1OSEA

Porcine pancreatic alpha-amylase complexed with acarbose
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of pig pancreatic alpha-amylase isoenzyme II, in complex with the carbohydrate inhibitor acarbose.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PORCINE ALPHA-AMYLASE
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1oseA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1oseA01
3PHAA 1ISWA 2V3DA 3EJRA 1T0OA 3BVXA 3BMVA 3GTNA 1P6WA 1D3CA 1HKJA 4XUYA 3MV11 1NOUA 3DX0A 3L2MA 5D9PA 2OSXA 3OA5A 1ESWA 2GJRA 2OWWA 3F5KA 4HTYA 3ZJKA 2XWDA 2YKKA 4M29A 5CSUA 1V3LA 4FNUA 2WAGA 4J27A 1GONA 3VGFA 3UEQA 4HOZA 4Q22A 1CTNA 1O6IA 4DO5A 1NQ6A 1UKOA 3WNMA 4F66A 4W7WA 5C71A 4OGZA 1WZMA 1E73M 1QI0A 4Z2JA 3CUHA 3ZO9A 1JXJA 1TE1A 3A5VA 3LPGA 1GORA 4E4PA 3II1A 3S2CA 1C8YA 2WMKA 2WSKA 2X2IA 1TVPA 3NJ3A 4FK9A 1V0NA 1M04A 1QNRA 1QBBA 3IAQA 3D5HA 1ITXA 2JEPA 2EPLX 4CCDA 4OOUA 2CKRA 1TQUA 1PBGA 2GK1A 1G1YA 2O9OA 3WNOA 2ZUSA 5D8ZA 4PMZA 3A23A 1M53A 3VX0A 3WF3A 1UWIA 3S6TA 3WH8A 3BH4A 4BCEA 4KGLA 3WEZA 4URIA 5CPSA 3FW6A 3RDKA 1XH0A 2YFOA 3L4ZA 3D52A 2J77A 2D0HA 1CPUA 2VX4A 1QW8A 2PWFA 4JFVA 4N0RA 1H0IA 4MB5A 4WF7A 3K8MA 1JYWA 4E8CA 2F2HA 2QMKA 2EJ1A 5FKYA 3OZPA 4PMRA 3HG3A 4KH2A 2J78A 4JFUA 1IZKA 4DUWA 1WCGA 2XFFA 4ATDA 1HVQA 2J7HA 2OW6A 3DC0A 5DT5A 4H8HA 1JDDA 1JZ5A 2YLLA 2DIJA 2YFNA 2O9PA 1E55A 3GH4A 3AMKA 2G41A 3PZUA 5A6LA 5I0DA 3AXXA 5IFPA 4J3TA 4Q7NA 2AOSA 5TD4A 3FHQA 3MV01 1WKYA 3D50A 3KL0A 2OSYA 3GXFA 3CZNA 7TAAA 1HJSA 4PCTA 2BV9A 3F4VA 1FOBA 2WMIA 3OLIA 3PZ9A 5GNXA 1OCQA 3U7BA 4AEFA 2DT0A 4DUVA 1NP2A 1CXHA 1LWJA 2PBGA 1W3KA 1TQWA 4UCFA 4KWUA 2VQUA 2PI6A 4P7OA 3W82A 1QOXA 3NYDA 3WDRA 3A24A 1YHTA 1J01A 3K4DA 3M46A 2BXYA 3ARYA 1J12A 2GK1B 1KQZA 4AD1A 4QCFA 2JF7A 2DH2A 3D4YA 1BG4A 3GH7A 3WQ6A 1ECEA 4W89A 1AQMA 1UR8A 4PTMA 3FY1A 3BCDA 1UWQA 4KRUA 4AIUA 5M3WA 1HKIA 1NM9A 1ISZA 2E3ZA 3W24A 1B3ZA 1FHDA 1AMYA 3VO0A 2J7CA 3GM8A 3AZRA 1F4HA 1J0JA 5A3HA 1KXVA 2ZUWA 3UETA 3WH7A 1JAEA 5JIPA 2QF8A 5HPCA 2CETA 1E56A 2F61A 2ALWA 3DYOA 3NSXA 1PX3A 5I6SA 3WH6A 4GI8A 1QPKA 2ZXDA 1NARA 3AMGA 5ABGA 1RPKA 3EJPA 1PEZA 2O92A 3VGGA 3AIEA 3K8LA 3VD5A 1ZBVA 1OBAA 4GO9A 4TXEA 4JCMA 3L4UA 3J7HA 4BQ3A 2WMGA 5HNNA 4M80A 1V03A 1UH2A 2G3MA 2VMFA 4Y7EA 4JKKA 6A3HA 2WCSA 3VX1A 2QPUA 1XCWA 3UG5A 5A94A 5AYIA 3W29A 1R33A 4AD5A 3U5UA 2XN0A 1JYXA 3K46A 3CZLA 4BS0A 4YHGA 3FXYA 1VIWA 3CHFA 4BQ5A 1E70M 2VVNA 2XJ7A 4B9YA 1PX4A 1GCYA 4PBGA 5A8PA 4AYSA 2G3NA 2YLAA 2VCCA 1UWUA 4K68A 3VDHA 2X8RA 2NT0A 2FHFA 5JIWA 1VB9A 5JBEA 3BVTA 3U7VA 4D71A 4XB3A 3CGTA 3KL3A 1GVYA 4R5EA 3NSNA 3F5JA 4HA1A 1R85A 1B0IA 4MNLA 3THDA 2DDXA 2D22A 3CH9A 1VENA 2D3LA 4ZXLA 2WWDA 1B3XA 4MDPA 1MW1A 2J62A 4XZWA 1SMDA 2CNCA 4BA0A 1XGZA 1G0CA 5EMYA 2ZICA 4N42A 4UFMA 3MUZ1 3SCPA 3LXCA 3GXDA 1TUXA 3WF1A 2DT2A 1JXKA 5D9OA 3HZ3A 2FHBA 1J0HA 2J7FA 2ZUTA 3N04A 1J0KA 3VTRA 3TTOA 3I3EA 1H3GA 4GQQA 4MB4A 1W2PA 1HNYA 2W5FA 3PZOA 1Q6EA 4A3YA 2GUYA 2WZEA 3ZM8A 1NOFA 3TOPA 4H41A 1KBBA 1WPCA 3B9DA 1E43A 1OB0A 4Z2IA 3MMDA 2XGBA 5CZKA 1E4IA 2YA1A 1QHZA 1R8LA 5A1AA 1XSJA 4PTXA 2OSWA 3SCWA 1G5AA 2OWXA 1V0LA 2D0FA 1VRXA 4PTVA 2VX7A 2D23A 2JIEA 3ARVA 1BPLB 3T2QA 2IXUA 3LPFA 1MQRA 4KRTA 3AIQA 3AISA 1WDPA 5A6BA 3WY3A 1KXTA 4BQ4A 2VZTA 2EPMX 2D3NA 2FGLA 4WSJA 3A4XA 4L4OA 1W3JA 3DHPA 3NCOA 1VAHA 3WIJA 2WC3A 3IAPA 4H7VA 4CN1A 2O9RA 4J3VA 2WKGA 1UR2A 2ESCA 4DWSD 2WLYA 2J74A 1NWRA 3VIHA 3BUQA 4MB1A 3WN6A 1TR1A 3PZNA 2BNJA 4CVUA 4TX8A 5JBFA 1ZJBA 4BZYA 2FHCA 2WW5A 2XSBA 2Z1SA 2QMJA 1W91A 2YJQA 4H8VA 1RH9A 1JDAA 1PJ9A 3N15A 4LGXA 1LLOA 2WNWA 1GQKA 1H09A 3BAIA 1V02A 2DSKA 1BGAA 3MMWA 2WZHA 2FYVA 4FLQA 3SUVA 4WIWA 1E1FA 1CXFA 2NW0A 1CGVA 5CLWA 3RM8A 1V6XA 4B3LA 2ZX8A 1JIBA 1M7XA 1ZBKA 1DEDA 4ZENA 5LYRA 4AYGA 1QWUA 1Q6CA 1UH4A 3GDBA 1QI4A 4WKFA 1J0YA 4DO4A 5A6SA 1V0MA 3SIMA 1H2JA 1KFWA 1UA7A 2PF0A 1UD4A 1XHGA 2GDUA 1OWQA 3HG5A 4WJXA 1HXJA 3CZSA 1EQCA 3THCA 4DO6A 2J7GA 2VURA 4J3XA 1EQPA 3DDFA 3W37A 1UH3A 4XZBA 1Q6DA 5BRPA 3CZEA 1UZ1A 2B31A 2HVMA 3SCNA 3L2LA 1RP8A 3WQWA 3CHDA 3WQ5A 2E9LA 1E15A 3A4AA 3KLKA 1EO5A 1WO2A 3D4ZA 3N18A 5E9AA 3AS3A 1KB3A 3LMYA 4PMNA 3W28A 2PWDA 1CZ1A 4W8LA 4MJ2A 5E70A 1E6SM 2FH6A 4ML4A 2YL6A 3UCQA 4GIAA 1TA3B 3MU7A 4EKJA 1C93A 2DEPA 5E6YA 4W84A 4U3AA 4DWSB 4F9DA 3ARRA 3BAXA 4D1IA 3AIRA 2F7QA 3K8KA 2EAEA 3VIFA 2DIEA 2VZVA 1UWRA 1QI2A 2XGIA 3KLLA 2GFTA 4S3JA 2GJXB 3OG2A 1QW9A 3N12A 1LWHA 4U2YA 3VNYA 5I24A 3A3HA 3AS0A 3DDGA 1WB0A 3WDPP 4X9YA 4D6DA 3VGBA 3VPLA 2BHZA 2UY5A 4GO8A 4CN6A 4FF5A 1Z32X 4MDOA 2HISA 3DYPA 2WXDM 3RPMA 4FLRA 2E8YA 1HVXA 1WDQA 1ISYA 1H49A 3AICA 5BWFA 2IGTA 4GQRA 4CCCA 4LYRA 4MPKA 2E9BA 3ZOAA 1V3MA 5A2AA 4ZE4A 4QLKA 2XVKA 3T09A 5CPQA 2WHJA 1DWIM 3CO4A 4AC1X 4CD6A 3AMLA 1V3HA 3BAYA 1JAKA 1XYFA 4TOQA 2X05A 3N17A 1CGWA 4LYQA 1E40A 1X6NA 4D6IA 2ZIDA 3ARTA 5CGTA 3AYRA 4BF7A 2NSXA 2PWEA 2XN2A 1QNQA 2W62A 3D51A 3A22A 2OYLA 3VM5A 3CV5A 1GQIA 2GDVA 2WM0A 1WDRA 4J3WA 2ZXAA 3LRLA 4AMCA 3WY4A 3VIMA 5GPRA 3OLGA 4HZ6A 4V28A 3WF2A 1E4MM 3NDYA 2F1BA 2X2HA 1KGXA 2IXVA 1ODZA 4AZCA 4D6GA 1E72M 5DT7A 