4OV9A

Structure of isopropylmalate synthase binding with alpha-isopropylmalate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
385
structure length
380
Chain Sequence
PKTIHIQDVTLRDGNQALKRPWTIDEKIEVFDLLVELNVDGIEVGFPSSNETEFHTCQVLSKRAPKGKPIAALSRANQNEIAVTWEAIQKADCPRMHIVYPVSDFSIKHVLKISEKEVLQKIRNSISFARSIVGPGIEIQFSGEHFGDAIENFAFTKEAFLTAIEAGANIINLPNTVERYRPMVFVNMVKEIKDVVKDKAIISIHTHNDLGMATATSVESVYVGAEQIEVALNGLGERAGNTNLYETAIALHQNGENLNINFQRIYPTAKRISELTGIPIGEKTPIIGEDIFSHRSGIHQTLHQSKGAYRTFSPEFVGRMDKETISFTNQSGHKAIEFLLHQRGIQVSKEGIHHLFSLAKSISSRENNREITEAELVALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords isopropylmalate synthase
publication title Subdomain II of alpha-isopropylmalate synthase is essential for activity: inferring a mechanism of feedback inhibition.
pubmed doi rcsb
source organism Leptospira biflexa
molecule tags Transferase
total genus 144
structure length 380
sequence length 385
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ov9A01
4GNJA 1SFJA 3GNNA 1GT8A 3A5FA 3P81A 1OFQA 1N8FA 2Y7DA 2QAPA 1SW7A 2Y7FA 4LS1A 3NM3A 3QW3A 3M5XA 4HIBA 3P8JA 3W7CA 5FEPA 4O4WA 3CIXA 3W2LA 2E68A 1I2OA 1T8XA 1RR2A 4O54A 4LC8A 3KAOA 3TROA 5F2MA 1YYAA 1FCBA 2CFFA 2EHHA 2JKPA 3TAKA 1S5TA 1R2RA 3BW3A 2CLIA 2YYTA 1VC4A 5LKYA 2Y7EA 4ORMA 3HBLA 2ZRXA 4KFOA 1AK5A 5BRBA 3ATZA 3G8EA 2NXGA 5DY2A 2B7QA 4M7SA 4X3ZA 4FNSA 4IXHA 4L4LA 1UJPA 2RDUA 4RKAA 3HPXA 1GOXA 2OX1A 4U4MA 3NPVA 4Q4KA 2Y62A 2A5HA 2CW6A 3UWQA 1KM6A 1GYNA 3M44A 2G97A 1XFBA 3O16A 4NJJA 3DFSA 4QISA 4UFMA 4ZZ9A 3HQ1A 1ZFJA 3R13A 1HG3A 2CZDA 4FNRA 4MYAA 5K4ZA 1UB3A 2ZTJA 3NQGA 3W76A 4QQ3A 3LRLA 5EPDA 5D04C 2GUUA 4MKNA 1H60A 1IXPA 1WV2A 1YXDA 1KTBA 3HIJA 5MHBA 5AC6A 4AEOA 1LROA 2B7OA 1TV8A 5D37A 2OJPA 2VOMA 4M5PA 1B4KA 3LXBA 4DEFA 4IPJA 2JKAA 1QO2A 5C2XA 2HS6A 4JIPA 3VE7A 2RH9A 2X2GA 3B04A 3N14A 3R5EA 4NZJA 3L65A 4TR9A 5H2ZA 1O95A 4C1KA 1JCLA 3GDKA 2H8XA 4Y6GA 5SWUA 2QCNA 3CC1A 1OJXA 1L2UA 5HUOA 4MJMA 3T78A 4K7VA 1W56A 3M5YA 1FCUA 3G0XA 3BG3A 3BLIA 3G8RA 2DZTA 5KMYA 2ZRVA 5D2XA 3LI1A 3RU6A 4OU1A 4UFLA 4ALDA 2QCFA 4BWLA 2J6XA 1XI3A 3NA8A 4UC5A 2VEPA 1QFEA 3NGJA 3PSWA 1XC4A 3LHZA 5HULA 2ZCGA 1EP2A 1K02A 4AWUA 3TV8A 5KITA 1PVNA 2BWGA 4LUIA 4K6AA 2W0UA 1ALDA 3W7DA 3SZ8A 3W70A 4AWTA 2HSAA 1RV8A 2QCCA 3DU0A 4AHPA 3QF0A 2G95A 4X22A 4FHAA 3NM1A 5KTLA 3OIXA 4DO5A 1W5OA 1UCWA 3M9YA 1K7XA 1SR9A 3UY8A 1SSGA 1GWJA 2JBMA 4TX9A 4PTNA 2Z1BA 1KLYA 3THQA 3E02A 3W1PA 1F5ZA 1F6KA 2A7NA 2FB2A 1W37A 3IIVA 3PUDA 1P5BA 2W6RA 1KM4A 2QCEA 4UTKA 4E2DA 3O6YX 4FNQA 3B0PA 1F74A 1IXOA 4GUIA 3T7VA 3W2MA 1KFEA 2GQAA 5CZJA 1QNVA 3O8AA 1QMLA 1XM3A 1WDWA 1PV8A 4GBUA 3GXNA 1YDOA 1PHWA 5BW6A 3UPWA 1TPH1 3WJZA 5CZTA 2O7SA 3LOTA 4A2SA 2WNQA 3C2RA 3QM3A 2OMAA 3GAYA 4O4VA 2ABAA 4R34A 2NWSA 3BG9A 3AJXA 2H3BA 3W1TA 3LHVA 6ALDA 2ZZ1A 2J9ZA 4Q33A 3ATYA 4JGDA 5EA9A 1RQHA 4DELA 3P61A 4FX7A 1K7EA 3HMJG 2A1YA 2QJIA 2H8ZA 2Y63A 3RNDA 5D03A 4NX5A 2O7QA 4JTFA 5AHLA 3DGRA 3EKLA 3BPWA 4WX2A 4WUIA 4CNOA 4FX8A 1YDNA 3B03A 3EX6A 3ZFHA 1AW5A 3CM4A 2OZ0A 2I1OA 2DZWA 1ONRA 1IXQA 3L5LA 1FWSA 4M6VA 2NXIA 4WY0A 3WJYA 1I2QA 2QCGA 1V5XA 1QDSA 3GNDA 1VYSX 5FF4A 4HNNA 5AN7A 3C61A 3UZ5A 4JTSA 1KFKA 1TTPA 2QF7A 3LV6A 3G1AA 3GR7A 4IQLA 2GJNA 1JCJA 2YZRA 3S0CA 1QOQA 1D3GA 3NQ8A 1TPC1 2CLEA 5J5DA 1YXYA 1WX0A 3EWUA 2HMCA 3C8FA 3O07A 3R2GA 5FESA 1SZGA 2CWNA 3LCIA 1U5JA 3DHFA 1W3IA 4FX6M 3TDFA 5U4NA 1FX6A 3I7SA 5DXYA 2DP3A 4FXSA 4N02A 4M7TA 2AAMA 2ISVA 1ZNNA 3O05A 1PE1A 3DKJA 2HTMA 4A2RA 2CLKA 4GUJA 1TB3A 3EWZA 1WXJA 4UNKA 3IVTA 2BLEA 1NVMA 3INPA 1BWLA 3GKFA 3BVJA 1H1YA 5K7JA 4P2VA 4C1LA 5K9CA 3PB2A 4NX0A 3EWWA 2ZRYA 3U8GA 4UFIA 2WSYA 3KFTA 3MWAA 4H3DA 1NAL1 5D38A 3WK2A 3MHFA 4AHQA 1XUZA 3C2VA 3F03K 1JUKA 3B4UA 4NT0A 5LHFA 4A22A 4MJZA 2ABBA 1Q6LA 1X8FA 4ML9A 4JTTA 5C6MA 4RR4A 4O57A 3QSRA 4MUZA 2PRLA 3TW6A 3ZWTA 5E1QA 4XTDA 1NF0A 3NR0A 4NUWA 4LRSA 3VFLA 5AHNA 1VHNA 2E6YA 2V0TA 1TSIA 3LHYA 1NF7A 1TCDA 4ORIA 1M7PA 4Z0JA 2JK2A 1FCVA 4AVFA 3KVMA 1UASA 1RD5A 1TREA 4I7UA 1QO5A 1W5MA 1JCXA 3LRKA 3M0ZA 4CCEA 3KHJA 3ABRA 4U28A 1H7OA 5HWMA 2ISSA 3USBA 4UTMA 4UTTA 1OX4B 2XN1A 3W7NA 3G22A 1HO4A 4WZHA 1KFJA 4GC4A 1AG1O 3MYPA 2NV2A 4M6PA 1KFBA 1F05A 3ZR4A 2RDTA 3UZJA 2VFGA 3W7EA 3H53A 3HGJA 4AF0A 4WOZA 4OE7A 5DBUA 3NPXA 3ABOA 1JQVA 1MZHA 2H3DA 1C9DA 1ZENA 1MEIA 2WV8A 4CQ9A 1CW2A 2TRSA 3EXSA 1WAUA 3G24A 4JX6A 1TV5A 3IGXA 5AYYA 3NPWA 3D0CA 2DJXA 2FQIA 3QFEA 1DVJA 1WQ5A 3W83A 3I6RA 3MO7A 5D02A 2YYUA 4ONVA 3QMTA 3IVSA 4LNYA 4DF0A 5G4EA 3S9YA 1SW3A 3LCLA 4O50A 3A9IA 1T96A 5HWJA 4GJ1A 4LVAA 2NXHA 5K4XA 2GPTA 4CNPA 1ICQA 1L9WA 2QEZA 1DJQA 2A6LA 4XQ6A 4IXXA 3LCGA 2Y61A 4JTEA 2AQWA 3L68A 4JR5A 5LNUA 1L6YA 1ZAJA 1GEQA 1SO4A 2YPIA 5D2TA 4XWUA 2RDWA 1B57A 2TYSA 3WK0A 2NX1A 3G0UA 3NDOA 4JYDA 3T55A 1CX9A 1DL3A 1G4TA 1KFCA 3W2KA 3MHGA 3HG4A 2BTMA 3TMLA 2WSQA 4O53A 3W7JA 5DXXA 4LT9A 5CPOA 4NJIA 1RZMA 2QUVA 3W1UA 4FNPA 4JNMA 4IMGA 2ISWA 4HPXA 5AYXA 1LOLA 4UR7A 1KTCA 2QCDA 1GPWA 2X1RA 2NUXA 3FOKA 1Z42A 5HUPA 4UTHA 1ME9A 3GVGA 3HJZA 4Y9AA 1TPB1 2RHGA 1I45A 5EY5A 3SJ3A 3MBDA 2E5CA 4O19A 1LLWA 4QNWA 2DZVA 3HG3A 4TO8A 5FF7A 5IBXA 1TTIA 3OVPA 3KOFA 