4BK9A

Crystal structure of 2-keto-3-deoxy-6-phospho-gluconate aldolase from zymomonas mobilis atcc 29191
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
207
structure length
207
Chain Sequence
RDIDSVMRLAPVMPVLVIEDIADAKPIAEALVAGGLNVLEVTLRTPCALEAIKIMKEVPGAVVGAGTVLNAKMLDQAQEAGCEFFVSPGLTADLGKHAVAQKAALLPGVANAADVMLGLDLGLDRFKFFPAENIGGLPALKSMASVFRQVRFCPTGGITPASAPKYLENPSILCVGGSWVVPAGKPDVAKITALAKEASAFKRAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-HYDROXY-2-OXO G
publication title Crystal Structure of 2-Keto-3-Deoxy-6-Phospho- Gluconate Aldolase from Zymomonas Mobilis
rcsb
source organism Zymomonas mobilis
total genus 65
structure length 207
sequence length 207
chains with identical sequence B, C
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2013-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4bk9A00
2BLEA 2CLIA 3EKZA 3TE9A 2H90A 5D04C 4EWND 1SPQA 4O16A 2EAWA 2ZBTA 1KLZA 4JIQA 4JTIA 1YDOA 2C15A 2VEIA 3LBCA 1W8SA 1I2PA 4FNRA 4NT0A 1KTBA 3V1PA 5D30A 2ZTJA 4OWGA 4MYXA 1X7FA 4IMGA 2JGYA 2LLEA 3TK7A 3PWAA 2VXNA 1S5TA 1YTKA 5A5WA 1MSSA 5D2TA 5HR6A 3GXTA 3CEUA 3S1VA 3TAKA 3IIZA 4JYEA 1WXJA 2F84A 1SZEA 1KFCA 4ADSA 2HTMA 3EX1A 3W86A 1K02A 2J88A 4O15A 3NEVA 1TJPA 4LVFA 3C0JA 5BOOA 1R46A 3WJWA 2V9DA 3P61A 4M7TA 3EWYA 3HG5A 3O63A 4UR7A 2GVGA 3N3MA 2GJLA 4QIUA 2B7NA 4TX9A 5T26A 3RLVA 2QAPA 1O60A 1OYAA 1L6SA 2I9EA 3S1XA 1LTDA 3L0GA 2W0UA 3O05A 1VCVA 1OFRA 1OK4A 1GG1A 3RF9A 1JCLA 1KBJA 3W2MA 1O94A 1J5TA 2EKCA 1YTEA 3FFSA 3GX9A 4OU1A 3QPYA 5H2ZA 3U6WA 3M16A 5I3KA 4UMCA 1JCNA 4MZYA 1ZALA 5J5RA 1S5VA 4BI5A 1WYIA 4IPJA 3LCGA 3SY5A 3WJZA 4BWLC 3CTLA 5AHFA 4WD0A 1I2RA 4FNTA 4JXCA 2HMCA 3HGOA 1SW7A 5G1YA 3PY2A 1M5WA 4MOZA 3UYCA 2C19A 2DZTA 1TIMA 2X1UA 5TQLA 5EBUA 1LZOA 2WSQA 3NQ2A 5EYWA 4MJZA 3QF0A 2VEPA 5D2WA 2ZA2A 3MBFA 1GYLA 3STCA 1KFEA 1F6PA 3VFLA 2FPTA 1HG3A 5ABTA 1ZCOA 2CLLA 3M5ZA 4HKPA 5AFDA 1EWDA 3I7QA 1JULA 3DBPA 3STFA 1GQNA 4HPJA 4YCPA 2WNQA 4QAIA 3NNTA 3EX2A 3TROA 3UY7A 1LYXA 2GQ9A 1PE1A 3UXAA 1C8VA 3L5LA 4O57A 3A23A 1XCFA 4FNPA 1DQXA 5AHIA 1W0MA 2CU0A 1B4KA 3PF3A 5SWUA 3DFTA 4OV9A 3GR7A 3NPXA 3O06A 5FEPA 3W73A 4ZQOA 1LRNA 4KKXA 4UTMA 3W7NA 4IXXA 2ISWA 2GQ8A 4O1AA 2QUVA 2VC6A 5K3VA 3GAYA 5KINA 2A2IA 4UTLA 2FPYA 1GTHA 5L9FA 4WZHA 3W88A 1JUEA 2FFCA 3W71A 2GVLA 3BV4A 5DBUA 4M6VA 1H7PA 2A21A 2FIQA 5E93A 3W7OA 3W7GA 1LDCA 1D3HA 2C14A 3MO7A 4LS0A 5D02A 3HMJG 2YFNA 2BSLA 1WBJA 1SZFA 2V0TA 4WOQA 4CQAA 3H53A 2UV8G 2QCCA 1OFPA 4JDYA 2QJIA 4TO8A 3QMRA 4FEZA 1IXOA 4GXMA 3DZ1A 5HINA 4DF2A 2ZTKA 2I14A 2AAMA 4JY9A 2NXIA 3Q37A 1MEWA 2JKAA 3SIZA 1C29A 2ABBA 3G8RA 3P60A 4JEQA 3NQVA 3IIOA 3EX6A 2E5DA 1TQXA 2G97A 4RKAA 3A5FA 3B05A 2EPHA 3W76A 1AG1O 2G96A 4ZQCA 2PRLA 4DPQA 2XN2A 4MZ8A 3HPSA 3SZ8A 4O17A 3GZ3A 4JICA 1QDSA 2TPSA 3W2NA 1JQXA 4O1CA 5CZTA 2E6AA 1WAUA 1M7OA 1ZHAA 1OFBA 1HO4A 4O10A 1QMLA 2A6NA 1K8YA 2TRSA 4QNEA 3PVFA 1FWWA 4R53A 4UUIA 1FCBA 3MHGA 3CB8A 2Q8ZA 1K8ZA 4EIVA 4LC6A 3DFPA 1MZHA 4HN4A 4A2RA 5F4XA 3TQ0A 1WOBA 1ZAHA 2ZA3A 4DQWA 3S8HA 3W2KA 1LBLA 5F1UA 2P0OA 4GUIA 5KZMA 1RVGA 2ZFAA 2R91A 4QQ3A 5DBTA 1FDYA 2J9ZA 3D0CA 3JS3A 4MLJA 3VE7A 3F1QA 4R34A 1PHWA 3NYZA 3P82A 1UB3A 4NZFA 4ZQMA 1LORA 3PM6A 2VEKA 1JJKA 3LDVA 3W7IA 1N55A 3TSMA 1PCKA 3CIWA 1B3OA 5EL1A 3YPIA 4GFSA 2DP3A 4KWWA 2X1TA 3KVKA 1H1ZA 4QM1A 4ZVJA 4HPXA 2CWNA 5TBOA 4IPIA 1QNVA 3KRSA 5AHNA 3L66A 5IBXA 3GLCA 3LHVA 5C2XA 2GOUA 1RZMA 1Y0EA 3FA5A 3IGUA 3TIMA 1LCOA 3FLUA 2ZYFA 3F4WA 5EA9A 1RR2A 1VYSX 1PL9A 2NZLA 3BW4A 1QO2A 4Q33A 1EUAA 3I68A 3AJXA 3RNDA 4ZL1A 3UZ5A 1WOAA 4NJHA 4E2BA 4K37A 3RK8A 1AL7A 4UTWA 4X22A 3N2XA 2CLOA 1TB3A 2EGZA 5DCEA 3N9SA 1I2QA 3W3OA 4NVTA 3LRLA 1MXSA 3W7RA 4GUJA 3B0PA 4Y6GA 3HJZA 5DXXA 3N14A 2OCZA 4O11A 2NX1A 4K8EA 4MY8A 2YFOA 1Q6OA 1ZJIA 3MHUA 4FNUA 4ZMGA 3HQ1A 4FHAA 2PCQA 4D2JA 2CLFA 3UWWA 3W1UA 1XBYA 1G67A 1Q45A 3H55A 5FEZA 3DFNA 5BRBA 1SZGA 3KAOA 2ABAA 1OX5A 4UFIA 1GT8A 3R13A 3KHJA 2X1RA 3M44A 2AGKA 3NPWA 3TC7A 3KRZA 1YYAA 3LLDA 3NXFA 1DHPA 3EWWA 5D2VA 2R14A 1A5AA 3PULA 3E0IA 1OVDA 1F73A 1A53A 4HIBA 4PODA 3G1VA 3M41A 2RDWA 4DO5A 1RQEA 4EF8A 1ML1A 3PSVA 3PBWA 2YSWA 2J6XA 1ZY9A 4H3DA 4WXZA 1W31A 3R5EA 1W3NA 2CZ5A 1PIIA 2CLKA 5E0KA 3O07A 3M0ZA 2EHHA 4Z1DA 3KFTA 1QPOA 1SR9A 3CLMA 4DELA 1L6WA 3PG9A 4OHQA 3M5YA 4PH6A 1O4UA 4NNCA 4O4WA 4G1KA 3LGEA 3NO5A 4AEOA 1AW5A 1S3HA 1YTDA 3W75A 4ALDA 3PR2A 1R2TA 3WJXA 4LV9A 3MMTA 4MUZA 2Y70A 3N34A 1P5BA 1XDLA 4LW7A 4A21A 2H8XA 2DZSA 2VFGA 4OE7A 3WFAA 2Z1BA 3THAA 1L6YA 3W7PA 3GXPA 1GVOA 2Q8LA 4HNTA 2Q3RA 3EX4A 3HGSA 2OMAA 2Y7GA 5EY5A 3IIXA 2NUYA 3QJAA 4XBSA 1NF7A 3MWAA 2B7OA 1IF2A 3P8IA 4Z0SA 3RU6A 4XZ9A 3M47A 4N6FA 1QAPA 3MP4A 2QEZA 1QO5A 3GNDA 1TPEA 2ZRYA 4OBTA 3QRHA 2NUXA 4O1DA 3DAQA 1LRTA 4AAJA 1J4EA 2DU2A 2V2DA 1TYGA 4IQLA 2PRHA 2OX1A 4I9AA 5BMXA 3QSRA 1YDVA 2JKPA 3LCIA 2CZFA 2ZQ0A 1XI3A 4UFLA 4OQVA 3RFAA 5FESA 3T40A 1H1YA 1QPRA 4A2SA 2YCEA 4OT7A 3T7VA 2HS8A 3DGRA 1DL3A 1FY6A 3NL3A 3KVMA 3O15A 3QZEA 5F2MA 2WSRA 2ZDRA 2J9YA 4H4IA 4GRSA 1RV8A 2GJNA 1H62A 3VKJA 1EA0A 1I2OA 1X6UA 3O16A 3G1XA 3LXBA 1T99A 1Q3NA 2KZHA 3DI0A 4JY8A 4K38A 2F7FA 1I4NA 4RZ6A 