3QSTA

Crystal structure of trichomonas vaginalis triosephosphate isomerase tvag_096350 gene (val-45 variant)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
251
structure length
251
Chain Sequence
RTFFVGGNWKANPKTVQEAEKLVEMLNGAKVEGNVEVVVAAPFVFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEAGFINIVNSNVHSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase, putative
publication title Crystal structure of Trichomonas vaginalis triosephosphate isomerase TVAG_096350 gene
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 86
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qstA00
3G0UA 1QPRA 3EX6A 4K6AA 3S8HA 3H55A 3DKJA 5LNVA 3W73A 2ZZ3A 5KITA 1G4EA 3HGRA 3EXTA 1FWRA 3G0SA 4NJHA 3DI0A 3GDTA 1F05A 3OVRA 1GVRA 1QAPA 2X1TA 1QDSA 3U6WA 1QCWA 3TIMA 2FLIA 4AHOA 4HPJA 5KZMA 4ZQMA 4IJBA 2QCCA 3CIWA 3TV8A 3S1VA 2TSYA 3PG8A 1ZAIA 2AAMA 3TQKA 3LCGA 3GNDA 5F1UA 5FESA 3TFCA 1G7VA 1YPIA 1SO5A 3G24A 1HO4A 1GVOA 1GWJA 2ISWA 4DXVA 3NQGA 1XI3A 4RZ5A 1DJNA 2I1OA 4EF8A 3FKKA 1L6YA 4M7TA 1H62A 3W1MA 2EKCA 3PUDA 3W86A 3IRDA 1EP2A 4JY8A 3W1AA 1VRDA 5DCEA 3I68A 3RLVA 5IM51 3D0CA 2B4GA 3A21A 2ISSA 3O06A 2WSQA 3CWNA 4B5NA 2V82A 3W7IA 3WK3A 1CI1A 4FNRA 2X1SA 4OHQA 4HPXA 3WK2A 5HR7A 4YXGA 1A53A 5AHNA 3NEVA 4RLIA 4MLJA 1E51A 4DBEA 1DORA 3PUOA 4GXMA 1YDOA 4LC6A 3KVMA 3STEA 4ALDA 1PV8A 3W7PA 1O60A 2H8XA 3L5AA 1W3TA 3NNTA 3JR2A 1FBAA 4HNUA 5LNSA 2QUUA 5DCBA 1A5AA 3TSDA 3WJYA 4JYDA 3HF3A 4QSHA 5I3KA 4ZQNA 5HULA 5AC6A 4KFNA 2A21A 1SU5A 3IVSA 4UCGA 4O52A 5DN1A 1M7OA 3R5EA 2CWNA 3MYPA 1VLWA 4OGZA 3HGJA 4CNOA 1IGSA 4O16A 4KWWA 4O18A 1YXCA 1TV8A 1KM3A 4XUGA 1EP1A 1G6CA 5HNRA 1KFBA 3SIZA 5CZ0A 3TA6A 1LYXA 2I9EA 3DH7A 4A3UA 3M16A 1L6WA 4KWVA 4UIOA 4LUJA 3P5YA 4MOZA 3BVJA 3FIGA 3L66A 1A5BA 2TPSA 3AJXA 5I3HA 3U2OA 4PL1A 3R8RA 3FYPA 1FCVA 4Y9AA 3GR8A 3NQ2A 4BK9A 2Y89A 1GVFA 1WOBA 3C52A 3HGOA 2QCGA 1GYNA 4XWUA 1T99A 4HNVA 3PBWA 3MYOA 1NVMA 3BG5A 1YTEA 1TO3A 1T96A 3IIZA 4IX2A 2YPIA 5C5YA 3E9AA 1S3HA 3S5YA 3W87A 3RMJA 3HJZA 4NNAA 3B05A 2OT1A 3G1YA 1H1ZA 1EX5A 3LERA 5C2XA 1VPXA 2NUXA 4P61A 3OG3A 4UFMA 2NUYA 1W3NA 1KM4A 3P81A 4BR1A 4UTUA 4O0KA 3RF9A 2JKPA 2Y85A 5CPMA 5F4XA 4NX0A 4OT7A 4UTLA 3M5XA 3QJAA 1KFKA 1Z41A 3L67A 5KMYA 3TR2A 3MW7A 3P82A 1JJKA 2J24A 4A29A 4IMGA 1O95A 3NQEA 1GYLA 3I7RA 4QM1A 3O6YX 2OMAA 3LI0A 4UTMA 1W5QA 2J9ZA 3EXRA 4A21A 1Q3NA 4JDYA 1K03A 4N02A 3TSMA 1LOSA 1RZMA 3LCFA 3NQAA 4JY9A 1TCDA 8TIMA 3LCIA 4Y90A 1UCWA 2NX1A 1JRCA 3IGSA 1HL2A 1N8FA 3M44A 3PAJA 4HN4A 2QCEA 1BEUA 1GTHA 1WV2A 3O16A 4PCFA 3BW4A 1LRNA 4IMEA 4MZ1A 2YZRA 1VS1A 3GK0A 3P62A 5DY3A 3INPA 1JULA 1SW0A 2E6YA 3NZRA 3C2RA 2QCHA 2Y61A 3PM6A 3H54A 3IIOA 4JD4A 4OBTA 1QO2A 4E0CA 2Y88A 2BXVA 4JX6A 4LVBA 3IVUA 4O8RA 4M7SA 5AN7A 2FJKA 1PIIA 4JTJA 4OV4A 2ZRVA 3GDKA 3G1HA 3FOKA 1ME7A 5L6UA 2PCQA 3B8DA 1DBTA 3QEZA 3A23A 2Q3RA 3W2LA 1H51A 4JTHA 5AHEA 3DFQA 1OYBA 2GPTA 2NX3A 1I2RA 1EUNA 3FYOA 4DELA 3O8AA 1L6SA 2C18A 5F4SA 1H7RA 1H7PA 1G4PA 3IIVA 1QOQA 3C8FA 5AOUA 4QQ3A 2ZDRA 2Y7EA 5HUOA 1B9BA 1Z48A 2C19A 3B06A 5DY2A 2C15A 3SR7A 2G95A 4XQ6A 2PRLA 3OBKA 3NQ8A 4Z1AA 4ZMGA 3O07A 4RXGA 4XTIA 4HNTA 2VEKA 2QCDB 3W2NA 2ZA2A 1DV7A 1DJQA 5I3FA 2WO5A 1G69A 4FXSA 4WOQA 4MY1A 3LCXA 5LNRA 3KRZA 4LY8A 1IXQA 5TQLA 3IIXA 3O15A 3OHIA 4FHAA 2DZUA 3IV3A 4A22A 2ZZ5A 3SGUA 1ZNNA 1V5XA 4YL2A 1OX4A 1GVSA 3TKFA 1RQHA 1RQBA 4IMFA 4LVAA 5FEPA 3RFAA 3UWQA 2CLIA 3GYEA 3P61A 3SW6A 4JYFA 1GPWA 3A9IA 2GVGA 4QIUA 3W7RA 5H2ZA 1OK4A 4NZJA 5AC8A 3N2XA 3CQ0A 1YPFA 5SWUA 3ZFHA 2WSYA 1TREA 2ZTKA 3STCA 4ONVA 3C6CA 4YMZA 3N3MA 2JGYA 4WX2A 5FF0A 2VFHA 1TPVA 1TIMA 3OVPA 3WJXA 3F1QA 1RR2A 4XZ9A 3QZEA 1QR7A 2ISVA 2WNNA 3WK1A 1ZJIA 3S1UA 4GUIA 4JTIA 3ZWSA 1JCJA 2JKEA 3NL6A 3UXAA 1M5WA 4OWGA 4FNQA 2JKAA 3M1ZA 4JGDA 1N7KA 3TJXA 3W83A 2A1YA 2C1HA 3PBUA 4DBDA 4WOZA 5EMUA 4AMAA 4AXKA 1WYIA 4UTTC 4UFKA 5E0KA 1I8JA 4WQ6A 2VFEA 2NXGA 2F7FA 1TTPA 3WJWA 1SW3A 3P5ZA 5GVJA 1WBHA 4WY0F 4O1BA 3E12A 5EA9A 3RK8A 5FI8A 4O19A 3HBLA 4H4IA 2GUUA 2X16A 5DXYA 2WPBA 1C29A 3W7GA 1F74A 1UUOA 1GTEA 1Z44A 2W0UA 3WFAA 3L0GA 2XFWA 4NJKA 1BWKA 4CLMA 1ONRA 1TQJA 1Y0EA 3KRSA 1DKWA 2YYTA 1IIGA 3N9SA 3UWUA 5BNKA 4PFMA 4O50A 1W31A 4G1KA 1OFDA 2ZFAA 1JVNA 3EWWA 1WXJA 1R2TA 3CEPA 1LBMA 3KRUA 1OJXA 3NA8A 4N9CA 4IXXA 4QISA 2CLKA 3PBYA 3LRKA 5H91A 2ZA1A 4O28A 3MMTA 1ZAJA 3GB6A 1RV8A 3TUUA 1GG1A 2ZCGA 2NXIA 2E6DA 1MEHA 4MIMA 1RD5A 3L68A 4GBUA 1W3IA 2JGQA 1Z42A 3THQA 1SZFA 1W0MA 3LM7A 4N9BA 2BWGA 2EGZA 4U28A 4HSOA 3HO8A 2NZLA 3PSWA 4NJIA 5FEZA 1BTMA 3LV6A 2W6RA 3Q58A 1KTNA 2HS8A 1TV7A 3SY5A 1AG1O 1K7XA 2YYUA 4NVTA 5J5DA 3LHVA 1KFLA 4Q32A 4MYAA 3W1PA 4O53A 4UXDA 4X22A 4TMCA 1GG0A 3CU2A 4GNJA 5AHLA 1FWNA 3BV4A 4Z0SA 1JRBA 2DP3A 1ML1A 2V30A 3ANYA 3TW7A 4PA8A 3M47A 1KV5A 3QH2A 4ORIA 5FF2A 3MJYA 3Q94A 3R13A 4XKYA 3DFPA 4JDBA 3VKJA 3OIXA 3UPWA 2DZPA 1X1OA 2H8ZA 5D32A 2EHHA 2RDWA 1YDNA 3F4NA 3OVQA 1F5ZA 3GAYA 4FX8A 3DHDA 4FIRA 4XBKA 4RR4A 3PB0A 4WD0A 2HTMA 1YTKA 3NQFA 1J5TA 4CCCA 5CPLA 1C8VA 2FDSA 3KXQA 3UZJA 4N9DA 1H63A 4BWLA 1VQTA 1ADOA 5D38A 3W22A 2QCLA 3WK0A 4IMCA 2D73A 1JUBA 2YXGA 1IXNA 