1HJQA

Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
332
structure length
332
Chain Sequence
b'ALQYKGVDWSSVMVEERAGVRYKNVNGQEKPLEYILAENGVNMVRQRVWVNPWDGNYNLDYNIQLARRAKAAGLGLYINFHYSDTWADPAHQTTPAGWPSDINNLAWKLYNYTLDSMNRFADAGIQVDIVSIGNEITQGLLWPLGKTNNWYNIARLLHSAAWGVKDSRLNPKPKIMVHLDNGWNWDTQNWWYTNVLSQGPFEMSDFDMMGVSFYPFYSASATLDSLRRSLNNMVSRWGKEVAVVETNWPTSCPYPRYQFPADVRNVPFSAAGQTQYIQSVANVVSSVSKGVGLFYWEPAWIHNANLGSSCADNTMFTPSGQALSSLSVFHRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,4-GALACTANASE
publication title Structure of Two Fungal Beta-1,4-Galactanases: Searching for the Basis for Temperature and Ph Optimum
pubmed doi rcsb
source organism Humicola insolens
molecule tags Hydrolase
total genus 129
structure length 332
sequence length 332
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hjqA00
3M07A 1FH7A 3S6TA 3EDEA 1WNOA 5HPOA 1FP9A 2VNCA 4M29A 1OINA 3CLWA 2V5DA 1Q6DA 2VZOA 5ABEA 1B3YA 3GDBA 1KR1A 1VJZA 4HPGA 4U3AA 1TMQA 2WSKA 4HZ6A 1F4AA 2Z1KA 2JE8A 1ZL1A 2O9TA 3SUVA 5AC5A 2BY2A 4BZYA 2DPEA 2G3MA 1KXVA 3AIEA 2JFEX 4JHOA 4MDOA 3ZJ6A 3WMBA 4UFMA 4PUDA 4ATDA 5CG0A 1UD3A 3WFZA 5I5RA 1UYQA 3LMYA 4PMXA 1HKJA 4W84A 2Q8XA 3W6LA 5BXTA 1GQJA 1EHAA 3ZR6A 2E4TA 3RM9A 4PCTA 2BY1A 4W86A 3PZQA 4JFUA 2WC4A 1V3KA 2WVUA 3DYMA 3W53A 1DWFM 2QHAA 1VENA 2VZTA 3OLGA 1BYCA 1E4NA 2V3GA 4DM1A 4HTYA 2DDXA 2XVPA 1R8LA 3I3EA 4AW7A 1P6WA 1Q6EA 2DGAA 1OIMA 3W81A 4HP5A 2XFFA 3CHEA 1UD5A 2JEQA 1XSIA 1U30A 2ZX7A 3M6DA 2O9PA 2VVSA 4RE3A 4FLQA 1E6XM 3PTKA 1E6NA 2WCAA 4W89A 2FHCA 4EKJA 4CGTA 4CKQA 5IFPA 1XD1A 3VUPA 1GORA 2CNCA 3WD2A 1KBBA 4HU8A 1M03A 4XUYA 4URIA 1CTNA 4CCEA 1KQZA 1OGSA 2GJXB 4UOZA 5ABHA 1QNQA 3AJ7A 1FP8A 1KWGA 1WP6A 4W93A 3PZUA 1EHNA 2BVDA 5D9MA 2ZX6A 4EE9A 4F66A 1HP5A 5CQ1A 4WKFA 4XZWA 2WHLA 1CNVA 2DH3A 1E72M 5CGTA 4AZHA 1VFFA 1GOWA 2AAAA 3ARZA 1XH0A 1E0VA 1ISZA 3GM8A 5A1AA 5FKYA 4OUEA 1BF2A 5CJ5A 3ARYA 4Z2KA 5JIPA 4J3VA 1EDTA 3NJ3A 4J3XA 2BY0A 3B9EA 3VGGA 1K9TA 2E3ZA 4ZEPA 4W88A 2WMJA 1HL8A 3AMDA 3UERA 3GNRA 2ZWYA 4HMDA 3MSDA 5A8NA 3CUHA 1ITXA 1IV8A 1TA3A 1W9DM 1BLIA 2J79A 1E40A 1HKKA 1HVQA 2WXDM 3T2OA 1BVZA 4UTFA 4OBSA 2YL8A 5CZKA 1H41A 1E1EA 3GXMA 3FY1A 1UKOA 2EPKX 2XHYA 3DHPA 3PZ9A 2WAGA 3EDDA 4PTXA 5BRPA 1M7XA 1H0IA 1V0NA 3WKZA 1V08A 1EQCA 1CBGA 2WLZA 1KCLA 4FK9A 3WQ8A 1UR9A 5CLWA 1J0IA 1CENA 3VD7A 1CZ1A 2VTFA 2PF0A 3FHQA 4UNIA 3BLPX 5I23A 1H3GA 2V3FA 1E71M 1MYRA 3VDAA 4XB3A 4N42A 1E5JA 4NF7A 1J0YA 4E8CA 2G8ZA 3K8KA 5FL1A 1HX0A 1HKIA 3CHDA 2PWDA 1CLXA 5CPSA 1CXLA 4PN2A 5E09A 3WELA 4DWSD 2O9RA 1E0XA 4GXPA 2VI0A 1E55A 3AIQA 4W5UA 1WDPA 4DUWA 1NOUA 3W37A 2FGLA 1V0LA 1QNOA 4PSPA 4U5IA 3BMVA 1HN1A 2VMFA 2EJ1A 5CSYA 1UA3A 2WCSA 3L4YA 3F4VA 4GQRA 2OYLA 4ACZA 4MJ2A 4U5KA 2WZEA 4NRSA 1XHGA 1AQMA 2D3LA 5A6SA 4E4PA 5A6AA 3O6AA 5CGMA 2WVVA 3VGHA 1TFVA 2ZE0A 1U33A 2WCGA 1VEOA 2OSWA 4AZIA 2PI6A 2GK1A 1CGYA 4CVUA 4W8LA 4AZBA 4Z2GA 1XH2A 2FHBA 2J75A 3VDBA 5DO8A 3WMSA 3AQUA 7A3HA 3AXXA 4AZCA 1NWRA 3GNOA 3EBVA 4BCEA 2WM0A 3WD1A 2QMKA 2J47A 8CGTA 1W3HA 4D1IA 1E43A 2BFGA 1VB9A 1EIBA 1MWOA 3WQ5A 1OB0A 1XYZA 4PMDA 6TAAA 2WZIA 3VILA 2Y8KA 1BYAA 2DEPA 3VDHA 3G6LA 2J7DA 1UWUA 4DM2A 3POHA 3AMCA 1C7TA 4UZSA 4EK7A 1QW9A 3MV01 3W4RA 1JAKA 1MQQA 2TAAA 2WHMA 3MV11 4CUCA 2CERA 3T0BA 1I1XA 1EQPA 3VD4A 2CKRA 1EA9C 1JZ3A 1E4MM 4UR9A 4H04A 3WEOA 3AMLA 2J7CA 2F2HA 3AXHA 3VIJA 4PMNA 1VEPA 2DH2A 3ARXA 3KE0A 3NCOA 2WMGA 3SUSA 1B30A 2OWXA 3M7SA 1PAMA 1G0CA 3DYPA 3UG4A 4F9JA 1VBRA 2VRQA 2X1IA 3ZM8A 5LYRA 3N17A 1TCMA 4AIEA 3WL0A 4MAVA 1JYNA 5JUVA 2Y2WA 1Y7VA 1UKTA 1KGXA 3WDHA 2XVNA 4F9DA 3VIHA 1HT6A 4DWSA 1UWQA 5FD0A 5M3WA 1GOIA 4EAMA 1GVYA 3G6MA 4HOWA 4CN6A 2XFRA 2V5CA 1JDDA 1OSEA 2QF8A 3T08A 2FDMA 2PBGA 4W7VA 2J8FA 2F61A 3VTRA 2VC9A 3L2LA 3ZT6A 1K9FA 2VVNA 2WLYA 1KWKA 1VBUA 1V6XA 3W29A 2J7EA 3PN8A 3QHOA 3SCSA 1MXDA 5EFFA 3GNPA 4Z2HA 2FHFA 4ATLA 2WMIB 4UZUA 1A3HA 2ZICA 3JUGA 3ARSA 4JKLA 1GQKA 1W1PA 1HP4A 4MADA 5FOOA 1US3A 4P7LA 4PMOA 2PWEA 7TAAA 1MW3A 4LYRA 4LPCA 4J3UA 1NH6A 1QHPA 1W9PA 1ISVA 1BGGA 1J0KA 4L4PA 3N12A 2XM1A 3W28A 3WUFA 5DF0A 1Z32X 1UD6A 4U2ZA 3UR8A 1E6PA 3WNKA 1BYBA 1E4IA 1E9LA 2J78A 2DT2A 2WVSA 5A3HA 1TZ7A 2CHNA 4J3TA 4ZENA 1B90A 1ISXA 2YLAA 3F5KA 3BLKA 1UD8A 2WK2A 2QPSA 1HJXA 1BGAA 1NOWA 4PMRA 2EPMX 3AHVA 4S3KA 4JKMA 4Y7EA 3GTNA 4D71A 3VGDA 2DT3A 1NQ6A 1U2YA 3VDCA 1AQHA 5C8BB 3CGTA 3TTQA 1UQZA 4GI8A 2VX6A 3NSMA 1UA7A 3OBAA 4GZIA 3WF4A 1ZBWA 1WKYA 5JBDA 1GOMA 1TE1A 3B8SA 3AYSA 3RCNA 4PUEA 2WMFA 5FIPA 2VQUA 5E6ZA 4NRRA 3AS3A 3ALFA 2PWGA 5AYIA 3S2CA 3BAIA 1JZ8A 2YIHA 1UH4A 1KXQA 1L0PA 1XD0A 2BNJA 5GPRA 2D1ZA 2CEQA 2WWCA 3CZLA 4ACYA 1UWIA 1CXEA 4AZ7A 1NOFA 3SCRA 1E3ZA 3IAPA 5ECUA 4RE2A 3PZMA 5A69A 4F79A 4V27A 5GNZA 2CHOA 2NW0A 1JF5A 3WH7A 4PCSA 4GINA 1GJWA 1J12A 3CUJA 5AC4A 2ZXBA 4OOZA 2WKGA 1VJSA 4AISA 2CYGA 4YPJA 3B9AA 4QDMA 5BXSA 3POCA 4Z2LA 1W3KA 1HJUA 4CD8A 2EXOA 2D22A 3CZJA 1LL4A 4WSKA 1JF6A 1GPFA 1V3LA 4OJYA 5A6JA 4D6EA 1GOKA 1V02E 5HNNA 3FNDA 4W5ZA 1JD7A 4PMYA 4YHGA 4K68A 2FH6A 1BYDA 2ZX8A 4GPNA 4KRTA 5FCZA 1JYXA 3WNPA 5CPTA 2OYMA 4JFSA 1E5NA 4KMQA 4F8XA 5IHSA 3AHXA 4IPNB 1QI3A 1FFQA 