4I90A

Structure of the n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus bound to choline
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
302
structure length
302
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
total genus 121
structure length 302
sequence length 302
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i90A00
2ZKMX 3H4XA 4RW5A 4I9TA 5T9CE 1YDYA 2FJUB 2P76A 2OOGA 3MZ2A 3OHMB 3PTDA 2O55A 4R7OA 5T91A 3V16A 3I10A 1PTDA 2PTDA 5T9BG 1QASA 3V18A 4F2UA 4QJ4B 3EA3A 3RLHA 5PTDA 3QR0A 2PZ0A 3H4WA 2PLCA 4F2TA 3NO3A 1V8EA 4RW3A 6PTDA 3RLGA 1AODA 1DJHA 1QATA 3KS6A 4OECA 3QR1A 3L12A 1T6MA 4F2BA 1PTGA 7PTDA 4RV3A 4I9JA 3V1HA 2ISDA 4GNKB 2OR2A 3KS5A 1DJXA 1DJGA 4I8YA 4QJ5B 2F9RA 4I9MA 1DJWA 3CH0A 1T8QA 1DJIA 2OTDA 1ZCCA 1O1ZA 4PTDA 4Q6XA 4I90A 1GYMA 3EA2A 1VD6A 4S3GA 3EA1A 1XX1A 1DJYA 1DJZA 3QVQA 4QJ3B
chains in the Genus database with same CATH superfamily
1XUUA 2ZA2A 3PWAA 4RNJA 1W31A 2ZZ3A 4QJ4B 3RGTA 3ZS4A 1Y5VA 4UFLA 4BQ3A 1ODZA 3ZO9A 3V4BA 4O0KA 2G97A 2WQDA 1BQCA 1NWTA 3NXLA 3N9KA 1KXQA 1SJAA 1KFWA 1ADOA 2OYLA 4HHMA 3DECA 2X2YA 2RFGA 3URQA 2ZWZA 3B4UA 3QV6A 2O9PA 4HA3A 1A5CA 2Y62A 1ZY9A 4I9MA 3OGSA 3MCOA 1M7JA 5A6TC 1V7YA 4QE1A 3LU2A 3KUMA 3QOMA 4K7VA 3SI9A 3I68A 5C2GA 3GNXA 1XH1A 1F07A 1QHOA 2NT0A 1QDSA 1JI2A 2WSKA 1PYMA 3GNDA 2Y5SA 2J77A 5CPQA 4D71A 2ZXDA 4H41A 3S2NA 4UQAA 4GYFA 2Q02A 5U4NA 3L21A 7REQB 4AZCA 3VOGA 3SGUA 1CWYA 3O3RA 5LIXX 1XISA 1W9UA 2PS2A 2POZA 3LENA 3OA5A 2DJXA 5BYWA 3PPGA 1UWTA 4QE4A 3UT0A 5M17A 1QPQA 1WV2A 3GVRA 3JVAA 1AW2A 3N17A 4Y7EA 2PDPA 2IPWA 4DBDA 3RK8A 4HPXA 2GQAA 4Q4MA 4ERAA 4H9UA 1FWIC 4RNIA 1FA2A 3OLGA 1SZRA 3OZYA 1C29A 2R94A 5HATA 2C13A 4IP7A 3UG3A 4HSHA 5KTLA 4DJDD 1NFGA 2V68A 1Z9AA 1H63A 3HA1A 2Y63A 4LUSB 2YZ5A 4E4FA 2FFCA 1AZ1A 4MJ4A 1H50A 3SRFA 1S1PA 1Z41A 5AYIA 4C6FA 4ACYA 4ZODA 4PYSA 3FKRA 1W3JA 1A0CA 5DQPA 1Q3NA 1YYAA 3GFXA 4LCQA 1D7FA 2GVEA 5FSDC 4QLKA 1E9LA 1DJZA 4OJYA 4MJMA 4NAFA 2WK2A 3SCNA 3OG3A 1VPXA 4NHVA 1QASA 4AVFA 5G5IA 4WCJA 3IJ7A 5F2GA 3THAA 4GI4A 2GL5A 2YB1A 1YEYA 2VFDA 2Y89A 3MHGA 5EPDA 2WMKA 4PUUA 5DN1A 2QJIA 1Z69A 3GM8A 2PRMA 3KRZA 4GIYA 4MMWA 4YVPA 2D73A 3S42A 3HJZA 2QLYA 2J7GA 4EPBC 3LERA 2ZXAA 4B91A 2WSRA 1HFBA 4FAMA 4CD5A 3B9DA 1RLCL 5TQLA 3T44A 1FWGC 1EP2A 4DO4A 2PD5A 3UA3A 2POTA 2VZTA 1VFHA 3ABRA 1QTWA 2PBGA 4NZ4A 3O6DA 3BE7A 1K3UA 1OM0A 3H2EA 1TUXA 2PDCA 1RSCA 3SUSA 1QCWA 4G7FA 1NOWA 3JRKA 5C54A 4H9TA 1KNWA 2BVTA 1GW9A 4AEOA 1DWFM 3P93A 4E0CA 5AVNA 3DG7A 4FALA 4XX6A 1DPMA 2V5DA 2OEJA 3VZZA 4LBUA 3NL6A 1Y8BA 3UZ5A 2A7NA 3E2SA 1MRQA 5BMWA 1M65A 4HP5A 1IXNA 4TVDA 3MI3A 2ZTKA 4HKPA 1VQTA 1GVRA 3ABZA 4GOAA 2DGAA 4GCAA 1O60A 1CXKA 1ENUA 1QT1A 4LUIA 2C3ZA 4H2HA 2AL1A 1UKQA 5D8ZA 3TV8A 1E5NA 4L65A 5A8PA 2ZA1A 2B7QA 4MLRA 2FB2A 4F9JA 2C1GA 4L4MA 2VQTA 3LLFA 4JPGA 3LYEA 4IQLA 2FPTA 1BXCA 3KP0A 2DVXA 3CK5A 3R5EA 3CV1A 1ZJBA 3HB9A 4GI6A 3MW7A 1Q63A 4ZB5A 4JHZA 4LAKA 3LPFA 1HZYA 3T09A 5FI8A 3S1XA 3DFYA 2J8TA 3GFYA 5REQB 2YCLA 3SZ8A 4PCPA 4A3HA 5HA7A 5CPTA 3VGFA 2C16A 1F3XA 4ZQRA 4NI3A 5D2VA 4YPJA 1KM4A 2WHJA 2XSXA 1SO4A 3O0FA 3W2LA 3SCOA 2H9AA 1MZHA 1N82A 1SUXA 3KBJA 3T8LA 4D9PA 2GJLA 3CHVA 2JGYA 1UROA 3FJ4A 1OCNA 3EPOA 1U1JA 4AIUA 3CUIA 1L6WA 1FWEC 3VI2A 3ITTA 3D46A 5CBBA 1J0KA 3MMUA 1AH4A 3WDRA 1OC5A 5BXSA 4NL1A 2Z1WA 1XDMA 3QW4B 1ITQA 4AH7A 4IIEA 5LA1A 5I09A 2X0SA 3ELFA 3CLMA 1DHPA 3WNKA 1HL2A 2V3GA 3F5KA 1LL6A 4JIEA 4MFDA 4WSJA 4G56A 5E9XA 5HUPA 1UWAA 2JIEA 1C8QA 4GINA 2VYOA 4M80A 3KM8A 4UIOA 3T08A 3FLUA 3AJ7A 1JPHA 1VPYA 1ZS2A 3MU7A 2PLJA 1W3IA 1CGXA 1WXJA 2YCLB 3KOXA 5HDRA 4X9SA 3GDRA 3NSNA 2X40A 2INZA 4E3VA 2OGYA 1LDCA 3AYTA 2R1MA 1FCQA 3FJ6A 4BCEA 3ECQA 4F2BA 2C14A 2H8ZA 4CN6A 3PJUA 3Q45A 5EKYA 4XZ9A 1VS1A 1RA5A 2WBKA 1LF1A 3WQDA 2H9AB 5C9ZA 4U4MA 2F84A 2QUTA 3MBDA 4W7UA 3P74A 3P0XA 4AD3A 3EDJA 4TTUA 1NP0A 3BDKA 2X2GA 4BI6A 2CZDA 1E6QM 4Q6XA 2A79A 2W5FA 1YPFA 3PUOA 4U3AA 4AZBA 1ME9A 2ZX5A 3DI1A 1MW2A 2FTWA 3R0KA 5CC3A 1XIFA 3K4AA 1PTAA 1GOWA 4AZ5A 3ALGA 4D6EA 4GWEA 1XQLA 3MUXA 4X3ZA 1B2YA 2V2DA 3CHCA 4DBWA 3TJXA 2X42A 2GGEA 4W4QA 1XGZA 2Z28A 3K46A 4Q8QA 2ISDA 1IWPA 4H8UA 3UWEA 3IJQA 2BSLA 7TAAA 3SADA 3OLDA 5ABTA 2J9YA 1JPDX 3TU9A 3GHSA 1W1ZA 4KGJA 3UXDA 2X0HA 2F6KA 4RE0A 3C3UA 3OP2A 3BICA 3O6CA 4JL2A 2OYMA 2YLAA 3KCOA 3GTNA 3K1GA 3SCSA 4PTMA 1KFJA 5CAKA 2W91A 3PUEA 2O0TA 4GY7A 3IAPA 1OFBA 3WG6A 1XRVA 2OXNA 6CGTA 4IXXA 4K8EA 1H7OA 2NX1A 2A7RA 4ORMA 1QOPA 1XIMA 4H9XA 2DSWA 5KZMA 1GJUA 1CX9A 3SCUA 4PUDA 1GTEA 2V5JA 4FNRA 4AIOA 1B0IA 1E6SM 4M1BA 2OG9A 4OFCA 1D3HA 2C71A 1KBIA 2WMIA 1L2QA 1H5YA 3M41A 4CU8A 1X8FA 4IQDA 1L6SA 3RJXA 1TREA 3BOFA 4MIMA 1VBRA 4WLCA 1PTGA 5DX7A 4RDZA 1XV8A 4A3UA 4IGMA 2PA6A 3M0YA 1Z89A 4Z42C 3W7IA 1EGMA 3NIYA 4BK9A 2WW5A 6REQA 3GBDA 4KQNA 4M24A 3A4XA 3WK2A 1KTNA 1VEPA 4LYKA 3R7MA 4I8YA 4C6LA 4JXCA 2DH3A 5C9RA 4JQ3A 3DFSA 4C6CA 4NI8A 4ROPA 1BGGA 1KFEA 2BHUA 1W9PA 4LVDA 1Q85A 3CL7A 5G2HA 1V8EA 3CZGA 2O7SA 4ZB2A 3R4IA 5LKYA 3N34A 2Y7DA 3VNJA 3WQFA 4QR6A 3GH4A 4C6EA 3DFHA 1TPFA 2E25A 4CD8A 3B8DA 1P0EA 3QSRA 