4OV9A

Structure of isopropylmalate synthase binding with alpha-isopropylmalate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
385
structure length
380
Chain Sequence
PKTIHIQDVTLRDGNQALKRPWTIDEKIEVFDLLVELNVDGIEVGFPSSNETEFHTCQVLSKRAPKGKPIAALSRANQNEIAVTWEAIQKADCPRMHIVYPVSDFSIKHVLKISEKEVLQKIRNSISFARSIVGPGIEIQFSGEHFGDAIENFAFTKEAFLTAIEAGANIINLPNTVERYRPMVFVNMVKEIKDVVKDKAIISIHTHNDLGMATATSVESVYVGAEQIEVALNGLGERAGNTNLYETAIALHQNGENLNINFQRIYPTAKRISELTGIPIGEKTPIIGEDIFSHRSGIHQTLHQSKGAYRTFSPEFVGRMDKETISFTNQSGHKAIEFLLHQRGIQVSKEGIHHLFSLAKSISSRENNREITEAELVALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords isopropylmalate synthase
publication title Subdomain II of alpha-isopropylmalate synthase is essential for activity: inferring a mechanism of feedback inhibition.
pubmed doi rcsb
source organism Leptospira biflexa
molecule tags Transferase
total genus 144
structure length 380
sequence length 385
ec nomenclature ec 2.3.3.13: 2-isopropylmalate synthase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4ov9A01
1SW7A 3IEBA 3TMQA 3P5ZA 4JIQA 5AHIA 3NL6A 3MWAA 3HGOA 1QO5A 2FTPA 2X30A 3LHYA 1SZNA 3QSTA 1KM6A 1MEIA 4JYFA 4O8RA 2RDTA 1I8JA 4N6FA 5KZDA 2VXNA 3RLVA 4BWLC 2WO5A 1H61A 4PODA 4G1KA 2H6RA 5D37A 4H3DA 5C54A 3L0NA 3CU2A 2NUYA 1DJQA 3DI1A 2BWGA 1KFCA 4ZQRA 3PBWA 3W1UA 4FNRA 4XUGA 4A3UA 1KM3A 3QPZA 3EWUA 1QO2A 3PVFA 3HPXA 4JTGA 3W2LA 4ADTA 3HB9A 2PRHA 4ORMA 1H5YA 5K3VA 1KV5A 3LRLA 4U28A 4YCPA 2E6DA 4GFSA 1UUOA 3MP4A 4TO8A 2ZZ5A 3W2MA 3RU6A 3HJZA 3G1SA 5HWJA 3NAVA 2F84A 3SFKA 3S1UA 5CSRA 3BLFA 3HGSA 1ZNNA 4DQWA 1S3HA 4NNBA 3EXSA 2TPSA 4Z1DA 3PM6A 4CQ8A 1SO5A 2BX7A 2BLEA 3C3NA 4OGZA 4WY0A 2YCEA 1SUXA 1RD5A 3I7QA 3WK3A 1OX4B 5C6MA 2RDUA 1ICSA 4JY8A 3OVRA 4IPJA 3W7EA 3IIXA 3UWQA 5F2GA 2DZUA 4CNPA 5D38A 4BI7A 1SFLA 2WPBA 3S9YA 4HN4A 3GNNA 3GXPA 4RZ4A 3EWYA 2X1TA 3IV3A 1CX9A 1TYGA 1YPFA 2OT1A 2NXHA 1KM1A 1B4EA 1W56A 1IXNA 4CCEA 3O16A 3O8AA 4PCFA 5U7SA 5EY5A 2FPVA 3EWBX 1ZAIA 2CLIA 1VHCA 3LGEA 1LRTA 1W5NA 3N19B 2RDWA 2HS8A 2YPIA 3TAKA 2A21A 4CQAA 3R89A 4ADUA 3PULA 2B7PA 3HGJA 2J24A 2W79A 4IMFA 1QDSA 1RR2A 2RHGA 3KVKA 3WK0A 4GUFA 3SR7A 4AHQA 3N3MA 2JK2A 4Q4KA 5EKYA 1GVSA 2ISWA 5FEPA 1FDZA 3RFAA 2GPTA 3Q94A 5LNVA 1N7KA 3EWWA 2VENA 4QIUA 1MEWA 3FYOA 4YCOA 3C56A 3LHTA 4DF2A 4OT7A 5LKYA 4OU1A 3C8FA 3W7QA 3W7LA 3OVQA 3TH6A 2NWRA 4O28A 2RH9A 5G1TA 3LDVA 3WJSA 1ME8A 3G8RA 3GDMA 4Q33A 2DJLA 5FF7A 4AB4A 1GQNA 3G3DA 4PL1A 1C29A 2C3ZA 3NPVA 3PF3A 3W1LA 4YMZA 1NSJA 4C1LA 3NPUA 1KTNA 1VCVA 2ZTJA 3L65A 2YGYA 2XN1A 1KA9F 3W7RA 3QFEA 1Z41A 3UNDA 3M5YA 4NZJA 4O14A 3RLUA 3G0SA 3TX9A 3W7PA 4JNMA 2TSYA 3W2UA 3RMJA 3I6RA 3EEGA 2B7QA 4UTUA 3W7DA 3P8JA 4MIMA 2QCGA 4L4LA 3FLUA 1OVDA 3R12A 4GNJA 2OT0A 1JUBA 1KW1A 3C2EA 3W72A 4RXGA 4EF8A 2QCLA 3P60A 3W88A 3CB8A 4HNVA 4U4MA 5IBXA 5FF0A 2A5HA 3EWZA 4DBEA 3GYEA 4O52A 3PB2A 4JTLA 2WSQA 3GXTA 3EXRA 3T55A 1EP2A 1AG1O 2QEZA 2O7QA 1PHQA 3CT7A 1EWEA 1BWLA 3W7IA 3NQDA 4MKNA 3GXNA 3UZJA 3LXCA 3FOKA 3M1ZA 3BLEA 2VEKA 3TCEA 1EPXA 4BR1A 1G7VA 1XM3A 1KFLA 4AHOA 4ML9A 4KFNA 2EGZA 2NXIA 4JX4A 1BKSA 3UXDA 1FWNA 2GJLA 5CSSA 5BMWA 1JR1A 1L6WA 3UPWA 3NNTA 5I3GA 4MY9A 1TTPA 2C13A 4X22A 3G1YA 1W3NA 6ALDA 4JX6A 4BK9A 4Z0JA 3NEVA 2PC4A 3NPWA 4XBKA 1ADOA 4LS0A 4OQVA 2TRSA 1XL9A 4S2CA 4ZVJA 1CW2A 4O13A 4E2DA 3USBA 2Y7EA 3G1HA 4MZ1A 2W6RA 3LTYA 7TIMA 4O19A 4O18A 2ZTKA 4EIVA 2GJNA 5DY3A 4JTTA 1QR7A 1YTEA 4GE8A 4R33A 1TQJA 1THFD 5C5YA 3P80A 1OFEA 3MI6A 2E6YA 5F2MA 2V5BA 4MYAA 5J5RA 1VLWA 1YXYA 3FS2A 1H7PA 4ZQPA 3JRKA 4HSOA 3TSMA 3T44A 1QPRA 1TREA 1OYAA 1X1ZA 4LVDA 1IXOA 3FEMA 5LNWA 3SECA 3GIYA 4IMGA 2TMDA 1O4UA 2GQ8A 2ZRUA 4K7VA 4PTNA 3UXAA 2ISSA 1W5OA 3S5ZA 4QITA 1VS1A 4WZHA 5E0KA 3E0IA 1M6JA 2JBMA 2DZVA 3W7JA 1OFAA 2AAMA 4M6QA 4OE7A 4FXRA 4O57A 1SU5A 1LYXA 4EVZA 1I2RA 4IPIA 5DCDA 1LOSA 1R2RA 3W70A 3DHDA 3C4UA 5ABTA 2GOUA 1PS9A 4RJEA 1JULA 2YYTA 3LOTA 2WNNA 4LUJA 3FA5A 2VEMA 1RZMA 4LY8A 3W3OA 2E6FA 1LM1A 3NQGA 4OWGA 3STCA 4LU0A 4E38A 3CC1A 3LBCA 3N14A 5D04C 5HWMA 3EX2A 3TSBA 2ZYFA 4UTTA 2V2CA 1EB3A 2DP3A 3W1RA 4LTSA 4WOZA 2VEIA 3DXIA 3HBLA 1FCVA 1RPXA 5AHEA 2HMCA 4AWUA 3UWWA 5LZLA 2B0MA 1TRDA 3PUDA 3BG3A 1U5JA 1LOLA 4O10A 2LLEA 3W1TA 1B4KA 2ZZ1A 2HSAA 1O60A 3NQ7A 5HQEA 1KLZA 2WV8A 3PY2A 2TYSA 2WNZA 3LX9A 4P61A 3G24A 4O53A 3O6CA 1HG3A 2CZEA 3NZ1A 3G8EA 3TXZA 1NF7A 4RKAA 5CZ0A 1H7NA 2PRLA 1Q3NA 1A5CA 3MMTA 3F03K 4I7WA 1D9EA 4DXVA 4PFMA 2J9XA 4O1BA 2Y6ZA 3W07A 3G3MA 5FEZA 3M43A 1HTIA 3G18A 3QYQA 4N6EA 5AB3A 4HKPA 5F1VA 2NV2A 5CPNA 2Y88A 4ICNA 4Z1BA 3W9ZA 4WQ6A 1OFRA 3HF3A 3MI3A 2E1DA 1I2QA 3EKZA 2C19A 1KBIA 5DXXA 1FWRA 1W0MA 5CKSA 1IGSA 1LDCA 2A85A 3SI9A 4JTUA 2YX0A 2G96A 4BF9A 3DFTA 1FX6A 1B9BA 1QWGA 1ZCOA 3BK0A 3HOJA 3IVSA 1YDVA 2NWSA 1FXQA 5K2ZA 4UTWC 3C2VA 3FKRA 1X1OA 3KHJA 1L2UA 3Q2DA 4FB7A 3ABSA 4N9BA 1F74A 5EBUA 4O50A 4HIBA 2VFDA 1H1YA 4JYEA 4JD4A 4MY1A 2UV8G 4RV8A 4CCCA 2FQIA 1TJPA 3W86A 1JQXA 4FX6M 1W3IA 1WYIA 3BW3A 3M5VA 4N4QA 4UTLA 4UFMA 3DGRA 3WK2A 4K39A 2CZ5A 1P0NA 4QNWA 1GVQA 4JXCA 3MHUA 4ZQCA 5LNUA 4MFEA 2Y70A 3STEA 1R30A 2NX1A 2P10A 5DCBA 1XI3A 2QUVA 1O5KA 4OBTA 3I65A 3LERA 4NT0A 3B06A 