5CGQA

Crystal structure of tryptophan synthase from salmonella typhimurium in complex with f9 ligand in the alpha-site and the product l-tryptophan in the beta-site.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Crystal structure of Tryptophan Synthase from Salmonella typhimurium in complex with F9 ligand and the product L-Tryptophan in the beta-site.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
total genus 101
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cgqA00
5E93A 1LLWA 1FDZA 1KM0A 5BRBA 3PUEA 2V2DA 2AGKA 4E2BA 1TYGA 2ISSA 4IPJA 4JX6A 1AW1A 3CTLA 3LLDA 4M19A 4MPQA 3P60A 1RQHA 4OGZA 1ZAJA 4KWVA 3UYCA 1FUYA 3U6WA 1IXOA 4BR1A 3TSBA 3W88A 4UTTA 4CQAA 4AAJA 2A6LA 4M6VA 3FIGA 6TIMA 1GJPA 3SY5A 4FIRA 1TJPA 3S1XA 1S5TA 4Y6GA 5FF0A 1YXYA 4Z08A 4UTHA 3STCA 1LROA 4FXSA 5T26A 1T8XA 3PG9A 3IIZA 5HWJA 5AC7A 3P74A 1QO5A 3MW7A 3QC3A 4IXHA 3F4WA 3W7EA 2WNQA 4FNPA 2RDUA 1K03A 4NQ1A 1EB3A 1W3IA 2BXVA 5BMXA 4AMAA 2ZA2A 3O63A 4MLJA 1FCQA 4DELA 1HTIA 3GLCA 1LZOA 3LTPA 5AHIA 1OX4A 5LSMA 4Z0SA 8TIMA 3NL2A 3W2JA 1OYAA 2FIQA 3G1XA 3CM4A 2QCDA 4UR7A 2Y63A 2YGYA 4AB4A 3DZ1A 4H3DA 1TTQA 1R47A 4MVAA 2C15A 4ADSA 5I3JA 4CQ9A 3KVLA 3W7IA 3MHFA 1TPH1 3O6DA 2PURA 5H2ZA 1T96A 3LV6A 2ISVA 3DBPA 1YDNA 3K30A 4XUGA 3KVMA 1X7FA 4NNBA 5I3FA 4UTKA 1LBMA 1M7OA 2E09A 3INPA 4O57A 4AXKA 5KZMA 1PIIA 4QAIA 2VEMA 3SR7A 3W1NA 1KBJA 4IMFA 2FDSA 4O4WA 1H51A 4KKXA 3RMJA 3M6YA 3F4NA 1OFRA 1ZENA 2ZTJA 1VQTA 5EA9A 2Z2UA 1KFJA 3E12A 5HJLA 1XCFA 1OFBA 3QPYA 1EPXA 1LRQA 3C6CA 5AC8A 1OF8A 3S6DA 4PODA 1R2SA 1FXPA 1B3OA 1X8FA 4K36A 2TYSA 2Q3OA 3QW3A 4R53A 2FB3A 3A21A 4JX4A 2ZFAA 3PR2A 2H6RA 5DY3A 3N73A 5EMUA 4H6KA 3PY2A 4E38A 3DGRA 4JGDA 3IVUA 1HUVA 1GOXA 6ALDA 4AVFA 1W54A 5LHFA 1W37A 3D0CA 4FO4A 3QMTA 3A5FA 2CU0A 2RKXA 4M6PA 5FEZA 1Q6LA 4PL2A 3KHJA 4WX2A 3E96A 3TH6A 4ZQCA 4RK8A 3R89A 1WYIA 1GVFA 4LRTA 1PCKA 1NEYA 1Q6QA 2E6YA 2PRHA 2A7RA 3QQ0A 1WA3A 1PE1A 5DXYA 1W8SA 4OT7A 4LUJA 4RJEA 3GDMA 1T0OA 3NQ6A 4UXDA 2RHGA 2ZRXA 3U8GA 1TPEA 2PCQA 2X1SA 3G1AA 5F2IA 1DL3A 2FQIA 1YLVA 1KTNA 1QOPA 4IQLA 1LOLA 1GVRA 2ZZ1A 1XDLA 3FYOA 4IMEA 3MMTA 3T78A 1FCBA 3NQFA 2XN0A 4JD4A 4LC8A 1K8ZA 4FX7A 3KVJA 2ABBA 3NM1A 3QH2A 1TPDA 4O1CA 2YX0A 2E5DA 4JYEA 1H62A 1F6PA 4PTNA 1GEQA 1YXDA 2ZRVA 3W07A 5AC6A 4Z0JA 2YSWA 4LUIA 4WOZA 3DFTA 4QISA 3NYZA 3TV8A 4EF9A 1OFQA 4UCGA 4QM1A 3PC0A 1HG3A 5F2GA 4M6QA 1YADA 4HIBA 4Y90A 1JCMP 2C0AA 5HWMA 1LORA 3GVGA 2J9XA 2CZDA 3P80A 3HPXA 4CCEA 1P4CA 3DH7A 3W7KA 3HBLA 3W3OA 1SZFA 3H54A 4GUHA 4JY8A 2ZZ2A 7TIMA 2H8XA 2ZZ3A 1N55A 3FA5A 1EIXA 3R13A 4DO4A 2FTPA 2W0UA 2BSLA 3GAKA 1SO5A 3LDVA 5D02A 1QO2A 4UTJA 1F6KA 3W1TA 2CLEA 3DI1A 4UFIA 4UTUA 1A50A 1QWGA 1M5WA 2GQ8A 5I3HA 4IJBA 4DQWA 2CLFA 2JK2A 1K7XA 2E6AA 2YW3A 1UASA 3L0KA 3ZWSA 4W9TA 3HG5A 2YXGA 1TPFA 3KFTA 4MFDA 3S0CA 3H55A 2A4AA 1P0KA 4U4MA 2ZRZA 4I9AA 3TROA 3W72A 1XUUA 1KFCA 1VHNA 1DKWA 4DF1A 1SO3A 1Z42A 4ONVA 2Z6IA 1KV8A 3B0PA 1O60A 1TQXA 2NUXA 3LHZA 3O6CA 4KFPA 2GJLA 1PV8A 3W86A 5LNSA 4UMCA 1H7OA 4EOUA 4XBKA 3IEBA 4ZL1A 2QAPA 4NXSA 3KXQA 2H90A 4N9EA 3MP5A 2P10A 3C2OA 5KZEA 3W75A 2A85A 3E9AA 5F1VA 3W1XA 4LRSA 3P67A 1ICQA 1RV8A 3B03A 3TMLA 2QKFA 4O18A 2V2HA 2Y70A 3W7HA 4A2SA 1QAPA 3KX6A 4IUOA 4O53A 1VR6A 2DZPA 3BV4A 4K37A 4EWND 4JTHA 3HGSA 2YR1A 4FNTA 1QOQA 2R91A 4CNOA 2E6DA 3M9YA 4TX9A 2R94A 5F2MA 2VEPA 2VC6A 3GAYA 2V2CA 4K39A 1IIGA 2YCEA 3LBCA 2JKPA 2YDAA 1VCVA 2ISWA 2QCNA 2WOQA 2QCMA 3LRMA 4R33A 1JCLA 2C19A 3IIPA 1LCOA 3W7JA 3IIVA 2PE4A 5HR7A 5FF7A 2E5BA 3M44A 3BG3A 2ABAA 3S9YA 1R2TA 2QUUA 3FEMA 3ZS4A 4GUIA 2GVJA 3O16A 3N14A 4O15A 3QJAA 3A23A 3EEGA 1QMLA 4HKPA 4UMAA 5AOUA 1TREA 2Y85A 1OFPA 2QCFA 1FDJA 5CPOA 3LCGA 2PRLA 4B5NA 1EUAA 2KZHA 3G3DA 3TQVA 4OU1A 3DHDA 5LKYA 1W3NA 4GUGA 2ZRWA 5L9FA 2Y7EA 1DJQA 3SSJA 2EHHA 3FJ6A 3LXCA 5AHFA 3HJZA 1HO4A 1JCXA 5D2XA 1KV5A 3B06A 1JCJA 1A5BA 2PC4A 2QCEA 2QUTA 1F73A 4R34A 1OF6A 1CW2A 2B7OA 1JUBA 1L6YA 1X1OA 1JULA 3EXTA 3TJLA 5KSWA 5CZTA 3F1QA 2NUWA 2LLEA 2NV1A 3NL3A 2PRMA 3ANYA 3PULA 3TQKA 2J9YA 2ZRYA 4PC8A 4GRSA 3HGJA 4R7JA 1AG1O 2QUVA 3NQ2A 4HNTA 1F2JA 1C9DA 4O1BA 4RZ5A 3PB0A 5CSSA 3IGSA 4DBEA 3M47A 4AHPA 3QW4B 3WJXA 4N9CA 4MYAA 1OFEA 3RNDA 1I2PA 3TNOA 1DQXA 5A5WA 1PHQA 1W31A 5CSRA 1V5XA 4NVTA 1TPWA 4A2RA 1KFKA 2X1TA 4TO8A 1KM5A 1NVMA 4RZ4A 2GVGA 5AHEA 2Y89A 3NOEA 1JQVA 4D2JA 2ZTKA 5DXXA 3EX2A 1KBIA 3TSMA 4PL1A 5K4XA 1W56A 1TRDA 2YW4A 3HO8A 5G2HA 1N8FA 4FF7A 5CZJA 4I7VA 5C5YA 4WOQA 1SUXA 2CLHA 1R2RA 5F4XA 4MOZA 1OX5A 5EKYA 2C18A 2NX1A 2OT0A 4OE7A 2A5HA 2NX9A 4HHPA 3SGZA 3EB2A 5DCBA 1FWWA 2DJXA 1AW2A 3NL6A 3G3MA 4QJ1A 5CKSA 3GXPA 4JY9A 4QNWA 1PHWA 2CZEA 2W6RA 3BLEA 4FNRA 4MZYA 3V1PA 3CU2A 4IX2A 4RLIA 2A7PA 1KM2A 1TMHA 4NJIA 3STEA 1QCWA 3GYEA 2QJIA 1Z48A 3VE7A 5F4WA 5LGZA 1TTIA 2VFEA 3LB0A 4P2VA 3NM3A 3P82A 2FPTA 1OFDA 3TX9A 4NX5A 4JDBA 3QFEA 4A22A 3NZ1A 1S5WA 1WAUA 1BKSA 1GZGA 3PWAA 2VFGA 3BK0A 4NT0A 4ORIA 4L4LA 1YTDA 1GVQA 2C13A 1FQ0A 1GYNA 4WJEA 5SWUA 1J5TA 3N2MA 1FCVA 3WJZA 3SFKA 4EVZA 2Y62A 1ZCOA 5DN1A 3GNNA 5K3VA 1ML1A 2JKAA 1EUNA 3GZ3A 3VE9A 2J6XA 4WZHA 