3BW2A 3K30A 3KVKA 4ORMA 4WZHA 3EWZA 4IGHA 3TH6A 1LBFA 3PWAA 2QUTA 1FY6A 4TIMA 1VCGA 4OU1A 5DCDA 5EPDA 1AW1A 1VGAA 4PC8A 5IBXA 1EIXA 1VHNA 3ABRA 1XUZA 4KKXA 1ALDA 2X1UA 1Q6QA 4O14A 3BLIA 3UZ5A 1LZOA 5D04C 1GVQA 2FPVA 4R7JA 1LM1A 4K8HA 4UMAA 5BMXA 1GOXA 2A4AA 1BKSA 1N55A 3BLFA 3DENA 3MBDA 3H53A 2V2CA 2Z6IA 4N4PA 4HT3A 2XN2A 3W1QA 2XN1A 2EF9A 2H3DA 4IUOA 2DZVA 3TU9A 2YDAA 3NL5A 2CU0A 1UASA 1R30A 3SECA 4M6VA 4RJEA 4DQWA 5EKYA 4Z1DA 1I2OA 2EPHA 4L4MA 3T40A 3W2KA 1FDYA 3LHUA 3W88A 1GZGA 4JTSA 5K2ZA 3DGRA 4R34A 4O0ZA 1HFBA 1JR1A 1O4UA 2EAWA 4HSNA 4Y6GA 4AWTA 4UNKA 1BWLA 2B7QA 2C0AA 2ZA3A 3QW4B 1DHPA 4GUJA 3LLFA 3W1UA 4O54A 2E68A 1C9DA 4TX9A 2Q3OA 2WV8A 3TXZA 1O5KA 3TQ0A 1W8SA 4LVFA 1TTQA 3KAOA 4K8EA 5A8GA 1M7PA 2GVLA 5E1QA 2A6LA 3W7EA 3R2GA 2BSLA 4AAJA 3QQ0A 3IGUA 2BTMA 1G4TA 3UQNA 2NV1A 2XN0A 3N34A 1KM0A 4DPQA 2DZTA 3TFXA 1OFPA 3TK7A 3GVGA 1I2QA 1LOQA 2V8ZA 4D2JA 1V7YA 5HJLA 5TBOA 3RLUA 1R2RA 1U83A 4H3DA 4UNLA 4UR7A 3S1WA 3UXDA 2VELA 1LROA 1TQXA 3O63A 2QR6A 2DZSA 1OYAA 2E5CA 4LRSA 3ZWTA 1HUVA 2R94A 3HG2A 2FQIA 3JS3A 2G96A 4LU0A 3PY2A 3L5LA 1TPEA 3DAQA 3NG3A 2ZZ1A 1W56A 3DHFA 1W37A 3LGEA 3TAKA 4M5PA 3T7VA 4MY8A 4MYXA 3DKLA 1OHLA 2Z1BA 1KM6A 2VKZG 4AH7A 4LVDA 1K8XA 5LHFA 4LW7A 5F2LA 2VEMA 5DELA 4R53A 5EYWA 1OK6A 3UY8A 4AF0B 3M0ZA 1S5WA 2E6FA 4QNWA 3CT7A 2FB2A 3B03A 3NXFA 2ZRXA 3BG3A 5KZDA 5LZLA 3W85A 5FF7A 1OX6A 3IEBA 1OFEA 3LXCA 3NQ6A 3P80A 4EF9A 1GT8A 4ZQPA 3TSBA 1JUEA 5KZEA 1ZENA 4UTKA 2V0TA 1TTIA 1KTBA 2RKXA 4JICA 1VHCA 2E6AA 1RQEA 1P0NA 3B0VC 1Q45A 1O5XA 3S6DA 4DO5A 4TMBA 4FEZA 1QPQA 5FF4A 4JTEA 5CGQA 1LRQA 3CLMA 4ZQOA 1XXXA 2E1DA 4P2VA 2PRMA 2H90A 1K3UA 1NFBA 3G1VA 3A5FA 3CPRA 3SSJA 3SZ8A 4UTJA 4FNTA 3FFSA 4KFOA 2Q8ZA 5D2VA 5MHBA 4TU1A 3QMSA 5BOOA 5AYYA 2NXHA 5D05A 4RXFA 1TPB1 3QFEA 1NF0A 3LRLA 2WNQA 1UB3A 3CTLA 4OQVA 4JIQA 3TXVA 3UPBA 2CLOA 4QNEA 1YLVA 2A85A 1ICSA 1FCBA 2B7OA 5I3IA 1XFBA 2V5BA 2OZ0A 1SFLA 2ZQ0A 4E2DA 3QPZA 2WOQA 4H6KA 3T44A 5D03A 4NQ1A 1WX0A 1X6UA 3CHVA 1UBSA 3NPXA 3GIYA 3UWVA 3BG9A 1SQ7A 4GJ1A 2WQPA 4CQAA 3ABQA 1VH7A 3NR0A 2C3ZA 3M9YA 3TJLA 4DF2A 1YXYA 1I2NA 1KW1A 2YSWA 4MLRA 4GUGA 5D2XA 3W7HA 4UMCA 4DO6A 2WSRA 1P5BA 2QF7A 2WNZA 2Z0IA 4MFEA 4UTTA 4MUZA 2C16A 1HO1A 1G67A 4PEKA 3VCRA 4LV9A 4K39A 4NXSA 1SZEA 4MY9A 3KOFA 1ME9A 1FWSA 2IQTA 3W23A 5HR6A 1X8FA 1ICQA 1J4EA 1NSJA 4TO8A 4JX4A 1F6PA 3KFTA 4Y8FA 5K3VA 3S5ZA 2GQ8A 3GNNA 3W7OA 4HIBA 3A5VA 4WXZA 4DF0A 3IIPA 4MVAA 5BRBA 3SJ3A 2QJHA 2QCDA 4O57A 3P8IA 1XL9A 1D3HA 2CFFA 3DI1A 2PC4A 3JRKA 3PUEA 5K9CA 5T26A 1EEPA 1TJRA 1VCFA 2J27A 3R89A 1K8YA 4LT9A 3CM4A 5AB3A 3N19B 1SUXA 3STGA 3L0KA 2ZRZA 3LV5A 1PHWA 1ME8A 3BLEA 3W1RA 3HOJA 5E93A 2CLEA 3BO9A 3LXBA 3QMTA 5AYXA 3LI1A 5L9FA 5FEXA 3W6YA 2CZDA 1B4EA 4FNUA 3HB9A 2WKJA 2QEZA 4FO4A 2ZYFA 3GXNA 1LCOA 2CLLA 2VFDA 4JXCA 4UTWC 4IPJA 1Q6RA 1QO5A 4ADUA 2TYSA 1CX9A 3VE9A 4O4VA 1FCQA 1OYCA 2KZHA 1EB3A 2QDGA 3MUXA 3DFTA 6ALDA 4IOTA 3FS2A 4AHPA 5G4WA 4WY0B 5G1YA 2A7NA 4CNNA 2OT0A 4CNPA 2HSAA 3G1FA 2Y70A 3L65A 3LTPA 1OF8A 4GUFA 2AQWA 3NM1A 1WOAA 2ATMA 2X30A 1JQXA 2LLEA 2R91A 5LGXA 5HWMA 1SW7A 3CEUA 1I2PA 5D33A 4KFPA 3C2EA 3C3NA 3MHFA 1B3OA 1QFEA 2BX7A 4JTTA 5K9DA 3NPWA 3V1PA 3LTYA 2B7PA 2YR1A 3UWZA 3RU6A 3VI2A 1T0OA 4X3ZA 2CW6A 3NO5A 3PR2A 2P0OA 2J9YA 2Y7DA 3HPXA 2O7SA 5I3GA 1YTDA 2Z6JA 1XC4A 3GAKA 1H60A 3G0XA 4WUIA 2ZZ4A 3NZ1A 3CIXA 1H7OA 3O1NA 1QPOA 2C6QA 5HWNA 4M6QA 3L5MA 1EWEA 1K7EA 3LB0A 3G1DA 4RK8A 4TR9A 1MXSA 1SPQA 2CLFA 5EY5A 3W1NA 5LSMA 4FNPA 4MFDA 3FLUA 3PF3A 3W3OA 3MI2A 1SFJA 1R46A 4YLWA 4ZL1A 5FF3A 1NEYA 4UTHA 1IF2A 1I45A 3NAVA 2F84A 3G8EA 3PC0A 2YCEA 3PULA 3VNDA 4HHPA 1SO4A 1VR6A 3QPYA 5A5WA 4ZVJA 1QMLA 1DVJA 1LDCA 4LVGA 3SFKA 1FXQA 3I6RA 1VYPX 2RFGA 2W79A 4NJJA 3W1TA 3TCEA 4O1DA 5KSWA 4JNMA 3E0IA 2GJLA 1L9WA 2V9DA 1JCNA 1ZHAA 3EX4A 1M6JA 1A5CA 3EWYA 3M7WA 4UMBA 4E38A 5DLCA 1EA0A 3E96A 1TMHA 1RVGA 3C56A 1JCXA 4WJEA 3EKZA 4XTDA 4NXKA 4JTLA 3MP3A 3U8GA 4HKPA 3NGJA 4LS1A 3NL3A 3IVTA 3G22A 4X2RA 1VYSX 1KA9F 3FKRA 2CZFA 4EWND 4O1AA 3C2OA 3UY7A 1VLIA 3A22A 5F1VA 5I3JA 3DXIA 3NPVA 3TAOA 1KM1A 1AK5A 5FEWA 2J88A 3DBPA 3QYQA 4FX7A 1WBJA 4IX0A 2PRHA 4MKNA 1D9EA 2QAFA 4JTUA 1KTCA 3MP5A 1TJPA 3GKAA 4QITA 1EUAA 1IXPA 3PG9A 2P10A 3SI9A 4O13A 4Q33A 5F4WA 3ATZA 4AWUA 4FIQA 1PCWA 4OV9A 2Y7GA 4JEQA 1K8ZA 4AB4A 3EXSA 4W9TA 3W7JA 1OFQA 1F2JA 4N9EA 1KLYA 2HMCA 1THFD 1OFBA 1RPXA 3LCLA 2NUWA 5J5RA 3BK0A 1H1YA 4NNCA 5DBTA 3G18A 4FF7A 5AC7A 2RDTA 3P84A 3E49A 4MZYA 3W07A 1ZALA 1FDJA 1XKYA 3V75A 2HS6A 2E77A 3NL2A 4E2BA 1SO3A 4GUHA 2VENA 4UR8A 2J6XA 5AHMA 4PODA 5K4ZA 3ELFA 2B7NA 4JIPA 4Y96A 3UWWA 4CQ8A 1LRTA 4K38A 3C0JA 5D2WA 2CLHA 5CZJA 4FNSA 3W72A 2DORA 2QAPA 1OVDA 4RV8A 3T78A 4GE8A 4ZZ9A 4UFHA 1JQVA 2QKFA 3TC7A 2QCMA 1KBIA 4JTKA 3HPZA 1MO0A 3NYZA 2CLMA 1XCFA 4RZ4A 1TRDA 4EVZA 2QCFA 3I65A 3O6DA 3W70A 1VCVA 4EIVA 1F6KA 3GLCA 5CG7A 5CSSA 2CZ5A 3BGJA 3EWBX 4N4QA 1P0KA 2FTPA 1J2WA 1W5PA 2FIQA 2WJZA 1OABA 3BPWA 3W71A 1P4CA 2R14A 1KFEA 1G4SA 1XUUA 1AMKA 4ADSA 2Y63A 5AHFA 4K37A 4K7YA 1NAL1 3UD6A 1W5MA 7TIMA 2JK2A 1P1XA 4DO4A 1LBLA 4R33A 4NUWA 1MEWA 1R47A 1UJPA 3B4UA 