4I90A

Structure of the n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus bound to choline
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
302
structure length
302
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
total genus 121
structure length 302
sequence length 302
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i90A00
1GYMA 3QVQA 1T8QA 1DJYA 1XX1A 4F2UA 3EA3A 1QATA 1YDYA 3V18A 4R7OA 3MZ2A 1DJWA 4GNKB 4I9TA 4RW3A 1V8EA 2ZKMX 1PTDA 5PTDA 5T91A 3H4XA 1DJXA 4S3GA 3PTDA 2PZ0A 4QJ4B 2P76A 1PTGA 4F2TA 3L12A 4I90A 3CH0A 3QR0A 1DJHA 2OOGA 3EA2A 3QR1A 4PTDA 3RLHA 3H4WA 6PTDA 4I9MA 2PLCA 4I9JA 2OTDA 3RLGA 1DJIA 1AODA 4F2BA 1DJGA 1DJZA 1ZCCA 5T9BG 3KS5A 1T6MA 2FJUB 3I10A 2OR2A 4Q6XA 4QJ5B 4RV3A 2O55A 1VD6A 4OECA 2F9RA 3NO3A 5T9CE 7PTDA 2ISDA 3V1HA 3OHMB 3V16A 2PTDA 4QJ3B 3EA1A 4RW5A 4I8YA 1QASA 1O1ZA 3KS6A
chains in the Genus database with same CATH superfamily
2O9PA 5MF5A 3THQA 3ME3A 3QVQA 1XIEA 4ZQOA 1KM6A 3VVGA 4ACZA 1IF2A 1DJQA 1K8ZA 3M0XA 2XINA 2ZUUA 3T8LA 4MZ1A 5J8LA 4CN4A 4D1IA 1CCWB 2BTMA 3G0XA 1G4TA 4JOMA 2PSNA 4KETA 5HMEA 1HKJA 3OG2A 1R30A 1J79A 5KZ6A 1IWAA 2DY3A 2HQAA 4ERGA 1TIWA 1FWWA 3RRAA 4UTKA 3GQYA 3E0WA 4IMCA 3B0UX 3DH7A 2O4MA 4R34A 3WLKX 4NYYA 3N15A 1R7AA 4O15A 1RHCA 1QHOA 1LP6A 1JXJA 3OVQA 3TZNA 3N19B 4PL1A 2QDEA 3EMCA 4J5NA 1WO2A 5ECUA 2F84A 4QNWA 1KBBA 3ICJA 3MVTA 3S2JA 4JTLA 3RYSA 4YMZA 5FJUA 4A29A 1QO2A 3C5QA 1C7SA 1UR1A 1W9BM 4WOQA 2V2CA 3B4YA 5AVNA 5CBBA 4HMCA 2AKZA 2V68A 1IYXA 2XIJA 2UBPC 1RY8A 3CXOA 3OHMB 3H54A 4WZHA 4JHOA 5KSWA 3IUHA 3V5OA 2I16A 3B4UA 3CIWA 1PXGA 4PTWA 4J40A 1ZJAA 1A3WA 3LEPA 4GKLA 3TKFA 2A3CA 3W1AA 2XGZA 3KL3A 2DH2A 3QHMA 2ISWA 1V3KA 1CYGA 3H4GA 2D20A 2R6OA 4AFYA 4MPKA 1BVWA 1E71M 1DTNA 1H5YA 3CAKA 3FIGA 1P0KA 2EPMX 3EGJA 4EVZA 4RV8A 4UTMA 5D30A 4QJ4B 3WEOA 4FR6A 5I3JA 1WDSA 4EXQA 3GLCA 5D38A 3CS2A 3UGRA 3QR1A 3CMGA 1UA7A 4IIHA 5EMMA 4KRUA 2V63A 4M8UA 1R7OA 3V0SA 3OA5A 3BTNA 1LWJA 5AYIA 3TWBA 4QDMA 3MKKA 3OGSA 1XLMA 3GIYA 4NVTA 3WF3A 2Q8ZA 4P7QA 2XIOA 1ZY9A 5HNTA 3H2CA 1UPPA 3ABRA 1UR8A 5FEPA 4AQLA 4E2VA 3PJWA 2JGYA 3AO0A 4JGDA 1KA9F 1SFSA 4GIRA 3GDBA 5IXEA 1YNQA 4JDYA 5HANA 2QKFA 4E3VA 2CXEA 3EPOA 1RD5A 5F2LA 2HPIA 1ICSA 3E3HA 2IPJA 2ZYFA 3Q37A 3VGGA 4DAIA 4WEVX 1FP9A 5DEZA 1VPXA 3N1AA 3VTRA 3EBVA 3DECA 4IFKA 3UWWA 4BR1A 1FWSA 4DN1A 3B8IA 2ZBTA 1I2PA 3TONA 3PFMA 4QE4A 2DU2A 1RCOB 2PC8A 3E74A 1CLXA 3HN3A 1NTHA 3DHFA 3WBXA 4S2BA 4LVBA 4DJFC 3W7CA 2WYSA 4NRRA 3AHXA 2Z00A 1QR7A 3QZ6A 3B03A 4LAZA 3GH5A 1H1ZA 1K4HA 4O8RA 3NZPA 2QVHA 2W63A 3GVQA 1B9BA 3MVIA 4MWAC 3WD1A 5I09A 4XBSA 4S3CA 4PFMA 3LA4A 2YX0A 3AHZA 2HNEA 3I6EA 2XSBA 3W9ZA 3T40A 1L0PA 2BLEA 5JIWA 3H70A 3IV8A 3LPOA 3MUZ1 4WR3A 3EXSA 1RAKA 1W5PA 3QV7A 3K4DA 1KFBA 2YGYA 1KLZA 3SRKA 1EP3A 1CW2A 4H83A 3AJXA 1JCLA 3VNKA 4Z2JA 3D46A 4O52A 2OODA 4BEUA 2DSZA 4F66A 4IUOA 1DHKA 3WX7A 5HPCA 1BYDA 2H90A 1W3JA 3MDUA 4J2PA 1XLGA 4LBUA 3FGCB 4ML9A 3LSBA 2EBNA 8XIAA 4US5D 3W7OA 1PEZA 2GDVA 2G3MA 1J2WA 2ACQA 1UB3A 4RDYA 1H3GA 3VNDA 4LGXA 5A2AA 3P80A 5DMLA 2PC4A 3K8MA 1K7EA 3IGSA 4IUGA 3UXKA 2QR6A 4I6KA 1CIUA 3PBYA 3RLUA 3MSYA 5E5CA 1QNOA 3PUGA 3UWVA 4C1LA 2PDFA 3BSHA 2I5QA 1KM2A 5D32A 1PE1A 3A64A 1UKSA 3LG3A 3BGGA 1W1B1 2PTWA 2WB5A 2QV4A 1TSIA 1E9LA 4NAEA 1EGZA 3VOFA 3ARQA 4MUPA 3CUIA 3DFTA 3H7RA 1B4KA 4DBEA 5IHSA 4J3TA 2E77A 8XIMA 4FF7A 1YRRA 1ZGDA 5EMYA 3CQHA 4C5ZA 4CD6A 1ZBCA 4KBXA 1E55A 2GWGA 3IPWA 1JZ6A 3AMDA 1ZP4A 5HQLA 2NSXA 4K7YA 3U9IA 1MSSA 1XKJA 3JS3A 3NJ3A 4V28A 3T0CA 1S39A 1IV8A 4DXVA 1H1NA 2HBVA 4X3ZA 2V3EA 5C7VA 4B2DA 2IW0A 1S2UA 2VP8A 2XYLA 4UTFA 5MHBA 4NJIA 3GNRA 3SM0A 3KOZA 1BXBA 3NDYA 2X2GA 5JBFA 3LHZA 3SUSA 3QYQA 1DWGM 5A8GA 2CIPA 3ZT6A 2CBIA 4IIEA 1JD7A 1IXNA 3QFEA 5G2WA 3GUGA 1MW0A 3WF4A 4PUJA 1BF6A 3NQDA 3H12A 4PH6A 3T2OA 3MI6A 3ITYA 3R0DA 3CV6A 4GQ0A 3O6AA 4HTYA 1KM4A 3V1PA 2CLEA 4F48A 4JFTA 4FA3A 3UU0A 3BJTA 2I17A 3ISIX 2OT0A 1JULA 2GVLA 1O1HA 1PX3A 4FALA 4W8LA 3KVKA 1QPKA 2R8WA 3GC2A 2FQIA 1CLVA 4CU8A 1OZMA 2JBMA 1XFCA 4EE9A 2VRQA 1Q63A 3GYCA 1J0KA 9XIMA 4NKCA 2WNZA 4HSNA 2X0SA 1UD2A 1E9ZB 2CWNA 1DIEA 3L5LA 3JUGA 4IMEA 4I5XA 4PCFA 2H3BA 3H6OA 1HZYA 1X6UA 3VAVA 1MZRA 3NAVA 2O0TA 4TTUA 3THUA 3G0UA 5I2UA 4OTKA 3PZIA 1Q5MA 3CL8A 4RE2A 1X1NA 2GQAA 4DO4A 3IS4A 4GVIA 3NGJA 1PO9A 3R8GA 1PYFA 3BLLA 4NZCA 3SAZA 2DIKA 2R1MA 4ZE5A 1KTNA 1LBMA 1TJ0A 4UQCA 1LYXA 7XIMA 4DHGA 1SFLA 2HCVA 1OBAA 2VZSA 4Q3MA 3L2LA 3WLJA 1CTNA 4FNRA 2GSHA 1ALDA 3MCNA 3L2IA 3SCSA 1C8XA 4OJYA 2VL4A 4EF8A 3C0JA 3ZVHB 1Y7VA 4ADTA 4U3AA 1UKQA 4N42A 1V08A 1NWUA 1XH0A 3L65A 1FHDA 2WM0A 5KTLA 3EKLA 2A7NA 2OQLA 5CC5A 3WLNA 4GH3A 3PG9A 5FF7A 1HJUA 1JPMA 2D0GA 1ME7A 4NG3A 2BP1A 1S5TA 3DYPA 3PBWA 1GORA 3G8RA 2PTDA 3ES7A 1A47A 3TVAA 4BQ5A 4MYAA 5G2HA 2AGTA 4XISA 4DZAA 4LUTB 3I65A 1IZCA 3M46A 3CIXA 2QUUA 4PMZA 4JAWA 2PURA 1ZNNA 1QHPA 3FK4A 4UTWC 1IEIA 1MEIA 3MWCA 1VP5A 2ZUTA 3ZLHA 1W9VA 3W0KA 2R1LA 1IGSA 2F6KA 3MY9A 3C0LA 1RV8A 3WK2A 1J12A 1K7FA 3LHVA 3L4XA 5BU9A 4FMVA 4FOUA 4EOUA 1RLDA 5ABTA 5CZ0A 3IIXA 2Q09A 1VFFA 5BRQA 2L5HA 5EL1A 