5CGQA

Crystal structure of tryptophan synthase from salmonella typhimurium in complex with f9 ligand in the alpha-site and the product l-tryptophan in the beta-site.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
268
structure length
268
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Crystal structure of Tryptophan Synthase from Salmonella typhimurium in complex with F9 ligand and the product L-Tryptophan in the beta-site.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
total genus 101
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cgqA00
3M44A 2RDWA 3NPUA 2Q3OA 1T8XA 4LRTA 1SPQA 4O14A 1NVMA 5E1QA 2EKCA 3VKJA 4CCEA 3JS3A 2OJPA 2V9DA 3HPXA 3G3MA 4I7VA 4ONVA 5CZ0A 3G18A 1ME8A 3UWVA 3SW6A 2QCHA 1A5BA 5CG7A 4IJBA 4FIRA 4HHPA 2WQPA 3UD6A 4BI6A 4GE8A 2Y63A 1TCDA 3MHUA 5K4ZA 2NV1A 3LRLA 5HWNA 3R13A 1S5TA 4O0KA 4AH7A 2GVLA 3PB2A 3C2RA 4PCFA 3NDOA 1G6CA 2RH9A 3F4NA 1GYNA 3QYQA 4OT7A 5F2MA 3W76A 3W7EA 3UQNA 3DGRA 4JY9A 1XCFA 4PL1A 2JBMA 2CLOA 2VEIA 3W7HA 5D09A 3NPXA 4UTLA 3HMJG 1K7EA 1IF2A 4O1DA 5K9DA 3Q58A 2EF9A 4WXYA 4O15A 5HJLA 4LVAA 3LRKA 4ZQNA 1PVNA 1B9BA 3GDTA 2ZZ2A 1P5BA 3ANYA 1YLVA 2Q3RA 3HGSA 2YXGA 1EUAA 1GYLA 3PBVA 4XBSA 1O4UA 4I9AA 3DFNA 1ICQA 5IBXA 1JCYA 3BGGA 4M7TA 2LLEA 3C52A 2ATSA 3GXTA 4UTWC 3NL6A 3W2LA 2FFCA 1KLZA 3W7RA 4HNTA 3WJXA 4RKAA 1VLWA 3MI3A 3F4WA 5EMUA 3WFAA 1XXXA 1ME7A 3NZRA 1ALDA 4AVFA 5LNVA 1KM6A 2CLHA 3S8HA 1KFKA 3T44A 1TQXA 3DXIA 4UNKA 5FEPA 1VHNA 2V2DA 3W83A 5U4NA 2QKFA 3W7LA 4IMDA 3W1QA 1GOXA 2QUUA 3GR7A 4R33A 2FB2A 4UFJA 4AF0A 5LNUA 3CTLA 1MEWA 3QW4B 1H7PA 1KFEA 1DQWA 1OFRA 1QPNA 5F4XA 2FPTA 2Q8ZA 4BK9A 4JTIA 1H1YA 1SFJA 4HSOA 3B8DA 2HSAA 3M6YA 4RJEA 4BWLC 2ZZ4A 5AHNA 5CKSA 2ZQ0A 1EB3A 4LS1A 3G0SA 5BRBA 3OBKA 1HL2A 4N9BA 1SW3A 1DVJA 1LOLA 3W23A 3G1VA 1JCXA 2CFFA 2E5CA 4PODA 3M1ZA 4TIMA 1UUMA 2E6DA 1RQBA 2AGKA 4DBDA 1JRCA 1EWDA 5FF2A 2Y62A 1F76A 5G2WA 2XN1A 2WNNA 2CZEA 5DY3A 3G1HA 5FF3A 4N4QA 3DHDA 3M41A 2B4GA 4LOCA 1JUBA 2AQWA 3LXAA 3CWOX 2GJLA 1A50A 2QR6A 4JTUA 1H50A 1BKSA 3AJXA 3SECA 3FYOA 4LVBA 1MO0A 3WJWA 3QMRA 4ML9A 2RFGA 5K3VA 4ZQMA 1H7WA 3GX9A 5FF0A 5DY2A 3LHWA 3UYCA 1GZGA 4Z08A 4LVFA 3GNNA 1KM5A 5TBOA 4UMAA 4C1LA 3WK0A 2FDSA 2ZDRA 1L9WA 1BEUA 2DZTA 2D73A 3GYEA 1IXOA 3M5VA 1TPB1 2A7NA 3EWYA 2YYTA 3NGJA 5H91A 3MP3A 1GEQA 2ZA1A 1LDCA 3TV8A 1Z48A 1FX6A 4MUZA 1MZHA 3C4UA 4O52A 4UIOA 4PA8A 4DF1A 3GVGA 1F6KA 1SZEA 4JXCA 3N19B 1K03A 4XWUA 4JTFA 3C3NA 5CPNA 2ZRXA 3FJ6A 3GR8A 4MY8A 3ZWTA 1C9DA 2FLIA 3TSMA 4X22A 2NXIA 1OX4B 2YFOA 3W7CA 3U2OA 2TYSA 3VE9A 4I7UA 1T0OA 4JTTA 1XUZA 1DKWA 1VRDA 4GFSA 3LHVA 4AWTA 3LHTA 3IVUA 3WJYA 1RPXA 4ADUA 1ZFJA 3G1DA 4RX0A 1OX6A 1JCJA 3VCRA 4IXXA 4UTUA 3UXAA 1SZNA 5E0KA 2GVJA 3GDMA 1KBIA 4IX0A 1M7PA 2R8WA 4AMAA 3M9YA 2OCZA 4ZVJA 4JS3A 1C29A 2JKPA 4WZHA 2EGZA 3BW2A 1TREA 1J2WA 1RR2A 2ALDA 5L6UA 3MW7A 4AWUA 1QCWA 5LZLA 3UZJA 5AHIA 3RU6A 3TMLA 8TIMA 3LI0A 3TSDA 3FJLA 4A2RA 3MHFA 1AMKA 3TX9A 1VCVA 4WY0A 4BI7A 3W70A 1WOBA 3QF0A 1YYAA 4WJEA 3BO9A 3CIXA 2JKEA 1QMLA 4DXVA 4OU1A 1XI3A 1H7XA 3P7YA 3TMQA 4NVTA 1ZAHA 1Q6LA 2UV8G 2WSRA 3TFXA 4MOZA 1X1ZA 1V7YA 3BVJA 3NQCA 1TO3A 1FCQA 4OBTA 3LCXA 3DI0A 1KFBA 5DXYA 2HTMA 3NL2A 5AYZA 3LTPA 3INPA 1HO4A 1FWTA 3O6YX 3DENA 4I7WA 4NJJA 3NA8A 3U6WA 1P4CA 1MEIA 2J88A 2QEZA 1VYPX 2V5BA 1KM0A 2VELA 3DHFA 3BLEA 1G69A 4MFEA 3ATZA 5AHLA 2GOUA 3NG3A 4RCXA 3OIXA 4UTMA 4DO4A 1KFLA 2OX1A 4Y9AA 3MO7A 4DF2A 1H61A 4NU7A 4M19A 3A5VA 1DHPA 3PUDA 2QCEA 2VEMA 5G4WA 1DJQA 4LUIA 3L0KA 5G1TA 3L5AA 5FF7A 3UWUA 2DP3A 3E9AA 3HQ1A 4S1FA 4MJZA 2J9ZA 3TXZA 4QSHA 2H3DA 2R94A 3NPWA 4EIVA 1DORA 3LCIA 4LC8A 4UTKA 3KRSA 2H8XA 1WQ5A 2WO5A 3LB0A 1YPFA 1K8XA 4LY8A 4QNEA 2A6LA 3PC0A 2V8ZA 3WK3A 2P1FA 3FIGA 5T26A 3S42A 4GUFA 4FF7A 3GNDA 3L0NA 2CZDA 2YSWA 1KM1A 1I2PA 2FB3A 3QEZA 3VNDA 4WUIA 5ABTA 4TX9A 3ZFHA 2A7PA 4FXRA 5FEWA 1YADA 5LNSA 1YXYA 3UY8A 2RDUA 1WBHA 3IGXA 5I3IA 3BLIA 3NQ8A 1S3HA 1Q3NA 5HNRA 3KRZA 2F84A 3LHYA 2I14A 1FCBA 4LU0A 1KTCA 1I8JA 4X3ZA 3CU2A 2A1YA 4ZQRA 1OFOA 4GRSA 3RLUA 1F7BA 1I2OA 4GUHA 2RDTA 2I1OA 3B05A 2ZA2A 4ALDA 1T96A 4N6FA 1AL8A 1BWKA 1SUXA 3DFTA 3KRUA 5F4WA 3TQ0A 1RV8A 3DKJA 1PHWA 1IXQA 5K9CA 2TPSA 3GXPA 3L2IA 1LBFA 3BV4A 2A5HA 5EA9A 4Z0SA 2O7SA 3TUUA 4ZQPA 5HWJA 5EY5A 2C16A 3TK7A 1G7UA 1U83A 4FX8A 3STFA 4N9CA 1ZENA 3QZEA 4QIUA 1FCUA 4DPPA 1H1ZA 4O28A 3Q2DA 3MBFA 2QCGA 4M6VA 2QCCA 3MBDA 1PIIA 1EPXA 1GJPA 1R47A 1TQJA 2B0MA 3G0XA 5LNWA 1XM3A 4Y8FA 2NX3A 3W7QA 4QITA 4JTGA 3W86A 3P8IA 4IMFA 2V30A 1VYSX 4HN4A 3TA6A 2BWGA 3P5ZA 4JIQA 3EWZA 1RQEA 3O07A 3W1RA 4MVAA 1OFDA 2JK2A 1W5PA 3TE9A 1FCVA 4UMCA 5EL1A 3W88A 1KLYA 1SSDA 3UXDA 2X2GA 4PH6A 2Y70A 2JGQA 3R2GA 3ZS4A 1W0MA 4MIMA 3TFCA 3GAKA 3OHIA 3LBCA 2JGYA 2DZPA 1GVQA 4FNPA 1SFLA 1KTBA 1PHQA 3QMSA 3OEXA 5HQEA 2CLKA 2TMDA 4E2BA 3TW6A 3SFKA 4YL2A 1XC4A 2E09A 4WX2A 2X1RA 3W1NA 4NX5A 2YPIA 2PC4A 4NJGA 3QJAA 3NPVA 5C54A 4O0ZA 1TRIA 5BMWA 1FDJA 4RV8A 4MJMA 3G8EA 3VFLA 4GUIA 4AHOA 2E68A 3P5YA 4N2YA 1ZNNA 3BPWA 3C2FA 3B0VC 3LGEA 1I45A 1LRQA 4JYFA 4QAIA 4TMCA 4JTLA 5DCEA 1WDWA 3ABRA 5A8GA 2EAWA 1TPDA 3NZ1A 