4WD0A 5LHEA 4NZJA 1ZY9A 1VRDA 1P1XA 2X2GA 1XBXA 2I14A 4QITA 4WY0F 3Q94A 3PS7A 4QNEA 1H7RA 5E1QA 1L6SA 4IX0A 5HNRA 3MHUA 3CPRA 3DFSA 2EAWA 1WV2A 3NPXA 3LOTA 5G1TA 3QMRA 5D2VA 3W7DA 1Q3NA 4JIPA 4GFSA 1D3GA 2WSYA 1SFLA 2CLOA 2XN2A 4ML9A 1I2QA 2CLMA 1AW5A 1KFLA 1F76A 5F4SA 3M43A 4RZ6A 5EY5A 4HPXA 5G2IA 1XKYA 2ZDRA 5G2WA 3C4UA 3MP4A 1RQBA 3FOKA 1W5NA 4HPJA 4UFLA 3LCLA 4UTLA 1OYCA 3S42A 3SW6A 2QCLA 1H50A 1EEPA 5FF3A 3UXDA 3VFLA 3B8DA 1V7YA 5AFDA 5KITA 4K8EA 3PBWA 1YPFA 3MI2A 3S8HA 2HMCA 3DKLA 2VOMA 5FI8A 4FHAA 1TPC1 4NJKA 4GUJA 4S2BA 2EF9A 3CB8A 4TMBA 3LCFA 1JVNA 1QPNA 3KAOA 2QEZA 4E2DA 4UTTC 1FCUA 5FEPA 3PG8A 3IRDA 1QPQA 2VELA 4J9JA 3TFCA 2F84A 3HG2A 3FYPA 1VC4A 1DORA 4TIMA 3TC7A 1T99A 2FLIA 1LBLA 3THQA 2QJHA 3U2OA 4NU7A 3NG3A 2V5BA 1OJXA 4AWSA 4L4MA 5K4ZA 4UFHA 5DBUA 3E02A 3EX1A 3W7OA 3CWNA 2NXIA 4JNMA 3L67A 1SO6A 2IQTA 3M41A 4ADTA 1B57A 4UC5A 2V5LA 3EKLA 1WXJA 2ZZ6A 4DPPA 2FPVA 4JTFA 3BW4A 3L5MA 3LHUA 1K3UA 1OVDA 1RR2A 2QF7A 3DXIA 3G8RA 4UTWA 3EX4A 1O4UA 2FB2A 1X6UA 2Z6JA 2YYTA 3C8FA 4O14A 4O12A 1SFJA 3CEUA 1K7EA 1YXCA 4GBUA 1I4NA 3WK1A 2E1DA 1L6WA 4MZ1A 5FESA 1H63A 1K02A 5IBXA 2NLIA 2WJZA 5D38A 4XWUA 3W85A 3O15A 4NJJA 5HR6A 3OBKA 1SPQA 5HMSA 1KTCA 4UR8A 3GX9A 3HOJA 4JEQA 2DJLA 3N3MA 2V81A 1E51A 4Y8FA 1DBTA 3GXTA 5CPLA 3TR2A 3DENA 1KA9F 2NWRA 1SQ7A 4JICA 2ZZ4A 1OG0A 2ZA3A 3O06A 3HGOA 1OYBA 1H7PA 1K8YA 4HSNA 4ZQPA 3UY8A 4X22A 3GR7A 4FB7A 3P84A 4AF0B 3HMJG 3C0JA 2QJGA 4UTWC 1TO3A 3NQDA 1FWSA 1ZAHA 5BOOA 1ZFJA 2I1OA 1KFBA 2X1RA 1YTEA 1G7UA 4JTEA 5E0KA 1KLZA 3EWUA 3RU6A 2GPTA 3WK3A 1JJKA 5G4WA 3TE9A 1RZMA 4N9DA 2B0MA 1ME8A 3NR0A 3LHWA 4JN6A 4TU1A 2RDTA 4MY1A 4QQ3A 3PBVA 5CPMA 3QSTA 3PM6A 3W6YA 5DELA 4A3UA 1FWRA 2YYUA 1Z44A 2W79A 3UWZA 5HWNA 5FEXA 1OHLA 1LOQA 1NF7A 2CLLA 3LRKA 4JS3A 5EYWA 2OJPA 3Q37A 2HS8A 2B7PA 4DO5A 4LV4A 1WDWA 2BWGA 1Q45A 1GTEA 3BW2A 3G1FA 2V9DA 5K9DA 3ABRA 3W84A 2A7NA 4LVFA 5HQEA 1D3HA 3W70A 3E0IA 4OQVA 5D2YA 1KM4A 2CFFA 1SW7A 3TIMA 4ZQNA 1MSSA 3CEPA 4QSHA 3P61A 3T40A 5C54A 3ABQA 1LM1A 4DO6A 4Z1AA 4WY0B 2CZ5A 4JYDA 3HPSA 3TC6A 1G6CA 1XM3A 2TRSA 1UBSA 3PF3A 1ZJIA 3THAA 4NXKA 1MEHA 4U28A 3PVFA 1AK5A 2EGZA 3TMQA 2DU2A 3NQGA 1Q6RA 5MHBA 2R14A 4WXYA 5H91A 2OCZA 4O0ZA 1KM3A 5HULA 1VYRA 2XN1A 5J5DA 3QRHA 3EX6A 3LRLA 4RXGA 3T55A 5LNUA 4ZMGA 5U4NA 1AL8A 3HQ1A 1QR7A 1IXQA 3B4UA 2J24A 4O19A 1I2RA 2VXNA 1GYLA 5LNWA 1H7XA 3PAJA 1ZNNA 3MHGA 1J2WA 4NUWA 4MYXA 5CGQA 2Y7DA 2WSQA 5KMYA 5KINA 4NNAA 4PEKA 4RX0A 3HB9A 3MYPA 1GTHA 1VS1A 3ZR4A 4CCCA 4X3ZA 4C1LA 1CI1A 1A5AA 3RLVA 1QNVA 5FF4A 2O7QA 3BPWA 5AYYA 1GG1A 1LRNA 5AYZA 3BLIA 1VZWA 3N2XA 3NO5A 1I2OA 1DOSA 1Z41A 4O17A 3B0VC 2ZCGA 3N9RA 3WJYA 2JKEA 2A1YA 2AAMA 2DZVA 2NV2A 1OX4B 3UWQA 4LS1A 1XL9A 1W5OA 3NNTA 4PFMA 3W22A 2GJNA 1LYXA 3HG4A 2DP3A 3I68A 2WSRA 4LWWA 3TAKA 1WQ5A 3P7YA 3M5XA 2A2IA 3NQAA 3I65A 1FBAA 1LP6A 2R8WA 4QIUA 1VYPX 4BI5A 4BI7A 3IVSA 2NXHA 3NL5A 4BK9A 2CLIA 5AN7A 1NFBA 3DHFA 3ZWTA 3STFA 1L2UA 5D04C 3L0GA 4JTKA 1VLIA 4KWWA 4MLRA 2Z0IA 4UIOA 1IF2A 3N9SA 1DJNA 5G4EA 4UFJA 4Q4KA 1TQJA 4O11A 4JTSA 1W5QA 4M7TA 3G1SA 5DLCA 4AWTA 3OIXA 3LHVA 3LBMA 3NAVA 2WKJA 3ABSA 4O0KA 1G4SA 1UJPA 3Q58A 4WXZA 3VCRA 3NQEA 3W7MA 5J5RA 3G1VA 3M5VA 5KZDA 3ELFA 1WBHA 3G0XA 3A5VA 4MY9A 4BWLA 3S1WA 2V8ZA 3OEXA 1C29A 3BLFA 5BMWA 2X16A 4GE8A 4OWGA 4DEFA 3MJYA 1XBYA 3QEZA 4WQ6A 4RV8A 1EWEA 3DFNA 1OX6A 3CHVA 3QYQA 2C3ZA 3SIZA 3AJXA 1SSDA 4XTDA 3W76A 3HG3A 4IXXA 1PS9A 5LGXA 4FIQA 1BWLA 4O8RA 1AMKA 2J9ZA 5AHLA 4YMZA 1M6JA 4MIMA 1H1YA 5K9CA 3A9IA 3CWOX 3TXVA 1VJIA 3IIOA 1YDOA 1LRTA 1W1ZA 1K7FA 3OVRA 2GVLA 3M0ZA 2NXGA 1VPXA 3ZFHA 1XBVA 5L6UA 3BO9A 3B0UX 4XQ6A 4O10A 5K2ZA 3L9CA 4DPQA 5I3IA 1W3TA 2CZFA 3KRUA 1G67A 1OFOA 4GC4A 3MP3A 3FS2A 1C8VA 3W2UA 2P0OA 3FKRA 4CLMA 1THFD 4JTIA 1G4PA 1TV8A 3G0SA 1YTKA 4AF0A 1HL2A 4YXGA 3G1HA 1EX5A 3EX3A 2QCGA 3LGEA 3W7RA 5FF2A 2ALDA 4JTGA 4LS0A 5TQLA 3ATZA 1QPRA 4NNCA 1YPIA 3UZ5A 2P1FA 4LV9A 3BG9A 4ZQMA 1XFBA 2FFCA 1TIMA 4S2CA 1NSJA 1JCYA 3STGA 3HPZA 3GKAA 4MJMA 5I3GA 5TBOA 4M7SA 5ABTA 4JTLA 5LZLA 4JX5A 5LNRA 3HF3A 4ORMA 1LBFA 1FWNA 3DFPA 2WNNA 1GVOA 1YYAA 1H1ZA 3LI1A 1XBZA 3S5YA 2WNZA 2VFFA 4LU0A 4RXFA 3MBFA 3PUOA 2DZTA 4N6EA 3JRKA 1YDVA 1WX0A 3BW3A 1I45A 1EP3A 3B04A 3SJ3A 2RDWA 1GVSA 1KW1A 3NQ8A 2NUYA 3IIXA 3TQ0A 1KFEA 3R8RA 1RPXA 3R5EA 3I7QA 2G5WA 2WQPA 3L2IA 3LXBA 1TB3A 1XC4A 1F7BA 1ZALA 5D37A 3GR8A 3MYOA 1S3HA 1FY6A 1IXNA 4Z1DA 4NJHA 2Y61A 4BF9A 3O6YX 2OT1A 3OVQA 2C6QA 1B4KA 1ZAIA 1FDYA 3W71A 5U7SA 1ZHAA 1HFBA 1D9EA 3USBA 3UWVA 3TKFA 2Y7GA 2RFGA 4O52A 4JIQA 3W83A 3O05A 3QMSA 4N2YA 4DF0A 3C3NA 4FEZA 4ZVJA 3QPZA 3TFXA 1LOSA 3F03K 4K38A 3PB2A 5F1UA 3S5OA 1KTBA 1NAL1 4K7VA 1GT8A 5DCDA 3NA8A 3TXZA 4MY8A 2VFDA 3T4CA 1I2NA 1RQEA 1XUZA 4N9BA 3SECA 4JXCA 4AWUA 4PCFA 1SO4A 3MBDA 3UZJA 2H8ZA 2BX7A 3B05A 5KTLA 2NWSA 2Y88A 3R12A 1TRIA 4UTIA 3S5NA 5D30A 3CIWA 3PSVA 3BVJA 1JUEA 3HIJA 2DZWA 4BI6A 1UUMA 2QDHA 1O5KA 2C1HA 4LY8A 2HTMA 1TPB1 1SW0A 1AL7A 5EL1A 3LHTA 1J4EA 2DZUA 1S5VA 3EXSA 3IVTA 3WJSA 2NX3A 1I8JA 3LTYA 3M16A 1SU5A 2VFHA 2I9EA 2E68A 4AEOA 3CC1A 1F05A 1OABA 4XTIA 3YPIA 2B7NA 