4H6QA

Structure of oxidized deinococcus radiodurans proline dehydrogenase complexed with l-tetrahydrofuroic acid
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
281
structure length
281
Chain Sequence
PQVEQLARQKMWNLAERFVAGESIESAIQAVQALERDGIAGNLDLLGEFIDSPAKCTEFADDVIKLIEAAHAAGIKPYVSIKLSSVGQGKDENGEDLGLTNARRIIAKAKEYGGFICLDMEDHTRVDVTLEQFRTLVGEFGAEHVGTVLQSYLYRSLGDRASLDDLRPNIRMVKGAYLEPATVAYPDKADVDQNYRRLVFQHLKAGNYTNVATHDERIIDDVKRFVLAHGIGKDAFEFQMLYGIRRDLQKQLAAEGYRVRVYLPYGRDWYAYFSRRIAETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Proline dehydrogenase
publication title Crystal structures and kinetics of monofunctional proline dehydrogenase provide insight into substrate recognition and conformational changes associated with flavin reduction and product release.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 123
structure length 281
sequence length 281
chains with identical sequence C
ec nomenclature ec 1.5.5.2: Proline dehydrogenase.
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01619 Pro_dh Proline dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.530 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 4h6qA00
2G37A 4H6QA 4H6RA 2EKGA
chains in the Genus database with same CATH superfamily
3NR0A 1DV7A 4YTTA 3W85A 4INFA 4XZHA 4KCWA 1QI0A 5EGRA 3HIJA 1P43A 3QV7A 1C7SA 2CLHA 3FSUA 3K4DA 3G6LA 3WF0A 4G7FA 1P0BA 3NQEA 1G5AA 5DY3A 1HQTA 4JY8A 2NSOA 4US6A 3LPGA 1KKOA 1MVYA 3PBYA 3S9ZA 1IEWA 3WMLA 3U5YA 4MB5A 1UH3A 4LC6A 4IQEA 3CUZA 4HB7A 4X9YA 1JPHA 2YCKX 1E9LA 5E6ZA 4OFCA 1NOUA 5KINA 3V3WA 4YJ5A 3EXSA 4F79A 5E6YA 4AIBA 1H62A 5A6BA 1H60A 3NZ1A 4AY1A 1TREA 1UKTA 1Y5XA 3LBCA 3AU6A 1HW6A 3G6MA 4L1GA 5CPMA 1IT0A 1R38A 3WH7A 1JRBA 2VRKA 5CZJA 4EK7A 3TJXA 3LZ5A 1LP6A 4IJRA 3DC8A 5BOFA 2YXGA 2ON3A 4LT9A 4I5XA 4PGLA 3UY7A 3LI1A 4JN8A 4B2DD 5LHFA 3WEMA 3VC5A 3UZZA 2WO5A 1H7XA 1XRTA 3QLLA 1NH6A 1V7YA 3L12A 4W4QA 4DUVA 5IBXC 3TYCA 3IANA 3V35A 3THDA 1SW0A 1UUOA 3GXTA 2PTXA 1ONXA 1WNOA 2H9AA 4ZBCA 3MSGA 1FP9A 3HJEA 3S6OA 3KAOA 4BEUA 2VGGA 3P93A 5H8MA 2PWVA 3QJAA 2NQ9A 4DWSD 3IIZA 3LGDA 4QP0A 2HCVA 3EKZA 2Q6ZA 1UP2A 2YW4A 4OV9A 3EWUA 3DKLA 4HHLA 1CZ1A 3E0LA 2XTKA 4LEQA 3EAUA 4AWEA 2WZMA 5FEZA 3PBMA 3MS8A 3OGVA 4ZFCA 4GI6A 3FA3A 5FJRA 3RO8A 4TX8A 1ZJHA 1VFTA 1KQZA 1ZS2A 2KX9A 3TLLA 1A4MA 3L9CA 4J9JA 2P5NA 3L0KA 3A3WA 1GUVA 5K3VA 1LQ0A 3MJYA 1H2JA 1R3RA 4LV4A 1I2NA 1FOBA 4QDPA 5D32A 4ZB2A 1HT6A 3CV7A 1SO3A 1RK6A 1EC9A 2PDGA 4I9TA 2JGYA 3GVQA 4AXKA 2WSYA 2OWWA 5DBUA 2O56A 1EA0A 2YDSA 4B5XA 3NIYA 2X05A 4O28A 3L5LA 2G50A 4ASTA 4NYUA 3OYZA 1G67A 5F2LA 2O92A 1PZ3A 4H3DA 3W3OA 1E1FA 1L8NA 4MUPA 2NV2A 2B7OA 5FSDC 5FF4A 3NPUA 4NNAA 3SEPA 2HMCA 1XCXA 1KBBA 3MUCA 4UB9A 3AYTA 3B05A 4C7GA 2GVGA 2NLYA 2OLAA 4CNSA 1W3LA 1GEQA 2OR2A 3A4XA 4RV8A 1XR2A 3ATZA 3I3DA 4S2CA 1SR9A 1NVMA 2D22A 1DYSA 3O16A 1S38A 2TYSA 3LHYA 1XX1A 1F4HA 1B1YA 2GYIA 3KDOA 4H7ZA 3EDDA 4O12A 1K77A 1WPCA 3O6AA 3W1QA 1HTIA 4H01A 1RP8A 3W29A 1SM9A 1XBXA 4LY4A 2J66A 4J3ZA 2D24A 1V3LA 2DUZA 1IQ8A 3BLEA 3GDBA 4X22A 2CWNA 4B5UA 1W2VA 2F7FA 2YXOA 1IGWA 2E5BA 1SW7A 4YLWA 3LXAA 1W9XA 3WUEA 1X96A 5C71A 2GGIA 3PZ9A 1WOAA 1SUXA 3G8RA 3TNBA 3VPLA 3KLLA 2GZXA 2CPUA 3E2QA 4JTEA 5CSRA 4UR7A 4Q6XA 2DSWA 2Z1BA 3D46A 1GOIA 3LHUA 3RILA 2VYOA 3SQMA 3H2EA 5HPOA 3GXIA 2PDKA 4HMEA 3C86A 4Y96A 1H51A 5EBAA 3S0CA 2Z25A 4IQDA 5G5IA 2V2CA 1DWAM 1UIOA 2WLYA 3KRZA 3KVJA 4WDUA 7CGTA 1Y65A 1AODA 1P6BA 3CAKA 4JKKA 1DEDA 2VZUA 3W81A 4M51A 4D72A 2AQOA 3BLDA 3CWOX 2VEGA 3MP5A 3P0XA 4W93A 3UT0A 4B5WA 3NXFA 2WBKA 1OCQA 5D9NA 3F4WA 4NT0A 3DOPA 2C71A 1P7TA 5K7JA 2ICSA 4UCGA 4MLJA 5I02A 1B0IA 3J7HA 1AUSL 1J5SA 2DZAA 4ADSA 3VOHA 5I0DA 3R11A 2QHAA 1K1DA 2TSYA 5DMYA 3UZ5A 4WDWA 4F0KA 3NDZA 2FB3A 3UNTA 3O9NA 3E0IA 2XIOA 4QRNA 1O66A 1W9DM 3LHTA 3FFSA 4ZXOA 5K4XA 1I60A 3S47A 3C8FA 4H83A 3MANA 4JBRA 5ENLA 2TODA 1CCWB 1A5OC 5RUBA 3QV8A 2DZXA 3IIPA 3BW3A 3L2LA 2OZ3A 5JH1A 2ZX7A 4W7WA 4UOJA 3GK0A 1UWAA 4PMOA 2BGNE 1ZAJA 1XHGA 2VR2A 2VCBA 2D20A 2A6LA 3C8NA 3JS3A 5BW6A 4M80A 2BP1A 5F2GA 4UNKA 2A79A 3WNMA 3F1QA 4CD5A 3GXPA 3EA1A 4ZA0A 5ABTA 2JKPA 5HXMA 5JVLA 4JDYA 3TOYA 3ISIX 2OSXA 5ABFA 1QPNA 2X0YA 4H6KA 1S2AA 3CBWA 3R2GA 3DAQA 1K9TA 1R6WA 4GKTA 1EJRC 3HPFA 4AWSA 3CEUA 5JUVA 4FA3A 3NDOA 4IFKB 4C6BA 4ICMA 1A80A 1R2SA 4U5KA 2NX1A 4FF7A 1DVJA 3RU6A 3KWXA 4R88A 4XD4A 4RXFA 2J9YA 3WLIA 1CWYA 1Q8AA 3I6RA 3FJLA 3P7YA 3ENLA 2A7PA 1OX5A 4JDBA 4AWUA 1OG6A 2PTZA 1W1TA 1XD0A 1HL2A 1IWBA 1UWTA 4RX0A 2JBMA 2YGYA 2E7FA 4AD4A 3BARA 4XVDA 3OVGA 2WSQA 3V5CA 1QASA 3VNJA 3WK0A 4XKMA 4BFAA 1ML1A 3POCA 3BGGA 3P6LA 1E70M 4GA8A 3KCJA 5HR7A 4IPJA 1EP2A 3GU1A 3MDWA 3ALGA 3EDEA 2FPYA 4IMGA 2OG9A 4OHQA 5HOSA 3W28A 1I45A 4GC4A 4DHGA 4JFSA 1YDOA 3DERA 4DJDD 3XINA 3MHFA 5I06A 2Y1HA 2XM2A 5EPDA 2NQZA 1CXLA 4XTIA 3WH5A 2ZC1A 2XVLA 1RQHA 3GUWA 2VXNA 4X0NA 4MY9A 1G0CA 4AHPA 1SZNA 3DUGA 3WH8A 2HBXA 3CL7A 1EXPA 2BZNA 1ELSA 5D09A 4AX7A 4C6NA 4BWLA 1KTNA 3RX2A 4ZO8A 3VILA 1NQKA 4K68A 4TU1A 2OELA 3DI1A 4PUMA 2ZRUA 3UPBA 3N25A 2X7WA 3JR2A 2FVKA 4NX5A 3OZYA 3NZQA 1UOZA 3OGRA 1K9EA 3LEPA 4P5UA 1QXLA 3NA8A 3ANVA 3TW9A 2ZKMX 3FK4A 3WQEA 4QISA 