4I90A

Structure of the n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus bound to choline
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
302
structure length
302
Chain Sequence
b'DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
molecule tags Hydrolase, lyase
source organism Staphylococcus aureus subsp. aureus
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
total genus 121
structure length 302
sequence length 302
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i90A00
3NO3A 1DJIA 1PTGA 3OHMB 1VD6A 1DJHA 1QATA 2OTDA 1XX1A 2O55A 4I90A 1PTDA 4I9TA 3L12A 4Q6XA 1DJWA 1DJYA 3V18A 1V8EA 4PTDA 3V16A 3RLHA 3QVQA 1QASA 2P76A 4OECA 4F2UA 3H4XA 3QR1A 4RW5A 4S3GA 5T91A 4RV3A 4F2BA 4QJ5B 1DJGA 3H4WA 3PTDA 4GNKB 2PZ0A 6PTDA 2OOGA 4I8YA 3KS6A 2FJUB 2OR2A 2ZKMX 3EA2A 5T9CE 4R7OA 2PTDA 3MZ2A 1DJZA 4I9MA 5PTDA 4I9JA 1GYMA 3CH0A 1T8QA 4QJ3B 1T6MA 3I10A 2F9RA 4RW3A 3RLGA 4QJ4B 2PLCA 7PTDA 3V1HA 3QR0A 1YDYA 1DJXA 1O1ZA 5T9BG 2ISDA 3EA3A 4F2TA 3KS5A 1AODA 3EA1A 1ZCCA
chains in the Genus database with same CATH superfamily
4IT1A 3PY2A 1V6TA 4TMCA 5M5DA 2W79A 2WOQA 2VC9A 4GH1A 4L5ZA 1RALA 5IOBA 3WF1A 2FB3A 3F2DA 4TV5A 3EX3A 3WF0A 4QITA 3C0QA 5A2BA 2GDQA 2PDXA 3TMLA 1EUNA 3W7QA 4TIMA 4MYAA 3F4DA 4UTUA 3E2RA 1H0IA 4C7GA 4DQWA 4L61A 1VEPA 2P5NA 1S2VA 2VCAA 4QHRA 1TWSA 1GJWA 4U2ZA 3AIWA 4MWAA 4Q4SA 4L7ZA 1K9EA 5CZTA 1K8XA 2Y7FA 4TVUA 1EJTC 1XHGA 2DH2A 1UP2A 2A0NA 4G1NA 2Y88A 4JL1A 4PFMA 4D6IA 4MYXA 4E38A 4D6EA 1GEQA 2ZRWA 5KZMA 4EF8A 5F4SA 1BXNA 3R89A 5D4YA 4GE8A 2QPSA 1E40A 1F61A 4JPGA 4D1IA 4PULA 4ZO7A 4F79A 4WHBA 3FK4A 3UWZA 4F8XA 3ALFA 3WEMA 1C29A 2BWGA 4LCSA 3QC3A 1OCJA 1FWAC 3CEUA 4QBXA 4FXSA 3N73A 3RMJA 1WDQA 3I3BA 5DRIA 3NM1A 4LAKA 2RDXA 5F1UA 4UNIA 4ZL1A 1TIMA 2AMXA 4UNKA 2HDJA 5A3HA 1MUMA 2VWTA 2PDIA 3QLLA 2OELA 3VKAA 5FF0A 1SU5A 2EPKX 2WHLA 3HQNA 2QMJA 1HJUA 3LQGA 3M6YA 4UTTC 3AICA 2VO5A 2I5QA 3C0LA 5KEZA 3U48A 2FGBA 7CGTA 2DH3A 1JG9A 3QV8A 5JBFA 1W8SA 4H8UA 2E4TA 2QEZA 4RK8A 3SN1A 3H4GA 3LU2A 3ZLGA 4DYKA 3WQPA 2TPSA 4CCCA 3A3XA 4WJEA 3SJ3A 4Y8EA 1VFHA 1XG4A 3W1LA 1LOLA 1H7RA 3FVMA 3G6MA 3M41A 4GKLA 4F4RA 2Z1VA 1WAUA 5CXPA 3W70A 1CCWB 3WQWA 1ODUA 4CVWA 2CLOA 3UG8A 4M82A 2W0UA 4GMEA 1H41A 2AKZA 3N3TA 1W8GA 2PTDA 4AZ5A 1XYCA 3VFLA 3GO2A 3CMFA 4WJ8A 2VTFA 3TDFA 3IV3A 1E0VA 4W84A 3T9PA 1Q6LA 5DMYA 2QCDB 2C91A 1JDFA 3A9IA 1JZ8A 1E6QM 3TA9A 4WKHA 5JQ9A 3VKBA 4WOZA 3C2YA 3TYEA 2J78A 1CNVA 2J7CA 3QHNA 2ZZ1A 3IGSA 1KGXA 1M7OA 3L4VA 2Y5EA 2FQIA 2AMGA 1WQ5A 1OC7A 3POCA 4HZ7A 2YJQA 3D47A 4B4HA 5CAKA 3WK0A 4AY1A 2CHRA 4LF2A 2XZ9A 4X61A 4Q8PA 2E09A 4O1FA 4UMCA 4H9ZA 1P0BA 4NAFA 2JK2A 2IXVA 3CO4A 3MHGA 4DF0A 1RCXB 4E2VA 2WANA 4PUNA 4V15A 5LHEA 5FF4A 2UBPC 4HOZA 2Z29A 3EDJA 2E5DA 2WWDA 1YTKA 3ZO9A 4Q33A 4OUEA 2PE4A 1Q4NX 3FGCB 3BLKA 4IMDA 5F2LA 4LVDA 4UMAA 3BMWA 4AC1X 5DY3A 4GINA 5LKYA 3H2EA 3BANA 1E5NA 3P5YA 4WKFA 3CH0A 3EMZA 1A3WA 2OB3A 2Q8ZA 3STCA 2ZXAA 4GYKA 4MZ1A 3I6RA 8CGTA 3N6HA 4CQDA 3EXRA 3WQ4A 5E9AA 3TC3A 4QG8A 3IIOA 1WPCA 1FWIC 4L9ZA 3M0VA 1GZGA 1QI0A 4O10A 1P0NA 1FWJC 1R85A 3DERA 4JFUA 4DHGA 4KFNA 3EX2A 3CAVA 2CC0A 5LNSA 4O1CA 2HS8A 2RDWA 5LIYX 2XVLA 4ICCX 3W07A 4REQB 1WDPA 3QMRA 1OJXA 1E0UA 4PYSA 2PWVA 4KIEA 1F6PA 5IBXC 4FNQA 2PWFA 1EPXA 4BEQA 1V79A 4ERIA 1XXXA 1Z42A 4IIGA 1JCXA 1JUBA 3HJZA 1LBLA 3W02A 1P1XA 4JN6A 4DBUA 1VBGA 1HGWA 4QIUA 3GFYA 1RAKA 5K9XA 1AODA 2XFYA 1TCDA 2R91A 1W17A 2XH4A 4ZTYA 1JDEA 4O13A 1UR1A 1WKFA 2R8WA 3NVTA 2R24A 3PNUA 1RP8A 1TE6A 5CZSA 5EKYA 3WJSA 1I0BA 4UMBA 6XIAA 1TPB1 4WR3A 1GPWA 3PNZA 1T8XA 2FZBA 5JVLA 4LEFA 3AOFA 1H2JA 1UPPA 1AD1A 3I6EA 1DJYA 3ID7A 5CSSA 1N7KA 3VOFA 3PFRA 3AS2A 1W6TA 2IS7A 3IGXA 5I6SA 2C71A 2GZXA 4GGBA 4WJXA 3S5YA 1TTIA 1W9PA 1HKWA 3HURA 2QF7A 1X7FA 4PB3A 3QVQA 1IWAA 2Z7KA 2W6RA 4LJ3A 4QAIA 2PGWA 2OWCA 1UJQA 1Z9AA 3M7SA 3WD4A 4XSLA 2HXTA 1LRTA 4JTQA 3W53A 4L6DA 1YXCA 2FTYA 1F4HA 2PBOA 3TW7A 2GL5A 2QF8A 5E09A 4E8CA 4FR6A 4W8AA 2FPTA 4EANA 3HMJG 4KEMA 1Z44A 2DT0A 3RHGA 2P50A 5I3KA 3UVAA 3K5XA 4M1RA 3UG3A 1R30A 5FJTA 2BSLA 4BEUA 6XIMA 4GY7A 1FWEC 1VIWA 3AHXA 1X1OA 3W75A 1UIPA 4L9XA 5CBIA 3BLIA 3S6TA 5G2IA 3OVQA 5KETA 3WLMA 4O1DA 3ABXA 3B0XA 4R7JA 4CN4A 5D2WA 4DI9A 3WJWA 1SFJA 3V0SA 1MXGA 4AF0A 2WPBA 2QQ6A 3R12A 4E4UA 4DO6A 2PDPA 1C3FA 3IV8A 1UP0A 3WBXA 1UIOA 3CPRA 3ELFA 4I5XA 4QG9A 1BHGA 4M8UA 3W88A 3GR7A 1VHCA 5A2CA 3UF9A 1O4UA 4ZCWA 3GVVA 4FB7A 3GTHA 1QOPA 2ESCA 3QFEA 4GJ1A 1EGMA 3EDFA 4Q4KA 1L8NA 4TR9A 2E5BA 2DIJA 1C92A 3PBGA 2X2GA 3TJXA 3UG4A 1ZPTA 3ZMRA 3O6AA 4RJEA 3KOXA 3HN3A 3B40A 4Z1AA 2ZXDA 4AWEA 1OYBA 3TXVA 3LSCA 3CQJA 4D1JA 1DYSA 4MB5A 3GU1A 4OOZA 3GAYA 2GGHA 3AIUA 3IPWA 3OIHA 4F0KA 2Y0FA 3DGBA 4EXQA 2E28A 1Z8AA 3TQ0A 3W23A 2VURA 1MRAA 3S6DA 3PZQA 3KWSA 3KZPA 1VIZA 3VNYA 1SJAA 2GK1B 3RF9A 1LQ0A 1X38A 4OTKA 1E73M 3TYUA 3EPOA 1CPUA 2PU0A 1FWTA 3R8HA 1XBYA 3C2RA 2UY2A 2E3ZA 2XDFA 5A6BA 2QCEA 3GW3A 3UCDA 5D09A 2D0HA 3NEHA 1US0A 1XD0A 1ZENA 3RM8A 3STGA 2XISA 1SMAA 3M5VA 2HNHA 4X0NA 3SCOA 3QYSA 3WFZA 1OT2A 3HPFA 1E6PA 2C1HA 4DJEA 4S3BA 4IPPA 5FKYA 3W1UA 3L4YA 3UW6A 