4BK9A

Crystal structure of 2-keto-3-deoxy-6-phospho-gluconate aldolase from zymomonas mobilis atcc 29191
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
207
structure length
207
Chain Sequence
RDIDSVMRLAPVMPVLVIEDIADAKPIAEALVAGGLNVLEVTLRTPCALEAIKIMKEVPGAVVGAGTVLNAKMLDQAQEAGCEFFVSPGLTADLGKHAVAQKAALLPGVANAADVMLGLDLGLDRFKFFPAENIGGLPALKSMASVFRQVRFCPTGGITPASAPKYLENPSILCVGGSWVVPAGKPDVAKITALAKEASAFKRAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-HYDROXY-2-OXO G
publication title Crystal Structure of 2-Keto-3-Deoxy-6-Phospho- Gluconate Aldolase from Zymomonas Mobilis
rcsb
source organism Zymomonas mobilis
molecule tags Lyase
total genus 65
structure length 207
sequence length 207
chains with identical sequence B, C
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2013-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4bk9A00
2FLIA 3T44A 3TMLA 3DKLA 3Q2DA 4DBEA 2GVLA 4GWEA 1FWWA 4GUJA 2NWRA 5FF0A 2OMAA 1DHPA 1LP6A 4NZFA 3DFTA 5HUOA 1PHWA 1YDNA 1Z41A 3NOEA 1LTDA 1ZENA 3GIYA 3M16A 4IGHA 3NQDA 3QZEA 3C3NA 3LHZA 3G1DA 1QPOA 4FNTA 1EP2A 4HIBA 1GZGA 1JR1A 3W2LA 4CCCA 5MHBA 5HUPA 4K8EA 3KVLA 5BW6A 3OIXA 1DJQA 1YTDA 1C9DA 4DO6A 3OA3A 2E1DA 2NLIA 2YFOA 2GJNA 2Y89A 2VEMA 2YZRA 1L6SA 3O15A 4GBUA 3ATYA 4JTKA 1VCGA 5DELA 5AHIA 2FTPA 3PG8A 2OT1A 3VNDA 4N9BA 3SSJA 4E2DA 3B0UX 3NGJA 1I45A 2NV1A 4N9EA 5BMXA 3NO5A 4O15A 2IQTA 3HO8A 3NNTA 4NU7A 1B4EA 1SZFA 2XN0A 3DBPA 4HSNA 5F4WA 2ZZ5A 3FOKA 1A5SA 1FCVA 3LRMA 2V9DA 5AHLA 4HNVA 3T55A 3M43A 2ZZ1A 1J4EA 3N14A 5TIMA 3G0XA 4O52A 1YXCA 4M6PA 1VS1A 3KFTA 1KTBA 1H1YA 2DJLA 2FFCA 3GKAA 3L5LA 5DY3A 5DN1A 4C1LA 3TXVA 3UY8A 2QCEA 5EYWA 1W5NA 3NM3A 2C19A 4P2VA 3NDOA 2BSLA 4U28A 5AC6A 1OK4A 4UFLA 3PSVA 4FNPA 4ML9A 3IGSA 1KM4A 4UTTC 4WY0F 2Q3OA 4JYDA 3N34A 3TH6A 3HG3A 3I65A 4RX0A 1G4SA 3THAA 4UTIA 4A3UA 4NQ1A 1H7PA 1TTJA 4M5PA 4GC4A 4HHPA 1DV7A 1MEHA 1FXPA 3RF9A 5ABTA 5DLCA 4ZZ9A 3N3MA 1DORA 4WOZA 1OFAA 5K2ZA 5H2ZA 2WNNA 1Q6LA 2Z6IA 3PG9A 3OBKA 3DKJA 1K03A 2Y6ZA 4LVBA 5K9DA 4FXRA 2DZWA 3W83A 3O06A 5D05A 3L0GA 2J6XA 3L5AA 1TIMA 1SQ7A 4TMCA 4CQ8A 5K4ZA 1W5QA 3NXFA 3W1UA 5C6MA 4MOZA 4DELA 2TYSA 2B0MA 1Q45A 2YR1A 4AHPA 2Q8ZA 3B4UA 2JKAA 4AVFA 3C2VA 4R34A 2D73A 3LGEA 1SZGA 3GR8A 3G22A 2P1FA 3TW6A 2GJLA 4NNCA 1TPWA 3LBCA 4A2RA 1JJKA 1TPB1 2C18A 5AC7A 1OX5A 4KKXA 1OFPA 2R8WA 3EEGA 4ZQNA 2Y7FA 4LRSA 3S9YA 1QPNA 1IF2A 4DPPA 2ZRXA 3VFLA 4LVFA 3MP4A 4JTGA 1TRIA 2Y7DA 3C6CA 4PODA 1YPFA 1G4TA 3UWWA 1W5OA 4NJJA 5F2LA 3TU9A 3RNDA 3G8RA 5LNRA 1SO3A 1RZMA 1IGSA 3HIJA 4XKYA 3O05A 3G1XA 1GTHA 4FF7A 3NG3A 1OFRA 1SFJA 4FX7A 1YLVA 2AQWA 4NXSA 3W1PA 1ADOA 1UUOA 1ZNNA 1EA0A 2ZFAA 1QMLA 1SO5A 2FPTA 1H7XA 4NZJA 2YYTA 3W2NA 2C6QA 3CLMA 4O1BA 1G67A 1KLYA 4K39A 2ABBA 4BF9A 4LC6A 4IPIA 3A22A 1OHLA 3U8GA 1I2OA 1W0MA 3GR7A 4N02A 4O50A 1N55A 4RZ4A 5DY2A 1A50A 1ME9A 1SU5A 2H8XA 4JX6A 3NQVA 3NQ6A 4HKPA 2RKXA 2Y88A 5CSRA 3CM4A 5CZ0A 2R14A 5G4EA 2EF9A 2CLIA 3JRKA 1LYXA 4BI6A 1P0NA 3P74A 3THQA 2ISSA 3STCA 4TR9A 3S0CA 3QFEA 1F73A 2RH9A 2V5BA 4JTHA 4CLMA 3C4UA 5DXYA 2WNQA 5H91A 3NPWA 3NQEA 3U6WA 3TQKA 1LM1A 3NQ2A 5LNVA 1JCYA 4UTWA 1ONRA 3SZ8A 5D02A 4MPQA 3HGJA 3TR2A 3GDMA 3P5YA 3WK2A 2BWGA 1LBLA 1SZNA 3PAJA 3S1UA 1IIGA 5A5WA 1QFEA 3G1AA 4UFKA 1H7RA 5FF2A 3B05A 3CWNA 3FA5A 4A29A 3STGA 1GT8A 2E5BA 5HMSA 5FF7A 3SIZA 5FEPA 4AWUA 2NXHA 1KFEA 3WJZA 1BWKA 5DBUA 4NJIA 3MBFA 3MYPA 3W6YA 5U7SA 3C8FA 3BO9A 1H5YA 3RK8A 4PTNA 3UYCA 2E5DA 1HL2A 2RDTA 1QO2A 1SW0A 2NX9A 3W84A 3E9AA 4M6QA 4Q33A 1OK6A 3O63A 1H1ZA 1KTCA 4FX6M 1BTMA 2BX7A 5HQEA 5LNSA 4LVGA 1O5XA 4QM1A 2V82A 1SUXA 1FCBA 4PFMA 2DU2A 1O5KA 1R2RA 4Z1BA 4HT3A 4IX2A 5FF4A 5BRBA 2FDSA 2HTMA 4JTLA 1GVRA 3ABSA 2V2CA 2V8ZA 1W1ZA 4JD4A 4DF2A 3IV3A 2GQAA 2PCQA 1YDOA 2WV8A 4LTSA 4KWVA 5EY5A 1I2QA 3HPSA 1JVNA 3QMSA 2B7OA 1W3TA 4GUFA 5D04C 2ZBTA 2X2GA 2X1RA 3EKZA 4RR4A 1XKYA 1XUUA 4UIOA 3W2KA 1M6JA 5I3KA 4MJMA 4K38A 2JGQA 5D2VA 4FO4A 4ZMGA 3LXAA 1A5BA 2ZRYA 2J88A 2G95A 2XFWA 3PB2A 1K8ZA 5TBOA 3G1FA 2NXIA 3FS2A 2CZEA 1OYAA 3KRZA 4TIMA 1CW2A 2E6AA 3L0NA 4Q4KA 4UTWC 3RMJA 4MY9A 4DF0A 3DAQA 3UPBA 3S8HA 4CCDA 4B5NA 1OFEA 1NF7A 2PRLA 3QMRA 4O1DA 2VEIA 4JXCA 1JCMP 1U83A 1VLIA 4AXKA 5EL1A 3LV5A 3P67A 1TPVA 1VC4A 1Q6OA 3UZ5A 3JR2A 3V75A 4R53A 5AHEA 1OX4A 2R94A 5D2TA 3DFPA 4JY9A 4FXSA 3NVTA 4LY8A 5F4SA 4YXGA 1JCNA 1NVMA 1ML1A 2YDAA 1HG3A 5HNRA 2CWNA 2F7FA 4MJZA 3O16A 4UTKA 3A21A 3R5EA 3DU0A 3HG4A 5EPDA 4EOUA 8TIMA 2VFGA 3A9IA 2WO5A 2E6DA 4YLWA 3CPRA 4GNJA 3HGOA 1W54A 3K30A 2YCEA 1YTEA 5D33A 1WV2A 3LHVA 3MBDA 4UTHA 3OVQA 1H63A 2RFGA 3W87A 3IGUA 1GJPA 5F2IA 2QCCA 2GVJA 1NAL1 4JTUA 2VENA 3GYEA 1XXXA 3P62A 4LV9A 7TIMA 1KFCA 3W2JA 1R30A 3B04A 2GVGA 2H6RA 2X30A 3U2OA 3WK0A 2H3DA 4LNYA 4ZVJA 3W1MA 2QF7A 4FEZA 4ADUA 2DZTA 4PL1A 3SR7A 1Q6RA 3GDKA 5D30A 3GNDA 4HNTA 1EWEA 3LXCA 1TPUA 3PSWA 1TTQA 1OJXA 1UBSA 3W7LA 3WK3A 1GG0A 3C2EA 4FNQA 3W23A 4GJ1A 2GQ8A 5LSMA 1G7UA 1FWRA 5CZJA 4LV4A 4OWGA 2B4GA 1JULA 3G18A 3PF3A 1ZHAA 5J5RA 3O1NA 2X1SA 1QCWA 3L5MA 1TYGA 4DXVA 3GDLA 1XBZA 3OVRA 2PE4A 1GOXA 2QJGA 4LUJA 1EUNA 4GXMA 3LTPA 1RR2A 3L2IA 4WY0B 3IVSA 1IIHA 2YGYA 1O4UA 3PBVA 