4JTEA

Crystal structure of f114a mutant of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
276
structure length
251
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAALARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQTRGRRAQALDLALAGMATRLAGLFLPLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Examining the Role of Intersubunit Contacts in Catalysis by 3-Deoxy-d-manno-octulosonate 8-Phosphate Synthase.
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 85
structure length 251
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2013-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4jteA00
1L2UA 4AEOA 3WFAA 1QFEA 3CM4A 3S8HA 3MHUA 3PR2A 1C9DA 5CGQA 1PV8A 3TSBA 2GQAA 1J4EA 4UFHA 1OF8A 3TFCA 3HG2A 1R30A 1VQTA 1IXNA 2V0TA 4IMEA 4TU1A 3OHIA 3Q94A 3VE7A 4OV9A 2PURA 3NQDA 4BI5A 1JCXA 1IF2A 3L0KA 1SW3A 4XBKA 1WDWA 1FCQA 3BG5A 4UMAA 3UZJA 4DF1A 2X2GA 5D2XA 4NZFA 3M41A 2QR6A 3O6DA 1G7UA 3PB0A 4HNTA 3EWUA 4RZ4A 4JY8A 2J27A 4DELA 3G0XA 1JCLA 2J9ZA 4L4MA 3S1WA 3P84A 1W5MA 3W1UA 4FX7A 3OVPA 1TO3A 1QO5A 1V7YA 1P4CA 2WNZA 1F73A 2ZA1A 3KVKA 3U2OA 3EX3A 2YFNA 2Z0IA 1JUEA 3C2RA 1W31A 1LORA 4BI7A 3W1RA 1G6CA 3UWWA 3MW7A 5FESA 2J24A 3DHFA 1UB3A 5LNVA 1SO5A 1X8FA 4AHQA 4POCA 3LV5A 3W72A 3LCIA 3NQFA 5BW6A 3W3OA 4WOZA 4MFDA 5F2IA 1Y0EA 2QJGA 2ZDRA 3W7CA 1ML1A 1IGSA 1OK6A 2X1RA 2GUUA 1FUYA 3W2NA 2J9YA 3LXBA 2JKEA 1OX5A 2DZVA 2X1TA 1LRQA 3BV4A 2WNNA 4O52A 5H2ZA 4LOCA 3L9CA 1LTDA 1XBVA 4FNUA 3DFTA 1OX4A 3G1XA 1H7PA 2A5HA 3M7WA 1I2OA 4MVAA 1VR6A 4WJEA 3GAYA 2XN2A 1XBYA 1VLIA 1NF0A 1OFQA 4PEKA 3FEMA 3WJWA 3M47A 1TV5A 4FNPA 3LGEA 1RQEA 1O5KA 4MY9A 3W23A 4DO5A 4TMBA 4UXDA 3DFOA 4ML9A 3GR8A 3W73A 3IIPA 1ZALA 2WV8A 1P0KA 1THFD 1AW5A 2H8ZA 4QSHA 1GVRA 2QCLA 1I8JA 1ZAIA 4WX2A 5E93A 1H7NA 4O13A 1VZWA 1NFBA 1GVOA 2WOQA 1X6UA 2FFCA 2HTMA 1G67A 2A7PA 3IGXA 1L6WA 1PHQA 3M6YA 2ZA2A 4NX0A 4IGHA 1K7XA 4LV4A 3STFA 1ZY9A 5CPNA 3W84A 5CSRA 3GDRA 1P0NA 2I14A 5KZDA 4N6FA 3FIGA 3PB2A 1ZAJA 4MOZA 4RJEA 3NL5A 1DBTA 2EGZA 3MBDA 1NAL1 1HTIA 3SZ8A 4JR5A 3C6CA 3GB6A 3MWAA 3PBYA 3SGUA 3GKAA 3W07A 3HF3A 4HNVA 2TSYA 4RXFA 3TSMA 1OFPA 4ZQCA 2G97A 3N2MA 3GZ3A 1W5NA 5I3GA 3PC0A 3O15A 1X1OA 3C4UA 1GT8A 1W54A 2ZRXA 3SECA 1WA3A 2H6RA 1JCYA 4KKXA 3MP5A 1I2NA 4O15A 4JXCA 1OF6A 2V81A 2DZWA 5HULA 5AFDA 5LKYA 2Z6IA 3NQMA 3LLDA 3LHTA 3VKJA 1EP1A 4MZYA 4AF0A 4YXGA 1GG1A 5L6UA 5TBOA 3N14A 2FJKA 1MXSA 4JTEA 3NQEA 4O50A 3W74A 2F7FA 1LRTA 1Q6OA 1WV2A 1PCKA 4UIOA 3M1ZA 5K4XA 1HUVA 2CZEA 3ANYA 2X16A 2Y85A 2RFGA 3KVMA 2JKPA 4O19A 2Y88A 5L9FA 5KZMA 1W8SA 1J5TA 4GNJA 5F2GA 4JIQA 1DQXA 1O5XA 3LX9A 4UCGA 3LTYA 5J5RA 1DKWA 5AHIA 2ATSA 1KFEA 3DKJA 3R2GA 4IOTA 2CW6A 4FNRA 3PBVA 2GVGA 5AYZA 3DI0A 2FB2A 3L68A 3WJXA 3LB0A 4ZL1A 3SY5A 1L6YA 3TC7A 2C18A 1P1XA 4WQ6A 2EHHA 2VEIA 3NL3A 1OABA 4UTHA 4GBUA 4HNUA 5D05A 4B5NA 1S3HA 1VCFA 4Q32A 4K8EA 1RV8A 3B4UA 4R34A 4UFKA 3HG3A 1PL9A 3P67A 3TCEA 4EWND 3A5FA 3W85A 1H61A 2QCEA 5G1TA 4IMDA 5DCEA 1LP6A 3C2OA 5FI8A 2A85A 3W7PA 4K7VA 4MKNA 1TPB1 3KOFA 3W2MA 2HS8A 3I7QA 3O06A 1PVNA 4NT0A 3DENA 1N8FA 3KVLA 3HG5A 1SFJA 1ME7A 2C1HA 3W7GA 4QITA 1BWKA 4FXSA 5HWJA 3S5OA 4UR7A 1ONRA 3LTPA 1AK5A 2FPYA 4M6PA 2VC6A 3E12A 1W5OA 4UFJA 3JRKA 1ZJIA 3FKRA 3QYQA 3QW4B 4A29A 3R8RA 4IUOA 1TREA 2NZLA 3LDVA 4MYAA 1R46A 3LRMA 4X2RA 5E0KA 4WY0F 3P82A 3O6CA 3NA8A 2B7NA 3OBKA 5FEZA 2YX0A 3UXAA 4OE7A 1K7FA 5DCDA 1HFBA 4BFAA 4XQ6A 1ICQA 5D04C 1QO2A 4RX0A 5AB3A 2BSLA 1KTCA 5D32A 3IGSA 3NNTA 5BMWA 3OEXA 4D2JA 1GWJA 4X22A 1A5SA 3IIZA 1PCWA 3B0UX 3KRSA 4ZQOA 5DN1A 3GDKA 1QR7A 1SUXA 2ZZ3A 2DZXA 2CFFA 4GE8A 1H1YA 2EF9A 1YTEA 4E0CA 3NPVA 2JKAA 1O95A 3L0GA 4TMCA 3QFEA 4NX5A 2VFGA 1RQHA 3NDOA 1F5ZA 3PUEA 3QC3A 1KFKA 4IXHA 4OT7A 4CLMA 4M6VA 1O4UA 1EEPA 3UY7A 4W9TA 3UYCA 4EF9A 3W2LA 2NWSA 4GXMA 1TPWA 4HIBA 4AWTA 4FX8A 4RKAA 3R5EA 2AAMA 2QCDA 2Y7GA 1B57A 3P62A 1FXPA 4TO8A 4M7SA 3HQ1A 1RPXA 2C3ZA 4ADSA 1RQBA 2ATMA 5F4SA 2YFOA 1TPDA 5ABTA 1KM2A 1OFBA 3LCGA 1JJKA 4N4QA 3LCHA 2B7PA 2NX9A 1M7OA 2J88A 1BWLA 1FCUA 3HGSA 2OCZA 3K30A 1G4PA 3M5ZA 4N9DA 4AAJA 4RR4A 5HR6A 3TJLA 4KWWA 4WXYA 2QKFA 3UWUA 3FLUA 4U28A 3VFLA 2H90A 2WO5A 5EBUA 1TJPA 1SZGA 3C52A 3GNDA 3SSJA 4CNOA 3RLUA 3M9YA 1F6PA 2GJLA 3GAKA 4OBTA 4JDYA 2VELA 3ABQA 3G0UA 2Q3OA 3FJLA 5F4XA 3G8RA 1W3NA 3R12A 7TIMA 1AL8A 5HUOA 4MZ8A 4M7TA 1ZHAA 1YTDA 3FOKA 4NJGA 2F84A 3EXRA 2C13A 1KV8A 1LYXA 1SSGA 3Q37A 3T78A 3TAKA 1SZNA 2FIQA 3LERA 4UTJA 3LV6A 2V5LA 4MYXA 1WYIA 1K3UA 3WK2A 1PIIA 2ZCGA 4CCDA 3STGA 3W7JA 3TW6A 3M5YA 2D73A 3TSDA 3S5ZA 1D9EA 1JQXA 4E38A 4JDBA 1A5AA 1OFDA 1VJIA 4JTHA 3H53A 1H7RA 1GVSA 2V9DA 2V82A 3BK0A 3DXIA 1BEUA 1LBMA 1VPXA 2ZYFA 3TKFA 2ZZ1A 3CT7A 2YYUA 5K2ZA 1YLVA 5J5DA 1WOAA 3MUXA 1JRCA 3QEZA 4TIMA 1YADA 1JCJA 3G1VA 4N6EA 4RLIA 1GG0A 1LZOA 3GVGA 5CKSA 5G2HA 4M5PA 3LRLA 2ZRZA 3TK7A 1UUOA 4DF0A 4QISA 1XFBA 3BLEA 3NQ6A 2CWNA 3MI3A 5D2TA 4MPQA 4LUIA 4JTGA 2C14A 1M7PA 1F6KA 3BG3A 3G0SA 4BWLC 2E6DA 3SFKA 4GFSA 1TJRA 3S1XA 2ZZ6A 3HGRA 1N7KA 3F4WA 4JX4A 2Y6ZA 4N9CA 1T0OA 1MZHA 1IXPA 3LHYA 1FY6A 2DZSA 3FYOA 3TMLA 1H5YA 3W7EA 3RK8A 2E6YA 3MHGA 5CZSA 