3QSTA

Crystal structure of trichomonas vaginalis triosephosphate isomerase tvag_096350 gene (val-45 variant)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
251
structure length
251
Chain Sequence
RTFFVGGNWKANPKTVQEAEKLVEMLNGAKVEGNVEVVVAAPFVFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEAGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase, putative
publication title Crystal structure of Trichomonas vaginalis triosephosphate isomerase TVAG_096350 gene
rcsb
source organism Trichomonas vaginalis
total genus 86
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qstA00
3KVKA 1D3GA 2CU0A 2FIQA 4K39A 1XKYA 3DH7A 1FWNA 2GVGA 5HUOA 2HMCA 1KBIA 2NXHA 4JDYA 4ADTA 1PCKA 2J24A 3BW3A 5G4EA 1W5MA 1UJPA 3F4WA 4MY1A 3NL2A 2QCCA 2ZZ7A 3USBA 2DZUA 4ZQCA 3CM4A 1B4KA 4O28A 3T55A 4N6FA 3HGJA 4DXVA 3BGJA 4UTTC 4IPIA 5D37A 3BO9A 3OVRA 3BARA 2GUUA 3W7KA 3FS2A 5HWMA 2E68A 3TXZA 1A5AA 2CZEA 4TR9A 4NX5A 3GLCA 1SW0A 4N4QA 1DQXA 4WD0A 1GOXA 4UTUA 3BVJA 3TE9A 3P61A 3IVTA 1EPXA 3M0ZA 3QZEA 5CPMA 4Q4KA 1IF2A 2A2IA 3CIXA 3G0UA 2W6RA 5FEXA 1XC4A 3H53A 2C6QA 1TV5A 2NXGA 4UC5A 1TMHA 1MZHA 3IVUA 4FNQA 1VS1A 2TMDA 2JGYA 4NXSA 3MO7A 1JCJA 3W1LA 2G95A 3MP5A 4WY0F 2E6FA 5C6MA 4YCPA 1O60A 3T44A 3SFKA 4XQ6A 1I2OA 4N6EA 3UYCA 2YW3A 4XKYA 5U4NA 1JUKA 1LRTA 2QKFA 3HO8A 4IOTA 3LCIA 4OGZA 2XN0A 3G0SA 3S5OA 3M6YA 3LOTA 3M5ZA 3TDFA 1O94A 3HB9A 4CLMA 3C2VA 3W87A 1DVJA 3DFQA 4RCXA 5D02A 1JCYA 3O16A 1NAL1 1SZEA 2J9YA 3MI6A 3DXIA 5CSSA 2Y7EA 2C3ZA 1ICSA 3VNDA 4ML9A 1OX5A 1H7XA 5HR6A 2Z2UA 3W7DA 1TTPA 1YDOA 2VFEA 3B04A 3T78A 3E49A 2X1RA 3LB0A 4RV8A 2VXNA 1QWGA 3A21A 5K4ZA 5F2GA 3C52A 4QITA 3GX9A 1S5TA 3H55A 1DL3A 4M6PA 4IWWA 1F7BA 3KX6A 1IIHA 5TIMA 1H1ZA 4QNEA 4UXDA 2Z6JA 2F7FA 1K7XA 2H3BA 4NVTA 3EWXA 1LBMA 3TJXA 3W2LA 5KITA 1AW1A 3HIJA 1T96A 5A5WA 1FDJA 2VFIA 4IMFA 1FWSA 1EUNA 3SJ3A 3W3OA 8TIMA 4KFNA 3L66A 3GKFA 1XUZA 1TPFA 2WNNA 3NQ7A 5DY2A 1P4CA 3NL3A 1LORA 3M5XA 4M19A 5L9FA 2ZZ6A 2NWSA 3O6DA 4O1CA 4LU0A 5BOOA 4NJKA 2C18A 3CIWA 3UWYA 4BK9A 3W9ZA 2VOMA 3TMQA 2B4GA 2V8ZA 4YWIA 5H91A 2QF7A 1TPH1 5CSRA 3QPZA 1OYCA 5F4SA 2YGYA 1XDMA 1AK5A 3BG5A 4GJ1A 3W7IA 2VC6A 2J88A 3W1PA 1QO5A 1TPC1 4Y8FA 4LS0A 4JYDA 3ZWSA 1ZJIA 3L5AA 4MOZA 3OA3A 3HGRA 4WXZA 3LTYA 1SZGA 3WJWA 3O07A 4O1AA 1TPEA 2D73A 4NJGA 4AVFA 4KKXA 5DXYA 3LI0A 1WXJA 1HO4A 2ZZ4A 5LHFA 4C1KA 3GDTA 3O06A 3N19B 3MMTA 3GNNA 3G1HA 4Q32A 2OMAA 2NUWA 3DHFA 1XM3A 3M1ZA 4UNKA 3HG3A 1KM6A 3PSWA 4O18A 3NG3A 1B57A 1AMKA 1J4EA 3LCLA 4IMGA 5LKYA 5AYZA 3S1XA 1OX4B 5IBXC 1TPWA 4K38A 2R94A 3N9SA 3GAYA 3LCXA 4GUGA 4NXKA 2ZZ3A 3W1MA 1L2UA 3QQ1A 3NPXA 3FFSA 4O16A 3MP4A 2FLIA 3LRMA 5DXXA 2OCZA 3WK2A 2C14A 4RZ6A 4BI5A 1L9WA 1YPIA 4WZHA 3TX9A 2PRLA 4IX2A 3NL5A 1ZENA 3EB2A 4FNRA 1TO3A 5EYWA 1AG1O 5D33A 2RH9A 2ISSA 5CZ0A 3E02A 1LOQA 4DPQA 1S5WA 1VJIA 4O1DA 1KLZA 1XCFA 4RR4A 4UTWA 1PVNA 1OJXA 5LSMA 2WPBA 5AYYA 4C1LA 1M7OA 4UIOA 1GTHA 5EY5A 3F1QA 1FY6A 3C2FA 4X9SA 2QCMA 2VFHA 4PL1A 1H61A 5AHMA 4MZ1A 4JTFA 2UV8G 3KHJA 3QMRA 1H5YA 1G4SA 1JUBA 2B7NA 5J5DA 4DBEA 2QJHA 1ALDA 3WJZA 1BTMA 1C29A 3HG5A 1FCVA 2DJXA 3TQVA 5DCDA 4IMCA 3G18A 1GEQA 2ZZ2A 1IXQA 1RQBA 2DZWA 1F6PA 4AMAA 3UD6A 3EX3A 5DELA 3AO0A 4JYEA 2QUVA 1UB3A 1SO6A 3JR2A 2CW6A 4JX5A 3CT7A 5F1VA 2ISWA 3LCHA 2HSAA 3OVQA 3RMJA 2ZDRA 1QOPA 1VZWA 3LERA 3Q2DA 3KFTA 4EF8A 2C19A 4LVBA 4O1BA 3L0GA 2IQTA 3GKAA 3W73A 4D2JA 2Y62A 1C9DA 1G7VA 1GVSA 4QAIA 5CG7A 3NPWA 3LCWA 4NJIA 1SQ7A 2OT1A 3FKRA 4AF0B 2A21A 5AYXA 3NAVA 1KTCA 2OJPA 1DQWA 4N9EA 5AHLA 2Y7GA 3DKJA 4QM1A 5LNUA 2V81A 2QCDB 5I3GA 4MJZA 3W2JA 3TU9A 5FF7A 4MZYA 3PBWA 3S42A 4AWSA 1LOLA 1JJKA 3U2OA 3KAOA 1W3NA 3UXDA 2JGQA 2QDHA 4EIVA 1H7WA 2P1FA 4HKPA 4GUIA 4QIUA 4BWLA 5F2IA 3TIMA 3TNOA 2V2CA 4O15A 3MHUA 4WXYA 3EWZA 4M6VA 1FWTA 2B7OA 4MIMA 5D2VA 2YZRA 3HF3A 1OYBA 4XWUA 1TCDA 3G1DA 3LGEA 1VH7A 4H6KA 2E1DA 2YR1A 2PURA 3I7QA 3A23A 5AHEA 5G4WA 1KM1A 4QSHA 4LOCA 3TMLA 3K30A 2NX1A 3GYEA 5KMYA 2QR6A 3PG9A 2FPTA 3T4CA 5AHNA 1F5ZA 2Y63A 3LM7A 3UY8A 1ICPA 2CLLA 3STGA 5LNWA 3C2EA 5A8GA 1W5QA 4CQ9A 3KRZA 4YL2A 3GXPA 4JYFA 4OE7A 3GDKA 3B05A 4TIMA 4Z1AA 5AN7A 5LNRA 4O53A 4JY9A 4PL2A 3UZJA 3W75A 3NA8A 1XUUA 3C8FA 1TJPA 1TRDA 1OX6A 5EBUA 3N34A 3C2RA 1DOSA 4QJ1A 3NQ2A 3NM1A 1KFJA 1PE1A 3SIZA 4LT9A 4O8RA 3FKKA 1KTBA 2R8WA 1B4EA 1YPFA 2Q3RA 5HR7A 3BGGA 2Y6ZA 3EX4A 2J9XA 2QCNA 4ALDA 4MFDA 1YLVA 2YPIA 3W7RA 5D2WA 3B8DA 1H50A 5G1TA 3B4UA 1O5KA 1THFD 2EGZA 4BF9A 5G2WA 1NF7A 3GXNA 4HNNA 2YCEA 3QC3A 3OG3A 3KVMA 1HFBA 2DORA 4H3DA 3IGUA 2DZPA 3BLIA 4OT7A 4JTGA 3QM3A 4FHAA 3GZ3A 2LLEA 1YTDA 1GJPA 1SSDA 4YCOA 2YFNA 3N2XA 3NGJA 4R53A 1YDVA 1SU5A 1V7YA 2A1YA 1QPNA 3S9YA 3W2MA 1KFKA 3B03A 5FF2A 1WV2A 5CPOA 2FB3A 3QSTA 2Y89A 5DY3A 2CLEA 1LP6A 4I7VA 2EHHA 1FWRA 3G3MA 4UFKA 1EX5A 4YLWA 5HUPA 4PA8A 4JR5A 2H8ZA 4XUGA 3TKFA 1PCWA 1TRIA 1OFQA 3CB8A 1FWWA 5HINA 4HNUA 4O11A 1W37A 1EWEA 2EAWA 3PBUA 1KFCA 4S1FA 2PCQA 2H90A 3M5VA 3PM6A 1KM3A 2VELA 4TU1A 4ZMGA 2E6YA 2QCHA 3W2NA 1NFBA 1VYPX 1NSJA 1LLZA 3LXBA 4IMEA 3M43A 2X30A 2EKCA 1TSIA 4R33A 4E38A 3HG2A 2QCGA 3C2OA 3L67A 3O1NA 3EKLA 1H7NA 1X8FA 