1BWKA 3O6YX 4QM1A 2ZZ6A 3F4WA 4PH6A 3BGJA 4O17A 3L5LA 1FBAA 2ALDA 2VFIA 5D2YA 3V75A 1E51A 5D2WA 3VI2A 5KTLA 2EAWA 4N9EA 4J9JA 3IGUA 4QJ1A 2I14A 1F7BA 2QJIA 3KRZA 1T96A 4FIQA 4MJMA 2FIQA 2CLEA 4FNPA 3B05A 1J5TA 1IXPA 3EKLA 4IJBA 4TR9A 2DZSA 4A21A 3PG8A 2QCDB 1VLIA 3NZRA 2O7SA 3BARA 4IXHA 1T0OA 3C2FA 3L0KA 2X2GA 3QEZA 2GVLA 4AF0B 3LTPA 2NX9A 3A23A 3QQ0A 1UASA 3N2MA 4O0ZA 1ZENA 2QCNA 1S5WA 3UQNA 5G5IA 3KVMA 3TFXA 4Y90A 3T4CA 1WBJA 1P0KA 3THQA 4NXKA 2VC6A 3LCLA 4XKYA 3V1PA 4M19A 5D2XA 2CLHA 3TC6A 4R7JA 4BI6A 1XFBA 5F4SA 1U83A 5CZJA 2YFOA 5D2VA 3CQ0A 3L9CA 4ZL1A 3IGXA 2Y63A 1YDNA 5G4EA 2ZRWA 4RR4A 2YFNA 4LWWA 3M5ZA 1TPWA 3QM3A 4ADSA 1SR9A 1TPFA 2W0UA 3N2XA 1PE1A 1BEUA 1GTEA 2A6LA 1YTDA 2VFGA 3I7SA 1LBFA 2C0AA 4D2JA 3THAA 4K36A 1XKYA 3TNOA 3OA3A 1DKWA 3LRKA 1WOBA 2D73A 1HUVA 2QCMA 4A22A 1EUNA 2X1SA 5DBTA 4IOTA 5HMSA 3TQ0A 3PUEA 4N2YA 3GKAA 2CW6A 4LRTA 3DFSA 4UNLA 4CQ9A 1HO4A 4IWWA 1G4EA 3LLDA 5U4NA 2PURA 3QMSA 3O07A 1TV7A 4DF1A 4FXSA 4LVFA 3W7NA 4M7SA 4HHPA 3S1WA 4CNNA 1W1ZA 4O12A 4UCGA 1LZOA 2BXVA 3W85A 4IGHA 1VYPX 3MUXA 1UB3A 2KZHA 4JTJA 4AHPA 1TV8A 1DQXA 2GQ9A 3P61A 1QPOA 2PE4A 3TKFA 4LVGA 3STGA 2NV1A 1DHPA 1EIXA 2E5DA 1IXQA 1TQXA 2JGYA 4NZFA 3M7WA 1KTBA 4MYXA 5I3IA 4UFKA 2A7RA 1JQVA 1S5TA 5FEXA 3BW2A 2A0NA 2FB2A 1B3OA 3PBVA 4LVAA 2Q8LA 3NQCA 3L0GA 2WOQA 4GC4A 4MY8A 2JGQA 3M0ZA 3NG3A 1ME9A 1YDOA 1OK4A 3W22A 1WV2A 2IQTA 2CLFA 3BO9A 4AWSA 4TU1A 4GJ1A 5DXYA 4JYDA 5CG7A 3WJXA 3UD6A 3PS7A 3E02A 4JS3A 5LNSA 2Z0IA 1W3TA 3JR2A 3LI1A 5G2WA 3PWAA 3EXTA 1DORA 2JKAA 5K4ZA 1H7WA 1AK5A 1PCKA 4DPQA 3NQ8A 4Y6GA 2CU0A 2YZRA 1SW3A 2ZZ7A 3P82A 2A2IA 5L6UA 2H3BA 1V7YA 2J6XA 4I7UA 4OV9A 3SJ3A 2ZA1A 1ZY9A 3NQMA 5CGQA 1KM5A 1OFBA 3CLMA 4IXXA 3G1DA 3WJZA 4AH7A 4UR7A 1PCWA 1W31A 3E49A 2WSYA 5HULA 1K3UA 2VFFA 5IM51 3B0VC 2ZZ3A 2QCHA 5CZSA 2B4GA 1YLVA 3DAQA 5IBXC 3EX6A 4UUIA 1Q6QA 4WUIA 3ZWSA 1G4SA 5K9XA 3HPSA 3NPXA 2ISVA 2QR6A 2XN0A 2Y62A 3QF0A 3ZR4A 1K8ZA 1YXCA 2QAFA 1L6SA 4GWEA 1LORA 5FEWA 3P81A 1GZGA 3LLFA 3TK7A 1OF6A 1GT8A 4HNUA 3W1NA 3K30A 1QPNA 1MEHA 5EMUA 4WXYA 3WK1A 1W8SA 4FX7A 4LOCA 1FWTA 1VYSX 1O95A 1JUEA 2C15A 5D09A 4X9SA 3S1VA 1JRBA 3L67A 1OX4A 2A6NA 3VFLA 4JDBA 1ML1A 2DZXA 1YADA 3LRMA 3D0CA 2ATSA 2DORA 3G1VA 3QW4B 4PL2A 3MO7A 5AHMA 3SY5A 3ATYA 2YW3A 5F1UA 2ZFAA 3IGSA 1TIMA 5H91A 3DBPA 3TJLA 2Y89A 2FLIA 2DJXA 4R53A 1DL3A 2Y61A 1W5MA 1WQ5A 1FCUA 5BOOA 3M44A 2WQPA 1HL2A 2HTMA 5I3FA 1KBJA 1CI1A 1VCFA 2E5BA 4RXFA 1XBYA 3W7OA 3NQEA 4MLRA 5AOUA 1AW1A 2FJKA 2V9DA 4DF0A 4O11A 3GDKA 2PRMA 5FF4A 2Q8ZA 2E68A 2NX3A 5D33A 4HNTA 3ZWTA 2Y7FA 3KXQA 1UBSA 2AGKA 4Z0SA 1TPB1 3RK8A 4K38A 1LLWA 1QMLA 2ZRYA 2V30A 3ABOA 4I9AA 3DI0A 5AYYA 1ZAJA 3GX9A 5HJLA 4AXKA 1WX0A 4Z08A 1OYCA 3L21A 4JTIA 3NR0A 1H7XA 4DO5A 3LM7A 1EX5A 3GDRA 3B04A 1JCLA 4FNQA 1SO4A 1VYRA 5AHFA 3W1PA 5FF2A 3UPBA 5KITA 2V82A 3I68A 3KRSA 4PA8A 2CLKA 1JUKA 1XDMA 1PV8A 5F2LA 3NYZA 1NF0A 4DBDA 2A7NA 4NNAA 1JJKA 3GDTA 2QDGA 2Y7DA 3KVJA 1K03A 1H60A 4HPXA 1A50A 1F05A 3ABQA 1KFEA 3P8IA 2V2DA 3DKLA 1LTDA 4DO4A 1S5VA 1FY6A 4BI5A 3R8RA 1H1ZA 3N9RA 2NLIA 1AW2A 5KINA 4LV4A 3HMJG 1F2JA 4UTTC 2BSLA 3OG3A 3LHZA 1EP3A 2V8ZA 4ORIA 4MVAA 1H63A 4M5PA 2J9ZA 3TUUA 4LT9A 3W75A 4LUIA 1MZHA 1W5PA 2A4AA 1LLZA 3I7RA 5K9DA 1Q6RA 4DEFA 2E77A 3AO0A 1GG0A 1OFPA 3E9AA 4FIRA 3NQ2A 3R5EA 4YXGA 4C1KA 3NO5A 1EEPA 1H50A 4MZ8A 3BG9A 5FI8A 3C52A 3LCXA 3DFPA 4XTDA 3HQ1A 1LRQA 2C18A 3L68A 1DJNA 1W54A 4GUHA 4UMBA 2VFHA 2A7PA 1P1XA 3O1NA 1LCOA 1RQBA 1VPXA 1XCFA 4N4PA 1J4EA 1GOXA 2ZA2A 5K9CA 2GVJA 4YLWA 1VHNA 3ATZA 5HUPA 3CWOX 2NUWA 6TIMA 3C6CA 1I2PA 1OFQA 1GVOA 1VR6A 5KZEA 3LCHA 4KFOA 1F6KA 2CLOA 4AWTA 4DO6A 1V5XA 3IRDA 1F5ZA 4JN6A 2OZ0A 3C2RA 2Z2UA 2ZZ2A 3G22A 3KX6A 1AW5A 3MHFA 1N8FA 4WD0A 2NZLA 4N9DA 3KRUA 3LCWA 1FWSA 1P5BA 1F76A 3A5FA 3YPIA 3H53A 4KKXA 4NXSA 3SSJA 2JKEA 1LBLA 1I2OA 3A22A 5AHLA 5K4XA 1UUMA 4S1FA 2OX1A 1SSGA 3HG4A 4H6KA 1FCQA 2Q3RA 5AFDA 2WJZA 3DFQA 3F4NA 3A5VA 4UTKA 3S6DA 3UWVA 3RF9A 2B7NA 2QKFA 4NUWA 4JGDA 1H62A 4FNTA 2RFGA 3PC0A 3DHFA 4O1CA 2EPHA 2WSRA 3S8HA 3TU9A 1DOSA 5G1YA 1T99A 2OCZA 3TC7A 5HWNA 3GR7A 4PEKA 4ZQMA 4K8HA 5EA9A 1ALDA 2VOMA 3P67A 4JDYA 3NXFA 4AAJA 3HO8A 4NX0A 4JICA 3FIGA 1KLYA 1WDWA 3DENA 1TV5A 2FFCA 2EKCA 4YWIA 4L4MA 1X7FA 3H54A 4HSNA 3W2JA 4POCA 4WY0B 2BZNA 3GLCA 4H4IA 1VC4A 4LVBA 1O5XA 3C2OA 3NOEA 1A5SA 2X16A 3DZ1A 3TW6A 3RNDA 1VCGA 1XUUA 4Y96A 3OBKA 1FXPA 1I45A 1SO3A 4KWVA 3WJWA 2QF7A 4UFIA 1G4TA 1TCDA 3HG2A 1XXXA 4MLJA 5I3KA 4UMAA 1EA0A 3C61A 1KTCA 3IIOA 2QUUA 3LCGA 2I9EA 3O15A 2ZZ4A 4A29A 2RKXA 2GVGA 3LBMA 1R47A 4O4VA 1H7OA 3LB0A 4IMEA 1MXSA 1OFDA 3SIZA 3W1AA 1NVMA 3CHVA 4UC5A 3JS3A 3LCIA 4JY9A 4JTHA 3BLIA 3S0CA 2QCEA 2R91A 3M16A 1YPIA 3S42A 3ZS4A 4MJZA 3M6YA 1UJPA 4RLIA 2CLLA 2J9YA 1I4NA 4FNUA 1YTKA 3GK0A 2YR1A 3GDLA 3NM1A 3P62A 1Y0EA 2V5LA 3NL5A 4LW7A 3OHIA 4I7VA 4FO4A 4NJJA 3CIXA 4Z1CA 4O16A 2VELA 3T40A 4GUIA 3S1XA 4NNCA 4WXZA 4UFJA 2FDSA 3W87A 3NL2A 1KM4A 3CTLA 2GQAA 3DU0A 4RCXA 4MOZA 1ME7A 3QQ1A 5I3HA 3NDOA 4HNNA 1JCYA 3HG3A 3MBFA 4S2BA 5G2IA 4BWLA 4LC6A 4LV9A 4YL2A 2J27A 1TTJA 5TIMA 1JCMP 5D03A 4E0CA 3DFNA 4CCDA 5HUOA 2Z1BA 5D30A 1RVGA 1DV7A 1GWJA 3NA8A 