2XFRA

Crystal structure of barley beta-amylase at atomic resolution
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
487
structure length
487
Chain Sequence
b'VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-AMYLASE
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 191
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xfrA00
5FL0A 4RE2A 1H09A 5DEZA 4L4PA 4V2XA 2DQXA 2X05A 1GZJA 1MFUA 1QHZA 2XM2A 5BXPA 1C3FA 1CGTA 2QPSA 1LWHA 3CPUA 1EGZA 2CERA 2J47A 2UY2A 1TA3B 1V6XA 3VIFA 1LG1A 3A6OA 3W37A 1IT0A 3WEZA 3PZNA 1Q4NX 1GNXA 1OGBA 2VL4A 2YDRA 4LGXA 1CGWA 4S3KA 2X1IA 1LF1A 1NWTA 3WKZA 4HMDA 3BLPX 4HMEA 1PZ2A 3CMGA 3ARVA 3L2MA 1I1WA 4J7RA 2VT0A 3L4XA 5JUVA 1MXDA 3SURA 2EPLX 3ARSA 4UFHA 5D8WA 3SUUA 2DSUA 1PAMA 2CKRA 5D9NA 5KZ6A 1BYCA 3NUKA 2DSVA 1EIBA 1MQQA 2VRKA 3GH4A 2QMKA 4Z2KA 2XFYA 1JZ3A 5CLWA 1G94A 3U7VA 3ZQ9A 1MFVA 4Z2HA 4M29A 2YLAA 2ZWZA 5M3WA 1GW1A 4GI8A 4FMVA 1W1VA 1WPCA 2E9BA 4ACZA 1M7XA 1HJWA 4JHZA 3B9AA 2CHOA 3F5JA 3IJ8A 2Z1SA 4BA0A 2BS9A 3U7BA 1OIMA 1JNDA 4UFKA 4GI9A 3WQ8A 2DIEA 2XGBA 1H0GA 1MQRA 4W88A 5A94A 4OBRA 5ABFB 2G3JA 2GDVA 3VDCA 4RL3A 2WCAA 2VVNA 4HOXA 4WSJA 3K8KA 1TA3A 1KGUA 3QHOA 2HVMA 2DH2A 4AZGA 2XTKA 5IFPA 3FN9A 1GUVA 2CBJA 1HL8A 2EPOA 3OZOA 1TUXA 4MNLA 3OZPA 1E43A 2VCCA 1OM0A 3WUEA 2DSKA 3EDFA 4TTGA 1DP0A 2VNCA 4PMVA 4U5IA 5E09A 5C70A 5D8ZA 5A6BD 1PEZA 4D1JA 2X8RA 1QNRA 4KRUA 1K9EA 4MJ2A 4N0RA 3UESA 2ZX9A 3ZMRA 1PPIA 2WAGA 2AAAA 4AEFA 3W25A 3NYDA 3LMYA 3AHXA 1WZKA 3TTYA 4B16A 1PIFA 5I6SA 1W9VA 1E3XA 1ODZA 4AY1A 1AVAA 4AXNA 2ZXQA 2PBOA 3WL1A 1KXQA 3WNOA 3WF3A 3ZO9A 1R8LA 1JYVA 1UWRA 2VZVA 2Y5EA 1E3ZA 4HOZA 1V3MA 3VX0A 3NCOA 3RIKA 3MUY1 3BAIA 3QGVA 4K68A 3G6MA 1W1YA 3SUTA 2BVTA 3WNLA 1XH0A 2JIWA 3K4DA 4CD5A 3N9KA 2V3GA 4EAMA 4CD4A 3DYMA 3ARQA 2ZXBA 2TAAA 3VIMA 3VILA 3L4VA 1UD2A 5ABFA 3MV11 3HMCA 4UFJA 1IZJA 2VZSA 4B9YA 5I3DA 1UKTA 5IDIA 4AZHA 3VIPA 5JIPA 1H2JA 3OGSA 1UQYA 2ZUWA 1US2A 1FP8A 4AIEA 3AMCA 2X09A 1E0XA 5BXTA 4UTFA 2FHFA 4PN2A 5EFDA 4FF5A 1ISWA 3POCA 5CPSA 2V38A 4JKKA 2NT0A 3VMOA 4DUVA 4QFUA 4PTMA 2PC8A 3AJ7A 3BSGA 3WIJA 1HVQA 5LA0A 2VX4A 5A2BA 2CBUA 3W27A 3AXHA 3RILA 2CCRA 2PF0A 3JUGA 4PMRA 3AXIA 1K9DA 3DC0A 1JIBA 2OLHA 2J8GA 4GO8A 5EMYA 1G5AA 1H41A 1RH9A 3BAJA 3OLEA 4PTWA 5JBEA 1E6ZA 5HPOA 1UD4A 5E70A 4BQ2A 2ZUVA 1FH9A 2CBVA 5A6AA 3RMEA 2WHLA 4W85A 3WH9A 2WMIB 2DT1A 2JEPA 4U2YA 1Q6EA 4M80A 2DT2A 5ECUA 1DEDA 4D6GA 2JFEX 1QI2A 3WF2A 1E4NA 3VGDA 1SMDA 4E4PA 3EBVA 1ZU8A 1W9PA 4AW7A 3GBDA 3WMCA 4AD1A 3BH4A 2EBNA 3AS2A 4QCEA 2IXUA 1G01A 2W62A 4CU6A 5CSYA 1NWRA 1E9LA 1Q6FA 3OLDA 5E9AA 1E6XM 2F2HA 5FIPA 1KGXA 1AMYA 2J25A 4GQQA 4AZ5A 3GH7A 2BNJA 4AIUA 4GO9A 2BY1A 1E4IA 1WE5A 3VGGA 1B9ZA 4WK9A 1E0WA 3BGAA 4MPKA 2D23A 3EDJA 1BVNP 3W26A 4U2ZA 1JF6A 1B3ZA 4DWSA 4IPNB 3WH8A 3WMSA 1XD1A 4U33A 1FA2A 5BCAA 3CZLA 1BPLB 3EMQA 4ATWA 3WH7A 1QNOA 4AWEA 2ZUUA 1A47A 2WC7A 2XIIA 3SUSA 5M5DA 2WWCA 2DEPA 3AS0A 4Z2GA 2WLZA 3O2LA 4JCLA 1XSIA 1CNVA 5A8MA 4X9YA 1DWHM 1LL6A 3N18A 4W93A 1EXPA 1V3HA 4URIA 4D1IA 4FLRA 4AIOA 4PMYA 5BYWA 1H4PA 2FDMA 2VX5A 3ZJ7A 2YBUA 5CQ1A 1HL9A 3VGBA 2AOSA 3FHQA 2VX6A 2WMIA 4W5UA 3WUFA 4PSRA 1ZBWA 1CECA 2ESCA 1JFHA 4V28A 1GQLA 4HOWA 1CZ1A 1TE1A 3WUGA 2PWEA 1M03A 2Y4SA 1J0YA 1EA9C 1LG2A 3UG3A 5CG0A 5GNYA 1VFMA 1A3HA 1NWSA 2G3IA 5GNZA 3PTMA 2YDSA 4U3AA 3AOFA 2JF7A 3ECQA 1OGSA 2DGAA 3TOPA 2VQUA 3DHUA 4CN1A 3L4WA 3AIRA 3B9DA 1UQZA 1U2YA 1O7AA 4P8WA 4UZSA 1MW0A 2WXDM 3I3EA 3RDKA 3VMPA 1CLVA 4W7VA 1UG6A 3SCNA 4CD6A 3SCWA 1BGGA 5E6YA 3ARRA 1H11A 3SCOA 1J0HA 2J7EA 1PBGA 1CXFA 3WSUA 4CCEA 3GNOA 4YHGA 3A3HA 1J0ZA 3WDRA 2X0YA 4UCFA 2ZX7A 1CWYA 5ABGA 1XYZA 3SCTA 3WF4A 1HJVA 2YLLA 1J10A 3SUVA 4E2OA 1B1YA 1NOWA 2CYGA 3W28A 5GQBA 1VAHA 4DM1A 4HPHA 3AIBA 2VTFA 2OSWA 5I5RA 1J18A 4J3TA 1HJQA 1W3HA 2AMGA 2UY4A 5GNXA 2WHKA 2CXGA 4UR9A 4CU7A 4D6JA 3B9EA 5HDRA 4DUXA 2CKSA 4ACYA 3CHDA 4XUYA 4W87A 1EDQA 1VFUA 2XGIA 1C8XA 1GJUA 2J79A 2DH3A 4HZ6A 4Z2LA 2D20A 3GYCA 4QAWA 5LA1A 1CENA 1E1FA 1JNEA 2XVKA 3MO4A 5JBDA 3AHTA 4HTYA 2WSPA 3M7SA 3VU2A 3N12A 3OGRA 1JXKA 3SUWA 1US3A 4XZBA 2VZUA 1U33A 5I78A 5EFFA 5A6BA 5JIWA 4D6IA 3WD1A 1ISZA 4FK9A 1OSEA 1UHVA 1QBAA 3FNDA 4NRSA 4JFUA 4AYSA 2WVVB 1UD5A 5I2UA 2OSYA 2WSKA 3WDPP 2EO7A 2XVGA 3VKKA 3WNMA 5C71A 4W7WA 4DWSC 4P7LA 7CGTA 1EO5A 3KZSA 2V3EA 1UWQA 2WBKA 4KGJA 1E6SM 3MUZ1 2WW5A 2WMJA 4ZE4A 3BC9A 2GJPA 4OBSA 3CZKA 4P8VA 3W53A 3AIQA 5M17A 2VR4A 2CNCA 1GOQA 3CH9A 3WH6A 2CEQA 3N1AA 1UR1A 1W9UA 2WANA 2XVLA 2XSAA 1UKOA 5I0DA 3NDZA 4JFTA 3SIMA 4PMNA 3MMWA 1CPUA 2O9TA 3PZVA 1W2VA 1DWAM 2FHCA 4AD4A 1QOXA 1KQYA 3PBGA 5GPRA 3VGHA 3APGA 4N42A 4D72A 4AEEA 2J77A 2UWFA 4U31A 3VX1A 1G9HA 1LWJA 1H1NA 2FGZA 1WDSA 4ZXLA 3EMZA 2OSXA 1ZB5A 1JF5A 2UY5A 1BTCA 1GQKA 4MTVA 1ITCA 1TG7A 5IHSA 3KL0A 1CXEA 4PTXA 4PMXA 4LYPA 4A3YA 2YBTA 3AYSA 4BF7A 2G3MA 2BVDA 3MUAA 1V02E 3PZOA 1VF8A 5BXSA 4ATDA 5HNNA 2ZUMA 1JI1A 1UKSA 1VEOA 1RD6A 5DO8A 1BAGA 3AYRA 3MMUA 1DWFM 1R87A 1Y7VA 2CESA 2WC3A 1E71M 1QI3A 1TVPA 5I24A 3AICA 2XYLA 2WVVA 1WP6A 3PN8A 5BWFA 1MW1A 1ITXA 4PSPA 2QF8A 1EHAA 4TTUA 5FD0A 