4OV9A

Structure of isopropylmalate synthase binding with alpha-isopropylmalate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
385
structure length
380
Chain Sequence
PKTIHIQDVTLRDGNQALKRPWTIDEKIEVFDLLVELNVDGIEVGFPSSNETEFHTCQVLSKRAPKGKPIAALSRANQNEIAVTWEAIQKADCPRMHIVYPVSDFSIKHVLKISEKEVLQKIRNSISFARSIVGPGIEIQFSGEHFGDAIENFAFTKEAFLTAIEAGANIINLPNTVERYRPMVFVNMVKEIKDVVKDKAIISIHTHNDLGMATATSVESVYVGAEQIEVALNGLGERAGNTNLYETAIALHQNGENLNINFQRIYPTAKRISELTGIPIGEKTPIIGEDIFSHRSGIHQTLHQSKGAYRTFSPEFVGRMDKETISFTNQSGHKAIEFLLHQRGIQVSKEGIHHLFSLAKSISSRENNREITEAELVALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords isopropylmalate synthase
publication title Subdomain II of alpha-isopropylmalate synthase is essential for activity: inferring a mechanism of feedback inhibition.
pubmed doi rcsb
source organism Leptospira biflexa
total genus 144
structure length 380
sequence length 385
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ov9A01
4MZ8A 3MJYA 1I2PA 2DZWA 2CZ5A 3IIVA 4H6KA 3BPWA 1JUKA 3TDFA 5EKYA 1XUUA 5IBXC 1OX4B 2Z6JA 4O15A 4NT0A 1XI3A 4TU1A 5EL1A 3MUXA 4IOTA 2RKXA 2Q3OA 4HSOA 2KZHA 5HQEA 4OBTA 2JGQA 4Z1DA 3W7EA 3VFLA 2B0MA 6ALDA 4QITA 4E2BA 1MO0A 4A2RA 3TW6A 4JIPA 1Q3NA 4O57A 3TNOA 3E49A 4TX9A 4QM1A 3CM4A 1UUMA 4LUIA 2Y7GA 2QCLA 4FX7A 4CQ8A 3KHJA 1QR7A 1Q6QA 3L66A 4EF8A 1OVDA 1J4EA 2CW6A 2DZTA 4LV9A 4FIQA 3THAA 5D02A 2TSYA 4GUJA 4O28A 4ALDA 1BWLA 2I14A 1TV5A 3P81A 5CZSA 4NXSA 2GQ8A 4JTTA 1H63A 4UTTC 3B03A 3T78A 2FLIA 2QUVA 4MYAA 5KZDA 3NQMA 3HGSA 4QISA 3CU2A 3MW7A 3QC3A 4O4WA 3FLUA 3P62A 1UB3A 3NQFA 4HPJA 4MJMA 4EIVA 1NAL1 4NJGA 4AWSA 3LRMA 4XZ9A 4BI7A 1VQTA 4JYFA 4NQ1A 3PVFA 4BF9A 2C14A 1AW1A 3TC6A 3W6YA 1G4TA 4Z0SA 1QO2A 3THQA 3WK3A 1UJPA 1JUEA 3LRLA 5FEPA 3C2FA 3NQVA 4N2YA 1VYSX 4K7VA 3WFAA 2DJXA 2QDGA 3JS3A 2J6XA 2HSAA 2QCDB 2YDAA 1QNVA 2AQWA 3GDMA 4P61A 3UWWA 1G4SA 4NX5A 4GE8A 2ZYFA 3M5ZA 4CNNA 2JKAA 3LX9A 5C55A 5FF2A 1L6YA 1ZHAA 2TRSA 4N9BA 1EA0A 2V2HA 3BG9A 1GZGA 4YLWA 3BGGA 2Q8ZA 4ZZ9A 3GLCA 3KOFA 4QQ3A 3W7HA 3STCA 1SPQA 3BVJA 1KM5A 1PIIA 2QCFA 3NPVA 3U8GA 2F84A 1XCFA 1YXDA 4TIMA 3G8EA 1YTDA 3MO7A 1TREA 3PB0A 4MY9A 3R2GA 1M7PA 4JTUA 1R46A 4HNTA 3I7SA 1ICSA 4O11A 3PSWA 1SO3A 1I2RA 2C3ZA 3LM7A 4H4IA 2C19A 3ANYA 3QMSA 1RQEA 1A50A 4LC6A 3HIJA 1YPIA 2YR1A 2GUUA 4LVGA 1IIHA 2FPYA 1IXNA 1MSSA 4N9EA 2WJZA 3LERA 5K7JA 1X8FA 1S5VA 1PHWA 1XKYA 1W5NA 1W1ZA 3O6DA 3OEXA 4R7JA 4QIUA 4L4LA 1ML1A 2QJHA 4RZ5A 3W70A 1X6UA 4JNMA 1AW5A 3G0XA 3VE7A 3SJ3A 4MOZA 4L4MA 3KFTA 4N9CA 1M6JA 4K6AA 5AC7A 4O18A 3FJ6A 1GT8A 3G1FA 3W1QA 5CZJA 2B7OA 3WJXA 4S2CA 1KTNA 1MEWA 3UNDA 1JCJA 1LRQA 2V5BA 3ELFA 5IBXA 1GVFA 1OX6A 3SW6A 2QCMA 2WQPA 1O60A 4IXHA 4U4MA 3U6WA 3LV5A 1H62A 5F1UA 1GVQA 3NQ8A 3C2VA 1FWRA 2YXGA 1LLZA 3PBWA 3W1AA 1S5WA 4RCXA 2C13A 3SFKA 2A7PA 1LOLA 4WXYA 3B4UA 3UY8A 1K7EA 4M7SA 2E77A 1NF0A 1LDCA 5DBTA 1HO1A 3UPBA 1LCOA 3EX1A 3R89A 1Q6RA 3OVRA 5EBUA 4AAJA 1PHQA 3GNNA 3TA6A 3S1WA 1GOXA 1JR1A 1K03A 4CQAA 1YDVA 2PURA 3HQ1A 5D38A 2W0UA 2ZTJA 4DPPA 2A6LA 3C56A 3DXIA 4IX0A 1AL8A 3O8AA 4OWGA 4RJEA 3MI6A 1ZAIA 4HNUA 3JR2A 3L5LA 3G22A 4Z1BA 2ZRUA 3LXBA 3LCXA 4LU0A 1EEPA 4JTSA 1QO5A 3TXZA 3W88A 1ICQA 4FNUA 1X1ZA 4O19A 3STEA 2YX0A 3KRZA 3W7CA 2RH9A 1YDNA 4GXMA 1QFEA 5AHNA 1H7RA 1LOSA 4NNAA 3N2MA 4JDYA 2Y63A 1E51A 3HB9A 4YWIA 3GDKA 3GX9A 4NNCA 4TMCA 1QOPA 2CLHA 1XL9A 3UZJA 4JD4A 1K7FA 4UXDA 3BO9A 3W7GA 2CU0A 4Q33A 2J88A 2VC6A 3HGOA 1HO4A 4FNSA 1ZAHA 4A22A 3M6YA 1VH7A 3NYZA 3C4UA 1UUOA 3O16A 5KZMA 1Z42A 4GC4A 3P82A 2WV8A 1TPFA 4LNYA 5DXXA 4KKXA 4UTWC 2ZA2A 3TC7A 5D2VA 3P7YA 3NEVA 2GQAA 3QPYA 3OVQA 4IMCA 5LGXA 3DKLA 4M19A 1DQXA 3W7DA 2QCEA 1QPRA 2Y7FA 1ZAJA 5G2WA 1WOAA 4DPQA 3W83A 4EWND 5FEXA 1R47A 2UV8G 2CFFA 3HMJG 3W1PA 2FB3A 2QAFA 2YFOA 4K38A 3S0CA 2VFEA 3GAKA 4O1BA 4BI6A 3W1NA 3LB0A 1GVSA 3WK0A 4AB4A 1A53A 1QMLA 3NL2A 2BTMA 1FCUA 4R53A 1FWWA 3PM6A 2GVJA 5BRBA 3PBVA 3BLFA 4QSHA 3C2EA 3WJWA 2A4AA 3OG3A 3MBFA 2C1HA 3CTLA 2NXHA 3C0JA 4LUJA 5U7SA 1XXXA 3C8FA 4ZQCA 2J24A 4RKAA 5KZEA 3W7IA 2EF9A 1F2JA 1VC4A 1OF6A 3D0CA 3G18A 4N6EA 3A5VA 4JICA 1B3OA 3HPSA 2C0AA 3TMLA 4MY1A 4ZMGA 2GQ9A 1SZFA 4Y9AA 1TJRA 5FF7A 4O53A 3W1UA 3TKFA 4FNQA 3CQ0A 5D04C 1YTEA 2ZA1A 3UWUA 3W7OA 3DFPA 1L9WA 2I9EA 3C3NA 1Q45A 1H50A 4PC8A 3MI3A 2DZVA 3QZEA 2RDTA 3DI0A 1FDYA 1JRBA 3P60A 1O4UA 3NZRA 2PC4A 4JTLA 4Z08A 1H60A 1YPFA 3A21A 3FJLA 4LVAA 4O8RA 1K8YA 4XTDA 3TSBA 1AL7A 1ZENA 3PWAA 2GVGA 1OYAA 1JCYA 1JRCA 3NPUA 5AN7A 3A22A 1B9BA 5LNVA 4O0ZA 3F4WA 3LI1A 5AHLA 3IIXA 5CSSA 1DL3A 1EP1A 5AHIA 4E38A 2H6RA 3BGJA 4UUIA 1PV8A 3RMJA 2C15A 2FB2A 4UTUA 3A9IA 1J2WA 3T7VA 3OHIA 4UR8A 3EXSA 1EP2A 3UZ5A 1BTMA 4LTSA 3N34A 4IMDA 1KTBA 2DP3A 1NVMA 1PVNA 1WDWA 4AH7A 3QMRA 3TQVA 2NUXA 1N7KA 2ZZ5A 1THFD 1UASA 2Y70A 3HGRA 3PUEA 2CWNA 1W3TA 5I3KA 5C5YA 4CLMA 4OHQA 3QRHA 4FX6M 3ZS4A 3V75A 3W2UA 3LTPA 3LCLA 4NNBA 2HS6A 3W76A 3S6DA 1JJKA 3DFNA 4UTHA 3ATZA 3TXVA 2CZFA 3H54A 5AHEA 3GXNA 1N55A 1KM6A 1TPVA 1YXYA 4ZL1A 5LSMA 3O63A 3S42A 1H7PA 2VFIA 1MEIA 4TO8A 2CLLA 4U28A 1TTJA 1HG3A 3LCIA 2VEKA 5DLCA 5A5WA 3DH7A 4UFKA 3G3DA 1QOQA 4O0KA 1H61A 4K37A 5I3JA 3GNDA 4O1CA 