3L65A 3NL5A 4O1CA 2EAWA 3VCRA 4A22A 3EWYA 1L6YA 1MO0A 2FB2A 2ISVA 2CLKA 1DQXA 2JBMA 4IQLA 4JTSA 3ZS4A 3QPZA 3STFA 3A5VA 1R46A 2DJXA 2Y85A 1SSGA 5KZMA 1TPFA 1PV8A 1F76A 3T40A 2ZZ3A 1JQXA 1EPXA 1W5MA 2ZRWA 4OQVA 1MSSA 4DBDA 1SR9A 3A23A 4XBSA 4WOQA 5F1UA 1HO1A 1EEPA 3O8AA 3W7IA 3AJXA 3PUEA 4LS1A 1ICPA 2ZQ0A 2VKZG 3UZJA 2C1HA 3M5ZA 4GE8A 4EIVA 3VE9A 2ZCGA 4O28A 3R12A 3L9CA 4DO4A 3BG3A 1BWLA 1P4CA 3EKLA 4IMFA 3W73A 3PC0A 1EP1A 4H4IA 1K3UA 3E96A 3TW7A 3S5OA 3P82A 1AG1O 3W2UA 2E5CA 4CNNA 1RPXA 3R89A 3PWAA 1O60A 3TX9A 3UWUA 2Y63A 3TFXA 3NQGA 1XFBA 1TQXA 2ZZ6A 4JTIA 4LRTA 5IM51 5FI8A 1TREA 1WBHA 3EX2A 3LB0A 1RQEA 2UV8G 3LRKA 1G6CA 1JRBA 2NUWA 4AWSA 3QC3A 4MUZA 3LLDA 3B0PA 3DFQA 1W8SA 4ORMA 4PCFA 3R8RA 1K7EA 3LCXA 2HS8A 3C52A 2BTMA 2VFDA 3NPVA 4LOCA 4XBKA 3BVJA 3FJ6A 4AAJA 2VEKA 3PBYA 4LVAA 4WUIA 4UCGA 3VE7A 3HG2A 1OFBA 4XKYB 2GPTA 3M44A 3L21A 4LS0A 4NVTA 3W1XA 4JEQA 4UTUA 1QR7A 3B06A 1OYBA 1FDZA 1MZHA 4J9JA 1X6UA 2LLEA 1ME7A 4MYAA 2A6LA 2FPYA 1W37A 2V2DA 2X1UA 3QSTA 1XDMA 5F2MA 1FWNA 1H7NA 4ZL1A 3SECA 3KVMA 4FIRA 4ZQPA 1WDWA 1GYLA 2QR6A 4WZHA 1AW2A 3WJWA 1VCVA 3MWAA 1X8FA 1LCOA 3Q37A 3LX9A 1F05A 4JYFA 4WY0A 5DCDA 3T7VA 2A0NA 4UFHA 4NJGA 2E6FA 3ELFA 1QPRA 4AWTA 3LV6A 4MZ1A 3T4CA 3UXDA 4HN4A 2ZA3A 4CCEA 3I68A 3IVUA 2QCLA 3W1LA 4RLIA 4UMCA 2Y61A 1LRNA 2CLOA 3A24A 4OV4A 1YXDA 3IIZA 3B0VC 1PVNA 3H54A 1M7OA 3E12A 5CPLA 4JIQA 3W9ZA 3N9SA 2VFEA 4MZ8A 3ABOA 4O4WA 3LBMA 1ICSA 3C2RA 3BLEA 4O10A 3TCEA 4MY8A 4AEOA 1B9BA 3KHJA 1UB3A 4WQ6A 2A21A 3O6YX 4TU1A 2XN1A 1PCKA 2YSWA 3MP5A 3H55A 3CEUA 3DGRA 2GOUA 2O7SA 5C2XA 1GPWA 4ZQRA 4NXKA 1LLZA 1PE1A 2G5WA 4I7VA 3M7WA 1BKSA 4N2YA 3B8DA 3EWXA 5C54A 4LS2A 1VZWA 3FYOA 1JCJA 1DVJA 3HQ1A 5D03A 4NT0A 2NX1A 2Z2UA 3STEA 4RCXA 2H90A 1G4EA 4P61A 1TCDA 4XTDA 5K3VA 1XI3A 1ZAHA 3DFNA 3IIXA 4ADSA 1FBAA 4CQAA 4IXXA 1SW7A 1TPEA 2V0TA 1VYRA 2P10A 3P84A 3AO0A 3N2XA 4KFNA 1FDJA 3P80A 5T26A 1AW1A 2AGKA 4JIPA 3SFKA 1TV8A 3D0CA 4MLRA 4A2SA 2DZPA 3LCLA 3PR2A 1TTPA 2CLMA 3HG5A 3W1TA 2X1TA 2WKJA 3MW7A 1WBJA 2EGZA 5E0KA 1SO4A 1ZAJA 3GZ3A 3HJZA 1VYPX 3NQMA 3W1QA 1I2RA 3DHFA 3KVJA 5AN7A 2HSAA 1FDYA 3SI9A 5HR6A 5G1YA 2CW6A 4QNWA 1QOPA 2KZHA 1JRCA 5KMYA 2ZZ2A 4IMGA 3LHUA 1TRDA 3SGUA 2QCGA 3TSBA 3CHVA 4MVAA 2WNZA 4M19A 5G2IA 4FHAA 3IIPA 2DZSA 5KITA 1WAUA 5D2XA 5I3GA 1NF0A 2DZXA 3LERA 3M1ZA 2TPSA 2YYUA 4GUHA 4TO8A 1KM1A 2O7QA 4E2BA 5L9FA 3G1VA 1TV7A 3LDVA 2ABAA 3C2FA 3INPA 3HB9A 4Y96A 1CI1A 3G0UA 4UTLA 2A6NA 4UUIA 5HWNA 1WQ5A 3W88A 1XC4A 3W75A 3GAYA 3GDTA 3FFSA 3SW6A 3E0IA 2V30A 3C2OA 4AB4A 5HULA 4K37A 2WSRA 3NPUA 1KV8A 1X7FA 2DZVA 1ME8A 4S1FA 1OX4B 2B7PA 2Z0IA 4MFEA 2ZRUA 4N4QA 2DZUA 4MZYA 4C1KA 2ZTJA 5G2HA 5LNWA 1K7XA 1MEWA 1T0OA 3EX1A 3I7SA 1H7WA 3W7NA 3GAKA 4MKNA 5F4XA 3TC7A 2V2HA 1KBJA 4O57A 1SPQA 3MI3A 3VI2A 5DCBA 4O12A 3R2GA 4RJEA 2A5HA 3BLIA 3UWQA 1JUBA 4RKAA 3G8EA 1EWDA 4A21A 3W7QA 4KFPA 1UCWA 1O95A 1GVOA 3OHIA 4O13A 3TSMA 3W7CA 3QW3A 3V1PA 1NEYA 4Q32A 1TTIA 4PL2A 1DOSA 5U4NA 2JKPA 3Q94A 1WXJA 5AYZA 3S5YA 3TFCA 1TQJA 4JYEA 3L67A 1E51A 5AYYA 1VHNA 1TB3A 2TRSA 2CLFA 2FPVA 3W1NA 3ZWSA 5AHFA 1FQ0A 2YX0A 1QOQA 5BMWA 2DP3A 2H3BA 4AHOA 5LNUA 3W7PA 4LT9A 3LHYA 1L6WA 1G69A 4X9SA 4QIUA 1J5TA 3H53A 4YL2A 4UFJA 4S2BA 1X1OA 1WYIA 2OZ0A 4O1AA 4TX9A 1LROA 1F74A 3F4NA 3MI2A 4RXGA 4OU1A 1LOQA 4O11A 3BW2A 1QNVA 4RZ6A 3FLUA 3HGSA 3TSDA 3GB6A 4BI5A 2A2IA 2A7PA 3TJXA 2VFIA 3SY5A 4JTFA 3BG9A 5EA9A 4QNEA 3W7RA 1IXQA 1ICQA 2CU0A 1W3NA 3WJYA 1LOLA 2I1OA 3QYQA 4Z0JA 3TK7A 5HWJA 2ZTKA 2F84A 4M6VA 1EB3A 1H7OA 4IUOA 2FQIA 1Y0EA 1A5CA 2OJPA 3UPWA 1SW3A 3W7MA 4MYXA 4Z1DA 1KA9F 3IGXA 1I2NA 2TSYA 3O6CA 2QCFA 1BEUA 3OVPA 1GYNA 4L4MA 1ZFJA 3ABRA 3W2MA 2JKEA 1PCWA 3TIMA 3SJ3A 3TQVA 1TPH1 5AHMA 3HMJG 3W7GA 2JGYA 4NNAA 1H62A 3NL3A 3USBA 1LBFA 3ATZA 2NZLA 4FNSA 4BFAA 2C14A 1SSDA 1JUEA 3NL2A 3W7DA 3IEBA 1DQWA 4DF1A 5SWUA 4MLJA 3C56A 2P0OA 4QJ1A 5I3JA 2GUUA 1GVSA 3EXTA 3A5FA 3TJLA 4ALDA 4O53A 3LXBA 3RU6A 3NQCA 2QAPA 4JDBA 1UJPA 4TMBA 3S5NA 1H50A 1Z42A 3UD6A 3NYZA 2ZA2A 5DCEA 3W3OA 1FY6A 1XBVA 1LZOA 1VHCA 3P61A 5LGZA 4NJHA 1YXYA 4UXDA 2BLEA 4OGZA 3MO7A 4IWWA 5AC8A 3HGRA 3G3DA 1CX9A 1KFKA 1TPC1 3CB8A 3W76A 3W07A 5AFDA 3RLUA 3S1WA 4K36A 1XUZA 2E77A 1I8JA 3LI0A 2YW4A 3S6DA 2J9XA 1DJNA 3G1HA 4WXYA 4G1KA 4ICNA 1PL9A 1RD5A 3EXRA 2PRHA 4IMCA 4XQ6A 4UFMA 5D2WA 3PY2A 2WPBA 3W74A 4N4PA 3KRSA 3CWOX 5EKYA 2NV2A 1GWJA 3UWZA 4JX5A 3GLCA 1RQHA 1T96A 4K7YA 2J9YA 2RDUA 4O4VA 2G96A 5A8GA 5CPOA 1TO3A 1TJPA 1F7BA 2V81A 4YCPA 2J27A 5L6UA 4EF8A 4UNLA 3MJYA 4NNBA 1AW5A 3C0JA 5GVJA 4PC8A 5J5DA 3M41A 5K9CA 3QW4B 4IMDA 3FEMA 2QCDA 1PS9A 5EMUA 3EB2A 4O18A 4UR7A 1J2WA 1K02A 3ZR4A 1AMKA 2ZA1A 3G0SA 3G24A 5F2GA 4NJKA 2XN2A 2Y62A 2AAMA 3HOJA 3DFOA 4EVZA 1KM0A 1C29A 4OT7A 1OF6A 1G7VA 3NZRA 3MHUA 3P81A 3PBWA 4UMBA 5AOUA 1JUKA 4LWWA 5G4WA 1N8FA 3LCHA 5DXXA 3LCIA 4CQ9A 1Q6QA 3UNDA 2Y7EA 4IMEA 3G3MA 2Z6JA 6TIMA 1P0KA 1R2SA 1OFDA 2QDGA 2BXVA 2CZDA 1R47A 4E38A 3O07A 4O14A 3ZWTA 4O0KA 5FEWA 2YPIA 1JCXA 1MXSA 1Q3NA 3MUXA 2WQPA 2QUUA 3F4WA 3TNOA 1GQNA 3DI0A 1SZEA 4OBTA 5G2WA 1IXNA 3EX4A 3MP3A 4XZ9A 1Z44A 2H8ZA 4JX4A 3NAVA 1RV8A 3ABQA 1G4PA 3W7HA 1KFBA 