2XFRA

Crystal structure of barley beta-amylase at atomic resolution
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
487
structure length
487
Chain Sequence
VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-AMYLASE
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
total genus 191
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xfrA00
3A3HA 1BG9A 4MAZA 4M80A 2ZOXA 3GDBA 5BXRA 1E73M 2BVTA 1W9VA 2W5FA 2XPKA 3VX1A 1W9PA 4J3XA 1QI5A 1R7OA 2WNWA 3BAXA 3AFBA 5CLWA 2WKLA 3NDYA 1E4NA 4U3AA 3CHFA 4N0RA 1SFSA 2ESCA 1H0IA 1CXEA 3VM5A 3RDKA 4IM4A 1OB0A 3BAIA 1I1XA 4AY1A 2O9PA 3AJ7A 1E56A 2IXUA 1JG9A 4PMXA 3VIJA 1UYQA 1C8XA 3AZSA 1HX0A 2YDSA 1VFOA 1D7FA 1VENA 3N18A 2BY1A 3EMZA 5D9OA 1UOKA 3GNRA 2EPMX 5E6YA 5I79A 1PEZA 3IJ9A 2EQDA 3EDEA 2OLHA 3ARYA 3AMLA 4NF7A 2FH8A 1HJXA 4AIUA 1VBUA 3OIHA 5CPSA 1XSIA 1JYWA 2J62A 3WDIA 4IPLA 1VF8A 4OZOA 3PHAA 2YL9A 3W24A 3WQWA 4FLRA 3IANA 3BCFA 4CN4A 4NRSA 1HJWA 3ZMRA 4MNKA 1JAKA 3CHCA 1OT2A 1UA3A 3WMCA 4W7WA 1MVYA 2ZUTA 1NM9A 4TUFA 4AZCB 2ZX9A 2D3NA 4M29A 1IZKA 3AS3A 5BRQA 2X8RA 1Q6CA 3MO4A 1HT6A 1ZB5A 4BQ2A 1D2KA 4D1IA 1FH8A 2E0PA 1BTCA 4GIAA 4EK7A 4QCFA 1GOQA 3CZEA 1E5JA 2QPSA 3OG2A 3UESA 1CWYA 3L4ZA 4ACZA 1KBKA 5KEZA 4P7RA 1NOUA 4PRWA 3VOCA 2WC7A 1E0VA 1KWGA 3GXMA 4S3JA 4AD1A 3QGVA 4OOUA 4JKLA 4UFKA 1B0IA 1JZ3A 4HOZA 3N04A 2VCCA 1XRVA 3VVGA 2Y2WA 4XZBA 3W53A 1HNYA 1UD3A 3WQ8A 4R5EA 2YLLA 2FHCA 2WVTA 4GZJA 1HKIA 3SURA 1GQKA 2WXDM 4GI9A 4HMDA 1JXJA 2PBOA 2QMJA 3AYRA 1PPIA 4L4OA 1AMYA 2WW5A 3VNYA 5A6AA 2CHNA 2CKRA 4PMDA 2J8GA 2PBGA 4J7RA 1OD8A 1EO7A 1XH0A 3I3BA 2G3JA 3W6MA 2ZX7A 4D6FA 7TAAA 3L4UA 1LWHA 5KZ6A 4C7DA 3SUUA 3MSDA 1VEOA 4AD3A 3CGTA 5FIPA 1DEDA 1H09A 3CZKA 1UWRA 2DEPA 2CNCA 4HOWA 3PZVA 1L0PA 3FXYA 4WSJA 2W67A 1BYAA 1WDSA 1TZ7A 1BVZA 2AMGA 1OBAA 1ZS2A 3NYDA 3AS2A 4FLSA 4GKLA 3F5KA 5AYIA 1UHVA 1J0HA 3HMCA 1XYFA 1NWUA 2X05A 2G3NA 3K8MA 1VJSA 5FL0A 1PX8A 1XH2A 4PYSA 5CPTA 1R8LA 3AMGA 4JHOA 4W8LA 3SUTA 1CBGA 2VVSA 3MMDA 2Y8KA 4H7VA 1DWJM 1TVNA 1ZBVA 2ZWZA 3RMEA 3GBEA 1HF6A 1O7AA 5I3DA 1U2YA 1GQJA 3FAWA 3WNPA 1HP5A 3N9KA 4M24A 1V3JA 1W91A 4J27A 2YL8A 1UA7A 1HL8A 3EYPA 1BYCA 1VEPA 5FOOA 4UTFA 2W91A 1C91A 2DT1A 3OZPA 4TXEA 2DH3A 5DFAA 3SCOA 1KGWA 3WNNA 5EB8A 3K8LA 3ZJ7A 4MJ4A 2GSJA 3F5JA 4JZ5A 2EPLX 2D0FA 5D8WA 3PZIA 2ZUVA 3ZSTA 1E55A 3WD4A 2WLZA 3VDHA 3UR7A 3SCPA 2WZHA 4DM2A 3UETA 5I23A 2VTFA 2A3EA 4F66A 2UY5A 1F4AA 4PUEA 3T0AA 1C90A 2D23A 2WWDA 3FHAA 3THDA 4X0VA 4D71A 5CLTA 3F5LA 4B15A 2DQXA 1C93A 5JIPA 1HKMA 1R86A 2Y24A 3GYCA 2ZUNA 1JFHA 2E9BA 3GBDA 1VEMA 4UFHA 2PWGA 4NSBA 1E0WA 2J75A 2X0YA 1NARA 2WAGA 5E0CA 3WQ5A 4AZ6A 4DWSD 2D0HA 1GORA 1B3WA 4P8VA 2ZUUA 5E70A 1V02A 1C7SA 5CJ5A 3AI0A 2FHBA 2WSKA 1NH6A 3VD3A 1E15A 4F9DA 4MB1A 4C7GA 1H11A 1XH1A 4Z2LA 2OSXA 4WKHA 5A2AA 2Q8XA 3HJEA 4ACZB 3ZOAA 1UD2A 4YHEA 1K9EA 1BQCA 3GH4A 2GJPA 4KGLA 1VJZA 1XC6A 1P6WA 3L4YA 1OT1A 1V6WA 5A95A 2CITA 3AISA 1B3YA 1PX3A 3ARTA 5M5DA 4D6HA 1GJWA 4BCEA 3PTKA 1W9UA 4ZFMA 2MANA 2PWEA 3PBGA 1FHDA 5IDIA 3VIIA 1J0KA 4IPNB 4CGTA 4U5IA 5CSYA 1CYGA 1JDDA 5BYWA 1TE1A 3AMCA 1RPKA 2QHAA 1NWRA 1W3LA 3NIYA 3ZM8A 3POHA 2XVNA 3PN8A 1E0XA 2WZEA 4DUVA 1B90A 1V3LA 3AIUA 4KGJA 4TVUA 3VIOA 1CXHA 1QNRA 4GZIA 3VMPA 2A3CA 5A6LA 4Z2JA 3CUFA 2CBUA 1EQCA 3WN6A 1W32A 3AHTA 1B30A 3RM9A 3CZGA 4JHZA 1WAWA 1MYRA 1Q6DA 5ABHA 3T2PA 4JFVA 1JZ7A 1PZ3A 1UR4A 1UZ1A 2OSWA 1J0IA 2GJRA 1J0ZA 1MFVA 1G5AA 4W86A 1PIGA 4P8XA 3L4VA 3POCA 3LMYA 5IFTA 2CXGA 4HMEA 3WBAA 5AY7A 4XV0A 4HPHA 3CUHA 3DYMA 4PCSA 1K9DA 4UFMA 2ZX5A 4UQEA 4A3HA 3ZQ9A 3SUSA 3WFZA 4BQ5A 3WUBA 1K6AA 3TTQA 1QI0A 2OYMA 1WE5A 2VT0A 4H8UA 3VKKA 4LX4A 5HOSA 2J77A 1HJUA 4AZCA 1ITXA 3VGGA 4ATWA 5GPRA 4V27A 3BGAA 2CBJA 2GUYA 1W2VA 4N42A 4NI3A 1JZ5A 2XHYA 1E6PA 1J12A 1QNSA 4PTMA 1H41A 4WF7A 1OWQA 2RGMA 1V6UA 2EJ1A 1GOKA 1RP9A 5E9AA 1EDGA 1CEOA 4QCEA 3BLKA 1BSIA 2WZIA 1W9DM 3ARZA 4XB3A 1X1NA 1JF5A 2YL5A 2JFEX 1MQRA 4OJYA 3W37A 3GXFA 1KFWA 2VOTA 4D1JA 1JYNA 4AZ5A 2WHJA 2QMKA 2DSUA 5ECUA 3KL0A 1CENA 1EGZA 4M81A 2Z1SA 6A3HA 2WM0A 4U33A 4GO9A 3E1F1 