1GVRA 4RXGA 3P84A 3NQAA 4MUZA 4I7WA 1KFBA 4MJZA 2X2GA 3DKJA 3NM3A 4PL2A 4XKYB 5GVJA 2VFGA 5AHMA 1KV5A 4AWTA 1D3GA 2QCGA 1KM0A 3QFEA 1SW0A 2OT0A 3R8RA 3VNDA 5F4XA 3I7QA 2WNNA 3CB8A 3TMQA 2VKZG 2E6DA 1CX9A 5EPDA 1R2RA 1QPOA 5EYWA 1U83A 1VJIA 4IXXA 4WJEA 1OFQA 2NLIA 4AEOA 3OVPA 5J5RA 3VE9A 3WK1A 2V2DA 5TBOA 3GDRA 3W9ZA 2H3DA 4K8HA 5D03A 3UWQA 1OYCA 2O7SA 1JCMP 4NUWA 3W74A 1GPWA 5HWNA 1ME7A 3W75A 5F1VA 1B4KA 3B0UX 2ZZ4A 5D32A 5I3FA 2YPIA 5LHEA 2NWSA 2JKEA 4YL2A 4NU7A 2ZTKA 4YCPA 3IGXA 1L6WA 1P4CA 3BW4A 1X1OA 4NJJA 2DZSA 3W3OA 4X9SA 4IX2A 2GOUA 4UCGA 3KRUA 3OIXA 4MZ1A 4YMZA 5H2ZA 3EWBX 3QYQA 3R12A 1WBJA 4KFOA 3O1NA 2GJNA 3V1PA 2P10A 4NJHA 3NQGA 1FCVA 4WXZA 3M41A 1WYIA 4IPJA 2J9ZA 2HS8A 1W5PA 2H90A 1FWTA 1EWDA 3BG3A 5TQLA 3M47A 4MVAA 2VOMA 3GXTA 4QNEA 5CPMA 4I9AA 1OFEA 5KMYA 3LLFA 3DGRA 3RLUA 1TTPA 1G4PA 3F1QA 3TE9A 1TPUA 3MYOA 1RQBA 5HNRA 2ZZ7A 4JTEA 1W3NA 2A0NA 1SO4A 3UD6A 3BV4A 2WOQA 4DF1A 4TMBA 5K9DA 3HG2A 3P5ZA 1JCXA 2QEZA 3FFSA 5BNKA 4NXKA 1WOBA 1P0NA 5KITA 1F73A 2X16A 3HBLA 3FKKA 3W1LA 3EWWA 4GWEA 4ICNA 3M44A 3PB2A 1OFRA 2JBMA 3IVSA 2ZDRA 4M6PA 3HPXA 5CZ0A 1H5YA 1YTKA 3S5YA 3ABRA 4LRTA 4D2JA 4Z1AA 2W79A 4WZHA 1PCWA 5E0KA 3SZ8A 1TTIA 1OABA 3UQNA 4KWWA 5K4XA 2NXIA 3W1MA 1OFAA 1SW3A 4JYEA 4Q4KA 3EXTA 2VFHA 1FXPA 1ALDA 3MWAA 5G2HA 3AO0A 3SR7A 3H53A 4LT9A 4AF0A 4EOUA 3RK8A 5CSRA 4UNLA 4X3ZA 3B0VC 1JCNA 2OMAA 3PBUA 2I1OA 3WJSA 3TUUA 4JX6A 1OK4A 4AHPA 2BSLA 3W2KA 3HGJA 1FDZA 2QKFA 2A5HA 1SFLA 4ADTA 4PEKA 4O17A 2J9YA 4IMGA 1C8VA 4O4VA 2YSWA 3G8RA 1W37A 3GXPA 4N02A 4AHOA 4FF7A 2YYTA 1VR6A 2F7FA 1ZNNA 2AAMA 5HMSA 4LVDA 5IM51 3FYPA 3GDTA 5LZLA 1SQ7A 4IUOA 3LI0A 3IIOA 3F03K 3G0SA 4A2SA 2ATSA 5HUPA 3CIXA 4LVFA 1EIXA 3MHFA 4GUHA 4UFHA 3ZR4A 1AW2A 3L68A 3M5VA 4O52A 2D73A 4OV4A 1QDSA 3NOEA 3NL6A 4AMAA 4MYXA 2WSRA 2Y7EA 4BR1A 2PRMA 3CEUA 5KINA 4AVFA 1C9DA 1YLVA 2W6RA 3TROA 3MBDA 2CLMA 1A5BA 1LTDA 1VHNA 3MHUA 2ZRVA 3AJXA 3O6CA 3HO8A 1KTCA 3W73A 5L9FA 3LLDA 3W7QA 3W87A 1O5XA 2O7QA 1A5AA 4N6FA 1JQVA 4MFEA 3A5FA 2G95A 3RU6A 3W22A 2NUYA 3EEGA 4UFLA 1FWSA 1FCBA 1W5QA 4FXSA 3MP4A 4UC5A 3QMTA 1WX0A 5AHFA 4WOZA 2JK2A 4UIOA 4WY0A 1UBSA 4EF9A 4GUIA 1SO5A 3T40A 3ATYA 1H1ZA 5K4ZA 2E5BA 2YYUA 4MZYA 1RPXA 1DQWA 2NUWA 1VCVA 2PCQA 2R14A 1XDMA 2EGZA 3IVTA 3I6RA 1FWNA 3L9CA 3M9YA 1W54A 1EP3A 1O5KA 3JRKA 5F2LA 5FF4A 3UWVA 3W07A 5K9CA 2NZLA 4AWUA 1FXQA 4KWVA 4FNPA 7TIMA 4M6VA 3P5YA 1SFJA 1OF8A 2FDSA 1ONRA 1WQ5A 1H7NA 1ZFJA 3WJYA 3EXRA 1DKWA 2Q3RA 1OFPA 1R2SA 5CG7A 4PA8A 1I8JA 1WV2A 2GVLA 4NVTA 1EUNA 1H7OA 1PL9A 4FB7A 1D3HA 2YW3A 1OX4A 1H1YA 8TIMA 2X1TA 4K7YA 4NJKA 2PE4A 2VELA 4JTFA 4LWWA 1KFEA 4PODA 4ORIA 3WK2A 3TCEA 3LHTA 5DBUA 3I68A 3QM3A 3EX6A 1VCGA 3W7PA 3VCRA 1TB3A 4O10A 3CC1A 1TV7A 5HJLA 3RFAA 1O94A 4UMCA 1VCFA 1KLYA 4DBDA 4IWWA 4I7VA 3N14A 2FQIA 2EHHA 3PC0A 2FPVA 4JX5A 3NG3A 4H3DA 1SU5A 1KM4A 1W5MA 1GTEA 2ATMA 1GVOA 2WPBA 5F2MA 4M6QA 1Z44A 3G1AA 3W71A 2ZZ6A 3BG5A 3PUDA 4DQWA 2FTPA 5AOUA 1WAUA 3TSDA 3L65A 5DCEA 3LHVA 3R5EA 1VLIA 2P0OA 4UTJA 1ZJIA 4LY8A 4E0CA 4DF2A 4UTKA 3H55A 3CWOX 6TIMA 4S2BA 4Z0JA 1DOSA 1YXCA 3Q2DA 5HR6A 4JN6A 1V5XA 4KFPA 2E09A 1FX6A 3ZWSA 3UXDA 1GQNA 1LLWA 1C29A 3ABSA 3DI1A 1SSGA 1HFBA 4MY8A 5D30A 4IJBA 3DZ1A 2E68A 4WOQA 1N8FA 1VRDA 1KM2A 2NWRA 5J5DA 4C1LA 5E1QA 3W7LA 2CLIA 2QUUA 2ZRZA 3LGEA 4ZQMA 3L5AA 1R30A 5AFDA 1WA3A 2ABBA 2QCDA 2FIQA 1JVNA 3NO5A 3RLVA 1IGSA 3TV8A 3PAJA 4Q32A 5SWUA 5LNRA 4LC8A 4OE7A 4RK8A 1QAPA 2B7PA 4N9DA 4LV4A 3A24A 1K02A 3Q58A 3O6YX 3PBYA 1PCKA 4XQ6A 5E93A 1GTHA 3B0PA 3G1YA 3EWUA 3GB6A 1LBLA 5G2IA 3GK0A 5D2TA 2PRLA 5DCBA 4JXCA 4K39A 1T0OA 1GEQA 1RR2A 5T26A 3W1RA 3N9RA 3W23A 1G7VA 1KM3A 4ONVA 3FIGA 4O1DA 1MEHA 3MP3A 5AC8A 5CKSA 3P8JA 1AK5A 2IQTA 4IGHA 4XTIA 2B7QA 1LOQA 2NX3A 4PH6A 3DHDA 2DZUA 2WNQA 1TQJA 1EWEA 5HINA 4K36A 4KFNA 2OJPA 3KVJA 3TR2A 3FOKA 2TPSA 5LHFA 1MZHA 5C2XA 3EKLA 2E6YA 3L21A 4UFMA 2Y85A 2A6NA 2BWGA 4NZFA 2WO5A 3P74A 3O06A 1Z41A 2E5DA 1GG1A 4WUIA 1PE1A 1OFOA 2VEIA 3GAYA 3LHUA 3QPZA 4Y8FA 1A5CA 1SZEA 4IPIA 3DU0A 5G4WA 2Y89A 3DENA 1F74A 2EPHA 2VEMA 3TAOA 2CLEA 1KFKA 4RR4A 4DO6A 3CLMA 5FESA 1HUVA 1FCQA 3G1VA 2B7NA 3NVTA 4DO5A 1F05A 3W85A 4QJ1A 2CLFA 1XBXA 2A2IA 4G1KA 2ZZ1A 1B57A 4YCOA 1TYGA 3E0IA 4AXKA 1F76A 4MLRA 1TSIA 4QNWA 1HL2A 3DAQA 2C18A 3EX2A 2Y62A 3E02A 4RZ4A 2TMDA 3P61A 4O16A 1GJPA 1ICPA 3HG4A 3G3MA 1F7BA 3L0NA 4JY9A 3USBA 1TRIA 2E1DA 2XN0A 1VGAA 3HJZA 3L5MA 2Q8LA 3B05A 1LORA 1M7OA 2NXGA 4FNTA 5A8GA 5D2WA 2OX1A 3HG3A 1IXPA 2XN2A 3FA5A 5G5IA 1SZGA 1XC4A 1XM3A 3W72A 1FDJA 1LBMA 1Y0EA 4X22A 4C1KA 2V0TA 1K8ZA 5F4SA 1F5ZA 1KM1A 2ZCGA 4ADUA 2JGYA 2Z1BA 3QQ0A 1T96A 4POCA 1H7XA 4GNJA 1DORA 3GKFA 4HNVA 2R94A 3K30A 3QEZA 5KTLA 3GIYA 1GG0A 4DXVA 4MLJA 2HMCA 4JTKA 2R91A 5MHBA 1WXJA 3NNTA 4CNOA 1OFDA 5BMXA 2QUTA 2JKPA 4JR5A 1VPXA 1WBHA 3KVKA 3P67A 1OFBA 2BX7A 4P2VA 3NL3A 3W1XA 4RV8A 1G69A 4TR9A 3FS2A 1W8SA 2ISWA 4CNPA 2QR6A 3M1ZA 1DVJA 3N3MA 1TJPA 3LCFA 1AG1O 3IEBA 2WSQA 3QF0A 2P1FA 1RV8A 5EA9A 5CGQA 4B5NA 4HT3A 3N73A 3HOJA 4M5PA 3TSMA 2E6AA 5FI8A 1QCWA 2Z6IA 4UNKA 3BARA 3NPXA 1ZCOA 2QCNA 2TYSA 3SY5A 3QQ1A 5C6MA 2X1SA 3DHFA 1QPNA 5AYYA 5FF3A 1TPWA 2NV2A 4OT7A 