4P61A 3EXTA 3NAVA 4LOCA 3UWUA 3NL5A 3HF3A 3IGUA 5D2WA 4UFJA 5BMWA 3NQFA 5D09A 2QKFA 4I7VA 3SFKA 1SW0A 3TC6A 3G18A 4UTWA 4A3UA 2V9DA 2CZ5A 4PEKA 3WJXA 2Y89A 1TIMA 3GDRA 1QPQA 3S5NA 4DPQA 4M6QA 4DPPA 4DO6A 2BSLA 2TMDA 1OFDA 4AMAA 3W6YA 1E51A 3DENA 4Y96A 1XBYA 3DXIA 3PY2A 4IMFA 4FNUA 1DQXA 4DBDA 1W54A 1KW1A 2B7PA 4BI7A 4EOUA 4IPIA 3TW7A 4WJEA 1QWGA 5A8GA 2G96A 3MHUA 4FEZA 4JX4A 5FEXA 3STCA 1KFLA 5T26A 2E6FA 3LRMA 4KWWA 3L0KA 4MZ1A 3TQKA 1EWDA 2YW3A 3ABQA 1WBJA 1H7WA 1DQWA 1U83A 1KM5A 2FLIA 1O5XA 4NXKA 3CTLA 2ZZ6A 1W5NA 4PC8A 1W5QA 1PHQA 2OCZA 2GVJA 4A29A 2A0NA 3TSDA 2B4GA 3PB0A 4K38A 3M5ZA 4YCOA 5U7SA 3NQMA 2VELA 3W7KA 4QAIA 3P8IA 1EX5A 4TMCA 3V1PA 3PBWA 5TBOA 4GRSA 1VPXA 4TMBA 1A50A 4HKPA 4KFPA 2CLLA 3TX9A 3TNOA 3WJSA 3UPBA 1Z41A 2ZZ7A 4PFMA 4HHPA 3UQNA 3C52A 1JQXA 2FB3A 4R53A 3MUXA 3WFAA 5H91A 2A4AA 3M43A 3LXCA 3GZ3A 4HPJA 1TPDA 3S5ZA 1TTQA 3B8DA 3E9AA 4O10A 3W22A 4N4PA 2V2DA 3IIZA 4MYXA 1DKWA 1AMKA 1OYCA 2E6DA 5EBUA 4KFNA 5D2VA 3LCFA 3FJ6A 4NQ1A 3EEGA 4LV4A 1FXPA 2Q8LA 1D3HA 3LHTA 4RZ5A 1AL7A 4Y8FA 1GVOA 5FI8A 3KX6A 2JGQA 5AHEA 3Q2DA 3STEA 4BF9A 2P0OA 3WJWA 8TIMA 4JEQA 1TMHA 1IXNA 2FIQA 2QCLA 3EWBX 2PRHA 3DAQA 4Z1DA 4RCXA 2WQPA 5BNKA 4XKYA 4AWSA 3W87A 3GYEA 1XXXA 2X30A 4JTIA 3W71A 3PS7A 5G5IA 3G1YA 4G1KA 1JVNA 3W7QA 2EAWA 2BXVA 1F2JA 4JDYA 5I3FA 2HS8A 4GXMA 4GFSA 4DO4A 4N9EA 2WPBA 4MFDA 3F4WA 1OVDA 5G1TA 1L6SA 1GTEA 3LI0A 3FFSA 3NZRA 2ATSA 3PBVA 4W9TA 2VFIA 3FKRA 3THAA 3HO8A 1SSDA 1G6CA 3CU2A 5DY3A 3W9ZA 2B0MA 5FF0A 2ZFAA 1TPUA 3GK0A 4BR1A 1IIHA 1KM3A 3W7HA 4TIMA 3LHWA 2LLEA 2GVLA 4JIQA 2E5BA 1DV7A 3N9RA 4E2BA 5E0KA 1FDZA 3AO0A 4LW7A 1JRBA 3CEUA 1OFBA 2X1SA 1ZAIA 4OWGA 2ZZ4A 4HNUA 3W1QA 1L6WA 3GDMA 3TSBA 3O06A 4JXCA 3IIPA 3W2JA 1EPXA 1VRDA 3NQ7A 4QNEA 4JN6A 1OK6A 3W1LA 4JY9A 1OFPA 4KWVA 3HGOA 2FPVA 1SFLA 3C2OA 1MXSA 3FYOA 1WOAA 1DJNA 2WNZA 3QZEA 3W1AA 4HSOA 2VEIA 3DFPA 3EWXA 2C3ZA 4UCGA 4CQAA 3M5VA 4S2CA 3W7PA 1GVQA 4UFKA 1OX5A 1P4CA 1SZFA 3VE9A 4BK9A 3M1ZA 4Z1BA 3E49A 1MEHA 3KRUA 5HJLA 1W3TA 3TE9A 4HSNA 2VKZG 4OV9A 5I3GA 3MI2A 4WY0B 4QSHA 3CLMA 3PF3A 1YADA 3G3MA 3B0UX 3QPZA 3M6YA 3PUEA 5CZSA 3NQEA 1Q3NA 2C13A 4O52A 2Y6ZA 5LZLA 2GVGA 3DBPA 1ZJIA 3BG5A 3HG2A 3N73A 1R46A 4CQ8A 2ZA3A 4Z0SA 5D32A 1G69A 2VC6A 2NX3A 4ICNA 2J9XA 1W3NA 2YR1A 3M7WA 4ADTA 1FWNA 3VNDA 4IX0A 1KBIA 3LERA 3PSVA 3QC3A 4JYFA 2ZYFA 5L9FA 4K8HA 4ZMGA 3SGUA 3QQ0A 3N19B 1SZNA 4AXKA 4IX2A 3TMQA 1H61A 3ZWSA 2ATMA 1LOQA 4M19A 1GVFA 3N34A 4UNLA 1X6UA 3R89A 3RFAA 4GWEA 3C0JA 3HPZA 1I2RA 4RZ4A 4QITA 3W7MA 1TTJA 3T4CA 1VLIA 2QCMA 1LDCA 4IJBA 4LV9A 4O13A 1XDMA 2C19A 3GXTA 4RXFA 3KXQA 4RJEA 1XUUA 3LX9A 2KZHA 2J27A 3TA6A 3N9SA 1T0OA 4RK8A 5DELA 3G1SA 3TFXA 1TJRA 1F73A 4UFHA 2DZPA 1K7FA 4MY9A 3G1DA 2NZLA 4O1CA 1EWEA 4O8RA 2D73A 1OHLA 3BGJA 1QCWA 3CWOX 3OBKA 2F7FA 3RLUA 3JRKA 5LNWA 4K8EA 3NL2A 3TIMA 5F4XA 1TPVA 3OHIA 1PL9A 4OGZA 2Y88A 3CPRA 3FIGA 1OK4A 4QJ1A 2EKCA 3NZ1A 2DZUA 2OT0A 1ML1A 1OF8A 1W8SA 3QYQA 1GG0A 1H50A 4HN4A 2C18A 3O6DA 3MP5A 3LB0A 3TR2A 3TXVA 1F7BA 3DFOA 3GXPA 5L6UA 1GG1A 3TK7A 1SZEA 3CHVA 3QMRA 4JTGA 2CLMA 1TJPA 4JYEA 1YDVA 5I3JA 2GQ9A 1UUOA 3LTPA 4H6KA 3TCEA 4JY8A 3M41A 2C0AA 3W7RA 1G7UA 3DKLA 4WXZA 1G4PA 3H54A 4TU1A 3BO9A 4QIUA 1QPOA 1X1ZA 3LBCA 1RVGA 3NOEA 4NNBA 3BGGA 3PUOA 4EF8A 5I3HA 4DBEA 5EMUA 1I4NA 1VCFA 5HINA 4MPQA 3PR2A 1LRTA 4EWND 2VFFA 1RPXA 4JS3A 1SO6A 1EP3A 4R33A 1YTDA 2RKXA 2ZBTA 1XL9A 4LVGA 4MLJA 4AF0B 3N2XA 4JTLA 2ZZ5A 3DFQA 2Z2UA 1N7KA 4I9AA 3C4UA 3NQ2A 1YLVA 4YMZA 5AOUA 3W74A 3P62A 3SGZA 3KVLA 2VEMA 3CQ0A 2YXGA 3W72A 1RQEA 4E0CA 1DBTA 3L2IA 1GZGA 1I2NA 4Z08A 5HMSA 3O15A 5AC8A 3MI3A 3S8HA 1O4UA 3LLFA 4NNAA 1P1XA 4GUHA 4NNCA 4B5NA 3KRSA 2CLFA 1FY6A 4PL1A 1NFBA 2H6RA 5C55A 3TC7A 4ZQNA 2RFGA 1OFOA 1W1ZA 4EF9A 4O28A 1JCYA 1AL8A 3BV4A 3NL6A 2ZQ0A 3W23A 2PURA 2V5LA 1TO3A 2WNNA 4POCA 3IIOA 4OV4A 5DCEA 3LM7A 3P80A 5CKSA 4YLWA 3S5YA 1VR6A 4UIOA 1QPNA 1T99A 2WO5A 1KV8A 5LNVA 3EB2A 1F76A 1GQNA 1B4EA 1K03A 5DLCA 4N4QA 4DF2A 2ZA1A 3NQCA 1FQ0A 1XBXA 3IV3A 2E1DA 2PC4A 1QAPA 3I68A 5LSMA 2GJLA 5CGQA 1B9BA 1VZWA 4ZQCA 4K39A 3W2NA 1ZCOA 5DBTA 5DCBA 3W85A 3NQVA 3TKFA 4PCFA 4ZQOA 3QW4B 5HNRA 4IMDA 5FF3A 2A85A 3GIYA 2I9EA 4O14A 4H4IA 4XBKA 2DJLA 1VYRA 2Y70A 3NXFA 4UTUA 1EA0A 2CLOA 2NUWA 1BWKA 3HOJA 1PCKA 2X1TA 2QCDB 2NUYA 1WYIA 5GVJA 1SO3A 4JTKA 4WD0A 2P1FA 2WSRA 3W1XA 4UMBA 1N55A 3A21A 5F2IA 1A5BA 2V5BA 1GYLA 2H90A 3A23A 4NVTA 4MY1A 3DFNA 2YFNA 3DZ1A 4S2BA 3MBFA 2NX9A 3I7RA 5BOOA 4NZFA 3L67A 4ZQMA 2FDSA 1P0KA 3UNDA 3GAKA 1YPFA 2YFOA 4QM1A 1JR1A 3LTYA 1H62A 1A5AA 1QPRA 3GKAA 1OG0A 1ZALA 4NXSA 4O15A 3UD6A 4GE8A 5CSRA 4RX0A 1F6PA 1GTHA 1LP6A 4UTLA 4GUGA 1A5CA 3MMTA 5DN1A 1PIIA 4HNVA 1I2PA 4JTUA 1FWTA 2A2IA 3LCHA 1YTEA 4XZ9A 3CT7A 3NQDA 1MEWA 3F4NA 1VYPX 3PWAA 4N6FA 4KKXA 3U6WA 3C2EA 3BW4A 1W5PA 3I65A 2DZXA 3OVRA 4LVFA 2Z0IA 3CEPA 1VS1A 1AW1A 1R47A 4O1DA 3P84A 4MVAA 4RXGA 1JULA 3S6DA 4CNNA 5I3KA 2A7RA 4K7YA 2JGYA 1GVSA 4AB4A 4N2YA 2QUTA 1G4EA 2YX0A 3MP4A 3PAJA 3UWZA 1DOSA 2ZRWA 3A24A 1OF6A 3N3MA 3LLDA 3QMSA 5CPMA 3YPIA 1THFD 4XBSA 3SW6A 2X16A 3LCWA 1SU5A 3TXZA 2QR6A 3WK3A 1JUEA 4YCPA 3S1XA 4BFAA 1FBAA 1UBSA 1SQ7A 