1HJQA

Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
332
structure length
332
Chain Sequence
ALQYKGVDWSSVMVEERAGVRYKNVNGQEKPLEYILAENGVNMVRQRVWVNPWDGNYNLDYNIQLARRAKAAGLGLYINFHYSDTWADPAHQTTPAGWPSDINNLAWKLYNYTLDSMNRFADAGIQVDIVSIGNEITQGLLWPLGKTNNWYNIARLLHSAAWGVKDSRLNPKPKIMVHLDNGWNWDTQNWWYTNVLSQGPFEMSDFDMMGVSFYPFYSASATLDSLRRSLNNMVSRWGKEVAVVETNWPTSCPYPRYQFPADVRNVPFSAAGQTQYIQSVANVVSSVSKGVGLFYWEPAWIHNANLGSSCADNTMFTPSGQALSSLSVFHRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Two Fungal Beta-1,4-Galactanases: Searching for the Basis for Temperature and Ph Optimum
pubmed doi rcsb
source organism Humicola insolens
molecule tags Hydrolase
molecule keywords BETA-1,4-GALACTANASE
total genus 129
structure length 332
sequence length 332
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hjqA00
1V3KA 1GQJA 4QLKA 3WDRA 4R27A 5DFAA 1UZ4A 3NIYA 5ECUA 3VGFA 1US3A 4F9DA 3UR8A 1TVPA 1B3XA 1GW1A 2O9RA 3NCOA 1QW8A 2WAGA 2O9PA 4DM2A 3GZAA 2IUZA 2HVMA 1NP2A 2PB1A 3OZPA 1XH2A 3F5LA 1EOMA 4EK7A 3K8LA 1JG9A 3M6DA 1BVZA 1JL8A 3N11A 4DM1A 1KXHA 4ACZB 1R7AA 4RE4A 1UH2A 3W29A 3APGA 3FAXA 2V3FA 1LL4A 1C3FA 5A69A 1AMYA 2WKLA 4JHOA 2YL8A 2WZIA 4CD5A 2EO7A 2RGMA 1JZ5A 2G3NA 1UHVA 3RCNA 2WBKA 2F2HA 1UKSA 3SUVA 3VILA 2WZHA 1BAGA 1XHGA 2GDUA 2D2OA 2JF7A 4HOZA 1QNOA 3WN6A 2WHKA 3PZIA 2CESA 3O6AA 1KGUA 1UKQA 5EMYA 2NSXA 3OG2A 4KRTA 2XPKA 3CUGA 4AYSA 1TMQA 2EPMX 3L4YA 1V6YA 1RP9A 4PYSA 2J47A 1XYFA 2G41A 1UZ1A 2WMJA 3G6MA 3CO4A 1XD1A 4AW7A 2O9OA 2ZUTA 1PX8A 1M53A 3PZVA 4JCMA 1MQQA 3WL1A 1FH9A 5CSUA 4H8UA 4EE9A 3POCA 1O7AA 4WSKA 3T0AA 3WDPP 4HA3A 2NT0A 3CZGA 4MTVA 4P8VA 4HOWA 3N9KA 1JDAA 4TX8A 1FFRA 1NOUA 2OLHA 3VUPA 1V6XA 1IV8A 1PX3A 4D72A 3ZM8A 1J10A 1W9PA 3WBEA 3RJXA 5KEZA 2DT2A 2BXZA 2UWFA 1WZKA 1H0IA 1WP6A 1BYDA 4PBGA 5CLTA 3I3EA 1PZ3A 2BHYA 1VFFA 4HMEA 2WHJA 1WZMA 1LL7A 2E40A 4P7LA 5E9AA 1CPUA 4B15A 2Y4SA 1E15A 1KCLA 3EDJA 4PRWA 1UR8A 1AQMA 4DUWA 2FHFA 5A2BA 3W27A 1TG7A 1UD6A 3CUJA 1FHLA 4IPLA 5BYWA 1MWOA 1UWRA 3RMEA 4M81A 2VRQA 1DEDA 1FHDA 3WEMA 3AMDA 1BYBA 3SCTA 3ZJ7A 5JBEA 4UNIA 1Y7VA 1PBGA 4PMRA 2EPKX 2VZUA 5IXEA 3SUSA 2YKKA 1E6SM 3WNKA 2ZX6A 4D1JA 3BLPX 1KR0A 4UOQA 4GZEA 1HJUA 4LPCA 3ARVA 5BROA 4CCCA 1K9EA 1CWYA 1RD6A 4U31A 3ZT6A 2J7HA 2XIBA 4UQEA 4R5EA 1X6NA 3ARZA 4Q7NA 3RM9A 3AZRA 4JFWA 1WB0A 2X0YA 4UFLA 1G5AA 3CZEA 1FOBA 5DT5A 2D24A 1KXTA 1OWQA 5LA0A 4CVUA 3WFZA 4DWSC 3WQ4A 3BAIA 1QHZA 1V02A 1UH3A 3WENA 3WD0A 1TZ7A 2CYGA 4JKLA 4C7DA 2ZUMA 2ZUUA 4PSPA 3OZOA 5IHRA 2J8FA 1UWSA 3VIPA 3VDAA 5ABGA 1R87A 5A95A 5E6YA 2VX6A 4ZE5A 1HX0A 3ARXA 3WH6A 2XFRA 1QOXA 3SCQA 2VTFA 1ISZA 4AZGA 1BGAA 4AZ5A 4W5ZA 1UD2A 1VBRA 3MMDA 3BMWA 3NYDA 4FLRA 4W93A 4EAMA 4GI6A 3SCWA 4HZ8A 2V5CA 4U33A 3SCOA 1CIUA 3K4DA 3A4AA 1QBBA 3PZUA 2WW5A 1ZS2A 2VVNA 4AIEA 3UESA 2Y2WA 2PWGA 2BY2A 2YIHA 1BYCA 4OOZA 3OLGA 1QNPA 3ZR6A 1MQRA 4FF5A 3AYSA 1WDSA 3AIUA 2XFFA 5JBDA 1L8NA 1CDGA 4OIFA 3KL5A 1OCQA 1EHNA 5E0CA 1WPCA 1CNVA 2JE8A 5FOOA 5A8NA 4XX6A 1B3VA 1H5VA 1H4PA 3FAWA 2VCCA 4Y7EA 2J7GA 3L4VA 1V03A 3HN3A 3AISA 1EQCA 1TA3B 1ZBKA 1EDTA 2YL9A 2E4TA 4JFSA 5A2AA 4GIAA 2GVYA 3CUFA 5CLWA 1CXEA 3OGVA 4KWUA 1HP5A 3IANA 2XFYA 4KGJA 4QLJA 3KE0A 8CGTA 2QHAA 3K8MA 3ZT7A 4CU8A 5A6LA 3WDJA 1LQ0A 1W1VA 4M80A 4AY1A 3CHCA 3CUHA 3WD2A 3OBAA 1B9ZA 3VU2A 3SCPA 1HXJA 4LYRA 3IJ7A 4BQ4A 1V3MA 3VDHA 3VOCA 1WZAA 3DECA 3BGAA 3PHAA 3VNYA 2J8GA 2VQUA 4Z2LA 4W8LA 2XIIA 4DWSB 3ARUA 3PTQA 1OD0A 2YBUA 4S3KA 1UR4A 3OGSA 2CBUA 4TOQA 4CU6A 1NOFA 2RGLA 2VZVA 4QP0A 2VRKA 2XUCA 1GORA 1QI5A 1PIFA 3AIBA 1H49A 1R86A 1CXLA 3NUKA 3VIIA 4TUFA 3BSHA 1DWFM 1HJWA 3GTNA 1NM9A 1TE1A 1XC6A 3VD3A 3EYPA 2CKSA 5A2CA 1GJWA 3BAWA 5CPQA 3U7VA 4QAWA 2YA1A 1C7SA 2GJPA 4BCEA 2Q8XA 2Y8KA 3UEQA 1TCMA 1M7XA 3U57A 2PWEA 4QLLA 1DHKA 4AZCA 3RJYA 1W1YA 4PTWA 4MB4A 4Z2HA 1D3CA 1VFMA 1ZJBA 1JNDA 2D20A 3MMWA 3MUY1 1VF8A 3N1AA 1BSIA 3IJ9A 4D71A 2YL6A 1H1NA 3GXMA 2E0PA 3W53A 3WH9A 3MUIA 3O9NA 3RILA 2EEXA 1Q6FA 3IAQA 3WF1A 5BWFA 3VVGA 4MDPA 3CZKA 2J79A 4B9ZA 7TAAA 3GDBA 4N0RA 5HOSA 3WNMA 2BXYA 2J7FA 5ABHA 4OJYA 1MXDA 2QPSA 3RM4A 1QBAA 4FLOA 2G3MA 1UH4A 4X0NA 1HL9A 4AZIA 3AHZA 2W5FA 2E9MA 1TVNA 3KL3A 2C0HA 4P7RA 4AZ7A 2CIPA 2WMFA 4MNKA 1EA9C 3MUAA 4U5KA 2Y5EA 4KGLA 4W5UA 4HU8A 2D0HA 3VNZA 3SURA 2EJ1A 4XZWA 3ARWA 3AHXA 2UY4A 1KQYA 2UY5A 1JYNA 1UWIA 4AISA 2C7FA 1W9BM 2FGZA 1FH7A 3GXFA 5D4YA 2DIEA 5A3HA 4GKLA 4E2OA 1JXKA 2J77A 2XVKA 1NQ6A 1XCXA 3OA5A 2EQDA 5DEZA 1X6LA 3FN9A 1PX4A 3GH7A 4JFTA 4CGTA 2JF6A 1VJZA 2VOTA 1UYQA 3T08A 1KXQA 1GUVA 3M07A 3TTOA 1EO7A 1XD0A 2XVGA 2WCGA 3WMCA 2WHLA 5C71A 3UERA 2ZICA 5I23A 1E43A 2WMIB 3MV11 2YA2A 1GQKA 2PWFA 1LG1A 3VM7A 3NSXA 1GCYA 2PBOA 4JFUA 4AWEA 4PMZA 3AXXA 2XWEA 1M01A 1MXGA 1OIMA 4A3YA 2OYLA 4P7OA 1V6VA 2W4XA 4OUEA 3GNPA 1JZ2A 5D9PA 5GPRA 3W82A 1DWAM 1G01A 2DEPA 1UQZA 4TTGA 4PSRA 2VX5A 2VL4A 4H8HA 2WVVB 1VEMA 1N82A 1HIZA 4AZCB 2DH3A 4PMQA 1SFSA 5DO8A 4U5IA 6TAAA 4XB3A 2VT0A 4L4PA 6A3HA 4MB1A 3WSUA 2FH6A 1VJSA 4QFUA 3WH8A 3AXHA 1V3LA 3NJ3A 2EBNA 1B1YA 1W32A 4DWSA 4A3HA 5A6MA 1HF6A 2VURA 3MMUA 2WSPA 2WWDA 2DT0A 3AS0A 2WMKA 1V3HA 1GZJA 4WIWA 1UR0A 4BS0A 