2C16A 1PS9A 1XBZA 1BWKA 1DHPA 3QH2A 3LRKA 3QSRA 3NR0A 3BW3A 4UFJA 5C54A 1FY6A 2XN1A 1RD5A 3Q94A 3TQ0A 5D05A 4A29A 2BLEA 1P0KA 1I2NA 1YDOA 1VYPX 3FEMA 4I7UA 3SGUA 2J9XA 4PTNA 3L0KA 3HPZA 1TPH1 3KX6A 3PUOA 5DY3A 5K9XA 3LHZA 2VFFA 3DBPA 3L2IA 4JS3A 2Y7DA 2NX1A 1DJQA 2G5WA 5DXYA 5D2YA 3EWXA 4Y90A 4ZQNA 4LS1A 1H51A 5BMWA 5LKYA 3DFOA 5I3IA 3C2OA 3NQ6A 1DV7A 2Y6ZA 2RHGA 4GBUA 3U2OA 3KRSA 4FHAA 4DF0A 4ORMA 4UR7A 3RF9A 3EX3A 4PFMA 1LM1A 3KAOA 4S1FA 3HF3A 3MHGA 3LBMA 4JTIA 5HUOA 2ZZ2A 3W1TA 2V2CA 4O1AA 4HSNA 3EWZA 1TPEA 1LBFA 4GFSA 2ZRYA 4M7TA 3E9AA 4UFIA 2QAPA 4JTHA 2OCZA 3NXFA 4CCDA 3INPA 1Q6OA 4DO4A 5F2IA 3W84A 5AC6A 2ABAA 1B4EA 3DFSA 3IRDA 1L2UA 3GKAA 4IQLA 4MPQA 4JDBA 2EAWA 3KVMA 4R34A 4UMBA 2AGKA 2Y61A 3LHYA 4PL1A 4HHPA 4BFAA 4LW7A 2ZA3A 1XBVA 2C6QA 1O95A 5AYZA 3I7RA 3STGA 3CEPA 5FEZA 3LBCA 5CZTA 3GDLA 1NEYA 4HNNA 1SUXA 4ZQOA 2PRHA 4LOCA 1RZMA 1GYNA 2RDUA 4MKNA 4QAIA 2RDWA 1P5BA 1XBYA 3C2RA 1I2QA 1I45A 4XWUA 1TMHA 2V81A 1OX5A 1R2TA 4BWLA 1I4NA 1IF2A 2EKCA 4HN4A 1TPB1 2XFWA 1JCLA 3TJLA 3S1UA 2RFGA 4OQVA 3IVUA 4LRSA 4GRSA 3W86A 3NPWA 1TPC1 2WSYA 3W7KA 3OA3A 1KA9F 3NZ1A 1KBJA 3NQ7A 3QW4B 4O12A 4FO4A 2A1YA 1DJNA 3OBKA 3TAKA 3NAVA 4X2RA 3T44A 3ZWTA 2DORA 2QJIA 1OG0A 1XDLA 1OYBA 1YADA 2Y88A 3NL5A 3GR8A 1NFBA 5G1YA 4NX0A 4MIMA 1H7WA 1W5OA 1W3IA 1TV8A 3LCHA 3TU9A 5TIMA 3W2JA 1S3HA 4GJ1A 3I65A 2CLKA 4R33A 3O05A 4LS2A 4JTJA 4DBEA 3W7NA 3PR2A 2X1UA 4FNRA 2OT1A 3LDVA 3BLIA 4XKYA 3M5XA 2LLEA 4ZQPA 4A3UA 3S5OA 5BW6A 2E5CA 3YPIA 1G7UA 4JX4A 4FXRA 1L6SA 2ISSA 5CPOA 1YYAA 2ZQ0A 3S5NA 3EKZA 1P1XA 1LRTA 3SGZA 3G1SA 3S1VA 2A7NA 3PF3A 1EUAA 3R13A 3WJZA 3UWZA 4BK9A 4E2DA 3CT7A 3M0ZA 1K8XA 3TJXA 3CPRA 4JIQA 1XFBA 4UTIA 2WKJA 3M16A 4J9JA 1BEUA 2BZNA 3S1XA 3L0GA 2QF7A 3E12A 4XUGA 4UTTA 2NV1A 5G4EA 5D37A 3FYOA 4HKPA 4WY0F 1AMKA 1KV8A 3TQKA 5LGZA 3M7WA 3MMTA 1ZY9A 5DELA 3C6CA 1XUZA 3LCGA 3SIZA 1KBIA 3IIZA 3TFXA 3NQDA 1EB3A 3C52A 5HWJA 4ADSA 1IXOA 3TIMA 3TK7A 3S9YA 2DZPA 3BK0A 2BXVA 4CQ9A 4OV9A 2QCCA 4FIRA 2YZRA 3NQ2A 1SZNA 1SR9A 3LV6A 2ZRXA 2ZZ3A 5L6UA 1LP6A 2Z2UA 5HWMA 5LNSA 3STFA 3T55A 5D2XA 1LYXA 3PG9A 3O15A 5G1TA 2YFNA 2H3BA 3L67A 4IMEA 3QSTA 3IGSA 5AYXA 2J27A 3GZ3A 4Y96A 1SO6A 4WQ6A 4IMFA 2YCEA 3CIWA 4JGDA 1Z48A 1TCDA 1TQXA 1JQXA 4JY8A 3UY7A 1ADOA 5EY5A 5BOOA 4GUGA 1ZALA 3W7JA 1K3UA 4LS0A 3S8HA 2ZBTA 2YGYA 4ZVJA 3HG5A 2FPTA 2VENA 5DY2A 1JULA 3LXCA 5FF0A 2QDHA 3MP5A 3W2NA 5CPLA 2G97A 3PG8A 2NX9A 3MYPA 3GR7A 1U5JA 3GYEA 1FUYA 1V7YA 3S5ZA 5KSWA 1FBAA 1ME9A 5K3VA 4UTMA 4FEZA 3G0UA 1F6KA 4UMAA 1NSJA 2WNZA 3TFCA 2Z0IA 1LROA 5F2GA 1G6CA 4HPXA 1KFJA 3LCWA 3LTSA 1TRDA 3G1HA 3TH6A 5HULA 3CHVA 4O13A 4RZ6A 3IIPA 3W7RA 3W2MA 1HTIA 1Q6LA 2ISVA 3DFTA 3BW2A 1MXSA 3NDOA 2QJGA 4A21A 3F4NA 5ABTA 2DU2A 3GVGA 3VI2A 3TW7A 5K2ZA 3CWNA 5DN1A 3NA8A 3A23A 3KVLA 4NZJA 3QW3A 3E96A 3LTYA 5LNWA 2QCHA 1OHLA 3ABQA 4NJIA 2E6FA 3PY2A 4XBKA 2V5LA 4ZQRA 4AF0B 3O07A 4WX2A 4Z1CA 4N4QA 2CZEA 3QJAA 1W31A 3SECA 1GWJA 1JUBA 3N2XA 5FEWA 2A85A 3IV3A 3G24A 1T8XA 4FX8A 1W0MA 1CI1A 2V8ZA 1RVGA 3B8DA 4EVZA 2A7RA 1SW7A 4UTLA 5HR7A 3NM1A 2YW4A 4Y6GA 3C61A 4N4PA 3FKRA 5DCDA 1KLZA 3B04A 4BI5A 2DJLA 1OK6A 1FQ0A 5CPNA 1SSDA 3G1DA 4PCFA 5I3HA 2H8ZA 4HIBA 3NQEA 3NQCA 3BLEA 2ZRWA 2G96A 2VEPA 4RX0A 1D9EA 3M43A 2V82A 3W2LA 1IIGA 2VXNA 3TX9A 1CW2A 1K7XA 2X30A 5LNUA 3EB2A 4ML9A 5D09A 1M5WA 3RNDA 4WD0A 4O54A 2FJKA 1KFLA 1TTQA 4YXGA 3SI9A 1F6PA 2CZDA 3NGJA 1UCWA 2VFDA 3EX4A 2DZXA 3M5YA 1X7FA 4RXFA 1VLWA 1OJXA 3UYCA 3EWYA 1VYRA 2ZFAA 3ABOA 5I3GA 2V30A 3PULA 3B06A 1ME8A 4AHQA 5EMUA 4CCEA 3IGUA 3P80A 5U4NA 3W7MA 4W9TA 4XBSA 2GJLA 3MI2A 3PSVA 3UWYA 4LVBA 4WY0B 3SSJA 3LOTA 2ALDA 1A5SA 4RLIA 1RQHA 3P8IA 1IXQA 4OU1A 1BKSA 2GPTA 1NF7A 3VKJA 3KXQA 4DEFA 2B4GA 3T4CA 4K8EA 1TIMA 5F4WA 5AB3A 4JTGA 3G1XA 3LHWA 3Q37A 1TO3A 4BWLC 1KW1A 4GUFA 1LZOA 4CCCA 2CLOA 2FFCA 5H91A 1VZWA 3N19B 1LRNA 2OZ0A 2X1RA 1G67A 1VHCA 3PS7A 1G4EA 4O50A 3N9SA 4UTWA 1I2OA 3ZFHA 1QWGA 3DFQA 1T99A 5D33A 4MFDA 1GYLA 4JYDA 1S5TA 2HTMA 4OGZA 1W56A 3UXAA 1KFCA 1TPDA 3LXAA 1EX5A 2A21A 4JEQA 2R8WA 3UPWA 4DELA 1QPQA 1VS1A 1EPXA 2H8XA 1DBTA 4O14A 1J5TA 2V9DA
chains in the Genus database with same CATH superfamily
2A3BA 3MJYA 3FYYA 3BPWA 3OVGA 2BMBA 3TDFA 1MUMA 5EKYA 3TN6A 4Y2WA 3VIKA 2Z6JA 4G7EA 4XUYA 1JGMA 3MUXA 1TV2A 2FMOA 1LJYA 5EMYA 4OBTA 4Z1DA 3W7EA 1E9IA 3VFLA 2B0MA 4H00A 1U22A 3GFYA 1U1JA 4QCEA 3ARSA 1Q3NA 4O57A 3SN1A 2HV5A 4TX9A 3C0LA 9CGTA 1UWUA 3RHGA 4F79A 1REQA 1EOMA 1V02E 3KHJA 4IMAA 1BLIA 3DYOA 1QR7A 3H23A 1Q6QA 3HTWA 1DEDA 4J3UA 3BE7A 2CW6A 1QXLA 4KW2A 4LV9A 4G6CA 1I1WA 1BWLA 4JQ1A 2I17A 2AL1A 5T91A 3KTSA 2D3NA 3RX4A 2GQ8A 4UTTC 3PTMA 3S1GA 3MMDA 4ZO7A 3MW7A 3QC3A 3TCSA 3P6LA 1Y65A 4FLSA 1VQTA 4JYFA 3PVFA 2YXXA 3W6YA 4Z0SA 4DXXA 3AC0A 2VQTA 2DEPA 2DW6A 3PAOA 4JKKA 5DO8A 3WK3A 1R3RA 2EPNA 1I0BA 2XIQA 3JVAA 3NQVA 1TA3A 4P8XA 3WFAA 2OG9A 2DJXA 4O0QA 2DW7A 1GZ1A 2BHUA 4MWAA 4DB7A 5H1WA 2HSAA 2YDAA 1QNVA 2AQWA 2V69A 4P61A 3R8GA 3V36A 2OU4A 5D9PA 5C9XA 2ZYFA 3M5ZA 2JKAA 2C0HA 1TX2A 3V5FA 2V5JA 4PBGA 3EOUA 1UKTA 2TRSA 2FZ9A 3T4WA 1NOFA 1OINA 1W1TA 3ITVA 1X38A 1GZGA 3H2EA 4YLWA 5I77A 2NQLA 4JCLA 3STCA 1P0DA 