2XFRA

Crystal structure of barley beta-amylase at atomic resolution
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
487
structure length
487
Chain Sequence
VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-AMYLASE
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 191
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xfrA00
3WFZA 4GI6A 1Q4NX 3GTNA 6A3HA 4UFLA 4L4PA 4PMOA 2ZXBA 2DQXA 3AYRA 1C7TA 4MJ2A 4GI9A 3AHYA 2VZVA 5E09A 1VIWA 1SMDA 4OIFA 1UKTA 1DWFM 3M7SA 1UD6A 3KZSA 3RILA 1AVAA 4D1JA 4DWSA 3AQUA 3TA9A 2CKSA 3WKZA 3BH4A 4FMVA 2OSYA 3A47A 5KEZA 3BXWA 3U5UA 5HXMA 4WKFA 5LYRA 1XYFA 5ABEA 2J74A 1TE1A 3W29A 3RIKA 2OYLA 2YDSA 4N42A 4BCEA 4LXFA 4UFMA 1PIGA 4H41A 5HPCA 1BGAA 2MANA 1TG7A 5A8PA 4W8BA 1KBKA 3AIVA 5I24A 4HMEA 1MQRA 1DP0A 2A3EA 3AI0A 4MDPA 4ATLA 2F2HA 3PZGA 4HA4A 1BQCA 3PZQA 5FCZA 4M1RA 4J3WA 1OINA 2VVSA 1DWGM 1ODUA 4OKDA 3IJ7A 1CPUA 1CGYA 3CUFA 2XUCA 2X09A 1EDGA 4KRUA 2OLHA 2B31A 4ZXOA 3AIBA 1JF5A 2ZUSA 3KEHA 2Z1KA 2W4XA 4LGXA 2XWDA 2V3FA 1QBAA 5M17A 4V28A 3BGAA 5GPRA 4U3CA 3VIKA 4P7OA 3SCOA 2G4FA 1JYNA 5A8QA 4PMUA 2WK2A 1QHPA 1I75A 3W53A 1GJWA 2NT0A 1XD0A 3EYPA 2FGZA 4CD8A 4PCSA 3L2LA 2YL8A 3VIIA 3UR7A 4MB5A 1WAWA 1E1FA 3FY1A 3OZOA 2XG9A 3WDHA 2XM2A 2CBIA 1C8XA 4IM4A 1XYZA 4JHOA 2CESA 1J0YA 3GNPA 2WC3A 2XVGA 1I1WA 5CZKA 1E6SM 2WMFA 3N15A 2VVNA 1JNEA 3RM8A 1MFVA 3LPFA 1GVIA 1J0ZA 2Y5EA 1J12A 2FH8A 1QHOA 4QFUA 2ZX9A 1H49A 3T2QA 1ISVA 1BGGA 2VUYA 5A8NA 1ZB5A 4OJYA 3WDPP 3WEZA 1M53A 3RM9A 3WUBA 2XFYA 4HZ8A 4AMCA 2A3HA 1CIUA 4U3AA 1E72M 4UQDA 5A1AA 1GPFA 1CGXA 4WKHA 1B3VA 1RD6A 1OIMA 1OGGA 4U5IA 1JG9A 2C7FA 3K4DA 5JBDA 3AZRA 4OOUA 2FGLA 3ZO9A 3APGA 1NH6A 1MYRA 1OM0A 2WZIA 2D0HA 3NSNA 4PN2A 2VCAA 1BPLB 3MMDA 1H1NA 3ZJ7A 3WNMA 3WQ8A 3WF1A 2D3LA 1W9DM 4BA0A 1UG6A 4GO8A 1GW1A 3FN9A 4W8AA 2CEQA 1E6QM 1EOKA 3ZSTA 2ZIDA 1MQPA 4C7FA 2Y8VA 2V5DA 1PJ9A 4IPLA 3CZ8A 4KGJA 4D6DA 3SCNA 2YJQA 1SYTA 4TVDA 4AYSA 1J10A 3OGVA 1V0LA 4J3SA 2E4TA 2G3MA 5IXEA 1JZ2A 1E4IA 1UD3A 1EXPA 3WNLA 4GZEA 4QLJA 3AICA 4D1IA 3FAXA 4CD6A 1R7AA 4W5UA 3WH6A 1D2KA 5CLWA 1HJSA 4R27A 1E73M 1JI2A 2BY1A 4PYSA 1JDDA 2E0PA 2FHCA 2PWFA 2E9LA 5CSYA 1M01A 3EDDA 5A6AA 1UD2A 4AEEA 3DECA 3RJXA 2AAAA 4D6JA 5A95A 3OLIA 1OT1A 1VJSA 3WMCA 3W25A 1IZKA 3KL0A 3J7HA 3AXIA 5HOSA 3UG3A 4KWUA 1LLOA 2PWGA 5DF0A 1KQYA 2A3AA 3WF0A 4H8VA 2VO5A 5JIWA 1JZ5A 2EPNA 4YPJA 5CQ1A 1DTUA 5E9AA 1MVYA 1E15A 1UUQA 4X0VA 1BHGA 3ZQ9A 1W9UA 1V6UA 3L4XA 1HKJA 1UKPA 1C8QA 4JAWA 4AC1X 4UQ9A 2VRJA 1BAGA 1A3HA 3IJ8A 3WQWA 3ZR5A 4NZCA 3N13A 1QNOA 3GZAA 4P8XA 3AYSA 3M46A 1V02E 2VL4A 1NM9A 1OSEA 1B30A 5C8BB 4UFIA 4HMCA 1WZLA 4HA1A 4S3JA 3AOFA 3K46A 7CGTA 2YBTA 3BAYA 1OIFA 2O9OA 4P8UA 2VRQA 4M82A 3CMGA 2ZXDA 3OGRA 4PTMA 1V6YA 5E70A 3WF2A 2WVSA 3AMGA 5HNNA 4JFTA 3I3DA 4Z2JA 1I1XA 4AZ6A 3K8LA 1B3YA 4BQ4A 1ZBCA 4LYPA 3ALFA 1XH1A 2X0HA 3VD7A 1DWIM 4NRSA 2YDQA 1UZ4A 5AYIA 3WH8A 2G3NA 1CGVA 1E6PA 1WP6A 1TVPA 2WMHA 4KH2A 3BAWA 3BAKA 4MNJA 4UQBA 3NDYA 4JCLA 4XUYA 2ZX7A 3CMJA 5C71A 4PTXA 3SCSA 2X0YA 3O9NA 3CH9A 5D9PA 5BXRA 2D20A 2W63A 4M80A 1E6NA 4F79A 1YQ2A 2BHUA 5IHRA 3WN6A 1EH9A 5I6SA 4UQCA 4AZHA 1WO2A 3QHOA 1BG9A 3SCUA 4W5ZA 4W7UA 3AHTA 4PMQA 8CGTA 3WY1A 1UYQA 1MXDA 1E6ZA 4PEEA 1U2YA 1J0HA 1W1VA 1W9BM 3VIOA 5GNZA 1N82A 3W6MA 1QPKA 1HKIA 2DT3A 4MADA 3OLGA 4V27A 2W66A 4WK9A 1U30A 4R5EA 4E8DA 2GK1B 3WQ5A 4J3VA 1GNXA 1O6IA 4D71A 1HXJA 3TTSA 1G5AA 2WVUA 3QOMA 2WCGA 2VTFA 2W5FA 1JZ7A 2QLYA 4QDMA 3DYPA 1L8NA 4ACYA 5GNXA 1KR0A 2VI0A 3QHMA 1R85A 3B9DA 4QLLA 4W8LA 3MMUA 3M07A 2J7DA 3BLPX 3ARVA 1C3FA 2W61A 1V03A 3TONA 3W82A 2CBUA 5A6BA 4KRTA 4RL3A 1GZJA 2JEQA 4OBRA 4P7RA 1BSIA 2O9PA 3SCTA 3ECQA 3QR3A 5IFTA 3VMPA 1W9XA 2WWCA 3BAJA 1UR2A 2WMIB 1R87A 3VNYA 1CXIA 1G0CA 3A4AA 5A6LA 5GQBA 1V3JA 1HL9A 5CG0A 2UWFA 4D72A 2XFFA 5A6SA 3VILA 4D6CA 1KGUA 3OLEA 2X1IA 3B9EA 4D6GA 3K8MA 6TAAA 4BQ2A 3OBAA 4UOJA 1HKMA 1VFUA 2WXDM 3GXIA 2D1ZA 4MPKA 4CN6A 1JZ8A 2XTKA 1CGUA 1HKKA 3SUSA 3UESA 4IUGA 2BNJA 3ARYA 3ARXA 3VKKA 4A4AA 2W62A 3IAPA 1FH9A 3EDEA 4FLOA 3VU2A 3VDBA 3VD9A 5I5RA 4CD4A 1E40A 1AMYA 3AMKA 5LA2A 2E8YA 4UZSA 2WHMA 2WSKA 2WWDA 3NSXA 1AQMA 3NDZA 1JIBA 3GXMA 1CNVA 3AS3A 2RGLA 4PUDA 4HZ7A 3MKKA 1EDQA 1G94A 5A3HA 2QMJA 4DWSD 2WC7A 3W6LA 3S2CA 1VJZA 4RE2A 3ARRA 1UH2A 3AS2A 3N04A 4PSPA 3U7VA 1W3LA 1PPIA 1QI5A 1ZU8A 2D2OA 2JALA 4YHGA 3WELA 4AD1A 2WM0A 1US2A 1QNPA 1GVYA 4AIOA 4UTFA 3WD1A 1GOIA 4HMDA 1K9EA 4J27A 1JZ4A 1U33A 2WPGA 1CLXA 1XD1A 1JI1A 4W86A 2DSZA 3I3BA 5A2CA 1V6VA 2WVVA 3OIHA 3WFLA 3FAWA 4GPNA 4J7RA 1C91A 2OYMA 3VUPA 1KXQA 5M5DA 1W1PA 1HF6A 4EAMA 1NOWA 3THDA 3AISA 1J0IA 3WMBA 4U31A 3MS8A 3L2MA 5KZ6A 4FLSA 1EO7A 2BY2A 1VF8A 3N1AA 3SCWA 1MW0A 3HJEA 2FH6A 1EDTA 1OGBA 4MB4A 2UY3A 1GOQA 2ZXAA 2FHBA 3DYOA 3TTOA 2D3NA 2D23A 4U2ZA 2XVKA 3ARPA 2WB5A 2WBGA 1CTNA 4URIA 2D22A 2WC4A 1DWHM 2ZOXA 1W1YA 3ARUA 4QP0A 2WHJA 3AZTA 2VCBA 1EA9C 2C0HA 1UH4A 4H04A 1KXHA 1HJUA 1QW9A 1P6WA 5A6JA 4CU7A 1ZJAA 1WNOA 4S3KA 3ZIZA 5E0CA 1E9LA 2GJXB 3VVGA 3WNKA 4LPCA 4AISA 1J01A 2D0FA 3WL1A 3ALGA 5ABFA 3B8SA 3EMCA 1KQZA 3CHEA 1UH3A 