3G6LA 5JQ9A 2I57A 4PB5A 2RDTA 3C4UA 2IPGA 1W5NA 2VRQA 1S3HA 4G8TA 3SFWA 3WK3A 4XB3A 4ZTYA 3UJRA 3GFZA 3VCCA 2A21A 4NRRA 1NDVA 5D2TA 1G5AA 1XQKA 4L64A 1UPMB 2VOMA 3CUZA 3L9CA 4JTJA 3N18A 5HPOA 4Q4QA 2QIWA 2WKGA 2GJXA 3PZGA 3U0HA 1U1HA 1M7OA 5EBAA 2WC3A 5CCZA 3LUTA 2ZA3A 1HN1A 4JX6A 2BOGX 3BGGA 1TE6A 4DF2A 2WMIB 4UQDA 4BI7A 1GEHA 1V3KA 3H54A 3H12A 1LUCA 3LCXA 5EMYA 4AEEA 3SCQA 4QJ3B 4DLMA 2XVNA 2PFHA 2OLHA 1XLBA 3P2VA 1PZ1A 4RNFA 3PZMA 2NVDA 3S47A 3GHUA 4B9ZA 4WJEA 3E0FA 3WMLA 3P84A 1VFTA 3LLDA 4JICA 1LLOA 5HJXA 1E4NA 4OOZA 4JTTA 1XLFA 5CGMA 2G3MA 4DWSB 3USBA 4WUIA 1PAMA 3OYXA 4GY0A 1XRSA 4RXFA 3TR2A 4IHCA 1GOKA 4YHGA 1K4GA 4JIPA 2QVNA 3BMWA 4YCOA 1S3TC 4CCCA 4JKKA 3UGRA 4I6VA 4E4UA 3BSHA 4DPQA 3NSXA 1R8LA 3N6JA 3QJAA 1X1OA 1MUWA 1DIEA 1OVDA 1QR7A 1MQPA 4I7UA 3UCQA 1EJVC 2Z1XA 2E6AA 3K8MA 5IBXA 3ZVIA 1M03A 2WLYA 2VFGA 3V0SA 1KLZA 2C18A 3KXQA 1O95A 1GQIA 1ZP4A 2Y7FA 2VFIA 3DYPA 2XM2A 3T4CA 1S5VA 3GW3A 2G3IA 3N4FA 4CNPA 2GDUA 3OVQA 4IH3A 1O5RA 5BNKA 3APGA 1J01A 3Q2DA 3A9IA 1BF2A 3CWOX 3CAKA 4X2PA 4KEUA 1SZFA 2QV5A 1C7TA 2P53A 2X05A 3TTSA 2MANA 2I14A 4PBEA 2Z7KA 2PDQA 4KCUA 4XVDA 3QMTA 4GQRA 1HJQA 1V77A 2DZXA 3IJLA 1C90A 2WB5A 4HHPA 4WSKA 3APTA 5AHIA 1RAKA 1H11A 4W5UA 1DE5A 4LF1A 3LTSA 5DXXA 1HVXA 4Z2JA 3SN1A 1EJ7L 1BF6A 2X7WA 4OBSA 5FKYA 4KIRA 1K7FA 3VGEA 3DFPA 2JKEA 3W6MA 3EWWA 2OPJA 3C8NA 1XIGA 3P61A 1WCGA 4KWWA 3DHFA 4WJXA 1RXOB 4LEQA 1I0DA 3XIMA 3PZOA 3L2MA 5KZ6A 4REQA 5D2XA 4A8LA 3CT7A 2OLSA 2ZIDA 3C5QA 4BF7A 4AB4A 1K03A 2ZC8A 5DT7A 4EANA 5HR7A 1UH4A 4PUNA 2I7GA 1ZRQA 3W7JA 3G77A 2WV8A 2OODA 1EPVA 1JZ8A 1YPXA 2NWSA 5AN7A 4QDWA 4GYJA 1J6PA 4P5UA 3RX4A 4KF1A 2OGJA 1QJWA 1O94A 3FS2A 3V1HA 2WQPA 2PDWA 3FXYA 4A3QA 3PZVA 1OYBA 3WEOA 4P7QA 1SJDA 1B1YA 2NW0A 2WVTA 4A3RA 3ZM8A 4X22A 4D6GA 4CN1A 3T0BA 4DELA 2JE8A 5DMNA 4MZ1A 3UEQA 3NPWA 3FEMA 1KLYA 1RCQA 3AXKA 4GVHA 4A22A 5SWUA 2CHOA 2QMJA 4YTTA 2FZ9A 2QCHA 3WQVA 2DW6A 1Z3NA 3RJYA 2DUZA 2J7FA 2QJJA 1OB0A 3BMXA 3GRIA 4DJFA 2E6YA 3W7LA 3CAWA 4MB4A 1L6GA 2A7PA 1R7OA 2J9XA 3W6LA 2XN1A 1JDAA 3T42A 2DT1A 3QPZA 3EEZA 5IM51 1O1HA 1EL3A 3QGAC 1P6CA 1TIWA 2Y4SA 1TWWA 3VMPA 1LZOA 4URIA 4ATLA 4ZOBA 4JKLA 1TWZA 3F4WA 1M53A 1PKMA 4PCFA 1V3LA 4PL1A 4V28A 2VX4A 3W2UA 4GJ1A 3GUGA 3DBNA 3UR2A 4RNHA 3F4VA 3NR0A 1UWUA 3BW2A 4LU0A 2VUNA 3VKBA 1SZNA 3ANVA 5PTDA 5FAJA 2VM8A 3MCNA 3KZSA 4TQTA 4Q4PA 2FH6A 4RV3A 3BL3A 3ARSA 2P5NA 1GYLA 2XJ7A 3KBMA 2E5BA 3PULA 1B90A 4A05A 1YDNA 5T9CE 2PMQA 4LCSA 4DAFA 4WRHA 1A5OC 3QR0A 3F1QA 5HWNA 1JFXA 3URBA 3EPNA 3TSDA 1H7XA 5A8MA 3R8RA 2OR2A 2CLFA 3TA6A 2HBXA 2AMXA 3HQ1A 1UR9A 4GYKA 1ZLPA 5TBOA 3ZJKA 1RCXB 4NKCA 3VE7A 3GG8A 3SQMA 3AS0A 1MFUA 4XV0A 2FJUB 4EX4A 4W8LA 2YBVA 1R3VA 1TPUA 1QRQA 1AODA 4F79A 3CBWA 1H1NA 3WK1A 1XYFA 2PZNA 3RIKA 2YKKA 4XAYA 3RF9A 2BXYA 4HVXA 1FWSA 1Q6QA 4DWSD 4NX5A 4A35A 1W56A 4EAMA 4MDPA 4HA1A 3WNMA 4DY1A 2P76A 3PTDA 1ISVA 1UKOA 4P8VA 3VINA 3PTMA 1H41A 3ITOA 1U5HA 4MZYA 1S5MA 3QKZA 1WKEA 3UZZA 4LUSA 4EPKA 4JNYA 1A5SA 3VGDA 4GIEA 1XXXA 3LCFA 1FWRA 1QW9A 3G1SA 4D1IA 2PWHA 4K8GA 4ZSUA 2QJNA 1PE1A 3U5YA 3O05A 4PMVA 4HB7A 3B3DA 1KV5A 2VEKA 1VFOA 1RD6A 2WMJA 1KM1A 1XLIA 3B9NA 5HJLA 3O07A 1AL8A 4IG2B 1GOXA 1XR2A 3BXWA 1ECEA 3LDVA 3E2RA 3NDZA 4UR7A 4J7RA 1UJQA 2BXVA 3AIBA 1BWKA 5FJUA 2VWSA 3NO5A 4MAZA 3IGXA 3SGZA 1KM2A 3N14A 1UD5A 2XTKA 4HJWA 3PUDA 3WNPA 1DP0A 4XAFA 3FNDA 2P0IA 3BLFA 3KOYA 3PZ9A 3GXDA 4KRTA 3EB4A 4MB3A 3QTPA 3M43A 3RLVA 1Q13A 4RW3A 2XG9A 1E3ZA 2HWGA 5T26A 1FCUA 2GLKA 2GYIA 4QJ1A 1XBYA 1B30A 1A53A 3CGTA 1WB0A 4OV9A 1M6JA 3VD4A 3CM4A 4B5UA 2F61A 4AD4A 3QV8A 3BC9A 1EOMA 2Y8VA 4AYSA 4KFPA 3PG9A 3DHDA 1E1CA 3BG9A 2PLKA 1XJBA 1N2VA 3PF3A 1J96A 5LNWA 4HMCA 4E3TA 4GD0A 1GUVA 4JX5A 1WUFA 3N2XA 4L5ZA 1DWIM 1A3WA 3MDUA 3CT2A 5FJRA 1UCWA 1H3GA 4DYJA 4M81A 1KR1A 5LIYX 1JL8A 4MNJA 3WBAA 4Z17A 1PDYA 1FP9A 4CQ9A 2W92A 4D2JA 1VHCA 4G6CA 3KZPA 3BVJA 4MKVA 4S2BA 4A2SA 2WSQA 2WVUA 2FTPA 2H6RA 4A21A 3THQA 3NPVA 3MCMA 2VMFA 2DQXA 4A6GA 4CCEA 2WSYA 2XVLA 3HV8A 3LXAA 2VOTA 4FIQA 3E96A 2BASA 3UNDA 2BV9A 2R6OA 5LXXA 1BG4A 2KAUC 3M6DA 3CH9A 3M0JA 3FAWA 3LTYA 5I24A 4Z2HA 3TOPA 3WFLA 4L1WA 3LQLA 3QC3A 5BRPA 2EXOA 2WMHA 4W87A 5DFAA 3RDKA 1R85A 4JTHA 4W7WA 2EG7A 1HUVA 1XLEA 2NXGA 1S2VA 1HIZA 2X30A 3TYZA 3CL6A 4HZ6A 2RJGA 3EMZA 3GSMA 3CTTA 1VRXA 3HTWA 1BAGA 3T0DA 3UJSA 2CU0A 3TNBA 2FZDA 3E5BA 2NVAA 3KL5A 2OT1A 2ZYFA 1JPKA 2CZFA 1E0XA 1LROA 1UZ4A 3V0UA 1O12A 4HPGA 2JK2A 2RKXA 3FK4A 3UVAA 1OCBA 3DKJA 1K02A 3TWAA 3TONA 3W75A 3P5ZA 2HCVA 3WMSA 4CUCA 2ZWYA 1CGWA 4Z0JA 4HMDA 2C8NA 3T9PA 2VZVA 3VVGA 2OU4A 3H2OA 2Z6IA 3V35A 4L9XA 1BWVA 3DDMA 2EKCA 1TA3A 4F9DA 1UHVA 4D6CA 1R0MA 1JCJA 3P5YA 1KGWA 2IPJA 3OB8A 2ABBA 3BLDA 3FYYA 3A12A 3VNDA 4JQ4A 1THFD 3UR5A 1TPEA 1ZFJA 3G2GA 4O57A 3V16A 1W5QA 1BGAA 2R1NA 2G4FA 4RLIA 5FACA 4UTIA 1E5JA 4QROA 3COTA 2J13A 1NDYA 1CYGA 3WJWA 3IJDA 1WYIA 4I3GA 2QT3A 4IICA 3WDJA 1P0BA 1OK6A 3W7NA 1BXBA 3E0VA 2CITA 1K4HA 3VIKA 1JCMP 4L9YA 3GTIA 3GNRA 3FY1A 1W0MA 3FKKA 3WF2A 4N9DA 1XLAA 3CHEA 4FR6A 3WH6A 1CPUA 3ABQA 2G0WA 2ZXQA 3KVKA 