3BAXA 5E70A 2NW0A 1J12A 1FP9A 3ARQA 4LQ1A 3F5KA 4B3KA 1J0IA 4AXNA 1GOMA 5CQ1A 1GHSA 4CN6A 4JIEA 3VTRA 3VD7A 1LG2A 1OGGA 2DIJA 4J3VA 3LMYA 3GYCA 3PN8A 3S6TA 2ZX7A 4P8UA 1YQ2A 2G8ZA 2WCSA 4WJXA 1G1YA 3U5YA 4HTYA 5I77A 1R8LA 1JI2A 2OYMA 3WBAA 4GO8A 2PC8A 1NARA 2MANA 3VMPA 4W89A 5JIPA 1BPLB 3PZNA 4HMDA 3VIJA 1TFVA 1QI0A 1OD8A 2ZOXA 3VIKA 4GPNA 4L4OA 4BA0A 3GNOA 5GNXA 5A8QA 4E8DA 3UETA 1V0NA 2BVYA 3SEPA 3WMBA 2BHUA 4MJ4A 3AIEA 1WCGA 4IISA 5A1AA 2VCBA 1GVIA 2TAAA 2YDQA 3DYMA 3AMLA 3MV01 4D6DA 4ATLA 3NDZA 1K9TA 4UR9A 1EIBA 1C7TA 3CZLA 1HT6A 5BXPA 1S46A 2VX4A 2VNCA 4PMDA 4GINA 3T09A 4AEEA 4UTFA 1V6UA 2BFGA 1MW0A 1E6PA 4M1RA 2BS9A 2BVTA 4D6IA 1JZ8A 1E5NA 5D9OA 2WHMA 2EPNA 4ACYA 1XH0A 3AS1A 4J7RA 2GK1B 3MSDA 4BQ5A 4PMXA 5I78A 3VINA 1UA3A 4IUGA 3OLDA 1GOOA 3ZIZA 1BHGA 4FLSA 1VFUA 3I3DA 2XHYA 3SCNA 2YA0A 3CHEA 3TA9A 1H11A 2A3BA 5D8ZA 1DWGM 4AD2A 3MU7A 2W67A 1ZL1A 1HJVA 3ZMRA 1XV8A 2DSZA 1JZ6A 1EGZA 1J18A 1QPKA 3WDHA 8A3HA 5M5DA 3WUGA 1Q4NX 3K4AA 5BXTA 3BAJA 4JKMA 1GPFA 1UKPA 1TA3A 4PMNA 3UR7A 4ZFMA 1HJSA 1K6AA 3ZSTA 5HDRA 5D9NA 1GJUA 2XSBA 3AQUA 3FNDA 4HP5A 4AD1A 2DT1A 1E6XM 4JFVA 2WVVA 3TONA 2FDMA 3FY1A 3EMCA 1G9HA 4PMVA 1H41A 1W9DM 3F4VA 2JFEX 3VIFA 2E3ZA 1O6IA 2W63A 2WVSA 3WD1A 3K1DA 1H0GA 3AI0A 3WY1A 2DT3A 4W84A 5HBFA 3AXIA 2WK2A 3QR3A 1B30A 2CBJA 2WSKA 1UWUA 4TVUA 4J3WA 3ARSA 1GOIA 1GVYA 1E5JA 2O92A 4GZIA 3WFLA 3CPUA 2DSWA 2WC4A 4J3XA 1JXJA 4QDMA 4V28A 3SCUA 3D3AA 2XVPA 2ZXQA 1UR1A 5D9MA 1B0IA 4B3LA 4P7NA 4FK9A 1QNSA 2JIEA 4F79A 5I24A 5JUVA 4GZJA 1J9YA 4QCEA 1WKYA 1GQLA 2W92A 4D6EA 1B3ZA 3THDA 4PMOA 1PEZA 2E8YA 3NSMA 2WMHA 3VIGA 1H2JA 1CTNA 4MAZA 4UQDA 1F4HA 4TVDA 2DQXA 1VB9A 4PMYA 1JFHA 1KXVA 2WKGA 2WWCA 3L4WA 4XV0A 1GONA 5HXMA 2QMKA 2WPGA 1V02E 3W37A 1LWJA 1GHRA 4CU7A 1B3YA 1GOQA 2G3IA 2YLAA 2A3CA 4M82A 2WLYA 4CN4A 5KZ6A 1NP0A 2DSKA 3B8SA 3ZJ6A 2GUYA 1U2YA 5CSYA 4YHEA 1JZ3A 3U7BA 1LF1A 1JF6A 2EPOA 5AY7A 2D23A 4KMQA 4ZXOA 3M46A 3BSGA 1B2YA 1BFNA 1W3LA 4PCTA 2ZXDA 1PJ9A 1PAMA 1JD9A 2WBGA 4M29A 1C8QA 1KBKA 1J0YA 4HZ6A 5JIWA 2G4FA 3WQ5A 1JNEA 2EXOA 2EPLX 2BY3A 4AD5A 3LPPA 5A8OA 4WK9A 1E6QM 1OSEA 2J74A 4BF7A 5E09A 1OT2A 1E55A 3FHQA 1MYRA 3T2QA 1B31A 4JKKA 4PTVA 4RE2A 1FA2A 1CECA 2BNJA 1Q6CA 1CXKA 4GQRA 3BC9A 1J0ZA 1WDQA 2VJXA 4KH2A 4W7WA 1W2PA 3WUEA 4IM4A 4W7UA 1BG9A 1E6RA 4LXFA 2HISA 1NWRA 4PEEA 4DUVA 1JDDA 1HNYA 2XTKA 1XGZA 4ZEPA 3HJEA 1KCKA 1UG6A 3IAPA 4P8WA 2Z1KA 5GNYA 3J7HA 1V3IA 1WO2A 2DSUA 5FL1A 4PTMA 2CBVA 4CD7A 1CBGA 4CD8A 5JBFA 3AOFA 5EB8A 3AHYA 1BYAA 1VFOA 1KWGA 1R7OA 3AIQA 4HZ7A 4ZXLA 3G6LA 2OWWA 3BAYA 1KR1A 1ZB5A 1GNXA 3ZJ8A 1DTUA 1J11A 1QNQA 3E1F1 4HPGA 1LWHA 3DYPA 2X05A 4M56A 3TTSA 3MS8A 1NH6A 2J7DA 2J75A 3AMCA 3AFBA 4UQAA 1QI2A 4EKJA 3IJ8A 1MFUA 4W8BA 1DWHM 2XM1A 4M8UA 2CETA 5FL0A 7A3HA 5E6ZA 3ZSSA 3MSGA 2B31A 3FHAA 3EDDA 4M24A 1KFWA 1KQZA 3W28A 2XYLA 1ODZA 1NOWA 3UG4A 1HKKA 5I6SA 2X0HA 4BZYA 4GI9A 4UQCA 4GXPA 3N04A 3CUIA 4D6JA 4MB3A 3TP4A 5M17A 3ZR5A 1UUQA 1JF5A 1UWQA 1VRXA 1U30A 2AOSA 4TVCA 2J78A 5A6JA 5I3DA 5IFTA 2D0FA 5ABFA 1JZ7A 5CG0A 1UR9A 1KB3A 3W81A 1ISXA 4D1IA 5C70A 2PI6A 4YN5A 1LJYA 1UKTA 5BCAA 4UFJA 3WQ6A 3CBWA 3VDBA 5M3WA 4GQQA 4JL2A 1KBBA 1LL6A 7CGTA 3AIVA 3CLWA 4D6FA 4Z2IA 5GNZA 4ACZA 4UFKA 4E8CA 4WLCA 2XGIA 5BXRA 1H09A 3M7SA 1QI3A 1JYWA 4U3CA 1C93A 3W25A 5TD4A 3RDKA 5IFPA 2FGLA 1OGSA 2BY0A 4AIUA 1HP4A 3WQWA 1WE5A 1E6NA 5AYIA 6CGTA 2E9LA 1W1TA 3W6LA 3EMZA 2YOCA 4JL1A 2O9TA 2X2YA 3SUWA 5I2UA 2WZEA 1DWJM 3VGGA 5BRQA 1J0JA 1I75A 2VCAA 5HNNA 1BQCA 4H04A 4FLQA 1AQ0A 1C91A 1XRVA 3HMCA 2Z1SA 2XG9A 4B16A 1J0HA 1CXHA 3NSNA 3GXIA 2GJXB 3QOMA 2OSWA 2BHZA 1BGGA 1UR2A 3WD3A 4F66A 3VD5A 3WF0A 4HU0A 4ATDA 2QV4A 3UG5A 3GBEA 3WEOA 4UCFA 1JI1A 5GQBA 4J28A 2XVLA 1ZJAA 2CXGA 1V08A 5CPTA 2D1ZA 4MDOA 2VVSA 3T2OA 3VX1A 1JYVA 2WMGA 4P7QA 3VKKA 3AYRA 5CJ5A 3W24A 3CIVA 3GH4A 5C8BB 4UQBA 3VGBA 1J0KA 1JDCA 5BXSA 5CGMA 1K9DA 1CGUA 3A47A 3D5HA 4H41A 5FKYA 2J25A 2OWXA 3WF4A 3PZOA 3VGEA 2UY3A 2VQTA 1ISWA 5AYBA 2QLYA 2AAAA 2D22A 1E4LA 1EH9A 1E0VA 3WUBA 2UY2A 4TTUA 1PZ2A 3WF2A 2CCRA 4CD4A 1EO5A 5ABFB 3WD4A 3CZ8A 2YL5A 1QW9A 2X8RA 3AROA 5A94A 4S3JA 4YHGA 4CCEA 3AMGA 1GOWA 1GOKA 3PZMA 3FXYA 3AIRA 3SCRA 3L4UA 1PPIA 2YLLA 5I0DA 3VX0A 1QVBA 2BY1A 4BQ2A 1MW2A 4U3AA 3PBGA 3EMQA 1SYTA 3BCFA 4HOXA 1EDGA 3GBDA 4URIA 5AC5A 1E72M 4B9YA 4UOZA 2ZWZA 3AJ7A 2V3GA 1Q6DA 4UFHA 5E0FA 5EFDA 1HL8A 2BVDA 4NI3A 1E70M 1CYGA 5A6SA 1EXPA 3VGHA 3GM8A 1E1FA 5LYRA 2WANA 3TTYA 1FH8A 1J01A 5F7UA 4MNJA 3ZT5A 2V3DA 2DSVA 3VIMA 4D6GA 1E4IA 3WH7A 2JIWA 2D3LA 4D6HA 4XUYA 2VX7A 1XSKA 2XSAA 1JAEA 1R85A 3BMVA 1CENA 3L4ZA 1EHAA 3K46A 1CGYA 1E3ZA 3BCDA 4J3SA 4CD6A 3PZGA 5I79A 1SMDA 1XSJA 4V2XA 4UFIA 3DHPA 1V3JA 2GSJA 1RPKA 1VBUA 1HJQA 3AZSA 1B3WA 2IXVA 3CMJA 1CLVA 4C7GA 3CMGA 3L2LA 1CGWA 4WKAA 4NZCA 3S2CA 4AMCA 2YJQA 3AHTA 1E4MM 1WZLA 1OM0A 4LGXA 4H8VA 3SCSA 4J3UA 2WB5A 1VEOA 5M03A 1LLOA 5FCZA 3OIHA 1CXFA 1HVQA 1V0MA 3POHA 3VM5A 4D6CA 1G0CA 4X0VA 5CPSA 3WIJA 1EOKA 1XSIA 1RH9A 4AZ6A 2ZX8A 4AZHA 2JEQA 4MNMA 3WF3A 1V0KA 3WNNA 1ISVA 3T2PA 3VDCA 1M04A 4H2CA 1D7FA 4LX4A 1HKJA 1VEPA 1HKMA 1W3HA 3DHUA 1K9FA 1UD5A 3UG3A 1UD8A 