1HJQA

Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
332
structure length
332
Chain Sequence
ALQYKGVDWSSVMVEERAGVRYKNVNGQEKPLEYILAENGVNMVRQRVWVNPWDGNYNLDYNIQLARRAKAAGLGLYINFHYSDTWADPAHQTTPAGWPSDINNLAWKLYNYTLDSMNRFADAGIQVDIVSIGNEITQGLLWPLGKTNNWYNIARLLHSAAWGVKDSRLNPKPKIMVHLDNGWNWDTQNWWYTNVLSQGPFEMSDFDMMGVSFYPFYSASATLDSLRRSLNNMVSRWGKEVAVVETNWPTSCPYPRYQFPADVRNVPFSAAGQTQYIQSVANVVSSVSKGVGLFYWEPAWIHNANLGSSCADNTMFTPSGQALSSLSVFHRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,4-GALACTANASE
publication title Structure of Two Fungal Beta-1,4-Galactanases: Searching for the Basis for Temperature and Ph Optimum
pubmed doi rcsb
source organism Humicola insolens
molecule tags Hydrolase
total genus 129
structure length 332
sequence length 332
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hjqA00
2OSYA 3ARQA 4PCTA 3RPMA 3M6DA 1V02E 3A4WA 5A8OA 2D20A 3MMUA 5EB8A 1GCYA 2BY1A 3VVGA 1GVYA 2XVNA 4J3UA 4AZ7A 1HP5A 3VGBA 5E6ZA 3ARSA 2ZUSA 5BRPA 1NARA 5IFPA 3BAWA 2VCBA 3PHAA 4FF5A 8CGTA 5EBAA 2QLYA 4EAMA 4JAWA 2BVDA 1KXHA 4NF7A 3VD9A 2QPUA 1W91A 3BH4A 3PZVA 1KXVA 3AMCA 3N9KA 4U31A 4EKJA 1MQPA 1J0ZA 3MUAA 4KGJA 3WF4A 2WKLA 1ITCA 5DEZA 3M07A 3MKKA 4GZJA 1HJQA 3I3EA 2EPLX 2FH8A 4MB4A 3DECA 5DMYA 3AIBA 1JD7A 1B90A 2WHLA 5EFDA 3GYCA 4AYSA 4ACZA 1GHSA 1EHNA 3GBDA 4OBSA 3T2QA 3G6MA 2WC4A 4JHOA 2ZX6A 1BGGA 1H09A 1BYCA 3VIPA 1PIFA 2TAAA 3PZQA 4WJXA 1WNOA 4JKKA 3DYPA 1B3ZA 2CHNA 2C8NA 1JYXA 1MQQA 5IHSA 2X8RA 3K8MA 4MJ4A 1HN1A 1XV8A 4HPGA 4HMCA 5D8WA 3FAXA 1ISVA 3BAJA 1D7FA 1V6XA 2XVPA 1B3XA 1ISYA 2D22A 1TFVA 1CBGA 4CU8A 3AMKA 3AZSA 5CLWA 3EDFA 1UWQA 1GJUA 3THCA 3UESA 3VIFA 2WBGA 3WQ5A 2J7CA 1JI1A 2XGIA 3A47A 2JIEA 4AZCA 5AC5A 1LL7A 2GDVA 5A8QA 1CLXA 3WNOA 6A3HA 1M7XA 2BY3A 1JAKA 2VZSA 3CO4A 4P8VA 4U2ZA 5BYWA 1MW1A 1Q4NX 1V6VA 3CMGA 3BGAA 1ECEA 2G3IA 1HIZA 1JZ3A 4DM2A 5I2UA 4LPCA 2OYMA 1BLIA 5C71A 3U7VA 3PTQA 1CGYA 1GOWA 4CN1A 3HJEA 1JAEA 2J7HA 1V3KA 1CGXA 2QHAA 4UOJA 4E4PA 3AMLA 5FL1A 2DQXA 3VNZA 5LA2A 3CIVA 3VD5A 3CUJA 1HKMA 2EXOA 2J8FA 5A2BA 1WCGA 4PMUA 1QI0A 2WHMA 1E0XA 2J74A 2GJPA 3A6OA 1VBUA 2WCAA 2CEQA 1UQYA 4J3WA 2D3NA 3NJ3A 2OWWA 2DSKA 1B3YA 2W4XA 3G6LA 5ABEA 2OYKA 1WZMA 3CGTA 1MXDA 2JFEX 5HBFA 1AQMA 1R7AA 2O9TA 1FFRA 1G1YA 5A6SA 4BQ3A 4K68A 3T0AA 2BHYA 1R87A 4W5UA 4PUEA 1ISWA 5JBFA 3PZOA 1HF6A 5LA0A 1J11A 1E4IA 1KR1A 3IJ9A 3ARUA 4F79A 1Y7VA 3N17A 3WMCA 4UQDA 1UH4A 4Z2LA 1OBAA 4L4PA 2XYLA 4WF7A 4CGTA 2GSJA 2E3ZA 1QVBA 4HOXA 3LPPA 3RJXA 4CCEA 4GZIA 1VEOA 3GXDA 3WUBA 1R8LA 1H4PA 1E6NA 1UHVA 8A3HA 2CYGA 2DSZA 4P8UA 2G8ZA 5A69A 4W7WA 1MW3A 1UWIA 2J25A 3L4XA 3NYDA 4W8AA 1UA3A 2WZEA 1HKJA 1LLOA 3QHOA 1IZJA 4A3HA 1J12A 1FHDA 4TUFA 3IAPA 3PZTA 1H11A 1WE5A 1KBKA 3AIQA 1B3VA 3ZJ6A 3AXHA 4QLKA 3WDJA 3CLWA 4QCFA 3AS0A 1MFVA 1B0IA 2DH2A 2ZUTA 1W9XA 3PZMA 4W87A 1JIBA 1C7TA 2IXUA 2WMIA 1VBRA 2XM2A 3MO4A 3ARZA 4U5KA 1O7AA 1WAWA 2E40A 1RH9A 1EHAA 3PZNA 3QOKA 4FLQA 5I3DA 4PBGA 3NSMA 1HXJA 3WFZA 4E8CA 4D72A 2WC7A 1EO5A 4P7OA 4BQ5A 4B9ZA 4EANA 3L4WA 2NW0A 2Y4SA 1UD5A 1XSJA 2O92A 4W7UA 3T08A 3KWXA 4UQAA 5FOOA 4CKQA 2DT1A 1MFUA 3WDIA 2A3BA 4AZHA 2WWDA 2VCCA 4QDMA 4X0NA 1LWHA 5D9NA 1TG7A 5FKYA 3CMJA 1CXIA 5A8NA 5F7UA 2VX4A 1UYQA 4J3VA 1VJSA 3ZMRA 3UG3A 4GI9A 2CIPA 4PMOA 2D23A 3POCA 2W91A 3D5HA 4URIA 2XVGA 4D6GA 4GPNA 5AY7A 3HMCA 3TP4A 4FK9A 4H7VA 2HISA 2MANA 2B31A 1GZJA 3K4AA 2WXDM 3AS1A 4D6IA 1ODUA 1PZ2A 1W9UA 5HXMA 1Q6FA 3CHFA 2CKSA 5EFFA 3BLKA 3MV11 1KWKA 1J0IA 2WBKA 1E4LA 4MNKA 3GNPA 1MW2A 2WMHA 5JIPA 4GIAA 4ZEPA 3ARWA 3CHEA 1H0IA 2WHKA 2E8YA 2VL4A 2ZX5A 4EK7A 4PMRA 2FDMA 1JDAA 3CHCA 4CD7A 1V3IA 1QNRA 2O9OA 3ARPA 3A4AA 3WF0A 2ZXBA 1KWGA 4D6CA 3T2PA 2E9LA 4GI6A 1JYWA 2Y24A 1NP0A 2WCGA 1HNYA 2J7EA 1RPKA 1QW9A 2E9BA 1UA7A 2FGZA 1PAMA 1GPFA 1E70M 3SUSA 3WDQA 2E8ZA 5ABFA 2G3NA 4IISA 4A4AA 4HU0A 2XG9A 1JGIA 2GJXB 1OIMA 1W9DM 2YBUA 3VIIA 3VDCA 2VR4A 1PJ9A 1JZ5A 5CQ1A 1L0PA 3GNOA 1E55A 4PTMA 1OGSA 3SEPA 2XUCA 2PF0A 4PTXA 1BYBA 1OD0A 4NI3A 2WWCA 1V0MA 1EO7A 1U2YA 4PTWA 1OSEA 3WIJA 4PYSA 4MB1A 1H49A 1BGAA 3RIKA 1W1PA 4W84A 3AQUA 4FLOA 3PZIA 1W3LA 4ZXLA 1B9ZA 2PC8A 2ZUNA 1PX3A 2CETA 4BA0A 3T09A 1H3GA 1DWGM 4UFKA 2D0GA 4TTUA 1V0LA 3WL0A 1S46A 4AW7A 1FH8A 4JFUA 5BCAA 1EOKA 2JALA 4GKLA 3N15A 5HDRA 4BCEA 3SURA 1LG2A 2EO7A 2BHUA 4V27A 1JFXA 3BMWA 5I6SA 3VU2A 5GPRA 1HKIA 1C90A 3LMYA 3LPOA 3WNKA 3VGGA 4M1RA 5KEZA 3F5LA 1IT0A 1CGUA 4PMZA 1QNQA 2WCSA 3VMOA 4H2CA 2CCRA 4UFIA 1OWQA 4XZBA 5FCZA 5IFTA 3ZJKA 1G01A 4Z2HA 3SUTA 1Q6EA 3EMQA 3TONA 2J77A 2FGLA 4Z2KA 1GORA 2DSWA 1V3HA 2VJXA 4U3AA 2YLAA 2X1IA 2CHOA 2DSUA 2EPOA 1I1WA 2WVVB 3AHZA 4V2XA 4WSKA 3UR7A 4BZYA 3WD3A 5LA1A 1ZJAA 2DGAA 3AMDA 4KGLA 2VT0A 4AD1A 4ZE5A 1CGWA 1KXQA 2QMKA 2VO5A 4F9DA 4M56A 2BVTA 1J10A 3KL0A 3AZRA 3FHQA 4UQEA 1VFOA 3B8SA 1K9TA 3W25A 4M80A 4WLCA 5CPTA 4OIFA 3B9DA 4YPJA 2BFGA 4AIEA 5AYIA 2FHCA 1EDQA 3AYRA 1FH9A 1W3JA 4UCFA 2WLZA 3KL5A 1NOUA 4PEEA 4CVUA 2EPMX 3BCDA 5E0CA 3VGDA 1X6NA 1XCXA 1OGGA 1CGVA 2YIHA 5JBDA 3SCPA 2V3DA 1GOMA 1UG6A 4YHGA 3VILA 2JE8A 5BXPA 1ODZA 2VRJA 4PN2A 1AQ0A 3OBAA 4P8WA 1X6LA 1BYAA 3ZR6A 4ACZB 1J18A 1FOBA 4AZ6A 