5CGQA

Crystal structure of tryptophan synthase from salmonella typhimurium in complex with f9 ligand in the alpha-site and the product l-tryptophan in the beta-site.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Crystal structure of Tryptophan Synthase from Salmonella typhimurium in complex with F9 ligand and the product L-Tryptophan in the beta-site.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
total genus 101
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5cgqA00
1W54A 1O94A 1ONRA 3ABSA 1W5NA 3OIXA 1W3NA 3TU9A 4PA8A 4DF0A 1XUZA 1K7EA 1DHPA 3N9SA 4AWTA 3N2XA 2J9ZA 4ZQRA 4LWWA 1X6UA 3M5YA 1OJXA 1NVMA 4CLMA 4K36A 1TIMA 2VENA 3IRDA 3LTYA 3G1VA 4YXGA 1TO3A 2NLIA 2WQPA 3MW7A 5DELA 3IIPA 3W23A 3S5ZA 1OF8A 2J6XA 1TTQA 2YSWA 4ML9A 5C54A 1O60A 1MO0A 1YPFA 3F4NA 4EWND 4JS3A 1EP3A 5KZEA 3PSVA 2X2GA 3B0PA 1KLZA 4UFLA 3EWZA 1OX5A 4H3DA 3DU0A 5A5WA 1RR2A 3CT7A 1BEUA 1TV5A 3O05A 4ZL1A 2E5DA 1OFQA 3IV3A 3HQ1A 2ZZ7A 4AF0A 2Y7EA 1P0KA 1VC4A 3WJXA 1B57A 2Y63A 2P1FA 3A23A 1KFLA 2VOMA 3EX2A 2Q3RA 2FPTA 2PURA 2QAPA 4XBKA 5K9XA 3EXRA 3TMLA 5D32A 2CW6A 3U2OA 5CKSA 1JULA 2QCFA 1AW5A 2YGYA 3GKAA 3PSWA 1TREA 1D3HA 1P1XA 1L6YA 5D2WA 1HO4A 4JX4A 5F1UA 1DJQA 3OA3A 1NAL1 3L9CA 4OQVA 4ZQPA 2JK2A 3TC6A 3G24A 3UYCA 4PCFA 1M7PA 3GXTA 3LCIA 4UTMA 1F05A 2ZRVA 3N9RA 2YW3A 3S1UA 1EUAA 4LVFA 4AAJA 3DGRA 5DCBA 3MI2A 1YTDA 1UBSA 3MO7A 4FNTA 4GUIA 3W1MA 1SSDA 5AHFA 4NZFA 2VEPA 3G1XA 1SR9A 3BPWA 4ZQOA 5LSMA 3D0CA 1RZMA 1IXNA 1GYNA 2Y88A 5K3VA 2I9EA 3W9ZA 4LNYA 5HWNA 3DHFA 3NOEA 3ZWTA 3G1SA 3NA8A 3PF3A 3TSBA 3Q2DA 2E6FA 4YLWA 4RV8A 4DO6A 1MEWA 2E6YA 2ZZ2A 4ZQCA 3GX9A 3KVKA 5BMWA 3W1PA 3EWUA 3C6CA 2PC4A 2CLLA 4KFPA 1E51A 6ALDA 3QQ1A 3PC0A 1W8SA 5D38A 5CSSA 5G2WA 3MYPA 1ZNNA 4DQWA 3QQ0A 1VYSX 1G6CA 4DPPA 1D3GA 2IQTA 1OVDA 5AC8A 3FYPA 5DBTA 3B0VC 5LNVA 2J9XA 5EY5A 3LCHA 4LS0A 3SZ8A 4O1BA 3HG2A 2HMCA 1MEIA 3W7JA 4QAIA 3GXPA 4IQLA 5FF4A 1SPQA 1IIGA 5DLCA 4EF8A 2J9YA 3VCRA 2OX1A 1XDLA 4Y9AA 4UTJA 1ZAJA 3B03A 2WKJA 2DZXA 2ZZ3A 4TMBA 4EVZA 3W7NA 3QEZA 1MEHA 5FEWA 4QITA 3ABOA 5K7JA 2A85A 4OV9A 1NF7A 3OVQA 5LZLA 1KLYA 5EA9A 4AHQA 3PY2A 4NX0A 2VEIA 4W9TA 3L0KA 5F4WA 1FDJA 1VJIA 3O6DA 3O06A 3P81A 2Q8ZA 2V82A 1KM1A 2G97A 2FPYA 1XBVA 1KW1A 4IXXA 1K8YA 2V30A 3UZJA 1GG0A 5LNSA 3CHVA 2J88A 4CCEA 5D2YA 2R94A 2UV8G 3PG8A 5EL1A 1LRTA 1NSJA 1ZCOA 1T99A 1Q6LA 1Q6OA 1TQXA 4WJEA 3DENA 1R47A 3LXAA 1RPXA 2X1RA 4FF7A 4NZJA 2NWSA 3KVJA 3QSRA 4R7JA 3P82A 1GYLA 3FEMA 4PC8A 1TSIA 3MHFA 1OFRA 3GDLA 3FKRA 3NQCA 2VEMA 4MUZA 4MZ8A 2FFCA 1FDYA 5HUOA 3O8AA 1JCXA 1OFBA 4RXGA 1H63A 1EA0A 1P0NA 4UFMA 1KFKA 3N34A 2GJLA 4MZ1A 4Z0JA 3O16A 3P61A 2VC6A 2QCDA 4OT7A 3DFNA 1BKSA 1OYBA 3FJ6A 5E0KA 5AFDA 1HUVA 3DI0A 5I3KA 5TIMA 5CZTA 4DXVA 1RV8A 3CLMA 3W72A 3NQGA 3SGZA 1VH7A 1KV8A 5F4SA 1XBXA 3RK8A 5EMUA 4O53A 1ZHAA 3O15A 5AC6A 2ZRZA 3OVPA 3QJAA 4AWSA 3BARA 3NQ2A 5G2IA 2VXNA 3N14A 4XBSA 3DFQA 2ZA2A 4LRSA 2Z6JA 4LVAA 3C2OA 3EX4A 1QWGA 4A2RA 4UFHA 4NQ1A 3TXZA 4TMCA 1JVNA 4UUIA 3E02A 5LGXA 3Q94A 3GDKA 1IGSA 2WSQA 3C2EA 2QDHA 4BK9A 3UY8A 1EB3A 1VRDA 2HSAA 3W2MA 3NQ8A 1FCVA 1VQTA 3KVMA 2DZPA 1G7VA 3IGUA 2JKEA 2V2CA 4KWWA 4WQ6A 2RDUA 3OEXA 3TH6A 2E6AA 2NV2A 3G8EA 3A9IA 1KFBA 1T8XA 3QPYA 1L6SA 4DO5A 3NQAA 5D2VA 1UCWA 2CZFA 1QPNA 4POCA 5MHBA 1WDWA 1R2SA 3ZS4A 1S5VA 2ISVA 4CNNA 1TCDA 4RR4A 1NF0A 5SWUA 2V81A 2ATSA 3HPXA 3OBKA 2ZA1A 5D04C 2A4AA 3W6YA 3CB8A 4IUOA 3KRSA 4A22A 4UTKA 3NDOA 1OFPA 4K37A 4MY1A 1KTCA 3STCA 5HINA 4HT3A 1H61A 5I3FA 1SFJA 3NG3A 3RF9A 1I8JA 4IMGA 3W7HA 3DI1A 1JQVA 3BW2A 3T55A 3LCLA 4MJZA 4M5PA 3TXVA 2NX9A 4RLIA 5AHEA 3NR0A 4AWUA 1XM3A 1SZNA 4IMDA 5CSRA 1GOXA 5I3JA 3LB0A 1IF2A 3LI0A 4AHOA 5G5IA 4GC4A 3CIXA 3PS7A 3W7DA 1FY6A 1JCNA 3W7OA 3UWYA 4O52A 5F2LA 1TYGA 3LCXA 3NM3A 1F7BA 1ME9A 1SSGA 3LHWA 3UZ5A 4N9BA 2F84A 2Y6ZA 2X30A 4GUJA 3C52A 4QQ3A 2B7QA 3MHUA 4ADSA 2ZDRA 3C56A 1K3UA 3PBWA 3L68A 2X16A 5J5RA 3LCWA 3LTSA 2JGYA 1U83A 1AL7A 5D03A 1LBLA 4HSNA 1BWLA 3WJZA 5F2IA 3G3MA 3SW6A 2AGKA 3U6WA 1VCFA 3QH2A 4DO4A 2ZRYA 3SECA 2C19A 2YW4A 1KM6A 3TDFA 3ZR4A 2Z6IA 3C2VA 3UWQA 4LTSA 4JTJA 5I3GA 4DELA 4O13A 3ZWSA 5KMYA 1VPXA 1ICQA 4JTTA 3G8RA 3P62A 3G1YA 3QMTA 2OZ0A 2A1YA 4OBTA 4WZHA 2VFDA 3DXIA 2QF7A 3B8DA 4L4LA 3SIZA 4LVDA 4GUGA 5FESA 1NFBA 3VE9A 1OK4A 1BTMA 4XKYA 3W71A 3QRHA 3UPBA 3RLVA 4WY0A 4N6EA 5IM51 1DQWA 1AL8A 4LV9A 1MSSA 3IEBA 4JDBA 3TAOA 2X1TA 3ABQA 1EP1A 3I65A 4YMZA 4E2BA 3UWVA 3IVTA 4MFEA 3O07A 4RJEA 1R30A 3MMTA 3S5YA 3W2NA 4WXYA 3IIOA 2FPVA 4MLRA 1TPB1 1A5CA 1K8XA 3R89A 1KV5A 3BGGA 4FNRA 4NJKA 4HNVA 2J24A 2EKCA 2H8XA 3L0GA 2ZZ6A 3I6RA 1J5TA 3STEA 3ZFHA 4E38A 2AAMA 1S3HA 2DP3A 3TR2A 1WXJA 4GBUA 2YR1A 1P5BA 2PCQA 4Y96A 2YFOA 3A5VA 4HNUA 2GUUA 4O1CA 1YXYA 1ZJIA 1WA3A 1WBJA 4JY9A 4JTLA 4N9EA 4Z1AA 2A7RA 3S42A 3KAOA 4KFOA 5HUPA 3QW4B 3W3OA 2H6RA 3HPZA 1AW1A 4QM1A 3RLUA 4O57A 3TUUA 3CWNA 5CZSA 4IMEA 4MIMA 1F76A 4UCGA 4AVFA 2CLFA 1QDSA 5G1TA 4O1DA 3F03K 5CPOA 1CX9A 5AC7A 1SO4A 5C2XA 5C6MA 4BWLA 4MPQA 3MP3A 4FNPA 3GLCA 4BWLC 1G4TA 1TRIA 4Q4KA 2XN2A 3THAA 3BK0A 3P8IA 4IJBA 3G1DA 2B7PA 4N9DA 