3TTQA 4TXEA 2CEQA 2ZX5A 2X09A 2W62A 3EDFA 1L0PA 3AHVA 3SIMA 3B9AA 2CITA 5FD0A 2F8QA 1CLXA 3VO0A 1D2KA 1UQYA 1ECEA 2FHBA 1W1PA 2PBGA 1YHTA 2E9BA 3N13A 3MKKA 3N17A 1MQPA 2XVNA 1HKIA 4QCFA 3W4RA 2F61A 2VR5A 2J7EA 4Z2KA 4PCSA 1E0XA 2GFTA 2XWDA 4RE3A 2V3EA 1W9XA 1AQHA 2ESCA 2VZOA 1MW1A 2VC9A 1VENA 2W66A 5EBAA 2CNCA 2YDSA 2WNWA 3ALFA 3CZJA 1QI4A 2XGBA 1V0LA 1QNRA 1I1WA 3CTTA 3WMSA 4UZSA 1G94A 4W85A 1JAKA 1US2A 4PMUA 2IXUA 4CN1A 3SUUA 3ECQA 3PZQA 4BQ3A 3WELA 3WNOA 2OWCA 3IK2A 2PF0A 4AD4A 2ZE0A 3U5UA 1UOKA 3AS2A 3CH9A 2PWHA 4Z2JA 3BH4A 2DH2A 2WLZA 2VMFA 2CBIA 4UFMA 4AZBA 4JHZA 5I5RA 4C7FA 1OT1A 4JZ5A 1HVXA 4ZENA 1KGWA 1BG4A 1WDPA 5ABEA 1IZKA 3L4TA 3VMOA 5LA1A 4PUDA 1UD4A 2VI0A 4WF7A 1FP8A 1EDQA 4EANA 2PWDA 2DPEA 3WDIA 4AC1X 3LPGA 1OB0A 1W3KA 4W87A 4H7VA 2FH8A 3KL0A 4E4PA 3VPLA 4MB5A 4Z2GA 3MO4A 4Q22A 1VAHA 3VD9A 2OSXA 3THCA 1MW3A 4HA1A 3ARRA 1OGBA 1ZBCA 5HPCA 3ZJKA 3N12A 2J62A 3WNLA 4PTXA 3RPMA 2GK1A 2V5DA 2GJRA 4W7VA 3RO8A 3VIHA 1C92A 3OLEA 1JD7A 2NT1A 3KWXA 3PTKA 4OZOA 4ZE4A 2VUYA 1CGVA 3QOKA 3WNPA 3WQ8A 2CKRA 3ARTA 1KGXA 2WC3A 4OBRA 4J27A 1E40A 4JAWA 1IZJA 1W9VA 1DWIM 1ZBWA 4W8AA 4UZUA 5CXPA 3DC0A 3K8KA 2WVUA 4V27A 3PTMA 3F5JA 2CERA 1TUXA 2WC7A 1OBAA 4HMCA 3O2LA 4NSBA 3VGDA 1CXIA 2A3EA 5DMYA 3WQVA 5A6BD 2ZUWA 3W38A 4A4AA 1UWTA 3A4WA 9CGTA 3GNRA 3A4XA 3OLIA 1MVYA 2ZUVA 4JCLA 3II1A 1OIFA 2VZTA 5HPOA 5LA2A 1ITXA 1E1EA 1CGXA 2DDXA 3AICA 3EDEA 1A47A 3WUFA 1I1XA 3BXWA 1ITCA 1V6WA 1Z32X 4CCDA 2OSYA 1SMAA 5A6KA 5BRPA 1B90A 1BTCA 3LPFA 4U2ZA 3BAKA 4WKHA 3EDKA 5IHSA 3KEHA 3L2MA 1C90A 4W88A 4OBSA 4PUEA 1W91A 2OYKA 2Y24A 2ZIDA 4ML4A 3MUZ1 3WL0A 3RIKA 4N42A 5EFFA 3CGTA 1UD3A 3N15A 4IPNB 3QHMA 3B9DA 1ZBVA 3ARPA 2VR4A 2D3NA 1E71M 2J7CA 4AIOA 1XH1A 4NF7A 2WMIA 1JZ4A 2WXDM 4CVWA 1BF2A 2VO5A 4W86A 2ZUNA 2YDRA 2ZUSA 4GO9A 3EBVA 2A3HA 4NRRA 1Q6GA 3LPOA 3TOPA 3KZSA 2XJ7A 3GH5A 4MNLA 3ALGA 1M03A 3AS3A 4WKFA 5D8WA 3ZQ9A 4F8XA 5FIPA 1TR1A 1F4AA 4YPJA 4CUCA 5DT7A 1CGTA 3I3BA 1JIBA 3OGRA 2QPUA 1QHOA 1HJXA 3ZO9A 1AVAA 2GDVA 1E3XA 1GQIA 2CPUA 4OOUA 4CKQA 1KWKA 3L4XA 1C8YA 3A6OA 3VMNA 4XZBA 3BLKA 4K68A 3WKZA 2WYSA 2X1IA 1W3JA 4UOJA 2VRJA 1DP0A 2A3AA 5IDIA 1C8XA 4MAVA 3AMKA 3QHNA 2BV9A 2ZX9A 3JUGA 4MJ2A 1IT0A 1ESWA 4KRUA 4MADA 3DYOA 1OINA 4LYQA 1E56A 3ARYA 3GXDA 4AD0A 3SCVA 3MANA 2CHNA 2E8ZA 2V38A 2ZXBA 4HA4A 2QMJA 4UQ9A 3WDQA 1NWTA 1W2VA 2DGAA 2WM0A 3AZTA 3W6MA 3AIWA 3ZOAA 2WCAA 2W61A 4GI8A 1E0WA 4P8XA 3W26A 5A8PA 4U2YA 5A6BA 1FFQA 3CHFA 3FW6A 4FMVA 4DWSD 1E4NA 1UA7A 4LYPA 1JGIA 1WAWA 4X9YA 4NRSA 1ISYA 2AMGA 3QHOA 3A3HA 3PZ9A 1XCWA 5CGTA 2JALA 1NWSA 2Y8VA 2ZWYA 4RL3A 1BLIA 5CZKA 5A6AA 1W9UA 1RP8A 3VIOA 4PN2A 5DF0A 4MPKA 4F9JA 1SR0A 1WNOA 1ODUA 1WDRA 2VZSA 2C8NA 1UKOA 2XM2A 3W0KA 2FHCA 1CEOA 3NDYA 2J4GA 3HU7A 2YBTA 2WVTA 3B9EA 4HPHA 1E6ZA 1HN1A 3QGVA 4WSJA 1H3GA 3PZTA 2GJXA 3OB8A 1E73M 1NWUA 1JFXA 1PIGA 2G3JA 1U33A 1X1NA 4AD3A 1VIWA 3T0BA 1MFVA 3WEZA 4AEFA 1XYZA 1CZ1A 2QF8A 4TX6A 3VD4A 4ATWA 4J3TA 1A3HA 1ZU8A 2JEPA 1BVNP 3RM8A 3WH5A 2CHOA 1JYXA 2ZXAA 3T0DA 1P6WA 5A8MA 4OKDA 1QHPA 1E9LA 3N18A 2D0GA 3CHDA 3UCQA 3SUTA 1EQPA 5AC4A 1Q6EA 2W91A 4DUXA 2J7BA
chains in the Genus database with same CATH superfamily
1F2JA 3VI2A 3ITYA 2F2KA 2J9XA 3MZNA 5DFAA 3NIYA 1FWWA 2J88A 3JZEA 2DUZA 2PRHA 1US3A 3CU2A 3VGFA 3B0XA 3UVIA 4UB9A 3NCOA 3NYZA 1Q3NA 4Q7BA 4DLFA 5FAGA 3O63A 3GZAA 3DG6A 4F0RA 3F4WA 4DJFD 4X61A 2E77A 1EOMA 1HG3A 1ECQA 4DXKA 1VZWA 5F4WA 4DM1A 1ADSA 4HN8A 4RE4A 1UH2A 3NNTA 3W29A 1YNYA 3MA8A 3APGA 3GTIA 2YGYA 3WBXA 1VYSX 3TN3A 1N8FA 2VENA 3CMFA 5DN1A 5C54A 5CPNA 5AZ0A 1K3UA 4QAIA 1FWEC 4DN1A 1UKSA 2WJZA 3VILA 2WZHA 1XHGA 4IIDA 2PCQA 5CH9A 2JF7A 3UWZA 1QNOA 3PZIA 3O6AA 3E0IA 5L9FA 3S1XA 2A1YA 3CUGA 4GVGA 1J2WA 2XIOA 2QF7A 4K7VA 4K3ZA 4PYSA 3OBKA 3URNA 3N4FA 3MBFA 3NZ1A 2YCLB 2WMJA 4AW7A 3BLDA 2ZUTA 1POKA 4UTTA 3E38A 3MPGA 5G4WA 1EBHA 1KM6A 4ZSTA 4PZVA 1AODA 4EE9A 3KOFA 1RY8A 3T0AA 3EWBX 5DRIA 3WG6A 2NV9A 1JDAA 1FFRA 1NOUA 2OLHA 5U7SA 1Q5MA 3OYXA 3RXZA 4BF9A 4D72A 4LUYA 2PSNA 1J10A 1MSSA 3IARA 4O12A 2F7FA 5LGXA 4I5RA 3E96A 1EPVA 1BYDA 2PDLA 2XISA 2Y0FA 4E3TA 1VFFA 4HVXA 5REQA 1AW1A 4MZYA 2FLIA 3CQHA 4ERIA 3TUUA 2QCLA 4GUFA 4P7LA 2F6UA 1CPUA 4B15A 4HPNA 3W2KA 1LT8A 4DIAA 4V33A 1KCLA 4PRWA 2ZCGA 3PTDA 1UD6A 3CUJA 1QTWA 3I6EA 3OVRA 4LAOA 4RLIA 2R1KA 4PC8A 1FHLA 5LGZA 7TIMA 2NUXA 4XAPA 4C6LA 3RMEA 3ZWSA 4LH8A 3LMZA 1FHDA 3WEMA 4ZTYA 2V5LA 1PKNA 3KCOA 3L67A 1Y7VA 4PMRA 2VZUA 1RJRA 5IXEA 3IGUA 3WNKA 3HPZA 4Q4RA 4ZOAA 3ARVA 5H91A 2PURA 4U31A 2XN2A 2FKPA 4UQEA 4R5EA 5J8LA 3B8DA 3C8NA 2F6KA 3BANA 3AZRA 1YPFA 4JFWA 2EKGA 1J2BA 5G4HC 5KZMA 5DT5A 4AAJA 2PEVA 4L64A 4MWAA 3BAIA 1SW3A 4L9YA 1UH3A 1DIOA 2BTMA 1ZY9A 3W1XA 4C7DA 2V30A 2ZUMA 3QPEA 1IEXA 4E6MA 1XYLA 4LUSA 3VIPA 2G97A 1XLJA 3VDAA 1O95A 3NQAA 2ALRA 5A95A 5E6YA 2XSXA 4ZE5A 1HX0A 4AEOA 4MGGA 1L2UA 2QS8A 2XFRA 3PJUA 3SCQA 3M7WA 3N2XA 4AZ5A 1BGAA 5LNUA 2GGJA 4W5ZA 4JTJA 3IIPA 3BGGA 3GG7A 3MMDA 1WOBA 1QNVA 2X41A 3UXAA 3V0UA 2OLAA 3WLIA 2CWNA 3LHWA 4TO8A 2V5CA 3SCOA 4UMCA 6ENLA 3K4DA 3A4AA 2YFOA 3PZUA 1MDRA 3LTSA 4AIEA 2Y7GA 1HO4A 4YS1A 1NELA 5AOUA 2BY2A 2AL2B 