5LHEA 2RJGA 2DT2A 4GLEA 1VF8A 1BQGA 3BO9A 2Z1VA 3N2OA 2I9UA 4N6FA 4O1CA 4W5ZA 4B91A 3LGGA 3FX4A 2QR6A 2FJUB 3BQ5A 5I3IA 1M65A 3K4WA 3VABA 2RGMA 3HMJG 2QGHA 1V0NA 1P1MA 2PDXA 1SU5A 2WVSA 1FTXA 3ERPA 2WZEA 3CNYA 3KCOA 2EF9A 1O6IA 4GQGA 1HKKA 3GVRA 1G7UA 1Z41A 1TPC1 4NRRA 2HS8A 1NU5A 4AIUA 3PBWA 1V6XA 7ODCA 1JD9A 2YBVA 1X1ZA 3GG1A 3GU9A 4Q8TA 4MNMA 3LLDA 2PCEA 5F2MA 4L6OA 1BD0A 2QLYA 4Q4SA 4PMJA 1GQLA 3HGJA 1Z8AA 2J6XA 1JUBA 2OO6A 2A5HA 2J7DA 3W2KA 3UVIA 3C3NA 4US5D 1EDTA 1AD4A 4UMCA 4WUIA 3FVDA 4RXGA 3W23A 2FIQA 3GTFA 1MNZA 5FSEC 2Q09A 4LUTB 3P8IA 1YBQA 4UR9A 4CKQA 1ZAIA 3B40A 3GE7A 1J2BA 3PUDA 5BOOA 2PS2A 3VKDA 4BA0A 2YCIX 2P1FA 4IF2A 1PZ2A 2AL2B 3LTPA 3MP4A 4DO5A 5C8BB 5I23A 4KWWA 3N4FA 1YLVA 3N9RA 4AHOA 4GBUA 4AHQA 4JEQA 3WBYA 4Q8OA 4KBXA 4K8HA 1VFMA 1VR6A 2QJMA 2HPIA 5FKYA 3CASA 4YTQA 3CZLA 1GNXA 2GGGA 3EOOA 4FXJA 1VPQA 2VZOA 3ARRA 3RCYA 1S2WA 1W5QA 1XRVA 1E51A 1PKNA 1U22A 1NWSA 2FZ8A 4M82A 3AALA 4AWTA 3P84A 3GY1A 1UH4A 3UR2A 3VK5A 1P5BA 1D8WA 3REQB 4HPGA 3WFZA 1KM0A 4NUWA 4YWSA 1E9YB 3OHMB 1G4SA 2FVMA 2BOFX 3LSBA 2A3HA 1MUCA 2P50A 4A4AA 1WX0A 3CPUA 3BJTA 3KOYA 4NY2A 4E0CA 3OQEA 2LLEA 1WBJA 3PSVA 2RJHA 2G4JA 5A2CA 4PRRA 1WZKA 4G9PA 3TA9A 4X2RA 1EWDA 3AUJA 4Y2WA 5LXEA 1EGVA 1HNYA 4F3HA 2BBFA 1B5TA 4RLIA 6ALDA 2EGZA 1DE6A 4RNFA 3E12A 1DJYA 4RZ5A 4QG8A 2ZUVA 3L4WA 2C0HA 3STFA 1XLHA 4F0HA 3GVWA 5J5DA 7TAAA 1IZJA 2E67A 3UJFA 1QTWA 3SCQA 4YYFA 3CEPA 3QGAC 4LBRA 2J79A 4UNLA 2VFEA 3AS1A 1OJXA 2Z6JA 4WJEA 3B06A 3E74A 2AMXA 5EMKA 2J27A 5D05A 4O1DA 1EJ7L 3GNXA 1WDDA 5LNSA 3WQ8A 4YYCA 1K7EA 5D33A 1R30A 4LUTA 5GPRA 4GNVA 2PZ0A 4MGGA 4W8BA 3VNDA 2V9DA 1LL7A 1BGAA 1GTEA 1ZP4A 1FWWA 4Y9PA 3CUHA 1G1YA 3W86A 1K4HA 3PTDA 3NQ7A 3RHGA 1E9IA 4ZQMA 3CTTA 1WCGA 3BSMA 3GR8A 2RFGA 1NFPA 4QLKA 2G97A 3BQ6A 3K8LA 2VVNA 1SQ7A 4HU3A 5I3FA 3U7BA 2GJXA 2ZRZA 3L67A 2H3DA 3ZO9A 3SQSA 3O6YX 1R0MA 4ML4A 4TX9A 2QCFA 1VBUA 2PBGA 2VZVA 3VCRA 1ZU8A 1W31A 4UTIA 1O5RA 3VGDA 1EKOA 4LWWA 3AS0A 3NQBA 1R7OA 3QPEA 3P2VA 5HPCA 3ZOAA 1AH0A 3UZYA 2QJJA 3KLKA 1UD4A 4HSHA 1QNQA 3MHGA 3SO7A 4XX6A 1W5NA 5DELA 1UWIA 4L5ZA 1T0OA 4PUWA 1UG6A 5D03A 3GU2A 1XYFA 5I03A 3DFTA 2F8QA 4PB3A 2OSWA 2O9PA 2XWDA 2AKMA 4U5IA 2ZA2A 2XVGA 3MP3A 4Q7BA 1QMLA 1J6OA 1VFFA 2XIQA 3SY1A 3MQTA 1BFNA 1L6YA 1OFAA 3OG2A 4FNQA 1ZL1A 2I5GA 1RA0A 1EGMA 2V81A 4L6HA 3E6EA 3ECQA 4RUBA 3W7PA 2VX5A 4PFMA 1OT1A 2AKZA 1VFHA 1VGAA 3W75A 3Q67A 3QEZA 3URNA 3SRKA 2PGRA 1FWNA 1WKEA 4N9BA 1EPXA 4O0ZA 4K37A 3IJDA 3A23A 1PEZA 3ARWA 4L4OA 4JYFA 5LA1A 2RUSA 5DANA 3FYOA 1ZLPA 1J5TA 4KCVA 2CLIA 1W9UA 3WQVA 3Q45A 1ITXA 2GVEA 4WIWA 3G0XA 3U9IA 4GD0A 1UR3M 3V4BA 1BXBA 4QX4A 2JE8A 5DF0A 1DPMA 3M0HA 4F2UA 4RE3A 5BXRA 3TAOA 3UZJA 5B7YA 3NQ2A 3GTHA 3WLPA 4OTKA 4JIHA 3ZVHB 2NUYA 5EY5A 4CNUA 3TEVA 3ARVA 1Q8JA 3E38A 3HG3A 1OD0A 3INPA 3R13A 4QTGA 3L4XA 4DY1A 4PBFA 4XBSA 1PHWA 1MDLA 3WUGA 5HMFA 4DUXA 1QAPA 1GPFA 4CEXC 4FOUA 2ALDA 2GQAA 1AFSA 3F5KA 4KKXA 5CKSA 3VDBA 1UKQA 3QYQA 4B4HA 5TD4A 3IUHA 2GVLA 3QKEA 3ARYA 2UV8G 2XWEA 3AXKA 1Y7VA 3WJSA 1VZWA 1VPYA 4UIOA 1JDEA 1J18A 1Z3NA 2JKEA 2BHZA 2Y8UA 5JIWA 5XIMA 4LRSA 4TIMA 1QO5A 1JDDA 2WNWA 3M5VA 2DGAA 2R1KA 2F6XA 3VNMA 2Q8ZA 2G95A 1U5HA 2QEZA 2DVUA 5EKYA 3QYSA 2OLHA 2WMIA 3A4WA 3LY0A 4XZBA 2GVJA 3IIOA 3BE7A 2XGIA 4WJXA 1OFDA 3VOFA 2Y5SA 3QMSA 5XIAA 2C14A 6TIMA 3WIJA 1CB2A 2PRLA 3S5SA 4UXDA 1VCVA 2OWCA 4HCHA 1EYEA 3H2MA 3GIPA 3U4FA 3BLPX 3KRSA 4D8AA 3V18A 5BRPA 2RHGA 3HOJA 4KCUA 2ACRA 3AMGA 3EPMA 3OVQA 3M0KA 5TF0A 2G4FA 3C0LA 4H2HA 2RKXA 5C9UA 2I5QA 5D2TA 4CN4A 3UG5A 1K7XA 1GVIA 3P5YA 2OX4A 4LNCA 1TMLA 4I9AA 2DQWA 3T8QA 1PDZA 2WW5A 4FMVA 4E2BA 1H3GA 3CIXA 4YHGA 3WL0A 3NSNA 4MB3A 3N04A 4KQNA 5D2YA 4ZR8A 3SUSA 5HJXA 2Z4GA 3LMYA 1Z32X 2V5LA 2CNCA 3E49A 2WQDA 4IG2B 4MKSA 3A22A 2BV9A 3H7VA 3OG3A 4K7YA 2PDMA 2KAUC 1NARA 3UWQA 1B30A 3BAYA 1X7IA 4LQ1A 4P8VA 2CLOA 1GGOA 1W1IE 1XYZA 2VO5A 2PAJA 2X40A 4RNJA 1RCQA 1JYXA 4JQ3A 4Q8QA 3VIFA 4Q6JA 2A2IA 1U5JA 1ITQA 2E77A 4N9EA 3PHAA 5AYIA 3FYPA 3HTWA 4S3BA 3WYZA 5F1UA 3JUGA 4GO9A 4MWAA 4BI7A 2GOUA 2XH4A 3W88A 1MO0A 4I7UA 1WP6A 2BOEX 3AHVA 1F76A 1CBGA 1KXVA 5KTLA 5LNRA 3CHCA 3VX1A 1NY1A 1HUVA 2BG5A 1K70A 3MZ2A 1JDAA 1R86A 5K4ZA 4EXBA 4LUSA 4A29A 2JEQA 2EBNA 5CG0A 3T4WA 3B03A 4Y9AA 4EXQA 4O18A 4UTTA 1LBMA 1UR1A 3GDLA 3WD1A 1V08A 4LVDA 2WCSA 2R6OA 1W5MA 1LJYA 5A95A 1ICSA 3FJNA 2QCEA 2QUUA 3QSRA 1SO6A 1HGWA 4IXHA 4DQWA 4ROPA 3TN3A 4EE9A 2QYGA 3DIPA 4GC3A 2IQ0A 4WSHA 4E5TA 3TN4A 4MWAD 3T6CA 2PDPA 5GJMA 3WMCA 1QW9A 1UWSA 3WNNA 1TZ7A 2A6NA 3RJXA 4HTYA 4R27A 3NQCA 1ADOA 3WQ4A 4EWJA 4OE7A 1UD8A 4B5NA 5E9XA 2HDJA 3EPOA 4XBJA 3CB3A 2UY4A 1CEOA 2BVWA 3QR3A 5BRQA 4V15A 3WH6A 2WKGA 1AVAA 4CU7A 2WXDM 4ZSTA 1UZ4A 3WLMA 4W5UA 2VC6A 3SUVA 2J9ZA 4MADA 5J8LA 5REQB 1ECQA 2PDLA 3P67A 1GKPA 5JBFA 9XIAA 4IG2A 4BZYA 1VS1A 2EXOA 4TVCA 2FGBA 3ARQA 4HN4A 4JFUA 1GVRA 2VENA 1UBSA 3TFCA 3RGTA 4D6HA 3W0KA 3CMGA 1GG1A 3WBWA 3EX4A 3R0UA 5CZ0A 3MVIA 2PDHA 3KOXA 4MYAA 4PRWA 5F4WA 3UERA 1AH4A 2UWFA 3MPGA 2YCLB 1AQHA 3IS4A 1ME8A 2NLIA 4N2YA 3LK6A 1V3HA 1XLGA 1FWCC 3G1SA 4I8DA 4PC8A 5HK4A 4EPEC 4F8XA 1ZSXA 3R8GA 4IWWA 1Q6RA 3S5OA 4P7RA 4IJCA 1A5AA 2ZUTA 1TPEA 3S6DA 1ZUAX 