3OVPA 4O1AA 1ONRA 3W74A 1XI3A 4DF2A 1NF0A 4FNUA 3WK2A 1FX6A 1QFEA 3GDTA 5AHMA 4GXMA 4Q33A 3RLUA 3C52A 5CG7A 5EBUA 3LLFA 4OV4A 3ABOA 1G4EA 4UMBA 3VKJA 1TV5A 4DBDA 3LI0A 3W1QA 1UCWA 1BTMA 2JGQA 3RFAA 3KRZA 1WBJA 3DU0A 4FNQA 4O28A 5AHNA 4GWEA 3NVTA 3MI6A 1W5MA 1IIHA 4NZFA 3QQ1A 2ATMA 2ZA1A 2E77A 3W7CA 3P5ZA 2HSAA 4POCA 3LM7A 1VGAA 1W5PA 1O5XA 5D05A 3MO7A 1O94A 3PBYA 3G18A 2YZRA 3TUUA 2QCHA 1VYSX 3W23A 1TPVA 2AQWA 3S1UA 5CZSA 2B4GA 2RH9A 2GOUA 3TJXA 3NPVA 1LLZA 2BTMA 2Q8ZA 4MKNA 1H7NA 1RVGA 4XZ9A 5D32A 2Q8LA 1L9WA 2CWNA 3E49A 3EKZA 1ICSA 1SW3A 2F7FA 2OZ0A 4O1DA 4N02A 3NZRA 3TCEA 5D33A 3CQ0A 3VNDA 3P62A 4AHQA 1K8XA 1ME9A 3JR2A 3WFAA 4TR9A 3FJLA 2UV8G 5I3KA 1H60A 4LC6A 4Q32A 3M1ZA 4FX6M 2ATSA 1GWJA 4X2RA 4RKAA 1WOBA 3NPUA 1TTJA 4JTTA 1MXSA 2Z1BA 3G1DA 4O50A 3DKJA 3L5LA 1EP2A 4CNPA 1PL9A 3M5YA 3G1YA 4CCDA 1QPOA 4MUZA 1JRBA 4CQ8A 3BGJA 3NQVA 1ICPA 2Q3RA 3QF0A 4XKYB 3W87A 1M7PA 4A21A 3FFSA 1TSIA 1SZGA 1TTPA 3L65A 1OK4A 3W7QA 3C61A 1FXQA 1SR9A 4K7YA 5IBXC 1KLYA 3SI9A 3UPBA 5K9XA 3GDKA 4X9SA 1JR1A 1VCFA 3IGXA 3P8IA 4UUIA 4Y9AA 3W1AA 3GIYA 3SZ8A 2VENA 3C56A 1ME7A 4LVBA 5F2LA 2ZZ7A 3EWYA 3O1NA 4H4IA 4ICNA 3W2NA 4LT9A 1OK6A 4N4PA 3TK7A 1DV7A 1ALDA 4IPIA 4RR4A 4IMDA 3EWWA 2A6NA 3N19B 3Q2DA 2GQAA 4OV9A 4LVAA 3UWWA 4EF8A 1U83A 2ZQ0A 2GUUA 3EWZA 2DORA 2C16A 4HNNA 2X30A 4JDYA 3LX9A 3MWAA 3LCWA 4S1FA 3GNDA 4YL2A 5HUOA 4FX8A 2JGYA 1LTDA 1R30A 1O95A 2FPYA 2A0NA 2V0TA 5DY2A 3UWYA 5LNVA 1B4EA 1UUOA 2NZLA 4HSOA 4IMGA 1P0NA 3TU9A 4IWWA 3UQNA 1EWDA 4YWIA 1IGSA 4P61A 3WK0A 3C2RA 4YCPA 1TCDA 1G4TA 3H53A 3LCIA 4G1KA 1H7WA 4FNSA 2HS6A 5G5IA 1U5JA 3L68A 3QM3A 3LTSA 2EKCA 3QZEA 3W2MA 1ADOA 1TPUA 1TJRA 1EA0A 4BFAA 2BLEA 3MI3A 1VH7A 4IGHA 1GPWA 3NGJA 3W1MA 3BGGA 1H61A 4I7WA 5D03A 4O4VA 4JTUA 1R46A 2J88A 3GK0A 4YLWA 4UTMA 3LHYA 4A29A 2WV8A 3TW6A 2EPHA 1X1ZA 2DZXA 1IXPA 1WOAA 3PUDA 2OMAA 3G22A 3W1PA 4UNKA 3C2VA 2G97A 4LNYA 2QCCA 3GKFA 1N7KA 3GDLA 1FWTA 2V82A 3KRSA 1TV7A 3OHIA 3TA6A 2WPBA 3CT7A 2QR6A 4JTJA 1DVJA 4AHOA 4OHQA 4HT3A 4ADUA 2DZSA 2XFWA 2QCDB 2ZZ5A 3SGUA 3N34A 2TPSA 3NQCA 3NEVA 3LCXA 1BEUA 2TMDA 2CW6A 5FEWA 1G7VA 4N6FA 1HO1A 1XDMA 4ZQOA 3W7PA 2Y7FA 3DFQA 5DCEA 3T44A 2JBMA 4Y96A 3BARA 4K6AA 5A8GA 3UPWA 2E6FA 3RF9A 3UY7A 5D2TA 1BWKA 2YPIA 4LOCA 4IMCA 4O16A 3W2KA 5DBTA 2QDGA 3CLMA 3I7RA 1F74A 3DAQA 2YFNA 2VEKA 3KOFA 3R2GA 1EP1A 3RK8A 1LDCA 4NX0A 4UNLA 4LVDA 2ZRUA 3EXRA 3KVKA 4OBTA 4HNUA 1Y0EA 1GQNA 3JS3A 2ZBTA 4M5PA 2GQ9A 3M5ZA 5BNKA 4HN4A 3W1LA 4GJ1A 3UXAA 3P5YA 3GDRA 3O07A 4ZZ9A 1VHCA 3L66A 4LVGA 1RD5A 3W2LA 3IGUA 4I7UA 4K8HA 4C1KA 3A22A 2TSYA 1PVNA 5HUPA 2BZNA 5GVJA 3S1VA 3L21A 2E5CA 4MJZA 4Z1BA 2D73A 5IM51 3UWUA 1MEWA 1CX9A 4LTSA 1H5YA 5EPDA 3TAOA 2B7QA 1VLWA 4EIVA 3W7GA 3I7SA 2G95A 3ATYA 3LV5A 3DFOA 3G8EA 3S5ZA 5C6MA 3CIXA 4N4QA 3W9ZA 3BG5A 4XBSA 3LXAA 4O13A 5D2WA 3VI2A 5K7JA 1A5CA 1DQWA 2VEIA 1SZNA 3P81A 1KM1A 1OFAA 4O54A 4MZ8A 3EWBX 1KM6A 4IOTA 4PA8A 3V75A 1MEIA 1MO0A 3NXFA 1P5BA 1SSGA 1UB3A 2VFIA 4BWLC 4FXRA 1W0MA 2QAFA 4XKYA 3W73A 1B9BA 3FLUA 4Z1CA 3GXNA 1GG0A 3M7WA 1XXXA 2C14A 3DI0A 4YCOA 3QSRA 4GNJA 4LW7A 4UFKA 3NPWA 3L0NA 5C55A 1A5SA 1G69A 2ZYFA 2O7SA 3W1RA 3WJWA 1JCNA 3GB6A 4LS2A 1PCWA 2H3BA 2Y6ZA 3P8JA 1MZHA 4WUIA 1JUKA 1Q6OA 2WO5A 2YFOA 5HINA 4KFOA 3C2EA 1F5ZA 2OX1A 3NDOA 3A24A 4JR5A 3PSWA 4RCXA 5CPNA 1JRCA 2VKZG 4PH6A 1JQXA 3W7LA 1VCGA 3HGRA 3MUXA 1QDSA 3TW7A 4ZQRA 5TIMA 3I6RA 5AB3A 3G0UA 3OG3A 2V30A 4TMCA 1DHPA 4ALDA 4HNVA 3AO0A 3IV3A 5G1YA 2CLKA 3LERA 3UD6A 2FJKA 3G24A 5D09A 3LCHA 3EWXA 4CNNA 1SZEA 2G96A 5BW6A 2A21A 3FKKA 4GUFA 5C2XA 3OA3A 3L5AA 2X1UA 4DXVA 4AH7A 3W7NA 4MFEA 2J27A 3O8AA 3W1UA 3TDFA 4E0CA 4JYFA 3T7VA 4WY0A 3NQ7A 3C2FA 3NQMA 3TSDA 5AYXA 4KFNA 3UNDA 5CZ0A 1A53A 4NJGA 2H3DA 4UFMA 3PBUA
chains in the Genus database with same CATH superfamily
4M8UA 3T09A 4HQVA 1Q7ZA 3TOPA 2IQ0A 1KM0A 4YPJA 4GIEA 2I56A 4E2BA 3WD3A 5CSUA 3UYCA 4KWVA 4H8VA 5A8PA 1FUYA 1YHTA 3W88A 4M6VA 3FIGA 2QW5A 6TIMA 2IMRA 3AXMA 1UWSA 2VR4A 4PB4A 1FH9A 4Z08A 2D2JA 1QXLA 1TVPA 1P48A 4PSPA 1BXBA 1FOBA 1QO5A 1ZJAA 1E5JA 3WMBA 3W7EA 3QY7A 3LG3A 1S1PA 2RDUA 4UOJA 2E4TA 3UT0A 1EB3A 2BXVA 1GNXA 2ZA2A 4MLJA 1SMDA 2E8YA 3LTPA 3T2PA 3W2JA 3CM4A 3R4IA 1C92A 1OM0A 2Z27A 4UR7A 2YGYA 4AB4A 4YHGA 3L4XA 4ADSA 4IICA 1JPHA 3MHFA 2PURA 2ISVA 3KBVA 1BSLA 1M04A 1X7FA 3HZ3A 4O57A 3FVDA 1TA3A 2VEMA 5CJ5A 3W1NA 4CD8A 3GNOA 2XM1A 1A5KC 1RY8A 1PTDA 4Q3MA 4LCQA 1VQTA 5EA9A 2Z2UA 1DXFA 5F7UA 3AZRA 1OFBA 3QPYA 4W85A 4XKMA 1PTGA 4TX6A 4U3CA 5I09A 3N3TA 2POTA 3MDUA 3S6DA 3WMLA 5BWAA 1FXPA 1X8FA 2V3EA 1EX1A 3KM8A 2AQVA 2WVTA 3LYEA 3CPUA 5DY3A 3BLPX 4JGDA 1QATA 6CGTA 1OY0A 1EJ7L 3IVUA 2BP1A 3CL7A 6ALDA 3WQ4A 3CHDA 2X2YA 3D0CA 1Z6KA 4M6PA 1Q6LA 3IJLA 4O1FA 4WX2A 3WQVA 4DUOA 4AZ7A 4GQGA 4LRTA 1NEYA 2QJMA 3QY6A 4OT7A 1PYMA 3PHAA 3NQ6A 2POZA 2ZRXA 4BEUA 2GJPA 2FKPA 2X1SA 3MUCA 5F2IA 1YLVA 2HVOA 1KTNA 2B81A 4IQLA 1TX0A 1LOLA 3FYOA 4B2DA 4IMEA 2X09A 5CC6A 2BFGA 3NQFA 1K8ZA 4DNMA 4FX7A 3NM1A 3KEHA 4YS1A 3KDNA 3LK6A 1TPDA 1K9TA 3S83A 2R1KA 4MGGA 3L12A 3ARRA 3W07A 4B5VA 4WOZA 4TVDA 2VGBA 1V79A 