4I90A

Structure of the n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus bound to choline
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
302
structure length
302
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
total genus 121
structure length 302
sequence length 302
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i90A00
2OTDA 3MZ2A 1DJHA 4GNKB 1XX1A 4QJ3B 4RW5A 3H4XA 2ZKMX 1DJZA 1DJYA 4F2UA 1PTDA 3PTDA 2PZ0A 1V8EA 1DJXA 1PTGA 5T9BG 3QR1A 4I9TA 4I8YA 3QVQA 4I90A 3EA3A 2PTDA 3KS6A 4Q6XA 3I10A 3EA1A 1AODA 4OECA 3KS5A 2OR2A 4I9MA 5PTDA 4R7OA 5T91A 1DJGA 3RLHA 3CH0A 1VD6A 3NO3A 6PTDA 1DJWA 3V1HA 4F2TA 4I9JA 4QJ5B 4RW3A 4F2BA 1ZCCA 2FJUB 1QASA 3V18A 4QJ4B 3OHMB 1DJIA 3L12A 1T8QA 1QATA 1GYMA 3QR0A 2F9RA 3RLGA 1YDYA 1O1ZA 3H4WA 4RV3A 3V16A 2PLCA 2ISDA 3EA2A 2OOGA 2O55A 5T9CE 2P76A 4S3GA 1T6MA 4PTDA 7PTDA
chains in the Genus database with same CATH superfamily
4NZFA 1UJQA 4B16A 4KEZA 4UTKA 1E1FA 2YJQA 4TUFA 1XKJA 2D69A 1H60A 1PZ0A 3EWXA 1E70M 2YXGA 1RALA 3ARZA 3OHMB 4HOZA 1AQFA 3SCOA 4HU0A 1EJUC 2O9TA 1NJJA 4DWSD 1E51A 4MOZA 2WHLA 2Z00A 4YCPA 1ZU8A 2WMHA 1TPVA 2PRMA 3DI0A 2IS7A 4OECA 1UQYA 3WF0A 3KLKA 4HYWA 4H8VA 3HG2A 3LPGA 4D9PA 4E38A 2CHNA 3BWWA 1XP3A 1T0OA 1TO3A 1WZLA 3MSDA 5I24A 4OFCA 4RLIA 3W7GA 1FBAA 5K3VA 2PI6A 3BJFA 4Q8UA 3VOHA 4LUJA 4ADSA 3DN5A 2NX9A 1PKMA 1UOKA 5FL1A 4U2ZA 4ZE4A 3WLTA 4JKLA 2DQWA 1EWEA 3PZVA 4RW3A 1AZ1A 2DEPA 3WQ5A 2EKCA 3QR3A 5E6YA 2FIQA 3MUZ1 2WLYA 1LOSA 3AZRA 4UCGA 4DZIA 1M41A 1T8XA 5M5DA 2JEPA 5FA5A 1TREA 1Q6DA 3N19B 3DHUA 3IGHX 3DFPA 1CWYA 1REQA 3WK0A 4R7JA 5CQ1A 5HULA 4ILSA 3BC9A 3KOZA 1Q65A 1F8IA 2OT0A 4XAGA 5FAJA 4W5UA 3GXPA 2PB1A 4MKSA 3LK6A 4RZ4A 5CPQA 2VWSA 4IFKB 8A3HA 4XISA 2YW3A 4HU4A 4RPPA 3WF3A 5J5DA 3F4NA 3LGGA 4KIRA 1T96A 2CXGA 3W7PA 1XG4A 3LD5A 1M65A 2ALDA 1NQ6A 1QPQA 1F3WA 3M0VA 1E73M 4DYJA 3S5ZA 3QPEA 1ZFJA 2O9RA 4NI3A 4IIGA 2QAFA 4K68A 1VFHA 3I3BA 2WMFA 3S46A 2GGHA 3LV5A 4UOZA 2OEMA 4IGSA 2RDXA 3BLDA 1IV8A 2DUAA 2QDDA 3MVTA 1ZJAA 3A64A 3LQLA 5TF0A 5EMMA 3CS2A 1NAL1 2GJXB 2WSRA 3QGVA 2XSBA 4ROPA 4GRSA 1BG4A 1HJVA 3HN3A 2FB3A 1B30A 4UC5A 1MXSA 1EUAA 1ML1A 3VNIA 4GUFA 3W26A 4IFRA 5U7SA 4N7QA 1FTXA 1O5XA 1G4TA 4Y8EA 1G9HA 2F8QA 4GGHA 4A3QA 2OCZA 4O4VA 3R7MA 4LT9A 2C8NA 4UTFA 2XIJA 3WDJA 3C3NA 4DJEA 1JD9A 2J8FA 4A8RA 3BOFA 5FI8A 2VI0A 1UH4A 1VR6A 3W53A 1GPWA 2ZRVA 2RFGA 3MJMA 4HCDA 1D7FA 3TUUA 1OG0A 2J79A 1K8XA 2ANUA 3G1AA 2YL6A 1YTEA 3N6JA 5CG7A 3GH5A 3NQFA 2GUUA 1KFWA 2NWSA 1XYLA 4DJDD 5D9OA 3VE7A 2OEJA 3AU6A 4FALA 2QPSA 5JH2A 3EWYA 3IRDA 1T41A 1RCOB 3UZXA 3S2JA 2WZTA 2CLKA 1LL4A 5D02A 4JKKA 1KFJA 1XC6A 1ZBKA 4LANA 3SCVA 2QULA 1C8YA 4AX7A 3QLDA 3U4AA 2C18A 4I9MA 1UKPA 1U1UA 3RX4A 1EXBA 2DZSA 9XIAA 3IIXA 2HMCA 3N3MA 1LT8A 2GOUA 4F40A 1ZP4A 3MZ2A 2XSXA 2DZAA 2OQHA 1LBFA 4FNRA 2PTYA 2ACQA 3K46A 3NO3A 4CU8A 4JTRA 8XIMA 5K4XA 2P76A 1QI5A 3IJQA 3VKAA 4CD7A 2GJNA 1DBTA 3KVJA 5DO8A 4D71A 2QDHA 4FI4A 4QIUA 3BGAA 3FSUA 2GUYA 3L4ZA 4Z08A 3UG3A 2ZZ7A 2PDLA 3STFA 1FWFC 3AS3A 2D22A 3M44A 2P10A 1E55A 2XUCA 3U6WA 3CMJA 4I8YA 4FR6A 1ZAIA 3H2EA 1O5QA 5ABHA 4W8BA 2HQAA 5DCBA 4K38A 3XISA 2AQWA 3P8JA 4YVVA 2BXYA 3HQ1A 2VM8A 3C4UA 2ZA2A 1P6BA 3NQBA 5LIKX 2NXHA 1M01A 1KRAC 3HGSA 1NFPA 1TYGA 3IUDA 4NYYA 4XB3A 3GC2A 2PWGA 5E9XA 2RHGA 1FH9A 3H2NA 1FQ0A 1Z32X 3B04A 2INZA 3TQ0A 1AH0A 1WB0A 4GJIA 2QCNA 1TIMA 1YDVA 3N6HA 2OEKA 1A3WA 2ZKMX 3MHGA 2EPMX 1HKKA 2R1LA 3S1VA 2V67A 1W5PA 2X2YA 2Z2AA 4QG6A 4JTEA 2XVGA 4S3EA 2XFRA 4BQ4A 4C5YA 5LYRA 3L5MA 2WVSA 1H62A 3LRLA 4MAZA 5G1TA 2W27A 1NDZA 1TUXA 5BXRA 4PUJA 3I6EA 3ABXA 4QXIA 2ZUMA 3O06A 4PMJA 3D47A 2PDPA 2XIIA 1XUZA 4EPDC 1BRLB 1J18A 1H7NA 2ADAA 3APTA 2ZX5A 2INFA 3V5FA 1GHRA 1BPLB 3PBUA 2O7QA 4IFKA 3A47A 3KOFA 5BWAA 2F61A 4HU3A 5CJ5A 3IGUA 4JTHA 1V3MA 5PTDA 1TWZA 4MADA 1V6XA 1CZ1A 3ZJ7A 1O6IA 1DJIA 1XSJA 4PMUA 2YA2A 3VKKA 4WF7A 2DFAA 4CD8A 4DJFA 5C9XA 2V3FA 1UC4A 2QT3A 1E6XM 2GGGA 4TR9A 4K3ZA 3V1PA 4GWEA 1KWGA 2GPTA 4BA0A 3W1UA 1I1XA 2YBVA 3BLFA 4O15A 2ZZ4A 3WN6A 1JZ5A 4AY7A 4JHMA 2OZTA 2QCHA 4L4MA 4NNCA 4DBEA 3IJ6A 1VYRA 5FESA 1GEQA 5D2WA 3WLPA 4UTJA 3ZSSA 4RCXA 2FDMA 2PSNA 3GR7A 1XICA 3EA3A 3LNPA 2GJXA 5EPDA 2HZGA 2EKGA 1W5OA 2Z7GA 4H83A 4OJYA 1EYWA 3BOLA 3COTA 4LNYA 4H8NA 3FOKA 3PG9A 3VUPA 3LHWA 3G1RA 1OHLA 4QQUA 4JQ3A 1IZKA 4G6CA 3W3OA 5LNUA 3C8FA 3EDJA 4O1EA 1PPIA 1B1YA 3ZR6A 5BMXA 3VIHA 3EPNA 4KWUA 3W76A 5ENLA 1X1OA 4O50A 3PY2A 1IQ8A 4KCWA 1JUBA 2QGYA 3CHCA 1W6TA 1TWDA 1OGGA 1EJ7L 4TMCA 4M5PA 2PWVA 1B5TA 3VAVA 3R12A 1BXCA 1OFOA 5E0KA 1TZ9A 1J0HA 1NOUA 4BY3A 3USZA 3UBPC 4YMZA 3R8HA 3GSMA 3H23A 5I6SA 4JIEA 1GVFA 3AWOA 2PDMA 3H53A 3P7YA 3D3AA 1QNVA 3SAZA 3G1FA 1RK6A 1QPRA 5F2LA 3UPMA 4PB3A 2Z2BA 3VGGA 1UH2A 3SCQA 4D6GA 4ACYA 3BLEA 1ODUA 1XDMA 4O1AA 3UVAA 1N8IA 4LUSA 3ATYA 1R3RA 5F4SA 4JL1A 4ONVA 1X6LA 3BANA 1RA0A 3HG4A 1DHPA 1OX4A 2NQ9A 1KBLA 4DUXA 1XH1A 2PWEA 2WWDA 5BXPA 1M68A 2QS8A 2E25A 3EGJA 4L64A 4AMAA 2CLMA 2PLMA 1W3LA 4S3GA 1T40A 4AD5A 2A3EA 1SJCA 2OX1A 2Z25A 3QQ0A 5I09A 3SSJA 4HZ8A 3R5EA 2QDEA 3SY5A 3CHEA 1VS1A 4AD2A 