4I90A

Structure of the n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus bound to choline
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
302
structure length
302
Chain Sequence
b'DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
total genus 121
structure length 302
sequence length 302
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i90A00
1T8QA 4GNKB 5T9CE 1AODA 3EA1A 6PTDA 7PTDA 1DJXA 4QJ3B 1V8EA 4F2TA 3NO3A 3KS5A 1DJWA 2P76A 3L12A 2ISDA 1O1ZA 4RW5A 2OOGA 3I10A 2PLCA 4I90A 4RW3A 3MZ2A 4PTDA 3H4WA 1DJYA 1DJZA 4S3GA 1XX1A 2PZ0A 1QATA 1VD6A 4F2BA 2ZKMX 2OR2A 3H4XA 3RLHA 3CH0A 3QR1A 4QJ4B 4OECA 3QVQA 2OTDA 1PTGA 4F2UA 4Q6XA 2FJUB 4I9MA 4RV3A 1YDYA 3QR0A 1QASA 3V18A 4QJ5B 1T6MA 5T91A 3EA2A 3V1HA 5PTDA 3OHMB 2O55A 3KS6A 3V16A 3PTDA 3EA3A 4I9JA 5T9BG 1GYMA 4I9TA 4R7OA 2F9RA 2PTDA 1DJIA 4I8YA 1ZCCA 3RLGA 1PTDA 1DJHA 1DJGA
chains in the Genus database with same CATH superfamily
1QFEA 3W6YA 1EX5A 1IZJA 5K9XA 4ZO8A 4UB9A 1E4NA 2WKGA 3UWVA 2TRSA 3UA3A 3VDAA 5BCAA 4H9MA 4MJ4A 4S3AA 4XKYA 4RW5A 3VOHA 5J04A 1QI4A 2J8GA 1AUSL 3UY8A 1U5HA 2ZA3A 1JDEA 1HKMA 2YCLB 1J9YA 3P67A 3HG5A 4IX0A 4HMCA 1E6SM 2HE8A 1KRBC 4UR8A 3VFCA 1F9CA 2L5HA 3GW0A 2V5JA 4UTJA 4MJ2A 3UF9A 1C8QA 3DFPA 3JU2A 4H8UA 4QE1A 4C5ZA 4TVCA 2CITA 3W74A 4Q32A 3T4CA 4Q6XA 4KFOA 3ITCA 4PULA 5F2LA 2QT3A 1NFPA 4W8BA 1POKA 4LJ3A 2X16A 1CPUA 3GC5A 4WZHA 5HMDA 4MUZA 2DUZA 5CPSA 3CZGA 3OHMB 1ZJBA 2AMGA 2HS6A 1M04A 4WXYA 3WLLA 1EIBA 1TV4A 3OYZA 3FVMA 4UTTC 3ONCA 4GIAA 5MF5A 2CLKA 5BXTA 1B2YA 3CB8A 4HJWA 3CUIA 3U8GA 3KOZA 2E77A 3NR0A 1EO7A 2ZZ7A 3S4TA 2I5GA 4UTTA 2OT0A 5HULA 1XRVA 4LU0A 3BLIA 1Y8BA 5A95A 3T7VA 3LNPA 3NQAA 1SJAA 4C6FA 3DHPA 4IMFA 1D8CA 2C79A 4UCFA 4MAZA 1OG6A 4DYKA 3U7BA 1JGMA 4M7SA 4PEKA 3BANA 2X2YA 2NXGA 4ZFCA 1J5SA 4O18A 1OK6A 1CGUA 1QNVA 4ZA0A 2Y61A 3MBFA 4XZ9A 3TW7A 1H2JA 2QW5A 2P3EA 4N4PA 1FWSA 1J0IA 3C61A 1CX9A 3MJYA 2W66A 1W5PA 5ABTA 1OFRA 4LVFA 3E1F1 3GDKA 4CNNA 3W75A 5HR7A 4ACZA 3AICA 3HPXA 2XSXA 1UIPA 1BXBA 1JUKA 4XAFA 4DWSD 1L6SA 1KB3A 1GONA 2GZXA 3CZKA 3E2RA 4RPPA 3HM7A 3POCA 3ABSA 5E9AA 4KCTA 1V02E 3QSRA 5FF4A 1PXGA 1JGIA 1BHGA 1S2WA 1ME7A 1PVNA 3IPWA 4QQUA 4DM2A 1DXIA 4CCDA 1B9BA 3R5EA 2GDQA 3A4WA 3F5KA 2VTFA 3AHYA 2YDRA 1I0DA 1JJKA 3LCHA 1QI3A 1TQJA 1WO2A 2GJRA 3UR2A 3EWBX 3R0KA 2OSYA 4OUEA 3UZWA 3WLHA 2OQLA 5DO8A 4NZ5A 1XG4A 4OV4A 4FP1A 2Q02A 1QPRA 2EF9A 4UTKA 4X0VA 1YX1A 1RCOB 1X98A 4YN5A 2YIHA 3UJSA 1Q4WA 5CZSA 1TWSA 1TPEA 1PZ0A 5AC4A 4C1LA 1OWQA 2HK1A 1ZP3A 1JZ4A 3DKLA 4B4FA 3ZVHB 1G6CA 4D2JA 4BFAA 4JS3A 3AAMA 3GUWA 3W70A 5IHSA 1XIEA 3TC7A 4DYEA 1ZALA 4AZ7A 4RZ4A 4PCFA 3AHXA 3HN3A 4H00A 2PBOA 1B0IA 2PDHA 2XN0A 1A53A 3LYEA 1XD1A 3VILA 3G77A 1DXFA 5CEWA 3MCNA 5AHEA 4RKAA 2AL2A 1E1CA 2QUMA 2R24A 4OUIA 3L2IA 4MNJA 4WX2A 4LCRA 1R9YA 1SW7A 2VD8A 3LHYA 4ECLA 4UBPC 1GVQA 1OT2A 2AQOA 5DLCA 1K8ZA 3M9YA 5AECA 3H7UA 2QF8A 3ZLHA 4XWUA 4AD4A 1EP3A 4TU1A 5HOSA 3Q2DA 3UXLA 2GFTA 2PWFA 1JDDA 4US6A 3W81A 1DJHA 2O9OA 3QJAA 1XWYA 3CV7A 1C9DA 3LXAA 4GZIA 2ZTKA 4PTXA 3C8NA 3LCLA 2Y5SA 3UR8A 3T78A 3KP1A 3ABQA 2DFAA 3W2NA 2PDYA 2D0HA 3BW2A 4EF8A 3GXPA 3NQ2A 4DRSA 1VP5A 3K30A 2HZGA 3MUXA 3BJTA 2BHYA 3HGRA 1EX1A 1WBJA 6REQA 2Y8VA 3ES8A 5F1UA 1ZPTA 4AXNA 5FESA 1US2A 1ZB5A 1XYFA 3T81A 5TBOA 1O5QA 3P62A 4F2BA 1CECA 4BA0A 1R2TA 1D3CA 4HYVA 3LPPA 3WBWA 2V63A 5GNZA 3S6TA 1DTUA 5I07A 4X9SA 1Y5XA 1J6OA 2FJKA 3BOFA 1G01A 4ILSA 3AMCA 2FYMA 3U48A 5BYWA 5I3KA 3EMCA 4LYQA 5DT7A 1U1HA 1ZRQA 3MUZ1 2YCEA 3R58A 1UP2A 4IGMA 3NGJA 2EEXA 1EBHA 3PJUA 1SGJA 4NZCA 2A6NA 1BF6A 1TA3A 3IV8A 4NZ1A 4B5UA 1DHPA 3MMWA 4F79A 1OSEA 1R3WA 4Y7EA 1KFKA 3O6CA 2P53A 2P8CA 4LUTB 3LEPA 3APYA 3HG2A 2J9YA 3HPZA 3T2OA 1NAL1 3WLOA 5K4XA 7ENLA 4FNSA 3TTSA 2PF0A 1ODUA 2F2HA 1W3KA 1GQIA 3CO8A 3HQPA 3BC9A 3WENA 3USZA 4J40A 4QLKA 1N82A 1KBKA 1LTDA 3M7WA 1GOOA 4E2BA 2DSUA 3VINA 3GDTA 8CGTA 1ADDA 1KM2A 2W0UA 2QF7A 2X0HA 4QR6A 4XAZA 4B5TA 3TN6A 4FEZA 5IHRA 4DBWA 1E15A 2DY3A 2A4AA 2R8WA 4M6QA 4M6VA 2BP1A 3H54A 2YOCA 1NFBA 2QAPA 3DG3A 3L7RA 3QQ0A 3QV7A 4GI9A 1JCTA 4JIHA 5DCBA 2XN1A 3S2MA 3UJRA 3PAJA 4U5IA 4MB3A 4NNBA 4K7VA 1CI1A 1E6ZA 3WEOA 1HO4A 2HVMA 3GH7A 4GVIA 1RUSA 3VUPA 3GTFA 3R8GA 4WDXA 3PUDA 4UQBA 3CHCA 5T91A 1L8PA 1KGWA 4HZ8A 1TV7A 3VCRA 1FWBC 2BOFX 1HTIA 4W9TA 2J7DA 4CQ9A 3TAKA 4I7VA 1GVSA 5AHFA 2YL9A 1L8NA 3VE7A 3EWXA 3O15A 3UWZA 1XLHA 1H61A 2BLEA 4HNTA 4P7NA 3B9NA 1C7TA 4LX4A 4TVUA 2B4GA 2DVXA 4GNKB 4WEVX 4O14A 4YHEA 3DUGA 3WELA 3GVGA 4AZHA 1MEWA 1DP0A 4PUEA 1GWJA 4KT2A 3G3MA 3F2BA 4FX6M 4IG2A 3SUSA 1JPDX 2WSYA 2ZICA 1O1ZA 3N4AA 2UY3A 4JY9A 4HCDA 3WDPP 2WQDA 1OC5A 1QU4A 3E2QA 4JEJA 4JEQA 4L56A 2JF6A 4JNMA 4PUUA 5DMLA 3AOFA 3AXIA 3B9AA 4IT1A 2QUUA 3M0HA 1Q6RA 1PDZA 1E70M 1DBTA 3UGRA 3RGTA 4WGHA 4AHQA 1MQPA 4M82A 4GCXA 4MOZA 3WMCA 1FCVA 1JRCA 2F38A 5DEZA 4L4LA 1QNRA 4O10A 4L5ZA 1W3JA 3BSMA 4JTDA 4WF7A 2WVVB 5EBUA 4PMYA 1CB7B 3RX2A 2JE8A 2POTA 3AC0A 1A4LA 4A4AA 3QGAC 4WKFA 1E6PA 5KZMA 2NLIA 1PIFA 2PWEA 2ZX5A 4QDPA 1KLZA 1OIFA 2VEKA 3MUY1 5G5IA 4HSHA 5BU6A 3QEZA 3ZS4A 4G7EA 4FR1A 