3UW6A 2QCDB 4XKYA 3S83A 4MJZA 4GJJA 4URIA 1SFTA 4ACZB 1SMAA 1XBVA 1E0TA 1V6VA 4RE0A 3IJ6A 3LV5A 5AKQA 3GDRA 4CD6A 1GQNA 4XSMA 4CNPA 3CPGA 4IPLA 2Y62A 2D2HA 3WNLA 1JCNA 3CIVA 2DT0A 2HQAA 1EDGA 4AU0A 2ZICA 2ZUSA 3WENA 2YOCA 1W5OA 3HQOA 2J74A 3RLGA 4CD8A 2Z00A 3NWRA 1VENA 4A21A 4CQ8A 2Y88A 3BJFA 3CZGA 4KIEA 5FF0A 3B4YA 4JTSA 4E8DA 4KEUA 1VIWA 1Q6LA 4UQEA 3WEOA 1KM1A 4H2CA 3JZEA 2A0NA 4RZBA 4QR6A 3EXTA 3VGFA 2I14A 3M5ZA 1ICQA 1K3UA 2PWEA 4ORIA 3GNDA 1RVKA 2ZVIA 3KX6A 2J77A 4KPLA 1PV8A 2A3AA 4DJFA 1RZMA 4NI3A 3HN3A 1M41A 3AHXA 2WK2A 3BGJA 5CBIA 2J8TA 1YPIA 5HQLA 1XRSA 5D2XA 5H91A 1IEXA 3CZJA 1JD7A 2WMFA 1T96A 3BW2A 3BH4A 4DF2A 2EPNA 4W89A 4GYJA 4AYSA 5JQ9A 1VC4A 2DW6A 2BTMA 2GQ9A 1QBAA 2WLZA 1U83A 4CCDA 2NWRA 3R7MA 5H8UA 4QEEA 1OGSA 3IK2A 4Z08A 1LLWA 3GIQA 1KM2A 3LN3A 4IZGA 3W7IA 4WQ6A 4Q8VA 1S3TC 4ADTA 3T05A 2DVTA 4S3DA 5FESA 3RLUA 3RAOA 1FWIC 2YCLA 1EGZA 1TPB1 4XUGA 5E70A 1QPQA 5U4NA 5BRBA 2HE8A 1UHVA 3M46A 4S3JA 3LCLA 4XG1A 2WZHA 1W1A1 3OJGA 2CLMA 1RHCA 3TKFA 2AGTA 4CCCA 1H0GA 1D9EA 2WHMA 1KM3A 3ZR5A 3ZJ6A 2YL6A 1GORA 1XIEA 3RU8X 3W53A 3AQUA 3NEHA 1C91A 5TIMA 2YCEA 4GUJA 4BS0A 3RM8A 2X2GA 1JXJA 1IT7A 4RL3A 4WZHA 4B9YA 4EANA 1BYCA 4CLMA 2WWCA 4E38A 2GSEA 4LJ3A 2WB5A 3BCJA 3CV2A 3NSMA 4XD5A 1FHLA 3EXRA 1KR0A 4I7WA 3VKKA 3GFYA 1GK8A 1VEMA 4LUJA 1J0YA 1QJWA 1V3JA 4QBXA 3UY8A 3IARA 1DTNA 4UTWA 1E5NA 3O05A 5EMUA 1SO4A 1R2TA 1EX5A 3M0MA 2QJIA 2OGJA 5IHSA 1QOPA 1OC5A 2CBIA 5FL0A 4QGCA 5G4WA 3T7VA 2Y8KA 3WF4A 4D8ZA 3SIZA 1KXHA 4WY0B 2KZHA 4KH2A 4RV3A 3LYEA 1BF2A 3A24A 5C2GA 1XCWA 1PYMA 4LRTA 4PRTA 3FKRA 4W85A 3PPCA 1QR7A 2PODA 2CYGA 1LLOA 4NL1A 3U2OA 3W25A 1R9ZA 2EJAA 3GC5A 3POHA 3UGVA 5HBFA 1LL6A 4H8VA 5BU9A 1WB0A 1DWFM 1VRXA 1UD3A 3ARUA 4LOCA 1R85A 4U3AA 2E6DA 8TIMA 3MUIA 1JCJA 3T0CA 3CUXA 4OBTA 4QQ3A 3T1GA 3WDJA 4MKVA 2E6AA 4GJ1A 4DF0A 4ZQRA 2NVAA 4ORMA 3FNDA 2J75A 2BXZA 3GYCA 4UC5A 1Q6GA 3F4DA 3V7PA 1VHNA 4LAMA 1JPDX 1TIMA 1N8IA 4JCMA 4A3HA 3A21A 4IPIA 2WC7A 3FAXA 2E09A 2CLLA 4WLCA 2VR4A 1OB0A 4RPQA 2NVDA 1D2KA 3MCMA 2EG8A 3F2BA 3M0LA 4LPCA 3GR4A 4KWSA 5AHNA 5D37A 4N02A 3KOZA 3MSYA 1E6SM 3THQA 4M3PA 3K46A 1E73M 1FHDA 3PZQA 4DJFC 3ZS4A 1OABA 3FGCB 1AJ0A 2Y85A 3EWDA 2AQVA 5LYRA 4PN2A 1B54A 3HB9A 2JK2A 3GNPA 3VIHA 2XFWA 3QY6A 3N2CA 3TP4A 1KFCA 5CZTA 1I1XA 4EPBC 4MDPA 4Q8WA 3LCGA 3W7CA 4A22A 3O0KA 3A3HA 1QHZA 2NX9A 3TQPA 3BICA 1AD1A 2A85A 4HJFA 2E8ZA 3OIXA 3WQOA 2ISWA 4CU8A 1FFRA 3CB8A 1YTDA 2QF7A 1R3WA 2VEPA 3B8WA 5BXPA 1JIBA 3AZTA 1YX1A 2UY3A 4ZOCA 4XSLA 5GNXA 1MUWA 3CHVA 2WHLA 3NDYA 4GUIA 2BY1A 5G2WA 1TV2A 2AGKA 1TMHA 3UXAA 4AFYA 3CMFA 2BASA 4G1NA 1A47A 3SSZA 4IGHA 5AC6A 4DIAA 2QUTA 4FB7A 1FH8A 3C2FA 4IIDA 4L9YA 1M6JA 3WMSA 4X2PA 2YDQA 1QNRA 3UJSA 4L4PA 3G22A 1TA3A 3CU2A 3DU0A 4GH3A 1DJIA 2Q3RA 3IJQA 2A7NA 1UIPA 2ZZ3A 1KO0A 2G5WA 4CN6A 2ABAA 1OF6A 4CCEA 1UASA 2QJNA 2WJDA 1V02E 3W9ZA 3LM7A 4AZ7A 3CLMA 1R9YA 1QCWA 4M6VA 2XGBA 3LA4A 4PMYA 1AW5A 2PCQA 5F2IA 2QT3A 1JDFA 1H63A 3GUGA 3FY1A 3MUY1 3ARTA 3KXQA 4LV9A 4QE1A 2OGYA 1ZBCA 4S2BA 2DVXA 1J01A 3ES8A 2RAGA 1JGMA 3VI2A 3WK3A 4UTWC 2DZUA 3PUGA 4JFVA 1W9BM 3DG7A 4AMCA 5BMXA 3FV9A 4A05A 2B81A 4H7CA 2A4AA 3AXIA 4P2VA 2BNJA 4KGJA 2J8FA 4ERIA 2FZ9A 4JX6A 1MYRA 4OBSA 3NOEA 3RMEA 1DQXA 4IP4A 4IMEA 2V63A 3H2AA 3SUTA 1LBFA 1SFSA 2EPMX 1V79A 3QXBA 4J3WA 2POTA 1AMKA 1PZ0A 3H2OA 5GNZA 2V3DA 3N4AA 2I9EA 2ABBA 1GQKA 3IV3A 4H8HA 3OGSA 1N8FA 3NOYA 3LTSA 1BSLA 1TZ9A 2EO7A 1HKJA 5AC8A 3OYXA 4IIHA 3U2ZA 3C2VA 3OZMA 3DFHA 3M41A 4FXSA 4QE4A 3MJMA 4NJGA 1GVYA 1TV4A 3OVRA 3JW7A 3LD5A 3G3DA 5E0CA 4LS0A 3MBFA 1ZCCA 3AYRA 4KERA 3MKVA 2PC4A 4KGLA 1BF6A 2F61A 2VMFA 3P61A 3N6HA 2V67A 2RDXA 5D4YA 5D02A 2GGJA 4Z42C 4PULA 4D6EA 1TB3A 1F2JA 2ACQA 4JIPA 1PTDA 4N4QA 5A8QA 2ZE0A 3DG6A 1SZGA 1WUFA 3ME3A 4CD4A 4HD5A 3S2MA 8XIAA 2R14A 1TV5A 1CLXA 2XSBA 3VZYA 3AIBA 1GQIA 1UMLA 4F9DA 3P5ZA 5I5RA 4C6MA 3VCNA 4J2MA 1FWAC 3P60A 5T26A 3TN6A 4F2TA 2FYMA 4RDYA 4BQ2A 3GHSA 1L6GA 4IXXA 2VDHA 1FCBA 1FH9A 1YE6A 3LI0A 2PRMA 3N2XA 3WD4A 1MW0A 1BG4A 5FJPA 2J9XA 1W8SA 3MWAA 4HOXA 3U2EA 4NASA 4EF8A 1G4TA 1KCKA 1DWGM 2V3GA 3SECA 2DPEA 2ZBTA 4RW3A 3AYVA 4H9UA 3UCDA 1OFEA 4RDZA 2YDAA 5G4EA 4AZCB 4HBKA 3AMCA 1UWUA 3UR7A 1CGUA 4MG4A 1O4UA 1OFRA 4NP7A 1CGXA 2ZX5A 4PMZA 3EWCA 1RJPA 1O68A 2QIIA 2V3EA 1R3SA 1OQFA 4QHRA 4H1ZA 2CBVA 3BC9A 3R6IA 1IWAA 3LDVA 1S2CA 4GKLA 1PX3A 2WC3A 3R43A 4UQBA 1BSIA 3HQPA 1XLEA 1CENA 4X60A 4P8UA 1XQLA 1I4NA 4GI9A 4OUIA 3PB0A 3SURA 5JH2A 4UUIA 3TROA 1R7AA 4UQ9A 4TMBA 3FXGA 3T0TA 1H5YA 1JZ5A 4AY8A 4HGXA 2ZFAA 4HT3A 3C61A 2WBGA 4AVFA 5LGXA 3CIWA 5IDIA 4NSBA 4I6VA 4B90A 5FI8A 2Z2UA 3M5YA 1Q6QA 2QCGA 2CW6A 4WX2A 4LGXA 1ZCOA 3APTA 3RRAA 3ONCA 1YMYA 2B7NA 1R8LA 5DRIA 1TVLA 3BJSA 3XISA 3TK7A 3E02A 3UG3A 3GSMA 4JIIX 3QSTA 1XH2A 2X7VA 4ERGA 4C6JA 1J11A 4BF7A 4HU8A 2E9MA 3UGRA 4S1FA 2H8ZA 4GY1A 4V33A 1S5TA 4FOJA 1XH0A 3C4UA 3RFAA 4ZFMA 1DORA 4B5VA 2GGEA 3BW4A 1DL3A 4H9TA 3S1GA 1TR9A 5EBUA 2XHYA 3M16A 3LCHA 4BQ3A 1A5NC 3KZSA 1W9PA 3DN5A 3KVMA 3KP0A 1NDYA 3NQFA 3T09A 2X1SA 1EO7A 4ATWA 3NQGA 3HGSA 4I9JA 1D3CA 5T8GA 3CUIA 2OKOA 4IM4A 2ANUA 4U2YA 5ABGA 4MY8A 1GOQA 3VNLA 1XIGA 4Q4QA 4IGNA 4M81A 2Y2WA 1VEOA 3H23A 