2DU2A 1RY8A 4QEHA 3N04A 4X2PA 4UNLA 2R1KA 3FKRA 3JUGA 1S5TA 3QOKA 1KRBC 2MUCA 3NZQA 4M7TA 3WF4A 1BF2A 5A2AA 1DXEA 3M5VA 3SGZA 3OBAA 3EMZA 2Y61A 1GJUA 1GW9A 2ATSA 2A3HA 4QE4A 2BVYA 2QDGA 1RLCL 3MI3A 4HHPA 4GVFA 3E9AA 4N4QA 1TVNA 2ISWA 1WQ5A 3NQGA 2C15A 1O1ZA 4AWSA 1DKWA 5C9WA 4ZQOA 3HA1A 3FXYA 1CB2A 3EA2A 4PH6A 3RM8A 4G5DA 4UTUA 5CGMA 1N82A 4J3SA 3VABA 2RDUA 1R87A 1XM3A 3SZ8A 1F5ZA 2CBVA 1H41A 2AAMA 3IUIA 3B8DA 1K02A 2RJHA 3VIPA 2IQ0A 1QW9A 5JIPA 5I0DA 3L4WA 3H4XA 2J88A 2Y89A 3LRMA 1TE6A 1QWGA 1U33A 3NWRA 3FDKA 2ZX8A 3REQB 5KITA 1TV4A 4CCCA 4E4PA 2J9ZA 1L6YA 3U57A 1CXIA 2V69A 4DJDA 3HFYA 3UESA 1AFSA 1KM4A 2J8TA 3CM4A 3VFLA 1P4CA 1YHTA 1S2WA 4OOUA 2XN2A 5I3IA 4EWND 1UKOA 4HQVA 3HU7A 1IXOA 3UWQA 4XG1A 2AL1A 5DLCA 3WJYA 3LCGA 1TE1A 3PUDA 3VD3A 1Q66A 3M0KA 4MYAA 2A3CA 3H21A 3TLLA 2ZX6A 1ITUA 4H00A 1U1JA 3M5YA 3G24A 3MHUA 2J25A 4NVTA 5U4NA 3TJXA 4AIOA 4JTJA 2VCAA 4JYEA 3OW1A 4O16A 3WNKA 2ZBTA 2ODOA 4Z2JA 3DG6A 1DWJM 4U5KA 5M17A 2YCJA 3WF1A 1J5SA 3TJIA 4DJFD 1TV5A 4HTYA 4K2SA 3QPYA 1OD0A 1WOAA 4Y7EA 3T44A 4JOMA 4ENLA 3ABRA 3BE7A 4PZVA 2VX7A 2GSJA 5CPSA 3NVTA 1Y0EA 3M64A 4QSFA 1XGDA 3OYXA 3UU0A 3L23A 1LRQA 2W62A 3GNPA 1KCLA 5H8PA 4YTQA 5F4WA 1J11A 1G69A 2EEXA 3HURA 3N34A 2NLYA 1EO5A 4RNFA 1AL7A 2PDXA 1RD6A 3TJ4A 3SCUA 3MU7A 2TSYA 1UD5A 1EPVA 3A5VA 1R9YA 5A8MA 2J7BA 4C60A 1RVKA 3W7MA 3AI0A 2VOMA 3THAA 1GCYA 1CGUA 1PAMA 4YHGA 4KQNA 5B7ZA 4HD5A 3LDVA 4E2VA 4LB4A 3VVGA 4ERGA 1FH7A 4PUNA 3W6MA 3B0YA 4DLFA 1UWQA 3KDOA 5I23A 2P8BA 1RJQA 3R6IA 1E1CB 4ML4A 5I7GA 3WUEA 3N17A 4N9EA 1V3KA 1AMKA 4P8VA 1CEOA 2I5QA 1KM0A 4GO8A 3W0KA 1CECA 2CZ5A 4JQ4A 1OB0A 2FMNA 4ICCX 1G4SA 2TODA 3N73A 1IHIA 3FEQA 1X6UA 3ALFA 4HNOA 5A95A 1LG2A 2F6UA 3CASA 3TK7A 4GA8A 3H8AA 3CU2A 3S5OA 4J1OA 3AZSA 3V36A 1ICQA 4JX5A 1EFZA 1MSSA 4O0KA 2A3AA 2AGKA 5CJMA 3DHFA 2WSQA 3OLDA 4WDTA 2Y5EA 4XBJA 2C1HA 5D38A 1A3HA 4AH7A 1WDWA 1MZRA 4MNJA 4C6DA 1KKOA 5KSWA 4A22A 2ZADA 3E0WA 2ZZ5A 4W9TA 3L21A 3LXBA 3B8SA 2H9AA 3O6DA 4M19A 1ONRA 2A6NA 2WHKA 2CLLA 2ABBA 3LMZA 1UCWA 1QDSA 3OA3A 4J40A 4IMEA 3T0DA 3H54A 4PUEA 3AO0A 4UWMA 3H7VA 4DXXA 5AZ0A 3VOJA 1TWSA 3UJSA 5CC7A 3WNLA 2BVDA 4HPXA 4ZSUA 1PBGA 1VCFA 8TIMA 1WKDA 2UV8G 3WH8A 3H2AA 2W0UA 1M53A 4GD0A 4NT0A 4PCFA 2VGGA 3B3DA 4BI5A 5EBUA 5D8ZA 3PZTA 2YCLA 7PTDA 3TU9A 1OX6A 3SSZA 4I3GA 4IJRA 3THQA 3QHNA 4OVXA 3NNTA 3G5EA 4L1XA 3LRKA 3U2CA 2X42A 4A21A 3DUGA 1U30A 3L5AA 2PURA 1LYXA 1MEHA 2IKGA 2VP8A 4J3UA 5DQPA 4ZFCA 3FS2A 3QY7A 1OD8A 1WYIA 2QJJA 2XGZA 4AZGA 2HPMA 4AAJA 2AKMA 4PBGA 2WJFA 5C8BB 3AIBA 5G2HA 2ZOXA 2VFHA 1SO3A 2ZVRA 2XFWA 4FX6M 5HA7A 1NOFA 5DMNA 4UTHA 2ZXDA 4LF2A 6ENLA 1BFNA 5DT7A 2Z7KA 2E8ZA 3L5LA 3WQ4A 3AAMA 2YW4A 2V5CA 3ABZA 2RUSA 4K1WA 5FEXA 4W7WA 3D6NA 1IZJA 5CCZA 3KHJA 1EA0A 1GOQA 1E9LA 3W75A 4BEUA 3GQYA 1WKEA 2WNZA 3GD6A 3E2QA 4GIYA 3O7UA 5A8OA 4F8XA 4FOKA 3AYTA 1VBJA 3LXAA 1VFLA 2OB3A 4J28A 1V0KA 1E71M 3ANVA 1YBQA 2WNQA 1F05A 2VZUA 3O1NA 3ME3A 4DEFA 4BK9A 4HVXA 4FLRA 2VC7A 4HMNA 1A0CA 1H5VA 3S2LA 4XAFA 5CC5A 2GQ9A 4JN7A 2WANA 4GLEA 1FKXA 2I16A 4D6IA 1YE4A 2HEJA 1E0WA 1WZKA 3OZMA 3OZPA 4LS2A 3CV2A 2PDIA 2QIIA 3W73A 1OFRA 5C70A 4CU6A 1FFRA 4GFIA 4C1NA 4IJCA 1FWEC 3WO8A 1P0KA 3H4GA 3GNDA 5BWFA 2HXTA 1KO0A 2P8CA 2OLHA 4GISA 2ALRA 5HINA 4P8XA 3LCXA 4ZXOA 1NH6A 4L80A 1PIFA 2Y0FA 1NF0A 1KW1A 5A6AA 1UR8A 4PTVA 3N11A 1HTIA 3N18A 1HW6A 1IT0A 3RLGA 1N8WA 1E3ZA 3NEHA 1ZQ5A 4GY1A 1A4LA 2VFGA 2QMJA 1QNPA 3EX2A 2ZZ3A 3AOFA 3WNPA 3WLOA 4ECLA 3TE9A 2J8GA 4MB3A 1N2VA 4N4PA 2A7NA 3DHPA 4IPNB 3NR0A 2OLAA 3MZNA 3KBJA 2WVTA 3KHDA 3W27A 4Q8PA 3P80A 3USBA 5HPOA 4S3KA 3JZEA 1ZAJA 4E2BA 4CN6A 1JZ6A 4UFKA 4I5RA 3B9AA 3GUWA 4R9XA 2TPSA 4X3ZA 2PDBA 2WJDA 4GH3A 3GLCA 4ZB2A 5AHNA 2OJPA 4UMCA 4YLWA 1XRFA 2G3NA 4UTIA 4IP5A 4PSPA 1JD7A 4JTGA 3GZ3A 4LU0A 5EMLA 2ACUA 2GVYA 5CLTA 4QG9A 4WEVX 3AFBA 4KMQA 3UJEA 5FCZA 4H9TA 1TR1A 2A2IA 5HMFA 1A80A 3CL6A 5C54A 5FJOA 1Y5VA 5LHFA 5HPCA 1H0GA 2ISFA 3LTPA 4B4FA 3UY7A 1H7PA 4K8EA 4CQAA 1Q4WA 2FJKA 1RCQA 2AOSA 2OZ3A 1IYXA 4DWSA 2OFJA 1F6YA 3IV3A 1FWAC 2FZDA 1GOXA 3GBDA 5BRQA 4GC3A 3I65A 2PC4A 4QSHA 1NWTA 4M6UA 2R94A 4RW5A 1J0ZA 1SZGA 4US5A 1H51A 1XQLA 4MM1A 1JI1A 2AQVA 4MSSA 1Q5MA 1VFFA 2JFEX 2C19A 3W25A 1AODA 1AUSL 2DH3A 1AK5A 1H7RA 1RAKA 4EVZA 4H6EA 2XINA 3SUWA 4AG0A 1EC7A 2ZYFA 5EA9A 2POTA 1EYEA 2OELA 2UZ9A 1EGVA 1K7FA 5D03A 3O07A 4MTVA 4B3LA 1XH2A 2E6AA 3NQAA 3DBPA 3NDYA 1SYTA 1SFSA 4YU1A 3LHZA 3VIIA 4UOJA 1ZBCA 2WJZA 4Z2HA 4HZMA 3UGRA 4QX4A 3TDFA 2J47A 1TVLA 4I9AA 4PL2A 2HS6A 3W7QA 1YW1A 3NCOA 3F1QA 4WSKA 2BOFX 5EBAA 1CGWA 2Y5JA 3IJIA 3CQKA 4EE9A 4M81A 4MLJA 1SR9A 3IJ7A 1X1ZA 1B4KA 3WLMA 2HDJA 1UMYA 3WK3A 5IHSA 4LRTA 2QVHA 2C91A 3QVQA 3IGXA 3QFWA 5CKSA 1H7WA 3L9CA 5AOUA 2O7SA 4RNHA 4XAZA 1SSGA 4FOUA 1SFTA 1S2TA 4LQ1A 2EPHA 2BGNE 3L67A 1LLWA 5FSDC 1VJIA 3ONCA 6TAAA 3CQHA 2Q8LA 3PWAA 1MQPA 3T6CA 5JVLA 2BBFA 3VC5A 3BUVA 1KLZA 2CETA 3WBXA 2IQTA 2E6YA 3A9BA 1NFBA 2VQTA 3R11A 3HGJA 4W7UA 4UZSA 3DYOA 3CZEA 1O12A 1R46A 3QV6A 4HSNA 2ZE0A 3C2EA 2VUYA 3BJSA 5A1AA 3F2DA 2PCQA 4DWSB 5DT5A 4ZTXA 3TTYA 