4FLSA 3CZ8A 3VIKA 1PJ9A 1OB0A 3CLWA 1WZAA 5IHRA 1KWKA 3L2LA 4C7DA 3THDA 1D3CA 3T08A 1JDDA 3K8LA 5CXPA 1J01A 3WN6A 1OT2A 4H2CA 4NSBA 2D22A 1H0IA 2NW0A 1JI2A 3RPMA 3D3AA 2QPUA 5F7UA 1W9BM 2W67A 3EDEA 1ZS2A 3CIVA 3T0DA 5IFTA 1E6NA 2JIEA 2CIPA 3WMBA 2J7HA 4J3SA 4MAZA 3AROA 1JDCA 3AIWA 2YA2A 5D9PA 3ZIZA 5BXRA 5A8PA 3S6TA 1PX3A 1XH1A 2VUYA 4CVUA 3UG5A 1GORA 2BY2A 1CXLA 1TZ7A 3AZRA 4WKHA 4NZCA 4LYQA 1KCLA 1B2YA 1V0MA 4OIFA 4UQBA 2YL9A 4TVUA 4UQEA 1QNPA 2ZICA 1NOFA 4KWUA 4LX4A 3KEHA 4P8UA 4W8LA 5LYRA 5I77A 1CYGA 3B8SA 1WO2A 3ARWA 3MSGA 1MVYA 3AI0A 5EBAA 3M6DA 4X0NA 3WD0A 3FY1A 1EDGA 1L0PA 1C7SA 2XFFA 3GZAA 4IM4A 4HU0A 3HJEA 3WDHA 3CMJA 2WYSA 5AYBA 3VD9A 2WHMA 1NP2A 3AMLA 3AFBA 4TXEA 3ZT6A 3RO8A 1M53A 3IAPA 5HOSA 1V3JA 3N13A 1E5JA 3WDQA 2VCAA 2OWCA 5M03A 3A4XA 5EB8A 1W3KA 1JYWA 4D6DA 3VD4A 4L4OA 2PWFA 1E73M 3SCQA 1UUQA 1XRVA 4E8DA 5FL1A 4WF7A 4AC1X 1CXHA 2VQTA 1NARA 1VBUA 2WVSA 2E40A 3WDJA 3VM7A 3T2OA 3WNNA 2D1ZA 3VINA 3WUBA 4QCFA 4AD2A 1EOMA 7TAAA 3OG2A 4DWSB 3KL5A 1NWUA 1B0IA 1IV8A 2JE8A 1QW9A 4WKAA 1C7TA 1B3YA 1YQ2A 4M1RA 2J78A 1B3WA 4OOUA 1GPFA 1SMAA 3ZR6A 4BQ5A 1J0KA 1F4AA 1UR0A 4CCDA 1GOMA 3FW6A 4JFVA 4AMCA 1KWGA 1F4HA 3QR3A 1DTUA 3K46A 3OGVA 1BYDA 1N82A 3GDBA 4DM2A 3KWXA 3VIOA 3ALFA 4BZYA 3GBEA 3VUPA 4UOJA 1J12A 3WENA 1V3KA 1UR2A 1FFQA 2WNWA 1HKIA 1W1PA 4H8HA 3UCQA 2D0GA 3I3BA 4ATLA 4W86A 3CHEA 5A69A 4J28A 3VDBA 1HKJA 7A3HA 5A8NA 1JZ6A 3ARPA 1UH2A 2ZWYA 2ZOXA 3ZM8A 1E72M 3TTSA 4AZ7A 2V3DA 3ZSTA 2QV4A 4UQ9A 1XH2A 4OZOA 2BXYA 2X0HA 1K6AA 1OGGA 2WMKA 3IJ9A 3UETA 4ZEPA 2J7GA 4Q7NA 3GNPA 3N15A 3RM9A 4GIAA 4XZWA 4GINA 2W91A 3BLKA 2FH8A 3K1DA 1XYFA 2PWHA 4HA4A 3FAWA 3LPGA 3CZGA 1BGAA 3HU7A 1CGUA 1JL8A 5A8QA 3W29A 2O9RA 2V5CA 1ESWA 2BV9A 1EHNA 3WQ6A 1W91A 1R86A 2ZX6A 1GOKA 4R5EA 1FFRA 3GNRA 3W6MA 3OIHA 5CJ5A 3T0BA 1HKKA 3MV01 4D6FA 5DT7A 2CBIA 1JZ7A 2XFRA 3AIVA 4HZ7A 3GTNA 1OCQA 4KH2A 4NRRA 4W5ZA 1BF2A 5HPCA 1JD9A 1VBRA 2EPMX 3SCUA 1ZL1A 3W6LA 4IISA 2WVUA 2Y2WA 5JBFA 3CHCA 2E4TA 2GK1A 1WZMA 2WK2A 1KBKA 3U5YA 4UFMA 3SEPA 4AD0A 5BRPA 2XWDA 4PMZA 2W4XA 1WDRA 1VFFA 1CXIA 3IAQA 2ZX5A 3ZJ6A 4JCMA 1VFOA 3IK2A 3MU7A 4MAVA 3BCDA 4PMQA 1X6NA 4YHEA 1W1TA 3AHYA 1GJWA 4JL1A 1TCMA 1GOOA 6CGTA 3PHAA 4TX8A 2QLYA 4AD5A 4CUCA 1KQZA 1HJSA 1S46A 2PB1A 1L8NA 2JALA 1OD8A 2Y24A 2OWWA 2XUCA 5DF0A 1BFNA 2VRJA 2DSZA 5E6ZA 3UR8A 3EDDA 4PMOA 2QMJA 2ZIDA 1R7AA 4H41A 3ZT5A 1UKPA 1C93A 1MXGA 2D3LA 3WQWA 3PTKA 1NQ6A 1UR4A 2GFTA 3CUFA 4PMUA 1BQCA 1ODUA 1TVNA 4MDPA 2VOTA 3EMCA 1GQJA 4PCTA 4X0VA 5CPQA 1BVZA 1JAEA 2XHYA 2ZUTA 3ARZA 1WNOA 3AZTA 4MB5A 1V3IA 4E8CA 4QP0A 1B31A 1GVYA 4J3VA 4D71A 2OYMA 4J3WA 4CCCA 1V3LA 3VM5A 2D0FA 2XIBA 3A4AA 4OJYA 2YL8A 3S2CA 1GONA 2GVYA 1OT1A 2E3ZA 4KGLA 1MYRA 2EXOA 3DHPA 2WBGA 3N04A 4TX6A 4PUDA 1DWIM 4H04A 3AMGA 2E9MA 4HU8A 1JZ8A 4MNJA 1MW2A 1BHGA 2YDQA 3ARXA 3AZSA 1E6RA 2YIHA 2HISA 1HF6A 1W9XA 2E8YA 4P8XA 2C0HA 4BS0A 3TONA 5I23A 3ARTA 1SYTA 4BQ4A 4EE9A 4HA3A 1HJUA 1E55A 1I1XA 1ZJAA 4F79A 4UQDA 1UA3A 1UYQA 4M8UA 3ARUA 1UWUA 3UR7A 1B30A 1PZ3A 2J7CA 2FH6A 6A3HA 1UR8A 4AD3A 4A3HA 1OD0A 1LJYA 1UKQA 2YJQA 2A3HA 3RCNA 4W7UA 2DPEA 4RE3A 1B3VA 4LPCA 4QLJA 1CBGA 3DECA 5AC5A 1E5NA 4MADA 4ML4A 5BRQA 3M46A 4PMDA 4PTVA 4A4AA 3CZEA 4WSKA 3ZJ8A 4IPLA 3DYPA 1I75A 4CD7A 1XC6A 1VJZA 3MUIA 3RM4A 5A6KA 3TP4A 2YA1A 1SFSA 3VDHA 3GM8A 4M24A 3IJ7A 1QHPA 2XVNA 1FHLA 3WNPA 1JG9A 4EKJA 4W8BA 2J7DA 3BMWA 4TOQA 2W5FA 2BFGA 3OBAA 4ZFMA 1XCWA 2WMFA 1KXVA 5E0FA 1QVBA 4H8VA 1CGYA 4ZXOA 4V27A 4J3UA 2DSWA 3A47A 4EK7A 2ZE0A 1EOKA 4MB1A 2IUZA 4XX6A 4GI6A 2JEQA 4OUEA 3PZMA 3ZSSA 4W8AA 2ZXDA 1V6VA 1MQPA 1HN1A 3FHAA 1M01A 2WKLA 3VGFA 3OA5A 1UA7A 2RGMA 4YPJA 2WKGA 1CGVA 4HMCA 3FXYA 3O9NA 1V0KA 1OIFA 1GQIA 2XJ7A 3LPOA 1VIWA 1BG4A 3DYOA 1GOIA 3WFZA 3SCVA 1X6LA 1KB3A 5DT5A 1XSJA 2CPUA 3MS8A 2D24A 2GUYA 2VC9A 1ECEA 1UD8A 4AZ6A 1UR9A 1AQ0A 3AQUA 4FLQA 3BMVA 2O9OA 2BVYA 2J7BA 1E6QM 3WY1A 4JZ5A 3VTRA 2ZX8A 5HXMA 1H5VA 3ARYA 3WQ4A 4MB4A 4WIWA 4CKQA 2OYLA 1CLXA 3AHVA 1ZJBA 1CTNA 2J4GA 4GPNA 2V5DA 5A2CA 1UOKA 1LL4A 1R85A 1U30A 1JYXA 3VO0A 3WQVA 4QLLA 2O92A 1QI4A 4BQ3A 2E8ZA 3PZTA 1K9FA 1E56A 2ZUSA 4D6HA 1UWTA 3CUGA 3RM8A 1E4LA 2CETA 1NH6A 4C7FA 3CUIA 4PYSA 1UZ4A 1ZBKA 5CGMA 2BY3A 1GOWA 3K4AA 1Z32X 3I3DA 4R27A 1O6IA 3RJXA 3VNYA 1H49A 2WZEA 4TVCA 3GXMA 4B9ZA 4H8UA 1CDGA 5A95A 2O9PA 1KR1A 5D9MA 3CGTA 1NP0A 2EJ1A 1UWSA 1PX4A 5A6MA 3SCPA 4HA1A 1FHDA 2A3BA 1X1NA 1BYAA 2F61A 1KGWA 2G4FA 4F8XA 1J9YA 4Z2IA 4EANA 3IANA 3CHFA 3II1A 3W0KA 1CGXA 5AY7A 3OLIA 4GXPA 4D6EA 4UNIA 1V0NA 3QOMA 5KEZA 1WZLA 2GJXB 3PZUA 4UOZA 3EYPA 3LPFA 4HP5A 2WCSA 3PZGA 3NSXA 1UD6A 2VZTA 1BLIA 2YL5A 8A3HA 3MANA 4P7NA 4CN4A 5D9OA 3WD4A 3UEQA 1TMQA 2GDUA 3GH5A 1VB9A 1W32A 2Z1KA 2W66A 1CIUA 3OLGA 4GKLA 2WC4A 4UFLA 1DHKA 1HT6A 2G41A 4U3CA 5CLTA 2J75A 4RE4A 3W82A 1HX0A 1VENA 3UERA 2WHJA 5D4YA 2J7FA 3PZIA 4CN6A 1G1YA 1G0CA 2JF6A 3KL3A 5CPTA 1Q6GA 1EO7A 1RP8A 3ZOAA 1W9DM 5DFAA 1FH7A 1J0IA 3SCSA 3WNKA 3PZQA 3T2PA 2VVSA 1NOUA 2WM0A 3PZ9A 4LQ1A 4CD8A 2GSJA 3OB8A 1JAKA 1QNQA 3AS1A 3WBEA 4Y7EA 4CVWA 4M82A 3F5KA 2J74A 1V08A 3AXXA 