E6DA 4LU0A 4MJZA 1YPFA 2E5CA 3GK0A 4YXGA 4O52A 1FCUA 2CW6A 1ZAJA 5D30A 3R12A 3W1XA 4JNMA 8TIMA 1YTEA 3GDKA 2A5HA 3TU9A 3PG8A 4O10A 1TQXA 3M5VA 3BG3A 2DZTA 3EWYA 3FFSA 3TAKA 1KM0A 5GVJA 2GVGA 3WJSA 5FEXA 2YW3A 1LYXA 3PY2A 2YR1A 1JRCA 1ICSA 5FF0A 5H91A 3PSVA 3P60A 3Q58A 4Q32A 4KFNA 3QFEA 4LUIA 4O4VA 2WO5A 5CSRA 3G1VA 4DELA 3LHUA 3GZ3A 5BRBA 5DY2A 2P1FA 1NSJA 2WNQA 3QRHA 1EIXA 4NJIA 3L5LA 5DY3A 2D73A 4JX5A 1OFDA 1S5TA 1QOPA 3IIOA 3DHFA 3LXCA 1X6UA 5K2ZA 1H7NA 2NV1A 2QDHA 2QCDA 3N9RA 1I2QA 3ZFHA 3OG3A 4RXFA 2Q3RA 3MP5A 1O94A 1GQNA 3E49A 3FKRA 3EB2A 3H54A 3WJZA 1JULA 5G1TA 3O15A 2GUUA 2X30A 5G2WA 2QJGA 5AHFA 1MSSA 1TQJA 4TMCA 2BTMA 3MHGA 3GDMA 3C4UA 3THQA 2ZA2A 3GNNA 3ABQA 3CTLA 4JTGA 4DO5A 3DKJA 4RCXA 4O16A 5KINA 1ZENA 4UTLA 5FF3A 1HO1A 4ZQOA 3L9CA 1PHQA 1P0NA 1XCFA 1LP6A 1I45A 1U83A 3NQMA 3W7PA 2X2GA 4RK8A 5I3GA 4O13A 2EGZA 1E51A 1EP1A 2VEPA 1ML1A 1JQVA 2C6QA 1QPNA 1THFD 5LZLA 3I7SA 2OJPA 4Z1DA 3QW4B 1P5BA 3KXQA 1SW0A 1GEQA 1J4EA 2ZZ4A 5K4ZA 3UY8A 3VNDA 3TQ0A 2GQ8A 3W76A 3DFNA 3DAQA 4M5PA 4JTLA 5K4XA 3QMTA 3ABSA 1VYRA 4KWVA 3BW2A 1QPRA 1LOQA 1AMKA 3MBFA 2QCMA 4GC4A 4JGDA 3C52A 3KRZA 1B9BA 3BLIA 4DPPA 1GVRA 4UC5A 2O7QA 1VC4A 3FKKA 1O5KA 3LX9A 1XFBA 1D3HA 3B05A 1DJNA 2AGKA 5HMSA 4CQ8A 4PH6A 1TPUA 4WZHA 1GVOA 3TSMA 4JYFA 3S9YA 4BK9A 5I3IA 3S5ZA 3TR2A 3A22A 1KM6A 4RR4A 1EPXA 3R89A 2QUTA 5AHNA 3LHTA 5K9DA 4KWWA 4JY9A 1P0KA 1JCJA 3QW3A 1FWSA 1SO3A 1TJPA 2RH9A 3LXBA 3BARA 1F6PA 4U28A 1LCOA 2ZTJA 1BEUA 3R5EA 1GG0A 1J2WA 2ZRXA 3TNOA 2A1YA 1KM1A 2WV8A 1IXQA 4NNBA 1TPB1 1G4TA 3O1NA 3VFLA 2AAMA 1DQXA 5J5DA 2CLMA 4M6VA 1QR7A 3C3NA 1PL9A 5DN1A 2C19A 3HOJA 1KFJA 2A6LA 2UV8G 1RPXA 5HNRA 4R33A 1VYSX 3T7VA 2CU0A 1QWGA 4A2RA 3MUXA 5TQLA 3W7RA 4ZQNA 1XI3A 1YDNA 4QQ3A 4MUZA 4R34A 3LI0A 2Y7EA 5LNRA 4KFOA 1SFJA 1OFBA 3G22A 1TB3A 1VR6A 3TW7A 4YCPA 2Y70A 5L6UA 1FY6A 1RZMA 3W2KA 2Y61A 1W5OA 4ZQRA 2YDAA 3I65A 4FNQA 1UUMA 4LRSA 3UNDA 3ZWSA 1QPOA 3M9YA 3SZ8A 2V82A 3L65A 4LVGA 1OVDA 3GXPA 5D2WA 2WQPA 3QPYA 3TDFA 4ICNA 3EX3A 3SJ3A 1Z48A 3HF3A 4DBEA 4GUIA 1F05A 5D2VA 3LV5A 2I9EA 3TJLA 3NNTA 1FDJA 1JCNA 4UR8A 3W3OA 5CZSA 3W9ZA 1G4PA 2OT0A 3GDLA 3N14A 3SECA 3GB6A 4DBDA 3QEZA 3A5FA 1WV2A 2W6RA 3CIWA 4L4MA 1B3OA 1EUAA 4BI7A 1KM3A 5FEPA 4FHAA 1G69A 2C3ZA 3L21A 2V0TA 2ISVA 4JTKA 4EVZA 3UWZA 4AMAA 3BPWA 3I6RA 3LGEA 3ZR4A 3E9AA 1WOAA 4CCCA 3E12A 4IX2A 1TPWA 3GVGA 1FWWA 2VEKA 3MP3A 2VKZG 5D03A 1X8FA 1SPQA 4OU1A 3L5AA 4O57A 3V75A 1LRQA 1ZJIA 4X22A 1H50A 3LCWA 1W3NA 3SY5A 1M7OA 3W7KA 2ZZ5A 1XKYA 3WJXA 2FLIA 3RNDA 1O4UA 2B7QA 4AXKA 1TTJA 4UMAA 5CPLA 4UNLA 1H7RA 4AWTA 1W5QA 3NZRA 3CIXA 3G0UA 4O50A 3DBPA 5BOOA 4GRSA 2GQAA 1SZGA 5HWJA 4KKXA 1WOBA 1R2RA 1Q6LA 3P81A 5EY5A 3STCA 3B06A 2YFOA 1Q6QA 2E6YA 3CC1A 3NAVA 4UUIA 4AVFA 4IMCA 1MEWA 4NUWA 1BWKA 2ALDA 3W73A 1P1XA 3KOFA 3TC7A 3QPZA 4N4PA 2J9XA 3WJWA 4XBSA 1TRDA 3U6WA 3C56A 3QJAA 3CWOX 3HG2A 4JXCA 3H53A 3RF9A 1MO0A 3CT7A 3TE9A 4UTJA 3BG5A 4IJBA 2H8ZA 2ATMA 1TTQA 1WYIA 3GR7A 1P4CA 2ZA3A 1AK5A 4OT7A 1RQBA 2CLOA 2QCFA 1FWRA 2Y7FA 1Q6OA 2A7PA 1WX0A 3R2GA 3MI3A 1V5XA 1GVFA 2BLEA 1R30A 1VHCA 4Z0JA 3S42A 4DF2A 2HS6A 4HNTA 2CLLA 1WA3A 2W0UA 3B4UA 5F4SA 1VS1A 3GX9A 1VZWA 4FXSA 3E96A 3KVLA 3HGSA 3LHYA 3DH7A 4X3ZA 1KM2A 5MHBA 1S3HA 4FIRA 5K9CA 3PUOA 1H61A 3C6CA 3LTPA 4Z1BA 3A21A 2RHGA 4QISA 1JCMP 4LVFA 1TPH1 4HN4A 4QSHA 2OT1A 2R8WA 3P8JA 3PUDA 1TYGA 2CLEA 1TPEA 4GXMA 3GXTA 1I2RA 1JR1A 3WK3A 1GT8A 1LOSA 1A5BA 1YDVA 4TIMA 1OJXA 1W31A 5D2YA 2QCHA 1A5SA 4LNYA 1D9EA 1B57A 2DP3A 4UFLA 1VLIA 5KITA 1O95A 1B4KA 4ZQPA 1XUZA 1UJPA 5KZMA 2Q8ZA 3L68A 3W7DA 1JCLA 3BLFA 3G0SA 3TKFA 4UTHA 4HNUA 1SW7A 2QCGA 4U4MA 4R53A 4GUHA 1IXNA 1YTKA 3UZ5A 1FCQA 2GPTA 2J9YA 3MI2A 4I7WA 2GJLA 4UTIA 4FIQA 1FX6A 1GWJA 1OK4A 4M6PA 1I8JA 4NJJA 3UPBA 1OF6A 3PUEA 2NWSA 3GR8A 3NQVA 3LXAA 1VCGA 1OFPA 2YGYA 3EWXA 3BG9A 1CI1A 4IPJA 4JD4A 3P5ZA 4LC8A 2X1SA 4MVAA 4BI5A 3S5OA 4TO8A 2PRHA 3M5YA 1W3TA 3GYEA 3BGGA 3N73A 4WY0F 1M5WA 1RD5A 3C2VA 4JIQA 1GYNA 5LGXA 5HR7A 1GG1A 2C15A 2RFGA 4E38A 2YSWA 4LTSA 1OHLA 1T96A 1H60A 1MXSA 2QEZA 3PVFA 1W5PA 4WXYA 3FA5A 3EKLA 1F76A 4O15A 1GZGA 1AG1O 5FF4A 2ABBA 1L6WA 4A2SA 1NF0A 4O11A 5HJLA 1DHPA 2QUVA 2J88A 3IGXA 3HIJA 2DU2A 3PSWA 3G1AA 4I7UA 1S5VA 2RDWA 2DZWA 5AC8A 2J24A 3P5YA 3HGOA 4MKNA 1JUKA 4UXDA 1KFLA 2I1OA 4IX0A 4DF0A 1IGSA 3S5YA 3U2OA 4MZYA 2V5BA 3NPXA 3SIZA 5G4WA 2FIQA 2QCEA 3GAYA 3PBWA 1L9WA 3W70A 5LNVA 3W22A 5A8GA 3DI0A 2NLIA 3OHIA 2HSAA 3UQNA 2WSYA 4YCOA 1TJRA 3LCFA 2NXIA 5LSMA 3NM1A 2H90A 1R46A 2W79A 4MY9A 2A6NA 3W7CA 3HGJA 4CLMA 3HG5A 5K7JA 2WKJA 1RQEA 4EOUA 1G4SA 2C1HA 3UY7A 1H51A 4OV9A 1H63A 3N2XA 3W7OA 5BMXA 4MZ8A 4S2BA 4RX0A 5IBXC 1XC4A 2VFFA 4UFIA 3O8AA 4QIUA 1NFBA 1SO4A 3F03K 5K9XA 1ZAIA 1TV8A 4AHOA 1TPDA 5F4XA 4A22A 3NL6A 2NXHA 1JRBA 4NU7A 4MLRA 3LHWA 3TAOA 2YW4A 3G1HA 2ZRYA 2FPYA 4LS1A 3P8IA 1XBXA 3CPRA 1QFEA 2B7OA 1SW3A 3O16A 5BNKA 4FO4A 3NGJA 