3M6DA 4W85A 2QLYA 4JL1A 2W92A 3G6LA 4P7RA 1JI2A 3T08A 4YHEA 4CD4A 4OOZA 2PWHA 4UTFA 3A6OA 2WK2A 1K9DA 4WKAA 4D6EA 3AZSA 1O7AA 2EXOA 2GJXA 3KEHA 3KWXA 3WQ4A 3AFBA 3BSGA 4MNMA 2DSVA 3POHA 1NP0A 3ZMRA 3VMOA 2VRJA 3MSDA 5GNZA 2WMIB 3WF0A 3VILA 1J10A 1ZL1A 2F18A 3RMEA 3WFZA 5M17A 2E0PA 3VM7A 1V6WA 3QHOA 3ZR6A 5IHRA 1HJUA 2EEXA 4P7QA 3AXHA 3LPPA 1FP9A 4EK7A 3VGDA 1XSIA 1X1NA 1TQSA 1ZS2A 4FNPA 5FL1A 5DF0A 4OJYA 3S5YA 1QBAA 2XIIA 4P8UA 4WSKA 2XSAA 5CPTA 1HXKA 2GSJA 3WDHA 1EGZA 1V3KA 5HXMA 2JALA 4XV0A 3ZT6A 2CCRA 2XM2A 1UUQA 1TQTA 3AS1A 3CUFA 4ACZB 4LQ1A 3KE0A 1FHLA 1E4NA 1GQLA 3WDQA 4PMDA 4C7FA 1A3HA 2W63A 2EPNA 5A69A 3RJYA 3EDJA 2OWCA 4Z2HA 4AWEA 5C70A 4AD0A 1OGSA 5EBAA 1OINA 1CIUA 2CPUA 4M24A 4P7NA 1MFVA 1V6UA 2FGZA 3VIJA 3A47A 2XTKA 4PUEA 2XHYA 1KWKA 4NZFA 3OZOA 4UR9A 3QHNA 2VO5A 1ZBWA 4C7GA 4DWSA 5HDRA 2A3EA 4WK9A 1B31A 2V3FA 4ATWA 1MXGA 2BVYA 1J11A 2VZUA 1UR1A 1UZ4A 4A3HA 1H41A 2YBUA 3VDCA 2ZE0A 3HJEA 5ABEA 1FH9A 1UR4A 2J47A 5A8OA 2F8QA 1HF6A 2E9MA 4U3CA 2FE0A 1BLIA 4PMOA 3WD2A 3UG4A 2ZX9A 2ZUVA 4GZJA 4CU8A 1R34A 1SYTA 3LRKA 2JFEX 1JZ2A 1CBGA 1FFRA 3AQUA 4RE2A 2QPSA 1E4LA 4V27A 1W1PA 2XVGA 4W7UA 1JNEA 1CXEA 3HG2A 3GH5A 2ZWZA 4JFSA 2CBUA 3RIKA 1BHGA 2BXZA 5CLTA 4NI3A 2VC9A 5CGMA 1E6RA 1XD1A 3BVWA 4CD5A 2J7EA 1R86A 1BGGA 2CHOA 3G6MA 3ZJ6A 1HT6A 1UR9A 5AC5A 2DT3A 1LG2A 1HX0A 1TFVA 4MB3A 5FOOA 2AMGA 1E6QM 4DUXA 1DWFM 1W1YA 4B16A 3T2OA 5A6JA 3EDEA 3BAJA 4RE4A 2VNCA 1R7AA 2JIWA 4TVUA 2A3AA 3IANA 4W8BA 1CECA 4CN4A 3TTYA 3S5ZA 1C8QA 5D4YA 1D7FA 2RGLA 2YL8A 1TMQA 3ARPA 2VR4A 5ABHA 1QVBA 3ARZA 4FLOA 4JIEA 1HTYA 3OLEA 1W3HA 4EANA 1PIFA 2X0YA 1KXQA 1XD0A 1CNVA 2V3GA 4P8WA 1OGBA 3MSGA 3FAXA 2VQTA 2UWFA 1CXIA 2X0HA 3VSTA 1BAGA 1X6LA 3CC1A 4P7LA 1TZ7A 5CJ5A 4PMQA 4OZOA 3EDKA 1HJXA 1LL6A 3AMDA 1OT1A 1GNXA 5LA1A 4U5KA 2X09A 2IUZA 2WC4A 3VSUA 4H2CA 1UD6A 4U33A 3WY1A 5I5RA 3WBEA 1EHNA 4B9ZA 1TG7A 2Y2WA 3FHAA 4QDMA 1MYRA 1B9ZA 3PZIA 1MW0A 2D73A 1HP4A 2YL5A 3LXAA 4QAWA 3WQ8A 1DTUA 4ZXOA 4UZUA 1V6VA 3GZAA 4OBSA 5HPOA 1S46A 2VCBA 1ZBCA 2DH3A 2VZOA 2WWCA 3ZSTA 3RJXA 4HU8A 2WKLA 1OGGA 1KBKA 1BYAA 3FAWA 1J18A 1JNDA 1IT0A 1LG1A 2Y8KA 2YDQA 3POCA 5BCAA 3SUTA 5CG0A 2CYGA 3MKKA 1E3XA 2VI0A 2F7RA 3WDJA 4F79A 1UD2A 3VIIA 4LYPA 4B15A 3ECQA 1CXLA 4RE3A 3OB8A 2WVTA 2RGMA 1BG9A 1B3VA 5CXPA 2CESA 3O2LA 1W9UA 4GXPA 3A4WA 5BXTA 1UKTA 4GI6A 1PIGA 1WZLA 1KWGA 2J4GA 1NWSA 1V0KA 2A3HA 1R75A 2XVPA 4QP0A 2XVLA 5FL0A 1V3JA 1EXPA 3N9KA 1SFSA 2X2YA 2Y8VA 1E0VA 3I3DA 1GZJA 1ISXA 3W81A 1OT2A 1E1EA 4H8UA 1U33A 1XCXA 2DGAA 2O9TA 4IM4A 3ALGA 3WNNA 3WSUA 4BQ2A 2J7DA 4D6HA 3W6MA 1U30A 3AOFA 3WFLA 1HJVA 1DWHM 1V6YA 3DX3A 2CXGA 1E3ZA 4C7DA 1JDCA 2EO7A 3WDIA 3ARWA 4W5UA 1QHOA 1C90A 4MAVA 3DX2A 2DSZA 3W25A 4GZEA 5E1QA 3MMUA 2OYMA 1R87A 5BRQA 1VJSA 2EPKX 3VOCA 3W6LA 3BLPX 1VFOA 4JKLA 1UA3A 1I1WA 3ARQA 1LF1A 5C8BB 2FH8A 3WD0A 3AIUA 2VZSA 3PZGA 2BY3A 4UFIA 1B3YA 5A95A 2ZX7A 4UFJA 3WY2A 3CHCA 4WKHA 1CEOA 2W67A 2W66A 3VGHA 2CITA 2V5DA 1G01A 1BYCA 2PBOA 3EDDA 2WMHA 1VEOA 1DP0A 3SUUA 2G8ZA 2WBGA 3WMBA 1FH7A 2EQDA 2G3JA 2XFYA 3TONA 1TA3A 3HG4A 3A21A 3CIVA 4IISA 5GQBA 4CU6A 3B9EA 3GNOA 1QNOA 1BYDA 4J7RA 1C3FA 1JZ6A 2VT0A 3ZR5A 2VVSA 4UQ9A 3CBWA 4QLLA 1KQYA 4JZ5A 5E6ZA 5IXEA 1AQ0A 4UNIA 5KZ6A 3IK2A 3VD9A 4NZCA 2V38A 3VDAA 3RILA 1KTBA 2J8FA 5LA2A 3ARUA 4NX0A 5M5DA 2CHNA 1PS3A 4W7VA 3ARXA 3AIBA 1BFNA 3GNRA 5ECUA 1R7OA 4LXFA 3MI6A 1H0GA 2D1ZA 5BROA 1UD3A 1I75A 2WBKA 4AXNA 1EIBA 1GVIA 4UOQA 1UKQA 3VUPA 3WNKA 2XG9A 2WVSA 1W1TA 1B30A 1B1YA 1V3IA 3WMCA 2W4XA 3L4XA 1E0WA 1N82A 2BHUA 1CWYA 3O6AA 5IFTA 3WL0A 3WEMA 1HKKA 1PPIA 4QFUA 8A3HA 4DM1A 4KGJA 3VIPA 1BTCA 1C91A 3RM4A 3SCRA 3LX9A 1VFMA 5GNYA 1VF8A 1GJWA 1R46A 5AC4A 1JYNA 2YIHA 3BVUA 1W9DM 2WCAA 5A8NA 1TVNA 1W1VA 1JYVA 3BUBA 1HWWA 1HJQA 3AHVA 4UOJA 3H55A 2Y5EA 3VD3A 2ZX6A 3GBEA 4HMCA 3L4TA 1KR1A 5BXPA 4PMUA 5I77A 1PZ2A 1WDSA 1Q6FA 1DHKA 3BSHA 4M8UA 4FNQA 3EJUA 1JZ7A 1JI1A 2Z1KA 3IJ8A 1OIMA 4AY1A 1AVAA 3EMZA 1O7DC 3NSMA 4FNTA 2WANA 3SURA 3CZJA 3PZVA 2CBJA 3AHTA 3U5YA 3WBAA 3SCVA 4X0NA 4UQBA 5A2BA 1HN1A 7A3HA 4UQCA 3QGVA 3MS8A 5A6BD 4ACZA 4JCLA 2EACA 4NZJA 1EH9A 2CBVA 5FIPA 5JUVA 1EA9C 4S3KA 4JKMA 1UKSA 5I79A 1CLXA 3VMNA 2YL9A 3OGRA 4IUGA 3BLBA 1MQPA 2ZXQA 1W32A 2J75A 3PZQA 4W8AA 3LXBA 1XC6A 4PRWA 2TAAA 3SCSA 2VL4A 3AROA 3VU2A 1UASA 2VTFA 4KMQA 1W9VA 3PBGA 4PYSA 3BCFA 3WNPA 2WSPA 2WYSA 3WD3A 4MADA 2VUYA 3DHUA 1QI5A 3DYMA 1JZ8A 1EO7A 5LA0A 3NIYA 1Q4NX 1F4AA 2BS9A 2A3BA 2W91A 3BMWA 5FCZA 1ODUA 1H4PA 2WVUA 3HU7A 5EFFA 5HOSA 4UZSA 4ZFMA 2BVTA 1LQ0A 2ZX5A 1K9TA 2X1IA 4P8VA 1SMAA 2DSWA 5JBDA 2PB1A 3WNLA 3MO4A 3BGAA 1W2VA 1OM0A 4IPLA 3GXMA 3VIKA 1W9BM 2OW7A 4ZE5A 4F8XA 1G94A 4B3KA 1ISVA 2F7OA 5FD0A 5CQ1A 3WF4A 2XIBA 2VX6A 2XYLA 3HN3A 2DT1A 2WHKA 3WQVA 4OKDA 2OYKA 4AZ7A 3F5LA 2CKSA 3BXWA 8CGTA 1UWSA 3K4AA 4HPHA 3AIVA 1SZNA 3MUIA 1NWUA 3WD1A 4TTGA 5I23A 4GINA 2JEQA 3PZMA 2FDMA 1OIFA 2ZXBA 4AMWA 1JFXA 3MUY1 3D3AA 1ZU8A 6CGTA 1EDTA 3T0BA 1GUVA 1GHRA 2F7PA 3WMSA 3WH9A 3FNDA 2V3EA 4W88A 4PEEA 1QX1A 4U2ZA 1MQQA 4AMXA 2EADA 3L4WA 2BY0A 1RD6A 6TAAA 2VJXA 3SCQA 3UR7A 