2P0IA 8A3HA 3EA2A 3W83A 1N55A 5FL0A 3LCIA 4BQ5A 3SCSA 2G97A 2FZDA 3OHIA 3BLPX 1XLLA 2RJGA 4O1BA 3RO6A 3IVSA 3MP3A 3OLDA 1D7FA 5E6ZA 4M29A 1F3XA 4KWOA 4ZA0A 2YR1A 1E9LA 2I16A 1UBSA 4DI8A 4PMOA 4C6BA 1VC4A 4Q7IA 1VBUA 3KOWA 3AISA 3ARWA 4NZ3A 3GNPA 2NX3A 2E68A 3W1PA 4MF4A 2VNCA 2VR4A 3WQVA 4LGXA 3T2QA 2INFA 2O9TA 4YIWA 1OC5A 2WLYA 4DO5A 4NZFA 1E3XA 1O12A 3UNTA 1NQKA 1R9YA 1AH4A 1Y5XA 4NXSA 1A4MA 1OFEA 1S5VA 2O55A 4ZEPA 3FAWA 1JDDA 4AVFA 3VX1A 3FNDA 2VUYA 1IWPA 4OGZA 3GIPA 1DPMA 2DSUA 1ME8A 4HTYA 3TVAA 3VI2A 4DPPA 1PV8A 2XU2A 2IQ0A 3KTXA 3AAMA 3FDKA 3C86A 3ITVA 5M1TA 2P8BA 4XAZA 2WXDM 3P74A 4H8HA 2Q3RA 4N4QA 4QE5A 4RPPA 4A8IA 4H2CA 4ZODA 3UPWA 1AH3A 4HNLA 1ISXA 3M0HA 4CLMA 3LV6A 3G5EA 2BVTA 2PI6A 3E12A 3FKRA 1DWGM 1C90A 1OX4B 5I00A 3UR2A 4NASA 1GOWA 4ZFCA 4IUGA 2F9RA 1DE6A 4CD6A 3PWIA 1JQVA 2ZUUA 9CGTA 2WYSA 3S9IA 1S46A 1ZY9A 4V28A 1H1ZA 1YYAA 2PB1A 3PPFA 4W88A 1AMKA 3W7DA 2NQLA 4L4PA 1PZ2A 3FY1A 5DMNA 1IZJA 4LFYA 2WAGA 1TPEA 2ACRA 2D23A 3M64A 2VZTA 4WVXA 5D33A 3HG5A 4ZE5A 2V63A 1K6WA 1W5QA 1WNOA 1FDJA 1OGGA 3BXWA 1W3LA 3REQA 3WLOA 5FEPA 1LQ2A 1P4CA 1DKWA 1T5AA 1QPQA 4JD4A 4J7RA 1VBRA 1DJZA 4FNSA 1S5WA 3RO8A 4BF7A 4H4IA 1H63A 3NNTA 4X22A 3DI0A 3BQ5A 3A4JA 2E6YA 3CV1A 5IDZA 3G1RA 3THUA 3QQ0A 4AZIA 4UFLA 4MHBA 2XWDA 5DMLA 2WSPA 5HUPA 3BLEA 3DZ1A 1ADOA 5HINA 4J27A 3B9OA 3C2OA 1W2PA 3K8KA 3IK2A 4ZZ9A 5AHEA 5LHFA 5DT7A 1PYFA 4EWND 4JX4A 1TR1A 1PZ3A 4CEUC 4O1EA 4KESA 5AVNA 3NYZA 1EWEA 2BOFX 1W2VA 4MKVA 2O4MA 4LY4A 3R10A 4OU1A 1SVDA 4XWUA 5L9FA 1JEZA 3O8AA 2L5HA 2H3BA 3AIRA 2WVVA 3O9NA 3MMWA 2XH7A 2ISFA 3P67A 3WF2A 4FR1A 1LQAA 1GZJA 4NZ1A 3TLQA 1KFJA 1BF2A 2XM1A 4B5XA 4C6NA 2G4FA 1NTHA 4BCEA 3ZWTA 3UWEA 4AX6A 2CKSA 5AHNA 1VH7A 3UP8A 1WZMA 2VRQA 2ISVA 3WNKA 1BWKA 4PEEA 2OR2A 3VGDA 2XUCA 2FZ8A 1XLAA 1CXKA 2PEVA 1IWBA 2FPVA 4J3XA 3KS5A 1EJVC 3LZ5A 1L2UA 1HL8A 1KM2A 4JTUA 3AHTA 3RX4A 4BZYA 3G1VA 4PSRA 4ROQA 2W3ZA 3GKFA 3N9KA 4ZO8A 4YL2A 3MYOA 1N8WA 1HJWA 1T40A 3L0KA 1O95A 1QNVA 3G1DA 3UERA 1GUVA 2WNNA 4CD5A 1UD8A 3W7LA 3EWWA 1A5LC 2YL5A 2AGKA 2YBVA 3VX0A 4US6A 1M7JA 4WY0B 3SJNA 2W27A 5DEZA 4AMAA 4Q22A 3S9ZA 3GTFA 2F2KA 4GI8A 4A6GA 1AJ2A 1JPDX 4WF7A 4XBKA 2WZHA 3W85A 4XO6A 3CWOX 2V2HA 4YNGA 5E0KA 2C15A 4EVZA 1BQCA 2XYLA 4AVOA 3CZEA 4HKPA 1VFFA 4JZ5A 1H7WA 4AZGA 3Q37A 1XGZA 1MQPA 2WSQA 3LMYA 2XPKA 3ARVA 4EACA 3EX4A 3VCRA 1KWGA 1IT7A 1QI4A 4LVBA 1ODZA 1UKQA 2CETA 5CEWA 2DVXA 4NJKA 3UYCA 2YX0A 2JE8A 2J7BA 1CXFA 2NLYA 4TU1A 1Z32X 4MZ8A 2PDUA 3WMBA 3BCDA 4WIWA 4CQCA 2W5FA 3R8RA 2ZXBA 4QDPA 3ZT7A 2QIIA 1ZCCA 3P2VA 3GNOA 4Q8QA 5KMYA 1EEPA 1RH9A 4UTWA 1GHRA 3AALA 3PBMA 3OP2A 4LBUA 3W27A 4V1YA 1NQ6A 4F2TA 3E1F1 4NJJA 9XIMA 5KSWA 2G8ZA 1RQHA 4K1WA 3WUBA 2VXNA 4F2BA 2DSZA 5C2XA 5D03A 3RITA 4I5RA 1W1YA 4MM1A 1CGXA 4LY8A 1SZEA 2G3FA 5BXTA 2BS9A 1Y65A 2HXUA 4W5UA 2BFGA 4KF1A 4B4FA 3GH7A 1E9YB 3W7JA 4AU0A 2CPUA 2YZRA 3O0KA 1R3RA 4LAOA 2WSRA 3IS4A 4DM1A 4RW5A 4GFIA 4JNMA 3PF3A 1OZQA 3CT7A 3LHVA 4UBPC 1B3VA 3A4WA 1KXTA 4LVFA 3YPIA 4ICNA 1HL9A 3BW4A 4WK9A 4A29A 1DWIM 4CD4A 1TWDA 3TYAA 2IKHA 3R7MA 5CC6A 3PC0A 1TV5A 4L64A 4M51A 1NM9A 4ZOAA 1JD9A 2GSEA 5ABFB 4DJEC 2O4QA 1UBPC 3VKCA 1UOKA 1V3MA 3SGZA 4FMVA 3FVDA 2IW0A 2NSXA 3H12A 3W00A 4XZ9A 1KC7A 4PC8A 1GQKA 3HTWA 1RD5A 1YNPA 4LNYA 5CPOA 1UWIA 3BAJA 2NWRA 4F0LA 5HOSA 1X6NA 3ITXA 1BQGA 1A4LA 5MHBA 1FCUA 3CBWA 3O6CA 1KNWA 3RG6A 4OOUA 3UXKA 4S3DA 4NRRA 3VK5A 2PURA 4DELA 1BGGA 5I3IA 3QLDA 3KHDA 1I8JA 3B3DA 1IXPA 1KFEA 4P8XA 1XIDA 4W87A 1JI2A 2A2IA 3I4KA 3TAKA 1V3HA 1W3JA 4G7FA 5HMFA 2CNCA 3LSBA 3GDKA 4LS2A 2R9RA 5HDRA 5DN1A 1SO3A 2RGLA 1QATA 1HQTA 2FHBA 4UFJA 3EOEA 3OVPA 4GC3A 5BROA 2D69A 1CGWA 4LNCA 2H6RA 2RGMA 2WHKA 2EG7A 1UZHA 4FXJA 4WCJA 1I2QA 2FJUB 3UR5A 5LNRA 1E1FA 5AC4A 3WH7A 4JTEA 1E71M 2Z27A 1UH4A 3WQEA 4F9DA 5HPCA 1A5KC 1DJIA 1MEWA 3TOPA 1J2BA 1BTMA 3U2EA 2ASHA 4NZJA 3QW3A 2E6DA 1GVFA 3CH9A 2FYMA 1SZGA 2Y8VA 2TMDA 3L4TA 5C9XA 4JIRA 4EKJA 1ONEA 1H4PA 2PF8A 1QK2A 1A5SA 4AD3A 3GZAA 3MMUA 1JXKA 1B3XA 2ZRVA 2NUWA 5BMXA 3VNDA 4FLRA 3N17A 2A21A 2IKGA 1ZUAX 3WK2A 4PB4A 1BYAA 4PB5A 3DHFA 3UNDA 2UV8G 3VIPA 2C18A 2D0FA 3V0TA 4W7VA 3T40A 1PB0A 4M0XA 1XYBA 1V02E 3U9IA 2RHGA 4OZOA 4JL2A 2TYSA 1ZCOA 1TKKA 5CPQA 3UXDA 3SGUA 4ZBCA 1DWAM 5FJOA 3HQ1A 4HNVA 3FS2A 3CU2A 1VFUA 1YE4A 1U1JA 3KL0A 4BQ2A 2GVEA 1RBLA 4Q4RA 1RY0A 4XG1A 2EPOA 4AVNA 2NVAA 1J93A 3DUGA 1Q6GA 4Y6GA 5T9BG 2A79A 2BLEA 3PPHA 2J7DA 4ONVA 3W2NA 2ZTKA 1THFD 4X0VA 4LWWA 4REQA 5I78A 1VFLA 1HT6A 2ZA1A 3W7IA 4IOTA 1ZAIA 5E0CA 4GXMA 3LPPA 1ML1A 4GQBA 4P8UA 4QQ3A 1PHWA 3IVTA 3N2BA 3CZ8A 4Y9PA 4L4MA 5HNTA 4GY0A 5AB3A 4RZ4A 3LTPA 1PIFA 2Z2UA 2XSAA 4MOZA 3R25A 3BG3A 1W91A 1KBBA 4NJIA 1A50A 2DZWA 3H7UA 4QJ3B 3N18A 2Y63A 3VDAA 3HIJA 3UA3A 1QMLA 1XWYA 2D2OA 4P7RA 2E9BA 1CLVA 5GQBA 1AW5A 3VIHA 1F5ZA 1WYIA 1E5JA 3S2JA 4M7SA 3NQ6A 4WKAA 5CZKA 2WM1A 3CIWA 2PDQA 4NU7A 2NQHA 1KB3A 2Y8KA 2OZ8A 2CLEA 1OADA 3QR3A 4Z2GA 3RLVA 1KCKA 4GJJA 4GNVA 1PHQA 2DUAA 3V4BA 4S3EA 1R2SA 4ECLA 4H7CA 4O15A 3BMVA 1LCOA 5LZLA 1W31A 2OGYA 1MMFA 5EMJA 4U5KA 3DCPA 4GACA 3QHOA 3ZR4A 4AAJA 3NCOA 1XC6A 