2OWXA 4H7VA 1E1EA 3CZJA 3VPLA 1BSIA 3CUJA 1BG9A 3AISA 1JXJA 2FGLA 2QHAA 1V6UA 4OOZA 3BAYA 4W89A 4PRWA 1UD3A 1VRXA 2WZIA 4B15A 4JL2A 5A6SA 2WWDA 2DIJA 3K8MA 3NJ3A 4Z2JA 3W4RA 1KCKA 4HZ8A 2VURA 5A3HA 1LL7A 1DWGM 2GJXA 4MNKA 3TTQA 1EH9A 3NSNA 3NSMA 1FOBA 1RPKA 1WDQA 2WB5A 4C7GA 1WKYA 2WVTA 1SR0A 1H3GA 4PEEA 1VEMA 3HN3A 3VGEA 3VD3A 2GK1B 1D7FA 5HBFA 4M81A 1QI0A 1HP4A 5A6LA 2WCGA 4WJXA 2NSXA 2BHZA 1GHSA 2MANA 5A8OA 5AYIA 2DDXA 1JFXA 4BCEA 1E4MM 5ABHA 1CEOA 1UH4A 2PWGA 2XSBA 2WMGA 1JZ5A 3QHMA 1JZ2A 1WB0A 4D6CA 2Y8KA 3BAWA 4JFWA 5BROA 2ZUNA 3AMDA 2V3FA 1KBBA 5FOOA 2C8NA 3VD5A 4AZIA 3PTQA 3WH5A 4P7OA 3WF1A 3FAXA 4NI3A 1WDPA 4FLOA 2E9LA 2EPKX 5C8BB 2A3AA 3ZJKA 2GJRA 2W61A 3WQ5A 1CXKA 4NF7A 4PUEA 2A3CA 3W38A 1GHRA 3WEOA 1Q6DA 1PX8A 1QNSA 2C7FA 2W63A 2G8ZA 1VEPA 1V0LA 5DMYA 1QHOA 5CZKA 2WPGA 4UQAA 1OINA 5AC4A 5E0CA 4UFIA 1HP5A 1FP9A 3W24A 1W2PA 2WMHA 3T2QA 4TUFA 4AISA 4GQRA 4MNMA 3CUHA 4J3XA 2DT0A 1QW8A 2BHUA 1V6WA 2VZOA 3MKKA 4AZBA 1M04A 2XPKA 3WL0A 9CGTA 1TR1A 3BSHA 2XVPA 2BY0A 1EQCA 2Q8XA 2VR5A 2EEXA 1EQPA 3VNZA 1E40A 1WCGA 1VJSA 3U5UA 3VIIA 1E0VA 3L4YA 2NT1A 2ZXAA 4AZCB 3LPPA 1ZBVA 1LQ0A 1JD7A 1RP9A 2YA0A 3AS3A 3E1F1 4WLCA 1KR0A 3WF0A 1QI5A 1QPKA 3A4WA 3VIJA 3MSDA 1W3LA 3GXFA 4JKMA 3L4UA 4B3LA 3SCRA 1XV8A 2PBGA 4QLKA 1JDAA 3CTTA 1E15A 2YOCA 2YL6A 4P7RA 1EDTA 3AHZA 3T0AA 2D0HA 3L4ZA 4JHOA 1TFVA 3U57A 3QHNA 4J27A 2OYKA 4OKDA 2VCBA 4QDMA 3BAXA 4U5KA 1NM9A 5CSUA 1XSKA 1C90A 3O6AA 4MB3A 1LLOA 3MMDA 5FKYA 5TD4A 2VI0A 3VVGA 4B3KA 2DT3A 1HKMA 2D2OA 1BYBA 2W92A 1HVXA 1XCXA 3G6LA 1R7OA 5CGTA 4DUWA 2J8FA 1HXJA 1UZ1A 3WELA 2EPNA 4LYRA 4HPGA 4GZIA 2IXVA 3WFLA 5I79A 4JAWA 2EQDA 3VMNA 3D5HA 3VDAA 2RGLA 2Y8VA 3CBWA 3POHA 1K9TA 2VX7A 3WEMA 1OWQA 3WD3A 3GXIA 1E70M 2PI6A 3TA9A 1KXTA 3F4VA 4CGTA 1JYNA 3F5LA 1KXHA 4F9JA 4AZCA 5IXEA 3VIGA 3VOCA 3AMKA 3VIHA 1GCYA 2FHBA 2PWDA 3BCFA 1C8YA 3M07A 1KFWA 4CU8A 3NDYA 3T09A 2E0PA 3AIUA 3GXDA 4IUGA 1XGZA 2CITA 1FH8A 2B31A 1MWOA 2XWEA 1J11A 3AIEA 1V03A 3QOKA 1ISYA 4P7QA 4GZEA 6TAAA 2YKKA 4KRTA 1HNYA 4TVDA 5LA2A 1E6PA 1MW3A 1C8QA 1WAWA 4MDOA 1ZBCA 4Q22A 3KE0A 4JIEA 1B3XA 1GVIA 4LXFA 1HJXA 1AQMA 1YHTA 4F66A 1W3JA 3WBAA 3BAKA 1QBBA 2VMFA 4UQCA 3RJYA 1UWIA 3ALGA 2X2YA 2VRQA 3WD2A 8CGTA 2XM1A 3UG4A 4UZUA 3NIYA 4ZE5A 2F8QA 2BXZA 1V6YA 1C91A 1OBAA 2WLYA 1HIZA 3EDKA 2BHYA 1UH3A 2XG9A 1XHGA 4UOQA 2UY3A 1C92A 1JZ4A 4WKFA 4GZJA 3N17A 4JFSA 3J7HA 3VD7A 1XD0A 3N11A 4DWSD 4XB3A 5ABEA 3CO4A 3TTOA 2CHNA 4W84A 2VO5A 2J62A 2VJXA 3THCA 3ZT7A 3L4TA 1IZKA 4F9DA 1JGIA 1ISXA 1P6WA 4PCSA 3W81A 1D2KA 2D3NA 1V02A 5FCZA 4YN5A 4PBGA 4ZENA 1Q6CA 1AQHA 4MJ4A 1B90A 4S3JA 2G3NA 5A2AA 5A1AA 3WDIA 4ACZB 2WZHA 1ISVA 1PIGA 4M56A 4JKLA 5A6JA 3BXWA 2A3EA 4XV0A 1DWJM 4KMQA 1J0JA 3ZR5A
chains in the Genus database with same CATH superfamily
3DFPA 3OQ8A 3GC5A 4NYUA 1JULA 4MF4A 4AX6A 2DQXA 4C91A 1EJXC 1EZ2A 4GJIA 1AJ2A 2A79A 1CGTA 1W3IA 2J47A 1P0BA 1W5NA 3VNLA 2PCEA 1V6XA 5K3VA 1TJ0A 4PUKA 3PZNA 1YX1A 2NX9A 2YDRA 3FIGA 3CAVA 4Z1BA 3CUXA 1T96A 4S3KA 2X1IA 1P43A 1PZ2A 3TU9A 3Q65A 3CIXA 1MXDA 4F3HA 4F2TA 3KOXA 1XM3A 5D9NA 3LXCA 2PDFA 2H3BA 1G4PA 2NLIA 1MQQA 1P7TB 1DL3A 4AYGA 1OX6A 1Z7AA 3NEHA 1YMYA 4FR6A 3SQMA 3U7VA 1S3HA 4S2BA 3IIZA 4GKTA 1GTEA 2YLAA 2ZWZA 4GYPC 5M3WA 1GW1A 4TMBA 4FMVA 4NJIA 1HJWA 4G6CA 2WZTA 3DDMA 2BWGA 3U2OA 4MFEA 4NZ5A 3F5JA 1N8WA 3E49A 5GJPA 2BS9A 1OIMA 1JNDA 4UFKA 2HRWA 4GI9A 3WQ8A 2DIEA 3HGOA 3LNPA 5A94A 1QO5A 4JTTA 5ABFB 5HAOA 3BURA 2ACRA 3UJFA 2WCAA 3GDRA 4I9JA 2YXOA 2BGNE 1TA3A 4H9YA 4FX7A 1KGUA 2ZA1A 4Y8FA 4HNVA 3R1ZA 4AZGA 2ONEA 4F4RA 3THUA 1HL8A 1TUXA 3OZPA 1E43A 2XIOA 2G97A 2VCCA 3UXIA 3WUEA 2J9XA 3EDFA 1DP0A 2VFIA 2VNCA 4PE8A 2OLAA 3EWBX 4MZ8A 4PMVA 5D8ZA 5E09A 5C70A 2OQYA 4UTUA 4KESA 1R38A 4N0RA 3LHVA 5CG7A 2ZX9A 2YB1A 3IGSA 4Q4PA 3ZMRA 3S1GA 3TOYA 3S42A 2OZTA 1WZKA 2WKJA 3EWZA 4V1XA 1PIFA 1TPUA 4XZ9A 4GUHA 1E3XA 4GH1A 2BOFX 3O7UA 5FESA 1AVAA 1N8IA 2ZXQA 3FV9A 5JH1A 1UR3M 2PBOA 3LXAA 3RPDA 3WL1A 4PB4A 3WF3A 2H9AB 1Q7MA 3W7IA 4JTLA 2OVLA 1E3ZA 4HOZA 3B0PA 3NCOA 5CJNA 3O0FA 3MUY1 4S3FA 1ML1A 1U5VA 4EF8A 3TQPA 3QGVA 3B4YA 4ZGYA 3SUTA 2I5GA 4KEMA 1XH0A 1IEQA 1UCWA 2OJPA 4PTDA 4J3ZA 3DYMA 2C1HA 2ZXBA 4GNJA 5CBJA 3VIMA 2YFNA 3B06A 1RQEA 3SN0A 3SGZA 2VZSA 4F48A 1UKTA 3MKVA 4AZHA 1H2JA 1PO9A 3M41A 4HYWA 1IEVA 5HINA 2X09A 5BXTA 3W83A 3ES8A 4REQB 4HSHA 2FHFA 5EFDA 4FF5A 2PFHA 1ISWA 3POCA 3G2GA 4ICCX 2DV0A 1LRTA 3SJNA 4JQ4A 5J5DA 1O66A 5DBUA 2VX4A 4B2DD 4J35A 2ALDA 3WLLA 5HNRA 3M0HA 2Z0IA 2ZA2A 3AXHA 2CLLA 2HS6A 2PF0A 4J40A 1XQKA 3WQCA 2D69A 3L7RA 5EMYA 3CC1A 3OLEA 5JBEA 2NXHA 5U7SA 5E70A 1KNWA 2ZC1A 2QCHA 4BQ2A 1FH9A 4G56A 3RMEA 3WH9A 3GDLA 4DRSA 2DT1A 3TYEA 4U2YA 1F61A 2DT2A 2X1UA 4RV8A 3LX9A 2G50A 1E4NA 3KFTA 3EZ4A 2NQJA 5LNVA 1UP2A 5DXYA 3S5ZA 4AW7A 3E6EA 1QPOA 2HK0A 4CU6A 5CSYA 3GR7A 4GUFA 1NWRA 3OLDA 2GGGA 4WX2A 1W5MA 4E2DA 1RQHA 4WJEA 2J25A 1GKRA 3M43A 2BY1A 3NEVA 2EG8A 1WE5A 4WK9A 2PUZA 5DXXA 3LRMA 2PGFA 4PL1A 4YYCA 2Q6ZA 3GSMA 1JF6A 1B3ZA 3ABOA 4GQGA 4K1GA 1CCWB 5EMLA 1TJPA 1QNOA 4AWEA 3V1HA 5AHMA 4ZSUA 4GY0A 3EA2A 