1TCMA 1FH8A 1NH6A 5D8WA 3RCNA 3KL5A 4AD3A 2YDRA 2VRQA 1E6PA 3PTMA 4F9JA 1V08A 2DSUA 1E6ZA 1FP8A 1D2KA 2DPEA 3DECA 2D0GA 1C7TA 3VVGA 4HZ8A 3SEPA 1E5NA 2UY3A 5D9NA 3VMPA 5I78A 4J28A 3AZTA 4U5IA 1BSIA 4M82A 1UYQA 1HIZA 3VD7A 3IJ9A 2XVNA 3CZGA 3EYPA 3B8SA 3WENA 4W93A 1E0XA 4OUEA 1E6XM 1UD8A 3GNPA 5I3DA 4PN2A 4AZBA 2E4TA 3MANA 1HP5A 1K9FA 1C92A 4HPGA 4J3SA 1JFHA 1DWAM 1Q6GA 3TTQA 1Y7VA 3AHXA 4AISA 3QOMA 2YDSA 1CDGA 2YA2A 3VGEA 4D6CA 1E9LA 5A6MA 3CUJA 3RM9A 2GVYA 1YQ2A 3WUGA 4CD7A 1L0PA 5A2CA 3BC9A 1CGUA 3LPOA 3VIGA 4CD8A 1K9EA 2G4FA 3NDZA 2Y24A 3VNZA 3SCUA 4RL3A 1I1XA 1R47A 2E40A 3UESA 1EOKA 2EABA 4FLSA 1KCLA 1M01A 2ZWYA 2C0HA 2UY2A 3PN8A 4HA3A 1TQVA 4NXSA 1GOIA 4PMVA 4D6FA 1KCKA 5A6KA 3BAKA 1ZJAA 1GPFA 1M03A 4NSBA 2CIPA 2VCAA 4TTUA 3CMGA 4HMDA 1EDQA 2YOCA 4CU7A 1C8XA 2BVDA 1XH2A 4D6JA 3PZTA 3WELA 3OIHA 4Z2LA 3WL1A 2J25A 3W27A 3QHMA 5EFDA 3M7SA 2W61A 2Y4SA 3FN9A 2V5CA 5AYBA 2WZIA 3QR3A 1UQYA 4PMYA 3SUWA 2WLZA 4EE9A 4Z2KA 4HP5A 1LJYA 1UG6A 1UHVA 3PTKA 4JHOA 1SR0A 1VEMA 3AJ7A 3DX4A 1HKMA 5BXSA 2WMJA 4CKQA 3BUIA 2EPOA 2ZUMA 1GJUA 2WVVB 3CHEA 1JF5A 2VOTA 4ZEPA 2YA0A 4P8XA 4AD2A 4MNKA 3VD4A 3AHZA 1EDGA 1UR0A 1UQZA 3CZKA 1FA2A 4M1RA 4NRRA 5A8MA 2BY1A 4H04A 1BF2A 2VX5A 3ARSA 4A4AA 1E6NA 3K1DA 2ZOXA 2WC7A 2MANA 4OBRA 4JL2A 1BQCA 2PWGA 2XPKA 1BVNP 1DWGM 3ZJ8A 2J7BA 1QHPA 2C7FA 1KTCA 3GXIA 1AQHA 3IGUA 3PTQA 5A8QA 4AZ6A 1JZ3A 3IJ7A 2F1AA 3UR8A 1UKPA 3W26A 1HL8A 1KGUA 1WZKA 3ZSSA 2WMFA 2J8GA 4JHZA 4LX4A 1JD9A 4HOXA 1GW1A 1UD5A 1UWTA 1HJWA 1VEPA 2XWEA 5DEZA 1HL9A 3LRMA 1QI3A 3EJQA 4AD4A 1WZAA 4YPJA 3GXPA 3CMJA 3N11A 3AMCA 1OD8A 1JGIA 2BFGA 3ZT7A 1GQJA 4V2XA 2XM1A 3BAWA 4CUCA 3EMCA 4MAZA 3CZ8A 4CGTA 3L4VA 1E5JA 3M07A 5DMYA 3QOKA 4PMXA 5F7UA 5E09A 2XUCA 4U31A 5ABFB 4X0VA 2WB5A 1K6AA 3ZT5A 2G3IA 1NOWA 4LPCA 4HA4A 4FMVA 1MVYA 1US3A 4NXKA 3DX1A 3AYSA 1A47A 2BY2A 4HU0A 4TVDA 4UOZA 3L4YA 4AZIA 2CEQA 1V02E 2C8NA 3MUAA 2DQXA 3WUBA 3GYCA 5DFAA 1CGTA 4UFHA 3EDFA 3W53A 4M56A 4R27A 1CYGA 1J0ZA 3B9AA 1CLVA 4PCSA 1VJZA 2EBNA 1GOOA 5IDIA 4AIEA 4D72A 3O9NA 4AZ5A 1RP9A 1GHSA 1EOMA 1QNPA 1GOKA 4JFTA 3W4RA 1C7SA 4DWSC 1WP6A 4J3UA 3W38A 1XRVA 3H53A 4UQAA 1PX8A 4W87A 5BXRA 1XYZA 1E71M 1CENA 3CUIA 1PZ3A 4MJ4A 3UG3A 5BYWA 2ZUNA 1QNSA 1U2YA 4GPNA 1H11A 2D2OA 1JL8A 2ZUUA 4PSPA 5HBFA 2YBTA 2NT1A 4E2OA 5EB8A 3ZJ7A 1J9YA 3EMQA 2PC8A 4L4PA 2Q8XA 3TA9A 2WHLA 2X2JA 3AS2A 4IPNB 1OSEA 4OIFA 1CXKA 1BVZA 5DO8A 4MNJA 4JAWA 2CBIA 4GKLA 3ZIZA 3OGSA 3OLDA 2UY4A 1UOKA 4W5ZA 1J0IA 4PTWA 1WE5A 4GI9A 4QCEA 4PSRA 1JD7A 1H1NA 4TUFA 5M03A 3OBAA 3WD4A 3BLKA 2CERA 3T0AA 3AXIA 1FFQA 1GOMA 1XSKA 4CCEA 3VIOA 3TTSA 3SCOA 2E8ZA 1IZJA 4AZHA 2BHYA 3W0KA 1VFUA 4FNSA 5E0FA 9CGTA 3CPUA 4E8DA 2J79A 3U57A 4AZGA 4YN5A 3WKZA 2JE8A 3RO8A 1MW2A 2XN1A 3GXTA 4AIOA 1PAMA 1VBRA 3APGA 1B2YA 3E1F1 1US2A 3NUKA 4TX6A 1DWJM 2QHAA 1B3WA 5IHSA 3AHYA 4HOWA 2WHMA 4W86A 4HZ7A 3T0DA 1IV8A 4UQEA 2A3CA 3ALFA 3OGVA 3BUPA 1XH1A 1CGYA 1JF6A 1BYBA 4UFKA 1L8NA 1ZB5A 3ZQ9A 1VBUA 3VDBA 3H54A 2XFRA 3BUDA 1ITCA 3SUSA 1H5VA 3VSVA 1LL4A 4TVCA 1GOWA 5CSYA 3TV8A 4AW7A 5E0CA 4ACYA 2D20A 2OLHA 1WAWA 3WUEA 4M81A 1OD0A 1VFFA 3UERA 4UQDA 4WLCA 3I3BA 1JG9A 1GOQA 3GBDA 1KXHA 4MTVA 4NF7A 3N13A 3EJTA 3EBVA 7CGTA 3JUGA 1G9HA 3CUGA 3N1AA 1JZ4A 3WH5A 2WVVA 5D9MA 2GJPA 4AEEA 3WUFA 4CVWA 1LL7A 1QWNA 1MFUA 2VR5A 5A6AA 1B90A 2AAAA 4AZCB 2D24A 4JFWA 1MW3A 1EHAA 3CLWA 4EAMA 3BVVA 5AY7A 4DM2A 2WCGA 4GZIA 4QLJA 2WPGA 1MWOA 3HMCA 3KZSA 4D1JA 5ABFA 4ATLA 3WEOA 3TP4A 1W3LA 1KGWA 1XV8A 4HMEA 4NRSA 3SCTA 1WNOA 4XX6A 5I2UA 3EJSA 3CTTA 4PUDA 4UFLA 2VRKA 3GXNA 1MXDA 1NWTA 3VKKA 3AIWA 3VINA 1CGXA 1KR0A 1W9PA 5KEZA 4Z2GA 3T2PA 2JF6A 2QV4A 1W9XA 3AI0A 4FNRA
chains in the Genus database with same CATH superfamily
4C4KT 1T1WA 3OKOB 3RNKB 5IVOA 1OYCA 3GSNA 3PHAA 5IKCB 1ID5I 1JPSH 4JO4H 1NICA 1JBJA 1ISWA 1YXDA 1YEWA 1AL7A 2LU3A 2QKSA 3BVXA 2CKBL 1X8FA 2QUUA 3JTBA 5EFIA 3DJSA 3P77B 5DR5H 4GUGA 3BKJL 2NUPB 5J8OA 1QLFA 4Q9BA 1T66D 4BKLA 1D3CA 4IEFA 1IIGA 4X63A 1XXDC 1JCJA 3AYVA 5JDJA 4JG0L 4JIQA 5HJXA 2X7LB 4CJ1A 2YPKA 1N3NB 3LZFH 3FCUB 3BGMA 2NLJA 1V5JA 2FGBA 4F0HA 1Q9KB 1WYJA 4UT6H 4I85A 2JFCA 3THML 1ESWA 4LSQH 4P9HC 4UV4H 3SY1A 4PWIA 4GH1A 2QDHA 5H2BB 1XZ0B 3SO3B 1X5GA 4NQEE 5IGXL 4QCIB 5BS0A 5L2KA 2AK4E 4ICXA 4TSBL 4HUNB 1KM5A 4J4KA 1NCCH 4PRPA 3ZE1F 3HVDA 2IBGA 2XH4A 3UEQA 4U5KA 3RZCB 1QQDB 3B0YA 4KKZA 3MA8A 2XCMC 1H8SA 1I1FA 1CTNA 3WLKX 4ICCX 2KZBA 3WJLA 5J13B 2WXPA 5MHBA 4Q74A 3RDTA 3W2KA 3LZFL 2NNAB 3MDUA 1YEKH 5D1QE 5C3LD 5JXEC 4JG0H 3WNMA 4B41A 5E5MA 1LRQA 1A6AA 1FO0B 4EI0A 4RZCA 3U4KA 3DX8A 1ED3A 3MBFA 1OAUL 4R33A 3UZYA 2VD8A 2ZYRA 3NIGF 5B8CA 5F7EL 3UTTA 5FLUA 1E73M 1QI0A 3OHXC 2AQPA 3FH5A 3CUHA 4IKIA 4MY8A 4A8NA 2ED6A 1JXJA 1UXMA 4PJIB 3A5VA 2K6YA 4E4UA 3NPVA 4DNLA 4CSPA 2PYEA 1I8LA 3HOJA 4A7UA 3II1A 3MTRA 3V5KA 4F33A 5MEOB 1QPPA 1VRDA 2A83B 3T55A 4GP4B 3UPWA 3A3WA 4IFKA 1JF1B 4NAFB 3PM6A 2X6MA 4CDGC 5GS3A 2GGGA 1KIRB 3GSVA 1LVEA 3DPBB 5FYKH 1K85A 1QBBA 1QNRA 2GQ9A 4ZB2A 3QUML 4UTIA 3NEOA 3P73A 1FA4A 5D5MA 2HVJB 3FJTA 3RGTA 2EPLX 3TIEA 1FDLH 1MJ7H 2IPTH 