5CGQA

Crystal structure of tryptophan synthase from salmonella typhimurium in complex with f9 ligand in the alpha-site and the product l-tryptophan in the beta-site.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Tryptophan synthase alpha chain
publication title Crystal structure of Tryptophan Synthase from Salmonella typhimurium in complex with F9 ligand and the product L-Tryptophan in the beta-site.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 101
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cgqA00
2QUTA 4EOUA 4UNKA 1EP1A 5FEWA 2VEMA 4BFAA 4GRSA 3DKJA 3W23A 4D2JA 4DO6A 1BWLA 1O95A 2C14A 2NLIA 4AWUA 1OK4A 1K02A 1FWNA 1SSGA 3HG2A 3S42A 2CZ5A 3CM4A 4HKPA 4IX0A 4NJKA 3C2FA 3TXVA 1FCVA 4AHPA 4UMAA 5G2IA 4ZQOA 1OJXA 3ABQA 1W31A 2H6RA 2CLHA 5AOUA 3T44A 3BG5A 4YCOA 4WY0A 3MHUA 3P61A 4NNCA 3LRLA 1J4EA 3NA8A 4JY8A 3C8FA 3W7RA 4O1DA 2QCLA 1UUOA 1C29A 3ABSA 4FF7A 4UTJA 1H7NA 2B7OA 2R8WA 3DU0A 4JR5A 3TAKA 2TSYA 4I9AA 3NQDA 2ZZ4A 4HT3A 4HNNA 3KAOA 3U8GA 3DFSA 1YXYA 1QFEA 4JIQA 5CZ0A 4KFNA 1KFEA 5H91A 4L4MA 4TO8A 3LCLA 3W7HA 5C6MA 1C9DA 1EP2A 1W54A 3LHUA 3NNTA 1Q6RA 3P5YA 1K7FA 3V75A 4OWGA 2J9XA 4MZYA 5DN1A 5EMUA 1P1XA 1FCQA 1VHCA 3GKFA 1OX6A 1XBXA 3UZ5A 3FKKA 2OZ0A 4MOZA 3MP5A 2AAMA 5HWJA 1DQWA 4GWEA 3W88A 4Y96A 3W86A 2X1RA 4UTUA 1OX4B 1F5ZA 3QC3A 1G4PA 5I3KA 4YL2A 4FXSA 2E5DA 4WQ6A 3BLEA 4UXDA 3B0PA 1XC4A 3JR2A 1H7OA 2VFIA 3OHIA 2C15A 4AHQA 3W7QA 1UUMA 1GVRA 1SFLA 5BRBA 3ZWSA 3N9RA 1EP3A 4QNWA 5EKYA 3PB0A 2Q3RA 3MYOA 5HQEA 4PEKA 5C5YA 2AGKA 5AC6A 1EX5A 3HG3A 3UYCA 3W7CA 3LGEA 4NT0A 1A5SA 1Q3NA 1PV8A 1ZCOA 1O60A 4N4QA 1OFRA 1QCWA 3HPSA 4M6VA 2H3BA 5DXYA 2DZUA 4QITA 1GJPA 4UR7A 3N9SA 3NQ6A 3B0VC 4Z1AA 1R2TA 1X8FA 1T96A 4KWVA 2FDSA 3NQFA 3KVLA 3MI2A 3GX9A 3TW7A 3HG4A 3DI1A 3O07A 1FUYA 1NFBA 2Z6JA 1H7XA 4DPPA 3BPWA 2A7NA 5KINA 2ZZ2A 3S9YA 4BK9A 1CW2A 2A85A 2A6LA 1QWGA 3M5VA 4GE8A 5J5RA 2A6NA 4IMEA 5FI8A 3OVRA 3BG3A 1OFQA 1PL9A 1VC4A 4K39A 3CU2A 4FNPA 3SGUA 3NOEA 1X1ZA 4ZZ9A 3LCWA 1JCLA 1K8YA 1T99A 3QMSA 3EWXA 4NU7A 3N14A 3NQCA 1TIMA 4X2RA 3UY8A 4LS0A 3LOTA 2JK2A 3DKLA 4MVAA 3HMJG 3SECA 3RLVA 2ZZ1A 1K8ZA 4NJJA 3WK0A 3QYQA 1MEHA 2CLKA 1AL7A 3LXCA 2QCNA 1WA3A 1LZOA 2HTMA 3LV5A 3CIXA 1TPWA 2FQIA 4YXGA 5CZJA 1FDZA 3W1NA 4MKNA 1KM2A 4NXSA 4LOCA 3S5ZA 2EKCA 1W3NA 3W7GA 2ZFAA 2HMCA 2NXHA 4AF0A 3TFXA 5D33A 4YWIA 5H2ZA 1KBIA 2A0NA 3NQGA 2EGZA 1ALDA 3M5XA 1KBJA 4FB7A 3LERA 3H54A 1SR9A 3BGJA 3UY7A 1PVNA 5FEPA 1KFJA 3MP3A 5E93A 3I7QA 3PSVA 3N3MA 4X22A 5AHIA 1YPFA 3W72A 2Y63A 5IM51 5A5WA 3W3OA 2CFFA 4IMDA 3FJ6A 3L9CA 8TIMA 1M7OA 2V82A 4O4WA 1VH7A 1A5BA 4N9CA 4A22A 2QJIA 3W76A 1FX6A 2H90A 3QPZA 4HPJA 4P61A 4R53A 4UFIA 4X3ZA 3B06A 4N9EA 3INPA 3G18A 4A2RA 2WNZA 3LB0A 3MBFA 4EIVA 2NXIA 3MMTA 1ICSA 1YLVA 1K03A 3TX9A 5DCBA 3LCFA 3YPIA 5G2WA 2VFHA 2WQPA 3HOJA 1YDVA 1KM0A 2NWSA 5K9XA 1OFEA 2H8ZA 1W37A 4JTJA 3FLUA 4IQLA 4LV9A 1ZAIA 1R30A 1RQEA 4WX2A 3PWAA 5FF4A 2VFEA 1IIGA 1NF0A 1NF7A 4MLRA 3W1AA 2B7NA 3NG3A 2C18A 1OFAA 4OT7A 2BTMA 3HF3A 3E96A 3NL5A 2QF7A 1TYGA 1MO0A 1OF6A 2ISWA 3W7JA 1WBHA 4LS1A 4S2CA 1TQXA 3HPZA 4LRSA 3GIYA 2JKPA 1N55A 1AW2A 2CLOA 1ZENA 3ZS4A 1LOLA 4IGHA 4CQAA 2V5BA 3LRKA 5HUOA 1FCBA 3FEMA 3C4UA 1H5YA 2JKEA 2XN2A 4UCGA 4UTHA 5CPOA 5BOOA 2BSLA 1ZHAA 1O5KA 2WSRA 3ZFHA 2GJLA 5LGZA 1MEWA 3C6CA 4CLMA 2VOMA 1X7FA 3N2XA 3T4CA 2QCCA 3RMJA 1NEYA 1DBTA 4FEZA 4JN6A 3QSRA 1TPFA 2ZRZA 3EWYA 4E0CA 5AHFA 1Z41A 4IOTA 1QOPA 1VCGA 1H1ZA 5HWMA 2RH9A 5E0KA 3IIPA 1LRTA 4X9SA 1L9WA 3W2JA 3OA3A 3P5ZA 4GUIA 4TMBA 1QDSA 4BI5A 2QAPA 3BARA 3S1XA 1H61A 3TDFA 4PL1A 3U2OA 5AC7A 2Y89A 4QNEA 1JCYA 1KM6A 1FXPA 5AYYA 3ZWTA 3UWYA 1SW7A 4BI6A 2X16A 3CPRA 3CTLA 3GAKA 1OG0A 3W74A 3PG8A 1SZNA 4JX5A 1WYIA 2W0UA 3S5OA 1OF8A 4XWUA 3L65A 5CPLA 3PUDA 1SO3A 4GNJA 1SFJA 4QIUA 2WOQA 1AL8A 1S3HA 1VYRA 3C61A 1BTMA 3EX2A 1P0KA 1U5JA 1VQTA 1W5MA 4FNSA 1D3GA 2V30A 3NZRA 4M19A 4UFHA 4A29A 4C1LA 4HNTA 1OX4A 1VHNA 1JCMP 1XL9A 3O6DA 1QAPA 1L6SA 1FY6A 2WKJA 3GXPA 3LV6A 4JTEA 5CPMA 1WV2A 2CW6A 2QDHA 3DH7A 3LCXA 2WO5A 1UJPA 3VCRA 3MJYA 4E38A 1OYBA 5LSMA 4RK8A 3SJ3A 3QMTA 3CWOX 3G22A 1NSJA 4NQ1A 2R91A 1IXQA 3L2IA 1SZFA 1V5XA 3UQNA 3KXQA 1X1OA 4JTFA 4R7JA 1LBFA 5AHLA 1Q6QA 1THFD 3WJZA 3TCEA 2TYSA 1ICPA 1CI1A 4K36A 3M1ZA 4NJHA 1AW1A 4CCEA 5AHEA 2ZZ5A 3VKJA 1OVDA 3F4NA 3M5YA 2ZCGA 3UNDA 4JICA 5HUPA 4HNUA 4GFSA 3WJSA 5EL1A 3C2EA 4QISA 3IVTA 5G1TA 2RKXA 3CT7A 5FEZA 3D0CA 5K4XA 4PA8A 4AXKA 5CSRA 4DBDA 5DCEA 2V2HA 4TIMA 3W85A 2XN0A 4FNTA 4AAJA 1YPIA 5I3HA 5AHMA 4UC5A 3LTSA 4FO4A 2FLIA 3BV4A 2DZPA 3WJYA 3SIZA 1IXOA 3FYPA 1OX5A 4AB4A 1I45A 3IIXA 3B4UA 2A7PA 3FKRA 1G7VA 1ME9A 3TQVA 3O05A 4O19A 2NUWA 4JY9A 3W2LA 2QR6A 1A50A 7TIMA 1ME7A 4FX7A 1RVGA 1UBSA 5T26A 3W7OA 3W7MA 1LBLA 2CLLA 3NM1A 4ORIA 5CPNA 5F4SA 3G24A 4IXHA 3NQMA 2EF9A 1EB3A 2QDGA 2ZRUA 1YXDA 3HG5A 3W83A 2DJXA 3A22A 1TRIA 4ZQRA 3K30A 2V2DA 2YDAA 4UUIA 1ZY9A 5F2MA 5F2IA 2V9DA 4JD4A 4CQ9A 1SU5A 1GOXA 1OFBA 3C2OA 4UNLA 5AC8A 1W5PA 5DY2A 2EPHA 3EXRA 2FPTA 4FHAA 3A5FA 4LVBA 3W70A 5DBUA 3NL6A 5MHBA 3ELFA 4Y9AA 3UD6A 5KZMA 5D2TA 1G67A 3NVTA 