4CCDA 3EDKA 3N12A 1C90A 1PZ2A 1LWHA 3HMCA 5BROA 1LQ0A 4AD4A 2DT2A 4DM1A 3BSGA 3BCDA 1TR1A 3WD4A 3RM4A 2W67A 3N11A 1V3MA 2XSBA 3POHA 3VM5A 4ACZA 4CU8A 3ZSSA 4ZEPA 2DGAA 1WZMA 4HTYA 4M56A 5A8OA 1OGSA 4BF7A 3SCRA 1CWYA 2PF0A 1MW2A 3OA5A 4U33A 3SEPA 1JZ3A 3L4TA 2Y4SA 2QV4A 3WUFA 3PN8A 1JL8A 2E3ZA 1NWRA 4L4OA 2NT1A 2F8QA 4DWSC 9CGTA 1X6NA 3VIHA 1C7SA 1GQKA 1OB0A 3D5HA 3RDKA 2J7BA 3CUHA 1V0NA 1VAHA 1BYCA 4TTGA 4QCFA 4AIEA 3MUAA 5IDIA 4DUVA 3PZMA 4TTUA 4AZCA 1HT6A 3VDHA 1D3CA 5DT5A 5BXSA 4TX6A 1KCKA 1Z32X 3MSDA 4J28A 3SCQA 4AY1A 3GDBA 3GM8A 3AMDA 1V6XA 3SCVA 4J3XA 4MDOA 1DWAM 1PIFA 1FHDA 3GBEA 2JF7A 3WBEA 4JFUA 1GQLA 1AQHA 2GJRA 3AIEA 1MQQA 2E8ZA 4B15A 2EXOA 1WKYA 2VX7A 1VENA 1NWSA 1E6XM 4HP5A 3IK2A 4N0RA 2VURA 3WSUA 3U5YA 5JBFA 2G3IA 1BG4A 3GH5A 1LL7A 2WCSA 3VNZA 1JDAA 3ZT7A 2YL9A 1ISWA 4E8CA 1LJYA 1TVNA 2J47A 1VBUA 1CEOA 3VGHA 4NF7A 4UOQA 5EB8A 4AZ7A 1JYVA 2ZUWA 1PBGA 4UFJA 4AD0A 1NP2A 4EANA 1CZ1A 3IJ9A 1JDCA 4PMNA 4K68A 1UWTA 1A47A 3L4ZA 3LPOA 2XWEA 3VMNA 3GYCA 3RO8A 1WDSA 2V3EA 2VQTA 4M81A 1W3HA 2EPKX 3FHQA 1CGTA 2YA0A 4JL2A 1CLVA 2J25A 4H7VA 3JUGA 1NQ6A 4W84A 2YBUA 1WCGA 1ZS2A 2EQDA 5ABHA 2BS9A 4J3TA 2ZX6A 4Z2HA 3AJ7A 4TOQA 4ML4A 1SMAA 3EMZA 3VIMA 5DFAA 3AXXA 4GIAA 3VGEA 5D8ZA 2J7CA 1UD4A 2CXGA 2VCCA 3GH4A 3WMSA 4NSBA 1W32A 2DIEA 3ZMRA 1HJXA 5DEZA 4NRRA 3KE0A 3WENA 1MXGA 1EO5A 2J4GA 2WZEA 4JIEA 3AIUA 3PZIA 1H3GA 5E6YA 2WMKA 1UKSA 3OZPA 2DPEA 1JD9A 3ZJ8A 1E0XA 5CPTA 3UEQA 3TOPA 1M03A 2VX5A 3ZT5A 1XSJA 4P7NA 2V3GA 5HPOA 2JF6A 2WYSA 1IV8A 3TTYA 2WNWA 2WBKA 3VIGA 1D7FA 2GSJA 3NYDA 1GOMA 3MANA 1XCXA 5AY7A 3THCA 4U2YA 3CBWA 2VOTA 3UERA 2UY5A 3VO0A 1GOOA 1O7AA 2Y2WA 4DM2A 1VFOA 5A6KA 1E56A 4CKQA 2A3CA 4EK7A 4J3UA 4UFKA 4Z2IA 4WSKA 3PTQA 1OD8A 1E0VA 1BLIA 3W4RA 3SIMA 1JXKA 1E6RA 5CPSA 7TAAA 3LPGA 1KBBA 1VEPA 3NIYA 3ZOAA 3G6LA 3GXDA 3GXFA 5LA1A 1CENA 4LYQA 4RE4A 2QPSA 1GUVA 2DT0A 1X1NA 2EO7A 1V3HA 2IUZA 3B9AA 4UR9A 4FLQA 1R8LA 5F7UA 1LWJA 3ARZA 2HISA 2VJXA 2VR4A 1BFNA 1XH2A 3HN3A 1E5NA 1MFUA 3SUTA 2CHOA 4P7LA 2CETA 2VX6A 2ZUTA 3WEMA 1IZJA 3KL3A 1CECA 3WD0A 4FF5A 4GZIA 1VRXA 5FL0A 2G3JA 1RH9A 4DWSB 1ISYA 1E71M 1UA7A 4BQ3A 3W37A 1GONA 2BHYA 2WVVB 1BVNP 2VZOA 4JKLA 1ZBKA 4B3KA 1VFMA 1W9PA 1B9ZA 3AROA 3PZNA 1E5JA 5M3WA 1JAKA 2XVNA 3GH7A 1E4MM 4PTVA 4MNKA 3FHAA 1HVXA 1H2JA 1GHRA 5GNYA 5I77A 3OLDA 4C7GA 2XJ7A 1LL4A 4Q7NA 4ZXLA 2Y8KA 3WQVA 3BAIA 3DHUA 4WSJA 2EPMX 4AZ5A 2VT0A 4PMDA 1EGZA 1QNSA 1GCYA 1MW1A 2O9TA 2ZUUA 4FK9A 4GZJA 1E55A 4AXNA 4OUEA 1JAEA 4JFSA 1OBAA 5BXPA 5DMYA 4GQQA 2QMKA 1Q6CA 1DHKA 3RCNA 1H0GA 4CD7A 2J7EA 1DWJM 3AHVA 3VD3A 4JL1A 1H4PA 4XB3A 1E4NA 3G6MA 2GFTA 3A6OA 2Y24A 2WLZA 3BAXA 1QI3A 1JNDA 1LG1A 3CZGA 5I2UA 2GJPA 3WH5A 5I23A 4JFWA 2AMGA 5CJ5A 1KGXA 1UR0A 3VIPA 2PC8A 1KCLA 3FXYA 4W88A 1B3ZA 3CUGA 4DUXA 5HDRA 5C70A 1EHAA 1UD5A 5FD0A 4D6IA 2G8ZA 1VFFA 3S6TA 1C8YA 1ZBWA 5D9NA 4GO9A 2BVYA 3TTQA 1KFWA 1SR0A 2UY2A 1G9HA 2J77A 3WUGA 4D6HA 2W91A 4X0NA 3GBDA 4HA3A 1ZBVA 3VIFA 5FIPA 2ZUNA 1QI4A 4ZE4A 2CERA 4M8UA 1XGZA 1WZKA 4X9YA 2Z1SA 3VDCA 1JD7A 4F9JA 1E1EA 3AHXA 1CXEA 5A69A 1UKQA 1PX8A 3VM7A 2YLAA 1WPCA 3VX1A 1B3XA 3N18A 3PZ9A 2JIEA 3D3AA 2XSAA 3PTMA 1UWUA 1QI0A 5ABGA 3BCFA 1DEDA 2E9BA 4BZYA 1HP4A 1HP5A 1TUXA 3BC9A 4JKKA 2J79A 2OSXA 1OD0A 1L0PA 2XIIA 1LL6A 4UNIA 2CBVA 1JYWA 3VX0A 2ZX8A 2XM1A 4B16A 4XX6A 2WMJA 4AD5A 1BYBA 2WSPA 3O2LA 5BWFA 1KXTA 1VEOA 4B9YA 1JZ6A 3SUUA 4AZBA 1CXFA 4AD2A 3CTTA 3A4WA 1JYXA 1RPKA 3PTKA 4BQ5A 3K4AA 4E4PA 1HVQA 4WF7A 4PTWA 2X2YA 1UR8A 2NW0A 1K9DA 3AS0A 1J18A 4PBGA 3CZLA 3NCOA 2PWHA 8A3HA 5D9MA 1SFSA 4CGTA 2RGMA 4XZWA 1GORA 1WB0A 1XCWA 2CKRA 5EMYA 1K9FA 3AIRA 4U5KA 1FH7A 2GDUA 3AMCA 1R7OA 4TXEA 1W3JA 2HVMA 1QI2A 1UWRA 1JFHA 1PEZA 2D24A 3IANA 5JIPA 4M29A 2VRKA 2PB1A 2BVTA 3F5LA 1LG2A 5FKYA 5E0FA 3CHFA 3MSGA 4P7QA 5AC5A 4B3LA 1X6LA 2E40A 1H5VA 4W7WA 1EOMA 1V0KA 1AQ0A 1KWKA 1XC6A 3MMWA 2VZUA 2YA2A 1YHTA 1GHSA 5CXPA 3PHAA 2WCAA 1J9YA 1EIBA 3T0DA 3GNRA 2DH2A 4JHZA 2X05A 4ZFMA 4GQRA 2EEXA 5E6ZA 2X8RA 1CGWA 4P8WA 1G01A 1LF1A 2AOSA 2WMGA 3UG4A 1NP0A 2E9MA 3CZEA 2ZUMA 1ITCA 2XGBA 1CXHA 1HJVA 1HN1A 3QHNA 3WF3A 4D6EA 3W0KA 1E0WA 2W92A 3SUVA 1WDPA 1JF6A 3VTRA 1UR9A 4CU6A 4CD5A 2BHZA 4EKJA 2DEPA 5AC4A 1Q6DA 1RP9A 4AD3A 2OWXA 2XHYA 2ZWYA 2QF8A 2YKKA 2VNCA 2WHLA 1VEMA 2BXZA 2GK1A 2ZE0A 3KL5A 2JFEX 3AFBA 4KMQA 3GNOA 5CSUA 3CLWA 5D9OA 2IXUA 1NOUA 2WKLA 4ZENA 2JEPA 1OT2A 1V08A 4QAWA 1B2YA 1UWSA 1QOXA 4LQ1A 1TCMA 3PZUA 4DUWA 2PBGA 3T08A 4W7VA 4AEFA 2DH3A 3M6DA 5EFDA 4IISA 2V5CA 1VB9A 1B3WA 4V2XA 4LYRA 4PRWA 1TZ7A 3IAQA 3L4YA 2XFRA 4UQAA 1Y7VA 4ZE5A 3TP4A 1ZL1A 3WQ6A 4PMVA 2OWCA 2YL6A 2J78A 1QBBA 2D0GA 4OBSA 2WMIA 1FFRA 1PZ3A 1M7XA 2WW5A 3WF4A 3WUEA 3SURA 1FH8A 5BRPA 4PMXA 1UR4A 4M24A 4CUCA 2CNCA 2ESCA 5I0DA 1Q6EA 1FFQA 3WH9A 2V38A 5FL1A 3MV11 1M04A 1EQCA 3BMWA 5AYBA 5LA0A 1UQYA 2ZWZA 4ATDA 4H8UA 4Y7EA 3BLKA 1FHLA 1QHZA 4CVWA 4H8HA 3CZJA 3AHZA 1E43A 5CGTA 4P8VA 3ZJ6A 4Q22A 3MU7A 3WEOA 2OYKA 3KWXA 2CCRA 1Q6FA 3VGBA 3WD3A 5JBEA 3CIVA 1TA3A 2PBOA 1XHGA 2XIBA 3OB8A 4TVUA 4AZGA 1JGIA 2BVDA 4AWEA 1BVZA 1W1TA 1ISZA 4A3HA 