4BK9A

Crystal structure of 2-keto-3-deoxy-6-phospho-gluconate aldolase from zymomonas mobilis atcc 29191
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
207
structure length
207
Chain Sequence
b'RDIDSVMRLAPVMPVLVIEDIADAKPIAEALVAGGLNVLEVTLRTPCALEAIKIMKEVPGAVVGAGTVLNAKMLDQAQEAGCEFFVSPGLTADLGKHAVAQKAALLPGVANAADVMLGLDLGLDRFKFFPAENIGGLPALKSMASVFRQVRFCPTGGITPASAPKYLENPSILCVGGSWVVPAGKPDVAKITALAKEASAFKRAAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-HYDROXY-2-OXO G
publication title Crystal Structure of 2-Keto-3-Deoxy-6-Phospho- Gluconate Aldolase from Zymomonas Mobilis
rcsb
source organism Zymomonas mobilis
molecule tags Lyase
total genus 65
structure length 207
sequence length 207
chains with identical sequence B, C
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2013-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4bk9A00
3E96A 3HOJA 1SFJA 5HR6A 1F5ZA 4LWWA 1ICPA 5DY3A 2Y7DA 2GVLA 1NF0A 2HS8A 2VEIA 2G97A 1GVQA 5CPNA 3GNDA 3NGJA 2AAMA 3DFOA 2Y6ZA 3LBCA 3MI2A 3TE9A 5C2XA 3T4CA 2CWNA 1N55A 5EMUA 3LI1A 3EWWA 1L2UA 3CC1A 1JRBA 1TTQA 3CT7A 3BV4A 4ALDA 3TA6A 1FDYA 1LP6A 4EF9A 4LVGA 1KBJA 4JTHA 3W7LA 3KFTA 3W2UA 3KRSA 4DF0A 4QNEA 3VFLA 3STFA 1KM5A 1THFD 3S42A 4UTWC 1KV8A 2QCNA 4OHQA 4RXFA 5LNRA 2J6XA 3L0GA 3GDMA 1KM4A 2NWSA 4KWWA 5H91A 2E6DA 4TO8A 4JD4A 3VE9A 5A8GA 1P4CA 3EEGA 1L6SA 4Z1CA 3TUUA 1PIIA 1I2PA 1M7PA 2FLIA 1MEHA 1MEWA 4AXKA 3IGSA 3C2FA 1EA0A 5K3VA 1VS1A 4HPXA 1SZEA 3R8RA 4JYDA 5KMYA 4RZ4A 3TDFA 1LLWA 3MHFA 4K7YA 1YYAA 3PG8A 4MVAA 2QUUA 5HUOA 3TU9A 5U4NA 1ZAIA 3I68A 3DFNA 5D2VA 4FB7A 2FDSA 1W3TA 5AHIA 1TJPA 2GQ8A 1H1ZA 1ZAJA 1F6KA 2CZDA 5TIMA 4NZFA 1A50A 1EP2A 4XUGA 5F2MA 3QJAA 3W74A 3NPXA 3LHWA 4RCXA 3GDRA 3W85A 4UFIA 3CLMA 1KV5A 2CLIA 4UFMA 1Q6OA 2FB3A 4QM1A 2VFFA 2QF7A 2VEPA 1SSGA 4Q32A 3MW7A 5G4WA 2PURA 1QPOA 4QITA 2ZBTA 3DI1A 4JS3A 3WK0A 3EWBX 3ZR4A 1X7FA 3G1DA 4GUIA 4LVDA 3OEXA 1F6PA 4K38A 5IBXC 3G1YA 3IVTA 4KFPA 2QCDB 3FJLA 2RDTA 1ZJIA 2Y7EA 2YDAA 2ZA3A 2O7QA 3HGSA 4Z1DA 1K7EA 3THAA 3NQCA 3TFCA 5DELA 4O28A 4O4VA 3WJXA 2PRHA 4K36A 4R53A 3THQA 2CLOA 2GVGA 5LHEA 5I3FA 1ME8A 3W84A 3C56A 1PL9A 4BFAA 1TQXA 2C13A 1PCKA 3WK2A 1XL9A 4IPIA 4PEKA 3IIPA 4MY8A 4UFKA 3CTLA 2CLLA 4RZ6A 4C1KA 3LERA 1P5BA 1TJRA 2TSYA 4B5NA 4DF2A 3IRDA 1HL2A 2Y7GA 4JYFA 1G67A 3TSBA 1YDVA 5K4XA 2B7QA 3P62A 4GFSA 1FDZA 3AJXA 3L2IA 3LX9A 3MI6A 5F1VA 4N4PA 3NAVA 5AHMA 1H5YA 4QAIA 4Q4KA 3LB0A 3PULA 2RDWA 2P0OA 1OX6A 1RPXA 1UB3A 3G1SA 4RZ5A 3C6CA 2GJNA 2C6QA 2DZXA 1LRNA 3W3OA 2W0UA 1B9BA 3HG4A 3P82A 1XKYA 3E02A 5LKYA 2JKPA 2C16A 1UCWA 1SW3A 1NSJA 1GYLA 1TPC1 2Y88A 2Y85A 3HPSA 1UJPA 3M5XA 3MWAA 2NX3A 3LDVA 3LRLA 3TW7A 1WYIA 1KFBA 3C2OA 3NM1A 2CU0A 1FXQA 4O1BA 2YYUA 4WX2A 2F84A 1WBJA 1JUKA 1OYCA 2JK2A 5KZEA 4UTMA 5KZDA 4AMAA 3TQKA 4O50A 3B8DA 1LBFA 1XXXA 1YADA 4LOCA 4CQAA 3P81A 4CQ9A 2OZ0A 2DZTA 4UNLA 1PE1A 4O54A 4XTDA 3W2NA 1J2WA 2NX1A 2ZQ0A 3SGZA 1TMHA 1IXQA 1OHLA 4OWGA 3PY2A 4LV4A 4LW7A 4GXMA 1ICQA 4IJBA 3WK1A 1OYAA 4LS2A 4U28A 2A7NA 2XN1A 1UASA 2Q8LA 1I2RA 3P8IA 3W72A 1TCDA 1QMLA 3W9ZA 1W0MA 2KZHA 3QC3A 2WSQA 2WQPA 1AG1O 3LBMA 3PAJA 4KWVA 3LHVA 2C19A 3I7QA 1FWTA 1B4EA 2ZZ6A 1H7RA 3TX9A 2EKCA 3RNDA 4UMAA 2QUVA 3N73A 4JDYA 4O16A 5KITA 3DGRA 1O5KA 2Q3OA 1VHCA 3GAKA 4IMDA 1G4SA 3GVGA 2OMAA 3V1PA 2EF9A 2WV8A 1V5XA 4A22A 2QDHA 4O4WA 1SZNA 1TPVA 2ZDRA 3LHZA 4MOZA 3STEA 4H4IA 2DZPA 2ZYFA 5K9XA 4LNYA 3DFPA 3P67A 3BW3A 2DZWA 4IX0A 4MIMA 1EPXA 3G0UA 3OA3A 2ATSA 2D73A 2E68A 3PB0A 2VEKA 1I45A 3LV6A 1GVOA 3JRKA 2RH9A 2E09A 4BWLA 1H7XA 3L67A 4DPPA 3D0CA 1SQ7A 4PFMA 1GVRA 2YSWA 4JICA 2I1OA 1TPWA 3LLFA 4UR8A 1EP3A 3HQ1A 5CZ0A 1L6YA 1EWDA 5D04C 2YYTA 1VLWA 5FF7A 1IIGA 4AH7A 1ME7A 2YGYA 4Y8FA 2CW6A 1KA9F 1W5MA 5C5YA 3BG5A 3CHVA 4JTKA 3I6RA 2UV8G 3RLVA 1CX9A 3DZ1A 4IXXA 3TCEA 2RHGA 4DQWA 4CCEA 1YXYA 4BF9A 1L9WA 1MEIA 3FIGA 4JDBA 3KVMA 1W1ZA 2QCCA 4LT9A 3GR8A 1XUUA 3F03K 3ABRA 4LS1A 1YXDA 4AAJA 4RLIA 5U7SA 3O16A 2AQWA 1D3GA 2FFCA 3L66A 3QPZA 1C9DA 1A5BA 1QPNA 3TV8A 2OX1A 5I3HA 3IIXA 4NX0A 3B06A 3EB2A 3SW6A 3UWUA 3W6YA 3NQDA 4XKYB 4WY0A 1NVMA 3F1QA 3SI9A 3TAKA 4A2SA 5LNSA 3FKKA 3U8GA 4XBSA 3PM6A 2ZZ4A 3LRMA 1XDLA 4K8HA 1GVSA 3C61A 3DKJA 4UTWA 4ZQOA 4QJ1A 3W2JA 1HO1A 1W5OA 1KFJA 2JKEA 3TC6A 5J5DA 4BI5A 3W7GA 2CLKA 2GJLA 1TO3A 3FJ6A 2C0AA 1WA3A 4MYXA 3C2EA 3MP5A 4MZYA 3NPVA 5H2ZA 5AYYA 4OV4A 4AF0B 1T0OA 2X1SA 4CLMA 1H1YA 2V2CA 3G0SA 4YLWA 3VCRA 1XC4A 3FLUA 3EXTA 3LHTA 3PUDA 1SW0A 3CEUA 3B04A 1ZENA 4HHPA 4WY0F 4ZZ9A 3W86A 1KTCA 4YMZA 1OFPA 2NLIA 3W1LA 3VNDA 1OFQA 2PRLA 1WXJA 4MPQA 4NNBA 3A24A 3GXTA 2NV2A 1KLZA 1OFOA 2TRSA 2DZUA 4UTTC 1W31A 3W2MA 1ZCOA 4MFEA 3LM7A 5F2IA 3HG2A 5D02A 3G18A 3NQ8A 4DO4A 5ABTA 3T40A 4BR1A 1GYNA 3EX3A 2V8ZA 3CEPA 4PC8A 1EX5A 3L65A 3QSTA 1G7UA 3NQMA 2J27A 3RMJA 5FEPA 1ME9A 4UTIA 4ZVJA 3G8EA 5BMWA 2FJKA 5IBXA 1JJKA 3S9YA 4MY1A 3LRKA 5C6MA 3HBLA 4LVBA 4GUGA 4FNPA 2ZZ5A 1FBAA 3VE7A 2B7NA 4LU0A 4RK8A 1H60A 3KX6A 3L0KA 3U2OA 2H3BA 1Q3NA 4WD0A 1F05A 6TIMA 4JGDA 2G5WA 3A5VA 1SO5A 3WJSA 2ZRXA 1ONRA 1BKSA 5D05A 1W5QA 3HG3A 4GUJA 1WAUA 1H7WA 5EKYA 2G96A 3FEMA 2I9EA 1OF6A 3LXCA 1GJPA 2BXVA 