1OSEA

Porcine pancreatic alpha-amylase complexed with acarbose
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGSREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGEDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWREIRNMVWFRNVVDGEPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PORCINE ALPHA-AMYLASE
publication title Crystal structure of pig pancreatic alpha-amylase isoenzyme II, in complex with the carbohydrate inhibitor acarbose.
pubmed doi rcsb
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1996-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1oseA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1oseA01
5AC4A 5BXTA 5CPQA 1UD8A 2BV9A 2O9OA 3MV01 4AZIA 2C7FA 4M1RA 2IXUA 1MW1A 4PEEA 5GPRA 2X2IA 2XVLA 5I0DA 4CD4A 1AVAA 3AS2A 2X8RA 3UETA 5A3HA 3RIKA 1W9BM 1MQQA 2WWCA 1E9LA 1OGBA 3EDEA 5E09A 1KBBA 2WVVA 1GOWA 4HU0A 2DIJA 1C92A 1QWUA 2WHLA 3VGBA 4AMXA 4TX6A 4UZUA 1J0ZA 3GXTA 4M29A 1EHAA 1EOKA 3MSGA 2D0GA 1MYRA 5DO8A 1PJ9A 3SUUA 1HIZA 1KXTA 1V3KA 2CERA 2YJQA 5CLTA 5I5RA 5E6ZA 1E6XM 2J8GA 3THCA 1UR4A 2GK1B 1UWQA 4H8HA 1TVNA 3EJTA 3S5YA 2EXOA 2G3NA 5DFAA 1HWWA 4XV0A 1C93A 1HX0A 5DMYA 1X6NA 4ZENA 1SR0A 3IGUA 4W8BA 1WZMA 4YHGA 4IPLA 4GQQA 4J27A 1UD2A 1E6SM 4HTYA 1WP6A 2Y5EA 3BVXA 3MO4A 4IUGA 1QW9A 4HP5A 4CCEA 1TQTA 3N12A 3D52A 2D0HA 2Y2WA 5FOOA 1AQHA 3VGHA 1NQ6A 3MMWA 3WDPP 3WD1A 5F7UA 1CTNA 1UQYA 1UWUA 3W24A 4AD1A 4CCDA 1IZJA 5FD0A 2ZWZA 3WNLA 3GH4A 1E71M 1KGUA 4QCFA 2A3AA 3VGEA 3T08A 4D6DA 1XYZA 3LPPA 4JHOA 4R5EA 1UD4A 4AEFA 4LYPA 5KZ6A 3ALGA 1QI2A 2ZX6A 4HA3A 4FNRA 2PWFA 4PMQA 2VRKA 2WVTA 2GSJA 3AIBA 2ZUVA 1PIFA 1E6ZA 2Z1SA 1HJVA 3ARTA 2CETA 5A6LA 2RGLA 2XHYA 2D20A 3EDFA 1W91A 3VIIA 3RM9A 2D1ZA 1ISVA 3QHOA 4U5IA 1I75A 4X0NA 4D1JA 4BS0A 4DUWA 1ZL1A 3RO8A 1C7TA 1EDGA 2PBGA 3VX1A 3ZMRA 3N9KA 1KQZA 3T0BA 4B16A 1UH3A 3CGTA 2ZICA 1FH8A 1I1XA 3PN8A 4PMZA 3HG2A 4RE2A 1QI4A 1EQPA 4HA4A 1XSKA 2HVMA 2YDSA 4PTVA 3WUEA 4JL2A 3DHUA 2D3NA 4LGXA 1UD5A 2VMFA 1HKMA 1Q6CA 3WDRA 1E55A 1XC6A 3CHCA 4QLLA 2PBOA 1BYCA 1UR2A 1FH9A 3L2MA 4HMDA 2XGIA 1WDSA 5GNYA 3AOFA 1J11A 5M3WA 2WCGA 4QFUA 3CHDA 3CUFA 3A4AA 3WUFA 1JYXA 4AZCB 1OM0A 2BY0A 2DSZA 1FA2A 2EO7A 5A8MA 4LPCA 4UOQA 2VO5A 3M46A 3L4UA 4AMWA 1UR9A 1X6LA 1XD0A 1B90A 4TTUA 5CGMA 1B3VA 2BFGA 2VR4A 1G5AA 4JCLA 2WB5A 1R75A 1K9TA 1QWNA 2BHUA 3T0AA 3EYPA 1FFRA 3DDGA 4D72A 4JZ5A 4NZJA 4EKJA 4OKDA 3SUSA 3AYRA 4PSRA 3WQ5A 1UYQA 3AHYA 4LQ1A 4PUEA 2WLZA 4AMCA 4U2YA 5HDRA 2O92A 1OGGA 5CG0A 1GOQA 3CO4A 1C7SA 2X1IA 3VU2A 1I1WA 2VRQA 1JAKA 2J8FA 4Z2JA 4JIEA 4MAZA 1G01A 1E4LA 4PRWA 1UR0A 2Y8VA 3AS3A 2XN0A 3PZNA 1JNEA 3T2QA 1JIBA 1W2VA 2BVDA 4E4PA 2WCSA 4MJ2A 4ATDA 3DX2A 8CGTA 5DT7A 6A3HA 1OSEA 1VFFA 3PZ9A 3BXWA 1NH6A 2OYLA 3WF4A 1LQ0A 2OWWA 4AYGA 3BVUA 4QLJA 1ZJAA 2WVSA 3GNRA 3SCNA 2WM0A 3L4TA 1PBGA 3BUIA 3VM7A 4P7LA 4UFLA 4EK7A 1HTYA 1QNQA 1QHZA 1BHGA 2Q8XA 3VIHA 5I2UA 5E1QA 4PMXA 4HMCA 4UFKA 5IFPA 1CXLA 1E15A 1E40A 1KWKA 3QR3A 2WYSA 4PMNA 4W8LA 2VZOA 1V6XA 2VZUA 4F9JA 2FE0A 1XHGA 2V5CA 2F1BA 1M53A 3SCPA 2ZUSA 2VOTA 4CUCA 1UUQA 4H41A 3CZGA 1JZ6A 1JGIA 4MB4A 4X9YA 5DEZA 4BQ3A 1WB0A 3WF1A 4UNIA 4FNSA 1JYNA 2UWFA 2XFRA 4R27A 1EOMA 2CBVA 4U2ZA 5EFFA 3PZVA 4HU8A 4DO5A 1SYTA 1G0CA 3RILA 1H1NA 1W9VA 3PBGA 3NIYA 4K68A 4J7RA 2BS9A 4RE3A 2PWEA 2BY1A 3WN6A 5CLWA 4UQ9A 2DT2A 1KR1A 3AHVA 1CDGA 4AEEA 1R7OA 2YA2A 1DWIM 4WIWA 2HISA 2JF6A 4CD5A 2EACA 1GOOA 2D22A 3DC0A 4W89A 3KEHA 1PZ2A 1QI3A 3ZT5A 4UOZA 1LLOA 1WKYA 1C90A 2W91A 2OW6A 3MUY1 5A6AA 1TA3A 3A4WA 1OIFA 3VSVA 3BUBA 3POHA 3ALFA 3IJ8A 4QP0A 3ZR5A 3QHMA 1VEMA 3M6DA 3N1AA 4D1IA 3BGAA 3BSHA 3IJ7A 5JBDA 2NT1A 4PMYA 2C0HA 1W9PA 1ODZA 2OSYA 3M7SA 3WBAA 2E3ZA 1JNDA 3N04A 3O2LA 3ARUA 4GI9A 5CXPA 2WK2A 2X09A 2OSWA 1NOUA 1OINA 5FCZA 2VQTA 3DX0A 2CYGA 2FGZA 2X05A 1U33A 4MADA 3ARRA 1VBUA 4CVWA 3I3BA 3PZTA 1BPLB 1J0YA 2XSAA 4U3AA 3SEPA 5A6SA 5A8PA 4B9YA 3PZUA 5I24A 4WSKA 3KL0A 2AOSA 4W85A 3BUDA 5EMYA 3A47A 4JFUA 1JZ5A 3IAPA 3N18A 1C8QA 1EXPA 2VX6A 5M17A 3BAYA 3GXFA 2DH2A 1MW2A 1US3A 2VX4A 1QBAA 4WKHA 5CSUA 5ABEA 1Q6GA 2DDXA 3GTNA 1ODUA 1H0GA 2F18A 1P6WA 3D4ZA 3LRMA 3CBWA 3WD2A 1UHVA 5IHRA 3WH8A 5CPSA 2VZSA 2YKKA 1W1YA 1G94A 1WDQA 4OOZA 2BVYA 1E4NA 3OGSA 3TA9A 2WAGA 2YLLA 4LX4A 5C71A 4AIOA 1V6WA 5M5DA 2W4XA 4B9ZA 1TUXA 1QNOA 4MPKA 2W92A 4FLOA 3WEOA 4CD6A 3EBVA 3L4WA 5C8BB 3WDJA 2YFOA 2G3JA 4YPJA 2YLAA 2E8ZA 1QNPA 1GHRA 2WWDA 2D2OA 3AMDA 3MKKA 5CPTA 5JIWA 5I23A 4BQ4A 3PHAA 2E40A 1QI0A 4GI8A 1VJSA 1R86A 3ZJ6A 1KGXA 1HKJA 5EB8A 3RM4A 5AYIA 2BHZA 1Z32X 3WSUA 1J18A 2CBUA 3ZJ8A 4E8CA 3WUBA 1F4HA 1VAHA 3CMJA 1GUVA 5AC5A 5JIPA 4W7UA 3S6TA 1QHPA 3A24A 3GNOA 3CUHA 4CCCA 4V28A 1EIBA 4D6EA 4MNJA 1DEDA 1TFVA 4EE9A 3WF3A 4AZ7A 2XFYA 1J0JA 3D4YA 2WMFA 2ZUUA 1JG9A 2XPKA 4HZ6A 3A21A 1GOKA 4LXFA 2GUYA 4HOWA 2WZHA 4DWSD 3NDYA 3AMKA 2DEPA 2J62A 2DT3A 2DT1A 1V02E 5A2AA 1E5NA 4S3KA 4M81A 3KL3A 2ZUWA 1FH7A 3FAXA 1CWYA 1CGXA 2ZIDA 3W6LA 1NWSA 3T2OA 4ACZB 3AJ7A 2JF7A 4FNPA 3VX0A 3SUTA 3VIFA 4WF7A 1NM9A 1DWJM 4NF7A 3VIMA 4AISA 4W7WA 2G4FA 2QPUA 1XH1A 5LYRA 3HG3A 1R33A 3L4XA 3WDHA 4URIA 5KEZA 2VJXA 1KCLA 