4GUIA 3LTSA 1KM6A 2QKFA 4AH7A 3PS7A 2C3ZA 3OG3A 1XCFA 1UUMA 3W7EA 3UQNA 1XBYA 1TJRA 3PM6A 3BPWA 4XTIA 3IVTA 2NWSA 1QPQA 3QM3A 4S2CA 2ZRVA 3W70A 1A53A 2A7NA 1EUAA 4JR5A 3QEZA 4RZ5A 5KINA 3W71A 1VPXA 4AF0B 4L4LA 1OG0A 3IIOA 2TMDA 2NXGA 3W1AA 4FB7A 3N19B 3DFSA 1B4KA 4Z1CA 1M7PA 2VC6A 1ZY9A 3DENA 2Y7GA 2OX1A 3PB0A 3PUOA 4DPQA 1ZJIA 3P60A 2ZRZA 4ADTA 1C8VA 2X16A 1AL7A 3TE9A 2Y70A 5E93A 2VOMA 4PH6A 2R91A 3ANYA 5F1VA 2NUXA 3TKFA 1Z48A 5IBXA 4JN6A 3TC6A 2E09A 1A5AA 4HPJA 3TQ0A 3W7KA 2BZNA 1QO5A 5I3FA 1K8YA 5D32A 4DQWA 4O19A 3CT7A 2CLLA 4YWIA 3HBLA 4O54A 4W9TA 1LDCA 3QH2A 4IOTA 4JTEA 3M9YA 2GQ9A 1K8XA 3QJAA 4GUGA 1I2PA 5HJLA 4BK9A 1B57A 3L68A 3TA6A 3C61A 1KFLA 1VR6A 3LRLA 2QUTA 1EX5A 5FEZA 5CPNA 5D09A 4JTTA 3WJXA 1KM2A 3QSRA 1YDVA 3B03A 3RFAA 1VGAA 3OEXA 1UASA 2FJKA 2B7NA 3DI1A 3O6DA 5E1QA 2PRMA 4BI7A 1FXQA 3N9RA 4K7VA 3S1VA 5LHFA 2FB3A 3BARA 2ZZ7A 3WFAA 3HPZA 5CGQA 4M7SA 2VELA 3M5XA 2FIQA 4HPXA 1W56A 4PA8A 1XDLA 1QWGA 4UR8A 1TV5A 3W1RA 3NA8A 4LC8A 3GXTA 3UXAA 1L2UA 1GTEA 3LHWA 3KAOA 1DL3A 2C16A 3NPXA 1V7YA 1HUVA 4JDYA 4NX0A 3TAOA 3IIVA 2ALDA 2CZFA 4WD0A 1EP3A 2QUVA 2WSYA 4OE7A 3W72A 4DEFA 4O17A 1LRTA 4AF0A 1JCLA 2QCMA 1NSJA 2E68A 1TMHA 2EPHA 1GG1A 1ZAIA 4MY1A 3T78A 3E02A 3BW4A 3W86A 1ZCOA 4H6KA 4U4MA 2QJHA 3N73A 4RK8A 2JK2A 3UY7A 1S5TA 4O8RA 3GDRA 3PULA 2DORA 2YXGA 4BWLA 4YMZA 3KRUA 1R2TA 1B3OA 1WA3A 2ATMA 3MHGA 3NEVA 4Y8FA 2QCHA 2QJIA 5HINA 1S3HA 4N9CA 4FX8A 1D9EA 3KXQA 3NZ1A 4MFDA 4JY8A 3P8JA 2Q8LA 5IBXC 4D2JA 1VCFA 5BNKA 3EX6A 3I6RA 2PURA 4I7UA 1JQVA 1GVFA 1YPIA 1OFOA 3TMQA 1H61A 4IXHA 1TSIA 2CFFA 1K7FA 3EWUA 1RQBA 2WOQA 1I4NA 2HMCA 1ZALA 3IRDA 1HO4A 2J9ZA 3HPXA 4UFIA 2E6YA 3UWVA 2HS6A 3UWYA 4K8HA 1OVDA 3M6YA 4IX0A 3FKRA 2C13A 3LI1A 3KX6A 2YW3A 1FWSA 3LHTA 1HFBA 4HNUA 2WSQA 1XM3A 2C15A 1NFBA 3TAKA 2J24A 3WJSA 3BLFA 3WK1A 3NQFA 2I14A 3S42A 5K4XA 1KM5A 1KTNA 4NX5A 2Q3RA 5C5YA 3YPIA 3KOFA 3I7QA 3CTLA 4I9AA 4WX2A 3EX3A 3LLFA 4HSOA 3S5ZA 2VFHA 5CKSA 1VQTA 4QQ3A 4JICA 2QAFA 3NR0A 5CSSA 4LUIA 1LBMA 5I3IA 3NM1A 4LU0A 4Y9AA 1YADA 2QCNA 2A7RA 1FCQA 3MMTA 3LCWA 3TDFA 3JS3A 3HF3A 4JNMA 2CLEA 4N6FA 4N6EA 2EKCA 2G97A 4LVDA 1FCUA 1KV5A 3M5VA 1U5JA 4Z0SA 5I3HA 1KW1A 1LORA 3M47A 4R7JA 2W0UA 3QRHA 4O16A 1D3GA 1XBXA 5G1TA 3R13A 4FNUA 6ALDA 1IXPA 1WOBA 4MIMA 1MEIA 2W6RA 3NL6A 3BW3A 4KFOA 1M5WA 3BGGA 5D37A 4EF9A 1PIIA 2NUYA 5AB3A 2ZYFA 3FYPA 3NQ8A 4Y90A 1KLZA 3TROA 1KM3A 1D3HA 3CU2A 2I9EA 3BGJA 1F6KA 4EWND 3M5YA 4PEKA 2Z1BA 4UC5A 2QDHA 4BWLC 2ZDRA 3GNNA 3NQAA 1FWTA 3EWWA 2RDWA 4FIQA 4YCOA 5CPMA 1S5WA 1H51A 2CZ5A 3M0ZA 1OFQA 1PHQA 3W7JA 2OT0A 4QITA 5CG7A 3EWZA 4X22A 1FX6A 3Q58A 5CZTA 4OHQA 2PC4A 1SFLA 1X1ZA 1OABA 1VH7A 1P5BA 3CC1A 3BV4A 3DHDA 1GEQA 3G1SA 5LKYA 4AHQA 3TUUA 5FEXA 5K9XA 3N2MA 1OF8A 4KWWA 3L0KA 4ORIA 3QF0A 3CIWA 3GVGA 3MYOA 1HTIA 1S5VA 4XWUA 2ATSA 4RXFA 1YYAA 2NX3A 2VEPA 1N7KA 3W22A 4QSHA 5KZEA 5AYXA 3GKFA 2EHHA 2B7QA 3F03K 4ZQOA 3DZ1A 4M7TA 4K6AA 3PBUA 1O94A 1T99A 3MI6A 1T8XA 3FKKA 4NUWA 4POCA 1VYSX 1WOAA 2A4AA 2QEZA 4R33A 5KSWA 3TV8A 3W7OA 3W85A 3BK0A 3MHFA 2A85A 5BOOA 3FIGA 1P1XA 1F2JA 1XL9A 2QCDB 2VXNA 1F6PA 5CZSA 5K7JA 2YFNA 5LGXA 4UTJA 4FNRA 3GXNA 3LM7A 5C55A 3GK0A 1IXOA 5AHNA 5HR7A 3VKJA 1EIXA 1THFD 5DBTA 4ZQMA 5KZDA 3F1QA 1W5PA 3GXPA 3E49A 3NQ7A 3L66A 1QDSA 4AMAA 3CQ0A 1DKWA 3P7YA 1KFJA 2ISWA 3PVFA 1GVQA 3PUDA 3LCGA 2V5LA 4Y6GA 4CNPA 4WJEA 3BG5A 4I7WA 4OV9A 4JS3A 4X3ZA 3SGZA 2CLHA 3TXZA 4GFSA 1VJIA 5LZLA 5KTLA 4CNOA 4Z1AA 3LCFA 1VLWA 3LOTA 3LTYA 1KBIA 3DH7A 1AL8A 5D38A 1W3IA 5G5IA 1WX0A 1RVGA 2W79A 3KVKA 3ZFHA 1LRQA 3G1YA 4QAIA 1VRDA 4ONVA 1F5ZA 4E0CA 3EXSA 4UMAA 1LOSA 1FUYA 3QQ1A 3GX9A 2ZZ4A 1YTKA 4GRSA 4O0ZA 3CIXA 4LW7A 4ZQCA 1SO6A 3FJLA 2RHGA 4Z08A 5EBUA 3S1XA 5HWMA 4IJBA 1ALDA 5TQLA 3EWBX 2A1YA 3QQ0A 4DO5A 5FESA 1TPDA 3P5ZA 1LLWA 4RV8A 1W31A 4QISA 4UTTA 4IPJA 1AK5A 2OCZA 2WJZA 2VFFA 3RLVA 4HNNA 5FF3A 1DBTA 5D2YA 4XUGA 3P8IA 1L9WA 1OYCA 3CEPA 4UNKA 5LHEA 4H3DA 4JTJA 3DXIA 1H60A 4N9DA 4X2RA 1QAPA 3I7RA 3QPYA 4UTMA 1OX6A 1V5XA 3QMTA 2C0AA 4WXZA 4JGDA 4BR1A
chains in the Genus database with same CATH superfamily
3GTHA 2QVHA 1E6SM 1VPQA 3FVDA 4DBEA 1XLHA 3IJ7A 4GWEA 3M0JA 3KS6A 5FF0A 5DT7A 4H8NA 1TWSA 1R9XA 1DHPA 5HUOA 1PHWA 1YDNA 1JPDX 3NOEA 3GIYA 4IPNB 3VOIA 3S6OA 1P0EA 1EP2A 4S3EA 4D6FA 4NI3A 1JR1A 4HPGA 4GNVA 5HUPA 4TUFA 1NY1A 2EG6A 5BW6A 2PWUA 1C9DA 2NLIA 4PRRA 3NTYA 2OG9A 3OQ8A 4QXIA 1DWGM 4MB5A 3BJTA 3O15A 3UT0A 4JTKA 4IGMA 1TE6A 2FGBA 3K13A 4N9BA 3SCUA 3UWEA 4BQ2A 4E2DA 3G77A 3OLIA 3SM0A 3B0UX 2DT2A 4HMDA 6XIAA 3UR8A 3EMCA 2IQTA 4GGHA 4KRUA 5JU6A 1RAKA 2XM1A 1H0IA 4CD7A 4HSNA 2OQHA 3L4ZA 2HNHA 1DIEA 1QW8A 1FWDC 4LCSA 3T55A 5JBFA 4J3VA 3GNXA 1VEOA 2WJDA 3WMBA 3GKAA 3L5LA 4HZ6A 4MDPA 1DHKA 4Z42C 2CBIA 5DN1A 3BAXA 1JF6A 1K6AA 4NZ5A 4C1LA 1QHZA 1ZB5A 3LQLA 3WLLA 1W5NA 2C19A 3NDOA 1BHGA 1TX0A 4HB7A 4KH2A 4UFLA 1US2A 4UTTC 5EMLA 2Q3OA 3TEVA 1VBHA 4J2MA 3I65A 4BQ3A 4GVHA 4RX0A 1R6WA 4NQ1A 3EPNA 1R5YA 4V1YA 2PTYA 1DV7A 4Z2IA 3BOXA 4DM1A 1OCNA 5ABTA 4LBRA 2JF6A 4FSAA 1DORA 4AD2A 2W62A 5H2ZA 1CB7B 2HQAA 3QXBA 3OBKA 3AMKA 4QJ4B 1A5OC 2GQ3A 2XIOA 2Y6ZA 5HJYA 2DZWA 1I0BA 2WWDA 3O06A 