3CEPA 1XCFA 1QPQA 3LBCA 1P0NA 1P5BA 4EF8A 1B4KA 2ATSA 3W2NA 3L0NA 2CLEA 3LHWA 4WJEA 1MZHA 4DF1A 3P67A 4LUIA 4I7UA 3KVKA 2V5LA 1OYCA 4DPQA 1Q45A 1E51A 2Z0IA 3QW3A 4XKYB 4Y90A 1LORA 3KHJA 1OABA 4CNNA 2DZVA 1PHWA 1R2SA 1GPWA 1R47A 2X1SA 2JGYA 1YTDA 5AN7A 1QPRA 1Q6LA 3GDKA 3M7WA 4MUZA 1FWWA 1EUNA 1JJKA 3LCGA 3EWUA 3P82A 3W1QA 5D32A 4G1KA 5DCDA 4ORMA 1I2RA 1I2QA 3QSTA 4R33A 5HJLA 3FIGA 2YR1A 3EEGA 5CKSA 3EWWA 1QR7A 3HGOA 2DZTA 3O06A 4XUGA 1XI3A 3FFSA 2B4GA 3E02A 4NZFA 4QAIA 4GXMA 1GVQA 1MEIA 1NAL1 3BGGA 1I2NA 3TSBA 1GZGA 4HSOA 4PL2A 3TFCA 4NX0A 4K8HA 2CLIA 3PSWA 2DU2A 3RNDA 4H4IA 5C55A 1TMHA 5FF7A 3QRHA 4IPJA 2PURA 2YXGA 5G4EA 1MXSA 4WY0F 1SO6A 3ZR4A 4ADSA 2RDTA 4O16A 3SSJA 2F84A 4KKXA 1B4EA 3LTPA 5E1QA 2J24A 5EYWA 1ICQA 5K9DA 3SFKA 5BNKA 1DHPA 4LVDA 3C3NA 4DEFA 1W3TA 2WSYA 3AO0A 3DFPA 3R8RA 1PIIA 4NVTA 1JQXA 3WJXA 1G7UA 3L0KA 4H3DA 1EUAA 4QQ3A 1Z42A 1LRNA 3MI6A 1GVFA 5LNSA 3P74A 1KFLA 2YSWA 3FJLA 3RFAA 5DELA 1VPXA 1HO4A 1YADA 4BWLC 4XZ9A 2G5WA 3S5YA 4ALDA 4UTLA 1VZWA 5LGXA 4UR8A 4M7TA 3LI0A 2JGQA 1G4TA 3RF9A 3GZ3A 4KWWA 3NZ1A 3W6YA 3A5VA 3LTYA 3G1YA 1LOQA 1JQVA 4XQ6A 1TPUA 3I68A 1W5NA 4WZHA 1TPB1 4XTIA 3HGJA 4Z1CA 3DGRA 3UXDA 3UPWA 3P81A 1RQBA 2J27A 5KZDA 3NPUA 4N02A 1K8XA 1TPVA 3N2MA 2Y62A 1KFKA 2DZSA 3NAVA 4JDYA 4YLWA 1HL2A 1TPC1 2C13A 4LY8A 1YYAA 3L21A 3F4WA 3KVJA 3GDMA 5D09A 3PS7A 4YCPA 3MW7A 2KZHA 1FCUA 4MY9A 5F4XA 1LOSA 3LRMA 2FB2A 1ZAHA 3MHGA 1RR2A 1FWTA 1PCKA 1W3IA 3G0SA 4ML9A 3TH6A 5I3IA 3THAA 2E09A 1D9EA 1D3HA 4H6KA 3O6YX 4FIRA 3S6DA 3C2VA 3IVUA 3IGSA 4K38A 3ABOA 1H7PA 5D2VA 4I7WA 1KW1A 3W7PA 1ZALA 3JRKA 3OEXA 2ZQ0A 3WFAA 2ZTKA 4UTKA 4DF2A 5D05A 3VFLA 4JS3A 2C1HA 3KOFA 2QJHA 1DJQA 1UASA 3O1NA 3OG3A 3PULA 1OHLA 4OQVA 1H1YA 3QW4B 4M6QA 5CZSA 1Z44A 4IMCA 3BG9A 1KTCA 3DI0A 2YYTA 3GR8A 4UFJA 1UB3A 3ATYA 2WSQA 3G1DA 1XXXA 4UTTC 2ZRVA 3EX6A 2PRHA 4WD0A 3EWZA 3VI2A 2C0AA 5EA9A 3T78A 3PF3A 3LI1A 5F1UA 2E6YA 4LT9A 5DY3A 3TA6A 1UCWA 4DBEA 4CCCA 2DORA 4MJZA 1PCWA 1VCFA 5TQLA 2Y7FA 2A5HA 4MZ1A 3KVMA 4GUHA 4Z08A 1XKYA 4YMZA 3Q94A 4UMBA 3STGA 3LLDA 2CZDA 2FPVA 4UIOA 3GYEA 1ZAJA 1W1ZA 2QUVA 5IBXC 2G96A 3B05A 1W8SA 3EKLA 1TRDA 3QQ1A 1QPNA 5EY5A 5F1VA 5D04C 2F7FA 3W9ZA 1O4UA 3LLFA 5LZLA 1WAUA 1L2UA 2B7PA 5GVJA 2ZRXA 2VKZG 1KLZA 1GVSA 1IXNA 3QFEA 2X30A 3TMQA 2QCMA 2Y61A 4LU0A 1EEPA 2Y7EA 4M5PA 4TU1A 1XM3A 3R89A 3TK7A 3G8RA 1KLYA 5CSSA 1HFBA 5EBUA 2ISVA 4O0ZA 2V2CA 2E77A 1I4NA 4M6PA 2GQ9A 3UXAA 4AMAA 1FWSA 2P0OA 2D73A 3NL3A 1QPOA 1K7EA 1H7RA 2ZYFA 2QUUA 3DHDA 3DHFA 2FB3A 3BK0A 3L66A 4JTHA 3PR2A 5AB3A 1JR1A 3GAYA 5K7JA 4K7YA 2X1UA 2Q3OA 2CWNA 5HWNA 4LC8A 4XKYA 1KM5A 3QEZA 1G4SA 3FOKA 3MYPA 3T55A 4HSNA 1A53A 3OBKA 2BLEA 3PUEA 3S1VA 2ZZ7A 2GOUA 2A7RA 4JYFA 1XBYA 2OCZA 3P7YA 4JNMA 2J9ZA 4BWLA 2NWRA 3NPWA 5HINA 3T40A 1JRBA 4Q33A 3S1WA 3QM3A 3WK2A 2ZTJA 4NXKA 2DJLA 4KFOA 2Y85A 5SWUA 3W87A 4Y6GA 5HR6A 2E6FA 4XTDA 3EXTA 4FNUA 3IIZA 4JEQA 1LBMA 3Q37A 4EWND 2VFDA 1JRCA 1XDMA 2GJNA 4GC4A 2QCGA 2YW4A 3L0GA 3H55A 4O15A 1P4CA 3A23A 2I1OA 3S0CA 4HHPA 5D03A 4RXFA 4UTMA 2J88A 1LM1A 4U4MA 1WOAA 1OFPA 4MIMA 3G1VA 2J9YA 4GUJA 2TRSA 2ABAA 1B9BA 3EX1A 4MJMA 4TMCA 4PCFA 3NQEA 4RR4A 3BW3A 1F05A 3TC7A 5L6UA 1I2PA 3G0UA 2QKFA 4RZ5A 3S5NA 4O28A 4PC8A 2QEZA 4Q32A 1IF2A 1JCJA 1F73A 1X6UA 3L68A 5I3FA 3LHVA 1B3OA 3C56A 4O1AA 5C2XA 2Y88A 3PBWA 1VYPX 2E6AA 4IXXA 3THQA 1TTQA 4JGDA 4JX6A 4GBUA 3MBDA 1O94A 2VEKA 4LC6A 3BVJA 4P2VA 3DBPA 3W1LA 3QZEA 1DOSA 4Y8FA 5FF0A 3HGRA 2VENA 2H8XA 4O54A 5G2HA 4K7VA 2VEIA 3SR7A 3G3MA 3NQVA 2QAFA 4Z1BA 2E68A 1TO3A 2CLFA 4LVAA 3WJWA 5G5IA 1CX9A 3G3DA 1VGAA 4O17A 1GYNA 4MYXA 4O10A 3CC1A 2RDWA 5D2YA 5FF3A 3GDTA 4CNPA 5AFDA 2GPTA 2Y6ZA 2Q8ZA 4UTTA 4Z0JA 4K37A 3TSMA 5KITA 2ZRWA 3LHYA 4EVZA 1QNVA 3IGUA 4E2BA 1O5XA 3VE9A 3NXFA 1HO1A 2NUXA 3A21A 3M43A 4GJ1A 4Q4KA 2VELA 2UV8G 2C16A 2DZWA 1PS9A 3DENA 3G1SA 1GEQA 3R12A 3HGSA 2ALDA 1TPDA 4WOZA 3S8HA 3LCIA 3N19B 1S5WA 3VNDA 1OFOA 3W7NA 2QCHA 3W22A 4N9BA 2NV2A 4O53A 5G4WA 5IBXA 1F7BA 5BMWA 3RLUA 6ALDA 5LNWA 2HS6A 4OU1A 2ZZ6A 2GVGA 1PE1A 3RK8A 1BKSA 5AYZA 4UTWC 4RLIA 2OJPA 4DO4A 4O18A 3B03A 1JUEA 3FS2A 1SW3A 3GVGA 3O6CA 4O1CA 1WOBA 4QM1A 3QF0A 3R5EA 1VCVA 1OK6A 2DP3A 3ATZA 5C54A 1B57A 4MFDA 2QCDB 1NVMA 2PRLA 1GTHA 1TPEA 3EXSA 1TQJA 1V7YA 1EPXA 1F76A 3EX3A 1FDJA 1EIXA 2YFNA 1L6YA 1XBVA 1A5CA 4KFPA 3TQKA 1LDCA 4RCXA 2YGYA 4IMGA 3GLCA 2BWGA 1KM1A 1TB3A 5CG7A 3TROA 1DQXA 5K9CA 2GQAA 4JDBA 1TJRA 3NGJA 5LNRA 2DZXA 3BW4A 5KTLA 3HBLA 3G8EA 5K2ZA 3TNOA 1W56A 4ZQCA 3B0UX 4CQ8A 4MPQA 2A4AA 3WK3A 3MHFA 3HO8A 4R34A 1MSSA 4RXGA 4WXZA 3T7VA 2YPIA 2Y70A 1A5AA 2OX1A 3C2RA 5DBTA 3PC0A 1W5QA 1FXQA 4BI7A 2B7QA 4S2BA 3PM6A 4UFMA 2ZA2A 1GTEA 1JCNA 5LNUA 2GUUA 2LLEA 1LLZA 3FYOA 3B04A 3RU6A 2X1TA 2Q8LA 3IEBA 4W9TA 5LNVA 1SSDA 3R2GA 3E49A 1K3UA 4JYEA 4ZQMA 2WJZA 4O52A 1LCOA 2R14A 1HUVA 3MWAA 4AWTA 3W73A 1H60A 3NEVA 1PHQA 3SGZA 4IUOA 4PH6A 1W0MA 4MZ8A 3TR2A 2G95A 4ZQPA 4N6FA 1G4EA 4O0KA 3LCHA 4CNOA 1DJNA 1AG1O 3EB2A 3TUUA 2FIQA 4K8EA 4AHOA 1TV7A 1GQNA 1FDYA 3L67A 1KV5A 4MY8A 6TIMA 4XBSA 2Z6IA 1LYXA 2NX3A 4NZJA 3TC6A 1H50A 3PB2A 5F2LA 