2WVUA 3DFTA 2PDNA 3T81A 1OGGA 2CETA 4QM1A 1RY0A 2DT0A 3PC0A 4PMZA 1M03A 3SBFA 1HG3A 4M6QA 1YADA 1R87A 2NV9A 3SUWA 1JCMP 1LORA 4GYPC 2CZDA 2OODA 3M0KA 3DH7A 2Q02A 3FVMA 3W3OA 1VBHA 1BRLA 3ZYZA 3S3GA 1N55A 1H11A 3S9ZA 1F6KA 2CLEA 1VP5A 1KCKA 2DQWA 4UTUA 3ZJKA 2XGBA 4GY7A 2XSXA 1XYBA 2VJXA 1V3MA 2PGRA 1ITUA 3UEQA 1K7XA 2E6AA 2AAAA 3L0KA 4ROQA 4DYKA 3U48A 4Q4PA 4IQDA 3FGCB 1E6PA 4MFDA 2W67A 1P0KA 4PMNA 2FZBA 4U4MA 4OBRA 3W72A 2PWDA 1F4AA 1KFCA 2CHRA 3NWRA 1IEWA 1Z42A 3GTHA 4AW7A 3O7UA 5J04A 1YDYA 3U7VA 1KV8A 3ERPA 4JIIX 1O60A 3BCFA 2NUXA 3LHZA 3OJGA 3OLIA 5LNSA 4UMCA 1P6CA 2Z28A 4XBKA 4YJ5A 3H26A 3SCVA 2GSJA 4EKJA 5KZEA 3PANA 3U5UA 4LRSA 4ASTA 1LQ2A 1ENUA 2Q6ZA 2MUCA 2V2HA 2Y70A 2DZPA 3L4WA 3MQTA 3M0YA 2I7GA 2WXDM 4KEZA 1GKQA 1CECA 4JTHA 1GOMA 3GVRA 3HGSA 1GK8A 2YR1A 3R7MA 4DBSA 2J4GA 1RH9A 3C8NA 1QOQA 3WDRA 4TX9A 1GVEA 2QGYA 5F2MA 4Q22A 4K39A 4DYEA 3AMGA 2YCEA 3TA9A 5C71A 4GKTA 1S2WA 3LBCA 4QDWA 1MQPA 4WR3A 4R33A 1NWUA 3ZR5A 3IIVA 4H19A 3VUSA 4IMAA 5FF7A 3OZPA 1EJRC 2NSOA 3NJ3A 3GW0A 3VIFA 1QMLA 2F2HA 1F3EA 4DAIA 3GXDA 2Y85A 1FWGC 4NILA 2VVNA 1F3WA 2IKIA 2PRLA 2WC7A 4B5NA 1Y65A 3CMFA 1W1TA 3RPTA 1I60A 5AHFA 4ZTXA 2HQAA 4GYJA 4R34A 4QSFA 2B7OA 1JUBA 2VD9A 1A5LC 4B3ZA 4HD5A 2WHKA 1DJIA 2CIPA 5KSWA 3P0XA 2XIBA 2LLEA 3GNPA 5FD0A 1XX1A 4HA0A 4IZGA 3URNA 3VNLA 5T9BG 3ZT6A 2PRMA 3IAPA 3T0BA 2J9YA 3MCNA 2OWXA 1JCTA 3AAMA 2XZ7A 4GRSA 1AG1O 3NQ2A 1F2JA 2Z7GA 3T07A 1Z89A 4Z2LA 5A6MA 3M47A 4AHPA 1F4HA 3QW4B 2WYSA 3WJXA 2WVVA 3WEMA 2WPGA 1XGZA 5A5WA 4TVCA 4QRNA 1UBPC 3PP7A 3MSYA 4TO8A 1NVMA 2GVGA 2Y89A 3NOEA 1EA9C 5DMNA 4D2JA 1DIDA 4UWMA 5DXXA 3QGKC 1KBIA 3TSMA 1JAEA 4PL1A 1TRDA 2CBUA 4NZ1A 3HO8A 4LUSA 5LA0A 2FMOA 2OZTA 5I24A 4I7VA 2EPMX 4E3VA 3PTDA 4WOQA 3LGDA 1SJDA 4OE7A 1UR2A 5I78A 2NX9A 4WF7A 1JD7A 3NL6A 1DHKA 1BKHA 2VCCA 1F07A 4QJ1A 3WMSA 4H7VA 2X0HA 1ZS2A 3GXPA 1V0LA 2A3HA 3BLEA 2R1NA 4EP8C 1E3ZA 1NDVA 3CU2A 4RLIA 5KEZA 1QNRA 2JIEA 2GGGA 1QCWA 3CQHA 3GYEA 1HJXA 3HURA 1KRBC 3NM3A 2BHZA 2FPTA 5FJTA 1OFDA 3TX9A 3I3DA 3QFEA 4A22A 1UWRA 4L61A 1D7FA 2Y5EA 3D6NA 2Z7KA 6REQB 4Y9MA 2A79A 4F48A 4NT0A 2BOFX 1EDQA 4HA3A 1GVQA 1JYWA 4L65A 1XS2A 1V93A 2WZIA 3D47A 4QG8A 1J5TA 3Q65A 1FCVA 3WJZA 1X7IA 3FA3A 2D0HA 1QNSA 3RU8X 2PWHA 3A12A 5LHEA 2WMHA 2I14A 1FWFC 1V3LA 4PRWA 4QNEA 1L6SA 3WH7A 4W8LA 1ZU8A 4PMQA 1DWJM 1TKKA 3AHXA 3LOTA 5G1TA 3R94A 5C9XA 3WQWA 3T8LA 3FCPA 1E4IA 4Z2JA 1FWCC 4EANA 4IP5A 3EOOA 1E56A 1FKWA 2CLOA 1BG9A 2CLMA 4GPNA 1KFLA 2G50A 1QI4A 4HPXA 4PMJA 3JVAA 3KCLA 4C5YA 2VHLA 3WF1A 3SW6A 3SUVA 3VFLA 1V7YA 2F61A 4CVUA 2ZX8A 2VOMA 2AMXA 2BY3A 4C6NA 4NJKA 3MU7A 2GWNA 2XUCA 1CT5A 1QI3A 4GUJA 3CB8A 3BCDA 3VK5A 4IL2A 4LUYA 3SRFA 1QPNA 3KLKA 4UTTC 4QJ4B 2Y24A 4HGXA 2G8ZA 1DORA 1ZP3A 4TIMA 1T99A 4DBUA 1VD6A 4KRZA 1UH4A 3P6LA 1BLIA 1OJXA 4C6CA 3E02A 5ABHA 4WDWA 1E6NA 3QPEA 2QJJA 3CWNA 3DIPA 4IJRA 3AICA 1KC7A 4PUNA 2QVHA 3AYVA 4L4PA 4ADTA 1TV2A 2ZZ6A 2OYLA 4DPPA 2FVLA 3F4DA 1FH7A 2EXOA 1RR2A 5M5DA 1V3JA 2QF7A 3DXIA 3LZ5A 3VTRA 1E6RA 5CJMA 2RGLA 2YYTA 4PCSA 1SFJA 2C91A 4ERGA 1YXCA 1AQHA 2E1DA 1L6WA 1JNEA 2VMFA 3PJUA 4BCEA 2WBKA 1K02A 4LANA 5D38A 4PUMA 4DM2A 5DMLA 2BVDA 4FSAA 4XVDA 3CTTA 3O15A 1XCXA 2WMIB 3L7RA 3OBKA 1SPQA 4OKDA 4UR8A 4JEQA 2W9MA 4CVWA 3N3MA 4MPKA 3IJ8A 1RBLA 4J28A 3R6IA 3TR2A 3VD5A 3B9EA 3S2MA 4JICA 1K8YA 3HPAA 4ZQPA 4X22A 4FB7A 3LGGA 2R24A 3P84A 3LUTA 2OZ3A 2I1OA 4WGXA 3STPA 1KFBA 3NEHA 3PUGA 3TTQA 1HN1A 4FA3A 3EWUA 3RU6A 3N12A 5G4WA 1RZMA 4N9DA 2B0MA 3NR0A 3LHWA 4W7WA 2RDTA 3SRDA 4FR1A 4D9PA 3PZUA 5DELA 4JQ4A 4F0RA 4HZMA 2P8CA 1FWRA 1WP6A 3WQFA 1JF6A 3VKBA 1LOQA 3VDGA 4I5XA 2HISA 2ZUTA 5A1AA 2ZVRA 3WY1A 4LGXA 3WZ0E 2NVDA 4DO5A 4LV4A 5A94A 1J2BA 5BXSA 4Q6JA 2J47A 4C6FA 3V1HA 2CFFA 1SW7A 4ZQNA 1JDEA 3P61A 1N2VA 5C54A 1RXOB 3ABQA 2HK0A 3PZQA 4XD6A 3SUUA 3UW6A 1XQKA 4JYDA 1F3TA 3TWAA 3THAA 4NXKA 1MEHA 3PVFA 1AK5A 3TMQA 2DU2A 1RJRA 2BOGX 5BXTA 1WZMA 3GY1A 1FWDC 4QS6A 1KM3A 3UG5A 2XN1A 1Z3NA 4RXGA 1I0DA 4ZMGA 1AL8A 5EFFA 3B4UA 3GQYA 4JL2A 2TAAA 1I2RA 1HKMA 3G5EA 5LNWA 1E0UA 1P0DA 4DJDA 8RUCA 1UZDA 3H2EA 4NAFB 2W27A 2WKGA 3CHCA 4PEKA 1E15A 3MYPA 1TWDA 2XH4A 1IEXA 4CCCA 4X3ZA 4U2YA 2Y4SA 1Z41A 3HTWA 5BU9A 2ZCGA 3WJYA 5JH1A 1CBGA 1NY1A 3TVAA 1XL9A 4PFMA 1PX3A 3W22A 1UIOA 2GJNA 1LYXA 5HOSA 3P7YA 1JZ7A 3M5XA 1VIZA 1KGXA 4AIBA 2Y5SA 1NWRA 3CNYA 2R8WA 1LP6A 3OG2A 2NXHA 4W93A 2XH2A 3NL5A 3SEPA 2CLIA 5AN7A 3RDKA 1X8CA 3WCZA 5D04C 2NLYA 2VT0A 3L0GA 4JTKA 1EQCA 1VLIA 2Z0IA 5BOFA 4KESA 1J0YA 2ICSA 1DJNA 5G4EA 4JAWA 3UCQA 2XIQA 4JTSA 1W5QA 4M7TA 1DJYA 1XDJA 1NJJA 2J77A 3B4YA 3Q58A 4DJEA 3VCRA 3W7MA 5J5RA 2XG9A 1UR8A 2DW6A 1ONXA 1WBHA 1HJUA 2GGHA 2NQ9A 1MDRA 6TAAA 1UWAA 4G9PA 1GKRA 2CHNA 4LYKA 3HPFA 1QUMA 1BSIA 1XLMA 1GOQA 4OWGA 4DEFA 5BWFA 1XBYA 5I3DA 3WDPP 1EQPA 3QYQA 2C3ZA 3LS9A 3EMZA 3AJXA 4MWAA 4XTDA 1M7JA 3U5YA 3BAKA 4DI9A 4IXXA 5LGXA 1XYZA 2FHBA 5AHLA 1AH3A 1YDOA 1IWPA 2GDVA 1SJAA 2HEJA 2NXGA 4JTAA 4X63A 4A6GA 3BO9A 1PEZA 4LEFA 5K2ZA 2OLHA 3AIBA 3KRUA 1G67A 2VZSA 2Y1HA 3AIRA 1IT7A 1XPGA 4ROPA 4B4HA 4DWDA 5A6BA 1TV8A 1AH0A 4YXGA 5IFTA 5CLTA 