2XVGA 3PFMA 4TIMA 2VCAA 4MY9A 3R2GA 4QE4A 2IQDA 3NXLA 1CDGA 4HNTA 3I7SA 1ICSA 4CCZA 1VEOA 4EXQA 1PEZA 3CWHA 1TWIA 4U5KA 1KKRA 2D69A 3QMSA 4PRRA 2YR1A 3D46A 1CB2A 4YVVA 4JHMA 4RNFA 1OIFA 2FPYA 1MSSA 1W3JA 1QPKA 2WJZA 5DMLA 4LQ1A 1S5VA 1XKYA 3OEXA 4YWSA 4H6QA 3DG7A 1AW5A 1H5VA 3TVAA 4L4MA 4AZCA 4KH2A 2P5NA 3KFTA 4N9CA 2ALRA 3GYCA 1XIBA 3AIBA 1GT8A 2FGLA 5XIMA 1GOWA 8RUCA 1KTNA 1MEWA 4XVEA 3SCSA 1RXOB 1CLVA 1FHDA 1OX6A 3SW6A 5CCZA 2QCMA 3R1ZA 1EZ2A 4CQBA 2V67A 3PNUA 2YXGA 3F2DA 1GGOA 3G77A 4K8GA 1EJ7L 2A79A 4DYEA 2A7PA 4IL0A 1LOLA 1CIUA 1MW3A 1K7EA 5BXRA 1LDCA 3I3BA 3UPBA 3OVRA 5EBUA 5B80A 4AAJA 1PHQA 3VD3A 3GNNA 1GOXA 2WMIA 4GABA 3VGGA 1K03A 4CQAA 1A0DA 2QS8A 3HQ1A 3WQEA 4MB5A 4BHYA 3AXMA 4V1YA 2A6LA 3DXIA 3O8AA 4EP8C 3H24A 3ZOAA 2Q8XA 2W63A 3LYEA 5LIUX 1TWDA 2P88A 2ZOXA 3ITOA 4HK7A 3SQSA 2WHLA 2F38A 1ICQA 1J8VA 3IJQA 3KDOA 4FNUA 1UKOA 3S2CA 1AJ0A 4NZ5A 3O6AA 4GO9A 2QV5A 2RH9A 1YDNA 4GXMA 1QFEA 1H7RA 4YWIA 1H3GA 3GDKA 4NNCA 4TMCA 2Z27A 3AS3A 3WQ6A 3UZJA 4KT2A 3VOCA 1K7FA 4D6GA 3BO9A 2CU0A 4Z2KA 1F4AA 3N6JA 4KEMA 1QVBA 2GJXA 1ZAHA 2QGYA 3LPOA 4ECLA 1VH7A 1J79A 3DIPA 1AH0A 3MS8A 1XIEA 3NZQA 3P82A 4UTWC 2IKGA 3WQFA 1ENUA 4JZ5A 5C70A 4IICA 1FHUA 3GW0A 1EHAA 1JXKA 3CHEA 2XZ7A 1QNQA 4BI6A 4DM2A 3W1NA 3LB0A 4NRSA 3WK0A 3CNYA 1QMLA 2IW0A 2OYMA 2WC3A 2OVLA 3BJTA 1R3VA 4C5YA 2BTMA 3IJDA 3APGA 5BRBA 2Y24A 3N6HA 4Q4QA 3Q65A 3DYPA 5CH9A 4ZXOA 4H2CA 1VAHA 2C1HA 3CTLA 3MBFA 3UJ2A 2IQ0A 4ZEPA 1YNQA 2NXHA 2WZTA 5I5RA 1SFTA 3FVDA 2YLAA 1V08A 4NHVA 1M3UA 1EC7A 5FSDC 4PCPA 2CHOA 3OA5A 4DLMA 4YIWA 1F2JA 3ZXWA 1OF6A 4KCVA 4JICA 4WSKA 3WQPA 1B3OA 4ZMGA 3OYZA 4IFRA 1SZFA 1XIGA 4Y9AA 4QS5A 4O53A 3VOIA 2FVMA 4FNQA 1D2KA 1L9WA 3DFPA 4A6GA 2XIMA 1Q45A 4I5XA 2D3LA 3MI3A 1L6GA 1UH4A 3E38A 1HX0A 5ABFA 4LAZA 1UG6A 1PWMA 2V5CA 1H60A 3FJLA 1L2QA 1LQAA 3EPMA 2POTA 1KCZA 2UY2A 4WDUA 1QI4A 2GGEA 1T6MA 5LNVA 1US0A 4O0ZA 5AHLA 3IIXA 4JIRA 1HJXA 4JIHA 4L9YA 1EP1A 3RX3A 2RUSA 3M0JA 1J2WA 2ZUWA 4UR8A 4Q22A 2PB1A 4QQUA 1A80A 1D7FA 3BLPX 2YCJA 4IMDA 1WDWA 2Y2WA 3TQVA 1N7KA 3MB9A 3H4XA 4XZIA 2CWNA 5CSYA 1W3TA 5C5YA 4OHQA 3HV8A 4OOZA 1FVPA 4FX6M 4YU1A 4NI8A 2PGEA 3LTPA 3LCLA 2VP8A 4PEEA 1UR1A 1HJSA 4PB5A 5IDZA 1NWUA 3DFNA 4UTHA 2CHNA 1WKYA 3WNLA 3UBPC 5AHEA 3VUSA 1TPVA 3WN6A 1N8WA 4PUJA 4QJ4B 1MEIA 2WZHA 2CLLA 3UESA 3BMXA 1TTJA 1HG3A 1KXTA 2VEKA 4I90A 2OFJA 4H83A 2QDDA 5CC7A 5HQMA 4K37A 4XD3A 2RJHA 3V4BA 3W38A 2X2GA 5BU6A 7PTDA 4J2PA 4REQA 2GGHA 2D20A 2QCGA 1SW0A 3N12A 3T0DA 1QJWA 3I7QA 1XH2A 5HJXA 1TMQA 4KPLA 3L4TA 1EOKA 3QFWA 3IV8A 3N25A 1OFQA 2NLIA 4C6PA 3OVPA 4LGXA 2V2DA 3LGGA 3GDRA 3HPFA 4K8HA 1G01A 2QHAA 5BZAA 4NUWA 1GPWA 2FFIA 4H9MA 3MSRA 1B4KA 2WPGA 4NU7A 4YCPA 1ZBCA 3VABA 1L6WA 1P4CA 2Y8VA 3M6DA 5IFPA 4JFSA 1X1OA 1PZ2A 4BY3A 2G37A 1IR1A 5CC6A 4MZ1A 8A3HA 1YRRA 2PDWA 1WBJA 1DWHM 2Z25A 3NQGA 4E8CA 4WXZA 3KW3A 2HVNA 1EWDA 3BG3A 5TQLA 2VOMA 5CPMA 3G2GA 3AYVA 5I07A 1KGXA 1JPKA 3DGRA 1AQFA 1MXDA 1J0ZA 3S2JA 3VKAA 3WQGA 3ZT5A 3RO6A 3TZNA 3BV4A 5I09A 4DF1A 1Q13A 4TMBA 3U2EA 2PZ0A 1ZCCA 4PMXA 4D8ZA 5BNKA 2DIJA 3SSZA 4CVUA 1F73A 3QKEA 3HBLA 3W1LA 3EWWA 3MUIA 4DUWA 2JBMA 2NVCA 2WVVA 3UU0A 3WLJA 5CZ0A 1YTKA 3ABRA 4LRTA 4ENLA 1WPCA 4XAPA 5FAJA 5A2CA 3W1MA 4U3CA 4ACYA 3QTPA 3KBMA 1R3TA 1XGEA 5KEZA 1W9UA 3AO0A 3CAVA 4CGTA 4WDTA 4UNIA 4AF0A 1ESWA 1DTUA 1U30A 1E56A 3EWCA 3ALFA 4JX6A 2Z1VA 3HGJA 5DRIA 3WLLA 4ADTA 4IMGA 3LSBA 1VR6A 1K8CA 2CBIA 4LVDA 2FMNA 3AS1A 3FAXA 4MJ4A 3WLTA 4ES4A 1RBAA 3AQUA 3LI0A 2E1WA 3UNTA 1CTNA 4OOUA 4A2SA 3SJNA 3EDFA 1I6NA 1E15A 1V6YA 4UFHA 3ZR4A 4HYWA 3TWBA 2OO6A 2D73A 3Q67A 3PUGA 1H4PA 4F0HA 3E74A 1ZBKA 4C65A 1GOIA 3VIOA 2WSRA 4RE4A 3BAIA 4BR1A 3CEUA 1XFCA 2QYGA 3TR9A 2VL4A 1VHNA 2ZRVA 1DXFA 1FP9A 3LLDA 1W1B1 1WKEA 4GX8A 1O5XA 3SURA 2GWGA 1VBJA 1FCBA 4FXSA 1WX0A 4DJFD 4IGSA 2JK2A 4WY0A 4GUIA 3URAA 3H26A 1H1ZA 3P14A 2YYUA 1VEMA 2EG6A 1RPXA 1DQWA 2NUWA 3AISA 1VCVA 4HOZA 1YNPA 2PDMA 2Z7KA 4JTAA 4LUTA 4M56A 1RA5A 1V6TA 3IVTA 1Q6CA 2VTFA 2J8TA 1CENA 4C6MA 4CN6A 3M9YA 1E0TA 2OELA 3EYPA 4L80A 1O5KA 1TG7A 5FF4A 3CUGA 3T05A 5K9CA 1S2TA 4AWUA 2RGLA 4FNPA 4HCDA 2E3ZA 4GA8A 3NJ3A 2XINA 3TZFA 2CETA 1SFJA 3AS2A 3OTRA 3QZ6A 1LUCB 1WQ5A 1H7NA 1ZFJA 3T1GA 4WK9A 2BASA 5CC5A 3LZ3A 3EXRA 1DKWA 1V3LA 2J6VA 3H2FA 5CG7A 1WV2A 2GVLA 3M7SA 4XO7A 1PL9A 1D3HA 4C6NA 1H1YA 8TIMA 4K7YA 1KFEA 3WDIA 2PP3A 1O6IA 4MAZA 2YOCA 4GJJA 1XG4A 2WBGA 1BSLA 1M68A 1P0BA 2V6AA 3LHTA 1JYWA 3URBA 1VCGA 3W7PA 4LALA 4HYRA 3WQ8A 3L23A 5I24A 4UMCA 1VCFA 3VO0A 1R8LA 1EYWA 2MUCA 4XD4A 3WQOA 1CCWB 2FQIA 3PC0A 3C8NA 1FKXA 2OB3A 1TUXA 4H3DA 2ATMA 1KM4A 1W5MA 3T9PA 3OGRA 4C91A 2WPBA 4M6QA 3G1AA 3VUPA 2ZZ6A 3BG5A 4XZHA 3PUDA 3GIPA 1T41A 3WNPA 5DCEA 1R3QA 3LHVA 3R5EA 3FEQA 4PUNA 4YTSA 4M80A 1A47A 1PJ9A 2KAUC 2Y5JA 4UTKA 1IEVA 4GYFA 4S23A 3CWOX 6TIMA 4IIDA 2YJQA 1VFLA 3QV9A 2GSJA 5HR6A 3JW7A 1EJTC 3F5LA 4XZNX 1GQNA 3VOJA 1C29A 1IZJA 3DI1A 3T0BA 1HFBA 3DZ1A 1WDDA 4FA3A 4K1GA 2Y8UA 4IISA 3EKGA 1KM2A 1AJ2A 5CGMA 3LGEA 4ZQMA 3HA1A 3WEOA 2ISFA 2ABBA 2FIQA 5GNXA 2WHJA 3EOLA 1CGYA 2OOGA 1NP0A 3UR8A 1B1YA 2BXZA 1T5AA 4N9DA 4IPNB 1K02A 2P0IA 1KXVA 3PBYA 1KCLA 4XQ6A 1FRBA 