2C18A 4OOZA 1QNPA 3ZLFA 3VNMA 4XAGA 1V5XA 1X8FA 3V75A 3AIUA 5JBDA 1F3XA 1CDGA 3LUTA 2FFIA 3KRBA 3G2GA 4JTGA 4QG8A 4HT3A 3W23A 3N9SA 4Q4SA 3KAOA 2JE8A 5FOOA 1J5SA 1B3VA 3UP8A 1XX1A 4QJ3B 1J6PA 1H4PA 4B5NA 4DRSA 3OO2A 1WUFA 1XINA 3W7RA 1E0UA 2H9AA 3SIZA 3TR2A 1ZBKA 4E2VA 4QJ1A 4S38A 3CO8A 3RPTA 3D0CA 3B05A 1W1B1 4DI9A 5A2AA 4GIAA 3JZUA 3LGGA 3CUFA 7ODCA 4O17A 4FA3A 4MY9A 2XFYA 4RXGA 2ZA2A 1KFEA 5A6LA 4GVFA 8RUCA 2IKJA 4QJ5B 2ZKMX 2CHRA 1PDZA 1HXJA 2A6LA 4WY0B 5E93A 1V3MA 8TIMA 4G6CA 3VOCA 3ABQA 1F05A 3BGAA 3LCXA 1Q66A 3SN1A 3TJIA 5FEZA 3UWVA 3S6OA 3SN4A 2VQUA 3SAZA 4W8LA 4DWSB 3PTQA 1OD0A 1UR4A 4H6RA 1XBYA 2YXXA 3PNZA 3O6CA 4TOQA 1PL9A 3LHVA 1EFZA 1BXNA 3CIXA 4RDZA 3THAA 2PFHA 3EA3A 3PAOA 1NM9A 4DJEA 4HSOA 4UTTC 5D38A 1Q7ZA 5A2CA 1AL7A 1M9HA 1T0OA 2VDGA 3U7VA 3H21A 2ATSA 4QAWA 2BDQA 4NAFB 1SJAA 2PPGA 4RDWA 4XZIA 1G4PA 2Y8KA 4D9PA 2R9RA 4GVIA 1W1YA 2DP3A 4MB4A 4Z2HA 6REQB 1VFMA 1ZJBA 3G5EA 1JNDA 2X0SA 2OODA 4QJ4B 1NU5A 4GKTA 4C6KA 2YL6A 1XLKA 3BMXA 2IPWA 2W9MA 1OYAA 3W53A 3W1NA 1TJ1A 2EEXA 1F5ZA 1Z44A 3AO0A 4IG2B 3WF1A 3W2NA 2Z2AA 3F2DA 2UV8G 3MC5A 7TAAA 4N0RA 1EYWA 5HOSA 1ZTVA 2J7FA 4JNMA 2QPSA 1QBAA 4EX4A 1JDEA 2OPJA 1HL9A 3TJLA 3UPMA 2W5FA 3QC0A 1XPYA 4RW5A 2C0HA 2W6RA 2ASHA 1QPOA 5T9BG 4W9TA 4DZ5A 4JPGA 3EXSA 4U5KA 1WKFA 4HU8A 2V0TA 3SURA 1G4SA 1QWGA 1I9CB 4REQB 1TV4A 1AW2A 1L9WA 1J8VA 3RR4A 3LK6A 6XIMA 4QG6A 1EZWA 3SGGA 1LP6A 5I00A 5D4YA 3VOIA 3TU9A 4ERGA 4E2OA 1JXKA 2J77A 1OY0A 2HS6A 4YTQA 3GH7A 2Z4GA 1VJZA 1XIFA 2FMOA 1UYQA 3T08A 1I2PA 3ENLA 2ZZ2A 1EO7A 4H7CA 1IWPA 4G2DA 1X39A 3UERA 2ZICA 3SM0A 1QO5A 2OZ3A 1GQKA 2PWFA 2A7PA 1LG1A 3VM7A 4C1LA 3LBMA 4AWEA 4ZO7A 3ITOA 1ZAHA 1S3HA 2FMNA 2Y7DA 4DNMA 1XLFA 3BLOA 4XSLA 2J13A 4CQAA 1J79A 1DWAM 2DEPA 1S38A 4CLMA 3LRLA 1US0A 2VL4A 1KTCA 1N82A 1HIZA 4AZCB 1FDZA 4PMQA 4U5IA 4XB3A 2VT0A 4E4UA 4IIGA 6A3HA 4XBSA 4OTKA 4C5YA 3AXHA 4G8TA 3GUGA 2ABAA 2EG6A 4A3HA 5A6MA 2R82A 3TR9A 2DT0A 3GG0A 2IKGA 4PE8A 4ZB5A 1J12A 1QW7A 1FP9A 2PRLA 1J0IA 4JX5A 2Z28A 3GDKA 2OZ8A 4L80A 3Q2DA 3LQLA 4NAEA 4JIEA 4RZ5A 3HGSA 4J3ZA 2QUVA 5XINA 3VD7A 1LG2A 1J96A 3E5BA 4U28A 5DXYA 1UBPC 2G8ZA 2OX4A 3MKCA 1G1YA 2GGGA 5I77A 3PULA 3QVQA 1JI2A 3WBAA 2X42A 2MANA 3VMPA 3S46A 5JIPA 4IGNA 3TWBA 3PZNA 4HMDA 4JTFA 3U2OA 1KRAC 2VD8A 3RK8A 4XD5A 2D69A 2TMDA 5FJIA 5DMMA 4US6A 5GNXA 5TIMA 3GHUA 3UETA 1E9ZB 3C3NA 1V0NA 3G1DA 3W6YA 1OFOA 3UD6A 4ZQRA 2BHUA 4MJ4A 1GVIA 2TAAA 3DYMA 3MVIA 1XUUA 3SGUA 4IHCA 3TYUA 3URAA 4BKNA 2VNCA 3E0VA 4GINA 3EWDA 2GQ3A 5AHEA 4UTFA 1K4GA 4FHAA 1ZP3A 2BS9A 4R3UA 1JZ8A 1E5NA 2WHMA 1LBLA 4I8DA 2FVKA 1OYBA 1YADA 5I78A 3EXRA 1GOOA 3DKLA 3ZIZA 1U22A 5EMUA 2V63A 4NT0A 3VOFA 3K13A 3H26A 1EC9A 2QDGA 4Q8MA 4ZQMA 1Q85A 4YTUA 4JGDA 2EG7A 1MUMA 2W67A 2FPYA 1VQTA 2O4MA 1AL8A 1GKPA 3VKAA 3LNPA 1K8CA 1J18A 3WDHA 1LWIA 3K4AA 3CHVA 3HG5A 2E1WA 2QT3A 2ZRYA 4MIMA 1TA3A 4PMNA 3QLDA 1PYMA 5HR6A 3FNDA 2YYUA 3KVLA 5AC7A 1E6XM 4DF1A 4JDYA 3TONA 3FY1A 2I14A 4PMVA 5LIXX 4N02A 4JD4A 3IGXA 4C6FA 2ZRVA 4N6EA 4GA8A 1VBJA 2WVSA 1VR6A 4WHBA 2I9EA 1JVNA 5CJNA 5HBFA 2QPXA 4TVUA 4J3WA 5MKGA 2PTYA 4OUIA 3TYEA 1JXJA 2KZHA 2XVPA 2FZNA 4B3LA 3Q45A 4FK9A 4S23A 3RRXA 4U4MA 3E0LA 1ZALA 4GZJA 1FQ0A 3ZVHA 3WK3A 2W92A 4D6EA 3DEQA 1B3ZA 3S5ZA 3THDA 4S3EA 3KX6A 4B5UA 3W7NA 3NSMA 1H2JA 4NNAA 4J2MA 3KOWA 3GR4A 3W73A 2AL2A 4KKXA 5CZTA 2R1LA 1TSIA 1VB9A 3MUCA 4A8NA 5AVNA 3TN6A 3UZJA 4G7FA 3W7KA 1GYNA 3GHRA 5F2LA 1ONEA 1IGSA 1V02E 3GWQA 1S2AA 1GHRA 2MUCA 4CU7A 1GOQA 4CN4A 2DSKA 4Z1DA 4Q6XA 1DJWA 1JZ3A 4DX3A 1DOSA 2AL1A 2EPOA 3OVQA 5AY7A 4KMQA 2OQHA 4XAFA 5JXQA 1OF8A 3IIZA 1TRIA 4FOKA 3BSGA 1BFNA 1EL3A 3IACA 4WDUA 4NJIA 3N2CA 4Q8NA 1KBKA 2G4FA 3IVSA 1JNEA 2BY3A 4AD5A 5A8OA 2Y89A 1S1PA 3UR2A 1TPWA 5CZJA 5E09A 1MYRA 2NV1A 3MB9A 4ICNA 1FA2A 1REQB 2PE4A 4HNUA 1J0ZA 3GQYA 1W2PA 3IUIA 3HO8A 3KM8A 3LU2A 1BG9A 1PTAA 5FA5A 3GIPA 4A2RA 1SZEA 3EA2A 4IF2A 4O50A 2XTKA 3NDOA 3I7QA 1Y5VA 4PB5A 1XI3A 3E0FA 2CU0A 2DZVA 3J7HA 3W2UA 1V3IA 3PJXA 4PTMA 3HGOA 5JBFA 3PFMA 3AOFA 2E6AA 3AIQA 4ZXLA 3UQNA 3RU6A 2MNRA 3CAKA 5CSRA 2V5KA 3MS8A 4K2SA 3WYZA 2PCEA 3W72A 4UQAA 1VCGA 2VHLA 1RQBA 4W8BA 2XM1A 4M8UA 4GIYA 2B31A 2QJNA 1KFWA 1KQZA 3W28A 3HPXA 1NOWA 2WQDA 2X0HA 3GX9A 4GI9A 1TTIA 5BOOA 4BF5A 5M17A 1L6YA 4E0CA 1JF5A 3STFA 5I3KA 3KDNA 2IMRA 1OK4A 5HUPA 5I3DA 4Z1YA 1JZ7A 5CG0A 2V81A 1UR9A 1X97A 1R6WA 1ISXA 4WDXA 5C70A 2QCEA 1UKTA 4DF0A 5M3WA 2XN0A 1KBBA 4Q8VA 1A0CA 3AIVA 4D6FA 4ACZA 1PO9A 4WLCA 3S1VA 4DEFA 2Q6ZA 1H09A 4QS5A 4U3CA 1C93A 5IFPA 1IHIA 2BY0A 1S1RA 4GZ7A 3WQWA 3GC2A 1E6NA 1R46A 4JTSA 5AYIA 3C2FA 3NQEA 6CGTA 3ITGA 2O9TA 1I2OA 2WZEA 1K70A 4O19A 5BRQA 1FDJA 3B8TA 3ZZ1A 2BGNE 3S3GA 3LV6A 3TX9A 4HGXA 5HNNA 2BMBA 1PVNA 3MCMA 1AQ0A 2CWXA 5ENLA 4GMEA 1EA0A 3TW9A 3NSNA 1UZHA 1ZCOA 1O94A 1R3SA 3MJYA 4MVAA 3WF0A 4ATDA 2C0AA 3GBEA 3UCCA 4H00A 1JUKA 1MEWA 5HULA 1JI1A 4C1NA 5GQBA 4BY3A 1H7PA 2VVSA 3MUXA 3T0TA 2WMGA 4P7QA 1O5QA 3VKKA 3LI0A 3S2JA 2RDWA 3ES7A 5C8BB 1J0KA 1JDCA 2H8XA 3PUGA 2I1OA 4H41A 3BDKA 3PZOA 1Q6LA 1PHWA 2UY3A 1F61A 4Q8OA 1MZHA 2VQTA 1ISWA 4O1DA 5HA7A 1QPRA 4XBJA 3D6NA 2AAAA 3OQ8A 3OZYA 2I16A 4LBRA 