1VC4A 4N9DA 1C9DA 1DBTA 1OYCA 3O6CA 1A5CA 4UNLA 1FCQA 3FEMA 4QITA 3THQA 4UFKA 5IBXC 3LHZA 3PUOA 4M7SA 3TJXA 2XN0A 3BGGA 2C0AA 1ME8A 5CKSA 3KXQA 3VI2A 3Q58A 2ZZ5A 4AH7A 1OFOA 4JTFA 2ZZ2A 2HSAA 3NQFA 5CPLA 3SFKA 3P8JA 1W5QA 3W85A 4N9BA 3OG3A 4BK9A 1YDNA 5TIMA 2ZRWA 3DU0A 1W5MA 4PA8A 4N4QA 3S5YA 4GE8A 1H61A 4CLMA 4UTWC 4UTIA 3W1LA 3W9ZA 4DBEA 1PS9A 5J5DA 4N2YA 1XFBA 4HHPA 5LNUA 3QPZA 4RLIA 3JR2A 1ZFJA 4UCGA 1W54A 3ZR4A 2DJLA 3G1AA 1LBMA 3N73A 1K03A 4U28A 1KLYA 1TQJA 4NUWA 3MW7A 3MYPA 3LX9A 2A4AA 2ZZ3A 4B5NA 3G1FA 1XBZA 3I65A 5CZJA 4UTUA 3I7SA 3W1NA 1TRIA 1QPQA 1VHCA 3HBLA 4JDBA 2FLIA 3ATZA 1RD5A 3NOEA 3HOJA 1OX6A 1FDJA 3L21A 2C1HA 2A5HA 4GUFA 5EKYA 1KV5A 2H3BA 3P84A 5FF2A 4CCDA 2YPIA 1EP3A 3MP3A 1H63A 4TMCA 1P0NA 3W1AA 3GB6A 2YGYA 3GR8A 3C56A 1RPXA 2RHGA 2G5WA 5C6MA 3TFCA 4AHPA 2E5BA 4WY0A 1OF6A 2NV2A 3G18A 5H91A 3LM7A 1B4EA 3NL6A 1PV8A 1OFDA 3L65A 3FYPA 5C54A 4JGDA 5MHBA 4K8HA 1K3UA 1TV8A 3USBA 1R47A 3SGZA 8TIMA 3TUUA 4K36A 5LHEA 4JTJA 4H6KA 4UTJA 3S5OA 4AB4A 1VLIA 2PE4A 4WY0B 2FB3A 2Y61A 3C52A 3P5YA 5EMUA 3W7JA 3TAOA 4X2RA 1YXCA 4UXDA 4DXVA 1LOSA 5HR7A 3PBYA 4DF1A 4LNYA 3HPXA 5HWNA 1QCWA 3O6YX 1KFJA 1KM6A 3MI3A 4JX6A 3EEGA 3CPRA 1KFKA 1U5JA 3S0CA 2VOMA 1IIGA 3LTYA 2NV1A 3LCWA 4MIMA 4DBDA 3OBKA 4E38A 2YW4A 4I7WA 2OT0A 1F74A 4Y8FA 5FI8A 3M43A 1SSDA 2WKJA 5G5IA 5HWJA 4Q4KA 3STGA 2GUUA 3PUEA 4N6EA 4Z1BA 1T96A 3W74A 4NNBA 1BKSA 3W7LA 3EWXA 4PEKA 3R8RA 1SO6A 4QISA 1LROA 4Y90A 4FIRA 1KW1A 1Z42A 2YDAA 3DXIA 3A21A 3E96A 4X9SA 5AYXA 1HFBA 3LHWA 1IXNA 4IX2A 5C5YA 1KTCA 3B04A 4I7VA 3BPWA 3W7CA 4O8RA 1G7UA 3SGUA 2C3ZA 2Y7DA 1VHNA 3B8DA 3BVJA 2V2CA 5GVJA 2BTMA 3LRKA 2V2HA 4XKYA 3TQKA 1NVMA 2CLEA 3N9RA 5K7JA 1OF8A 3W2JA 1XC4A 4W9TA 1V5XA 2Z2UA 4I7UA 2FPVA 4IXHA 4NXKA 3B06A 3LHTA 3HIJA 2E5CA 5BMWA 4XKYB 1EX5A 4IGHA 4LVBA 4Z0JA 3NM3A 1BEUA 1TRDA 2NLIA 4M6QA 5CZSA 4TIMA 3PBVA 1VCGA 3G1DA 1L9WA 3C3NA 5FF3A 2H6RA 1G7VA 3EXTA 2DZXA 3FKKA 1O95A 1JVNA 3TMLA 3QM3A 2NXHA 2BXVA 3TR2A 4OGZA 3A5VA 4LT9A 1OFEA 5CPMA 4UTHA 3GIYA 1V7YA 2GPTA 4LVGA 1OG0A 2B0MA 4RZ5A 4XTDA 3NL5A 1KM4A 3M9YA 4O4VA 1UJPA 3NA8A 2B4GA 4UMAA 4UNKA 1ICSA 1MEIA 1XM3A 3W1XA 3UZJA 4O19A 1MEHA 3HPZA 3L2IA 4RK8A 1GVRA 1PHQA 3BLIA 1R2SA 4NZJA 2QDHA 3CM4A 4S2CA 2I1OA 4EVZA 4KFPA 3UNDA 2NWSA 1VZWA 3WK2A 1TPH1 2Q3OA 3S9YA 1FDZA 4O1BA 3IIVA 1F76A 3U8GA 2FB2A 2ISSA 2NX9A 4GWEA 2VFIA 3G24A 3NQMA 5A8GA 4ZQNA 4BI6A 4JTEA 4HNNA 2YXGA 3O8AA 4WXYA 4UTTA 4K7VA 5G1TA 2IQTA 4TR9A 3P62A 4OV4A 1QWGA 3HGRA 5LKYA 3W84A 2FJKA 1OX4B 1GOXA 4UTKA 2W79A 3M5VA 4IOTA 3GXNA 1M7PA 1E51A 4UFMA 2PRMA 2ZRXA 2QUTA 3LCHA 4AHQA 4WY0F 4N9EA 3NGJA 3DI1A 3T55A 3IGXA 3IRDA 3ANYA 2DZUA 3ABRA 5E1QA 1N7KA 1ZAIA 4GJ1A 4FIQA 1D3GA 3EXSA 3DFSA 1JUKA 1WDWA 1A5BA 3NDOA 4N9CA 2ZZ6A 3T4CA 1P4CA 2C6QA 4LC8A 1FWRA 1TPDA 2NXGA 4S2BA 1FQ0A 5DLCA 4HNVA 2QDGA 4GC4A 2A1YA 3DFOA 3LLFA 3KVLA 3KX6A 2A7NA 3TW7A 1FX6A 3L0KA 1XBVA 3UPBA 6TIMA 3C61A 3TW6A 3HG2A 2BWGA 3S42A 3G1YA 4UMBA 1TREA 1VLWA 1AL8A 3EXRA 3QMSA 5D38A 3LTSA 5LHFA 1NAL1 3PAJA 3ABSA 3LOTA 4UFHA 4CNNA 3BG9A 1OHLA 4LWWA 3BLEA 2QCDA 2Y63A 3PBUA 4LRTA 1NF0A 1SUXA 5K4ZA 2FTPA 1KV8A 2WNZA 1ALDA 4FB7A 5DCDA 4FX6M 3Q94A 4JTKA 1XUUA 1F05A 5F2GA 1W5OA 4NJIA 4BF9A 2VENA 3TMQA 1NSJA 3K30A 4AF0A 2QCDB 3NQGA 1J2WA 3KRUA 5F2IA 3GDKA 1Z48A 3UQNA 1AK5A 5KSWA 2E6YA 2A85A 1D9EA 4Q32A 3P67A 4XQ6A 1ME7A 1KM0A 2JGQA 4LTSA 2V8ZA 4AF0B 5CGQA 1VCFA 3CWNA 2NWRA 1UUMA 5CSSA 5AYYA 3S5NA 4IMFA 2QJGA 3W87A 1WX0A 3OA3A 2ATMA 4O14A 3UY8A 2ZRUA 4WJEA 2YX0A 3DH7A 3F03K 3TCEA 1CX9A 3C8FA 3CEPA 3SJ3A 3W07A 1H50A 5HMSA 3QYQA 3QSTA 5D03A 4Y96A 1VQTA 4AHOA 1L2UA 2RFGA 2WNNA 1GYNA 2YR1A 1WQ5A 1KFBA 2FDSA 3TFXA 1TPWA 3NPVA 3MP5A 3NQ7A 3QC3A 2WQPA 4R33A 3NAVA 3GYEA 2TMDA 2QCEA 4JN6A 3VE9A 1SW0A 3OIXA 5DY2A 3LTPA 2V5BA 3UWVA 4YLWA 2XFWA 5I3HA 3LHYA 1W37A 3UWUA 1HUVA 1YXYA 3QMTA 2E6DA 2ZZ4A 5DELA 4MY1A 3OHIA 1GG0A 2V5LA 1G4PA 1JCYA 1GEQA 1H51A 3S1WA 1FBAA 2QJHA 3NQ6A 4ML9A 1SO5A 1SZNA 4RJEA 1OK6A 3O1NA 3G3DA 2J9XA 1IXQA 1WBHA 1F5ZA 1H7OA 3H54A 3W1QA 3E9AA 5KZEA 3W7KA 5LGXA 1JRCA 3CIXA 3LV6A 3W83A 4PL1A 4ORMA 4JNMA 4HNUA 4O50A 5D05A 4RXGA 1VS1A 1G69A 3L5MA 1VPXA 1HL2A 3IGSA 4XBKA 2QF7A 3DHFA 5K2ZA 3DENA 3FJLA 3L5AA 1YADA 3OVQA 4UIOA 4QNWA 1LLWA 3NM1A 3R2GA 2WJZA 2NUWA 3L9CA 5DN1A 1TTPA 3L67A 3NZRA 1H7WA 3LXCA 1KM5A 1W5PA 4P2VA 3DKJA 1GWJA 3G0SA 1G4EA 1HTIA 3E49A 5AN7A 5CSRA 3V75A 1H7RA 3FS2A 3QQ1A 1UUOA 2ZZ1A 4LV4A 4ORIA 2ATSA 3NQCA 5KTLA 3W7DA 4NQ1A 2A7RA 5LNRA 4FF7A 3IEBA 3S5ZA 1EPXA 1FXPA 3I6RA 3FOKA 1OYBA 2VFHA 3BW2A 3TNOA 2E6FA 4LU0A 3MI2A 5HUPA 4CCEA 3WJSA 3IVSA 4A22A 1ADOA 1UASA 1LOQA 2V82A 2VFDA 1TCDA 5CPNA 2NX3A 3AO0A 3TV8A 1RQHA 1Z41A 5AYZA 2EF9A 3U2OA 3W1MA 3WJYA 3C2OA 3QW4B 4MPQA 1CI1A 4S1FA 5IM51 1VRDA 4AWUA 3G0UA 2FQIA 5G2WA 5I3IA 3TQVA 3LXAA 4CQ9A 2C18A 5LSMA 2BX7A 2Z6JA 4MJMA 4RCXA 2HS6A 3SECA 2QCGA 3LERA 5K9DA 3BG3A 1DVJA 4MLRA 5F4WA 2XN1A 1K7FA 3B03A 4O12A 3RLUA 5BW6A 3TU9A 2WO5A 3NZ1A 1PVNA 1ICPA 1ME9A 5AC8A 1FCUA 3HG4A 5I3JA 3FKRA 1DORA 4JIPA 5KITA 2X16A 4R7JA 1VH7A 1JCJA 4K6AA 3C2FA 2ZZ7A 2YYTA 4M19A 3TSBA 2B7QA 3GDRA 5FF0A 3LCLA 3BO9A 3PB0A 3E12A 