3P2VA 5I0DA 2J6XA 3B8VA 1XLFA 4CQ8A 4ICMA 3CQKA 3W1UA 3SGGA 4WSKA 4EWJA 2B0MA 3ARSA 1Q45A 3SUWA 4P7RA 4AHPA 4PEEA 3T42A 4F2UA 3D6NA 5BU6A 2JKAA 3CHCA 3H12A 4HCLA 3C2VA 3B8IA 5E5CA 3G22A 4MKSA 4A2RA 1UC4A 4ZFMA 4CD8A 4W4QA 3MKVA 2UY4A 1IWPA 3LMZA 4GPNA 1QPNA 1IF2A 3S9YA 1S3TC 3VFLA 1CGVA 1UH3A 2HVOA 1R3QA 4U10A 3S46A 3MSDA 2XWEA 3ERPA 4DXKA 2PLCA 2XIJA 3S2CA 3TU9A 4AZIA 1Q63A 3GU9A 1ZBCA 3G8RA 5LNRA 1SO3A 2PWHA 3S5SA 2Y24A 1HJXA 3JUGA 3OOQA 6ENLA 2EJAA 1UBPC 2QGHA 4TXEA 2WW5A 4NAEB 5J8LA 1EA0A 5HMFA 1SO5A 2FPTA 2ZUUA 3H6OA 5CGTA 4H7ZA 3NO1A 7ODCA 2DUAA 3CNYA 1Q4WA 1BWVA 3FW6A 4KWOA 1IT0A 1OHLA 3U8GA 3PZNA 3BAIA 1Q7ZA 1Q13A 4N02A 2J7GA 4O50A 1N55A 1IWAA 4MWAC 5DY2A 1A50A 3VIOA 4Q8MA 2XISA 4S38A 3QBUA 2VWSA 3W26A 5LIWX 5CSRA 1OINA 2EF9A 5EFFA 2CLIA 3CPGA 3WY1A 4ML4A 1PSCA 2WMKA 4IFKA 4BEUA 3S0CA 2I5IA 3C3UA 5H91A 2VD8A 3NPWA 3NQEA 3U6WA 5LNVA 3BAJA 1ONRA 3MKCA 3HGJA 3TR2A 3UYIA 4WKHA 3GDMA 3P5YA 1C8QA 5IXEA 4ZOEA 1XLLA 4M56A 2QJJA 2PPGA 2FZ9A 3CWNA 4B5UA 2NQJA 4CUCA 3VCNA 2ISDA 3CGTA 2ACQA 2X0HA 5FL1A 2DVUA 5FEPA 1KFEA 2VZUA 1XYMA 3WJZA 3E5PA 5DBUA 3B4YA 4NHVA 3MYPA 1JNEA 1H5YA 1F3XA 3RK8A 5A6MA 4NKCA 3HJEA 1HL2A 2Z1KA 4MNKA 4YHEA 2ACSA 4GX8A 4DVOA 2OZ3A 4XO6A 2XTKA 1JYVA 2PDUA 3M46A 5HANA 1NFPA 4HU3A 4R88A 5DANA 3R1ZA 1O5XA 4QM1A 1FCBA 3JVAA 3NFUA 5A6KA 4IX2A 2FDSA 2HTMA 3RPTA 2V2CA 1W1ZA 3EOOA 4J3XA 2O56A 4BF7A 1MDLA 1I2QA 4L80A 3QMSA 2B7OA 2FVMA 2ZBTA 1SVDA 2P50A 3APGA 5C9RA 2X1RA 4DWSC 4RR4A 3UCDA 3VD3A 4DJDC 3F4CA 1PTGA 2QMKA 3M0MA 2XFFA 1CGTA 2PLMA 3W2KA 4H9ZA 1JDAA 2JGQA 4FO4A 4ZMGA 2ZUMA 3LXAA 4WIWA 4C60A 3VDBA 3SCVA 3WUGA 5H1WA 2QXWA 2V5JA 3H8AA 3KRZA 3TONA 3P0WA 3GWQA 1HL8A 3VMNA 3UZZA 4KRTA 4HGXA 4I8DA 4GXWA 3S8HA 3WD4A 1BVWA 4B5NA 3DCPA 3AMDA 2PRLA 3QMRA 1RJRA 3GH4A 2P8BA 1V79A 2HXTA 2AL2A 4JIHA 3P67A 1VC4A 2X7WA 3HFYA 3WLRA 3JW7A 2ZWYA 1FFRA 4G9PA 2ANUA 3NVTA 5F4SA 1XKJA 1JCNA 3IRSA 1HG3A 3W38A 1LJYA 2JE8A 3DIPA 2F7FA 2BY1A 4MJZA 5FAJA 3O16A 1AZ1A 2VCBA 3QGKC 3R5EA 2F6UA 4AMCA 5EPDA 4YJ5A 3VNKA 1VFSA 2E6DA 2GL5A 4QDMA 2HEJA 2GDVA 1IEQA 4KW2A 2YCEA 1DIKA 1YTEA 4GQ0A 2FZDA 1B90A 3MVTA 5MF5A 1H63A 2RFGA 3N2BA 3VYLA 4GHRA 3AYSA 2GVJA 2QPUA 3OLDA 2VENA 4ZE5A 5D4YA 1GOKA 3CQJA 2WZMA 4L7ZA 2DDXA 2X30A 3WK0A 2H3DA 4FEZA 4ADUA 4WDXA 2DZTA 1UA3A 2Z24A 1TVLA 1UWSA 3PPCA 3GDKA 1BXNA 5A1AA 3CZJA 3ZR5A 4J35A 1EWEA 3VNMA 1QI2A 1EYEA 3PSWA 5A6SA 1UBSA 3W7LA 2I5QA 4FNQA 5FJJA 3DYOA 2XH4A 3U0HA 2GFTA 1HVXA 5LSMA 1GEHA 4GXPA 3KRBA 1WP6A 2C91A 2PGEA 4LV4A 4OWGA 2B4GA 1JULA 2WHLA 3WUEA 4ZO8A 3PF3A 4PE8A 2X1SA 4EANA 3L5MA 4DXVA 1VD6A 4D8AA 3GDLA 2PE4A 4LUJA 5A6JA 1E6ZA 2XSBA 3LTPA 3WQEA 1WCGA 2Y4SA 4F8XA 1IIHA 3PBGA 3PBVA 1H41A 4A22A 3EWYA 2ISVA 2JBMA 5KEZA 3TVAA 2GYIA 2VM8A 2ZUWA 3QPZA 3A5VA 4R3UA 2IQ0A 3VABA 1O66A 1E9IA 2ADAA 1HO1A 1E1CA 3N12A 3W7IA 4ZA0A 4LFYA 2CZVA 2VKZG 4PMJA 2ZX6A 3WF4A 4EIVA 3P3BA 3VE9A 3WBWA 4O28A 3T81A 5C9ZA 1P4CA 3A3XA 4KWSA 3EWCA 3PC0A 2CYGA 1K3UA 3WMCA 1S2VA 3R89A 1WZMA 1O60A 3UWUA 4NF7A 1M03A 3EA1A 1QASA 3QLLA 1XFBA 1TQXA 4AY1A 4JTAA 3R4IA 3EX2A 1UD5A 3PFRA 1JDFA 3T8QA 1H1NA 4DN1A 4FOKA 1G6CA 3ZT5A 3AC0A 2NUWA 3QC3A 5C7VA 4MUZA 2VUNA 3ANUA 1EXPA 4XIAA 2VEKA 3PBYA 2NQ9A 4LVAA 3TW9A 4Y2WA 2P5NA 5DFAA 1OFBA 1YMYA 2GPTA 3VUSA 3L21A 4IIHA 4NVTA 5CLTA 1FDZA 1MZHA 4WSJA 3A4JA 1FH8A 4I5UA 1ME7A 2E4TA 4MYAA 2A6LA 5F2MA 4ZL1A 4FIRA 4ZQPA 1WDWA 3WLMA 1GYLA 4ES4A 1NWTA 4H9UA 1VCVA 3A4AA 1X8FA 4KGLA 4DAFA 3EDJA 4R7WA 3IJDA 3Q37A 4KQNA 1KRCC 1F05A 4WY0A 1HF6A 3VGGA 3T7VA 4C7GA 4PN2A 3V16A 4MKVA 3VKBA 3QVQA 5AYBA 4MZ1A 3T4CA 4A8RA 7XIMA 5EGRA 1R3RA 1J0KA 3K2GA 3L4VA 3TA9A 3IIZA 1VAHA 3GHRA 1PVNA 3USZA 3IUHA 1JL8A 4WJ8A 4IFKB 1AFSA 1QOXA 1E0TA 4A8IA 4C6DA 3QV8A 3W9ZA 1TJ2A 3OLEA 2VFEA 5FACA 4MZ8A 4W87A 1Z69A 3LBMA 3KTSA 4IJCA 3SBFA 1ICSA 1D3CA 4QRNA 3TCEA 4MY8A 3TYBA 1POJA 2JALA 4HA3A 3O6YX 2XN1A 5C2XA 3KOZA 3FGCA 1E56A 2IMRA 1LLZA 3ONBA 3KOYA 3M7WA 4AWEA 4UOZA 3B8DA 4LS2A 2Y5SA 3V3WA 1DVJA 1SFSA 1HNYA 4NT0A 1E5NA 3STEA 2NVCA 3REQB 3TYUA 3WQDA 2VTFA 5K3VA 1ZAHA 1L6GA 1TMQA 3H2OA 4JAWA 4I9MA 1FBAA 4IXXA 3PZUA 1TPEA 5HATA 1E6PA 3B9AA 3AO0A 3GVWA 3GHUA 4J40A 4KFNA 4U2ZA 4HJWA 3FAXA 1EA9C 1JG9A 3QTPA 4DO7A 3HG5A 1AH4A 3UGRA 3CUGA 1JYWA 3MW7A 2ZICA 1D8CA 1ONEA 1SO4A 1ZAJA 3HJZA 3ZVHA 3W1QA 3KVJA 4DJDA 1BSLA 2HSAA 3O6AA 1LQ2A 1KCLA 5HOSA 5G1YA 2JF7A 3FJNA 1NWSA 3FX4A 3KCOA 4P8VA 1QOPA 2KZHA 5B7ZA 2W5FA 2C79A 2QCGA 3CHVA 4RNHA 4R85A 1HZYA 2WC7A 3CV1A 5D9PA 2ZX7A 4C7FA 3VTRA 1X97A 1EXBA 4JFVA 2XIBA 4XBJA 4GUHA 2TPSA 2YYUA 3AWNA 4WRHA 1KM1A 2O7QA 2HK0A 2PDNA 5JXQA 4AY8A 3HB9A 1UUQA 4Y96A 1AD1A 3AS3A 2VWTA 2A6NA 2CBJA 5REQA 3W88A 2FZNA 1GCYA 2OB3A 3FFSA 3UETA 1J0YA 3W6MA 2V30A 3O3RA 4K37A 2AL2B 1FTXA 3BZGA 2WSRA 1KV8A 2XVGA 3PZ9A 4S1FA 2B7PA 2Z0IA 4ZTYA 4C1KA 1S46A 3EX1A 3BJSA 2Y8KA 1H7WA 1OZQA 2D2HA 2X05A 3VI2A 5FD0A 3R2GA 1XIFA 4RJEA 4F9DA 4Q8PA 1PXGA 3G8EA 4HPNA 1FWJC 1MXDA 4X2PA 1EGZA 3TSMA 3W7CA 5F7UA 3QW3A 3WLQA 4Q8TA 1NEYA 5CEWA 3KP1A 3ZJ6A 1DOSA 5U4NA 1S1PA 2JKPA 3Q94A 4PB4A 5AYZA 3TFCA 1UMYA 1VHNA 1TB3A 1DIOA 3PZMA 4CEXC 2X40A 3ZM8A 4DX3A 3N25A 1FQ0A 5BMWA 3E2RA 2H3BA 