2DJLA 1F74A 1JUKA 5BMXA 3S9YA 3SI9A 3MI6A 3L21A 1CW2A 4HIBA 3TJXA 4LV4A 3CU2A 5CPMA 4LUJA 4AXKA 1YXDA 3TROA 4JX5A 1YTEA 2WSRA 3M5XA 1QFEA 1VHNA 3TAKA 3W74A 2A6NA 4FHAA 1WAUA 4LC8A 1G4SA 3QC3A 1K7XA 3TQVA 4Z1DA 4JTEA 4A21A 2X1SA 2QDGA 5LKYA 4GUHA 5DXYA 1DL3A 3W7MA 2G5WA 4IX0A 3W88A 3W70A 5DY3A 1ADOA 5CPNA 1H7WA 1TJRA 1FWSA 1IIHA 1LCOA 3OG3A 4NJGA 2A5HA 4O0ZA 3PULA 1KFJA 2EAWA 1FDZA 5A8GA 2Y7DA 4BI6A 1W37A 3DH7A 3R5EA 4HSOA 1WBHA 1PHWA 3W1QA 4UTWA 1L9WA 5HNRA 5BOOA 4PTNA 5CG7A 3LV5A 4UTWC 2RKXA 3GAYA 1ICSA 2V5BA 5EYWA 3VKJA 3G1FA 4UTTA 2VFHA 4UTTC 1AK5A 5D09A 1HTIA 5KTLA 4DBDA 3NVTA 3PBYA 3QW3A 2X1UA 3F4WA 2WNNA 4JY8A 5CPLA 1TTIA 4XWUA 1P4CA 3W2LA 2B4GA 3I7QA 1VHCA 2HS8A 4O14A 2HTMA 2LLEA 2PRHA 4TU1A 3AO0A 3W1NA 3H53A 3MHGA 1OX6A 1H51A 4EF9A 1Q6RA 1F6KA 1YXCA 3B0UX 3EX1A 3KRZA 4EIVA 1B9BA 3EXTA 2NUWA 2HS6A 5KITA 3THQA 1A5SA 3V1PA 2PRMA 1W31A 3GR7A 3LCFA 3QM3A 4H4IA 3LHUA 1AG1O 3RU6A 1GVFA 4U28A 1GEQA 1RQHA 3LXCA 1A5BA 2WJZA 4RCXA 3GVGA 5K2ZA 3W1UA 3BVJA 3GNDA 3PBVA 1XBZA 2E1DA 5FEPA 3PG9A 3CEUA 4O10A 1YYAA 5AHLA 3SSJA 3DBPA 2ZQ0A 1YADA 2KZHA 1SW7A 1OYAA 5HJLA 5DN1A 4HPJA 2ZZ5A 3IGSA 4RXFA 4ZZ9A 1H7NA 1JUBA 3UD6A 4YCPA 1FBAA 1V7YA 1I2RA 5DCDA 3W7IA 3LRKA 3I7SA 4UR8A 5I3HA 1OABA 3M47A 4NJHA 3P74A 4IMFA 3TQ0A 3LHTA 2R91A 4GJ1A 4TO8A 2C18A 4UR7A 4NXSA 4GNJA 4LC6A 3NGJA 4JTGA 5DBUA 5F4XA 1XC4A 2QCMA 3QSTA 5CZ0A 3U8GA 1TRDA 2JBMA 3ATZA 1KM0A 3KXQA 3LM7A 3EKLA 4WOZA 2QJGA 3TMQA 3NQFA 5U7SA 4QISA 1GPWA 3PUOA 2QCCA 2V0TA 4MJMA 5FI8A 5AHIA 3FLUA 3T78A 1FWWA 2GVJA 1H1ZA 3EXSA 3LX9A 4O18A 2CFFA 3NQ7A 2ISSA 1LRQA 2ATMA 4Q32A 3HF3A 1YDOA 2YX0A 2FLIA 4IPIA 4NXKA 1VLWA 3K30A 1FWRA 1EEPA 1F5ZA 3MBDA 5D37A 2EHHA 2CU0A 4RZ6A 4TR9A 4S2BA 4ALDA 3A21A 1KM4A 4GWEA 1G67A 1B4KA 2ISWA 3G1AA 3IVUA 1W5PA 4FX6M 1FQ0A 1SW0A 1AW2A 3L5AA 3CEPA 5FF7A 1S5TA 3PBUA 4O54A 1I45A 4O4WA 5DXXA 5KZMA 2A7PA 4ORIA 2NXGA 3EB2A 3CQ0A 4NX5A 2RDTA 1LBMA 2BTMA 1FXQA 3W7QA 4LVBA 4R53A 1WV2A 3LLDA 1Q45A 2QEZA 3RMJA 3N2MA 2XN1A 4I7VA 3TA6A 1QPRA 2P0OA 4XKYB 3N73A 2GQ8A 3MP4A 3MI3A 4PL1A 4IX2A 1KBJA 4WY0B 1C9DA 3OHIA 3PAJA 2QCNA 4MOZA 4I9AA 4RZ4A 2EGZA 4R34A 3W2UA 4WX2A 3NPWA 2ZTJA 3M5ZA 1JCYA 1VCVA 1OX4B 2CZ5A 3L66A 2OMAA 3BLIA 1LZOA 4AEOA 2NWRA 5HQEA 4MY8A 4GFSA 4PEKA 1IXQA 5D02A 2E77A 5G1YA 2QR6A 2YPIA 2Z0IA 4K7YA 1ME8A 2A2IA 3S5NA 4E2DA 3MBFA 1HG3A 4CCDA 4O15A 3NL5A 4CQ8A 2E5CA 3TIMA 3IVSA 2Y7GA 1LORA 1UJPA 1C29A 4BR1A 5AYZA 1F2JA 3HJZA 3WJWA 3LI1A 5TQLA 3WK0A 1QMLA 1EIXA 4FEZA 1Z41A 2NX1A 1Z42A 1MXSA 5HR6A 1DQXA 3HG4A 3G3DA 4K38A 4LVGA 5T26A 3FOKA 2OCZA 4A2SA 6TIMA 3P8JA 1A53A 3IGXA 3BO9A 1H7RA 1GTHA 2V5LA 1W5QA 2YFNA 1H5YA 4M6VA 1HFBA 4UMBA 1I2NA 3M16A 1YTKA 1YLVA 3PR2A 3B05A 3HIJA 1SZEA 1RVGA 3QMRA 2QKFA 3NQMA 3O63A 2EPHA 4ADUA 3R12A 2YZRA 4FXRA 4N4PA 3NPXA 2VKZG 5LGZA 3HGRA 4PODA 3UXDA 4QIUA 4UXDA 1UASA 3NPVA 1EX5A 1TPFA 1XL9A 2C0AA 4M7TA 4JTSA 3TQKA 4K39A 4O1AA 3PUEA 3CM4A 1R46A 5HWJA 2VFEA 4K7VA 4O50A 2C15A 4GRSA 4YWIA 3SGUA 4P2VA 3GB6A 3NZ1A 3WJYA 1VLIA 3GR8A 3QPZA 1KFEA 1PL9A 4D2JA 3W2JA 3P7YA 3STFA 4WOQA 3HOJA 3TV8A 4AF0B 2TSYA 1Z48A 2QUTA 3CIWA 4K8HA 3SY5A 1EWDA 1TV8A 3KX6A 5LNWA 3TJLA 3HGOA 1TMHA 3KRUA 3TSMA 1WYIA 4BF9A 3W7RA 2ABBA 1KM2A 1JCJA 3NO5A 1W5MA 1JCLA 4WD0A 2RFGA 4FX8A 4LY8A 1QO2A 3BG3A 4MLJA 1ALDA 4ZMGA 1KM5A 1DBTA 2FIQA 1VZWA 4LRTA 4JTKA 4IMCA 4O11A 1X7FA 4XTDA 3MP5A 1OF6A 1TQJA 4FX7A 2VEKA 1XI3A 4GXMA 1QOPA 2DU2A 2A0NA 3LV6A 5I3IA 4NNCA 4O0KA 4C1LA 4UTUA 2NXHA 4DPQA 2NUXA 5D2XA 2V2DA 3KVLA 2ZYFA 1W3IA 3TFXA 4FIQA 1HO1A 4IOTA 3UWWA 2P10A 4OU1A 3M43A 4TIMA 3LBCA 3JS3A 4N02A 3BW3A 3W2KA 2O7QA 1JQXA 1QR7A 5C55A 3WFAA 3G1HA 1PCWA 2CZEA 3LDVA 4FB7A 1SO3A 3M9YA 1M7OA 4N2YA 4MKNA 3S6DA 4X3ZA 3W7KA 3UQNA 1M5WA 3EEGA 1W56A 3W7PA 1KA9F 2DZWA 3MWAA 2GQAA 4Y8FA 4RZ5A 4JICA 4S1FA 1T0OA 1G4EA 1TV7A 2V9DA 3T40A 1FCUA 2QCLA 4A3UA 4N9CA 1O4UA 3STGA 3GNNA 4JN6A 2C1HA 3P5YA 1GVQA 3P5ZA 2DZUA 3NL2A 3UXAA 4LOCA 2QCHA 1G7UA 4FNUA 3W22A 2DJXA 2CLIA 2Y85A 1O5XA 4YL2A 4JNMA 4LUIA 2GJNA 3L2IA 1R2RA 2R8WA 1XCFA 1VYPX 2FDSA 2NXIA 3CPRA 4IPJA 4AMAA 5IBXA 1PVNA 2FB2A 1RQEA 1LBFA 3DAQA 2RHGA 5IBXC 2RH9A 3E9AA 2Y7FA 1G4PA 3W1TA 3W1XA 3G0SA 1JCMP 1OYCA 2W79A 2A6LA 1SQ7A 2A21A 1R2TA 4OGZA 3HGSA 2C6QA 3TCEA 3UNDA 8TIMA 3TW7A 3JR2A 4MY9A 3E96A 1GVRA 3C8FA 4I7WA 4DBEA 2GVGA 2WPBA 3N19B 4PL2A 4JIPA 4K8EA 4JTFA 4OE7A 3C2FA 3EX6A 2WOQA 3M5VA 4UFKA 1VS1A 5H91A 1I2PA 4MVAA 4RK8A 5C5YA 4MYXA 3GK0A 1SZFA 1TB3A 2A7NA 4UTLA 3HB9A 3NPUA 3QYQA 3PUDA 3FJLA 2PE4A 3HO8A 3GDMA 3TFCA 2NV1A 3TK7A 1KTNA 1FWNA 2DZSA 3R8RA 3GZ3A 3FFSA 1JR1A 5CGQA 3N3MA 3LHYA 2E09A 3W75A 1GVOA 2OT0A 3W84A 4O12A 5E93A 3S0CA 3NYZA 3LGEA 1QPQA 4HKPA 2CLKA 1X1OA 2QCDB 1SU5A 3P60A 4FNQA 3BW4A 2I1OA 3AJXA 1Q3NA 4TX9A 1J2WA 3DFSA 1H62A 1TPVA 2WSYA 1K02A 4Z0SA 3DHDA 2DZVA 1ME7A 3LLFA 4B5NA 1WOBA 1GZGA 3LRMA 2ZA3A 1LP6A 3TKFA 2XN0A 4GUFA 3SR7A 2ZRWA 3FA5A 1LOLA 3P80A 1OFEA 4JTUA 3USBA 2NZLA 3G0XA 3LRLA 4GE8A 3QMSA 5AOUA 5G4EA 4Z1CA 4JEQA 1T96A 4ORMA 3FIGA 3LOTA 2GQ9A 5K4ZA 2Y62A 1GWJA 5BW6A 1FCBA 3INPA 1ZAIA 3W7LA 1K7FA 1M6JA 1FCQA 