3GBDA 1H3GA 4XZWA 4FF5A 2ZXAA 1V0NA 3BLPX 5E70A 5A6MA 3ARPA 3WQ6A 4D6IA 4W93A 3AS0A 3VD3A 4P8VA 2DSWA 3OLEA 1E70M 2F8QA 4J3UA 4J3VA 1J9YA 3BVWA 2QF8A 4TVCA 1QOXA 5HPCA 3BMVA 1KTCA 1UKTA 2X2YA 3RDKA 2DGAA 3L4YA 1CBGA 3GH5A 5CZKA 2G41A 1H5VA 1XV8A 2GJPA 4WJXA 4UFMA 5HBFA 3VUPA 4V27A 1TQVA 4U33A 3MMDA 4GZJA 2D3LA 4PSPA 1CNVA 1HL9A 2D0FA 3GBEA 3UR7A 1XSIA 2FH6A 4P8XA 4J28A 2VTFA 3GZAA 4PN2A 1GOIA 1OB0A 3RJXA 3WUGA 3QGVA 2J77A 1RPKA 4F8XA 2PB1A 1QX1A 5C70A 5CJ5A 3A3HA 1VF8A 3L4ZA 1QVBA 4AZBA 1R87A 1BG9A 3ARZA 5FIPA 2CKSA 1V6UA 2XM1A 1JXKA 1BTCA 1TQUA 3A4XA 4CU8A 1D3CA 3HN3A 2WKGA 3KLLA 4MB5A 1QW8A 1UASA 2VI0A 1M04A 2VZTA 1PPIA 4Z2HA 1UKSA 1ZU8A 5I77A 4UZSA 1Q6DA 4DO6A 4ZXLA 3O6AA 1MW0A 1NWUA 4U5KA 4Z2IA 4M8UA 4KRTA 3NDZA 2ZE0A 4AZCA 3BUPA 2YDRA 1TQSA 5IDIA 2E4TA 1AQMA 2VX5A 1GQLA 1ZBWA 3MUZ1 2YA0A 2ZX9A 4DUXA 4W7VA 2VR5A 4NRRA 3ARSA 3AXXA 3BAJA 4D6JA 4PCSA 1RP9A 2JALA 3WQWA 4F79A 2VVNA 2O9RA 1JYWA 3AQUA 4Q22A 3LPGA 1WZLA 3AZSA 4MTVA 1Q6FA 1B31A 1B3XA 2ZWYA 4L4PA 5A1AA 2XUCA 3DX1A 2VVSA 4CN4A 5A95A 1V03A 3APGA 5E6YA 4JKLA 3WBEA 3GXPA 3BSGA 6CGTA 1CECA 3TTQA 3A5VA 4NSBA 1C3FA 2E9LA 3VINA 3ZIZA 1CGTA 3CV5A 1E3ZA 3G6MA 2YL8A 3B8SA 2VL4A 2A3BA 5BRPA 3VDHA 3WFZA 3K46A 2UY2A 1BGGA 2G3MA 5I78A 1EGZA 2XSBA 2GDUA 3SCRA 4DUVA 4UQCA 1JI2A 7CGTA 3FNDA 1GQIA 3VMOA 2UY4A 4AZ5A 4CN1A 2YFNA 3AIWA 3F5LA 4KH2A 1HVXA 1W32A 2XG9A 3EMQA 3AHZA 4PMDA 5TD4A 1OCQA 1OT1A 4BF7A 3PZGA 2V3DA 3ZOAA 3RCNA 1E6PA 1WDRA 3W82A 2NT0A 3WQ8A 2GJRA 2XWEA 1HKIA 4J3SA 3PTMA 1TE1A 1U30A 3H54A 4JFSA 1M7XA 2NSXA 1MFVA 2VQUA 3CC1A 5A8OA 3E1F1 3AZRA 2UY3A 3VD9A 4P7NA 3VM5A 1C8YA 3WH6A 1L0PA 3G6LA 1K6AA 1TQWA 1KB3A 4FLSA 3MS8A 4JKMA 4WKAA 1J0KA 1VENA 1UWTA 4WKFA 3H55A 4RE4A 3WIJA 4C7DA 4M82A 2WMJA 4A3YA 1VFMA 5ABHA 3VDBA 3WH7A 1EDTA 3DDFA 1W3HA 1R7AA 2IUZA 2ZUTA 3ZSSA 1FHDA 4N42A 2DH3A 3S5ZA 2WPGA 3VNZA 4XZBA 4AD4A 3D50A 2WHMA 3TTOA 4KGLA 3KLKA 2WC4A 1BG4A 1UQZA 3TTSA 4D6FA 5ABFB 4W86A 5CSYA 5HXMA 3PZMA 4LYRA 4KGJA 1HKKA 7A3HA 1E0XA 3D3AA 1KWGA 1R47A 1IZKA 1SMDA 2XYLA 4ATWA 1L8NA 5A2BA 3ZSTA 4NI3A 4MNLA 3MSDA 3WNOA 4Z2LA 3AHTA 1MQPA 1LWJA 1KXQA 4YHEA 1DP0A 3FN9A 5D9MA 1V3LA 4P7RA 3WELA 1E1EA 3ECQA 5AY7A 2DPEA 2W66A 4B3LA 3AIEA 3LPOA 1PZ3A 2WC3A 1W1TA 1B0IA 3VGFA 5BYWA 1JYVA 5ABGA 4CVUA 1JD7A 2GVYA 4P8WA 1QI5A 1UKPA 1XYFA 3VD7A 3K4AA 1TMQA 4JAWA 4MDPA 3RJYA 1XGZA 1R46A 1US2A 2OSXA 1UOKA 1EO5A 3CPUA 3QOKA 2XIIA 1ITXA 4OOUA 3OB8A 1GVYA 3BAWA 5A6BA 2ZXBA 1CXIA 4HMEA 2CIPA 2CNCA 2PWGA 2PWHA 1DWGM 2J75A 2EPKX 1Q4NX 1B3ZA 2GDVA 1NOWA 4AC1X 3CZJA 3WKZA 1MFUA 1NOFA 3SCSA 4GQRA 1V3JA 3AROA 4JCMA 1CXEA 2WBGA 4GPNA 1JF5A 3BLBA 1NWRA 4E8DA 3WFLA 3FW6A 2EPNA 1V0LA 1WZAA 1PS3A 1GORA 2CESA 3DECA 1JXJA 5GQBA 4GKLA 1HJXA 1BYDA 2F7QA 1R8LA 1UKOA 6TAAA 4AXNA 3UG4A 4D6HA 1JAEA 3SURA 1GNXA 2C8NA 2XM2A 3W38A 1K9EA 1CPUA 1EHNA 4NX0A 2CBIA 1QNSA 2WW5A 3J7HA 5AYBA 3HJEA 5CGTA 1E73M 4JFVA 5A2CA 1PX3A 1WAWA 2IGTA 2YBTA 1T0OA 1ITCA 4UR9A 3VGGA 1ECEA 1GQJA 3A6OA 4QCEA 5A6JA 1BVNP 3LXBA 1TG7A 2EEXA 4QAWA 4GINA 1LG2A 1TR1A 2FGLA 2XJ7A 3GYCA 4UFJA 3ARQA 1HXKA 4JFTA 5BXRA 1RP8A 5BROA 5GNXA 4F9DA 5A6BD 1ZB5A 2WKLA 1KQYA 4DWSA 3AHXA 3O9NA 2Y24A 2J7DA 2ZUMA 3AIQA 1GHSA 3CZNA 1DHKA 3UCQA 4TX8A 4ACZA 3VNYA 3EDDA 3EJPA 4CU7A 3GXNA 2WANA 4HA1A 2E9BA 4TVUA 1VEOA 2YDQA 2YA1A 2CHOA 2PI6A 2QHAA 1M01A 1ZBKA 1LL4A 2YL5A 3WMCA 4BQ2A 1CGYA 2FYVA 3WQ4A 1W9XA 2OWXA 2A3HA 1D2KA 1H2JA 3ARWA 1CXKA 3SIMA 3WDQA 3WMBA 1UH2A 1CXFA 1B1YA 2AMGA 5ECUA 4AZ6A 4OGZA 2DT0A 3HZ3A 2DIEA 3U7VA 2FHFA 1LWHA 3ZJKA 1QPKA 5A69A 1CGVA 3ZR6A 3CTTA 2WC7A 2WNWA 3VIKA 5EBAA 5DT5A 1NWTA 2W63A 5EFDA 3WD0A 3CLWA 1WO2A 3AICA 4AD2A 3EJQA 2XGBA 4MB3A 1JZ2A 1V0MA 4H8VA 1BGAA 1JD9A 3N17A 1HP5A 3BAXA 2V3GA 2ALWA 1D7FA 1CZ1A 4GXPA 3VOCA 1NARA 1E0WA 2E0PA 3GXIA 1E3XA 5D8WA 3OLIA 3UR8A 4JHZA 3WF0A 3W4RA 2W61A 2ZUNA 2VRJA 1HN1A 1FFQA 1ZBVA 3GXDA 3VSTA 2EBNA 4J3XA 3N13A 1GW1A 2BY3A 2J79A 4N0RA 1E4MM 3CHFA 1BLIA 3CUGA 2XVNA 4WLCA 2J25A 4GZIA 1C8XA 1OGSA 1MWOA 2GK1A 2BVTA 2CXGA 4J3TA 1H11A 3VKKA 1IT0A 4HPHA 4F66A 1VEPA 4NZCA 5FL1A 4PTWA 4W5UA 1E56A 2EPOA 1SZNA 5E0CA 3IK2A 1NP0A 2ZXQA 2EABA 4WSJA 1WZKA 2F2HA 4MAVA 2QPSA 3VPLA 3FAWA 1V3MA 1GCYA 3CZLA 3NJ3A 2OYKA 4W84A 1CLXA 3FHAA 2VT0A 3SCWA 1HJSA 3HG5A 1XD1A 1GPFA 2WMIB 1O7DC 4UQBA 3KL5A 3WD4A 3VILA 3GNPA 3WY4A 4AZGA 2VNCA 2WZIA 1JZ4A 4P8UA 1DTUA 3ZJ7A 1J01A 1JZ8A 2BXYA 2JEQA 3NCOA 2CBJA 1DWHM 1ZS2A 3WH5A 3VD5A 1B3YA 2W5FA 2NW0A 1RH9A 3WMSA 2VUYA 1R34A 3OGVA 2YOCA 1HL8A 3U5UA 3SUVA 2CKRA 3ARXA 1V08A 3BC9A 3WNMA 2GJXB 3VTRA 3IJ9A 2XFFA 1VFOA 1HNYA 3UG5A 1GJUA 3ARVA 3F5JA 3LRKA 3NSXA 3CIVA 2J47A 1BF2A 4Q7NA 4CD7A 1ZJBA 4NXKA 5BWFA 5I6SA 1M03A 1S46A 4OZOA 3GDBA 1GVIA 2QMJA 2CITA 3AMCA 3K4DA 2X2HA 3A22A 1UZ1A 5A94A 3A23A 3GXMA 1PAMA 2D73A 2JE8A 1JZ7A 2WMHA 5BXPA 4A3HA 3H53A 1KFWA 3SCTA 1B9ZA 3W28A 3TTYA 3K1DA 4YN5A 1XCXA 4MDOA 3CZ8A 3OZPA 4H2CA 5CQ1A 2XVPA 3AIUA 3EJSA 1BAGA 3EJRA 4BZYA 1J12A 3AYSA 5DF0A 1JFXA 4LYQA 3SCVA 3BAIA 3II1A 1JDDA 1H41A 3TP4A 2Y8KA 4M24A 1ISZA 4Z2KA 5IHSA 4HPGA 1QNRA 2DQXA 3EDKA 4DO4A 2CPUA 2AAAA 1FHLA 1MXGA 1J0IA 1UWIA 