3UJRA 2DIJA 1X38A 1V3IA 1AJZA 5TNVA 3WLPA 2PDXA 1L6WA 2ZUSA 1JF5A 2Z1XA 5BXSA 1JCTA 2OZ0A 2Q02A 4WKAA 1DPMA 5E0CA 1DQUA 2J25A 3AXIA 1QNVA 4RZ6A 3HGSA 2WC4A 3WH7A 2BHUA 4BI5A 1V3HA 2VFIA 3TN5A 2AAAA 1O5QA 3AMLA 5EA9A 3KCLA 1TKKA 2ZUNA 4TVUA 3LG3A 3MTWA 1J79A 3QYQA 3TK7A 3FA4A 4C6OA 3M6DA 1H7OA 1Y0EA 3CPUA 1A5CA 4X9YA 4Q6XA 3K4AA 1U1JA 1PX3A 4IPLA 3SRHA 1DE5A 1I2NA 4W84A 3VOFA 3DECA 2QCFA 1HP4A 3K1GA 2J7EA 3W2MA 4IZGA 1PCWA 3TYDA 1E1CB 3FY1A 2OQYA 3TQVA 5AHMA 3W7GA 4NNAA 3H23A 4EPKA 2PGFA 4V2XA 3USBA 1XLDA 3EPOA 1B3VA 4FNSA 2D22A 3LGGA 3SRKA 2DIEA 2P53A 4MB3A 3KEHA 1DQWA 4MLJA 2FHCA 1O7AA 3C56A 3B0XA 4RE3A 4IG2A 1QU4A 4ALDA 3S2NA 2DSWA 1OC7A 4KRZA 1KKOA 3LXBA 2HNEA 4JDBA 2EPNA 3DN5A 2RDXA 4R5EA 2DZAA 3P61A 4NJHA 3SUTA 3A4WA 1HGYA 2DPEA 4A35A 3UJEA 1JFXA 2BY0A 5I03A 3W76A 4LYKA 5AFDA 3S1WA 3MC5A 2Z4GA 3TN3A 4QG9A 2YW4A 3WNKA 1DJNA 1HX0A 1Z9AA 4WXYA 3B8TA 4XB3A 3AIUA 1GOIA 3BSGA 4N42A 3T1GA 4GYPC 3R0DA 2Y5JA 3EXRA 2PRHA 1GONA 4ZO9A 2WPBA 1M01A 3PJXA 1E3XA 3CWOX 1FWFC 3WFZA 1OCJA 3GLCA 1NM9A 4GCXA 1RQHA 1R8LA 1I0DA 3ZZ1A 3K4DA 3OTRA 4HA0A 1F7BA 1Q6GA 1GW1A 4H9XA 1E6RA 1T40A 4EF8A 3MJYA 3F2DA 3C0JA 3QOMA 3M41A 1KO0A 4IMDA 1VJSA 3EB2A 3GW0A 4QX4A 1K02A 1EYWA 1AMKA 3G0SA 4EACA 2G3MA 3KL3A 1BG4A 4JOMA 2IQDA 4XZNX 4EVZA 1CXKA 1W3HA 1UZHA 3TJIA 1KR1A 1G7VA 3P81A 1UD8A 3CHDA 1GJWA 2GGIA 3LCHA 4CQ9A 3SURA 3G3MA 2HBVA 5AVHA 3W81A 1CB2A 1OFDA 3PP7A 3E3HA 4E38A 1XIJA 3N15A 3VM5A 1XD1A 3FA3A 2QHAA 2OU4A 2YBVA 1H09A 1JNDA 1Q3NA 2WQPA 1TCMA 1FHVA 3FGCB 4ZOAA 1K77A 2FTYA 1ITXA 5G2WA 3EX4A 3MMUA 1G4PA 3ABZA 4GUIA 4AH7A 2QKFA 5DF0A 2POZA 3BAWA 4G8TA 3AJ7A 1QHPA 1MFVA 2CETA 2J7CA 3IVTA 3VDHA 4GI8A 4S2CA 3QEZA 5KINA 2DY3A 4A3HA 2NXGA 1GOMA 3N19B 1NELA 4Q8NA 1ZY9A 2OX1A 1NDWA 3E2SA 5AZ0A 3HN3A 1E0XA 4E4PA 1KXHA 2ZRZA 4LAUA 2VOTA 3TE9A 1B2YA 5E93A 3BE7A 2J4GA 3E0WA 3BLLA 3AI0A 4PH6A 4AISA 3TKFA 2PDFA 3GR4A 3ZVHB 1Z48A 3PZGA 3U5YA 4JN6A 4AZHA 2IUZA 1G01A 2XHYA 5GJPA 1QO5A 3GBEA 1AQHA 4PUNA 3CT7A 4LBSA 3AROA 2IKHA 3M9YA 3QJAA 4AQLA 4LAZA 1QWKA 3VIPA 3RO8A 4NSBA 3MUAA 1MW0A 5D09A 3B9EA 3IJ8A 3QSRA 1YDVA 3KDOA 3B03A 3RFAA 4DUOA 1R85A 3OEXA 1UASA 1WE5A 5REQB 3TYEA 3NIYA 5E1QA 3EB4A 3TCSA 3LY0A 4K7VA 5LHFA 2J6VA 1XRFA 5CGQA 4Q4RA 3M5XA 2VQTA 1BGGA 3B9NA 3WMSA 3ITYA 3VIJA 4UR8A 1AQMA 3GXTA 1DL3A 1UD2A 3M0HA 1HXJA 2ZE3A 1FH7A 2WSYA 4UQDA 1ODUA 1NWRA 3AXHA 4AF0A 1XIDA 4NAFA 3LA4A 2ON3A 2TAAA 4H6EA 4MY1A 2F8QA 4P7OA 4JPGA 3W86A 4U4MA 2QJHA 4HOWA 2O4QA 3N73A 4Q8OA 3HQPA 4S3BA 1JZ7A 2VGFA 4J7RA 3PULA 2DORA 3RLHA 2YXGA 3WYZA 1YEYA 3QQWA 2CLPA 3KRUA 3MDUA 4Y8FA 3MB9A 2QCHA 5HINA 2VR5A 4J4KA 1Q8JA 3HV8A 4FX8A 4UZUA 1D9EA 2BB0A 2OKTA 4IIDA 4CU8A 4ACYA 4WEVX 4D2JA 4FF5A 5BNKA 2BS9A 4X60A 2PURA 2JIEA 3TMQA 1TSIA 2CFFA 1U5VA 3GNOA 1I4NA 3E0VA 3IRDA 1PKYA 2E6YA 4A05A 3UWYA 4K8HA 4H41A 1OVDA 4EX4A 4IX0A 1A5NC 1UH2A 2CBVA 5CXPA 4TX8A 1T8QA 1A5KC 5I77A 1HFBA 4QE5A 4LB4A 4HNUA 3TZFA 5B80A 1XM3A 3KS5A 3W82A 3AIWA 3LLXA 3WENA 2J24A 4HA1A 3WJSA 4Z1YA 3NQFA 3S42A 2D24A 5HAOA 5JIWA 4M6UA 3I7QA 3CTLA 4NZ3A 5FIPA 4LAOA 5A6AA 3GZAA 1SMAA 2O9PA 1XIHA 5G4HC 3NR0A 1LBMA 3NM1A 2QCNA 5HK4A 4A3QA 2RUSA 1FCQA 3LCWA 1EJUC 3VGEA 2G97A 3LBOA 1U5JA 4MWAE 4O16A 2WBKA 5G1TA 4ZOCA 3W02A 1UROA 4H04A 3BGAA 4U3CA 2GSEA 4DJFD 1M5WA 3Q4DA 5D37A 4C6FA 4PUDA 3CU2A 1D3HA 2I9EA 2FZBA 3HURA 3LPPA 2Z1BA 1X6NA 4EPBC 2RDWA 4YCOA 1GKRA 2PTZA 2CZ5A 3F4DA 4CNSA 2OT0A 3EWZA 1W9PA 2EPKX 2CHNA 2PTXA 1OC6A 1X1ZA 1VH7A 1P5BA 3R10A 3DHDA 4F0SA 4JZ5A 1GEQA 3BZJA 2ZXAA 3G1SA 3H4WA 2OGJA 3TUUA 2GK1A 3L0KA 3QF0A 4TV5A 2D3NA 1PIFA 2WSPA 4FLRA 1EIBA 3VNJA 2IKJA 4K6AA 5BROA 3PBUA 1VPYA 3CASA 1T8XA 3FKKA 5GJMA 4X63A 4LQ1A 2R6OA 4NUWA 3ZIZA 8XIAA 1VYSX 2A4AA 1B3WA 2QEZA 2PDMA 1EJVC 2G4FA 5KSWA 1TJ0A 4BCEA 2Z29A 1W9UA 3MHFA 5FJUA 1TVPA 2A85A 1JDCA 2XVNA 3QV6A 3AAMA 1XL9A 4TQTA 4ERAA 2FGLA 2IPJA 1LT8A 1KRAC 5LGXA 2BVDA 3GXNA 4W7WA 3CMJA 1THFD 3F1QA 1O12A 1NDYA 2FVLA 4M51A 4GKLA 1V03A 3P7YA 2ISWA 1GVQA 2F2HA 4PUMA 3LCGA 2X7VA 4Y6GA 4KIEA 3BG5A 4N0RA 1REQA 1EC9A 1J2BA 3SGZA 4O1FA 1BYDA 2GJRA 3LCFA 4J28A 5ECVA 1W3IA 4PRWA 4D6DA 2DUXA 1JZ6A 1WX0A 1RVGA 4YTUA 1YPXA 1JXJA 4EXQA 3ARVA 4G1NA 4NIRA 3GRIA 4H6RA 4UMAA 1FUYA 2NW0A 3VD9A 3QQ1A 3OP2A 5HWMA 1TFVA 4YTTA 4IJBA 1XICA 1ALDA 4DO5A 4K68A 4H9VA 1TPDA 4OBSA 3O9NA 3DG3A 4B3LA 4QISA 3FCPA 2OCZA 4HOXA 1W32A 3RLVA 2E9MA 5I3DA 4XUGA 4O0QA 1OYCA 2XIMA 4H3DA 4JTJA 4HSHA 3DXIA 2X1IA 1FFQA 1QAPA 3QPYA 4UTMA 1OX6A 1V5XA 3QMTA 3TWBA 4XD5A 4HYWA 3R0KA 5KZ6A 4LCQA 2VRJA 4W7VA 2W9MA 4GUJA 2HJPA 3WQOA 2OMAA 4NZFA 1CPUA 3EMQA 3MCNA 4G2DA 1US0A 2D0GA 3MCOA 3QZEA 4GJJA 3G1DA 2WZTA 2V3FA 1QPOA 4FNTA 5FAGA 2ZWZA 1J0JA 2PWEA 2Z2AA 4K8EA 5BYWA 2GGEA 4DO6A 3OA3A 2O55A 1L6SA 4W86A 2EPLX 4UBPC 3LD5A 4V33A 2GDUA 4ZTXA 2YA1A 3AHXA 5CC5A 4WDUA 4GBUA 1JPMA 5DELA 2QIIA 5AHIA 3AICA 2Q6ZA 3PG8A 3SSJA 5A2BA 3QV7A 3NGJA 1I45A 2NV1A 2VHLA 1XCWA 3I3DA 2F6KA 4O15A 3GVVA 4NU7A 1B4EA 2XN0A 3NSNA 4CVUA 2ZZ5A 4DLMA 3FOKA 1A5SA 1OIFA 4NAFB 3M43A 1I75A 4MHBA 3APYA 2ZZ1A 3N14A 4O52A 4H9TA 1YXCA 1VS1A 1KTBA 2FFCA 3IPWA 2DJLA 3KFTA 4YPJA 4ACZA 1NJJA 1MUWA 3TXVA 1TG7A 3MDWA 