5I77A 4QE1A 3VCCA 1BG4A 3AI0A 1QOXA 4DBWA 1TELA 2ALDA 3AUOA 3ATZA 4PBEA 3MV11 3V0SA 3R0UA 4JCMA 1A47A 1TUFA 3BMXA 4REQB 3THDA 1MYRA 3HPZA 2ZUUA 5HMFA 5I3GA 3UU0A 3SQLA 3VMPA 2Z1SA 5LNRA 4ORMA 2DIEA 1YYAA 3LI1A 4PBFA 1XBZA 3TZNA 3S5YA 3A4XA 1GVIA 4PMVA 2QPXA 2DUZA 4RXFA 1O7AA 1W32A 3JRKA 2J66A 2I57A 3OOQA 1C3FA 1TR9A 2RDWA 2NUYA 3MO4A 1V6TA 3I7QA 1S1RA 2G5WA 3L2MA 1MNSA 2F38A 3PK7A 3R0KA 3FGCA 2IQDA 5DANA 3ZZ1A 1FY6A 3F4CA 4BF9A 1G94A 2WM1A 4KRTA 3DYMA 3HV8A 4C1NB 1UUQA 1FDYA 4QJ5B 3SCOA 5CJNA 4C7DA 2XPKA 1IR2A 1EF3A 3RPMA 3WO8A 3QPZA 3TFXA 5HMDA 3BSHA 5F1UA 4GLEA 3B8IA 1YQ2A 4K7VA 1GT8A 3NA8A 4JHOA 4WSJA 3T4CA 1I2NA 3RM4A 3SECA 3F5JA 1ISWA 1UHVA 2BY1A 5CXPA 4PCFA 1SO4A 4CN6A 1UD8A 2Y88A 1OC6A 2PDIA 3KTXA 1JUEA 2R9RA 3GHRA 1EL3A 1NM9A 5DMYA 2QDHA 3VM5A 1UZ1A 1SW0A 3HA1A 1XFCA 1PPIA 3APTA 3EXSA 3WJSA 4F0HA 1IEIA 3LTYA 1NU5A 3M0LA 2I9EA 1OABA 3IJQA 3GZAA 1EC7A 2VX5A 2UY4A 1EHAA 4GCXA 1ONRA 3NSNA 2QIWA 1XI3A 4Y9OA 4UZSA 4FNUA 3RN6A 4UQAA 1FX6A 4IGSA 2Y2WA 3GDTA 3BLOA 4GXMA 3PTMA 4MG4A 1KXQA 5EMLA 3C52A 5CG7A 3U2CA 3ABOA 1MVYA 3EA2A 4UMBA 1TV5A 4DBDA 3LI0A 3W1QA 1W9VA 3C86A 1K1DA 4IPLA 1UZ4A 2GFTA 3SN0A 3RFAA 2VGGA 1YRRA 1ESWA 1A5MC 3DU0A 3LN3A 4XIAA 4O28A 2ZXQA 4GWEA 4P7LA 3WLKX 1XIMA 4GVIA 3NVTA 4NZFA 2VGFA 3S47A 3UGRA 1MI3A 4DVOA 4POCA 3LM7A 1NOUA 1O5XA 3PBYA 4W88A 2WK2A 2IUZA 3E5PA 2YL6A 3CQIA 1EC8A 4DXXA 4IH3A 2G3MA 2BTMA 1RVGA 4XZ9A 4ZO8A 5E6YA 2CWNA 4F2UA 1ICSA 1LLOA 4H9VA 2ZE0A 3NZRA 1W17A 3VNDA 3BDKA 2BHUA 1XLJA 3WFAA 4TR9A 2UV8G 1H60A 2PDJA 5BCAA 4Q32A 1DWHM 2PWGA 4W4QA 4FX6M 2ATSA 3GRIA 3R8HA 4X2RA 4NP7A 3HM7A 3NPUA 2FTYA 4JTTA 1CIUA 1EP2A 4CNPA 1PL9A 3M5YA 1OCNA 1J18A 1PTAA 4GA8A 3CPGA 4QJ3B 1WB0A 5ABFB 3KP1A 3FFSA 1ADDA 1TTPA 4HPNA 3PBGA 4P7QA 2ZXDA 3BAYA 3UG3A 1ZP4A 4K7YA 3SI9A 3VNKA 3BJFA 3VFCA 4AD3A 3IGXA 4Y9AA 3W1AA 2WLYA 5A2CA 2BBFA 2EG7A 3D3FA 2ZUNA 3SZ8A 2QV5A 5F2LA 1XW8A 2ZZ7A 2OLSA 4H4IA 1OK6A 4XG1A 6REQA 2VQUA 5FSEC 3PZGA 3K1GA 3EWWA 4M1RA 4K8GA 3EDFA 4OUEA 1CLXA 3NTYA 2X30A 1B1YA 4Q4OA 3OLDA 2IXVA 1EC9A 4NHVA 3WUBA 1DWGM 2XVLA 4FX8A 3K1DA 3VAVA 3I6TA 5HAOA 5DY2A 2NZLA 3TYZA 1M9HA 4GG9A 4IMGA 4IWWA 1L6FA 3P93A 1PKMA 1IGSA 5E09A 4P61A 2FJUB 1G1YA 4D1JA 2WMJA 4LUTB 3WSUA 4ZSUA 4FNSA 1BAGA 4I8DA 5G5IA 1U5JA 2OWWA 3PZMA 1TJRA 4BFAA 2BLEA 3JU2A 1GPWA 1PWMA 1LQ0A 4I7WA 4Z2IA 1E9LA 3II1A 3R43A 2YCJA 1V6YA 3QVQA 4U33A 1VFFA 3SGGA 2WZEA 2XVGA 1X1ZA 4CN4A 1WOAA 1GPFA 4ACZB 3C2VA 2G97A 3GKFA 3T08A 1TV7A 1EOMA 5T9CE 1NTHA 4JTJA 1DVJA 4HT3A 2BY2A 2XFWA 4KW2A 2QCDB 1XIJA 4WSHA 3OVGA 3NQCA 3RM8A 1BEUA 2ACRA 2TMDA 2CW6A 3EYPA 4N6FA 1JXJA 4YVVA 4J2MA 3W7PA 2Y7FA 2JBMA 2PGEA 2VGIA 2GDUA 4W5UA 3M0XA 2JF7A 3AQUA 2RGMA 3RF9A 1B2YA 3VU2A 4J3WA 3IARA 2O55A 3SAZA 4O16A 2ACUA 1W3JA 3RK8A 1NQ6A 2P50A 1Y0EA 1S38A 1RJPA 2X41A 1FP8A 1J0JA 2DSZA 4HN4A 4GJ1A 4FMVA 3O07A 1W9UA 1EIBA 2OO6A 5XIAA 2PTXA 1YBQB 3KS6A 2E9BA 1CYGA 1F3XA 2FZDA 4C1KA 4H01A 4HOZA 2TSYA 1PVNA 3ZJ6A 3GH4A 4C5ZA 4HSHA 3L21A 1H4PA 3PZ9A 4JCLA 4MJZA 3DYPA 4Z1BA 4NIRA 3UWUA 3QC0A 4EWJA 1CX9A 4YNGA 1H5YA 4QLKA 3TAOA 2WMIA 5H8PA 3ATYA 3LV5A 5JQ9A 4LB3A 3DFOA 3G8EA 4PUKA 3CIXA 4N4QA 4P7OA 3W9ZA 1LL7A 3LENA 1B3ZA 2QYGA 4XBSA 4ICMA 3GE7A 2W5FA 2VEIA 3P81A 1KM1A 3VKKA 1V02A 1BF2A 3GG7A 3NDYA 3S46A 2A3CA 2EEXA 6A3HA 1MO0A 3HFYA 1E1FA 1P5BA 3MCMA 4BWLC 4FXRA 5A8MA 4XKYA 3W73A 3FLUA 1QNOA 3DI0A 3QSRA 4GVHA 4LW7A 4UFKA 3KL5A 4XO6A 2ZYFA 3W1RA 1XLDA 5PTDA 1D3CA 4QXIA 1PCWA 2QZRA 4NI3A 4P5UA 1MZHA 3EPOA 1J93A 3RIKA 2WO5A 2YFOA 4KWUA 5HINA 4W7UA 3B3DA 3C2EA 1O1ZA 5EB8A 3A24A 1QWKA 3PSWA 4PUUA 3A4JA 3GNRA 2XVNA 4G6CA 1VCGA 3B8UA 3I6RA 1P1MA 4TMCA 5H1WA 4ALDA 1J12A 1M3UA 3W4RA 5G1YA 4L4OA 2FJKA 3EPNA 4PMDA 3EWXA 4WLCA 4GISA 9CGTA 2JQXA 5BXPA 3V7PA 2VC5A 1MW3A 3OA3A 4PCPA 4DXVA 1SVDA 3V3WA 3C0LA 4E0CA 1CLVA 1VEMA 4QG6A 3NQMA 4HYRA 3VNZA 5AYXA 2G3NA 4Q8PA 4F9JA 5LXXA 4OIFA 2OGYA 4GMEA 1RALA 4IPPA 2IPFA 1TCMA 2Z25A 3QGVA 1FDZA 4C6PA 3PUEA 1EBHA 3NUKA 4INFA 3IRSA 3LSBA 2ISSA 4B2DD 1DWIM 1JPKA 4ZSTA 1ZAJA 2JEQA 3NZQA 1DXEA 4GO8A 5D9PA 3S1XA 1S5TA 2GVYA 3PFMA 1UJQA 5T26A 2UWFA 1OZMA 4AD4A 4ATWA 1K9FA 3MW7A 5EBAA 1UW9A 3WBWA 1K03A 1L0PA 4NQ1A 2XH7A 5BMXA 9XIAA 3O63A 3GTXA 3N4FA 2R1PA 1HTIA 3GLCA 3RXZA 4AISA 8TIMA 3NL2A 1QW7A 4KMQA 3I4EA 3EDDA 5I3JA 2C15A 4P8UA 4FF5A 2BV9A 4CQ9A 3SO7A 4CUCA 5H2ZA 3DBPA 5CZKA 2X8RA 3E74A 4JFUA 3KVMA 4QTGA 4UB9A 1LBMA 2E09A 4TTGA 4O4WA 4ZXOA 1VIWA 1US2A 2ZX9A 1X39A 2O9TA 4H04A 4RE3A 3DG6A 5TNVA 3R8GA 1MFVA 3E12A 5HJLA 1GQIA 4NYUA 2ASHA 4PMUA 1YE4A 1XJBA 1HJVA 2XYLA 5AC8A 2G4FA 5JMUA 1UR0A 2TYSA 2Q3OA 1KGWA 3PJTA 3WF0A 3A21A 4G7EB 1UP0A 2ZFAA 2DDXA 3N73A 3WLJA 4NRRA 2V63A 1PZ3A 4L5ZA 4P8WA 2PFHA 1XSKA 3DYOA 3WUFA 4CQDA 5HJXA 2DSVA 1QHOA 5LHFA 1W37A 1J96A 2YB4A 2V3DA 3A5FA 3ZSTA 5FEZA 3KHJA 2ON3A 4ZQCA 3OB8A 4R9XA 1DWFM 3VIOA 3MSDA 1Q6QA 3EOSA 3VKDA 3WQ8A 1LG2A 4M1BA 4PMOA 1WA3A 1PE1A 4MUPA 5A6AA 3V4BA 4LUJA 3AYTA 3U8GA 3CH9A 3D3AA 5ECVA 3UA4A 3SY1A 3DESA 2D0FA 3AXKA 3PJXA 1QOPA 1S39A 3T78A 1FCBA 2XN0A 4JD4A 2R6OA 4IIEA 4O8AA 3KVJA 2ABBA 4NZ4A 4BF5A 3QH2A 3T8QA 4DM1A 