1EO5A 2ISFA 3WD4A 5A94A 3AMGA 4I6VA 5F2MA 2RJGA 2A7RA 3KOYA 1LUCA 1QVBA 2BY1A 2Y62A 4BQ2A 1BRLA 1I2NA 3KHJA 3H2EA 1VRDA 3BCFA 4CEXC 2NUYA 1EDGA 4URIA 3MHGA 4UOZA 1IEWA 5E0FA 4NI3A 2QUUA 3VGHA 1OX6A 4FB7A 5F7UA 3VCNA 3GVQA 3KCLA 1H5YA 4MNJA 3EOOA 3ZT5A 3VIMA 3WH7A 2D3LA 1XSKA 1RJQA 2FYMA 1UC4A 1FXPA 3BMVA 1CENA 5F2IA 1V7AA 4KWWA 1E3ZA 1SSGA 3DG7A 4CD6A 1DJNA 3PZGA 1SMDA 5HMFA 3LX9A 4UFIA 1UJPA 4JBRA 3HQNA 3TYZA 1RPKA 2OEJA 3T07A 4O14A 3VAVA 2FGBA 3RUBL 2Z00A 1UZDA 3CMJA 1W54A 1XGEA 1CLVA 4Z42C 4KEMA 2PDQA 3HBLA 3L2LA 4C7GA 3P93A 4WKAA 1P1XA 4NZCA 2PDKA 3U9IA 1TCDA 1A80A 5HQEA 3AHTA 3ORWA 1IT8A 1VPYA 3WLKX 4H8VA 1LOLA 4U10A 2O7QA 4ZOEA 3PWAA 2P76A 3GXNA 5M03A 4JYDA 3G1YA 3QKEA 4Q8TA 4H9YA 3HIJA 1UWAA 3RRAA 1FHVA 1XSIA 1RH9A 1R3WA 1ZJHA 4IWWA 4ZL1A 4AZHA 3CYJA 4LAKA 1ISVA 3GD6A 3T2PA 3TK7A 1M04A 1H62A 4H2CA 3GKFA 4I90A 2DUXA 3CV1A 1W3HA 4LBSA 3VKDA 4TX9A 3IIVA 3PM6A 6PTDA 2ZX5A 1SSDA 3G0UA 3EDFA 4PUJA 4AU0A 4C6MA 2F8QA 5EPDA 4DXXA 2QAFA 4QE4A 4XG1A 2BASA 1ECEA 3ANYA 1I2RA 3NQ2A 5D30A 3ZXWA 4ZOCA 4WXYA 1MQPA 2E6FA 1LCOA 1RXOB 4QCFA 2F61A 2VR5A 1EJXC 4HNLA 2V3EA 1W37A 2VC9A 3SRFA 1UPMB 2YDSA 3USBA 5FJUA 5HNUA 3CZJA 2IQDA 5LHEA 1K7XA 1QNRA 3AALA 4NVTA 3CTTA 4FIQA 4Z0SA 1US2A 2IXUA 4CN1A 1N55A 5D02A 3PZQA 2OWCA 2XH7A 4AD4A 4QROA 2ZE0A 3SSZA 4ZVJA 2E67A 3AS2A 4AXKA 3CH9A 3FA5A 2DH2A 4PTDA 5T26A 3PB2A 3KLKA 2FZBA 4YNGA 1HVXA 4QR6A 1BG4A 3XISA 3VMOA 3LSCA 3TW7A 4PUDA 2J27A 4TIMA 3B0YA 3L0KA 3DBPA 3Q4DA 5HMDA 2JKPA 1EEPA 1IEIA 2BVWA 3CEPA 4LALA 4GY1A 4C6BA 2QCCA 4MB5A 1YXCA 4UXDA 4GG9A 5C55A 3PBYA 5J5DA 3ARRA 4K39A 1ZBCA 3FSTA 5HPCA 2XINA 2XH4A 3N12A 2J62A 4DJDC 2V6AA 3W1LA 1T7LA 4A29A 3W00A 1MUWA 3E12A 3QTGA 1JD7A 3NEHA 1I6NA 3KWXA 3PTKA 4MUZA 1JRBA 2FIQA 3N25A 4OZOA 2HNEA 3PWGA 3QOKA 3UYCA 4A3QA 3I10A 3WNPA 1KGXA 4HU4A 1DIEA 4RUBA 4D8AA 3UU0A 4GNVA 1ZBWA 1W3IA 3NZGA 5AYXA 2WVUA 4V27A 5K4ZA 2CERA 1TUXA 2WC7A 3W1AA 3O2LA 5KMYA 5A6BD 2ZUWA 5BRBA 2DU2A 4KCUA 1TMHA 4B91A 5AHMA 4NZ1A 2ZUVA 4JCLA 3OJGA 5LA2A 4INFA 4HMNA 3LRMA 3P81A 4ZB2A 1Z32X 3E74A 5A6KA 5BRPA 3QF0A 3DENA 4J9JA 1BTCA 1A5LC 4K8HA 4U2ZA 3MQTA 3EDKA 4NL1A 3KEHA 3U0HA 2IKHA 1QRQA 1YKWA 3R11A 1FWFC 1W91A 2OYKA 2Y24A 3UW6A 4Y9PA 3WL0A 2XZ7A 2ODOA 4QGCA 3FXGA 2Y7EA 1UD3A 2AAMA 3BZJA 3IJLA 4IPNB 4BR1A 4MSSA 1NAL1 2ALDA 4HNTA 2X1SA 2AKZA 4M3PA 2VR4A 2D3NA 1E71M 4AIOA 5CAKA 3LHYA 1KBLA 4NF7A 4CVWA 2PLMA 3S5OA 2YDRA 3SFKA 2VDHA 2X16A 2VEIA 1A49A 4DXVA 4NNBA 3GH5A 4OT7A 1HGYA 1W3TA 1M03A 2QVNA 4EP8C 1J4EA 5LNWA 1F4AA 4YPJA 1M1BA 1RA5A 2NX1A 5DT7A 4CUCA 3I3BA 3NZRA 5ECVA 3W01A 3MDWA 4RDVA 2BGQA 1JR1A 5C9RA 1B5TA 4Q8WA 4O8AA 1C8YA 3VMNA 3APYA 4AF0B 3VE9A 2X1IA 2H6RA 3PG8A 4UOJA 2VRJA 4M5PA 4RCXA 4MAVA 4ZQNA 3IS4A 4OVXA 1PCKA 2BV9A 4O1AA 3WJXA 1SVDA 4MADA 2X1UA 1FWTA 1TE6A 3SCVA 3MANA 2E8ZA 4EWJA 2ZXBA 3B3DA 1DQUA 4UQ9A 4MHBA 1RLDA 1Y8BA 3AIWA 3ZOAA 4GI8A 1KRBC 4P8XA 5JH2A 2H3BA 3G1FA 4JN6A 1LRQA 4U2YA 1L6GA 1FFQA 3CHFA 3FW6A 4FMVA 4O1EA 4DWSD 1E4NA 4X9YA 4FO4A 2AMGA 2ZRWA 3QHOA 3NZQA 5AKQA 1A5UA 2Y1HA 3A9IA 1D8CA 3G18A 4S3BA 4P2VA 1NWSA 2ZWYA 4RL3A 2DVXA 5A6AA 1RP8A 4MKSA 1HUVA 2ACRA 3WMLA 4MPKA 4AVOA 4A6GA 1AZ2A 1SR0A 3A22A 5I3FA 4GYFA 1RVKA 4V1XA 1WDRA 3SI9A 4R53A 2NQ5A 3S5SA 3AYVA 2FHCA 1ZNNA 1X7IA 3BGJA 3HU7A 2YBTA 2WVTA 1E6ZA 2NQHA 4L7ZA 1F76A 5JH1A 3N6QA 3OB8A 4GISA 4HHLA 1JFXA 2G3JA 4QISA 1VIWA 1Z9AA 1MFVA 1ZZMA 4MPQA 2YXOA 3CQIA 1XDMA 4QE1A 4IPJA 4J3TA 1ZU8A 4R9OA 3RX4A 2V69A 3WH5A 4GC4A 4E2DA 4NX0A 4JN8A 3T0DA 1P6WA 5C7VA 1QHPA 3B8VA 1XIJA 2D0GA 3CHDA 2PLJA 3ERPA 1VBGA 3NO1A 3E3HA 1BSLA 3DDMA 3SUTA 2DZBA 2W91A 3T78A 1V3KA 3WDRA 4R88A 1UZ4A 4DJDA 4RXFA 4AWUA 5ECUA 4KETA 4FX7A 3N4AA 4H2HA 1TVPA 3O05A 4ROPA 1G4EA 1I8JA 5U4NA 2A3LA 1OQFA 2HVMA 1NP2A 3OZPA 1XH2A 4UC5A 4KEVA 4EK7A 3QMSA 1JG9A 3M6DA 1BVZA 4ZO9A 3QZAA 1JL8A 5KITA 2DUAA 3V36A 4ACZB 1AA1B 4PULA 4GABA 3GS6A 4MF4A 2V3FA 1C3FA 2FPVA 4NJJA 3WK2A 1PKMA 1AMYA 2EG8A 2OGYA 2WKLA 2WZIA 4CD5A 5DBTA 2EO7A 3FCPA 4AY8A 3P7YA 3RNDA 1UHVA 3RCNA 3QKZA 2ZRUA 3OHMB 2XH2A 4JYEA 3RLUA 3SUVA 4IFKA 3ME3A 2GDUA 3CWNA 1QAPA 3PUEA 2KAUC 3ZLHA 2CESA 1KGUA 4QX4A 2NSXA 2QCDB 1S5TA 4IFKB 1TMQA 2EPMX 2Y88A 2OCZA 4YIWA 1E0TA 2VD9A 4TV6A 3CM4A 3RN6A 4KF1A 2QCDA 1EPXA 2O9OA 3XINA 4GE8A 1M53A 5BU9A 1TMLA 1MQQA 1FH9A 3WDPP 1R30A 1OADA 4HA3A 4CCZA 3TFXA 5J04A 4HOWA 4TX8A 3TLLA 5HWNA 4HU3A 3ZM8A 1CB2A 3WBEA 1Y5WA 2BXZA 2UWFA 1YDOA 1FXQA 1H0IA 4HKPA 4FXRA 3NEVA 1TKKA 5CLTA 3S9ZA 1FWHC 4XSMA 4CNOA 4GH1A 4HMEA 2E28A 3LTPA 1VLWA 4GQBA 7PTDA 3IIOA 1WZMA 5K7JA 2J66A 2TSYA 4EXBA 5E9AA 3NOYA 1E15A 3EDJA 2QV5A 1AQMA 4DUWA 2FHFA 1TIWA 2VUNA 5A2BA 3IRSA 3W27A 3DESA 4MLRA 3VOJA 2OG9A 3M47A 2FQIA 3BG5A 3MTWA 3PBWA 3WFAA 4M81A 1TPVA 2P53A 1F73A 5KZDA 1BYBA 3SCTA 5JBEA 3M5YA 3GDLA 3H53A 1SO4A 4PUWA 1PBGA 3VE7A 5CPMA 3SUSA 1PTDA 1E6SM 4DO4A 4UOQA 3FDGA 4CQBA 1K4HA 3CT2A 4LPCA 1K9EA 1SZFA 1V79A 1RD6A 1KCZA 4AVNA 4B90A 2J8TA 3ARZA 4Q7NA 3CQKA 3EOUA 1XBZA 3LLXA 1IEQA 4PEKA 2D24A 1OWQA 3WFZA 4DWSC 3KFTA 4FNTA 1H7WA 2W3ZA 4XAYA 3QTPA 3WD0A 5E1QA 1TZ7A 2CYGA 3KLLA 3FYPA 4PSPA 3W2MA 5IHRA 4C6CA 2J8FA 3RX3A 4OU1A 3UPBA 