3CHVA 2V2CA 1K8YA 3L5LA 3IVUA 5T26A 4XTIA 3LOTA 3QMRA 3CEPA 3LLFA 3FS2A 1JULA 5A5WA 2A7RA 4ORIA 3EB2A 3N9SA 5D2VA 1KA9F 4DF2A 1FX6A 3NPXA 4UFMA 3GDTA 3PG8A 1YYAA 1FCBA 4MJZA 5DXXA 3TUUA 4XUGA 4UTKA 4UTTC 1RVGA 3MHFA 3OIXA 2NUWA 1HO4A 3BLFA 1K7EA 3NPWA 5KMYA 1QAPA 5GVJA 1M6JA 2ZZ7A 1XXXA 4C1KA 4S1FA 4Y90A 1H51A 4CQ9A 5C2XA 4JYFA 2P1FA 5G1YA 3T55A 4NXSA 5F2LA 1TYGA 3PUDA 5D03A 4Z1AA 3N9RA 1A50A 5C6MA 2CLMA 2Y89A 1LOSA 3PY2A 4NXKA 3PS7A 5D2WA 4PCFA 2NV2A 3UY8A 3W76A 2ZRWA 3LTSA 3NOEA 1KM5A 5IM51 3IGUA 3W7LA 3NZRA 2VEMA 2J9XA 2ZZ4A 1ADOA 3W88A 1R2SA 2X30A 1XM3A 4XTDA 3NYZA 1GOXA 4FB7A 3CWOX 4O16A 2RDUA 1AL7A 2Q3RA 3IVTA 1W1ZA 3IIOA 5CPMA 2OX1A 4ZMGA 4XZ9A 2FPVA 5KZEA 2CLLA 4OQVA 4LRTA 2GVJA 5EA9A 4O4VA 1OFOA 4FIQA 2FLIA 3VNDA 2VFFA 4A22A 5CZTA 5K4ZA 1GYLA 1KLZA 1I2RA 1H62A 3H55A 1VYRA 3C2EA 3EWXA 4AMAA 3O07A 5HMSA 3HOJA 4LVGA 3ZWTA 2OJPA 4UMCA 1EX5A 1LROA 1AW1A 3GXTA 4MLRA 2QCNA 2A6LA 1K8XA 5FEXA 3RLVA 2Q8ZA 3L5AA 2PRLA 4H6KA 1Z44A 4AHPA 2Z1BA 1ZCOA 2I9EA 4UFIA 2G95A 4H4IA 1DJNA 2V5BA 4KFNA 3NL6A 1TPH1 4QNEA 3NQ8A 3VCRA 4FNQA 1FDJA 3Q2DA 1QPRA 1OYCA 5A8GA 3P61A 4Z0SA 1XDLA 3W1PA 4UTLA 2DJLA 3JS3A 2C19A 3ABSA 3V75A 3SI9A 3PSWA 4O57A 2QAPA 3CU2A 1T8XA 5EMUA 1H1ZA 5LSMA 5FF3A 3NQAA 4NVTA 1LDCA 4WY0A 1DORA 1TPC1 5G2IA 4GC4A 4O10A 1W3TA 1OX4B 3B05A 1XUUA 3E9AA 3I6RA 4O4WA 2X1UA 1C8VA 3STCA 3RFAA 2YCEA 1GTEA 3LCWA 3PUOA 4RK8A 4JTJA 3P7YA 3HPSA 3W87A 1VLWA 1HG3A 3PF3A 3BGGA 1FWNA 2ABBA 2YDAA 3E49A 1S5WA 2R91A 4IMCA 3TA6A 4KFOA 3GYEA 3O8AA 3CC1A 1QOQA 2ZRVA 1CI1A 4HSNA 4MY8A 5AC7A 4GUJA 1SO6A 1UUMA 3NG3A 3C56A 3NQ2A 2YSWA 4JTIA 4WOQA 3W1LA 5D38A 2OT1A 2QJIA 4QAIA 5SWUA 5FF4A 3L0NA 3O1NA 1TRDA 3NQVA 5BNKA 3SIZA 4MFEA 2XN0A 3G18A 1TTIA 4RCXA 4O54A 4XWUA 4WUIA 4K7YA 4JY9A 2QF7A 3G1YA 1MEHA 3C2VA 2BLEA 2NV1A 2PRMA 3B0VC 4LW7A 1VC4A 3W70A 1HL2A 3MJYA 1PE1A 2CLHA 1SZEA 3UWQA 5AOUA 3GXNA 3QJAA 3HPXA 1O94A 1VRDA 1G4SA 5K9DA 3KRUA 3PVFA 1CW2A 2EKCA 3S6DA 3DI1A 3MI2A 4PFMA 4JS3A 2Z2UA 3IEBA 4PL1A 1FWRA 4DO4A 4QM1A 4EF8A 2VFEA 2VENA 1GPWA 1FBAA 4K6AA 3DFPA 4M6QA 1ALDA 3WJZA 3EX2A 3NO5A 4QQ3A 4BR1A 3HIJA 3CQ0A 4HNNA 1W5PA 4O1CA 4P61A 2KZHA 2YW4A 2H3BA 4UTWC 4A3UA 4LUJA 2JGQA 4AF0B 2TMDA 4I7WA 4YMZA 5FF0A 1LM1A 4KWVA 1DOSA 4FF7A 1B9BA 1NVMA 3LBCA 3A22A 2W79A 1ZENA 5LGZA 3RNDA 1SR9A 4BI6A 5I3JA 1KTBA 1VS1A 5CPOA 1V5XA 5DY2A 2FDSA 2B0MA 4MIMA 3W86A 4IMFA 3I65A 4IXXA 1XUZA 5CZ0A 4IMGA 1F2JA 4JGDA 3Q58A 4E2DA 4IPJA 3HG4A 2QDGA 4HSOA 1XCFA 4O1DA 4WD0A 1QPNA 3KAOA 1AG1O 1KV5A 3UZ5A 4UTWA 2CLIA 1F76A 2E5BA 3TU9A 1IXQA 3UWYA 4ADTA 3UNDA 3W7DA 3W1MA 4JTFA 1FWWA 5DLCA 3M43A 2ZRYA 3QPYA 5LGXA 3FA5A 3DFNA 1FDZA 2TYSA 1OYBA 3OG3A 3TH6A 3S5NA 5FEWA 4CNNA 2DZTA 3LHUA 2A4AA 3PM6A 5LHFA 1EWDA 1ICSA 4LVBA 3E96A 5EPDA 4K36A 3EWBX 4NNAA 2P0OA 1KM0A 1GZGA 3LXAA 1U83A 4LVDA 4PL2A 3MP4A 1D3HA 5D2YA 4ORMA 4IX2A 3NL2A 1Q45A 3W7IA 4S2CA 1K03A 3G24A 1RD5A 3LCLA 1L9WA 1QNVA 4JTLA 2V30A 1LBFA 5C5YA 4PH6A 2AQWA 2B7OA 3UPWA 1TCDA 4PA8A 2ZQ0A 2OZ0A 4YCPA 3O05A 5KITA 4O8RA 5CPLA 2VFHA 2VFIA 5DXYA 5KTLA 1TTJA 3N19B 1KBIA 4O18A 2PRHA 3L5MA 1W0MA 1JQVA 5D37A 4RV8A 3QQ1A 1YDOA 2ZBTA 3OA3A 1E51A 1KW1A 3A21A 2WPBA 1LCOA 3TIMA 3HGOA 3HB9A 4UNLA 4LC6A 2VOMA 5TIMA 3M5VA 4Y96A 3KHJA 1LOQA 3EEGA 3U6WA 1MEWA 2Z6JA 4OWGA 5HWMA 3W83A 3A9IA 1SQ7A 3NQ7A 1VCVA 4EOUA 5K7JA 3W1AA 3OVRA 3IIVA 3S5YA 4AXKA 2NWRA 3THAA 3HJZA 2CLFA 1EIXA 1GVFA 1TQXA 2CZ5A 4IX0A 3NQGA 3W7RA 4FIRA 2NUXA 4JTUA 2GJNA 3P60A 4NZJA 4YL2A 2WKJA 3AO0A 2WNQA 1U5JA 5D02A 4NNBA 4FNTA 4O12A 1OX6A 3INPA 4CNPA 3QRHA 4AHOA 4IJBA 1TV7A 4JYDA 4NJJA 4DEFA 3V1PA 2ZTKA 3E0IA 5EYWA 3JR2A 4ADUA 3F03K 3P74A 1F05A 3W7MA 4MY1A 3S1UA 1VHNA 3S1VA 2A1YA 2QCDB 2HMCA 5AHNA 3H54A 4DXVA 3GR7A 1GQNA 1G4EA 3BO9A 2ZTJA 3MI6A 4A21A 2QDHA 1GJPA 5BOOA 3NXFA 3W7QA 1YDVA 4C1LA 3TX9A 3EX1A 1C29A 2DZPA 3CB8A 3IVSA 3PBWA 3G1DA 4O17A 4RZ6A 4M19A 4Z0JA 1KBJA 4CQ8A 2ZFAA 1H7XA 5HR7A 1FQ0A 5I3IA 2V8ZA 3HPZA 4ZQRA 2QCHA 2DP3A 3MYPA 2R14A 3FJ6A 1EP3A 4PC8A 5LNSA 3EXSA 4XKYA 5LZLA 3M0ZA 5DBUA 3A24A 1LBLA 2DORA 2R8WA 1GEQA 4GUIA 4O0KA 4IQLA 1JR1A 1QPQA 3ABRA 2UV8G 4GUHA 5AYXA 1B4EA 3QQ0A 2WQPA 3AJXA 2VFDA 3BW3A 3W7OA 3T7VA 2QCMA 3TROA 1H63A 1QWGA 4LVAA 2JGYA 2RH9A 4NNCA 3WJYA 3S42A 3P81A 3W7NA 3WK0A 4MUZA 2Y7EA 2VXNA 4O53A 2NX3A 2BTMA 3W75A 4DBDA 3S0CA 2PC4A 3QF0A 3BW2A 5AN7A 1MEIA 1OFRA 1RR2A 5IBXC 3W2JA 3DHDA 3TXVA 1R2RA 2QCGA 2DJXA 1H60A 1I2PA 3HBLA 2NUYA 3UD6A 3M44A 3C3NA 1J2WA 5CG7A 4R7JA 3FKKA 1FCVA 4GRSA 3B0PA 5AHLA 1YDNA 4ZZ9A 3NAVA 3TQKA 1Z48A 1KM3A 4JYEA 1Q6RA 1KLYA 3U8GA 3P80A 4Z08A 5HWNA 1XC4A 3ZFHA 1JCNA 2QAFA 4DPPA 2E6AA 1X1ZA 3EWWA 4A2RA 3HO8A 1BTMA 2BXVA 4BWLA 5G5IA 5G4EA 3UWZA 3ATYA 3QPZA 3TQVA 2ISSA 5IBXA 6TIMA 2W0UA 2ALDA 2HSAA 1TPEA 2CZFA 4X3ZA 4LT9A 4EVZA 2E5CA 3TAOA 1YXDA 2FQIA 5FF2A 2OT0A 2GPTA 2ISWA 4JIPA 3G22A 1A5BA 1WBJA 2DU2A 3ABOA 4OV4A 5AC6A 1TV8A 1SO3A 2BZNA 3LRKA 4FXRA 1FWTA 4DBEA 2Y61A 4UR8A 2RKXA 1KM4A 2Y62A 4LS1A 1QCWA 3ZR4A 1WOBA 3O6YX 4QNWA 3PULA 3IRDA 1SZFA 4MLJA 1FXQA 3SJ3A 1OK4A 3TE9A 2NXHA 1EUAA 4G1KA 4UTTA 1NSJA 1TRIA 2Q8LA 4NJIA 5HQEA 1O60A 