4JYEA 1H62A 1RSCA 5LIWX 4DZ5A 2YBVA 5AC6A 4Z0JA 2YSWA 3CL8A 3EBVA 4EF9A 4UCGA 3N6QA 4WDTA 5F2GA 1LF1A 5ABEA 2HRWA 4QEHA 5H6HA 5IRPA 1ISVA 2C0AA 4JBRA 2I16A 2X0SA 3HPXA 2YCLB 4EX4A 1P4CA 4V27A 1P7TB 3S2JA 2VQTA 3RO8A 2ZZ2A 1MRAA 4UQDA 2ZXAA 3SRKA 3SY8A 2HWGA 3CV7A 3GD6A 3TQPA 2W0UA 3UF9A 3GAKA 5D02A 2QNEA 2VP8A 4L9XA 3W1TA 1A50A 4FAMA 1M5WA 3UPMA 2GQ8A 5I3HA 4XZWA 5IDZA 3CBWA 2JK2A 2YW3A 2ZADA 1UASA 4W9TA 3HG5A 3W24A 3VOCA 2YXGA 1R3SA 3WFLA 2A4AA 3PPGA 3S2NA 4I9AA 3TROA 5E70A 4ONVA 2P3EA 3WNKA 2Y8KA 2GLKA 1W9PA 3RR4A 3F5KA 3BTNA 3K46A 4KFPA 4ERAA 4WEVX 4JKMA 3BJTA 1H7OA 4J35A 3IEBA 2QAPA 4NXSA 2DT1A 4GY0A 1UQZA 1UD6A 1R38A 4HNCA 4GO9A 1BVZA 4JKLA 2IKGA 3W00A 4L9YA 1ICQA 3QV9A 3TMLA 1OT1A 2HBVA 4O18A 4A2SA 1IV8A 4O53A 2QS8A 2HVMA 1WO2A 2EG6A 3PAOA 2R91A 4CNOA 2XU2A 2R94A 2V2CA 1PKLA 1IIGA 1OGSA 1AA1B 5CC5A 2VUYA 2D3NA 2JKPA 2QCNA 4NYYA 2WOQA 5CBIA 2QCMA 1BYDA 1EJSC 3E0VA 5EMMA 1JCLA 3IIPA 3KE0A 4PMRA 1E6SM 2E5BA 3S9YA 3FEMA 3QY8A 3N14A 3E0LA 1FVPA 3A23A 4HKPA 4H9TA 4EXAA 2P53A 3EOLA 1TIWA 1PSCA 2F6KA 1FDJA 2V38A 4US6A 3K8MA 3KL0A 3LCGA 3G3DA 4NAEB 3TQVA 4H7CA 3VYLA 1VBJA 2OTDA 1NDWA 3SSJA 4CU6A 1VB9A 4HU0A 4D8ZA 1HO4A 1CWYA 1JCXA 4LBSA 1A5BA 2PC4A 2QCEA 1F73A 5D9MA 2PDGA 3UYIA 3BQ5A 4G8TA 1A3XA 3QZ6A 1JULA 2QDDA 2BGNE 3TJLA 1XPYA 4HJWA 2VEGA 4MWAE 3SUSA 3RRXA 1HKJA 3PULA 5MKGB 3TQKA 5I2UA 2ZRYA 4ZENA 1N8IA 3VOFA 1FH8A 4R7JA 2J79A 1ZTVA 2VEFA 3MMUA 1C9DA 2UY5A 1NP0A 2A3EA 1A80A 3PB0A 5CSSA 3QTPA 4DBEA 1V6UA 1ZQ5A 2XFFA 2HJPA 4MYAA 4Q4SA 3TW9A 4FK9A 1I2PA 1W2VA 1DQXA 1W31A 1V5XA 1TPWA 1KFKA 1JI2A 4PUWA 1KM5A 1OQFA 3L4TA 2ZTKA 1FWBC 1Q65A 3M0JA 1ZGDA 3EZ4A 2J25A 5K4XA 5TF0A 4GX8A 3IANA 2PP3A 1CENA 5ABFA 1J9YA 1SUXA 2CLHA 1R2RA 4MOZA 1OX5A 5EKYA 3WQCA 2C18A 3QFWA 2V5CA 1KKOA 3COTA 3UBPC 2QXWA 1GKPA 4HHPA 4Z42C 3SGZA 3WH8A 3EB2A 5DCBA 2DJXA 5CKSA 2WAGA 2Y0FA 2PDPA 4TTUA 5A6JA 4JY9A 5M2FX 7REQB 3ZJ8A 1PHWA 2CZEA 3KP0A 4MZYA 3T0CA 4UCFA 2Z1WA 1TMHA 3VE7A 1HP4A 5JH2A 2O0TA 2OWCA 4BQ5A 3M4HA 1VFHA 3NURA 3P82A 2E28A 1J79A 4JDBA 4LXFA 3NZ1A 5C9WA 3EB3A 4UTFA 1BKSA 3W53A 4ORIA 4L4LA 1YTDA 2C13A 4PUDA 4UQEA 5FJIA 4BQ2A 4S23A 4M24A 5H8UA 3R0DA 4FS9A 4HU4A 1JG9A 1S5NA 1ML1A 1DJHA 1T8QA 1W91A 3KW3A 3MUY1 2X05A 4OJYA 3OZMA 4WD0A 4JNZA 5TD4A 1AJ0A 1P1XA 1XBXA 4QITA 4WY0F 1S2TA 1H7RA 4LUTA 4JFVA 4IX0A 4L1XA 1E3XA 3CPRA 2FH8A 4F0SA 2EAWA 3NPXA 3T05A 3VCNA 4L6HA 3WQEA 3W7DA 4CN1A 7XIMA 4KQNA 2WZHA 1SFLA 3WLTA 3TJIA 4ML9A 1I2QA 1HT6A 4EAYA 1AW5A 1F76A 2KX9A 3ZT7A 2HPMA 1RP8A 2OR2A 4RZ6A 2X7WA 3ZLGA 2ZDRA 1AQ0A 3C4UA 3MP4A 1RQBA 1W5NA 3FOKA 3LCLA 1OYCA 2XGZA 1XQLA 3S42A 1W8GA 1W1VA 1WDQA 1XGDA 5FF3A 3UXDA 1YPFA 4XUYA 3DKLA 3WDQA 1TPC1 4Y2WA 2DQXA 3GU9A 3GYCA 3TYUA 3MSGA 4I9JA 4LAKA 4O1EA 5HPOA 3FSUA 3QLLA 3CAWA 4H6QA 4E2DA 3PG8A 3GXMA 2NW0A 3HG2A 3BMVA 1XGEA 1TE6A 3T6CA 1XIEA 3M0VA 3WQ6A 3NG3A 1FHLA 1IE7C 2ZC8A 3E1F1 3W7OA 3C0SA 2BDQA 3WQPA 2G3JA 3AIQA 3M41A 3EDJA 1B57A 3GUWA 3KUMA 4JTCA 1H49A 2RJGA 3WQDA 1YBQA 3CMJA 4L64A 4CNTA 3NFUA 4UTWA 1Y5VA 4RE2A 3PBMA 1U5VA 4HZ8A 3APGA 4DJDD 3CZJA 4PE8A 4NL1A 1UOZA 4ZOBA 3CEUA 1K7EA 2YA0A 1D2KA 5HATA 3WK1A 1V3IA 5FESA 1YIXA 1AQMA 2NLIA 3CUGA 3BSMA 3PWGA 1C93A 4Z2GA 4NJJA 2F6UA 1R3QA 3GX9A 3RLGA 3VUPA 1HGYA 2DJLA 2V81A 1BYAA 1E51A 4DZHA 3GXTA 1GORA 4I6VA 3DENA 1KA9F 3IUDA 3MPGA 2D1ZA 2ZZ4A 3BCJA 2VTFA 3UY8A 2ISDA 2VD8A 1PZ0A 2YCKX 2QJGA 4D72A 2PDMA 2CKSA 4UTWC 1FWSA 3TP4A 5ENLA 1DE6A 2X1RA 3IV8A 3O6AA 3B97A 1G7UA 1E4LA 3URBA 3P14A 1LL6A 3N6JA 3H7UA 1UD2A 2ZICA 1IYXA 4H9MA 1JJKA 4LSBA 4JN6A 4TU1A 1A0CA 2V5KA 1FWJC 4QQ3A 4GC3A 3ITYA 3ABZA 1VKFA 3QSTA 1WUEA 3PM6A 4KWOA 4QQUA 4W5ZA 3W6YA 3SADA 1X98A 4DJED 5E9AA 1K6WA 1WKFA 3UWZA 3VGHA 4H6EA 1KO0A 5FEXA 1QHPA 1OHLA 3PPCA 5EYWA 1JZ6A 2OJPA 4HCHA 1IWAA 1UQYA 5BRQA 4WSKA 2FFIA 4JTDA 3LPPA 4GZ7A 1GTEA 2YDQA 3MKKA 3T0TA 3G1FA 3P3BA 4UR9A 1W9DM 4GOAA 3ES7A 4RE0A 4AX6A 3AS3A 4HMCA 2DZAA 1UPMB 4I8YA 3F5LA 4AZCB 2O4MA 1C8YA 4QSHA 5EFDA 3T40A 3B9OA 1XR2A 4H9YA 4Z1AA 4WJXA 2QJNA 1OSEA 3A47A 3FN9A 1HKWA 1UBSA 3PF3A 4MADA 4TV6A 5A6BD 4U28A 2ZUWA 3N13A 3O2LA 1Q6RA 2VVSA 5MHBA 4WXYA 1QTWA 3FY1A 5H91A 1R3YA 2OCZA 5MF5A 5AC4A 1RLCL 2UBPC 3CZGA 1AH4A 3S9IA 5J5DA 3QRHA 3LRLA 5DFAA 5LNUA 4U5KA 1W9XA 1IXQA 2IW0A 2D22A 4PYSA 1FHVA 3M07A 2XIOA 2D2GA 4O19A 2ZKMX 3UCCA 1GYLA 4PSRA 4XSMA 3OGRA 1CLKA 1V0NA 4NUWA 3ITGA 3A3WA 2WSQA 1A5UA 5KINA 4RX0A 1CPUA 3ZR4A 4C1LA 1CI1A 1R3VA 1A5AA 1QNVA 2CWXA 3KCJA 4B4FA 3PTQA 2FGLA 3BLIA 1VZWA 3N2XA 3CZEA 3TN6A 1DOSA 5M3WA 2JKEA 2AAMA 3WX7A 2NV2A 2ZX7A 4LS1A 3ITOA 2OSYA 1GEHA 3HG4A 3P2VA 3ITXA 4GQBA 3BE7A 1WQ5A 3EOEA 2J78A 3WDHA 4U3AA 3I65A 2J7HA 4BI5A 3IVSA 4W87A 4BK9A 1DXIA 3DHFA 1J0IA 3KZSA 1YKWA 1XLEA 4UIOA 4C6QA 3N9SA 4C6OA 4UFJA 4W8AA 1GYMA 1TQJA 4O11A 3IUIA 5DLCA 4AWTA 3OIXA 3NAVA 2WKJA 3ABSA 4O0KA 1KCZA 2CC0A 3AMLA 4DWSA 4OZOA 4LJ3A 3ELFA 1QJWA 3QKEA 3FJNA 3S1WA 3C5QA 1AUSL 3WKZA 4BY3A 2X16A 4GE8A 3MJYA 2WM0A 5I5RA 3DC8A 3DFNA 1OX6A 1GHRA 3BOXA 1SSDA 4KRUA 5BXRA 3I4KA 1U2YA 2XH0A 1I75A 4FIQA 4RNFA 1V0KA 2VZOA 2GYIA 2J9ZA 1V02E 2W61A 4YMZA 3EEZA 