4OV9A

Structure of isopropylmalate synthase binding with alpha-isopropylmalate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
385
structure length
380
Chain Sequence
b'PKTIHIQDVTLRDGNQALKRPWTIDEKIEVFDLLVELNVDGIEVGFPSSNETEFHTCQVLSKRAPKGKPIAALSRANQNEIAVTWEAIQKADCPRMHIVYPVSDFSIKHVLKISEKEVLQKIRNSISFARSIVGPGIEIQFSGEHFGDAIENFAFTKEAFLTAIEAGANIINLPNTVERYRPMVFVNMVKEIKDVVKDKAIISIHTHNDLGMATATSVESVYVGAEQIEVALNGLGERAGNTNLYETAIALHQNGENLNINFQRIYPTAKRISELTGIPIGEKTPIIGEDIFSHRSGIHQTLHQSKGAYRTFSPEFVGRMDKETISFTNQSGHKAIEFLLHQRGIQVSKEGIHHLFSLAKSISSRENNREITEAELVALS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords isopropylmalate synthase
publication title Subdomain II of alpha-isopropylmalate synthase is essential for activity: inferring a mechanism of feedback inhibition.
pubmed doi rcsb
source organism Leptospira biflexa
molecule tags Transferase
total genus 144
structure length 380
sequence length 385
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ov9A01
1TIMA 1RZMA 5I3KA 2G96A 2X1UA 5F4WA 1EP2A 3ZWTA 3R12A 4DF1A 1SR9A 2G95A 3DFOA 3DU0A 3W2UA 3O1NA 3ZR4A 7TIMA 1DQXA 3EXSA 3MI2A 5F4XA 1Q6OA 3QQ0A 5DXYA 1BWKA 4UTWA 3W7MA 2YX0A 5H2ZA 2Z6IA 5FEWA 4O28A 2CW6A 3EB2A 1TQXA 2X30A 3KRZA 1PCWA 5DCDA 1UUMA 2DZWA 2YYUA 4ICNA 1YLVA 3ATYA 4JYFA 1QDSA 2RFGA 4O15A 1VLWA 2QUTA 3W22A 1DQWA 1W31A 3MYOA 2F7FA 5CPLA 2ZA2A 5DCBA 3W75A 3KXQA 4Z1CA 3EWYA 2DZXA 4LVFA 3RU6A 1VHCA 3NPXA 3QZEA 5DY2A 4O17A 1NAL1 2B7NA 2PC4A 3W2JA 3ABSA 2QJIA 3CQ0A 1OYCA 2WKJA 2A7PA 5D2TA 3VE7A 4UUIA 1QO2A 4UR8A 1Q6QA 2JGYA 3UYCA 2ZZ4A 3W7NA 3ELFA 4RXGA 3PUDA 3QEZA 3CB8A 3FA5A 2NX1A 4AAJA 1JCXA 1NF0A 3IIVA 4LRTA 3QF0A 4N02A 4YCPA 4QNEA 4JICA 1KFKA 5A5WA 4AHPA 1B57A 3BLFA 3V1PA 1R30A 2E5BA 1SW7A 1KM3A 5LGZA 4QISA 4K7YA 4EWND 3GNDA 1Q3NA 5AB3A 3BG5A 1FCUA 2GVGA 4A2RA 3PULA 4HNTA 4DPQA 2R14A 3EWUA 4N6EA 2YYTA 4JN6A 4ONVA 3R89A 4HNUA 4YL2A 2H3DA 4PODA 3CEPA 5D09A 4O10A 1TQJA 1OX5A 4AF0B 3TUUA 3PVFA 1ZJIA 4MY9A 4NX0A 2CWNA 1LLZA 1OJXA 4AVFA 5L6UA 4GWEA 1RQBA 4FXSA 2HSAA 3EX4A 3W7JA 1OFRA 2E09A 5AHIA 3PSVA 5A8GA 4M19A 1LCOA 1SW0A 3W87A 5FF2A 5D37A 3NQ8A 1Z42A 5FF7A 4AH7A 5C54A 4JX6A 1PVNA 4YWIA 4O19A 3EXTA 4WOZA 4GBUA 2B7QA 5CSSA 4TMCA 3DFNA 1KLZA 4K37A 3VE9A 1YXCA 4K8HA 4O52A 5HUPA 2FIQA 1R2TA 1QPQA 3LHZA 1FWSA 1K7EA 3DI0A 3LHVA 4KFNA 2BLEA 2V0TA 1TSIA 4MY8A 2D73A 5K2ZA 3W74A 5TIMA 5CZJA 6ALDA 4TIMA 1H1YA 4QNWA 1DHPA 2GPTA 1LBMA 3LBCA 1PHQA 4I7UA 3RMJA 1VS1A 4ALDA 4LRSA 2C14A 3HQ1A 1H7RA 3W76A 1OF6A 4HPJA 3FJLA 3K30A 3OVRA 3C4UA 1VCGA 3GNNA 1KFCA 2DU2A 2ZRVA 1QNVA 5C5YA 2NLIA 3A5FA 3GLCA 4BFAA 4JGDA 3CEUA 2WSYA 3KVMA 1A5SA 5DXXA 3BO9A 2QJHA 4GJ1A 4ZVJA 4LNYA 1JVNA 1OX4A 1L9WA 1G6CA 5K4ZA 2W6RA 2WQPA 5EYWA 3VCRA 1F5ZA 1SZGA 1GQNA 1F76A 3B8DA 3OA3A 3BLEA 5L9FA 4HPXA 4LW7A 1XUUA 1MSSA 3MP5A 1J4EA 2VEIA 2NUXA 2B0MA 3TQ0A 1Z44A 4E2DA 3HMJG 4LVGA 4QITA 3UY8A 4NNCA 4PL2A 4XKYA 1KM5A 1FWRA 5AYYA 4CCCA 3KOFA 3WJWA 1HFBA 3W1XA 1AL7A 4GNJA 2VEPA 4Y90A 4CQ9A 3N2MA 2W79A 1P5BA 4DEFA 3DH7A 3TMQA 4XQ6A 1XM3A 2YFNA 4H3DA 3W2MA 3P74A 3W7HA 1ZHAA 1WOBA 1TPDA 2GVLA 4A21A 2BXVA 1I8JA 3PBYA 1OVDA 4FIQA 1GJPA 2CLKA 1EIXA 3P62A 3IIXA 2XN0A 4XZ9A 4C1KA 4O57A 4AHOA 2Q8ZA 3DFQA 5LNUA 3S1WA 3N9SA 3MW7A 2ZDRA 1Y0EA 3QC3A 3C2FA 3QH2A 1M5WA 3UPBA 2Q3OA 3LCFA 3BK0A 3W1PA 1SO4A 3GIYA 1RV8A 4BI5A 3N2XA 2B7PA 2WV8A 1XBYA 1WQ5A 2YFOA 1N7KA 1X1ZA 3S0CA 2H6RA 3S1XA 3H54A 4JDBA 5TBOA 3DHFA 5HINA 5F2LA 3I7SA 1FWNA 4S2BA 1BKSA 3IGSA 5E93A 4ADUA 3HGOA 2ISVA 2QCNA 3U6WA 1ZCOA 5LZLA 5AHLA 3H55A 3G1YA 4N9CA 3C8FA 4UTTA 4DBEA 2A85A 4OV9A 4R7JA 4C1LA 1SU5A 3C2RA 4RLIA 2A0NA 3A23A 3HBLA 4X2RA 3B0UX 4W9TA 2EKCA 2WSQA 2NUWA 2Z6JA 3WJZA 3O15A 3M0ZA 3BW4A 4OV4A 3FEMA 1IXPA 3S5ZA 4MFDA 3TJXA 4LVBA 4CNPA 2HS6A 1XI3A 3OEXA 4FHAA 3B0VC 1EWEA 2OT0A 3DKLA 3O6YX 1OYBA 1SW3A 1YADA 2VFFA 2YCEA 2YPIA 3MHGA 3W23A 4Z1BA 1W5NA 4Z08A 3W2KA 4IMFA 1MEHA 3TCEA 1UB3A 3IIZA 3A9IA 1H7PA 4QIUA 4H6KA 5CSRA 4H4IA 1GG1A 3QSTA 2C0AA 3EWXA 2OCZA 3GR7A 2E5CA 4IJBA 3CIWA 5FEXA 2JGQA 5EKYA 4UTTC 5LGXA 4K38A 3L65A 1TB3A 3QW4B 4Q33A 5KMYA 2FLIA 3JRKA 3HIJA 1RR2A 2FPTA 3UWVA 1FXQA 2A6LA 4UNLA 3BVJA 1ZAIA 2R94A 5I3JA 3OHIA 2GQAA 4CCEA 2QUUA 3Q37A 3WK2A 1W1ZA 3TSMA 2HMCA 2B7OA 1LRTA 3L2IA 4AHQA 2A21A 1D3HA 3G8RA 5F4SA 5HWJA 1VYPX 1UBSA 3MYPA 3STFA 1IGSA 3TR2A 2J6XA 3QM3A 4NZFA 1OX6A 4MFEA 3TMLA 4UTMA 3E96A 3MJYA 3U2OA 3EKZA 5FF4A 1I4NA 5FF0A 4NNAA 4NUWA 2V8ZA 1GYNA 4I7VA 4O11A 5CKSA 3UWUA 1TMHA 1IXQA 3DKJA 3IIOA 4Z0SA 3NQ7A 1ZNNA 4RCXA 1MXSA 5F1UA 5MHBA 3LTYA 4Y96A 3DGRA 4XUGA 2DZVA 5AC6A 3PB0A 3UNDA 1VC4A 1JQXA 2JK2A 2GVJA 2FB2A 3NQCA 4UR7A 4DQWA 2QDHA 5D02A 1THFD 2E68A 3B0PA 4S2CA 3G24A 1KTCA 5AHNA 4JTIA 2CFFA 2BX7A 5FI8A 3NQEA 4E2BA 5KINA 3S1VA 3AO0A 1FCQA 3M44A 1YTDA 1H7WA 4LU0A 1OFEA 5AC8A 4Y8FA 4MZYA 1G4SA 1OHLA 2ZRUA 1PHWA 1UUOA 1H5YA 2NV2A 1ICPA 3M5VA 2ZZ5A 1H50A 4WQ6A 2QAFA 1EWDA 1BTMA 4JR5A 2BTMA 4JTHA 4U4MA 5AC7A 1KBIA 3KHJA 3P5YA 1TRDA 4LVDA 5G2HA 3UWYA 1L6SA 4UTKA 3LGEA 5SWUA 2KZHA 5I3FA 3BARA 4IMCA 4JX5A 1TPC1 4RV8A 3UXAA 2ZBTA 1EP3A 3O06A 4ZMGA 3PBVA 4LV9A 2VENA 5DY3A 4E0CA 1XKYA 4UTLA 3QJAA 1V7YA 