3ARVA 3RCNA 3T0DA 1NQ6A 3W0KA 1B2YA 2BXYA 4D71A 2J62A 4HZ7A 1ZU8A 2VZOA 3OGRA 5HNNA 1TZ7A 3PTMA 4UZSA 7A3HA 5GNYA 5BXSA 2F8QA 4HOZA 5I79A 1W3HA 4N0RA 4PSRA 4R5EA 1C3FA 5IHRA 3OLIA 5GNZA 3UCQA 2XVLA 2WVTA 1KCLA 4KH2A 2HVMA 3WMSA 2YA1A 1W2PA 4C7FA 1KGWA 4QCEA 1SR0A 3F5JA 3UG4A 3N13A 1E6ZA 3EBVA 4GINA 4UQBA 4KWUA 3WH6A 2Q8XA 3VX1A 1UWUA 3WNPA 5A6LA 2J79A 1NOWA 1QI3A 1DHKA 4JKLA 4E2OA 4AEFA 3LPGA 4AZCB 1KGUA 1KCKA 1UQZA 4KMQA 2O9RA 2NSXA 4YHEA 3AXIA 1WDSA 5CPQA 5D8ZA 4M24A 5CGTA 4HOWA 4AEEA 3MV01 1VFUA 4WSJA 3CZEA 4W93A 1EQCA 3PBGA 1E3XA 2GK1A 4H41A 4DM1A 3BMVA 3O9NA 1WZLA 1CXLA 1AVAA 1RP8A 1CIUA 2YDRA 4GO8A 4PMYA 3CUGA 4N42A 4RE4A 1CEOA 2E4TA 4AXNA 5A95A 1VB9A 5EMYA 4ZENA 2OWCA 3W38A 2Y8VA 1CTNA 3AXXA 3MMDA 3PZUA 1OT2A 4PRWA 1UR4A 3WD4A 4MJ2A 1BTCA 1Q6CA 4W7VA 3IANA 2EBNA 1E9LA 4JCMA 5LYRA 4LYQA 1EOMA 4AD0A 4CCDA 1WPCA 4TVUA 2OLHA 1WP6A 1U33A 4HZ6A 5E70A 1LQ0A 4LGXA 1L8NA 4AMCA 2OWXA 4AZBA 2Z1SA 3ZT5A 4BF7A 3W37A 1W9BM 2G4FA 2F61A 1E5NA 1E40A 1JZ7A 1XH1A 5A6BA 1C8QA 4CD4A 4QP0A 3VX0A 1TCMA 1TA3A 2RGLA 1V6WA 2YL9A 1M53A 5D9MA 3MANA 4GI8A 5A6KA 3VTRA 1LL6A 3M7SA 2D3LA 3K1DA 5CJ5A 4DWSA 3CZKA 1V0KA 1E4MM 4GZEA 1XYZA 3F4VA 1BVNP 3SCOA 4P8XA 4ACYA 1GONA 3MUY1 5A6MA 3WQ8A 4DUWA 4JIEA 1R85A 1UR0A 1HT6A 1MVYA 1OM0A 3QGVA 1NM9A 4AY1A 2XJ7A 3JUGA 1UWRA 4J27A 3KEHA 1EXPA 3SUVA 1C91A 4UFMA 1UD6A 1US3A 1NP2A 4QFUA 1J0YA 1DTUA 2YA0A 3GXMA 3CUFA 1HJUA 4NRSA 3VGEA 3WH5A 1I75A 3FW6A 2VNCA 1C92A 3WEZA 1EGZA 3BC9A 3WKZA 4CD8A 4LQ1A 3RM9A 1ZL1A 4WKHA 2CPUA 5D9OA 3WDHA 5I78A 5BROA 3WSUA 2WMIB 3VM5A 1UH3A 4ZFMA 1E0WA 4JL2A 1ZBWA 4XZWA 5I77A 2YL8A 2D0FA 3DHPA 2UY4A 1MWOA 1VEMA 4M29A 4F9JA 1QNOA 1BHGA 4Z2GA 2J4GA 2A3HA 3QHMA 3NSNA 4AISA 1WKYA 3MUZ1 3W24A 3UG5A 4PMNA 1A3HA 1J0KA 3B9AA 3POHA 2DIEA 1UKPA 2YDSA 3AOFA 1QI4A 5BXRA 3SCQA 1EDTA 1KBBA 2VURA 3IAQA 5KZ6A 1SFSA 4JCLA 4XB3A 1WDQA 4M81A 1QHPA 2CESA 1E6XM 3S6TA 3AICA 5CGMA 4LYRA 3VIKA 1JYNA 2WVUA 1HJXA 3VIOA 4W8LA 1WDPA 4F66A 3SUWA 3AHTA 1GOQA 3RO8A 3DYMA 2XIBA 3W81A 1N82A 4TVCA 3IJ7A 3EMZA 3K8LA 1WB0A 2VR5A 2E0PA 1B3WA 1NWUA 3GM8A 2DEPA 1UR8A 5ABGA 2CERA 3VDAA 2DSVA 3SCNA 2OYLA 3WQ4A 3VDBA 3K8KA 4JL1A 1BQCA 1UKQA 2J75A 4D1IA 5E6YA 1E6PA 2PWEA 3GNRA 5C8BB 3UEQA 1QHOA 3VIJA 1ISZA 1CXFA 3TTQA 5CSYA 1JG9A 4M82A 4AD4A 4XV0A 1DEDA 1ZB5A 3NDZA 3OB8A 2W66A 1M04A 1VIWA 2JEPA 1I1XA 3W27A 5IXEA 1MXGA 3NSXA 2ZXQA 1UZ1A 3K4DA 3L4YA 4UQ9A 4P7LA 3D3AA 4CCCA 1QHZA 1NWTA 4AIOA 2ZOXA 2VC9A 1P6WA 4UTFA 4HPHA 1E73M 1VFMA 3W29A 1HX0A 3ZJ8A 1EIBA 2XWDA 3ZO9A 2JEQA 3E1F1 3AHYA 3QHNA 4ATDA 3CBWA 1GUVA 3NIYA 1EH9A 2QF8A 3CUIA 3T2OA 3W6LA 4B9YA 3APGA 1Q6GA 4D6FA 4OZOA 3WBAA 1VRXA 4AC1X 1DWJM 3BXWA 3AFBA 4C7GA 3U7BA 1XRVA 2VQTA 3II1A 1EA9C 2NT1A 3GZAA 4F8XA 5M03A 3RJYA 3BAKA 1G5AA 5HPOA 4U33A 2PI6A 2Y8KA 4TOQA 1H2JA 3OZOA 1DP0A 1DWIM 2CXGA 4HA3A 1UKOA 3W53A 1GOKA 3VMNA 4IUGA 1CYGA 2WVSA 5E9AA 1LWJA 3BLPX 2UY3A 2V3GA 1LG1A 3AIVA 2ZWZA 2AAAA 3M46A 3OLEA 4OUEA 2W63A 3WH8A 3I3BA 3WNNA 2XIIA 1GVIA 2WHJA 3KE0A 4MNJA 3AIUA 2JIWA 5JBEA 4D6HA 4AZGA 1OT1A 2A3AA 1PEZA 3WEMA 2YKKA 3MS8A 4H8UA 3EYPA 4Z2JA 1B31A 3WN6A 3L4TA 3GDBA 4C7DA 1ESWA 4TX8A 5CZKA 3O2LA 5TD4A 4UR9A 2GDUA 2J7DA 2VCAA 1E72M 2CBIA 1HJWA 5ABHA 2OSXA 1JD9A 1D2KA 4IPLA 4KRUA 1XGZA 2PBGA 5DFAA 3WBEA 1K9EA 3VUPA 1BAGA 3ECQA 2GJRA 3CZGA 4PMDA 2VX7A 5AC4A 4JFTA 1C8XA 3BSGA 2W92A 3FHAA 2YL5A 4AD3A 1JFHA 2BHZA 1CECA 3ZT7A 3L2LA 2PBOA 2D24A 2CKRA 2YLLA 1OIFA 2VOTA 4HMEA 2IUZA 1QOXA 2W5FA 1CXHA 1NWSA 1UD4A 2VRKA 2J8GA 3SCVA 4MB3A 2C0HA 1ZBCA 2Y5EA 3VINA 3WY1A 3OGSA 4WKFA 4HZ8A 2A3EA 2ZUUA 3CH9A 1CDGA 3VKKA 4W86A 1JXJA 1V03A 3CHDA 2WMKA 1J01A 3ALFA 1C93A 3GH4A 1JZ6A 3F5KA 1W1YA 3CZ8A 2VVNA 2UY2A 1XD1A 2G3JA 1E6SM 1OB0A 3RM4A 3WUGA 3N18A 3K46A 1GQJA 2GK1B 4GQRA 5GQBA 2GFTA 4GO9A 2WZHA 4PMXA 4DUVA 4AD5A 1C7SA 5A8MA 4J3SA 3VD4A 2YJQA 2BV9A 4PCSA 2ZXDA 3ZJ7A 4PUDA 3OIHA 1CZ1A 4J7RA 1OINA 1SYTA 2JF6A 1Q6DA 2IXVA 1XC6A 4NSBA 1A47A 4GXPA 5IDIA 3FNDA 2EJ1A 1HL9A 1UH2A 3EMCA 1TE1A 3BCFA 2WSPA 4MAZA 1UUQA 2AOSA 3WH9A 1PX4A 2XGBA 3TTSA 2XVKA 3S2CA 2ZUWA 2X0YA 1FHLA 3O6AA 3WD1A 2FHFA 4TVDA 3VPLA 4RE2A 2W67A 2DT3A 4AZIA 4AZ5A 2J7GA 2UY5A 2XHYA 2WVVA 1G0CA 1UR2A 2VMFA 1NOFA 2X2YA 1TA3B 1E0VA 4MADA 1E4NA 3SCRA 4TTGA 3WQ6A 1ZBKA 1FH7A 1UD8A 2VX6A 4QLJA 4DWSB 2CBUA 5D4YA 2PB1A 1CNVA 5CG0A 1BSIA 1PBGA 4JFWA 4X0VA 2FH6A 1M03A 5E0FA 4DUXA 5I24A 2WMGA 1V0NA 1XSIA 3ZOAA 4S3KA 3B9EA 4QAWA 1DWHM 1ZJBA 4P7QA 3HN3A 1TUXA 3WF3A 1UZ4A 4XUYA 3RMEA 4B3KA 1UWSA 3AISA 5A6BD 2QMJA 2UWFA 5A6JA 3OG2A 4DWSC 1SMDA 1J0JA 4HTYA 3N12A 4KRTA 1ZS2A 4TX6A 4ATWA 3MUIA 4JKMA 2F2HA 4MAVA 4W5ZA 2XFFA 1TR1A 1PIGA 1US2A 1R7OA 1W1VA 2WLYA 4DWSD 3TOPA 2Z1KA 4D6EA 5JIWA 1JZ4A 4UFJA 3WQWA 1IV8A 2XSBA 5C70A 1E56A 4Z2IA 4W89A 1MYRA 4EE9A 4D6JA 5M3WA 4WIWA 1UWTA 3AYSA 1R86A 3AIRA 2ZIDA 2ZE0A 1F4AA 1JDCA 3VO0A 3T0BA 1TMQA 2ESCA 1PPIA 1NH6A 2V3EA 3AHXA 5CPSA 1OGBA 1K6AA 3WF2A 5A6AA 1VEPA 1NWRA 4CUCA 1GHRA 1B1YA 1E43A 1UD2A 4UNIA 3FAWA 3W26A 2VZVA 2JF7A 3RILA 4MDPA 2ZX9A 1HJSA 1QBAA 1KGXA 3VD3A 4WKAA 1Z32X 2BY2A 3UR8A 4BQ4A 1WZAA 4RL3A 5I0DA 4CN6A 3ZT6A 2EQDA 1RP9A 2ZICA 4QLLA 