4OOUA 4Q2ZB 4L4JA 3NMEA 4MNGB 3ZHDA 4AVIA 1G7PA 1R1CA 3B3IA 3O0RL 4NO5B 3WNOA 1WOBA 4L1GA 4M7TA 4ZVJA 1EEZA 1OPOA 4J8QA 5E51A 3HMJG 4EBQH 4Y2OA 4PJFA 3ARFC 4MMXB 3WF3A 4UU9B 3MOQA 3S6TA 5E6IA 3S42A 5CPSA 4LBRA 1XH0A 4XN8A 1WHPA 5ETUB 2GYIA 5JQ6L 1SEBB 1OT4A 1QA9B 2NY4C 3L4ZA 4ACPA 1U8MB 2J4WH 4RBPH 1R5VA 3NP3A 1EV2E 3D52A 3PUCA 5DCCA 4YNYB 2UWEF 5FKAB 7PCYA 4FTVB 2Z1XA 3CN0A 1CPUA 2OL3A 3MJ8A 1JPGB 1QBMH 2AQSA 4HWBH 4QOKD 1MEIA 2Y07L 2AJ3A 4DI8A 4N0RA 1ZJIA 1ADQH 4Q0XH 3KOZA 3NPWA 3GMNA 4ZAKB 3VFGH 4CJ0A 4URKA 1K8YA 4PJ8A 2RDTA 4WWKB 5C0BA 5HMDA 1AD4A 3OAYH 2F2HA 1XBVA 2EJ1A 3FRPG 4PBEA 3EOTH 5FKYA 5HYSB 1SO3A 2EKSA 3MLTB 4JFUA 2J78A 4XBJA 2I24N 4HKBB 4S2SA 5CZRA 5C0ND 5JPNC 3FGCB 1JRHL 1FC1A 3CWGA 4P9HL 4FEZA 4RGOH 4DP2X 4FSAA 2IDQA 2VGBA 3CFNA 1M7PA 4HKPA 4FQ1L 2ZVIA 5ESVB 3DC0A 4PRHD 4UQ3A 4YDZA 2EVIA 2YLLA 3AAMA 3QLDA 3D12B 2Q2LA 3ZGIA 3JS3A 4NU7A 4Q4RA 3HS9A 1VFLA 3A0OA 1MCJA 3GH4A 4MWFB 2GQHA 4Y2LA 4L9XA 3H7VA 1YYLL 4TX9A 3MMEB 4WY0F 1FCCA 1R3YA 2OCCB 5TE6H 3ARGA 4O58H 4XN4A 4PGJA 2H3DA 4IJTA 2VQ4A 1R5IA 2HPTA 4JLRA 4X98B 3QS3A 4JDEA 2LFGA 3QC5X 4S3FA 4ENEC 3EYSH 1P6BA 4BF9A 3UWWA 1HZHH 5KITA 2Z6FA 5IBXC 4LB8A 1IEBA 4B60A 3QUXB 5LG1A 5CIPH 2GSEA 2I5YL 5L6YH 3DK2A 3GXFA 1KB5B 3CZNA 4DP6X 5C0IA 3FDKA 5IG7A 4HUVA 3ABKB 3QO0B 4W6XB 4A6YL 1UJQA 2BV9A 2FX8H 2OR7A 4ODXB 4YHOL 5D70L 1JUFA 3QEGL 3TH2T 3F3HA 5AAWA 4S38A 3RPDA 3OLIA 3SD2A 3LU2A 3N9GL 5LAPA 2BSSA 4HCFA 4AEFA 4DUVA 1V10A 1U92A 4KXDA 5E8OA 1CXHA 4G3YL 4NUMA 1N8FA 1CLOH 4GZ7A 4NASA 2YEQA 4BFNA 5B4MD 2PBGA 4MHBA 5LCVA 4GSDL 1ZHLA 2XNAB 3B8UA 4Q4PA 3SBFA 2V2TB 2AQVA 5H2BA 4YYFA 2JKLA 3FUHA 1PL9A 4YBQD 4PCPA 1SHXA 3O7UA 4KWUA 5DD3H 4OUOA 5CBBA 3KYAA 2VQUA 4QG8A 1BXCA 1D9KD 1JSYA 1H5YA 3VI4A 1HL2A 1QOXA 1MG2C 3Q3GB 3ULUC 3A24A 3QWRA 4HMNA 3AU2A 1XGDA 3G3LA 2GJ6D 3D4CA 3ZKQD 2F74B 5ACZB 5HHOA 2EE0A 4XHJC 5DTFA 1JGVL 2BNRE 4LLUB 2AGKA 4DQAA 3D4YA 1Z44A 3GRWA 2HV5A 5DJAA 4C6IA 2NY3D 5HGHB 1RY8A 2RAGA 2VYOA 3IJSA 3GH7A 4W89A 5FYJH 3V0AC 3GSOB 1AQMA 5I8OL 1YN6A 5FYKL 1FTXA 4ZFFB 3RVUD 1O5XA 2QT3A 3IUIA 3URNA 1P0DA 3H9SA 2B1HL 3VA8A 4E9LA 3TXAA 3M44A 5DCDA 1RUKL 1W3IA 1Z9SA 2QADB 1ISZA 2E3ZA 4U6VH 4OZHF 4RV8A 4KV5F 3T1FB 1MRQA 1JV5B 3SY6A 1T2JA 3GM8A 5B3NA 1JPKA 1DVFC 2ZCKH 4I0CC 4NUGL 3EWBX 1KPRA 5I71C 1UB3A 3SQLA 3UU0A 1QAPA 1UWXK 1XF3B 3AZRA 4ZQNA 1F4HA 2R14A 5C2GA 3NIDB 4IOIB 4IBLT 4D8PA 4EXPX 32C2B 3B2DC 1XL4A 4HJ0D 1S3HA 3UETA 3WH7A 3U2IA 1SUXA 1QSEA 4RA3A 3P84A 4NQVA 1CDBA 2CETA 5JUEH 4PUKA 1F02I 1HHIA 3CFIC 4HLZG 4KTDL 5HDQH 3L1GA 4OZHA 5IJDC 5BXSA 2QVMA 1VPXA 4AGLA 4AE1A 1BQHG 2DQDL 1A6ZB 1FE8H 4L8BA 1E4WH 1E9ZB 1NAML 1KXQE 1I3GH 5D2LB 3G24A 1S1PA 1EXUB 4QXVA 3BFWA 3FXGA 3EJPA 1A4LA 3VGGA 1E4KA 1UQSA 3JV5A 1EFZA 1IARB 2WO3B 3IKCB 1HSBB 1NFIA 2IOOA 1R5VB 3F7RA 4WI2A 5TF1H 4I48B 2YDAA 3APTA 4JCMA 2OJ1A 4LAMA 3J7HA 3RPIB 3EX3A 3QCUL 4A6YH 4BQ3A 2WMGA 1V27A 3OQEA 5H37G 4MY9A 4Y7EA 6A3HA 3G5EA 3DXAA 5FSEC 3BRDA 2FLBT 3OGCA 4BQCA 3H2EA 4AF0B 3FKKA 3F7YB 3DUSB 4EF8A 4PJFE 15C8L 5FM5O 3QZPA 4EPSA 3ENLA 4BDVA 5A94A 1DUZA 1Q7ZA 2ACUA 1M1SA 4AUJA 1R3RA 4M48H 2V2CA 3CZLA 4EOWH 5KYYB 1TV2A 3FA5A 4IT1A 3LM7A 4M6PA 5MEQA 3SDDC 4NC2B 3AWNA 4YHGA 4QTFA 2XN9D 2YAOA 1N19A 1DN2A 1BW8A 1M6OB 1VIWA 4TYUA 4G8FB 2HWGA 5E8DH 4EPKA 1UZ8B 1E70M 4MMXC 4EUPA 3SN1A 3KOXA 2D03H 2E6AA 2BM3A 5U7SA 2IDFA 4B9YA 4H83A 1GCYA 3AG3B 2J1XA 4PGBB 4AG0A 1R17A 4K68A 2YWZA 4RAHA 3TESA 4B9IA 4WI8A 3RWGB 3BSZH 2OMXA 1QMUA 2FHFA 2NT0A 3Q44A 2YQBA 3IJEB 4ELME 4LLUA 3N40P 3BVTA 4IPJA 3U7VA 1NC2A 4YFEA 2P7TB 2A2IA 1FRBA 3DUGA 3E0VA 1JCVA 2WYIA 5C7ZA 3GR4A 3RWHA 4R5EA 2P10A 3TO4C 3KCOA 1BF6A 3HMWL 3TF7C 4S1QH 1LBMA 3VFRB 1CFSA 3EB4A 3CH9A 4TQTA 2D03L 4WHTA 3Q2DA 1JRBA 3HBGA 2UZYA 1Z9SB 1F3JA 3X14B 2C1PA 2F2KA 4MDPA 4YVVA 3U4EA 1MW1A 3TH4T 5FF6A 1ZV5A 4QRTA 4Y4KC 1WBYB 3ZTCC 3VD2A 2CO6B 3GS6A 1XGTB 4S3EA 4UR8A 4MS8D 2L7UA 3S46A 2ZTJA 1G0CA 2WQDA 3DRQA 1MXSA 1XF3A 3C5ZC 2XN9E 3U7YH 5EMKA 2AQNA 2QJDA 1LO3H 1T8XA 4FR1A 2FX7L 3H4GA 4DVBA 3R58A 1KJVA 4LLDA 1NEZB 1YC7A 1F4WL 2C3VB 4NAJA 4G6CA 1QLRB 2EDNA 5DJCB 3HE7D 1JXKA 1I53A 2BSCA 3W6YA 4OCSL 4JE4B 3P82A 4H0HB 2FHBA 2J7FA 1OAYH 1RZKC 4JDTH 2ZUTA 3ULUF 2C6QA 1R3TA 2XG5B 5IWLA 4J3BA 4NJIA 5DANA 2D8KA 1A7QH 2FQFA 3QS2A 4HHAA 4O17A 2EEDA 3L95B 4I3RH 4W9LC 4JDZB 3ZTNL 3SGDH 1PJWA 2APTA 1T5WA 2DJ4A 3UABA 4AC4A 4JGDA 3H3BC 3AT9A 2V63A 5JLZA 1KV5A 2EDDA 1HNYA 2WLMA 3IKCA 4KK8D 5IEKA 1Z5YD 3B7TA 4X2RA 5DJ6A 1Q6EA 4ZPTA 4BYHA 4OUIA 1X5AA 2BODX 5EPDA 1JCNA 5BV7L 4JMXA 3HMXH 5K39B 1O95A 1FYTB 4IP5A 3ZM8A 4C56E 4C4UA 2IQAA 5AECA 3RY6A 1B4LA 3L7EA 1QTSA 4NQXB 2V17L 2X0VA 1OB0A 4MM1A 4ZBCA 2XGBA 5GSVA 5C2CA 1UACL 3OGCB 1G6RB 1U5JA 2DMCA 2YA1A 1ZIAA 4YSRA 3SO5A 1QHZA 2M1KA 1R8LA 4K7FA 4Z7UA 2H9AA 2OSWA 2NWSA 3SCWA 2CMRL 3KYOB 3LNDA 3PWUB 3OKDA 1H60A 3KW7A 2OO6A 3RY5A 5JOEA 5T1MA 4PFEA 3AY4A 1A5BA 1OFAA 1RK1A 2I25N 2KZWA 3DPDA 4MRBA 1EEPA 2YPLB 2DQUH 2YGNA 2FX9L 2FYYA 4Q9RL 4K23L 2JCCF 2OSLA 4MVAA 1IJ9A 2VZTA 3VFUB 2WTRB 2D3NA 3F7QA 5EUKB 3VQMA 4BHUA 5DMKB 1ADOA 2BP1A 3A4XA 4JPWL 