3MV11 3MUAA 2JIEA 2XVLA 4DUXA 4LYQA 3FY1A 4D6DA 4QAWA 1ZL1A 2VZTA 2DSKA 2EEXA 2GDVA 4JFSA 1BFNA 4HZ6A 3VD7A 3AYSA 2NT1A 3T09A 1W3KA 1DWIM 4PTVA 3OB8A 1KCKA 3HU7A 1NWTA 5LA0A 3SUWA 1AVAA 1DTUA 4HMCA 2WKGA 2DT0A 4OBSA 3WKZA 2CETA 1JYVA 1JI2A 3IJ7A 1LL6A 3BAYA 1MXDA 1JL8A 4W85A 5AC4A 1VFFA 2E9LA 5DT5A 4Z2GA 1KQZA 4HPGA 1CZ1A 4D6GA 2WK2A 3FW6A 4Q22A 2VCBA 1W3JA 1CLVA 4CD5A 1JZ6A 1CIUA 2VI0A 5AYBA 1V3KA 2VUYA 3VM7A 1IZJA 3WH7A 2DIJA 3N17A 3QOMA 1UG6A 3WFLA 1UR8A 1GQLA 1Y7VA 3RJXA 3T2QA 5A8NA 3G6LA 5IHSA 4YHGA 1EA9C 4RE3A 4AZIA 5A6KA 1B3VA 3WF3A 8A3HA 1RP8A 1QBBA 2J7GA 1TR1A 2VVNA 1QI3A 3PZGA 2J8FA 2J7HA 3AQUA 1BGAA 1E6SM 1XCXA 2Z1KA 4B3KA 5HPCA 2YOCA 4HA4A 2XSAA 3WD3A 3SEPA 3UG5A 1XD1A 5EFDA 3N13A 3KEHA 3BMVA 1J9YA 4JCMA 1OGGA 4W5UA 3M7SA 3DHUA 2YBTA 4GQRA 2V3FA 1EHNA 1TMQA 4PSRA 3WH9A 3W4RA 2GK1B 4AC1X 3WNKA 3BSGA 1XV8A 4B16A 2BY0A 4FMVA 1TCMA 2ZXDA 4D6IA 4UOZA 1CXKA 1R87A 1GOMA 2WMIA 1Q6GA 2IXVA 1WZKA 4Z2HA 1EOMA 1AQ0A 3CPUA 2YA0A 1JXKA 1VIWA 3WF0A 4U5KA 1SMAA 5HBFA 5BXTA 4WJXA 4Z2KA 2OWXA 2VZOA 1H1NA 4HA1A 1WO2A 3WD2A 1KGXA 3WUGA 1GW1A 2CHOA 2GDUA 1E1FA 2JEQA 1WP6A 6CGTA 3GNOA 3U7VA 3EBVA 1GJUA 3B9DA 3ZIZA 4D6CA 4W7UA 3ARRA 2OWWA 5I77A 3KWXA 4MDOA 2D24A 1BPLB 2JALA 2VX7A 2WWCA 2D20A 3WDJA 4EAMA 1DWAM 4J28A 1HP4A 3W38A 4A3YA 3N1AA 1ITCA 3VIHA 4AYSA 4HA3A 2W92A 4C7FA 3GTNA 4Z2IA 1I1WA 3QOKA 3VGHA 4QLLA 3VNZA 3PTQA 2G41A 2Y5EA 5JBFA 1YQ2A 3CMGA 1JYXA 1EIBA 4ZEPA 5A8MA 4S3KA 1VB9A 1QHPA 3OGSA 4GO8A 1Q4NX 2J7EA 1W2PA 3BAWA 1UD4A 2E8ZA 3GH7A 4JFTA 3A4XA 1XHGA 1G1YA 2C8NA 1VAHA 4MTVA 4HU8A 1KR0A 1WZLA 3VDBA 2OSYA 1TUXA 3CZJA 1SYTA 1WDRA 5CPQA 4TTUA 3BC9A 3T0BA 1EQPA 4MNJA 2ZUWA 3WF1A 3CUIA 1RH9A 2EPNA 1JAEA 3UEQA 3DECA 3M6DA 3SCSA 4RL3A 4HTYA 3B9AA 2DSVA 1UWQA 3TA9A 3FN9A 2NSXA 3IK2A 5CZKA 3BLPX 3CH9A 3SCUA 5BCAA 4UQAA 4PMYA 3AIVA 2YIHA 2V38A 3ARWA 4UFIA 3OZOA 4PSPA 1ISVA 2WB5A 2W66A 4P8UA 3W28A 4UQ9A 5ABGA 1W9BM 3B9EA 1X6NA 4UFLA 3PZNA 1OIFA 2WMKA 1FH9A 4CKQA 1XSJA 4QLJA 1QOXA 1GCYA 3WH8A 4MJ2A 2J25A 4EANA 3WQ4A 2GJXB 1I75A 3M07A 4MB4A 4AZHA 1HJSA 4AZ7A 2WCSA 1W9XA 4CN6A 3WBEA 3LPFA 3K4DA 2YA1A 3ARPA 2YBUA 5DT7A 5DEZA 1EHAA 2XG9A 2BHUA 4J3UA 1BYDA 3AICA 1WDQA 1C92A 4P7NA 2XWDA 1A3HA 3WNOA 1V6YA 4A4AA 1EO5A 2B31A 1FA2A 2X09A 4JCLA 3AIQA 2XFFA 1H2JA 5EFFA 3VD4A 4CD8A 3QHMA 3EDDA 1WCGA 4ATLA 2XIIA 3U7BA 1NQ6A 2WHKA 5HDRA 3WDHA 3MUZ1 1QVBA 4QFUA 4DWSC 4LGXA 3ZJ6A 2DT3A 2ZIDA 1HIZA 2XVGA 3RO8A 1UZ4A 3WUEA 2DGAA 4BZYA 2W63A 4R27A 5HXMA 1V6XA 5IXEA 1JZ8A 5A1AA 5A8QA 4UCFA 4AXNA 2HVMA 1LL7A 3ARXA 1NOWA 2YDQA 1HVQA 2J47A 1E71M 2VJXA 3AIWA 3GM8A 1GUVA 1E43A 3AIEA 3CIVA 2NW0A 3UCQA 3FAXA 1UH2A 2ZWYA 3WD0A 1E6RA 1OD0A 1DWHM 1GOWA 2WMIB 2F8QA 1LG1A 1BVNP 3CZLA 2JF6A 5ABEA 9CGTA 3IAQA 1D3CA 5M3WA 2C7FA 5FL1A 1IV8A 4U2ZA 4CU8A 1JZ2A 1Q6EA 4NZCA 3T0DA 1QW8A 4ZE4A 2WC4A 1M53A 3VIGA 5LA2A 4D6JA 3WDPP 2J4GA 2PF0A 4WK9A 2WBGA 1OCQA 3ARQA 4TTGA 1E9LA 4AZGA 2JEPA 3EDFA 5IHRA 3ECQA 4QLKA 1G01A 1E6XM 2WVSA 1AQMA 1GOIA 4HP5A 3TOPA 4JIEA 3L4WA 2J7DA 1CGTA 3WNLA 4JFUA 4EKJA 2UY3A 1CDGA 3AXIA 3ZT5A 2O9RA 5EBAA 2UY2A 2BV9A 3TP4A 1E3ZA 1SR0A 2BVYA 4ATDA 1UH4A 1CLXA 2J7BA 4DM1A 4FLOA 1BYBA 2O92A 4V2XA 2FDMA 4PMRA 3LPGA 5I2UA 2BS9A 3WENA 3U57A 4PTXA 1CNVA 3UG4A 1O6IA 1J0JA 2XSBA 1QHOA 2G8ZA 5I5RA 1PZ2A 1VFMA 2QPUA 2WYSA 1FH7A 2AAAA 2YDRA 2F61A 3DYPA 1XGZA 3AROA 3VMOA 3KL5A 4GPNA 4MADA 3SCQA 2V5DA 4KRUA 4P7LA 1F4HA 2QF8A 2V3GA 3AZRA 1HXJA 4MDPA 2XJ7A 3OGVA 4Y7EA 3ZT7A 1FP9A 2OYKA 4CUCA 2BNJA 4W8BA 2J74A 4TVCA 1UKTA 4UFJA 4UOQA 3T08A 3CTTA 4EE9A 2VX6A 4AWEA 3VD9A 4CN1A 4LYRA 2A3HA 3LPOA 4W5ZA 1J10A 3N15A 2JF7A 5LA1A 4X0NA 1JNDA 4OKDA 3UR8A 2G3IA 1C7TA 1CXIA 3MSGA 2XUCA 2GK1A 2D0GA 4P8WA 4FLQA 4PMZA 2CERA 5D9MA 1WZAA 4LPCA 4L4PA 1E70M 3HN3A 1PX4A 4CU6A 2HISA 1PAMA 2ZX6A 4QDMA 3VIKA 4GXPA 2JIWA 2TAAA 1GZJA 4OOZA 2DT2A 1GQIA 3WD1A 1GONA 1C8QA 1JNEA 3PZMA 1QHZA 4KRTA 1DWGM 1EOKA 1HJVA 3BH4A 1KXTA 2EO7A 4UQDA 5GNYA 4W93A 2VR4A 3GH5A 1GHRA 4FF5A 1H4PA 3BMWA 4AEEA 4V28A 4J3TA 3AOFA 4URIA 2XYLA 4PEEA 2EPOA 2WSPA 5CXPA 1E72M 2VRQA 