3ZR4A 1YIXA 4QAWA 3N4FA 1K03A 2ZA3A 4LBSA 4J7RA 5HQMA 4IJBA 2ZFAA 3UA4A 4UZUA 1W1VA 4ZXLA 1J93A 4Q6JA 2B81A 3GC5A 2BV9A 3EPMA 4V28A 1XHGA 2CLOA 1VLIA 2HVMA 3EKZA 2CESA 4QP0A 2W61A 2FQIA 3R89A 1E4NA 4HKPA 1C8QA 2GK1B 3G6LA 3SCWA 2ZTJA 3BGJA 3KOXA 1UOZA 1M6JA 1IR1A 3AMKA 3FJLA 1EF2A 2O9PA 1JRCA 5ABTA 3CYJA 5I3KA 1OINA 3ARXA 5A6BA 3LXCA 1QOXA 1X7IA 3MBDA 3B0PA 2PPGA 4H01A 2IKHA 3F5KA 1QU4A 1GONA 1UWTA 3QMSA 2DW6A 5I3JA 1GOKA 1IZCA 1FWGC 1XYCA 2Y8VA 1P0NA 3W83A 4Q4MA 3AS0A 3LSBA 3KCJA 1IIGA 2PC8A 3W01A 3G0UA 3V35A 2OO0A 1CXHA 2OOGA 1NOWA 1M3UA 4CQCA 4JTQA 1A50A 1M7XA 3LI1A 3K13A 4DX3A 2OYLA 3K4WA 3QV9A 3NOEA 3PBGA 1O5RA 1EF3A 1E15A 1QK2A 3I7RA 3VD5A 3AIWA 3ORWA 2Z26A 3CQ0A 1CCWB 3WNMA 4FNUA 3VZXA 3CZGA 1C3FA 2GDVA 4G1NA 1KM1A 5FOOA 3K4AA 3VOIA 4MJMA 3DESA 3WQ8A 2DZVA 1U83A 2A3LA 2IPFA 3LGDA 1S3TC 3VDHA 1MDRA 2PLJA 1EPXA 1UH3A 2GJPA 1WAWA 1VFSA 1UD8A 3HG3A 3EXTA 1DORA 3ARVA 3WFAA 9XIMA 4DWDA 1GOOA 3IJDA 3O05A 1BVZA 3W88A 4GZJA 3VNJA 2HE5A 2PDGA 3TN4A 3LOTA 3ABOA 3CTLA 1FA2A 1MFUA 4IT1A 1TPDA 1V0MA 3IK4A 1MW3A 1TV8A 1LG1A 1W17A 5K9DA 1BD0A 4HJWA 2QCDA 9CGTA 2Y62A 4OKDA 3N2CA 1OWQA 4RXGA 3M7SA 4KESA 3EDKA 3EB2A 1MW1A 3T42A 3CJPA 2X16A 3PB0A 1ADSA 4DJDC 3QHOA 5DXXA 2XSAA 2FB2A 2PRLA 3WENA 3KBNA 3KZSA 1R7OA 1KGWA 3KCLA 4YL2A 1MMFA 3G8EA 3L7RA 2OSYA 3BGGA 4Y9AA 1LDCA 2G3MA 3T05A 3U7BA 5H6HA 2VRQA 1AQHA 1WDQA 1EJRC 1HT6A 3WUBA 2X1IA 2ZDSA 4EP8C 5EMJA 5E5CA 1GOMA 1LQAA 2JKEA 1JNEA 1FHVA 4IQLA 4IPLA 5IOBA 1E6SM 2QUUA 4XSMA 4QRNA 1YX1A 4DO6A 1DP0A 1W1PA 2CITA 4FEZA 1JXJA 2DH2A 3I7SA 4WXYA 1LQ2A 4XUYA 4B9YA 3ZT6A 3DGRA 3N2XA 3KX6A 3W29A 4AWTA 2WC7A 1E0XA 3DERA 2FZMA 4GCAA 4BF7A 1GYNA 1W3IA 3WDIA 1F3TA 4DBWA 2VVSA 1KFCA 5AHEA 5AHFA 1TA3B 3OU8A 3VI2A 1H2JA 3G1SA 4PL1A 4LAKA 3QQ1A 1EBHA 1GVSA 4HN4A 2J7HA 1RVGA 4CCEA 2E3ZA 1E0UA 1S2AA 1K7EA 1CTNA 1GOWA 1AJ0A 1SMDA 5A6LA 1TPEA 3LHYA 1DPMA 3QQWA 1FWJC 4EACA 3E0IA 2BOEX 1W8SA 2QW5A 3LMYA 2W3ZA 3KL3A 1V5XA 1BKHA 1XD0A 3H22A 2H6RA 2VT0A 3QR1A 4O1DA 2VYOA 3PTQA 3WDHA 4GXMA 1W1IE 3GNXA 3VX1A 3CQJA 5EFDA 4Y9MA 5C0QA 2J7CA 4DWSC 4C7GA 4H3DA 3M0ZA 4OBTA 1E6ZA 1EX1A 1UBSA 1JUEA 4B2DD 4FZIA 3TYBA 1PTGA 1YDOA 4C6BA 5F1UA 3NFUA 1FWWA 4M1RA 1MVYA 1SZRA 1XLBA 5HNNA 2E4TA 2XH0A 3KE0A 2OLSA 1ME9A 4TO8A 4GUIA 5TNVA 2QVNA 4GYJA 3G3DA 3GB6A 3K8LA 1ME7A 3B8UA 1EOKA 5KEZA 2X2GA 4OUEA 1R2SA 2QNEA 3F03K 3TTEA 1FCBA 2EAWA 1FVPA 2VVNA 3SM0A 3VZYA 3ZIZA 4CD5A 4HT3A 4PRRA 3DHDA 1OX5A 2BP1A 3WQWA 3LHVA 3DKLA 1GVQA 1EGMA 3B05A 2FDSA 2VEFA 2ZWZA 2GSEA 3N15A 1Z69A 1M04A 3LS9A 1G01A 1UWIA 1RV8A 1YMYA 3TA9A 2V2CA 3ZFHA 3STPA 3OIXA 2DIEA 1VHNA 4QDWA 4W8AA 3TYZA 4CNNA 1TR9A 4WUIA 3OPSA 3I4EA 3KCOA 4CUCA 2VRJA 4UIOA 3OHIA 3BAJA 1GUVA 4IIBA 4IQEA 3ZJ6A 1DOSA 4L9YA 4PUDA 3GW0A 2YR1A 3H2CA 4F0KA 2PD9A 3W1QA 4QAIA 4QJ3B 3HPSA 1OFBA 3ONBA 3RM4A 1I2OA 3AHZA 1GKPA 1QT1A 1TTQA 4US6A 1HX0A 2VURA 3BCJA 1DJGA 3A22A 3MBFA 1Q2RA 1QCWA 4W89A 1WP6A 5ABFB 1TQXA 4N9CA 2OG9A 4K1GA 4B92A 3KUMA 4JTSA 3S6DA 4GPNA 1XINA 4X0VA 4O54A 3WEOA 1E9YB 1HKJA 1R30A 3HGOA 1Q4NX 2WSPA 4DNHA 3EZ4A 1ICPA 3GU2A 4H6QA 4IIFA 4IL0A 4AIBA 1OM0A 3AMCA 3NL2A 2Z27A 2E1WA 3RO6A 3RN6A 1UP3A 4GIAA 5AC8A 4MFEA 3W7NA 1I0BA 3VNLA 3GXMA 5DCEA 3LM7A 3WMBA 1A49A 4I9JA 3SN1A 1ALDA 4LWWA 2X1TA 2DT1A 1W3TA 1J96A 2Y7FA 3R1ZA 4AVNA 4GE8A 3ZR5A 4H6RA 1XIGA 3GW3A 3L4VA 5M3WA 1LOLA 2E9BA 3BK0A 1XIBA 3GDRA 3SIMA 1DIDA 1DQXA 3LX9A 1OFPA 2ZCGA 1XC4A 1G6CA 3JVAA 1OBAA 3LN3A 3UXAA 3HZ3A 3CAKA 1JQXA 4P8WA 4UMBA 2J62A 1TIWA 1QTWA 1GPFA 1V4YA 2QCEA 1CXFA 5JU6A 1DV7A 3ITYA 2W66A 3OGRA 4O0ZA 4ERIA 4LFYA 4HMEA 4NUWA 2X40A 3BQ6A 2W92A 2YZ5A 1PX3A 1NDVA 4DQWA 5I78A 1FCQA 4U4MA 4X63A 4WOQA 1WDPA 4EK7A 2JQXA 3B4YA 4FLSA 3SCSA 1ITXA 3URAA 1IT7A 3NQEA 5A2CA 5C5YA 4RZ6A 3P2VA 1W9XA 4LYQA 2WWCA 1FXQA 4AFYA 1HL8A 1XLGA 3M0JA 1EB3A 5FEPA 8CGTA 4IPIA 1YYAA 4Z17A 3N29A 1G0CA 1UKQA 3LGEA 1M9HA 3JW7A 1JXKA 5I3FA 3CYVA 4DJFC 3K2GA 2GDUA 1B2YA 2WNNA 5ABEA 4MJ2A 2PCEA 2W5FA 1TZZA 3E6EA 2VGBA 1AJZA 2BGSA 4WZHA 3AUOA 3MTWA 4ZMGA 3M4HA 2BSLA 3E74A 4QLJA 1FXPA 5MKGA 3CZKA 3PTKA 2HNEA 4P7NA 2OWWA 4KWSA 1ESWA 2PP0A 3WNNA 1W91A 3UJRA 4IOTA 5A69A 3O3RA 3MKVA 2NVDA 1C9DA 1HGWA 1JVNA 2VR5A 4L9XA 5F1VA 2WV8A 2ZXBA 3O9NA 1D3GA 1R3VA 3UEQA 3S2NA 3ITLA 1S3HA 2VQUA 5BXTA 1FWIC 2CIPA 5HUOA 2J6XA 1YNQA 4XVEA 4IG2A 5D2TA 1VEPA 2OKOA 2J7EA 4YVXA 2GK1A 4C6JA 5CZ0A 4L5ZA 8RUCA 1KFBA 4DIAA 3SUTA 4AY8A 4OWGA 3KRSA 2FHFA 4WD0A 1O60A 3GU9A 5BOFA 3RDKA 2E40A 2W79A 2WSYA 2X1SA 5G4WA 2E8YA 2OGJA 2CPUA 4C6OA 5AB3A 3K30A 1E4LA 3MUY1 1BSIA 2P1FA 1F3XA 3L12A 4G7EA 3UWWA 2C0HA 2ZZ6A 4JTCA 2VNCA 4J3WA 2OKTA 2IKIA 2PWFA 3RMJA 1FWHC 1FDYA 1A5NC 4FX7A 4B2DA 1RBAA 3Q65A 2PLKA 2C13A 3GG8A 2QYGA 3S8HA 1OYAA 1SPQA 2ACSA 1SO5A 3H12A 2Y5SA 1UPMB 1W1ZA 4HNCA 1UWSA 3M46A 1DWAM 3DFHA 2F84A 1U5HA 4DPPA 1C29A 3CH0A 2BG5A 3IVUA 3AWNA 4PGLA 4UB9A 1ZCCA 4ACZB 2NUYA 2C7FA 1J2BA 2I7GA 1PWLA 2Z24A 2IPGA 1XIEA 4UFHA 4AHOA 3N2OA 3IJ8A 4DB7A 2NSOA 3GS6A 3PZIA 2ZUNA 5E09A 4NRRA 3M0IA 1RPXA 4FA3A 3EX1A 4UFJA 5FEWA 4BS0A 1FWTA 2W91A 4YYFA 2IQDA 4F66A 2CLHA 