3W38A 2DSKA 3WH8A 3WD4A 2XJ7A 3WY1A 2O9OA 3EDFA 1DWJM 1E6QM 1LLOA 4WK9A 3AROA 4BQ3A 5HOSA 2J62A 3WQVA 4H2CA 3BAYA 2HVMA 5BWFA 3RJYA 3W6MA 4KH2A 1NWTA 1WCGA 1VFMA 3OLEA 2WPGA 1JG9A 4AD4A 4TVUA 1GW1A 3WH5A 1BG4A 3SCNA 3PZOA 1QBBA 2E40A 2E9MA 3THCA 1QI0A 3AHTA 3WQ6A 2EPOA 4AD0A 4AXNA 1PEZA 1VFOA 4UQEA 4TVDA 1C8YA 1LL7A 5A2BA 3ARRA 3SCWA 2YDSA 4AD1A 1ZB5A 3A4AA 4J3WA 3TONA 3OZPA 2BHYA 4BA0A 4UQ9A 4B9YA 4MAZA 2A3EA 2WBKA 2XM2A 4XX6A 3VU2A 3THDA 5C70A 3WDQA 4PMZA 4ZE5A 4CD6A 1W9UA 1QI4A 2A3CA 4C7DA 1BHGA 3CMGA 3CHCA 2XYLA 4Q22A 3WNLA 3WQWA 5A6MA 3VPLA 3B9DA 3PZVA 1UUQA 1SYTA 1TUXA 3AI0A 4P8XA 4CU6A 1MFVA 1R7OA 4OBRA 2CKSA 3CPUA 1OWQA 2Z1SA 2JIEA 3LPGA 3ARPA 1GCYA 2Y8VA 4HZ8A 4UFIA 4ATWA 3VD9A 2YDRA 2UY2A 4OIFA 2PWFA 1US2A 1GOQA 4M80A 1KXTA 2WMKA 2ESCA 2EEXA 3MMUA 2JIWA 4V28A 2C7FA 4PEEA 4OKDA 4GZJA 1ZS2A 4KWUA 1DWHM 3PBGA 4V2XA 2VCAA 3ARWA 3ECQA 3N13A 4WF7A 4GI6A 5BXRA 1QHZA 2YL9A 3WF1A 3GXFA 4U31A 4ZFMA 3WNMA 1V6YA 2J74A 4UOQA 2GJPA 2BY3A 3AS2A 4TXEA 2XWDA 1UR4A 4QAWA 4WLCA 1DWIM 1JXKA 4P7NA 3SCQA 3L4TA 3II1A 5I2UA 5A8MA 2CBIA 1UQYA 4CD7A 4IM4A 3SEPA 1XC6A 3VIKA 4MNKA 4UOJA 9CGTA 1JDAA 1UG6A 5A95A 4A3HA 1TA3B 1HF6A 2XFYA 3VIOA 3QGVA 1WE5A 3VGBA 2DSVA 2X2YA 1OD0A 1CWYA 3IJ8A 2IUZA 2DSWA 3WEMA 1CGXA 1KR0A 2ZUTA 1N82A 4U33A 1C3FA 4MNJA 1ODUA 1E70M 3ZT7A 3AXIA 1OM0A 1B1YA 4JIEA 3SIMA 1FOBA 1J10A 3DYOA 3TTYA 4TUFA 4QLJA 1WO2A 1KCKA 3CBWA 1PZ3A 3L2MA 2PBOA 1CXKA 3IK2A 1GQLA 1DHKA 3MUZ1 2YA0A 1EH9A 4YN5A 3NSXA 1OD8A 3VM5A 1HJWA 3FAWA 1GVIA 3AIWA 1BVNP 2C0HA 4A4AA 2QPUA 1RD6A 2IXUA 1MXGA 4J7RA 3TTOA 1UOKA 3PZGA 2O92A 1PPIA 4AD2A 2D24A 3VGFA 3O9NA 5I77A 4H41A 5DT7A 1PZ2A 3AFBA 1FH9A 5CPQA 3MO4A 1V3IA 3BXWA 4W7WA 4AMCA 2VURA 3CZEA 3L4XA 4H8UA 3GZAA 2GDUA 2VO5A 2RGMA 3L4ZA 4B3KA 4ACZB 2EO7A 1IZKA 4JFTA 2X0HA 4E2OA 2FGZA 2ZOXA 2WVVB 2VR4A 4MNLA 1V3HA 1CLVA 3WNNA 4TVCA 2GK1B 1S46A 4S3JA 3RIKA 3EMQA 4KGJA 4H8VA 2DIEA 5D9OA 1C7SA 1HVXA 3WDPP 2A3AA 4GZEA 3ZOAA 3ZJKA 3CUGA 2JF6A 3ZMRA 4AIUA 3OLDA 3OB8A 3KL3A 1D2KA 3WUGA 1MFUA 2VUYA 2XPKA 3L4VA 5E0CA 5A8PA 3KEHA 2GFTA 2OSYA 4P8VA 1RP9A 4U2YA 3L4WA 2BXYA 3TA9A 2ZIDA 1JGIA 3EDKA 3KL0A 5IDIA 3WUEA 1LG1A 3BGAA 3GYCA 5E9AA 2VR5A 1CGWA 2ZUSA 4JCLA 4TTGA 1ZJBA 1F4HA 4FLSA 2ZUUA 3QR3A 2D0GA 2CCRA 5BRQA 2J4GA 1J0ZA 3FN9A 4R27A 3AIRA 5A2AA 3D3AA 3ZSTA 2UWFA 3T2PA 5BCAA 1CECA 5EMYA 1KGWA 1UR2A 2J7BA 4PTVA 2PB1A 4UFJA 5DFAA 3HU7A 4XZBA 2QLYA 2PC8A 1O6IA 1KFWA 1H11A 2W61A 3VGEA 5HDRA 1PX4A 3RM4A 1WZLA 3SCTA 1KGUA 5ABGA 2YKKA 1EDGA 4IISA 3VINA 3CMJA 4JL2A 3APGA 1G5AA 1VF8A 4CCCA 4AIOA 2NT0A 3SCUA 2B31A 4PMQA 1E56A 4DWSB 1R7AA 4MB3A 1W1VA 1V6WA 3J7HA 1UKQA 3W27A 3DECA 1EOMA 1BQCA 1V03A 1XH1A 4WSJA 5KZ6A 2XTKA 4UFLA 2VL4A 1GZJA 2DSZA 2WHJA 5GQBA 3WF0A 5M17A 4Z2JA 1W9XA 3SUTA 3WIJA 3W82A 2QV4A 2UY5A 4ZXOA 4BF7A 3ARQA 5LA0A 1UKPA 2BHUA 2YA1A 2MANA 2CITA 2BHZA 2D2OA 4JKKA 4FMVA 1LG2A 3MMWA 3U5YA 2BVYA 3IAQA 1BAGA 2VZUA 5CSUA 4FLRA 2DT1A 1MQRA 5IFTA 3AS0A 4UQCA 1MW0A 3VX1A 3N9KA 1QI5A 3VIMA 4HMEA 2OWCA 5BROA 1E4LA 1C8QA 2A3BA 3WDJA 1UH2A 4R5EA 3BSGA 2D23A 1NP2A 4DUXA 1GJUA 2VZSA 3U7BA 3RILA 1JZ5A 3EYPA 1L8NA 2WW5A 3IJ9A 1W3JA 3N11A 4UQDA 2VJXA 2YLLA 5D9NA 1H0GA 2J8GA 3MUAA 3AZSA 3WNOA 1G94A 3HMCA 1NWSA 4LXFA 2QMJA 1JDCA 2OWWA 4E8DA 3ARUA 3MSGA 4J27A 1UZ4A 3KWXA 3OLIA 3K1DA 4MB1A 6CGTA 4CD5A 3VMPA 3GH7A 4L4OA 1QNSA 2NT1A 3A6OA 3N1AA 1DEDA 1NP0A 2ZUMA 5A6BD 5ABFA 1B3ZA 4AY1A 2VX4A 1O7AA 1EGZA 3EDJA 2WHKA 1JYWA 3ZJ7A 4DUVA 3OGRA 3WD3A 1WZAA 1TVPA 3RO8A 1I1WA 4W87A 1VAHA 4GI9A 1GQIA 1UD2A 1B3VA 1GHSA 1M53A 4MB5A 4AEFA 1QBAA 3VIGA 3GH5A 5IXEA 4X0VA 1WPCA 4TX8A 4KRUA 4PYSA 4W8AA 4HPHA 1V6VA 3WDIA 3ZT5A 3DHUA 4CU8A 4PTMA 3ZO9A 3BAXA 1ESWA 1ISYA 3UEQA 3CH9A 5HXMA 1M04A 4H8HA 3MMDA 1C8XA 3W26A 1JIBA 4X0NA 3IANA 1QPKA 1KB3A 3WUBA 1V6UA 1EDQA 2UY3A 2W62A 4JFWA 5JBFA 3U57A 2J25A 2RGLA 4M82A 3HN3A 5E0FA 4P8WA 1UD4A 4CD4A 4D6HA 3GH4A 3WBEA 1C91A 3LPPA 1I75A 2J7FA 4U3CA 3PZTA 2DT0A 3VMOA 1Q6GA 2OLHA 4BS0A 2CIPA 1B2YA 3TOPA 3BH4A 2EBNA 2OYKA 1OIFA 3WENA 1B31A 1J0HA 3T0DA 1NWUA 2V3DA 4PBGA 3L4UA 1B3XA 4D6JA 1GNXA 2EPLX 1W91A 3CIVA 3NSNA 2WBGA 4TTUA 1OCQA 1A47A 1UKSA 1FA2A 5I24A 1UZ1A 3BCFA 2HISA 4HOXA 1HL9A 3FW6A 3ARTA 1CIUA 4D6CA 1D3CA 4GO9A 2YJQA 3NYDA 5D8WA 3SUWA 1AQ0A 1SMAA 3NDYA 3VD5A 1E6RA 4FF5A 4OOUA 5EBAA 2GVYA 2Y24A 1GOOA 2YL5A 4W85A 4UFKA 3VVGA 1DWGM 3ZSSA 2W67A 2XSBA 3BSHA 1VIWA 5A8OA 1X6LA 4Z2IA 3UCQA 3VM7A 4JHZA 1KBKA 3WL1A 1HXJA 2ZXQA 1YHTA 4CCDA 1JZ2A 2E0PA 3M46A 2NSXA 2BS9A 4LQ1A 7CGTA 1V3JA 2XSAA 3KZSA 2Y5EA 3CZGA 1XCXA 4BQ4A 3N18A 4HA1A 2GSJA 3AZRA 5A6BA 4KGLA 2VOTA 1J9YA 3CTTA 1TR1A 1VFUA 1UH3A 1W3LA 1ISWA 1JI2A 3MUIA 1LWJA 4D1JA 4UQBA 5FL0A 2PWHA 3BMWA 3I3DA 5A6LA 2WVTA 1MQPA 5JIWA 4M24A 2GJXA 2W92A 2WWDA 2J7HA 3CZKA 1K6AA 4J3SA 1HJVA 1HNYA 4UFHA 5TD4A 4D6IA 3A3HA 3OZOA 1AVAA 3VOCA 2G3JA 4PMVA 5D9PA 5GNXA 3NIYA 3PZNA 1XV8A 1H4PA 1D7FA 2BVTA 4JCMA 1UR1A 3AICA 3WD0A 2EPNA 1PX3A 3NUKA 5A6KA 1JXJA 2YBUA 3WSUA 1JZ4A 1W2VA 2GUYA 1E3XA 3AZTA 4WJXA 2ZX9A 3RDKA 5C71A 4WKHA 4MDPA 4HOZA 2VQTA 4M1RA 3AIUA 3O2LA 2YDQA 4AZGA 2ZUVA 3RMEA 1CGTA 1FH8A 1LQ0A 4PRWA 3WN6A 