4LY8A 1EP1A 5E93A 3LGEA 3OEXA 3PVFA 4K36A 3U2OA 2GQ8A 3B06A 3E12A 1H63A 4CCCA 4WXYA 2FPTA 1M5WA 2F84A 3SSJA 2ZZ3A 1HL2A 3BK0A 3EX2A 5CPNA 5EKYA 2Q8ZA 1KBJA 2A7PA 5D2YA 5HR6A 3NQAA 4PODA 3SR7A 3P5ZA 4I7WA 3LCXA 5LNRA 1G7VA 3QH2A 4PL2A 1C29A 1G67A 3DHDA 4RZ6A 4ADSA 1LZOA 4UR8A 3DI0A 7TIMA 1HUVA 5K9XA 1EUNA 3EX1A 5J5RA 3FJLA 4UXDA 3LXAA 3S5OA 3UXAA 2V30A 1H7PA 4HT3A 3BW2A 5F4WA 4MIMA 3W1NA 3RF9A 3V75A 2R14A 5HQEA 3W3OA 1KV5A 2C16A 3L5AA 3M47A 3VCRA 1YTKA 3PM6A 2DU2A 1TRIA 1LLZA 2XN2A 3HG5A 3B0VC 1R2SA 2WOQA 4BWLC 4N6EA 1Z44A 4E38A 1LYXA 1GVRA 3UY7A 1OFEA 4WQ6A 1AW2A 3KVJA 2J24A 2CZFA 1TRDA 5AYZA 5CZ0A 4ZVJA 1KM0A 2A6NA 3W2UA 2QAFA 1O94A 1SUXA 3PG8A 4LU0A 3FLUA 4LWWA 4XKYB 1FUYA 4WY0F 1TQXA 4FIRA 4ZL1A 4J9JA 1OX6A 2ZZ2A 6TIMA 3MYOA 1LRNA 1ME7A 1FWRA 3E96A 4N9CA 3TQVA 4MFEA 3SY5A 4JX5A 4IWWA 1MO0A 4O1AA 2XFWA 3ANYA 2QCHA 3NL3A 3QPYA 3EX4A 3L9CA 1Q6RA 3G1HA 1TPEA 3A5VA 4ZQPA 4GUFA 3T40A 2P10A 1LBMA 5F2GA 2XN0A 3MI6A 3PULA 2Z6JA 3C6CA 3UWYA 4O12A 2J9YA 3MJYA 3S42A 1ADOA 4Z1AA 1VGAA 3NVTA 5ABTA 1VH7A 3P82A 1Z48A 3P7YA 1VJIA 4CLMA 5LHEA 1O60A 2V2CA 3K30A 3L0GA 4WOQA 1FCQA 1XBVA 2Q3RA 3G0SA 5TIMA 1LCOA 3OVQA 4MOZA 2VFHA 3DI1A 3W07A 3F1QA 1VQTA 5AHFA 1WOBA 1Q6QA 2EF9A 1S5WA 1EUAA 3IVUA 3HGRA 2ALDA 1BTMA 4CCDA 2PRMA 3PC0A 3FYPA 1DHPA 1IGSA 4DF1A 5LGZA 3R8RA 4IOTA 2VFDA 3UWWA 2NLIA 1X7FA 2TSYA 1LRQA 3T44A 2PCQA 2YGYA 3NPUA 4LS2A 5FEWA 4EVZA 2C14A 4IMEA 2ZRUA 1CI1A 3DFTA 4FB7A 5D30A 4ZQRA 4N9DA 4FIQA 1K8XA 1LM1A 4UMAA 3CB8A 3RMJA 3RK8A 1EIXA 2EGZA 5F1UA 1FDJA 5F2LA 3G1XA 3STFA 1GJPA 1VCVA 5C54A 2YSWA 3P60A 2E09A 3NNTA 3W86A 3TJLA 2V2HA 3N2MA 3HB9A 2Y7GA 2DORA 4O16A 4O18A 1VLWA 1KM1A 1J4EA 3NQ6A 3ABSA 1K8ZA 3GX9A 5DCDA 5FF2A 3LHUA 2PE4A 2I14A 5I3IA 4JDBA 1LBFA 1J5TA 1X1OA 3KRZA 1FDYA 2X1UA 3L66A 4OQVA 4MZ8A 4PA8A 1TPWA 2V82A 3PBUA 2CU0A 1FXQA 3TJXA 2UV8G 1ICSA 4O17A 4AHOA 4A21A 1OABA 4AH7A 5K2ZA 3W75A 1JCMP 3W73A 3NO5A 5LGXA 2BZNA 1BKSA 4BI6A 4OBTA 4K37A 1H7RA 1YPIA 3C3NA 2C15A 4IUOA 2WJZA 1EEPA 2J88A 3C2FA 4NJKA 4DQWA 3TSMA 4OT7A 3KVKA 4PH6A 4UTIA 4HNTA 1XKYA 3PBYA 4EIVA 3TU9A 1I8JA 2Z6IA 1W31A 2V81A 4FXRA 5EYWA 1Q45A 4Z1CA 4UTTC 3BLFA 3LV5A 5G2HA 3JS3A 4LRTA 3OG3A 2IQTA 1H7NA 1M6JA 3IEBA 4LVBA 1KM2A 3GDTA 1D9EA 1OYAA 3Q58A 1WA3A 3MW7A 1LORA 2VENA 2FJKA 1DORA 5D05A 5TQLA 5D33A 3CIWA 3S1WA 1LTDA 3LDVA 1IIGA 3C56A 1H5YA 1PCWA 3EX3A 4ADUA 1Y0EA 1EB3A 4O0ZA 4YWIA 1H7XA 1TPFA 4YXGA 3FKKA 1HO1A 1UUMA 1J2WA 3A22A 4L4MA 4MY8A 3SECA 4X9SA 2W79A 3SIZA 1NSJA 2EPHA 3G3DA 5G2IA 2V8ZA 3FEMA 1RQBA 4LS0A 4XUGA 3WK1A 1VHCA 2VEKA 2ZDRA 1M7OA 1SPQA 3NEVA 5K3VA 3UWVA 1JUBA 5K9DA 1W0MA 5HWNA 1TV7A 3QQ1A 3Q37A 5KSWA 4JICA 1R30A 5KINA 4NJHA 4N9BA 1A53A 2OT1A 1HFBA 1K3UA 5LNSA 2YDAA 4O0KA 2B7NA 4LC6A 1KA9F 3O1NA 2QUUA 4R7JA 1MSSA 3QEZA 1OX4A 3TH6A 3GB6A 4AAJA 3S1UA 4X2RA 4LUJA 3STGA 5AC7A 3L21A 3OA3A 2AGKA 2Q3OA 4UTJA 3EKZA 1TYGA 1BEUA 5KZEA 4XTIA 2Y85A 3NG3A 3W1RA 3W88A 2BX7A 5KZDA 3E0IA 3W84A 2E5DA 4FF7A 3B05A 1XCFA 5CG7A 4O11A 3ELFA 1PS9A 3W1MA 4JTHA 5G2WA 3NYZA 2NV1A 3IRDA 1KTNA 2WKJA 1ICPA 3QSTA 4Y90A 1A5SA 2QDGA 5IBXC 3TAOA 4OHQA 3CWNA 2CZEA 5CSSA 3EWYA 3O63A 3RLVA 1ZY9A 2QDHA 5F4SA 2FPYA 2JKEA 1B3OA 3TFCA 4RV8A 2C1HA 1TQJA 1C8VA 4RLIA 3VI2A 2VXNA 2QJHA 1OFRA 3FS2A 5G1YA 1ZHAA 4UTWC 3BLEA 3O6CA 5AHIA 5BMXA 1VCGA 4LVDA 3G1FA 3GDLA 2YW4A 3PG9A 1QR7A 3BARA 2TPSA 3R12A 2E6AA 5AHMA 5EL1A 2QJGA 4IMCA 3W7OA 1S3HA 3S1VA 2DZSA 4O1BA 1H51A 3ZS4A 2ZRZA 1SO5A 4NU7A 5AB3A 5AFDA 3W7LA 2CLHA 3FA5A 4JTJA 5G4WA 3IIXA 3P67A 1NEYA 1IF2A 3IGSA 4NJGA 1YXCA 2VFEA 2ZTKA 4S1FA 1ZAHA 3UYCA 3W7IA 4JD4A 3MP3A 5CPLA 3EXRA 1ME8A 3HPSA 2R91A 4UUIA 2C6QA 1QOPA 1JCNA 1R2TA 3LTSA 2FTPA 3L5MA 4D2JA 1WBHA 1K8YA 1V7YA 3SI9A 2NWRA 2YCEA 5HR7A 4DXVA 3QRHA 3JR2A 1XDLA 2GOUA 2ZA2A 2R8WA 1JJKA 5C5YA 1S5VA 4YL2A 1JRCA 3W7GA 2A21A 2E77A 4UMCA 1FWWA 3P5YA 1H1ZA 4BI5A 3M16A 3LBMA 5KZMA 2FFCA 1LOSA 3GR8A 1O5KA 4FNTA 4IGHA 1XBZA 1LBLA 1KLZA 5FEZA 3L0NA 4LTSA 2R94A 1Q6OA 2G5WA 3P74A 3I7QA 3G1VA 3QJAA 3HGSA 3GLCA 3UXDA 3TUUA 1OFAA 4MLRA 4Q32A 3DH7A 3VKJA 3Q94A 1OYBA 4MZYA 1HTIA 3H55A 5F1VA 3TQ0A 5A5WA 5IM51 1G4SA 1P0NA 4FO4A
chains in the Genus database with same CATH superfamily
4RE4A 4L5ZA 3P81A 4XAPA 5E9XA 5CGTA 2PTYA 2QAPA 1PTDA 3QW3A 1UWQA 3P8JA 3W7CA 1IHIA 3AROA 1XICA 2X1IA 4IISA 1RR2A 2EPMX 2R1KA 3TROA 5F2MA 3T8QA 2Q09A 1LJYA 3BE7A 2XDFA 3CMFA 3TAKA 4TTUA 1QNOA 1EJTC 2YYTA 1JZ4A 1VC4A 2BHYA 3ZT6A 5BRBA 1DPMA 3AXMA 5CPSA 5DY2A 2GDQA 4X3ZA 4IXHA 4L4LA 3PZGA 5H8PA 1GOXA 1W9VA 2OX1A 3UP8A 1JNEA 4Q4KA 2INZA 1XX1A 2F61A 2VUNA 4U2ZA 3GD6A 3RN6A 1XFBA 2GFTA 4QISA 3OYZA 5J8LA 1EFZA 4FLQA 4MYAA 3WQ4A 3CV2A 2DQXA 3RPDA 4QQ3A 2ZIDA 1OCNA 5D04C 3C86A 3VIIA 1WV2A 1KTBA 3NTYA 3THDA 1CNVA 3KP0A 2OJPA 3GTNA 3LXBA 4I5RA 3W6LA 3CUXA 5C2XA 2HS6A 4JIPA 4N7QA 3N29A 2X2GA 4WKHA 3N14A 4V1XA 3H22A 4NZJA 3TZFA 4GY1A 3KL5A 3AU2A 3GDKA 3WX7A 3ZR6A 1OJXA 4ROPA 5FSDC 1B3YA 1KQZA 3M5YA 1FCUA 3KOWA 4QLKA 1V8EA 5FKYA 4MB4A 4FA3A 4MB1A 2XZ7A 5KMYA 2A79A 2HE8A 4GZIA 3LI1A 3L4WA 3OLDA 4ALDA 3WQ5A 1FWHC 4W8AA 1XC4A 3LHZA 4KQNA 4KEVA 4PMRA 5IXEA 2E8YA 3TV8A 2BWGA 4HHMA 2W0UA 1ALDA 4AWTA 1TMQA 