1WDWA 3SIZA 4MUZA 4NJJA 1IXOA 3W1QA 1GZGA 1DORA 4EF9A 1F7BA 4JTUA 1XFBA 4GC4A 5BMWA 1QR7A 1X1OA 1YDNA 3GZ3A 3LCLA 1KTBA 2GQ9A 3O6CA 3O8AA 3W7QA 5LNSA 4MLRA 3FFSA 3W1TA 3WK1A 1N55A 1JR1A 4EIVA 3BGGA 1O95A 5KZEA 3KVKA 1NEYA 2I9EA 3MWAA 2X1TA 4GUIA 1KTNA 2EPHA 1AW5A 3W88A 3UWWA 3UY7A 3CPRA 4O54A 2Y85A 1W3TA 2ZTJA 1EP1A 4Q4KA 1RQEA 1C29A 3SW6A 3ATZA 3Q58A 2FTPA 4POCA 1DBTA 4EF8A 1QPNA 4WX2A 2ZRYA 1EUAA 3NDOA 3ABQA 3LCWA 4ZZ9A 3BLIA 5D2XA 3PG9A 4ZQRA 1EX5A 3SJ3A 1T0OA 3HF3A 3HG5A 2CLLA 3NQ6A 2A6NA 2V2CA 1QFEA 4OE7A 5IM51 3W86A 3SI9A 1DOSA 3USBA 3GDKA 4UMCA 1W37A 1Q45A 1A5AA 3GR8A 2DORA 4N4PA 2ATSA 2GQ8A 3P82A 2QCLA 5IBXC 2YGYA 1W5QA 3W7OA 1C9DA 4CCDA 5DBUA 4Y6GA 5KZMA 3IRDA 4LC6A 1R2RA 1WBHA 3CLMA 2FPYA 1GVSA 3A21A 5G4WA 1FDYA 5D2YA 4B5NA 3N19B 2VEMA 5CPMA 4RX0A 4UFKA 1QWGA 4CNNA 1K7FA 1FX6A 1KFEA 3DZ1A 4WY0A 5G4EA 3TXVA 2QEZA 5DLCA 4IMEA 2I14A 2J24A 4P61A 3LXCA 1TTJA 4ADTA 3SGZA 1HUVA 3NQVA 5E0KA 3W83A 4M6PA 4FNQA 4WOQA 1TTPA 2BZNA 4LC8A 4M6VA 1FBAA 3LLDA 1G69A 4FEZA 4ZQPA 2LLEA 4LV4A 3CWOX 3HO8A 5CZTA 3OVPA 1LROA 4UTWC 1R2SA 4IPJA 3DBPA 3GB6A 1PL9A 4FNTA 3NPUA 1KW1A 3HGRA 4FNSA 4FNPA 1O4UA 1M6JA 5LKYA 1OG0A 1YYAA 3UWQA 3QSRA 1K02A 3TC7A 3GK0A 8TIMA 3BGJA 4BI7A 2Y89A 4HKPA 1OYAA 4RZ5A 2A4AA 3W1NA 1W54A 5K3VA 4XBKA 3G1VA 5HMSA 1QMLA 4IQLA 4HN4A 1ME9A 1O60A 1O94A 4QSHA 4LWWA 2XFWA 3TV8A 3BV4A 5J5DA 2VXNA 4UCGA 3N34A 3NM1A 1AMKA 3HPSA 4GUHA 2TPSA 1JCMP 2ABAA 1JCNA 3INPA 3BW3A 1D3GA 3MBDA 3M9YA 1BEUA 5HWNA 4N9BA 3RLUA 2RH9A 2JKPA 3B04A 4JTEA 1YDVA 3CU2A 3JS3A 4HIBA 3W84A 4A22A 5GVJA 4UFHA 1KV5A 1GVFA 1Q6LA 4DO6A 1I2QA 1LYXA 1G4TA 4ORMA 1JULA 2ZTKA 5I3IA 2YW3A 3CWNA 2RDUA 4PEKA 4JY9A 3TAOA 1QCWA 1LP6A 3P81A 1GVOA 3NNTA 2CZFA 1W8SA 4WXZA 4UFIA 2NWRA 2QJGA 2FJKA 3U8GA 3IVUA 3OBKA 1F05A 2VFIA 5KZDA 4O8RA 1SSGA 3N9RA 1NFBA 1E51A 2VFGA 3UXDA 3W7GA 3P84A 3B06A 4X3ZA 3TE9A 1XC4A 1V5XA 1QPRA 2OJPA 4O4VA 1F2JA 2QCFA 3O63A 4K39A 4JX4A 3EWBX 1LBLA 3S8HA 1WOAA 2TRSA 4ZQMA 2QCEA 1TRIA 1TV8A 1VR6A 5EY5A 1PS9A 3G1HA 3C56A 4U28A 3UZJA 1WX0A 4FXRA 1HTIA 3T7VA 4KKXA 4NZJA 3DFTA 1D9EA 5DCEA 3DXIA 5EMUA 4FX8A 1I2RA 2J27A 4NXSA 3WJSA 4M5PA 2GOUA 2P10A 3PR2A 1KFJA 2NUYA 3W2NA 4IMDA 4AEOA 4O0ZA 4JXCA 1OF8A 3LOTA 1VCFA 3RK8A 3LLFA 4WJEA 3P60A 1VJIA 3LRKA 2H90A 3QW3A 2V2DA 3W85A 5FF3A 4MYXA 4UMBA 4YCOA 4ZL1A 4WZHA 3VFLA 4IPIA 1OFDA 2E6AA 1XXXA 3TNOA 1DJNA 2EHHA 3G18A 4UIOA 3MHFA 3S6DA 3BG9A 2QAPA 2Z0IA 3ZFHA 3W1AA 3TSDA 4N6FA 3OVQA 3OIXA 2ZA1A 1X7FA 5FEZA 3AJXA 1LOSA 2ALDA 3W7IA 3KAOA 1N8FA 3FLUA 1LOLA 3SR7A 1ICSA 5CG7A 2QCCA 5D38A 3FS2A 3MP4A 3WK0A 4IMGA 3NO5A 3A5VA 4ADSA 2C13A 4IUOA 3G0UA 2NV1A 3MBFA 4RXFA 4DPPA 3FJ6A 1SO3A 2ATMA 4UTIA 5CZSA 5HNRA 3NXFA 4M7SA 2AAMA 1FQ0A 1K8XA 2BSLA 3I7RA 1TPB1 5T26A 1NSJA 2Y88A 1EPXA 3ANYA 1F6PA 3BW2A 4PC8A 4TX9A 1OABA 2DZTA 4M7TA 2RKXA 3UZ5A 1XBVA 4P2VA 3SGUA 3NL2A 2OX1A 4QM1A 1SQ7A 3LB0A 5D32A 5G2IA 1SUXA 1QOPA 3VI2A 3RFAA 5FESA 5KITA 1P1XA 3HB9A 1JRCA 3O6DA 2OT1A 2DJXA 3NR0A 5AYXA 1W5PA 3TFCA 1VYSX 3C52A 3O05A 1SZFA 1UASA 3M47A 4X9SA 4AWSA 1OK4A 2CZEA 1B9BA 4R33A 1TJRA 3PSWA 1C8VA 1IF2A 3NG3A 4Y9AA 4QJ1A 4DBDA 2VKZG 1K7XA 2QDGA 3TQKA 4JTJA 3NQGA 1OFAA 5EL1A 1LLWA 1ZALA 3DAQA 5KTLA 3PUOA 2YDAA 5ABTA 1AW1A 5D05A 2FB3A 4GRSA 2A1YA 3UQNA 1XBZA 1ALDA 3G1FA 1ZENA 2GUUA 1W3IA 4FX7A 1EEPA 1J5TA 1CX9A 3NPWA 2O7QA 3DENA 4MJMA 3ZS4A 3TQVA 3STCA 2V9DA 4UTJA 1DKWA 2DZSA 3R8RA 1T8XA 3EX3A 1LRNA 3HG4A 1B4EA 1UJPA 4BF9A 1LM1A 2YZRA 5AFDA 4JTSA 3CIXA 2YXGA 2J88A 3UPWA 5K7JA 2QCDB 3PF3A 1OFQA 1SZEA 4YMZA 1P0NA 2Q3RA 5CPNA 1JQVA 1JJKA 4LT9A 4JD4A 4ZQCA 3M5XA 2AQWA 4FB7A 4RZ6A 3PC0A 2BWGA 3C3NA 5EBUA 3VKJA 3LCIA 2X1RA 3HJZA 2H8ZA 4K36A 2C3ZA 3GDTA 2UV8G 3NQFA 4N2YA 2W0UA 3FOKA 3NQMA 3LXAA 1H7OA 4IWWA 4GUFA 3CM4A 3V75A 1DV7A 4MPQA 1H61A 3LHWA 4A3UA 1FDJA 1W5OA 3VNDA 3NOEA 3IIPA 3TJLA 1W5MA 4N9DA 3TAKA 1TCDA 3TSBA 3UD6A 2TSYA 3LX9A 4UXDA 4MOZA 3TW7A 2CU0A 2YR1A 1A53A 5EA9A 3NGJA 5D2WA 1G67A 3NQAA 1MEWA 3LV6A 4UFJA 3QPZA 1VCVA 4NVTA 3W1UA 4PH6A 3CHVA 1GWJA 2E6FA 2C19A 2CZ5A 2CLIA 1FXPA 4IX0A 4XTIA 3PUEA 4OBTA 2C1HA 1BWLA 1FCBA 1K8YA 3HPXA 3SY5A 1EA0A 4WY0B 5LNRA 1CW2A 3N3MA 4GUGA 3F4WA 1WV2A 2RHGA 1KM1A 2Y7FA 3RLVA 3E9AA 4A29A 3IGUA 2J9XA 2DZPA 3F1QA 3FKKA 4I7WA 1OFBA 1YTEA 3LI1A 3GAKA 2JBMA 3HG3A 2Y7GA 1HG3A 3MUXA 2IQTA 3W73A 3DFSA 2ZRWA 1SFJA 3FKRA 1S5WA 1VLIA 1ME7A 4PA8A 1RVGA 1JUEA 3YPIA 1SSDA 1WXJA 2A5HA 3W7KA 2ZA3A 3G1XA 2C15A 5D30A 3T44A 4NU7A 3PB2A 3ZWSA 2H8XA 3SSJA 4NJKA 5AHMA 1W56A 3DHDA 2RDTA 3Q94A 1VPXA 4HSOA 3S5YA 2G97A 4NJHA 1FWWA 1TV5A 2DP3A 3C6CA 2WSRA 5AYZA 2Y61A 2ZYFA 3O07A 3N14A 4UFMA 1TREA 2CLFA 1L6YA 1TTQA 4R34A 3PM6A 3W70A 2Y6ZA 2YW4A 4RZ4A 1YPIA 1GPWA 2ZQ0A 1VGAA 2NXIA 2NWSA 1ZAJA 4ORIA 1FCVA 1YTKA 4WD0A 1GEQA 3L66A 3QPYA 4RJEA 3W7RA 2Z2UA 2VC6A 1PCKA 3LRLA 3S1UA 1EB3A 1TV7A 2XN2A 3QFEA 3G3DA 3TH6A 4IXHA 1WA3A 5F2MA 1MO0A 3NPVA 5D33A 4NX5A 4L4LA 2CLEA 1NF7A 1GTEA 3P67A 5I3GA 2FFCA 2FDSA 1T99A 3HPZA 3D0CA 2VOMA 3WJXA 4JS3A 1RD5A 3NZ1A 1WBJA 4LUIA 4FF7A 2O7SA 4CQAA 4DO5A 1VYRA 3W6YA 3HG2A 1HO1A 1IXNA 2ZRXA 3NVTA 1XL9A 4J9JA 3TXZA 3QMSA 3FIGA 5HQEA 1OX4B 1LDCA 5CZ0A 1CI1A 1TTIA 