4U5IA 2G41A 5FL0A 4UOQA 3AIEA 3CTTA 5A94A 3WENA 1OD8A 4GQQA 3AJ7A 1FFQA 2XTKA 1UR1A 3QOMA 3VDHA 4OKDA 3OLGA 4CU7A 3VIHA 2DIJA 2EEXA 1QBBA 1RD6A 1UKSA 3AIWA 4M8UA 3DC0A 4OBRA 3I3DA 1E6RA 4V28A 3THDA 3TTYA 2WSKA 3SIMA 4AD2A 4W85A 3RDKA 1GNXA 1XSKA 4J28A 1WO2A 4U3CA 4CU6A 3RM8A 3GXIA 4A3YA 1LF1A 2X0HA 1BVZA 4B3LA 3WH7A 3MSDA 1AMYA 3AROA 3AI0A 1BF2A 2Y2WA 2GVYA 3BAIA 3L4UA 4JZ5A 1JYVA 5CXPA 1PZ3A 2W61A 1QI5A 5A1AA 3L4VA 4TXEA 1KFWA 4LX4A 3GTNA 3AS3A 1VFFA 2BNJA 1QI2A 1VENA 2XSAA 3ZSSA 4S3JA 1JNEA 1GQKA 4OOZA 1FA2A 4ZE4A 1SMAA 3WF1A 1BPLB 5HPCA 1G9HA 2WK2A 3OGVA 3WEOA 3NDYA 1V6UA 4ZXOA 1OCQA 4MB5A 4D6DA 1HJVA 1X1NA 4FMVA 4JHZA 5D9PA 3VIMA 3EDJA 4D1JA 6TAAA 3WMBA 2AMGA 2FHBA 5CSUA 1LL4A 1UD3A 3N04A 1TVNA 1QNPA 2QPSA 3ZR5A 3UETA 2C7FA 5A2CA 1ITXA 3WD0A 4PMVA 2X05A 4Y7EA 3VGHA 1GJWA 5A3HA 1AQHA 4JFSA 2EPNA 2XPKA 3ARRA 1QPKA 1YHTA 1GW1A 2D1ZA 3WUEA 5HOSA 5I23A 4LYPA 4R27A 3VIGA 4OJYA 2WMFA 5DF0A 1KB3A 2O9PA 2XWEA 3MU7A 5ABFB 1V3MA 2WZIA 1W3KA 2J47A 1JZ2A 3PZ9A 3HU7A 2VI0A 3WDRA 3WFLA 1CWYA 3W82A 4YN5A 7CGTA 3J7HA 5ECUA 2ZX7A 2PWFA 1MW0A 1XH2A 1BFNA 1DWFM 1E1EA 1LJYA 1ZBVA 3U5UA 2DDXA 2GUYA 1DWAM 2EPKX 3FXYA 4MPKA 2ZWYA 1H41A 1CGTA 1FP9A 3NUKA 3WD2A 1JI2A 3WDPP 3WELA 4P7NA 1E3ZA 1FP8A 4NRRA 3VOCA 2VTFA 4MTVA 3KZSA 1UR9A 2DT2A 1E1FA 1KQZA 3L2MA 3PN8A 3W28A 2WNWA 1H5VA 2WAGA 3OLDA 4ATLA 2WMJA 3SCWA 2CITA 1GQIA 3WQVA 5E09A 2J7FA 4H8HA 3AS2A 5DT5A 4IPNB 3U5YA 3EDKA 1IZKA 1QW8A 3VNYA 1KR0A 2WM0A 2NT0A 2ZXAA 1G94A 1EQPA 4FLSA 2BVYA 4HP5A 4XX6A 1HVXA 4CD5A 1JNDA 1BG4A 9CGTA 1CXKA 1K9FA 2WW5A 3FN9A 1JZ8A 1JXKA 1V08A 3A4XA 3CPUA 5DO8A 4W8BA 1EDGA 2RGMA 3WUFA 3W6MA 3ZQ9A 1GOIA 3VM7A 1UKTA 3MMWA 1H0GA 3ARYA 3WL1A 1HVQA 1W2VA 1K9DA 1F4HA 2J78A 2VZTA 1BG9A 2E9MA 4H04A 2ZUMA 1JF6A 1BYDA 2ZUVA 4W88A 5M5DA 1V02A 2WANA 2J7BA 2WC3A 4L4OA 1TVPA 3BSHA 4HA1A 2QV4A 2PWGA 2YDQA 2YBTA 4PSPA 2VZUA 5A8PA 2XFYA 3AMGA 3TTOA 4HMDA 2CBJA 1CXEA 1XD0A 1JDDA 3MSGA 4UZUA 3OZPA 1JL8A 4UQCA 3SCUA 3ZSTA 5BRQA 3ZM8A 1VAHA 3ALGA 3IJ8A 3ARXA 4FLRA 1V3JA 2DPEA 2VRQA 5FIPA 1CENA 3CZLA 2D2OA 2XFRA 1XH0A 6CGTA 3CUHA 5M17A 3BAXA 3L4ZA 1HKKA 3VGFA 2X09A 5I5RA 4E8DA 1MQRA 1E71M 3A3HA 2V5CA 4PMQA 3GXFA 3AHVA 1QNSA 2PWDA 1GOOA 5BWFA 3EDEA 5DT7A 2VUYA 4P7RA 2A3CA 2CBVA 2V5DA 1E15A 4B15A 4HU8A 3EDDA 4IM4A 1WDRA 5A2AA 3NCOA 3W4RA 3GH7A 2W62A 3SCTA 4J3TA 7TAAA 2VVSA 2XM1A 1W1TA 3IK2A 4AIUA 2YA2A 5FD0A 2WYSA 1V6YA 4WK9A 2GJXA 2BXZA 1HL8A 3AZTA 1YQ2A 4CN4A 4LXFA 4JFVA 1XHGA 3CZJA 3SUUA 3WNMA 3PZGA 1ISXA 3VMPA 1KXTA 4UFHA 1E5JA 1GQLA 4MNLA 3DHUA 3QR3A 1C8YA 2DT0A 1XYFA 3KL3A 1J0HA 2YL6A 3DYOA 3GH5A 1CLVA 1D3CA 3WNLA 3FY1A 1KQYA 2G3MA 2VQUA 3BAYA 1XCWA 1M01A 2WKGA 2YOCA 4BQ2A 1B30A 2PWHA 4X9YA 4BS0A 2OSWA 4B16A 1VJZA 5GNXA 4PTVA 2CNCA 3UERA 4AWEA 2D0HA 5JUVA 4CVWA 2BS9A 4RE3A 2DH3A 2ZX8A 3N11A 3VD7A 1U30A 4J3XA 3N1AA 1V3LA 5AYBA 1JF5A 2WPGA 4NZCA 3LPFA 1WZKA 3OA5A 2VX5A 4OOUA 5CLTA 4MNMA 4CD6A 4UFLA 3TA9A 4UOZA 4H8VA 2BY0A 1O6IA 1W32A 4ML4A 3PTKA 2V3FA 4Q7NA 3U57A 4MDOA 3SCSA 5BXTA 4HA4A 1HP4A 1J9YA 1VF8A 3GBEA 1E6QM 3ARTA 4U2YA 1W9VA 1UOKA 4Q22A 2WB5A 1H1NA 1PX8A 1W9PA 2V38A 3ZIZA 1CPUA
chains in the Genus database with same CATH superfamily
2I7GA 2OSYA 3ITGA 3M0VA 2J24A 5IOBA 2D20A 2GGJA 5H8PA 2PLCA 4HN8A 3VGBA 1QDSA 5F1VA 5G1YA 1TB3A 4RV3A 2R6OA 2TRSA 5BRPA 1NARA 1O68A 3BAWA 1NELA 3PHAA 4MWAA 4NZ1A 4FF5A 3RRAA 3KCJA 4LBRA 4GY1A 4Y9MA 4XSMA 4L9ZA 3TQKA 2QPUA 3BH4A 3HGOA 4U10A 1KXVA 3N9KA 4G1KA 4GVHA 2WM1A 3LMZA 3A23A 2WKLA 4LB3A 3I3EA 1OX4B 2PLKA 2P8BA 4INFA 1YNPA 3T44A 1D3HA 3HFTA 3RU6A 3G6MA 3SFKA 1BGGA 1FX6A 1R3VA 1H09A 2GQ8A 3MYPA 1WNOA 4JKKA 4YVVA 4YJ5A 3UPMA 4C1NA 3IK4A 3K8MA 5AC6A 2DORA 1XV8A 1D3GA 4ERGA 3FAXA 1D7FA 1FUYA 2P5NA 1V6XA 2PU1A 2XVPA 2V68A 1ISYA 3VKCA 1MNSA 4GC4A 2ABBA 3AMKA 4BY3A 2F9RA 3GZ3A 1S2VA 3G1HA 3NPUA 1UWQA 3THCA 1EC7A 1NQKA 5HINA 3WQ5A 3GVRA 4DXVA 3A47A 1XLIA 2JIEA 3GE7A 5BMWA 1TJ0A 4PBFA 2GDVA 1PS9A 1OY0A 1CLXA 3WNOA 5JH2A 1KW1A 5XIAA 4Q6XA 3FV9A 2BY3A 1JAKA 1OADA 1MW1A 4FXRA 3CMGA 2PCQA 5CSRA 4GXWA 1HIZA 2W27A 1JZ3A 4DM2A 4LPCA 4S39A 5C71A 3U7VA 1CGYA 4E4PA 5LA2A 2PDYA 3CIVA 4WSHA 4EWND 1HKMA 2QDDA 4GXMA 5A2BA 1KTBA 1WCGA 4BHYA 3GHTA 3MKCA 2WQPA 5HNUA 3H4XA 3PJXA 3GTXA 1MZRA 2GJPA 2WCAA 5DY3A 4J3WA 2D3NA 4OQVA 2VEGA 3SECA 2OWWA 1MEWA 2YW4A 1W1ZA 1K8ZA 4NXSA 3CC1A 1UOZA 3T0AA 4LANA 1PCKA 1ISWA 5DLCA 2JBMA 4GG9A 1IXPA 5E9XA 3HB9A 1KM4A 3N17A 3KW3A 3W7PA 4O4VA 4Z2LA 4L4PA 4K8EA 4FNUA 4IG2B 3FVMA 5KITA 3W72A 4CGTA 2GJNA 3KOZA 3DFPA 4CCEA 1QMLA 1VEOA 3WUBA 1Q66A 1UHVA 3STGA 4UTTC 4IPPA 2G8ZA 1O1HA 4E3VA 1ICSA 2ZBTA 2JKAA 3A13A 4H1ZA 1PKNA 1J12A 1IGSA 3C3NA 1PDYA 1JRBA 2XFWA 3QY8A 3BQ6A 1JJKA 3ZJ6A 4QLKA 5JQ9A 3CLWA 3L68A 3GYEA 1MFVA 3K5XA 3H2AA 3LLDA 1Q63A 3TQPA 1W9XA 4XK2A 4W87A 1JIBA 1C7TA 2IXUA 1LLZA 3QC0A 1FWHC 4F3HA 2ZZ1A 1EHAA 2NQ9A 3GTIA 4PBGA 3GVQA 1HXJA 3BOFA 4P7OA 1AW5A 3GDKA 3GDMA 4AVFA 1FWAC 3NXLA 2QS8A 1TJRA 5FOOA 2DT1A 2A3BA 5I3JA 2YX0A 2VCCA 4XZ9A 1F9CA 4WXZA 3WLKX 5A8NA 1XYBA 3M9YA 4O54A 5K9CA 5G4EA 2QUUA 2CIPA 2D23A 2W91A 4E5TA 4IXXA 3BQ5A 3D5HA 4URIA 1S5VA 4D6GA 5AY7A 1CCWB 4ZO9A 