3PSVA 4JCLA 4JQ2A 2ACQA 5C9XA 3VABA 2E5CA 2YB4A 2UZ9A 4ZA0A 4AIOA 4PMYA 5BYWA 4C6DA 4DI8A 3VGBA 5MHBA 1AUSL 2PA6A 2VX6A 4W5UA 1ZBWA 1QFEA 1E1CA 1TE1A 1GVFA 1QWKA 1LLZA 3WUGA 2PWEA 1GTHA 2Y4SA 2AKZA 2IMRA 1IHIA 4C6KA 5CG0A 5GNYA 1VFMA 4N6EA 3PJXA 2G3IA 5C6MA 3PULA 2YCJA 4O1BA 1AW2A 2YDSA 1MUMA 1W8GA 2QXWA 3MYPA 5FJOA 2SFPA 1O4UA 1A50A 1UQZA 4OVXA 1XFBA 2AQVA 4CQAA 2FB3A 4XKMA 3RR1A 4P8WA 1MW0A 3I3EA 1MDLA 4L9ZA 2X7VA 3N4EA 4W7VA 1UG6A 2DZTA 3RRAA 1NY1A 1WXZA 2A2IA 3M0YA 1JVNA 1YXCA 1CXFA 2ZZ2A 4CCEA 3GNOA 3PS7A 3A3HA 4XUGA 2NUXA 2X0YA 2ZX7A 3O15A 5EYWA 3LLXA 1XYZA 3C2FA 4ZSTA 5C5YA 3RLVA 5HANA 4E2OA 3W28A 2NX1A 1VAHA 3UJSA 4HPHA 4Q8UA 3AIBA 4WXZA 4EOUA 2Z27A 5I5RA 1K8CA 1J18A 2CLEA 1HJQA 3EPNA 1WQ5A 2RUSA 4JTKA 1ECQA 2WHKA 4UR9A 4V1YA 3KP1A 3ATZA 1KBIA 3N34A 3PPGA 2CKSA 1OQFA 2NQ9A 1VFUA 1TYGA 4G1NA 4AMAA 3QTPA 4QG9A 4QAWA 3SZ8A 2HCVA 4ZQOA 5LA1A 3W7DA 1JDFA 3OP2A 4NAFB 3MT1A 1VPYA 2WSPA 4GFIA 4UR7A 3WLRA 1US3A 2VZUA 4D6IA 2GVLA 3WD1A 4L4MA 3FNDA 4IPPA 1UD5A 2OSYA 2WSKA 3WDPP 2XH4A 3W7PA 5C71A 4PR4A 3S8HA 4M6PA 1EO5A 4JQ3A 4L65A 3CWNA 3VXGA 3KZSA 2V3EA 3MTWA 4Y2WA 1E6SM 4TX9A 5LNRA 1R9YA 1F6PA 2WW5A 3NOYA 5MF5A 2WMJA 4S3EA 1S2TA 2GJPA 4OBSA 3UGVA 3GUGA 4NIRA 5M17A 3T07A 3RCMA 1TMLA 1GOQA 1UR1A 1LLWA 4L6DA 4DBDA 1UKOA 4MUZA 1CPUA 1W2VA 1DWAM 2EKGA 2FHCA 4AD4A 3ITOA 4YLWA 1A5LC 1FKXA 1KQYA 3LM3A 2POTA 4MPQA 4ZO6A 3SR7A 4R9OA 3CK5A 4U31A 3KBMA 1H1NA 4KWOA 2D2GA 4ZXLA 1BTCA 4C65A 4MTVA 1ITCA 4QE5A 2QJHA 4KS0A 1AH3A 4PTXA 4XBKA 3BTNA 4H9TA 3BOXA 2WSYA 4A3YA 2YBTA 4B3ZA 3E2VA 4BF7A 2BVDA 3MUAA 2I9UA 4LVDA 1US0A 5F2LA 3P5ZA 4BJHA 5BXSA 1XS2A 5FJJA 5HNNA 4B4HA 1JI1A 1OFAA 1FWBC 4RNHA 3LTSA 3TYBA 1R87A 2ATMA 2WC3A 1QI3A 2ZBTA 3AICA 3RG6A 1MXSA 1S1RA 2ZZ1A 1SJCA 4S1FA 4PSPA 2QF8A 4TTUA 4FLSA 3CZ8A 1JQXA 1M6JA 1V93A 3WJWA 4C7DA 1SO6A 2V67A 1JDDA 3WO8A 2F2KA 4DO6A 3W1RA 1A5MC 3TYUA 4ZTXA 4JXCA 4DHGA 1UMYA 1UJPA 1XIJA 2XFWA 3AYTA 4L7ZA 1H0IA 5B7YA 2NW0A 1K6WA 3A4JA 1SM9A 2PLKA 3B40A 4LV9A 4N9EA 3ZXWA 2QPUA 5F7UA 3LU2A 4JY9A 3OBKA 2I1OA 3T0DA 3BZGA 1E6NA 2FB2A 3WMBA 3AROA 1EP1A 2YW4A 5A8PA 1AL7A 3E38A 1JPIA 1P4CA 4H4IA 1GORA 2BY2A 2V6AA 4IICA 1TZ7A 3WLHA 3XIMA 1XX1A 5T91A 4LYQA 1V0MA 1P6CA 1VFLA 3O6DA 1PKMA 4PA8A 1DQWA 3TC7A 4G7EB 2V0TA 1QNPA 2ZICA 3CB3A 4EAYA 3LZ3A 3NQVA 4GIYA 5KZEA 4LX4A 3KEHA 1W54A 3O16A 5LYRA 4QISA 5I77A 4KWVA 3TR9A 1UP0A 1WO2A 3HQPA 4A6GA 3IGUA 3MSGA 5C7VA 3PUGA 4EWJA 1LQ2A 4IFOA 7REQB 1WUFA 2O55A 2IKJA 2Z2AA 3V16A 1C7SA 2PDJA 3GZAA 2B7NA 2WHMA 1NP2A 3AMLA 1E51A 1IGWA 2E28A 1Q6RA 1M53A 5HOSA 3TQ0A 3I6RA 1E5JA 2VCAA 1TPFA 4GH3A 1KTBA 3A4XA 1MRAA 3VKAA 1W3KA 1JYWA 4D6DA 3QV7A 4XZMX 1RSCA 3UY7A 2XDFA 3GC4A 3A22A 1UUQA 4Z42C 4AC1X 3GU1A 1FDYA 3WDJA 3VM7A 1S5NA 2D1ZA 4CQDA 3TN5A 1PDYA 9RUBA 3A64A 3HV9A 1EOMA 7TAAA 3VUSA 1YBQB 1YTDA 4CQ8A 4WGXA 1EC8A 4NASA 4Y8EA 1YQ2A 4NZ3A 5F4SA 1H7OA 1SMAA 3TCSA 3ZR6A 4HYVA 2DZSA 3W86A 1F4AA 4PBFA 4JFVA 4AMCA 3S6DA 1KWGA 1P0KA 3GG0A 2EG6A 3V4BA 3K46A 5H8UA 3OGVA 2FPVA 3IACA 3GBEA 3REQA 2CXEA 3Q58A 3LV6A 2NQZA 1OF8A 3M9YA 3W7CA 1RXOB 4FNRA 2D0GA 3I3BA 4JDYA 3L5AA 5A8NA 2OZ3A 3M5VA 1N7KA 3FKKA 3ITGA 2V3DA 2Z1WA 3ZSTA 1BVWA 4X61A 5BOFA 2VEPA 1KKRA 1G7VA 2R14A 4RZ5A 2J7GA 4Q7NA 1QPQA 4GIAA 4LF2A 1ITQA 1SFTA 3DFSA 4DWDA 3C4UA 3NR0A 1CGUA 4CNOA 4QQ3A 2XISA 4YTSA 2CLMA 2ZX6A 1Y8BA 3EWWA 3T0BA 5DT7A 4JNZA 2I57A 1DKWA 3WMLA 4N9BA 4YTUA 5CPLA 3N4AA 2GYIA 4NRRA 1BF2A 5HPCA 1JD9A 3CLMA 3TSMA 3W6LA 4F40A 3NZ1A 3DFOA 3T05A 5JBFA 3CHCA 3W9ZA 3PB2A 2GK1A 1KM1A 4DJDC 1MRQA 4UFMA 4QJ1A 2XWDA 4O0QA 2W4XA 2QUVA 1VFFA 3GDMA 4MAVA 3BCDA 4PMQA 3KCJA 4K8GA 4O14A 2J27A 3HG2A 1GJWA 4JL1A 6CGTA 3GX9A 4TX8A 4PUUA 2Z1VA 5DY3A 1PKNA 4F0SA 4HVXA 1OD8A 1Q8AA 2Y24A 4EVZA 3ZYZA 3R6IA 3C2VA 1VBHA 1FXQA 5E6ZA 1S5MA 3JU2A 1MUWA 3ZT5A 4A2RA 3NA8A 1C93A 3AU6A 4ZTYA 2D3LA 3WQWA 3F1QA 3D46A 1NDYA 4C6CA 1YW1A 1EX1A 1LORA 3DHDA 1GQJA 4PCTA 1BVZA 2R1PA 3AZTA 4QE4A 4E8CA 4IMEA 2PCQA 4Y9OA 2OYMA 2WQPA 3CL7A 4QAIA 2E3ZA 1F3EA 1V8EA 3PPHA 4TX6A 2V8ZA 4PUDA 3PG9A 4IIEA 2ADAA 4N02A 4FA3A 1VC4A 5H91A 3MDWA 3LSCA 4JTCA 1X1ZA 3AZSA 4GK8A 2FFIA 2C91A 1E6RA 3IJDA 3U9IA 1JCTA 4P8XA 3SRFA 4JR5A 3TDFA 5I23A 4KCVA 4ZO9A 3BLDA 1ZAJA 1ZJAA 4F79A 3BANA 1TJ1A 1UA3A 1QPRA 4BWLA 1R9ZA 1QW7A 3U48A 3V0UA 3TJXA 4AD3A 3GHTA 2C0AA 4YS1A 1LJYA 1ZCOA 4MWAB 1ONRA 1P1XA 5TIMA 4DBWA 4C6EA 1B3VA 2A0NA 1CBGA 3GRIA 4HHHA 1DJWA 5CZJA 4JIHA 4XISA 8XIMA 3M46A 1ZAIA 4PMDA 4WSKA 3ZJ8A 1JCNA 3GFZA 3DYPA 2PRLA 1WBHA 4B92A 4DYKA 4ZVJA 3MUIA 4NZJA 1RJRA 4HT3A 2YA1A 4X3ZA 3WJZA 3VDHA 3I4KA 1NSJA 3BLIA 4M0XA 3V0TA 1RLCL 4EKJA 4W8BA 3T7VA 3LLDA 3BMWA 2W5FA 1ZP4A 1P6BA 1SW7A 1PZ1A 1ZCCA 4R3UA 4V27A 4J3UA 1PTGA 2Z1XA 1M7PA 6TIMA 5T9BG 3TK7A 4G8TA 3HQOA 4JTRA 1T6MA 2IUZA 3TVAA 1GVRA 2JEQA 1JRBA 3ZSSA 1NU5A 3QKEA 1MQPA 1FVPA 3P67A 3TLLA 4GUGA 4M5PA 4QNEA 4DZIA 1BG4A 3GU9A 4KERA 3LGEA 1X6LA 1KB3A 3CYJA 4LYKA 4JX6A 2D24A 2GUYA 2I14A 1D3GA 1IF2A 4DYEA 1FWDC 1UR9A 1FWRA 5DY2A 2WSQA 3TXVA 1F3XA 1Y5WA 3MCNA 2DIKA 3WFAA 2J7BA 5DRIA 3W74A 1FCBA 4DPQA 1H5VA 3FA4A 2A3LA 4MB4A 4CKQA 