1JCLA 4NXKA 2ISWA 1S3HA 1A50A 5D2VA 3SECA 5F2IA 2GJNA 1EUNA 4DELA 4BWLA 3GYEA 1LRQA 1ICQA 3B05A 3QQ1A 2B4GA 4O1CA 3WJYA 4TU1A 1VRDA 3ABOA 3DFPA 3G8EA 4XKYB 2E6YA 2WNNA 4D2JA 3DI1A 3NQDA 4DF2A 1OFOA 1B4KA 3E02A 4JYEA 1MZHA 1MEIA 1KM0A 4Z1AA 1XDLA 4MY1A 4Q32A 2P0OA 3TW6A 5C55A 3BPWA 5FEPA 3LHUA 3TC6A 1J2WA 3I6RA 3JR2A 1GG0A 3C2VA 1I2OA 1HL2A 1VH7A 1W0MA 2ZFAA 1OFPA 1QPOA 3EX2A 1SFLA 5K9DA 2ISSA 4I9AA 4HSNA 4L4MA 1LTDA 1XUZA 4MIMA 3F03K 1SZNA 4PTNA 3M43A 2FQIA 2V5LA 4DF0A 3PAJA 4LOCA 1AL8A 1SO6A 2VFHA 2V5BA 3GXPA 4A2SA 2QCHA 1A5BA 2ZZ6A 1XBXA 4NNBA 2G5WA 3P80A 1G4PA 2NXGA 1KBJA 1JCJA 3NL6A 5AHEA 4JDYA 4AB4A 3LRMA 4YXGA 4BWLC 4EVZA 3TDFA 5HULA 1KM4A 1M7PA 2JKAA 1FY6A 3G0SA 4K6AA 4DO4A 1UCWA 4GUJA 4UNKA 1K03A 5EPDA 3MMTA 2C18A 1ME8A 4GFSA 3KRUA 3IEBA 3E0IA 4MZ1A 3S5NA 4UC5A 4CLMA 2I1OA 3MI6A 1TYGA 3N73A 3P8IA 4UTUA 4O18A 3R5EA 4FO4A 5LNWA 1YPFA 4Z0JA 3L0GA 3LV5A 1GVRA 4CNOA 3LTSA 3GKFA 2QF7A 2A7NA 3HGJA 3L67A 2XN1A 3LHYA 4WXYA 4RK8A 4K7VA 1O5KA 3QMRA 4OGZA 1G7UA 1S5VA 4OHQA 1O5XA 3G0XA 2YSWA 3GDRA 2J9YA 1PIIA 1WAUA 1GOXA 4O1AA 3EKLA 3L9CA 2RDWA 4PFMA 3L5AA 4LY8A 3LI0A 4N9EA 4O14A 3L5LA 2OMAA 3FYPA 1TO3A 3W7EA 5CGQA 3NM3A 1F6KA 4RKAA 1TJPA 3TFXA 5HR7A 3E12A 3HOJA 3IGXA 2V82A 3I65A 4ML9A 3M7WA 2Y62A 4LS1A 4KWVA 2C16A 5J5RA 3NQ2A 1I45A 1H7NA 4M6QA 4O1BA 3QRHA 5HR6A 1P4CA 2CLMA 2VEKA 2Z1BA 3L68A 3R13A 1QO5A 4O12A 1R46A 1AW2A 3B03A 4O16A 3LDVA 3KX6A 2QCMA 1XDMA 2OZ0A 3KVLA 3EWZA 3THAA 3E49A 3IV3A 4AF0A 1X6UA 4O4WA 3W07A 3BG3A 2PRHA 3C2EA 1JCYA 1KFLA 1G4EA 3TKFA 1K8ZA 2DZUA 1VZWA 3LBMA 5HWMA 1H7XA 3H53A 2E77A 3STGA 4LVAA 2Q8LA 5HJLA 4JTLA 1Z48A 3PBWA 2EGZA 3NA8A 4MVAA 1AK5A 2PURA 3EX1A 4UMAA 2WNQA 2NX9A 1HO4A 3TU9A 5F1VA 3LM7A 4RR4A 3MO7A 2NZLA 1DVJA 1JUKA 3M6YA 5K4XA 3KVJA 5BRBA 3B4UA 3GVGA 3QYQA 1SO5A 3P61A 3OG3A 5C2XA 4G1KA 3QMTA 3W72A 1TPVA 2V30A 4ZQOA 3W9ZA 1Z41A 5K9XA 3W7LA 3L0KA 1Q6RA 2TMDA 5LSMA 4LUJA 1H60A 2VFEA 4HNNA 1B3OA 3LTPA 1ZY9A 4Z1DA 2E6DA 1QAPA 1L6WA 2F84A 4NT0A 3EXRA 4E38A 3KFTA 2HTMA 4MYAA 3T4CA 3ABRA 1H1ZA 3Q2DA 2X16A 3P7YA 2R91A 2DJLA 4UFLA 4QAIA 3IVTA 1KM6A 2WO5A 3L0NA 1U5JA 1VQTA 4KWWA 4OU1A 5LNVA 3P5ZA 4JTGA 1FWTA 3NL5A 1S5TA 2VELA 3TX9A 1XCFA 5G1TA 5AN7A 4AXKA 4EOUA 3A24A 3MP3A 2CZDA 3S5OA 4LTSA 3NEVA 4DXVA 1QOQA 3T40A 1YDOA 5U7SA 1ZFJA 4OWGA 5DELA 2HS8A 2ZZ7A 4O50A 3L5MA 3G22A 3SFKA 3W1MA 1KA9F 5H91A 3GKAA 3LCHA 2ZZ2A 1PV8A 4O1DA 3STEA 1KFBA 1LOQA 2ZZ1A 3TROA 4FNUA 4KFPA 1F73A 1H51A 3W3OA 3RNDA 1ADOA 2V2HA 1WYIA 3W7DA 1ONRA 1TPFA 2E5DA 3KRSA 2ABBA 1R47A 2WOQA 4MKNA 5AHFA 1F74A 1TPH1 3PS7A 4XBSA 3I68A 1I2PA 4XWUA 4PCFA 5G1YA 1VHNA 4NQ1A 4TR9A 5I3HA 4JTTA 3MHUA 1AG1O 1U83A 3PY2A 4JTFA 2Y63A 3GDLA 4BI6A 2Y7EA 6TIMA 2H3BA 4GE8A 3LXBA 2CLHA 5KSWA 1SPQA 2A7RA 4JNMA 4O53A 2X2GA 1G7VA 2Y70A 3S42A 3M41A 4WUIA 4HT3A 2PRMA 1JRBA 4JIQA 4UTHA 2WPBA 2PCQA 4JIPA 1YXDA 5LHFA 3GX9A 5AOUA 1GT8A 4IOTA 2NXHA 3M5YA 3PBUA 3NZRA 3PWAA 4AWUA 2AGKA 1L2UA 4HNVA 3W7CA 1KLYA 4YLWA 3W2LA 4AMAA 1DJQA 1OK6A 3TK7A 2Y7DA 2E1DA 3TA6A 4PL1A 2JKEA 5CPOA 4XTDA 4IGHA 4BK9A 1TPWA 5C6MA 5BW6A 4OT7A 4CQ8A 1PE1A 3M16A 4JEQA 3T55A 3W1RA 3L21A 4X22A 5G2WA 2PRLA 3RF9A 3R2GA 5DN1A 3FYOA 4NJGA 3G1AA 1I2NA 1H63A 5DBTA 3GXTA 3WFAA 4MJZA 4JY8A 3SZ8A 3C61A 3LCXA 3M5ZA 3EX6A 3M1ZA 4TMBA 1IIHA 2NX3A 2VFDA 3F4NA 3LERA 2C6QA 3GAYA 3NYZA 1IIGA 1FDZA 1TPUA 3W71A 5HUOA 1W3NA 5U4NA 5D03A 4S1FA 5BOOA 4JYDA 4NJIA 2QUVA 3UWZA 3CC1A 3GXNA 3NL3A 1LBFA 3TIMA 1ML1A 1K3UA 4N4QA 3S9YA 2EF9A 2X1SA 3G1SA 3MI3A 4BR1A 1DL3A 1GTHA 1P0KA 1KM2A 3G3MA 2CLOA 3LCGA 4QQ3A 1KV8A 3W1LA 1LORA 5LHEA 4R53A 4AWTA 2QKFA 4LS2A 4LS0A 3IVSA 2WNZA 3NAVA 2V81A 2QR6A 4HHPA 5BMXA 4O0KA 3PG8A 5E1QA 4ZQNA 3THQA 1T96A 4IX2A 4OQVA 2ZRZA 2WJZA 3I7QA 2EAWA 1NVMA 5IBXA 2TYSA 4TO8A 4K8EA 5K9CA 5BNKA 2FPVA 1GVQA 2ZCGA 1TPEA 1LZOA 4KFOA 1YXYA 3P8JA 5D04C 1RQHA 3G1DA 1JUBA 2R8WA 2QCGA 1A5CA 3EEGA 4O13A 1FUYA 2GJLA 2ZZ3A 4FX6M 4JTKA 1M7OA 3LHTA 3EWWA 2PE4A 3C2OA 2QCDA 2J9ZA 1RPXA 3C0JA 3O16A 3HGSA 4WY0F 5F2GA 1GYLA 3W7PA 5TQLA 3A22A 3WK3A 4FIRA 1ZAHA 2A2IA 4FNRA 4MZ8A 3GDMA 4IXXA 3CTLA 5G5IA 4MLJA 3CT7A 4GXMA 3T78A 2P1FA 1H62A 1X8FA
chains in the Genus database with same CATH superfamily
3PZTA 2DVXA 3CUIA 2G96A 3FJNA 3LS9A 3DFOA 4V33A 3W2UA 1IZJA 3MMDA 5DXYA 3A3XA 3VD9A 1RCQA 1RAKA 4UTWA 4RDYA 3W7MA 5H2ZA 4QEHA 2PGWA 2X30A 4LXFA 3BJFA 4D6FA 3ID7A 5DCDA 1YLVA 4WGHA 2RFGA 3H2AA 1UWQA 3TYUA 2ZA2A 2YA1A 3W75A 4B4HA 1BSLA 3EWYA 3GNPA 4DWSB 1UKTA 4DZIA 3NPXA 2QJNA 3EMZA 3V0UA 4GIRA 2WHMA 4FLSA 4O17A 1TG7A 3B0YA 3CQ0A 2WKJA 4JTRA 5BXTA 1EJXC 2ZZ4A 5CAHA 4U10A 1JNDA 4RXGA 4DUOA 1MW2A 3QEZA 3CB8A 4GACA 4YVVA 3WFLA 1UQZA 4Q8PA 1E70M 3AHZA 3HTWA 3IIVA 1B90A 1B31A 1CGYA 5JMUA 4QNEA 1KFKA 2C91A 4IPNB 5A2BA 4HA4A 3UVIA 3GYCA 1R5YA 3WF4A 1EH9A 2WVTA 1O1ZA 3BG5A 3SUUA 1FCUA 3VIMA 2GVGA 3PULA 1NIUA 4HNTA 2D1ZA 3W27A 4DPQA 1RVKA 4N6EA 2IMRA 3GQYA 3AWOA 2OFJA 3R89A 1CGTA 3UJFA 4YL2A 3O2LA 4JKLA 1X38A 4A4AA 4H6EA 4AF0B 3PVFA 4UZSA 1NQ6A 2R1PA 1DJHA 4AVFA 4GWEA 4FXSA 2PODA 4URIA 1A0CA 3V16A 3PSVA 3E6EA 2WCGA 2AQVA 2YCIX 1UR0A 2QDDA 3ME3A 4H8VA 5C54A 2UBPC 3B8TA 3KRBA 2OKTA 1KNWA 1SJAA 3ITGA 