3MUXA 1SUXA 1Z44A 3T44A 5AB3A 1ZALA 3S8HA 3B06A 4ONVA 3S1VA 2ALDA 2H90A 3M6YA 1JUEA 3IIVA 3G18A 1WOAA 1LTDA 4IXHA 3T4CA 3ATYA 2BLEA 1LRNA 3EX3A 4CQ9A 2FJKA 1I4NA 3VI2A 5BRBA 2ZZ1A 2WV8A 3P84A 1LYXA 1FUYA 4O28A 4HPXA 1LM1A 3GIYA 5BNKA 5KZDA 2D73A 1EP2A 4OV4A 4O8RA 4UTHA 4O17A 4MFDA 2ZRUA 5AYXA 4NNAA 1SW3A 3W87A 4XQ6A 3BG5A 3EWYA 1WX0A 1XUUA 2CZDA 3C4UA 1QO5A 3TC7A 5L9FA 1PHQA 1TJPA 4ICNA 3QFEA 2B0MA 3IIXA 3W86A 3LHZA 2ZCGA 5ABTA 5D2TA 1W0MA 5D05A 5G4WA 1PE1A 3QZEA 3BGJA 3VNDA 5J5DA 5LHFA 2Z1BA 3WK2A 4Y90A 1PV8A 4ZVJA 3VE7A 4ADTA 2ZTKA 3NQ6A 1YDVA 5EKYA 1I2OA 1EPXA 4UC5A 3O1NA 2CLOA 4JD4A 3BV4A 1VYRA 3DFTA 3ANYA 3NQEA 2C14A 5K4XA 1QCWA 4OHQA 1DOSA 1H7PA 1J4EA 1OG0A 4UTIA 1O5KA 2WO5A 2FQIA 2BXVA 1DORA 4J9JA 3HG5A 4JIQA 3IIZA 1JRCA 1OK6A 3YPIA 4A29A 1FX6A 2W6RA 4XZ9A 3NZRA 3NQVA 4O16A 4HNNA 1L6WA 4DEFA 2TMDA 1UB3A 1I2QA 2TPSA 4N6FA 5K9DA 4FO4A 3PB0A 1ZENA 4NVTA 2R14A 2VFIA 4WXZA 3NXFA 3W1LA 3M44A 5FF3A 3KFTA 3O6YX 2TYSA 4JR5A 2DZTA 4UMCA 4YCOA 3WJSA 4Z1BA 2Q8LA 2ZRXA 3E12A 1TTPA 1SO6A 3L5MA 4PH6A 3A5FA 3H54A 2QCGA 7TIMA 1X8FA 4CNOA 3M7WA 4NJIA 2C13A 2PRLA 2Q3OA 4JGDA 3W83A 3GKFA 2QJHA 2ZFAA 2Z2UA 1FWTA 1L2UA 3NNTA 1AMKA 3NL3A 1Q6QA 4KWVA 4M6PA 1BWKA 4R33A 5D30A 5DCEA 1C8VA 1WQ5A 4QJ1A 3FYOA 3NM1A 2TRSA 1OFAA 1YPIA 1XKYA 5HWMA 1K8ZA 1DV7A 1ZAHA 4P61A 1V5XA 1ZY9A 2H3BA 1QOQA 2XFWA 1THFD 3KHJA 3LXBA 1B4EA 3L65A 1HL2A 2QCEA 3DKLA 4LT9A 5TBOA 3TW6A 1X1ZA 2QUVA 3NQDA 4K6AA 3EWBX 1H50A 4RX0A 4JDYA 4AHPA 1XFBA 4X22A 4MYAA 2YXGA 2FB3A 2JKPA 3LTPA 3CTLA 4MZYA 3RNDA 1DJNA 1B3OA 5G2HA 1KBIA 3WK1A 1GG1A 3B04A 4E0CA 4KKXA 3W76A 1W3TA 3UY7A 3EWWA 3HGJA 1RQBA 4LS1A 4EOUA 1DKWA 1U5JA 1XBYA 3GYEA 4M6QA 3W1RA 1GT8A 5U4NA 1OFOA 3S1XA 4AH7A 4CCCA 1TPDA 5H2ZA 1LROA 3PB2A 3EWXA 3UPWA 1YDNA 2ZZ4A 1RD5A 3LBMA 4UNKA 3NAVA 1MZHA 1XDMA 2GOUA 2VELA 4UFJA 3SFKA 1O95A 2QJIA 3M0ZA 4JTIA 4JYFA 3DFOA 1TPEA 4OWGA 4NUWA 3W7GA 1A50A 2E6DA 4H6KA 2BX7A 2YYTA 2H8ZA 2G96A 2CLHA 4IGHA 2NUYA 5FF0A 4HNTA 4FIRA 1ZFJA 4O19A 4Q33A 2J27A 4I7UA 1F6PA 1TPUA 2YDAA 2NX3A 1PIIA 1EUNA 4M7SA 5LNRA 1F73A 1GVSA 1UUOA 4HN4A 3GXNA 5EPDA 1VR6A 1PS9A 1QNVA 3S1WA 3RFAA 1N8FA 2ABAA 1D9EA 1QAPA 4BFAA 4UMAA 2VFFA 4NT0A 3W7CA 3G22A 2GVLA 3BG9A 3CWOX 2YYUA 3L0NA 1TPC1 4JXCA 1N7KA 2AQWA 3ABRA 3UWZA 3M1ZA 3T7VA 2VFGA 2QUUA 2B7NA 4JTHA 1H60A 3B4UA 4C1KA 2CLEA 4S2CA 4JX6A 1KFCA 3W07A 4L4MA 4BI7A 2C3ZA 3I7RA 3LHVA 4X2RA 2GPTA 2OT1A 5E1QA 4ZQMA 3A22A 5AYYA 1TPH1 4PFMA 3HPSA 2RDWA 3MYOA 3OVRA 3R2GA 3TNOA 3A24A 2QAFA 3UWUA 1Y0EA 1TPWA 2ZBTA 3HG3A 4JYDA 3V75A 4XUGA 4DF1A 2Y61A 2V2HA 2C16A 4N4QA 5GVJA 3LCGA 3W73A 4Y6GA 3C3NA 4JYEA 2WNZA 2W0UA 4KFNA 1LLZA 3E49A 3C61A 3W1AA 1VCGA 2DORA 3F1QA 4FXSA 3M41A 4QNEA 3SJ3A 5L6UA 5KSWA 1W1ZA 5AHMA 3W85A 2Y89A 3MJYA 1IXOA 3HBLA 1ML1A 4CNPA 1GTEA 2JKAA 3W7EA 1ICPA 4ZQNA 3TE9A 3L5LA 4FNSA 1LDCA 1LOSA 3GAKA 3WK3A 1H7XA 3GDRA 1DVJA 4M19A 5HULA 4RKAA 3H55A 3PWAA 4UFIA 5AHNA 4LW7A 1LLWA 3G0UA 3LERA 2YCEA 1CI1A 4NNBA 3HMJG 1A5AA 3DFPA 2OJPA 2E5BA 5FEZA 1KTBA 3KOFA 2BWGA 1TTJA 2WNQA 3O6CA 5HR7A 2I14A 1G69A 3PVFA 3R13A 3NL6A 5FEXA 5F2MA 1SO5A 2EF9A 2B7OA 2G95A 3EKZA 1SZGA 5D33A 3I68A 2H3DA 1VGAA 3P67A 1H7OA 5DY2A 2V8ZA 4U4MA 3DKJA 3TSDA 4WUIA 5FF2A 1SFLA 4XTIA 4IWWA 4BI5A 1H1YA 1OX4A 4LS2A 4X9SA 2CWNA 3ELFA 1EWEA 2FTPA 3TX9A 1PCKA 3BLFA 1IXPA 1S5WA 2BSLA 4QSHA 5F1VA 2BZNA 1N55A 5LNUA 4O4VA 3S5OA 5HMSA 1GJPA 4UNLA 1K03A 3FKKA 1QPOA 1XXXA 1JJKA 3Q37A 2F7FA 1OFDA 3GDTA 3QF0A 1OHLA 3Q58A 3E0IA 5F2GA 5LHEA 2Y70A 4CQAA 4HHPA 4Z08A 3VFLA 3JRKA 4G1KA 3C0JA 3C2RA 4UIOA 1LOQA 5CZJA 4WY0F 3L67A 3NEVA 1KM3A 3CC1A 4QNWA 5KINA 5K9CA 4LU0A 1UUMA 4AB4A 1JRBA 2E68A 2CLMA 2O7SA 4NJJA 1FXPA 3BLEA 1W5OA 1GQNA 4DF2A 3FS2A 3DZ1A 5AN7A 2JGQA 1NEYA 3PM6A 5EBUA 4NU7A
chains in the Genus database with same CATH superfamily
1W54A 1O94A 3ABSA 1W5NA 1G01A 3TU9A 2WC3A 1C91A 1DHPA 3CQJA 1E6RA 3CTTA 3DG3A 1OADA 3D3AA 1FP9A 2RGMA 4CVUA 4DN1A 3BANA 3CQKA 4CLMA 4Q22A 1TIMA 3LTYA 1GQIA 2XVLA 4H8VA 2J7DA 5BROA 1ISZA 1REQB 3MW7A 5DELA 3GXMA 3IIPA 3UXKA 2PWDA 1GZJA 4C6PA 2HDJA 4ML9A 1X96A 2J79A 2C1GA 3VCCA 1HF6A 4JS3A 5DFAA 4PUDA 3PSVA 3CT7A 1BEUA 1TV5A 5A8PA 1QXLA 3IV3A 2O4QA 2ZZ7A 3GW3A 4J27A 1KCLA 1FHVA 1V77A 2Y63A 3AYSA 5AC4A 1M65A 3E2VA 4WR3A 3EX2A 1YKWA 2G4FA 4PUNA 4XBJA 2DY3A 3AXMA 4QR6A 2QCFA 1AW5A 5DEZA 4L1GA 1UD2A 1P1XA 1L6YA 2E8ZA 5D2WA 5M2FX 1HO4A 2W66A 3SCOA 5LIYX 1DJQA 3OA3A 4PCFA 2VEGA 3GXTA 3LCIA 3NZQA 1XIJA 1EUAA 4LVFA 3DGRA 2DGAA 3EDDA 2WMGA 3F5JA 3SCNA 3KL3A 2CPUA 2PA6A 2PCEA 2D3LA 3KCOA 3WLTA 3OGRA 1SR9A 3BPWA 4ZQOA 5HWNA 3DHFA 4IG2B 1PXGA 2L5HA 3ZWTA 2PTYA 2BY1A 2HISA 3TSBA 1OGGA 4YLWA 5D4YA 4LUSA 4QDPA 2ZUVA 3C6CA 1XWYA 2PDNA 3PTKA 1E51A 1OGBA 1EEXA 2JF6A 5D38A 4CN6A 3QPEA 3LGGA 1TWDA 1ZNNA 4BEQA 4JPGA 2DSKA 5DBTA 3B0VC 1RALA 5C9ZA 3LCHA 1U1HA 3CWHA 1MI3A 4H19A 1PSCA 5AKQA 3W7JA 4QAIA 5LA0A 1YW1A 2JIWA 4EF8A 3KZPA 2OX1A 1XDLA 2FYMA 5E5CA 4UTJA 5HNUA 5DMYA 1UR2A 2A3CA 5CQ1A 3EKGA 2WKJA 2DUXA 2DVXA 2F6UA 5FEWA 3NURA 1EJWC 3SB0A 4LYKA 1XIGA 1KLYA 5EA9A 4AHQA 3PY2A 3CHEA 4W9TA 3PZQA 1VJIA 2VJXA 