4MIMA 3A9IA 3CWOX 3SCTA 4QDMA 1CDGA 4XBJA 3TXVA 1VJIA 3N4EA 4RE4A 2Z24A 3M0ZA 1VPXA 2V3GA 1XBVA 1UD3A 4PCTA 5L6UA 2BNJA 4J5NA 1EHNA 2FVMA 3B0UX 4URIA 2QV4A 4O10A 1KQYA 4DPQA 3LPGA 5I3IA 4TXEA 5I7GA 4EE9A 5IHRA 1OFOA 4GC4A 3FS2A 2VCBA 3W2UA 2P0OA 3FKRA 1THFD 2HVNA 4JTIA 1YTKA 2BVWA 4AF0A 4C6JA 7PTDA 4I5UA 4PCNA 3VDCA 1Q4WA 2VRQA 1ODUA 1P6WA 3A9BA 4CQBA 2P5NA 1J01A 2OXNA 3RO6A 3B0YA 3UZ5A 4MNLA 3IJ9A 2YBTA 5J8LA 2XWDA 2VNCA 2FFCA 1TIMA 1NSJA 1CB7B 1JCYA 3H2OA 1RBOB 2BG5A 4HU8A 1KCXA 4NSBA 5FJPA 5ABTA 4JTLA 3V5CA 4JX5A 2YA1A 1OADA 1PZ1A 2E9MA 5DMMA 5FL0A 2YCLA 4PMYA 5AZ1A 1RAKA 1EPVA 2OSWA 4C6LA 4LU0A 3NZPA 1U1JA 2WLZA 3MBFA 4N6EA 3AZTA 1YDVA 2ANUA 3ANUA 4C60A 1WX0A 3ISIX 3ARPA 3SJ3A 2ZXBA 3NQ8A 4W86A 1RJQA 3TN3A 4Q7NA 1RPXA 3R5EA 4HTYA 3H24A 2G41A 3L2IA 3LXBA 3M0MA 5C2GA 1T41A 5D37A 3B0XA 3MYOA 1XP3A 7CGTA 3AHYA 2PDXA 3H8AA 1WZKA 4LF2A 1P6BA 4ZOEA 3OVQA 5GJPA 8XIAA 5HXMA 4PZVA 3KLLA 2E67A 1ZAIA 4IIDA 3W71A 1HFBA 1L2QA 1MQQA 4G56A 2C79A 3KWSA 3QV8A 2RFGA 1S5MA 2VUNA 2R1LA 3O05A 2PZ0A 4DF0A 4ZVJA 4FEZA 1LOSA 3SCSA 1MW1A 3PB2A 1CXHA 1NAL1 3A64A 4AXNA 3IK2A 5DCDA 3TXZA 4MY8A 3SQSA 5C9UA 3O0FA 3OGVA 4N9BA 2VX4A 3U7BA 2REQA 4RNIA 2IPWA 2BASA 2GJRA 1LWIA 2BHYA 1XLLA 2JE8A 2BX7A 2PP0A 5HDRA 1Y5WA 4UTIA 3S5NA 1A3WA 1GHSA 3THCA 5D30A 1E9IA 1EYEA 2PAJA 1V8EA 1HP5A 3RPDA 3CB3A 3LHTA 3VA8A 3PZIA 2EJ1A 2DZUA 3IAQA 4CD6A 1I8JA 3AJ7A 3WLOA 1SU5A 2VFHA 4DYJA 4ML4A 4JQ3A 2E68A 4AEOA 2BS9A 2GQ3A 4HP5A 4E6MA 4QHRA 3CWHA 3OVPA 1WKYA 2F9RA 4OOUA 1M65A 4A8LA 4EPKA 2DH3A 5REQB 1VFSA 3QR3A 3QV7A 2PSNA 1KQZA 2DV0A 1LUCB 3EKGA 1NF0A 2H9AB 4NAEA 2OYKA 4F4RA 4QDPA 3W25A 1UP2A 2HNHA 3FAWA 5AHMA 3N25A 4E5TA 4S3JA 4A3HA 3B40A 3CHFA 4Q33A 3VX1A 2CBIA 5CPTA 1CZ1A 1PKYA 2VDGA 4D6FA 1Q85A 3WUGA 4OV4A 1ZCCA 3VKJA 3SDOA 2PDLA 1BF6A 2HNEA 3T9PA 3PZTA 4AYGA 5D9NA 3GXFA 5A6LA 2JGQA 1WBJA 4FNQA 3N15A 3WNMA 3R10A 3WD4A 4GACA 4R7WA 4JFTA 3QQ1A 2GSEA 3FK4A 3AIWA 4YN5A 1BD0A 4OFCA 3UZWA 1W5PA 3VNIA 3MO7A 1ISXA 3G18A 4RDZA 1B9ZA 4ZE5A 5KETA 1U5HA 2BODX 2AQWA 3QOMA 1KWGA 2RH9A 2BXZA 2GOUA 3TJXA 4MKNA 2Q8LA 2PDBA 4GI4A 3E49A 4MB5A 2OZ0A 4YHEA 3TCEA 4AHQA 1ME9A 1VBGA 3JR2A 3FJLA 5I3KA 2OKTA 2V3FA 4AIOA 3M1ZA 4GYPA 4KPLA 4RKAA 5IOBA 4EAMA 1WOBA 3JZUA 1MXSA 2Z1BA 4YWSA 5FJJA 3PN8A 4PUJA 4AZBA 1WDRA 1BGGA 4CCDA 2XM2A 1JRBA 4CQ8A 3BGJA 3QV6A 3VVGA 1ICPA 1TG7A 2YL8A 3W87A 1TSIA 1SZGA 4EK7A 3LNPA 4WKHA 2VR5A 3C61A 1US3A 1UKOA 2PLKA 4Q4MA 5IBXC 1KLYA 7REQA 1P0BA 2FYMA 5K9XA 3UPBA 3WIJA 2PD5A 3S6OA 4UUIA 1TVNA 2VENA 4CNUA 4YTQA 3EWYA 4U5IA 3VZZA 3AU6A 4LT9A 4HB7A 3VKAA 2WJEA 4CGTA 3QR0A 4RR4A 4YU1A 4IMDA 2A6NA 3Q2DA 3EWZA 2DORA 4LFYA 4HNNA 1QI2A 1LG1A 4JDYA 3MWAA 4S1FA 3DCPA 5HANA 4YL2A 3UA3A 1R30A 2V0TA 3ZM8A 1MUWA 3ID7A 3REQB 2BGSA 3UQNA 2BY0A 1ISYA 4HU3A 5DT7A 4HYVA 3C2RA 3MCOA 4DI8A 4KGJA 3CAKA 1RK5A 4K1WA 4YVPA 3WDIA 3L68A 1VBRA 4OTKA 3LTSA 2EKCA 3W2MA 6XIAA 2VOTA 4UOZA 4XZNX 1BFNA 4LNCA 2V6AA 3MI3A 4IGHA 2WHLA 1R6WA 4Z2HA 3NGJA 1H61A 3CK5A 1X38A 4W8BA 4KGLA 5D03A 1ZRQA 4JTUA 3GK0A 1WDSA 3POHA 4IQEA 4TOQA 3F2DA 4A29A 3TW6A 4RUBA 1TUXA 3BLKA 3AOFA 4ZODA 3EGJA 3FHQA 3PUDA 3QYSA 3XISA 4S3DA 3MKCA 4LNYA 2XIMA 3VIMA 1IEQA 1FWTA 2QPUA 3M7SA 4UNIA 4AHOA 1KBKA 3O3RA 1JIBA 2DZSA 1TJ0A 5AYBA 2J6VA 3N34A 1VEOA 3LCXA 3ZJ7A 1UD4A 3AS1A 1ZBWA 3DERA 1HO1A 4ZQOA 4F3HA 3VX0A 2DIKA 4JQAA 4XZHA 1UG6A 1CB2A 3VOIA 3UPWA 4H8HA 4DJFC 4IMCA 3W2KA 2QDGA 2PU1A 1WZLA 3CLMA 4RNHA 1TA3B 2IKHA 2AGTA 2UY3A 4AZIA 3IJ6A 2VEKA 3R2GA 3GS6A 1DQUA 2HROA 4UNLA 2ZRUA 3KVKA 2PTYA 2CBJA 3SRHA 3T0DA 4HNUA 3GBEA 4XISA 3IUHA 2ZBTA 4HHLA 4GJJA 3M5ZA 4RZBA 4GI6A 3AU2A 5BNKA 2IXUA 2YL9A 4W7VA 3LPFA 1VPYA 3WYZA 3VO0A 4JHZA 4LVGA 3L66A 1IQ8A 4XAZA 3IGUA 3FNDA 2XVKA 3TOYA 2G37A 3U2EA 4M6UA 4ZXLA 5HUPA 3S1VA 1PDYA 2VX7A 1E0VA 3FW6A 2EQDA 1WCGA 2D73A 1C7TA 5IM51 4MB1A 5CAHA 2D0GA 1NOFA 4QX4A 9RUBA 4GZJA 3WENA 5I00A 3E2QA 1JGIA 3AC0A 5E9XA 3S5ZA 1E6QM 1PWLA 4O13A 3MSRA 4LY4A 1X1NA 3BJSA 3OODA 1O66A 3EWBX 4IOTA 3V75A 1GUVA 3EOUA 1UB3A 1JYNA 1IT0A 3GNXA 3H12A 3ALGA 4MKVA 2QAFA 2RDXA 3KOYA 4JTRA 4Y7EA 4Z1CA 1GG0A 3M7WA 2Y8VA 1SMAA 1XXXA 2C14A 4YCOA 1EO7A 2NT1A 3NPWA 5C55A 3F2BA 3BAXA 2O7SA 1JCNA 2Y6ZA 3P8JA 4P7RA 4LAOA 1JUKA 1LQAA 3WD2A 3CASA 4F0MA 1UH3A 2ONEA 1FP9A 2OX1A 4PUEA 1J10A 4O0QA 3L2LA 3CO4A 1JRCA 3OA5A 4AU0A 3W7LA 4CKQA 3HGRA 3MUXA 3OGSA 2DGAA 3G0UA 2V30A 1DHPA 1E43A 4HNVA 3IV3A 1ITXA 2CLKA 3LERA 2EG8A 1JGMA 3KRBA 1SZEA 3VNMA 1GW1A 3FKKA 3L5AA 2X1UA 1HVXA 1JZ2A 2D20A 2VRKA 4MKSA 4YYFA 4MFEA 3DHPA 1MXGA 3W1UA 4JYFA 3NQ7A 3LU2A 4KFNA 2PPGA 1JPMA 4KH2A 1WE5A 2PDFA 2HCVA 5CZ0A 5CBJA 1DE5A 1A53A 1XIIA 3PZNA 2F8QA 4PULA 1Q6DA 3EAUA 3LZ3A 5E93A 3A6OA 1DTNA 1EJVC 1LLWA 1FWAC 3PWIA 5BRBA 7ENLA 2V2DA 4F40A 4B15A 2AGKA 2PBGA 2A3LA 1AW1A 3LLDA 2WMGA 1XLFA 4M19A 5DO8A 2OSXA 1E1CB 3N2TA 1V0MA 3ITVA 4NZCA 3NSMA 4UTTA 4CQAA 3IS4A 1BWVA 4PFHA 4FIRA 1TJPA 3RG6A 1YXYA 1E73M 4FXSA 1A4MA 5EGRA 3WFZA 3IIZA 4QG9A 5HWJA 5AC7A 2PZNA 3WBYA 3QC3A 4IXHA 3F4WA 2DW7A 4I9MA 2SFPA 3VD9A 1GQLA 1MRQA 1UMYA 3TC3A 1LZOA 1S46A 3W28A 5A8NA 4MJ2A 4Z0SA 3G1XA 