1AMYA 1C9WA 2B7QA 3DFNA 1E4LA 1RLDA 4MWAB 3VE9A 4AX6A 1QBBA 4WDWA 2VTFA 4L7ZA 4NI3A 4O52A 1QPQA 2QMKA 3DI0A 1QW9A 1TSIA 4MY8A 5K2ZA 5TIMA 1H1YA 4QNWA 3H23A 4J3SA 5HATA 1G9HA 3RMJA 1VS1A 3WNMA 6XIAA 3HQ1A 4TVDA 1HJQA 2FVKA 4EWJA 3K30A 1VCGA 1WZAA 3VGGA 1VBGA 1XGEA 3GNNA 1VFSA 3F7JA 5C5YA 2NLIA 3GLCA 1FWFC 3N17A 1QASA 3LGDA 2X7WA 3KVMA 4WDXA 1FWBC 3GVVA 4PTWA 4LNYA 4CD6A 1GGOA 1UQYA 1JVNA 3WKZA 1L9WA 2E1WA 2W6RA 5A6SA 1GQNA 1ESWA 3B8DA 3ZT5A 3OA3A 3VOGA 1E0VA 1XH0A 4HPXA 3USZA 4B9ZA 1XUUA 5DANA 3MP5A 3N15A 3TA9A 5JUVA 1QATA 4RUBA 4A3YA 5HJXA 3HFYA 4XVDA 1Z44A 3UG5A 3HMJG 3WQWA 4DHGA 5AYYA 4LQ1A 2BASA 3WF3A 2VHLA 3W1XA 3WMBA 4EPKA 4F8XA 2CCRA 1AL7A 4Y90A 4CQ9A 3SCSA 1P5BA 2WC3A 2PWHA 4I5XA 3TMQA 3W2MA 1WB0A 2PCEA 1ZHAA 3VIIA 1DWIM 3CL6A 1V6VA 4HOWA 2BXVA 4ZA0A 1I8JA 1X6LA 4CU7A 1GJPA 3SRFA 3RMEA 3IIXA 2WZHA 5FJIA 4C1KA 3CPUA 3DFQA 5LNUA 1VJZA 2JQXA 3N9SA 3MW7A 3W38A 2E9LA 2ZDRA 3GD6A 3MCNA 3W37A 3K1GA 3W1PA 3SUVA 3T09A 1BYCA 4PRWA 4BI5A 2WV8A 1XBYA 1WQ5A 2YFOA 3H4XA 4JDBA 5LIXX 1NWTA 2DVTA 3N1AA 3NOYA 4S2BA 4ZB2A 3IGSA 5E93A 4GOAA 3HGOA 2ISVA 3M0VA 2QCNA 1UJQA 5A6KA 1ZCOA 4A3QA 4MTVA 1YE4A 3G1YA 2ISFA 3TC3A 2XIOA 2PF0A 3A23A 4CU8A 2WSQA 1XIGA 1Q85A 1MW3A 2VL4A 3K4WA 3UR5A 3BQ5A 3FEMA 1A5UA 1ZQ5A 1XRFA 3HV9A 1NDWA 4CNPA 3D3FA 3VDCA 1U1UA 1XI3A 1LQ2A 2ZUUA 4DJDC 1UPMB 2A3HA 2YCEA 3MHGA 5FSEC 4OUEA 2ONEA 1PDZA 4M1RA 4Z08A 1UB3A 3RM9A 4MDOA 3GHRA 1EX1A 1MW1A 2E3ZA 1UD2A 2Y8VA 3A12A 1ZUAX 5LXXA 4H6RA 4UTTC 2DEPA 3UXIA 3QW4B 3P0WA 2FLIA 3HIJA 4C6QA 3I6TA 1FXQA 4MB3A 3BANA 1ZAIA 2GQAA 4FALA 1KGUA 4CCEA 1LF1A 3Q37A 4LBRA 3WK2A 1W1ZA 1E15A 2HMCA 2B7OA 1LRTA 1D3HA 3CZLA 5HWJA 4A8NA 1GZJA 1VYPX 1UBSA 4E3VA 4KGLA 1JZ8A 2PP0A 4E8DA 1EPVA 1OX6A 4YTUA 3M0LA 4D8LA 2Z1SA 1W3LA 4UTMA 1QK2A 3E0WA 3VABA 2Y5SA 3EKZA 5FF4A 4I7VA 1ELSA 2CNCA 5JIPA 5JXQA 3C8NA 3FGCA 3IIOA 4Z0SA 4ATDA 3PZNA 1TA3B 2BHZA 3RN6A 2E28A 1V6YA 2JK2A 2E9MA 3UNDA 2GVJA 1F3EA 4PMVA 3VPLA 3U3HA 3BSHA 1THFD 2E68A 3QLDA 1IWAA 4GI9A 3G24A 1KTCA 5AHNA 4G56A 4DI9A 2J7FA 4S3BA 1SYTA 2BX7A 1T41A 1M3UA 1ZSXA 3WQFA 3S1VA 3WQPA 1ITQA 2XIMA 4GH3A 1LWJA 4EANA 3EOSA 4MZYA 3OODA 4EXBA 4GMEA 3A4XA 2ZRUA 2X8RA 1HP4A 3T2OA 1DWJM 1SJBA 4FLRA 2ZZ5A 3M5VA 4FMVA 1IEQA 4WQ6A 3LY0A 1DIKA 4GY0A 1XV8A 2GJRA 3W81A 2PC8A 4MPKA 2EPLX 1NOUA 1JGMA 3T07A 3E2SA 1OCQA 3CNYA 3VDGA 3UWYA 1L6SA 2VX7A 3BARA 4IMCA 4JX5A 4AXNA 1PKYA 4RV8A 2ZBTA 2FHCA 4H19A 1S1PA 1HKWA 3VOIA 3PBVA 2VENA 3VIFA 4U2YA 1H3GA 3IJLA 2PWGA 4NJJA 1IXOA 1XIHA 4LF2A 1XISA 4GC4A 1JYNA 1X1OA 2GQ9A 3O8AA 2G3MA 2UY4A 4MLRA 4CNUA 3BDKA 1P0BA 1N55A 2WM1A 1JR1A 1JXKA 1TX0A 3NSMA 5KZEA 3P2VA 3SBFA 3MWAA 1R7OA 4HK7A 3SUSA 4GQQA 2EPHA 4DXXA 3DUGA 3QKZA 4TV5A 3WDJA 5B7ZA 1CPUA 1QW7A 3LPGA 3EDDA 2J47A 4GFIA 1DBTA 4J7RA 3VDHA 3TNBA 4EF8A 4GKTA 4WX2A 2ZRYA 1BRLB 1E6RA 3NDOA 4TTGA 3IRSA 3BLIA 4ZQRA 1NWSA 2POZA 2HBXA 1NP0A 3HG5A 3T9PA 3KZSA 2QIIA 2DUXA 1F3TA 2V2CA 1QFEA 4GQGA 3V0TA 3W86A 2BB0A 1TV2A 3UESA 3GDKA 3HV8A 2P3ZA 4PUUA 3THDA 2XFFA 4Y6GA 2OO6A 4JCMA 2VUYA 3TW9A 4IQEA 4AZCA 1KFWA 1R2RA 4GKLA 2XH4A 1L8NA 1JFHA 1E9YB 1GVSA 4WLCA 1JDCA 2E40A 4B5NA 1U30A 3VOHA 5EFFA 4P7NA 4CN6A 3E2VA 5ABFA 4LF1A 1VEOA 1V0LA 1H49A 2DUZA 4WKFA 4JIEA 3VIJA 2J24A 1H2JA 4ADTA 1ISZA 1TUFA 2D24A 4DJEC 4Z2GA 3R58A 3W83A 4G8TA 4A3RA 1WZLA 4R9XA 4PTDA 4NRSA 3MVIA 3UBPC 3LZ5A 2D23A 1XF0A 2J62A 3KDNA 1Z8AA 5FD0A 3M0JA 3FA3A 8XIMA 3HO8A 3GTIA 3PZUA 3OVPA 4Z2IA 1XLDA 4CEXC 3WLOA 3B8UA 4AG0A 3GB6A 3UR8A 1PL9A 4YNGA 4F0LA 4B3ZA 1O4UA 3OOQA 1NTHA 2VZUA 4QCFA 4MNKA 3QSRA 2ZUNA 4C1NA 4CCZA 4HKPA 1OYAA 2PDCA 2A4AA 3W1NA 1W54A 1C91A 3KWSA 4WDUA 3UPMA 4Q8QA 5EFDA 3WBXA 1NWUA 4DVOA 3FV9A 4JBRA 1O60A 4D6EA 4QSHA 1W9DM 4LWWA 2XFWA 3TV8A 2VXNA 1XKJA 1KCLA 4AWEA 3XISA 4GYFA 2TPSA 3BW3A 2IKHA 3MBDA 5A2CA 1UD3A 3M9YA 5HXMA 3WZ0E 1KRCC 4PMXA 3VAVA 2D69A 2Y4SA 5GVJA 4UFHA 1GVFA 3UETA 1XYLA 4IL2A 1I2QA 1LYXA 4LYRA 3TYBA 3ZLHA 1K9TA 1XGDA 1IWBA 5I3IA 3AMCA 4KS0A 1FWIC 2RDUA 1KD0A 2VCBA 3CHCA 4M51A 5I77A 2WMGA 1BVZA 3N2CA 3P81A 1GYMA 2XJ7A 2BOGX 1CLKA 1HJUA 4ACZA 3GTNA 5MKGA 1OT2A 3O0KA 4NASA 5KZDA 3V3WA 1SSGA 1NFBA 2WVVB 2J25A 4Q4RA 2VFGA 2DT2A 2Z2BA 3P84A 3W7GA 1H0GA 1VFFA 4F0RA 4X3ZA 4Q4PA 4F48A 1V51A 2QCFA 3O63A 4K39A 3EWBX 1LBLA 2YL9A 3S8HA 3SN1A 1WOAA 1D3CA 1ZU8A 1VR6A 1ISYA 1OT1A 3G1HA 4RPQA 1HTIA 2WMIA 3UG4A 4KKXA 4NZJA 4FX8A 1SMAA 3WLSA 2OX4A 1E1CB 5LIKX 1EZ2A 3CO4A 2CZVA 5I06A 4IMDA 2DIEA 3UCCA 2A3BA 4IQDA 3LLFA 3P60A 2YJQA 3LRKA 4AX7A 3TP4A 3AUJA 2H90A 3QW3A 4PUWA 3W85A 2RAGA 2V69A 4Q22A 1N8IA 3VFLA 1OFDA 2DT1A 2VX6A 3TNOA 8A3HA 3KL0A 1UKSA 3CL7A 3UJRA 3TSDA 3W1AA 4DO7A 3OVQA 2UY3A 3IJ6A 4JQAA 3AJXA 1CCWB 1XLGA 5C9XA 5G4HC 5D38A 3K1DA 4TTUA 3A5VA 4IUOA 3G0UA 4D9PA 1MRQA 3MCOA 2OEJA 2Q6ZA 3QZAA 3WNKA 1EIBA 2PLJA 1TPB1 2DV0A 1NJJA 4GCXA 1SGJA 3BW2A 5XINA 1OABA 2DZTA 1UWAA 5XIMA 4KWSA 2RKXA 1TWWA 3PNZA 3ZR6A 1SQ7A 3E0VA 1QOPA 4W88A 2OWCA 1MYRA 4QS6A 3TLQA 3NR0A 3CQIA 3TFCA 2W62A 1VYSX 3FX4A 4KT2A 1SZFA 1UASA 3M0MA 1NM9A 4HZ6A 1B9BA 3T0BA 2GGGA 2I5GA 3BAJA 2HCVA 4Y9AA 2ZVRA 1JDEA 1E6SM 2VKZG 2QDGA 3NQGA 1OFAA 4IIHA 1ZALA 1HGWA 2VNCA 1O6IA 3DX5A 2ZXAA 