3HPFA 4JTGA 3IIPA 2PAJA 2MANA 2B31A 1GZJA 4G8TA 1A53A 3TNOA 4KERA 1ODUA 1W9UA 2XH4A 1BWLA 5HXMA 1Q6FA 3CHFA 2XISA 5CAKA 3MV11 1KWKA 1DL3A 1TPEA 1YADA 5DQPA 4XKYB 2E8YA 2VL4A 3VNMA 3W1UA 2DY3A 4PMRA 1AH4A 3VZXA 1XYMA 1KWGA 4D6CA 4GI6A 4C90A 4LEFA 4MY8A 2PWUA 4DRSA 4WVXA 2FVKA 2VELA 1RPKA 1S39A 3AJXA 4XD5A 3UR5A 2OPJA 3S6OA 1JGIA 1HGWA 1OIMA 2GJXB 4NXKA 3SB0A 2GUUA 1W9DM 2VFHA 2QDHA 3VDCA 1YEYA 1OC6A 4RZ6A 4CEXC 2XH2A 3GK0A 3SEPA 3K1GA 1NF7A 1V4YA 4PZVA 4C5ZA 1F6YA 3G24A 2POTA 1Z42A 1H49A 3S4TA 3RIKA 3TX9A 3W07A 1W3LA 4ZXLA 1B9ZA 2PC8A 5H2ZA 4BA0A 3T09A 1H3GA 4XD6A 2QQ6A 3RPDA 3N4AA 1XUZA 3MCMA 1S46A 4JFUA 1V8EA 2JALA 3GAKA 3N15A 3V36A 1Y65A 1GG1A 4HZMA 5I6SA 3VU2A 5GPRA 2CLLA 3MBDA 1ITQA 4KFNA 4S1FA 3LPOA 1THFD 3NQDA 3F5LA 1IT0A 1UJQA 5CBIA 2WCSA 1SJCA 4GCAA 3VMOA 4LYKA 1PWLA 3H53A 4WX2A 5FCZA 5IFTA 4EXAA 3ZJKA 4A2RA 4O12A 3EMQA 5T26A 1JGMA 4IMDA 3EEGA 2YLAA 1E1CB 4ERAA 1KD0A 2EPOA 1SSDA 2WVVB 3AHZA 4V2XA 4WSKA 3MDWA 2A21A 1N8WA 2VT0A 4QG9A 2QMKA 1J10A 3LS9A 4UQEA 2OXNA 1M7OA 4WLCA 5CPTA 1ZJIA 2A79A 4OIFA 4AIEA 4NYYA 1FWSA 2YXGA 5LHFA 1Q8AA 5A5WA 3KL5A 1NOUA 1WBJA 3B04A 3JW7A 4PEEA 1TR9A 4D8LA 3S5YA 2JKPA 1XCXA 4N4PA 1CGVA 2YIHA 1NDZA 4YHGA 4DWDA 4GH1A 3DOPA 1LBLA 4MWAC 4ACZB 1TSIA 1J18A 1R46A 4RNFA 1ZUAX 3HGSA 1RD5A 2HV5A 4S3EA 1OABA 4JY9A 2ONEA 2RFGA 1UCWA 3ZVHB 7REQA 4DBDA 4L80A 2F8QA 1B3OA 1I45A 4R5EA 1BWKA 3B05A 5IHRA 3OLIA 5GNZA 3UCQA 2XVLA 2WVTA 2KX9A 5H6HA 4Z1CA 4QCEA 2I5QA 5HWJA 3F5JA 3UG4A 3EBVA 4WDTA 4UQBA 4KWUA 2Q8XA 5A6LA 1UWUA 1M9HA 5C9WA 4JKLA 2C3ZA 5AVHA 4AZCB 4C6DA 4Q8VA 1YBQA 2C0AA 2VUNA 4R34A 5CGTA 3H7VA 1TTQA 4NQ1A 3UZYA 3MV01 1YX1A 3CZEA 3BLFA 1ONWA 4H41A 4LUIA 3HFYA 1K7FA 2PLJA 5LNUA 1ZCCA 4GO8A 4TMBA 4A3RA 3B0YA 3FYOA 1A5AA 2VFFA 4XAFA 2OWCA 2UV8G 4RDYA 1OC7A 3H2CA 1TZ9A 4MGGA 2NZLA 1Q6CA 3C2FA 4H6EA 5TIMA 4Y8FA 2EBNA 1E9LA 2INFA 3DERA 1UPMB 3TMQA 2OEJA 3T05A 3M0MA 1U33A 1RHCA 3DI1A 2ISWA 3C3UA 2TMDA 4GLEA 6ALDA 2B7PA 3S9ZA 5HWNA 2Y1HA 4QE5A 1W31A 1JZ7A 2RUSA 4QP0A 3VX0A 3W1XA 4XWUA 1M53A 1GTEA 3M0XA 2OG9A 4UBPC 3GUGA 1XLEA 4NNBA 2NSOA 5CJ5A 4H6RA 4DWSA 3FXGA 3KXQA 1E4MM 1SPQA 1XYZA 3GU9A 3S1GA 3WCZA 3SCOA 4P8XA 3MUY1 5A6MA 4HBKA 5B7YA 4O8RA 4ZOEA 1EC9A 3ABXA 4EP8C 1ONEA 2E6AA 4AY1A 1NM9A 4ZO6A 2BMBA 1F3TA 4LAKA 1ONXA 4CQBA 4ORIA 4J27A 4JEJA 1EXPA 4NI8A 1EP1A 1QPNA 3RNDA 2PDNA 4S3GA 4RX0A 3CUFA 4XD3A 4NRSA 3WH5A 2NWRA 1GEQA 2GVGA 2QULA 3DG7A 5EYWA 3PB0A 4WKHA 2CPUA 3WDHA 3EKLA 5BROA 2WMIB 3G0XA 2INEA 2Z6JA 2OO6A 2FJKA 1ZBWA 1B9BA 4FA3A 4K1GA 2V82A 5I77A 3QKEA 4EPEC 2YL8A 1MUWA 2D0FA 3N9SA 1SFLA 4F9JA 1KV8A 1JULA 2PRMA 4GISA 4Z2GA 4RJEA 2J4GA 5TAOA 2Y70A 2QT3A 3P81A 4S23A 4PMNA 4I9JA 3B9AA 4LH8A 4D8AA 2YDSA 2VGFA 1QI4A 2VXNA 3H2EA 4WJEA 8XIAA 5K4XA 2VURA 4NZ5A 1UZDA 3V16A 3WK3A 1SFSA 2OQYA 5I3KA 3LHVA 1IXQA 3EPOA 3RMJA 2EHHA 3S6TA 3AICA 3RX2A 4LYRA 5CGMA 3W02A 5CPOA 5HMSA 3V3WA 3SUWA 1BRLB 3S8HA 3DYMA 4CNOA 3EB4A 1WB0A 2BZNA 2E0PA 1F8MA 5DXXA 5T9CE 1B3WA 3UXIA 3VDAA 2OYLA 2OT0A 1LT7A 1RA5A 3WQ4A 5AHEA 1XIEA 4C1LA 1XKJA 2PWEA 4MLJA 2PTYA 3VIJA 1ISZA 3OJGA 3G1FA 3B3DA 5CSYA 4NZFA 4A3UA 2I5IA 3T07A 4GGBA 3MSRA 4D2JA 1TO3A 1ZB5A 2BGQA 5JXQA 2WO5A 3NAVA 3W86A 3OB8A 4N9EA 2V8ZA 1I1XA 4QNEA 5HMEA 5IXEA 1MXGA 3NURA 1A0EA 1UZ1A 3L4YA 2XN2A 2I14A 4C1KA 3D3AA 4CCCA 3I65A 3ONCA 1HGYA 4LV9A 2ISDA 1FWBC 3KHJA 4UTFA 2V9DA 3O6DA 5I07A 2C19A 3ZJ8A 1KBLA 3CYJA 3AHYA 3FSUA 3HURA 3TMLA 2P53A 1VLWA 3E74A 1O1ZA 4XAPA 3R10A 3CBWA 3W2NA 4B5VA 4CQAA 2PWVA 1EH9A 2E6FA 3T2OA 3M5XA 3SIZA 4MVAA 2VHLA 1Q7MA 1RVGA 4D6FA 1VRXA 1T6MA 3BXWA 3W70A 1ME7A 1XDLA 1YNYA 4C7GA 3U7BA 4ADUA 4LF2A 1XIDA 4O11A 4GA8A 2G95A 4GJJA 4ENLA 4F2TA 3W7MA 1G5AA 4U33A 5JU6A 4TOQA 1H2JA 5EPDA 1DWIM 2VC6A 3FA4A 5D37A 2HBVA 2UBPC 1E9YB 3N3MA 1LG1A 3AIVA 4X9SA 1LOLA 3OLEA 2W63A 3WH8A 3B06A 2XIIA 3IUDA 1GVIA 2C71A 2WHJA 3R0UA 3MO7A 1LYXA 4HNVA 1D8CA 1BVWA 2FPYA 5JBEA 5CZTA 3W88A 2DZSA 3EYPA 1W3NA 3SY8A 5AYXA 4B92A 4TX8A 5CZKA 4EF9A 2R1MA 1TWDA 2J7DA 2C18A 3WQPA 1D2KA 1PSCA 3NL2A 4MOZA 4IPLA 5LGXA 5DFAA 3ELFA 1OCJA 4H9ZA 4XKYA 4ZQNA 3BGJA 1Z44A 3VE9A 3ECQA 4JHMA 3B8WA 1V5XA 3KHDA 4O1FA 3UJSA 3W7JA 4FHAA 5G1TA 3BLIA 1RBAA 4H6KA 4AD3A 1Q45A 1JFHA 1YPXA 4Q8OA 1CECA 3IACA 3RF9A 3KVMA 3S6DA 3L2LA 4US5A 2YZ5A 3DFTA 2ALRA 3CWOX 3BPWA 4WJ8A 2YLLA 1GYNA 3LSBA 4FOJA 2PGEA 2VOTA 1QOXA 4NJIA 1UD4A 4J5NA 3BL3A 3LTYA 1LM1A 3KZPA 5AYZA 4Q8PA 4HZ8A 2A3EA 1CDGA 3TJIA 3ZVIA 3L0GA 4PL1A 3VKKA 4W86A 3ITOA 1V03A 3T7VA 1KFCA 3LYEA 2G5WA 4S2CA 2VVNA 4PH6A 4HU3A 2UY2A 3L2IA 1SZFA 3RRXA 2Q8LA 3WBXA 1JPIA 3RM4A 4N7QA 2E28A 3BLDA 3ME3A 2GK1B 2HPMA 3UY7A 4PMXA 1EUAA 1EEXA 3E5PA 4JGDA 4JTJA 5A8MA 3VNJA 2YJQA 3LLFA 4AUBA 3TIMA 3CQIA 4HSNA 3OIHA 1CZ1A 3R79A 1OINA 1SYTA 4FXFA 4P61A 1XC6A 4GXPA 3FNDA 1HL9A 3PBVA 2Z2AA 4DF0A 3VABA 2MUCA 4NJGA 3NFUA 3ES7A 4JPGA 1JUKA 4OV9A 4GE8A 3VKJA 1FHLA 1RZMA 3G22A 2OQLA 3E2VA 3AWOA 2NX3A 4AZIA 1L9WA 2J7GA 4W9TA 3TZNA 2XHYA 2WVVA 1UR2A 3W7HA 2VMFA 5EMJA 3T81A 3SCRA 1IEQA 4HJFA 1R38A 3WQ6A 2PFHA 1ZBKA 3UA4A 3UZWA 4ZO8A 1FCVA 2CBUA 4XBSA 3NG3A 2OGJA 1BSIA 1KA9F 4Q33A 3N25A 4X0VA 3PG9A 3MZNA 5E0FA 4DUXA 