1GTHA 2Q09A 3N2BA 3B0PA 3G1YA 3EWUA 1TVPA 5D2TA 3QOKA 4JXCA 4K39A 3UJFA 1T0OA 4H8HA 1GEQA 1MMFA 1M04A 4Y9PA 1E1EA 1KM3A 3K1GA 3E2VA 4JN7A 4L1WA 4D6EA 1WDQA 5DMMA 4IT1A 3DHDA 3U7BA 3SCTA 4W7WA 4FLOA 3KVJA 3TR2A 1UC4A 1AZ1A 4CEUC 9RUBA 1H49A 2E6YA 2JQXA 3L21A 3T2OA 1UROA 2WO5A 1JZ6A 3O06A 2YXOA 1H41A 4GYPA 1PE1A 1FFRA 4XSLA 3LHUA 7A3HA 2J7GA 4MTVA 5G4WA 1E1FA 3DENA 4CNUA 4RPPA 1J0IA 3AHVA 2CLEA 3WQ4A 4D6DA 3DECA 1HUVA 1FCQA 5C9ZA 1OEPA 3U4AA 1F05A 3W85A 2AKZA 1XBXA 3G6MA 1KRCC 1CGWA 1B57A 1TYGA 3E0IA 4AXKA 4MLRA 3DAQA 3EX2A 2TMDA 1EHNA 4O16A 2W3ZA 1ICPA 2AAAA 4S38A 4Q7NA 4IJRA 3ZSSA 3KP1A 3HJZA 1Z8AA 2Q8LA 4DYJA 3B05A 4PULA 5M1TA 3TTQA 5D2WA 3HG3A 2UY3A 3WMLA 4MG4A 3NTYA 2D22A 3FA5A 2ZE3A 4ATWA 2VM8A 3U57A 1LBMA 4C1KA 2XYLA 3NVDA 3VD7A 2HISA 5LA0A 2Z1BA 5C9WA 1T96A 4FXFA 1OBAA 2ZUTA 4JTKA 5MHBA 3PP7A 1WXJA 5C2CA 4PYSA 4JR5A 3KVKA 3N4FA 1AUSL 4F2UA 4GCAA 4P2VA 3T0TA 3W1XA 4RV8A 4TR9A 4PBEA 3KDNA 3IEBA 3QF0A 2P1FA 4JN8A 1RV8A 4B5NA 4CEXC 5C71A 2YKKA 4M5PA 3CXOA 4DI8A 4GOAA 2Z6IA 3BARA 3NPXA 4L65A 1MYRA 3FVMA 5HPCA 5C6MA 3OQ8A 1SJCA 2YDRA 3CAKA 2OQLA 5FF3A 4OT7A 1PS9A 3CZLA 4AY1A 1OCNA 1GK8A 1QHOA 3NR0A 1X8CA 2CESA 1DP0A 3UG4A 1DWJM 3APYA 1FH9A 1TWSA 4LUSB 1R38A 4K1WA 3FA4A 3FEMA 6REQA 3SGUA 1IEWA 4ZO6A 4ACZA 3KX6A 4J1OA 4C6DA 4KWSA 1BAGA 4BQ3A 5CAHA 1CECA 3ITTA 3DBPA 4JS3A 4QSFA 1K4GA 4X61A 2YA2A 4LS1A 1R9ZA 5BMWA 3XISA 3CS2A 4BEUA 3AXXA 2RHGA 4ZSTA 4HA3A 3PPGA 2VCCA 3KRSA 4FHAA 4TVDA 4DF0A 1A5LC 4ORMA 1B3WA 2YCLB 2QT3A 3EX3A 1Q5MA 4TV5A 4DJFA 2PF8A 3KAOA 5M3WA 3HF3A 4Z2GA 3MHGA 3DEQA 2ZUMA 3KOWA 1C7TA 3VDAA 4O1AA 3LU2A 1OADA 3I10A 2ZRYA 3VM7A 2QAPA 1XLJA 4CCDA 4DO4A 2D24A 1SJDA 5F2IA 3BSMA 1B4EA 1K4HA 4IG2A 1L2UA 4MPQA 2WJFA 3KVMA 4B2DD 4R34A 3N6QA 3SUSA 3AFBA 2Y61A 3LHYA 4LUYA 4RE3A 4HHPA 3OJGA 3AIVA 2ZA3A 1XBVA 2HK1A 2PDJA 3I7RA 3STGA 3SUVA 3QV7A 2DUAA 1LQ0A 1XG3A 1NEYA 4HNNA 4ZQOA 5D9NA 4LOCA 1GVYA 2VZVA 4FOKA 1Y8BA 2RDWA 1XBYA 3C2RA 3WNKA 4XWUA 1TMHA 2V81A 1OX5A 1R2TA 2PLMA 1TPB1 1OD0A 2P3ZA 3S1UA 3IVUA 4Q3MA 5JMUA 3M4HA 2WSYA 2IKHA 1KA9F 3OA3A 5DT7A 3VGEA 4DZAA 4NL1A 4MKSA 2A1YA 3TAKA 2X42A 3NAVA 2GOKA 4X2RA 3T44A 3ZWTA 3CUZA 1TV3A 3NL5A 3C2YA 3GR8A 3I4EA 5EU9A 3OLEA 1NARA 2EJAA 2DQXA 3E5BA 4LEQA 1MFUA 3LCHA 4RPQA 3W2JA 3WUFA 1ISWA 2OR2A 3B9AA 4GI9A 2OT1A 3LDVA 3M5XA 2VEGA 3S5OA 2E5CA 3YPIA 1G7UA 1J0HA 5CPOA 1YYAA 2ZQ0A 3EKZA 1P1XA 3SGZA 3G1SA 3S1VA 3GBEA 2A7NA 3R13A 4BK9A 5LIWX 3RDKA 1B5TA 3CT7A 3FHAA 3MZ2A 4AXNA 2VZUA 2WKJA 1J0JA 1E5NA 4Q8OA 3BMVA 1BEUA 2PLKA 7REQB 3L0GA 4XUGA 3B3DA 2WZMA 2NV1A 3C3UA 3F2BA 3FYOA 1HN1A 4GI4A 3M7WA 1HKWA 3AZTA 5DELA 1XUZA 1DJYA 1Z32X 1PTGA 2Z1WA 2X7WA 3IIZA 4ADSA 1IXOA 4TVCA 4Q4SA 1AQ0A 2ZVRA 1S1PA 3KM8A 4MDPA 3OZMA 2GSEA 3S9YA 3BK0A 3I6EA 2VYOA 3VGFA 4CQ9A 2Q6ZA 1Q6DA 2QCCA 3CIVA 3SN4A 2YZRA 1EJRC 1SR9A 2Z2UA 4B90A 5HWMA 3OQEA 3STFA 3MPGA 3O15A 2J77A 2YIHA 3AXIA 3QY7A 1NFGA 3L67A 2NSOA 5GJPA 1J9YA 4Y96A 3SCRA 5FJTA 1ADOA 4DJEC 1C8YA 2ZBTA 4ZVJA 2VENA 1JULA 3BICA 3DUGA 3GNRA 4TV6A 1VEPA 2X09A 2PSNA 4NZCA 4L4OA 4Z2JA 5CPLA 2PDBA 3PG8A 4HZ6A 3UVAA 1PSCA 2GVYA 1GUVA 4QJ3B 3S5ZA 1JDEA 5JIPA 5LIKX 1ME9A 4LF2A 4QGCA 4PMRA 4UOQA 1F6KA 2O92A 3UP8A 3TFCA 2Z0IA 5DMNA 2NQ9A 4JIIX 2X0HA 1TRDA 5AKQA 4G8TA 4DBUA 2FVLA 3KE0A 4F48A 3LENA 4KRTA 3FJNA 4OJYA 3W2MA 4B4FA 1Q6LA 4ZGYA 3NDOA 2QJGA 3F4NA 2DU2A 3URNA 1JDFA 1MDRA 3CL7A 3KVLA 1KR0A 3LTYA 5LNWA 4IIHA 2VR2A 4NJIA 2X2YA 4B91A 2E6FA 3PY2A 2WCGA 8XIAA 2O9TA 2OYLA 3NOYA 2CZEA 4JHOA 1R3WA 2A85A 3VNZA 4P7OA 2XIOA 4FX8A 1ISXA 3V35A 5HDRA 2V8ZA 3OG2A 1KBLA 3B8DA 2A7RA 1SW7A 4Y6GA 4RDZA 1J93A 3AROA 3FKRA 5EMLA 1ITCA 1KLZA 3B04A 3PZGA 4BI5A 4GY0A 1FH8A 1OK6A 4DN1A 3CAWA 1PDYA 2EKGA 2WCAA 1AODA 4PCFA 5I3HA 3UT0A 3V1HA 2H8ZA 2JF6A 3NQEA 3BLEA 2P8BA 3AXKA 1JIBA 2G96A 2VEPA 2PBGA 1KWGA 1ONWA 4J40A 4Q6JA 3BCFA 2Q02A 1W91A 4V2XA 3M43A 2VXNA 4JHZA 2X30A 4ML9A 4EK7A 3GHSA 5D09A 4WD0A 1GOMA 1TTQA 1K6WA 1XSKA 3NGJA 3CV6A 1DWAM 3K8MA 5I79A 4RXFA 1FWJC 4PTWA 2ZUSA 3GVQA 4AZ5A 8XIMA 4AHQA 5EMUA 3UZWA 3IGUA 2O9RA 5U4NA 4W9TA 3W7MA 4KEZA 3F2CA 3PSVA 4LVBA 2ALDA 1RQHA 1BKSA 1PUDA 1U33A 1GYMA 4PUDA 1OIMA 1IWBA 1P7TA 3KXQA 4DEFA 2B4GA 5AB3A 5EGRA 4YN5A 3UEQA 1WZKA 4BWLC 2WQDA 5AYIA 5H91A 4C6EA 3PBGA 3ZIZA 3VOHA 2BB0A 3N9SA 3ZFHA 1Y7VA 4OGZA 1HVQA 5D8WA 3UXAA 2E40A 3LXAA 3KCJA 2A21A 4E6MA 4W84A 1QPQA 1VS1A 3ITCA 1E6XM 2H8XA 1DBTA 1J5TA 2V9DA 4MZ8A 2PDUA 2DZWA 3IIVA 4ZFCA 4H6KA 1JUKA 1KQZA 3BZGA 3VX1A 1QNRA 4NT0A 5EL1A 3UF9A 2RKXA 5XIAA 2Q3OA 4HSOA 5HQEA 4B4HA 2GJPA 1MO0A 1KWKA 1IHIA 2CIPA 2QGHA 1UR8A 4V28A 3CM4A 2XIBA 3U48A 2QCLA 1I9CB 1ODUA 1TR1A 4C1NA 1OVDA 2RAGA 1J4EA 1YBQA 1XIFA 2D2GA 2DZTA 4GKTA 5D02A 2TSYA 2O55A 1HJVA 1TJ2A 1XLAA 4ALDA 3MSYA 3P81A 4NXSA 5JUVA 3JZEA 4PCNA 2GVEA 4MYAA 4IIEA 2EJ1A 4O4WA 3TN4A 3FLUA 4UB9A 1VD6A 3T2QA 3NQFA 5JBEA 4EIVA 2OX4A 3N3TA 3PN8A 4NJGA 4PE8A 1EGZA 4XZ9A 1PTAA 1LWIA 4F3HA 2C14A 3TC6A 4HCHA 1G4TA 1QOXA 3L2LA 2OWXA 1GQJA 5A3HA 3OLIA 5GJMA 1ZGDA 5FA5A 4DJED 4RUBA 1VYSX 1GJWA 4S3CA 1Q65A 2JIWA 3JS3A 2I5GA 2OWCA 3QN3A 2QCDB 4B3ZA 3SADA 3UWWA 1CT5A 2J7FA 1VIWA 1UWQA 1NFPA 4CNNA 4HK5A 2RGMA 2PGWA 