2BGSA 4WVXA 4AXKA 3UNDA 3AS1A 3LV5A 2BFGA 1DJIA 2WV8A 1ZCCA 4NRSA 1KBKA 1GJUA 1HNYA 4Q4QA 1U30A 4FEZA 3L2MA 2YB4A 3RGTA 2EEXA 1YLVA 2HISA 4KPLA 2POTA 5BZAA 3W87A 4LNYA 5A8PA 1C8QA 1GVSA 2IPFA 1EYWA 3VOIA 3V1HA 2ZX7A 5EFDA 4FF5A 1EFZA 3VILA 1SYTA 3CZJA 5C7HA 5A2BA 4TOQA 1XJBA 2QLYA 2CKSA 1UP2A 2IPGA 2GGGA 2V3DA 2HTMA 4GZJA 5TNVA 3USBA 4HBKA 3OZPA 1UROA 4DRSA 1F4AA 4CU6A 3ZT5A 3G18A 3K1DA 2WKJA 3A5FA 4HMEA 1DQUA 3F4DA 1E3ZA 3WDIA 1KNWA 2J79A 4LEQA 4C1NB 4C7DA 1I1XA 3W1XA 3TP4A 4LRTA 2IKJA 1QNQA 1O5RA 4DY1A 3AYVA 4UMAA 1AQFA 5KZDA 3LPFA 5HJLA 1XXXA 5JXQA 2AMGA 2XVNA 3URQA 4H6EA 4UBPC 3JU2A 3L68A 1H41A 1DQXA 2NVAA 3WQGA 3VGFA 4QQUA 4K8GA 3H4WA 1R9XA 1XIGA 1ZPTA 1TV7A 2R1KA 4FHAA 3TC6A 3II1A 2GJLA 1A50A 1GTEA 6REQA 2BASA 1E0TA 1QFEA 4W8AA 4YJ5A 3ARVA 1ODUA 3GTIA 1KBLA 1B2YA 3ZJ6A 3GR8A 1YBQA 3A13A 3DU0A 4X2PA 3GFYA 4AHPA 4XD4A 2VEGA 5CSSA 4Z08A 2GPTA 4D6IA 5HNNA 2VC6A 3P82A 3PTMA 5JIPA 1CBGA 3JZUA 4UNLA 2OZ3A 2XSAA 4S3BA 1JZ7A 3F2DA 3P62A 2GOUA 4URIA 1VHNA 1XP3A 4H2CA 1GT8A 2OO0A 4Y96A 4EAMA 1R8LA 2Y8UA 4N9BA 2DJXA 2GLKA 1A5MC 3TTQA 3UYIA 4ZR8A 1YX1A 4M0XA 3WNNA 3KE0A 4Y9AA 3RPTA 1IHIA 2OVLA 2FZBA 4QX4A 2X1UA 1SZEA 4R5EA 1X1OA 4GI4A 4PSRA 4M6QA 4D71A 5C5YA 1YPXA 3GU9A 1OINA 2OELA 3ONBA 1GNXA 1S5NA 3L12A 1H7WA 3AFBA 2VTFA 4JY9A 3QQ0A 1E72M 3MKCA 6ENLA 4R7JA 1ISWA 2J7HA 5EKYA 3MCOA 1OFEA 2CZEA 3PZTA 3W6MA 3WEMA 4HU8A 4DUXA 3WNKA 2OOFA 2OSXA 4CNPA 3MO7A 1TMLA 3OVRA 4BEQA 4AY7A 5HWNA 1BPLB 2Z29A 1FP8A 1WDRA 2GSJA 4U5KA 5I3FA 2HVOA 3TJLA 2ACSA 2BBFA 2REQA 3QMSA 2VWSA 2PF0A 2PS2A 1UZ1A 4UCGA 4XD3A 1IEXA 2R9RA 2OEKA 2D73A 1AW2A 3UJEA 1V0LA 4PMJA 4PTVA 2YL6A 1DV7A 1W56A 1AK5A 2X09A 3ONCA 1Q6QA 4LYKA 3T09A 5XIMA 2XH7A 3TSMA 5I3DA 4K8EA 4D6JA 4G56A 4QITA 3M4HA 1CGYA 2WCSA 4QEEA 1V7AA 1EJWC 3VKAA 1EF2A 4QTGA 5HMSA 1WB0A 4LVDA 4L6OA 1CWYA 1W1PA 1YQ2A 2HZGA 2JQXA 4Y9NA 3CT7A 1R3QA 1C9DA 2YXXA 3HJZA 3K30A 1EJVC 3TWAA 3SCNA 1PCKA 2X7WA 5G4EA 2YL8A 2QMJA 4H7CA 2F2HA 5CPTA 5D02A 1MEHA 1M7PA 1O60A 3NM3A 4C6OA 1OF8A 3E2SA 3RM4A 3KCJA 3QGAC 2DFAA 1KRCC 4UC5A 2VRKA 2WMIB 4UNKA 3VDCA 8A3HA 2PLCA 2ICSA 9CGTA 2OTDA 1IIGA 3TUUA 1UZ4A 3G0SA 3E1F1 2QPSA 4RLIA 3VE9A 3W53A 1VPQA 4DUOA 2C91A 1UR4A 3AHYA 1YPFA 5TQLA 3B8DA 4ZTXA 2R82A 3KBSA 1GONA 5EB8A 4GUIA 3OP2A 2BSLA 2PGEA 1E1CB 2BMBA 4Y8FA 1SR9A 3K2GA 1AH0A 2XH4A 3A47A 5IOBA 1HKKA 1GKQA 4DBUA 1LL4A 3HQNA 1CB7B 4QLLA 3Q45A 1RQHA 4E4PA 4NILA 3M0MA 2GJPA 1EHNA 4Z2GA 2PD5A 1A5SA 2PB1A 2G4FA 2Q8LA 2QJMA 3I6TA 3PC0A 1P4CA 4XZWA 1JUBA 2BVDA 1WKYA 3BJSA 1FWBC 5DCDA 2QUVA 1GW9A 1DXIA 1TVLA 3NQ8A 1TVNA 1OWQA 4E2OA 2FZDA 2OYMA 1TPFA 3LBMA 1WXZA 4DB7A 1FXPA 2E3ZA 1V3MA 5ABFB 3MYOA 1YKWA 3V5FA 5E0CA 1GVFA 4LCQA 1BRLB 6CGTA 5E09A 5MKGA 2E68A 3NGFA 3LXBA 4UR7A 4RZBA 5FJIA 3KOFA 4ZB2A 1IGWA 3EDKA 3WQFA 3K5XA 1BVNP 3WQVA 2J6XA 2XDFA 2DVUA 3VK5A 3OVGA 3SR7A 1YDVA 4MDPA 1V4YA 3W83A 4S3JA 1FDYA 3B8SA 2CERA 1QBBA 3NQ7A 3OZMA 1EUNA 4WJ8A 3N29A 3E5BA 4PTNA 4NZFA 4W8BA 2XZ7A 2PDUA 3M5YA 3N2XA 1UD3A 3QGKC 1P7TB 3C2EA 3OLEA 2DUXA 2GQ3A 2QNEA 4GBUA 4XG1A 3THDA 5EMUA 1MI3A 3SN4A 1UH3A 4K7VA 3KP1A 3FEQA 1OGSA 3W27A 4DXKA 4P7RA 1VF8A 3PSWA 4G6CA 4Y90A 3Q94A 1C92A 4RE0A 2XN2A 3VIFA 4UTIA 1ITUA 3UVAA 4C6IA 4OV9A 4AIOA 1R3RA 4C6CA 4O28A 1VC4A 1RD6A 5FSDC 5EYWA 4JTJA 4CNSA 2WZEA 3KAOA 5XINA 2IUZA 6A3HA 5K2ZA 2BY1A 4FIRA 2J13A 4UIOA 2IKHA 1ZENA 1MWOA 1MUMA 3TA6A 4TXEA 2YR1A 1UKPA 2OLHA 2Q02A 3RN6A 1OT1A 1TV8A 2E67A 3RLHA 4XBJA 3PANA 4IJBA 2VFIA 2Z26A 3OGVA 2BWGA 5JQ9A 2RKXA 1BAGA 1NSJA 5A6TC 3N2OA 2DW6A 3W24A 3U2ZA 5I3IA 1AJ0A 3DHPA 3GDKA 4AWTA 3RJYA 2C18A 1HGYA 3IJIA 1JG9A 4KGJA 1E1FA 1V0KA 3NZGA 5BROA 3QGVA 1VBJA 3AUJA 1UIOA 2WWDA 3POCA 3W88A 3TYEA 1KFEA 3J7HA 4JPGA 3KBMA 3MUY1 1S3HA 5IRPA 2XN0A 2C7FA 5I7GA 3WUGA 3T0AA 3CL6A 3RRXA 3PPHA 3E5PA 2I57A 4B9ZA 3TN3A 2NZLA 1HP4A 3GZ3A 4M6PA 4G2DA 3LRMA 3B9OA 3AIRA 4KKXA 4OE7A 1XF0A 3ITLA 4UQEA 2PI6A 3PWAA 2AKMA 3ZIZA 2PDGA 1VJIA 2EJAA 5DY3A 5TIMA 5HJYA 1FFRA 5U7SA 4GGHA 5AZ0A 3D3AA 4Q8WA 1UBSA 1G5AA 2EGZA 2A3BA 4LAOA 4WXYA 1GOIA 3B04A 1UQYA 3RR4A 1W1TA 2XFRA 3AS3A 1RQBA 1CXLA 2FDSA 2QJIA 4HT3A 2YIHA 1WP6A 3RLGA 4WOZA 1NQKA 2GVGA 3TFCA 1AODA 4Y8EA 2E1WA 3W2KA 2DSVA 2OWCA 3LLDA 3AIQA 2G3IA 5A6AA 3LENA 4JTAA 1O94A 3R12A 5D9OA 1KXQA 1XG3A 5BMWA 1CECA 4JTFA 1R2SA 3VDBA 2HSAA 2AL2B 2ZX5A 3LUTA 3UJSA 7PTDA 1ADOA 3AI0A 4O14A 1HKVA 2VI0A 3RM9A 2P8CA 5G4HC 3VIHA 1M7XA 2VCAA 3HG4A 5AHEA 4V2XA 2VFHA 3IAQA 2HNHA 2J75A 4I5RA 5C2XA 3O6YX 1X8CA 4GWEA 4X2RA 2PODA 2DT0A 3MS8A 3GVGA 2VEFA 1U2YA 3HGSA 2OSYA 3OLGA 3WFLA 1JDEA 3ARWA 4S39A 3MMWA 3A4AA 2ISVA 3JR2A 3OLDA 4GYKA 3SFKA 4MSSA 2ZICA 3S2NA 3SY1A 2WZMA 1MDRA 1B3ZA 1VBHA 1NH6A 2NLIA 1PB0A 3VNIA 2XVKA 3L9CA 5LIYX 1GQNA 1EL3A 3E0IA 3E96A 4LY8A 3LDVA 4TV6A 1FKWA 1GQIA 4C6MA 1UPMB 3S2MA 2XGIA 3F2BA 3SGUA 4W5UA 3PWGA 1TWSA 3EOEA 4LT9A 6PTDA 4QSFA 1P6CA 1E4IA 4FOKA 3QSRA 4AVFA 2HEJA 4F2BA 3EOLA 4W7UA 3C2FA 2G95A 3WUEA 4RPQA 3W2JA 1QXLA 4IQDA 3VO0A 4AZCB 1X96A 3QW3A 4UZUA 3VDAA 3ABZA 1MW2A 1TV4A 4WSJA 3G1HA 3S4TA 3ARSA 1LLWA 1MNZA 4V1XA 4CNTA 