4HT3A 4OE7A 2A7NA 7TIMA 1T99A 2ZCGA 3W1AA 4TR9A 2BSLA 2H3DA 3CM4A 1ZY9A 4Y8FA 1RQHA 5I3JA 2ZFAA 2NX9A 2HTMA 2C18A 2PRLA 3T4CA 1I2NA 1JUEA 3EEGA 1QOQA 4ADTA 2GOUA 5TBOA 3T78A 2V9DA 2PRMA 4NJHA 2BWGA 3PBYA 4MYXA 3W7MA 2XN2A 4BF9A 1W5MA 2WNZA 3STFA 1HL2A 4S2CA 2V30A 4AAJA 4Z1AA 1WXJA 3G1SA 4AB4A 2FJKA 3UYCA 4O19A 1ZCOA 2V2CA 4N9EA 5D02A 3L5MA 4QAIA 1EA0A 4W9TA 3BK0A 1TRIA 2E09A 2E1DA 5KMYA 1KBIA 3GKAA 1QCWA 2P0OA 3PB2A 4LVDA 4CQAA 1A50A 3LCIA 4I9AA 2CZFA 3IRDA 4N6EA 3W72A 1DQWA 3V1PA 3O6CA 4DQWA 3HPZA 4ZQMA 4IQLA 2YFNA 2ZA1A 4Y96A 3AJXA 1YYAA 2KZHA 1HO4A 1KBJA 2QCCA 1OYAA 5CZTA 2ZRZA 3W7HA 2YYUA 3HBLA 3JRKA 3EX4A 4LC6A 5EMUA 3QSRA 2ZBTA 3HPSA 1GYLA 1SO5A 2VXNA 3NZ1A 4NXSA 3TW6A 5FF2A 4QJ1A 2YCEA 4JDYA 3LRMA 1EP2A 5D38A 4IPIA 3DXIA 3G24A 3DI1A 1TSIA 4UCGA 4IUOA 3A24A 3WK1A 5BW6A 5FESA 3B03A 3GDTA 5LGZA 5HWMA 3F4NA 2Q3OA 3KRUA 3PR2A 1KV5A 3DFSA 3LLDA 4EF8A 4O53A 5C54A 1SZEA 5IBXA 4FNSA 3NOEA 3A5VA 4C1KA 1OFEA 3L0GA 4ZL1A 2TPSA 3CQ0A 2NX1A 4PEKA 3M43A 3DKLA 1PV8A 2FPTA 2C0AA 5J5RA 1I2OA 4UMCA 3IVSA 4MYAA 1V7YA 1LBFA 4LRTA 4IXXA 1JCXA 1KV8A 3ABOA 4L4LA 1TTPA 3HPXA 1K7EA 3NG3A 1LM1A 2NXGA 1N55A 3BGJA 4K38A 3TX9A 3W7NA 3EWZA 3IGUA 1ZNNA 1XDMA 5CGQA 1ADOA 3EWBX 2Y6ZA 3HQ1A 3PM6A 3W2NA 1SZNA 3BW3A 1H7XA 3ATYA 4P2VA 1OX4B 2QDGA 5KZDA 1F74A 4WX2A 4LUJA 4HNVA 3FOKA 3MHUA 4K37A 3NPWA 3QMSA 2RDUA 2J6XA 1F2JA 3N34A 2EPHA 1R2TA 3UD6A 3P62A 1OYBA 2HS8A 4LVBA 3NO5A 1YXDA 2G95A 2I14A 1OF8A 1H7OA 2JKPA 1PCKA 1FWNA 3LI1A 3P82A 1IIGA 5FI8A 2WSQA 3TJXA 1G7VA 2FTPA 3G1DA 1QAPA 4Z0SA 1AL8A 2OZ0A 1ME7A 3O07A 3S1UA 5DXYA 4EF9A 4MIMA 3DHDA 2QJIA 2ZTKA 3IIXA 1BWLA 2GQ9A 5AB3A 2A85A 4Y6GA 4NVTA 5KSWA 1XUUA 1MEHA 3C2EA 2VELA 4UTMA 3TCEA 1KW1A 1NAL1 1ZFJA 5G4EA 3N9SA 4PL2A 5EYWA 3W2MA 1ICQA 3TXZA 1TCDA 1WBJA 3LM7A 1UBSA 4FX6M 2FB2A 4DEFA 3RU6A 3W1MA 4WY0B 1LLZA 4JDBA 1FUYA 4QNWA 2VFGA 4E2BA 3KVKA 5H2ZA 4S1FA 4NNAA 5D2TA 4MFEA 4MFDA 3GAKA 1CX9A 4K7VA 3W83A 3S1XA 4MZ1A 5AHIA 5F1VA 2P10A 2QJHA 2A21A 3NL5A 2NWRA 4HSNA 4BWLA 2FDSA 4JTUA 3WJYA 1FBAA 1LRNA 3P80A 3QC3A 3P67A 2CFFA 2WSRA 1FDZA 1UB3A 1SQ7A 3NQEA 3P61A 4WY0A 1M7PA 2JKEA 1G7UA 3FLUA 2IQTA 3UZJA 1OX6A 3W1RA 1ZALA 3T44A 4XUGA 5T26A 3SSJA 3VKJA 5AYXA 1LZOA 1XBYA 3M1ZA 3NL2A 3WK2A 2X1TA 3W86A 3LHZA 3LV6A 1Z44A 4UTWA 2F7FA 4PCFA 4XKYB 1F5ZA 5AFDA 4AF0B 1RVGA 5F2MA 1VGAA 5FF7A 3QMRA 1LRTA 3HG4A 2Z2UA 4MY1A 1TV5A 2GJNA 3DFOA 3OBKA 4IGHA 1ZAHA 2NUWA 3LCLA 4ORMA 4ZVJA 1HTIA 1YXYA 1IXOA 4ZZ9A 1IIHA 3M41A 1ONRA 4RKAA 2QR6A 3NQ7A 4A21A 5D05A 4N9CA 4OHQA 1IF2A 3DZ1A 1X7FA 4IMFA 5G1YA 5LNWA 3LB0A 5SWUA 3QSTA 3W2UA 4NZFA 3PC0A 5TIMA 3W1TA 4UTTC 3TMLA 3LTYA 3P84A 5AHEA 1WQ5A 1NVMA 1PVNA 4O0KA 5CPNA 1Q45A 3QM3A 1BKSA 2PURA 3G18A 3KVMA 5DCEA 2TRSA 2E77A 3IVUA 3ATZA 2R91A 4NJGA 4YLWA 3PG9A 2VOMA 3W07A 3NR0A 4CNOA 2TSYA 2VEIA 1EX5A 1XDLA 4E2DA 2DZSA 3W7GA 3IEBA 4ADUA 1EEPA 3ABRA 1KFCA 1OYCA 4LY8A 5DCDA 4BR1A 3I7QA 4NQ1A 4GWEA 5HQEA 3IIZA 3EXRA 1G67A 3FJLA 3UWWA 5LHFA 4XWUA 4O18A 3QQ0A 3EXTA 2ZRVA 4POCA 5HR6A 4CQ9A 3TFXA 1U5JA 2ISWA 4NXKA 1RR2A 3VE9A 3LTSA 3W23A 4RZ4A 5C5YA 5HUOA 1EUNA 4FNRA 2CLFA 3HG3A 3OA3A 5CG7A 1Q3NA 5BMWA 3C8FA 1IXPA 4GJ1A 4Z08A 4G1KA 4HSOA 3U8GA 3K30A 3KRSA 4Z1CA 1H7PA 3C0JA 4P61A 2NV2A 3TV8A 1YXCA 2WPBA 3PULA 3W1NA 3BVJA 4N4QA 3L2IA 3MWAA 4JTSA 3H55A 3G3DA 4WJEA 4UMBA 3UXAA 3FS2A 1NEYA 1QDSA 3RMJA 3HO8A 3UWUA 3G1FA 1L2UA 3NM3A 5LHEA 3AO0A 4BI6A 2ZQ0A 4TU1A 4JTFA 4LV9A 1HUVA 1B4EA 1AW5A 2QAPA 3GDRA 4CNPA 2X16A 1A5CA 3NEVA 1TPVA 5AHMA 3IV3A 2YYTA 1TIMA 1UUOA 1OK6A 1SFLA 5ABTA 1DL3A 2CLIA 3EKZA 3I7RA 3N2MA 4MY8A 3ZWTA 2DJXA 3G8RA 4I7VA 1W8SA 4OV4A 1QMLA 5CSSA 4UTTA 4KFPA 4CCEA 3TC6A 6ALDA 3D0CA 2A7RA 2OMAA 4UFHA 3TA6A 3TIMA 2QAFA 3W88A 4ZQCA 3HMJG 3OIXA 3STEA 4K8HA 4AHPA 4JTIA 3B04A 3NYZA 3LCGA 2WNNA 2ZDRA 3RFAA 2QF7A 4PL1A 3TMQA 1VRDA 5CZ0A 5CPMA 3O63A 5F2GA 4FEZA 1TV7A 1Z41A 3M44A 4CCDA 3SI9A 1OFAA 3HB9A 4NT0A 4B5NA 4R7JA 4M19A 4Y90A 1FQ0A 3B0PA 4YWIA 3RK8A 2RKXA 1OFOA 3TXVA 2Z6JA 2Q8LA 5LNUA 4IMEA 1KFKA 1PIIA 4IOTA 4JYEA 1K7FA 3I68A 1AW1A 2ZZ3A 3M6YA 1EB3A 1JVNA 2B0MA 3M0ZA 2QCDB 3UWQA 1KFBA 4MOZA 4AWSA 4UFJA 2TYSA 2R94A 5EKYA 3TH6A 3OVPA 3JR2A 4NNCA 1KTBA 3GKFA 4NX5A 2XN0A 2YZRA 4X9SA 5E93A 5FEZA 2CLHA 3L67A 1LTDA 4CNNA 4LS0A 1KLYA 3FJ6A 5CZJA 4O1BA 1KTCA 3G8EA 3L0KA 5AN7A 1L6YA 1OFRA 5AYZA 3MBDA 1N7KA 1XL9A 3NQCA 3NPVA 3FYOA 4JYDA 4O1DA 4DPQA 1DBTA 2G5WA 2XFWA 4JN6A 4NX0A 3FIGA 1R47A 1XM3A 3P7YA 2PE4A 3CHVA 1H1ZA 1YADA 4ZMGA 3O05A 4H4IA 2Y7DA 2DZXA 4AH7A 5U7SA 3TSBA 3MJYA 4PFMA 3O06A 3S1VA 4NJKA 1SU5A 1ME8A 3OVQA 3W7EA 1JUBA 4Q33A 3L66A 2EF9A 5DBUA 3FEMA 3G0XA 5C55A 2VENA 5EL1A 4LW7A 4UTKA 2ZZ2A 4UFKA 1LBMA 2X1RA 3DENA 4AEOA 1H62A 4HHPA 4N02A 3W1LA 5AOUA 4PODA 3CLMA 5HULA 1UASA 3UWYA 1A53A 1EWEA 1ME9A 3A23A 4HIBA 1OG0A 4JY8A 4UIOA 3W2JA 2E68A 1QPQA 4RJEA 3IIPA 3TSDA 3PB0A 2V5LA 4GUFA 4JTHA 1GTEA 5D2XA 1N8FA 1ALDA 1HFBA 