5TIMA 3UZJA 3P60A 1GVOA 1L6WA 4JTSA 1FQ0A 2O7SA 3O63A 1M6JA 3NPXA 2YW3A 2PC4A 3GB6A 2Z2UA 1G69A 4LUJA 5LHFA 1RQHA 1SO5A 3UWWA 4LNYA 3EKZA 5K3VA 5L9FA 5AYXA 4OV4A 1U83A 1LRQA 1TREA 1SUXA 3UWVA 1TPH1 4QJ1A 2ATMA 1XUUA 1H63A 2B0MA 4LV4A 4IX2A 2FFCA 3DAQA 2Y7GA 2C6QA 3QH2A 4O50A 3C0JA 1KTBA 3PY2A 3PVFA 5G1YA 2BXVA 2GVJA 5D38A 4S1FA 3SI9A 3QPYA 5DLCA 1BWKA 2OT1A 4L4LA 3IIVA 4A2SA 1FWRA 5FF2A 1SZGA 3TQ0A 1KFBA 1H51A 3IRDA 3LM7A 2FPYA 3SY5A 3I6RA 4DELA 3TW6A 3W84A 4JXCA 2YZRA 1FBAA 5BMXA 1M5WA 4FX8A 1SPQA 4HIBA 1IIHA 1TTPA 4JTTA 3LBMA 4UTWA 4N6EA 3P62A 3HJZA 4WOQA 1S5VA 1YDNA 3M16A 1M7PA 2P1FA 3GXTA 3W1UA 3M47A 3A9IA 4JTKA 2H3DA 1SQ7A 3PBYA 3STCA 1KTNA 2YCEA 3U6WA 3E0IA 3MO7A 5HULA 3P84A 3TJLA 4O4VA 2Z1BA 4UTIA 3QJAA 3HPXA 4U28A 3IV3A 1AK5A 1ML1A 1JUBA 2CLMA 3CQ0A 1DV7A 5KMYA 1RZMA 3W7LA 2NUYA 3NQ7A 2YX0A 4IMFA 1KFCA 1H7WA 4CCDA 3M41A 1XUZA 5LKYA 4PTNA 2VEPA 1VYSX 1Z48A 2NV1A 1LTDA 3L5AA 3NPVA 3W1PA 1WQ5A 2EAWA 2C3ZA 4WUIA 3CHVA 4DF0A 4UFLA 2ZA3A 1QOQA 3KX6A 3LHZA 3R13A 4PFMA 3B8DA 2CZFA 1DL3A 3CLMA 3N73A 1TSIA 4IPIA 3W1MA 1KM3A 5F4WA 2V8ZA 3P80A 5HR7A 4K6AA 1S5TA 2BX7A 3W7EA 2BZNA 4NNAA 3EWBX 3M5ZA 3STEA 3LDVA 3LHTA 4O12A 3PAJA 1XDLA 1GT8A 1T0OA 2O7QA 1XBZA 3W7IA 4LVFA 3L5MA 2WPBA 1ZFJA 4XBKA 2QCDA 3HIJA 3NR0A 3NYZA 1XFBA 3S1UA 5AHNA 3FA5A 3I65A 3TE9A 5HNRA 3DFNA 2ZZ3A 4N9DA 1AW5A 1JUKA 3KRUA 4FNQA 3MP4A 3USBA 3KFTA 3TU9A 2X2GA 4OE7A 1WBJA 3W1TA 1RV8A 1SO4A 3O8AA 5U7SA 3W2KA 5I3GA 3TAOA 2PRMA 2W79A 1F74A 3DFTA 2PE4A 4JTUA 3W1XA 4WY0B 4JYDA 4PODA 5U4NA 4LTSA 4C1KA 4MY1A 4DO5A 3QMRA 1ME8A 5FESA 1QMLA 4AWSA 4JTGA 3ANYA 2HS8A 3LXBA 3E12A 3GNDA 2XN1A 3M0ZA 3M6YA 2QJGA 3BW2A 3LXAA 4JTLA 3SW6A 5D02A 3V1PA 2PCQA 4POCA 2NX1A 2Y7DA 4TX9A 2A21A 1EA0A 3HB9A 3OIXA 4FX6M 3IGXA 1VR6A 2R94A 1TV8A 2ABBA 3A24A 4OV9A 2E5CA 3GKAA 1VLWA 4RX0A 2ZRYA 3JS3A 1HTIA 4OGZA 4Z1DA 4WXYA 3LX9A 5LHEA 4OBTA 5KZEA 5J5DA 2OMAA 2VXNA 1GG0A 3UWQA 2JBMA 4E2DA 5KSWA 1Y0EA 3NQAA 5D30A 3DXIA 3STFA 3G1HA 1TJPA 4RJEA 5D2XA 5K4ZA 3I7RA 2EHHA 4O1BA 5F2GA 3CEUA 5D2WA 1VLIA 3TV8A 3EX4A 3KRZA 3Q2DA 3DFOA 3L5LA 1LLWA 3F03K 3IVSA 4AVFA 1R46A 4HN4A 1VRDA 3BLIA 3CIWA 4FIQA 4N4PA 1KV8A 4J9JA 4ADTA 2RHGA 1H62A 4UMCA 4RZ4A 1TTIA 1DKWA 3PBVA 2YYUA 3PG9A 3SZ8A 1C8VA 4Z0SA 1JVNA 2NZLA 5EPDA 2XFWA 4LWWA 4NJIA 3TSDA 2OT0A 3NQ8A 1I2OA 4I7VA 4MYAA 5A8GA 1Q6OA 4MFEA 3DZ1A 1I8JA 1TTJA 3VE7A 1W5OA 2IQTA 3UWUA 2TPSA 4A21A 3IIOA 1BEUA 1VJIA 1SZEA 3W2MA 1JCXA 2YFOA 4GUFA 1RPXA 4ZMGA 3UWZA 3E9AA 1ZJIA 3C52A 4NNBA 4O13A 1QO2A 2G97A 4ZQNA 4AEOA 5CZTA 3W1RA 2GQ8A 3G1XA 4ONVA 1WXJA 5FEXA 3TIMA 3W71A 1J5TA 1F6PA 4ICNA 5I3JA 1ZNNA 2QCFA 2NX9A 2E5BA 3MI3A 4DQWA 2E6DA 3UPBA 3P8JA 3GR7A 1DORA 1EWDA 2ZDRA 3G1AA 1QO5A 1G6CA 3O16A 1K7XA 3NDOA 3I7SA 1EWEA 5D37A 4HNVA 4JTIA 3NM3A 2I9EA 3PUOA 3PBUA 1F6KA 3GDRA 1YXCA 3W7KA 3NQ2A 3NO5A 3G0XA 2VFGA 1LP6A 4O11A 3QQ0A 2E1DA 4LRTA 2HSAA 5HMSA 4AF0B 4BF9A 1DVJA 1IGSA 2WV8A 3O15A 1IXPA 2CU0A 2ZBTA 3TXZA 1ADOA 1TV5A 1GG1A 5BW6A 3GNNA 2C19A 1OFDA 3AJXA 4RZ6A 4TR9A 4OHQA 2VC6A 3TJXA 4M7SA 3G1FA 4FNRA 2V0TA 1N8FA 3H53A 1KA9F 1TCDA 2QCEA 4JX4A 4LS2A 2ZA1A 2WNQA 4IJBA 4A3UA 3M44A 3WK1A 3F1QA 2AQWA 3ABRA 3MUXA 1AMKA 3NL2A 1YTEA 4HPXA 4O14A 1F2JA 1JULA 3GXNA 3GK0A 4LW7A 1T8XA 3KRSA 3W07A 3W75A 1SW0A 2RDUA 3TMLA 4GUGA 4N2YA 2WNNA 3BLFA 4MLJA 2A1YA 5CGQA 2FTPA 4BR1A 2RFGA 4RV8A 4ZL1A 4QSHA 3N34A 5ABTA 3W7DA 1HG3A 3OVPA 3W2UA 1LROA 3HQ1A 1YDOA 4ZVJA 1KM4A 2FJKA 2CZEA 2GVLA 4FXRA 1WDWA 4DXVA 2V81A 4NJGA 4O8RA 2VFFA 3P8IA 1R2RA 3OVQA 3M9YA 4NUWA 1GWJA 1WX0A 3CB8A 2I14A 1N7KA 2J6XA 3DFQA 2NXGA 1J2WA 5DXXA 3CWNA 4AH7A 1VS1A 3TKFA 1RD5A 5TBOA 2W6RA 4IWWA 4EF9A 1OYAA 4RKAA 2A2IA 1YTKA 2JKAA 2TMDA 4UFKA 4NX5A 4O57A 4JIPA 1ONRA 3Q58A 4B5NA 4ADUA 3GDLA 2ISSA 1GYLA 3BO9A 2P10A 4LVGA
chains in the Genus database with same CATH superfamily
4EOUA 2MUCA 1IQ8A 5FEWA 2VEMA 1BVNP 3ZOAA 2C14A 3KZSA 4GFIA 1PTDA 3CZGA 3HG2A 2CZ5A 4HKPA 4D1JA 2CNCA 4AHPA 4ZQOA 3IJ7A 2I57A 3ABQA 3AZRA 4GQQA 3MSGA 3EOEA 1WB0A 2CLHA 5AOUA 3T44A 3BG5A 4YCOA 3LRLA 4FS9A 4JY8A 3UCQA 1PTAA 3NSXA 4O1DA 1UUOA 4CGTA 3ABSA 1PZ0A 4JR5A 4I9AA 3NQDA 3FY1A 1SMAA 4M51A 7A3HA 1DJHA 1QFEA 3WLHA 2WZIA 1C9DA 1DWJM 1H0IA 3THUA 3TYBA 5A6BA 2V5CA 4MNMA 1XLJA 1Q6RA 3WNNA 1J10A 2E28A 2PWDA 4RUBA 4L9ZA 5DN1A 3HFYA 1VHCA 3GKFA 3N12A 3UZ5A 1TMQA 4MOZA 1JDAA 1TJ2A 4M1BA 6PTDA 3W88A 4Y96A 1OT2A 1IT8A 1JDDA 5ABGA 3QC3A 3GSMA 1GVEA 4FXSA 3KOXA 3BANA 4UXDA 3S9IA 2E25A 3B0PA 1H7OA 4G9PA 3STPA 2Z2AA 4AHQA 3FJ4A 2QJJA 1GVRA 3CJPA 4F0HA 3ZT6A 4B5VA 5BRBA 3BSMA 2Q3RA 3MYOA 3UU0A 4A35A 5T91A 1FWBC 4S3DA 3R6IA 3CV2A 4QHRA 3BLOA 3UYCA 4J28A 5CJNA 3LGEA 4NT0A 4ASTA 1Q3NA 4N4QA 3V35A 4IJCA 3HPSA 2XFFA 5DXYA 1HKIA 4UR7A 1R2TA 1DYSA 4Q4PA 4KWVA 5DO8A 1V3MA 3NQFA 1JYNA 4HMDA 5KZ6A 2WHJA 3DI1A 3LA4A 4V15A 3O07A 5FA5A 1GOIA 4D9PA 3VX0A 3BPWA 3PZNA 3L23A 5J04A 1VBRA 2P53A 2C1IA 1AJ2A 4I8YA 1XIDA 1QWGA 5J5RA 5FI8A 5IOBA 3PPCA 4R9OA 3SGUA 4C6EA 1KCXA 3LCWA 1K8YA 3QMSA 3N14A 2V5JA 1TIMA 1R6WA 4W7WA 3VCCA 1DIDA 3SECA 1WAWA 2E1WA 1B1YA 3QYQA 1MEHA 4PBEA 2OG9A 3AOFA 2FTWA 