4O15A 3G0XA 4ALDA 1DBTA 4IX0A 1FUYA 1I2NA 5F4XA 4LS1A 5KSWA 4P2VA 3MP5A 5I3JA 1K8XA 2QDHA 3QH2A 1C9DA 3O63A 4AMAA 3TSDA 4AEOA 4A2RA 2VEPA 5C55A 3TMLA 4XQ6A 4O1AA 3EX4A 4E2BA 2E5CA 2EHHA 2E6AA 2ZRXA 1G69A 1QOPA 1KFJA 2YSWA 1SPQA 3A9IA 4GUJA 3HIJA 3PBYA 3PB0A 3E96A 4X3ZA 2CZFA 2ZRZA 5DLCA 4ZQNA 2DZWA 3VNDA 1K02A 1RQEA 3GNDA 5DY2A 5DBUA 3W1QA 2CFFA 1R2TA 2QJGA 3M5XA 4O4WA 4GXMA 1Q6LA 5AC6A 1VJIA 3L2IA 3P84A 4B5NA 2QUTA 3OEXA 1KFBA 4JR5A 5CPLA 1AL7A 4IX2A 4FF7A 1H51A 1EP1A 4K37A 3BV4A 5D2TA 5K7JA 1OX6A 3EX3A 1TTQA 4UXDA 3PG9A 3W76A 3BG5A 4NJHA 2DZTA 3G1FA 1XC4A 3F1QA 2QCDA 1XDLA 3L66A 3FJ6A 3MYOA 3W23A 3W7GA 3IVTA 3W84A 4UMCA 3B03A 5HR7A 2J88A 4X2RA 4AF0A 3QMRA 1QOQA 5G2HA 1GJPA 2C6QA 3QC3A 5LHEA 1FCBA 4OV4A 3M9YA 5H2ZA 1L9WA 1QCWA 3N73A 2ABAA 1PIIA 1R46A 3TXVA 1ZFJA 1WA3A 3OIXA 3TJXA 3CEUA 1SZEA 1ICQA 5AHNA 3QRHA 3G1XA 3GB6A 5BW6A 5EL1A 4ONVA 1F6PA 4Z1AA 4TMBA 1PVNA 1D3GA 5CPMA 1NFBA 5C2XA 1Q45A 1OJXA 2R8WA 1G67A 4UTMA 3CWNA 4Q32A 2WKJA 4FEZA 1FDJA 3W1MA 1EUAA 3SZ8A 5D02A 2XN2A 3LTSA 1TPVA 3TAOA 2FB3A 1RV8A 3AJXA 1A5AA 3SGUA 3LXBA 3PAJA 2H3DA 2ATMA 4FNSA 3GVGA 3VKJA 4FX8A 3B0UX 1QNVA 4K7YA 1IIGA 2OJPA 3KFTA 4NQ1A 4M7TA 4A2SA 1EWDA 5AC8A 4MFDA 1FDYA 3TA6A 4RX0A 1W37A 1XBVA 3TDFA 1UCWA 3LI0A 5MHBA 3L5AA 1MSSA 5BRBA 1WOAA 4MZYA 3TIMA 5L9FA 1KV8A 3W83A 5LSMA 3U6WA 2H90A 4O54A 1G6CA 4NX5A 3W7HA 1WBHA 3UWYA 1SW0A 3IVUA 2V0TA 2X1RA 3LXAA 1JCXA 3A21A 4UNKA 3W1XA 3VCRA 2H8ZA 2OMAA 3O6DA 3VE7A 1F73A 3P5YA 1T8XA 3GR8A 3WFAA 5LGXA 4M6VA 3PSWA 1L6YA 3O06A 4Y8FA 2NUXA 1K8YA 1GPWA 1LRNA 3EWXA 3EB2A 2ZRVA 3BVJA 1TSIA 3QZEA 5KZMA 5E93A 1TPUA 3MP3A 4DELA 4XWUA 1A5BA 2CZDA 1K7FA 1J2WA 3TV8A 4ZQOA 3OVPA 4GBUA 1TPH1 2YXGA 2YW4A 3R2GA 1TRIA 1VQTA 1TMHA 4N9CA 3NL3A 4JTFA 4RZ5A 2R94A 3INPA 4EOUA 3EX1A 1Q6OA 1SZGA 4XTIA 4EF9A 4ZZ9A 2G97A 3NQAA 5CZTA 1WAUA 4QAIA 1P4CA 2QCFA 5AYZA 4RK8A 1TB3A 3FKKA 1M7PA 4BFAA 2G95A 5FF3A 1TTIA 2JKPA 1RQHA 3BW4A 2VKZG 3GAKA 3M41A 3P7YA 2ZCGA 4Y9AA 4QSHA 3PUOA 3U2OA 5DCEA 3WJYA 2Q3OA 2A1YA 4CLMA 1JRCA 3M47A 4LC8A 1QAPA 4MPQA 3MW7A 3CPRA 1PL9A 3E12A 5LNRA 3W6YA 3TW7A 2DZPA 3L5MA 2X1UA 4KWWA 3W7MA 3BPWA 2XFWA 1Z42A 5LHFA 1QPQA 4HT3A 3HGRA 1ZJIA 4WY0F 3KOFA 3KVLA 5GVJA 3TQKA 3LV6A 3IIVA 4OHQA 8TIMA 1AMKA 1YYAA 3UWZA 2G5WA 4RZ6A 3W71A 1XBZA 3FJLA 3ELFA 1VZWA 3CIWA 1TPEA 2I1OA 2V81A 2YYUA 4AVFA 1K7XA 3DH7A 3DKJA 4UIOA 1D3HA 2F7FA 3STFA 1LP6A 2GUUA 5CPOA 3W73A 1IF2A 1H7RA 4LS2A 5D05A 1GEQA 3NGJA 4JTKA 1GYLA 1GVFA 2NXGA 5FESA 2YDAA 4UFHA 3R13A 4IMDA 3HPZA 1XUZA 4NJKA 3QMTA 4ZMGA 4IUOA 1SSDA 4JIPA 4QISA 1C8VA 3NVTA 5A8GA 2C14A 1SFJA 5EYWA 4PC8A 1W5QA 2HS6A 4TIMA 1OYBA 5EPDA 3GZ3A 3G0UA 5DELA 2P1FA 3W7KA 3NQ6A 1GTHA 4FHAA 1VH7A 3CM4A 1ZHAA 2BTMA 3QSRA 2CWNA 2R14A 5HR6A 4O0KA 3B4UA 3TE9A 3W74A 5TBOA 5E1QA 4UFLA 5HNRA 1X6UA 1OX5A 2B7OA 2Y7GA 3KAOA 3CEPA 5AN7A 2V2HA 2Z6JA 3T7VA 4JEQA 3TROA 1FQ0A 1M7OA 2DU2A 4JTSA 3LHVA 3QPYA 3U8GA 1VGAA 1DVJA 4XKYB 3NQVA 3TQVA 4UR8A 1A53A 4K6AA 4LNYA 4UTIA 4W9TA 3PBUA 5DN1A 1KFKA 3IIPA 1AL8A 3T78A 4GRSA 4IMCA 3UY7A 1R2SA 2H8XA 1TO3A 3SW6A 1YXDA 2AQWA 1HFBA 4M6PA 1SO6A 1WXJA 3S5OA 3Q58A 4DPPA 3PSVA 1NEYA 1ZALA 1ONRA 5G4WA 2QAPA 1FWWA 1MO0A 3LCFA 1Z44A 1ICPA 2QJHA 1BTMA 4QQ3A 3A24A 3C0JA 3UWUA 1SQ7A 3NM3A 3W2KA 5KMYA 1OHLA 2ZBTA 1TPDA 1GG1A 2Y85A 4JX5A 4UTHA 4NVTA 3FFSA 4NJIA 1LROA 4CNOA 3ZFHA 5BNKA 5F2IA 1DQWA 1OG0A 4IQLA 5D32A 3N9SA 3P74A 2FPTA 3W2NA 3DFOA 4WOQA 1B57A 3UY8A 2QCCA 1G4PA 2ZQ0A 3GKFA 4NU7A 4LRSA 2Z6IA 2EF9A 5T26A 1O94A 3ANYA 2C1HA 3S5NA 3UYCA 4UTWA 1OFOA 3N34A 2CLMA 4QNEA 1KM2A 1KM0A 3UZ5A 4WX2A 3MBDA 4XZ9A 1LOQA 3MJYA 3PR2A 4WJEA 1M5WA 2ZDRA 4MUZA 4JTEA 1Z48A 1ZAHA 1TJRA 1K7EA 1QFEA 3IIZA 1XBXA 2C16A 1PHWA 3O05A 1JCJA 3BGGA 1SZFA 4TMCA 3B0PA 3ABRA 3GAYA 1OK6A 2WNQA 3TR2A 3LHWA 3QW3A 5F4WA 1JCNA 2P0OA 3FYPA 4HPJA 5J5DA 5LGZA 4UTJA 1VRDA 3G1AA 1G7UA 3MHGA 1NAL1 3LHUA 4XBSA 2VFEA 3Q37A 1GYNA 5BMXA 5A5WA 1X8FA 4R34A 1HO1A 5SWUA 1OABA 1TPC1 5HINA 3W7CA 5TQLA 3LV5A 5AYXA 5AC7A 3B8DA 2FPYA 2ZA3A 3NQFA 2PCQA 4KFPA 3VE9A 1GVRA 3H55A 3MI2A 1JVNA 1N55A 3QJAA 3HG5A 4TX9A 4O1DA 4EWND 1OF8A 4N02A 3MYPA 2ABBA 4K8EA 1LBMA 4GUGA 3S5YA 2E09A 4NJGA 3SGZA 1IIHA 3TFCA
chains in the Genus database with same CATH superfamily
1SW7A 3IJIA 5BZAA 2VD9A 2WZHA 1GW1A 3P5ZA 4X9YA 4ACZB 3WF0A 3ECQA 3HGOA 3MWAA 5DT5A 2X30A 1KM6A 4JYFA 5I24A 1XH1A 1A3HA 2A3CA 5H8UA 4AQLA 1TFVA 5AC5A 4ZO8A 4MTVA 1UZHA 3SCNA 3BWWA 4U3CA 2P3EA 3CU2A 2NUYA 1DJQA 3WD0A 3EDKA 4AZ5A 3VIHA 2PU1A 5JMUA 2GJXA 3NZGA 4LEFA 1W1B1 4LUYA 2Z2AA 1W9UA 5I2UA 3NXLA 4JTGA 4MJ4A 3OYZA 1TV2A 1K9DA 4AX6A 1R8LA 4ORMA 1R3RA 1D2KA 4YCPA 3LRLA 4U28A 1Q7QA 1QWKA 1ISYA 4ATDA 2POTA 1QPKA 4LX4A 2PWVA 4AIBA 3TYDA 2PGEA 1JNDA 3UESA 4XK2A 3SFKA 3BLFA 2F6KA 2Z1SA 3M0YA 1HKVA 2PZ0A 1KKRA 3RM9A 4Q6JA 2YCEA 2FZDA 2OO0A 4H9YA 5A6JA 5D38A 3E2RA 2X1TA 3IV3A 4HA1A 3GZAA 1YPFA 4DWSB 1KM1A 3ZQ9A 3O16A 3AROA 5EY5A 2O55A 2FPVA 3EWBX 1ZAIA 2CLIA 3B0YA 3ZJ6A 1K6WA 1VHCA 3HJEA 3EDDA 2DDXA 3TWAA 2YPIA 4CQAA 3R10A 3UNTA 4ADUA 3AMGA 3PULA 1J6PA 5D9NA 4TTGA 2CBIA 1XW8A 4IMFA 4EAMA 1PTGA 1ISXA 1RLCL 1I6NA 1VPYA 2JK2A 1POKA 2L5HA 3RFAA 4M6UA 3U4FA 5KEZA 