5D04C 3CU2A 4WD0A 4A3UA 1EP3A 3S6DA 4AHQA 2E6AA 2QKFA 3LCXA 5EBUA 3N3MA 5IM51 2Y89A 2YPIA 1G6CA 5F4WA 4FX7A 3E02A 4LS2A 3RLVA 3INPA 1BTMA 2PCQA 3FYPA 3NPUA 3EX1A 3NQDA 3WFAA 1QO2A 1FCBA 1JJKA 2ABAA 5L9FA 1LOLA 3W7IA 3CWNA 3W87A 3MYPA 2FB3A 3R13A 2G96A 1SO6A 1C9DA 1VPXA 2V81A 1KA9F 5CPOA 4BWLC 5KZEA 1VCVA 1W56A 1DJQA 3C2OA 1SUXA 3MI6A 3IVTA 1GPWA 1K02A 1ZHAA 1Y0EA 4K8EA 4AWUA 4IMDA 1LROA 3GXNA 1LLWA 3JS3A 1FXPA 4WOZA 1H1YA 3MHFA 5LNSA 4YMZA 2EHHA 4MLJA 3QYQA 1PCWA 2F84A 2A2IA 3PS7A 2EKCA 4GUJA 4GUGA 3W1PA 4FB7A 1HG3A 3GLCA 3T40A 5D37A 3DU0A 4WQ6A 1SSGA 2J27A 5U4NA 3EXSA 3CEUA 2LLEA 1W1ZA 2ZZ1A 2Z6IA 1EWDA 3LBCA 2FFCA 3NXFA 5HWNA 1G4EA 3NQGA 4TMBA 4UTWC 2B7NA 4O0ZA 5I3FA 1FCVA 2E5DA 4ADSA 3LCHA 4BFAA 4TX9A 1LORA 3QF0A 3TK7A 3W7JA 3BO9A 4GE8A 3TQKA 3A9IA 3LERA 4RV8A 2Y63A 3UWVA 1I2PA 2A0NA 3Q94A 4GBUA 4FXRA 4M7TA 2ZRUA 1NF7A 2QCNA 1MZHA 4O12A 1VJIA 3W2LA 1TO3A 3KX6A 2GVJA 3CEPA 1WAUA 3BLEA 4K7YA 3MP4A 2C13A 1L6SA 4IXHA 3SGZA 2QCLA 4RZ5A 1OX4A 3KFTA 2NZLA 2NUXA 4JTJA 3G3MA 5CKSA 3C61A 1OX5A 2FPVA 2H6RA 1W5NA 5I3KA 5DBTA 2VFDA 1KFEA 5K3VA 3T55A 3NQ6A 3PBVA 4MPQA 3W6YA 2CZ5A 4RZ6A 4H6KA 2E5BA 4D2JA 6TIMA 1M6JA 4JX4A 4OBTA 4O4WA 1K8XA 3YPIA 1RV8A 1AW2A 1K3UA 1WDWA 3Q37A 1XXXA 2Y85A 1ICPA 2CLKA 3NQ8A 3B0VC 3G1XA 4MJMA 3M7WA 1FDYA 4QM1A 2Y88A 3F1QA 2DZUA 3OEXA 3GIYA 2RDTA 5DCBA 1W0MA 4DF1A 3SW6A 1VH7A 3PBUA 3LRLA 4DXVA 4EWND 4C1LA 2G97A 1YLVA 3OVRA 1GVQA 4JS3A 3MYOA 1YTDA 1YPIA 4DO6A 3W74A 4JX6A 4E0CA 3QH2A 4HNNA 1KM4A 3SFKA 3DFQA 3EX6A 1F7BA 4WOQA 1F73A 2ISSA 4DO4A 4XZ9A 1A5AA 1FWTA 1K8YA 3PWAA 4O54A 1X1OA 2H8XA 1LDCA 5D32A 4J9JA 3NQFA 1T8XA 5AHLA 4PA8A 3LBMA 3VE7A 4PTNA 4K36A 3R8RA 1D3GA 4PC8A 3USBA 1XBZA 5EPDA 1CW2A 2YXGA 4A29A 3B0UX 4QNEA 4IMGA 3KAOA 3W85A 4LT9A 2CZEA 4JTEA 2TMDA 4K6AA 1T0OA 4ORIA 1H5YA 2QUUA 3ZS4A 5HUPA 3VI2A 5DXXA 2DZVA 4FX8A 3CB8A 1C29A 3C2RA 3QZEA 5F1UA 4YL2A 4QITA 2JK2A 1I4NA 4JEQA 3EWWA 3W7QA 3B8DA 3TQVA 4ALDA 3TROA 3KHJA 1K7XA 4UR7A 1TPFA 4WXZA 3SGUA 2ATSA 1GTHA 4N9BA 4NZJA 1PHWA 5KTLA 5G5IA 4OWGA 2OX1A 2O7SA 3RLUA 5AC6A 2XN1A 5D33A 3M16A 1YDOA 2YX0A 1WBHA 3M47A 1FXQA 5HINA 2GVLA 4WUIA 3THAA 4OQVA 1VYPX 5AYYA 4Y9AA 3L0NA 1JCYA 1O60A 2C14A 1GJPA 3HGRA 4FNUA 3DGRA 3TUUA 1DORA 1GOXA 4XKYA 2BX7A 3MW7A 4AF0A 5C6MA 4JTTA 3NQAA 4FNTA 1VCFA 2PC4A 4UNKA 4OGZA 4O8RA 5F2IA 1Q6RA 3IGSA 4M7SA 2ZZ7A 3EX2A 2V2HA 4UTUA 3M5ZA 3NA8A 4JIPA 1KTNA 5F2LA 3MO7A 1W37A 3S0CA 3VCRA 1DKWA 3NVTA 3QQ1A 3HJZA 1SR9A 4UFMA 4N6FA 2FQIA 5LKYA 4ML9A 2CWNA 4XTIA 2Y62A 1MEIA 4K39A 4EIVA 3LLFA 5D09A 3W71A 4GFSA 2CZDA 4XTDA 2Z0IA 2J9ZA
chains in the Genus database with same CATH superfamily
2B4GA 3IIVA 1VB9A 2GVYA 2P3ZA 3BMVA 4OKDA 3THCA 2JEPA 2VC6A 4J28A 3LK6A 5A69A 4PUWA 3JW7A 4C6IA 1B0IA 2Z28A 3BJFA 4TX8A 3P74A 2V5KA 2NX3A 4CQBA 2O9PA 1E6ZA 3W1QA 4K2SA 2ZE3A 3GTXA 1W3LA 3A9BA 4CVUA 4L9ZA 3SRHA 3S1WA 1N2VA 2IW0A 3ELFA 4LWWA 4DXXA 1EYEA 3BC9A 3TN6A 5DELA 3IK4A 1J0IA 1Q6FA 4L1WA 1POJA 1VENA 3LSBA 1XBVA 1O5RA 4I9TA 3R25A 2R14A 1DXIA 3U7BA 3LHVA 2O4QA 1SZFA 4GD0A 3SR7A 4TV5A 1M7XA 2B31A 2I5QA 1XGEA 1B54A 2ACSA 3BW4A 4IWWA 2VGIA 5I5RA 1QNVA 3PF3A 3MMTA 2DORA 4JKMA 1YW1A 5TNVA 4F0RA 1W3IA 4P8XA 1ZP3A 4FK9A 1E6NA 3BAKA 1CIUA 3BLOA 2AMGA 2JGQA 2OSXA 1HW6A 3HQNA 3H2AA 1OM0A 2VFHA 2XGBA 2WCSA 2V2DA 5I00A 3H2MA 3BSMA 3E0WA 2DZPA 1Z42A 3W84A 4Q4KA 1R2SA 5CLWA 2IPGA 1K6AA 3WLQA 3D3AA 1GVYA 3CUGA 4N2YA 3OIHA 1PE1A 2BZNA 4O17A 5DRCA 2A4AA 5EA9A 1PX4A 1VQTA 3VC5A 1IV8A 5JQ9A 4HBKA 2PGRA 3M6DA 3N12A 1FFRA 3F4WA 3KL5A 5C2XA 2XVKA 2Y7GA 1NWUA 4AMCA 4FMVA 3E0IA 1AL7A 1J5SA 4LAKA 2WOQA 4JNYA 2CXEA 4NZ1A 2E6DA 3VDCA 1FP9A 3UP8A 4JL1A 4J3UA 1QNSA 2E5CA 4ZEPA 4AISA 4NF7A 3ZLHA 1Z32X 3IJ9A 3R12A 3CQIA 5D30A 8TIMA 1NDVA 1MW0A 1PKNA 3GDKA 1E1CB 2A5HA 3KLLA 1XKJA 4O10A 1TQXA 4CD7A 2UWFA 2QVHA 2DZTA 5ABHA 2YA2A 1KM0A 4GQGA 5GVJA 1WDQA 1LYXA 3MDWA 1JRCA 4Y9MA 1JIBA 2EPLX 1KXVA 5FF0A 3K1DA 4Q32A 3VIOA 1WZAA 2OODA 1ECQA 2YDQA 4HNLA 1UKQA 4LYQA 3GZ3A 4E4FA 1NSJA 2QYGA 1X8CA 4JX5A 1H5VA 1VPQA 4L7ZA 3VM5A 1M1BA 4CQDA 2QCDA 1PUDA 3E2QA 4J4KA 3WNKA 1YE6A 3MP5A 1RK5A 2F61A 3NUKA 1NH6A 1PZ1A 3MSDA 1RPKA 3BQ5A 4GA8A 1MSSA 5FJIA 1WDPA 2D2OA 1UR1A 1J0YA 1JPMA 1XIGA 1CLXA 1AH0A 4PMZA 4Q3MA 3AIQA 4UTFA 1US0A 5KINA 4UTLA 4JIRA 1HO1A 4ZQOA 3IJ8A 1P0NA 4IF2A 1LP6A 1R6WA 2G37A 2X2GA 3S4TA 4HOZA 2VRJA 2L5HA 5I3GA 2EGZA 1FWBC 1VEOA 3UVIA 1EP1A 2VEPA 1YNYA 1THFD 5C2CA 1MW2A 3MO4A 1J79A 1SW0A 1GEQA 1J4EA 4L6OA 2PFHA 3B9EA 3UY8A 3DAQA 3VA8A 4JTLA 4XX6A 1UP3A 3ABSA 1U33A 3MBFA 1P0EA 1U5HA 3KRZA 1B9BA 1RALA 4DPPA 1K9TA 4UC5A 2PLMA 2O7QA 2J77A 3FKKA 3FV9A 3LX9A 1XFBA 2D3LA 1Z6KA 3UZYA 1DJNA 3MA8A 4YYFA 4CQ8A 2IKHA 1N8WA 3ALGA 4WZHA 4JQAA 3S9YA 1KCLA 4BK9A 2PTWA 4YTTA 1HVXA 4E4UA 2NSOA 3S5ZA 3GQYA 1B3VA 1KM6A 1P43A 1EPXA 3R89A 3ARYA 2ZX5A 3PTKA 5ABGA 1W1TA 3PZ9A 1P0KA 2RH9A 1F6PA 4U28A 1EZWA 3T4WA 4HD5A 1BEUA 4C7FA 2ZRXA 