1HJQA

Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
332
structure length
332
Chain Sequence
ALQYKGVDWSSVMVEERAGVRYKNVNGQEKPLEYILAENGVNMVRQRVWVNPWDGNYNLDYNIQLARRAKAAGLGLYINFHYSDTWADPAHQTTPAGWPSDINNLAWKLYNYTLDSMNRFADAGIQVDIVSIGNEITQGLLWPLGKTNNWYNIARLLHSAAWGVKDSRLNPKPKIMVHLDNGWNWDTQNWWYTNVLSQGPFEMSDFDMMGVSFYPFYSASATLDSLRRSLNNMVSRWGKEVAVVETNWPTSCPYPRYQFPADVRNVPFSAAGQTQYIQSVANVVSSVSKGVGLFYWEPAWIHNANLGSSCADNTMFTPSGQALSSLSVFHRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-1,4-GALACTANASE
publication title Structure of Two Fungal Beta-1,4-Galactanases: Searching for the Basis for Temperature and Ph Optimum
pubmed doi rcsb
source organism Humicola insolens
total genus 129
structure length 332
sequence length 332
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hjqA00
4CN6A 2PC8A 2ZWZA 2D0FA 3MUY1 3TA9A 2CITA 1KBKA 1E3ZA 3CH9A 4J3UA 3WD1A 4FLOA 1HP4A 3WF0A 5M03A 3OB8A 3WNNA 1PZ2A 3A4WA 4AZ6A 4CD8A 3AZRA 3GXDA 1CGTA 1GHRA 4U33A 4NF7A 2BV9A 3RM4A 2J7FA 4HU8A 4UOQA 1CXIA 1LL6A 1I1XA 3THDA 3WY1A 1KGWA 1J01A 1JI1A 4QCFA 1UYQA 1V0NA 3W29A 2ZXBA 4KGJA 3PN8A 3CUFA 4AD0A 1UWQA 1ECEA 1E0XA 3I3BA 4AEFA 4HU0A 2O9TA 3ARQA 1E6PA 1XH2A 4PN2A 5GNXA 4BS0A 1KXQA 1E5NA 3DYOA 1PJ9A 3WF3A 3WD0A 4WSJA 3QGVA 4GZIA 2WBGA 3PZQA 1M53A 3MSDA 4BQ4A 4ZE5A 4NSBA 1E43A 2W4XA 1WDPA 2W67A 1HJVA 4ML4A 3VD5A 1PX8A 2PB1A 2J7DA 1CYGA 1VRXA 1JAEA 2WNWA 2J77A 3VD3A 2E3ZA 3RMEA 5FD0A 3HJEA 5CPSA 4JHOA 3SUUA 2JFEX 3BSHA 2FHBA 5IFTA 5A2BA 4J28A 4CD5A 3APGA 1LG2A 5JIWA 5HPOA 3RPMA 3IJ7A 3WL1A 2IUZA 3CUGA 1ISWA 3KL5A 2X2YA 2DPEA 4PMYA 4D6HA 5F7UA 1JNDA 3CHEA 4MTVA 1V03A 5I79A 1BYAA 3CTTA 1ISVA 2CESA 3L4ZA 1GOKA 2VCAA 3GXFA 1BG9A 1B3XA 3EMZA 1V3IA 4J3VA 3SUVA 1KXVA 1TCMA 3RJYA 2VZVA 1JYWA 1JYVA 2YL5A 5BXRA 3II1A 1Q6FA 3K8KA 1MQQA 2BFGA 2EEXA 3WH8A 1HX0A 3EYPA 4U5IA 4HPHA 1GOQA 3AIQA 3AS0A 4U3AA 3W26A 1K6AA 4YPJA 1B3YA 3WMBA 4HA3A 3ZT6A 1MW3A 3GTNA 4AIUA 3CMGA 2QMJA 2X1IA 1JXJA 3OIHA 3AZSA 3I3DA 2WMKA 4ZXOA 5ABFA 1X6NA 3WKZA 3MKKA 3BAKA 3B9AA 1KQYA 1E6QM 1PZ3A 4A3HA 2PWEA 3POHA 2O92A 1FHDA 1L0PA 1OWQA 1OT1A 3OGVA 2XIBA 1WPCA 4M56A 3AROA 1WP6A 1WAWA 4AD2A 1E0VA 4ZFMA 1V3MA 3B9DA 4UQCA 5E0CA 3NUKA 4AW7A 1GJWA 1BVZA 1OCQA 3SCTA 2VCCA 1UD6A 3FAXA 1H41A 1XYFA 4MNLA 5JIPA 3VNZA 4D6EA 1JD9A 1GHSA 1MWOA 4W88A 3TTSA 3DHUA 1M03A 2CXGA 2E8YA 4QFUA 4AZIA 4L4PA 1UR4A 5EFDA 3W27A 2VNCA 1UWUA 1EDTA 1ZBWA 1CTNA 1UG6A 1UQYA 3W38A 2QHAA 1CGXA 4FLSA 3SCRA 4HZ7A 2YLLA 1AQMA 2DSWA 1TA3A 2J7BA 1E73M 2X09A 5LYRA 1K9FA 2WSPA 1V0LA 3T2PA 2XJ7A 2XM2A 1R7OA 3M46A 3WDIA 3AS1A 4WKAA 2XUCA 2XM1A 1E72M 1LWHA 5D9PA 1ZBVA 1B3VA 1M01A 2XG9A 5CPTA 3ARYA 3A6OA 1FHLA 3WIJA 1XSIA 3QHOA 2WC7A 4FK9A 3LPPA 2J78A 1JZ4A 1K9DA 1UH3A 1XCWA 4CVUA 1GJUA 1OIMA 3PZ9A 3VIGA 2VRJA 3WDQA 2J7EA 1JGIA 3IAPA 3AMLA 4P8VA 2GVYA 1UOKA 3TP4A 1VB9A 2EO7A 4ZE4A 3AIBA 4IISA 5DMYA 3VGDA 3SCNA 1ODZA 4GQQA 3SCUA 3AXHA 2JIEA 3ZSSA 1JZ8A 3WNKA 2GJRA 4JCLA 1DTUA 1CIUA 4WKFA 3WDRA 4JFWA 5I24A 3K46A 2D0GA 1A3HA 4A4AA 3OZPA 4J27A 3L4VA 4PMXA 1GVIA 4B3LA 1JFXA 2CBIA 4GPNA 2WW5A 1TZ7A 2GK1A 5A2CA 1R86A 1XSJA 2GUYA 2WPGA 3QHNA 1JAKA 1PPIA 1OGGA 2VO5A 3KL3A 2HVMA 3VGHA 4AZ7A 3WF4A 4S3KA 3WQ8A 1OGBA 1J12A 4JCMA 4RE4A 3ZJ7A 1UD5A 1B31A 4EKJA 3NSMA 2ZX5A 2YA2A 3VDHA 4MPKA 3TOPA 2WHJA 4KGLA 4P8XA 5CGTA 1U33A 2E9BA 5E6YA 2EPLX 4HOWA 4WJXA 4CCDA 4QCEA 4MB5A 4HA4A 1W9XA 3CZLA 3EDKA 3NYDA 3G6LA 1RD6A 4PUEA 1UWSA 4AY1A 1J0YA 5C8BB 4WKHA 2BHYA 1W3HA 3CO4A 5DT5A 3EDFA 4QAWA 2PWGA 2VZTA 3U57A 2ZUVA 1FA2A 2Q8XA 3RIKA 1UA7A 1E4NA 5M3WA 1NWUA 5A6BA 1E6ZA 2Y4SA 3OA5A 1UKOA 2GJXB 1UKQA 1EQPA 4DWSB 3GYCA 2EPMX 1B1YA 2OSWA 4AMCA 1LJYA 3CZ8A 1JFHA 1H0IA 1QNSA 1IT0A 4P8UA 1QOXA 2D3NA 5ECUA 4ATWA 2Z1SA 3MMWA 3SCWA 2QMKA 1CENA 5JBEA 4UR9A 2AOSA 1UH4A 1KXTA 1JZ2A 4TX8A 3VGGA 3NIYA 3GZAA 1KXHA 3MV01 1C91A 1D2KA 1XC6A 1A47A 1OT2A 3ZM8A 2CCRA 1G9HA 2DSVA 3GNRA 2A3AA 2JIWA 4AIOA 6TAAA 2XVKA 4AC1X 3CUHA 2EBNA 4E2OA 4DM2A 2O9OA 2XSAA 3W0KA 4GZJA 1E6XM 1LF1A 4V28A 2ZWYA 2BY0A 3AIVA 1ZBCA 2A3CA 2J74A 3RDKA 4AZHA 3IJ9A 1UZ1A 2CERA 2NT1A 5LA2A 1C8XA 1CBGA 2DDXA 3BCDA 2E4TA 1ZB5A 4UFJA 3GH7A 1CPUA 3EBVA 4OZOA 2IXVA 1BVNP 2XFYA 1EQCA 3ZJKA 3PTMA 3WEOA 4OBSA 2UY5A 3WF2A 4AZCB 4X9YA 4UZSA 4WF7A 4M1RA 4BF7A 4W8AA 2Y8KA 1B3WA 2ZUSA 4URIA 5LA1A 1QHOA 3JUGA 9CGTA 3BGAA 1SMAA 2D2OA 2A3BA 2VUYA 1UR9A 2OYKA 1WNOA 4ZENA 1FFRA 1W32A 1Z32X 5FOOA 1AVAA 1J18A 1SR0A 5HXMA 1J0ZA 2E0PA 3CHFA 4UQ9A 3UERA 2JF7A 1QVBA 4WSKA 1Q6DA 5BCAA 2VURA 1KQZA 1OD0A 1NWSA 2V5DA 1GOMA 1W1VA 2CBUA 4JFSA 1HKIA 4TVCA 5CJ5A 3PZIA 2W63A 1BTCA 4PMNA 1Q4NX 4F66A 3L2MA 3THCA 1XRVA 2X05A 3KZSA 3T09A 1XGZA 3QOKA 3W6MA 3W53A 4Z2JA 1E4LA 1GUVA 2RGMA 3ALGA 2PWFA 1VAHA 1R87A 1MXGA 2CBVA 2YDSA 3HMCA 1KR0A 4CU6A 3WBEA 4UTFA 4M81A 4AEEA 1WZLA 4P8WA 4XX6A 2OWWA 2Z1KA 2D22A 5EMYA 4GI6A 5HNNA 2WWCA 4JKKA 4MADA 8A3HA 2VZSA 4OUEA 3MSGA 2YKKA 1ZS2A 2XVGA 3ARXA 2BNJA 2WC4A 5JBDA 5ABHA 2YBUA 1CXLA 3SCSA 1MFVA 4TTUA 1ZBKA 4YHEA 2WM0A 5I2UA 2F61A 3MS8A 4RL3A 3WQ6A 3WL0A 2PI6A 3AFBA 4MNJA 5CQ1A 1OBAA 4TVDA 1QNOA 1UH2A 4AZCA 4BCEA 1J0HA 4AISA 2W61A 2DSZA 2VRKA 5A8NA 