3KTXA 1DJGA 2CIPA 2DZSA 4IICA 1E4MM 1WZAA 4GNKB 4WEVX 4B3LA 3U5UA 2PZNA 1W17A 4FP1A 1GOOA 2J88A 3ATYA 4KEVA 1H7NA 9CGTA 2C1HA 1WQ5A 1OX4B 5K9CA 3VCCA 3WL1A 2A3LA 3TC7A 5HMEA 2VUNA 3KTCA 2CLEA 5H1WA 3EX3A 3PS7A 4D6DA 3IJ8A 3T44A 3B8VA 1Y8BA 1QNOA 5JMUA 2C3ZA 1RY8A 1V8EA 1RXOB 4GUFA 4FXFA 3W7GA 3RCMA 3L2IA 3V36A 1VIZA 1ZTVA 2VZSA 2F2HA 4POCA 4AY7A 5E5CA 3F4NA 3S9IA 1QK2A 2WZTA 3ORWA 1FWEC 1EB3A 4S38A 3PF3A 1FWSA 3EMCA 4E2DA 3U0HA 1EIXA 3H2FA 2BGSA 3TJLA 2IW0A 3I65A 1MXDA 4NXSA 3VMPA 1C8YA 2QJGA 4IQJA 1QK0A 1MW1A 3LRMA 1R3QA 2HV5A 1YPXA 3IIVA 2E6FA 2ZRXA 3SN0A 1QWKA 2GPTA 4XD6A 3SW6A 4M29A 1QW7A 4MPQA 2VFFA 4K8GA 4ML9A 4MUZA 3Q37A 3RNDA 1B57A 5HINA 2B31A 1BVWA 4LCQA 5AHLA 1DIDA 1IXNA 3HV8A 3M44A 3VNKA 3OLEA 2OB3A 3W1MA 2QV4A 1MZHA 1W3KA 1EIBA 3L4ZA 3G1XA 3UG4A 1XXXA 4FF5A 4E3VA 1KCLA 4Y8EA 4HMCA 4AZIA 3L4VA 5BXTA 2ISFA 2FDMA 1XLDA 3RXZA 1KFBA 3WD3A 2GWGA 3NZRA 3UWYA 1EA9C 4MAZA 4Q7IA 3LHVA 1BXCA 1CX9A 1H7WA 1LBLA 3TFXA 2DSUA 4IMCA 1AMYA 2YZRA 3D6NA 3KL5A 4HA4A 3B9AA 1QNSA 3BZGA 3L5AA 4NZJA 3NM1A 5IFTA 3MV01 3WBAA 3WO8A 1O5QA 1FP8A 3BSHA 2W91A 4O57A 4F48A 3TXZA 1AL8A 3LCIA 1ME9A 1Q4WA 3N3MA 1BKHA 2WMHA 1IIHA 1E3ZA 1FDJA 4GJIA 4JTRA 5FEPA 1CTNA 3FYYA 1XV8A 4J28A 3O1NA 3B8UA 2F6KA 4TTGA 3MBDA 3W72A 2DSVA 1EBHA 2PMQA 3W1LA 5CPNA 3BG9A 5C2CA 2PDCA 3WK1A 4OGZA 1WOBA 3WQGA 1KGWA 4F0SA 2PPGA 3GTXA 3F03K 1S5MA 5IFPA 1ZFJA 2XFFA 1GKQA 4HNCA 1ICPA 5HWJA 1XSIA 4PB5A 5LIWX 4KWVA 1I75A 2OEJA 4J5NA 1V3MA 3GXDA 4C6OA 3D0CA 4J2PA 2H8XA 2WMKA 3ZSTA 4R7OA 4GNJA 3W76A 4CU6A 4FLSA 3G1YA 2QMKA 2HE5A 2NQHA 1NOWA 3ITTA 3T07A 1V0KA 3Q58A 2PURA 3STGA 4EOUA 3WUBA 3SCRA 3WLLA 3AIQA 4QG6A 3R12A 5HUOA 1VH7A 4CQ9A 1IWPA 4NNCA 1E1CA 1JUEA 4HCLA 2R1MA 1CECA 2WANA 4ZO9A 4QDMA 4ENLA 2EPLX 3CT2A 4WDXA 5I6SA 1XL9A 1JCYA 2YX0A 1P0KA 2I17A 3IACA 2DDXA 4HZ8A 1REQA 4K1GA 2HBVA 3HBLA 1QT1A 2RGLA 1QATA 2YA1A 3CMJA 4BQ4A 1EZWA 2IPFA 1MXGA 1U1JA 1CXKA 3KW3A 3ZJ7A 3WEZA 4Z2HA 3GH4A 3V1PA 4MMWA 1XPYA 1F3XA 2TRSA 3OP2A 3FIGA 1B3YA 1EUNA 1WDQA 2QDGA 1M7OA 3WLQA 2VKZG 1PWMA 3H26A 1OM0A 4PTVA 3MVTA 5AC5A 2E4TA 3CT7A 3PAJA 3BG5A 5I77A 4IHCA 4GWEA 4HZ7A 3GZAA 3KBVA 4BJHA 1UQYA 1BVNP 3VIMA 3DGBA 1O5KA 4AD1A 5CC7A 3KS6A 1F05A 3WF2A 1Y5VA 5C0QA 3MDUA 1Z48A 2J7EA 2XSAA 4WOZA 2GGHA 2Q01A 3R79A 3C2YA 2AMGA 2EPOA 1O1HA 3N15A 1PPIA 2PWDA 2WWDA 6TAAA 1VBHA 5ECUA 1ESWA 1A5UA 4MZ8A 3ITOA 4YVXA 2F2KA 2CHNA 1A53A 4IX0A 4C6FA 4H19A 2VVSA 1DTUA 3M07A 3W24A 1CYGA 2ZWZA 1I2PA 1Z89A 4JTDA 1Q63A 3PUOA 1UC4A 3GH5A 4D6IA 2V0TA 4LAKA 3R58A 4FIQA 5KMYA 3TZNA 2DY3A 1M5WA 4BHYA 2WQPA 2XIJA 8RUCA 2WM1A 1QRQA 4JNYA 3STEA 3KE0A 4QQUA 3LPOA 3MT1A 2W27A 3A6OA 4D9PA 1EZ2A 1DJQA 2ZX9A 2J7HA 4KFPA 1V93A 5I09A 2DJLA 5A6SA 3TC3A 3PUEA 1PX8A 4Q4PA 5AN7A 2OX1A 1J0ZA 1L2UA 4Q8NA 3SFWA 3DHFA 1V0MA 3DYPA 1JVNA 1ENUA 1US3A 3KHJA 3H22A 4TV5A 4DUOA 2CZDA 3SAZA 1OBAA 4GIEA 1EF3A 3P8JA 4G2DA 1T40A 4NILA 3W27A 3OZOA 3GYEA 4FEZA 4QSHA 4ZQPA 4GUGA 4MPKA 5E09A 4DJEC 2GL5A 3DBNA 3ZJKA 2H6RA 1RQBA 3ZVIA 1LT8A 4JGDA 5CGQA 4P61A 1WO2A 3R1ZA 3AI0A 4KETA 2H9AB 4FI4A 5DCEA 4WVXA 1W1B1 3TR9A 4A6GA 3L66A 5CH9A 3E3HA 2YJQA 4UTMA 2HJPA 4DAFA 4ALDA 3K4AA 5DMNA 3WQCA 3FEQA 2A3BA 3S4TA 3LBMA 4NIRA 4KMQA 2Y7DA 4PBEA 3NO3A 3VU2A 1KTCA 2X0HA 5TQLA 3TCEA 4X3ZA 5C5YA 3SM0A 4YTRA 1PCWA 2DZBA 1UJPA 1EPVA 2ESCA 2V2DA 3GVVA 2DIEA 1YPFA 4IH3A 4JXCA 3N2MA 4I5RA 1ECEA 2OEKA 4WHBA 5CG7A 3W1RA 3TTEA 3CQIA 1KBKA 3GWQA 1VLWA 3NTYA 3VGBA 1U1UA 3GXMA 3OTRA 1OG0A 4H9XA 3T2OA 1WAUA 1CLKA 3W82A 1SJAA 4OKDA 1YNPA 4JKLA 3LGEA 1OZMA 1LUCB 3LOTA 2FMNA 2VJXA 5AHEA 1OX6A 4QJ5B 1KBLA 2JALA 4GK8A 1UWRA 1M01A 2VRJA 3PFMA 2HRWA 4C91A 1TO3A 4IMDA 4B2DA 1J10A 3TONA 1CB7B 8A3HA 4ZOBA 4X63A 2FTPA 1X8FA 2OOFA 4JX5A 3VM7A 1X6UA 1CI1A 3B8SA 3DDMA 3TA6A 1QI5A 5BNKA 2VWSA 2EPHA 3GTIA 3PBVA 4MDOA 3W71A 1AJZA 1DIOA 3II1A 4E4PA 2JIEA 1QPRA 2AL1A 1S46A 1GW9A 4PBGA 1P0DA 4LS1A 4DWSA 1ME7A 3WQ5A 1A5SA 1DP0A 3A64A 3FA4A 3LRKA 5IDZA 1E0VA 2PFHA 2G3JA 4JTHA 4R85A 5I07A 1TPWA 2GSJA 3QHNA 2DQXA 1UP3A 4UTUA 4EWND 4AZ5A 5CPQA 3HV9A 2C0AA 3SCVA 1IR2A 2Y7EA 3ZWTA 1TJ0A 5EB8A 1XLFA 3ZJ8A 4AF0A 2JF7A 5I00A 4IPNB 3A9BA 3GC2A 2YCJA 4NF7A 1GHRA 4UFJA 2XM1A 1JCLA 1X1NA 3GLCA 4ZZ9A 3E2VA 4D2JA 4KT2A 4YNGA 3VFLA 3GBDA 3NO5A 1EJWC 3FHQA 4MOZA 1H49A 2PDUA 3EKGA 2V38A 3TW7A 3N6JA 2JGQA 1VJSA 3ITYA 1WE5A 1JPMA 1X39A 2QV5A 3SCTA 5FF2A 2XN0A 3ABSA 3ABZA 1ZHAA 1BRLB 3VIOA 1EOKA 1SYTA 2AOSA 3FJ6A 5AY7A 3PTMA 1GZ1A 2BLEA 1UYQA 5I78A 1UZ1A 3PB2A 3FN9A 1FCVA 1ZPTA 3H53A 1GEHA 3SCPA 3WQWA 4WD0A 2F9RA 3M6YA 4Q4MA 4KCTA 4UZSA 4H6RA 3W6MA 4O17A 1G9HA 5JXQA 3QW4B 4O53A 4UFHA 2ZQ0A 2ISDA 1GHSA 3MTWA 3YPIA 4LTSA 1P7TB 2POZA 4C6DA 1IF2A 3EMQA 1QI3A 4IIBA 4O14A 3T4CA 3PANA 1LUCA 2VL4A 3WELA 2DSZA 2OLSA 3AJXA 3UYCA 1KLZA 2XVNA 5I79A 3STCA 4NG3A 2V68A 1K6WA 4JD4A 5TAOA 2VC5A 4Q8PA 4H4IA 3EA2A 2FH8A 1ISXA 3VTRA 2VURA 4P7NA 2QPXA 1QVBA 1CGYA 1TV7A 1XFCA 3TSBA 3UU0A 2W9MA 1VB9A 4AYGA 4O54A 2RH9A 5U7SA 2V2HA 1K9DA 3NL5A 2V6AA 1KBJA 2REQA 1YDYA 3HG4A 1GZJA 2EAWA 3ARPA 3W7KA 1J79A 4TVUA 4A8LA 3BMXA 3QRHA 3AHYA 4O1AA 1GJUA 1DBTA 4PUUA 4NAEA 1PKLA 4L4MA 3CQ0A 3UD6A 3SY8A 2BGQA 2NUXA 4V1YA 3WUFA 1D7KA 3THUA 2D1ZA 