4NP7A 1P7TA 3CIXA 1TPWA 2GGHA 4A3HA 2YCKX 3K8KA 1HVQA 3W1NA 1KM2A 4NXSA 4FXFA 3S5ZA 1OD0A 1CB2A 2EO7A 2YA1A 1R9ZA 2E4TA 2ZFAA 2HMCA 3QLDA 3SURA 1TWWA 4AF0A 3B40A 5D33A 3L4XA 1TA3B 3ARSA 3ARQA 3NQGA 2YB1A 4XG1A 4X2PA 2PDNA 3N2OA 3I7QA 3PNUA 3N3MA 5A5WA 4CQBA 4MKVA 7TAAA 3GVVA 3F5LA 4IIDA 1IYXA 1EH9A 8TIMA 3OZYA 1M7OA 2Z2BA 3KOWA 4B5XA 5CJMA 1A5BA 1DXEA 1RALA 2VL4A 4N9CA 2QJIA 3W37A 2Z1VA 3QPZA 1Q65A 4E4UA 4R53A 2NVAA 5C2CA 3B06A 2ZUWA 5DCBA 1LQAA 4UOQA 3HOJA 1YDVA 2PS2A 4C6FA 3MZ2A 3QTGA 2H8ZA 3L2LA 3VZZA 3B97A 1W37A 3BAIA 2ZOXA 4DI9A 2VR4A 1ZAIA 1R30A 1RQEA 3EEZA 4NASA 1BYAA 4DB7A 1EBGA 1NF0A 3RG6A 2IUZA 1UIPA 1OFAA 4OT7A 5HNTA 2BTMA 3E96A 3NL5A 1M7XA 1TYGA 2QF7A 3GFXA 3OYZA 3MVIA 4O1EA 4LS1A 3DDMA 1AW2A 1ZENA 4IL2A 2V5BA 3N11A 4FOKA 3ITGA 4GJJA 1UH2A 2FFIA 1H5YA 4OFCA 2JKEA 2HK0A 3H7UA 5CPOA 5BOOA 2BSLA 1LG1A 1MQRA 2W63A 2IQ0A 1W9XA 2WMKA 4CLMA 4CNUA 4WKFA 4G7FA 1PX4A 4DI8A 1NEYA 4FEZA 3QSRA 3M0XA 5AHFA 2DH3A 1Z41A 1VCGA 2RH9A 4L4PA 4INFA 2IKGA 4QJ4B 4AZGA 1GOOA 1AQHA 1AJZA 1QDSA 4BI5A 3W4RA 1H61A 1K1DA 4PL1A 1EFZA 3GU9A 3MVTA 1TUXA 2Y89A 4QNEA 3RR1A 5GJNA 4AW7A 5AYYA 3UWYA 2HZGA 4BI6A 1XH1A 4FA3A 2VJXA 4GG9A 3PG8A 3BXWA 3NZPA 4DM2A 1US0A 1W1B1 4AYSA 1UOKA 3SCTA 4UQCA 5CPLA 1SO3A 3CQHA 3U9IA 4ATWA 1X7IA 4GI6A 3HTWA 2BOFX 4KF1A 2BFGA 2ZC8A 1BTMA 2GSHA 4AQLA 1P0KA 2EJAA 1U5JA 2XGBA 4UBPC 4MSSA 1W5MA 1N8IA 1V0KA 1A4MA 3CV6A 3OLGA 4HNTA 1CCWB 4Q6XA 1A0CA 4YTQA 3LCXA 3MWCA 2WO5A 4DWSB 3BJSA 4D8AA 4PMOA 5LSMA 3TTSA 4NQ1A 3AIBA 1V5XA 2Y2WA 4GD0A 1LBFA 2VC5A 1A5UA 4DYKA 1JZ3A 1THFD 3TCEA 4ACZA 3VDHA 1V3LA 3M1ZA 4NJHA 2PC8A 5AHEA 3REQA 4XISA 3B9OA 3VDBA 1OSEA 3M5YA 1Q8AA 3UNDA 4HNUA 4GFSA 1MNSA 2XGIA 2BNJA 4QISA 4B2DA 1REQA 1JYXA 3D0CA 4L6DA 4AXKA 3WDQA 2D2OA 1PKYA 3W85A 3SDOA 1DJWA 2R6OA 1VPQA 4GH1A 1GQLA 3VIGA 5I3HA 5AHMA 4UC5A 1A3XA 1V6VA 4FO4A 3BV4A 1CGVA 5C8BB 3LK6A 1UROA 1IXOA 3FYPA 3DFHA 4AB4A 3APYA 1I45A 1US2A 1W9DM 3XIMA 1HX0A 1G7VA 3TQVA 2OZTA 1YNYA 3WEOA 4RNIA 4DNMA 3PWGA 1ME7A 4LY4A 4FX7A 3WLSA 2PWFA 3IK2A 4Q8QA 3V5CA 1LBLA 1EDGA 5DQPA 3NM1A 4ORIA 4QE5A 5F4SA 3G24A 4GISA 3B9EA 4YVXA 3ZJ6A 1OCBA 3W27A 2ZRUA 4PBFA 1YXDA 2NLYA 1R9YA 1WDRA 1J6PA 3WLQA 5G1MA 3OB8A 4A8LA 1TRIA 1T7LA 4ZQRA 5G4HC 4D6GA 2QT3A 3GG0A 3AXMA 4ZR8A 2PLKA 2XSXA 2J4GA 3WN6A 1XIBA 1OB0A 4JD4A 1GOXA 3P14A 3C2OA 3N29A 2EPHA 1NARA 3CAQA 4LAKA 2PSNA 1I1WA 5I78A 5KZMA 3AU6A 5D2TA 2BOGX 2VWSA 1GHSA 5E9XA 3RUBL 3MMDA 3LNPA 3W2NA 1MZHA 2OLAA 4WVXA 3OQ8A 3P67A 1V08A 4TUFA 3BCDA 2DIEA 4DPQA 3QW3A 2IPWA 3P3BA 4ERGA 1PB0A 4LUSA 4QDPA 3H70A 4NAFA 2DZVA 1GPWA 2JGYA 4L56A 4PE8A 3SRKA 4R7WA 2YLAA 3PN8A 3GDKA 3M7WA 1JZ6A 2DV0A 4V1XA 2ZUTA 1FWWA 1W2VA 2ZXAA 1JJKA 1SR0A 3LCGA 5ENLA 3EWUA 1KCZA 4AIOA 2OKOA 5D32A 2CHRA 4TV5A 1FVPA 2J7DA 4DWDA 2FZDA 1QR7A 3UG4A 3O06A 4XAFA 4YYCA 4HGXA 4XUGA 2HXUA 1XI3A 3L7RA 2DSKA 4J3UA 4QAIA 1GVQA 2BV9A 1JF5A 1NAL1 5I79A 2WXDM 1XCWA 1OEPA 3UGVA 3TSBA 1XLCA 4PL2A 4GVHA 2DU2A 2R1NA 2Y0FA 4HYWA 3OYXA 1LQ0A 5G4EA 2JIEA 3F4VA 2X7VA 4ADSA 4ECLA 3KHDA 4R9XA 2Y8VA 3SSJA 2F84A 1GPFA 4OBSA 1HIZA 5E1QA 4OBRA 2AQVA 3C86A 1ICQA 1KFWA 3WLPA 1IEQA 1W3TA 4OTKA 4F48A 3UR5A 3R8RA 2O4QA 4Z17A 1S39A 4QDWA 3L0KA 3M7SA 2WCAA 2WJFA 3FVDA 3GIPA 2HROA 4C6KA 1XYZA 3QV6A 2R1KA 4FLOA 1GVFA 5CJ5A 1V77A 3FA3A 1QW8A 3WQFA 1EPVA 1OC6A 1KXTA 4BWLC 1UH4A 5A6AA 1PIFA 1UYQA 4AX7A 2GVEA 1G4TA 3GTXA 3GZ3A 2GJRA 3CMFA 3WQ8A 3A5VA 4EWJA 3G1YA 1IGWA 3I68A 3TYAA 1JI2A 1WKEA 4W8LA 4LJ3A 1RQBA 5CQ1A 2BVTA 1UR2A 1TPVA 4F9DA 4XV0A 1CZ1A 2ZVRA 3GU2A 4LY8A 1IR2A 1KXVA 5FAGA 1YYAA 4MY9A 4KEVA 1BGAA 1V4YA 1FWTA 5D9MA 3T2OA 2IS7A 4ML9A 3THAA 1D9EA 3IGSA 1UBPC 3ABOA 1H7PA 3WLKX 5D2VA 3JZUA 1KW1A 5C9WA 1ZALA 3VMNA 2QVNA 1UMLA 1UKOA 2C1HA 4F79A 4C1NB 1DJQA 1UASA 3IJIA 4MPKA 1KBLA 1OHLA 3QW4B 4M6QA 5CZSA 4IMCA 3DI0A 5JXQA 3WUFA 3KWSA 2WSQA 4HK6A 3GU1A 4AD0A 2ZRVA 4UZSA 2J7BA 4JEJA 2C0AA 7PTDA 5JBEA 3TA6A 1UCWA 4CCCA 4GJIA 5BWAA 4QP0A 3KVMA 1XKYA 4YMZA 2A3AA 1OCJA 3PBMA 3LN3A 4GA8A 1R3VA 3Q45A 3URAA 3U2ZA 4UIOA 5D9NA 3GW0A 4D6FA 5LA2A 1DXFA 4Q8PA 1MXGA 1UZ1A 3G5EA 1JD9A 2WMHA 3T0AA 3GG8A 3VX1A 4JKMA 3QQ1A 5EY5A 1K9EA 1O12A 3MT1A 3F4DA 2J79A 5D04C 1E0TA 3PHAA 1EJWC 3W9ZA 1O4UA 3Q4DA 3LLFA 1MQQA 1WAUA 3BAKA 2TODA 3WL0A 2VZTA 3LZ5A 1ZBWA 4KIEA 1IXNA 1XIMA 2X09A 3QFEA 5FKYA 3TMQA 3TYCA 3II1A 4LU0A 1EBHA 1XM3A 4AISA 1BYBA 3G8RA 1KLYA 5EBUA 2ISVA 3WDPP 4O0ZA 1I4NA 4AMAA 1FWSA 2D73A 1DEDA 3URQA 4GKLA 4OOUA 2QUUA 3DHDA 1OWQA 2IPFA 3UPMA 3GG1A 4FLSA 2FB3A 2Z29A 2PDGA 4JTHA 3PR2A 4HD5A 4PMVA 1JR1A 5A8MA 3VKDA 2CWNA 3VNJA 4L1WA 1TWSA 3BC9A 1DPMA 4E4PA 2QMJA 3SRFA 4KCUA 3QOKA 4EACA 4HSNA 3GYCA 1XH2A 4BEQA 5AC5A 3D6NA 4LAOA 1Z6KA 1E6RA 2RUSA 4H9YA 3CASA 1PDZA 4JNMA 1IEIA 4KW2A 1QI5A 1LF1A 1Q7ZA 5HINA 3T40A 1JRBA 4DUWA 5E6ZA 3KL5A 4N7QA 4AUBA 3QM3A 4EPKA 1S5NA 4NXKA 1VFOA 4DXXA 3W87A 2VI0A 1WUFA 5HR6A 2GSJA 1IZJA 3Q37A 4X61A 1UA7A 2DVTA 3D47A 1XDMA 2G4JA 4ZXLA 1JF6A 4HHPA 5A3HA 2WYSA 4S3AA 3G1VA 1O1ZA 2VMFA 3NSMA 2OO6A 4GUJA 4QDMA 3DHUA 2AGTA 1RLCL 4PCFA 2Z28A 1Q5MA 3H4GA 1R8LA 2Z26A 4W8AA 4RR4A 4XVEA 3MANA 1ITCA 