5KMYA 2HNHA 4NAEA 3B97A 2V3FA 4J2PA 1RBOB 1OFAA 1GG1A 1TZ7A 1OYCA 3E6EA 4OU1A 4JGDA 1ZLPA 1JQXA 3LN3A 4C7FA 3QQ1A 3PZTA 1FKWA 3BAYA 3K1DA 4Q8WA 3EYPA 2V2HA 1M5WA 2XVKA 3NQGA 2YCJA 1OX4A 3EPNA 1OFPA 2CYGA 1A5LC 2RAGA 3OJGA 5XIAA 2RKXA 5CC3A 1FP9A 1A5MC 2ZZ3A 4L80A 3SUTA 1FDYA 3WD3A 4F0MA 3KOYA 1X6LA 1ZBWA 3A9BA 2Z00A 3PN8A 4JIIX 3E0FA 4JTCA 1XRTA 3AROA 3NQ6A 4FOUA 5A6MA 4UZUA 3RR4A 1KM5A 1LRQA 3LTSA 1D7KA 4B2DA 3QR3A 5HXMA 2DH2A 2WJZA 1KFEA 1L0PA 3I3DA 1PIGA 1S1PA 3QPZA 5I79A 3PWGA 1F61A 4MB5A 3AS0A 3FKRA 3DYMA 1H4PA 1MNSA 3BDKA 1QW9A 3PTKA 4AU0A 2DIJA 2PGRA 1E40A 2QV5A 5KZDA 4M56A 1NOWA 2DP3A 3FA4A 4CLMA 1J0JA 1H41A 3EA1A 2ZUVA 3SM0A 2VO5A 3BAIA 1JDCA 5D8ZA 4LBRA 1TPUA 1IR1A 2R6OA 4DVOA 2ESCA 3EX1A 2FB2A 2FTWA 1UR4A 5I24A 2PWUA 4L7ZA 1FTXA 1WA3A 7XIMA 4Z2LA 3OLGA 1E1EA 1E71M 2GUBA 1A3WA 3ZR6A 2D1ZA 2NUYA 3NQEA 4LB3A 5DMMA 3SUUA 1Q45A 2IPWA 3ID7A 3UNDA 5HQMA 2R82A 3S6OA 2X1SA 1PHWA 3VZZA 3MUIA 1JYNA 1LQAA 3M5YA 2NZLA 4I3GA 2GPTA 3U0HA 3TROA 5J8LA 3PANA 2GSJA 4DJED 4AYGA 4YVXA 3B40A 5LNSA 5G1MA 1R30A 1TX2A 1WOAA 2RH9A 3EX3A 5G4HC 3UWYA 1W1B1 3IWPA 2WVTA 3OTRA 1KCXA 4FF5A 2FGZA 1WKYA 1EQPA 1XKYA 1EOKA 1V02A 4GWEA 4R7OA 5FCZA 1W3TA 4U3CA 3CB3A 1VYRA 2XZ9A 7TIMA 3TTEA 4GCAA 4DUOA 1JNEA 1XYBA 3GNOA 4RE3A 3RAOA 4B5XA 3PB2A 3NL2A 2GVLA 4S3DA 3CMFA 2Y2WA 1BQGA 1DXEA 1YHTA 1E56A 1A5BA 2MNRA 4O1EA 1UW9A 1Z32X 3KBNA 1E6RA 4H41A 1KV8A 3OIHA 1C91A 2RUSA 5K9CA 2EG8A 3S5YA 5DCEA 3NQBA 1Q66A 4HB7A 4GVFA 3M0VA 2C7FA 3HGSA 1RPXA 3UCQA 5TQLA 2ZXQA 2DIEA 1YYAA 3LI0A 4PUJA 1E6XM 3MA8A 2LLEA 4UFMA 4HHLA 4O54A 1R5YA 1QMLA 3UBPC 4MDPA 1WDSA 1FBAA 1PX8A 3OEXA 3WJWA 3N9RA 4FNRA 2PTYA 1GKQA 5AYZA 3BAKA 3BVJA 3CHEA 1XIDA 1XYCA 3WQVA 1J79A 2VKZG 1XSJA 2HNEA 1UH2A 4R53A 4MJMA 1QWGA 2PDLA 5I7GA 4DLMA 4LY4A 1E0VA 3CUGA 1G1YA 1NTHA 2TPSA 2OKOA 2ANUA 3NGFA 3WQPA 1QHOA 3EB2A 3R8HA 3BCJA 4L4OA 1MUMA 2BBFA 1ICQA 3FA3A 4CN1A 4KWVA 4F0KA 3H70A 3AS1A 3ZLGA 1IEVA 4FHAA 1UD4A 4XD4A 5AVHA 2J4GA 1K4HA 1S3HA 1BYCA 2EG7A 4E2OA 1AZ1A 4M3PA 3O16A 5I23A 1RZMA 3N6QA 1NF7A 2PLMA 3TW6A 1GYLA 2ZUUA 1OFQA 4LXFA 4XAPA 5SWUA 3SCUA 1YBQB 4A3HA 3CIWA 1ZU8A 1PBGA 4A8NA 4H2CA 3S2LA 1HQTA 2PDIA 2VFHA 3BAJA 2YCKX 2J47A 4GMEA 3U4AA 2YA1A 1FWDC 1KR1A 4FNUA 4G5DA 3SY1A 1FA2A 2D0FA 2ZUTA 3UG4A 4AG0A 1V5XA 4CNPA 1HXJA 1MMFA 3EWWA 2J79A 1LUCB 2B81A 3N14A 1SU5A 1CENA 4H3DA 3WMSA 1CGYA 3I6RA 2ISSA 3S2NA 4IP4A 5JBDA 5AOUA 2WWDA 1OCJA 2VM8A 1Z9AA 2Y8KA 4F48A 2ASHA 5FAGA 2YW4A 3S46A 3UJEA 4TX8A 1A49A 1OZMA 1CBGA 1I9CB 2ZUWA 1HJWA 4XSLA 4LS0A 3W7PA 1CEOA 1G4EA 4FA3A 4QNEA 1R3QA 1M68A 1BYAA 1F5ZA 4WY0A 4E2VA 3G1YA 3Q67A 3BUVA 5HATA 4QEEA 1ECQA 2IKGA 4GFSA 1JYVA 4PRRA 3OBKA 1KBJA 5C2GA 1TG7A 3B8SA 3F5LA 3DFOA 4HT3A 1LT8A 2PDFA 3KWSA 2BWGA 2J25A 1LRTA 1RV8A 4CD8A 2PDNA 2GVYA 4F3HA 2VXNA 2W6RA 1KR0A 1PCKA 1VFHA 4CNUA 1U22A 4R7WA 1U5VA 3KRBA 3H2FA 5DY3A 3L4TA 3AXMA 4FB7A 2NV9A 1F3XA 1SZRA 1BVNP 3IUHA 1JRBA 3PBUA 2YYTA 3OGVA 1YMYA 5D2TA 3CH0A 2Q8LA 1RD5A 3RU6A 1AD4A 5AYIA 3RUBL 4NX0A 5C9UA 3EMZA 3KXQA 4L1XA 1PTGA 5M2FX 4XIAA 1UUMA 1JCMP 2G8ZA 4MY9A 3MWAA 4YS1A 1V6XA 3W1LA 4I6VA 2Z27A 2DSWA 4MG4A 4XBSA 2DVUA 3SGGA 4BEUA 2I17A 4PBFA 3K4DA 1VRDA 3RK8A 1YE6A 4FIRA 3ARQA 3AQUA 5T26A 3U2ZA 4C6CA 4DO5A 3TSMA 3MCMA 4YTQA 2WZEA 1N2VA 2VZSA 1WDQA 1QPQA 5LXXA 1Z89A 2EJ1A 5CAHA 4DUVA 4Q8UA 3AXKA 1CXHA 4IMDA 4GGHA 4GINA 5JVLA 2VP8A 2ZC8A 3SQLA 3RPDA 4LH8A 1AD1A 3GBDA 5K4ZA 4HN8A 1OINA 1EGMA 2VGIA 3VNIA 5DQPA 3VPLA 5JBEA 1KTNA 2VVNA 3L21A 1BXCA 1K9DA 1H1NA 5EL1A 3AYVA 3M5ZA 4AW7A 2Y85A 2DV0A 2PPGA 1EJWC 3D5HA 2WK2A 3JR2A 3PBMA 3WQ4A 3B0XA 1C8YA 1RHCA 3C8FA 1CNVA 1ONEA 1FXQA 3TR2A 1M6JA 1I2RA 2J74A 4GG9A 1N55A 2VX6A 3LHVA 4DI8A 3G1AA 1ZJHA 1H7OA 5CSUA 1IXOA 4FXSA 4WY0F 2QAFA 1E4MM 2Z1SA 3GG1A 3K5XA 4P8WA 4C6QA 4H6RA 1WBHA 2Y0FA 1JAEA 3PZIA 3TDFA 1ISWA 3VOJA 1LLZA 1YPIA 1PEZA 1TYGA 2FQIA 1J6PA 2YL5A 3VD7A 2CLEA 1DQUA 1FHLA 1EJUC 5CBBA 2BTMA 4X2RA 2V82A 3MSDA 5IBXC 3VIMA 7PTDA 4AC7C 4AY8A 4YWIA 2E67A 1EJVC 4JXCA 1KFCA 4C90A 1BAGA 5IBXA 3EXTA 3BLPX 2PEVA 5HMSA 2OVLA 2PD9A 3W7EA 1MW3A 2AKMA 4DQWA 2C71A 3BQ5A 5D02A 1QTWA 3CEUA 3SUWA 3CWHA 1KV5A 3BOXA 4HP5A 4C1NA 3EOLA 1GNXA 4Y8EA 1OJXA 4KERA 2ZX9A 3PNUA 1CXIA 2X05A 3GNPA 3WQ6A 2VZTA 1QOQA 1LWIA 3VGFA 4PYSA 2XIQA 3CT2A 4XTIA 4DO4A 2XFYA 1FY6A 1D8WA 4IPJA 3ZVHA 5F7UA 3GDMA 3N17A 2JGYA 3V0TA 3QZAA 1UMYA 3L65A 2NV2A 2VYOA 3AIRA 3HOJA 3QY8A 3MI6A 3W7NA 1YRRA 1KWGA 3UZZA 1PS9A 3C0QA 4JQ1A 4WK9A 2HPIA 4IL2A 2R1PA 2ZRWA 2EPKX 2FMOA 1PSCA 1RR2A 4S3FA 2GQ9A 3SECA 2FMNA 4NQ1A 1DIKA 3HURA 3GVRA 4F0HA 1UZHA 1S2CA 3PWIA 3SRHA 4QG8A 2PDUA 1UH4A 2JKEA 4MJZA 3UA4A 2FDMA 3PNZA 4GQQA 3S1WA 1AZ2A 4YYFA 4S38A 4R33A 3CZ8A 1DJYA 1YTKA 2VDGA 2XYLA 4J2MA 4KGJA 1XLGA 5B80A 3GH4A 2OSXA 4S3KA 2WC4A 3A4XA 4FOKA 3E5BA 4ADUA 1TCDA 3H4XA 1EZWA 1EJ7L 1GQKA 3VNZA 3OGRA 3M5VA 4X61A 3SCRA 3QR1A 3WDHA 3NQCA 4ASTA 2AOSA 2WNQA 1AFSA 3NPXA 4CQBA 4MGGA 1FKXA 4AWSA 1JPIA 1R46A 1E4LA 1TB3A 4I9MA 2R1MA 4XUYA 2QJHA 1YDYA 2BASA 2VVSA 2WCAA 4DELA 3ONBA 2D2OA 4N9CA 4QEHA 5REQB 2OZ8A 5AN7A 4D6HA 3W24A 