3VGHA 4WK9A 2CBVA 2Q8ZA 1R3VA 4RE0A 7PTDA 4MGGA 1ZBVA 1KW1A 3F4VA 4F66A 4JIRA 3ITYA 3UZJA 4KWOA 5LNSA 3JVAA 3CHVA 2QPUA 4CCEA 3DFYA 3EA2A 2UV8G 3PG8A 2HVNA 2PUZA 1NSJA 1T99A 1TUXA 1JYWA 1RPXA 4FF7A 4NZJA 2NWSA 3KVJA 4F0LA 4DZ5A 1V03A 4PC8A 4AD4A 4H01A 4JTCA 1JXKA 2VEMA 1XIMA 2Y4SA 4OOUA 5ABGA 4QJ4B 5CLTA 5HUOA 3VIHA 1OFBA 1QK2A 3SCRA 4H9ZA 1GCYA 1KR1A 3DFNA 1BKSA 3R0UA 3FJ6A 3H4WA 3A4AA 1XG3A 2C0HA 1FWDC 1CXFA 1RV8A 3CLMA 1TA3A 1B31A 3NQGA 1VH7A 2I5QA 1FKWA 5F4SA 4PGLA 1RD6A 3B8UA 1DJGA 3O15A 3QJAA 4AWSA 1E0WA 3NQ2A 5G2IA 2VXNA 4XBSA 3TONA 5A6MA 1VEMA 3R1ZA 2PWEA 4PTXA 4TMCA 1XYBA 4B5SA 1Q7ZA 1XCWA 1IGSA 4D6JA 2VI0A 4WGHA 4EXQA 2WNWA 4MF4A 3SN4A 1FCVA 3DGBA 1A5UA 3BGAA 4KWWA 3OZOA 3IACA 4AX6A 1XGDA 3G8EA 2E40A 3A9IA 1EF3A 4EPBC 4M3PA 1KFBA 4DO5A 4UQEA 5MHBA 3GG7A 1EJ7L 1QI4A 3TVAA 2D2HA 1B3ZA 1ADDA 1BXCA 1Q8AA 1U2YA 2Y5SA 1ZP4A 4C6MA 3O3RA 3PJTA 2WHMA 2WM1A 4IUOA 4UTKA 1KO0A 2GVEA 1FWEC 1OFPA 1EYWA 4MY1A 2AOSA 2JALA 1KCXA 2G3MA 3VIJA 1SFJA 3REQA 3RF9A 4AY7A 1JQVA 3T55A 1VIZA 3FYYA 3VAVA 3FHAA 3OOQA 4LYQA 3NR0A 2J7GA 4F8XA 2BFGA 4AWUA 2UY4A 1GOXA 3ARUA 1A3XA 2ZX9A 2QF8A 3LZ3A 4ZGYA 1HKKA 5G5IA 3CIXA 1P6CA 3FNDA 1Z69A 3LCXA 3NM3A 1GORA 4URIA 3W24A 2CERA 3UWEA 5REQA 3C52A 5BWFA 1XLGA 3ZXWA 1GW9A 2PB1A 1VB9A 1WXZA 2W63A 1J18A 4GCXA 1U83A 3FEQA 1BWLA 3UP8A 2PEVA 2O4MA 3DC8A 1XRVA 3WJZA 3C2YA 1EBHA 3GUGA 4RDVA 3QH2A 2BY3A 4US6A 3LMZA 1W9PA 1AUSL 2YW4A 1B3VA 2V5CA 3UWQA 4LTSA 4GI4A 4JTJA 4KRZA 1VPXA 1TZZA 1K8CA 3QMTA 4UQDA 2A1YA 3QOKA 3DXIA 3ZIZA 3SIZA 1KXHA 4LVDA 2ACQA 3VX1A 1OK4A 4RNJA 1N82A 1BQCA 1BTMA 2BOEX 3W82A 2PDYA 3UG5A 3VNMA 3MJMA 4WY0A 1Y5WA 1DQWA 3ZJKA 3CBWA 2VX7A 4GABA 3NEHA 3IEBA 4QP0A 1EP1A 1HIZA 1RY0A 3I65A 4XVEA 2GZXA 4AIUA 3UWVA 3SN0A 3QZ6A 3HQNA 1H0IA 2Q02A 1QWKA 4MLRA 2BVYA 1A5CA 4NJKA 4HNVA 2XDFA 2J24A 1R3SA 2OU4A 3DYPA 4GIYA 1J5TA 3AHZA 3H12A 3P0XA 1S3HA 2DP3A 3TR2A 1WXJA 4YTQA 3N2TA 2GUUA 3GTNA 1M7XA 3EAUA 1NP2A 1W17A 2EXOA 4FK9A 4HB7A 1UG6A 1MFUA 4JTLA 3WLMA 1W1PA 3KAOA 5HUPA 3QW4B 2Z7GA 4X2PA 1J0ZA 3RLUA 2VX5A 1A0EA 4LQ1A 1EO7A 3TUUA 2D0GA 1JAKA 1F76A 1NQ6A 2WHKA 1H4PA 4EXAA 4AVFA 1A5NC 3TJ4A 1EL3A 2EEXA 5G1TA 5GJPA 3BICA 5CPOA 1UR1A 3QR3A 1CX9A 5AC7A 2POZA 4HYRA 5EMLA 3MP3A 4ZXOA 4N9DA 1JUKA 3KCJA 1PUDA 3L21A 4Q7BA 2CC0A 2PWUA 3TJXA 3CU2A 3L2MA 4W85A 1OIMA 3QV7A 5CPMA 4Q8MA 4LUJA 4AXKA 1YXDA 1XYCA 4X0NA 3NXLA 2WSRA 1QFEA 2QVHA 1HJSA 4FHAA 1S2VA 1RJRA 2D0HA 2PDIA 3VD7A 1F3XA 1K7XA 1DWAM 4V15A 2EJ1A 4HNLA 2G5WA 4IX0A 4GY7A 2PWVA 3W70A 1J2BA 1ADOA 4Y9PA 4H6RA 1TJRA 5JBFA 1LCOA 4Q4PA 5CBIA 1IYXA 4Y8EA 2EAWA 4PSRA 4BI6A 2IQ0A 3MKVA 1AVAA 2IXUA 1TA3B 4UTWA 2FVLA 4UTWC 2WM0A 1ICSA 2DQXA 5EYWA 3E0WA 3TLQA 3K5XA 3IJQA 3QQWA 1HTIA 2MANA 3QW3A 2X1UA 1ISVA 1P4CA 2P3EA 5E6YA 2YDSA 4H9XA 1VHCA 2WBGA 4H04A 2VRKA 2HTMA 1X6NA 3AWOA 4EF9A 1F6KA 3EWCA 1YXCA 3B0UX 1JF6A 4PMJA 1XLFA 1B9BA 3WD4A 3EXTA 2D1ZA 2ZICA 2PI6A 1Z32X 1TJ1A 2NQHA 3QHMA 3B9AA 1DJHA 5BYWA 1AG1O 2ISDA 1GVFA 4U28A 3H21A 1DJXA 3GW0A 3AYTA 4RCXA 4GYKA 1MNZA 5K2ZA 3BLKA 3W1UA 2QUMA 3NGFA 1OD0A 3GNDA 1XBZA 3PBVA 5HJXA 3PG9A 5AHLA 3SSJA 1EX1A 2GOKA 1YADA 4MMWA 3EMQA 3DDMA 4KRUA 4AZGA 5HJLA 2DFAA 3GBDA 4AD3A 4HPJA 2ZZ5A 3CAQA 2PU1A 3IPWA 4IQDA 4CEXC 2YL5A 4ERAA 4PUJA 3GVRA 4DYKA 1FBAA 3B40A 1I2RA 3LRKA 4TTGA 2FTWA 5C7VA 2QQ6A 1XINA 3REQB 4QXIA 1EJUC 2XZ7A 3QGAC 2R91A 4XZBA 1TELA 3M0IA 4HCDA 1C93A 5DBUA 2I7GA 3QSTA 5CZ0A 3APGA 1BAGA 3ATZA 3JZEA 3PTDA 3CZJA 1HN1A 2FZDA 5B7ZA 4JQAA 4ZOEA 3RPMA 4OZOA 1EZWA 3EZ4A 3FLUA 2GVJA 5CPTA 1BHGA 3AUJA 3H8AA 4O18A 1B3YA 4MNLA 1BYCA 4YTUA 3NQ7A 3BJSA 1NARA 1YDOA 5G4HC 2FLIA 4IPIA 4NXKA 3M0JA 4K1GA 3URNA 1UZDA 5HK4A 1F5ZA 3ZQ9A 3MBDA 2PGWA 5D37A 3CUXA 4TR9A 3VGBA 2HVMA 3UEQA 3A21A 3UCDA 3E0VA 2QIIA 2Z2BA 3VYLA 3A3HA 4FX6M 3AICA 1AW2A 5FF7A 3QY6A 3PBUA 1AH4A 1D8WA 5DXXA 4IHCA 2VGFA 3WN6A 1W2VA 4DBSA 1DXEA 3EB2A 1PPIA 2CZVA 4NX5A 3W7QA 1R7AA 1K9FA 4JCLA 1N2VA 1Q45A 2NT1A 1IHIA 1BRLB 1EKOA 2QEZA 3RMJA 3N2MA 2XN1A 4L56A 3TA6A 1DJWA 1QPRA 1K9DA 3RN6A 1CT5A 1RJPA 4WY0B 4Z2GA 5CC5A 4RZ4A 2ZTJA 1D2KA 1JCYA 1VCVA 2DW6A 3SRKA 3VIPA 1LZOA 2NWRA 5CPSA 1EOKA 2FH8A 4MY8A 3UT0A 4PEKA 1W3LA 2XH7A 3R8GA 3T2PA 4ZE4A 4F0HA 3KRBA 1ME8A 1HG3A 5C0QA 3WQCA 1X8CA 6PTDA 3TIMA 4TVUA 3QV8A 3A3XA 2Y7GA 4AIEA 4PMQA 4BR1A 5AYZA 1F2JA 3HJZA 1ZTVA 1JF5A 3CUZA 5TQLA 1EIXA 2NX1A 1MXSA 1H09A 2G4JA 4F2BA 5HANA 2P76A 5T26A 4DWSA 2Z1SA 1CGUA 3SN1A 4DWSC 3IGXA 4WKHA 1UD5A 4H6EA 3UW6A 2V5LA 2HK0A 2XTKA 1H5YA 4M6VA 4XZWA 3LSCA 2WK2A 1HFBA 1F3TA 4KF1A 3Q4DA 2WCAA 3Q67A 4MDPA 1MFVA 3B05A 3B9DA 5AYBA 1RVGA 3SRHA 4E5TA 3T0CA 4C7DA 4ILSA 2YZRA 4YN5A 4WDXA 3UXDA 4QIUA 5IHRA 2G3JA 4UXDA 3NPVA 4ACYA 1SM9A 3TQKA 2PD9A 5LXXA 3PUEA 3CM4A 2VFEA 4MB3A 3V4BA 3PZVA 3LPPA 2J7CA 4H8UA 3I6EA 4YWIA 3SGUA 4P2VA 3GB6A 4ZB0A 1VLIA 1EBGA 3GR8A 4MWAD 2VRJA 1KFEA 1PL9A 4IISA 4D2JA 3W2JA 4A3HA 3STFA 2VNCA 4ACZB 4TOQA 2QUTA 4K8HA 4DXKA 1UD8A 3KX6A 3AIBA 3HGOA 3H24A 4GJIA 2VR4A 1WYIA 3WQFA 2QLYA 3EWDA 4CUCA 2NQ9A 3IUHA 1W5MA 3W29A 1JCLA 4WD0A 1VPYA 1MQPA 3FJNA 4FX8A 4IH3A 1AQ0A 3KWSA 3GHSA 5HMEA 