1OSEA

Porcine pancreatic alpha-amylase complexed with acarbose
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
b'EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PORCINE ALPHA-AMYLASE
publication title Crystal structure of pig pancreatic alpha-amylase isoenzyme II, in complex with the carbohydrate inhibitor acarbose.
pubmed doi rcsb
molecule tags Hydrolase
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1oseA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1oseA01
7TAAA 4GI9A 2VVSA 2YDQA 3OLEA 1IZKA 2W91A 4H41A 2ZUSA 2ZIDA 4QCFA 4HTYA 1B9ZA 3SUVA 4FNQA 1GOKA 3WQWA 4DO6A 4OGZA 2VCCA 1OT2A 1QBBA 3DX2A 3CZSA 4XZWA 2VJXA 3GDBA 4Z2JA 5I0DA 1PIGA 2WKGA 5TD4A 1U33A 2QLYA 1JZ8A 4AMWA 4A4AA 4RE3A 4LPCA 1JDDA 4U31A 1BF2A 2E40A 4TX6A 1OWQA 4BA0A 3U5UA 1ZJAA 4J3UA 3WQ8A 4XUYA 2E8YA 2GK1B 2WW5A 3O9NA 4CD5A 4PSRA 3EYPA 1Q6GA 3A47A 4M1RA 4AZBA 2ZUTA 3CMJA 4F66A 4W7WA 1DHKA 4E8CA 2ZUVA 3MO4A 3RIKA 3CTTA 4LYPA 1C8QA 5CSUA 3BSGA 1BG9A 3WEOA 2O9OA 1M01A 1R47A 4PEEA 2DH2A 2J4GA 2DPEA 1TMQA 3BAWA 1FH7A 5I6SA 3NUKA 1LL6A 1E6NA 3AXIA 5GQBA 2ZX7A 3N15A 4W85A 1B2YA 2CHOA 1H4PA 3GNPA 1J0HA 2UY3A 4UQAA 4J3SA 2WMFA 3SCPA 2IUZA 3T08A 3FNDA 4HP5A 3J7HA 2WBKA 4UTFA 3D4YA 4DWSC 3NYDA 1UHVA 5E1QA 4W8AA 3N13A 3ARWA 1GZJA 4JKLA 2GVYA 2OSXA 3PN8A 1PS3A 4UZUA 3UCQA 2UY4A 3AS3A 1CXFA 4KRUA 1UASA 1Y7VA 5EFDA 2WLYA 1B1YA 4QFUA 4UFLA 6A3HA 1E1FA 3CZ8A 4JFTA 1EH9A 3KLLA 4HA1A 4ZEPA 1V0MA 1NH6A 5D9MA 1GQJA 4MDOA 1GW1A 1OINA 4F9DA 3F4VA 1JZ7A 3UESA 5BCAA 1J18A 1HL9A 3ZJ6A 4RE4A 2XIIA 4PYSA 1NWTA 1FH8A 2EADA 2DGAA 3ARSA 1UR2A 5AYIA 2Y8KA 1K9FA 1V3HA 4CN6A 1BPLB 3ARZA 4JFVA 5A6MA 4WJXA 3KWXA 1WCGA 1KQYA 2BS9A 4ATDA 1EQCA 1MFVA 1CEOA 2X0YA 3WF0A 2J7EA 1TA3A 5DO8A 3D51A 1NOFA 3GXIA 3DDGA 1R8LA 1OM0A 2BY2A 1EGZA 1QNRA 5AC4A 4U5KA 4P7RA 4W84A 1GOOA 1GVIA 3NSMA 1ESWA 4NSBA 4UFJA 4H2CA 1BYAA 4GO8A 4AEEA 1UD5A 2VX4A 2X2IA 1OGGA 3ALFA 1PBGA 3PZOA 4OJYA 3GNRA 3BAXA 1WZKA 2PWDA 1IT0A 1UA3A 1H3GA 5CGTA 4PTMA 1OGBA 3WUBA 2Y8VA 1KR0A 4X9YA 2ALWA 1JDAA 3AMLA 5M3WA 2Y4SA 3BGAA 3WUGA 4OKDA 4H04A 4YHEA 2DIEA 1NOWA 3PZQA 1R33A 2VR4A 4UFMA 4BS0A 2NW0A 3VMOA 4P8XA 1LWHA 3BLPX 1M53A 3VM7A 3DC0A 1CPUA 1EQPA 1C7SA 2XVGA 3RM4A 2YKKA 3WQ6A 4P7LA 1HKKA 3M6DA 4MNLA 4UQ9A 2CITA 3SUTA 1QW8A 2EQDA 2XTKA 3DX3A 1JI1A 4M80A 4J3TA 3CUFA 3WEZA 5BRPA 5C70A 1CGYA 2ZUWA 2EEXA 1J11A 3OGSA 3QHNA 1D2KA 3PTMA 1TQTA 3K1DA 4JIEA 1E72M 1C91A 3T2OA 2J47A 3EDJA 3OZOA 2WC3A 1WDQA 5A6JA 3UG4A 5I5RA 1AMYA 1Q4NX 3WQ5A 2J7BA 3AMGA 4AZCB 4MDPA 4PCSA 3UG5A 2XM1A 1QHPA 1UR9A 2VI0A 1E6RA 1EOMA 3MUAA 4CUCA 4UQEA 3DDFA 3AYSA 1TVPA 2ZXAA 3CHCA 1PIFA 3WELA 1TG7A 3CZLA 3E1F1 3AQUA 2E4TA 4DO4A 3I3EA 2F7OA 4P7OA 4JZ5A 3LRMA 3AICA 3AZRA 3HU7A 4AEFA 1SYTA 2EO7A 2BXYA 3CUJA 4PMRA 3VPLA 4AXNA 1ITCA 2CIPA 2GJXB 2WZEA 2A3AA 1EXPA 3LX9A 4U2ZA 2V38A 3EBVA 2CHNA 3WH8A 3DX4A 2V5DA 3BAKA 5A6BD 3W6LA 3BVUA 3WNMA 1JYWA 4QCEA 4F8XA 3WKZA 3GXDA 4UOQA 2OW6A 3OG2A 3AFBA 1I1XA 1GVYA 1L8NA 1W3JA 4P7QA 4W8LA 3CHFA 2NSXA 4JFSA 3N1AA 5DT5A 3ZJ7A 3M7SA 2WHJA 1CNVA 4W5UA 3W0KA 1HP4A 3MMUA 2DSZA 4HZ7A 2DT3A 5HDRA 1FP9A 1JGIA 4AY1A 5A2AA 4U3AA 4FLOA 4OBSA 3VX1A 4JFWA 3SCNA 4N0RA 3SCWA 1KTBA 4PMOA 2ZWZA 1GOQA 2BV9A 3WDPP 2X8RA 1JXKA 3U5YA 3L2MA 1UR1A 1CLXA 2YA0A 1GOIA 1VBRA 2PWHA 4FNTA 3RJYA 2XN0A 1JFHA 4MJ2A 5FOOA 3CH9A 3EDDA 4JFUA 4DM1A 4H8HA 2CNCA 2QPUA 3HJEA 1OSEA 5FD0A 8CGTA 1WDSA 2OSWA 1ISXA 4E4PA 3BCFA 4PN2A 3FHAA 4GKLA 3SEPA 2VZSA 5IXEA 5JUVA 4ZE4A 4GPNA 4EK7A 2YJQA 3GZAA 3TOPA 3ARXA 4HZ8A 2DH3A 1QHZA 4FNRA 4PMNA 2WXDM 4TX8A 1E5NA 3RCNA 3S6TA 2XJ7A 2VQUA 1PJ9A 2E0PA 2A3CA 1ODZA 3RO8A 3L4YA 4MB4A 1BHGA 1F4AA 2UY5A 3UG3A 5EB8A 4Y7EA 4CCDA 3A23A 1NM9A 2ZX8A 3F5LA 3ARRA 5I2UA 3WQ4A 2ZUMA 5BXSA 2GSJA 3II1A 2UY2A 1MW3A 1PZ3A 1J10A 4D6IA 2CBJA 4AIOA 3WY1A 3QOKA 2A3HA 1CGXA 2ZX9A 2DT2A 1VRXA 4AZ7A 4GI6A 2CCRA 4MNMA 4QLKA 1E43A 2ZXQA 4PMUA 2VZOA 4U5IA 1V3IA 4AIUA 4CN4A 3AMDA 1MQRA 4KGJA 4NXKA 3U7BA 1CLVA 3VD4A 1J0YA 1LLOA 1BSIA 2AOSA 1V0LA 2VCAA 5A94A 4D71A 5CGMA 3I3DA 3WL0A 5IDIA 3HG5A 4U2YA 3AZSA 3VGEA 2BVDA 4NZJA 4RE2A 5IFTA 3OGRA 1UKOA 2VX6A 2YL6A 1KCKA 1E56A 4HMCA 5BYWA 3PZTA 4EE9A 3S5ZA 3KL5A 3IJ9A 2BY0A 4LYRA 5M5DA 1NQ6A 2E9MA 3ARVA 3LPGA 4PMXA 3WNKA 1H5VA 2XFYA 6CGTA 4ACZA 2DSVA 4AZHA 2CKRA 3UETA 3ZOAA 1XYZA 3TV8A 3L4UA 1VBUA 3BC9A 1PX8A 1SFSA 3N9KA 1NP0A 1WP6A 5HPCA 4V2XA 4AC1X 3JUGA 1B3XA 1J0KA 1C8XA 1YHTA 2C7FA 4UQCA 4R5EA 5BROA 1FFRA 1UQYA 3UR8A 5FIPA 1GOMA 3ZSTA 4JL2A 3GH7A 4M56A 1WNOA 3K8KA 4CKQA 3VIPA 2GJPA 5E6ZA 3BAJA 3WN6A 1QI0A 1W9UA 4PUDA 1B90A 3VSVA 1BYCA 1V6WA 4UQBA 2E9BA 5DEZA 3W82A 1RP8A 3A22A 4FF5A 4EAMA 2ZE0A 1QW9A 1PAMA 1L0PA 5A6BA 4HOZA 3LPOA 3D50A 2O9PA 3VDBA 3F5KA 3SUWA 3AJ7A 4R27A 3VIHA 3OGVA 2W66A 3AISA 5E6YA 3WSUA 2WVVA 2XM2A 2WMKA 1EHAA 3ARPA 4D6HA 1R75A 2FH8A 2D24A 1V0KA 1N82A 1W3HA 3K8LA 3NJ3A 3VOCA 2EPLX 4A3HA 4HOWA 1NP2A 3K4DA 3WUEA 4TVCA 1J9YA 1DWIM 1EO5A 5F7UA 3VGDA 1UWIA 3PZUA 3WNOA 5D4YA 3A21A 1KR1A 1W32A 2J7CA 1JFXA 1XD1A 4Q22A 1XV8A 4P8WA 3BUIA 7A3HA 3POHA 2WNWA 1I75A 2QF8A 3AXXA 3VX0A 3FHQA 2WSPA 