2YDAA 3PUOA 3NIYA 2VDHA 2YCLA 4NSBA 3PFRA 3CHDA 2FB3A 4KRTA 1XBZA 1ALDA 3G1FA 4NAFA 2D2OA 3T08A 1IEIA 3HQNA 2DSKA 4ZB5A 4KH2A 1JPKA 3N29A 2O7QA 3DENA 4MJMA 4GNKB 3MUZ1 1LRNA 4FF5A 1UUQA 1Q66A 1HJXA 7ODCA 1J93A 4JTSA 2DUAA 3UPWA 3NCOA 5K7JA 2ZIDA 1OFQA 4B5XA 1SZEA 2ZC1A 4Z17A 4ZXLA 4FB7A 4RZ6A 1EA9C 3PC0A 3C3NA 3RUBL 1IV8A 4X63A 3LCIA 1XH1A 2X1RA 3KL5A 3LMZA 3WDPP 1RP9A 1FWGC 4ZEPA 2IKJA 2WYSA 3GDTA 5GJPA 3VMPA 4S3GA 2X0HA 3WNOA 3UGVA 1UIOA 1H7OA 3WH7A 3CM4A 3REQB 1DV7A 4C6KA 2IQDA 3QKEA 4MPQA 2G37A 2QV4A 3ANVA 1H61A 1WUEA 3UT0A 1DJYA 2PWVA 1W5MA 4PB4A 3SURA 3TAKA 5EB8A 4PCTA 2UZ9A 3WX7A 3UD6A 1BQCA 2WZEA 2REQA 4H9YA 3S83A 4NRRA 3TW7A 3CJPA 3GTXA 1WKFA 3UZWA 4ZCWA 1G67A 3CH0A 4ZOCA 3DDMA 5T91A 4PH6A 3BSGA 2AL2A 3H2MA 4AD2A 3OYZA 1RJPA 4WY0B 5LNRA 4AY1A 3TVAA 1WV2A 2R6OA 3MKVA 2HEJA 2RHGA 1KM1A 3VNIA 2R82A 3AU2A 2Y7FA 3E9AA 4A29A 2J9XA 2DZPA 2ZKMX 3FKKA 3WNNA 3LI1A 2Y7GA 4XZNX 1SFJA 6TAAA 1S5WA 4PA8A 1WDQA 1PDYA 3EMQA 2A5HA 5D30A 3T44A 2H8XA 4IIDA 5AHMA 3DHDA 2RDTA 4C6BA 1VPXA 4HSOA 1ONWA 4JIIX 1FWWA 1TV5A 4MAVA 2WSRA 2Y61A 3NYDA 2ZYFA 3F4DA 4HVXA 3O07A 1OSEA 3N14A 4O1EA 2CLFA 1V6WA 4YS1A 2V3GA 3PM6A 3LQGA 4QG8A 4HP5A 4RZ4A 5KEZA 1GPWA 4WSJA 1ZAJA 4ORIA 4DJFA 4IH3A 3E2RA 3W7RA 1LQ0A 1PCKA 1WE5A 2VRQA 2XN2A 3WLTA 3G3DA 1HXJA 4RPPA 4IXHA 1WA3A 1BGAA 1PIGA 2ZE0A 2G0WA 1FFQA 3ARYA 4NX5A 4C6FA 3P67A 3URAA 3L4VA 4FR1A 4MSSA 3D0CA 1RD5A 1A0EA 4V2XA 4XSMA 4LUIA 1FRBA 4CQAA 1LLOA 3W6YA 3HG2A 4QG6A 1IXNA 1HO1A 2ZRXA 1XL9A 3EYPA 4ZOEA 2XHYA 5IDIA 3MCMA 1OX4B 4AZ5A 9CGTA 4JN7A 2D2HA 2ISWA 3TJIA 1S3HA 3ARWA 3WF2A 1J2BA 5XIAA 1PO9A 1VENA 1EUNA 1Q5MA 1PZ2A 4BWLA 3GYEA 3AYSA 4BQ5A 1PPIA 4O1CA 1VRDA 4HU0A 2VOTA 4Y7EA 5GJNA 1Z9AA 3PHAA 2PLCA 4FXJA 1R9YA 3NVDA 4MDPA 3IARA 3E02A 4JYEA 5HNNA 5I24A 4Z1AA 1XDLA 1OBAA 3CUGA 3CXOA 1HKKA 2WC7A 1GG0A 1I2OA 1W0MA 5E5CA 1T40A 3W82A 5D9MA 2ZX9A 1Y8BA 5K9DA 4B2DA 2Q02A 3H7RA 1LTDA 2PEVA 1XP3A 1XUZA 4MIMA 3F03K 4PTNA 4D6CA 3M43A 3TLLA 2EBNA 3B9AA 4DF0A 2ZWYA 1HJWA 4LOCA 3PWIA 2VGIA 3SCNA 2RGMA 3S2MA 1NU5A 1A5BA 4PTXA 4HYRA 2PD5A 2V3EA 2NXGA 1MFUA 1KBJA 1JCJA 1RA0A 4JNZA 3OHMB 1A4MA 1QNSA 2OPJA 3AWNA 1Q8JA 4EVZA 4RW3A 5HULA 1M7PA 2JKAA 1FY6A 4DO4A 1UCWA 1BAGA 3IAQA 3HZ3A 4A35A 5EPDA 5JQ9A 3PZOA 1TMLA 4WCJA 2QVNA 4H9UA 2C18A 1ME8A 4QE1A 1M01A 3KTCA 5LA0A 1TYGA 4S3FA 3P8IA 4UTUA 1JF5A 2XVPA 3M0IA 2X42A 2GFTA 4CNOA 3FN9A 3LTSA 2QF7A 3AIQA 3VUSA 1P6WA 2XN1A 3HQOA 4UZUA 2FJUB 4L6HA 4RK8A 4DWSA 4IF2A 4K7VA 4D6DA 1O5KA 3QMRA 4HHMA 1S5VA 3WBAA 3G0XA 1W1VA 2YSWA 1I60A 1PIIA 5HQMA 3EKLA 4PFMA 1KXHA 1EXPA 3L5LA 3FYPA 4ZFMA 1RD6A 3NM3A 2FMOA 4ZR8A 1UMLA 1E5NA 5HPOA 2FZNA 3CZKA 4HU3A 4ML9A 4H9TA 2Y62A 1DXIA 5J5RA 1H7NA 5A8PA 1UWRA 3QRHA 3G6MA 1P4CA 2VEKA 4G6CA 3RLGA 2DSWA 2I16A 4D72A 5A69A 1QPKA 3CB3A 3BV7A 4Q4SA 4D6IA 2ACQA 3A6OA 3HMCA 3B8SA 4AUBA 1DWHM 1VFOA 3VD5A 4AF0A 4E5TA 1CBGA 1PZ0A 2QXWA 4I6KA 1S39A 3GM8A 2NQZA 2DZUA 4JTCA 4JTQA 4YYFA 1H7XA 4OOZA 3OQEA 1KGWA 1I0BA 2R1NA 3PBWA 2EGZA 1Z69A 4WKHA 2WNQA 2VQTA 4MJ2A 3RRXA 1JIBA 3MO7A 2V3DA 5GJMA 5CLTA 2VR2A 2NZLA 3APTA 5K4XA 3KVJA 5BRBA 3GVGA 4W5UA 3VU2A 2VVSA 3OG3A 1OEPA 3V18A 4INFA 3QMTA 2HK0A 2V38A 4RV3A 1TPVA 4ZQOA 2WMFA 4IIGA 4BF7A 2VR4A 4KCVA 1QAPA 4NT0A 3KFTA 5HOSA 1XYMA 4DZAA 3T4CA 3OB8A 1H11A 2X16A 3P7YA 3KL3A 3SB0A 1U2YA 3OU8A 2DJLA 1KM6A 5CBJA 3MTWA 5H8UA 2VELA 3KBNA 2I17A 2E8ZA 4CQBA 3KHDA 3VNKA 2CZDA 3W6MA 2EJ1A 3T40A 5U7SA 2Q09A 1Y7VA 3MJMA 2OO0A 3PZVA 1DHKA 3NGFA 3L5MA 4AIUA 5C2GA 5BWAA 4LUTA 5H91A 2VC5A 3QBUA 4X0NA 5IHSA 1UZ1A 1KFBA 4HJWA 1R6WA 5J04A 2ZZ1A 4KFPA 3AYTA 1DJXA 3W3OA 1HL8A 1W17A 4PMDA 2PTDA 2V2HA 3AALA 2QPSA 2GL5A 3IJDA 3A64A 2WOQA 5AHFA 3GG0A 3AMDA 1M7XA 3PS7A 3I68A 3CWHA 5REQB 1E0UA 3GG1A 3R25A 5I3HA 4CVWA 3PY2A 2F9RA 2PDWA 2F2KA 1K77A 5KSWA 2A7RA 3BLOA 4D6HA 4XZHA 1HVXA 2Y70A 3RO8A 2PRMA 5A3HA 1IEVA 1J0HA 4UTHA 1E9LA 4NZCA 2WPBA 4JIPA 1XIDA 3OQ8A 1VB9A 5AOUA 1JYXA 1MQQA 3RM8A 3PWAA 4AWUA 1KWKA 1VFUA 3S6TA 2HJPA 2W9MA 4UQCA 1KLYA 1SVDA 3W2LA 3M0HA 1UROA 5BRQA 3TK7A 4NIRA 2J4GA 2Y7DA 2E1DA 1VBJA 5CPOA 2WZMA 4BK9A 2VD8A 1TPWA 4CN1A 2PBOA 3GFYA 9XIAA 1PB0A 5M1TA 3RPDA 1EYEA 4LAKA 2HVOA 2FVLA 3S9ZA 4J3WA 4MJZA 3CZEA 3SZ8A 4HMDA 1UH2A 2IPWA 4EK7A 1PEZA 1IIHA 1V3IA 4GI6A 1XW8A 2RJHA 1EL3A 3A13A 4KF1A 4C6IA 3M0XA 5HUOA 1W3NA 5U4NA 2EG8A 2XH7A 3GTHA 3CC1A 1LBFA 5C8BB 1WDSA 4N4QA 1VIWA 4BR1A 1GOQA 3LCGA 1KV8A 3W1LA 2IPJA 4GZIA 4JOMA 2F61A 2QIWA 5A6AA 4LS2A 1BXCA 1DYSA 3S2NA 3NAVA 3BCJA 2QR6A 4O0KA 5I02A 4ZQNA 4EACA 2WJZA 3I7QA 5JH2A 2EAWA 5IBXA 1UPPA 1GVQA 1TPEA 1X97A 1ZZMA 3H2OA 3MQTA 4XD5A 1A3XA 5IHRA 1LZOA 5D04C 3AXXA 3G1DA 1JUBA 5FJTA 4XAPA 1A5CA 3EEGA 4ERIA 1N82A 4FX6M 1FUYA 2ZZ3A 1M7OA 3LHTA 2DSVA 2PE4A 2QCDA 1DWFM 3EDEA 1PX8A 5KETA 5F2GA 1J18A 1TWSA 4W86A 3K46A 2A2IA 3FCPA 1A5KC 1BYDA 3MS8A 1MW0A 2A3AA 3SCVA 4IXXA 3ARSA 1K9DA 3T78A 1OCNA 3WEZA 3PTDA 3S47A 2XISA 5I3KA 4F9DA 4XSLA 2D2JA 4DF1A 1SR9A 4FOKA 1QI0A 5B7YA 3O1NA 7TIMA 1DQXA 2NQLA 3MI2A 1Q6OA 3QQ0A 1BWKA 1GOKA 3S1GA 2YX0A 1V3HA 2Z6IA 3VIGA 8XIAA 1V0KA 4O28A 3EB2A 1TQXA 3KRZA 3WUGA 2YYUA 1QDSA 1QNRA 2F38A 2QUTA 3KBJA 4OKDA 1W31A 1JZ4A 5CPLA 