5CLTA 1NM9A 4JAWA 4DWSC 2Y4SA 1QHOA 4WIWA 3ALGA 2CXGA 4M8UA 5I3DA 2G3NA 2XGIA 1LWHA 1QVBA 3BC9A 2CBVA 2V3EA 4YHEA 1Q4NX 3N04A 3VIIA 2XUCA 1SMDA 1NARA 3D5HA 4MNMA 1EO5A 1PIGA 4A3YA 1CDGA 2VRKA 5EFDA 2XVKA 4AZ5A 3GBDA 2WMHA 2VX7A 2XVLA 2JALA 1XSKA 4AD5A 2V38A 8A3HA 1MW1A 1HJQA 3AIVA 1SR0A 1X1NA 2FH8A 3IJ7A 3SCOA 3DC0A 1UR0A 1X6NA 2YL6A 3FXYA 1E6SM 2W91A 3QOMA 2E9BA 4B9ZA 2WANA 4TOQA 3UETA 3VX0A 1BPLB 2E9LA 4H7VA 1JZ6A 2D20A 4RE4A 3MUY1 3OGSA 1J0JA 3FAXA 3SURA 2DSUA 4AEEA 4NSBA 1E73M 1W32A 3GBEA 5F7UA 2BV9A 4IPLA 4W8BA 2W66A 3BAJA 3SUUA 2XG9A 1EO7A 4OZOA 3PTQA 3W25A 4MJ4A 3GXDA 2D3NA 1G01A 1H49A 1J11A 2ZUWA 4NI3A 3AIBA 1J01A 1JNEA 4PMUA 5GNYA 4EANA 1BTCA 1JI1A 3WFLA 4AWEA 3AMGA 1RP8A 4P7OA 4ML4A 3MS8A 3RJXA 4N0RA 1FHDA 1QOXA 1RPKA 5BXPA 3VO0A 2CPUA 1FHLA 1M01A 1EOKA 3PTMA 3VNYA 4M81A 5AY7A 3AISA 1Q6FA 5I6SA 1WB0A 4ZXLA 2X0YA 4MPKA 1CYGA 2G3IA 4CN1A 1E15A 2XWEA 1UHVA 4NZCA 3ZQ9A 1W1TA 5LA1A 1HIZA 3VKKA 2F8QA 3VIPA 5DT5A 3T0AA 1XYFA 1V0MA 2XIBA 4PTWA 3U7VA 3OA5A 1EXPA 1H1NA 1RH9A 1E1FA 4AZCB 3T2QA 6A3HA 2WKLA 2UY4A 5E70A 4BQ2A 2WSPA 4QLKA 2YOCA 3ZR5A 2AMGA 1DP0A 1UWSA 2IXVA 3BAKA 1ZJAA 4AZ6A 1G9HA 5JBEA 4CN4A 3T09A 2VCBA 5LA2A 1JYVA 3WBAA 1QNRA 1FFRA 4X9YA 5AYBA 4ZE4A 3CZ8A 1KQYA 1SFSA 1V02A 1LJYA 2X09A 5M5DA 4UQAA 1ZU8A 2ZX5A 3AHZA 4BQ5A 1ECEA 5DMYA 5A94A 3LPFA 4J28A 4QFUA 5A2CA 1GONA 4HMCA 1WDQA 1R85A 2GDVA 1CXIA 3E1F1 2W5FA 1C93A 4IUGA 4D72A 2E8YA 2WYSA 2ZUNA 3K4DA 1BFNA 4D6FA 5KEZA 2VCCA 2C8NA 1B9ZA 2G41A 4RL3A 2DQXA 4AYSA 2EQDA 1E6ZA 4HU0A 3AHYA 3RPMA 1PJ9A 2X8RA 3MANA 1VRXA 4WKAA 2XGBA 1WDRA 4C7GA 1WDSA 4CU7A 3GXIA 5D8ZA 4JL1A 3WH9A 3CUFA 1CXHA 2WZHA 3WQ4A 4D6DA 1B3WA 1DWAM 3WDRA 4PSRA 4P7RA 1W2PA 2A3HA 4LYPA 5A8QA 1PBGA 1JD9A 5HBFA 3W24A 1TVNA 1JL8A 2GJRA 1AMYA 2J77A 1IT0A 4JFVA 3FHAA 1KXHA 1GUVA 3UG3A 2W63A 2VZVA 1JZ7A 3CHFA 2WMIA 3VMNA 2CBJA 3U5UA 1BG9A 3AS1A 1G1YA 1H2JA 1GHRA 3K46A 4B16A 2W4XA 2YBTA 3W0KA 3QHMA 3AOFA 3OGVA 3AMKA 3CUIA 4MB4A 1JNDA 3OG2A 4GO8A 2E8ZA 1UR8A 1C92A 1PX8A 2D0HA 4XV0A 3I3BA 1TG7A 3A4WA 3ZJ8A 1E0WA 4D6GA 3BAWA 1CPUA 3WF2A 1OGBA 2OSXA 1VEMA 1ITCA 4FLOA 3PHAA 5EB8A 4B15A 5DEZA 1IZJA 3VNZA 4LGXA 3SCPA 4MTVA 1QW8A 4P8UA 1C90A 2XVGA 1R87A 3WMCA 4Q7NA 2WB5A 3OIHA 5BYWA 4GIAA 2D0FA 2YA2A 3MKKA 1V0KA 3SCVA 4P7QA 1OBAA 2ZWZA 5IHRA 1XCWA 3BCDA 1CEOA 1K9DA 1MW2A 4QCFA 3RM8A 3K4AA 4QLLA 1LF1A 1CGVA 1JAEA 1H5VA 3ZIZA 4LYQA 1R86A 3A4XA 5I78A 1JFXA 3MU7A 3HJEA 4GKLA 1ODZA 3EMCA 4HA3A 2ZXDA 4LX4A 1OT1A 1QI2A 4TX6A 4HA4A 5M03A 2CESA 3PZIA 1K9EA 2VT0A 1V3MA 1OT2A 3K8MA 2VRJA 3ARVA 3KL5A 4W7UA 3AYRA 4B3LA 1W9VA 1ZBCA 3N15A 3UR7A 3F5JA 5ABFB 3K8LA 3TTSA 3NDZA 3WEZA 1DTUA 1OGGA 1UWRA 3UESA 4CVWA 1XRVA 2WC3A 5E6YA 2WC7A 1BSIA 1UWTA 1XSJA 5CXPA 1XGZA 1WZKA 2J7GA 3QHNA 2JF7A 2DIJA 5HPCA 2CETA 4UCFA 3WH6A 4AD3A 5D4YA 4GQQA 2JEPA 4QCEA 2AOSA 3EMZA 1YQ2A 1JFHA 1LL6A 1ZBVA 2CBUA 3TP4A 1HJSA 2G4FA 4AC1X 4M56A 1HKMA 3F5LA 3WF3A 3CO4A 3VD3A 4JZ5A 4QP0A 2ZXAA 3UG5A 2WNWA 1H09A 1B0IA 1CGUA 1MVYA 3A47A 1W9BM 1WZMA 4HZ7A 2XIIA 1W1YA 1Q6CA 1WAWA 3QOKA 1PIFA 1CXFA 1ZBKA 1J18A 4C7FA 3LPOA 3VIFA 2BXZA 5I0DA 2VX5A 2X05A 1QNPA 5I79A
chains in the Genus database with same CATH superfamily
4QJ1A 4ZQPA 5C9UA 3N19B 3B9NA 2FZNA 2ACQA 1VYSX 4E2DA 1GYNA 3NPUA 1NTHA 1U1HA 3UZ5A 1KA9F 1D3GA 2JE8A 3MVIA 2O9TA 3PWIA 2BY2A 4XZIA 1FWSA 3LCXA 4MDOA 3RYSA 3L0GA 4PUDA 3A9BA 2FJUB 4IX0A 4ATDA 3ANVA 1UD3A 5I3GA 4JTLA 5I5RA 3L9CA 5CBJA 3EWXA 2NUYA 5FF4A 1UOZA 4QM1A 4W84A 2A7NA 4HJFA 4UUIA 3W6LA 5BXTA 3LB0A 2E4TA 4PCTA 2BY1A 3IIZA 3W22A 2JKAA 2Z1VA 5G4HC 1YTDA 2WVUA 3A3WA 3N73A 3QPEA 4BHYA 5HWJA 3W7PA 1ZAJA 1J6PA 1E4NA 1R8LA 3I3EA 1Q6EA 5E0KA 3W81A 2CLIA 2XFFA 2Z28A 4CNTA 2ATSA 5I3JA 3CHEA 4FX8A 3W72A 4GQGA 1YDOA 1U30A 3VNIA 2IKHA 4RE3A 4FLQA 1TV4A 5CKSA 2OEMA 4K39A 3PTKA 3TDFA 4FA3A 4W89A 2W79A 4EKJA 3AXMA 5IFPA 4NVTA 1OYAA 1GORA 3GIPA 2X2GA 4NILA 4HU8A 4URIA 5A6TC 1Q8JA 1KQZA 1OGSA 4QS6A 2WJZA 2ZC1A 1EJUC 5ABHA 5LIXX 1QNQA 3AJ7A 1KWGA 1DORA 4EE9A 4F66A 1RCXB 4FPSA 4DI8A 4XZWA 4H3DA 2WHLA 3TC7A 3E5PA 4S3AA 4AZHA 2YXGA 1E0VA 1O1ZA 3GM8A 4JX4A 3EGJA 3UG8A 4K6AA 5FKYA 4ROQA 1F8IA 1TRDA 4MKNA 1EPXA 4J3VA 3KTSA 4YCOA 1LT8A 3E9AA 1S2VA 5HQLA 3B8IA 1CCWB 2WMJA 5IBXA 3NO3A 3AMDA 1OX4A 3KFTA 5A8NA 3MO7A 2A7PA 5C9WA 1W9DM 1TQXA 2J79A 1HKKA 2VOMA 4FNPA 4S2BA 2BGSA 1TV5A 4FZIA 2F2KA 1BVZA 4DX3A 3OHIA 1RVGA 1SO5A 1UKOA 2XHYA 4ADSA 2WAGA 3I6RA 3HGOA 1XXXA 2EKCA 1V0NA 1CBGA 3DFSA 3UWUA 1XYMA 3WQ8A 1UR9A 5B7ZA 5CLWA 5CEWA 5BOOA 1CZ1A 2VTFA 3ONCA 2PF0A 3BLPX 3LTSA 4Z17A 1Q7ZA 1L9WA 4XB3A 1E5JA 4UMAA 1KCZA 1EJ7L 5FJPA 1QATA 1J0YA 2DZXA 2FZDA 4C6QA 2PWDA 2CZDA 4FNTA 5BNKA 2E28A 4DWSD 3ITTA 4GXPA 3N2MA 4W5UA 1YXCA 5B7YA 3MUXA 1AFSA 1NDVA 2FGLA 3BWWA 3IGXA 1XQLA 1OFDA 3BMVA 1HN1A 4EIVA 2VMFA 1XIFA 2Y88A 1SJCA 3JU2A 1UA3A 2WQPA 3L4YA 2Q3OA 3F4VA 3TE9A 3I7SA 3CL8A 5CJMA 2YZRA 3AYVA 3OU8A 3OVPA 1UP3A 4NRSA 3RO6A 1AQMA 1VS1A 3VYLA 1VZWA 1Q45A 1PDYA 2EG7A 1TV3A 3MT1A 3BVJA 2POTA 2OSWA 1IZCA 1CGYA 4XSMA 3H53A 3VKJA 1S5TA 3E2VA 1G7VA 5DO8A 2BOFX 3AQUA 2PDWA 3OEXA 1EEPA 1NWRA 3USBA 3N4AA 3T78A 4BCEA 8CGTA 4D1IA 1E43A 