1OBAA 1ZSXA 2DEPA 1DV7A 3G0XA 2BXYA 3A5VA 1KC7A 4IXXA 3N6HA 3A12A 1MW2A 2G96A 1XC6A 4GJJA 5JUVA 1K77A 5I03A 4P8XA 4UNKA 5CAKA 4AD5A 2XGBA 2VC9A 3V35A 1XRFA 3ITLA 2ISDA 2ZRVA 5M1TA 4LUTA 2DT1A 2QUVA 3TA9A 1ZENA 4MF4A 4W84A 4P7LA 3H21A 3VD4A 2VFEA 3PJTA 1TPB1 3O06A 4H6QA 1JF5A 3FAWA 1OX5A 3UCDA 3OA3A 5K2ZA 4AZ5A 3WQCA 2XH0A 1CW2A 1Z8AA 2ZX6A 1W3LA 2NQLA 3IV3A 3O9NA 1M1BA 3WLQA 3AYSA 3GNXA 1SJCA 3WQGA 3TTOA 2XM1A 2OYKA 3KP0A 1WB0A 4UTLA 4JDBA 3SCNA 4GXMA 3ZT5A 4HNUA 1KO0A 4NJIA 4AXKA 1UHVA 2YZ5A 5EKYA 3ARSA 1NJJA 5J5DA 3H7RA 1EL3A 1DJNA 2V6AA 1GUVA 3MHFA 2CWNA 4E0CA 1FCUA 2ZE3A 2GJXB 5AZ0A 3KCJA 4RX0A 1ZAJA 2J9ZA 1XRSA 4UR9A 2EXOA 2PODA 1U1UA 1AMKA 4MM1A 2CLIA 3P5ZA 1T8QA 4PMDA 1UBPC 5BNKA 4XB3A 2CLHA 4LT9A 3PBVA 4G56A 4BI7A 1TUXA 4RE4A 1EB3A 4O12A 2VGFA 3VX1A 3T0DA 1IV8A 3ES7A 4W5ZA 4Q4QA 1PDYA 4GPNA 3GXFA 3LERA 4RNFA 5A6SA 4XX6A 4YU1A 4HU3A 3BZJA 1QW8A 3G24A 3R89A 1I2NA 1BGAA 5HPOA 1RCQA 3AMGA 5HBFA 1Q6GA 2QCLA 2QS8A 4PC8A 4EOUA 2OKTA 2XJ7A 4EE9A 2QIWA 3CBWA 3LNMA 1W3IA 3GZ3A 4LUSB 5BWAA 4B9YA 1PKNA 2NWSA 1PUDA 3JW7A 2PGWA 1RY8A 3SB0A 1VBJA 1UKTA 3NWRA 4IOTA 1RJRA 2X30A 1GJUA 4PMNA 1F05A 4UC5A 3VGGA 3CL8A 3DECA 1ZL1A 2BNJA 3VMOA 2Z2UA 2VRKA 1SO3A 3W2LA 3OQEA 1RCXB 2X2GA 1GOMA 2PS2A 2DZAA 1SVDA 1FFQA 5JMUA 3S1XA 3HPAA 2H90A 3LBCA 4Q8NA 2FHBA 6TAAA 2FGBA 3QYSA 4JPGA 3E96A 4QSHA 2A3BA 3ERPA 1H7PA 2WVVA 3LG3A 1W91A 3OU8A 4Z17A 4J4KA 3EOSA 4HHMA 1CXFA 2FFCA 5LIKX 3B4YA 3LM7A 3N4FA 3MVIA 4LVDA 1QPKA 3V75A 4DF2A 1EP2A 1KW1A 4NASA 4DJDD 3W02A 3RYSA 4R9XA 2OXNA 1PWLA 5LKYA 3MV11 1VFLA 3IS4A 4DO7A 3AIEA 3WCZA 4JHMA 3QKZA 1CGXA 2P1FA 1JQVA 2ZWYA 3WX7A 2OYMA 4ZB2A 4OFCA 4ADTA 4Q4MA 2AAMA 1KQZA 3ZJKA 1XDLA 4JFTA 3BO9A 1XQKA 1E51A 1P0BA 4KCWA 1VBRA 3DFYA 4AD2A 4E8GA 1EDGA 4IMGA 4Y9NA 3UESA 4WJ8A 1XLLA 2ACSA 3R7MA 2BY0A 4JFSA 1C3FA 4R88A 4FSAA 2FZNA 3ICJA 1P0NA 3O6YX 2OTDA 3B05A 2YFNA 4C6OA 4UR7A 4D6JA 4MZYA 1DVJA 3ITXA 4UUIA 3TNBA 1RQHA 1M01A 3JZUA 2E40A 4PE8A 1NP2A 4HZMA 4EPEC 4K6AA 3NL6A 4NX5A 5K7JA 5D2WA 2OT1A 2VOTA 5H1WA 2ACRA 2UY2A 3BMVA 3RCYA 3FGCA 3AI0A 4PB5A 5CGTA 2DJXA 4PMOA 1ICSA 2OGYA 3WBXA 5C71A 2Y7EA 3SAZA 4RJEA 6PTDA 4CQ8A 4B16A 3LQLA 4QSFA 5D37A 1IZCA 1B4KA 3HV8A 4XD5A 2VX4A 5BMXA 3C0JA 3WF4A 4YTRA 4XVDA 1BD0A 2B7PA 3T8LA 1PKMA 4Z1DA 4E8DA 1RBLA 4AC1X 1NARA 3NEHA 3NYDA 4PR4A 6XIAA 1F3EA 2ZFAA 3W72A 4GYJA 1SSDA 2QUTA 2XVNA 3IANA 3NQ8A 1OGBA 3BV4A 2O9RA 4MWAD 3GTNA 1ITCA 1XBZA 4I9AA 2X8RA 3H23A 4H19A 6ENLA 3LDVA 5IXEA 4C5YA 4XK2A 5CH9A 2J7HA 4GC3A 1E0WA 5E6YA 4CCEA 2WHJA 4TMCA 1B3XA 3BW4A 3QKEA 4DY1A 2Y7FA 3I7QA 4D6GA 3JS3A 4JTEA 3PVFA 3T09A 4V15A 4Z08A 4E5TA 1G67A 3WQWA 5D9PA 4AY1A 1JZ3A 4WDWA 3BJFA 3PPCA 1RPKA 3QOKA 2NXHA 3FOKA 3B0PA 2C1HA 3TEVA 2A3LA 5G2IA 1RJQA 5IRPA 3M6YA 3RMJA 1V3LA 4F0LA 3STEA 3WLJA 3DC8A 1AG1O 4PSRA 1P6CA 3OZMA 4GJ1A 3N73A 4BY3A 4N2YA 2BHZA 3DESA 4HBKA 4BQ4A 4XQ6A 2Z1VA 2CETA 1ADSA 4DHGA 4LAMA 4ACZB 1SFTA 3LHZA 3T1GA 3CQKA 2GJNA 1VYSX 4JIRA 2PDMA 3CZLA 4H8NA 1W37A 1QOXA 3V7PA 4ADSA 3LBMA 3LMZA 5E0KA 1OFBA 1JL8A 2PI6A 5JQ9A 1PZ2A 4LAZA 3ITTA 5KTLA 1W1ZA 4HNNA 1E43A 4W8AA 1GVOA 2Y6ZA 4Q22A 3VIOA 2E6FA 2BGSA 4ZR8A 1NIUA 5BWFA 2Z25A 3Q4DA 1NF0A 2NSXA 2CBUA 2WQPA 3AZSA 2VURA 1RALA 3WK2A 3O6DA 1QNQA 1EOMA 2DDXA 2Q8ZA 1Q6CA 3CUXA 4NRRA 3BXWA 5M3WA 2VUYA 1M41A 5T8GA 2DQXA 1F3TA 3GKFA 2PBGA 2YJQA 3W4RA 1LBFA 2E5DA 3OIXA 4Z1CA 5DMNA 4O57A 3TZNA 1W17A 4UTIA 3CAWA 2AL1A 4C6BA 3ORWA 1MI3A 1TUFA 1RQEA 1YQ2A 1X7IA 3WDIA 3IEBA 3UJFA 4I7UA 4HK7A 2O56A 2WXDM 4LS2A 3EPOA 3PZVA 2G41A 3AIBA 1MXSA 3MO4A 3CV2A 2CZVA 2ODOA 4UTFA 2A3EA 3KOXA 1MZHA 1BTMA 2FHCA 3FN9A 5A8QA 3NZ1A 1X1ZA 4H8HA 1AW2A 2BVDA 1QCWA 1UQZA 1MZRA 3FFSA 4Z0SA 2AL2B 1DOSA 3H26A 3CM4A 5ENLA 1XH1A 3ALFA 2Z7KA 3N34A 3DU0A 3K13A 5I3GA 4DZ5A 3NQVA 1TMLA 2WJDA 1XPGA 4K1WA 3ITGA 3DAQA 3L0GA 3W7GA 3W7IA 5A5WA 1E4IA 3UZ5A 1AJ0A 4Q8PA 4R85A 2AQWA 3WF3A 1PYFA 3NAVA 3GNNA 1KXVA 4RNJA 3DFNA 3VIJA 2QDEA 1V51A 1VCFA 4CEXC 4ZO7A 2V69A 1YBQA 2ZZ2A 3WMLA 2OFJA 3WEMA 1R3RA 3LY0A 3GFZA 3ZR4A 1UD8A 2F84A 2IKHA 3CH9A 1WV2A 5DBTA 1ZAIA 1T40A 2RDTA 4JX6A 3EA2A 4K37A 5CZJA 1KBIA 3M5XA 5G2WA 3GZAA 2PDKA 3GH5A 4GYPC 1LUCA 5JXQA 3U7VA 5C55A 5TD4A 3BARA 5KZ6A 5A3HA 2PTZA 1PIIA 4ATDA 1OB0A 4RDVA 4JX5A 1GCYA 4RE2A 1TR1A 3NDYA 3BJSA 4J3SA 1RSCA 1F6KA 5AC6A 3SFWA 2CBJA 3SW6A 1QBAA 3OZOA 3SSJA 3AISA 1IEQA 1T41A 5LZLA 3VC5A 3WD4A 1L6GA 3RNDA 2UY5A 3VOIA 2PRHA 1TA3B 4NNAA 1EDTA 3LA4A 2C0HA 3NFUA 1BGGA 1EXBA 4IISA 3KTCA 3O05A 3T8QA 3RPMA 3A4AA 4URIA 3WBYA 5FEWA 3P61A 4ERGA 5A8OA 2PLJA 2ZZ5A 2PC8A 4UTWC 3LLDA 3W1MA 1GW9A 1M7PA 1H62A 1N7KA 3ZOAA 3MMTA 3AXHA 4UTWA 5FJTA 3STPA 4YHGA 1KFLA 4AWUA 1G94A 2FPVA 3SY8A 3BE7A 3UVAA 1IHIA 4DN1A 2FH6A 3R8RA 3B8VA 1P5BA 3WN6A 3FDGA 1XLFA 1EH9A 3UWWA 4XO6A 1E3ZA 3H4GA 3IGSA 4P8VA 4S3BA 3ARYA 1B1YA 2A5HA 2OZ3A 1CCWB 1L2UA 2DSKA 4A05A 4GQGA 1GG0A 1PTDA 4PMVA 3U6WA 1G4PA 3RIKA 3XINA 1K03A 3DEQA 4PUWA 5FF7A 5A6BD 3ARUA 1BSIA 1KGXA 4FLRA 4H9TA 3H6OA 4O0KA 2PTWA 4HD5A 4Q7BA 4E4PA 1QRQA 4A3QA 1UUOA 1PWMA 2V3DA 5EFDA 2BDQA 4B3LA 3LX9A 2DJLA 1GVIA 