1JL8A 4WLCA 1GQLA 4Y2WA 3SECA 4DO7A 3TTSA 4FLQA 5GJMA 1Q6LA 3G1VA 5MHBA 1TPB1 2PTXA 1G67A 2BMBA 3W7KA 1K8CA 4M6PA 4J27A 1YKWA 3R43A 3CZ8A 4AZ7A 2QV4A 4GJJA 3UWEA 4GVGA 4BF5A 2RH9A 5HUPA 4D8ZA 4MNKA 5AECA 1Z89A 4GIEA 1HJQA 3CPUA 2Y24A 1A0EA 1V7AA 1AVAA 3CV7A 3NSNA 4K37A 5CG0A 1TPWA 2DJLA 5F2IA 5G2WA 5C2CA 2NQLA 2QIWA 2YIHA 4OOZA 3GHTA 3LPPA 1BHGA 3UWVA 4GQQA 3KOWA 5IXEA 3C0QA 2A85A 4HCHA 1JI2A 4HU8A 1XWYA 4MDOA 2Z1SA 3UR5A 3ZQ9A 5LIWX 3IV8A 1THFD 3C2VA 2NWRA 3IPWA 4QHRA 3PAJA 2QV5A 4QROA 1LLOA 3W2NA 2XVPA 4U10A 3L65A 4PUWA 2ESCA 1Q85A 3EKGA 4Q8OA 3HGRA 4YN5A 5C7VA 3W37A 3CT7A 5D32A 1UMLA 3A4XA 3RCMA 4FIRA 5G4HC 4C1LA 2FFIA 4W93A 1VC4A 3S9YA 3RCYA 3AIVA 3N9RA 3H70A 1KD0A 1QMLA 5BRPA 1BQCA 4AD3A 1VCGA 4M0XA 4XKYB 4EPEC 1K9FA 3IAPA 4ICNA 3POCA 2QKFA 3KW3A 4A3RA 1UQZA 4QEEA 2XVNA 3QLLA 3CB8A 3BCDA 1LOQA 4LJ3A 4P5UA 4F2TA 5D4YA 1F4HA 3TAKA 4PMNA 2OVLA 4P7RA 3CZJA 2TYSA 3QM3A 1XIDA 2WXDM 1TPFA 2G3JA 3BQ5A 1DQUA 5JBFA 1FY6A 1JPIA 3AMLA 4D6DA 4GUHA 2VMFA 2XIQA 4KEMA 2FZBA 1ME8A 2YDRA 1QJWA 1XBZA 2UY5A 1X8CA 1RP9A 2HNHA 3GU1A 3N4EA 2HRWA 3NO1A 3S2MA 4AWUA 2VD9A 4RDYA 1W32A 3RRXA 4H9VA 4PC8A 5CSRA 4LW7A 2SFPA 3UJ2A 4WY0B 3VOGA 4YXGA 4GY0A 4JTTA 2D2OA 5EMYA 1JDFA 4FSAA 2VZOA 3K5XA 3RITA 3VFCA 2XHYA 1J9YA 1HUVA 4HYRA 2I9EA 3BURA 3R8RA 3DYMA 3VOCA 1XF0A 3VGEA 5I00A 1XLIA 2VJXA 4IP7A 1A47A 1KBKA 3L2MA 4LVGA 3EWWA 3W82A 1JYVA 3SUVA 1HNYA 1UUMA 4UQAA 3S1GA 3RUBL 1NQKA 2AGTA 4HHLA 5A6KA 4NAEA 2QCGA 1F6PA 2NUXA 1XW8A 4IIDA 5IBXA 1JCTA 4UR7A 1KFEA 4B3KA 3WYZA 2WB5A 2X1UA 4GMEA 1H50A 3OZYA 3CUGA 1ISYA 2OODA 3PC0A 2O0TA 3ZVIA 2OR2A 2XG9A 3T4CA 4JZ5A 2DQXA 3GVWA 3CUXA 5A5WA 4HSHA 3CMGA 4I5XA 3TC7A 1BF6A 3UJFA 3EOEA 3HV9A 2J77A 3P14A 5AZ1A 1L8PA 3L68A 3FYPA 1F76A 1UUOA 1I2PA 4HCLA 1RA5A 3M7WA 3QC3A 4DZHA 4K7YA 4V15A 1EX5A 3GAKA 3F4WA 1K8ZA 2FVMA 3UCDA 2Z29A 4TVDA 3OVGA 3G18A 4DN1A 1XJBA 2VGFA 3RLUA 4YWSA 1VBHA 3WLLA 3QR0A 1UWAA 4UQEA 4PTXA 2CLIA 5E0CA 2WBGA 3ZT5A 4ZO7A 1ZNNA 2P88A 3U0HA 4L4OA 4PA8A 2QJMA 3LI0A 4NSBA 4YHEA 1W9BM 1FKWA 2Z1WA 3AC0A 1HIZA 5IHRA 2QHAA 1M7PA 4DBDA 2XYLA 4JXCA 3AYSA 3MSGA 4RXFA 4IFOA 2CEQA 4D6JA 2W6RA 2FMOA 2Y7DA 3MMDA 4JBRA 1UD3A 2YB4A 3EOUA 3RFAA 3GIQA 4D8LA 2O4QA 4OTKA 5CSSA 1E43A 1Y7VA 4ZENA 4QBXA 4QITA 3H2OA 4MY8A 4OZOA 3PPCA 1GEHA 3AU2A 3G8RA 4G7EB 4MJZA 1Q6OA 3T0TA 5DF0A 4KFPA 1K3UA 3WLIA 3RHGA 5C6MA 1HP5A 2Z6JA 3GHSA 2GL5A 5GNZA 1RQHA 4N2YA 1SZEA 3WLJA 1GYMA 3TYEA 3U3HA 4YS1A 4UNKA 3LQGA 4LF1A 4RZBA 4LAMA 3N2BA 3FHAA 1W1TA 4FNQA 4JIHA 2E0PA 4Q6XA 3GAYA 4Q7IA 4BI6A 1W5MA 1WO2A 2XIMA 1DE5A 1QASA 1QPNA 3WJZA 2BHZA 3TYAA 2HV5A 2VFEA 4UR9A 1OCQA 3V5CA 3V0TA 4B5NA 3ARPA 3GO2A 3AXMA 2HCVA 4E2DA 2V5LA 4K6AA 3NL3A 3W02A 1C90A 4Z0JA 3ARYA 1OFQA 3AXKA 4YCOA 1FDZA 1NWSA 1HKIA 2VDIA 3EXRA 4AHQA 5JQ9A 3O15A 4Q22A 1I60A 4UXDA 3GFYA 3CPRA 1BRLA 1S46A 3G77A 4FMVA 4GXWA 3O0KA 2DT0A 1R3YA 3GFZA 1V0LA 3M41A 4M1BA 2YXOA 1TV7A 2A1YA 2OTDA 4IG2B 4JEQA 1XLJA 1ADDA 3W7EA 3ES8A 1CENA 1MRAA 1KR0A 5HJLA 5ECVA 5I06A 2QF7A 2XH4A 4LUTB 5FJTA 4JHZA 1GQNA 2A7PA 2JGYA 4JCMA 3VKBA 4JDYA 1UG6A 4L56A 1W9DM 3WUGA 4YNGA 1EJWC 4JTKA 3H7UA 1T5AA 3CO4A 1NVMA 1GOIA 3ID7A 3KBSA 1ZSXA 4I90A 2NX3A 1HJWA 3BAXA 3E0LA 2FYMA 4LUIA 1S5VA 1XCWA 3ARSA 1EGZA 1MW2A 2PDUA 1V3JA 3FFSA 5CSYA 2YL8A 1JR1A 3BV4A 3EKLA 1R3TA 4U33A 3G3MA 2PEVA 8XIAA 1ZENA 1B3XA 3ZS4A 1KCKA 3W7HA 3THDA 2J13A 3W7CA 1IGSA 3GUGA 2PDQA 1VJZA 3TYDA 1E0TA 2BHYA 3W7JA 1OQFA 4S1FA 3FIGA 2Z4GA 3NZ1A 4J2PA 1BQGA 1XRSA 3E02A 1GT8A 3B0XA 4M3PA 1E4MM 1SM9A 2VX4A 3MY9A 3U8GA 6REQB 1J8VA 1KV8A 1TJPA 2A21A 2XZ9A 4LXFA 4E4FA 3K8KA 3J7HA 5H8UA 5HWNA 5DRIA 3W2LA 2EGZA 3BL3A 3LZ5A 4LRSA 4E8GA 5DY3A 3JR2A 1DHKA 1LUCA 2R8WA 1Q3NA 3RF9A 2XFYA 3KL5A 1V79A 1EC9A 3KEHA 1XIHA 1J5TA 1QFEA 1ELSA 2V82A 3AZTA 1QAPA 3CWOX 3GZAA 2YX0A 2QLYA 3HG5A 6XIMA 3WFZA 1KTNA 3MYPA 4IGHA 3NYDA 1UBPC 4L7ZA 4PB4A 2GQ3A 5GQBA 3GY1A 1TMHA 1TJ0A 3W1TA 2AMGA 4ML9A 3DFQA 4XVDA 3FA4A 5LSMA 1H7OA 1GTEA 1XR2A 4KIEA 3VCRA 5EB8A 1EDTA 2E67A 1NARA 2OSXA 1Q13A 3TROA 3MC5A 3QSRA 4XKMA 5FD0A 3WMLA 5T91A 1B3WA 3M0LA 4GIRA 4REQA 2HE8A 4WY0A 7ENLA 3BAYA 3W00A 2A7RA 4JN6A 5HMEA 1G4PA 2AQOA 4WOZA 5REQA 1PKLA 1VP5A 2BY2A 4LB3A 3UCCA 3THCA 4W84A 4O8RA 1J0YA 2XVKA 2PDYA 4E4UA 2GQAA 3TZFA 3UFYA 3FY1A 2YDSA 3F4VA 1XRVA 3QTPA 4ADUA 4R27A 3M5ZA 2PF0A 4XO7A 1N8FA 3IJLA 1H4PA 4ROQA 4LEFA 4UCFA 2C71A 4NJJA 1UHVA 1LWIA 1TSIA 2PP1A 1XLAA 4H19A 4KW2A 4PMQA 4CKQA 3NPUA 3IGSA 2J7FA 2H90A 3AYRA 4ZCWA 3UR7A 1LRNA 4JFTA 4XAYA 3QTGA 5ECUA 1Z41A 1SFJA 4XWUA 2PDNA 5DXYA 5LXEA 1KCZA 4Y8FA 5IDIA 4MZ1A 1JZ7A 2UWFA 3DAQA 3RAOA 4A6GA 3GR8A 3LEPA 1QHOA 4PCNA 4JTIA 3TCEA 3TTOA 3WFLA 4DNMA 3QFEA 3N9KA 3L0NA 4CNSA 2VKZG 4JICA 1TA3A 3LSCA 3CUIA 3PJUA 3LV6A 4ORIA 3ZO9A 2PDKA 3PSVA 1RPKA 1KXTA 1R47A 2WJEA 5HMSA 3AALA 1HXJA 3DFSA 2CW6A 1PTAA 1R9ZA 3MJYA 4LYKA 1GZ1A 1W5QA 3SY8A 2G3IA 1GZJA 1G94A 3B9DA 3CIVA 3NVDA 1WDRA 1K70A 4JQAA 4BQ5A 1CGTA 5C55A 2OO6A 2V6AA 2D0HA 3G6MA 3P61A 2PZNA 3A9IA 3S83A 1Q7QA 3ECQA 4HTBA 1ZS2A 1DWHM 4FP1A 4GQGA 4GKTA 1O1HA 4IGMA 5LNVA 1D8CA 1GVRA 