3UG5A 1ZJBA 4PCTA 1PX4A 4OOZA 3WENA 3RM9A 4K68A 3W4RA 2DIEA 1BYBA 3WF1A 4UOZA 2BVYA 4W5UA 4PMZA 1LQ0A 4AIEA 1GQLA 1DWFM 4F9JA 3GNPA 3GM8A 3WUEA 3GBDA 3ECQA 1KWGA 3F4VA 2YOCA 4MJ2A 1RP9A 5IHSA 1X6LA 4UFLA 2GDUA 1WB0A 3UCQA 3N15A 1JXKA 1VEOA 3AHYA 1J11A 2WMFA 1JZ5A 3T08A 1VEMA 1GOIA 1EIBA 4M24A 1DWJM 1E70M 5BROA 2EQDA 5CXPA 3W6LA 1SYTA 3UG4A 3ARUA 4PTMA 3G6MA 4PTWA 3SCQA 1NP2A 4AZGA 4V27A 1FP8A 4AD4A 5M17A 3FW6A 4H41A 1JF5A 4IPLA 4MDPA 2PBOA 3CHDA 1TMQA 2PWDA 3BAYA 1NARA 2UY3A 2D0HA 4PMRA 3AS2A 4XZBA 3HN3A 3RILA 1EO5A 4FLRA 4KH2A 1QI0A 1TUXA 2GDVA 4TOQA 5GNZA 1NWRA 5KZ6A 4DUVA 2XFFA 2J8FA 4XZWA 1TR1A 5A8OA 4ACZB 1SMDA 4UOJA 5GPRA 1FOBA 1V02E 2J75A 2W66A 2WXDM 4MNMA 1AMYA 3CZKA 3VIIA 1HJQA 2GFTA 3GXIA 4AZ5A 5A6JA 5A6BD 3OLGA 3VDCA 2MANA 3PTKA 1Q6GA 3ARVA 3O9NA 5E9AA 5E70A 3J7HA 5GQBA 3U5UA 2QPUA 4GQRA 5I3DA 3RJXA 1JYNA 4Y7EA 2J4GA 4HZ6A 5A1AA 2HISA 4R27A 7CGTA 2YIHA 4JZ5A 2QPSA 1E1EA 3M6DA 5C71A 4D6DA 3AMCA 1GORA 5CG0A 2VL4A 1LLOA 4GO9A 1V3KA 3IAQA 4M8UA 2BVDA 1HVXA 1AQ0A 1MQPA 4NRSA 1B30A 1G94A 1V0MA 3BAXA 1V3JA 2VC9A 3UETA 3MUAA 2BXYA 3VX1A 4H2CA 1HJSA 4MB1A 1HJXA 3CGTA 1UR1A 3OLEA 2WCSA 1D7FA 1W2VA 2WCAA 2WHKA 2WVUA 3TONA 1EH9A 2QV4A 3MANA 1C7SA 1GQJA 3T0AA 4TTGA 3N11A 4PRWA 4W86A 3AHVA 2DIJA 3WH7A 1EOMA 2W62A 5A8QA 2XSBA 3VIJA 1QW9A 3VIFA 1HKJA 1W1TA 3UR8A 3N12A 1US3A 1CZ1A 2G3JA 1GOWA 2VZOA 2YBTA 2O9RA 3SCPA 1TE1A 4JL2A 2J62A 3ZT7A 3ZOAA 2F8QA 4UQEA 4FLQA 3VM5A 2XGIA 2WVSA 2WKLA 1E5JA 2XPKA 2AAAA 2CBJA 2YLAA 1UKTA 3VDBA 1W3LA 2BHZA 2V3EA 3WH6A 3AICA 3W37A 3LPOA 1X1NA 1H2JA 3AMKA 4U2ZA 4HMEA 2EPNA 1BAGA 4NRRA 5IHRA 5I23A 1F4AA 4CGTA 4C7DA 1QNPA 4UZUA 2QLYA 1V3LA 3ZIZA 4LX4A 1EHNA 4UQBA 3IK2A 2ZUNA 3MO4A 2WLYA 5AC5A 3FHQA 1K9EA 1CGWA 3WFZA 1QI3A 4W8BA 2WB5A 1TFVA 1G0CA 2Y24A 1FH8A 1KR1A 3ZJ6A 2NSXA 4B9ZA 2JALA 1ISYA 1ZJAA 5BXSA 2W5FA 4KRUA 4PBGA 1HXJA 1UR0A 1B2YA 1C3FA 4JHZA 2IXUA 2WZEA 1QNQA 3IANA 1E15A 3L4TA 1LWJA 1VJZA 3VGFA 2WMHA 3OGSA 1V3HA 1OINA 1W1YA 2ZXDA 4JL1A 2YA1A 3MMDA 4W89A 3L4WA 3OG2A 4RE2A 2W92A 1W9BM 2D20A 3D5HA 1NM9A 1G01A 3MU7A 1H49A 2ZXAA 1BG4A 2YA0A 1V6WA 4LYRA 1EXPA 3SUTA 4H04A 3VOCA 7A3HA 1V0KA 4U3CA 1WE5A 6CGTA 1LL7A 4HZ8A 2C7FA 1BYCA 1G1YA 1NOUA 3BMVA 1H5VA 1PEZA 3MMUA 1DWAM 4CVWA 2OYLA 4J3WA 1W9PA 3AZTA 4D6IA 3WDHA 4Q22A 1JG9A 4OKDA 3UG3A 3ZMRA 5I6SA 2UY2A 3PZVA 1H0GA 3VM7A 1V6UA 1XCXA 2AMGA 5BWFA 3WD2A 2J7GA 1VENA 4CU7A 4P7OA 3CZJA 3BC9A 2D1ZA 1UZ4A 1KGUA 1BF2A 2OLHA 4GIAA 1DHKA 2EPKX 4MAZA 3DYMA 1V08A 1W2PA 3NJ3A 2DQXA 3WQWA 3PZMA 1KGXA 4CUCA 4TX6A 2YDRA 5D9NA 1HT6A 1H3GA 1EGZA 2G4FA 1FH9A 4BA0A 1EDGA 2WVVB 3PZTA 1CXFA 3SUSA 4B16A 2V3GA 3WH9A 2ZUUA 3CBWA 5A95A 3KE0A 3WEMA 2BHUA 4FF5A 4PCSA 4PMUA 1KWKA 1MW2A 2E40A 4QLKA 2WVTA 1L8NA 1WCGA 2VMFA 5E0FA 4P7RA 1MYRA 3VD9A 3K8LA 2YL9A 1R7AA 2OYMA 1MFUA 3WSUA 4ZEPA 3L4YA 2ZIDA 1Y7VA 4ZXLA 2V3DA 2X0YA 2WMIB 5EB8A 1UQZA 3WNLA 4UFMA 4J3TA 1CDGA 5HDRA 5AYIA 1PIGA 1UD3A 2X8RA 2XIIA 1H4PA 2NT0A 3AOFA 4JIEA 4HMDA 2XTKA 1ODUA 2CYGA 4AZBA 3SEPA 1MVYA 3GNOA 3AXXA 1C7TA 5D9OA 2YL6A 1VBRA 5A6KA 2ZXQA 3S6TA 3WD4A 1UD4A 3BXWA 3WUFA 2Y2WA 3DYPA 3N1AA 1WDQA 2CKRA 3OLIA 1V6XA 2CHNA 2ESCA 3BH4A 4Z2KA 3ZT5A 1KBBA 1VJSA 4X0NA 4F8XA 4W93A 4GINA 4GXPA 2DH2A 4MDOA 2G8ZA 2OWXA 4CKQA 1UKSA 4B9YA 5CZKA 1HL9A 1LL4A 2VVNA 4HOXA 2FGLA 3AQUA 2CNCA 4OOUA 1VEPA 7TAAA 4PUDA 5A3HA 2TAAA 3QR3A 3UEQA 1B9ZA 5BYWA 2J7HA 4PTXA 3HU7A 3K4AA 4PMDA 5A6MA 3O6AA 4FMVA 4Q7NA 4CD6A 2CETA 1OB0A 2DSKA 1VFMA 2GJXA 2BY1A 1HL8A 4DWSA 3CIVA 2VI0A 4UQDA 4UQAA 1B90A 3TTOA 4W7VA 4D1IA 3BAWA 1IV8A 1VBUA 3B9EA 3MUIA 4W85A 4J7RA 1WZKA 3ARPA 4D6GA 1QI2A 4PTVA 2Y5EA 5HOSA 2DH3A 4W7WA 3L2LA 2Y8VA 5JUVA 1JF6A 4YN5A 2G3IA 2J79A 4E8DA 2W91A 4HP5A 4AWEA 1HF6A 1ISXA 1Q6CA 1HKKA 2E8ZA 3AHZA 2ZE0A 3OGRA 3WUGA 5BXTA 1UD8A 5EBAA 3AIUA 3TTYA 1GPFA 3VIPA 1QI5A 4JFVA 3WELA 2BVTA 1I75A 3WQ4A 3VPLA 4CN1A 3VNYA 1R8LA 1PBGA 4P7NA 4YHGA 4BQ5A 3VIOA 1GQIA 4PSPA 2XVLA 2DEPA 3LPFA 1J0JA 4M80A 4W5ZA 1UKPA 1PAMA 2ZX9A 5DFAA 4JFTA 1UHVA 1E9LA 5I0DA 3WBAA 1I1WA 4MB3A 4GI8A 3T2QA 1EOKA 4LPCA 2XGBA 3WNOA 1FH7A 2FH6A 3CZEA 2EXOA 3ARRA 5BXPA 2WMJA 2YJQA 4GO8A 1U2YA 1J10A 1DEDA 5FL0A 3AIRA 1BSIA 1ZU8A 1US2A 4H8UA 3ZR5A 1WDSA 2WAGA 4M29A 1XYZA 1ESWA 5HPCA 3OBAA 3VD7A 1P6WA 1CLXA 3BLKA 3WDPP 3BAIA 3F5JA 2WBKA 3SCOA 2DSUA 1V6YA 5AYBA 1ITXA 2DT3A 2X0HA 5CLWA 3CUJA 2FDMA 1UWIA 1UD2A 1HN1A 5A6LA 1WZMA 2OSYA 1TVPA 5FKYA 4Z2LA 1E4MM 3T2OA 2QF8A 1XHGA 3MUZ1 4LXFA 5CGMA 3CHCA 4D71A 1R85A 2C8NA 3POCA 3WD3A 4ACYA 5CPQA 3DHPA 3ZQ9A 2PWHA 1C92A 3N04A 2UY4A 3AISA 8CGTA 3PZOA 2E9LA 2D24A 4WIWA 1RP8A 4JKMA 2VCBA 2XWDA 4W87A 2DT1A 2VX7A 1BGGA 3CLWA 4P7QA 3VX0A 3BMWA 1GZJA 5ABFB 5LA0A 4EAMA 1E6SM 1U30A 4AD1A 3GXMA 2OSXA 3B8SA 4E8CA 1H11A 1HVQA 1JDDA 2JEQA 1DWIM 4MJ4A 1B0IA 3FN9A 2V38A 3L4XA 3VDAA 5JBFA 4H7VA 3AIEA 4TUFA 1BYDA 3QHMA 4H8VA 1JD7A 4U2YA 4F79A 4J3SA 1E71M 1EDQA 4JKLA 4LYQA 3LMYA 3FXYA 1MW1A 5AY7A 3DC0A 4U5KA 2DGAA 2VTFA 1W9UA 3RCNA 3UESA 3WMSA 2CKSA 3K8MA 1E55A 1UWTA 1DWGM 1B3ZA 1QHZA 2DT2A 4L4OA 4BQ2A 4P7LA 3BSGA 3SURA 3WMCA 3AHTA 3VMOA 5ABEA 3VMPA 1MQRA 4WK9A 3WFLA 2XWEA 3VD4A 1E3XA 