3R13A 3NM3A 3HMJG 3KX6A 4HKPA 2E5DA 5G2WA 1T99A 2YGYA 8TIMA 3SR7A 5F2MA 4RXGA 2CLOA 3B8DA 3MO7A 2C0AA 1F74A 1JUBA 3VE9A 3NVTA 4N9EA 1H7OA 5LHEA 4KFPA 2B4GA 3P8JA 3G1HA 3LI0A 3G3DA 5I3HA 1QOPA 5AC8A 1MO0A 1S5VA 1KM6A 3EWZA 1SO4A 4Z1DA 3LHZA 1SFLA 1B4KA 2EPHA 3WJSA 4LS0A 1W56A 1OJXA 2E09A 2CLKA 5DBTA 2G5WA 4TR9A 4N2YA 1SPQA 2BX7A 3TDFA 3UPBA 1EA0A 3VI2A 1VGAA 4UUIA 2Y7FA 1TSIA 4DO6A 1Q6QA 1VHCA 1EPXA 5KSWA 3DKLA 5AYYA 3SW6A 3B06A 2HS6A 3DBPA 2FB3A 2AGKA 4R33A 4LNYA 2A6NA 5TQLA 4IPIA 3ZS4A 4LTSA 3P8IA 2OMAA 4N9BA 1FDYA 3TR2A 4AB4A 4S2BA 3A5VA 3MYOA 1IIGA 1ME9A 3IIXA 4JD4A 4FEZA 4LU0A 3W1TA 5C54A 3LCFA 1FWSA 2E77A 3TNOA 1IXOA 1NF7A 4AH7A 4QIUA 4WZHA 5F4WA 1LLZA 3DFSA 1S5TA 4QJ1A 1W3IA 2P10A 3L21A 5K3VA 1OFEA 2A7NA 1Q3NA 1PS9A 3M5XA 1EUNA 4O28A 2Y7DA 2TRSA 2V2DA 5HUPA 2QJHA 3CWNA 1GYNA 4Q4KA 3QMTA 1TPFA 1HO1A 4UNKA 5HINA 4CCEA 5KINA 1N55A 2GQ8A 3D0CA 2GQ9A 1YXCA 4UFLA 5BRBA 1VCGA 5C55A 4GJ1A 3WK1A 1DQWA 1WBHA 1TPVA 3PBUA 1KFBA 1UCWA 2C6QA 1YPIA 1UBSA 3EKLA 4JTTA 3W7HA 4YLWA 1XKYA 4LV9A 3M16A 1W37A 1ICPA 5EKYA 3PSVA 2CLEA 3EWYA 4WY0B 1I2QA 1Z42A 3HGJA 3C61A 4A2SA 3QH2A 4FNSA 2O7SA 1OHLA 4R53A 2NX1A 1ZFJA 3W1XA 4JTKA 3UQNA 1TIMA 2NLIA 3GDLA 3TJXA 5AHEA 3DH7A 3P5ZA 1G69A 3G3MA 5DCBA 4LWWA 1XBZA 3STEA 4JX5A 3SGZA 3C8FA 2ZZ5A 1K02A 4NJKA 2G96A 3F1QA 1ZAHA 2LLEA 3F4NA 4O0ZA 3DU0A 1TPUA 2ABAA 1EP2A 2YR1A 5F1VA 1TQJA 3PAJA 3W1QA 4H3DA 3BVJA 1GVQA 3LHVA 3LBMA 3A23A 3CTLA 3KRZA 1KFLA 4FHAA 4JTSA 3CEUA 3ATZA 4UTMA 1DHPA 4N4PA 3W9ZA 3TXZA 3C0JA 3PG9A 5EY5A 1TB3A 3G1FA 5AHMA 2VKZG 3WK3A 3G1SA 4ALDA 2FTPA 4K37A 5F1UA 4O14A 2ISVA 2YXGA 1VH7A 4YWIA 3S9YA 4OHQA 4LRSA 1A53A 3LI1A 3NGJA 4GWEA 1I45A 3NM1A 4RZ5A 4UTIA 2PCQA 2QUUA 2W6RA 2TPSA 2QCFA 2EAWA 4ZQNA 4AWUA 1VYPX 3NPUA 3BARA 1KM1A 4GUGA 3EX6A 1LOLA 3N34A 4Y8FA 4WXZA 2A0NA 3THQA 4NJHA 1K8ZA 1KFCA 5CZJA 1AMKA 1OVDA 3L65A 4HT3A 1A5CA 3DAQA 3TFXA 4OU1A 3FYPA 4JX6A 2WSQA 2IQTA 1G7VA 3GNNA 2VEKA 1KTNA 2E68A 4P2VA 3I7SA 2CU0A 2DZUA 1ZNNA 3PWAA 2WSYA 4CQAA 4HPXA 3EKZA 3GX9A 4NUWA 3NR0A 2ZA3A 1DV7A 3MP3A 1MSSA 2RDWA 3W2UA 3QZEA 3LM7A 4UMBA 1H50A 4Z1CA 3TC6A 1OG0A 1P5BA 3GDMA 3W22A 2H8XA 5LNWA 5MHBA 3KFTA 1TTPA 2VEPA 3L66A 5BMXA 3QMSA 2GOUA 3ZWSA 4O1AA 5FF7A 1JUKA 1CX9A 1LLWA 3UWVA 2A2IA 4BF9A 3TV8A 3ELFA 1G4TA 4LC8A 4MZ1A 2H3DA 5D30A 3DFQA 4K38A 4J9JA 3YPIA 5U7SA 4JICA 1D3GA 4I7UA 3DGRA 2JBMA 3BLIA 3O63A 3GKFA 4NQ1A 1JCMP 3EX4A 2CZDA 3LHWA 4ZQMA 2QEZA 1VYSX 1X7FA 3EXTA 2QUTA 2WSRA 1NEYA 2R94A 3T4CA 3GLCA 3W71A 2Y70A 3N73A 3CPRA 1JVNA 5K9CA 2X1SA 1SSDA 3FFSA 5FEPA 4U4MA 3TQ0A 4ZQPA 2BWGA 1Q6LA 2A21A 1WQ5A 1BKSA 4UTUA 3NQCA 1OFAA 1XDMA 1SW0A 3TW7A 3C2FA 4LVFA 1XL9A 2J6XA 3BPWA 4PTNA 4ICNA 4Q33A 4ONVA 3L2IA 2RHGA 3QM3A 4DQWA 1F7BA 3T44A 1TMHA 5DY3A 4FO4A 2E6FA 2XFWA 3T40A 5U4NA 5LNUA 2NXGA 4JEQA 1XI3A 4AVFA 4Z1BA 3CLMA 1GTHA 2O7QA 2QUVA 4GUFA 1EB3A 1UJPA 2Y63A 3KXQA 3G8EA 4E2BA 2NXIA 1I4NA 1R47A 2E1DA 2B7QA 3NEVA 3GIYA 1JRBA 3RMJA 4FX6M 5E1QA 4OGZA 1QPOA 4EIVA 3G1AA 5HJLA 1PHWA 3IV3A 4HPJA 3W7KA 3RU6A 3N2XA 4HN4A 3DZ1A 4Y6GA 5I3KA 3W6YA 1UASA 1SU5A 5LNRA 4XBSA 5CSSA 4K8HA 4UC5A 4LY8A 1L6SA 1RZMA 1IIHA 1SW7A 1KFJA 2C16A 1DVJA 3QSRA 3LXCA 4O1BA 1ME8A 1QDSA 4MJMA 6ALDA 1YTKA 2FPTA 4N02A 2QCCA 3USBA 3MBFA 4K39A 2C15A 1WXJA 3BW4A 4HHPA 4IWWA 1M5WA 4LS2A 4I9AA 2PE4A 4JNMA 4AWSA 5K9XA 2ZZ2A 3LCXA 1OYAA 1W5QA 5DELA 4O11A 2JK2A 5G4WA 3RF9A 5D09A 1H7WA 1QMLA 3BGJA 5AHFA 2ZRUA 1R2TA 5H91A 4I7VA 3TMQA 1LRNA 3P5YA 5HNRA 3NZ1A 3R89A 1YPFA 2V2HA 1XBXA 3OVQA 3W1NA 1YXYA 4NU7A 3UXDA 5I3FA 2WJZA 3CIWA 2XN1A 1WX0A 4YCOA 3I68A 4CCCA 1WAUA 4BK9A 2YW3A 5EL1A 3B04A 1DJQA 1Z41A 2RDTA 3B03A 3BG9A 2I1OA 3CIXA 3GK0A 1EWEA 4XKYB 3W2KA 5D33A 4TX9A 4ZVJA 3QW3A 4X9SA 3I7RA 4JN6A 4PODA 1T96A 2GVLA 1AW2A 2YZRA 3O16A 1DL3A 3N3MA 1B3OA 3QSTA 4Y9AA 3GXPA 1TTQA 2YPIA 3E02A 4DPQA 3KVJA 3L67A 4L4LA 2YYTA 3MMTA
chains in the Genus database with same CATH superfamily
1L2UA 2YLAA 3OB8A 5DF0A 3UFYA 1ITCA 1J4EA 1AZ1A 5B80A 3OHIA 3SJNA 2PURA 3VM5A 1R3WA 2D0GA 4MPKA 2QF8A 3L0KA 1SW3A 2EKGA 1WDWA 3UZJA 3GIQA 4DF1A 3AHVA 3ZJ8A 5A6AA 3M41A 2EBNA 3PFMA 4GYKA 2F38A 2J27A 3G0XA 5A8NA 1JCLA 5MF5A 5ECUA 2J9ZA 4QG6A 4I8YA 5HXMA 4FX7A 2POZA 3IARA 3CL7A 2WC4A 2WNZA 4N7QA 5BXRA 3U2OA 2YFNA 1JUEA 3QYSA 1W31A 1LORA 4PB5A 4I5XA 4BI7A 3OJGA 4L6OA 1LWJA 3MW7A 3DHFA 6XIAA 1JGMA 2YB4A 4RDVA 5LNVA 3WNOA 3CK5A 4LBRA 4MADA 5A8MA 2J74A 5CLTA 3W72A 4PTMA 3LA4A 3NQFA 2PSNA 2VDHA 4IGSA 4AG0A 2VD8A 2OKOA 1CXIA 2QJGA 2ZDRA 4L5ZA 1IGSA 2X1RA 4DYEA 4GZIA 3PFRA 2WZTA 1TZ9A 4U10A 1SMAA 3LXBA 4B15A 2JKEA 2D2OA 3V0UA 4Z2GA 3KS6A 2WNNA 3UCCA 3D3FA 5HQMA 4FNUA 3G1XA 1ISWA 4AY7A 5CBJA 4B92A 3W01A 1ZQ5A 2GDVA 3GAYA 4GX9A 1CB2A 4PEKA 3WJWA 3M47A 3RUBL 3WIJA 1M7JA 3I4EA 2BHYA 3WYZA 3DFOA 2OEJA 3W73A 3WFLA 3GVWA 1J12A 3IIPA 4DN1A 1GKQA 5FJPA 2ICSA 3FW6A 1U30A 1BLIA 2CNCA 2QCLA 1ZAIA 4IIGA 2C79A 3T0BA 1OM0A 3K1GA 4AZCA 1PAMA 1M04A 1G67A 1QNSA 1ZGDA 1L6WA 3FAXA 5HAOA 1ITXA 4GH1A 3RM4A 5CJ5A 1PHQA 3M6YA 1Y7VA 2QPSA 4NX0A 2Z27A 4IGHA 2E3ZA 2VC9A 2XFYA 1K7XA 4LV4A 1DWIM 1ZY9A 2G3FA 2F6UA 4GYFA 1H5VA 5BU6A 