3CLWA 3VNDA 5DN1A 3VNKA 2R1PA 1EQPA 1HG3A 2PWUA 4JTUA 4XQ6A 1L0PA 2WLZA 2YA1A 1HVQA 1V6VA 2J6VA 2WBKA 1V0NA 4QNWA 3STEA 3DDMA 1PX8A 2ABAA 5BROA 4ZSTA 2ACRA 2Z1VA 4PBFA 3H55A 2DGAA 3UXKA 3WQEA 2EHHA 4WVXA 4CVUA 3AMDA 4Q4OA 4UTTC 3W7OA 3OO2A 1X7FA 4AF0B 3CB3A 2P50A 4HNTA 4CGTA 4NI8A 3VNMA 2IKJA 4ZB0A 3NUKA 4NAEB 1AW5A 3OVPA 1B31A 2EPOA 2D20A 4WSJA 1VEMA 1PXGA 4PFMA 4EXQA 4JL2A 1J0KA 1K4HA 4LAOA 4AZBA 4X2RA 1MNSA 2WOQA 4XV0A 3U5UA 2JIEA 2YPIA 3OLIA 4I7WA 3K1DA 2BOGX 4Q8VA 4JHOA 3WELA 3WBEA 3W23A 2XZ7A 2KZHA 3E38A 3WD1A 3W4RA 2H3DA 2VD8A 4ERAA 1HFBA 1EIBA 5HMDA 3QBUA 1CPUA 1VFMA 3YPIA 2B7NA 3QY8A 1OIFA 5I3DA 5FF3A 4R33A 4F2UA 2J7DA 1WBJA 3RG6A 3TQKA 5D30A 3B03A 4HOXA 1FP9A 1V51A 3MMWA 4GK8A 1S2UA 1FHLA 3CPGA 3FJNA 3LG3A 3WJXA 2WZEA 4HBKA 4NQ1A 2F2HA 2OQLA 2FHBA 1NP2A 1RSCA 4A2RA 3RCNA 4HMCA 1E0VA 1AH4A 3BLOA 4XZNX 4J3TA 3A5FA 4P61A 2J75A 1BVWA 1CB7B 4HNVA 2BODX 1O66A 2D0FA 4C65A 3CHVA 2V3EA 2V5KA 3M47A 4DI8A 2HS8A 3PNUA 4QDMA 3QZ6A 4LTSA 3THUA 2RAGA 4QFUA 3HMJG 1KFKA 1IXPA 3PWIA 4GH1A 5GNXA 2Y70A 3EYPA 4MFDA 4RDZA 5HANA 5LGXA 1J6OA 2CKSA 5FIPA 3SI9A 2PRHA 3C2FA 3VD7A 5CBIA 2ZDRA 3MV01 2PDHA 4IISA 3PUEA 4HPNA 3T55A 2QR6A 3HPAA 5REQB 4DBSA 5EKYA 4AIUA 2OZ0A 4PCTA 2WQDA 3ATZA 1VF8A 4O8AA 2DT2A 1ZP3A 4HNNA 4W87A 3IAQA 4DY1A 2X41A 3MVIA 5CAKA 2Q02A 3MI2A 1ADOA 1MYRA 5LXXA 3VMNA 1J6PA 5AC7A 2FTYA 2IW0A 1W31A 4AX6A 1EEPA 2EG7A 4DAIA 4KKXA 4QM1A 5D05A 1XGZA 2E68A 2ZUTA 4IX0A 2KAUC 4J35A 1BWKA 2OMAA 2GWGA 3AIUA 3ARTA 3FX4A 1RXOB 4C7DA 4ACZA 5DCDA 1GQKA 1WOBA 1AD4A 5EYWA 3IS4A 2EO7A 4PUKA 4EOUA 3HJEA 3SUUA 3T0AA 4U31A 3FVDA 2ISDA 3GNOA 4KRZA 1ISZA 2G3FA 2Y6ZA 3UZ5A 3SN0A 4DBUA 2R91A 4CN4A 4ZOEA 5I07A 4XBSA 1RHCA 4NXKA 3R8GA 5I3GA 2ZRXA 1J12A 4GBUA 2ZX9A 3N1AA 4ZR8A 1G5AA 4GOAA 1L8NA 4POCA 4BQ2A 1X8FA 1EXPA 1A53A 3BMVA 3VM7A 2Y4SA 4AD1A 1XI3A 2YCKX 4DM2A 3PK7A 1CLKA 5EL1A 5IFTA 2JKAA 4XSLA 4RPQA 1EDQA 2PS2A 3WLKX 5C2GA 3STGA 1MUCA 1JF6A 4MKNA 4R53A 2VEIA 3MP3A 1KFLA 3CAVA 3PZNA 4H2CA 3WL1A 3VK5A 2VFFA 1IR2A 5A8QA 3CAWA 3WQOA 1XSIA 1ITCA 1JULA 1XLEA 1UWUA 2G96A 3HPZA 4H7VA 2QCDB 2EBNA 5BYWA 3O0FA 1W37A 4N9DA 1CIUA 3B4UA 4S38A 4GGBA 1W3JA 2HK1A 5E1QA 1T7LA 3GTHA 4A3YA 2HROA 1Q6EA 4IL2A 1SJDA 2VFDA 1X38A 4D72A 3RK8A 2VOTA 1Q63A 3W28A 2OPJA 2CBIA 3SN4A 4MZ8A 3NQ7A 4D1JA 3WKZA 2E5CA 2EJ1A 4XD6A 1E9ZB 2XVLA 4W5ZA 2VFIA 4NZCA 1XYBA 4LVBA 4R5EA 4ATDA 1VHCA 2DZPA 3TEVA 4KPLA 4DF1A 3MYOA 1UD6A 3ARRA 3RXZA 1RR2A 2NXIA 1W2PA 4ZOAA 5E9AA 3WD4A 5HNTA 3IJ9A 1V3LA 3VXGA 1B3YA 4AXNA 1DL3A 4ZZ9A 3W87A 1ZY9A 4KRUA 1DIKA 4ZVJA 3VGDA 1JZ2A 3HV8A 3MSYA 2BTMA 3DFNA 1QI2A 4KWOA 3SEPA 1CGVA 4BI7A 1JRBA 2CKRA 1ZTVA 2VDHA 4ASTA 4F0RA 5FKYA 1WXYA 2Y63A 3VMPA 1RD5A 3FVMA 1NTHA 3EWBX 4LCQA 3MP4A 3NPXA 1E1CA 2QXWA 4HPHA 2VCBA 3AICA 3UGVA 4PE8A 2DDXA 3VM5A 4DXKA 5TIMA 1BTMA 4D6HA 1VRDA 2B7QA 2X30A 1E6PA 4IZGA 4IIHA 3OTRA 1VYSX 3O6CA 1JCYA 1RQBA 1GGOA 5T26A 1QI4A 2NQHA 3P74A 1W0MA 1UUQA 1KM6A 4ZB5A 3M9YA 2C1IA 3GVVA 6XIAA 2Z1XA 2PLCA 4LY4A 4C6QA 3UF9A 1HF6A 3WBWA 1UPPA 1YPIA 2V63A 3NQDA 3PNZA 4MAVA 4OBSA 3G0XA 3QMTA 5CAHA 3IIZA 3RPMA 3GRIA 1Z42A 1HZYA 3KFTA 4UMAA 4O1FA 1NM9A 1Y5WA 5D04C 3TSBA 4ZQPA 4ZA0A 4NIRA 3T2PA 2EQDA 4LVAA 5HR6A 1RBOB 3KBMA 4TVUA 3VDCA 4I7UA 6CGTA 2G50A 3R0DA 1JCMP 2H9AB 3AIQA 5JXQA 4DUWA 4LY8A 1UP2A 4CNOA 4CVWA 1IEXA 4Q4SA 1UA3A 3VGFA 4AYGA 4Q8NA 3VCCA 1V08A 4NZ3A 3RJYA 1F9CA 3TFCA 3UERA 1K77A 1JCJA 3C5QA 7TAAA 2X7WA 5LIYX 2WNWA 1EJSC 4ZBCA 1OK4A 4L9ZA 2V9DA 3GXIA 4LS0A 5FEZA 5TD4A 3P60A 6TIMA 1H11A 5CZKA 1X1NA 3P5YA 3RPTA 5HWMA 1YDNA 4NZ4A 4BF9A 1JDEA 3C2OA 4JIRA 3PPFA 1TVPA 5GJPA 1O94A 4F3HA 4M82A 2LLEA 1OJXA 4XAPA 1DWGM 5LA1A 2D2JA 3VILA 2QPUA 4JTLA 3BAWA 4XIAA 4FXJA 1US0A 2VEKA 4GBDA 2J27A 3CL8A 3MA8A 4H7ZA 5LZLA 2VZTA 1UYQA 4B5XA 2BY0A 3U48A 5XIMA 3VNZA 4FB7A 5MKGB 4K8HA 4H9MA 1EZ2A 1U1HA 4ZQMA 2Q01A 1KRCC 1KXHA 2A0NA 1W1A1 4M80A 2CXEA 2GGEA 2FJUB 3RX2A 1CBGA 3S1XA 4JNMA 4ZQRA 3CQIA 4WQ6A 4H8UA 4PSRA 3KTCA 3WDQA 1GVEA 3M5XA 1QHPA 3VIJA 1LM1A 4RUBA 2C6QA 3Q2DA 2GJRA 3MHFA 4TX9A 1SGJA 5TAOA 3W74A 3EWUA 4ZO6A 4RDVA 2EPKX 1LBMA 3G1YA 1MRQA 3VTRA 3DENA 2BY1A 4RE0A 4GNKB 4LVFA 3SRFA 3W72A 3N14A 3G22A 4KEUA 4B90A 2DP3A 1JIBA 2QAPA 3S5YA 3SADA 3JRKA 1BSLA 4O14A 3KBVA 3NL5A 4O52A 4G9PA 5D37A 1BEUA 1TRDA 4UR8A 4S39A 1C7SA 4X9YA 4WIWA 3ZT7A 3S5SA 1KC7A 2QEZA 2I57A 4JKMA 3DH7A 3FK4A 4C6IA 4DUOA 3Q67A 3P0XA 4PRTA 5H8MA 2ZWYA 1HP4A 4AF0A 1UZDA 1KM2A 3NSMA 3IIVA 4UFLA 3OOQA 2YCEA 1QATA 1TPH1 5A3HA 4D6FA 3GTFA 3L4XA 3UZZA 3V75A 4HK6A 4AY1A 3PANA 1Q45A 1KBJA 4U28A 1VPXA 2WSKA 2DZUA 2GWNA 3ITOA 3NTYA 1UP0A 4AWEA 4ICMA 2P5NA 3K1GA 2D23A 3FJ6A 4FF5A 3NDOA 1WAUA 4NP7A 2R9RA 3PULA 2DY3A 3RNDA 1OCJA 4KFNA 3BW4A 3TW7A 5C7HA 3E5BA 1US2A 3NSXA 4ZQCA 4C6NA 2WMIA 2Q3OA 1P0BA 3TW6A 3W86A 2H8ZA 4Z1DA 1I2QA 1IWBA 6REQA 2IPJA 2D73A 3WD2A 4MJ4A 4AEEA 3N2TA 4CD4A 4MGGA 2BWGA 3B06A 3S5NA 4GI9A 1SW7A 3O2LA 4GO9A 4LGXA 3TKFA 4KETA 4PUUA 1XIMA 2PTDA 3A12A 4ATLA 2WMKA 4O1BA 1A5AA 3WIJA 3LCLA 2DSVA 2YCIX 1XLFA 2Q3RA 5BOOA 2EPNA 5AYIA 5EFFA 1UKSA 5CZTA 4FX8A 4ZTYA 