3VX1A 3KXQA 1VFMA 1TR9A 3VD3A 2OLSA 4HMCA 5DY2A 4ZO8A 2C8NA 2DZAA 2B7NA 2PC4A 3W2JA 3ABSA 5D2TA 5ECVA 3AIWA 3PJWA 2JGYA 3UYCA 1K9FA 3W7NA 3ELFA 2HZGA 3PUDA 1FP8A 1TJ0A 1W9VA 2F6UA 1V3JA 1W32A 1NF0A 1OG6A 1TCMA 4JICA 2FZMA 4AHPA 3BLFA 4I90A 4B90A 1C92A 3VDBA 1KM3A 4HZ8A 3R1ZA 1J12A 5AB3A 1ENUA 3V5OA 3LD5A 4I6VA 4F79A 2OZ3A 4DN1A 2R14A 4TXEA 4LX4A 1W1IE 3VYLA 1B2YA 1XINA 2PDNA 5D09A 3SY1A 4DWDA 4MY9A 5AZ1A 2WJDA 1Q6EA 1UP2A 5L6UA 1UKQA 1RQBA 3W7JA 2HSAA 3EX4A 5M3WA 2E09A 2YDQA 4W8AA 2WMJA 2ZXBA 4KERA 1AQHA 1JGIA 4PB3A 5FF7A 4AH7A 3SQMA 2FHBA 4GI4A 4IFRA 4TMCA 5CSSA 5E6ZA 2J6VA 3RX4A 1YXCA 4K8HA 1DTNA 1OWQA 1EF3A 5FL1A 1TJ2A 3LHVA 3VZXA 1VFTA 4AD5A 5CZJA 4LUYA 1YBQA 5CC6A 4O8AA 3ZM8A 1DJZA 1PIFA 1V77A 4LRSA 2C14A 2W66A 1OF6A 3FJLA 4AW7A 3C4UA 2YA0A 5DX7A 4UTFA 1UW9A 1KO0A 3ZYZA 5FJUA 4JGDA 2W5FA 2R1LA 4GHRA 3AXIA 5DXXA 2QJHA 3WY1A 3VIKA 5K4ZA 2G3NA 2WQPA 5EYWA 1RJQA 3WQ4A 1F76A 5E0CA 3GG8A 3ITXA 4US5A 5I79A 4PFHA 5A6LA 1MSSA 4OJYA 1NOFA 2CHNA 1KQYA 5T8GA 3TQ0A 4Q4QA 3EPMA 1HNYA 2QW5A 1FWRA 4WR3A 4CU6A 2IXVA 4GNJA 1Q7MA 3TTSA 1GOWA 3IANA 1RUSA 4H3DA 4J28A 5E6YA 3DYPA 1YRRA 1TPDA 3VGFA 2J8FA 3SUWA 4QAWA 4FIQA 1OVDA 2WKGA 2CLKA 3CASA 1EIXA 3L23A 1AODA 4XZ9A 4O57A 4AHOA 2Q8ZA 4XZMX 2QUNA 3LCFA 1XD1A 4D8AA 3GIYA 4GX8A 5E9AA 3F4VA 1RV8A 3WLPA 2PDJA 3N2XA 3W4RA 2WB5A 1XLIA 1KCXA 2P8BA 1X1ZA 1FWDC 2JEQA 5HINA 2ZXDA 3FEQA 4QBXA 4IT1A 1FFRA 4ADUA 4UWMA 5G1MA 1NP2A 3GNOA 3U6WA 1MQRA 1B54A 2OB3A 2GUBA 3BJTA 4N9CA 1Q4WA 3C8FA 3E74A 2FDMA 4UTTA 4DBEA 2A85A 3QOKA 3C2RA 3SDOA 1XSIA 2W61A 4W9TA 1L0PA 3S3GA 4Z1YA 2NUWA 2Z6JA 2BOEX 3W01A 3W53A 4I5UA 4U2ZA 4FP1A 2NV9A 1BSIA 3GH4A 2BDQA 5I2UA 1JD9A 1UC4A 5T9BG 2PA6A 1V4YA 1S2CA 3WEMA 2WVVA 3BL3A 4HQVA 5LA2A 2VGGA 3B0VC 2OT0A 1JPMA 3KM8A 3RYSA 3QFWA 3W23A 3AYVA 5A6BD 3T6CA 3W2KA 4IMFA 3ZJ8A 3PJTA 1MEHA 2ICSA 4QIUA 1B30A 1VFHA 4H4IA 1GG1A 2XVNA 4F4RA 2C0AA 2OCZA 3LPPA 2YDRA 3U9IA 2BBFA 3RILA 1OC6A 3N2OA 5HA7A 1BHGA 4GY1A 5EKYA 4NZ5A 2BVTA 3L65A 3EPOA 4IM4A 4A6GA 3UW6A 1KCKA 4Q33A 1CWYA 4AQLA 3TTOA 2DFAA 4HOXA 2ZX7A 3JZUA 2FZ8A 4GZ7A 2OQLA 5F4SA 3WQ5A 3PP7A 4HZMA 3MUAA 4NZFA 3CUJA 2EEXA 1E6PA 1PSCA 4AY7A 4MFEA 3TMLA 2RJGA 4NNAA 2VGFA 5AZ0A 7REQA 2V8ZA 4O11A 3F5LA 1LWHA 6ENLA 3DKJA 4P5UA 1ZNNA 3PZGA 4RCXA 1VAHA 2WCAA 3DGRA 2DZVA 5CBBA 1TWZA 1H4PA 3WNLA 2J66A 2FB2A 4IIFA 5MF5A 4QDMA 4UR7A 4DQWA 4RNHA 2Q8XA 3B0PA 3AYRA 4D1IA 3NEHA 3WF0A 1KBKA 3EOLA 4PULA 2FGZA 5FI8A 3NQEA 4HZ7A 4LJ3A 3ECQA 2PDYA 2PS2A 4Y8FA 1G4SA 4OBSA 2X0SA 4RDVA 3SADA 3B8IA 1H41A 3URBA 2VZOA 1ICPA 3N18A 1EWDA 2XZ9A 1BTMA 4IGMA 3KHJA 4QHRA 1KKRA 3P5YA 1XC6A 3MSYA 5G2HA 2VZSA 3QPEA 2Y5EA 2Y2WA 1U1JA 5SWUA 2GSJA 4XD6A 4ZMGA 5DY3A 4BQ4A 3VGEA 1S5MA 3BAKA 4QDPA 2QQ6A 3W1QA 1ZP3A 3MUIA 4Q7NA 1QR7A 3GZ3A 4R3UA 5LNSA 3W7QA 1P0EA 3KBSA 4W85A 4JFVA 1O95A 3KVKA 3IJ8A 3OVGA 4DRSA 2PZNA 3SSZA 2X1TA 4IHCA 3PUGA 1KTNA 1H09A 1AW5A 3CUHA 1C8YA 4KGJA 3UWWA 3PK7A 1E0TA 2Y85A 1I6NA 4B91A 5I03A 2QPXA 3T4WA 1C29A 4MAZA 2OELA 4H7VA 4POCA 2GK1B 2O55A 1EUAA 3N25A 1XLJA 3P14A 1CGUA 4ZZ9A 1ISWA 3PG9A 3SJ3A 1US0A 2A6NA 4OE7A 2UWFA 2VO5A 3ALFA 3CL8A 4H8UA 4C7GA 1GJUA 4FAMA 1W37A 2ACSA 1Q45A 4HU8A 4CNSA 4N4PA 3PZIA 2YGYA 4JQ2A 3N4FA 4Y9PA 1W5QA 1CIUA 1C9DA 4F2BA 4AEEA 1MUWA 3VX0A 3A21A 4IP5A 1FDYA 5D2YA 4K1GA 2VEMA 3AXKA 1QWGA 2ZC8A 4KCUA 3MSDA 3UZYA 1KFEA 3DZ1A 4OVXA 4WY0A 3FHQA 5DLCA 1K6AA 2I14A 3WBYA 1XYCA 4P61A 4L9YA 2GGHA 3FVMA 1MXDA 1TUXA 4M6PA 5FACA 4FNQA 4G7FA 5D8ZA 1PKNA 4B3LA 5CC5A 3RGTA 4DYEA 3LLDA 1G69A 4FEZA 2QUMA 5BOFA 3O3RA 3CWOX 2CIPA 4R9OA 1LROA 2PSNA 4UTWC 4MB1A 2H9AB 1R2SA 3DBPA 2VP8A 3IPWA 1AD1A 2A3LA 3AS2A 1JDAA 3SCPA 4FNPA 2WHKA 3ES7A 1M6JA 5LKYA 1OG0A 1YYAA 3S9IA 3UWQA 3M07A 1CLVA 5JBEA 3D46A 5LIYX 4EPBC 8TIMA 2QT3A 3H2FA 2D3LA 2Y89A 3GFXA 4J3TA 4B5VA 1EC8A 3OLGA 4XBKA 3W24A 4IQLA 4HN4A 3IUIA 1J9YA 4Q6XA 1O94A 6A3HA 4UCGA 3CV7A 5CSYA 1JAEA 2HVNA 3PTMA 4JQ1A 4GUHA 4P8VA 4FSAA 1ODUA 3LLXA 1D3GA 3U7VA 2PDHA 4IG2A 1D7FA 3PN8A 5A8OA 4Q4MA 2JKPA 3B04A 1AUSL 1A5OC 3I6EA 3W84A 4X60A 4A22A 3GHUA 4GG9A 4DO6A 3DN5A 3V0SA 4WSKA 3ANUA 4ORMA 2ZTKA 1KGXA 4C6EA 2P0IA 1OZMA 1Z7AA 3CWNA 1R7AA 1EDGA 3HJEA 3GBDA 4RL3A 3TAOA 2WC4A 4CEUC 2HXUA 3K4AA 4KIEA 2FVMA 1DJGA 3S2JA 2J79A 3RO6A 1EOMA 4F40A 2CZFA 1W8SA 4GYPA 3MZNA 4WXZA 1XPYA 2NWRA 2FJKA 3OBKA 4W7VA 3WSUA 3R4IA 1E51A 1HJSA 2XDFA 4L9ZA 3TCSA 3U2ZA 3BZGA 3SFWA 2PU0A 3PPHA 4O4VA 3CGTA 2X7VA 4NKCA 3HM7A 4REQB 4JX4A 3P3BA 1QXLA 5TNVA 2TRSA 1KQZA 4Q8VA 1XIBA 1TRIA 1PS9A 1XLCA 2DW7A 1BXBA 1AH4A 2XWEA 4FXRA 3T7VA 3C0SA 4Z2LA 3RAOA 4GIEA 3UZXA 3MB9A 5EMUA 3I10A 4X2PA 3WJSA 4FK9A 2GOUA 2XINA 3PR2A 4ICMA 4KQNA 4IGSA 3FAXA 3DFYA 4GXWA 4O0QA 2J7CA 4JXCA 1QI5A 3LOTA 1J5SA 2GDUA 1VJIA 3BAWA 3QY6A 5FF3A 3WG6A 1UR8A 4UMBA 1SZRA 4IPIA 3SCOA 1XXXA 2EHHA 4DJFD 3MHFA 4N6FA 4V15A 1X7FA 3M7SA 2SFPA 3KAOA 1C3FA 1N8FA 2PDMA 2VURA 4UOJA 1J96A 2W3ZA 4CVUA 1Q8AA 1YE6A 3T2QA 2IXUA 3GO2A 3N2TA 1E71M 4GH1A 3CMGA 1REQB 1SO3A 2ATMA 4UTIA 5CZSA 1Q6DA 1KRBC 1KBLA 2V5CA 4XVEA 2ZUMA 2ZXQA 1FQ0A 2CC0A 4CD7A 2ADAA 4DBWA 5AVHA 4DI8A 2O9OA 2Y88A 3EA1A 1F6PA 3K2GA 1DQUA 4PC8A 4TX9A 3M4HA 2PGRA 2RDXA 1WXZA 