5CZJA 2YDAA 3PM6A 5AC7A 1GTEA 1YTEA 4O13A 4YXGA 2NXHA 2E5DA 1FDZA 1LBMA 3OVRA 3P84A 2W79A 1XKYA 1O95A 4ADSA 4KKXA 2BSLA 1G4PA 3I65A 3BW4A 1VGAA 3W7NA 1PL9A 1TV7A 3IRDA 6ALDA 3N73A 4A3UA 2F7FA 4RXGA 1KFJA 3KFTA 1KM2A 3EKZA 3QPZA 3W1MA 2ISSA 3E0IA 3NQFA 4BI5A 2H3BA 3KX6A 3R89A 4NNAA 4DBEA 5F4SA 3O8AA 4K6AA 4LWWA 3QFEA 4UFLA 4UTIA 2QCMA 4A21A 2VFHA 4ZQOA 2ZBTA 2Q8LA 1NF0A 3LLDA 3DFPA 3FYPA 1BTMA 3DFQA 3S1VA 4M6QA 3PF3A 5DN1A 3P74A 3E96A 1WA3A 4EWND 1WAUA 4H3DA 1H60A 4FX7A 4CNPA 1TTQA 4LUJA 4N9EA 5L9FA 1OX5A 1UB3A 3W72A 4LVDA 2XFWA 4NZFA 2DZVA 3TNOA 1SZFA 1B4KA 1NSJA 4WY0F 1KM4A 3A21A 1TPFA 2YYUA 4XZ9A 3N3MA 3HG3A 3TCEA 2E6AA 1K02A 4CQ9A 5K2ZA 2V0TA 2IQTA 1R2TA 2A21A 3HG2A 3O16A 1QNVA 5IM51 3HB9A 1NEYA 2ATMA 1QO2A 2WPBA 5AN7A 3BG5A 4MLRA 2DORA 2B7QA 5G2IA 1EX5A 3TAKA 1QAPA 5AYYA 1KFCA 3SGUA 3LBMA 3LXBA 1OFAA 1W37A 3OA3A 1OX4A 3H55A 4DELA 3W2NA 3T55A 2YGYA 7TIMA 1ZAJA 3PWAA 4NT0A 1WOAA 1KV8A 3M5YA 3LTYA 3IIPA 3LCWA 4RZ4A 4CNOA 2C13A 1LTDA 4O12A 2ISVA 2Y89A 4O4WA 1EWEA 1QFEA 3ATYA 4ICNA 2BZNA 4TMBA 3I68A 2QCNA 3LDVA 4CCCA 3KHJA 2X30A 4M7SA 3STGA 1G4EA 2O7QA 4XUGA 3TC6A 1GVRA 3L9CA 4LS0A 2ABAA 2BXVA 4O1AA 2V2HA 1R46A 2G97A 3GLCA 3SY5A 1I4NA 3RNDA 1MEHA 3HGJA 5LKYA 3HG4A 1AL7A 1N8FA 3KOFA 2Y85A 3W1UA 2CZFA 1QDSA 3WJZA 3HPSA 2WJZA 5DELA 2V82A 4O50A 3W1AA 4JICA 1YTKA 3H54A 2FPYA 4ADTA 3PUOA 4POCA 1EIXA 3N9RA 3GXNA 3W3OA 4LV9A 3W7KA 5DLCA 2ZZ6A 2A4AA 2VKZG 1B57A 3QC3A 4G1KA 1LORA 2NLIA 5C55A 2Z0IA 3W84A 2A2IA 1OG0A 1UUOA 1WX0A 1OJXA 1W3NA 2P10A 4JX4A 5D2XA 3O05A 4FIQA 3PUEA 1X1OA 5K7JA 3W6YA 2ZFAA 1F6PA 3HJZA 3NO5A 3S6DA 4KWVA 2ZRYA 2V2CA 4PC8A 3QPYA 4JGDA 5HINA 4Y96A 1IIGA 4ORMA 1A53A 3M0ZA 1Z41A 3NQMA 2H8ZA 2QAFA 4RXFA 3A22A 1K8ZA 1FXPA 2E6FA 4UTTA 1JCNA 3MHGA 4QQ3A 4WXZA 2OZ0A 1XBXA 2C0AA 5I3GA 4GUJA 1OYAA 4FNQA 2V81A 4UNLA 1HTIA 1X7FA 3DFSA 5K4XA 5LGZA 1JVNA 3PG9A 4R7JA 1SW7A 3W7GA 2NWSA 5CZTA 5LSMA 2DZSA 4S2CA 3USBA 1UASA 4AF0B 4P2VA 2J9YA 3IVTA 4L4MA 4IXHA 3P81A 5IBXC 4LTSA 5G4EA 3W74A 2E1DA 5U7SA 1TPEA 2B7OA 2Z2UA 1ONRA 3A9IA 3PBUA 2HS6A 3P60A 3P67A 1G67A 3MYPA 2ZRUA 3EXSA 3UWYA 1OK6A 4BFAA 3KVJA 3IVSA 5DBTA 3W1LA 1GWJA 4PEKA 3G3DA 3NNTA 3MI2A 4HT3A 5CSRA 4JEQA 4XQ6A 4FNRA 4YCOA 3M16A 4JN6A 3PBYA 4YMZA 4K36A 5HUPA 3GDRA 2BLEA 4B5NA 4K8EA 2R14A 2Y7FA 3C0JA 3PG8A 3FFSA 1VHCA 2Y7DA 3A23A 4NUWA 1B3OA 3RF9A 1LLWA 1O94A 2XN2A 1NF7A 1WBJA 1ZJIA 4PTNA 3P82A 2DZWA 2YW3A 2A7RA 1GVFA 1QOQA 3G1FA 3NM3A 1W31A 5D02A 1W1ZA 5E93A 5FF4A 3N2MA 3EWUA 3S1XA 3W2UA 4OWGA 3F03K 3IEBA 2TRSA 4M5PA 2Y88A 3IIOA 2VEKA 1JR1A 4YCPA 3ELFA 4PFMA 3C61A 3R5EA 1QOPA 3NQEA 3MP5A 5BMXA 5G1YA 5J5RA 1FQ0A 4XTDA 5AHFA 4O17A 1XDMA 4IPJA 3Q94A 5D05A 1CW2A 3NAVA 1XL9A 4FHAA 5KZDA 3FOKA 1MXSA 3GB6A 1W56A 3ABOA 1QPOA 1VYRA 3CB8A 3W2MA 4NZJA 3S1WA 5HULA 3S5ZA 2PE4A 4CLMA 3EWXA 3CPRA 3W07A 1A5AA 3CC1A 3Q37A 3BG9A 3TC7A 3GAYA 5I3FA 3P61A 3LCLA 2VFIA 2EPHA 3PULA 3S5NA 2ISWA 4DF0A 5HMSA 2QF7A 4LW7A 1VPXA 2DU2A 2CZ5A 3HBLA 1PV8A 3W71A 3CEPA 3PR2A 3PSWA 4X2RA 4MKNA 1OF8A 1SU5A 1AG1O 2DJXA 4YLWA 4UMBA 3W75A 3HGOA 2WKJA 3W7JA 4JX6A 4XKYB 4E0CA 3S1UA 1D9EA 1LOQA 3UNDA 4O53A 4HKPA 2GPTA 3SGZA 4BF9A 1EA0A 1EUNA 4NX0A 5G2HA 3THQA 2BX7A 4H4IA 4RK8A 4LS2A 1H51A 1SW0A 3QQ0A 2NUXA 3KVKA 1R2SA 5HR6A 3TROA 2C18A 3DFOA 3HO8A 2KZHA 4AHQA 1HG3A 1OVDA 2X1UA 2QDHA 4JYDA 1YTDA 3MYOA 1D3GA 4UXDA 2CU0A 1GT8A 1Z42A 3L68A 5AB3A 3E12A 1FWNA 3QW3A 4OGZA 4O19A 4IMCA 1TPH1 3W2KA 3W1PA 4WY0B 1GTHA 2VFEA 3B0PA 3NVTA 3NQVA 2EHHA 3GZ3A 5FEZA 1SZGA 5I3HA 2ZYFA 1DJNA 3M43A 3TXVA 3SIZA 1TJPA 3GKAA 3CQ0A 4IMGA 1W3IA 5SWUA 4GUGA 2ZRVA 1LYXA 2GQ8A 2NX9A 2PRMA 1IXPA 2C19A 2NWRA 1VH7A 2GUUA 4Q33A 3HIJA 3HOJA 3S5YA 1HFBA 1OFPA 2WOQA 4HNNA 1F74A 1M6JA 3UPWA 1W5QA 2JKAA 4AEOA 4K7VA 4RZ5A 4U4MA 4Q4KA 3MP4A 4JX5A 3G1SA 3DZ1A 2J24A 2VXNA 1L6SA 1YXDA 3F1QA 4GJ1A 4UTWA 2CLEA 3MWAA 1W54A 3N14A 4N02A 1Z44A 1W5OA 4MZYA 3CEUA 3W7PA 1JUEA 3LOTA 2P0OA 2WSQA 4UFIA 3UWZA 3G22A 1EP1A 1A5SA 5TIMA 2QJHA 2QCFA 3TJLA 5EPDA 3EX3A 1YXCA 2RKXA 3KAOA 4JTKA 4HNUA 4WQ6A 1GQNA 3T40A 3O15A 2CLIA 3SJ3A 4QM1A 4K37A 2FQIA 2HMCA 4O8RA 5FESA 3L66A 2AAMA 3G24A 2G96A 4JDYA 3NR0A 2E5BA 1VLIA 1HUVA 1CX9A 3P8JA 5J5DA 1THFD 1FY6A 2PCQA 5AYXA 3YPIA 2QCLA 1JCLA 1ZY9A 1PCWA 5D03A 3CIWA 1DL3A 3QH2A 3BW3A 4UR8A 1DV7A 1YDNA 2J9XA 1OFBA 1FUYA 3B4UA 1LBLA 1TV5A 2G95A 1EP2A 2QDGA 2NXGA 3DBPA 2NX1A 1RZMA 4W9TA 2NUYA 4OHQA 3BG3A 2Z1BA 3LRMA 1I2RA 1ML1A 3THAA 5C5YA 3BARA 2B7PA 3R12A 3EWBX 3MJYA 5D32A 5BNKA 3DKLA 4A29A 3LI1A 4UFMA 3FKKA 3GDLA 4TU1A 3IIZA 1CI1A 2VOMA 3SSJA 1H63A 3LLFA 2FPVA 1K7FA 2QJGA 4OV4A 4IQLA 2QCDB 3M5XA 2G5WA 2J6XA 3L5MA 1XBYA 2WNZA 3A24A 4ORIA 3EX1A 4JR5A 4IUOA 4Z1BA 1L2UA 1WYIA 4CNNA 2OT0A 4L4LA 1KV5A 1L6WA 1DQXA 2CLFA 5AHMA 3TIMA 4GC4A 4DO5A 2Z6JA 4OV9A 1JUKA 3W1XA 3LCGA 3PVFA 4MYXA 1NAL1 3LERA 3P80A 3LX9A 3NQGA 5KZEA 3O63A 4JNMA 4MLJA 3EWWA 4UCGA 1GVOA 4X9SA 1LM1A 4FO4A 4DO6A 3NQ6A 4ZMGA 3OG3A 1ICSA 1XDLA 3NM1A 2ABBA 3EX2A 3PSVA 1VZWA 1YDOA 1JQXA 1XFBA 3L5LA 4AXKA 1TSIA 3V75A 3QMTA 2HS8A 2E6YA 4UTJA 3TH6A 3UWQA 4Q32A 3W85A 1F2JA 2DJLA 1UCWA 5F2LA 4JTSA 