5HQEA 2C14A 2ZRZA 2QCLA 3EX4A 1DJQA 4NZJA 2ZA2A 3OHIA 1W54A 4O19A 3BG9A 1JCXA 5E1QA 3PS7A 3SZ8A 4NT0A 4XQ6A 2E5DA 3P60A 1OFDA 2E77A 3HJZA 3NL5A 4YWIA 1R2TA 3CIXA 5G2IA 3NM3A 4O11A 4A21A 4AEOA 2NUWA 4UMCA 2WNQA 4CNNA 3PR2A 2TYSA 3L21A 1I2QA 3P7YA 1FWNA 4NQ1A 3ZWSA 2CLMA 4UCGA 3W07A 3GIYA 4M7TA 4M5PA 4A29A 3F4WA 1H50A 5G1TA 2VFEA 2BLEA 1SU5A 3C2VA 2XN2A 2ZTKA 1WV2A 3M16A 3NL6A 4O8RA 4JN6A 1Y0EA 1PV8A 4LUIA 1W8SA 1VQTA 2Z2UA 3VKJA 1W56A 4O1AA 2DJLA 1S5WA 4GC4A 3G8RA 1JCLA 1IXOA 3M7WA 5FF2A 1SW7A 3TC7A 4I7WA 1W3IA 4ZQRA 1VGAA 4IX2A 4LTSA 4MJMA 4FO4A 3G1XA 2FPYA 4HSOA 2CLFA 4FIQA 2VKZG 4WXYA 4KFOA 5I3JA 3BLIA 1XDMA 3IIZA 2WO5A 1TRDA 3NOEA 1WBHA 2FTPA 4ZL1A 1K8XA 4UXDA 4ZQNA 1LDCA 5G2WA 3GX9A 4NX5A 4DO6A 5KSWA 1PVNA 2BSLA 1TPFA 4UTUA 3EKLA 2YW3A 3HB9A 2V9DA 5CSSA 1T99A 4X2RA 1TTJA 3I7SA 3H54A 1QWGA 3C52A 2ZRVA 1G6CA 1JCMP 4Y6GA 4FNSA 2ZA1A 1OABA 3W7IA 4QNWA 2VFGA 3LCFA 3NPUA 4PTNA 3NVTA 2E6FA 3M5VA 1S5VA 3PBWA 1HG3A 3W1AA 3TKFA 3INPA 3H53A 3LCHA 4EIVA 2A7PA 4GUFA 2DZSA 5F4XA 1HTIA 5AC8A 1M6JA 2QCFA 3P8JA 1RQBA 2NXGA 2JGYA 2NUYA 1LRQA 2C1HA 4WJEA 2A4AA 4LC8A 4RV8A 4BK9A 3BLEA 1TIMA 4FX6M 3B05A 1XUZA 2Y70A 1MXSA 1VJIA 3QPYA 4POCA 2QCEA 4TX9A 1RR2A 1ADOA 5MHBA 1F73A 4J9JA 1RQHA 4EVZA 3QMTA 4S2CA 1FX6A 3M9YA 1JQXA 4ONVA 3W7RA 2FB2A 1QPRA 2QCDA 3DFSA 4LVAA 4DXVA 3P5YA 4JTGA 3R2GA 5TBOA 1KFCA 4WOQA 2B4GA 2QAPA 3DI0A 3GR7A 2VOMA 4PL1A 3NYZA 3QQ0A 5T26A 3TQVA 4OE7A 1TPDA 1MO0A 3GKFA 3NQEA 5DXYA 3UD6A 4AWTA 3DHDA 2IQTA 2ZTJA 3S5NA 3MHUA 1GT8A 3NL2A 1D3HA 2JBMA 2EHHA 4LUJA 3GDTA 4H6KA 4UTLA 4YCPA 1VYPX 4JX6A 3TIMA 3ZS4A 5G5IA 4HNTA 4IOTA 4JTEA 4CQ8A 1TV7A 4ZQMA 1R46A 4O18A 2A7RA 3CWOX 2R94A 1AMKA 3BK0A 1WDWA 3TMQA 1Q6QA 4N9DA 1OYBA 1Z44A 5KZMA 3P80A 3PVFA 2NWRA 4FX8A 4UTJA 3TNOA 1X8FA 4GWEA 3BLFA 1AL7A 2TPSA 1BWLA 1OK4A 3S1WA 1N8FA 1LCOA 1SUXA 2VFDA 3EWXA 5D2TA 3PBYA 4JTUA 1VCGA 4OQVA 3R5EA 3B4UA 3G3MA 1U5JA 2WSRA 1JR1A 1XM3A 3SJ3A 3L5AA 3SFKA 2V81A 2OJPA 2H3DA 4LVFA 4LS0A 1R30A 4AB4A 1KTBA 2B7PA 3T7VA 5C55A 2QEZA 3NXFA 3PB2A 1Z42A 2E1DA 2WOQA 4G1KA 1DJNA 3Q94A 5DBTA 2NX9A 3HGRA 4L4MA 3DXIA 3E0IA 1TTIA 3LXAA 3C8FA 3UXAA 4HNUA 5HULA 2ZCGA 3LCWA 1TTPA 2X30A 2C18A 4IMCA 4N02A 3MP3A 1FDJA 3QRHA 5CG7A 4WQ6A 4E0CA 2FPTA 3S5OA 3USBA 3GDLA 4BI7A 1J4EA 1DQXA 5IM51 1DBTA 4RX0A 1BWKA 2ISWA 4HN4A 2YR1A 4O14A 3W1TA 1DVJA 3B0PA 3OVRA 1GEQA 2RKXA 2XN0A 4WUIA 3PC0A 3M5ZA 3U6WA 4S2BA 4FNQA 3LCIA 4UTTA 2PCQA 2GPTA 4M6VA 2ZZ2A 3MP4A 4ADTA 5E0KA 3O06A 4NVTA 4NNAA 2OT0A 3FOKA 3ABQA 2QDGA 1I8JA 3SY5A 2BWGA 2F7FA 4TIMA 3ZWTA 2ATMA 3UPBA 3LLDA 3GYEA 1Q45A 5J5RA 3DU0A 2PE4A 4HKPA 3L0NA 1QR7A 3YPIA 1B57A 1KW1A 1FCQA 2ABBA 1OJXA 2Q3RA 3LI0A 3HG5A 1GWJA 3CPRA 1A5AA 2FQIA 1H51A 4IMGA 4JTIA 5K9DA 3IIVA 4CNOA 3R89A 3W2LA 4H3DA 1VC4A 2B7OA 3I65A 1AL8A 3MYPA 3RLUA 4LV9A 3UZJA 3JS3A 3QMSA 2NXIA 5SWUA 4MFDA 1W37A 2WJZA 3CB8A 5AHLA 1LOLA 3SECA 1TRIA 4RR4A 3B0UX 1C29A 4FHAA 3W7HA 3V75A 4O12A 1FXPA 1NAL1 1JQVA 3QF0A 5AHEA 4N4QA 1M7OA 3KAOA 2Z1BA 4Z0SA 2Y61A 4U4MA 1KM6A 3W1RA 3W7NA 3W88A 1IF2A 1AW5A 2YFOA 4M6QA 4EF8A 4LRSA 1EUAA 1UUOA 2DJXA 2YPIA 5D37A 5EY5A 4Z1AA 1S5TA 5F1UA 3TROA 3O07A 2ZRUA 2J9ZA 1Q6LA 1MSSA 3S5YA 4MZ1A 3OIXA 5CPLA 5FEXA 3KRUA 3VI2A 4FXSA 4UFLA 4AHQA 4GRSA 1PHWA 2Y63A 2CLEA 5L9FA 1GVFA 1XFBA 4OGZA 2ZZ1A 3M5YA 3W71A 3STCA 2V30A 3TXVA 4D2JA 3IEBA 1IXPA 4WOZA 1TV5A 2W6RA 2A6NA 3LOTA 1ZNNA 5F2LA 5CZTA 4UTKA 5D33A 1S3HA 4XKYA 1WX0A 4PCFA 4ADUA 2W79A 4GBUA 2WPBA 4NUWA 3P74A 1G7VA 4LC6A 4QIUA 3O6YX 5EYWA 4JIQA 3UPWA 3W7KA 2YW4A 3NQAA 4YCOA 5FI8A 3W7EA 2B0MA 3Q2DA 4JTLA 2G95A 4HT3A 3IV3A 1TB3A 3N2MA 3KVKA 3LHYA 5TQLA 3NNTA 2GOUA 3DAQA 4HNNA 4O0KA 1O60A 1SPQA 1EIXA 3M44A 1HO4A 4GNJA 5D38A 3P5ZA 1K03A 4JX5A 2H8XA 5KTLA 1TPEA 4JTTA 1KM2A 4AF0A 3DFTA 2H6RA 3G3DA 4QISA 4MY9A 1QPQA 3UWZA 5D30A 4N9CA 3W73A 1JVNA 3L5LA 1HUVA 2VELA 3LCXA 3HMJG 4MUZA 1K8ZA 4FNTA 3EX6A 2NV1A 3BARA 3Q37A 4O15A 4QSHA 4ZQPA 3UWVA 2EPHA 3HPZA 3ATZA 3NZRA 3E12A 3QEZA 1FUYA 3W22A 3UY7A 1ZALA 3QQ1A 4M6PA 4UFJA 5AHFA 4Y9AA 5A5WA 3KHJA 2XFWA 1VR6A 3S8HA 5I3IA 1J5TA 2QJGA 3G24A 1DV7A 5K2ZA 3OG3A 2DZVA 5LNWA 1A5CA 1SO3A 3UQNA 3TR2A 4UUIA 3M1ZA 3GXPA 5AYXA 3G22A 3W7JA 4IQLA 1LRTA 1DQWA 1SSDA 3UY8A 1O94A 1HFBA 1QOPA 1TPUA 3HPXA 2A6LA 2VFIA 4O13A 4HSNA 3A23A 3EX2A 3KVLA 3O6CA 2GVJA 1EEPA 2C3ZA 1GG1A 2A85A 5AB3A 1P0NA 4JYEA 1VCFA 2X1RA 4ADSA 1VPXA 1RQEA 1CI1A 3NQVA 4Z08A 1R2SA 1TPB1 3QW3A 4WZHA 5D2YA 2I14A 3UNDA 4O1CA 2CZ5A 1FCBA 5K9CA 1WOAA 1KLYA 1XBXA 1ZFJA 1CW2A 1OFEA 2ZFAA 3HGJA 3W7QA 5LGZA 2VC6A 1QDSA 1RV8A 3M47A 3NEVA 3S1UA 4BWLC 3MHGA 3EXSA 3C2RA 1KM1A 3NZ1A 1GTEA 1LBLA 3IGUA 1K02A 1JULA 4K6AA 1A5SA 1IIHA 3O05A 4GE8A 1DKWA 2FPVA 3T55A 4DO5A 1K3UA 3GAYA 3SSJA 3M41A 4IUOA 3EKZA 3TSDA 4JY9A 3W76A 3A22A 3L68A 5D2XA 1W5NA 1TYGA 4IWWA 1VYSX 3E9AA 2BZNA 1OVDA 1TQJA 3P61A 4BI6A 3QW4B 1VH7A 3B03A 2Q8ZA 1ML1A 1YTEA 3RU6A 3DKLA 3ELFA 3N9RA 5HR7A 3S6DA 4DEFA 4HPJA 2CLHA 4O52A 2J88A 4OU1A 1JCYA 3S5ZA 2RDUA 5FF3A 3T78A 1UBSA 1K7FA 2V5LA 3WJWA 3LHUA 4Y96A 3WK3A 4NJHA 4NJIA 1YTKA 2J9YA 3GXNA 3C3NA 3CM4A 2WKJA 3PWAA 4I7VA 1GPWA 4NXSA 3C4UA 3T44A 4FXRA 3TSMA 1TPH1 