3NGFA 3N42B 3WBWA 1B0WA 3FO2A 4O5LH 1CU4L 2XFYA 4MASA 4CN1A 2O9RA 2PW1B 3ULSB 1MEXH 3KVJA 4AV0A 3P2VA 3WLMA 2NXHA 1A1MA 1BM3L 2WXNA 4MMYA 5DJYB 3RF9A 3OC5A 1P6AB 4DWSD 4FX5A 3VKAA 1NWRA 2R0KH 3ANYA 3WN6A 1OHLA 4KFOA 1YNLH 2ATPB 5F7BA 5CC6A 1SY6A 3QW3A 5JBFA 5B38A 2DM3A 3MJ7B 3RGBA 2RDXA 4LCUB 3QQDB 2Z8VC 4FL4B 5E8NB 1W8SA 2Z1SA 2QMJA 1WBJA 4XP1L 2FEJA 2H9GA 4IQJA 3VNIA 1T0NA 3FTWA 5CCKH 3LCWA 3TYZA 2NXYD 2XWRA 4DGUA 5FAJA 3MCG1 3VOGA 1KEGL 3W11D 3R13A 3LKQA 2C4FU 2GB2A 1QASA 3KBEA 4P5MB 4V11A 2GGIA 2P5NA 5IJVB 1QFPA 3L12A 3U2SA 5F7HA 5MP6H 2DSKA 2ZUYA 3MRCA 3JR2A 2ZJSH 2WD0A 3N0AA 3MMWA 2VN3A 4Y8EA 1N2RB 1E65A 3QI9A 4FLQA 3G77A 4OZIA 1RA5A 1A2YB 3DI2B 1OAKL 3SDCD 2GBVA 2J8UE 2VWEE 4PS4H 2L0DA 2EYTB 5CLWA 1QVOB 3WEXB 1SXCA 3OV6A 1BJMA 1EAJA 2UZXB 3RM8A 2HRPL 4HJ1A 5G4MA 2XIMA 4E41A 2WQSA 2NNAA 3V1PA 4FQXA 4RNJA 4ZENA 7PTDA 4MS8C 3TJ4A 4YXKH 4AYGA 2ZUQB 3N1PC 4I1RA 4BWWA 3M0YA 1IXNA 3SW6A 1UH4A 4ALAL 3DKHA 3RUBL 3L3HB 4WXZA 4WO4A 1RJCA 2E25A 4JR5A 1QI4A 1DSYA 4DO4A 5A6SA 1XEUA 3LLFA 3E5PA 3KPLA 4M61A 4WHTB 5KVDL 5IVZA 4HTBA 1M6JA 3QPQD 5HGBB 2Y1AA 3NDOA 3EYVA 4YHKL 3NZSA 2GDUA 3GD1C 3KVQA 5I30L 4AE0A 4WD0A 4XWUA 3HG5A 4NZRH 4YBLB 4E9YA 3MP3A 4N8UA 4KJPC 1EX1A 3FUEA 3C6EA 3DROA 3CZSA 4PLJD 5ABAA 3UO1H 4DP5X 4DXXA 4DO6A 4OCRL 1CDCA 2VURA 3BK0A 2AKRA 4KXZI 2K7QA 4ZQPA 4H8WL 1XGQB 4A1RA 3O4LD 3N3EA 1QEWB 1AH0A 5HHPA 1PS9A 1UZ1A 1S78C 4L56A 3X13A 1ZXQA 4KRLB 2VLKD 4GT7A 4PJDE 4AITA 2B31A 3RZCA 4U6HA 2DQHL 3L3JB 4PPTA 3EB3A 1Z3GH 2DJUA 4HC1L 2HVMA 4L1XA 5EMLA 1ZA6B 3AADB 1CURA 1SUJA 1GCFA 1W0VB 1GHFH 2Q3ZA 3BP6B 4AQ1C 1KELL 1TZHA 4AQZA 3WQ5A 3EF7A 5CILH 2VERA 2QKIC 5E5MB 3KBPA 1AJ0A 1WJ3A 1QA9A 4N6EA 1SJHB 4YSSA 1A0EA 3HQPA 2DQFB 4TMPA 4NHUA 1Z5HA 2W80C 3N18A 5CJNA 2JKNA 4QMEA 5AVQB 1P6CA 1FYTA 1RCXB 1XR8B 4V1XA 1AG0A 1R9FA 3B3BA 5KSAD 3AQDA 5FW8A 3MNZA 1CZ1A 2X4PA 4FQJL 3KYMB 1E6SM 1W0YT 4ML4A 3OMIB 1Q6LA 4XC1H 4JFFD 3CBRA 4HZAA 3BE7A 1HXYA 3C5JB 4F58H 1TA3B 4K6AA 1JK8B 5EZPA 3UDWA 1U8NA 3GVVA 1M2VB 4LBSA 4EKJA 1EF3A 2EC9U 4MJIE 4YMPA 3ZDZB 5E6YA 3KXFE 1VHCA 3PP7A 3EGSB 1G7UA 2GTWA 3MN8A 1HH9B 2Q76A 5DHVH 4M1GH 3KWTA 5J9PA 5FF3A 1A7NL 3UGVA 2FEEL 3F2LA 4M00A 4XUGA 3T8VA 4DZBB 1U4FA 4WGXA 5I15L 1JERA 2PP3A 5EPMA 4R7OA 4WGWB 5DEGA 2K70A 3GE7A 3NZ8A 1OXYA 4PR5B 4ZDHB 2ICEA 2RDWA 2NNXA 4GKZA 2ZCGA 3JV6A 4KQ3L 4FIRA 5AD0A 1OYBA 1MHCA 3E9UA 3MCLL 4PGCA 5SWZB 3C60A 3D0CA 4P46C 1CF8L 4MZRA 5EEXA 1QI2A 4HZMA 5K9KB 2V5YA 4IFRA 2Q8AL 3IGHX 2EIEA 4EWJA 2JV6A 5EF1A 4NLHA 4OCRH 3RWIB 4OCYL 4RFEB 5I24A 1S5IL 2V68A 5ACMA 4K8HA 1KCVH 3NCMA 3V6OE 5GZOA 3LBOA 3ES6B 4NERA 5DXYA 4JYEA 5C07E 2A7BA 2E27H 2ITEA 4LKXA 5DMMA 2K6ZA 2FECI 2NR6D 4HDIA 3VXRA 3WDPP 2AV1A 4X9YA 1XSOA 4HGWB 1OGPA 4OF6A 5B1AB 5LIWX 2R23A 2YZ5A 1GYCA 5BW7C 3WD5H 2IGLA 3C08L 2NV9A 3GUFA 3FSUA 3QUZB 3MZ2A 4LUYA 4NGHL 2QGEA 4U1NA 3BWAA 1JHTB 4ORGA 2R29H 1TB3A 1PCKA 4FX7A 4TV5A 2ZP9A 3S2AA 4C6EA 3VPLA 3EF4A 2BHZA 4R5VA 3LCLA 4KFNA 3L1OH 1J9QA 1A4CA 1KCVL 2WO2B 3HC0A 3IB4A 4JZJA 3S3JA 4R85A 3OKEB 3CC5A 4G8GE 4DVRL 1FWFC 2JKIS 2VXSL 2W5PA 4Y4HC 2WXDM 3MO1A 3HTLX 3RPMA 4QTHA 5DS1A 4A2HA 1HVXA 4PAZA 1WDQA 3L2NA 4R26H 3VWJC 1L9PA 1H49A 1PG7W 2Y7MA 2F53E 3DV4B 2IGTA 4O4YL 3ULUE 4GQRA 4HWEL 5DVMA 3SGEH 2IAMA 4AUYA 1NEYA 4PTDA 4BGDA 3TC9A 2E9BA 3ZOAA 2R2CA 1V3MA 4KVCH 5A2AA 1ZP4A 1IAOB 5JPMA 1BEYL 4W9EC 1QRQA 3TROA 2Y36L 2WHJA 5IFHL 1RSYA 3LKNB 4ADIA 1DWIM 1TIUA 4RMRA 4XPBH 4R4ND 3QI9D 1UATA 1BA9A 5JNYA 3RCYA 3ZU8A 2J2ZA 4PJXB 3QO1A 2I7SA 1JAKA 4ZD3L 4TOQA 4LCQA 4Q4EA 3C6SB 3N17A 3ZBMA 4LYQA 1E40A 4D6IA 2ZIDA 1Z48A 4P5TD 1BD2D 2PWEA 1RJLA 5GGQH 1KM2A 3UYCA 3GM0A 4LAQH 3KW8A 3DFTA 2AL1A 4NFCA 4F2EA 3INUH 4AL8H 5HHXH 3MGAA 3QMRA 1ZT1B 4Q4MA 2BP0B 2DMKA 2ZXAA 2AKRB 3HLAB 3LRLA 2M2DA 4GRWB 1NTHA 5KVGE 2GUUA 5EH1A 4HZ6A 5JW4M 1S9YB 1HINL 1KIUB 5E1AA 4PJ7E 3NDYA 3AU1A 2QHLA 4KK9C 2FQGA 1JXFA 5CWSA 1GYWA 1F2JA 5HQEA 4DIAA 3QUKB 4H1LH 2QEJA 1IGSA 3T7VA 1Q7MA 1BLNA 5JW3H 4AZCA 1UYWH 4M4RA 5LQBL 2XFXB 4E6MA 3IKKA 4WI3A 4W85A 4E9SA 1KDJA 4NNCA 3HGRA 1E27B 3LS9A 5D2LA 3ZVIA 2E9IA 5EUOA 2J72A 3GBMH 3HJ0A 5E4EB 4U0RB 2HVNA 4JS3A 4YJ5A 3VE0A 3C60B 3VRJA 2QQ6A 2WJ7A 1AI1L 2X10A 1UZ6E 2PWHA 3NT0A 1YYAA 2W0FA 4FQCL 4JFXA 1KLGA 1VKXA 1XIDA 2HMIC 1JGDA 4GW5A 1NELA 2K7PA 3VOIA 1VFAA 2GJXA 4LEBA 5EU6A 3O41A 1SO5A 2PP1A 3DEQA 4TTDD 3HOGA 4QKTA 2O5XH 3WFCH 1SO6A 3WQ4A 4RVBA 4MNMA 1XLKA 1CTOA 4O02A 1K03A 1NP0A 2WZ5A 1TREA 1U4EA 2VRJA 2A9NH 4XNMA 1GG0A 2WMIB 2XSXA 3MSDA 3VILA 3WF0A 3O4LB 2F18A 4G9FB 3QQ0A 3CPLA 1M1XA 1V8EA 5C7XH 5C0AE 3QHOA 1FPTH 1JV5A 5CU5A 5BW6A 3ZR6A 3IGXA 1UEYA 1PD1A 4G8IB 4RMBA 4QRUA 1T21B 2DL9A 4TNVF 1P4IL 4J6RL 4H88L 1AQFA 4M6VA 2UZ9A 4P7QA 2VJ8A 5AHIA 4W9CC 2QNEA 2OX5A 4J12A 2IWKA 1FP9A 2FPVA 5HYQA 2QDDA 3VGDA 3GSXB 3L08A 4N0UA 4O10A 1WIOA 3B5HA 4GIPD 3FTVA 4NAEA 3SKNA 4JFED 4S10A 1S9WA 2D9CA 5EPMB 5J06A 4MPQA 15C8H 3BZFA 3CVIH 4D0DB 3VFOA 4E9RA 3AI0A 1KO0A 3OBKA 5L4IA 5DF0A 2WGNB 4OZGE 4P2CG 2F68X 3F7LA 4K2UH 1MI5E 2DJMA 3ARBA 3S5YA 3OTTA 1AFVL 3VZYA 5FGCE 1PU0A 4RRPA 5HYIA 2WTPA 3HZVB 3HG1D 