4WOQA 1F5ZA 5CPOA 2C15A 4JYEA 2OT1A 4JIPA 1XBVA 3CWNA 4MFDA 4H6KA 4LV4A 1GG1A 4IX2A 2H90A 3C2EA 3MMTA 3DAQA 1VR6A 3W9ZA 1I2QA 5FEXA 1G7VA 1QPRA 3LV6A 3WK1A 4FNTA 2V5LA 1KTNA 2ZZ3A 3TJXA 3H53A 4C1KA 1SO6A 2WNQA 1D3HA 2A6NA 5C6MA 3TQKA 2XN0A 4U28A 5KTLA 1XBZA 5AC6A 1H7NA 1U5JA 3QSTA 4HNVA 1Q6QA 4MY1A 4GBUA 4A2SA 2PRLA 4WD0A 3ZWSA 3G0UA 2FTPA 3DU0A 3TDFA 1LZOA 4O1BA 1LOSA 5DCBA 5LHEA 5FI8A 3TAOA 4HIBA 5EYWA 4P61A 2FIQA 4RR4A 3TSBA 2ZZ7A 4YWIA 4AHPA 4K7YA 3B0UX 5I3JA 4QNWA 1OHLA 5GVJA 1O5XA 1DOSA 3M47A 2R91A 1OABA 1TPUA 1O60A 3VE7A 3PB0A 1WV2A 4K8HA 3K30A 2C6QA 2GJNA 3SZ8A 2RHGA 2C1HA 4KFOA 4IPIA 5AHEA 3RLVA 1IXNA 1RD5A 1LCOA 3P62A 4O1CA 2WV8A 3S0CA 3CLMA 4PL2A 4LVGA 3I6RA 4IOTA 3R8RA 2GVGA 2ZCGA 3L65A 3T7VA 1KA9F 1N55A 4K38A 1PS9A 2W0UA 3EEGA 3O06A 2Y7GA 3I7QA 4NXKA 1J5TA 1H7OA 2VFFA 4LC6A 5MHBA 1P1XA 5AFDA 1Q45A 1S5VA 1TPWA 3DH7A 1WXJA 5AC8A 5CPMA 1EP3A 4ZZ9A 1R2RA 3TW7A 3EX6A 3N34A 1IGSA 4UUIA 3TU9A 3AO0A 2ZRZA 3O6DA 3ZR4A 3FLUA 1FDYA 4E2DA 3BGJA 3S9YA 3C2VA 1OYCA 1S5WA 3CT7A 3I7RA 4NNBA 3KVMA 3LHZA 1GG0A 3S5OA 1ZAIA 1TYGA 3BLFA 2YZRA 4GNJA 1ZHAA 1W3TA 3CM4A 1TJRA 4MYAA 1FWWA 1VS1A 2Y61A 5D2YA 5LNRA 4LRSA 3UPBA 5LHFA 3JRKA 3B06A 3M5ZA 4M6PA 4QISA 4XBKA 2ZA3A 4EOUA 1BWLA 1QPQA 2OMAA 2DZUA 1X8FA 5C2XA 5D33A 4JTEA 3NQAA 1K7XA 5BOOA 4O10A 1VCFA 1JCMP 4CQ8A 3BK0A 3VI2A 1HO1A 2VC6A 3V1PA 1LLZA 2YW4A 1ZCOA 3TR2A 5KMYA 5KZMA 2QJIA 5EKYA 4O54A 4NQ1A 5F2GA 4NNCA 1UJPA 4Z1AA 4Y6GA 4IGHA 3E02A 2VENA 3LTSA 4IWWA 3W1TA 4QJ1A 2YCEA 1LROA 3M7WA 1TPC1 4DEFA 4NXSA 2CW6A 4CQAA 4O57A 1VC4A 4J9JA 3SI9A 4FB7A 1VJIA 4UFHA 4OE7A 2C3ZA 2TSYA 5G5IA 4E38A 3RK8A 3JR2A 2ZTJA 1M5WA 3N2XA 5F2IA 5HUOA 3HF3A 3HGRA 3OVPA 4IMEA 4Z0JA 3PY2A 5KITA 3G1YA 4XKYA 1FXQA 1KBJA 1VQTA 1SO5A 3WJSA 5I3KA 5H2ZA 2I9EA 3LV5A 4MY9A 3LHUA 4HPJA 2NUWA 2Y7EA 3EX4A 3G8RA 1UBSA 3N9SA 4RLIA 5KINA 4XTIA 3W7IA 3I7SA 4NJKA 2X1TA 5F1VA 6TIMA 4O16A 2PURA 4HPXA 4CCDA 1ADOA 2A0NA 3IGUA 4AAJA 3IGSA 5AOUA 2Y6ZA 4N9DA 1QWGA 2X16A 2B7NA 1OYBA 4BR1A 3PS7A 1B4EA 1I2NA 3UZ5A 1M7OA 2NZLA 4EVZA 3CHVA 4JTJA 3IIXA 4KWWA 5EBUA 1NFBA 2VFDA 5D38A 1F05A 4RZ6A 4D2JA 4UTHA 5KSWA 4GXMA 3NXFA 4N6EA 3FKRA 3NL5A 1O5KA 1G4SA 1OF6A 1W8SA 2ZTKA 1RQHA 1GPWA 1JULA 2X1SA 3W7DA 1SO3A 3GK0A 1K3UA 1FWSA 1YDVA 2VEPA 5CSSA 1LRTA 4O11A 5DBUA 3C2OA 3IIVA 1LP6A 3W22A 1JRBA 1TMHA 1RVGA 3MUXA 1TPVA 1MSSA 3LXCA 3QRHA 1FBAA 1Y0EA 4KFNA 1F73A 1SSGA 3B03A 5D04C 3QSRA 2DZXA 1AW2A 4N4PA 4WOZA 4FX6M 4FXSA 2QAPA 1H5YA 1PE1A 1TTJA 1TIMA 1W5MA 4R34A 2FJKA 3NL3A 3PAJA 1K8YA 5DXXA 1SR9A 3LM7A 5CZSA 3W7OA 3W87A 2ZRWA 1QR7A 3RFAA 4UTTC 1T99A 3EKLA 4S2BA 4NJHA 4GWEA 5CGQA 1J4EA 3HPZA 1N7KA 3NQDA 3LCFA 5D37A 4ZQCA 1FWRA 4FEZA 3FEMA 1EEPA 4EF9A 2CLMA 4Z1DA 2YX0A 5D2VA 1OFEA 3EB2A 3ABSA 3U8GA 4O4VA 4Z1CA 1AK5A 3W7MA 5D2TA 4K39A 4UFKA 1G4TA 1GVSA 3DI1A 4KFPA 2W6RA 1XUUA 3HG5A 3UWWA 3KVLA 3EXTA 1V5XA 3STEA 3TQVA 1OK4A 3GIYA 3G1XA 3SR7A 3KXQA 1ME9A 2QUVA 3FS2A 4JD4A 3A5FA 2C14A 3STCA 3WK2A 1OFQA 5F1UA 2WSYA 2QCDA 1W5NA 3QM3A 1C8VA 2NV2A 4JY8A 3W73A 3ABQA 4LT9A 3B04A 2H6RA 4AB4A 1H7RA 2YR1A 1ICPA 3G1AA 5BW6A 5CPLA 2YFNA 1SQ7A 3C8FA 1P0NA 3C6CA 4DPQA 4DQWA 4TR9A 2QUTA 5K9XA 4EF8A 4LNYA 1A5CA 3QQ1A 1E51A 4ZL1A 5DCDA 1YPIA 1AW5A 1QO5A 1VCGA 4FNSA 4OQVA 3OVQA 1AW1A 2GQ9A 3GDKA 1Q6RA 2VFGA 3RMJA 2ZZ5A 2CWNA 5A5WA 1Q6OA 1PCKA 4MZ8A 3W2JA 5LGXA 3PBWA 1JJKA 3T78A 4AWSA 1IIHA 4TO8A 4NJIA 1TRDA 2A85A 1LRNA 5TQLA 3O1NA 3E49A 4Y90A 1DBTA 3T4CA 2BTMA 3L0GA 4MZ1A 1L6YA 1SO4A 1TTPA 3D0CA 3O6CA 3L21A 3TKFA 3UY7A 3C56A 3IV3A 4JDBA 4BWLA 3NEVA 2GQAA 1H62A 1TV8A 1JQVA 3L67A 1R30A 3MI6A 2PRHA 4UR7A 1X6UA 3GKFA 3LCHA 5HWMA 3FA5A 2ZZ1A 4A22A 2J27A 1P0KA 1TTIA 4O18A 1KW1A 3NOEA 2CLLA 3NQ7A 5HR7A 1TB3A 2E77A 4R53A 4JTHA 1KM3A 4MPQA 5D30A 1ZALA 3NQ2A 2Z6IA 3NYZA 4FNUA 5D2WA 4HSNA 4UC5A 3EXRA
chains in the Genus database with same CATH superfamily
3TW9A 1Y5WA 2ADAA 5E1QA 2EG8A 2PP1A 1O1ZA 3LNMA 2OJPA 3HPXA 3HU7A 3G18A 1ME8A 4AG0A 4P7RA 5CG7A 4DWSC 4FIRA 2WQPA 1QUMA 2HBVA 1Q7ZA 1V3HA 2VUYA 3MUAA 5HWNA 1S5TA 1IZJA 3PB2A 1CGUA 2GGGA 5I7GA 3NDOA 3F5JA 2HNEA 1F6YA 3TYZA 3QYQA 3NWRA 1J79A 3W7EA 3UQNA 4L1XA 4JY9A 4PL1A 3PNUA 1UW9A 1V0KA 2QIWA 5D09A 4UTLA 4R9XA 1UWUA 3WEZA 4O1DA 4CUCA 2PDUA 2QF8A 1KC7A 1R3QA 4HMDA 5HJLA 3LRKA 4GIAA 5DT7A 4XKMA 2J47A 4HMEA 2QUNA 3D47A 5H8MA 2OLAA 2XWDA 1EUAA 1GYLA 3DCPA 6REQA 3DFNA 1KCXA 1TWDA 2JF6A 2VC7A 1JCYA 1REQB 5B7YA 4M7TA 2F6KA 2ATSA 2D2GA 3FSUA 5FSEC 1UA7A 1VBJA 1E5JA 4QEEA 3QV6A 1SFSA 3MPGA 3W01A 7TAAA 1VLWA 3MI3A 3AXXA 2C1IA 4R5EA 5FJJA 3NZRA 1Y65A 3WENA 2W4XA 3VD7A 3PZMA 1KFKA 3TP4A 3CZ8A 2CBJA 1VHNA 2V2DA 3W83A 1KWKA 4IMDA 3W1QA 4B90A 1CTNA 3GR7A 3FNDA 4R33A 1JD9A 3T2PA 3QR1A 1EO7A 4BQ4A 4IZGA 1Z69A 4CD5A 1E0WA 1I1XA 3QY8A 3HJEA 1OBAA 5IHSA 2Z26A 4JIIX 3AZSA 2FYMA 1H1YA 4IGMA 3B8DA 2G0WA 4BWLC 4DI8A 2AOSA 3RM9A 4WR3A 3OBKA 1HL2A 2Q8XA 1DJZA 2DT2A 3W23A 1RBLA 3DG6A 4ZOAA 3BLDA 1B9ZA 1V3KA 2BG5A 1P7TA 3QBUA 4DBDA 2WC3A 4C6JA 3NSNA 2Y62A 4WJXA 3JUGA 1XRVA 2QULA 2XN1A 1DIDA 5FF3A 3AHVA 2B4GA 3LXAA 2GJLA 3U9IA 3ARXA 1YX1A 4QJ4B 3AJXA 3SECA 3SGGA 