3WL0A 1ESWA 1CDGA 1PX4A 3WQ4A 1KXVA 1HJWA 4W89A 3MUZ1 1H09A 2GUYA 4UCFA 3RMEA 3MUIA 3UG5A 2V3DA 4MB3A 1F4HA 4TX8A 4HOZA 2DIJA 3EDFA 4F66A 1JFXA 4TUFA 1H11A 5ECUA 4TVCA 2DSUA 1UD8A 1UWQA 2YDRA 3N17A 1XSKA 1HNYA 1XRVA 2YA1A 4PMYA 3WNNA 4CVUA 1K9TA 2YLLA 4Z2LA 1J0KA 3UCQA 1UWIA 2DSWA 4JFVA 3AIWA 5CGMA 3A4XA 3PZVA 1HX0A 2J8FA 3PBGA 3L4VA 1HL8A 4Z2GA 5HBFA 3PZOA 1FP8A 5A2AA 2CPUA 1KWGA 4XV0A 1IT0A 2BXYA 1CBGA 2J8GA 4MNLA 5D4YA 1NARA 1W9VA 3VD5A 4CCCA 4LX4A 4CN4A 3L4WA 1H0IA 3AMLA 3W38A 3ZT6A 4A3YA 1W91A 3MV01 4PSRA 5TD4A 4D6FA 2BY3A 3ZR6A 2ZX5A 2EPOA 1ECEA 3F5KA 3CHDA 1UOKA 2J62A 1V6WA 1WE5A 3VDAA 4C7DA 1V3IA 3CZKA 3VD4A 2DSKA 1MW3A 4AIUA 1FP9A 1E70M 1V02A 4GKLA 1GQJA 2EBNA 3T0BA 4OZOA 2VMFA 1V0MA 5JUVA 1XV8A 3AIQA 3ZM8A 1JXJA 5BCAA 3OGSA 3T09A 1WDQA 5A2BA 1E3XA 1B31A 1KR1A 2EPLX 2GJXA 4HU0A 3W28A 4ATWA 2CYGA 4AZIA 5CPQA 2EJ1A 1J11A 2XYLA 2XVPA 3N9KA 2YL5A 3F4VA 1PAMA 3K1DA 2G41A 3VOCA 3RPMA 3VMOA 2TAAA 4E2OA 2GVYA 3WBAA 3FNDA 1TMQA 2J75A 4GI8A 1MWOA 6CGTA 3F5JA 1UR1A 1QNRA 2IXVA 2VR5A 5I78A 1GQIA 2DT1A 2CIPA 4PMZA 2FHFA 4UFHA 3O6AA 4MAVA 3SUWA 2A3BA 4WLCA 4WJXA 3W24A 1FOBA 5CLTA 1GOWA 3ARTA 2PWDA 3AZSA 3QOKA 4GXPA 1RP8A 2WHKA 4HPHA 1UA3A 4PMRA 5IHSA 1C93A 3UETA 1V3KA 2WLYA 1EQPA 3DYMA 3VGDA 1W3KA 5DO8A 1QVBA 1E3ZA 1UQZA 2CBJA 5I3DA 3WDRA 4PCTA 4UOZA 4JCMA 3NSMA 2BY0A 1UZ1A 3UR8A 3CHCA 1ITXA 3K8KA 3VGGA 1CYGA 1EHNA 3L4UA 1G1YA 4XZBA 5A6MA 1XSIA 2YOCA 4MJ4A 2BV9A 5D8WA 2Q8XA 4QLKA 4MAZA 3U7BA 2VC9A 1B1YA 1HJQA 1K6AA 3MUY1 3FW6A 4MB1A 3WH7A 4HU8A 1W2PA 4PUEA 2BFGA 3I3EA 3AS1A 5FOOA 1WZAA 3T2PA 2ZUVA 3ARSA 3VPLA 1GOKA 2DDXA 5EBAA 2PI6A 2VX4A 2WANA 3BSHA 4W87A 2OWWA 1B90A 3QGVA 3OG2A 7A3HA 3CUJA 2DSVA 3EMQA 3CPUA 3E1F1 4UQEA 3VIJA 5BXTA 5BRQA 4W85A 3VGFA 1NOFA 3SCPA 1S46A 4MTVA 3WDJA 3W27A 4NI3A 2XVLA 1NWUA 4IPNB 4Z2KA 2VQUA 2UY4A 5A6BD 2WVTA 5A94A 2WKGA 4JZ5A 5EFFA 4QCEA 3WIJA 1BTCA 4RE3A 5ABFB 2JE8A 4YN5A 1FA2A 1VBRA 1E4LA 3LPPA 5M03A 2VZSA 4KGLA 4W93A 3WD2A 3ARWA 1ZJBA 1KGWA 2YIHA 3ARQA 2F61A 1C92A 2QPUA 2JIWA 1BF2A 4CCEA 1GJUA 4UZUA 2QHAA 4GINA 4MNMA 1B0IA 3RJYA 1Q6GA 4ACZB 3BMVA 4F9DA 1NWTA 3AXHA 1US3A 2XPKA 2CHNA 4H2CA 3CUIA 2OSWA 1UKOA 2VZTA 3PZTA 1H41A 1W2VA 4HOWA 4F8XA 1BYDA 2O9RA 3WDIA 1QW8A 5A8MA 3CGTA 3A3HA 3T0AA 3W26A 4JKMA 1CXLA 1R86A 1UHVA 3U57A 4HOXA 4FLRA 2ZXQA 2J7GA 4HPGA 4CN1A 2WZHA 3VINA 1V3LA 4AW7A 3WNOA 3W81A 1J0JA 1TFVA 3ZJKA 3DHPA 2WAGA 3NJ3A 4WKAA 4BS0A 2GDVA 4AZCB 4B9ZA 2O92A 1CXKA 2J7FA 3MO4A 3NUKA 2PWEA 1ISXA 1F4AA 1HIZA 2NSXA 4WIWA 3POCA 1OCQA 1QNQA 1OWQA 1PX3A 3T2OA 2XGIA 2FDMA 1KB3A 1TA3B 5DT7A 4YHEA 5I79A 3WDQA 3WNPA 3LMYA 3II1A 2C8NA 1XH0A 1ODZA 3EDJA 3EBVA 3HU7A 5IFPA 1WDRA 4HZ6A 5BYWA 2J7HA 4OOZA 1BYAA 3CO4A 3DC0A 4EE9A 2CITA 2ZICA
chains in the Genus database with same CATH superfamily
1Q4NX 3GTNA 1PS9A 1EA0A 6A3HA 5CEWA 1UASA 3P93A 2ZXBA 2DQXA 5DRIA 4K36A 2YCKX 1F2JA 4MJ2A 3NL5A 3DFTA 3AHYA 5E09A 2W3ZA 2Z6IA 1UD6A 1AH4A 3SW6A 3AQUA 3TA9A 3P61A 3WKZA 4FMVA 1EJRC 4DO7A 5HQLA 5KEZA 2YZ5A 3U5UA 3PJWA 2BTMA 3NOYA 1PXGA 2XH2A 1L6WA 4GVIA 3BDKA 4FOKA 4DXVA 2YDSA 3CB3A 4BCEA 4JBRA 1PIGA 5HPCA 4BF9A 2MANA 1TG7A 3EX4A 4TX9A 3R89A 3GS6A 2DZTA 1MQRA 3AI0A 3FJ4A 4ATLA 4HSHA 4HA4A 1OF8A 1F3TA 1GYLA 5AECA 3LV5A 2H9AB 5FCZA 4I6KA 1X8CA 1FWHC 3NQ7A 4O15A 4OKDA 5CC5A 3M41A 4Q8OA 1KM3A 1A3WA 3CV2A 2YXGA 3DKLA 1EDGA 2OLHA 2B31A 4LS2A 4ZXOA 3FS2A 2H8XA 2ZUSA 3KEHA 3LNMA 1UZDA 4QS5A 4LGXA 2VFHA 4FNTA 2V3FA 4V28A 5GPRA 2PSNA 3DHDA 1F74A 3PBWA 4P7OA 1VJIA 3TX9A 3SCOA 1JYNA 3O6CA 5A8QA 4PMUA 4GKTA 3LTSA 1PV8A 2NT0A 2PWVA 2GOUA 3EYPA 1IEXA 1Q5MA 2QCDA 5CCZA 1H1ZA 5GJMA 2YL8A 3VIIA 2FMNA 4IJBA 1JPHA 1R38A 1WAWA 1E1FA 1R3WA 3OZOA 1XL9A 1GKPA 1THFD 5I7GA 1XIFA 1XYZA 4JHOA 2CESA 4GFSA 5F2LA 4Y90A 4MZ8A 3VNLA 3OVGA 2WMFA 4PCNA 1GVIA 2OZ3A 5JVLA 1VBGA 5B80A 1OY0A 2QVNA 2Z1WA 3KLLA 4O0KA 3WLQA 3P81A 1BGGA 2B4GA 2VUYA 4O0ZA 1ZB5A 3MW7A 4LALA 1M53A 3BOLA 2JGYA 1SO4A 2HBVA 1VRDA 5C9WA 3HG3A 4U3AA 5A1AA 2Z7GA 2FKPA 1CGXA 4WKHA 1B3VA 1RD6A 1DKWA 3SFKA 4XK2A 4KWSA 3W2MA 1FCVA 2C7FA 2YXOA 5JBDA 1GKRA 4RW5A 1NJJA 2FGLA 2PDLA 3ZO9A 2OZ0A 4S3AA 4ZA0A 1YBQB 1NH6A 3H7UA 1OM0A 1R9YA 2WZIA 1OFEA 4ZQCA 5AFDA 1IZCA 2IKJA 3COTA 4PN2A 2PRLA 4BI5A 3MMDA 2IQTA 4F0SA 2ZDSA 1XBZA 1TPWA 4GXMA 1B54A 4EF8A 3LU2A 2X1UA 1TWSA 3I6RA 3LZ3A 2Y8VA 2V5DA 5KITA 4D6DA 2YJQA 1SYTA 1HTIA 4CLMA 1QK0A 4AYSA 1KFCA 4WJEA 2G3MA 1JZ2A 3Q67A 1EUAA 4S23A 4AVFA 3VNKA 3BQ5A 1QDSA 4ILSA 4W5UA 4UMBA 4ZQPA 4WDXA 1D2KA 5BRBA 2BODX 1E73M 3PB0A 4OHQA 3DOPA 2CZVA 1IXQA 5A6TC 1Z7AA 1AH0A 1ICQA 3NURA 5A95A 1VJSA 1EYWA 2Q01A 4M6PA 1IZKA 2OJPA 4HA0A 3DHFA 4YJ5A 3WCZA 4R3UA 3ONCA 2GVJA 3KOFA 4KWUA 1KQYA 2A3AA 3AXKA 3FEQA 3KS5A 3PJXA 4IG2A 5EYWA 3DH7A 3KCJA 1DTUA 1E15A 3H23A 4HNLA 5D32A 3ZVHA 4KWOA 4YWIA 4L61A 1W9UA 1SU5A 1W1ZA 1V6UA 4AEOA 1QASA 4FEZA 4AC1X 2FB2A 3VAVA 1BAGA 1FWCC 3LSBA 2EJAA 4NZCA 3N13A 3QC3A 3QGAC 5DCEA 1VP5A 1PKNA 2F9RA 2VL4A 4R85A 1W31A 3NEVA 3K46A 7CGTA 3H2FA 2O9OA 3ZS4A 2WVSA 4HKPA 1J6OA 3AMGA 5HNNA 2ISSA 4AZ6A 3HOJA 4BQ4A 3GFYA 1ZBCA 4LYPA 3ALFA 3CJPA 