3W1RA 4O52A 5EKYA 4MLJA 2JBMA 1SO3A 1DV7A 5BNKA 4FNUA 2I9EA 4N02A 1MXSA 4IJBA 1QAPA 2DZXA 3W1UA 1K7EA 1OFBA 2YXGA 3IIOA 2BWGA 5CPNA 3HPXA 3W2KA 2VEMA 3R5EA 1EP1A 3HGSA 3FOKA 4UNLA 3EXRA 5AOUA 3BPWA 5D38A 2G97A 4U28A 4LVDA 2ZA2A 1R2TA 3PVFA 2WKJA 2YSWA 1AW2A 1XFBA 3P81A 3W88A 3P84A 1VC4A 1MEIA 4O0ZA 2YYTA 1Z44A 3S8HA 3G0XA 2BXVA 1CI1A 4UR8A 3RK8A 2DZSA 3CWNA 1WX0A 3F03K 3UQNA 1H60A 1TPVA 4CCCA 3OVPA 2JKPA 4FB7A 5AC8A 4LTSA 3DENA 3BV4A 1UUOA 2V82A 1KV5A 2I14A 4JTTA 2RDTA 4MVAA 4MKNA 1JCNA 3GB6A 5J5RA 4GXMA 1P1XA 3C56A 3W84A 3TQKA 2ZRZA 3SECA 2J9ZA 2RHGA 4UFLA 4M5PA 2WSYA 3C0JA 1LLWA 1GT8A 2E09A 4U4MA 4WUIA 1Q6QA 3PB2A 4JNMA 4EOUA 5K2ZA 5F4XA 3G24A 3QRHA 4ZZ9A 2B7QA 3IV3A 4UFHA 3SY5A 5F2MA 4HNTA 1Z41A 3WJXA 4AHPA 1PHQA 3GDLA 4ZQNA 3W1QA 4LVAA 5K3VA 1ZNNA 3DI0A 4GBUA 4JD4A 1LBLA 1SPQA 6ALDA 5E93A 1W31A 1GVFA 1B9BA 2R91A 3R8RA 3PUDA 1XBXA 4E2DA 2AGKA 1GZGA 4AEOA 2QEZA 2ZTKA 2Y61A 3CWOX 3EWBX 3S5NA 4JEQA 1KFLA 1RZMA 1TTQA 1W0MA 1HL2A 2WNZA 2A6NA 4XTIA 3G1FA 3W7GA 2H8XA 4NQ1A 4HT3A 2QJIA 3L0NA 4UFMA 3FJ6A 4S2CA 4DO5A 1EUAA 4NX0A 1OHLA 3R12A 3LCGA 3TSDA 2ATMA 5BW6A 2Q3OA 1WAUA 1G69A 4HIBA 1GYNA 3EXSA 3M9YA 4A21A 3HPSA 4HN4A 3MI2A 3DFNA 4IX0A 1TPB1 3UXAA 3NQEA 4MYXA 2Q8LA 4RZ5A 3BK0A 3PF3A 3IRDA 1OFRA 3MW7A 2ZCGA 4UMCA 4WQ6A 3QF0A 3UWQA 1QO2A 5HWNA 1SUXA 5C55A 3UWZA 4DO6A 4JX6A 2YFOA 3A24A 1VPXA 2A7PA 3TA6A 1D3HA 1KM4A 3LLFA 4MYAA 1TB3A 2V2HA 3MHGA 1G4PA 3MBDA 2E77A 2QJGA 3L9CA 5E1QA 4AWUA 5EPDA 3RF9A 2E5CA 4AB4A 4FIQA 2HS6A 1XBYA 3PC0A 1R30A 1SO4A 4GE8A 1YXDA 4UTWC 1X6UA 4HSNA 2QCEA 3TV8A 5AC7A 2CLKA 4LV4A 3UWWA 4GFSA 1EP2A 1ZHAA 5FF3A 4M6QA 1KM5A 4A3UA 1SO5A 1PIIA 3I65A 4LV9A 3TROA 4IGHA 5KSWA 4GNJA 4A29A 1VYSX 4O4WA 2RDUA 4UTHA 2QAPA 3VI2A 1DJNA 4M7SA 2NXIA 1TTJA 1A50A 3F4NA 1WYIA 1N55A 2GQ9A 3TFCA 1EB3A 3TK7A 4Z1CA 4P2VA 4N9BA 1P0KA 1W1ZA 4PC8A 3QMSA 2OZ0A 4ADUA 4TMCA 4O17A 5EMUA 2CFFA 1GWJA 2PC4A 3SGUA 2BZNA 2CZDA 4E2BA 5I3KA 4M7TA 4CNOA 5DBUA 1TYGA 3NQGA 3LBCA 4K8EA 4RK8A 3NQ8A 4DQWA 1I2NA 1VYRA 1K7FA 4LUIA 2X2GA 3P5ZA 3HMJG 3S0CA 3W07A 1A5SA 5FESA 2CLMA 1TIMA 3CTLA 4A2RA 5I3HA 2GJLA 4MJMA 3L2IA 4FEZA 5D32A 1FCQA 1RPXA 4IUOA 2ZRUA 4PODA 4EVZA 4JTUA 4FXRA 5G2HA 1FX6A 3C3NA 1Q3NA 3O05A 1ZALA 5L6UA 1LDCA 5F2LA 1DKWA 1Q45A 3TW6A 2WSQA 3OBKA 3VE7A 1KBJA 5DBTA 5TQLA 4O12A 3HJZA 2ZQ0A 3A5VA 1SSGA 3IIXA 4JTJA 3TJLA 1G7UA 2RFGA 4UFIA 2ZRYA 5TBOA 3QSRA 2HS8A 1BWKA 4BWLC 2NV2A 3PY2A 2A4AA 3R2GA 4FXSA 3LHVA 2ZA3A 2X1TA 1OFEA 4ORIA 3WK3A 1H63A 4AHOA 3LBMA 3KOFA 5D04C 1FBAA 2FPYA 3M44A 3O6CA 1WOBA 3MHFA 4J9JA 4K37A 3N3MA 2H3DA 5CPLA 1ZAIA 4CCEA 5EA9A 1NF0A 4JN6A 1QNVA 4PFMA 1GQNA 2JK2A 3CHVA 1VHNA 3W1NA 4JY8A 4FX8A 4A2SA 4JTLA 3FLUA 5HMSA 5C54A 3OIXA 4O57A 1RQHA 3HQ1A 2V2DA 4JTEA 3P62A 1IIGA 1YTEA 4UR7A 1SR9A 4P61A 4WOZA 3TFXA 1ZCOA 3IIVA 3P80A 4UMAA 1OG0A 1LTDA 3UNDA 1OK4A 2AQWA 1OX4A 3MWAA 1QPOA 3L5MA 4Z1DA 4PTNA 4BR1A 3I7RA 3INPA 4E0CA 5BRBA 3W1TA 1IXOA 1EWDA 3I7SA 3UY7A 2Y7DA 3ABQA 1XL9A 2A7NA 1R2RA 3ANYA 5G1YA 3KRUA 3NM3A 3NQ6A 4RZ4A 3TUUA 1SZFA 5MHBA 3GR7A 2VEPA 3ATYA 3PS7A 2GQ8A 1V5XA 1AL7A 5LGXA 4CCDA 4LS1A 4POCA 3WJSA 1BWLA 4R7JA 5FEPA 4ORMA 2CLOA 3FYPA 4NJHA 4RLIA 2ATSA 2BSLA 3E9AA 3JS3A 4R34A 3QJAA 4ZVJA 1D9EA 1JRBA 2VFFA 2WV8A 1K8ZA 3LHWA 1VLIA 5AHFA 2V5BA 4JXCA 7TIMA 2JKEA 3ABOA 4LC8A 3UZ5A 4HNVA 3G22A 3LX9A 4RXGA 4K7VA 3TC6A 3G1SA 4JICA 1VCVA 5U7SA 2GJNA 3LXAA 2I1OA 3P5YA 3LRLA 4Y6GA 3W1AA 2W79A 1R46A 4GWEA 1I2RA 3CC1A 3G1XA 4PEKA 1BEUA 3B0UX 3EEGA 3C61A 1GG1A 3P74A 3U8GA 1JQVA 3LTPA 3Q58A 4EWND 2O7SA 4O54A 2TRSA 5LZLA 5SWUA 3GAKA 4BI6A 1KV8A 3NDOA 1UUMA 3EX2A 1K8YA 3NQAA 2E6AA 1OYAA 2ZRVA 1QDSA 1XDLA 1KFBA 3PULA 3LV6A 5D2XA 3PB0A 1XXXA 1G67A 3CLMA 3M7WA 3S1WA 1LYXA 1K3UA 1VCGA 1SZNA 3O8AA 1IGSA 3I6RA 2Y85A 3FJLA 3HBLA 1AL8A 4O4VA 3TH6A 4XKYB 2ZRXA 4MZ8A 4DO4A 3W7QA 3N14A 2QCDA 1I45A 1SW7A 1LBFA 3TR2A 1FDZA 1NVMA 3D0CA 3NVTA 3CEUA 5FI8A 4ONVA 3UPWA 2Y7FA 4I7WA 2CLIA 1ZAJA 3IGSA 4XZ9A 2DP3A 1KTNA 4CQ8A 1QFEA 3L5LA 4A22A 4NT0A 4GUJA 4JTIA 1O5XA 4WY0A 2HTMA 3EX6A 4N9DA 4QNWA 2V30A 5KZEA 3LHUA 1TPUA 2YYUA 4OWGA 3RLUA 3B0PA 2C1HA 2CLHA 3EXTA 4RXFA 1B3OA 3JRKA 3ZS4A 3VE9A 4WJEA 2PRMA 4NZJA 4BI7A 3N2MA 3V1PA 4HHPA 2VEKA 1SFJA 1MEHA 1J5TA 2R14A 5DCEA 1Q6OA 3M47A 5D2YA 5CZJA 4FX6M 3KRSA 5K7JA 3ZFHA 5DN1A 3ATZA 2Z1BA 1WDWA 3MP3A 2B0MA 3ZR4A 4RX0A 1EEPA 4NU7A 5DCBA 1YXYA 1OFPA 5KTLA 4WOQA 3DFPA 3W76A 2DZTA 4K8HA 3N9RA 1LRNA 4DEFA 1LOSA 1GG0A 2RKXA 3DFOA 3T7VA 1LZOA 3A5FA 3W7EA 3EX1A 2VEIA 2E6DA 4L4MA 4W9TA 2O7QA 4LRSA 2A85A 4ZL1A 1F05A 4H4IA 1VRDA 4IMDA 2G96A 4FX7A 4OBTA 3DFSA 3S5ZA 1JQXA 4IXXA 5EL1A 1LRQA 1JCMP 5FF0A 1BKSA 3W1XA 4S2BA 2WOQA 2NUYA 3NQMA 1RV8A 1G6CA 3IGXA 2CWNA 1JRCA 1PV8A 1UBSA 2TYSA 1M6JA 1LCOA 3TXVA 3BLEA 4DF0A 1HUVA 2X1SA 5FEZA 3MJYA 4MPQA 1ML1A 3L0KA 3THAA 4ZQOA 4UTTA 4L4LA 2OX1A 1TQXA 3STEA 1P5BA 4LWWA 1HTIA 3SR7A 1I8JA 4LY8A 1OABA 1FCBA 4MY8A 2CZFA 2QDGA 3KVJA 1I2QA 1T99A 3STFA 3SW6A 1KA9F 3CQ0A 1FQ0A 1WQ5A 3BG3A 3C6CA 1F73A 2ZA1A 3G1YA 4WX2A 1H62A 3BW2A 3G1VA 3GDMA 2XN1A 4FNSA 4LRTA 3TSMA 3L68A 2ZZ5A 3WJYA 1A5CA 2V5LA 4KWWA 