2J79A 2HSAA 2QCCA 3DU0A 3APTA 4FHAA 1EBGA 1J0ZA 3M9YA 5A8QA 3LZ3A 5GPRA 2OU4A 3VNKA 4DI8A 4H9ZA 2QYGA 4JL2A 1YRRA 3PUDA 1V3KA 5C9RA 3PZ9A 3O6YX 4KEZA 1KFEA 1UQYA 5CZJA 1QMLA 4TUFA 2FHCA 1LT8A 1WDWA 1PV8A 4GBUA 1H3GA 1YDOA 5CXPA 1TPH1 4F40A 3LOTA 1H49A 2Z1VA 3BG9A 3SN4A 3W1TA 5FCZA 1MWOA 2J9ZA 4Q33A 3ATYA 5EA9A 2MNRA 1RQHA 2PFHA 3HMJG 3VTRA 2QJIA 2GGJA 2GJPA 2WPGA 5D03A 5AHLA 4P7QA 4WX2A 4CNOA 4U3AA 1A5KC 3SCVA 1RBOB 5BXPA 1AW5A 2YL8A 1EHNA 2OZ0A 4P7LA 3TN4A 1W1PA 2VDHA 2AQOA 2CKRA 1BXBA 1UR4A 1V5XA 3ICJA 3QHOA 3MUIA 2PP3A 4MWAE 2J66A 1J11A 3RILA 2FYMA 5C70A 5AYBA 4PMJA 4QS6A 1JPDX 3SUUA 1XLBA 4ASTA 1TVPA 1EL3A 3AWNA 1KFKA 3LV6A 2Y5SA 1JCJA 1X6LA 4B5TA 3MSGA 3EWUA 3PZQA 1SZGA 1VFSA 5A6BA 3DHFA 1FX6A 1PEZA 4XD4A 1AJ2A 4N02A 4LY4A 4M7TA 2AAMA 4EXQA 3O05A 1UD3A 1HN1A 1GGOA 2CLKA 3LYEA 1DTUA 1VBHA 1E0TA 3SCPA 1TB3A 4F66A 1WXJA 4UNKA 2BLEA 1BWLA 4V1YA 5I23A 5C0QA 3ORWA 4DJDD 2DDXA 4ENLA 1NH6A 3EA1A 4UFIA 5EMKA 3WK2A 3UERA 2WVVA 1UR9A 3F03K 1CGTA 4NT0A 3BMWA 2ABBA 1V0MA 1Q6LA 2FMOA 3RXZA 5C6MA 3R4IA 1XR2A 4RR4A 5B7YA 4UQ9A 2PRLA 4Q4PA 3ZWTA 2NQ9A 2XFFA 3U57A 3UJEA 1NF0A 3EDKA 3NR0A 5KETA 3VFLA 4LRSA 3WL0A 3H7UA 1UROA 1UD6A 3II1A 4JNZA 2D3NA 1RA5A 2Z7GA 1TSIA 3VGHA 1TCDA 2IPWA 3GTFA 2W66A 1HF6A 2XH4A 3OQEA 4LALA 4R3UA 3V5CA 3LRKA 5I09A 3DHUA 1XWYA 1H7OA 5HWMA 1B9ZA 4X61A 3G22A 1N8IA 4WZHA 1AG1O 1HJVA 1RXOB 3ZR4A 3AMLA 3GXMA 4H9TA 3E2SA 1HKKA 1HKWA 5A6LA 2QGHA 2AL2A 1JQVA 3MDUA 4ZFCA 1W3JA 2OX4A 1C9DA 2XIIA 4W8BA 4ERAA 1SFSA 3PPFA 1S2AA 4O0QA 4O1EA 4B9ZA 4IGNA 4MGGA 3W83A 3I6RA 1XGDA 3VOFA 4F79A 3V18A 3WQCA 3TOYA 1QXLA 3IVSA 6TAAA 1BGAA 4DF0A 1QK2A 5G4EA 1SW3A 4O50A 2V3EA 4Q6XA 3TTQA 1IEXA 5HWJA 3B9AA 3RAOA 4GJ1A 5FJJA 4S3EA 4J2MA 4QS5A 1VBUA 1DJQA 1GHRA 1AZ1A 1V0LA 2A6LA 3GO2A 5CQ1A 4PCNA 1TVNA 1OZMA 3K1GA 1D7KA 3T81A 4YTRA 4PGLA 1UP3A 4JR5A 3A12A 5LNUA 1YNQA 4WSKA 4HN8A 5D2TA 1YHTA 3WK0A 2NX1A 1GJUA 1KFCA 4WJ8A 4LX4A 3HMCA 1H5VA 3HG4A 4GJIA 3KOYA 4F9DA 1CXFA 2WSQA 4O53A 3EDDA 1PX4A 4PULA 2O9OA 1CBGA 5FJTA 4L80A 4X9YA 4QQUA 4J3WA 4LT9A 5CPOA 4CEXC 1RZMA 1GEHA 2QUVA 4JNMA 4IMGA 2PAJA 5AYXA 4H9VA 4L6DA 1JZ5A 3ANVA 1TPB1 2PGEA 3SJ3A 3MBDA 4XZBA 2CLPA 4AEFA 1W91A 2DZVA 1E4LA 1I1XA 1ZCCA 3NAVA 1DJWA 4YWSA 3AS0A 2XINA 1Y5VA 3SQMA 4BQ5A 4UFJA 5BMWA 3RPTA 3NQFA 5D09A 2QKFA 2OWWA 4IPPA 4FOJA 3ME3A 3TC6A 2WMIB 3BCJA 3OIHA 1X98A 2V9DA 2CZ5A 4PEKA 3WLQA 1FKXA 1FOBA 1J0KA 3SGGA 4DPQA 3CQHA 2BSLA 4S3DA 3GS6A 1A49A 5A6SA 1UA7A 4HMCA 3VIJA 4IFKB 3ID7A 4Q4RA 2X0SA 4IMFA 2J6VA 5HPOA 4HYWA 1W54A 1KW1A 5CSUA 1W8GA 1MUCA 1ZPTA 3TW7A 5A8GA 1T7LA 3MHUA 3WLHA 1IR1A 2IXUA 4HZ7A 3A4JA 4KWWA 3MANA 4B92A 1YE4A 1EWDA 3VKDA 2EPKX 3FXGA 4Q4QA 1JGMA 1U5VA 5LA1A 3PZOA 3WH7A 1WBJA 3WEZA 2DT3A 1O5XA 4PTWA 4WR3A 4I5XA 4NXKA 2ZZ6A 4PUKA 4PC8A 3OU8A 3TSDA 3SAZA 1QTWA 2CYGA 4X2PA 3PB0A 2UY3A 3URBA 4NAFA 2IPFA 1EX5A 3P8IA 1C92A 4TMCA 5C9WA 3WD0A 1VPXA 1A50A 3IACA 3TX9A 3TNOA 1E1CA 7CGTA 4PB4A 1J10A 4D6GA 3ITYA 1JQXA 4R53A 3WFAA 1WXYA 2JF7A 1MRQA 2GQ3A 1TPDA 4Q3MA 3VIHA 4BF5A 3GXFA 1K9EA 3LPGA 2X0YA 1AMKA 2CHRA 3GNPA 3FJ6A 3LCFA 1GQLA 4LV4A 1FXPA 1TJ1A 3WNOA 3VDCA 3ISIX 3GW3A 4Y8FA 4AQLA 4PMDA 2DGAA 3Q2DA 4D6EA 3VCCA 4Z2KA 1E0XA 4BF9A 2DIJA 2VGBA 1TMHA 1IXNA 3RITA 3B40A 3UNTA 1UIOA 1NM9A 1ZLPA 4Z1DA 4RCXA 1J6OA 3VZYA 5BNKA 4WDTA 7ENLA 3JU2A 1K1DA 3KBWA 2IPJA 3VDBA 1GVIA 3GYEA 3W4RA 4IJCA 1QNSA 1XPGA 4K3ZA 3G1YA 3ITXA 4RL3A 1JVNA 2EAWA 2BXVA 5GNYA 1F2JA 1S2VA 1PUDA 2FZDA 5FJUA 3AC0A 3EGJA 1EQCA 4GXMA 1Q65A 4UBPC 4UQEA 1TZ9A 2WYSA 1OVDA 5G1TA 1GTEA 3LI0A 3FFSA 3NZRA 2QNEA 4LCQA 5DX7A 4I6VA 1SSDA 4HQVA 5DT7A 3CU2A 3W9ZA 3DX5A 1WDSA 2WCGA 1IIHA 3N12A 3OODA 3RJXA 2LLEA 4GX9A 2WZIA 4B91A 2ANUA 5E0KA 1H4PA 4E4PA 1JRBA 4X60A 5EMJA 1S46A 3M0VA 4OWGA 5M17A 4HNUA 5JXQA 1L6WA 1F3EA 4JXCA 4LCSA 3NQ7A 4QNEA 2J7EA 3SCUA 2D2OA 4JY9A 1OFPA 1GKRA 3KBSA 3H4XA 2ZX6A 2XVKA 4F2BA 1WOAA 3QGKC 3KZSA 1DJNA 3QZEA 4LUSB 4H6RA 3DFPA 4K1GA 1E9YB 3B8TA 4QXIA 2DFAA 4JKLA 4CQAA 3W7PA 2G3MA 1P4CA 4QE5A 4LAKA 2Q6ZA 5DFAA 2FFIA 3VE9A 3B4YA 4QBXA 2D0GA 4YTTA 1YADA 1KXVA 3NQEA 3R7MA 1Q3NA 1YBQB 4O52A 4PTXA 1ECQA 2WZTA 3DBPA 4F0HA 3ECQA 1ONWA 1EPVA 2CBVA 3BCDA 1G69A 5HDRA 2POZA 2J9XA 2FHBA 1W3NA 3BAKA 3VNDA 3PSVA 3QC3A 4JYFA 2G0WA 3B8IA 2HV5A 3SGUA 1L8PA 3N19B 4AXKA 3VUPA 2WXDM 3D3FA 1AA1B 1S1PA 1V03A 3AHXA 4M19A 3M0XA 4UNLA 3PN8A 3W7MA 4KWSA 5HANA 4IJBA 4LV9A 4O13A 2C19A 3GXTA 2Z1WA 2EPOA 4V28A 1XUUA 2J27A 3TA6A 3N9SA 1IV8A 4RK8A 1A4LA 3TFXA 1F73A 3VOGA 2Y4SA 2CBIA 1MI3A 4DVOA 3CUZA 3KM8A 3LS9A 4ECLA 3CWOX 1NWTA 4HD5A 1KRMA 2F7FA 3RLUA 3JRKA 5LNWA 4K8EA 3NL2A 2OEMA 4JIRA 3QY7A 5F4XA 3VNJA 1TPVA 3FW6A 3KWXA 3VPLA 3TLQA 2WC4A 3MV11 4QEHA 1OK4A 2V67A 2VX5A 4KEMA 4E4UA 1W8SA 3O6DA 3TR2A 3WLOA 5I07A 4REQB 3TK7A 3KTCA 2ZE3A 6REQA 4GHRA 4H9MA 5BRQA 3POHA 4RE2A 2HXTA 1Q2SA 4H6KA 3A13A 3W7RA 2A3AA 3ZLHA 5LXEA 5A2BA 1ISYA 3DKLA 1NQKA 3CAWA 4WXZA 3FDGA 4C6PA 3OVGA 4WCJA 4F2TA 1MZRA 3NDZA 1RVKA 1QPOA 3LBCA 3BGGA 2WC7A 3FJNA 4P8WA 5EMUA 2KAUC 1EJXC 1VCFA 1OC6A 5A94A 5I0DA 1E4MM 5HINA 4DJDC 4M82A 2PCEA 1KR1A 1RPXA 1YTDA 1OBAA 2NVCA 2XZ9A 1TKKA 4LVGA 4MLJA 4DWSB 3N2XA 4HCDA 2ZX5A 