2QS8A 2PS2A 3G0XA 3OYXA 3KXQA 4WY0F 3G1RA 4ADTA 1UOKA 1PYMA 3JZUA 2AAMA 4GVIA 1A5AA 2YCKX 3K13A 2Q3RA 3VO0A 2XIJA 3C0QA 3W1LA 3IJLA 1KFCA 2O92A 1A4LA 5FJIA 1QMLA 2E8ZA 3W2NA 1SZFA 4D6HA 1E56A 3GTXA 4IIDA 1E4LA 4G2DA 1NH6A 3NPUA 4PYSA 5AYZA 3CQIA 1TR9A 1O6IA 3RJXA 3W73A 5AYXA 3MA8A 4WOZA 1XDLA 4HNLA 3RITA 4H8UA 3OW1A 1CDGA 3W2KA 5A95A 2O9PA 4NJJA 1NDWA 1EC7A 3FGCB 1XIHA 1X1NA 1GOXA 1VYPX 2F61A 2P50A 3N29A 5RUBA 4F8XA 1IIHA 3CHFA 2B7OA 3VC6A 4HTBA 4GXPA 4D6EA 5DCDA 2HPIA 4PODA 4JICA 3QOMA 5FAGA 4XZIA 5HMEA 4FB7A 3COTA 2C15A 5KEZA 2GJXB 1EP3A 2WNQA 4CEUC 2WCSA 3NSXA 1L6FA 2VZTA 1S5TA 3W1XA 3MANA 1I45A 3UEQA 4JTHA 2W66A 1CIUA 3R12A 4UFLA 2BASA 1IXPA 1DHKA 3CHVA 2OOFA 3P84A 1XUZA 4HD5A 1HX0A 4WOQA 1FHUA 3UERA 5D4YA 3PZIA 4L1WA 1ZJIA 4E2BA 5CPTA 2F84A 3QY8A 1L6YA 3DXIA 1C9WA 1Q6GA 3ZOAA 1W9DM 1BD0A 1ELSA 1FTXA 3PZQA 2WM0A 3O1NA 4LQ1A 1DYSA 4A8RA 4DBEA 1FWTA 1QNQA 1IE7C 3AS1A 4Z1DA 3WBEA 4QITA 3N2MA 5H1WA 4M82A 3S0CA 3LHTA 1WKFA 5K4XA 2O0TA 1XLMA 3AXXA 4H7VA 5HUOA 2Y88A 5HNTA 2QHAA 5DN1A 3KOZA 2Q71A 4OOZA 1Y0EA 3MW7A 5XINA 1N55A 1VRXA 1P0DA 2WZIA 4B15A 5D38A 5A6SA 1FY6A 4XAYA 4OQVA 2YZRA 3K8MA 4J2MA 3W4RA 4NILA 1ZSXA 1OX4B 2CLPA 1DWGM 4MNKA 1WYIA 3TTQA 5TF0A 1FOBA 4GNKB 2WB5A 1W0MA 4KQNA 3W7NA 4A22A 4K38A 4NT0A 4Q6JA 1VEMA 3DX5A 2GK1B 4M81A 1W31A 1DBTA 3V36A 5HUPA 3GFYA 1FWHC 3HQNA 2WCGA 2BHZA 2IPFA 1GHSA 4IUOA 5A8OA 1H7RA 1IQ8A 1FWSA 1S5WA 2VHLA 2OCZA 1TV3A 3PUOA 1CEOA 2PWGA 2XSBA 1U5HA 1O5KA 2WMGA 1D3HA 1WB0A 1F6YA 4XG1A 3G1VA 4JYEA 3UA4A 3QR1A 2V3FA 4POCA 3EX6A 4QXIA 3WF1A 3FAXA 3W70A 1WDPA 3T4WA 5K9DA 5C0QA 4FLOA 4OE7A 2GJRA 2W61A 3P93A 4NF7A 4F0KA 4JEJA 2QKFA 3VNKA 3ABRA 5AC6A 1QNSA 1XUUA 2ZTJA 3BDKA 1JPHA 2C7FA 3R0KA 4JTJA 2W63A 1OY0A 1UC4A 5ECVA 2ZA3A 1QHOA 3QEZA 5DMYA 5CZKA 5D03A 2WPGA 4GVGA 5HQEA 1OINA 3EWDA 5E0CA 5EU9A 3H4GA 2WMHA 3T2QA 3CUHA 4J3XA 2DT0A 1ONWA 1KCZA 4HSOA 3MKKA 4AZBA 9CGTA 1ZLPA 2BY0A 1EQCA 2Q8XA 1WCGA 4GE8A 3FDGA 3U5UA 3L0KA 4Z08A 2X2GA 1EFZA 5EGRA 1AD4A 3WLIA 3LPPA 4MHBA 2DVTA 3UWWA 4B4FA 1LQ0A 4IP4A 1JD7A 1VBGA 3AS3A 4FXRA 2CC0A 3WF0A 1QPKA 1W5PA 3MSDA 1QK2A 1OZQA 4JKMA 3L4UA 2FVLA 2I5QA 3FJ6A 5AC7A 3IPWA 2YOCA 5L9FA 4P7RA 1EDTA 2QCNA 2W9MA 3T0AA 3DUGA 4D2JA 1EB3A 3NQFA 3NZGA 2P0OA 1XRFA 4M7TA 1TFVA 4MIMA 3PC0A 2OYKA 4QDMA 2YCLA 1XSKA 3OQEA 3BQ6A 1C90A 4A29A 2OKTA 3O6AA 1OC5A 4WDWA 3TJLA 1KO0A 3QJAA 1VCGA 5TD4A 3VFLA 3I68A 4B3KA 5BOOA 1XCXA 3IIXA 1G69A 3NO3A 3ITLA 2CZDA 3T81A 3WELA 3KOWA 4LYRA 4HPGA 3W02A 5AVHA 5G1YA 2IXVA 3QTGA 4LANA 5CPOA 5BW6A 4AWUA 3W07A 4JAWA 2EQDA 4S3AA 3VDAA 2RGLA 2Y8VA 4WY0A 1TKKA 2Y5JA 2VX7A 1OWQA 3WD3A 4KKXA 3GXIA 1E70M 3SQLA 3TA9A 3WK0A 4DLFA 4DZHA 1YPIA 4IHCA 4AZCA 4AEOA 5IXEA 3VIGA 2FHBA 1QTWA 1TPDA 2PWDA 3TE9A 3BCFA 3W1QA 4AWTA 1C8YA 1J6OA 2OT1A 3BK0A 5U4NA 4F0LA 4QHRA 3T09A 3VKBA 1K4HA 5CZ0A 2XWEA 3AIEA 4P7QA 4GZEA 3W2MA 4JX4A 1HNYA 1GYMA 5LA2A 4YL2A 4QS6A 4IL0A 3H2MA 3HPFA 4JIEA 4EWND 2QEZA 1H50A 1W3JA 3WBAA 4V33A 3LRLA 3QGAC 8CGTA 4KBXA 4KFPA 3SM0A 1FWJC 3CWHA 2BXZA 1B9BA 3EDKA 3SN1A 2BHYA 2YX0A 1UH3A 4HN4A 3E3HA 3HQ1A 4H3DA 3S5YA 1I0BA 3O05A 3J7HA 3VD7A 3OIXA 3M64A 3CO4A 4AIBA 3PAOA 2VO5A 2X41A 3ANUA 3ZT7A 2Y1HA 3L4TA 5KTLA 3PUDA 3P0XA 1B54A 3UFYA 1ICPA 3MY9A 1P6WA 1T8XA 5D37A 1M7JA 2D3NA 5FCZA 4I90A 1AL8A 1TTQA 4ZENA 4DF1A 4XVDA 1XPYA 4MJ4A 1B90A 4S3JA 1R2TA 2G3NA 3M5ZA 3N2CA 2HROA 2FJUB 5AOUA 5A6JA 3DAQA 3BXWA 4WDTA 1GZ1A 4GUJA 3KBNA 1J0JA 3SSJA 4H6RA 1VZWA 1GYLA 1EF2A 4RE2A 4DLMA 2BG5A 1A5CA 1RVKA 1HQTA 2X05A 1WKDA 1MFUA 2XM2A 1XXXA 5BXPA 1C3FA 2P53A 2E6AA 4PFMA 4XD6A 1EGZA 4HK6A 1REQA 4WVXA 2UY2A 3OVGA 3VIFA 1O5RA 3RLGA 1LG1A 3GG7A 4HNUA 2ZZ7A 4KF1A 1U1HA 2R24A 1RBAA 1J2WA 1K7EA 1OG0A 3ZLGA 4HMDA 4O52A 4HMEA 3ELFA 3FVMA 3L2MA 3C0LA 2OR2A 4AVOA 2VGIA 3EX2A 4J7RA 2IQDA 2VT0A 4HZMA 3ARSA 5D8WA 2GZXA 1PAMA 3TX9A 2Z2BA 2CKRA 1LDCA 2WQDA 3P3BA 3NUKA 2DSVA 1EIBA 1BRLB 3GH4A 3CAWA 1R0MA 4Z2KA 3NQBA 5F4WA 3P62A 5CLWA 1G94A 1MFVA 4Z2HA 3SQSA 3HIJA 1EIXA 4XTIA 1XW8A 3DERA 4HPXA 5K9XA 1W1VA 4ACZA 5DMLA 1MDRA 1WAUA 4OGZA 4A2SA 2CHOA 3W7MA 3U7BA 2W27A 4NNAA 4DAIA 4W88A 1TPEA 4OBRA 2I16A 2G3JA 1XYLA 3E96A 2INFA 4IFRA 5CC7A 1TREA 1HG3A 3QHOA 2HVMA 2DH2A 2QAFA 3N6JA 1GUVA 2CBJA 2EPOA 1CX9A 1OABA 1YKWA 4TTGA 1PDZA 1JPKA 5A6BD 6XIMA 2H3DA 1K9EA 1G6CA 4ADSA 3URQA 3V18A 3A5FA 1PPIA 4WQ6A 4AEFA 3W25A 2DZBA 1EJWC 3C56A 2HBVA 3TTYA 1SVDA 2PRHA 3CQJA 4KIEA 1MI3A 1NIUA 2QJGA 1XIMA 1KXQA 2F6UA 4EX4A 3ZO9A 5LKYA 2BVWA 2D2HA 3FFSA 2VZVA 4DNHA 1RD5A 1V3MA 1K7FA 2I17A 3BAIA 1EZWA 2DZWA 4O1CA 3UWUA 3MJYA 4ZQNA 3OTRA 3G6MA 3DFHA 3WNLA 2JIWA 4CD5A 3N9KA 4EAMA 4C1NA 2Z1BA 4L1GA 4R7OA 5BWAA 1R2SA 2VD9A 3HMCA 4Z0SA 2HV5A 5IDIA 5JIPA 3L5MA 3PBVA 1UQYA 3B9NA 2QPXA 4K3ZA 1G4SA 3NQCA 4AIEA 2A7RA 3AMCA 1PS9A 3INPA 2DUZA 5CPSA 3V5CA 3VMOA 4QFUA 4PRRA 1KD0A 5G4WA 1VIZA 1HVQA 5LA0A 4GJ1A 4LAMA 4M19A 4EIVA 2ALRA 3GC2A 3S5NA 2CCRA 3UNDA 3MWCA 3WLJA 2HXUA 4RV3A 4MFDA 1K9DA 1TO3A 2WNZA 3LRKA 4OV4A 1LBLA 1JCJA 5HWJA 1DJQA 1H41A 3L23A 1W8SA 4PTWA 2PTYA 4I5RA 1E6ZA 2W3ZA 3DCPA 3TAOA 3GR4A 1LZOA 5C2XA 4W85A 