5I07A 3PPHA 1BF6A 3BJTA 4XTDA 2YOCA 3MP5A 3K8MA 4CQCA 2YJQA 2BXYA 3QV9A 2OZ3A 5I3IA 4NNCA 4HA0A 4FMVA 4B3LA 2NXHA 3GU1A 3KVLA 3SUWA 2HXUA 1NELA 3TFXA 1AJZA 4MSSA 1HO1A 3M43A 3JS3A 4N02A 3CQHA 4XD3A 4UTFA 3AZRA 4IQEA 1JQXA 4FALA 5C55A 4F9DA 1F61A 4UCFA 6A3HA 4DWDA 3M9YA 1M7OA 4MKNA 4JQ1A 3BOXA 3UJEA 4X3ZA 3W7KA 3UQNA 1W56A 3AIEA 2DZWA 4IFKA 1UROA 4LFYA 4BQ5A 1KCZA 3EA3A 1UYQA 4LEFA 4JICA 4Q3MA 4S1FA 2YA2A 3CGTA 1TV7A 3H2AA 2V9DA 3T40A 2CEQA 2QCLA 2QMKA 3VNZA 4A3UA 4N9CA 2PDLA 1ODUA 2PS2A 3P5YA 1GVQA 3H2NA 3UXAA 3NTYA 4LANA 1PZ1A 4FNUA 2Y85A 1PTAA 4W7UA 4DBUA 4JNMA 4G7EA 1X6LA 3UJSA 4MB1A 4D72A 1W9DM 3DAQA 1XYLA 1BXBA 3GE7A 4TQTA 5C2CA 3WH7A 2A21A 4WGXA 1R2TA 3HGSA 1F8IA 1CENA 4BCEA 1R0MA 3IRSA 3NSMA 4L9XA 3WH5A 4MY9A 3E96A 3GBEA 1GVRA 4I7WA 2HPMA 2GVGA 4NF7A 2ZE0A 4QEEA 4GG9A 3S2CA 1W9UA 1XD1A 2DV0A 3GG8A 3C2FA 3TOPA 1TFVA 4PEEA 3OODA 3WH8A 4MVAA 5C5YA 4MYXA 4C6EA 2A7NA 2WMFA 3HB9A 3COTA 3HO8A 5LIUX 4R27A 5C8BB 4P8UA 1RVKA 2P8BA 2ZKMX 1GVOA 2O92A 2E28A 2XH4A 3AC0A 5E93A 1QPQA 2CLKA 4LGXA 2QCDB 4ZXLA 1M53A 1O1HA 1US0A 1UOZA 5GPRA 3BW4A 4M29A 2I1OA 2OWCA 1H62A 4FLSA 5I24A 4PMZA 2DZVA 3LLFA 1WOBA 3LRMA 1LOLA 1BFNA 4GMEA 4Z42C 2VR2A 1J5SA 5H8PA 1GWJA 1L8NA 3INPA 1K7FA 4K2SA 4JHOA 4I9TA 3WEZA 3SRDA 3T44A 5AB3A 2WVTA 4KIRA 3S1VA 1TE6A 1E6PA 1LUCA 1LQ0A 4U3AA 1LRNA 1XYZA 3VI2A 1V93A 5BRBA 4O28A 1LYXA 2CHNA 1CWYA 3PWIA 5D9PA 2IPGA 5KZDA 2BGNE 2D73A 1FP8A 3ARXA 4UTHA 4O17A 4MFDA 1CB2A 2ZRUA 1IE7C 4NNAA 1V02A 3VDGA 4NYYA 4C6IA 1XS2A 5CZKA 4HOWA 1XUUA 3VILA 2CZDA 1QO5A 3NWRA 3WBWA 3N13A 5L9FA 2D69A 3N6QA 2CBIA 4HHLA 3IIXA 2ZCGA 4PCTA 3B8TA 5ABTA 3PZUA 5D05A 1M41A 1PE1A 2WZHA 3T6CA 1Y5XA 1EC8A 4F4RA 1A0CA 5BZAA 1VAHA 3W53A 3WK2A 2HEJA 4ADTA 5A2CA 1YDVA 1FFQA 5I0DA 5HQLA 3CYVA 3NQEA 3WEOA 2X41A 4HOZA 4PBGA 3VOCA 4ZSUA 1V6TA 1O5KA 2FQIA 3AS3A 4FS9A 3WLPA 3U48A 1JRCA 3GH4A 1VFSA 4W5UA 2VHLA 3TN6A 1JNDA 4AIOA 4PMOA 4A29A 4J3WA 5HATA 3PZ9A 3CZGA 2EKGA 4O16A 4HNNA 1L6WA 2TMDA 2TPSA 1I2QA 2D2OA 3VIFA 1FHUA 3OTRA 4INFA 3RGTA 4GX8A 5FSEC 2R14A 2IMRA 2EPKX 3WFLA 3NXFA 3W1LA 4JNYA 1R6WA 1BWVA 2WLZA 3KFTA 2TYSA 1BVZA 4JR5A 4Z1BA 2ZRXA 4PTWA 5AZ0A 1SO6A 2CHOA 3L5MA 2R24A 2QCGA 4OUEA 4CNOA 1R9XA 4H9MA 3BTNA 3RX4A 4JGDA 3WO8A 4DUXA 5CH9A 4ZOCA 1KD0A 2Y24A 2XWEA 1Q6QA 2XU2A 5EMYA 5D30A 4E3TA 5DCEA 2BGQA 3FYOA 3NM1A 2TRSA 2P5NA 4JIHA 1V5XA 4GXPA 2GJPA 1SFSA 1QOQA 2VDIA 4QS6A 3S47A 3LXBA 2NLYA 3IANA 4D6HA 2J7BA 4LT9A 1OZMA 1EXBA 1Q13A 1T7LA 3EWBX 4RX0A 4L6DA 4H6QA 2WW5A 1S5MA 1RBAA 2FB3A 1KGXA 5DRIA 1DJNA 1B3OA 1AFSA 1KBIA 1XP3A 3OPSA 4P7LA 4IPPA 1W3TA 2W91A 3K8KA 3HGJA 4LS1A 4QG8A 4D6CA 1DKWA 1PWLA 1CGXA 5AYIA 1EQPA 4RDWA 4XX6A 1OFOA 4AH7A 4CCCA 3W28A 3SY8A 1D7KA 5EB8A 1NWTA 5H2ZA 3EWXA 1NU5A 4X63A 3WX7A 4F40A 3LBMA 3IK4A 5A6JA 2Y1HA 3KBVA 3NAVA 2GOUA 2VELA 2PLMA 1O95A 4JTIA 1TPEA 3DESA 4H6KA 1XIDA 3IGHX 2YYTA 2CLHA 3A4WA 4XZIA 1NWSA 2NUYA 4LBRA 4FIRA 3WIJA 1IEQA 3S2MA 4G7EB 5HQMA 2NX3A 3CZ8A 1K9TA 4R7WA 4ZSTA 1EUNA 5LNRA 1CLVA 1GVSA 1UUOA 2FMOA 4ZB2A 2OSYA 2V68A 3T09A 4DNHA 5BU6A 3G6LA 1VR6A 4H41A 1QNVA 3ITTA 4MNMA 3RFAA 3XIMA 2G37A 2CKSA 3THUA 5DT7A 4F2TA 2GVLA 1GHSA 3L0NA 3WNNA 3OYZA 1UOKA 1TPC1 4TVDA 2O56A 4L9YA 4V1XA 3M1ZA 4D6DA 3DHPA 3AZTA 3UR7A 3UXIA 2WCSA 4WKFA 2YZ5A 3W07A 3AWNA 4JKMA 3CL8A 3BXWA 3FY1A 4CKQA 3WBYA 1J79A 1FWGC 3S9IA 4IIHA 4ZQMA 5EBAA 2DZAA 1A4MA 2QJJA 1SJBA 3ID7A 1RA0A 3R2GA 3TNOA 4LCRA 1SJDA 1UC5A 3UWUA 1Y0EA 1TVPA 1IZCA 4FXFA 4XUGA 4NZ5A 2V2HA 2WJEA 5BU9A 4IGNA 2XHYA 4JYEA 5M1TA 2W0UA 3DN5A 3H2MA 4NKCA 1LLZA 3E49A 3RMEA 4S23A 3C61A 3VDBA 2X2YA 2DORA 4FXSA 5BXRA 4PTMA 1UA3A 4DI9A 3WF4A 3W85A 1K6AA 3EDJA 4ERIA 1XRFA 1E73M 3BZJA 1IXOA 3SFWA 3TE9A 2X0YA 5B80A 1LDCA 1RBOB 1OZQA 2IKJA 2QPXA 4RE3A 3LA4A 3GDRA 3GHUA 4RKAA 3H55A 3PWAA 4EAMA 3HV9A 4JFTA 3CMFA 1LLWA 3CO8A 3G0UA 3LERA 2YCEA 4BQ2A 1E4NA 4NNBA 3WDQA 1A5AA 1J11A 1BSIA 3N2CA 2O0TA 4KT2A 1KXTA 3SEPA 3ITXA 2F61A 1KTBA 3BOLA 3RLHA 2I14A 1E43A 5FEXA 5CC3A 2PD5A 2G95A 3EKZA 1BF2A 5D33A 2H3DA 2R6OA 2HVOA 3MSDA 5HMDA 1LUCB 2D3NA 3DKJA 1M9HA 5TD4A 4DUVA 4P7RA 2PDGA 1DE6A 1V3HA 4BI5A 1OX4A 4M8UA 4LS2A 3AQUA 4IJCA 4X9SA 2ZX5A 3LD5A 4KCUA 3ELFA 3F2DA 1L8PA 3GVVA 3M0KA 3TX9A 3LQGA 2BSLA 5F1VA 1N55A 3AIUA 1QI0A 5T8GA 2REQA 2PGRA 3LMYA 3A3WA 3JW7A 4UNLA 3VNJA 1QPOA 3QY7A 3UR5A 4U33A 1JJKA 3Q37A 4RNHA 1A3WA 3QF0A 1OHLA 3VU2A 1EJRC 4QSFA 3KP0A 2VVSA 2WZTA 3C0JA 3C2RA 4U10A 5CZJA 4A8NA 2E9LA 4LJ3A 1W1TA 4WY0F 3L67A 1DJZA 4QNWA 3SIMA 5H8UA 4HOXA 2GK1B 2CBJA 4GQBA 1UUMA 2E68A 3B0XA 2O7SA 4NJJA 4S39A 1W5OA 3IARA 1GQNA 1Q4NX 4DF2A 2AL2A 1M3UA 5LYRA 3TYEA 3WF0A 1PYMA 2XVNA 3UG8A 2XIMA 5A6BA 4J3TA 1W9VA 1MDLA 3P2VA 4DF0A 3A4JA 2J6VA 4B3ZA 1K7EA 2Z29A 4YU1A 3W0KA 1XICA 4UQBA 4JQ3A 1X6UA 4QLKA 1OJXA 3NIYA 2Z4GA 2VENA 3IRDA 4XD6A 1PJ9A 3MMDA 1M04A 2NLIA 4GH3A 4W4QA 2WQPA 4L4PA 2PDHA 4U3CA 1OF8A 1NQKA 2YSWA 1K70A 1P43A 4UZUA 1YPFA 4EPDC 5KZEA 3WQ8A 2HE5A 4LY4A 3B3DA 3B0PA 5I6SA 5A5WA 1Q6DA 1RR2A 3N4EA 3WLQA 4ZL1A 2E5DA 1R9ZA 2ZUTA 2X09A 3HQ1A 1JD9A 2Y7EA 4JHZA 3WJXA 1RK5A 4DM2A 4WF7A 3VKBA 3DC0A 4NIRA 