4GK8A 5I24A 1XSIA 1DJIA 1H60A 3GQYA 4N2YA 2HMCA 4S3KA 4US6A 3CXOA 1ZJBA 3LU2A 3HN3A 2OEKA 4XUYA 3RMEA 3CLMA 4B3KA 3LTSA 5BOEA 1UWSA 1TTIA 2Q71A 3AISA 2QMJA 2UWFA 5A6JA 3OG2A 4DWSC 3IUIA 3CTLA 4JTAA 5HJXA 4IZGA 4C6CA 1J0JA 1R9ZA 4OGZA 1DQXA 3EXRA 2PRHA 1ZS2A 4ATWA 3MUIA 3O3RA 3C5QA 4MAVA 1IEVA 2Z1KA 4D6EA 3E2QA 2A7NA 2WPBA 3G5EA 2XSBA 1E56A 4Z2IA 4YTQA 4GVGA 1MYRA 1ADOA 4EE9A 4XG1A 4WIWA 4DXXA 4M5PA 1FDYA 1JDCA 3VO0A 3T0BA 3EKGA 4JQ4A 5HNTA 1PPIA 4UMBA 2FKPA 3BJTA 4KT2A 2HS6A 4UTWC 2PA6A 3C52A 2R1KA 3WF2A 3IGUA 1NWRA 3H6OA 4CUCA 6ENLA 2QCFA 3ABQA 3TCSA 4HSHA 2JF7A 1R30A 1LZOA 4KCWA 1HJSA 4N02A 1KGXA 4ZOBA 4WDXA 4NVTA 3QTPA 4AG0A 3UR8A 3R8HA 4BQ4A 5I0DA 4CN6A 3ABSA 1RP9A 3MJMA 1G4PA 4I7WA 4Z0SA 2G41A 5FL0A 1DXFA 4LTSA 3DFNA 3VNKA 4DIAA 2RHGA 1XIMA 3MCOA 4C6KA 4V15A 2PDCA 3RK8A 3R58A 4GX8A 2GGEA 1QBBA 2V30A 3AIWA 4M8UA 2ZA2A 5XINA 1OC5A 5FJTA 4PB4A 1IE7C 1FWCC 3PUOA 1ZSXA 4I7UA 3TJXA 5DBTA 2YFNA 1ZZMA 4U3CA 5CC7A 3RM8A 4M7SA 1LF1A 5I3HA 4B3LA 3SJNA 1A5BA 1KM3A 1U5VA 3TE9A 1AMYA 3CPGA 1ALDA 1PO9A 3BAIA 4HIBA 1EKOA 2HXTA 4DO4A 2Y7FA 5C9ZA 3U48A 4DLMA 4EAYA 1KFWA 1SJAA 3GTNA 2BNJA 5TF0A 4R7WA 4QGCA 2QJHA 2QNEA 3I6EA 3KLLA 3TLQA 1GQKA 3VFLA 3WF1A 1BPLB 3UYIA 5HPCA 1G9HA 3UZ5A 2EKCA 3OGVA 3WEOA 1F07A 4ECLA 3LCGA 4ZXOA 4C6FA 4D6DA 5LNRA 1HJVA 2YR1A 1FWRA 1OFAA 3ICJA 1A50A 3EDJA 3RUBL 2OLSA 2XN0A 5CSUA 1V93A 1KFEA 2QCHA 3TW7A 3PTDA 2QPSA 1ZJHA 4O1BA 1QR7A 3TJ4A 3NVDA 1UUOA 5A2CA 1ITXA 2Z00A 3QKZA 4PMVA 3WG6A 4GYPA 4Y7EA 3VGHA 4XAGA 1GJWA 4OWGA 1XBXA 1VIZA 4HT3A 3NXFA 3T55A 2OZ0A 2OCZA 3ARRA 5C5YA 3CL6A 1SZGA 4IOTA 4KS0A 3IARA 3VIGA 5FJUA 2QJGA 4OJYA 4RZ5A 1UP0A 3IJLA 3GHUA 2FGBA 2XWEA 3IVSA 5U4NA 3T4WA 3GTFA 1W3KA 3GDLA 4Q3MA 4KWWA 3HU7A 3WDRA 7CGTA 3J7HA 5ECUA 3I68A 2X0SA 1MW0A 4NUWA 4QNWA 1BFNA 1ZBVA 2GUYA 1DWAM 4MPKA 1O5QA 1FP9A 1DQWA 4P7NA 1RLCL 2HNHA 3QZEA 3P60A 4LUSB 4QTGA 1OZQA 4NRRA 1PYFA 2VTFA 8XIMA 1UR9A 3AUJA 1KQZA 3L2MA 5FEPA 3O7UA 2WZTA 5HMFA 3WQVA 4QITA 2J7FA 2Z1VA 3NYZA 4IP4A 2WM0A 5HR6A 2ZXAA 1G94A 2DFAA 4FLSA 3U4AA 2EG8A 3FJNA 3FN9A 5J04A 3B8TA 2YCLA 1DIKA 3LB0A 1QOQA 2V0TA 1V08A 3CPUA 3EGJA 3S83A 1GVFA 1CB2A 3W6MA 4XAZA 4A05A 1GOIA 3URNA 4Q8UA 1ZAHA 5FF0A 3MMWA 4H9MA 1L6WA 4WZHA 2P0IA 2RJHA 1RCXB 1BG9A 1BYDA 1U83A 3MCNA 4IF2A 2HBXA 3TR9A 3NEHA 4Q4OA 2C14A 4L4OA 1TVPA 2A6LA 2IMRA 3BSHA 2PWGA 2YDQA 4JTRA 4IQLA 2E77A 3A21A 5CC3A 4HMDA 3BANA 1TWZA 4UQCA 1JVNA 1N2VA 3ZSTA 3FLUA 2HXUA 4PRTA 3ZM8A 1FRBA 3ALGA 4QEHA 3E12A 4FLRA 4JBRA 2VRQA 1RY8A 5FIPA 3DHFA 5IRPA 2F2KA 4H01A 4IIGA 5I7GA 1ZAIA 3PUGA 4C6NA 5KETA 1RCQA 4X2PA 1W5PA 1YPIA 3A3HA 3M5ZA 4PMQA 2WNQA 3NEVA 1QNSA 5BWFA 5DT7A 4UXDA 1E0UA 3QY7A 1Z48A 2NQJA 2ZZ4A 3QW4B 4LBUA 3NQ7A 3DBNA 4HMNA 4O18A 3HQOA 3VZYA 4KW2A 1PB0A 4J3TA 1LLWA 1FWJC 1XPGA 2VVSA 4PA8A 1O5RA 5EU9A 4IGSA 4AIUA 4XZMX 2PCEA 5FD0A 3FA3A 4R85A 4WK9A 2BXZA 3I4EA 2WNNA 4JN8A 4LXFA 1Z41A 4XZIA 1ITUA 3WNMA 3PZGA 1S2CA 1IEXA 1KXTA 1FXPA 5FI8A 1TKKA 1W17A 1OFPA 2QVNA 4LSBA 4MNLA 4L6HA 2DT0A 1XYFA 4CQDA 1VRDA 3W1MA 1H62A 1TPDA 1QWGA 2YL6A 3WNLA 2QUVA 4GQ0A 3IV8A 1KTNA 2YOCA 3B8VA 1XLJA 2Y7DA 5D2YA 4AWEA 4MKNA 2D0HA 5HANA 3QPYA 4HQVA 2BS9A 2DH3A 3VD7A 3BG9A 1S5MA 4RR4A 3N73A 3N1AA 1V3LA 5AYBA 2ZRVA 2WPGA 2BWGA 3W74A 4K7YA 4IHCA 4ERIA 3S1WA 4OOUA 2ATSA 2AL2A 3W7NA 1I2NA 3KTXA 1EYWA 3TA9A 2BY0A 1O6IA 1Q6LA 4A8NA 1W32A 4ML4A 1A5CA 2Y88A 3SCSA 4IIBA 1HP4A 1VF8A 4RE0A 3PWIA 3ANVA 1H1ZA 1R47A 3NQVA 2BOEX 3C8NA 1Z9AA 4S3FA 5TQLA 2HRWA 4MWAD 2OU4A 4PUUA 2X30A 2AQVA 2OQHA 3ZIZA 1Y5XA 1CPUA 3QEZA 3RPMA 3A4WA 4HCDA 3MMUA 3O07A 4CCZA 3G0UA 3VFCA 2E67A 2VEKA 2HNEA 5E6ZA 3F4WA 5IFPA 3E2RA 2VCBA 3PANA 3R0KA 8CGTA 1BWVA 4EAMA 4M51A 3VD9A 3CEUA 1KKOA 3PZVA 3QRHA 2PTDA 1MQPA 2XH0A 3W9ZA 3BW2A 3CUXA 4Q8NA 4I9MA 3BJSA 4BI6A 3C8FA 5DEZA 3UPWA 3MKKA 4GZJA 4MB4A 3DECA 4Z1AA 3R12A 3P62A 1XXXA 3AIBA 3UR2A 4ADSA 2Z27A 3QLLA 4X63A 3GYCA 3H24A 1CLKA 3NTYA 2Y62A 3ZWSA 3LUTA 4OBSA 1O66A 4DELA 3ATZA 3KBNA 2EAWA 1BYCA 4IPJA 2TAAA 3PZQA 4H6QA 1YTKA 3TA6A 2HJPA 5IHSA 2X8RA 3NWRA 5K7JA 1A4LA 5D2TA 1ISVA 4RXGA 1UPPA 1SW7A 2CZVA 3VI2A 4CU8A 3LXAA 1BQGA 2PDLA 3E5BA 3JS3A 3LA4A 3IJQA 1OK4A 5CLWA 3XISA 1GJUA 3UESA 1PKMA 5G4HC 2J88A 5HQEA 3S2JA 5AC5A 4JTKA 1QO5A 5A8QA 3TYUA 2PDFA 2A5HA 1GVRA 4IQDA 3WQCA 3A22A 3BWWA 1YKWA 3JZUA 1TV5A 5BYWA 4CLMA 4BEUA 1J6OA 3P0WA 5I2UA 3DGRA 1K3UA 2O4MA 1BLIA 1GOWA 4CN1A 3A12A 2QHAA 1V3KA 1CGXA 2DQXA 1LRNA 1OF8A 2GLKA 4YWSA 3VD5A 3LCFA 3FFSA 3CM4A 3KVLA 2J74A 1TPUA 5FJJA 3KUMA 1VPQA 1BEUA 3TAKA 1A5SA 2Y61A 4HJWA 3NJ3A 3PBWA 1VBHA 4KQNA 1B3YA 1NDVA 2W4XA 4TIMA 2OYKA 1WZMA 2R14A 1MXDA 4IMFA 5HBFA 1OZMA 1AQMA 4QRNA 2Z25A 4PUEA 3NPXA 5JBFA 3PZOA 1R3WA 1KR1A 2A6NA 4WXYA 4GYPC 1X39A 1Y5VA 4F79A 1WKDA 3WMCA 4UQDA 1OBAA 4GYJA 4Z17A 4W4QA 3LBOA 4WF7A 3QMRA 2GSJA 1QVBA 2NQHA 4H00A 1R8LA 3AYVA 2E25A 2GUBA 1E6NA 1WBHA 4O19A 3N6HA 2GDQA 8A3HA 2PDHA 3NQEA 2DSZA 3PBYA 4HD5A 1DYSA 4JS3A 4WOZA 3L4XA 4FALA 4OV4A 4W8AA 2WZEA 4HA0A 3DFHA 1LLOA 2F6KA 3DU0A 5HJYA 2ATMA 3EWBX 3PZTA 1H11A 1W5OA 1QATA 1H5YA 1EFZA 5I03A 5K3VA 1L6SA 1B3VA 1VHCA 3MC5A 3N2OA 3N4EA 3AXHA 3WDJA 2A7PA 