2BFGA 2HK1A 1W5NA 1OC7A 1OB0A 1AH3A 3WQ5A 3S2JA 2VELA 3W00A 4EVZA 3CEUA 2WSQA 6TAAA 2OGYA 4O14A 1GVSA 1HZYA 3GG7A 1VPXA 3W1QA 3VDHA 1QPOA 4C5ZA 3MV01 4LWWA 1OZMA 3FYOA 3AUJA 2YCKX 4S38A 1Y65A 1Q3NA 5AVHA 2GQ9A 1I1XA 2AL1A 4C6MA 3AU6A 2A2IA 3FJ6A 3M64A 3PPHA 4U10A 2DH2A 4RNHA 2I17A 3VXGA 3KE0A 3NCOA 4HSHA 3N2OA 4LT9A 2OWXA 3KCJA 1G0CA 3DYPA 1JUKA 5LYRA 3N17A 4AIEA 1JYNA 4IL0A 1Y7VA 3DERA 1KGXA 3WDHA 3W7NA 4IP5A 3R8RA 1QDSA 3AAMA 5HR6A 1UWQA 5FD0A 5M3WA 4IGHA 4X3ZA 4EAMA 3T8LA 3G6MA 4CN6A 2PDBA 3FIGA 1VHCA 1RY0A 4IJRA 2BMBA 4DXKA 1JDDA 2D2GA 4UTTC 5HNRA 1BEUA 4HHPA 2PBGA 4KS0A 2J8FA 1T99A 2F61A 1WXZA 3KVLA 4L9YA 1C9DA 3LM7A 1V6XA 5D2VA 3W29A 5EFFA 4PMJA 3U4AA 1K70A 1G4SA 1DJIA 1TYGA 4QTGA 4MZ1A 3TYZA 1GQKA 5HNTA 3REQB 4EPEC 4EXAA 4MADA 2A4AA 5FOOA 7TAAA 3KX6A 3EA1A 1I0BA 1NH6A 1QHPA 3VOFA 2ZDRA 1ISVA 1BGGA 3SZ8A 4IXHA 2XM1A 3W28A 3NOYA 1XKYA 1PB0A 3LGEA 4S3CA 4C6LA 4DYEA 4N9BA 5EPDA 1BYBA 4ROPA 1E9LA 2WVSA 3K30A 5A3HA 1K1DA 3WLQA 1ISXA 3F5KA 1XYLA 2NXGA 4LBSA 1QPQA 2EPMX 4GCXA 4JKMA 4ZOBA 2Y89A 3GTNA 5HINA 3C86A 5DMLA 4D71A 1NQ6A 5DBTA 1GZGA 3VDCA 4ASTA 2BOGX 3CGTA 3QR1A 1D8WA 3ABQA 3C2FA 3NQBA 4GZIA 3L5LA 2VM8A 3NQVA 1YDYA 1O66A 4F0HA 1WKYA 3LHTA 5JBDA 1GOMA 3B8SA 4B5SA 3BCJA 1GGOA 1IE7C 4PUEA 4RNFA 1FHVA 1X7FA 1SVDA 4M6PA 1MMFA 3O16A 2Q09A 2PWGA 3S2CA 3E02A 3IIXA 3THAA 3G3DA 1EYEA 3BG5A 1IXOA 3IV8A 1X39A 2YIHA 1XYCA 1JZ8A 3L0KA 3WQGA 4V1YA 2PDJA 2D1ZA 2OU4A 3B0PA 1EZ2A 1TWZA 3CZLA 5FEZA 4UTKA 1UWIA 1CXEA 3IAPA 1UR3M 3NM3A 4L6OA 2ZTJA 2QIWA 4Q8OA 2EPHA 4I3GA 3EA2A 2NW0A 1RBLA 3QW4B 5AC4A 4C6DA 2ZXBA 3QSTA 2I5QA 2IQDA 4LVFA 2CYGA 4AYGA 1PL9A 3VZXA 2FZ8A 3OVQA 3SO7A 3D3FA 3POCA 2PURA 2X40A 1XINA 2GWNA 4C6OA 3DI0A 5AVNA 1LL4A 1L2QA 2O55A 4WSKA 2Y7DA 3F4DA 5CPLA 3LHUA 1GOKA 3TSMA 3FNDA 4W5ZA 3ZVIA 3OOQA 1BYDA 2ZA3A 2ZX8A 1HKWA 1SZGA 2F9RA 2WKJA 3UZJA 3WNPA 5DMMA 1KFJA 3Q65A 4IPNB 1LTDA 1QI3A 3PUEA 3M41A 4NYYA 3WY1A 2CLPA 2X1TA 1IIHA 3KBMA 1RD5A 2V0TA 3ITLA 3LU2A 4A6GA 1ZJIA 1VFMA 1TTIA 2WPGA 4K7VA 1RALA 1ZTVA 2Q02A 3C8FA 2C1GA 3PZOA 2YW4A 3QW3A 3VI2A 2E9MA 3THCA 4AXNA 2PGRA 4QAIA 3TA6A 4TVDA 9XIMA 4FOUA 2QKFA 3BOLA 1GPWA 3ARRA 2R9RA 1HKVA 3WLLA 4B9YA 4MAZA 2XM2A 4XX6A 3R89A 3THDA 2HEJA 3RLHA 1UWAA 1KD0A 4ZE5A 4CD6A 4MG4A 1QI4A 4C7DA 3NPVA 3CHCA 5F2IA 4Q8WA 3WNLA 2GLKA 1C8VA 3ITGA 1SYTA 1TUXA 3IVUA 1DJZA 1L6WA 4P8XA 4RZ5A 1R7OA 3CPUA 3B8UA 1EP2A 3LZ5A 2XN1A 2JIEA 4GY7A 2YXOA 3LPGA 3ARPA 4HZ8A 1FBAA 1ZUAX 4IFKA 2PFHA 2UY2A 1A5NC 3P82A 2PWFA 4M6QA 4AC7C 3PPCA 5AYXA 2WMKA 5KINA 4EX4A 2JIWA 3LHZA 3DCPA 1WKDA 1XYAA 2R6OA 3LD5A 2VCAA 4DYKA 1QOPA 4LB4A 3N13A 2PCEA 4IG2A 4WF7A 4GI6A 1EKOA 4U31A 2GVEA 1DJYA 1N8FA 3QMSA 2Z0IA 3G3MA 1G4EA 3G0UA 3W1AA 4TXEA 3N2XA 2XWDA 3WYZA 3LLFA 4WLCA 4WR3A 1DWIM 1JXKA 3L4TA 3Q45A 2NZLA 5I2UA 5A8MA 1E1CA 3PUGA 9CGTA 1VIZA 2O7QA 1EL3A 3S46A 1O60A 1P6CA 2NQ5A 1HGYA 4I8YA 5LSMA 4BI6A 3S5YA 2W27A 1VCFA 3RK8A 2BASA 3V75A 4U33A 4KF1A 1RR2A 2X1SA 1ODUA 4MNJA 4C65A 1DTNA 1ZNNA 4DBUA 3S5SA 1E9YB 1FOBA 1XLMA 2GWGA 3HG4A 1XLIA 1KCKA 1PZ3A 2EKGA 3GHUA 4NYUA 3VM5A 1HJWA 4WDUA 3FAWA 2JGQA 3EA3A 1TV8A 2QPUA 1FVPA 1RD6A 3ZFHA 2IXUA 4J7RA 1IEXA 1WUFA 2CLKA 3BANA 3VZZA 3CUXA 3QMTA 2DVUA 4R7JA 1I8JA 2R1NA 3VGFA 4HVXA 4S3BA 1PZ2A 3W1NA 2O4MA 4PULA 2HE8A 2IKJA 3KW3A 5CPQA 3BXWA 4W7WA 4AMCA 4L56A 2VURA 3W2LA 3NZQA 1S5MA 4FNUA 3TUUA 2HPIA 2OOFA 3VFLA 4E2OA 1P0NA 3M1ZA 2FGZA 5CZ0A 1V77A 1IQ8A 5CPOA 3WNNA 3GKAA 4TVCA 2GK1B 3BG9A 2RAGA 4GBDA 1H1YA 3RIKA 4KGJA 2DIEA 5D9OA 4O1DA 5LZLA 1EGVA 3CUGA 2Y5SA 3KVKA 1I2PA 1PYMA 3GU9A 1SO6A 1Z3NA 3KL3A 1D2KA 1P0BA 2XPKA 2J88A 5E0CA 4N4PA 3PSVA 3ZVHA 1RP9A 1QPRA 4OT7A 1W3TA 4LNCA 1J2BA 4X2RA 2ZIDA 4ZR8A 1JGIA 2WZTA 3VOHA 1LG1A 3BGAA 3CT2A 3GYCA 2R24A 3EX4A 2HVOA 5E9AA 5KZMA 2VR5A 2ZQ0A 1CGWA 5D32A 3R13A 1ZJBA 2XDFA 2DJXA 2ATMA 4FLSA 2ZUUA 3MWAA 2D0GA 2CCRA 3R0KA 1ZPTA 3UJ2A 5A2AA 5LXEA 1GVQA 5ECVA 3BZJA 2UWFA 3P81A 3T2PA 2Y6ZA 5BCAA 5CBBA 5EMYA 1KGWA 4AQLA 5DFAA 4DRSA 1NF0A 5CPNA 4HHHA 4XZBA 3BLFA 2QLYA 3EX1A 1O6IA 1KFWA 3HV9A 1I2QA 1ZP4A 4Q4PA 1PX4A 5FEPA 4MGGA 2OX1A 4NHVA 4LRSA 1LOQA 4IISA 1H7XA 2AL2A 3VINA 2Z26A 3APGA 5G4WA 1V79A 4ZL1A 1G5AA 2B7OA 4DBDA 2NT0A 3SCUA 2B31A 4MB3A 3CPRA 1U1JA 1V03A 2H90A 3UA4A 3CQHA 5HQMA 5KZ6A 5GQBA 3WF0A 2HTMA 1BVWA 3FGCA 3T4WA 2E1DA 1XWYA 2CHRA 2UY5A 4ZXOA 3ARQA 3MJMA 1UKPA 3LQLA 2CITA 3TXVA 3KDNA 5EY5A 1Q7QA 1NU5A 3SQMA 5REQB 3U5YA 5DY3A 4NU7A 1EP1A 4PUJA 2OO0A 2GQAA 4FLRA 3DFNA 2XINA 3HZ3A 1YNYA 3VX1A 3NURA 4HMNA 1NFPA 5JXQA 2B0MA 1E4LA 1W5MA 3FCPA 4LTSA 4EXQA 1XUUA 1SJBA 4R5EA 2D23A 3BARA 3P2VA 1NP2A 3W85A 3RILA 1JVNA 1JZ5A 3F1QA 1V93A 3DHFA 4M6UA 3MUCA 3S1VA 1D8CA 1GT8A 1W3JA 4DIAA 1XIHA 2QCCA 2VJXA 5D9NA 1H0GA 4JHMA 3MP5A 2GSEA 4DJDA 3AZSA 2VD8A 4LANA 1IGWA 3M0XA 2OWWA 1HQTA 3Q2DA 4H1ZA 2VGFA 3ARUA 3HV8A 3MSGA 2E6FA 3B0VC 3K1DA 3N2BA 4M51A 2NT1A 4NX0A 3KRSA 1VH7A 4D8LA 1NDYA 2O4QA 5ABFA 1KRMA 1A0DA 3KP0A 4UTIA 2Z6IA 4AY1A 1O7AA 1EGZA 4GUFA 2WHKA 3ZJ7A 4DUVA 1VLIA 4DI9A 3UPBA 1VAHA 1KRAC 3AUOA 4MB5A 3C61A 4H9VA 2QXWA 3GH5A 4H6KA 5IXEA 2BWGA 3A21A 2PEVA 2D69A 3ZT5A 2GJLA 4PUUA 4YVVA 4QEHA 