3NPWA 1R0MA 1A5KC 2DSZA 4OV9A 5A8GA 4DZAA 2OQYA 1JDDA 3UD6A 4Y90A 1VD6A 3I4KA 3UW6A 4LUSB 4DZ5A 1ZCOA 2ATMA 4JY8A 4O13A 2PDFA 4A8LA 1VBGA 1T6MA 3DECA 5AYYA 4FXSA 2NV1A 3EPOA 2CLPA 4M56A 4FPSA 2XPKA 1MNZA 3BICA 3IK2A 1HO1A 1QO2A 4KWWA 3RO8A 3QJAA 2ISSA 2CCRA 4GI8A 4N42A 2WO5A 3WDPP 4O19A 4PULA 1OZQA 1GKQA 1SJBA 4OGZA 4R9OA 5GPRA 3BLLA 1PWMA 3S2CA 3WH9A 2XWEA 4OIFA 1ONWA 3VDGA 1P7TA 3W7LA 4FK9A 3CIXA 3NQ8A 3ZM8A 1RZMA 3SRHA 6PTDA 4GX9A 3QV8A 3SFKA 3W1XA 4GI4A 1A4MA 1EBGA 4MHBA 2J9YA 2PFHA 3DZ1A 3SJNA 3FSTA 5T8GA 3OODA 4BQ3A 3LB0A 1LROA 4D6CA 3CWHA 3T8LA 2YL9A 1GJWA 2ICSA 3CV1A 3KLLA 5E70A 4Z2GA 4TIMA 2D2GA 1OADA 4DF0A 1AQMA 3WQVA 2UY2A 2YKKA 4DUVA 2BDQA 2NQZA 2CWXA 1QPOA 2DIJA 2MANA 3DG7A 1P6CA 1J2WA 1MUMA 1DWFM 1QNQA 4ZQNA 1XV8A 2DW7A 1LL7A 4L6OA 1UIPA 3I10A 4GZIA 2QUVA 1QW7A 3LPFA 2PMQA 2WAGA 2E9LA 4C6PA 4ZO8A 2VO5A 3MT1A 4W8LA 1LF1A 3DYPA 4G1KA 1T99A 1E40A 3PJXA 5AHLA 1DQWA 1B54A 3D46A 3RIKA 4RJEA 5E6ZA 2DVTA 3NM3A 3NAVA 2VL4A 4KFOA 4JS3A 3XINA 2YBTA 3MPGA 1OFEA 2XWDA 3O63A 1QI0A 4GX8A 1XLLA 4X9SA 1KA9F 3GKAA 3EDDA 1PDYA 2VR2A 1TJ2A 3DFTA 4JYDA 2CYGA 4QG8A 1V6YA 2X1RA 3PZGA 4RX0A 5FAGA 2NZLA 1EP3A 4DO4A 2ZUVA 4QR6A 4Q8MA 3ELFA 4WKAA 2A6LA 3FN9A 4GVHA 3EX6A 1IF2A 2WKLA 2XIOA 3PVFA 1B3OA 4NF7A 5KINA 1XLCA 3P8IA 4YJ5A 2FPYA 3CO8A 3MKKA 2NSXA 4GUJA 2JKPA 3NQMA 5HQLA 4JNYA 3TVAA 5C9UA 2XGBA 4Z1BA 4ORMA 4RNJA 4GACA 3ZYZA 5FF0A 7TIMA 3W1LA 3RJXA 4RR4A 4DJEC 1QI3A 3AHTA 1MI3A 2G41A 3H6OA 3VKCA 3CH9A 1M03A 2PF8A 4O17A 4Y9PA 5CXPA 5H91A 1UD2A 4E8DA 4EWJA 3T07A 3W24A 4L6HA 3V0SA 2I9UA 1I0DA 3AHXA 4MWAA 2WKGA 4S3BA 5J8LA 1LL6A 3D5HA 2CHRA 5D8WA 3WK2A 3SURA 5A6TC 1K9TA 4UTWC 3VKDA 1ZBWA 5CPMA 2I17A 3IVSA 4K39A 4LCRA 1H63A 2FGBA 4AC7C 1ZJBA 1ZBVA 1CNVA 2ZQ0A 3AS1A 2PGFA 2FH8A 1GVYA 2AKZA 1PUDA 3D3FA 4OHQA 4L65A 1Z48A 4E5TA 2OT1A 4R85A 2ZX7A 2QZRA 1GVIA 3W84A 4W7VA 4X61A 2XH2A 4C6LA 3QYQA 1H5YA 1DIEA 1VB9A 3GK0A 5KZ6A 2C16A 1YQ2A 1J0IA 4IHCA 5CZSA 3CUHA 4QJ5B 3BJTA 4HGXA 5D09A 4QNEA 1LTDA 4XKYA 1NF7A 1DXIA 2ZXAA 3NGFA 2TAAA 1XLDA 5G5IA 2PGWA 4PEKA 3BG3A 2ONEA 3RILA 1JNDA 4JX6A 1K9DA 3T09A 1AG1O 3WJWA 3TYUA 4C90A 3I3DA 1SJAA 1KXVA 3PUGA 1IIHA 1WX0A 3NL6A 4MNLA 1Z44A 3QZEA 4F0SA 2EF9A 3PP7A 4Z42C 3HF3A 3AJXA 1PIIA 3M43A 3PR2A 4C6FA 4AEOA 3MUIA 5K4ZA 4NJKA 2G95A 2FGZA 3W22A 1U2YA 3CMFA 1XD1A 4QLLA 3WX7A 5HBFA 1NP0A 5C71A 4E0CA 2E7FA 3B8VA 2DV0A 1QWKA 1ZHAA 4J2MA 1IXNA 5TQLA 5HJYA 3GDKA 2YLLA 3PB2A 3SR7A 1SSDA 3K8MA 1CGXA 1F74A 5EY5A 1WZMA 2C79A 5AYXA 3UT0A 1JF5A 1KM3A 3Q37A 4J3XA 4LS1A 3UYIA 3OYZA 3ITXA 2XJ7A 2Y7GA 4ZFMA 4WDUA 3W1RA 4O10A 2BB0A 3C2YA 2QCFA 4IQJA 4S3JA 1GZGA 4DO5A 1Q7ZA 3W1PA 3O6YX 4GYPC 3TNBA 3LCHA 4LNCA 2Y8UA 3UZYA 1PDZA 2GUBA 2PTWA 1Q6CA 5JIWA 1BLIA 4MLRA 3WSUA 3UXDA 1WXZA 1FP8A 4IXXA 3TXZA 5CPOA 5CJNA 2WYSA 1XBYA 1Q6GA 2H3BA 3V4BA 2O92A 4GUGA 1J0JA 3G1XA 3EDEA 1W1B1 2TRSA 4I6VA 4WX2A 1JDCA 2ISVA 3SY1A 3FAXA 3GHRA 5LA0A 3FW6A 1VAHA 1OYBA 3SIZA 1JQVA 3CHFA 4FIQA 3GYCA 4YYCA 3P3BA 4RL3A 1A5LC 3TH6A 3BARA 1Q6QA 6A3HA 3E5PA 1FHUA 3VDBA 4NNAA 4C1KA 3QHMA 2HBXA 4NRSA 3C0SA 1W1YA 2Y8KA 5GNYA 3RR1A 2RKXA 1VKFA 3Q94A 3QEZA 4XZHA 1R2RA 4BKNA 2R6OA 1XBVA 4F48A 1FWSA 5K2ZA 2BXZA 5A6MA 1XYFA 3MI6A 1LORA 3E2RA 2NQJA 3PJTA 3VIFA 1FWBC 1OX4B 3MCMA 2B4GA 2V38A 1B9BA 3AYVA 1QNRA 4BWLC 1Y5XA 4N9BA 4RE3A 1N55A 2GFTA 1GHSA 4IUOA 2AL2B 4K8GA 5L9FA 1NY1A 3N3TA 3N9SA 3XIMA 3T4WA 4AIEA 1P1XA 3GNRA 4GCXA 1VFOA 1GVOA 3CEPA 1JPHA 4E6MA 4YTSA 4ZL1A 3FYOA 3AQUA 1BAGA 2GVJA 3U4FA 5C9RA 3G0SA 4EF8A 3PAOA 3HB9A 3NQCA 5F2GA 1E6RA 1JFXA 3RGTA 2J66A 1JPKA 3LCWA 5RUBA 3TAOA 3GDBA 5G4EA 4G56A 4O28A 3VD4A 2XGIA 4PMVA 4FR1A 4I7VA 3VU2A 4G7FA 4OU1A 2B0MA 3P82A 4DELA 3GH7A 5E93A 4WJ8A 3WBYA 2WM1A 1SVDA 1ZALA 2HVOA 4PCPA 3CV6A 3EBVA 2QPXA 5DMYA 4CLMA 2EG6A 3FDGA 3DBNA 3UXLA 1RUSA 3MP5A 1V03A 2ZXQA 5B7YA 2XFFA 1JAEA 3V5OA 1MQQA 3KL0A 1TWWA 2JF7A 3LY0A 2CERA 3BXWA 4CNTA 2X0HA 1V02E 4J4KA 3GE7A 5CGQA 2P53A 3IIOA 2A79A 4HNLA 4RNIA 4RE4A 1NWUA 1XDJA 3IANA 2ZZ1A 1KGXA 1E5NA 4MUPA 1XPGA 4MB5A 4ZOBA 1MW0A 2QJGA 3URBA 3ZJKA 1TWIA 1OGSA 2D24A 2P3EA 1TPC1 4PR4A 5IM51 1W9VA 4FXFA 2V2DA 3SQSA 5I77A 4GKLA 4LYPA 5HXMA 3QRHA 3KS6A 4NAFB 1HKVA 1RJRA 1SO6A 4LEQA 1PCKA 1BWVA 3ZXWA 2AL2A 3NQVA 3ABSA 1YPFA 1C8VA 4PTNA 2YGYA 1VPQA 2D0GA 4LBUA 2J74A 1UROA 4ZOCA 4PN2A 4F0MA 2QF8A 4MWAD 1S5MA 1SMAA 5KTLA 2VR4A 4B5VA 1VH7A 4NJGA 1EO7A 4XO6A 4CU7A 4JFVA 1YXYA 2HSAA 2GDQA 3L0GA 3VC6A 3V1HA 3RU8X 3LYEA 1BGAA 2ZVIA 4JX4A 2DZWA 4NYUA 2HVNA 3T2OA 3EWCA 3L66A 4AYSA 4QE1A 2XTKA 1LBLA 1QNSA 3CL7A 1C7TA 3LNMA 1K6AA 3MSRA 1E1EA 1LRTA 1M5WA 1I8JA 1UA7A 1W5NA 2XU2A 3LLXA 2G4FA 1O4UA 5ABGA 3TCSA 2QCMA 1MEIA 1JCXA 3A3XA 3FKKA 1MFVA 4GY7A 4QJ4B 1YRRA 3W2KA 3IUHA 3W07A 3BSHA 1AZ2A 3WNOA 1XDLA 3B8IA 3AIRA 3L2IA 3IACA 3GFXA 3DFOA 3WLNA 4GC4A 2IUZA 3VIMA 1FH8A 1Y8BA 1JDAA 1OF6A 3W7RA 1AMYA 3B40A 1DWIM 5JUVA 2R1MA 4WDWA 4K7VA 1IWAA 1VQTA 5I5RA 3VINA 1GNXA 4S3CA 4V1XA 3QKZA 3OGVA 2HISA 3PJWA 1WE5A 4Z2LA 3KBWA 5H2ZA 2VGIA 3WCZA 1VBUA 1ZAHA 4Z2KA 3U2EA 3H2MA 1PJ9A 5D9NA 1W9UA 2YZRA 1H1ZA 4H7CA 