3E1F1 3CYJA 4B92A 3TTYA 3WJWA 3ARYA 4GI4A 5FJIA 3OQEA 4ZQMA 1H7WA 4AC7C 4ROQA 1FHDA 1W9PA 3WK0A 2YIHA 3K8LA 5D9OA 4B3KA 4ECLA 1CB7B 1BEUA 2D73A 1IXOA 2XH2A 3EWYA 3NGJA 5H91A 1U30A 5DEZA 1P48A 1FX6A 2QV4A 5I07A 4UIOA 1N82A 3VIJA 3AZTA 4DM2A 1ZJBA 2XU2A 1G1YA 3CMFA 4JXCA 3S5SA 3F4VA 1OCQA 4L5ZA 3BLLA 1KRMA 4S3EA 3GR8A 3UBPC 3ZWTA 4YNGA 3TTOA 2PP0A 3E2VA 3U2OA 2FMOA 3WQEA 4AX7A 3GHRA 3TYDA 2TYSA 3MC5A 3VE9A 3ZJ6A 2DQXA 3M6DA 3ZSSA 1T0OA 1VRDA 4J2PA 2Q02A 2P88A 3LHTA 1BF2A 3IVUA 3TYCA 2D3LA 4RX0A 2CWXA 1HVXA 1OX6A 2D0HA 3VCRA 4IXXA 1S46A 3WLTA 3SRHA 3WKZA 4GVFA 3QGAC 4GO9A 3SB0A 4IX0A 1Q4NX 1SJAA 3CYVA 5I03A 1JDFA 1ZGDA 2JKPA 3U57A 2V5KA 3BOFA 1IQ8A 2EGZA 1VFLA 1XIEA 2NVCA 3RHGA 4C60A 4L1WA 2ALDA 1QCWA 3QKEA 4Q8WA 3JVAA 5AHIA 5EMKA 3T0BA 4A8IA 3RU6A 1I1WA 3TN4A 8TIMA 4FOKA 3OGVA 1TJ0A 1XF0A 3W70A 1DWAM 4PBEA 3QF0A 1YYAA 4WJEA 1NWTA 1V8EA 1EX1A 2JKEA 1QMLA 3WMBA 1K8CA 1E72M 1H7XA 4JQ4A 1U5HA 3TMQA 4DJFC 2PDPA 4L1GA 4NVTA 4YWSA 3LGDA 3E0LA 1UWAA 2UV8G 2WSRA 4MOZA 1V7YA 3BVJA 4KF1A 3VGEA 3U5UA 4LNCA 4ROPA 2PDHA 3RX3A 3AZRA 5A94A 3GBDA 3MV01 1WZKA 1IEIA 4G56A 5BOEA 1MEIA 2OEMA 2QEZA 3NIYA 3KDNA 1KM0A 3ATZA 5AHLA 1O1HA 3VIFA 4Q4QA 4UTMA 1VIZA 3SDOA 2OX1A 3ARWA 2W61A 2HNHA 4TOQA 3I4KA 1CECA 3NURA 4NU7A 3BV7A 3IRSA 3D46A 3SFWA 2VEMA 2WMGA 5MKGB 3T05A 4H9YA 5G1TA 3ITOA 3L5AA 3M0VA 2D69A 3R4IA 2RGMA 4QDWA 2W63A 1A0DA 2JF7A 2A3LA 4HYVA 2H3DA 3N1AA 4LC8A 1CXFA 4Z2HA 1WQ5A 2QZRA 4F66A 2A3HA 4B9ZA 4XG1A 3PC0A 1XIJA 2V8ZA 1ZBVA 3WK3A 3FIGA 1HJQA 4MKSA 3S42A 4FF7A 1Q7QA 3GNDA 3L0NA 3UCDA 2YSWA 3PPCA 1KM1A 4BQ2A 2I57A 4MB1A 3O3RA 3QEZA 4WUIA 3EBVA 4TX9A 2A7PA 4Y9PA 5FEWA 3ITCA 3FAWA 1YXYA 1EHNA 2RDUA 1WBHA 5I3IA 1HQTA 1JAKA 1A5MC 3KRZA 3LHYA 1WZMA 2I14A 3V0TA 4X3ZA 4GUHA 3MCNA 1XD0A 1LQ0A 2VUNA 1SUXA 5F4WA 1AVAA 1S3TC 3WY1A 4PRRA 1PHWA 1IXQA 2DT0A 3L2IA 3BV4A 5EA9A 2A5HA 3QQWA 3AOFA 4E5TA 4DLMA 3LZ5A 2QJNA 4ES4A 1UIPA 3GYCA 3SUTA 3AHYA 3SAZA 2YCKX 3W53A 1ZENA 4IQEA 1W9XA 2OKOA 4I9MA 3RPDA 1O12A 4M6VA 1UKTA 1PIIA 4DB7A 5A8QA 1ZRQA 3KLKA 1ONEA 4JFWA 3KL0A 4JTGA 3W86A 4IMFA 3WX7A 2V30A 3VIMA 4KWSA 4DWSB 1RQEA 2DSKA 3W1RA 4WKFA 2AMGA 1A80A 4W88A 2JK2A 1W5PA 3TE9A 1FCVA 2I9UA 2FJUB 5EL1A 3W88A 1SSDA 2X2GA 4PH6A 4ZO7A 2JGQA 3R2GA 3L4XA 3TFCA 3GAKA 1UD8A 3AIWA 4MHBA 3LBCA 4Z2GA 2OZ8A 4NY2A 4FNPA 1EZWA 4CD4A 1PHQA 3OEXA 3KBWA 2TMDA 1MDRA 4YL2A 1XC4A 1AQMA 3VGFA 2X1RA 2YPIA 1DE5A 4EPDC 3QJAA 4J3ZA 1O68A 4RV8A 3GH5A 4MTVA 1A3XA 4AHOA 3SEPA 3GG1A 2XVGA 4PMYA 3N13A 4TMCA 3N12A 4DX3A 2Z2BA 1P6BA 1TV2A 4YJ5A 2YDAA 4M8UA 4URIA 1GTEA 3TVAA 4O13A 3QR3A 2YBVA 1FWDC 1WPCA 2WC4A 1K1DA 3OPSA 3P84A 1XKYA 1E71M 1TUFA 1V0LA 1EIBA 3WN6A 3WNPA 4C6QA 4KKXA 1KXTA 4GQ0A 1K70A 4JN8A 4DBUA 2GSHA 6ALDA 3ARRA 1K6AA 1BXCA 4J2MA 5TF0A 4D6GA 1KM2A 1EQPA 4DIAA 1EZ2A 3EKZA 2WHJA 2ISSA 3NQFA 4R3UA 3UW6A 4H9MA 1U1UA 4LWWA 3QHMA 4UFLA 4BS0A 4E4PA 3BAIA 2VFHA 4A21A 2ZBTA 3O9NA 4Y9MA 3P74A 5HPOA 1GOMA 1S2AA 1XFCA 1TTQA 4KH2A 3E2QA 4IL2A 3IUIA 1UB3A 5IRPA 3CZKA 4TV6A 1NSJA 4F2TA 3U0HA 3VOCA 2ZUMA 1B90A 4CQ9A 5K2ZA 1R2TA 3HG2A 3PAOA 5AN7A 2WPBA 2XFRA 3ORWA 3BG5A 1CXKA 2B7QA 1UC5A 1EX5A 4DAFA 1OEPA 2AQOA 4FA3A 4CKQA 5AYYA 3SGUA 1TVNA 3C0SA 3OODA 3A13A 3MSGA 1ZAJA 3C3UA 4CU8A 3M5YA 3LTYA 3BE7A 2IPJA 4G5DA 3BC9A 1FRBA 1D7FA 3I68A 3LDVA 3SY8A 2F8QA 3ZVHB 3STGA 3QZ6A 1GVRA 5JUVA 4LS0A 2ABAA 2BXVA 3MANA 2DUAA 2Y5JA 4LF2A 1JZ6A 3GLCA 3SY5A 1WAWA 2WZHA 2XIQA 3HG4A 3VUPA 2Y85A 1A5UA 1VBUA 4ZB2A 1H5VA 3PTDA 3TYUA 3H54A 4QJ3B 4ADTA 4E4UA 2PZ0A 2G37A 1LWHA 2XTKA 1M04A 4QXIA 4G1KA 4FXFA 5C55A 2Z0IA 4BY3A 2D2HA 4JHMA 1OG0A 3TWBA 3WQVA 1VFOA 4RZBA 4Q8QA 3AU6A 5D2XA 1KQZA 4FIQA 3U2CA 2ZFAA 3HJZA 3AICA 1QATA 1DPMA 4IMAA 4PTWA 3RLGA 4AEEA 4Y96A 4AD5A 2QJMA 1A53A 3M0ZA 2QAFA 3NQMA 5AC4A 4PTXA 2W9MA 2E6FA 3LY0A 1PTGA 4M51A 2I56A 4M1BA 1J93A 3ME3A 4FLOA 2OZ0A 1P43A 4QQ3A 4WXZA 1XBXA 2C0AA 1JYNA 5LGZA 1JVNA 3V5CA 2BODX 2DVTA 1SW7A 4NI3A 2NWSA 4TX6A 1W9VA 1XGDA 1OM0A 4XAYA 1F8IA 5HK4A 2EQDA 4FOUA 2DH2A 4YN5A 5U7SA 2JEQA 2Z2UA 1UD2A 3KBNA 1UUQA 4LUTA 2ZRUA 3WQOA 4BFAA 5DRCA 3URBA 3IVSA 1GWJA 3AMGA 4PEKA 3AALA 5CSRA 4JIHA 4IP4A 1R7OA 1ENUA 1UR2A 4B5NA 4K8EA 3VNYA 3PG8A 4ZXLA 2Y7DA 5CJNA 1UC4A 5HNTA 3B8TA 2RJGA 1ZZMA 1WBJA 4EK7A 5J04A 4AZBA 5H6HA 1GVFA 4AZGA 2EJAA 3H70A 3CZLA 3NM3A 4GYFA 5CC7A 1W1ZA 4TTGA 3FXGA 3S1XA 1XLFA 1W32A 3IEBA 4M5PA 4CU6A 4YCPA 3HM7A 3R5EA 5J5RA 5AHFA 3CHDA 3K4AA 3NAVA 3FN9A 1Z8AA 3FOKA 1OT1A 3H2NA 4JQ1A 3W2MA 2Y0FA 3SSZA 4JOMA 4NZJA 4DUWA 2DDXA 3S1WA 1V79A 5HULA 3EWXA 3CPRA 1EJRC 2VCCA 4J3SA 1R3SA 4CN4A 5CZKA 2VFIA 3M0LA 2ISWA 3W82A 1MQPA 3PUGA 1PWMA 1VPXA 2RUSA 2DU2A 2CZ5A 4B5TA 3WNOA 4PB3A 3KCOA 1WO2A 3W71A 3ITTA 3CEPA 4ZA0A 1MUMA 3VM5A 3PSWA 2BVTA 1W91A 4F9DA 1E5NA 4XAGA 1UPPA 3HGOA 2DIEA 3W7JA 1E6PA 3NYDA 5GJNA 1LOQA 1BPLB 3IARA 3UNDA 4NHVA 3CO4A 2A3AA 1GQLA 4BF9A 4IP7A 1EUNA 4NX0A 4DI9A 3OO2A 3THQA 1JZ2A 1EKOA 4XZNX 2BX7A 5E5CA 1QI0A 4C1NB 2CBUA 2WZEA 1SW0A 4HA4A 4DLFA 1X8CA 5HJXA 1BSLA 2C18A 1NP2A 1Q7MA 3HO8A 2KZHA 4XO6A 3VIKA 2QDHA 4JYDA 3QV7A 3U7BA 2PF8A 3ANVA 3BZJA 3L68A 4D6IA 5AB3A 1ZL1A 