4QQUA 3SGUA 1JI2A 4DLMA 2OX1A 4QM1A 3LB0A 3VI2A 3A4JA 1WKDA 2VDGA 3A3HA 3P6LA 5FESA 3OGSA 1P1XA 1S2AA 1EHNA 1MI3A 1UR1A 2DJXA 5LIUX 5FKYA 3VCCA 3C52A 4OOUA 3AZTA 3WQEA 4AWSA 3UXKA 2CZEA 3NQBA 1NARA 1UZDA 2W92A 4R33A 1TJRA 1C8VA 1IF2A 3LM3A 2NT0A 4DBDA 4XD4A 4PUJA 3VKKA 3WLQA 5EL1A 3DAQA 5ABTA 2WAGA 4GRSA 2A1YA 1CECA 3UQNA 3GC2A 1ZENA 1W3IA 4JKMA 4C6MA 5C9ZA 1CX9A 4WSHA 3F2DA 3CAVA 3EPNA 3PPGA 3TQVA 4B2DD 2DQWA 2V9DA 1WZKA 4QJ5B 1Q2RA 3R8RA 2DZSA 4M24A 3AICA 3EX3A 3GW0A 4DX3A 4BF9A 2J7HA 1LM1A 4EPDC 2VX4A 2YZRA 5CPSA 4H6QA 3CIXA 2J88A 1W1B1 4RE4A 1XLLA 1PAMA 4QLJA 2VD9A 2P50A 1JQVA 5TD4A 2V5JA 1WNOA 4JD4A 3MWCA 4H7CA 3AAMA 1UZHA 3HQPA 4PUDA 4H2CA 3FYYA 3BJSA 2J7DA 1LL4A 3VKJA 4Y9OA 3GXFA 3T05A 3EB3A 2UV8G 1M9HA 3GNXA 4S3AA 2JFEX 2IW0A 2W0UA 3NQMA 1RBAA 3CHEA 3DYOA 3SO7A 1F07A 2PTZA 3EDJA 2GJXA 3V75A 3L12A 2OZ8A 3VGHA 1QI3A 2PU1A 3FVDA 1I9CB 6REQA 4YPJA 1J0IA 2BVYA 2ZUWA 3KOWA 3TTYA 3ZIZA 2CU0A 2YR1A 3RJYA 4DWSD 1O68A 4YVXA 4N7QA 3NGJA 4J4KA 5FJRA 3BLDA 3NQAA 2QGYA 3QPZA 3AIRA 1VCVA 4NVTA 3W1UA 3CBWA 1Q13A 3TONA 5HQLA 1ONEA 5I23A 2CLIA 4XTIA 3UNTA 1AJ2A 2C1HA 1BWLA 3TN5A 2DSUA 5EMMA 4JCLA 3F4WA 2CEQA 2OODA 3A9BA 4UQAA 1YKWA 1TMQA 1FHUA 4KEMA 4FXFA 5HPCA 1NOWA 3RLVA 2I7GA 3KLLA 4IPPA 3F1QA 3G2GA 3GAKA 2JBMA 3ZJ6A 2V5KA 3MUXA 1T6MA 5EGRA 3W73A 1DXEA 3DGBA 3DFSA 4LGXA 3WMLA 1VLIA 1ME7A 2E0PA 1JUEA 4RE0A 5GPRA 1E56A 3W7KA 3G1XA 4NU7A 3ZWSA 3SSJA 2G3IA 4NJKA 4AC7C 5REQA 1EO7A 4AVOA 3R10A 5CPQA 3UERA 2J8GA 3UVAA 1US3A 1CLXA 1VBUA 4HJFA 3S5YA 5BZAA 2PWFA 3SCUA 1ZL1A 5ABGA 1CT5A 4YU1A 5AYZA 2OGYA 2W67A 3GR4A 4XO6A 2CYGA 3U2CA 4UFMA 1GKPA 3WLHA 1MDRA 4I9MA 1NFGA 1C90A 1TTQA 3W70A 2Z1XA 2ZQ0A 2Y1HA 4WD0A 1YTKA 3L66A 2INZA 3RLHA 2ASHA 3M64A 1X1NA 3QPYA 3ARUA 3MPGA 2XFRA 5DRCA 4AY8A 3UCQA 3S1UA 1IT7A 1UHVA 1N8WA 3BICA 4HMEA 3TH6A 3ARZA 1OB0A 2XGBA 3T0AA 5D33A 2CLEA 3GDBA 2VC7A 2FFCA 3NXLA 5E09A 1HN1A 3HPZA 4P7LA 1XS2A 2VOMA 4JS3A 2F2HA 1K1DA 4QXIA 1BG4A 1J6OA 2GVYA 3MT1A 1WBJA 4J5NA 5JH1A 2HWGA 4B5SA 3NVTA 3TXZA 3APGA 4UB9A 5CH9A 3MA8A 1T7LA 4UQDA 3FIGA 4GQBA 1RLCL 5HQEA 3QQWA 3V5CA 4QROA 3VKAA 1YDYA 3AOFA 4ZTXA 5D2VA 3SECA 1GVYA 1R86A 3AHVA 2CWXA 4J3UA 2O4QA 4DELA 5LXEA 1LRQA 3FDKA 1ICQA 3B05A 2B4GA 3WJYA 4LYPA 1M41A 4UR9A 1UIPA 2QZRA 3LEPA 4UQEA 3ONCA 5EMKA 2E6YA 2WNNA 4D2JA 3NURA 3CZGA 5ABEA 1HL9A 2GWNA 1B4KA 7A3HA 3VILA 1FH8A 5I07A 3TW6A 5C55A 1LUCA 5FEPA 3LHUA 2FTYA 4XKMA 3BTNA 2X41A 3C2VA 1VH7A 3JW7A 1I1WA 1SFLA 3OZOA 4L4MA 4PMNA 3KS5A 3RCYA 2JIEA 1UA7A 3CIVA 2ZUVA 2PWUA 3PAJA 4C5ZA 1J6PA 1AL8A 1SO6A 2VFHA 4A2SA 4HPNA 2QCHA 4L9XA 2OQYA 3VVGA 1R3YA 1MXGA 4D8ZA 1Q63A 3KBWA 5A1AA 1JAKA 4QR6A 1W2VA 2I9UA 4Q3MA 1ADSA 2W63A 3LRMA 4AB4A 5CGMA 1Z89A 1KM4A 3G0SA 4K6AA 1Q4NX 1SR0A 1B3WA 1SJCA 4GFSA 1CB7B 1GW9A 3IEBA 3S5NA 2G4JA 2X09A 2NW0A 4JPGA 3N73A 4O18A 3KCLA 3R5EA 2OKOA 3L2MA 1YPFA 2P53A 3LV5A 2W4XA 3GKFA 2A7NA 2PWDA 3VC5A 3CUXA 3L67A 4KPLA 3WD4A 1WDDA 1CXKA 1UR2A 5CGTA 4WXYA 1RCXB 2A79A 4MKSA 4OGZA 1G7UA 1A5LC 3S46A 3GDRA 3WH8A 1IEWA 1NH6A 5JU6A 2I5IA 2RDWA 3L5AA 3LI0A 3ES8A 2OMAA 2OZTA 3W7EA 3R0KA 5CGQA 4BQ2A 4RKAA 1TJPA 1QI4A 5HR7A 3E12A 3HOJA 3I3BA 3GNRA 3CV1A 2C16A 4P7OA 1B3ZA 1OM0A 1XLEA 3XINA 1I45A 4M6QA 3LN3A 1GORA 4C6LA 1EQCA 3CQJA 3DERA 2YL5A 4GYJA 4XBJA 1MVYA 1UP3A 1GVEA 3H8AA 4O16A 1PTDA 1K4GA 2QCMA 3A3WA 2QS8A 1MNSA 2OZ0A 4LYQA 3H21A 1XGZA 4LYKA 1V03A 3C2EA 1JCYA 1KFLA 3LQLA 3JVAA 2GZXA 3BCFA 1Z32X 4LVAA 1EJSC 1JZ2A 3TWAA 2F8QA 2Q8LA 5HJLA 4PMOA 2YZ5A 3QY7A 4LNCA 5IFPA 3B9OA 2X1IA 1HO4A 1DXFA 3TU9A 1IR2A 7PTDA 4RR4A 4FPSA 3AISA 3VKCA 1DVJA 1JUKA 1VPQA 3PZQA 5DO8A 4L1GA 2VT0A 3P61A 2DY3A 1POKA 2PDKA 4G1KA 4DXKA 4LCSA 1X39A 4WGXA 2XM2A 1L6GA 3GIQA 4ASTA 3ARVA 3GXMA 1Z41A 5K9XA 3GC5A 2WMKA 1EFZA 1CTNA 5CJNA 2Z00A 1PXGA 2WKLA 1ZY9A 4TX8A 3ENLA 3E0LA 4E38A 2HTMA 4K1WA 5C7HA 3ABRA 3G5EA 4RDWA 1UWSA 3Q2DA 3QXBA 2WJEA 6XIMA 3BURA 4ROPA 3UJ2A 3UYIA 2QMJA 3TX9A 4MB5A 4BEQA 1JCTA 4S3EA 1IT0A 3S5OA 3WEOA 2PDUA 1QOQA 4J3XA 3FY1A 3N04A 4OWGA 4R7OA 5LIWX 2AMXA 1V02A 3R8GA 3G6LA 1AZ1A 3BAIA 4O50A 3G22A 3SFKA 4XB3A 5HJYA 3EGJA 3GKAA 3LCHA 2ZZ2A 5H6HA 3DFHA 4O1DA 4GK8A 3LZ3A 3TROA 4Y9NA 2JIWA 2PTWA 4HK6A 3WELA 1PUDA 2P5NA 2PDFA 5JVLA 1UD6A 1TV3A 1ONRA 1SFSA 3SN4A 3EBVA 5JBFA 1O5QA 4PUNA 3E2QA 4XWUA 5G1YA 1PTGA 4K68A 1VHNA 3GU9A 4TR9A 1EBHA 4L65A 1XYAA 2DDXA 1QRQA 2CLHA 4JNMA 4O53A 1G7VA 4A8LA 3S42A 2DH2A 4DIAA 4BZYA 3MVTA 4JIQA 3DC0A 4Z2KA 2PCQA 4I8DA 2AAAA 2POTA 1YXDA 4IOTA 1RPKA 1RSCA 3IV8A 2EG7A 4HNVA 3W7CA 2EG6A 4YLWA 3ZSTA 1DJQA 3V36A 1GQJA 3TA6A 2JKEA 4IGHA 4DY1A 4OT7A 4CQ8A 2EPKX 4JEQA 3T55A 1HP5A 1EJWC 2HK1A 3W1RA 3CYJA 1B1YA 5DN1A 1BKHA 3GXTA 2XFYA 4MUPA 4AIEA 3C61A 4A05A 3RJXA 2OQHA 2NX3A 3LERA 1ISVA 5HANA 4ZE5A 2C6QA 2C79A 4PTVA 3GAYA 2OSYA 3NYZA 1FDZA 1TPUA 4US5D 4H83A 1EDQA 5CSUA 4S1FA 2JALA 5BOOA 4RW5A 5B80A 4NJIA 4ZSTA 2R9RA 4PBGA 4ATLA 1K3UA 4E3TA 3S9YA 3OGRA 4PR4A 2YB4A 3M6DA 2V67A 3W25A 1GTHA 1F3WA 1M65A 4XZWA 1B0IA 3RCMA 5LHEA 4AWTA 2QKFA 3B4YA 4EE9A 2V81A 3PG8A 3THQA 1TR1A 2ZRZA 4L6OA 2Z25A 4JNYA 1EJVC 3G1RA 4LAOA 2TYSA 1FH7A 4K8EA 1GONA 5BNKA 2FPVA 3EOUA 1OGGA 1C8XA 2ZCGA 3GU1A 