2Q3RA 4XK2A 1XSKA 4UOJA 4AW7A 3EXRA 3TMLA 5D32A 1NP0A 3PK7A 3TTSA 3DOPA 2V5JA 2D22A 4TX6A 3PSWA 1NH6A 3AS2A 4I5RA 4YYCA 1AZ1A 4JX4A 3LQLA 3RYSA 1MUCA 3QYSA 1C3FA 3UERA 1CZ1A 3M0VA 2QMJA 1FTXA 4RNFA 3MI2A 1YTDA 2BASA 1UBSA 3N15A 3MO7A 4FNTA 1KRAC 3CXOA 4NZFA 3G1XA 1KBBA 3N4FA 2PODA 5BXTA 1RZMA 1HNYA 1IXNA 1PB0A 5K3VA 2OLHA 2I9EA 4HCHA 3W37A 5IOBA 2PWFA 2VC9A 1EIBA 2FGLA 1J10A 2WMHA 3GX9A 2XVPA 1JI2A 3KVKA 3PPCA 4L4OA 3EWUA 4N7QA 3QKEA 5HBFA 3SUVA 3E6EA 5HJYA 4HMDA 1S1RA 1Z3NA 3CHFA 1W32A 3MS8A 2AL1A 1G6CA 1KXQA 3UZZA 1MW0A 5AC8A 3KOYA 2BDQA 2Z25A 3A64A 5DT5A 1Z7AA 3SZ8A 4TVCA 3I3EA 4IQLA 5FF4A 2DVTA 2BY2A 4L64A 3VCRA 1PTDA 3GC5A 3TEVA 3CLWA 3OVGA 1OT2A 3CO4A 3OG2A 4EVZA 4KWSA 1KKOA 2FZBA 3JU2A 4QITA 3VGEA 3SUTA 4P8WA 2A79A 1FDJA 3P81A 1IEVA 3MSRA 4OOZA 2AKZA 1KM1A 3AIWA 3L4UA 2FPYA 1L6FA 4IXXA 3R4IA 5JU6A 1NJJA 1EOMA 1K8YA 3EGJA 1E0VA 1UWIA 1GG0A 4MWAA 1V7AA 2J88A 4LAKA 5CPQA 4MWAC 1W1B1 2R94A 3S9ZA 1ZCOA 4AQLA 2D23A 4AVNA 4J35A 2W61A 6CGTA 2HBXA 3O7UA 4PMXA 4HHMA 3PANA 1UW9A 4FA3A 3AHVA 3P82A 1GYLA 1TSIA 1R5YA 3D3FA 2BMBA 2Z00A 2ODOA 4IQJA 2E4TA 3NQCA 1XD0A 4PR4A 3MY9A 4E4PA 1H63A 3UCQA 1BG9A 4HN8A 4GC3A 1EA0A 4UFMA 2F38A 3FAWA 4MZ1A 3UU0A 1UR0A 1QHZA 3ANUA 4OT7A 3VMNA 1TJ0A 2P88A 2XIJA 5FAGA 5A6AA 1OYBA 3AHTA 3FDKA 5E0KA 5AFDA 2DPEA 5CZTA 9XIMA 4JAWA 3QZAA 2HNEA 2GGHA 4GYFA 2W62A 4JL2A 2RAGA 1WUEA 1XCXA 2C1IA 4IICA 3GQYA 5EMUA 1Q5MA 2ZRZA 4OUIA 3BARA 4ZOAA 3CJPA 4U5IA 5T9BG 5DQPA 3VA8A 4MAZA 5CC7A 5GNXA 2WWDA 1B54A 1E55A 1QWGA 2WYSA 3B97A 5LGXA 1MVYA 1YE4A 3HN3A 2IXVA 2WSQA 2PP0A 2REQB 1ITCA 3FV9A 4HZ7A 4M80A 3CL6A 1S2AA 3GM8A 1EB3A 3NVDA 3NQ8A 2DZPA 1Y5VA 1E0UA 3IGUA 7TAAA 1OG6A 2JKEA 2V2CA 5FL1A 4MDOA 2RDUA 3TN3A 2NV2A 3H23A 5DX7A 1GJUA 1L6SA 2TODA 3C3UA 3WQPA 1K4GA 2CZFA 1R2SA 4B4HA 1S5VA 3H2EA 3BV7A 3W02A 4CNNA 3NJ3A 1IZJA 4CEUC 1NF0A 2VCCA 5SWUA 2V81A 4P7OA 3HPXA 2ASHA 4CD5A 3ZSSA 2ZA1A 5XINA 1NWUA 2A4AA 4QTGA 3W6YA 3CB8A 3KRSA 1D8CA 3NDOA 3RJXA 2GVYA 1J9YA 2NSXA 3ES8A 4BEUA 3K46A 2XIOA 3DHUA 1VEPA 4HT3A 5I3FA 3NG3A 5M03A 3WD1A 1Z6KA 4AZ7A 3LCLA 4M5PA 1XLCA 3ABXA 4R7OA 2NX9A 1XRTA 4RLIA 5AHEA 3PPGA 2OZ8A 1XLEA 2X7VA 1WDSA 1XM3A 4IMDA 3GD6A 5I3JA 3GNXA 1H5VA 1IF2A 3LI0A 4GC4A 3PS7A 2INZA 3W7OA 2WQDA 1QBBA 3M0LA 1RK6A 2GSJA 1F7BA 3RUBL 3BH4A 3SCSA 4N9BA 4L9ZA 5TF0A 2F84A 2Y6ZA 3GU2A 4C5ZA 2ZDRA 3W6LA 1PAMA 4HMEA 1D7FA 1ISWA 4ATDA 2DW7A 1RLCL 1TR1A 2GGEA 3WH6A 3ZT5A 2I5GA 3LBOA 3G3MA 3SW6A 4GY1A 3QBUA 1UA7A 3CAKA 1VCFA 4DO4A 1QI5A 4HU8A 3TDFA 1TZ7A 2Z6IA 3ZR4A 1TWSA 1UP3A 4O13A 3ZZ1A 3G8RA 4TV5A 1CLKA 4GY0A 4WZHA 2VFDA 2QF7A 1Y65A 1NFBA 1J93A 3KUMA 1HL9A 4Q6XA 1OCNA 2OXNA 3PBMA 1E56A 4HTYA 3BJFA 3ZT6A 3RCMA 3TYUA 5IM51 1Q6FA 1X1NA 4EPKA 3TAOA 4L1WA 1E40A 1AQHA 1O7AA 3GXFA 3L12A 1CGWA 4HVXA 1LWHA 3IVTA 4MFEA 3O07A 1WKDA 4OJYA 1W91A 4Z1YA 2E1WA 3IIOA 2V38A 2FPVA 2QVNA 3TYDA 1TPB1 4BA0A 1ELSA 4YWSA 3CUFA 3K4DA 2EKCA 4ZO7A 1O66A 3GXDA 3ZFHA 2AAMA 2PDFA 3THCA 1P5BA 4RDYA 4Y96A 2YFOA 3I3BA 4HNUA 4O1CA 3AS0A 4A8IA 3BC9A 4HZ6A 1GVEA 1LG1A 5I77A 5JBEA 4JY9A 2IPFA 2A7RA 3BLOA 2CHRA 3DUGA 1PKMA 4QM1A 1ZB5A 2RDXA 1UD3A 4DJFA 3K1GA 5CZSA 5TAOA 4DJFC 1XH1A 4UCGA 3DYOA 3CH9A 3HFTA 2Y8UA 4PTDA 4FLQA 1EH9A 4MHBA 4L1XA 4K68A 1VF8A 3T9PA 2GGIA 5C2XA 1RAKA 1BPLB 2WHLA 3P93A 4ML4A 3GLCA 1RLDA 2OOFA 2J8FA 3I4EA 4Q4KA 2F2KA 2XN2A 3R43A 1JAEA 1Q8JA 2QDEA 5BMXA 5DRCA 3WENA 1XW8A 1YRRA 3CMJA 1XGZA 4LV4A 2WVSA 2J8GA 1GUVA 5I2UA 2OKOA 4JIIX 4YHGA 4S38A 2A6NA 1WAUA 3CASA 5BOFA 1ESWA 3QC3A 4R3UA 4DI8A 2GGGA 4NRRA 8XIAA 4M6UA 4GVHA 3O6AA 4PMUA 1QATA 1DL3A 3W88A 4NSBA 1HJXA 2PDKA 4OECA 3O2LA 1FVPA 5CPNA 2NVAA 1RHCA 1TUFA 4RE2A 3UJRA 2A5HA 4O0ZA 3T0AA 2CLPA 4HJFA 1XIHA 3E5PA 3HM7A 3W1QA 1L9WA 5HNRA 3ZLGA 5BOOA 4BF5A 1FH8A 1E9ZB 1UKQA 4D8LA 3G1FA 3HPAA 1DJIA 1UWUA 2YB4A 3WD3A 2BG5A 2VFHA 1S5NA 5KTLA 4DBDA 5LIWX 3MUAA 3LNMA 3IJ6A 2ANUA 3BCFA 3PUGA 3H4GA 3W2LA 1I0BA 2HS8A 4QCFA 2PRHA 3WLRA 5E0FA 1WUFA 3H53A 1OX6A 1Q6RA 2OR2A 2QXWA 4UZSA 1U33A 1XLMA 4HD5A 4EIVA 2WMKA 3THQA 3UFYA 1A5SA 1U1JA 3V1PA 2PRMA 1NOFA 3GR7A 3LCFA 3EOEA 3RU6A 1A5MC 1C8YA 1GEQA 4IF2A 4JTQA 4CNSA 1JPDX 4QG6A 1RBLA 3BVJA 3MKCA 1DP0A 3MUIA 3AXXA 4X61A 3WQOA 1OYAA 5I5RA 1WKEA 2JFEX 3ONCA 3SY1A 1G1YA 3BQ5A 2J66A 5A69A 1JUBA 4KEVA 4ES4A 4CD8A 3I7SA 2A3HA 4NJHA 2UY5A 3P74A 4IP4A 4CD6A 1RP8A 2ZDSA 3B8SA 1XQLA 3K8LA 4GJ1A 5BXSA 1ENUA 4UR7A 4ICMA 3IAQA 3VC5A 3NGJA 4GBDA 4JTGA 4LCQA 3A47A 5F4XA 1K1DA 4DHGA 1JCTA 4HMNA 3UR2A 3AISA 3ZLFA 3GTHA 3LM7A 5FJOA 3LNPA 3O0FA 4WOZA 1JZ2A 4QISA 1GPWA 2QCCA 2V0TA 4CNUA 4MJ2A 5FI8A 5AHIA 1FWWA 4AZIA 3H7UA 4WKAA 4B9YA 5H6HA 1LRQA 5BRQA 4Q32A 2YXXA 3HF3A 3GIPA 3R0DA 5FCZA 5I00A 4EPEC 4WSJA 1V02E 1P6WA 2IS7A 2EHHA 2CU0A 3LK6A 1KKRA 4RZ6A 3PJUA 3AMDA 3CB3A 4ALDA 3A13A 2QIWA 3N2OA 4GWEA 2J77A 1G67A 1B4KA 1BVNP 1PTGA 3G1AA 1V6WA 2VCBA 4GYPA 4HJWA 2G41A 4GYPC 1S5TA 1I45A 4IUGA 3CUHA 3MMWA 1T6MA 4A05A 4PE8A 2ZADA 1G5AA 1DTNA 2BV9A 1W2PA 1FXQA 4R53A 2Y8KA 3MUZ1 1BD0A 4MPKA 1TZ9A 2VDGA 3GUWA 1RCXB 4PL1A 1ZBWA 4IX2A 5AY7A 1C9DA 1GZ1A 2QCNA 1R3YA 4ECLA 1QNPA 1DHKA 2CZ5A 5BWAA 