1KLYA 1K7XA 4CU7A 5FA5A 2VNCA 3QV6A 4JFUA 4JFVA 4ZTYA 2DQWA 3WDQA 1YLVA 3QZ6A 4G1NA 3ZQ9A 3BTNA 2XIOA 2QZRA 2H9AA 4OV9A 4IPLA 1S2VA 1QI2A 3NDZA 1VD6A 3NIYA 3W23A 4J27A 4Q4OA 3FXGA 3TLLA 3KBSA 4IG2B 1T96A 1QUMA 2ZA1A 4AIUA 3LSCA 3JRKA 1DORA 4S1FA 5FJPA 1RLDA 4ZQPA 3FYOA 2XUCA 4QRNA 1W8SA 3E0VA 3MWCA 5E0CA 3MI2A 4X2PA 1V3HA 4GUIA 1CLXA 2XH2A 3S5NA 4C65A 3GHRA 3QLLA 2EPLX 4I5RA 4DXVA 3E0LA 4LV4A 3ITVA 3VDGA 1OVDA 4IL0A 4IH3A 2WBGA 2A85A 1BXNA 4IUOA 4C6KA 1Q65A 1LCOA 3AS3A 5I2UA 2Y7GA 3UR5A 4ZOEA 3P3BA 2E28A 2CBIA 1DQXA 2ZX7A 2B7OA 5XINA 3SSZA 4XZHA 1ZBCA 2OOFA 4H4IA 1FP8A 3CAQA 3VTRA 3CMJA 3BL3A 4Q7NA 1B31A 5BW6A 3M4HA 1O5RA 3GRIA 3DHUA 4G7EB 4KRZA 3GC2A 2OYLA 4LWWA 1UWTA 4Z2JA 1TJ0A 2ON3A 3W1PA 4J1OA 1QOPA 3GFXA 3VGEA 1H7NA 3LLXA 3ZJ8A 3AFBA 1W5NA 2W92A 4A3RA 1TCMA 4IIDA 2YA0A 4A29A 1GTEA 5AC8A 5LNUA 3SBFA 4HNCA 3VUSA 3OBEA 4OECA 3WH6A 3FHQA 1EJSC 2C13A 4RDWA 4HOWA 5F4XA 3KVMA 3SEPA 1FCBA 4M1BA 2C1GA 4PMUA 3M1ZA 2HSAA 1GKPA 3BQ6A 5CZTA 1QK2A 3PHAA 1E72M 4I5UA 4DJFD 2CERA 4IFOA 1WDPA 4BZYA 1T7LA 4LYPA 3GIQA 2YYUA 3W07A 2R1NA 1K02A 4O4WA 3W2KA 3WZ0E 2ZX8A 1TWWA 2HBXA 1XGEA 4IJCA 3RM4A 1HKWA 1VR6A 1XLIA 5HNNA 3BPWA 5EB8A 3KHDA 2XIIA 3PPGA 1JXKA 4YL2A 4NAFA 1IEXA 2XGZA 4J3TA 1DWIM 3COTA 2NV1A 1MXDA 1X7FA 2CXGA 4JTIA 3OVPA 4ERAA 4WR3A 1HNYA 1MXGA 1XP3A 3SDOA 1H60A 3W53A 4XSMA 3PZ9A 1LWJA 3E0IA 2WHKA 3RO6A 2Q01A 4RDYA 1TX0A 3WH7A 4JTJA 3ENLA 3CIXA 4LCQA 1P43A 1LLOA 3P14A 4S2BA 3O8AA 4Z2KA 3R94A 3NCOA 2EAWA 4J3XA 3FEQA 1GOIA 5DANA 1LM1A 2NX1A 4FLSA 1OY0A 1QBBA 1AK5A 2VOMA 3WNPA 3BLDA 4CD6A 2D3LA 4B91A 4JYFA 2PDBA 1LBMA 3VOGA 1JG9A 1EEXA 4H9YA 3VI2A 2F6XA 3RM9A 1W1YA 2QCFA 3QFEA 2KX9A 4JL1A 3AYTA 4N42A 3PS7A 4TV6A 2QGYA 4FK9A 1GOKA 1YDVA 2R1LA 5D32A 3WNOA 1TKKA 3W87A 1NY1A 3E74A 3TOPA 1WDRA 1TJ1A 4W87A 1PZ1A 3KBMA 2YB1A 3SQSA 1SZNA 1SSGA 4FI4A 3FIGA 2VR2A 3ZLFA 4QHRA 2C8NA 3ISIX 1ZAHA 3G8EA 3INPA 3UNTA 4CU6A 3GTHA 4WOQA 1XBXA 4DNMA 3TV8A 1ITQA 4WVXA 2GGIA 4A35A 1HUVA 2OX4A 4U10A 3PM6A 1JI2A 2E9BA 1JIBA 3CJPA 4JNZA 4IJBA 1WPCA 1Y5WA 2PRMA 5EBAA 3TONA 1X38A 3N2XA 3MT1A 4NP7A 3S1GA 1VEMA 1X1NA 4U2YA 3L4WA 4QLLA 1WDWA 4QQ3A 5JIWA 4OOUA 4O50A 1EYWA 4JQ4A 1TFVA 3TYUA 4ZTXA 3IK2A 4PTWA 3RILA 3A24A 4BQ3A 3AU2A 3GYEA 4BJHA 4E8CA 1JD7A 1LL4A 3TK7A 4Z1YA 2FVLA 4KGLA 1XBVA 3DI1A 4JR5A 1PX3A 3B8WA 3H24A 1T8XA 4AD1A 4O15A 5B7YA 4ZEPA 2WC3A 2OWWA 4B9ZA 3C0SA 4RV8A 4D9PA 3PZUA 4NRSA 2H8ZA 1Q8JA 3NXLA 2WZTA 5U4NA 3ZSTA 6XIMA 3MBDA 3IGXA 4MWAE 1DIDA 3KL5A 2YLAA 3H2OA 2IS7A 3MI3A 5E0FA 4J35A 5CKSA 1EA0A 2CPUA 3UWQA 2W61A 1YXYA 3WBEA 2WB5A 2WVSA 1TVPA 4DUXA 1ZFJA 1LYXA 4EXBA 2FZ9A 4OZOA 2QVHA 1NWRA 2J8TA 2Z1BA 1FDZA 4XKMA 1DJZA 3THUA 1M9HA 3EX2A 1NOFA 3SIMA 1UP0A 5HINA 1EF3A 3RHGA 1C7SA 1RP9A 3S6DA 5D05A 1UD6A 4GOAA 2HXUA 3U3HA 3LRMA 3ALGA 2BXVA 2R1KA 1AQMA 4KF1A 4KESA 3SGZA 2D69A 5E93A 5I78A 1XDJA 2I5QA 2VFFA 4ZXLA 3W1UA 3LCXA 4GHRA 2G3FA 4P7RA 5AZ1A 3LBOA 5EMLA 1Y0EA 3T2PA 5IFTA 1EJRC 1EWDA 4I9JA 3IUIA 2BSLA 3C4UA 4FR6A 3QMRA 1XJBA 5LHEA 5DBUA 4GBDA 3DYPA 4IFKA 2Z6JA 4LRSA 3BSGA 3W7CA 4EWJA 1QO5A 4A6GA 2J77A 2ZDRA 1FQ0A 1P7TA 4KFNA 1NELA 1XUUA 4YXGA 3OOQA 4QX4A 1UZ4A 1US0A 3PY2A 1OG0A 1VAHA 1V08A 3UPMA 4QCFA 1HFBA 3W28A 5J5RA 3HQOA 3AO0A 3N29A 2PA6A 3TXZA 4Q8QA 3BSHA 2OO6A 2BVTA 1HX0A 4AVFA 3BAWA 2YPIA 2EO7A 1OHLA 1J0HA 4WY0B 4FIQA 4HMDA 4K38A 1W5MA 4Z0JA 2W67A 4L9YA 5M5DA 2CESA 3LCWA 1SMAA 2HROA 2YCIX 4PUNA 4ORMA 3EWUA 3KCLA 4W85A 9RUBA 3GR8A 4JQAA 2G4JA 3ITYA 3N9SA 3AU6A 4N6FA 3FSUA 3TYDA 4G6CA 1Q6QA 3A4JA 4CU8A 3UXAA 4KWOA 3G1XA 2PWVA 1W31A 5EMUA 4HJFA 2OWCA 2R14A 3G22A 5AY7A 3B8IA 3NZGA 4A2SA 1A4MA 1HGWA 3V5CA 5G2HA 1C92A 4KW2A 4DPQA 1XCXA 3UYCA 1NQ6A 4M51A 1UJQA 4F66A 3DFTA 3TLQA 5CLWA 4RDZA 1J93A 4TTUA 4CN4A 4A3UA 1V3MA 4TTGA 4EF9A 3C0LA 2WNNA 3HJZA 1NDYA 2CLOA 3N2BA 4PCTA 3IGUA 4QCEA 1I2QA 3TUUA 4XBJA 1XLKA 3W71A 3KUMA 4X3ZA 3GG0A 3W9ZA 4MFEA 4FF7A 1ZGDA 1AL7A 3PUOA 3W7LA 2CZDA 2POZA 1KRAC 3NG3A 2HV5A 2ZZ4A 3RPTA 4V2XA 3P8JA 2J78A 1DIOA 4B15A 3UPBA 4YTUA 1K6WA 4MZ1A 3L0NA 1Z41A 3ZWSA 4Q6JA 3THQA 1WKFA 1C29A 1Q6DA 3W7QA 3I68A 3T07A 3W22A 4LPCA 1IGSA 4BR1A 3GAKA 5FJRA 1SFLA 1AJ2A 2P10A 4S39A 3A21A 1ZBVA 2Z6IA 2DGAA 5EYWA 2ZXAA 3LHUA 4D8LA 3WJXA 2PMQA 4HOZA 1KRMA 1X8FA 3UG8A 4AIOA 5BRBA 2O55A 2PTXA 5BU9A 2GLKA 4O4VA 3FJLA 1VFMA 3AS2A 1LQ2A 2WWCA 3G1HA 2DSZA 5HJYA 1YNPA 1R3VA 1EPXA 3AJXA 3M0MA 3SCOA 4I5XA 1VC4A 5A6AA 1V6VA 2C1IA 5DELA 2VT0A 5LIWX 4ZE4A 1XIGA 2OLSA 3W73A 3CIVA 3H2MA 4HNLA 1M03A 1BWVA 2OZTA 2E6YA 3KFTA 3LPGA 1Q13A 1B3YA 4I7WA 5AYXA 3Q45A 4E4UA 1LL7A 5F4WA 2VZUA 4Z42C 1H0IA 1FVPA 4H7CA 5JH1A 3A64A 1KM4A 4OWGA 5CXPA 4IXHA 4HZ6A 5HWJA 4MPQA 1JDFA 4HMEA 3CWOX 3SN4A 2V68A 2PF8A 1CLVA 3QMTA 3VNDA 2CC0A 2DZUA 1ZJIA 1W9BM 1XBYA 4PTVA 3NSNA 2PAJA 4C1NB 4C60A 4ZL1A 3PTQA 1W56A 4ZFMA 1E55A 2PD5A 3PSVA 1H7RA 2QKFA 4FOJA 3LD5A 5A94A 4HZ7A 2EKCA 1NWSA 3TMLA 2CLFA 5A6LA 2IQTA 1MUWA 3RO8A 3H55A 2GWGA 3GXNA 3SI9A 1EHNA 5H91A 2BZNA 2D3NA 2X0YA 3L9CA 4JBRA 5BMWA 4M1RA 1OF8A 2Y1HA 3F03K 3TYZA 3BLKA 3D6NA 2RFGA 1B90A 4U2ZA 1JCYA 3WD1A 4KEVA 