4Z1CA 2VFGA 1ZCOA 1IIHA 5CPNA 1SO6A 4QJ1A 4IQLA 1TSIA 4YWIA 1NF7A 2ZRYA 3N9RA 4C1KA 1OG0A 3O6CA 2Q8LA 3W7KA 2YFNA 1OFAA 4AHQA 1QNVA 1PCKA 2O7QA 4DEFA 1ZY9A 4JYEA 4O4WA 3NM3A 1GEQA 3VFLA 1VZWA 4AEOA 5K4XA 1S5TA 1KM5A 4N6FA 4PH6A 4ICNA 2PE4A 4I7UA 2B0MA 1ZAHA 3CC1A 1TPC1 3LBCA 3W2MA 4BWLC 1TPWA 2E5DA 1OX5A 4CCDA 3NQDA 1H61A 5LGZA 3EEGA 3G1SA 4BF9A 2ZZ6A 5CPOA 4PTNA 3T55A 3UNDA 2RH9A 3ABSA 3GDMA 2QCNA 3LHWA 4O1CA 1JUKA 1SZNA 3W76A 3EX1A 3LRMA 3QQ1A 5IBXC 2I14A 1TB3A 3BGGA 3P67A 4UTIA 2VC6A 1H7WA 2H3BA 2DJXA 1FWTA 3F4WA 3KVLA 4RCXA 3VE7A 3STFA 3TC6A 3DU0A 3DFOA 3W7DA 2ZRWA 4S2BA 1TPUA 2YGYA 3W2UA 4LNYA 1CW2A 2Y62A 1LLWA 2VOMA 5CZTA 2DZXA 3LDVA 4Z0JA 1TYGA 3TX9A 3ZS4A 3HG5A 3TMLA 3M41A 1W5NA 1Q6OA 3W7CA 2OCZA 3NPUA 1IXOA 3P74A 3LOTA 4BFAA 3C61A 1K7FA 2RHGA 4PL2A 5D2YA 2ABBA 1TPDA 5G4EA 3DZ1A 2A7PA 3QW3A 4IMDA 2H6RA 5HQEA 4LS0A 3UWYA 3QMRA 4FB7A 3KX6A 1GJPA 2GJNA 1O94A 1FUYA 3B04A 3M5VA 3TMQA 1VC4A 4AF0A 5G2WA 3TQVA 3G3MA 3LHZA 4M6PA 1VYRA 5D30A 2V5LA 2TRSA 5DBUA 3FJLA 1R2SA 4UFIA 4BI5A 3HIJA 3GR7A 4O12A 3TROA 1PHQA 1X7FA 1QPNA 1JCYA 4RZ6A 3FA5A 1EPXA 4O15A 3B0PA 4POCA 1F73A 3N73A 2RDUA 4RKAA 3LHYA 5U4NA 1XBXA 3TW6A 5K7JA 3NQ7A 4JS3A 3M5YA 1OFOA 1XBVA 1QWGA 3ZR4A 4S1FA 3GX9A 1KBJA 2A2IA 1W5OA 3QM3A 3QRHA 5LNWA 3W7QA 3IGXA 4O10A 2AGKA 2YW4A 1XDMA 3I7QA 4FX6M 4IWWA 4O17A 1DL3A 3GZ3A 3MHGA 3QSRA 2ABAA 3PBVA 1HG3A 3BW3A 4JTFA 3Q2DA 1XBZA 3LX9A 4GWEA 1LORA 5F2MA 4IXHA 2YX0A 5D2TA 1EWDA 3C2FA 4BI7A 3W2JA 1L2UA 3EX3A 4I9AA 2QJGA 3G1AA 2ZZ7A 3EWXA 3OA3A 5G2IA 2NWSA 5EL1A 5DXXA 2JBMA 5AFDA 2C13A 3GXPA 1WA3A 4MJZA 4YCOA 3W1XA 1WDWA 3PVFA 3S9YA 3CB8A 3PSVA 1JCMP 4DPPA 2NLIA 3F03K 3S42A 1PL9A 5C54A 4CQ9A 3S5NA 5HWJA 3M5ZA 1K02A 1ZFJA 4UTWA 1A5SA 3R12A 1W54A 3HPSA 1OF6A 1Q6LA 3O05A 5CKSA 3DFSA 4ML9A 5D02A 1KFCA 3NOEA 1FDZA 2FFCA 2VEIA 2X2GA 1LP6A 3MO7A 4L4LA 2NX9A 2ATSA 5TIMA 3W75A 1FX6A 2ZRUA 3GKFA 5LKYA 5LNUA 1YADA 3RNDA 3NQVA 1LLZA 2Y7FA 3E02A 1XBYA 1F76A 2FB3A 4IPIA 4OE7A 3HQ1A 2V81A 4AWSA 1KM2A 3KHJA 4XBSA 2GOUA 4LRTA 4LS2A 4JX5A 4NU7A 2Y6ZA 3S1XA 2P1FA 3W1LA 1FWWA 1G7UA 3YPIA 4WXYA 1AL7A 2BLEA 2A0NA 3USBA 5K9XA 3W84A 2V2HA 5BW6A 2G5WA 1H5YA 2QDHA 3WJZA 1TPH1 3G8RA 3WJSA 5CZSA 3LCHA 3L21A 3NVTA 3NQMA 1AW5A 2GQ9A 3DFNA 3FJ6A 3P60A 4Z08A 2OJPA 5C55A 3Q37A 4UFLA 3P8JA 1MZHA 4GFSA 4MJMA 3A24A 4A2SA 3P7YA 2OX1A 2GQAA 1H7NA 1KFJA 3N14A 5G1TA 2DJLA 4N6EA 1OX4B 1JCLA 4U4MA 3G1XA 1H50A 2CZEA 4N2YA 2TMDA 4GRSA 4RX0A 4ZQRA 4NNBA 4ZQCA 4LC8A 4M19A 2DU2A 3OEXA 1QOPA 5F2GA 2YW3A 2A7RA 3HMJG 4UUIA 6TIMA 1PVNA 2NV2A 4I7VA 3MP4A 3TDFA 2YFOA 3MBFA 3W7MA 5D09A 3LTSA 3HG4A 3TNOA 3S5OA 2UV8G 3EB2A 4LOCA 5G5IA 3LLDA 2V2DA 4X9SA 3GDLA 4LTSA 5D37A 5EBUA 3W74A 4WY0A 2VEPA 4JTGA 3QF0A 1SZGA 1YYAA 1SSDA 3LBMA 2FPTA 1TTJA 3HG3A 3ATYA 2ZBTA 3W9ZA 3EKLA 2ALDA 2QJIA 1A50A 3GDRA 4NT0A 5HMSA 1LTDA 3BARA 2A5HA 3LXAA 4NZFA 2A6NA 3LHTA 1VJIA 4AVFA 5KINA 2ZTJA 1SR9A 5LHEA 1FQ0A 1TRIA 3LCWA 4A2RA 1I4NA 4BI6A 4Q4KA 2J9XA 4FXRA 5U7SA 4MPQA 1X1ZA 3FEMA 5C6MA 5AHIA 4GC4A 3M6YA 4K7VA 1H7XA 4UFJA 1UUMA 1D3GA 3EWUA 3L9CA 1OFRA 4NX5A 2GVJA 1F7BA 2PURA 2BZNA 2ZZ2A 5F2IA 1S5VA 1W1ZA 1KV8A 2VFIA 5KTLA 3L0NA 4EOUA 3QC3A 5ABTA 2QUVA 3PB2A 3MI6A 1DOSA 4MZ8A 2VXNA 3M43A 1AW2A 1MSSA 3EX2A 5BMWA 3UYCA 1DQWA 1ICPA 3MHUA 4JN6A 1WQ5A 4O11A 4DF1A 2DZWA 2C14A 1T8XA 3B0UX 1U5JA 2Z2UA 4NJGA 3KVJA 4UC5A 2R8WA 2VFFA 3ABOA 1B4KA 1KLZA 4I7WA 2X1RA 3AO0A 5CSRA 1MEIA 1FCUA 4ADTA 4S2CA 1DQXA 1TV5A 3W7NA 1B57A 4LUIA 4J9JA 1GQNA 2E5BA 4JR5A 1XDLA 4Z1BA 3C2VA 4LWWA 3S0CA 1PE1A 2G97A 3G3DA 4HNNA 3W7LA 5AYZA 4LV4A 3L2IA 1HTIA 3T4CA 3GXTA 4YCPA 3THAA 2E09A 4CCEA 3NDOA 4K36A 3TE9A 3SGZA 1FXPA 3N2MA 1TPFA 5HUPA 3I7SA 3HGSA 5G2HA 3MI3A 3PS7A 1PS9A 3CWOX 3MWAA 5HINA 1YDVA 4QAIA 1YXDA 3QSTA 4XKYB 1XM3A 1WAUA 1AL8A 3C4UA 1SSGA 2NWRA 1LOLA 2FPYA 1EP3A 3NQCA 4C1LA
chains in the Genus database with same CATH superfamily
5FSEC 4HBKA 3EX6A 3R58A 3H55A 1E6XM 1FH8A 2J25A 5IHRA 4TVDA 4G8TA 3DI0A 2W61A 2CXGA 4HZ8A 4CGTA 1DXIA 2X1TA 1OCQA 4XZNX 3U6WA 3TIMA 4WKAA 3URNA 4YWSA 4S3CA 1A0EA 4LGXA 2YBVA 4HPJA 2D2GA 1OBAA 3H7RA 1DP0A 3PG8A 1ZAIA 4L1GA 5CEWA 5HPOA 3LCGA 1B2YA 1L8PA 1YMYA 4L64A 3G24A 2YL9A 1EBHA 2WQDA 2PWGA 2ISWA 4ZODA 3EKGA 2WZTA 2QMJA 1DJNA 4RZ5A 2WM1A 1H62A 2PGRA 1J5SA 5FJJA 3PUDA 3CZLA 4CQCA 2O9OA 1JAEA 4I9JA 3VO0A 5BOEA 1C91A 1EHNA 4F0SA 3D0CA 1HL8A 3O06A 2WSQA 4ZFMA 3CWNA 2C1GA 4B5NA 1AZ2A 2V3EA 2X1SA 4DAFA 3NIYA 4RLIA 1E51A 3PUOA 2HWGA 1G5AA 3KVMA 3STEA 4ALDA 1PV8A 5DT5A 3OVGA 3W7PA 2H8XA 3L5AA 4HNUA 1FBAA 5LNSA 3LMYA 5DCBA 2DIKA 3AI0A 4U31A 5RUBA 3PFRA 4M6UA 4KFNA 1PAMA 1NWTA 3QV6A 2XM2A 1CB7B 2WLYA 4DBWA 3CZKA 3NXLA 1KCZA 1HP5A 1WKYA 4UOJA 1J01A 1YXCA 1TV8A 1EP1A 1KFBA 3A4WA 1ADDA 3GW3A 3DYPA 1LYXA 4JQ2A 3DH7A 4BQ3A 1KQZA 3MV01 3IJDA 1JNDA 4UIOA 4MOZA 1WDDA 1OB0A 3L66A 3AJXA 2GSEA 3R8RA 4LB3A 5C71A 1UOKA 2GSHA 1ONXA 2XFYA 4QJ5B 3S2JA 3QQWA 1ITXA 4GY0A 1WOBA 2HISA 3RM8A 4AUBA 2CBIA 1C90A 2PDXA 4XWUA 5C9XA 3URQA 4JFWA 4YVXA 5CAHA 1FWBC 3AHZA 4IX2A 4ZTXA 3L23A 3AIWA 4X2PA 2DSUA 3RMJA 4KERA 3HJZA 4IH3A 3G1YA 3WDPP 1EX5A 3LERA 1VPXA 