3GXTA 4UFJA 3EWYA 2BTMA 3GR8A 3KVLA 1EIXA 2E5DA 3RLVA 3R13A 5G5IA 5HULA 3W7HA 1YADA 2NWRA 4AWTA 4N9CA 2ZTJA 3QYQA 3ZWTA 5LNVA 3W7MA 3IIZA 2Q8ZA 3DGRA 3NYZA 3CPRA 3O6YX 3M41A 4DF1A 1ICQA 1ZAHA 3NPUA 1K02A 3S5YA 5D09A 3IEBA 1GVRA 1CX9A 2FPVA 4UUIA 1DHPA 4MUZA 5T26A 1W5OA 1TV8A 1F2JA 3V75A 4HSOA 4ZQRA 4LUJA 1J2WA 2E5BA 5F4WA 4OU1A 1DBTA 2B7PA 1U83A 1VR6A 1RD5A 4KFOA 4LVGA 4O13A 2DU2A 2NX9A 1H1YA 3QPYA 5CKSA 3RU6A 3A22A 1OVDA 1MEWA 1WA3A 1A53A 2CLFA 4DBDA 4Y9AA 2DZVA 3N73A 2X1UA 4LVFA 2YDAA 1T0OA 4JIPA 1IXNA 1GVQA 1I2PA 2TSYA 4GUFA 3W23A 2G5WA 4X3ZA 3IVSA 1OF6A 5AFDA 2XN2A 4CNNA 2X16A 5LNSA 1H7RA 2EPHA 3NEVA 3W7NA 2FB2A 3U6WA 3W7OA 1OFAA 3W7LA 3BG9A 3HG4A 3VFLA 3WFAA 3GVGA 1FDYA 1FXQA 4I7UA 1VLWA 3PUOA 3GNDA 1W3TA 3NZRA 4LC6A 3QEZA 2W0UA 3LLDA 3P67A 3FEMA 4Z1BA 3SI9A 3NQCA 4JTHA 3NXFA 3NPVA 3SZ8A 3LRKA 3W85A 1ME9A 4MY9A 1SW3A 4G1KA 1X7FA 1G4TA 2FFCA 5DLCA 1R2SA 1KFEA 1KM2A 3DKLA 4RKAA 3ABSA 5HJLA 1K03A 3PUEA 5LGZA 1VCFA 1K8XA 4Y90A 1HO1A 3TQ0A 3P7YA 3O15A 1Q6LA 4FO4A 3LHTA 3P82A 4QQ3A 5F1UA 1Y0EA 1FCUA 1Q6RA 3LDVA 1WBJA 2VKZG 1QPQA 3LI1A 1JVNA 5FF4A 5IM51 1OFOA 2FTPA 3M16A 4AAJA 4OQVA 4AH7A 3PR2A 2ZZ1A 1YXCA 2Y88A 1RVGA 5GVJA 4IQLA 3QMTA 1S5VA 2VFDA 3UWVA 1EA0A 4NNCA 4TMBA 1YTKA 3G3DA 3RFAA 3PSVA 6TIMA 2GPTA 1RR2A 4LS2A 3NR0A 3UPBA 3MI3A 2WNQA 1PS9A 4BFAA 1NEYA 5I3FA 4K7YA 4RJEA 3G8EA 3PBYA 1GYLA 1LROA 3P8IA 5I3JA 4O10A 3WK0A 1XBZA 3NQFA 4JIQA 3DI1A 2YW4A 2BLEA 4NUWA 3W22A 1GVOA 4YXGA 1TPDA 3MYPA 4Q33A 2QUUA 3MYOA 4CNPA 1JULA 1W3IA 4LNYA 2GVJA 2PRHA 3NQDA 2J6XA 1FUYA 3QFEA 2FQIA 4HPXA 1X1ZA 4NNBA 3OHIA 2QCFA 3GDRA 5K9CA 4UTKA 5KZDA 3W74A 2WQPA 3DU0A 5CGQA 4KFPA 1TREA 2VFGA 2J27A 3DZ1A 4LW7A 3O63A 4IXHA 2KZHA 4X22A 5C2XA 3KXQA 1UCWA 5D2TA 1L6YA 4Z0JA 3B06A 5G2IA 1GTEA 5IBXA 1PHWA 4QISA 3HOJA 3QW4B 4AHQA 1C8VA 5AHIA 3LHZA 1ADOA 2NZLA 2WO5A 3THQA 3STCA 3MUXA 2Z6IA 4XBKA 3W6YA 4UTIA 5HWJA 5I3IA 2ZRWA 2DJLA 5AC6A 4X2RA 1L6SA 3NQVA 5FEWA 2P10A 1TQJA 3HGOA 3LV5A 3TW7A 3QW3A 3G1AA 4ICNA 1JUEA 3L21A 5AB3A 1KW1A 1YDNA 2ALDA 3S1UA 1W54A 1T8XA 3C4UA 1JR1A 1ME7A 4OHQA 3T40A 1EP3A 1W5PA 2GOUA 1FXPA 1ZFJA 2ISVA 5H2ZA 4K6AA 3PAJA 5CZTA 3P8JA 3W2UA 5KINA 1I4NA 3BW4A 3CU2A 1OFDA 3I68A 5KZMA 3WK1A 1W56A 5K9DA 2ZFAA 3S6DA 3TSBA 3IIPA 4EF9A 4O0KA 2QCLA 2F84A 3HPZA 3TAKA 4GC4A 3A9IA 1P0NA 5CZSA 4JX4A 2C0AA 4O19A 5LHEA 3YPIA 3W86A 1IXPA 1Z42A 3PWAA 2Z0IA 3AJXA 3SGZA 1GPWA 4AXKA 3NL6A 3TC7A 2OT0A 1X1OA 4JDBA 3DBPA 2C16A 1G4EA 4JTKA 3VCRA 1MO0A 4XBSA 3E0IA 3Q37A 4PH6A 2V0TA 1L6WA 4TO8A 3W71A 1VHCA 4JTSA 3DHDA 2P0OA 1OF8A 2Y70A 1OK6A 5C5YA 2GVLA 1RQEA 1ME8A 4Z0SA 1MSSA 1JCLA 4WY0B 3P60A 1ONRA 3W70A 2V9DA 1E51A 2A6LA 1DORA 2EF9A 4GRSA 1Z48A 3PBVA 2A0NA 4NNAA 2AAMA 2GQAA 1H7PA 1AW5A 4NJJA 4Y96A 1H7OA 1O4UA 3TAOA 2C15A 5ABTA 2NUXA 3CEPA 3FYOA 5BMWA 2FJKA 3BLFA 4JS3A 3VKJA 3TCEA 5E0KA 3EWUA 3B0VC 4UMBA 2YX0A 1W8SA 1VGAA 5D05A 3ABRA 4JGDA 2NV1A 1O95A 3GIYA 3S1VA 4XTDA 4HPJA 1F74A 1TJRA 1QCWA 2XFWA 1XI3A 4FF7A 5BMXA 2ABBA 2ZYFA 3E96A 4FNPA 1XBVA 3QQ0A 4OV4A 3PG8A 4TX9A 3W7JA 1H51A 4I9AA 3NNTA 4UTJA 2WJZA 3E12A 5D30A 4DF2A 1N7KA 2PE4A 3FA5A 1U5JA 3RNDA 3Q94A 1S3HA 1TTIA 3EKZA 1DJQA 4CQAA 4ZQPA 1WBHA 5K4XA 4UCGA 4N4PA 1R47A 3W7PA 1N8FA 4MFEA 1QR7A 1UASA 1A5BA 3W7CA 5K9XA 1WOAA 1SFLA 1KM0A 2C13A 2TPSA 1F6KA 4B5NA 3NOEA 4Z08A 1ZY9A 1PL9A 1YYAA 3LXCA 4DPPA 5HNRA 4AF0A 4ZQMA 3M5YA 3UWUA 3LCFA 3W83A 3DFTA 4IPJA 4N2YA 3MBFA 3DAQA 4OV9A 4PCFA 1LM1A 4MLRA 2ZBTA 1W5NA 2BX7A 4O14A 4UTMA 3H54A 5D03A 2ABAA 1M5WA 2CZ5A 2JKAA 2H6RA 5HQEA 3FIGA 2WSRA 2QAFA 3NZ1A 1QMLA 2QUTA 3QH2A 1VQTA 1F76A 4DELA 1JCXA 1HG3A 3OEXA 1QPRA 3ELFA 2A7RA 2NX3A 3SSJA 2VENA 3EWWA 4K36A 4UTLA 3GK0A 3W72A 2A5HA 4FNTA 4GUHA 1TV7A 3NO5A 1M7PA 1CW2A 4O50A 4ADSA 2FDSA 2NLIA 3R89A 4NZFA 1KLYA 4KWVA 1QOQA 3LHYA 3LTSA 4FIRA 4YMZA 3G8RA 2RDWA 3L65A
chains in the Genus database with same CATH superfamily
3KVKA 1XKYA 4KIRA 1SFSA 2OOGA 2PBOA 2XH4A 4ADTA 1PCKA 2IS7A 1J2BA 1LF1A 3KTSA 4MY1A 3USBA 3QLDA 1N8IA 3RG6A 2DT3A 3IJIA 3UG4A 3DDMA 7A3HA 1B9ZA 2P76A 3DOPA 3VOGA 3WDQA 3OZOA 4DXVA 2HPIA 3WLMA 4UTTC 3CT2A 3WDHA 3BARA 3APTA 2PWGA 2GUUA 2GVYA 4XZLX 4IQDA 4X60A 2UY4A 3FDKA 1MW1A 2J8TA 1A5AA 2CZEA 1RBOB 1FP9A 3GLCA 2CETA 1V77A 3N2TA 3SRFA 2EBNA 3LQLA 1KCKA 3LS9A 3IV8A 3WUGA 3IVTA 3QY8A 1EPXA 4OUEA 3UZZA 2WZEA 2P88A 4Q4KA 4B2DA 1VRXA 3G0UA 1W9PA 4Q8UA 2FVKA 1HX0A 1MZHA 2OZ3A 3B8SA 4XK2A 4QSFA 4NXSA 3W1LA 2G95A 1HVQA 4WY0F 3ZOAA 3BH4A 3ORWA 5C6MA 4GNKB 3T44A 4N6EA 1EBHA 5HA7A 2YW3A 3GG7A 2ON3A 5U4NA 3MU7A 3DEQA 1X6LA 1JYXA 1UWQA 1JUKA 4S38A 1LRTA 2QKFA 3HO8A 4OGZA 2XN0A 1Q2RA 3TDFA 3HB9A 3ZJ8A 5MKGA 2VGFA 4RCXA 5D02A 1JCYA 5D4YA 3DXIA 3VDCA 1E55A 1DJIA 3WEZA 1H7XA 1GJUA 3MCMA 3WDIA 1TTPA 1UWAA 5I03A 1NTHA 5A94A 5DMYA 4RV8A 2VXNA 2XU2A 1CPUA 1ZBCA 5D9PA 5LIWX 3QGAC 1MVYA 1PSCA 1E0WA 5TIMA 4CEUC 4C6OA 1TX2A 3H24A 3W2LA 4ZOBA 5A5WA 3T2PA 2ONEA 5E0CA 3WQGA 1MXDA 4YHGA 2Z28A 3KOYA 1N8WA 4HOWA 4KFNA 3L66A 3FJ4A 4J28A 1XV8A 1P4CA 1EJXC 3SN0A 1E6PA 5L9FA 2INFA 3O6DA 4CU6A 3U7BA 2C18A 4BK9A 5LIYX 1TV4A 2B4GA 3AROA 2V8ZA 3T0BA 1TPH1 4ML4A 4PEEA 