3AUJA 3PTDA 3B9DA 4UZUA 4W87A 1EA0A 2V2HA 3WF0A 1EGVA 1W17A 3POHA 5MKGB 4ZZ9A 3GLCA 1MW2A 4QQ3A 3W7HA 4ZCWA 1V6XA 1SPQA 4WKHA 3NPVA 2YBUA 1XCFA 4AZ6A 3G8EA 2Y5SA 4G56A 2YZ5A 1Q2SA 2HBVA 4RL3A 1M7PA 4O11A 3PSWA 3RYSA 3FY1A 1P6BA 1SO3A 4H4IA 3OPSA 3BANA 4AIBA 1B9ZA 1RQEA 1A50A 4LC6A 3HIJA 3P0WA 4LVGA 2VEFA 1IIHA 4I8DA 3M0VA 3E2SA 4HZ7A 1X8FA 3IJ7A 4AISA 2ZXDA 1PHWA 3O6DA 4R7JA 5CZKA 4QIUA 4L4LA 3T0AA 4F40A 2QJHA 3S2MA 1XC6A 3MA8A 3C5QA 3KRBA 3BAXA 4CD6A 4Q8QA 3D47A 3MDUA 3GSMA 4K6AA 5AC7A 3G1FA 4UQ9A 1HQTA 3WJXA 1ZJHA 1RSCA 4PMDA 2ODOA 1TIWA 2VC5A 1LRQA 5A2BA 2B81A 1O60A 4KEUA 1EC8A 4IXHA 4ZOEA 3U6WA 4O8AA 2VVNA 3NQ8A 3QHMA 3C2VA 1FWRA 2ZXAA 3L4VA 1LLZA 3DBNA 3PBWA 2OQHA 3W1AA 4RCXA 4PMYA 4EPKA 4JFVA 1PPIA 4WXYA 4W93A 2VRQA 3LZ5A 2VDHA 4JFTA 1LCOA 3EX1A 1N2VA 4GVFA 3TA6A 3S1WA 3CUJA 2PURA 1KKOA 2W0UA 1NWRA 1WCGA 3MCNA 5A6SA 3DHUA 4IX0A 4QDMA 4WKFA 2AMGA 1F3EA 5CBJA 4J3SA 4S3GA 2P76A 2E9MA 4KQNA 4S3BA 4ZOCA 4ICMA 4B5TA 5IRPA 3SCQA 1A49A 2PWGA 4IGNA 1TWZA 2PFHA 4KETA 3LM3A 1EDTA 3MKCA 1QO5A 3AHZA 3W88A 3H2MA 4AD1A 1V77A 1W3LA 1X1ZA 2W5FA 3STEA 2YX0A 1C90A 3NURA 3MMWA 3GNXA 3WNOA 2YB1A 3GX9A 3VVGA 1QOPA 2CLHA 1A0EA 1XL9A 1Q63A 2PDQA 3LBOA 1J11A 4Q33A 2J88A 1LG1A 2VC6A 1HO4A 5BCAA 4A22A 3MC5A 3M6YA 1UUOA 4JAWA 4XX6A 4LNYA 5DXXA 4I9MA 3R7MA 3QPYA 5LGXA 2PCEA 2PZNA 2Y7FA 2PP0A 1UQYA 4DPQA 2VX7A 1SJAA 4EWND 2ONEA 3BWWA 2ZICA 4A05A 5FEXA 2UV8G 2CFFA 3RCMA 3W1PA 3QY8A 2QAFA 3FV9A 4D6FA 3S0CA 2VFEA 3AIUA 5HMEA 2HCVA 4O1BA 5BWFA 1GVSA 4Y9OA 3UW6A 3UPMA 3DHPA 4B5VA 2GVJA 3BLFA 2YL6A 2BY0A 2XISA 3RGTA 3WJWA 3V0SA 2R9RA 3OG3A 3R10A 2REQA 4DZHA 4H04A 4W85A 3PZQA 1BYBA 1G5AA 1XXXA 3C8FA 3CH9A 4L9XA 3NCOA 5KZEA 5CAKA 1XJBA 3WG6A 3A5VA 1PKYA 3UA3A 3VKBA 3KBWA 2C0AA 4MY1A 2W67A 1QI2A 1D8CA 7TAAA 1TJRA 4PSPA 3W1UA 4ASTA 2W62A 5D04C 3TYZA 4AVOA 2ZA1A 3W7OA 4S3EA 4HJWA 2I9EA 3GU9A 3C3NA 2Z2BA 1H50A 5C0QA 4JQ4A 1RA0A 3QZEA 2GDUA 1F61A 3UZZA 3NZRA 5CPQA 2PC4A 4DBSA 3A21A 4GQRA 1M65A 4O8RA 3TYUA 1K8YA 2WYSA 3TSBA 3GM8A 1ZENA 3BOXA 3G1RA 3B8TA 1SZRA 3T8LA 1JCYA 2X05A 3A22A 5CSSA 3IUIA 1Q6EA 3K4WA 5AHIA 4E38A 1DJIA 4J3ZA 3BGJA 1PV8A 2BGSA 3RMJA 2FB2A 3VDGA 4UTUA 3A9IA 3BTNA 2OSYA 3OHIA 4HZ8A 3QGKC 3LEPA 3GTHA 3N34A 3WL1A 1KTBA 3BAWA 4ZODA 3T8QA 2DUZA 3QMRA 1E9LA 2PDGA 4H41A 2NUXA 2NLYA 1UASA 2BS9A 3PUEA 3V0TA 1KO0A 4XBJA 1GKQA 2BVYA 3PZNA 2R1KA 2WKGA 3V75A 4R9XA 3T6CA 5D4YA 4NNBA 2HS6A 3W76A 2YA0A 3FAWA 3U2ZA 3ATZA 4M29A 3TXVA 2J74A 5T8GA 1YIXA 3GXNA 1N55A 3R0KA 1YXYA 1V3MA 1EXPA 3UJSA 1JPHA 1ZU8A 4TO8A 1IWAA 1FP8A 3B0XA 2BOFX 5HNTA 3ZT7A 4WDXA 5HNUA 5DLCA 2FVKA 4BQ2A 3VTRA 4IIBA 4Z2IA 4UFKA 2VUNA 3G3DA 1QOQA 5LXXA 4O0KA 5I3JA 1HZYA 3KBJA 5XINA 1HL9A 3S2NA 3P84A 4MUZA 1F07A 4MJZA 5FJUA 5REQA 3DKJA 1F3TA 4PL2A 3ES7A 3GH7A 3L4ZA 3QFEA 4HSHA 4J28A 1CZ1A 2DT0A 1R0MA 2PC8A 5F4XA 3WDHA 3UXLA 3CB8A 1EF3A 4ILSA 4DIAA 1CX9A 1R2RA 1MZRA 4KERA 1L0PA 3V16A 1KR1A 5EYWA 1U83A 4CN1A 1VJIA 4HN8A 4HHMA 3VX0A 2GL5A 3VE9A 3AYRA 3WK1A 1TVNA 4Q8UA 4W8AA 3UWQA 1MWOA 2O7SA 3WBXA 3KS6A 3W74A 5F1VA 2BDQA 3UCQA 2YPIA 2NWSA 2ZTKA 4LXFA 5MF5A 1E4LA 3R4IA 4GACA 3ZLFA 1RCQA 3TYDA 3BSGA 4X9SA 4UCGA 4F0MA 4YMZA 3O0FA 3V1PA 2P10A 1FOBA 2XM1A 1W5PA 2PDPA 4DNHA 4X60A 1LT7A 1B54A 1P43A 4MVAA 4AC1X 3GXTA 4QNEA 4I9AA 2ZC1A 4CNTA 3ME3A 3AZRA 4JL1A 4B3KA 3TE9A 1TPUA 3MYOA 2X7VA 1RLDA 1RQBA 3GRIA 3REQA 2X8RA 4JTEA 1ZQ5A 2GK1A 4LANA 3WUEA 1SO4A 3UD6A 4DWSD 5DEZA 3K8LA 2PLJA 3VDHA 1JCXA 4GIAA 2NT1A 2XFYA 4AD0A 1JZ3A 1P0NA 2C79A 3S83A 4GINA 3HJEA 1ZUAX 3FKKA 4ICNA 3M44A 3PB2A 3CYJA 2ZDRA 4M6PA 1AH4A 1H5YA 1PYFA 3AOFA 4Z1AA 1CPUA 2W79A 4WZHA 3TTYA 3LMZA 3FJ4A 1TTIA 4JQAA 1OABA 3BSHA 4KWWA 2GLKA 5K4XA 5KZ6A 3U3HA 1K77A 2XSXA 3EXTA 4TTGA 1FXPA 1EC9A 1IWPA 1Z69A 5G2HA 3WBWA 4LT9A 3TEVA 3SRHA 3B0VC 1JCNA 3PBUA 1JI2A 2ISDA 4AHPA 2BSLA 1WZMA 2G3IA 2XGZA 5PTDA 2A5HA 3DFHA 4PEKA 2J9YA 1C8VA 1TKKA 4J4KA 4O4VA 3WD0A 3GXPA 2PTYA 4FF7A 1E71M 1EH9A 5HMSA 1VJZA 1NY1A 2XH2A 2PTWA 3GDTA 4XSMA 1HJUA 4YYFA 1SQ7A 4IUOA 3IIOA 3F03K 2EG7A 5E6YA 3RLGA 5HUPA 5HJYA 4AFYA 3CIXA 3N11A 3MHFA 1N82A 3TJIA 4GUHA 1UZ4A 4WCJA 3R6IA 3WDRA 1E72M 1IGWA 3FDGA 3EDJA 1EIBA 1ZRQA 3O9NA 3NOEA 4CKQA 4QTGA 3RAOA 4EX4A 1LWHA 4MYXA 3SIMA 2BVTA 3AS0A 2WLYA 3MUCA 6A3HA 4AVFA 4US6A 3TROA 1TZZA 3PZ9A 4IP5A 3MBDA 2CLMA 3VDBA 2RJGA 3O6CA 5L9FA 4AG0A 3W7QA 3W87A 4KIEA 2O7QA 3ZVIA 1A5AA 3OW1A 4MFEA 3VK5A 2V3FA 4UFLA 3ARZA 3ARUA 3SB0A 4UC5A 3QGAC 3PJTA 5AHFA 1JAKA 2D2JA 4MWAD 1IEQA 3STPA 3URQA 1UBSA 2EEXA 1E6QM 1XCXA 5M2FX 3T40A 4M8UA 4R5EA 4RE0A 3ATYA 3GUWA 5K4ZA 4MZYA 4FMVA 3WLPA 3L4UA 4L5ZA 2R14A 1QRQA 1VFHA 1PKLA 3L9CA 1UPPA 1W54A 1E3XA 3JRKA 5F2LA 3W07A 3TTEA 3PZTA 4LBSA 2VZOA 4KWVA 4HU0A 4MGGA 1O1ZA 4FP1A 2JFEX 1S3TC 4BS0A 1XH1A 1OF8A 4DWSB 2FDSA 4PN2A 4OZOA 2BHYA 1XH0A 2Q3RA 1OCQA 1OFPA 1I8JA 4D1IA 4OUEA 1RK6A 1DYSA 1OQFA 1W3HA 4FB7A 2YW3A 1OX4A 2PE4A 2VELA 4LCSA 2XGIA 1BVZA 4OTKA 2WC7A 4XIAA 3IACA 3KTXA 3CC1A 1BRLA 1O94A 4NAFB 2CEQA 4YVPA 3WBAA 4Q8MA 3A9BA 4IWWA 3H7VA 4I7VA 1H2JA 1YQ2A 4G7EB 2FPVA 4JX5A 3ABXA 1GVOA 3CPGA 4HMCA 5RUBA 2HE8A 1Z44A 4DY1A 2FTPA 3EOOA 5AOUA 1XLIA 3VINA 3TSDA 2WJDA 