4WEVX 4KIRA 3OQEA 3ARXA 2PF8A 1ISZA 1PHQA 4AZGA 2ZE3A 3OOQA 1VBRA 1QT1A 3CC1A 3NYDA 1LBFA 4GI6A 3SCWA 1E51A 1O68A 3VKBA 4U33A 4IMEA 4GYKA 4E5TA 2WW5A 1ZS2A 2VVNA 3BG9A 3UESA 3VOHA 3UPWA 7REQB 5G4EA 3W74A 4AX7A 1LORA 1GVQA 1BYCA 4BK9A 4DBSA 3OLGA 2WNZA 3S9IA 3QY7A 2HXUA 1MQRA 3CAWA 5FSEC 2W79A 2P3ZA 3TCEA 4OIFA 4QRNA 3GXTA 3M0YA 5BOFA 1OCQA 1EHNA 2VM8A 4H9ZA 4KS0A 3V3WA 3LZ3A 1WPCA 4MWAC 1TWZA 2CC0A 1CNVA 1T6MA 3TQ0A 3B03A 3JW7A 4Q8UA 2FJUB 4KFOA 4XX6A 3FAWA 1AZ1A 4Y7EA 2J7GA 4CQ8A 1JGMA 3T44A 1H61A 2QCGA 1GTEA 3E02A 2QCMA 1TA3B 5TF0A 2E4TA 4JFSA 3DU0A 2CLPA 4JHMA 1Q4WA 2RJHA 2GQ9A 3TV8A 4LVDA 1CXEA 4EOUA 3TLQA 4KWUA 3IANA 4AUBA 4KGJA 4QLJA 3TAKA 8CGTA 3K8MA 3TC3A 3WDJA 1R3RA 4EPDC 3C52A 3CUHA 3OBAA 3SCPA 1IR1A 1TPDA 3TZNA 4BQ4A 2Z26A 4LRSA 1SZRA 1XLEA 4S39A 4Q4OA 3ONBA 2CZDA 3THQA 2CZFA 1LM1A 2INZA 2VEMA 2J8GA 4HB7A 4Z2LA 1TJRA 2XIIA 3UXKA 4QITA 1NOFA 2VZVA 4QP0A 3KRUA 3T4CA 2XUCA 3C2RA 4GUHA 1GOXA 5AHNA 3R25A 1CI1A 3E2QA 1E9YB 1AJZA 2DIKA 3NUKA 3VIIA 4TUFA 2C91A 4RK8A 3W9ZA 4YYCA 5C2XA 3EYPA 1FCBA 2VYOA 3BAWA 1YE4A 4Q4PA 2WNNA 4GYPA 2YXGA 1C7SA 2GJPA 4BCEA 3M64A 4O16A 1OX5A 2GVEA 2PWEA 1DHKA 4AZCA 4PTWA 3U48A 4JIIX 3H23A 5E9XA 4IQLA 3L65A 2OQLA 2D20A 3MMWA 3MUY1 2GWGA 1BSIA 2X30A 4NZ3A 4D71A 1RJPA 2E0PA 3GXMA 3WH9A 3O9NA 3RILA 4XKYB 3BQ6A 2GL5A 5BWFA 4OHQA 4AH7A 4CNTA 3CZKA 2J79A 4ZZ9A 4DQWA 5EYWA 1KM1A 4ZA0A 5ABHA 2WZTA 3GB6A 1MXDA 3P80A 3M41A 1MRAA 5K9XA 4K8EA 4CNPA 2G3MA 4X0NA 3O3RA 3XIMA 1OZQA 2E9MA 1TVNA 1JPIA 4JTDA 3LTYA 3P0WA 4I9TA 3D3FA 1AFSA 3MUAA 4EPKA 1KM5A 4UUIA 2V68A 4W5UA 2VGFA 2QIIA 2TPSA 3VNZA 4Q6JA 1Q6QA 4X9SA 2EJ1A 4XZWA 3ARWA 3AHXA 1KQYA 2UY5A 3V5FA 3A5VA 3NL5A 4AISA 2DW6A 5F1VA 1FH7A 1XLDA 1X6UA 3FS2A 2QUMA 5D37A 1IF2A 2DIEA 4S3DA 3W86A 5FACA 1VFSA 3R1ZA 4F48A 5B7YA 1UR3M 2EQDA 5DEZA 3VC5A 3FN9A 3GTHA 4CGTA 2VOTA 4Y8FA 3ONCA 3QN3A 4NI8A 1GUVA 3TTOA 4TV5A 1YXYA 1XD0A 2PTZA 2WCGA 1BF6A 2QUTA 3WMCA 5C71A 4LCRA 5I23A 1AH0A 1E43A 4B2DD 3N2MA 2RDUA 4IP4A 2C71A 2YSWA 3M4HA 4YL2A 2IS7A 1GCYA 2PBOA 2B7QA 4MJZA 2POZA 4RZBA 3EX1A 1LROA 1W5QA 4A3YA 2OYLA 4HPXA 4FEZA 3UG8A 4OUEA 3ZYZA 4E8GA 3GNPA 2ON3A 5G2IA 8XIAA 1EGVA 1M68A 4JTUA 5D9PA 1S2TA 2NVDA 2JKEA 3DX5A 1KLZA 5JMUA 4Q4MA 2PDFA 4H8HA 4EIVA 3B06A 5LSMA 3NPVA 4C60A 4DLMA 5DO8A 3M9YA 4DWDA 1XR2A 3WSUA 3UJEA 5LZLA 1VJSA 4QFUA 3WH8A 5DLCA 1B1YA 5C0QA 3VZZA 3QV8A 3L0NA 3S4TA 2VURA 2WSPA 3RF9A 4WOZA 1V3HA 4MFEA 1EWDA 3DIPA 4HSHA 1GZJA 4GBDA 1UR0A 4ML9A 3BAXA 2GQAA 2NW0A 2OMAA 1ZPTA 3K5XA 3EPMA 1R9YA 4KWVA 5CQ1A 4BEQA 1GHSA 1TIMA 3TSBA 3G77A 5C7HA 5HMSA 3STEA 3VTRA 1OCJA 3QGAC 3HZ3A 4LUTB 2E5CA 1HQTA 1OEPA 2QQ6A 3KRZA 2O56A 3CJPA 3B04A 2ZX7A 4P8UA 1YQ2A 1CB7B 3TJXA 1OJXA 4LF1A 2WCSA 4WJXA 3ZR4A 3DHFA 4Q8QA 2OYMA 3B8UA 4Z1BA 5LNVA 3YPIA 4W89A 1RHCA 1Z42A 4AG0A 3CB3A 2VGIA 3TQKA 1NDVA 1TFVA 3K30A 1QI0A 2HS8A 2ZOXA 4L4OA 3GNOA 4BWLC 1JUBA 4E8DA 2F38A 1JUEA 2BVYA 3SEPA 3WMBA 3AIEA 3KRSA 2V5JA 4RX0A 1ONRA 5A1AA 1RALA 2VCBA 2YDQA 4D6DA 1SM9A 1A5BA 2XIJA 3NDZA 2V2HA 1HT6A 5H1WA 1YDYA 4PMDA 3T09A 4AEEA 1FWJC 1DJHA 3LCFA 2Q3OA 3DKJA 3K1GA 4BEUA 2BFGA 1E6PA 2BVTA 3QBUA 2E6YA 3FYOA 3U2ZA 3W7GA 5D9OA 2EPNA 4RV8A 9XIMA 3AS1A 2GK1B 3MSDA 1RZMA 2JGQA 2GUUA 4JYFA 4PCFA 4TU1A 3R79A 2Y85A 2VGBA 1JEZA 2GGHA 4WSHA 3I3DA 3QC3A 3SCNA 1H11A 3BW3A 1X7FA 2FFCA 3WLLA 7ENLA 2RKXA 3TN4A 3NOEA 1JPDX 4MKNA 3M43A 2GQ8A 2QDHA 1DWGM 3MU7A 1RK5A 3NQ7A 2QR6A 5SWUA 2HNHA 1JZ6A 3HQPA 4FXJA 1N8WA 4DO7A 3KXQA 3O15A 4O1FA 4R7WA 3USZA 1Q4NX 4C6OA 5BXTA 4CQCA 3BAJA 4JKMA 1ZRQA 1IYXA 2VEFA 3UR7A 3RYSA 3ZSTA 5HDRA 4Y9OA 2XSBA 3MJMA 2OOFA 2CZEA 3PB0A 3EMCA 1M7OA 1AD4A 1G9HA 2QAPA 2TYSA 3R13A 3WLQA 3F4VA 3PUDA 5ABTA 2E3ZA 2W63A 1DXIA 3WD1A 2ZVRA 3H70A 3QMRA 3WY1A 5DBUA 2DT3A 1TRDA 4BI7A 2WK2A 3AJXA 3QR3A 1GOIA 4S2BA 3NXLA 3R94A 3WFLA 3CPUA 4ZCWA 4Y9AA 4V28A 3PPCA 3IGSA 3LCIA 4AB4A 1LOQA 5D9MA 1B0IA 4P7NA 1QNSA 1NTHA 1XYBA 4C90A 1J9YA 1I2QA 1LQ2A 2HE8A 4AHOA 3FDKA 3M5ZA 4KWOA 1EEXA 1EJVC 3N73A 3W3OA 3V4BA 3Q65A 4L9ZA 2WMHA 4UNLA 3SN0A 1CTNA 1F3TA 3W7DA 3I7SA 3SBFA 3P61A 1RQEA 2PWVA 1JPHA 2EAWA 3BLLA 4TVDA 2DQXA 3KTXA 1JFHA 1D3HA 5MKGB 1KXVA 2YPIA 3M0HA 4G5DA 1SO6A 1F74A 3L4WA 2WPGA 3HURA 3W37A 1EC8A 1B3YA 2GZXA 5F2GA 2VEGA 2G3IA 3GFXA 2YLAA 3FSUA 4DBWA 4DPQA 3ZLGA 3CIWA 5EMLA 2ICSA 3U7BA 2PDCA 4NASA 1LF1A 1MO0A 2QDDA 1OFQA 3EOSA 4NZ4A 4FAMA 2OVLA 3PG9A 1N8IA 4ADUA 3QXBA 1JD9A 1C8QA 3S2NA 4YU1A 3GG1A 4HZ6A 2FPTA 4XWUA 4F40A 3WQ5A 1QFEA 3LPPA 4NQ1A 1E6QM 3NXFA 5FF0A 4YVXA 3C6CA 2HBXA 3LLDA 4A22A 3S1WA 2YFNA 1UASA 2BNJA 5C2GA 1C8VA 1RA0A 4S3FA 2ZZ7A 5CKSA 4GQRA 3IPWA 4KCTA 1EJWC 3BC9A 1LZOA 3CL7A 2C1HA 4KH2A 1Q13A 3GZ3A 1REQA 1E6RA 1RBOB 3BPWA 4LXFA 1NWRA 3B97A 4DUVA 4YXGA 2C13A 4A21A 3SRKA 2JQXA 3WQDA 5EL1A 4Y2WA 3S47A 2Z1KA 2NUWA 2BOFX 4JY9A 2HWGA 5FL1A 1KTNA 4IIBA 1RVGA 4N9CA 3V0SA 3N34A 1PWMA 1ZB5A 3A5FA 1J11A 1O12A 3E1F1 1IIHA 4HPGA 1LWHA 4HPJA 4V1YA 3DYPA 2X05A 3NGFA 2HVOA 4IJCA 1OFBA 4PGLA 3W1PA 3HG2A 1K02A 4DPPA 4EKJA 1MFUA 3STGA 1VYRA 3EZ4A 1NY1A 3N14A 3TVAA 4X60A 5CZSA 2Q01A 3MSGA 3SQSA 4IGHA 3EDDA 2PDXA 6TIMA 4XK2A 3PVFA 5I6SA 3SJ3A 2GDQA 