3NQMA 4QNWA 3WK1A 1FWGC 1VFTA 5CC3A 4DJFC 3GX9A 1M68A 3AMLA 3ITCA 3WQOA 4HPNA 5D2YA 4MKSA 4N6FA 3A13A 1UQZA 2QIWA 4BY3A 1J12A 5I07A 3HF3A 1UUMA 2ZRYA 3L4XA 1JF5A 4E2OA 4Y9OA 3ARZA 2YKKA 5JIPA 2WLZA 1Q2SA 2CXEA 3KVLA 3M0XA 4HHLA 1QWGA 3ITGA 4WDTA 2FVLA 4KT2A 2WC7A 3MSDA 2PD5A 1JJKA 2DY3A 1SR0A 2V67A 1KLZA 4C6FA 4JY9A 5JMUA 3OU8A 2QUNA 4UQ9A 3OOQA 1U22A 3VO0A 7ODCA 2PDGA 3ENLA 1A0CA 3TYDA 1IGWA 2R1KA 4JIEA 6A3HA 4DJFD 2CERA 5HATA 3CXOA 4GFSA 4F0SA 1XINA 3HG2A 1FTXA 4QQUA 1V5XA 1E0XA 3A9BA 4E2BA 4JOMA 4J35A 5LYRA 3LCHA 3H6OA 1TV4A 3CNYA 1OT1A 3R4IA 5AVHA 4HU4A 4DBSA 3DEQA 3GH4A 3SUSA 2V0TA 1A0DA 2C13A 1GOKA 1FKXA 3U7VA 3TWAA 4IMCA 4AXNA 4MY9A 1WDDA 2J74A 1W5NA 3EOSA 2OTDA 5DT5A 4DUOA 3G3DA 2VJXA 3T0DA 1V6XA 1P0KA 2PDHA 4C5ZA 4HN8A 1WBHA 5BMWA 5DY2A 1PPIA 3LQLA 1F07A 3XISA 3KOZA 1PDZA 4CNOA 2FDMA 4NT0A 4MIMA 3TOYA 3DH7A 3GY1A 2TSYA 5C9ZA 3PG8A 4ZQPA 3W0KA 1G94A 2GSJA 5C0QA 4NI3A 4DAIA 3P6LA 4KFOA 1RCOB 2OX4A 1FWCC 4GY1A 3ATZA 4HK5A 3CUFA 2VEMA 4K37A 2ZX8A 6REQB 4GVFA 1M6JA 3IIXA 3OHMB 4GPNA 2PF0A 4KH2A 1DP0A 5CPNA 5IHRA 5LNWA 5HBFA 5I02A 1X97A 3VD7A 4BQ4A 3LTSA 5LIWX 2YYTA 4UWMA 3NPWA 4PRRA 1LRNA 2NQ9A 2YXOA 4G56A 3C4UA 4ZQRA 2EG8A 1KFBA 1TZ9A 1X7IA 1XX1A 1SSDA 3WNNA 4MLRA 1JPKA 3UEQA 3D3AA 1PKMA 3FSUA 1ZQ5A 2WKLA 3IWPA 4CVUA 1NU5A 1Q6RA 4KKXA 1TB3A 1SO4A 4A2RA 1OY0A 1SR9A 3CUIA 4IHCA 3GHRA 4ML9A 3MCNA 4X2PA 4GH3A 3W1RA 3SO7A 4AIOA 3O63A 4LV9A 3ZLFA 1M3UA 1E0TA 3STFA 1FWDC 4B5SA 3OBAA 1NDVA 4JEJA 3VNIA 4N2YA 4YYFA 2YYUA 1QOQA 5PTDA 7A3HA 3KFTA 4TV6A 1RPKA 3VKDA 4TO8A 3BCFA 3NQFA 3IAQA 1TYGA 3VKKA 5HJLA 3OODA 3PTMA 1ADSA 4M19A 1LYXA 2FHFA 1BXBA 1RJRA 1A5AA 1F2JA 3ARSA 4C7DA 3U2ZA 4ZE4A 3M0IA 2Y7EA 1IXOA 4C91A 1MNSA 2QPXA 4GI4A 2J25A 3FHQA 5H91A 3W7MA 5EPDA 1SQ7A 4RNFA 1RQBA 4D71A 1EJSC 2D3LA 1EOMA 3GDRA 4C6EA 1VLIA 1JPHA 4NKCA 1TV3A 4LAZA 1J79A 4B16A 2O9PA 3EKLA 1V51A 4LV4A 3BW3A 1OVDA 3ZLHA 5HNNA 1FWFC 3BLOA 3R94A 1KCZA 1YLVA 4UQBA 1DHPA 2XN1A 4CQ8A 1UA3A 1ESWA 1A3XA 2CU0A 4IQJA 1K8CA 1ISYA 5D2VA 3CIXA 4HSNA 3LNMA 3EX6A 2GVJA 2PWEA 3MBDA 1QBBA 1F05A 3OG2A 1MZHA 2CWNA 1HGYA 1VRXA 2E77A 2INEA 1D7KA 3BZJA 3VNJA 1RVGA 1GW9A 3WELA 2ZUTA 4HMDA 1QBAA 2ZQ0A 3RM4A 1W9XA 3NQAA 4JCLA 2OEMA 4C5YA 4FXFA 3F5LA 5GNYA 4R9XA 2W62A 2G4JA 2BB0A 2XH2A 1J2WA 3ITLA 6CGTA 4HZ8A 4Z2IA 1FH7A 1S3TC 4HVXA 1B3YA 5G2WA 3TROA 4I7VA 3G77A 5C9WA 2VX6A 2J8GA 2WSYA 1OBAA 3CS2A 5C5YA 3GM8A 4I6KA 2YFOA 1UKSA 2X30A 3MHUA 2DIKA 1OWQA 2OMAA 1JUKA 5CAHA 1ZS2A 3TXZA 3P0WA 1FWNA 5F4XA 1W3KA 4LAUA 1TV7A 3USBA 5F7UA 3SCTA 4AB4A 4AD2A 2PWUA 1MQRA 1HTIA 1HVQA 1W3HA 1MFVA 3CB3A 1DIEA 3A3WA 4QJ5B 4H8NA 1RR2A 2FGZA 1JULA 4LYRA 2PFHA 2F2HA 4HK7A 1MUWA 5I3DA 1TPDA 2QDGA 1PSCA 2EEXA 1YRRA 2HZGA 3ONBA 4L80A 3S1XA 4DIAA 4GJIA 5BOOA 1G01A 2GUYA 2VFDA 4MZYA 4NNBA 1DJHA 2VR5A 3RGTA 1R47A 8RUCA 1AJ0A 3HJEA 1O1HA 3E49A 3T4WA 3MTWA 1EXPA 5G2HA 3VTRA 3GE7A 4JKLA 4AC7C 2J6XA 3S3GA 4G7EB 1ZJAA 4N9DA 2ISSA 2YCEA 1XKYA 3L4WA 1YW1A 1E4MM 1IT0A 1YTEA 2AL2A 4PMYA 3SAZA 5LA2A 3AO0A 4DUVA 4S3KA 4W7UA 4YJ5A 2D2JA 3ORWA 1NARA 1LG1A 2QDHA 4DLMA 3SRFA 1G4EA 1EX5A 4NJHA 3BE7A 3SCVA 2Z25A 1TX0A 3AMDA 3W7KA 1SFTA 2FHCA 3S8HA 3HMCA 5I79A 3TCSA 3MVTA 1BPLB 4PRTA 4N4PA 3CTLA 1E55A 4M6QA 4FX7A 4AZCB 3IACA 3TTOA 1NIUA 1RP9A 3BV7A 3W37A 3T08A 4OVXA 3B0PA 2YL6A 4HGXA 2X1RA 4JGDA 1YDNA 4QAWA 4XZIA 2YSWA 1XCWA 4IF2A 3CHVA 6TIMA 1XSJA 4KQNA 3C2FA 1J0JA 1K7EA 3URBA 2CBVA 2C3ZA 3UD6A 4B5NA 2CZVA 3PBWA 1FHLA 1XUUA 3PB2A 4JYEA 2QGHA 3N15A 3H24A 1DQUA 3TYZA 1RK6A 2F61A 3MVIA 3KP0A 3EDKA 2GDVA 1MDLA 3LI1A 5E6YA 2AQVA 2I14A 2ONEA 3OGVA 4S3CA 3DX5A 3SRKA 3MQTA 3FXYA 5G1MA 2JKAA 3UBPC 1M41A 4P5UA 1PTAA 1CXLA 4PFHA 4QXIA 2RAGA 3URQA 3ZWSA 3TP4A 3VZXA 4K8GA 1X8FA 1SGJA 1OB0A 4Y96A 1A5UA 1OK4A 2Y7GA 2XGZA 4FXRA 4H83A 4PA8A 3SFWA 4IX2A 4RCXA 2A3BA 4U5IA 1E9ZB 2AAMA 5GNXA 1ISZA 5BWAA 3MDUA 1AD4A 4IMGA 1LLOA 4KETA 1XICA 2GQ3A 2QUVA 1QU4A 3KBNA 3UG5A 3QM3A 5HULA 4FOKA 5DX7A 3WLQA 4IWWA 2EBNA 3SY1A 1KKOA 1WXYA 3I7SA 1KGUA 1W1ZA 4RX0A 3QMSA 3ZSTA 5AC7A 1K8YA 1VBJA 4WY0A 3LBOA 3TMQA 2NUYA 4HA3A 2ZUNA 4H9MA 1EPVA 3GTXA 1XYLA 4QFUA 1DL3A 1F76A 3LLDA 1KFKA 4UXDA 3B9DA 1XLDA 4UZUA 1JCLA 4P7QA 3ALGA 1XISA 2ISDA 4UR9A 1J10A 4HSHA 3LPFA 1UR8A 4UUIA 3AXIA 3IJQA 3C56A 4ZB5A 4MAVA 3TX9A 5BRQA 2FJKA 3PUDA 2DSVA 3S0CA 3ZVHB 1UKPA 4P61A 2ZUSA 1A5OC 3G18A 1W54A 4FPSA 1OFBA 4AZHA 4B3KA 5AYYA 3ZQ9A 5ABEA 4JNYA 2NV1A 1VFSA 5LSMA 2ADAA 2WSKA 2ACUA 1XSIA 3LMZA 3K13A 1EWDA 3GFXA 4QLJA 3DYPA 1XDLA 2DVTA 3LXBA 1F9CA 1J6PA 3T55A 2A1YA 4PBEA 3UR8A 1JPIA 1RPXA 4B3ZA 3MKKA 5AZ1A 2XHYA 2C1GA 1QHZA 1QI3A 3WL0A 2HK1A 3NZRA 1NP0A 3BQ6A 1SPQA 5CZJA 3FJNA 1KGWA 2ZZ7A 3K4AA 4GUIA 1H11A 5E9XA 2OT0A 1GVOA 3WNPA 5EBAA 3TR9A 3KX6A 3CASA 4DF2A 4AX7A 1FXQA 4WSHA 5BXPA 3IRDA 3SBFA 1KXVA 1F3EA 1N8FA 3MKCA 2R1NA 4H9TA 3WLHA 3B8VA 2NT1A 2OYKA 3JR2A 3R1ZA 1YPXA 2X41A 1EP2A 4NIRA 3M44A 3S6OA 1EEXA 2ALDA 3DU0A 1LORA 1JCTA 3MI6A 4UOZA 1BKHA 1V03A 2VX7A 1HFBA 1UKTA 3PAOA 1OHLA 4RDZA 3ARYA 1OGBA 5D2TA 1GK8A 1J5TA 2CYGA 4P8VA 2WQDA 1BVZA 2YLLA 1GG1A 4H6EA 2PDNA 3OO2A 1L6GA 2BDQA 