1XYMA 2UWFA 3TXVA 4YPJA 1EPVA 4I90A 8A3HA 4KRUA 4FNTA 3G5EA 1EXPA 3P8IA 5AHMA 4UTUA 1WZAA 4MADA 3EAUA 2WYSA 3AALA 4RCXA 2OZ0A 5C2XA 1N8WA 2W62A 2J7CA 3GDLA 1EDQA 3E2VA 4JICA 4GO9A 3MSYA 4KWUA 3G6LA 5FEPA 3QH2A 1S38A 2CKSA 4C1KA 3MKVA 2OEKA 1F7BA 4UOZA 5HPCA 2C19A 3S9ZA 1BEUA 2V81A 2VCAA 4LEQA 3USBA 3KDOA 1GHSA 2V5CA 4KWWA 4MPKA 4R7JA 1NQKA 2HS8A 3WH8A 1MW0A 2CLMA 1W54A 1LT7A 4AEFA 3CO4A 3IGHX 1QDSA 3W1XA 2HDJA 1BF2A 2VCBA 5C9RA 2YBTA 2BHUA 3FXYA 3LQGA 4K8EA 3OG2A 1A5SA 4B2DD 1V8EA 1I45A 3OPSA 1PB0A 2PWHA 1FH9A 3K8LA 3FEMA 4WSKA 3FSTA 3GO2A 3DI0A 1QI5A 1QR7A 2NQ9A 4HPHA 1JUEA 3T0CA 3DDMA 1RBAA 3A13A 1UR0A 1K1DA 3URAA 3KWXA 4PTNA 4DIAA 4ZGYA 1V7YA 3T0TA 3PBWA 2E1DA 4NJHA 1ESWA 3APGA 4LYRA 4FXFA 2IMRA 1DWHM 1E3XA 4ZQCA 3WQFA 3HB9A 3AMDA 2PURA 5L6UA 5I3HA 2R91A 1LQ0A 2VWTA 3CLWA 4DBUA 5IM51 2WLYA 3NQFA 1XXXA 3FKKA 4C6IA 1P48A 2YLLA 1HL2A 3GNRA 4GUGA 4QS6A 1FH8A 5I3JA 2GGEA 4H7VA 3B9OA 4RL3A 1DPMA 4AZGA 4D6CA 1JD9A 5CBIA 4CN6A 3VIIA 3GYCA 4JDYA 1T6MA 2G97A 3CEPA 1TELA 1S1RA 3VGHA 4HPNA 4BKNA 5IDZA 3IRSA 4BK9A 5AKQA 7ODCA 4IGSA 3MJMA 4FMVA 3BK0A 4QFUA 3ZYZA 3UXIA 4HVXA 3QMSA 3ABZA 5I02A 2GL5A 1H63A 5AYBA 3HA1A 2Z28A 3LV6A 4XISA 4MNLA 3TJIA 3DERA 3NVDA 3MSRA 4PTMA 5FIPA 3VIHA 2WBKA 4F8XA 4AZBA 2WMIB 3ZR5A 1JPHA 3L2MA 1TZZA 1VF8A 4PL2A 4Q8MA 3K4WA 2XZ7A 3EXRA 3HIJA 3VMPA 1OEPA 1FXPA 4QGCA 4GKLA 4PUKA 1YW1A 3W25A 3O3RA 4IZGA 4HU8A 2DZPA 2WSPA 4AZIA 3VDBA 1MQQA 1IT7A 2FLIA 5I09A 3WH5A 1WXJA 1V4YA 3N2OA 4QJ1A 3VC6A 4C6JA 3OO2A 2VENA 1S2UA 5FD0A 4O1FA 1CXLA 2PDCA 1TREA 3A3XA 2PZ0A 4KEMA 3FJ6A 1NDZA 1OCBA 2E25A 4J3UA 4UFHA 3TVAA 2BGQA 4KIEA 4PN2A 3DX5A 1UZDA 2JEPA 2J8FA 4PCNA 3UZYA 4ZSUA 4P7OA 3LMYA 3UFYA 4L6HA 5TAOA 4J7RA 1A47A 5I5RA 2HTMA 3EWZA 2IPGA 4HMNA 3MKKA 1FFRA 3CS2A 3DBPA 1RY0A 3AIWA 1QASA 1XHGA 4X0NA 1XCFA 4W8LA 1HKKA 3M41A 1GZ1A 1W9UA 1R2RA 3OVQA 3AHZA 5FJIA 9XIAA 4LUIA 2QGHA 1R8LA 3BH4A 1CGVA 4KCVA 4M6PA 1IEWA 2PDQA 3L4UA 4DWSB 5F2IA 1KM0A 1XLJA 2QUNA 1UASA 1O7AA 1LZOA 5FJUA 1RA5A 4QG6A 3BLFA 5EA9A 1F07A 3NO3A 1CWYA 3F4CA 8TIMA 1LBLA 1TRDA 2P0IA 2D2GA 2NLYA 1IE7C 3W37A 5CSYA 3GSMA 3W27A 1ZS2A 4QTGA 1TMHA 1HJUA 1VBGA 3IVUA 3WQ8A 4US5A 4LF2A 3I10A 3KEHA 2X41A 5HNTA 2OB3A 2FPTA 4WHBA 1J10A 2ZVRA 4MKNA 1W6TA 5D2XA 1H1YA 4UMAA 2PGFA 3W29A 1JULA 5CLTA 4UQEA 3A5FA 4CUCA 3U2EA 5GNXA 3M0XA 4WOZA 1SJBA 4XVEA 5HNRA 3DHDA 1ENUA 2P8BA 3BGAA 3P0XA 4EP8C 3GDBA 3VOFA 1W2VA 3D3AA 3ME3A 4DF1A 2GJPA 4H8VA 4MB1A 1Q2SA 1I75A 4IIGA 3AHTA 5D2VA 4HCLA 3PTDA 4UWMA 1WZLA 2I1OA 3RDKA 1HP4A 3GQYA 2P88A 3OBAA 4RNIA 1FDJA 3MANA 2ZOXA 3LPFA 4WRHA 4GBUA 4AIEA 3H8AA 1AH3A 1Q63A 4P61A 1WX0A 3CYJA 3NNTA 3WQDA 3MB9A 2WHLA 2W4XA 2ABAA 5EU9A 4NXKA 4ZQNA 3ZO9A 3C3NA 1R87A 1Y65A 1P6BA 3U5YA 1HKJA 2ONEA 1FRBA 1D2KA 1SYTA 1TV8A 5D4YA 3URQA 1UWSA 2E6DA 2ZIDA 1Z42A 2BFGA 5I00A 1UUQA 2DUXA 3WJZA 2OQHA 3FGCB 3W1RA 2NX9A 2Y5EA 1X6UA 4ZMGA 1A5UA 1IXQA 4UCGA 4HGXA 4HK5A 1UC5A 4M5PA 4CVWA 2H6RA 1PPIA 3NURA 4O1AA 3IJDA 1LF1A 1MDLA 1A5AA 3PWAA 1XIFA 3ZJ7A 2Y8UA 2QMJA 3TCEA 3L68A 1GOXA 1V0NA 3H2CA 4PMZA 4O19A 4CCZA 4V33A 3WK0A 4AMAA 4O52A 1FHVA 3KZPA 2CHRA 4KH2A 4POCA 3PG9A 3W6LA 2PC4A 3KRSA 1KA9F 3N25A 5T9BG 1XG3A 2QCDB 3BG9A 1V6TA 2ZRXA 3EDFA 1VYPX 2PZNA 3REQA 3GC4A 4JOMA 1J4EA 3CV6A 3W7JA 2OLAA 4CD4A 1LOQA 1BPLB 1UH3A 2QPSA 1DJWA 4HPXA 2C6QA 4Q4SA 3G2GA 3VM5A 3MP5A 1W5QA 4U31A 1J2WA 3DBNA 3QN3A 4NT0A 3BICA 4H6KA 1AQHA 4IHCA 4RZ5A 3R12A 3EWYA 4LUJA 3GLCA 4FS9A 3GXDA 1POJA 5ABGA 2WVUA 2QNEA 2EKGA 4MMWA 1VZWA 4IQLA 2PUZA 3BCFA 2E09A 4NSBA 3UPWA 3ZM8A 3XIMA 4GUHA 5CGQA 4YCOA 3OZYA 5EFFA 1M7XA 3LCFA 2Q09A 2YXOA 4BWLC 2AGKA 4ZVJA 1TV3A 2WMJA 1V93A 1HVXA 3GVVA 3THDA 3VKDA 2ZC1A 5C9ZA 4BWLA 1H11A 1UKQA 2IKIA 2GUYA 5AYYA 3HMCA 5A8MA 2VDIA 4MYAA 2Z0IA 3WDRA 1S5NA 4TQTA 4IQDA 4W7VA 3J7HA 4AX7A 3EXSA 3VCNA 1ZBKA 3TU9A 3AJ7A 2E9MA 1BG9A 1E9LA 4FNQA 1HL8A 4H9UA 4ZQOA 3LK6A 1CDGA 4CEUC 4OT7A 1ME8A 3HZ3A 4PMXA 5MKGA 3FHAA 1QO2A 5F2GA 1XIBA 1UJPA 3TYCA 2FTYA 2OCZA 3FX4A 2NX3A 4EPBC 3HMJG 3TYEA 2R9RA 3V0UA 4CCCA 3DFHA 1M3UA 2PU0A 1V77A 1TJRA 3R6IA 2JKPA 2C3ZA 2ZCGA 3SCTA 3W7DA 2GK1B 4C6EA 3GWQA 3TKFA 4JY8A 4L65A 1OX6A 3MW7A 2ALDA 4ZB0A 4D72A 2ZRZA 4NYUA 2BGNE 1LL6A 3S9IA 1XC4A 4YNGA 1PE1A 3BG3A 3BGGA 2VJXA 4GY7A 4ZQRA 4JKMA 3RLUA 3EDKA 3H4WA 3M0YA 1CGWA 1V0LA 4DO6A 2C91A 3T0BA 1KKOA 2QCHA 2OLHA 1V6UA 2OEJA 2NVDA 4HTBA 4W93A 3PF3A 3QV8A 9CGTA 4MSSA 5BXRA 1CXKA 3CLMA 1F4HA 4NI8A 5AC7A 1QHPA 4PSPA 3WQEA 2DZSA 2GDUA 1WXYA 3DFQA 4C6PA 1VLIA 1XF0A 3LGDA 4HCHA 2NQZA 1H5YA 1YDOA 1W3HA 3SO7A 3WLSA 1JZ5A 4B3KA 1JF6A 1I6NA 1R7OA 3ABOA 4AHOA 1KXTA 2X42A 4GXWA 2OWXA 3LB0A 3OG3A 4XZNX 1QNSA 5RUBA 1UPPA 3RR1A 3RJYA 3W38A 3GG8A 1Z48A 3KVLA 3IJ6A 4FO4A 1A0DA 3T40A 4JIEA 1JCJA 2GGJA 1GVYA 2TSYA 3STCA 1DJIA 3RM8A 3QPEA 2I16A 1XCWA 2I57A 4GQRA 2Y88A 3VZYA 4L9XA 2QMKA 3FLUA 3TR9A 3BW3A 1XICA 3N11A 5BOOA 4XD6A 4RLIA 1RJPA 2EPOA 1XQLA 3R10A 4RUBA 4INFA 5CJ5A 4JTAA 4AMCA 1AQ0A 2O0TA 3IIPA 4EXAA 2CLLA 1B5TA 3PP7A 3WJSA 1X8CA 4ERIA 2BX7A 3OZPA 3M0KA 3BOLA 3DZ1A 1VCGA 3F5JA 9XIMA 2OMAA 5AHNA 1ITUA 