4UNIA 1GQLA 3SCOA 3IJ7A 4WSKA 3WDIA 3OBAA 1QX1A 1HJSA 1XD0A 5DFAA 3VD7A 4L4OA 3VGBA 4HMDA 3POCA 3RILA 2YLAA 3PHAA 1HJQA 4XB3A 3TA9A 1HP5A 1VFOA 3LXCA 5A1AA 1XSIA 3VKKA 2BVYA 4BQ2A 4PMZA 3VGFA 1TA3B 3WDJA 1KXVA 1CGVA 2YBUA 4W7VA 4B9ZA 1UWQA 3BSHA 2YLLA 2VC9A 2YFOA 4PMVA 2EACA 1KXQA 4NRRA 3BLBA 4JHZA 2J7FA 4LQ1A 4TOQA 5A8MA 2PWGA 3SURA 3CZEA 1RH9A 2D3NA 1QWNA 3BH4A 1DP0A 3VIMA 3WUFA 4FNSA 1JZ4A 2VRKA 1H09A 2VUYA 1E6SM 2JEQA 3CUHA 4JAWA 4AYSA 1S46A 3AIWA 4D6JA 1UD2A 4CVWA 2XN2A 3RPMA 4B9YA 4B3KA 2DSKA 1QI4A 2PWFA 3H54A 4LGXA 2JALA 4V27A 3I3BA 1E4MM 2DIJA 1ISZA 2J77A 2D22A 1E15A 2VTFA 3WQVA 1HL8A 3BUBA 3WH7A 4DWSB 1JG9A 1QI2A 1HIZA 3CIVA 1UKSA 1E5JA 3H55A 4MTVA 2XFRA 1VEOA 5CZKA 1XCXA 2OYKA 3DHPA 5I23A 3HMCA 4AIEA 3PZVA 2PI6A 4BZYA 1UUQA 2QHAA 1MWOA 4AZ6A 3WD4A 1UOKA 3WH5A 1BVNP 1GJWA 1V6VA 3T2PA 2HISA 8A3HA 5CG0A 3O6AA 1E4NA 3WMBA 3GXTA 3UERA 3MU7A 2W67A 3WNNA 4TVDA 1VB9A 1VFMA 2CEQA 1B0IA 2X09A 3VO0A 4UFKA 3VTRA 5A8NA 3GBDA 1D7FA 2WCSA 2DT1A 1MQQA 2XVNA 2MANA 4LXFA 3BLKA 3WFZA 3CBWA 2PB1A 1JAEA 4AD5A 5DMYA 1V6UA 2CETA 1R46A 3TTYA 3MV01 4IISA 5DF0A 2GK1A 5JIWA 3WD1A 2J78A 2WAGA 2OWCA 1CXIA 1FHLA 1Z32X 3H53A 1UKPA 3PTKA 1NARA 2JF7A 1UWTA 4EKJA 3AIEA 1U2YA 5C8BB 4UZSA 1ZBVA 3AHVA 3WDQA 2F18A 4MB1A 2IXVA 4OOUA 1BYDA 4JCLA 4P8UA 3S2CA 1NOUA 4E2OA 2X2HA 2ZWYA 5DT7A 1A3HA 3RM8A 1JD7A 1US2A 3ARYA 3HG4A 4M29A 1XH0A 3KL0A 1GONA 3GXPA 1E0XA 4S3KA 1KXHA 1CDGA 3BMWA 3EJSA 3SCTA 3VVGA 4C7FA 1VFUA 4DUWA 1PZ2A 2F7QA 3U57A 3AOFA 1WZMA 1O7DC 2XGBA 2ZUUA 2OW7A 3GYCA 2AAAA 3LRLA 5HNNA 4P8VA 4CGTA 1LF1A 4PMDA 5EMYA 2W5FA 2WPGA 3F5JA 4M81A 4FLRA 2J7HA 1NWRA 4HU0A 2DSWA 2V3EA 2GDVA 4MAZA 4PMYA 1VF8A 4CD7A 1QPKA 1HWWA 4URIA 4ATLA 3G6MA 4DUXA 2A3EA 1W1YA 5FCZA 5CPSA 1UH3A 1K6AA 1E6QM 1UWRA 4ML4A 1JF5A 1M03A 3EMQA 3A4XA 4TVUA 1UKQA 3W26A 4OUEA 1KBBA 4ZFMA 4MJ4A 1XGZA 1X1NA 3L4TA 2YDSA 1W91A 3RJXA 1JL8A 3ECQA 1JNDA 1HJXA 1C90A 3NCOA 2Y24A 1GJUA 1NWSA 1WB0A 4HPGA 4XZBA 3FAWA 2B31A 2Z1KA 4CD6A 1E40A 2OYLA 1PEZA 4TUFA 1TE1A 1FA2A 4TTGA 3VSUA 4X0NA 1US3A 4V28A 3AHTA 1O7AA 4K68A 1E55A 2WMGA 2XGIA 1CIUA 3PZGA 5E0FA 2EJ1A 3APGA 3TTQA 3AS2A 3LMYA 4WIWA 2BY1A 1ZJBA 3SIMA 3A5VA 2VZTA 1Q6CA 3D3AA 3VNZA 2VQTA 2VVNA 1OBAA 2CBUA 3TTSA 2WCGA 3K4AA 2J7DA 2EABA 2WWCA 2BVTA 4BCEA 1VJZA 4UQDA 4YHGA 1HXKA 1KCLA 1HKMA 1ZBCA 2O9TA 5LA1A 1A47A 3ZIZA 3ZM8A 1KGUA 1UA7A 1TQSA 1UWUA 1R7AA 4OZOA 4L4PA 2D20A 2Y2WA 1U30A 3FAXA 1LG2A 3SUSA 3WBAA 2CESA 3OZPA 1UD6A 3AHXA 1V6XA 5A8PA 3DYOA 3BVTA 2D2OA 4JL1A 3ARTA 2BFGA 4TTUA 2W4XA 5IFPA 1R85A 1V02A 2G4FA 4WKAA 1HF6A 2QV4A 3TONA 2CPUA 1OB0A 2D0GA 2XWDA 2FDMA 2G3IA 3B8SA 4UOJA 1P6WA 1CXLA 4ZE5A 2IGTA 1LJYA 3VDAA 4Q7NA 1V3JA 1E6XM 1AQMA 2A3BA 1QNQA 4KGLA 4MB5A 4EANA 3CGTA 1W9VA 5CSYA 2G8ZA 2UWFA 4LYQA 2WC7A 4ACZB 3VD5A 1LL4A 3ZJKA 4JKMA 1RD6A 3W38A 3GNOA 2O9RA 5ABFA 2YL8A 1UH2A 4Z2GA 2EAEA 1CYGA 3EJTA 1TCMA 2IXUA 1OCQA 1R34A 3M07A 3MUIA 1JZ3A 5M17A 1WO2A 2WM0A 5BXTA 2G3JA 3DHUA 4JCMA 1XH2A 1ITXA 4WK9A 4J7RA 2TAAA 2X2YA 5BXPA 2ZX6A 1HN1A 3W29A 3KEHA 2CYGA 2WZIA 4PBGA 4GQQA 1TZ7A 4AD3A 3SCQA 3TTOA 3VNYA 3BAIA 3LPFA 1OD8A 1GPFA 2E8ZA 2RGMA 3VIFA 1V08A 1HKJA 5JBEA 1YQ2A 2J7GA 3AZTA 1GOWA 2PBOA 1TFVA 1FFQA 2XVPA 1FHDA 3CZKA 4GQRA 3EDFA 1J0ZA 4DM2A 2XSBA 3PZ9A 3T2QA 2FHBA 2JEPA 3B9AA 1H0GA 1E70M 5I24A 4BQ5A 4BQ3A 4J3XA 1QNPA 3S5YA 1V02E 1CXKA 2VX7A 3ZT6A 1X6NA 2QMJA 1Q6DA 1SMAA 2YA2A 1AQHA 3AMKA 2XFFA 1Q6EA 1KXTA 3IK2A 1O6IA 1JI2A 3D52A 3EJRA 4WKHA 4GO9A 1WDRA 2J62A 2BNJA 1DWAM 4J28A 5JIPA 4FNUA 1BYBA 1FH9A 4U33A 1VFFA 1ZU8A 4QLJA 3VIKA 3W4RA 3OA5A 4IPNB 1MW2A 3BMVA 3VMNA 1R87A 4MADA 5GPRA 2FHCA 3VIIA 1K9DA 2WK2A 1H49A 2BHUA 2X0HA 3WD0A 3OLIA 5E09A 1JYXA 2CBIA 1JD9A 1TQVA 4AMXA 3DYMA 2PC8A 3VILA 4AD1A 3VIOA 1BAGA 5D8WA 2OLHA 4E8DA 2XSAA 3IANA 2VL4A 1DWFM 3VD3A 1DWJM 4NX0A 2BY3A 4WSJA 3WF3A 4OIFA 2DDXA 2FGLA 5ABGA 2XHYA 3CUGA 5CXPA 4J3WA 5A95A 4X0VA 3EMCA 1QVBA 2XYLA 1W3KA 4CCCA 4NF7A 2ZUNA 4D72A 5E0CA 1RPKA 3AHYA 1MVYA 3BUQA 3WY3A 1B3YA 2WB5A 1QI3A 2VOTA 1C7TA 3FXYA 1BG4A 3LRKA 1UH4A 3WDHA 2D0FA 5AY7A 3QOMA 3SCSA 2XVKA 4DWSD 4MNKA 4ATWA 1QNOA 5I77A 4J3VA 1VAHA 3CZJA 2WMIA 2WZHA 3A3HA 3BVXA 1CXHA 3VSTA 2DQXA 1B3WA 4KH2A 2GDUA 4F9JA 2GFTA 4CN1A 1G5AA 2CBVA 4UOZA 4D6FA 2D0HA 1M7XA 2XWEA 3WDRA 1QNSA 1LWJA 5CLWA 2W63A 2OSYA 2FGZA 2CXGA 1PPIA 1XH1A 5CQ1A 3CMGA 1IV8A 3L4XA 1FP8A 3ZR6A 1CENA 1KQZA 3AIRA 5AYBA 3PZNA 3VUPA 1GCYA 3GH5A 1JYVA 1UG6A 3QR3A 2EPKX 4QP0A 3UR7A 2JIWA 4PTXA 2WHMA 4IUGA 5IHSA 4HOXA 4AWEA 1BFNA 2PWEA 4GZEA 1PX3A 1UD4A 5JBFA 3WFLA 2XUCA 1WPCA 4W8BA 1HVXA 4CCEA 2OYMA 3W24A 2Y5EA 4PCTA 3EJUA 4HZ6A 1TUXA 3DECA 1EA9C 1V0NA 3VU2A 1Q6FA 3KL3A 3SCVA 1V3MA 1BVZA 3WIJA 3K46A 3MS8A 5E70A 1JZ5A 4H8VA 1OT1A 3WF4A 5A2BA 3AIBA 2WLZA 4CVUA 2WVTA 3ZMRA 4W87A 4GINA 4GZJA 6TAAA 3EMZA 4AD2A 1KB3A 4U3CA 4YN5A 1HKIA 3N12A 1LQ0A 1J0JA 4W7UA 3VGGA 2NT0A 5IHRA 1GNXA 4Z2IA 2BXZA 1HT6A 4KRTA 3BUDA 4W93A 1W2PA 3CZGA 1R7OA 1KGXA 2FHFA 1UZ4A 2YIHA 1MXGA 1EDTA 5GNXA 1JYNA 2G3MA 3AIUA 5D9PA 4MAVA 3U7VA 3MSGA 3MUY1 2F7PA 1E4IA 5FKYA 1B3ZA 3DX0A 1UD8A 4IPLA 2WBGA 5I3DA 