5G2HA 2A7PA 1JQVA 4CNOA 4IJBA 2OZ0A 5AB3A 5HULA 3UXDA 4BR1A 4MYAA 2P10A 3HGJA 4CCCA 1X1OA 4JR5A 4FNQA 3LB0A 1BWKA 2GQAA 3UWQA 2RDTA 2QCHA 4K7YA 3GDTA 3P74A 4JTTA 4WOZA 5AC7A 1I45A 1SQ7A 4MY9A 1O5KA 1FXQA 2QR6A 1LP6A 4O28A 1QFEA 4M6PA 2C13A 3DFQA 4LVAA 4YMZA 4EF9A 3BG5A 4KFOA 4Z1AA 5G2IA 1SFLA 3DHDA 5FEWA 4FO4A 3BARA 1W56A 2X1SA 4O13A 3L68A 3LCFA 4BFAA 4RXFA 1HO1A 3P81A 1S5WA 4JTGA 4X3ZA 3QFEA 4A3UA 1JR1A 1P1XA 1GZGA 2A0NA 4O0KA 5FF7A 1K7EA 1YPIA 5CPOA 1JRBA 1LLZA 5F1VA 3TX9A 1SO4A 1H60A 2R8WA 3ABQA 5DCBA 1TJRA 3RMJA 4LS1A 3B0UX 5AOUA 4LY8A 4HT3A 4AMAA 4O18A 2WSYA 2V30A 3ZWSA 3PSWA 4QSHA 4TMBA 3GNNA 4DO6A 4JTLA 4PL2A 5LZLA 3W7MA 1X1ZA 3I7RA 2DZVA 2J27A 3HO8A 4AXKA 2G95A 1I2NA 4O54A 1AW2A 1TMHA 3S6DA 5K4XA 1EEPA 2X30A 3NQ8A 1GJPA 2VFFA 3LI0A 2ZRZA 2P1FA 1EP1A 2YW3A 4O0ZA 4JTUA 3SR7A 1TV5A 3EX3A 3INPA 4PCFA 2DZWA 3EWZA 5CZ0A 3NQDA 2Y85A 1ZNNA 3PC0A 2QCFA 1THFD 3W1RA 3GAKA 3SI9A 4JD4A 4NJKA 4WQ6A 3MBDA 4JS3A 5HNRA 5AHEA 3NVTA 4DEFA 2RDUA 5HJLA 2R94A 7TIMA 1ZENA 3N19B 1SW3A 4FX7A 2RKXA 3PG8A 4PFMA 3QH2A 3CT7A 1A5SA 1SO3A 3BK0A 5F2LA 3LRMA 4POCA 3M6YA 4RR4A 3HG3A 2VEMA 4YCOA 3LHUA 3BW3A 4JYFA 1ZAJA 4NX0A 4L4MA 4J9JA 1I8JA 5BNKA 3EKLA 4RZ4A 3ZWTA 1IXPA 3LI1A 4LOCA 4TU1A 4Z1CA 2O7QA 2YZRA 2CZDA 1VYRA 4LRSA 1P0KA 3MJYA 1UCWA 3FYOA 4NU7A 3LV5A 1B57A 2C16A 2GVJA 1F7BA 4FNSA 5G4WA 1O5XA 2OT1A 2WOQA 3MI6A 3IV3A 5AHMA 1LOLA 3NR0A 4AWSA 3QEZA 3LCXA 3PUDA 3C4UA 2DJXA 2RH9A 5D2XA 2CFFA 3C2EA 3SSJA 4YWIA 3W6YA 4P61A 3SW6A 3GKAA 1DOSA 3IIPA 1W3IA 2QUUA 1K8XA 2E68A 3EWUA 4N02A 2VFEA 3CQ0A 3UPWA 3CU2A 4E2DA 2Y62A 3NG3A 4C1KA 3B4UA 4RV8A 4JTSA 1TPVA 4HSOA 3WK3A 1OX4A 3WK1A 3MHFA 1XDMA 1K7XA 2V81A 2Y6ZA 5G4EA 5C55A 4K39A 5K9CA 4QJ1A 4AVFA 2ALDA 1QPNA 5D33A 4CQ8A 5I3GA 1R2RA 4IUOA 4YL2A 4GNJA 1JUBA 1TTQA 2H3DA 1VGAA 2A6LA 2ZRVA 4IMEA 5CG7A 3TSDA 3GDLA 1IGSA 3Q2DA 1EWEA 2PURA 2JKEA 1VR6A 2CLHA 1TO3A 2QCMA 4IWWA 1W5NA 1KM2A 4AWTA 4GBUA 1RQBA 3EB2A 5D2YA 4NX5A 1JCMP 1QOQA 1TSIA 4ONVA 3T44A 3G1SA 3QQ0A 1DQWA 1M6JA 1NFBA 1OFAA 2QAFA 4FXRA 1DV7A 4N4PA 1F6KA 3HB9A 1DJNA 4CNPA 1BWLA 3MUXA 4IMCA 3PS7A 1KA9F 5LGZA 5HQEA 1F2JA 5D37A 1Q6QA 1G4TA 4JX5A 2Y7FA 3C6CA 3BGJA 3G22A 1VJIA 1Q6RA 3G8EA 1EUNA 5F4SA 2QCNA 3ZS4A 1H7XA 1TTJA 3GKFA 4FX8A 2O7SA 3G1HA 5LNVA 4PTNA 4C1LA 1JCXA 2QCLA 2CLMA 3ATYA 4JX4A 3FJ6A 4FXSA 3F4NA 2DORA 4E0CA 3TC6A 4BI7A 4MKNA 3ZFHA 1TTIA 3TXZA 4DO4A 5KMYA 3P80A 3FIGA 4HSNA 1GVFA 4MZ1A 1KBIA 1GTEA 1TPC1 1SU5A 4NJGA 1FUYA 1EIXA 3ABOA 3OVPA 3CHVA 3TJLA 3O6DA 3QW3A 4RX0A 1FWSA 3UWYA 6ALDA 2WV8A 3M7WA 1GVSA 1OABA 4IX0A 1XKYA 5AC6A 1GVQA 2PC4A 1H5YA 3KVJA 5K9XA 2ISVA 2H8ZA 1PCWA 3TDFA 4M5PA 4PC8A 3A24A 1CW2A 1WV2A 4XTIA 1XXXA 4A29A 2JK2A 3C2RA 3W2LA 4DPPA 3C2VA 3PB2A 2Z0IA 1KTNA 1BTMA 4LUJA 3LBMA 3TH6A 3OVRA 1VYPX 5U7SA 1OJXA 1XUZA 1KFLA 1DJQA 3A9IA 3NL2A 1LBFA 1KM1A 2W6RA 4JYDA 1T8XA 3W70A 2Y89A 4O53A 4NNAA 3GK0A 3HF3A 4Y9AA 2TSYA 4ICNA 3R89A 3EWBX 3TKFA 1A50A 3TXVA 4IMDA 4LUIA 1SSGA 3NQEA 5D32A 3WK0A 1WA3A 1GPWA 4XUGA 3JRKA 4UC5A 2ZCGA 3IVTA 5EPDA 3VCRA 1LM1A 5HWMA 1QR7A 3B0VC 2TYSA 1X8FA 1B9BA 4GUHA 3G3MA 3W7QA 1DKWA 1AW1A 3G0XA 1TV7A 4XWUA 1W1ZA 3M1ZA 5U4NA 3L0NA 3W72A 4YXGA 4KFNA 1YXDA 1EB3A 1R30A 1T0OA 3W22A 4MVAA 5KZDA 5DY3A 3NPUA 1H7NA 1Q6LA 3W1TA 3A22A 3MYOA 1KM3A 3GVGA 4MFDA 5LNWA 5AHLA 4BWLA 3P5ZA 3R12A 1AMKA 1U83A 3KOFA 4ZQRA 2OJPA 1OFQA 3STEA 2E09A 1MO0A 2AQWA 4O52A 2ZA1A 3S1UA 3W1PA 1ICQA 4UTTC 3UD6A 4NXSA 3T78A 1YLVA 4UFJA 2X2GA 1Z44A 3W23A 2Y7EA 5LNSA 3GDMA 2Z6IA 1TPFA 4L4LA 4ADTA 4EOUA 1N8FA 3W2UA 1G6CA 4JTHA 5FF4A 1YPFA 2BZNA 1FCVA 2J24A 2VELA 4WX2A 3UWZA 1EP2A 4LS2A 1W3TA 5DXYA 5FEXA 2WPBA 3CWOX 1NEYA 3TA6A 1LRQA 3CC1A 3NQAA 2YYUA 5HUOA 3ELFA 1XL9A 2JBMA 4NJJA 3W7EA 2Y88A 3VNDA 2DZPA 2D73A 3IVUA 2E77A 1QOPA 4ZQPA 5I3FA 4ZZ9A 1IIHA 3N2MA 4LVDA 1TPUA 3M5XA 1FWNA 3P7YA 1FWTA 5D09A 3W7HA 4UR8A 1ONRA 2B7PA 4WUIA 3E02A 4KWVA 4DF0A 1UBSA 5L6UA 2CZEA 2CW6A 1G4SA 4MFEA 4Z08A 1TPB1 2QKFA 1XBXA 4ADUA 4GUGA 3OEXA 1SFJA 2VKZG 3BLFA 3DKLA 2E1DA 4U4MA
chains in the Genus database with same CATH superfamily
2BLEA 1R5YA 3VNIA 1GJWA 5D04C 4FXFA 4A3HA 1KLZA 3O6AA 4JIQA 2OWCA 3KM8A 3CZEA 3OBEA 4TV6A 1LL6A 2PMQA 3DUGA 2REQA 1XRSA 2DT3A 2X05A 2PP3A 6A3HA 4Q4SA 2JGYA 4JIEA 2XIJA 4KF1A 4HTYA 3ZQ9A 2VXNA 2X8RA 3N2CA 1MSSA 4JCLA 3GXTA 3CEUA 3S1VA 3R79A 4CU8A 3ANVA 2HCVA 1KFCA 2HTMA 2FMOA 3W86A 5GJMA 1K02A 1UA3A 5CC3A 1N82A 4PCTA 2SFPA 1NU5A 3K4DA 3P61A 4KEMA 3ECQA 3WX7A 1SJAA 1YNPA 4JFTA 4DI9A 2GVGA 3N3MA 1LT7A 3SIMA 5T26A 4C6FA 4LF1A 2QAPA 1OYAA 3SCPA 2OG9A 3AYRA 1VFLA 2W0UA 1NOUA 1GG1A 5M3WA 1KBJA 3W2MA 1O94A 1J5TA 3WQCA 3GX9A 4PN2A 2ZUUA 4F2UA 5H2ZA 2BVYA 1I0DA 3SY1A 2VX7A 3U6WA 5I3KA 3CUIA 3QV9A 1B2YA 1UWTA 5HATA 3LCGA 2NQ9A 3DN5A 4BQ5A 3QKZA 3PFRA 5AHFA 4WD0A 4FLRA 4JXCA 5CEWA 5IHSA 3LEPA 4D8AA 3OGSA 4E5TA 3PY2A 5FL1A 3UYCA 3AS0A 1RUSA 5IFTA 1RP9A 5D2WA 3QF0A 1XC6A 4PUWA 1PX4A 4MB4A 1HG3A 1LQ2A 1ZCOA 4HKPA 1EWDA 3R4IA 2FTYA 3U0HA 2Q09A 1GQNA 4JQ4A 4HPJA 4QP0A 1RH9A 3W0KA 2XVGA 2OFJA 3NNTA 3UY7A 3U57A 1WKDA 1PE1A 1QW7A 2E67A 3EZ4A 3M07A 2XIOA 2OZ3A 3DFTA 1WNOA 5FEPA 1E9IA 5I2UA 1EC9A 2HE5A 