2BBFA 3E12A 1OY0A 4P7NA 2IS7A 3FV9A 1UZ1A 2J13A 3VAVA 3TEVA 1H0IA 5GPRA 3B0PA 5I3HA 1BQGA 1SZGA 1W1VA 4MB4A 1IYXA 4IMGA 3DC0A 4CN6A 3IJ9A 5C9WA 5SWUA 3CV6A 1LYXA 1V0NA 2GQ8A 3CHEA 3PZVA 3CTTA 2C19A 1VH7A 3ITGA 1LL4A 3HOJA 2YJQA 3S5YA 1F74A 3UPWA 4K7VA 4Q4KA 2WBGA 4JX5A 4CCZA 2J24A 4GKTA 7REQB 5JIPA 3E5BA 3MWAA 2QVNA 1W54A 3WH5A 1Z44A 1J0YA 3CEUA 4ZE5A 2WMHA 4S3KA 2P0OA 2WVSA 3NDZA 3G22A 3ENLA 3WF2A 2QJHA 2QCFA 3TJLA 1PAMA 4OJYA 5E9AA 1GQNA 1MMFA 3O15A 2OYLA 1O5RA 2PDGA 4K37A 3V18A 2XYLA 1K9FA 3UR2A 2G96A 4JDYA 5GJMA 4J27A 3NR0A 3QY7A 1WP6A 1BQCA 2DVUA 2PCQA 5AYXA 5I3DA 3OGSA 1OZQA 5REQB 5D03A 3CIWA 5FAGA 3AMLA 1QXLA 1R86A 4DN1A 3CZJA 4UQEA 4Q7IA 2E7FA 1OFBA 2D20A 1LBLA 3KE0A 3DBPA 4GQBA 3SQLA 2NUYA 2WCSA 1ISWA 1J01A 2AQVA 1X98A 4LF1A 3MJYA 1EJSC 2IKIA 3WLKX 4ZO9A 2BY3A 3LI1A 4A29A 4UFMA 1JI1A 3FKKA 2HRWA 3IIZA 2VOMA 4IUGA 2CITA 1XQLA 4GK8A 1XBYA 1BVNP 3AC0A 4PBGA 3A24A 1V77A 4ORIA 4MAZA 4Z1BA 1HX0A 1WYIA 3CL6A 1KV5A 5E09A 3PTMA 3ZJ8A 4GC3A 3TIMA 3CAKA 2Z6JA 4TTUA 4UTFA 1PTDA 3W1XA 1RK6A 1JNDA 4BQ5A 3LSCA 3PVFA 3BUVA 3NQGA 5KZEA 1GVOA 2CESA 1F4AA 1LM1A 4DO6A 3NQ6A 4PB4A 2ESCA 2GQ3A 3OG3A 3PBGA 4CU7A 3LQGA 1XDLA 3NM1A 3EX2A 1B1YA 1MFVA 2B81A 1YDOA 4A8LA 4G8TA 2NQ9A 1XFBA 4AXKA 1NM9A 1Q85A 3MSDA 1UWQA 2DJLA 1WKYA 2WHKA 4D6HA 4MG4A 2W62A 2HBXA 3IANA 2C15A 4JIPA 1JNEA 1XBVA 2DIKA 3CWNA 4IX2A 4GVHA 3VOIA 1QPRA 4QQUA 3ZT7A 3LV6A 4IQDA 2DT3A 4CD6A 3T8QA 1V3JA 2A6NA 2FZ9A 3TQKA 4XV0A 3NFUA 1Q66A 3RYSA 4H8VA 2WNWA 4W7UA 5A2BA 4J1OA 3RMEA 1NDWA 2GJRA 4PCPA 3G0UA 3DU0A 1XR2A 4XZMX 2REQA 5LHEA 1HKVA 2YB1A 2FIQA 3SCUA 4C65A 2WJDA 4Z1YA 3CASA 1GQJA 2ZZ7A 4GYKA 3KBJA 4AHPA 3B0UX 4QNWA 1OHLA 4H8UA 5GVJA 1DOSA 3M47A 1HKIA 1TPUA 2W92A 1W1PA 1O60A 1TVPA 1ZQ5A 1BYBA 2OWWA 3K30A 2C1HA 3CGTA 4IPIA 1RD5A 1XW8A 2XM1A 2WV8A 3WLNA 3QGVA 2PBOA 4ERIA 4B5XA 1VBHA 4L4PA 3RDKA 4YYFA 1PS9A 3FVMA 4W87A 5A2CA 1TA3B 1UBPC 4XVEA 3O06A 1KGWA 4KETA 3HA1A 1J5TA 3AS2A 1H7OA 4N0RA 3ZJ7A 3WQ6A 1QW9A 5MHBA 3ES8A 4EAYA 1Q45A 3ZXWA 1WXJA 3VD4A 3U2ZA 2PLCA 4ZCWA 4D72A 1R9XA 3TU9A 2ZX7A 3AO0A 1KRCC 3BDKA 1OIMA 4HCDA 3FLUA 1BLIA 1RJRA 4E2DA 1VENA 3IJLA 3BGJA 4V1YA 1W1YA 1QI4A 3S5OA 1ZAIA 3RIKA 3WDPP 1ZHAA 1W3TA 3CM4A 2Y61A 4LRSA 1DWHM 3EOLA 2YOCA 4GJIA 1K7XA 5BOOA 5C71A 2D22A 2PDCA 2VC6A 1S39A 3APTA 4N42A 3V1PA 3ICJA 3CS2A 5EKYA 4O54A 1UJPA 4HU4A 4LH8A 2VENA 3VKDA 1KXQA 1ZPTA 3UEQA 2GOKA 1EXPA 3K46A 4S3DA 3WDQA 3WFZA 1WE5A 1K6WA 4NZ4A 4O57A 4J9JA 4FK9A 5MKGA 1E3XA 4E38A 2Z1VA 2AMXA 4EE9A 1NDZA 1M5WA 2BGSA 2DW6A 3N2XA 5F2IA 5HUOA 3PY2A 4GINA 3K2GA 1SO5A 5IDIA 5H2ZA 2I9EA 1FH9A 2E1WA 1A4LA 2X2YA 3LHUA 4K68A 5HANA 4P5UA 3VC5A 3G8RA 1UBSA 3MMUA 4IP5A 9XIMA 4NYUA 3OBEA 1ADOA 1K77A 4K3ZA 4UQ9A 2VZTA 5AOUA 1UA3A 2XVNA 2EPLX 4MKVA 4HHHA 1QWGA 3RO6A 1U5VA 4HB7A 1B4EA 3DHUA 1C8YA 2O92A 3H2MA 3AIQA 3W25A 3ARQA 1XYLA 2BFGA 1VF8A 1G5AA 2OXNA 1YDYA 2VFDA 2FH8A 6XIMA 4HU8A 2OGYA 4UTHA 3FHQA 1AQ0A 2CLPA 1OIFA 1CGXA 3NXFA 4EXAA 1MW1A 1XYCA 3NL5A 1G4SA 3D6NA 4KIRA 4QG6A 4J5NA 2Z00A 2FGLA 1SO3A 3W7DA 4KEMA 1YDVA 3EDDA 2V67A 2QMKA 1LUCA 3MSYA 3IIVA 1LP6A 2J78A 2DV0A 3MUXA 3QGKC 3TJ4A 1F3EA 1SMAA 1Y0EA 3V1HA 2A3CA 5D04C 4M3PA 2DZXA 1AW2A 3RJXA 4MWAC 2QAPA 1BWVA 1W5MA 3A4WA 3H8AA 2FJKA 2YDRA 3F5KA 1XQKA 3AQUA 5DXXA 3V5FA 2WK2A 3CMGA 5CPQA 1EBGA 1UMLA 1LG2A 2ZRWA 4R85A 1XPYA 1EYWA 3MKCA 2FZDA 4K2SA 3EKLA 4GWEA 1XH0A 4PCSA 3SN1A 1HXJA 4HA3A 3NQDA 3CV2A 4ZQCA 5FIPA 4W8BA 2GVEA 3Q4DA 3WF0A 3FEMA 4E8GA 5A3HA 2RAGA 2CLMA 5D2VA 4JAWA 3ABSA 1P0EA 1X39A 2J7FA 2CC0A 3WF1A 1GK8A 2CKSA 4FMVA 4JN7A 2W6RA 1C92A 1XICA 1PZ1A 3HG5A 1BAGA 1IEXA 1XRSA 3MUZ1 1IHIA 1S2TA 3WYZA 4A05A 2QUVA 1T5AA 4M24A 3GTFA 3WK2A 3AHTA 2PDIA 1C8VA 2NV2A 1RHCA 5LIUX 1V4YA 1JZ5A 1H7RA 1SJDA 5BW6A 1ICPA 1D2KA 1K4HA 3EMQA 1T7LA 2YFNA 1SQ7A 5CLTA 1P0NA 3CBWA 3MZ2A 4DPQA 4DQWA 2C8NA 1QI5A 2QUTA 3GC2A 1WUFA 2Z1KA 3GW0A 4LYRA 1E51A 5I2UA 1AW5A 1QO5A 1VCGA 3Q67A 1AW1A 2GQ9A 1Q6DA 3GDKA 3RMJA 6TAAA 4KWOA 1Q6OA 3THUA 3UXLA 2V38A 4WEVX 5CC3A 2PDYA 2YLLA 4ACYA 5A6JA 1HIZA 5LGXA 3PBWA 2CKRA 3BSHA 4U3AA 4AWSA 1IIHA 2GWNA 2HWGA 3GIQA 1LRNA 3E49A 4TXEA 4Y90A 2BTMA 3TN5A 4OZOA 4MZ1A 3D0CA 3O6CA 4ZODA 2Z1XA 4AIEA 4BWLA 4LSBA 2GQAA 1TV8A 3AROA 3L67A 3VIGA 1R30A 2PRHA 2QLYA 4UR7A 1X6UA 1TUXA 3SRFA 2ZZ1A 4EXQA 1BFNA 4JHZA 5I02A 4HP5A 2VGFA 1TB3A 4QR6A 4U33A 3FA3A 3GBEA 4JTHA 2BDQA 4I6VA 1T8QA 2F6UA 5D2WA 1W9BM 4UC5A 5A6TC 2WW5A 3A4JA 3RRAA 3NPUA 1T8XA 4O14A 1NVMA 2EKCA 3JS3A 1XIFA 2WMFA 1ZUAX 5I5RA 4DAIA 1EJUC 4I7VA 1J5SA 4ONVA 1FWFC 1FHVA 1A5BA 3GVVA 4JFTA 2ZX9A 1VB9A 3GG7A 4GE8A 4I9JA 3OBAA 4B16A 4XVDA 1UJQA 3LRLA 4ZXOA 4DZ5A 1GQKA 1XDJA 4AH7A 3W29A 4O8AA 4H00A 5CBBA 3KWXA 1RBAA 3F4NA 1Z9AA 4GHRA 1V7AA 2GGIA 2VURA 5AY7A 3W76A 3G2GA 1NQKA 1FWBC 1NELA 3L2MA 3SUWA 2VEIA 5CGTA 2ON3A 4XZIA 2BASA 3W26A 3Q58A 4M80A 2EF9A 4O15A 1J0IA 3F2CA 1B9BA 1R3YA 3GDTA 5I00A 3AUJA 4PFHA 1E0UA 4IIGA 1P5BA 3ANYA 4CGTA 3PJTA 2YXGA 2ZXAA 3OYZA 3PBVA 5IFTA 4IG2B 5IBXA 1EJXC 1CGTA 3C52A 3CZEA 1XYFA 3ANUA 4H2CA 4J7RA 4UTWC 4NAEB 3UG4A 1XISA 3KL3A 3QOKA 3LPPA 3ZVIA 1KLZA 3W7RA 5DMNA 3UETA 