1WZLA 3G6MA 1W3NA 4UTUA 4C5ZA 3T6CA 3SM0A 3WQGA 3AICA 3RF9A 2JKPA 1FHDA 5F4XA 3CAKA 4UTLA 1UWSA 2KAUC 2FZMA 4X63A 3TR2A 2YLAA 3P82A 3LENA 3WLNA 4A29A 4QM1A 3I7RA 2WZIA 1T8QA 3EXRA 4TQTA 1Q3NA 5DMYA 2IUZA 1RA5A 2ASHA 1RZMA 3WL1A 1F3XA 3KOWA 1TVNA 4QHRA 4PCFA 3BW4A 4IMEA 1PTGA 3NTYA 2YZRA 4IIDA 4AD0A 3GK0A 2F8QA 3GXMA 3RDKA 1SW0A 2E6YA 1LL7A 5E0CA 3N2BA 1JXJA 4DWSD 1RJPA 1K9FA 2BXVA 4UQDA 2PDHA 2PP1A 2PWFA 3IVUA 1BF2A 2Y4SA 2FJKA 4MTVA 1WB0A 2ZRVA 2XH0A 3PBMA 2HXTA 3G1HA 1DBTA 3QEZA 2Y24A 3S6TA 2Q3RA 1H51A 5DMLA 3TZFA 4JIIX 3UA4A 4U33A 1PZ2A 1UR1A 2QS8A 4Q8PA 1H7PA 3AALA 4B5UA 3IIVA 2VDGA 3I3DA 1M7XA 4YHGA 4XIAA 4MWAB 2F2KA 2R1KA 2G3NA 1B9BA 1Z48A 3VZZA 7PTDA 3QLDA 4HGXA 3UT0A 3BAKA 1JFXA 1RH9A 2ZC1A 2PRLA 1LLOA 4GI4A 3NQ8A 1S2TA 3O07A 2P8BA 2P5NA 3AZTA 2QCDB 1UZHA 3W24A 1DJQA 2R82A 2WO5A 4WOQA 5CSUA 2ACRA 1POKA 4GH3A 2Y5SA 1NDVA 1ZNNA 2WWDA 1V5XA 1ZTVA 4LBRA 2VL4A 5FIPA 1OX4A 3GH5A 3S9ZA 3ITLA 5IRPA 5EMYA 3PJUA 5FEPA 1GPWA 5H2ZA 2DFAA 1MMFA 1M04A 5AC8A 3WD3A 4GYPA 3WFZA 5SWUA 3VIOA 2WSYA 2X40A 2ZTKA 3STCA 4Q8VA 4ONVA 1NOFA 2Y5JA 2BVTA 3N3MA 4GKLA 5FF0A 3MTWA 1TIMA 2VQTA 1JZ6A 1YW1A 2WNNA 3B9OA 1B3YA 3WK1A 1ZJIA 4GUIA 1FHVA 2JKEA 1M5WA 4C6EA 4CD4A 4GVGA 2JKAA 2XWDA 5LXXA 3TJXA 1Z8AA 4AQLA 4G56A 3LZ3A 4DBDA 4WOZA 5EMUA 1WYIA 4UTTC 5E0KA 3GY1A 2NXGA 2F7FA 1TTPA 1UR8A 4L6HA 1RJQA 2YL6A 3UA3A 4WDXA 1FFQA 3GVWA 4GFIA 1C9WA 3KBNA 1C29A 5A1AA 1F74A 4HMEA 2GVYA 3MUZ1 3WFAA 3OODA 2CZVA 4CLMA 1ONRA 4IFKA 3UJEA 1DKWA 1ZJHA 1NOUA 1EHAA 4HZ7A 3V7PA 2Y1HA 3BJSA 1EOMA 1KO0A 4M51A 2ZFAA 4D71A 5JBFA 1KXQA 4IIHA 5M2FX 4QJ3B 1LBMA 1WXYA 5AVHA 2Z1VA 1XR2A 1V6TA 2CLKA 5H91A 4RDWA 1TUXA 4U10A 3BE7A 3LS9A 4YPJA 3WLTA 5CC3A 4DIAA 1ZAJA 1RV8A 3WH9A 1GG1A 2ZCGA 3UG4A 3FCPA 2E6DA 5CJ5A 4GBUA 2VZSA 3WH8A 5J04A 2R9RA 1BAGA 1SZFA 2WC7A 4PRTA 4N9BA 3TCSA 2EGZA 3DFHA 4HSOA 4DBSA 4UCFA 3AAMA 4J27A 2R1NA 3FYYA 4R85A 2W6RA 4D72A 3GBDA 2OQHA 1MW0A 3VNJA 1AG1O 3OZPA 4J3TA 4Y7EA 3SURA 1OCNA 1IEQA 1TR1A 2BHYA 3N6HA 4MYAA 3W1PA 4UXDA 2XINA 3FHQA 4Z2KA 4GO8A 4D6IA 4Q8UA 3CXOA 1FWNA 3BV4A 3A3WA 4PA8A 3T81A 4LCQA 1JDDA 2PDGA 4MM1A 4ORIA 1O7AA 3MJYA 3Q94A 4B16A 1GQKA 1FTXA 3OIXA 1OZQA 4L1XA 3E74A 3F4NA 4XK2A 3K1GA 1V6UA 5BRPA 4XBKA 3BUVA 1KKOA 3PB0A 2W62A 3NQFA 1J5TA 5I23A 3SY1A 2FDSA 1O68A 4L56A 1VQTA 1R7AA 5D38A 3W22A 2VYOA 3KVKA 3EGJA 4WZHA 2GSJA 3N12A 3TH6A 1GKRA 3EEZA 3XISA 1L0PA 2YDRA 2IW0A 1FFRA 3SIMA 4PC8A 1EIXA 1ALDA 1Q6QA 4O14A 3BLIA 2HVNA 1LZOA 1GVQA 3BAJA 1OM0A 1LM1A 4IZGA 4UMAA 5BMXA 3OBEA 3T2QA 4C60A 3B97A 2QVHA 1BKSA 2JALA 3T2OA 1N55A 2VCCA 1UMYA 4JTCA 3MBDA 1W8GA 3F4DA 4MNKA 1P6BA 3KUMA 2H3DA 2DZVA 3GC4A 4GXPA 3OG2A 1UR3M 4GY7A 1S5NA 2QLYA 2WPGA 4M6VA 3R79A 2WNWA 3T40A 2PGFA 1TFVA 3NGFA 4MNLA 1PYMA 4EE9A 5FAGA 3OGRA 1VEOA 3AQUA 3RG6A 4L9ZA 1Q6GA 5EMLA 2EAWA 2PB1A 4W5UA 1XIJA 4UNKA 1E6NA 2C0AA 2B7QA 2ZA3A 2WWCA 3LLFA 5IFTA 3KWSA 1MWOA 1ZZMA 4O54A 2E68A 3AMLA 1V7AA 4PMVA 1GONA 2Q3OA 3IK4A 1UWRA 1QNPA 3TTQA 2FHBA 1W8SA 1VFHA 2XHYA 4MAZA 4K8EA 4W7UA 3MCOA 5E1QA 4GX8A 3H21A 5FA5A 1QW8A 2BSLA 3IGUA 2BTMA 2XN0A 3O0FA 1JYNA 4E8CA 3N34A 5REQB 4DPQA 1MVYA 2PLKA 1OFPA 5FL1A 3TK7A 1H0GA 3M0IA 1I2QA 1JD7A 2YB4A 3VIPA 4D2JA 1V7YA 4Q6XA 1MW1A 5TBOA 4FS9A 5A6MA 1ZCCA 4PBEA 3USZA 3QBUA 4RNFA 5LIWX 1LROA 3O63A 1EF2A 2QR6A 4Q4MA 4Q8WA 4LRSA 2FQIA 2ZUMA 1B90A 5AY7A 4QR6A 1TPEA 4WRHA 1XJBA 2DH3A 1Y8BA 1W56A 4DWSB 4C6KA 4C6CA 4GQBA 3TAKA 2QT3A 3D3FA 3VOIA 3BCDA 3ITTA 2Z1BA 4MYXA 3WZ0E 4DVOA 3MMUA 4AEFA 2OODA 3BAYA 3ITOA 5JH2A 1X38A 2VVNA 5A8PA 2VEMA 1WKEA 4IQEA 5EYWA 4Z2JA 4XB3A 3Q67A 3M0ZA 4HHMA 4KETA 1GVEA 1W17A 5FL0A 3AYSA 3NXFA 5LZLA 4M0XA 3E2RA 1K4GA 1OX6A 4PMOA 3LXCA 4EF9A 1RK6A 2HDJA 1BVWA 5KZEA 1ZENA 1KTBA 4DUOA 4JICA 2E6AA 2HVOA 3CUJA 3QY7A 1A5NC 1TV2A 1ITUA 3S6DA 4PGLA 5FF4A 2NVDA 4MNMA 3MQTA 4Z2GA 4ZQOA 1K77A 3RHGA 2QYGA 5I03A 3I3BA 2H90A 3SZ8A 3FFSA 3N4AA 2G3JA 1XPYA 3SCPA 4TU1A 3T07A 3CUGA 4GX9A 5D05A 4RXFA 2WMFA 4MMWA 3L4VA 3ERPA 2C71A 3QFEA 4CCZA 1EGVA 1EDGA 1ZB5A 2HE8A 2JEPA 5EU9A 4OQVA 2AAAA 2HQAA 4QNEA 1GQJA 5I3IA 4KRTA 5IDIA 2OZ0A 2RGLA 3R94A 1UWUA 1R9ZA 4E2DA 1ZS2A 3QPZA 4H6KA 3WQ8A 3NDZA 2YA2A 5D03A 4PTVA 2BGNE 3CHVA 4GVHA 3RIKA 2QV4A 1GOOA 4GJ1A 4HOXA 1V0NA 2WQPA 2NT0A 1VH7A 2XM1A 4KWSA 2C3ZA 5FCZA 3GYCA 4DF2A 1WCGA 2WSKA 4GINA 3O7UA 2DEPA 1OQFA 3H7UA 3AOFA 3W7HA 1V6XA 3MSGA 2V5CA 3PZUA 2VUNA 1UKOA 5A6AA 2C16A 3OPSA 4FOJA 4PEKA 4UQCA 3VCRA 1KD0A 4K39A 4MWAA 3BANA 2DVTA 4NXSA 3KOFA 5CC5A 3V16A 5HR6A 1ICQA 1NSJA 4TO8A 4MB5A 3A13A 2NVAA 4JX4A 3WF1A 2NQ9A 1DIOA 4H00A 4HIBA 3KOYA 3TLQA 4MVAA 3E38A 3M64A 2QCDA 1DWHM 1I0DA 1XL9A 3R43A 4W7WA 3DI1A 1CGTA 3A47A 2RGMA 2HBVA 2VEGA 4AZBA 1EEPA 2J27A 3LV5A 5E93A 2CLEA 3LXBA 1PZ0A 2P50A 3U5YA 3WKZA 2DT2A 2WKJA 5BROA 3GVRA 2ZYFA 1UWQA 1TVPA 2CLLA 3UVIA 1IGWA 3MCNA 4GJJA 4GQ0A 1Q6RA 1QO5A 3LD5A 3ZJ6A 4IP5A 4WDWA 5CC7A 4Y8EA 3MT1A 1FCQA 4P7NA 4BHYA 4MB4A 4IOTA 1E9IA 4WY0B 2WAGA 2A7NA 3G1FA 5AYBA 3K1DA 4OBSA 4L5ZA 1IWPA 1G94A 5IDZA 3WLLA 1U5HA 3NM1A 2WHLA 2ATMA 3ZLGA 3M07A 3AUJA 2R91A 4GZ7A 5LGXA 3P6LA 5HWMA 2O9PA 1OGBA 4EP8C 4KFPA 