2ZX6A 3AMDA 3F5KA 2CEQA 4BQ3A 3VIHA 2WSKA 2DT0A 4UFKA 3FAWA 3F5LA 2JE8A 2FGZA 5IDIA 1TA3B 3AMGA 4KWUA 4QP0A 4W8LA 2CHOA 2JEPA 2ZUTA 3VO0A 4CD7A 3RO8A 3UR7A 2WMGA 2CPUA 3ARWA 2FH8A 3W28A 2D3LA 3ALFA 5E6ZA 5EFFA 2NW0A 5E09A 3WQVA 1BHGA 4QDMA 4XB3A 1CWYA 1BFNA 5GNYA 1OD8A 1XH0A 2D23A 4B3KA 2WLZA 1KCKA 2V3FA 5I77A 2XVNA 1WDRA 1QW8A 5DF0A 2ZX8A 2WWDA 1E56A 3FY1A 1CGVA 3VIKA 3N9KA 3AHXA 5IXEA 2A3HA 1JZ3A 3K4DA 2WC3A 1BGAA 4HTYA 1JDAA 3WNPA 4XUYA 3ZO9A 1HJUA 4UCFA 2V5CA 2G3MA 2ZUMA 1KCLA 1V02A 3BLPX 1HNYA 3WEZA 3U5YA 1QPKA 3VVGA 2BY2A 3RM8A 1E6RA 5C70A 4PYSA 4ACZA 2VVSA 4HMCA 3KWXA 3EMCA 3E1F1 3GH4A 3EDEA 1N82A 1VFFA 2VT0A 2J25A 3NDZA 3T0DA 1RH9A 1CXEA 5DEZA 5HBFA 3WUBA 2F2HA 5TD4A 1C90A 3BAJA 1HIZA 4AYSA 2GK1B 3PBGA 4R5EA 4DWSD 4EK7A 2VJXA 4UFHA 3KEHA 2BXZA 3CUIA 3FHAA 1XSKA 1E1FA 1VFUA 4DUWA 4OBRA 3NSXA 3ZJ8A 2ZUWA 4KMQA 2B31A 4PMOA 4C7GA 1C93A 5A8MA 4JFUA 3AXIA 1WKYA 1W9DM 3WN6A 3SIMA 3GBEA 1C8QA 2WHMA 1H09A 4EE9A 3SCVA 1EO7A 2A3EA 4F9DA 2VR5A 3VIMA 1OGSA 4AD5A 3A3HA 4HPGA 1EHAA 3WNMA 4UFIA 2ZOXA 2O9PA 3AS3A 4KRTA 1GVYA 2VQUA 4WLCA 1GNXA 2J8GA 1WZAA 2VX5A 3BCFA 5D8WA 4Z2GA 4S3JA 3N18A 1S46A 4CD4A 3A4AA 3D3AA 5I5RA 4NZCA 5DO8A 1SFSA 5FL1A 2G3NA 4A3YA 2ZICA 4CN4A 4IM4A 3MV11 1NP0A 1HJWA 1GQKA 2JF6A 3OZOA 1HP5A 4OIFA 5AC4A 3ARZA 1JYXA 3IJ8A 1E40A 3O2LA 2XHYA 3DECA 3NSNA 3M7SA 1AQHA 1JZ7A 4OJYA 3AYRA 4EANA 2G41A 1QNRA 3VUPA 2EJ1A 5DT7A 2CIPA 3NCOA 5M5DA 1QI4A 3S2CA 4Z2HA 4QLLA 2WZHA 1K9TA 3GH5A 1NH6A 1YQ2A 3N13A 5I78A 5CLTA 4X0VA 3OLDA 5D9MA 4B15A 1JI2A 1CGUA 6A3HA 1XV8A 2WK2A 2J7CA 1E6NA 1JNEA 1WO2A 3U7VA 1PIFA 4UNIA 1NOWA 2XVPA 1W9VA 4H8HA 2VX6A 4HOZA 4ATLA 3CMJA 3VKKA 5A8PA 4W7UA 1JZ6A 3NDYA 3AJ7A 2WZIA 4LQ1A 1MXDA 4IUGA 5D8ZA 4CCCA 2GSJA 1BPLB 5CSUA 3FNDA 1VIWA 5KEZA 3VINA 1YHTA 4QLJA 4J3XA 3KL0A 3PTQA 1CECA 1O7AA 2WCGA 3K1DA 4TVUA 1M04A 1QBBA 3M07A 3TTQA 3W24A 1ISZA 1XD1A 4PEEA 1XH1A 5A2AA 1OSEA 5A6AA 1H1NA 4AXNA 3WH5A 2C0HA 2VR4A 3PHAA 4IPNB 2VZUA 1GOOA 4NI3A 4TXEA 4MNKA 3PZGA 1CXKA 3ZSTA 5A94A 4DWSC 1M7XA 3VGBA 3ZR6A 4MAVA 4M82A 5A69A 3EDJA 1ITCA 3GDBA 3AIWA 1UR2A 3QOMA 4CCEA 2VQTA 2E9MA 3PZUA 2VRQA 3CZGA 1J0KA 1GONA 4D72A 1DWHM 2WANA 1MW0A 4PMVA 4PSRA 1W1PA 1BQCA 1HKMA 2VX4A 3EMQA 1LG1A 1UUQA 3AYSA 2BS9A 1QBAA 3N17A 1CEOA 1BLIA 3VTRA 1FFQA 4AD3A 4BZYA 3ARSA 1VF8A 1JIBA 1IZJA 4E4PA 4XV0A 1QHPA 1J9YA 1E0WA 4D6FA 1IZKA 1OIFA 3AI0A 1EA9C 1OM0A 4W84A 3L4UA 3A47A 1GCYA 1XD0A 1VFOA 4CU8A 2WVVA 3ARTA 3WDJA 1PX3A 4N0RA 2BY3A 5BRPA 5BRQA 3EDDA 1W91A 4GI9A 3VU2A 2FHFA 1KFWA 4U31A 4ATDA 2YL8A 1RPKA 2XFRA 1JDCA 2YDQA 1D3CA 1ZL1A 3VGEA 2WHLA 4D1JA 3T0BA 1CNVA 2GJPA 1W3JA 1V6VA 2WMIA 4GZEA 3CPUA 3I3EA 1NOFA 1Q6EA 1O6IA 1UA3A 1GW1A 1UWRA 3W82A 3PZNA 4LGXA 4RE3A 4V2XA 5CSYA 3U7BA 1C8YA 1CLVA 5IFPA 4GKLA 2XYLA 2FHCA 5A6SA 1NQ6A 1E4IA 4D6CA 1F4HA 2WKGA 1TG7A 5ABGA 2PF0A 5FCZA 3SUWA 4JAWA 4DUXA 2J47A 5FIPA 3W81A 1NWTA 1DP0A 3WQ5A 1J0IA 1W3KA 5D4YA 4N42A 2WYSA 2ZX7A 3LPGA 2OWCA 4MB4A 1G5AA 1CGYA 1FP9A 2PBGA 2UWFA 3A4XA 2EPOA 1UR8A 4PMQA 1TVNA 2VOTA 1JL8A 1KB3A 3VILA 3W25A 3VMNA 4C7FA 4Z2IA 4LYPA 2RGLA 1CXHA 4DM1A 4D6JA 4HA1A
chains in the Genus database with same CATH superfamily
4GLEA 3RLUA 1KBKA 4FNUA 3CAKA 3WF0A 1CT5A 4LCSA 2ZZ2A 2X16A 3OB8A 4O1AA 2QUUA 3LERA 1FKWA 1K4HA 3KP0A 3BW4A 3R43A 4AZ6A 1CGTA 4U33A 4A3QA 2PDQA 1OX4B 4NASA 1CXIA 2PLCA 3WY1A 2C19A 1Q6RA 1KGWA 2ZRZA 1JI1A 1XF0A 4N9EA 5AFDA 4NJGA 2Z6IA 1YEYA 4C90A 4UNLA 1DXIA 2W6RA 3RK8A 3A24A 4HGXA 2V5BA 1ENUA 3CUFA 4LUIA 1UWQA 3DH7A 4EP8C 3LI1A 3LN3A 4LRSA 3ZWTA 1BWLA 1XDLA 4DF1A 1AH0A 4IMFA 2ZRWA 5FF2A 2GZXA 2VDHA 4PN2A 3BUVA 5GNXA 2V81A 3S1GA 1NSJA 3O05A 5C2XA 3G5EA 2GQ8A 1GYLA 2BGNE 4IPJA 3ZZ1A 3QGVA 4EIVA 3PZQA 1M53A 1EP1A 3DCPA 4ZE5A 2NQ5A 2W4XA 3Q67A 1WDPA 3EWCA 4ML4A 4WGHA 5AHMA 4LS2A 4V1XA 2J7DA 4AXKA 1JAEA 1ME9A 1BQGA 4JTGA 4GVGA 5LZLA 4JHOA 3SUUA 2YB4A 2DZTA 3LRMA 3H7UA 4CD5A 1XYAA 1F74A 3T4CA 3WL1A 1MSSA 4XKMA 3CUGA 5E5CA 3CLMA 4D6HA 4HA0A 1W1A1 2V68A 3CHEA 4MTVA 5A8GA 4NAEA 1F9CA 3QM3A 4IFKB 5A5WA 3CTTA 1LWIA 3H2NA 1R46A 2VZVA 2GVGA 2P8CA 3GAYA 5BXRA 3GQYA 3HQPA 2D69A 2FZBA 3BJSA 1KTNA 5C9ZA 3R0DA 3BPWA 4ERIA 1HX0A 5MF5A 2NV1A 1AUSL 4HPHA 2OQYA 1SQ7A 5E1QA 3MT1A 3H2AA 3ZT6A 2Y88A 3NQAA 2QMJA 1IEIA 1JDFA 1JPHA 2C71A 2O7QA 4UTLA 1YNQA 3P2VA 2WKJA 3I3DA 3IEBA 4XAGA 4ZXOA 4JPGA 5C54A 4IQJA 5L6UA 1UP2A 1EL3A 4BKNA 2NLIA 3AJXA 1K70A 2D73A 4KIEA 4EPEC 2ZRYA 3POHA 1FHDA 3VXGA 4HHHA 1OT1A 3MPGA 4UMAA 3R8GA 3KRSA 4ADSA 1WP6A 1WAWA 1E0VA 1Q5MA 4UQCA 5E0CA 4AW7A 1K8XA 3A22A 3SCTA 2VCCA 4WY0B 3IARA 3HGSA 1MEIA 2QCCA 2WQPA 1MWOA 4AZIA 5LHEA 4L4PA 5EFDA 1YTKA 4E0CA 1UWUA 1EDTA 3KLLA 1CTNA 1UG6A 2BASA 1J93A 3B4YA 3W38A 2HXUA 4HYRA 1PSCA 3UBPC 4IICA 2A0NA 3S83A 4HZ7A 5LGZA 1AQMA 5LYRA 2X09A 1K9FA 4C6MA 3LCHA 2WSPA 3T2PA 3WCZA 1WYIA 5I3HA 1R7OA 3M46A 3UWEA 3WDIA 3R0KA 4XAYA 4NUWA 4PUMA 4WKAA 2XUCA 2XM1A 4L65A 5MKGA 3ITOA 4QE1A 4Y9OA 2ZRUA 5FEZA 1UH3A 3SY5A 3LB0A 1XKJA 4YCPA 1WDWA 1FWBC 2X40A 3NQ7A 3AMLA 1UOKA 4UXDA 3WQDA 3NO3A 5RUBA 1UJQA 3OU8A 2XH2A 1O68A 1A0CA 3AXHA 1SJCA 3M1ZA 2JIEA 4XO6A 2H8XA 3WNKA 3CB3A 5CPMA 1YTEA 