3LX9A 2J7CA 4QDMA 2XWDA 4A4AA 3MI6A 4IISA 1J10A 3UESA 2FHBA 2EJ1A 1UR8A 2F7OA 3HU7A 2Y4SA 3GM8A 4Z2GA 1CGWA 1JDAA 2BY2A 1QBBA 3CMGA 4CU6A 3VGDA 1PX4A 1UA7A 5HOSA 7TAAA 3D51A 2RGMA 3N15A 3K8LA 1OD0A 4AWEA 1SFSA 4U31A 4MNMA 3U5YA 3AI0A 2V3FA 4GIAA 1NP2A 1CEOA 5IXEA 3CHEA 3ZT6A 1GQKA 3U7BA 1G9HA 2WVVB 3W81A 1TZ7A 2CHNA 3BLKA 3F5KA 1E6NA 3T2PA 3U57A 1WNOA 5LA1A 3WNKA 3LMYA 3L4VA 4PCTA 4DM2A 4HZ7A 4U3CA 5D9PA 3BMWA 8A3HA 4GO8A 2ZX5A 4GI6A 2W67A 4XX6A 1E4IA 1UKQA 5E0FA 1Q6EA 2OYMA 1XRVA 3MUAA 3OBAA 1N82A 1W3JA 1TCMA 4KMQA 2WBKA 3MANA 3OZOA 5ABFA 1JDCA 2X0YA 4AW7A 1VBRA 1GONA 4XUYA 1LG1A 2VURA 3W25A 4L4OA 1VRXA 1CENA 2EPLX 1HP4A 3EMZA 3LRLA 1E6RA 5I79A 3NSNA 1HJQA 4S3JA 2CCRA 3AMGA 3I3EA 1W1VA 3SCOA 1WCGA 2WXDM 2XTKA 3BCDA 4EAMA 3FXYA 2EQDA 3CZEA 2F7RA 4J3WA 2EADA 3ZT7A 1HT6A 1FP9A 2E9MA 1CYGA 1W9UA 3OLDA 1OBAA 5A8QA 1C91A 1W3KA 2ZX8A 3AIRA 1WDPA 1OWQA 3WEZA 2V5DA 1VB9A 5BCAA 1JI1A 4P7QA 1Y7VA 4OUEA 3W53A 2O9TA 4TOQA 2VC9A 4GZEA 2PWDA 3OLGA 3LXCA 5JUVA 1X1NA 4AD3A 2DSUA 3OA5A 1DWFM 2WMGA 1BSIA 2EPMX 3W0KA 4ZEPA 3WL1A 4TXEA 1ZBCA 3MMUA 4PMRA 2YIHA 4KWUA 3FY1A 2IXVA 3UERA 1WE5A 4UCFA 1EQCA 3I3DA 4IM4A 2B31A 1CIUA 2WZEA 2MANA 3AXIA 4HOXA 2VCAA 5M03A 2GFTA 4PYSA 4PMOA 2JIWA 4W88A 1LF1A 5LA0A 3CZKA 4MNKA 1V3HA 3L2LA 9CGTA 1V3IA 4FNUA 3VMPA 3PTKA 2FDMA 4CN6A 1V6VA 1AQ0A 5D8ZA 3F4VA 5HPOA 1GZJA 2QLYA 2JIEA 1TVPA 3VVGA 1UA3A 1E43A 3KWXA 3LPFA 2A3CA 3THDA 3ZM8A 4AY1A 2J7EA 1JZ3A 1W2PA 4AZHA 5LA2A 4MJ4A 1KCKA 4Y7EA 3SUWA 3RPMA 3NYDA 3EDJA 4W87A 1UD6A 4W5ZA 1ISXA 1H4PA 2Z1KA 2FHCA 1UZ4A 1K9DA 5D9NA 1IV8A 3CH9A 3OG2A 5A6KA 3KE0A 2WHJA 5GNZA 3DX3A 1KXHA 1CXHA 3DYOA 4AD5A 1KXVA 4RL3A 3KZSA 3SCUA 4AYSA 2G8ZA 2VCBA 3WNNA 1XH2A 2ZX7A 3K8MA 3W37A 3BAKA 2X0HA 4DM1A 3MUIA 3PZOA 4D6CA 1ISYA 5D9OA 2J78A 5FL0A 2D24A 2BNJA 3B9EA 4IPNB 3WL0A 1H0IA 4PMUA 3WENA 2J7GA 1PEZA 1BFNA 1WPCA 1OD8A 3TV8A 3TOPA 2V3EA 3BH4A 4XB3A 1PX8A 2X2JA 3WD3A 4AIUA 2FH8A 3N11A 3DYMA 2QV4A 2UY5A 4QLKA 3DYPA 3W6MA 2D23A 4NRSA 1R85A 3VIJA 1W1PA 2A3EA 4UOJA 5FKYA 1OIMA 4V2XA 1V0KA 2WVUA 2OW7A 2WMKA 3CUJA 1UD3A 4FLQA 1EO7A 4W8AA 4M80A 1A3HA 4B15A 4JL1A 3UEQA 3WF2A 3VO0A 2F61A 1EA9C 1KGWA 3AZTA 1KBKA 4UQAA 4DWSC 5E9AA 4ZE4A 4CD8A 3SCQA 2V38A 3HMCA 4FMVA 4OBRA 3GH7A 1ESWA 3BUQA 4PUDA 3BCFA 3UG3A 1MW3A 3QOMA 4HZ8A 5BRQA 2ESCA 2OWCA 3WNPA 4UFIA 3RMEA 4JKKA 2J7FA 3PZQA 1UR1A 5IFTA 4KRUA 4PBGA 1JL8A 4H8UA 4FK9A 1GOMA 3IAQA 1B2YA 4CKQA 1H49A 2ZXDA 4HOZA 3B9AA 1VFUA 3AS1A 1EH9A 3VDAA 4ZXOA 5A8NA 4BA0A 2OLHA 2JEPA 4ML4A 4UTFA 2YL6A 3CUIA 4FNTA 2VCCA 5BXSA 3OIHA 1VIWA 4H04A 2E8YA 1JFHA 4FNQA 3ZQ9A 2XVGA 3T0DA 1UG6A 3WY3A 4ZE5A 3WQVA 2EAEA 3M07A 2YBUA 1XSJA 4P7OA 4E2OA 1HVQA 2WCAA 1FP8A 3EMCA 4D71A 3MV11 4WK9A 3POCA 3AMLA 3WY1A 3EJUA 1SMAA 1K9FA 1FOBA 3AXHA 1W3LA 1YQ2A 3BVVA 1CGUA 1B3WA 3WY2A 3D5HA 2WMIA 2DSKA 3AFBA 3ARYA 3PZIA 1E6QM 1AMYA 1LL6A 2PF0A 1UWRA 3WEMA 1YHTA 1E72M 3VIGA 3W29A 1BYBA 4UQEA 5I3DA 3PTQA 3VDCA 1KTBA 2F1AA 3IANA 1XCWA 1TA3B 2VX7A 3ZO9A 1B30A 1MVYA 1MQRA 1VJZA 1E5JA 4NXSA 5JBFA 1BQCA 1XH0A 3VIOA 2DSVA 4CGTA 3QHNA 4M56A 3VMNA 1F4AA 2W62A 3DHPA 2WHKA 1LL7A 3LXAA 1UH4A 2GJXA 2BXZA 4TUFA 2JFEX 2O9PA 4AD0A 4MB1A 4TVDA 1A47A 2WSKA 2YL9A 3TONA 4ACYA 4OBSA 4TTGA 1O6IA 4NZFA 4PTXA 2G3IA 3AISA 1OT2A 3RM8A 4BQ5A 2PC8A 3B9DA 1GJWA 3NSMA 2J7HA 2J7BA 4C7GA 3W27A 2F7PA 1J0HA 1EDQA 1PIGA 2XN1A 4D6GA 3BVTA 3K8KA 2WSPA 2XIBA 5JBEA 4C7FA 4EANA 3VIPA 3OGRA 1KR0A 1BVZA 3DX4A 1UWSA 2J74A 2XVKA 1W9DM 1O7AA 3WDIA 1V02A 4UFHA 4AIEA 4PTMA 1E1FA 1HJWA 1LJYA 2J4GA 4DWSB 4JFWA 2BHYA 3NUKA 4B3KA 4OIFA 1HF6A 3HG4A 3MU7A 4BCEA 1HJUA 4GO9A 5HNNA 1V6YA 4H7VA 2QMKA 1DWAM 3VD4A 5D4YA 2WLYA 4OJYA 3VSUA 1MXDA 3W26A 2XN2A 3JUGA 2TAAA 1E0VA 1CLVA 1H09A 4FLRA 1JF6A 1G1YA 4ATLA 1QHOA 4ZFMA 2CEQA 1HXJA 1BYAA 4X0VA 3T09A 1U2YA 3WH9A 4UQDA 2VZVA 3AIVA 4PMVA 2ZOXA 3FHQA 1ISWA 3CZSA 3S2CA 1RD6A
chains in the Genus database with same CATH superfamily
2Q8BL 4Y1AB 5TQ0H 2IAAC 3D39A 4LNCA 1WBZA 1QDSA 3F7RA 4L3EB 2LOEA 4DEWA 3BQUC 2WVVA 2O7SA 4ALDA 4MBOA 2VWSA 4WI0A 2NSQA 1YEKL 2VXQL 3PUGA 1KXTA 4ZJ9A 2PW1B 1B2WH 4PHXA 2P28B 2YJQA 4EDXB 4ONHA 5E2TL 4GO6B 3GUGA 2HFFB 4I2XA 3RTQC 2G5RA 1M1BA 1BLNA 3C87A 1E6SM 5C0FA 3MJ9L 5AVVB 5C1MB 3H4FA 1FWJC 4CCEA 1IIGA 1YY9D 1CTNA 3T8QA 1HOEA 5KVFH 4C56A 5HHQA 3QJAA 4L8SB 2WO2B 3SGZA 2ZXGA 5GGUA 4QRPD 3A67L 3BZEA 2OTDA 5LIXX 4U05A 2DWEA 3IWVA 3P4OB 1SDAB 2FIKB 5HJGA 5KUKA 3FT3A 4M19A 3JS3A 2PXYA 4DJMA 2A1YA 4F2FA 1J87A 4GKTA 3FIGA 4RX4D 2WXGA 2IWKA 4JPKL 4JPIA 1QNZL 3C09B 4KI5C 4UTLA 2GY5A 2R4RL 4WW1B 1I3GL 2XXCB 2ICCA 3CWOX 5DBUA 4GRLD 5DZAA 3VWJD 1GGYA 3PN8A 3UC0L 5CMAB 3S1UA 2A77H 3RBGA 5I6KA 1O7SA 4DPAX 1MJJA 1TLMA 4LGXA 1U1UA 2VZ1A 3EWBX 4ZT1A 4UTCA 1YAZA 2GJ6D 3L3DB 1F6LL 2FCBA 2PD9A 3W2MA 2B2XH 2XGIA 1OF8A 2LTQC 3AB0C 1SR9A 3W7LA 1JPEA 5F1NB 4AGQA 4ZUVA 2IG2L 4AZCB 2Q10A 2OZ0A 4UM9A 2DSZA 3QXDB 4Q9CA 4R7JA 3ATYA 3FGCA 4JCLA 2I24N 5EBWA 3CN1A 3DFOA 3EWCA 3HE6C 2CXKA 1YAIA 2BWDA 5BZDB 3IXAA 5XIAA 2RJGA 3HKFA 5HDRA 2BOBB 4XPFH 1PBYA 5BO0D 4K9EC 3JV4A 1Y6NR 3QUZB 3J07A 4DGIH 3CN2A 1MG3C 4XO6A 2OI9B 3TEZA 1P43A 