3BDKA 3G0UA 4RZ5A 4O28A 4PC8A 2QEZA 4Q32A 1JCJA 5I3FA 3GQYA 2DW7A 4O1AA 5C2XA 1VYPX 1CWYA 6ENLA 1TTQA 4JGDA 4GBUA 1O94A 1DE6A 2VEKA 5BROA 1XIHA 1CXEA 2VENA 4WDXA 4K7VA 5CSUA 3S2JA 3TLLA 2E68A 1LUCB 1ZPTA 2O55A 4ZO7A 3CYVA 2CLFA 4LVAA 2WBGA 5EMJA 2CWXA 1K4HA 4MYXA 4MGGA 3IPWA 1M01A 5JBFA 1ZJBA 3T07A 3KL3A 4DYEA 2WCGA 4AZCA 5KITA 3MQTA 2F6XA 2OKTA 2DSZA 3KLKA 3NXFA 1TV2A 2SFPA 4WKHA 4LUTA 3WBEA 1HO1A 1MW3A 5DRCA 4Q4KA 4Y9MA 5D8ZA 2DZWA 3UCDA 1PS9A 4A8RA 1YE4A 1OC7A 1JIBA 2DVUA 3LCIA 3N19B 1S5WA 1UWAA 4J35A 2XVPA 3SN1A 1P1MA 3H8AA 4AZIA 4N9BA 3DECA 3B8TA 1TUFA 3SCWA 1BQGA 1PE1A 5CPSA 3UVIA 3HFTA 1GOKA 4HB7A 5AYZA 4LSBA 2OJPA 3M6DA 4H9UA 2VCAA 2QYGA 2WC7A 3GVGA 3O6CA 1OM0A 4O1CA 4DUOA 4QR6A 3GTFA 3ATZA 4H01A 2XPKA 2PDMA 1NVMA 1BQCA 1VAHA 1TQJA 1GKQA 1F76A 3UJRA 3GTNA 1FDJA 1EIXA 3CV1A 2YKKA 3VIMA 1A5CA 4KFPA 3TQKA 3I4KA 3TTEA 5BXTA 4US5D 2QJMA 1DQXA 1Q4WA 3CO4A 3TYZA 2C8NA 2QLYA 4BQ4A 3NGJA 5KTLA 3ABXA 7REQB 5K2ZA 3TNOA 1XGDA 4I5XA 4AD1A 3NTYA 3WK3A 3MHFA 2Z1SA 3HO8A 3VAVA 4NZCA 2BS9A 4WXZA 3ANUA 1CLXA 3QR0A 3T7VA 4NZ4A 1A5AA 5HQLA 5ABEA 3PPHA 4EKJA 6REQB 4S2BA 5CZKA 3N18A 5MF5A 5HAOA 3NXLA 3F5JA 1GTEA 3A6OA 2LLEA 4L4OA 2O92A 3BAXA 3IEBA 4W9TA 3NOYA 3E49A 4JYEA 4ZQMA 2W67A 2WJZA 2R14A 3AMCA 4TVUA 1HUVA 3CUJA 3MWAA 2POTA 1H60A 4C6QA 3NEVA 4UQBA 3QYSA 1XIEA 3ZR6A 4MZ8A 3VZYA 1VRXA 5FL1A 1ZP3A 4N6FA 2ZUNA 4O0KA 3LCHA 4CNOA 1DJNA 4AEFA 4H8HA 1AG1O 4MNKA 2VZUA 2V5KA 3MSRA 5A6LA 1ZBCA 3KOZA 1FDYA 2DVXA 1KV5A 4HNCA 4XBSA 2AL2B 2Z6IA 4GO9A 5BYWA 2NX3A 1VFHA 2YL9A 3PB2A 4IM4A 3UZJA 4KEMA 3TA9A 4JTSA 4LF1A 1A5MC 2WM1A 1R38A 1XLHA 1M6JA 2PC4A 2YA0A 5LHFA 3QC0A 4B16A 4GIYA 4E5TA 4H8UA 3EKZA 5E5CA 5AYXA 4OV4A 1R7AA 2I9UA 2FHBA 3WH7A 4Q7NA 1CLVA 1UWIA 1TMLA 2MNRA 1RHCA 2W5FA 2C6QA 4O50A 3GC5A 2BXVA 3BSHA 5D38A 4KWOA 2Q02A 2JEPA 3IGHX 3NDYA 4S1FA 3QPYA 3HPFA 1XSKA 2AKMA 1HL8A 1NJJA 1RY0A 4DBUA 4O1FA 3IIVA 4B5TA 3TEVA 1FWRA 4CD4A 4FALA 3TQ0A 4GPNA 4NKCA 2G8ZA 4DELA 3A13A 2AKZA 2Z27A 5BMXA 3LG3A 3WQWA 3K1GA 1M5WA 3AIUA 4ZFMA 1IE7C 3LBMA 4IP7A 3UCCA 4N6EA 2W62A 1UIOA 4C91A 5TAOA 4PTWA 5E6YA 1HKVA 1S5VA 1JFHA 1M7PA 3M16A 4FZIA 1T8QA 1BRLB 1A0EA 3PBYA 2PTYA 4Z2LA 3E2QA 1VIWA 1A80A 1UWSA 5HULA 3TJLA 4O4VA 1VJSA 2Q6ZA 3HPXA 2R24A 3LPFA 3LLXA 4KEUA 5AKQA 3WD2A 2PDBA 2Y8UA 2Z1XA 1KQYA 2FKPA 3NYDA 4DX3A 1RZMA 3UZWA 2BDQA 3FK4A 3W7LA 3VOGA 4IMFA 3CAVA 4JIHA 1D3CA 1TZ7A 2VURA 2J6VA 2VEPA 3WFLA 1Z48A 3LY0A 2CKRA 5FJTA 4H00A 2XVGA 2PDIA 4BY3A 3L5AA 3NPVA 4NAEA 1WQ5A 2EAWA 3CHVA 4V33A 2WC3A 3ZYZA 2O9OA 2PDKA 4JIRA 4AIBA 4H9MA 4AY7A 1BFNA 1O1HA 3CLMA 3N73A 1TSIA 3W1MA 1WDQA 2D23A 3CLWA 2IKIA 3GIQA 2GDQA 1UKTA 2BX7A 3CBWA 2PBOA 1GW1A 4NNAA 1S2WA 1K9FA 3M5ZA 4ZODA 1MRAA 3LDVA 1XDLA 2J8FA 2XHYA 1GT8A 1T0OA 1JCTA 3BE7A 4EP8C 4CCZA 4LVFA 2QCDA 2IW0A 5AHNA 3MUCA 5I5RA 3SGGA 4IPPA 3T08A 1E6XM 1JUKA 3MP4A 3E2RA 1HQTA 4KCWA 1E56A 4OE7A 3W1TA 1SO4A 5I3GA 1DWIM 3DFTA 4JTUA 4WGXA 2PE4A 2HCVA 4WY0B 3DHPA 4JYDA 5FJIA 4D6HA 2IPGA 5U4NA 1QBAA 3G2GA 3AISA 4DO5A 4MY1A 3RYSA 3QMRA 2D24A 4IGMA 1QMLA 4AWSA 1YDYA 2BP1A 2HS8A 3M0ZA 1ISWA 1ECEA 3IAPA 1V51A 3BW2A 1CBGA 1OZQA 1WE5A 3SW6A 2WWCA 3CL7A 3M0YA 2Y7DA 3TWBA 2DGAA 5GQBA 3TTOA 3HB9A 4FX6M 2XWEA 1AQ0A 4I3GA 2R94A 2DH2A 2E9BA 3I10A 1VBGA 4RZBA 2ZVIA 4WXYA 4MB3A 3P6LA 5J5DA 3H26A 3SUSA 4U10A 2JBMA 4DVOA 2OR2A 5KSWA 1Y0EA 4H9TA 1TV3A 1XH0A 1B3ZA 4G56A 4DAFA 3DXIA 5K4ZA 3NGFA 1JNEA 3DX5A 3UZZA 4O1BA 5F2GA 1VFFA 3CEUA 5D2WA 1VLIA 3ALGA 3TV8A 3KRZA 3DFOA 3L5LA 1E4IA 4F2TA 3IVSA 4AVFA 3NO3A 4U2ZA 3RMEA 1VRDA 4W4QA 3OBEA 3WD1A 1OADA 3BLIA 4ZOEA 4FIQA 4ADTA 1NH6A 1O66A 1Z9AA 3GTIA 4AX6A 3WEMA 2R1LA 2BB0A 2QPXA 1JVNA 4LWWA 4NJIA 2ACSA 2F8QA 4LF2A 1T6MA 4N42A 5A8GA 1I8JA 1NQ6A 5FJJA 1TTJA 3VE7A 3UWUA 2TPSA 1XPYA 1U1UA 4NYYA 1JCXA 3LM3A 1BYCA 3ZLFA 4XX6A 4ERIA 4ZQNA 5TD4A 3U7VA 2GQ8A 3G1XA 3W71A 2F38A 4AIEA 4DQWA 3M0HA 1AVAA 4KIRA 4DYJA 1QO5A 4CD5A 3O16A 3GFZA 3U5UA 2NSXA 3I7SA 5D37A 4WK9A 2C71A 3PUOA 3IUHA 1CXFA 1HJUA 4H2HA 3G0XA 2VFGA 1LP6A 2C1GA 3BJTA 2CYGA 2E1DA 2PBGA 3AICA 4MB4A 1XD1A 4PCSA 1IGSA 3CAWA 1ADOA 5BW6A 3GNNA 2PDFA 4F0SA 1E3ZA 4H83A 3A3WA 1KA9F 4GGHA 4JX4A 4HA0A 4W7VA 4LUYA 2EKGA 3JZEA 5HNUA 3WK1A 5FSDC 4JCMA 3ABRA 3MUXA 5C7HA 1JI1A 4HNOA 3GXNA 4B3ZA 1J79A 4ML4A 4QG6A 1J12A 3AYSA 3R25A 2G3JA 3W07A 2RDUA 3WF1A 4UOZA 4IL0A 1Y7VA 3OP2A 4GUGA 1ECQA 1R3TA 1U5VA 3BLFA 2RFGA 3RCNA 4H8NA 4P8UA 3N34A 5ABTA 1LROA 4J3WA 1MUWA 2GVLA 4PSRA 4DXVA 4AFYA 2V81A 2VFFA 3P8IA 3OVQA 4MHBA 3M9YA 1GWJA 2I14A 1N7KA 2ZC1A 4ZB2A 3T0TA 2VRKA 2YCLA 3MB9A 4J4KA 1YBQB 3G6LA 4M24A 3EDEA 5E0FA 3WQOA 2ZUSA 4EF9A 2DSWA 2A2IA 1PEZA 3W82A 4RNJA 3ZIZA 3EPNA 5CXPA 3IV8A 3U2EA 4IF2A 4O57A 3CTTA 3T0DA 3ALFA 1TWDA 4ICCX 4B5NA 1KNWA 5FJRA 4ENLA 1EJTC 2P10A 1GZ1A 2DDXA 4D2JA 2E8ZA 1W91A 2NLIA 1RD6A 1OK4A 1LWJA 4HTYA 3COTA 3VGGA 4IX0A 3EDJA 1FCVA 1J5SA 4UMAA 5G2IA 3FEQA 4GZJA 5I24A 1M04A 3T81A 1UWTA 2NVDA 5BXRA 3EB4A 1XYFA 3P61A 3NA8A 1G0CA 3EWCA 3GNPA 3W53A 1C29A 1XHGA 4MM1A 3DU0A 1PYMA 3CK5A 2ZZ4A 5CEWA 4Q4RA 1GUVA 1YXYA 4KFNA 5H91A 3L4TA 1EP2A 4IFKA 3BMWA 4Y8EA 1XRVA 