4QAWA 1CWYA 1UKTA 1KTCA 4WKFA 1WZLA 3AHZA 3G6LA 3WH9A 5BRQA 1ZL1A 2XN1A 1UZ1A 2OWWA 2E3ZA 1NWUA 3MMDA 2YL9A 3ZJ8A 4Z2KA 2JIEA 2VZUA 3VDCA 1V03A 3NSNA 3B9EA 3OIHA 5ABHA 1DEDA 3MKKA 2AMGA 5LA2A 3T09A 3QHMA 1C3FA 5I79A 1EOKA 3D5HA 4OOZA 2WSKA 1HJVA 1UWSA 1E71M 2ZICA 3CZNA 1CTNA 4FMVA 3WL1A 4S3JA 1ZB5A 5AC5A 4NI3A 5CLTA 3WY4A 3AROA 2ZOXA 5CJ5A 2DEPA 1MYRA 1W9BM 3ZT5A 3VIJA 3OLGA 3BCDA 3BXWA 4C7DA 3VMPA 1W1PA 3SUUA 3CPUA 1XSKA 1UYQA 3WNLA 2DT0A 1QI5A 5HOSA 3VD9A 2ESCA 2J75A 3AIQA 3IAQA 5I78A 1W9DM 1AQ0A 2FH6A 2F2HA 3WY2A 1KGWA 2WCAA 3NSXA 1XHGA 2G41A 1PX4A 4WF7A 2YOCA 3EDEA 4ACYA 3RMEA 4KMQA 3BAYA 1CBGA 3WD3A 2FYVA 1RP9A 5KZ6A 3N11A 3CUIA 2O92A 3O2LA 4FLSA 3ARUA 2VCBA 2BHZA 2Q8XA 1CGUA 4ZXLA 1EHNA 2EXOA 1SZNA 1B30A 3A24A 1QBAA 1HVQA 1VEMA 3KLKA 2C0HA 2VO5A 1CGTA 3WMCA 4BF7A 1QOXA 2VR5A 1E73M 5FL0A 5EBAA 2YL5A 3T0AA 5LYRA 2W61A 2GUYA 3ZO9A 2DSUA 3UEQA 3VDHA 4DWSA 3HG3A 2YA1A 2WMHA 1ZS2A 5A8QA 3AIVA 3PBGA 3BVVA 3WF1A 2ZXBA 2WC4A 1XRVA 3HN3A 2YDRA 2D23A 1WKYA 1BLIA 4HU8A 3KZSA 5A6KA 3GTNA 2XIBA 3W28A 1WAWA 1J01A 4AW7A 1E3ZA 4PUEA 1MXDA 3OB8A 5A6LA 1EIBA 2VX5A 4B16A 1K9TA 3GM8A 2X1IA 3SCRA 2V3DA 2WHLA 1E6ZA 1W1TA 4BQ4A 1ODUA 2JFEX 3KE0A 3NDYA 1KWGA 1DTUA 3HG2A 2F61A 5C71A 3NIYA 4M8UA 3GXNA 3EJQA 3ZQ9A 4MB3A 5A6SA 2J79A 4GIAA 1C93A 3FN9A 5ABFB 3LXAA 3FW6A 3QGVA 1QHOA 1C8YA 3N04A 5A3HA 3GBEA 4QLLA 4TXEA 1E0WA 2ZXDA 3RDKA 4CD8A 2J74A 3CLWA 4ZXOA 2JE8A 2E9LA 4AD0A 2VT0A 4NXSA 1GQIA 1TVNA 1V3LA 1K9EA 3EJPA 2VZVA 3ARQA 3SCUA 3L4ZA 4UCFA 1JNEA 4W86A 4F79A 3MUZ1 1OGSA 4PMQA 1XYFA 1HTYA 1HXJA 5BXRA 2QMKA 2J8FA 1JF6A 4IM4A 1B3VA 2F1BA 3TP4A 4RL3A 2V3FA 2JF6A 5D8ZA 3T0DA 3AMCA 3RM9A 3ALGA 1TQUA 1LG1A 1JZ2A 4B15A 1JXJA 1QWUA 4HMEA 4AZGA 1FOBA 4XV0A 3CC1A 1SR0A 1CZ1A 4KWUA 3BVWA 3CO4A 5HXMA 5LA0A 1ECEA 3A4WA 1VIWA 2VNCA 3W25A 1W9XA 2F8QA 3IJ8A 2WMJA 4HA3A 2NT1A 1OIFA 3M46A 1MW0A 2HVMA 5EFFA 2V3GA 4NZCA 4J27A 1E9LA 5ABEA 4PRWA 4AZCA 4B3LA 3VIGA 4MPKA 4FNPA 3W6MA 7CGTA 3AYRA 1XSJA 2RGLA 1BGGA 3B9DA 1D3CA 1F4HA 1ZBWA 3AI0A 4N42A 2X05A 4WLCA 3WNPA 4CU8A 4H8UA 4UFIA 4AZIA 1ISYA 3VM5A 1MFUA 2PF0A 1I1WA 4AZ5A 4GXPA 3K8MA 2Z1SA 4D1JA 2VMFA 3MSDA 1SMDA 2GJXA 1H11A 4Z2LA 2QPSA 3VGHA 1VENA 9CGTA 1BQCA 1EDQA 2F1AA 2WVSA 4W88A 4ZENA 4Z2HA 4D6DA 1CGWA 1H2JA 4P7NA 4OBRA 4AD4A 2FE0A 1EO7A 2F7RA 1GQKA 4C7GA 1J0IA 2WHKA 3WD2A 2VRQA 1JIBA 1CXEA 1W1VA 4PSPA 2BHYA 3THDA 1DWHM 1JAKA 4D6EA 3ZT7A 1E4LA 1G9HA 2WKLA 1G0CA 1ISVA 3BUPA 1C92A 3NDZA 3LPPA 1JDCA 1UR0A 2V5CA 4A3YA 1LL7A 4XX6A 2XPKA 3DYPA 4W89A 4CD4A 2WVVB 1WDPA 1KBKA 2D3LA 2X2JA 1MQPA 3IGUA 3AXHA 3L2LA 1VEPA 1OD0A 4MNJA 4QDMA 4D6GA 3W53A 1W2VA 2WMIB 4HA4A 3WBEA 1WZAA 3PZIA 3AS0A 3A6OA 2CKSA 2WWDA 2WVUA 1H0IA 4CU7A 5CPQA 1J12A 3MMWA 3WMSA 1V6YA 3PTQA 4AISA 1E1EA 1G01A 5GNZA 2PBGA 5JBDA 4JKKA 5E9AA 2D73A 1UR4A 2EBNA 3WEMA 1VJSA 2G3NA 5A8OA 3ZR5A 4FLQA 1ISWA 1DWGM 1UQZA 3GXFA 3QHOA 3EDKA 1HJWA 4M82A 4D6CA 2WANA 3DX1A 5GNYA 4CU6A 3IAPA 1GUVA 5HBFA 1IZJA 4M24A 1MW1A 1GORA 5HPOA 1H41A 1TQWA 1V3KA 1M04A 3LXBA 5FL1A 3PZMA 1KWKA 3L4WA 3W37A 3N18A 2GJRA 3GH4A 2XG9A 4GZIA 1W3LA 2W92A 1CECA 3GXMA 1XC6A 1WE5A 3L4VA 3MANA 3CV5A 4AYGA 4PTWA 3W27A 1HX0A 4W5ZA 2CERA 2D1ZA 3WF2A 1G1YA 2W62A 4NZFA 1OIMA 1HNYA 4UFHA 2C8NA 2EPOA 4H7VA 1GHRA 4GI8A 1AVAA 3D4ZA 1G94A 4UR9A 1T0OA 4JHOA 2EPMX 2WYSA 1EDGA 3AS1A 1E3XA 1W9PA 3A4AA 2VRJA 1GHSA 3CHEA 4PTVA 1UR8A 2XVLA 1KFWA 3HZ3A 2VURA 3MI6A 3CHDA 1E6PA 3THCA 4DUVA 3T0BA 5ECUA 2J25A 3FY1A 1R86A 2EPNA 3WH6A 4DO5A 4YPJA 5KEZA 1ZBKA 1UD3A 1TR1A 2YFNA 4LX4A 1BGAA 3ZSSA 1JZ6A 2J8GA 3VINA 1X6LA 5A2CA 1B31A 1E0VA 5D9OA 2OWXA 5BWFA 3MV11 4NRSA 1XCWA 2YBTA 5D9NA 4AMCA 1H1NA 1BTCA 5A6AA 3OLDA 5CPTA 3WENA 3N17A 4FK9A 2ZX5A 4HPHA 5A69A 3W81A 5M03A 1HJUA 4D1IA
chains in the Genus database with same CATH superfamily
4DX3A 4Q8UA 5GGTL 4U1NB 4MAUH 4LPVA 4RSYA 4YDLB 3DG6A 3CL8A 1XG4A 1PO9A 4WJ8A 5AZ1A 1R5WA 3UYOD 3L54A 1NL0H 2QGYA 3EYOA 3LGEA 4JFFD 3FQYA 5JO5A 4XISA 2X3CA 5CKSA 4IU2B 4KRPB 1EJFA 4E8CA 1S5MA 4JRYE 5FUCE 3BT0A 4Z7IA 1FWHC 1UCWA 2GQAA 1RFDL 3KPRA 2H2PD 4NOBA 1CO1A 4XKMA 3VOIA 4X5WA 5CP3A 1B2YA 1NC2A 2QDHA 4ZPTA 4J3SA 3EKCA 4L1SA 2DLFH 1UR3M 1G7QA 1GZJA 3F2BA 1GPOL 1MIEH 3TZVA 5KVEE 1H7XA 1NU5A 2W0UA 1J1OH 3ZE0B 2R1XA 2FB3A 3ROLA 5GGQH 3CLEH 2AABH 1QSEE 2JJUA 2BP1A 5DD3L 2EC9U 3QPXH 4CN6A 5EC1B 3OAYH 3P5ZA 2QPFA 4WW1A 5A6MA 4XAGA 1KQYA 4YL2A 4YNYA 4R26L 3GQFA 1Y1UA 3T3MF 5LHDA 3QH3B 1WBJA 1QOPA 3H2WA 1R8LA 1U95A 3DSNB 2OX1A 2A6DA 1G7PB 2FQFA 1GMIA 4KO5A 1N0XH 3GW3A 3SDOA 4FP8H 4J39A 2WJZA 3E0GA 4W4QA 1WF5A 4N0CC 1QBLH 3CMOH 2J66A 3QUYC 1YDNA 3MROB 4RRPG 4L29B 1GKQA 5A2FA 3Q6GL 4EBQH 6PCYA 4UQ2B 4P59L 2NYYD 3EWUA 3VM7A 3L4CA 2CITA 5IDZA 2NZ9D 3W7OA 5DVNA 5AYXA 3NO3A 2Z92B 2NTFA 3ZDZB 3QHNA 1DCEA 3PTMA 4JIEA 3L1FA 5E6SB 1DQJB 4S10A 4TNWK 4FA8A 2X9ZA 3AWNA 3CNYA 5FGBC 3LCXA 2CBPA 4MQSB 1OGAD 4S1DC 3MLWH 4AZCB 3CSGA 2XM1A 3W0WD 3AZUA 3X2QB 1EOMA 4UQEA 4DVOA 4AYEC 1PIFA 4R4FL 2E4TA 5FK9A 2WWKO 1HHHB 4QT5B 3CD4A 5F6IC 4TXVB 5C07B 5JH2A 1I8IB 3ULVE 1IL1B 3UBXG 3J2PA 5AOMA 2WZ6A 4D8LA 1FA4A 2ADGB 3GXDA 1XFPA 