4ATDA 1E7UA 1NH6A 5CJOH 3G1XA 2IMMA 2NX5A 2VAAA 1QU4A 2VB5A 4K71C 4UDUA 1SDDB 3KDNA 1KEGH 3D1MC 3RKDC 1KJMA 1OE2A 4HX1B 5LHDA 1ZK9A 4N8CH 4A6YL 1S3HA 3WTSA 4CNPA 2QR6A 3LRSB 1NGPH 2VRAA 4DVOA 1J8SA 1MJ8H 1XHGA 3KVPA 4DCQA 4Q9QH 3KW3A 3ELQA 4YIQA 2N56A 2GIXA 1RZKL 2CZVA 4HZAA 3IGAA 4ZAKC 5AYUH 2CBVA 2I60L 2EYRB 3L3HA 1A4LA 4MVAA 4LVAA 1G0CA 4Q8BA 4RPPA 4DKEH 1MFBL 1W9VA 3RAOA 4YHIB 4KAQL 2VSCA 3R1GH 5ADOH 2VEIA 4GY0A 2I9LA 4S3CA 3NAAH 5KSAB 2J20A 1NELA 5JQ9A 3AALA 4W89A 4L5ZA 4HALA 3D18B 2PTWA 4PL1A 4UOZA 4MNQE 4I1NB 1YNYA 5HHNB 4LDOB 2H6PB 2AP2A 4IGHA 5E4EC 4QP0A 4D1IA 1YPZB 4XP9H 5J11B 2AJ3B 5CP7B 1AFSA 1W9PA 2XDHA 3L4CA 2PDNA 1TTRA 1M7UA 2DQFA 1IEWA 1NGXA 1JNDA 3BLEA 2OSWA 1NOUA 1V4YA 3GHEL 4A6YA 3DX0A 5LKNA 2QULA 4MUZA 4L3CB 2YYUA 4XZUB 5GJTL 4HN4A 1BIIA 2FECI 3PBMA 1BPLB 5ABDE 3DMMC 3MACL 4PHZA 5A6SA 1JNNH 1LM1A 2H32H 1VCFA 3V7AG 5EO0B 2W0UA 1UC5A 4HD9A 1KF9B 4J2QA 2DJMA 1DCLA 2ODHA 3H2PA 1HHIA 3T6QC 1US3A 3GTNA 2XFXB 3CBWA 4NZUH 1IVLA 5BZZA 3L1OL 3O3AA 3WXVH 2OMXA 2W80C 4XCEB 5DFVC 5E9DD 4XX1E 4JY5H 1Q90A 4IRSB 3GSNH 4WFGE 3AXLB 1NCCL 4G1MA 3AMDA 5HJ3A 3QP3A 4X4MA 4JZJA 2WNXA 1KGXA 1EA0A 4DGYL 3B6SA 4OT1L 4PW9A 4BZ2L 3EH2A 2JNZA 1H7WA 3VNDA 3B8TA 1QHPA 5FF2A 4MNJA 4EE9A 1GS8A 4HZ6A 1EGMA 3LZQA 5JMOC 3SN0A 2YBGA 1OAXL 1QMLA 2BRRL 3QNXB 5D1XA 4QEHA 1Y6MR 4UTAL 2ZUWA 5GGRY 4LBUA 4M8QB 2ZIDA 4RDVA 1VYSX 3UJIL 4N5ED 4N4YB 4Z7VB 6TIMA 4LY4A 4C4KT 3LQGA 1XH1A 2K6WA 3V8OA 3OJVC 5IWLA 1GWJA 4WCYH 2Y06L 1A1MB 1UXSB 3OLEA 1E70M 2VXTL 1XIWA 2VLRB 4NC1E 1JR1A 2V9QA 4NO5A 1XH3B 3QXVA 3BW9B 2VGBA 4X63A 3JU2A 3IPWA 5FEPA 3GH5A 2LU7A 5HDBE 3P84A 3FB8B 2WWMD 5GHWL 5IHZA 2AHIA 4IXHA 3VUPA 1EX5A 2FVNA 4EI5C 4R84A 3FU7A 2V5MA 2D3LA 4HJFA 3LERA 1ZE3C 3HNSH 1CL7L 4J3OC 5KVGL 1OB0A 4P59L 4LARL 3QISA 1MFAH 5TQ2L 4CNNA 3MLYH 3KW7A 4H44C 2GT9A 5DJDA 3C6CA 3ARZA 4U1IB 4C6IA 2UUDK 5D6DC 4F8TA 2WKGA 3SOTA 3HHSA 1QW8A 2VDPB 3W2KA 3BKML 1PPIA 4A8RA 1GPOH 4WSGA 1T0NA 2OMVB 5TH2B 2C1GA 5MEOB 5HYSB 4YN3A 1TQSA 1Q7ZA 4MA8L 2ZX9A 4H1LG 4FYSA 5T1LB 1TEGA 2WW8A 1NCBH 3F58H 1N8ZA 1ICSA 3UP1A 2XIJA 4BE5A 2DQTL 1LCOA 5DRCA 1W0VB 1FCBA 1PU0A 4ZXBC 4IS6B 4IX0A 2ONEA 5ICUA 2G3ZA 3K80A 5GGRB 3FC8A 3NXLA 1LK3H 1VADA 2V5JA 3PBUA 1OGAA 1IQWL 3AU0A 1LNUA 3N40P 3TF4A 2V2DA 5C09B 5JPNC 3WO4B 3HZYA 4OD1L 4YX2L 4ADUA 1P4UA 4KI5F 3APMA 3UG8A 5FYJD 2ICSA 3V5HA 1UJ3C 1E7VA 4MKVA 3GMLB 4Z0JA 2ZE3A 4XTRD 2GSGA 2HZHA 3ARDC 5DRWB 5IW6A 5F89B 5E4OA 3CC5B 1JNHA 2D4FA 1DBJH 5JHDB 2HMCA 4KH9A 2Y63A 4AIBA 5D4IA 2JQMA 4Z77B 4B7LA 4HLZH 1KCZA 2CHXA 3O06A 3GKAA 4LKXA 1H15A 1ROWA 3SKJL 3T6WA 4Z0BL 4WKFA 1OAYH 1V54B 3K6OA 4TLSA 3W0WA 1YG9A 2GHWB 4MPQA 1KXVC 1EDTA 3LUTA 1R7AA 2X28A 3ZSSA 1FHDA 5I1LA 1E9OA 1CR9H 5PTDA 4KGLA 2BOCA 3VACA 1VPOH 4MS6A 4CMMA 2UUDH 2E5EA 1GKRA 3VH8B 3MYOA 2PTTB 3LN9A 1FBAA 2WXRA 1OB1B 4UTIA 4JHWH 5B38B 2JB6B 3CZFB 5B7FA 4MNLA 1V7YA 3GDLA 4HFUL 3BKJL 5D2LA 1L9RA 3LPOA 1JTOA 2ZZ5A 4Y2WA 5IVNA 1BQHB 1D5MA 4F8OA 1VKXA 2NY4B 1XYFA 4JAWA 4G5AA 4DJDD 1EO5A 3CPUA 3FN0L 1XRSA 1F6KA 1C16B 2VMDA 4NP7A 3MFGB 2PDPA 3RNQA 3V0UA 3HC3L 3SPVB 2R0LL 4GQRA 3H42L 2EPNA 4JFZH 5I3GA 2C18A 1JXJA 3SGJA 1KJ2B 2CIKA 4UILH 3GX9A 1S9WB 2DQUL 1CPUA 3BWAA 3HJEA 5CGTA 4E2VA 4WHYG 1CLYH 4OZHE 1EEYB 4DN4L 3BDKA 3LIZH 1WUEA 2EEXA 3OV6A 5GZNA 3NEHA 3JWDH 5BXRA 3W5NA 1SUXA 3SE9H 1RJYB 3HGOA 5HTSA 2IPUK 3K5RA 4QGCA 4JFEE 2Y24A 4HIPA 1UOLA 5IHUH 2XVBA 5E8DL 3E0IA 3FA4A 3UT0A 2Z1VA 5I3FA 3UJJH 1NC2B 5DUJA 1FI8C 1XF5A 1W1IE 1ORQA 2YA1A 4UT6H 2PI6A 2EIDA 2QHAA 5CD3A 5GS0C 2Z2BA 5E03A 3EX3A 2ITFA 2OSLB 1XJBA 1I0BA 2G50A 5HHMD 2W94A 1UFUA 4X4XA 1SM3L 1O4UA 2DIEA 4P05A 3U7VA 1SOKA 3O63A 2KMWA 2CHWA 4BHUA 4LLWB 2AJSL 1V7NH 3N17A 2EIZA 3RGBA 5CC5A 3STCA 4LBSA 4XO3A 4LCYB 3U9PL 3BISA 4XXCA 3FQXA 1ACZA 5CEZD 1LWIA 3B3DA 1ES0B 4GZIA 1MWOA 3FOLA 3NDYE 3WZ0E 1VEPA 3CIAA 1OY0A 1XB8A 5AZUA 3IGSA 2BSRA 1ASOA 3VNKA 3F4CA 4PFMA 3HB3B 2ATAA 3CZLA 4X6FB 2OYKA 1CLXA 2CDFB 2XY1A 3VFRA 5AW9B 1GG0A 1EFQA 4Q4MA 2IS7A 4N0CD 1VCBC 4E3VA 3PF3A 5BZWB 4CBPA 1GPWA 4M7LL 4RAUB 5CSRA 3N2TA 1WXJA 4FQHA 4L23A 1LLWA 1KBIA 1JGEA 4IQDA 3DNKA 3QT2A 5JQIB 3T5WA 2CKRA 3UP6A 4P2QB 2LVEA 3PPGA 3BC9A 3WNMA 3SQOH 1VFOA 3GJEB 2XRAL 4N86A 4Y4KB 3LRKA 3CQJA 5BMXA 4MNGB 3SOBL 4BUGA 1A9VA 1TWWA 4Z7WE 4QHLA 4MXVE 1JDEA 1ZUAX 3TV3H 3TBWA 1P7KA 4LP8A 1I1FB 3GSUB 4BRJA 2XWJB 3A22A 3ZE0E 1GVEA 4R90L 3IUHA 5C0RL 2ESVB 4NBYB 3WIIH 1XCXA 4PJFA 4PJ6A 1HIML 2VLMD 4HCRL 2WHVA 2VDOL 4X5LA 1EBGA 5DF0A 2P1YA 3II1A 1H41A 1T3FB 1TV4A 2NWRA 3SPHA 2DQXA 3EDKA 2YXOA 4J3OF 5ITBL 1MFCL 1SFTA 3NJGA 1BQRA 2Q6WB 2Y4SA 3MRMB 3RGHA 2XTJB 5HI5C 5HOSA 3IJQA 3V95A 3ZXWA 4JVPA 3K91A 4LASL 3U5YA 5F9AC 1NAMA 5FUZH 3IRDA 1AQFA 4HSOA 4JHBA 5AWNL 2YAPA 4FLHA 4J1UA 1RXOB 3UZWA 3FQTB 1NAKH 3WNKA 2LU5A 2O5ZH 1MSSA 4WY7H 1QVOB 4LLMB 1DXIA 4XPGH 1IEBB 4MZ1A 3CDZA 5D7JA 3U82B 3GHBH 3CVBA 1ZAGA 1XRVA 2XNAA 4XHQA 3MANA 1JHKL 2XWBA 4ORGB 2Z91B 1T80A 3GHPA 2NVDA 2EXYD 3DJTA 1ETZB 4HZMA 3VGAB 1YXYA 4QJ3B 4RIRA 4K7PL 2HVJA 1LP9E 5AL0A 2CLHA 4HCRA 3ZT7A 3KBNA 5LGYA 1YRKA 5A8QA 1OTTD 5DMGC 3ZS4A 1P4IH 3ZY7A 3VKAA 1IF2A 