4LANA 3ES7A 4IGSA 2ALRA 1QW7A 1BSLA 1CGVA 3MKVA 1E6PA 1VBHA 1D3HA 1WKEA 1TCDA 1WP6A 5D2YA 2WMHA 1O60A 5G2IA 4XUYA 5CZTA 3U2CA 2PA6A 4PTXA 3SCSA 3GIYA 1XLCA 4F40A 9XIMA 5D9PA 4RKAA 3GIQA 4DPQA 4I9TA 4JIHA 3L9CA 1FWFC 2W63A 2C13A 1QPRA 4B3ZA 4DUOA 3Q2DA 1LROA 1YQ2A 2PDNA 3WN6A 1EH9A 4AZHA 4LBSA 3C8NA 1BG9A 3SCUA 4EP8C 3O06A 5IOBA 3W7JA 3MT1A 4MPQA 8CGTA 3F4NA 4ROPA 2Z1XA 5BU9A 2I57A 1XGDA 3APYA 1E6ZA 1W1VA 2OCZA 5GNZA 1N82A 1QPKA 1BVWA 1P7TB 4QG8A 4MADA 1SR9A 2P10A 4MY1A 4WVXA 3ZZ1A 4F0KA 5CAHA 2PCEA 1Z89A 5DXXA 3TMQA 1GTHA 2E77A 1NIUA 2P5NA 2Y63A 3UR2A 1V6TA 1RV8A 2QLYA 4DJFC 5GNXA 3VC6A 1R85A 3QHMA 3B9DA 4QLLA 4W8LA 1Z9AA 3MMUA 1M41A 1QR7A 2W61A 3KP1A 4MKSA 3TV8A 3H4GA 5KETA 2O9PA 3E12A 1JPDX 1W9XA 2DZPA 1Q7QA 1R87A 3VNYA 1CXIA 1G0CA 2CW6A 5DY3A 4D8ZA 5AC8A 3I4KA 3AWOA 2REQB 5CG0A 1VFLA 3S6DA 4IXHA 5A6SA 2PD9A 1AZ2A 1N8WA 2VELA 4XD6A 6TAAA 3OBAA 2WXDM 5H91A 4L6DA 5DBTA 3GXIA 2HXUA 1LRTA 4R9XA 3NZGA 4S38A 2OGJA 1U83A 4IUGA 4PTNA 1KFEA 5BOFA 3ARXA 4GC4A 4IJCA 1ZTVA 1FH9A 3EDEA 2VEFA 3VU2A 4AUBA 1EL3A 5I5RA 4CD4A 2XIOA 1E40A 4BJHA 3PUDA 4UZSA 2WHMA 2WSKA 2WWDA 1MDRA 1AQMA 1JIBA 4EPEC 3AS3A 3G0UA 3UP8A 1LRNA 2QMJA 2WC7A 4XZ9A 4X3ZA 5JH1A 3LI1A 3S2CA 3H24A 4UXDA 3UT0A 1VIZA 1ITUA 3ARRA 1UH2A 3AS2A 3U7VA 3GB6A 4AF0B 3AO0A 4HHHA 1PPIA 4LAUA 1NDYA 4JQ3A 2PLCA 3WD1A 5IDZA 3TJLA 4HMDA 1S5VA 1JZ4A 1VCFA 1GQNA 1JJKA 1UW9A 2WVVA 3OIHA 3IV3A 9RUBA 1C91A 2OYMA 2VP8A 3G18A 4LH8A 3RPDA 2V5BA 1YDNA 3IIPA 3D47A 3OZYA 4KFNA 5KZ6A 2BY2A 1VF8A 3N1AA 3SCWA 4NU7A 2FH6A 1OGBA 2CZDA 4MB4A 2FHBA 3DYOA 2ZE3A 1GOXA 2XVKA 3ARPA 2WBGA 2PF8A 1R3VA 4IX2A 2WC4A 2ZOXA 4TV6A 3E0VA 2V5KA 3ARUA 4JN6A 3AZTA 4UNLA 4QS6A 2VCBA 1XLJA 1A80A 4EWJA 1OX5A 1KXHA 4CU7A 1QWKA 1ZJAA 3JZEA 1E9LA 4Q6JA 3VVGA 2NLYA 4IXXA 2D0FA 2NWSA 1KQZA 4S3EA 2OT0A 4ZSUA 3BGJA 1C90A 3WQPA 3HMCA 3IARA 5BROA 1LQ0A 5HMSA 4JOMA 1TR1A 3UWEA 1Q63A 4LVBA 1Z42A 4PH6A 3UZYA 3SFWA 4O1EA 4MFDA 2E6YA 3W02A 2ISWA 4X2PA 3RYSA 1JL8A 4QISA 5KSWA 2V82A 3HFYA 5DMMA 4L4OA 2F8QA 2PDGA 3MP4A 3RDKA 1VAHA 3OVPA 2FZ8A 1PO9A 2I9EA 4QAIA 4AIEA 4NP7A 2XH7A 4MF4A 4DUVA 4AZCA 6REQA 3W7LA 1D3CA 3T8QA 1Z32X 3IRSA 4BI6A 3SCQA 3GC4A 1W5OA 2C15A 1TKKA 3PJUA 4UTJA 3LUTA 3QJAA 3LNPA 5G2HA 1V6XA 4J3XA 2IPFA 3BW3A 3IIVA 3GBEA 2FZDA 1GQLA 3DFYA 2V0TA 3V1PA 4IIBA 4FR6A 4KCWA 2EXOA 3NQ2A 2QCEA 3HFTA 3B40A 1M65A 5C54A 4GI4A 3GK0A 4AHOA 2OVLA 4M6UA 4DO6A 2EG7A 2FYMA 1WKFA 3VNZA 1EXBA 3ZT7A 2YL9A 3TA6A 4KFPA 4GUFA 4E8CA 3T4WA 3CU2A 1VBUA 3VGHA 4NF7A 1OC5A 4AZ7A 1JYVA 4WSHA 2ZUWA 4ES4A 4PMNA 2CFFA 1WUEA 1UWTA 3O63A 1Y5WA 3GYCA 1MNZA 1ZALA 4QXIA 1HL2A 4JL2A 4YXGA 2J25A 3GG0A 2OOFA 1WCGA 2OELA 4JDBA 1GVOA 1TV2A 4Z2HA 3QQWA 4PBFA 5H6HA 1P5BA 3EMZA 3VGEA 3WMSA 2HK0A 3CWNA 4UMAA 3BV7A 5DEZA 5HNRA 1XQLA 4NXKA 3LGEA 4DIAA 3WQGA 4WXZA 1EJWC 3OZPA 1ZSXA 3FV9A 1E0XA 5CG7A 1EC7A 1M03A 3P6LA 1XSJA 3BTNA 5HPOA 2WYSA 3QF0A 2QCMA 3F2DA 1M6JA 1KFBA 1YEYA 5D30A 1IEVA 3PNUA 5XIMA 4N9CA 3MANA 1XCXA 3HQNA 3THCA 4G1KA 4G6CA 4U2YA 1HKVA 2BGQA 3CBWA 1XIJA 3UERA 3BLFA 3EEGA 1J2WA 1RJPA 3VO0A 1B4EA 4NNCA 3M0KA 1O7AA 3P3BA 3WG6A 1WXJA 1E56A 4HU3A 3UPMA 3VUSA 2BDQA 4EK7A 3AC0A 4Z2IA 1DJHA 2ZC8A 4N2YA 4NZ3A 1TPUA 3GVWA 1ONXA 1E6RA 1KO0A 2VM8A 5CPSA 3T8LA 1TZZA 2ZVIA 3IIZA 2IQ0A 3O6DA 1K3UA 2DT0A 2EO7A 4RK8A 4FLQA 5F7UA 1WBJA 2VJXA 5LXXA 3TLLA 1OG0A 3CM4A 1QXLA 2H90A 4IMDA 1S5MA 3SUTA 2CHOA 4WD0A 2VX6A 3L5AA 1Q13A 4LYKA 3RR1A 3W1NA 3NAVA 2G3JA 1W6TA 4DWSB 2XU2A 3AJXA 3LHUA 4J1OA 1UA7A 4BQ3A 1GONA 2BHYA 2WVVB 2E6AA 5K9DA 2A2IA 4Q8VA 4FF7A 4ZODA 4B3KA 3OVRA 2X1SA 1E4MM 2C79A 4MNKA 2Z2AA 3MCMA 3C0QA 3CYVA 4HU4A 3N29A 4LVFA 4C7GA 4C6BA 5L6UA 2XJ7A 1LL4A 3K4WA 1A0DA 4Y2WA 2YFNA 5BMWA 3WQVA 3BAIA 3IGHX 3NPXA 4LVGA 2XZ9A 1QNSA 1YYAA 3QY7A 4PRRA 2ZUUA 1IGWA 4K8GA 3KXQA 1T41A 1Q6CA 1DHKA 3TK7A 5AHLA 5AYXA 1FY6A 1H0GA 3V0TA 1DWJM 4QSFA 1JCMP 1J96A 1E4NA 2R1LA 3SSJA 1XLKA 3A6OA 2Y24A 4DF2A 3CHVA 1A5CA 1LUCA 4E2VA 3CZGA 5I2UA 2GJPA 3PR2A 2V67A 1K7EA 1NDWA 1L6SA 4FI4A 2P0OA 1RCQA 3SR7A 5CJ5A 1KGXA 4C90A 2OZTA 5L9FA 1X39A 4BWLC 1YE6A 1KCLA 4W88A 3W74A 1DE6A 2PP3A 3UJFA 2JQXA 5HDRA 2J6VA 2IKIA 1F3WA 4HPNA 4D6IA 4PL2A 1QFEA 1D3GA 5AC6A 2X2GA 2G8ZA 1VFFA 3S6TA 6ALDA 3OO2A 1ZBWA 3IVTA 4GO9A 1PUDA 3TTQA 1GT8A 1M7OA 4O1CA 2Y5SA 1XP3A 1XISA 3WUGA 2CLFA 2W91A 4X0NA 2QJJA 3UA3A 4GYPC 3VIFA 4EF9A 4ZE4A 4DEFA 2CERA 1WZKA 4WDWA 3V5FA 1R0MA 5KZEA 5XIAA 1EWDA 4IHCA 3MDWA 5DCDA 3AHXA 1CXEA 4YWSA 2TPSA 4QSHA 3SGZA 1WPCA 3S6OA 2O4QA 3N18A 3PZ9A 1FWBC 4IMEA 3S1GA 4X61A 5CPOA 1QI0A 1W8GA 4S1FA 1OJXA 1T5AA 1HP5A 1U1JA 4JKKA 1IQ8A 1S3TC 1OD0A 2CLEA 2PDYA 3SRFA 4NKCA 1A5KC 1EZ2A 1BYBA 2WSPA 3PAJA 3O2LA 4IFKB 1K4GA 3HPZA 3EWXA 3QMRA 5HJLA 2Z2UA 1LCOA 1AW2A 3M0HA 5F1VA 2X2YA 2NW0A 1K9DA 4QE5A 2PTWA 5F4XA 2DP3A 1TSIA 3NCOA 2PWHA 1SJCA 4I9AA 4XZWA 1GORA 4YTRA 1K9FA 1ME7A 1BRLA 4ZQOA 4INFA 2GDUA 3W6YA 4Q8MA 2HVMA 1QI2A 4PCFA 3LB0A 1UWRA 7PTDA 2PP0A 4M29A 1ME8A 2VRKA 4JIPA 2HZGA 4A8IA 2VFFA 3M9YA 2ICSA 5FKYA 4QEEA 3MSGA 2GOKA 1TVLA 3GZ3A 3S42A 1X6LA 1H5VA 4REQA 4W7WA 1F5ZA 2WZMA 1RPXA 4MMWA 1EOMA 