1R47A 3CT2A 5AZ0A 1M65A 4HK6A 2B81A 2NQJA 1A3HA 5TQLA 3OZPA 1A5KC 1VGAA 1JFXA 3H23A 3KBWA 1TX0A 2GK1A 3F2DA 3R11A 5HJLA 4KFPA 1H5YA 2WPGA 3N2BA 3CV1A 3QHNA 2IPWA 4A3RA 3KL3A 4I5UA 4RLIA 3ATYA 3W7JA 3VGHA 4DYEA 4RNFA 4JCMA 4K7YA 3OG3A 1UD5A 3F4WA 4DI8A 3IACA 1Z41A 2YA2A 4I7WA 4KGLA 3REQA 4PUNA 1JRBA 1U33A 4HOWA 2REQA 3UFYA 4WJXA 3GD6A 4HA4A 1W9XA 1H61A 1YRRA 2INZA 3CS2A 5H6HA 4DXXA 5C8BB 1GGOA 4WKHA 3MC5A 2BHYA 3GVRA 4QG8A 1KTBA 4QAWA 2PWGA 1XKYA 4GD0A 3RX3A 4B2DA 4PTDA 2ZUVA 2H6RA 1FA2A 1AMKA 2BZNA 1XPYA 5M3WA 1E6ZA 2GJXB 3RPTA 3PWIA 1B1YA 2OSWA 1LJYA 1JFHA 2FZDA 3H2OA 2VGGA 1RCOB 3PBWA 4HU3A 1JQXA 3UWQA 4P8UA 4ZOBA 4AQLA 4FNQA 3P60A 2Z1SA 4LJ3A 3SCWA 2HK1A 1EZWA 4Z08A 3G22A 2PSNA 1PYFA 1KXTA 1W1B1 1AFSA 1XLKA 4IP7A 2QQ6A 2H3DA 1KXHA 3SM0A 3CEUA 4O8AA 2Z0IA 4PRRA 2HSAA 1B3OA 3BVJA 3T4WA 1A47A 4G1KA 1XLAA 1HZYA 4N2YA 3WBXA 4JQ4A 3NL6A 2BVWA 3W7IA 2Q71A 3M0YA 2DSVA 3R6IA 5G4HC 3GNRA 3E2RA 1EKOA 3WQCA 6TAAA 4AC1X 2EBNA 4B4FA 4DM2A 4JTAA 4B5UA 4WXZA 1IR1A 5HANA 1K6WA 1EBHA 3SRDA 3N6JA 4KF1A 2QAFA 4HU4A 1LF1A 2BY0A 3AIVA 1FHVA 3S5OA 4UTMA 2J74A 4DI9A 5BOOA 5K4ZA 2RJHA 3FVMA 5DY3A 5LA2A 3G18A 1C8XA 1CBGA 2P3ZA 3EKZA 1J6PA 3GH7A 3HPZA 2AKZA 1P43A 4OZOA 2XFYA 5LIWX 1EQCA 3ZJKA 3UZZA 3SRFA 3PFRA 1FWCC 1KD0A 2UY5A 1FWEC 1SFTA 3WF2A 1JPMA 4UZSA 1IR2A 4C6JA 4W8AA 1OYBA 1JQVA 5HJYA 2VELA 1KO0A 1KKOA 3S9IA 3BGAA 1SMAA 4F0SA 2OYKA 1K7XA 1WNOA 4WDTA 2WNQA 3P14A 5CJNA 1DIOA 1Z32X 5FOOA 3RCYA 2E0PA 3CHFA 3S1WA 1VFHA 4UQ9A 3UERA 2JF7A 1ADDA 3S6DA 5BCAA 3UY8A 1BXNA 5HATA 3HA1A 2V5DA 4IH3A 3TE9A 2FYMA 3P5ZA 1GOMA 1W1VA 4P2VA 1L9WA 4IOTA 1MNSA 4IIBA 3L2MA 1VBJA 2PTWA 5H91A 1LRNA 3MMTA 4KRZA 2VFHA 4J5NA 3LZ5A 1XGZA 3NOEA 4DYJA 3CT7A 4Z2JA 1GUVA 5D09A 1TPB1 1MXGA 2IQDA 4L9XA 1KR0A 3WBEA 1T5AA 4M81A 3NO1A 3KZPA 1P0EA 1VD6A 3BMXA 3B4UA 4JKKA 4GY7A 3W7CA 2YKKA 3ARXA 1U5JA 2WC4A 3OYZA 3IIXA 1LP6A 1ME7A 3KBMA 1RV8A 4M3PA 2V63A 2RH9A 1H1YA 2WM0A 5LIUX 3FGCB 2PI6A 4MNJA 2C91A 3PSVA 1Z42A 5CQ1A 4S3FA 1QNOA 3KX6A 4LUJA 4BCEA 5A8NA 4ENLA 1PS9A 3SI9A 4C6EA 2DVTA 2L5HA 3DKLA 3TAOA 2OO6A 1F3TA 3W70A 3PS7A 4XBJA 3OIXA 4QAIA 4DJDC 4OWGA 2ZTKA 3W7HA 4PMZA 4M6UA 1WX0A 4AIEA 2BBFA 3HOJA 3ECQA 5CGQA 4XZNX 2YOCA 2CZEA 5IHSA 2V67A 1MO0A 4G1NA 1RAKA 8XIAA 3G0SA 3MB9A 1D7KA 3T08A 2OOGA 2TYSA 3GW3A 1TJRA 4M24A 2DFAA 5BROA 4LOCA 5CXPA 3W6LA 2Y5JA 3G6MA 2IPGA 1FP8A 3WK3A 5M17A 1MEWA 3PB0A 4IPLA 3QQ0A 4EXBA 3CHDA 1ICQA 2UY3A 1PKMA 1VLIA 2Z1VA 4PMRA 5DXXA 2HEJA 3TYCA 4XZBA 3RILA 3SN1A 4S2BA 1OX4A 2I9UA 5T9BG 4G7FA 5KZ6A 3QLDA 4TOQA 5GNZA 4KWSA 4F40A 5A8OA 1UR3M 3W1RA 6PTDA 4FAMA 4ERAA 4LV9A 2J75A 2FKPA 4B2DD 3IVTA 4LFYA 3DG6A 1AMYA 3EB4A 1HJQA 2GFTA 3GXIA 1V7AA 5A6JA 3KBSA 3OLGA 2V5JA 1LQAA 4AEOA 4UTJA 1Q6GA 1MEHA 2FPVA 2C16A 3M9YA 1LOSA 2Q6ZA 4P61A 2QKFA 1F3WA 5FF0A 2J4GA 2BGSA 4HZ6A 4LAOA 3FOKA 2DU2A 3RFAA 3UA3A 5C2GA 4KWWA 3M5YA 1E1EA 2HTMA 3QGAC 4KT2A 2VL4A 4J40A 3W83A 4CCZA 5LXEA 3A5VA 1POKA 4FX6M 1GTHA 4MIMA 3L0GA 4JGDA 3FYPA 1MQPA 3Q4DA 1YLVA 2VDGA 2DZVA 1B30A 3BAXA 3BQ5A 4O8RA 1R9XA 4M6VA 4GUJA 3CGTA 1UR1A 4RDYA 1D7FA 3U48A 1W2VA 2WHKA 3CQHA 1EH9A 1XISA 4EACA 3EWDA 1C7SA 4TO8A 4K36A 3B05A 3T0AA 1VFLA 3SFWA 1LBMA 2CW6A 3U2OA 3BG3A 1F3EA 4FXRA 3GDMA 5D2WA 2XSBA 3VIJA 3VIFA 1HKJA 3FA4A 1W1TA 3O6CA 1US3A 1RPXA 1CZ1A 4HN8A 2VZOA 2YBTA 3H12A 1JCXA 1N8FA 1PO9A 2F8QA 4FLQA 3VM5A 3PUGA 3JRKA 2WKLA 2XPKA 2CBJA 1W3LA 4OVXA 4QS6A 3T8LA 1LT7A 1E9YB 3TR9A 3QR0A 3UQNA 3WH6A 1Q2RA 1X1NA 4WGXA 3R10A 4NRRA 5FEWA 4CGTA 3UYCA 3TKFA 3ZIZA 2Y1HA 3LHZA 1Q6OA 4UQBA 1GVRA 3PM6A 3MO4A 4RDVA 2R1NA 2QNEA 3FHQA 1K9EA 3WLSA 4HBKA 5JH1A 3TDFA 4JS3A 3TU9A 2F6KA 2HVOA 2PZNA 2JALA 4TV6A 1KM6A 2W5FA 5ENLA 4KRUA 1X6UA 1HXJA 3FV9A 4JDYA 3NDOA 3IANA 1E15A 3KVKA 4R53A 2WMHA 3OGSA 1V3HA 4JL1A 4UTHA 3LOTA 4MKSA 1B54A 2NVAA 5U7SA 1XRFA 1LROA 1ZJHA 1TTJA 3W7GA 2YA0A 3SUTA 4H9ZA 4LAKA 2XZ9A 4H04A 4FF7A 1POJA 3TV8A 2R1LA 2E09A 3M4HA 3TROA 3T55A 4HZ8A 2QUVA 3S3GA 1G1YA 3GVVA 1BKHA 1F6PA 4FB7A 4IIHA 1PEZA 3MMUA 4J2PA 4NXSA 1TV4A 4QTGA 4HK5A 4WOZA 1KM2A 1NFBA 4HCDA 5I6SA 5BWFA 2J7GA 1TQXA 1ZGDA 2QDGA 4CU7A 3IGHX 3N9RA 3CIXA 1G6CA 3KP1A 3QBUA 3WLTA 3ME3A 3CC1A 1V08A 3WQWA 3PZMA 4CUCA 4S3BA 1HT6A 3ABSA 1FH9A 3PZTA 3SUSA 4HCHA 3U0HA 3CNYA 4GQ0A 1MUCA 4PMUA 2E40A 2XH0A 4NU7A 5EMMA 3GKFA 3SW6A 1VPQA 2WZTA 4QLKA 2WVTA 3NZ1A 2E1WA 5E0FA 4GE8A 1W8SA 3LBOA 3VD9A 2YL9A 3WSUA 1ICPA 3L4YA 2CWXA 1L6YA 4EVZA 1Y7VA 4UTIA 2TMDA 2E7FA 2ZRXA 5EB8A 3VOFA 4CNSA 5AYIA 3S2LA 2PRHA 2B7OA 1F73A 2F9RA 3TZNA 4HMDA 1ODUA 4AZBA 1EX1A 1WXYA 4MY8A 2ZTJA 2YL6A 5A6KA 3WUFA 3DYPA 1RK6A 4KW2A 3K13A 2CHNA 3LV5A 3BH4A 2GGEA 3KS6A 3GIQA 4F8XA 1NAL1 3F2BA 4W93A 3RGTA 4JIRA 3VCRA 1GW9A 4GXPA 2G8ZA 3N73A 1F07A 3LMZA 4DF2A 1UKSA 4B9YA 4JIIX 3VFCA 1LZOA 4HOXA 1VFSA 2FGLA 4HZMA 4MPQA 2NSOA 1P48A 5BYWA 2J7HA 1G7UA 3PB2A 1XLJA 1ZFJA 4J9JA 3T9PA 4CD6A 2CETA 4GMEA 4IMAA 2DSKA 1VFMA 2GJXA 2BY1A 5XINA 3QQWA 1VCGA 4UQAA 3TTOA 3OQ8A 2X1UA 4D1IA 2V30A 3TMLA 1VBUA 3B9EA 1NEYA 4A8RA 3FIGA 4M1BA 4D6GA 3H8AA 1AJ2A 4C6FA 4K8HA 5C9XA 1A3XA 4XZMX 1KLZA 4F0LA 1Q66A 2DH3A 3MP5A 3QTGA 3M43A 5E9XA 2G3IA 2J79A 