2O9TA 2QV4A 3SUVA 1US3A 3WH5A 2WHMA 3ZJ8A 3OA5A 4UQCA 4TX8A 3CHDA 3I3EA 1UKQA 5FD0A 1E6NA 2RGLA 4FK9A 2J78A 1WDPA 2V5CA 2YJQA 5C70A 5A94A 2E4TA 2VR5A 1V03A 1PIFA 1PBGA 1UD5A 3G6MA 1HKJA 3CO4A 3NSXA 2BXYA 1H5VA 3CZ8A 4IISA 2J79A 3K4AA 2BHZA 1BF2A 2X2YA 1Q6FA 3VMNA 2CEQA 3CBWA 4E8DA 1NOFA 3TTOA 4PN2A 1B3ZA 1TA3B 1V6VA 1JIBA 2VRKA 1HVXA 3WL1A 2ZICA 3WEZA 4E8CA 1ISZA 4PBGA 1N82A 4U3CA 3OLIA 1W3HA 5M17A 4OIFA 1J18A 1BAGA 3OLGA 1B1YA 3S2CA 3WF4A 3ZT6A 1ISYA 1ECEA 4WKFA 3WSUA 3VIPA 1CXLA 2DIEA 4AMCA 2WVUA 5A6SA 1EH9A 3K46A 2V3DA 3WEMA 3RJYA 3VGFA 3GXDA 3ZR5A 4H8HA 1LLOA 1UUQA 3ZJKA 4U2YA 3FHQA 3SCTA 2FGZA 4OUEA 1Z32X 3T2OA 3NDZA 4LYPA 2OWCA 4M8UA 3A4AA 4MB3A 5CG0A 1JD7A 1A47A 1CTNA 2DPEA 4H41A 1XSKA 4AZBA 4CCDA 1OIMA 3ARSA 1VRXA 2GJXA 2BY2A 3ALGA 3APGA 1UQYA 3PTMA 5A8OA 2QLYA 3AIBA 4JFWA 1ZBKA 3CUGA 1V3MA 4CU7A 1B9ZA 4JKKA 4YN5A 1QPKA 2XGBA 4IUGA 4B3LA 4AD5A 2YL6A 3AMDA 2AOSA 2CBVA 4PMNA 2CIPA 1ZJBA 3GNPA 1UKPA 1W1PA 1YHTA 1H49A 2BHYA 4JAWA 5CQ1A 3WMSA 1EXPA 3WEOA 1LL4A 1L8NA 2VZUA 4H8VA 5A2CA 4CVUA 4X9YA 4W7VA 2PI6A 5GNXA 5AC5A 4BF7A 1QI2A 1S46A 2YLAA 2XVKA 2FH6A 2IUZA 1KCLA 3MUY1 1V0KA 1WKYA 3QHOA 2EBNA 2VQTA 2V3EA 3KZSA 4LQ1A 4H04A 3AHXA 1QNQA 4PMOA 4M82A 4J3VA 4W89A 2XGIA 1CGUA 2WMJA 1UKOA 3K8KA 2XWEA 4PMQA 4WKAA 3SCRA 5I0DA 1HKKA 1C8YA 1JI1A 1G94A 4WLCA 5A3HA 1KQYA 2J7FA 4ZE5A 3AXXA 1U30A 4AD0A 1UR2A 4AIEA 3EMQA 4MNMA 3VGEA 5C71A 1QNPA 2CKSA 2WMFA 4J3WA 2XIBA 1V3IA 4W84A 2VURA 2VO5A 3UG3A 3LPPA 5EMYA 3TONA 2D3LA 5BWFA 1C3FA 3JUGA 4UZUA 3S6TA 5BXPA 1ISXA 2DSZA 4CD7A 4JKMA 2E9MA 3ALFA 1E40A 1M03A 2VCAA 4ZENA 5I24A 1V0NA 3AMKA 1BGGA 1HJQA 3AXHA 3W6LA 4RE2A 1JD9A 3O9NA 4HZ8A 1R7AA 1MQQA 4ACYA 2BXZA 1E4LA 2VZSA 3WNMA 1LJYA 1WB0A 6TAAA 1SMDA 3PZUA 4PTWA 3ZSSA 1B2YA 5JUVA 4E4PA 1US2A 5BROA 1DP0A 5E0FA 1KBBA 3EMCA 3VU2A 3L2MA 1EDTA 3VTRA 1FP8A 2VQUA 4F9JA 1MW2A 3II1A 3WQ6A 3RM8A 4BA0A 4H2CA 1E1EA 2BFGA 1XCWA 4W8AA 4PMVA 4GI8A 5GQBA 2E40A 1GHSA 2VL4A 2XM2A 2WVVB 1GPFA 5D9NA 1UKSA 5E6ZA 1QI4A 1UQZA 2ZUMA 2PB1A 3NSMA 3SIMA 3VIFA 5A6JA 1KB3A 1XYZA 4OBRA 4UNIA 4XUYA 2VZVA 1G0CA 4AW7A 4DWSB 1TG7A 1GVIA 1FOBA 8CGTA 3ZR6A 3OLEA 4ZXLA 1FHLA 1MFUA 1E5NA 4HOXA 2WANA 5E09A 3CHEA 4NRRA 2A3BA 3N11A 3DC0A 4CD4A 3RCNA 2DDXA 2GFTA 5IFPA 3J7HA 3ZO9A 4KH2A 2X1IA 1CGVA 2UY4A 3W0KA 3SCVA 4F8XA 2NT0A 4U31A 4CCEA 1UR1A 1M04A 1DHKA 5I6SA 2XTKA 4GINA 2F2HA 3KE0A 3BCDA 4GI6A 2O9OA 4W87A 5A6BA 4Q7NA 3W25A 4CD6A 3K1DA 3CUJA 1DWFM 1GVYA 3GZAA 3N12A 4HU0A 3MS8A 5DF0A 1HL9A 4BQ3A 1LWJA 4W88A 2ZXBA 1W1YA 4LXFA 1VBRA 2WHLA 1UR0A 2WMGA 1E4MM 3MMWA 5ABFA 3WQVA 2Y4SA 2DH2A 1VFUA 4BQ4A 5I78A 3AHVA 1KWKA 3F4VA 2WC3A 4PUDA 3EDKA 1BHGA 2PWDA 1ZJAA 5DO8A 4B9YA 1MW0A 1W1TA 3QR3A 3DHPA 3D5HA 3RILA 2G4FA 3M46A 2WLYA 2EXOA 3VINA 3CLWA 1MQPA 1TA3A 4AD2A 1ODZA 3DYOA 3WUFA 3VIMA 4UOJA 3PZTA 3VPLA 1OSEA 7A3HA 3AHZA 1B31A 1NP0A 3W27A 1UWUA 3WDRA 1QW9A 1GOOA 5M03A 4AISA 3NUKA 3RPMA 1CECA 1OGSA 3WELA 3WIJA 3L2LA 3O6AA 4TX6A 3PZOA 1M7XA 3U5YA 5C8BB 3U5UA 1AQHA 2PC8A 4UR9A 3MV01 2VX5A 5JBDA 1V0LA 3VO0A 3WF2A 1WNOA 1CGXA 1LG2A 5F7UA 4D6EA 3I3DA 4CVWA 1UR9A 1HN1A 1UWTA 3NSNA 3WY1A 1XD0A 1LQ0A 3EDJA 3VDCA 1JGIA 2E3ZA 4UZSA 2CPUA 1CGWA 1H3GA 5HPOA 2CBIA 1OM0A 2A3AA 1JDAA 4J3SA 1FFQA 4RE4A 1K9TA 3W29A 4GZEA 4YPJA 2X0HA 5CGTA 5D4YA 2D22A 1UD6A 4WIWA 1BLIA 3WDQA 1KR1A 1QNOA 3MUIA 7CGTA 5DMYA 2JE8A 2DSWA 1ODUA 1KGUA 2XFYA 2OYLA 2PWFA 3L4XA 5BXSA 2J7CA 3TTSA 4JL1A 3VGBA 4PMUA 4F79A 1LF1A 4GQQA 1TFVA 1V02E 3VX0A 1GNXA 1JZ4A 3B8SA 1E4IA 3ARUA 4PCTA 3D3AA 1PJ9A 3OLDA 4MAVA 2VNCA 2WCGA 2Y8VA 2WBKA 1MW1A 1B3XA 2W61A 3O2LA 1V0MA 4P7QA 3VDAA 4TOQA 5A8PA 3UERA 3IJ8A 3WMBA 3AHYA 5CGMA 2E8YA 1E6ZA 2FGLA 3RIKA 1UWIA 1V3HA 2XVPA 3SCWA 1IT0A 2UWFA 5FKYA 3TTYA 3A47A 1MW3A 3VUPA 2XM1A 1E3XA 2CESA 5LYRA 1WPCA 4UQBA 3RM4A 1H0GA 3VGDA 3BXWA 2ZXAA 1UD8A 4BS0A 2XFRA 1KXQA 4MNLA 2BVDA 5HNNA 4CCCA 4M1RA 1ZBWA 4XX6A 1CGYA 1CPUA 2BY3A 5A2BA 4P7OA 3OBAA 2VX4A 3CMJA 3PZ9A 3AZTA 3IAPA 5JIWA 1M01A 4KMQA 4HZ7A 1BG4A 3AS0A 5ABFB 4MB5A 1G9HA 5JBEA 4AIOA 4MPKA 1MWOA 1UH3A 3MU7A 1K9FA 