3FVDA 4TVDA 4B90A 1KM1A 4HCLA 4NNBA 4ZA0A 2AAMA 4HHMA 2ZC1A 2VGFA 2CLMA 3C3NA 4I9MA 4Q4SA 1TV3A 3HOJA 4AVOA 2UV8G 5HNRA 2C91A 2ZXQA 1S2CA 2XHYA 2OEKA 3ZYZA 1XI3A 1YDNA 2VX4A 4YHEA 4MUZA 3TN4A 1OFBA 3G22A 3I3EA 3H2NA 5GNZA 3TW7A 5L6UA 1RLCL 2PDBA 1RZMA 1UG6A 4H9ZA 3W2KA 2YDAA 3I65A 3KDNA 2NT1A 4M24A 3UNDA 5CPSA 3ZWSA 1QPOA 3M9YA 2V82A 3J7HA 4LVGA 1OVDA 3GXPA 5GJPA 1G01A 2FHBA 8XIAA 1GOQA 2XPKA 2ZUVA 3N29A 2I9EA 3NNTA 3TQPA 2OEMA 5HMDA 3RMEA 1G4PA 3GDLA 3TOPA 3SECA 1S1PA 4PUKA 4DBDA 1WV2A 1MYRA 3AHYA 4L4MA 1E4IA 2ZWZA 1EUAA 4BI7A 1LT8A 1G69A 3VX0A 2UZ9A 4FF5A 2WXDM 3UWZA 3ZZ1A 5CC6A 1TVNA 4ILSA 1WOAA 3E12A 4IX2A 5BZAA 4MB1A 1AH4A 1A47A 2C79A 2V3EA 2VT0A 3ZR6A 2VEKA 1X8FA 1SPQA 3MSRA 2X8RA 2OELA 4A05A 1ONXA 3V7PA 2WHKA 1RA5A 4ZR8A 4WGXA 5CPLA 1SYTA 4IHCA 3NZRA 3CIXA 4O50A 2ACRA 4GRSA 2GQAA 1SZGA 1OT2A 5HWJA 4B3KA 1EQPA 2F6XA 1Q6LA 1SJBA 3B06A 2E6YA 3CC1A 4AVFA 2DH3A 1BWKA 2OWCA 2J9XA 4XBSA 3U6WA 4S3EA 3H53A 1D8WA 5C9UA 4DYEA 4FLQA 2NVDA 2GJPA 4CNUA 3WUGA 4LSBA 4ROQA 5LIXX 4W4QA 4J3SA 2ZA3A 4OT7A 5DX7A 5EMYA 4TQTA 2PPGA 4BQ2A 2A79A 3W37A 3DX5A 2CBIA 2A7PA 1WX0A 3EA1A 3AZRA 1DYSA 1GVFA 1R30A 1VHCA 2HS6A 3ABZA 2W0UA 5F4SA 4MM1A 4F8XA 3NWRA 1UP2A 2PLCA 1JG9A 3E96A 3KVLA 3ITXA 3HGSA 1GORA 3FK4A 2I9UA 1KM2A 2QIWA 5MHBA 4Q4PA 3PANA 3A4JA 5K9CA 1H61A 1DPMA 3ARVA 2BB0A 4QISA 4LVFA 4HN4A 1KR1A 4QSHA 3N2CA 3P8JA 1R3QA 3WD2A 1TYGA 2CLEA 1I2RA 5CC3A 1JR1A 1LOSA 1R5YA 4E2VA 1A5BA 4NI8A 1YDVA 2DPEA 4ENLA 3LMYA 1OJXA 4X0VA 2QCHA 2DP3A 5I78A 2J7BA 1VBJA 1VLIA 3IGHX 1O95A 5JIWA 3CBWA 3SCWA 1JCLA 2CZVA 5C8BB 3TKFA 4UTHA 5M3WA 3KWSA 1D8CA 2QCGA 1V02E 4R53A 1IXNA 1FCQA 5M03A 4GYPA 1CGXA 3MI2A 2GJLA 1S2AA 4HMEA 2I5IA 1HX0A 4FZIA 5CJMA 1RVKA 1H11A 3AIEA 3UPBA 1XYMA 2ONEA 1DJGA 1VFMA 4LB3A 2O4MA 1M7JA 3T05A 3R94A 1EQCA 2BVWA 2XZ9A 1CI1A 4JD4A 1VFSA 4IZGA 1KKRA 2VO5A 1VEMA 3CQHA 1RCQA 3HN3A 1REQA 3KCOA 4QEEA 4WY0F 1P6CA 1MFUA 1WUEA 2Y8KA 3E74A 1XCWA 3MU7A 3CWHA 3C2VA 3WY1A 1GYNA 2OFJA 4B15A 1R8LA 5LGXA 4WDWA 3PAOA 1UC5A 3C0LA 1X6LA 4E38A 2YSWA 4JIHA 4LTSA 2QLYA 4GO8A 2WZTA 1RCXB 2QEZA 2Q8XA 2OO6A 4WXYA 1EDTA 5BOFA 1D2KA 4O15A 1GZGA 4A2SA 1NF0A 4O11A 5HJLA 4RW3A 5HQLA 1XIIA 5JMUA 1XC6A 5AC8A 4RDZA 5FKYA 3APYA 4HP5A 1JUKA 4KRTA 3SUVA 4IX0A 4WDUA 4EPDC 1JPHA 5G4WA 2V6AA 3GAYA 2GDUA 5FSDC 5A8GA 3OHIA 2WSYA 4YCOA 1D7FA 2DSUA 4GBDA 3VNYA 3CH9A 1CXFA 2C71A 5E0FA 2KX9A 3W7CA 3HG5A 1XIMA 2WKJA 3VOFA 2VFFA 3VOGA 1SO4A 3BMXA 1JNEA 1HGWA 2JIEA 2FTWA 4D1JA 1TPDA 3H23A 1EEXA 3QXBA 4NU7A 3TAOA 2ZRYA 1Q2SA 2PDFA 3H2EA 1QFEA 1SW3A 3O16A 4HT3A 4OE7A 7TIMA 2E40A 1T99A 2X42A 3ZXWA 1F3XA 1ZY9A 3CZEA 3S2LA 3ZT6A 1RQHA 1VJSA 3FA3A 4F3HA 2HTMA 1S3TC 1RA0A 3CIVA 1K9EA 3DFYA 3H26A 2V9DA 4NJHA 4MYXA 3KBNA 4MHBA 2PLKA 3CXOA 1DIOA 4FS9A 2BDQA 1ADDA 2W5FA 3G1SA 3VDGA 4IIDA 1O7AA 2OPJA 4O19A 4N9EA 3WQ4A 3L5MA 3WH8A 3CPGA 5CH9A 3BK0A 1TRIA 2E1DA 1ITCA 1EO7A 3PB2A 2QPUA 4LVDA 4LYRA 2JF7A 3BL3A 1MXDA 1GQLA 3LCIA 4I9AA 2GGHA 2DSKA 1DQWA 3BCFA 3RR1A 3OLIA 4DQWA 1V0KA 2P3EA 2ZA1A 1YMYA 2HPMA 1ZJBA 2P88A 1OYAA 3W25A 2YYUA 2DIJA 4GIEA 4S39A 3QSRA 3HPSA 3MB9A 1SO5A 2VXNA 4NG3A 4LAZA 4PEEA 1V93A 4D6HA 3CO8A 4J3ZA 3LPFA 3G24A 1TSIA 3A24A 5FESA 4HNCA 2OYLA 1BVWA 4FLOA 2VUYA 3IJQA 2P8BA 3PR2A 4DX3A 1PKYA 3ARQA 1KWKA 1PPIA 4O53A 5EFFA 5IBXA 1AA1B 3NOEA 1V6UA 1PWMA 3L0GA 4GJIA 2YJQA 2TPSA 3GG7A 4F2UA 1JI1A 3VABA 1GOMA 2PDHA 2C1GA 5I6SA 2W67A 3FN9A 4Q4QA 4UMCA 2BHZA 2IKIA 1HP4A 3OZYA 4L4LA 1TTPA 3V16A 3ITVA 2NXGA 4IUGA 4YN5A 5I3DA 3SCOA 4L65A 1ADOA 2RGLA 4IPNB 3PM6A 1S2TA 4XIAA 3BW3A 3AIUA 3ARSA 1E55A 4P2VA 1XHGA 4AZ5A 3GUGA 4LUJA 2QULA 4K37A 1W9VA 4ZODA 3NPWA 1JDDA 1D3CA 3NQBA 4AEFA 3VPLA 4TTGA 1F2JA 3KBMA 4RUBA 5C71A 1OWQA 2HROA 3LA4A 3P62A 2DGAA 2GUBA 1AJZA 3N4AA 2I14A 1OF8A 5C9ZA 1PCKA 2OLAA 3P82A 1DJZA 3B9NA 5FI8A 5IDIA 9RUBA 2JFEX 5MF5A 3CK5A 1FOBA 3G1DA 4Z0SA 2Z1WA 4KEMA 3UNTA 4M51A 2F9RA 2Z7GA 2G8ZA 1J96A 2DVXA 4NP7A 1XW8A 2FHFA 4RDVA 3EDFA 4W93A 2GQ9A 3STPA 5AB3A 4Y6GA 4NVTA 5KSWA 1K77A 1MEHA 3LYEA 1IR1A 3M0KA 1ZFJA 2CHOA 3N9SA 4PL2A 4MWAB 3MKCA 1QPKA 1ICQA 3E38A 4DEFA 4TTUA 4K3ZA 6A3HA 2TODA 2XH4A 2WVTA 4ZE4A 2VFGA 3H4GA 4FLSA 2WLYA 4DZHA 3V35A 5D2TA 4WF7A 4QAWA 4H6EA 1WPCA 4H9VA 3DN5A 3WMSA 5JU6A 4K7VA 3MCMA 1EJXC 4IGSA 4MZ1A 2V5JA 1G9HA 2A21A 3NL5A 1TWDA 2NWRA 4HSNA 3UPMA 2FDSA 3P14A 1SFSA 4JTUA 3R10A 2YOCA 1LRNA 4G8TA 1FHLA 4HCDA 5CJNA 2YXXA 2FZBA 1JXKA 1UB3A 1SQ7A 4NZ3A 4NI3A 1M7PA 1KGXA 3NZPA 1XR2A 1KBLA 4Q7IA 3DBNA 3T44A 1A0DA 1DWGM 1LL6A 2PD5A 1JZ5A 3VKJA 2YB4A 1LZOA 4ZXLA 3NL2A 4Z2JA 3PJXA 3M4HA 4S23A 4PMRA 4S38A 3W86A 3LHZA 4ACZB 1Z44A 4GQQA 4UTWA 2F7FA 3BE7A 3VILA 5AFDA 4OJYA 4AF0B 1R3TA 3W38A 3VM7A 1UPPA 1VGAA 4QCFA 1V6VA 1V3MA 4LBRA 3HG4A 3GW3A 3T42A 4TVUA 4BA0A 3ARXA 4RL3A 3RGTA 3DFOA 4AD4A 3W00A 2EXOA 4ORMA 3QQWA 1V3JA 4ZZ9A 6CGTA 1ONRA 3VGHA 4V15A 2QR6A 1EDGA 4U2YA 4A21A 3BH4A 4N9CA 3DZ1A 2D1ZA 