1M41A 2QPUA 2AKMA 4HNTA 4L64A 4GYPC 3ABXA 1XP3A 3WD0A 4H9TA 3BJFA 2DUZA 3F4WA 5AYIA 4PMDA 1JFHA 2OWCA 2YA2A 1UR4A 1OGGA 1EGZA 1X7IA 1UD4A 4CD8A 4S3FA 4Q8NA 1RA0A 1BGGA 3T44A 4UNKA 2PWUA 1MFUA 5U4NA 1J11A 4QE1A 2J7BA 5I6SA 2FB2A 3VKCA 1JAEA 3CTLA 3UVIA 4LY4A 4B15A 2V3GA 3EOOA 5PTDA 3G6MA 2KAUC 2FPTA 2Q8ZA 4DJFA 4N7QA 4HSOA 2HSAA 4AZ6A 3OQ8A 5CKSA 4CEXC 4LS1A 3NEHA 3G0SA 2CZVA 4XZLX 3ARVA 1LOLA 2G3MA 3G1VA 1JCXA 2CFFA 5CPTA 3UGVA 3M1ZA 4ZO8A 4TIMA 1E6NA 1UUMA 2E6DA 4HTBA 5DF0A 1ITQA 4B3ZA 4WRHA 1JRCA 2BXYA 4F0MA 5FF2A 4G6CA 4DJED 3FEQA 4YTSA 4V1XA 2CZEA 4I9TA 3AUOA 3KZSA 1RP9A 1UHVA 4LOCA 2QR6A 2G3IA 2OVLA 1RPKA 4F0SA 2V3FA 4KEZA 1MO0A 3HV8A 4HPHA 5HXMA 3QMRA 4ML9A 5K3VA 1QW7A 3WQ4A 5DY2A 3UYCA 3GNNA 2R24A 2ZDRA 2DZTA 3DIPA 3KWSA 1TPB1 1V6UA 2NV9A 4P7OA 1Z48A 3GU2A 4MUZA 4FOJA 1MZHA 3C4UA 5I78A 2PWHA 2FHCA 3L7RA 3LENA 1C9WA 3N19B 1K03A 5BROA 4JTFA 5CBIA 2CXEA 5CPNA 1W3KA 4FI4A 4GZIA 5FOOA 4G1NA 3TSMA 1OX4B 2YFOA 5C9ZA 1W6TA 1KCZA 4P8WA 3CUZA 2IUZA 4I7UA 4PEEA 2RGLA 3C2YA 3KL5A 4KIEA 3QLLA 4GKLA 2QXWA 3LHVA 4AWTA 4LCSA 3WJYA 3G1DA 4GX9A 2IQDA 3O2LA 1JCJA 5DMMA 3NTYA 3UXAA 4OOZA 2CETA 1B5TA 2GVJA 3GDMA 1KBIA 1TX2A 3M9YA 4QS6A 1UZHA 4ZVJA 2ZADA 4JS3A 4WZHA 4HGXA 4JBRA 1TREA 2BHZA 4Q8MA 1UG6A 3UZJA 2VC9A 1YPXA 1XG4A 3FDGA 2PTZA 5I06A 3LI0A 3TSDA 1UKPA 3FJLA 1AMKA 3TX9A 2W91A 2PDJA 4MWAB 4W8AA 1EYEA 4Q4MA 5D8ZA 2E3ZA 3CIXA 3OIHA 3W0KA 4DXVA 2DSZA 3WF3A 1XI3A 1FHUA 3UR8A 3P7YA 1I9CB 2OSXA 3LEPA 1ZAHA 1KQYA 4H04A 3RCMA 3OHMB 4F79A 3R7MA 2ACQA 1TO3A 1BD0A 2V69A 3B9NA 3PN8A 4R7WA 1PEZA 1FCQA 4OBTA 4RE2A 5AYBA 4M29A 3NL2A 3LTPA 1HO4A 3WELA 1IEWA 3O6YX 4PMOA 2OOFA 3IUHA 4HZ8A 1AD4A 2FVLA 3S3GA 1V0MA 1L0PA 2V5BA 2J66A 3V4BA 1EC8A 1UH4A 1E9YB 1KB3A 2HISA 4RCXA 1Q6GA 3OIXA 3EGJA 1UKSA 2CPUA 3EKGA 4US5D 3B9EA 1E0XA 3PANA 3MO7A 4U2YA 4DF2A 1H61A 3QOMA 3I3EA 3MT1A 3GDBA 3A5VA 3PUDA 5G4WA 1DJQA 2DZAA 4FR6A 3UWUA 2XISA 3K4DA 1UD3A 3BANA 1F9CA 3MS8A 3LCIA 3DG3A 3WD2A 4UTKA 2PTDA 2RDXA 5REQA 1YPFA 4GG9A 3TNBA 3POCA 3AWNA 3VIIA 1S1PA 1FWJC 4FS9A 1FFRA 4WJ8A 4IGNA 3GE7A 2V6AA 3GS6A 2VDHA 4RNHA 3CQIA 2FB3A 4ZEPA 4NRRA 4EPKA 3ISIX 3JZUA 5C9UA 5EMYA 1PSCA 4FF5A 3BLIA 3CLWA 3H6OA 5HNRA 2F84A 4AD0A 4LCRA 3WL0A 4LU0A 4DJEC 1KTCA 1I8JA 1RJPA 2DT1A 3GSMA 4OUIA 2F2KA 4GRSA 3RLUA 3UJRA 4E4FA 4Q7NA 2QYGA 2ZA2A 1I6NA 1RLDA 4H8NA 3TQ0A 1RV8A 5K9CA 1LBFA 4Z0SA 3TLQA 3P14A 3TUUA 4ZQPA 5HWJA 5C2GA 1G7UA 1U83A 4N9CA 1OT2A 3NCOA 2ZUNA 1J0KA 2Z7GA 3QZEA 4QIUA 3ONBA 4DPPA 1H1ZA 2VTFA 3Q2DA 3TCSA 1DIKA 3MBDA 4P8VA 4W93A 5JH1A 4I8YA 1FA2A 2VGIA 3MWCA 2INFA 4XZHA 4MUPA 1GZ1A 1OCNA 3WNLA 4QE5A 1KNWA 1VYSX 4HN4A 1XX1A 3P5ZA 1DJGA 3EWZA 3O07A 1N2VA 3ZT5A 4WHBA 3H7VA 4Q8TA 1G9HA 4UMCA 1KLYA 1XGZA 4DJDA 2E25A 2PWFA 4MWAE 3ZS4A 2PGEA 1W0MA 2XINA 4J3TA 4HA0A 1ECQA 2QUMA 3M7SA 1W3HA 1SFLA 1KTBA 5E6ZA 4ZO6A 4E2BA 2IKGA 3SFKA 4JFSA 4WKAA 3UZWA 3WFLA 4WX2A 1J6PA 3W1NA 4TVCA 4NJGA 1CNVA 3NPVA 1TRIA 2VX4A 3VFLA 4LUYA 4H9UA 1EOMA 2YA1A 4N2YA 4A3YA 3B0VC 4E8CA 2P0IA 1LRQA 1RXOB 4JYFA 3VNLA 1SZRA 4PZVA 3KCLA 4QSFA 3ABRA 3REQB 3QHNA 1POKA 1RUSA 5CQ1A 1E0VA 1YTEA 4O0QA 3ITVA 3FSTA 2PU1A 4AZCB 4HSHA 1NU5A 3OVRA 2W79A 1TA3A 4HOWA 2D24A 4LANA 2BSLA 1PBGA 2QPSA 2PWEA 4A3UA 2F7FA 4RXGA 4H9VA 1FFQA 3QPZA 3E0IA 1UP3A 2J7DA 4BI5A 3R89A 3BAJA 3BICA 5F4SA 4K6AA 2QJJA 2XZ7A 3QFEA 1W2VA 2QCMA 1NF0A 3S1VA 1BTMA 1B3ZA 2PPGA 3R0DA 5DN1A 2NT0A 4HQVA 1WA3A 1PKNA 3MUY1 4EWND 5C8BB 3MVIA 4WK9A 4CNPA 4LUSA 2HK0A 3GWQA 2OELA 4AD4A 4REQB 3TNOA 3T42A 2H9AB 1SZFA 1B4KA 3CAWA 3BAWA 4OECA 1CXEA 1JPIA 2XH0A 3WLRA 3GXFA 2PD9A 4HK7A 1WKEA 1GVEA 1XIBA 1EBHA 5IXEA 1E1CA 2XVLA 3O16A 4XZWA 3DGBA 4GBDA 4M6UA 2ZXDA 5IM51 1NEYA 2VGGA 2MANA 4MLRA 1OC7A 5LA1A 4DZHA 4L9ZA 1PPIA 1QAPA 1E70M 1C8QA 3H23A 1YBQA 2XDFA 4OFCA 4DELA 2Y2WA 4MB3A 4IJCA 2YGYA 2VDGA 3UXIA 1A47A 1IWAA 3PWAA 4GCAA 1WOAA 2W5FA 2EJ1A 4D6EA 1HF6A 2C13A 4O12A 2YBTA 3B0YA 3ATYA 4ICNA 4GO8A 2YXOA 4TMBA 4X0VA 3KHJA 2HE5A 4M7SA 1UH3A 4E6MA 2ZXBA 3TC6A 1W1IE 1UZ4A 2PFHA 2CHRA 1B31A 3H12A 2Q71A 2WMJA 3Q65A 1QOXA 1N8FA 1KRBC 2XH4A 2FZ8A 3AMKA 4NSBA 2V82A 4O50A 1S2CA 2GYIA 2FPYA 3H4WA 3PUOA 3TOYA 4Z2JA 2J7EA 2O55A 3GXNA 3W3OA 4LV9A 3W7KA 3BMVA 4C5YA 1IZKA 3IUDA 3QC3A 1LORA 2NLIA 5LA2A 1UUOA 4D8LA 3KUMA 1WX0A 1JFXA 3PUEA 2Y8KA 1X1OA 2POTA 5K7JA 1C90A 2XIOA 1E56A 4V28A 1F6PA 1EL3A 2I5QA 3S6DA 3S4TA 2V2CA 4JGDA 3WCZA 2VRKA 2B31A 1CGVA 1Z41A 2H8ZA 4RXFA 3A22A 4LBUA 3EEZA 1FXPA 4UTTA 1JXJA 2VZVA 4HU3A 2VX6A 4DXXA 4NIRA 3F5LA 5I3GA 4GUJA 1GGOA 3E38A 3GC5A 1XH1A 4GGHA 3CIVA 1HTIA 1X7FA 3ARUA 4W5ZA 5K4XA 5CC5A 4Y2WA 3PG9A 4GD0A 1MYRA 2HVMA 3M46A 3USBA 4AF0B 3K1DA 3N2TA 2E9MA 4L4MA 3S2JA 3EOUA 4C6EA 4ZOEA 1I60A 3V7PA 1ONRA 1QI3A 1E9ZB 2W67A 1CZ1A 3VD9A 4AZHA 3MYPA 2IPGA 3EXSA 4QCEA 3IJDA 4X61A 3UWYA 1OK6A 2OSYA 3KVJA 4LYQA 3G3DA 3MI2A 4HT3A 8A3HA 2FMNA 5A8NA 5IFPA 3PBYA 4YMZA 1UR8A 3K1GA 1A5LC 2R14A 3SUVA 2J8FA 3C0JA 4H6QA 2OEJA 4NUWA 4DUOA 5HBFA 3EMCA 3T81A 2YLAA 4Z2IA 4PTVA 2XJ7A 1GOKA 1U1HA 1L6GA 4PTNA 3P82A 2DZWA 3N2MA 3EWUA 3MUIA 5JBDA 4QLKA 3F03K 1CPUA 2Y88A 1JR1A 3BLPX 3LPFA 