2J9XA 5EMUA 3P0XA 1OX6A 1XBXA 2DUXA 3FKKA 1EL3A 3LBOA 4MDOA 2NQZA 2AAMA 5HWJA 3CNYA 1DQWA 3FN9A 4GWEA 3W86A 5E09A 1K9DA 4UTUA 1OX4B 3LD5A 3ARWA 5I3KA 4YL2A 2E5DA 3BLEA 2DIJA 1E6NA 4W93A 4J5NA 1XC4A 3JR2A 1TVPA 4L1XA 3OHIA 1EJVC 3W7QA 1UUMA 1YE6A 4GX8A 1EO7A 1A5LC 1KD0A 3QGKC 1VD6A 4PSPA 1JXKA 2QJNA 3R7MA 3T42A 1F3XA 4IIFA 4OECA 3QHNA 1ISYA 2H9AB 4YTTA 2J77A 1ODZA 1A5SA 1W3KA 1PV8A 1OFRA 2IKJA 1NOWA 4B2DD 5C9XA 4M6VA 3B8WA 2L5HA 4QITA 1P0BA 4I6KA 3FAWA 4Z1AA 1Q66A 1X8FA 2VRQA 4EX4A 4Q8WA 1FTXA 3KVLA 3TTYA 1MUMA 3HG4A 1XPGA 3S2MA 1NFBA 8CGTA 2Z6JA 1H7XA 4DPPA 2A7NA 5I06A 2VTFA 2V69A 3S9YA 1V0MA 3ERPA 3V1HA 4E2VA 3DFYA 2WZEA 3KRBA 2A6NA 2PEVA 3K1DA 4Y7EA 1PL9A 5EU9A 1VC4A 1X1ZA 4HP5A 4J1OA 1Q85A 3EWXA 1E73M 3NQCA 6CGTA 4LS0A 3LOTA 2JK2A 2F61A 3DKLA 1JNDA 3DESA 1XIFA 4PUUA 2XIBA 2VVNA 4ATDA 2XIJA 4HTBA 5FL0A 4NI8A 1YRRA 2CLKA 1AL7A 2XIQA 3LXCA 2QCNA 2HPIA 4RNHA 1LZOA 3LV5A 1L0PA 1HKWA 2BVDA 5CZJA 3CUHA 1LLOA 3W01A 4LOCA 2EKCA 1LQ2A 1W3LA 2ZE3A 3KBJA 3KOYA 4B9YA 3BAYA 2HBVA 4KPLA 2XG9A 1VB9A 3TFXA 1UZDA 3HV8A 3VMPA 5H2ZA 4L61A 2UBPC 4E8GA 4K68A 1GOMA 4E8DA 4FB7A 3LERA 1SR9A 4LPCA 1F4AA 3MKKA 1PVNA 1KFJA 2PLCA 3W25A 5AHIA 1YPFA 3TOYA 3WH8A 1B31A 1W1IE 3FJ6A 1TFVA 1QK0A 3NQBA 2V82A 1HJVA 1RP9A 4O4WA 3UERA 1VH7A 2WHKA 3W76A 3E74A 1WZLA 1PPIA 2AMXA 1RP8A 3AYTA 4G1NA 3LB0A 3SRDA 4P5UA 4EIVA 1XYCA 2NXIA 5GNZA 1ICSA 2CCRA 1K03A 2Y24A 3TX9A 1JEZA 1BLIA 3ME3A 5G2WA 2WQPA 3KE0A 5K9XA 2XFYA 1OFEA 3ARZA 2YOCA 3V7PA 4GK8A 4JTJA 3FLUA 2BGQA 4IQLA 4LV9A 3FDGA 3PWAA 4H9XA 4MLRA 2VGFA 1EXPA 3NG3A 2C18A 3KBMA 5CH9A 2OVLA 1XG4A 3S1GA 4HZ7A 4F4RA 3R0UA 3FGCA 1MO0A 1OF6A 2QNEA 4S2CA 4LRSA 3CQJA 3GIYA 3SM0A 1N55A 2CLOA 3ZS4A 5GNYA 3I4EA 3LRKA 4Q8OA 2YBVA 3GR4A 4B9ZA 1EZWA 5ECVA 3C4UA 1CNVA 1YHTA 3FSUA 1MEWA 2WANA 3C6CA 1GKRA 2QCCA 3QQWA 3R8GA 3RMJA 4HVXA 3LUTA 4JN6A 3S6OA 5M03A 9RUBA 1TPFA 1RJQA 3EWYA 1POJA 1DXIA 1M53A 1HVXA 4IOTA 5HWMA 1UP0A 3SO7A 2A3EA 3K8MA 4X60A 3IIPA 4MWAB 3OA3A 3P5ZA 3RM8A 4GUIA 4TMBA 2Y5EA 2GWGA 2XINA 4NYUA 1FFRA 3TN6A 3W26A 2GQ3A 2DQWA 3U2OA 3VFCA 3VD4A 1KM6A 1V3IA 3GAKA 3CPRA 1OG0A 2OYMA 4GO8A 4XWUA 1SFJA 1AL8A 1S3HA 1VYRA 3EX2A 2PF8A 4XZWA 4Z2KA 1VQTA 5H8MA 1I6NA 4LBUA 3SAZA 3NZRA 1ZS2A 1GQJA 1PX3A 4C1LA 4XB3A 4PUKA 2GYIA 1ELSA 2ZX5A 1U22A 1QAPA 1L6SA 2WKJA 5A6TC 3LV6A 2QDHA 3DH7A 3FVMA 4DJFA 1UJPA 1UR4A 3VCRA 4E38A 1VFSA 4DBSA 1OYBA 4JQ2A 4RK8A 5M17A 1IT0A 4JFWA 3AZSA 3U2CA 2R91A 1SZFA 3KXQA 1X1OA 4K1WA 2CERA 4AWEA 5AHLA 1ICPA 3OIHA 2PDUA 3RX3A 1I75A 3QR3A 3QHMA 3QN3A 4IQEA 3HQPA 1RK5A 2VNCA 4UQAA 5DFAA 3LGGA 1L2QA 3WMBA 5FEZA 5LXXA 3FCPA 5K4XA 4PA8A 4DBDA 1XIJA 3W6MA 5A6JA 2PWVA 4Z2IA 1YPIA 3VNIA 3LTSA 4QEEA 5F7UA 3LMZA 1E0XA 5IFTA 3WJYA 3ZLHA 1NP0A 2GK1B 1V3HA 1OX5A 1KR1A 4HQVA 4CNTA 5I07A 3VNYA 1HN1A 3QVQA 3GE7A 1Y5VA 2V3FA 4M0XA 2NUWA 3W2LA 3F2BA 1Q6CA 2GGEA 4GY1A 4Z2GA 1HKJA 3PZQA 3FDKA 2WLYA 5CPNA 3IARA 4HOXA 2QDGA 3VOIA 3U4AA 3HG5A 3W83A 1CEOA 4Q4OA 3L2MA 1EZ2A 1M03A 4HPHA 4Z2JA 3A22A 1AFSA 1O7AA 3E38A 3K30A 1TZ9A 4HK5A 1TA3A 4UUIA 1E9YB 4PR4A 5F2MA 4E3VA 1E15A 3AXKA 2V9DA 5AC8A 4CQ9A 4DUVA 1W5PA 1NM9A 4TVCA 2WLZA 2ODOA 4FHAA 4LVBA 3W70A 5MHBA 3NL6A 4U33A 4Y9AA 1VJZA 3CEPA 4F0KA 4JIIX 3L0NA 3HU7A 3LHWA 4DF1A 4Q4MA 4H7VA 5LIKX 1A4LA 4LUIA 4B5UA 5FCZA 3NFUA 1JZ7A 3VNMA 2D20A 1HP5A 2NQ5A 1OYCA 4PMNA 2Z0IA 4XKYB 4Y90A 1LORA 4CNNA 1PHWA 1OY0A 3VKKA 1YKWA 2X1SA 4XZHA 5AN7A 4WGHA 1EC7A 1RK6A 3U7BA 4ZA0A 4MUZA 3CO8A 1OGSA 4B92A 4G1KA 5DCDA 4DZ5A 1I2QA 2QIWA 3ES7A 4R33A 5HJLA 4HJWA 5CKSA 1OQFA 2DZTA 3LENA 1GGOA 4WJXA 5AZ1A 2RAGA 1E43A 3BOFA 3E02A 4H9ZA 4GXMA 5LIUX 4KWUA 1MEIA 5AYIA 1I2NA 3PSWA 4H4IA 4UWMA 5FF7A 1O5QA 1E71M 1WUEA 1IEVA 4FMVA 4WY0F 5BU6A 4O16A 1T5AA 1JPKA 2J24A 3BWWA 1HP4A 5K9DA 4XIMA 5BNKA 1DHPA 1TV4A 4PB5A 3AO0A 1BG9A 3WFZA 3M0MA 1JQXA 1RH9A 3RLGA 1EUAA 3MPGA 2PP1A 4QQ3A 4KH2A 4I90A 4E8CA 3MI6A 5LNSA 3ZMRA 4ZTYA 2YSWA 3RFAA 1BD0A 3OHMB 2FH8A 4ACZB 5DELA 1YADA 1J0YA 3LI0A 2JGQA 1XP3A 1XLAA 3MV11 3AIEA 3LTYA 3SUUA 1EOKA 4XQ6A 1U33A 4WZHA 4AY8A 4IMAA 1G9HA 1PJ9A 2YDSA 3DGRA 3GY1A 3IJLA 3UPWA 1UD3A 2J27A 3H2FA 3AYVA 1J93A 5DEZA 3NPUA 3MMWA 4N02A 3N2MA 4DJDC 1K6AA 2Y62A 1KFKA 2DZSA 2QV5A 5BRPA 3G77A 4QJ3B 4QBXA 2XSAA 3L21A 3F4WA 4C6MA 1QHOA 3PS7A 5D09A 5F4XA 3LRMA 3A3XA 4DWSA 4L9YA 2OB3A 1IWPA 4YU1A 4RDWA 3C2VA 3IVUA 4I5RA 1BXNA 3ITLA 1S1RA 4IIGA 2WSPA 1KKOA 3CGTA 5DMYA 1CECA 3OEXA 2Z24A 2ZQ0A 2BY0A 3RDKA 2RJHA 3LPOA 2QDEA 3VFLA 1RLDA 4PMUA 3KOFA 2QJHA 2YCIX 4F0LA 4K1GA 1LWIA 1H1YA 4H19A 1D8CA 4MTVA 2OU4A 4UFJA 3WELA 3SFWA 6XIAA 4JN7A 1XXXA 4WD0A 3EWZA 3VI2A 2GFTA 2FTYA 5F1UA 4LT9A 4YNGA 4QFUA 4JNYA 5DY3A 2NW0A 1C93A 1RSCA 3WLIA 2DORA 3QLLA 4MJZA 1PCWA 3CUIA 1VCFA 1J96A 1E9LA 4MZ1A 4GUHA 1CB7B 2YZ5A 4UMBA 1LG2A 2PP0A 4PGLA 2CZDA 2VDGA 1NWSA 2OEMA 3BZJA 1XLEA 4HU3A 3BLPX 3IJQA 3R94A 2G96A 5I7GA 5F1VA 4XKMA 1XQKA 5HDRA 1E55A 1HXJA 1RAKA 4MUPA 3SQLA 1FH7A 1L2UA 2B7PA 1X39A 4F3HA 5I09A 2KAUC 4CQCA 4LYQA 3WBXA 2VKZG 1KLZA 2UY5A 3GW3A 1KRAC 5AYBA 1VEPA 2GVYA 2FGLA 3O0KA 2QCMA 1RCQA 1EEPA 4PMYA 2BVWA 4GVIA 4TU1A 3K5XA 2V3DA 