1K8CA 1QHZA 2BX7A 4P7RA 3NPWA 4HD5A 3V1PA 2B7PA 3GBEA 1XD1A 1J11A 3VI2A 3C5QA 2WCAA 2DPEA 2L5HA 3KBWA 1A47A 3DN5A 3PR2A 2AL2B 2J9YA 1XIEA 3HPXA 4JOMA 1YTDA 3GAKA 3EDEA 3G0XA 4QLJA 3QHNA 4HYVA 5HBFA 2BXYA 1HJQA 4M6QA 3L5MA 3DCPA 1JEZA 3V5OA 3HURA 4ATLA 5HNUA 1EA9C 4S38A 3N9KA 4H6QA 3EA3A 1R46A 2DGAA 4V28A 3VIHA 4JIHA 4ZL1A 5JUVA 1NEYA 4UTHA 1IF2A 1PUDA 3G8EA 1ZUAX 4W8LA 5LYRA 4ZO9A 3K13A 4ZOCA 1DVJA 1LDCA 4LVGA 1QTWA 1KBLA 3W1TA 2ZVIA 4H41A 4JNMA 4H9XA 3E0IA 6A3HA 2A79A 1A5CA 2F6UA 3BTNA 2ZUTA 1X96A 1US3A 1SJCA 5DLCA 2G37A 3AHXA 3AZRA 4S3KA 1TWDA 4XVDA 4LXFA 3ONCA 3C56A 1NWRA 1JPMA 3BSHA 3NGJA 1MRQA 3QOKA 4FF5A 3OJGA 4AX6A 2DVXA 4F40A 1CIUA 3FKRA 2CZFA 3NFUA 1XISA 4O1AA 5F1VA 5I3JA 3DXIA 3TAOA 5FEWA 3QYQA 4IX0A 4MKNA 4NRSA 4V1XA 1TJPA 1FH7A 1V02E 3CYJA 4QITA 3PG9A 5HNTA 1D2KA 3ATZA 2P88A 2X7VA 4W9TA 1KLYA 2HMCA 4DJFD 4QTGA 4XV0A 2OFJA 1H1YA 5DBTA 1WP6A 3P84A 3E49A 3WDQA 3MJMA 4XZIA 1ZALA 1BG9A 4E2BA 1R3VA 2VENA 4UR8A 4BJHA 5K4ZA 2VWTA 1PDZA 4A3YA 4Y96A 4DZHA 4K38A 1FWJC 3W72A 1JYVA 2DORA 4NZ5A 2QAPA 5M1TA 1JQVA 3MKCA 2QKFA 1E0VA 5AYIA 3MMWA 1TRDA 2QCFA 3E2SA 2IXUA 1JGMA 3W70A 5DT7A 4UZSA 2HE5A 1F6KA 4JQAA 5CG7A 4M1BA 5CSSA 1IQ8A 3VTRA 2J79A 2Y8VA 3BGJA 4WDTA 1OC5A 1W5PA 3P3BA 2D2OA 4X0VA 3PZOA 4IISA 2R14A 1KFEA 4WIWA 2YCIX 1JZ2A 1XUUA 4ADSA 3WNLA 2Y63A 2DV0A 3VA8A 4K7YA 3C0SA 2QVNA 2ISDA 3BJFA 3UGVA 1HGYA 3BWWA 1R87A 3N4FA 3UD6A 4CNSA 4OZOA 1LBLA 2CHNA 2GGIA 3HV9A 2R6OA 3W6LA 4GNKB 1SO6A 4QJ1A 4JL1A 3P2VA 3K4WA 1NF7A 3KP0A 4EXAA 3PHAA 2YFNA 2G3FA 2O7QA 4JYEA 2XSBA 3NM3A 3UWEA 3D5HA 4OVXA 4GLEA 3PFMA 1S5TA 3WF3A 2KX9A 4LYKA 4PH6A 4ICNA 2PE4A 2B0MA 1TPC1 1TPWA 4J3WA 1JGIA 1OX5A 3K46A 3CS2A 4C7GA 5LXEA 4GPNA 3NZQA 5REQA 2RH9A 3GDMA 4B3KA 4O1CA 3U2EA 3IRSA 2OEKA 3LRMA 1H5VA 2FMNA 3P67A 1TB3A 3BGGA 3MPGA 2OO0A 1ZBCA 4LBSA 2H3BA 3MC5A 2DJXA 3WMLA 3STFA 3DU0A 4F4RA 3W7DA 2ZRWA 4M29A 2PCEA 1WDQA 2PTXA 2J74A 3LDVA 3HG5A 4KH2A 2OSYA 1K6WA 1GVIA 1CB2A 4M81A 3P74A 5TF0A 4DWSA 1GZJA 3C61A 2RHGA 3VNLA 3WD1A 3VNYA 2IPFA 2V38A 2Y2WA 3EMQA 1H11A 3M5VA 5TNVA 1QNOA 2QJNA 5BZAA 3TYDA 5A6JA 4KCUA 1PHQA 2X8RA 1QPNA 1JCYA 4POCA 3IJLA 3ZT6A 1NP2A 4RKAA 1XBXA 4LAZA 2GGHA 3GR4A 1XHGA 1NQKA 4D9PA 7ODCA 3MS8A 1B0IA 3GX9A 1F07A 1W5OA 3RR4A 3TN6A 4O10A 1EXBA 2YW4A 3I7QA 4O17A 1DL3A 4FLOA 4FI4A 4XBJA 3QSRA 3KCOA 1UD2A 2INZA 1FWFC 3SQMA 1GJUA 3S47A 4BI7A 3LZ5A 1ECEA 3MUAA 5DXXA 3W00A 3M6DA 1EQPA 2JBMA 3VD7A 5EMKA 4MJZA 1TMQA 1WDWA 1HL9A 3PVFA 3UGRA 3PANA 3CB8A 1EPVA 5FSDC 2J7CA 4CQ9A 3S5NA 2AMXA 3M5ZA 1ZFJA 1A5SA 1B3XA 4D1IA 2GJPA 2IPWA 3O05A 4IPLA 4PULA 4PFHA 2BGSA 1M41A 1TX0A 3IARA 3TYAA 1EF3A 3KZSA 2PLCA 2X2GA 4L4LA 1RCOB 2J7DA 2NX9A 1X8CA 3BV7A 3W75A 3MSDA 3GKFA 5DFAA 2VD9A 3SRKA 4H9ZA 1XRVA 3WUBA 3N13A 2P8CA 4CEXC 3IUDA 3VGBA 2WLZA 2VJXA 3BOXA 2GOUA 4LS2A 1B1YA 3S1XA 1FWWA 2A0NA 4NL1A 5K9XA 5BW6A 1CCWB 2VX5A 2GGJA 1O5RA 3NVTA 4WEVX 3DFNA 3KE0A 4UFLA 3P8JA 3WQ5A 2YA1A 4MJMA 4LF1A 4A2SA 1H2JA 1I6NA 3P7YA 1X6LA 3WLMA 5D8WA 3G1XA 4B9ZA 1H50A 3NSXA 2POZA 4GRSA 3EYPA 4RX0A 1O66A 1OADA 3S2CA 2MUCA 4TTGA 2I5IA 5ABFB 4NYYA 5BXSA 4PTXA 1DIDA 3TJIA 5F2GA 2YW3A 1EJTC 4J3XA 3FAXA 6TIMA 1PVNA 2W27A 4HCLA 2NV2A 1EKOA 2YFOA 5D09A 3S5OA 3WNMA 2XVNA 5A2CA 4S3GA 1OWQA 2UV8G 5T8GA 1WKDA 3FJNA 4DHGA 2V2DA 4WY0A 3K8MA 1SZGA 3LBMA 3W29A 2YDQA 3W9ZA 2QJIA 3BL3A 2A3CA 1A50A 3GDRA 5HMSA 1CXHA 1O12A 3BARA 1VJIA 3GVQA 1UH4A 1S2AA 1XDJA 2ZTJA 1SYTA 2DUXA 4J3UA 2FZ8A 1OT2A 3WF2A 1GKPA 2ODOA 4A2RA 1I4NA 4BI6A 2VO5A 3DEQA 3ITCA 1XH2A 2FJUB 4HVXA 1X1ZA 4MWAC 2PDLA 1B3VA 1YRRA 5AHIA 3D6NA 1LL6A 4QBXA 4K7VA 5H1WA 2AL2A 1D3GA 2GVJA 2VFIA 2ZUNA 3GUGA 4A4AA 5ABTA 1E6PA 3MI6A 4MZ8A 1KBBA 2PEVA 1PWLA 4HSHA 1NU5A 4S3DA 1ICPA 3PTQA 3BLPX 1WQ5A 3THCA 2C14A 3LPGA 1U5JA 3KVJA 1CLKA 2ANUA 3ITVA 2VFFA 5ECVA 3W4RA 4NZ1A 4JZ5A 3BLDA 3WLQA 2X1RA 5CSRA 3TC3A 1MEIA 3N15A 4S2CA 5LIXX 3WBWA 1B57A 1XDLA 4LWWA 1IT7A 1PE1A 1JZ4A 2G97A 1LWHA 2VHLA 3EOOA 3HZ3A 1HTIA 3T4CA 3VK5A 1UQYA 3GXTA 1LG2A 3NDOA 4H6EA 1J6OA 4F79A 4EKJA 5I07A 1JYXA 2W92A 4Z42C 1QT1A 4WSKA 1QK2A 1MW2A 1MFVA 2DUZA 2BS9A 5A8OA 1TPFA 3E6EA 4QDMA 5G2HA 3IJ8A 4PRRA 5HINA 1E43A 1OINA 2OO6A 4YU1A 1YDVA 6XIMA 2WB5A 3QSTA 2UWFA 3CQHA 3PPFA 1AL8A 1AUSL 3T05A 3EBVA 1QJWA 1LOLA 3AZSA 3LGGA 1EP3A 3NQCA 4C1LA 2Y8UA 3ZIZA 3G0UA 1QPRA 4K6AA 3KP1A 3DKJA 1YHTA 3KM8A 5TAOA 4KWOA 3WUFA 5KITA 2GJRA 3EXTA 1FWRA 1V8EA 3EMCA 2NW0A 3OVRA 1GVRA 1QAPA 1HP4A 4KEMA 3ZR5A 4Q3MA 1BVNP 1Z6KA 1XIIA 4IJBA 2QCCA 3DDMA 4WSHA 3CIWA 3BMXA 1E71M 1VP5A 3S1VA 2PU0A 3RJXA 3TQKA 1M65A 2ALRA 3GDBA 2VX7A 4ACYA 3H12A 3R4IA 1MYRA 3CGTA 3TFCA 1SO5A 4BKNA 1GVOA 1CENA 4DXVA 3VOGA 3CAQA 3UG8A 3V36A 4PE8A 3FKKA 1DJWA 2EKCA 4AY7A 2VNCA 1EP2A 4JY8A 1HKIA 3WL0A 4IPPA 2ZOXA 3GNPA 2OOFA 5IM51 2B4GA 3VNMA 3ZM8A 2ISSA 1W1YA 4KGLA 2DT3A 2V82A 3CZ8A 1NTHA 3F4VA 1GHSA 3WK3A 5GPRA 4XD3A 2ZVRA 1A49A 1E4LA 1BYBA 5HR7A 1A53A 2OTDA 3UR7A 1BXBA 4G9PA 4MLJA 3AYTA 1JYWA 2VUYA 5JVLA 3EPOA 3HMCA 4DBEA 4LUSB 3WYZA 2D3NA 3EB3A 1O60A 3GXDA 3NNTA 3KZPA 2BASA 3GH4A 1UD5A 4QSHA 4C6JA 5HULA 3ENLA 4DUWA 2CWNA 4DXXA 3MYPA 1VLWA 2UY4A 