3AALA 3BAXA 4ILSA 2Z1XA 1UC5A 4ECLA 4XZLX 4MLJA 3TZFA 3CH9A 3BOXA 1R47A 3LCWA 1YLVA 1KB3A 3T44A 4AUBA 3JZUA 1EDQA 3VNMA 2J25A 1BKHA 5E0FA 4P8WA 4CD4A 4I9JA 1UC4A 2J7FA 4AEOA 3SGUA 5C55A 1W56A 2DT0A 3TSDA 3EX6A 4B2DD 2GOKA 4IHCA 3EEZA 4BS0A 1TR9A 2GQ3A 3W1RA 5G1MA 3URQA 1B31A 1PZ1A 2P1FA 5DN1A 3WLSA 4YYFA 2PGFA 2V3DA 5FJOA 3W9ZA 3L4UA 1B3XA 3MC5A 4D6JA 1GNXA 2EPLX 2VEPA 4TTUA 3A24A 1OCQA 3FX4A 1A47A 1MUCA 2YCLA 4FNSA 5I24A 1GQNA 4EPKA 3BCFA 4LY8A 3C0SA 2X7WA 2PP1A 3GIQA 4S1FA 4D6CA 3UWWA 3NDYA 4ALDA 4LAKA 2OPJA 2W0UA 1GOOA 1OYCA 1OVDA 4IUOA 3T05A 2W67A 2XSBA 3VCRA 4O0QA 4Z2IA 4DO7A 1Z6KA 1QK2A 1UIPA 2BG5A 4C91A 4OV4A 2ZXQA 1YHTA 1WOAA 4DJFC 2E0PA 2CWXA 1KM2A 3MHGA 4IMDA 1LUCA 3M46A 1PTAA 5LGXA 2BS9A 1TPC1 1RA0A 1KTCA 2Y5EA 3UGVA 1XCXA 5HNUA 1OK6A 4FP1A 4KGLA 4PE8A 3CTTA 1XP3A 1UH3A 1JI2A 4PH6A 4UQBA 5FF2A 1O95A 1T6MA 3PFMA 1NEYA 5JIWA 4LUIA 3RLUA 1J5TA 1R2TA 2PTDA 4E0CA 4RXFA 2WWDA 3CZKA 1K6AA 1O5KA 3M0JA 3QZAA 3BLDA 4UFHA 4D6IA 4IWWA 3NQ7A 3OZOA 3FS2A 3BGJA 4JXCA 4DPQA 5GNXA 2QEZA 4JCMA 4MKVA 1GVEA 3G77A 4OE7A 3CMFA 2RH9A 1OQFA 3WSUA 3C0LA 3AZTA 4US5D 2ZX9A 4WKHA 4HOZA 2VQTA 4UTHA 1NDZA 1PZ0A 1XR2A 2YDQA 3O2LA 1SW0A 3NEVA 2FQIA 2FVKA 1R3VA 4Q4MA 4Z08A 2J24A 5I3DA 5BU9A 3TQVA 1OX5A 2G3NA 4KQNA 1P48A 5HMSA 2ISSA 4S23A 4YTRA 2AQVA 4KFPA 1XLFA 2F84A 2NVDA 4R9OA 4A22A 4DVOA 2C6QA 4O54A 1EO5A 1CDGA 5EFDA 3GBDA 3M5XA 2P8BA 4ERAA 1POKA 1XSKA 8A3HA 1R6WA 3K5XA 1KLYA 2C71A 3CAKA 1HJQA 1X1NA 2FH8A 3GYEA 5K9CA 1X6NA 3FXYA 1E6SM 2QR6A 3G8RA 3FOKA 2WANA 4DJED 3B03A 3VX0A 1F7BA 1BPLB 1QK0A 1JZ6A 3TZNA 2XU2A 4AWUA 1WDWA 3SURA 3WQFA 3VCNA 1YDVA 1WBJA 5H1WA 3F4CA 3LNMA 3TQKA 1W32A 3NFUA 3VOIA 2BV9A 4W8BA 1XG3A 2PP3A 2XG9A 4QISA 3IS4A 3PTQA 3U2OA 3GXDA 4N9CA 3S5ZA 3UXKA 4A2SA 3IIOA 2ZUWA 3AIBA 1M6JA 3WK0A 4JIHA 3BZGA 3WFLA 4RUBA 3AMGA 2VXNA 4WY0A 4ML4A 1BXNA 4DYJA 1RPKA 5EA9A 2Y63A 3OQ8A 3S1GA 3VNYA 4G8TA 5AY7A 3P8IA 4A8NA 3URBA 2GQ8A 2ZYFA 4H8NA 1DPMA 4ZXLA 3HG3A 1FRBA 2RKXA 1CYGA 2XWEA 1TJ2A 4XZ9A 2I9UA 1W1TA 1S3TC 1HIZA 3VKKA 2F8QA 4D8ZA 4PZVA 4GNKB 4GI4A 3T0AA 2V2HA 4PTNA 2XIBA 3PFRA 4JIPA 3PPGA 2L5HA 5AC7A 2NVAA 2VEIA 1QAPA 4RXGA 1XDJA 2G50A 4GUGA 4L5ZA 3Q4DA 5E70A 4JTDA 3S42A 3TQ0A 2YOCA 3ZR5A 2AMGA 1UWSA 1IXQA 5BOEA 1G9HA 2VKZG 1JYVA 3T09A 2VCBA 3AJXA 1B9BA 1FFRA 4X9YA 4JN6A 4ZE4A 1KV5A 3CZ8A 3JRKA 1DVJA 1R9YA 1LJYA 1FQ0A 4XWUA 1LDCA 4HK6A 1UP2A 2PAJA 3LGGA 3GAYA 3FYYA 1TSIA 1WDQA 4M6VA 2GDVA 4JICA 2G4JA 4JQ4A 1C93A 2QDHA 3CQ0A 1XIDA 1SSDA 3K4DA 4LS1A 4W4QA 4AWSA 4IQJA 4NAEA 3MZNA 5AHNA 4MSSA 2BGQA 1ADDA 2CLFA 4NAFB 3QEZA 1PJ9A 1NAL1 2FMOA 1W5PA 4RE0A 1J6OA 2ISWA 4C7GA 4G1NA 4JDYA 4XD5A 3G5EA 1K03A 4GC3A 1CXHA 1B3WA 3NQ2A 1Z89A 4P7RA 1AJ2A 1W2PA 2A3HA 3IRSA 5A8QA 1TTJA 3W24A 4RV8A 1LOSA 2GGJA 3TQPA 3KOWA 3OP2A 2EHHA 4RZBA 2A0NA 1KXHA 1GUVA 3UG3A 2W63A 2VZVA 1FXPA 3VMNA 2YFNA 3U5UA 3PBVA 1YEYA 3K46A 4LY4A 2V5JA 2HBXA 3ITXA 3PR2A 3AOFA 1XRFA 3AMKA 3CUIA 3L23A 2E8ZA 3H55A 3F4WA 1XJBA 4KBXA 1PCKA 4E5TA 1VKFA 1TG7A 2X41A 1TUFA 5G1TA 1CPUA 3WF2A 2BODX 3KRBA 5FACA 4C6KA 4FLOA 1FUYA 5DEZA 1IZJA 2R1LA 3VNZA 2HS8A 3QV6A 2V82A 1R87A 4RCXA 3OIHA 2D0FA 3PBUA 3MKKA 1V0KA 5DY2A 4P7QA 1EX5A 3GZ3A 1XCWA 1Y0EA 1JR1A 1CEOA 1K9DA 1YTEA 5HMDA 4QITA 3RM8A 4O15A 3GNDA 1CGVA 3PNUA 4KIEA 3ZIZA 3W7HA 3R0UA 5AHEA 4RW5A 3G8EA 3DBNA 1XG4A 5BMXA 5DMNA 3FKKA 4XAYA 3WBWA 4LBUA 4GHRA 1K9EA 2OZ0A 1PKLA 5J5RA 5L6UA 3R10A 1Z9AA 2PLMA 4H9MA 3CS2A 2OELA 2ZRVA 3ARVA 4B3LA 1R0MA 3N15A 3UR7A 3O15A 3K8LA 3TTSA 3EWBX 3WEZA 1DTUA 5CSRA 1OFOA 5E6YA 2OB3A 2WC7A 2V5KA 4ZO6A 4ZA0A 5HJYA 4ZTYA 4AD3A 3GVWA 1XRTA 2JEPA 2PTYA 2PTZA 3P80A 3V5OA 1YQ2A 2NV1A 1JFHA 1ZQ5A 3DESA 3LCHA 1AW5A 2FTPA 4REQA 1HKMA 3F5LA 2ZZ7A 3CO4A 2PDPA 2C0AA 3D6NA 3P0WA 1Q66A 1W9BM 3VKBA 1RBAA 1VHNA 2OCZA 3CLMA 2QUUA 1KNWA 5HA7A 3QOKA 1CXFA 4WUIA 1J18A 4C7FA 3LPOA 3VABA 4Q8VA 2X05A 1MO0A 4HCHA 3IGUA 3M07A 4IJCA 2PS2A 3EDEA 2V5LA 2E7FA 1XBZA 2YCEA 1H1ZA 2FPVA 3SSJA 2WJDA 4H9TA 5KSWA 5J8LA 3GDBA 3NQGA 4U3AA 1LQ2A 1F4AA 3M9YA 1RLCL 3SAZA 3SUVA 4BZYA 4CEUC 1XDLA 3P61A 3UY7A 3AIEA 2JFEX 1WXJA 5EMJA 4UFMA 5G2WA 3W1UA 4AHPA 2C14A 1IEWA 1S2WA 1YPFA 3LMYA 3O0KA 1EJVC 1JJKA 4UCGA 2H8ZA 5AN7A 5D04C 3UR2A 4XVDA 3C2EA 3C6CA 4WEVX 3RM9A 5I09A 3PZQA 1A53A 4UTTA 2WC4A 1V3KA 3DYMA 2QHAA 2NQZA 2IKGA 3KOFA 3PBWA 3OLGA 1OFAA 4MVAA 2EAWA 2Z7GA 2DDXA 1WDDA 1ZALA 3IACA 3PVFA 2DGAA 3W75A 1GZ1A 1MDRA 3U2CA 1F2JA 4LF1A 4QG8A 1UZHA 4MF4A 4FXFA 2QCGA 2ZX7A 1R2RA 2OZ8A 2VVSA 4MFEA 3BV4A 2PDMA 2WCAA 5AB3A 5I3KA 2FHCA 3SBFA 1XD1A 3SRFA 3VUPA 3N9RA 4XUYA 1CTNA 4L9XA 7TIMA 4CCEA 2INEA 3MPGA 4PL2A 4ZOAA 5DELA 3KTXA 1YNPA 1KO0A 3GTFA 5D9MA 5MKGB 4O8RA 1HP5A 4G7EB 1CNVA 2DH3A 1E72M 3MTWA 1VFFA 4TV6A 1XH0A 5LNRA 1ISZA 4A3QA 5H8UA 1BF2A 1UBPC 5F2GA 3V0SA 1FWGC 4F48A 3OHMB 3STFA 4WDXA 4FB7A 2BY0A 1RA5A 1V51A 4ZEPA 4G6CA 2OFJA 4QE5A 3GNRA 1FCVA 2ONEA 4XBKA 3CUHA 4HCLA 1IV8A 1TA3A 4IQDA 2UBPC 1E40A 3EWUA 3KBWA 4IXXA 4ENLA 4LAMA 4UTFA 3SRHA 4OBSA 2YL8A 4LUSB 1ZSXA 3PZ9A 2GDQA 3IPWA 4AVFA 1KM1A 2PSNA 4E8GA 1M7XA 1H0IA 4GYKA 1EQCA 2OKOA 4QE4A 2WLZA 1ENUA 1KCLA 1GOXA 4FK9A 4Q8UA 4IIGA 1CENA 1XRSA 