4PUJA 1P7TB 1VRXA 4C6LA 5SWUA 4S3GA 4PMYA 1SVDA 3OJGA 4URIA 1UZ1A 5H8MA 2CIPA 4AZCB 3WNOA 5AHEA 3WQEA 5FL0A 3MMDA 2JQXA 1CGTA 3G18A 2E77A 3B9OA 3W07A 1BLIA 1EX5A 2VCAA 4E2DA 3W7GA 3IEBA 1BXNA 1R3YA 1NDZA 1R86A 4NQ1A 4GWEA 4WSKA 3EWCA 5CC7A 4IMAA 3UXLA 5CPTA 4PYSA 1F3WA 3GC4A 2Z29A 2PDCA 3LG3A 2EKGA 4O18A 4PUDA 4DUWA 4CQ9A 1OIMA 2NT0A 2Z00A 2ISWA 2OQYA 1RR2A 1US3A 1U1UA 1JPIA 3WEZA 1EA9C 4RZ4A 3H22A 5C5YA 4B9ZA 4ERIA 1FWDC 2Q09A 3HG3A 2CBUA 1NWSA 5BMWA 2IS7A 3C8FA 4IQJA 4Z08A 3E6EA 3QTGA 3UXKA 4RNIA 1WKFA 3KRSA 1S38A 4AW7A 2OLHA 2NV2A 3GXMA 3TV8A 3BVJA 1U1JA 4GACA 4TOQA 3ES7A 3TTYA 5H6HA 3GO2A 4WJEA 3L4XA 1XS2A 2J7CA 3HO8A 3UWUA 4Q4OA 3OLEA 4U2ZA 5LHEA 4JHZA 4LV9A 1NFGA 1X6NA 5IHSA 1RBOB 2VTFA 5AHMA 1TPVA 1HP5A 1TIMA 1UUOA 3E0FA 1OK6A 5ABTA 1DL3A 2CLIA 5TF0A 4HMNA 3FSUA 3R11A 2YXOA 4F40A 4DNMA 1W8SA 3SCRA 1R9YA 1EBHA 1EFZA 3AZSA 4QSFA 2WMFA 3BZJA 6ALDA 2H9AB 4H9YA 2OZ8A 3CUHA 2QAFA 3HMJG 3OA5A 1UWTA 3STEA 3XINA 4JTIA 4QP0A 3FHAA 1R3RA 2QF7A 1QW9A 4PL1A 1TX2A 4IFRA 3URQA 2CETA 4Z2HA 3NO1A 1Z41A 3K4DA 1H2JA 3TCSA 4CCDA 4W89A 1O12A 4NT0A 3VOCA 1TZ9A 4B5NA 1OSEA 3KCLA 4Y90A 4IM4A 2RKXA 3B0YA 1OFOA 2Q8LA 1KFKA 3WQGA 2QDDA 1EB3A 3T09A 1MW1A 4AWSA 4UFJA 2FJUB 3W29A 2G3JA 5A8QA 3GNPA 3QHOA 4DHGA 2E4TA 3LD5A 3GKFA 2RJHA 1GOOA 4NX5A 3BCDA 5FEZA 2CLHA 1FH9A 1KLYA 1NY1A 3T8QA 2VOTA 3B4YA 4O1BA 4XUYA 4E5TA 3WLPA 3R0DA 5ABFB 1OFRA 1UMLA 1IWBA 1J12A 3MMUA 4XAPA 1N7KA 4O1DA 9CGTA 2G5WA 3VIMA 3OB8A 2Y8VA 1YADA 4I8DA 1A3HA 2HBXA 5U7SA 3TSBA 3F4VA 3MJYA 4PFMA 2P76A 3I6TA 3W7EA 4P5UA 3WNLA 4FP1A 9XIAA 1QNOA 1GZ1A 1ISZA 4Z2LA 4B5XA 1MXGA 4IJRA 4AEOA 4HHPA 3W1LA 1L6FA 4J3WA 5BCAA 2Z27A 1ME9A 3A23A 3F2BA 3OGSA 1EF3A 2V5LA 1ALDA 4L64A 4B92A 4WD0A 1EP3A 4AHQA 2E6AA 4XAFA 1CGWA 1DE6A 1JF6A 2VEFA 3NPUA 1XLEA 1DWHM 2FKPA 2HEJA 1AMYA 4IICA 2ABAA 3CWNA 3W87A 2FB3A 1YX1A 4BQ5A 1W2VA 4Q8TA 1KA9F 1W56A 3RLHA 4PMXA 3C2OA 3MI6A 2GQ3A 1K02A 4ACYA 1OZQA 4AWUA 4BF7A 3VGDA 4YTQA 2OOGA 2GDVA 4QRNA 4WOZA 3TA9A 3MHFA 4MAVA 3SCPA 4F0KA 1Q2RA 4MLJA 5DT5A 1PCWA 4S3FA 2HE5A 4HVXA 3ANVA 3PS7A 2BY0A 3W1PA 4GUGA 3NTYA 1P48A 3T40A 5D37A 4PTMA 5U4NA 4LANA 1W1ZA 2RGMA 5DO8A 2FMNA 1EWDA 3LBCA 2PUZA 3NXFA 3WG6A 3N13A 4Q6JA 2XGIA 4UTWC 2PP3A 3N6HA 3EOOA 4IL0A 4ADSA 2VZVA 1TV2A 4XSMA 4CU8A 2F2KA 4IP5A 3N2TA 1LORA 3OO2A 3K5XA 3QF0A 2A3EA 2CYGA 3W7JA 2XWDA 3A9IA 4GQBA 3UERA 2A0NA 2EG6A 3AYSA 3RYSA 3THUA 4EPKA 1MZHA 5LIKX 3W2LA 3EOSA 5AECA 3GG8A 4R3UA 3MP4A 8XIMA 4IXHA 2QVNA 2PDXA 3G6LA 4RZ5A 2VGBA 3VIFA 6REQA 4JTJA 2BY3A 3G3MA 4PMVA 3B9AA 2PU0A 5I3KA 3PBVA 4RZ6A 4H6KA 4NRSA 4D2JA 1Y5XA 4H8VA 1X38A 2DW7A 1K8XA 3PWGA 1WDWA 3YPIA 1GEHA 2VWSA 4LB4A 3UG8A 4EXAA 2CLKA 1XLIA 1MWOA 3G1XA 4UWMA 4DUVA 1A5MC 4X61A 1FDYA 4QM1A 2EPMX 4HN8A 4V33A 2O55A 3OEXA 3KTCA 1XWYA 3WL1A 2RDTA 1J9YA 4ZO9A 3SW6A 3BOFA 3FY1A 3PBUA 4H9XA 4C1LA 4JFSA 1YLVA 1JZ4A 4MB3A 1YTDA 2Y5JA 2VD9A 1YPIA 4QS5A 4DWSD 3W74A 1GOWA 2WCAA 3AU2A 2Q6ZA 4E0CA 1QHPA 3HURA 3SFKA 3DFQA 3ONBA 3EX6A 1F7BA 4A35A 4MWAA 1I9CB 2Z7KA 1V0NA 3PWAA 4O54A 3AYRA 5D32A 1UWQA 3GSMA 1NOWA 2ZICA 2AKMA 5AHLA 4K36A 1D3GA 4PC8A 5FSEC 5EPDA 1CW2A 3B0UX 2E8YA 3KAOA 4LT9A 2CZEA 4W8BA 4I6VA 4Z42C 2BGQA 2J7EA 3ZS4A 5FIPA 2DZVA 4H9MA 2I7GA 4MNMA 3IJLA 4ZCWA 3EGJA 4V1XA 5AVNA 3TJIA 1NELA 2PGWA 3B97A 5A6SA 3EWWA 4W87A 2I56A 4C6MA 4H2CA 4ALDA 3KW3A 3SGUA 2ATSA 4UQEA 2DDXA 4QE4A 4ATDA 3P3BA 2O7SA 4GY7A 2CBVA 3BICA 1YDOA 2VC9A 3PK7A 1W1PA 2YBTA 4WUIA 5FJTA 3M7SA 4H7VA 5C9WA 1XLLA 3GTHA 4FNUA 4ACZA 4FOJA 4AF0A 4HZ7A 3NQAA 4FNTA 2E25A 4B9YA 3CYJA 1TMQA 1AJ0A 3IGSA 2ZZ7A 3EX2A 4UTUA 5FJJA 3WBEA 1S1RA 1RUSA 4GGBA 1KTNA 3ZOAA 2HXTA 3S0CA 5E9XA 1ZGDA 3NVTA 3HJZA 2EQDA 1HL9A 3SUUA 4XTIA 1XH0A 3RR4A 1MEIA 1XP3A 1KKOA 3FCPA 1P7TA 3DG6A 2ZUSA 2Z0IA 1NP0A 4A3HA 3NL3A 4AZCA 3C2FA 4O14A 4P7NA 2ZC8A 1MZRA 1GQJA 4DN1A 2YA0A 2V8ZA 1W54A 3GNDA 2PMQA 3H4XA 5TAOA 3GG1A 4RXGA 4LQ1A 3AICA 1J6OA 1JQXA 1WZMA 4IT1A 4KMQA 3M5XA 2PDKA 2VFIA 4F0HA 2GWNA 3VNKA 1T5AA 2PGEA 4H3DA 4N0RA 1W17A 3ES8A 2HMCA 4AX7A 5BROA 3UESA 4V28A 2G50A 5G2HA 4YVPA 3N6QA 3B3DA 3NDOA 1DVJA 3CZGA 1CNVA 2WJZA 4GNJA 4LVAA 1F4HA 1MNSA 2O9RA 4HKPA 1M9HA 2IQDA 1J0JA 3LENA 4EPBC 1QASA 2H3BA 3BWWA 4O28A 2NUYA 2XIQA 1M41A 2QUMA 3U2EA 4HPJA 2PWFA 1XYBA 1ONEA 3GD6A 4ECLA 1J5TA 1CCWB 4X60A 3PAJA 1DV7A 1OZMA 2MNRA 3GE7A 3OOQA 3S8HA 3WBXA 2BXVA 4X2RA 3VOJA 4JPGA 3W75A 2WVVB 1PXGA 3UPWA 3W1UA 4O1AA 1E1FA 3RITA 4XAYA 2CITA 1RBLA 4QG6A 3VGEA 3RPDA 3T8LA 4HU8A 3AWOA 3QZ6A 1GKPA 4LOCA 3K8MA 3L12A 1KM5A 2INZA 1TPC1 3STGA 2IKJA 5A5WA 3CL8A 3GNOA 3B8SA 3KOZA 3KBSA 4FNPA 1QO5A 2VZUA 3KP0A 4AY1A 2JKAA 2HQAA 2GJXB 1GKQA 4DB7A 1P0DA 3ITCA 1Z69A 3K4WA 1YPFA 3CL6A 4YXGA 3ZVHB 1FCUA 1QXLA 4IISA 1XG4A 3VKDA 3I6EA 7TAAA 2H9AA 2WVSA 8CGTA 3BG3A 5PTDA 1JEZA 1NWRA 1OIFA 3TAKA 3G1RA 1QRQA 2YW3A 2PU1A 2ZUWA 1ICSA 1RAKA 2P5NA 1KRCC 4KFNA 2YBVA 5CSRA 1LQ2A 4DELA 1V6XA 3LHUA 