3GSMA 5CBJA 4ILSA 3CUHA 1M9HA 1KM5A 4L9YA 3M43A 4QCEA 1NF7A 4IIHA 3T09A 4Q8NA 1CT5A 1MZRA 4DJDD 1R3TA 1JQXA 4AIEA 4A35A 2Y1HA 1R7AA 1TWZA 4FZIA 3HFYA 1HG3A 3TN6A 1PUDA 5BXRA 4W85A 2B7OA 3KLKA 3EX1A 1FA2A 5C54A 1TVLA 1XCXA 3H4WA 3F4NA 3DDMA 3PR2A 2G5WA 7TIMA 3GHTA 2REQB 4PUMA 5A5WA 1V7AA 3LHWA 1QI2A 1DWFM 1PTGA 4I8DA 1EBHA 4I9TA 5DXXA 4ZSTA 1UWRA 2VRJA 3UZXA 1TPWA 3WFAA 3TFCA 3MP5A 9RUBA 2DZUA 4RNHA 3TN3A 5BZAA 3CV2A 3RRXA 1GOXA 3V1HA 2HSAA 1BWVA 1UA7A 2VEIA 3BAXA 3QGAC 1YEYA 3KUMA 3HV8A 3TZFA 5MF5A 2BBFA 4A3HA 5C6MA 5I3GA 2V8ZA 1K6AA 1WB0A 3B9NA 1TWIA 2GWGA 3DHPA 4S3GA 2WZTA 4J40A 3L12A 1IR2A 3Q67A 3RU8X 3SGGA 1VFOA 3MWAA 4GCAA 1QAPA 1I0DA 4NF7A 1GYNA 3BDKA 1T7LA 2C79A 2NVCA 2RUSA 3LI0A 4A4AA 1RLDA 3OLGA 1U1HA 4IJRA 2FTPA 2F84A 2PRMA 1M5WA 3CC1A 1K8ZA 4L1XA 1UQYA 1Z7AA 3O16A 1VKFA 2EF9A 4W9TA 1W5MA 2B0MA 1W9BM 2QCDA 3W86A 4CEXC 1MDRA 1XQKA 1FCVA 2A3CA 3FV9A 1IXNA 3KCJA 3QBUA 4H9YA 2IPGA 2PDJA 3V1PA 1GJPA 3CL6A 3E96A 1UWSA 4NILA 3AWNA 3SUUA 1BF6A 3VNKA 2CLLA 4DJFA 1H50A 1WOBA 3WBAA 1XV8A 4C6DA 4JYFA 2PWGA 2VYOA 4JTFA 2AAAA 4LOCA 4XD6A 4YTRA 5DBUA 1FCQA 2I9EA 1F3WA 1NSJA 4US5D 4JHOA 5EBUA 2C7FA 2EXOA 1EBGA 4Y9NA 2VZOA 5KTLA 1KBKA 4UOJA 4IGMA 4MAZA 3B04A 4ZXOA 5A8MA 2OZTA 1DJGA 3QZEA 3OBKA 3DYOA 3PZOA 4GBUA 3H26A 3LY0A 3M5ZA 1YDYA 2OLHA 2ZC8A 2OGJA 3GXTA 2J75A 3H55A 5AYZA 1I1XA 4KRTA 4AIUA 4DXVA 2HV5A 5TIMA 4Z17A 1H49A 3TJLA 1B3WA 1V6VA 2DORA 2E67A 1ENUA 2XINA 1NOUA 1NDZA 3BAIA 4M5PA 4UTIA 1OD8A 4BHYA 4XKMA 2QV4A 3B03A 2GOUA 4WDXA 3VDCA 1TVNA 4DRSA 4MNKA 2IMRA 3CWHA 4XZMX 4ZQOA 1U5JA 4LX4A 1JGIA 3LRMA 4GI6A 3SDOA 4KBXA 4NL1A 2AQWA 4HU0A 3BAWA 1EYEA 3VCNA 4PMXA 4Y2WA 3AHZA 1VCGA 2PC4A 1XFBA 3NQEA 1VEOA 1AZ1A 1UWAA 4BWLA 3H4XA 3P0XA 2GGGA 2XSXA 1T41A 3APGA 4AWUA 4ZMGA 4NSBA 4AQLA 2AKMA 3S47A 2VRKA 4J3ZA 5A6BD 1AH0A 4L6HA 1SFSA 4H6RA 4HU3A 4RPQA 5MKGB 2Y4SA 1SJCA 4GVHA 3WG6A 2GFTA 4HHPA 1Q8AA 4F0HA 3BAKA 3W7HA 2CZFA 3L65A 2C0HA 2E0PA 7REQB 3JZEA 3NFUA 4RDVA 4AHOA 1QWKA 3SCUA 1H7OA 3W1XA 1ZBCA 4FALA 4FNUA 1KBJA 2ZUMA 1C8YA 3F7JA 4PUWA 4PMJA 1FWBC 2XIOA 4AD4A 1PDYA 4IICA 1A80A 4EPEC 1XLIA 5F2GA 4ZB2A 3VIIA 4UTHA 1XGEA 4KWSA 2FFIA 5K9DA 2OQHA 2VWSA 5E5CA 3QV6A 5FJRA 1FHVA 1K4GA 2PZNA 3KBWA 3WH8A 4Z0SA 3NPUA 1KCLA 1ZBKA 1VQTA 3EYPA 1EIBA 2CLPA 3ABRA 3NQGA 1T6MA 2OXNA 1D8WA 3FOKA 3DFYA 4HMNA 5FJUA 3VD4A 1JXJA 1XRVA 4A3QA 5AYBA 1EJ7L 4DLFA 4MPKA 5EMUA 3MUY1 2DV0A 3VDHA 3AXKA 5J04A 2ZADA 1XG3A 2V30A 2FDSA 2DQWA 4HA4A 4QDWA 4BK9A 1P5BA 2GUUA 3G24A 4DBDA 4JIQA 1EJXC 4AG0A 4JKMA 1UW9A 4MB3A 2O7SA 2JQXA 3P93A 3LUTA 3XIMA 2GQAA 2OWWA 5IXEA 2JKEA 4HJFA 1VYSX 5I7GA 4PMNA 2GQ8A 3LB0A 1RY8A 2VENA 1G4PA 2O92A 4E0CA 3QGVA 2HE8A 4PMUA 1B3OA 3EGJA 4PMVA 2HROA 1DVJA 4OT7A 2NUXA 3OZPA 3DHDA 1CTNA 1UPMB 4ZR8A 4IMAA 4CD7A 2PLMA 2VOTA 2Z2AA 2GJPA 3KRZA 3GHSA 2OEKA 2YCJA 1GJUA 1RJPA 2W92A 4GQGA 3UWQA 3WH5A 3TJ4A 1RCQA 4XB3A 1W1A1 1WOAA 3QV7A 3W2LA 3CM4A 3FN9A 3R0UA 3RIKA 1QPKA 1R38A 3T78A 1OCQA 1Q13A 1OFRA 2FZMA 1KBIA 1XIMA 3FEQA 3EBVA 2E5CA 3DG3A 5A94A 4JQ3A 1MFUA 5E0FA 3EPNA 5A95A 2GGJA 5RUBA 1XBZA 2ZE0A 1ITUA 3AXMA 5A6JA 4PBFA 3K1GA 1HXJA 3RAOA 2VVSA 3N12A 1EX1A 2WQPA 3GXIA 4U2YA 2VC6A 3AYRA 2A6NA 3EPMA 5HQMA 3TWBA 4UTTA 1R3WA 3PUGA 1FVPA 2CLHA 1BRLA 1L6YA 4HYVA 2ZZ3A 4JFWA 1H7XA 2FLIA 3QSRA 2PWDA 3KL5A 4D6GA 2G3MA 2PA6A 4QCFA 3VGEA 1TPVA 4K8EA 1W32A 1K70A 1Q6CA 3TTSA 2QLYA 4CU8A 3T8QA 2FZNA 1V93A 3G0SA 2PU1A 5ABFA 4O14A 3WBEA 4UTWC 3T81A 2O56A 4XZHA 3GHUA 3S42A 2NLIA 3SADA 3G2GA 4AYSA 4HD5A 3GW0A 4O50A 1QW8A 2B7PA 1QHPA 1PE1A 5LA0A 2ZUVA 2PDKA 5D9PA 2J62A 5CJNA 1TQJA 1H1NA 4GISA 1G0CA 4EE9A 4D9PA 3B4YA 3A21A 3CEPA 1LBFA 4J3TA 3W4RA 5D37A 3TNOA 1JD7A 3WZ0E 1R3SA 3EWZA 4S2CA 1TPC1 4AZ7A 4I9MA 4EX4A 3ZS4A 2X0SA 4JKKA 3MBFA 4JHMA 2XTKA 2CFFA 3M7WA 1CIUA 1L6WA 3O7UA 4YYCA 1WUEA 4KCVA 3W7GA 3WJXA 1KM4A 2PRLA 5G1TA 3AYVA 4BF5A 1TMHA 2WMIB 4GIRA 1GKPA 3B8WA 3WX7A 4AIBA 2AL1A 2BHYA 2MANA 3P7YA 5AYXA 2CZDA 3VIJA 4JTJA 4C6KA 2Z6JA 5B7YA 1XFCA 2H9AB 3PZUA 4BWLC 3CV7A 1KLYA 3JS3A 3H2NA 2X1UA 1YIXA 5AC6A 3TYBA 2I57A 1F8IA 1TUFA 3V5CA 2A7RA 3SUWA 2P1FA 1LJYA 5BU9A 3CPGA 2GJLA 4DY1A 3APTA 1X1ZA 1JCYA 1EHAA 2D0GA 5XIMA 4K38A 3TQKA 5LGZA 5GJPA 3IIPA 1KV8A 4JTTA 3LHYA 1O1ZA 5CG0A 5MKGA 3DN5A 3KRUA 5I2UA 3DI1A 3LNPA 1EJRC 1H7PA 1E3ZA 4Y7EA 1GTHA 2QDEA 3DFHA 1SO6A 3E02A 2R82A 1LUCB 4BQ3A 1S5TA 3LG3A 1P1MA 3GNDA 4LVAA 2QMKA 3N2OA 1DBTA 5CJMA 5C70A 4Z1CA 2IUZA 3IGHX 1JYNA 1ZSXA 3UQNA 4G7EA 1GVIA 1UH3A 3UZJA 3N34A 1BEUA 4D6DA 4AD0A 4HT3A 4IIBA 1DWJM 1K9TA 1AK5A 5JH2A 1ZTVA 5HWMA 1OX4A 4MY8A 1QNPA 4PCNA 3A5VA 1TVPA 4PCTA 4PUJA 4N02A 3C5QA 4OE7A 3AFBA 3TYCA 8TIMA 1G4SA 1MW2A 2YLAA 2PDCA 2XVPA 4JYDA 3GYEA 3NTYA 3NM3A 4MNLA 3ES8A 5H8UA 3WDJA 1WZLA 3VA8A 3IRSA 4LBRA 3MW7A 5CCZA 3H22A 1JYXA 3NWRA 2OVLA 1B1YA 5BWFA 1JNDA 1OD0A 1XH2A 5AHLA 4XBSA 1O5KA 3LM7A 2J24A 3QW4B 3DECA 1DJQA 4NX0A 1V6YA 4IQDA 4X9SA 3OEXA 1KFLA 5G4EA 1RHCA 3GDLA 4AZCA 3OVRA 1TR9A 2ZDRA 2FMNA 1GT8A 1NWRA 1KA9F 5C7HA 1XIGA 5CQ1A 3GUWA 3WKZA 3JVAA 3NQ2A 1HO1A 4LC6A 3OZOA 1D2KA 1QT1A 1W0MA 3S2LA 2TAAA 2VDIA 2V5BA 