4QCFA 4NJHA 1B0IA 2DH2A 5CPNA 2ZUTA 2A1YA 4O1CA 3ARZA 1O7AA 3EWZA 3TYEA 1WAWA 2E40A 5I3DA 3KDOA 3U3HA 4LC8A 2J8TA 1EO5A 4L7ZA 2V63A 3L4WA 2Y4SA 1XSJA 1ZHAA 4W7UA 1FCQA 3NM1A 1RQHA 1K77A 4PE8A 2SFPA 4FXSA 4QDMA 2WQDA 4X0NA 3QV7A 1KLYA 1TG7A 2ZCGA 5FKYA 1W1A1 5A8GA 5F7UA 2VX4A 5DBUA 4GI9A 4PMOA 3POCA 4S3DA 2ZVIA 1M68A 2XVGA 4DPPA 5C2CA 4KF1A 1KC7A 2CZEA 4H7VA 4NIRA 2NXGA 3IEBA 4NG3A 5LHEA 3AS1A 1PZ2A 2BB0A 3L5LA 4JIHA 1X98A 3U0HA 4A29A 1DQUA 1TREA 3BLKA 5EFFA 3Q65A 1J0IA 1SM9A 3BW4A 5H8UA 3EOLA 1RSCA 2B81A 5AYYA 5HK4A 1W3TA 4GIAA 4LVAA 1JDAA 3CHCA 4TV5A 5TBOA 3FYYA 2R94A 1ZPTA 3ARPA 4JDBA 4D8ZA 3JZEA 1JPHA 3T2PA 3RXZA 4ZQPA 5I3GA 4KETA 1JYWA 4AWUA 2Y24A 4GUIA 1VFTA 3UCCA 3V0SA 1UA7A 1PAMA 3M47A 4IIFA 3G18A 2ZFAA 4A4AA 3PPHA 1KFJA 1WQ5A 2ZRYA 5BWAA 1X1ZA 3GNOA 5F2LA 1E55A 4R9OA 3S42A 4QQUA 3W22A 1US0A 3BW3A 4NI3A 4HCHA 1EO7A 1U2YA 3OYXA 3TEVA 2V2DA 3ZYZA 1S3TC 1M7PA 1MXSA 2D2HA 2V5JA 5KZEA 2FZBA 4JN7A 2ZZ7A 4ZBCA 2CETA 4J2MA 3GC4A 3QPEA 1NFGA 1NAL1 2W0UA 1SW0A 3A5FA 4WEVX 4UFKA 2D0GA 3TV8A 4TTUA 1BKHA 4XTDA 1Q5MA 3WL0A 2POZA 3CB3A 3OPSA 4C91A 4EXQA 3PSWA 1GQNA 1TV3A 1KM6A 3V5FA 2NVCA 3AALA 3GKAA 3SURA 1LG2A 4V27A 1WX0A 1JFXA 1I2PA 2AKZA 3BMWA 3GG8A 4ROPA 1XCFA 1O12A 2BBFA 5J5RA 2CLEA 3PFMA 3LMYA 3WNKA 3VGGA 4M1RA 3XINA 5KEZA 3FCPA 4MIMA 1TX2A 4WDWA 2CCRA 1Z3NA 4UFIA 4AU0A 3L5AA 1OWQA 4JN6A 4XZBA 2NVDA 4H2HA 3B0VC 4PUNA 4QEEA 3C56A 1Q6EA 1RBLA 1K7XA 5L6UA 3EKZA 2OZTA 1YDVA 3H54A 1WUEA 4EX4A 4PL2A 4BZYA 4L4MA 4DO6A 5LA1A 5FJIA 2DGAA 3BLLA 3SY1A 3KBJA 4HYRA 4KFOA 1N8IA 4ZE5A 2H6RA 2BLEA 4M56A 3KL0A 1XRFA 3T8LA 3GR4A 4MWAB 1VFOA 3GX9A 5E5CA 3W25A 1FWWA 3WO8A 3TR2A 3AYRA 4UCFA 2WLZA 2NUYA 4MMWA 2EPMX 3DEQA 1X6NA 3CIWA 1OGGA 4MZYA 5JBDA 3TROA 1EC8A 2QGYA 2V3DA 1GOMA 1SO6A 5BXPA 1ODZA 3S2NA 1EJXC 2HCVA 4R9XA 3EAUA 2X40A 4P8WA 4YYCA 1BYAA 1S5NA 3CWHA 5FF3A 3ZR6A 4AZ6A 1VBGA 5MKGB 4R3UA 4LUJA 2BXYA 1H51A 4B4FA 1EGMA 3UP8A 3A9IA 4UZSA 4L1XA 5K2ZA 1XM3A 1W3IA 4C1NB 1W3HA 4N0RA 4PSRA 2C91A 5DMLA 1DIDA 2D73A 4O10A 3N3TA 3CV1A 2XIOA 4KH2A 2HVMA 3TWBA 4C7FA 5CBBA 1KGWA 3C0JA 3TXZA 3B9OA 1SR0A 3CS2A 3N13A 1MNZA 1X6UA 3SGGA 3VX1A 2J79A 1W0MA 1FHUA 1QI3A 2A0NA 3BLEA 2QW5A 4ZGYA 3ERPA 4S38A 3Q45A 1Q2RA 2QCGA 4PUKA 5LSMA 2O9RA 3PWGA 2VYOA 1Y5WA 3AXIA 2OX4A 4XBJA 5CPQA 4QXIA 2GVLA 3BMVA 3S1VA 1CXLA 4XIMA 1CIUA 2YDRA 4KCVA 4BI5A 3OVRA 4RE4A 1VB9A 4QBXA 2Y8VA 3A3WA 3AXXA 3GR8A 3PZUA 2NV9A 3LV6A 4PRWA 2ICSA 3WD4A 1EP3A 3SQLA 2ABAA 3NOYA 4W7VA 4EACA 3LERA 3LNPA 3MJYA 1N7KA 4JCMA 5HULA 5LYRA 1TVLA 1EOMA 1WPCA 2G97A 5REQA 2ZRWA 4TVUA 2A2IA 1FY6A 2DZUA 1GW9A 5E70A 1LQ0A 1L8NA 2O7SA 2Y7EA 4BF7A 2F61A 5HMDA 1WUFA 1E40A 1C8QA 3CV7A 4CD4A 1ZCOA 3PPFA 3VKDA 3HJZA 3P80A 1TA3A 2DUZA 1QK2A 2YL9A 3MANA 3THAA 3WQGA 4GI8A 5A6KA 4QE4A 3EOUA 3M7SA 1GVQA 2AMXA 3K1DA 3B97A 3CZKA 3BOXA 2FQIA 1BVNP 1IXNA 4DX3A 4ACYA 3GY1A 4UTMA 1VHNA 4JIEA 4MPQA 1BKSA 1MVYA 2Y63A 3QGVA 3JUGA 7TIMA 3SGUA 4NNAA 5G5IA 3VXGA 4QFUA 1VD6A 2YA0A 1EB3A 3VGEA 3CWNA 1GG0A 1I75A 3FW6A 1BXNA 1YE6A 3NO1A 1ZL1A 5D9OA 1SJDA 2Q8ZA 1TTPA 5I78A 2VWSA 1M65A 3CQKA 1UH3A 4M6UA 4ZFMA 2XINA 2OEMA 4QJ1A 4DZAA 1XLBA 2I1OA 2AGTA 4XZWA 4ZSTA 4DEFA 4JTFA 3DHPA 1ZAJA 2UY4A 1MWOA 4QQ3A 2HE8A 2A3HA 3W2MA 3NSNA 2P8CA 3TU9A 4FO4A 3LGDA 4AXKA 3SFWA 3KP0A 4K1WA 3OHIA 3UG5A 3AAMA 3W83A 3ABZA 2DQWA 2DIEA 3PG8A 2QJNA 1AW2A 2W3ZA 4L1GA 1DJNA 1GZ1A 3U4FA 3NQ6A 5KZ6A 3KVKA 4XB3A 1WDQA 3A64A 3CAQA 6TIMA 3LGGA 4IFRA 4JNYA 3VIKA 1PCWA 1H7OA 3VIOA 1W37A 2F84A 4W8LA 4B90A 4DJDC 4F66A 5GJMA 3G2GA 5KTLA 3CUZA 3REQA 4MM1A 5BZAA 1Z8AA 4ICNA 5F4SA 2QAPA 5D32A 1W1B1 3IJ7A 4Q8WA 3EMZA 2VR5A 2I56A 3WYZA 2IQTA 1NF0A 5CKSA 3GM8A 4E2VA 1XG3A 5ABGA 4HPNA 2DSVA 2PEVA 3SCNA 2HEJA 4IFKA 3VDBA 1F05A 3SN4A 4ICMA 5E6YA 2Z1XA 2J9ZA 5C8BB 1QHOA 4H19A 1OYCA 3U2OA 2I57A 5KZMA 3E02A 1P43A 1IR1A 1GKRA 2DVXA 1J79A 1EJ7L 3HIJA 3NDZA 1DJZA 3CH0A 3D46A 3EZ4A 1S3HA 1F6PA 1VIWA 2JEPA 1DE5A 3W27A 1PHQA 3G1YA 1EJUC 2ZXQA 2F6XA 3K4DA 2CWXA 2WNZA 4N6FA 4O57A 2Z26A 1NWTA 1Z6KA 1S2UA 4DZIA 2ZOXA 1K6WA 4JDYA 1P6WA 3WLRA 4AVOA 3AC0A 1E73M 1VFMA 3W29A 4K37A 5C9UA 3MPGA 4LVGA 2QDGA 4O1DA 3EX2A 3KFTA 4RKAA 3QHNA 1XJBA 4HYVA 3W7DA 3QMTA 4O50A 3TW6A 3QY6A 1CI1A 5EBUA 2OB3A 4C6MA 1AJ2A 2PPGA 3HQPA 1P4CA 2ISSA 3APGA 4HNCA 4A6GA 4HB7A 3LOTA 4OZOA 3WBAA 4K38A 1TQJA 1DWJM 3B40A 3H4GA 3KTCA 1P1MA 3P2VA 1XYCA 4FNPA 3FYPA 1JPKA 4G7EA 2Z4GA 3LI1A 1YDOA 2OOGA 4IXHA 3UCDA 3URAA 3ITCA 2NT1A 3GZAA 4F8XA 2QJMA 1TPFA 5M03A 1O4UA 1RK5A 3RJYA 1FBAA 2PI6A 2PP3A 3U6WA 2OMAA 1DP0A 2CXGA 4HA3A 1UKOA 4O14A 1GOKA 3MQTA 3VMNA 2PC4A 4CQ8A 1L6YA 2WVSA 1LWJA 3BLPX 1TX0A 3ZZ1A 2V3GA 1HKVA 2V81A 2PTZA 4JXCA 3LXBA 4K39A 1AJZA 1QRQA 2DVTA 3AIUA 1NSJA 4IJRA 1PEZA 1DIEA 3BDKA 3MI2A 3NGFA 2QCMA 4Z2JA 1B31A 3GDBA 1XQLA 4C7DA 1ESWA 4X60A 4PFMA 4LOCA 1E72M 2EPHA 3QPZA 4QROA 2R1NA 3WBEA 4AY7A 3EXSA 1K9EA 1SGJA 4JQ1A 4E2DA 3W7EA 5AC4A 2QGHA 4DBWA 1C8XA 3B03A 3N2XA 3FHAA 5HQLA 2YL5A 2QJIA 2P50A 7REQB 4A2SA 3ZT7A 2IKHA 5PTDA 1T5AA 2PBOA 4O28A 1RJPA 1QK0A 3D3FA 3IV3A 5K9XA 4F4RA 4HMEA 2WSYA 1IYXA 1I0DA 3FIGA 4AQLA 5DXYA 1KO0A 2VRKA 3H12A 3F7JA 4UTKA 4C6BA 