3ELFA 3HFTA 3LTPA 3VNYA 1K6AA 3T9PA 3JUGA 1EUAA 2G50A 4K36A 4N02A 4ZO6A 4JTGA 5CZKA 1B3VA 4K68A 2OR2A 3NXFA 1GT8A 3LHWA 2ZZ1A 3AXXA 5H8PA 2Y62A 5HK4A 3TX9A 1K7EA 5CJMA 3IVTA 1DE6A 3HG3A 3WD0A 3A9IA 1HIZA 3UY7A 4MNKA 2J13A 5LSMA 2I7GA 2W79A 5A2BA 3PK7A 1NP0A 3HJEA 1TPVA 3DGBA 4ACYA 4GI6A 4WKHA 2PWGA 4JHOA 2A6LA 2DT0A 3CK5A 3WK3A 4B92A 3O2LA 3E3HA 1TO3A 3N2CA 2QCGA 3LXCA 5FF3A 3Q37A 4XZBA 3A3HA 3GD6A 4O1DA 3AIUA 1DHKA 2CHNA 4LYKA 4JAWA 1UD5A 1EO5A 2OG9A 2VR5A 3NQ7A 1AVAA 2QYGA 3EKGA 3KVJA 3NQMA 3WLPA 3WEZA 1JXJA 3GVWA 5CJNA 2UZ9A 4IWWA 2QCEA 1TE6A 2PCQA 1NU5A 2J7GA 1EBGA 4FXJA 2DH3A 4DXXA 4JN8A 1CB2A 1LOLA 5KINA 3GVQA 5EMMA 2CZEA 3CL6A 3DH7A 3W0KA 3HGJA 2WSRA 1J12A 4CQCA 4XAYA 5JIPA 3F4WA 3QZEA 4WJEA 2Q3RA 3ZJ6A 3KRZA 4O1BA 1J0YA 3MZ2A 4ZQMA 3HPFA 2J7FA 4IMCA 3M0ZA 1C93A 2ISFA 3UEQA 2O7QA 1MYRA 3WD2A 2QR6A 3L4XA 1JYXA 1IGWA 1GYNA 2XH4A 4AFYA 3CV1A 4HA0A 1T99A 3LZ5A 3OA5A 4U5KA 5IFPA 3HBLA 1PYMA 3C86A 1Y5VA 2X40A 1LRNA 5ABEA 1TPFA 3QTGA 1R0MA 3W85A 1AJZA 1V6WA 1X1OA 1TQXA 3OVRA 4DUWA 1GPWA 3VDHA 3STFA 4ROPA 2ZVIA 1F4AA 1FWHC 4HSNA 2WMKA 3CZEA 3W76A 2VFDA 2H9AB 3NZRA 3WMBA 2V30A 4XIMA 4XTDA 1GOQA 2OODA 1H49A 1IWBA 1W9XA 4GRSA 4QE4A 3VE9A 3MV01 1OF6A 4NILA 3RX4A 3W7KA 2E5CA 4AQLA 2FGLA 3SRDA 3VOCA 3H2EA 3SZ8A 4GVHA 4UQ9A 4QLJA 2D0GA 2HVNA 1K8XA 2EQDA 2PDJA 2QJMA 3O7UA 4KEZA 3M16A 1UWRA 3M0LA 4LV9A 4U28A 3VKAA 1BVWA 4PUMA 1S46A 2QPXA 5JU6A 3GW3A 1UR3M 2PP0A 1XV8A 1HF6A 2BOGX 3VNLA 1EQCA 3I6EA 3ARTA 2NQJA 5DFAA 4A2RA 5IOBA 4EWND 1TV2A 4D8AA 1TTQA 3F4VA 1C90A 4OKDA 2W3ZA 2D73A 3DGRA 3F2CA 1UKPA 1LP6A 4KKXA 4UQDA 2ZKMX 3OVGA 1JPMA 1X6NA 1FWAC 1Z44A 2PFHA 3GDRA 4QAIA 1TPDA 5C7HA 4EACA 1L9WA 1UMLA 3HGOA 4M80A 2CLPA 4GXPA 4PB4A 3T2QA 4S3JA 1KCKA 1O60A 3O63A 4K1GA 4ICCX 2H8XA 3N04A 3YPIA 3R0DA 3AZRA 2YX0A 1MDRA 3CXOA 4L4PA 3T44A 4NJJA 5KETA 3SADA 4HHHA 1VH7A 4WGXA 4KWSA 3O07A 1IYXA 3LU2A 3URNA 1TR9A 4RXFA 3IJLA 3LLFA 3MMUA 3N15A 1P0EA 3UT0A 2P76A 4F40A 2AQVA 4GUJA 4Q4PA 3TQPA 3N2MA 2V2DA 3M6DA 2PB1A 3HF3A 5DF0A 3KL0A 1KM3A 4C6NA 1GGOA 1NDWA 5HMEA 3TZFA 3W2UA 1E0XA 2INEA 4PTDA 2JGQA 4QISA 1OGSA 3I4EA 2XIBA 4L6DA 2Y70A 5CSSA 2TMDA 1NSJA 4NUWA 4JTRA 4EAMA 4IJRA 1QXLA 3WG6A 1KBLA 4J28A 3LXBA 1K3UA 1ZNNA 3GXIA 4JCLA 2JKAA 4QG9A 2Z1XA 4NAFB 3UERA 4K3ZA 1LLWA 3MYPA 5C6MA 2XG9A 1RLCL 4ZSTA 3GU9A 3L2LA 3V18A 5M17A 3AMKA 4P5UA 2HQAA 3V5FA 4O17A 4L61A 4FALA 1ELSA 3GAYA 1GK8A 4H04A 4JTQA 4EPDC 1E0UA 1SW0A 5DRCA 1Q6OA 3MU7A 4E3TA 5LXEA 1XLDA 2WKLA 3K8KA 1UWQA 3VGDA 3T6CA 2VC7A 4ALDA 5D38A 1DQWA 4LC8A 1WOBA 4IIFA 4WSJA 1R47A 1KM6A 2FTPA 4PGLA 3EDEA 3EWCA 1XKJA 1J2BA 5K9DA 3LS9A 3G8RA 3R0UA 4K8HA 3FV9A 3ZZ1A 2XIJA 4Z1BA 2VEPA 3OQ8A 2X0SA 1FHUA 1BG4A 5F2MA 1K7FA 3TJLA 1R6WA 1O4UA 3CMGA 2DZWA 4ICMA 3L5LA 3FYYA 3K2GA 5A6KA 2WCSA 3D3FA 3RMEA 4JQ3A 5A2AA 1UD2A 4GACA 2CCRA 4OQVA 2WMFA 5HQEA 1V79A 4JNYA 2YBVA 5A2CA 2VRJA 4HA4A 1MFUA 4ZE5A 1OYBA 1IZKA 3TWBA 4GNVA 1LWHA 3FDKA 5CC7A 2FDSA 2FPYA 1F8MA 3GHUA 3N19B 4DLFA 1VHNA 3MKCA 2NT1A 3KE0A 1SO6A 5C54A 3V16A 1BFNA 1SFSA 1X96A 1FWRA 4MKVA 3S3GA 3UG3A 5LA2A 3NSXA 1TIWA 3GU2A 3GFYA 4EKJA 4LNYA 3F4DA 5I3IA 1H7XA 1U33A 1WUEA 4O11A 1XH0A 2A3AA 5DY2A 2XM2A 3M46A 3OLDA 3OLIA 4G9PA 2DZTA 2INFA 4LVAA 3C6CA 4N6EA 3SCQA 3GIYA 3B0YA 4NL1A 4W4QA 4OIFA 1GVRA 2NXIA 1KWKA 2YL6A 3PAOA 2QV4A 2V9DA 4H01A 7REQA 3NO1A 3ZT6A 2DZBA 4G1KA 3WFAA 3V3WA 4AISA 2VELA 3WNLA 4QNWA 1NVMA 4H9VA 1HKVA 2PLCA 2VGBA 2BY3A 4JKKA 4AD0A 1H5VA 2GQAA 3EX6A 5XIMA 4NG3A 3TQVA 2WMIA 5TNVA 4S3GA 2I9EA 3EX4A 1KCZA 2YDAA 4MZ8A 4GGBA 3O1NA 1YXDA 1MFVA 1IEIA 1UD3A 1WZMA 3W1QA 4LGXA 5ECVA 1B3OA 3WYZA 1OD8A 1OFEA 1IWPA 2ZBTA 3D46A 3NUKA 4UOJA 4PFMA 1QHZA 4K7YA 3VABA 2V3EA 2WM0A 3KTSA 3R4IA 4WLCA 3LV5A 2JF7A 3SR7A 3QYQA 2XVLA 1BYDA 4QM1A 3MHGA 1XS2A 2V2CA 2VMFA 3UQNA 2W91A 3KOFA 4IQEA 3FY1A 4EPKA 3LTYA 4DM1A 2XU2A 3TSBA 1GVEA 1OC7A 3KDNA 3SN0A 2DPEA 4J9JA 1XPYA 3BMWA 2Y63A 5H6HA 4KBXA 3MHUA 1JEZA 3H12A 2DZXA 3TFCA 3PJWA 1WAWA 4LQ1A 4FX8A 2XN2A 1YEYA 4D6DA 4DWSC 1I2OA 4MIMA 4OTKA 3CHFA 5LHFA 4LRTA 3BG5A 3KZSA 2Y4SA 1F6YA 4DWSA 2IPFA 1I8JA 1DJQA 2QJJA 3ATYA 3HPSA 4XZWA 4YJ5A 4L6OA 3VIGA 3B8UA 1TRIA 2X1TA 1JFHA 2YR1A 3W01A 5D2YA 2PGEA 2CNCA 3M64A 5JH2A 2E1WA 4IFKB 1QATA 3I4KA 4EANA 4P7QA 5CPMA 3LGGA 1P7TB 1YNYA 1M53A 2HJPA 1RK5A 1U30A 1EP1A 2W63A 2VGGA 3GXMA 1VBHA 2IUZA 2Q71A 5LA1A 4TOQA 4CNTA 1UG6A 3UW6A 3QM3A 5HJXA 4WSHA 4H2HA 4C7GA 3T08A 3BLEA 4DZIA 3R11A 5I6SA 4MNMA 1N8IA 4LSBA 1DL3A 2ZADA 1WAUA 3RRAA 4KFPA 3QLDA 4R9OA 4HIBA 4LNCA 2B7QA 5CG0A 3HQ1A 3GKAA 2Q3OA 3G1DA 1LG1A 3BCDA 6ALDA 3ZSSA 3WLIA 5FL1A 2CWXA 1XLAA 3QW3A 1TWDA 3F7JA 4QJ3B 1RAKA 3B06A 2BY2A 3VMNA 4GIRA 1G69A 3VA8A 1US3A 4DPPA 3QW4B 3CTTA 4AAJA 3MVTA 5KEZA 3CT7A 1UR9A 3NOYA 6TIMA 4MY8A 3W7MA 1XR2A 1BQCA 4S3CA 1FWWA 5LIYX 3WBAA 4CVUA 1XX1A 4JD4A 4V28A 3CPRA 1Q7MA 2EPNA 2I9UA 3H2AA 4GYFA 3C2FA 2CFFA 3HV9A 2JEQA 4GY0A 5GNYA 1M7JA 2Z24A 2FHFA 3PBYA 5A8PA 3WK1A 3UYIA 1GPFA 5BROA 4WQ6A 3RXZA 2HE5A 3I7RA 1Z3NA 3TMQA 3WFLA 3PSWA 3W82A 3C52A 2I5IA 4V1XA 3CAKA 3S9YA 4DXKA 4Q4KA 3BAXA 5C0QA 