4GOAA 3OVRA 1UC4A 1E9ZB 4AWEA 1P1MA 2C0AA 5KITA 3VZZA 2A85A 2PP3A 2E8ZA 3OGRA 1OFAA 3GO2A 4JFVA 1J2BA 3STFA 3WQ4A 1PVNA 3VPLA 5G2HA 1R8LA 1XLCA 3FKRA 2OGYA 4QDPA 4BF9A 2XVLA 4W5ZA 3LPFA 4C1NB 4G5DA 4OECA 1GKRA 1PAMA 4JQ2A 1NTHA 3PTDA 5I0DA 2O0TA 3B03A 4NILA 2XGBA 3O06A 4DXVA 3WNOA 2PC4A 1FWGC 2FH6A 2IW0A 4JXCA 4Y8FA 4IIFA 1X98A 5AHEA 3LNMA 2I16A 2W79A 2VKZG 4XSMA 4MKVA 3LA4A 5CKSA 4MKNA 1Y5VA 4H8UA 5FJOA 1JVNA 2WAGA 3UNDA 4M29A 5HPCA 5FA5A 3RLVA 1PZ0A 4YLWA 3V36A 4AIBA 3F4DA 5AYBA 2Y85A 4BK9A 4CNUA 2X0HA 5CLWA 3I68A 3PWAA 1UWIA 3M6YA 1HN1A 3UXDA 4A8IA 1QNVA 4GNJA 3QMTA 4X2RA 4Z2LA 1V8EA 1Q4WA 3CHCA 4D71A 1O66A 3G1AA 3DHPA 1AJZA 2PWHA 1C92A 3N04A 3ZQ9A 1FUYA 5C2CA 3G2GA 1QOQA 2E9LA 5DLCA 3PK7A 2XWDA 5BMWA 4GIEA 2GGHA 3W84A 3GR8A 3CLWA 3VX0A 1GZJA 3B0XA 3H53A 2SFPA 5ABFB 2OT0A 3BSMA 3F4CA 4HNCA 2ZDSA 4O1CA 4G2DA 1E6SM 4RR4A 3DFSA 3UWWA 1UB3A 4NI8A 4WSHA 1Z6KA 5CZSA 2JEQA 4MJ4A 1FDZA 3EA2A 4LB3A 1T8XA 4I9JA 4N6EA 3UF9A 4XO7A 1RA5A 2NQHA 3AIEA 3OHMB 4H8VA 1EGMA 1YBQA 3FGCA 4Y8EA 3FXYA 4MSSA 3VKCA 1VPXA 3DC0A 3WMSA 3MUXA 1I6NA 4LW7A 4QITA 1JR1A 1YDYA 3H7RA 4P7LA 1OJXA 4GJ1A 5ABEA 4FX7A 1MMFA 3W9ZA 3VIHA 5I02A 1A5CA 3FA3A 2DT0A 4UFKA 3FAWA 5IDIA 1FWHC 4W8LA 3DC8A 2Z26A 3RO8A 1ZLPA 4B90A 1DJHA 6XIAA 2PUZA 4DJFD 6ALDA 2CLHA 2PPGA 3KCLA 3ALFA 5EFFA 2HS6A 4HQVA 3A3XA 1AA1B 1LM1A 3Q45A 2D23A 3O0FA 3QY6A 3L9CA 5I77A 2XVNA 5DF0A 2ZX8A 1IWAA 1SGJA 4S3GA 1E56A 3CL7A 3FY1A 3MP4A 3VIKA 3N9KA 3UYIA 1TPFA 3MDWA 3K4DA 2EF9A 4JIPA 1QFEA 2WC3A 3GDTA 3SO7A 2XISA 1HJUA 2ZUMA 2FZMA 5HMEA 5H8PA 3U5YA 1ADSA 5AC7A 1QPKA 2BY2A 3H24A 1E6RA 2NVCA 5C70A 1JPKA 3FJNA 3PUOA 4RUBA 3RHGA 1N82A 4LTSA 5F2LA 4Q3MA 4IXHA 1JCTA 3TEVA 3WUBA 3BAJA 3PBGA 2X42A 3S1XA 4GX9A 3KEHA 1Z3NA 1VFUA 2EHHA 5BU6A 5CBJA 2QJIA 4GJJA 1PV8A 5C5YA 4MMWA 1C93A 5A8MA 4JFUA 1RUSA 1WKYA 2XH7A 1LORA 1W9DM 3IIOA 4QSFA 3GBEA 3EKLA 2WHMA 3EWBX 4EE9A 2A3EA 4F9DA 2QS8A 2VR5A 5EPDA 5LNWA 4LS1A 3M0ZA 3A3HA 4HPGA 3DDMA 3WNMA 2Z28A 3BZJA 2PWUA 2O9PA 2YFOA 5D8WA 3EX4A 2J8GA 1YMYA 1H62A 3P0XA 3SGZA 3N18A 5CG7A 2QULA 1GEHA 4MF4A 3RO6A 4A3YA 2ZICA 1H7RA 3E96A 2JF6A 5AVNA 2INFA 4N9BA 1S38A 1VPYA 1E40A 2GPTA 2XHYA 3NSNA 3O2LA 1AQHA 3M7SA 4LT9A 4DJEC 1SW7A 5LGXA 4US6A 2DZPA 3VOHA 3NQ2A 3DGRA 2FQIA 3FLUA 4PUWA 4O50A 1QI4A 3S2CA 1O5XA 3WQGA 7REQB 2JKEA 1PIIA 1RY0A 3GH5A 4E2DA 1YQ2A 3DI1A 3MW7A 3KRZA 3QFWA 5ABTA 3OLDA 2FGBA 2XZ7A 1XV8A 2VWSA 4YVPA 2AL2B 4NG3A 2NUXA 3LI0A 4S23A 2OELA 1W9VA 2ACSA 4H8HA 4HOZA 1EIXA 2JGQA 3VKKA 3BLLA 1VYPX 4QNWA 3O16A 1ZY9A 1HL2A 4IUGA 3EPNA 5D8ZA 4R85A 2I1OA 3O3RA 1BPLB 1DQUA 4B5NA 5TIMA 2WCGA 1WKEA 1JUEA 3K1DA 4L6DA 4TVUA 3TTQA 1P0KA 3ITCA 1FCQA 1NJJA 2GVJA 1XH1A 3R25A 3KOXA 3E9AA 1H1NA 1QMLA 4AXNA 2OKOA 4IPNB 2VZUA 2IS7A 2O55A 4DLFA 1GOOA 3L5MA 4RE0A 1OVDA 2FVKA 3N4FA 2XSXA 2J9XA 4A22A 3MHGA 3GLCA 5KZMA 4BY3A 2J9YA 2TODA 3VGBA 3ZR6A 3W86A 4NP7A 4LVDA 1XI3A 2BDQA 2J24A 3IV8A 4Q8MA 3PZUA 2VRQA 3CZGA 3VYLA 1DBTA 2ZCGA 2AQVA 1F76A 2VFGA 4AG0A 4D72A 2QCHA 1MW0A 1W1PA 3NYZA 3MKCA 3QW4B 1XG3A 1UUQA 3AYSA 3PG9A 4WR3A 1XYMA 1QBAA 1CEOA 1BLIA 1PB0A 1FCUA 1VF8A 1X7IA 4XV0A 4L1WA 3XIMA 1QHPA 3GYEA 1E0WA 4HYVA 1EA9C 1OM0A 4W84A 3MKVA 3ZLGA 1XWYA 2VC5A 3WJWA 1XD0A 1OY0A 3DESA 2I17A 3ARTA 3WDJA 1PX3A 5C55A 3UG8A 3W1MA 4U31A 3L12A 3TQKA 3H2MA 4ZQCA 1JDCA 2YDQA 4AYGA 2WHLA 5DN1A 3W7QA 1QJWA 1O1ZA 1QASA 1TMLA 1F6KA 3CPUA 3SIZA 1UA3A 4F0HA 1S39A 1SUXA 3GTFA 4RZ6A 4GBDA 4LGXA 1IYXA 4RE3A 4IHCA 4MY9A 4XIAA 5REQB 4V2XA 5CSYA 1YNYA 1CLVA 5IFPA 3BLIA 3WX7A 1H51A 3V16A 3UP8A 1AZ2A 3S1UA 2Q09A 1F4HA 5ABGA 2PF0A 4K1WA 1HGYA 3R8RA 4F3HA 2J47A 5FIPA 3W81A 1ZTVA 3GXTA 4EF9A 4QIUA 4N42A 5BWAA 2ZX7A 3LPGA 2OWCA 1G5AA 1FQ0A 1I8JA 2UWFA 2E68A 3GVGA 4MHBA 3A4XA 4JTQA 2V9DA 5DMMA 1R9ZA 1TVNA 2VOTA 3W2UA 4R88A 3H7VA 1XW8A 1CXHA 3WG6A 2ISSA 4DM1A 3UZ5A 4HA1A 3DBNA 3BGGA 1TV8A 2PC8A 2ZWZA 3MUY1 3TA9A 2CITA 3WQOA 3CH9A 3WD1A 4EOUA 1VP5A 2HZGA 3A4WA 4I5RA 4CD8A 3AZRA 4QSHA 4NF7A 2BV9A 4FI4A 3RM4A 3TW7A 1TV3A 1SO5A 3THDA 3VE7A 3ABXA 1TPWA 1ZPTA 4LBSA 4FR6A 5HULA 1KM5A 2H9AB 4KGJA 3PN8A 7TIMA 3U3HA 4AD0A 3LSBA 1ECEA 3UR2A 4HU0A 3G77A 3MCMA 3ARQA 2PDGA 3JVAA 1E6PA 1XH2A 4AFYA 2QJMA 3DYOA 1YYAA 1S2WA 4WSJA 3GZ3A 1W5NA 2PDCA 2FTYA 2WBGA 3W02A 1W1ZA 3NQFA 4UTWA 4BQ4A 4DN1A 1I60A 1HJVA 2W67A 1N8WA 3MWCA 1XBZA 4C1NA 3H22A 1CYGA 1PDYA 1KM4A 3W3OA 4GFIA 4J1OA 1Z9AA 2XIJA 2OT1A 2J77A 3VD3A 1A5SA 3BV7A 5FD0A 2Z2UA 3TFCA 1GG0A 1MDRA 1DJIA 3BSHA 2CLFA 5IFTA 3NVTA 3APGA 1XC4A 5JIWA 1FWIC 2OU4A 3PC0A 2FPTA 2XN1A 3KL5A 4PMYA 1JNDA 5J5RA 3DXIA 5I79A 1BYAA 4KS0A 4X61A 2VCAA 3URBA 1BG9A 2DUXA 5DRIA 1JEZA 3P0WA 1TCMA 3RJYA 2B7NA 3NPWA 1JYVA 4NZFA 1KM3A 3T42A 3K8KA 5JVLA 3KLKA 3S46A 1RBOB 1MQQA 2BFGA 3NZQA 1OYCA 1GOQA 3AIQA 3AS0A 4MY1A 3W26A 1KCXA 4YPJA 2J27A 3LG3A 4HA3A 4CEUC 1MDLA 1TIMA 4JTJA 1MW3A 2X1IA 2CXEA 2RDTA 4R34A 1YTDA 2WJDA 2Z1XA 1ITQA 5ABFA 1OCBA 1OF6A 1TMHA 1DJQA 3MKKA 3B9AA 3ITTA 1KQYA 1YW1A 3VOJA 1EB3A 4TU1A 3VABA 4S3EA 1L0PA 4J2MA 4QJ1A 1LRQA 3NR0A 4M56A 3AROA 5F4WA 1V3MA 5KTLA 5I3FA 5F2GA 1SJAA 1GJWA 2ADAA 2EPHA 3FAXA 4KCUA 5CBBA 5JIPA 3EOLA 3QH2A 1OC6A 4D6EA 