1VIWA 3BLIA 5HQEA 4GFSA 1P0EA 1IXQA 5D02A 5JMUA 4MUPA 3WF1A 5G1YA 1U30A 3RX3A 3OP2A 3GHTA 2Z0IA 4K7YA 2GSHA 3MBFA 1O1ZA 3VDHA 1GK8A 2HNHA 4Q6JA 2OB3A 1U1UA 1UJPA 1S38A 4IG2A 3THDA 3N6JA 4S3BA 3WK0A 2I56A 4G56A 1MRQA 3BWWA 1E6XM 4LVGA 1ZLPA 1EYEA 1WDDA 3S2JA 3BO9A 4Q4OA 2W92A 3VUPA 4QROA 1NM9A 1IQ8A 2UZ9A 4NHVA 4D71A 3ITCA 4PRRA 3M16A 3PR2A 3FSUA 4D6FA 3HIJA 3KLKA 3NQMA 2AQOA 1XH0A 2EPHA 3R12A 1ZJHA 1VFOA 1XLKA 1W6TA 4N4PA 5LGZA 3HGRA 4J1OA 4PODA 4IJRA 2A3EA 1C7TA 1XR2A 1EX5A 4FOUA 1UKOA 1TPFA 2QZRA 4JTSA 2RGLA 3V0TA 3HMCA 3NO1A 4GX9A 2EPLX 4LAUA 1C9WA 3T0TA 1KC7A 4I5XA 4AZ6A 1DJYA 3PWGA 3NZ1A 4E8DA 4ZA0A 3PHAA 5C71A 2OSWA 3P7YA 3GDBA 4AF0B 3M6DA 3CIWA 3W38A 4C6LA 5LNWA 4C6JA 3KRUA 2YL9A 2VUYA 4E2VA 1QU4A 4KETA 2D2GA 3AOFA 3QV6A 4QX4A 3BCDA 1HP5A 4XIMA 1E9IA 1KM5A 3WLKX 4LRTA 4W87A 2VP8A 4CU6A 3VM7A 1IV8A 1XI3A 1EZ2A 4GXMA 2XSBA 2OGJA 2A0NA 1FFRA 3EB4A 4ROPA 4C1LA 4C6KA 2NUXA 3FA3A 1LL6A 2ZYFA 1W3IA 2XIBA 4A3RA 2EO7A 5PTDA 4PB4A 2YCIX 4TIMA 2OELA 1MXDA 3LBCA 3BW3A 3KOXA 4NP7A 3KTSA 2O7QA 2VWSA 1Y8BA 2CBUA 3WFAA 3TWAA 2XPKA 3U5YA 6XIMA 1SO3A 3QOMA 4NZ4A 1FWFC 4N2YA 2CKRA 3S6DA 4DAIA 1UHVA 2Y2WA 3EEGA 2QJMA 1KA9F 4I6VA 1YX1A 1ZBKA 3MWAA 1UKTA 2GQAA 2GWGA 3V16A 1G4EA 1X7IA 3VIGA 4PMYA 4H8NA 1O4UA 1EDTA 3GNNA 4JN6A 1ITUA 3P5ZA 1Z9AA 3EPNA 3WG6A 1YBQA 4DVOA 4ZO9A 3QKZA 2DJXA 3VKCA 2CLIA 2XWDA 4FLOA 2GJNA 3UBPC 1V3MA 1XCFA 2FDSA 3KW3A 4IPJA 3CPRA 3U4FA 5IBXA 1PVNA 2VVNA 1VFHA 3T42A 2QULA 5IBXC 3IV8A 4PUUA 1OINA 3G0SA 1B1YA 1PYFA 4W7WA 1GKQA 4XD5A 2W79A 4Q4SA 2BBFA 2PLKA 5TNVA 3TCEA 4JQ2A 1E6NA 4DLMA 1QNSA 1JYXA 3N12A 4DBEA 2WPBA 4J2PA 3VTRA 2P50A 3PP7A 1H0GA 4UFKA 1VS1A 5H91A 1I2PA 3WY1A 2PDWA 1LWJA 3EMZA 4RK8A 4XO6A 4UTLA 4Z2IA 3NPUA 2GDQA 3QYQA 3FJLA 2PE4A 3V0UA 3GDMA 5HDRA 2NV1A 3HZ3A 2DZSA 3FFSA 4HK6A 1YE6A 4HU0A 3W84A 3U3HA 5F7UA 3VOHA 3S0CA 3VC6A 4HKPA 1SU5A 4FNQA 1Q3NA 4TX9A 1K02A 3DHDA 3IUDA 4Q8NA 5GNZA 1GZGA 1CXKA 1KFWA 2HK1A 8A3HA 4GUFA 3WLIA 3KTXA 3USBA 1TCMA 4UQCA 3T1GA 1LF1A 1V6VA 5LXEA 3QMSA 3O0KA 4Z1CA 4XAZA 4ORMA 3V35A 2FDMA 2XVGA 3LOTA 5K4ZA 2OTDA 4MM1A 3BAKA 4G9PA 1FCQA 1R85A 4D1JA 2XSXA 3VZXA 4YTRA 3MKKA 3B06A 1B90A 2ALDA 2OOGA 3R79A 1UD6A 4CQ9A 2R1LA 3TTQA 4ZR8A 4GNKB 1LM1A 4IIDA 2OSXA 4Q8TA 5C7HA 3UG3A 2Y5EA 1VP5A 2D24A 5A8NA 4G7FA 1NY1A 3MV01 3TOYA 1SW3A 3EWYA 4Z2HA 4Q7IA 4QBXA 4ZE5A 2O9PA 1G0CA 3OB8A 1TJPA 2HROA 3VVGA 4ICNA 2B0MA 3LHZA 5D2TA 1D3CA 4PUEA 3TN5A 1W0MA 4Y9OA 2J47A 3KLLA 5MKGB 5J5DA 5LHFA 3RG6A 4PCSA 4Y90A 1GGOA 1O6IA 3BAIA 4ZVJA 4GO8A 3M46A 1QNQA 5I09A 2Z28A 4G8TA 1EPXA 1CLXA 2CLOA 2FTYA 3ANYA 2C14A 2GJXB 4QLJA 3ARYA 4KBXA 4GNVA 3RX2A 2H9AA 1J0KA 4GJJA 3BSHA 2WVVB 2BXVA 4J9JA 4JIQA 3CUJA 3AIVA 2XH0A 3AS1A 2BODX 1L2QA 3LEPA 3RM4A 5FACA 2E0PA 3NQVA 1QW9A 1B9ZA 1UB3A 1FWJC 2WPGA 4N6FA 4RNIA 3BMVA 4E4FA 4H9UA 3U2EA 5E6ZA 4WXZA 5FJPA 1BYBA 4GCAA 5HPCA 3P3BA 2I5IA 4PMVA 2DZTA 1TVLA 4QHRA 1O12A 3A5FA 1CGVA 3ZJ6A 7TIMA 1X8FA 3RU8X 2C13A 4BY3A 5HMFA 2QJHA 4PCPA 1YMYA 1L2UA 1AMKA 4M6PA 4R33A 3MZ2A 3N11A 3SCUA 2XINA 1FH9A 1WQ5A 4QJ1A 3OLGA 1KCKA 1GW1A 1YPIA 5HWMA 1ZY9A 2H3BA 4I5UA 2GUBA 3KHJA 3G77A 1B4EA 1HL2A 5TBOA 3F4DA 3C0SA 1X1ZA 2QUVA 4K6AA 4EP8C 4MYAA 1QNRA 2YXGA 3VNYA 1VPQA 3LTPA 4X0VA 1A3HA 3AU6A 3WBEA 4MTVA 1KBLA 3RNDA 4CU8A 3W76A 1SR0A 3W4RA 1RQBA 3AMKA 3W1RA 4N0RA 1GT8A 5U4NA 3SCTA 1VBHA 1WDQA 3MDWA 4S3AA 4C6OA 3URQA 1TPDA 3E1F1 3PB2A 2R1KA 2DQWA 4MWAE 4HPHA 2R82A 1HKWA 5CLWA 2XG9A 1MZHA 3APYA 4FXJA 2Y5JA 4UFJA 3PTQA 2GWNA 3B8IA 3VCNA 3WMSA 4JYFA 2R9RA 4NUWA 3W7GA 4UB9A 1HJUA 2G96A 1YBQB 4W84A 1WDRA 3MC5A 5BOEA 4I7UA 1F6PA 1V3KA 2XSAA 3F4CA 1XFCA 5DMMA 2IUZA 2PMQA 1RXOB 2PGEA 3GXNA 3PFRA 3S1WA 1N8FA 4B5XA 1EFZA 1D9EA 1XYAA 4BFAA 4NT0A 3ISIX 3B9EA 1QW7A 3W7CA 3BG9A 2AQWA 4YVXA 3M0MA 1I6NA 1P0BA 3H70A 3GIQA 3T7VA 2VFGA 2QUUA 3E0FA 1OIFA 3WSUA 4XZNX 4H9YA 3B4UA 4S2CA 3NZPA 1TG7A 1KFCA 4Q4MA 4JNZA 4Y7EA 4S3FA 3LHVA 3CZEA 5HNNA 3TA9A 5ABFB 3HURA 2OT1A 4ATLA 5E1QA 3VUSA 3Q45A 3QGVA 3MYOA 3OVRA 2X8RA 5IDZA 3A24A 4I9MA 2QAFA 1HGWA 1UQZA 2ZBTA 4UQAA 4JYDA 5GVJA 1QRQA 1OC6A 4OFCA 4EAYA 1B0IA 1FA2A 4Y6GA 5DO8A 3C3NA 1YPXA 4JQ4A 4KFNA 1E0XA 1AH3A 4U31A 1OD8A 1VCGA 2J13A 4QNEA 3M41A 1GKRA 3SJ3A 2KX9A 3FGCB 4NAEB 5G1MA 4HU4A 2VR5A 1GTEA 2JKAA 1FH7A 1ICPA 4ZODA 1W3HA 2PPGA 1LOSA 2ZXBA 3GAKA 1MW2A 4NASA 3WK3A 1V3JA 1DVJA 4M19A 3U0HA 3URBA 3N1AA 4UFIA 4G6CA 1UWRA 3VM5A 2FHFA 1NDWA 4HYVA 4RDZA 3HMJG 3QVQA 3DFPA 2OQYA 2OJPA 3WMBA 4KCWA 5FEZA 4P8VA 5HR7A 1G69A 2EBNA 3NL6A 5F2MA 5E9AA 3QR0A 5LIXX 1BRLA 3SUSA 2EF9A 2QT3A 3MB9A 4KQNA 2PDMA 3L7RA 1S3TC 3WQVA 3P67A 1H7OA 4W86A 2HXTA 4WUIA 1DE5A 4JN8A 1E1CB 4IWWA 1H1YA 3BL3A 2Q6ZA 5AVNA 2CWNA 1EWEA 4LB4A 1QUMA 3BLFA 1IXPA 3WKZA 3TYCA 4JKKA 4MADA 4KIEA 4O4VA 3ALFA 3S5OA 3WMCA 4XZHA 1YDYA 3GDTA 4B5UA 2A3AA 2OWXA 1VRXA 3LY0A 2PF0A 1GOWA 1LOQA 3ZOAA 3PTMA 2O9TA 3WL1A 1H3GA 1P0DA 1MUWA 1VJZA 1W9XA 1KR0A 3R11A 2W5FA 2GYIA 4XISA 3BLEA 2H9AB 1DWHM 1KGUA 1NDZA 1A5KC 3T8LA 5D9MA 4DJED 3PM6A 5EBUA 2W4XA 3OBAA 3WQWA 4C6BA 1W3NA 1YNYA 2V5DA 3SCQA 4PA8A 1ISYA 1HZYA 1XUZA 2FH6A 1ITQA 