4OGZA 4PUJA 3R1ZA 1TWWA 1U22A 1IGSA 4DJEA 3MUIA 2YL8A 4KGJA 1OSEA 4O18A 4DWDA 1PX4A 4XUGA 1G6CA 1XSKA 5HNRA 5AZ1A 1GZ1A 3BAXA 1EDQA 2I9EA 1ZJAA 2OGYA 5CH9A 4LUJA 3GFXA 1D7KA 4W8AA 3GTHA 5A94A 3KL0A 3FIGA 1A5BA 2TPSA 2FGZA 2GYIA 3H2AA 2FVKA 4Y9AA 1Q2RA 3CYVA 3QZAA 1JFHA 2Y89A 3LQGA 4AZHA 2CETA 4HOZA 2WVVB 3C52A 1GYNA 1T99A 4C90A 5M03A 3MYOA 3BG5A 1TO3A 3IIZA 1A80A 3E9AA 2XTKA 2OT1A 1IEVA 1SFTA 2NUYA 4FR1A 3KBVA 3P81A 4BR1A 4NYUA 3VD3A 3GIQA 4E8DA 3RX2A 4O0KA 2Y85A 3LYEA 4W8BA 3UCDA 1HJSA 1CLXA 4NX0A 2OYKA 4OT7A 2HVMA 3ORWA 3QJAA 2C79A 4LYPA 4DO7A 2QUMA 1WZAA 2ZE0A 2EJ1A 1JJKA 1P0EA 1GYLA 3O6YX 4UTMA 3REQA 3TW9A 3WH7A 4HOWA 1H49A 4N02A 3MMDA 1LOSA 4HA0A 1E1EA 3NQAA 4JY9A 8TIMA 4B3LA 4Y90A 2NX1A 1JRCA 1HL2A 3II1A 3PAJA 2QCEA 1BEUA 3OLDA 1GTHA 1F6YA 3CPUA 4AY1A 2VX4A 3INPA 1MXDA 3R10A 1E70M 3C2RA 3PM6A 4JD4A 3FSUA 4GCAA 4ICCX 1TKKA 3NCOA 4JX6A 4LVBA 4O8RA 3ECQA 2QMKA 4ERGA 3A4XA 1XSIA 4JTJA 3AMCA 4S3EA 1IT0A 1HW6A 5B80A 4DWSC 1CYGA 4US6A 4IT1A 1EO5A 1ME7A 1ODUA 1ISWA 3H4XA 3ITYA 2PCQA 5AHEA 1UC4A 3UR5A 1EUNA 2WKGA 1HKMA 1US2A 5F4SA 1H7RA 1QUMA 2P3EA 1R0MA 3SUWA 1QOQA 3C8FA 4C6OA 3F2CA 3B40A 5HATA 1E9ZB 2ZDRA 4FOKA 2Y7EA 2GK1B 3MU7A 3B06A 3LGDA 1WZMA 3SR7A 3UEQA 4XQ6A 4GI8A 2XISA 4TV5A 1W1A1 3ARVA 4AIBA 4LB4A 4HNTA 2PDQA 2VEKA 3MSRA 1XLBA 3E2VA 3W2NA 2VC5A 2ZA2A 1UA7A 3AIVA 4BF5A 3ZT5A 4GKTA 1QHPA 4F0LA 3GWQA 3IIXA 3O15A 2OX4A 3B8WA 3OHIA 3IV3A 4A22A 3GC5A 3SGUA 3LPPA 4JTQA 4YL2A 1GVSA 3TKFA 3FXGA 1RQHA 1RQBA 3BMWA 4IMFA 4FSAA 4F0RA 3UWQA 2CLIA 3SW6A 4JYFA 2GVGA 1JD9A 1HX0A 4NZJA 4RNIA 5ABFA 1KB3A 2IKJA 3ZFHA 1AH0A 4DZIA 1P7TB 4DXKA 3H2FA 3AUOA 3C6CA 4ERAA 4WX2A 1TPVA 2HBXA 3OVPA 3WJXA 1QATA 1ONWA 1M01A 3L4YA 3S1UA 2QDEA 3NL6A 4GQQA 3UXAA 4DYJA 3OYXA 1GQLA 3M1ZA 3OLIA 3W83A 5CBBA 4UQEA 2YLLA 3FEQA 3AC0A 4AMAA 2X7WA 4AXKA 5T91A 4HHLA 4WQ6A 1XIBA 3NZGA 3P5ZA 3JVAA 1SJAA 5GVJA 4LSBA 4O1BA 3O0KA 6PTDA 3E12A 4O19A 2DVUA 4H4IA 3TVAA 1E4MM 4FLRA 1TE6A 3AS0A 4JNYA 4G2DA 3VIIA 4AD3A 1C8XA 2XFWA 2V63A 4YVVA 1TQJA 2OSWA 1QNQA 1E9LA 3KRSA 4RW3A 4F48A 3NJ3A 1W6TA 1JCTA 1V93A 4G1KA 1JVNA 3EWWA 3IJIA 5BXTA 1R2TA 2PWUA 3KRUA 2XSAA 1Z3NA 4HB7A 1SFSA 2XH2A 3LRKA 5HNNA 2ZA1A 4ROPA 3LN3A 3C2YA 3WQ6A 4DJFA 3EAUA 1YNYA 2OB3A 1SM9A 2VGFA 5EB8A 3I4EA 1PSCA 1J0KA 1BG4A 3CV1A 3HFTA 3L68A 4F2TA 3IJQA 1W3IA 2VZOA 3AHTA 3THQA 1A5UA 1O1HA 3EOEA 4YTQA 2G50A 5A8MA 1UG6A 2BWGA 4U28A 3PSWA 1YIXA 4I8YA 2IQ0A 4O0QA 5FEZA 5FJRA 4GYKA 1A0DA 1EFZA 4XZWA 2O92A 3ZZ1A 1CWYA 4I5UA 3HQNA 1AQFA 3RX3A 5A2AA 1LWIA 2C8NA 4NVTA 1QOXA 1I1WA 3QR1A 1J0HA 1P1MA 2VM8A 5J5DA 3UJ2A 1KFLA 3KL3A 3PP7A 3P0XA 1CXEA 3RLHA 2C91A 1CGYA 4X22A 4TMCA 1GG0A 4GNJA 4GI6A 5AHLA 3VZXA 2E25A 4L65A 1EO7A 1ML1A 5AECA 3M47A 3IGHX 3QH2A 1XLEA 4I5XA 4MKSA 2OKOA 3R13A 2RJHA 4LQ1A 1Y5XA 3RRXA 5D32A 4LNCA 4I5RA 3B0YA 3EMZA 3OVQA 3GAYA 3ZMRA 1QVBA 2CITA 2HTMA 5CPTA 4CCCA 3BAIA 1C92A 3WQWA 3W25A 1PWMA 3WK0A 3HJEA 2QCLA 5HMDA 1VFMA 1XGZA 1X1NA 2D73A 1JUBA 4ORMA 3K30A 4WCJA 3IV8A 1OIFA 3AS1A 3E0WA 3K8LA 3GQYA 3UP8A 5DCDA 5EPDA 5CSYA 5IBXA 1KGWA 1VHNA 1XUZA 4D1JA 5FKYA 4K8HA 4AEEA 1DXEA 1WDRA 2A4AA 3E0VA 2E3ZA 3BLFA 3VUSA 1QBAA 2V2CA 1UP0A 5HJXA 4A3HA 2V3DA 4HNLA 4Q6JA 4IUOA 3NL5A 2CU0A 4X61A 2VR5A 1B9ZA 1WZKA 3T0CA 5EKYA 1I2OA 3W2KA 1PJ9A 1GZGA 1VBRA 4O0ZA 1Y5WA 5ABHA 2CBVA 3CLWA 1WUEA 1HFBA 1JR1A 1O4UA 1NFPA 4XZMX 2VZTA 4GUJA 3TYZA 5I3DA 1G0CA 4LJ3A 3KS5A 3IANA 3N25A 3KOZA 3AU6A 1RBAA 1O5KA 3G77A 1S2UA 3W27A 2ON3A 4B5WA 4GHRA 3KAOA 2IS7A 5A8GA 6TAAA 1M7PA 2A6LA 2X41A 1GGOA 3QQ0A 1DJXA 2OSXA 3APTA 1GK8A 3AMKA 4INFA 3BQ5A 3W0KA 1KM0A 5LA2A 3ANUA 4WR3A 4S3AA 3TFXA 3CT2A 1XIGA 3N6QA 4DJDD 5MF5A 1DJHA 1LOQA 3FA4A 4D6FA 4JHZA 2WBKA 4UR7A 2VELA 1TQXA 2PDCA 1OYAA 4ES4A 3BDKA 1ZBKA 1U2YA 1HUVA 5H8MA 3HG2A 5CJMA 3L5LA 1YNPA 3ZSSA 2O56A 3DHUA 2RUSA 1J0IA 4AVOA 3NG3A 4KRUA 2WVVA 4GIYA 2YXXA 3DHFA 2BHUA 3MO4A 1GEHA 4HU0A 1EDTA 2J47A 1BKHA 4QE4A 2VKZG 4AH7A 2OXNA 4JKKA 5HAOA 1OK6A 3UY8A 4AF0B 4QNWA 3CT7A 5G4HC 4O8AA 3W85A 4B90A 2WMKA 1N82A 2PTZA 3RO8A 4H04A 1EC9A 4AMCA 4GOAA 3P80A 4I9MA 1LL4A 2E4TA 1JUEA 2V68A 1ZGDA 3TLLA 3IAPA 2UY5A 1Q7ZA 1VHCA 1RQEA 4NASA 5DRIA 4HPNA 1WXZA 2DIEA 3SN4A 5H6HA 1JF5A 3QY8A 1J12A 1TJ1A 5D9MA 3GSMA 3VMNA 5CGQA 1MW3A 5EBAA 1TR9A 1XXXA 4P2VA 4JTAA 2WYSA 2ADAA 3A5FA 3CPRA 4HU3A 4KFOA 2Q8ZA 1KCLA 3QMSA 3E5PA 1AMYA 1HJUA 1W1PA 2GL5A 4TX6A 1T40A 2RDXA 3LRLA 3ANVA 3U4AA 1UB3A 2IPGA 2P76A 4O1FA 3TXVA 4ML4A 3AIQA 1ICSA 1XFBA 2E0PA 1W2VA 3WY1A 1SFLA 2ZQ0A 2ZUVA 3TN5A 1NY1A 4CNTA 3ID7A 4Q4OA 5J8LA 3ALGA 1WX0A 1ZU8A 3UWVA 1RP9A 1SQ7A 4E4UA 3L4TA 3LMZA 1YXYA 3LUTA 1UZ1A 1I2NA 4M24A 1Q8AA 5D2XA 4HK6A 3AMDA 3SO7A 3A4JA 4C7FA 2WSRA 4DO6A 2QIWA 2WNZA 4TTUA 4MFEA 4UTTA 1UR2A 1MUMA 1G67A 3PAOA 2WVUA 2DW7A 4MY9A 2GK1A 2IQTA 1X8FA 1J4EA 4GNVA 4ZENA 3WN6A 1U30A 5K3VA 3S5ZA 2WMIA 3W7OA 4DM2A 3CNYA 1W3KA 4Y9MA 2GGEA 4LALA 3SJ3A 4UQ9A 1QI2A 4O57A 3CL8A 2CFFA 4GZJA 3JRKA 3PUEA 5K9CA 5T26A 3R89A 1K8YA 4LT9A 3CM4A 5AB3A 3N19B 3STGA 2ZRZA 1PHWA 1ME8A 2G3MA 2GJXA 1AODA 2WVSA 3BO9A 1TA3B 4TX8A 2VC7A 3N3TA 5L9FA 5FEXA 1VFSA 3W6YA 2CZDA 1B4EA 