1XSIA 3HJEA 3QLDA 2VT0A 3WQWA 4MM1A 1XC6A 2YXGA 5BCAA 3ITTA 1MW1A 4Z08A 4DAIA 3O15A 3MI3A 3NOYA 4KRUA 4K8GA 4GUHA 4BQ2A 4ICCX 5C55A 1XLGA 3WEMA 4ROQA 1AH4A 1AL8A 3BV4A 4JQ2A 1SJAA 3VILA 5DCEA 1E73M 3VM7A 2YCIX 1ESWA 4UIOA 1QPNA 4JIIX 1TZ7A 2I5GA 2MUCA 1S5NA 4JTCA 2D0HA 1B4EA 1K03A 3DYPA 1EO5A 3IV3A 4MNKA 3EDJA 3LEPA 1CLKA 1AODA 3I68A 5FJPA 2WM1A 4KRTA 3UCQA 1B9BA 1VZWA 4K39A 1ZCOA 3BLLA 4JEJA 2ZX8A 3H2EA 4V15A 1NFGA 3TKFA 4PCFA 1OEPA 5HNRA 1D8CA 3U48A 4O14A 4XBKA 5A6AA 1UC4A 3CUJA 5ECVA 3AXXA 3TCSA 1RCXB 4C6MA 4UTFA 3PZIA 5F2IA 1WAWA 4TXEA 2VDIA 2V5BA 1KGUA 4NVTA 4DJFA 4X0VA 4MY1A 2R24A 1V3MA 3DG3A 1BQGA 2PDJA 1EIBA 4UOQA 1XRSA 1KB3A 2NQZA 3GAKA 2YFOA 3W28A 4QM1A 1EJVC 3N13A 3WQVA 4D6FA 2YIHA 3WDPP 3GKAA 1ZALA 3OHMB 4GE8A 3OG2A 4RX0A 1LP6A 2VWSA 5CC5A 4UTLA 4GUGA 2BFGA 4G7FA 2QXWA 1PIIA 4HNVA 1I2PA 4JTUA 1BKHA 3TYBA 1Q7ZA 2A2IA 3Q65A 3P3BA 2FZBA 1YTEA 2PDXA 1MEWA 3F4NA 3NO1A 1V0KA 2PP0A 3ARWA 5IHRA 1M9HA 1A5UA 1X97A 3I65A 4YTQA 3ZJ6A 4LVFA 1NP0A 5BRPA 3AISA 3S6DA 3MV01 2JGYA 1GVSA 4AB4A 4N2YA 2QUTA 3W38A 3UXKA 3EMZA 1OF6A 3N3MA 4GABA 4MUPA 2AKMA 3QMSA 2W67A 1XIMA 3SW6A 3BDKA 4Y2WA 1SU5A 3ERPA 3QKEA 4A3HA 4LY8A 3MPGA 5EU9A 3KBMA 8XIMA 4C7DA 1XIGA 2OO6A 4U33A 5IOBA 1BYBA 3SJNA 4CCCA 3ES7A 4CQDA 3SO7A 2FPTA 2J78A 1OIFA 1S1RA 4ZOBA 3SSJA 4HOWA 3W02A 3WFLA 5I3DA 5CPNA 4PMYA 1KBJA 1Y7VA 2BY1A 5HR6A 3NQAA 4PODA 4LH8A 3SR7A 1CGUA 3N3TA 3LCXA 4GD0A 3QH2A 1E6SM 3KE0A 4PL2A 3UR2A 1ISWA 5A2CA 1GHSA 3T05A 3C8NA 5J5RA 4UXDA 3S5OA 4IMAA 5LA2A 1H7PA 4ZOAA 4HT3A 2FKPA 3UETA 4C6BA 5HQEA 2C16A 1ODZA 2CEQA 2I56A 1OG6A 3VCRA 3RO8A 1CDGA 2J75A 1TRIA 2XN2A 1NDWA 1R2SA 4UQAA 1Z44A 3D5HA 3LM3A 4KW2A 4GYJA 2EJAA 3PWIA 4S3KA 1LL6A 1PZ2A 3NZPA 4HA0A 5CZ0A 4GI4A 4BQ4A 2AMXA 2QAFA 1M41A 3BOLA 1FUYA 1XLJA 2QPUA 4QGCA 1TQXA 4FIRA 3KDOA 2J7CA 4MHBA 2OFJA 4Q4MA 6TIMA 3AIRA 1TX0A 1US0A 3E96A 1OD8A 4Q6JA 3AS2A 1V6XA 4MAZA 4L1GA 3AZRA 4IQEA 4C5YA 2GL5A 1G1YA 3O0KA 4X0NA 5C7VA 1Q6RA 4XX6A 3N2TA 1KRAC 5HJYA 3A5VA 4HJWA 3LN3A 2OSYA 2VGIA 2YDQA 1LBMA 3IRSA 1EYEA 5M03A 1WCGA 1UMYA 2Z6JA 4S3FA 3GG8A 4DBUA 3OA5A 2UWFA 3S42A 2WVUA 3KTSA 4E2VA 4Z1AA 1VGAA 4GI8A 5J04A 1KXQA 1VH7A 3PWGA 4QG8A 4BCEA 3DERA 3HM7A 3VD4A 3CYJA 1XBVA 2F6UA 1DIOA 2W91A 4DZHA 5DF0A 1V3IA 1PIFA 1HJWA 3DI1A 3W07A 3F1QA 1ZZMA 2W5FA 3VA8A 2P0IA 3GE7A 3M6DA 1M04A 3O6AA 3WDQA 3DUGA 2ALDA 1E0WA 4JHZA 4HU0A 4INFA 5BU6A 1ZP3A 3GU2A 3CV6A 2WW5A 4CN6A 1R3QA 4ERIA 2EG7A 3UWWA 2EEXA 1X7FA 2VZTA 1LRQA 2NLYA 4ZA0A 1Z89A 4EVZA 4W5ZA 1CI1A 2JQXA 3DFTA 3TW9A 1JYNA 3FA3A 4ZQRA 4CD4A 3QR3A 2Z1SA 4C6NA 1EIXA 2EGZA 1FDJA 5F2LA 3G1XA 4ZO7A 1VCVA 2YL9A 4J3VA 4LAOA 3W86A 3H2AA 1YNYA 1J5SA 3GNXA 1TX2A 1VLWA 1K8ZA 2PC8A 1EJRC 1P0DA 4FOUA 3P14A 4UCFA 4Q8TA 3O2LA 4ZSTA 3GC4A 1QI5A 3W6MA 1Q4WA 1X96A 1UD5A 3TQPA 1KCXA 1VBJA 1CPUA 4BS0A 4A21A 3NGFA 5K2ZA 1F3XA 1E5NA 5LGXA 3I10A 4BI6A 2FVMA 3WH6A 3LD5A 4AMCA 1E9ZB 4MWAB 4IUOA 2WJZA 2R1MA 2WBKA 3UGRA 3WUFA 3C2FA 3SSZA 2YL5A 1C9WA 1XQKA 3KVKA 3T1GA 3WD1A 4EIVA 1EC8A 1YDYA 5E5CA 4Y8EA 1I8JA 3EOLA 4QFUA 1RP9A 1G94A 3N2BA 4HBKA 5G2HA 2WNWA 3JS3A 3PHAA 3IJ8A 1M6JA 4LVBA 1BPLB 2XFYA 1DIKA 2WLYA 3Q58A 1Z9AA 1SYTA 5TQLA 2UY2A 1O1ZA 3G5EA 4KCUA 1LTDA 1XD0A 1IIGA 3C56A 2PWVA 3VMOA 1PCWA 4B5VA 2PSNA 4KERA 2QF8A 3CH9A 4J3SA 1FHLA 4NZ1A 1H7XA 4HPGA 4YXGA 3AIEA 1J2WA 4L4MA 3B9NA 5C71A 5LIUX 1RCOB 3RO6A 2BVDA 4ZCWA 2XSXA 3SIZA 2EPHA 4AD3A 3CQIA 4FS9A 3M0IA 5GJMA 1KRBC 1W3HA 2VEKA 3N04A 4HZMA 1M7OA 3NEVA 4PMOA 3MSDA 2BG5A 3LNMA 5AY7A 5K9DA 1U33A 5HWNA 3PJWA 4DJFD 3Q37A 5HJXA 3WNKA 4A8RA 1R30A 3H7RA 4NJHA 3M0YA 1E3ZA 3IJ7A 1T5AA 4IQDA 3ZQ9A 3JVAA 1ENUA 2G8ZA 2YDAA 4O0KA 4C6OA 2DSUA 1PB0A 3DDMA 1KA9F 5A69A 3D46A 4R7JA 1JL8A 1P6BA 2PDLA 4LUJA 3STGA 1UP0A 4GFIA 3L21A 1UHVA 1TYGA 1XIFA 4D9PA 2OB3A 3CO8A 5KZEA 4ZOEA 1PX3A 4HK5A 3NG3A 5JH1A 1KD0A 4LYPA 2VURA 2E5DA 4W84A 3B05A 4HMEA 3EWDA 3A3WA 1JIBA 5CG7A 2NQLA 5G2WA 3PPGA 3MJMA 2YXXA 1S39A 2ZC1A 2CERA 3MVTA 2DUAA 4TV6A 4W86A 1RLCL 2E0PA 3U7VA 1A5SA 2HK1A 4FLRA 2DW7A 4H04A 1V3JA 3I4KA 4Y9PA 3CWNA 3SUSA 3W00A 3EWYA 1N2VA 3LU2A 3KBVA 1ZY9A 3WD2A 1JF6A 5F4SA 2NV9A 1YX1A 4H6EA 2C1HA 1TQJA 3T0BA 1U22A 3VI2A 3WLSA 2PD5A 3IUHA 4HHLA 1XCXA 4PMVA 1ZHAA 2HEJA 2D0FA 1KBKA 2WMFA 3B8SA 2RAGA 1PSCA 4HTYA 4LVDA 1EBHA 3GDLA 2YW4A 3SUVA 2PDHA 3BARA 2TPSA 2QJGA 4CVWA 3S2LA 3B0XA 2DZSA 1SO5A 4NU7A 3W7LA 3FA5A 4HTBA 1PYFA 1TWWA 3MCNA 3IGSA 1J79A 2VFEA 4HP5A 1ZAHA 5E9AA 3PJUA 3MUY1 3W7IA 2XGZA 4H7ZA 2C6QA 2VRKA 1QOPA 2V3FA 1R2TA 1XYCA 3TTEA 2VC9A 4RDWA 1ZRQA 4H7VA 3SI9A 3R10A 4GXPA 2WCSA 3E3HA 3S2CA 2R8WA 1S5VA 4YL2A 1JRCA 3GHRA 5DMLA 4GQRA 1POKA 1FWWA 2BGQA 4HA1A 4A05A 2C91A 3M16A 7XIMA 2WMIA 5KZMA 5CBBA 3TTSA 1LOSA 1O5KA 4IGHA 1E43A 3HPFA 3IAPA 3GVRA 1LBLA 2X42A 1N82A 3S2JA 3I7QA 3GH7A 3VD3A 2XGIA 2C7FA 1EJSC 3GLCA 4IFKA 3DH7A 2AGTA 4MZYA 1M65A 2AQVA 2PDBA 4R7WA 1EXBA 3UT0A 4WLCA 4F0SA 1P0NA 8A3HA 3UCCA 3BGAA 3T2OA 1GT8A 3A5FA 3TWBA 1UIPA 2EBNA 1N8FA 2Y7DA 2QW5A 4I6KA 2Y7FA 4LS1A 3NM3A 3M5XA 3O0FA 5FEPA 4O4WA 3ZYZA 3BANA 1IR2A 1PKYA 1YYAA 4B3ZA 5KEZA 3GHUA 4DBSA 1Q7MA 1S5TA 1XPYA 2C1IA 4KCTA 2VCBA 3R94A 2VC7A 1GJWA 3KP1A 