3WCZA 3CLWA 2VO5A 1HJQA 1REQB 1G9HA 1XIIA 4UTJA 4GG9A 3VNYA 4A35A 1ZJIA 3VNMA 4DF2A 3H55A 1QHZA 4ZOBA 4I5UA 3WNNA 4CN4A 4G2DA 2A3AA 1RH9A 1X39A 2V3GA 2E09A 2WHMA 4MPKA 1K1DA 1QK2A 1TZ9A 5HATA 3T2PA 3G6LA 1LLWA 2WVTA 5KETA 3HM7A 4QE1A 3WFLA 5D30A 4PCTA 4IJBA 1C3FA 2E68A 1M41A 1VPYA 1VRDA 2BXYA 1PX8A 4C1LA 5E1QA 4U10A 2CLIA 3BZJA 3VZXA 1JVNA 1B30A 3NO5A 3RLVA 3TV8A 1A3XA 1KBBA 1XLCA 4JTDA 3AWNA 3KBVA 4GZJA 2PD9A 4GVIA 5LNRA 3SRDA 4LC8A 4OE7A 4RK8A 1DIDA 1QAPA 4LV4A 3Q58A 2ZDSA 5DMYA 2V63A 1TA3B 1BXNA 4MWAB 2XSBA 2BGNE 3H7RA 3GK0A 2VJXA 5DCBA 3FCPA 2VR4A 1UIPA 4KGLA 5ENLA 3W23A 3FA3A 3WD1A 4ONVA 1H0GA 3RPTA 5AC8A 2WM0A 4PUMA 4PMJA 4IGHA 1EKOA 1LOQA 4EAYA 4WSHA 1TQJA 2DIEA 5HINA 3LK6A 5DT5A 3RUBL 1PXGA 3WLIA 2CZVA 3IARA 2OTDA 5LHFA 3CUXA 1MZHA 3L2MA 2Y85A 5C9UA 2L5HA 2BWGA 1YNYA 2VDGA 3CB3A 1DJXA 3B9OA 1AQMA 3JZUA 1OFOA 2ON3A 3GAYA 4Y8FA 1A5CA 3PFRA 1SZEA 3DU0A 3OIHA 4M6UA 3SBFA 3R79A 1F6YA 3G1VA 3CUFA 2B7NA 3NVTA 3UERA 2ZIDA 2PI6A 4DO5A 4U2ZA 2CLFA 4G1KA 5BRQA 4YCOA 1BKHA 1LT8A 1UYQA 1Q6FA 3BLKA 1TSIA 4QNWA 4R85A 4AZCB 2C18A 2UZ9A 3RM4A 3P0XA 4H9ZA 3U2CA 3TTSA 1OZQA 1XRFA 1J5SA 3QQWA 3USBA 1TRIA 2E1DA 3W01A 4JTCA 2XN0A 1JZ8A 4PUEA 2J78A 1PKNA 3WLKX 2XZ9A 1VFUA 5DRCA 2NXGA 1WB0A 3QV6A 4CNSA 1SVDA 4W86A 1IXPA 4ICCX 5G5IA 4ZXLA 2HNHA 2D2OA 3W72A 1FDJA 1Y0EA 5F4SA 4C6JA 5C7HA 1P1MA 3TLQA 2ZCGA 4BA0A 2JGYA 1IEXA 4POCA 4GNJA 3K30A 3QEZA 4V15A 5KTLA 3GIYA 1V3JA 1GOQA 4BJHA 2R6OA 4TX8A 5A2AA 4CNOA 2HXTA 5BMXA 2QUTA 4ZB5A 2I56A 4I6VA 1RCXB 4AU0A 2XVPA 4CNPA 2QR6A 1EQCA 4NAFA 3TYCA 2Z7GA 5EA9A 2CCRA 2J7HA 4MNKA 4QG9A 1XP3A 1SJBA 4L4PA 4HT3A 1A0CA 3PPHA 4L7ZA 3TSMA 4L61A 5FI8A 3VZZA 3QZAA 2OYKA 3BLLA 3H7UA 4UNKA 1ZCOA 3IGHX 1W1PA 3SY5A 1BHGA 3ZR6A 2AOSA 5I78A 3Q4DA 4UQCA 4B9ZA 1QPNA 5AYYA 1E0VA 1TPWA 2W92A 2GJXB 5ABHA 1B31A 4MHBA 2Z26A 2DSVA 1TE6A 5AC5A 3LRKA 1M9HA 3QSRA 1E70M 4IIFA 5CQ1A 4DUVA 1KD0A 4OBRA 3BW3A 3SY8A 5C54A 1S5NA 3TQ0A 4B5XA 1HKMA 2BLEA 1XIMA 4HMEA 1JGIA 2W61A 1XPGA 2PTDA 4DVOA 3W6LA 1UKPA 3MMUA 3OP2A 3ZO9A 2ZC8A 5LXEA 3GFXA 3L0KA 2PDFA 3LD5A 2XPKA 3PUOA 1XDJA 5DY3A 3UZXA 2Y7DA 2NX1A 2G5WA 5D2YA 2ZWYA 4X63A 1C7SA 2DY3A 4F8XA 3VNKA 3CQHA 3EAUA 1ADDA 2JEPA 3OOQA 5I3IA 2OLAA 2WC4A 3C2OA 2Y6ZA 3FSTA 4DLFA 3U2OA 3VPLA 3W29A 2POZA 4ZO8A 3P3BA 3RF9A 4PMVA 3WQVA 4JNYA 4JTIA 3WUGA 2ZZ2A 3USZA 1VKFA 3GIQA 3EWZA 2AKMA 1LBFA 1JEZA 4IUGA 3FGCA 2DQWA 1ZJAA 3INPA 4Z2HA 3H6OA 4J7RA 4HU8A 3PNZA 1P6CA 3LPFA 3MSDA 4Q8PA 5ABFB 3AIQA 4JDBA 3CZEA 4MADA 2AGKA 2C1GA 4NIRA 3LLXA 4PL1A 3GE7A 4BFAA 4G7FA 1XS2A 1DE6A 2C6QA 1O95A 2F8QA 3A6OA 5A1AA 3CEPA 3E2QA 4Y9MA 4ZOAA 5FEZA 3LBCA 3GDLA 1WZAA 1RZMA 2RDUA 4MKNA 3SCWA 4KWOA 2FZMA 1P5BA 3EGJA 1XLHA 4A8IA 3OBAA 1IF2A 5FAGA 1QHPA 1ZPTA 2EKCA 2VQUA 4HN4A 1JCLA 4X0NA 2ZX8A 2ZUNA 1FTXA 3S5SA 1W1IE 3MY9A 2PDKA 3VCNA 1KBJA 4O12A 4AC7C 1DJNA 3OBKA 3WH9A 5C7VA 4G1NA 4BF5A 2P3EA 3GG7A 2BHZA 2IPGA 1YADA 3QHNA 4RE2A 4KGJA 1J6PA 1OB0A 4MIMA 1ADSA 4F9DA 2BNJA 1TV8A 3I65A 3O05A 1XSIA 3GZAA 3B9NA 4DBEA 2FH8A 3WD2A 1TJ1A 1EF2A 1GONA 1W1YA 2CLPA 3PR2A 3BLIA 4XKYA 4ZQPA 3VKCA 5BW6A 5IXEA 2O0TA 1L6SA 4CD8A 3SAZA 3THDA 4FZIA 1E6SM 1LRTA 4HP5A 1QWKA 4M3PA 3DX5A 3WJZA 3UWZA 3VKDA 4LF1A 2PWHA 4REQB 5D8ZA 4HB7A 4ERGA 3LPPA 4QLLA 4JIQA 3M16A 1TCMA 3GFZA 2AL2A 4LAKA 3OYXA 5D37A 3RM9A 4WY0F 1RVKA 2WW5A 1KV8A 5LGZA 3MMTA 3S3GA 1E5JA 1S46A 4GGHA 1K9FA 2ACSA 3LCGA 1D3CA 1KBIA 4RW5A 1OT1A 4AEFA 3C52A 3TIMA 3ERPA 3TQPA 4R7WA 1BPLB 1L6FA 4OV9A 2EPLX 4HPHA 4YYCA 4FIRA 1GEHA 3LV6A 3EB3A 1LP6A 4W5ZA 1MW0A 3T55A 5D2XA 1A5KC 1XR2A 3LUTA 3CMFA 2H3BA 3QVQA 2DUXA 3MU7A 1IQ8A 1SO6A 3KHDA 1SMDA 4WQ6A 4IMFA 2YCEA 4JGDA 2V3DA 3IAQA 5LIXX 3UY7A 1ZALA 3W7JA 3PZMA 4I6KA 3S8HA 4MKVA 3HG5A 2PU1A 4I3GA 2TODA 4Z2LA 4AD5A 4M82A 1CXLA 4P7LA 1DJGA 2VURA 2G97A 3UR2A 3ZJ7A 4GZ7A 4KF1A 2G0WA 1EPVA 1ZP3A 3WDPP 1A5OC 5KSWA 1V4YA 1HVXA 3PTQA 5FJRA 1NSJA 2WNZA 1LROA 1G6CA 1KFJA 1M03A 4RNIA 4WRHA 3G1HA 3VILA 3TH6A 4O13A 4RZ6A 3IIPA 1NDZA 1SYTA 3SCNA 1K9EA 3W7RA 2WVVB 4HNOA 4MNMA 3CQIA 1Q8JA 3BW2A 1A5UA 4F4RA 1HF6A 3QY6A 4GXPA 3MVTA 3VI2A 5EB8A 4KRUA 1A3HA 3A23A 4IQEA 2YBTA 4LNCA 2QCHA 4GZEA 3ABQA 2ZUVA 4XBKA 3HQPA 3BURA 1CYGA 4N42A 2V5LA 4AF0B 1O66A 4DAFA 4P8WA 1T7LA 1W31A 4F0KA 3SECA 1JUBA 3N2XA 1OM0A 1NOWA 2X0SA 3GO2A 4GPNA 4KEVA 3BAYA 5C9RA 4NASA 4HA4A 1DWFM 1U1UA 4FR1A 1RP9A 1V93A 3N9KA 1GPFA 5M5DA 1RVGA 4RW3A 5A6KA 2EPOA 4OBSA 3MUZ1 3NM1A 3T09A 4YTRA 4Q4RA 2A3CA 2ASHA 1QNSA 1E6NA 4GYKA 1FQ0A 3CV2A 5AC4A 4DJFC 2DT3A 1EJWC 5IFTA 4KESA 2GGJA 2ZRWA 2OKOA 4CQDA 4RX0A 4DRSA 1D9EA 2BY1A 5BWAA 4C6BA 2V82A 2WZEA 1NJJA 2FJKA 2WAGA 2WJEA 3SI9A 1F6PA 2WMJA 1TUFA 2E4TA 3EX4A 1J10A 1A4LA 2DZXA 1UWRA 1X7FA 3EWYA 2ZFAA 5I3GA 3PULA 4AIUA 1GVEA 4W8BA 3PWGA 1WDSA 1KXHA 4XBSA 3NZPA 4WY0B 4OU1A 1IXQA 2PP1A 2EG8A 4EANA 1NF7A 4K8EA 3N4AA 1VF8A 4LCRA 3Q37A 2QMJA 4KBXA 4LUTB 1KW1A 3MO4A 4IFKA 1V6UA 4CCCA 2PPGA 4FLQA 1VZWA 4E5TA 3N19B 1LRNA 4NAEA 1WDPA 2J47A 2OSXA 2PD5A 3FHQA 3PS7A 1GKRA 4MFDA 3W4RA 3F5JA 4AD2A 1W56A 1TPDA 4HA1A 3CT2A 2V5KA 1EPXA 1HL8A 1K70A 3T81A 1OGSA 2J4GA 1XUUA 3H70A 5IBXC 3D3FA 4O15A 1XI3A 2QULA 3IUDA 4TU1A 1C92A 4R88A 