3G1VA 2XIJA 5I23A 1H3GA 1ZRQA 1BWVA 1MYRA 3E12A 1TV7A 3LI0A 3VDAA 4N42A 4MIMA 4NF7A 3K8KA 1HKIA 2YB4A 4LAOA 1CXLA 4C6CA 4BEUA 1ITQA 1E0XA 1V5XA 3AIQA 3GG8A 2DJLA 1SZRA 1X8CA 2CLOA 5HWNA 1QNOA 4PSPA 3RR1A 3E0WA 2F7FA 3P93A 3BMXA 3W2KA 4PCPA 1U5VA 4F4RA 1PV8A 3B3DA 4GQRA 5EU9A 1ZAHA 2G37A 2OYLA 4FO4A 4ICNA 4ACZA 1CX9A 4U5KA 1AJ0A 2D3LA 5A6AA 5CGMA 1TFVA 4UTUA 2INZA 3NVDA 2WCGA 4IIDA 3TN5A 3NM1A 4W8LA 3XINA 2E25A 4AB4A 3WMSA 2YZ5A 4ZO9A 1RHCA 4X63A 4AZCA 5F2LA 3GNOA 3LXBA 1W3HA 1VB9A 4C6FA 4O1AA 5K7JA 3S1WA 3RX4A 4I6KA 2I5IA 2IW0A 2A6NA 2ZBTA 5AZ1A 4NXSA 3B97A 3K1GA 1SGJA 4JX6A 2VP8A 1R3YA 1TJRA 3RX3A 1UWUA 4DM2A 1FWCC 3POHA 3AMCA 2VFDA 3PJWA 4UZSA 1QW9A 2OZTA 3HOJA 3RPDA 3W4RA 2BGNE 3WLHA 1JAKA 4JTTA 2TAAA 2WHMA 4ZSUA 3R8GA 4WXZA 3V1PA 2CERA 4DJDD 4MHBA 1LT7A 1EQPA 4H6RA 5I02A 1VD6A 1W8GA 1EA9C 3L5AA 1ADSA 2FB2A 2J9ZA 4H04A 3WEOA 1Q6LA 2F2HA 3VIJA 1THFD 4PMNA 2H9AA 1VEPA 3ARXA 4XSLA 3TMQA 3TC6A 1MUWA 3KRUA 2WMGA 4UC5A 4YIWA 4O28A 1T8XA 1JDFA 5FJIA 2QJJA 1I45A 2PDKA 4F9JA 3DAQA 1W17A 5JUVA 5TF0A 2QJGA 2V8ZA 1Q65A 3E0VA 2ZDSA 4DWSA 4HNTA 3ATZA 1LCOA 4Q33A 2X1UA 2AGKA 4GFIA 1LBFA 3B40A 3LM3A 4B91A 4DO5A 3QFWA 1FWBC 1SR9A 1U83A 2XFRA 1FTXA 1LRQA 4H83A 2DZSA 2QF8A 2TMDA 2FDMA 4W7VA 3GRIA 3P5YA 4PGLA 1OFPA 2A79A 3CC1A 3L2LA 3GC2A 4FHAA 3ZT6A 4AIBA 1T40A 3WQCA 2J7EA 3W2JA 3PN8A 3LV6A 3L7RA 3GNPA 4Z0SA 2FHFA 4ATLA 2XIOA 3P8JA 4M7TA 1A3HA 4O10A 4QIUA 1EUNA 4BY3A 3DENA 3BQ5A 1W1PA 4FNRA 3C0QA 4Q4QA 4CQ9A 3CHVA 1FWJC 3TAKA 4GIRA 4JR5A 4LYRA 1OF8A 3NZGA 2V68A 1J0KA 4XTDA 3WK2A 4U2ZA 3G1DA 3NQEA 1E6PA 3T9PA 5AYYA 2TPSA 2CFFA 5CSSA 4YYCA 2J78A 2QCMA 2NUWA 4J3TA 3TH6A 1BRLB 4JTIA 1UD8A 3NVTA 4S3KA 4Y7EA 5H6HA 3QZ6A 1KKOA 4DO4A 2DT3A 1U2YA 4G56A 1RK6A 3LCFA 3TSBA 3WLMA 4Y96A 1VBHA 1UQZA 4GI8A 4WDTA 3SQLA 2VX6A 3EKGA 4O19A 3NSMA 3C3UA 3WF4A 3L66A 1ZBWA 3HGRA 1XIIA 4I5UA 1TE1A 1UASA 4ORIA 2PUZA 2CZEA 4I9MA 5E6ZA 2QDEA 3WX7A 1Y8BA 1AQFA 3NWRA 1ZLPA 5AYIA 3M0YA 3LZ3A 4XKYA 4DF0A 1KXQA 1L0PA 1SPQA 2GGEA 3GXNA 4RDWA 4B90A 2CEQA 1NY1A 2ACSA 4ACYA 1EFZA 4ONVA 2GYIA 3AU2A 4YWSA 5GNZA 4GINA 1J12A 3CUJA 4LF2A 2DQWA 3DDMA 4PCNA 5F2MA 4OOZA 4AISA 4XZHA 1FCQA 2DVTA 3MCNA 1HJUA 4CD8A 1UMLA 2EXOA 4PB5A 1UZDA 2PZNA 1GPFA 2C1IA 4GGBA 5GJMA 4KETA 5A6JA 2J66A 4D6EA 3VC6A 5HNNA 4UTMA 1JD7A 1Z41A 4PUWA 5FCZA 1JYXA 4JFSA 1E5NA 4KMQA 4F8XA 5IHSA 4ZBCA 5I03A 1D9EA 4BWLC 4LUYA 1FFQA 2DSKA 3NO1A 2XJ7A 2O9OA 4ZQOA 3EDFA 4AG0A 1G67A 4GK8A 1LLOA 1AH0A 5IM51 3BURA 3WQVA 4H2CA 2BLEA 3UYIA 2YDAA 4S39A 5K4ZA 3OLEA 3IEBA 4TVUA 1BG4A 3TJ4A 5KETA 1QBBA 4NNCA 1H7RA 4AD0A 3W88A 3WQ6A 1PEZA 1VFOA 1AL7A 3GNXA 1A5UA 2TSYA 2YDSA 3SJ3A 1K4HA 3A22A 6REQA 3L5MA 3TONA 4QDPA 4IIFA 3VU2A 5HULA 2P8CA 1LRNA 1UB3A 4LW7A 4GVIA 1S5WA 4YVPA 3CMGA 4L4LA 3M47A 2XYLA 3PK7A 4Q22A 2FZ9A 1PHQA 1QASA 3VE9A 4IMCA 4NKCA 3NTYA 2HPMA 4IIEA 2DUZA 4GX9A 4ZOEA 2GVJA 3SB0A 4Q4KA 2OODA 1I9CB 3GO2A 3LHWA 1P6BA 1F61A 3L12A 3AYTA 2XIMA 1F9CA 1TPWA 4OIFA 3MP4A 2YBVA 4EP8C 1GOQA 4IGMA 4R33A 4HNLA 2ESCA 3LLDA 4V28A 5DCEA 3R6IA 4GZJA 1ZS2A 4KWUA 1RQEA 3PBGA 2DORA 3O1NA 2I7GA 4GWEA 5AHFA 3ARWA 3T42A 4GYJA 2YL9A 1DE5A 4ZFMA 2P3EA 1V6YA 4UOQA 2GJPA 4GVHA 2YPIA 3SI9A 3WLOA 2BY3A 4JQAA 1UR4A 1MNZA 5D05A 1LWIA 5HUOA 3GVVA 3EOEA 3O06A 4QJ3B 3KOXA 4MLRA 4O11A 2FZMA 3O63A 3IUDA 4KWOA 2FPTA 4IM4A 4RLIA 4Q8QA 3VIKA 4MNKA 4UOJA 1UG6A 3IV3A 3LTPA 1HF6A 1YX1A 3QGVA 1OD0A 3IJ8A 1A5MC 1SZFA 2PDIA 2ZZ1A 1OG0A 3WEMA 5HR7A 3UJFA 2DZPA 4MM1A 3MI6A 1E70M 2A7RA 4TQTA 3AXIA 2DZTA 2DW7A 3S2MA 4E2VA 4HHMA 1J10A 2D73A 3TTYA 4TUFA 4BK9A 1YBQA 1KM6A 3IK2A 3TK7A 1JCTA 2VWSA 1DHKA 2YA0A 3CAQA 3SDOA 3EXSA 4IOTA 4NJIA 1GVIA 3AIWA 1BVNP 1LYXA 3OODA 2YXXA 3N29A 3N3TA 3PC0A 3TTOA 3GR4A 2FTYA 2O92A 3G1RA 3NQCA 4WY0B 1A80A 1PPIA 4AD2A 2D24A 1RV8A 1PTDA 2OLSA 3I65A 3M0MA 2I16A 4CNOA 3E5BA 1JCMP 2PF8A 3WQEA 3AFBA 3F2BA 2XIQA 2UV8G 3CZEA 3L4XA 3GZAA 2GDUA 3L4ZA 4B3KA 5LIWX 2G95A 5BRBA 5D38A 4DLMA 4JFTA 2X0HA 4NXKA 4C6IA 1VLWA 3U2ZA 1IF2A 2W9MA 1YRRA 1WBHA 2VYOA 3MY9A 2WVVB 2VR4A 4E4FA 4IJBA 4S3JA 3EMQA 3PJUA 1HL2A 4XK2A 5GJPA 2A3AA 3ZOAA 3LV5A 2NWRA 3S83A 2JF6A 4AIUA 1Q6QA 4CLMA 4GACA 3UZZA 4IT1A 3OB8A 2AMXA 2VUYA 2E6AA 3L4VA 4AF0A 3DKLA 4YWIA 3IIPA 2GFTA 1UPMB 4U2YA 5FJJA 2GJNA 1L2UA 3L4WA 2BXYA 3BE7A 4IIBA 3TA9A 2E77A 4OHQA 5IDIA 1JDEA 3WUEA 1XDMA 2ZUSA 4MWAC 4TTGA 5DXYA 1WQ5A 1F4HA 1XS2A 2J4GA 3FN9A 1XX1A 3AIRA 3GG1A 2HZGA 2YSWA 1AZ2A 2R8WA 3KUMA 1P4CA 2NX9A 2JKEA 3GS6A 3NA8A 1UR2A 4PTVA 3TW6A 4OVXA 2PB1A 1YE6A 3EEGA 4UFJA 3HU7A 3UWQA 1DKWA 4K2SA 2PC8A 4O16A 3N6HA 3KP1A 4L1WA 4IP4A 3UXDA 3VGEA 4AY8A 4Y6GA 5FAJA 1QCWA 3SCTA 3QMRA 7XIMA 3TYAA 4TO8A 1KCXA 1Z48A 3KLLA 3LYEA 1XLAA 3W87A 1YE4A 3FEQA 1R7AA 1W1VA 1X6UA 2NQHA 3J7HA 4IFOA 2J8TA 2NSOA 1YXDA 1BQCA 1XH1A 1JPIA 3VCCA 4Z2JA 2OQLA 3QY6A 4JTHA 2PDXA 4BF7A 2BHUA 4ZQCA 2D2OA 3BTNA 4FMVA 4JKKA 1VGAA 3QGAC 2C79A 2PDHA 5CSUA 3L21A 3W7LA 2DT1A 1MQRA 1TX0A 3D0CA 3R25A 1MW0A 3N9KA 1MEHA 4KERA 3W1MA 1C8QA 2QJHA 5AHLA 3BSGA 3L67A 5LIUX 4DUXA 2VZSA 2WW5A 1FX6A 4YCPA 3IJ9A 3RCMA 4Y9OA 3LENA 3N11A 1BXBA 2J8GA 5HANA 1EP3A 1NFGA 1G94A 3HMCA 3IJLA 4LXFA 4NZJA 