1UWIA 4QITA 4EVZA 3VD9A 4OZOA 3PPCA 4I9AA 2CZVA 3HBLA 3O6YX 3L65A 4OVXA 2C0AA 3UVIA 1K8ZA 4FOUA 1UH3A 4LV9A 2I5QA 3VDBA 2XIQA 1QUMA 3IACA 4NT0A 1W1A1 1K8XA 3GDBA 3G22A 4UNKA 4ECLA 3NZRA 5HQLA 4O1FA 1BSLA 1SW7A 2QPUA 3FHAA 3AHVA 3UR7A 1OZQA 5JXQA 3IGHX 4XSLA 3LPOA 2I17A 5H8MA 2OEKA 1QHPA 3K8KA 3LHWA 3WK0A 1E71M 4UQBA 1EOKA 4WIWA 3W0KA 5CGTA 2BGNE 1VP5A 4PSRA 4J3SA 1IEIA 3W27A 1GHRA 3EDDA 3LM3A 2EJ1A 2FJKA 1VH7A 4E2BA 8TIMA 4M8UA 4UOQA 1KKOA 3LV6A 1GVSA 2FHBA 3WLKX 2WNZA 3AIWA 2YDAA 2RHGA 2C15A 5EGRA 2VDGA 1FY6A 1W9VA 4G2DA 3CV6A 3EAUA 5CEWA 2YXXA 4DJFC 4JDBA 4ADSA 5A6AA 3MUAA 3NOEA 4UXDA 4FX7A 2WCAA 1ICPA 1LOSA 1E9YB 4IQEA 3SEPA 3H6OA 3WQ5A 5HNTA 4KRUA 4UCFA 3S2JA 2VC5A 3AWOA 2E28A 3TCEA 3MVIA 3NQEA 3VKJA 3Q67A 1GQLA 4F8XA 1CBGA 3WLNA 2X8RA 4WOQA 2ZRWA 5CZTA 2QGHA 1TV4A 3MV01 3MMTA 4WDUA 1JRBA 4Q8PA 3HO8A 3RR1A 3GNOA 1IYXA 1OFPA 3Q58A 2HROA 1MDRA 1H09A 3P80A 4JCLA 3V3WA 2Y24A 2Y7GA 2HMCA 3L5MA 5CZKA 3F4CA 1O5QA 5IOBA 1UWSA 3B8TA 4GPNA 4US5A 1JGMA 1MW0A 3CWHA 3BLLA 1JJKA 1Q6RA 2DEPA 4MDOA 2JBMA 1IEXA 1FWTA 1MZRA 5C71A 2F7FA 3KE0A 4OOUA 3TJIA 4B15A 3QMSA 1CZ1A 3RUBL 2WAGA 1W1PA 1EX5A 1R5YA 1RALA 5D30A 2PTDA 4C65A 5C9UA 2RDUA 2DT2A 1FCBA 1VGAA 3R6IA 2YA0A 3BJFA 4AHPA 1R2SA 3CLWA 4GQ0A 1CGYA 1F9CA 5CPNA 3FA4A 2JF6A 4GH1A 1B3ZA 4GIAA 4KERA 1ADSA 4H8HA 4PC8A 4MJZA 4LY8A 4O15A 1WPCA 2FLIA 3NDOA 1LRQA 4PRRA 3ZT6A 2VEMA 1VJSA 4WXZA 3W7OA 2FHCA 3O06A 2PUZA 3GZ3A 2CLEA 4GC4A 1KCLA 4YL2A 4GVFA 1T96A 3K1DA 1VIWA 4UTMA 5DMLA 3BSGA 3B9OA 4K1GA 3PBYA 3S5YA 1ZAHA 4XD4A 1JF6A 4RE3A 4IFKB 3KHDA 1PX4A 1SQ7A 1JYVA 3WNNA 3PK7A 4F3HA 2XIBA 3M7SA 1BD0A 5LZLA 5I3JA 4RCXA 5JU6A 5EFDA 1TPC1 3QV9A 3H4XA 3MDWA 1EB3A 2VWTA 3S5SA 3PN8A 1KCKA 3QC0A 5M2FX 3A3HA 1SFLA 1Y5WA 4ZXLA 4ZL1A 3NQ6A 2QCEA 1UOKA 1X98A 1DEDA 3LMYA 2QJMA 2HSAA 4D1JA 2ICSA 4LAOA 2PDKA 1XM3A 4B92A 1POKA 3I3DA 3MZ2A 3H2MA 3HV9A 2A3CA 4YMZA 1E73M 2BBFA 1DJHA 1XIBA 1ITUA 3T7VA 1Q65A 4DJFD 3S1GA 1EF3A 3Q94A 4IL2A 5CPSA 3WLTA 2NSOA 4GQBA 1BPLB 2A2IA 1XKYA 5AB3A 4AC7C 1GZGA 2XM1A 4PH6A 1TMHA 2DIJA 4LX4A 2Y7EA 3UWWA 2DZAA 5AZ0A 3CO4A 2ANUA 5LIUX 4HBKA 3S5NA 4GUIA 1GVFA 3S6OA 2QQ6A 2E6DA 3BLEA 1EYEA 1OT1A 2CLLA 2XH7A 3QV7A 5I3KA 1DTNA 3QZAA 1TYGA 4KESA 3QLDA 3AU6A 4IIBA 1MYRA 3IUHA 4CQAA 4F66A 1BKHA 5CG0A 2WNQA 2CBJA 1KR0A 1J11A 2O9TA 1TPH1 2P88A 4M7TA 2XIJA 4L6DA 4H2CA 3L4UA 1X38A 1XSKA 1JUEA 3IUDA 4LYPA 4LYRA 3IUIA 3M5ZA 1XHGA 3W1TA 3LBCA 4DI8A 3WD2A 1XLDA 2EJAA 4NP7A 4L4PA 4AZ7A 3GWQA 1GZJA 4XAZA 5J8LA 1VBUA 3WDIA 3OYZA 2XFWA 2IKIA 4RV8A 4U5KA 3GKAA 3PB2A 4WHBA 1A50A 2VXNA 3PPFA 5A3HA 2E8ZA 3WF1A 1JULA 2QZRA 3CWNA 3GIQA 1SSDA 3AALA 3RX2A 4K8HA 4E38A 3LGDA 3QZ6A 2PDXA 3PZNA 3W7PA 3N3MA 3R0DA 3BH4A 5D05A 4WKAA 3CPRA 4LYQA 3CQ0A 5ABFB 4RUBA 1WXYA 1GGOA 3MJMA 1J10A 2E7FA 1EPXA 4X63A 2HK1A 4PL2A 3VIOA 2P1FA 4ZENA 3BJTA 1XLLA 1XW8A 5CPOA 2QNEA 3FJNA 3PFRA 1I8JA 4RE4A 4CQCA 5C8BB 4HU3A 4F0KA 1WKDA 2XN0A 2QUUA 4H19A 3WCZA 3BARA 2FPVA 3VO0A 1TJ2A 1R38A 4ZO7A 3KFTA 2GVYA 3VX0A 2BODX 4KIEA 3U3HA 3QQ0A 4HU4A 1V03A 3CAVA 1DL3A 1XYZA 3QF0A 3W26A 2CC0A 4US5D 3LX9A 4ZFMA 3M44A 1MEWA 2R91A 5FF3A 1KC7A 4Q4OA 2PWEA 3LCGA 3W74A 1TV2A 3G8EA 4CNTA 4GZ7A 4CQBA 3TW9A 3WD0A 2D3NA 3F5JA 1GQKA 1HJUA 4Y90A 2BWGA 2CERA 5A6BA 3WL1A 4HQVA 2V82A 1G67A 3CAQA 4O1CA 5D2WA 4Z2LA 1XIHA 1US3A 2VP8A 3KVLA 1JNEA 2V30A 3B0PA 1W6TA 7ENLA 4RW5A 1GVQA 1V6UA 3HPAA 1JPIA 5H6HA 4XQ6A 2VEFA 2DUXA 3VCRA 3K4DA 4PUEA 3UP8A 5AYZA 2YA1A 9XIMA 1VCGA 2O92A 2NQ9A 3FA5A 5I77A 1HGWA 3W7RA 4O8RA 4H9ZA 4GO9A 3HQOA 5F2IA 2YOCA 4FI4A 4ICNA 1B31A 1EBGA 1W9BM 2VQUA 3FDKA 1SO5A 3I7QA 2JALA 5CSUA 3G1VA 2W6RA 1DWJM 3N29A 3QQ1A 1I2NA 3LZ5A 3WJXA 2DH2A 1EF2A 1LOQA 3U2ZA 5HANA 3VOFA 3W53A 4D8LA 3R2GA 3B9AA 2XUCA 3QSTA 1YX1A 5DRCA 5I2UA 1W9XA 2HS8A 2Z6JA 5KZDA 2YDQA 4EACA 3PVFA 3C52A 4W86A 2FHFA 4ZOCA 3HQPA 3UR8A 3VNKA 3A3WA 3STEA 2HNHA 2A3HA 4N42A 4TV5A 1I9CB 2DT0A 4Q3MA 4AWTA 3VX1A 4I8DA 7PTDA 2YSWA 5CKSA 3W70A 4QCEA 1QI2A 2Z25A 1Y7VA 4AVNA 2Z1VA 4DO5A 2Y61A 5A6BD 4H7VA 2TMDA 4O1BA 4CU7A 4IF2A 1RP8A 2RDXA 3NQDA 1TTIA 1KGUA 1ZGDA 4DN1A 4REQB 4B16A 2VEIA 2Z4GA 1ZBCA 3FAXA 1NOFA 4PMYA 2J7EA 1E51A 1WAUA 1Z7AA 3G1AA 4DJDA 2QDEA 2A85A 3EX6A 5C0QA 2R82A 3N19B 3PZUA 3CO8A 3E74A 4C6OA 3UPBA 1XD1A 3SSJA 1DYSA 3GLCA 4A2RA 4O18A 1Q6EA 3CXOA 5A1AA 1BKSA 4N2YA 5CG7A 4AFYA 2BTMA 2QPSA 4QSFA 4IUGA 3DERA 3HF3A 3ICJA 4KPLA 5AC4A 1YTEA 1YXYA 4MUZA 3TYUA 3ITCA 1K1DA 1LG1A 7CGTA 4GIRA 1LP6A 3NVDA 3M4HA 3H22A 4PB3A 2HBVA 1ZSXA 1DQWA 2F38A 4GNJA 2PDIA 3CYJA 3KOZA 4IUOA 4JFTA 1OD0A 4JBRA 2Z2AA 4NF7A 2YBTA 5EMKA 3OGVA 4FXJA 4H6RA 3NM3A 1B3VA 4ZBCA 1F6YA 4R7OA 1ZENA 1SO3A 4IX2A 5AECA 4LANA 1W17A 4H1ZA 1P1XA 3BCDA 4YVXA 5C9XA 2CHRA 4J3TA 1FWNA 3JZUA 3H70A 3A9BA 2YXGA 4X9YA 5GJPA 1RBOB 2FDMA 4QE5A 5BXTA 3UZYA 4Z2GA 4QEEA 1RK6A 3DFNA 4JTSA 1XRFA 4AY8A 3R8GA 1HW6A 1ZJAA 3ARWA 1EDTA 1JI1A 2OLAA 1GVIA 2ZDSA 3V18A 4UMCA 1VIZA 3P60A 4C5ZA 5C2CA 1RBLA 3DFQA 3WQ8A 1XH2A 1TZ9A 4DLFA 2XWDA 3SFKA 1ONXA 4BWLC 1CXLA 1OT2A 2Q09A 1CT5A 4S1FA 3AMLA 1BVZA 1P7TA 1KRMA 1TJ0A 3GVVA 3OZMA 