3SGUA 3LERA 4DI9A 4MY9A 3B0UX 2GVEA 4D8AA 5DRCA 5DMMA 3NQ2A 4Q7BA 3F2CA 5BXSA 1HN1A 3AMGA 2WVVB 4K36A 1PE1A 3KRBA 3W85A 1KV5A 1ZUAX 2E09A 4YVPA 5HAOA 5D9MA 5B80A 3MUCA 4ZEPA 3ZJ8A 1T8QA 3WMCA 4P7LA 2WC3A 1X6NA 3TSMA 3WJSA 1ZJIA 2ZA1A 3T81A 3U7VA 1Q7MA 3GTNA 5BW6A 3E1F1 2JK2A 3H26A 1OT2A 1UD4A 4GHRA 4M7SA 2P3ZA 1KQYA 5CH9A 1ITQA 3CC1A 1F61A 1V02A 3FCPA 3ENLA 3KTSA 3EWDA 4XTDA 2PWHA 4AW7A 2XIBA 1W3KA 4R3UA 4XD4A 4M6QA 3H7RA 3Q58A 5KZEA 3TR9A 1KNWA 5IBXC 3WBAA 2NUWA 1RJPA 3W9ZA 2BLEA 3I6TA 5C2XA 4PTWA 1BYAA 4DAFA 4XD3A 2BVWA 5MF5A 5HOSA 1A5BA 4C6CA 2RGMA 1GG0A 2JIWA 3QGAC 4RK8A 5GVJA 3WQCA 3OA5A 3S9ZA 3FGCA 5D2YA 2QUTA 4R34A 3CAQA 3CT2A 3W2JA 3ZLHA 2E9MA 1RBLA 1YE6A 3HTWA 2O55A 4L4PA 3CXOA 1A5CA 4QISA 2QUNA 4C6KA 4CQBA 3E12A 4NASA 4B5WA 4O12A 1CXLA 3WQFA 3M6YA 4NXSA 5AYZA 2I56A 4WRHA 3F4CA 2I5IA 1SW3A 5D9PA 1JCLA 1OGBA 1MDLA 2WW5A 1XPYA 2VX5A 3H24A 2DUXA 1DXFA 3C86A 1KTBA 1UR1A 2UY4A 1BYDA 2VDGA 2FVLA 3JS3A 2WZMA 4M8UA 3NYZA 2WVVA 4Q33A 1F4AA 4NZ5A 4HZ6A 1S39A 4QQ3A 4H4IA 3I6RA 2B7PA 3NURA 4AZHA 5HATA 3ITTA 4IPPA 4UBPC 4MNMA 3WQPA 3WUFA 3A3HA 3FEMA 5AY7A 1SW0A 4A35A 4PB5A 5G1MA 5G1YA 3MO4A 4PUMA 1KWKA 1EA9C 4KGLA 3ALGA 1PEZA 1OVDA 3EMCA 3UZJA 3PM6A 3BVJA 1XS2A 2W4XA 1BKSA 1IEWA 3MO7A 3NDZA 3GVGA 3NO5A 5AVHA 4WY0F 4XZ9A 2ZRWA 4IWWA 2OOFA 1QBBA 3T8QA 1F07A 1XRTA 1KCXA 1Z3NA 4O18A 5HQEA 3VCNA 1NDYA 3L4UA 4O57A 2A5HA 4C1NB 2OX4A 3M0YA 3UPBA 4PBEA 1KBIA 3Q45A 1W9PA 2FHCA 4KT2A 1ZZMA 3TONA 3N6QA 4FNTA 1SZFA 1X39A 4EANA 5BMWA 3TN5A 1J01A 1G7UA 3NIYA 1XCXA 6ALDA 1TUFA 2C1GA 4KCVA 2V3DA 2G5WA 1DJZA 2GVLA 3P62A 3DIPA 3RLVA 1WDSA 1TMLA 4LH8A 3RLHA 3C0JA 2NX1A 1SFLA 1HL9A 3T0BA 1TKKA 2YFOA 3AISA 4N6FA 2OYKA 3QC0A 4JTFA 5CZJA 4OUIA 4O11A 1EQCA 2FZ8A 2E77A 3TN6A 2HJPA 3NEVA 1J79A 3MCNA 4UTMA 4S3AA 2HBVA 3SJ3A 1TTIA 3GTXA 2D3LA 1XCFA 5HNUA 2FFCA 5LHEA 4S3FA 3WF2A 3WLSA 5CC3A 5D2XA 1U5VA 2PZ0A 5BRBA 2Y2WA 1BTCA 3BMWA 4XZBA 1QR7A 1ODZA 4JR5A 1TG7A 3OG3A 4YWIA 3IWPA 3GIPA 5DEZA 4Z1YA 4LVDA 3O6AA 1VJSA 4HHHA 4I5UA 3T9PA 3KM8A 2NXGA 4NL1A 3SUSA 5AN7A 2HWGA 1NEYA 3R0KA 2Z2UA 4F79A 2X0YA 1I9CB 3FYYA 1EUNA 4KCTA 5G2IA 3BV7A 1K1DA 4GXPA 4IIEA 2UBPC 2NQ5A 4J5NA 1NDWA 4MPKA 4YTRA 4UOQA 4JPGA 1IE7C 3PZ9A 5IRPA 1IT8A 1P7TB 3BAKA 4GQRA 4M24A 3NOYA 5CGTA 3A3WA 3AJ7A 4D1IA 1VIWA 1HO4A 3EXSA 4DM1A 5KMYA 2F6KA 3GR4A 2BNJA 3VGHA 3EX3A 1PS9A 3S42A 2QJNA 1XL9A 2OZ8A 2R1NA 3P6LA 3STCA 1QW8A 4HN8A 1PKNA 2FPVA 2BHUA 3OZOA 3E2VA 2XN1A 2NT0A 3Q4DA 4LV4A 2B7OA 2TMDA 4BZYA 5FF2A 3UXIA 1P48A 5EGRA 2ASHA 4H2HA 1TTPA 3VX0A 1TQJA 1LJYA 3LTYA 1OSEA 2IXUA 2YA0A 3GM8A 5TBOA 4AU0A 5BOEA 4ZO9A 3PBMA 3B8WA 3PF3A 5ABFA 1WV2A 4EXBA 4AHPA 2XM1A 3BLIA 4FS9A 3GXFA 1YNYA 1MO0A 2PGRA 3UY8A 3DI1A 1O5KA 1OY0A 2WCSA 2BX7A 4E8CA 3KOYA 5AVNA 1XIFA 3KWXA 3N4AA 4PMDA 5DELA 4UUIA 3VPLA 4IMFA 1UR4A 1OC7A 3SCTA 3AHYA 4NNBA 4B15A 4WK9A 2A3BA 3EMQA 3L4YA 1KM5A 3TQVA 4OE7A 4XZMX 1XQKA 3UR8A 1HGYA 4GG9A 3BPWA 3A4JA 4AZCA 4HOWA 4H9ZA 1HQTA 1MXDA 3BSGA 4OQVA 5DMLA 2RDWA 3OEXA 3S1WA 3B9NA 2FLIA 3LBCA 3BLKA 3OLEA 4WSHA 4HA1A 3QGKC 4BWLA 4MY1A 1EZWA 4V33A 3CHDA 3BSMA 3MB9A 4NY2A 3OVRA 5LNRA 1A0DA 1OG6A 5FJJA 4XUGA 4PCSA 1SQ7A 1VZWA 2AMXA 2XH7A 1FUYA 5AFDA 2V3GA 4ZGYA 4X22A 1BVNP 3DXIA 5EMUA 3HBLA 4IQDA 2OU4A 2YLAA 3UETA 1VLWA 2WC4A 3N13A 3HPXA 1QPKA 4GI6A 4UFMA 3KRUA 1XYZA 4AD4A 3WLRA 3VYLA 4QDPA 3ES7A 1JUKA 4TTUA 2PGEA 3SQLA 2PUZA 3O8AA 3QPZA 3TJLA 1JZ3A 2G37A 1U5JA 3UR2A 4MWAC 1BYCA 3TR2A 3F4DA 1GKRA 1MXGA 3N2MA 3A4WA 2Z1KA 1ZPTA 3TSDA 2X09A 3ARWA 1F2JA 1OCBA 3PG8A 2PBOA 3FV9A 1UASA 3KXQA 2YCLB 5A2BA 3ARUA 2NV2A 1VGAA 1XIIA 1YXDA 1OT1A 1QNOA 3C6CA 1D2KA 3GH4A 3V16A 4V1YA 3SFWA 3TTQA 2V30A 3CUFA 3QMRA 1V7YA 3GVQA 1HJXA 3W7IA 1ZL1A 4JIIX 2NVCA 3DC0A 5FJUA 2PA6A 4GYPA 4S23A 4C7FA 1H09A 4IUGA 3UWUA 3WQ6A 1DJYA 3A21A 5F7UA 5M1TA 4UNIA 1ICSA 1GW1A 2OWCA 3F5LA 1VCVA 1JPDX 2X7VA 4JGDA 2DZTA 3V18A 1YLVA 1SU5A 4JTDA 1REQB 4LAZA 1AQ0A 5LNWA 2WZHA 2Q6ZA 2CZVA 4EPKA 3OBKA 1WKFA 4LSBA 4KGJA 2V5DA 1OEPA 4Q4QA 4WKHA 4FNSA 1OYCA 3OVQA 3KP1A 3WEZA 1S1PA 3R0UA 3CTTA 3MUXA 3BAIA 5CPTA 1YBQB 1MQRA 5JBDA 4EAYA 1OC5A 4IMCA 5AYBA 1QOPA 3MDWA 3ERPA 3AROA 4FXRA 3KVKA 4IICA 4TU1A 3B9OA 3PZUA 3UA3A 4A3HA 5EU9A 3I68A 2YOCA 1WKYA 1Z9AA 1YNPA 3EEGA 4L6DA 1DTNA 5J04A 1LT7A 3FHQA 4HMDA 1VYPX 5A8PA 2EG8A 3TFXA 4Z0SA 1W56A 3F5JA 3CGTA 2PP3A 2FKPA 4U5IA 4L1GA 3SCRA 3SO7A 2V2HA 4MWAB 3E3HA 1WNOA 3C2RA 3L4TA 4HZ7A 1EJXC 1YTKA 4UQ9A 1QUMA 3WMSA 4UQBA 2GSHA 4INFA 5K9XA 3WK1A 3BMXA 3H4WA 2VZVA 3PTMA 1WXJA 2Y85A 4UTTA 2CWNA 4IP4A 5DX7A 3TOYA 4P8UA 1M1BA 3KVLA 2R24A 2CU0A 2FZNA 4QS5A 3M0XA 2QCCA 3S4TA 3ITVA 4YTTA 4GZ7A 2YB1A 4GVIA 3LHUA 2E28A 4PMZA 4U3AA 4JFWA 1EOMA 1TCDA 4JIPA 4JNZA 4PMRA 1UZ4A 3T40A 1K7XA 2GZXA 1CI1A 3DOPA 3R2GA 4CCZA 5IDZA 2NV9A 1L2QA 1NSJA 2OGYA 4URIA 2DORA 3TMLA 3FNDA 1GYLA 1NWRA 3TXVA 2B31A 5HDRA 2CBUA 1KBBA 1GWJA 1RLDA 2PBGA 3LUTA 3A13A 2VELA 3INPA 3UCQA 2CLFA 3EB4A 1HJUA 4H04A 1H0IA 1WBHA 3QSTA 4N0RA 3MWCA 2WPGA 3WH5A 1XIJA 5LGZA 5FSEC 5CBJA 1G4EA 5AKQA 2OSWA 4EF9A 5J5RA 1V77A 1L6WA 3OP2A 3M1ZA 3KZPA 