2XINA 3E9AA 1THFD 2GJNA 3CZKA 3DBPA 4GQBA 3K1GA 4M6PA 2FB2A 1ISVA 3Q2DA 5ABFB 1W3JA 4FSAA 4HHPA 1JL8A 4ZB5A 3AOFA 2R1NA 7A3HA 2ZOXA 1JRCA 3UETA 3S9YA 2HXTA 3CPRA 5KEZA 2ZUMA 2QS8A 1I0DA 2CZ5A 4X0VA 1JZ4A 3KCLA 5TBOA 1CDGA 4S3CA 4JCLA 3W84A 1JPIA 1XIMA 1C92A 4G1KA 1NOFA 2YKKA 3P80A 5F7UA 5DMMA 1B90A 1ZY9A 3GM8A 2VX7A 1JXKA 3C0SA 3HO8A 4CEUC 3M9YA 3NJ3A 3EEGA 4M19A 3UBPC 1XICA 1BRLA 2XN2A 5CC5A 2XU2A 1I2RA 1X38A 4XZNX 1LOLA 5CLTA 1GYLA 4JN7A 2X8RA 3K8MA 3URQA 4HNNA 3GNNA 5AYBA 1UZDA 3SDOA 2NVCA 2WNQA 2O55A 4U3CA 5I2UA 2Z6IA 4QJ3B 1RBAA 4DWSC 2XN1A 1TIWA 4FOKA 3R94A 3VE9A 2PDNA 1HO4A 4NJHA 1YTKA 2O9TA 1TUXA 2YA2A 1K8CA 2E5DA 2G37A 3WQDA 3TWAA 3GXNA 3BAKA 2V30A 2ZRYA 4GY0A 3TMQA 5KZEA 2CKRA 2PTYA 1XIJA 1AK5A 1VFSA 3BL3A 3S5YA 2X41A 1V7AA 2A3CA 3VGHA 3GNOA 1US2A 2R1LA 3AS3A 3LM3A 2OVLA 1P1XA 4YTSA 1TV3A 2CXEA 3CZ8A 1E6XM 2WKLA 2Z1KA 4C7DA 3G5EA 4F4RA 2QCMA 4HHHA 1OGBA 1W9VA 4XAGA 1FDZA 1X6NA 4DXKA 3ZLFA 5A6TC 1B3ZA 3I7QA 3DHPA 3LLXA 4J35A 4JOMA 5CJNA 1QOQA 1TX0A 1MUMA 3LPFA 1PTAA 3DZ1A 2J25A 1S2VA 4XUYA 2OCZA 4K39A 3EMZA 1VD6A 3GAYA 4BI6A 4H6QA 1Z9AA 3W1PA 4WCJA 4MVAA 1LWHA 3EBVA 2OQHA 1HL9A 4DAIA 3FKKA 3MI3A 1V3KA 3NPXA 1SO5A 4MNKA 4AAJA 3GR7A 1TUFA 4RNHA 1KCZA 1KXQA 3L5MA 3N3TA 4J3XA 3T08A 3CL8A 3L2MA 4NKCA 3IJIA 1YE4A 1C8QA 1LZOA 3M0XA 4QS6A 2ZE3A 4N9CA 5CZKA 3IGSA 4GZEA 4HP5A 4PCFA 3AXHA 5AHMA 4ZQNA 4BF9A 2YYUA 3SCOA 3ZYZA 3WQ6A 3PSWA 3KRBA 2ACSA 4HYWA 1EHAA 5H2ZA 1UUQA 1XUZA 4IQLA 3BV4A 2DUXA 3KHDA 2X42A 1FCUA 5LXXA 3HG2A 4DJDA 1MQQA 5A6JA 1IR1A 3TW6A 4AIEA 2VQUA 3UCCA 1WBHA 3MUZ1 3B0YA 1UC5A 2Q71A 5F4SA 3W7QA 1X6LA 1SJBA 4UTKA 2PGFA 5CAHA 3USZA 4S39A 3I6EA 3QHMA 4L1WA 1AW2A 1WXJA 2BDQA 1ISWA 1HJSA 2PGWA 2VC7A 2V5KA 3Q4DA 4H6EA 1Q3NA 4DLFA 1YNQA 3TWBA 3PULA 3L0NA 2I5IA 3SBFA 2YW3A 4WY0F 3BUVA 1VFLA 4OZOA 2W0UA 5BU6A 2Q02A 1ZBVA 3RYSA 2PF0A 5CBJA 1EQCA 3QY7A 4XZMX 4AC1X 2C18A 4PMQA 1YBQB 2GQ3A 1X7FA 5DRCA 3WLKX 5CPTA 2D2GA 1XF0A 4Y7EA 1Y5WA 1XGZA 1OFPA 2W5FA 5DY2A 2YBTA 1TTQA 1T6MA 4L64A 3F4CA 2DORA 4W8LA 3TNOA 3DFPA 3RPMA 2C1IA 3G3MA 5A2BA 2E1DA 2PB1A 3LPPA 4H9YA 3OPSA 1TG7A 5MHBA 1OY0A 3A4AA 1KGXA 4QDWA 4LX4A 5CBBA 1A5BA 1DJWA 4C5YA 5I3GA 3CQHA 2VFIA 3IRSA 2WMJA 3N14A 2G96A 3THCA 1UD2A 3RO6A 3GFZA 2Q8LA 2HPMA 5CSSA 3GX9A 1BQCA 2QUVA 5AYYA 3M0YA 3HZ3A 1GZGA 2GFTA 3I4KA 4YHEA 3HFYA 4R5EA 2Y89A 1ITCA 2WV8A 3N17A 2FVLA 1RAKA 3W26A 3BAWA 3L23A 4JIQA 5T91A 4O1BA 3QGVA 1W32A 1C93A 1XLLA 4WKHA 4AXNA 3EOEA 3GHUA 4NZ4A 3JVAA 1TWWA 1FY6A 1ADSA 1NELA 1VYPX 1QFEA 4PFHA 1MNSA 1N82A 4MKNA 3WDIA 4PCTA 2BOGX 4QG9A 4KIRA 4ECLA 1B3WA 4GRSA 1EJTC 3S1XA 4US5A 4CNNA 3GBEA 3G1HA 2IXVA 3EOLA 2D0HA 2XVKA 4OECA 3QVQA 4XZ9A 1XCFA 1FWJC 1UKOA 4GVHA 3M4HA 2J24A 2E68A 3GH7A 4FS9A 3MZNA 2VELA 1Q6FA 1HP4A 1TCMA 1TRIA 5CGTA 2OEMA 1EWEA 1KFJA 3LERA 4GE8A 1L6WA 4PTWA 4GQ0A 2FZMA 2IPGA 1EUAA 2GUYA 3JRKA 3QTGA 1JCMP 5IXEA 2IKJA 4W7UA 3UVAA 4GX8A 3BOFA 1S39A 3WNOA 3OIHA 2VGBA 4NQ1A 2YLLA 3GKAA 4AMAA 1OHLA 3LUTA 3FAWA 4XAYA 4DUWA 3PFRA 3CXOA 3S1UA 3BLOA 4WJ8A 2XVPA 4AW7A 3HM7A 3BVJA 1HKWA 1WAWA 3AIEA 4AB4A 4A8IA 1LROA 1FWDC 5D2WA 3S2NA 1OK4A 3G0UA 4GH1A 3EX2A 2CC0A 2QCLA 1H09A 4I3GA 4RE4A 3N13A 3BV7A 3UA3A 2Z24A 4H7VA 1PIIA 1HKIA 3LG3A 3MMUA 3OHIA 1E71M 1E6NA 3AXMA 2J78A 2ATSA 1YXCA 4LEFA 2D2JA 2QCHA 2P3EA 2CLPA 2A21A 1ZAHA 4FO4A 2O9RA 5A3HA 3ZIZA 1H5VA 3WCZA 5B80A 2GJXB 4RDVA 3K5XA 5BWAA 4GYPA 1XINA 3QFWA 4DJDC 2I57A 4I7VA 3BTNA 2J7FA 8XIMA 3CC1A 2ZIDA 4CD7A 3HMCA 3S6TA 1BYDA 4AG0A 3SCWA 4C6KA 1KFEA 4E4FA 1Z42A 5D8ZA 3W00A 2C79A 2I1OA 3QQ0A 4MY1A 4Q4KA 4J1OA 3T55A 5KZ6A 3NPWA 1VLIA 3SJNA 3WFAA 3BLFA 1KNWA 1KQYA 1M9HA 2W92A 3USBA 3ZLGA 2NX3A 1KLYA 3RX3A 4N4PA 1SZRA 1HJVA 4OOZA 3B8TA 4JZ5A 5LIUX 3GFXA 3VD7A 3TYDA 1BTMA 5G2HA 4KEZA 4I9MA 3UWVA 5PTDA 3NL2A 5DMLA 1IZKA 4JPGA 4XBKA 4GFSA 4DELA 3LQLA 4B4FA 3UF9A 3H8AA 1JI1A 2ZZ1A 4DJED 3W6YA 3TH6A 3MV11 1PE1A 3F2CA 2FLIA 2O4QA 3HQNA 3DEQA 3C56A 3EWXA 3FDKA 3SN1A 1MEHA 4ZL1A 5D38A 1O1ZA 2ZADA 2Y6ZA 4RE2A 1GWJA 1XD1A 1L9WA 2PLJA 4HZ6A 3CAVA 3WK2A 4XVEA 2INEA 4LNYA 4BWLC 1POKA 4HU4A 1H7PA 2Q8XA 1I2OA 4JTIA 2NV9A 1PJ9A 3OZPA 3W4RA 1F7BA 3D3AA 1XYCA 1TPFA 4C1KA 1E6QM 4MSSA 1VAHA 4ZENA 4EKJA 2J8GA 4PSPA 3AICA 3K2GA 1V03A 4GZJA 1W3IA 4NHVA 2W79A 3UJEA 1VYRA 2OU4A 4YU1A 3VAVA 3NO1A 1RR2A 4IT1A 1D3GA 4J40A 3ANUA 4NX0A 5H6HA 3SGZA 3BZJA 2YIHA 2O7QA 4G7EA 5MKGA 2HVOA 3APGA 1R5YA 2ZZ5A 4O8RA 1OVDA 3AXXA 5M3WA 3UXIA 3WJXA 3T0DA 2E6YA 4U31A 4W7VA 4GZIA 3ZT7A 3V75A 1BXNA 3DECA 3G8EA 1NEYA 3NG3A 1CT5A 3UPWA 4DI8A 5E9AA 1VKFA 1XIBA 3GW0A 5IBXA 1WA3A 3GO2A 1UR8A 3ABRA 1M04A 3R25A 1IEQA 4B5SA 2V82A 3N12A 2Y0FA 4MIMA 4UBPC 1I8JA 4LVBA 2FZBA 2GK1B 3UXDA 1NJJA 3SRFA 2G3MA 2SFPA 5I3KA 3SR7A 1SR0A 2EG6A 4K6AA 2WMIB 3EEZA 3OODA 4NJJA 3EDKA 2VDGA 3C0JA 2MNRA 4MB4A 5FJIA 4J3TA 1Q6EA 1BTCA 1HFBA 3T42A 1V6UA 3MO7A 4TR9A 3QFEA 1BWLA 4IL2A 1A3XA 3FS2A 4C1LA 1L6SA 3TAKA 4GPNA 1FXPA 2OXNA 2Y24A 3IK4A 1PCKA 3QZEA 2G3IA 3PBUA 3P14A 3TQ0A 1SZEA 2OYMA 3WF3A 4UTLA 1VFOA 3WJZA 4GMEA 2V5DA 4QNEA 2RDUA 2FGZA 5DLCA 1DHKA 2HWGA 5D9OA 2FKPA 5TNVA 2VOMA 1TWDA 3A12A 3EB2A 4OQVA 3VNYA 2W4XA 3GG8A 3RN6A 5F4XA 4AH7A 2CLKA 4QLJA 2P3ZA 4GYPC 