4G5DA 3N2XA 4ZQRA 4IPLA 2CXEA 4LWWA 4S3KA 3PJWA 2ON3A 3HV8A 4JTRA 1NVMA 4FAMA 2DIKA 1AMYA 3AMCA 4K36A 5E0CA 3AIRA 3M07A 3G1VA 4YXGA 3LM3A 1TO3A 1E3ZA 2PDPA 2ACRA 5EMMA 1PX4A 3R10A 1EJXC 1TTQA 3M0YA 4FR1A 1JL8A 1O60A 3PNZA 1MO0A 1WZAA 4IM4A 4EWND 4AEEA 3T2QA 3VK5A 3GZAA 9XIAA 4PCNA 4H3DA 2W9MA 5FAJA 4ACZA 2ISFA 1P0KA 3VMOA 1B57A 1WKYA 2DSUA 1FWBC 2QV4A 2Z24A 4ZENA 2NV9A 1V8EA 2FPTA 4QCEA 2QAPA 4LYPA 4XBKA 2W67A 2CW6A 3U2OA 4MB5A 1JULA 2FHCA 1CYGA 2YGYA 2PDJA 1JIBA 2ZWYA 3VMPA 1D3HA 2WAGA 2Z1WA 4IL0A 2EPOA 5F1UA 3H4XA 3L9CA 4OQVA 2JK2A 3TC6A 3G24A 4GVGA 3UYCA 3ZJ8A 1TV4A 1DPMA 3N9RA 1JZ6A 3S1UA 4AAJA 7XIMA 1WAWA 5DCBA 1HX0A 2XM2A 3VX0A 4W8LA 3BSMA 2VEPA 1Y7VA 3ORWA 2VYOA 5LSMA 3DIPA 4KCTA 3NDZA 3W9ZA 4LNYA 4WLCA 5B7YA 3G1SA 3I4KA 3NA8A 1ZS2A 3PF3A 2FZNA 2G0WA 1BTCA 1ECEA 1Q63A 2ZZ2A 4KWUA 5CEWA 2RUSA 3W1PA 1UC4A 2PC4A 2CLLA 3DX5A 5I23A 4TUFA 6ALDA 4LEQA 3QQ1A 1UZ1A 3UXLA 1YEYA 4X9YA 3S4TA 3PC0A 3W6MA 4AD2A 5CSSA 5G2WA 4L65A 3QQ0A 1VYSX 2UY2A 4DPPA 2IQTA 1OY0A 1Q7QA 2Y8VA 2BS9A 3USZA 5LNVA 4LXFA 4O1BA 3HG2A 2HMCA 2XFFA 1O5QA 2NQZA 1HXJA 2J9YA 3DBNA 1ZAJA 3B03A 4EANA 4HQVA 2DZXA 1WZMA 2NW0A 4NY2A 1UZ4A 1MEHA 1XQKA 2IQDA 3WEMA 4JFWA 2WC4A 3VGDA 3CPUA 4OV9A 5LZLA 1JPIA 2VEIA 5F4WA 3O06A 5KEZA 3OQEA 1XBVA 4FLRA 1Q65A 5A6BD 4GKLA 2EG6A 2V30A 4V27A 1NWRA 3ICJA 4NI3A 3KS6A 3PZTA 3VD3A 4WJEA 2WJFA 1R47A 3LXAA 1QHOA 2ACUA 2X1RA 1A80A 3QSRA 3FEMA 1HVXA 1UH3A 1OFRA 3GDLA 4MUZA 1UQYA 3I10A 2Q8XA 4MZ8A 1FDYA 1PIFA 2YBUA 1CB7B 1KWGA 4RXGA 3CIVA 4ERGA 1YNPA 2GJLA 3V5FA 2FMNA 4Z0JA 1VFFA 3P61A 2VC6A 2QCDA 1U5HA 2QS8A 4RZBA 1VD6A 5FJIA 1HUVA 5I3KA 5TIMA 4AEFA 4US5D 1GPFA 2HBVA 2VOTA 3W72A 3SGZA 1KQYA 1KV8A 1XBXA 4HZMA 5AC6A 3GG1A 5GJMA 3DFQA 2ZA2A 1LT8A 1FRBA 4LVAA 4XAGA 3EX4A 4A2RA 3D47A 4QS5A 3TXZA 4UUIA 5JIPA 3VIOA 6REQB 1AQFA 4QE4A 3Q94A 3M0HA 3GDKA 5EFFA 1EGMA 1UWAA 3C2EA 2QDHA 2WSKA 1ZZMA 5A1AA 3S2LA 4BK9A 4GQGA 4HU3A 3VDAA 1UIOA 2HSAA 3W2MA 1VQTA 3KVMA 1UBPC 3F7JA 5A94A 4GD0A 3PPFA 5FL0A 2UBPC 3OEXA 1CCWB 3TH6A 2E6AA 4GISA 3OQ8A 1R3WA 3UYIA 3NQAA 1XYFA 4HP5A 1UMYA 1WDWA 4XSLA 4NG3A 3AI0A 1UD4A 4O1FA 4RR4A 1TR9A 3BE7A 3R7MA 4KPLA 1VBGA 3RPDA 2ATSA 1HKMA 1RCOB 3OBKA 5A95A 2V63A 2OEJA 1LL7A 1G9HA 3FK4A 3STCA 5HINA 1IEWA 1K77A 1I8JA 4IMGA 3AMLA 3UVIA 2O55A 5CSUA 3IJ7A 3GS6A 1C8XA 4MJZA 3TXVA 3ITVA 1US2A 3GH7A 2GGJA 1E4MM 1SZNA 3OW1A 5CSRA 2VX4A 4RV3A 3SAZA 3W7DA 3V5CA 4P8XA 4JFVA 2R1NA 1ME9A 3LHWA 5RUBA 4F3HA 2ZE3A 4GUJA 4QQ3A 1UR9A 2B7QA 4HYWA 3MHUA 4ADSA 3C56A 5T91A 1K3UA 3PBWA 3L68A 3IJ9A 4B15A 2JGYA 1LBLA 2G8ZA 4HTBA 4HSNA 1GOOA 2AGKA 3U6WA 2XFYA 2PWGA 4S3EA 2JQXA 2OQHA 4OBSA 4OBRA 5DMNA 2ZRYA 2VD9A 1KM6A 3C2VA 2V69A 5I3GA 4EWJA 4DELA 4RL3A 5ENLA 5KMYA 3TR9A 4JTTA 3P62A 3G1YA 3C0QA 3VOIA 2OZ0A 1O5RA 4MB4A 2UY3A 4Y9NA 4CNTA 3QLLA 1IT8A 2C8NA 2EPMX 1GEHA 3QHOA 1XLBA 4TX8A 3W71A 3QRHA 3UPBA 3RLVA 3E0LA 4B91A 1R3TA 4N6EA 4PSPA 1UWQA 1AL8A 3NQBA 3P6LA 2ICSA 4JDBA 2X1TA 3ABQA 4IIFA 4X60A 1AA1B 1HJVA 4E2BA 2G3NA 1Q2RA 4HSHA 3QFWA 3MMTA 3V18A 1IEIA 3B8WA 7REQA 3PZGA 4WXYA 2WSPA 1P7TB 4FNRA 1RUSA 3BQ6A 2GFTA 1I0DA 3JZUA 1PDZA 4WCJA 3L0GA 4JTDA 2QGYA 3I6RA 4DBWA 4E38A 3H2OA 4KEMA 2YR1A 1TVNA 5EFDA 4QRNA 3CQIA 2HV5A 3A5VA 1AD1A 1YXYA 1ZJIA 2ZXAA 1WA3A 2DT3A 1WBJA 1XPGA 3WNOA 4CQBA 4N9EA 2PWHA 4LALA 4Z1AA 4JN7A 3KBMA 2GSEA 3S42A 4KFOA 6ENLA 4JTAA 4PRWA 2H6RA 3HPZA 1AW1A 1T40A 3TJIA 1S2TA 4B2DA 1JI1A 1XDJA 1ONWA 1FWCC 4Q8PA 4IMEA 3WLOA 3N29A 1SO4A 1GNXA 4BWLA 3ZR5A 1DIOA 4FNPA 3C5QA 4BWLC 1G4TA 1TRIA 4J7RA 4IJBA 3G1DA 2B7PA 3WH9A 1EGVA 1W1A1 3PJXA 2WKLA 1E9LA 3KDOA 3SI9A 1VBJA 2PDXA 1CW2A 1PKLA 2FZ8A 5JQ9A 1J01A 1Q6CA 1PZ0A 3TROA 1YTEA 2ZUUA 1VHNA 1QASA 8RUCA 4IPNB 4LC8A 1G4SA 5IHSA 4F0MA 1IT7A 4B4FA 4HK5A 3TQVA 4JTEA 1JDFA 3KBNA 4A21A 5LKYA 2BB0A 4U2YA 4IIEA 4I90A 1ZP3A 1CXLA 5FJRA 2GLKA 1JZ4A 4QDWA 1IIHA 3MWCA 3OG3A 4NJGA 3T08A 1KFJA 4NAFB 4M56A 5A8GA 4AVOA 4K3ZA 4AD5A 4Y9MA 1W37A 3R5EA 1WBHA 5M17A 3ZVHB 4PTNA 5CG7A 3LV5A 2RKXA 2YB1A 3GAYA 3OO2A 2V5BA 4IP5A 3VKJA 1MW1A 4IL2A 1CIUA 1QBAA 4UTTA 2V5KA 3V5OA 1E3XA 4UTTC 2QYGA 3NVTA 3PBYA 3F4WA 1ONXA 2WNNA 4W88A 4JY8A 2OG9A 4XWUA 2YL6A 2B4GA 1E72M 1UMLA 1MYRA 4O14A 4V2XA 4L6HA 3MHGA 1H51A 4B5VA 4BF7A 2ZUMA 4JCMA 4GK8A 1E4IA 1BXNA 1OCBA 2KAUC 5KITA 1SVDA 4HA4A 1W31A 4H4IA 4M1RA 3LHUA 3BMWA 4W5ZA 1EJTC 1RQHA 4DB7A 3XINA 2J8TA 3LLXA 3RRXA 2VZVA 2IPWA 2SFPA 1JGMA 4Q4RA 2E1DA 3V3WA 3KTCA 4O10A 3DBPA 3SCPA 4E8CA 1ZCCA 3WLHA 4PYSA 1SW7A 2XZ9A 5DN1A 2YKKA 1IZKA 3IGSA 4RUBA 4RXFA 3GFZA 4ZZ9A 1UP2A 3UD6A 4YCPA 5JVLA 1V7YA 3W7IA 1M68A 4LF2A 4UR8A 1R86A 5I3HA 3M0XA 1J0YA 4REQA 5I79A 2GK1A 4G1NA 4DJFD 3TQ0A 3LHTA 3VNKA 3KEHA 2C18A 4NXSA 1PX8A 1POKA 1MDRA 4C90A 2QCMA 3U8GA 1TRDA 2JBMA 2JEPA 4F0KA 1KM0A 3A4XA 4JOMA 3VKKA 4GVIA 3EKLA 3A12A 4ROQA 2QJGA 3UZWA 2VL4A 3TMQA 3NQFA 5U7SA 5CG0A 4GZ7A 3PUOA 1ZRQA 2J75A 4MJMA 2OYMA 3ZYZA 2YBTA 3B0YA 3EXSA 3LX9A 1OBAA 1XRSA 2CFFA 3QTGA 4ENLA 4E6MA 2YX0A 1EEPA 4UNIA 4J40A 2C91A 2OO0A 1ZUAX 2ZVIA 2BHZA 3UA3A 1HJWA 1CGTA 1KM4A 4Q8QA 2ISWA 3IVUA 4DZIA 3EYPA 1SW0A 4V28A 3L5AA 3ARTA