1G4PA 1I4NA 1LORA 3DENA 4FX7A 1JCJA 4OT7A 5K7JA 2JGQA 3G1FA 3KOFA 1JUEA 3W7OA 3N19B 3MJYA 3BO9A 4MJZA 5L6UA 4EOUA 3OBKA 3GKAA 3O63A 3QM3A 1LROA 3UWWA 1QAPA 1TSIA 3DH7A 4R33A 3W1NA 4PODA 3W7PA 4N6EA 1WOBA 7TIMA 4NJGA 4UIOA 4NNCA 1O95A 3MBDA 3W7MA 4C1LA 5LZLA 2V5BA 3LGEA 4XWUA 5LSMA 3LV5A 1YLVA 4FIRA 4MYAA 4DBEA 1DL3A 1PHQA 4TU1A 1H7NA 3S0CA 5CPOA 1VRDA 4AWUA 3N14A 4GUHA 1AW2A 3MYOA 2HMCA 4LRTA 3N34A 1LZOA 2V0TA 2YCEA 3DHFA 4FF7A 4OBTA 4YXGA 1W5PA 1GTHA 3M6YA 4RXGA 1JCNA 3M43A 4XZ9A 5HNRA 4O57A 1YTDA 3EWYA 1SO6A 2V2HA 4E38A 5G1YA 5DY2A 1UUMA 4AHOA 6ALDA 1YPIA 3NQ6A 5LNVA 4KKXA 3GDKA 3OVPA 3O8AA 1FCUA 1LYXA 3W83A 2QCHA 3N9SA 4NU7A 5BW6A 1H63A 1QCWA 3UYCA 2BX7A 5K4ZA 2LLEA 3TFXA 3UZ5A 4UTHA 5LGXA 2YFNA 1TV8A 5DCEA 2QUTA 2QCGA 4UMBA 3L9CA 1N7KA 1Q6RA 4XBKA 4R7JA 4DPQA 1JRCA 2Z6JA 3UWQA 2ZZ7A 3RF9A 3FKRA 3BPWA 2O7SA 5AC6A 3W75A 4MLRA 3ZFHA 1NF7A 4K37A 4K39A 4TR9A 4IGHA 3KRZA 3OVQA 2VEMA 2WNZA 3ABOA 5FESA 1Z48A 3NQ2A 4CCCA 5KINA 3PUOA 4UNKA 3QH2A 5HJLA 2OT1A 3WFAA 8TIMA 4JX4A 5DCDA 3A5FA 1PCWA 4QQ3A 1O4UA 3BW4A 4K7VA 1U83A 3TJXA 5AHNA 3W1PA 2ALDA 1I2OA 1LOSA 1G69A 1VCVA 4ML9A 2ZZ3A 4WXZA 2P10A 5I3KA 3TAOA 1K8YA 3NR0A 2R8WA 5D32A 3HF3A 3LCGA 1VLIA 3W70A 3O15A 4P2VA 2A1YA 3PSWA 1FWSA 5EPDA 3LXBA 3BW2A 4AWSA 1QO2A 1FWWA 3HIJA 4P61A 3W2KA 2DP3A 2R91A 3WJYA 1PS9A 3G1HA 3NQ7A 5G2HA 1IXNA 3QFEA 2A21A 3JR2A 3PBVA 1O5XA 2ISSA 3TXZA 2X16A 2Z6IA 2ISVA 1IGSA 1XI3A 3R13A 3S1VA 4PH6A 1DHPA 3A21A 4E2DA 2Z0IA 5D2WA 3SR7A 1SR9A 1D9EA 3PG9A 3FA5A 2H8ZA 3FS2A 1TREA 5AFDA 3IGXA 1T96A 2E6AA 2X1TA 3TH6A 2J9XA 2AGKA 4FEZA 1QFEA 1W3NA 4S1FA 3FYOA 4NJJA 1P1XA 5FF4A 3PF3A 3MUXA 1LBMA 2NZLA 3C0JA 5AYZA 3NQGA 1LM1A 5AC7A 1NEYA 1P0KA 3FYPA 3LTPA 4X22A 1EB3A 1L6WA 4HIBA 1G4EA 1M5WA 3QMRA 5DBUA 2TMDA 3FFSA 4HNVA 3F4NA 1NFBA 2GQ9A 3I7RA 5CSRA 1XBVA 3EWUA 2YX0A 1LOQA 1OX5A 4NJKA 5LNUA 3H55A 5LHFA 1WQ5A 5E93A 4TMCA 5GVJA 3M0ZA 3EX1A 1F76A 1Z41A 4Y90A 3NL3A 1YPFA 2WNNA 3EXRA 3NO5A 1ZAHA 2Y62A 3W23A 5G4EA 2EAWA 1KFEA 3CWNA 3IVUA 4MLJA 2VFHA 5CZSA 3KXQA 3TJLA 1F7BA 2NXHA 3LTYA 1MZHA 4N9BA 1VHNA 2H90A 3N3MA 1BEUA 4JEQA 3GK0A 3G1AA 5CGQA 1ZY9A 1XBZA 2CZFA 1RZMA 5DXXA 1I2NA 4K8EA 4IMEA 1DORA 2YXGA 3L5MA 2DORA 4N6FA 3DBPA 1H61A 1GOXA 3NA8A 4LY8A 4M7SA 3KVJA 4CNPA 1QO5A 1R2RA 2HSAA 4AVFA 1OK6A 2A2IA 3MBFA 5BMXA 4N2YA 1GG0A 3SIZA 3SGUA 1LLZA 4A2RA 3IIOA 2JKAA 3MI3A 2YZRA 3PBUA 4JNMA 1GQNA 4E2BA 2C15A 1H7PA 3IVSA 1SZFA 4ORMA 4X9SA 4IPJA 4UC5A 2A5HA 3DFQA 3MMTA 1DOSA 3E49A 2PRMA 2QJHA 2HS6A 3HGOA 4TMBA 4AHPA 4O53A 5D03A 5EBUA 5F2GA 3G0XA 4DF1A 5I3GA 4X3ZA 3GZ3A 2V2DA 1BTMA 2CFFA 3RFAA 3W7CA 4Z0JA 1KFKA 4JTSA 3GLCA 1AW1A 2QKFA 2V82A 1VYRA 2QCMA 4MKNA 3TK7A 1XCFA 5BNKA 5EL1A 1KTNA 3NQFA 5DLCA 5HINA 4GJ1A 4ORIA 4FNUA 4L4LA 2ZRYA 4FNRA 3O6DA 3TQ0A 3GB6A 4UR7A 3R12A 5HUPA 3S1XA 3BVJA 4JTFA 3UXDA 5AOUA 4A3UA 4WY0B 3EWZA 5C54A 1F2JA 2P1FA 3W1UA 1GZGA 3K30A 2Y89A 4JR5A 2ABAA 1X1OA 5CPMA 1ICSA 4RKAA 1K7XA 4W9TA 3PSVA 3Q58A 4PA8A 3W1QA 2J24A 2HTMA 1AK5A 5FF0A 5FEZA 3TMLA 4ZMGA 1KFLA 1SFLA 3LTSA 2R14A 1SZGA 3PUEA 1FY6A 4DELA 1EWEA 1B3OA 4I9AA 3ANYA 3W7DA 1QNVA 3STGA 1YDNA 2VXNA 2RFGA 1ALDA 2ZRWA 3ABSA 5HWMA 4RJEA 1FWRA 5BOOA 2NUXA 2QAFA 5DN1A 2QJIA 1A53A 2DU2A 3QYQA 1YXCA 1OX4A 1X1ZA 2A0NA 3O1NA 3P84A 3HO8A 5FEWA 1G4TA 1FQ0A 5F4WA 1F74A 1H62A 4O0ZA 1OX4B 5HMSA 2OCZA 1FCVA 4O17A 5D09A 5DCBA 5BRBA 1OFBA 4ZQCA 1XBYA 2BTMA 5HWNA 4UFHA 1T8XA 2QR6A 5CKSA 4PL2A 3CU2A 3GNNA 4EWND 5AN7A 1JUBA 3BGJA 1OFRA 1LTDA 5HWJA 4O10A 4YL2A 1RD5A 1OF8A 4Z1BA 4M19A 1R47A 1QOQA 2WSYA 3MO7A 1KM0A 4MZ8A 3A9IA 3W1XA 4I7UA 4N9EA 1H7OA 1SO4A 5CZJA 4JTJA 3W87A 1OFAA 4JXCA 2X2GA 3BGGA 2PC4A 3QZEA 1ZHAA 4NXKA 3W1MA 5EA9A 3BG3A 3CQ0A 3RK8A 4CCDA 2EGZA 2GQAA 3B0VC 3WJZA 3ATYA 3G1VA 2E6YA 4XTIA 1EP1A 4O1DA 4ICNA 1KM3A 2VENA 1B4KA 4Q33A 1VZWA 1V7YA 2Y7FA 1OG0A 3N2XA 2GUUA 4JY8A 2CZEA 1YDOA 2E5BA 1RVGA 4IXHA 3LCLA 5F4SA 1KBIA 2X1UA 4KFNA 2FIQA 3NPWA 1EUNA 3CIWA 4JIPA 1X6UA 3UWYA 3TW6A 3AO0A 1E51A 4R34A 1C8VA 4IMFA 3NG3A 2E5CA 3NDOA 4DBDA 4OV9A 3QSRA
chains in the Genus database with same CATH superfamily
3B8WA 3WD3A 4QX4A 7TAAA 4QGCA 1O1HA 3GU1A 4LWWA 3WMLA 2Y7DA 2E25A 2VEIA 1AH0A 4KW2A 3TE9A 1UD6A 3TONA 5C2XA 2JEPA 1W9BM 5EMUA 3K46A 3WMBA 1JRBA 3FVDA 1KBJA 3W7LA 3AIQA 5BOFA 3KFTA 3W2UA 1CEOA 1K1DA 3KRSA 4G7EA 4FOJA 4QNEA 5BXSA 1THFD 1X38A 2SFPA 4JL2A 4DXXA 3VZZA 2J6XA 1JDAA 2NWSA 2J4GA 3V5OA 5C7HA 5LA0A 4MADA 5CAHA 4NZ4A 1P4CA 3EEGA 5DO8A 2AMGA 1R6WA 1M7PA 2W62A 1QASA 2DIJA 3HQOA 5A8PA 5C9WA 4EX4A 2NSOA 3XINA 5HNTA 1T6MA 3PZ9A 4ZTYA 4XG1A 1A49A 1NIUA 1TFVA 4MVAA 2D3NA 5HUOA 1V02A 1ZAIA 3I68A 1UR9A 4JTQA 5D2VA 4J28A 3LM3A 4FB7A 1NARA 1W3TA 4GMEA 5AHIA 1TJPA 4OOZA 1S2VA 1K9FA 1ZAJA 1F6KA 3VOJA 1A50A 3GTNA 3QJAA 2Y4SA 1W17A 1AJZA 4RCXA 3OOQA 5FA5A 3I3EA 3NSNA 1WNOA 4QM1A 3ARQA 2PDHA 2QF7A 4Z2KA 4L1GA 1SSGA 1UD3A 2PURA 1KXQA 3UG4A 4QITA 3VIFA 5TAOA 2ZBTA 3VO0A 3ITXA 3N9KA 2Y8VA 3EWBX 3WCZA 1E4NA 3CZ8A 4JIEA 4KFPA 4LYRA 1I0DA 3FJLA 3B8SA 5D9PA 4HGXA 1FHUA 3HGSA 4Z1DA 2NQZA 3THAA 4WDTA 1U30A 4GGBA 4O28A 3WJXA 3VOIA 5FCZA 1VPQA 3ARXA 4LAUA 3KM8A 3W84A 3BTNA 3C56A 1PL9A 2B81A 