1N7KA 3KCJA 3EWWA 2VENA 4QIUA 4C6NA 9RUBA 5JBEA 2P76A 4U2YA 4QR6A 3FYOA 3C56A 4MNMA 3EB4A 1M41A 4DF2A 3I4EA 1EJVC 3ZOAA 3WQEA 1E0XA 2C7FA 3WUBA 1HVXA 4XD6A 5A8PA 1E1FA 3OVQA 1DIKA 1WKEA 4O28A 1U5HA 1XSJA 3WJSA 3GDMA 4DUXA 1GQNA 4GG9A 1CECA 3G3DA 4B5VA 2C3ZA 3NPVA 2H9AA 3PF3A 3IJ6A 4C1LA 4YVPA 1WPCA 2PGWA 1GYMA 1MWOA 1VCVA 4KEVA 1KA9F 4GO9A 5JQ9A 1TUFA 3QFEA 1V3MA 4O14A 1JZ5A 3RLUA 3G0SA 3TX9A 2TSYA 1YNPA 2B7QA 3T1GA 2WMKA 4CN6A 3LGDA 5D9OA 4L64A 2OT0A 3D5HA 3LQGA 4L9ZA 3C2EA 3W72A 1POJA 3WLPA 4EF8A 2QCLA 1Z89A 3CB8A 4HNVA 2A5HA 4HU8A 3EWZA 3QLDA 2A3HA 4DBEA 4DUWA 3KL3A 1P7TB 3RX2A 3EXRA 3T55A 4Z2HA 2QEZA 3BGAA 5I78A 4J28A 2BODX 2R82A 1GQJA 1PHQA 4HHMA 3CIVA 1BWLA 1FWJC 3F5KA 3WENA 3W7IA 4IHCA 2E3ZA 1XD1A 3PZUA 3IK4A 3FOKA 1JZ6A 1YMYA 2QT3A 4BR1A 3HQPA 4ASTA 3ITYA 3AXMA 3IAQA 4JQ3A 4AHOA 4ML9A 4KFNA 3IACA 5CC7A 2NXIA 3GW3A 3OGRA 3UPWA 4RNJA 1SVDA 3T07A 4S3CA 2UY2A 1CDGA 1NH6A 2X05A 2OFJA 4DJDC 3G1YA 1EHNA 3ARTA 1KBKA 1QHOA 1KCKA 4LQ1A 4Z0JA 1Z69A 4DBSA 4RE4A 3NEVA 3NPWA 4XBKA 1ADOA 1OCQA 3SCRA 3UYIA 3I4KA 4S2CA 4URIA 1IR1A 1CW2A 1ELSA 2Y7EA 4FALA 1OB0A 3LTYA 4O19A 4O18A 3W26A 3TVAA 2ZTKA 4EIVA 5CQ1A 1QR7A 2YA2A 1LWHA 1IHIA 3WFZA 2V5BA 1XQLA 5J5RA 4X60A 1JI1A 2XTKA 3ARRA 2XVLA 3HPAA 1Y5VA 1UZDA 5ENLA 3WLMA 1EEXA 3TSMA 3ZJ7A 1TREA 4LJ3A 3NSXA 4LVDA 1IXOA 1IGWA 1XH2A 3FEMA 2QV4A 4ZEPA 3H2EA 2XHYA 1O4UA 1OT1A 1W5OA 3DYMA 3E0IA 1OFAA 2AAMA 3OJGA 1LYXA 4EVZA 4WKHA 4NZ4A 1LOSA 1R2RA 2O4QA 3W70A 3C4UA 3WN6A 3MKKA 2YDQA 1AQFA 1J79A 1J10A 4LUJA 3FA5A 2VEMA 1XG4A 3LD5A 1UKSA 1DQUA 4A3HA 3W3OA 1LM1A 2OLAA 3STCA 1SR0A 1VBRA 2PC8A 1DJWA 4UTTA 3AMLA 1BYBA 3DIPA 4KH2A 3HBLA 1U30A 4Z2IA 5AHEA 4HZ7A 4KCVA 2B0MA 3BV7A 3BG3A 1V3IA 1DWHM 1BYAA 2WJFA 2LLEA 3VKCA 3LA4A 3W1TA 3ZLFA 1WP6A 4E4FA 1O60A 4M56A 3NQ7A 5A6BA 4G56A 1KLZA 3VIKA 4LAKA 3PY2A 1Q6DA 2TYSA 2WNZA 4GGBA 3UR5A 1W2VA 2FZBA 3G24A 4QJ4B 3O6CA 1V8EA 1HG3A 4MB4A 1X7IA 5CZ0A 1C92A 2PRLA 1A5CA 4DUVA 4NP7A 2XM1A 4DXVA 2WKLA 4C7FA 1LL7A 4O1BA 5I00A 2Y6ZA 3WH7A 7A3HA 4DJED 4N6EA 1UWRA 1PXGA 3CV6A 4LNCA 3URNA 3QVQA 2BVDA 5XIAA 2BNJA 4IPNB 2J8FA 1JAKA 1N82A 4JTUA 2YX0A 3AMCA 4WRHA 5HATA 4QAWA 4LAOA 4W7WA 4KRUA 3UXLA 3BK0A 2IW0A 3HOJA 2NWSA 1FXQA 5K2ZA 1TX2A 3FKRA 2E9BA 2YL5A 3FJNA 3ABSA 5EBUA 3VZZA 4JN7A 2VFDA 1DPMA 1H1YA 3GUGA 4PMJA 2HVOA 5A8OA 4E3TA 1QNSA 4CCCA 1MQPA 4QGCA 1TJPA 3W86A 1JQXA 1W3IA 4UFMA 1S2TA 3AHYA 3RDKA 2J79A 2J7HA 1OC6A 4AZGA 4FLRA 1P0NA 1EO5A 1QT1A 4REQA 4PUMA 2OGJA 1YNQA 3EZ4A 5BOFA 2HXUA 5FSEC 2GQ3A 3CLWA 3T0TA 1R30A 4HGXA 4UQBA 2NX1A 4WK9A 2J7EA 4NT0A 4Y9PA 2VJXA 2D24A 3F4WA 4TV6A 4PH6A 3L5LA 3URAA 5D2YA 3V75A 4GY0A 3GVWA 3VI2A 1CENA 2NVAA 4N9EA 4RZBA 3ARWA 5FKYA 4XSLA 3B05A 1IXPA 3EKLA 2DZSA 2YBUA 5DRIA 1CEOA 3NZRA 3EOSA 4PB5A 3B8WA 3BARA 3C2FA 2X2GA 3QEZA 4AF0B 4F4RA 3LTPA 3A23A 3N2MA 3PWIA 1V6WA 3GIQA 3UQNA 4FAMA 4GIAA 3S9ZA 3KEHA 3TFXA 4LALA 2DZAA 4NXKA 4U3AA 5HDRA 4XKYA 2VR2A 3KBNA 2CLHA 2V5JA 7REQA 2WKGA 3CYJA 1Q66A 1TV4A 2VQTA 4BHYA 5TAOA 1L8NA 3W0KA 1SR9A 1TPFA 2E67A 3T0CA 4C6FA 3S9IA 1PE1A 1UUQA 3ZIZA 1T41A 3CUXA 3VNKA 4J3UA 1LBFA 1OZMA 4K36A 1D7KA 4OOUA 3GHUA 4QG8A 4QJ5B 1RY8A 3KWSA 1DKWA 4A8RA 2BVTA 5EB8A 2D73A 1YX1A 1AFSA 2ZICA 2X1SA 1EO7A 5HMSA 4YWSA 3GKAA 2J8GA 1W2PA 3GR4A 4CQ9A 4L6HA 1XS2A 2QJMA 4IWWA 4XZHA 1WDDA 4DF1A 2YXOA 5CXPA 1ZBKA 1Q6EA 4M7SA 4HHPA 3S1WA 1WZKA 4HOZA 5M3WA 1W1ZA 2GK1B 4RE0A 3W85A 4IGHA 1VYPX 2UZ9A 1UB3A 4JTJA 2XM2A 3NQBA 4UWMA 1TV8A 1CIUA 3SCTA 1DQXA 3ZVIA 4WGHA 1RD6A 1Y7VA 2PE4A 3POCA 4LVGA 3STGA 4CVUA 1JXJA 1EIXA 1OWQA 1TQXA 5J8LA 1RCOB 3M7WA 4KPLA 2Z24A 1S5TA 1XRVA 3BW2A 2MANA 2A0NA 2DH2A 1B3OA 4LVAA 2O4MA 3SO7A 3NQCA 5CBBA 3CAQA 3IRSA 3VIFA 3EA1A 2FVKA 2A79A 2Z2BA 2IQTA 4O1EA 4B90A 1UH2A 4AWSA 4NAFA 4GJ1A 2QW5A 5DXYA 1HIZA 3UD6A 3V4BA 1ITXA 4GD0A 5XIMA 5HNNA 4KRTA 1NDZA 4JS3A 1EC7A 2Z0IA 3MB9A 3T2OA 3REQA 5K4ZA 2ZXDA 1PCKA 3M0MA 4HZMA 1VRXA 2VDHA 4Y6GA 4A3QA 2P8CA 2CU0A 4S3BA 2VURA 3WKZA 1KO0A 3E0FA 2A2IA 5L6UA 2DUAA 4L1GA 5CGQA 1GOQA 3G1DA 1MDRA 3NJ3A 1PCWA 1W31A 2DT3A 3E49A 2WSYA 1K3UA 1XLJA 2BBFA 3B9EA 4H9MA 3ARSA 5CZSA 3DAQA 3EOOA 1XINA 1WKYA 4DLFA 5H8MA 4WUIA 3NIYA 1G4SA 5K9XA 4DI9A 3HQNA 4Q4MA 1LORA 3KZPA 3UJSA 4HNUA 3W1NA 1HF6A 1HNYA 1QPNA 3TTQA 4US5D 5I3DA 1VYSX 1FWBC 2EBNA 2PDQA 3L67A 1OSEA 1OX4A 1UWSA 1PUDA 1UP0A 3WUEA 2CLPA 3C8NA 5I06A 5DF0A 4JDBA 2DZXA 3D0CA 2CIPA 4WIWA 1NOWA 3QW4B 3ATYA 2QUNA 2VZTA 5F1UA 3IGSA 3VOFA 1TIMA 2J7CA 2FLIA 4R53A 2Y61A 1W5MA 1WQ5A 1ISZA 3M0KA 4EXAA 1Q8AA 4PUDA 1EHAA 1TJ1A 1H2JA 3VIJA 1PEZA 3AC0A 2IPFA 5G1MA 2E5BA 4C90A 4WGXA 3W29A 3KP0A 1AW1A 5CJNA 2V9DA 4O11A 3BQ5A 3GDKA 3EEZA 1VBGA 1SJAA 2E68A 2NX3A 3U5UA 3S1GA 1BGGA 1MQQA 2HQAA 1UBSA 2VRJA 1TPB1 3RK8A 2FH8A 2HZGA 4K38A 1QMLA 3ABOA 3GXFA 3KL5A 2ZXAA 4HMCA 3WEMA 1ZAJA 1WX0A 2DSKA 2R1NA 3AWNA 3HTWA 4F48A 1EKOA 3LM7A 4FNQA 1VYRA 2VT0A 3UPBA 3I68A 4PA8A 2YKKA 4HJWA 1PWLA 5AZ0A 4C6QA 3QV8A 4DBDA 3GDTA 2FHFA 2XIJA 1JIBA 1H60A 1A50A 3DKLA 4WVXA 2X0SA 3I6EA 4ZB0A 2O92A 1DWIM 1H1ZA 4UBPC 2NLIA 4MAZA 3F5LA 3RR4A 1E70M 2HNHA 2PDPA 3VX0A 3TUUA 3W75A 2NSOA 3PZTA 3OLDA 2PB1A 4FMVA 1TX0A 2E77A 2XPKA 3QV9A 3U0HA 1OFPA 