5LKYA 3VX0A 4ORMA 3HBLA 1AK5A 4GZ7A 3ATZA 3G8EA 2NXGA 5EMLA 3WQGA 3WD3A 4JTRA 3WDIA 3WEOA 4GCAA 3RCYA 2YCJA 1DTNA 3NPVA 3THUA 4I8YA 2CW6A 3M44A 2ESCA 2G97A 4IQJA 3O16A 4NJJA 3HQ1A 4XZWA 1ZFJA 3VNZA 3FYYA 2CZDA 3QFWA 5G1MA 5IFTA 4FNRA 2OGJA 4A8IA 1KKOA 4E8GA 5K4ZA 5I78A 1DWFM 1UOKA 3LRLA 4H41A 1U2YA 2RGMA 3SM0A 1H60A 4RW5A 2B7OA 4IP7A 1X1NA 1JAEA 3R8GA 4M5PA 1B4KA 1L8NA 3WNMA 4DEFA 4QAWA 4LAMA 2JKAA 1QO2A 4RW3A 3NQBA 3TONA 4MNLA 3R5EA 4TR9A 1R3VA 1O95A 4C1KA 5JIWA 4NZ5A 4ZSUA 4NYUA 3CC1A 3T78A 1XLAA 1DXIA 3G0XA 3PZVA 4AC1X 6A3HA 1YKWA 3BLIA 3HZ3A 3KLKA 1LL7A 5D2XA 4PUUA 3AHZA 4GQBA 1V6WA 4OU1A 4LAZA 3V0SA 4MB5A 3EPOA 3NA8A 1XI3A 3PSWA 3U2EA 3QV8A 2ZCGA 1EP2A 4AWUA 5KITA 3ZT5A 1Q2RA 4K6AA 4AISA 3SZ8A 2PU0A 4WJXA 1EJ7L 1TV4A 1V51A 4AHPA 4ZO6A 2W4XA 2OKOA 2G95A 2OWXA 1UCWA 3GNRA 4GKLA 1GWJA 2JBMA 4TX9A 4PTNA 3H24A 3VIKA 3CYVA 1KLYA 2L5HA 4GLEA 4CU6A 2SFPA 1W37A 1WO2A 2VTFA 2QVNA 2W6RA 2QCEA 4E2DA 4CU7A 1F74A 4GUIA 3GWQA 3O8AA 3TTOA 1SJDA 4AZ6A 3ITLA 1W1A1 2QPSA 1EOMA 4NZ3A 5BW6A 2G50A 1HJUA 5CZTA 4A2SA 3C2RA 1MNSA 3GAYA 2WBGA 2HCVA 1XV8A 2W3ZA 1XP3A 3LHVA 2ZZ1A 4JGDA 4PB5A 3HN3A 4LUSA 2H8ZA 2Y63A 5XINA 2G3JA 4R9XA 3BPWA 4FX8A 1LG2A 3B03A 3EX6A 2PZNA 1Y5XA 3CAQA 3FA4A 3TP4A 3MKKA 2I1OA 3CTTA 2F8QA 1ONRA 1OCQA 3LUTA 3GTIA 3B3DA 2QIWA 3ZR5A 1VYSX 1YBQA 1SVDA 5AN7A 3QXBA 1F9CA 2Q01A 4IGSA 4S23A 1JDFA 3C61A 2WJFA 4B2DA 3FAWA 3LQGA 1HJXA 2QF7A 4IJRA 5FL1A 2B81A 3G1AA 2GJNA 1UUQA 3GG1A 3WZ0E 1YXYA 4P7NA 3VUSA 4LFYA 2FTYA 3O07A 2D69A 4B3LA 1QBBA 1KCKA 1T40A 1U5JA 1W3IA 2X7WA 2XIJA 3KBNA 4FXSA 4L4OA 1PE1A 4A2RA 4GUJA 4UQCA 1UKPA 1UW9A 1FWJC 3INPA 3PAOA 3BVJA 1H1YA 2OR2A 3MTWA 1MXGA 4P2VA 4P5UA 2ASHA 3EWWA 3U8GA 2WSYA 3KFTA 1NAL1 1VENA 4GZEA 3F4DA 3WLKX 1WPCA 4AC7C 5LHFA 4A22A 2PODA 4MJZA 2XYLA 5JBDA 3QSRA 1V6UA 4S3GA 3TEVA 2G37A 3OZPA 3V3WA 4JTDA 2PDQA 3UJFA 1OGSA 1US3A 4NUWA 3XISA 4REQA 1M53A 3SCSA 5A1AA 4Q8NA 3LHYA 1M7PA 2BGNE 2JK2A 1FCVA 4AVFA 1UASA 1RD5A 1XIEA 4I7UA 1PZ3A 2PWHA 3CJPA 3TYCA 1EC9A 1DJGA 3ABRA 2VR5A 2ISSA 4UTMA 2YXOA 5EMYA 3S83A 2C1GA 4DYKA 4W7WA 2ZX7A 2Z1KA 1HO4A 3AZSA 1KFJA 4M6PA 3VZXA 3GBDA 1YNPA 3HGJA 4GQ0A 4WOZA 1E6NA 4DWSA 3QLLA 4LB4A 4DM2A 4HU8A 5DBUA 4Q8MA 1DWHM 3NDYA 4GISA 2H3DA 5HA7A 3AOFA 2XGBA 2ACQA 3RDKA 1QHPA 3WLMA 5LIWX 3UG8A 2TRSA 1XLDA 1TV5A 5AYYA 3D0CA 1P7TB 1FHDA 5BU9A 4L61A 4DJFC 4QR6A 3CAKA 1FA2A 3BJSA 3QMTA 4GJJA 2I17A 2R1NA 4NI8A 3QY6A 3SEPA 1EOKA 3S9YA 2GJRA 2XIMA 1T96A 3VD7A 1WB0A 4LVAA 5FJOA 1V7AA 3QOKA 4MSSA 2GPTA 1L9WA 1UZDA 1XG4A 4HNCA 1KR0A 3LCGA 2G41A 1K9DA 4JTEA 2AQWA 3MKVA 4E2OA 1EGZA 4F8XA 3CWHA 3LGDA 3ABXA 3IK2A 1XD1A 1UKQA 3G6MA 3G0UA 3T55A 5DMNA 2DH3A 5JBFA 1BVNP 4AX7A 3W7JA 1W9XA 1F8IA 3MQTA 5DXXA 4NJIA 3SCNA 3HPAA 2I5IA 4CNSA 4XIAA 3IJQA 3FOKA 1S2TA 4UTHA 1NJJA 1TG7A 3HJZA 1RPKA 1I45A 2VOTA 5EY5A 2W92A 3CK5A 2E5CA 5D9OA 3VIMA 4ZXOA 2WMGA 4QNWA 3HG3A 3KEHA 3UESA 5FF7A 1TTIA 3KOFA 4P61A 4GQQA 1UWRA 1R38A 3S47A 4IGMA 3S6OA 3UWUA 3NL5A 3IGUA 1V6VA 2VZVA 1UPPA 3HFYA 3GRIA 4YU1A 1K9TA 2YLLA 1JCTA 3KOZA 2HK0A 2F2KA 3GDRA 1P43A 2WC3A 4M6QA 3R79A 4H19A 4AMAA 3WDJA 1W32A 1E51A 3DENA 2V3GA 3GZAA 4Y96A 1XBYA 3CPGA 3BMVA 3DXIA 3WQFA 4FNUA 1DQXA 1LT7A 4DBDA 1R9XA 5EB8A 2B7PA 3QBUA 4CUCA 4WJEA 2VGFA 2WMKA 4FEZA 4Y9MA 3ARQA 3RIKA 5FEXA 3STCA 3E2QA 1KFLA 2QLYA 1A0EA 3W81A 4Q8WA 1H2JA 4L7ZA 3HV8A 4OECA 1U83A 4WRHA 1KM5A 3FV9A 1I75A 3CZJA 3L4YA 3CTLA 4H01A 3D6NA 3EA2A 2GVJA 4A29A 3HQOA 4K38A 1QRQA 3CB3A 4QAIA 5AECA 3NJ3A 3PBWA 2J13A 5TBOA 4GRSA 1WDPA 2OXNA 2R82A 4TMBA 5LA0A 1IQ8A 3WJSA 3UPBA 2ZZ7A 2PDKA 4S38A 1XW8A 3UQNA 1NU5A 2FB3A 4I5UA 3MUXA 1JF5A 4AVNA 3EOEA 5H91A 5HATA 3WUBA 4MDPA 4Q8PA 2A4AA 3POCA 3LXCA 4G56A 4HPJA 5B7ZA 3S5ZA 1TTQA 3B8DA 3CT2A 3E9AA 1ZB5A 4O10A 3W22A 2EPLX 4N4PA 2V2DA 3R0DA 2E6DA 4LNCA 5D2VA 5EBUA 5REQB 3K8KA 4AVOA 2OSXA 4RZBA 2A3LA 3LHTA 1Q6GA 3N9KA 3KX6A 5AHEA 2VD8A 4JN7A 3QN3A 2JEPA 2P0OA 3WJWA 4AZHA 3QYSA 3DYOA 1RAKA 4FK9A 3W87A 2OZTA 1HQTA 4AZGA 3PS7A 2BDQA 1CLVA 2QUMA 4G1KA 3W7QA 1QUMA 4MF4A 3WQ6A 5DQPA 4GACA 1QATA 4JIHA 4JDYA 3IUDA 5I3FA 2Z7KA 4HZ8A 4GFSA 3R11A 2ZVIA 4DO4A 2OGYA 4IP4A 3ZOAA 3LSBA 2HROA 1R3YA 1WDDA 1OWQA 4DUVA 1PPIA 4EPDC 3THAA 3HO8A 1H41A 2B0MA 2ISFA 2EG6A 1TPUA 1XIJA 3VNYA 1V08A 3H21A 3W7HA 4YVXA 5CC3A 4AD0A 3OO2A 3OZYA 3LSCA 3KCLA 4GYKA 3BC9A 1FDZA 3H6OA 4LW7A 1ZAIA 4Q8VA 1BFNA 3DFHA 1WUFA 2IKGA 3GDMA 3O06A 3IIPA 3PFRA 1VRDA 4JN6A 1JFXA 3CH0A 3HGOA 2J8GA 1GKPA 1TJ2A 1MXSA 4GIYA 3FYOA 1JNDA 2WNZA 4R7OA 3W1AA 4HSOA 2VEIA 3EWXA 2C3ZA 3LZ5A 4RNJA 3BV7A 4S2CA 1XLFA 2PTWA 1W9DM 4GK8A 3M1ZA 4Z1BA 1MEHA 3KRUA 5HJLA 1DIEA 1R86A 3T07A 4OV9A 5I3GA 1T8QA 3MI2A 4S3BA 4QSHA 3OLEA 3QPZA 3M6YA 3S4TA 3PUEA 5E09A 4WSHA 2GSJA 1A0DA 3TYAA 3HG2A 3N73A 2WLZA 4CQ8A 2VC6A 3IWPA 1CZ1A 2NX3A 4ACYA 4P8XA 3NYDA 1VB9A 2YR1A 3HQPA 3WQOA 3WQPA 3SIMA 4K8HA 3QQ0A 1SZNA 4IX2A 3TMQA 2Y1HA 3AYVA 1LOQA 1ONXA 4CN1A 1P0BA 1GVFA 3N34A 1PO9A 2OWCA 4S3JA 1FH9A 2OVLA 4IUGA 3C0JA 4M6UA 3GVWA 4W88A 4P7RA 4QITA 3T4CA 3C0SA 2QCMA 3BH4A 1XDMA 4RXFA 2CWXA 3KXQA 4RJEA 2ZXBA 4MWAA 3AJ7A 6ENLA 1L6FA 2V5JA 4AZCB 5M5DA 1Z32X 5JUVA 1F4AA 3BJTA 2ZADA 2DZPA 1J9YA 