3EWUA 2PDIA 2HJPA 2CXGA 3M0KA 5D2YA 1I2OA 2FPYA 3O07A 3O6YX 1ZBWA 3S8HA 1UQYA 4D2JA 3VE9A 3L2IA 4GGHA 2YLLA 1T41A 1E73M 2C3ZA 3VUSA 2C13A 3NO5A 2OZTA 5DMLA 1E72M 1IEXA 2GQ9A 1ZBVA 3AO0A 2NQLA 3A6OA 3QHOA 4YIWA 3TVAA 1XPGA 4JYFA 4B4HA 1A53A 4ZSTA 1JZ4A 4EWJA 1WKFA 3CWOX 1GYMA 3T0CA 1GJUA 1OFPA 3PZ9A 4HD5A 3U6WA 1U83A 1V77A 2GVYA 1VB9A 1DQXA 3OO2A 5DMYA 4E3VA 2BXVA 1ODZA 4GQQA 2GQAA 1TV2A 4Q8WA 3ZSSA 1JZ8A 1OYAA 4AHQA 2GJRA 3O63A 1DTUA 4WZHA 4E8GA 4WKFA 2ZC1A 4JFWA 5I24A 4JTCA 1GWJA 2EG8A 2D0GA 2P0IA 1S2AA 3EOUA 2NV2A 4J27A 2IKIA 4I5XA 3D6NA 4RJEA 1H50A 3NPXA 1TZ7A 3KXQA 1RQBA 1XSJA 2GUYA 3TTEA 4L9YA 4H9UA 1WA3A 1PPIA 2VO5A 3KRBA 3P61A 2F84A 3PJXA 4AZ7A 4EWND 1XINA 4S3KA 3HURA 1Z7AA 1OGBA 3OW1A 4IQEA 2E1DA 3S5SA 3U4FA 3ZJ7A 1B31A 4EKJA 3PAOA 3NSMA 4NXKA 3WLLA 3S0CA 3VDHA 2WHJA 1LOQA 1SZRA 3GTHA 3C0QA 4QCEA 3URQA 4O17A 4MB5A 3UT0A 1XLLA 1XQLA 4LC6A 2WSQA 4AY1A 1J0YA 3O1NA 2ZKMX 3QY8A 4JY8A 3B06A 5G5IA 3NQVA 4GVIA 4PRTA 1K8YA 5PTDA 4MOZA 3W1AA 1IXQA 3U57A 3THAA 1EC9A 2PTXA 1XCFA 2Q8XA 3RIKA 1UA7A 1E4NA 3WLOA 2Y4SA 4C1KA 1EQPA 4DNHA 3G8RA 1H0IA 4K1GA 2VHLA 1QOXA 1K1DA 1DE5A 4C6BA 2GVLA 3TAKA 3CUZA 4ONVA 4C5YA 2QYGA 3V1HA 4C6CA 7REQA 1GZGA 3QLLA 2G3FA 2A3LA 4UR9A 1UH4A 3UWUA 2IKGA 2QCEA 5BU9A 3EZ4A 3QGKC 1C91A 3MJYA 2AL2A 3DG3A 1GPWA 2AGTA 3AU2A 2A3AA 2JIWA 4AIOA 2HXTA 1EJVC 1S1RA 2G50A 3CUHA 4E2OA 4S3AA 5FJUA 3W0KA 2XSAA 3BOXA 3UXAA 2HE5A 5AC8A 1E6XM 3BGJA 3CL8A 4JEJA 2Z2AA 4BWLA 3RDKA 4EPKA 4PFHA 1YADA 3MJMA 4UTKA 3VCNA 1Y5WA 2POZA 3SN0A 3NPVA 3R58A 3V7PA 1RZMA 2NT1A 3T07A 1YE6A 2DZBA 3LHUA 2DDXA 2E4TA 4UFJA 2GYIA 2DZSA 1OX6A 3BARA 2IXVA 5EA9A 4DELA 5K9DA 1IEWA 3BLOA 4AZCB 3TJLA 4M1RA 2YYUA 3P80A 1B3WA 3SJ3A 2ZUSA 4URIA 5LA1A 1QHOA 1Q3NA 2PE4A 2VUYA 4GYFA 1QAPA 1FFRA 3CQJA 1ZHAA 1J18A 2HPMA 4ORMA 5HXMA 3IJDA 4WSKA 3FA5A 3VI2A 5HA7A 4DEFA 1NWSA 5CPLA 1RHCA 3NGFA 2W3ZA 2CBUA 4JFSA 1HW6A 2DORA 1Q4NX 5C7HA 4KKXA 4R3UA 3THCA 1PKLA 4HNNA 2A7PA 2X05A 4NYYA 4JTLA 3W6MA 1SO3A 1V4YA 4GRSA 3UXLA 3HMCA 2VFDA 1R38A 4CU6A 1UZHA 4UTFA 4AEEA 3B0VC 4UTWC 2D22A 1E0UA 4IJCA 5HNNA 2WWCA 1VZWA 5AKQA 2X7WA 4DO7A 1LOLA 2BNJA 1EJWC 5JBDA 4ZOAA 2R1KA 3WJZA 4TTUA 4YHEA 3FEMA 4ZL1A 3L7RA 4RL3A 1DIKA 2GUUA 2C1GA 3WL0A 4A35A 1OBAA 1K77A 4TVDA 1VRDA 1IEQA 5FF4A 3GB6A 4V33A 2W61A 2VFIA 2VRKA 4IGMA 3DFPA 3VDGA 1ZJBA 2OO0A 3B40A 4OOZA 3RM9A 2J9ZA 4UR7A 2QZRA 2P5NA 4KBXA 4O15A 4UOZA 4M51A 4RNIA 1AD1A 1ONXA 1LQ0A 2P3EA 1GQLA 5HUOA 3LSCA 4O19A 1FY6A 3DEQA 3GM8A 2B0MA 3I6TA 1RP9A 2XIMA 1IIGA 3MYPA 1U5HA 1X6LA 2GDUA 4DHGA 2YZ5A 5EYWA 3NZPA 3N15A 3XISA 3MI2A 1J5TA 1J11A 1NDVA 2WMFA 3W73A 1DWJM 3E49A 3TLQA 3DHFA 4S39A 2XGZA 3SSJA 3UG4A 3JU2A 3ARUA 1M1BA 1A5BA 3V0UA 4B3ZA 5I3JA 4UWMA 2OG9A 3R13A 2DQWA 4F2UA 4V27A 1DIEA 3K1GA 4WD0A 3UJRA 1JF5A 4OGZA 1TMQA 1XBYA 3T8QA 2VEFA 3ENLA 5TBOA 4PB5A 4KH2A 3VCCA 4DY1A 1TUXA 4QHRA 4IQLA 3GHRA 1C8VA 4DUVA 4H01A 2J88A 5DRCA 3IGUA 4DRSA 1Q7ZA 5GPRA 2W66A 1A4LA 3RLGA 3EX6A 3VIIA 1M6JA 4PZVA 3ES7A 3F7JA 4IIEA 3QSTA 5HQMA 1O5QA 3A9BA 1TWIA 2MANA 3AWOA 4N9DA 3H2FA 4G9PA 5CH9A 1K3UA 4DAFA 3J7HA 3G0UA 3U5UA 5EMUA 1RQHA 3L23A 4O52A 5A1AA 2HISA 1S2TA 3CXOA 2PDJA 4Y9MA 2XDFA 5CJMA 3AMCA 5CG0A 3NWRA 6REQA 4GO9A 1LBLA 1EFZA 1Q63A 2BVDA 2OQLA 5K7JA 3I4KA 3HQ1A 1V0MA 1V3JA 4LF1A 4W4QA 1LLZA 1ML1A 2GOUA 4MB1A 1HJXA 3G1YA 3EAUA 1TE6A 1IQ8A 3TFXA 3PBVA 4OT7A 5KMYA 1R3VA 3N11A 3QMRA 4PRWA 4W86A 3AHVA 2DIJA 1EOMA 2W62A 1A5NC 5A8QA 4ZQMA 3UR8A 1F3XA 1HG3A 5A6TC 1GOWA 1OC7A 2O9RA 1TE1A 1PKNA 4JL2A 2J62A 4RX0A 3UVIA 3ZT7A 3ABQA 3U2CA 1D8WA 1E5JA 2AAAA 1UKTA 2BHZA 3TQVA 4K7VA 1H2JA 3C86A 4U2ZA 1PL9A 3RYSA 4XUGA 2EPNA 4DQWA 1BAGA 1GQNA 4REQB 2EG7A 3B8IA 4C7DA 4GIYA 4F0KA 1QNPA 4UZUA 2QLYA 5CC3A 3IK2A 5AC5A 2GWGA 3OVQA 2PP0A 2E67A 3EPOA 3IUDA 4J35A 1ZAIA 1XX1A 1G0CA 2Y24A 3ZJ6A 1JGMA 4ZTXA 3PWGA 1ZJAA 3I6RA 2YYTA 4G8TA 1UR0A 1C3FA 4JHZA 2IXUA 1YPFA 2ALRA 2A1YA 5CEWA 2PEVA 4O0QA 1LWJA 1VJZA 4S3CA 3BDKA 4O0KA 1B4EA 1HO4A 1A5AA 1M68A 2A7NA 2VEPA 3L4WA 3OG2A 2W92A 1NF7A 1TZ9A 1NM9A 4LYRA 1EXPA 5FJPA 2YDAA 1OK4A 4MZYA 1FWJC 3IUIA 3P8JA 1NF0A 4U3CA 4DBUA 1C9DA 3TJIA 5C9UA 3BMVA 2W9MA 4N7QA 3IRSA 1Z69A 4J3WA 5I03A 4ICMA 3G0XA 3WDHA 3ZMRA 3QSRA 4B92A 3VM7A 2AMGA 3MTWA 2EGZA 1VENA 3TQ0A 2QCGA 4Q4KA 1R3TA 4GIAA 3ANVA 1CB2A 4MAZA 3W1LA 5H8MA 5DMNA 3FS2A 3C2EA 1VYSX 4MZ8A 2WJFA 4BA0A 1EDGA 1HQTA 2WVVB 1HTIA 1SPQA 2ZUUA 4BWLC 3S42A 5A95A 2FFIA 1OX5A 3WEMA 1TPC1 2BHUA 4PCSA 5G4WA 2V6AA 1KWKA 2HBVA 4HPNA 2RJGA 1MYRA 2QCLA 1R7AA 4KEVA 4EPBC 3TR2A 4ZEPA 4YTUA 4MVAA 1P6BA 3IIZA 2X0YA 2O4MA 1H7PA 1BF6A 4UFMA 1ZUAX 1PIGA 2PA6A 2X8RA 3UCCA 4B91A 2OXNA 3G1VA 3OODA 4HNVA 3UXKA 2CYGA 3RXZA 4PH6A 4LEQA 4LCQA 4I3GA 1C7TA 1GZ1A 3LHWA 4HSNA 3STEA 4YJ5A 1VBRA 2BGQA 1W5MA 3WD4A 3LK6A 1KBIA 3BXWA 3KM8A 5G4EA 1SW0A 2CKRA 3N3MA 2P76A 3EXSA 1FWAC 4Z2KA 4X0NA 1UZDA 4GINA 5AHNA 4C5ZA 2DH2A 2R6OA 1P7TB 1G4TA 4IGNA 2OWXA 4BHYA 4DBDA 1XS2A 3BJTA 1LL4A 4TMCA 4OOUA 4QG9A 4PUDA 4JNMA 2QUNA 3LDVA 3VNJA 2Q3RA 4XK2A 4ZCWA 1Q8AA 4POCA 3NZGA 4Q7NA 4FMVA 2I56A 3KAOA 1ZP3A 3MSYA 4IIDA 1QWKA 2ZRVA 3VKJA 4JTHA 3T0TA 2VI0A 3VOIA 1W31A 4L4MA 