2D0GA 3R5EA 4C1KA 3E3HA 3MC5A 4G6CA 1EEPA 1H50A 1EC8A 2VOTA 1OC5A 1XLIA 3DFPA 4XTDA 4GVIA 3Q45A 1EFZA 4PRRA 5FJTA 1NWTA 1P1XA 3O1NA 1LCOA 1E3XA 2XH2A 1RQBA 3PANA 4O0QA 1GOXA 2ZA2A 1CLVA 5K9CA 1MUWA 2OQLA 2GVJA 3ATZA 3FV9A 3VOJA 6TIMA 3C6CA 3CUFA 3C3UA 1VR6A 1F6YA 3LCHA 4KFOA 1F6KA 1V5XA 4JN6A 8CGTA 4PULA 5BXPA 1LF1A 1AW5A 5BXTA 3SB0A 3AISA 3KRUA 4IP5A 5C0QA 1FWSA 1QI3A 1QATA 2VO5A 4KRZA 4NXSA 4KMQA 4Q4OA 4JAWA 4GIEA 3IARA 2RAGA 4IPLA 4QDMA 3CASA 3FNDA 2GJXB 1UH3A 4AZCA 5C9WA 2B7NA 4H9UA 3U3HA 4NUWA 3BZJA 1V0MA 1KGWA 3S8HA 4XAFA 3WSUA 1DOSA 2OCZA 4H41A 4ZODA 1MNSA 3NOYA 3UA3A 4DJDD 1ALDA 4ZE5A 1EDGA 3SURA 3NXFA 1NFGA 3ZT5A 2D2JA 3B9NA 3VM5A 4P7QA 4AAJA 1WCGA 3AYRA 3EWDA 3FIGA 3VOIA 5G4HC 4IJRA 3I6TA 1AZ2A 3ISIX 4GCXA 3W2JA 5IXEA 3RLGA 5DO8A 4H4IA 2CXEA 1XISA 1E6QM 3C2OA 3NOEA 2PEVA 2X16A 3HV8A 3TW6A 4LUSB 4Y96A 4PMZA 4M1BA 3WLRA 3FDKA 1KD0A 4IIBA 5CSYA 1Q4WA 2QF7A 2P8BA 3UWEA 3HG2A 4MLJA 4PMNA 4QFUA 5I3KA 3C61A 1EOKA 4QE4A 3UA4A 3IIOA 2Z4GA 3O15A 3MMWA 1ZLPA 2GVGA 3WNLA 4O4VA 1ONWA 5IRPA 2MUCA 1E56A 1MXSA 4RL3A 3W1AA 2F8QA 4UC5A 1YPIA 3K4WA 4MJZA 4L5ZA 1E9IA 2G3IA 2J9YA 2GGEA 3QFWA 3WH9A 4OJYA 2G4JA 4IPPA 3P0WA 1NP0A 1QNRA 2WM1A 4CD8A 1AVAA 1BXCA 3CQJA 2QGYA 5A69A 4I7VA 1SM9A 1CXKA 1DIOA 5CC3A 3E0WA 4GJJA 4NJJA 1UJQA 1REQA 2VELA 3T40A 4ZSTA 5A6BD 4UFJA 3TOPA 3W87A 4AG0A 3KS6A 3KCOA 1KM4A 5FAGA 2H9AB 2CITA 3Q4DA 2GVYA 2ZC8A 3MUZ1 1OGBA 4MOZA 1B3XA 3TZNA 5E9AA 3MBFA 1SFSA 4BWLA 4DRSA 4LC6A 1V51A 3ZO9A 5TIMA 1JCMP 2PBOA 4CCDA 2Z1BA 3EDEA 1DV7A 2OZ8A 3TA9A 3QHNA 4TXEA 1DBTA 1YKWA 1AH4A 3VGGA 2Z29A 5FJUA 1UD5A 2VQUA 5CLTA 3CL7A 4QJ3B 1JPHA 3FHQA 4D1IA 4R3UA 3VD9A 1V08A 4A2RA 2WBGA 2CKSA 1ZJAA 3VMNA 1S5MA 4XQ6A 4GZIA 4E2BA 2E5CA 2EHHA 5IDIA 1IWAA 4DHGA 3NVDA 1KFJA 4HNLA 3PBYA 4CD5A 5C8BB 1JPKA 5PTDA 2CZFA 5GJMA 2VP8A 1RQEA 4LEQA 5DBUA 2VDIA 1XLMA 3BOFA 4GXMA 1Q6LA 4B5NA 1HKWA 3OEXA 5CPLA 1AL7A 2FTYA 3BV4A 3CZEA 1CXLA 4W5ZA 4B5TA 3W76A 4A3RA 3BG5A 1TVPA 4Q8VA 4NJHA 4IIDA 1XLLA 3VGDA 4AIUA 1YE6A 2IKJA 3FJ6A 3MYOA 2ZOXA 4S3GA 1ZGDA 1GJPA 2QDDA 2GUYA 4W88A 3ME3A 3GNPA 1ZFJA 1V79A 3OIXA 2W9MA 5EU9A 3BOLA 5AHNA 4ONVA 4Z1AA 1O1ZA 4TMBA 4ZENA 3CZGA 2NQHA 1VB9A 5CPMA 4QLKA 3S5SA 1NFBA 5C2XA 1Q45A 1JZ2A 2R8WA 1FKWA 3QKEA 4FEZA 1FDJA 3W1MA 3PJUA 3LN3A 3LTSA 3R6IA 4WKFA 3SGUA 3PAJA 2H3DA 4FX8A 3B0UX 4FXFA 3LENA 4A2SA 5BXSA 4N0RA 1J8VA 1XBVA 1QHZA 3IJ7A 5BRBA 5IOBA 1FWCC 3TIMA 5L9FA 1JG9A 1P0BA 4R27A 1GCYA 3UWYA 1VFSA 3VGFA 4YU1A 1HGWA 2VHLA 3W1XA 1J0HA 5IHSA 4YS1A 1JPIA 3FGCA 4GBDA 3O06A 9XIAA 4DYJA 4PUEA 2ZRVA 3BVJA 4HU3A 5E93A 2IS7A 3OGSA 4M80A 2I9UA 1J2WA 3TJ4A 1SYTA 2YW4A 1KRAC 3R2GA 1PIFA 4V15A 1TMHA 5I77A 5MKGA 4JTFA 3ZJKA 1W32A 3OZOA 1ZPTA 4RZ5A 2PDHA 1E4MM 2CBVA 3RMEA 1Q6OA 2HK1A 1Z7AA 3SY8A 1WAUA 4Z2JA 1P4CA 3GQYA 2ONEA 4G1NA 4RK8A 5CBIA 1XRFA 2UBPC 1M7PA 1TTIA 4JZ5A 4JQ4A 1M04A 1BYDA 3FSUA 2O9OA 1M65A 3M41A 4Y9AA 1NFPA 3M6DA 3IUHA 3U2OA 5DCEA 2Q3OA 1W3JA 2A1YA 4P8WA 4IGMA 6XIAA 1JRCA 4LC8A 1QAPA 3CPRA 5LNRA 4LCQA 3AAMA 2X1UA 2ACQA 2HBVA 2XFWA 4CCZA 2B31A 1B3ZA 4HT3A 1K4GA 3LNPA 3TQKA 1DJYA 3AS3A 4OHQA 1E4IA 1P0EA 1YYAA 1I75A 4AD1A 3H70A 3UWZA 8TIMA 2PDYA 2G5WA 1KWGA 1MW2A 3FJLA 1QNOA 4REQB 4W86A 1XLBA 5EBAA 1WUFA 2I1OA 3WMCA 3DKJA 1N8IA 1LP6A 4AFYA 2GUUA 3W73A 3SADA 3AS0A 1H7RA 1GVFA 3PJWA 5FESA 2ON3A 1XYLA 1XUZA 4UNIA 3QMTA 1CGYA 1C8VA 3TJIA 2C91A 3B9DA 1SFJA 2HEJA 4S39A 1W5QA 2HS6A 4TIMA 4J40A 1OYBA 5EPDA 3GZ3A 3PHAA 3U5YA 3PFMA 2BMBA 3W7KA 3SRFA 3ZVHA 3NQ6A 2GWGA 3UG5A 1JL8A 4ZOBA 3CM4A 2CWNA 2XISA 2R14A 3UEQA 4JTRA 5LA2A 1IT7A 3A4WA 4C6PA 3W74A 5FACA 4DX3A 1X6UA 4F3HA 1O12A 1OD8A 3KAOA 1BXNA 3SY1A 2ACRA 4JOMA 4LAUA 4TQTA 3NTYA 3TROA 1FQ0A 3LHVA 3QPYA 2AQVA 1AQHA 1VGAA 4XKYB 3TQVA 3IANA 1XYCA 4FPSA 6PTDA 3PJXA 7REQB 3QR3A 1FHVA 3SCWA 4R7OA 1B5TA 1KFKA 3IIPA 5CAKA 3RPTA 3QOMA 1UPMB 2PLKA 2QHAA 1HFBA 4M6PA 4US6A 3HN3A 4DPPA 1ONRA 2JEPA 3LCFA 1Z44A 3L2LA 2OB3A 4IH3A 4QQ3A 1FKXA 1UYQA 1SQ7A 3W2KA 3VNJA 3FFSA 4AISA 1ODZA 2RJHA 4MPKA 3CHCA 4KWUA 3N12A 5F2IA 3BE7A 4IQLA 5D32A 3P74A 3DFOA 4DBWA 3UY8A 1G4PA 4AVNA 1O5QA 3R11A 2BOGX 4NU7A 4LRSA 2NQZA 1UZ1A 5T26A 1O94A 2C1HA 3T08A 3RX4A 4ZA0A 3MBDA 1LOQA 3WDQA 2ZDRA 2VX4A 4MUZA 3TZFA 1TJRA 1PHWA 5FJJA 3CO4A 1JCJA 3BGGA 1SZFA 3CMFA 2D0HA 3EOEA 3B0PA 4EE9A 3GAYA 1OK6A 3VAVA 3LHWA 3QW3A 2D23A 2P0OA 5LGZA 3FYPA 4HPJA 4IG2A 1OINA 2D20A 4KBXA 1P0DA 4IIFA 3MJMA 3S6TA 2XFRA 2J7BA 4XBSA 1GYNA 4GI4A 3NO3A 3AIBA 1RK5A 3W7CA 4JIHA 5AYXA 2QULA 3B8DA 2FPYA 3NQFA 3GU9A 3VE9A 5CG0A 3D6NA 2CHNA 1IT8A 3RXZA 3V1HA 3CNYA 4NAFB 4TX9A 1OF8A 4XVDA 3WF4A 2OOGA 3MYPA 4K8EA 5HMEA 3QY7A 2WZMA 1YNYA 3S5YA 4NJGA 4GX8A 1U1JA 3TFCA 5GJPA 3UFYA 1US3A 3TMQA 2OSXA 2GLKA 4JIQA 3W6LA 1MXDA 3LHYA 1JXKA 2D1ZA 4O8RA 1C91A 2RDTA 3VMPA 4L6OA 1I8JA 4N6FA 1H61A 2X09A 1XSKA 3IS4A 4G1KA 3VMOA 3VINA 4H3DA 3GH4A 3L0NA 3V5FA 4X63A 4QLLA 1KFCA 3BAXA 2RGLA 3OQ8A 3VKAA 1TMLA 2PTXA 5AYBA 4A3UA 2JEQA 3EWUA 4WHBA 3PVFA 4S3KA 4WDXA 4XZLX 3W2LA 4ADTA 3HB9A 3U2ZA 2PRHA 3B8SA 5K3VA 5AKQA 2E6DA 3N6QA 2VVSA 3MP4A 4IGSA 3H2AA 1YEYA 4TO8A 1S1RA 2VVNA 3S3GA 5JH2A 4W5UA 3HJZA 2FDMA 2OZ3A 2W3ZA 5CSRA 1MXGA 1A49A 1EGMA 