1O5QA 2KZHA 2VVSA 4UCFA 4URIA 2JGQA 1PAMA 2QIWA 2YL9A 4QITA 3SEPA 3TW6A 4JIPA 4QM1A 1UUMA 4FOUA 3U4FA 1XCWA 4LUIA 2Y7GA 1HKVA 4KCTA 4EF8A 3L66A 2PWEA 4PUWA 2WSKA 1E6PA 4FIQA 3THAA 3DC0A 1JG9A 4GUJA 4O28A 1QUMA 1GHSA 2P50A 5CZSA 3COTA 4W88A 4O1EA 1H11A 1Y5WA 4JTTA 5I6SA 2WSPA 2QUVA 3VC5A 3NQMA 3ABZA 4QISA 3CU2A 1UB3A 3U5YA 3N15A 4HPJA 3I3DA 2ICSA 5F7UA 1XLEA 1NAL1 1BXBA 4YVXA 4NG3A 4BI7A 4NQ1A 2CXEA 4J5NA 1AW1A 3THQA 5HNNA 2XHYA 4IFOA 1ELSA 1JUEA 5FEPA 3C2FA 4N2YA 5BOFA 5CSUA 1GQIA 4HNCA 1MW1A 3MTWA 3WLMA 4JFUA 2QDGA 4Q7BA 1KQYA 1P6WA 2J6XA 3M64A 3WH5A 3PPCA 2XH7A 1NIUA 3GG1A 3B8IA 3KUMA 3LX9A 5C55A 1DJWA 5FF2A 1US3A 1FH7A 4BQ4A 3E0LA 3BG9A 2CXGA 1XV8A 1RJRA 3KOFA 3TWAA 2OGYA 3PPFA 3W81A 3BVJA 5JU6A 1PIIA 2QCFA 1RLCL 1XIDA 3U8GA 2YA1A 1YXDA 4ZTXA 4LYKA 1YTDA 3MO7A 2JE8A 1TREA 2OO0A 3GTIA 2P53A 1LQ2A 2PF0A 1R46A 2QMKA 4QLKA 2YCKX 3MWCA 3D5HA 4FAMA 3TLLA 2C3ZA 3ANYA 3A13A 3AU2A 1RCOB 1VRXA 1YPIA 3VIPA 2GUUA 4WDWA 4EXBA 5JBDA 4WEVX 2D2HA 1IXNA 3OLGA 4N9EA 3LERA 5K7JA 3ANVA 3EMCA 1W5NA 4YNGA 2FGBA 3BUVA 1ML1A 4WR3A 4RZ5A 3W70A 3D6NA 1X6UA 2IKIA 3VE7A 3G0XA 2VZSA 1MUWA 4MOZA 1XYZA 3CTTA 5A8MA 6CGTA 4A4AA 4O18A 3FJ6A 4AW7A 3W1QA 5CZJA 2B7OA 3UNDA 1GVFA 4ROQA 1BYAA 2PBOA 4U4MA 3OGVA 3LV5A 1H62A 5F1UA 1GVQA 4U33A 2NSXA 3UXIA 3AAMA 5IHSA 4WIWA 3SFKA 2J7EA 3EWDA 4TOQA 3B4UA 5ECUA 4NZ3A 4M7SA 2E77A 5DBTA 2BG5A 4DO7A 2HVMA 3VIIA 3R89A 4IZGA 1Q6RA 4GZIA 2OEJA 1O12A 3WD3A 1JR1A 1JDCA 2O9PA 1YDVA 3ES8A 3W28A 3NO3A 2DSUA 2V38A 4DPPA 3IPWA 1XRVA 1GQKA 3SCPA 4H1ZA 1AL8A 2GGGA 1TWWA 1G1YA 3MI6A 2I5IA 1UR3M 3UR5A 3L5LA 4QEEA 4Z1BA 2ZRUA 3LXBA 2IPJA 3LCXA 4LU0A 1QW8A 2HK0A 4JTSA 4MNLA 2XDFA 4KMQA 4O19A 3WKZA 3GTNA 5AHNA 3RN6A 1LOSA 4JDYA 1FA2A 4E4PA 1BVWA 4JD4A 2F6KA 4UXDA 3W7GA 4W8LA 3H2NA 4H9TA 4GCXA 1AVAA 2PDLA 4ATDA 4FALA 4FPSA 1TFVA 3NYZA 3C4UA 3WYZA 1Z89A 1Z42A 4LX4A 2ZADA 3EEZA 5EMKA 4GC4A 4PTDA 1TPFA 2E9LA 4N7QA 1DIKA 2ZA2A 5D2VA 2QVNA 2J7DA 3DKLA 4M19A 3WQCA 3PJUA 3W7DA 1CB7B 2QCEA 1QPRA 2Z4GA 5G2WA 1WOAA 3AHYA 3GXFA 1R47A 3ZLGA 3HMJG 4F0LA 1V0MA 1A53A 4B16A 5D9MA 3OZOA 1CLKA 4R53A 3FNDA 1ITQA 3PM6A 6REQB 4B9YA 3OODA 3A3HA 3PBVA 4XISA 2J75A 2PGFA 3E0FA 4ACZB 3C2EA 4NY2A 4GH3A 2A4AA 4NILA 3F7JA 1JNEA 3C0JA 4C6FA 9XIMA 5U7SA 1NWSA 1MFVA 2RDXA 4XVDA 1DWIM 3V5CA 2EF9A 1VC4A 3D0CA 4N6EA 3SY1A 4UR9A 2NV9A 4FR6A 4IP4A 1BGGA 4C90A 3TKFA 5FJPA 1EA9C 3BJFA 3UWUA 2WKLA 3HFYA 4S3KA 1YE6A 4W89A 1JFXA 3M07A 2PAJA 1UD8A 2RDTA 3DI0A 1FDYA 2XU2A 3P60A 1O4UA 4ZR8A 1W1A1 1N8IA 1NDWA 3E0WA 4JTLA 3SUWA 1YPFA 1EJSC 4LVAA 2GYIA 3L4WA 2EPMX 4XTDA 4AWEA 2A3HA 4IG2B 2GVGA 2WXDM 3H2CA 2QPUA 4GI6A 5AN7A 1B9BA 3N29A 3LI1A 3WLRA 3E5PA 4X0VA 2H6RA 3AMDA 3S6TA 2C15A 1V79A 2SFPA 4B5UA 2YBVA 3NUKA 3EXSA 3UZ5A 1BTMA 2HEJA 4N0RA 1R6WA 2DT1A 5BXTA 1NVMA 2FHFA 4MSSA 2Y0FA 2O4QA 1RHCA 3VU2A 1KGWA 2OSWA 4HNLA 4MJ2A 5I00A 2AMXA 3ZS4A 1WAWA 1HKKA 3S6DA 2XFRA 1JJKA 3O0KA 1UP0A 3U0HA 4LJ3A 1J6OA 3H54A 4F2BA 4LBRA 5DFAA 1KM6A 2VWSA 1JFHA 1S1RA 3N4EA 1C9WA 1GQLA 4ML4A 4ZL1A 1AZ2A 3O63A 3S42A 2VFIA 4QROA 1S2VA 3PZOA 5AZ1A 4U28A 3TYEA 4EACA 1WUEA 1A4MA 3BAKA 3GH5A 2Z1XA 3VNIA 3VOGA 1GVRA 4RXGA 2VX4A 2BVWA 4NRRA 1GOKA 3NQAA 4UQDA 3WY1A 4GMEA 5GVJA 3M0HA 1YW1A 2DSKA 2VFGA 1G94A 3PZUA 3NSNA 2XIIA 2AGTA 3AWOA 4XB3A 4AWTA 1D3GA 1KM0A 1J0YA 2OT0A 1UH2A 5J8LA 4XZWA 2E8ZA 1B3YA 5CBBA 2YDQA 3BLOA 3TMQA 2E6DA 3M0YA 1SR0A 3UGRA 1QPOA 1JPMA 1PDZA 2CHRA 5J5RA 3VYLA 1DQUA 1E4IA 3GG8A 1NH6A 1W2PA 3RLHA 5D03A 4DBWA 1OYCA 4C6OA 1JCMP 3C0QA 3N17A 4XZMX 2IPFA 3R0UA 1ME7A 3W75A 1B3VA 3B0UX 5D32A 4UQEA 5I3FA 1DJHA 2JKEA 3U5UA 2VD9A 3PZIA 5ABEA 3RMEA 5EBAA 1O7AA 1UUQA 4S3JA 3BW4A 5CPSA 4NJJA 2DZSA 4IX2A 1WNOA 4QXIA 4XK2A 4O1FA 1ONXA 3EWBX 3QYQA 1XYBA 2O9OA 2GJNA 5A8OA 1S39A 1UMYA 1XYLA 2XVKA 3M41A 1WYIA 1DXEA 4IPJA 3K5XA 3N2CA 4HPGA 3H8AA 2PDYA 5C8BB 3WUBA 3WO8A 3LS9A 3M47A 1FWAC 3RJYA 3K13A 3PANA 4G5DA 1OFEA 3ISIX 4WGXA 4ZB2A 3LLFA 3RLUA 4HMNA 4P8VA 1TTPA 4DJDA 2E9BA 3QOMA 2PTXA 1AMYA 1GJUA 1E3ZA 2ZZ7A 3ARTA 1W3NA 1M7XA 1EXBA 3BL3A 1VB9A 2WOQA 5K9DA 3HG2A 3P5ZA 3W27A 2VRJA 3TN5A 1MI3A 1JPIA 4HBKA 2I7GA 2X16A 4GWEA 4GY7A 2H9AA 2PA6A 3SCOA 2VGGA 4E3VA 1XSJA 3GR4A 3RR4A 4PMOA 4DM1A 1C8XA 2WK2A 5JH2A 2NVAA 5C2GA 3J7HA 3UQNA 3UXKA 5JVLA 1UQZA 1OFAA 4JYEA 3ONCA 4CD4A 5FCZA 1EBGA 3H53A 1YKWA 3MV11 3WQWA 4EOUA 1V03A 5CSRA 4EPEC 4UNLA 1MQRA 4X3ZA 3WJSA 3BJSA 3TUUA 1VJSA 3NZGA 1OK4A 5E0FA 2ADAA 3W2KA 3IRSA 4LBUA 3BV7A 4K68A 4GBDA 1W2VA 4O17A 3WL0A 3RRAA 1W37A 3TOPA 2YYTA 5A69A 3OGSA 2F7FA 2AAMA 5IM51 3AIWA 3FYPA 1Z9AA 3RU8X 3AI0A 2DH2A 2NQZA 1XD1A 2QQ6A 1AH3A 2IUZA 1OG6A 1GZJA 1AW2A 3CHFA 3L68A 3M5VA 4O52A 4OV4A 1EDGA 3NL6A 1LL6A 1JF6A 4IQDA 4Y9NA 2V3EA 2PRMA 2ZX9A 1V3KA 2D0HA 1A5BA 1LTDA 3MHUA 3WENA 1KTCA 1GVIA 3CO8A 3FX4A 7CGTA 3A3WA 4S3FA 4N6FA 3IK2A 3B9EA 4GISA 4JL2A 3KBNA 3QBUA 3RU6A 3W22A 2NUYA 3EEGA 1FWSA 1CBGA 1W5QA 3UYIA 3IJLA 1MVYA 2FHBA 4TQTA 3QMTA 5A6TC 3WFZA 4WOZA 2W66A 4UIOA 2X1IA 1Q7QA 4H7CA 3AMGA 1R7OA 1O1HA 3IAPA 2PCQA 1XDMA 4AD4A 3L12A 3I6RA 1US2A 1J96A 3WLHA 3R94A 1R86A 2QUMA 3CJPA 3FXYA 1UR9A 2HDJA 2FZ8A 2NZLA 2Y1HA 4QHRA 1FXQA 1P7TB 7TIMA 4M6VA