1MQQA 4E0CA 1X98A 2F2KA 3CZEA 3EAUA 3W7KA 4MOZA 4UQDA 2H9AB 1U1HA 3S5NA 3FEMA 1US2A 1FQ0A 2Y4SA 2I1OA 1JI1A 2BNJA 3A5VA 1F74A 3WMLA 3NQFA 2ZZ3A 1IE7C 4LYQA 4XVEA 1SM9A 2NXGA 3O6CA 5BU6A 4NSBA 1W3HA 4ZVJA 1I8JA 3P67A 3ARUA 1CDGA 4S3GA 3OB8A 2GDQA 4REQB 4CCCA 4D2JA 3HPZA 4NP7A 3RMEA 1EA9C 4MAZA 5HATA 1EX5A 1H1YA 3VKCA 2WCGA 3CUHA 4W9TA 3WELA 2O9TA 2XM2A 3AMLA 5F4SA 4Z2HA 3BW3A 1VLWA 4GI9A 1A4LA 1TX0A 5LIKX 3QY7A 2OT1A 3N4EA 1PZ3A 3AYTA 4AHOA 3TK7A 1UUMA 3HU7A 4XAZA 4F9DA 1NJJA 4XB3A 4XX6A 1Z89A 3KM8A 3N17A 3ZJ7A 3CBWA 1AMYA 4O1AA 3QR3A 3VIKA 4Q6XA 4QJ5B 1XYMA 4QQ3A 1EDTA 2XHYA 3MUAA 2FGBA 4J2MA 2PWHA 3U3HA 3SCTA 4MDOA 4MJ2A 2BV9A 2QMKA 3CUXA 3NQEA 1J11A 2J62A 1XGEA 2Y7EA 4QBXA 2BXVA 5IDIA 1UR2A 1YTEA 3N6HA 4YWSA 9XIAA 2VC9A 1OD0A 4P7LA 2Y0FA 3NSMA 3U5UA 4L1XA 2OZTA 1WKEA 3BURA 2OX1A 4Z1CA 3TJIA 3GDLA 5BRBA 1JYWA 4JY8A 3UZWA 4F0HA 4Z42C 4W89A 3UCDA 1ME9A 4RPPA 1Q8JA 4DBDA 1J6PA 4NU7A 2WXDM 1TV2A 4JTGA 4OZOA 3AXIA 2W4XA 3HIJA 2CNCA 4H04A 1B30A 4WY0B 3EDDA 1VAHA 1HG3A 4FLSA 2CLFA 1OD8A 3H7VA 4HJWA 5KETA 1L6SA 4GMEA 4XO6A 4US6A 4N6EA 1N82A 4LX4A 2ATSA 3S5ZA 5CPNA 3WNMA 3GRIA 2WMGA 1F05A 3QTPA 1QNRA 2X8RA 2PRMA 3A6OA 3DOPA 4ZL1A 1GZ1A 3LCFA 5BWAA 2YA0A 1BG4A 1HL9A 4MWAD 5HJXA 2OYKA 1US3A 1G9HA 4LB4A 4N4PA 1MNSA 2INFA 2Z27A 4P2VA 3FW6A 1KXVA 2GJXB 3UJ2A 2ISDA 1W1A1 4HD5A 5IHRA 3BGJA 1CI1A 3P6LA 4XAGA 4US5A 4NZ3A 4HQVA 3P8IA 1ZJIA 3VKBA 3GS6A 1UH4A 4QLJA 4A3QA 2NUYA 2WHKA 1UKTA 3ZR4A 3LBOA 3G6MA 1WBHA 4XZNX 1OG6A 4IIGA 4J3XA 3WL0A 4X61A 4H8NA 3ATZA 4MLRA 3CHEA 1N8WA 3YPIA 5GNYA 5B80A 3LN3A 3BAWA 4GUJA 4RXFA 2VEKA 2W5FA 1KWGA 4NASA 2FTWA 2HV5A 1RCXB 3FSUA 3VMOA 1TA3B 2P3EA 5D33A 4JIEA 3W7PA 4NQ1A 3WQPA 2FZ8A 3UJRA 2V5JA 3S2CA 5BMXA 3E49A 2C6QA 4I9JA 4ECLA 2B0MA 1YADA 3VM7A 4EKJA 4X60A 4WSKA 4BJHA 3S0CA 1DJGA 4GVGA 2CBJA 2VELA 3S83A 2VGBA 1UMYA 3REQB 3LCLA 1GG1A 5LHFA 2WK2A 3KDNA 1QW8A 1D2KA 5I79A 1QW7A 1B90A 3T44A 1RUSA 3CNYA 5A6JA 2E9BA 3PK7A 2CFFA 4Q7NA 2C3ZA 4HVXA 3ELFA 3ZFHA 1TB3A 4O10A 2JIEA 1JPDX 4L65A 3NSNA 3E0LA 3DENA 4HOWA 1DXEA 4QAWA 3G24A 1P1MA 3EDEA 1QOPA 3NQMA 3FJLA 1QRQA 1ZL1A 4DJEC 4IX2A 1E43A 3UG3A 3L5MA 3GK0A 3RCNA 2AGKA 1W6TA 4ATDA 3JZEA 3V5CA 1TRIA 1F9CA 3W7JA 1V8EA 2XG9A 1KM3A 4GISA 4HP5A 1XW8A 3E2VA 3GNDA 1SJDA 1KV5A 1O5KA 3QF0A 4MJMA 2J27A 3PP7A 4RXGA 3ABXA 1FH7A 2DZVA 1JRBA 2WVVA 3AXHA 3VZZA 1YXDA 2V67A 1YXCA 3S5YA 3BW2A 4GVHA 4QXIA 2ZA2A 3DC0A 2D69A 5JBEA 1QPQA 5HR7A 3K8KA 4LUSA 2CETA 3AXXA 2RFGA 3HA1A 4AWUA 5FJJA 3VMPA 5REQA 5SWUA 2YBUA 3C56A 1R3YA 2Y88A 3HB9A 4ZFMA 1OX4B 3VFCA 1RVGA 4CVWA 2WSRA 2CLMA 3LTYA 1DIDA 2JF6A 3MI3A 1FKXA 1PSCA 3UR5A 4G1NA 3L4YA 3M07A 5D9MA 3LMZA 1LRTA 1HVQA 2DORA 2OU4A 3ZOAA 3BCFA 4DI9A 1XQKA 1J96A 1XGZA 2FDMA 3C61A 3WLMA 3WLOA 3U0HA 3RF9A 4YCPA 4L6HA 3SSJA 4A8RA 3KL5A 3EX3A 5D05A 1OIFA 2ZIDA 1Z9AA 5C71A 3DFPA 2ZE0A 2Y6ZA 1EWDA 3E02A 4QLKA 4IMDA 4IMGA 3W1TA 2QDGA 3P60A 3A24A 4I9TA 3AIEA 4XUYA 3VE7A 4GY0A 4ZODA 3D0CA 1OCQA 3QN3A 3WDQA 1UASA 3HPSA 4H4IA 3ITGA 1SO5A 4N9CA 4MJ4A 4DNHA 3SQSA 5LSMA 3CO4A 3SEPA 3C6CA 2ABAA 3B9NA 3B0XA 4RL3A 4MKSA 4GBDA 4I9MA 3UXIA 1S2TA 1VH7A 2OLAA 1GW1A 2V30A 2PDJA 4JTRA 1W91A 1WOAA 3PB2A 4QE1A 3LGEA 3TW7A 3PZUA 1GYLA 3EWYA 1NIUA 4UFIA 3PTKA 4UZSA 4JIQA 2VQTA 3BUVA 1E6QM 3M0VA 2TRSA 4PMOA 2E28A 3U6WA 5AC5A 3A3HA 5T9CE 5AVHA 3LK6A 2OEMA 4KRZA 3O7UA 4NZ4A 2JE8A 4IICA 1YNYA 5HUPA 5F7UA 1TZZA 3SRHA 1IT8A 2GFTA 4M7TA 1TQJA 1B3VA 4I7VA 5D2WA 5CC3A 4XZBA 4YNGA 2P3ZA 5D09A 5L9FA 2Y63A 4KCTA 3VOHA 2XTKA 2YSWA 2VX6A 3LCGA 1SFTA 2MANA 2V0TA 3BLOA 2Y7GA 4C91A 3L67A 3HZ3A 2GUBA 3OLIA 3W76A 1JXKA 2IXUA 4GX9A 3QM3A 5CSRA 4AC7C 2J25A 3NQGA 5LNWA 4CKQA 3S1XA 3IVSA 3FV9A 1TVPA 2AQOA 3RJXA 2V3FA 1NDWA 1ITCA 3KHJA 3LHUA 1W9PA 5LGXA 1NVMA 3S6OA 2NX1A 4OU1A 2VUNA 4BQ3A 5AC8A 5KZEA 1CXIA 4CD7A 3RX3A 2BXYA 2VNCA 4EPDC 4K36A 4FSAA 2OZ0A 3KEHA 4TX6A 1G69A 1H51A 4JN8A 3PZ9A 3WH8A 2J7EA 1KRMA 5CSYA 2X1SA 2Y1HA 2F8QA 5LHEA 1SJAA 2FVMA 1WV2A 1KRAC 3TR9A 3NL5A 2CLLA 3BANA 4CCEA 1E0VA 3TH6A 4JFUA 2W6RA 1W3LA 4UFMA 4QRNA 1E4NA 3I7RA 3V16A 4JTDA 1CZ1A 3W7NA 4UNIA 3RITA 2CZFA 3G1AA 1W3TA 1OEPA 5AFDA 4XZHA 4F0KA 2ASHA 2Q71A 1R38A 3DHDA 1P0DA 1DORA 4M51A 2V5LA 4DWSD 3IAPA 1G01A 3AOFA 1A0DA 1E15A 1EP2A 4WY0F 4LTSA 3FJ6A 1XICA 2TYSA 4D6DA 3NZRA 2WANA 4IXXA 4Q8QA 4HNTA 2O7QA 5AB3A 1NFPA 4D1JA 5GQBA 4HU0A 4L61A 4M81A 5RUBA 3TN4A 1FCUA 4GHRA 5C9XA 1D3HA 4PEEA 4CQ9A 1PKLA 1HUVA 1CLKA 2PWVA 1E1EA 2ZWYA 2NVCA 4IGHA 3AXMA 1A80A 4WJEA 2CITA 3MWAA 2ZVRA 3QZAA 2R91A 3QLDA 5CEWA 3L7RA 3WMBA 4LALA 1T5AA 1ZHAA 4MB1A 1K3UA 1K9EA 4HYRA 4IQJA 1TWIA 4HJFA 5CGMA 4MF4A 4Z2KA 1TPUA 1KB3A 1WPCA 1JZ4A 3CQIA 4RK8A 4HNNA 1GKPA 3S9IA 1ZSXA 3QEZA 4LBSA 3TN5A 2UY4A 2EG6A 4PMXA 4RJEA 4RNIA 2ISSA 4FNQA 4S3KA 3VD7A 3T0TA 4GIYA 2Z1XA 3P7YA 5C9UA 1HGWA 2B7PA 2VOMA 1FH8A 1UA3A 2ZTJA 1SR0A 4AWEA 3LERA 3VA8A 1ME8A 4DJDC 4L1GA 3GXPA 1T99A 4F0LA 2XIQA 1ESWA 4GYPA 4JCMA 3GHUA 3PZMA 4FB7A 3ENLA 3N04A 1QWKA 1GPFA 1E4MM 2FLIA 3AHTA 1IIHA 5FCZA 1HTIA 1UYQA 1X6NA 4ZQCA 3G5EA 4H3DA 1RBLA 3FA4A 4CCDA 4AF0A 3N11A 4TVDA 