1V0KA 4A2SA 3MMWA 3PHAA 2WCAA 1DIOA 1TTPA 4B4FA 2GQ8A 2X05A 4Z1AA 4ZFMA 5E6ZA 2X8RA 1CGWA 4X2RA 4BR1A 3FYYA 1G01A 3NQ6A 2AOSA 4QNWA 3UG4A 2E9MA 2ZUMA 1G4TA 1EEXA 2YW3A 1YDVA 4ZB2A 3GTHA 2W6RA 1CXHA 1HN1A 4O17A 5FJIA 4DXKA 1EGMA 3HPFA 4Y8EA 1JCNA 3A3WA 1KFJA 2W92A 3SUVA 5F2GA 4F48A 3RCMA 1FDYA 1UR9A 3ATZA 4XBSA 4XAGA 5AC4A 1Q6DA 2OWXA 2QF8A 4UTUA 2GQ9A 3SSZA 2VNCA 2WO5A 1VEMA 5LGXA 3QV8A 3AFBA 1EEPA 4XKMA 3WJYA 3BWWA 1V08A 1WXZA 1B2YA 1OHLA 4OFCA 4GGHA 3LI0A 4WY0A 3DU0A 3F2BA 2DH3A 3M6DA 1XCFA 3A21A 4GJJA 3IAQA 3M5VA 5HMDA 3FJ6A 3M0MA 4XSMA 1OC7A 2WJDA 3K13A 3I7SA 1OX4A 3TP4A 1ZL1A 3SZ8A 1I6NA 2VD8A 1LYXA 1K02A 2OWCA 2J78A 1QBBA 2D0GA 1S39A 4QE4A 3LHWA 1M7XA 1FH8A 5BRPA 1J8VA 4M24A 2Y7DA 4CUCA 4NNBA 1FFQA 3MWCA 4ZO6A 2VFEA 3BMWA 5AYBA 4EACA 5LA0A 2ZWZA 2TMDA 3T55A 2WSYA 1QHZA 3LRMA 4XZHA 1E43A 3ATYA 4P8VA 2HVOA 3MU7A 3WEOA 3PG9A 3KWXA 3WD3A 1ONWA 1IEIA 4TVUA 1BVZA 4NHVA 2BG5A 1H5YA 4XTIA 2NUXA 3UNDA 1PX4A 3WQ4A 4Y8FA 1P0KA 4Q8WA 3CV6A 1GKQA 2GUYA 2C16A 4IUOA 2EAWA 3W22A 3UG5A 2E1WA 2V3DA 4MB3A 1KTCA 1LT7A 3KOWA 1Q85A 1Q6LA 2O0TA 1H11A 2D69A 3MZ2A 4H9XA 4TVCA 2GUBA 1LQ2A 1V8EA 4XQ6A 2VOMA 4TU1A 1XRVA 2YA1A 1S5WA 4CVUA 3OOQA 1XX1A 4Z2LA 1O1ZA 4HJFA 1UWIA 4A29A 1ZPTA 1VR6A 3A4XA 1RALA 3VCCA 1OFAA 1HL8A 4JXCA 4LFYA 4DYKA 1FP8A 2FFCA 4GG9A 3PTDA 1OCBA 4LF1A 1NARA 4QIUA 2X42A 2GGHA 1FWAC 3CQJA 3AMLA 2V9DA 2FZ9A 1TV4A 1XYMA 3GNNA 1EGVA 3N4EA 1R30A 4NJIA 1REQA 3W38A 4NZ4A 4PULA 5TD4A 4D6FA 1ECEA 1EPXA 3T0TA 2Q8LA 3VD4A 1MW3A 4AIUA 1N7KA 2CLPA 1K4HA 4PGLA 2TRSA 4XIMA 1K70A 1P1MA 9XIAA 4JQ4A 4LOCA 4ERGA 3ZM8A 4GD0A 3I68A 3PPFA 4BKNA 3GHSA 4NASA 1E1CB 5G2WA 1TZ9A 1PKLA 2EJ1A 2XYLA 3TN5A 3GU1A 3NDOA 1SVDA 3TQ0A 3T1GA 4PZVA 4CEXC 5JH2A 2PURA 3K1DA 3MC5A 3RPMA 2GVYA 3VC5A 3JVAA 2DUAA 4BFAA 3WLPA 2CLKA 3B97A 2J75A 3GW3A 4DJFA 2DUZA 3LBOA 6CGTA 3GHRA 1EC8A 4OBTA 1FX6A 2IXVA 3KBJA 4CQ9A 5I78A 2DT1A 4FNSA 3O6AA 2A3BA 1B9BA 3EXTA 1GOWA 2PWDA 4V33A 4HB7A 4GXPA 4HPHA 1UA3A 3PWIA 4Z0JA 1RLCL 3NQCA 4NAFB 4PB3A 3T44A 4WOZA 1E3ZA 3WDRA 4PCTA 2GJLA 4UOZA 3O1NA 4JCMA 2R82A 1UZ1A 4NY2A 4C5YA 3W1RA 2Y7EA 1OFQA 2A79A 4UR8A 4NUWA 2XH4A 1B1YA 3MUY1 4DZIA 3DFNA 3LM7A 1VHNA 4MB1A 3WH7A 2HRWA 1JUBA 1HKWA 1R3QA 4PUEA 4BK9A 1TPVA 3F4DA 3R25A 2E5CA 2DDXA 3RK8A 3RITA 1PHWA 5D03A 4HNTA 2IPJA 3C2RA 3BSHA 5C5YA 2OWWA 3OG2A 2NUYA 4K1WA 1EBHA 5BXTA 1QOPA 1ZCOA 1PL9A 1S46A 4MTVA 2XVLA 4K8EA 5FF0A 1NWUA 2HBXA 1SM9A 5A6BD 5A94A 3WIJA 1W3TA 4RE3A 5EPDA 2FZNA 1E4LA 3V0UA 3WD2A 3ARWA 5F1UA 3FSTA 4KKXA 2F6UA 4L6OA 2QPUA 2HV5A 4M5PA 4CCEA 1FQ0A 3MY9A 4UZUA 1MUMA 2QHAA 4O4VA 3RJYA 1A4MA 5FAJA 3T81A 4QG9A 1G7UA 3G1AA 1NWTA 3IVUA 2QV5A 3P14A 3BOXA 3ICJA 4DJED 1UKOA 4L1GA 4MGGA 5H2ZA 2A4AA 1QW8A 5A8MA 3T0AA 4MHBA 4C6IA 3VYLA 5DMLA 3SN4A 4H6KA 4HHLA 2PTDA 2J7GA 4HPGA 1IHIA 2WZHA 3TYCA 3ZJKA 3DHPA 5AHIA 4WKAA 4JX4A 3N6HA 1KM6A 4B9ZA 4A05A 2OX1A 3H4XA 5LGZA 2PWEA 1ISXA 2CZFA 3MUXA 1HIZA 3ORWA 1SFTA 3L68A 2NSXA 5HULA 3N3MA 4HIBA 3EA1A 5T26A 2Z7KA 1OWQA 1PX3A 5D09A 3T2OA 2XGIA 4FX7A 2FDMA 3EWDA 4YHEA 3U2OA 5I79A 1K03A 3ABSA 3LMYA 3GYEA 4LVDA 3NQGA 7XIMA 1JCJA 2WQDA 4HZ6A 1UPMB 1BYAA 3SQMA 2EKGA 3U4FA 1H7WA 2IS7A 1IXPA 5J04A 4GI6A 4LBRA 3CUXA 4MYAA 2R24A 4QQUA 1QRQA 4L4PA 4PMOA 1TWWA 1PTAA 3NZPA 3AYRA 4ADTA 4QG6A 2I5IA 1X7IA 3KCLA 4JTUA 2INZA 1UKTA 4I5RA 3KZSA 4D1JA 1AVAA 3QV6A 4IL0A 4ERAA 1L6YA 3BQ6A 3BH4A 3BG3A 4KEMA 1BF6A 3A47A 3B9OA 5CZSA 5HK4A 2ZZ3A 4RZ6A 5LNRA 1XYLA 2VFGA 3GVRA 4GZ7A 2J74A 4O13A 1TE1A 4C6NA 3W29A 2FTPA 1O66A 5FF3A 1VH7A 2G96A 3WLHA 4YTTA 1Q2RA 3LGGA 4M0XA 4DXXA 3BMXA 4MY8A 3PPHA 2EKCA 4HMEA 3WLIA 3PB2A 1DP0A 4DJEC 3B0PA 2F2HA 1QO5A 3PZQA 3DBNA 3DESA 1H50A 4J3WA 3CQ0A 1A49A 5E1QA 4HGXA 4OVXA 2C1HA 4LT9A 2VVSA 1DWGM 3C0SA 1ODUA 4NZFA 2A6LA 3EWYA 2X09A 2QDEA 1GTEA 3S0CA 1QPQA 4WDTA 4NQ1A 3ZWTA 1QBAA 5M17A 5CJNA 1ZHAA 5FEWA 2JBMA 3VIKA 2PCQA 4V15A 3HPSA 2G4FA 2BX7A 4QJ3B 1QHPA 4QROA 3W53A 5HMFA 3T6CA 2PRHA 2FGZA 3UR7A 1F8MA 5GVJA 4E5TA 3FY1A 2WC3A 1P0BA 3LD5A 3GUGA 1I1WA 2VEMA 5CZKA 2E67A 3N15A 2VVNA 1QMLA 1XM3A 1MFVA 1TWZA 1W3NA 1WXYA 2XN0A 4JNMA 3W1TA 4Q8QA 1D8WA 4QFUA 1YTKA 3DAQA 3CWOX 4I5UA 1RK6A 4GNKB 4OJYA 3TDFA 4LBUA 1E72M 3G5EA 2P50A 3PBYA 1GPFA 1SUXA 3QQ0A 1OIMA 5BWAA 4RV8A 4IIEA 3KW3A 3K4DA 1I0DA 4CEUC 1KTBA 3BJTA 3LQLA 3TQPA 4RJEA 3W87A 4H4IA 2XIQA 3OVQA 3ZFHA 4JTJA 5TBOA 3P62A 1H1NA 2E28A 4JTCA 3WNMA 2ZZ1A 5HQEA 4I5XA 4BA0A 4GO8A 1GW1A 3FN9A 3TSBA 4W8AA 1E6QM 2ZIDA 4PODA 2IPWA 3UYCA 3HGRA 1SO5A 1W1B1 3CZ8A 4US5D 4EIVA 4XO7A 1W5MA 3SY1A 5T9CE 2BB0A 1J10A 2FLIA 3OGVA 3OHMB 4R9OA 2EHHA 4J3SA 4XAYA 4DBDA 5IXEA 5K2ZA 2Q3OA 4C6PA 4OUIA 1XJBA 1UD3A 4DN1A 4PUNA 3AICA 3W2JA 4ZOEA 1R7AA 3DG7A 5G4EA 4CQBA 2OKTA 1HJSA 3BURA 4R27A 4B5XA 3B4YA 4A21A 1KRMA 3TE9A 3WMLA 2DJXA 2BY1A 4PYSA 1JDDA 2E0PA 3EWCA 3R11A 5A6AA 1UD2A 4ALDA 2DVTA 3WMCA 5B7YA 1SJDA 2DORA 3J7HA 2PDKA 1LZOA 3AXIA 3W76A 3UG3A 4H6RA 3P80A 1I0BA 1LLOA 2PWGA 3WF0A 3SECA 1J79A 2V5LA 2Q71A 2WJZA 5CQ1A 4KT2A 3GVGA 3C2EA 1AA1B 3QEZA 1OFOA 2JK2A 1ZY9A 2VRJA 3G2GA 4BWLA 3W72A 3GZAA 1SW7A 2GGGA 1WDDA 1KKOA 