4TLTA 4XO9A 3ZKXC 3Q2LA 5DD0H 4L8CB 3KFTA 1F8TL 5BXFA 1Q38A 3TWCL 1RVGA 1SZGA 2GSJA 4WJEA 3U0TA 1ASOA 1J5CA 5HINA 1VRSA 1BYNA 3DESA 1IC5L 4DELA 2X30A 5TQ2L 2AJVH 5IQ9B 1AGDB 1KJ3L 3JZEA 4Q6KA 3ZT6A 3ZZ1A 2ESVB 5AW5B 2WBJA 2NDGA 4K8RH 5IBTL 3V0JA 4AXWA 4X4YA 3DO7A 1TQTA 1CIDA 1DBJL 3HE6B 3AS1A 1P2CA 5AZEH 5PAZA 3AGWA 1BOGB 5I66B 1FHLA 2GJ6A 5K1NA 4YDVB 4GS7B 5JW4Q 2W63A 3HB9A 3V6BR 1HQ4A 3W02A 4LVOB 2B1OA 3VXRE 2Q7YA 1LQSR 3EDJA 3SDYH 3MNDA 3WGUB 4TR9A 3UVAA 4M4PA 4AWEA 5TH2A 1XGTA 2FZNA 3NZRA 3O3UN 4XPFH 1DL7H 1H63A 4BEQA 4P7NA 5E0KA 3N25A 2J8OA 4YLWA 1EAQA 1MFVA 2KI6A 1ZAGA 1ORQB 3VG9C 1YDYA 1M5WA 3CK5A 3FYYA 3KGTA 4FX8A 1TPWA 4PYGA 3L23A 5D2XA 1NFDB 1OD7A 1XIWC 3V0VA 1NCBL 3GXUB 3C6LB 4NZFA 3O6CA 3E3HA 4F48A 1NC2D 1B57A 3QT2A 1T41A 4U1IB 3MREA 4QT5B 1XT5A 4JREB 4AQLA 4KDTA 2J1KA 2IPKB 2YRLA 4PLOB 5HDRA 1KFBA 8PAZA 5DZ9A 3IJEA 1LQAA 1B3OA 1T40A 3I6GA 3HAEB 3UADA 1B31A 2IWGA 4XISA 4QRBA 5C0CB 4HGKC 1ME8A 2F19H 2AL2A 2GQ3A 4A3HA 4FTDA 4UNTA 4BWTA 3K6OA 2BS71 4I4WA 1KLUB 4V1DE 2N7BA 3R0NA 2LABA 1UR4A 2WXLA 5EO0A 4G7EB 4M43L 5FKPB 5IMLA 1HF6A 2FR4A 1P43A 5DUJA 4HBKA 5GGSY 4TVSa 3QNXA 4U3CA 5SWSB 3O3EA 4R7DB 4PJFB 1BLIA 3WD2A 4EN3B 2ZX9A 2ZUVA 3DRQB 2GWGA 4UTTA 4ZNCD 3D6NA 3QFDB 3O8XA 4NRZA 2B7NA 3ILPB 4FAAB 4W4QA 4Z1CA 4OQTL 4OHQA 1KV3A 4GW4A 1RKRA 2FVNA 3SD5A 3V4VB 5FKAA 1CBGA 3CFJA 4Z7WA 3P73B 2Q09A 4CL7A 3PPHA 2BWIA 4LE8A 4QF1B 1E4LA 4M5YH 4V27A 2YPLE 4OLUL 2Y06L 5T1DL 2NY3C 2CAKA 1OAQH 2C9XA 2IH9A 1FSKB 1XIWA 1BHGA 2B5IB 2QKIA 4FI7A 1ZHBB 4OCYH 3O3AA 1ZLWH 1KCXA 1QWGA 2C26A 2WUBL 4LSBA 1E4XI 3ZYJA 3P67A 3BO8B 4XMWA 2LLNA 3MC5A 1J86A 1F4WH 1FBIL 4O02L 3QUMB 4R97B 1WX0A 3S88L 3BVWA 2C4FT 4KZDH 3QGAC 5CCGE 4CD5A 3HB3C 4MSWB 5IR1A 2IIJA 4WX2A 4K3DL 4WCJA 4F0SA 3ZJ6A 1LG2A 4HCRL 1A6TB 4PTTA 4MB3A 1DYSA 2AMGA 4XNMB 3P30L 5EWIL 5ALBL 5HJLA 1BQHA 1MFEL 3OWEA 4G1MA 5LQBH 1FP5A 4XAGA 3ITOA 4PRNA 3T3ME 5GVJA 4B16A 1I9RH 3GNMH 3NIDE 4L2YA 2APBA 4JFYA 5JIQA 4MZ3A 4UIOA 4DEWA 8XIMA 5K3VA 3RVXD 3ARBC 4RE4A 4XZLX 3FQTA 4O2EA 4OLEA 3BKMH 5L2JB 3M6YA 2ZSVB 4UTCA 3IV8A 2ITCA 5TGBA 2J71A 2PF8A 2OX5B 4RMTA 5I8CA 3MYPA 1CECA 4K7FB 1GY1A 1H0DB 1HDMB 4Z7UB 4YC2B 4CN4A 3F7JA 5K4ZA 5DS8A 4F2MA 4G8AC 3S5ZA 1OOWA 1IE5A 3JV4A 1PZ0A 1SDDB 4Z7OB 1POKA 1ZUAX 1LD9B 3D0VB 3FHEA 3GI9H 3ARPA 1I8KA 4JJ5B 3U1SH 3MZTA 4AK1A 3CHOA 3SY0B 3B4UA 5ABHA 5CC5A 3RNQB 4P3CL 4FLOA 2FO4A 5ESQA 3GKFA 1HTYA 3GBML 3GYEA 1PIFA 3FT3B 3QQDA 3CH1A 1U3JA 1NM4A 3SKOA 4R96A 4GMEA 2EECA 1AXTL 1KXQA 2AJUL 1IAIH 2V3GA 3ERPA 4E4FA 2CO3A 3LKPA 4XXWC 4BJHA 1JN6A 4PCNA 3QUGA 1CD0A 1CXIA 4MNHB 3UTTD 3VI4E 2UWFA 1CJYA 4EPEC 3S35L 1QR1A 5M2FX 5CM1A 1RFDH 2QDEA 3QJAA 3GZPA 3VJ6B 1B6DA 3FRPA 4Y9GA 5DVOA 2DYSB 1UOWA 5GZNC 1GGCH 1TZ7A 2JKPA 1KKOA 5IBLC 4OZOA 4REQB 3DGGB 3EDKA 2R8SH 3VC6A 1MQKH 1IX2A 3PWPA 1YNKH 2XWBB 3G5VA 4P4KB 1DBKL 3STBA 2HN7B 4XZ4A 2BSBA 2WBJD 5FPIA 1KKRA 2XN9B 1XUUA 3FNKA 8A3HA 5CJXC 4LCYA 1S9XB 1SM3L 3HAEH 1W0WB 3ISYA 2K6WA 4EAYA 1DVSA 4KJYA 3RTQC 3RX2A 3BGGA 3M16A 4KY2A 4IDJL 2SODB 3DIDA 4IIQA 1UD6A 4O28A 4TTDC 3QNXB 3IDJB 4YE4H 1AD1A 1KPVB 1P4LB 4OFCA 2DWEA 3QEQE 5AKQA 3WBEA 4B9ZA 1CDYA 2V37A 4C1NB 4U4BA 3PG9A 2Y2WA 4TL5A 4BUGA 1YYLH 2XNAA 1ZHLB 3SQSA 5E08L 3QFJB 1UOVA 1MW0A 1X5YA 1H9DA 1VJIA 4U1HB 2PS2A 3EOOA 3DERA 1JPFA 3VXSB 4GABA 2PDPA 5IOKA 4QAWA 4FIQA 4OD1L 1BEYH 1AZRA 4N6RA 3ZTJH 3HKZA 3BP5B 4KVCL 2C9VA 5DYOB 5JORA 2EKGA 1WGVA 5E9DE 5IBUB 3CDZB 4TV3A 3WBYA 5DI8A 3T1FA 2VZOA 3ARDD 3BH9B 1HGYA 1MF2H 2B2XH 4PODA 2WKLA 1MRDL 2C5DC 1OGGA 4ZA0A 1QFEA 3C5QA 3L5XL 2Y5SA 1N8ZB 5F7AA 1JNDA 3PHOA 1OAKH 2KPWA 4Q8BA 4B3VA 2WSYA 3W2LA 1N0XL 3MJWA 2C13A 4XCEA 4XO4A 2IWEA 3ISIX 3QDGE 1GVOA 2PCFA 4NGHH 5FLVA 3DG6A 2BLFA 1MLBA 1JGLH 1YEHL 3MJ9H 4XOEA 1T80A 5IREA 1RHFA 3L5AA 2F7RA 2VGLM 3WDJA 2R4SH 4F79A 3B0XA 4IHOA 3S3DB 1SVBA 3TL5A 1FWHC 1RZ8A 4B15A 4C60A 5CZTA 4JN1H 2FD6H 3CCHA 3I6KA 3IPWA 4XOCA 3GKAA 4YHYB 4F0RA 5I8CB 3O16A 3PIQA 3QR0A 3UY8A 1TITA 3TCLA 1Q72H 3UYOD 1XBZA 3URAA 4I9WE 2BW5A 3GMMA 1IEWA 2DOCA 1YNPA 2CJUH 3I9GL 2VE6A 2DW6A 4DQOL 3CFEA 2Y5QA 1XF4B 2EIBA 3H42H 1R24A 4GI6A 4RA0C 4LB4A 1PIGA 5JHLH 1KWGA 3BPLB 2D31A 4H44C 1V0KA 5IHHA 2D7PA 1MUCA 1XAKA 2A3HA 5FJRA 3MBWA 1EXUA 3ET9F 1WAAE 3W2NA 4X4ZA 4OLWL 3TBYA 2XVLA 3P0YH 3RY6C 4HYWA 2HH0L 1V3JA 1J5SA 2E7HA 1EO8L 5CEYA 3N9KA 5JW5A 1E6OL 4L80A 1DBJH 5FOBB 5IBTH 5AB1A 1ISXA 1SJCA 1Q8MA 3IN2A 4NT6A 1YADA 2PGFA 1X98A 3LDBB 1MWAH 5D1XB 2DLHA 1DSWA 3D39A 2DGAA 2X4TB 4JO2L 4XMUA 5DEGB 1CLYH 4JFYB 5C0CD 5IM51 4M6OH 4AG4L 1AIFA 2DQEL 3IEBA 1RVFH 4GMTH 5E4EC 3AOFA 4LTSA 4QXIA 1GVFA 3FYEB 4BXSV 3DC8A 5GZOC 2DQGH 1MF2L 1A7BA 1GZQB 3DX3A 3D3FA 3H6JA 4TNWF 5LN8A 1OCJA 1YE4A 3GK0A 4I7UA 2J1WA 2X4UA 3MCKA 4JQXC 4OR1A 3CVIL 3WDIA 4ZQOA 1HNFA 3VOJA 4LLWB 5MEQB 2IAMD 3P74A 3GSRB 1H50A 2CJSA 4W5UA 4FTVE 1QU4A 1VBGA 2R2HB 3D0LB 1TPEA 5E1QA 1IGTA 1NEZG 1EHLL 1Y8BA 3RVUC 2YXXA 5CH9A 2OYMA 5BO0D 4EDWH 4S1RL 4XZIA 1WD8A 4P2RA 4Z0BH 1JCMP 3K0YA 1K4GA 2OPJA 4PGBA 5A6IA 1XDJA 2PA6A 2EPKX 2HLFC 4GCXA 3OR6A 1T22B 3CLEH 1DQLH 5FR3A 2EDYA 4M7LL 