3WF1A 4P7OA 2RDXA 2TPSA 3L2MA 4Z1DA 1SO5A 3P6LA 1HVQA 2BLEA 3C3NA 3GG8A 4JFVA 3WLNA 3BJSA 4S3DA 2ZUNA 1OX4B 2YL9A 5C6MA 3CXOA 4JY8A 4IPJA 4PMRA 4PMQA 3UWQA 5A6TC 4A8NA 4CNPA 4BI7A 4J3SA 4Z2LA 3GNNA 4HA3A 1UWQA 1BFNA 3R58A 2NXHA 2QXWA 4JFWA 1W56A 1P6BA 1CPUA 2OG9A 1NOUA 5E70A 1LQ0A 4O1FA 5GNYA 4JN8A 4PUNA 4IT1A 3PNZA 1A4LA 4GK8A 5D9MA 1TUXA 3HGJA 3KBVA 1ZCCA 2PLMA 1QDSA 1RR2A 4LAMA 1CB7B 4ROQA 1W9XA 3FYYA 2IMRA 2JQXA 3T0DA 3MSRA 2GPTA 4B3KA 4L6DA 4JHOA 1F3WA 4B2DA 1MUMA 1NU5A 5EMKA 1BSLA 1E5NA 4KEMA 1QNQA 3LHTA 1EF2A 5DFAA 1XG3A 4OU1A 3C8FA 3W7QA 1XD0A 3PTQA 1FH8A 1QNPA 2VNCA 3W28A 5CZKA 2E9MA 1ME8A 3TR9A 3G8RA 3RX3A 4AB4A 3MV11 4WDWA 2A3BA 4PL1A 1PX3A 1NSJA 3AYSA 5CLWA 3VNYA 3B8TA 1KTNA 4QDWA 2ZTJA 2YGYA 4GI9A 4LSBA 1JGMA 3W7RA 1EOMA 4GO8A 4NZJA 3W7PA 1OZQA 1TKKA 2OEKA 2D3LA 2HRWA 1RCXB 1UIPA 4C5ZA 1BGAA 5F7UA 3KOYA 4GNJA 4PMUA 1NWRA 3W88A 1AQ0A 4JTQA 5FF0A 3WMBA 3H7VA 3PB2A 3QHOA 1WKFA 2GFTA 3H2MA 1HT6A 4NRRA 4H2CA 1EP2A 1AG1O 2O7QA 3H24A 4QCEA 4KF1A 1BHGA 1UR4A 4S3AA 2HJPA 4HA0A 3MCOA 4JTAA 4XZNX 3UZJA 1QW7A 3GXNA 3SCVA 3BLEA 2VEKA 1FH9A 3GD6A 3WLLA 1G7VA 2ZC1A 1XM3A 5A2AA 1YIXA 3QY6A 3VGBA 1ZBCA 1BKSA 1HKMA 1OY0A 5CPTA 3UCDA 1UKPA 4XAPA 5LIWX 1C8XA 2OYKA 3BLKA 3TYBA 5A8MA 3RCMA 3RITA 2DVUA 1HX0A 2Z7KA 4BK9A 4TX6A 8RUCA 4GYFA 4LS0A 1XJBA 4ZVJA 4O13A 3GY1A 4C6KA 4E2DA 2F2HA 5HANA 4LUTA 4I6KA 1R85A 1M7XA 1BD0A 1O5RA 2Z1XA 2VZUA 1YTEA 1OFEA 4HK5A 3MI6A 2E6YA 3GO2A 1RBLA 1VLWA 2V67A 3V0SA 1PSCA 1OYAA 2QIIA 3WQDA 3BCFA 1MW0A 2BHUA 3SECA 2ZRUA 5E6ZA 2ISSA 4AZBA 1F4HA 1R3TA 4GNKB 2JBMA 2DZVA 5HA7A 4M6QA 2G0WA 1XF0A 4O57A 4IPIA 3CPGA 4GHRA 4X61A 3N15A 1WE5A 1W9DM 3LOTA 2PSNA 2PF8A 4K1WA 2WC4A 3NQGA 4B5WA 1BQGA 3LBCA 4GI6A 3VKDA 5J04A 3TSBA 3WCZA 3G6MA 4XUYA 1TIWA 4EANA 3VGHA 4W8AA 2V5CA 2X0YA 1CZ1A 1FCVA 4EWJA 1RPXA 1P7TA 4AWUA 1V6VA 3PUDA 3SM0A 4Q7BA 3CZJA 1LOLA 1JDFA 1B4KA 3RO6A 1QTWA 3DEQA 1OT2A 4HU0A 4P61A 4O53A 4AX7A 1IEQA 4WCJA 1Q3NA 1B90A 3ES7A 3MMTA 4W7UA 3F03K 4I7WA 4ZOEA 2HROA 4PFMA 3BQ6A 4H7VA 1ZTVA 1REQB 3G3MA 1ZRQA 3M43A 2VWTA 4TOQA 4HKPA 4PMYA 2EPLX 4ZFCA 3FJ4A 2C1GA 2O9TA 3WEOA 1I2QA 3EKZA 2C19A 5DXXA 1W0MA 2W66A 5CKSA 3RHGA 5FSDC 1IGSA 2A85A 1E43A 4J1OA 4XX6A 3DG6A 4BF9A 3DFTA 3PBMA 1XCXA 1V03A 1HJUA 2EXOA 3IVSA 1KC7A 3UBPC 3C2VA 2CEQA 3PK7A 2HBXA 2QNEA 4FB7A 4N9BA 4O50A 3V7PA 4JD4A 3TYCA 3VM7A 1S38A 4MY1A 2UV8G 5D8ZA 1QU4A 3TC3A 2OU4A 3FAXA 1QI5A 3WLQA 3V18A 2QIWA 1WYIA 3M5VA 3BW3A 5DRCA 1S2CA 1IZKA 1UQYA 3DGRA 1VAHA 1EIBA 3GTIA 1H1NA 2CZ5A 2XGBA 3WX7A 3QKZA 3OA5A 4ZQCA 1X6NA 5LNUA 4MFEA 3CUJA 2OSYA 4JKLA 2PZNA 3VCCA 1SZRA 4FA3A 4YTSA 3PZGA 4PTVA 3WNKA 3WD3A 4GQRA 3B06A 4PR4A 3N4AA 3O6YX 4QM1A 1EJSC 1GW9A 2ALDA 3ITVA 4OZOA 1FHDA 2ZADA 3AXKA 1Q6FA 1X38A 3NYDA 4IF2A 3I3BA 3AICA 4FIQA 2FIQA 4MUPA 2VX7A 2W63A 4FNPA 4A21A 1VLIA 4AWEA 2PLCA 4F0HA 2I5GA 3W81A 9XIMA 2GVLA 2NX9A 4JTCA 3VNMA 4BKNA 1ZENA 2QCNA 2IXUA 1E4LA 3T4CA 1EC9A 1P0KA 5B7YA 4X0VA 4M19A 5DT7A 5D2XA 3TC6A 4BI6A 1RCQA 5F4SA 5D2VA 3CQ0A 4AEFA 4Z17A 1YDNA 2YFNA 2VRKA 3CV7A 4GIRA 3QM3A 4ADSA 3EB3A 2W0UA 1XYZA 3N2XA 2OXNA 3KDNA 2WLYA 2XH0A 3UERA 3HMCA 1BEUA 1GTEA 3KW3A 2A6LA 4C5YA 1IQ8A 3MT1A 2EQDA 1XGEA 2C0AA 2EPMX 4YVVA 3THAA 3TNOA 4M1RA 3VD3A 3VPLA 3Q67A 2C71A 4IGNA 4J27A 4C6BA 3GH7A 4A22A 4K68A 1U5VA 3DX5A 1RPKA 3KTXA 3PUEA 3MA8A 1RJPA 4J3WA 3URBA 1P6WA 5U4NA 3O07A 1C90A 5BWAA 4FXSA 3GXDA 1XIHA 4XZMX 5E0CA 4CNNA 4FP1A 3WIJA 4O12A 4H00A 4IP7A 4UCGA 3PZIA 4XIAA 3T4WA 3MUXA 4WSKA 3EA2A 3CL6A 3FGCB 3GS6A 5A8QA 1HJWA 1Z9AA 2AL1A 1QPOA 3P61A 4AZHA 1A3WA 3NSNA 4MWAC 3VGEA 2V68A 2E5DA 1IXQA 2NLYA 4AW7A 1UBPC 2JE8A 2X8RA 4EKJA 2PTYA 4MYXA 4Y7EA 2A7RA 1A5MC 4HP5A 3RILA 1JQVA 1E72M 5C2CA 3WMSA 1R7OA 1UA3A 4XV0A 2GUBA 4YN5A 4LPCA 5MKGB 3B3DA 3PBVA 1H0GA 4YYCA 1JF5A 2Q8LA 2FGZA 3H2OA 2YBTA 1W9PA 3ZR5A 2WMFA 4KERA 4H19A 3NG3A 4QRNA 3JZUA 1BVNP 4DLMA 1OK4A 3W22A 3RLHA 3VUSA 4NZ3A 4NILA 2CLFA 4TU1A 3T42A 1BF6A 3WLSA 4NIRA 2Z00A 1DJHA 5EMMA 3DDMA 4DY1A 1E9ZB 2F6UA 3JR2A 4OUEA 3EXTA 3WQOA 3CUGA 1XLKA 2X7WA 2PWUA 2PODA 1V6YA 4YHEA 3GTXA 1JDEA 2YZRA 4Y9OA 2ZZ7A 3H8AA 5GPRA 1GOMA 2CBUA 2J6XA 1V7YA 5BOEA 3SJ3A 2ZA1A 3NQMA 2WMGA 1GJWA 1OFBA 1WAWA 2GDVA 5EFDA 1XFCA 4AH7A 2INZA 4E4UA 2Y2WA 4XD4A 5T9CE 5IM51 5IBXC 4UUIA 1Q6QA 4CQCA 3QGVA 3NPXA 3SAZA 2Y62A 3QF0A 4NYYA 1BG9A 3KWXA 1K8ZA 1YXCA 4XO7A 1L6SA 3TYUA 2IPGA 3B9AA 3TK7A 2VEFA 3AXIA 2JIWA 4JKMA 1BYCA 4WXYA 3WH6A 3WK1A 2DIEA 1TR1A 4D6JA 1FWTA 5REQA 3C0LA 3KZSA 2BS9A 4X9SA 3VNLA 2E28A 1JRBA 2EPOA 1J0YA 1KXTA 1S39A 3ZVHB 2XJ7A 2D2OA 1YADA 1IR2A 4KWSA 4PL2A 4TVUA 3SY5A 1S1PA 4DJEA 3DBPA 3TJLA 3UP8A 2P88A 1DL3A 4RE2A 5BOOA 5CSUA 5FL1A 2HTMA 3ITLA 3HFTA 1EJ7L 3NQEA 5IFPA 3EBVA 5LXEA 4K1GA 4K2SA 2PRMA 5FF4A 2AKMA 3AI0A 3N1AA 2Y7FA 4NZCA 1ITCA 2EPNA 1NDYA 3AQUA 4RE3A 1LLWA 3MSDA 4I9AA 2V30A 2W92A 2WMJA 5AYYA 2W62A 5HJLA 1FWFC 4MADA 2CBJA 4IJCA 3VNIA 4JTIA 1D8CA 4DI8A 4DO5A 4AXNA 3R0UA 4GFIA 3R94A 3GDRA 4V2XA 1JCLA 5AHFA 3MVTA 3W1PA 2V82A 1H0IA 1XDMA 4B2DD 3QHMA 3S2CA 1W1YA 1NF0A 2A7NA 1JJKA 4RPQA 3TTYA 1K03A 3CZLA 4JQAA 4F66A 4AY7A 2ZE0A 3RIKA 2QMKA 4HN8A 4D6EA 4ENLA 3R8RA 1K8CA 3N9RA 3OQEA 5KINA 