1IR1A 3PJTA 5C8BB 4UFIA 2R91A 5HAOA 4S3JA 5DQPA 4F2TA 5DBUA 2YBTA 4PA8A 3E0IA 4IH3A 2ZXDA 3OGRA 3UNTA 3WLKX 4N7QA 3G22A 2PGEA 5FEXA 1XLEA 1I1XA 1NFPA 1B3YA 4LB3A 1XH1A 3VD7A 1DWIM 1C8VA 3DN5A 4GYPA 2OQHA 1U5HA 1UZ4A 5AYIA 4JPGA 3DFOA 1TVPA 3BAWA 4UQBA 3LDVA 2NQLA 3KRUA 3NDYA 3UXLA 5C71A 3CB8A 1OFRA 2QAFA 4AY7A 2FTWA 3O9NA 1E6NA 4Q4QA 4G7EA 1ELSA 3PWAA 5I6SA 1NDVA 1YTEA 2XISA 1WO2A 4LS1A 2Z27A 4W7UA 5DXYA 1DIEA 4H7CA 3GLCA 4FHAA 1P0NA 1R9ZA 5AHEA 4PMQA 3WLSA 3G8RA 4AHQA 3L0KA 4E3VA 2CLHA 1BWVA 1RQBA 1TRDA 1T8XA 3TYUA 1KCZA 1XBYA 1W9BM 3MSRA 3LGDA 1HKIA 2DT3A 3EKZA 3ANVA 3DZ1A 3OLGA 4KERA 1XUUA 4WHBA 4IICA 2J24A 4ECLA 2GK1B 2XN2A 3WQ5A 4NYYA 1HXJA 1YDOA 3TVAA 1G5AA 3QOMA 1PHQA 3EOOA 2W5FA 1JZ7A 3RMJA 4ACYA 2PS2A 1KR0A 1O68A 3KBSA 3M07A 2J7DA 3L21A 1C3FA 1CCWB 3WK3A 3P0XA 3CMFA 4RL3A 3R0UA 3K30A 3VDGA 3H70A 3ECQA 1AH3A 1KM2A 1T40A 4UR7A 5GJNA 5IFTA 3C52A 4NAEA 3VMPA 3BAJA 3R13A 1XRSA 2OLAA 2GDQA 4BF5A 3ANYA 4XVDA 3A4AA 3UYIA 3M1ZA 3M0VA 1V3JA 2POTA 3MBFA 4LV9A 2XFWA 2AMXA 2CZEA 4I9JA 3S8HA 2VENA 2EG8A 3OLEA 1GYMA 4BQ2A 1JUKA 4NZ1A 1GG1A 1PWMA 4CN6A 4DBEA 1JZ8A 4GVHA 2O56A 4Q4SA 1WDWA 3S5SA 3SUSA 4YNGA 1A0EA 3ARYA 4KETA 4IWWA 3GNXA 4A4AA 2W62A 1S38A 5JMUA 3VD9A 3SQLA 1VKFA 2Z28A 4Y96A 3ID7A 3E0WA 4DQWA 1QAPA 3CPGA 3W1UA 1R3TA 8TIMA 3GXMA 3EOLA 4R7WA 4L9ZA 4JR5A 4PUDA 4HZ7A 4Z1YA 3NVTA 3UXIA 1SFLA 4DWSD 2WV8A 2QF7A 1QUMA 3LRLA 2ZYFA 4HT3A 4PSPA 1KV5A 3IPWA 3GC5A 2JALA 3R4IA 4GHRA 3W1XA 2RFGA 2WM0A 2SFPA 4GY0A 4AIOA 1SW0A 3JW7A 1MMFA 4IL2A 4J27A 3NOEA 2WPGA 3RAOA 1XD1A 3W7RA 1JI1A 2ATMA 2DSZA 3NQ8A 3WFLA 1F05A 4J7RA 3S1VA 1JRBA 3QTPA 3STCA 2Q09A 2OQYA 5EMKA 2R14A 2MUCA 4BY3A 1T8QA 5I09A 3AISA 1W1A1 4U10A 4DB7A 3H26A 1J0IA 1PDZA 3WMBA 1POKA 1DIKA 4N6EA 1UMLA 3MS8A 5B7ZA 4JNYA 1EO7A 4HSNA 3HJEA 3QYQA 2UY3A 5CBBA 3AYTA 3UY8A 4C1NB 7ENLA 3LQGA 4Z0SA 5AYYA 3RN6A 1SW3A 2E1DA 4U2ZA 3ITGA 3VNIA 5MKGA 4Q8UA 3C2YA 5D04C 1SZNA 2VC7A 4QP0A 4FXJA 1DOSA 1DORA 2QJIA 3IEBA 1KLYA 1HJUA 2A7RA 2I14A 3MO7A 1WNOA 4HK6A 3ZIZA 4BI7A 5E0CA 1GZ1A 2GJXB 3RRXA 4LPCA 2YB4A 1XBXA 2C1IA 3ALGA 5ABFA 3EMCA 2PEVA 4NJHA 5I3FA 1UUMA 1UH3A 4YS1A 4MZ1A 4JX5A 5D2XA 3N12A 1LWHA 4CNOA 3CASA 4DM1A 3BSGA 4EWND 3QQ1A 3RM4A 1W5QA 4TMBA 3CQKA 1K1DA 3WQFA 1M7JA 1ZJHA 3M5YA 3ZSSA 2FZMA 4ZEPA 4HTYA 4M56A 1Q6RA 4PRTA 2PF0A 4GGBA 1MW2A 4TMCA 4JS3A 2R6OA 5HR7A 3M7WA 3SEPA 1JZ3A 2Y4SA 3WUFA 3CAKA 4GBUA 3EOUA 3H54A 1I2NA 4L64A 5CPNA 3MI6A 3NM3A 3DERA 4DWSC 1S2VA 1C7SA 1GQKA 4G8TA 2V30A 2J7BA 3CUHA 1Z44A 1BYCA 1MI3A 3GXPA 4QCFA 5BMXA 3MUAA 1PE1A 3L0GA 4Q4OA 3WX7A 4TTUA 3VDHA 4XKYB 5BXSA 3UZZA 2WQPA 1KCKA 3MSDA 4Z1CA 5KTLA 4AH7A 1YLVA 4AY1A 3KBWA 3GM8A 4WXYA 4JTGA 1RA0A 1TV5A 1B57A 3AMDA 3MWAA 2Z4GA 3SCVA 4F0RA 1DWAM 3KBVA 4GJIA 2JF7A 3WBEA 4GIRA 4AQLA 2QVHA 2E8ZA 3H2OA 3TC6A 2VX7A 4MWAE 2VYOA 1E6XM 3O8AA 4HP5A 4N0RA 3JR2A 5G1MA 3R6IA 1FVPA 4GCAA 3LHVA 2VURA 1YMYA 4Z17A 1PWLA 3N2TA 3GH5A 2WCSA 2ACUA 1ML1A 1NU5A 3M0IA 2ISDA 4KCVA 2GWGA 1TVNA 1UZHA 1Q8AA 1H61A 2P1FA 4UCGA 4UOQA 3H4WA 5EB8A 2J13A 8RUCA 4HMNA 3CLMA 4UFJA 2ZZ4A 4AD0A 1DBTA 1JDCA 2HS8A 2DW6A 4K68A 2ZZ7A 1A47A 4FR1A 2VQTA 1XG4A 1E9IA 4H7VA 3JUGA 1NQ6A 2J6XA 4JIRA 2YBUA 4O57A 1ZS2A 1EJTC 4FX6M 4J3TA 1PSCA 4HYRA 3W83A 4TOQA 1RVKA 5C6MA 3A13A 4ML4A 1SMAA 5DFAA 4XIAA 2J7CA 1VLIA 2J66A 5AVHA 1E9YB 1NAL1 2HS6A 1W5PA 1RY0A 1HJXA 3WENA 1EO5A 4JIEA 1H3GA 3M0JA 3TU9A 1KRCC 1UKSA 4IQDA 1XI3A 2H9AA 4K7YA 2I1OA 3TOPA 3GVQA 1AW5A 1ZJIA 3I4EA 4JTSA 1Z69A 4Q7IA 4YLWA 5CBIA 5C9RA 1JDFA 3TTYA 3VFCA 1AW1A 3ERPA 3BPWA 1KTNA 3NYDA 1GOMA 5IRPA 5AY7A 3KTSA 4YU1A 3W1LA 3D0CA 4QJ4B 2UY5A 3QV9A 3B9NA 1QWGA 1ZAJA 2Y2WA 1HW6A 1SSDA 4K39A 4J3UA 1PZ1A 3TAOA 3TW6A 3R0DA 1SO3A 1J6PA 1E0VA 2OTDA 3W4RA 3SIMA 3E5BA 3LPGA 4H9UA 4PMJA 1VFHA 2CZ5A 2AGTA 3ZOAA 3DENA 2RDTA 4D8AA 1CENA 3SRKA 6XIMA 5CSSA 3CL8A 1V3HA 2IUZA 1LWJA 2NV2A 3BSMA 4Y9MA 1BFNA 3HN3A 1W0MA 1MFUA 1DVJA 2CETA 1MZHA 2ZUTA 3WEMA 3KL3A 1CECA 3G1FA 1R2SA 5FL0A 1RH9A 1XLHA 4GLEA 1ISYA 1X1ZA 3G1XA 4DLFA 3M0YA 3TW9A 4E8GA 1LM1A 4E2DA 4A8RA 2PD5A 2VZOA 2BMBA 4JKLA 1B9ZA 3PZNA 3ITXA 4WQ6A 3RRAA 5I02A 2F7FA 5CPLA 4ZFCA 2WPBA 2PRMA 1SZRA 4ZXLA 4DJDD 3DHUA 2WJFA 2EPMX 1O4UA 2F38A 3H2MA 3W7QA 4IQJA 1YBQA 1MW1A 1YE4A 1MRQA 1LOLA 4HYVA 1ME9A 5DMYA 4GQQA 2X0SA 3FGCB 4CD7A 3AHVA 3VD3A 4XG1A 4JL1A 3CK5A 4KCTA 3DIPA 5D33A 3R58A 4FXRA 2GFTA 3MDUA 1U5JA 3BLEA 1QI3A 1JNDA 4DNMA 5K4XA 2HQAA 3RU8X 3PPGA 4HNUA 4DBUA 4A8LA 3MP5A 3UBPC 1EZWA 1TB3A 4XVEA 1V79A 3KP0A 2GVGA 1UR0A 3DGBA 1TO3A 3A9IA 1GVRA 2ZZ5A 3C5QA 1Z8AA 3U2EA 5C70A 3PUOA 4ONVA 4L5ZA 4GE8A 1R3SA 4F0HA 3IGUA 1U5VA 2XDFA 3U48A 4Q8NA 5D9NA 1TRIA 4LAKA 3RX3A 4MY9A 3CQIA 1ZENA 4O28A 1XG3A 1TX2A 1EJUC 4IQEA 1G9HA 1AFSA 2PDCA 3V7PA 1XGZA 4IMFA 5LXEA 1JD7A 2ABAA 3MJMA 4Y9PA 4LNYA 2WSQA 3HURA 1FHUA 4DJEA 3C56A 3N25A 5A69A 1DXIA 4GVGA 4NL1A 4NG3A 3T7VA 4HYWA 5G4HC 1H1YA 3VX1A 3WQDA 3ME3A 1AL7A 2XSAA 5HWNA 1VPXA 3BCFA 3NL6A 4BZYA 1HP4A 1TUXA 2J79A 4M7TA 2P3EA 4Q4KA 1L0PA 3CS2A 1LL6A 3T40A 5DY2A 1JYWA 2CBVA 3PSVA 3FYOA 1AJ2A 3VX0A 4AMAA 4XX6A 3N2XA 2FMOA 