5LNEA 2BFVH 5LDUA 4Z7AA 2XH4A 3CFDA 3BGMA 4I4WB 4JMXA 5LXVA 1HP4A 4IIZA 1XIEA 3H7BB 2NW3A 5JW5A 1YEFL 5FKAA 3H8AA 3N41B 3DURB 4PJ7B 1EIXA 1A4KB 1DANU 4MKTA 2XA8L 2OMVA 1U3YA 1NCOA 3BSZL 5D2NB 1L7IL 1QNIA 2QGDA 3VD1A 3JVGC 4IGBA 1CLYH 2EVGA 4QRPA 4GPNA 1MFBL 2YJQA 3QZWG 4RGOL 2FPVA 3P69A 2JKRM 4FXKB 2EYRB 1MJ7H 1TSRA 3AYTA 4QUOA 3FU3A 2PTXA 3ES8A 4KQ4L 3LQZA 4PS4H 2Z9TA 2ZSVA 4BQ8A 4M48H 3S6TA 3L7FA 5FECA 1KIPB 3I6TA 5EEUA 2CLLA 4AWSA 3L4YA 4L8CA 3ABZA 1NTHA 1IEIA 1CK0H 2VIRB 4AVJA 5CEZD 1YJDC 4MNQA 2YHGA 4NNYA 2QUVA 2VXQA 1EMTL 2YZRA 2VLMD 2VLKE 1EANA 4L4MA 2C4XA 4AZHA 1CGXA 3RA7L 4G42B 2CO7B 1J1XL 3AMDA 2GK0A 5KS9A 1CLVA 3VD4A 5EC2B 1PTDA 2L0DA 4PJ9B 4RBPH 5A94A 2BSTB 5FCUL 3WL0A 4XH2A 5F70A 3TW9A 4Y5XC 3BDKA 2IANE 4E68A 3SDCD 2BY0A 4HH9B 2E9MA 4A2RA 6CGTA 2WD0A 4ACZA 1UA6L 2CKRA 4PJAF 2VAAB 2DQIH 5HPCA 1NP0A 2ENYA 3GK8L 4PD4J 1PFOA 4MCMA 4PWIA 1KJ3L 4Z7WB 1Y8BA 4R5EA 1P0BA 3RTQC 5EWIH 4WOZA 2EYSB 3NOYA 1W5MA 4BKNA 3SN4A 3MNZB 3W6YA 2CAKA 1REIA 1RQEA 3O41A 1FCBA 1E5ZA 3DO3A 5INCA 4C56B 4OW6A 3RRQA 2OTUB 3ZRSA 5E6YA 2C5DC 4XCNB 1XLDA 4YDKL 4LKCA 3Q2VA 2P44B 5H8MA 5IQOA 4Z1BA 1ITUA 1RUML 2FEJA 4A3HA 3RUGA 2C4FT 4C6KA 2P0OA 4YJZL 2DVUA 3MV9E 1XV8A 2AJYL 3ENEA 3RWCB 4IPPA 4ZTYA 4YIWA 3ERPA 4F37F 3PGFH 1F2JA 2PRLA 5I3KA 4AQZA 3SCOA 1RUAH 3E74A 5DFAA 3DGGA 1CD1B 1AMXA 5C09E 2GAZB 5A5WA 4Q6IA 2XTSA 3B3IB 2PCFA 4JTEA 1VKXA 4ZQCA 3LZQA 1TA3B 1YPZF 4BK5C 1KXVA 3RZCA 1HILA 4IJCA 1OV8A 4B9ZA 1M7DB 2F7FA 3G5XB 1JV2B 1AZNA 2LT9A 3LDVA 4JHZA 1XDJA 2RMNA 3E49A 3VOGA 5T3XH 4Y5YB 1LEKA 4WUKH 1UM5H 4OSUH 1E6SM 2H9GB 3NFUA 2FUTA 1AD0A 2ADJA 4B3KA 1MRDH 2NUTA 2DIJA 1C12B 2CCWA 1QPPA 1E15A 1WBXB 2NY5L 3T1FA 1HL8A 3NA8A 5LIYX 4HK3N 3CIVA 1BF8A 3W7PA 3LPWA 4XP6H 3V0HA 2DQEH 1OOAA 1LP9B 4CQ9A 3N34A 1EERB 3KCPA 2GGGA 1V6VA 4WFHD 2QKIB 4XPBL 1DZ0A 2C9VA 1MVFA 4EPKA 3MNMA 5JIQA 5L7XH 3ES6B 2OXGA 3GB7A 3KJ4C 3S35X 1HOEA 5DF0A 2VERN 1NARA 2LHAA 1NCCH 4L4LA 4QNPE 4LRNH 2V6HA 3N6JA 1L0YA 1N3NA 4E3TA 3FH8A 3B8IA 4AJ0A 3PJNA 5EBUA 4X7FC 1KCRL 4WHDA 1JNHA 2WN3A 2YGVA 1MI5D 3GSVB 3EF4A 3JR2A 1OLLA 1OFRA 3QXAB 4QRNA 4OIIH 2ISVA 5E5RB 4JQIL 3VTTA 1NC4A 3VVGA 2F7QA 3OJDB 4IGMA 4E42B 3NEXA 4G83A 1GZQB 2P5NA 3WUWG 3A3XA 1YNTA 3WJMB 5IVOA 1Q63A 1ZKAA 3VA6A 4IG2A 4X6EB 4K3JH 4B50A 2PCXA 5CJQH 3BOXA 4NZ3A 1NELA 3PJWA 1TPB1 3FK4A 3RO6A 4EVNA 1A7QH 1OFBA 3LERA 1UJ3A 2RFXB 1U8PA 2X4PA 1TX2A 3HG1E 1W1YA 1DQDH 1DJXA 2E75C 1X1NA 3CWHA 3VD0A 4YX2L 5LGKA 3FRPA 5DYOA 4R85A 3KWWB 4LS2A 3FAWA 3UZJA 3N4FA 1I8UA 3O6ML 4MJ5B 3HNVH 5ECGA 3FYIB 5E6RB 1GYWA 5LBVA 2CJSA 4NM4H 2WTOA 3EOEA 2UYLB 1CLCA 1WYJA 3FJNA 3LD5A 2EO1A 2VXQL 3WBYA 3SGDI 4DJDD 1AZUA 3RDTB 5IB1B 2BM3A 1ZJBA 1GKRA 2R15A 1AGBB 1S9XB 1ICTA 1XGPB 2A4ZA 1UWYA 4K73A 1TO4A 3BFOA 1AKJA 4UV7H 4L6HA 3E6EA 3ZDXF 1LT7A 2UZ9A 1S9YA 3H9SB 1GOFA 4ZI8A 1YTDA 5D55A 1R9ZA 5LXGH 4A68A 3ZJAA 3EOSA 1X5LA 5DUML 4DEUA 1QLFA 1UOLA 5ACZA 5AYUH 2INFA 2ZYFA 5FAJA 3QI9C 4HU3A 2Q86B 4X7TB 4JTQA 1QNQA 3Q5TA 3VG0L 3CT2A 5JPNC 4XWOD 5IW6A 2VLRD 4LSQH 3VGAC 5KVDE 2YLKA 3Q45A 2QT6A 1TWDA 3NACL 4GQQA 5D32A 1LGVA 2OTWB 5DEGB 3U48A 3AUOA 2AL1A 1HKJA 5LAXA 4LANA 1PLCA 2ZDSA 2VDIA 2J7GA 2HT3D 3WD5L 3C75A 5HI3D 4GQRA 4US6A 1JP5A 3S6DA 4K38A 3VXMB 1XDMA 1J1PH 4OFCA 3IT8D 3F12B 5KVFE 3RL2A 3S5YA 4L0ZA 5L9DL 5AAPA 3EPMA 1AJ2A 4WVXA 2FWUA 4KKRA 4X6DF 3HI1A 4EE2A 2JB5L 3EJRA 2B1HH 4XPFH 5EIIG 2EDWA 3W4RA 4F3FA 2R91A 3GMRA 3V4VB 5GJPA 3VE7A 1E2WA 3FT9A 3NQAA 5E93A 3CO8A 2ZOWA 4F0KA 3DYMA 5IBUB 3AALA 3VILA 5LDSA 4YHNB 3QCTL 3SPVB 3W7MA 3D09A 1IM3A 3GSXA 3JWNE 3D9AL 2G9HB 5E6IA 4HVXA 4L8DA 4WSJA 1EX5A 5ENWB 1WQVT 1SMOA 5TDPA 5A95A 3EFDH 4EDWH 2GSGB 3MO7A 5I76A 4ZW7A 1CE6B 4P9HL 1W54A 1C7TA 1RHFA 1ZY9A 3RFRA 3AC0A 4PHZA 3WDHA 3B0YA 4C6EA 1YMMB 1L9PA 1P7HL 4NT6A 5HWJA 3B9KA 4HK7A 4XOAA 5I8OH 3E9UA 1MFEH 1EBPA 5MENA 3HMXA 4JGUA 3EBAA 4KI5D 2PCYA 2YUWA 3WKYA 3KS6A 3ZR6A 1UM4L 2VGLM 1T21A 1OXYA 2MRYA 3EJYC 5F1IB 3DHFA 3GH5A 3USBA 4LW7A 1YDPA 1AXIB 3LNDA 1J05A 4BH7B 1RZGB 1M71B 1HKWA 2XSXA 2GY5A 4UAOB 4M8QA 3THUA 1D5MA 3U1SH 3ZE2E 1RZ8A 2FJFB 1H3TA 5I7GA 4FQHB 1QYGH 3LV6A 4PS8A 2PABA 1ORSB 4XMKL 3FTZA 3BQVA 3TF7C 1AQFA 2GBUA 1C08A 3O3EA 4AY8A 1E8YA 3GUTB 1RUKH 1RH8A 3SE9H 4B90A 4JY4B 3AQDA 3V9FA 1BBJB 2OSLB 3RU8L 3VGGA 4KRMB 5IHRA 3RBGA 4IIQC 4J9JA 3IDMA 1W2PA 3RUGF 4DUOA 1P9MC 3I6SA 1EL3A 2YIHA 1MXGA 5GNXA 3PAUA 4LE8A 3AIUA 4HK6A 2Y6TE 3KCWA 2C1HA 2ZT9C 3G1AA 2OGJA 5KYNA 1KLGA 5SX4H 3WO3B 3QG6A 3QPKA 1RIUL 3S46A 3CX2A 1TWSA 3TN0A 3GSNL 2N7AA 3F4DA 3RK8A 1SFHA 3HMJG 3H2FA 2FO1A 4Z2KA 4G7VL 3FU7A 1AD4A 3SE8L 5ABHA 3MKKA 4WI0A 3CWOX 1KJ2L 3IJIA 3IMVA 1Q9LA 4EMZA 2QIWA 3G5WA 3IDGB 3SN1A 1ZCCA 4GMSH 4DGUA 4WK2B 1N67A 1I7RB 2DEPA 5FF7A 1MCIA 4QHMA 1B0RA 4R5TA 3L5XL 5GIRB 1M6OA 5KW9H 2J75A 3VNDA 3PL6C 4YAQB 5ADPL 1OX6A 1DDTA 2G41A 2WLLB 3W07A 3PANA 2GVGA 3C09C 3HEIB 1ML0A 4O4VA 4NC0B 2JTDA 3VXRA 5IQ7L 4HIEA 5D9SA 4XMPH 1ILSA 5FKPB 3SDYL 1UMLA 4DFIA 2VB5A 1U3HC 2BMBA 1CU4L 5F9JB 4WFGD 5DJDA 1UMYA 1YUHA 5FJTA 4X7EC 3VAVA 2CKBA 3PG9A 3NNTA 1C9SA 1BJ1J 4IMGA 4MFDA 5HDBB 1AHWC 1HZHH 