4LV4A 4INFA 3UR7A 2BSLA 3PZ9A 4CD6A 2V8ZA 2IXVA 4ORIA 1VEOA 4LT9A 1XIGA 1UIOA 2OX4A 4S23A 1WKDA 1W5PA 3I7RA 2FHCA 4IG2B 2W67A 1GG0A 3E9AA 4FIRA 4XVEA 2OQHA 1GKRA 4M0XA 5FI8A 1LRQA 1OQFA 2C18A 1JYWA 1W54A 4GUHA 2A7PA 3BJTA 3PUGA 1V0LA 1E1CA 4D1JA 4N4PA 3ZLHA 3HU7A 1GVEA 1UROA 1R3QA 4ML4A 2PDIA 3RRXA 4NAEA 3GTFA 3F4VA 1EYEA 1I2PA 1OFQA 5KZEA 4WKAA 1E55A 2CLOA 5C2GA 3OLGA 2Y5SA 1W1IE 2OZ0A 1XIDA 1PX4A 4GH1A 2Z2UA 3G22A 5AECA 3ABXA 4GZEA 2DFAA 2C79A 3MHFA 1N8FA 3S2NA 4WD0A 3W38A 1AQMA 2NZLA 3LCWA 4EPBC 2I5IA 3W82A 3CV1A 1F76A 4V28A 3SSJA 2JKEA 3A22A 3LSCA 1UUMA 3UJRA 4MGGA 3WD4A 3HG4A 4Z2GA 1B2YA 3DCPA 2WJZA 2DVTA 3WUFA 1JYXA 2PDGA 3AIRA 4BS0A 4UTKA 3S6DA 3UWVA 4C6JA 4I9MA 3RYSA 2RFGA 4JEJA 2EPHA 2WSRA 2ISFA 3TU9A 3WNOA 4IFKA 5CPQA 5HWNA 4MM1A 3V16A 4ZQMA 4K8HA 4L7ZA 5EA9A 3P67A 1MQRA 1DWAM 1FOBA 1KXHA 4FK9A 2WJEA 3DGBA 4OBSA 5JH1A 4HPNA 2XH7A 1CNVA 2EKCA 1JFXA 4C6LA 4JFSA 4GZJA 3H54A 1L8PA 5T9BG 1ZP4A 2W5FA 1JCTA 2BZNA 3MZNA 1E4NA 3GLCA 1VC4A 1O5XA 1A5SA 3DZ1A 4EK7A 3UW6A 1VCGA 1XUUA 3OBKA 2HISA 1BAGA 2C1IA 1AH3A 1BRLA 4Q8UA 4KWVA 1R6WA 1G4TA 4BY3A 4DIAA 1DJZA 1EA0A 1M7JA 4GCAA 1H3GA 2QUUA 1MUCA 3LCGA 3V0UA 4ERGA 4J7RA 3O0KA 4LB4A 2ZZ4A 1TWDA 4A29A 2A3LA 1R47A 3MDUA 3LB0A 3OYXA 4IMEA 1OFDA 3EKGA 3CPUA 1I0BA 4JCLA 2YL6A 1NVMA 1UD2A 4AC1X 4JY9A 4JTHA 4HNOA 3M16A 3WLOA 4J3ZA 3S42A 2GZXA 4IP4A 2CLLA 5M17A 1I4NA 3GWQA 3GK0A 1DIEA 2DT2A 2YR1A 3A6OA 5FJIA 3VVGA 4LW7A 3OHIA 2ZX6A 3SIMA 3E0LA 4FO4A 1ODUA 3K4DA 4E3VA 4O16A 2WCAA 4GNVA 4PFHA 4NNCA 3UZZA 4JIEA 4WXZA 4HQVA 2NT0A 2VZSA 1I0DA 2GSJA 4QS5A 2GQAA 3DU0A 1LQAA 1ME7A 3QQ1A 3IJDA 4HMDA 1H49A 4FSAA 1DTNA 1A80A 2DGAA 2ZE3A 4ES4A 3BCJA 4US5A 6XIMA 3G0XA 1PKYA 3AYTA 4H8UA 4IX0A 3LPFA 1FUYA 4GACA 2OEJA 3WD2A 5KSWA 1K9EA 3MP5A 1QW9A 1K8XA 3O63A 1MNZA 4XKMA 4GY1A 3MV01 4UOQA 3AMKA 2VEPA 5ABHA 5DQPA 3T2QA 3TMLA 4ZXOA 5CGMA 2BFGA 1J9YA 3EDJA 1C8YA 3OIHA 2ZXBA 4OKDA 2OEMA 3VKKA 3LNMA 2YB4A 1JZ4A 2YSWA 1J6OA 4HHHA 1SPQA 4GUJA 2FZMA 4LUSA 3HIJA 4MWAE 3W01A 4QP0A 2XVGA 3E96A 2V3DA 4X3ZA 2ZRZA 3SQMA 5DLCA 4ZQNA 1K02A 1M1BA 3GNDA 3B9OA 2PUZA 3RAOA 5RUBA 3IJ8A 1R2TA 2OYMA 3M5XA 4O4WA 3FVDA 4L9YA 4KETA 1VJIA 3EWCA 2YL8A 4QS6A 3KL0A 2QUTA 1KFBA 2ALRA 4JFTA 5D2TA 4IQJA 4BZYA 5K7JA 1OX6A 3EX3A 5A94A 2DZTA 3ITOA 3G1FA 1XC4A 1GQLA 3F1QA 2QCDA 1XDLA 3W23A 1J12A 1TMQA 4LUTB 5HR7A 3QMRA 4LB3A 1QOQA 1V0NA 5G2HA 3TQPA 1UW9A 5EMYA 1GJUA 3OZMA 4MB1A 4OV4A 1RHCA 2PD5A 4HPGA 1ECQA 3N73A 1R46A 4KGLA 1F3EA 3TJXA 3WNPA 3GB6A 5BW6A 4GYPC 1F6PA 1PVNA 4ICCX 1D3GA 1VPQA 4DVOA 1OJXA 2VGIA 2J66A 1VFTA 4UTMA 1RH9A 1EF3A 3C5QA 2XN2A 3PBGA 3EDFA 3AJXA 1RV8A 1A5AA 4NI8A 1UP2A 4ACYA 4BEUA 4NQ1A 1GQKA 3MUY1 4M7TA 4MFDA 1FDYA 1W37A 2VWSA 2P5NA 3LI0A 5MHBA 3L5AA 4GQ0A 4DZAA 1NWSA 4MZYA 5LSMA 4C6IA 1A0CA 2HVMA 2H90A 5CC6A 1G6CA 2DUXA 4NX5A 2V0TA 1KQYA 2X1RA 1RBAA 3LZ5A 1JCXA 1TJ2A 1OCJA 3VCRA 1U22A 2OMAA 4ZB5A 1IYXA 4DWSC 4EP8C 4ZXLA 3VE7A 3BAIA 4MB3A 1J0JA 4DB7A 5JXQA 4NYUA 1K8YA 2FZ8A 1QK2A 2JFEX 3EWXA 2ZWYA 4B15A 1DJGA 1HJVA 3MP3A 4DELA 4XWUA 3DN5A 3OTRA 2R1PA 4ZQOA 2PP3A 4FLQA 1TPH1 2VMFA 4JHZA 4F9JA 1VQTA 3MUAA 1CTNA 1JDCA 4N9CA 1OGSA 3NL3A 2AMXA 3QGKC 2DQWA 4ATLA 2R94A 2PP1A 3INPA 3WZ0E 1MZRA 2INFA 1J0IA 4ZZ9A 2G97A 1Y5XA 1ZU8A 3NQAA 1KFWA 1JGIA 3WQPA 1CGTA 5AYZA 5BRPA 4H1ZA 1E9LA 2DW7A 1X97A 5FF3A 4MWAD 2PF0A 4B16A 2JKPA 1KCLA 4NHVA 3XISA 3EPOA 3A13A 3BW4A 4DJDA 3B0XA 2ZCGA 4WJXA 3DUGA 1KRBC 2XVKA 4HSHA 5GQBA 3MANA 3M47A 4HJFA 3TOYA 2VGGA 4XAYA 3AIUA 1PL9A 1M53A 3TW7A 3L5MA 2PGFA 3DESA 4AYGA 4KWWA 3W7MA 4DZIA 4QG9A 1X96A 4V1YA 4RNHA 5GVJA 4D6GA 5IHRA 3M0VA 3IIVA 1AMKA 4TUFA 3W71A 1XBZA 1JPMA 2UY5A 1UWTA 3ELFA 3CIWA 1QBBA 2NT1A 4IMAA 1TPEA 2YXXA 3N18A 3PWGA 4AVFA 3DH7A 4UIOA 9CGTA 3VU2A 2VZVA 1GHSA 1PZ0A 3W6MA 3UJEA 3STPA 1XDJA 4LBRA 1GEQA 4JTKA 2NXGA 2YDAA 3PZOA 4UFHA 3VC6A 5A8NA 2PCEA 3H26A 2GJPA 1L0PA 3NUKA 5EFFA 1UD8A 2YDSA 3R1ZA 4ZMGA 3MSGA 2ZUWA 2PDCA 3CAVA 3WLJA 1XYAA 3LK6A 1EBGA 3WUGA 5DELA 3WQ4A 2QJNA 3VKBA 1GTHA 3ARUA 4WLCA 2YLAA 1ZHAA 1HJXA 1HP5A 3I3EA 3SCUA 5HR6A 1XIJA 3TYZA 3TE9A 3WLIA 1Q7ZA 4YPJA 5I5RA 5E1QA 1R9XA 1TCMA 2B7OA 2Y7GA 5AN7A 3CEPA 5FL0A 2V2HA 3WF3A 2Z6JA 4IFOA 4JTSA 4UZSA 4GMEA 1DVJA 6ENLA 3UR2A 1OG6A 3NQVA 4UR8A 4YJ5A 4L1XA 1S5NA 2REQA 3CH9A 1A53A 3OZPA 5FOOA 1IEVA 1A4MA 2EKGA 1GVIA 1K77A 1W17A 4UTIA 3MUIA 4Q8TA 1SJBA 3T78A 1UD6A 2WWCA 4QEEA 1EX1A 1XRTA 3UY7A 1R3VA 3MDWA 2AQWA 4TX8A 3S5OA 1SO6A 2AQOA 2GGIA 1V77A 6CGTA 4Y9NA 1NEYA 1U33A 1FWWA 2SFPA 4JQ1A 4Y2WA 3BAKA 1EXPA 3NM3A 4GPNA 4AD2A 1MW3A 2ZBTA 2Y85A 4WF7A 1LROA 4GQGA 3ZFHA 2VCAA 3U4AA 1DQWA 4H6EA 3R25A 3N9SA 3BLPX 1ZS2A 3SDOA 2QCCA 4AZ6A 1RK6A 3TYEA 3GKFA 2FTWA 3M4HA 3GVQA 3KBWA 3ANYA 1QASA 3S5NA 3UYCA 3FX4A 4QNEA 4Y8EA 1AA1B 3MJYA 3PR2A 4WJEA 4R7WA 2ACSA 1ZAHA 1D3CA 3UZYA 3UJFA 1TE6A 1T40A 3ABRA 2WSPA 3TR2A 2XINA 5LXXA 3XINA 1JCNA 4MDOA 5J5DA 4UTJA 1M01A 1RA0A 4KCTA 3SN0A 5JIPA 4UQCA 1NAL1 4C6EA 1PDZA 2VFEA 5BMXA 5A5WA 2I56A 3QR1A 3CTTA 5SWUA 1NTHA 1OABA 1TPC1 3KLKA 4YYFA 3E74A 5AC7A 1G1YA 2BP1A 4PRWA 5A3HA 2ZA3A 4OECA 2PCQA 5A2CA 3H55A 2OPJA 1W6TA 2PDMA 2NQ9A 3HG5A 3QQWA 4R5EA 3UZXA 4O1DA 3DERA 4EWND 