1Y7VA 2ESCA 3DERA 1KCXA 2BSLA 1L0PA 4U28A 2OOGA 2J7HA 3PSVA 5CZKA 1W1B1 4JYDA 2PU0A 3N17A 1A5LC 1W1VA 3N34A 1GVEA 3HG3A 1PPIA 3UP8A 1QI0A 3THAA 4P8XA 2WVUA 3EOUA 1MEHA 3AXKA 1FXPA 1KKRA 3DHPA 3EDFA 3N3MA 3R8GA 3R6IA 1OFAA 4WOZA 5K2ZA 1UOKA 1NOFA 2WNNA 4B3ZA 4JCLA 5K9DA 4LVBA 2CITA 2VGBA 1XSJA 3DYPA 3L5AA 1ONWA 1O1HA 1TIMA 5D8WA 3AFBA 4GI4A 3GFZA 3WL0A 4MOZA 4W89A 4DELA 2QIWA 5E70A 4MNLA 1ZL1A 1PEZA 4ZOBA 4GY7A 2G3JA 1ZQ5A 1XR2A 3A47A 4LEFA 3UR2A 2BGSA 3D46A 3OBEA 2WMIA 3NEHA 2D73A 3B40A 3LGEA 1QATA 1ISVA 2P1FA 3TW6A 2GJLA 4NNCA 2DW7A 3LBCA 1LF1A 3PFMA 1TPB1 1OX5A 4KKXA 2VRKA 3EEGA 1E9ZB 4ZQNA 5JQ9A 4DPPA 2ZRXA 4LVFA 2PWDA 1TRIA 4IP7A 2WZHA 2Y7DA 3CXOA 1G4TA 3UWWA 1JEZA 3H2NA 5F2LA 2O9OA 2AKMA 3BURA 1BSIA 2I16A 2NQ5A 4GIRA 4D6EA 4FX7A 4NXSA 5H6HA 3W27A 1YNPA 3W1PA 2QYGA 5AY7A 3ITCA 1H49A 4NZJA 4JQAA 2BODX 1FWIC 3CLMA 2X42A 1PX8A 3NVDA 1TUFA 1C8XA 5FA5A 2F9RA 4IPIA 3GR7A 4EAMA 3OGVA 4JIIX 2WAGA 3TTYA 1D2KA 1ME9A 6REQB 2GK1B 4JX6A 3NQVA 3NQ6A 3CM4A 2AMGA 5CZ0A 2R14A 5G4EA 4BI6A 4DBWA 1P0NA 2ISSA 3NJ3A 3STCA 5FJRA 1WZKA 4UTFA 1ZU8A 1UD6A 6CGTA 2V5BA 2RH9A 3C4UA 5DXYA 1PYMA 2BOFX 5CAHA 1ELSA 3VGHA 3TQKA 2J7BA 4UTWA 4BJHA 4ZO6A 5FJPA 3SQLA 4HCDA 4MPQA 4E5TA 3CUHA 1O68A 1AQFA 3N1AA 3SAZA 2BWGA 1SZNA 1C9WA 1XYFA 3M0LA 4DNHA 1UZ4A 1QFEA 5CLWA 3WG6A 3B05A 3FA5A 1GT8A 1M7JA 2ZX8A 5CPQA 3SIZA 3T6CA 4OJYA 2Z7KA 3CQHA 4YHGA 4TOQA 4NJIA 3S2MA 2PU1A 1AH0A 4ROPA 1P43A 2KX9A 3C8FA 3V5OA 2IKGA 4PTNA 3UYCA 2BHYA 4Y8EA 1QO2A 1REQB 1SW0A 3VDGA 2NX9A 3E9AA 2E40A 3SCRA 3RGTA 5CH9A 4Q33A 3CB3A 1GQJA 5LNSA 3WL1A 1SUXA 1F8IA 2EG8A 5A2AA 1O5KA 3QHMA 1WKDA 1B1YA 3SCQA 4JTLA 3AU2A 3U57A 3ABSA 3C5QA 3GH5A 5C8BB 4MNJA 5BWFA 1XRTA 3IV3A 2WV8A 1XDJA 4FR6A 1A49A 3MZ2A 4KWVA 5EY5A 1TWZA 4GUFA 5T9BG 5D04C 5GPRA 3WQGA 2X2GA 3WLHA 3SN1A 2YBTA 1ZRQA 1XKYA 3GNPA 1XUUA 5A3HA 1W3KA 3U9IA 1MXGA 4S3FA 4MJMA 4K38A 2E67A 3LGDA 4AIEA 3FK4A 2J88A 1UW9A 2G95A 4PCPA 1W17A 3PB2A 1J9YA 2NXIA 3FS2A 1F61A 4US6A 3CBWA 2PAJA 3VIHA 2OKOA 2E9BA 3AYRA 3RLGA 4HPHA 4V28A 1NDVA 2BMBA 1Z32X 4CCDA 1T6MA 1I1XA 2R82A 1TWWA 2E8YA 1JCMP 3FHAA 4J3SA 4AXKA 4Q4OA 1IHIA 3AHVA 3SUVA 1M9HA 1Q6OA 2R94A 3NDZA 3V36A 3DFPA 4IIEA 4LY8A 3K5XA 4YXGA 4QSFA 3KWXA 1ML1A 5HNRA 4HK6A 5CCZA 1Y8BA 3RCMA 3MKKA 4E4UA 2VDGA 1J96A 4UTKA 3H7UA 2VFGA 2PB1A 3EMZA 2YB4A 2WO5A 4YLWA 2V3EA 1EPVA 3HGOA 4U33A 1FHUA 5D33A 3LHVA 3MBDA 2J8FA 2BASA 3OVQA 2IPWA 3W87A 1GJPA 1E71M 2IXVA 5D9NA 5F2IA 1CBGA 1XXXA 3S3GA 1KFCA 4JQ1A 3CH0A 2GVGA 2H6RA 3U2OA 4OECA 3E38A 4LNYA 3W1MA 1Q4NX 1RHCA 3NSMA 4PL1A 1V6WA 3SR7A 1KQYA 2EKGA 4XAGA 1V6XA 4HNTA 1N8WA 4A3RA 4D1JA 1TPUA 1OJXA 1WZLA 4AIBA 3ORWA 4GJ1A 4YVPA 3SFWA 2PP1A 2UY5A 4ZE4A 2A3AA 2QJGA 2WMFA 2E3ZA 3NL5A 4WHBA 1KNWA 2NLYA 3WD0A 4E2OA 2Y5EA 1DWIM 3AXMA 4JTSA 1EH9A 1J01A 3STFA 1OBAA 3GG1A 1CGWA 2DJXA 2C71A 2Y85A 2OFJA 1SSGA 3T40A 2ZZ3A 3TYCA 1EPXA 2ZRWA 3C0QA 1SR9A 1ZSXA 2PBGA 3O8AA 3AJXA 4LY4A 2ZQ0A 2C1HA 2XG9A 5ENLA 2ZCGA 3BANA 4XAYA 1C90A 2GSHA 3BL3A 4DO4A 2WMIB 1VEPA 3L2MA 2NVDA 2Z28A 3W28A 3EKLA 3MWCA 4IMFA 2OXNA 3E6EA 3W2UA 4ZBCA 1RCXB 3PWAA 3PK7A 2YCLB 3TX9A 2Y63A 4M24A 4ZCWA 2ZKMX 4GZJA 2NV9A 5FI8A 1HKWA 1PX4A 1MYRA 3IJLA 2PI6A 2V63A 4AWSA 1JI1A 3B0PA 4ORMA 4EK7A 2HS8A 2VFDA 4MPKA 2XH2A 3AIRA 3FJ6A 3ITGA 3URNA 1UWTA 5HQMA 3CV6A 4XZHA 4L56A 3VE7A 4JEQA 1IWBA 3JZUA 3B06A 4F4RA 3TZNA 2OEKA 4J5NA 5MKGA 2V2DA 4XUYA 1FWNA 1IZCA 4U31A 3KVMA 3SECA 2QR6A 1D8WA 1AW2A 3MA8A 3SDOA 3MS8A 4HQVA 3MWAA 1LCOA 3W53A 3RO6A 4FI4A 1TWDA 3UVAA 4JFTA 1XLEA 1V3MA 4AWTA 1AQ0A 3UXDA 1E3ZA 1W2VA 2REQA 1E0VA 4CCEA 1XHGA 3TTQA 3WF1A 1LRNA 2CLOA 1YXDA 3SUUA 4QLJA 3MV01 3B0VC 1QBAA 4AYGA 4P8WA 4PTMA 2OSYA 3E12A 1NWUA 1LWIA 4JIQA 1EX1A 1F3TA 1AZ2A 3NYDA 1Q85A 4H8VA 2EBNA 2G3NA 5DMLA 1BXBA 5EMKA 3AS1A 3C2RA 3T0BA 1GK8A 4EE9A 1ZUAX 3IGHX 5TD4A 1K8CA 8A3HA 1IR2A 2VNCA 3H55A 1Q6EA 1VFMA 1BG9A 3VAVA 1Q65A 4FLOA 2V3GA 1XPYA 3RU8X 1PE1A 4JNZA 4I7VA 1IE7C 4V15A 3WLSA 3QC0A 1LL6A 3DESA 1US3A 2DFAA 2QDDA 3FYOA 4CNUA 4TVDA 4PGLA 5TF0A 4RE0A 2Z2UA 1OQFA 5FJIA 1G4EA 4UCFA 1MRAA 4DBSA 3K8LA 2P3EA 1BAGA 1EOKA 3RRAA 4CU6A 3IIXA 5BOEA 4H8HA 2OZ8A 2VDHA 4ADSA 3UXKA 4EKJA 2GVYA 4XKMA 4GA8A 3L2LA 4AIUA 2P10A 3P84A 4P7QA 1AW1A 4MTVA 3D0CA 4MLRA 1UA7A 2EQDA 4C6KA 2CLMA 4LEQA 3RM4A 5E0KA 1X6LA 3BQ5A 5G1MA 4UNIA 1I2RA 3DHFA 2PD9A 2W67A 3CHFA 1Z89A 3CLWA 3AYVA 1FDYA 4ZODA 3OJGA 2XUCA 1M1BA 5HR6A 1IGWA 2CW6A 1R3TA 4QNWA 3VU2A 5KMYA 4X0VA 2ZZ2A 4I9TA 3QKEA 3SGUA 3TN4A 3VUPA 1H3GA 3TOPA 4LAMA 4MAVA 2FH6A 1PDZA 4CNTA 4FHAA 3B8UA 2IW0A 5XIMA 1FOBA 1BD0A 1R38A 3M64A 3CO8A 5D2XA 4AZGA 3QFWA 4QEEA 3LERA 1CXIA 4DZHA 3G1VA 2PDKA 3LDVA 3T0CA 3C2FA 5XINA 4K8GA 3G0UA 3WNNA 2XIIA 4UUIA 4PUKA 1XC4A 1F3WA 4XX6A 4ZB2A 4NI8A 3GDTA 2FZMA 3E0IA 2X2YA 4L5ZA 4S39A 1X7FA 2DZVA 4LUYA 2YB1A 1GOWA 2FGZA 3SCOA 3SB0A 3VOHA 2GSJA 2XVPA 4MFEA 2ZRUA 4PTVA 1OG6A 4E8GA 5G2HA 2YCKX 5LNWA 1A5UA 2VC9A 5F4XA 2DEPA 1KBJA 3VIIA 5DMNA 1SPQA 3E5BA 3MI3A 5CPTA 4PUEA 1HJQA 4O12A 4DB7A 1QI5A 3BLIA 3WNPA 3W7QA 4KFPA 3T07A 1O95A 2POTA 2XINA 1PZ1A 3PN8A 2MUCA 5CGMA 1WXJA 1TQJA 3MY9A 1WDRA 4JYEA 3SJNA 4DYKA 4PMZA 1Y65A 2X8RA 