1XQKA 1KFWA 1EFZA 1X97A 1GQJA 2PDQA 2FFCA 4IP7A 3KBWA 2QJHA 4U2ZA 5KZDA 4JKMA 1XDMA 1CNVA 1VPXA 1UROA 1E6ZA 3EWYA 1FWHC 2XFYA 4WXZA 3G1RA 1FWGC 4DB7A 4L9ZA 4UCFA 1PYFA 3GAKA 4GVIA 4CUCA 1IEIA 1MI3A 4OU1A 4LC8A 4Q4RA 1N8WA 3R5EA 4FLRA 1XIFA 1TQJA 2V5CA 3AC0A 1J9YA 1K03A 1S2UA 5HUPA 3SGGA 4TVDA 1V77A 3DXIA 3E0VA 4LW7A 5FA5A 5CSYA 2FTWA 4P7LA 5HQEA 4S23A 3U6WA 4MWAB 3N19B 3E2RA 3N2BA 2CHRA 5CZSA 4AEOA 4DYJA 2V5JA 3F7JA 1FWRA 3K13A 4PE8A 4L80A 2PD9A 3I3BA 1UQZA 2OPJA 3S8HA 4V2XA 1Z44A 4ZO7A 4N7QA 2GJRA 3IGXA 3WN6A 4BR1A 1JAKA 4LUSB 1W1ZA 5LA0A 1OT2A 6REQA 2GK1A 3M7SA 3DX5A 4FIRA 2ONEA 3GD6A 3P62A 2NZLA 4HN8A 4HA1A 1JZ3A 3MHUA 1V3IA 3C2RA 4O8AA 5HNTA 2CU0A 3WBXA 4D6JA 3N18A 1F3TA 4QEHA 2C91A 2VM8A 1WDWA 3JZUA 4KS0A 5HNNA 4QNWA 2HK1A 4WSKA 1A3HA 4AQLA 4LS2A 3T2PA 3TE9A 3NNTA 2VNCA 1YNYA 1TQXA 1KM4A 3KVKA 3PTQA 1EBGA 1OFQA 3F4VA 1UP0A 3H2NA 4B16A 4RR4A 4KFNA 2ZZ7A 1MW3A 1XC4A 5A8GA 4IJBA 3SCUA 1W1YA 3WD0A 4XK2A 2PLMA 3CWHA 3ANYA 3AWOA 4Q4OA 1HP5A 2QUMA 4RW5A 2XIIA 3QHOA 2AAAA 1FXQA 4CVUA 3GDMA 3BWWA 4ZTYA 3W07A 5C9RA 2O4MA 2VP8A 1LDCA 5D9PA 1TTIA 4C60A 1W8GA 3GKFA 1Q45A 4UWMA 3FEMA 2YDRA 1Q6DA 1RJRA 5KZMA 3U3HA 1S5VA 3EA3A 3AMKA 1DXIA 3O6CA 3AFBA 5IHRA 4R33A 5L6UA 3NZPA 3M1ZA 4WK9A 2DH2A 1Q66A 1AZ2A 4LH8A 3MYPA 1X8CA 1E0XA 6XIMA 3N29A 2BVDA 4HYRA 5M5DA 3QLDA 3WLRA 3A47A 2Y8VA 4WDTA 3SJ3A 4D1JA 2VCAA 1QHOA 2VEKA 4IISA 5CQ1A 3FSTA 4E6MA 1Q7MA 2B4GA 4I6KA 5AECA 1QOXA 1LRTA 1C9WA 4JHOA 5A6BD 4JL2A 3W37A 3M5XA 1UH2A 3C2EA 2ZYFA 4H9MA 3MI2A 4U28A 3QMTA 4MJ2A 1PSCA 4JHMA 1JZ2A 3M0VA 3AIVA 7REQB 5M03A 3IUIA 1HJXA 3GTNA 1KFLA 4ATLA 4PMXA 1LWIA 4GIYA 3WJYA 1C90A 3V16A 1AQFA 5LA2A 4XKYB 3S5NA 1LOSA 2Y4SA 4ACYA 1MWOA 1EYWA 2E28A 4UMAA 1ZGDA 2PEVA 2X1TA 1E1EA 1J0HA 2DJXA 3ITVA 3PC0A 2X16A 4O16A 2NQJA 3BURA 5C9XA 4DBWA 2YL5A 2JIWA 3ES7A 1TJ1A 3QC3A 1QNVA 1G4EA 4Y6GA 5JBEA 1GVQA 1JDCA 3SRHA 1SVDA 3SRDA 3LCFA 3RLVA 4CQAA 2Y5JA 2VQTA 3PJUA 1M7JA 3TYUA 4YTUA 4Z0JA 2YSWA 3GS6A 2P76A 4M7SA 3FW6A 2CZVA 5ECVA 1UR4A 1A5MC 2GOKA 3MW7A 3VNIA 3GDKA 1FRBA 1W3NA 3DCPA 2DT3A 4DZIA 3FA5A 1CGWA 1HL8A 2C15A 1FCQA 4PTMA 4C90A 1NDVA 2BY3A 3WDRA 1XLIA 5BROA 2CBJA 4ZMGA 2ZVRA 1RPXA 3GB6A 3NQVA 4DM1A 1IE7C 5AZ0A 3OLGA 2C6QA 5LNUA 1IT8A 3WX7A 1CPUA 2W62A 1JQXA 3SSJA 3VIGA 1Q6CA 1RLCL 4H00A 4XV0A 2FPTA 2CHOA 3GVGA 2ACUA 3TTYA 1FFQA 1BYBA 2ZZ4A 2CERA 4EAMA 1XKYA 1YADA 1OFOA 1O60A 1B4KA 1HJUA 1OIMA 2CWXA 1SFLA 3NAVA 1EJXC 2QULA 2FHBA 2HISA 4IX2A 3TVAA 1XLMA 3NL3A 1N2VA 1L8PA 3ZFHA 4FX8A 2QGYA 4WF7A 2WC4A 4PODA 3ZMRA 4PB4A 2IUZA 5C2XA 1IHIA 4NZFA 1XFBA 4Q3MA 3R8RA 3V5FA 5A8MA 3MUAA 1UW9A 4J3UA 4PZVA 4WOQA 1XH1A 3DYMA 4KRZA 3ABXA 1IXOA 1R2RA 2ZXDA 1GG0A 2L5HA 4DNMA 4EX4A 4LAUA 4J3VA 4F0MA 1OSEA 7REQA 3VIJA 2FHFA 2VEMA 3OB8A 2E9LA 3B9DA 3TQVA 1EHNA 4KRTA 1AG1O 5JIPA 3WY1A 3P74A 1U2YA 1P0EA 3B9EA 5ABEA 1B9BA 1GCYA 4C6IA 3RMJA 1W6TA 2R24A 1W56A 1IEVA 2X0SA 3VE7A 3E96A 2Z29A 3L4YA 5M17A 1RA5A 2V5BA 3TV8A 2AQWA 4IIFA 1KW1A 5LNVA 2J62A 3BMVA 4M6UA 3WQFA 3IAPA 3QR1A 5HQMA 3W83A 1MRQA 4L1XA 1BPLB 3QZAA 2Y7FA 1Q6OA 3CO8A 2XUCA 1TPVA 4RCXA 1YKWA 4JQ4A 4H9ZA 2I16A 1F07A 1ZJBA 3CV6A 1ITUA 3M0JA 5C7HA 3PNZA 4LCRA 3DFQA 4QS5A 1EJUC 2F38A 3NVTA 3TQKA 2C16A 1KWGA 1HIZA 3G18A 4M1RA 5FJUA 1YEYA 1SSDA 5E1QA 2JQXA 1PO9A 1VHCA 2NSXA 4IUOA 3VDHA 1ZJAA 3DFOA 4LF2A 1VJZA 1SJCA 4JTQA 1NWTA 4ZCWA 1F61A 4E2OA 4FNPA 4MWAC 1R87A 2J7BA 4QIUA 2CCRA 1VQTA 2OOGA 2PGEA 1YTEA 1JF5A 3LQGA 2IPWA 3PZIA 5G2IA 2WOQA 3W2LA 1KM5A 4GGBA 3A13A 3QTPA 2XZ7A 2PSNA 2X1UA 3U4AA 2FDSA 3VD4A 3LXCA 3O7UA 2VFHA 4FNSA 1E4IA 4EAYA 3W2UA 1XYBA 3AU2A 4C6EA 1H1YA 2GDQA 4UTJA 2A7RA 2VHLA 5G1MA 3PG8A 4NU7A 2AAMA 2G3FA 4UTTC 3HF3A 3LS9A 3MMDA 3TR2A 1TPDA 2ZUUA 1VBJA 5B7ZA 1LTDA 1PWLA 3VUSA 3EB4A 1AH3A 3EDFA 4TX6A 3DC0A 4CGTA 1GYNA 1ZBWA 3ZSSA 2D2OA 2VDIA 2YXXA 4H8UA 1ADDA 1XC6A 3NURA 2QPSA 1UKPA 3T8LA 1RD6A 4BKNA 1BEUA 3TN5A 2OZ0A 3PZOA 2HVNA 1J0KA 2E0PA 3VIPA 3RJYA 4TTUA 4GFIA 1LYXA 3LCXA 2E5CA 3SY5A 3CLWA 3B8DA 5GNYA 5A6KA 1NP2A 3PAOA 4FALA 1OYCA 1JEZA 1EJVC 1EL3A 1AQMA 3ZQ9A 2GJLA 4QITA 2WPBA 2YFOA 1M68A 1DIEA 1OYBA 4GCXA 4QLLA 4N6EA 1XLAA 2B0MA 3MC5A 2IXUA 4W84A 3B97A 3PVFA 3OBAA 5EMLA 2RDWA 3QKZA 5HATA 4PTDA 3IVTA 1BKSA 4EXAA 2YL8A 4D8LA 4E3TA 1QPKA 2UZ9A 4U4MA 3NZGA 4GQQA 4L6DA 3W70A 1Z6KA 1EC7A 3IAQA 3QC0A 2BY0A 2DU2A 3PPGA 2IKHA 1VBRA 2CEQA 1XKJA 1HF6A 4I5UA 2YYTA 2NXIA 3IVSA 3W22A 4HNLA 4Z2JA 4ATDA 3VM5A 4AEFA 5AYXA 3CS2A 1E3XA 4ZOAA 5DT7A 2XJ7A 4MWAE 1RALA 3OO2A 1GVEA 1XPGA 3MCNA 3ZR6A 4LFYA 3B0VC 3WJWA 2OQLA 4LAZA 2WM0A 4QFUA 3LBOA 1KRMA 2P0OA 3QQ1A 1GOMA 1B3XA 4OUEA 5AHIA 4GX9A 4YL2A 2YBUA 2R82A 1GYMA 2ZXAA 1WKFA 3RLHA 4IFKA 1JZ6A 1M53A 4PUKA 2QZRA 1W1PA 2XZ9A 1XYMA 1WKYA 3OBEA 3S42A 1F6KA 1AL7A 4LYKA 1RBLA 4NJKA 5CLWA 5FOOA 4D6CA 1TA3B 3H24A 5T9CE 1T5AA 4GXWA 4CN1A 4W87A 4XTDA 1FDYA 3M0ZA 1Q5MA 1E6PA 3GG0A 3E0WA 1MEWA 2OWXA 1RLDA 1XGEA 2OMAA 4UMBA 5SWUA 3S5ZA 3LHZA 3WLOA 1RP9A 3EWWA 3HFTA 3QOKA 3PZMA 3VO0A 4Z0SA 1F6PA 1UMYA 3I6TA 4JIEA 1CGVA 1NP0A 2VWTA 1J2WA 2Z0IA 1HKMA 1ZQ5A 1XISA 1EH9A 4YN5A 5GQBA 2C19A 2XFRA 2HTMA 1I9CB 5AHFA 1XDLA 4HSOA 2JFEX 2V69A 5K2ZA 4R7JA 1H41A 3N4EA 2BB0A 3UPMA 3BXWA 