4N6FA 4XX6A 4UQDA 3TQPA 3FIGA 4NASA 3A9BA 1FA2A 5FCZA 2DVXA 4RJEA 3NL5A 4ZCWA 1HTIA 5FKYA 1FVPA 3GB6A 4Z1YA 3R11A 5A8QA 4V2XA 3P3BA 3MJMA 3GKAA 3HF3A 4HNVA 4KT2A 1VENA 2G97A 1B30A 4DZAA 4KRUA 3VMOA 3FSTA 4ZOEA 3QV8A 4J3XA 3O15A 4GA8A 1GT8A 1W54A 3FV9A 3H7UA 2IXUA 1XYLA 4I5RA 4O15A 1B2YA 4HYRA 3KBVA 5AFDA 5HNUA 1JZ5A 3OLGA 2Z6IA 3MCMA 3MVIA 3NQMA 1UC4A 1DIEA 1QW8A 2V38A 1XLLA 2BOGX 3W38A 4YXGA 2YCIX 5L6UA 2OYMA 3N14A 5FIPA 2CYGA 4O50A 2PDYA 3II1A 4XSMA 2QGYA 4UIOA 3WBXA 5K4XA 4RZBA 3IJ8A 1DEDA 4MAZA 3KVMA 2JKPA 2GJXB 1UP2A 1UKSA 1XRVA 1J6PA 4MDPA 3BJSA 1DKWA 3DKJA 3R2GA 1EL3A 2CW6A 3NGFA 2VX7A 3K4DA 2G0WA 3GU9A 3TC7A 2C18A 4DRSA 4MJ2A 2VEIA 3NL3A 1UR4A 4HNUA 1QVBA 4B5NA 1FKWA 1DQUA 3R0DA 1QBAA 1VCFA 3E3HA 4K8EA 1LUCA 1I0BA 4MNMA 2EXOA 4IFRA 3P67A 4NG3A 3R8HA 5A69A 1B3WA 3ZLGA 3B8IA 2QCEA 4KEZA 3G5EA 1HP4A 2OZ3A 4IMDA 3RU8X 5FI8A 4DWSB 3AWOA 1EGZA 3FXYA 4K7VA 4MKNA 3KOFA 1R3TA 1V3KA 4S23A 2HS8A 3I7QA 1TWIA 4AMCA 3KVLA 3UG8A 1PX8A 2DV0A 1BWKA 3FDGA 1IQ8A 2FPYA 5IDZA 1W5OA 3BAWA 4M0XA 1RCQA 3A4WA 4A29A 4ERIA 6XIMA 4MYAA 1CLVA 2A3LA 4K3ZA 4DJDC 2B7NA 4CD6A 5BOFA 1HFBA 3LPFA 1IWPA 3LN3A 4XQ6A 3BZGA 3S6TA 1JD7A 5C9WA 3BMXA 3N12A 4MDOA 2BSLA 3PAOA 2VL4A 5D32A 1PZ1A 3NNTA 2I57A 4D2JA 1H4PA 2O9RA 4X22A 2PDKA 3GDKA 5A6JA 1SUXA 3VGEA 3ZIZA 2GK1B 4NYYA 1H1YA 5BXSA 1AQFA 3O0FA 2GGEA 2JKAA 4TMCA 2VFGA 3NDOA 3PUEA 1A47A 4YNGA 3W2LA 2NWSA 4PUDA 1PKMA 4IF2A 4JOMA 1TPWA 4AWTA 4RKAA 4W4QA 3BH4A 4JZ5A 2W92A 2NSXA 1RCXB 1B57A 3P62A 3OLEA 1ADDA 2C3ZA 4ADSA 4HTYA 3QKZA 1C90A 5C7VA 2P53A 5D8WA 3LCHA 2B7PA 2NX9A 1M7OA 4BEUA 1BWLA 3WQ4A 2OCZA 1G4PA 4AAJA 4GKTA 4WXYA 4K1WA 2Z24A 4B3ZA 1SZGA 3GNDA 3H12A 4HMDA 3A4XA 4B4FA 5M3WA 3CO4A 4OBTA 2PDPA 3PPGA 4F2TA 4M7TA 1Q6GA 3N18A 3EXRA 1UKOA 4C1NB 1SZNA 3DYOA 1E6NA 4UTJA 2I17A 3FHAA 3LV6A 1FP9A 3N6JA 4CN4A 1K3UA 3W53A 3T2PA 3WK2A 2OYKA 1TZ7A 2ZCGA 3GR4A 1HGWA 3U4AA 3W7JA 5D9PA 3TW6A 2I5IA 1JQXA 4QDPA 3CQJA 3WQ8A 1OFDA 4UQCA 3OZOA 4JTHA 1HNYA 1GVSA 3BK0A 4I9JA 1LBMA 5BZAA 2YYUA 3E74A 2CEQA 4GQ0A 1ZBVA 1YADA 4W84A 4CD4A 1LZOA 5G2HA 1IWAA 3QVQA 2ACSA 4KMQA 2ZRZA 4F8XA 3DYMA 1UUOA 5GJNA 3GRIA 2HPMA 3Q65A 3RPTA 1M3UA 1HN1A 2VX6A 1F6KA 3G0SA 4GCXA 3QFWA 2E6DA 3SFKA 4RNIA 4GFSA 1SJBA 1WPCA 1TV4A 4N9CA 1EF3A 1FY6A 1X7IA 3TMLA 4G2DA 4GI4A 2BDQA 3RK8A 3MHGA 2ZIDA 3WY1A 3W29A 5T26A 4DWSD 3ZR5A 1JULA 1UJQA 2ZX5A 5A5WA 1ZP4A 3T0CA 2Z28A 4DF2A 3S2CA 4UFMA 1WZMA 2W62A 6TAAA 1YYAA 1DTUA 1FCBA 1GOWA 4P8WA 4MF4A 4C7DA 4UTKA 4UTTC 1RVGA 3MHFA 1J10A 3OIXA 3BLFA 1K7EA 4XIAA 5KMYA 3NDYA 1M6JA 1Z6KA 4Y90A 1U1JA 3LEPA 1S2WA 4JYFA 2J47A 4LNCA 2YA0A 1OCJA 3IUHA 4HZ6A 3T55A 4R27A 2GYIA 3CNYA 4PMUA 5D03A 3UVAA 1Q6DA 4C65A 2GVEA 1KCKA 1DWAM 2ASHA 2Y89A 3N11A 5D2WA 3AQUA 3MMUA 2ZRWA 3NOEA 5HMDA 2G3IA 3UESA 1RY0A 3HQNA 2NVDA 3W88A 3SDOA 4GLEA 2X30A 1O1ZA 1KFWA 5BROA 1FH8A 1AL7A 5HATA 4JKMA 1W1ZA 8XIMA 4PUWA 1HXJA 5CPMA 1EFZA 4L7ZA 4XZ9A 4LRTA 3KCJA 2FLIA 3WELA 5CZTA 4I9TA 1KLZA 1VBRA 1B0IA 5CJNA 1VYRA 2AMXA 4AMAA 3HOJA 1P6CA 2OJPA 3EMQA 4V33A 4UBPC 3ZYZA 1AW1A 1X98A 1K8XA 5FEXA 3RLVA 4B2DD 2D3LA 2Z2BA 4AHPA 1EBGA 2G95A 4MB4A 3NL6A 4LUYA 2D2HA 3Q2DA 5T9CE 3KDOA 2FZMA 4DXXA 3H7RA 1DXIA 1R87A 3SI9A 2XWDA 1H1ZA 3VK5A 5LSMA 1XS2A 5CPTA 1LDCA 4WY0A 1W91A 4GC4A 1EA9C 3I6RA 5I77A 3ARVA 1C8VA 3STCA 3RFAA 3ARTA 1W3JA 1VJZA 2Q71A 3KOZA 3LCWA 3PUOA 1W6TA 3VNJA 2ZX9A 2XIQA 4UQAA 4GVGA 1XIHA 4Q4MA 3W87A 1HG3A 3BGGA 1ZS2A 5XIMA 3LPPA 3K1DA 1FRBA 5D9OA 3GYEA 2VHLA 1BYBA 3GXMA 6A3HA 1EYWA 2VCAA 3OODA 4GUJA 3TYZA 3NG3A 2XISA 4FZIA 1Q7ZA 3NQ2A 4PSRA 3QHMA 2BY2A 2WBGA 1XGDA 1F6YA 2BOFX 3GFZA 3KZPA 4ENLA 4D8LA 3A12A 4J5NA 3T0TA 2CESA 4JHOA 5DEZA 3L0NA 2CPUA 5FA5A 4QGCA 5BCAA 2UZ9A 4RCXA 4XWUA 3V4BA 2QF7A 4PUUA 3SCVA 3SQLA 3B0VC 4LW7A 4B5WA 3W70A 4YPJA 2PD5A 3VMNA 4FP1A 2TODA 3QY6A 2DH2A 2V68A 1FHVA 1Q8AA 3ANUA 2ZX7A 1R3QA 5K9DA 1UPMB 3PVFA 4A8IA 4KS0A 3SM0A 1CBGA 1Q4NX 4C6QA 5M03A 2BNJA 3H7VA 2WMIB 4QTGA 2E9MA 3VNKA 4DO4A 2V5KA 4GZ7A 3CV6A 4K6AA 1S3TC 2ALRA 2ZUWA 2INFA 3S2LA 2OLAA 4TTUA 4QQ3A 2XFFA 4BR1A 3VIKA 3VUSA 3A3XA 1KR1A 4O1FA 4DJFD 2IPJA 1W5PA 4O1CA 7REQB 2W67A 3GXIA 1EO5A 2YW4A 4WDWA 2EJ1A 4WKFA 4UTWC 1T7LA 4LUJA 2Y24A 2DIJA 5D9MA 2TMDA 2OQYA 4I7WA 3CASA 4Q8MA 1Y5WA 3VGGA 2I56A 2E7FA 1NVMA 2W79A 1WZLA 1UQZA 1W32A 2CBUA 3RNDA 3BOLA 5I3JA 1JPHA 3GTFA 1RLDA 2FDSA 5LIXX 3PJXA 1BQCA 2PGRA 3I65A 4ZOBA 5ABFB 1V79A 2E67A 1WB0A 3FCPA 4E2DA 2PBOA 1RA0A 3HG4A 4WD0A 1M03A 3T0AA 1QPNA 2ZOXA 1B3YA 3EDDA 1KV5A 3UZ5A 3NDZA 4ZSTA 3TU9A 3VD9A 3FVMA 5IXEA 1EC7A 3UNDA 1UZ4A 6REQB 5EMKA 3QLDA 5C7HA 5TF0A 1MDLA 1KQZA 3DFNA 4ZO9A 1OYBA 5EMYA 3GSMA 3V5FA 3WH9A 1ECQA 5FEWA 2DZTA 5AZ0A 4U5KA 5M2FX 4K36A 3RLGA 4JNYA 4AEEA 4LUSA 1VD6A 2GL5A 3M0LA 3VIFA 3WQ6A 4AVNA 1TWSA 4MKVA 4PUJA 1J0KA 2FYMA 1Q7MA 1IYXA 4ORMA 4IX2A 7CGTA 3NL2A 4GYJA 3W7IA 3MANA 3G24A 1RD5A 1LBFA 3WQGA 2BY1A 4PH6A 1J79A 1BF2A 1NDYA 4R7WA 2OZ0A 4DM1A 3DDMA 2VFHA 1JZ2A 5D37A 2IQDA 2AGTA 4AD1A 3QQ1A 1I9CB 3CXOA 3WH5A 1DTNA 1FH9A 4D6IA 4WEVX 5B7ZA 3TIMA 3HB9A 3ARWA 3RCYA 4LAMA 5TIMA 3M5VA 3KHJA 1LOQA 1JPMA 1MEWA 2VCCA 2YB1A 