4B9YA 1JZ6A 4O1FA 4RUBA 4AZBA 4YIWA 3VCNA 1XYAA 1VC4A 4DJDC 4E4PA 1OCNA 3HTWA 4P5UA 1YPIA 2AL1A 2CLOA 2PDXA 3AS0A 1J18A 4LJ3A 4PBGA 4XAFA 1XCWA 5EMYA 3AIRA 1IIHA 1FH7A 3E74A 2AQOA 1R7OA 3AMCA 1U22A 3VABA 1F76A 2D24A 5JIPA 4AB4A 1OYAA 3N4AA 4HCHA 3WQCA 3F5LA 2YYTA 3L0NA 4HHPA 2QDGA 3CHFA 4B3LA 1EFZA 1W56A 5ENLA 1AQ0A 1YIXA 1TE6A 4B2DD 1XC6A 2X1TA 2YA2A 1YHTA 4PTDA 4C6CA 5HNTA 1EIBA 2Y7GA 3T0DA 1NFGA 3GNRA 2DH2A 4GQRA 2EEXA 1Q66A 3ELFA 4S3DA 1PB0A 3B0YA 5CBJA 4XSLA 1ITCA 2XGBA 3RG6A 3QPYA 4D6EA 4O10A 3NVDA 3Q65A 4UTTC 3KRSA 3C2VA 1JF6A 4GXWA 4Z08A 2FB3A 2QULA 3A64A 1RP9A 3N9RA 4AD3A 5EMMA 1P7TA 2ZWYA 5F2MA 5C7VA 3FYPA 2WHLA 3VI2A 3UFYA 1DYSA 1TYGA 4LB4A 2V63A 2BXZA 2X1RA 4XO6A 3KL5A 4MWAD 3L7RA 4LUTB 3GNOA 5CSUA 5D9OA 4LC8A 2IXUA 1NOUA 2CLIA 4ZENA 2JEPA 3RNDA 3V4BA 4YCOA 2C19A 3CL7A 3CUZA 1QOXA 2ATSA 1YNYA 3GSMA 4DUWA 2PBGA 3T08A 4H19A 1W3IA 4W7VA 2ZC1A 1VB9A 3EZ4A 4V2XA 4G9PA 3KWSA 4LYRA 1YXDA 5C0QA 1KRBC 3IJIA 4I7UA 2WZTA 1FWSA 3WQ6A 4PMVA 2CU0A 3OU8A 4D8LA 2YL6A 4OBSA 4WJ8A 1GVFA 3O0FA 1DJQA 2WW5A 1XIEA 1UJPA 1IIGA 2JKPA 1UR4A 3JZUA 3B0VC 2X30A 2ESCA 2REQA 3CAWA 2AKMA 3IS4A 1D8CA 3WH9A 4H2HA 4QQ3A 1M04A 1XDLA 4IT1A 2O7SA 2PTXA 3GU2A 3QN3A 1O1HA 1UQYA 4O0QA 3RFAA 3AHZA 4IFRA 3ZJ6A 4JYFA 2TSYA 4Q22A 4ERIA 4NVTA 7REQB 1LLWA 2OYKA 1Q6FA 2PBOA 1XLFA 4AZGA 5FJPA 1JGIA 4AWEA 1ISZA 4XD3A 1KXVA 2X16A 3BK0A 4IMGA 4W89A 3QZAA 4C6KA 3MUZ1 2J27A 5I3JA 3MUIA 1OADA 2PGWA 4FNPA 1WV2A 3UWZA 4HOZA 2DIJA 3EDFA 2GGIA 1TX0A 5I3KA 5LIUX 4EPDC 1UWQA 3N17A 1W54A 4ICCX 4ICMA 4AF0A 4A8NA 4PMYA 3RLVA 3RHGA 1K9TA 2YLLA 3ABQA 3QY6A 4GIEA 2OXNA 2E68A 2DSWA 1HX0A 3NZQA 4HCLA 4AXKA 4QNEA 4O11A 1EP2A 3H6OA 3NQEA 4XV0A 4O12A 3PSWA 3BVJA 4ASTA 1CBGA 3QTGA 4MWAC 4US5A 3VD5A 1DL3A 4QGCA 3WLTA 3FX4A 2EF9A 2NXIA 3ZT6A 5FA5A 4PSRA 1CI1A 3CNYA 4ZOAA 2BY3A 4IPJA 3F5KA 2NQ5A 4DYJA 3W7KA 4I7WA 1WE5A 4DBWA 3CZKA 2DSKA 4I7VA 1YPXA 4E6MA 4FXSA 2QXWA 1FP9A 4ZQMA 3OJGA 4ZTXA 1V02A 4GKLA 1FWDC 1JRCA 3TYAA 4B90A 1GQJA 2EBNA 4G7FA 3T0CA 3NZ1A 3C0JA 5EMLA 1XV8A 3AIQA 4E4FA 3OGSA 3QSTA 3ITYA 2EPLX 4L9XA 4HU0A 4GX8A 4ATWA 1AQFA 2E7FA 5CPQA 3GU9A 1J11A 1F7BA 2YL5A 3LCHA 3B06A 2O7QA 3I6EA 4AU0A 3F4VA 1LRQA 1PAMA 1A3XA 2G41A 3VMOA 2GWNA 1XKJA 2TAAA 4PB4A 2ZRXA 3WBAA 3ITCA 1TTIA 2B7OA 3F7JA 2A7PA 3GVVA 4GY7A 4W9TA 5C9XA 1XYCA 2J9YA 2EGZA 2XH0A 2FHFA 5IBXC 2CLLA 4GMEA 4US6A 4UFHA 4C65A 1RAKA 4WLCA 4QITA 1FOBA 2PC4A 3GR4A 3CAVA 4JEJA 1V3KA 5J8LA 2YDAA 3DYMA 3VGDA 5ECVA 2NVCA 1JPKA 1TPDA 2Z0IA 5I3DA 2H8ZA 4GQBA 4KCUA 3UWUA 2BY0A 3UR8A 3B05A 3K8KA 4GUJA 1NEYA 1LLZA 5A6MA 2YOCA 2OOGA 5D8WA 3KOZA 1H63A 4BHYA 1VHCA 3N3TA 3VZYA 2BFGA 2J9XA 3UVIA 3C0LA 5FOOA 5FF2A 1G7VA 1JVNA 3T2PA 2QUUA 1XICA 3ARSA 4ORIA 3VPLA 2PI6A 2VX4A 3N6QA 3E5PA 2DZVA 2VKZG 4HSOA 1NQKA 3LM3A 3UF9A 4LUSB 3HG5A 3SM0A 4UMCA 2OEMA 1XLGA 1KA9F 3KVJA 4NI3A 1KM1A 2VQUA 3TAKA 1MRAA 3TWBA 3BG5A 1T96A 1J4EA 1Q65A 4OECA 2QR6A 3V35A 2WNNA 2C14A 1BTCA 3KFTA 4YN5A 2PGFA 4UBPC 4PEKA 4FALA 3P8JA 3LPPA 2QZRA 4O53A 2VZSA 3P67A 4IIFA 4QHRA 1R6WA 1ZJBA 1P6BA 1SPQA 3GX9A 3QZ6A 2PTZA 2C6QA 1XIDA 2JIWA 5AZ1A 3TQKA 1BF2A 2GSEA 4UTHA 1GWJA 1X7FA 1IXOA 1B0IA 4ACZB 3AWNA 1NF0A 1ADSA 3AYVA 1O12A 3VNDA 3C3NA 3LLFA 3WK0A 5M2FX 4JTEA 2RJHA 2GQ3A 5REQB 2PDWA 3MHFA 1UB3A 3TEVA 3CYJA 4HOWA 4F8XA 4K1GA 3WDIA 2NX9A 3U57A 2ZADA 1K8XA 2ZXQA 4RR4A 1XF0A 2ZRWA 4ZB0A 3GAKA 3PPCA 4LUIA 3WNOA 1TFVA 4E2BA 2GDVA 1EX5A 4NX5A 4G56A 1CXKA 4Z42C 3MO4A 4GY1A 1HG3A 4JDYA 1QNQA 2YPIA 1AD4A 3UGRA 4Y6GA 2ISFA 1OYCA 1KB3A 4F3HA 2DZXA 3P74A 1IXNA 3R94A 4EVZA 5KZMA 4ADUA 7TIMA 1ODZA 3W7GA 3EDJA 3KVMA 3HU7A 1WDRA 3TMLA 5BYWA 3HG4A 4FNUA 3TWAA 3CO4A 3O16A 4EE9A 1GEHA 3STPA 4S3BA 3WFZA 5A5WA 2GSHA 2OB3A 3NR0A 2VZVA 5A8GA 1VIWA 4OIFA 5GJPA 2I17A 3M7SA 4LUYA 4PUKA 2P8CA 4DWSA 2QDDA 3GKFA 5EMJA 2YBVA 1NY1A 2CKSA 4NNAA 3VNJA 3RR4A 2V2CA 4WGHA 3TUUA 2YYUA 3L23A 3BGGA 5HXMA 4WKFA 4FIQA 2OYLA 5I3GA 4N42A 1GYNA 4LXFA 1R47A 1TIMA 3E3HA 4UFMA 4H41A 1BGAA 5A8PA 3HPAA 4W8BA 4EPBC 1PIIA 1KBKA 3AIVA 5D2TA 5C2GA 3GHTA 3QYSA 4HN4A 3UD6A 4MDPA 1JQXA 1OF6A 4ZQRA 1BQCA 4ICNA 4M1RA 4FXFA 2POZA 1ECQA 1IWPA 1OINA 4H83A 1X38A 4C1KA 3UJRA 1N8IA 1G4EA 3HV8A 3IJ7A 1CPUA 2YW4A 3CUFA 1D7KA 5K3VA 2XUCA 2NUWA 1IT7A 2A3LA 1XLMA 4I90A 4KRUA 4GJ1A 1Q8JA 3AIBA 1JF5A 1XIHA 1RBLA 4UTMA 3STEA 3BGAA 3AUOA 3G3DA 3LV6A 1S1RA 3PM6A 4KEUA 3WLJA 3WZ0E 1GJWA 3SGGA 1XD0A 2V2HA 4CD8A 2G97A 1ZP3A 3L2LA 3GXTA 2HPMA 4B5TA 2XG9A 3WDHA 3O15A 1DJWA 4IM4A 1J0YA 2ZRYA 3GNPA 3QR1A 4NI8A 2P8BA 3S9ZA 3N14A 3ZLHA 3OIXA 1TMHA 1KKRA 5I07A 1B4KA 1YKWA 2VR2A 2Y5EA 2XINA 1J12A 1ZRQA 2FH8A 3UWVA 2ZX9A 1H49A 3T4CA 3B8UA 3A22A 3T2QA 4GOAA 1AJ0A 1S5TA 4B5SA 4U28A 3IV8A 2XIMA 3RM9A 2XFYA 4HZ8A 1D9EA 1EX1A 2A3HA 1CIUA 2B7NA 2DVXA 3THQA 3F4CA 1UR3M 3GNDA 5LSMA 2Z6JA 1XPGA 1N8FA 3S5ZA 4E4UA 1EPVA 1L2QA 1JG9A 4IFOA 3WK2A 4ENLA 3APGA 5C9ZA 3EPMA 3TR9A 4RZ5A 4JTKA 4O16A 3NEHA 1MYRA 1IE7C 3G1DA 5FJOA 2D0HA 4MKVA 3N2OA 3NSNA 2V5JA 3LMZA 3UCCA 1DPMA 4IFKA 2VCAA 2RDUA 5MHBA 2D3LA 1W9DM 1KFKA 4F0MA 1V77A 2QUVA 3V1HA 4O8RA 1QCWA 1VYSX 1UJQA 2YCLB 