4Q8TA 1R6WA 5I07A 3H24A 3WJXA 2JEPA 2WZMA 1H7NA 2VFDA 3F2DA 4DJED 5ECUA 4LFYA 4D6GA 5HR6A 3M44A 5GJNA 1PTDA 3O6CA 4MMWA 3EB2A 2ISVA 3G1DA 3B8IA 1SMDA 4E4PA 3EBVA 3QPZA 4UUIA 2P3ZA 3WQEA 3GBDA 3DG7A 2QGHA 3UJRA 3AS2A 1TPC1 1G01A 4C6JA 3FXGA 1O60A 4DJEC 4FALA 1EGMA 2A7NA 1SJAA 3STCA 4WJ8A 4RNJA 4GQQA 3GH7A 2BNJA 4GO9A 3NO1A 1M41A 4QBXA 3ZWTA 1B9ZA 3EKZA 3BGAA 2D23A 4C6MA 1AW5A 3FYOA 4U2ZA 3EPMA 4L5ZA 4DWSA 4IPNB 4A8IA 2HVOA 3QFEA 5BCAA 3CZLA 3P0WA 4G9PA 4ZR8A 2ZUUA 1A47A 4LAZA 2WC7A 2XIIA 4FNTA 3AS0A 3IIOA 3F4DA 4Y6GA 1XSIA 2TMDA 1ICSA 3G1XA 1MEIA 4GI4A 1LL6A 4UTTA 1OC6A 2FZBA 3MB9A 1JUBA 4LALA 3UR2A 7TIMA 2A6NA 2ZRYA 1XYCA 1W5QA 1V3HA 4D1IA 3NQAA 3E0LA 5CQ1A 3URNA 5CC3A 3FHQA 2WMIA 1R9XA 1CECA 2J9YA 3BPWA 1CZ1A 1F05A 3THQA 3LBCA 4HCLA 1M03A 4C6OA 3D47A 3BARA 3B4UA 2CLKA 1LG2A 3UG3A 3MVIA 1NF0A 2FLIA 1EF3A 1NWSA 4DELA 3F4NA 1TE6A 2DGAA 3TOPA 1N2VA 3T8LA 4CN1A 3Q37A 3L4WA 1XBVA 5FF0A 1PCKA 3MWAA 4K1WA 1O7AA 3JR2A 3QV6A 4AWSA 5CGQA 1W6TA 3VMPA 1CLVA 1Q6LA 4GYKA 3CEUA 3H2EA 3PF3A 3SCNA 4CD6A 3SCWA 4GYPA 1BGGA 4XK2A 4QS5A 1ZJHA 5E6YA 3EEGA 3CYVA 3SCOA 1J0HA 4UXDA 1PBGA 1B4EA 3WSUA 1J0ZA 3KTSA 3SCTA 3WF4A 3KTXA 4NX0A 1FWCC 3F2BA 3QZEA 1KA9F 3SUVA 5H8MA 1PXGA 4GLEA 1NOWA 1I9CB 1N8FA 3FSTA 3QKZA 5CPNA 4BI5A 1ZFJA 2QCCA 4CU7A 1V77A 1IWPA 1L8PA 4UC5A 3AXKA 1REQB 3BLEA 4GYJA 3CU2A 4XUYA 1MZRA 4YWIA 3RLUA 1TQJA 1GJUA 1XDMA 3UR5A 1T41A 2DH3A 2ZE3A 3TWAA 1BWVA 1E1FA 1F7BA 3MO4A 5JBDA 5SWUA 4HTYA 4MKNA 3DU0A 3VU2A 4I5XA 3OGRA 1JXKA 3SUWA 3B0XA 4C6BA 4XZBA 4D8LA 5IDZA 1OC7A 3N19B 5JIWA 1NVMA 2AGTA 1OSEA 2F6XA 1QBAA 3ABXA 3UWZA 5I2UA 2P76A 3NZQA 2EO7A 2XVGA 3F7JA 2X1RA 4P7LA 4JTIA 1G4EA 4NI8A 2G4JA 1DV7A 2PSNA 3MI2A 3MUZ1 1OFRA 4LVBA 1JQVA 1IWBA 3NQDA 3LB0A 3HMJG 5FJRA 4P8VA 4OHQA 4C6PA 2GVJA 3AIQA 1EJTC 2CW6A 3ERPA 1XLAA 4K36A 1TV7A 1W9UA 3SIMA 4PMNA 3MMWA 4EXAA 1VH7A 1S1PA 1QOXA 4X9SA 2FVMA 2QCFA 3PBGA 1Z89A 3TR2A 1V7AA 3VX1A 1LWJA 2FGZA 3RRXA 3ZVHB 2OSXA 4LF1A 4ONVA 1K70A 1GQKA 5B7ZA 4JTQA 2GSEA 5IHSA 3KL0A 4E0CA 4PMXA 4LYPA 1XRTA 2QF7A 4JHMA 1OYBA 5LGXA 2X42A 2QUNA 3R0UA 5ENLA 3FJLA 5LNWA 2VM8A 2V5LA 4IG2A 4ATDA 2ZUMA 1VEOA 3P80A 2BGSA 4HB7A 5BU9A 4S3DA 2XN2A 1OK6A 1Y7VA 4FI4A 1E71M 3OVRA 1SO4A 3S9YA 4LB3A 2WVVA 3PN8A 5BWFA 1J79A 1QNVA 1AMKA 4Y9AA 1OB0A 3CLWA 1WZAA 1C8VA 1UP3A 3T08A 2JKPA 3TN6A 1OT2A 3LBMA 3MP3A 2D22A 1JI2A 2PDBA 2OEKA 1W3NA 4C1NB 5LXEA 3EDEA 1V79A 2TYSA 3CIVA 5CAHA 2VKZG 4GCAA 3E02A 2CIPA 2J7HA 3KVLA 1JDCA 3IJIA 2DW6A 3H22A 1IIGA 3GDTA 4FIQA 4H9UA 4RDYA 1ME9A 1OF6A 5CBIA 2J9ZA 1XCFA 1IEWA 4WGHA 4MZYA 4H6KA 3NFUA 1KCLA 1B2YA 3AC0A 4M3PA 1FUYA 1ENUA 2YL9A 5AZ0A 4TVUA 3W84A 4N4QA 1W1ZA 4A3RA 3TFXA 1E9IA 4RKAA 3UZ5A 2F6KA 3SFWA 5G4HC 3BL3A 4KWUA 3BV4A 3CEPA 5FF3A 3VE7A 4P8UA 2O7QA 5H8PA 2Z2UA 3B8SA 1S3TC 4HCHA 1RPXA 3L66A 2HPMA 1F8IA 3LS9A 3AI0A 9XIMA 2X30A 3GWQA 5LHEA 4X0NA 3NZPA 2VGBA 3WD0A 1L0PA 4HU0A 5LIUX 3NQ8A 2V30A 3HJEA 4MY8A 2X1SA 3VD9A 4QJ3B 3UJEA 4R7WA 3AFBA 4TXEA 4ENLA 3ZT6A 4PUNA 3MBDA 5LIXX 2Z28A 3N13A 1Q2RA 2FZ8A 4DPPA 5I03A 5M03A 2E09A 3UNTA 3A3WA 4QEEA 1HKWA 1DJNA 4L4OA 4XWUA 2PWFA 1E73M 1CXHA 2NQ5A 4MWAD 1XG4A 3VK5A 1Z44A 2XZ9A 3UCCA 1YYAA 1TPWA 1XISA 3QRHA 3VINA 1RCQA 1Z69A 2WSRA 3WUBA 3T9PA 4AD2A 2TODA 4DWSB 3KL5A 1FWEC 1NWUA 2OKOA 2YGYA 4MWAC 2CZEA 3NO5A 4ZMGA 4O53A 3CPRA 2P0IA 1IV8A 1KM4A 1C7TA 1B3YA 5D09A 4M1RA 1WDDA 3DH7A 1B3WA 1GPFA 3SRDA 3EWUA 2E77A 5CKSA 3FW6A 1YDVA 3UU0A 3UQNA 3QR3A 4Y90A 3ISIX 1N82A 3ALFA 5KZMA 2PDLA 4JYDA 3VUPA 4UOJA 1QJWA 3WENA 1RCOB 1V3KA 1FFQA 1HKIA 1X38A 4H1ZA 3ZZ1A 3P8IA 3IK4A 3M6YA 4I3GA 3AYVA 2FMNA 4TQTA 3FCPA 3ARPA 3R8RA 2I56A 1GYNA 2ZOXA 3DESA 4AZ7A 4E3TA 3UD6A 1Q45A 4QGCA 3UZXA 4LAOA 2EGZA 2X0HA 3R10A 3DC8A 3GNPA 1TWSA 4RPPA 3OZMA 4XZWA 2E7FA 2W91A 3BLKA 3OPSA 4PEKA 4YVVA 4PZVA 3GD6A 3V75A 1KFBA 3H7UA 3VC5A 2GQ8A 3CZGA 2AQWA 1A0CA 3LERA 3W29A 2BV9A 2CFFA 3WQ6A 4US6A 1W91A 3IWPA 4R5EA 3GNRA 3W6MA 3OIHA 1HKKA 4D6FA 2CBIA 1JZ7A 1XF0A 4Q4MA 3AIVA 5C7HA 1R3RA 4GFSA 4W5ZA 2QW5A 3UVIA 1VBRA 4IGMA 3QZ6A 1X7FA 2WK2A 4B5XA 5BRPA 4AD0A 4FXFA 3KRUA 1RJPA 2PLMA 1Q13A 4JCMA 1VFOA 5J8LA 3E9AA 4YHEA 1GOOA 2OEJA 3PHAA 2QLYA 3KX6A 4AD5A 1QXLA 2QNEA 4YXGA 3I7RA 1KQZA 1HJSA 1BKSA 2WNNA 1SQ7A 5B80A 4WHBA 3TZNA 3ABZA 1XRSA 1XG3A 1RA0A 2VRJA 2DSZA 3TW9A 1OX5A 4PMOA 4NP7A 1IR2A 1DIDA 4DJFD 1Z9AA 3W22A 3R4IA 1ZAHA 1MXGA 2VOMA 3PTKA 3MP4A 3LCGA 3EA1A 4E2VA 4S3GA 3M0JA 5I06A 4IOTA 1BQCA 4MDPA 2VOTA 4Q33A 3IRDA 4TMCA 1JAEA 4DJFC 4MB5A 1FBAA 4DF0A 4QP0A 1B31A 4GHRA 1JUEA 1GVYA 4J3VA 3D0CA 3OO2A 1V3LA 4H6QA 3VM5A 3KRBA 4KFOA 3A4AA 4OJYA 3EGJA 3S2CA 4A8LA 1GONA 5KMYA 1OT1A 3DHPA 3PK7A 4JY8A 4FF7A 3P74A 3AMGA 1I4NA 3N2BA 4XVEA 4X60A 3G77A 4HU8A 1RLDA 5AVNA 1LYXA 5A6TC 1VS1A 2YDQA 3ARXA 1KV5A 2ASHA 3QPEA 1EKOA 1O95A 4BQ4A 3EXTA 1HJUA 2PC4A 1NTHA 1XFCA 3ARUA 3UR7A 1B30A 4UTHA 4ZOBA 4XKYB 5REQA 5F2MA 1UR8A 4AY7A 4A3HA 2GVGA 1H62A 1XLBA 2HVNA 1UKQA 3QMSA 2A3HA 3C3UA 3EA3A 8TIMA 2H8ZA 4W7UA 2DPEA 4RE3A 3W71A 4PTNA 1PHWA 4QLJA 1YPFA 4IG2B 1E5NA 4MADA 3LHWA 1AG1O 4ML4A 4UTWC 3RUBL 4ERAA 4PTVA 