4DZHA 1UKQA 2VQTA 3UXAA 2GQ9A 4MB1A 3MO4A 1H7RA 1NDZA 1R5YA 2YIHA 3GUGA 3DHFA 3BURA 3WLOA 3GAYA 2XFRA 3UW6A 2X1UA 1IZKA 4URIA 3WDRA 3FOKA 3EA1A 1C8XA 2EG8A 2P76A 2RGMA 1OGGA 3IAQA 3T55A 4ROPA 2WVVB 3ANVA 4S3JA 1UC4A 2HK1A 1Q2SA 3S1VA 4JYFA 1QI2A 1XBYA 1XLGA 3P7YA 3TYEA 2NWRA 4IG2B 3B8VA 1OT1A 3KM8A 3EOLA 3WK2A 5SWUA 2Y85A 2VZVA 4Y6GA 4G7EB 1L8NA 2E6FA 4EPBC 4FNUA 4JEQA 3WL1A 2P0IA 3ZM8A 1LBMA 2BGNE 3LU2A 3MCOA 2FVKA 1CXKA 1GNXA 2YW4A 3L0GA 4ZE5A 4O15A 1F3TA 3E2SA 2FH6A 1P4CA 3A23A 3KBVA 2VUYA 1ZZMA 3WX7A 1W9BM 5HPCA 3S0CA 1UZHA 2OLHA 3DUGA 1DP0A 1LM1A 2F9RA 4B4FA 4QXIA 4MIMA 3R10A 3GH5A 3K4AA 2WHLA 1XSJA 3ARPA 2ABAA 4MJMA 4HU8A 3OO2A 2GWNA 2O9RA 1F05A 1XF0A 3EYPA 3TC7A 5I03A 1I2PA 1DHKA 2FHFA 1EYEA 1W2PA 3DYPA 1UR1A 1S5MA 4EXBA 3GC4A 2Y88A 3CUGA 3PBWA 2E6AA 1NFPA 3B0YA 3THQA 4AZBA 1RA5A 3MBDA 4LC6A 4P2VA 3QZEA 3HM7A 5FF0A 3DG3A 3PK7A 4GBDA 2VEIA 4H41A 4R85A 1W8GA 3WJWA 3MUIA 4H8VA 3G3DA 1VGAA 1GYNA 4O10A 3CC1A 4M82A 1PSCA 2W61A 2REQB 3RXZA 1FHVA 4XVDA 5AFDA 2ZICA 2Y8KA 3CQIA 4UTTA 4WHBA 4Z0JA 4K37A 4GABA 1I1XA 3PFRA 2XZ9A 3TSMA 4L7ZA 2CZVA 3LHYA 3VUSA 3LSBA 1O5XA 3VE9A 4NRRA 1W3JA 2INFA 4P7RA 1AH3A 4IQDA 2NUXA 1DWHM 4FK9A 5H6HA 4DZAA 3A21A 4GJ1A 2VELA 3WQ4A 2UV8G 4CEXC 3DENA 3H23A 3G1SA 1GEQA 3Q67A 3R12A 4JNZA 4GX9A 1WP6A 2ALDA 1TPDA 1MRQA 4KGLA 3VNDA 1Q6DA 3W7NA 1XS2A 2DT2A 2OOFA 1WDPA 3BSGA 3GO2A 3LSCA 5A8QA 1U1HA 4W84A 3WH5A 1ZSXA 4O53A 3ES8A 1F7BA 4MKSA 5BMWA 4BQ5A 4REQB 4OU1A 2HS6A 2ZZ6A 6ALDA 3OZMA 3WO8A 4RLIA 2FVLA 4DO4A 4IHCA 1JUEA 4BF5A 1SW3A 4HHMA 3AS0A 3OTRA 1J0ZA 3CMJA 4MFDA 1FFQA 2PRLA 3AS1A 3VA8A 3OPSA 1V6UA 4CU8A 1TR1A 3VIHA 2FZNA 4XD5A 1JFXA 2PDXA 4IH3A 1V02E 1YNPA 3T0BA 4C1NA 2OZ3A 5A1AA 1L6YA 2WZMA 1LDCA 2YGYA 4IMGA 2BWGA 2PTXA 3V5FA 4P7OA 3TROA 4YYFA 4DUXA 4D72A 3DIPA 1WKFA 3ITCA 3PPFA 1E4NA 2YL6A 2XISA 3WIJA 3BUVA 5AC4A 1J6OA 1DTNA 4KWSA 1W56A 4ZQCA 1LL7A 3B0UX 2PZ0A 4QSFA 4MPQA 4YPJA 7CGTA 3SY1A 3QKZA 4JQ1A 4LB3A 3C2RA 1NDVA 2POZA 3N2TA 3OG2A 3PM6A 4UFMA 2ZA2A 5LNUA 2NT1A 1JDEA 2GJPA 5CBBA 3FYOA 5CC5A 4MDPA 4R5EA 4GH3A 1SSDA 3R2GA 4E2OA 2Z25A 1X96A 3UETA 1LCOA 5CG0A 1ONXA 4AWTA 3W73A 2VC9A 2J7CA 1T40A 2I5IA 1G4EA 3AIWA 3FW6A 2HNHA 4JAWA 1MQPA 1JAKA 3EB2A 5EFFA 3TUUA 1G94A 4AHOA 3EGJA 2GUBA 2PWUA 2OOGA 1TR9A 3QY8A 5BRQA 3ZZ1A 3O0FA 1LYXA 4KS0A 4BHYA 1EIBA 2QIIA 3V4BA 1MYRA 4NZJA 3TC6A 4JFVA 2OQHA 5F2LA 5TIMA 4B90A 4KBXA 3VD7A 1LL4A 2PDYA 3M0KA 1JPIA 1FQ0A 2GGJA 2PTZA 5DX7A 2XDFA 3NPXA 4OVXA 4PUEA 1G69A 4LUJA 4W86A 1SO5A 3B9DA 4WDTA 3N3TA 1MVYA 3WH6A 4XAZA 1E5JA 4XUYA 5I3DA 4EXAA 1TREA 1TPH1 4LBRA 3LQLA 4FLQA 2B0MA 2WAGA 4IX2A 2FFCA 3CXOA 2QGHA 3VKAA 2Y7GA 3QH2A 3GNXA 1KTBA 4C7GA 1TWZA 2WHMA 3PY2A 1EX1A 2GLKA 2GVJA 2JEQA 3UJSA 3TONA 5DLCA 4MWAE 5B80A 2O9TA 4LYRA 5A8PA 1SZGA 1EA9C 3O7UA 3OGVA 1KFBA 4JZ5A 4TOQA 3LM7A 3I6RA 3N25A 3CZJA 5LIYX 3W84A 4HU4A 4Q7BA 2BHYA 3JVAA 3UZXA 3DGBA 2FGZA 4HIBA 1IIHA 1TTPA 4JTTA 1ZQ5A 3KTCA 4UTWA 5JMUA 4YIWA 3HJZA 1X38A 2PB1A 4NL1A 2P1FA 2JIWA 3GXTA 3UVAA 1C7SA 3CWHA 1UA3A 1BWVA 1A49A 5EGRA 3SCNA 3MO7A 3EA3A 4DLMA 2Z1BA 3T9PA 2V38A 3S2LA 4U28A 1LUCA 3H4WA 1AK5A 1BGGA 5BOFA 1GONA 2C7FA 1ML1A 2CLMA 1QASA 3OODA 3CQ0A 3TYDA 2V68A 2V67A 1H7WA 4CQDA 5LKYA 1E3XA 2HQAA 1VYSX 5PTDA 3W1PA 2C3ZA 4DF0A 3IUIA 4UFLA 2ZA3A 2ADAA 3W02A 1BYDA 2VX4A 3CUFA 1DL3A 4IPIA 1V7AA 3P80A 4ZCWA 5HR7A 1WKYA 5DMLA 2ZX7A 4BQ2A 3IK4A 2HVNA 1ZCCA 3HURA 3STEA 2WNWA 1B30A 3AZTA 5JH2A 2ZX8A 1NY1A 4HU0A 1VP5A 5I02A 1ZFJA 4XBKA 1DIKA 3GM8A 3S1UA 1WZKA 3I65A 5HNRA 2V63A 1W17A 1AW5A 1V93A 1O5RA 1D8WA 3TU9A 1SFTA 1JZ8A 2CBUA 4J2PA 1V6XA 2RGLA 3O8AA 3TAOA 2PRMA 1F74A 3GNOA 4IIEA 3AROA 4UTFA 3ZJKA 3QV8A 1E1FA 1OIFA 4PODA 1H1NA 1I0BA 4G5DA 1NDYA 4M6UA 7REQA 2HISA 2JQXA 3RJYA 3SCQA 3ANYA 3E12A 3LXBA 2XN1A 3XINA 5A69A 3K46A 2V5DA 5BWFA 2J25A 3LXAA 5D02A 5JVLA 2WWDA 4XSLA 3KLLA 3V1PA 2PCQA 2NX1A 4CU7A 3USZA 3PTMA 4AZ5A 4KCVA 2HWGA 6REQA 3IS4A 1TV8A 2ABBA 5CGMA 4YS1A 2B81A 2QQ6A 3KL0A 4RX0A 2ZRYA 4TVDA 4OGZA 3LX9A 8RUCA 2OWCA 3VO0A 1GCYA 2YJQA 1GG0A 1DJZA 5LYRA 4LCQA 3UWQA 1NFGA 4E2DA 1DIEA 3G1HA 1TJPA 5D2XA 4CD7A 3DEQA 1NDWA 1CLKA 3Q2DA 1PO9A 1E6QM 1MWOA 1KV8A 4J9JA 2RHGA 3C8NA 1XKJA 1TTIA 3PBVA 5CCZA 3PG9A 2AL2A 4QS5A 1XYLA 2NZLA 4QCFA 2OWXA 1A5OC 4JKLA 1UJQA 3ITXA 3V36A 8A3HA 3M46A 5H8UA 3IJ9A 1VFLA 7XIMA 4C6JA 3I3EA 3C0QA 2OSWA 1VPYA 1BEUA 3FHQA 1VJIA 1SZEA 4XO6A 3KBSA 2YFOA 4GYKA 2XJ7A 3DC0A 1RPXA 4QQUA 3UWZA 4QROA 1SJAA 4DRSA 1ZJIA 2QHAA 2XYLA 2X0YA 2EBNA 4J2MA 3AXHA 3VOJA 4LALA 1J5TA 1F6PA 4ICNA 5I3JA 2NX9A 2E5BA 6TAAA 5M2FX 4KEZA 3BTNA 1NWUA 1G6CA 3PZIA 3BL3A 3H6OA 3NDOA 1EWEA 4PMRA 3URBA 1H41A 3ZJ7A 3GTHA 4JTIA 3OLDA 1F6KA 3THCA 3GDRA 3W7KA 4Q7IA 1JL8A 3NQ2A 3NO5A 2IXVA 1O68A 4O11A 3QQ0A 4CVWA 2FJUB 3E6EA 4H6EA 3S3GA 4NRSA 3RPMA 2WV8A 3FV9A 2CU0A 3TXZA 2R1PA 1GG1A 2PPGA 2FZMA 1HNYA 3C3UA 3AJXA 1S2AA 1JZ2A 1W1TA 1U30A 5FD0A 2PFHA 3TJXA 1UH3A 4M7SA 4WIWA 3G1FA 2V0TA 1N8FA 3H53A 2QCEA 3EDDA 1XR2A 2WNQA 2ISFA 1BRLA 4PRRA 3AJ7A 2AQWA 3TZFA 3F5KA 4HPXA 1F2JA 1G5AA 2J7FA 3GK0A 1UUQA 1QW7A 4AC1X 3VIOA 3KRSA 3W75A 1ADDA 1S2VA 