3S1GA 4DNHA 1LL4A 3FXGA 4B90A 3U3HA 5EFDA 3W2MA 3EMQA 3V5OA 2E8YA 1ISWA 2P3EA 2PAJA 4OFCA 3QEZA 1V3LA 4GX9A 1R2TA 3UESA 4UTMA 1VCVA 2FMOA 5DBTA 1I6NA 2NW0A 1OIMA 1QW7A 1L9WA 3ME3A 2WMIA 1M53A 2PGFA 4HSOA 4RV3A 1E6RA 5A1AA 1TREA 4XAFA 1O60A 4A8NA 2H9AA 5JU6A 3IJ6A 1XPGA 5DQPA 3G8RA 3T8LA 4QR6A 1EGVA 9XIAA 3NQCA 4MWAD 4YWIA 3Q65A 5AY7A 1WKDA 3VPLA 3ARUA 1E56A 3QQWA 3GVWA 2HBVA 3G1YA 4W89A 2AQOA 2CBIA 4IPJA 1AJZA 3GC2A 1QNRA 2IPFA 1TG7A 1TZ7A 2WVSA 3AZRA 3WQGA 4ES4A 3K30A 3KBJA 3VNLA 1WDWA 3MO4A 2ODOA 1E6ZA 1S1RA 3LGEA 1K77A 5D9MA 3W7PA 2YOCA 4UR7A 2QCGA 2W91A 2YDQA 4R9OA 4MFDA 4DX3A 2QJGA 4CQBA 1OZMA 5XINA 2FH6A 1JCMP 1DIDA 1VPYA 3LHTA 3BPWA 4HA0A 2FZ9A 3CUZA 7PTDA 3O05A 1B54A 2HJPA 3ISIX 2J88A 1C9DA 2EGZA 2OZ0A 4H6KA 4S23A 1V0MA 2CHOA 4ATWA 1MSSA 3PPGA 5EY5A 5HMSA 4DNMA 4JQAA 2YDAA 5FSEC 3OA3A 2E1DA 1V3KA 2WJZA 4JN8A 4Z1YA 2Q8XA 1NFGA 4I7UA 5ENLA 5F2MA 3AZTA 2VC5A 4LUTA 5U4NA 4EIVA 1ECEA 3MV11 3S5OA 4J3WA 4FLOA 1D3CA 3O1NA 2WC4A 4PCFA 3WMLA 2I7GA 3BV4A 4ZENA 4DN1A 4CQ9A 1LDCA 3H2CA 4PZVA 1QNOA 5IRPA 3GKAA 1FHUA 3TJIA 4K8HA 1BRLB 3CJPA 4ZO9A 5AHFA 1H51A 5C8BB 4X2RA 2VELA 2XN0A 1UUQA 1I2RA 4GUHA 2OPJA 1O5QA 2Y5SA 3FSTA 3GZ3A 4JS3A 2JEQA 2W66A 3MUIA 3WK3A 1EDGA 5LA1A 1DJNA 1G67A 2B7NA 2LLEA 5TAOA 1OC6A 1JIBA 8XIMA 1NEYA 1OF8A 4GVGA 1VENA 2VCCA 3KVMA 4C6PA 4JFTA 1W1PA 1YMYA 1XIHA 2XIIA 3ES7A 4ATDA 4XVDA 5CSUA 5I5RA 5D38A 1F4AA 3GUGA 3N9SA 1MUCA 1V4YA 3SRDA 1JRBA 3T4CA 1O94A 1R5YA 4HMEA 1UCWA 5E93A 4D6CA 5AC5A 1TIWA 3CZGA 2QV5A 4GNKB 1KR1A 3ANYA 3DENA 1XLHA 4ORMA 4JR5A 4C65A 3HPXA 2RDUA 2JEPA 3BZGA 3RPTA 3KL3A 1U83A 1WP6A 2DQXA 3RYSA 1ZB5A 4DJED 4QISA 4HZ6A 2P88A 3APYA 3VDGA 2ANUA 2X7VA 4KEZA 4ZOEA 1UWQA 2Y89A 1D9EA 3BGAA 4R5EA 3PP7A 1TPFA 2YFNA 3R0DA 4M24A 4XISA 1EUAA 1POJA 1YADA 3WJYA 2DZVA 3THCA 3IUHA 1HNYA 5D04C 2NZLA 1XD1A 3VGGA 5D32A 1GOIA 1IZKA 1BLIA 3VE7A 1Q7ZA 3M1ZA 1CX9A 3QY8A 3N04A 5FEXA 1PBGA 4QROA 4C1KA 4UQAA 3VOGA 1ISVA 4KS0A 3ABSA 2VQTA 1UD3A 1PJ9A 4M1BA 3MU7A 1FY6A 2NXIA 1I4NA 3B9AA 3TC6A 1JCNA 4F48A 2XZ7A 1E15A 4UCFA 2GVYA 1W3TA 2WB5A 3DXIA 2JGQA 4HCDA 1AUSL 1GVYA 1LLZA 1TE1A 3NO3A 3W81A 3HGRA 4IP4A 3LXCA 3KEHA 3PUEA 1XRTA 1GHSA 2C1IA 3WD2A 4E4FA 4QNEA 4O8RA 1VGAA 3A12A 4XVEA 2VFHA 4MPQA 3JU2A 4F9JA 1NFBA 3FJ4A 5LGXA 3KCOA 1KFWA 2IXUA 2YXXA 3ITTA 1C8VA 2PCQA 2A3AA 1UYQA 4RE4A 4HHHA 3K46A 2P8CA 4E6MA 2ZFAA 1XUZA 2HCVA 3MZNA 1MXSA 4XTDA 3TV8A 4HJWA 4LAMA 1EB3A 1QCWA 4XIAA 4HCLA 1FKWA 2OT1A 4PTWA 2HNEA 3UWVA 4GD0A 1SYTA 3MHFA 1BGAA 2GUBA 4B5WA 4GXPA 4HPJA 2YL9A 4MJMA 4ROPA 1JPMA 2GJRA 5EB8A 1MI3A 5H8MA 3U4AA 1UC5A 5HXMA 3LS9A 4O53A 1XW8A 5GJNA 3S9YA 4H8VA 3MUAA 1JDAA 1G4TA 4FO4A 4M7TA 1GVSA 1XLCA 3F5JA 3T2PA 2QVNA 4YVXA 2B7QA 3SSZA 3BL3A 4XTIA 3C8NA 5ABHA 3P80A 3WLNA 3S1WA 3UZZA 4LPCA 1WO2A 3WQDA 1MEHA 4B92A 2DZTA 4EXBA 1FDYA 2VDGA 3B0VC 3PZGA 4MNJA 3RFAA 2OJPA 3G1FA 1GORA 5FCZA 3WDQA 4WD0A 1S2AA 3W7RA 5I3FA 3VIOA 2IPJA 5K3VA 3BAYA 5T26A 4O1AA 3I7QA 1JGMA 3STEA 3CIVA 5DFAA 2HK0A 4GQRA 3VNZA 1NWSA 2C8NA 5IDIA 4P8WA 2G96A 3VGBA 4Y8FA 3URNA 2EQDA 1DORA 4O0ZA 2ZDSA 1LLWA 3WYZA 3T44A 1F73A 4RV8A 4GI9A 2P0OA 4FX8A 4DPQA 3NZQA 4Q6XA 2E6FA 1X39A 4F2UA 1TV2A 3THDA 3QGKC 2UY4A 4C6OA 4MGGA 1GYMA 3BICA 2ZVIA 3NQ8A 1Z89A 1GCYA 1CXHA 2E7FA 3MA8A 3MB9A 5HR7A 2F6UA 2XIQA 1YHTA 3EWUA 1PO9A 4W7WA 4TMBA 2Y8UA 2PTXA 1TTQA 1WXJA 1XQLA 4J3SA 4B9YA 1S5MA 4ZOBA 1I2PA 2XJ7A 2QJHA 3Q94A 4OBSA 1BKSA 3N6JA 3M4HA 2I5IA 2UWFA 2G3JA 3B97A 4J28A 3VC6A 4CCEA 4U3AA 1G5AA 3AU6A 1VRDA 3L5LA 3WMSA 3TE9A 3P8JA 5DF0A 3TA6A 4ZGYA 1RBAA 3WQ8A 3LTYA 3QC0A 4PEKA 4ZOCA 1Z6KA 2F6KA 4GX8A 4BJHA 4UB9A 3NO5A 1UKOA 1C8XA 4IG2A 4U10A 2XVKA 5CKSA 5CPTA 3WLSA 1QW9A 3JW7A 5A8GA 2XH0A 3FJLA 4YLWA 4IGNA 2QUMA 2CXGA 2VDHA 3M0JA 4XAGA 1GW1A 4IQLA 1EF3A 4HOXA 4LUIA 4JDYA 3CQHA 4DUXA 4ADSA 2HEJA 4I5UA 4LUTB 3B0UX 1T0OA 3KBMA 2OQLA 4GG9A 1TJ2A 2PSNA 2BTMA 3ZJ7A 3PAJA 4X3ZA 1G7VA 1H5VA 1ICQA 3KLLA 1IEQA 2CWXA 2BY2A 3DGRA 3IJDA 4I9AA 3I3EA 3FW6A 4CU7A 4TXEA 4M56A 1CW2A 1S2UA 2BY1A 1GWJA 3ARPA 3ATYA 4ZTXA 4O4VA 4DZIA 1RXOB 1BTCA 2POZA 1A49A 2Z7GA 5TF0A 2WZEA 3NL5A 5BCAA 3ZVHA 3VMOA 4GWEA 3TW9A 2VCBA 1DTUA 1SO5A 1V6WA 4IX0A 2VEKA 2Z28A 1DHKA 4BI7A 3SEPA 1X8CA 4IFOA 1J5SA 3NPVA 3SECA 4X63A 1XS2A 1LOSA 2FIQA 2WW5A 1PWLA 3SUTA 2QGYA 3F4CA 3VD3A 2DUXA 3NQDA 3V35A 1XI3A 4WUIA 1XBVA 1LBMA 5EU9A 1NY1A 3CZLA 3KVJA 3WIJA 3I7RA 4FI4A 1P43A 3ICJA 4S3FA 1UUOA 3NVDA 1TZZA 4JBRA 5K2ZA 3BJTA 1VFMA 2GJXB 3CV6A 3H8AA 1ZP4A 1BYBA 4OIFA 2BGNE 3WNMA 4AY8A 2ISWA 3WBWA 3IUIA 4LW7A 1BYCA 1O5RA 4Z2JA 2OKOA 4KW2A 2PPGA 2X8RA 4BI6A 2NXGA 3TK7A 4UNLA 4TX8A 4J1OA 5CSYA 5I3HA 5B7ZA 4ML4A 3L68A 3NAVA 3R8GA 3MANA 2G0WA 2GDUA 4B15A 1FFQA 2Z00A 3W1TA 3DBNA 3GVRA 1QNQA 2BODX 3L0NA 1SW7A 2E9MA 4MFEA 4CNSA 2A5HA 3W7OA 3HQPA 1KTNA 2QCNA 2Y61A 1TJ1A 4IH3A 3W72A 5C9UA 1R9XA 3V5FA 4GBDA 3MCOA 1JR1A 2A6LA 3LCGA 4K6AA 4AXKA 2BY3A 2D2HA 1SW0A 3WO8A 2NWSA 2JFEX 5FJJA 3SCWA 2X42A 3CZKA 1QUMA 4I3GA 3PBVA 2W67A 3IAPA 3VMNA 4CU6A 3BLDA 1PX4A 4L1WA 2YA0A 3VOJA 1PAMA 4YN5A 5T8GA 2Q8LA 1M03A 3DFOA 4LTSA 3QMTA 1W37A 5D9NA 2W63A 