3MMEB 2WC4A 4M1DL 1MOEA 3MKGA 2YD3A 2CLZA 4LLDA 5FYJU 3QXWA 4HUUB 5D8JH 1MXDA 4IKKA 5C9UA 4RGND 4C83B 4OV6F 3C8KA 5T1DL 3BK0A 4QDWA 4QOKA 1EDYA 4H8WL 1Q0YH 2L8AA 4PBVC 1XLBA 3C6LD 4JTIA 2DBLH 3RVXD 4Y1AD 1PQZB 3E1ZA 4H25B 4N87A 5K9KB 1BZ7A 4C6FA 1A7NL 5I19L 2RBLA 3KBSA 3KHJA 1UWAA 5FO2A 1VLIA 1XGDA 4TXEA 4PWFA 4QEEA 2VC6A 2FTWA 4NXSA 3DOSB 4F79A 4R2GD 2H41A 4MLJA 3PBWA 3GG7A 4MJHA 4RL3A 1YY9D 4WW2A 1IGIH 3IFNH 2E67A 5JQIB 3QZLA 4GSXA 1FOBA 1LDPH 3SO3C 3UGUA 3QYSA 3G6JB 3CO4A 4Q6KA 2Q8AH 3B40A 4Z76B 5BW7A 1ZLSH 1OAJA 2EINB 4UM9B 1J8VA 1I53A 3WFCH 2HVMA 1OARL 5C3LD 4ZMYA 4FNPA 5CZVH 1X1OA 4DW2L 3UEZA 2NV9A 4RRPM 5JH1A 4ZYKA 3K71A 1F4HA 4B5TA 3AFLA 3V4PL 1ISYA 3NIFE 5IMLA 3FOKA 4EPBC 1AJ0A 3BPCA 3EJCA 3QEQE 4XNYL 3VFNA 3C0JA 3S34L 2VW4A 2ICWA 1EO7A 1F3DJ 4IOFD 5IROC 3HI5H 5LGJB 3ITLA 3FHEA 5DQPA 3SYPA 2YD0A 3L3KA 1NTDA 2XT1B 5J8OA 1MF2L 4NZ5A 4NGHH 2IQAB 3FQTB 2G2PA 4K8RC 1G9HA 1TZHA 4KFNA 3G6AB 1UR0A 3QZAA 4OFDA 2A9BA 3IJEA 1BXNA 4X6BA 3ZLGA 3H7LA 4P2RA 1LRQA 1VIZA 5AW7B 2N1KA 5CPQA 3M86A 1C5DB 3ML9A 4LY8A 3GVGA 4LEXH 1ETB1 1DE6A 4P23C 3WN5A 4O1BA 1NAKL 4JKKA 3DX6A 4AGOA 5EU6A 2D73A 3UBFA 2G3NA 1IC7L 5EN3A 2WXFA 4UOW1 1LRTA 2NV1A 4Y19D 3EDKA 1P5UB 1IBGH 4CU6A 2EHHA 1DXIA 4ZMPA 3MRCB 5E2WL 3UTSE 1HYRC 2PGFA 4LNRB 5JTWA 3G5EA 3MTRA 3BKML 1GZ1A 2HRLA 2EKSB 2IWEA 5FF4A 5EGRA 2ZAGA 3R4DA 3V0IA 1FCUA 3CBJB 4KNUA 2AK4D 3RGVC 3RJQB 3W02A 3K5XA 1VSCA 2EUXA 1OAUH 1GHRA 4QSHA 3SE4A 1DVQA 1WLHA 3UXKA 2R0WH 1Z69A 1KJMA 5IVXA 1DUYB 1KFWA 3JWOC 1OX4A 5LG6A 5DUPH 2C3VA 4FQJH 2YPLB 1EHLH 2Q7NA 3S4SG 3KBVA 2J8GA 3WK3A 2O72A 1TZIB 3MODL 2EZ0C 2UXTA 1LJMA 3QIBD 5CHNB 4AMCA 3A4DA 1CBJA 1F1GA 4JFPB 1O75A 5AL0A 1RHHB 4UB0L 4B0MM 4HTYA 5PAZA 3U30B 3AXKA 3CH0A 3ZE1F 4BZ2A 3K13A 1OGPA 4HWEH 1BEYL 2F84A 4FAAB 2X1WL 3VXTB 1NSJA 3ILQD 1Q72L 2WW5A 3M1CA 4WEBL 1QNZL 2DI9A 2R9HD 3QJFA 4HLZG 4DKFH 1RY7B 4LU5L 3KGTA 3LTPA 5I1GH 4WU7A 4X5RA 3K0YA 5FUOL 1MPAL 3W9EA 2ESVB 4MGGA 5L2JB 4K7PH 1WHPA 2CDGB 1LO2L 4UQAA 3UTTD 1NFDE 3DARA 4PJFF 3ARBA 4L9ZA 1F41A 2Q0ZX 4ANWA 3L2IA 4N68A 1QRKA 1JBJA 5KSVB 2ZXCA 2PTVA 1J8SA 5EFDA 2WLYA 3OZMA 6A3HA 4O2FA 3XISA 3QARA 3MI3A 1J79A 2VFDA 4H88L 5FYLD 3UESA 1J18A 4HAKA 4EPSA 4WV1B 5ILTH 1KCVL 5C3TA 3KWXA 1CLOL 2P1YA 3I6LD 4K9EC 3PJUA 3ZL4L 3G6DH 1KFEA 4ENLA 1PL3A 3I9IA 3SPHA 1ASPA 2BMKA 1FL3B 3OW1A 4B95C 1MFDL 1LO3H 1OGGA 5TE4H 5TK4A 4QITA 1MREH 4OM1L 5J3HD 1GTNA 4P5KA 4HPXA 5IJVA 5T3ZD 4G7YH 3ZHNA 4N0UA 2QJIA 1EZ2A 2G0LA 1J9RA 2VR4A 1M9HA 3VXPA 4HZLB 3KXFE 2ISDA 2QKFA 4PBFA 2Y72A 4UI2A 2Y7OA 2YN5A 3V5DB 2EPHA 1TUPA 2XTKA 5ID0B 3TK7A 3NSCA 4J3TA 3CUFA 1OTUD 3KBWA 4TNFA 3V6OC 2VWEE 4I5BA 1HINH 2V6AA 4Q2ZB 4JIPA 1M5WA 2HSIA 4H3DA 1ZLEA 3CE1A 4A66A 2J7BA 4R96A 1JZHA 4ABUA 4PCSA 2E09A 1H7OA 3KPSA 2X4OA 5FFOA 3CHCA 1TJIL 1PKOA 3H2EA 3EHBB 3VW3H 3AICA 2F54D 2GT9A 4XD3A 1JPTL 3L0NA 3BWUF 1X4ZA 2HG5B 3BVUA 4OLXH 3K6NA 4PJHE 3BFWA 3DMMA 1GVYA 1KKRA 2QF7A 1EX0A 4AGMA 3MOBH 1A3QA 3WEXB 1TPXC 3T04D 4HZ7A 4ZXBB 3STPA 3HBPA 4ODBD 1F6YA 2DWTA 2BSRB 4FLOA 1CFTB 1P4LB 4M3PA 3U0PA 4B3EA 5D7IF 1U3JA 3SDAD 2AAMA 2W94A 2YUVA 3SDDB 1OAQH 3U5YA 3E3QC 1EZUA 3RL1B 3EDDA 3L23A 1W8NA 3SBWA 5DA4A 2VLJE 4AVKA 1TFPA 3P8IA 3EYSH 2OCFD 1OPOA 3GVVA 1ISXA 5C1MB 4Z7NE 2DIAA 2FX8L 4JPIB 3TURA 1NKOA 4OM0L 5EB9A 4PJ8C 4A6YH 3FTSA 3DV4B 3MX0B 5BVPH 3FFCB 3TOPA 4HZ8A 1KIRB 5KSBA 1VGKB 5DWUL 4KKAC 1HG3A 1FFPB 4PMNA 4TF4A 1E5NA 3Q8AA 3MLTA 3OMNB 1UIOA 2ZXEB 3W22A 1FPTL 5A2JH 2YMXL 1QSFE 4DP8X 2NY2D 3UPRB 2XG5B 1NM9A 3P3RA 3ATEA 4GXVH 3QUZA 3PHQB 1JJUA 2H8PB 3DVNA 5E8NB 1MW3A 1J10A 3UGEA 4TSAL 3C60D 3PWUB 1VRXA 4MVBD 3WNIA 3CK5A 2PPCA 3ZZ1A 4DF2A 1CICD 5JIIA 1QFPA 5I8KH 3U7YL 4IMFA 1FL5B 5CBEA 3UPCA 4G8AC 4QROA 3QFDB 2Y6ZA 4BKTC 1G9MH 3PZTA 3TFCA 2AQOA 4ZFOB 4UYPA 3GU2A 4PMXA 3WNKA 4ZBJA 4UQ3A 4EI0A 3QEUB 1U2CA 1CS6A 4OJDH 4A1RA 1VBUA 3W7KA 2KERA 3EYFB 4AC1X 5I1LB 3JUGA 1J0KA 3MQIA 1M7IA 3QJHB 1FVDB 5F0MB 4TO8A 4LS1A 2OT1A 4BDVA 2FZMA 2ENJA 2V9QA 4V33A 3IFLL 3RY5A 2A74B 3B2UC 4MNGA 3VUSA 4LLMB 3LH9A 4P5TC 4Q8PA 1FNAA 3OVRA 1WITA 4KHXH 1L0PA 5A6BA 5KBMA 3CFIC 1JJKA 4GVGA 4AK2A 2Z31A 2Z4QA 3STZB 3V35A 4G43B 1ZT7A 2BK8A 3CH1B 4EN3D 3K8LA 5HHME 4X5QA 3VOCA 2PD9A 5I6NA 5IFJB 2V7NB 1W32A 4OLZL 2J7CA 3BWAA 4F2UA 1I75A 3HGJA 3LBOA 3OQ3B 1GQLA 2ZA2A 3WFDL 3WDIA 1ONXA 1HZKA 4YDZA 4PLKC 4HMDA 3RILA 1VYRA 5D6DC 1YAZA 4UT9H 1AD1A 4Z1PA 4P2QB 2MKWA 3R8QA 1SF3A 4N2FA 1TTFA 3TEWA 4JTLA 4W7VA 4PMVA 3CSTA 3R0DA 5SWSA 1N5YH 2HJFA 4GWEA 2HFEB 4XMLL 3H9HB 1TPFA 4A37A 1AGDB 5H6HA 3NEOA 2F6AA 2M26A 1H09A 3QDMB 3GSUB 5ISZA 1E5BA 2I60L 4XP9H 1M57B 3H85A 3HAEH 5EIVA 1FGVL 2ZSWB 4J12A 4A3RA 3WH7A 1TIMA 1JG9A 2CA3A 4IJBA 5EA0L 1PE1A 4MTVA 1ITQA 1HWHB 4KVNH 4IEFA 4BZYA 1UUQA 3QDGB 4WU5B 1WA3A 3LNIA 2EYTA 3GD6A 1ZP3A 3ARGD 3T2PA 4EI6B 3HPJA 4WUUA 4FNLL 1PEWA 1LDCA 3UH8A 2R69H 4UNUA 5C92A 1XF2A 2HJPA 3WLMA 3EXSA 1TZGL 4N7QA 3ZKSD 1D7FA 1AW5A 3IJHA 4TUKL 1D5ZB 2FZ3B 4XBGA 4JQVC 4XT1C 1T7YA 1PG7L 2CZVA 4FB7A 5DZAA 4F1ZA 2PXYD 1N64L 2QCFA 1T5WA 4JCLA 4HUCA 4E2OA 2BNQD 2ZWYA 1KPVB 3KRSA 3RM8A 4G8IA 3V0FA 4ERGA 