2YXXA 5AYYA 2TRSA 1KQZA 3ITTA 1JPHA 1U30A 3CV7A 4LF2A 3SIMA 3VILA 1HQTA 4PMYA 1JZ3A 1VKFA 3XINA 1PDYA 5IHSA 3LHYA 2O0TA 4QIUA 3H53A 4S2BA 1X1OA 1WYIA 4O1AA 3E0LA 1HJUA 1W1TA 3F4NA 1TELA 3WQ4A 1ENUA 4O11A 5FOOA 3II1A 4M80A 3BDKA 2A2IA 3R25A 2PDWA 1WNOA 1LUCA 1UMLA 1SJAA 1HGWA 3BG9A 3BCFA 4L9XA 4QNEA 4C6NA 3W7RA 2DSVA 1ICQA 2CU0A 3AS0A 2XH7A 3B8SA 4IIGA 2I1OA 2CNCA 1QTWA 4E6MA 1RLDA 2ZTKA 2F84A 3H2MA 2WHKA 1ISXA 2FQIA 4D6JA 3O0KA 1B30A 3W7MA 3XISA 1M53A 1F4AA 3IGXA 2Z25A 2TSYA 2J62A 3O6CA 4C6IA 1GYNA 4L4MA 4FPSA 4LNCA 3V4BA 3KLLA 4R9XA 2IXUA 4B9ZA 4AEEA 2YCJA 3HMJG 1K9DA 4HCHA 1RVKA 3DUGA 4BA0A 1LBFA 1G1YA 1XIEA 4BFAA 2C14A 4KETA 1GW9A 2WVVA 1JDEA 1EL3A 3I6EA 4DF1A 1SZRA 5A6TC 4QJ1A 5I3JA 4UOJA 1AH3A 3F7JA 2J78A 2WKLA 3TJLA 1EJ7L 3F5LA 2VX5A 3NQCA 1RSCA 4GI9A 2SFPA 3NYZA 3QHOA 1LZOA 1VHCA 4P8UA 3GS6A 3ECQA 4UXDA 3FV9A 4IWWA 3HGRA 4Q7NA 1KFKA 3W07A 5DEZA 4DIAA 1BLIA 4K36A 1I8JA 3LI0A 4AD4A 4YTRA 2J9XA 4HVXA 4G1KA 1E5JA 1W9VA 4ICNA 2PDJA 1CLKA 4UFMA 2V5KA 1PZ0A 1W91A 3RG6A 5MKGB 4HP5A 2X0SA 2CESA 3KRSA 3VPLA 1G5AA 1A4MA 1NOWA 3CAVA 3SCWA 2PC8A 2FMNA 2C8NA 3UERA 4O4VA 4FOJA 5A8GA 1I60A 2WB5A 1W8GA 3WQ5A 3DG6A 5M3WA 4MGGA 5CC7A 4C91A 3BMXA 4UNLA 4NNBA 2REQB 3VOGA 3WH8A 2NVAA 3FEMA 2QCDA 5EMUA 4O18A 4UR7A 1J2WA 3ZR4A 4J3UA 5F2GA 4C1NA 1X98A 3C0LA 1AD4A 3LEPA 4OT7A 1CXFA 3VM7A 3VMPA 1UWIA 5DXXA 1HP5A 1EGMA 3CAWA 4IMEA 5H8MA 3VC5A 4DWDA 1HT6A 3FYYA 1P0KA 1R2SA 1KWGA 1R47A 1FWCC 3O07A 3P6LA 4S3JA 1UR1A 2YPIA 1CCWB 1ZP4A 1RY0A 2QUUA 4PMVA 3F4WA 2QVNA 1PJ9A 3T2QA 3S83A 1IXNA 2V5CA 3MP3A 3URBA 1Z44A 2H8ZA 4UWMA 3M0IA 3ABQA 3QY7A 1KFBA 2DQWA 1KM6A 3OG3A 3W7EA 1XCFA 2GWNA 3XIMA 1XBYA 1I9CB 3QM3A 2ZRVA 4OBRA 1A53A 2A7NA 4JR5A 2J8TA 2ISFA 4NASA 4PUUA 2WVTA 3BOLA 3W71A 5BRQA 4B9YA 4GIEA 1HW6A 1GYMA 1OG0A 2PDIA 3IIOA 3UBPC 3W1AA 4GVGA 1WAWA 2HBXA 4CEUC 2D1ZA 2HWGA 2D0FA 3MMWA 1B4KA 3CWHA 4KIRA 1M7PA 1TVNA 4HZ8A 2QV4A 3PB0A 4ADTA 5CBBA 4XD6A 2HV5A 4GIYA 5JIPA 1HKMA 2VOMA 1J10A 2YBUA 1RBAA 1OT1A 3ANYA 1C93A 2HE5A 2NUXA 4K3ZA 9XIAA 3VD7A 4Y9MA 5IBXA 4GK8A 4PB3A 3TC6A 3OYZA 1A5AA 4HPJA 4Y7EA 1U1HA 5I06A 4U5IA 5I3FA 4DQWA 5AC4A 2R1LA 4W7UA 1UWAA 4O54A 4HA4A 4IOTA 4JTEA 3KHDA 4C5YA 1WXYA 4DBUA 3TYAA 4YVVA 3L68A 2XJ7A 3TA6A 3WDHA 4YN5A 5CPSA 3LRLA 2QUTA 5FEZA 4DJEA 4JTTA 3WJXA 2QUMA 1KM2A 1Z6KA 4GKTA 1PBGA 1VGAA 4DUWA 1E4IA 4HHMA 4IMAA 2PRMA 4BI7A 4LYRA 6PTDA 3N9RA 4IFOA 4L6DA 5A8NA 3BAKA 1F07A 4Q7IA 3WFAA 4E3TA 2HVMA 4F40A 2VELA 2V69A 4CVWA 3KBSA 3NA8A 4LC8A 1GPFA 4QG6A 1RJQA 3N2TA 2W91A 2ASHA 2PUZA 2VEFA 2VL4A 3NPXA 3IUDA 1RCOB 1RA0A 4WD0A 1ADSA 2ALDA 4DEFA 4JTQA 1LRTA 3LK6A 2DIKA 2QCMA 1QI4A 1TMHA 1GG1A 4B90A 4H1ZA 4NL1A 3T08A 4H6KA 2JK2A 1S5TA 2YIHA 2XVKA 4AY7A 1WDDA 4O8RA 1J0HA 3GQYA 3CYJA 4LALA 2ZC1A 4YMZA 1WA3A 3U5UA 2O4MA 3HM7A 4HU8A 1S3HA 6TAAA 1W9DM 3D3AA 1ZJHA 3AIEA 5AECA 3NZ1A 1J0IA 3P8JA 1N82A 1VCFA 1CWYA 2GZXA 1OFOA 1XQLA 4IXHA 3LPFA 1AUSL 4JFWA 1K7FA 4UQAA 4C6LA 1HO4A 2J9ZA 3UWVA 2HS6A 4CQBA 3VKAA 3UXIA 3SEPA 3M6YA 3FKRA 2C13A 3LHTA 3APTA 2IKIA 2GDQA 4FAMA 1LUCB 3WNOA 1IEXA 2WMJA 1A3WA 1L8PA 3SCPA 3WK1A 2I14A 4KWUA 4IIBA 1KM5A 4QJ5B 3WD1A 3TQPA 2XSAA 3F5KA 2BXYA 4TTGA 1MI3A 4I9AA 4WX2A 1WDQA 4GJIA 2Y8VA 2YDQA 2VFHA 4JICA 3N4FA 4LANA 3PTDA 5CSSA 4BQ5A 4LUIA 1YADA 4AVOA 3TDFA 4XAPA 4UB9A 3D3FA 4N6FA 1FCUA 1UP0A 1KV5A 3M5VA 4GBDA 4Z0SA 5I3HA 3TR9A 1XSIA 4R7JA 3M47A 3D47A 1ZJBA 3PNZA 3R13A 4IJRA 5C71A 1W1PA 3UGVA 1JYNA 4MIMA 4US5A 2W6RA 3NL6A 3OA5A 3WBEA 3ZR6A 2ZYFA 2UY2A 2E7FA 4DZIA 1XYZA 1OCQA 2BY3A 4GO9A 1KLZA 3GVRA 1KM3A 5KETA 4I5XA 1TV4A 3LNPA 3O0FA 5ABEA 4UC5A 4BWLC 2ZDRA 4IF2A 3NQAA 2W92A 3E2VA 5CPMA 4UQEA 3N6JA 1PHQA 3W7JA 1V77A 4X22A 4ZEPA 5CZTA 5ABFA 1SFLA 2OWXA 4PZVA 3CC1A 5TAOA 2ZE0A 3KBWA 4LYPA 4OUIA 1UP3A 3E74A 1C91A 3N2MA 3OVGA 1JPIA 2VDIA 4U5KA 3MYOA 1HTIA 4WR3A 2ATSA 3WUFA 4RXFA 1YYAA 2XU2A 4RDVA 4QSHA 1VP5A 4E8DA 1A5MC 1A47A 4REQA 2PDCA 1VFFA 1O94A 1V6VA 3CMGA 1T99A 3VNIA 1Z7AA 2NSXA 1KBLA 4XD4A 1WOAA 3W85A 1GNXA 4J3WA 4PRTA 1F2JA 2VXNA 3OZYA 1XIIA 2QCDB 1CT5A 2BOEX 3WN6A 4FNRA 2EEXA 4PSPA 3KZPA 4KGJA 3AMGA 3FVMA 4C1NB 5A2CA 1EO5A 3GK0A 5HR7A 2VC5A 4OOUA 1GQIA 2BGQA 1HVQA 4GIAA 4ZQMA 3LPGA 1W5PA 3GXPA 1RP8A 4YTQA 4EPEC 1P0DA 2J75A 1WB0A 3CQ0A 3ITLA 1DKWA 1KFJA 1NOUA 3PVFA 3O7UA 1CEOA 3HZ3A 3NDYA 4CNPA 4I7WA 4GZIA 2AMXA 2CLHA 1K9TA 4GFSA 1VJIA 5LZLA 4F0KA 4CNOA 4LSBA 3AYTA 1VLWA 3E2QA 3LOTA 3OB8A 3PPFA 3GTNA 3VNYA 4XAZA 1KBBA 4WJXA 3WF2A 7PTDA 3PZTA 3SUSA 4G5DA 4NILA 3HU7A 4QAIA 4S3CA 4BKNA 3BWWA 1CYGA 8RUCA 2W63A 3GX9A 3VMOA 4HZMA 1YTKA 3N9KA 1E6NA 4AEFA 1U2YA 1SO6A 1DJIA 2RHGA 3OIHA 2VR2A 4L1GA 3BAYA 5TQLA 3EWBX 3MPGA 2UBPC 5BRPA 5FESA 3EAUA 1W31A 2D23A 3N13A 3V7PA 4UTTA 2G4JA 5CJ5A 4GNKB 2OEJA 5I24A 3CEPA 3EDKA 3LSBA 4HK5A 4N9DA 1P0BA 4WXZA 4YNGA 4H9MA 4JGDA 1UR0A 3GC4A 2C0HA 3VZXA 4ZFCA 2FLIA 3T44A 2HISA 3TMLA 3OPSA 3H24A 3WIJA 1Q7MA 3DKLA 2VZTA 1JIBA 1UYQA 2GVLA 2BY2A 3HQOA 5IDZA 3EOLA 4IP4A 2NWRA 3GE7A 3DFTA 3RDKA 8CGTA 2WK2A 1Z41A 4XAFA 1LTDA 1ZENA 3M16A 3NQDA 1UD3A 3LHZA 3QR1A 1ZS2A 1KCZA 3KL5A 1V08A 3OQEA 3DC0A 3MT1A 3EEZA 4NRRA 3SQMA 4KEVA 1DJQA 3BCDA 2XZ7A 