3LBOA 3M0KA 4HTYA 3HB9A 3GG1A 1R3RA 4GC3A 2HEJA 1POJA 1US0A 3PNUA 2VFDA 3DG3A 5JQ9A 3LY0A 1P7TA 4FLSA 3V3WA 4J40A 2FZDA 3L4WA 5HMFA 3VE9A 3CHEA 2PBOA 5IXEA 3M0JA 3WENA 1EB3A 4RW5A 3MUXA 3DFTA 4DLMA 3FS2A 4AYSA 2DDXA 3WNKA 2OT0A 3K8KA 3SRFA 3L65A 4GUFA 3DIPA 1VAHA 4DYKA 2X30A 2D20A 2LLEA 4H9MA 1EZWA 3UFYA 4KS0A 3GFZA 2XH7A 3R0UA 1E0TA 1AD1A 1V0LA 2F6KA 2PWEA 4YHEA 5D33A 1GW9A 3C2EA 3MHFA 1B3OA 1QFEA 1AQ0A 5K9DA 1RCQA 2OZTA 1SJBA 4JIEA 3H23A 3RU6A 4J4KA 3W53A 2WJEA 1T0OA 4QAWA 2ACQA 4X3ZA 2BGQA 2CW6A 2P0OA 1BFNA 3LG3A 4JKMA 2V5DA 5AKQA 3VMOA 1PTAA 1XC4A 1LJYA 2ZZ4A 4AW7A 1H7OA 3O1NA 1PZ1A 3QPEA 3T09A 5HWNA 3C0QA 1EWEA 5PTDA 3LB0A 3VOCA 1PIGA 3EOSA 5MKGB 4YJ5A 4J1OA 3W1NA 5LSMA 1IWBA 4MFDA 3FLUA 3PF3A 3W3OA 4IFRA 2REQA 3IWPA 2PS2A 1IZJA 1EGZA 1SFJA 1Q2SA 7XIMA 1TZZA 1I45A 3A3XA 5I7GA 5DF0A 2ZX6A 3N2CA 1Q13A 4XIMA 5I6SA 2P0IA 2WHMA 1R3YA 1FOBA 3TYCA 3QPYA 3EZ4A 1D8WA 3GXFA 2IKIA 1FXQA 3I6RA 1VYPX 2W79A 3RMEA 3TCEA 1I9CB 4DNHA 5KSWA 2JIWA 2GJLA 1L9WA 1ZHAA 4KMQA 4AZCB 1M6JA 4X0NA 3U4FA 3BICA 3EWYA 3M7WA 4UMBA 4E38A 4ZO8A 1EA0A 1UIOA 1RVGA 3GG0A 1PDYA 4JKLA 1JCXA 4Z1YA 4WJEA 5JH1A 4XTDA 4Y9NA 2YL5A 4U3AA 2ZX8A 2ZUSA 1CEOA 4CU6A 3OTRA 3MP3A 4HKPA 4LS1A 1AA1B 3IVTA 3OGSA 3G22A 3S2LA 2G8ZA 1VYSX 4HJFA 1LQ2A 1KA9F 4OECA 2A3LA 2XVKA 3VKDA 3D46A 3KCLA 1MNSA 1XG4A 2OPJA 3UY7A 3C2OA 1VLIA 3NPVA 4W93A 3HFYA 1UA3A 4JTUA 1DEDA 5FD0A 3M0YA 2P10A 4Q33A 1BD0A 3NURA 4HA4A 4OV9A 2Y7GA 2X09A 1SMAA 1K8ZA 4L6DA 3QC0A 3W7JA 2CLPA 4ZBCA 4TV6A 4A8NA 3FX4A 4J2MA 3BK0A 3DESA 4HA3A 3M0HA 2PWVA 3WNPA 2Z1SA 2QPSA 4NNCA 3TJ4A 3VAVA 1V0MA 4LEQA 2OU4A 2RDTA 2NQZA 4DJFC 5LIUX 1XKYA 4LF2A 1Q7MA 2E77A 2HS6A 4KRZA 2J6XA 1OC6A 4V2XA 4JN7A 3BZGA 4HZMA 3UWWA 3C0JA 1XYBA 4R3UA 1AZ1A 1R9XA 4Q8OA 1UWTA 3T78A 2QCMA 2Z24A 2UY2A 1YQ2A 2CLMA 1RAKA 3WBXA 3ARXA 3QOMA 2DSVA 4XUYA 3VXGA 4M56A 3WDJA 4EVZA 1J0YA 2EKGA 3O6DA 4NAEB 2D22A 2O55A 4H7ZA 2C1IA 2EBNA 4AZ7A 3EWBX 2FTPA 4W5ZA 3S9IA 2WJZA 3N1AA 4A8IA 3W71A 1KXHA 1AMKA 3OZYA 3DC0A 5AHFA 1VEPA 2V67A 1K70A 1D3CA 2JK2A 3U9IA 4DO4A 3VNZA 9RUBA 1UKPA 2QF8A 3AXIA 3KTSA 4D6GA 1MEWA 1UJPA 2VFGA 2GDUA 3TN4A 5CPNA 3VDBA 3J7HA 2OKTA 2VC9A 1PKMA 4RL3A 4QLKA 3URBA 4JFTA 4C1KA 1OG0A 2Q8LA 3UESA 1JAKA 4AHQA 1QNVA 3HPAA 1PEZA 4DEFA 1IR1A 2ZXQA 3QV9A 4O4WA 1GEQA 3T0DA 1VZWA 1KM5A 2Y0FA 3LPFA 3TYUA 1ZAHA 3CC1A 3LBCA 1Z32X 4JTDA 2OZ3A 3GRIA 3M7SA 4MDPA 2FHCA 4ENLA 3G1SA 3RYSA 1REQB 2CWXA 2ZZ6A 4PTNA 3T55A 3ABSA 3PBGA 1K1DA 3LHWA 1JUKA 2HRWA 2O4QA 3SUSA 4J7RA 5IBXC 2I14A 1UPMB 4UTIA 1H7WA 1XV8A 3QGKC 3QHOA 4PMNA 4LAMA 1E5JA 3TC6A 3DFOA 5ABGA 1BYAA 4DBUA 4LNYA 3LM3A 4H9TA 5CZTA 4Z0JA 5I78A 4MPKA 2OCZA 4GISA 5C70A 3QKEA 3AYVA 5G4EA 4MG4A 1RBLA 1VPQA 4PRWA 5CC6A 3BURA 3CL6A 4FB7A 4IIBA 1MQQA 1O94A 4OOUA 3TMQA 4AF0A 5G2WA 4D6DA 5D30A 3VIMA 3WIJA 2E40A 1JI1A 1R2SA 3A6OA 4BI5A 4B4HA 3GR7A 4O12A 4GYJA 4M82A 1X7FA 1F3TA 3AJ7A 3B0PA 2RDUA 1V51A 3TW6A 7ENLA 1ZLPA 5K7JA 1OFOA 1XBVA 4IGNA 4QE5A 2A2IA 5C9WA 5C2GA 5LNWA 4K68A 3A64A 1XDMA 1W1B1 4IWWA 2C0HA 3LEPA 4PCTA 5KETA 2OVLA 3PBVA 4E8GA 1W91A 4GWEA 1QK0A 1LORA 3JZEA 4OTKA 3TTOA 3S2NA 4L80A 4I9AA 2TAAA 2ONEA 4K1WA 4IMAA 3KOXA 5BWAA 3VYLA 2CBJA 2Z1KA 5G2IA 5EL1A 4NG3A 2ZXAA 3P93A 3GD6A 2EXOA 2R24A 4J5NA 3W1XA 1UPPA 2V6AA 3S9YA 4OUIA 4IUGA 4D6HA 1JCMP 2PD9A 2NLIA 3S42A 1PL9A 1IEXA 2Q8XA 4DYEA 1DWFM 4KW2A 1W54A 4C6PA 3BCFA 1WDSA 3LLXA 5CKSA 3DFSA 4RUBA 4ZOEA 1Q4WA 1VBJA 5C9ZA 3MO7A 3QKZA 2J4GA 4KEUA 5TIMA 3PJTA 2ZRUA 5LKYA 3IK2A 3CMGA 3VILA 2Y7FA 3E02A 4ZB5A 1F76A 2FB3A 3U57A 4U2YA 4AWSA 3KHJA 4XBSA 2OEMA 4HK7A 2Y6ZA 3W1LA 2RAGA 3A9BA 3WLKX 4TUFA 2Z2BA 1XIFA 2G5WA 9XIAA 1MDRA 3KW3A 3B8IA 1WKFA 1MNZA 2PZ0A 5M3WA 3G8RA 3PWIA 3LCHA 3NQMA 2GQ9A 3FJ6A 3P60A 4Z08A 4NAFB 3H24A 4PMJA 3GUWA 2OX1A 3WLSA 3AXMA 5G1TA 2DSWA 2DJLA 1JCLA 4U4MA 4ZQRA 1VD6A 4NNBA 2YCKX 3A4AA 5CXPA 4ZQCA 2VT0A 2ZC8A 4M19A 1TA3A 2OGJA 4D6JA 4CU7A 1BLIA 2PDKA 3HU7A 3MKVA 3MP4A 4ICMA 4AISA 5JIWA 1V03A 1CZ1A 2CKRA 1IR2A 3W7MA 1CGUA 1HT6A 3CPGA 3MVIA 1P6WA 3LLDA 1UR9A 4NILA 4RPQA 4X9SA 3GDLA 3SUTA 4LTSA 5D37A 3W74A 2JEQA 2VEPA 3SSZA 3T0AA 4GIAA 1SSDA 3HG3A 2ZBTA 2XGIA 1GOWA 1HNYA 2A5HA 3TP4A 3LHTA 3T08A 4FAMA 5KINA 1SR9A 4IM4A 1RD6A 1TRIA 1F4HA 4Q4KA 1IZKA 1H09A 2D23A 4ZFCA 3GHSA 1PX8A 4MPQA 7A3HA 4W89A 4GC4A 4UR9A 2EPOA 1H7XA 4S3JA 1GOMA 1J8VA 1OFRA 5F2IA 4AX7A 2ZZ2A 2Y8KA 1S5VA 1KV8A 3TZNA 5KTLA 3L0NA 4EOUA 3QC3A 4A05A 2QHAA 4GMEA 2VXNA 3M43A 1IE7C 1JNEA 5CGTA 4D8ZA 5MKGA 4ILSA 2J13A 5BMWA 3UYCA 2WK2A 4UOQA 3EOLA 2PU1A 3JU2A 3NQBA 3RR1A 4O11A 4YIWA 2J77A 1EJUC 2XIMA 4C6IA 3GH7A 1IHIA 3BLKA 5CCZA 3ABOA 3FJ4A 4IPNB 4C7DA 4AU0A 2WMGA 1EX1A 4ADTA 3GFYA 3W7NA 1GQNA 2DIJA 1FHLA 3S0CA 1F8IA 3G3DA 4HNNA 4BEUA 4AZCA 4LV4A 1Z9AA 2FDMA 4PEEA 3THAA 3GC2A 4CCEA 1QXLA 3PTKA 3ZJ8A 3SGZA 3KRBA 3CHCA 3DYOA 3WELA 3KDNA 5FJTA 3DG6A 5HUPA 3I7SA 4S39A 3VFCA 4K2SA 3EPMA 3PJWA 3VM5A 1CPUA 4QAIA 3VDCA 1DTUA 1R8LA 1WAUA 2NSXA 1QU4A 3VABA 3VPLA 5D4YA 4BA0A 2VR2A 3M0VA 3S8HA 2FKPA 4HZ6A 4Q8MA 5LNVA 1S1RA 5XIMA 3OA5A 2VURA 3W73A 1I60A 4NJHA 2XZ7A 1J0ZA 3GDTA 2EJAA 1QDSA 1HXJA 1QCWA 4AHOA 