2H2PC 4BHUI 4HVBA 5F72S 3FT4B 4D0BB 4AYDC 4IBUA 3RWDB 2Z6JA 5HHVL 5C0CD 5JOEA 3VI4A 4MWAA 4XOBA 2DQFA 2GJ6D 2Z1WA 4ELMA 1N59B 2EDTA 2BVQB 4HT1L 3DPBA 1SO6A 1YQVL 1E50A 3BPLC 2Z7KA 3FH5A 1CFQB 1KM4A 1AACA 2VP8A 4YDIH 1UWGL 5ANHA 2A3EA 3OMIB 3FB6A 4NRYB 7FABH 3V10A 4Y4FB 3V0WH 1LM8V 4PAZA 1JL8A 2PCPB 1C90A 3DOIA 3WGUB 4IRZA 3F5WA 5LVEA 2Z1KA 1EXUA 3W39A 3FCGA 1EPVA 5KINA 1PEZA 5C54A 4NQED 5JR1L 2IDCA 3PZGA 4FG6D 1G7UA 4DF1A 3UY7A 1C5BH 2DORA 1G0YR 2NX5B 5HHNB 4UTAL 2VABB 3UFIA 5FYKH 1P7QD 2APWA 3STFA 1LT8A 3LS4L 1DQLL 2NYYC 2WXIA 1RZJL 2Z1BA 5IWLA 1UA7A 1TQSA 2FZ9A 1WIPA 5C7HA 4IICA 2CESA 1ZSHA 4LUSA 3LKNB 3RWJB 2NZ9C 1RV8A 4TOYL 2ATPB 1HJBC 5KZEA 4MJZA 3T77A 1NCNA 2BFGA 5JMUA 4YPGB 1AP2A 1V8HA 4ZE5A 2IGTA 3L08A 1DN2A 2Z8WC 4MB5A 4KGLA 4WI9A 3VD5A 5CC3A 1KYOJ 1GGOA 3W38A 1THCA 1DO6A 4HETA 1YEGH 5I5MA 1D3HA 1IVLA 1R34A 2XTJD 3M07A 4WJ5A 2DMHA 2DD8L 4A04A 4GSDH 1P69B 3CLFL 3FTVA 3QF0A 4UC5A 4PJAA 4N20A 4OD3H 2XWBB 1RY8A 2YEVB 2DW5A 4XVSL 2A85A 1QLRA 1YQ2A 2WWNA 2VMJA 4TUOA 3EOBA 2H5UA 1PDKB 2VXNA 3I7RA 1TQCB 5FO9A 4M03A 4EQ3A 1KFCA 1JK8B 1V02E 5E5LA 4L9LB 3NRPA 4TQEH 4D9QD 1TTCA 1A6VL 1JI2A 4HS3A 3PR2A 4WKZB 4QXTB 4X22A 1XGUA 1DVJA 4HD9A 1BYBA 1A6PA 4QLJA 3MJ7A 4MHHG 4PBDA 5EO9B 5C0EB 4JGDA 1I85C 3TF4A 4NQXA 2X0HA 3HRZB 4KRPD 5HGHB 4Z7VB 3IU3B 2DZEA 1LD9B 4KUCD 3UAAA 1ME9A 4PG2C 1MHPH 3VD3A 5FYJD 2Z29A 4Z23A 4YDNA 5JOPD 3GC4A 1CFNA 4WDUA 3MZGB 2VOMA 4BGDA 3FT2B 1YPZA 2BERA 1OK6A 4QTIL 5C6TL 4AYBA 2AI0H 4DWSD 2IJ0C 4KROB 1CW2A 1NFAA 3QWRA 2OK0H 3R1GL 2BOEX 1K70A 2XZ9A 3FB5A 4ZMAT 1NMAH 3FYYA 4M1CD 2OLSA 2V2WA 1RD5A 2R8WA 4GJ1A 1P0SE 3E0VA 3P84A 2JCCB 1E9QB 1IAMA 3L4XA 1TE6A 5IP4A 5CPNA 1IM9A 1GCYA 5DRNB 4ZUWB 2VQ1B 2YZ1A 2YMTA 3SDCC 4QRUA 3PGCA 4ZUVB 2IDFA 4DYEA 5C08E 5BVJA 3NJMA 4XNXL 4WHTA 2GTZB 2AQ2A 2ZP0T 4Q8BA 4POYA 3DC8A 3VRJA 4ANXA 2A73B 3DRQA 2JGQA 2CLPA 3UZWA 4OFYA 5C0DA 3S35H 4L8SA 4UM8A 2PLCA 4FKEA 4DERA 2F6UA 3N12A 1EEZA 4W7UA 4LHUA 2NT0A 2BXZA 4JKWA 3ULUH 5LNVA 4O8RA 1GHFL 1ZAJA 1EJOL 5K69A 3DX0A 2QCLA 1AC0A 2Y8UA 4LL4A 2WBGA 4NX5A 3MRGA 4B9JA 3I75A 4E3VA 3R8GA 1ZL1A 2ZUYA 5ADOH 5FDWB 1P6CA 5DJ8A 1YYLL 3RFZC 2JKLA 3N3TA 3BLEA 3N40F 1CT8B 4WI8A 1QATA 4S3JA 3HE7B 4NI3A 1MAKA 1QCWA 2OMTA 2R1LA 1JWUB 4GNVA 4CSPA 5GGSB 3BXWA 1W1PA 3CPUA 4N25A 5TIMA 5C07D 2ESCA 3IAQA 5HDOA 2Q3AA 3FRPG 4XNUH 2K70A 4AM0B 5DYFA 1OW0A 4MX7B 5DCDA 1ZQ5A 1S7RA 3Q7JA 4JE4B 1U58B 1RAKA 4WF7A 3MFFA 2C1IA 2AEPH 3FRUA 5GGUA 1TRDA 2A9NL 4DPBX 4NSKA 5CNHA 2FDBP 3PABB 3I2CL 3A0OA 1QBAA 3S3JA 1ID5I 1QRNA 1RJPA 1YW1A 4U1JA 1UP2A 5DQ9B 1HCFX 4AQAB 2A79A 2GUYA 4JIHA 2FYYA 1T0PB 4O58H 3HG3A 2VKZG 1PKQE 3L5WB 4KBPA 1QWHA 5DMKB 3LYEA 3HNSH 4RX4D 4DLFA 1K8ZA 1WAWA 4WO0A 1CJYA 1N0LA 3OB8A 4AUYA 1BM7A 1HQ4B 5BXFA 4FXSA 5IW1B 2PF6A 4YQXL 4URKA 2JFEX 1DSYA 2PO6B 2VDRL 5KVEH 4YHLL 1FO0B 1UCBH 2HE5A 4JG1H 4L1GA 2JELL 4BWWA 4YHPA 3NIYA 4M8UA 5I66B 3VXUA 4PL1A 2PZ0A 3VOJA 1ENUA 4BWLC 4MB3A 4F8QA 1C93A 4D3CH 3BARA 5C0BE 4PCPA 3O4LE 5DVMA 4ODTH 2Q3XA 1MAJA 4S1RL 4OY9A 2ZXDA 3VI4F 3BWZA 5HGBA 2DIKA 4A8IA 2UWEE 2B77A 3G04B 1B4LA 2VZVA 4K7FA 4A7TA 5CEXA 4ELMF 4H4IA 4W86A 5DK0A 1RY0A 2G5RA 3AREB 3US1A 3VFTB 2R27A 2CCLA 4XXWC 2PTYA 5D2LE 3Q2LA 4DVBB 2X4QA 4GUHA 1E9YB 3BP7A 3TR9A 2XYCA 1ZV9A 3T0DA 4PJ9D 1FKXA 1R5IB 1XC4A 1F4XL 3EOLA 4GRLB 4WY0F 3QAZB 2YD6A 4GGHA 1ZEAH 1CB4A 1IIIA 2N7BA 4APQA 4AUUA 1IIKA 2NT1A 1PKNA 5L2KE 1FXPA 4JRLA 4NBZB 5JPMB 3L6FB 3W6MA 4LCYA 1S9KC 4NN5C 1BCIA 4X6DA 4ENED 4F15B 2RGLA 3EIFA 2K7QA 3PWLA 1D3CA 5DRIA 4G3YH 3TN6A 1P5VA 4GG6E 1NANI 4UFIA 3QW9A 1MFUA 2AXFB 2PF0A 4AZ5A 2MTPA 2J71A 1FHNA 5GSRA 2GJXA 2QJJA 2WBXA 9CGTA 3JV4B 1GY1A 4C56D 4YSPA 3O6KH 5TFSL 3K0WA 1A5BA 1ZMYA 2IMMA 4OHQA 1GQKA 3IYLW 4WJEA 4PP2A 1X39A 2BHYA 2BZNA 3MRJA 3L21A 3KPOB 4DJDC 1VZHA 2WO5A 5JDSA 5I0XA 3C08H 2MHAA 4XWGH 3QQXA 4GW5A 4RDVA 3AXHA 1VEPA 2CLHA 3VACA 4HA4A 1BTMA 3ULVH 1BAWA 3HC3L 1MCOL 2WVUA 3C2OA 1ICPA 4GKNB 4WJG3 4Q8MA 3CIQA 3NZGA 2G4EA 1TT6A 4MVAA 4C65A 2NZIA 3O45B 5E99H 1VJSA 3V0DA 4L5FL 1RSYA 5DU7A 3N55A 1HJWA 1X1ZA 1SOXA 3GRWH 1KM3A 3WMQA 3IAPA 3SGJC 2XU2A 4M24A 4AK1A 1JXDA 4P5SA 3DROA 4TLUA 5C6PB 4L4VA 2XKNA 3GSWA 3HC4H 1KWKA 2ZCKL 4RPQA 4XWOC 1WUZA 2XETA 4QRFA 2JJVA 4AYGA 3NM1A 3BOFA 1HX0A 4W5ZA 2HVBA 3GMMB 2MPAL 3RY6A 4KIEA 5C9WA 1BDYA 3ALXA 4GFSA 1NIUA 3BQUA 1Z41A 4WZ9A 2H8ZA 4UILL 3OJGA 4LVFA 4LTSA 1L6PA 3FTYA 4IBWA 1IBHA 3CHEA 4LLUB 2GSIA 2HT3C 3K72B 5HI3C 2AJSH 3V8OA 3FV9A 2YFNA 4GRWE 2H6RA 3FCTA 3RXZA 3LENA 1HH6A 4UT7H 3QZEA 4DN3L 4ILDA 5M03A 4ZFGH 4H41A 2R94A 4FNQA 3UYPA 5IQLA 1T1YA 1UWEL 3MRHB 1HKVA 1I9RH 1IBFA 5IVZB 4Z2JA 1V51A 1JS4A 1D9KA 2E40A 1E4XI 3KPQB 5AOIA 3WQ8A 2GQ9A 3H2PA 5DHYA 4AWUA 3I10A 3WLNA 2INEA 4NJIA 4XSMA 3WMPA 1QTWA 3BSGA 2A5HA 5ICUA 2KLRA 2E5DA 5BMFH 2J4GA 3HE6D 3VKCA 1B2WH 3BTNA 3OXSB 2ACUA 4W85A 4IFOA 1YNYA 4X99B 2UY3A 2B0SL 2ALDA 1JF1B 4RNRA 4RW5A 1TYEB 3ZKQD 3HCVA 1F42A 3D4YA 1L3NA 1KFKA 2DQCL 3ARWA 3FPYA 1X9UA 3SO7A 5FV1L 3U0TB 1BFTA 3FU9A 2D7OA 1EH9A 3IGXA 4XX1G 5D9MA 1GW1A 5EMLA 3F4VA 4KI5C 4G8EB 4BJLA 1NWTA 3R58A 2JKIS 3DRTA 4U6VH 