3UETA 4AIUA 5FAGA 1EEXA 4M7SA 3SFWA 4ZXOA 2VGFA 3U4FA 1GKRA 3MT1A 3NOEA 4D6GA 1RLCL 2WM1A 3MW7A 5HOSA 4I9AA 2B7QA 4NIRA 1HVXA 2HXTA 2YFOA 1H60A 2G97A 3RLVA 4PEKA 2FGZA 3WDHA 3KRBA 7TAAA 4BZYA 2I7GA 3BH4A 1M01A 1TRDA 3EWCA 1WDPA 3A4XA 3G1YA 3B9EA 3GC4A 2ZXBA 1XBXA 3KRZA 1EIBA 4V1YA 1TMQA 3HPXA 2ESCA 2RDUA 4GJ1A 4RW5A 5JVLA 4JYDA 1WQ5A 4UFJA 1R46A 1K4GA 5L6UA 3PBUA 3UPWA 2WNNA 4PFHA 4NAFA 1KGWA 1XRFA 1VIWA 3MZNA 1S46A 1THFD 4QHRA 4OFCA 4WDWA 5H8UA 4AMCA 2FTPA 4TVUA 4JNZA 4F79A 4R9XA 3VGBA 4PCSA 3VABA 2PBOA 3NPWA 3NPUA 3RXZA 1R6WA 3S42A 1BSIA 1KGUA 3W02A 3W7LA 3TYCA 1WCGA 3IK4A 2INZA 4L64A 4ROPA 1SW3A 1NELA 2P1FA 2W67A 3CB8A 4H9UA 3SB0A 4JL1A 3ZM8A 1IR1A 3OTRA 3UCCA 3UFYA 4N4QA 5C2CA 3C8FA 4BY3A 1L8NA 2ZZ7A 3WQ8A 3BV4A 4G7FA 1QI4A 5DY2A 3RM8A 1H0IA 5AC4A 1XIHA 1Z69A 3I4EA 4WKHA 3GG8A 2HE5A 1JJKA 2PE4A 2PWGA 1N55A 4L5ZA 4EANA 1A3XA 2OFJA 3VNZA 3O2LA 3HGOA 2H3DA 1POJA 1SSDA 4ICNA 2B31A 1KQZA 4GYJA 3GKFA 3POHA 4GFIA 4L6DA 1EPVA 5M5DA 2ZRXA 1E5JA 5A8NA 3COTA 3SCPA 1EQCA 3O63A 4JQ3A 3VCCA 5DRIA 1W9UA 3G1RA 2QCGA 4PA8A 5LKYA 1ZJHA 3VD5A 1JDDA 1C8YA 2EG8A 1C93A 3W2MA 3N2BA 4HNUA 2YZRA 3QPEA 3M6YA 3W7MA 4OT7A 2YJQA 1E0WA 4WD0A 4MZ8A 4JFVA 1PTDA 2V69A 4H8HA 3ANUA 2Y7DA 2CLIA 2OG9A 3S6DA 1AVAA 1E6ZA 4IIBA 2EKCA 4K37A 3IRDA 1AL8A 4TX9A 3BV7A 4RDWA 4UWMA 2EPLX 2J9ZA 2A21A 4FX7A 1FFQA 1NAL1 1YXYA 3C0SA 1J0JA 4NNCA 2ZZ1A 4ZOAA 2HROA 3DFOA 3EPMA 3HG2A 2CESA 4R27A 4HZ8A 3K13A 4GJIA 4F40A 1G0CA 5C9WA 2TPSA 1KWKA 2IMRA 3W86A 3VD4A 4R9OA 3ATYA 1PBGA 1J0ZA 3SDOA 1NWTA 4B4HA 1E5NA 4MHBA 4AYSA 1LQ0A 1X39A 4BWLA 4LY4A 1WZKA 3VCRA 1XPGA 2YDQA 3ARYA 4A3RA 4Z2IA 3B8VA 3MSDA 4IFKB 3SIMA 4OKDA 3CUJA 1JQXA 4HK6A 4DI8A 2VX4A 2B81A 1REQA 2FZMA 3GU1A 5LNRA 3CMJA 3W71A 4I7WA 2CPUA 1BYAA 1QBAA 3QH2A 2XIIA 3AWOA 4JCLA 5FI8A 2DZAA 3ERPA 5A6SA 1H09A 4RW3A 2CHRA 1Z8AA 1HJQA 2HS6A 3G8EA 4NYUA 1R3TA 1XLEA 3H4XA 3PN8A 1TTQA 4RDZA 3L4WA 2FKPA 1VFHA 4J9JA 3WDRA 4BFAA 2GGIA 3VPLA 4IJCA 1KFJA 3CIVA 5GNZA 3EDFA 4KWOA 3AMKA 2C0AA 2HVNA 1ITXA 4S1FA 3FCPA 1IT0A 4IHCA 2XZ9A 5ABEA 2XVLA 2A79A 1TPEA 3FVMA 3APTA 4ZQMA 5T9BG 4Z17A 3GXIA 3KFTA 5M2FX 4PMYA 4KCWA 1U33A 4O53A 3FFSA 5CG0A 4WRHA 5DCEA 4F0SA 1Q7MA 4CNNA 3DFYA 1DKWA 1YE6A 4FP1A 3WD2A 4L4MA 4V33A 4PC8A 2QPXA 1LZOA 2VR5A 4DYEA 1AA1B 3RK8A 4DYKA 3AROA 1UOZA 1Q8AA 1EOMA 1ONRA 4EPBC 1LWHA 2DT1A 4A3UA 4PN2A 3CUGA 3BVJA 1R47A 4LEFA 3WFZA 3T81A 1YW1A 2CBUA 3W1MA 4LYRA 4OGZA 3UZYA 4W88A 1IEWA 4PMNA 1ZCOA 4JIRA 1TR1A 1NOWA 3VGDA 4DBSA 5LA0A 2FPTA 2P76A 1OFQA 5H8MA 1J18A 2VFGA 3CH9A 1ZJBA 4Q4RA 1SO4A 4GD0A 3BXWA 3EWXA 4HU4A 3QW4B 1XRVA 1EPXA 2NQZA 3VGEA 4Z1AA 4NAEB 3DKLA 3U4AA 2A4AA 4HNVA 2W91A 3UR8A 3EDJA 2XIBA 3LU2A 3FHQA 5FJPA 1NQ6A 4YVPA 3APGA 3NYZA 3WD4A 4C5YA 1V3HA 3CK5A 3W75A 3NQ2A 3TYZA 3HGRA 4HPGA 1JFXA 1Y65A 2ZVIA 5CXPA 3DI1A 1NDVA 5H91A 2DT2A 3M1ZA 2OKTA 2ZX8A 3ITCA 1XLLA 5CGQA 1JYVA 1V3LA 1F6KA 4P8UA 1POKA 4KT2A 1A5NC 1FWFC 1EJRC 3BE7A 3GXNA 2W9MA 5FL1A 1AL7A 4Q8OA 4AY1A 2HK0A 4ZENA 3KL0A 3NDOA 3P81A 1XRTA 4M6VA 1MXSA 3LMYA 4N7QA 4XBKA 4JNMA 3PG8A 4XKYA 3WN6A 1JCNA 3W73A 4YHEA 4MPQA 1QMLA 3LGDA 1WUEA 3RNDA 1UMLA 2QVNA 2CXGA 4MMWA 4UMBA 4B4FA 1ZBVA 4KWWA 1E4LA 4WGHA 5E1QA 4IXHA 1O68A 3M41A 3R89A 1HO4A 1MMFA 3NPVA 2IXVA 4ZMGA 3BMWA 1V03A 1JNEA 4GQBA 1Q6DA 1XWYA 3RCMA 3KVLA 4ZSTA 2ZFAA 4QISA 3WLPA 2CHNA 1QNPA 5HMDA 3PBGA 2GUYA 2QZRA 1IZKA 1I1WA 5D2TA 4WK9A 3F1QA 4NXSA 4KWUA 4WDTA 1Q2SA 1VR6A 3FLUA 4ORIA 4TTGA 3TNOA 2J7GA 3PPFA 3ZR5A 5TD4A 3VOJA 2DUZA 1C3FA 5A6BD 1QU4A 3UWEA 2ALRA 1EBGA 3EYPA 1PUDA 2O4QA 1VKFA 1ENUA 4LUIA 3SUTA 2VHLA 4G7EA 3TC7A 3PBMA 5IFTA 1V02A 1JDFA 3TXVA 3Q65A 4KF1A 1MEWA 3C52A 1BTCA 4JXCA 1P0NA 3CZGA 5J5DA 2VZVA 5HAOA 1SZNA 3M47A 1PIIA 2JF7A 3ABOA 3EB4A 3AU6A 5FD0A 5LGZA 1V7YA 5AYYA 2YW4A 4IFOA 1RBOB 1KXTA 4HGXA 1ZTVA 2WZHA 3F4VA 3MUXA 4GUHA 2Z0IA 1XDMA 2A7RA 1ICPA 3GHSA 3AZSA 4AX7A 3GZAA 3BO9A 3FA5A 2UY2A 5M03A 5G4WA 5LA1A 2PP0A 3L66A 1TX2A 4DZ5A 2DT3A 2PLKA 1DOSA 3MC5A 3GH7A 3H53A 5I6SA 2VYOA 3W7QA 3N13A 4W7WA 4GXWA 5CBIA 3DZ1A 1U1UA 1ISVA 1JGMA 3PF3A 4ZBCA 5A6MA 2GQ8A 3OIHA 1XLDA 4BI5A 5A6KA 4L4OA 3GO2A 4W84A 1DE5A 2VKZG 3V36A 2DUAA 3LRLA 1IQ8A 3NOYA 4KWVA 2BDQA 1UWSA 4LVGA 3EMQA 1VEMA 6TIMA 4B5TA 3VZXA 1U22A 3VU2A 3QXBA 1ZAIA 1PHWA 4GYFA 5A95A 3CLWA 5HUOA 1W31A 2P10A 2ZADA 4XKMA 4Y6GA 3GNXA 1HJXA 5FJRA 1Y5XA 5FF3A 2W79A 1SZRA 2BZNA 3BW4A 3SGGA 3TEVA 2Y89A 2VCBA 1E0UA 4GPNA 3HURA 4RDVA 3DCPA 4Q8TA 3PNUA 5DX7A 4H8VA 2E9LA 3EZ4A 4ZA0A 2DP3A 5I0DA 1OT2A 4A3YA 3WD3A 1WBJA 4P8WA 2TSYA 5CZJA 4MWAA 3GVRA 1RR2A 3LCHA 1VBRA 4Z0SA 3LM3A 5BXSA 3AYSA 1B54A 3UT0A 1I2NA 3SJ3A 3B9DA 4AVNA 1XM3A 1N7KA 2YYTA 3ZXWA 1SW7A 4ZO6A 4RV3A 2QXWA 1W2VA 4Q4OA 2EPKX 4GXPA 2FIQA 2IKGA 4M80A 3VINA 4OUEA 1QOXA 1UUQA 3OBKA 5CC6A 1MFUA 4TUFA 4WCJA 4LF2A 1S5VA 3HPFA 1HX0A 4TV5A 3SJNA 3WG6A 3OU8A 3IIOA 1EIXA 1G4PA 5D8WA 5A5WA 1XLCA 2OB3A 3MHFA 3LCWA 2JKPA 5G2IA 2R1NA 1XLFA 3W37A 2CW6A 1TR9A 1P6WA 4EXAA 4JHMA 3ZQ9A 2UZ9A 2EAWA 1GUVA 5CAHA 4KEZA 2I9EA 3SY5A 1ZAHA 5EU9A 4JQ1A 2KAUC 3ALFA 4DXXA 4LC6A 3R8RA 2E9MA 2Y85A 