4DUOA 3B8TA 3UJRA 2GWGA 3ARTA 4NJIA 1XV8A 2I5GA 3L5LA 5DY3A 2D73A 1M03A 1OFDA 1S5TA 1QOPA 3AYVA 3DHFA 4AQLA 1X6UA 4AC7C 5K2ZA 3C3UA 4WDTA 2QDHA 2WC7A 4GZJA 1KWGA 3ZFHA 3OG3A 2OQLA 2Q3RA 4PUEA 2VGGA 3E49A 3H54A 3WJZA 4FXFA 3ERPA 1DWJM 3UR8A 1ZJAA 1L6GA 5G2WA 1TQJA 2DT0A 5HAOA 3IACA 7ENLA 3C4UA 3FSTA 4FAMA 4E8GA 3DDMA 1JYWA 3V5OA 4DO5A 3T2OA 1V3LA 5FF3A 3LSCA 5ABFA 2J6VA 3L9CA 1GCYA 3S46A 2BODX 4O13A 4M29A 3RU8X 4MDPA 3AMLA 1ML1A 4XB3A 1JQVA 2C6QA 1A5OC 5LZLA 4GIYA 3ZLGA 3NSXA 5K4ZA 3T6CA 3VNDA 3TQ0A 1ZQ5A 1EH9A 1KRMA 2NVAA 3W76A 3DFNA 4M5PA 3VGBA 1JGIA 1VYRA 1J93A 3RHGA 4KWVA 4OUEA 4CD4A 1EJ7L 3PN8A 1R7AA 2NQLA 2QCMA 4GC4A 4L9XA 1HJWA 5HPCA 4MWAC 5HDRA 1GVRA 2AQOA 1GNXA 1VC4A 1Q7ZA 4OIFA 3KEHA 2VVSA 4IL2A 2AGKA 4PH6A 1TPUA 3TSMA 6XIMA 4JYFA 4XVEA 1WB0A 3QYSA 4GYKA 5I3IA 3LEPA 2FVKA 1LL4A 5JBDA 3ZMRA 3ID7A 2IMRA 2DY3A 5AHNA 1EPVA 3OZOA 4KWWA 4ERGA 2J78A 3LXBA 1OQFA 1WDSA 2D20A 4PGLA 3HJEA 1GG0A 3VMPA 2ZUNA 2VX5A 2WV8A 4YWSA 4IH3A 4RW5A 5A6KA 1DQXA 1QK2A 4Q7NA 4M6VA 3P0WA 1PL9A 5DN1A 3AFBA 3AS3A 1KFJA 3N15A 2W27A 4C6JA 4LXFA 1RPXA 4R33A 4MADA 3T7VA 4AYGA 3ZO9A 3QV7A 1FH8A 4KCUA 2Q02A 2RJGA 5LNRA 5FA5A 1TB3A 1B31A 2PWVA 1VR6A 3CUFA 2Y70A 3GVQA 4IFKB 4H00A 3TNBA 3WNMA 4PMQA 1JDAA 2BVYA 2OYKA 2DQXA 3OU8A 3L65A 1FFQA 1Y8BA 5D2WA 3QPYA 4ICNA 3EX3A 2PB1A 3VU2A 5D2VA 5CGMA 2J7GA 4YVVA 1ADSA 4US6A 3W3OA 1EO5A 3GHTA 2W6RA 1F3TA 1RXOB 1KBKA 1B3OA 2J8FA 3VKAA 4CN1A 4PRWA 3VZYA 3MMWA 4F9JA 2DUXA 3A13A 1H1NA 4PTVA 3LGEA 1TPWA 3VDAA 3GVGA 1FWWA 2QNEA 1OY0A 3ZR5A 3VX1A 1TMLA 2X0SA 3L5AA 1H50A 2BASA 1W3NA 3SRDA 1ZBKA 3AXHA 2B7QA 1TTJA 4UMAA 3MANA 1W5QA 3S9IA 5A8OA 1XLCA 1ZL1A 5BOOA 3OZMA 2HISA 4KKXA 2PTDA 1WOBA 2EG8A 3VKKA 4WK9A 1PTDA 3OVGA 3ECQA 3BAJA 4OVXA 2E3ZA 3LM3A 2YLLA 1P1XA 3KOFA 3L4UA 3WJWA 4HTYA 3C56A 3V3WA 3H24A 1V02A 4WDXA 3WQWA 4JXCA 1YDYA 3ARUA 3IAQA 5C7HA 4IJBA 4P7LA 2DT2A 3MVTA 4JFUA 3VIJA 2PWEA 3GR7A 5EBAA 4D6GA 2BOGX 1DXFA 1WAWA 1E56A 3VD7A 1Q6OA 3GFYA 2UY3A 1YEYA 1Q8JA 3R2GA 2PDUA 3MI3A 5A8NA 2BLEA 4HNTA 2BGNE 2CLLA 5I02A 1J01A 3B4UA 5A6BD 1C8YA 3RDKA 5A6LA 2QMKA 2ASHA 3G5EA 3GX9A 2WHMA 4YTUA 5REQB 1PZ0A 5DMNA 1JYNA 3QGKC 3DH7A 4X3ZA 2B81A 1A4LA 3WLHA 3L2MA 4FIRA 3ZT5A 5LXXA 3N4EA 4Z1BA 2FFIA 3BAYA 2RHGA 3EMCA 3GVRA 3PNUA 1KQYA 1DQUA 2OT1A 1J0HA 3PUDA 1BPLB 4QG9A 3GXTA 3CUJA 2QXWA 3GH4A 2Z24A 1MQRA 1RY8A 4UOZA 4GK8A 5A6JA 3BGAA 1A80A 1XDJA 3EAUA 3WENA 4UFLA 1B4KA 3EPOA 4ZQPA 2PDLA 1TZ7A 4DBUA 3KP1A 4U4MA 3R8GA 1YTKA 4KS0A 3JU2A 2J9YA 2E8ZA 3ARPA 5CSUA 4M56A 4UTIA 4A3RA 4FIQA 3QY7A 5FOOA 3ABXA 3LY0A 1E9LA 4M80A 4M6PA 4LUTB 1OF6A 5HPOA 2NWSA 5CAKA 3GU9A 1VCGA 5HJYA 4JFTA 3BG9A 5TD4A 3P5ZA 4LC8A 4H2HA 2D0FA 3GRIA 2WANA 4KWSA 4BI5A 3KCJA 4TO8A 3GYEA 3UW6A 2WZMA 1UROA 1W9UA 3N73A 3R8HA 4M8UA 5AKQA 2DQWA 2IPWA 3D47A 1K8CA 3WFLA 4B5TA 4M1BA 1GG1A 4ZB0A 1AVAA 4PMUA 3CYVA 1OHLA 2WJDA 4PSRA 1J2BA 1EJUC 1H60A 4IG2B 1MXSA 4C90A 5GJMA 4XD6A 1W5PA 3FA5A 3EKLA 1AG1O 3UZZA 1L6WA 1PJ9A 3UA3A 3PSWA 1S5VA 3EEZA 2RDWA 1HKMA 3B8WA 1UQYA 2J24A 4MKSA 1WKEA 4NSBA 5BRPA 2AOSA 2I1OA 3S83A 3U57A 2CNCA 3TLQA 5KZ6A 2WHJA 1TIWA 4Q8NA 3SIZA 1PEZA 1E6XM 1W3JA 2QCEA 3PZIA 3F4DA 3WD0A 2VNCA 2WZHA 3MUAA 2WVVA 3LCFA 3WUFA 1R46A 2W79A 2ON3A 3HGJA 4CLMA 3RO8A 4YVXA 2C1HA 3GBEA 2ADAA 1H63A 3QY6A 3DYMA 3CZKA 4S2BA 4NASA 3UZXA 4UFIA 3AS2A 3O8AA 1Q8AA 4D6CA 3OLGA 3RCNA 4AHOA 2I57A 4A22A 4EACA 2NXHA 1V03A 1IZKA 1JRBA 3KBJA 3LHWA 4YTRA 3FJ4A 2DSVA 3P8IA 1XBXA 2GJXA 2XSAA 2W4XA 3W1AA 3CM4A 3ZLFA 3PFMA 5I3JA 4I3GA 4Q8MA 2ZFAA 1I2NA 3ZSTA 3EEGA 4DLFA 3FA4A 4UQ9A 2BWGA 3PBYA 3STFA 1Z9AA 1HL2A 2J13A 2WVUA 4XVDA 2CKRA 3TOYA 4Z1AA 1WXJA 1VBHA 2CBJA 1UD8A 3TJ4A 4Q8PA 3WQFA 3T1GA 4QAIA 4W9TA 1IR2A 1KBIA 3GKAA 1QCWA 3PZOA 1TX0A 4CQAA 1BQCA 4EPEC 1C7SA 1RJRA 5AZ0A 4CD6A 3O6CA 2PDNA 3HPZA 4ZQMA 4JQ1A 3TWAA 4TVCA 2Z25A 4WKHA 2QCCA 3EZ4A 4HJFA 4LC6A 2X41A 2ZBTA 3WSUA 5A6MA 4LALA 4ICMA 4XZHA 3WLKX 2NLYA 5FF2A 1UC4A 5D4YA 3FDKA 2YCEA 3LRMA 2P50A 1G0CA 4IPIA 2QJMA 4MB5A 2Q71A 1PKMA 4F66A 1O6IA 3UZWA 3CZ8A 3VTRA 5BW6A 2FGZA 3GDTA 4AZ6A 1RD6A 5LGZA 3L4TA 5HWMA 4XISA 1HL8A 3KRUA 4E6MA 1KV5A 3URBA 3S2NA 6ENLA 4EF8A 3HTWA 5C54A 1CT5A 3EOLA 4FNSA 4DJFA 1OFEA 4XZLX 2J75A 3CQ0A 2HVNA 2NX1A 4QR6A 2D24A 3M43A 1PV8A 2BNJA 3AYTA 4GABA 2HVOA 4MYAA 1LBFA 4LRTA 1M04A 4ZOEA 3HPXA 1K7EA 4IIEA 3NG3A 5FAGA 3AZTA 4UR9A 3KS5A 1IHIA 2X7VA 3BGJA 4K38A 3W7NA 1XDMA 4Q7BA 1W1VA 1QK0A 1EC8A 1XQKA 3W2NA 3BSGA 1EIBA 4FSAA 4K8GA 3W01A 2GYIA 4WX2A 3FOKA 3BDKA 5HNNA 3QMSA 3PTMA 1K9DA 3GH5A 1F6YA 1CZ1A 1B30A 3FW6A 4XD3A 4H8NA 3WDPP 4LUYA 3NO5A 2JKPA 3LLXA 1H7OA 4D71A 1FWNA 3LI1A 1GW9A 1IIGA 2W3ZA 3GYCA 3TJXA 1FWIC 2FTPA 2PDJA 4X2PA 1QAPA 2YKKA 3S1UA 5DT7A 3AIWA 4I9JA 4JIEA 1LWIA 2ODOA 3DG3A 3K46A 1NP2A 3IIXA 3PZNA 3M0YA 4ZGYA 1XUUA 3C2EA 3OQ8A 4WJ8A 2KAUC 2VELA 1KW1A 1TWIA 3ZIZA 1S2UA 1NQ6A 3CV1A 1GYMA 5DANA 3W2MA 1XSIA 1WBJA 3LM7A 2GFTA 3W1MA 