3WHXB 2ATKB 3ARZA 3D39B 2QIIA 1KLUA 4NRXB 1I82A 1JUFA 4MFEA 3TBSA 3TYGL 4OF7A 3B9NA 1OCWH 3P4MB 4MYWB 1W37A 5EU3B 4ELDA 3TO4A 4Z18A 1X6UA 4JIQA 4KY1H 2X3BA 4NSBA 1UW9A 4NNPL 2MSPA 4L4JA 5TF1L 3TA6A 1UQSA 4YSOA 4XZUA 1XAKA 1TNMA 3K2UH 1IT0A 5HNTA 2K1MA 1T41A 4X9YA 2R0ZL 3BD5A 3NFSH 4DK6A 4G9FA 1PY4A 3H9SD 1Q3NA 6XIAA 4MNLA 4QRAA 4RKAA 3QDHA 2VITB 4S3BA 3C61A 1HIMH 1F3XA 4I1PA 4DWDA 2LTQC 4EEEA 4O8AA 3SBFA 2VSMB 1H5BB 3EDJA 5FA5A 1JPHA 4UV4L 1NGQL 3WE6A 3I6GB 4NZ4A 2GITB 3UADA 1AMYA 5FGCE 3MV7B 5I8CB 4MDPA 2WXKA 1UR9A 3N29A 4YFLI 4QY8B 1TVPA 2ZXAA 5BRBA 1E8WA 3WFHA 4P7OA 2L3BA 3S5LA 2QDWA 3W1LA 5M95B 4A38A 3V0JA 4XGZB 4U2ZA 4LOFA 4JZJB 3IGFA 3GEFA 4X7CC 3TEZA 4FQQA 2APBA 3VXMD 3VD2A 5K33A 3FMGL 4HIIB 4HDIA 5EFIB 1ED3A 5HSFA 3NR0A 2DZSA 1C1EH 2X4SA 4MJID 3IGKA 3QYCA 3HIJA 4GYPC 2HVOA 1E0OB 2J6XA 1YY8B 1RZIA 1EVTC 1ANUA 3RWIB 3NPUA 1KCUH 4JXCA 3X1GA 1TWIA 1X97A 4C5YA 4YDMA 4YXHL 2B16A 5DR5H 3IEAA 4CVZA 3C5JB 4X4YB 4JO1L 2ADYA 1KTKE 1QUNB 1ACCA 2X1QA 4YHZH 4RGNC 4LSVL 4F2FA 4KT2A 1L0XA 1B3IA 4O17A 3C6LC 2BNUB 3SCMB 2MOVA 2JK5B 4HSAC 4YDVA 3RI5K 3QRHA 3W87A 3ARXA 3RVXC 1FLRH 1J7VR 4R53A 2A9AA 4XAKD 2XY2A 3OODA 3ZFHA 4UYQA 4ZUUA 3DTUB 4UMBA 1LO5A 1KENH 4F7EA 3S96B 3GUGA 2NLJA 1SYVB 2LE9A 4HFUL 2YPKB 1YMMD 1G6RA 1J8HE 4C4UA 1A7BA 4I6KA 4IJ3B 4R2GC 2CBMA 2ZUMA 4KWOA 3S2JA 2AAVA 4PGBB 2V7HB 4LT7A 2VGFA 4AZ7A 3T6VA 3PULA 1EXBA 1YY9C 3HS0A 3RGBA 5T33L 4AIUA 1M68A 4LPXA 5GZOD 4F92B 2A1YA 3FOLA 1TTQA 2X38A 1U8QA 2CM5A 4RE2A 3E8VA 3QCVL 5EN2B 5FB8A 2B15A 4ZQNA 3G5VA 2QQLL 1H5VA 4LVGA 3UETA 1IGJA 1O5PA 2C3XA 4C1NA 2ZZ2A 1MAML 2Y5QA 3L4UA 2A9ML 1VLWA 4F7PB 3H42H 3OAUH 4N22A 2HZGA 2J57A 1BFOA 1VPOL 4Z95H 4M93B 3MN8A 2QHRH 4BCXA 4GJIA 3QORB 1ZGLA 2DDQL 3FTXA 4X83A 3VIPA 1FAIH 1AD9A 3BAJA 3P54A 5E56A 3E2QA 2PCEA 4PUDA 2G96A 4IOFC 1I8MA 3N91A 2ZE0A 2P80A 4K3DH 3T42A 4A63A 1NDGB 5LIWX 3O3AB 5KVDH 1NBZA 3QDAA 1Z44A 2YD1A 5FF0A 1AZ1A 2LLLA 1W3HA 4OJCA 3HF3A 1JPGA 1RURL 3TH6A 5IHWA 4FQCH 2BZ7A 1JPDX 4PJFA 1KR1A 1Z9SB 1JFXA 1KNOA 1QZ1A 2WSPA 1YMHB 3HUJF 4J3OH 1R24A 3OBAA 5IMOA 5ETUA 1FWDC 3VJ6A 3VGBA 5HVHB 4OCWH 5KVFH 3UTOA 4FABH 3S2MA 3P02A 5E08H 3QFJB 2C9RA 2VEKA 3NIDB 5E4EC 3T0EA 1KCBA 3DJ9A 5DC9B 5KAQG 1XBYA 2J21A 2YAMA 4NJ9L 3FT3A 2OMZA 3HLKA 2J7FA 1ZANL 1UZ6F 4JFOB 3L5LA 2PWUA 2JEQA 4MSWB 4H26A 4ZZ9A 1W80A 1BVKA 2PWFA 4NHUB 2RCSH 3JWNH 3W1MA 3QEGL 5DMMA 4EI5B 4NWTL 1UKSA 2XQ0A 2HP4A 2CRYA 2QL1A 4QHUB 5BMXA 3QIBC 3UTZB 3R8HA 1A7RH 4XNMB 4KOCA 3ABKB 3BGFC 1BVNP 2DYPB 3W1XA 4YIQA 4X6CA 2PC4A 2QV2A 4YH6A 2C16A 4HS8L 2ZRWA 4LYKA 1B0IA 3VO0A 2WXRA 2TYSA 4BI6A 3TSMA 3P0XA 2ENPA 3RKPA 1TJXA 5DMYA 2EE9A 1AJ7L 5BV7H 1UVQA 3ILQC 3EYUL 4LSRL 3MKCA 1TPEA 5LNDA 5D93C 3LI1A 1U2YA 4NZRL 2R9HC 4YL9A 5I00A 4TLTA 2O5YL 2Q6WA 3ZKND 4UWQB 1IQDB 2H1PH 3NT0A 1JD7A 3L3HB 3L16A 4M29A 1VC4A 2W9EH 2C0AA 1AK5A 4YFDB 1EGJA 3IVKB 3A4FA 4FFYA 1R3IL 3LM3A 4KUZL 4YTQA 3U57A 4GG8B 4P48A 1X44A 1FYTB 5G5IA 5A3ID 1MRAA 3FUMA 3LRLA 1SW0A 1EO8H 5F88B 2DKUA 2KZ1B 3U82B 4UM9D 3VFOB 4Q8QA 2X9XA 4QRBA 4ONGH 2GVEA 4OZGB 4O5LL 1R3HB 2V5TA 3W71A 2IXQB 1KPRB 1VF8A 2FFIA 4RAVA 2ICEA 1KBJA 1XG3A 5BO1L 4BFFA 3O6FA 3KPTA 2PYFA 1H3VA 3F7PC 3ATZA 5D7IA 3K1KC 4MJ4A 1W1B1 1PZUB 1EJTC 5C0AA 4F2ME 3HO8A 3HR6A 4OCRL 3N9SA 3CN0A 3SGGA 2IPUG 4Y9GA 1HI6B 5L8LB 1S2TA 1G6RL 3HPFA 3K6SB 4M1BA 1DVFB 1E55A 2WMGA 5FSEC 5J3HC 4CSZA 1FNHA 3LS5H 3KJ6L 2P47B 1FN4B 1FY6A 2DZPA 3GS7A 3SKMB 1X96A 2BVTA 3ESPA 4UDUA 1PSKL 4FYQA 5TQ0H 3HIZA 3PQYB 5K9OB 4KMLB 1T6BX 3OZPA 4WK4B 4XTRD 1Y65A 1OWWA 5DJAA 2FL5B 3BVTA 4BH8B 2NWSA 1OTUC 4MJ6B 2W4XA 3QZNA 4JS7A 3CQ0A 4HUMB 4A3QA 1D7CA 3BV4A 2QQ6A 2H8XA 3QJOA 4Z5RB 4JFDA 3GKAA 5H2BA 1LJYA 2RUSA 3NURA 2BOGX 3CGTA 4L9YA 2XNAB 1LL4A 2HWGA 5L6UA 4HXAH 4ZB2A 1SDAB 1H0DB 3MUIA 5FF6B 4NYLB 4X8XA 1W5OA 2R1YA 2ODHA 5CSBA 3D2UA 4ZAKA 4K23H 4PBGA 3EX3A 3RMJA 1R2RA 4FEZA 3ITYA 3LQAH 4W6YB 3NL5A 6ALDA 4E4UA 3M7FB 5B8CC 2RGMA 2PCQA 3SDXE 5DGRA 1CN4A 1E7VA 4YLCA 5B21A 4C58B 3ARFA 1T89C 2OGYA 4KKPA 4IS6B 4QMEA 4GY7A 4XO8A 2Q01A 4EXAA 2C14A 2G30A 3ZT6A 2QMJA 3HMXL 4FZ8H 3NTCH 1FDYA 4KEVA 4ERSH 1I7UB 4RXGA 3SDAC 2WOYA 1SEQH 2QQKH 2EE0A 3UG8A 3IK4A 1A9BA 4D94A 5IOKA 4NUGL 5L4IA 3U9PL 3F7LA 3K81A 3QV6A 2A6JB 4NM8H 1Z3GL 2Z0BA 1FWEC 4BI5A 2YAHA 3V0VB 4PUBL 2FZ8A 4AD1A 1OQOA 5D8WA 4E8DA 2J8HA 3T0VA 2IQTA 3H7UA 2ZRUA 2F8XC 4PWHA 4KMTH 4KETA 5ID1A 3V36A 2ESVD 1Y0EA 1TR9A 4B6ZA 2G75A 4W9IC 3J07A 3RCMA 3WIHH 4G70B 4S2SB 4MMYB 4HQVA 4FMFA 3D2TA 2X4UB 2WJFA 2NY2C 3GHUA 2YS4A 1YYMH 1CG9B 2CLEA 1F6AB 3TXAA 1X7TA 2P5EB 1RVFH 1ZT4A 3CSFA 3MHGA 2YGYA 1P2CA 3FFOA 4Y8DC 3C60C 4LLVB 3WCYA 2DQXA 2N3JA 4MVBC 2GDUA 5CIPA 1CICC 2CJ3A 1JQXA 1LWJA 1FZMA 1Z7JA 4U1KB 3ZQWA 3CVBA 4P5RA 5AVSB 4RWHA 1CI1A 4ML9A 5I3JA 4HEME 3UJEA 3HZMB 3CWGA 4HOXA 1AODA 2XBTA 5HI4D 5JBFA 2XUCA 2Y89A 5G5DA 1AO7B 3I02A 3LCLA 3EJUA 1GGCL 3H3PL 4CC0A 3N85L 4LEOA 2PP1A 3MS8A 1R17A 4K94L 1BAFH 4UTUA 1A5FH 3MSYA 2I9TB 1HEZB 4XNBA 5JW4M 2OP4H 2R51A 4YN5A 4ZTPH 5C9KA 3BPWA 1I9JL 3UO1H 5D1QD 3WCZA 3CEPA 5BQDA 4MA8H 2B08A 1H15A 2AZAA 3SKJH 2H9AA 3EOOA 2WO3B 