3SGKA 3OF6D 3BUYB 3M45A 1GS6X 2HFGH 2OJPA 4PC8A 4EKXA 4LEXL 3STEA 2GTWA 3OP2A 4E42A 1KGCD 2VKZG 5G4NA 1LHZA 1EMTL 1QUNB 1RQ5A 1NTHA 1K5NB 4BSVB 4HOXA 4NQQA 4LP4A 1T5WA 2HVOA 1ORSA 2F8OA 2FDMA 3KPOB 3ZUNC 2JCCF 3AQDA 1Q7MA 2FL5A 1QPRA 2VAJA 4LVHC 1E6JL 1IKFH 5H37H 1TVPA 3LM7A 1TPDA 2W65B 5GS2D 3ETSA 4JG9A 4AY1A 4AXKA 3S5SA 4LEOB 2ABAA 4N0YL 1Q9LB 1M7JA 2Q86A 4LRSA 2IAMB 4HEPG 3QE5A 3HJZA 5TDOB 1DANU 1TIUA 1IV8A 1QYGL 2OT0A 4BKLA 1W80A 5I30H 3TJIA 4JM4L 1ISYA 1I1RA 4F7CB 5GGTL 2ATMA 1FV1A 3FTXA 4Y5YB 2QSVA 2MH4A 3UIYA 2A85A 2V3EA 1KB9J 4HT1L 3N11A 4U7SA 4QLKA 3DYPA 4Y2OB 3BP6B 1H8NA 2DU2A 2OW7A 1EO7A 4HUWB 4J1OA 2AQOA 4RGNC 3QSTA 3FH5A 4DWSC 3EGJA 1DQML 5EUOF 2HWZH 5IVXE 4JFFD 3F65A 4R9OA 1JPSH 1MW3A 3ZTCC 1S2AA 2OWCA 1CICB 4UFIA 1KJVB 1E0OB 1H8SA 5K1NA 3PANA 2KDGA 4X99A 5I0YA 4JFDE 4HOZA 2XWTA 4NNPH 2BNRB 3APNA 2VDQL 5I1CH 4AEIH 6ALDA 5C0DB 4L4VB 4NJIA 3OXRB 5DI8A 1GRWA 4PREB 4ZW8A 2OQYA 3WQVA 3BGMA 2EAEA 4MYWB 2X70A 4XOBA 1F56A 4C6KA 4WWNA 3QUHA 4P3WA 3WY1A 4WHBA 3EJUA 2QQNH 3BQ5A 2NZ9D 3KGTA 5FW6A 3QZPA 1RPQA 3BVVA 1WRFA 4H1LA 4A2HA 2JQZA 1TZOA 3VJ6A 4BSWB 1BWVA 3PJWA 3LYEA 3WBYA 1XLCA 3MJ7B 1ET7A 1KIUB 2BOFX 4L9DA 1UWYA 4FFYA 1X7SA 5AFAA 1MVYA 3GB7B 1H0DB 3GZ3A 3ZYIA 2BNQD 2BXZA 2JFEX 4I1PA 4WGKA 2NUTB 1A80A 4TTGA 4MKMA 3MN8A 4HIHA 5FUCC 3RGVD 2ZQ0A 2YUZA 1AR2A 3TYGH 3VI4B 4F7PA 3BT2L 4DOHE 4HSNA 4FQIL 3NBNA 1NGQL 3QYMA 3VIPA 5SWZE 2KAUC 1BBJB 4DXVA 3FT4B 1O5RA 4QGYA 3TNNB 3Q4DA 3TN0D 3NUKA 3K2GA 3B9VA 4MAUH 1HJUA 1E5BA 2QCLA 2HX7A 4A7UA 2O4EA 3UPMA 1XYAA 2TSAA 3QIWA 5D32A 1S8DB 2B08A 1TVHB 5KBDA 3MV7B 2VZVA 3LHWA 4ABUA 3OR6A 5EU5A 4RR4A 5DZLA 5DTFB 3AWOA 5CPQA 4GBXD 2ZYIA 4M61B 5C0IA 3AVEA 3H12A 3F7QA 2XVLA 1W54A 5JW3H 3KVLA 3Q1SH 3B9NA 1VH7A 3WN5B 1Q1PA 1KBBA 3OXSA 2DIJA 2WHLA 3VGBA 2YXXA 3DI1A 1EHAA 4DEPB 4K8RL 3QWRA 5BOOA 2GAZA 3MOAL 1E6XM 2VW6A 2DM4A 2KPWA 1KBVA 3UNTA 4YLQT 5AVSB 1P0BA 3GJFH 3C5SB 4O2EA 4Y2DB 2B5IB 3TZVA 3QJSB 1LDSA 2WQXA 4ILDA 3D52A 1AQHA 3I4EA 4KTYA 4IMLB 1VJIA 2UZ9A 3GH4A 1RUML 1KGUA 2Z7ZA 4KTDH 3T3PF 2HTLD 1R2TA 4M62H 4QKTA 5HUPA 4NQSB 2EDKA 2CLEA 5CC7A 2CRYA 4HGKC 5U4NA 4OY9A 4XKYA 2ZCHH 2IWFA 4JNZA 2M8XA 1VGEL 4IUOA 3P5YA 4IFRA 3HPLA 1GZHC 3EJYD 4K7FA 4K2UL 3KOWA 2W5PA 3VD0A 1TYRA 3NIFB 3LH8A 2F2KA 4RNIA 3GRGA 4QITA 4K5LA 1I3RA 1A5NC 2DJ4A 2EXWD 4KXCA 2WNKA 1NGZB 4AG0A 3KZ8A 4MVBD 4PL2A 2J73A 1T03L 4PBDA 1MI5B 4IP4A 4LESA 4IBWA 1MI3A 1I1AB 4JANB 1Q9OA 1A8JH 1T6BX 4IDJL 1TJGH 2CUIA 4QOKD 4U4MA 1G1OA 4A7SA 2VDLB 4MXQC 4HWZA 4OM1H 3DX9B 4MQTB 1U3HA 1A5MC 3RLGA 2NY6D 1NFDF 2DQHL 4MWAE 5LHEA 3SDYL 4D8LA 1UATA 3L4UA 1XX9C 1U6AL 2ITEA 3BPLC 5F0LB 4HNOA 1KGJA 5ANMB 1QRQA 4K3JH 4D72A 3AT8A 2OJEB 4FTVA 5EMKA 5I1IL 2OQJA 4PUEA 3T4AA 4U2YA 1OGGA 5JR1L 4DK5A 4M6AA 1Q1JH 4X6EB 4JIEA 4L6DA 1JWMB 4DQOL 1DQDL 4ML9A 1RPXA 4WJ5A 1ZSDA 3CPLA 1OSEA 4AL8C 2OWWA 3K6DA 2WQ8A 3NG5A 1X5HA 3Q06A 2X87A 3GVWA 5A2FA 3LS5H 1L7IH 3HFFA 2AQQA 4CNIB 3DTXA 2VZUA 2FE0A 2NNAA 5E99H 5C08A 2XLLA 4IHOB 3BJ91 4KUZH 1SBSL 4E41A 1ADSA 5IJBC 2AK4D 3VXQA 5DMMA 3C6LB 4KK9C 3QIUD 5EFFA 5D7IE 1ADQH 2CLZB 2DDQL 3RX8A 1KBGH 3WKNA 1TWZA 3S96A 4XH2B 3E2VA 1F73A 3BOXA 5CPNA 3H7UA 1BQLH 1KR1A 1ED3A 5FW7A 3B2DC 1UCBL 2E7HA 3EXRA 1HK6A 4XTDA 4IX2A 5HI4D 3RVXC 4O53A 2R8SL 4ECNA 1S7TB 3VXPA 2BJML 1FWFC 4TVPH 3I02B 3M6DA 2ZOWA 3GHUA 1EP3A 4LEQA 1EHLL 2R1WA 5CN1A 1WFUA 1XR8A 3CASA 2FYYB 3MGTB 4ZQTA 3JZYA 5E2WH 3OD3A 1JCJA 2B0MA 5FO7B 2YARA 1E2WA 2PF6A 2BZDA 3O8XB 1QQDB 3PNZA 1XZ0B 3ZBMA 1EC7A 4MADA 3FN3A 4ONFL 5DSCA 1PSKL 1KUMA 3VG9C 2XSAA 4GXMA 1N12A 4D0BB 3SGEH 3MKGA 1JCMP 5BOFA 1ZV2A 4NQCA 1KA9F 1JERA 2ARJB 5DQ9A 3SGDH 5L2KB 1JRHH 4G6FD 4FTDA 3FQWB 3LRMA 2AQRA 5IHRA 1GGBL 1OWRM 1TDQA 4GW4B 2YLLA 4Z78B 3FSOA 2OP4L 2J88L 2HAZA 4NDMA 3NPSC 5C8BB 3WDJA 4GLRH 3X3FL 3QUXD 2QR0A 2Z8WC 4FQQA 4RKAA 2E40A 1MDLA 4QF1A 5AOMA 5J9PB 2XG4A 4B0MM 1OFPA 4M7JH 3BO8A 1C29A 3WSUA 5AB1A 1WJ3A 4NGHL 7TIMA 2WUBL 1GUVA 3QN3A 1A7QH 1S4IA 2ZWSA 1HQ4B 4B9CA 3O9WD 3WF3A 1RLBA 3EWWA 2QKIA 3A21A 4EF8A 3BGFC 4LXFA 4Q8NA 3PBVA 4KFOA 4FMKA 2ED7A 3TA3B 1FKWA 4HGXA 4DP8X 3FTZA 5FECB 4K5PA 2R2BA 2CLFA 2MHAA 1NSNH 3WFHA 4XO4A 1W16A 1CWYA 2W9EL 3ZHLA 1A02N 4XVTL 3WLJA 4WGHA 3NJNA 4TSCL 2ZSWA 1XLIA 1J8HA 4RA0C 1YNKH 4BZ1L 5KEZA 4G7EA 1TENA 2UY7A 4LFHG 5DEFA 3ARPA 5E70A 3AS0A 1G0DA 3JWOH 4M4RB 3B97A 1IT8A 1ZEAH 4S39A 3P0GB 4GWEA 3E7JA 3BMVA 3UZ5A 3W1NA 4X5RA 2Z2AA 3L4YA 2ZCKL 4PRBA 4JY9A 5I15H 5CPMA 2OMYB 4KKQA 1ZMYA 4I18C 5AYYA 2AQVA 4NAQA 5KSUA 3OW1A 3ROOB 3O4OC 4POCA 1GSMA 4I4WA 1NMCC 3UR7A 4O4WA 5AALA 2CCWA 4HCIA 5AZ0A 5L0QC 4US5D 4R85A 3S2NA 4L8DA 3LZFH 3VFMA 4J28A 4P5TA 3GZAA 4HEPA 3DTUB 3RJXA 3H2NA 3B9OA 3AAMA 1I82A 2HVKB 2AGJL 2OG9A 1KJ2H 5K69A 5D2NA 4TLUA 1TQUA 4JKWA 5DVOA 1PVHA 1DIEA 3QSRA 1W2KT 4Q8TA 3QO1B 2RAMA 3RVWD 4LHJB 1G9NC 4DO6A 3ES6B 5C07B 3O6AA 4DP4X 3V0DA 1KLUA 4YDKL 3FO9B 1OSZA 2ZE0A 4K7YA 2YJLA 3VFPA 4A63A 1XB3A 3BUPA 2I14A 2E4TA 4BZ1A 3LTYA 4Q8QA 3AU6A 1BYNA 1QBLL 3VYOA 3UTSE 1TVBB 3VTTA 3A4DA 2CM5A 3WQWA 4LSRH 2CGYA 3RWDA 4MMYA 1K4HA 3BARA 2JXMA 4KDTA 3CSYA 4PWFA 9PCYA 3MO1B 1QR7A 3WTVA 2PR4L 