2O56A 4IFKA 1UA3A 1NJJA 1FUYA 4K1GA 1OGGA 4QNWA 3WH7A 3KVKA 2EO7A 2VVNA 1Q5MA 4S1FA 3G2GA 3V5CA 1DJHA 1N8IA 4X63A 1HVQA 2ZUUA 2WC4A 3GAKA 4RPPA 1M53A 1ZS2A 4HHLA 1V79A 3W83A 3S1XA 3EPMA 5F1VA 1C90A 4Q4RA 2R9RA 4QDPA 1FBAA 2AL1A 1WCGA 2WSRA 3P61A 4LH8A 4WY0A 2BXZA 5JXQA 2JKEA 3SN0A 1G7UA 3FLUA 2D22A 1OX6A 3QGAC 3W1RA 3WBAA 4XUGA 3SSJA 4PULA 1OC7A 3S47A 1JFHA 2DW6A 3IAPA 3M1ZA 2X1TA 3QC0A 1ISXA 2Y24A 3LV6A 4U3CA 3S5SA 1LWHA 1YPXA 3CUIA 2DVUA 2W61A 5FF7A 1V8EA 2YB1A 3LPPA 2Z2UA 3NURA 2NUWA 4AD0A 3LBOA 4C6KA 1IIHA 2YDRA 3I4EA 1IEVA 4RKAA 3WQVA 1LQAA 2GSEA 4OHQA 1IF2A 1NDYA 1X7FA 2XYLA 3NFUA 5G1YA 5LNWA 3LB0A 2WK2A 3EWDA 3QSTA 4AXNA 3W27A 4UTTC 2X0YA 2BOEX 3RJXA 4M1RA 4FLRA 5CPNA 1Q45A 3FX4A 2X09A 1BKSA 2PURA 1EJTC 2PD9A 5DCEA 3IVUA 4NJGA 5LIYX 2VOMA 3RM8A 1F61A 3OG2A 4CNOA 1J6PA 3UXIA 5A2AA 5REQA 4DZ5A 4PBEA 1KFCA 1OYCA 5DCDA 4H8HA 3I7QA 3JUGA 4CQCA 1QBAA 2WHLA 1MNZA 4ZENA 2DV0A 4M3PA 4NAEA 2OSWA 1E70M 3MUZ1 4XG1A 5HR6A 1XLGA 3LTSA 4UZUA 1EZ2A 1IZCA 1UYQA 3BURA 3GIPA 4FNRA 2CLFA 3TYEA 4H04A 5CG7A 1EBGA 3N3TA 2WM1A 3CV2A 4HSOA 4GX9A 3U8GA 4GPNA 4DM2A 3GWQA 4Z1CA 4AIOA 3C0JA 1TR9A 4N4QA 4JTSA 1PWLA 4X9YA 1UH4A 3AIRA 3LPOA 1DP0A 1Q7QA 4GIAA 3KOWA 3WX7A 1XH1A 1L2UA 3NM3A 3UCQA 4LUTA 3EOUA 2VHLA 3BAXA 4JTFA 3GHUA 2QAPA 5C9RA 5EMMA 3UG4A 5LA2A 3HZ3A 3WLJA 4Z2IA 1JZ6A 2ANUA 3WLLA 1SFLA 3EKZA 4IIGA 2DJXA 3G8RA 3O3RA 3AOFA 4OV4A 1QMLA 4HA4A 3GW0A 4HCHA 4CCEA 1AD4A 3TC6A 2HV5A 3A4XA 5MKGB 1YHTA 4CNTA 4IG2A 4WSHA 3PPGA 1QJWA 4ZQCA 2EPNA 1GZJA 4K8HA 1MFVA 3AHXA 4ZO7A 2NV9A 3B04A 3LCGA 4Q6XA 1VP5A 2WNNA 3AQUA 2CERA 4R27A 4PRRA 3TMQA 5CZ0A 3O63A 4DJFC 1PBGA 3SI9A 1OFAA 1UR2A 3ITGA 3H7UA 4M19A 1FQ0A 3B0PA 4GOAA 1GOKA 2IXVA 1Q85A 4IMEA 4IOTA 1K7FA 1AW1A 1KCZA 1XRVA 3M6YA 4MKVA 3SDOA 3TN3A 3IJDA 4KESA 4F79A 3ALFA 1V3IA 1TVLA 4H1ZA 3WLOA 1SJAA 1FHVA 2R94A 5EKYA 2CXGA 1F3EA 3LQGA 1B3YA 1KTBA 2XN0A 3ZVIA 1W91A 2NQ9A 4LS0A 4LCQA 4MNJA 3FJ6A 5HXMA 4L1GA 1KTCA 5AN7A 1E3ZA 4P8VA 1L6YA 4GFIA 2HK0A 3TYUA 1ZP4A 3NPVA 4JYDA 3SCQA 1QNPA 1E1EA 3FIGA 4UQDA 3P7YA 2PE4A 3CHVA 2X2YA 4H4IA 3WUBA 3COTA 3MV01 4L4OA 3O06A 4AIUA 3WLMA 1SU5A 3OVQA 4Q33A 2DZBA 2XISA 3HV8A 4Z17A 3FEMA 3I10A 2W63A 4X0NA 4LW7A 4UTKA 4NZ4A 2ZZ2A 4IP7A 4PR4A 1LBMA 2X1RA 4GO9A 3ZSSA 3HU7A 5IHRA 5HULA 4PTDA 1A53A 1EWEA 5KEZA 1OG0A 4JY8A 3W2JA 1QPQA 3IIPA 4JTHA 1GTEA 1HFBA 5D9PA 3VDHA 5H8PA 4UOQA 3S6DA 1SMAA 2Y5EA 1HT6A 3F4CA 1I75A 2QKFA 5EBUA 3N3MA 2A3LA 4U10A 2YPIA 5F4WA 4GNKB 3E02A 4LS2A 2PSNA 2XFRA 3RJYA 3NQDA 3HQPA 1LQ0A 4PBGA 3W7IA 1GHRA 1Y7VA 5I03A 1HKIA 2WAGA 3B40A 2BGSA 1UD3A 5CPOA 3LUTA 3FVMA 4BQ3A 4ZB2A 3OQEA 3IVTA 5CBIA 2WSPA 1Y0EA 4K8EA 3L4ZA 3A12A 3AXMA 3WUEA 1E9IA 3AIVA 4MMWA 3GXNA 1LLWA 3H70A 1FXPA 1XICA 2X1IA 3N18A 3KBVA 4W7VA 2A2IA 1HG3A 5D9NA 1SSGA 2VJXA 3M46A 1T41A 2QGHA 2ZADA 3FXGA 2FFCA 3QV6A 5JVLA 1C93A 1XCXA 4RV3A 2HRWA 3NQGA 4YNGA 4O0ZA 3T08A 4DAFA 2E5DA 3LCHA 4BFAA 3AS1A 5CC5A 4TX9A 5BU9A 4TX6A 1K6WA 3BO9A 4GE8A 3QKEA 3LERA 2Y63A 3PTDA 4QLKA 4GBUA 3CH0A 4M7TA 4AZBA 2ZRUA 4H83A 1NF7A 4A6GA 3WL0A 1TO3A 3KL0A 1E4NA 1MRQA 3K2GA 1L8NA 2NZLA 3CT2A 5CKSA 3VD4A 3O2LA 2R1LA 2FPVA 1A5LC 4IGNA 4GI8A 4PZVA 5T9CE 3NQ6A 1Y65A 4B5WA 2X40A 4LFYA 2E5BA 6TIMA 1EXBA 4JX4A 1RV8A 3Q37A 3F5LA 2RDXA 1OCBA 1ICPA 3WYZA 3NQ8A 3B0VC 4E3TA 4MJMA 3TLLA 3M7WA 3SN1A 2XTKA 3VIGA 1W0MA 4DF1A 1WNOA 4DXVA 4JS3A 1VFOA 4US5A 2ZXAA 3CJPA 2AL2B 3GFXA 4JX6A 5LA0A 4WOQA 2JALA 3MS8A 4U5KA 4XZ9A 5H8UA 3CZLA 2H8XA 4HOWA 4PA8A 1UJQA 3PTQA 3VE7A 4AZ7A 4PTNA 4M81A 2ZX7A 1CBGA 5B7ZA 2XIJA 1Y5VA 1QHOA 1AZ2A 4JTEA 2GK1B 3QGVA 1H5YA 1BTCA 5HUPA 3VI2A 5DXXA 4FX8A 3CB8A 1QNRA 1XLKA 3N17A 3LGDA 2YLAA 4ES4A 4BQ4A 2WBKA 4AY7A 2F6KA 4YL2A 2V68A 2EJAA 1UUQA 2XWEA 2JK2A 4QITA 3ARZA 4JKLA 1I4NA 2E7FA 4EXQA 1VIZA 3CNYA 5HBFA 3B8DA 1XRFA 4KIEA 4UR7A 1M01A 2GGGA 4BKNA 1L2QA 5AZ1A 4WXZA 4GVGA 1UWUA 1GTHA 2EEXA 4MJ4A 3L4YA 4NZJA 1PHWA 2VC7A 5KTLA 1QI3A 4GG9A 5AC6A 1O5QA 2XN1A 5D33A 4ZO6A 3IUHA 4OQVA 2GGEA 4XZNX 1CXHA 3L0NA 1GJWA 1R9XA 5C0QA 1IQ8A 2YBUA 3HGRA 3WN6A 5CBJA 4HZ8A 3GM8A 3SQSA 5C6MA 1A5KC 2PDMA 1DJYA 4RE2A 1VCFA 3WEOA 5F2IA 1AUSL 1Q6RA 1KBBA 3SBFA 2PBGA 4JIPA 4B2DA 5CCZA 1Y5WA 4GYJA 3F2CA 3TN5A 3GU2A 1BHGA 1SR9A 1YNQA 4N6FA 5LKYA 1EYWA 5HK4A 4LGXA 5AYIA 1E6QM 4K39A 1W8GA 2GJRA 3W71A 4GFSA 2CEQA 2NSXA 1QATA 2J9ZA 3ANYA 2ZYFA 4L80A 2QPXA 1RJPA 2CKSA 4C5YA 2EAWA 3MC5A 5AC7A 3AAMA 1BYCA 5I3HA 2W66A 5BXPA 1ZSXA 4CD5A 2ISFA 3UXDA 1N82A 6TAAA 1RJQA 2NW0A 1KLZA 3F7JA 5I79A 2JBMA 3G1YA 2C16A 4I8YA 3BV4A 1P0BA 3MCOA 5FJOA 1V77A 4JICA 5FEWA 4G6CA 3UA4A 4A8IA 1UCWA 4CU7A 3EWUA 3FXYA 3O6YX 4PN2A 4RLIA 2DUAA 1PS9A 7XIMA 3S3GA 1K03A 3TFCA 2B7PA 3K13A 2VFEA 2E6FA 4XBKA 3TYAA 1AQHA 3KVJA 4J5NA 3VD3A 2AQWA 5CGTA 1CLKA 3HFYA 2X05A 1F6KA 4NYUA 3DHPA 3BLKA 1S5WA 4A8RA 3SIMA 1CWYA 4M6QA 1X1ZA 3N11A 2ZUTA 4GQRA 4JEJA 4TV6A 7REQB 2QV5A 4JIIX 3WQDA 4C1NB 3DFTA 1YQ2A 