2YFOA 3K8KA 2VGIA 2Y89A 1XD0A 2YZRA 3AHYA 5XIAA 3MUZ1 3ATYA 5I02A 1VCGA 1TA3A 2FTPA 2OT1A 3VNDA 4WK9A 4N9EA 3RCNA 4AX6A 5ECUA 3K46A 3NNTA 1J6OA 1SZFA 4W88A 1G94A 1UP2A 3DBPA 4WGHA 1GORA 4ASTA 4PB5A 5F4WA 3RR1A 5FJOA 2AOSA 3KCJA 4ROQA 2EJ1A 1FCVA 2V9DA 4HNVA 1W1YA 1RPKA 1UD4A 1VFHA 4BY3A 4B15A 4A6GA 3G0XA 1H1YA 5DY3A 1MQPA 1V6TA 1R87A 3LNMA 2HE8A 3UY8A 4AU0A 2QCEA 1OD0A 2XGIA 5C7HA 4P2VA 4L9YA 1OK4A 4FNPA 3N4AA 3IGSA 4ML9A 2I17A 3WEMA 2PDGA 4QBXA 1W2PA 3U2CA 1HIZA 3TH6A 3WNMA 1ISYA 4UZSA 1G4SA 5CJNA 4UTIA 4A3UA 3N6QA 1H7PA 4GC4A 4HHPA 4MWAA 3RF9A 3FHQA 3ZMRA 3QGAC 2GGJA 3CL7A 5LA2A 1Q6LA 1JI2A 4JTRA 3CZEA 2HPMA 1HJSA 2J7FA 1LWHA 3DKJA 2WC3A 5D05A 5B7YA 4X0NA 3L0GA 1XLCA 5K4ZA 3KDNA 3LYEA 1DJXA 5C6MA 1QNSA 4AW7A 4F79A 2OEMA 3VIFA 1W6TA 2YR1A 4PCTA 4IFRA 5C9WA 2QGYA 2Q8ZA 4R34A 4W5UA 3RR4A 1SZGA 3GR8A 4YYCA 3EOEA 3VGDA 1JJKA 2DH2A 4ZSTA 1FA2A 2C18A 3CZLA 1MNZA 1U22A 3HPFA 3WEZA 3H70A 1OFPA 4DJED 2Y7FA 2DH3A 3VOCA 4V1XA 5E09A 4ECLA 4JTGA 1XLGA 5A6LA 3C6CA 4IT1A 4PODA 3ZOAA 3A13A 2FHFA 1TJ1A 1XP3A 2VT0A 1K9EA 1W5OA 2DQXA 4NJJA 5DX7A 1WPCA 5LIUX 4H83A 4FA3A 1XINA 3ME3A 1RA5A 4RDWA 2QLYA 1IGSA 1U33A 3HIJA 1B5TA 4GCAA 2OPJA 4XKYA 3O05A 3ZO9A 4DXXA 1XYAA 1GTHA 4FF7A 4HMCA 5CC3A 1CENA 3NG3A 3A3HA 5EMYA 1SFJA 2GUYA 3AUOA 3H2EA 1ADOA 1ZNNA 3AWOA 2EPOA 3QZAA 2ZFAA 1V8EA 1YNQA 2V6AA 3AU6A 5BOFA 1X39A 4D6HA 1H7XA 1EBGA 3RITA 1H4PA 1Q6FA 2YYTA 1Z3NA 3W2NA 2VX6A 1EF3A 4O1BA 4IQEA 5ABFB 1KLYA 4K39A 1DYSA 1CXHA 4K2SA 1XH1A 3A22A 3BMVA 1KWKA 4GLEA 1V3KA 4RZ4A 4GMEA 4DWSA 1O6IA 2H8XA 4HKPA 2Y88A 4PULA 4HN8A 5LXEA 5I07A 3JRKA 1LYXA 1E4LA 1GHRA 3P74A 3THQA 3LSCA 1KXTA 3NUKA 4RV3A 1V6YA 4F48A 4REQB 4MADA 3EDDA 3QFEA 4GISA 1F73A 4JTHA 4CLMA 1CIUA 3R11A 2OGYA 4PTDA 4L4OA 3UZXA 2AQOA 1NU5A 2QT3A 4Q8WA 1LM1A 3NQ2A 2YJQA 2ACRA 3UW6A 5D02A 1PYFA 3E1F1 4HHHA 3OZOA 4UOQA 4AG0A 5BXTA 3BSMA 3EKGA 1PKLA 3KUMA 3S1UA 4IQDA 1KGXA 1Q2RA 2P88A 3G1AA 4UFKA 5FF2A 4YWSA 1WUEA 2Q09A 4NY2A 5FF7A 1UR3M 3AZTA 3WNLA 2NXHA 4AWUA 4YU1A 1BWKA 4B91A 1OD8A 2X0YA 3MBFA 1W9XA 6XIMA 3W6YA 1YQ2A 4H00A 5U7SA 3BO9A 3EA3A 1QNOA 3WD3A 4HYRA 4PCNA 2RDTA 3GY1A 2QS8A 3W84A 1EJXC 1KXVA 1RK6A 4QTGA 1J12A 1A4LA 1H1ZA 1KTCA 2D2JA 4D6GA 5HQEA 4US5D 5GNZA 4RE4A 4KMQA 3VKKA 3EA2A 4HT3A 5BRBA 3WBYA 4RPPA 1DJHA 1ODZA 4JD4A 4KEUA 4DF2A 3WCZA 2PCQA 2Y0FA 3WO8A 4LTSA 2QQ6A 5HQLA 3WLOA 1JVNA 1W3TA 4XVDA 5FJTA 1TZZA 3IJ6A 1QPKA 5HPCA 1Q7QA 1DXEA 4PMDA 3LN3A 4UIOA 1M6JA 4BQ4A 3CUZA 1QI3A 3AHTA 2DT1A 3V35A 4RPQA 2WLZA 2YL6A 1MDRA 2XFWA 1ZPTA 3EBVA 7A3HA 3GUWA 2QF8A 1R86A 4B4FA 4HNLA 1PIGA 2VD9A 3L0NA 4Q4KA 3RMJA 4NP7A 3IS4A 5GNXA 3DAQA 3UPBA 4LUSA 4OOZA 1NF7A 3VXGA 4JN8A 4O1DA 1EDGA 2VEIA 1VLIA 1JZ5A 4AC1X 1XLMA 4BZYA 3JR2A 5AHEA 1OX4A 5D2TA 4YIWA 4JY9A 3QOKA 4FXSA 1NVMA 1J5SA 1DJZA 5I78A 1EJRC 3SRDA 3K4WA 1SYTA 4ATLA 3A21A 3DU0A 2PDYA 3PJWA 8TIMA 3S1GA 2UY3A 3WQCA 3CPRA 3B3DA 2VC7A 1JPKA 3K30A 5E0FA 1WV2A 5LIXX 1TA3B 1PB0A 3W0KA 3UG4A 3HA1A 2QCCA 4M81A 2DUZA 1XH0A 4OFCA 1GKPA 2WJFA 4LV9A 3W2JA 1R30A 2ZVIA 5I23A 4MAZA 1MUCA 2PLJA 4MJ2A 3QPEA 3CS2A 3LU2A 2QF7A 5D9MA 3DX5A 4PTWA 3UA4A 1Q6RA 5D30A 1H2JA 4D6CA 3POCA 1KGWA 4AX7A 4IHCA 3C2EA 2J79A 3WBAA 1RK5A 3W23A 2GQ8A 1XX1A 1FWRA 2F38A 3VGFA 3QR0A 3G18A 1ZHAA 3O1NA 2OTDA 3H2AA 1QCWA 5JUVA 1TYGA 2PA6A 1XBZA 3M0XA 3OVRA 3M07A 3NXLA 1RR2A 3L2IA 4MWAB 4WY0B 3IVSA 3GXMA 1V0MA 3VCRA 3L65A 4O1CA 2EAWA 5C9UA 4BHYA 1L6YA 4KERA 1MO0A 1UKTA 1A0DA 2ZVRA 2P3ZA 3ZS4A 5E6ZA 1UQYA 4Q3MA 4Q4SA 4J1OA 1JQXA 1MSSA 4P7LA 3A23A 4WOQA 2DVTA 1EEPA 1GQKA 2PP3A 3CZGA 4QG8A 1ICPA 3UZJA 1SFTA 5IRPA 5D8ZA 4XO7A 3B8WA 4DI9A 4DZ5A 1EP1A 1CNVA 3E96A 1LWJA 1BFNA 2OVLA 4QAWA 1AG1O 1E0UA 2E5CA 3VIKA 4CNNA 3ARWA 2ZZ6A 3R43A 1HJVA 2BBFA 4LRTA 2INFA 4XZIA 5IM51 1WBHA 3LB0A 1RQEA 2UV8G 2HVNA 2YXOA 3MQTA 5J04A 3FAWA 1JZ4A 1JRBA 1NDZA 3URQA 4RDYA 3LLDA 4LX4A 4HNOA 4PCFA 4W8AA 3R8RA 1FWGC 3LCXA 3C52A 3NPVA 4WUIA 3MANA 4UCGA 3AMCA 3ID7A 3UG3A 1QK0A 3UG5A 3IJIA 3RJYA 3SCNA 3HG2A 4XKYB 3QR3A 3M44A 4LS0A 3W1XA 1FWEC 1JDDA 3RPDA 4H2HA 1OYBA 1P6BA 2ZUTA 4J9JA 1E40A 2LLEA 4QP0A 3QSTA 2FPYA 1W37A 2X1UA 2NQLA 4HD5A 1XDMA 4CN1A 1H7NA 2OOFA 1T5AA 5CSYA 4WZHA 2I56A 3PWGA 4S3DA 3OHMB 3GU2A 3PTKA 4MF4A 5DCDA 2UZ9A 2A0NA 4GABA 4NJGA 3T0AA 3WQVA 3LV6A 5JVLA 4HN4A 2EXOA 4DWSB 1EF2A 3SSZA 3IVUA 1PZ2A 3W1LA 4KCUA 2Y61A 3A24A 4F3HA 3BUVA 3H54A 4IP5A 3WF3A 4B5SA 2Q71A 1FVPA 1ITQA 4MWAD 1KD0A 3T9PA 5CPLA 1I1WA 4O4WA 1IV8A 4TTUA 3OLGA 4RNFA 3BLEA 3CAQA 7CGTA 4G56A 4CN4A 3W24A 1XYCA 2DW6A 3THCA 5H8PA 3M7SA 4JFUA 2A21A 3ARUA 5HPOA 4TU1A 3ARQA 5DRCA 1PCKA 4QEHA 2CEQA 2GOUA 2O7SA 4UR9A 4NXKA 5CSUA 3CK5A 1BKSA 1PTDA 4N2YA 5C54A 8XIMA 3WLIA 1VZWA 1FHDA 3HQ1A 5HXMA 1QBBA 2BNJA 2WJEA 3JZEA 3PTMA 4Z2GA 2RJGA 4JN7A 4RCXA 3MSGA 3L23A 1XI3A 4U2YA 3VX1A 3DFNA 3QTGA 4PUWA 2F6XA 3B9DA 1YBQA 1IZKA 3B97A 3N2XA 4HK7A 1FDJA 4AIOA 1CGYA 5T26A 2AGKA 4H19A 4JIPA 3SFKA 3M4HA 4KS0A 2XWDA 3I3BA 2DZPA 3LCLA 2VJXA 2DSUA 3PR2A 1UC5A 1XYLA 5DT5A 5BXRA 3N18A 3W1TA 4O1EA 4JEJA 1XCXA 3T4WA 2WKJA 1WBJA 2EGZA 1E0WA 1XH2A 4W8LA 5HBFA 3U48A 3NQMA 5AN7A 1GZ1A 1H0GA 5HMEA 2PBOA 1JAEA 2BV9A 4I3GA 1CDGA