1ODUA 3MP5A 3PTQA 1U5JA 4O1AA 2O4QA 2ZDRA 5H91A 5A6LA 4DUXA 1KWGA 1MXSA 4M56A 1X39A 4ATDA 3B4YA 4JQ2A 3PJTA 2Q01A 2Y1HA 5J04A 1NU5A 2FGBA 4YNGA 4UWMA 1LLWA 4MFEA 2OSYA 1X7FA 1KV8A 5TNVA 1K8YA 4Q8WA 4ICCX 4HK6A 3VOJA 4DWSC 1UA7A 3RO6A 1ZZMA 1E0UA 1CXEA 2OB3A 4GGBA 3INPA 2JKAA 4KGLA 2ZBTA 2ISWA 2XGBA 2HPMA 2CXGA 4B90A 3HFYA 2OVLA 1G1YA 5BROA 1EZWA 2V2CA 1YXDA 4IMFA 4UMAA 1J9YA 2VX7A 2IKJA 1R9ZA 1J6OA 2DU2A 1SR0A 4EXQA 5AYBA 1PX8A 4FO4A 3QVQA 5KZEA 1PO9A 3UXIA 4UFMA 4M29A 1VLIA 3W07A 4QDMA 4K6AA 4AUBA 4LW7A 3QYSA 4H01A 4DBUA 2EPHA 4UTUA 1DJXA 1PWMA 5FEZA 3M0ZA 3N3TA 2WHKA 1DBTA 3RILA 2FIQA 3MVTA 2VEPA 4C6KA 1OYCA 4LH8A 3BG3A 4C60A 4F2TA 3MHUA 4GUJA 4QNEA 1WDPA 5G2IA 1Y65A 1EEXA 3T05A 1Z6KA 3TYEA 4KH2A 2P8BA 2GFTA 2Z1BA 3URAA 1GOMA 4JQ1A 1DXFA 4XBKA 3LBOA 4MNKA 3E5PA 5DMYA 3FW6A 4AHOA 1JD7A 2OX4A 4AMCA 1TRDA 2OWWA 4DZ5A 1E3XA 1YQ2A 1QOXA 2QCMA 4O0QA 1ALDA 3EGJA 1NIUA 4QIUA 2UZ9A 4HCHA 2VC6A 3O7UA 3OZOA 4GO8A 3LI0A 3EWUA 4L1GA 1T40A 5GNZA 3DX5A 2PURA 3ARXA 4BKNA 1GOIA 1O5KA 3HGOA 3PAOA 3IVTA 1ZCCA 3SQSA 3NZGA 5A6MA 1VFUA 1TZZA 2ACQA 3TWBA 4JTIA 5K4XA 3T07A 1FWBC 4XD6A 3FXGA 4ZQNA 3WZ0E 4MWAB 1UD4A 2EPOA 3M16A 1S46A 3VKDA 2ON3A 3M0LA 4IIDA 2Z2BA 3WBXA 2XZ9A 4Y2WA 1JDEA 3GS6A 3I4EA 4S39A 3EX2A 4DJEA 2VCBA 3GVGA 5EB8A 4AWEA 2X1UA 3BAJA 3WD4A 1SZEA 2ATSA 1EEPA 1B57A 2E5CA 1F3WA 3O6AA 3PSVA 1M01A 4MWAC 2ISSA 1TCMA 2ZTJA 2QCNA 4JZ5A 4XZBA 5CLWA 3KBNA 4Q8NA 4UZUA 3KRUA 4CD6A 1XLKA 4JFWA 4UTHA 3OJGA 1QPKA 1QFEA 3CIWA 2DZBA 5LSMA 3BAXA 3BCJA 1RPKA 1DOSA 1HKJA 3XISA 4A8NA 3MP4A 1R3YA 1EWDA 4LS1A 2E6FA 4NXKA 4LB4A 4LAZA 1Q7MA 1Q8AA 1QXLA 1IZKA 2HDJA 4TMCA 4J5NA 1GONA 4TVUA 3JW7A 5I3IA 4GXMA 4HK5A 3CB8A 1I1XA 3UPMA 5BU9A 2PWFA 2A0NA 2PU0A 1XCFA 3H2CA 3W83A 3WJZA 4GBDA 3W1MA 4CCZA 4H7ZA 3FHQA 4H7CA 2NUWA 4CVWA 3ZT7A 2G3FA 1OJXA 3RITA 1B9BA 2J8GA 4ACZB 3QEZA 5DT5A 3W28A 3H53A 2G41A 3CZ8A 5HOSA 4PRWA 1PZ2A 1J8VA 2FZ8A 4FLQA 1X1NA 3W73A 1R9YA 1SGJA 4NYUA 2JKPA 1I4NA 3TAKA 1TA3B 1VCFA 2DIEA 5JBEA 4J3XA 2WSPA 3ITGA 4H8VA 2UY3A 4JTLA 2OO6A 3DU0A 2QDGA 1LT7A 5DCEA 3W3OA 1PBGA 2DSZA 4I90A 1R87A 1H7WA 1REQB 4GISA 1CCWB 1XL9A 5LGZA 3P8JA 3OQEA 3IIZA 4PFHA 2DW7A 3R43A 5K4ZA 4C1KA 1HGYA 3EX1A 1E6RA 1C8VA 3VUSA 1TRIA 3QY6A 4C6DA 4JY8A 3DXIA 3F2CA 4N4QA 1HX0A 4H04A 2A6LA 4LPCA 3S4TA 2ZRYA 1A80A 2J66A 4C6NA 2OSWA 1PIFA 1TQXA 5DCDA 1Q4WA 3U7BA 1DWAM 3UG8A 1IHIA 3W76A 2D22A 4XBSA 3IGSA 3HURA 4JR5A 1OIMA 1BYCA 5A6JA 5A69A 4LVBA 4OBRA 1MO0A 4O28A 3LBMA 4AD1A 3TXVA 3JR2A 4A8IA 4P7LA 1MQRA 1J0ZA 3RLGA 1XIIA 2CLOA 5HNRA 3NM1A 4D72A 5I7GA 2XVPA 2V5BA 3QMRA 1REQA 4MLJA 1ONWA 5D9MA 5IXEA 3HG4A 1LL7A 2W61A 4G1NA 4F48A 3SRHA 4S3EA 4NU7A 1XF0A 3ARZA 2FQIA 3GC4A 4AF0B 1RBAA 2HQAA 4ZQPA 3NGJA 4QRNA 3CZEA 4C1NB 3GUWA 1BQGA 4PSPA 2PTXA 3NGFA 5DBUA 2WCSA 5EY5A 1ISYA 3T2OA 1L9WA 1OK4A 1TPVA 3PBUA 1WZAA 4JIHA 4ML9A 4HNCA 4H6EA 5I03A 5DMMA 3DG6A 2O7QA 1TTQA 1F5ZA 1TPB1 3RFAA 1UR3M 2XH4A 1QVBA 4ADTA 1QAPA 2VVNA 1NQKA 4NILA 4HT3A 5H1WA 2IW0A 2J47A 5I6SA 1W2VA 3TR9A 1P43A 3W22A 4HA4A 5IFTA 1QWKA 1WBJA 4Z1CA 3HFTA 3H23A 3HZ3A 3ZR6A 4AYGA 1FWDC 3DFTA 4QTGA 3AWNA 4EWND 1GQNA 1IF2A 4QAIA 3ANUA 1UD2A 2QCDA 2YJQA 1PTDA 4XBJA 5E6ZA 2J74A 4R27A 3AXXA 5H8UA 1V3JA 4PMXA 1XH0A 5A2CA 1IV8A 1EA9C 1AJZA 1TX0A 5D04C 2ESCA 4BQ2A 4PCTA 2C19A 1A0DA 1ZUAX 2EBNA 1D2KA 2NQLA 2FDSA 1LWJA 3AQUA 4GJIA 3H21A 2XSBA 3M0MA 5T8GA 4RDVA 2BNJA 4TVCA 4DWDA 1VCVA 4GBUA 3TK7A 2VGGA 5LIKX 4XIAA 3M6YA 4MUPA 3QPYA 3MUZ1 1MQQA 4AD2A 1A3XA 3BZGA 2ZICA 4LC8A 3YPIA 3FGCA 3UU0A 2JQXA 2OKOA 2BOFX 2QPXA 1D8CA 4HCDA 1GHSA 2ALDA 3STGA 3AHYA 5FJOA 2QCCA 3G1DA 1B4KA 1UR2A 3MKCA 1QI4A 2ACRA 3BZJA 4ZO6A 3CV2A 4NZ5A 5EBUA 4JTRA 2CWNA 1WDWA 4QSHA 1US2A 1H7PA 2WJFA 4YXGA 1I75A 3GG0A 4U2YA 4G7EA 3IV8A 1QBAA 1WP6A 1YBQB 1KBKA 3EWYA 1V4YA 4UCGA 2AOSA 1DORA 3GNPA 3DYOA 1RJRA 1ICSA 1M04A 3D5HA 1D3CA 1H49A 1QK2A 3NEHA 2YCEA 1NQ6A 5I0DA 1RD5A 3ZFHA 2CXEA 5CZ0A 3KHJA 3DEQA 1UB3A 2GJXB 1HKKA 3DG3A 4NAEB 1KRCC 8RUCA 2P3ZA 1S2TA 5GNYA 1WBHA 4PEEA 3EDKA 5FJJA 7ODCA 2A3BA 2D69A 2VCCA 4ASTA 2G37A 4R34A 1IZCA 3OBAA 3GH7A 3NEVA 1S39A 4ZOEA 1D7KA 4Q32A 1GORA 3MMWA 3WQPA 3T6CA 4Z0SA 3OOQA 2E9LA 4AXNA 3IVUA 4NQ1A 1O68A 4HYRA 3F7JA 1U2YA 1IT7A 5CC6A 3LOTA 1RQEA 1PYFA 3GDTA 3REQB 2WANA 1UWQA 4HNOA 2DUAA 2YCJA 1XWYA 1Y0EA 3I3BA 1WZMA 4N6EA 1SW0A 4TU1A 4KW2A 1RP9A 5LHEA 3VAVA 3L12A 4LC6A 5LGXA 1VHNA 3MA8A 5DELA 3G1FA 1JR1A 1GKPA 1O4UA 4S2CA 3GXPA 4U33A 1Z48A 1EJSC 4LOCA 5HWJA 1UKTA 3WQGA 4HIBA 2XWEA 1UR4A 1WDDA 1UZ1A 1UZHA 1WOBA 4KFNA 2PP1A 4YTQA 2UY2A 4YYCA 1MXDA 3AS2A 3KOWA 1BSIA 1QW7A 2X41A 1T8QA 1MRAA 2QUMA 1ZBWA 4Y6GA 1VEMA 2MNRA 4M7SA 2R8WA 3NQ2A 1P4CA 1KTCA 1W37A 1VLWA 4WK9A 1V0NA 3EOSA 1UWRA 5GQBA 1H1YA 4UFHA 3N15A 3WH7A 2ZQ0A 3WLHA 1QWGA 3QKEA 1OFDA 3R12A 1Z44A 2AAMA 2Q71A 4JTGA 2OZ0A 3CMGA 4Y8EA 1F4AA 3GG1A 5JBDA 1W3LA 3SUWA 4D6IA 1MI3A 2VX5A 3BO9A 3VYLA 5HNNA 4JTDA 8XIAA 3CIXA 3AS3A 3C0QA 2W67A 3HM7A 3QOKA 2VGIA 3S6DA 3T78A 4QGCA 3M0HA 1NF7A 4H00A 5A6KA 3ABOA 2WZIA 1F7BA 3H24A 4GQGA 3REQA 1VB9A 2E77A 3M47A 1PCWA 2GGJA 1XIEA 