3VUPA 1J01A 2AMGA 4B4HA 2OPJA 4H7CA 4MLJA 2A1YA 4BR1A 5M5DA 4ZL1A 3A64A 2D22A 1HG3A 3OVPA 4JHZA 3W2UA 5XIAA 5I23A 4ZVJA 1GEHA 2FJKA 1MW2A 4RE2A 1WDWA 2C0HA 3WQPA 3SCRA 4NJGA 4O8RA 4NUWA 5GJPA 2P50A 3A4WA 1I9CB 1TE6A 5B7ZA 2C79A 1VEOA 5DXXA 4C7FA 3MCMA 1OGBA 4H6QA 3TKFA 5TBOA 4IWWA 1OYAA 4RKAA 4Q8TA 4FR6A 3HA1A 2A3BA 4AMCA 2TMDA 2ZWYA 4QJ5B 1W1PA 2DZAA 4R3UA 4AIUA 4Z2HA 4ADUA 3BO9A 4EAYA 4LVGA 4HK7A 1EP1A 4B3LA 4GRSA 3W23A 3VNKA 1Q8JA 3RAOA 4DO6A 1BWLA 1O95A 3RJXA 4AWUA 1WZMA 1SSGA 4GKTA 1B2YA 5AVNA 1QPKA 4NJKA 3C2FA 3TXVA 1FWFC 5HJYA 4GQGA 1JZ4A 2H6RA 3VKBA 3NCOA 4WY0A 4NNCA 3W7RA 4LBSA 5H1WA 2XGZA 4ZBCA 3U48A 1FHLA 4FF7A 4UTJA 3NVDA 2B7OA 2R8WA 1HGWA 2HPMA 2DQXA 2AL1A 3DC8A 4LYKA 1EJUC 1YEYA 4RNFA 1H4PA 3A47A 1NELA 3ZVHB 3JUGA 1UP3A 5JQ9A 5CZ0A 1KFEA 3UG8A 4L4MA 5C6MA 3LCLA 1VBJA 4LCRA 3T4WA 3NNTA 3P5YA 4JHOA 3VK5A 3WLLA 4OWGA 1P1XA 3MP5A 4DJFD 1E6ZA 4J3XA 3S5SA 1UWUA 2X1RA 2JE8A 1G4PA 3K4DA 4QLKA 2OQLA 4WQ6A 4BQ3A 1EQCA 4ZB0A 2XVKA 5REQB 1VBHA 4GYPA 2C15A 1A3WA 2HVOA 3GH7A 5BXSA 2QS8A 2FZ9A 1TVLA 1NIUA 1J0KA 2WK2A 1EP3A 4QNWA 5EKYA 1OBAA 5HQEA 4U31A 2VD8A 1A5NC 1EX5A 4PN2A 3N9KA 1F8MA 4AC7C 3UG3A 1BSLA 5XIMA 3E5PA 3H2EA 2PDWA 3KTXA 2BVYA 1ZCOA 1O60A 4PEEA 4K8GA 1QCWA 4P7NA 2QUMA 4C6NA 3QV7A 3O3RA 3VNZA 2VO5A 1K8CA 1GJPA 4ERAA 3NQ6A 4H1ZA 4HPNA 2MANA 3F4CA 1T96A 2JF7A 4J3SA 3WBWA 3MI2A 4RV3A 1JGIA 3QKEA 1FUYA 5KINA 2A85A 2BODX 2D2JA 4GE8A 4IMEA 3OVRA 3BG3A 1OFQA 5A6SA 4K39A 1KRBC 3L4YA 3NOEA 3RO8A 1JCLA 3VTRA 1PBGA 1NQKA 4X2RA 3EB3A 3HMJG 3B0XA 3RLVA 4OIFA 4C6DA 1K8ZA 4NJJA 4RL3A 4HA4A 4DJFC 1WA3A 2HTMA 3AYRA 4OKDA 1PKLA 1EJSC 1JGMA 5DT5A 3OGSA 4MKNA 4UCFA 1KRMA 2PU1A 5AY7A 1DQUA 1W3NA 3MZNA 3W7GA 4EANA 5HANA 2NXHA 1M65A 3EOSA 2ZE0A 1KWGA 4YWIA 1KBIA 4PB3A 2A0NA 1KKRA 3M5XA 3AUJA 3ARYA 4GI9A 1NWRA 4KERA 3S47A 1V6TA 2VZOA 2XIMA 3FNDA 4Q22A 4IPNB 3UY7A 5FEPA 1S1PA 3MP3A 1TX0A 5E93A 1XINA 3PSVA 4JQ3A 2O4MA 3W72A 1U2YA 3ZT7A 2CFFA 4U3AA 4IMDA 4UOJA 1W6TA 3L9CA 1CT5A 4D8LA 3GC2A 1UD8A 2X0SA 2YCJA 3RCYA 3V0TA 4A22A 3GVRA 1FX6A 2H90A 4HPJA 5CPTA 3UNTA 4UFIA 2VQUA 3VNLA 4PYSA 3MBFA 3MMTA 4LAMA 1QWKA 4FF5A 3LCFA 6A3HA 3YPIA 2P88A 1KM0A 2YL5A 4IFOA 1PZ2A 1JPDX 2VX7A 5TF0A 4DBWA 3KCOA 1XG3A 3TZNA 2E9LA 4WX2A 5FF4A 2VFEA 1IIGA 3W1AA 1YBQA 2Z00A 1VKFA 2B7NA 2CEQA 3SCVA 3D3AA 5HXMA 3W7JA 1WBHA 4JL2A 2OZ8A 1TQXA 3CZKA 2G37A 1BKHA 2JKPA 4IGHA 1SYTA 1FCBA 3UF9A 4Y2WA 4YVPA 3ZSTA 4XSMA 4UTHA 1K77A 3IWPA 4HN8A 1F3WA 1ZHAA 1O5KA 2WSRA 3UJ2A 2GJLA 1V8EA 5LGZA 5CLWA 3NZQA 2ACRA 1J2BA 2FZBA 3WUEA 1KGXA 5I00A 2AAAA 1DBTA 3MMUA 1BXBA 4G2DA 1PX8A 4C6IA 2B31A 1TE1A 1QOPA 1H1ZA 3UBPC 4GCXA 5CLTA 3TJ4A 1L9WA 4IGSA 3WF3A 3ZSSA 1R3QA 3OGRA 5HQMA 3XISA 3VU2A 3TTQA 2QAPA 1JCYA 2CHNA 2DW6A 3ZWTA 1TX2A 2X16A 4TXEA 3GHSA 3K13A 2W0UA 3S5OA 1I60A 3PUDA 3WQ6A 2WOQA 3VM7A 3CZLA 3OZPA 3C61A 3OW1A 2W27A 1D3GA 3TWAA 3WNKA 4DWSD 2V30A 1QBBA 4M19A 4UFHA 4A29A 4HPGA 1OX4A 1VHNA 1JCMP 1XL9A 3O6DA 1FY6A 2VGGA 1JYVA 3GXPA 4JTEA 5CPMA 4XIAA 4WF7A 1WV2A 2CW6A 3KS6A 4M29A 3U3HA 3MJYA 4KESA 3QMTA 3CWOX 3UESA 3CL6A 1IXQA 1JDCA 4ZFCA 1P43A 4UQDA 2H9AA 4D6JA 4EPEC 4IICA 4V1YA 2TYSA 3QHOA 1CI1A 4K36A 1AW1A 4CCEA 2ZZ5A 3F7JA 3VKJA 1OVDA 1FWCC 3KEHA 3F4NA 3UZYA 5HA7A 3U4FA 3C2EA 1NP2A 3DG6A 4ATLA 5G1TA 3AFBA 3LQGA 2UWFA 4E4FA 3V0SA 4FI4A 4GIRA 1GOQA 5CSRA 2D2HA 2CBIA 3WNPA 5DCEA 3DERA 2V2HA 2XN0A 1M9HA 3L12A 3OBAA 3C0SA 1AD1A 1QW9A 4FNTA 4AAJA 1P0EA 2ZIDA 3I3DA 1FP9A 1LT7A 1E4LA 2FLIA 2DZPA 4GVGA 3WLMA 2IXUA 4RE4A 2FGBA 1UR0A 1IHIA 3IIXA 4WDUA 1QNQA 4GZEA 4MJ2A 1BAGA 3O05A 4I6VA 3S2CA 2QR6A 3WF0A 1V02A 7TIMA 1RVGA 4DWSC 5A2CA 1VF8A 3W7MA 2CLLA 2PI6A 1HJQA 1UQYA 2DSUA 1XCXA 4IXHA 3NQMA 2EF9A 3BMVA 2WVSA 3CPGA 1RBAA 3M07A 2G50A 2WVTA 3G1RA 2V2DA 5DT7A 3MUZ1 5BXPA 1ZY9A 4UQEA 1S2UA 3PZGA 3AWOA 4X0VA 4UNLA 5DY2A 2NVCA 4OOZA 1EGZA 3AALA 4AD5A 3A5FA 2XUCA 5DBUA 3F2CA 3ELFA 3UD6A 4H2CA 3PZ9A 1G67A 3NVTA 1XCFA 4YWSA 3RRAA 1B4KA 2ATSA 3W29A 4U2YA 1XLBA 5GNXA 1Y5XA 3ICJA 1QT1A 1BVWA 3CT2A 3VD9A 4I7UA 3KVKA 3MC5A 2V5LA 3N6HA 3TP4A 1E51A 3EMQA 4QGCA 3POHA 2EQDA 3PTQA 1IT7A 1R47A 1YTDA 1QPRA 1RCOB 2BBFA 3AMKA 3EPMA 4E3TA 1V3KA 2ISDA 5E9AA 4QG8A 3W1QA 3H2CA 1EC8A 3FHAA 3CAKA 4ORMA 5M3WA 3QSTA 4GGBA 1RA0A 3PTDA 1RVKA 3AI0A 1WDSA 2YR1A 3OQEA 2ZUVA 5D8WA 2VYOA 2Z7GA 4PCNA 3FFSA 4PUNA 5TNVA 2B4GA 3E2VA 1I0DA 3BGGA 2QUNA 4PTVA 3MDWA 2ZXQA 1GZGA 4HSOA 2NQHA 4NX0A 4K8HA 3RNDA 5C55A 1UR8A 4W85A 4AZ7A 1KWKA 1SO6A 3ZR4A 2RDTA 1R3WA 4FPSA 1XYBA 1EC9A 1KB3A 3LTPA 2PGRA 3DBNA 3HQOA 3H2NA 1U5HA 3C3NA 3WMLA 4HYRA 2WSYA 4RDYA 3DFPA 4JFUA 4WRHA 2R9RA 3UXLA 3WJXA 1Q7QA 4H3DA 1Q63A 5JIPA 3CYJA 4MWAA 1MNZA 4NZ3A 2YA2A 2D0GA 1QNSA 3P74A 3FJLA 2QVHA 3QPEA 4HZMA 1VPXA 1HO4A 4RE0A 3UA4A 4PULA 1J9YA 2G5WA 4ALDA 3L4UA 4J27A 1X8CA 3R58A 4M81A 3NZ1A 4GC3A 1E6PA 2VUNA 1R87A 5JIWA 3GFYA 1LOQA 1W5NA 3UFYA 3HGJA 4Z1CA 2A3HA 2OSYA 1KO0A 3GUWA 1FWEC 4PTDA 4JQ4A 3M0JA 1GVIA 3RLHA 4XZLX 3NAVA 1M1BA 4JDYA 2WC4A 1HL2A 1TPC1 4YLWA 2C13A 2XH4A 3N13A 2YL8A 3CS2A 3GDMA 3MW7A 2J62A 4PTXA 1LOSA 5CC7A 3GHTA 2FB2A 3MHGA 3SUWA 1UHVA 3MKVA 1RR2A