4C7FA 2AL2B 1PJ9A 4IPLA 2YCEA 1TJPA 2FZBA 4JIQA 4KGJA 3SCNA 4JN8A 4TVDA 3BUVA 4H3DA 1TJ0A 1V0LA 3S3GA 2A5HA 2PDMA 1WA3A 1MUCA 5FJUA 3W1AA 2PFHA 3TYBA 2YB1A 2QUMA 5E0KA 1E4IA 3W7DA 4LAZA 1XLAA 3SO7A 4D1IA 3BJSA 1S2TA 3HB9A 1S3HA 3E2VA 3WH6A 3W7OA 2FVLA 4KEZA 5TNVA 5CLWA 3QM3A 4MG4A 2HMCA 1JI2A 2FHCA 5CGQA 1A4LA 2E9LA 4FNRA 4AEEA 2BGNE 3DECA 2AAAA 4JICA 1RHCA 4D6JA 3OLIA 1OT1A 4LWWA 3SBFA 4RCXA 3W2UA 3W25A 2CWNA 3EX1A 4CNPA 3KL0A 1VYPX 1Q4WA 1PDYA 5DF0A 5KMYA 3FJNA 2HDJA 2J8TA 2VO5A 3DBPA 3M4HA 3KRZA 5JIWA 3A4JA 4A3RA 2EPNA 5BU6A 4YPJA 3WJSA 5E9AA 1MVYA 1TPC1 4MVAA 1BHGA 3MB9A 3ZQ9A 4HJWA 3L4XA 1UKPA 4JAWA 1FWNA 1S2AA 4UQ9A 1A3HA 2PWUA 3IJ8A 4S3FA 3R0KA 1SFJA 4P8XA 2HPIA 3AYSA 1HGWA 3M46A 3RF9A 1NM9A 1B30A 1WZLA 4QBXA 4GQGA 3N4FA 2GGJA 1Z41A 4U4MA 4P8UA 2VRQA 3CMGA 3D3FA 4PTMA 1S5NA 3MQTA 3W7CA 3I3DA 4GFIA 4PUUA 3K8LA 3FCPA 3B8TA 5FJRA 3TFXA 2X0HA 5HWMA 2QPXA 3ABRA 4NRSA 3W73A 2G3NA 3GR7A 4K7VA 1JQVA 1K7XA 4RDVA 4JQ2A 5E93A 3LSCA 3IJQA 1JEZA 4OTKA 4JCLA 3E38A 2R1MA 4UC5A 3G77A 1TQXA 2ZX7A 1G4SA 3CMJA 3HPXA 4Q7BA 3CH9A 4C6LA 4KESA 1H7XA 5BXRA 2E5DA 1Y8BA 1MSSA 1UPPA 3QC0A 2BHUA 5IHRA 1DQWA 2NX3A 4UQCA 3E9AA 3QHOA 4RPQA 4ZQNA 3B8IA 4B5WA 4GYFA 3LN3A 3AHTA 3C86A 1UYQA 3RXZA 2PUZA 1J0HA 4GH1A 3QR0A 3THAA 4PCPA 3W01A 3W6MA 4YYCA 4DJDA 4PE8A 4V27A 1NDZA 4M3PA 1GW9A 3TXZA 2W66A 5FJJA 4R5EA 4E8DA 2B7PA 2ADAA 4GC3A 1XKYA 4J3VA 1GNXA 1RSCA 4D71A 1CX9A 3BICA 4Z1DA 2HEJA 2WCGA 2VTFA 5K9XA 3BLDA 3DYPA 1NF7A 4N9BA 2VI0A 4AX7A 3SADA 2XSXA 4C5ZA 4ZMGA 2PDJA 3ARVA 4L6HA 3N9SA 4EXQA 3TONA 2CBUA 4KRTA 4ZO7A 4C6EA 2I9UA 2JEQA 4OBRA 4P7RA 1BSIA 3P5ZA 5BW6A 4J2PA 1U1UA 3QR3A 3P8IA 1JCXA 2NV9A 4E3TA 2VDGA 1A5BA 2WMIB 5LIXX 4B5VA 1ZUAX 3E6EA 3P82A 3V3WA 3EXRA 5A6LA 2PU1A 4TV5A 4D72A 2KAUC 3VILA 4D6CA 1GG0A 3VZZA 1KGUA 2JGQA 3K8MA 4HK7A 4UOJA 1HKMA 3GIPA 2PE4A 3ONBA 3GTFA 2D1ZA 4MPKA 3GDRA 2XTKA 1Q7ZA 1M5WA 3CT7A 3DI0A 4J40A 4UTTA 3UESA 4PUMA 1VYRA 3GG7A 4MSSA 3VKKA 1E1CA 4PBEA 3IAPA 1LWIA 4FLOA 2NVDA 2GVLA 2AQVA 3U3HA 1R2TA 4GUHA 2E8YA 1TJRA 3WJWA 1FDJA 3KCOA 4HNVA 3TIMA 3NSXA 3NDZA 1CNVA 1XBVA 1O5KA 1EDQA 2R1KA 1GVSA 2DV0A 1G94A 3JU2A 5A3HA 4CCZA 4C91A 3ABXA 5AOUA 1QTWA 1VJZA 4RE2A 2ZTJA 1R3RA 2VUNA 2OQLA 1QI5A 1ZU8A 3DG6A 3SY5A 4JEQA 3STFA 4HD5A 4JYEA 5HMEA 4B5UA 1US2A 1QNPA 1GVYA 3MZNA 3EWWA 3S2JA 3ZXWA 1WOAA 2ON3A 1K9EA 2R1NA 1U33A 2IQDA 3DGRA 4NAFA 3CO8A 3I3BA 5A2CA 4AX6A 1V6VA 4LV4A 3TCEA 4ZVJA 4GPNA 2BZNA 2XGZA 4DHGA 3KOYA 1KXQA 5M5DA 1HF6A 4EAMA 1NOWA 1XIBA 4AAJA 4WY0F 4HPXA 4MJZA 3UA4A 2PODA 3FA4A 3L2MA 1A0CA 2OZ8A 4YMZA 4DYEA 1MW0A 3S2NA 3UXAA 1DV7A 1EDTA 1GOQA 3TTOA 2D3NA 1TPEA 2VGGA 4PFHA 1P0EA 3ITTA 1QJWA 2WB5A 1SZGA 1DWHM 4P2VA 2RJGA 3LZ5A 2WHJA 4NILA 4B2DA 3QVQA 1DTNA 2C0HA 4Q4PA 3CV7A 1QW9A 1H7PA 1P6WA 1JPMA 3IJ6A 3STGA 4JTIA 3A23A 1J01A 3HGJA 3BARA 3WL1A 3S1UA 4K3ZA 3CHEA 1I2PA 4CCDA 3EDKA 4X9SA 3G24A 4I6VA 4AD4A 3CEPA 1M3UA 3KM8A 3P60A 1UBSA 4FX8A 2W67A 3QW4B 5K4ZA 2Z25A 3N11A 3TN4A 4JTAA 3ZWSA 1RXOB 4RLIA 3Q58A 2ABBA 2XSBA 3REQB 3F03K 2QCNA 3F2CA 1WZMA 5A8OA 4BF7A 3MTWA 3ZR4A 3SCRA 3MKCA 1OFPA 3KDNA 3WLRA 3GC2A 4DELA 4MWAA 4D2JA 3Q45A 2OFJA 2QV4A 4GUIA 5DRCA 1T6MA 2YSWA 1JDEA 5FACA 1PTGA 4QTGA 3SRHA 9CGTA 4C60A 3VIHA 1OB0A 2ONEA 4F2BA 2BOEX 3H8AA 2OT1A 1AODA 2RDXA 5U7SA 1V0NA 1Q45A 2H3BA 4O19A 4TTGA 4AFYA 3S46A 4DBSA 3UZJA 3N19B 1QU4A 1HT6A 2J88A 2RAGA 1RD5A 4A2RA 2NQJA 4PUJA 4J28A 3UU0A 4PB5A 4WGXA 1ZAIA 4XZMX 2INEA 2C1GA 1POJA 1B5TA 4JFUA 5CPMA 3LCLA 1FBAA 4B15A 1G4PA 6XIAA 3U8GA 4LY4A 3AXMA 2NVAA 4RE0A 1C9DA 1NELA 5K9CA 1F07A 3I65A 3TOYA 3B0XA 3LY0A 2Q6ZA 3IGSA 3P0WA 1ISWA 1H7NA 2J47A 4O1DA 2TYSA 1MEHA 3S9YA 2X41A 1FWEC 1OZQA 1XIMA 5IBXA 5FAGA 2PDBA 1W8SA 5HUOA 4FNQA 3PBVA 1LQAA 3L65A 1NP2A 2VEKA 5AB3A 3IJ9A 3R43A 1IYXA 4NJJA 3LPOA 5G5IA 2XWEA 3S4TA 3N2CA 3RO8A 4N9DA 2V3EA 4M81A 3FHQA 3NXLA 3S5NA 4AWTA 3TNBA 2EQDA 3XISA 4N6FA 3DXIA 3AJ7A 3QLDA 3LCFA 3DX5A 1VZWA 2QAPA 3AXXA 4I3GA 5D8ZA 3TSMA 2V8ZA 2CXGA 3M5XA 2VCCA 1KBIA 4NSBA 3VZXA 2HCVA 1W32A 4NRRA 1MXGA 2J4GA 2WZEA 3INPA 3PZIA 2GL5A 2QJHA 1FUYA 2WMKA 3MHGA 4MUZA 5EL1A 3MUCA 3HF3A 4XZNX 4GNVA 4LRSA 3ZT5A 1RJRA 1UMYA 5I03A 4P7NA 1FTXA 4DJFD 1ZP4A 4AVOA 1IV8A 2WNWA 2WBKA 3R7MA 3UVAA 2DQWA 3VIGA 1D7FA 4AIBA 1IEWA 4XAZA 1ONRA 3TROA 4YVXA 2HE8A 4CQAA 1RJQA 2VOTA 1XRFA 1BKSA 3WQEA 1VS1A 1ICPA 4H9YA 3GR8A 2HXTA 1TWIA 2C3ZA 4IGHA 4J3ZA 1VFOA 5IM51 3NZRA 3EAUA 3IUHA 3GY1A 4KIRA 4UFKA 3PTQA 3ZVIA 4CNUA 2QUTA 4KWWA 1BLIA 5HQMA 1JXKA 7TAAA 5I3IA 1YW1A 1KBBA 1VEPA 3HG2A 3NIYA 3G6LA 2YCIX 3GXFA 2XN1A 5BZAA 5LA1A 2AQWA 4LYQA 4RE4A 4CQ8A 1R46A 1X1NA 3HA1A 3B9AA 1R8LA 3ARZA 2VR4A 4YTSA 4V1YA 1XH2A 4KS0A 4O1BA 1S1PA 2RDWA 4R53A 1DIDA 1SJBA 1TJ2A 2W0UA 4P7LA 2YGYA 3WD0A 5BNKA 4FF5A 3RCYA 2NXHA 1I2OA 1VRXA 1KNWA 3NPUA 3E2QA 3TLQA 3LK6A 3GAYA 4F4RA 4IPIA 3TN6A 1BVNP 1AMKA 5HUPA 1ZBKA 5EGRA 1W9PA 5M3WA 1E5JA 3UJEA 4I9MA 4Y9NA 3U6WA 2VDIA 4PTVA 3WBWA 3FHAA 3C4UA 1HVXA 1O95A 1GHRA 5I77A 4KFOA 1F73A 1LTDA 4C6FA 4XD5A 1M68A 4Q7NA 2Y8KA 4JIIX 4ZSTA 1FCUA 1DJXA 1FHVA 2VT0A 1UIOA 1EGZA 4PFMA 1DJNA