3RNDA 4DUOA 4MY9A 4C6QA 4MZ8A 5K3VA 1JZ2A 1HP5A 1PKYA 2R24A 1T8XA 2J25A 2HZGA 4C6BA 2G95A 1ISXA 4JTAA 5AC5A 4BWLA 5C2XA 3PSWA 2V3FA 3HMCA 1FWFC 1PHQA 4DYEA 2CBUA 4PTNA 5CPLA 4IGSA 3WIJA 1A0EA 4JYDA 2Y70A 1LORA 3MY9A 4GE8A 4DQWA 1JZ7A 3A47A 3C86A 4GABA 4QFUA 1QPNA 1FHDA 1QI5A 1K6AA 2PDBA 3CJPA 5ABGA 1P6BA 1BTCA 3IJ6A 3IPWA 4FSAA 2ZUWA 2QIIA 2WZMA 2GGHA 4WVXA 1BYDA 2A6NA 4MM1A 1MXGA 4XZLX 3HG2A 2EGZA 3L0KA 3MSGA 4RDWA 3SQLA 3GU2A 4OWGA 2Z24A 4K37A 1HKIA 4EIVA 4DXVA 2KX9A 3NL2A 1I45A 3W23A 3NXFA 3TSMA 5IFPA 1J93A 2O4MA 1Q66A 3PS7A 1XIJA 3BWWA 1VENA 1T41A 5CJ5A 5I00A 2Z0IA 1E6XM 1KBJA 3CUFA 1ME7A 4QXIA 4ZQCA 4JFUA 3THCA 1RVKA 1G7UA 3VIFA 3T1GA 4FIRA 2NUYA 4ZFCA 3UNTA 2FFIA 1RV8A 4ZEPA 2OOGA 1QO2A 2C0HA 1T7LA 4DPPA 5E1QA 4OIFA 1JCTA 5IRPA 3OTRA 1R7AA 3GYCA 1Z32X 1WKYA 3H7RA 4YVVA 3AC0A 2E3ZA 5AFDA 3LA4A 5BWAA 4UNLA 3WBEA 3LB0A 2VT0A 1JEZA 2G3NA 1DHKA 1OCJA 2JIWA 3IANA 4FMVA 1PEZA 4GCXA 1EFZA 3PNZA 1EBHA 1UW9A 1AMKA 4P8UA 1UBSA 2ISFA 3KTSA 1JYWA 4OUEA 4UZSA 1GPFA 4KS0A 3EWXA 4S3KA 4AISA 4PR4A 4PMDA 2D23A 3V1PA 4X61A 2GUYA 1D8WA 3S9IA 2GJNA 1X6LA 5BMXA 4DJDC 2ZUSA 5JH1A 4TX8A 4GKLA 1H60A 5TD4A 4O10A 4LRTA 3I6RA 4HHHA 1F3TA 5IDZA 3VIJA 1I60A 2ZVRA 5CQ1A 1JUBA 2Z00A 2BP1A 3IV3A 3CB3A 4HHLA 4K68A 1DQXA 3GR8A 3KOFA 3TUUA 1LRNA 4GVGA 4UC5A 4PZVA 5CC7A 3SSZA 2AAAA 3GE7A 1ADDA 4WY0F 4K39A 3B9EA 3SB0A 3GU9A 3SCPA 4CCDA 1Q2SA 3B06A 2QKFA 1EGZA 4PCSA 4HNTA 4F0MA 2WJDA 1VC4A 4NNCA 1HJSA 4LTSA 2PLMA 5E70A 3VUPA 4J28A 4R5EA 1BG9A 4GGHA 3L7RA 1CDGA 1YE6A 1G94A 1GVEA 1YLVA 3AAMA 4PTXA 1PHWA 3W7HA 4TMBA 5E09A 4IG2A 3WLSA 4JNZA 3T8QA 2Z26A 4G1KA 2EPNA 5D09A 1W3TA 4UFKA 3FCPA 5A94A 2B7PA 4MKSA 4HJFA 1TUFA 3I10A 1NF0A 3ZXWA 1A5UA 2X0YA 4BS0A 4AY7A 3F5LA 2J7HA 4Z1BA 4B3LA 3S0CA 1GJWA 2NSXA 3STCA 1S5WA 2DSUA 1IR2A 1NFBA 1NELA 3OVRA 1ZCOA 4BEUA 4MVAA 3MI6A 2J24A 2BX7A 2Q8LA 6ENLA 1UZDA 3AIQA 3AZTA 4KWUA 2DZTA 1H61A 5AC6A 3TX9A 4AZHA 4F4RA 3U2OA 1K8CA 2BY2A 2WPGA 4O16A 1GVOA 4E6MA 2V3DA 2G3JA 2QV4A 3VMOA 2NV2A 1XBZA 3MSDA 4EPDC 3MC5A 2B0MA 1UH2A 3S2CA 4PMNA 4HN4A 2V63A 4WR3A 3NURA 1ESWA 1GTHA 2NVCA 1XLCA 3WQWA 4FK9A 2WM1A 1K70A 1V3MA 1LG2A 4GFSA 2PPGA 3T0AA 3ZR4A 1V6YA 4LB3A 1XBVA 5LA0A 3FJLA 3LGGA 4FNPA 3IIXA 4AY1A 3ARYA 1ITCA 4BF5A 5HXMA 2X7VA 3ANYA 1P5BA 2CESA 4YIWA 3SRDA 4LS0A 2TPSA 3MSRA 4HNLA 5I3GA 2D1ZA 1TTJA 3UWUA 1RK5A 4EXAA 1J0YA 2ZE0A 4AWSA 3BAKA 2QMKA 4Q4SA 3NQFA 3BAYA 5HQEA 3BLKA 4M0XA 3VNIA 2IUZA 3KLLA 4PTWA 4ACZA 3VGBA 3WELA 3H4GA 3S9ZA 1LTDA 4IQJA 2PODA 1VEOA 3MB9A 1V3HA 3CC1A 5F1UA 6TIMA 3QR1A 2VI0A 2OOFA 4Q8MA 1HKWA 2Z1KA 3TROA 3MTWA 3O63A 4LVGA 1GWJA 2J7BA 5FCZA 3OVGA 4UTTA 4J3WA 4DF0A 4MYAA 4UNIA 3R58A 3C2OA 5G4HC 3UWZA 1FCVA 1RJQA 3FFSA 4JFSA 3DN5A 5D37A 2BMBA 3E3HA 4O53A 1WDSA 5MF5A 5ECUA 1KWKA 2QXWA 2YFNA 2AQWA 2ODOA 3NFUA 3EOLA 1ZTVA 4CNOA 1EP1A 1IEQA 3W01A 1E9IA 1XG3A 5I3FA 4LT9A 1UR1A 2DJLA 4I9TA 4X0NA 2ZXBA 5DBTA 1DXEA 4XTDA 2NLYA 3GXNA 4BA0A 2NQJA 3KDNA 3TLQA 3EX3A 1TV3A 4C7GA 4HD5A 3CU2A 3LXCA 1XYMA 3DH7A 3ZLGA 3P67A 4W8BA 1XRTA 4Y96A 1ZU8A 4W89A 2P3EA 4NSBA 4C6JA 4JDYA 4AIEA 3BSMA 1KO0A 4WKFA 3DHPA 4A8RA 1YNQA 1A49A 2PDHA 1PZ3A 2GOKA 3AIRA 4Q8VA 3MYOA 1OC6A 2C91A 1QNVA 3A4WA 3M0XA 4NXSA 2NUXA 3PBWA 4OUIA 1W1IE 1B9ZA 3MUY1 4FOJA 3SN0A 1OADA 4HMNA 5B7YA 3IEBA 5FF7A 4IPNB 3E38A 4FNQA 3UCDA 3BLPX 3QY8A 3TMQA 1AA1B 2GGIA 5DANA 3L4ZA 1EKOA 2PEVA 2PRHA 1FP8A 5M1TA 3F2DA 2EHHA 3N9RA 3T0TA 4KEVA 4F40A 3SUTA 2ACUA 3F4NA 1XDJA 1EP3A 4W9TA 4XAPA 1QOQA 5GJMA 3MUIA 4I7WA 3QM3A 2F8QA 4N9BA 1U83A 4AWUA 1H4PA 4GKTA 1VFSA 4M6QA 3HGSA 4FA3A 5RUBA 1EJTC 4Q33A 1E6PA 4O17A 2VKZG 4XK2A 1JAEA 3M0KA 3NWRA 2GK1B 3B03A 5CLTA 4FEZA 3MPGA 1F2JA 3UYIA 3VD3A 4J9JA 1XSIA 4ERIA 3OIXA 1KFLA 4DXXA 3N2BA 5EA9A 2Z2UA 1XINA 4DJED 3GW0A 4R3UA 5CSSA 3RU8X 3KBVA 4C91A 1T5AA 4DVOA 3QTGA 3RLHA 1EDQA 3UCCA 3DFOA 2AL2B 2IXVA 8XIMA 1TIMA 4HSNA 4FLOA 1C8YA 4LJ3A 4XZIA 5FF0A 1KRBC 3U2CA 4JIQA 1V7AA 5JVLA 4P7NA 4IJCA 5CGQA 3W85A 2F2KA 3W1UA 3PC0A 2X16A 3ARQA 3TQPA 4GJJA 4WY0A 1F61A 1XUZA 2YL5A 2XH2A 4IJBA 4POCA 1Q7QA 1W1TA 2WKLA 1Q6DA 3WJYA 2WVVB 1QHZA 3POHA 3TTYA 4ML4A 2W4XA 3QW3A 2YDSA 3W2KA 3KBWA 1W2PA 1KD0A 3U9IA 1E1EA 1FDJA 1OG0A 3CUGA 3KS5A 2W9MA 3C0JA 1IXQA 2FVLA 1G01A 1GKQA 2EPKX 3PJXA 4GFIA 1H5VA 3WKZA 3PY2A 5K9DA 1C93A 5B7ZA 3GDMA 2VD8A 1B3OA 4JGDA 4UOJA 4A3YA 1V08A 1DTUA 1PIGA 4NYYA 2BGQA 1PX3A 1R6WA 3EMQA 4BFAA 2ATMA 4BY3A 2FB3A 4NNAA 3GVQA 4PCNA 4UTTC 1QNRA 3LNPA 5BU6A 3L4XA 1UMYA 1V0LA 4KCWA 3SY5A 3G5EA 3BJSA 4P2VA 4BI5A 3EA3A 3F4DA 1T6MA 1YNYA 2A1YA 4GC3A 2NLIA 1EHAA 3VPLA 5G1YA 3NO1A 1FQ0A 3L2IA 5G2WA 2DVUA 3WUGA 5K9CA 1VRDA 3NYDA 4E8CA 2VZUA 3R1ZA 4U3CA 5G1MA 3TQKA 4Q7NA 1XYLA 3NL5A 4DXKA 1FHVA 4XZWA 2J7DA 1XPGA 1X8CA 3SDOA 4B5TA 1AQFA 2X1IA 5EL1A 1R3RA 2GQ8A 4DNMA 4ROQA 2DY3A 3AFBA 1MMFA 3E0WA 3C3NA 3IJ9A 4R7WA 4UFIA 4IIGA 1JNDA 4E2DA 3OODA 4AZCB 1XCXA 2CHNA 4ZA0A 3S8HA 3VC6A 2GWNA 5FAGA 1E0TA 6REQB 3CL8A 3FYPA 1OFAA 4FF7A 3QHOA 1IWBA 4NZ3A 2ZX8A 3LTPA 3R94A 1FFRA 4FX8A 1DV7A 3PPHA 4RPPA 2C1HA 9XIAA 2CFFA 1IGSA 1NJJA 3UQNA 3G1XA 2G5WA 