4UQDA 3D47A 5T9CE 4W7VA 1S3HA 3W74A 3KVLA 4W85A 1O1HA 1WZKA 2CLPA 4PTVA 5CAHA 2QDEA 5HOSA 1BWKA 2ACRA 3LENA 1CX9A 1JF6A 4YN5A 1QCWA 1IGWA 4GC4A 4UBPC 5JH2A 3F03K 3WYZA 4PUUA 4E8DA 1JJKA 3W72A 2QCDB 3E12A 2W91A 4HP5A 1HF6A 4L64A 3EA3A 3SR7A 1HKKA 4HIBA 1K7EA 3SGUA 1UD8A 1CB7B 1FRBA 3AIUA 1QI5A 1EYEA 4RV3A 1I2RA 1TPUA 3OP2A 4ZB5A 3CJPA 3GDLA 1G4EA 2DEPA 2HNEA 2ZX9A 1XGEA 4JFTA 1UHVA 1E9LA 4GJIA 2NX9A 3TYDA 3GXPA 4QROA 3SJNA 5KINA 3GAKA 3UGRA 3S4TA 4GZ7A 3CZEA 2EXOA 3ARRA 2WMJA 2YJQA 3M5XA 1U2YA 1AK5A 1DEDA 5FL0A 3N14A 3AIRA 4L9ZA 1BSIA 4RPQA 4N4PA 3I6EA 1XYZA 2ABAA 5GJNA 1ESWA 3TYEA 3W00A 3VD7A 1J5SA 1I45A 1ZP4A 4LUTA 1PHQA 4NJJA 1EYWA 2WBKA 3SCOA 4C6NA 1CLKA 1E1CA 4Q4OA 1FWDC 1YNPA 3KW3A 2ANUA 5AC6A 1XHGA 1MRQA 1G67A 4C6LA 1A4MA 3POCA 4ACYA 5CPQA 2UY4A 2QVNA 4WX2A 3HGRA 3PZOA 1RP8A 4F4RA 1XICA 1RBLA 2VX7A 1BGGA 4P7QA 4NAFB 3LXBA 4CNOA 5D32A 3TSDA 1TJ0A 3GXMA 2RKXA 1H11A 3S5YA 4O18A 2YB1A 1DWIM 3PJWA 4KEZA 1F5ZA 1B0IA 2V38A 3L4XA 5JBFA 4H7VA 2XU2A 4H1ZA 2E6YA 1EEPA 4FNRA 4F79A 3PJUA 1SO4A 4J3SA 4C1LA 4AX7A 3LMYA 4LC8A 4U5KA 1EX5A 2VTFA 1S2CA 3EOSA 4H9VA 3GTIA 2PGWA 1DWGM 1QOPA 2DT2A 1XQKA 2C1HA 2F7FA 3BSGA 4YYCA 3SURA 3WMCA 1SW3A 3C2OA 3VMPA 1MQRA 3WFLA 2Q8LA 2ZX6A 3AMDA 3TJXA 3N2OA 4DJDA 3B0PA 2WSKA 4LY8A 5D33A 3V0TA 3F5LA 2JE8A 5F2MA 2CZ5A 1TA3B 3AMGA 4QP0A 1GVEA 5EBUA 2ZUTA 5FESA 1W5QA 4IGSA 3H6OA 2DZXA 2FJUB 2OEMA 2FB2A 3HG3A 4PODA 4GYPC 1CWYA 1S1PA 1OD8A 1XH0A 1EWEA 4EPDC 1KCKA 3BOFA 1WDRA 2RDXA 2V2HA 1GTEA 3V0SA 1CGVA 4YWIA 2R94A 2VGFA 4H3DA 4N4QA 3UVAA 1BGAA 1RY8A 4UCFA 3PBMA 4HPJA 4PA8A 1KCLA 1Y65A 1V02A 2VGBA 1DIDA 1HNYA 4AX6A 1EUAA 4NNAA 3G1SA 2V8ZA 2VVSA 3EMCA 3E1F1 3GH4A 4GACA 2Q8ZA 2EAWA 4Q4SA 3DENA 4UMBA 4WDWA 5HBFA 1GKQA 3UW6A 3NPUA 3ANYA 1QXLA 1HIZA 4R5EA 4EK7A 3WO8A 2NLYA 1LLWA 2RAGA 5F1VA 2ZUWA 4RZ4A 2WJZA 5LNUA 2QVHA 1EC7A 4C7GA 4LANA 4AAJA 2QDHA 3AXIA 2YCJA 4OV4A 1EJUC 4L1XA 3WN6A 1IT7A 5BMXA 3N6HA 1H09A 3SCVA 1EO7A 4BFAA 3SY8A 2VDIA 2PDHA 3VIMA 3LCXA 4Q7IA 4E2VA 4PUJA 3PAJA 3SBFA 4KRTA 2VQUA 2KX9A 1OZMA 1X8CA 1GNXA 1WZAA 2PD9A 4WLCA 3UU0A 4S3JA 3N4AA 3EPMA 3F1QA 4GHRA 4Z1CA 3C6CA 3S9YA 5I5RA 3LS9A 4JDBA 1OCJA 2G3NA 2ISFA 4RKAA 4CN4A 2DY3A 3MV11 4MZ1A 4O1BA 3OZOA 1HP5A 3BW2A 4OIFA 5AC4A 3ARZA 3QV6A 1JYXA 1GVSA 1R3RA 3GC2A 5HWMA 2DUZA 5LSMA 4GUHA 4EANA 3TLLA 1QNRA 1ALDA 3L66A 5DY2A 5DT7A 4MLRA 3W1TA 4QX4A 5M5DA 3SECA 3I10A 4Z2HA 4QLLA 3TWBA 4CQDA 3RMJA 4ECLA 1KV5A 3MVTA 1FCBA 3N13A 4HJFA 3MY9A 3HG2A 6ENLA 1QUMA 3NTYA 4B15A 1CGUA 3PPCA 6A3HA 4B5XA 5K2ZA 1DHPA 4O1FA 1IXOA 2OZ8A 1GEQA 1JNEA 5EGRA 4REQA 3OHIA 3DUGA 1NOWA 5B7YA 3NL2A 2E5BA 3GHSA 4GWEA 1TJ1A 2JBMA 4Z17A 1VCFA 4KPLA 3CMJA 4W7UA 3ZFHA 4JTDA 3AJ7A 2I57A 4JIHA 1GG1A 3GWQA 3C61A 3CV6A 5CSUA 3VINA 4GXWA 1DJXA 4WXYA 1SZGA 3BG9A 1M04A 4UMCA 5E93A 1MNZA 4JQ1A 3BOLA 3W24A 1ISZA 4PEEA 5A2AA 1OSEA 5A6AA 5AYZA 4R9OA 3B9OA 3EX1A 3PPFA 3EB2A 4NI3A 1NIUA 2YPIA 3IGXA 3SGGA 5A94A 1N7KA 3QMSA 1M7XA 5C9WA 2DIKA 3SQLA 4GUIA 4JQ3A 1KFLA 3VAVA 2E6FA 3EDJA 1ITCA 3GDBA 3P74A 5AYYA 3TYBA 4CCEA 3FJ4A 3C5QA 2CZFA 2EKGA 3WLIA 3CQKA 2PDBA 1DWHM 5I07A 3ABOA 4IPIA 5BRBA 1L6SA 4NZ5A 4R7WA 1LG1A 1K8ZA 2PGRA 4NQ1A 4PC8A 2ATSA 1WXJA 1UROA 1QT1A 4HPXA 5KZEA 1FFQA 4AD3A 4BZYA 3VA8A 5DCDA 4DJDD 1IZJA 5CZTA 4GUGA 1DJNA 4LH8A 2A6NA 5DBTA 3W1QA 1IZKA 4NZ1A 3W85A 4H00A 3GE7A 3A47A 3W7LA 1VFOA 2WVVA 4UTTA 2Z27A 2BY3A 1VH7A 3VU2A 1UMLA 1SZEA 5SWUA 2QGYA 1VBHA 2PURA 4D1JA 3V5CA 2GJPA 3DFYA 1W3JA 2ZA3A 1TSIA 4NJKA 2PD5A 1V6VA 4GZEA 3QV7A 2C1IA 1Q6EA 1O6IA 2PTZA 2BLEA 5AZ1A 4LEFA 4XWUA 1GW1A 3W82A 4HHLA 3IRDA 3BO9A 4GKLA 5A6SA 3S2JA 4D6CA 3KWSA 4MWAB 3LD5A 3QRHA 4JAWA 3WQ5A 3ABRA 3RAOA 2RHGA 4MB4A 4QEHA 1FP9A 3BLDA 3QKEA 1AW2A 4ROQA 4AHOA 2QEZA 4IJRA 1UR8A 3ZVHA 4Z2IA 3CB8A 4LYPA 2RGLA 4JYDA 1H63A 3XINA 3NL3A 2D0FA 1XM3A 2ZZ7A 4J3UA 5IRPA 3HV9A 2GVEA 3DHDA 5M03A 3L5AA 3KOWA 2FLIA 1PZ2A 1SJBA 1XIBA 3GXDA 1GHRA 3BTNA 3HPAA 3HG4A 4E38A 2J7FA 5EMKA 4M5PA 3M5ZA 4M6QA 5HR7A 1KFJA 3N2MA 5DELA 1ZRQA 1UYQA 5FSEC 3ATZA 1R0MA 3W29A 2ZXBA 1W56A 2DZWA 3FK4A 3ZS4A 4S1FA 2O56A 4AEFA 4ICNA 3V3WA 1B4KA 4FHAA 3WBWA 2GGJA 4L56A 2O9TA 3NNTA 2QCDA 2A6LA 3U4AA 2PDFA 1OFEA 4BS0A 4H9MA 1EJRC 1KXQA 2I5GA 4FALA 1PJ9A 3WF3A 2QW5A 3WD0A 5HNRA 2GJLA 1RJRA 3N19B 3MSDA 4JEQA 3BWWA 5I7GA 4WJ8A 4AVOA 3B04A 4NSBA 1E43A 3M0JA 3GR7A 5F1UA 3VD5A 4K8GA 3GUGA 3IPWA 1VRXA 3RG6A 4HNLA 1QK0A 5HJXA 2WNWA 4MJMA 2Y5SA 3HPXA 2E3ZA 3RMEA 3W22A 1X8FA 1Z8AA 3HJEA 5CPSA 1L6GA 1S5VA 3LQLA 2FHBA 2DW7A 5A2BA 5JXQA 4J28A 3M44A 3PBYA 3RPMA 3IJ7A 2IUZA 1YE4A 1ISWA 3ISIX 2X2YA 2QDDA 3PP7A 2PMQA 5HWJA 1V03A 4JR5A 1UBPC 1V6TA 1ISVA 2CESA 3ZVIA 3GXFA 1B3XA 3EMZA 4DUOA 4K39A 1V3IA 4J3VA 3SUVA 1KXVA 2BP1A 2GJNA 3B8TA 4U28A 2VEMA 3AC0A 1Q6FA 3RU8X 2D2GA 3TMQA 3MWAA 1Q45A 1ZQ5A 3WH8A 4ERGA 4U3AA 4DXKA 1QPQA 1K6AA 1B3YA 3HIJA 2X2GA 2P8BA 1OFRA 4Z0JA 1VBGA 3LLXA 5MKGB 3GTNA 1TUFA 4AIUA 3CMGA 4KWOA 1JXJA 3OIHA 3G24A 4QJ4B 2ATMA 3GS6A 2A5HA 4KFNA 5FEXA 3WKZA 4G56A 2AGKA 3W75A 4JX6A 4UNKA 1P6CA 3BANA 1UP0A 1FCVA 1PZ3A 3HPSA 2PWEA 1FDYA 1RLDA 1OWQA 3OGVA 4X63A 1R2TA 1WPCA 3NEHA 4ZODA 4AD2A 4ZFMA 