1JDCA 5PTDA 3RRAA 4IF2A 1OFEA 3KWXA 4CNPA 4MB1A 4CD5A 2KX9A 4H9UA 1NP0A 3CB8A 1JYWA 2WNNA 4O17A 3G0SA 1Q13A 4LAUA 3WD3A 5IBXC 1TVPA 3R58A 4EXBA 3PG8A 1I1WA 4W87A 5KZDA 2JGYA 4GI9A 1GQIA 1M53A 4AEFA 3F03K 4X22A 3T81A 1XQKA 4KRUA 1AUSL 4PYSA 4HPHA 1XBYA 2HROA 3GFYA 1ESWA 2OT1A 3WLIA 3CQJA 4WY0F 4DN1A 3TTEA 1PWMA 3N6JA 1SO4A 5DXXA 1WAUA 4KRZA 1QPKA 3IJ6A 5FJTA 3R79A 1V6UA 3TVAA 2RGLA 2ZC8A 3HN3A 4UTWA 1XM3A 1CI1A 1C91A 2VDHA 3ITVA 3QKZA 3H7VA 3BPWA 4JYEA 1OC6A 3B8DA 2Z6JA 1TIMA 1SM9A 1B2YA 2HK0A 4L4MA 2OEJA 3WENA 1OIFA 1W1A1 1PS9A 5I3HA 1NWUA 2YW3A 4PBGA 1XFBA 3MDWA 3GSMA 3H2OA 2FJKA 3FLUA 2WBGA 3I6EA 4PBFA 3DGBA 4HOXA 1HL9A 1E0TA 4D2JA 3LQGA 4G9PA 3DOPA 2YJQA 3SUWA 1G4TA 2NUXA 3HQOA 2OTDA 2HCVA 3GUWA 1RY8A 4OOUA 2Y24A 3BLOA 2PLCA 4H9XA 3ZSSA 3ITOA 1K77A 2X16A 3VM7A 3QC3A 1KBKA 3WL1A 3MYOA 3EZ4A 3N3MA 3K2GA 1JZ2A 1WYIA 3IVTA 4I7UA 4MJZA 4OV9A 3KZSA 3O6YX 4DXXA 3CZGA 3OTRA 2QCDB 4BQ4A 4DNMA 2GSJA 5CC6A 2VOTA 1J9YA 1W3LA 2CU0A 2BP1A 2Z27A 4EWND 3URNA 3MUIA 1PWLA 4D1JA 5FL0A 5RUBA 4PTDA 2VFEA 3FJLA 4H01A 1W8SA 4ZCWA 4M24A 2PODA 5A8GA 5TD4A 3S9IA 4US6A 3G1SA 3CWNA 3VOCA 2G3JA 5D9PA 3OW1A 4XZNX 4JTSA 4JTQA 1QXLA 1KRBC 1XV8A 5G1YA 1H4PA 2XN0A 1D7FA 4JIRA 1UR1A 3AICA 4POCA 1BWLA 2IQ0A 3NUKA 5A6KA 4O13A 1JXJA 1EC9A 3WLPA 5LNUA 1JZ4A 1TMLA 1E3XA 5U7SA 3BW4A 3DKJA 2A5HA 5C71A 2FFCA 4B2DA 3LNPA 4JTGA 3F2DA 3UXLA 2RDTA 2PU1A 3GQYA 3RMEA 1CGTA 1FH8A 4Y9MA 3WN6A 5CLTA 3VOJA 2Y4SA 1OEPA 3YPIA 1XLLA 3WK3A 5D30A 1FCBA 4R34A 2XGIA 3BC9A 2CBVA 4GQBA 4A35A 4YHEA 3VIIA 2XUCA 1KW1A 4FXJA 1NARA 4XBJA 4MNMA 1PIGA 4FF7A 4JNYA 2R91A 1IGSA 3HBLA 2JKPA 4AD5A 4CCZA 3LHVA 2RJHA 3AIVA 3IJ7A 1QU4A 1NQKA 1UR0A 2YL6A 1F6YA 1F76A 1TJ1A 4MZYA 2W91A 3TN3A 4JNMA 3E2RA 3TLLA 5DCDA 4HN4A 3R8HA 4WGXA 2D20A 2ODOA 3PANA 3MUY1 2E6YA 1EJRC 4RZ4A 4N9DA 4AEEA 3UP8A 5DQPA 5CJNA 2X0SA 3CASA 3SUUA 2JBMA 4OZOA 2I1OA 3W25A 2D3NA 1G01A 1Y5XA 4MPQA 4NZ1A 1JNEA 4AWEA 4N6EA 3MCOA 1BD0A 1JCYA 1X96A 3GK0A 5XINA 4P7OA 1ELSA 4LV4A 5D02A 1JCXA 1EJWC 1XBXA 3VO0A 3CM4A 1JCJA 4ZOCA 4KIRA 1X97A 5I6SA 2V69A 5U4NA 4MWAE 4MPKA 3H4WA 4KWSA 4CN1A 1E15A 4A8RA 3HTWA 3BLIA 1AW2A 4AVNA 3ERPA 4US5A 3VIPA 1OABA 2O0TA 4XBSA 1XYFA 4TMBA 4K36A 3U7VA 3EB4A 3OA5A 3FEMA 3E0FA 4RK8A 4X9SA 3EWCA 4AZCB 3T2QA 6A3HA 2WKLA 2UY4A 3T7VA 1DP0A 3KM8A 1F5ZA 3BAKA 3Q58A 3N4EA 4AZ6A 1TTQA 2JQXA 3TFXA 3NZ1A 1QPNA 5C2CA 4DBWA 3ME3A 4JEJA 3T07A 1K7XA 3IIVA 5M5DA 3AHZA 4MY9A 5BU6A 1ECEA 5EMMA 5DMYA 1AMKA 5A94A 1DJQA 3LPFA 3E2QA 4J28A 3GHSA 4QFUA 4I6VA 5A2CA 1GONA 2XH2A 5FEXA 1PKYA 5C5YA 3GY1A 3S0CA 2D2HA 4IUGA 4DJEA 2AAMA 2E8YA 2WYSA 2ZUNA 1QUMA 4D6FA 1P7TA 4I7VA 2QJNA 2C8NA 3GG0A 6TIMA 3PF3A 4AYSA 4RV3A 1E6ZA 3CYJA 4HU0A 3RHGA 3RPMA 2OOGA 2X8RA 2OMAA 5AC8A 4UB9A 2CXEA 3GXIA 2H3BA 3CB3A 1ECQA 5C2XA 4H4IA 3H54A 3TU9A 3CUFA 3WQ4A 3TJLA 3NDOA 1PBGA 4YMZA 4E6MA 3GC4A 4D8AA 4QJ5B 1TVNA 2GOUA 2DVXA 1AMYA 1IT0A 3GHTA 4JFVA 1HG3A 3ELFA 3FHAA 4F2TA 3EWZA 3CHFA 1XIEA 1BG9A 4ZZ9A 1G1YA 1H2JA 4AFYA 2W4XA 3KXQA 1PTGA 3REQA 3WQOA 1F8MA 4JTKA 4MB4A 2REQB 3UY8A 2YR1A 5CZTA 5JMUA 4XV0A 2Z25A 3A4WA 2ALDA 3ZJ8A 1E0WA 4WXYA 3DFPA 4PCFA 1GG0A 1OGBA 1R46A 3DFTA 2QJMA 1VEMA 1ITCA 2GVGA 3WQPA 3THUA 1TB3A 3PHAA 3E0LA 3GDLA 3SCPA 4MTVA 4P8UA 1J4EA 5D37A 2WV8A 1C90A 3WMCA 2E1WA 1Q63A 4JYFA 3USZA 1XIJA 4XQ6A 1XLHA 2YA2A 2Y62A 3SGGA 1EPVA 2ZWZA 3HURA 3M0KA 2VWTA 4FIQA 5IHRA 3BCDA 4RNJA 3WLTA 1TPVA 4I8DA 4QCFA 4H9YA 3UPWA 1LF1A 3C3NA 1R86A 8XIAA 2POZA 3HJEA 3EMCA 4CEXC 1XGEA 2ABBA 2QUMA 4JEQA 3KBJA 4KCVA 3ORWA 4K1WA 3VZYA 2YYTA 4GFSA 3GDRA 2CESA 4E2BA 4UTLA 1PIIA 4JIQA 1Y5WA 4LEQA 4PEKA 3K8MA 4DAFA 4EAYA 2PWVA 2NV2A 4MJMA 4W7UA 3AYRA 4JTUA 4IX2A 1ZBCA 3ZWTA 3EWWA 2F6XA 1AD4A 3GR7A 3M6YA 3BDKA 1SZNA 2EG6A 1OGGA 1UWRA 1XRVA 4GD0A 4ZTXA 1BSIA 1UWTA 1XSJA 2B81A 5FJRA 5CXPA 4NZ4A 2DIJA 5D4YA 2H3DA 3NQDA 1A5BA 1XUZA 3W2NA 3W86A 1GG1A 2CBUA 1HJSA 1OFRA 2E5BA 4NJKA 1XW8A 4C1KA 4QP0A 4LCSA 2HDJA 8RUCA 1WZMA 4HZ7A 4DZIA 1HTIA 2XIIA 1Q6CA 2LLEA 1JCNA 3A23A 4Y8FA 3M5YA 1ZBKA 3O7UA 2PDUA 1TPUA 3B04A 4H6QA 5I0DA 3E96A 3VE7A 5IRPA 4KESA 5HPOA 2VNCA 3HPXA 4M29A 3QN3A 1OINA 1UPPA 3CLWA 1Q6DA 3W07A 4NQ1A 5T26A 1B3YA 3KOZA 4XAZA 5TBOA 4HPGA 2FPYA 2Z1KA 4D9PA 1ZL1A 3FSTA 5AC5A 4NZ3A 1QT1A 3ZJ6A 3WMBA 3EPNA 1Q6RA 4JX5A 1P1MA 4LYKA 5CG0A 1VYRA 3WFZA 1UYQA 2YX0A 3WCZA 3GLCA 5AOUA 3GE7A 1AJZA 3M5ZA 1HKJA 3MJYA 3T6CA 1GQJA 4PR4A 3ZR6A 3S9YA 3W3OA 4Y9NA 1B3OA 5BMWA 3UZXA 5CG7A 2IQTA 2I14A 3NL6A 3W53A 1DWFM 3W1TA 4G5DA 2V67A 1O68A 2ZA1A 1BYCA 4HTBA 4GMEA 2V3GA 3TROA 5JH2A 4HNVA 4DM1A 4JTCA 4LVDA 3SADA 3M4HA 1JPDX 4HP5A 2QQ6A 2WJFA 4CNSA 3UW6A 2BTMA 5FF7A 1A49A 3OIXA 2JEQA 1XSIA 2ZVIA 4GYPA 3M6DA 4MYXA 5EGRA 1E6XM 4WZHA 3STPA 4L6HA 3UXAA 3G1XA 3C2YA 3NPXA 4DZAA 1KBBA 5T9BG 3UJEA 1M03A 1TPH1 2GJXB 4UOZA 4XKMA 1SFJA 2PLJA 3KS6A 4LVGA 1TPEA 1X98A 3S2LA 4W93A 2BVDA 1W1IE 2ZX6A 5CQ1A 4WKFA 4AVOA 1MUMA 3V0UA 5EMKA 3SGZA 1GOWA 1N8WA 2XZ9A 1FWHC 3TYCA 4DJFD 3M5VA 1H7PA 1VRDA 4QHRA 2NLYA 4OUEA 5CJ5A 3ARYA 2Q01A 4OU1A 5JIPA 3TLQA 5AHMA 1Z69A 1EDTA 2Y1HA 1LZOA 3NJ3A 4L1XA 4J3XA 4C1NB 1UJQA 2C13A 3VGGA 2E3ZA 4HK7A 1CW2A 4G2DA 