5M3WA 3GD6A 3CQ0A 3FDGA 1MEIA 2VZVA 1H62A 4JX5A 4H6QA 4KCWA 2E1WA 3CAWA 4TQTA 1Q65A 3LBMA 3KE0A 2G37A 3OGSA 2X7WA 1MWOA 4O54A 1W9VA 4QTGA 2VFGA 3C3UA 2PGEA 4PMQA 3EA3A 4IL0A 4IQEA 2WKJA 4IL2A 1U30A 3AJXA 3G22A 3T0BA 4JFSA 4D8LA 1OK6A 2QJIA 1EO7A 4FP1A 5D30A 4F0RA 3M5YA 1FOBA 4HNNA 3WLPA 4POCA 1Y7VA 5D05A 4P7LA 5A6TC 5BU6A 1AVAA 2BOEX 4LVGA 3OIXA 2WVUA 3J7HA 3P60A 3S5NA 3VIGA 3M6DA 2Z1BA 8XIAA 3EOUA 4NYUA 3BSMA 3BW2A 2BX7A 1RA5A 3H2OA 1KCXA 3TTYA 4I6VA 4GXWA 3OGRA 4UIOA 1E4IA 2Z1SA 1S2CA 4KRUA 1XIJA 3AJ7A 3QKZA 1KXHA 2J8TA 2RKXA 2YCKX 3B8TA 1HKJA 3BG5A 1VJSA 4RDYA 1A53A 1OFAA 4GIAA 1UWTA 1HKKA 3LZ3A 4TX6A 1LL7A 5LIUX 5AN7A 4GYPC 1O7AA 2Y6ZA 3M9YA 3T05A 1LTDA 3TTEA 1YDOA 1GVEA 1V0LA 3AS1A 3BJSA 1ALDA 3WN6A 4JTGA 3K8LA 3CLMA 2CEQA 2ZA2A 3HQOA 4NP7A 4C6IA 4XZWA 1OGSA 4IJCA 4Z2HA 4N6EA 3PZMA 4MNMA 1DXIA 4LS0A 1R46A 1EC9A 2IQTA 1K7FA 1A47A 4R7WA 5CJ5A 2BXYA 1AQHA 3VIKA 3OW1A 2VUNA 4QE4A 1UR0A 1D3HA 3TC7A 3FFSA 3EEGA 3PHAA 4HMCA 5DO8A 1F3TA 4W4QA 3N2TA 4PMDA 2DFAA 1S38A 1OM0A 1F6KA 1FWHC 2X1IA 2XVNA 1Q6OA 5DANA 3O0FA 3G3MA 2FGLA 3UWYA 2OU4A 1CB2A 3NYDA 4B5TA 5C55A 2BHZA 2R1PA 5FF7A 2WMJA 3GS6A 2O0TA 4B5UA 3WH6A 1Q66A 5IM51 1SMDA 1JAEA 3IVUA 2ZCGA 4O57A 3TH6A 4K7VA 2QUTA 1TA3B 3UGVA 1WKYA 1EKOA 6REQA 4HPHA 3TU9A 2R1MA 2QYGA 4IGHA 5CZ0A 2X05A 5KZEA 3P81A 3RNDA 2FPYA 2EG6A 1RBOB 4TOQA 4P7NA 2QHAA 3K2GA 1BAGA 3AUOA 3HGSA 2VP8A 1WKEA 1J18A 1ZRQA 4K1GA 1E6SM 1F74A 3FYYA 4XO7A 4EF9A 3B9EA 3LV5A 1VB9A 2XFWA 3G1XA 2Z6IA 2BY0A 1OFQA 3W87A 4PTVA 4UQCA 3R43A 1VD6A 2XIMA 3GNXA 1UMLA 4V27A 3B8IA 4IFRA 5DELA 5JH1A 1PX8A 1J0HA 4HPGA 4RXFA 5CPMA 1DV7A 4A2SA 3INPA 4LBSA 2VC7A 2DUZA 2Q3OA 3URAA 3W6YA 1GTEA 3R6IA 5KZDA 3VGHA 2ACSA 2WMFA 2H90A 4G6CA 1JVNA 5FESA 3PZTA 3UCCA 3WUEA 5BXSA 2I17A 1B31A 2WZIA 4WDUA 1AFSA 4XKYB 1WDSA 2HS6A 1QVBA 4FOUA 1H7NA 5HJYA 5BW6A 2D22A 4MJ2A 1F6YA 4YHEA 3BUVA 1WX0A 1OIFA 1EF2A 1TMLA 3ZXWA 3O6YX 1IT8A 2JKPA 3UJSA 4OKDA 3SM0A 4DZAA 1BYDA 4IJBA 1J0YA 2BASA 3KW3A 1HUVA 4W5ZA 3KHJA 3MI3A 2WBGA 3U8GA 3NQ7A 1B2YA 3W7CA 4IUOA 3NO1A 5HANA 3ZR5A 3GYCA 1VEMA 1CEOA 3LLFA 2YCIX 1GPFA 4QEHA 3W38A 1W5OA 5LNUA 5A8PA 3IK4A 3TSDA 2D1ZA 1PEZA 1FRBA 3II1A 5IFPA 3LPOA 3N3MA 2VGIA 3TQVA 1U33A 3A4AA 3NSXA 4U4MA 5EA9A 3F2CA 2FTWA 1Z3NA 3N29A 3ONCA 3TKFA 2J9ZA 1FUYA 4V2XA 3O15A 3LCFA 1IYXA 2VT0A 1PYMA 4PUUA 3EMCA 2C16A 3IJIA 1Q4WA 3WUGA 2WJDA 1J8VA 1UP3A 4Z1BA 3DG7A 1XYFA 4J4KA 5JIWA 3ZJ6A 3H7RA 4Q6JA 3PB0A 3S2MA 4C90A 3A3HA 4LT9A 1TA3A 3L21A 3CB8A 1NJJA 2PLCA 3ZM8A 1Y5VA 2RH9A 4F3HA 2OSXA 1XYZA 3G8EA 3OZMA 1JRCA 3AYSA 3QN3A 1E51A 2QS8A 5FAJA 2WJFA 4ZFMA 1SFLA 5FAGA 1FHDA 2Y62A 1S2WA 5T9CE 3MSGA 1XBXA 2YDRA 3SSJA 3WH9A 3HGJA 2PP3A 3ERPA 2KZHA 3I65A 1B4KA 4WQ6A 3AZSA 3HPZA 4LCQA 4EWJA 3ZIZA 1XLJA 5FL1A 5J5DA 3AYTA 2DZBA 1SZNA 1I45A 1XLFA 3Q58A 2QCHA 2WMKA 1CECA 1XPYA 3MPGA 3F03K 2EPMX 3C2VA 1RJQA 4M81A 3SQMA 4N7QA 4S2BA 5KITA 3F2BA 1N8IA 4H01A 1TTJA 3N25A 3THAA 3CQIA 2JIEA 3P14A 3ZR6A 4AFYA 3KAOA 4H2HA 1KW1A 2D73A 4K36A 4S1FA 1BVNP 4Q4PA 3VU2A 3A24A 3EOLA 4IPNB 3NZPA 4OBTA 4MSSA 3LLXA 1NP2A 2ZX9A 1ZLPA 4X9YA 1L2QA 4J9JA 2VD8A 1DXFA 1IIGA 4OBRA 3CAQA 3QPZA 4LYPA 3R58A 1T99A 2VM8A 3CL8A 2J47A 2ABBA 4WXYA 2BXVA 5BYWA 5HWNA 1RA0A 4WGXA 4C1NA 3TIMA 3UJFA 4YCOA 4IP5A 1ONXA 3BOXA 3E9AA 4WXZA 4B5VA 4JNZA 1G69A 3HA1A 3LEPA 3VIMA 5A6SA 3CO8A 4QLKA 1EGZA 5HWJA 2X0YA 4S39A 1IEVA 4O19A 3SCQA 3E74A 5XIAA 5G1YA 3KDNA 1DJXA 2O9OA 4Q7NA 2A3HA 4X60A 3T07A 3S5SA 4PH6A 1A5BA 2HISA 4CD8A 2I5GA 2QCCA 1ZZMA 1TPUA 2WMHA 3UPMA 4KCTA 4OJYA 2ZOXA 2ZX7A 4A3RA 1Z48A 1CLXA 3RXZA 3VABA 3P5ZA 3HZ3A 3E0VA 4JCMA 2W9MA 1MRQA 4MWAC 3GH5A 2F6XA 1W1TA 3VM5A 4FNTA 1JCJA 4NRSA 1PKYA 1JAKA 1P6CA 4R27A 5H6HA 1SZRA 2BVYA 1G7UA 2I56A 2GK1A 1Q7QA 4ICMA 4O17A 5J5RA 1NVMA 1A3HA 3BLFA 2HTMA 1CWYA 1W9DM 3MKVA 3N2MA 2UZ9A 1WDRA 2QVHA 3C3NA 1YE6A 5TNVA 2PS2A 1Q6FA 4NAEB 1PXGA 2NQ5A 3UZWA 3P62A 4H41A 4GUJA 4JDBA 1IEXA 2O7QA 2G3NA 1KRAC 3T1GA 3UJEA 3OB8A 3SN4A 1YPFA 2BGSA 3PM6A 3ARRA 4ERAA 4YTUA 4RXGA 4HTBA 4XQ6A 4XAYA 3L5MA 4MWAB 1EQCA 4CN1A 3W25A 1B57A 2VX5A 4RZBA 3AROA 5LNVA 4YTQA 5F2IA 4QJ4B 4P7OA 4EXAA 3W1MA 4AY7A 4KRZA 2WZMA 3CZJA 3ABZA 3I4EA 4FLQA 1ZBWA 2V38A 4I90A 1LP6A 1TX2A 3W84A 3BOLA 5JBEA 1QPNA 3K4WA 3WLJA 1AQ0A 4PTMA 3FHAA 4XZLX 3RILA 3WL1A 1VYRA 2DW7A 2DSWA 2P3ZA 2QNEA 4GLEA 1GOMA 3JRKA 1IXQA 3A64A 1CXIA 3PANA 3GXMA 1SUXA 3M0LA 2MUCA 3KVKA 3W3OA 1OFPA 3RCNA 4MJ4A 1H3GA 3LBCA 3DKJA 1RQEA 4DYEA 2GSHA 1M7XA 1BXCA 4KFPA 1G1YA 3MJYA 3JUGA 4LCRA 3U7BA 2TRSA 4M6VA 4NG3A 1LZOA 3LD5A 3CHEA 1Q85A 1HX0A 4WGHA 2EJAA 3UCQA 3PZVA 3V36A 3LCXA 3AMKA 4GVIA 4AW7A 3NJ3A 3EKZA 1V8EA 3C6CA 1ZALA 3V75A 2J7FA 3DESA 1KO0A 3CHFA 2H3DA 1KR0A 3GK0A 3A22A 4E2DA 4FF5A 2YB4A 4NI8A 2DT1A 1DTNA 2IKJA 4JTAA 2JIWA 3D0CA 3WF3A 3QFWA 2DP3A 3KCLA 1XC4A 4K2SA 3TSBA 1LWIA 4Z2LA 1ZHAA 2XSBA 1EQPA 1B4EA 4PL2A 3SRHA 1R3VA 3AXHA 4JFVA 3REQB 5B80A 4LUJA 1W3NA 4AH7A 3DFTA 4LSBA 1QI5A 1WZKA 2WNZA 1EJUC 3HGOA 1Q3NA 4LUYA 3L2IA 3TLLA 4Z08A 4KGLA 4L6OA 1PWMA 4C60A 4BF9A 4E4PA 4QDMA 1CI1A 2OSYA 1XDJA 2FVKA 1OX6A 4MLJA 5HK4A 2J9XA 