5KZDA 3HO8A 1JEZA 2ZC1A 1XFBA 1C92A 1EKOA 3LPOA 3GIYA 1RH9A 4LCSA 5SWUA 1BYBA 1QOQA 4QS6A 2CZDA 4QCEA 1F8MA 3CBWA 1KXQA 3OQ8A 4J3VA 2RDTA 4AXKA 4Q4PA 3TA6A 5IFPA 4DJED 3M16A 3ZWSA 1UR9A 5I02A 1F73A 2VHLA 3PFMA 3VE9A 5D33A 1EJVC 5HJXA 1A5SA 4JEJA 4JDBA 2O4MA 4Y9OA 3GDTA 3RX3A 3KWSA 2P0OA 4J9JA 3FLUA 2VENA 3LM3A 2F38A 3PSWA 2REQA 1VENA 3TW9A 2J78A 4GJ1A 1XLHA 4HPGA 4DXVA 3LU2A 2A4AA 2EXOA 2CLEA 1FRBA 3OB8A 3C8NA 1SUXA 3QH2A 1YPXA 2ZUUA 4GYKA 4TXEA 3SCPA 3LA4A 4MPQA 3G1HA 5AHMA 2GGIA 3II1A 4AUBA 3S3GA 3PZMA 2R82A 3UNTA 1MUWA 3NM1A 1EDGA 2GGJA 1GK8A 2VUNA 2YYUA 1EJTC 4MVAA 4F9JA 3SRKA 1CGYA 4B9ZA 1UW9A 1JYNA 5CEWA 2BASA 2V68A 3W6LA 4B5UA 2OYMA 3SGGA 3IVTA 1I45A 1VPYA 4H1ZA 3B9EA 4C5ZA 4PTMA 3VIGA 3WH7A 4F9DA 4QCFA 3KRZA 1R38A 3AIEA 3LTSA 4JY9A 1FWNA 4AZ6A 1QO5A 3TC3A 4N02A 1F6KA 3LLFA 1A3XA 2DZBA 4NX5A 3MDUA 3CZLA 3A4AA 1E72M 4EPBC 5HR7A 1CT5A 4TX8A 1I75A 3A23A 4UFIA 1O7AA 3JU2A 3BTNA 2W9MA 3WQGA 3S1UA 4BHYA 3E96A 3W6YA 2XM2A 4S2BA 4LAUA 4Q8QA 3PFRA 3C56A 3C3UA 3GBEA 2NLIA 1LCOA 2F7FA 3UG5A 1P0EA 1PX4A 4O53A 3WDRA 3SB0A 1JCNA 4ZODA 3P5ZA 1D3HA 1UJPA 1QBAA 4CQ9A 3LHTA 2OXNA 1NIUA 3WLQA 2VWTA 3R4IA 2ZZ2A 4QGCA 1JGIA 1UKTA 2JE8A 4HA0A 4H41A 4C6EA 1JJKA 3R10A 4H9XA 3S6TA 3B8TA 3C52A 4HA3A 5FJPA 1R2TA 1H1NA 3EX4A 3T08A 2DSKA 2VEPA 3OGSA 4MDPA 5CC6A 1WUFA 3GNNA 3EA1A 4GINA 2ZICA 3ZLGA 2ZTKA 2F6XA 3AUJA 4WR3A 2V5JA 3BG5A 3EWZA 4XK2A 3NZRA 1S2CA 3A6OA 1XBXA 5CPLA 2W67A 5HNRA 1V6TA 1DE6A 1TZ7A 1AJ2A 5I3HA 4OBRA 1ZRQA 4F0LA 1OK6A 5DBUA 1CLXA 1S5NA 3MUAA 4ALDA 4FF7A 3LENA 5T9CE 4MUZA 2G97A 2R14A 1POKA 1D3CA 3CUZA 1I2RA 5AC6A 1GG1A 1RY0A 2GVGA 1ECQA 2FGLA 2VTFA 4QTGA 1JG9A 4CQDA 4A29A 1NU5A 2FTPA 4DLMA 2POZA 3GDLA 3RMEA 3FAWA 4P7QA 4A2SA 1B90A 4WCJA 1MZHA 3AXXA 4NJIA 1AW2A 4BEQA 3ANYA 3PTDA 1BGGA 1KKRA 3W2MA 4CN1A 7XIMA 2XISA 4O4WA 1XFCA 3U2ZA 2C14A 4WJXA 1B0IA 4GNJA 2QQ6A 3BDKA 1M7JA 4PEEA 2Z1BA 4MZYA 3RU6A 2INEA 3R94A 3BZGA 1I1WA 1R3SA 1C9WA 2V0TA 3GXTA 2PE4A 2ZE3A 4RV8A 1ONEA 4Q32A 1PIGA 1XH0A 2G0WA 3AXIA 3UYCA 4Q8TA 4PODA 4JAWA 4IM4A 2V8ZA 2GYIA 1TV3A 1HKMA 4W85A 3V3WA 3N25A 4MB4A 3W38A 3WL0A 3CNYA 5FF7A 3EOOA 4IF2A 1XUUA 4IMAA 1PYFA 1NELA 4R88A 2G4JA 4AZIA 1FDJA 3KP0A 4FO4A 1PHWA 4PMYA 3EEZA 4BCEA 4MKVA 4IGNA 4FLOA 1WPCA 4F2BA 4X60A 3LLDA 4NX0A 1LP6A 2VC5A 3R58A 1A5OC 1PZ2A 4B91A 1PKYA 1H7XA 4DYKA 3AHVA 1XLMA 1E5JA 1OC6A 3ICJA 1X98A 1R86A 4DHGA 1XSKA 3WD0A 3VOFA 4BR1A 4JFUA 4M51A 3GC4A 3CUJA 2FVKA 1PO9A 5XIAA 2J24A 2I1OA 4I6KA 5BCAA 4JCLA 3B0VC 1RK5A 3PZQA 3KVMA 4MG4A 5BU9A 2PDJA 1VIZA 1CYGA 3AS2A 4MWAE 4TQTA 1E4IA 2JGQA 4NKCA 3ZOAA 4HPJA 3TYCA 2E5BA 3OQEA 4Q4KA 2Z28A 2WCGA 2Q8ZA 3EOLA 5KZMA 1PSCA 1UIOA 4ATWA 5LIUX 4JTAA 1K4GA 1LWJA 1EEXA 2F9RA 3U2OA 3RM9A 4KEVA 3NXLA 1VFUA 1S2VA 4H8HA 3BLPX 1DJHA 1DTUA 3VNYA 4MMWA 2E6DA 1V6UA 4UTWA 2WMGA 3RRAA 2PWDA 2KX9A 1IEIA 3B97A 2BGQA 3W81A 1JYWA 4Q8WA 3GWQA 1XGEA 3PZOA 2C3ZA 3W1NA 1OIMA 4TV6A 3I7QA 4AMCA 4IPJA 5D2VA 1EIXA 2ZRUA 1DIOA 4HIBA 3R79A 2NT1A 2DZXA 7ODCA 3OLGA 4RZ5A 1PZ1A 4P7OA 1Q8AA 1ISXA 3UQNA 1WUEA 4XZIA 2CFFA 3IEBA 7REQA 1DJNA 4PTDA 3O16A 1XLKA 1PCWA 1XX1A 1ONXA 3TZNA 7CGTA 1E3XA 5A6SA 2Y1HA 3GTIA 3NZPA 4HK5A 4HYVA 1E6QM 3MS8A 3KS5A 1S5WA 2YFNA 1V3HA 3E0VA 1FWDC 1R85A 4DPQA 3EB3A 1IWPA 4N6EA 4KWVA 5AC5A 4JIQA 4REQB 2DVXA 1B3ZA 3TNOA 4AZ5A 3QV7A 3EAUA 3NPVA 2ZUSA 4CNUA 4D6EA 1DJQA 3U5YA 2QJIA 2DJXA 1KR1A 3TX9A 4AVFA 1YXCA 2RJGA 4JQ2A 1W2VA 3TV8A 1Z8AA 1CXKA 2REQB 3M0MA 4XTIA 1D8WA 3SCNA 1C8XA 1VBRA 5LIXX 1OABA 4AD0A 1M7OA 2WHMA 1PVNA 1TX0A 1AD1A 1BXNA 4F0HA 4PFHA 1HKWA 1TV2A 1UB3A 1KQZA 3VMOA 3EOSA 3HMCA 3L2LA 2QCLA 3SQMA 1I2NA 2WHJA 1UZHA 3T78A 4NG3A 3OIHA 5F2MA 3F2BA 4HNUA 2PDWA 4YPJA 2YSWA 3R13A 4RKAA 1XKYA 4EX4A 2YXXA 2UY3A 4L61A 2PTZA 4A05A 1WCGA 2DIKA 3WY1A 2RGLA 3TC6A 2BFGA 1YDYA 1ZGDA 2I14A 3VA8A 3V0UA 1PYMA 1TELA 3P93A 4Z1CA 3PBWA 5BZAA 5LNSA 1KTCA 4YIWA 1C91A 3RYSA 1V8EA 1LUCB 4NHVA 3UVIA 1EH9A 1JZ4A 4TMBA 4CD6A 3QY6A 4FOJA 1P0DA 4D2JA 3GG0A 4DF2A 3TP4A 1CW2A 1ISVA 3MANA 3G1DA 3VIOA 4AQLA 4TTGA 3WD3A 4HK7A 2IMRA 3FA3A 4ES4A 3M0HA 5LKYA 3KDNA 3BH4A 4W4QA 3MW7A 4GNVA 4XBKA 2Q71A 2VEMA 2WZIA 2CZFA 2Z6IA 3MMTA 4AC1X 2IPWA 7REQB 2ZRZA 3QYSA 1RQEA 1XISA 3UP8A 2IXVA 2WVUA 2ZIDA 3TWBA 3ANUA 2D2HA 3SDOA 3BW2A 5AC4A 5F4XA 3GKFA 1QVBA 2DUZA 3HQOA 2VRKA 1LWHA 1IGWA 3HPFA 3UWZA 3PBVA 4LPCA 2WPBA 3H2FA 4MB1A 3NJ3A 3R25A 1IEVA 5CBBA 1AL8A 3EDFA 4Y6GA 3PWGA 4LC6A 1FHDA 1OZMA 1ECEA 3FJ4A 1QHZA 4WXZA 3DU0A 3GYEA 5JBEA 4EAMA 5H1WA 4MYXA 2DVUA 3TQPA 1B4EA 3IARA 3U9IA 4KS0A 2E1DA 3S9IA 3UG4A 1RCXB 4OV4A 3CEUA 3PHAA 3W1MA 2GLKA 3QKEA 1EWDA 2CC0A 3GXNA 4GZEA 2JF6A 5LA2A 3TMQA 1L2UA 2CZEA 1R9XA 4AVOA 1TRIA 2I5GA 3FXGA 3T0CA 3URNA 3CK5A 3N12A 3MWAA 4KBXA 5L6UA 5BNKA 2VEGA 2V81A 3VZZA 4B5TA 1Q6FA 2ZRYA 3QW3A 2GJLA 3DX5A 4F4RA 4DVOA 3G2GA 3KAOA 2G8ZA 2D3NA 3DEQA 3FA5A 1L6FA 1JFHA 5AHIA 3MCOA 4HP5A 3QF0A 4A4AA 3W70A 3FGCB 3REQA 5C9ZA 4AB4A 2V5BA 3TIMA 9RUBA 2WKJA 1GQIA 2CBJA 2QUMA 4Y9NA 4A8IA 2QMKA 1GORA 2HXUA 3LCFA 4CEXC 3NGJA 2EJAA 2PODA 1WA3A 3LBMA 4OT7A 2BS9A 1WZAA 2VZSA 2Q8XA