4W88A 1XL9A 1HL8A 1DIOA 3UERA 5LHEA 4HBKA 2ZWYA 3MSDA 1ITXA 2QCLA 2QUTA 3U4FA 4E38A 1ZHAA 2E5DA 4ORMA 1HVQA 3H23A 2WXDM 3QRHA 3OBEA 2FLIA 5GVJA 4AXKA 4W9TA 5CZKA 2VFIA 3GXMA 4C6EA 3FY1A 1IEIA 3G24A 1B57A 2DZWA 4PTXA 3WKZA 4DB7A 1F6KA 4GIYA 2QF7A 2NQLA 3BJFA 3DU0A 3GKFA 4QX4A 1SZEA 1E71M 4L64A 1TJ0A 4JD4A 1A3WA 1DV7A 3FA3A 1E9IA 4DF2A 3W2UA 5FL1A 4E8CA 3G0XA 3JVAA 2PRLA 5J5DA 1CLXA 1FCUA 3HMJG 4PN2A 5E09A 1T8QA 3XIMA 2O9RA 5F4WA 1YBQB 1WDPA 1DXFA 1DIEA 3G22A 4G1KA 1MEIA 4DUWA 4U28A 4GVFA 1NOUA 2B7NA 3W37A 1V0LA 4Q3MA 4A21A 2EJ1A 5CSYA 2WCSA 3B0UX 1PDZA 3H6OA 3ABSA 4MFDA 4MJ2A 2WZEA 1XHGA 5A6SA 5CAKA 4E4PA 2Y70A 3O6AA 4K37A 3VGHA 1U33A 2EG8A 1VEOA 2GK1A 4CVUA 1TJPA 3IJDA 1REQB 4MMWA 3T4CA 1I6NA 4AZBA 2FHBA 2ZRUA 1M68A 2J75A 3B4UA 7A3HA 3AXXA 4NUWA 1AW1A 2DU2A 2XN2A 5M2FX 3NGFA 3WD1A 1J5SA 1TZ9A 2QMKA 1DIDA 1EIBA 1MWOA 4A8LA 2VUNA 1XYZA 1NSJA 2IPWA 1RBOB 1U22A 2G5WA 5CC5A 4GNJA 4L9ZA 1YADA 3VILA 4NNAA 4H9ZA 4J4KA 3LXAA 4Z1DA 1BYAA 2Z4GA 1P43A 2HV5A 4J40A 4RW3A 2DW6A 5JH1A 1C7TA 3UA3A 4EK7A 3NQ8A 1IT7A 1MQQA 2NVCA 1FY6A 3MV11 4CUCA 1S2CA 3T0BA 1GTHA 3ES8A 4OECA 2FIQA 4NX5A 2HRWA 2ZADA 1YMYA 3LCIA 3AMLA 1FWTA 1EZWA 1PKMA 3AXHA 3FDKA 4ZODA 2X7VA 1VPQA 1ZENA 4LS0A 5I06A 5C54A 3BW2A 4E3TA 5IOBA 1Q6OA 4XUGA 4N2YA 2R94A 3ISIX 3SUSA 4GVGA 3DXIA 4IH3A 1PAMA 1DJGA 4IIHA 1DXIA 1K8YA 4DO6A 1XI3A 3ZM8A 2Y2WA 1JPMA 2XVNA 1ZZMA 5KZEA 2C15A 3CV6A 3OYZA 1HT6A 3BJSA 3W76A 4GGHA 4AWTA 3QBUA 1GVYA 4GXWA 2PDYA 3RUBL 2V5BA 1R5YA 3SRKA 4HOWA 3NZRA 2QAPA 3NAVA 2VEKA 3R2GA 3SSZA 1OG6A 3SN1A 2VEFA 3GVQA 4FX7A 1OSEA 5BZAA 3UWEA 1LBLA 1RLDA 3CPGA 5REQA 1W3NA 3DI1A 2VVNA 1KWKA 3EX2A 1VBUA 2HJPA 2QYGA 2OXNA 3HG5A 1OFQA 3SCSA 1MXDA 1XFCA 2P88A 4MOZA 3RF9A 2WMIB 2ZICA 4CQ8A 4QGCA 4JKLA 3BGGA 4BEQA 5B80A 1HP4A 1YW1A 4PMOA 2QUVA 2PWEA 4QRNA 4GOAA 5E9XA 4YNGA 1XKJA 3CTLA 2PPGA 4NASA 1W9PA 1EJXC 3N12A 3WUFA 5DF0A 2OQYA 4IL2A 4YLWA 1Z32X 1XIGA 1GW9A 1TV2A 3L68A 3WMLA 4Z1AA 2OO6A 4GX8A 1X1ZA 1Y5VA 1TZ7A 2CHNA 1W5OA 1B90A 2YLAA 3BLKA 2J6VA 3QPZA 2WK2A 1HJXA 3W1XA 4PMRA 2QCNA 3WJZA 3IUHA 3VGDA 2HBVA 2DZBA 4PB3A 1AQHA 2PGEA 5C8BB 1KLZA 5XIAA 3DHDA 3QSRA 2HE5A 2IPGA 4DUOA 3QV8A 4LUTB 1KM0A 4IFRA 4R88A 3DFOA 4DXVA 3RCNA 5AZ0A 5FIPA 2VQUA 1VFSA 4NRRA 3MA8A 4ICCX 3UYCA 3ALFA 4FNQA 3CT7A 2E09A 3QR0A 4LEFA 1Z42A 5LIYX 2WWCA 4RR4A 4H00A 3ITYA 2YFOA 1NOFA 1E3ZA 5ECUA 1UUOA 2WSRA 5A69A 4BR1A 1SFLA 4F79A 2CHOA 1JF5A 3WH7A 2DV0A 4WHBA 4PCSA 1GJWA 4BJHA 1YKWA 1H5YA 5LXXA 2VGGA 1SW7A 1GKQA 3P3BA 4PUKA 3APTA 1JGMA 5BXSA 3DC8A 4Z2LA 1XYBA 3STCA 2D22A 4HU3A 4MWAB 3ABOA 3BK0A 3NQFA 4LC6A 5JVLA 4GZ7A 4OJYA 3LN3A 1V02E 1V7AA 3TV8A 4YHGA 2FH6A 3UFYA 4GPNA 4KRTA 4AAJA 3RPTA 5CPTA 2OYMA 3HA1A 3G1AA 3CO8A 1XPYA 3GTIA 4ZMGA 3WD4A 4F3HA 1DQXA 3AROA 1WKFA 1TELA 4YTUA 5HOSA 3KBNA 2J62A 1ME9A 4X2PA 1VR6A 3RJYA 4KH2A 3W1PA 4OQVA 1JG9A 4AD4A 1GW1A 4O0ZA 3WH5A 2PDQA 3SCNA 5EKYA 1TREA 2E40A 1K7FA 1QI0A 3AHTA 2EPOA 4JDBA 4JQ2A 2WJEA 1C8YA 1F6PA 3TYBA 1LL7A 2OGJA 4C5YA 3SCWA 1DL3A 4AD1A 4J3WA 2BXVA 2QCFA 3OZPA 3U6WA 2E68A 4GQ0A 5C70A 3CXOA 4MUPA 3QY8A 3MHUA 1W9UA 1BHGA 3FSUA 1Q85A 4PC8A 1R30A 1ADOA 2QVNA 3WQWA 3B9DA 4OBTA 3UZYA 3PZVA 3APYA 3AI0A 1EX1A 4XAPA 4CU6A 4OBRA 3W71A 1A5OC 2CKSA 4GUJA 1D3HA 1YYAA 2HWGA 3O0FA 1HUVA 4Q8MA 1W5QA 1GCYA 3QM3A 3H2MA 4UFIA 4ATWA 3VD9A 1M7OA 2ZZ5A 1V6TA 3LS9A 1US2A 4M80A 1KXTA 1ZAIA 5I3FA 3MMUA 4H6EA 4GIEA 4PEEA 3M0VA 4F0MA 3H2AA 1DWHM 4V2XA 3BUVA 4B5XA 3R12A 3SY8A 1QHZA 3GXFA 2J74A 1UW9A 1SQ7A 3I4KA 3T0CA 2GSHA 3AS2A 4QAWA 4QNEA 4ZO8A 1U5HA 3VK5A 4M1BA 4TIMA 4P7NA 3SCQA 4L61A 5J04A 2X1RA 1VCGA 3L2IA 1VJIA 2H6RA 1W54A 4M0XA 4CD7A 3SEPA 1XC6A 1OX4B 2RUSA 2J9YA 2PLKA 3EOUA 4A3HA 5K9DA 1EIXA 4IPIA 1WE5A 1LRTA 2QCEA 3CQIA 4KEVA 2DSWA 3ZXWA 1OZQA 2GVLA 1N82A 5JU6A 1TPB1 4ZVJA 1OM0A 1B1YA 1S2AA 3UQNA 3KRZA 1RQHA 1WUEA 1J8VA 5DCBA 4P2VA 7PTDA 1LLWA 4QLJA 2FGBA 3L2MA 1CXKA 2ZFAA 6PTDA 1JQXA 1GQLA 3MUZ1 4UXDA 1EH9A 4L6DA 3NSXA 4J2PA 1OD8A 2ZCGA 4JTEA 2ZRYA 2C0HA 3T1GA 3TX9A 4A4AA 3TNBA 2Y0FA 1MXGA 4RNIA 1ICPA 3O9NA 4Q4RA 2QW5A 4E4UA 3I68A 3CU2A 3N34A 3MO4A 1V3IA 1DHPA 4UIOA 4H8UA 4EACA 1W31A 1KC7A 4IICA 4Y9PA 3ZYZA 2Z00A 1RPXA 1SJAA 4RPPA 2ZOXA 1J79A 2B7QA 4MNLA 1CLVA 3MKVA 3W7OA 4H8VA 1C7SA 1HVXA 3IUIA 5HMEA 3TWAA 4DZHA 4NIRA 2AKMA 4BI5A 3ZMRA 5E93A 3OLDA 2VC7A 1MSSA 4RPQA 2AQOA 5A8PA 3IK4A 3S1XA 3A9IA 3STEA 2HXTA 2CLLA 1B4KA 4K8HA 5FSDC 1JUEA 3UCCA 2Z29A 3BQ6A 1BQGA 4WD0A 3RLGA 4A3RA 1SFTA 4JCLA 3W01A 4C6PA 1P1XA 3HF3A 4HD5A 1T41A 1PO9A 2QAFA 5BRQA 1J0ZA 4R27A 3WLRA 2P0IA 3WLKX 1OCJA 1QRQA 3DG6A 4NAFA 3W7DA 1QO2A 1EGMA 8XIMA 1KRCC 3S6DA 1P7TB 3O3RA 4AX7A 2C19A 3LA4A 4ADUA 1LQAA 2Z2BA 2I57A 1H11A 1BF6A 2W61A 4LAZA 5C9RA 2I9EA 1JPKA 2BBFA 4DY1A 1KGUA 2ALRA 4O4VA 2QCHA 5CBIA 2YKKA 4JL2A 3OZMA 1HW6A 4A29A 3TIMA 1VF8A 1EC8A 4PMQA 1TWIA 1V6WA 1UKQA 1MRAA 2VGBA 3DECA 1EOMA 2Q8LA 4WSJA 1GZJA 2DSZA 2WHJA 3M0IA 4LCRA 5M17A 4V1XA 1VFTA 1W9XA 3SN0A 4M5PA 3AWOA 1X1OA 2A21A 5T9CE 4WQ6A 4K8GA 3TKFA 3HQNA 2RDXA 3TR2A 5C9XA 2YA1A 1KFLA 2BHZA 3CNYA 4GISA 1LG2A 1R3RA 3HPZA 2BVYA 3IAQA 3H2FA 1JPHA 3N2CA 3L65A 2WO5A 1ZJHA 1T7LA 4UQCA