3T44A 2R9RA 1I2OA 3MJMA 1XC6A 4ZO7A 3RM4A 5A6KA 2XSXA 4PB5A 1FHLA 4DX3A 1UB3A 2G0WA 5LHFA 4LAKA 4GD0A 4IQLA 1GWJA 2WMFA 4ZXOA 3MQTA 4KIRA 1Q6OA 4JIQA 3FA5A 3NQGA 4HNOA 4MB1A 5FF7A 1R3QA 4XX6A 4GI6A 1QOPA 4OUEA 3N3TA 3I4EA 3EPOA 4JYFA 1HN1A 3WK1A 4FHAA 4DY1A 2WKLA 5F2GA 2RGMA 4MVAA 4YPJA 2P3EA 2WKGA 4O57A 1CGVA 1KW1A 2ZC8A 4HMCA 3LMZA 3SY1A 4HNCA 2AQOA 3O9NA 5A8GA 1OIFA 3LPOA 3DYOA 1LT7A 4DXVA 4FZIA 5AYYA 2ZFAA 4OT7A 5DT5A 1XSJA 2CPUA 4NJKA 3EX1A 1VCVA 1A4MA 2C3ZA 4UNKA 4JPGA 4PMJA 4ILSA 1UD8A 1DIOA 3UPMA 4Q4OA 2ZZ5A 3AQUA 3ZFHA 1YIXA 4HGXA 3WY1A 4JZ5A 3VTRA 1CLXA 4LCQA 2CLIA 2PDYA 3P81A 1ZJBA 3AWNA 4IJBA 2E1WA 4DO4A 5F1UA 2PDNA 1OFOA 5A2CA 1FWNA 5E0KA 3BG3A 4GOAA 3A23A 2VC6A 1W1B1 1U30A 5HMSA 2E5BA 3WQVA 4MM1A 4CLMA 1VHCA 3TJ4A 1K9FA 2QUUA 4OTKA 1T40A 3R25A 4O4WA 3STFA 1LQAA 3OA3A 3O07A 3C0SA 4MUPA 1CT5A 1UZ4A 2BY3A 1EWDA 3LXBA 3USZA 3EXRA 1SZRA 1QU4A 1H49A 4TVCA 1UC5A 1W1A1 4GX9A 3CGTA 1NP0A 4BWLC 1PX4A 3VNDA 2DZAA 1FHDA 4NXKA 3QFWA 4ERIA 1BYAA 1TIMA 1AW1A 4PL2A 1O94A 1RBLA 4Z2IA 4EANA 3IANA 2FYMA 2Y8UA 5AN7A 1CGXA 4BI6A 3OLIA 2Y70A 3IIVA 1UWAA 4GMEA 2IS7A 5AHLA 1H61A 2E25A 4JN8A 4NX5A 4HP5A 2V9DA 1BF6A 2YL5A 2VEKA 4QR6A 1TMQA 4DJDA 2OMAA 4GKLA 2DP3A 4BKNA 2QAPA 1W17A 2R91A 2E6FA 2NQHA 4L9YA 3W1TA 4M1BA 1YRRA 4IMCA 1G1YA 1IT7A 4HKPA 3WQPA 4XZHA 1RP8A 4C6LA 2FGBA 1VFSA 2R1MA 3WQFA 4KW2A 2OO0A 3CNYA 7PTDA 1OCNA 1WOAA 3OB8A 4HPJA 1J6PA 1XYMA 2ZVIA 3W7KA 2YCIX 4YVPA 4K8EA 4Y7EA 2ZRUA 4H9ZA 5ABTA 3C2RA 3F5KA 2A85A 3UVAA 4F2BA 2J74A 2ZRXA 1YADA 1DQXA 4H9VA 1E1EA 2BXVA 1X8CA 4XAGA 2QCDA 3CUJA 3AISA 3DGRA 3WJSA 3AUJA 1JXJA 1Q3NA 2FGLA 2FKPA 4PRWA 1X6UA 3C3NA 4FP1A 4QEHA 2VC5A 1U22A 2REQA 3GU2A 3ONBA 1KCKA 1V6TA 5A3HA 2VURA 1EYEA 1YE4A 3R11A 3L21A 1EH9A 3NSNA 4Q3MA 5DX7A 1CI1A 2EPHA 4XIMA 4C7GA 1WKYA 1JRCA 1SR0A 3TV8A 3VGEA 3VD3A 1D7FA 4NUWA 3NM3A 1D8WA 1HP4A 5A6LA 4WJXA 2MANA 1EBHA 3SO7A 3MP5A 3KTCA 5E1QA 1JFXA 4I6KA 1R30A 4IQEA 4A3QA 4BCEA 2AGKA 4QDPA 1QT1A 8XIAA 3QHMA 1JZ2A 1ZQ5A 2QIIA 3N2XA 6REQB 2ZUNA 2GGJA 3MC5A 4YU1A 2C8NA 3GHSA 4P7OA 4NI3A 2H90A 5C8BB 1P5BA 2E9LA 2A3AA 3BLFA 1ZPTA 3MVTA 2WO5A 1CXKA 1SGJA 3DIPA 4RPQA 3SI9A 4PUEA 1EGVA 4IP5A 4O0ZA 2AL2A 3TYAA 3W38A 1GHRA 5AHFA 1JCXA 3WEOA 4E5TA 3KVKA 5T8GA 3L12A 3MI6A 4DBSA 3EOLA 2A7PA 1VEPA 3VFCA 2R1KA 1AJ0A 4UQAA 3PNZA 2PTWA 3CAKA 1V51A 1HP5A 3LDVA 1FP9A 2FZMA 3TZFA 4TUFA 4GQRA 3MSYA 1KM2A 3TC3A 4PCFA 1V6WA 2VZOA 3PFRA 1DIKA 1M04A 1GW9A 1TR1A 3BSHA 1EL3A 3QQ0A 2VR5A 3VNZA 4NKCA 1G67A 3PPCA 3QYSA 4UTMA 2NT1A 5JU6A 2C16A 1H5YA 4KEZA 1YXDA 3W7EA 1H7PA 3QV9A 1ZBVA 2BSLA 2IPWA 4UNLA 3VI2A 5LSMA 2YA0A 4FO4A 4G7FA 4V15A 3VIJA 1M65A 1R46A 4XZLX 2QJIA 4B5VA 4M51A 1XV8A 1E9YB 4QLKA 3NGFA 3DN5A 4RK8A 3IEBA 5J5RA 2ISWA 2D0HA 2OGJA 4JHOA 3HFTA 1GEQA 2QCEA 1NM9A 5CSUA 1TWZA 4LUTA 1Q8JA 3W6YA 4MOZA 1BXBA 2YPIA 1LLOA 2E67A 4LVFA 4JN7A 3LGGA 5FKYA 2GGIA 1LT8A 1TV4A 2W92A 3KVMA 1HVXA 3G6LA 5CGTA 5D33A 3GXPA 2J8FA 1XP3A 1UZ1A 2RHGA 3USBA 5G4EA 1XLDA 4H83A 4GZIA 4H01A 3S2LA 2QUMA 4UIOA 3G18A 2E5DA 3VMNA 2Q09A 2D2JA 3CBWA 4O12A 5K9CA 4MLJA 3ES7A 4LS0A 4XD3A 4IJCA 4RLIA 1NEYA 3B8TA 3M0MA 1JYNA 3F5LA 4F9JA 3IVUA 2HQAA 5GJMA 3AMKA 3U4AA 3RMJA 3VIHA 3UZYA 3ITYA 3M5YA 1TSIA 3M07A 4CU8A 1ALDA 1I60A 4IGNA 1YDYA 3WLPA 5FEZA 3AIUA 1XLLA 4IUGA 2CITA 4PUJA 5AHNA 3QOKA 3C2YA 6TAAA 2R1LA 4KRTA 2HBXA 1H7XA 2GL5A 1E6PA 4XQ6A 1WAWA 1ZBCA 3CWOX 3FA3A 4LXFA 4DN1A 2VWTA 1XBXA 3TROA 1DQUA 3S83A 2VMFA 2VUNA 1LUCA 2UBPC 4FR1A 3RJYA 3ALGA 2X2YA 2Y7EA 3W01A 2VRQA 3WD2A 3R43A 1EUAA 3VE9A 1CW2A 4UZUA 4ZE5A 1QWGA 2WLYA 1HIZA 3WBWA 5K4ZA 4Y96A 2BX7A 3TEVA 2NZLA 1UMLA 3CH0A 4QE1A 2A1YA 4D9PA 2PWVA 2HS8A 2CLHA 3EOSA 4LV4A 4AQLA 1I0DA 3NWRA 4W84A 2JGYA 3MSRA 2VJXA 3THCA 1DJXA 3C2EA 2NXGA 4RDWA 3MBFA 1YTEA 1FWGC 4F9DA 1CLKA 4B91A 1IXQA 2Q01A 1TELA 1WOBA 4H6EA 4PBGA 3UT0A 1Q6CA 3BMXA 4BHYA 2Z29A 4PBEA 4KEUA 2YYUA 1ISVA 1KRMA 3QZAA 1X8FA 1XIEA 4KMQA 1WXYA 1LBFA 3D6NA 4FS9A 3NQMA 4DXXA 4JN6A 1H09A 4IF2A 5DEZA 4V2XA 4FNUA 4I7UA 1GZJA 1QHZA 5AB3A 5AHIA 1M7OA 3OHMB 2QPSA 3CPUA 4XAZA 1AH0A 1TA3B 1XLHA 3DHFA 1Q4NX 6XIAA 2HMCA 2CZVA 2QVNA 5AHEA 1LF1A 4E4UA 2C1IA 3OODA 4WRHA 3CMGA 4H9XA 3ARVA 4U28A 1I1WA 1SSDA 1T99A 1RK6A 2GOUA 4ZQCA 4CCZA 5XIAA 1ZNNA 1TB3A 3SURA 4UFHA 4AG0A 4IFKA 2DSUA 3QY7A 3BE7A 5CSRA 3KBSA 1BYCA 3FSUA 2QJJA 1UZHA 3KLKA 3ME3A 3LQGA 1XDJA 3PFMA 3P7YA 2R1NA 2XFYA 2P1FA 5I00A 3IGXA 2PGEA 1RK5A 5HULA 3W1AA 3THAA 3URAA 3WX7A 4MWAE 4IIBA 1RHCA 4BK9A 5BOEA 4GIRA 2Y61A 3B9AA 3CIWA 2PU0A 4BA0A 3K5XA 4KCWA 2OFJA 2PD5A 3U2CA 4JS3A 2BMBA 4F0HA 1SU5A 1R2RA 3C86A 2PU1A 3H2AA 2MNRA 2GDVA 3M0LA 4IH3A 2JKAA 3Q67A 4MKSA 3M0IA 2RKXA 3EAUA 4N6FA 4HOXA 3FKRA 2QDEA 4BY3A 5IFPA 3FN9A 3KOYA 1FCUA 3KZPA 2DSKA 3GTHA 2RJGA 5IM51 4PGLA 1L6SA 1PEZA 1F73A 4D1JA 2QZRA 4MJ2A 3UESA 2FPYA 2AAAA 3NYDA 3LMYA 3W7HA 1DJHA 3STPA 1ZHAA 3AU2A 4B16A 5I6SA 1QR7A 4S3BA 5EL1A 1U1JA 4AY1A 3CPGA 2FVKA 3GXTA 1KBLA 4AXNA 1OYCA 2FZNA 3T0CA 4WR3A 3PB0A 4Q8OA 1R8LA 1JYVA 1UWRA 1K1DA 3BSMA 3JW7A 4E4FA 7ODCA 1WV2A 2RAGA 3RIKA 1MMFA 3HM7A 3DOPA 3ICJA 4B5NA 1EA0A 