3U57A 3QPZA 4BEUA 4W8BA 1RJPA 3WQFA 1ZRQA 3ARWA 1XG4A 3BG5A 3ARYA 3FN9A 3W1PA 1LG1A 1AZ1A 1KXQA 1MRQA 1BYAA 1IT0A 2EG8A 4QDWA 2GDQA 4DJFD 5H1WA 1QXLA 3GXDA 1SZGA 3O07A 4NAFA 4HU0A 3VMOA 2DZAA 2VZSA 4AVNA 3MPGA 3HURA 4B3LA 3UP8A 1WXJA 2ZZ4A 3HV8A 2Z2BA 2AL2A 4J7RA 3UR8A 3VIHA 2IKGA 4B5VA 3N19B 3GNNA 2PTYA 4V2XA 1OIFA 3THCA 3DHFA 2OSWA 3TP4A 1EF2A 1BVZA 4PFHA 2WVSA 3U2EA 3NG3A 5A6BA 5IHRA 1R3QA 3A3WA 4WGXA 4WDWA 2AMXA 1BXBA 1NFPA 4H04A 3GAYA 5DFAA 2EEXA 3M7SA 4QP0A 3FVMA 2WC3A 4C6DA 2ZZ3A 3W1MA 1REQA 2ZUMA 1U2YA 1K1DA 1XGZA 3TJ4A 2PZ0A 4E8CA 3AS2A 4RZ6A 3TX9A 1QUMA 2PRLA 2BMBA 3NL5A 4FNRA 1AJ2A 3EOEA 4P7NA 3L23A 3NZPA 4GYPC 3GW0A 1VFHA 3WQPA 1XCFA 2XSBA 3BZJA 5REQB 3GR4A 1M7OA 4FI4A 3P14A 1ODZA 3MZNA 1GTHA 5EY5A 3R0DA 3R58A 2CPUA 4C5ZA 4PL1A 1H61A 5AHMA 2HE5A 3KHJA 1JZ4A 1H5YA 1WZAA 1G4SA 3CV6A 3AXHA 3SCVA 4NZ5A 4HU8A 3ONCA 4US6A 2D69A 3MSYA 3L12A 1UKOA 3U2ZA 4E8DA 5A1AA 4QCEA 2C79A 3G18A 1IXQA 2DZWA 1F6PA 4AMAA 3AO0A 1ISYA 4AYSA 2YL6A 3LCHA 3POCA 2ZDRA 3GHSA 4Y7EA 3GVQA 4DWSB 4QGCA 4PTXA 4C6PA 1XYFA 3LERA 4XD3A 3VGHA 4F48A 3VNKA 4OZOA 4HTYA 3SRKA 1MI3A 4LVBA 4O1BA 4PSRA 2IQTA 3H2FA 4EPEC 4A3HA 4M1BA 5DEZA 3VM7A 3LCWA 5GNYA 4NJIA 2OT1A 1Q65A 4AF0B 1TZZA 1W8GA 4PBFA 2DIEA 4AWEA 4C1NB 4D6CA 1DJYA 2FDMA 5AHLA 4ZFCA 3A4WA 4KEVA 2PSNA 3NDYA 3W2JA 3TU9A 3NGFA 3OZMA 1WUFA 3PBWA 1PZ1A 4B9ZA 5C2CA 1W3NA 4HB7A 3HJEA 2QF8A 4IG2A 3KW3A 1RLCL 4Y2WA 3QGVA 2DH2A 5C71A 3CHDA 2PU0A 2B7OA 2PZNA 2YZRA 1OYBA 3UG5A 1J79A 1VH7A 1TVNA 1F3WA 2VCCA 1NELA 4A8NA 2PURA 1C92A 3OLEA 3I7QA 5AHEA 5G4WA 2OQHA 2IQ0A 2ZUVA 4RNIA 1VF8A 4E4PA 5IHSA 4AQLA 4D6DA 4M6UA 3VFCA 4I6KA 4KWUA 1RY0A 1UR1A 1W6TA 4GKTA 1RJRA 3MT1A 4W93A 3NWRA 5A8GA 1W5QA 4IQJA 4JYFA 1P0EA 4OE7A 3GDKA 2XUCA 2FZMA 2P5NA 4FLOA 3KLLA 2QUMA 1XUUA 4C65A 4BQ2A 1M01A 2ZUWA 3SIZA 4EE9A 4XO7A 4HZ6A 2CIPA 2Q3RA 3LPOA 2G37A 5A8NA 3BGGA 4PTDA 2PLKA 1PKLA 3B8DA 3RO8A 1O5KA 5G2WA 3WLQA 2RJHA 3QC3A 1RBLA 4GXWA 1HFBA 4GQBA 4XZBA 3KBWA 2I57A 3ZVIA 2DZPA 4DJEC 1DWFM 4JTGA 3CUXA 4FHAA 1JPKA 2ASHA 3FXYA 3KL0A 4EPBC 1JEZA 1FH7A 1GJPA 4RDWA 3ENLA 1YX1A 2CWXA 1CCWB 1J5SA 1YDVA 4QLLA 4F79A 3K1GA 3O9NA 3UF9A 3TLLA 3LSBA 1KFKA 3B03A 5MKGB 1L6GA 3QQWA 3MSRA 2WZHA 3QSTA 2Y89A 5DY3A 1LP6A 1HGWA 2WM1A 3P3BA 4I7VA 5FD0A 1FWRA 3G3MA 3RHGA 4UFKA 1EX5A 2BY3A 3TKFA 4HNUA 1W37A 2EPLX 4QE1A 3I6TA 1UW9A 2O56A 1NOFA 3POHA 2OO6A 3BCFA 4Q4RA 2IPGA 1WO2A 2E6YA 1JDAA 3W2NA 1NSJA 1BVWA 2QIWA 3NO1A 1J0KA 2EKCA 4R33A 2Y8VA 4S3KA 3EOSA 3C2OA 5EFFA 4JKLA 3EKLA 1H7NA 1X8FA 1GGOA 1ODUA 4MLJA 2CBVA 5BNKA 4FNUA 4CU8A 4N02A 4IJBA 2DIJA 2Z1WA 3VIOA 2ZKMX 2PPGA 1OFBA 2ADAA 2YXGA 1F3XA 1C8YA 1QNSA 4DNMA 2WLZA 3EXRA 2O92A 1QJWA 4LVDA 4PMVA 1HN1A 2YDQA 3MC5A 4F2TA 2ZXBA 1VJSA 2ZA2A 3V36A 2JIEA 4O0QA 4U33A 1AW2A 1XFBA 1KCLA 2VUYA 2J79A 3B8TA 4HBKA 3VZXA 3GM8A 4MWAE 3ABXA 2YYTA 3UJEA 4ZO7A 1BF2A 1OIMA 3W0KA 3QOKA 4C6BA 1H60A 4CCCA 4Q7IA 1WUEA 3OVPA 2NT0A 3UPMA 4NAFB 1EJ7L 1KV5A 1RAKA 2RDTA 4ECLA 1JCNA 2AAAA 3EDFA 3C56A 3N3TA 1V4YA 2RHGA 2OYMA 2AL2B 4WR3A 4FAMA 2E09A 4MDOA 2WMFA 5DMLA 1Q6QA 1E1FA 4EOUA 1GYMA 1M53A 4Q6XA 2WSKA 3MWCA 4ZZ9A 4ZGYA 1OC7A 4HNTA 3PANA 1EFZA 4AHPA 1REQB 2Q6ZA 4JD4A 4G7EA 1ITXA 3VOFA 2Y0FA 1FWEC 3PUDA 3K4DA 3H4XA 1GZGA 1T7LA 4TV5A 4GI6A 4QS5A 4S3DA 3IS4A 5BRPA 1V79A 1XIFA 4HZ8A 1KFLA 1JYVA 2J6VA 4JHOA 3UEQA 3CV7A 4NQ1A 3QV7A 3UWEA 1PWMA 2MNRA 1EUAA 3TQPA 4P8WA 1ISVA 5HMFA 1BXNA 3R12A 4XAFA 4EWJA 1EL3A 3EMQA 1PKNA 3LCGA 1ZUAX 2ATMA 4HCLA 5C2GA 4LFYA 1ZZMA 3AZSA 3SCOA 1XP3A 3M9YA 4A21A 3HPSA 3QTPA 1KGUA 4AD1A 4MYXA 5HDRA 1XRTA 4JIHA 4GBDA 4W84A 4BA0A 1OFRA 1R9XA 1W1IE 2YCKX 2PODA 3P6LA 3UWZA 1QK0A 1D2KA 4JX6A 2YFOA 4YTSA 1OINA 1AVAA 3VM5A 3LLFA 2WVTA 4AIUA 3TTQA 6TAAA 3GH7A 2E77A 4MAZA 5EPDA 4F0HA 1XBYA 2GSHA 4GGBA 4I6VA 4E6MA 1UG6A 1T40A 5CSYA 2FGBA 3K8LA 1GOQA 3WENA 1HQTA 4GFSA 4FOUA 1S2AA 3WQEA 4IGNA 5CXPA 4ZA0A 1SO5A 1PIIA 3I65A 2CXGA 3WQ5A 3AYSA 4OECA 2ZIDA 4IGHA 3WLPA 1NM9A 4L6OA 1CXEA 2RDUA 4UTHA 2QAPA 3VI2A 4IG2B 5I2UA 4M7SA 4Z1CA 2AGTA 1E6QM 2XYLA 1W1PA 4PC8A 1C9WA 2IKJA 4HSHA 4IP7A 4B5WA 1GOIA 3QXBA 4E2BA 1XG3A 5I07A 4M7TA 4CNOA 4H7VA 1AD4A 1EHNA 5DBUA 4AD2A 4HTBA 3D47A 3W6MA 3V0SA 8A3HA 1I2NA 3N9KA 1VYRA 3H21A 1K7FA 4L7ZA 3P5ZA 3WQWA 3S0CA 3W07A 4LXFA 4C5YA 3CTLA 3PJUA 3MCOA 2GJLA 2QQ6A 1QW8A 4JTUA 4FXRA 5G2HA 3VTRA 4RE4A 1YKWA 5JH2A 1ZALA 2XIBA 2BVYA 5HK4A 3OQEA 5M1TA 5F2LA 3VE7A 3HJZA 1G7UA 2RFGA 2ZRYA 2C91A 3PTKA 1BWKA 4WEVX 4IL2A 3F5LA 4MNMA 5EFDA 2YJQA 3RRAA 3WD3A 1VAHA 4HOXA 1KWGA 4LJ3A 5D04C 4RV3A 3O6CA 3MHFA 1I0BA 4J9JA 3CZLA 5CJNA 4M24A 4RE2A 4HZMA 5EA9A 1MNZA 4JN6A 4PFMA 1GQNA 3CHVA 1VHNA 3VINA 4YTQA 1UIOA 4A2SA 1PDYA 3FLUA 5HMSA 2GUYA 3VNLA 1XSKA 3FSTA 1F07A 3P62A 2O0TA 1FA2A 1YTEA 4CEXC 2ZX7A 4CN6A 1TUFA 1JD7A 1ZCOA 2G8ZA 3P80A 4UMAA 1OG0A 3UNDA 2WHLA 1OX4A 2VHLA 1E71M 4HYVA 2YXXA 3L5MA 3SB0A 1Z3NA 3W1TA 3PWGA 5FL0A 1XL9A 1YNPA 4Q7BA 1KXTA 3ANYA 4Y9MA 3K8KA 4R9OA 1CGYA 2BGNE 2VEPA 3ATYA 3V1HA 3DBNA 3C0LA 4MB1A 5LA0A 4L61A 1S2WA 3WJSA 3FK4A 4ORMA 2CLOA 5DF0A 1DTUA 3JS3A 3DIPA 2JFEX 2JF7A 1SM9A 3I3EA 2WVVB 3LUTA 3V0UA 