1F6YA 1AQFA 3B9DA 1YDVA 4WEVX 5BOFA 1BVZA 5C6MA 3N29A 1OCQA 4FPSA 1UD6A 1H41A 2B7PA 4MNLA 2WM1A 3VNZA 3ITXA 4IFKA 2ABBA 4AU0A 1GHSA 1ONRA 4W88A 3TTSA 3DHUA 1M03A 2E8YA 2OOFA 4IMEA 4IFRA 3W27A 2VNCA 1MI3A 3VNDA 2QJJA 1EF3A 1U1JA 1LRTA 3THUA 1FBAA 4FLSA 3SCRA 2DSWA 1TA3A 2J7BA 3O8AA 1T6MA 1V0LA 1DTNA 2XJ7A 2XM2A 1UWAA 5K4XA 2NUYA 1OABA 3REQB 2REQB 3NZRA 1LWHA 3PPGA 3GKAA 4L4LA 5D9PA 5FAGA 3VFLA 1B3VA 1M01A 5CPTA 1FHLA 3L68A 3WIJA 1XSIA 4K38A 2PAJA 1I4NA 3LPPA 2J78A 1TWWA 1K9DA 1R3QA 4RDWA 5IBXA 2OX4A 4CVUA 4E4UA 3RRXA 3VIGA 1ECQA 1JGIA 1KLYA 3A4JA 1TR9A 2EO7A 3G3MA 3M0VA 3LBCA 3EXTA 4ZQNA 3UZXA 3AIBA 1EJTC 3R5EA 3GXNA 4IISA 3SRHA 3A12A 3GG0A 1WUFA 3VGDA 2CFFA 3SCUA 2BOEX 1HKWA 3DFNA 3QV8A 1LYXA 3K46A 3VZYA 4O4VA 1PWLA 4L5ZA 3LQGA 4CNNA 4A4AA 4XTDA 4Y9PA 4WY0A 3MHFA 1T96A 3PUDA 1L6WA 1FXQA 2CBIA 4XISA 2PDUA 1YXCA 4TQTA 1R86A 1P1XA 1BWVA 5JQ9A 1JAKA 2GQ3A 2VXNA 2H3BA 1JUKA 4PTNA 2HVMA 2POTA 3TC3A 3B0YA 3GW0A 3TN6A 1J12A 4RE4A 4KIRA 3LY0A 1UMYA 4CQ8A 2HCVA 1G7VA 3TOPA 5CGTA 2E9BA 2EPLX 5J04A 2FMOA 4Y9AA 4IIGA 2EJAA 4IX0A 1XIEA 2PFHA 3EDKA 3NYDA 3G6LA 1RD6A 4PUEA 1UWSA 4NX5A 1W3HA 1W5OA 3M0XA 3CO4A 3PNUA 3UPMA 1K7FA 5DT5A 3EDFA 5BNKA 1S2UA 4IL2A 1NELA 1RA0A 3UGVA 1NWUA 4KEUA 4Q33A 3OA5A 1UKOA 3ZLFA 4DJEA 1UKQA 4UTTC 3LGDA 5D30A 4QISA 3GYCA 2EPMX 2OJPA 3RR1A 4AMCA 3CZ8A 3NQ8A 2D3NA 1ZAJA 2QCNA 1SM9A 5E0KA 1Z89A 5AN7A 5ECUA 2QMKA 3FYYA 2V5KA 3MCNA 5JBEA 2PRMA 2AOSA 1JZ2A 3LM7A 2OEKA 3N25A 1ZCCA 1XL9A 3VGGA 1FDJA 3AWNA 3NIYA 3AUJA 4GQBA 3O6DA 2VGIA 3MV01 1D2KA 1XC6A 4IT1A 2Z25A 3C52A 3DFOA 4E4FA 3H54A 4XZHA 1D8CA 1OT2A 4O53A 4XZ9A 1G9HA 3KDNA 3OVGA 3C0SA 3K5XA 1Q2SA 5TF0A 4ZR8A 3DI0A 4WY0F 3BJFA 4P5UA 5EL1A 4LS0A 2HPIA 4Y90A 3SFKA 3RLHA 5H1WA 3VNLA 1R9YA 3H4XA 4XAZA 1QK2A 1TV7A 4GZJA 4ZO9A 4V28A 4PFMA 1ZBCA 5CC7A 4AZHA 3IJ9A 4O54A 2NQ9A 2WV8A 4BI7A 3CL6A 3GIYA 3QEZA 1PUDA 3DFHA 3BCDA 1VR6A 1CPUA 4FIQA 3G1HA 3EBVA 2QUTA 4PULA 1XIJA 4XKYB 3MUCA 5HUPA 5LNVA 1IE7C 5GVJA 1DL3A 2R1MA 3GVQA 4DX3A 2F38A 3T81A 2X41A 3QXBA 4X9YA 1QPOA 2QXWA 3KHJA 2DV0A 3P8IA 3E0FA 3JUGA 3G3DA 2ZZ4A 4A8NA 3GDKA 2X1SA 3NG3A 9CGTA 3W01A 2A3BA 1UR9A 3AXKA 4XSLA 4AY8A 4Z1DA 3I65A 2OTDA 1SR0A 1QVBA 2VURA 1RALA 3SDOA 5IDZA 2X7VA 4I8DA 3STGA 1HKIA 3EWWA 4TVCA 2A21A 4IUOA 1BTCA 4RZBA 2OKTA 1XRVA 2DJLA 4RW3A 3KZSA 3QOKA 3S47A 1E4LA 2RGMA 4Q4PA 2PWFA 1VAHA 2CBVA 2YDSA 4JBRA 2HS8A 1XUZA 2QJHA 5I06A 2VENA 2VYOA 1O95A 4H6KA 1DORA 4QDWA 2Z1KA 2X0SA 4GI6A 5EMLA 3M47A 2QJGA 3QZEA 4JYEA 2R82A 8A3HA 3MSGA 2YW4A 3ZLHA 3R4IA 5K3VA 2E6DA 2OLAA 1AG1O 2YBUA 4RXGA 1CXLA 1ZBKA 4S2CA 3KUMA 3P67A 2F61A 1GT8A 3MS8A 5EKYA 1PTGA 3HM7A 3LM3A 1DXFA 4EF8A 3FXGA 1EC8A 1A5MC 3DBPA 1P0DA 1B5TA 2DSZA 3TC6A 1TIWA 4YMZA 3DG7A 5K9CA 1F8MA 4PCTA 2C79A 4JN8A 4O16A 2NZLA 3W4RA 4HNUA 3GU9A 3RX4A 4MWAA 4JTRA 2YCEA 3V75A 1SSGA 4Q6XA 1DWFM 4F9JA 3GNPA 1X97A 3WUEA 3GBDA 1KWGA 2J6XA 4MJ2A 1I0DA 1OEPA 4U10A 4UFLA 3UCQA 2FVLA 6TIMA 3O15A 1C9WA 1AD4A 4JN7A 3KRUA 4JOMA 2AQWA 1TVLA 3CM4A 1EIBA 1E70M 1U1UA 3MA8A 4ZVJA 4I7UA 4PTMA 4PTWA 3W7EA 4FR1A 1NP2A 1OHLA 4XD6A 4XBSA 2DVUA 3LRLA 4W9TA 4AD4A 1M41A 3FW6A 4H41A 4C6PA 2PBOA 4LY4A 2DUAA 2Z00A 1SR9A 3P93A 2D0HA 1BXCA 3S2NA 3HN3A 1EO5A 5AB3A 5LIXX 1DJYA 4FLRA 4GCXA 2LLEA 1QI0A 2GDVA 4PB4A 1NWRA 4XZWA 1XR2A 1BKSA 4HHPA 1VIZA 5KETA 1HO1A 1SMDA 3BICA 3PG8A 3T44A 1FOBA 1KBLA 1V02E 2WXDM 4MNMA 1L2QA 3CZKA 2Y7FA 4BEUA 2ZDRA 2FZ9A 4AZ5A 3VDCA 1A5LC 4H8NA 4DF0A 4DJED 2PU0A 4MYXA 3WBYA 1WV2A 2V5LA 3ARVA 5E9AA 2PODA 1YDNA 5E70A 3TC7A 2OVLA 2QPUA 2Y6ZA 5I3DA 3H2CA 2YCLB 4Y7EA 4R27A 2VEIA 1K4GA 4L1GA 4F2TA 3M6DA 1KRMA 1TELA 2QT3A 3CAQA 1BVWA 2HQAA 1XLBA 1ELSA 3G1DA 4M8UA 3IVUA 3ONBA 4FA3A 1HVXA 1AQ0A 3W1NA 3OEXA 2VC9A 5HWNA 2BXYA 1Q7QA 3RF9A 2G5WA 3EB3A 3VX1A 3TN3A 4H2CA 3B8WA 2TPSA 3QY7A 5IBXC 2WCSA 4QEEA 4RNJA 2UBPC 1RXOB 2YX0A 2WCAA 3TONA 3MANA 1GQJA 4YU1A 4QXIA 3CYJA 4ASTA 3W7MA 5ECVA 3TNBA 3CPRA 2FVMA 4JTUA 1R2RA 3O7UA 3HTWA 3N12A 4KERA 5HR6A 3L0KA 1P5BA 3TW6A 2YXGA 1F8IA 2HVNA 3UY7A 4LNCA 4GC3A 2XGIA 2WVSA 4B5TA 3VDBA 4QNEA 2YLAA 4KCVA 1OG6A 3SAZA 2V3EA 3GC5A 3W37A 3UJEA 2JKAA 1E9IA 1F4AA 4C6OA 5B80A 3UPBA 2CC0A 4ALDA 4QGCA 4GBUA 4HN4A 4Q8OA 2GUBA 2ZUNA 1PXGA 2OEJA 1CGWA 4W8BA 1CI1A 3TX9A 2WB5A 5JMUA 3STPA 1TFVA 3KOYA 1YDOA 1RCQA 1F61A 1FHUA 2NSXA 1KW1A 1ISYA 4YTQA 1S5MA 3S1VA 5BXSA 1TREA 4PBGA 3VNIA 3NAVA 1B2YA 2A7RA 4YTRA 5CC6A 1XLGA 6XIMA 3KHDA 3L4TA 2ZA1A 3M0HA 1RLCL 1WBHA 2ZXDA 1WBJA 1UC5A 4UUIA 1GK8A 2YA1A 3MMDA 3U9IA 1N8IA 4RE2A 3LLFA 1W9BM 3ABZA 2Y0FA 3E0IA 3SQSA 3H26A 2D20A 3D5HA 3OVPA 3MU7A 1H49A 2ZXAA 1BG4A 2VWTA 4RDZA 2E6AA 4H9XA 1XIMA 3PUEA 2Y62A 3VOCA 2CWNA 3G1RA 2EKCA 3OQEA 7A3HA 3R12A 3TUUA 3M64A 1OADA 1WE5A 6CGTA 3SY1A 4XD4A 2C7FA 1NOUA 2YGYA 2Z4GA 1H5VA 1DWAM 3SSZA 1H7OA 1UOZA 4OFCA 5HNTA 3AZTA 4D6IA 2E77A 3E2VA 2Y70A 4Q22A 4OKDA 3H4WA 4KETA 2VM8A 1XCXA 3NQCA 4NX0A 3WD2A 2Z1WA 4K8EA 3LXAA 1KRAC 1EF2A 3FVDA 4AC7C 5AECA 3CZJA 3BC9A 2D1ZA 4MWAD 1UZ4A 2EPKX 3ZR4A 2R1PA 3DYMA 3LEPA 1JCMP 3TCEA 3R8HA 4E2BA 5D9NA 4ZO6A 1H3GA 4ZQPA 1EGZA 2G4FA 2PDYA 3COTA 3QC0A 4YTTA 5D02A 4B16A 2V3GA 2QAPA 3CBWA