4D72A 3VILA 3OGRA 1OINA 1KXVA 2WMHA 5BRPA 1UWSA 2G3MA 2GVYA 1EDQA 2PWHA 4AEFA 2VC9A 3W82A 2YA2A 3A4WA 5FCZA 4M56A 4AD4A 2WCAA 3A6OA 4DUWA 1MXGA 1V08A 4KWUA 3L4TA 1ISWA 3MANA 3SCNA 4ZXOA 1TVPA 4WSKA 1NP2A 3W81A 5A6MA 2FHFA 2VRJA 4E2OA 1X6LA 2VMFA 1WZMA 3NCOA 4QP0A 1U33A 3KL3A 4JL2A 3BAJA 5CSUA 1ZU8A 5A69A 3GXIA 2ZX8A 1JF6A 3WL0A 3WH6A 3AS1A 5TD4A 1J11A 1J0YA 1QBAA 1JFXA 1RD6A 1KXHA 4XZWA 2EPKX 2ZE0A 3FNDA 4B9ZA 2WVVA 4K68A 3W26A 2YKKA 3PZQA 1OGBA 2ZXQA 1E6QM 1ESWA 1ZBCA 5GNZA 1J01A 2W62A 3MMUA 3THCA 2CYGA 1NWSA 1CXFA 3NJ3A 2W4XA 5D8ZA 2CCRA 4DWSA 2D2OA 3BSHA 3AIRA 1W1VA 4TVDA 3BAKA 2ZUSA 3QHNA 2C0HA 1FFRA 5D9PA 3MKKA 5A6BD 3ARVA 1JDCA 2WPGA 1R85A 4ML4A 2D1ZA 3VD5A
chains in the Genus database with same CATH superfamily
3IEBA 3MP5A 4DLMA 3GDBA 3SN1A 1E73M 2VEIA 4O57A 4N4PA 1VPQA 3O16A 2XPKA 1CX9A 3XIMA 1QK2A 1U1HA 4FZIA 3U2EA 3VI2A 2HBXA 4N0RA 1ZFJA 3QVQA 1H0IA 3VM5A 2YXGA 4B5WA 3N9RA 1IXQA 3BAIA 4B5UA 2V2DA 3UZJA 3UWWA 4YVPA 4JTDA 4C1NA 2YFNA 2IXUA 1JG9A 2Y7FA 3FJ4A 3LTSA 1UYQA 1C8XA 1O66A 2YDSA 5CPNA 1D7FA 2EGZA 3MWCA 3OZMA 2BY1A 4A3UA 3EPNA 2OLHA 3ARYA 4E0CA 3RU8X 4C6PA 4ZB5A 1NF0A 1LRQA 4X63A 2Z0IA 1A3XA 3MZ2A 4L9XA 3WDIA 2YL9A 2PGFA 3CV2A 2GSEA 3W24A 3WQWA 5HNUA 2A5HA 1TPUA 3N6JA 4NRSA 5MKGB 3MI2A 3CMFA 4NP7A 3E5PA 5BW6A 3IUHA 3MJYA 3TYEA 1RV8A 1MVYA 3OG3A 4JY8A 1AW1A 3MPGA 2FVLA 1EGVA 3WLHA 3EB2A 3GDMA 1DBTA 3R2GA 4BQ2A 2YCLB 4S3FA 3BW4A 3VC5A 1D2KA 1TPC1 1VFTA 1BTCA 1QO2A 5AHMA 3CZEA 1E5JA 2VELA 3UESA 1CWYA 1YYAA 4HPNA 3L4ZA 3CQKA 5KEZA 4P7RA 1NOUA 3ZLFA 3VOCA 3V75A 3PNZA 2V81A 2NUYA 1KWGA 4AD1A 1B0IA 1QPQA 4G7FA 3UPBA 2HS6A 3ZWTA 1FQ0A 3TCSA 4C5YA 5F4WA 2PDGA 4NZ3A 3W53A 3B4UA 2YLLA 4AXKA 4GIEA 2WVTA 1RVGA 1GQKA 3M0VA 5TQLA 4GI9A 2RJHA 1U5JA 4HA0A 3GRIA 3CLMA 2EKCA 1AMYA 4H00A 3VNYA 2CHNA 3NQCA 1DJWA 1XH0A 2FLIA 3I3BA 1QUMA 5C9ZA 3W84A 3VNIA 3SUUA 4EWJA 5KZEA 3M0IA 5I09A 2FQIA 3BLFA 4GE8A 2SFPA 3S42A 1AW2A 1BF6A 1TZ7A 1WDSA 1OBAA 3TYBA 2QR6A 3AS2A 1J0HA 2PCEA 1XYFA 3HMCA 4GFSA 2X05A 3C86A 4ZQNA 1VJSA 1PX8A 1X7FA 3ABQA 3TJXA 4PYSA 4RXGA 3SUTA 4E3VA 4E38A 3EPMA 1ZBVA 1XRFA 4Q8VA 3SIZA 1HF6A 1O7AA 2PGRA 1U2YA 2PURA 3FAWA 4M3PA 4O52A 3N9KA 4PCPA 1GVEA 4J27A 1HL8A 3FX4A 1XFBA 2RUSA 4UMCA 4LALA 1GOXA 2I1OA 4FIQA 2W91A 1C91A 3QC3A 3OZPA 1IGSA 2DH3A 5DFAA 6REQB 4AQLA 3Q37A 2G5WA 4X2PA 1OCJA 4JZ5A 5KMYA 4JTLA 4RZ6A 5EMLA 3PZIA 2ZUVA 3ZSTA 4R7WA 4RJEA 3VE7A 2X1TA 3LB0A 2WZHA 3UETA 3HURA 2UY5A 1LYXA 3D3FA 1H62A 4PUEA 2KAUC 2D23A 2RAGA 4GY0A 4F0MA 1FXQA 3BICA 4LRSA 4JGDA 1UROA 3TMLA 4B15A 2DQXA 1JCXA 4EACA 2ZUNA 3W01A 4FA3A 4IL0A 3DFOA 3C56A 2QZRA 4UFHA 3QMTA 1JPMA 1PKLA 1RXOB 1QO5A 1OFEA 4L64A 1DV7A 4CEXC 3PJWA 2J75A 1I45A 3AYTA 4LUSB 2AQOA 2OEKA 5E0CA 4DWSD 2D0HA 3CUXA 4P8VA 5TBOA 2E7FA 1S1RA 3LGEA 2GQ9A 2FZ9A 5CJ5A 1OVDA 2PDBA 1OYBA 3VD3A 4F9DA 4C7GA 3EKZA 3B97A 4DBDA 4WKHA 2WOQA 2Q8XA 3HJEA 2Q8LA 3ZOAA 3C0LA 1AMKA 2VEKA 1Q6QA 1XCFA 4F40A 3UWVA 3H4XA 5EMKA 4JTAA 1VJZA 1XC6A 4LC6A 1PIIA 1FCUA 4JTIA 3GD6A 1D9EA 3CV1A 3LXAA 3CQIA 4LB4A 4QDPA 3WJZA 4ERAA 3MHGA 4IGHA 3PTKA 1EPVA 3LZ5A 3PBGA 1FHDA 1J0KA 4MZYA 3PWIA 1ME7A 4G2DA 1S1PA 4Z1YA 1CYGA 4M7TA 4HHLA 1H61A 2PDNA 1NWRA 1GWJA 1G4TA 1RK5A 2FIQA 2R1LA 5C55A 1XYMA 3ZM8A 3R0UA 3KP1A 5G1YA 1NDZA 3VIOA 4A6GA 4O8RA 3TDFA 4YWSA 3F7JA 4GZIA 4PRRA 2PDLA 1O68A 3CUFA 1P0NA 1UCWA 3WN6A 1XC4A 3T42A 3CAWA 2W79A 4H8NA 2ZRWA 3REQA 1TWWA 1MYRA 1HL2A 1YXYA 3T2PA 4CLMA 4HGXA 1UZ1A 3BW2A 2J6VA 4Q6XA 1GPWA 5I00A 3T0CA 5IFTA 1I9CB 2CXGA 3KVMA 4HMEA 3WBAA 4IQDA 1GKQA 4XV0A 3DYMA 2ISDA 3BLLA 1K9DA 4QISA 2ZX5A 3HG2A 3CT7A 1FCBA 1XDLA 3WLIA 4LX4A 4Z1DA 4Z42C 2NV1A 1P43A 4TO8A 4HSOA 4JEQA 3BGAA 2YB4A 4LV9A 5BOOA 3RNDA 3DIPA 2CLKA 1E6PA 4JR5A 1I60A 1QNSA 4PTMA 4EXBA 3PBMA 4LVFA 3TTEA 1AH4A 2OPJA 3MDUA 3NZQA 5CBBA 3DCPA 2BTMA 1BSIA 5D33A 4XD4A 1R3SA 3GW3A 4ZBCA 4AZ5A 4V15A 1JPDX 2WHJA 3S1XA 3VUSA 2DSUA 1H63A 1CENA 4PUKA 2GVGA 3HGOA 6A3HA 2WM0A 4KWVA 1IHIA 2JIEA 3B0VC 2XVLA 4DUXA 3FY1A 4JTQA 4BY3A 2DSKA 3M4HA 4JFSA 1AJ0A 3Q45A 5F1UA 3AYSA 2D2JA 4Q33A 4PTVA 4QE5A 