3LLFA 4JTAA 4UQCA 2YLAA 4DBSA 4XZLX 5A8NA 3BG3A 2PUZA 2EKGA 2WNNA 4NXKA 2FHCA 4DBUA 5CPSA 5C7VA 1POJA 2VEIA 3GRIA 3K8KA 1MQRA 1C8VA 1ZRQA 1R47A 3QGKC 3WDHA 3PZGA 3KEHA 4W86A 3QN3A 2W3ZA 1KR1A 4AZBA 4CVWA 2Y70A 4X9SA 4HIBA 1WXYA 3TLQA 4K2SA 5FJOA 1LWJA 1LF1A 4FR1A 2YPIA 1E56A 3VNZA 5EL1A 5CJ5A 1K9FA 5E93A 4XZIA 4L9XA 3UJ2A 3UNDA 2VOTA 3W7LA 2P8BA 3H55A 3EYPA 4PSRA 4UQDA 1P6WA 4Y9OA 3U7VA 3TC6A 1E43A 3PWAA 4PCSA 3KDNA 4QAIA 4HMDA 5CEWA 3HA1A 4A3RA 1MEIA 2GDUA 2PDBA 4ICCX 2IQDA 2CZFA 4DEFA 4S3EA 1XLCA 5A5WA 4HKPA 3HGRA 4Y90A 3UP8A 3CV1A 5A6AA 4FXRA 1GJPA 2W61A 4PUNA 3H21A 3EPNA 1Z69A 4O52A 2XH7A 5DCBA 4B15A 1U33A 4AX6A 3QPZA 3S2LA 1DJNA 4S3GA 1J0JA 4P7QA 3VOIA 4HA3A 3RDKA 3LENA 3AZSA 4DO6A 1JR1A 3VGGA 1SPQA 3VDGA 4LALA 3T0BA 2OT0A 5M2FX 5D8WA 2J13A 3T40A 2QVNA 1JF6A 1R3YA 4D6GA 3ABQA 4LYPA 3SCNA 3QMRA 2PU1A 1AQ0A 2BX7A 4MF4A 1UBPC 5FEWA 4GHRA 1TZZA 3VD9A 5EFFA 4HCDA 4Z1YA 1KV5A 3VUPA 3TYEA 4ADUA 1HZYA 4E8GA 3HG5A 3KL0A 5EMYA 2AL2A 1D7FA 1H61A 2F6UA 1WUEA 2ODOA 4Q22A 5LIKX 4AVNA 5L9FA 2NT0A 1NFBA 1HN1A 1TVNA 4V1XA 3EOSA 2QDHA 4JTTA 1K4GA 4YCOA 2J4GA 1DXFA 3VMOA 1IYXA 1B2YA 1JG9A 1OK6A 1FHUA 3MYOA 4HNVA 3LTYA 3TYAA 3CTLA 3VA8A 1HG3A 1FVPA 4NVTA 3OLDA 3CYVA 3REQA 3W7HA 1WYIA 3G77A 5LIYX 3BMWA 5HNRA 3ALFA 4N9DA 3NPVA 3BLKA 4L4LA 1FHVA 4UFIA 4CNTA 1A0DA 3A5FA 3FOKA 5DEZA 4L56A 2VEFA 1BGGA 3L0GA 4ERAA 4GI8A 2BVYA 4O10A 2NV1A 4RKAA 2GUUA 1E4LA 3W7OA 4XZWA 3G2GA 4HNUA 2C13A 4XWUA 3NXLA 3T0AA 3PTKA 5FJJA 3ZR4A 4EP8C 1EX1A 1F8IA 3AIUA 3BOXA 3DFNA 2Z1XA 1WDSA 1UD5A 5GJNA 4RPPA 3DFYA 4JY9A 1MW2A 2QQ6A 2FZDA 2D69A 2WSRA 4LY8A 2PTWA 4W88A 1MZRA 3W1AA 1ZP3A 2HXUA 4HPJA 4LANA 1XLJA 4IFRA 3BLIA 2Z26A 2NUWA 5CC3A 5HANA 2YB4A 2NXHA 3PZVA 1R3VA 1NTHA 3CQKA 4JTUA 4R9XA 2Y63A 5AOUA 2V8ZA 4KRUA 1LM1A 3R89A 5J04A 4J7RA 2OFJA 2RDTA 4O4VA 4BCEA 1PDYA 1G01A 4DF1A 5ABHA 2PLKA 3NM3A 4PMVA 1BHGA 4PMNA 3RF9A 4HPXA 1OCNA 2EKCA 3LHWA 2O0TA 4HHMA 2Z7GA 1KRAC 4WKFA 1S5WA 1CXHA 4GGHA 2QVHA 3KP1A 5FCZA 4JEJA 1RSCA 1GJWA 3S1WA 1JAEA 3A5VA 4YIWA 1PL9A 3E0FA 1XBZA 2DT1A 2DZVA 3BAJA 4BI5A 5BYWA 1D8CA 3URBA 5FAGA 4XIAA 2O7SA 4HOWA 4PH6A 1V0LA 4E8CA 2HVMA 4JFWA 5LZLA 1K8XA 3ITXA 3RUBL 1L2QA 1XG3A 2ATMA 1SW3A 3KVLA 3RPTA 4P7OA 5BMWA 2TPSA 4DBEA 5K9DA 2E25A 2ZDSA 3FHAA 2Z28A 3CAQA 2G41A 3FLUA 3IWPA 4AD0A 1A49A 3WNPA 2VD9A 1ONEA 1Q4NX 3QZ6A 1KTBA 2FH6A 5FF7A 4MTVA 4FHAA 3SIMA 4IUGA 4NZ3A 3VXGA 1UOKA 3HJZA 4PMUA 1B31A 4OIFA 1E40A 3WNKA 4C7FA 1TV8A 2TAAA 4GY7A 2B7PA 1KA9F 3NVDA 4OOUA 3EKLA 3VDCA 1QU4A 4PCPA 1XUUA 1K8YA 2FZNA 4GVFA 2CLFA 4HZMA 5DT5A 2WJFA 2EPKX 4DNHA 4GG9A 1V5XA 1PX4A 4M1BA 5CCZA 5CPOA 4B5TA 5A6LA 4JTCA 5C55A 4IGMA 4JTJA 2VRQA 1HJWA 3PM6A 3GZ3A 1XLBA 1BLIA 3TZFA 2BVTA 1DWHM 1UJQA 1JZ7A 3MO4A 4JTFA 1NF0A 1CXIA 1SFJA 1E4NA 3EWBX 3GXFA 4V28A 3K1DA 4NJIA 1PZ1A 5A69A 4PTNA 3IV8A 2INZA 1UKSA 2XIMA 5H8PA 2P0IA 3WLTA 1B9ZA 2ZC8A 2P8CA 4B9ZA 2BSLA 1NWUA 4MAVA 1GOWA 3GQYA 4Z1DA 2PWUA 4G8TA 1EOMA 2C8NA 2YZ5A 4CQDA 4D6FA 3KBSA 4JX4A 2ZTJA 3SCSA 4DPPA 2WNZA 4WSJA 4AD2A 1RBOB 1RK5A 1R46A 2E3ZA 2PBOA 1GONA 1JQVA 4C6LA 4Z1BA 3M7WA 2O9OA 3O07A 2ISVA 4JAWA 4GXPA 3OBKA 4XISA 3N1AA 7PTDA 4PR4A 3O15A 1JCTA 1HGYA 2WHJA 2XG9A 1FWFC 4G56A 4BF5A 1DOSA 4DZHA 3W1TA 1M7XA 3ZVHA 4ZSUA 1P0NA 1ZBKA 3RR1A 3AMDA 5I24A 4HVXA 1XW8A 3CH9A 3H4WA 3W7DA 1V6YA 4O0QA 1JNEA 3GHTA 4X61A 1FQ0A 1UR0A 4DVOA 3CHDA 4ROQA 3SN4A 2CXGA 3U2CA 3P0WA 3E5PA 3WD2A 3ABOA 1X98A 4PEKA 3PPFA 2J7CA 3KBNA 4PYSA 1C3FA 1E72M 3IGUA 3O0FA 4I8YA 1Q7QA 4YWIA 5HJYA 1F6YA 3FXYA 2FPVA 2Y61A 2XH2A 1F3EA 1TTJA 4DRSA 3SZ8A 1TVPA 1E1CB 2BS9A 2ZDRA 3ITGA 1N55A 5KITA 1O7AA 1XG4A 3N73A 3UEQA 1LG1A 2GQ8A 1JZ8A 2XPKA 1W1VA 2PP3A 4QJ1A 3IIXA 4Q8MA 1REQB 1BWVA 1CIUA 1H50A 1NSJA 4WXYA 3UESA 4LBUA 3GC4A 3ARSA 3CAWA 2QAPA 1NWRA 2XISA 3N2TA 3B4UA 4JICA 4N0RA 1A50A 2PP0A 2V3FA 3QPYA 1CLVA 1O94A 3OA5A 3DYOA 1MDRA 3BCFA 3MI6A 1RJQA 3TUUA 4O4WA 4ONVA 5FACA 1ALDA 1KCXA 2QNEA 4JYDA 4LAOA 3VZXA 2ALRA 3OOQA 3WKZA 4PEEA 4K1WA 4F0LA 4OJYA 1DHPA 3N34A 2QPUA 1S1PA 4UOQA 2IS7A 3WMBA 2ZRWA 3FDGA 5EU9A 1Q85A 1BWKA 3M64A 3HPAA 1XSJA 1DJZA 4F2BA 3BSGA 5FF3A 1IGSA 2PE4A 3TCSA 4DN1A 4JNMA 4O1FA 5AZ1A 2JF6A 4A35A 3O6DA 3O3RA 5K9XA 3UFYA 3VINA 3PZTA 4Q33A 2WHKA 3AUOA 3KTSA 1TCDA 2D0GA 1HXJA 1E5JA 3AYSA 1LQ2A 1DE5A 1OFBA 5F1VA 5A1AA 3LU2A 3PR2A 4BY3A 2PWFA 3AIRA 3VVGA 5G1YA 1GVOA 1XIIA 4QSFA 4R34A 3UG8A 3R8HA 2CFFA 2VI0A 4NNBA 4TXEA 1F73A 4HK6A 3LX9A 4KWUA 5HMSA 3QBUA 4J27A 1F4AA 5DXYA 2P88A 3MY9A 1BVZA 2MUCA 1FWTA 4PUJA 1TWSA 1Z7AA 3L4TA 3NSXA 5EMJA 4XO7A 4AIOA 1VP5A 3PZNA 5A8OA 3GG7A 3PY2A 3ELFA 1PAMA 2DEPA 1UR9A 2HNEA 5KSWA 4JQAA 1A5CA 3LSCA 3LNMA 1FUYA 3XIMA 1Q65A 3C3UA 1P48A 2VFDA 3B9NA 1Q13A 3N9SA 3W7EA 1HX0A 3KL3A 1D3HA 3UZXA 1ISYA 4KFOA 1P6CA 2PDYA 3JU2A 2G0WA 2YFNA 2Y7GA 3BPWA 4C65A 3W2MA 4R3UA 3MB9A 1JULA 4FPSA 1PKMA 3AZRA 1JI2A 4PTXA 3L21A 1LLZA 3COTA 1PIGA 3UJRA 1SSGA 1MXSA 4JTLA 1UPPA 5AVNA 5HR6A 3VC6A 5HMDA 3WQPA 5XINA 1V02A 1GKRA 1O95A 1TJPA 4FNUA 3G1FA 2OO0A 2QUNA 3W7MA 4O50A 2C7FA 3V0UA 4Z2IA 1DJXA 4ES4A 3B9OA 3E1F1 3I10A 1QI2A 1J4EA 1CXFA 5CGMA 3R4IA 3ZLHA 1KBIA 1TRDA 4QE5A 2WPGA 1AW1A 1F5ZA 2XH0A 1RV8A 2VX6A 3I4EA 1X1OA 1K7FA 