2NX9A 4J3UA 3W6MA 3D6NA 1C93A 1EL3A 1W1IE 4YVPA 1GNXA 4LB3A 4WRHA 1AZ2A 1F8MA 1IEWA 3TR2A 3UETA 3AIEA 2I9UA 2R1LA 3MSYA 3THQA 1UZDA 4RR4A 2OOGA 2DZSA 1TRDA 4UFKA 3MYPA 4WY0F 3W7NA 2ATSA 4UTKA 4L65A 1UMYA 4N42A 4FS9A 4HK6A 3GIQA 1NOFA 2ZVRA 4J3VA 1YNYA 2CITA 5TBOA 1MNZA 3USZA 2WWCA 1PKLA 2UY3A 1IZCA 1WA3A 2WHJA 4D8ZA 1OQFA 4O0QA 2Y7DA 3GVQA 4B2DD 3QZAA 4Q4MA 3MY9A 2VHLA 2DT3A 3WNOA 4C1NB 1SJBA 3W2UA 4EPKA 1KWKA 3VZYA 4AEEA 1FQ0A 1XLEA 4JTRA 5E1QA 1J9YA 4PUKA 3BVJA 4EPDC 1WCGA 2OX1A 5CG7A 3LHZA 3N4EA 4UTLA 1E4LA 2V9DA 4QE1A 4NUWA 3LRLA 1R3QA 4RNIA 3H21A 3L67A 2GVLA 3OLEA 2HVNA 1MXDA 2VVNA 4DO4A 2G50A 3E2SA 1UR2A 4RZ6A 3ZYZA 2GVGA 2V3DA 2ZUWA 1WUFA 1M1BA 3NG3A 3RUBL 2FFCA 3UA4A 5LXXA 4TTGA 4HNTA 2CESA 1EJWC 1KXQA 3KM8A 1MW0A 1ECQA 2E9LA 3A47A 1V08A 4H7ZA 4ERGA 2X2YA 4DXKA 2OO0A 3GB6A 5C71A 3AMCA 2OLAA 3VXGA 3FIGA 2VKZG 2ZTJA 1TJRA 5FEZA 1H1YA 3VMPA 3FA3A 5AYIA 2XN2A 3GRIA 3MC5A 1YNQA 1L6FA 1J96A 3C2EA 3IJ8A 1FH9A 4IMEA 1BG4A 1ONWA 1YXDA 4QM1A 4PL1A 3DAQA 4OWGA 2YPIA 3E3HA 5HMEA 1NDWA 1K9FA 3NQVA 2JBMA 2VL4A 1PIGA 5AHMA 3VKJA 1UR4A 2W4XA 4EPBC 1UR3M 4NZ4A 1EZWA 2CLFA 2PLJA 3I3DA 4CCDA 2QJMA 4B3LA 2BNJA 1UROA 3ANUA 4H19A 3OYZA 4DB7A 4R53A 1TJ0A 4LF1A 3RX2A 1XIFA 4QS6A 4CKQA 5BRBA 1LWHA 4JAWA 3NL2A 3G1HA 4JTHA 2QW5A 4N9BA 1JZ2A 1OFDA 2VD9A 1QO5A 3M46A 6TAAA 1PCKA 4QGCA 3SR7A 4HB7A 4LS1A 3KDOA 4DF1A 3AIQA 5K9CA 4DAFA 1JDCA 3SIMA 3R13A 3SZ8A 4NAEA 1TFVA 1CGYA 3CT2A 3EA1A 1Q7MA 4XBJA 3WBYA 2ZWYA 4DYJA 3MJMA 2YW3A 3NDZA 1OYAA 2CZ5A 1AQMA 2ZA3A 3CAKA 2VQUA 3GFZA 5FSDC 4BR1A 2ZZ4A 1V77A 3MZ2A 4URIA 1S3HA 1WV2A 4LALA 2ZBTA 2GGIA 1I1WA 3ZFHA 5CSRA 4FHAA 3GR8A 1P7TA 3M5XA 3EOOA 4O18A 1QXLA 1W3IA 1EH9A 3KXQA 4GIEA 4HU8A 2BHUA 3WQ6A 5REQB 1VS1A 3OVGA 3LA4A 4QRNA 3CGTA 3MT1A 3VILA 4FA3A 3TN4A 4DZHA 2ZZ6A 4GO9A 2Z0IA 4A05A 1ZJHA 3ZT5A 3B8UA 2OKTA 4I9JA 3TTQA 2QJNA 2PCEA 3GTIA 4Z42C 1Q5MA 4JTCA 3WQFA 3NA8A 2V5KA 2P10A 1JL8A 3QF0A 3WLLA 4AYGA 4GNJA 1DIOA 1EC7A 1XR2A 3VUSA 4Z1DA 4LU0A 3K4DA 2XG9A 5I3JA 4IFKA 3FJ6A 4ZB0A 1CENA 4GQQA 2IKIA 4CQAA 4JHZA 4NQ1A 2G41A 1KTCA 1VJZA 4UC5A 5DCBA 3DIPA 1XYMA 1XF0A 3BSHA 2DT2A 5D9OA 5C2GA 2YZ5A 2F38A 1AW2A 1IE7C 1HO4A 3A6OA 2ICSA 4NX5A 4MY1A 3VD5A 3H7VA 3I10A 4ZQCA 1BD0A 1V3IA 3R2GA 3FYOA 4O16A 3TUUA 5M2FX 1Q63A 4A8RA 2EHHA 4A3YA 3GDMA 4KWVA 1R7OA 3DOPA 1JUEA 4Q8WA 4PUDA 1KQZA 3IJ9A 3KZSA 3IARA 3RX3A 1J11A 1XLMA 2DJXA 1ZP3A 4DWDA 2YGYA 3CMGA 3VE9A 1QPOA 1EDTA 3RMEA 3UXIA 1RD6A 4CNUA 3ZZ1A 2A3LA 3NPXA 1ZAHA 3TW6A 4OECA 2EKCA 5JUVA 2QAPA 1CGVA 3R79A 5C9RA 3BGJA 4L4LA 4XD5A 4Y9MA 4W93A 3IIZA 1TRIA 3SQLA 3B4UA 4DO7A 3DFNA 5C7VA 1XP3A 3UXLA 1QJWA 3QTPA 3HV9A 3CYJA 2P76A 3SURA 2DPEA 4CCZA 1FFRA 4G8TA 3VVGA 2ZKMX 5G4WA 2BV9A 3GAKA 3EWBX 1SW3A 3RR1A 1UD5A 3QY7A 2IQDA 3MP4A 4GQ0A 4NZCA 1ITCA 2EPHA 4ZXLA 3RN6A 3M0KA 3SIZA 5LIKX 3PN8A 2OWXA 1VZWA 2EAWA 5I06A 3WJZA 4C6MA 3G0UA 3SCPA 3G6LA 2VFIA 3HOJA 2YBTA 5IBXA 3BARA 1JZ5A 1AW1A 1K03A 3GXFA 4H1ZA 3O6DA 4Q8OA 3S5ZA 3QYQA 1PZ0A 3L2LA 4UTJA 1ME7A 3T0TA 3WEZA 1JF6A 2ZXQA 4CNNA 2XFRA 1PCWA 2W61A 4RUBA 4W8LA 4QP0A 2XFFA 1W1VA 4XAPA 2XIBA 3A23A 2GLKA 4IGSA 3KWXA 1VCFA 3P8IA 2B4GA 3BJFA 1FCBA 3R5EA 1C91A 2ATMA 4NNCA 2YA2A 2OLSA 4IFKB 4R33A 4DVOA 2XIJA 5FA5A 4OHQA 1TCMA 4EK7A 4KGJA 2PWHA 4YTTA 4LRTA 1G6CA 1E43A 1RLCL 1EOKA 4PR4A 1BSIA 2WM0A 5DMMA 3TEVA 1EP3A 3N2XA 5BNKA 2Q71A 1GOQA 1KTBA 2DDXA 2VGFA 3IIVA 4YVVA 3FLUA 2ABAA 4RE2A 4JIHA 3SB0A 3CL7A 3CUJA 5H8PA 4GZ7A 1F7BA 4WOQA 1U5HA 5HQLA 1DEDA 1IHIA 1ZAJA 3RCYA 2CLKA 3T2OA 4QS5A 4PCPA 1JYWA 4EOUA 4V33A 3T0AA 3UYIA 2J66A 3NGFA 3WUFA 3LN3A 4LRSA 3U2CA 1LROA 1RSCA 5CGTA 3H53A 3V16A 5KINA 1E70M 2CHNA 4HBKA 5EFFA 2VEFA 4ADUA 3VZZA 4YHGA 2Y85A 3GNRA 3QSTA 3PZNA 4GA8A 4C6JA 1REQA 3SCNA 2X1SA 2VEPA 3NEVA 2X16A 1K7XA 4ZQMA 2HE5A 2CLIA 2BOGX 4HNOA 3U5UA 4HNUA 2P53A 2GJNA 4D6FA 1ICPA 4IMFA 4Y9AA 2XM2A 4MKNA 3VDBA 2A4AA 1FP9A 1FH8A 3VOIA 4J5NA 2QCLA 4JQ2A 2VOMA 1QHOA 2ZC1A 1J4EA 3PTQA 2EKGA 2QULA 2VFEA 1ZGDA 3LCLA 4G5DA 2QXWA 3N13A 4JTLA 2B31A 3L7RA 3W1AA 1OYCA 5H2ZA 1TWWA 4JEQA 2ZIDA 3TAOA 1B9ZA 4JIPA 3GDTA 3N6QA 2JALA 4AWSA 1PX3A 2RDTA 2J7EA 3AUJA 4DWSA 1ZJBA 2INZA 3EXTA 3BTNA 3RPDA 3T42A 3WFLA 2V5JA 1M7PA 3TQPA 1UASA 1C7TA 3GG7A 5C2CA 3STPA 4PMRA 3WLRA 4UFIA 2J7GA 4D72A 1C9WA 1KD0A 3TN5A 4XV0A 3OYXA 5AECA 1E0WA 4AD1A 2YDSA 1Q45A 2Q01A 3NR0A 3Q4DA 3A5FA 4LEQA 5EMKA 3UPBA 4I8YA 1E1CA 1XH1A 2Z2BA 3EXSA 3U5YA 2OCZA 4S38A 3NDYA 4NXKA 4JTIA 1QR7A 5D2XA 4E5TA 1E1EA 2HWGA 3E5BA 3QKEA 3RJXA 1IEIA 1LT7A 1MO0A 4L56A 5ECUA 1V6UA 3EWXA 3IJLA 1Y0EA 4JN7A 4Q4QA 1GKQA 4G2DA 1A5NC 3HPSA 3E6EA 3TNBA 4Q4OA 4PTXA 4HPXA 4GZEA 1XIBA 3WEOA 3MO7A 1TV8A 4ZVJA 1SZFA 4HHMA 2HMCA 4DXXA 2PZ0A 1V02A 4UR8A 2FVMA 4MB1A 4B91A 2WVVB 3BOFA 4DJDA 3RRAA 1AG1O 2J9YA 3UT0A 5ABGA 3G1SA 2GGEA 4XD3A 1HN1A 5DRCA 2V82A 1XLKA 5EMLA 4L1GA 2A7PA 3V18A 2OOFA 1YX1A 4PSPA 4CGTA 2D24A 2PLKA 5HNRA 2ALRA 4ORIA 3QOKA 3B8SA 3N1AA 3FGCA 3I6TA 2OG9A 3AIBA 4O4WA 4BKNA 2YW4A 3MSRA 3SUVA 1XYAA 3GU9A 3PULA 3O2LA 3NZGA 5IFTA 4DWSC 4LQ1A 4UQDA 1XH0A 4NAFB 1R2RA 2WPGA 3V7PA 1S5NA 6ENLA 3S4TA 5DCDA 2BG5A 