4S23A 3O8AA 1WX0A 1W1YA 3SN4A 2BVTA 3FOKA 3OOQA 4ZZ9A 3W1MA 1K3UA 1PUDA 4RE0A 1JPDX 4CD4A 3ARQA 5HQLA 3VCRA 2TAAA 1OVDA 3VILA 3L4VA 5ABFA 3MV11 3CMFA 1IZJA 2G96A 3OGSA 1UBSA 1US2A 1FP8A 4GX8A 1OFDA 1E0XA 4DNMA 3KRZA 4UTFA 2Z00A 3F03K 4L6HA 3N9RA 5EMKA 4GACA 1GGOA 2V38A 4JKKA 4GQBA 2NT0A 4PTMA 1IXNA 3DBPA 3S3GA 3AJ7A 3BSGA 3WIJA 3EB3A 1A0EA 5I09A 2CBUA 4PC8A 2C14A 4HNTA 2W0UA 3W27A 2F38A 3JUGA 4PMRA 2DJLA 3AXIA 4R9XA 3DC0A 4OUIA 1PWMA 1JIBA 2OLHA 4OWGA 4C1KA 4GO8A 3GFXA 1HKVA 1TV2A 3FK4A 1PSCA 1FXPA 2YFOA 1UD4A 4CEXC 1MUCA 3UZJA 2H9AA 3ZWSA 1SR9A 1FQ0A 2CBVA 1HFBA 3H7VA 1XIBA 1Q6EA 1E1CB 1DEDA 3WLMA 3KUMA 1KFJA 3WF2A 1BKHA 1Z3NA 3VGDA 5E93A 3FYPA 1W9PA 3WMCA 4AD1A 4QCEA 2IXUA 4NZFA 3TMLA 2W62A 3IVSA 1Q6FA 2GDQA 5E9AA 1E6XM 1AA1B 5FIPA 1KGXA 5HMFA 4AZ5A 4AIUA 1Y5VA 4I7VA 2BGQA 1FWAC 3TN4A 2RFGA 4MPKA 2V82A 1L2QA 3TMQA 3WLSA 5BU6A 1ICQA 3WH8A 3WMSA 1XD1A 3LEPA 4U33A 1NFBA 3BG9A 3EMQA 4DJDD 3WH7A 2E1DA 5KINA 3HOJA 1M9HA 4IMAA 4BFAA 1POJA 4JGDA 2WWCA 2DEPA 1GKQA 4ZB2A 4QROA 3EEZA 4E8GA 2G3FA 1SZGA 1CNVA 3RAOA 5A8MA 3GQYA 4X9YA 5FSDC 1DWHM 4PH6A 3N18A 3QC0A 3T42A 4H7ZA 3F4CA 4W93A 1EXPA 2QQ6A 4URIA 3QYQA 3GE7A 3M5XA 2YBUA 1JCLA 1HL9A 4R53A 2AOSA 2JGQA 3VA8A 1FRBA 4PSRA 1JFHA 3QN3A 4V28A 1GQLA 4HOWA 4LCSA 4Y9PA 2XN1A 2VR2A 1J0YA 1ZTVA 3ID7A 4K6AA 5TBOA 1R3YA 1A3HA 3L68A 5EA9A 5GNZA 3PTMA 2PD9A 4EXQA 1I2NA 3TNBA 5LIKX 4AXKA 3TFCA 3HF3A 1TTPA 4ROQA 3WLQA 3AIRA 3B9DA 2Y6ZA 4AY8A 1U2YA 1ZRQA 1VPQA 4UZSA 2WXDM 3RDKA 4N7QA 5GVJA 5FF2A 3H2NA 1H11A 2J7EA 4NJGA 3WDRA 4O54A 4GVHA 4UCFA 1UPPA 1G4TA 1W56A 3T4CA 4L1XA 3VKCA 1CWYA 4CNUA 1OCJA 1HJVA 2YLLA 1J10A 1B1YA 2CYGA 5GQBA 1BQGA 2OSWA 3LYEA 4US5A 3R58A 2UY4A 5GNXA 1XIFA 2CXGA 4JIRA 2PRMA 5CC6A 3B9EA 4IMDA 4DUXA 4PULA 4R88A 3PG8A 2Z7GA 4ACYA 4A21A 4B90A 4AB4A 1EDQA 3PUEA 2XGIA 2J79A 4HZ6A 2EKCA 5JMUA 4Z2LA 4XO6A 5D02A 4Y9MA 4LW7A 3VNJA 1W3TA 5C9RA 3YPIA 2Q8LA 1QCWA 1VD6A 4K2SA 3ZLFA 3N12A 3PBUA 1T8QA 4AF0A 3B97A 2BZNA 3WZ0E 1U33A 5I78A 5A6BA 2ZTKA 1M1BA 1ISZA 4FK9A 1UHVA 4NRSA 2XH2A 4JFUA 4DB7A 3B8WA 5LGZA 1FDJA 3WNMA 2HWGA 4W7WA 4DWSC 1LRNA 2C6QA 4FPSA 1RV8A 1F6KA 1TWDA 4X2PA 1UWQA 4RZ6A 3QPYA 3IIPA 3BC9A 1XYAA 2VR4A 2QDHA 2YXGA 2CNCA 5EPDA 3CH9A 2CEQA 4L4LA 1XLFA 2XVLA 3M4HA 4UTTC 3TN3A 2Y89A 3NDZA 1K8XA 3PZVA 5GPRA 1NDZA 3VGHA 3APGA 1XICA 2PZNA 5BMWA 4YYFA 3OU8A 2TRSA 2J77A 5A5WA 2UWFA 1B4KA 1G9HA 4RZ4A 1WDSA 3EMZA 1D8CA 1ZB5A 3ZR4A 1JF5A 2HDJA 1CXEA 3UW6A 3PWAA 1S2UA 4LS1A 2G3MA 3KBVA 4WEVX 1HW6A 1GEHA 1V02E 2X1TA 4QG6A 4NAFA 1DJZA 3R7MA 2OZ0A 4JIPA 1RD6A 5I02A 1BAGA 3AYRA 3G3DA 3MMUA 3CL8A 2CESA 4ZCWA 1TVPA 5I24A 2HE8A 2XYLA 4J5NA 1WP6A 1MW1A 1ITXA 1EHAA 5FD0A 4B5UA 1R47A 3VIKA 1A3WA 3S1UA 4LU0A 2P8BA 3E2RA 3L2LA 1JPMA 4YJ5A 1D3CA 5CXPA 3WN6A 3WQGA 2WJEA 4RNFA 4H2CA 3BLOA 3HA1A 2Y0FA 1V7YA 5H2ZA 3G0UA 2NUYA 1P0NA 2Z4GA 2W67A 1LOSA 1VJIA 2POZA 4JQ1A 1W1IE 3NXFA 4DJEA 1Z6KA 4RR4A 3NGJA 2DORA 2JIEA 3VCCA 1FCVA 4WSHA 3NPVA 4IZGA 4J3SA 2ACSA 3AIWA 2YA2A 2J66A 3ZIZA 5BXRA 3S6TA 4ZQMA 1M3UA 4O50A 1ZUAX 2VUYA 3W7OA 2I5IA 3UG5A 3MHFA 3B0VC 1CXLA 2BB0A 3A21A 2DU2A 2ABAA 3AZRA 4U4MA 4FOUA 4IQDA 3C5QA 1PE1A 1TX2A 3DFTA 4B5SA 4UQEA 1ADSA 4OV9A 4DEFA 1NOFA 2ZDRA 1XWYA 3MZNA 4KCTA 1EJVC 4HU3A 1POKA 3TW7A 2ZZ6A 1FWWA 3W88A 3ABQA 1EUNA 3QW3A 3ARWA 2OU4A 1MVYA 5EBAA 3GVGA 3DGBA 2GVEA 4LB4A 2DW7A 3FY1A 2PLCA 3REQB 1OADA 3FEMA 4IM4A 2XFFA 3WDHA 3CMJA 2WYSA 3WLNA 3E2SA 3QY6A 2YXXA 1HZYA 3GVRA 4O11A 4AVNA 3RO8A 3TLQA 1F2JA 4LEFA 4JEQA 2NUWA 1DJYA 1Z48A 3VOIA 3WDQA 3L9CA 2OWCA 4XZNX 3NAVA 1RAKA 1QK0A 3QSRA 4O19A 4C6NA 3VD4A 2CWXA 3RK8A 4ZQPA 4JTFA 3SCQA 1XRVA 3UYIA 4NQ1A 4E8DA 1T5AA 2BP1A 4WF7A 2INZA 2VQTA 2AKMA 3GG8A 3W2UA 3CV6A 4HA0A 3T2OA 1DXEA 2DVXA 3UP8A 1E9ZB 4KCUA 3CL6A 3P8JA 2HNEA 3OG2A 3T0TA 3H21A 2DZUA 2BODX 3H2OA 5EBUA 3IGHX 3SB0A 3NURA 2JE8A 4RXFA 1IYXA 4WKAA 4G7EA 1O5XA 4X22A 2YBVA 4H2HA 1AZ2A 1YNQA 4OOUA 1QATA 2FZ9A 1J0KA 4CCDA 3N25A 1GPWA 2V2HA 1A49A 1OFPA 2VFGA 1KM6A 1F9CA 4LVAA 1DTUA 4HK7A 5I3KA 6ALDA 4H00A 3CQKA 1EJ7L 2RDTA 3GDBA 2IKIA 3ITTA 7REQA 3CUZA 4HSNA 4DBUA 3CM4A 1D7KA 1J12A 4I6VA 2ZDSA 2WNWA 1W1PA 1SFLA 4H8HA 1YDNA 3GY1A 1QAPA 2V68A 4W86A 3CHEA 5A69A 3VDBA 1RUSA 3LGDA 2QCLA 1JZ6A 4CQCA 4ZOCA 3R89A 1SW0A 4JDBA 5HR7A 2ZWYA 1O5QA 4NJHA 1E72M 3TTSA 4NYYA 3IS4A 3NYZA 4C60A 2QV4A 1AZ1A 2PTZA 4OZOA 5HJLA 2BXYA 2ATSA 3IJ9A 3UETA 4ZEPA 3WJYA 3PBMA 4XBJA 3O0KA 6ENLA 2YCEA 2PP0A 4GINA 2FH8A 3K1DA 1HGYA 4QRNA 4HA4A 4IX2A 3HU7A 1JL8A 5A8QA 2V5CA 4R34A 2QVHA 3LHYA 4L56A 1YBQA 1R86A 4JTGA 1GOKA 1T0OA 4LAUA 3QLLA 1TWWA 2QUTA 2NX3A 3MV01 3K1GA 3GTNA 1OCQA 2J8TA 4KH2A 3W7LA 4PFHA 4RNIA 2EPMX 1ZL1A 2O56A 4IISA 3A5VA 2WVUA 3KP0A 2E4TA 1F3WA 3GKFA 2A4AA 1WZMA 2OZ8A 4M6VA 1KBKA 1FDZA 3E0WA 3SEPA 3BLLA 1XBZA 4GUIA 1A0DA 4C5YA 1ADDA 1WDRA 4NY2A 2CZFA 1CXIA 3IAQA 2ZX5A 3MUCA 3IK2A 3HURA 2OG9A 3STGA 1W1TA 2GUUA 4S2CA 3Q4DA 2B7PA 1JR1A 1S46A 3GLCA 2PB1A 1KLYA 2R6OA 2JALA 3T8QA 2XUCA 5I3FA 5DF0A 1BFNA 1GVOA 1EEPA 4MJMA 4UTIA 2QMJA 1R7AA 3E12A 1UUMA 4FAMA 5IBXA 2C79A 1UR4A 2GFTA 4AF0B 1TVNA 1NF7A 5TAOA