3KX6A 4E5TA 3MMDA 1UWAA 2PDKA 2VFFA 3H8AA 3THCA 3WBWA 4X0VA 2A3LA 1AG1O 2RH9A 3LSCA 2A85A 3GXTA 4PBGA 3UBPC 3TYDA 3TIMA 4X63A 3VKJA 3BGAA 1F73A 4LSBA 6REQB 2VGIA 1OGBA 1PX8A 1MRQA 4H01A 4GIAA 5TAOA 1YBQB 3S1UA 3DBNA 2QIIA 3CYJA 2NVDA 4EPEC 5K7JA 3QV6A 4GC3A 3W3OA 4Q7BA 5C8BB 1GGOA 4E4FA 5DT7A 3MMUA 2J9YA 2YCLA 1AMKA 3ZR6A 2QULA 3H55A 2JKAA 2QUNA 3V3WA 2FGLA 3WJWA 4H9VA 2AQWA 3H21A 3VFLA 3GTHA 4YCOA 1I6NA 4AD4A 5E0FA 1XR2A 1K6WA 3LYEA 1JVNA 4UTUA 1UBPC 3ITTA 5C0QA 1EO5A 4KFPA 4AVOA 1V79A 2E6AA 1HL2A 3PBVA 1XYLA 1RH9A 3N9RA 4QIUA 1EGVA 3M7WA 1K8XA 3IGHX 2PUZA 3QHOA 4GNVA 3VUPA 1QTWA 3GG1A 3P2VA 3GTFA 3OQ8A 4X9SA 1XLKA 4M29A 3F7JA 4MNKA 3MP4A 1RQEA 3DBPA 5FEWA 1XLBA 3KBVA 4LANA 1DWIM 3LXAA 3U2CA 2VGGA 5AHIA 2WMHA 2C0HA 1E3XA 1K6AA 1J10A 3WK0A 4J1OA 1X7IA 3O06A 1WKFA 1FWNA 3DKJA 2NLYA 4XIAA 3UQNA 2PRHA 4XD6A 1A49A 1OYCA 4NJKA 1KD0A 1J01A 3AZRA 1DIKA 2IKIA 4JD4A 1OFAA 2QCNA 2WC4A 3VIPA 3GFZA 2JALA 4S38A 4IGSA 2GWNA 2CU0A 1R5YA 4EF9A 3W4RA 4DAFA 3PAOA 2Z7KA 2REQB 5KZMA 1MYRA 5DXXA 4TMCA 4IP4A 1R2TA 4PMQA 3EX4A 5H6HA 1JEZA 4I8DA 1P5BA 1RA0A 5GNXA 4JHZA 2PDWA 4WY0A 3FHAA 4IX0A 3G3MA 1GVQA 3U7VA 3T0BA 5I3GA 2NWRA 3VNLA 4A6GA 4GVFA 3WKZA 2R1PA 5CQ1A 4FI4A 1UD5A 4O16A 1CT5A 1Q4WA 3FX4A 4RZ5A 1ODZA 4LBRA 4ZZ9A 3TQVA 5CPQA 2VX7A 1XIMA 1G7VA 1CNVA 4JKKA 3T0DA 2Y5JA 3HO8A 4D6FA 3RHGA 1ELSA 2XM1A 3T55A 3NDZA 1EJSC 4CCZA 3NEHA 4FPSA 1PKMA 2J6VA 1BHGA 4L9YA 3M0IA 1GVIA 3V18A 1JNDA 2DZSA 3O9NA 2QW5A 2FB3A 3W1PA 1UP0A 4LNCA 1TTIA 3M0KA 4IPNB 1EP1A 1PZ2A 1UWQA 2EG7A 4D8LA 4DO7A 3WIJA 5AC6A 1FOBA 1JFHA 2ACRA 2PP3A 2V81A 1EXBA 4GC4A 1LUCB 1US0A 2PDHA 1L6FA 3P93A 2PDCA 3N2TA 2YB1A 4DPQA 4JX6A 2WPGA 2E09A 2OPJA 3GAYA 3PUDA 2HPMA 9RUBA 3B06A 2FHBA 1GPWA 3TR2A 4JTKA 3KBNA 3ARPA 3BAJA 4WQ6A 3LM7A 3GVWA 3HJEA 1R3SA 4ENLA 1OZQA 4XTDA 4J28A 1V6VA 4JTUA 1KFCA 1VFLA 3DUGA 5D37A 2BGNE 3R10A 1GJPA 3CQ0A 3P5YA 2YYUA 2O92A 5CJMA 5D04C 1GEHA 3PUEA 3GY1A 1JF5A 4LJ3A 3DGBA 4N02A 1FVPA 4G9PA 4QEHA 4GG9A 1BWKA 1NFGA 5KMYA 4J3UA 3RU8X 2PU0A 4CD5A 3AQUA 2DVTA 3URAA 3SUVA 4EWND 2NUWA 1H11A 5A8MA 3KS6A 4DVOA 3EKZA 4O0KA 2G3JA 4DQWA 4S3AA 3T4WA 3BOLA 3RU6A 3EX1A 3CL7A 1QHZA 5M1TA 1YDYA 1ZUAX 5LNSA 4CQBA 4CEUC 3R0KA 3M0JA 4LXFA 4B5XA 3GW0A 5K9DA 1GOQA 1VYPX 4QCFA 1UR9A 5MKGB 4QM1A 3CAQA 3QY6A 3CYVA 2VURA 3BQ5A 2PDPA 1W9DM 1KR1A 4MKNA 3GKAA 4HA4A 2GQ9A 2Z28A 7REQA 2DPEA 1SU5A 1PS9A 4OV4A 3UA3A 4XZIA 2JKEA 4AZBA 1R85A 2FPYA 1QOQA 3H23A 1LTDA 3QC0A 3SW6A 4PCNA 3W29A 2BOFX 5JBDA 3TYBA 5LIXX 3N9SA 4M1RA 4FNUA 3KLLA 1K9DA 2VFEA 4GKTA 3SY8A 3QKEA 4O0ZA 2WNWA 3NM1A 4AG0A 2OYLA 2PWDA 4H9MA 3S1GA 2VZUA 3I3DA 4N9DA 3WNOA 2NQ5A 1VPYA 4CQCA 5K4XA 3VC5A 4DEFA 4MNLA 3VIJA 4PMUA 5BOEA 5I07A 1QW9A 2B7OA 1QAPA 3T1GA 3VMNA 4DWSA 3IIVA 2OWXA 3BCDA 3LNPA 1W1ZA 3ZWSA 1OY0A 3TCSA 3DHUA 1WNOA 2ZC1A 2B7NA 2E5CA 2PAJA 3CZLA 3OHIA 1G4SA 2E40A 3ORWA 3ANYA 3C2VA 1Q6GA 4PRWA 4PUKA 3L4VA 3AU2A 3O3RA 2ZA1A 1BQGA 4MB5A 1B57A 3V7PA 4EX4A 4R3UA 3GNPA 3LS9A 2P0IA 1XLHA 3M5XA 3ABQA 1BKHA 4Q4SA 3FVDA 5HQMA 1NEYA 3AZTA 3UY7A 3CO8A 3C2YA 1T40A 3BMVA 5BNKA 3B8TA 4L1WA 3AYRA 3W72A 2PFHA 4JDBA 3N9KA 3B3DA 4XO7A 1OC7A 3INPA 2R14A 4KWSA 1G7UA 1T6MA 1TIMA 4QS6A 4IGNA 2WO5A 1B3XA 2BHUA 4AY8A 2UWFA 2D23A 1XSKA 2Q8XA 5BCAA 3VXGA 1UUOA 3PS7A 3USZA 4XD5A 1VCGA 4GZIA 3QTGA 1Q66A 1J5SA 1ZQ5A 2FZ9A 3E38A 5C70A 1TELA 3QKZA 2ZX9A 2ZRUA 1BSLA 3EA1A 5CJNA 1RP8A 2EXOA 4OQVA 3RDKA 4E6MA 4TIMA 1CENA 3W70A 3DAQA 3LD5A 3CJPA 3W38A 3AIUA 1JZ2A 4OOZA 3ES8A 2OKOA 1JCTA 4RZ6A 2VJXA 2ZRWA 4E8DA 1LM1A 1M6JA 2VM8A 1FCQA 2RDXA 4H9XA 5DANA 1OF6A 3OZYA 1K8YA 3N3MA 1I60A 3PTDA 2VC5A 4PL2A 4YVVA 2DZXA 2J7DA 1M5WA 2CYGA 3BARA 1J0HA 4CVUA 2ALDA 4NJHA 4UB9A 4C6NA 3A21A 3KHDA 3FOKA 3FKRA 3WH9A 3V0UA 1VYRA 3STCA 4TQTA 4KIEA 1XCXA 1MZHA 3EOSA 5G1MA 2PLMA 3CUZA 4DJDD 4ZO7A 1OFDA 1DBTA 1SZFA 1SO3A 4BS0A 3RPDA 2BGQA 1JI2A 1O12A 2ADAA 4FX6M 1WOBA 2WSQA 2VD8A 3QLLA 4N2YA 5A3HA 4LH8A 3F03K 3KRUA 5DMNA 2ZUSA 1LRNA 3V0TA 1JF6A 1XDLA 1VYSX 2GK1A 4IM4A 5EY5A 2G3FA 1Y5WA 3S6TA 4PE8A 2CLHA 3VNJA 1YTKA 1GZJA 3ALGA 4P8VA 4V15A 1VFSA 5DRCA 4LVAA 1JYXA 1OJXA 3QOKA 1D8WA 3W7HA 3RR1A 1JQVA 4MB3A 1JAEA 5U4NA 1EZWA 1RPXA 3WSUA 4S3FA 3L0KA 1DP0A 3GAKA 1O1ZA 1LG2A 3UESA 5FESA 4OVXA 1EUAA 1KRBC 3WF2A 3FKKA 3LI0A 5I3KA 1EXPA 3A12A 2XISA 4NNAA 4NZJA 1IZJA 1C91A 1H2JA 3DEQA 4ZB5A 4MVAA 3DESA 2ZUMA 1W8SA 3CZ8A 1PJ9A 3E2RA 4IH3A 4R85A 4ICMA 1TWZA 3SQLA 2TAAA 4KIRA 4OWGA 2BHZA 1FHVA 2WC7A 4DBWA 1BXNA 1F76A 3GR4A 5E0KA 2GSEA 4JYFA 1CGTA 3NL2A 3GX9A 3AXKA 5LA2A 1LWIA 3A4JA 1P48A 5FACA 3KP0A 5CJ5A 3CTTA 1HJSA 8TIMA 2YXGA 2C1HA 1KR0A 4O4WA 4UQ9A 3TN6A 3SCQA 4B15A 2ZRVA 4RUBA 4MGGA 2JGQA 3BMXA 2Y8VA 1ZRQA 2Z4GA 2C19A 4MYXA 1Q7QA 3A9BA 4NX0A 4A8IA 1Q2RA 3GIQA 1EC9A 8RUCA 1DWFM 3VUSA 3QQWA 4WSHA 1VS1A 1Y8BA 2ISFA 1VGAA 2OQHA 2CZ5A 3PPGA 2QF7A 4J7RA 3LI1A 4AX6A 3IEBA 3DERA 3OZOA 1F7BA 4LB3A 4F3HA 1S2AA 3W85A 4QDPA 2J7CA 3WQOA 3NL6A 1WAUA 3MUCA 1HO1A 5BOOA 3CH0A 3TOYA 3U2EA 3PPCA 1UWIA 2RDWA 3AIWA 1E40A 5ENLA 1BEUA 3U5YA 1GTHA 4GRSA 1UJPA 1E9IA 3WBEA 2Z25A 3GUWA 4O0QA 