4ORIA 4GXPA 3N04A 2PAJA 4D6JA 1SO5A 3TP4A 2Q3RA 3PANA 4MY1A 3ZR5A 3SADA 1UUQA 1UWQA 2AOSA 4OECA 5IBXC 1VIZA 3P14A 1WYIA 4F0HA 4FX8A 2D0FA 5IFTA 1IWAA 1GVFA 2WOQA 2WZMA 3TFCA 2GSEA 3W81A 2PI6A 2POTA 1LJYA 3IJQA 4HYRA 3WQ6A 1LUCB 1KW1A 3VDBA 4O1CA 3IV8A 4PB4A 5A8GA 4E8CA 4UFKA 1UW9A 5BXRA 3E0WA 2V2DA 3H7VA 1VHNA 3ITXA 3L12A 2FGLA 3FGCA 1K1DA 5IOBA 5D2TA 3TYDA 1HP4A 4DO5A 4MZ8A 3NM1A 1EIXA 3LGDA 1Q6RA 1VPXA 2ZRXA 3EMZA 2HVNA 2YOCA 2ZZ4A 1OCNA 3W7HA 1PSCA 3W1MA 3GDRA 4H6KA 4F0SA 4FLQA 3DFHA 3VDGA 3UWUA 3P5YA 2F84A 2C15A 1XRVA 3HMCA 4HCLA 2PDWA 1J0HA 3GXIA 2X2GA 3H2OA 3QOMA 2OSWA 5H8PA 1BGGA 1UR2A 4H1ZA 1AD1A 1PDYA 3VD5A 4HU0A 1SW0A 5EKYA 2QJJA 3WEOA 3O7UA 4KEUA 4FNPA 4IX0A 3LXAA 4J28A 2XVLA 5BU6A 5CPTA 4MDOA 3HV9A 3T2OA 1JYVA 3NVTA 5M1TA 2IW0A 3U2CA 4GJ1A 2QGHA 1EJ7L 3UBPC 4KRZA 4GK8A 3G1HA 3VGBA 5CBBA 3PBUA 1UJQA 2OWXA 4UTKA 1QOPA 2Z6IA 4FOUA 2PWUA 5LXXA 1FVPA 1Z7AA 1FWIC 3DFPA 2QLYA 4RR4A 1Q6OA 3PPHA 1E0VA 3WUBA 1EKOA 4TTUA 2R24A 1PZ2A 4LU0A 5CC7A 1A4LA 1BXBA 2CCRA 4CD4A 3SW6A 5ABFB 3TKFA 4IMAA 2X8RA 4KERA 4MYAA 1UCWA 4M0XA 1GOWA 4O1BA 4MOZA 3L4UA 2YLLA 3GC4A 3ZS4A 1DPMA 1KFBA 2J24A 4XTIA 4U3AA 3EMQA 3G24A 3LN3A 4XZMX 2Z1WA 2ZWZA 2PZNA 1O66A 1YX1A 2V3GA 4O57A 3IVTA 2QNEA 3LQGA 1ITUA 5A6SA 1EXPA 2QVHA 3GM8A 2WANA 3TTYA 1XBVA 4ZFCA 1FH8A 1K6WA 2GGIA 3LI1A 2DSVA 3A3XA 4Q3MA 1E4IA 3ICJA 4L5ZA 4IOTA 1S2VA 2XSAA 4PA8A 2AGTA 1TYGA 2JGYA 1KBIA 3R7MA 1T8XA 3N2BA 1P4CA 3BCDA 1M41A 5I79A 1F07A 3N2TA 1RV8A 3DHPA 1V3JA 3EPNA 2Z25A 3GO2A 2RHGA 3ZVIA 1TPEA 3DFNA 4GFSA 1ZJIA 3FYYA 1XGDA 2ZTKA 1B3WA 4HNOA 2FDSA 4AMAA 1NFBA 1A53A 3CMGA 1P6BA 3S2CA 3BV4A 4G1NA 1XLIA 1XYAA 4AMCA 1O4UA 2YJQA 5FSDC 2WV8A 4UTWA 3WX7A 1E4MM 2A0NA 3EWUA 3F03K 4LGXA 3SCSA 1RQHA 4XIAA 2WB5A 5AHIA 5FCZA 3TYBA 1OC5A 3OIHA 1CXFA 1HVQA 3H4WA 1G0CA 1Q2SA 1QASA 5CPSA 4O10A 2OKTA 4MYXA 4N9BA 1P48A 3H2FA 4QG9A 3ABXA 1H1ZA 3WF3A 3UWWA 3REQB 3WNNA 1P5BA 3P84A 3VDCA 4ZBCA 1S5MA 1HKJA 1XIGA 3HQOA 3DHUA 4LANA 3P8IA 2R1PA 1UD5A 4WRHA 4GACA 3TTQA 4TXEA 2X09A 5BMWA 3SR7A 3KWSA 1PB0A 3AHVA 1PKLA 2ACUA 1RUSA 5FD0A 3WLPA 3VO0A 1SUXA 2FHBA 2PBGA 4C6NA 3N13A 3QSRA 3QV9A 3NPXA 1C9DA 3H7UA 5L6UA 4Y9MA 4JN7A 2J7EA 1E0XA 3HG3A 4RE3A 1W9XA 2VZOA 3LHUA 1MW1A 1VENA 3C0JA 3BUVA 2C1GA 3ALFA 3M0JA 2IPFA 1DXEA 3M1ZA 1V0LA 3ANUA 1MEIA 2Y5SA 3BK0A 1LRTA 1G94A 2GOKA 4W85A 3C2YA 3SUUA 3ECQA 3DOPA 3G3MA 1F6YA 3U5UA 4XTDA 1S2CA 1JJKA 3MWCA 2VMFA 2HROA 1SJDA 4AZBA 2QCFA 3QJAA 2R14A 1KGWA 3IK4A 3L4TA 3COTA 1UD4A 4WF7A 4C6QA 3WDIA 3LPGA 1BTMA 1TO3A 4XZLX 1TV7A 3JS3A 3H8AA 4E4PA 3VPLA 4LOCA 4XQ6A 2RAGA 4Z2GA 3BZGA 3W75A 3MO4A 4TQTA 4Q22A 2OSXA 4HA1A 2DORA 3WLMA 3KOXA 3ZJKA 3WNLA 4D2JA 2GK1A 2V5DA 1TELA 4UTWC 2GJRA 3RO8A 3VIHA 4NJGA 3OLEA 2QEZA 4EWND 3AC0A 2OT1A 4GIRA 3W02A 2PDGA 3WLRA 5D03A 7XIMA 3WQ8A 3H4XA 4LW7A 3F1QA 4OBRA 1DWIM 1TV8A 3GDTA 2A4AA 3DHDA 3PTMA 1FY6A 1ZAIA 1BWVA 4IMCA 3VGDA 1EX1A 2A3EA 1XQKA 2HQAA 2QJGA 4A4AA 4HSNA 1SPQA 2FZMA 3OLIA 3QW4B 1OIFA 2VZTA 1E1EA 3AICA 3L5LA 1A47A 1I1XA 2ZQ0A 1SMAA 2DV0A 1B90A 4FNRA 3SY5A 3PPFA 3LPFA 4WKHA 3BAKA 1EP2A 1YDVA 5IHSA 3OTRA 4Q32A 1C90A 1YBQB 2PZ0A 1XG3A 5HUOA 3REQA 4A35A 1XRTA 4ML4A 3MY9A 4UTUA 1P0EA 4C6PA 1GT8A 3MDUA 3QHMA 3T40A 3NL3A 1R47A 3ARPA 1SJCA 2IQTA 1XH1A 3TNBA 1JZ4A 3EOLA 1KFCA 1YNPA 2VO5A 4W86A 2WQPA 2ZUSA 2GOUA 4GO9A 3EBVA 5I3HA 5K2ZA 3LPOA 3MYOA 2XJ7A 1R3VA 3ALGA 5D8WA 4F8XA 1OF6A 1TR1A 3LOTA 2VC6A 3VNDA 4LRTA 1Z69A 2V2CA 1JIBA 2QPUA 1QK0A 3UZ5A 2OXNA 3QYQA 1OHLA 2XZ9A 3LM7A 4BI5A 2GDVA 1E3XA 1GQIA 4CKQA 1KWKA 4REQA 3LHZA 2CXEA 4K68A 3MSRA 3CQJA 4I9AA 1DP0A 5IDIA 1XBXA 1C8XA 1Q8AA 1JPMA 2ZX9A 2XGZA 1ESWA 4LC8A 2OOGA 4XBKA 3T4WA 1E56A 2OLSA 4NHVA 3PSWA 2V38A 4UR8A 1TWDA 5I3GA 5C6MA 3WDQA 2DGAA 3UCDA 2WM0A 3E9AA 2WCAA 1E0WA 2VGGA 1IT7A 1LOSA 4AX6A 1AJ2A 3CWHA 1JGIA 1WAWA 1KM4A 1ISYA 4LWWA 4JTCA 4KQNA 3ITLA 3PZ9A 1GYLA 1XCWA 5CGTA 3VK5A 2P50A 3WQGA 3VNKA 1BLIA 4QBXA 3UZZA 1W9UA 1GTHA 3VIOA 1WXZA 3SJNA 3MI3A 3A64A 5D33A 3RO6A 3LV5A 2VZSA 1UKOA 3R10A 3V18A 3GUWA 4IP5A 3H24A 1BXCA 4YVPA 1ALDA 4JX4A 2NLYA 3C2EA 3M0ZA 3QGVA 1DBTA 3LXCA 1IXPA 1NWUA 3TNOA 4K7YA 4PL2A 1U33A 5KZEA 3T0BA 4AEFA 3TJ4A 1XYZA 2QF8A 4TX6A 4ATWA 2AGKA 1RBLA 3PPGA 2E5DA 1TREA 1XYCA 4MUPA 3RM8A 4BJHA 2CHOA 3KVMA 4LYKA 4XZ9A 4JQ2A 3VABA 2PTWA 4LBUA 1P7TA 3OVPA 3UCQA 3G1SA 3L66A 4EACA 1Q6EA 4DUXA 2J7BA 1VFHA 3RAOA 1GQJA 4QLKA 2VEKA 1NDYA 4N7QA 3BTNA 5D2XA 3CYVA 1UROA 3NQ6A 1FWRA 4POCA 3BOLA 4H3DA 4JOMA 2YR1A 3NTYA 1B3XA 4AQLA 3PJWA 1QW8A 2XFWA 3GE7A 3IGHX 2O9PA 1W5OA 4DM2A 3GVRA 4ECLA 2G37A 2DVUA 2YCJA 2PB1A 2QYGA 4HHMA 3F5LA 2NQZA 1VFTA 1YE6A 1QPNA 3N11A 4ZQOA 2PMQA 1JCTA 4G1KA 4PCPA 3TZFA 4I9MA 5A69A 1XDLA 1S2UA 3CXOA 1OG6A 1W1ZA 2YL8A 5M2FX 2RGMA 1JZ5A 3R8RA 3ATZA 5AB3A 2JBMA 1TWSA 2I5IA 4JTKA 2F2HA 4JEJA 2QDEA 1OFRA 4Z1AA 1BAGA 3C0LA 3KBWA 2D2OA 2INFA 4XUGA 4HOZA 3BURA 2A85A 1UKQA 4DHGA 3EKLA 2XPKA 3NGJA 1Z8AA 4WQ6A 4C5ZA 4L6OA 3L4YA 1XYFA 2G41A 1UZ1A 3E5PA 4GXWA 3G6MA 3F2CA 3CO4A 1JPKA 3OU8A 3QPYA 1PX8A 3DFQA 3PZVA 4LEQA 2VFFA 3ITVA 3G1AA 4PH6A 3PF3A 3POCA 2E68A 1O7AA 2GVJA 4O0QA 1K03A 2NT0A 1NQKA 4MTVA 3VUPA 