1TJ0A 1EGVA 3PPCA 2WMJA 5E1QA 1K8ZA 4R85A 4RPQA 4KGJA 3AMKA 2F38A 3KOYA 2Y5SA 2DSZA 3RN6A 5CXPA 1VFTA 1G1YA 2OCZA 4C65A 1JYVA 3WK0A 4LCRA 3W7LA 1DOSA 1TTIA 1LBLA 1U5VA 4GC3A 4D8ZA 4KCVA 2DJLA 1FHDA 1O5XA 2JGYA 2WYSA 3MPGA 1UIPA 4LU0A 3UWEA 1OCJA 4MJZA 1E9YB 1V4YA 3PJWA 1OT1A 2QF8A 3GK0A 7CGTA 1XRSA 5AY7A 4HPGA 1E71M 1ZAJA 4JTDA 1W9DM 3CUXA 5IRPA 3PG8A 5MKGA 3ANUA 2OG9A 1IGWA 1TE6A 1QI4A 2R1KA 2GVGA 3WJSA 5FEXA 4RE4A 3CPUA 2YR1A 1NDWA 5GPRA 5A6TC 4PCTA 4WSJA 1U2YA 3P60A 4LUIA 2CHNA 4O4VA 3M0MA 2WO5A 4GZEA 1US2A 2RAGA 3G1VA 5BRBA 4IQEA 2P1FA 2WNQA 3QRHA 1EIXA 3RLGA 1WDRA 1C3FA 1VAHA 4C6PA 3ITYA 1JI2A 4XK2A 3IIOA 1E1CA 1HN1A 2OLSA 3NVDA 3DEQA 2NV1A 3KTXA 1Q7MA 5BRQA 2Z4GA 4RXFA 4WHBA 2X0HA 1F07A 1GQNA 1OGSA 3SUSA 5DQPA 1JULA 1XYCA 1FRBA 2FGLA 2VX6A 4GY1A 2X30A 1H09A 2QJGA 4OFCA 3MHGA 3OTRA 3W26A 3GDMA 3KRBA 4CEXC 3WH9A 4W84A 2ZA2A 1EJSC 3GNNA 1PKLA 2R24A 3BJSA 4JTGA 4C60A 4JCMA 4GCXA 3DKJA 3QR3A 3GUWA 3BTNA 1FWEC 1XCFA 4GVIA 2QIIA 1U83A 3NQMA 1JL8A 4Y2WA 1ZTVA 3F5JA 3NOYA 4Y7EA 5HANA 1E51A 4QDWA 2XINA 4JN8A 5D8ZA 1QPNA 3D46A 3I7SA 2OJPA 4Z1DA 3QW4B 3KXQA 1Q13A 3WQ8A 3M64A 1LJYA 1VBRA 2BVTA 1UD4A 4O1FA 2VI0A 3N2BA 5K4XA 1KXQA 3QMTA 4ZOBA 2GDQA 2R1MA 1JFXA 3PPFA 3POHA 4U31A 3BW2A 3RG6A 3L4WA 1AMKA 1E0VA 1U30A 4JOMA 4JGDA 3C52A 3EKGA 1Q4NX 3D3FA 1O5KA 1WXYA 1Q66A 1OD0A 1D3HA 1RK6A 1WE5A 5HMSA 3PPHA 4KERA 3KE0A 2A3BA 2AGTA 3ONCA 4B91A 3TR2A 5XIAA 4GIRA 4WRHA 4RR4A 4L4PA 2QUTA 2REQB 3QW3A 1SO3A 4INFA 3A47A 3W4RA 2ZTJA 3VMOA 1BGGA 3R5EA 3TNOA 1W1A1 2A1YA 1G4TA 3G77A 3O1NA 3C0QA 3GTNA 5J5DA 3TYDA 2WLZA 1GUVA 1UH3A 1ELSA 2OU4A 1XPYA 2CLPA 4HYVA 1UOZA 1VYSX 2CU0A 3MUXA 5TQLA 1JPDX 4C6CA 3W7RA 5BU6A 4ZQNA 4QQ3A 1UR4A 1CB2A 4R34A 8A3HA 1VD6A 4J7RA 3PBMA 1RSCA 4YCPA 4MPKA 4RNJA 1XFCA 1KXTA 2Y61A 1BD0A 1QI5A 1W5OA 1Z8AA 3E5BA 4FI4A 4FNQA 4ZTXA 1ZB5A 5BYWA 1WP6A 2GVEA 3JVAA 3SZ8A 3BCJA 1E6SM 4DZIA 3WD3A 2WQPA 1AQMA 3TDFA 1UD2A 2D3NA 3HF3A 4DBEA 4GUIA 1F05A 4GI6A 1I1XA 3TJLA 3S9ZA 5XIMA 1FDJA 1J0ZA 1JCNA 1XD0A 3IPWA 1IT7A 2FVLA 5FJPA 5CZSA 1G94A 3W9ZA 1AD1A 3N14A 3GB6A 5HMFA 3A5FA 2XU2A 2OR2A 4EAYA 1QWKA 2VRKA 2ZE0A 3IUDA 4LF1A 4OZOA 5FEPA 4HSHA 3SSZA 2C3ZA 4PTWA 3RO6A 4EVZA 1UD5A 2V38A 3BPWA 3LMZA 3H2OA 3ZR4A 3E9AA 4AC1X 4GI4A 2J8GA 1TELA 3S2JA 2VKZG 2VYOA 3A6OA 4Q4MA 1R38A 3IJIA 1O1HA 3V75A 5CZKA 1KQZA 4KRZA 3OZPA 1PIFA 4DI9A 3W7KA 2FLIA 5EU9A 5I09A 1O4UA 1W32A 3VD9A 4C6QA 4GYPC 4FR6A 4UNLA 4AWTA 3G0UA 2AL2A 4FALA 2ZX9A 4YJ5A 4EP8C 3P2VA 2FGBA 1K4HA 3WLTA 3STCA 1FHUA 3UR5A 4WCJA 3NAVA 4UUIA 4IMCA 1MEWA 2OKOA 2ALDA 3E2RA 3W73A 4B2DD 3TC7A 3D6NA 3VXGA 4QE5A 2WMIB 1TRDA 1KGUA 3HG2A 4M6UA 3W0KA 4UTJA 2GK1A 4I5RA 3HPAA 4EE9A 2ATMA 1BVNP 4A3YA 1TJ2A 1WYIA 1TA3B 3ZT7A 1AQFA 1FWRA 3EBVA 2Y7FA 3SO7A 3TYZA 1HKVA 3EDEA 4E3VA 1V3HA 1V5XA 4Z0JA 3S42A 4RNHA 1WA3A 4EKJA 2J79A 1TCMA 1VIWA 1VS1A 4JQ3A 5GJNA 4ZOCA 3SUTA 4FXSA 5T91A 3RIKA 3IUIA 5XINA 1Q4WA 1K4GA 3VKCA 2VDHA 1S3HA 3KOXA 3MZ2A 3PUOA 1OEPA 2BHYA 2CHRA 1PYFA 4QJ5B 3LTPA 5JBEA 2YCJA 1TPH1 3RRXA 4NYYA 2OZ3A 3AXIA 4GXMA 2BFGA 3VMNA 1LF1A 3WK3A 1GT8A 2W91A 4HU3A 4TIMA 3W81A 1W31A 5D2YA 2FH8A 1A5SA 1B57A 2DT3A 2INEA 2VL4A 5KITA 1XYZA 1XUZA 5B80A 5KZMA 1REQB 3G0SA 4AWEA 4HNUA 1EKOA 2E9MA 3TTEA 3E5PA 2PWDA 4GUHA 4KIRA 4HK5A 4D6DA 4OOZA 3EOEA 3XIMA 1OK4A 1I8JA 3PUEA 3NQVA 5E0CA 4O8AA 3ZJ6A 3EWXA 2BBFA 3MUIA 1DXEA 2GGJA 4LJ3A 3W53A 1WUFA 3VNMA 3TP4A 4HU0A 1W9XA 1DEDA 2V5DA 3TTSA 2PRHA 3M5YA 1W3TA 4LY4A 4EX4A 1KD0A 4JIQA 7ODCA 3POCA 3EDKA 3CMGA 3O6AA 2RFGA 4B16A 2QMJA 4HYRA 1ISYA 4L6DA 1EC9A 1T96A 2JEQA 2J25A 1F76A 1ODUA 2BP1A 1XYAA 2J7DA 3BOXA 3WELA 1HJSA 1XLMA 1R3SA 3VNJA 3VVGA 2J88A 1B2YA 3HIJA 3GTIA 4I7UA 1V0LA 2O9OA 1QTWA 2PDYA 1I1WA 4V1YA 3P5YA 3HGOA 1HKWA 1NOFA 4CU6A 3M0LA 4IFOA 2VM8A 1KFLA 4AIBA 1ZLPA 3MVIA 1H0IA 3OGVA 3U2OA 1BYDA 4MZYA 3W28A 3NPXA 5IXEA 2FIQA 4ROPA 3PBWA 4HZMA 3PZMA 3WKZA 1Q6GA 4HK6A 7REQA 4Q22A 2ZXDA 2HSAA 3UQNA 2WMHA 1TJRA 1NQKA 2VR5A 4C1NA 5HJXA 2J4GA 5LSMA 2H90A 2WZIA 1XRTA 2A3AA 2A6NA 5K7JA 3GXFA 4EOUA 2DSWA 1LL7A 1XYFA 2XM2A 3UY7A 4OV9A 3W7OA 3N2XA 4AFYA 1X39A 5BMXA 3KDOA 2NVCA 4KW2A 1FWFC 4DAIA 5IBXC 1EGZA 3CASA 4QHRA 1S5MA 1VBUA 4QIUA 5K9XA 3UU0A 5GQBA 3PJTA 1JZ8A 4CEUC 4W86A 5E09A 2CCRA 1ONWA 4XO7A 2VEGA 2YW4A 1GKRA 3C86A 4LS1A 3V4BA 2WQDA 3CPRA 3SM0A 5AC5A 2B7OA 4HA0A 4FO4A 1EL3A 2A7NA 4LF2A 4UQAA 1W3KA 2A3HA 3T0CA 4TR9A 2BSLA 1B3WA 5M5DA 4Y8FA 3T81A 1UH2A 2NX9A 4UB9A 5I2UA 3TR9A 4Q8WA 3T4CA 4D6EA 2EPOA 4ADTA 4L1XA 3T78A 4D8AA 1E15A 5DMLA 1W5MA 2WNZA 4JTAA 4GH3A 3O7UA 3UVAA 4JN7A 3GC5A 4S2CA 3PZQA 1JDFA 4AB4A 2G3IA 2FJKA 5A2CA 1ZCOA 2V2CA 3BMWA 4P7OA 1RHCA 2E09A 1I60A 1C8QA 3WFZA 1M3UA 1A50A 4F9DA 4N6EA 3IRDA 3V1PA 4IQLA 5RUBA 2YFNA 3AUJA 2C8NA 4MGGA 2KZHA 5E6YA 3KUMA 5LYRA 3UETA 1UWRA 2ZRZA 1JNDA 3W7HA 3JRKA 3EX4A 4UNIA 1GW1A 1UP0A 1F9CA 4F0LA 3TW6A 4QJ1A 2WZEA 4D72A 4L5ZA 5D38A 2BG5A 1ITQA