4P5UA 2YCIX 4U10A 1OC6A 2E6DA 4IPLA 5AYBA 5M3WA 3PZVA 1U5JA 3MJMA 4GQGA 5AN7A 1QT1A 3PWIA 3W6LA 1YE4A 1TPC1 4WLCA 4GQQA 4UMCA 2NX3A 2RJGA 4C6JA 3EWZA 4OOUA 1EJTC 1SW0A 1X7FA 3H22A 4OECA 1Z41A 1X38A 1DQWA 2XFWA 2ATMA 4WXZA 2NQJA 4MLJA 4L80A 2X16A 4ES4A 2OWWA 1AFSA 1P43A 3QRHA 3TTEA 3NWRA 4NJGA 3VDGA 1FCVA 3H2NA 2NQHA 3PAJA 2G5WA 2VENA 2ZDRA 1AJZA 3Q67A 2W3ZA 3G1XA 4O12A 3S8HA 2OJPA 1AZ2A 4QR6A 4OUIA 1TCDA 4YIWA 2P0OA 4PBFA 1OM0A 3WLLA 2NT0A 4XAFA 1W54A 2VR2A 3SCOA 1HL8A 1NARA 2V5BA 4E2DA 4FLQA 3W82A 2DIEA 2EPNA 4AHQA 1XIBA 3ABSA 2YKKA 2ZZ2A 3L21A 3MDWA 3PHAA 3N12A 3OYZA 3C3UA 3EA2A 2VO5A 1V51A 1WDDA 2QQ6A 3SCWA 1T8XA 3MA8A 4O54A 3MSGA 4BF9A 1J0IA 1EX1A 1HJWA 3W74A 1KM1A 1UW9A 1IWPA 1PHQA 2QS8A 3HQPA 4KS0A 4IG2A 1OK6A 4LAKA 1TMHA 1OK4A 4L9XA 3EXRA 3TOPA 3VZYA 3WZ0E 3RX4A 4EIVA 3KCLA 3WO8A 1BKSA 1EB3A 4JL2A 1JPHA 3GH4A 2O9OA 2J78A 1VZWA 1CXFA 5DN1A 4AU0A 3DFHA 2YLLA 3MQTA 2QT3A 2G37A 2VVNA 3WMSA 2ODOA 1VHCA 2V38A 4JR5A 3WLQA 4HZ7A 5FL0A 1MQPA 5GPRA 3LNMA 2GJNA 3VX1A 3VKKA 1GZGA 3T6CA 4A8LA 4NHVA 1KKRA 4M5PA 3L4TA 3N6QA 2O56A 1H50A 1A53A 4KRTA 3XISA 3GDMA 1W17A 4FXRA 3FJNA 3PB0A 3HM7A 1J4EA 3MMTA 3MHUA 1XYAA 1W32A 4UOZA 4A8NA 4ZTYA 1D9EA 1KO0A 3DG7A 3WLRA 3ZZ1A 2DSUA 4ZQRA 2VDIA 3L5AA 2VT0A 1J5TA 4B3KA 4UQAA 5LNUA 3W1LA 1WZLA 1VJZA 3FAWA 3PJXA 1VCFA 2ZUWA 4AIBA 1QWGA 3BZGA 3EX6A 4R33A 1DWAM 1XH2A 1VCVA 1M04A 4UQBA 1H63A 1AW1A 1KXHA 3L4ZA 2WC3A 2WMKA 1E9YB 3ZSSA 4JTIA 5CZSA 5CCZA 3R2GA 3D3FA 4O13A 3C86A 3UPMA 3I68A 1FXQA 1XFBA 2F61A 3I4KA 1ZU8A 3WFAA 5EFFA 2EJ1A 1CXEA 3L0GA 3TTOA 4JN7A 1B3OA 1ZP3A 5EA9A 1E6PA 2WJFA 4O1EA 1TQXA 4A2RA 4B3LA 3SIZA 1DXFA 4QG6A 4L56A 1AJ2A 2IQDA 2BS9A 3HQ1A 1M1BA 2C71A 3IIPA 5I3HA 2ZRZA 1K7XA 1ZFJA 3CV1A 3NZ1A 1EWEA 1JL8A 1PCWA 4AEOA 2OO6A 5A69A 1JCXA 3H2AA 4Q8UA 5EBAA 3M0ZA 4ALDA 2VOTA 1IXPA 1OFRA 1Y5VA 3TZFA 1XC4A 1V3IA 1R3VA 1I2OA 2WVVB 1PTGA 4A2SA 1FTXA 1FWDC 3AIBA 1BGAA 2UY3A 4MKVA 3MBDA 5HA7A 4GCXA 2P5NA 3ARTA 2QJHA 2W62A 4LUSB 3PNZA 3TMLA 1B5TA 1PWLA 2JEQA 1HIZA 4AWSA 1EF3A 5REQB 4GI6A 3QQ1A 1EDQA 1HW6A 4W4QA 1EJ7L 1PX4A 3FA3A 3OGRA 1QJWA 3KS5A 3VD3A 3IV3A 4GA8A 3T7VA 5A6BA 3PZGA 2Y7FA 2HE8A 2NQ9A 2VC7A 2I56A 4K68A 1GOXA 3BAXA 2CZDA 3E6EA 3TTSA 1YDOA 2BXZA 5AYXA 3KBJA 4NZ5A 4PCPA 3DX5A 5D2VA 1H4PA 4ML4A 4HN8A 3STGA 2JFEX 1QVBA 1F07A 3PSVA 1TFVA 2VWTA 4INFA 3SRFA 4WUIA 4Q32A 3T2PA 4JIIX 4W86A 1QI0A 2D22A 1V3JA 4AEFA 1CX9A 2F38A 4BI6A 3CQJA 2Y70A 1TCMA 2HJPA 4BKNA 2A0NA 1UP3A 4C6DA 1PV8A 2EPHA 4DYJA 4FLRA 1DJWA 1MVYA 3U2OA 1EJXC 4I7UA 1LL7A 3GXMA 2BODX 4AD5A 3EB3A 2MUCA 4FO4A 3BG5A 2A6NA 1SQ7A 4FXJA 1JGIA 4JKLA 1F3WA 1EHAA 2VRJA 3CWOX 1Q6RA 1IEQA 3W2NA 4E4UA 3HV9A 4CQAA 2YOCA 3E0VA 4KFOA 3QYSA 3G22A 2FMOA 4C7GA 4Q4PA 4R7WA 5HNUA 4JN6A 2QCDA 5JH2A 3N6JA 3NCOA 4DUVA 1LOQA 2C1IA 1IXQA 2Z2AA 3V35A 1RY0A 3T08A 4GZEA 2FH8A 3Q58A 4QSHA 4YLWA 1GOWA 1XD1A 3AJ7A 2OR2A 2VUYA 1XINA 4H8UA 3SCUA 3MP5A 3WENA 4LS2A 1MO0A 3I3EA 3LLXA 2CLKA 4YTQA 3A23A 2EO7A 1Z6KA 3W7EA 3FJ4A 3W1NA 3VI2A 4IP7A 1E70M 3BG3A 3C8NA 3CTLA 3WQWA 3B0YA 1RP9A 2GUUA 3C3NA 3KDOA 1RPKA 4K8HA 1QI2A 1KLYA 4R88A 4HHLA 4JX5A 3CQKA 3SI9A 2DH3A 2WSKA 1V02E 2VEPA 1XIFA 4IP5A 3IJ6A 1U83A 1M7OA 2NUXA 3WJYA 4A3HA 2X42A 1PWMA 5DMMA 2Z1BA 4LOCA 2W61A 3AMCA 3OOQA 5TBOA 1J0YA 4GNKB 1KTCA 3MBFA 4W93A 4C6LA 3WH5A 2YL5A 1O5QA 1SMAA 1W1VA 2EHHA 3UGVA 1NWRA 1E6XM 3WK1A 4S3DA 2Y5EA 1JPIA 3PULA 1XYCA 3CM4A 5JUVA 4U31A 3FAXA 4IZGA 4JNYA 3EPNA 3L0NA 1QI3A 5E9AA 1XBZA 1AQMA 1GVOA 3BAIA 3AISA 1C90A 1VJSA 4Q33A 3CHCA 3ECQA 4BF7A 1W5NA 1YDNA 5LXXA 3O6DA 2ZX6A 1UWTA 3MHGA 4GK8A 1GJWA 1D7FA 5ABHA 4QAIA 4XUGA 3UZZA 1S2VA 3SURA 4KH2A 4YXGA 2H8ZA 3M44A 5I03A 3NQBA 2WVUA 3M0YA 5JU6A 3LB0A 5I77A 5LZLA 3IVUA 3ZSTA 4MAVA 1JZ3A 1KQYA 4ICCX 3MJYA 4HOZA 1PZ1A 3CHFA 4JTTA 2HDJA 4LAMA 3O0KA 3CHVA 1VLIA 4YS1A 4D72A 2GGHA 1Z3NA 2VXNA 1Q4NX 1MRAA 4XK2A 3IJQA 2NXIA 3AWNA 1AQ0A 3UEQA 2YA2A 1PDYA 3RFAA 2EF9A 5F4WA 3UWUA 1B9ZA 3VNYA 5LIWX 4DJFD 3HF3A 3ARZA 4PR4A 3KBWA 1FX6A 4UOJA 4IFRA 3WQ6A 1OB0A 3EOOA 5CG7A 4C65A 5ABGA 3CAWA 1WUFA 3LY0A 1Y0EA 1RBAA 1V6XA 2GYIA 4WF7A 4MWAE 1M53A 1KBIA 4YTSA 4Q7IA 4QS5A 3UWQA 4PODA 2ZZ4A 3AS2A 3R4IA 3STEA 4HN4A 4BF5A 1TG7A 4AW7A 1ITQA 2NT1A 4YVXA 1HJVA 3CPUA 1MFVA 1FBAA 4UUIA 1VBGA 4PRRA 4YWIA 4Z1BA 4GUFA 4IPIA 4M19A 3QBUA 1TE6A 3UA4A 3MV01 3W7RA 1VEOA 4B5UA 2E7FA 4OHQA 3W2LA 3HBLA 3R79A 4ERIA 5FIPA 1RJQA 1MDLA 1T8QA 2RJHA 1XH1A 2FTYA 3GTXA 4FXFA 5A94A 1UH2A 1IXOA 3RO8A 1A5KC 5E93A 3ARRA 1BXCA 1KGXA 1LF1A 4MB4A 4QNEA 2ZKMX 5CPLA 4DJEA 1TJ2A 2PRLA 3IRSA 1DHPA 1UD8A 1XC6A 3IVTA 2FHFA 4BHYA 4PBEA 3MYPA 3WQDA 1ADDA 4GLEA 1S1RA 1TJPA 2DQXA 2FFIA 4PMVA 3KZSA 1V6WA 1J8VA 1NDYA 3U8GA 4AF0B 2GVJA 2GZXA 2Z1SA 3M5ZA 3B9AA 5AHLA 3F5JA 3UXDA 3LQGA 5FOOA 4XZ9A 2PDBA 4B90A 2BVYA 3D47A 4E3TA 5BXTA 5DBTA 4C60A 4IISA 2PGRA 3F5LA 4UTHA 2R94A 1A5CA 4GQRA 2A7PA 4FS9A 1GVEA 4JFSA 4H7ZA 4M24A 4H1ZA 2A6LA 1TZ7A 2D3LA 4LS1A 2VD9A 2Z1VA 4B91A 4PUWA 1VD6A 2WKLA 4Y7EA 1BFNA 3XIMA 2P88A 3TQPA 2Y24A 5AYZA 4GUGA 1KBJA 3CV2A 2V3GA 3WEZA 3WF0A 2RGLA 4NAFB 3T2QA 4AAJA 