3NOYA 3KDNA 3NQ7A 4DJEA 4EOUA 5BWFA 3OVRA 4AXKA 2NWRA 5IDIA 5HNNA 1QU4A 4AY8A 2CLFA 1FFQA 3CMFA 3WLTA 1XHGA 4IX0A 1Y8BA 2GJNA 1ITUA 1OX6A 4ASTA 4G1NA 3KS5A 5C71A 4IJBA 4Y9NA 2ZTKA 4QDWA 3E0IA 5MKGA 2Z26A 5CLWA 1E6SM 1NOWA 2DSVA 3F03K 2PBGA 3PANA 4MY1A 1GKRA 3RM8A 1C8QA 3EMCA 3S1VA 2ZUUA 3R25A 2HMCA 5AHNA 4NF7A 4F66A 4Q8VA 1W3LA 1SYTA 3K46A 3MI6A 5FSDC 2WCAA 4UOJA 2PODA 8RUCA 2PU0A 1XLAA 1XLHA 2Q09A 3EX1A 3P0WA 3CB8A 5FJOA 4NP7A 1Z69A 3H26A 3W6LA 2X2YA 3G1DA 5AYIA 2VTFA 4CQ8A 1Q6CA 5M1TA 2AKZA 3HPZA 2QCHA 3EOUA 1O6IA 1JZ6A 3TYEA 2A3HA 3CTTA 3M0ZA 1E3ZA 2A79A 2D24A 2DORA 2FMNA 3W25A 4IQLA 4GUHA 1B4EA 3QQ0A 4W89A 2O0TA 3UPMA 3L4VA 1H63A 4QCFA 3IJ7A 1RJRA 1BXBA 3CV7A 4NZ1A 4GVFA 2D2GA 3W7NA 4LAOA 1J01A 1GVYA 1PO9A 3W75A 3S0CA 4Q4QA 4RE4A 5DFAA 1VFUA 1OFRA 1RJQA 3CH0A 1RR2A 3W2JA 2NQHA 1R2RA 2QCGA 2DJXA 4FOUA 3RRAA 4U2ZA 1QATA 2VRKA 3M44A 5I3DA 3FKKA 1FCVA 4XD6A 1DXEA 1EZ2A 4GRSA 4XISA 2Y8KA 5AHLA 1K9DA 1YDNA 1ZP3A 2PC8A 3TQKA 5CQ1A 4JYEA 1OZMA 1X6NA 1FP8A 2A3EA 1CLXA 2QDEA 2XHYA 3TTEA 3CZJA 1C9WA 1W1B1 2BGNE 5G4EA 1UHVA 1PZ3A 2J13A 4QS5A 2ISSA 2W0UA 3CHCA 3GH5A 1TPEA 2C91A 2CZFA 4EVZA 2YBUA 1MNSA 1VBGA 5FF2A 4LEQA 3UP8A 3BICA 4F9DA 3UJFA 2QHAA 3ABOA 1TV8A 2Y61A 1E9ZB 4GCAA 1J93A 1KM4A 2Y62A 3ZR4A 4JIRA 4WGHA 2PZNA 1GCYA 4MLJA 4L4OA 1FXQA 4YVPA 3TE9A 4KCTA 1NSJA 1TX2A 4JTDA 1O60A 3R13A 3KCOA 3NM3A 2YA1A 4WJXA 4GFIA 3B8DA 2V3GA 2C0AA 1F74A 4CQBA 2IMRA 1H7OA 3QZ6A 4KIEA 4MSSA 3NZPA 4KFPA 4XAPA 2VM8A 3G1HA 4LEFA 4DAFA 1E5NA 3U0HA 4MHBA 1S5VA 1KM6A 1SO4A 4Z1DA 4C6PA 4FLQA 1JG9A 3FDKA 3WJSA 1OJXA 1REQA 1MWOA 2AKMA 1SPQA 3TDFA 3ZQ9A 1BGGA 1VFTA 4DO6A 1VHCA 5IFTA 3TLLA 4H9ZA 4XZNX 1XYCA 3DKLA 5AYYA 3MUZ1 1D7FA 2A6NA 4IPIA 3S1GA 3ZS4A 2REQB 2O9PA 1TZZA 4AB4A 3KLLA 4XZWA 4DJDD 3RO6A 3A5VA 3FSUA 1IIGA 3AUJA 4FEZA 5C54A 2WNWA 2WZIA 4HU4A 3TNOA 1NF7A 3B9NA 5F4WA 3TC3A 1LLZA 3RYSA 1EJTC 2XVNA 2A7NA 3FXGA 1Q3NA 3VKDA 3ZM8A 4PUEA 3IJIA 2AL2A 2TRSA 3O7UA 1OADA 4PMDA 3VZXA 4DI9A 3OYZA 1TR9A 5KINA 2GQ8A 2GQ9A 4IIBA 1MW3A 1UWIA 4Q8NA 2VR2A 4GVHA 1RVKA 1O12A 4XSLA 1MQQA 4F79A 3K8KA 1UCWA 1SR0A 1YPIA 2CBIA 4WIWA 1P7TB 3NIYA 3MPGA 1FWGC 2GJRA 1LG2A 3M16A 1W37A 4HJWA 3SSZA 1KBKA 1ICPA 3FJNA 1LWIA 1Z42A 3HGJA 3WENA 3C61A 2O56A 3QH2A 1K9FA 1HJVA 2DIEA 4FNSA 3UVIA 4ZB2A 2XJ7A 1TIMA 2VUNA 2NLIA 2HNEA 1R9ZA 3FGCA 4K68A 1H11A 3ZLFA 3DH7A 1G69A 1QI3A 1Z32X 1W9XA 3MZNA 1XBZA 4H6EA 2ZZ5A 4NJKA 2QPXA 2QJMA 3N13A 3QY8A 1BSLA 1DWJM 2DSUA 1TPUA 1UA3A 4UCFA 2WJDA 2YR1A 3W1QA 3CWHA 3HMCA 4ATDA 4AZ5A 2VQTA 3LHVA 2X0HA 2Y0FA 2MNRA 4HPGA 3UERA 4A4AA 3CEUA 3PZOA 1YE6A 1DHPA 3GTXA 3G6LA 3K4AA 5EY5A 1TB3A 5REQA 4NYUA 4PBGA 1CEOA 2D0HA 2FTPA 4ALDA 3IPWA 3MQTA 4O14A 2YXGA 3DC0A 2PCQA 1EXPA 4WSHA 2QCFA 2EAWA 2QXWA 4EXBA 4AWUA 2CC0A 1VYPX 3AIBA 1B3ZA 3LM3A 1PPIA 3EX6A 1LOLA 3BSMA 1TV2A 2PMQA 3N34A 4WXZA 3THQA 4NJHA 1K8ZA 3TN6A 1AMKA 1OVDA 4HT3A 1A5CA 3DAQA 3TFXA 1G7VA 3GNNA 2VEKA 1KTNA 4PCSA 4CNUA 2C0HA 2E68A 4HMCA 3JUGA 2DZUA 3WX7A 3MMDA 4CQAA 4HPXA 3EKZA 5LYRA 3ARZA 3KLKA 2WSKA 3UJEA 1XJBA 3MP3A 3K4WA 1XFCA 1V7AA 4Z1CA 3W22A 3VTRA 5MHBA 1E1CB 4LCSA 2VEPA 3KOYA 5A8OA 3QMSA 2GOUA 4EPDC 3KBNA 3TV8A 1XYMA 1HT6A 4MZ1A 4QS6A 4JTCA 3DFQA 4KIRA 3V16A 4J9JA 3YPIA 5U7SA 4KRZA 1D3GA 3CQHA 3DGRA 2JBMA 3QPEA 4P8VA 3O63A 1NH6A 3APTA 4Q8OA 3Q45A 3OHMB 3EXTA 2E9BA 3GNOA 3DG3A 2WSRA 1NEYA 1ONWA 2R94A 3B97A 4BQ2A 3GLCA 3W71A 2Y70A 4GY7A 1SSDA 3FFSA 5FEPA 4C5YA 1FHUA 1WQ5A 3UJ2A 2ZXQA 8A3HA 5BU9A 1BXCA 3CUJA 1GEHA 3QOMA 2VZUA 4PTNA 2PDBA 2PDQA 2RHGA 3H21A 3QM3A 3U3HA 1TMHA 3ZVIA 4QHRA 3H2OA 3OZYA 1NFPA 2XFWA 4UR9A 3RX3A 4J1OA 2ANUA 3GY1A 3WD1A 5U4NA 2IKIA 3CJPA 2NXGA 3F4VA 1E3XA 4O0QA 4CU8A 3UZYA 5EMMA 4AZBA 2QUVA 4GUFA 4MAVA 1E0VA 4BF7A 2POTA 3AS0A 4E2VA 4E2BA 4EK7A 4E5TA 2Z29A 2B7QA 3S5SA 4L61A 5E09A 1I60A 3MB9A 1MUMA 1U1HA 3AMCA 1QPOA 4GISA 4QBXA 3UA3A 4F48A 4EIVA 2V67A 1XPYA 5HJLA 1PHWA 1YW1A 4FPSA 3J7HA 3DZ1A 3ITYA 4J3TA 1U22A 4Y6GA 5I3KA 4AX7A 8XIAA 4H9YA 3KOWA 5CSSA 4LY8A 4PB4A 1L6SA 1RZMA 4S3KA 1XG4A 3HJEA 1IIHA 1NWRA 3WNMA 1A3HA 2OOGA 2X05A 4HYVA 2Z1SA 2DSZA 4Z2HA 4MMWA 6ALDA 1YTKA 2VO5A 3SUSA 2QCCA 3USBA 3MBFA 2C15A 4CEXC 1NARA 4I9AA 2FVLA 4JNMA 4W93A 4V28A 3AI0A 1OYAA 4UNIA 4REQA 3RF9A 1QMLA 2FKPA 4MWAC 2ZRUA 2R1NA 4EPEC 3U9IA 4US6A 1T8QA 2PS2A 1BF6A 1YPFA 4M3PA 1XBXA 5G1MA 4NZCA 1W1PA 1YXYA 5I6SA 4NSBA 2B31A 2WJZA 1UKQA 1BRLA 4YCOA 4CNTA 1XINA 4F0KA 5EL1A 3B04A 1Z41A 2RDTA 3W2KA 3BSHA 3MDUA 4GZJA 5D33A 5FSEC 4TX9A 4ZVJA 3QW3A 4X9SA 4JN6A 1T96A 3RG6A 2YZRA 3UA4A 3QSTA 3VA8A 2CITA 3GU1A 3GDBA 4QR6A 3AXKA 1H0GA 4L4LA 2P76A 4GQQA 4AEOA 1QFEA 3ITOA 3PR2A 4PBFA 1C9DA 1PV8A 3TSBA 2GQAA 1XIGA 2HE8A 2C8NA 4UFHA 3HG2A 2OZ8A 1IXNA 2JEPA 2Z1XA 4IQEA 4TVDA 3VD5A 2YL6A 1FCQA 4JNZA 3VMPA 3OP2A 4NZFA 2QR6A 2UY3A 1G7UA 3O6DA 4LAKA 4G7FA 3FNDA 1E1EA 3MUAA 4DELA 3QZAA 3PHAA 1GVEA 3V5OA 1XH1A 3G6MA 5C8BB 3W1UA 1TO3A 4C91A 4P7QA 1V7YA 1P4CA 2ZXBA 2ZA1A 3KVKA 3C2RA 1G6CA 4PMNA 5FESA 2CLPA 4YTUA 4NAEA 1SO5A 3KWXA 4ZFMA 1XV8A 3R94A 3H4XA 3ITTA 3KHDA 3BAXA 3LV5A 4UZUA 5BW6A 5F2IA 2E40A 3WMBA 3W7CA 1OK6A 4JL1A 3OGRA 