1KCKA 3WBXA 2QCMA 2IPFA 4H6QA 2BOEX 4BEQA 2I9EA 2OQYA 4JTSA 4I9JA 5ABTA 3PJUA 2DT0A 3KOWA 2EG6A 1JYVA 1AZ2A 5DY2A 5U7SA 3HIJA 4LCSA 4HPGA 4B5SA 2QUNA 2X40A 4DPQA 1F6KA 4CQBA 3CAKA 4WCJA 3VNMA 4KESA 4HNVA 3LSBA 1CIUA 3R25A 1O1HA 4I7VA 4FALA 3C0SA 3IJQA 4LAZA 2QDHA 2VUYA 3LCXA 1O5XA 1LLZA 1UG6A 4PA8A 5H8UA 4U28A 1UR8A 2I9UA 1KBLA 4GC3A 2WJDA 1GQLA 1YDOA 2HDJA 3P7YA 2Y6ZA 5LKYA 4XKYA 4DZIA 2I57A 4Q7IA 3GYEA 4EIVA 4UTTC 2BBFA 2PP3A 3GTIA 1TR1A 1O5RA 1UZDA 4MWAE 5TF0A 4NZFA 4IOTA 5H91A 3FOKA 2Z6IA 5JH2A 2W6RA 1XCXA 1IXOA 2OZ0A 4NAEB 5HPCA 2YOCA 1QATA 4JIPA 3DHFA 2GGIA 3HGJA 3UG5A 3P62A 3CT2A 3N13A 4S38A 5BMWA 3ABRA 3BJSA 2DZXA 3LU2A 4JCMA 4DJFD 5HR7A 4NNCA 4GQRA 1TYGA 2YXXA 2NX9A 1TMQA 2Y0FA 1VYRA 3VDGA 1YE6A 3OVPA 1TQJA 4QIUA 1KW1A 1PTDA 3NG3A 1L9WA 4H1ZA 3BSGA 3WZ0E 2FJUB 4PCNA 1F9CA 4DPPA 1T41A 1TCMA 4NNBA 1A5LC 2ZXDA 2NQ9A 3WCZA 2DUAA 3IGSA 2RKXA 3UU0A 2HNEA 3HPSA 2AKMA 3M0HA 1AQ0A 3WLSA 1JPIA 4UR8A 4LSBA 6PTDA 3EZ4A 4RPQA 4U5KA 5BXTA 3WQGA 1UZHA 3ISIX 2PDCA 1H1NA 4FI4A 3WD2A 2YZ5A 1GW1A 2QJJA 3VZYA 2JEQA 4JN8A 4XTDA 4BWLA 3EOLA 4K7VA 3EBVA 1GJUA 3B9DA 4I5XA 5TIMA 3CNYA 3ATYA 2ONEA 4MGGA 4LCRA 4P61A 4LNCA 3Q65A 1XIIA 5C9XA 2D20A 4Q8UA 1L2QA 3M0XA 4L1WA 4L7ZA 4J28A 1VCVA 2VEPA 3W38A 4UWMA 3EX6A 3G3DA 3N1AA 1ITCA 4C7FA 3QOKA 3MVIA 3TN4A 3BVJA 3T55A 3V36A 3A3WA 1B54A 2A79A 4R9XA 5A8MA 1AD1A 5I06A 4G7EA 4DX3A 4XWUA 2OKTA 2ZRYA 2E25A 1UD4A 3GH7A 1O94A 2C8NA 3NGJA 4DO4A 1KR0A 4G1KA 3CZJA 3IJLA 4QG8A 4CEUC 1V93A 3BC9A 1EQPA 4WSHA 4MNJA 1DIEA 2ZUWA 4B5NA 3CUIA 3CQHA 1JAEA 1TJ2A 1XIFA 7ENLA 5FJIA 1ONRA 2E6FA 3SCSA 1NQKA 2YX0A 3B9AA 3H2AA 3PSVA 1UWQA 2P0IA 3ONCA 4Z0JA 3DH7A 2YW3A 3BLPX 1J2BA 1LDCA 1GVOA 3UNTA 3R6IA 4HU4A 3ARWA 3TYCA 4H4IA 3W7OA 2W66A 5H6HA 3W28A 4UQ9A 1G67A 1W9BM 1F73A 3B9EA 4UFLA 3EWXA 4FR1A 2IPGA 2IQTA 3KP0A 1XSJA 3LHTA 1QJWA 1XLHA 5HMDA 2OZ3A 3GXTA 2PLJA 3M07A 2ZA1A 4QR6A 2VFIA 2WCSA 4CN6A 1ITQA 5K3VA 3GS6A 3TKFA 2XH7A 3LPFA 2XG9A 4DAFA 3P82A 2IKHA 5G4EA 1BYDA 1LRTA 4UTJA 1FA2A 1DJZA 3W02A 2XFFA 4CD8A 3QTPA 1EUAA 3E12A 5HDRA 4GRSA 3WDHA 1KCXA 3MUZ1 4DWSC 2OJPA 2XVGA 2PZNA 3WUEA 3IUIA 4GVFA 5IXEA 3ZLGA 5FAJA 1JZ8A 3QW4B 3IRSA 3ZWSA 4XAGA 4FX8A 2E28A 2VJXA 3P5YA 1DJYA 3UP8A 3FAXA 1UH2A 4PC8A 2PA6A 2ZWYA 3IIOA 4PZVA 4DF2A 3GNNA 2HTMA 3AUOA 1F5ZA 9CGTA 2C7FA 3OQ8A 1VFHA 1IV8A 4U2ZA 1TV7A 3KWSA 5K4XA 1LBLA 4NZCA 2EG8A 4MPQA 4PUNA 1OCNA 1Y5WA 4ZE4A 5LA2A 2J4GA 4PR4A 1VYPX 1E9LA 1V4YA 4DRSA 1AQMA 4HP5A 2Z00A 3HV9A 4N9EA 4RKAA 4JIEA 1HTIA 2V30A 3G22A 3AXIA 2HK0A 1WDWA 3N2XA 3OZYA 4ZA0A 1E3ZA 1SR0A 4AFYA 4RK8A 3P6LA 1W5QA 1UH4A 5HJXA 4ML9A 4FLOA 4CNPA 4JX5A 2CLOA 2FDMA 3CQJA 1OFQA 3LPGA 5I2UA 2OU4A 1JDEA 1W31A 2HE8A 6ALDA 2Z28A 1J0JA 5EKYA 2DP3A 4DBEA 5I5RA 2J6XA 2TSYA 2QPUA 1FH7A 3QR1A 2F61A 4LS1A 1M7PA 4CQDA 3R7MA 4AMAA 1YTDA 5FEWA 1H5YA 1PHWA 4KRUA 1F4HA 2V3GA 3CIXA 4XO7A 2BASA 3QPZA 4G5DA 1MEIA 2GVEA 5AHLA 3TYZA 2CHRA 4W9TA 2PODA 4IXHA 5C2CA 5C5YA 2VGGA 2VX6A 1OY0A 3VOHA 3S1UA 1LBFA 2A3HA 1R6WA 5FJJA 4AX7A 5E93A 4W5ZA 1J10A 3N15A 1ONEA 3PBYA 1A5UA 2XH4A 1JNDA 1R2TA 5EMJA 4LUIA 3UWUA 1CXIA 1KM0A 5DBTA 3TN5A 4AB4A 2D0GA 1AK5A 4FLQA 4B5XA 3C3UA 2CERA 3W7DA 3LD5A 4XAPA 1FY6A 2WO5A 2WSRA 5SWUA 1TWIA 3HN3A 5AOUA 1M68A 4CU6A 3NDOA 3MCNA 4M19A 4FX7A 3UD6A 5AHNA 1GZJA 1GQIA 3BLIA 1C8QA 1EPXA 2UV8G 2C79A 1VYSX 2Y1HA 3BH4A 5C2GA 4W93A 2AAMA 3HV8A 1BEUA 1VHCA 1H4PA 1TV4A 4YTSA 1DKWA 2QS8A 2EPOA 5IOBA 4WY0F 2VRQA 2QV4A 2AGKA 3V1HA 4A8RA 5IRPA 3WH5A 4KETA 3W1NA 2PP1A 3WK3A 1H60A 5ENLA 4NJJA 5RUBA 4GYKA 4LAKA 5FD0A 3WO8A 4UTIA 1W17A 4FK9A 1A4MA 4HQVA 2J78A 4PEKA 5C70A 5A94A 3LA4A 3LV6A 2NUWA 3CYVA 1IXNA 1PBGA 5BMXA 4EF8A 3NSXA 1REQA 1A3WA 3CZ8A 4IISA 3MYPA 2J79A 3K4AA 4RV8A 4GY7A 2BHZA 4HCDA 1BF2A 3KX6A 1UIOA 1ZALA 1IT7A 3CBWA 1NOFA 3BZGA 2V82A 4M5PA 3TWBA 1TA3B 1J79A 2PDPA 2VRKA 4J9JA 3VCNA 3WEZA 3JZUA 2R6OA 1W3HA 5EMUA 4R3UA 3ZT6A 4AMCA 1I2NA 4UTLA 3BARA 4KQNA 2C1HA 2V3DA 4PTNA 1R38A 3C2FA 1UUQA 3ZJKA 1WUFA 3SN4A 3IIZA 2FGZA 3ABSA 3IS4A 1FRBA 3TUUA 1QOQA 2ALDA 2QJMA 2OWCA 4MB3A 4IH3A 