3PAOA 4IXXA 2ISWA 3IAPA 2VUYA 4UNIA 2YA0A 1VF8A 2RJGA 4V1YA 1GTHA 3W88A 3UXKA 1JUEA 3NDZA 7PTDA 3NGFA 3BV4A 3TTSA 3BCJA 5DBUA 3VCNA 3TOPA 2A21A 5E93A 3W7GA 4Y9OA 1D3HA 1C93A 1K9FA 1NWUA 1ZJHA 1SZFA 4PMNA 3WNNA 2PWGA 3CO4A 4E2VA 2QJMA 4PMVA 1LQAA 2VRKA 3DZ1A 3QTPA 2AAMA 3SIZA 3RCYA 2PWDA 3P60A 2IKJA 5MKGA 1YE6A 3UESA 2W3ZA 3EX6A 1TQXA 4HHLA 4HMNA 1H2JA 2G96A 4DB7A 2PRLA 3SZ8A 4JICA 4NG3A 4P7LA 2TAAA 4IP7A 1UROA 4D1JA 4O1CA 1NARA 1OFBA 1HO4A 3GNRA 1Q4WA 1QMLA 4MSSA 1UUQA 3L2LA 4PTXA 4XZIA 1TCMA 4R53A 5IFPA 1E43A 4GXPA 2Q8ZA 1K8ZA 5BROA 2FH8A 1KBLA 4Q7IA 5E5CA 4YN5A 3L12A 4LC6A 3EMQA 4W5ZA 3BQ6A 3WNLA 1Q6CA 5F4XA 4GI9A 1TWIA 3W28A 3B9AA 1ZGDA 2GWGA 3WQPA 3KOYA 3R11A 1IGWA 5E0FA 2YL6A 3TLLA 5GJNA 3IWPA 1RXOB 4GUIA 1RVGA 2DSZA 2R91A 3GS6A 1FDYA 4EXBA 3D0CA 1XYLA 4Q4PA 3PTQA 2GGEA 5LA0A 4A6GA 4ZQMA 2P53A 2VUNA 1JJKA 5H1WA 1RBAA 3CIWA 1B3OA 2PDYA 3ARSA 1GJUA 2O4MA 1TUXA 1W9VA 2DP3A 1HT6A 2X1TA 4HQVA 1E6RA 2AOSA 4W7UA 1H1ZA 3B8TA 4IPIA 1KB3A 2CWXA 5AHNA 5IBXA 2D0GA 2E9BA 5JXQA 3IGUA 1Y0EA 4FF5A 1LCOA 3FLUA 5EA9A 3GQYA 1PL9A 3HQOA 2PPGA 1T8QA 4AY7A 2HVOA 3BW4A 4IPNB 1HJVA 1EUAA 2Y5SA 3AJXA 2OTDA 4Q8UA 4KCUA 3A47A 1Z89A 4E3TA 3ITYA 1GQKA 4K37A 4X22A 2ISFA 3N2XA 4IISA 1QATA 3VKDA 2INZA 1WDQA 2E28A 2GQ3A 4I9JA 3MUIA 2J7DA 3IRSA 3UFYA 3U48A 4GUJA 2OLHA 1RP8A 4Y6GA 1W3HA 3ZT5A 1EJVC 4GBDA 4D6JA 2YFOA 4FNUA 4FHAA 3DHPA 4R5EA 2CLFA 4C5ZA 1G67A 1Q45A 1K9DA 3H55A 1LJYA 3S47A 1KQYA 4UFIA 3A3HA 4EANA 3M44A 3KRZA 2Z24A 2OVLA 1BVWA 4HP5A 4H41A 4TVCA 3LLDA 3EWWA 1I1XA 5D2VA 3ITGA 4PODA 1EJXC 1NP2A 3G1VA 4FS9A 1JAKA 3RCMA 1SGJA 4MM1A 3PBWA 5A1AA 3LN3A 3R5EA 1W3NA 1E4MM 2EHHA 3KFTA 4J27A 1NIUA 2D24A 1SR9A 4DELA 1JI2A 2BMBA 1L6WA 2RGLA 3L4YA 4NF7A 2XIQA 4PH6A 2VDIA 4ZGYA 3GXDA 3LGEA 5BCAA 5CJNA 1REQB 2H9AA 1TWZA 1R9ZA 1OBAA 3WJXA 3KDOA 2Q01A 1QOXA 1CB7B 1P5BA 1XDLA 2QV5A 4A21A 3QY8A 2DZSA 3MVIA 1LWIA 4OUEA 1W1YA 3THAA 4L56A 1F3XA 1D8CA 4HOZA 3UR5A 3W38A 2OMAA 2CNCA 4ZFMA 2JF6A 2B7OA 3S3GA 4MWAD 5CPTA 4XZ9A 3H4WA 1TX0A 2DIJA 1DYSA 1QO5A 1PZ3A 4IHCA 3H24A 4WLCA 3O0FA 1YPXA 4F0HA 3QRHA 2OELA 1YRRA 1Z32X 3WDPP 4AAJA 4GO9A 1J4EA 2DU2A 3FHQA 3GNXA 1OGSA 1PJ9A 1TMLA 5BMXA 3AIQA 2JKPA 2CC0A 2GDUA 2BHYA 3SUTA 1JFHA 3GY1A 1UP3A 3RFAA 4AZ6A 2YA2A 2YCEA 3FAWA 3BAWA 2HS8A 3DGRA 1DL3A 2GJXB 1C8XA 2NVAA 2OQHA 4NI3A 3ZSTA 1Z8AA 2PDLA 3ARQA 1HVQA 3O15A 3QZEA 5F2MA 2VGFA 2J9YA 1H62A 3AIBA 3FSUA 2G3FA 1BYAA 4JY8A 4RZ6A 2F7FA 4WF7A 2BY1A 2ALRA 1OYCA 1VFMA 3AIUA 3BOXA 1FCQA 4YNGA 2PU0A 3FEMA 3PZ9A 3QYSA 3PUOA 2XN0A 1S2TA 3DBNA 5CQ1A 2UWFA 4DBUA 3WBAA 3GG1A 3AOFA 1LG1A 4HYRA 3P8JA 1W5QA 1YDNA 4KS0A 3DU0A 4DZIA 4N4QA 3ERPA 2WLZA 5M1TA 3VKBA 4UTIA 1XFBA 5BRQA 4L5ZA 2PDPA 5LNUA 4V15A 5E70A 3VKKA 3ZR4A 2DJLA 3G1AA 1EJUC 5C70A 3OIHA 4GHRA 4U28A 2VO5A 2ZX9A 4IG2A 3MYPA 3U5UA 1KBKA 1JPHA 3GW0A 5CZJA 3VMPA 4DNHA 4JDBA 2FLIA 3NOEA 3IUDA 1SM9A 1ITCA 1TE1A 3HOJA 1FDJA 3L21A 2A5HA 3AC0A 3RJXA 3P84A 4CCDA 2YL9A 3MP3A 1X98A 3VXGA 1P0NA 1EGZA 1DXIA 3CQIA 5C6MA 1IE7C 2HK1A 1CCWB 2NV2A 4ERAA 3GNPA 1B4EA 3T0DA 1FHUA 4K8HA 4U33A 3UCQA 3TUUA 1FWIC 4GY0A 5EGRA 4JTJA 3S5OA 1YBQB 4JL1A 4DJDC 3C52A 4B15A 5EMUA 1P48A 3W7JA 3TAOA 4DXVA 5HR7A 4L1XA 5HWNA 1Q6DA 1V7AA 3MI3A 5A94A 3LG3A 2VOMA 1IIGA 3LTYA 4GZIA 3K4WA 4Q8QA 2NV1A 4MIMA 3FVDA 1E1CB 2HNEA 4E38A 3CPGA 1F74A 1XLGA 3OTRA 3RG6A 1WZAA 3M43A 4ECLA 4AMCA 4G1NA 1WP6A 5FJUA 3PUEA 2XVNA 2XU2A 1PWMA 5D8ZA 4NNBA 3LNPA 3W7LA 5LIUX 1N8WA 4CEXC 4FIRA 3KP0A 3CIVA 3DXIA 3DGBA 3A21A 4AX7A 5AYXA 4X9SA 4ILSA 3LHWA 4IX2A 1KTCA 1JZ2A 3W7CA 1TR9A 2BVWA 4DM2A 2C3ZA 1HJXA 4OFCA 2OYMA 3MTWA 5GVJA 4XKYA 1NVMA 3U9IA 3KRBA 1QBBA 3N9RA 2E4TA 5K7JA 3W2JA 4JPGA 1E5NA 3SM0A 3N1AA 1V3KA 1UD4A 3AALA 2ESCA 1EOKA 5BMWA 4ZTYA 5I7GA 5HQLA 1K6AA 4IGHA 4M0XA 4TIMA 3PBVA 4ZCWA 1G7VA 3HMCA 3MDUA 1LF1A 2NXHA 3R0KA 3NSMA 3A5VA 1E9YB 5CPMA 1JZ4A 1V7YA 3N25A 2I5GA 2YDQA 4BF5A 2NT1A 2WVTA 4UMAA 3W1XA 4YTRA 4O19A 1MEHA 2O0TA 4NZJA 2QDHA 4OOZA 1ZRQA 3NZQA 3WK2A 3I6EA 4UCFA 3T8QA 1FDZA 4O1BA 3RITA 3U8GA 1GKRA 2OKTA 2WSPA 4QX4A 3WF2A 3V35A 1PAMA 2DSKA 5A8GA 4BI6A 4WXYA 5G1TA 1QWGA 5LKYA 3K13A 1OX4B 4AIBA 1VFOA 3QV8A 1FKWA 2GJRA 3GXNA 1M7PA 1QHZA 1US2A 1ISZA 1V02E 3IRDA 2DZUA 2QNEA 4GJ1A 3BOFA 4FIQA 1D3GA 3IAQA 3AUJA 1UIOA 5TAOA 1A5KC 3NDOA 4IUGA 2BGSA 1UOKA 1TPDA 2BP1A 4S2BA 1XINA 3DFOA 3PZNA 4GG9A 4WR3A 5GNYA 1S2WA 6TIMA 1BGGA 1K1DA 3HG2A 3BQ5A 3UBPC 3S42A 3WMLA 3GTFA 2PDXA 3IJ8A 1VLWA 1AL8A 3EXRA 3QMSA 4IGNA 1NH6A 1NAL1 3ABSA 3LOTA 3H2EA 4CN4A 3BG9A 3BSMA 2VDHA 2D1ZA 4LRTA 3SB0A 1NF0A 2FTPA 3MUY1 1KV8A 1M9HA 2WNZA 4JNYA 4WJ8A 3WH7A 1XUUA 1WCGA 1W5OA 3AMCA 4BF9A 2VENA 2CHNA 5DANA 7REQB 1OSEA 3GUGA 4AF0A 1OINA 4PUDA 4PMYA 1Z48A 2VD9A 5KSWA 1UD2A 4RDWA 1UWQA 4Q32A 3P67A 2PGFA 1RK6A 2V8ZA 3W24A 2WHLA 4GKTA 1VCFA 5CSSA 3S5NA 4FMVA 4IMFA 3RYSA 1TUFA 1WX0A 2ZX8A 3EA1A 4JZ5A 3SRKA 2XH2A 3ARUA 4I90A 3DH7A 3AXHA 4H6QA 5LIXX 3A3XA 1XGZA 6PTDA 3OYZA 3W4RA 3WBWA 5HMSA 3QYQA 3WBXA 2YR1A 3DX5A 4QTGA 2FDSA 1IEQA 2RGMA 3URAA 1VIWA 2QZRA 2HBXA 4P8VA 4B4HA 4R33A 1JG9A 2ZX5A 4NI8A 3OJGA 1GGOA 1NJJA 2Z1XA 1IZKA 2QCEA 1A5NC 4WDXA 1LQ0A 2I7GA 1OGGA 