3EZ4A 1O5KA 1Q6FA 1FHDA 3Q65A 4UZSA 2A3CA 3L67A 1ML1A 3IJ8A 1P0KA 5D03A 3LZ3A 1UP3A 4TIMA 1O95A 4NZFA 3VNMA 3CHVA 3MQTA 1AL8A 2XHYA 4XZMX 1IF2A 1OFDA 4W88A 1Q7ZA 2A7PA 1O6IA 2IW0A 1XLBA 1R85A 4NU7A 2Z4GA 4E38A 1O68A 3S8HA 3WH9A 2VX5A 1ADOA 4IIBA 5G1TA 3QY6A 1FH7A 4XAGA 1QJWA 4ZO9A 4ZOAA 5FL0A 3EEZA 7CGTA 3E0WA 3V36A 2Z2AA 3DG6A 1T5AA 1GJPA 1NDVA 2I56A 2VEGA 2QCDA 1QWKA 3MS8A 3DHFA 2FIQA 4WIWA 2NSOA 4KPLA 1PKYA 4BHYA 3WIJA 3P0WA 2BVWA 1BYBA 3DXIA 3FA5A 3RLVA 2A1YA 3NA8A 4AEEA 2WPBA 1JZ7A 3V5OA 1PO9A 2O4MA 2XWDA 1M7OA 5FKYA 4WD0A 4QJ4B 4RPQA 5L9FA 1I4NA 4IMEA 3GE7A 4E4FA 3DKJA 2X7WA 4DNHA 3HO8A 3GX9A 5D9MA 2J27A 1S5MA 1P6WA 2GVJA 3BZGA 2VUNA 1ZQ5A 2DIKA 4UMBA 3AIVA 1KFWA 3W3OA 3PJXA 3CYVA 4L4MA 1EHAA 3PPHA 2CU0A 1A0CA 3THAA 3W83A 4AF0A 2X1UA 4MDOA 2ZTJA 2YSWA 4MY1A 5LNVA 5DXYA 1XM3A 2NVCA 3ZMRA 3AUOA 4CQDA 1UKOA 1NOUA 2WANA 1ZY9A 3PTMA 1XW8A 3U2CA 3S83A 4NJKA 3LENA 2D22A 4A21A 4H6EA 2WW5A 5LIXX 1KFBA 5IDIA 2E3ZA 3EOUA 1WE5A 2RDWA 1YADA 4UNIA 4AD3A 3UETA 4C6LA 3KOWA 3NPUA 1Q3NA 3PB0A 1GQNA 1I2PA 3RU8X 3QGVA 1IR2A 2FVKA 4P8UA 5HWNA 1BWKA 1GZGA 2DORA 4NXSA 5GPRA 2BG5A 3R13A 1YTDA 4LCSA 2GK1A 5CPQA 2J88A 2V67A 4ATWA 1WKEA 4ZXOA 3G3DA 2YBUA 3S0CA 4C6MA 4FLQA 1X39A 3IAPA 4R27A 1MNZA 4NVTA 1VJZA 1TMQA 2AGTA 3B3DA 4GI8A 1YIXA 2ZUMA 3KBVA 1IT0A 3EKZA 4XZLX 4HOXA 4UNLA 1YDNA 4REQA 4IX2A 4L1WA 2CBVA 4M7TA 3ZXWA 1GQJA 1A5CA 1W1PA 1UWAA 3CTLA 1W2PA 2WSKA 4DBSA 2E6AA 1Q4NX 4RZ6A 4U3AA 4Z2HA 4Y9AA 4M19A 5T9CE 3B03A 1Z7AA 3WNNA 4I6KA 3P6LA 1ZZMA 1DWGM 2V3GA 4O1CA 3SN1A 2F8QA 1XH2A 3Q58A 4IMAA 1HN1A 1XUZA 2XFRA 3NM1A 2D23A 2D2JA 1XLCA 3WUFA 3MO7A 4LC6A 3T05A 3S1UA 4N9EA 4Y6GA 4YCPA 1Z6KA 4AUBA 5HR6A 4PODA 3VKKA 4S2CA 4BF9A 2DZVA 3EEGA 1TZ9A 4NKCA 1XIHA 3SRKA 5C8BB 1Q2RA 2EPMX 2FH8A 3B9DA 1Z69A 4PL1A 1KXQA 3UP8A 1YPFA 3EOEA 1H0GA 1EJTC 3TQKA 5BZAA 1GJWA 3VDCA 3ZVIA 4M29A 2G3MA 2XGIA 1TTIA 1HJXA 2DW7A 5JBFA 3H22A 5AVNA 2FZ8A 3NL3A 3NZQA 4AYSA 1LJYA 2NWRA 5E6ZA 1E6QM 1ONRA 4WCJA 2J6XA 3TP4A 1KCLA 4RNHA 1Q7QA 1HL9A 1GVFA 3G0UA 3E12A 3K4AA 2ISVA 4JTTA 1RH9A 2O9PA 3M07A 4Q8TA 4MYXA 4LFYA 1FCQA 4XO7A 2XPKA 3SCSA 1V7AA 2WNZA 5C9XA 1H51A 1J8VA 1G7VA 4X60A 1FOBA 4NNCA 2V5LA 2Y89A 1AODA 5G1YA 3LHTA 3QY7A 2EGZA 1LDCA 1E6NA 3RCNA 4PA8A 4BCEA 3KLKA 4HNOA 3IACA 1EGZA 3FS2A 3S42A 2JK2A 4TO8A 2B31A 1TWIA 5DMYA 2C14A 3A23A 5FACA 5D30A 1O94A 1VCVA 1J5TA 1R3YA 3E2SA 4AZCA 4JTKA 1WP6A 5E1QA 4HPGA 1YE4A 3P81A 4DYJA 1L2QA 3WLTA 3ECQA 2ZRUA 4WDUA 4HNVA 2EBNA 3AIQA 5B7ZA 3QOMA 4ZZ9A 3OHIA 3LSBA 4JCMA 1JZ2A 1BRLA 3ABXA 3MPGA 7TAAA 2GYIA 4IF2A 2QULA 4Y8FA 1WXZA 3QVQA 1HGYA 4MWAB 1JFXA 1TPH1 4ONVA 4U4MA 3W84A 2VWSA 3G1RA 2Q6ZA 4CQAA 3FAXA 3MP3A 1W0MA 2WPGA 3VGBA 1SO4A 1G7UA 2OO0A 5BXSA 4JTLA 3URBA 3SGUA 3G0SA 3MY9A 3WUEA 1N8FA 4NYYA 3P5YA 4NF7A 3W7OA 4AY7A 4HTYA 3VAVA 1YKWA 4DX3A 1EZ2A 1TTPA 2YCLA 2X09A 1ZHAA 4GFIA 1MEIA 1VPQA 3T55A 3G1SA 2W5FA 1JR1A 1XINA 3QC3A 3KBJA 2XSAA 2FFIA 4TUFA 2VEFA 1UBSA 4JTFA 4K39A 2A0NA 4KQNA 1K9FA 5I77A 3TN5A 4M6UA 4DJEC 2WNWA 3KAOA 1C8XA 3FJ4A 3QC0A 4R3UA 3TE9A 2Q8XA 1I0BA 2OEMA 2VQTA 4DJEA 4HK6A 4EXQA 1VFSA 2VCCA 3P93A 1A3XA 4YMZA 3OP2A 5EPDA 1Y7VA 2INZA 3IIVA 4KEUA 4QAWA 1E1FA 2ZYFA 2XISA 4TX6A 4UFIA 3ARPA 2IXVA 1WCGA 3N13A 3WLNA 3M47A 2GUUA 1UZ1A 3WNKA 2XFWA 3CU2A 1EC9A 1R9ZA 3AHVA 1KXHA 3SIZA 1EF2A 2JQXA 2WZHA 2VQUA 1VIWA 3RRXA 2HISA 3QBUA 3QRHA 4YLWA 3I6TA 5FF0A 4IPNB 3FNDA 3VK5A 1DIEA 3GHSA 3STGA 4JX4A 2F6UA 4GH3A 1F6PA 4OJYA 2VFIA 1B3ZA 3P7YA 1G0CA 1SR0A 3TN3A 1HO1A 1OCQA 2W27A 2J24A 1XSKA 4ROQA 3CUJA 1E9ZB 5CPNA 2F7FA 3W1TA 1V03A 2E0PA 4JN7A 3UR7A 5E70A 4CGTA 1UROA 2GSEA 1UA3A 5H8UA 4X63A 2BXZA 3QSTA 3F4NA 2QDGA 1XIIA 1SM9A 4KMQA 2D24A 1PJ9A 4JIQA 1D7FA 3G1FA 3GXTA 2QJGA 2X1IA 4KCUA 3THCA 1WZKA 1KQYA 4ZCWA 1W8GA 2E7FA 1BSLA 3N3MA 3IIXA 3S5OA 3ZIZA 3H2NA 2GGHA 2CXEA 3C2YA 3F2DA 1W9PA 2OX1A 2PDGA 1DWJM 4YWSA 2JBMA 3BLOA 4JZ5A 5CSRA 3PFMA 4ML4A 4KETA 1OFOA 5K3VA 5GJMA 1WNOA 5LGZA 3B8DA 3FJNA 2YZRA 1BWLA 1A5NC 3KRUA 4MFDA 3U2OA 3IJQA 3EOOA 3CPGA 1VKFA 1WQ5A 1CXEA 4HHPA 2QJNA 4ES4A 5AHIA 1MUCA 4W7WA 5FOOA 3BURA 3W6MA 4QJ5B 3V1HA 3B04A 8XIMA 1DWAM 2ALRA 2Z26A 1XDMA 2J66A 4ATLA 3IIZA 3N3TA 3XISA 3B9EA 1MO0A 4YTSA 3IK4A 1MW1A 3PG8A 3NO5A 1DYSA 3QQWA 1OK4A 5CCZA 1VS1A 4GZJA 3AMLA 1K9TA 5I3FA 3TC6A 4NY2A 1J0KA 5FF2A 2PSNA 1CGTA 2EJAA 2IQDA 2HCVA 4BEQA 1MRQA 1RP8A 4F0RA 4N9DA 1THFD 1YPXA 1IQ8A 1EJXC 5MHBA 3MUCA 2GVGA 1TE1A 3EWDA 4KIRA 1GHRA 2G3IA 4GJIA 4LVGA 2Y7DA 3IJIA 2VC5A 4DAFA 5HDRA 4UQAA 2TODA 5BXPA 2HBVA 2MUCA 3REQB 1FWCC 1DTNA 1BLIA 2JIWA 4NHVA 3S5SA 1W1IE 4HU0A 1SZEA 4O16A 4Q33A 1I60A 4L9ZA 5LNRA 4GABA 3TTQA 4IP7A 5HMFA 4GZEA 4B5NA 2O9TA 2UBPC 4IICA 2BV9A 1ZCOA 4JKLA 1B57A 1VBUA 2J62A 4GUFA 1S39A 3N12A 2ZZ6A 1BKHA 3L0KA 2JFEX 4DB7A 1I1WA 1XYLA 3DOPA 2E68A 1AMYA 2OQYA 1K70A 5HA7A 4M24A 2FVMA 3EB3A 2BB0A 1ZTVA 3DYOA 1OIMA 6A3HA 3MUAA 4GQ0A 2XSBA 4UFKA 3EGJA 2QDHA 2PWDA 1W1TA 1EUNA 3C2OA 3CUZA 3VD5A 2Z7GA 3TYAA 3VNKA 1G4SA 1JCNA 2BMBA 2PP3A 2V5KA 4QBXA 1XFBA 2YFOA 4QP0A 3TH6A 1IXNA 4Y96A 4OOZA 1CZ1A 2P5NA 2PP1A 2A79A 