4KIRA 1A47A 1XSKA 4GUFA 3SGUA 2IKGA 2TPSA 4DJEA 3O63A 4FNUA 1L6SA 1XX1A 1VRXA 3B9OA 1RCXB 3TE9A 4HB7A 4DJFC 4MM1A 3G1FA 3TLLA 3QFWA 1SW7A 1UQYA 3IWPA 5A8OA 2QLYA 1EX5A 1RD5A 3DDMA 1B9ZA 4IMEA 4Q3MA 1MXSA 3V5CA 2XGBA 4IUGA 3E0LA 4S2CA 3CAQA 2YL6A 2QJGA 3W7RA 3AMDA 4PMNA 4Y6GA 1LOSA 1K8ZA 2Z7GA 1N7KA 1W1PA 4IJBA 1EXPA 4FXJA 2VZUA 3R0DA 4CVUA 2PI6A 1TZ9A 3G2GA 4IGSA 4Z0SA 3GDKA 1ITUA 4MKVA 4BF7A 2IUZA 5BOEA 3MUY1 4J40A 3QHOA 1TPDA 3LRMA 2VQTA 3B8WA 3KZSA 4LQ1A 4ZQRA 3RLGA 1R9YA 4GVIA 1P7TB 4RX0A 2FZBA 4M82A 4J3VA 1CGUA 2J13A 4Z08A 3M7WA 5J8LA 1IEVA 2XWEA 2BG5A 2QT3A 4WKAA 3SCRA 5I0DA 1JI1A 4J5NA 3C0JA 5GJMA 4REQB 2Q3OA 3AXXA 3LHYA 1YW1A 4E6MA 2FB2A 2EAWA 1D3HA 1Q7QA 3NPVA 5C71A 1QNPA 4QNEA 5D32A 3KTCA 5JU6A 3UWYA 1HKVA 3TONA 5CC7A 5BWFA 1VHNA 1N55A 2YGYA 2QUVA 4DB7A 2HEJA 2A0NA 1IGWA 3AAMA 1R3VA 4CD7A 2P8BA 3UXAA 1F7BA 3BLDA 1E40A 1M03A 4C6CA 3B40A 1HJQA 3AXHA 4RE2A 1VS1A 2NQJA 2ZDSA 3D47A 3O9NA 1R7AA 1ZY9A 4FOJA 2Z27A 4US5A 2BXZA 3K2GA 2ODOA 1UR3M 1E4LA 5IBXA 1WB0A 3TSMA 2GWGA 1SMDA 4Y90A 3PZUA 5MF5A 1B2YA 2CXEA 4Q4MA 2C13A 2VYOA 1YBQA 3VU2A 4O18A 3L2MA 3PANA 5EL1A 1HZYA 3UJEA 3EX1A 3ZZ1A 1MW2A 3RM8A 1E1EA 2BFGA 4W8AA 3VKAA 4IWWA 2XM2A 1GPFA 2GUBA 4YWIA 1XRSA 4KPLA 2PB1A 5AB3A 1VD6A 1KB3A 1UWAA 4PB5A 2VZVA 4F48A 3NQAA 4JQ3A 4PMJA 4DWSB 3BOFA 4IPJA 8CGTA 4C1LA 4S3DA 1FWFC 1EYWA 3HF3A 1KTCA 3DFQA 3ATZA 2QIWA 3O8AA 3AWOA 4NRRA 3N11A 4HSNA 4CD4A 1DQUA 4QSFA 1R0MA 4PL1A 5IFPA 1SVDA 2X1IA 1JJKA 2UY4A 4M51A 4XSMA 4XIMA 3A24A 4XD6A 3TAKA 2RH9A 3S2NA 2QCDA 4YYCA 1XIMA 2XTKA 1RAKA 2F2HA 3BCDA 2BOGX 4NYYA 2O9OA 4W87A 5A6BA 4XZHA 3W25A 2A1YA 3CUJA 2HQAA 1XIBA 2FGBA 3P80A 1I2QA 3N12A 2DVUA 3NPWA 1EJSC 4PBEA 3MS8A 1LWJA 5FJUA 2XIJA 3NL3A 1RALA 1WKDA 1W1YA 2V6AA 2WHLA 1DIKA 2WMGA 1E4MM 2QEZA 4WOQA 5HWMA 3WQVA 2BGQA 3LBMA 3R8RA 1KFKA 3F4VA 2FMOA 1ZJAA 3SI9A 3D5HA 3RILA 1K4GA 4ROPA 1SFJA 1XLEA 3VINA 3PF3A 1P0BA 1XJBA 3BPWA 2OQLA 1YPIA 1MQPA 2YR1A 3N3MA 5LIUX 4AU0A 2V2HA 7TIMA 1K7XA 2Q09A 1ZRQA 4IUOA 3IJDA 4H9YA 3ZVHB 3LHVA 1SSGA 7A3HA 4MMWA 3F2BA 1WAUA 3UJ2A 4AISA 3WLTA 3NUKA 3LQLA 4NG3A 3WELA 1M7XA 1C29A 1ADOA 3S5OA 1R5YA 2V8ZA 3CM4A 3USBA 3IIPA 3UR5A 1LG2A 3E0WA 3M6YA 3I3DA 1F07A 1UR9A 1H1ZA 1HN1A 1OX4A 2Q71A 3WY1A 4QE4A 3PWGA 4C90A 2CPUA 4DUOA 4N02A 3NTYA 3CB3A 1OM0A 2A3AA 4J3SA 1XLKA 1E0UA 4DBSA 2VC6A 3STFA 4IX2A 1UD6A 1BLIA 2HSAA 1W1A1 5DMYA 2JE8A 3HQ1A 2OO0A 1TJ0A 2E5DA 1ODUA 4IIDA 3M9YA 1XQKA 1G7VA 4JL1A 2MNRA 4PMUA 2FDSA 4ZB0A 2XGZA 3AUJA 1TFVA 3M0KA 3VX0A 1JZ4A 3PAOA 1E4IA 3ARUA 3C4UA 5CBIA 2J9ZA 2Y8VA 1B3XA 2W61A 3O2LA 4X3ZA 3IUDA 4TOQA 5A8PA 3WMBA 3MDWA 4RCXA 3BLOA 3RIKA 1UWIA 1V3HA 1EL3A 2XVPA 2WQDA 1IT0A 2UWFA 3CPGA 1WXYA 1A80A 2WSYA 3TTYA 5EBUA 3A47A 3VUPA 2J24A 3R5EA 1K8XA 2XM1A 1E3XA 4C1KA 3NO5A 1H0GA 3AC0A 1UD8A 4BS0A 2YW4A 2BVDA 4WD0A 3GU2A 3MC5A 4CCCA 4M1RA 1LTDA 1SR9A 2FTYA 1YXDA 3EXTA 3OBAA 5CAHA 2VX4A 5JIWA 1RJPA 1BG4A 2C0AA 4ZMGA 5HNRA 2CLLA 1ZNNA 1G9HA 1ME8A 1LZOA 4AIOA 1QMLA 1YADA 1XLJA 2ZZ2A 1PV8A 1OINA 1W5NA 1S3TC 5BRPA 4ICMA 3DFYA 2V2CA 4AVFA 1EDQA 2POZA 3TLQA 4AEFA 3W82A 4R33A 3PS7A 4HNTA 4XD5A 3GIPA 1ISWA 1L6YA 1GVFA 4GGBA 4JTKA 4WSKA 3UWQA 5A6MA 3C2YA 1G7UA 2FHFA 2VRJA 4E2OA 1P5BA 1TTPA 3UZYA 4TIMA 1WZMA 4QP0A 1U33A 3BAJA 5A69A 1VRDA 3H4GA 1J11A 1LROA 3SB0A 1JFXA 3Q94A 2ZE0A 3PFMA 4CQAA 1GK8A 5G2WA 4RNIA 1THFD 3W26A 3Q4DA 3KUMA 3DFHA 2FYMA 3PZQA 4O0KA 1OX6A 3TNOA 3MMUA 1QWKA 1YNYA 3TQVA 3KBJA 1J2WA 3EWCA 3CEUA 3TFXA 3PTDA 3AIRA 2GDQA 3BAKA 4BI7A 1FFRA 3MKKA 4ROQA 1GTHA 2QDDA 3ITGA 4ML4A 2D1ZA 3LM3A 1W8SA 3CJPA 1NF7A 4MAZA 3O1NA 3NA8A 3GK0A 1AFSA 3PPGA 2QVHA 4GCXA 5CLWA 3AFBA 2BLEA 2DZWA 2WKLA 3NDYA 4O1AA 3CHFA 1H51A 2ZZ5A 2ESCA 3LRKA 1J5TA 1OB0A 4A22A 4ZL1A 3O06A 4L1XA 4LVBA 4AY1A 2O9PA 2PPGA 2RFGA 4G1NA 3VIJA 3MHFA 4G56A 3AZSA 5KITA 1VFOA 4ZODA 3A3XA 4IFOA 1VJIA 3RFAA 2P53A 5D2TA 4GXWA 3NVDA 4DJDA 3EMZA 1L6WA 1BXNA 2EPMX 5H1WA 5I79A 2VD9A 1YMYA 3CC1A 2RDWA 3NPXA 2FH8A 3TK7A 1VBUA 2IQDA 3OIHA 3UY7A 3M0ZA 4A21A 4IP7A 4YLWA 1L6FA 1MEWA 4POCA 4IPLA 4OZOA 2E67A 3M44A 1XBZA 