2C13A 4PUNA 1PCKA 3CZLA 4IPIA 2FYMA 4MY8A 3QR3A 3S5SA 1TUFA 2TSYA 4B5NA 5XINA 1MI3A 3AIVA 3TSBA 5K4XA 4YWSA 1GQKA 2B7QA 2VVNA 3P62A 2FGLA 3L2IA 1V0NA 3FSTA 3LX9A 1QBBA 3EOEA 4JPGA 4QAIA 4HNOA 1CYGA 1OX6A 1RPXA 2BVTA 1HP4A 1GORA 4Y8EA 3DG6A 3ES8A 4FA3A 4I6KA 4RZ5A 2DZXA 1XKJA 3MCOA 1BF6A 4O1FA 4IL2A 1KFWA 2W0UA 4AD5A 4GI8A 1NSJA 4J27A 4L6HA 4XBJA 2MANA 3M5XA 1A4LA 3CHCA 2VOTA 4D6CA 4HU3A 1PX4A 1WYIA 3MJMA 5M03A 4WX2A 1WBJA 2PDKA 4AZGA 1OYCA 1UZ1A 4U5KA 4F4RA 1FH8A 1XIJA 3WLIA 1HQTA 2HE5A 1NQKA 4CQ9A 4MHBA 5C2CA 2DZTA 2FZBA 3B0YA 4FLSA 4FPSA 3MWCA 3LMZA 1WDSA 4S3KA 4TOQA 4XTDA 2NX1A 3GFXA 1Y5VA 5E6ZA 4OWGA 3HPAA 4GXMA 4GQ0A 3WK1A 4MDPA 4CVUA 3S2JA 2CZVA 3SM0A 3W72A 4HU4A 1WDDA 1DJGA 4IPLA 3QC3A 5E9AA 4GZIA 3BQ5A 3K4AA 2A3LA 4KWVA 3N4AA 5DANA 1J11A 2OFJA 3LEPA 1FWTA 1B4EA 1H7RA 3RNDA 4YNGA 4UMAA 4B9YA 4H41A 3DGRA 2IKJA 4C6FA 2QNEA 1IR1A 2Q3OA 3GAKA 4PBEA 2XINA 3BOXA 2WV8A 4M82A 3MZNA 1V5XA 1JD7A 4LB4A 1QJWA 4O4WA 1E56A 1TPVA 2ZDRA 3STEA 4MOZA 2DZPA 2WKLA 4HOZA 3S2NA 1JXKA 1WPCA 4HMEA 1RALA 2I5GA 4H83A 1HJUA 2D73A 4JNYA 2D2JA 5BWAA 3LV6A 1UD2A 2RH9A 3WEMA 2E09A 1FFRA 2WMKA 4WHBA 4B90A 3D0CA 1SQ7A 1LLOA 2NVAA 4PFMA 1GVRA 1MUWA 2VURA 3ZJKA 3ZQ9A 1YBQB 1UWQA 3MCNA 4PUEA 3VGBA 1W9XA 2VQUA 4NHVA 5LA1A 5CZ0A 4TQTA 1E3XA 3DERA 5CEWA 1NP0A 1ZP4A 3RJXA 4UCFA 3WDIA 4UOZA 5H1WA 4L61A 3V7PA 3BG5A 3CHVA 1L6GA 3I6RA 2UV8G 1X6NA 3RLVA 1CX9A 4BJHA 1GQLA 3CASA 1IEQA 1YXYA 1MEIA 1W91A 2Z4GA 3LGDA 3OJGA 1C3FA 3K13A 4KQNA 3HQPA 3ABRA 1YXDA 4AAJA 3WF4A 3GTIA 3SN0A 4KIRA 3UU0A 3O16A 2AQWA 2Y5JA 2FFCA 2X0SA 2CNCA 2OSXA 3EB2A 5IFTA 3EDEA 4WY0A 1NVMA 3F1QA 1QNPA 3N2OA 1BGGA 3CAVA 1Q6EA 4XBSA 3BCDA 3UR8A 1MW0A 3P14A 2XVKA 4KMQA 1W5OA 4W8LA 4W7UA 1KFJA 4HYVA 2JKEA 2D2HA 3TC6A 4E3TA 1XLEA 4KWSA 3W7GA 1B5TA 3T0CA 1J0IA 4Q6JA 5IHRA 1S2CA 2OPJA 4QEEA 3MP5A 4NAFA 3NPVA 5AYYA 3SUUA 5I77A 3IJ9A 2ZIDA 4CEUC 1H1YA 2V2CA 3FLUA 2A3CA 3UYIA 1ZENA 1KTCA 4ZB2A 2WVVB 3IJIA 3WLJA 1WDQA 2PRLA 3KUMA 2XGZA 4MPQA 4NNBA 4KCTA 2WW5A 3WDQA 1PEZA 1OFOA 2TRSA 1H49A 1ZUAX 1XGDA 2DZUA 3H2FA 3WBYA 1S46A 1RHCA 3P93A 5D02A 5CH9A 3GIQA 4CKQA 1P7TA 4NYUA 2RGMA 1MXDA 3T40A 1QNRA 3CEPA 4Y9NA 2EKGA 3O2LA 3CZKA 3AS1A 5DEZA 5FJPA 1EIBA 3K4DA 3D3AA 3NOYA 3NUKA 2Z7KA 3G8EA 4WF7A 5IFPA 3UXIA 4OTKA 1J5SA 4MY1A 1EXPA 1WDRA 4D6JA 4FNPA 4XK2A 2CHOA 1FBAA 3VE7A 4EACA 3GHSA 2B7NA 2VRJA 3VGGA 1UR4A 2P3ZA 4LBSA 1Q3NA 2OQHA 4QDPA 3QV9A 3IWPA 3JZUA 4EXBA 1F3XA 4C6PA 4DJFC 2O9PA 1SO5A 3SRKA 3B3DA 2J7CA 3HG3A 2D0HA 1WAUA 3VX1A 3FEMA 4W84A 4W4QA 1CXFA 3K5XA 2ZRZA 1BRLA 4ROPA 2YLAA 3EX4A 3WLOA 1GOQA 4YTUA 4KH2A 1IEWA 4AFYA 1DJQA 1YHTA 3GXFA 3H8AA 2OG9A 4FOKA 5E1QA 4AIUA 2C7FA 3PS7A 2XM2A 1Q85A 1AH4A 3P60A 1OFDA 5ECUA 5E6YA 4UTFA 4YWIA 1R2TA 5BCAA 3VMPA 3NM3A 2J47A 2NUWA 1OADA 2XVPA 1IT8A 3ID7A 2HZGA 2G41A 3PR2A 1E0VA 4YHEA 4NZCA 3GNPA 4M5PA 1W2VA 2FVMA 2ISFA 4B3LA 4PTMA 3NL6A 3M16A 1VJSA 1PV8A 3AIBA 2R1KA 1VQTA 3VKJA 2DJLA 1S5WA 4X2PA 2EBNA 1D8CA 1SW7A 3TC7A 5HPCA 5A6SA 3VC5A 2FPYA 4JFWA 2CLFA 1S2UA 2DSUA 5I3JA 3BLIA 3IIZA 3NOEA 1WBHA 2FTPA 1GHRA 3R25A 3GX9A 1Z6KA 1POJA 3I6TA 1T99A 1TTJA 2Y8KA 1QWGA 3C52A 2ZRVA 2DIEA 4Y6GA 1EF3A 3F5LA 1UKTA 3PZOA 3LCFA 1XFCA 3LNMA 3NVTA 2QDDA 2E6FA 3PBWA 8RUCA 3SN1A 4FLOA 1SJCA 1A47A 3VD3A 3OYXA 4EIVA 2A7PA 5F4XA 1EDQA 4GNKB 2QCFA 2WBGA 2NXGA 2JGYA 2BXZA 1LRQA 1KRCC 4LC8A 4Q4QA 2DVUA 1XP3A 3QPYA 1FP8A 4TX9A 3DUGA 2VP8A 1RR2A 5MHBA 1CXLA 1XYBA 2CESA 5E0FA 5ENLA 1DJIA 3M9YA 3W7RA 2GWNA 2FB2A 1QPRA 3CO4A 4DXVA 3F2BA 1QI2A 1DWIM 4WOQA 4PMYA 2QAPA 3DI0A 3GH4A 4HK7A 4OE7A 1TPDA 3VINA 3W0KA 2MUCA 3DHDA 5FJOA 1GOKA 1GT8A 1D3HA 2PTXA 2JEQA 3ITCA 2DSZA 4XZWA 2QPXA 3VMNA 4JX6A 3CH9A 3ZS4A 5G5IA 3PJTA 4ZQMA 3RO8A 5H8PA 2FH8A 5ABEA 3BK0A 4N9DA 1Z44A 1B0IA 3PVFA 4FX8A 1X8FA 3HQNA 4NY2A 1AL7A 3BAXA 4JCMA 4IQJA 2VWTA 3OTRA 3S1WA 1N8FA 1LCOA 2VFDA 2Y5EA 3VVGA 1AODA 4DVOA 1NDYA 1XM3A 3NXLA 4DJEC 3SFKA 1YW1A 3NDZA 2V81A 4PMUA 2VGBA 1TWSA 3J7HA 4GIEA 2F38A 4LVFA 3F2CA 2ZXAA 2XH7A 1XG3A 2XVGA 5C55A 2UBPC 3NXFA 4E4FA 3A4WA 3DCPA 2WOQA 3E0IA 3UERA 1TTIA 4IFKA 4RE4A 3LCWA 2XPKA 3BL3A 4IMCA 2UWFA 3MP3A 5FJJA 2D2GA 4DHGA 3TJIA 4K3ZA 2FPTA 1AZ1A 3C86A 3GDLA 1J4EA 3KL3A 1DBTA 4IPNB 4ATWA 2PTWA 2ISWA 5LYRA 3B0PA 2HPMA 4WUIA 1V6WA 3KCOA 3WLHA 3PC0A 3M5ZA 1NJJA 1LJYA 4XO6A 4F40A 2GPTA 3MP4A 5E0KA 3GH7A 4EANA 4ZR8A 1I8JA 2BWGA 2F7FA 4TIMA 2PP1A 1Q63A 2PWGA 1QW8A 3LLDA 4GOAA 1U33A 2ACRA 1JNEA 4ERAA 1JPKA 3MZ2A 5B7ZA 5I7GA 3DU0A 1V6VA 4K8GA 4IG2B 2BVDA 3LI0A 3HG5A 4WCJA 3KS6A 1H51A 3PAOA 2G4FA 4W8BA 4JTIA 2E28A 4FXJA 4PCTA 4H3DA 1VC4A 1AL8A 2X1IA 4LV9A 2V63A 4WDUA 3SY8A 4YTRA 3AU6A 5A69A 1AJ2A 1W37A 3CB8A 3SECA 1TRIA 4B3KA 4FHAA 1EC7A 1TZZA 2O0TA 2XDFA 3I6EA 2VT0A 1JF6A 1NAL1 1JAEA 3KAOA 4Z0SA 3NQBA 3CYVA 3UCCA 1KM6A 3ONCA 3W7NA 3W27A 3NDYA 4EF8A 2Q6ZA 1REQB 2Y0FA 1EUAA 1AQMA 2ZWYA 2GJRA 4Z1AA 1JIBA 3TROA 3IJLA 2J9ZA 3TYBA 1V7AA 1DYSA 2DDXA 5CPLA 3VI2A 4FXSA 4UFLA 4ATLA 3VGEA 4BEUA 4AHQA 1PHWA 2CLEA 1P0EA 4AX7A 5L9FA 1FHVA 3PANA 4OGZA 3M5YA 3W71A 3URBA 1WUFA 2V30A 1XYCA 2GL5A 4FAMA 1IXPA 2PZNA 4R9XA 2DUZA 2A6NA 5E09A 3WH5A 1ZNNA 1WX0A 3MKKA 1JCTA 3P74A 