1UB6A 2CKBL 3MUY1 5TE6H 3BVNA 2EDMA 5I6XC 4X9IA 4PJBF 5FF3A 3RX9A 4EN3C 1TVBB 4PVNA 3VWKB 3BURA 2PKDA 2JIEA 2VW6A 1EP3A 1ESOA 4X60A 1N2VA 4GQBA 5I79A 3G1YA 2EC9T 5J5RA 1AQDB 3T4AA 3TQPA 1UWSA 5CC7A 4LBEA 4HALA 4NO0B 4Z6AT 3WL1A 5AC5A 1YXCA 1FNGB 5E5CA 3KPLA 5IOPB 4YK4C 3MJGX 2P8PA 4X6FA 3C8FA 4Y2DA 3VIJA 4HXBL 1H8NA 3DEQA 3MDJA 2IPKA 3EO0B 4I9TA 2QUNA 4FXGC 5I17A 5D71L 3TAKA 3DUGA 4LVBA 2WCAA 5J6SA 3NDOA 5MERA 2BB0A 3ABLB 1XH3A 4QHKJ 4K8HA 3CLMA 3WD3A 1RP9A 3WXWH 3MCMA 1DUZB 4YJ5A 2GYSA 5E5UB 4RZ6A 2EXOA 2IH3A 1XGRA 1RVGA 5ALBH 1IBYA 1FV1B 4TS6A 4M6VA 4D8PA 4NKQB 2EF9A 4PRAA 2XA3A 1B57A 4CGUB 5AKRA 1LE9B 2A6IB 2WMHA 4EJ1C 4X6CF 2PGEA 2FVNA 4FR6A 5BU6A 2R2HB 1F11B 5TE7H 3B97A 1LUCA 1SU5A 5A6KA 3FUEA 3GBNL 1J01A 2C13A 5KYUB 3ARGC 2WHLA 1E6ZA 3KBNA 1YO4A 4IFKA 3LN5A 2X0UA 5IBTH 4PB9H 4AENA 4R4BB 3CJJA 2NLYA 3N44F 1I7TB 2PXYC 2OU4A 5IKCA 3TNBA 3CLWA 2Z25A 2BVOB 1ZNNA 3BZEA 1K9EA 4ES9A 1TU2A 4UCFA 5BRZB 1FCGA 1NEZA 1WEJH 1XLEA 3HR5B 3KH4A 5HP5A 5J9PB 4FS9A 1WC7B 4WO4B 1NCIA 4LPWA 4WR3A 4JN2A 1DANT 2J6EA 2HWZH 4QS6A 4I3RH 2XXCB 2V9DA 4DZBA 3GFUA 4DWHA 5EFFA 1OB1B 5KANI 2VE6A 3O2DA 4NQTA 3IU4H 3MV8E 4AWTA 1NM4A 2A6KB 3GSRA 3X3GL 4OI8A 1N6QL 4B7LA 2RD0A 1XX9C 1PTAA 3CSBA 4ZENA 4A21A 1JCKA 5A6TC 3R18A 5D1ZB 3MUCA 2WZ5A 2D2HA 3S8FB 2XKSA 3MJ8A 3NRFA 2FKPA 2ZZ1A 1CXEA 3F7QA 4AH2A 3HNTL 2JLPA 3KXQA 3B5HA 4JEQA 1P84K 4FG6C 2P8BA 3DX9B 3O9WA 3LHYA 1YN7B 3FSAA 2WKLA 2YKLH 1NFBA 1ZIAA 3AXMA 2D31B 1DO5A 5L4FA 4W89A 3DYPA 4EIZC 1BXUA 3LLDA 4YGVA 2FGWH 2XQYK 1R2SA 3HFML 1I7ZB 4OLWL 12E8L 1FG2B 3GSOA 1T7XA 3ZYZA 4C47A 3S48A 3EBIA 1MDTA 4W1TA 4XOCA 3W1AA 1BIIA 4LCWA 1GKPA 3TA4D 4P2QD 1PU0A 4U1LA 1HL2A 5J12B 3C12A 4BZ2L 3RX7A 2XN9E 1DWGM 4ZB5A 3V0UA 4WI5A 5I6OA 1KCSL 4XC1L 5CILH 1DQML 3FBQA 3L3JA 4S1QH 1TR7A 2QDDA 4EDXA 5I1DA 3EEZA 4S3AA 3LKQB 3X14A 3PF3A 1W3LA 4XP4H 2XTJC 2LR4A 4JN8A 4OIBA 1MFCH 2WQUA 5E2TH 4H9MA 1DSWA 4YSDA 5EBMB 3WIFB 5M94B 4PTVA 1EXGA 1JNLL 2EIDA 5SWQA 4DUVA 1JV5A 4QRRA 4J8QA 3FN0H 4PZVA 1FUYA 2BBFA 2R29H 5CLYA 2H3KA 2HKFH 3QDGD 4WTWA 2Q1EA 4PHXA 4HJWA 3UYRH 1ZA3B 2BIMA 3TH4T 2ZVIA 1NGPL 1HJUA 5IW3A 4AX6A 4MA3A 3TJLA 2DW6A 1F56A 3KS5A 4F7MA 1MLBB 4DELA 6XIMA 4K7VA 1VP5A 6PTDA 4UCGA 1XGYL 3CMFA 2WKGA 1VPXA 1DN0B 2BXVA 1E9IA 3BE7A 1I3GL 4KRPC 5ICXB 2OI9C 4XUYA 1ELSA 4RGMB 2WZPA 3B4NA 1R0AL 5DT1H 3UC0H 1N8ZB 3QHFH 4GXWA 2FATH 4GUFA 3EGSB 3UF9A 3SE3C 4WENB 3PLYA 4X80H 2XV6B 1BG9A 4G6ML 3PUCA 2JJWA 2GIXA 1NDZA 3B2VL 4L18A 2F38A 4IMEA 2WSYA 3QPZA 3LZFH 3EFOB 3WLWD 4PJGF 3VFRB 4V2CB 4HKXB 3KZPA 3M5ZA 5U7SA 3SCPA 2E6AA 2IUZA 1T5XB 3W7RA 4K5MA 2Y85A 2DKMA 4DWSC 2VDGA 4RDQF 2ZOKA 4Z7UE 3L3OA 1HSAA 1YPXA 3GGWA 4H7ZA 1GA2A 2UY4A 3AS3A 1CQYA 3S4TA 3TBCA 1DIDA 2AVGA 2NUWA 4M1CC 1V0MA 5E1AB 3JZ7A 4F9DA 5CMAA 1XR9B 5I15L 2QVMA 4Y4FD 2FBOJ 5DZLA 2P7TB 3PWNB 4Q4PA 4ATDA 3QKZA 4PY8I 1F13A 2NW2A 5DO8A 1HH9A 4LVEA 5C8JB 1OD7A 1GVOA 3VDGA 5AC4A 4M62H 3B8VA 1FJ1A 3LMJH 1EWEA 4LFHD 3DXIA 5DQJA 2X2IA 4J4PA 4TVSa 2NX5D 3OHIA 3DVGB 2G5UA 2PWDA 3QEZA 3MGOA 4ZS7L 2NQ5A 1UA3A 2OV0A 4HFWB 4F8NA 3FO0H 1CLKA 5E95B 3PY2A 3CDFA 2IDSA 5FHAL 1DTNA 3CX5J 1PHWA 5D1XE 5E8PA 5JA9A 3M6DA 3NL3A 1UIPA 1HZYA 2CDEA 1XWYA 4Y5VA 4GABA 1S2VA 1AXTH 1VFLA 5DD5H 4NPYB 2I85A 3MCG1 3MDWA 5A6JA 1FYHB 3NM3A 5LGYA 5MEOB 4WY0A 1LROA 3A6BH 3AMGA 3REQB 1Z5LB 4ZOBA 1CD8A 3BLFA 4CUCA 5DD6A 5SV3A 4YSCA 2A9CA 2IH9A 1FORH 3AZRA 1W72A 2DTML 3CUJA 3SPGA 2H6UA 3ZMNA 3NCFB 4DQOL 4C1KA 1GXEA 3IRCA 2V5DA 3G3DA 1T04A 2VR2A 1AYOA 3GJEA 3W57A 4OZ4A 1E4JA 1I1XA 5AFAA 3WS6C 1EAPA 4UZGA 1S7UB 1I1RA 1G6CA 1IGFH 3T6XA 3FB8A 4F7TA 4IMAA 2RHEA 2ITCB 2Y2YA 2DT3A 1BYOA 3RHGA 3NABL 3L7EA 3W86A 4Y2OA 4ZTOH 4C57C 4LF2A 4APXA 1RV6X 4TSBL 2UV3A 4JO8A 3S88H 3AB0B 1PZBA 4JBSA 1K6QL 1ET7A 2YARA 2VDNH 4UTTA 5JHDB 4ZG1A 2DVXA 1Y5XA 4S2CA 2YD9A 3SSGA 2VDMH 4E41A 3GMLB 5GGTH 4DYJA 2OSWA 2BVPA 1B0GB 2Y07L 1UYWL 4R7DA 2W95A 1EZVY 4BSVB 5I9QC 1R2TA 1DJIA 1DHPA 4RMRA 5F7DA 4JY9A 4FNRA 2J9ZA 2OKMA 4R3SA 3IDNA 2J4WH 1U8KB 5HHQB 3DENA 4NFBA 4YXLL 3UIYA 1KM6A 5JUEL 3IETA 3VYOA 2A77L 3R4IA 3MVSA 3A23A 4GVFA 2ZX8A 1O7DE 1S9VB 4KROD 4PJCE 5AOKA 2JQXA 1OCNA 3TT3L 4OKVA 3UJIL 2CBJA 1A1MB 4HHHA 1WAAF 5B1CA 4PJ9C 3INUL 3A64A 1MQRA 1A7PH 4NWUL 3SJVB 4DTGL 4R7LA 5DMIH 3OWEA 2FNBA 3T8QA 5IRPA 4G8FB 1SHMA 3K2GA 1RCXB 4RZCA 2BGSA 3VGEA 3MRDA 4ALAH 4NJGA 3MRPA 4JO4L 2NNXA 1ERNA 4DQWA 5B38A 4WFFD 5ERWB 3KOFA 3NJGA 2AV7B 2J8UE 2CSPA 2VH5H 2Q20A 4ENEC 3BC9A 4YWSA 3I6KB 3QJUB 1D6EB 1JPIA 3UZEA 2EE3A 1C8XA 3BW4A 3NSYA 4PJXE 3IAGC 4B5EA 4H8QA 1SXZA 3E2HB 3UWVA 2PGWA 3TYFB 4BKSC 5E6ZA 1PZSA 3BAEL 3HKFA 5DS8B 1INDL 3LHTA 1BYCA 4H1LB 3HLAB 2P24B 1NWPA 3IJ6A 1RP8A 1W6TA 1TQBB 4ELKB 1DJYA 5HYJA 4JLRA 5AVQB 4JR9H 1P7BA 3M64A 3Q6GH 5I0YA 3TIEB 3D0AA 1U91B 5CGQA 3HE7D 2N0KA 1UGKA 1JZFA 3WFBL 4DCQA 1XM3A 3K2KA 2LU4A 5D4YA 3EJJX 1H61A 3SB3A 1U93A 3KZ8A 1EP1A 1MCEA 4MZRA 4F9LA 4UNIA 4HS6B 5F6HJ 1AGEB 4M4RA 2X4TA 4LHJB 3OGCB 5EEVA 1IGSA 4GBXB 4KNQA 4GAYB 5LBSH 3T44A 5IQMA 3ITCA 1CGVA 5HYQB 1UWQA 1D5IH 4K07A 4Y5YC 4KAQH 5F7FA 3GQYA 4MA7L 2DQUL 1KXQA 1HO4A 1AY1L