3OIXA 2V5BA 3UWVA 1E40A 2Z1SA 1W37A 1YXYA 3I3DA 3UG3A 4A35A 2ZZ4A 3R1ZA 2Z7KA 2ZIDA 2V5LA 4JQ3A 1GEQA 2QS8A 2QJHA 3VGBA 3WNKA 1SZNA 3S6TA 3I6TA 2V69A 3PWGA 2Q71A 3KP1A 3R8HA 4HK7A 4PUEA 3F5LA 2PDQA 5D05A 5A8MA 1YNQA 2NSOA 1BAGA 2VR2A 4F0SA 1MQRA 2QF7A 3CAQA 1BYDA 4TVUA 3OVQA 4QNWA 3GC2A 3GNOA 3L9CA 5DN1A 1BWVA 1H7WA 4C1NB 1KM5A 1QT1A 4MWAA 2Y5EA 3U2ZA 4RZBA 2J66A 3DKJA 2WSKA 4YVVA 1HTIA 1BXBA 1BHGA 2W27A 2P88A 1T40A 3E49A 5CSRA 3V75A 2VQTA 2XISA 4LV4A 5E0CA 3F4DA 3LSBA 2D23A 4LCRA 5LNRA 9XIMA 4RPQA 3WQ5A 3WUEA 3S5ZA 3P2VA 2GSHA 1B31A 1M68A 3M64A 3NEHA 2E6FA 3LA4A 3DC0A 5HUPA 4CCEA 4DX3A 3PZIA 4AD3A 1UASA 1LOQA 3WQVA 2R1MA 1E9ZB 2NX3A 4ZFCA 3AO0A 3A64A 1XLMA 5AYZA 3ZJKA 3F4CA 3W1MA 3QW4B 3BZGA 1J2BA 4URIA 3WUGA 4S1FA 4M1BA 3LQLA 3UZXA 3TWBA 5G2WA 5I3IA 5D9PA 4CQ9A 3BTNA 4ML4A 2XFFA 2BX7A 3GTIA 4BA0A 3DG6A 3NQBA 2FKPA 4QFUA 1UKOA 2FGZA 4PRTA 3DERA 1VPQA 3ZT6A 4D6CA 4MLRA 4CD6A 3SUSA 1NWSA 1KRBC 2JQXA 2XN1A 3RLUA 1US3A 5BW6A 4LXFA 3NZ1A 1ME9A 3G6LA 3WG6A 1DORA 4JIPA 2POZA 4R7JA 3VINA 1Q6EA 3FNDA 4YHGA 5AC4A 5EMMA 2EO7A 4NY2A 3GDRA 3PB0A 3VOGA 3E12A 4PBEA 5HA7A 2E8ZA 1MUMA 1JQVA 1RD6A 2OZ0A 5HULA 3WDRA 2W66A 4O0QA 4QSFA 3TQPA 2F2HA 4CCCA 4IQDA 1XCXA 4JR5A 3LB0A 1BWKA 4B90A 5CAKA 4WOZA 4LQ1A 3QLDA 2JEPA 2XJ7A 1ELSA 1K77A 2REQB 3DFQA 4EWJA 5T91A 2WK2A 1OCJA 3WD4A 4Z1AA 4GPNA 2VWTA 4G7EA 2VZUA 2DSWA 2O9OA 4UR9A 3BLDA 4RXFA 3PPHA 1S5WA 3QFEA 1PB0A 1E73M 2X0SA 4JHMA 4XAGA 1JRBA 4S3EA 5M03A 1SO4A 1EH9A 1WKEA 1H60A 2R8WA 2P3EA 5DCBA 1JZ6A 1ECEA 3B0UX 4HT3A 5CPQA 3WF3A 1K4GA 4ZENA 3WF1A 3W81A 2E7FA 4DO6A 5LZLA 2DVUA 2WAGA 3W7MA 1EJSC 2J27A 2G95A 4O54A 1AW2A 3NDYA 5K4XA 3F2BA 3CXOA 2X30A 2VFFA 3LI0A 4QRNA 2P1FA 1RSCA 4JKLA 5H6HA 3ALGA 1TV5A 4M29A 1MRQA 3NWRA 4HCLA 2RAGA 3VZXA 3NQDA 3HURA 4JEJA 1A0DA 1CECA 1ZNNA 1J5SA 2Y85A 4G7FA 3GAKA 2VOTA 4WQ6A 2E8YA 3AS2A 3NVTA 5FSDC 2R94A 3E2SA 1ZENA 1OC5A 2VC9A 3EB4A 2RKXA 3PG8A 3CT7A 2EPNA 1SO3A 3BK0A 1E6NA 4HU0A 2AKMA 4POCA 3LGGA 4MMWA 4DBWA 4YCOA 1S2UA 3E5BA 1XS2A 4L4MA 4J9JA 4AQLA 5BNKA 5IOBA 1ISVA 3BMVA 3DFYA 4TU1A 4Z1CA 4US5D 3QGVA 3VX1A 3BJFA 3FV9A 1UCWA 2V5CA 1B57A 2C16A 2VX6A 1F7BA 3BLLA 3AROA 4DNMA 2WOQA 3PWIA 3IV3A 4NZ4A 4CD8A 1LOLA 4AD0A 2D2OA 3TONA 4IH3A 2Z7GA 4GOAA 2HBVA 3QEZA 3D6NA 3PUDA 1UP2A 3WYZA 4GQBA 2DJXA 2J7BA 2QDEA 3GE7A 1EC7A 3W6YA 3GKAA 3IIPA 1W3IA 3VVGA 1K8XA 1EJWC 1W3LA 2E68A 4DUXA 3KEHA 3EWUA 3N11A 4UOJA 2INFA 2P50A 2D2GA 5BWAA 4KETA 3B4UA 3N2BA 4JTDA 4JTSA 1VAHA 2OEJA 4GXWA 3TYZA 3WK1A 1XDMA 4EK7A 2V81A 3KCLA 4S3BA 4K39A 1PTGA 3GH7A 1XIGA 3WDQA 4JQ2A 3H21A 1D2KA 1QPNA 3IK4A 2WWDA 1UJQA 3SEPA 4IUOA 4B2DD 4AYGA 1JUBA 1TTQA 3QTGA 4PSPA 3E2QA 2BY3A 2ZRVA 5LXXA 3KLKA 3GDLA 4S3FA 1IGSA 3CB3A 2J78A 1EWEA 1IWAA 4GYFA 1AUSL 1IEXA 5GPRA 2CLHA 1TO3A 1Q2RA 1GHSA 1OIFA 4IWWA 1W5NA 2NQZA 1IT8A 4AWTA 4GBUA 1RQBA 5FOOA 3VABA 1PSCA 2V5KA 4O8AA 3H22A 3T44A 2DSVA 1M6JA 2BV9A 4FXRA 4XB3A 3BANA 3P0WA 4JFVA 4N4PA 4H9ZA 5BWFA 2Z2AA 4F79A 4IMCA 3PS7A 5LGZA 5HQEA 1Q6QA 3CH0A 4JX5A 2Y7FA 3C6CA 3BGJA 3G22A 1R3WA 1EUNA 3VM5A 5T8GA 1W9XA 2Q02A 3MZ2A 3B8UA 3G1HA 3OVGA 3WLIA 2YCLB 1LUCA 2C7FA 1A3WA 3HFYA 3OZYA 1EBHA 4H8HA 4XD5A 4HA3A 1BG4A 4IQEA 1E55A 4KQNA 5D4YA 2WYSA 5LYRA 4ENLA 1J8VA 2A3AA 4HSNA 1XD1A 3Q4DA 1TV4A 2YBUA 1GTEA 1KRMA 1YHTA 4QLJA 5G4HC 1SU5A 1QPKA 3PZVA 3IJ9A 3BSGA 2V3FA 2BGNE 3KL0A 3CUGA 3UWYA 6ALDA 4Q8PA 3S2MA 1GVSA 4IX0A 1N2VA 4KH2A 2PC4A 5D9MA 3KVJA 2BHUA 2ISVA 4HSHA 2H8ZA 4AZBA 2VZTA 4QGCA 2A3LA 3TDFA 2IKGA 4PC8A 2WM0A 1DXFA 4JHOA 3A24A 4CN1A 1XIHA 4XTIA 3TYUA 2JK2A 3W2LA 2XIBA 4LUJA 3OVRA 1OJXA 4FOUA 1DJQA 3A9IA 1TWWA 4JYDA 1Q8JA 1M04A 1C90A 3GK0A 3HF3A 3APTA 6XIMA 5DMNA 2J7CA 3TXVA 2R1NA 4E2OA 5D32A 4DJDD 1ZB5A 3VCRA 1X8FA 1D3CA 1B9BA 3O3RA 1FWHC 2XVKA 1OD0A 3G3MA 2WWCA 3OBAA 3T9PA 3PHAA 5XIMA 4B5SA 3MC5A 2A3HA 3M1ZA 4YXGA 1O7AA 1R30A 1T0OA 2OU4A 3WY1A 5KZDA 3CS2A 3A22A 1ADSA 3GSMA 2ZWZA 4F2TA 5ABFA 5LNWA 4KCTA 1JYWA 1C3FA 1TFVA 3P5ZA 3R12A 1AMKA 2ASHA 3NJ3A 3CMFA 3T1GA 2H9AB 2E09A 1WDSA 4NP7A 2AQWA 4O52A 2ZA1A 3W1PA 4H01A 4NXSA 3T78A 3FJ4A 2X2GA 3IK2A 5LNSA 2QW5A 3Q67A 4ADTA 5HOSA 1N8FA 2ICSA 4JTHA 1JZ7A 1YPFA 4ZSTA 2BZNA 4PTMA 2J24A 3MMWA 3DEQA 3FGCB 1NEYA 1OM0A 1LRQA 3NQAA 4PUMA 3T0AA 1F8MA 1XL9A 3L4TA 2WMFA 1JI1A 2Y88A 4IM4A 2CESA 2G3NA 4ZQPA 3VIMA 4DLFA 1JXJA 1IIHA 3UYIA 1TPUA 3M5XA 1LWHA 4GK8A 3W7HA 4UR8A 1ONRA 4LAMA 3AMLA 2CXGA 3T0CA 3MDWA 2YBTA 4I3GA 2E1WA 4DF0A 1V6VA 3FSTA 4UQ9A 4MHBA 3GUWA 4YIWA 1CXKA 1XBXA 5I00A 4GUGA 3VD4A 1JZ8A 4UQDA 2DW7A 4B3KA 3M6DA 1KO0A 2VKZG 4J3ZA 1PKYA 3BLFA 3DKLA 3SCSA 4K2SA 1K9TA 5HAOA 3NZPA 2CLIA 2WZIA 5BXTA 3TE9A 2H90A 3WLHA 3REQB 4UTFA 2Y5JA 1SPQA 3KOXA 1OGBA 3OZPA 3WQ6A 7XIMA 1YDOA 2Z1KA 1W1TA 2PC8A 3QXBA 5CGTA 4U2ZA 3V1PA 5D30A 2G8ZA 3WLSA 2GLKA 4BY3A 1US0A 4OWGA 3DDMA 1X7FA 4IMGA 4MG4A 2LLEA 3PWAA 1XLLA 1XSKA 1WXZA 2G3MA 1DTNA 3I4KA 4GH3A 2WKLA 5D2TA 1HP4A 5CJMA 3WDHA 1YQ2A 1SMAA 5A8QA 4JYEA 1SZEA 2D0FA 4ADSA 4IG2B 4L6DA 1RCXB 1WDRA 3LZ5A 2AMXA 4WGXA 4LVFA 1L0PA 5B7ZA 4KT2A 3WD0A 2GSJA 1A4MA 3PBMA 3O63A 4UR7A 2GJLA 3V5FA 4Y8EA 2B7NA 3RLVA 1O60A 4MUPA 1QBAA 3AWOA 4US6A 2WMHA 2I9EA 