1G7VA 1M65A 4O0QA 4C60A 4ZOEA 2YW4A 2POTA 2BGSA 4GBDA 5ABFA 3ITTA 4LYKA 3W7EA 4D72A 4XZLX 2G95A 3B8TA 3DECA 4B5WA 1K4HA 1YX1A 3BJFA 1ODUA 3RG6A 4O0KA 1SPQA 3P5ZA 2JIWA 3F5KA 4TVUA 2H8XA 2ZUSA 3W6MA 3CYJA 1KM2A 1QW7A 4QISA 1GVEA 4IPPA 5D30A 4DJED 4GCAA 1JVNA 2ACSA 1JPIA 2VELA 4MUZA 2WLZA 1R5YA 3EX6A 3BARA 4Q8PA 1VFMA 3PPHA 3EWDA 4JEJA 4JFTA 4ZQPA 4HQVA 3TN5A 3UWVA 3NZRA 4WRHA 3AHXA 1BYBA 1FUYA 4DUVA 4KETA 3UY7A 3VGHA 4UFJA 1VR6A 1VP5A 4XD4A 2VZUA 3ZIZA 2P5NA 2QJGA 3BGAA 3H6OA 1DWGM 1JL8A 3DEQA 1DV7A 2QV4A 3N1AA 4MWAA 4QBXA 3IRSA 4RUBA 2YB1A 5LNWA 3GVWA 5I02A 2AQVA 3AZSA 1TX0A 4FALA 1TZ9A 1AD4A 4S3CA 4IQLA 4EK7A 2HK1A 1DQWA 1SSDA 4KCUA 1C9WA 1RY0A 3H70A 1QOPA 3ITGA 1VFTA 1TPUA 2OO6A 5C9ZA 1J0HA 3EX2A 1EEPA 4GVGA 2BODX 3K4WA 4PSPA 5AB3A 1QRQA 1KD0A 1P0NA 3N2CA 3LPPA 4AU0A 1RQEA 3WLQA 2J7HA 1UIPA 3UNDA 4A8IA 2RDXA 3SCQA 1FCBA 3U7BA 5K9CA 3AXHA 3KS5A 3NEHA 1ZFJA 2DGAA 2Q71A 1LT7A 1XIFA 2XGIA 1ESWA 4ZFCA 2IQ0A 2HV5A 3NEVA 1J93A 1EHNA 3R94A 1VBJA 7REQB 2WLYA 1JPMA 3ZM8A 4HPGA 1JULA 4K6AA 4GE8A 4DO5A 1K3UA 4J7RA 2XJ7A 1TMQA 5F7UA 1E0TA 3TSDA 3EKZA 3E1F1 3A22A 2ZX5A 4XSMA 3PZUA 3WF3A 4NL1A 1E6QM 1XRFA 1TE1A 4F0LA 2QPUA 2Z2BA 7CGTA 1J0JA 3VOCA 2Q8ZA 1ML1A 3BQ6A 3WMSA 5H8UA 5HR7A 1R3RA 4DEFA 4HPJA 3QY8A 1JCYA 1G1YA 2RDUA 1UBSA 5LIYX 2V5LA 3A64A 4NJIA 4CNUA 3GXNA 1D7KA 3C3NA 3CM4A 3WLTA 1GPWA 3T44A 4FXRA 1G4PA 3DENA 1LORA 4FX7A 1JCJA 4EPBC 4MKVA 1LF1A 1QW9A 4AEEA 3N19B 3MJYA 1HKWA 1KB3A 4F9DA 4MJZA 1LROA 2E9LA 3REQB 4R33A 3RCYA 4OIFA 4UIOA 1FHLA 3Q67A 1M1BA 4NNCA 2Q02A 3MMWA 4LUYA 4KEVA 3DC8A 5LSMA 2OZ3A 4FIRA 4EAYA 3CZJA 1DIKA 3S0CA 1OG6A 5CPOA 2FMNA 1MDLA 3U57A 1AW2A 5FL0A 2DPEA 1RD6A 1E5NA 3WL0A 2HMCA 1LZOA 2V0TA 2YCEA 5BU6A 4OBTA 4H6QA 2G3IA 1GTHA 4RXGA 1KQYA 4XZ9A 5HNRA 1GJWA 4ZXLA 2CIPA 1A5KC 1CXEA 3DC0A 1SO6A 4E38A 4CD4A 1XRTA 2V68A 3KOZA 9RUBA 4TV6A 2Z27A 4U3AA 3TEVA 2V3DA 3S83A 5HMDA 3NQ6A 1W3KA 2AMXA 3BJSA 2D22A 3O8AA 1FCUA 1DJXA 1XIHA 2XM1A 1NWRA 3UYCA 3UZ5A 2VD8A 4UTHA 4DO7A 2QLYA 3H2EA 4MTVA 1IWBA 3R11A 4DPQA 1JRCA 1XD1A 2ZZ7A 3FKRA 3BPWA 4HD5A 6XIAA 3ZFHA 4F0KA 1NF7A 1XH1A 1UD4A 5I00A 4I90A 5GPRA 3KRZA 4FOUA 2WNZA 5BRPA 2E7FA 5KINA 4IICA 3QH2A 2ZICA 2CKSA 4LCQA 1VFSA 4R5EA 8TIMA 1RUSA 4H9UA 5DCDA 4QQ3A 1O4UA 4XD3A 2AQOA 4ZOCA 5AHNA 2HBVA 4C6IA 1BSLA 1LOSA 1G69A 2VX6A 3XISA 2E67A 4BQ2A 4LSBA 3WDPP 5HXMA 4ML9A 1ZBVA 5I3KA 1NDVA 3VMOA 2R8WA 2W4XA 5D32A 1V3KA 4PMXA 3LCGA 3MSRA 5A8NA 3O15A 2AKMA 3H4WA 1FWSA 1G94A 1F4HA 4LUSA 2WAGA 3DIPA 4B5XA 4HPHA 2DP3A 2R91A 3CUJA 4AVOA 1GPFA 1WXYA 1A5MC 3CAWA 3NQ7A 2DZAA 3T9PA 3A3WA 3QFEA 2GUBA 3JR2A 3PBVA 4A4AA 3CTTA 1TX2A 4TX6A 2PI6A 3TXZA 3E2SA 3ZVHB 4HJWA 3EOUA 4FLRA 3GM8A 2W27A 2Z0IA 3OZMA 4E8GA 3SR7A 1D9EA 3FA5A 3FS2A 1T96A 4QR6A 1D3CA 2YDSA 1J0KA 2AGKA 4FEZA 2PBOA 2IKIA 1Q65A 4C1NB 5FF4A 2REQA 4L1WA 3PF3A 4DZAA 1LBMA 2PWFA 3MUY1 4XX6A 3NQGA 1LM1A 3S9IA 1P0KA 3FYPA 4X22A 4H9ZA 3ARRA 4HIBA 1PZ1A 1E9ZB 1M5WA 1P0DA 3DOPA 5DBUA 2TMDA 1BTCA 4HNVA 1MYRA 4ZB5A 3DYOA 2O56A 3U5YA 3OZYA 3FJ4A 2GQ9A 2Z1WA 1DIDA 1LOQA 5A6TC 2Z1XA 5GVJA 3H7VA 5E9XA 3EX1A 3R58A 3SCTA 1TWWA 1NTHA 3QGVA 2D3LA 1UD8A 2Y62A 3CWNA 3ZVIA 1EHAA 1MZHA 3LZ5A 4N9BA 1JYXA 2ICSA 5CGQA 3G1AA 3SCRA 5A95A 2UY2A 3V0UA 5DXXA 3WUFA 4K8EA 1FWCC 4XD6A 2WZEA 4H2HA 4TVDA 4GIAA 1QNSA 3LGGA 3T6CA 3G5EA 3UJFA 4LY8A 1K4GA 5T9CE 3BZGA 3THUA 5BMXA 2W91A 1TJ1A 2GJPA 3ZXWA 4A2RA 3B9DA 3IIOA 1XF0A 2I9UA 4X0VA 3PP7A 3F4CA 4QG9A 3MMUA 3GDBA 4AVNA 3TWBA 3EMCA 4UC5A 3F4VA 1ECQA 5GJNA 3H2NA 2HS6A 4GPNA 1DPMA 2YA1A 3G0XA 2QGYA 3GZ3A 3R0KA 4X3ZA 1TVNA 3MV01 4Z0JA 4DZ5A 1KFKA 3V1HA 4MB4A 4WK9A 1AW1A 1AQ0A 1EH9A 1DE6A 1R7OA 2NVDA 4V15A 3TK7A 1PIFA 5BNKA 5EL1A 1RA0A 2Z26A 4J2MA 5DLCA 4AWEA 3LY0A 1XLFA 4L4LA 2E9MA 3B8IA 3RR4A 3GB6A 2FMOA 3V16A 3ECQA 4M1RA 4GI9A 3S1XA 1R85A 1AQFA 3BVJA 1J79A 3UXDA 5AOUA 3FK4A 3C0LA 2VHLA 3S6TA 1W32A 1XLHA 1GZGA 4PUWA 3K30A 2Y89A 3UWEA 1NP2A 4JQ1A 3MC5A 3VKBA 4NRRA 1ICSA 4W9TA 3PSVA 4WJXA 1XX1A 2BHUA 1FH9A 1LL6A 3VM7A 3TMLA 1ZBKA 1Z69A 4L80A 4DBUA 3LTSA 1E5JA 1FY6A 4DELA 4ASTA 2J66A 2VMFA 3B4YA 1XIEA 1QNVA 1VD6A 5IRPA 3OA5A 2PWUA 3WEOA 4ZO9A 5BOOA 1B3XA 1CGVA 3M0MA 5DN1A 6CGTA 1A53A 2I5QA 1OX4A 2GDUA 4WGXA 3HO8A 1FQ0A 1FWFC 4YU1A 5F4WA 1CCWB 4O0ZA 1OX4B 3WLRA 2OCZA 3FX4A 3KW3A 5D09A 3AIEA 5CBJA 1CXHA 1OFBA 1QXLA 4UFHA 3UCDA 3JZEA 3CUFA 4E4UA 1I0BA 4AD3A 4EWND 1EXBA 1W9PA 3BGJA 4U31A 1K8CA 5JQ9A 1F3EA 1NOWA 3COTA 4GKLA 2WHMA 1GKQA 1KM0A 4BHYA 1M03A 1H7OA 1SO4A 3TW9A 4G9PA 3W87A 3MVIA 3QZEA 3ARZA 2WZMA 4NXKA 3W1MA 2FKPA 4CCDA 3U5UA 1I75A 2J6VA 5E0CA 4PUMA 1EP1A 4XTIA 4KRTA 1TV2A 3GFYA 3N2XA 4ZO8A 5EU9A 1YDOA 1CLVA 4NG3A 1XICA 2EXOA 4HOWA 3CIWA 5CQ1A 1QWKA 3TW6A 3AO0A 2YKKA 4IMFA 1H2JA 2P88A 2E5CA 4DBDA 5LIKX 3E96A 4DZHA 3HOJA 1RXOB 1SFJA 1UWRA 5HR6A 1F5ZA 3EB4A 2GLKA 4N7QA 3HURA 3GNDA 3NGJA 3SCOA 2AAMA 3UCQA 3LBCA 3MI2A 1HGYA 4B15A 2HVMA 1NWTA 1XR2A 4HZ8A 3T4CA 2OOGA 2CWNA 3MA8A 2NQ5A 3LI1A 3EWWA 5FJRA 2PDNA 1FDYA 2XVNA 4EF9A 4BQ5A 4LVGA 2ZX9A 1VFOA 1NQ6A 1FFQA 4DF0A 3L4VA 3MT1A 3STFA 1KM5A 3S42A 3VFLA 6ENLA 2QCNA 4OHQA 2J7DA 4RXFA 1U1JA 2VI0A 1WKDA 1KM4A 5AYBA 4XB3A 3WEZA 