1HP5A 2J66A 7TIMA 1BLIA 3CQJA 4PUUA 4F0LA 2IPFA 3G22A 1GK8A 3LX9A 4S3JA 3WLNA 1EXPA 4XB3A 4JICA 4YHEA 1WKEA 1CYGA 3P5YA 1NDZA 4PRTA 2W79A 4Q8TA 1UOKA 1XKJA 3R43A 3NZQA 3U8GA 1OT1A 3LTPA 3GG0A 3BJSA 5LZLA 5SWUA 1K8YA 4DUXA 2E6AA 3ANVA 1PWLA 1S5NA 1MDRA 3PB0A 3BLOA 3KWXA 3RO6A 1XXXA 1XYLA 2OELA 3SUSA 3S1WA 1K3UA 1XD0A 2Y85A 3HBLA 2HWGA 3QBUA 3TH6A 3AZRA 5LA1A 3W7QA 1NOUA 3KE0A 4ROPA 3VGFA 3MMUA 4LAOA 4B4FA 2GZXA 1LBFA 1LT8A 1FDZA 4GZJA 4ILSA 3AI0A 1CB2A 3D0CA 2BFGA 2Y7FA 4I7WA 2PDFA 4JQAA 1F6YA 3S2LA 1ZAJA 4M3PA 4CQ8A 4GUJA 4KF1A 4JTIA 2QT3A 4WY0A 2HTMA 3EX6A 4QNWA 2XVPA 1JAKA 4OWGA 3IAPA 4RL3A 5ENLA 2C1HA 4RXFA 3JRKA 3KUMA 4DJDA 3UJSA 3ZS4A 4YVXA 1IYXA 4WJEA 5HOSA 1W9UA 4NZJA 4YNGA 1F4AA 2VEKA 2VCBA 5FJIA 1J5TA 2R14A 5DCEA 4PMJA 1VFUA 3S9ZA 5CZJA 4GINA 2BV9A 3ZFHA 3MUCA 1E3XA 3HTWA 2Z1BA 2B0MA 4RX0A 1GNXA 5I5RA 5DCBA 1YXYA 1OFPA 1Z89A 3DFPA 1MZRA 4JTAA 4EAMA 4AG0A 4DEFA 1LOSA 1GG0A 2WBGA 2RKXA 3SCQA 4JTRA 3T7VA 4W7WA 4AX7A 5CC5A 2JIWA 4L4MA 4W9TA 4IISA 3WX7A 4ZL1A 5BROA 3NSMA 3CZJA 4P8UA 2G96A 3VABA 3DFSA 4QE5A 1N82A 1UC5A 4ICMA 3EOUA 3PPGA 1BKSA 3IGHX 2WOQA 2XGBA 3NQMA 2CWNA 1OGGA 1R38A 5A8MA 1M68A 4KIEA 2OGJA 1S38A 3LZ5A 1M6JA 1ZTVA 4QXIA 1V6YA 1ML1A 3L0KA 4ZQOA 3AMGA 3LA4A 1P5BA 4LWWA 4MY8A 3RCNA 1ZJBA 4TV6A 3STFA 4LF1A 1PX3A 5AECA 2ZA1A 3SUVA 4TVUA 1H62A 3BW2A 3LMZA 4F4RA 2XN1A 4FNSA 4FXJA 2FGZA 3L68A 3WY1A 4KWWA 1PYMA 1B90A 3CPGA 4UFJA 3EWYA 4DB7A 3ARRA 3R13A 5HULA 2V3DA 1W32A 2CNCA 4AWTA 2VYOA 4MPKA 1AMYA 3O6YX 3M41A 3MDWA 4DF1A 1G0CA 1ZAHA 1K02A 5FACA 3IEBA 3WLTA 1GVRA 1CX9A 3WNKA 4MUZA 1QTWA 2R1PA 5T26A 5BYWA 1TKKA 4DLMA 1S46A 4U3CA 4ZB0A 4ZQRA 4LUJA 1JNDA 3LSCA 1E6ZA 2B7PA 4YWSA 1U83A 3S3GA 3ZVHA 4KFOA 3WYZA 1OQFA 4URIA 3ES8A 3O0KA 2WANA 2XZ7A 3A22A 4J27A 1CGVA 2YB1A 2VNCA 1VPQA 3EEZA 2CERA 2A3AA 2H9AA 2VR5A 1KBKA 3GH5A 3W23A 3DC8A 2XVKA 4IPNB 3IVSA 3RCMA 5AFDA 4MG4A 1H7RA 2AMGA 1GJWA 3NEVA 3AHXA 2DSWA 3W7LA 1K77A 1B3WA 3E6EA 3HG4A 3GVGA 1FXQA 3TN4A 1FHLA 1VLWA 3PUOA 3RPMA 3NDZA 2PLMA 4LC6A 3QEZA 2W0UA 3LLDA 1VBHA 2V63A 3FEMA 3SI9A 4UQEA 4JQ1A 1XLHA 3LENA 4NSBA 1ME9A 1W9DM 4G1KA 4JTDA 1X7FA 1G4TA 4HD5A 5HJLA 4NASA 1V3KA 5LGZA 2EG6A 4A4AA 3EB3A 3TQ0A 1Q6LA 4KBXA 4ZB2A 3P82A 3EPOA 4HHHA 2VKZG 1QPQA 3WLJA 1JVNA 4NY2A 5FF4A 4G7FA 1NDWA 3FXGA 4C6QA 1TJ2A 2OG9A 3EDKA 2EG7A 3G3DA 2V68A 2IXUA 4F2BA 3V0TA 1LQ2A 3ALFA 2GPTA 2AOSA 1TZ7A 3MI3A 4PUKA 1XLKA 4BFAA 3RPDA 4K7YA 3G8EA 3BGAA 1GYLA 2PF0A 1XBZA 2OEJA 3DI1A 3NJ3A 3P0XA 4NUWA 1F4HA 4QG9A 9XIMA 4Z2JA 1VFMA 3MANA 4Q33A 2BXYA 3QV8A 5I77A 4DBSA 1RBAA 2VRKA 2BS9A 2OX4A 2D1ZA 1X1ZA 4S23A 1AUSL 4TVDA 4EPKA 4AZIA 4US5D 5CGQA 2WKLA 1XS2A 3O63A 4IXHA 3KXQA 2ZC1A 4AEFA 3VNJA 5M03A 3C2YA 1NQ6A 5IBXA 3S4TA 1PHWA 3RR4A 4CNTA 4QISA 3HOJA 4U2ZA 2GJXA 2EPKX 7CGTA 1AH4A 4B4HA 3FYYA 2NZLA 2WO5A 3SM0A 5C9WA 3W6YA 3T09A 2PDHA 4F9DA 4PUDA 5I3IA 2QYGA 5AC6A 3E0VA 4X2RA 4XD5A 3NQVA 5FEWA 1QW9A 2V5JA 4GHRA 1CLXA 3QW3A 4QEEA 3G1AA 5AB3A 1YDNA 4QLJA 1AJ0A 1W54A 3OZPA 1T8XA 1ISWA 2Z2AA 4W88A 1LL7A 4FLSA 3B3DA 5H2ZA 5CZTA 1KQYA 5KINA 1I4NA 4ACZA 5IXEA 3MS8A 4Q8WA 1IR1A 5K9DA 2PC8A 3S6DA 4FLQA 1XINA 1S1RA 1XRFA 2PLCA 3N17A 3LNPA 4X0NA 4GC4A 2Q02A 2GGGA 1YRRA 1P0NA 4IICA 4JX4A 3NURA 1MNSA 2E4TA 1IXPA 4AXKA 1EGVA 4K1WA 2UY5A 4DVOA 1RPKA 3MMDA 1G4EA 1MO0A 4NIRA 4XBSA 1A80A 3Q37A 4PH6A 2V0TA 3ZSSA 2P0OA 2VL4A 1OK6A 1ZB5A 2ZWZA 2GVLA 4DRSA 4I9JA 1I60A 4WY0B 4AIEA 3PJXA 2R1KA 3OHMB 4XV0A 3BWWA 3W37A 3PBGA 1ZS2A 1Q8JA 1PUDA 1J18A 4Y96A 1NIUA 2YCIX 5ABTA 3CEPA 4JZ5A 5BMWA 2FJKA 3MKVA 5H8PA 4WDXA 3VKJA 3FSUA 3TCEA 4S3FA 4LSBA 3CH9A 1F8MA 3VXGA 1TV3A 5D05A 4CQBA 3HM7A 1J9YA 1VP5A 5TAOA 1TJRA 3ZIZA 2XFWA 2W66A 5BMXA 2ZYFA 1XIJA 3QQ0A 1Q4NX 1JCTA 1NWTA 1BPLB 2PE4A 1S3HA 1TTIA 1DJQA 4HQVA 4N4PA 1R47A 3W7PA 4E2VA 2W67A 4J2MA 1TMQA 3UCCA 3OODA 1J0IA 2BOGX 4P8XA 1X96A 3AFBA 3UZXA 4XSLA 3CAWA 1Q66A 1V3JA 5HNRA 4ZQMA 1RP9A 4LBSA 3LCFA 3W83A 1J8VA 4IPJA 2QJJA 4N2YA 3DAQA 4QLKA 4IIHA 4AZBA 2VX5A 4O14A 1EYEA 1M5WA 3BCJA 2H6RA 3VKCA 2WSRA 3DHUA 1QMLA 2PI6A 2HBXA 4J3TA 1QT1A 3TN5A 3VMNA 1QPRA 1GOOA 2A7RA 3M0YA 4YU1A 4ROQA 4ZE4A 4HOZA 3W72A 1M9HA 2XFYA 1CW2A 1YNYA 1E9LA 2PWUA 4FIRA 5I09A 3WLIA 3ME3A 1D3GA 1JI1A 2NW0A 2KAUC 2XGZA 3CZKA 3TOPA 5AYBA 1V0NA 4B5TA 2G3FA 5G4EA 2QIIA 3BLKA 2ZZ7A 2I56A 4ZQCA 4YYCA 2J7DA 4N6FA 1V02A 3HGJA 3ZVHB 4ZFMA 3BGJA 1C90A 3BO9A 3OVRA 4OTKA 1GVEA 1TA3A 4MADA 1MW3A 1QHZA 2OWCA 2F2KA 4JQ4A 1UQYA 3TXZA 4MKVA 4JIIX 3ARZA 5GNXA 4NX5A 1EC7A 1SW0A 3CZEA 4N4QA 4V15A 2BDQA 1DIEA 4HA1A 1U5HA 3D6NA 3LK6A 2ZX5A 4UTUA 2H9AB 1FWAC 3AS0A 2XG9A 3P61A 1Y5VA 3GW3A 1IF2A 1JXJA 2A2IA 1QATA 2W6RA 2WKGA 5FEXA 3H53A 5KETA 1E9YB 3SQMA 3D3AA 1JCJA 1K4HA 1O60A 3TYZA 5DMMA 4AY8A 1V03A 4DJED 4XKYA 3VDBA 4LQ1A 4JCLA 6REQA 3GBDA 4Z2HA 1JYNA 4UBPC 3T1GA 4LB4A 1XLBA 1BG4A 3G0SA 3S5OA 1H41A 3SEPA 3LOTA 3M5ZA 3PWIA 3UXLA 3DFQA 1H3GA 1VFOA 1NAL1 4NYUA 2J9YA 5CSSA 1ZBWA 4ZENA 2C3ZA 1HNYA 1ICSA 1KRAC 4ML9A 1OX5A 2G3MA 3MDUA 5FAGA 3UJ2A 1I75A 2Z2UA 3W7DA 2VFEA 1JNEA 3SCSA 1UPMB 3LB0A 3H4GA 5F2GA 3C52A 3PAOA 3GX9A 4ZTXA 1DL3A 4IWWA 1F7BA 1Q7MA 2E25A 