3ZXWA 3L0GA 1OK4A 1DIOA 3RF9A 4TX8A 4UQCA 3H23A 4OU1A 3GU1A 3ZLFA 1JCNA 3VZYA 5C2CA 1CBGA 3NO1A 3ZZ1A 4ACYA 2UY3A 3RRAA 5BU6A 2ZUNA 3O2LA 3OHMB 4XSLA 3SY5A 1WXYA 4KWSA 1KRAC 1I2RA 4FNTA 1J0IA 1UA7A 3RJYA 2DIEA 2HMCA 5G1YA 1KC7A 5I07A 1M5WA 4MOZA 1XIIA 1NQ6A 2X1UA 2W91A 3UP8A 3NQ2A 5EYWA 4AC1X 4KIRA 3AZRA 4HZ8A 5MF5A 1F6PA 1XIMA 5ABTA 2XH4A 3NSNA 3M5ZA 3I7QA 3VIOA 4I9MA 3TYAA 4C5YA 1BXNA 4U31A 1FFQA 3N29A 2QIIA 3ONBA 5HMEA 3LU2A 1S5NA 1LYXA 2IPWA 5DMLA 5JUVA 5M5DA 4O57A 4A8LA 4NZ1A 1AQMA 4B5XA 5AHIA 2YBVA 1UD5A 3E2VA 4KKXA 4JKKA 5CBIA 2GQ8A 4O1AA 2QUVA 4WSHA 5CBJA 1W32A 4UTLA 4JFSA 2FPYA 3T4WA 3D46A 4WZHA 3RIKA 5CBBA 3W71A 2YCKX 3WQOA 4US5A 2FIQA 3TTOA 3W7OA 2PDFA 1HX0A 3MO7A 5D02A 3HMJG 4XG1A 1R38A 2BSLA 4PMUA 3N15A 3C8NA 4CQAA 3H53A 3BAJA 2QCCA 3VK5A 2QJIA 2WXDM 4J5NA 4TO8A 5BXPA 3QGKC 4GVIA 4HA4A 2ZTKA 1WZKA 4EPEC 2I14A 1L2QA 3GM8A 1C29A 2HEJA 3UWEA 4AEFA 3ITOA 3AMKA 4GKLA 1VJZA 4UQAA 3B05A 3W76A 3PZTA 3IV8A 2VD8A 1M65A 3M0IA 4M1RA 4MZ8A 4O17A 1RBLA 3GZ3A 2V3GA 4H9MA 1QDSA 3MU7A 3IJIA 5CAHA 1JQXA 1WAUA 5CCZA 5CC7A 4NAFA 2HJPA 2TRSA 4QNEA 3PVFA 2W67A 1X6LA 4LH8A 3QV6A 2PDWA 4H7CA 4EIVA 2PZ0A 1ONEA 4RE0A 4FR6A 4HN4A 2FHCA 4A2RA 4ZXOA 2PF0A 4B2DA 3S8HA 3SUWA 1A5MC 3VGFA 3W2KA 4LX4A 1LBLA 3AUOA 4GX9A 5DBTA 2ZFAA 2J9ZA 3PJXA 4MLJA 4AEEA 4GNKB 5KZ6A 1XSIA 1PHWA 3NYZA 3WH9A 1TWSA 1VEOA 4W88A 3QC0A 2VEKA 3TNBA 2OODA 1JXKA 4I5XA 4XBJA 1JDDA 3ITLA 4GFSA 3BMXA 3OLIA 3VD5A 3KVKA 5A6TC 3CBWA 4HPXA 4HYVA 1QUMA 3L66A 3GLCA 3IUHA 1FHDA 4A3YA 3E5PA 1RR2A 1K70A 2NZLA 1QO2A 2D3NA 2WJEA 1HKVA 4NJHA 1V3LA 3RK8A 1AL7A 1JPMA 3USZA 2EGZA 2PBOA 4C6CA 4V1XA 5DCEA 3DFHA 1OB0A 3HJZA 2PDHA 2I57A 3OP2A 3N14A 4O11A 2NX1A 4WCJA 1A3XA 4K8EA 5DT7A 4MY8A 1KR1A 4ZMGA 1V77A 3HQ1A 3AIWA 1D8WA 3CMGA 2IXVA 2EG7A 1V51A 4NSBA 3UWWA 3MKCA 2DEPA 1X8CA 3DFNA 2X0HA 3LPOA 4NL1A 4DIAA 2ABAA 1UZ1A 1Q66A 4F48A 1W9BM 1R85A 3FYYA 1SFTA 2FYMA 1WZMA 4IJRA 3E0IA 3M41A 1WUFA 4PTVA 4EF8A 4ZE4A 1ML1A 3NURA 3ZSSA 1V93A 2YSWA 1FWJC 2Z29A 2CERA 2HISA 1W31A 1REQA 4D72A 4Z1DA 5I79A 4GQQA 4FI4A 3CZJA 2F61A 4DY1A 1O4UA 2OSYA 3POCA 4AEOA 1AW5A 1S3HA 2BY0A 1RALA 2YXXA 3PZMA 3VOIA 4ALDA 1R2TA 2OEMA 4MUZA 2Y70A 3JW7A 2D3LA 2ZXBA 4IJCA 2Z1BA 1L6YA 4X9YA 2VZOA 3HGSA 5EY5A 1OY0A 4E8CA 4Z0SA 3RU6A 3B3DA 4N6FA 1BVNP 2XVPA 1I60A 2HVMA 3GNDA 3C0QA 1TPEA 2HWGA 4GLEA 4OBTA 4RUBA 1WE5A 3WN6A 3DAQA 4U5KA 1TYGA 2PRHA 2OX1A 1VBHA 2A3BA 3LCIA 4C6QA 3FJNA 3GZAA 2EQDA 2J75A 4D6GA 2ZQ0A 2Z4GA 3E3HA 4OQVA 3T40A 1AJ0A 2QVHA 1H1YA 1QPRA 4S39A 4A2SA 4LYRA 3T7VA 1FY6A 5D9NA 1S1RA 1M3UA 1KXQA 3KVMA 2EBNA 2WSRA 5JVLA 4HOXA 4GRSA 1EA0A 1UMYA 1O68A 3ZT7A 5C0QA 1PX8A 3G1XA 3LXBA 2KZHA 4K38A 1I4NA 1W91A 1MWOA 4PB4A 4N9DA 2XFYA 1DBTA 2ZXDA 3O6CA 2F38A 4GGHA 4QE5A 4UNLA 1V0MA 1IEVA 3THQA 3OQEA 2WBGA 2IQ0A 3TJXA 2CBUA 2C0AA 1ME8A 2GDQA 5HJYA 1KGUA 3WFLA 2XIIA 2ZZ5A 1OFOA 4JTFA 3V0SA 1P1MA 2JF7A 5CPLA 3SFKA 4C91A 1H49A 1Q85A 3S5YA 1XQLA 4J2PA 2DV0A 3TYEA 3QLLA 4N2YA 4HHPA 2GK1B 3ZLHA 3EDJA 4RLIA 3WF0A 4PCNA 3OO2A 1ZCCA 1LBMA 3CUZA 4GIRA 1E6ZA 2PGEA 1K03A 2X40A 1E0WA 1KLYA 3C86A 3LX9A 2A4AA 2ZZ3A 3CQKA 1M1BA 1PPIA 3PNZA 4FP1A 1R9YA 4UTUA 4GNVA 1TRIA 1QPQA 1B3XA 4H8UA 3WNMA 5KETA 3T0TA 2OYLA 1Y7VA 1YW1A 3EA3A 1OX6A 2C1HA 3ONCA 4H9YA 4GUFA 5EKYA 4F8XA 4GISA 5I77A 5XIAA 3OZMA 1KNWA 3VOFA 5FF2A 2RDXA 3BAXA 1A3HA 2X7VA 1BSLA 1EP3A 3W6LA 2VRQA 3GB6A 2YGYA 3C56A 2RHGA 4PMZA 3TFCA 1YBQA 3FN9A 4AHPA 2E5BA 3NXLA 3N18A 2IPGA 1RY8A 3L65A 2WVSA 3I4EA 5MHBA 4JGDA 1HP5A 4G7EB 4QS6A 4E4FA 2J8FA 2FB3A 2PAJA 1KWKA 2YCIX 4W84A 1E1CA 4AZ7A 3MQTA 1YXCA 4UXDA 3PBYA 4QHRA 4LNYA 3EEGA 2WHJA 5JH2A 3S0CA 1ZUAX 3LCWA 4R27A 3SCRA 1ZJBA 3OBKA 1XRVA 4DBDA 1KCZA 4H8NA 5HQMA 1HF6A 3AHTA 3CZGA 1PZ1A 5FI8A 4RE4A 1SSDA 3QKEA 5G5IA 3GWQA 1G01A 4HGXA 2ZX6A 4H6RA 2HPMA 3T07A 3G1RA 3MPGA 3CQJA 4HMEA 1SO6A 4QISA 3ZO9A 4Y90A 5A6AA 2YKKA 1GOMA 3E96A 5C5YA 3B04A 1BPLB 4KEZA 1VHNA 3U2CA 3BVJA 4IL2A 5JBDA 1TG7A 5C9RA 3AYVA 4W9TA 1V5XA 4YYCA 3B0XA 2GYIA 4XAYA 1MQPA 2FPVA 3W82A 2Y2WA 4DYKA 3NM3A 1BEUA 1TRDA 2WM1A 4WEVX 4QLKA 1L9WA 5EFDA 3M0VA 1R8LA 4PEEA 2X2YA 2O56A 1TELA 3BSHA 2VMFA 4F0MA 3TR2A 3MB9A 4QS5A 1HJSA 3K46A 4LT9A 3NFUA 2GPTA 4LVGA 1OG0A 4QG8A 4RZ5A 1V03A 4BS0A 2W63A 3NA8A 2B4GA 4B5WA 5CLTA 3N4EA 3L2IA 1ITUA 2PP1A 5HDRA 1PHQA 3SQSA 4ZXLA 4EVZA 1DWHM 4HD5A 2VCCA 1C8YA 2Y8KA 2V5JA 4XZNX 2FB2A 2ISSA 4GWEA 5AZ0A 1XIDA 1UPPA 2INEA 5IDIA 2WMKA 4HNNA 3SN4A 1E0UA 3MMDA 3GBDA 2XTKA 4AFYA 1EDGA 4UTTA 4QEEA 2IQTA 3F2CA 2FJKA 4P8WA 3ITCA 3W26A 3M5VA 6REQB 4L6OA 4GABA 3H8AA 2VWSA 4UFMA 3BUVA 3RX4A 3VMNA 2PRMA 1P7TB 2ZRXA 1SJDA 3LCHA 4AHQA 4WY0F 3WF4A 1PKMA 4AD5A 1ADDA 3T55A 3IGXA 4HK5A 2O9PA 4GO8A 1JGMA 3DFSA 1TX2A 4KW2A 4N9CA 2C6QA 3SJNA 3E38A 3POHA 4HNVA 4S3AA 3LLFA 3KVLA 3KX6A 4KERA 2W9MA 1LT8A 3T09A 2QLYA 1QI5A 1KCKA 3BE7A 4UMBA 4DYJA 4ZR8A 5D38A 3LTSA 2ZUTA 4R9OA 4LJ3A 5LA1A 4DJEC 2P5NA 1FVPA 3OODA 7REQA 2WJDA 2HRWA 1IEIA 1ALDA 4FB7A 1V0LA 5DCDA 1FH7A 4O1EA 4LGXA 4FX6M 4MDOA 3SGGA 3Q94A 4HJWA 4JTKA 4DWSB 1F05A 5ABHA 1CPUA 5F2GA 4NJIA 3L7RA 3R43A 1AA1B 2PS2A 1QRQA 4X2PA 1W17A 1AH4A 1D9EA 4Q6XA 2VR5A 2ZE3A 4Q8OA 