3ERPA 1UJPA 2PSNA 1HO1A 2E1DA 1IEVA 1J2WA 4QQ3A 3QHMA 5CBJA 3UXKA 1TE1A 1OY0A 2BY3A 4WQ6A 1J5SA 3LGEA 3TAOA 3RXZA 3RG6A 2PF0A 2QCLA 3A64A 5CJMA 2BVYA 1YNPA 3GIYA 3C2EA 4QP0A 2BB0A 2ZUMA 3M0VA 3S6TA 1OEPA 1S38A 1TFVA 3D47A 5XINA 3A4JA 3W1RA 4M19A 3TXZA 1JQXA 1KTBA 2QUVA 1MUCA 3R10A 3VXGA 1NWUA 3W9ZA 3A21A 1A5AA 4UR8A 1V6VA 1F74A 3K13A 4GMEA 4IMCA 5C7VA 2B7NA 3U2EA 1FDZA 2OTDA 3C61A 1UP3A 1AVAA 5DY3A 2O9RA 2Z29A 2XFYA 4HU8A 4UOZA 2JEPA 2CNCA 3CUJA 5FL1A 1BLIA 3TNOA 3SBFA 1ZJIA 3NJ3A 1KQZA 4R7JA 1S1RA 5CAHA 2GSHA 1JG9A 1FH8A 1DQUA 1OFEA 3AMDA 5F2MA 3M7WA 3SECA 1YDYA 3NZQA 4JYFA 1VBGA 3G0XA 1KB3A 1EQPA 3W84A 2MUCA 1KGXA 2XFFA 3O2LA 3EOUA 1AK5A 3N13A 4RZBA 4XD3A 4DO6A 3JS3A 3KRBA 1KRAC 1V5XA 1S2CA 2QHAA 5JIPA 2Y0FA 1QNOA 1WQ5A 4IPIA 4N6FA 4PB4A 1YHTA 3BGJA 3R89A 3N9SA 2Y2WA 3N6QA 3ZLFA 3CUXA 1QPRA 4M6UA 1OC7A 3QR3A 4LWWA 5L9FA 3BAWA 3ITXA 1OHLA 2I5GA 1OF8A 4KEMA 3PZTA 2F6XA 4MOZA 3RRAA 4WZHA 3VNYA 3WL0A 2R14A 4ALDA 1YKWA 3W72A 4IP4A 2ZE3A 4CLMA 1VFMA 1JD9A 4GX8A 4RL3A 3GXMA 3USZA 4UTWA 4AZIA 4EPEC 5MHBA 1VF8A 1AD4A 1WDQA 3LHUA 4N9EA 2BHZA 1LL4A 1TVLA 2HJPA 5AHEA 4JKMA 2UV8G 1MEHA 4YTUA 1OBAA 2INFA 2VVSA 4O11A 3NL3A 1YIXA 4ZOAA 1BXNA 1AUSL 1YXCA 5REQA 3GNNA 4XD5A 3C56A 3WJSA 3LCHA 4QX4A 3AXIA 3GKFA 5F7UA 1RH9A 5C70A 4KCVA 5AC7A 1LLZA 4O1EA 2CW6A 3UESA 1VJZA 4PUKA 3KRSA 1ELSA 1DIDA 3LRLA 5HINA 1VBHA 2ZZ5A 3K2GA 4UQEA 4L56A 1R86A 2E40A 2IKHA 2REQB 3PM6A 3WMCA 5F4XA 2OELA 4PEKA 1W1VA 2FZMA 3CMJA 1QATA 1M7PA 5G1TA 4ZTXA 1AG1O 4YYFA 4NG3A 4KWVA 2A3EA 1SJBA 3LCWA 4IPPA 3GTHA 1V0MA 3S1VA 4QEHA 3EWDA 2JF7A 5F4WA 2E8YA 2YIHA 3BUVA 1HVQA 1K77A 1P6WA 2XPKA 4KT2A 3B8SA 4DO7A 2QCFA 1W8SA 1NWSA 5AZ1A 2B81A 3G24A 3DGRA 4V15A 5JUVA 2A3LA 4HTBA 1LBLA 2PDYA 1E43A 2ONEA 4FXSA 1BTMA 3CEUA 1RPXA 4Z2IA 3OW1A 2A3AA 3MP3A 1C8XA 2REQA 4NX0A 1IE7C 3P0WA 4ZVJA 4J4KA 3OGRA 4IIHA 1TO3A 3LRKA 4LBRA 2L5HA 1A5KC 3ABXA 1DJYA 4M6PA 4ZXOA 3PAJA 4RZ5A 4WDTA 1NP2A 2E9BA 1GK8A 4D6JA 5T91A 3UETA 1HJWA 3O8AA 3CUHA 4CNUA 2CKSA 1HJVA 2HV5A 2AMGA 3G18A 1DJNA 1OFRA 3A22A 3K30A 2VFEA 5BOOA 1WX0A 4HPHA 3RCNA 1R3TA 3D6NA 2WJZA 3AYSA 3KS6A 1M9HA 3WQOA 4BZYA 1K6WA 4Z1DA 1MNZA 2Y5JA 3MWCA 1Z8AA 1OABA 4UUIA 5BOEA 1BEUA 4IM4A 1GVYA 1JZ5A 2WM0A 1SW3A 4W85A 1VAHA 2ZX7A 3TQ0A 1PZ0A 4RE2A 2FYMA 3GIPA 1NDZA 1HNYA 2DVTA 4OHQA 1V02E 5FIPA 4Q6JA 2ACSA 2I16A 1CECA 2W27A 1FDYA 1UKSA 2TYSA 2GUBA 3VTRA 4MTVA 1RLDA 4HGXA 2Q8XA 3GDLA 1XC6A 4MPQA 3OLIA 2PCEA 2GJPA 4RX0A 2CIPA 1LT8A 3G3MA 3DZ1A 3FA3A 3S3GA 2QEZA 2PDNA 3OZPA 1AMYA 4N9CA 4L1XA 1PUDA 3ZIZA 2ZC1A 1UYQA 3B40A 1WE5A 1W32A 4IOTA 3ZT5A 2PWGA 3ARUA 3EOOA 1W3NA 3M5YA 3HPZA 3TFCA 2ZADA 4JYEA 1LYXA 3AYRA 1R47A 4AQLA 3IWPA 1H0GA 2AQOA 1R2TA 4AU0A 1TPDA 2A4AA 1Q5MA 3RHGA 1W9DM 4GA8A 1I0BA 4M6VA 1Q7ZA 3SO7A 1A5MC 1NWRA 4JN7A 2TODA 3DI0A 4IX0A 5HMSA 1TV5A 2O55A 4LUTA 2BHYA 5HMDA 4QQUA 3HQNA 4KMQA 1E6ZA 3GY1A 2YPIA 4L4LA 4LAMA 3V5FA 2WNWA 3VDGA 9RUBA 4QS6A 1UIOA 1DIOA 1KQYA 1PV8A 4KCTA 3WH5A 7REQA 1F3EA 2RAGA 2XGIA 1UR8A 4HCLA 3ALFA 3VNZA 1W5MA 3ZSTA 4IISA 4GI9A 3J7HA 3WUFA 4RZ4A 1EYWA 3CEPA 3WQEA 2DZSA 2NV9A 3C6CA 1LQ0A 1G4SA 3AZRA 4C6IA 1JXKA 4MB1A 3SN4A 1D9EA 4BR1A 3U5UA 2PZ0A 5DEZA 4XIMA 2JEQA 3E02A 4KRZA 2V5CA 5C55A 1DJGA 3CYVA 1QMLA 1JVNA 3UYCA 1L8PA 2E1WA 4O14A 2OZ8A 2AL2A 3TIMA 3C2YA 1I2OA 3VOCA 3TTQA 4IMDA 2YB4A 2V81A 4JL1A 3UF9A 2WMFA 3TMLA 3B8VA 3KVMA 2H90A 1I6NA 2VFFA 3DIPA 4HK7A 2PC4A 3N2TA 2FMOA 3OHMB 3ARVA 1X97A 3N2CA 3LEPA 2ZOXA 3WF0A 1HO4A 4G9PA 4CEXC 3QPEA 5DRIA 4GXWA 3EWCA 3VM5A 3GXFA 3IRDA 1SMAA 2PWVA 4LUTB 5HK4A 4S3GA 2DDXA 3I3EA 1K7EA 3H8AA 1V3IA 3SR7A 3RM9A 1J79A 4V1YA 2V5KA 5BCAA 3A6OA 1TG7A 1BHGA 2CETA 1OF6A 5AVHA 1M5WA 1QPOA 5KEZA 1XX1A 2DZUA 3MUCA 2HNEA 5AY7A 1WXZA 4ZR8A 4LY4A 1BWLA 5E0CA 4PTVA 4G5DA 3DBPA 3UG4A 3WFZA 1GG0A 5CH9A 1N7KA 1T99A 3FSTA 4DWSA 4DIAA 4AG0A 3DKLA 3LQGA 1Q6LA 2CBIA 4AC1X 1EWEA 2WBGA 2O56A 3PBMA 3LMZA 4LUJA 3I65A 4LNYA 1TTPA 1VYRA 5D33A 3R8HA 3TJ4A 3K4WA 1ICQA 2JFEX 2PGWA 2VR5A 7TIMA 5I06A 4I9JA 3VZYA 4DNHA 1EH9A 4Y9NA 3LS9A 2I5IA 1Q6GA 3KDOA 3SM0A 2H8XA 4DI9A 4DAIA 1LBFA 2WMGA 4AHQA 3OHIA 3TTOA 1TKKA 1K9EA 3TOYA 2DP3A 4MWAD 5T9BG 3N2OA 3WD1A 4H83A 3ITYA 2V5LA 1UQYA 1G4PA 2CZ5A 5A2BA 4PUJA 2E67A 1Q45A 2WNNA 4Y9OA 3G8RA 3DCPA 4O54A 2R9RA 1XFBA 4DM2A 5FJTA 4C1NA 2OQLA 3TYCA 2AQVA 4WSHA 3WX7A 3R11A 1M68A 3VU2A 4OT7A 4MJ2A 1JDDA 2VJXA 1PDZA 3UG5A 4CNNA 1AZ2A 3SGGA 1UKPA 1R3SA 2WWCA 5D9PA 3E1F1 4PODA 4K1WA 3NTYA 2BXZA 3PTKA 3BANA 4PRTA 3WYZA 1FWCC 4RKAA 2WOQA 4XVEA 1LBMA 2W63A 1ISZA 1YMYA 4LBSA 5A8QA 1YBQA 1LWIA 3A3XA 3IJ8A 1M41A 5ABEA 4F0SA 4N0RA 4AZGA 2G4JA 5AKQA 2B4GA 4L9ZA 3S83A 3G0SA 1GPWA 5M5DA 1IIHA 3PWGA 1TELA 5AOUA 1K9DA 3FVDA 1PB0A 1TSIA 1P0DA 2RH9A 3H7VA 5CZSA 4F0RA 1X7IA 2QR6A 3UFYA 1SU5A 5FJIA 3T81A 4HA0A 3I6EA 4AVOA 5CSYA 5LA2A 3BW4A 3HIJA 4D6HA 5E93A 1MEIA 2BG5A 1E55A 5KMYA 4BQ5A 1DE6A 3QY7A 1LQAA 1KBBA 5D38A 4ERGA 1F05A 3BLOA 3VFLA 1S2AA 3A4AA 3EXTA 3AUJA 4MYXA 4PMJA 5D02A 3UWVA 3TJLA 4R88A 4IL0A 4Q4RA 1U30A 3ZR5A 3OA3A 5HPCA 2NV1A 3NG3A 4S23A 1EUNA 3SCVA 3GAKA 1JIBA 