1NBYA 5IB4B 3GI8H 2ZOLA 1NF0A 2A2QT 1WBJA 4Z1PA 4PJ7B 4FC3E 5BO1H 3FOKA 1N5AB 3DRTA 5CU9A 3QFJA 2NLYA 5LG1A 1IBZA 2YD1A 5JXAL 3T9WA 1W8SA 4PH6A 3BQUD 2EDQA 2D7NA 5KYNA 1CFQB 4XZ9A 5HYEA 1BTMA 3JUZA 5HNUA 1E3FA 2YMTA 4PI0A 1E5ZA 3MX0A 1Q5MA 4KV5F 1OCQA 1G7UA 4HHGA 1CDCA 1KC5H 2BFVH 2HLFC 3IFOB 1WKEA 3RTQD 3PTMA 2Q02A 3IACA 1LD9A 2ED9A 2XN9B 3IJDA 3HI1A 3FQRA 3AY2A 3H22A 1TQWA 5GJMA 3R8RA 3EUDA 3QW4B 1VFMA 3HS0C 3JR2A 2P7TB 4ODXB 4XBJA 3BZ4A 5AG8A 5FOBB 4PRHD 1LOLA 2VEPA 4JM2D 3Q0HA 5I76A 4L1HA 3IFNH 4GFTB 1ZCOA 4Z7OB 2Y7OA 4D0DA 3RPBA 3IV3A 2WXKA 1M1XB 5DJCA 1E0XA 3W71A 4KI5D 2CSPA 2CCLA 3AAZB 4LHUB 3ZSTA 4E9VA 4LSUH 1XT5A 4MYPA 2B4GA 2IBZY 1NWOA 3DV4A 1KXQA 5IJDC 2ICWI 1JF1A 3E9UA 4EPSA 1OK0A 5C8JA 3NIGF 4ZUWB 5B4MC 1S5WA 5JQ6L 1O68A 3FFDA 4CVUA 4U6YA 3VD7A 3K4AA 1IGTB 3BW2A 5GRUH 1PKOA 4ZNCD 1YE4A 2CIPA 2CNCA 3HUJE 4HK3N 1L3WA 5BJTB 1TXKA 4QXTA 1WT5C 5DU7A 1TJHL 4H5SB 2VDIA 2OXGA 2B3IA 1NOFA 1WAAA 4GPVA 4BA8A 3ONCA 3WFLA 1VLXA 3WFBL 5HP5A 1TTJA 1MPAL 3JSSA 3H2AA 4PMFA 5LBVA 2M1KA 1JMZA 2AZUA 3L5WA 1Y18A 1FLRH 3W38A 3HE6D 3J7HA 4BH7B 4BXVA 2R23B 4CJ1A 4WNQA 1PX3A 2IGTA 4DBSA 2AI0L 4UR9A 2NVAA 5F2IA 3NCYP 4GUFA 1BVNP 5TGBA 4BCXA 4UTJA 1CYWA 1I31A 3H6OA 3NTCH 1N4XH 4X98B 3I50H 2FNBA 1LMIA 4BGLA 2P49B 3QULA 1NMBH 1ZT4A 1ODAA 4V1YA 1G5GA 5D1QE 4LCWE 4IK6A 3PJLA 3KBFA 3SDDC 2ZT9C 3RKDD 1PTZA 2YN3A 4PV8B 5FO8A 2FATL 2BP5M 3LQAH 4XCNA 1AGBA 2WANA 5L6UA 2Q5BA 2H26A 4EF3A 4FI7A 5CIPA 5SWSA 5FV2A 5BXFA 1MG2C 2FO1A 1D2KA 3SIMA 4V33A 1UH2A 5CO1A 3HZ3A 3KBEA 4UV7L 1YJDH 3WFCL 3E49A 5A69A 4OB5H 4LNYA 2WWKT 2BIPA 4AVFA 4ZAKD 1A7RH 2LV4A 2WNWA 5EBAA 1QSEB 5DEGA 5DT5A 5FYLD 4ZNEA 4ROPA 3DGDA 4GEJA 1CT8B 3VABA 1JD9A 3ZYZA 4RCAA 2V3GA 2QLVB 1PCWA 1T1XA 2CNYA 4M7ZB 4H00A 4GUQA 1HHJA 1DCEA 4AIZA 3EWXA 2BY3A 2BSSA 4DW2H 4CNSA 4KNSA 2GK1A 3PY9A 1GYAA 4LQFL 4CL7A 1BX2B 7REQA 1XCQB 3ONBA 1HOCB 1SZNA 4BIKA 3NACL 3TASA 5G2NA 3ATEA 1Q72L 3K2KA 2QPSA 4NCDA 3L5AA 4WW2C 4L4LA 1AD4A 4ELDA 1I3VA 3ILPA 2JVUA 1YUHA 3VC6A 5DA0B 2WMIB 3NQCA 1JCYA 1HILB 3PNRB 3ZDYF 1AO7A 1N6UA 5FWRA 4FP1A 2JEQA 3DMMD 1M7PA 5DDHB 2ILLA 4OGXL 2W5FA 3B8UA 3OPSA 5ICXB 3EBGA 3I9AA 2PPFA 3S6OA 5I66B 1ZAIA 3U5UA 4O58L 4Q33A 2XH2A 3SBFA 1L0QA 3TLLA 4I5BB 4W4OC 3QY8A 5DFVD 5BWFA 1J5IA 3G6JF 4OZOA 3P8JA 3BP5B 1I9RL 1XRFA 3EEGA 2QPEB 4PS3A 4XIAA 1T21A 1WXYA 3F2CA 4A3HA 2ADGA 4M8RA 5ILTL 4YDZA 1KNOB 3TF7C 4QRQA 2F8IA 4U1SA 3ECUA 1IQDA 3T4CA 4N20A 2XX1A 3EJRA 1XF3B 4UUIA 4IGBA 2OO6A 2XWDA 4X7DC 1BVLB 5EN2A 4J12A 1KFKA 1PFCA 3PB2A 1AYOA 1QK0A 4UIMB 3PFQA 1IGJA 3FA5A 1WBHA 3FA3A 1BD2D 3WBXA 5FFLA 4PS8A 2YGQA 1IAMA 1TWIA 3SHSA 1PG7X 3DSNB 3ZKXB 3RGTA 1MLCA 3MSPA 4K3EL 1BRLA 4QBXA 1FVEB 4FXLA 3CHEA 3WL9B 1LORA 1OYCA 4HAGA 4JFYB 3T2PA 1KFAL 3P4NA 1F1GA 4WO4C 3QWOA 4TQHA 2L7QA 5D9PA 3DO4A 1EXUA 1QZ1A 2HG5A 3KXFD 2XG5B 5CFHA 1AHMA 5IQ9B 2J55A 2ATPB 1NIFA 2ZJSL 3PUDA 3D69A 3SJVA 5B1AB 1M3UA 2QDDA 1LG1A 4JBSA 1CE1H 1HGWA 3NSNA 3ATBA 4S3JA 4QRRE 3KPPB 4EI5D 2Y1HA 3EWYA 3PDOB 1Q9WB 3MLUH 43CAA 3CXFA 2AJXL 4KI1A 2FWSA 5C54A 4J3OD 5E4AA 1NDGA 1YMME 5C0QA 3OLGA 5JUVA 2ZCLH 2DSUA 1DSFL 1IGCL 4K7PY 3OA5A 3EOTH 4G42A 4HWEH 2CGRL 3DFQA 3HC0A 3NCXA 4WI8A 4GOAA 4MJ6A 4LLDB 5TFSL 3T77B 3H0TB 2JIXB 1WE5A 4MJIA 4Y4HB 4HPOL 4GRWE 3T4WA 3JV6B 4XNXL 4PMOA 4U3SA 1A5UA 5LA0A 4OF8A 1C9WA 3GS0A 3C2SA 3TYUA 2VLKA 2XHNA 5C0CE 4CN6A 4JRXE 3RLHA 4KO5A 2HPIA 5FJJA 4XNZC 4NJGA 2N59A 4M43H 1LDPL 1CGSH 1OFDA 4FABL 2WQAA 3K13A 3RG1C 3TCTA 4QXIA 4WUUD 2G96A 4NC0B 3SQRA 2J4WL 3UTTD 2EDNA 4ZXBD 4KZ0A 4HAKA 3F4NA 4R3UA 4ODSH 2PDFA 4Y1SA 4GA8A 4HZLB 3TGXA 1SHSA 3FUNA 2CZ5A 2YAHA 2VEFA 5D1ZI 3DX6A 1H0IA 2J24A 2HRLA 4O0ZA 2BVOB 3PGFL 4IIQB 5D7SH 1MHCA 3C2VA 1RVGA 4FG6C 4O0QA 1UD3A 3STLB 1L7TL 4GVHA 1A3HA 2POTA 1WBYB 4V1XA 1Y65A 3PAUA 4C47A 4P23B 3D47A 1G69A 3MRDB 5LIWX 3V4VH 3PWAA 4F58L 3KWWA 3L7EA 3V79C 3WJJA 3QHZH 1MCJA 3OODA 3QZWB 4XVSH 4G9PA 2ZXDA 5HYJD 2Q76A 3OZMA 2JEPA 3TUUA 4FNTA 2DIAA 3E02A 4AU0A 1JFHA 2BMBA 4QDGA 3JRKA 2ZZUT 2JGYA 4UTTC 3V36A 1S7XA 3FSUA 3HV9A 2CDGB 3E8UL 4FAMA 3FTUA 43C9A 1MHEB 2IFFL 1B3WA 2C19A 2VDLH 3QC6X 3ZQWA 5IQ7H 2DSKA 4WUKH 4X9BA 1BYBA 4HK0B 2FX7L 2Y2YA 4YFLI 3K0WA 1RQBA 2R24A 4HDIA 2XZ7A 1P9MC 4N87A 2AXFA 3QO0A 1W3IA 4G8GD 5F7KC 2A9NH 2Z1PA 5DY3A 2B59A 3FT2A 4OZGB 1F8IA 1XLHA 3FUKA 3QVAA 4D6GA 3EF4A 5DJAB 1XGRA 3TYDA 3W75A 3Q2VA 3FO1B 5AAWC 2J74A 3UWVA 1V02A 3WO8A 4MA7H 4QISA 1FUYA 1M2VA 1NUFA 3RUGE 4OKVA 2GJNA 5IROC 1DWAM 2PYEB 3BGGA 4EDWH 2XN2A 4FULA 1R6WA 1SPDA 1E0VA 4LYKA 1VYRA 1ME9A 3T09A 5CCZA 4H6RA 4FOMA 2BSEA 1XKJA 3FHQA 5JO5A 3G1VA 1LUCB 4R7WA 4WW2F 4GG9A 3DVGB 1X1OA 3NTYA 4HSCX 4GW1B 4OJFL 4LGRB 4AZIA 3CL7A 3DURA 4Z6AT 3W1ZA 4YQXL 4CD4A 4OVVA 2WWCA 3TR2A 1EXGA 3VZXA 2XUWA 3DUGA 5GS0D 2ICEC 2QFPA 1I8AA 2A74A 4HK3J 3KWVA 4HHAB 1MFNA 5HYQB 4GT0A 1WD8A 4LIQH 4P8QA 1AW1A 1I1CA 1F18A 1MH5B 3G08A 5IW1B 2CERA 4AB4A 1KZYA 4QR6A 1ZLEA 4L2YA 2Z25A 4IBLT 3Q2WA 5GVJA 3S5YA 1F58L 1WS8A 4XV0A 1C93A 1KELL 2V2XA 1GTHA 4IPLA 4Y4FA 2CLLA 2DMKA 3MYPA 2D0HA 2R39A 5FLVA 4KFNA 4AD1A 3X1NA 2A3AA 4D6DA 3QRLA 5IUSA 5T5FH 3LPPA 3DIVA 3FSTA 