1E15A 4XQ6A 1ME7A 2WC3A 4LTSA 3CWNA 1FH9A 3QV7A 4PR4A 3W87A 4O14A 3DOPA 2ZRUA 1VPYA 3KWXA 2YZ5A 1CX9A 4AISA 2I5QA 2BBFA 2C1IA 1MW1A 3HFTA 3WELA 3VGDA 1UR4A 3QSTA 4Y96A 3RM8A 1GYNA 3BV7A 1KFBA 5FJJA 4FOJA 3KL3A 5DFAA 2XYLA 3WQ4A 4GYJA 4Q8VA 3NQ7A 3QC3A 4ZOBA 1UKTA 4PBFA 3GYEA 1IV8A 2V6AA 4JN6A 4GACA 2XZ7A 5DY2A 4IZGA 4LALA 2XFWA 1XHGA 1GVEA 2POTA 3LHYA 1EF3A 3UWUA 5REQB 3QMTA 5DELA 4IQJA 4QDMA 3IARA 1UG6A 1JCYA 5BU9A 3S1WA 2O92A 1SO5A 3MUCA 3PFMA 1XYZA 4K68A 2DZAA 3WEZA 2ZVIA 1H7OA 3H54A 2PGRA 1Y5WA 4L4PA 1JRCA 3LV6A 4JNMA 3J7HA 3AYSA 4C6MA 3APGA 4C1NA 1O6IA 1JD7A 1VBRA 1HL2A 3IGSA 4DRSA 3DHFA 5A2CA 5K2ZA 3DENA 2DUAA 3FJLA 4DM1A 3R2GA 2G4FA 2ZE0A 2FMNA 4C6BA 4D6HA 2NUWA 4Y7EA 3L67A 3NZRA 5A8NA 1W5PA 4P2VA 1FH8A 3L23A 1X7IA 1G4EA 3AHYA 3O0KA 4QJ4B 3T81A 1HXJA 5AN7A 1U5HA 4XAFA 3QQ1A 3UVIA 4ORIA 3NQCA 3MV01 4NQ1A 4GGBA 5FJIA 4NKCA 4S3GA 3A9BA 5BOFA 3I6RA 1NDWA 2DT2A 1GPFA 3FOKA 5TF0A 2VFHA 3TNOA 3MI2A 3RPDA 1UP0A 3IUIA 1JDAA 1FWBC 5CPNA 3VD7A 4XUYA 1XW8A 4TOQA 3TV8A 1RQHA 2J7EA 2OLAA 1LLOA 2EF9A 4YPJA 3WJYA 3C2OA 5IM51 5TD4A 4AWUA 2V5DA 2A3CA 3I10A 1BF6A 1S2CA 3G0UA 1KXVA 1UQYA 2FQIA 3F7JA 1U1UA 1NFGA 4DWSC 4J40A 2Z6JA 4JN7A 4RCXA 4AU0A 5EB8A 2R1KA 1RCOB 4DI8A 2P8CA 4UOZA 1HQTA 5K9DA 3GVQA 4Q8NA 4QROA 3M0LA 1YKWA 2OPJA 4K1GA 2HVNA 4JFWA 2GL5A 4HPGA 3B03A 1RJQA 4YU1A 3HG4A 2P0IA 5KITA 4Q8WA 4DUWA 3WUFA 1VH7A 1JCJA 2XDFA 4K6AA 2ZZ7A 2E0PA 2YYTA 1PEZA 3TSBA 2B7QA 3BO9A 1WDPA 4IFKB 3KWSA 2A7PA 4AVOA 4IJBA 3CUXA 3R7MA 3UXDA 1GW9A 3AZTA 4BR1A 4JTRA 4MYAA 1FTXA 1KR0A 1Z69A 2P10A 3HGJA 3ORWA 3PJWA 3TN5A 1RBOB 4GQRA 2O4QA 2GQAA 2QCHA 4K7YA 3P74A 5AC7A 1P0DA 1SQ7A 4MY9A 3SQMA 1GOIA 1FXQA 2QR6A 4HNLA 3EWDA 3TC3A 3W53A 2C13A 4NILA 4TTUA 4EF9A 4MB1A 3BG5A 3K8MA 1SFLA 4A8RA 2O55A 5FEWA 1U33A 1UIPA 1W56A 3L68A 4F2BA 5T9BG 1OT1A 1SFSA 3P81A 4I5UA 1P1XA 4CD5A 1K7EA 1QHOA 1YPIA 5F1VA 4AZGA 4C6PA 1A0CA 2G3IA 1PUDA 4ZB0A 1TJRA 4LS1A 4RNFA 4NASA 5A8OA 3IACA 3L4WA 2BG5A 4O18A 3UCDA 4B16A 1ZTVA 4GD0A 4CQDA 3VIJA 5CG0A 4QSHA 5EMLA 2UY4A 4QCEA 4JTLA 4GJJA 4PL2A 2Z00A 1CIUA 3RPTA 3I7RA 1F8IA 4B91A 4AXKA 4KEUA 1TMHA 4K1WA 4DYEA 3WBYA 4WJXA 3WQDA 2XFRA 4V2XA 2YW3A 1K4HA 3SR7A 3ALFA 2W61A 4P7RA 3INPA 1EJRC 3H7RA 2VR4A 3D3FA 3GR4A 4M3PA 1KXTA 2R9RA 4F40A 3EWZA 3PC0A 1THFD 3W1RA 1PO9A 1XLEA 2HZGA 2RDUA 5HJLA 1XG3A 1MUWA 3BURA 1SW3A 5G1MA 5FJTA 1MDRA 4PFMA 1A5SA 2PCEA 3LRMA 1MNZA 3LHUA 1ZAJA 4NAEB 3JVAA 1V79A 1IT0A 4XZBA 5DMYA 1Y5XA 1I8JA 1O5QA 4RZ4A 1R3RA 3A4JA 4LOCA 2YOCA 1B90A 3KS6A 3UXIA 2YZRA 1HVXA 2HPIA 4DN1A 5FA5A 3T08A 3AYTA 1TZZA 4MJ2A 4ROPA 1F6YA 4JN8A 2GVJA 4FNSA 2R1PA 1O5XA 1V0KA 2J77A 1JNEA 1PBGA 1U22A 1MFVA 5AHMA 3RLGA 4Q8MA 3LCXA 2RH9A 3MKKA 2DDXA 3THDA 3WL0A 1JDCA 3MV11 4Y9PA 2DPEA 3OLEA 3SURA 2F6KA 4P61A 3EDEA 3WZ0E 1A0EA 1QNSA 3P14A 4J4KA 3ZVIA 4N7QA 4N02A 3VIGA 2VFEA 3CQ0A 1JD9A 2YXOA 4QJ5B 2Y62A 4AY1A 4C1KA 5AVNA 4I8YA 2E9LA 4HHMA 4HSOA 2J8GA 2G0WA 4UQEA 4ZO6A 3AHZA 2EJAA 4PMOA 3BMWA 1K7XA 1U30A 5G4EA 3W29A 1HZYA 2ODOA 1BXCA 4J1OA 4K3ZA 3ME3A 4NIRA 4CQ8A 2ZC8A 2HDJA 2YB4A 4ES4A 1I6NA 3VPLA 4NAFB 3Q2DA 3H2OA 2FVKA 2XGZA 5A6MA 2PURA 1JYXA 2QCMA 3KCOA 4INFA 1XPYA 3KL5A 3ARZA 1MZRA 3EB2A 5D2YA 2NQLA 4PUKA 4NX5A 3CUJA 2CETA 3QQ0A 1DIKA 3N17A 1XIBA 2NVCA 4HA0A 1BWLA 2PDKA 2YCLA 2ZDSA 3EYPA 3VM7A 1KA9F 2YIHA 1F2JA 3FCPA 1C8QA 1CLKA 5D37A 4GVHA 3G8EA 5HBFA 5F4SA 1H7XA 1TTJA 4FX8A 4HK6A 3U4AA 3V1HA 4C1LA 1JCXA 5HMFA 1VBUA 2CLMA 3VNMA 1HKWA 3ATYA 4JX4A 2FVMA 4FXSA 2DORA 4TQTA 4E0CA 3TC6A 4BI7A 3UR2A 4MDPA 3TXZA 4PMRA 2PTYA 3GFXA 5KMYA 3P80A 1OWQA 5EU9A 1KBIA 3VNJA 4FLQA 3CLWA 1EIXA 3ABOA 4OTKA 3CHVA 4HBKA 1PKNA 3TJLA 3QW3A 4H8VA 2XHYA 3SN0A 1G9HA 3BOLA 4U5IA 2WV8A 1JPIA 3TOYA 1H5YA 4ZA0A 5A95A 1VFHA 5K9XA 3GW3A 2BY2A 3WEMA 3K5XA 4B5VA 4M5PA 5H8PA 3AS3A 1XXXA 5DT5A 4LUYA 3FY1A 1EKOA 2JIEA 1VYPX 1XUZA 1J01A 1LBFA 2X7WA 4WSKA 3NOYA 2C0HA 1XRFA 1DJHA 4O53A 4NNAA 3RR1A 2TSYA 4IFRA 4GVFA 3TKFA 1EJ7L 4G6CA 4IMDA 1JZ3A 3TN4A 2VQUA 3WK0A 2PDJA 4DJFC 2ZCGA 3IVTA 1LM1A 1QR7A 3B0VC 2TYSA 4HMCA 4GX8A 4GUHA 3ARRA 4LUSB 3W7QA 4A3RA 1DKWA 3CHFA 2GUYA 2J7FA 5U4NA 3L0NA 3PPFA 4KFNA 1YXDA 3C0LA 1EB3A 3M0KA 3MYOA 4GY7A 3GVGA 1NFPA 4OUIA 4ZB2A 3T8LA 5AHLA 4DLMA 4UB9A 1UR2A 3KOFA 4ZQRA 2OJPA 4IPLA 3GC5A 1MRAA 1Z7AA 3BLPX 3FEQA 3GO2A 4TVDA 4Z1YA 1OG6A 4KRTA 4UFJA 3B8WA 3FGCA 3GHUA 4BEQA 3W2UA 1G6CA 4QLLA 2VELA 4WX2A 2GWNA 2NT0A 2WPBA 3CWOX 1EF2A 3TA6A 3SADA 4EX4A 2JIWA 5HUOA 1CXIA 1OZMA 3ELFA 4S3DA 2PF8A 4NJJA 3HV8A 3VNDA 3OZOA 1UWRA 3IVUA 1QTWA 1QOPA 3V36A 3BCFA 4LVDA 3P7YA 3N4FA 1SYTA 1E72M 3WQEA 2B7PA 3WIJA 1Q13A 5FJRA 3AHVA 4WUIA 3LMYA 1J18A 1NQKA 1CXHA 4FZIA 2HV5A 4HPNA 2NV9A 4E4PA 3RM4A 4MFEA 4FK9A 3WMBA 3REQA 2JE8A 2QUMA 4EP8C 4F4RA 1ODZA 2DW6A 4M8UA 3V0UA 2C1GA 3EKZA 1F4HA 4LYPA 3THCA 4EWND 2G41A 3QOKA 5GNZA 1V08A 4O16A 4AZCB 1B5TA 2ZBTA 1V6XA 3VU2A 4Z2GA 4M51A 2PWFA 2VEIA 3LBCA 1W8SA 4W5UA 1TV3A 4FNRA 4NT0A 1KTBA 4TV5A 1WPCA 1QW9A 1AQFA 3M0JA 4MYXA 3PNUA 4XVEA 4EKJA 1F07A 3E0LA 1ZP3A 4OIFA 3TK7A 4B9ZA 1HGWA 3WLRA 4M6UA 2NLYA 2ON3A 2PODA 4L1WA 1S5TA 1YTKA 1E1FA 1PDYA 3IIZA 4AVNA 2F84A 1QK2A 4H2CA 2YDRA 