2BVWA 1SFJA 1WZMA 3GXFA 4B92A 1HF6A 2DQWA 3G1FA 5M17A 1AZ1A 2X2YA 5BOFA 3KVJA 2F6XA 1E56A 4DWSC 3GIPA 2ZDSA 3MZ2A 5EMJA 1TPH1 1IT7A 3HMJG 3UR2A 4J3ZA 2BOEX 2V2DA 1O7AA 3LX9A 4RE3A 2E8ZA 4IQLA 3DN5A 3SADA 3NG3A 3R25A 2EPOA 3WK3A 4FZIA 1A0EA 1O66A 2XH0A 4QCEA 1TV3A 4HZMA 4UXDA 2V8ZA 5AHFA 3GNOA 2V5CA 5DELA 1I9CB 3RILA 3W6YA 1ZBKA 4DO6A 3FXGA 2PDNA 5DLCA 1SGJA 4GFSA 5I23A 1HXJA 2IS7A 3FYOA 4Y9MA 3AUOA 1F6YA 2RAGA 3OO2A 3HFYA 2WOQA 1V6UA 2PMQA 4V27A 2ZWZA 3B8WA 1BG9A 5E6ZA 2C15A 4K39A 2XVGA 4C6EA 1KFWA 1U5HA 3MI2A 3UJFA 3FYPA 3N3TA 1S2CA 4JICA 2BHYA 4AD1A 5K9CA 4C90A 4OBRA 4WDXA 1BWLA 3KRSA 4XTIA 3M0HA 1FDJA 4JYEA 3GSMA 3O07A 1W3IA 1XKYA 3QSTA 2WWCA 4LU0A 3MCMA 4NXKA 3UYCA 1DYSA 1GOKA 1I4NA 1A5AA 1XUZA 1GVYA 3FGCA 2XFYA 4PTXA 1GQKA 1N8FA 3S9YA 3H26A 3BQ6A 2WZIA 4ORMA 1JDCA 3O16A 4B5VA 3BLIA 1DJXA 5CZKA 4Q4MA 3C0QA 3QV8A 3TSBA 4KEMA 1RK6A 5BXRA 4P7NA 4CD4A 4AZIA 4HNLA 2X1RA 2WQDA 3G3DA 3TU9A 1QNSA 4Z0JA 1BF2A 3AHVA 3W22A 3W7IA 3EWDA 4MJZA 1RJRA 4O11A 4FAMA 3BOFA 4HPNA 1F61A 4IIDA 1OSEA 3RPMA 5A1AA 1LCOA 4N6FA 4GX8A 1SJBA 1T96A 5FF2A 3W00A 4TU1A 4X0NA 2PTZA 1JPKA 4ILSA 4TX8A 5T26A 1EEPA 4YTUA 4I6VA 4MTVA 1EQPA 1VQTA 3G1VA 5CLTA 4MG4A 1OIMA 1K8CA 1XLAA 3SCVA 1REQB 5AC7A 1BYBA 4K6AA 4XVDA 4GO9A 1SSGA 2WCAA 3UY8A 2J4GA 3ITOA 2CLOA 3VYLA 4AZGA 1DIOA 4ZFCA 4U4MA 3LCXA 3BCJA 1FDZA 1YNPA 4HNCA 4PTMA 1ADSA 1D3CA 1WAWA 3N4AA 1RK5A 4MIMA 2ZQ0A 2DV0A 4E8CA 5GVJA 3RX2A 2PLJA 2C13A 4HPHA 5HNRA 3PUOA 3WH7A 1MUCA 1V6YA 2BY3A 1D3GA 2CLPA 5IDZA 1SUXA 5LXEA 1ML1A 3SUWA 4A4AA 4DWDA 4D6CA 3KOXA 1A0CA 3BK0A 3C2RA 4HMDA 1SMDA 3BLPX 3URBA 4HK7A 3BLFA 4MY1A 3SRDA 4LC8A 1WKDA 4JEQA 4F0RA 3BWWA 3UP8A 3VDHA 2RGMA 3I7QA 4U2YA 3P8JA 1GOMA 4HHHA 2QCMA 3OODA 3RAOA 3DFQA 3AIVA 3UG8A 5FSEC 1LUCA 4O57A 1HQTA 3OVPA 3WQ5A 1VBUA 5D4YA 2I5GA 1WZAA 1VIZA 4FK9A 4N9EA 3QPZA 3UF9A 1XCFA 1FA2A 1XYBA 3EX2A 3HG3A 1UOKA 2G8ZA 2YLAA 4LV4A 4DPPA 5K4ZA 1V5XA 4RX0A 2A3AA 1RJPA 3VOGA 4C6PA 3NIYA 3SSZA 4CNOA 4C7FA 2YDRA 4LUYA 5D9PA 1CGXA 5BXPA 1FWHC 1OQFA 2CCRA 4ONVA 4ZO8A 4B9YA 3TJXA 1JIBA 1H5VA 1S38A 1BQCA 2ZXAA 4EACA 2NXHA 2ZUNA 5HK4A 1PAMA 4HHMA 4ADUA 4ZB0A 1PVNA 1TPDA 4HNOA 4P8XA 1JUEA 1LORA 5G1YA 4AZHA 5FF0A 1CXHA 2Q6ZA 1QUMA 2OOGA 2JK2A 1WDQA 4UR9A 4DJDA 2VDGA 1EA0A 3UXAA 1KM5A 3P5ZA 2BY2A 2Y2WA 5F4XA 3GR7A 1OFOA 3V75A 4UTTA 4ATLA 3CPGA 5I78A 4RNHA 4LQ1A 1M68A 5G5IA 4F4RA 5EGRA 4C6BA 4S2CA 4ACYA 4FR1A 2F7FA 1T0OA 2QV5A 5AHNA 3ZVHA 2CKRA 3FDKA 1LOLA 1GWJA 5DBUA 2NW0A 2PTYA 1H7NA 2A3EA 2VVSA 3LTPA 1FUYA 5DT5A 3TX9A 3VNMA 3WLTA 4C6KA 2YDSA 3EWWA 3PZNA 3R6IA 3SZ8A 3TQKA 1UZDA 3N18A 3EB2A 3AALA 3QMRA 5D9NA 4K1WA 1YPIA 5F2IA 1DE6A 3NQVA 5FEXA 3W1UA 4Z1YA 3MKVA 3GHTA 4Q22A 3DFNA 3NR0A 5GJNA 3V4BA 4GE8A 4HK5A 4ROQA 3VIMA 1WE5A 4XKYB 4D8AA 3QPYA 3DG6A 4MFEA 5C54A 1OYBA 1UD4A 1W1IE 3LXCA 1WA3A 4LUTA 1I0DA 5CSUA 5IBXA 1JYNA 3S1WA 3IJLA 3S5SA 3UERA 1CPUA 3MO4A 7ODCA 5JH1A 3QJAA 1UQZA 3AS0A 3PZOA 1OYAA 4GJJA 1QI5A 2ZRYA 4HA1A 4NJJA 5HMFA 4E2BA 2DZTA 4OIFA 1PTAA 4KQNA 1AQHA 4Q8VA 3BAKA 4OBTA 2GOKA 2G4JA 3JW7A 3TA9A 2QHAA 3D5HA 5DCBA 2QUTA 3CASA 4XZMX 4CD8A 4UFLA 4Z1DA 4LS0A 4K2SA 1W3KA 4C1KA 4AZ5A 3WLIA 4GI8A 1VEPA 5AECA 3W7GA 3C2OA 4LF1A 3ZLGA 3P3BA 3VD9A 1BGGA 1KM0A 2VR4A 3UZXA 3CHDA 1W5QA 4EWJA 3BLEA 3VIGA 4ACZB 1XGDA 4HMNA 3BG9A 1UZHA 3ZJ8A 2AAAA 1OFPA 2YA1A 1LQ2A 3DC8A 5CPSA 3WJZA 2OSWA 4JTHA 4G7EB 1AD4A 2PCQA 4CN1A 1SVDA 4HSOA 2X05A 3TQ0A 8CGTA 5DXYA 4MM1A 4AEEA 1GYMA 2DVXA 3F2CA 4UFKA 4RKAA 1OCNA 3URNA 2MNRA 1H7PA 1MW3A 1ISYA 3LRKA 4PMRA 2E0PA 1XYZA 3P0XA 4WKAA 5EMKA 1DWHM 1B4EA 3MU7A 3O05A 1PIFA 5PTDA 2POZA 3UPBA 2AOSA 5E9XA 2J9XA 4YN5A 4C1NA 3H2OA 2D3NA 4WHBA 2OZ8A 3QOMA 3M16A 2KX9A 2O7SA 3K8LA 5K3VA 4D6HA 4DF0A 3S5OA 1TTPA 3WJSA 3WUBA 5I24A 7ENLA 2J7FA 2WLZA 3GB6A 2WMFA 1OADA 3B05A 4AD3A 2C16A 2QCEA 3F5KA 3CEUA 4UTJA 1R9ZA 4HOXA 2X1TA 3B8UA 4B5WA 1UR3M 2DJLA 2HRWA 2CHOA 3QY8A 1EDGA 1TJRA 3WH6A 1T41A 4L7ZA 2FVLA 5FJTA 3SN0A 4X22A 3KCOA 1JCYA 2E1DA 2Z1WA 4YPJA 5F1UA 1W2PA 2OEJA 1JCJA 1E73M 4QG9A 4H9YA 3CWNA 4YHGA 4XV0A 1XPYA 3OPSA 3GG7A 4PUDA 4O1FA 3TYAA 4YL2A 3O15A 4O1CA 4KERA 1FRBA 4IWWA 3KVMA 5HR6A 1DVJA 3IJDA 2YCKX 4HTBA 3GFXA 2I14A 3OIXA 1R9YA 3KWSA 1RVKA 1FHLA 3LHYA 2YPIA 1VRDA 1F4HA 3FYYA 4JTCA 2ZXDA 1DJHA 1EJUC 1L2UA 2FB2A 3WNLA 1ONEA 3N14A 3NFUA 5T8GA 4MWAB 4I5UA 3H2EA 5HWMA 4A22A 2EQDA 1JRCA 1TO3A 3R0UA 2PWEA 4MZYA 1HKWA 5DO8A 1WXYA 4RNJA 1F2JA 2PWUA 3P74A 1JUKA 3S9ZA 3W1RA 2Y61A 2PDMA 1BYCA 1AUSL 5I02A 2HXUA 1NOUA 4YU1A 1FWJC 1TUFA 4KEVA 1GCYA 4AC1X 4E38A 2DEPA 1I45A 4ASTA 3JRKA 2YL9A 3Q4DA 1FY6A 2G0WA 3U7BA 5CPOA 2OLSA 4U5IA 2WVSA 3GW3A 3WQCA 1LQAA 1GHRA 3BSGA 4H6QA 1NF7A 2VZOA 4ZCWA 1K03A 4BA0A 1FWEC 1CXKA 5HBFA 1W9XA 1I2QA 5H1WA 5GJPA 4O50A 3DYOA 1KV8A 1LJYA 2QDHA 2TODA 4TMBA 3TROA 1L8PA 1P0BA 3SQMA 3ZYZA 3TW6A 5CC7A 1BWVA 1XSIA 4DM1A 1DJYA 3P84A 3EA3A 3TLLA 1ZLPA 1VFMA 4A35A 3BZJA 4MADA 5HXMA 3BLDA 1FH9A 4FX8A 4LUJA 4MNJA 4HB7A 1XRSA 4RR4A 3S3GA 4XIMA 4GIEA 1YYAA 5H2ZA 3HFTA 4D6EA 3KZPA 3IJ7A 3UWZA 1XBVA 1GYNA 3WDJA 2PP1A 4DIAA 2D0HA 3MV11 5HDRA 