1M9HA 3S9ZA 4PB3A 1OX5A 2X1TA 5H2ZA 4LOCA 3L9CA 1LTDA 1XBVA 2FZDA 3U7VA 1R38A 3N25A 5I07A 4LB3A 1U5VA 1NF0A 3VNYA 3QTGA 2IQ0A 1GZJA 3PUGA 1ONEA 3AAMA 1RQEA 4LAUA 3ZT5A 4MY9A 3W23A 4DO5A 3L4ZA 4ATWA 4ML9A 3GR8A 4FALA 3VCCA 4G56A 1EXBA 4QSHA 4Z2IA 5LA1A 2P0IA 2BVWA 2O4MA 4B9YA 3WLPA 1GVRA 4WX2A 3B8SA 5HDRA 1H7NA 4D6CA 3WQPA 5JH2A 1OC5A 2FFCA 2HTMA 1HIZA 1CYGA 4YS1A 3PJWA 1YIXA 4G9PA 4MB1A 4FAMA 3PTDA 2O4QA 3OGSA 4JFSA 1R3YA 3W84A 1ISYA 3GDRA 3PTMA 4DYKA 3LNPA 2OSWA 4LB4A 1S39A 2XM2A 5H8UA 1HJUA 3MWAA 3PBYA 3AIVA 3C0SA 1E15A 4XAGA 3VC5A 3WNNA 2OR2A 3AZTA 4RXFA 1XSIA 3WLJA 4ZQCA 3N2MA 3WCZA 1S46A 3PZTA 3CL8A 1W5NA 3PC0A 4QXIA 4PCPA 4RNJA 2XPKA 3K2GA 2YL9A 3SAZA 4DUWA 4JXCA 2XVLA 3AJ7A 2DZWA 1CENA 4YVXA 1F3EA 4FA3A 4E3VA 1UR3M 5LKYA 2PDMA 1JFXA 3MKKA 4M24A 1JL8A 3LLDA 1KCLA 2PGFA 4GY0A 1E1FA 2VGFA 5KETA 5BOEA 2EG6A 4PULA 2VVSA 1XRTA 1EP1A 2VC5A 3IANA 1MXSA 1XLIA 1TA3B 2JIEA 4IPPA 3W74A 3IK2A 1LRTA 1Q6OA 1WV2A 5C2CA 4BY3A 1LQ0A 1C3FA 4KETA 1OC6A 2Y85A 2RFGA 4EP8C 1EHNA 2ACUA 3LLXA 2Y88A 3K8LA 3NSXA 5L9FA 1K77A 3PPFA 1J5TA 5LIYX 1G9HA 1PIGA 4JIQA 7PTDA 4DIAA 7ODCA 2ATSA 1KFEA 5JUVA 3E2SA 3PBVA 2GVGA 3WD3A 3DI0A 4EWJA 2WMGA 2Q6ZA 3LB0A 4H04A 3SY5A 1LJYA 1QT1A 3ARPA 2EHHA 1X1NA 1E40A 4UTHA 4GBUA 3KL5A 5D05A 1TUXA 1JF5A 3WNPA 1P6WA 3KBSA 1AQMA 4UOZA 1RP8A 1RV8A 4KEUA 5BXTA 3HG3A 3MSDA 2GGHA 2PWGA 3A5FA 4AISA 1HKJA 3MVTA 1H61A 4EPKA 1LP6A 4ACZB 3W7PA 4YTQA 1UR1A 3B8VA 3RITA 4EX4A 1TPB1 2ZVIA 3W2MA 1XH2A 5FJRA 3AMDA 3M0VA 4NT0A 2ZE0A 3REQB 1ZJHA 1UG6A 3NSNA 1TWDA 1SFJA 3PZQA 3CUZA 4FXSA 2J75A 1O7AA 3S5OA 1V3IA 4UR7A 3BAJA 1ONRA 3LTPA 4M6PA 3JRKA 1IZCA 3RX2A 3FKRA 1OCQA 3FA4A 3B40A 4OIFA 3VCNA 1EJVC 1TREA 5BYWA 5AKQA 3LRMA 5E0KA 4WY0F 3P82A 3O6CA 3OBKA 5FEZA 3BAIA 3LMYA 3CO8A 4LF2A 1M53A 2OELA 1R85A 3CLWA 4WR3A 4MNJA 3N3TA 4PMZA 3H4GA 1ICQA 2QDDA 5D04C 1QO2A 4RX0A 3DBNA 1H49A 4TVCA 1UH2A 3BUVA 3W26A 1Q7QA 1XIIA 5H8PA 1KTCA 4F0LA 3WNKA 4M80A 1QHOA 3EYPA 1R9XA 2NV9A 3B0UX 1RBAA 3NEHA 2DZXA 1K8CA 2KX9A 3GS6A 2VR5A 5CC7A 1XD1A 4WRHA 2V6AA 2DVTA 4Z2KA 4NX5A 1TJ0A 1F5ZA 3SIMA 5E70A 1O4UA 5E6YA 3PN8A 4W9TA 2X41A 3SCOA 3UYCA 3KCLA 2VRJA 3VOHA 2ZICA 3XISA 5FJIA 3R5EA 3CZKA 5CBIA 4NAFA 1VAHA 4GOAA 3AS1A 1RPXA 3MU7A 2ATMA 3SRHA 1RPKA 2YFOA 1TPDA 1DJZA 5ABTA 3GU2A 1OFBA 3LCGA 3WLOA 1JJKA 4PCNA 4N4QA 3BZJA 2J88A 1IE7C 1S2UA 4U3CA 3I10A 3G2GA 4C6NA 2HVMA 1UMLA 4RNFA 3TJLA 3M07A 4KWWA 4A35A 2QKFA 5C0QA 1S2TA 3KP0A 3FLUA 3VFLA 4YVVA 1W2VA 3O2LA 1BVNP 3SSJA 2YDRA 1G1YA 1F6PA 1EOKA 3GAKA 1A0CA 4OOZA 3C86A 3G0UA 1QHPA 1AL8A 5HUOA 2BY3A 1ZHAA 4JIEA 1XISA 1YTDA 4NJGA 3NTYA 4QLJA 2F84A 1FWBC 1LYXA 3LK6A 3Q37A 2FIQA 4I8DA 4Q3MA 4MYXA 4QJ5B 4Q7NA 3RCNA 5A6BA 1IV8A 4K1GA 4IP4A 5F7UA 3RGTA 1PIIA 3DIPA 4KBXA 1OGBA 1C7SA 2GDQA 6PTDA 1G01A 1KRAC 2XVGA 3GWQA 3SCNA 3VOIA 3AROA 4MJ4A 4GI8A 1MZRA 1YPXA 2XH7A 3AWNA 1VJIA 3H53A 5CCZA 3ZJKA 3LGDA 2EO7A 1QK0A 2V82A 2GZXA 1BEUA 4PYSA 2NQZA 3SEPA 3TWBA 1V0NA 4D6FA 2ZYFA 3TKFA 2ZZ1A 5K2ZA 1YLVA 2NT0A 1WOAA 1X97A 3MUXA 4A3QA 5CGMA 4I6VA 1JCJA 4AEFA 2VX5A 3LRLA 3U48A 1CLKA 1M7PA 3URAA 5HJXA 3VZZA 3W00A 2CXEA 3HGRA 1IT0A 1N7KA 3F4WA 2XH0A 4PTVA 1MZHA 5E6ZA 4H9XA 1ELSA 3RR1A 3STPA 3U5YA 1A49A 1K8YA 2DEPA 3IVUA 1WUEA 4XTIA 1S5MA 3QMRA 3CEPA 3FS2A 3NO1A 1PSCA 2VVNA 2IPFA 3GM8A 5D2VA 2QQ6A 3SUTA 1XR2A 4GO9A 5I0DA 3AHXA 3PG8A 3AFBA 1AJ0A 5DXXA 1HJXA 1NOUA 3AHTA 3H4WA 4DY1A 1HO4A 3ENLA 2WKGA 3NPWA 4WKAA 2Z00A 1QAPA 5GVJA 2ZZ7A 3ZSTA 4C1KA 2YCJA 3E5BA 4MWAB 4NXSA 3PUDA 2HJPA 4GI9A 3WLNA 5BRQA 2RDXA 3PY2A 3UU0A 1Q6FA 2NV2A 3UY8A 3UXKA 3IGUA 1V3LA 3N6HA 3NZRA 2XVKA 3WF2A 2J9XA 2ZZ4A 1ADOA 1QK2A 4ATLA 1XM3A 3AICA 4XTDA 3NYZA 4FB7A 1XLFA 4O16A 2RDUA 4LH8A 2Q3RA 1UD5A 4JQ1A 3IVTA 4IMAA 5C2GA 3AYVA 3WLMA 3A3WA 3OG2A 5KZEA 4OQVA 2FTYA 2GVJA 1L6GA 1OFOA 3QV6A 4UQBA 3P14A 2VFFA 1NTHA 1E9LA 4AVOA 3EWXA 4JN7A 2HBVA 3I4KA 3ZWTA 2Y8VA 1K9TA 4UMCA 2A6LA 1JPDX 1GORA 2HVOA 3RN6A 2Q8ZA 1R5YA 2YXOA 4V1XA 4S3AA 3DCPA 3TTYA 1VFOA 1EJUC 3BSGA 4A05A 2Z1BA 3FY1A 5I23A 2V3DA 2QULA 4H4IA 1J0YA 1DJNA 1ODZA 3R0KA 5H1WA 1L0PA 1G94A 3EOEA 4FNQA 3UT0A 1QPRA 4NRRA 1OYCA 5A8GA 4H7VA 2IXVA 2DJLA 2C19A 3ABSA 4M1BA 2P5NA 1IEIA 4O57A 2E8ZA 1ZB5A 5I78A 1T8XA 3EOOA 1MRQA 3A47A 1I0DA 4PRWA 3B05A 3MDWA 1Q65A 4XV0A 1JCTA 1V93A 1TELA 3VDBA 3WQFA 5FAJA 2CIPA 3FN9A 4RK8A 4JTJA 1UD6A 2E0PA 3HPSA 1ZL1A 3BL3A 1FWHC 1FWNA 4C90A 4IJCA 1EQCA 2R91A 4IMCA 1ITQA 3PZIA 3DN5A 3O8AA 1ZZMA 3LSCA 3CC1A 1CI1A 5CBBA 4HSNA 4CGTA 1SO6A 1VJSA 3ARXA 4IG2A 4AZCB 4WOQA 2BP1A 1XW8A 4XD3A 3CUXA 4IHCA 4RW3A 3OZMA 1VP5A 2A3CA 1XIJA 2UWFA 3GBEA 4ZTYA 4FMVA 3H2NA 4QAIA 4C7FA 3O1NA 4JTRA 3TP4A 1TRDA 5BNKA 3SIZA 2XN0A 2WK2A 2GSEA 1RHCA 1J0JA 1JZ4A 2J25A 3AHZA 1MEHA 3NQBA 4H00A 3TOPA 6CGTA 1SZEA 5AVHA 2VURA 1RBLA 5AOUA 3GHRA 1MXGA 1RALA 4PBEA 1O94A 1G4SA 2D20A 4P7LA 1A80A 2X09A 1SFTA 3S6DA 3DI1A 5B7YA 4BA0A 1W8GA 4PL1A 2VFEA 2VENA 2VR4A 5A2AA 1GPWA 3DFPA 1E5JA 3WJZA 1UP0A 2BHZA 2TAAA 3P6LA 1ZLPA 1TV3A 5A6KA 3BJTA 4A3UA 1M1BA 5FF0A 4DNHA 4KWVA 1DHKA 1DOSA 4PN2A 5DO8A 3LBCA 2VC7A 4W86A 4ILSA 4IICA 1BG4A 3M0JA 4H9MA 4BI6A 