4PODA 4MB3A 5IBXA 1P5BA 2BOFX 3OGSA 4WKFA 1QPOA 4LWWA 2Q01A 5GVJA 4DI8A 4EPKA 3W01A 5EMLA 4LVFA 1XLDA 5H8MA 1J01A 3ZFHA 1JZ6A 1YBQB 3O6CA 5M2FX 2HROA 3NL5A 2OZ3A 2G3JA 4DJEC 2I9UA 1GQJA 1TV2A 3MUCA 3V0TA 1W8GA 3MP4A 5GQBA 2GFTA 3N2CA 3PJTA 1G67A 1VH7A 4XTIA 4DUVA 1B57A 4AD5A 5CC5A 1C7SA 4J3SA 3E9AA 4OECA 4I90A 2QCLA 2DIKA 5KZDA 1Q6DA 3B0XA 2VWTA 3NZPA 5IDIA 3UWEA 3BCFA 3IJIA 3BURA 5D03A 3LDVA 1PX4A 3RLUA 3TTSA 1DJWA 2G37A 1F7BA 1OYBA 4K3ZA 2ZUWA 1ZTVA 1A80A 4FR6A 2X0YA 5F2IA 3QN3A 3EX6A 4TVDA 4RE2A 2G4JA 4LUTA 1UUMA 4RZ4A 5FAGA 4F0SA 2BDQA 3UGVA 4C6IA 2UY5A 4QR6A 1NDYA 3MDUA 1E0VA 3F4CA 1V79A 2GVEA 1ZQ5A 4GY7A 2PSNA 4GIYA 4AF0A 2ZRXA 3BMXA 2YCJA 4DWSB 3IRDA 5CG0A 3SRHA 4PEKA 1M03A 3QFWA 3MKVA 3MVIA 4NAFA 2WMGA 4XVEA 3SRFA 3B9EA 1DWHM 4Q4MA 4P7QA 4NZ3A 1XISA 3LX9A 3WF3A 3GFXA 4JTHA 1J2WA 4ZODA 7ENLA 8RUCA 1EA0A 4LBSA 4CNSA 2X7WA 1P0BA 2GJLA 1W5NA 4HTYA 5MKGA 5EY5A 1P7TB 1FCUA 3M5YA 4ZOAA 3W87A 2FIQA 4JKMA 2F2HA 4W5ZA 1XLFA 1PIGA 1US2A 1W1VA 2WLYA 5JIWA 1UW9A 4H8NA 1JZ4A 3NA8A 4UFJA 4PC8A 4X22A 3ITXA 3UJRA 5DMMA 4FAMA 5M3WA 3AYSA 1R86A 2ACSA 4YVXA 3HG4A 4NZJA 1TMQA 2QV5A 4KWVA 1F73A 4JIQA 2FVLA 4K36A 7PTDA 1JUBA 5CPSA 4KRZA 3FEQA 5A6AA 1L6GA 4B2DD 3MHUA 1UD2A 3UY8A 3FAWA 2CHRA 3IRSA 2VZVA 3B0PA 3RILA 4FOKA 2VC5A 2ZX9A 1JCXA 1QOPA 3VD3A 3GVGA 4I3GA 3WLTA 4RL3A 3BLOA 1Q85A 4RZBA 4QLLA 2ZZ5A 2AL1A 4N9BA 4HPXA 4UOQA 1DJYA 1OD8A 1N55A 3AJ7A 1FFQA 4S3AA 2REQA 3PULA 3WLSA 3PWAA 3QOMA 1KFLA 4UNKA 3XIMA 2W6RA 1OX6A 3VIHA 5KMYA 2DIJA 3GW0A 1L6FA 5AHNA 1UKSA 3WBWA 2HK1A 3GNDA 3DHDA 3W2KA 5ABTA 2B0MA 2WSKA 3VCRA 3SIMA 4AD2A 4MY9A 2EKGA 4IIDA 3M41A 3RDKA 4O0QA 1Q6QA 3ANYA 1DJGA 1WO2A 3R8GA 3R8RA 4YTSA 4NZ4A 1T40A 3GHRA 1JQVA 2X0HA 3MSDA 3N6JA 4QG8A 1IZCA 1J5TA 2GVYA 5CXPA 3GU2A 4PRRA 3WFAA 1QI5A 3L4VA 2BASA 2E6YA 3S2LA 3N2TA 4IGNA 2H3BA 3W23A 1WOBA 3GU1A 3TAOA 2XSAA 4S3JA 2QCDA 1HQTA 3WQFA 4OOZA 1SMAA 1A49A 2J9XA 4Q7IA 1Y8BA 2WK2A 1OCQA 4MB5A 3W7IA 4MJMA 1X1NA 3OU8A 3QFEA 4PUJA 3NPVA 2G50A 4FS9A 3VIMA 1EP2A 4D1JA 2WZMA 2FJUB 1JCNA 3M0ZA 3Q37A 1EZ2A 1TVNA 3ZR5A 3UETA 2C7FA 3S3GA 3U2CA 1FWNA 3L5MA 2QKFA 1U1UA 1AQHA 4YCPA 2EPNA 3V35A 2XPKA 3TYCA 1YHTA 2D1ZA 1V7YA 3AXMA 4AVNA 3PJUA 2NLYA 3P67A 4DZHA 3WJYA 2QUNA 2Y6ZA 3H22A 1A5MC 5DF0A 3OZYA 3N34A 3R11A 1V3MA 1JCJA 1JZ2A 1F74A 1HW6A 2GGIA 2YGYA 2O4QA 4YN5A 1SR9A 1VS1A 1XH2A 1DWFM 2L5HA 1LJYA 2PF8A 2DDXA 2EF9A 1F2JA 3H2MA 1H41A 3KBSA 3WD2A 3LHWA 5HAOA 3TN6A 3QGKC 6REQA 4ALDA 2Z29A 4MYAA 3VOCA 1Q65A 4LUYA 1TPVA 1IHIA 2DT2A 4IL0A 1E1FA 1XLLA 4IQEA 1EJVC 3DG6A 3R4IA 3K30A 1T41A 1J6PA 4ATLA 2WMJA 5E09A 3SJ3A 5CJMA 3WK2A 1QW7A 5KSWA 3T42A 1ZLPA 1EQPA 1I2RA 2BVYA 2XDFA 1HVXA 1DXIA 1I4NA 4YNGA 1SUXA 1JZ8A 2O56A 4OVXA 3BUVA 1EDGA 3LRKA 4QSFA 4Y9OA 1LBMA 4G5DA 1XIBA 4AY8A 2GQAA 3PJWA 4QJ3B 4A3QA 3OZMA 3DIPA 1RPXA 1UKTA 1A5NC 4RNJA 1H0GA 1NU5A 1F3WA 2OELA 2ZTKA 3ARYA 4LRTA 3WL1A 3A5VA 1HVQA 1F4HA 4LNYA 1TJ1A 2YCEA 3E0VA 2E9MA 4H04A 1AODA 1TWWA 2GQ3A 5M5DA 1PXGA 1D8WA 4RDVA 4HSOA 4GVIA 2IQ0A 2YBTA 4A8RA 3S46A 3TK7A 2XFYA 3H70A 3MUXA 3O63A 3EB3A 1JDDA 3LD5A 4EOUA 4JTUA 3SCUA 2WSQA 3WLMA 6XIMA 3VE7A 1V3JA 2DPEA 1KM5A 2D2OA 4I5RA 4FEZA 6CGTA 2VENA 3CUHA 3STPA 1HKKA 4J9JA 3DH7A 1XLMA 1MQRA 4E8DA 1HG3A 5IBXC 5J8LA 2V5CA 3R0DA 4WR3A 2PWDA 4H9UA 1UIPA 4ZQCA 3GFZA 4HHPA 2PS2A 3ENLA 2VUYA 1PE1A 1EZWA 2CBVA 2XIJA 1OF6A 1ME8A 4B15A 2ZDRA 3GUWA 3EDDA 4IM4A 2W62A 3V4BA 4O0ZA 3UXKA 3DAQA 3LM7A 4B5NA 2VEFA 1PL9A 2FLIA 3B8DA 4NT0A 2GGHA 2DZPA 7TAAA 3A9BA 2DZAA 2Z7GA 4WGHA 2DJXA 3W85A 5LNVA 1V6YA 2PDBA 1ZFJA 4YWIA 1AUSL 4DI9A 1BXBA 4M6QA 1XPYA 3AZTA 5AVNA 4JFVA 1ISXA 3VMPA 4R7OA 5HUPA 3S5NA 2C1HA 2FPVA 1E5JA 1GQLA 3H8AA 2CLIA 3QR3A 5LIXX 3NQAA 4CNTA 2PGRA 3THUA 1G4TA 2PDXA 3DYOA 3GH5A 3EWUA 2G3MA 4EF8A 1VPXA 2RDXA 4PUWA 1XCWA 1B30A 2OSWA 4B16A 2VEMA 2NX1A 3CHVA 4PTVA 1X7IA 2HZGA 4ZMGA 3N2BA 3HM7A 4G56A 3UWQA 3SQSA 4F40A 2ASHA 4NZCA 1ZRQA 4S2BA 4IL2A 3AXKA 3OA5A 4L6DA 4MNMA 3UVIA 4UFLA 4PB3A 1REQB 4UB9A 1QPQA 4MDOA 5BXTA 4OU1A 4NILA 3GBEA 3H7UA 2A4AA 4TQTA 1XLGA 4RCXA 1FWDC 1W9VA 1VJIA 1H1NA 1W9PA 4JTCA 3P74A 8TIMA 4X2RA 2HS8A 1LP6A 3UT0A 3HG3A 4QS5A 3M6DA 4JYFA 2BY1A 1GVYA 5KINA 4GNKB 3B4YA 2ZRUA 3ARSA 2ZUSA 3PFRA 3GSMA 3WLNA 3FKKA 5D09A 2QLYA 2OODA 1EWDA 4JAWA 3LBMA 1KXHA 1W91A 4GNVA 3C2VA 4KGJA 2XZ9A 1RCOB 4M6PA 4DYJA 1HJQA 1ICQA 3EOSA 5DMYA 4KIRA 2I17A 1JD7A 1B90A 1MRQA 4AYSA 1X1OA 1LORA 2ZADA 3UZXA 1GHSA 4QM1A 1QJWA 3GBDA 3UZJA 1R3YA 4CNUA 4JHOA 4J4KA 2ZX6A 5M1TA 3MW7A 3KBWA 3DYPA 2VEIA 2PTXA 1B3ZA 2C8NA 2P3EA 5F2MA 1MQQA 2G96A 5FJPA 4ORMA 4HPGA 4IGMA 4AEOA 3BAJA 2BTMA 2R91A 2YXOA 1B3XA 1C9WA 3EPNA 4UMAA 2D22A 3CYVA 3VNLA 1JDFA 3AZSA 4UTLA 4GUHA 3EPMA 3H26A 3P84A 2OOFA 3VIFA 4O53A 3BG5A 1JI1A 2XGIA 1EBHA 3H2NA 4IMEA 3ZLGA 2V69A 3VOHA 1R2TA 1LL7A 5AOUA 2GL5A 6A3HA 1M7XA 4Y90A 4FPSA 2J9YA 3M64A 3LBCA 1XDJA 1JCMP 4DJFC 5LNSA 4U2ZA 4P8VA 2Y85A 1Q4NX 1V6VA 2G3IA 3W84A 5DRIA 5FF2A 1ZENA 3PTQA 1JAEA 2CLPA 1MUCA 3AMLA 2VD8A 3VNZA 2FZ8A 3OP2A 4HHMA 1P1XA 3VOGA 3TN4A 3ATYA 4KWSA 4PMUA 1QI0A 1E0XA 3W7OA 2VP8A 1VBUA 9XIMA 1P7TA 4Q6JA 2E5CA 4KEUA 4UTWA 1RAKA 3G6LA 