2CPUA 2Y4SA 1BSIA 3B40A 2J88A 3N6QA 3NEVA 1TJPA 3BC9A 1R46A 1VBJA 4M7TA 3HG5A 1ZJAA 4XV0A 5AC5A 2E3ZA 4MB5A 2QGYA 3L4UA 4AXNA 4HU8A 1EBGA 3WH5A 4H00A 3OG2A 1LTDA 4CCZA 3O05A 1VCVA 1OFRA 3FVMA 1JCLA 2EKCA 2WMGA 2W92A 4B4FA 2X0YA 3HTWA 4DJED 7TAAA 1SJBA 4UMCA 4WDWA 1XLJA 3CAVA 4MZYA 1ZALA 3ZJ8A 5J5RA 1S5VA 1KXHA 1WYIA 1ISWA 4IPJA 4CNTA 1CENA 1Q7MA 3WJZA 3EPMA 3FX4A 4L7ZA 5A69A 4AZ5A 3HGOA 5B7YA 1UOZA 1KKOA 2DZTA 2C91A 4G8TA 1LZOA 2WSQA 4CUCA 1OC6A 2QIWA 2VEPA 3KZSA 3WLJA 2VEGA 1KFEA 4RNIA 3VFLA 2FPTA 2CLLA 5AFDA 3PPGA 1ZBCA 2WPGA 2XZ9A 3DBPA 3STFA 2QHAA 3VNYA 3EX2A 3TROA 3UGRA 5C9UA 2OEKA 3NIYA 4V28A 1C8VA 2I16A 3A23A 2DIKA 3RAOA 1XCFA 4FNPA 1B3VA 3MJMA 4LPCA 1W0MA 2CU0A 1B4KA 3PF3A 3N6JA 4LBSA 3NPXA 4ZQOA 4QBXA 4P8UA 3W7NA 2PDIA 4MGGA 5K3VA 3URBA 3GAYA 5KINA 1QXLA 5L9FA 2ZOXA 5FCZA 3UJSA 3AXXA 1H7PA 1UD8A 4GFIA 3EOOA 4AX6A 2C14A 4LS0A 2B81A 4WSJA 1KCLA 4PZVA 1BLIA 1S46A 2BXZA 2YFNA 4QCFA 4WOQA 2UV8G 5C8BB 1OFPA 4JDYA 3E2RA 2ZC1A 3QMRA 1VFUA 5CH9A 4JL2A 1IXOA 4GXMA 3WFZA 2OKOA 4H9XA 4JY9A 1MEWA 1TVPA 3G8RA 5C71A 3UG8A 3K2GA 4GMEA 4DWDA 4DPQA 2XN2A 3HPSA 1R7AA 1HKJA 5CZTA 2E6AA 4Q22A 1M7OA 1X6NA 3N12A 2A6NA 1FWWA 4UUIA 1FCBA 4REQB 3MHGA 1DWAM 2FZDA 3SY8A 2QUNA 2WVUA 3CB8A 1UMLA 1FWCC 1XJBA 3DFPA 3VUSA 4L4OA 2ACRA 3TQ0A 1S2VA 1P6CA 1WOBA 2R82A 1ZAHA 3COTA 1EQCA 4DQWA 3VILA 1CXLA 4XIMA 3GG8A 3W25A 1CXFA 6XIAA 3EDFA 3WH6A 2GDVA 1Q5MA 3VO0A 4G56A 5F1UA 5HJXA 3DG7A 4AIUA 2CKSA 4QQ3A 4HCHA 3JS3A 4IL0A 3T6CA 4R34A 4I9TA 5EBAA 4QG9A 1OCBA 4NZFA 3PM6A 1POJA 2TODA 3TSMA 3WBEA 4E4UA 3TYDA 3R0UA 5EL1A 3YPIA 2NQJA 3NCOA 4N42A 3MVTA 4DWSD 4KWWA 5HANA 4QM1A 3XIMA 2J74A 2CWNA 4S23A 5TBOA 1QNVA 3KRSA 3LD5A 3LHVA 5CPSA 3CHCA 2GOUA 1E9LA 1BRLA 3VC6A 5I3DA 1VYSX 4F0RA 3S5SA 4WK9A 3RNDA 3ARPA 4GCXA 1WOAA 1P6BA 3LS9A 1L8NA 1XH2A 5XINA 1O1HA 4WGHA 2CLOA 3WKZA 1DIDA 1B3YA 3LQGA 3PTKA 3N9SA 4L64A 1XG4A 1FHLA 4C6DA 1I2QA 1UZ4A 3GG7A 3W3OA 4NVTA 1MMFA 3W7RA 2CBJA 2ZXQA 4PMDA 2W4XA 3SN1A 2P8BA 4PUNA 1ZJIA 2WHMA 3MHUA 5AECA 2Q8XA 2PCQA 4D2JA 5I09A 5CC5A 5BRBA 1SZGA 3KAOA 2HXTA 1OX5A 3WNPA 3OLGA 3KHJA 2VGIA 3N04A 3NPWA 3TC7A 1K6WA 4L1GA 1DE6A 4DBSA 2W5FA 1PDZA 3CHDA 3VIIA 3GHTA 3PULA 1F73A 4HIBA 1S38A 2RDWA 3R8GA 3QY6A 4BHYA 4DO5A 1RQEA 3RU8X 5FJOA 4C6KA 1E70M 1NP0A 2J6XA 3U3HA 1XIEA 1M53A 2CLKA 3O07A 3M0ZA 4I5RA 2GUBA 3CLMA 3F4VA 2F6UA 3TYCA 2A79A 1H09A 3TTYA 1PX3A 4V33A 3BAKA 3F5JA 1S3TC 4NNCA 4O4WA 8CGTA 3NO5A 1MVYA 3I3BA 1YTDA 4XSMA 4CQCA 1OIMA 2YB1A 2Y8UA 5J8LA 3AHXA 3MMTA 3K1DA 3GH4A 2PGWA 1YIXA 2H8XA 4OE7A 3WFAA 4WRHA 1EQPA 3HA1A 1AFSA 1AH3A 2QULA 3HU7A 4HNTA 2Q3RA 5IHRA 3IIXA 2NUYA 1B0IA 3PBGA 3QJAA 1EJTC 4QQUA 5HNNA 3MWAA 1ZBWA 1QAPA 4WIWA 3MP4A 1JPDX 4RV3A 1MNSA 1E6QM 4Z2IA 4RW5A 2ZRYA 1RVKA 5D9OA 4O1DA 1EPVA 1EIBA 1LRTA 4IQLA 6CGTA 1J0KA 2CZFA 4HU4A 4W93A 3LSCA 4IGSA 2WW5A 4J28A 2BODX 1EHNA 1XI3A 4UFLA 3RILA 3NZGA 4WVXA 3GRIA 3A3WA 1YMYA 4OT7A 3ZJ6A 4P7OA 1T6MA 1DJZA 4GC3A 1XISA 5FD0A 4MNKA 4ASTA 3WMSA 1RV8A 2GJNA 3VKJA 1GVYA 1X6UA 3DYOA 4ROQA 4DZAA 4YTSA 5ABGA 1T99A 2XG9A 3LLXA 1VC4A 4H2HA 3S1GA 3WMCA 4QITA 4UFKA 2OGJA 4LBUA 2PB1A 1A5OC 3S9IA 4M7SA 2FFIA 2J25A 7A3HA 3VI2A 3Q58A 4Q4MA 2VCBA 1OQFA 3A4AA 3M0YA 3OLDA 2C79A 2HSAA 4PYSA 3I3EA 2GK1A 5M17A 3OG3A 4BK9A 5I0DA 5TIMA 3CAKA 5E6ZA 4PA8A 1RAKA 4GE8A 3CZKA 3JUGA 4UTWC 4PSRA 4DBEA 3W9ZA 1NWTA 1PS9A 3QPZA 5FSEC 3M0XA 1H0IA 1GQIA 3CZLA 1MW3A 2I17A 4NUWA 3MW7A 2WZMA 1XBZA 4HVXA 3HM7A 3TP4A 4RE2A 1E0TA 4PRWA 1VHCA 3UR7A 3HBLA 3ATZA 1H1NA 1RD5A 2IXUA 3SRDA 3BXWA 4OOUA 3HQNA 1R3VA 1Q7QA 3CYVA 1KV5A 2H3BA 1C92A 3LUTA 3OQ8A 3UZZA 2DFAA 1W8GA 4B92A 3W1AA 2WCSA 1MXGA 1R3QA 3GR8A 5GQBA 1KRCC 4BEUA 1SR0A 1OF6A 5H91A 4J3TA 1RJPA 1PV8A 2CKRA 2Y8VA 4C7DA 3FYPA 4DAIA 5C54A 1TV8A 1R47A 8TIMA 1KFWA 1TMQA 1XLKA 4K36A 5DMMA 4GI4A 2DQWA 4AB4A 2J7GA 1VLIA 2PE4A 4WY0B 2Y61A 2PD9A 3P5YA 3EB3A 4MAZA 4LCQA 1JNDA 3KW3A 3UW6A 3EEZA 5DRIA 4A05A 3HPXA 4HZ7A 1KFJA 4HYWA 1KM6A 2IW0A 3CPRA 1KFKA 1U5JA 3SCOA 5FKYA 2DZBA 2WVVB 4NRRA 1U2YA 5ECUA 1W1PA 2B31A 4DJEA 4CQBA 1ESWA 1EO7A 5C7HA 1C7TA 2OT0A 3TVAA 2PDMA 4NRSA 3RPMA 2ZUWA 1W9PA 5JIWA 2UY5A 4Q4KA 5CXPA 3G2GA 3IJQA 4LFYA 1IWBA 3AU2A 3GXFA 4H9TA 4HNOA 1T96A 1EFZA 2OWXA 4NZCA 4PEKA 3R8RA 5JIPA 4A4AA 1W2VA 4GZEA 2CBVA 1QNPA 1Z42A 2YDAA 5DEZA 1HFBA 1IXNA 2VJXA 3BPWA 4O8RA 1G7UA 3B8SA 3SGUA 3B8DA 2V2CA 2BTMA 3LRKA 1M03A 2PLCA 4P8XA 1U1JA 3WLTA 2CLEA 2CYGA 3B9DA 3PJUA 2ZX7A 2Z2BA 3VAVA 2Z2UA 3U5YA 2CITA 4NYUA 3B06A 3LHTA 1JF6A 4DJFD 5I06A 4LVBA 4Z0JA 5AY7A 3WDJA 4EPDC 5CZSA 2QPUA 5CC6A 2VHLA 2QPXA 1VCGA 3G1DA 3C3NA 3GYCA 3UZWA 5E9XA 3KHDA 2DZXA 3F2DA 1PXGA 1BF2A 1JVNA 3TMLA 3NTYA 2BXVA 2XGIA 3PZGA 4OGZA 4LB3A 1OFEA 3GIYA 4ZEPA 2CEQA 2B0MA 2V3EA 3EMCA 3M9YA 4O4VA 1UJPA 4P7QA 2XGBA 2KAUC 1GVRA 3BLIA 1R2SA 2XSXA 2OOFA 4S2CA 2I1OA 1GW1A 4KFPA 2NWSA 3L2MA 1VZWA 3VIKA 1TPH1 2Q3OA 3S9YA 4Y2WA 3IIVA 1F76A 4F9JA 6REQA 1ZLPA 2FVLA 3NQMA 4JTEA 2XH0A 4H19A 3VDAA 1P7TA 4YTQA 1NDYA 2YXGA 2CHOA 3O8AA 2OLSA 3ID7A 4K7VA 1VD6A 3P62A 3PTMA 4GYPC 4ZTXA 4OVXA 3VGGA 1E51A 2PTWA 4H9VA 4MNMA 3DCPA 3GIPA 4S3KA 1CZ1A 1QK0A 1O12A 3NGJA 3TZNA 4GY1A 3KZPA