2FIQA 4KF1A 2E7FA 3GU2A 2Y63A 3LQLA 1B54A 1R47A 3W29A 4MVAA 4WKFA 4G5DA 3K4AA 3KVLA 4ILSA 1PYFA 1PB0A 4NZ5A 4AVNA 3G6MA 4JHMA 1OG6A 3L4YA 3RAOA 3SCPA 2EBNA 1G0CA 1M7OA 1XLGA 2W66A 3UVAA 4AXKA 4QAIA 1XH0A 2ESCA 3SR7A 3OZOA 3WLSA 1H51A 4XZMX 1V08A 2V5JA 4PRTA 3PJWA 3ZQ9A 4ERIA 1BGAA 3F4NA 3SJNA 1KFJA 1XCFA 3S6TA 1EPXA 1TV4A 1LRQA 4LH8A 3OYXA 3C6CA 3PPHA 6ENLA 2MNRA 1A5OC 1R2SA 3H23A 4B16A 4C90A 3DN5A 3ZSSA 1KFWA 4JX4A 4Z1YA 3M64A 2D2OA 4KCTA 5EMUA 4E38A 2GJXA 3DGRA 3OPSA 1OGBA 4C6MA 1X6NA 3VGBA 3M0HA 4AVFA 3IJIA 1DP0A 1ZJBA 1RA5A 3ABXA 4D6GA 3AMCA 3E0FA 4PL2A 5CSYA 1WYIA 2EPLX 1I9CB 1GVFA 1PCKA 2OELA 2E6YA 5CC3A 1Q4NX 2A7RA 3TN4A 2L5HA 2QT3A 5DXYA 4RJEA 3RMEA 3DFHA 2R82A 4UXDA 2RHGA 4LUSB 1TPEA 1YE6A 3G1AA 2QGHA 3E2VA 2FQIA 4QE4A 4ZA0A 1ZB5A 3JZEA 3URQA 1R0MA 4J3TA 3UG4A 3VGFA 4O1CA 2WJDA 2XGIA 3WLNA 4JN8A 3T0AA 3GIPA 1VFOA 2C7FA 1GEQA 1YXDA 2ZRVA 4FZIA 1S2VA 3VOGA 4LB4A 3NYZA 4OBSA 3TV8A 1OEPA 1A4LA 2PU0A 1Q66A 1O6IA 3KBWA 5HWMA 2G0WA 3VIIA 2J9XA 1R9ZA 4RPQA 3H4GA 2WANA 3CZLA 2YBUA 3TLQA 4TX8A 2J7EA 2GL5A 2GVEA 3T4WA 3H54A 4ZB5A 3VOHA 2ZZ3A 5A95A 3FA5A 1EIXA 3R13A 2FTPA 4AQLA 2BSLA 4XZLX 3WNPA 1SO5A 1NFGA 2ZX5A 3LDVA 1QO2A 4D6HA 4H2CA 5LIUX 3ITTA 3DI1A 4UFIA 1R85A 4DUWA 1QWGA 2VCAA 1HJWA 2FVKA 3P0WA 4IUGA 4DQWA 4I9TA 3ZWSA 1B90A 1TPFA 1GOKA 4R9OA 1YX1A 4XAGA 1ONEA 2ZRZA 2BB0A 2FGZA 1XUUA 2GSHA 1DKWA 4DF1A 1SO3A 8A3HA 3USZA 1KBBA 2Z6IA 3EB4A 4ZO7A 5LYRA 3B0PA 2RUSA 3GXIA 1T6MA 1Q6CA 3O6CA 2GJLA 1PV8A 2XWEA 4LEQA 1BYBA 3MUIA 3N6HA 2NQHA 1MUCA 3KXQA 2H90A 3ONBA 3ITLA 4N9EA 3VGDA 3WH6A 2PB1A 1GJUA 1H2JA 2O9RA 1XRVA 3W1XA 1E1EA 1EF2A 3B03A 3W7HA 3KX6A 4IUOA 3WL1A 4ATDA 4B3LA 5JUVA 3LSCA 4D6EA 1JD9A 2JF6A 1SR0A 5GJMA 4FNTA 4LYQA 1LT8A 1WKDA 2Z1KA 3IPWA 1SGJA 2VEPA 2VC6A 5HQMA 1H41A 1VCVA 2ISWA 2OEMA 3LRMA 1MW2A 3W7JA 2PE4A 5HR7A 2XFRA 3M44A 3BG3A 4IISA 4F8XA 2ABAA 5GNYA 4IFKB 4JQ2A 2QUUA 3OQEA 2PP1A 4IT1A 4O15A 1K4GA 2OLAA 1RCXB 3LQGA 4UMAA 5AOUA 4HCLA 2Q71A 1KGUA 4BQ4A 3WNNA 4Q7BA 3K8LA 2VZUA 1KR0A 4OU1A 3DHDA 1NH6A 5LKYA 1W3NA 4X9YA 2ZRWA 5L9FA 2Y7EA 1DJQA 4GCAA 1UD5A 4Z17A 2EHHA 3FJ6A 3LXCA 4QAWA 1PUDA 2UY2A 1KV5A 1SJCA 1CNVA 1LT7A 4ZE4A 4GH3A 1PIGA 1EDGA 1L6YA 4GHRA 4DN1A 3A4AA 1RPKA 2WBGA 3EXTA 3GG0A 4GI8A 3TLLA 4HZ7A 2NV1A 1XIBA 3BOLA 1ZPTA 4W84A 5AKQA 2ODOA 3ANYA 2RJHA 5A2BA 4D6CA 3AISA 4PC8A 4E2OA 5JVLA 4HNTA 1JXKA 4O1BA 2QIIA 5JXQA 3IGSA 1UIPA 2PBOA 3BH4A 2QUNA 4N9CA 1A49A 1OFEA 1TR1A 2ZVIA 3GC5A 2WC3A 1PHQA 5CSRA 4NVTA 2GK1B 2X1TA 2PDCA 4RZ4A 4WVXA 1DEDA 3EX2A 4PMXA 1G9HA 4J40A 3RGTA 2EPKX 1W56A 4WJ8A 1N8FA 4FF7A 3GR4A 1UROA 5C5YA 4FP1A 5F4XA 3AYRA 3VIPA 2NX1A 2OT0A 2A5HA 3V0UA 4H9XA 3VM7A 1FWWA 4LX4A 4M29A 3G3MA 2ACSA 2VZVA 4B91A 1Y7VA 5AVHA 3NO1A 5D8ZA 2XSAA 2W6RA 1VJSA 4B3KA 2AL1A 1JZ4A 5C9ZA 2Z4GA 1Z48A 4LPCA 4NX5A 4AD1A 1S5WA 1WAUA 1GZGA 3EMCA 1AFSA 2VYOA 2VFGA 1QW9A 1JFHA 1SYTA 4QGCA 4DRSA 4V15A 4WJEA 5SWUA 3TONA 1NWSA 2Y62A 4X61A 1UWUA 1JEZA 2A3AA 3GZ3A 3VE9A 3REQA 2J6XA 3E2SA 2DT3A 4NZJA 2VURA 4CEXC 3O9NA 4MB3A 5C2CA 1S3TC 5HNRA 3MHUA 3DFSA 3UZZA 2HXTA 3QMRA 5FIPA 1BQGA 1W1YA 4IF2A 4K68A 3BANA 3DBNA 1Q3NA 4JIPA 4FXFA 1D3GA 2WSYA 3SFWA 1XYCA 1RP9A 4G2DA 4A8RA 3IWPA 4HMNA 4N0RA 1M53A 5F4SA 3M43A 5EY5A 2GGEA 3LBOA 1PAMA 4YTUA 5G2IA 4B92A 1IZCA 1XKYA 4JEJA 1WPCA 1HNYA 1CCWB 3L4UA 4HPJA 4UTLA 1QI5A 2QCLA 1UYQA 5BU6A 4K8EA 3ZLHA 2INFA 3MI2A 5LA2A 1UKTA 4AEEA 1QK0A 3CAQA 1YEYA 5FI8A 4U31A 4FPSA 4S2BA 3VDBA 2ZWYA 3KBMA 2EF9A 4DLMA 1EDTA 5JBDA 3DC0A 1A0EA 1Y8BA 4TMBA 1DJGA 3KAOA 1UWTA 2OG9A 1FCUA 1H09A 1MZRA 1QASA 2PTZA 3IRDA 3QQWA 3KOZA 1QPQA 3UJEA 1LBLA 2J7GA 4GYFA 4DUVA 5CLWA 4HZ6A 3THQA 2QJHA 3U2OA 3UZXA 5CPQA 2E40A 4FALA 4L4MA 4D6IA 4LYRA 3UJFA 1KWKA 5I03A 1GZJA 1B3WA 3BAJA 5A3HA 4PRRA 2HZGA 2V5LA 3EKLA 1WXYA 2TODA 1K4HA 2FPVA 2PWFA 4JTFA 4TUFA 4F2BA 3BLDA 3LHUA 2CBVA 1K3UA 5HNTA 2OOGA 1FHUA 3G8RA 1Y5XA 3EX4A 3WELA 1O4UA 2FB2A 1VAHA 1NWTA 1HVQA 2Z6JA 1R8LA 4GY1A 2HBXA 4O12A 4KS0A 1Q2RA 4DNHA 1Z8AA 1HW6A 4AYSA 4GBUA 3WF3A 2ALRA 5M17A 5LIYX 2J13A 1V77A 4MWAB 1MFUA 2ZUSA 3RJYA 2EPNA 1BQCA 1M1BA 5EMKA 3VIHA 1H0GA 3W85A 5AVNA 1RCOB 5HR6A 1KTCA 1XV8A 3BL3A 5ABGA 3BMWA 3K2GA 5C8BB 5I6SA 2I5IA 4Y8FA 1DBTA 5CPLA 2W4XA 2C0HA 3NOYA 3CMGA 5A6TC 1OG0A 2ZA3A 3SSZA 2OPJA 3HGOA 1OYBA 3K8KA 1H7PA 4HSNA 5HQLA 4KEVA 3GO2A 1DJXA 4HHHA 3C0JA 5HJYA 3CUHA 1ZAHA 3J7HA 1ZFJA 3V5OA 3QZAA 3WF2A 5BOEA 1YTEA 4H41A 1HKKA 1BVNP 5E0KA 5D4YA 3WK3A 3GIQA 3KS5A 1T7LA 2HK1A 1JF5A 1RK6A 4A3UA 3H2CA 1EJUC 1BPLB 1Z44A 2W79A 4DWSD 1V7AA 5HWNA 1R3WA 4E8DA 2OOFA 2CLLA 3LRKA 3Q37A 3WNOA 2HS8A 1VFUA 4AZ6A 3TCSA 3ZVIA 1WDWA 2BWGA 4UQ9A 4GNKB 3CUFA 1ONWA 4QLJA 4WIWA 2V9DA 5K9DA 3EDKA 3W84A 2A7NA 4AY1A 4LVFA 2PDQA 5D2YA 3TIMA 5GPRA 4Y9NA 3E2RA 3U9IA 1M7XA 4XIMA 3CEPA 5FACA 1LM1A 4ACYA 2E25A 5CQ1A 3OP2A 3TC6A 3GH7A 1XM3A 3CUZA 3UP8A 5CC7A 3UVIA 3KDOA 3EA3A 2EGZA 3NQGA 4XV0A 4EXBA 2PTWA 1E1CA 4V28A 3BWWA 4Z2KA 1SM9A 5HULA 1VYRA 3AXHA 3QHMA 3HQ1A 1QR7A 1AD4A 1UOKA 2J24A 1EZ2A 4JL1A 3VKCA 4AC7C 5AECA 1H7XA 3PAJA 4LAZA 1RHCA 3MHGA 1J2WA 1TE1A 3AYSA 2Y7DA 5A69A 1HJSA