1AQHA 3AIRA 5KZMA 4Q8TA 4ZQMA 2CHRA 3TV8A 3FA3A 3WBEA 2PTWA 2ZADA 2J8FA 5F1UA 1EBGA 3H4GA 2INEA 1G7VA 1YPIA 2AKZA 1HO4A 1GWJA 4AIEA 1R6WA 3S3GA 4E6MA 4HYWA 2I1OA 4EF8A 1L6YA 3E2QA 2CESA 3W1MA 5FJPA 2X0SA 3W86A 3IRDA 3W1AA 4NAEA 3IACA 5DCEA 1ZRQA 3WQPA 3I68A 4AD5A 4E3TA 3ZJ7A 3W7IA 1ISXA 1UD4A 2XIIA 4HPXA 3WK2A 4YXGA 3KDOA 4CN6A 3SCQA 1DJGA 3CAVA 1U33A 2QNEA 4B2DA 4GXMA 1YDOA 4LC6A 4N0RA 1XLHA 3TQPA 1W3TA 1GOIA 2GWGA 1ENUA 2D0FA 1A5AA 5E6ZA 3WJYA 4JYDA 5CPQA 2WW5A 3ZLHA 5AC6A 3IVSA 4O52A 5DN1A 1M7OA 2QJJA 3R5EA 3AROA 6ENLA 3HGJA 3F2DA 4AC7C 3WX7A 4ZTYA 1W9UA 4MADA 4KWWA 2AKMA 4EK7A 4FOUA 3FW6A 1KM3A 1O6IA 1M53A 3H6OA 4QDPA 3TA6A 1UD6A 1REQA 1XFCA 4HHHA 3N2OA 3M16A 4UQAA 4KWVA 4PTWA 2GDVA 5E6YA 2ESCA 4ZA0A 1BYDA 4PUKA 5I3HA 3OQ8A 2VQUA 3FYPA 1YE4A 1TUFA 1NDYA 2X1IA 4BK9A 1DWGM 2D69A 1GVFA 5C0QA 3HGOA 1TVLA 2QCGA 2PWDA 1HZYA 3PBWA 3U7BA 2F9RA 1NVMA 5E9AA 2ISFA 3CMFA 4R9XA 3S5YA 3W87A 3B05A 1H1ZA 4CN4A 5C2XA 3G5EA 1KM4A 2BFGA 3T42A 4NKCA 3VGGA 2DH2A 3WG6A 3ZYZA 2J7BA 1M3UA 4B5VA 1I1XA 1OG6A 4BCEA 2E28A 4A8LA 5F7UA 3EDDA 4J3ZA 1F4AA 1Z41A 4B91A 3L67A 5KMYA 3MW7A 5JU6A 4WJ8A 4XAGA 2OMAA 3N6JA 4MB3A 1UJQA 4PMYA 2J9ZA 1TX2A 1JPKA 1FWCC 4A21A 2PGEA 4D6EA 4JDYA 1S2WA 2I56A 4OIFA 2OQLA 2E8YA 2YDSA 1CECA 1UQZA 3K4AA 4Z2LA 1UD8A 1XYMA 3KBJA 3LCFA 1TCDA 1UCWA 2G41A 3LPOA 1N8FA 1A5LC 3QR0A 1WV2A 1LRNA 5DRCA 2BY0A 1E3ZA 2PI6A 5DY3A 1H3GA 4EAMA 1JULA 1FHUA 4E5TA 1D8CA 3NZRA 1UOZA 2C7FA 1IYXA 5B7ZA 1EGMA 3H54A 4IP7A 4OBTA 1V6WA 4XD4A 4PYSA 1EEXA 2Y88A 3BAWA 4PUNA 3UPMA 5AN7A 4M7SA 4QS5A 3GDKA 5JMUA 3FOKA 4JQ1A 3WLJA 1PPIA 1JF6A 5L6UA 3B8DA 3W2LA 1E72M 3ARTA 2BHZA 2OWCA 1PO9A 4CNUA 2GPTA 2NX3A 2WANA 3OHMB 4DELA 4P8XA 1ZP3A 4GCXA 1G4PA 5AOUA 2NQLA 3DUGA 2X42A 4IG2B 4QS6A 1RLDA 2Z29A 3ITGA 5HUOA 5DY2A 5DQPA 3GTNA 1ONEA 1ZJBA 4I8DA 4Z1AA 4P8WA 3R25A 3QXBA 4KWUA 4RXGA 1UHVA 3NO1A 1EJVC 2QJMA 3FK4A 5BYWA 4RE4A 4NAFA 4F2UA 5LNRA 4E3VA 3VD4A 4WJXA 4ZB2A 5TQLA 3WO8A 4QJ4B 2DY3A 1A4MA 4FA3A 1XCWA 4FHAA 5D8ZA 4LYRA 4S3BA 1JL8A 4LVAA 3RFAA 3DBNA 3GYEA 3P61A 3CMJA 4F0KA 4QIUA 3W7RA 1XPGA 5DO8A 1BXCA 2JE8A 2IKHA 3N2XA 3CQ0A 4F9JA 4LEFA 1LT7A 4IQDA 1QHOA 4AIUA 1D7FA 1DWJM 2JGYA 2BVYA 2BOGX 2VFHA 4JCMA 3QFWA 1G1YA 1SMDA 4C6MA 4IQJA 1HJXA 2DSZA 2XJ7A 1QR7A 2O9RA 3QZEA 2ISVA 3CAWA 3TTEA 4U5IA 3AFBA 3UXKA 3EDJA 4JTIA 4AXNA 1JCJA 3AISA 5I2UA 1GOQA 3VVGA 4OWGA 3VNIA 4HA1A 3PPCA 4MGGA 2VGIA 2C1HA 5H8PA 1LQAA 3PBUA 3NEHA 3CTTA 1I8JA 4LBUA 2PLJA 3WJWA 4CQDA 1WBHA 4WY0F 3UXLA 3PZNA 2B31A 5EA9A 1MFUA 5FI8A 3RK8A 4A3RA 1XINA 3HBLA 4FP1A 2GUUA 2HV5A 3SRDA 4JHOA 4E2OA 4MWAE 1UUOA 2PTYA 2W0UA 1UKTA 1J79A 1Y0EA 1UZDA 1MI3A 1Z89A 5DX7A 4H83A 3N9SA 3EDKA 3UWUA 3N4EA 5BNKA 1UMLA 1W31A 2GDQA 2WZEA 2E1WA 3CEPA 3U5UA 3URAA 3OZOA 4JIRA 1OJXA 3NA8A 3DOPA 4N9CA 4IXXA 3PBYA 4KEZA 2BP1A 3UVAA 3H70A 3KTXA 3WBAA 4GGBA 2GGGA 4Q4RA 1XLAA 1GORA 4DUVA 3WMBA 2AQOA 1L8NA 5E9XA 3V0TA 3GU9A 4F0MA 1MEHA 4MIMA 1E0XA 3O9NA 2B81A 1RY8A 1Z42A 2FZBA 1IT8A 3H8AA 3LM7A 4HPGA 3HO8A 2NZLA 3T2PA 2VCAA 2XFFA 1BTMA 4F2BA 1M7JA 4NZ4A 2W67A 3QN3A 1DXFA 3P14A 1OGSA 4RDYA 3POCA 3G6LA 2HS8A 3SY5A 1L6GA 3CL7A 2YYUA 4A8RA 3VIGA 3LHVA 1XSJA 4ZEPA 1KGXA 2Z27A 2VRKA 5HXMA 5E70A 1ITQA 4W4QA 2Q6ZA 3ONBA 1JZ3A 2BODX 4KF1A 3TW7A 3BOFA 2CNCA 3FHAA 1W9BM 3OYZA 3DFPA 4JDBA 4UB9A 3VKJA 4PBGA 1W9PA 3VCCA 2DZPA 1X1OA 2H8ZA 2EHHA 4Q8NA 5DMNA 1YDNA 1OGGA 4TVCA 4FX8A 3QGAC 4FIRA 3TOYA 1Y65A 4MJ2A 1TELA 3WNNA 5CPLA 1HKWA 1Z69A 3KXQA 3UZJA 4N9DA 4BWLA 5CJNA 4EXQA 1XG3A 3W38A 3GM8A 2YXGA 1IXNA 3BW2A 9CGTA 4HN8A 4IGHA 1LBFA 4LPCA 1RUSA 4LANA 3UZZA 4EAYA 1FY6A 4TIMA 3ARWA 3WD2A 2O4MA 1HIZA 4HNCA 1E0UA 1UP2A 1JPHA 3QTPA 2X1UA 3CASA 3NWRA 4MUPA 4AG0A 3QYSA 2Z1XA 2Z2AA 3AXKA 5D04C 2FPVA 1YE6A 1QRQA 1GOXA 3COTA 1U5VA 2I16A 3DENA 3SJNA 3RO6A 4NHVA 3H53A 3W28A 3UJFA 2UZ9A 3DERA 2XN1A 2EF9A 2YDAA 4PBFA 1FWGC 3V1HA 1R30A 1XCXA 3WQDA 1EXPA 2YXOA 4XAZA 4RJEA 4TVUA 4DQWA 1EC8A 5E0FA 4CKQA 2EPHA 4L4MA 3L4UA 3W88A 5K2ZA 3DGRA 3HM7A 4R34A 3SY8A 3UG5A 3M46A 2VCBA 3G1RA 5H8UA 1HKJA 4DI9A 1JDEA 1OY0A 4XSLA 4Y6GA 3QW4B 1DHPA 5AC4A 2G4FA 2OYMA 3IJ9A 3RN6A 2DZBA 4M3PA 1B30A 3U48A 5CG0A 1C9DA 1XLFA 4E2VA 3F4CA 3TXZA 1WUFA 3F5LA 3TQ0A 5A8QA 1TTQA 2QPXA 3VKBA 2PUZA 3R2GA 4AAJA 2PZNA 1V77A 5A95A 1N8WA 2HROA 2NV1A 3UQNA 3XINA 2WJDA 2YCLB 4W7VA 1E55A 1XC6A 1W1VA 3NSNA 5AVNA 2DZTA 4Q4QA 1XH0A 3AS2A 8CGTA 3C3UA 2V8ZA 4JCLA 4H7CA 5HJLA 3RLUA 1R2RA 1U83A 4UNLA 1X97A 3UXDA 3WMSA 2OOGA 2XPKA 3A3HA 2E5CA 4DJDC 3JS3A 2G96A 2BDQA 4LU0A 1ESWA 4DM1A 2AMGA 4DAIA 5IOBA 4LYQA 1E6SM 3DAQA 4IIGA 3VIFA 3WBYA 4AY8A 2ZZ1A 4J28A 3T4WA 1W3LA 4L6OA 1W37A 4M5PA 3GVVA 4KT2A 3UETA 4CEUC 1A4LA 4Y9OA 4LVDA 1K8XA 3OBAA 5LHFA 4JFUA 2EG7A 3RCNA 4OJYA 5EMMA 4JL2A 5DELA 2PDJA 3SFWA 2ICSA 2R1LA 3B03A 2ZRXA 5KZDA 1TV4A 1MUCA 1W3JA 3NQ6A 3W02A 1GT8A 4R7OA 2R1MA 1HVXA 4HCDA 2V0TA 1TTIA 4QEEA 5M17A 1P0NA 3B0VC 1Q45A 2VWSA 3CIVA 1M1BA 1EOKA 4PR4A 3ARUA 4Y2WA 3REQB 4TXEA 1QPQA 4JTEA 6REQB 3HQOA 5LIKX 4PMRA 3V0UA 4Z2HA 2E1DA 2ZUWA 1NFBA 2DT1A 3G1VA 3SSJA 1KRCC 5D2VA 1J10A 2I5QA 5BOOA 3F5KA 5AYYA 2NXHA 4GXWA 1P6CA