3U57A 4GISA 3AHZA 1NDWA 4W9TA 3PN8A 3HQ1A 2UY5A 3VOCA 4WGHA 1OIFA 4AZGA 2Z7KA 4NI8A 4MHBA 4UTFA 2D3NA 2OKTA 4MZYA 3A3XA 3NYDA 3P81A 4GI4A 4M6QA 2HNHA 1H7OA 1QHPA 3UA4A 2PDFA 3LXBA 2UY2A 3KUMA 2ZWYA 3MKCA 2BXYA 4XO6A 5REQA 4BK9A 2WVUA 1Q2RA 3U8GA 3TJIA 3MMWA 1DWJM 2ASHA 5BXSA 2Z1SA 1HVQA 4JHZA 2E9BA 2Z27A 2WJZA 1JPKA 4DWSB 5DBTA 3M43A 3QR0A 5AC7A 2VCCA 1GOXA 2G3NA 1F8MA 3CGTA 3EGJA 2WYSA 1EEPA 2DZWA 4MM1A 6PTDA 1NQ6A 4L65A 4YMZA 1E9ZB 5D2VA 3GW3A 1G4PA 3C0QA 4JR5A 1KC7A 3LNPA 4LYRA 4OV4A 1S2TA 4K7VA 4AF0B 7XIMA 2QF8A 1QW8A 4DJFD 1G6CA 2CETA 3PZUA 3RPDA 4R53A 3DG3A 3F5JA 1J96A 1LRNA 3W01A 4FAMA 2QCDA 1PBGA 1OCBA 2DW7A 2OJPA 3UYIA 5C6MA 1UD6A 2IPJA 3AS2A 3E2SA 4HA0A 4ACZA 5D04C 5DQPA 5BZAA 1ZZMA 5IM51 5I3HA 4Y9MA 2R91A 4CCZA 3AMLA 5E0KA 4PUEA 3W7JA 4XD3A 3ZT6A 3KM8A 2WCAA 4NRSA 2IKGA 3CHFA 3SADA 3AHTA 4M24A 1MFUA 4KWOA 4MZ1A 5KETA 2GSHA 1OEPA 2X1RA 3ID7A 5IRPA 5DN1A 1OC6A 3TMLA 4AZ6A 3BLLA 3GNRA 1QUMA 4HNTA 2CITA 2WMGA 2XGZA 5BOEA 2ZUWA 2EG7A 2ZA3A 3DFSA 4MLRA 3A9IA 1ONRA 1IV8A 3HPSA 1TR1A 3W1NA 3PP7A 4S3KA 3N11A 1TE6A 3DENA 1W5PA 4QCEA 4C6CA 2VGFA 3HPXA 4RNIA 3PG9A 2NT1A 4HU0A 3UR5A 5C54A 3DKJA 3KS5A 4GYKA 4HK5A 4JL1A 5LSMA 1TYGA 1QDSA 2FJKA 2OODA 1M7PA 3TXVA 4HYVA 3NL6A 2GDVA 1YDNA 2OQYA 2PP1A 2E8YA 1BAGA 3CM4A 2D23A 5D30A 1PB0A 2WCGA 3RK8A 3VIKA 1E6RA 2Z2AA 4LCSA 4HK7A 3SUUA 1YXYA 1YYAA 5CJMA 4B92A 2Q3OA 4G5DA 6CGTA 4O1EA 3W2NA 3DGRA 1JGIA 1SGJA 3CHEA 4M0XA 3VKCA 4XAZA 4GUHA 4RDWA 2WSKA 2OTDA 3IEBA 2XDFA 2DIKA 3UCQA 2G8ZA 4S3AA 5HNUA 4DLMA 1TMQA 1AA1B 2REQB 3B0UX 4GQRA 3QV9A 1ONWA 2IMRA 4HTBA 1LT7A 1C29A 2NXGA 3SQLA 1YRRA 4NAEB 3TTOA 1B3OA 4O11A 4Y9NA 3ARZA 3KOWA 5EA9A 1ZJIA 3NQMA 1W3HA 3AWNA 4FNTA 3B0PA 4S3FA 4GVGA 3QY8A 2FMOA 3M6DA 3T9PA 3AO0A 1HJQA 1XJBA 1SJDA 4XIMA 4ZVJA 3TOPA 4JS3A 3AROA 4BQ5A 4H8NA 4E2VA 3MU7A 2DFAA 1QBBA 1TELA 3GIYA 1EXBA 3S3GA 4ZODA 1EF2A 3NQ8A 3UXLA 2D73A 5C9WA 1LRQA 4V27A 2H3BA 5I3DA 5DFAA 3OU8A 3H7UA 4UZUA 1IZCA 3I3EA 4GYFA 3TDFA 1MRAA 4GOAA 3WLJA 4DYEA 2GVYA 4DWDA 4WKAA 4LUIA 1XI3A 3OA3A 1VYSX 5I7GA 5HWMA 4JN6A 1ZALA 3T2QA 4B3KA 1U1HA 3P3BA 1WDPA 4H04A 1I2QA 4DBDA 3W7NA 1VBGA 2QMJA 4JNZA 2ZX8A 2VX4A 4QROA 4RK8A 1B4EA 4ZTXA 2QW5A 2PI6A 1YIXA 2PU0A 3SFKA 5E0FA 1B3VA 3V1HA 4AZHA 4DZAA 1Y0EA 2P10A 3W38A 2HK0A 1A5LC 3RITA 1LCOA 3B3DA 2DH3A 1I1WA 4FX6M 4EIVA 4A3YA 2DUAA 4GABA 3WDQA 2IKIA 5DX7A 4DM2A 1PTGA 4IL0A 1KGUA 4O15A 4R7WA 3F2DA 4WY0A 2BHUA 3H2CA 4CQCA 4XQ6A 1YHTA 1F3WA 3TTSA 3RM9A 2NQ5A 3GHRA 4ZOEA 3R0DA 2X1IA 4DZ5A 3W7RA 1TTPA 1G94A 3HPZA 5J5RA 4CNOA 1G69A 5AC4A 1XM3A 2BHYA 1Q2SA 3ITLA 1OYAA 4O19A 1XIDA 2ZCGA 2JKAA 4FLQA 1IXQA 5FAJA 3V0TA 3WH9A 2X30A 3UR8A 1U5VA 1WZMA 3EWZA 4JQ2A 1UA3A 2UBPC 4I90A 3ZT5A 5LGZA 4AC7C 4K8EA 1O5XA 3UZWA 3G1DA 2GWNA 4GO8A 4YXGA 3KRUA 3APYA 4IGSA 2I56A 2PC8A 1YDVA 1JYVA 1JCXA 1KKRA 3WSUA 4C1NB 4AVOA 4ILSA 5HULA 4PL2A 1OGGA 3L7RA 3EOUA 2YB1A 4FK9A 5D9MA 3BK0A 1WXZA 3AJ7A 3QF0A 5MF5A 1NM9A 3HURA 2VGIA 6A3HA 3IUDA 1KRCC 3KOFA 3H4GA 2W6RA 3O63A 3B8IA 3CQJA 2PWGA 4MFDA 4F66A 2X2YA 1VJIA 4JYEA 4QAWA 4K38A 1K02A 1PIFA 3Q65A 1EJSC 3TU9A 4ZQOA 2A3EA 3N6QA 2ZXBA 1H0IA 1LL4A 3FGCA 1A0CA 3BAXA 2ZTKA 5DCDA 4A3UA 3TYBA 1V6TA 5IOBA 3NGJA 1QI4A 3K30A 1T8QA 3D5HA 1LQAA 1F9CA 3C5QA 2NW0A 4TV6A 5GVJA 4OWGA 1RCXB 3VD3A 4LVFA 2X09A 1TPUA 3L68A 4Z17A 4EPKA 2VFGA 2YA0A 1TX2A 1XRFA 4JFTA 5CXPA 3WFLA 2D0FA 1H1ZA 1OF8A 5CC6A 4NYYA 4DO7A 1M3UA 1GW1A 3KBMA 2WJEA 1SZFA 4LYQA 4LSBA 3MUXA 1V51A 3BCDA 1OWQA 1KM6A 2HEJA 1XYAA 4PMDA 3W73A 1RPKA 2ADAA 3MCOA 4QCFA 4LU0A 1M03A 1VRDA 3D3FA 4TOQA 4HPHA 3TSMA 3AIWA 3E5BA 3VOGA 4YVPA 3CZEA 5FJTA 1VEPA 2BMBA 4UR8A 1J93A 4HOZA 3QH2A 3NQDA 6ENLA 3PJXA 3S2CA 2ZX6A 2ZA1A 1DIKA 4WR3A 4OVXA 4TUFA 1RCOB 1AJ2A 3MSRA 1UA7A 9XIMA 1S1RA 3TYZA 3THAA 2OYLA 4E4UA 3RCNA 3I68A 3MKKA 1FX6A 3ONBA 1KD0A 3QOMA 1J8VA 2FFIA 1OC7A 4Z1AA 3ZXWA 4Z1CA 3UWEA 5LKYA 2YL9A 3RR4A 2WSPA 5HAOA 1VCGA 3W1UA 2E40A 3O2LA 3OQ8A 4NAFB 3SUWA 1L0PA 2XIBA 3I7RA 4DXXA 5HA7A 4M7TA 3UWUA 3VOJA 4JQ1A 4EPDC 4FR6A 1PVNA 4A2SA 5DO8A 3VX0A 4GIAA 1CXEA 4IPPA 3BDKA 4C1NA 1W0MA 1MQPA 4XB3A 3H54A 3CK5A 5LIXX 4QJ4B 1FWBC 3VDAA 4D71A 4IMAA 3I7SA 2FGLA 3LV6A 1A3WA 3VD5A 2QDEA 1A5KC 4EVZA 1XGDA 1W91A 3MWCA 2Y5EA 4TQTA 2OYKA 1RY0A 3VYLA 3FVMA 3UWWA 4RZ6A 4R9OA 1TPH1 2VZTA 2ZRVA 1TJ2A 4LF1A 3EB3A 1MSSA 3A4JA 2QAFA 4XAPA 1WZLA 3MA8A 2B7QA 4AEEA 1K6AA 1DWIM 2W63A 1SMDA 4UTHA 2QCCA 7TIMA 1LG2A 1PHQA 4GXMA 4J3SA 3G24A 2OZ8A 3M0IA 1U30A 3S2JA 1W37A 4A3QA 2EEXA 4IOTA 3NFUA 3WF1A 3O8AA 3DI0A 1KFKA 1ZNNA 2YR1A 2P53A 2TMDA 1RVGA 4DPQA 2WAGA 4UFKA 1E15A 4MYXA 2BWGA 1J6PA 3PK7A 1HO1A 2HROA 3O06A 1XWYA 1L6FA 3BAIA 4O13A 3W74A 3PPHA 4ZE4A 3C2OA 2BY2A 3EDJA 8CGTA 1C7TA 1FKXA 1FKWA 3EZ4A 4M8UA 3IVUA 3KZPA 3DH7A 4LBSA 7ENLA 4AUBA 2Z1WA 4ZQCA 1PUDA 3PNUA 2QKFA 3OLIA 1V4YA 1E0UA 2CKSA 4JIRA 1KV8A 1QPOA 1YW1A 3DHUA 3IJ7A 2F84A 1NAL1 4C5ZA 2JEPA 1EC8A 1N7KA 3NCOA 1UZHA 3CUJA 2CZEA 3SGUA 1XP3A 2R1PA 1K8ZA 1I6NA 5A2AA 3OVPA 4A2RA 1UB3A 1OCJA 3T78A 4J4KA 1S5NA 3IJ9A 4Z2KA 5G1TA 3ICJA 3G1AA 4UOZA 3KFTA 1M1BA 1R3TA 4KESA 1MMFA 4NAFA 3WG6A 3RG6A 4AZCA 5T9BG 3NEVA 3H7RA 3ZWSA 1QNPA 3BGAA 4ICNA 2HS6A 4U33A 4KF1A 9RUBA