1XIJA 2PD9A 3CGTA 2GPTA 4YTRA 2JFEX 3NZRA 2O9TA 1FFRA 1G1YA 5A6SA 4K68A 1R87A 3G77A 4DVOA 1XGEA 1FWEC 3EWYA 1XINA 3GVVA 5LA0A 1E4IA 5EGRA 3O16A 3B8UA 1ZNNA 3IJ9A 4JNZA 2PTWA 1Y7VA 3AU6A 3IIXA 4RNHA 2ODOA 4Y2WA 1YTDA 4MZ8A 4EXBA 2XYLA 3HGRA 4JY8A 4KFPA 1Q7ZA 3EOOA 2DJLA 1ENUA 4HOXA 3N6QA 3RJXA 4XISA 2R82A 3PSVA 3GXDA 2XIMA 2CZDA 1GGOA 4DZ5A 2PDKA 2CYGA 1OVDA 1FTXA 1XFCA 4P8UA 5A69A 1L2QA 3UYCA 1L8PA 2WJDA 4W7WA 1UWIA 4Y9PA 4NAEA 3FJ4A 2J25A 4PGLA 1D9EA 1UA3A 5FAJA 1IZJA 1FHDA 4TUFA 3RX4A 3IAPA 4YXGA 1P6BA 1HFBA 3SR7A 4KESA 4LCQA 1E0TA 5CZJA 4Z42C 1R3TA 4H7CA 4H7ZA 5ECVA 2YCLB 3UQNA 4GIEA 3HMJG 3PZMA 3DFOA 2XM2A 4U5KA 4XD4A 4DJDD 3NQGA 1SO5A 2NLIA 3HG5A 4KEZA 4FLQA 2PGWA 1NVMA 4NP7A 4X3ZA 3EWWA 3IIVA 5CGQA 3V0UA 4ZFCA 3WFZA 2WC7A 4JIRA 2HSAA 4YU1A 4EANA 2NW0A 4YYFA 1TV4A 1TV8A 3WJSA 5CC6A 3NL3A 3NR0A 3HBLA 4UQAA 5LXXA 3KRBA 1UBPC 3PM6A 3CJPA 1KM2A 2QF7A 1IIHA 1LWHA 4NKCA 4NYUA 2QXWA 5BOFA 3CMJA 1CXIA 3S9YA 3WBYA 2WOQA 4J3VA 1VJSA 3BICA 3SSJA 3UG3A 1S1RA 2FYMA 3TP4A 3E96A 4Q7BA 4JTTA 4I8YA 3T0CA 1M3UA 3K4AA 4D6IA 3W7GA 3W7RA 5FEWA 2BG5A 2H8XA 2WBKA 1E4LA 3GNPA 4AB4A 1P0KA 3HPZA 1PZ1A 3P3BA 3SN0A 3AYTA 1H0IA 1R2RA 2FDMA 1QNRA 2TSYA 3MY9A 3WF0A 5CZ0A 4I5XA 1FKWA 3LK6A 2E9LA 4D9PA 4XQ6A 4EWJA 1NP0A 4IFOA 3U8GA 2J7EA 1QW9A 3BARA 3GRIA 2E9BA 1GPFA 1EF3A 1E70M 1Q6RA 3WDQA 2E8ZA 4AIBA 3LHZA 2G3NA 4S3BA 4JEQA 2PDMA 2XG9A 3PB2A 4GGHA 3DFYA 2YBUA 1VR6A 1PJ9A 3IUHA 4NX5A 5CQ1A 4Z08A 1OHLA 4ZQRA 3VAVA 3JRKA 3VNDA 1ZALA 4PTMA 3W1LA 2XUCA 3CQJA 1Q3NA 2PF0A 1SVDA 4O52A 2WWCA 3H4WA 1V0MA 4RNIA 4PTWA 3WIJA 4PYSA 4MB1A 1BGAA 3LGEA 4W84A 3AQUA 4Q4QA 2A85A 3E49A 3KRZA 4DQWA 1AZ2A 1PX3A 4M19A 1MSSA 1YPFA 3QV6A 1LOQA 1J2BA 2PDWA 3TC3A 3TNBA 4NNCA 4JTQA 1B4EA 1FH8A 3PP7A 2O0TA 1EOKA 2QYGA 2FMOA 4O8AA 4GKLA 3P14A 5HDRA 1IT8A 3EOEA 2BHUA 4UTJA 5DCBA 2OTDA 1G4SA 3TWAA 3EWDA 2AL2B 3NGJA 3W7LA 3RAOA 3G8EA 1HKIA 1C90A 3PVFA 1P6CA 2F38A 4LJ3A 4O0KA 5BOOA 1CGUA 1QNQA 3NQCA 2PRLA 2NQLA 3VKAA 3SUTA 3TONA 2FGLA 1K4GA 4Z2KA 1GORA 2DSWA 3W1RA 3G8RA 2X1IA 4P2VA 1O94A 1GVOA 1XYAA 1TZZA 2HQAA 3NOEA 1JQXA 3WD3A 2FZNA 4Q32A 3NO5A 2NX9A 3S2MA 4IGHA 4F9DA 1S38A 3H7RA 3FHQA 5EMMA 2BVWA 3GC5A 3B8SA 3BZJA 1K9TA 3ONBA 4FX7A 2NQ5A 2BFGA 3ZR4A 5D02A 5AYIA 1FH9A 1KNWA 4LY8A 4B3ZA 1SZNA 9RUBA 4CVUA 4REQB 4GY0A 5E0CA 3VGDA 4HN4A 3PS7A 3TYZA 1W5MA 3VILA 1UG6A 4G9PA 2VRJA 4PN2A 3OBAA 4ZA0A 4DJED 1X6LA 3SM0A 3VUSA 4L65A 3VC5A 3T0DA 1NQ6A 1XS2A 3W0KA 1B2YA 4D71A 5HQMA 4WQ6A 1POKA 4HZ7A 4O17A 3OGRA 4L1WA 3ID7A 1KFBA 4MUZA 3LCXA 1EL3A 4YMZA 3PTMA 1A5UA 5GNYA 3MT1A 4G1NA 4YIWA 4MY1A 5I79A 4BJHA 4C60A 5D2VA 5F4XA 1OYAA 2YA1A 3SI9A 2ACRA 1PZ0A 1V77A 1E6ZA 2OKTA 4FNQA 4GINA 3D47A 2OLAA 3TQVA 1DHKA 4E2OA 4L64A 3LPGA 5I3FA 3IPWA 1R3RA 1KGUA 1KCKA 3LZ5A 4QAIA 1MDLA 4GOAA 2NSXA 3HF3A 4YHEA 2YW3A 3TTEA 4ILSA 3ANUA 4M24A 4IJBA 3QQ1A 1VFUA 4W93A 2J6VA 4DM1A 3O9NA 1WZLA 3BOLA 3QGAC 2FMNA 1T8QA 1KV5A 4PMYA 3A4JA 3CUGA 4N42A 2E4TA 5A95A 4ZENA 3W38A 4E38A 2C15A 4N9CA 1OFEA 1UR4A 4MJ2A 4MG4A 1BTCA 2JK2A 2VDIA 3TSMA 4ONVA 3IVUA 1REQA 4LYQA 4CCDA 3TZFA 4Z1BA 2OLHA 1WP6A 1GKQA 3LQLA 1PIIA 2OWXA 1J5SA 3M43A 3P82A 2Z1SA 1W9BM 2AKMA 2G4FA 1AJ0A 1XH1A 2PDIA 3PY2A 2BGSA 3KCLA 4RDWA 3L21A 2Z24A 5C2XA 5D9MA 3M1ZA 4I5UA 1W6TA 1LL6A 1QO2A 1RQEA 4DUOA 1TJ2A 3TH6A 2QPXA 3C0SA 1V0KA 4GZEA 4L9XA 3S1XA 2WKJA 3UWWA 5HWMA 1QFEA 3FJLA 3WQ8A 2YCIX 4DUWA 4E4FA 1EYEA 6PTDA 1UROA 1HT6A 2XJ7A 4LALA 1UIOA 2OKOA 1UWRA 4Z1DA 4JR5A 1C91A 4UFMA 5T9BG 1UD6A 5F2GA 4UTHA 1VP5A 3OYZA 1J0YA 1HJUA 2ACQA 3MI3A 5CZSA 4B2DA 3OOQA 2J27A 1F8IA 2VNCA 1C92A 3FGCA 3FK4A 2D2GA 4PR4A 4WCJA 3BC9A 3W73A 4LQ1A 2P3ZA 4UIOA 3GC2A 3STCA 3W6YA 2VR2A 1E0WA 2NVAA 3HZ3A 1UC4A 1B5TA 3P5ZA 4A8LA 5DY2A 1EPVA 4GBUA 1QNVA 1QASA 1VEMA 4GKTA 6XIAA 4M29A 1BHGA 4G2DA 1WKYA 1GZGA 3MUZ1 2ADAA 2HE5A 1IXOA 5HR7A 1OFRA 3R13A 2YDAA 4GWEA 2OO0A 4GIRA 1A3HA 4HNNA 1J0KA 1UKPA 1JRCA 4UTUA 2JGQA 5BXRA 1AQFA 3SCQA 1KBBA 3IAQA 4XVDA 1K7EA 2ZZ2A 2Z28A 3OG3A 1F5ZA 4DLFA 2H3DA 1E6XM 3VKBA 4MSSA 5D05A 5CSSA 2CW6A 1HJXA 3BO9A 2RKXA 1VYRA 4ZTXA 3AHTA 4GRSA 1GOQA 3C2RA 5DMNA 4DXKA 3QZAA 4TVCA 1N82A 3RLGA 3W7QA 3G3MA 2JGYA 4NU7A 2PDGA 2R1PA 2GVJA 3DKLA 1OQFA 2ZRZA 4HCLA 3PNUA 4JL1A 1BQCA 3W2UA 2J75A 4D1IA 4LCRA 1NFBA 3IJ6A 3PK7A 4AHPA 3KTSA 3UEQA 1R6WA 1ZP4A 1CXFA 5GJNA 3H23A 1JG9A 4H9TA 3QW3A 2E09A 1DEDA 4DB7A 4GFIA 1S2TA 5AC8A 1SO3A 4PMJA 5DCEA 4TV6A 4FZIA 1KRBC 1IEIA 5JVLA 2W66A 1WKFA 4XO7A 3NSXA 4UQ9A 1IIGA 2JKEA 2V2HA 4P7LA 4AIOA 3PC0A 3NQ8A 1TTJA 3SADA 5FJRA 5BNKA 4XZHA 5I00A 2VC9A 1IWBA 1RUSA 4UC5A 5RUBA 2GZXA 1HX0A 5DELA 5MF5A 2XWDA 3ZO9A 3W2LA 1QTWA 4ATDA 2ZZ3A 1XKYA 4DNHA 4GACA 3G3DA 1GUVA 1K70A 3NIYA 4R53A 2QF8A 3TN5A 3CUIA 1XDMA 2INZA 1JR1A 4B9YA 1QCWA 1Q6GA 3QV8A 1UJPA 3KS5A 4AC1X 1SFTA 5D38A 4J35A 4M0XA 1HO1A 1RALA 1GOXA 1M1BA 4I6KA 2VQTA 1L2UA 3M5VA 3DX5A 1DJXA 4F2BA 4E0CA 2IKGA 4E2BA 5CEWA 3LRLA 1WKEA 1V51A 3W00A 3YPIA 1XBVA 2XH7A 4B5SA 3KOYA 4IUGA 2PLMA 5E9AA 1FVPA 2UY3A 2ZWZA 2AAAA 1VYSX 3M46A 3O06A 5G1MA 4JIPA 4OUEA 1UR3M 4V1XA 1WXYA 1TIMA 3I3BA 4TU1A 3W1QA 4FIRA 3KE0A 4I9TA 4MNJA 1SO4A 2JIWA 2B4GA 1FQ0A