3WLTA 5HQEA 2QPUA 1CYGA 2HVOA 3NL6A 3FX4A 5D02A 5HJXA 2HPMA 1DWHM 3QPYA 1X1NA 4GUFA 3GG8A 4TX9A 4FSAA 3ABOA 2YBUA 2J6VA 4YU1A 4GHRA 1L0PA 4KCUA 3H54A 4R88A 2YCLA 4J2PA 5CGMA 4E8GA 4R34A 3ZJKA 1J0KA 1MQQA 1M01A 4H9VA 3CQKA 1ICSA 3QOMA 3NURA 4AUBA 4N9EA 4YXGA 1AL7A 5IHSA 3ZVIA 3DBPA 3ITYA 1GG0A 5REQA 2AGTA 3IJ7A 3W9ZA 3G0XA 3W22A 2ZRZA 3K8MA 4KWUA 1POKA 2PDBA 2DEPA 4DZ5A 2Q02A 3ARQA 1PZ1A 5A8OA 1GVQA 3LX9A 3CMJA 1HKIA 2GJXA 2NX1A 2NQJA 4AWTA 3PZIA 1G9HA 1XM3A 4JTDA 2WCAA 2A7NA 3W6LA 1QO2A 3W2JA 4PE8A 5CLWA 2NQZA 2WCSA 1B3ZA 2J79A 4IISA 1KKRA 5L6UA 5A6MA 1KM1A 4NHVA 1W9UA 3WSUA 4JICA 3M47A 3N14A 1GONA 1A5CA 4O52A 3WD3A 1CDGA 3PSWA 1Y8BA 2OQYA 5BRPA 5JBDA 1EO5A 4Q8UA 4MMWA 1FXPA 5AZ0A 2H8XA 4GYJA 4PN2A 4AF0B 4BFAA 4DEFA 2DSKA 2NSOA 5D8ZA 3W1QA 3PTKA 3NOEA 1K9DA 4PCSA 5CGQA 2F7FA 2OEJA 4IXHA 4AEOA 3AC0A 2ACQA 1OSEA 4XSMA 2V5CA 2GPTA 4KIRA 4FK9A 3UY7A 3OTRA 1TO3A 3NSNA 3U0HA 2QCMA 1B30A 4QSHA 3W2KA 4AZ6A 1IQ8A 3BLLA 1J6OA 2H8ZA 1H60A 3C0JA 3ZJ8A 3MUXA 5KZ6A 2NXHA 2ZRXA 5SWUA 2OZ3A 1O68A 1WAWA 3PJTA 2OO6A 2ZICA 3HFTA 2MNRA 1OX5A 1HIZA 3BH4A 4H3DA 4FNPA 1XRFA 1LG2A 3DFPA 2Z1WA 3MS8A 4J2MA 4JXCA 3QV9A 4YPJA 1HJVA 3MWCA 3W29A 3WLIA 4KMQA 1AQFA 4XD4A 2WVTA 3S1VA 2EO7A 3AI0A 1JYVA 3OLIA 1VYPX 3KRSA 3T6CA 3HO8A 4HIBA 3LM3A 4ADTA 3PUOA 2R14A 3VCCA 4DWSB 1R87A 4UTFA 3AU2A 4D6JA 3VC5A 1J01A 4YS1A 3VFCA 1REQB 2R6OA 4YMZA 1YTDA 2PP1A 1UZ1A 2BP1A 3POHA 3NSMA 2BGQA 5ECVA 1OFOA 4MUPA 3HM7A 1PS9A 4XKYA 1ME9A 2GQ9A 1XJBA 3AHYA 2CZEA 3QPEA 5K7JA 3C8FA 2PBGA 1Y5WA 1GYLA 3IEBA 3CTTA 4UOQA 4C6QA 3GLCA 1DOSA 1HP5A 4HZMA 1VR6A 4GABA 3KBSA 4MJZA 2E6AA 3L2MA 1IGSA 3VOHA 1UD6A 4JIIX 3RPMA 4S3JA 4NZ5A 3NXLA 3ZOAA 1FP8A 3PZ9A 3WENA 4BA0A 1LWJA 1Q6DA 4A22A 2WNQA 5DCEA 2KAUC 2WO5A 1X96A 5D8WA 1TJPA 3HG3A 4BI5A 4EAYA 2C19A 1YXYA 3EWCA 5K4XA 1US3A 2WMGA 4CNPA 3U2OA 4L4OA 2A85A 1UD4A 1MW3A 3N2CA 1RZMA 4QG6A 3U57A 2OSWA 4KEVA 3RJYA 1OEPA 3CHDA 1WBJA 1XLGA 3SY5A 3ECQA 3EWDA 3UZ5A 4GIYA 4P2VA 3I68A 1KM3A 1FWSA 3SFKA 4XX6A 2XGIA 3F4WA 4M6PA 3CWNA 3R0KA 1UC4A 4WSJA 3WMCA 1VPXA 3ABQA 7REQA 3LDVA 1E6XM 1BSLA 4ACZA 1UB3A 3WQ5A 1NWTA 1N2VA 1RV8A 2AL2B 2Z26A 3NGJA 4UQEA 4GYPA 2POTA 3M0MA 2TODA 1R6WA 1KQYA 1VLWA 1XSKA 6ALDA 1XIIA 1DQXA 4M6UA 4B9ZA 1QDSA 1ITQA 1QNSA 4PODA 3KOYA 1CGUA 3VYLA 4N0RA 5M03A 1W1B1 2Z4GA 4G9PA 1L8PA 2GYIA 3DHUA 1JI1A 3QJAA 1XRSA 4C7FA 3JZUA 1QPRA 5CLTA 2VGGA 2FKPA 1V7YA 3WF4A 5I03A 2VZSA 4LC8A 3P82A 2XWEA 3W73A 1JZ4A 1H09A 3NIYA 3GG1A 5CBBA 2PDMA 4K3ZA 3B05A 5A2AA 3QR0A 1VJIA 1BVWA 3E2QA 2DGAA 4U33A 1XGDA 2KX9A 4AHQA 2F8QA 3L5AA 3EWYA 1AA1B 2GWNA 4UZSA 4W86A 1FBAA 2VZUA 5HNUA 1HL2A 1H61A 1M65A 2J13A 4FF7A 3KTCA 3S46A 3D46A 2C14A 5A6KA 4H9XA 2EJ1A 1B90A 3LRKA 4C6CA 3FKKA 1EYWA 3FEMA 2D3NA 2YCLB 1QASA 2RFGA 4XZNX 1OG6A 2PDLA 1QOXA 1DXEA 2ZZ2A 4MG4A 3EDDA 3PSVA 1V3JA 2PUZA 3TFXA 2JGYA 3S1UA 5A8QA 5A69A 1O66A 3PJXA 4DJDC 4OQVA 3EB2A 5GJMA 1UJPA 3L23A 1L6SA 2HVMA 3G1AA 3BK0A 4E3TA 5CH9A 2PODA 4DBEA 3P61A 2Y70A 3O06A 5M17A 3WDPP 5G5IA 2QCFA 3QH2A 3MI2A 3PWGA 4C6LA 1NF0A 1YBQB 1KRCC 5GNZA 4AD5A 3W82A 1I2NA 2OYMA 3N4FA 1IV8A 4CUCA 1ZU8A 2V68A 1ZJIA 1V0KA 3GBDA 3MMTA 3BURA 1O6IA 3HB9A 3BMXA 3EB3A 3PS7A 3BGGA 3VIFA 3GNNA 3HG4A 4QLLA 4Y90A 3MMDA 4B2DA 3V0UA 4N9CA 4NVTA 4EP8C 4MB4A 2VGBA 3QTGA 2VI0A 3UZYA 1XDMA 4MADA 2B81A 1HKMA 1HKVA 3CHCA 3NXFA 3PJWA 1GQIA 4O0KA 1Z69A 3GXPA 1FWRA 3GVGA 4LUSB 1I60A 4LYQA 3RM9A 1GQJA 2WC3A 1E9IA 2Y24A 3Q45A 3GG0A 4XUYA 4LB4A 4QJ1A 1EDQA 4U31A 3DFQA 1XL9A 3KP1A 4GYFA 5JXQA 5CPSA 5AOUA 4PBGA 4Q8TA 5BOFA 1NAL1 3FAXA 2VMFA 3DG6A 4XK2A 1CB7B 2PDYA 3FA5A 2WK2A 3F5KA 2V5DA 2V6AA 3H70A 1VP5A 4M80A 4ENLA 3PBYA 3NZ1A 1UG6A 3T7VA 5GPRA 3WD1A 5FF3A 3UFYA 3PTDA 1YKWA 4YTSA 4IIEA 3L9CA 4HYRA 1OABA 5FJPA 1AMYA 1UOZA 4FAMA 3GQYA 3SI9A 1KFCA 3CLWA 3QXBA 4U3CA 3LYEA 3SW6A 5ABTA 4XIMA 4JQ4A 4RE3A 2VEGA 1B0IA 1CXEA 1I2OA 4IP7A 2ZX5A 3W76A 3AIVA 1B9BA 3PG9A 3WNLA 4XZBA 4ZO6A 3WQCA 7TAAA 3W28A 3LENA 2QT3A 4RL3A 4ACYA 1LM1A 3D3FA 2Z24A 4WDWA 3NQBA 1R3YA 3WY1A 1U2YA 2QAFA 3ARXA 4ZQNA 1S2TA 1IF2A 1N82A 4RDWA 4JX6A 3PFMA 4GGHA 4O11A 4ZSUA 1BG9A 1C8QA 5FF2A 2ZZ5A 2J27A 2Q6ZA 4QEEA 4JQ1A 2CBJA 4FIRA 4O8AA 3U4FA 5HAOA 2J77A 3MUZ1 2REQA 1EXBA 5E70A 3U6WA 1NOWA 2G3IA 1TQXA 3SQSA 1HZYA 3EB4A 4AEFA 2DZAA 4KERA 3B0YA 1VHNA 3OQ8A 3F4VA 4JTKA 3GTNA 2J8FA 4RW3A 3R11A 3EDEA 2AOSA 2ZE3A 2HPIA 3BSGA 1FX6A 1NWUA 1EA9C 4IZGA 3AS0A 3B06A 3ZSSA 4LANA 3W74A 4K68A 1ZFJA 3O07A 4PUEA 4MVAA 2E40A 4LH8A 1GQLA 2ZRUA 4E8DA 4H04A 4DWSD 5AC8A 1W56A 4IIFA 1RK5A 1T96A 1K4HA 3BC9A 4A21A 4FX6M 5J8LA 3RCMA 2DIEA 4Q7BA 3GC5A 4GOAA 2CLMA 2O9RA 3OQEA 3VGFA 4DM2A 4OUIA 1EA0A 3LK6A 4Z2KA 3TSMA 2PC8A 4D2JA 4V1XA 3H2FA 1SM9A 5FACA 3L4ZA 3OZYA 6PTDA 1OCBA 3VD9A 1YBQA 1OF6A 2PDWA 3DFSA 1P48A 3EKGA 3VINA 3CPUA 2DJLA 2EPLX 3HU7A 3TCEA 2PTYA 1BFNA 1TSIA 2E25A 3WDRA 3BCJA 2CBUA 4AMCA 3B8DA 1OCNA 1JFXA 3LHUA 4IXXA 1UH2A 2DVUA 3C61A 4A3UA 3W7EA 3H2AA 4FOJA 2C0AA 1D8CA 5AKQA 4EAMA 1GQNA 3ARTA 4DUWA 2ZX6A 1TTPA 4A8LA 3TZNA 4O12A 1LRQA 2VFFA 1MVYA 2C6QA 4US5A 3RDKA 1XCFA 3OG3A 1X6LA 4MWAE 4PTDA 2V81