4MY9A 3G1DA 3QHNA 4ML4A 2NZLA 4O1CA 3NSXA 2D73A 4DNHA 1QCWA 2EO7A 3RRAA 2EG8A 3OBKA 1Z69A 2VEFA 3HFTA 1TV3A 2PDGA 1DJYA 1DEDA 2Y8VA 5H6HA 5HAOA 4D8AA 1V77A 2VP8A 1A5LC 1UPMB 3G77A 4QJ1A 3NZ1A 1BG4A 2OT0A 4D8ZA 3PUGA 1ML1A 1NELA 5TNVA 2OSWA 3L4TA 1H50A 3TXVA 3SADA 3T6CA 5FOOA 3CLWA 3SB0A 5CEWA 2ODOA 4PZVA 1SZEA 3QMRA 1U1HA 2CLMA 1TJPA 2VCAA 5I3JA 2GQ9A 3LTPA 1AFSA 4PUWA 1GORA 1Q5MA 2C0AA 1DWGM 4HB7A 2ZUVA 1G4PA 1KRCC 1X1ZA 1CLXA 4EF8A 3BMXA 3G2GA 2PI6A 6CGTA 2VWTA 1UR2A 2V5CA 1EP3A 4R33A 3WN6A 2RKXA 1D8WA 1TWIA 4DXKA 2ZBTA 4QDMA 2ZZ5A 5I02A 1N7KA 3ZLFA 4YMZA 3W74A 3B9OA 1XCWA 2VEMA 3W72A 3L2IA 2D2HA 4QEEA 5AC8A 3W0KA 3A4WA 3FK4A 2CLFA 2W63A 1FY6A 1NFBA 4ZQNA 2BHUA 1WKFA 4PYSA 2XH7A 5I79A 2POTA 3GM8A 4JHMA 3E5PA 1XGZA 3KL3A 2YBTA 4QDPA 3NL6A 2ZQ0A 5BXTA 3FHQA 4TTGA 3ZJ7A 3WMLA 3I3BA 4POCA 3IIOA 3P80A 3WLRA 1T99A 5LNVA 4AG0A 1QI0A 3PPHA 4HSHA 1BSIA 1GQNA 1JZ7A 5DLCA 4N4QA 2ZA1A 1FQ0A 2HISA 1XBXA 4WKFA 4LB3A 3CGTA 4NHVA 5JU6A 2E1DA 2PC4A 3IARA 2PDWA 3U2ZA 1B3XA 2FHFA 1HXJA 4DHGA 2GGEA 3RPMA 2WKGA 2XVPA 1O1HA 3W85A 3IAQA 4GXWA 4JZ5A 4JOMA 4YTUA 2GUBA 2REQB 3QW4B 4EAYA 4IMDA 5FF3A 1A5NC 2DJLA 1XS2A 2GYIA 1DYSA 1E0UA 3GFXA 4Z42C 1VYRA 4EE9A 1U30A 1EA0A 3JUGA 1BWKA 3FVDA 1PCKA 2QCDB 4QLLA 1WYIA 5GVJA 1SO3A 1YE6A 1YIXA 4JTKA 4BF7A 1KNWA 4W8LA 5BYWA 4B5XA 4FSAA 4DY1A 3V0TA 3DZ1A 1XLIA 3MBFA 4QHRA 3BAWA 4NZ4A 1P0KA 2ZC8A 2WANA 5LIKX 1ODUA 5M1TA 5CC7A 3CXOA 3UCDA 1EDQA 1F6PA 3PZMA 3N2OA 2DY3A 2ZWYA 1VF8A 3UZYA 3DEQA 1R7AA 3MCOA 1XLHA 2D1ZA 1JAKA 3LCHA 3NQDA 3AZTA 3GXIA 4N6FA 1H11A 3U6WA 3BW4A 1W5PA 4H7CA 3AXKA 3WDRA 5T9CE 3CEPA 1UH2A 1VS1A 3P84A 3AXIA 4KIEA 1JULA 2A7RA 4K7YA 2WZMA 4PR4A 1G5AA 1G4EA 3UWZA 1DOSA 4LYQA 2HNHA 3YPIA 3ARSA 2HVMA 3RR1A 3VNIA 3LCWA 3GFYA 3PTDA 3TXZA 3NCOA 3VKBA 2VD9A 1Q6DA 2GVYA 1SQ7A 1EP1A 1R3TA 3PVFA 3EMCA 1HGWA 3B06A 4GH3A 4R27A 4PMQA 1E9IA 2F84A 4LYKA 2NT0A 1DJZA 5EKYA 2A7PA 1FWFC 3WLLA 1J0YA 1MFUA 4WIWA 1Q4NX 7TAAA 3P5ZA 3U5UA 3RM9A 1G7VA 3WMBA 2DPEA 4OIFA 1LZOA 2NVAA 4B16A 1EUNA 3ARZA 1SMAA 1M7JA 2H9AB 5C8BB 3UXAA 2V30A 4PBFA 4KESA 1B30A 4MB3A 5RUBA 3W1NA 4H8UA 2A3HA 3V75A 4QRNA 3KTXA 2FGLA 1W2VA 3L5AA 3V5FA 3PM6A 2DU2A 4P7OA 2WOQA 1R7OA 2D20A 1REQB 4JFUA 1RY0A 1DXEA 3WFZA 3PJTA 1GVRA 4DX3A 1OFEA 3CZ8A 1V3LA 1EJUC 3KVJA 2J24A 3QR0A 3S3GA 3CPUA 3FSTA 5AYZA 1KM0A 4IIHA 3H70A 1W17A 3VIOA 3PG8A 3T2QA 1MW0A 3FLUA 4XKYB 1G01A 4ZL1A 1E6RA 3UGVA 3AIBA 1OX6A 3T09A 3MYOA 4ATDA 4MFEA 4DUXA 9XIMA 4FXJA 2DV0A 4O1AA 4J5NA 2XH2A 2QCHA 3NL3A 4GKTA 4E6MA 3G1HA 1CGYA 3RG6A 1TPEA 5EFFA 3DGBA 4ZQPA 4GUFA 3ZLGA 2XN0A 1J01A 1EEXA 3MI6A 1WZKA 4AIBA 4NRSA 2DVUA 3C6CA 5IFPA 1S5MA 3UWYA 2FMNA 4HA3A 5FSEC 3DC8A 1PWMA 3MJYA 4MAVA 1AJ0A 5IDZA 1E6PA 5FD0A 3P7YA 1O60A 3K30A 3CZGA 3URQA 1ZBVA 4ZR8A 3E5BA 2PD9A 4WDXA 2J7HA 4AIUA 4I9MA 2J8FA 1LCOA 4MOZA 2VFHA 3W53A 4GCXA 4BKNA 1C93A 3EBVA 2EF9A 1LL4A 1S5WA 1EUAA 2D2GA 1D7FA 1GCYA 2XHYA 1IWAA 3O7UA 2QGYA 1MQPA 4M81A 2NLIA 3BICA 3T44A 2J77A 2C14A 4IMEA 4QP0A 1PDYA 1UR8A 4MKSA 4CEUC 5D30A 4UOJA 3CB8A 3FAXA 1NTHA 3RK8A 4DI9A 5BXRA 5HPCA 3ANUA 5C54A 2YSWA 1M7XA 3NNTA 3TJLA 3BSHA 3HB9A 1B1YA 2DORA 1V3HA 4M24A 4PTVA 1J4EA 3AWOA 3ABSA 3NQ6A 4OKDA 4BQ3A 3GX9A 5DCDA 5FF2A 4GNVA 5I3IA 3W01A 1C8XA 1LBFA 3BCFA 1J5TA 1FDYA 3L66A 3H2MA 1QU4A 1MYRA 4YN5A 3UU0A 4PA8A 4HPHA 1P1MA 3PBUA 3CHFA 3NFUA 4Y7EA 4ZO8A 1XIBA 2PZ0A 5HXMA 3W73A 5A6KA 3CHEA 2BZNA 3E0WA 1X6NA 1BKSA 1ZU8A 3DCPA 2XH0A 5M2FX 3C3NA 1R87A 2C15A 3AYTA 1UZ1A 5AKQA 2J88A 1TR9A 4PMUA 1XH2A 4NJKA 3TSMA 1FWBC 2DQWA 3ITCA 4PH6A 1MW2A 2OLHA 1XKYA 4HNTA 5GNZA 3SCWA 1B31A 3TZNA 1ISVA 2JIWA 3VX1A 2Z6IA 4C6DA 1WP6A 2NSOA 4FXRA 1Q45A 1EX1A 3MS8A 1EH9A 2CZVA 2IQTA 3IEBA 1RBLA 3GDTA 3MZNA 1AVAA 3MW7A 1DORA 4DWSC 2R1LA 4YHGA 4MJ4A 4RE3A 2FVLA 1US2A 3B97A 3VZZA 1JGIA 3QV6A 4ZEPA 2PTXA 4ADUA 2X05A 4IM4A 4O0ZA 4J35A 1TPFA 3FKKA 1UUMA 4MY8A 3W24A 3WH5A 3WD4A 2W79A 3T0DA 1NWRA 4JFTA 3G3DA 5G2IA 4Q8QA 2V8ZA 4LS0A 3WBXA 4XUGA 3SN0A 1VHCA 2ZDRA 1J0HA 2BVWA 4P8VA 4WVXA 1W0MA 2J7FA 4H8NA 4A6GA 4IF2A 3LPFA 3N4EA 1PXGA 2ALRA 2D3LA 3I3EA 4PUJA 2OT1A 4YNGA 1QI4A 1AJZA 3HQNA 3A3HA 2B7NA 1AD1A 1P0EA 3WMCA 2VNCA 3XINA 4ZFMA 4NI3A 3K13A 3H4GA 4KT2A 1R8LA 4CN4A 3OA3A 2CETA 4XTIA 3TN3A 2Y5EA 3W1RA 5DMYA 3C3UA 2O4QA 2P53A 4GIRA 2FGBA 3MO4A 1JXKA 2PLMA 3E0IA 4DUOA 1ZJAA 2DSZA 1XRFA 1IZCA 4JTHA 4JKKA 3VFCA 1KCZA 2Z00A 2WKJA 1P7TA 4AY8A 3QSTA 1BAGA 4HJFA 1XLEA 1XYFA 2HE5A 3BLOA 4KCVA 4OHQA 1PTAA 3TR9A 1WDQA 3DFYA 3IS4A 3KRBA 5CSYA 3WF0A 4QTGA 3VAVA 4D6DA 3GFZA 2JKEA 3TFCA 4XAZA 2V38A 2VXNA 1OFRA 3FS2A 5JBEA 4PN2A 3H23A 5AHIA 2XVNA 5BMXA 1FFQA 2DT1A 4HNOA 3G1FA 5IHSA 1QR7A 3WLJA 3R12A 2E6AA 4V33A 1S3HA 1ELSA 2ZRZA 5T91A 1E4IA 3F4VA 3UJ2A 4JTJA 4TVCA 1EQPA 4WGXA 3GU9A 3P67A 3F2BA 1IF2A 1YXCA 3B0YA 4HNLA 3ARTA 4J27A 5BWFA 3MP3A 1WNOA 1JDEA 1ME8A 4HK6A 4D1IA 5HMDA 1JCNA 2FTPA 2YDSA 3LBOA 1V0NA 2YCEA 4TOQA 1CGVA 3LQLA 2OYLA 1SMDA 3OYXA 3T08A 2P3ZA 1TUXA 1CXIA 1GQKA 4UMCA 1OT1A 1H1ZA 3EPNA 4HHHA 3LBMA 4FALA 5AYIA 4L4PA 3SRFA 4ILSA 3T9PA 1XBZA 5FIPA 3UA3A 3J7HA 2PDMA 3L0NA 2Z25A 1MDRA 4IFOA 3UXDA 1OFAA 1UZHA 1DWJM 4MLRA 5I7GA 3L4XA 4HMNA 3NWRA 