5IMLB 1T83A 4GY1A 1K2DA 1MF2H 2XIQA 2P5WD 1DL7H 3BTNA 3QCVH 2QT6A 3S36H 3FO0H 1HDMB 1OEPA 5DHVH 3D08A 3DGRA 4JTIA 2R56L 3WLIA 1TRIA 5C0BA 3FRUB 4L56A 3VXRE 3DHUA 3FONB 2P10A 5MI0C 4YHNB 1AD9A 2ITDA 1R3IH 3DC8A 1XC6A 4P5KB 1SMOA 2CRIA 4KWVA 1OHLA 4PULA 3L45A 1IM3D 1ZTMA 1NPJA 1A5FL 3PFUA 1WOAA 3CHDA 1UQSB 3IE4A 4NP9A 1I7TA 4UOQA 3B9KA 3N3EA 4DZ5A 5B3JE 3PHQB 3IXTB 3V5KB 1R75A 3S42A 3T0AA 1AIFA 3B3IB 1A7NH 1E8YA 5AYXA 4JZ5A 3WO3B 3FULA 1KPVA 4XPAL 2PDHA 1RJRA 3VFTB 4UOW0 4XVJH 2WBJA 2N7SA 3TMLA 3CFEB 3M17A 1DUZB 2QJHA 3IWUA 1IC5L 6A3HA 3FH7A 5HI5D 2WIMA 5B1BB 5I19L 1IFRA 2GJZA 4ZMAT 4AQ1B 5CGYC 2Y23A 1Z5YD 2ACSA 3N41F 2X40A 2FSEA 1SZFA 4YJZL 3G0XA 5KVFE 3FSWA 3O6FD 2CG9X 4B50A 1L9QA 4EZKA 4AXWA 1JQXA 4ZW6A 1E1CB 2D2JA 3ME3A 1O94A 4CUCA 3L66A 4Z1CA 2V7NA 4ZMWA 5FGCE 4ZFOA 3F01A 2P42B 3R12A 3W7OA 4X9YA 1L6YA 1WISA 3VFOA 1WB0A 4F1ZA 3ZVIA 1FNFA 2AAVA 2ZD0A 3HC4H 1H1NA 4L4TE 1KTLB 1AG0A 3S1WA 3WLOA 3V6ZA 4HJJH 4JPQA 1JV5A 3DK2A 4HNTA 2YA2A 3TNMA 5IG7A 4JDTH 4QXUH 5DMGD 4NM4L 1RHHA 1DQTA 3UTQA 4JTGA 2PPAA 2DWDA 4NRYB 4F7EB 2OW6A 1JWUB 1TA3A 3MSRA 3ATDA 1Z3NA 2C9AA 5JTWA 1PZ5B 1P7HL 5JBDA 1EQWA 4KCUA 2QPDB 1RFDL 3FT0A 1X5IA 1S9VB 2CO7A 1TO4A 4C6DA 1G4MA 4G8IB 3SI9A 1BWWA 1ZK5A 2Q7YB 3LKQA 4AOFA 2IANE 4TL5A 3BP7B 5A8PA 8TIMA 4S3AA 2OT1A 4DF0A 3A47A 4LBEB 3T8LA 4N7QA 4Y9AA 5HGAA 3QPEA 1Q6GA 2R9RA 3OWRA 3C3NA 1NL0H 1HL2A 4D8PB 3OGSA 4OIBA 5C71A 4MPKA 1CI5A 3QNZB 3ULUL 3CUZA 1D3GA 4CD6A 1QSFB 5DJ2B 2YLAA 4KDWA 2VSDA 4R53A 2ZYSA 2X3CA 3DG7A 1A66A 3R25A 2ID5A 1LEIA 4XZMX 3GBMH 4NNXB 4NUMA 1A9BA 2J5LC 2FT7A 3LEPA 1PNCA 4MMZA 1ZGDA 1YMYA 2ALAA 2EH7L 4JO2L 1HAUA 2WZ0A 4GAGH 4CVXA 1AACA 1BZQK 4MJMA 4HUVB 4RNJA 4RGND 1EPVA 2XPKA 2R0ZH 3TBYA 1GOKA 4C6NA 2V2TB 2EDYA 1KCUL 3HRZB 1GOXA 4DWSD 3SRDA 5C6WH 1IFGA 2I7SA 3AMKA 4ZMQA 2R9HC 3C5ZB 4OSUL 3RFRA 3QLDA 1R24B 2X4UA 5JLZA 3U4EA 3FAXA 3IJHB 4ZK8A 3RO6A 4IOFC 4G5ZH 3EFDH 2WLJA 1DWJM 1REIA 4C4KO 5E8EA 4Z1BA 3MRQA 3PPFA 5KS9B 2PYFB 1FWRA 4I0KA 2DSWA 1OX5A 4RDWA 3DG6A 5GRZA 2MCPH 2QZRA 4QRPA 4FL4C 4LPVA 4QXWA 1NAML 4GY4A 4N85A 2QF8A 1W5OA 3BPNC 4CADB 3RBSA 3RDKA 4KETA 3CLFL 5C2BH 1IWBA 2DGAA 4A55A 4E5XG 4C57C 2G41A 2C3HA 4P9HH 4RX4A 5AYQA 4NQXA 2A9CA 2EXTA 3FJNA 3IDGA 3RXZA 1RU9L 2IOMA 3VFGH 2GSIB 3X11A 4PWGA 4GRLA 4CAGA 1RPKA 4O2CB 4F2EA 4YSPA 1R5IB 1U93A 2B1HH 3IM1A 5A2JH 4MD0A 2X9XA 2XM1A 2BH0A 1KN4H 3A4XA 3GHSA 1ZA3B 2GJ6A 4MB5A 3ZK0A 7PCYA 5FW8A 3HHMA 3RPKA 2ZQKA 3EO9L 5A8GA 1ZVHA 3RL1B 1FVPA 2Q20A 4KRTA 5FSDC 2JK5B 2BVUA 4Z0SA 4J2XA 4RJEA 3C08H 1GC1H 3FPXA 4XG1A 3M5VA 4NQDD 4P4KA 2IPKA 4V2BA 4A7GA 4M3PA 2A79A 5ERWB 2QKFA 3AQUA 1I7UB 2PPDA 5EYWA 3W88A 4RWHA 1DBBH 1X9UA 2EDEA 1B3XA 2R1LA 4YZWA 4WI6A 3AUJA 4PGBA 1QR4A 3L5XH 1MEWA 2YWYA 2HTKC 3GXPA 1T6WA 3L6FA 3NZHL 4CILA 4AY0A 2ZADA 2YN5A 2IH3A 2A99A 4M48H 4N0UB 1UWGL 1IE4A 4MCMA 4P57A 5CKAA 2YFNA 1HVXA 4ELMB 2NUWA 3W5MA 1AH0A 1HCYA 4M6OL 5B7YA 4CRPA 3MC5A 3OZKA 3QHTC 5HMDA 2E4FA 4RV8A 3MCKB 4DJEA 1T40A 2Z7GA 1EZUA 3UA3A 2NY3C 4JFSA 3O41A 4MA1C 4Z3IA 5A8OA 1E8XA 4GAJL 4BKSC 2YUXA 1O5KA 1N0LA 3V4UH 1KLGA 2DLGA 3NK3A 4FLSA 3LTSA 4F15B 4NB7A 4PQXA 4JHAL 1I7RB 1BPVA 2BP1A 1KCRH 1QFUH 1N6VA 4RE4A 3E3QE 1UW9A 4JMNA 3SADA 2IADB 1JHLH 3CFCH 4U1KA 2VLJE 5BWAA 3U79A 2RDUA 2XISA 1VCVA 2P45B 2W3ZA 1IQ8A 5AQ0A 2CDEB 6PCYA 3TCLA 2WHMA 3QORD 2VISA 5F88A 2Z35A 3TTSA 5HNTA 1KFBA 2R1PA 3FPYA 5HWJA 1N0XL 2OX1A 5F96L 5KG9A 3LZLA 3PUUA 2GTQA 2EIKB 5IV2A 4ATWA 4A2RA 5A2BA 3WNOA 2Z29A 3OL2A 3KH3A 2YD9A 4QUOA 4H19A 2QCDA 4LCQA 1FFNA 5CBEA 4AIXA 3LTPA 2A1WH 3D3VE 4K2SA 5I5MA 4M3KB 2WJZA 2X44D 2QUVA 2YPVH 5CM1A 3DWTA 2F54B 2YSWA 4P9ML 3GLCA 1UOKA 1OL0A 4Q6IC 3BAWA 4K07A 2X1WL 1Y6KR 3G1HA 3L3IA 2PP0A 4P3CL 4E0RB 1F2JA 1G7HB 5BUAA 2DQCH 3IVTA 4E8DA 4FFYL 2J8UB 5E9DA 4Z8FL 2F7QA 5TE6H 2F6KA 1P5VA 3QEHA 3MNVA 4D7BA 4MHBA 1DVTA 5L6YL 2CLVB 4ZSOE 4B90A 1EAPB 1E0UA 1QNSA 4K5MA 5EU6D 2IDSA 3CCHB 4PCFA 1V5JA 1HZYA 3H3KA 1ITCA 1G6VK 2IALA 2JLPA 4Y8AA 3H4WA 5INCB 5KYUB 4X0KB 1TJ0A 5TDNB 2JKXA 2ZAIA 2Y1YA 2MIZA 4HXAH 4XCCL 4WKXA 1LG2A 3VUAA 1GT8A 4XOAA 3EWUA 1YN7A 2BIOA 1LO2H 5I74C 1TKWA 1EPXA 1FYTD 4OGYL 3VXME 3O81A 4ZW3A 5A6BD 1KC7A 4IDLA 1DO5A 4C6MA 4LOVA 2FJFB 4EXQA 4AUYA 4K55A 2D7TH 1R3TA 3BDXA 3EDDA 5G5IA 4QRUB 4F9PC 4TVUA 3GBNH 3TO4C 2VABB 3TVMB 2FWOB 4KZDL 4BRVA 1PKQB 2QUMA 1PKNA 1I8UA 1JJUA 3KHQA 4N6RA 3U7YH 1R0AH 2UXFA 1I8KA 1JPTH 3OG3A 2OQHA 4NAEB 4KK9D 1IE7C 5MENE 4ALAL 3EJQA 2O5XH 1JZFA 3F12A 4B41A 3Q37A 4S3FA 1CZ1A 2F84A 3D85B 4L1LA 4FZIA 4GK8A 3O3DB 4MD5A 4MYXA 4J3XA 4P2YA 1XF2B 4ZMLA 4G43B 3KOZA 2J6VA 3RVXD 1OGSA 2P5EA 3TXAA 3QUYB 5AZ2L 1H11A 3WLWC 5FYJL 3CFDB 4NRXA 3DARA 1AD0A 5E0CA 2JKEA 2ZXQA 3U2IA 2EABA 2O7QA 1AI1H 4X4YA 2WLIA 2H9GA 2A6JB 3DXAD 5HDQL 3D2UD 2DQDH 5IESL 5JOEA 2OR7A 2EYSA 4ODVL 3GRWL 3WY4A 4AZGA 2J43A 4JDVA 3NM3A 3KPSE 2VUYA 4F2MA 1IAOB 2PDGA 2GITA 4YE0A 5K5YA 4AAJA 1AMKA 1N64H 4JW3A 1TETL 5EMLA 1LBLA 2ZTBA 2DLHA 5KJ4A 3DG3A 4GBUA 4APQB 3DV6B 3WD5L 5LGJB 1Z7JA 3W7RA 1XP3A 3WTTA 2W6RA 1S39A 3NZQA 3GAKA 3V8CA 5C0AB 3LNHA 4Q32A 3H53A 1KFWA 2I9EA 6XIMA 2IPGA 2F53A 4YN5A 3DSFH 