4PE8A 1TG7A 3UR8A 4MWAD 2BB0A 2CERA 1V5XA 5DY2A 1V3MA 3W86A 4IXXA 4H8NA 3TJIA 3ONCA 5CZ0A 4YN5A 1F2JA 3CZLA 4IPJA 1XCFA 3EPOA 3PZNA 9RUBA 1QW7A 3GNRA 2E5BA 3PZVA 3CH9A 4ADTA 3GIPA 2P50A 1YNYA 4JTFA 5HK4A 2ZRYA 3QPYA 3FA5A 1DJYA 2D69A 1AA1B 1FDZA 4ZO8A 3OG3A 1LUCB 5I5RA 1A0DA 1KRBC 3LHUA 5LHFA 1QW9A 1RJPA 4PMVA 2VEFA 2WAGA 3E96A 3PPHA 1EKOA 4MB3A 5RUBA 4UQEA 1U83A 1XIMA 4CU7A 4PL2A 1KXHA 3GVRA 3MP4A 5JBEA 5D2YA 3ARQA 1K03A 3B9OA 4GIEA 4JTLA 3L4UA 1WP6A 2B7OA 3TYCA 1RA5A 1US3A 2HVNA 4M6UA 2VZOA 1EDQA 1RLCL 4ZFCA 3O05A 1JZ7A 2VFIA 5DXYA 3E6EA 3N19B 1KBIA 4O18A 3L5MA 1JQVA 4ZE5A 1OGGA 3UR5A 1E51A 1KW1A 2R1PA 3A21A 1HKMA 1N8WA 1CXEA 3OU8A 1L8NA 3U6WA 3EEGA 3VAVA 1SQ7A 4HYWA 1AODA 1VCVA 3QGKC 5K7JA 2WWDA 3OOQA 3TONA 1CNVA 1EIXA 2FVMA 3NQGA 2NUXA 4FS9A 3P60A 2J8TA 2QV5A 2OSYA 4NNBA 3INPA 3MCOA 4ERAA 4DZ5A 4AHOA 1B5TA 1LL4A 3V1PA 3OA5A 3BWWA 3BAYA 4GGBA 3RAOA 3VIGA 3IWPA 3H70A 3WEMA 4ADUA 3P74A 1CECA 2ZE3A 3S1UA 3APGA 1ONXA 2CHNA 3H54A 3Q4DA 4DXVA 4DWDA 3RHGA 4X63A 1GQNA 3BO9A 2ZTJA 3A13A 1HP5A 2DT0A 4LQ1A 1K1DA 1UW9A 4F0HA 3NXFA 4ZTXA 1W17A 2PDUA 3TX9A 1C29A 3IVSA 3JU2A 3ECQA 4GQGA 1KBJA 5HR7A 1FQ0A 3R0UA 5I3IA 2FH6A 4DZIA 4ZQRA 3BXWA 3WBAA 1RD6A 4JCMA 4DBUA 1EP3A 4KEMA 5LNSA 5LZLA 3WQWA 1AH0A 1POJA 2R8WA 5AYXA 3GC2A 4C6KA 4D1IA 3BE7A 1AQHA 2JGYA 2RH9A 2XDFA 1H3GA 3ALGA 4NNCA 1MFUA 4M1RA 1SZRA 3WK0A 3E0FA 4FXJA 2NX3A 2BTMA 1PTGA 3ANVA 2PC4A 3QF0A 1XIBA 2GDUA 3LD5A 1MW0A 2YKKA 3DHDA 3DOPA 4Q8PA 1E70M 4RPQA 4H8UA 3UD6A 1J2WA 4HBKA 5CG7A 3ISIX 3GTHA 3O0KA 5FJJA 4Q7BA 4BQ3A 3B0PA 4JAWA 1YBQA 4GC3A 1Y5XA 3U8GA 1KWGA 4HJFA 3VABA 1A3XA 3NUKA 3TYAA 1O68A 3GG1A 3R8GA 3ATYA 5IBXA 2WVTA 4X3ZA 4LT9A 3GE7A 2O9TA 5I24A 3T8QA 2FQIA 4F2BA 2OT0A 4FLRA 2I7GA 4RUBA 3W27A 2G3JA 5AC6A 4OV4A 2AQVA 2VP8A 2HCVA 3URBA 3UEQA 2BZNA 2O9OA 1FWTA 4DBEA 4B91A 3IS4A 4UR8A 1TWZA 2O55A 4WSKA 1PBGA 2YL8A 4F9JA 1QCWA 3PULA 4PMOA 1N82A 3URNA 4B90A 4N0RA 1UD8A 3WFZA 2YBVA 2ZUSA 4NIRA 4GY1A 4UTTA 4OJYA 4RW5A 2W27A 4HQVA 4FK9A 4WVXA 2DGAA 5F2MA 3MO7A 1JUBA 3PNZA 2GGJA 3ZSSA 5LHEA 3XIMA 3Q67A 3HV8A 2IPGA 3PBGA 1MO0A 1S5NA 1E0XA 4HOXA 1SFLA 1XLMA 3MO4A 3F2BA 2EPHA 4LS0A 3SURA 2WSPA 3PZGA 5DBTA 4NZ5A 4N2YA 3EBVA 1A4LA 1EA0A 2PDNA 1TSIA 3HPFA 1EPXA 4LFYA 1W3KA 1JNDA 3UBPC 4J3ZA 1FH7A 1EF2A 3QQWA 3DBPA 4CKQA 1A5KC 2IUZA 3AMGA 1S2VA 2AGKA 2BMBA 3N4EA 5TQLA 2J7GA 1R7OA 4LTSA 5AVNA 4D6DA 1VBHA 4S2BA 4YU1A 1DP0A 1K70A 3WF4A 3W1TA 3LCFA 2J62A 4GNVA 4AH7A 3QV9A 4WDXA 3F5JA 1SJDA 1YDYA 3DFSA 3N15A 4QJ1A 1GNXA 4XB3A 2C1GA 1W3IA 2CWXA 3L21A 1OFEA 4IT1A 2Z1KA 3M0XA 2YL5A 4Q4KA 4F2UA 3QMTA 1MW2A 1P43A 2XGBA 4H41A 1E43A 1UKPA 3BQ6A 5BRBA 1NWUA 3NVDA 5C55A 1EDTA 3KEHA 2GLKA 1GPFA 4EAYA 4B5SA 4EXQA 1WBHA 1TPVA 3PBUA 3DFYA 2D2JA 1KFBA 5CC3A 2XIIA 3EKLA 3ABXA 3BURA 3K8MA 4U3AA 3EWYA 1CXLA 1EYEA 1Z89A 4WY0B 4R53A 1MW1A 4IJRA 1EJWC 3HTWA 4LANA 1PTDA 3TJXA 3P5ZA 1SJCA 4LWWA 4JTQA 2F61A 4JKKA 4KPLA 4WLCA 4JX5A 2NQJA 3C8FA 1K02A 3F1QA 1ZAHA 3SCRA 1IWBA 1PKLA 3F4NA 1A0EA 1WDRA 2ABAA 1EP2A 9CGTA 4PEEA 5CAKA 4Q7IA 2GOKA 1TQJA 3GTNA 3TYBA 3BVJA 4L1XA 3EOSA 3KBWA 3T0DA 2WBKA 3LBMA 4OOUA 3NWRA 2PTYA 3KRZA 1XD0A 4UTMA 3AZSA 1PXGA 4XAFA 3W9ZA 4QROA 4PTWA 3TXZA 3PG9A 3G1FA 2ACQA 2DQWA 3D46A 5CSYA 5F1UA 1VH7A 4YWIA 3N6QA 6ENLA 3NGJA 2P8CA 4GWEA 4NKCA 4RZ5A 4UTIA 2QUUA 2XWEA 2W6RA 4CNSA 4ZQNA 3NPUA 3BARA 1KM1A 4GUGA 4UB9A 2Y2WA 4MTVA 3VOJA 5I00A 1RK6A 4Y8FA 3VNMA 2A0NA 3H2FA 3AIEA 1GK8A 3VXGA 2WSQA 1H1NA 3PJTA 2PWHA 4OUEA 3PWAA 5I02A 3CIVA 4KF1A 3GX9A 3MV11 2OQLA 1V6UA 2ZA3A 4BCEA 1MSSA 1FHLA 1RK5A 3QZEA 4CD5A 5BWAA 2HISA 3COTA 3KFTA 2R82A 1TTPA 4XD4A 1KWKA 3ZWSA 1JUKA 1SVDA 1JNEA 3ELFA 1G4TA 4YTRA 2PWDA 4CQDA 1BTCA 4MB5A 2JFEX 2NLYA 2JF6A 5D4YA 1BYDA 3RO8A 3B8UA 4GPNA 3WUBA 3GKFA 3RLHA 4NQ1A 4Q4RA 1JCMP 4BJHA 3EX4A 3LHWA 4ZQMA 3UXIA 1TVNA 4AZ7A 3VX1A 1VEMA 1X7FA 2QUTA 1OIFA 1AJ2A 3R4IA 1CIUA 3N73A 3CPRA 2X1SA 3TQ0A 4ZQPA 1Q6LA 1XGEA 2WWCA 1OFAA 1MUCA 3TW7A 4LVFA 3UCDA 4YTSA 3BPWA 4DYJA 3I3DA 4ICNA 1MVYA 2PF8A 3JVAA 4ONVA 3PK7A 3L2IA 3JW7A 4HVXA 4Q6JA 2Y5SA 4DQWA 1E6PA 1F7BA 3T44A 5DY3A 5A6TC 2E6FA 4FSAA 1IEWA 4YTTA 4PSPA 3GNPA 3T40A 3V18A 4GHRA 4LUSB 4C6EA 4JEQA 1KR0A 1XI3A 4Q8UA 3CLMA 1OIMA 4QSFA 2QS8A 3FX4A 4JFWA 3MWCA 2O7QA 1WKEA 1EB3A 5FL1A 1R0MA 2XGIA 4QP0A 3L7RA 4X0NA 3DFHA 3FEQA 1I4NA 1R47A 4BHYA 2PTWA 3RMJA 3U2CA 2HV5A 1VEOA 1ENUA 5E1QA 4JIHA 3OQ8A 2QUNA 4Z2LA 3PTQA 5EMJA 1VIZA 4RE3A 5DRCA 4S3JA 3OLIA 3RU6A 2ODOA 4AD4A 3N2XA 1XYZA 1CB7B 3B0YA 3W6YA 5LNRA 1BKHA 2WQDA 4UC5A 4HPHA 2OO6A 1P1MA 4AZIA 4D71A 2WCGA 3SCQA 3IRSA 3THUA 1DVJA 3CQIA 2EPOA 2IKHA 1GONA 4G8TA 3RM9A 4IGMA 1NDVA 3SBFA 3VOFA 4K39A 3HV9A 1OY0A 4B5UA 1V0LA 5MKGB 4AWSA 2VWSA 5K9XA 5EU9A 2ZZ2A 1W5QA 3VVGA 5DELA 2GSJA 3VKKA 1DJWA 4ICCX 3SFWA 4I7VA 1LRNA 2G8ZA 5HNRA 3EGJA 3R89A 2FDMA 4AIEA 2V2HA 3W1NA 2X8RA 1HJWA 2NVCA 4X2PA 2RJHA 3KRBA 1JIBA 1HKKA 1J18A 3CIWA 1WDPA 4CCCA 3T81A 2YW3A 4BK9A 4ZOAA 1X39A 4DUOA 3AU2A 4E4FA 1A5OC 3BG9A 1IEVA 4PODA 1DJGA 3I6EA 3GC4A 1UOZA 2HWGA 2QJJA 4IP7A 2WZHA 3QKEA 1EGVA 1TTQA 3U2ZA 5D9NA 3L67A 3TW9A 3MY9A 3MMTA 1QPKA 2OFJA 