3VE9A 4LPCA 3AWOA 1MFVA 1PIIA 4KEMA 2FZ9A 3EEZA 3IGSA 1MVYA 2CWXA 1JPDX 1FWJC 4LAZA 4R7OA 4HPXA 3R8RA 4RZ4A 3RILA 3OGSA 3TDFA 1EC8A 1Q5MA 2V5KA 1WAWA 3M6DA 2BG5A 1BF2A 4A3YA 3QQWA 1DTNA 3SUVA 1QBAA 1CXKA 1H1ZA 4AX6A 1U1UA 2CZDA 4JFVA 1XQLA 2P0IA 1EP2A 1BAGA 2WSKA 3W85A 2NQHA 2PS2A 1X6LA 4UFMA 1Q6OA 2OEMA 2OKTA 2VEPA 2YB4A 4Q32A 3VPLA 5G4WA 3FYYA 5A1AA 3TA9A 1US2A 2ZC8A 3ZR4A 3G1DA 4GUIA 4C6KA 1F6PA 1ZBCA 1JDDA 1TCMA 3L12A 3FAWA 3IVTA 3D3FA 3UT0A 4YYFA 2BMBA 3F5JA 1Q4NX 1QT1A 2Y7EA 5DT7A 5FSEC 5I78A 3QGKC 3RIKA 4JFSA 1I9CB 2QT3A 1W1IE 1K7EA 3CV6A 2NSXA 2PD5A 2DT3A 3AU2A 4GISA 3T4WA 4L1XA 2OGJA 4O4VA 3L4ZA 5D4YA 4Z2IA 5TNVA 1IZCA 3BUVA 2IMRA 1EQPA 1QK0A 1JPHA 2PDLA 4LY4A 1QUMA 3WK2A 3URNA 3KOXA 1RP9A 4PEKA 1EC9A 2VL4A 4ENLA 1CGXA 3EOLA 2BY0A 5BXPA 3GSMA 1V6UA 4AIEA 1IWPA 4JYFA 5C9XA 1WZMA 1YDVA 4LUTB 3S2LA 1FDZA 1TA3A 2VCBA 6PTDA 3MI6A 3CGTA 1H5YA 4H00A 3PULA 2RDWA 3EOSA 3G1SA 3OBAA 3C6CA 2GJNA 2C6QA 3LUTA 3TTEA 3OU8A 3OYZA 3W3OA 2IS7A 3E02A 1ADDA 1A5UA 1GZJA 3W4RA 1ADSA 1R3TA 1XLIA 3AXKA 3ITYA 5T9BG 2NX3A 2PUZA 3APTA 1V0LA 3TW7A 4C6CA 4OJYA 3TYCA 4IH3A 3NM1A 2CU0A 1FXQA 4EE9A 2F84A 4QQUA 3HA1A 5KZDA 1ZS2A 4AD2A 3QV6A 3TQKA 3B8DA 4XKMA 1XXXA 3P81A 4O54A 3KLKA 1J2WA 2ZQ0A 4GCXA 4AIBA 1M68A 5BU9A 1TMHA 1IXQA 4XO7A 2WB5A 4P8XA 3CS2A 4Q4OA 4C6BA 4F2BA 1OYAA 1D8WA 2XN1A 1UASA 2Q8LA 4EKJA 3AMCA 2WQPA 3LBMA 4JAWA 4W93A 3PAJA 2DT2A 3I7QA 2PDUA 4G6CA 1E6XM 2ALRA 3N73A 1VFFA 3QTPA 3VUSA 3VNKA 5CJ5A 3GVGA 2B31A 1AVAA 2OLAA 1V3MA 5A3HA 2VZVA 2OMAA 1H3GA 4UQAA 4A22A 3W6LA 3NO1A 3DHUA 1OCNA 1JZ4A 3LHZA 4DNMA 4H4IA 4G7FA 5K9XA 3DFPA 3P67A 5AECA 3BW3A 3A4XA 1OT1A 2PDGA 1EPXA 3VDCA 3ZSTA 3OA3A 2FGZA 3DFYA 3E3HA 4QS6A 1MW2A 1XLKA 2VEKA 3FVMA 5HQLA 2WXDM 1H7XA 3L67A 4L56A 1BQCA 2I7GA 2YBVA 2YSWA 2XIIA 2RGLA 2I1OA 2WPGA 1RCXB 1ONWA 3LLFA 2VYOA 3HQ1A 2YYTA 3JUGA 1VLWA 5FF7A 1IIGA 1ME7A 4Y8FA 1KA9F 2GK1B 2J8GA 2V3GA 3KCLA 4IUGA 1CB2A 2W67A 3DZ1A 4WDXA 1L8NA 4CCEA 3WZ0E 3EPNA 5JIPA 4Q7NA 5ECVA 4IQDA 4K1WA 4JDBA 1W1ZA 1GKRA 2QCCA 4LT9A 1M7JA 3GR8A 2NVCA 5U7SA 4PRTA 2CC0A 2IPGA 3U0HA 3WH6A 1D3GA 1A5BA 1QPNA 4IP5A 3IIXA 4C7FA 4H19A 1QHOA 1G9HA 4XKYB 3S47A 4REQA 3TAKA 4B91A 4A2SA 1H1NA 5LNSA 3FKKA 3U8GA 4PN2A 2YL5A 3VTRA 2ZZ4A 3LRMA 1XDLA 1GVSA 4UTWA 4QJ1A 3W2JA 1HO1A 4A3QA 3KTXA 1A80A 2PMQA 3PWIA 1SJBA 1V51A 5J5DA 2I56A 3AHVA 4GX8A 3WF2A 4A8LA 4WEVX 4DWSA 4D8ZA 1CECA 2FGBA 3A12A 3CH0A 3QHOA 2WVUA 3TZFA 4DX3A 5FL1A 3EZ4A 3E2RA 5REQB 3G0SA 3VCRA 1XC4A 3WF0A 3EXTA 1XS2A 3CXOA 9CGTA 3B04A 4HHPA 4WY0F 4BEQA 4YMZA 4PULA 3SUWA 1JI1A 3A24A 3EMZA 2NV2A 1KLZA 1EOMA 2VX4A 3LM7A 1Q8JA 2JF7A 2PBGA 3MO4A 4JCLA 4QDMA 3VIPA 3HV9A 4GIYA 3BOLA 3VGFA 1G7UA 3NSMA 4PGLA 5FEPA 2HK0A 5M3WA 2PTYA 4ZVJA 4HNCA 2XUCA 2FJKA 3MS8A 1E1CB 1UG6A 3LRKA 3VDHA 4GYPA 3HBLA 4GUGA 3WBXA 1FP9A 4LU0A 2Y2WA 1J10A 4AUBA 4RK8A 1H60A 2H3BA 4E5TA 4WD0A 9XIMA 2FZ8A 2X0HA 3WBWA 3XIMA 1BKSA 3MKVA 1W5QA 3SAZA 4GUJA 5HMEA 1XLDA 2QUNA 1H41A 3H23A 5EKYA 1EQCA 2QZRA 1OF6A 1TR9A 3U3HA 2GVYA 2BXVA 5HQEA 3RO6A 4L64A 2BY3A 5IOBA 4NZJA 3WDHA 1QTWA 2ZA2A 3OHIA 4O19A 5CLTA 1JCXA 3FY1A 3ZMRA 3A4AA 3CAKA 4NT0A 2E5DA 2E1WA 2E77A 3HJZA 3NL5A 1P48A 1PXGA 3N25A 1R3YA 5G2IA 4O11A 2G3FA 4AEOA 4UMCA 2J75A 1IE7C 3MB9A 4DN1A 4CNNA 3L21A 3PHAA 6TAAA 3AYTA 3TLLA 2CLMA 4QLKA 3W07A 4M7TA 5EMYA 2EPOA 4A29A 2MNRA 5G1TA 4RE0A 2BLEA 3N29A 1NH6A 3I3DA 5B80A 2ZTKA 3E6EA 3OG2A 5C0QA 5KZ6A 1Y0EA 4PTVA 3PN8A 4Q7IA 3VKKA 1XLLA 3OQ8A 1W8SA 2Z2UA 4IFOA 1AH3A 2ZUMA 4PB3A 4GC4A 3G8RA 1JCLA 2IXVA 5FF2A 4I3GA 3EDKA 3GQYA 4RNJA 1W1B1 4GQGA 4QE1A 3AWNA 4G8TA 4C90A 4MJMA 2VRKA 1R9ZA 4HSOA 4FIQA 4UQBA 4KFOA 4A3RA 4MB3A 5FIPA 2XIQA 4DO6A 5KSWA 1TPFA 3DHPA 3HB9A 2V9DA 3KRBA 2C71A 5CSSA 1VBRA 3LYEA 1IHIA 1J2BA 1BSIA 3ES7A 1JCMP 1QHZA 3W7IA 4QNWA 2WANA 4PTNA 4KEUA 3M5VA 1HG3A 2EQDA 1HF6A 3QZAA 3WFLA 3W1AA 3TKFA 1W1A1 3H53A 2CCRA 2DZSA 2O92A 1HTIA 1RQBA 1JZ8A 1XYZA 2ANUA 3BLEA 3SDOA 3AIRA 1XUZA 2Y70A 3A13A 4W85A 4MWAC 2RJHA 1I6NA 3OLIA 1F73A 4J9JA 3QMTA 3QLDA 4S2CA 2AL1A 2ACUA 1UP2A 1P43A 4Q4PA 4AZ6A 2GGIA 2QCDA 4XZMX 3PBGA 2PWEA 1OWQA 3WUEA 5TBOA 3W24A 2W63A 3HU7A 1R8LA 4TV5A 2B4GA 3C0QA 3GR7A 3NGFA 4PL1A 3QQ0A 1EO5A 2YA0A 4GINA 3KTCA 5ABGA 4J5NA 2IQTA 3S5NA 5CBBA 1B3WA 3NL2A 4PUDA 4H6KA 4UTLA 4F3HA 2BGNE 4GA8A 3IJ8A 4BCEA 4IHCA 3SN4A 3AIUA 1GQJA 1PAMA 3PBMA 4IOTA 2FTYA 4JTEA 4O18A 3KP1A 2QJJA 1BWVA 4RDVA 3VKCA 2R94A 4NAEB 3TMQA 2P8CA 3M4HA 1HJQA 2BY2A 3JU2A 3ZT7A 3TNOA 1F4AA 3QHNA 3BLFA 3EDFA 1OK4A 4E8CA 1SUXA 3EWXA 4JTUA 1EJTC 4P8VA 5EFFA 2OU4A 3O6AA 1SVDA 2R1MA 2WSRA 1UUQA 1V77A 2HISA 3QKEA 5CLWA 2H3DA 4H7CA 1R30A 4FMVA 4AB4A 2VQTA 1S1PA 2FTWA 3HMCA 3WNLA 1PTAA 2QHAA 1E4LA 4MNJA 3LA4A 2G4JA 3Q94A 5DBTA 3HGRA 3DXIA 3DGBA 2O9RA 1EA9C 1BLIA 1OINA 4H1ZA 1LWJA 1EJXC 3OLDA 3TN4A 3AICA 1GKPA 1FDJA 5CG7A 1ISVA 4WQ6A 4E0CA 1B2YA 3S5OA 4TTUA 3R10A 4ACZA 2XIBA 4ZEPA 1XYAA 3VIJA 4LJ3A 1Q6CA 4HN4A 3VZYA 1DVJA 1TV4A 1YE4A 5IDIA 1S38A 3QPEA 2ODOA 1CGTA 1UMLA 4HK5A 1IT7A 4UTTA 2PCQA 4M56A 4Y7EA 3AALA 1J6OA 3H4GA 4NNAA 4GY0A 4W8AA 3FOKA 3V3WA 3ZWTA 4Q8TA 3UPBA 4ECLA 1D7FA 4PSRA 1B57A 1KW1A 2GYIA 4DYKA 2ABBA 