3KPMB 2DIKA 1JFQH 3SDAC 1YYAA 4TKWA 5DT1H 4HETA 2RHEA 3RDTC 3VD2A 4Z7QF 3ZE1F 2NMSA 4PJAE 1GMEA 5F7EH 3I9GH 4IISA 2ZOOA 3QUMB 5F72S 1YEIL 1H3VA 4JHUA 2PTYA 3GRWA 1Z9AA 4FXJA 4JIHA 4PJCA 5HYIA 1WBZB 4NENA 3MLTA 5LHFA 2WWNA 4BFEA 2WVVB 1G4EA 4LSQH 1P1VA 4YHZH 4F0MA 1KXTB 2NQZA 4DM2A 4W70A 1AKPA 4ONHB 4L05A 3VD1A 3RX7A 5I6PA 1K03A 5IQMA 2HKHL 3OBAA 3TX4A 1IGML 2EEDA 4WJEA 1GMIA 1BLNB 3IFLL 1KMGA 4K38A 4KRNA 5ALBL 1Z41A 4NI6A 4GYBA 3LRLA 5I79A 3SFKA 4KVNH 1HJQA 1ZWIA 2ITCA 3BZ5A 3CVCA 4L5FH 4C56B 4EAMA 3CZEA 1MHPH 5HHQB 4TV6A 5D93C 4J3BA 1NKOA 5E0KA 4E9XA 5BMFL 5GGUB 3BZEB 5XIMA 3V9EA 2EGZA 4HIQA 1VFSA 2DWEB 4TV5A 3MRGB 4OUEA 3FT3B 4HS3A 4NNBA 2PXYB 3B0VC 2V2WA 5KVDL 4ZPVB 3DFNA 4DJDA 2FO4A 1TU2A 2UXTA 5AW1B 1P5UA 4DYEA 4LRNH 4MDIA 2OMAA 2A0NA 3CS2A 3WG7B 1Z8AA 4ZZ9A 3US0A 3MOBL 3LI0A 3CZKA 3VAEA 1OCBA 1A21A 2J5WA 1GAFL 3URNA 4C8XA 1MJJB 1IEVA 3JZ7A 3TZFA 2FT8A 2YXFA 4AKOA 4K94C 4NQ1A 4X7FC 4U1NA 1SXNA 5DD5H 3I9PA 1W2PA 5F97E 4MJ4A 4DGVL 1TOXA 4Y7EA 5CZSA 5CEZL 1H7RA 4ZUVB 2HRWA 3CH9A 4UM9B 2COQA 1Z48A 2VCBA 5F4WA 3FGCB 2X0HA 4BEUA 4D6CA 2HJFA 1OP9A 4LDEB 4IPNB 4PMUA 1O1HA 4I0CC 2PDLA 3IXAB 2YDAA 1PB0A 4GLRI 4UNKA 4FR6A 2NDFA 3JV4B 2OR8A 2YB4A 1ZLSL 1KBWA 5FKYA 2RH0A 1Z44A 5CKSA 1J96A 4E5XA 2VDPH 3OJGA 2HLFD 4M7SA 2IF7A 1RIVH 2ZTJA 2NX5B 2VAAB 4L6OA 2Y5QA 4QTIH 4UDUB 1F90H 4TMCA 3BWSA 5IEHA 3FS9A 1KJMB 4OI8A 2Y85A 5FJTA 4U1LB 5AD0A 3MNMA 2AVGA 3DVFA 1H6FA 5DYFA 2WO3B 1TPFA 1AODA 5DRNA 4FK9A 1PLCA 1V79A 1HFBA 4KVPA 1BEYL 4DCQB 2OLHA 3EYSL 3CUIA 5BXSA 1U8PA 4YIQB 4HB7A 1BEUA 3P77A 3IGAB 2YZ8A 2W59A 3NVDA 2AV1B 3L3HB 4HGWA 2WCAA 4IMEA 3DJZA 2G9KA 1QPOA 5D7HA 1NCNA 2A83A 1NGWA 5C9RA 2PLJA 2YPLD 1XBRA 1WITA 3V18A 1E72M 1K77A 5IRPA 4NAMA 1WV7T 5B4MD 4Y1AE 4PGDA 5CZVH 2NY0D 3O0LA 2VO8A 4LV4A 4PUMA 3W9ZA 3LHVA 1B30A 4LCUA 3UY8A 1JCTA 2DSVA 1EZVY 2QS8A 4C6FA 2DQFB 3K5SA 2YL9A 4WHCA 3TONA 1NGXB 1IAIH 3S2AA 4N9OB 4BQ5A 4A6YB 1UWEL 3ZKQD 1FORH 3K8KA 2W0KA 1BIIB 1PVNA 2WLNA 1EGVA 3M0YA 4JTTA 1W1A1 4PWHA 1KR0A 2OYPA 1RVKA 3D25A 1O7AA 1TQBC 2RDXA 3GZQA 1NJ9A 4EEEA 4AC7C 5HGHA 2AKRA 3C0LA 1HHIB 1C8PA 2PZ0A 4FZ8H 5A2LH 5AENA 3O3AB 2OMXB 4H7CA 4RDBA 3WS6C 4PGCA 4IMFA 1XGYH 5TF0A 4UB0L 1U2YA 4YXLH 4DP0X 1Q0YL 1JPST 2Z92A 3ARBA 4JJHA 4G1MB 5HJ3B 4BFGA 3MBEA 3VKBA 4JZJB 2O4QA 3SDDD 4M1RA 1FKXA 3HIJA 3B6SB 1WCQA 3WI9A 3L9RA 2DW7A 4ZQNA 3CEPA 4LF3B 1QWUA 4ZFGL 1OADA 4FXTA 1A4AA 5LNWA 3B4YA 2KX9A 2YAQA 3ZKND 5D1XB 1A3XA 4O16A 4XMZA 4OCSL 3QBTB 3GWJA 1ZJIA 3KZPA 2JKPA 3AC0A 1OWWA 5DUPL 4W8BA 1NBZA 4YVPA 5F0JB 3OX8B 1SHWA 3JWNH 1TQTA 1XIJA 5EDXA 3PF2A 4WVXA 1AC6A 3U6XS 5ENWA 4P06A 3T08A 2LABA 1JGLH 3EXSA 1XIWB 3GSVA 4PBWD 5AW6B 5KZEA 4NO5B 5L9DH 5F7HA 5FM8A 1E6ZA 5FCSH 2R4SH 1R3HA 3OF6A 5IHZB 1JTPA 1W91A 3HFTA 5AW4B 1WYIA 1RAKA 1I75A 3NH7H 2BHFA 1BMWA 4R4FL 3T0BA 1MXSA 4Q8OA 3Q8FA 4GIRA 1L3NA 1DN0A 3LCXA 5CJ8A 4JFOA 3AG2B 4PTVA 2OK0H 3Q44A 1XIMA 2GT9B 5DJDB 3CFUA 3UO1L 5I75B 3DLQR 3BZJA 5E6UB 3APTA 3QWNA 1BYCA 3HHSB 1PL9A 5LSMA 1EUUA 3TQVA 1T0NB 5GS1C 3P1VA 3VFVA 2VC2L 2NX1A 2DPKA 5DVPA 1CDBA 1W5QA 3WUFA 4F2UA 2L3BA 3O2WL 1KTKE 1C8VA 3QEQE 4DP2X 1DJSA 1X6LA 1CK0H 2BFGA 1G5AA 5C86A 1ILUA 2CQVA 5DCDA 1UOWA 5BQDA 4H88H 1N8ZB 4HYRA 2O92A 4NUGH 1SYVA 3CO4A 4Z2JA 5FHAL 1G01A 2N0MA 2AEPL 5D09A 4PRWA 3WQCA 2OODA 3BD5A 3QXUA 1VADB 3PZNA 2FQDA 5CEWA 1OGAB 2NSOA 1LNUB 5DT7A 4JRYE 3BXWA 3HZYB 1ZQ5A 2BGNE 1ZJAA 5JPMA 3V5HB 4ADJA 4P7LA 1TTGA 2QVIA 3TT3H 1A3LH 2EIEA 4GMTH 2R0KL 2GSGB 1QHZA 4JFFA 6FABL 2X1UA 3T0EC 1QEWA 1FDLH 5IW6B 3ES8A 1KWKA 4PMNA 1JNHB 3ETBJ 4WO4D 1FFOA 3H70A 3V35A 3LAFA 4PVLA 4JZOA 3HNVH 2GK0A 1RPUA 1D9EA 1JYNA 1PCXA 3S3SA 2XFRA 1L9OA 4LKXB 1H15B 2ISFA 3PZVA 3S97C 3B04A 3EOEA 5DMJB 3W0WB 2F8VA 3STFA 1CDGA 9RUBA 2KT6A 3P30H 1PKLA 1PD1A 1XIHA 5I1LB 4H20H 1E9OB 1A0QL 3FCUB 1N5YL 2HISA 3Q2DA 1DYZA 2BOCB 2XZZA 4LCIL 3BZDA 2HCZX 4OCXH 4RMWA 2CMRH 3B2XA 4CMMB 3BUBA 1OARL 2ENQA 3QHMA 4A2DA 2NXZB 3G7TA 4ZPTA 2F5BH 3LV5A 3E2HB 2C3VA 2BNQA 4U1JB 2Q3RA 2E7MA 3QRFM 1FG2A 4H6EA 3M7SA 3UW6A 4H0IA 4IEFB 1KV3A 3D30A 2QUNA 5D2LB 4N02A 4Z3EA 3PPCA 5H8PA 2J27A 4RK8A 3GPSA 1AKJA 1O6TA 5TAOA 25C8H 1VBUA 3QTGA 4U3AA 1SVDA 4R2GC 1D5MB 1VKXB 3KL0A 4HPXA 2XXFA 2VEMA 1Q0EA 5CUSH 2NUPA 1HKWA 3TN0A 3GS7A 2DH2A 3RNQB 5ABEA 4NQED 4PJ5A 4OF7A 1B4EA 5FYKU 4JCWA 3TZNA 4QLRA 3TA9A 4UV4L 1XUZA 3RMJA 5M5DA 1ACYH 4FI6A 3MO7A 4ZMGA 2W92A 3FRPG 1Z0NA 4ANWA 3L4WA 1BIHA 3STGA 2VLRE 3N0PB 3TN3A 4KRZA 3W01A 4Q9RH 3FDKA 5J04A 3L1EA 2CIKB 4D3CH 2BHZA 3BWAB 2NVCA 7ENLA 1T6MA 1VAHA 3UMNA 5JIPA 4GP8B 5F1IA 4FG6D 3CUHA 4V28A 3OKLA 4FYRA 4JQ3A 4KBPA 2YD6A 4H8NA 4DIAA 3ZE2F 1TLKA 4TS6A 2XPGA 2JJVA 2L7UA 5H2ZA 4YDIL 1E5NA 4KTGA 2VN3A 4JBRA 3HBQA 2YQBA 3W6LA 3SD5A 5AVNA 4Y5VA 3NEXA 1XF5B 3R6IA 3SUTA 1ORQB 5GZOA 5CD3B 4AISA 3H3PH 3OQEA 3QYNA 3OJDA 4TU1A 2X7LA 3GTVA 2K6ZA 4D6IA 1TZHA 4X4XB 4EI6A 4TVPE 1OM3H 3N1QC 1F1DA 3QRGH 2IQAA 3VQ1C 1G1CA 2C9SA 4PJBF 5HWNA 4UYPA 2EIZB 4G9FE 1SPQA 2LU3A 1WQVT 5JNYA 3FQXB 2F9RA 1H5BC 3TSDA 4AITA 4QG6A 2WY3B 1F0LA 4M6NL 1EZWA 5C09E 1O9WA 3FOLB 4P0DA 2VR7A 1JPFA 2P52A 2J77A 4R0LC 1LE5A 3PREA 1OC7A