1I1WA 1ITQA 1LF1A 3CASA 4PRPE 3WD0A 4JKPL 3MPGA 2VZSA 2EE2A 3HZKB 3QWNA 4F37K 5AVRB 3XINA 4UDUA 1N0LA 3WFEL 1BWVA 3QQ9D 2ZX7A 3N06B 5EU9A 3WY2A 3EOTL 3VXUA 1CEOA 3H2MA 3TZNA 4EF9A 1NGPH 5T33L 2P76A 3ES7A 4NZTH 2WO4A 4AQ1A 3CJJA 1Z66A 4MA3A 3W11C 4NENB 4FG6C 2IGFL 3KZPA 3FFCB 1VCVA 4RCAA 5HDBF 3FJ6A 2XG5A 3B83A 1H7NA 2BSRA 2Z92A 3PHQB 2WMHA 4MLJA 4WGHA 1VEOA 1DP0A 3SUUA 1N18A 1MO0A 5EU4B 1W56A 1CBJA 2Z31A 1PKQA 5CZVH 5EU7E 2WBGA 5IQLA 4IFOA 2EQDA 2G3JA 3NL5A 1WFJA 1Q3NA 3WQOA 3NJKA 3VCCA 3LH8A 3X1EA 4DVBB 2MH4A 4AMAA 2H6PB 3LRSB 4GLRH 3QORD 1XDMA 3CAVA 3TONA 3NZQA 1UWXH 3FEMA 3RYMA 4QD2E 5CEZH 2WJDA 4IKLA 4M5TA 1YLVA 4NZTL 4RMVA 1JPGA 4IISA 2NXZB 3ZQXA 1BYOA 4JFOA 2LGNA 3AREC 3SE8H 3WKYA 1XF4A 1LLAA 4MJIA 2PTXA 2PMZA 1BF8A 1MFBL 1YNTF 1BQLL 1P4BH 1QNOA 4IGBA 4Y1AE 4XVJL 3EKZA 1MIMH 1VKXB 3GU9A 2NY2C 2O6DA 4RGNC 3MWCA 3KNBB 3USZA 2WNZA 4UQ9A 5KVGH 2H3NB 2B4CL 2Q9OA 1NFAA 1P7BA 4UI2A 5ALCH 4LNCA 4R2GD 3WO8A 4PJDF 2YXWA 4G43B 4TQPA 4ADJA 4QCIA 1KPUA 3GBNH 5A7EA 5BS0B 5IXEA 2ABAA 3OZ9L 2DV6A 4M5SA 4AKQA 2HJFB 1XG3A 5B3SB 4Y9EA 1L2QA 1KN4H 1RHHA 4CADA 5IFHH 1K7EA 3O9WC 4NZCA 4B5UA 1KTBA 3Q8AA 1DIDA 3ARUA 4L5ZA 4ANVA 3D2UA 5E00B 2CRIA 1OO2A 1SFHA 4J3OF 4Y2DB 4PJXE 4IX2A 4W7VA 4HFUH 1EC8A 3AIBA 1YNLL 3K80A 2YCKX 3HLAA 3GNRA 3FBKA 3FTXA 2NY6B 3WJMB 1LEIB 2D1ZA 1HE8A 3CB3A 3NO1A 1GZQA 4ZB5A 1UD3A 5BROA 1ULVA 2VDKH 1I75A 4I1PA 2A74B 3OAUL 4HJFA 5I6XC 5D05A 4LF3B 1UC4A 3NQFA 4NYUA 4RNIA 3BGFC 4Z1PA 2BNRA 4TMCA 1GVIA 4UOQA 4LPVA 1IT9L 4FQPA 2Q2EB 3INPA 3WNKA 2WNGA 2ATPA 1BQUA 2XG9A 2BOCB 3O4LA 4UMGA 4FOMA 3PAOA 4N2YA 2PPDA 1THFD 2FCBA 4D8LA 3HMXL 3MR9A 1CL7L 5JHMA 2WVSA 1TQBB 1TEFA 5IOBA 1FFPB 3PFUA 3JYCA 3LD5A 4DNMA 1DLHB 3KWUA 3DX6B 4NKDB 4C91A 3H4FA 3IF1A 4N2HA 5AW3B 4B0MB 2W4XA 3ESOA 4XP1H 3EA2A 3L4XA 3REWA 3L0KA 2LAGB 4XNXL 3VZXA 4NT6B 3KRSA 4HIIA 4M43H 5CBJA 3IRZA 4I18C 2J1ZA 2LTQC 3H9YA 3VXOB 4RISH 5EBWA 4WJ5B 3B3IB 4NPKA 1YRKA 1IBHA 3R5EA 5CNHA 3VI3E 3RM4A 3SCVA 3TEZA 2DPKA 2CKBH 4F0MA 4KX9A 1BQ5A 1ME9A 4WO0A 4PGDB 5J11B 4PFHA 4R7VA 5E6IB 1NJ9A 3EWZA 5AVUB 1LK2A 2CUHA 2IH8A 1TWSA 2PLCA 4GNVA 1TVNA 3LKQB 4G6MH 3MOBH 5EU4A 4X6CB 1JQVA 3W0WA 5LHDA 3SJNA 2XXGA 4NM4H 1JYVA 1MZZA 5EHFA 5IV2B 4LSPH 5CU9A 1HWWA 1O9VA 4EVNB 4YUEL 1ACZA 1U5VA 1T96A 3AHVA 4UOJA 1XHHA 2I60H 2Y5EA 4HK6A 5DK0A 1FWWA 3VD3A 2MQ0A 2ZX6A 4YU1A 3NG3A 1RQBA 3U2OA 5BXPA 4L9ZA 3B04A 4R7JA 4PG9A 3FT4B 4OFPA 3FCTB 1MIML 5GJSH 5EN2B 3TNOA 3LG3A 1WDSA 2IPKA 4FKHA 4LHQB 4LSRL 1EUNA 1DHKA 2XY2A 4M8UA 3L5XH 5TH2B 3SE4A 4CAGA 1JI1A 1QATA 3HZKA 1RZJC 2CR3A 4AY1A 3NJGA 5K1VA 2OMVB 1AVAA 2CR6A 2JB5L 3KXFB 5E8OB 2H3NA 5DWUL 1H8OA 5KAQG 2YAFA 2ZA2A 4FNTA 4EJ1C 3F03K 3EKGA 5GGTH 4MD5B 2WANA 2CLVB 4AVNA 3DJRA 4CSSA 3AG2B 3SURA 4A2LA 3S36X 3FK3A 1BZ8A 3I85A 4JDVA 4LO9A 1C16B 5CJQL 4D0CA 5C6PB 3EADA 1JPIA 2CBJA 5E8DL 1J96A 4HNLA 1OSYA 3A6CL 2RHEA 3INOA 3CN2A 4X80H 3H4WA 4PB3A 3U5YA 1YHPA 4N2CA 2I17A 2ADJA 1YPZF 4EN3A 4MCZA 4NNXA 1MVUB 5I73B 1EC9A 1GKOA 1KN2L 3LY6A 1O6VA 4JLRB 4CNOA 3ULVF 3AREA 2RQ8A 2WQPA 3F4NA 4KESA 4ZSOA 1B2WH 4RFOH 4ZMQA 1XYBA 4Y8FA 2GY7B 3BEWA 3IJSB 5ISZE 1CTMA 2H3KA 2I56A 4YGVA 2PGWA 1TZOA 4DEFA 2J8HA 1XGPA 5C9JB 2G0LA 1C8VA 1DQXA 5D7IE 1ZRQA 4O1BA 3TWYA 4ROQA 3EYSL 1F4XH 4Y0GA 3VXQA 2J8UB 2ICWB 5FIPA 2BCKB 1EA9C 4N9EA 3C87A 4JKMA 1UKSA 4X4XB 4M7LH 1IBZA 3BLBA 3ECWA 5BRZB 1W32A 5LO7A 2J75A 5E5CA 3MBXL 3WFHB 4N0YH 1XC6A 2TAAA 3C5ZA 3U0WH 2CDEB 3FUKA 3SDAD 4GBXD 2VL4A 5IW1A 3BPNC 2JCCA 3O8XB 3CHXA 4JM2F 4NRZB 4WW2A 4G43A 3STGA 4YSAA 5EDXA 3B2UC 1UASA 3VU2A 2VTFA 3QTGA 1B0GA 3MKGA 4TS6A 4KUZL 1W9VA 3GY1A 1G9NC 4JTUA 3DX7B 3URBA 1O60A 3BKCL 4MADA 3MROA 3SCOA 3ORJA 3DHUA 4EUPB 4GUIA 3KGRA 3R1GL 1WA2X 4QGYA 4UAHA 2VLME 1JZ8A 4PJ7F 1CI5A 2O5XL 3WFCL 2OX4A 5LA0A 1F4AA 4BCZA 4KJPD 4PJGA 3LN3A 1HO4A 3Q2VA 5FCZA 3P0VH 5FFLA 1HDMA 1YZZA 2OTDA 2GTWB 2VC2L 1QFHA 5I16B 1YY9D 4JM2D 2LW3A 3KBWA 5DLCA 4ZFMA 4C1LA 2GYSA 1U8CA 2BVTA 2FECL 5C0RL 4L18A 2E09A 3TQKA 3V36A 2PR4H 2WKJA 3FFOA 3VG9B 4G1MB 3BOLA 3HKFA 1U1JA 1V79A 1D5XA 2X87A 2QF7A 2DSWA 2WLKA 3RI5F 1AOZA 3QMSA 4EVZA 5JBDA 1HINH 3WNLA 5IZ7A 4MSSA 1E4WL 3FT9A 3MO4A 4PJBF 1Y6MR 3BGAA 3QNYA 4K3DH 1OM0A 1TWWA 2JIXD 4OFDA 1G7HA 1W9BM 1HTIA 1W8GA 1F1AA 3HNVL 4XN2A 1U3YA 3BGJA 5DY2A 4UV7H 4AAJA 4PV1C 3SDCC 3RWEA 4ZUTA 1BFOB 3MSYA 5F97E 3NO5A 3ME3A 2V7NB 1FH5H 3NJVA 4OGAC 5EN3A 2I9EA 2VX6A 4H8QA 4UQ2B 3G1AA 1M9WA 4HIEA 1T4KA 5TE7H 5IP4A 4HOWA 4N6FA 3VWJB 3FQNB 1PV8A 1AP2B 4TULH 1MIEH 5E56A 4F1SA 3F5LA 3ABRA 1E9OB 5FO8A 1TYGA 3QV7A 4BFIB 2JKWA 3K4ZA 3RRQA 4K8RL 2GK0B 2X1TA 4QS6A 1NUGA 1PYFA 2OZ4L 2D3VA 4G3YH 4HXAH 4LASH 4L6DA 4XMXA 1IVLA 4H0GA 5DS8B 3SQOH 2CDGA 2R15A 3LYRA 4ZFGH 1N12A 1OF0A 4TTGA 4MBRA 3ZTEA 2AZAA 2P48B 3Q48A 3WLBA 1P5UA 4C65A 4MS6A 1AS7A 5DK0B 3ZLQC 3WXVL 4WHDA 3BDBA 1B4JH 1MCPL 3HR5A 4WUKL 3RB7A 1RPUA 2J12B 2FDMA 4IK7A 2WQVA 5T5FA 3NA8A 3OA3A 2XN9A 4E5TA 1E0TA 4HPYH 4AMWA 3FCTA 4QJ5B 1QBLL 3BZGA 1IAOA 5JPMB 2ZT9C 5F1SA 5HHOE 1ZLVK 2CLKA 4PUUA 5M94B 3VI3A 2ORBH 2NLJB 1E5BA 2X16A 4KI5C 2I69A 4YZFF 5TE6L 3VCLA 