1UPPA 3K2GA 3H7UA 2Q3RA 1GWJA 1T5AA 3CPRA 1A5AA 5K9DA 4CNOA 2PODA 3W2LA 3SBFA 2B7OA 3RLUA 3QGAC 2HE8A 3QMSA 2EG8A 5SWUA 2FZDA 4J3XA 5H8MA 2WJZA 5T91A 4R7WA 3W7HA 3WD0A 1NDZA 3CUIA 4O12A 4XZIA 3T1GA 3CUHA 4QS5A 1K70A 4X0NA 3WY1A 3P2VA 2VDIA 4N4QA 3ZR5A 2Z1BA 2XZ7A 2INEA 4IZGA 3LD5A 4G2DA 3W88A 1AW5A 1Z89A 3WQEA 4A3HA 4KGLA 4LRSA 5HQMA 4F8XA 1UUOA 4MWAD 5D37A 1S5TA 4WGHA 2ZRUA 5HOSA 1Q6LA 3H12A 3OIXA 3UZWA 1F3TA 3IJ6A 1YRRA 2C0HA 1XGZA 4ZXOA 3OZOA 3AMKA 1AA1B 3IACA 2PZ0A 3STCA 4JQ3A 2V67A 3TXVA 3T2QA 4D2JA 4B2DA 1PPIA 2W6RA 3K8MA 3P6LA 3LOTA 4H9TA 1PWLA 2J8FA 3BDKA 4ADUA 3T09A 1DHKA 1UC4A 3O6YX 5EYWA 4JIQA 4L6DA 1XSIA 5JMUA 3NQAA 5HPOA 4YCOA 5FI8A 2B0MA 3Q2DA 2D69A 3UESA 4HT3A 3FW6A 2XG9A 3FAXA 4LF2A 3KVKA 3LHYA 3DBNA 3NNTA 1ODZA 1O60A 1XPYA 1QPKA 1EIXA 3M44A 1HO4A 1V3LA 3TR9A 3E74A 5KTLA 4AF0A 3DFTA 3UWZA 1XRVA 4N9CA 1P6BA 2WHKA 4US6A 3L5LA 1HUVA 1NOUA 5KEZA 3LCXA 4UNIA 1C8XA 3Q4DA 3QXBA 2NV1A 1KXHA 4QSHA 2VTFA 4QJ4B 3IARA 2EPHA 5D9OA 4WSHA 1XLCA 2GJXA 3I3BA 1Y8BA 1ZALA 4M6PA 4Y9AA 4HHMA 5A5WA 2UZ9A 1HIZA 4ZSUA 2GJXB 2WC3A 3G24A 5CCZA 1A5CA 3GRIA 3TR2A 2IKGA 3GXPA 1LUCA 5AYXA 3GHRA 2WMGA 1XV8A 3AUJA 3VIOA 2OVLA 4GZJA 5HNUA 1I60A 3PNUA 3F2DA 2A6LA 2VFIA 4HSNA 4V33A 4YVVA 4JQAA 3NSXA 5A8MA 2GVJA 3CUXA 2G3JA 1HKMA 3O7UA 4QLJA 1YQ2A 1GG1A 4M1BA 3GUWA 2A85A 1L8PA 4GXWA 2X1RA 5IHSA 1VPXA 1R3WA 4DUOA 2WKGA 3EMQA 4Z08A 1EL3A 1TPB1 2J13A 2WCAA 4O1CA 4DY1A 4XAGA 4DJDD 1CGYA 1WOAA 3L2MA 4CUCA 4KIEA 3HGJA 3KCJA 3WFZA 5LGZA 3ARVA 1RV8A 3CZGA 3M47A 4QP0A 3FV9A 4BWLC 3MHGA 3U4AA 2HXUA 3EXSA 1LBLA 3ZLFA 4UZUA 1MZRA 5RUBA 1EJVC 4AW7A 3WSUA 2VR2A 3GAYA 3GE7A 5LXXA 4YPJA 4Q8WA 4C6LA 1KNWA 3W76A 3L68A 3LSCA 2Z00A 1TYGA 1TZ7A 2UY3A 3E9AA 4CD8A 2BZNA 5FSDC 1QU4A 1W1VA 1OVDA 2PDFA 1TQJA 3EPMA 4GFIA 7PTDA 2WCSA 1S5MA 3EA1A 4MM1A 1O5QA 3CZEA 3T2PA 2YXXA 3DKLA 1PX8A 3ELFA 5G1MA 4KGJA 3TWAA 2FZMA 3S6DA 4O52A 2CLHA 4OU1A 1KKOA 4E6MA 1AZ2A 1XLGA 3UNTA 4Q8NA 4KWOA 1SJAA 1T41A 3B9NA 3WJWA 5FD0A 4IGNA 1YTKA 4I8YA 1FVPA 3IJQA 1I4NA 3N6QA 1OC5A 3KOFA 1JUEA 1DE5A 3TQPA 2CITA 3ZZ1A 1TE6A 4MUPA 1FRBA 5GNXA 3MPGA 1GONA 3TZNA 1XYMA 3OBKA 4HZ7A 2PEVA 3QM3A 2I17A 3UWWA 1B30A 1TSIA 3DH7A 4G7EB 1BHGA 5FKYA 3W1NA 3ZSSA 3UXKA 1JG9A 4N6EA 1EYEA 1DWJM 7TIMA 1W1YA 1PTDA 3AFBA 3QR0A 4JNZA 2BHYA 1ITXA 1YE6A 3LGEA 1YLVA 2R1PA 3FXGA 4GD0A 3CJPA 1PHQA 1A5LC 4D71A 2ZADA 2CKRA 3N14A 4F0MA 3MYOA 4LRTA 1PSCA 4HN8A 3USZA 4MG4A 3QN3A 3M43A 4UZSA 2J8TA 3V5CA 2AL2A 3VABA 3EWYA 5G1YA 3AZRA 4QJ3B 5TF0A 1YEYA 3N4EA 2HXTA 4KKXA 4NILA 4GH3A 4O8AA 2QCHA 4NU7A 5BW6A 2ZUVA 5LGXA 2QCGA 3S1GA 1N7KA 1Q6RA 5DX7A 3CL6A 1BQGA 3UWQA 4GYKA 1Q2RA 3RF9A 3EBVA 2O7SA 1ZBWA 4I8DA 3W75A 2ESCA 3ARWA 4TR9A 4QDWA 4HSHA 3URQA 1EJSC 1AMYA 3OVQA 2VEMA 4INFA 3C3UA 2PGEA 5FESA 3RLHA 1ZGDA 1TVLA 3WFAA 5EMLA 4XZNX 1V3IA 4D8AA 4LALA 1GQIA 1RCOB 3VD7A 3A5FA 1M9HA 4P5UA 3THDA 3OZPA 2VWSA 1MRQA 3WLNA 1DP0A 3FN9A 4IJCA 1LG1A 2OYKA 2C1GA 3WQWA 3T2OA 3TAOA 5EMKA 4FSAA 3NR0A 1J0ZA 3W70A 2IPJA 3PSWA 3T42A 3KOYA 3WD4A 2XISA 3UZZA 2ZX8A 3BW2A 4YS1A 2VGGA 3AMLA 3GUGA 4P61A 2WZIA 1C90A 4F0HA 4PE8A 9XIAA 2GSHA 4PB4A 1OEPA 2G3NA 2ISSA 2Z6IA 4RL3A 2GGJA 3CBWA 5MKGA 4PH6A 1RH9A 3A21A 4E2DA 5JUVA 1ISZA 3O9NA 1TREA 4S3EA 3KL5A 4C91A 5CC3A 5GNYA 4DYJA 2OELA 3AXIA 4M3PA 2OTDA 4S1FA 3FYOA 2D0FA 2EJ1A 2NZLA 2ZKMX 4YTTA 2R1NA 1ELSA 5AC7A 1HKKA 1EB3A 4IT1A 4P8UA 2OYLA 1KCXA 1RBLA 1XCWA 1G4EA 2PWVA 2WMHA 3F4NA 3TYDA 1QVBA 1FH7A 5CSRA 2GUYA 3EWUA 2YX0A 4NJKA 4ZSTA 5LNUA 5LHFA 1P6CA 3FGCA 1C92A 1F76A 4IIHA 4DJFA 1H09A 1XHGA 1KRAC 4Q6XA 1XSKA 2EAWA 1KFEA 4MLJA 4L4OA 5CZSA 1G5AA 3KXQA 1F7BA 1VHNA 2H90A 2FH6A 1GVIA 1O68A 1BEUA 3ZOAA 2F6KA 2CZFA 3ZJ8A 1RZMA 5CC7A 1I2NA 3G6LA 2PP3A 2CETA 4ZODA 1WZKA 2YXGA 1X1NA 3DN5A 3VIMA 2DORA 5GJMA 4N6FA 3LZ3A 1OCBA 3NA8A 3LSBA 2O9OA 2DSVA 2A2IA 4OVXA 1ZSXA 3B9OA 1NELA 3MANA 4FI4A 2YZRA 4JNMA 4G56A 3ZYZA 1GQNA 2W9MA 2XH4A 2WMIA 2A5HA 1DOSA 1JDFA 2PRMA 1OC6A 4TMBA 4AHPA 5EBUA 5F2GA 1O6IA 4DF1A 4AYSA 1W9VA 1CT5A 2V2DA 1BTMA 4JTSA 1CXIA 1PWMA 4J3UA 2OLSA 4MKNA 3WQDA 3VC6A 4J3TA 2IW0A 1KTNA 1DXIA 1Q13A 1N2VA 4ORIA 4FNUA 4MAZA 1X7IA 4A8NA 4BF5A 2BB0A 2FFIA 1J18A 3PZIA 3HZ3A 3U9IA 3R12A 1MQPA 3JVAA 1LQ2A 1GJUA 3AIWA 3B0XA 2DV0A 4WY0B 3CMJA 5JBDA 1KGXA 3EWZA 3FA3A 2FZNA 1UR1A 1VBHA 3MVTA 4MMWA 2WHJA 3AAMA 4PA8A 1AK5A 5FEZA 5JXQA 4HNLA 3BXWA 1F9CA 1Z7AA 2R14A 2OEKA 1FWIC 1SZGA 3PUEA 1C7SA 1F3WA 1RJPA 3R7MA 4I9AA 3ANYA 1W3LA 4NAFB 1YDNA 4A6GA 1ALDA 3H7RA 1PZ2A 3NJ3A 5GQBA 4RJEA 1CLKA 2NUXA 1X1ZA 2A0NA 3O1NA 4CNTA 4FP1A 4FZIA 3P84A 2QJNA 1G4TA 3ARYA 2G0WA 5HMSA 2BS9A 4LH8A 4O17A 5BRBA 4ICCX 3C0SA 4ZQCA 3CAQA 1XBYA 3FEQA 3GW3A 3L4YA 1GUVA 4NP7A 2GZXA 5CKSA 3AXXA 1YKWA 4HBKA 3RRAA 4PL2A 4XVDA 2OWCA 4P7QA 1JUBA 1P7TB 1S5NA 1XG4A 2HRWA 4R3UA 2HPIA 1OFRA 1LTDA 1NOFA 1RJRA 2KX9A 1RD5A 1OF8A 4M19A 1R47A 1QOQA 4GJIA 3MO7A 3W1XA 4H8NA 4ILSA 3ZR6A 3ALGA 3EA3A 1HX0A 4PR4A 3WO8A 4JTJA 1PZ3A 4QROA 3WQOA 1FTXA 3PPCA 3ZJ7A 5I79A 1UP3A 2PC4A 4GGHA 3NIYA 1HKIA 1RK6A 3BG3A 2PP0A 3RK8A 4BS0A 3ATYA 3G1VA 1VFHA 4IFRA 4O1DA 4ICNA 1KM3A 3ITOA 2P3EA 3H2OA 4GVFA 3I10A 4F2UA 1XH0A 1XC6A 1J12A 