2J75A 5D4YA 1DWHM 2YL6A 3AJXA 3H2AA 3MSYA 1P1MA 3AZSA 5FF2A 3V36A 4FXRA 2Q3OA 1J18A 3CQJA 4RPQA 4D8ZA 2WC7A 3EX4A 2OWXA 4NZFA 4KWOA 1JPMA 3AMKA 4AZ6A 3SIMA 3VIMA 2ALRA 2RGMA 1EJUC 5LIWX 3RRXA 3TQVA 1TV7A 3A13A 3VIGA 3VFCA 4O13A 2HEJA 3S9YA 2V69A 2QDHA 1A47A 3TEVA 2OSXA 2HS6A 9CGTA 4FZIA 3QGKC 4H6KA 4WKHA 1SJCA 3SCWA 3TZNA 4C90A 2YXOA 3W37A 4Q8OA 4INFA 1FFQA 3ONBA 1UP0A 5D2YA 3T4WA 1PIIA 4CD4A 3N11A 1JZ6A 3VABA 5K9XA 4XZHA 1BRLA 3STPA 3O0KA 1Q2RA 3CASA 1I1WA 3Q65A 3W1QA 4V27A 4MADA 1DXIA 3P6LA 1LJYA 4I5XA 4CEUC 4S3FA 3WY1A 2EG8A 1E0VA 4PBGA 2H3BA 2AGTA 2NX9A 4JN8A 1VD6A 3U7VA 1UD3A 4HSOA 1W1B1 4I5UA 1GJPA 5FOOA 1H51A 3U4FA 1ZL1A 5XIAA 3MHFA 4DZAA 3P3BA 4Y9MA 2WJEA 3AISA 4PMOA 1ZQ5A 1DJWA 3MKVA 3P7YA 3C2RA 3GH5A 1S2WA 3LHYA 3LCLA 2VO5A 4H9MA 2XDFA 1W5PA 4YS1A 3NDYA 3KWSA 4W84A 3OBEA 3QH2A 5KETA 3LRMA 1JYNA 1L6YA 4YU1A 4HNUA 1Q4NX 2NT1A 1EQCA 1IT8A 2PTWA 1F6KA 2CLKA 1JCYA 1GCYA 2FGZA 1HP4A 3H2NA 4JEQA 4X2RA 1CIUA 2VTFA 3RPMA 3GTFA 3N6HA 4XUGA 2VDIA 2ZRZA 1EX1A 2VENA 1W3HA 4QG9A 1WA3A 5A2AA 1VZWA 3XINA 3C8FA 2EPMX 4OTKA 2FGLA 1W3KA 3BOLA 4HOZA 2BOEX 3E2QA 4XTIA 3MO4A 3SY1A 4P7OA 2HXUA 1G7VA 3NQBA 1BYAA 1EC8A 4YTSA 5LHFA 1GOOA 2VD9A 2P50A 2YFOA 2X1SA 4WY0B 4EOUA 3LK6A 1AJ2A 1KM5A 4PGLA 4JIIX 4O52A 4A29A 4E2OA 4DEFA 4C1LA 3WEMA 3EMCA 3T0CA 4OQVA 4BF9A 1VFFA 5HQMA 2RGLA 4BHYA 3LI1A 2Q8ZA 1CXFA 3TE9A 1KKRA 2EG6A 3QZEA 3S1UA 2HK0A 3GR4A 2ZX9A 1NM9A 1AW5A 1RJPA 2Y88A 2XZ7A 4FNSA 1RVGA 5A5WA 3KW3A 4NJKA 1P0NA 1XGDA 3POCA 4P8XA 5IDIA 3SJNA 1FVPA 5HBFA 2D24A 2PC8A 2D3LA 2DPEA 4NUWA 5AYYA 4ZO8A 3GZAA 3WN6A 2Z27A 4M3PA 1UD6A 3UJFA 1TB3A 2PDMA 3LNMA 3K8LA 1B4EA 1TWIA 3MJYA 2AGKA 2VNCA 3B8IA 1CGTA 5JH2A 3ARRA 3IK4A 1V51A 5ABFA 3GVWA 3G1HA 3ZJ7A 3W7QA 3B8WA 3GO2A 2WWDA 1TJRA 3DESA 3W1LA 1EJXC 1B3XA 4OECA 2WHMA 1O5XA 1H7NA 2QF8A 1TMLA 3EOEA 1KA9F 4PTDA 4TIMA 1XC4A 1V6XA 1NVMA 3CPGA 3W81A 2WC4A 3A5VA 3ES7A 3THUA 4PMUA 3WLIA 3FV9A 3IVSA 3OEXA 1ME8A 4A4AA 1E1FA 1UUMA 4IP5A 4LSBA 2OWCA 3SAZA 3AHXA 1PCKA 3E0LA 2XN2A 2VL4A 1J5TA 2RJHA 2F9RA 4CQ8A 3BTNA 5E5CA 1FWAC 4NZJA 2VC7A 1RY8A 2CWXA 2YW4A 1XBXA 3HU7A 1J0JA 4LFYA 3VDCA 2OFJA 3V5OA 3FDGA 2ADAA 3CQIA 3W87A 3H55A 1ZHAA 4YHEA 5H2ZA 4O12A 1VYSX 2FZNA 4MHBA 4GYPC 1R30A 4GZEA 3RX3A 3AIEA 2Z1SA 1BVWA 4OE7A 1SFSA 2XVKA 3NQMA 1JCXA 5DLCA 2I56A 4F2UA 3AXHA 1XYCA 4O8AA 4EKJA 2YL9A 5IHRA 1UC5A 3B0VC 3OG2A 1YPIA 3KCJA 1F6PA 1U5VA 3E6EA 4I6KA 4QDPA 2O9OA 1YADA 4U28A 3S46A 4IFOA 4TO8A 1PVNA 4JN6A 4PULA 4GXPA 3UWQA 1NFPA 2PTZA 2WCGA 4R9OA 2YX0A 1UUQA 2WKJA 4IZGA 3IIOA 4CU6A 1O6IA 2HRWA 3QFWA 2PTYA 2DIKA 4U2ZA 4MPKA 3M5XA 4LF2A 4ATWA 3WEZA 2J88A 3CZLA 2GJRA 1DJIA 2J4GA 3RMJA 1X6UA 3FN9A 2QCGA 5EYWA 4TR9A 2JGQA 2WYSA 5BWFA 1WZLA 5EMLA 4JQAA 5AHMA 1S5NA 4EP8C 4FLSA 3H26A 4FPSA 3EWZA 1OINA 2GUUA 5EU9A 4ZMGA 2CLMA 3MYPA 1KXHA 1V02A 2PGEA 2PU1A 4D8AA 2GQ3A 3NPXA 1SO6A 2VGFA 2ZZ7A 1UOZA 2F6UA 4UBPC 1CLXA 4TTGA 4WX2A 3ZWSA 1NTHA 3UXLA 1IR1A 3E49A 5E6YA 1QO5A 2WHLA 1EZ2A 2B7OA 4AMAA 1H1ZA 4Y9AA 1ZNNA 4FR1A 2NXIA 1OX5A 3BLIA 4ILSA 4ZQMA 4W93A 2BDQA 5LXEA 1GEQA 3W29A 2OMAA 4NVTA 4NJGA 3FGCB 4IGNA 2H3DA 4XKMA 3LM7A 1ZJHA 3EA1A 4YTRA 1A5BA 4Z08A 2ZZ2A 1V6TA 2YR1A 5ABHA 3VNMA 2QF7A 1UMLA 3B97A 3I7RA 4O0ZA 1E1CB 3B0YA 3MANA 4JTCA 3VD7A 1XG4A 1AL7A 2PGFA 1QI0A 3R79A 3TSBA 4L80A 3VIPA 4AW7A 1R2RA 1J12A 3FSUA 4Y9PA 4V1XA 1SZGA 2J6VA 4UTWC 3BAIA 2QYGA 4H6QA 5FSEC 2IKGA 3TCSA 3GAYA 3VCNA 3VMNA 1XGEA 4XO7A 3WLJA 3G1YA 5AHNA 2Y8KA 3IRSA 3PZQA 4UTJA 5H8PA 2X1TA 4DUVA 3WBYA 1ZBKA 3AU2A 3C2FA 1HTIA 3RO8A 3SCRA 2OKTA 2XYLA 3VGGA 3W7EA 3LHTA 1FXQA 2ZCGA 1E40A 1XYBA 4YLWA 2XIMA 1ZP3A 3DENA 3L68A 3KX6A 3ZQ9A 1ISWA 3GXIA 3QGVA 2QVHA 3KTCA 3RLUA 3M07A 5U7SA 3T2QA 2D20A 2ISVA 3HG3A 4DBSA 3LXBA 2XFRA 2I1OA 2EO7A 1AFSA 1DJQA 1XYAA 2HVOA 2OQYA 2XVGA 4EF9A 4B5SA 4Z1AA 2ZKMX 1VBJA 3AO0A 4GY1A 3QLLA 1GKRA 4QM1A 3L23A 4UTLA 5FEXA 5I3HA 2VX6A 4IGHA 4E8GA 4FHAA 4TXEA 3NUKA 5EMUA 2J6XA 5D9NA 8CGTA 3BCFA 3TC7A 5B80A 2QS8A 4JS3A 4MWAA 2QCDB 3MV11 4J2MA 3NO3A 1XFCA 1DKWA 4PN2A 3ENLA 1VJIA 3L0NA 2RUSA 1AH3A 4LUYA 3O9NA 4AD5A 5M03A 3CIVA 2PP0A 3NNTA 5L6UA 5I07A 1L2UA 2CBVA 3WD3A 4LRSA 3SCTA 2PBOA 5DXYA 3W6YA 2C7FA 1EC9A 3WDQA 1VFLA 3E0IA 1A5LC 2CYGA 2GOUA 1JUKA 1KCXA 3IIVA 3UW6A 3L2LA 2XGZA 3NA8A 4H9YA 1NEYA 2GVGA 1EJRC 2PWDA 3CPUA 3DHUA 2QJHA 3WLMA 3VZXA 1F8IA 1NOUA 3ZJ6A 3ARPA 3SURA 4J35A 4PUWA 1EO7A 3B0XA 2QDDA 3HG5A 2GWGA 1Q6OA 1J0HA 1UR0A 4JTEA 3O15A 4L6HA 1NAL1 4LALA 3DAQA 2FZBA 4AD0A 3OVPA 4HYWA 4NASA 2YL8A 3CV7A 4JAWA 1UBPC 2PF8A 2GVJA 4O19A 4DBEA 3LHVA 1R3QA 1FWWA 4WXYA 4ICMA 1T0OA 3W4RA 3WH9A 3EB3A 1ZPTA 3CMFA 4GZJA 4N7QA 3GQYA 2VCAA 2WVSA 4P61A 1WKFA 1OQFA 2QW5A 1TMQA 3W88A 4FNTA 1BVNP 1GYNA 3NZ1A 2NZLA 2Y6ZA 3ZYZA 2KZHA 2PP3A 3IK2A 1XIDA 1OX4B 2C6QA 2PDFA 5CZJA 3UZJA 2CEQA 5CPMA 1J2BA 4AF0A 3W38A 4B3KA 2OZ3A 3PBGA 3WLOA 1GW1A 2E68A 4X0VA 1D3GA 1HL9A 3AIVA 2W3ZA 2DFAA 1GQJA 2NWRA 1NY1A 5LYRA 4XISA 1P7TB 7A3HA 3N2MA 3M0IA 1IIGA 2EF9A 3TW6A 3EYPA 4BQ4A 3GTXA 2OCZA 1SFJA 1C3FA 3L5AA 1OCQA 2BY0A 4H3DA 3UPWA 1SM9A 3OLEA 2V8ZA 4LQ1A 