1K8YA 4LW7A 4YVVA 2B0MA 1ALDA 2REQB 1XFCA 2P3ZA 2CEQA 5MKGB 2CZ5A 4WKAA 4D8ZA 2ZXDA 2PDXA 4JTHA 1PX4A 3O0KA 5C70A 2DT3A 2XIMA 4LANA 4J3ZA 2RGMA 2FZDA 2C0AA 1H50A 3CHDA 1MEHA 3MP4A 2SFPA 1V3JA 4RV3A 3LRKA 2VEMA 3JVAA 1SQ7A 4PBEA 1EEPA 1F2JA 2G37A 3UJ2A 5HANA 2QEZA 3WUBA 3QGKC 3RF9A 4WDTA 2ADAA 3N1AA 4E6MA 1GOWA 2F9RA 4GY1A 3ITOA 1XGDA 1K9EA 3W86A 3DFSA 4QXIA 3ARRA 3E38A 4W89A 5F1VA 3IUDA 4JIPA 4N0RA 3FW6A 3UG5A 1VEOA 2DT2A 3SJNA 3I3EA 2V5BA 3KBWA 1P1MA 2PE4A 3R25A 3QHOA 5M03A 2QDDA 3W1AA 2OPJA 5CPTA 5HJLA 2QLYA 5EMYA 5FSDC 3N4EA 2ZDSA 1R9XA 3HQNA 4JYDA 3UU0A 3V4BA 3RCMA 5AHLA 3GS6A 2Z1WA 3HG4A 2G3JA 3QXBA 3GTXA 4MLJA 1HG3A 3NQDA 1KKRA 2FZMA 3CASA 4FXRA 1X97A 1XLMA 3A47A 3NJ3A 4HN4A 1T0OA 3FK4A 4XD3A 2GGGA 3R2GA 1R3SA 1OADA 1XLEA 5A8NA 5DT5A 5A8GA 3VM7A 1D3HA 1AH4A 3CQJA 4BQ2A 3TC3A 1IWAA 4ZOBA 3QR0A 1REQB 5ABFB 4GX8A 1SUXA 4LBSA 3P82A 3GNDA 3CL7A 2IPJA 1WYIA 4YIWA 2HMCA 2J75A 2VDHA 2QXWA 3EDDA 3SFKA 4W5UA 1B4EA 5A1AA 2ABBA 1G5AA 3LPOA 3UGVA 2NT0A 3OGSA 2HXTA 1Q85A 4NIRA 4OBRA 1GTHA 2ZA2A 4E2DA 4WJXA 4E3VA 1DJGA 5CGMA 4JTSA 3IARA 1F74A 1EFZA 3LI1A 3WY1A 1PAMA 5KITA 4AEOA 2VEIA 1XIJA 4BS0A 4OVXA 3WKZA 4NZ4A 2FB3A 4Y9MA 1JUBA 1QK0A 4B90A 3EMQA 3Q94A 4B5VA 2NW0A 4CD5A 1VHCA 4OE7A 2PU1A 3ATZA 2J6VA 4XG1A 4PRTA 5D04C 3ARZA 4IM4A 5HNUA 2P0OA 4RW3A 4QDWA 4HA1A 2ACUA 2IXUA 1RD6A 4C6DA 3BWWA 2VFGA 2RDXA 4JYEA 1QI0A 1PV8A 1I1XA 5CG7A 3TW9A 4J3WA 3OW1A 1CT5A 2WCGA 2IQ0A 2VC6A 3GHTA 4Z2IA 1ZJAA 1SO5A 3S1VA 1OCNA 3CNYA 4MB4A 1SPQA 4W86A 1IIHA 2J7BA 3M44A 4XBKA 4F2UA 3AUJA 5D9NA 3JZEA 4YTTA 4AHPA 3VD3A 1F8IA 1OM0A 3O0FA 4PCPA 3UXDA 2VZVA 1FWJC 3KS6A 4V1YA 1LOSA 4XKYB 4QS5A 2ATMA 1IIGA 4Y90A 2WZIA 1PL9A 2CW6A 5FJJA 2E5BA 3VKCA 4JFWA 3A22A 2V38A 2XFFA 2XDFA 1TJPA 2WAGA 1HKIA 1ONWA 3QPYA 1UQYA 4X9YA 3UWUA 4O28A 3NDOA 3LRLA 1L6WA 3N9KA 4LVBA 2VR4A 4EK7A 2YKKA 2AKZA 1ONXA 3IJ9A 3MDWA 4JHZA 1ME9A 4A8RA 4QDMA 1VEPA 4EX4A 3CUHA 4LBUA 1J11A 2I14A 2Z29A 2GWNA 3AWOA 3MDUA 1V3KA 3B8TA 3WJYA 3TAOA 3MCOA 3M43A 3ARWA 3WO8A 1VPYA 3G6MA 1EWEA 1EA9C 2H3BA 2F6KA 5F4SA 3S47A 5FSEC 5CPOA 4LOCA 1RXOB 4FX7A 4J3VA 1H1ZA 4GI4A 5FI8A 1XYZA 3PZMA 3WQ5A 3BGJA 1RVGA 2XWEA 5D9OA 4UOQA 1B9ZA 3C2EA 3TCSA 1JI1A 5PTDA 1ODZA 1S5VA 4QITA 4NI3A 1BVZA 3ANYA 4DF0A 3G1VA 2J7EA 3MC5A 4TR9A 4I8YA 1ZCCA 4ZBCA 3B0UX 2WJFA 4H1ZA 4O8AA 1DWFM 1VQTA 1Q8AA 5HQLA 2ZUSA 1UOZA 3PULA 1V0KA 1VFTA 1A50A 3P2VA 4F2TA 3NL5A 3KS5A 4FZIA 1OYAA 4CNSA 1E5JA 2ZQ0A 3B0VC 1RVKA 2ZUNA 3QTPA 4MKSA 2HEJA 3TJXA 4IQJA 4N7QA 3EPMA 1NWTA 1QT1A 1FX6A 3UD6A 2OOGA 3OYXA 5GQBA 2YXXA 1DEDA 1G4TA 1KFJA 3R43A 2CHOA 2O7SA 4IIHA 4NZ3A 4EIVA 1PZ3A 3AYRA 5LYRA 4N9BA 2QQ6A 2C15A 4IP5A 1O5XA 1GQLA 4PMRA 2GJLA 3ZWTA 8RUCA 3CPUA 2BS9A 1ZP4A 3W26A 2WMGA 3SQMA 2E9LA 1S2TA 2WOQA 4G2DA 2H3DA 3WLRA 1NWUA 1QW7A 5C9WA 4US5D 2P50A 3K8MA 5A69A 3DIPA 4CKQA 4OBTA 1OC6A 2UY4A 4LTSA 1Q6LA 5CZ0A 3PUGA 2X7VA 4AVOA 1ISZA 3S5ZA 4GO8A 4BI5A 2KZHA 2QVNA 1HT6A 4ZB5A 4Y9PA 2A7NA 2AMXA 1U1JA 1VJSA 1XD0A 3KVKA 2RDUA 4AB4A 5GVJA 2XH7A 1KRCC 2VRQA 4X22A 1KM1A 2PRLA 2PTDA 3MTWA 4RR4A 2GOUA 4QROA 1FUYA 3WF0A 3QF0A 2PLKA 3FYPA 3KHJA 1TVNA 4H83A 4AWEA 4Z1AA 1E9YB 5I0DA 1SMDA 3S2CA 2F2KA 3VKJA 1PKLA 5GJPA 3KW3A 2FZBA 1F76A 2JIEA 1W5OA 4Y2WA 1TTJA 4XZIA 5CBJA 1HZYA 2AAAA 4KS0A 1AW5A 1R2SA 3RG6A 1TVLA 4GD0A 5FEZA 3L4YA 1E1CB 1S2AA 1OZQA 2V8ZA 1Q5MA 4DBEA 2Z1KA 4LY8A 1MSSA 3SCPA 1J96A 4F9JA 1FWTA 2MANA 3LUTA 2QIIA 1UA7A 4GVGA 3E49A 4U33A 2B7NA 5G4WA 1UIOA 3T4WA 4DJDC 2RJGA 4MAVA 1NEYA 4K2SA 3TQ0A 3U57A 1H3GA 1OABA 2UV8G 1SR9A 3U4FA 3LOTA 4A22A 4RXGA 2W9MA 4DZAA 4DJDA 4UXDA 1VRXA 1TJ2A 3TNOA 1S5TA 3PZNA 1RA0A 4L1GA 1JZ8A 1FWFC 3UWEA 4GISA 3TIMA 3WQOA 4D6EA 5BOEA 1ZUAX 3LCIA 2WC7A 2X1RA 3D47A 1SFJA 3C2RA 1BKSA 6REQB 4JQ2A 4DAIA 1AH0A 3CUFA 4TXEA 1DJXA 4PMJA 1GZJA 2YXGA 5I3DA 1AA1B 3UXKA 4GX9A 1E73M 3P60A 2GQ3A 2YGYA 2YDSA 4GYPA 3TSDA 4AH7A 2CIPA 1VLWA 3HFYA 3W2MA 1W1A1 2V0TA 4A8LA 3B4UA 3T0AA 4TX9A 2QHAA 2VI0A 4H9XA 5H8MA 1JDAA 2YDQA 4Y9OA 4AWTA 3GB6A 1E5NA 4YVPA 3N18A 3VVGA 1CIUA 2DVTA 1EGVA 1W1VA 4GLEA 1FWGC 2EPHA 5ECUA 4MTVA 2NUWA 5E09A 4LAUA 3H53A 2E4TA 7REQB 3NPWA 3WLKX 1Q6EA 5KZEA 2G5WA 2QCCA 1UKSA 2RHGA 2Y24A 2OGJA 4EAYA 4UQCA 1K8CA 3ANUA 1NFGA 1TIMA 1TPC1 3ANVA 2KAUC 3KCOA 1KTCA 5D09A 3CWNA 1A0EA 1J01A 3PZQA 1HW6A 1JVNA 2EG6A 4MWAC 5E5CA 4D1IA 3W88A 1UCWA 1VENA 1J0ZA 1W9VA 4ZENA 4F0SA 2GQ8A 4H9ZA 4O0ZA 1EIXA 4MWAA 1B30A 3APTA 4XV0A 5CPLA 3OODA 3VXGA 2E8YA 4TV5A 4G7FA 4PRWA 1SW3A 3LM3A 4Q4RA 1J18A 3TOYA 4FPSA 3PPFA 5C7VA 3NM3A 4Q8VA 3S2JA 3GUGA 4ICNA 1V6YA 3WFZA 5LIUX 7A3HA 4GA8A 1BTCA 2ACQA 4ZODA 4M81A 1UPMB 3F1QA 4F4RA 4AZ6A 3WSUA 4F9DA 1A5OC 3DN5A 1O12A 3ZT7A 1JYWA 1U83A 3CGTA 2QCNA 1GW1A 2ZRYA 4UTHA 3GM8A 3RITA 5LNWA 2BOEX 5DXXA 4GIEA 3RLHA 4GNJA 3VU2A 1TSIA 4EVZA 5LGXA 1AW1A 4C7DA 4D6IA 3P84A 3VNJA 4YYCA 5A6JA 1FWEC 2A2IA 4LS1A 2D2HA 4HKPA 2NQ5A 2YW3A 3PBGA 3U5UA 3HTWA 2VZOA 2JALA 2Z2BA 1NH6A 1SJDA 3WNMA 1CLKA 1OD0A 3P74A 4JTUA 4LAOA 1L6FA 4N4QA 3RJXA 4K8GA 1GYMA 4I9TA 4KRTA 4GK8A 1UWIA 3SRFA 1P4CA 3P80A 1VGAA 1GORA 1CTNA 4D71A 4HYW