3QR1A 1UMYA 1RQHA 4QRNA 5AYIA 2ZUSA 5LYRA 4H7ZA 2PP1A 3UU0A 2WWDA 4C6CA 4JTKA 1PWMA 2WQDA 4C6OA 3O7UA 4A8IA 4J27A 5TQLA 4XX6A 4LBSA 4FIRA 1ZAHA 1EEXA 3S2CA 4YTRA 1KB3A 4GY7A 5G5IA 3DG6A 4CUCA 4JY9A 1WXYA 1X8FA 5C70A 2PB1A 1R87A 1TIMA 4DYJA 4GQ0A 3WDQA 1VP5A 5F4WA 3ZWTA 1JZ7A 3R12A 2G95A 3DU0A 2FYMA 3T1GA 3EXSA 3WUBA 3BLPX 3WLNA 1S2UA 3OG2A 4PMQA 2ZADA 3K8KA 2CW6A 3UP8A 5BYWA 1PCWA 1UUMA 2DZWA 4JYFA 4O15A 1VLWA 1DQWA 1UD8A 4PUKA 3AXHA 2F7FA 2YKKA 5DCBA 3OBAA 3EOEA 3N4EA 3RU6A 3R6IA 4ACZB 3F4CA 4HTBA 3QZEA 4QFUA 1J8VA 1NAL1 4EP8C 4WF7A 1V8EA 4UUIA 2YBTA 4UR8A 1Q6QA 3NZPA 3HURA 5A6BA 3H2CA 2XGZA 2D2GA 2NX1A 4AAJA 4GD0A 2XUCA 1JCXA 1HJVA 3SRHA 1WAWA 4LANA 4Y9MA 5A5WA 3QV6A 3V1PA 4PSRA 2GSHA 2E5BA 1SW7A 1V7AA 4K7YA 2J74A 1TWIA 1F8IA 1Q6FA 4AIBA 2YYTA 4GBDA 1VIZA 4ONVA 4HD5A 4HNUA 1OD8A 2H3DA 4O10A 1XCXA 5I0DA 2P3EA 1JXJA 1TQJA 4ILSA 1ZJIA 4NX0A 2CWNA 1P1MA 1LLZA 4MF4A 1OJXA 4R85A 4E4UA 1OQFA 2PLKA 5A8GA 4M19A 3N9KA 1LCOA 4L1XA 3DG3A 3W87A 5FF2A 5D37A 3NQ8A 1V08A 4I9JA 5JIWA 3ARTA 1WCGA 2HRWA 1A0DA 1PVNA 4YWIA 4IIBA 5A95A 3EXTA 3R0UA 1XQLA 4GBUA 1KLZA 4HYVA 4K37A 1BG9A 4KWOA 2BOFX 2FIQA 5IXEA 1MUCA 2HE8A 3GUGA 1K7EA 1TZ9A 2BLEA 1JL8A 2V0TA 4MADA 2D73A 4JHMA 3W74A 3ERPA 6ALDA 4TIMA 2V6AA 1C7SA 4TOQA 4PRRA 4ENLA 2GPTA 1LBMA 1PHQA 3Q67A 1GPFA 4G5DA 4V1YA 3C3UA 4IQJA 2I5QA 1QWKA 3GW3A 1H7RA 3W76A 1G01A 4HPJA 3OVRA 4JKKA 2DU2A 2ZRVA 5RUBA 1GUVA 4C6NA 1NELA 1QNVA 4H9ZA 1EGVA 3CEUA 2WSYA 3BO9A 3IJQA 4ZVJA 4HCHA 1POJA 3PZMA 1DPMA 4E6MA 1G6CA 1QU4A 2P8CA 1F5ZA 2MANA 3N11A 4GLEA 3BLEA 2CKRA 4BQ3A 3VMNA 2ISDA 3VC6A 2XU2A 3WLJA 2BVWA 2VR5A 3HFTA 4LVGA 2OYMA 4NNCA 4XKYA 4PTMA 4CCCA 2H9AA 1UH3A 1HFBA 3OPSA 4A3HA 3H24A 3WENA 2C0HA 1QI2A 2YCLB 2BHUA 3N2MA 2W79A 3DH7A 3H7UA 1WDPA 4XQ6A 2YFNA 1ZBCA 4DUXA 3W7HA 3MY9A 3BE7A 4HYWA 2GVLA 2HROA 4JZ5A 4Z2JA 1PX3A 3P62A 4DUWA 2EO7A 4JHOA 4AD4A 1BGGA 3ICJA 4HNOA 4NILA 4J2PA 3S1WA 1DIDA 3QC3A 3GH5A 3C2FA 2BS9A 1M5WA 3UPBA 3LSBA 1SO4A 4MM1A 4PSPA 2O9RA 2B7PA 4GYKA 1YNYA 3RHGA 2DQXA 1N7KA 2PDIA 1LJYA 4BY3A 2B31A 3S0CA 2XIIA 3S1XA 3TYAA 3BGAA 1W9BM 5A8MA 4D71A 2R1KA 4ROQA 2BXYA 4HNLA 3UJSA 2FH8A 1V3LA 3H55A 1S2VA 2VX5A 1OIFA 3CH9A 3T42A 3P93A 1SU5A 3P0XA 4RLIA 2DIKA 4CNTA 3ARRA 1R3TA 3HBLA 4HA3A 1ODZA 4X2RA 1XQKA 1EO5A 1I1XA 1UA3A 2REQB 3BW4A 4OV4A 4C6DA 4KEUA 4LALA 1WDRA 2CITA 3TJXA 4FLOA 2XM1A 1GOIA 2WVSA 1MUMA 4EKJA 2O92A 1OYBA 1SW3A 1YADA 3O6YX 2VFFA 1RXOB 2YPIA 1FHVA 4Z1BA 1W5NA 1BQGA 2IKIA 3KOZA 3PTQA 1L6FA 3TCEA 4REQA 3DEQA 3A9IA 2EPMX 3WN6A 3EA2A 2FTWA 1XHGA 3SEPA 4UBPC 3EWXA 4Y8EA 3GIPA 2E5CA 1RK6A 5FEXA 5LGXA 4G2DA 1TB3A 1F3XA 5AC4A 5KMYA 3JRKA 2XTKA 1RR2A 2FPTA 4OUIA 3UWVA 2A6LA 4UNLA 5I3JA 1Z3NA 3LMYA 1A47A 4JTAA 3TSMA 2A21A 2XWDA 1E43A 1DIEA 1XX1A 1VJSA 3JUGA 2GSEA 3QM3A 3WQCA 1B5TA 4PBEA 3E0FA 3E96A 1D8WA 1UKOA 4GQRA 3CAWA 4B92A 5FF0A 1ZJBA 3WO8A 5CKSA 1G5AA 5C0QA 3UWUA 1TMHA 3BLLA 4KBXA 1WZMA 1GKQA 3NZQA 5F1UA 3LTYA 4XUGA 2KX9A 4LB3A 5AC6A 3VD4A 1VC4A 1JQXA 3CZ8A 3H4WA 1XH2A 3NQCA 1AJ0A 1REQA 4B9YA 3THUA 4BA0A 4GINA 2XSXA 1V6UA 3H26A 3NTYA 2VDIA 3WLMA 2BMBA 4IFOA 4JTIA 2EQDA 7TAAA 4YJ5A 1J11A 3V4BA 4M8UA 2OGJA 4E2BA 5KINA 1R3WA 2Y24A 1FCQA 1YTDA 3QV8A 2JF7A 1OFEA 4LU0A 1EDTA 1ZPTA 1PHWA 2YIHA 3BOXA 3ZT7A 3WDRA 1GQLA 2NV2A 3CQHA 1H50A 5EMLA 4JR5A 4L56A 4XK2A 4JTHA 4U4MA 1KBIA 1GOMA 2PDLA 1TRDA 4LVDA 3II1A 4DUVA 3GHSA 3MUCA 4Q8UA 3CHFA 3LGEA 4H9MA 1P7TA 1Q7QA 2KZHA 1OY0A 4RDZA 3TWBA 3B40A 1TPC1 3WLLA 3UXAA 1RHCA 5HAOA 4E0CA 1XKYA 4UTLA 1K70A 4MUZA 1OCBA 1GZGA 4L80A 4B5WA 1DORA 3ITCA 4EF9A 1F7BA 3BMWA 3O0FA 3TN4A 2CETA 4JTUA 1XFBA 4NHVA 3KOXA 3EKGA 2Z1KA 2HBVA 1YDNA 3LCLA 3LPOA 3W1TA 5IRPA 5A94A 3EB4A 1YNPA 3NO1A 2J78A 4AD3A 2I9EA 4UQ9A 4Q8WA 4BCEA 3PPCA 2ZDSA 4R27A 3VNMA 3CPRA 4HOZA 2CXGA 1EP1A 2GGJA 2O4MA 4Q4KA 4XUYA 3MV11 1IYXA 3SW6A 3ATZA 3DHPA 4YVPA 3Q58A 2OXNA 2FTPA 3DG7A 2WHLA 2A3CA 5I3DA 4E2OA 4ZGYA 3ITLA 3ABQA 1BFNA 2GOKA 1ZJAA 2ANUA 1DEDA 3KE0A 1UKPA 4LEFA 5D2XA 1EX5A 1T0OA 3T2PA 1B3VA 2CLLA 3NQ6A 3UR2A 2ZVIA 1AH0A 3WQ8A 1UWTA 1DOSA 2RGLA 3USBA 1E6QM 1A5AA 5A8NA 3GR8A 1FHLA 2ATSA 2GQ8A 3P82A 1ZBWA 2QCLA 3SRKA 5IBXC 1A3WA 4QGCA 5FSDC 3W7OA 4ACYA 1US2A 5DBUA 5DEZA 5KZMA 3AIVA 1XIIA 1D2KA 3IRDA 4LC6A 1UR4A 3CLMA 1AVAA 4GA8A 2PUZA 3WBWA 5G4WA 3WDHA 4IIEA 3ZOAA 1XIFA 3N19B 4GO9A 5CPMA 4W7UA 1K7FA 1FX6A 4CN4A 5G4EA 5ECUA 2QEZA 3BMXA 3QTPA 2NVDA 1BF6A 1D8CA 1TX2A 4XG1A 1LQAA 1EZWA 3SGZA 1HUVA 2X0YA 3AIBA 3NQVA 2MNRA 4WOQA 4M6VA 1FBAA 1VKFA 4ZQPA 1RH9A 2LLEA 4LV4A 3STPA 2DW6A 3B9EA 3BC9A 2D20A 3RR4A 1KW1A 3HGRA 2DGAA 1PYFA 1UOKA 3UCDA 1RA5A 3GK0A 1GHRA 2DH3A 3BGJA 4BI7A 2AKMA 2Z27A 3PPFA 3L4UA 2Y8KA 4RZ5A 5K3VA 3G1VA 4DNMA 3HN3A 1TVPA 5PTDA 4F0HA 1ME9A 1X8CA 4IL0A 3BV4A 5J5DA 1GVIA 3N34A 3NM1A 3LNPA 3VZZA 3WBEA 4Z2HA 1AMKA 3ZLFA 3HPSA 1F4AA 2GUYA 1QOXA 3PAOA 4F2UA 4B3KA 3SGGA 1BEUA 4N9BA 3RLUA 2RH9A 5CJ5A 4JTEA 4GI8A 4LUSB 4FZIA 4HIBA 1PBGA 3EZ4A 1KV5A 2UY2A 5DMMA 1E0XA 1W8GA 1S3TC 1G4TA 3SCTA 3KCOA 3WCZA 1Q2SA 2YW3A 2QLYA 4CD4A 4MHBA 4DBSA 2ESCA 1QCWA 2J75A 2OYKA 3LA4A 2VMFA 3NNTA 4ZENA 4QEEA 4GJIA 4D6GA 4W93A 1FWHC 3U8GA 5HMFA 4WHBA 1I0DA 4HPGA 4N42A