1KBLA 4RNFA 3FA3A 2CNCA 4GUGA 2E09A 3JVAA 1IIHA 3F2DA 3VD4A 1R9ZA 4WJ8A 5AHIA 3NL6A 5C9UA 4GYJA 3FCPA 1HGYA 4GABA 1H4PA 4H83A 5KZDA 2VXNA 2OELA 2I5QA 1E6XM 2WW5A 2H6RA 5D37A 4CNSA 2WCGA 4M24A 1AUSL 4PCPA 3WBXA 1PYFA 4ZQRA 3BTNA 3W1UA 2D69A 4XUGA 5KZ6A 5JIWA 3KS5A 3OOQA 4H7ZA 1QO2A 4RPPA 3SCOA 2DUZA 1IWBA 4GA8A 3N2BA 1H5YA 3SRDA 1UUOA 1CLXA 4YHGA 3W2MA 4IIEA 4WDUA 2NW0A 2OSWA 2HCVA 3NAVA 3TP4A 3UETA 2J75A 1EYWA 4CEUC 3OLEA 3HGSA 2PS2A 1ZNNA 4D8ZA 1HZYA 4DQWA 4NNBA 5REQB 3EXSA 2ICSA 1T8QA 2OO6A 4WY0A 1SUXA 3PJTA 3I7QA 3WYZA 3PPGA 1OD0A 3WK3A 2RDUA 3ITTA 2IKIA 3OVRA 3H7RA 3W7EA 2UWFA 5F2GA 2F61A 4PYSA 1SFLA 2WPBA 5I07A 2RGMA 3AU2A 3CV2A 3EWYA 1LL6A 1CX9A 3E2VA 4CUCA 4LF1A 4PB3A 1IXNA 3O8AA 4AY1A 4S3EA 1LRTA 3B8IA 5DANA 3PPHA 2D2GA 3TN3A 2J74A 3TAKA 2A21A 3R89A 2VX6A 3ZMRA 2J24A 3U2CA 5HOSA 1W1PA 3WLKX 4LYPA 3ORWA 2XWDA 4GUFA 3SR7A 4AHQA 2QZRA 4Q4KA 1GVSA 2ISWA 5FEPA 4UTFA 1FDZA 3NEHA 4NRSA 4U5KA 3Q94A 5LNVA 3VD5A 3WMLA 5BWFA 3CQKA 4JQ2A 3UVAA 3PTKA 4OT7A 1QUMA 1DXEA 3APGA 1GNXA 2DSVA 3V5CA 1FTXA 1H11A 4I8DA 3V35A 2RH9A 2I57A 1TV3A 3LDVA 4K3ZA 4HPHA 5D4YA 1S2UA 4Q7IA 5E9XA 3VYLA 1C29A 2J8TA 3W1LA 5FD0A 3N2OA 3L65A 1GOKA 3ZSTA 2Z7GA 2GVEA 4HYRA 3TLLA 3N4FA 3UNDA 3B97A 2GGGA 3W2UA 3RMJA 3EEGA 3KOWA 4UTUA 3U7BA 2QCGA 1K6AA 3W24A 3FLUA 2BGQA 1OVDA 1JUBA 1KW1A 3IAPA 3P60A 4EXBA 4PCTA 3PN8A 2XFYA 4KCWA 1ZBVA 2I17A 4QE1A 1AZ1A 3GYEA 1F61A 1V3KA 3LPGA 3GXTA 1ZL1A 3C86A 5LIUX 4CVWA 1JDDA 4GI8A 3E6EA 4NASA 4F40A 3CZKA 3ANUA 1E1CB 3K8LA 1DE6A 3LXCA 2EEXA 2FVLA 4MHBA 4NAEB 1CCWB 1KFLA 2VDGA 3PPCA 4JX4A 3OBAA 2GJLA 3RPMA 5BMWA 4I5UA 3B4YA 4F8XA 1RP9A 1KNWA 4CU6A 4MY9A 4JL2A 3WH5A 4JX6A 3LS9A 2PMQA 2PC4A 3UPMA 1KR1A 4OQVA 1XR2A 2DT0A 2TRSA 1UR1A 3USBA 3G1HA 3L7RA 4GIYA 4E8CA 3E38A 2WVVB 4LH8A 1B31A 2CKRA 2PDLA 4W93A 1TQJA 2AKZA 1THFD 1VBUA 5JVLA 5F2MA 1RAKA 1DWGM 3GG1A 1Q8JA 4NSBA 3HM7A 1NM9A 1YXYA 4EPDC 3FS2A 4MJ2A 4IFKB 5D8WA 2OWCA 2G41A 1QPRA 1X1ZA 3NCOA 5LNWA 3APTA 3LEPA 3GIYA 4IMGA 2TMDA 2GQ8A 5CBJA 1X8CA 1Q5MA 4PTNA 3UXAA 3S5ZA 4DNMA 1HL8A 3D46A 5HMDA 1M6JA 1LLOA 4NKCA 4OE7A 3E0VA 3M07A 3K2GA 4FXRA 5DCDA 2IKHA 1P1MA 1RBOB 5ABTA 1BLIA 2GOUA 2AAAA 4RJEA 4F0MA 1JULA 5HK4A 2BASA 2YYTA 1BRLB 2WNNA 1MRAA 3LMZA 3T0AA 1VEMA 4LY8A 2V5KA 3GFZA 4LU0A 4E38A 4A8LA 5D04C 2FGBA 2ZYFA 3OBEA 1EB3A 4OOZA 1JYNA 1IE7C 2DSWA 4WOZA 2VEIA 2BOFX 3V5OA 1R3WA 2Q09A 3UWWA 2FJUB 3HFYA 1A0EA 1U5JA 1RALA 1F4AA 1WDPA 1TWSA 3K1GA 4QDPA 3S2JA 4E5TA 2HWGA 3A47A 2HSAA 5FA5A 4GVFA 3WQWA 4KIEA 3NZ1A 3MMUA 3TXZA 3SQLA 2WVSA 4RKAA 3GU1A 3KHDA 2D0FA 2X7VA 1ENUA 1UOZA 2C8NA 1D9EA 5AVNA 1EDQA 4DWSD 3KE0A 8XIAA 3W07A 3THUA 3VTRA 5FEZA 3QYQA 2PDXA 1S3TC 2NV2A 5CPNA 4B91A 2X2YA 1CGWA 3GHSA 5HJXA 3W9ZA 1CGUA 4E4PA 3JU2A 3MWCA 4KEZA 3WFLA 2OTDA 2E1DA 4RDWA 1GORA 1KBIA 1CXFA 1FWRA 1E73M 3CK5A 3QPEA 1QRQA 2D22A 3UJ2A 1E6SM 1E9YB 1Q2SA 4IISA 1XKJA 4HD5A 2G96A 3WNNA 4PSRA 1QWGA 3ARXA 3L4UA 2WHKA 1O66A 4UTWC 4IICA 1X1OA 3KHJA 1L2UA 1DXFA 2V38A 2V5DA 3Q2DA 2IQDA 3GHTA 1F74A 3LG3A 4LFYA 4HIBA 3ANVA 5CH9A 3Q65A 4RV8A 2PI6A 2FQIA 3ARQA 3DOPA 3FEQA 4FX6M 4UTLA 3WK2A 2WLZA 2TODA 3WDPP 1E71M 1CYGA 2FFIA 1BVZA 3ZXWA 3GFYA 3ARZA 2PAJA 3L4ZA 2Z25A 3WEZA 4PE8A 3STEA 1U1HA 1EJRC 1H5VA 3O0FA 3QYSA 3QY8A 4JL1A 4XG1A 5DCBA 3KCLA 1A5LC 5A95A 1TELA 3I65A 1Y5WA 1X39A 3W27A 3LERA 1BWKA 4QX4A 2ZZ6A 4O17A 4OVXA 7XIMA 1EZ2A 1UD3A 1W1A1 3AUOA 1E51A 2POZA 3GVVA 4P5UA 5D2WA 4AMCA 1GQIA 3K8MA 3VOHA 5KTLA 2EAWA 4NZ1A 3VO0A 4PTMA 3QLLA 3KOXA 4I5XA 3IGUA 4QJ1A 2I14A 1F7BA 3KRZA 2GGHA 3I3DA 2CLEA 4MJMA 3DYPA 4ZO7A 4JBRA 4RW3A 1VIWA 3PG8A 2QCDB 3M7SA 1K4HA 4IXHA 3ENLA 1XIEA 3GC4A 3EAUA 1A3XA 3AIVA 3PPFA 3QQ0A 4O0ZA 1S5WA 2YDRA 4Q4PA 2G4FA 1FRBA 1T7LA 1Z6KA 4FXJA 3SQSA 1A5UA 1TVNA 3BICA 2OLSA 3AU6A 4M3PA 1ZBWA 1U83A 5CZJA 2YFOA 1O6IA 2G3MA 4GKTA 5G4EA 4RR4A 4LWWA 3M5ZA 1AMYA 1TA3B 2YB1A 4H6RA 4M82A 4AEEA 1F07A 1A5OC 4GJIA 3I7SA 4PBFA 4ZCWA 1JZ7A 4M8UA 3CJPA 1CWYA 4L80A 3OA3A 4BA0A 5DBTA 3U9IA 3TQ0A 4R9OA 4F2BA 4JHMA 4QCFA 2CW6A 2Q01A 2WJDA 3CQIA 4UNLA 3CUHA 1L6GA 1G4EA 1ZSXA 2PURA 2XSXA 4LVFA 2QPUA 1UMLA 3M0XA 1CXIA 2J13A 3L23A 1IZCA 1HQTA 1LZOA 2BXVA 4B5XA 1R87A 5C9XA 1V6XA 3M0HA 4AHPA 4W89A 3G5EA 1W3LA 1F3TA 3SCSA 2GQ9A 3TKFA 4FF5A 2NV1A 4GVHA 1ZJHA 2JGYA 5I0DA 1AJ2A 4NZFA 1KTBA 5M1TA 4CNUA 5FEXA 2PTDA 2FMOA 1KGXA 3SFWA 4K8GA 1GZJA 3WL1A 2ZVIA 3CMJA 3GNOA 4QROA 2WOQA 1XIBA 4GC4A 3M0ZA 1R9YA 1LL4A 1YDOA 1WV2A 3BO9A 3WJXA 5CG7A 3T09A 3E02A 5AY7A 2ZKMX 5T8GA 1O1HA 5LYRA 3VIGA 1OM0A 2ZUTA 5G2WA 3B8UA 2JKAA 1H7WA 2PDKA 3CQHA 3K13A 2PDWA 4JIIX 2Z1KA 3OP2A 2C0HA 2JALA 2WHJA 4U5IA 3KBJA 4F2TA 3S46A 2XSBA 3GBDA 3AOFA 3N3TA 3GTHA 3FXYA 3AYVA 2DY3A 4OV9A 1ZY9A 4B4FA 3VNZA 3CLMA 3C2YA 3WJZA 1Q2RA 1V93A 2VFFA 4V27A 5AYIA 3LBOA 2B4GA 1YLVA 2P50A 4CQBA 1ISWA 4PUKA 2IUZA 4LYRA 3HPSA 2QR6A 3WH8A 1M3UA 5I02A 2QAFA 2VR5A 2QMJA 4GWEA 1UR8A 3MUCA 1ZZMA 1GZGA 1CXEA 3OW1A 3HV9A 4XD5A 3K30A 2VRQA 1EJWC 1OEPA 1MEHA 4Z42C 3P0XA 3OG2A 4GY7A 1W8SA 3A3WA 4UZUA 1O95A 1ONEA 1JUEA 2C15A 5D09A 3S1VA 3H6OA 1KXVA 4H8NA 1ML1A 2PDUA 3LRMA 2VGFA 1WDQA 3G1VA 3FHAA 2YW3A 2HVNA 1G0CA 2ZFAA 1NQ6A 5H91A 2Y89A 1YQ2A 3MU7A