1GUVA 1JHLL 1H5BA 3JW7A 3V75A 2ZUQC 4POZD 1D9KC 4LPWA 3OB0K 4X6EA 1X1OA 3OZMA 4NAFA 3WH9A 4TSBH 3ZKSD 3QDGB 2OB3A 3BLEA 2X88A 4FG2A 4LCWB 3NYZA 3TV3H 4X22A 4AJVA 5D93B 1UGNA 4KI5E 4HULB 3TC7A 2EADA 4PJ8D 4O53A 3ZYIA 3MROB 3SCQA 2CGRH 5JQIB 1KENH 3NGBC 2KZKA 3GU1A 4YH6A 3GDLA 5AYZA 5AHNA 1TTQA 4DPBX 2DTML 1ZT1A 2L04A 5HVHB 2CZFA 4U0RC 1JTOA 4GB9A 4ZX3A 2QADD 4UV7L 1EFXD 3PDGA 4OZHE 1S2AA 2DSUA 4YHZH 3LDVA 4J39A 1UPMB 1JPSL 4G80B 4JO4L 1FP8A 1KT2A 5F9JB 1HKFA 1QSEE 4NZ4A 3CVHA 3NEHA 4RV3A 1A5FL 1J1PH 3OYXA 1R24B 1YMME 1R3HA 1C7TA 1QSED 3OG4B 1O4UA 1A6UL 1E5NA 2WN3A 4XZUB 2ICWI 3DJZA 3RWCB 5DFWH 3T3PF 5BU9A 3VMPA 1VFBB 2QCLA 3ZFHA 2MNUA 3RX3A 5I78A 2WNNA 4FFYL 4AX6A 2VAJA 3O4OB 4PJFF 1OTSD 2BSEA 3SB3A 2EO1A 3VD7A 3CCHB 1WICA 3I6KB 4TQIA 3IJ9A 4OJEH 1IMHC 1I0DA 2PW2A 1XICA 2XVNA 1HH6B 3N2OA 3UZZA 5PTDA 3B8SA 4FCAA 4DJMA 4W93A 3R7MA 1G87A 4PP2A 4D2JA 1BFOA 2LLLA 1UD8A 2NQDA 2XQBL 4HD9A 3BIKA 2APXA 2XG4A 3O0RH 3GNPA 3SAZA 2NTFA 3K71A 1A5SA 5I3DA 4IRJB 3PWLA 4XAPA 3T4WA 1L9QA 1RK1B 1ADQL 1HP5A 2BIOA 4W4OC 2EG7A 1NC4B 5DRIA 5AAMC 2W38A 4AY8A 4O58L 4J3SA 1RPXA 3NFNA 5JHLA 1J88A 4X8JB 5EUOE 1GHFL 2GSGB 1QOKA 3R79A 4LB3A 4D6CA 3QUYC 3QWRD 1A21A 2A6DB 4HHWA 4J2XA 2R2HA 4WW2F 4JFDB 5JPNA 1RZKH 2Y7QA 1GPOL 2GVYA 5D2LE 3WLBB 4Z2LA 2EHHA 4NIRA 3WUGA 4ONHB 3GPSA 4HJUA 4CD7A 2EDKA 3O6DA 3CZFA 3O6FC 2UV3A 1CVSC 2Z8RA 3HLKA 5AYUH 2PDUA 1CGUA 2KHAA 3D2UD 5C0IB 1KLZA 2B7PA 3MCNA 4O50A 3VIGA 3KYKL 1IJNA 3QIWA 3ARFD 2ZCHL 5I6NA 3F6LA 1X38A 4ONFH 4I5RA 5CSSA 2HT4D 5B1KA 5BJTA 4HAFA 4KCWA 2B0MA 1R47A 2E40A 3IPFA 2R29L 4G9DA 5D5ME 3AABA 4FN0A 4UQ2A 2EABA 1EOKA 2FJKA 2FATH 4FI4A 3P8JA 3PBVA 4WRLA 4XNAA 2DORA 4YIWA 3SI9A 5IRPA 3KPSE 2C0HA 2VDHA 4IGBD 2Z1VA 2QS8A 5CGQA 4PMVA 4OVUA 3KVPA 2E5DA 3V0FA 1WBZB 3APFA 5FO7B 4C57C 2FZDA 3MREB 1QOQA 1ORSA 1ZTXE 2HYMA 1WC7B 2XTLA 4ZAKD 5FB8A 1GPFA 4YSCA 1LORA 3RLUA 2Z93A 3ANVA 2DV0A 3CMGA 2QCHA 2YOCA 1Q2RA 4HLEA 2C9AA 3WXWL 1VPOL 2BVDA 1B88A 2A3TA 5F7EH 4Z7AA 1O9ZA 1A7PL 4UDUB 3WKPA 3S9IA 5LNRA 3AFLA 2RH0A 1EJSC 1KBIA 4ZXBD 1UVQA 2YGQA 4PRHA 2XWJA 3LB6C 3V9CA 1NC4D 1E1CB 4JY5H 4NUPA 3QHMA 1KIQB 3DV6A 5HQLA 1N6UA 3FTGA 4L8SB 1BEXA 1RULL 2WXHA 2W61A 5ELIA 4UTTC 1CR9H 2ZCKL 3CDGB 3FN9A 4ODXA 5EO0B 2MCPL 3RE0A 2PAJA 2WJEA 4LPUA 2V5CA 2CRMA 1PSKH 5C0BE 3HC4H 2KQMA 1SQMA 3P3UA 1IKOP 3V4VL 5AYBA 4BA8A 2WZIA 1TG8A 4JY8A 3Q45A 5C0BD 1DN0A 4HHLA 4CSTA 2MQ3A 2Z31B 3GBNL 3TVMA 3SUWA 1J5IA 1W5PA 5MENE 1W5QA 4U7SA 4G9PA 4EE9A 4Z2KA 3KPSA 1JWSB 2JELH 4HP5A 5B1CA 3MV7A 2HWZL 2ZAIA 4OZ4A 1HH6A 3HVNA 1B4EA 1ET7A 1UG6A 3PANA 3W07A 3FTUA 3OMZA 3PTKA 4YTSA 4W1TA 2JIXB 1CICC 3KW3A 4JHOA 4I88A 1KBLA 4XVJH 3MB9A 2CFFA 4QITA 1ZHNA 3RQ3A 2KPNA 1C9SA 3AJ7A 4M7JL 4MHHG 4TXVB 1YNYA 2VELA 4LV9A 3R8QA 3VGAB 2HMID 1UM5H 3CVHH 3QR2A 3SBPA 1U8HA 1HKMA 1JULA 3O9WD 4CKQA 2EPOA 4DKTA 5DJ2A 1GPWA 4Y16A 2WMJA 3C0LA 3G0UA 2JI2A 4UMCA 4XXDA 3CHEA 2NY7H 2ZZ7A 2A9AA 3FU0A 3GDMA 3IWPA 1XEDA 3PS7A 3L3GA 1QFWL 3WCYA 3CV6A 2YGVA 3C09B 3VD4A 4MNKA 4J23A 1SJXA 3DDMA 2HT2D 3QIUA 4IYKA 1UR0A 4CQ8A 3FSWA 1LO0L 3L5WB 3ONCA 4JN6A 1F3DH 1UQZA 5CBAB 4MZ8A 5AOIA 1WT5C 2AV1B 3CZKA 3ZUNC 1VYSX 4GSXA 1OP9A 4XX5A 1NSNL 4AT6A 2ATSA 3CZFB 4M5ZH 4YHLH 4HZLA 2DFAA 2RDUA 5A8MA 2WZPD 4U1GB 2X4OA 4NPYB 1B0RA 4BFKA 2PYEE 4TQEL 4DKDC 1PDYA 1DDTA 1VGAA 3O05A 4MFEA 1LWRA 4F15B 4N2DA 5J9PB 4U7KA 2FYMA 2Y6SC 5L4FA 2XPKA 4F9LA 5HA7A 4N2EA 3SJVA 2Z1BA 1X97A 3ZJ8A 1IEHA 3O6FD 2LOEA 1QHPA 4HYTB 3DV4A 3M1BB 4J6IA 4RX4A 3TYGL 4WEBH 4DP7X 2PDMA 4S3CA 3X11A 2NY2D 5EIQA 1N4XL 1C12B 3NABL 4X0KB 5HYFA 3MRGB 2Z7KA 5A8QA 1DVFD 4P23B 4NKIH 2ZPKL 1AQKL 3IXTB 3GTFA 3VI2A 3Q05A 1CC3A 4IW4C 4LSUL 5GGSB 1AYRA 4MXVF 4AEIH 2F7FA 4WOQA 3T4CA 3GSQB 1JFQH 3WMLA 4P23D 4BH8A 1WZKA 4O15A 2J8GA 1GYUA 3H9SE 3IV3A 1ZEAL 3LEYH 3M0LA 1NEUA 4HOXA 1UWTA 3MCOA 2ED7A 4FP8H 2HVBA 3T0EB 4LBEB 2CBOA 1ZP3A 4S3GA 2X3CA 5AC7A 2WYTA 1VEPA 3K7UA 3ANUA 1MQKL 5D4HA 4R96B 2QADC 5DHXB 2DI9A 3GSWA 3WTVA 2HS8A 1RU9L 4ZMPA 3H12A 3GXPA 3DX6A 4NKDA 4ODVL 5HHVH 1OP3H 3RUGA 1FDZA 3BYYA 3MLWH 3UJ2A 4KUCD 3DARA 5FOJA 4NDMB 5CILL 5KSAB 3U9UA 4D3CL 5HJ3A 1AHWA 1OK4A 1OFBA 2XWZA 4LW7A 1KCSL 3CVDA 3DO4A 1OAXH 2FMOA 2GK2A 3U7AA 3E96A 1I4FA 4HQQL 3B8IA 3TN6A 3G5VB 1L7IH 1XCTB 5F0MB 3QA3B 4L4VD 3HPAA 2FJHB 3BAWA 2G3XA 4QRSB 4EXAA 4DPQA 4L8DA 4RGNE 4MAZA 2B7QA 3K72B 4IMLA 2XFXA 1N68A 3GMOB 4WJG3 3WL9A 3X3FH 3DGCR 1B4KA 3HI6H 3K13A 5B7YA 1NDGA 1E5JA 1NMCB 2BIHA 2VW6A 3GMPA 4IS6A 5K59E 2POZA 2EIJB 3G04B 2XUCA 1TLMA 5E09A 3PV6A 1UENA 4G7RB 4KUCF 5KSBF 3L13A 5FF7A 5G2HA 3F4DA 1MZYA 3DVNA 4LARL 3FVMA 3BJSA 3ENEA 5F7KC 1Q9KA 4GAGH 2JGQA 1WOAA 4JRXD 5IB2B 2V5JA 1OQXA 4LPCA 4AENA 3F04A 2RFGA 4FMVA 3QN3A 1OCWH 4NXKA 1UB6B 2AEPL 5HJBA 1MZHA 2EKJA 2DWDA 3D1MC 3R25A 3AYSA 3VNMA 2FL5B 1EFXB 1A47A 2ZKXA 3MNWB 1UB5B 3QIBB 4TPRH 4WEBL 1YDPB 1LQBC 5B7EA 3OF6D 2AVFA 4B96A 2IBZY 4YDNA 5D7LE 3SGKC 1JDEA 4AZIA 3ETBJ 1JHLH 4L4VA 5F9AC 4OVXA 4HIPA 5CEZD 3B8VA 3QUXC 5HNRA 3WUBA 4HUKB 3R0MA 3OM3B 2QPXA 5LXXA 1NANH 3WTWA 4DBSA 4M93B 2EJAA 4AQOA 4UFHA 4AY7A 3II3A 3SBWC 3VXMA