4OFCA 1AW1A 2OLHA 4DJFA 2D0GA 3HIJA 1T96A 5I0DA 4KT2A 3RX4A 1Z69A 1FWSA 1UQZA 4WHBA 1XYAA 2ZX9A 3BMWA 3U4FA 3SJ3A 2XTKA 4UWMA 1Q4WA 3W3OA 4NILA 2WNNA 1OCNA 3NQ7A 3NL3A 2XIMA 1YIXA 4NAEA 2NWSA 4O1CA 3GSMA 4MNLA 4NJKA 1WXYA 1RLDA 3SCPA 3UWYA 4IIDA 2VOMA 2UBPC 4LNCA 1K9FA 1B54A 2GJXB 4GVGA 3TMQA 4YWIA 3GU2A 3KOZA 1FWJC 5CSRA 3WBEA 1B3ZA 2ACRA 4BKNA 3SUTA 2YGYA 4UZSA 1LWJA 1WDSA 1MQRA 4GJ1A 2J88A 2WMGA 1QO5A 4RDYA 4HVXA 1XFCA 1TUXA 4Y8FA 1AZ2A 3BJFA 1ZJIA 4KWOA 3MB9A 3OA3A 4WXZA 4FZIA 2D73A 1BWVA 3DUGA 4ACZB 4GJIA 5LHFA 4C1KA 2J7BA 5CEWA 2IQDA 1UD2A 3GDTA 1PX8A 3MMTA 1YHTA 2NUWA 3VKKA 1XM3A 3ZZ1A 1Z7AA 3WMCA 4IMGA 3CO4A 3NXLA 5LYRA 3TYAA 4K38A 3R8HA 4HPGA 4V27A 4L4OA 5T9BG 1L2UA 1W1A1 1KQZA 4M56A 1GOWA 4O16A 3MP4A 4Q8NA 1GZJA 5DXXA 2P50A 3IRSA 5CH9A 1ZENA 1GUVA 2ISSA 2XWEA 3OJGA 2WJFA 3E02A 4O1DA 3S5SA 2WPBA 3GH4A 4B92A 5FCZA 2FTYA 2A3BA 3A13A 4X9SA 4RNJA 1HIZA 1CXIA 2FYMA 3JUGA 3WQ8A 3OZYA 5J5DA 1BGGA 3VD9A 4BZYA 4Q4PA 4LUTA 3WFLA 1BTMA 3LG3A 3ZMRA 3UG3A 2DJXA 2CZVA 3TQVA 1KFWA 4IMCA 4R85A 2NSOA 5A8PA 2E9MA 1DXIA 4JN8A 1RQBA 4G6CA 2SFPA 3IUIA 3VNMA 1HJWA 1PXGA 5DELA 3BDKA 1KXHA 4KMQA 2CW6A 3CT7A 3NYDA 5HAOA 3RMJA 3I3DA 1WDRA 1QOPA 1ZBKA 1WZMA 3DGBA 3SN1A 2Z7KA 4DNHA 2PWDA 1VZWA 3CK5A 1PBGA 3PZMA 3H7VA 3ZT5A 4HPHA 1RK5A 2WWCA 4WIWA 5CC7A 1GQKA 1SQ7A 2XH2A 2A21A 4MWAC 2Z4GA 5AYXA 3NAVA 4F0KA 4QE4A 1DQWA 4N9EA 2Y7GA 4B5SA 4AW7A 1PJ9A 5ABFA 5KEZA 3E5BA 5LNUA 1F3EA 2J7HA 4MJZA 4Q4OA 2P8CA 1R6WA 3N6HA 4X9YA 2YL8A 1LOLA 3UXDA 2JGQA 2WZMA 2QDHA 4IPLA 2PDJA 4XD4A 4LAUA 4GUIA 1Z8AA 3TIMA 1ONWA 4O15A 2VDHA 1EGZA 4DAIA 3EWZA 1FWTA 2PS2A 4MIMA 1DP0A 3G1DA 4H6KA 1UWRA 2DVTA 4RNHA 1DXFA 2YR1A 2BY2A 3ZJKA 1OZQA 4XIAA 9CGTA 4LOCA 3C3UA 3K30A 1ZJAA 3GYEA 3GXMA 3H22A 5KMYA 2NVAA 1ZCCA 3KL5A 7REQA 1V3MA 2WAGA 1PTGA 4Z17A 2Y63A 1KXVA 3FNDA 4AFYA 1U5VA 2CLLA 3STGA 1V7AA 4CQ9A 3KRZA 5ABEA 3GXPA 1O5QA 1HW6A 5CLWA 2HISA 4Z1AA 2WZTA 3F2CA 1TA3B 3VD3A 1TVPA 3N4AA 4JL1A 2J47A 3FX4A 3NA8A 1TRDA 5HXMA 1EHAA 2XH0A 4FR6A 4QJ1A 3W28A 3FKKA 5A2CA 1YPFA 3GVWA 4GK8A 3WNOA 3KBVA 3EX4A 2QCNA 4ALDA 1V0KA 2VO5A 3KBMA 3B4UA 3E1F1 5HANA 2EGZA 3BZGA 1NF7A 3GXNA 2OPJA 1E4MM 1FHUA 3OG3A 3KVMA 3RCYA 1SFTA 4RW5A 4KW2A 2W27A 1NH6A 2GJRA 1JFXA 3E0WA 4GC3A 4PMXA 5IOBA 3VDAA 3ZLHA 3IGUA 5A2AA 8RUCA 1UD5A 4J3WA 3BLIA 5PTDA 2FHBA 2W91A 4AC1X 6REQB 3BAYA 2IKIA 3UJFA 5BWFA 3ZM8A 3L4UA 4KETA 2VQUA 3VCCA 4R53A 4M29A 3NGJA 1IEXA 1HVXA 1V7YA 1UH3A 1VEPA 4K1GA 3RX3A 3W2MA 3ITLA 4G5DA 1V6WA 2V67A 2FB3A 2EHHA 3W6LA 3UERA 5HUPA 2O9TA 4PA8A 3ZXWA 2H8ZA 3CB8A 5TF0A 1FWWA 5HINA 1TWSA 1P6CA 1KFCA 2H90A 3FA3A 3PM6A 3WQDA 3GFXA 1KM3A 4TU1A 3QC0A 4GQQA 2D2JA 2QCHA 4GPNA 1VYPX 3GC4A 1LLZA 2OYLA 4AYGA 2PA6A 2I9UA 3VK5A 5J8LA 3HG2A 1X6NA 2RGLA 2QCGA 1VEOA 4DZ5A 2JBMA 1WZLA 1GKQA 3FGCA 5HJYA 1MXSA 3F4DA 1H09A 2FKPA 1G01A 1BG9A 2B81A 5ECUA 1K7EA 2J7CA 4TUFA 5M2FX 1UWIA 2DUXA 1EEXA 5CPNA 1E6XM 3HPXA 1BGAA 2VEMA 3CV1A 2JF6A 5C70A 1EOKA 2G0WA 4J5NA 1AQHA 5AOUA 2FHFA 4LEQA 2G97A 4QCFA 4WF7A 3PVFA 4AZHA 3Q67A 3QHMA 3H7UA 4MHBA 4HA0A 2YSWA 1UZDA 1OC5A 4PMRA 1MEIA 3THUA 3AYTA 4O0ZA 4Z2LA 2QZRA 1X38A 2X0HA 3G0XA 2BNJA 2BXVA 1XW8A 4H19A 2PDQA 1TPVA 1PZ2A 4FB7A 2JKPA 5AC8A 4JHMA 3RXZA 3DENA 1UUOA 4GZIA 4H8HA 1E9ZB 4JTTA 2GGJA 4J3ZA 2XVNA 1UD3A 1SGJA 5J5RA 4MGGA 2V6AA 3W84A 2WNWA 2J9ZA 1GOMA 4UFLA 2DGAA 2IPWA 2WMKA 4Z2KA 4OBSA 4H9XA 1GT8A 4G9PA 3T8QA 1KO0A 3PZ9A 4DUWA 3PB2A 2ZXQA 3CHFA 4XO6A 3N18A 4JNMA 5K2ZA 3VGGA 1W3KA 4FOJA 2I7GA 5F4XA 5HBFA 2GJPA 3G24A 1I9CB 5F2MA 2W4XA 3OB8A 3W1QA 1HKMA 1EDGA 3PBMA 4LVAA 1ZNNA 1UH4A 3DI0A 6ALDA 1SPQA 1W31A 1GVFA 3R8RA 2DFAA 4WRHA 1CDGA 1PKYA 3NTYA 5CGMA 2QEZA 5JVLA 5FJOA 3UGRA 1H4PA 1XRVA 4CQDA 3XIMA 1RZMA 1HJQA 1W0MA 2WNZA 2DSVA 3W7GA 2H8XA 3L0NA 4UFMA 2DQWA 2ZDSA 1XLDA 1IWAA 1OHLA 4U31A 3GG1A 3RYSA 2D2GA 1G69A 5EMKA 1W9BM 4HIBA 5HMDA 2OU4A 1GYNA 3WFZA 4LUTB 2FMOA 3WH8A 1D7KA 4HN4A 4BHYA 5JH1A 3AISA 4W8LA 4RZ5A 3BK0A 1MQPA 3IRDA 3MW7A 3PTMA 5E6YA 2ZCGA 1EQCA 1POJA 3KHDA 3PZNA 3UWQA 5HWNA 2PTXA 4DO6A 4S3AA 1A5OC 1VPXA 3EA1A 3ZR5A 3N11A 1D3HA 1G94A 1TB3A 3PPCA 1AJZA 2PP0A 4AMCA 3LEPA 1V93A 3MBDA 2QJGA 2PBGA 4AB4A 3IUHA 2OEKA 3EOLA 1R30A 1U1UA 3ARUA 3TVAA 1FFRA 3ITXA 4UTWC 2QCEA 2CLKA 5ABFB 4Q8OA 2HBVA 3A9BA 2E67A 4AD3A 3T0CA 3USZA 2INEA 3M0VA 4WGHA 4M6QA 1NJJA 2PP1A 1CB7B 4DUVA 4LV9A 4CNSA 5T91A 4GNJA 3OGRA 4A29A 1US3A 1POKA 1C8QA 2NXIA 3GU1A 3F4NA 1N55A 1E1CA 1EOMA 4GY7A 3B9EA 3CUZA 3F2BA 4Q8QA 5JBFA 1UMLA 1JDCA 3CHEA 2CFFA 4HK7A 3HN3A 4MMWA 5I3KA 2FH6A 3CMJA 5EU9A 2D2HA 6ENLA 4W8AA 1FH9A 4DQWA 7REQB 2X05A 1T5AA 4LUIA 2E1WA 1RXOB 4UQBA 4WCJA 4YS1A 2CLMA 3OQ8A 5I3HA 3ANUA 4MJMA 1RPXA 2ZRUA 4PODA 1FX6A 1OY0A 4KRTA 5JUVA 1DKWA 3AXMA 1FH8A 3PP7A 3TW6A 2WSQA 3AJ7A 1Q8AA 5TQLA 3A5VA 1UP0A 4UFIA 5TBOA 3QSRA 2XINA 2NQLA 4PTWA 2HS8A 4BWLC 2NV2A 3TWAA 3R2GA 4AU0A 2ZA3A 2DIKA 4ORIA 3W81A 1H63A 3KOFA 4J1OA 1HJUA 3VIPA 4QHRA 5D9MA 1WOBA 3WF3A 1XX1A 5BWAA 1ZAIA 1NF0A 1JFHA 1O66A 1XWYA 2X7WA 1R86A 2QS8A 2JK2A 3V5OA 3UNTA 1XSJA 4JTLA 4AZ6A 4O57A 3M0IA 3PPHA 1IIGA 3AIUA 4UR7A 3TFXA 3GTHA 4F0SA 2G3IA 2HEJA 