3TQ0A 2VL4A 1OZQA 4OOUA 4W87A 5A5WA 2WK2A 1G4SA 4ZODA 1SFJA 2PLKA 2BV9A 1F6YA 4G1NA 2HRWA 1T6MA 3MA8A 4HIBA 1B3VA 3EWCA 4O8AA 3VABA 4L1XA 4Y9NA 4AZ7A 3W2LA 2E68A 3EZ4A 1T8XA 4O54A 2FZMA 3AI0A 1FCBA 3GYCA 2ACSA 2EHHA 2JKPA 4K2SA 2QULA 1UJQA 4L6OA 4ZTXA 4US5A 1CGXA 1R2RA 1K70A 1MMFA 2P76A 3BW3A 2CLIA 1IZKA 4GNKB 4C1NB 2DVTA 3CUFA 2Y7EA 4KFOA 3UF9A 1UMLA 3QTPA 3MB9A 5H8MA 2B7QA 4YYCA 1KBBA 4FPSA 3K8MA 3HPXA 1XYLA 3M0MA 4A8NA 4JFWA 4AZIA 3BQ5A 3M0HA 3KLLA 2A5HA 5CJMA 1WZMA 3P0WA 4H2HA 5F7UA 3T8LA 4UFMA 3DFSA 3R13A 5BOFA 1IT8A 2WVSA 2EQDA 5EPDA 1SM9A 2GUUA 2O56A 3AHYA 1HNYA 5REQA 1IXPA 1YXDA 3HIJA 3WLTA 5MHBA 4J3ZA 1W1IE 3BJFA 1LROA 2V5DA 1TV8A 2YBVA 1VBGA 3ZO9A 4H9UA 5D9PA 3EDEA 3ZVHB 7A3HA 4IPJA 1JYVA 4NYYA 3EYPA 4DN1A 2RH9A 3DHPA 1JPMA 4GVIA 1Q63A 2ZE0A 4J3TA 3SURA 2Z1XA 3OBEA 2HPIA 2H8XA 3S5SA 2O9PA 3ONBA 4U10A 4EK7A 5HUOA 3C0QA 4MJMA 4Q22A 4FAMA 3SCTA 1BYAA 4K7VA 1W56A 2Y5JA 2TAAA 2QDDA 1K9FA 3T42A 5XIAA 1BXCA 3PTMA 2ZRVA 3FY1A 3RU6A 3T4WA 4PBGA 1K8CA 1BVZA 2PUZA 2QCFA 3QOMA 4BWLA 2J6XA 1C3FA 3MUAA 1QFEA 4UC5A 3NGJA 2INEA 1Q6EA 3L2LA 4IICA 2IS7A 1K02A 2MANA 3PJXA 1QW8A 5E70A 2GGHA 4LUIA 5C9ZA 2PLJA 3W7DA 1ADSA 3W70A 9CGTA 1RV8A 5GJPA 2YZ5A 4JQ4A 4X22A 5DMMA 3LA4A 5KTLA 3OIXA 1W5OA 5A6BD 1SR9A 1SSGA 5DRCA 3MUCA 2Z1BA 4C65A 4A4AA 3THQA 3E02A 3W1PA 1F5ZA 2A7NA 5HNNA 3GSMA 1RY8A 3BLDA 3WNLA 1KM4A 4UTKA 2HVNA 2VRJA 2D22A 3B0PA 2OYMA 3W2MA 3CIVA 3LLXA 1VEPA 1P48A 3UR8A 3GXNA 2Q02A 1AQFA 1PHWA 1VPQA 2PWDA 3WJZA 2IUZA 3S9IA 2OMAA 4O4VA 4B3KA 4R34A 2NWSA 3THCA 1OCBA 4L64A 3AJXA 2H3BA 4Q4OA 4MWAC 4PUDA 4DELA 3P61A 4FX7A 3AIVA 3I4EA 4MJ2A 5CAHA 3RNDA 2O7QA 3DGRA 3EKLA 4WUIA 3GNOA 1FWAC 1YDNA 1TR1A 2DZWA 4J40A 1FWSA 1UD4A 2NXIA 3A47A 3AQUA 3VKAA 3VD5A 3WJYA 1I2QA 5DT5A 1KGXA 1QDSA 1XJBA 2ZOXA 3N2CA 3L2MA 4FOKA 1FWGC 1VKFA 1SZRA 4JTSA 1WZAA 1TTPA 2V63A 4IQLA 4IT1A 3S0CA 1D3GA 1J0JA 1TPC1 3PTKA 4L6HA 3WO8A 2HZGA 1WX0A 2PA6A 4GINA 1EHAA 2OOFA 4ZO9A 3R2GA 3S6TA 5G4HC 4R88A 1UWSA 2CWNA 5HNTA 3TDFA 4DM1A 3WQDA 5U4NA 4PUEA 5DXYA 1QI3A 2P5NA 1GPFA 3MSYA 1ZNNA 1E1EA 4AEEA 4MG4A 2X2YA 3EOUA 4AZCA 1QW9A 3AIWA 4J28A 1TE1A 3EWZA 4DWDA 4KWUA 1DWIM 4ZB0A 1HP5A 5K7JA 1WKEA 3NXLA 5K9CA 3KUMA 4B4HA 3PB2A 4NX0A 2ZRYA 4H3DA 4AHQA 4LCRA 1XUZA 1MQQA 1X8FA 1XFCA 4JTTA 3F7JA 5T9BG 1Q8AA 1KWGA 1GONA 4MUZA 3P6LA 2WSPA 1ZSXA 3TW6A 4UWMA 4XTDA 3WBAA 4LEQA 1Z7AA 4RV3A 3STPA 3QKZA 3G1RA 1EXPA 4GVFA 2V0TA 1NF7A 2XM2A 4Z0JA 3R0KA 1F3WA 3KVMA 2WM0A 3N18A 1TREA 1TA3B 1XSKA 1W5MA 1JCXA 4KBXA 2IQDA 4B4FA 1DJHA 1I6NA 2E9BA 3M0ZA 2JF6A 3KHJA 3F5KA 2PPGA 5FAGA 3USBA 1NP2A 4UTTA 2XN1A 4JCLA 3W7NA 4HU3A 1OC5A 2HDJA 4GC4A 4Q7IA 4I90A 1F05A 2RDTA 3LY0A 1BRLB 3UZJA 4DZ5A 2VFGA 2P3EA 3H53A 3MT1A 2BOFX 2VQTA 1O5QA 1OGGA 4GC3A 1QHZA 1D3CA 2ISDA 2OEJA 4PTMA 3WUEA 3PBGA 1ZENA 4QE4A 3VGDA 1MEIA 2WV8A 3BAXA 3EXSA 4JX6A 3IGXA 3NPWA 2DJXA 2O92A 2BBFA 3K1DA 4ICMA 2V69A 2NQJA 3MO7A 5D02A 2OELA 1BTCA 2YYUA 4ONVA 4LNYA 4MNMA 3LCLA 3AYSA 3A9IA 1BLIA 1PBGA 2DZBA 2DIEA 1E15A 4M1RA 5K4XA 2QEZA 1BSLA 5EMMA 3VDGA 4DJEA 4IXXA 3WIJA 3IJLA 3L68A 2P8BA 4W5UA 1L6YA 1GEQA 2YPIA 2RDWA 1B57A 2OLSA 1ZL1A 2TYSA 4JFVA 3TC3A 3NDOA 4JYDA 1CX9A 3AICA 1G4TA 3W2KA 4XD5A 3ZZ1A 3TMLA 3CQKA 4HCHA 2REQA 2NVDA 3PPCA 3N11A 4IL0A 3SY8A 3UA4A 1U5HA 3IJIA 4FNPA 4GZJA 2XPKA 4HPXA 4UR7A 3L4UA 1HKJA 1KTCA 2QCDA 1GPWA 2NUXA 4BHYA 4IG2B 5HUPA 1ME9A 4WK9A 2FZ9A 2RHGA 3BSGA 4K1WA 5CPTA 1LLWA 1M03A 3KCJA 1VFUA 1XLKA 5AC4A 4AD4A 3HF3A 2BY2A 3L4VA 4BZYA 1BF6A 3MMDA 3BZGA 4LPCA 2YCLB 2XUCA 4UQDA 4A3UA 3WJXA 3AIUA 2AKZA 1QPQA 1TUFA 4DPPA 4DO6A 2TMDA 3N1AA 4EXAA 3FCPA 4LYRA 3F5JA 1EJWC 3QZ6A 4XUYA 1W9BM 4G8TA 3R1ZA 3PY2A 1V79A 1IEVA 3VOJA 1E6XM 2ZUUA 4EOUA 4IPIA 1Z8AA 2BOEX 3GW0A 2DEPA 2P88A 3AFBA 3OTRA 4ZTYA 3I6EA 3LRMA 3L0KA 5AVNA 3V35A 2Y24A 4BJHA 4E5TA 1H7WA 1DQWA 2X09A 3P2VA 2FLIA 3OOQA 3GIQA 3VKCA 2AOSA 1PHQA 1PJ9A 3M5ZA 4YCOA 2FZ8A 4IHCA 4EKJA 4C60A 1GOKA 2VELA 4U5KA 3L12A 1JDDA 3RMEA 3O3RA 1XYBA 1B3WA 4XVEA 4DZAA 2ACUA 5LYRA 4G7EB 1Z41A 3SUTA 4PFMA 3C52A 4ZB2A 3AS3A 4RDVA 3CNYA 3M43A 1CXEA 3GZ3A 1W2PA 3EDFA 2J8TA 2H9AA 3IIZA 2PWGA 4HCLA 3URAA 1AH0A 3PNUA 4KFNA 4ACZB 1VIZA 4NQ1A 1D3HA 2BXYA 3LNPA 1REQA 2YJQA 1AZ2A 3SUWA 4RZ5A 2NSXA 2FJUB 3MCMA 3QTGA 1GVOA 3MDWA 5FI8A 4HYRA 4EXBA 2JGQA 3RU8X 2W27A 3WF1A 1V6YA 4XIMA 8TIMA 2CKSA 4JEQA 1XH1A 2FGZA 4H8VA 3ZSTA 3UR5A 4BA0A 4XD6A 1R9ZA 1MNZA 4NIRA 2G3IA 4XKYA 5A6MA 4LAUA 2J7GA 1XXXA 2VO5A 4JTIA 2CCRA 1YEYA 5EBAA 1JZ2A 3NVDA 2QT3A 2C79A 3H2OA 1VPYA 1HVQA 1F07A 1WZLA 3CUGA 1X39A 1JDCA 1A3WA 3REQB 1UYQA 1J93A 2HS8A 1UQZA 1HP4A 4N9EA 4MFDA 3F4WA 1L6SA 4DZIA 1JPHA 5CC6A 1G0CA 4K68A 4RUBA 4JCMA 5ABGA 3PBVA 3N25A 2VFIA 1UR0A 3H7VA 3N4AA 1G6CA 5DY3A 3CBWA 1UKSA 2ZFAA 3GK0A 3OGSA 4BR1A 1MRAA 2XTKA 4TIMA 1OT2A 3LHWA 2ZICA 4JIQA 1CEOA 2G3FA 3CMGA 3N9RA 1B0IA 4C5ZA 1EF2A 3T2PA 2Q71A 3CEUA 2PGWA 1QT1A 3H8AA 2ZZ4A 1RA0A 3TSBA 4BEUA 1C8YA 4YS1A 1OK6A 3ALGA 4JKMA 3UPMA 4PFHA 3W1LA 3BOFA 4KWVA 4YHEA 2VJXA 1WXZA 4E3VA 3EKGA 2PDPA 2CXGA 3B8WA 2GJXB 2OG9A 2VDGA 4JL1A 4UCGA 3TYUA 3RRXA 5I5RA 4UFKA 1FWIC 1T41A 3OBAA 4BK9A 2FH6A 4D6IA 2GGGA 3TE9A 3SFWA 4HSNA 2VKZG