3CASA 3DUGA 4FLRA 4XISA 2PDQA 5JMUA 1RR2A 1TPFA 4MNKA 1B9BA 4BF5A 2VFHA 1OF8A 3UZWA 4W7WA 1GYNA 3S9YA 2QPXA 1NM9A 3SFKA 1JQVA 3CEPA 4K8HA 2ZX9A 5HULA 1UUMA 5BRQA 2X8RA 1XICA 4GOAA 1J6PA 1Q6CA 2ZFAA 2QF7A 1HT6A 2F38A 1WV2A 1L8PA 1QFEA 2B7PA 4D1IA 4DN1A 3NGFA 1QASA 4EK7A 3GVVA 3CUZA 1V7YA 2GWNA 2QPSA 1LLWA 3HBLA 1PYMA 4ACZA 4OVXA 3WLJA 4O0ZA 1QOPA 3DN5A 3LENA 1DJQA 4MF4A 2V5JA 5AHIA 1M7JA 1R30A 4S3JA 5AC7A 4HHMA 5CZ0A 4HOZA 2H90A 2VCCA 1XRVA 3MT1A 5KETA 3VVGA 2GOUA 2PS2A 2Y2WA 3WLPA 1UD3A 1YRRA 3G77A 3C2OA 1HKIA 3HG5A 4HPXA 2WXDM 6TIMA 2Y62A 4HMDA 1JXJA 3VKBA 2ACQA 4L4OA 3DGRA 3T8LA 3LRLA 4PMDA 1LP6A 4X22A 3LCFA 3M64A 5K7JA 2C16A 3GNDA 3MVTA 1W3TA 4QAIA 5C7HA 1QAPA 3W6MA 4GH3A 2OCZA 2OT1A 4A29A 1EBHA 3VOFA 5FIPA 2P1FA 3BWWA 1XR2A 3P81A 1JGMA 1VBHA 3LG3A 3GG8A 1L0PA 2NQLA 2F9RA 4WDWA 3F5KA 4B2DD 2E6AA 5CPTA 1CBGA 2VVSA 2Y8KA 4H7VA 1DWJM 1YXCA 1RQBA 2YZRA 1TVNA 1ZAIA 2ZWZA 3TYDA 5LNVA 2B81A 2X1UA 4GYJA 2VGFA 4S39A 1FHUA 1NFGA 4L9ZA 3WNPA 2Z7KA 3QBUA 2YL8A 1FWHC 3R10A 3EYPA 1BYCA 3B0PA 3PPCA 2DT1A 2VR2A 1V6TA 1RJQA 2GGGA 2AL2B 2XISA 4M6VA 3FJ6A 4MJ4A 3PAJA 4PODA 3F5JA 4EP8C 1A5KC 5D8WA 2VWTA 1TR9A 1E55A 2ZCGA 3WD4A 4DYEA 5M1TA 3SCPA 5T9BG 2FKPA 4FR6A 3LXCA 5I23A 2VTFA 4Q4RA 4F66A 1NEYA 3UBPC 3T0AA 1C90A 2WWDA 3QN3A 5LNRA 3THDA 4S3BA 3USZA 4TX9A 4D71A 3I6RA 3F5LA 3K5XA 1HKMA 1R86A 1TRIA 1E0TA 3N34A 2E9BA 2OX4A 1EA0A 5F1VA 2RDXA 4NSBA 1Z41A 4F4RA 2Z1WA 2WAGA 1RLCL 5CC6A 4AZ6A 4N4QA 1GORA 1B3WA 2PP0A 2RJGA 3EEGA 2VGBA 2QJIA 3FJLA 4I9AA 1LT8A 3CQ0A 1IIHA 1C7SA 3LLXA 2VDIA 5FACA 3HMJG 2GVJA 1XRTA 4JNMA 3DOPA 3K13A 3ES8A 3HGSA 1H11A 4TV6A 2REQA 1XH1A 2O55A 4Z2LA 2OSXA 2RHGA 4Q6JA 1UD2A 1O4UA 3JS3A 1PKMA 2C6QA 3S6OA 3S8HA 1TWZA 3L4YA 5C9UA 5HUPA 3B06A 4FPSA 1V6WA 1K6WA 5A95A 3KVKA 2CITA 2XN1A 3AISA 3DC8A 4MYAA 1PX3A 4S3CA 1H7NA 3NOEA 1BSLA 2R14A 3ARTA 3GG7A 3M0LA 3TYUA 5FI8A 3EKLA 4GYPA 3GWQA 3WLOA 4AUBA 4ZFMA 4L6DA 4YTTA 2PWEA 3MUXA 3VIIA 1QTWA 3KDOA 3W1RA 4IPNB 2DJLA 5CSYA 4O4VA 3S47A 3ANVA 2JK2A 3N29A 5I07A 1W3LA 3NIYA 4BWLC 1GVSA 3PN8A 2FVMA 4DAIA 5G2HA 2WZEA 4DUVA 1V3LA 3UXDA 1R9XA 1CXHA 3VMPA 2A3CA 1DJHA 3KCJA 5I3GA 4JHZA 3QEZA 3LI0A 1ICPA 2QCFA 4EOUA 3JU2A 3VOIA 1Q6DA 4JFVA 1EJVC 2OSWA 3SADA 1J0IA 2ZBTA 1MFVA 1JPKA 1G5AA 3WK0A 3O6YX 3PB2A 3L4VA 4NASA 2XSXA 6ENLA 5DQPA 3WLNA 2NXHA 3CUHA 4LBUA 6XIAA 2OEJA 1J8VA 4PCSA 1DL3A 4MKNA 4A3HA 3FDKA 1WBHA 3A9BA 3ZQ9A 3SUSA 3WUBA 4C60A 1SO4A 1K6AA 4O50A 4E4UA 3TTQA 1QI0A 4B2DA 1WE5A 4H8UA 3VKKA 5LHEA 1N8WA 1ITXA 4ATWA 1R3TA 3RLVA 3W70A 1FWRA 2X41A 2GQAA 1R3QA 4FS9A 5A6TC 4YTRA 1QPRA 1OWQA 2RGMA 1OHLA 1M9HA 1UPPA 1EDGA 4LU0A 5DMLA 4XTIA 4H83A 4TR9A 3QTGA 1W5PA 2OT0A 3O15A 4OJYA 3W37A 3L21A 1IR1A 3HA1A 3OBEA 5ECUA 3KL0A 5AVNA 3EA1A 4M81A 2Z1SA 2DZAA 1T6MA 3T07A 3E1F1 3MUAA 2UBPC 3H53A 5HMSA 1F8IA 2VZTA 2GDVA 1CLKA 1BFNA 5I3IA 1W3KA 1DWIM 3W1QA 3OB8A 4NZ5A 4HBKA 5DXYA 5LA0A 3GG0A 1DTUA 4XIAA 1R47A 3LDVA 1FUYA 5CCZA 2Q01A 2WKGA 4AY7A 3CB8A 3QFEA 2CETA 3LTPA 3BAYA 3NWRA 1I2PA 1MXDA 2YYTA 1U5HA 1JL8A 4W85A 3URQA 1VFFA 3STEA 3U4AA 5AC4A 1KQZA 1POKA 1TMLA 2VGIA 2VCBA 3GC4A 4PUWA 4Q4OA 1W5MA 3E0IA 4GI4A 2VI0A 1W5OA 1UIPA 1XW8A 5FSEC 1EB3A 1ZP4A 1JCMP 2I7GA 1UBPC 2ZQ0A 3QOMA 2ZZ4A 1S5MA 3WFLA 2FZDA 3GNXA 3VKCA 3RJXA 1N8IA 3U8GA 4LV4A 3MO7A 4YHGA 1EA9C 3ITVA 5A6KA 3P67A 1YNQA 3GDTA 3WF3A 1X98A 3ERPA 3LLDA 1QI3A 2J8FA 3FGCA 4JNZA 2J7HA 2ATSA 3AQUA 6REQA 1BGAA 1RPXA 1DJIA 4B3KA 2PDHA 3LNPA 3HPZA 1RBOB 4H7ZA 4UB9A 1J9YA 3W2UA 1GQNA 4OWGA 3CO8A 2YBTA 1YPXA 3IGXA 3LUTA 4DNMA 3IV3A 4HTBA 3VK5A 2YXOA 5G5IA 2GK1B 3APYA 4AC1X 5LIYX 1ZTVA 3ITTA 3VA8A 3WNKA 3P8JA 4AH7A 3O0KA 4B16A 2PDKA 4F0HA 3NM1A 4BHYA 2IKJA 4WRHA 2G96A 3AXMA 3E5BA 2WMIA 3LXBA 4IMGA 3GSMA 4N6EA 1EOMA 2R91A 2R24A 1XUUA 1VIWA 2O56A 5HBFA 4Z2KA 3BK0A 2OWXA 4GA8A 4BI6A 1KA9F 3QY6A 2OGYA 3QPYA 3WUGA 3UT0A 2GDUA 3U7VA 4D6CA 1E1CB 3EOEA 4W7UA 2FTWA 1YEYA 1DOSA 5A5WA 4Z17A 3GFYA 1BPLB 1TTIA 4N2YA 3WDJA 4EAMA 4S1FA 5C54A 1HP4A 5I3KA 4A3YA 2IW0A 4AYSA 4HA3A 2W92A 4Z2IA 3VYLA 1I1WA 4O14A 5BU9A 2YCIX 3L0NA 4NJIA 