2W66A 1FWTA 4AYGA 5FKYA 4IMFA 2WMIA 5DMYA 3DYMA 4IIFA 3QHNA 4Q8NA 4B5SA 3IJ9A 4PB3A 1LBFA 2WHLA 5CH9A 2GVEA 4HHPA 2YCLB 3KTSA 4QE5A 4AXNA 4CQ8A 1Q6FA 1LDCA 3N73A 1A5LC 2DSKA 2PCEA 2VEIA 2E5BA 3ARXA 4J3SA 3VIOA 4PGLA 1VFTA 1E1CA 2F9RA 3SUUA 2XUCA 1XI3A 2PDXA 3CGTA 2SFPA 1QK0A 4CNUA 5LIUX 4IPJA 3R94A 3AC0A 2EKGA 1VFUA 3DGRA 1TV5A 3NSXA 2ZZ5A 1L2QA 1XCWA 2FYMA 4H6RA 1H62A 4G8TA 3I6RA 3KTCA 4WKFA 4J27A 1KC7A 5A2CA 2ZOXA 1Q65A 1XX1A 2E6YA 3UG5A 5CKSA 2VDHA 3T42A 1WXJA 1ONWA 1K02A 1XSJA 3VOCA 1F3EA 3TTYA 4XWUA 2Y62A 2C79A 3TW9A 5BRPA 4DNMA 4CLMA 3SECA 3HV8A 3PR2A 4LYPA 1P1XA 5E6YA 4Q4KA 4LCRA 4HA3A 2BVTA 5ABFA 4FNSA 1M7JA 1DWJM 3O8AA 1KCLA 1C29A 1W8GA 4S3EA 4ATWA 3FY1A 1BRLA 1KFLA 2W92A 2D2JA 3N2CA 1CB2A 2HMCA 2ON3A 3GG0A 4ZOEA 1ISXA 3CAVA 3W1QA 3BJFA 1L6GA 3EWBX 2ZXQA 1UIPA 1MUWA 3GWQA 2BX7A 4HPXA 5AHMA 4AISA 3WY1A 1LBLA 1F6PA 3LQLA 3PY2A 2PDYA 2UY5A 4ZQNA 3BAYA 1DPMA 3UWYA 5KITA 3NTYA 1FCBA 4RZ4A 4IOTA 2PGWA 1KTBA 2A3HA 3TSDA 1L9WA 3ANVA 4XSMA 1XLJA 1P7TA 5F2MA 3GHRA 4WX2A 3UR7A 4QJ3B 1Q3NA 4ADSA 4FNPA 4NL1A 2XIMA 1LLZA 2WMJA 2J77A 5BYWA 3OJGA 2E6FA 2WNQA 1HKIA 4H00A 2VMFA 1R87A 4JIPA 1QATA 2J88A 2UV8G 1YEYA 3A4WA 2F6UA 4AB4A 4HCDA 3RIKA 3CUFA 1Q85A 4F9JA 2DZBA 5C6MA 3PZQA 3IWPA 5EBUA 1TTJA 4DF1A 4Y9PA 2KZHA 4O1DA 1P6BA 3EKGA 2YCEA 4R53A 3UZ5A 1JCMP 3WUFA 1W37A 5G1TA 1E6SM 1OCJA 3BPWA 1GEQA 1ZZMA 1EYEA 2J47A 4AD0A 3R58A 3TJ4A 1B0IA 1YMYA 3ZMRA 3F4NA 1DL3A 3T78A 4PUMA 4ZOCA 3GM8A 2NSOA 2C8NA 5H8PA 3WF1A 4IQEA 1NP2A 4KEUA 3KOWA 2WAGA 5ECVA 3T07A 3LHWA 2XN1A 3ID7A 2PDLA 5D03A 1G67A 1V93A 3DFSA 1GQJA 4HKPA 1Q13A 3TNBA 6ALDA 1XISA 2H6RA 2DZWA 3NUKA 2I9UA 2OMAA 3CEPA 4UR8A 1UWRA 1LL6A 1OG0A 2NV1A 2FFCA 3T9PA 5BW6A 4M82A 1XIJA 3SCRA 4ZQPA 5CGTA 3NPXA 3WYZA 6XIAA 4H19A 2W0UA 4Q8MA 4K38A 3NVDA 4ZGYA 1F8MA 4H41A 2WQPA 1XLIA 1J93A 4Q8PA 4JIHA 4IL0A 3GBEA 3LLFA 2WW5A 2NX9A 3GDTA 1XDJA 1RCQA 3U48A 1H61A 1R86A 2VCCA 2G96A 3B40A 3HGJA 3BLKA 4IJRA 7REQB 4AH7A 2WSPA 3GDRA 2GJRA 4KCVA 2CZVA 4BQ2A 1J2BA 3TE9A 4HU3A 4PTDA 1F3XA 5HQEA 4EPKA 4EXBA 1ZALA 3TAOA 3EXTA 2PWFA 2D2HA 3G1SA 4N0RA 4OBSA 1PL9A 3EEGA 3WL1A 1FWAC 1C7TA 4M6UA 3Q2DA 1D8CA 6XIMA 1EOKA 3QZEA 3OQEA 4A21A 2X40A 5EPDA 4YTRA 4LCSA 1K77A 1I0BA 4W7VA 7A3HA 1KCKA 4IPPA 3LTSA 3AAMA 3BICA 1UWUA 3M6DA 1EH9A 3NNTA 2Q01A 3K1GA 3UNTA 1R2RA 1JR1A 3IJ8A 2ZE3A 3S1VA 3E0FA 2AL2A 1ECQA 1NU5A 4DWSB 2YDAA 4O1BA 2ZC8A 3DXIA 2XPKA 1UJQA 2Z24A 3NA8A 4ZE4A 1UR0A 3ZJKA 3A3XA 4PUUA 3P61A 1AW5A 3KUMA 3VIIA 4HYVA 1M9HA 4H7VA 3N34A 4DJFA 3KXQA 4NF7A 5I06A 1CGWA 1KFKA 1TPB1 4A05A 3B0VC 1XYFA 3CPRA 1LROA 3OG3A 4FLOA 3FSTA 4B2DD 3H24A 1TKKA 5E70A 4G5DA 4HA0A 4D8ZA 2CBVA 3FXYA 4GGBA 4JEJA 2PA6A 1W5OA 1EGMA 3FDGA 1UCWA 5FEZA 2X0HA 2PGFA 1OVDA 1NM9A 4JTQA 4MY9A 3VCNA 2WLYA 4UCFA 3CC1A 3A3WA 2CWXA 3NL3A 3UW6A 2IQTA 1FWIC 5BWFA 3KLKA 2XWDA 2FJUB 1OGGA 1U5VA 3I10A 2WJEA 4Y9OA 3UG4A 1HT6A 3GTNA 1HKMA 3OYXA 4LRSA 2RDTA 4BK9A 2DZUA 2PDIA 2E25A 5FJOA 4AZCA 3GXDA 4BI7A 3NQAA 3IK2A 1OC5A 1R3WA 1NY1A 5C2GA 4GY1A 1OX6A 4J4KA 1SZGA 1B31A 2A1YA 3ZLFA 1LOSA 2IQ0A 4LWWA 1QO5A 2Z6JA 4XAPA 2LLEA 3K46A 1EC8A 4NI3A 1QASA 4AZ7A 1X1ZA 3R13A 4LV9A 3MP3A 1QCWA 3PFRA 1XIIA 1OHLA 1Q7ZA 4Z2LA 3W81A 2H9AA 4FXSA 3E9AA 2VEMA 1J6OA 3IGUA 3IUIA 3T4CA 4H2HA 2ZCGA 5T91A 3GBDA 3L4UA 4HCLA 3IANA 2Z2BA 2Q3OA 3HTWA 3GU2A 4M56A 2WKGA 3ZT7A 4XZLX 1S5MA 4JTEA 1BVZA 4REQA 2Z1KA 2X1IA 4P7OA 4TO8A 4NZ1A 1VB9A 4MNMA 2J7BA 4PYSA 4JX4A 3I3BA 1TWWA 3S2LA 4X9YA 1GVRA 3WJXA 3BDKA 4TR9A 1WX0A 3DI0A 3GVVA 3MANA 2QCCA 4QDWA 2GGJA 2J24A 2D2GA 2V9DA 1EZ2A 1UHVA 2INEA 2FZNA 2GK1B 4DUWA 1TUXA 5CZTA 2WJDA 2QGHA 3RG6A 3LPPA 3KTXA 3W07A 3WD0A 1WYIA 3RO6A 2QGYA 2XU2A 3HG5A 3VX0A 4PCTA 4YYFA 4XAYA 4O19A 2FVKA 2Y8KA 4CN6A 3RMJA 2GVYA 2V5KA 3LZ3A 1AD1A 4D9PA 4B3ZA 2BG5A 2PTXA 1X6LA 5C9ZA 4W85A 3VKDA 4JBRA 4KMQA 3HPAA 4DJED 5CAKA 1OABA 1M41A 2YZ5A 2X41A 3EEZA 1ECEA 4HPJA 1L6WA 4NNBA 7TIMA 1EKOA 3WMCA 4PMDA 4C6FA 2PZ0A 3MUIA 5CBJA 4F2TA 4L9ZA 1T7LA 1F8IA 4I90A 2GL5A 3HMCA 4QROA 2OX4A 3RUBL 4W5ZA 4ZO9A 4GXMA 4IL2A 3WDPP 3CMFA 3H2FA 2HBXA 4FIQA 2ZZ6A 3WLHA 2WBGA 2WZTA 4JFWA 4FOJA 5D2XA 2PEVA 4DF2A 4W87A 3ZVIA 1RA5A 3OW1A 4GINA 2WBKA 1R0MA 1Q6EA 1KCZA 1IEVA 2ZA3A 2ZTKA 3EMZA 5AOUA 4G1KA 4HYWA 2WSYA 3EWUA 1TPVA 1P0EA 1H49A 4NX5A 1GK8A 3NO3A 5FF4A 4PULA 3WBAA 3S47A 1PIGA 2QDDA 1G6CA 3CU2A 2DGAA 1QK2A 3HQOA 4Y2WA 1G94A 3OA3A 3UD6A 2B4GA 2GJXA 1IR2A 4AUBA 3DG3A 2E4TA 4O4VA 4P61A 4XSLA 1ISZA 2X30A 2DIJA 1NWSA 1FWRA 2D1ZA 2ZUVA 1F5ZA 1NF0A 4F2UA 1UC5A 5IFPA 3T05A 3WQEA 3C4UA 4TVCA 1B3WA 1JZ5A 2VQUA 1LRQA 3I7SA 3R11A 1S3TC 5D8ZA 3K4AA 2FH6A 1D7KA 4MY8A 2VX5A 3EOUA 3PJUA 2NWSA 1IWBA 1KKOA 1K70A 1NFBA 2WJZA 3NQCA 3WQ4A 3B97A 1V0MA 1TA3A 1Q45A 1YIXA 4HZ6A 3DDMA 2D24A 1O5XA 2XGBA 3WNPA 3BSMA 4JTSA 2R24A 1PKYA 2OGYA 1XL9A 3KWXA 3O1NA 4K1GA 2P50A 1XG4A 1DJZA 1OCBA 5HULA 1O4UA 2QCHA 4UTTC 1V77A 4JZ5A 4ZSUA 4L4LA 1A5UA 3M43A 3QC3A 2D0FA 3REQA 1BD0A 2PF8A 5KEZA 3CLMA 3D6NA 2QAFA 2RHGA 1F3TA 3TMQA 1I2RA 2W27A 1CGUA 2A2IA 3APYA 1UD6A 4WJXA 4EP8C 1VENA 4NY2A 1YHTA 3SBFA 3NO1A 1XIDA