3UA3A 3AALA 4Q7NA 1HKVA 2XH7A 4Z1DA 3RDKA 1NY1A 4PTNA 4HMCA 2YLAA 4GD0A 4BR1A 2GDVA 3DFHA 5BRBA 1BHGA 3LPPA 3I7SA 1KRCC 2CCRA 3UY7A 2Y7DA 3A4JA 5G1YA 1TVLA 3KRUA 3NM3A 2WQDA 3NQ6A 3IJDA 1SZFA 3DESA 5MHBA 3EWDA 3GR7A 1UP2A 1HKJA 4YVVA 4CCDA 4POCA 1KBLA 3AIRA 1V08A 3WLSA 1D9EA 1Z9AA 2VFFA 3LHWA 1QI0A 5LXXA 1ZGDA 1QPKA 3UXKA 4LC8A 1JZ8A 1IV8A 3W24A 3UZ5A 5E9AA 2GSEA 4HNVA 4FPSA 2EXOA 3TC6A 2Z29A 5U7SA 2QW5A 4Y6GA 5HPCA 5C8BB 3FGCB 2X2YA 3WKZA 3W1AA 1R46A 2V3EA 3KS5A 2GGEA 5DT7A 3G1XA 3EEGA 1GG1A 3P74A 3VZZA 4IM4A 3VOHA 2XFRA 3Q58A 1EQPA 4EWND 2TRSA 1H49A 1KRBC 3GAKA 3NDOA 1E1EA 1LJYA 4FP1A 1EO7A 2ZRVA 1QDSA 1KFBA 3PULA 3LV6A 3HPAA 4GOAA 2Y5SA 3CLMA 4PBEA 4W89A 4L4PA 4F8XA 1UMYA 1SZNA 3I6RA 8XIMA 3FJLA 5I79A 4O4VA 1HJXA 1WE5A 1LQ0A 3GWQA 4MZ8A 4DO4A 4PN2A 1U22A 3N14A 3OBAA 2UZ9A 1I45A 1SW7A 2V3GA 2D0FA 1NVMA 3PZIA 5FI8A 3M64A 2ACUA 3UPWA 3GO2A 4XZ9A 5EGRA 2Z1XA 4OUIA 3CMFA 1BQCA 2OZTA 2YYUA 3CZGA 3RLUA 1V6UA 2OTDA 3SCWA 1X7IA 3LM3A 2PRMA 4HHPA 1VJZA 1XF0A 4K8GA 3L4VA 1X1NA 2R24A 3SDOA 1W1VA 1EX1A 1W17A 4FX6M 3E74A 3MSDA 5DN1A 1J01A 1XGDA 3DHPA 3ZR4A 1TCMA 3A3XA 1FFQA 1LLOA 1C91A 5KZ6A 2NQJA 4QJ4B 3AMDA 4PTMA 1V3HA 3NZGA 4K8HA 1UR2A 1LRNA 3Q4DA 1X8CA 3B4YA 4Y8EA 3EX1A 2E6DA 1I6NA 2DSUA 5B7ZA 3IPWA 4D6FA 2A85A 3N2BA 2CHOA 4GIAA 5A69A 1RY8A 1FWCC 2NT1A 4IMDA 4OBTA 3C5QA 1BRLB 1SJAA 1O1HA 4IXXA 4AD5A 3SFWA 3WQOA 4LUSA 3GIPA 1WKFA 3W1XA 3WD1A 1QI3A 4L9YA 1DPMA 1BD0A 1RV8A 1PEZA 1EZWA 4IQEA 1LCOA 3BLEA 4DF0A 2DT0A 3RM8A 2ZX8A 2X1SA 3ARTA 5FEZA 3MJYA 2WMHA 3LNMA 3B8IA 4UTTA 1TQXA 1KCXA 4FALA 3KP0A 3TCSA 3SR7A 3MTWA 1OABA 3RUBL 5I02A 3PNUA 1I2QA 3HZ3A 1T99A 4JPGA 3SW6A 1FQ0A 5CSUA 3C6CA 1F73A 3GRIA 1D7FA 3G1YA 3G1VA 1K70A 3TSMA 5CQ1A 3WJYA 1XQKA 3GXTA 4H41A 3CQKA 1B5TA 2X40A 2REQB 3GR8A 2XJ7A 3AUJA 3BAJA 1X97A 1TZ9A 2DVXA 2YA1A 4N9CA 3QYQA 3ZWTA 3IIZA 3DGRA 3CPRA 4F40A 2CBIA 3S5YA 4MSSA 2PWEA 1W5OA 1SMAA 1C8XA 3K4AA 4EXQA 4HK6A 4HA3A 1F2JA 3SCNA 2PD9A 3V75A 3PUGA 1J2WA 2E5BA 3QHNA 2Z26A 4OU1A 1E1CB 2GGHA 1PTAA 3ECQA 5TNVA 1VR6A 3GHRA 3PZQA 1RD5A 4NG3A 2QJMA 1BTCA 5CKSA 1HP4A 3WBXA 2GVEA 1A53A 1UUQA 4DBDA 4Y9AA 3N73A 2X1UA 4LF2A 2YDAA 4S3CA 3E0FA 2O4QA 1Q63A 4JIPA 1FOBA 1DIDA 1I2PA 1QHOA 2PDCA 5DO8A 4YN5A 1J0HA 4KEZA 4S39A 2DQXA 3B0YA 4IT1A 2VWTA 4H2CA 2W92A 2WCAA 3WBYA 5LNSA 4HHLA 2EPHA 4GFIA 1JPDX 2OVLA 3AU6A 2FB2A 3W7OA 1AODA 1OFAA 3BG9A 3VFLA 3XINA 4I7UA 1EZ2A 5BZAA 3GQYA 3AOFA 4LCQA 4H83A 1H0GA 1CBGA 4JTHA 3NPVA 3SZ8A 4GMEA 1GZ1A 1SW3A 4M80A 1R3SA 4OIFA 2FFCA 1KFEA 4WKHA 3DKLA 3VUPA 3E3HA 5LA2A 1P1MA 4LALA 1E40A 3PUEA 1QI5A 4US5A 1VCFA 4JHZA 4NI8A 3O15A 3ZO9A 4ZTYA 3LHTA 4QQ3A 3OLIA 2I5QA 4KERA 1S3TC 3LDVA 1WBJA 3KZSA 3WDPP 3M16A 4L56A 4AH7A 3UFYA 2E28A 4REQA 2Y88A 5GVJA 2XVLA 3BLDA 4UQDA 4IF2A 5GJMA 1EA0A 4NNCA 1AQFA 4LH8A 1E73M 4Q4MA 4O8AA 1KRMA 4LS2A 3NR0A 3UPBA 2WNQA 2WHMA 1PS9A 3V35A 3VD7A 4MJ2A 4U5IA 4JIEA 3PBYA 3LQGA 3P8IA 2EPNA 4O10A 3WF4A 3EGJA 5AKQA 3QN3A 3CWHA 2DSZA 3W22A 1GVOA 3W00A 1UD8A 1TPDA 1VENA 4CNPA 1O7AA 3VCNA 3KDNA 4E4UA 2PUZA 2FQIA 4HPXA 5IDZA 3OHIA 1W9VA 3FHQA 3M0KA 3A47A 5K9CA 2E9BA 5KZDA 4YTUA 3W74A 2WQPA 1TREA 2VFGA 2J27A 3DZ1A 4UQCA 1Z32X 2WMIA 1E0TA 4ZODA 3LPFA 4D6JA 3HQNA 4QEHA 4XSMA 3THQA 3W38A 2HVOA 1B1YA 3E0LA 3MUXA 4UOQA 3FEQA 2CBUA 4XBKA 5GJNA 1NFGA 1D8CA 3BOFA 2DJLA 2JALA 4XG1A 2Z25A 3WMBA 5AVNA 3EB4A 2P10A 3AXIA 3WQ6A 1TQJA 3LV5A 4B91A 3U7VA 2PWFA 4ICNA 3ZR6A 4GYPA 5CZKA 3EZ4A 5GJPA 1WDDA 3C4UA 4OHQA 1EP3A 1W5PA 1EJTC 2OQYA 3LBOA 1FXPA 3WD4A 3T2OA 1UBPC 3W2UA 1OFDA 1EJUC 3I68A 2OSXA 3N25A 2X7VA 3WK1A 3ICJA 1VPYA 2ZFAA 3BTNA 3TSBA 4PSPA 3IIPA 3VIGA 4O0KA 4EF9A 1XLLA 2WSPA 3C0SA 2VGBA 5CZSA 2C0AA 4C6JA 5EMJA 5LHEA 4JOMA 3CTTA 1TJ1A 1Z42A 2ZC8A 1XCXA 3PWAA 1XH1A 1HXJA 5D8ZA 3AJXA 3SGZA 2OQLA 4ZO8A 1NWUA 2OT0A 4JDBA 3DBPA 2C16A 7TAAA 4LYRA 2WMJA 1L6WA 4TO8A 2OGYA 1XLCA 1W1TA 5C5YA 3V3WA 1CECA 2ZVIA 3AC0A 2HPMA 1JCLA 2W63A 1ONRA 4IIEA 2PGWA 3FAXA 3N2CA 2EF9A 2YCJA 1RUSA 3EDDA 3SQSA 2GQAA 1H7PA 1US0A 1AW5A 1H7OA 1O4UA 3TAOA 1HF6A 2C15A 1Y5WA 1PO9A 3BLFA 2F6XA 3EWUA 3B0VC 3BURA 3ABRA 4ERIA 4PCPA 3N6JA 3S1VA 4S3EA 3LGDA 4HPJA 1QCWA 1XI3A 4LANA 1FWFC 3KBJA 1A0EA 4FF7A 3E96A 1CNVA 3PG8A 5EBAA 5FOOA 3W7JA 1H51A 3NNTA 1IZJA 3E12A 5D30A 4XKMA 1DYSA 1N7KA 3FA5A 4UTFA 4LPCA 1WBHA 4UCGA 1CLVA 4QX4A 4LUSB 1WOAA 1R9ZA 2PDIA 1KM0A 2C13A 3AS3A 3G2GA 1PL9A 3VGEA 2CYGA 4MWAD 1JGIA 3ISIX 2VGGA 1G9HA 1SR0A 1EJWC 2WWDA 4L65A 3GUGA 5CPTA 4QS6A 2CESA 1KGWA 4MLRA 2ZBTA 4O1FA 4XZNX 4J3XA 1H0IA 2CZ5A 2Z00A 5HQEA 3R6IA 2ALRA 3AIVA 1CGUA 1J6PA 4ATWA 4PTVA 2QAFA 3NZ1A 3W02A 1TWZA 4PUMA 1VQTA 5A95A 3OEXA 3ELFA 3RAOA 4GI9A 3EWWA 2HK1A 1GW1A 2ZE0A 3VVGA 4WJ8A 3VGBA 1IEIA 3CQHA 5CCZA 1H11A 3NO5A 1MWOA 3U9IA 1M7PA 2FDSA 2NLIA 4WK9A 4BCEA 1XIEA 4GI4A 1ZQ5A 4YMZA 3L65A 1ZPTA 2WXDM 4H9ZA 2CU0A 2HVMA 4D1JA 5M5DA 4K39A 1J6OA 4UQ9A 2FZDA 3DH7A 1FWNA 2GVGA 3F5KA 5HUOA 2HMCA 2E8ZA 1HKIA 3BW3A 2JEQA 4GCXA 3F4WA 4DJEA 3NL2A 2QCCA 1XR2A 3LY0A 2J78A 4O28A 1A0CA 2WVVA 4IPIA 1L0PA 3WBAA 4HMNA 4B3ZA 2X41A 3W7KA 4A8RA 3OW1A 1RCQA 3FS2A 3MUY1 4KCWA 4LAKA 2DH3A 