3OBEA 1VZWA 4PUKA 1V7YA 2V5CA 5AY7A 1PKYA 4H8HA 3UVAA 2E5BA 1RVGA 1Q2SA 3LCLA 1KBIA 1BRLB 2X1UA 4O1EA 4KFNA 5AZ0A 3AHYA 3NPWA 4GXPA 1X6UA 4R34A 2OODA 3LPFA 4WKAA 3CHEA 1ZLPA 1Z3NA 4R27A 2TAAA 1W2PA 4EWJA 1HP5A 4WR3A 2YZ5A 3KL0A 4F48A 3LK6A 4M6UA 3RMEA 3VIKA 4D6EA 2V5DA 2DSWA 1OC7A 3BAJA 5DY3A 1K9DA 3AS2A 1UR3M 3NZQA 4MB5A 1NF0A 2G97A 2Z24A 4PYSA 4RDWA 3GNXA 1E4IA 3DFOA 2XSAA 2Y6ZA 2AKZA 4BQ4A 2O55A 3OLEA 4L65A 3TVAA 1ZU8A 5A94A 1N55A 2Z1SA 3PTQA 1KO0A 1L2UA 2VJXA 1UKQA 3CC1A 4EP8C 1TTQA 3CT7A 5C71A 4PMRA 1M01A 3TA6A 1LP6A 3KDOA 3S2CA 4I5RA 5MF5A 4UTWC 1KV8A 4KT2A 1UR2A 5LNRA 3L0GA 4KWWA 5H91A 4TO8A 1KBLA 4W5ZA 2J62A 1HZYA 4GZEA 1L6SA 4DWSC 5IDZA 3TUUA 1I2PA 1RLDA 2FLIA 1MEWA 4AXKA 2XZ9A 3C2FA 1QI4A 1EOKA 1MUCA 3MHFA 2R6OA 4C6MA 4K7YA 5BXRA 1YYAA 3PG8A 3QKZA 3B8UA 3PWGA 2FDSA 3WBAA 3RDKA 1V02E 1RBOB 5TIMA 4NZFA 4CD6A 1TWZA 5F2MA 1FHDA 1PB0A 3HN3A 3RN6A 4LYPA 3V18A 3D47A 3U7VA 2VFFA 3FDGA 1SMDA 1R9XA 1DQUA 1UWAA 4AZCA 1E6NA 3DI1A 3WK0A 5FOOA 1EF2A 2C8NA 1CLXA 1X7FA 4LVDA 3OEXA 3R8HA 2YIHA 1WKYA 4DAIA 3AC0A 4GYPC 4QCFA 2RDTA 1A3HA 1ZJIA 2YDAA 1UROA 2ZA3A 2ZUWA 1CGUA 1N8WA 1Q66A 3TFCA 1HJXA 4K36A 2PLJA 4R53A 4JTCA 3FJNA 4AY7A 1VBGA 3QR1A 3UVIA 1AUSL 3ITLA 2GVGA 1OM0A 5I3FA 5LHEA 1ME8A 1DJWA 4M81A 1TQXA 1XL9A 3R0UA 3SRHA 3IIPA 2BBFA 4UFKA 4JFUA 1RP8A 4RZ6A 4C1KA 1E4MM 4DF2A 3SFWA 3D5HA 3IRDA 1G67A 4Q8QA 3WELA 3HTWA 3ANVA 4GQBA 3SCWA 2ZDSA 4N4PA 1H5VA 5AHMA 1TG7A 3PFRA 3LB0A 1E40A 2P0OA 1UB3A 3RPTA 1WZLA 1BFNA 1LRNA 2DVXA 2WMJA 2NLYA 3BLDA 3P82A 1XKYA 3A3XA 1B1YA 3BWWA 3ARUA 5LKYA 2JKPA 2C16A 1CIUA 1SW3A 2Y85A 4WKFA 1UJPA 1VEOA 1X8CA 3W26A 3LDVA 1EJWC 3CMGA 2YYUA 3OW1A 1JUKA 2JK2A 4QAWA 4AMAA 4IFKB 1IEVA 1DXFA 4WDWA 3KBJA 2G37A 4CQAA 3SADA 1PE1A 2V69A 4JHMA 3W2NA 3OQEA 3ABZA 3SGZA 1TR1A 1QHPA 1OHLA 1G01A 3PY2A 3UJ2A 1JXJA 4ZTXA 1XSJA 4LS2A 6A3HA 4U28A 1UWIA 2J7GA 2WNWA 3MDUA 1IZKA 3GVRA 2V3EA 4LCRA 3KBVA 1TCDA 3FA4A 1QMLA 2XYLA 3V36A 3VAVA 3W9ZA 1W0MA 2WSQA 1JEZA 4AY1A 1UA7A 4US5A 4CU6A 2ZZ6A 3NCOA 2EKCA 4B5SA 3SCSA 2QUVA 4JDYA 2YL6A 4O16A 5KITA 1VHCA 2C79A 2OB3A 2F2KA 3VD9A 4DWSD 4UQ9A 3FHQA 3UGVA 4H8UA 2PC8A 3PPGA 1PYFA 3PJWA 2PDBA 2ZYFA 1PDYA 2ZVIA 3K8KA 4IX0A 3CO8A 3W01A 1QNQA 5CAKA 1DJYA 1KGWA 4HMDA 3UJRA 3PB0A 1A0DA 3MUIA 1JI2A 3UFYA 3H2MA 5CGMA 2O4QA 2OSYA 1GVOA 3F4DA 3UP8A 4DXKA 3HM7A 3GG8A 1EX1A 3CB3A 4R9OA 4RZBA 4UR8A 2F6XA 4GI6A 1L6YA 1EWDA 4H9VA 5D04C 1G0CA 3UPMA 3KLLA 3R4IA 4E3VA 2CW6A 5C5YA 3B40A 1P6WA 2P8BA 4X61A 5XIAA 3UXLA 3WLMA 2RHGA 4DQWA 4C6DA 1L9WA 4WJ8A 2DUAA 3KVMA 2XTKA 1XUUA 3ICJA 4MDOA 3WH9A 5JBFA 4LS1A 2TODA 4RLIA 2BVYA 4GLEA 2IUZA 3RJYA 2FJUB 4HA1A 1C9DA 4B5UA 4D1JA 5I3HA 2DZBA 1XIIA 2QDEA 2WJEA 3UWUA 3W6YA 3NQDA 4AC7C 3QLLA 3S3GA 3UZXA 1OGSA 3SI9A 2BDQA 3GH5A 1HNYA 1R87A 1VKFA 1OBAA 3DKJA 1ITCA 5ABFB 1EKOA 4RNIA 1K6WA 3N17A 2GJLA 3FJ6A 1V6YA 1A3WA 4QE4A 3DG3A 1WA3A 4MYXA 2Z29A 3O0FA 3WG6A 4B4HA 2INFA 4D9PA 4OV4A 1T0OA 4W7WA 4V28A 5EBAA 3MCMA 4QSFA 3WH8A 1KBBA 3PUDA 1SW0A 3CEUA 4IM4A 4HMNA 3BE7A 1OFPA 2NLIA 4M8UA 1W8GA 3VNDA 2XFFA 4I6VA 4UTTC 4XAYA 2F6UA 5F2IA 3EOOA 3HG2A 3G18A 3NQ8A 4DO4A 5ABTA 3MSDA 1X39A 4AD1A 4LF1A 4BR1A 1GYNA 3EX3A 3N2BA 4JKMA 4PC8A 1EX5A 1ONXA 3NQMA 2J27A 4MWAB 2VZOA 1ME9A 4W89A 5BMWA 2DQWA 5IBXA 3GTHA 4GQQA 3CV2A 4I5UA 1JJKA 2Z1VA 5EMMA 3CV1A 4UQDA 4LVBA 2ZZ5A 1KC7A 4Y9PA 1O66A 5FAJA 4MNMA 1E43A 3U2OA 3L0KA 2PU1A 3NO3A 4U3CA 6TIMA 2ZRXA 1E73M 2C1IA 3WH7A 3WQGA 5I23A 3RCMA 1ZQ5A 3GZAA 4AQLA 2G96A 1E55A 3BLKA 3LXCA 1GJPA 2BP1A 1FWDC 3N3TA 3RPMA 5C9UA 3QZ6A 2CXGA 3AMDA 4RNFA 2HCVA 1W54A 4YTQA 1FWHC 3BG9A 1GOWA 2I16A 3SZ8A 3B8VA 2PDJA 4XQ6A 2ZXQA 1S1RA 1TMLA 5I6SA 2WQDA 1B31A 4A21A 3BMVA 4H7ZA 2GSJA 4I5XA 2E40A 4M24A 2WNQA 4U2ZA 2TYSA 1ZP3A 1VJZA 4WSKA 3P7YA 1V8EA 4NQ1A 3UG3A 4UCGA 3BSGA 3BH4A 1CENA 4AZ7A 2GFTA 2PWHA 2QMJA 1NM9A 2VFEA 1R86A 1EGZA 2XN2A 1WV2A 3ONBA 4CN1A 3V5FA 3GWQA 4JN6A 5CSYA 4LUIA 2ZXBA 5M1TA 4IL0A 3MY9A 2E9BA 1ZCCA 3M7WA 1SR0A 4NKCA 4I7WA 3DFHA 5M5DA 2PLKA 4ZQRA 4LTSA 2VNCA 3G1XA 1JDEA 1GOIA 3CQIA 3FDKA 1XLMA 1TRDA 1TIWA 4ZL1A 4ZQNA 5G2WA 2QPSA 4S38A 1PVNA 2BSLA 2YW3A 3T81A 4P8WA 4X2RA 3I7SA 3BV7A 3RHGA 4FNSA 3G2GA 3L7RA 3MU7A 3LENA 3TYUA 3NPUA 3AYRA 1S5VA 1NDWA 5CZKA 1JYWA 2HDJA 3INPA 4D6IA 3A47A 1OSEA 3UF9A 4DJDA 2G3MA 5AC8A 1M6JA 3P8JA 4AG0A 3H24A 5FJIA 2A4AA 3OODA 1TIMA 1EFZA 4FX6M 4GNVA 2EG7A 1EJ7L 2Q09A 2BV9A 4KRUA 2QCEA 3WQFA 1RQHA 2GSEA 3LPGA 4TUFA 1FX6A 4ZBCA 4ONVA 3DFSA 4LVAA 3GXMA 4JTGA 3R2GA 3BMWA 2WVSA 3SB0A 2VEGA 3L23A 4S3GA 2UY4A 3BSHA 5T26A 3TQVA 2X0YA 3GKFA 3NQEA 4NZ3A 3UD6A 1IQ8A 1HJVA 3RU8X 3MHUA 2JBMA 2EHHA 4LUJA 1UWTA 4PCSA 1HJWA 1EBGA 3V0SA 3ARTA 2J7EA 1WKFA 4CQ8A 1DXEA 2A7RA 3CWOX 2BVWA 1AMKA 4PRRA 4OBSA 4RPPA 1K9EA 4AMCA 3LNPA 3H4XA 4K2SA 1OYBA 1FWGC 2YCLA 3UA4A 1BXCA 3P80A 2NWRA 4GWEA 4HMCA 2Y24A 2YCLB 1BG9A 5D2TA 1EBHA 3PBYA 5A6AA 4C5ZA 4HZMA 3R5EA 1JR1A 1E1FA 3SJ3A 1VF8A 3VNLA 3PPFA 2QIWA 3GU2A 3KP0A 1KTBA 4HA0A 3T7VA 3MSYA 2QEZA 3VIIA 4HYWA 2IXUA 4G1KA 1DJNA 2NX9A 2BHZA 4XZBA 2VUNA 3LXAA 3C8FA 2X2YA 3UXAA 1UKPA 4HNUA 3HPFA 1TTPA 4YVXA 2C18A 4N02A 3QRHA 4MPKA 4CQDA 3ARPA 1C93A 3USBA