3ELFA 4PFMA 3C61A 1FH7A 1OZMA 3NQEA 5BMXA 3WUFA 3IK2A 1XDMA 4C6IA 4BF5A 3OZPA 1UP2A 2NSXA 1Q6FA 3G1RA 4GNVA 1W56A 1QPOA 3CB8A 4L80A 1H09A 3CUIA 4UCFA 1SMDA 4HJFA 5DRIA 5EMJA 5HJYA 1EPVA 2WC7A 3Q37A 3TC7A 3ARPA 1H3GA 3GAYA 4Y9NA 8XIAA 3P61A 3LCLA 4CVWA 4QDMA 3KS6A 2QPXA 1A5OC 3XIMA 3B97A 1X1NA 1V03A 2QW5A 4LW7A 1NH6A 2X1IA 3CNYA 2DZBA 3AS3A 2Z7KA 1F61A 2UY5A 3GU1A 4MKNA 1SU5A 1AG1O 5T91A 2ZC8A 2DJXA 3W4RA 4Q6JA 3W75A 4XKYB 4LGXA 4PR4A 4HK5A 1H4PA 1NWSA 2GPTA 3SGZA 1XSKA 1MNSA 3VNJA 4WDTA 1H51A 2EEXA 3ITYA 1W8GA 3N6JA 4AHQA 4FR1A 2X1UA 5ABFB 2CU0A 3VD5A 1Q2SA 3T0AA 1FWNA 3QW3A 3R43A 2ZUUA 1TV4A 1DP0A 4HA1A 3WD4A 3GZ3A 3MVTA 3TXVA 1TJPA 3GKAA 3PZOA 5M17A 2YL8A 4JCMA 3KOWA 5BWFA 4V15A 4OBSA 2NX9A 3AS0A 1UYQA 3BTNA 1N8WA 3GO2A 2FFIA 2GUUA 1JYXA 1HFBA 4G9PA 2JKAA 2VCBA 1TIWA 4ZBCA 3DZ1A 2EBNA 2PA6A 2VXNA 1YXDA 4GJ1A 2OLSA 1VEPA 3KS5A 3N14A 4AXNA 1W5OA 4MZYA 4W84A 3RX2A 4GPNA 1JUEA 2X05A 3QTGA 3NDYA 2D1ZA 4FLQA 5CAHA 3D3FA 4AZ5A 3EX3A 1ODUA 4QDPA 4HNUA 5T8GA 3VCCA 4NZCA 2CHOA 4O8RA 1Z3NA 4Z2KA 5FESA 1KCKA 1WB0A 3A9BA 3L66A 2X40A 5KEZA 4MF4A 3G24A 3A3WA 3PZQA 4RW5A 5A6AA 1ISZA 2PTYA 4I90A 1HUVA 3OU8A 1THFD 2IPFA 1JCLA 4LYKA 1ZY9A 5A6LA 4NAEA 4WDUA 3LG3A 3WMLA 3ALFA 3GH7A 5BXPA 3C0LA 3MKVA 1DV7A 1YDNA 3I6EA 4E3VA 1TV5A 3I10A 2G95A 1IE7C 1RZMA 1H0GA 3LRMA 2Z1BA 2E9BA 2VWSA 4JIRA 1I2RA 3THAA 3VYLA 4L6DA 3VK5A 1PDZA 3M4HA 3EWBX 2X7WA 3RCYA 4GCXA 1HVQA 2G3NA 5MF5A 4DBSA 4TU1A 4IPNB 1H63A 3LLFA 1K7FA 2QJGA 4U5IA 4D1IA 3M5XA 2G5WA 2WNZA 1Q6CA 4CNNA 5CXPA 4QEHA 3HTWA 3PK7A 1DTNA 4WGXA 4OIFA 5T9BG 3GFXA 4AY1A 3LCGA 5FJUA 3LX9A 1EA9C 4JNMA 4WIWA 4PUEA 3OJGA 3XINA 1TVLA 5KETA 3L4YA 3GTNA 3T08A 1TSIA 3QMTA 3VGGA 2VOTA 4H1ZA 3UWQA 3W85A 1F2JA 1DEDA 4WOQA 1F5ZA 5CPOA 1LL7A 2OT1A 5D9PA 4MFDA 4LV4A 2H90A 3SQSA 3CB3A 4UB9A 3MMTA 1VR6A 4GZ7A 5I09A 4GZEA 3WK1A 5JMUA 2V5LA 3GNPA 3IAQA 1KTNA 2ZZ3A 4W89A 2C7FA 1PKYA 1D3HA 2XN0A 4U28A 1PWLA 3UA4A 4UOQA 2GK1A 3VZZA 1H7NA 4HNVA 1Q6QA 4MY1A 4AYGA 3RN6A 2PRLA 3PJWA 3ZWSA 2ZUSA 2FTPA 2QQ6A 3TDFA 1XLKA 1KBBA 3BMXA 3B40A 5FI8A 2OWXA 1OCBA 3LS9A 5EYWA 4P61A 4QLLA 3L4UA 2XZ9A 2PZNA 1EXBA 1SM9A 5I3JA 3HPFA 3IJ7A 1O5XA 4JQ3A 3ARTA 4CD7A 1R9YA 4X60A 2BVYA 4IFKB 1OABA 4AIUA 1V6WA 2PCEA 1WV2A 1IWBA 2RHGA 4GJJA 3RLVA 5AHEA 1LCOA 3VFCA 3OLGA 4KPLA 1NWRA 2GVGA 2ZCGA 3L65A 3T7VA 1KA9F 4K38A 1QRQA 5LXXA 2Y7GA 1CXIA 3UXKA 3SCRA 4KEVA 1XV8A 2VFFA 4XAFA 2E0PA 1P1XA 1XLEA 4MM1A 1KRAC 1D8CA 3MJMA 4G7EB 1RCQA 3VDHA 4HD5A 1DQUA 1V02E 1HT6A 1R2RA 3EX6A 3N34A 4C7DA 2YKKA 4UUIA 4IQJA 3O6DA 4LB4A 6REQB 3B8WA 3RM4A 2DFAA 1OINA 5AZ0A 4AVOA 3S9YA 4NYYA 4W85A 2VNCA 3PWIA 1OYCA 3C2VA 1GZJA 2MUCA 3KVMA 3V35A 4UOZA 1GG0A 3VABA 1D3CA 3P0WA 2YZRA 4AZ7A 3N18A 1P0DA 1YE6A 4GNKB 1JGMA 1VS1A 5LNRA 4YS1A 3FXYA 3B06A 1ZP3A 1IGWA 4QISA 4QAWA 2OU4A 1QPQA 3MZNA 4J3WA 5EB8A 5C2XA 4KERA 3SCTA 4EAMA 2XHYA 2YCLA 5A6SA 3S83A 3VI2A 1HO1A 3N2BA 4W7WA 3WG6A 1CT5A 3BOXA 4QG9A 4KQNA 4RE3A 5KZMA 2QJIA 1HZYA 1GCYA 4IGHA 4LPCA 2DSWA 3LTSA 1HJWA 1UOZA 4IWWA 2Y5SA 1LROA 1M7JA 2OTDA 4IGSA 3V16A 1GW1A 4PMUA 1TPC1 1E3ZA 4CQAA 1VC4A 2ASHA 3ZYZA 1S2VA 2R1KA 5G5IA 3DESA 4Q4OA 2ZTJA 4IPPA 1H41A 3IS4A 5DO8A 1NDYA 2INZA 4RDZA 3HGRA 4IMEA 3TOPA 1VQTA 3W27A 3RILA 3WJSA 5I3KA 3BAXA 3LV5A 1P0BA 2NUWA 2Y7EA 1EOKA 4XD4A 5KINA 3L4ZA 4XTIA 3PZTA 2UWFA 1HNYA 1KBLA 4Y7EA 4CCDA 4HPXA 2E28A 1XLLA 3IGUA 3P2VA 3A12A 3IGSA 4NAFA 2Y6ZA 4C6PA 3SN4A 3NGFA 3S6OA 3C5QA 5LIYX 4BR1A 1CXHA 1DWFM 1M7OA 2NZLA 3PJXA 2G4JA 4QBXA 2PD5A 3MSRA 4RNJA 1F05A 3AYSA 1TWSA 4L65A 1QBBA 4GVIA 1CYGA 2WKGA 5KSWA 4PMZA 2X8RA 1EC9A 3FKRA 1O5KA 4S3JA 2ZKMX 1DHKA 1OF6A 1W8SA 2ZTKA 1RQHA 1JULA 3GK0A 3U7VA 4Q4PA 1FWSA 3W24A 1LRTA 1UQYA 2EO7A 4ZOBA 3BJTA 5DBUA 3ONCA 1M9HA 1P6CA 3W22A 1GYMA 1OQFA 1TMHA 3UJ2A 4MMWA 4X9YA 2Z24A 3HMCA 3LXCA 3NOYA 1FBAA 4KFNA 1TMLA 2FH6A 1SSGA 3B03A 4KCUA 3CL7A 3CAQA 4UQBA 2ZDSA 3R11A 1RJQA 4DZIA 1NFGA 3P6LA 2GDVA 1TTJA 3PAJA 2OODA 3AYRA 1SR9A 3LM7A 3IV8A 3W7OA 1FVPA 3P0XA 4EXBA 4QROA 4IIEA 4JTDA 3WDIA 3RFAA 1PZ3A 2NQLA 4XD5A 5CGQA 1J4EA 3GXDA 3HPZA 4GY1A 1N7KA 3QTPA 3LCFA 3PFRA 3PZ9A 2NQ5A 3A6OA 4FSAA 4KT2A 2WBKA 1U22A 4Z1DA 1ESWA 2YX0A 1OFEA 2IKHA 3DYOA 4Z1CA 3W7MA 1SYTA 2PU0A 2WQDA 3EOSA 1G4TA 4OVXA 3R10A 3T0DA 3DI1A 3J7HA 1XUUA 5E9XA 3H2AA 1FP9A 3KOZA 3EXTA 4XUYA 3STEA 5CG0A 4GA8A 3O6AA 3SN0A 3SR7A 5XIAA 3FS2A 2C91A 2NQZA 4JD4A 3STCA 3GTXA 1OFQA 1JEZA 5F1UA 3GU9A 1JG9A 2QCDA 3QM3A 3KTSA 1XRFA 3W73A 1IT8A 2F6XA 3HV9A 4ZFCA 5EFDA 4K1WA 4C6MA 4LT9A 3B04A 2IMRA 4UZUA 3REQA 4A3QA 3KCJA 4O1EA 4F9JA 3CZGA 3PFMA 1AQHA 4PTDA 5A8MA 1CXLA 3WH6A 4W8LA 3GVWA 1BXBA 2OO0A 1UKOA 4EF8A 1A5CA 1E1FA 3QQ1A 4ZL1A 1SVDA 2XGBA 4V33A 1YPIA 2D0FA 1ZB5A 3OVQA 1UR0A 1Q6RA 5LXEA 2ZZ5A 1ITUA 5C9XA 2CWNA 3FVDA 3T4WA 1MRAA 4F48A 3DFYA 1PCKA 4WCJA 3SCSA 3MV11 4HZMA 1RAKA 4C6CA 3VGBA 1JJKA 2EPKX 3T78A 3N04A 4TO8A 3CUXA 4IJRA 1TRDA 4XIMA 1MQQA 2A85A 5TQLA 4AVNA 1O66A 1DBTA 4CQDA 1TTPA 1UR1A 4LAKA 3UY7A 3IV3A 4JDBA 1UWRA 1Y5XA 2CCRA 1H62A 2NLYA 1C3FA 1VJZA 3AXIA 1P6WA 4GIEA 1VAHA 4GGBA 2WZIA 3LYEA 2JALA 1T6MA 3WEMA 4I5RA 1KM3A 3NQ2A 