2HMCA 1V6XA 4XVDA 5EA9A 3BSMA 1TPFA 3N6HA 3MP4A 4FR6A 4UCGA 5KEZA 2FZ8A 5I09A 1WZKA 2X1RA 1EJRC 4H6QA 3TC6A 1S5VA 2BHYA 4JICA 1HW6A 4JNZA 2XIMA 2E40A 3F2BA 4KT2A 5DY2A 4ROQA 3N3MA 2E1DA 1UR8A 4NJHA 4UNKA 3OG3A 1TG7A 4RZ6A 1UWRA 2PU1A 4FPSA 4MLJA 3LEPA 1DEDA 1GZGA 3N19B 3AMDA 3ZJ7A 2CLLA 4UNIA 3C2OA 1OFDA 5CJMA 5H8UA 4O4VA 2EPKX 3UXDA 2R8WA 2YW4A 4H7ZA 4HNCA 2ZX6A 4D1JA 4GZEA 1HJUA 1MUCA 1RK6A 3OP2A 5BROA 3T9PA 2NVCA 4CCCA 3DGRA 1CWYA 1EYEA 3ZT6A 1UUMA 2BX7A 2J7HA 3BLFA 3QQ0A 1X6NA 3GIYA 4MG4A 3RM9A 4IFOA 4LT9A 2X40A 1WB0A 1WOAA 1G5AA 4I9JA 2QUNA 4BFAA 4K6AA 3CZEA 1FOBA 5LA0A 1XLLA 2HPMA 1VYPX 5BOEA 4DB7A 3FA3A 1V02A 5I06A 3SQLA 3PJTA 4JKLA 2B7PA 3DFTA 4DJDD 3EB4A 1LDCA 1C9WA 5FAJA 2BB0A 1UWSA 1UMYA 4LV4A 3UR5A 2Z6JA 3A24A 4LJ3A 1TPB1 2VX6A 3ID7A 3LG3A 4IQDA 3WH6A 1QOXA 3W76A 2VTFA 1AJ0A 3AYTA 1O5KA 1QU4A 4PL1A 4FLRA 4DYKA 1XLGA 3PAJA 4EAMA 4HZ8A 2R91A 1CIUA 1D7KA 1I4NA 1QBBA 3MBDA 1R5YA 3CWOX 1ZCCA 3NQVA 3UJSA 4NAFA 3OW1A 5KTLA 4L1WA 1FWCC 4GYJA 3EX4A 2YIHA 3GTXA 4NZFA 1DJQA 1MXSA 3EKGA 4LCQA 4FF5A 1UOZA 3VNLA 5DXXA 2XFFA 3T6CA 4N6FA 1L8PA 3T1GA 2BXVA 3KL5A 3WQFA 3HPFA 5E0CA 4C91A 3BW2A 3W2LA 4PUUA 4XKYA 3B4YA 1D3GA 2C14A 3OIXA 5XIMA 5A8NA 1IWBA 2PP1A 4WZHA 3L4VA 5HWMA 1V03A 4AWSA 2V5BA 3AISA 3VKJA 5CZ0A 3KP1A 1VS1A 2DZPA 3QEZA 4GYPC 1QJWA 4B5WA 2YL9A 3IJIA 3H2CA 3BJTA 1A5MC 4DBUA 2GVYA 5CLWA 3GFZA 5EU9A 3UJRA 1IEVA 4F3HA 3R0KA 3KE0A 3ZT7A 4LTSA 1VBHA 1W1VA 1A5OC 1VFLA 4FXFA 3CHCA 1DE6A 4L9XA 3WD2A 1B9ZA 3VU2A 3WLJA 4FI4A 3FKRA 1YEYA 3NO3A 3R89A 3K2GA 2WKJA 4HCHA 3UY7A 3DECA 3PHAA 1GVRA 1H60A 3BOXA 3VNYA 4AFYA 2YBUA 4S3KA 3OGSA 4GCXA 2CBUA 4CU6A 4H83A 4EAYA 2RGLA 1SJBA 2VRKA 3W7QA 3EA1A 4B2DA 1OVDA 1PIFA 3AIBA 1IXQA 4HHHA 1ICQA 3GKAA 3BSHA 1DWFM 1HJWA 1TE1A 3GTNA 1A0EA 3VD3A 4CQ9A 1RLCL 1GJWA 3M0IA 4J2PA 5AHFA 3U2EA 5CPQA 3KHDA 3W71A 3GY1A 4KCWA 3BW4A 4JIHA 2Q8XA 3FJNA 3KCJA 1PUDA 1TCMA 3B9NA 1M7XA 3U57A 3IV3A 4M7SA 4UTIA 3N4EA 3RJYA 1D3CA 2OJPA 5EY5A 1ADOA 2Q09A 3B8IA 3LCWA 4WOQA 2A2IA 3NL2A 3MUIA 3NURA 1KD0A 2WJFA 4GQGA 4L4LA 1ZSXA 2PTDA 3VVGA 3EEZA 3VKCA 4MDPA 3GDBA 3WNMA 5G2HA 3RM4A 1TWWA 1EF2A 1QDSA 2WSQA 4QQUA 3AHZA 1OC6A 3S8HA 3O6YX 3KL3A 4EF9A 4FXSA 3GVWA 2CIPA 4MNKA 1MZRA 3SY1A 3A13A 1Z3NA 4HJWA 4IZGA 4KGLA 5D09A 1SFJA 3RFAA 4K38A 2UY4A 3BARA 1R2RA 1JYNA 1UWIA 2C7FA 3OEXA 2FGZA 3GXFA 1YBQA 1V8EA 4CNSA 1PS9A 5A3HA 2FB3A 4GKLA 3FJ4A 4G9PA 1XCXA 4DUOA 3OA5A 3BE7A 4QIUA 4JFTA 4QEEA 5HATA 3MP5A 1UBSA 3NZPA 4YCOA 2WM1A 3TROA 3R0DA 2NQJA 3N2OA 3MV11 1XIMA 3NQBA 1FWBC 4OE7A 2W0UA 1H7XA 4XKMA 4JFUA 2E6DA 3UJFA 3FJLA 4GGBA 2DZUA 2XWEA 4HK6A 1MXGA 1OIMA 4XO7A 1V6VA 3W7IA 1XYMA 2ACSA 3QPZA 3W82A 3QGKC 4QTGA 4N9DA 2VX5A 3NQ8A 2PLCA 3K4WA 6XIAA 2Z27A 4C1KA 1GGOA 3W7EA 4B4HA 2WVVB 4H8NA 4M7TA 1EP3A 3VFCA 4LAMA 1VKFA 2DH3A 3S42A 1SFSA 3ZWTA 6TAAA 3ABOA 3STCA 1XLHA 4BWLA 1DE5A 4DAFA 1GG1A 4I7VA 3NJ3A 3S6DA 1VJIA 2EBNA 1U1HA 1XM3A 1MNZA 1HF6A 1UPPA 3DI1A 2WWDA 3GAKA 1F3WA 3HG4A 5DMLA 4WIWA 1R2TA 4BS0A 2YX0A 4FP1A 3M5XA 3ARQA 3F5KA 1N2VA 4HD5A 1SO3A 3A3WA 1M5WA 1OGGA 1AQFA 3GYCA 3VOGA 3PN8A 2QJHA 3S6TA 2ZVIA 3ABZA 1FDYA 2QIWA 3EWZA 2PDBA 3GW0A 3TA6A 3O16A 3IEBA 4O4WA 1DJGA 5HK4A 1Z41A 1LYXA 4GWEA 2PDJA 1DVJA 4GC3A 3I6TA 3W7CA 4YTTA 3GR8A 3WLNA 1NARA 9XIAA 2FZ9A 1BPLB 3RU8X 2CLIA 4ORMA 4MFDA 5FJPA 3BJFA 5D2VA 3S1GA 3VIKA 4GPNA 3CV6A 3RLHA 3CQ0A 2BG5A 1W17A 2ISDA 3U6WA 3QSTA 1J5TA 4S1FA 4E2BA 2PDPA 4UR9A 1EIBA 1C7TA 5BXPA 1S46A 2NV2A 3LS9A 4IMFA 4YCPA 4DZHA 1HL2A 3IIXA 4M1RA 3P3BA 1RSCA 4LB3A 1XH0A 4J7RA 1XP3A 1A5CA 4PMXA 1UA3A 1TV3A 3AUOA 3OLDA 1LT7A 4ZQPA 1BHGA 4A8LA 1VFUA 1TTQA 3VZYA 2XHYA 3TA9A 3B9OA 2J9ZA 5D8ZA 4DVOA 1GVSA 4B4FA 3O06A 3V16A 4AD2A 3CS2A 1HJVA 3ZMRA 1XV8A 1EGZA 1QPKA 3NFUA 5M5DA 4O11A 4S3GA 3WUGA 5FJOA 1FWAC 3LENA 3MI6A 2Q02A 4ZFMA 1K6AA 4E4FA 2G95A 3V7PA 1V6TA 1VHCA 3A23A 2RDXA 4DYJA 3BL3A 4HP5A 4AD1A 2DT1A 5HAOA 4JFVA 1TV5A 3LB0A 4MWAE 2WVVA 2FVLA 3CAVA 4JX6A 2FDMA 1OFAA 1BQGA 1U5VA 2PGEA 4DJEC 4M6VA 4L6HA 4B5VA 1DIKA 2P10A 5DELA 5REQB 1ZUAX 3CNYA 3GHTA 3K1DA 1HTIA 1LRNA 3GVVA 3QYSA 3OHIA 3QZEA 3G0XA 1QK2A 4W84A 1W31A 2DQWA 1GEHA 4JY8A 1B30A 2WSKA 1UWUA 3ISIX 3ARSA 1GVYA 2O92A 3O6DA 4GZIA 4J3XA 3SCUA 3D3AA 1PZ0A 4GXMA 4XD3A 1UR1A 2IPJA 4GJIA 2Q8ZA 2JIEA 5JUVA 3FA4A 3UA3A 3NVDA 3P8JA 2DJLA 4WY0F 4PMOA 1PEZA 1HFBA 1I60A 3FGCB 1XPGA 2FB2A 3VIGA 3TQPA 2RH9A 1J6OA 3BWWA 4UQDA 3UWEA 3V5CA 1V4YA 2HCVA 4R85A 3LD5A 3LGEA 1MDLA 2WKGA 3C86A 4K8GA 3T05A 3GSMA 4XV0A 1GONA 2QMKA 4ZOBA 3TW6A 4ZB0A 4LFYA 2VR2A 4ILSA 1CX9A 2G3FA 2P0OA 4M82A 1NP0A 3B8SA 3HGRA 2FJKA 3MW7A 2GUYA 1U2YA 3T8QA 2CW6A 1VPQA 5F4XA 1JF6A 2D23A 4FNQA 3OPSA 2Y70A 3EEGA 3VNJA 2QCNA 2VFDA 2GGEA 4IFRA 1W3LA 4PCTA 1PJ9A 1PAMA 1ZHAA 2WBGA 3SZ8A 5TBOA 1GW9A 5JIWA 2NWRA 3GHSA 2EXOA 4IMDA 2J74A 1Q2RA 1FWSA 1FWGC 4JKKA 4PTVA 2NVAA 3EGJA 4L56A 2XIQA 1CXKA 1T41A 3LCLA 5FJJA 4XAZA 3W1UA 2PDIA 4HYWA 1AK5A 3Q37A 2VJXA 5MF5A 4W7WA 1U1UA 1SZNA 1OFEA 3WUEA 4IM4A 4W7UA 3W70A 1TV2A 2CFFA 4ES4A 1ONXA 1FHUA 1JDDA 5I3JA 4L61A 4ZEPA 1KCKA 5I02A 1UG6A 5AZ1A 1E1CA 4JTQA 1A5NC 1KFJA 3P6LA 3DFYA 2DSUA 1YTEA 2OEMA 2ACQA 4CD7A