3AMGA 4FXFA 3DGBA 3TDFA 2PAJA 3BMVA 1WUEA 4R85A 4WEVX 1OX6A 5C7HA 3WDPP 3WFAA 4PMZA 1UASA 1TZ7A 4QAWA 3KLKA 5HWMA 1OG6A 1O7AA 2DQWA 2YBUA 5A95A 1Q6CA 5GNXA 3SJ3A 3PANA 3EZ4A 1A4LA 1NDWA 2Y85A 1B3WA 1PWLA 4WD0A 5F1VA 5I79A 3Q4DA 4LGXA 2XINA 3NQ7A 4RDYA 1WZKA 4ZE5A 2NXHA 2XIIA 2HE5A 3SW6A 3WQCA 2P10A 4ZB0A 5E0KA 3FX4A 2XU2A 3AICA 4NNBA 4ADUA 6XIAA 5I5RA 3S2MA 3L0GA 2BY1A 3WENA 3GK0A 3FEQA 4TOQA 4DB7A 2YCKX 5CSRA 3KVJA 3AUOA 4FP1A 1PKLA 3TZFA 4J3UA 3CQHA 4UQ9A 1MW3A 1OZMA 4HOWA 1UC4A 4ORIA 3V75A 3T2PA 4C7DA 2VZSA 1QK0A 5CC5A 1IQ8A 5J5DA 3AMCA 1XD0A 4I5RA 4NY2A 4C6PA 1G4EA 1Z42A 3OO2A 2DSKA 2PDUA 4UFJA 2ZVIA 2V38A 3H7UA 1JQVA 1JRCA 2ZFAA 3FYOA 4Q7BA 1RR2A 1WOAA 2IQDA 1E4LA 2DSVA 1CGVA 3H2FA 4H8NA 2EAWA 3W2NA 1VYPX 1X96A 4OBTA 5BZAA 1TVNA 1CNVA 5HULA 4HZ8A 3TYBA 2PRLA 4WDWA 3LSCA 3U6WA 1MSSA 1G4TA 1POJA 2VZOA 3RMEA 1YTKA 1U33A 3GU1A 3VK5A 1AH0A 3QQWA 4B5NA 6ALDA 4UTKA 4GVIA 3VDHA 1EJWC 2OX1A 1GT8A 5DY2A 2EQDA 3EWBX 3ZWTA 1US0A 4JIRA 2PLCA 4DX3A 6PTDA 4CVUA 3TTEA 4NAEA 1WNOA 4IFKA 4DZHA 2ZUTA 2EPLX 4NAFB 1KXTA 4QLLA 1E72M 3L4WA 3KBSA 3SUVA 4HYVA 1R3WA 4GK8A 3STFA 4S38A 2PDGA 1EGVA 1E15A 2ASHA 3UD6A 2DORA 4CKQA 3M64A 4LCRA 4LVAA 3N12A 2VHLA 1E4IA 4N4PA 3CZJA 3APYA 3RAOA 3GR7A 3B0UX 3S1WA 3TYAA 2VUYA 4OKDA 4GUGA 2ZRUA 4ZGYA 3OPSA 2FPYA 2G50A 4L61A 3T40A 2UBPC 2YZRA 2GK1A 4AAJA 1RCOB 4MGGA 4WDXA 5C6MA 6A3HA 1PPIA 4EE9A 1CXIA 2J9ZA 1CLVA 1OIFA 2OT0A 4LVFA 2HVNA 3PB0A 1HJXA 1S2UA 5KITA 4S3JA 3B05A 4XKYB 2Q3RA 4HOXA 4MB5A 3GHRA 4O1DA 1MWOA 5FJPA 4XKYA 4FX6M 5BRBA 3LV5A 5GJNA 1JCLA 1N8FA 3MO7A 1TWDA 2PCQA 4YWSA 5HMEA 1UA3A 4YCPA 1YW1A 3E2VA 3NZPA 3DC0A 4O4VA 3VOIA 5FA5A 1LUCB 3L67A 2GDQA 2TSYA 3EXRA 3MMDA 5I02A 1E6NA 2D0FA 4PFMA 4Q4KA 3KCLA 1IZJA 3W82A 3GC5A 1QNQA 1QW8A 3MQTA 3JZEA 2VR4A 1XI3A 2OQHA 4GQQA 4PE8A 1MVYA 4XZMX 4FF5A 4QBXA 4DZIA 5D8WA 2V9DA 1PXGA 2VFHA 1EHNA 1FUYA 1K9FA 4RJEA 4B5WA 1XLMA 1A5NC 1CENA 4GI8A 4R53A 4EF8A 2V67A 3NOYA 3B04A 2PI6A 1LM1A 4F0LA 1E70M 3WNLA 2AKZA 2X09A 3TP4A 2ZRXA 1JDCA 4H9VA 3ZSSA 4XWUA 3L66A 1MFVA 2G96A 3PNUA 4GZIA 5C9WA 4QJ5B 3WQ6A 3HPXA 3BG5A 2VURA 1FRBA 1FWJC 1EO5A 4UMBA 3BW3A 1RQBA 3WQ4A 2WXDM 5C5YA 2W0UA 3UGVA 1F73A 4NZCA 3D3AA 1TJPA 1FX6A 1G0CA 3TYDA 1TX2A 3Q37A 5TAOA 1LOLA 1CXHA 4GX9A 3TFXA 4J27A 1A3HA 4R33A 1ZAIA 2G8ZA 1DIKA 2IQTA 1N8WA 2IQ0A 3UERA 4IWWA 1J4EA 1KFKA 2ZUVA 3D0CA 5IBXC 2PDJA 1FHLA 2XHYA 4IT1A 4QS5A 4MAVA 3IARA 2QAPA 1EDGA 3AYVA 1EC7A 4WF7A 1ML1A 4Q22A 3TLLA 3N1AA 3EKZA 3SUUA 4TX6A 2I9UA 3IJIA 4MKNA 1TPWA 3KTXA 3WSUA 2BVDA 4MSSA 2D0GA 5FEPA 1PS9A 4HPJA 4U5IA 1AW1A 4OV4A 1ONRA 2QUNA 2Q6ZA 2HE8A 1ZBVA 2OEMA 3MZNA 4DYKA 1OFOA 1S5TA 3CHDA 4JTUA 3MI2A 3SIZA 1JF5A 3AS1A 1FH7A 2VC9A 2J7CA 3FIGA 4E8DA 3KP1A 3NAVA 1H0IA 1Q6FA 3RCMA 4MF4A 1KCZA 1LCOA 4S3CA 3E9AA 1IGWA 3TN6A 5JMUA 1R46A 3RR4A 3K5XA 1L0PA 3MS8A 4K7YA 3W1AA 3MWAA 4S3DA 1EUAA 1W1YA 2FVKA 4B4HA 1C7SA 3NCOA 4JFVA 3TVAA 2J27A 3T55A 5E0FA 5HNUA 3L4TA 3W71A 3LY0A 2YYUA 1OGSA 4HU0A 3G1RA 2WZTA 8A3HA 5GVJA 1RZMA 3KL3A 4B4FA 1M1BA 5A8NA 1XLGA 2YDRA 4RXGA 3RM4A 4J2PA 1RY0A 2NQ5A 1TCDA 1MDLA 3AROA 1FTXA 3AOFA 1JZ4A 4E5TA 4CGTA 5HR6A 2IXUA 1QI3A 3CTLA 3IAQA 2TAAA 1XPYA 4BJHA 3HMJG 2VRKA 4GRSA 2ZZ4A 3PWIA 1I2QA 3AXMA 3O16A 1CW2A 2ZUUA 4K36A 4PMQA 4CD7A 4MY1A 4D6DA 3PP7A 3TN5A 3UJEA 1CLKA 3H4WA 3N4EA 1XKJA 4C6MA 2V0TA 1U22A 3UY8A 3L4VA 3RPDA 1KM3A 3O1NA 2E9MA 3W7DA 3GX9A 4GUFA 4HNVA 4LV4A 4KBXA 5KINA 3N25A 2Y5EA 3R0UA 2Z7GA 3LPPA 3W7MA 2BFGA 2BLEA 4NJHA 1F76A 2XH0A 4MNLA 3KEHA 4L6OA 1JFHA 2BVWA 2V2HA 5AHFA 1K7XA 1FBAA 2IS7A 3LD5A 4L7ZA 5EMJA 4O4WA 3WUEA 1NARA 2BS9A 3HPFA 3S5ZA 3U8GA 2LLEA 3GYEA 5KSWA 2HPIA 3B8UA 4JY9A 4UQCA 1BFNA 2NQZA 3II1A 4HTYA 4GYPA 4WJ8A 2WO5A 4CNSA 4XUYA 3BV7A 1KW1A 4W8AA 3GDKA 5D03A 4JTFA 4LS2A 5TIMA 4ZSTA 3TH6A 5LNSA 4B5VA 4EK7A 4H4IA 1HKMA 2DZPA 3A23A 3UXAA 1V0KA 5MKGA 2PGRA 3NVTA 4AX7A 2DZWA 3BQ6A 4IIFA 3QBUA 2VDHA 1WDRA 3TN4A 5I3DA 2HXTA 3R13A 4QCFA 4YJ5A 3VKAA 4JX4A 4NIRA 4JTKA 2PD9A 4Y8FA 4Q7IA 5BXPA 2J8FA 2W66A 5D9OA 1V93A 3C0LA 1UP2A 1A4MA 3RN6A 1OWQA 3JUGA 3ORWA 2R1LA 2CZEA 3VGHA 1P0KA 4B5XA 1TWSA 1AQHA 2YW3A 3PFMA 4S3AA 3VA8A 1YDVA 3D3FA 5I23A 3GHTA 1HXJA 3DUGA 1E0WA 1XCWA 4FNUA 4ZCWA 4UTFA 1Y5XA 3EDFA 5G4EA 3M9YA 4PMRA 4WGHA 4IFRA 1W5OA 5LNRA 1ITXA 2X1RA 3W86A 4GACA 5AHLA 1H7RA 4M82A 3RPTA 5IHSA 2GGGA 4DF1A 3TKFA 3M46A 4PBFA 4GUHA 4IPLA 2QJGA 3FOKA 6XIMA 3UY7A 1SSGA 4DHGA 3F2BA 2J78A 3W7KA 3EPMA 2CKRA 4M51A 3W1XA 4YWIA 2D2JA 1ZB5A 4LNCA 4ENLA 3LZ3A 3EKLA 1IT0A 3I4KA 2YLLA 4XG1A 1OD8A 2GSEA 5MKGB 2UY4A 3NQVA 4US6A 4WOZA 3P8IA 3ZMRA 4QISA 4D6FA 4LXFA 1GG1A 1TR1A 1YRRA 5BRQA 2D0HA 3BOXA 2UWFA 1MW1A 3QXBA 3TN3A 4U31A 3QYQA 1B3YA 3VIIA 5JBFA 3VC5A 3EKGA 5HUOA 4W88A 1X1ZA 2HVMA 4C5YA 1X6NA 5LNVA 3AIUA 5ECVA 2D2HA 1PJ9A 3GC2A 3MT1A 2WPBA 3AI0A 3VDAA 3GXTA 5AYXA 2VEGA 4ZE4A 3MKKA 1EA0A 4QLJA 3AHTA 3UZXA 3DOPA 1UQZA 1VPQA 1XLJA 4K2SA 1TR9A 4JTQA 1G69A 2YA2A 4PA8A 3BQ5A 2GZXA 2R1PA 3HGRA 3PR2A 1C92A 3PJWA 1QNSA 2NQHA 7XIMA 3URNA 4AXKA 4KEZA 5CJNA 1LQ2A 5DF0A 1GOQA 3BK0A 3WF3A 1P48A 2FMNA 2IPFA