3QGKC 4GA8A 1CXKA 1XHGA 4TR9A 3FCPA 4LGXA 3WUFA 1W3JA 3WNLA 4WD0A 5C0QA 3GTIA 4PUJA 1XYBA 1GOXA 1E4NA 2P0IA 5HPOA 2O9OA 3NVDA 5CLTA 2WK2A 3BVJA 3WDJA 5JU6A 1O5RA 3TE9A 3RLHA 3DG6A 1XYCA 1TMHA 2FJUB 1NQKA 3IVUA 4FNQA 4GQ0A 1AD1A 3DC0A 3H12A 3ARPA 2F38A 1XLMA 3MO7A 1DWGM 3URQA 4A3QA 2E6FA 4YCPA 4QQUA 1XLAA 4QDPA 1FWBC 4GXPA 1I2OA 1YBQB 3QY7A 2OLAA 5CBJA 3BAXA 1C7TA 3TTEA 4IOTA 3LCIA 5C7HA 4MM1A 4MNKA 4CLMA 1W1B1 1DVJA 3QVQA 4WSKA 3MI6A 3RJXA 1KC7A 5AZ0A 3ABZA 3TYUA 3KOWA 3WH5A 4REQB 5HR6A 3B04A 1VKFA 3U0HA 4ASTA 3T78A 1XLEA 1XRSA 4FXFA 5G4HC 2X1RA 4YPJA 2VTFA 4HN8A 4AY7A 3H55A 1WNOA 4M6PA 1TE1A 1H1ZA 2GWGA 1RALA 1TJ0A 2Z6JA 2B31A 3N12A 4NVTA 4YYFA 1Y8BA 3EWXA 4E3VA 3ITCA 1ITCA 3LPGA 3IACA 3W01A 4WJXA 1J93A 2EJAA 2G41A 4IMFA 3ITVA 5DY2A 3WG6A 1OCQA 3RLGA 1ZLPA 4M19A 2ZZ6A 1IEVA 1VFLA 2NQZA 1PPIA 2PCEA 4LU0A 5BOOA 3CIWA 4C6MA 2WMIB 4J3UA 1KKRA 4AZ5A 1SJBA 3W9ZA 3WEOA 4KRUA 4NRRA 4JFVA 2VVNA 5H91A 2QF7A 3CZ8A 1OYCA 3KCLA 4PUNA 4ZXOA 1QK2A 1AK5A 1YMYA 5T9CE 5LIXX 1DJWA 1GPFA 2YCLA 1TPC1 3G77A 2AL1A 4JYDA 4KH2A 2VC9A 3L5AA 3HGRA 4L9ZA 1PZ3A 1TPEA 3EA2A 3U5YA 1A4MA 2J13A 4GKLA 4U3AA 1ZSXA 4KKXA 5DXYA 4FOKA 3UR7A 3LI0A 3CO8A 5M3WA 1K9TA 5FSDC 2XIIA 4Q32A 2OMAA 4J3SA 3VNIA 3QY6A 2XISA 3HG3A 3PSWA 4F2UA 1J4EA 3GBEA 3LCLA 4TX8A 1FHDA 3L2MA 5AYZA 3REQA 1EYWA 2R94A 3N9SA 3HMCA 3LCXA 3WMSA 4GUGA 2XSXA 5FIPA 4H7ZA 5A6JA 3BMXA 1R3YA 3NPXA 3FFSA 3IK4A 2XPKA 2YXOA 3LLXA 2FLIA 1XYMA 1L9WA 1R0MA 1OD0A 4WZHA 2ZUSA 4IX2A 2ACSA 1AG1O 3SRDA 5D33A 3FAWA 3W4RA 3IK2A 2RH9A 2XIOA 2W62A 2XWDA 1BYCA 2QJNA 4KEUA 1LOQA 1C7SA 4DPQA 1S5WA 1VJIA 1KLZA 2VC7A 4RR4A 1E15A 1PVNA 1OJXA 4XZHA 2YA0A 4ENLA 5AYYA 3GDBA 1UZ4A 1RH9A 2QCMA 4C6LA 3SJNA 4JTFA 2OOFA 2UV8G 3EMZA 2BG5A 4EAYA 1ADSA 2B7NA 2QJHA 5C9ZA 1ALDA 3WJZA 3HQPA 1R3WA 1UWTA 5DCDA 1WAWA 4FLRA 5GPRA 3MKKA 1UKSA 3VNYA 1GEQA 2ZZ2A 3GC2A 3M07A 3F4VA 2A3HA 3EX3A 2QUVA 1HKWA 3JR2A 4JX5A 3JW7A 2CKSA 5F1VA 2ISWA 3OVQA 1H1NA 2HSAA 2PP3A 3EPMA 1NDVA 3Q2DA 4U5KA 4C7DA 4EF8A 3SRHA 2DT1A 3W73A 1C9DA 1G7VA 3NPWA 2DPEA 3PZGA 3FKRA 2FFIA 5HJXA 1KTCA 3QPEA 3SUWA 2ZWYA 4M8UA 3DKJA 4QM1A 3WLRA 4NZCA 4DAFA 2QCDB 3TW9A 4HYRA 4D8ZA 3S47A 5FF7A 1KKOA 3N4EA 5AY7A 3UR2A 3VOIA 3S42A 2GOKA 2C8NA 2Z7GA 3AIQA 1QOXA 1JJKA 4EIVA 1WDQA 5F2IA 2VI0A 3TNOA 2V2CA 3MKCA 1UA3A 1BXCA 2G3NA 3MHUA 4M6VA 5D2VA 3HF3A 1V51A 4XWUA 4Z2IA 2Z27A 3PK7A 3VUSA 1ITQA 5CAHA 4QSHA 3ID7A 4OKDA 1QNPA 4DWSC 2NX1A 2WVUA 2QR6A 4R88A 5AZ1A 3PG9A 2FPTA 3T4CA 1SMDA 5AHNA 3OLDA 1F5ZA 1ICPA 4DXKA 1DXEA 1H5VA 5LNWA 4XVDA 2CXEA 3C2EA 1K9DA 1DHKA 1E0VA 3H2EA 1U30A 4CD6A 3B05A 5AN7A 3R94A 3VKBA 5LNRA 4LX4A 4JY9A 3C86A 4PL2A 1WDPA 3UZJA 3W75A 4MUPA 3AHYA 3C8FA 1TJPA 1OX6A 3CUJA 5EBUA 2VRJA 3QYSA 4L1GA 3NM1A 1PE1A 3UW6A 4IGMA 1P0BA 4LT9A 3V4BA 4O8RA 1TWWA 1KTBA 1ELSA 4RW3A 3GVVA 4R3UA 1B4EA 2GK1A 5HR7A 2D22A 2DUAA 2Y6ZA 2XIQA 1XICA 2YPIA 3W7RA 5D2WA 1H50A 4I5XA 4FR1A 3K4WA 4BF9A 2QULA 4HNNA 2YCEA 4JQ2A 1EO5A 2NQHA 4L1WA 1EJVC 4EXBA 4L5ZA 3L4TA 5B80A 4AX6A 3QM3A 5EMLA 2QDDA 2I16A 1FWHC 3GZ3A 5CG0A 2LLEA 1KWKA 1QNQA 1YTDA 3E38A 4M51A 4D9PA 1K6AA 1SSDA 4YCOA 4TOQA 1WP6A 2DW7A 2QPXA 2G4FA 2A1YA 1QPNA 5I7GA 1A47A 1WV2A 4PBGA 1XLGA 2EPOA 5LIKX 3RN6A 4YLWA 5H8UA 2P8BA 4JR5A 5CBBA 4XUGA 1PCWA 1GVIA 4O11A 3PBUA 4S1FA 2WYSA 1XJBA 3OGSA 2X0SA 4HCDA 2VELA 4ZMGA 1M03A 3RM4A 4QAWA 3VIMA 2HV5A 4PMQA 3VD5A 3WLLA 1TSIA 1M7JA 4E38A 3CL6A 3O1NA 3W1RA 2HCVA 1DIOA 5EKYA 3MO4A 1KNWA 1QNRA 2DZXA 1W9XA 2FVMA 3QOMA 4IFRA 2VZTA 2OEMA 1UD6A 4IP5A 1LL6A 4F9JA 3ARQA 4DN1A 2BWGA 3W2KA 2IXVA 4PE8A 3OP2A 3NEHA 3HGSA 2ZVRA 4UNLA 2FZNA 1JD9A 1Q5MA 4DZAA 3BPWA 3DYMA 1L2QA 5D38A 4QBXA 2VT0A 4QFUA 3DECA 3CJPA 3K5XA 1EXBA 1GCYA 1K4GA 4HK5A 3P81A 4RE3A 1W3LA 4PMUA 3S8HA 1Z44A 2VEGA 3NOYA 1CI1A 4UR8A 3RK8A 2DZSA 2YCLB 2F61A 4H6QA 2GYIA 2W9MA 3RU8X 3BV4A 3S2MA 4CNUA 3GNOA 2J7GA 3GB6A 1DJGA 1P1XA 3AIEA 4Z2GA 2ZRZA 3SECA 3S83A 4NZ1A 4M5PA 2PDBA 3C0JA 1JAEA 4MDPA 2ZUTA 5CJMA 3A4XA 3CIVA 2X8RA 5HQMA 4U4MA 5XIAA 2PDNA 3OPSA 3UZWA 1F8IA 2PDWA 3QRHA 4IH3A 2GLKA 3IV3A 1TFVA 2QMJA 3REQB 4UFHA 2BHUA 1Z41A 3WJXA 2VGIA 4ZQNA 1IHIA 1JYWA 5K3VA 4GBUA 2P53A 3OGVA 5E93A 1TR9A 1B9BA 3AIWA 4KEMA 4E2DA 2PEVA 4AEOA 2ZTKA 4TTUA 2Y61A 2E7FA 3CWOX 4H00A 4JEQA 4JTCA 1E9IA 3NSNA 1TTQA 3J7HA 2A6NA 4XTIA 2FHCA 4X2PA 4HT3A 2QJIA 4PR4A 3FJ6A 4DO5A 2C0HA 4NX0A 3P2VA 3T0TA 1KB3A 3L2LA 4GO9A 2QGYA 1CT5A 7ODCA 3SCUA 1GHRA 3KOXA 1WAUA 3MUIA 3EXSA 1EPVA 2VDIA 2HXTA 3MI2A 3DFNA 4IX0A 3UXAA 3NQEA 3T0DA 2Q8LA 2FMNA 4ZOCA 3WO8A 3ITOA 3PNZA 5BU9A 4YIWA 4M81A 5D8WA 4UMCA 4WQ6A 3QF0A 1R5YA 1HJSA 4C6KA 5C55A 5AC5A 4DM1A 3CUGA 3JVAA 3TLQA 4CD5A 3E2RA 1KM4A 4Q3MA 3MVTA 2V2HA 3MHGA 3COTA 1G4PA 1R8LA 3IANA 2YBUA 3L9CA 4AWUA 4L6HA 2HS6A 3PC0A 1V02E 2BY1A 1HKKA 3URNA 5EMMA 1YXDA 4ATDA 4PULA 3APGA 1X6UA 4XZMX 4ZR8A 4HSNA 3MCNA 1LWHA 4LV4A 2HJPA 3UWWA 3WL0A 1EP2A 1ZHAA 3LD5A 4PMZA 5FF3A 3BV7A 1YPXA 3W82A 4FS9A 1VFFA 3ZT7A 1E0XA 1XDJA 1DJNA 2ZXDA 1TTJA 1A50A 4DHGA 5DANA 1WYIA 3TFCA 1EB3A 1P0KA 1GQIA 5EMYA 2QPSA 1W1ZA 2UY2A 4CD8A 3WF0A 3CYVA 4O17A 5EMUA 2BB0A 3SGUA 2GDUA 2BZNA 1RA0A