3MHUA 5CGQA 5CC6A 1KCXA 3ES8A 2RAGA 2QUMA 3OZPA 1OGSA 3IUIA 1WO2A 3TFCA 1VQTA 2V0TA 4IMEA 1FWFC 3WUEA 4OV9A 5KZ6A 1X96A 2R1KA 1JCXA 1RBOB 3EZ4A 3BG5A 4KH2A 4AD3A 1PZ2A 4ICMA 4ZXLA 1F9CA 7XIMA 3PB0A 4RZ4A 1M41A 2YZ5A 3AMKA 3H24A 3S1WA 4H9UA 4ERGA 4A3YA 2PP3A 1QO5A 1OC7A 2PTDA 3WEOA 1M01A 3EX3A 2W9MA 3W1RA 2Y1HA 3OIHA 3UWWA 2DH3A 2PTZA 2J24A 2L5HA 1UB3A 1DWGM 1X8FA 1NU5A 3A64A 4IP5A 5JMUA 4POCA 1BSIA 1XLGA 2WMKA 1T6MA 3LCIA 4R5EA 4WOZA 5JH1A 1Y0EA 4I3GA 1TCMA 3AS2A 4GYPC 2I16A 2RJGA 1ML1A 1F8MA 1EEXA 3S3GA 1FUYA 3W2NA 3MUCA 4CEUC 3WQOA 5HQLA 2DZVA 1JXKA 1W9DM 4O52A 4LYQA 2J8FA 1OX4A 1C93A 1H7PA 2A5HA 4MVAA 4WJEA 5C9ZA 2J77A 3UNTA 1XBYA 1OFQA 1QI0A 4NHVA 4IUGA 3V1HA 2GUBA 1TV5A 3LGEA 3EDJA 1EJXC 4UXDA 2VD9A 1ZALA 2WV8A 1XDJA 1XSJA 1THFD 1AW5A 1UH4A 3AIQA 4QLLA 5E93A 3ME3A 1NFBA 1AH3A 3N1AA 4GJJA 2XIOA 5DT5A 2A7PA 3IGXA 1KGXA 3CYVA 4LCQA 3CHFA 1IZJA 3DGBA 2ZA2A 2PP0A 4TXEA 1REQB 1W1A1 4DJED 3RXZA 4I6KA 1DPMA 1R6WA 4WCJA 5CSRA 1P0NA 5KZDA 4INFA 1XIFA 2VGBA 4GKLA 4MGGA 5E9XA 1YMYA 3VOCA 3GXFA 1ZAJA 4MOZA 4LPCA 2A3BA 1DBTA 2E4TA 5I06A 2EGZA 3MBDA 1NAL1 3SZ8A 4JR5A 3UCQA 4F4RA 3WMLA 3SGUA 2WANA 4J3VA 4LSBA 4W88A 3W07A 1JD9A 1B3XA 3ALFA 4AY1A 1OBAA 2TSYA 3LUTA 3WLRA 1OFPA 3GZ3A 5I3GA 4HA4A 4QX4A 3C4UA 2AL2B 3SUWA 4CD8A 1GQJA 3SECA 1WA3A 2H6RA 2PPGA 3A6OA 3MP5A 2V81A 1V02E 4DX3A 2DFAA 1DIOA 4KESA 3WF3A 5HJYA 4MZYA 4AF0A 3IJDA 3VX0A 1A4MA 1GG1A 3ITXA 5TBOA 4S3FA 3O6AA 2F7FA 3ARUA 4HSHA 3E0VA 3OPSA 2X16A 5JQ9A 3HZ3A 3M7SA 2DPEA 4IH3A 5KZMA 1J6OA 2DT3A 2ACRA 5A1AA 4GNJA 3ITGA 3PZ9A 1KGWA 4V15A 1AH4A 3FGCB 3CZEA 4UCGA 3SUVA 2Q8XA 4FNRA 5AYZA 3CAVA 4OUIA 2FB2A 2J79A 1YX1A 4WQ6A 1FWIC 2C7FA 2XZ9A 2A3AA 3N29A 3EB3A 3UR2A 1BVWA 3MMWA 1S3HA 3V0TA 4Q32A 4KQNA 4J3SA 3O3RA 2SFPA 5FJUA 2V3FA 1XYAA 3EDFA 1T40A 3B4UA 4R34A 3SCWA 4UFKA 1CGUA 1UZHA 5FL0A 3W85A 2ZUTA 2FVKA 2A85A 1WE5A 3E1F1 5REQB 3UG3A 3GO2A 3QBUA 3VGFA 1PVNA 3F5LA 4ZO7A 4TOQA 4MKSA 4D9PA 3AXMA 3VYLA 1EJRC 2C1HA 4QITA 4C6LA 5HWJA 4E8CA 5HPOA 1RCOB 1AK5A 4H8VA 4GNKB 2VC6A 3E12A 2VDGA 1RP9A 3QW4B 3R8RA 1BAGA 4IUOA 4QAWA 3LDVA 1J0HA 1CWYA 3VZYA 3EWCA 4X2RA 3NA8A 3VFCA 2YX0A 4OE7A 4JFVA 1LLOA 2Z1VA 1VFLA 3KE0A 2NQLA 2W5FA 1TVPA 1KNWA 4G7EA 1N8IA 3WN6A 3MSYA 4H7CA 5BMWA 3AISA 1LG1A 1F4HA 4QEEA 1GWJA 1TR1A 1A5SA 1PCWA 5DN1A 2CFFA 5T8GA 4GE8A 4IFKA 4GI6A 2EF9A 3NPVA 1CXHA 2ZUMA 2R1LA 1JDEA 3QC3A 4IXHA 4OT7A 1U1UA 1F07A 5JIWA 2DDXA 4YIWA 2XGZA 3IAQA 4GXMA 4JHMA 1V02A 2XM1A 4J40A 4HIBA 3TYDA 1VBJA 2QCDA 1F8IA 1FXPA 4TO8A 4M7SA 3MSRA 1H09A 2BVDA 1QNOA 2GSHA 5IFPA 2OWXA 3I3BA 1KM2A 3BMWA 4JQ4A 3WF1A 3HGSA 1HKWA 4N9DA 1WZKA 3T4WA 1S2AA 4MNLA 4RR4A 1GZ1A 3VKBA 2BASA 5HR6A 3EKGA 3CAKA 1A5MC 1MNZA 4YHGA 2ISDA 2ISFA 2DZBA 5EBUA 2YXXA 1TJPA 3KZSA 3WD4A 4Q8TA 1OD0A 4QE5A 4Q22A 3M9YA 3LSBA 1R3VA 4HK5A 3WL0A 4JDYA 2VELA 3ABQA 2Q3OA 3O9NA 3FJLA 5F4XA 1V03A 1W3NA 1UR9A 7TIMA 4MZ8A 1UUQA 4H6RA 3V7PA 3MUY1 1U2YA 1KV8A 2EPMX 3TAKA 2G4JA 3LERA 1W1TA 2V5LA 3KL3A 5A2BA 3N2OA 4OBSA 1WYIA 3TTOA 4CCDA 3IK4A 4LYKA 1BXNA 3TN5A 2D73A 3S5ZA 2YJQA 4E38A 4W7UA 1A5AA 4W7VA 3QHOA 1UD2A 4U2YA 3VIPA 1VPXA 3CT7A 4XBJA 2PGEA 1KBLA 1QBBA 2FZ8A 1B9ZA 1JRCA 4TIMA 4N6EA 4RLIA 3GVGA 1GOOA 3ID7A 3TK7A 3PWGA 4DF0A 4QISA 1IT7A 1XFBA 4MPQA 4Q4OA 4LUIA 1VBUA 2C14A 4Y2WA 1Q85A 1I6NA 4BWLC 1TJRA 4HD5A 2ZZ6A 4W5ZA 3ORWA 2Y6ZA 1IR2A 1T0OA 3N9KA 1E6ZA 3MA8A 3FYOA 3W81A 4OECA 3TYUA 2E6YA 3VDGA 1D7KA 3UJSA 3CHVA 2V2CA 3L5LA 4GO8A 1R86A 2OGYA 5IHSA 4JKLA 1FWCC 1FWAC 3ZMRA 1NIUA 3I3EA 3NPXA 1JAEA 3IGHX 2WW5A 4ML4A 1BRLB 3B8TA 2WVSA 3DG6A 3N2CA 3TUUA 1OG6A 4XUGA 4PGLA 1KRMA 1KB3A 4JQ3A 2UY4A 1OEPA 2VUYA 2PDCA 2XSXA 1UYQA 5G1YA 2CBJA 3RILA 4N42A 3NURA 4HU8A 1E4IA 3OYXA 2WLZA 4IL2A 5F2LA 1Q66A 4WDUA 1K9EA 4Z1AA 3N9RA 1CZ1A 3T08A 2CLMA 5T91A 1LOSA 2VCBA 3S9IA 3W76A 1KM5A 3W7LA 2VEMA 3R6IA 3CGTA 2XG9A 4HNOA 5E9AA 1R2SA 3V0SA 3CWOX 4DUVA 3IIOA 2GJPA 2XVPA 4ZMGA 1A5NC 3VGBA 5EA9A 4O4VA 1Q2SA 5DMNA 4FIQA 2VDIA 2Q02A 3ZXWA 1KXQA 1SMDA 1KCZA 1I2RA 4XVDA 1H62A 3ARSA 5HMSA 4AC1X 4YWSA 3ZVHA 4IFOA 1LROA 3GXTA 4MLRA 2QCNA 1EIBA 2F2KA 2PUZA 3CHDA 3VU2A 4FI4A 1OCBA 4NAEB 1TVLA 3L5AA 2PRLA 3QGVA 2YCLA 3U2EA 2JQXA 1ZCOA 1HZYA 2I9EA 1W9VA 1FWDC 4QNEA 3T9PA 3IJ6A 1FDJA 2WVVA 2PI6A 1XDLA 4UTLA 1HJQA 3JS3A 5CH9A 2QMJA 3V75A 3CU2A 3SQSA 3RJYA 3NQAA 4HCHA 4NVTA 4D6JA 1DORA 1TPC1 4O10A 1W3TA 4US5A 3E9AA 5IHRA 2ZDSA 2X1UA 3AXXA 2YCEA 4GXWA 3BC9A 1BPLB 3P7YA 2ZKMX 4PMQA 1VLWA 3QGAC 3PF3A 1EHAA 1S5WA 2PWUA 3T8LA 3LY0A 1VFHA 1QOQA 5LXXA 5AC7A 1HX0A 1Q13A 4IIDA 1E72M 2YSWA 4U31A 3W1LA 5LA0A 2VYOA 2J7EA 1UZDA 3SN1A 2OT1A 1OD8A 4HK6A 5LXEA 2QJIA 5FF4A 4OBRA 1CGWA 3IV8A 1H0IA 1OT2A 3NQVA 4A8LA 3G18A 1TTIA 3OO2A 4K7YA 2H9AA 4JY9A 4C6MA 3G1YA 4MM1A 2BXZA 3GW3A 5HOSA 3PZMA 2BLEA 2PRMA 2OSXA 1VC4A 2PLKA 1KO0A 3MJYA 1NDWA 1EJSC 4DXKA 3GXNA 3HPXA 1VRDA 3EDKA 2OPJA 2BS9A 4DLMA 4AFYA 3KRUA 1CW2A 3B9AA 2EKCA 4GVIA 3VGDA 1GJUA 1GQLA 4JS3A 2Z2UA 3IEBA 3W82A 3CAWA 1FWRA 1D2KA 4ROPA 7TAAA 1ALDA 3L4XA 1I1WA 3EX2A 1RXOB 1VFSA 4HNNA 1UPPA 2HBXA 2H3BA 4GGHA 3WH6A 2VGGA 2XIBA 1LM1A 1XGZA 2QV4A 4E8DA 4LUTA