4GQGA 3NYZA 3ABZA 1K9TA 2QIIA 1EF2A 4HSNA 2YDQA 3VNKA 3F7JA 3TYAA 1XIMA 3G6LA 2Q3OA 1E6RA 4PSRA 3CHCA 3ALGA 3VKJA 4CCEA 3CPGA 3SCQA 2QT3A 3W28A 1J0HA 3NXLA 3G3MA 1XIDA 1GKPA 1QT1A 1M53A 3SW6A 3E5PA 1UKQA 3SBFA 4HPNA 4IJBA 2HQAA 1XPGA 1FH8A 3T2QA 2I7GA 1QHPA 2HVNA 2Y63A 1TCDA 2CHNA 4FLRA 4CNUA 1PB0A 4HYWA 5EBAA 1MI3A 1YIXA 5FJTA 3TJIA 3ZJKA 3CUHA 3C2RA 4PCFA 3GVRA 2E4TA 1BYCA 2AKZA 1VFTA 1RY0A 4YTQA 3VKBA 5M03A 4JKKA 4LYPA 4OT7A 5F2MA 4DUVA 2YDSA 3S6TA 4GIRA 1EJVC 2JBMA 2CLOA 3W7HA 2R6OA 4FXJA 4IF2A 3EYPA 5K9DA 1PX4A 4GABA 3A4XA 3BCFA 4LVAA 2ZZ2A 1B30A 2GSJA 3GTIA 3UG5A 2Q3RA 5HQMA 2E8YA 3HGSA 3SUSA 1WDQA 2V5JA 1EDQA 1ICQA 3FK4A 1ZTVA 3BGGA 2VX5A 2WM0A 4JHOA 2LLEA 3WO8A 3NL6A 3W2LA 4MSSA 2O9RA 3WNMA 2VZOA 3DEQA 4UQCA 4ASTA 3M64A 3WJXA 4WF7A 5EMUA 3WFAA 2CERA 3ITLA 1EJTC 1ME7A 3T1GA 4AVFA 2PC8A 2V5CA 3BWWA 4H6RA 1TQXA 3DXIA 2ZWYA 5FEPA 4Y9OA 4KGLA 2QKFA 3W7LA 1GOXA 2QUUA 4EP8C 4UFJA 2Y5EA 2R9RA 4AF0A 2CEQA 3R0UA 1Z89A 1KFEA 2DH3A 3WD1A 1DQWA 1OCJA 1B2YA 4ERAA 1OFRA 5AVHA 1QPNA 3A64A 2ISDA 4GX8A 5F4XA 3HURA 3PZIA 4BK9A 4JTIA 4AU0A 5M5DA 1SFJA 4U31A 3M0JA 5TD4A 4RJEA 1ISYA 2ZX6A 4NP7A 4INFA 4ZFMA 2ZQ0A 3MB9A 1PKMA 4LB3A 1SW3A 1DVJA 3IJIA 3TTEA 5HATA 3WDHA 2FZMA 4X63A 2HPMA 4RNFA 1EWDA 3O0FA 1IWPA 4PN2A 3QXBA 3AIRA 5CH9A 2CBVA 4DNHA 4IT1A 2VVNA 3DHDA 3WLPA 3CPUA 1JUBA 4IPLA 5IOBA 1A50A 2YL9A 1H50A 1BKSA 3SRDA 4ACZB 4LVBA 3DC8A 3FJ4A 3KP0A 3GX9A 4H7CA 1EJ7L 4Z08A 4LVFA 1KM5A 5TBOA 4DNMA 4UMAA 1HP4A 2FDSA 1L9WA 3R6IA 2YXXA 3GYEA 4PUNA 2WSPA 2WJFA 2YYTA 3MP3A 1GEQA 1E6XM 3Q45A 1LDCA 3TV8A 4LX4A 2EG6A 3BH4A 4F4RA 4O52A 2WWCA 1TR1A 4DF1A 3GVGA 4U3CA 3ZQ9A 1F6KA 3GNXA 1RD6A 2ANUA 2CBIA 1LQAA 3C3NA 2ZRXA 3FJ6A 1C9DA 2FLIA 2NXIA 1LWIA 1TZ7A 1WDPA 5D4YA 2VHLA 2AL2A 4JTTA 4GFSA 2D2OA 1GOIA 2E8ZA 1RPXA 2VP8A 1ZFJA 4ADUA 1AH0A 1WDRA 4NI8A 1BRLA 1H2JA 1XH2A 5I0DA 3N4AA 1HKKA 3JU2A 1KKOA 3FYYA 3H7UA 3WDRA 5BRQA 1UQZA 2OQYA 3QHOA 2BY0A 3LM3A 1C29A 4MDPA 3WMSA 1S5NA 2ONEA 3CQJA 4IIHA 2D0GA 4C5ZA 1PYMA 3BW2A 1J2WA 1RR2A 5L6UA 2BB0A 4AWUA 5LZLA 1VKFA 1MDLA 5C2CA 3VKKA 1UPMB 3M0IA 2DW7A 1X6LA 1VCVA 3O7UA 4QLJA 3EA2A 1WOBA 1K9EA 1F3TA 3UT0A 2WZMA 4OU1A 1AH3A 3AXMA 2GUBA 1EGMA 1XIHA 5LIWX 3N17A 3W00A 3E74A 4ZSTA 1X1ZA 1J6OA 1S2WA 3BCDA 3B8IA 2FHFA 1V08A 2PODA 2GSEA 5AYZA 3TYBA 3INPA 3WUBA 2PDXA 1VFMA 3DENA 4NJJA 2P5NA 5A1AA 3NA8A 3U6WA 1VRXA 2VI0A 4QGCA 5FA5A 1I0BA 2R1MA 2VJXA 3AXHA 3TC3A 5IHRA 3GVQA 3MMDA 2UY3A 1G69A 1R0MA 4K8GA 4MFEA 1VPYA 3NG3A 2X7VA 4DO4A 3WQFA 4M19A 4AUBA 2WVVA 1DHPA 4HHLA 3CMJA 4LUIA 3L0KA 3VMOA 5FF7A 4QP0A 3KTXA 1W9UA 1LQ2A 4DM1A 1W2PA 3HQ1A 1UIOA 4S1FA 4MJZA 2XUCA 5LIKX 3AFBA 2J9ZA 3TXZA 4QSHA 3B4YA 4EIVA 4PUMA 3USZA 4AC1X 3KRSA 4QFUA 3ARZA 1CEOA 3LB0A 5CPSA 1K8XA 3V36A 3BAYA 4I5UA 3VNZA 3PPGA 2P1FA 5T26A 4GUFA 4NZ5A 1DTUA 1R6WA 1A0CA 1W1TA 3LUTA 3R79A 4US6A 2GDUA 1I0DA 2HCVA 1KWGA 3UY8A 3IGXA 2Z29A 1S3HA 1Q3NA 3WBAA 1UH2A 8RUCA 2HPIA 1EHAA 3R1ZA 3CU2A 2A1YA 4ZQRA 1DXFA 5E70A 1I2OA 2PGRA 1LWJA 2RDTA 3B05A 2VL4A 3PTQA 4N6FA 1BWKA 3RPTA 3KRUA 1LG1A 4XB3A 3CH9A 3DKJA 3BOLA 2TPSA 3GXPA 4EKJA 2D3NA 4HK6A 4B91A 3BL3A 3WBEA 3VOHA 1ZSXA 4B2DA 4AD3A 3TK7A 1CLVA 3WH8A 4C91A 4H83A 4FX8A 3H21A 2J75A 4I6KA 6CGTA 4DHGA 3GXMA 3I3DA 4O28A 3MBFA 3SCPA 4DZAA 1GKRA 5EMLA 1GJPA 4KCTA 2QV5A 2XFFA 3DECA 1VEMA 1XM3A 4LCQA 2NX3A 3W7QA 3DG7A 5EGRA 3VIHA 1QHZA 2BWGA 1XC6A 4JIQA 4MVAA 1OFDA 3ZR6A 3TQPA 2ODOA 3NJ3A 1REQA 1VBGA 4ILSA 2QDEA 3UJEA 5DANA 3SCWA 1G94A 6XIAA 1HKJA 4L56A 2JGYA 4UNIA 1GVQA 3TA9A 2ZX5A 2OQHA 3WUGA 1QHOA 2ZVIA 3WH9A 4NX5A 3S9ZA 3M07A 5C54A 3GW3A 5BMWA 2ZC1A 3WZ0E 2GZXA 4GUIA 4OTKA 4IFKA 2E68A 1ZNNA 3BPWA 3VO0A 3H2FA 1I45A 1PJ9A 3LD5A 4CN1A 4D8AA 4XX6A 1WDWA 2PGFA 3QPEA 5A8GA 1TPDA 2J8GA 1ELSA 5CZJA 3PM6A 1OG6A 1RH9A 2OSWA 4YXGA 2NXHA 2VC5A 3UZXA 1FDZA 3DBNA 1LBMA 5A8OA 3EDFA 3BQ5A 3QY6A 1S2UA 3N9KA 4ADSA 1MZRA 3F4DA 3I65A 3VNMA 4XAZA 3W7NA 3IRDA 1TV7A 1MW3A 2VO5A 4DJFD 4G7EA 2DGAA 1KFJA 1CLXA 2CXGA 3KFTA 2HV5A 3CT2A 3W1MA 3KTCA 3P3BA 4DBEA 3O8AA 3U2EA 2Q8LA 1YEYA 3DFPA 3FYPA 3DFQA 4ZR8A 3OYXA 3PF3A 4G2DA 3E96A 4NKCA 1DWGM 1WAUA 1H60A 4FX7A 2P76A 1BKHA 1UWIA 4LUJA 4N9EA 5L9FA 3QV8A 1OX5A 4ZE4A 2XFWA 1YKWA 5TNVA 3BCJA 4WY0F 3H2OA 3A21A 1CCWB 4C7GA 1TPFA 2YYUA 2ACSA 2ZVRA 3N3MA 4XZ9A 3HG3A 3TCEA 1ADDA 1CLKA 2E6AA 1K02A 1MUWA 1CGWA 3V3WA 4GI8A 3XISA 1E6QM 3F4CA 2PTXA 1QNVA 1R3WA 3HB9A 2ATMA 1MUCA 2FZBA 1E0TA 2WANA 1A5KC 3LBMA 3LXBA 1OFAA 5ECVA 4XSMA 1AH4A 2OO6A 3T55A 7TIMA 2OX4A 1KV8A 2J62A 2FGBA 3H2EA 3IIPA 3LCWA 8CGTA 2O9TA 2AGTA 1LTDA 2ISVA 2Y89A 1YMYA 4O4WA 1EWEA 3H7RA 2BZNA 4AFYA 1KGXA 1M1BA 2O56A 1W9DM 2I5IA 2X30A 3KM8A 2XFYA 1G4EA 2EPMX 2QGHA 2O7QA 2PDMA 3L9CA 3L4VA 2POZA 1BVWA 2V2HA 5G1MA 3B8UA 5CGMA 1R46A 4BF7A 1NQ6A 2ZUTA 3RNDA 1MEHA 3HGJA 4ATLA 1NOWA 5LKYA 2CZFA 3WJZA 3GR4A 3HPSA 3D3AA 3RU8X 4JICA 1YNPA 1KXVA 4POCA 1EIXA 3N9RA 1E4LA 3LN3A 5DLCA 1TKKA 1KFWA 2A4AA 3SCVA 4UOJA 2P53A 4MAVA 4GH3A 3I6TA 1CBGA 2YA0A 3W84A 3KOXA 2WVTA 3E0FA 1OJXA 4AIOA 3O05A 1JGIA 4KBXA 3RR4A 2NVAA 2ZRYA 3L4WA 4MNJA 4PC8A 4X2PA 5HINA 1BG4A 3EA3A 4S38A 4ORMA