1EIBA 1TTQA 3BG9A 4ZEPA 1TE6A 3ELFA 2ACRA 4F3HA 1ZENA 3WJXA 1Q4NX 2J7EA 3KOYA 3E74A 4JFTA 4JQ1A 2BX7A 5HAOA 4MTVA 1Q7ZA 1Z8AA 1FWTA 3WF1A 4U4MA 5AKQA 1DHPA 1X8FA 3Q67A 3M6DA 2CLHA 4Y2WA 2I5GA 3FN9A 3KAOA 3IK2A 3GO2A 1FCVA 3TJ4A 5BCAA 4PMYA 4S3EA 3QV8A 2VDHA 3OZOA 1WKEA 4PSPA 1YX1A 1YKWA 2A4AA 2WB5A 1JUEA 4P8UA 4DY1A 1JCJA 5BZAA 4WEVX 2ISFA 3GFXA 3GZ3A 5CSSA 1GCYA 3WH8A 5EU9A 4MJ2A 1FTXA 1SJCA 1KV8A 3SRHA 4CNOA 2GJXB 2OB3A 1A5OC 4KS0A 1I2RA 4DWDA 1EP2A 1OC7A 5DEZA 1EHAA 4C6OA 2BHUA 4FX6M 1XQLA 3AICA 1EZ2A 2IMRA 3BTNA 4JCLA 4W4QA 1H2JA 5K9DA 3EDDA 2XIIA 2R1NA 4LGXA 5E1QA 4Z1CA 2DT3A 2ZIDA 3RO8A 4JTUA 4JTHA 4BZYA 5HXMA 1V6XA 3GVQA 5A1AA 5A8QA 4UCFA 4X9SA 2YDQA 4FNSA 1HVQA 3AIWA 3GM8A 1E9IA 1GUVA 3AIEA 2E1WA 1Q4WA 3CIVA 3KBWA 2NW0A 3UCQA 3RMJA 4LBRA 4OT7A 4HNNA 2QNEA 4ZQCA 4DZAA 2F8QA 5DCBA 5ABEA 5M3WA 1JZ2A 4HJFA 1B4EA 2A7NA 7REQB 3RX2A 3ITYA 2WC4A 1M53A 2GLKA 4JD4A 2WBGA 4FIRA 4O1FA 2OZTA 2JEPA 5A8GA 1A5BA 4F2BA 4LS2A 4QLKA 1B5TA 3UXIA 3NL5A 3U48A 3L4WA 2XZ9A 1P4CA 2AQWA 4NKCA 4EKJA 2UY3A 1QRQA 4NUWA 4LW7A 5EBAA 2UY2A 1F3EA 3HTWA 1S2TA 4C91A 3GVGA 4N9CA 3LHUA 3QJAA 4ATDA 3I7SA 3GXNA 1CLXA 1BYBA 1EEXA 4QEHA 1DXIA 2O92A 4V2XA 1R3WA 4OECA 4PMRA 1OEPA 3U57A 4PTXA 3LSCA 1EFZA 4Q8MA 2CZDA 1CNVA 1GVQA 4G7EB 1B3OA 4XAFA 3AWNA 1A0CA 3DI0A 5L9FA 4PFMA 1PZ2A 1VFMA 1TIMA 3OU8A 3DBNA 2Y7GA 3DYPA 1SFTA 3VMOA 4QHRA 4GPNA 4PBFA 3L0KA 1I2OA 3PUOA 1GZ1A 3HG4A 4US6A 1ZZMA 4KWSA 1HXJA 4IQLA 2OYKA 4NAEA 3UWEA 4UOQA 3WFAA 3NM3A 1IEWA 4EE9A 4CN1A 4LTSA 4AWTA 3LPOA 2HPIA 3M16A 2JF7A 3MMTA 4X0NA 4OKDA 3UR8A 4C65A 4K1GA 2GYIA 3U2CA 5H8MA 2NLIA 3KCOA 5IBXC 4GZ7A 3G1HA 3RX4A 4OHQA 1G4EA 2A3LA 3WLKX 1W37A 3FKRA 5D9MA 4IGMA 4IICA 1DYSA 4L4PA 1NVMA 1E70M 2QXWA 4PUMA 1PX4A 3H22A 3M43A 2HISA 1PAMA 2ZX6A 5LXXA 3UJFA 3S6DA 3QLLA 4PB3A 2OODA 3PZMA 1HJVA 2J66A 1BWKA 3E2RA 2EO7A 4UQDA 3FVMA 5GNYA 3L66A 5BWAA 3BURA 3GH5A 4FF5A 4QROA 3LY0A 3BMXA 1EJTC 3BMWA 3G0SA 4TQTA 2XYLA 4PEEA 3EWDA 3Q58A 5BRBA 5CXPA 4KCTA 1US3A 1UC5A 3OA5A 4B3ZA 4LFYA 1UKQA 3V0UA 3R13A 1BRLB 4EPEC 3SM0A 3D6NA 4AHPA 2JGQA 2E4TA 1AH0A 4QJ1A 1V03A 4Q8PA 3HM7A 1Z42A 4YYFA 4JICA 4L80A 1W0MA 3CO4A 4U10A 1XLBA 4MLJA 1VFLA 2A2IA 1TMHA 1Q6FA 3BANA 3VMNA 2CEQA 4E8DA 3LCIA 3TTOA 1GTEA 1KTBA 4ICNA 4JTJA 3WL1A 2ZICA 4HK7A 3RCMA 2VC5A 4E8CA 4IIHA 1A49A 1ISZA 3E0VA 1RA0A 3V4BA 4U3CA 5M17A 3UA3A 4OIFA 1BAGA 3OLGA 3S2CA 3WF4A 5C6MA 3QSRA 4WKFA 3WSUA 3VIPA 5G4HC 4RNFA 2DIEA 4ZTXA 5REQB 2Y7EA 5A6SA 3URNA 3BDKA 3K46A 5DLCA 3SQMA 1O12A 3VGFA 3GXDA 3G8RA 2Y61A 3INPA 3LMZA 5T91A 2FB3A 1QT1A 1RSCA 3FHQA 8TIMA 3W7EA 4OUEA 1Z32X 4XBJA 3A4AA 1MO0A 4B4HA 4FB7A 5CG0A 4IJRA 2PD5A 4EVZA 1ZUAX 4AZBA 3SJ3A 4J1OA 1KKRA 2VFGA 3H2MA 3ARSA 1AD4A 2P0OA 3PTMA 3H55A 3H8AA 3NR0A 5D05A 3CUGA 1V3MA 1IWAA 2Z1XA 2EG7A 3GY1A 4ZO7A 1ZCOA 2X1SA 1AL7A 2Y7DA 4JKKA 4R7OA 3KRZA 4JTGA 3NEVA 1OFRA 4AD5A 5KSWA 2WM1A 3L2IA 1Y65A 3GNPA 1UKPA 2FPYA 1H49A 2BHYA 4JAWA 5CQ1A 3WMSA 3SQLA 3GLCA 4IIFA 2XIQA 4GHRA 4H8VA 4GVHA 5A2CA 4A8IA 3M0MA 4IIGA 4X9YA 5EPDA 5DN1A 1VC4A 1QI2A 1S46A 3GW0A 2YLAA 2XVKA 2FH6A 4L4MA 3TZNA 2V3EA 5AVHA 2OX1A 1NDYA 3AHXA 1QNQA 3FXGA 3PBUA 4PMOA 2B7NA 2CLMA 1C9DA 4TV5A 1XYBA 2OR2A 4GMEA 2E09A 1K70A 3QPEA 1JR1A 3BQ5A 2G37A 1G94A 4I5RA 4RDWA 4DELA 2J88A 4WLCA 5A3HA 3RN6A 2XIMA 1KQYA 3AJXA 2J7FA 3DENA 4AD0A 2XH2A 1F2JA 4XZIA 4MNMA 1EUNA 4JEJA 3S5YA 1JPHA 3ICJA 2WMFA 4J3WA 4W84A 2VURA 1NDWA 2XN2A 4LVGA 2D3LA 5LIXX 3JUGA 4UZUA 5BXPA 1KM4A 3VNDA 1W8GA 3M5ZA 1R9ZA 4IGNA 2NQ5A 2QCLA 3LOTA 3AMKA 4O13A 3NNTA 3W6LA 2TODA 4I5UA 4HZ8A 3H2NA 4FO4A 1MQQA 2ADAA 5LGZA 4YS1A 3RR1A 3DBPA 1FKXA 2VZSA 3SGGA 3W2NA 3O05A 2XZ7A 1LJYA 2X7VA 6TAAA 2ZDRA 1A0DA 2ON3A 2E6YA 2V9DA 4PTWA 1XG4A 3VTRA 3AXKA 2TRSA 2DU2A 3WQ6A 3WQPA 3VNKA 5GJNA 3L5AA 2INFA 3OPSA 4GI8A 1PL9A 2E40A 2QDEA 3DFSA 5D9NA 2PTDA 5E6ZA 2QUMA 1QI4A 2HWGA 1UQZA 2VENA 1J4EA 2ZUMA 2PDIA 3UGVA 3ZYZA 5A6JA 4Y8FA 1A5NC 3P0XA 4UNIA 4QS6A 4HCHA 1G0CA 4XKMA 1TG7A 3TMQA 4UUIA 1M3UA 1ZJIA 1FOBA 2JKPA 3G1VA 1E5NA 4YTQA 4O10A 4Z1BA 1PWMA 2V0TA 3DC0A 3HO8A 2GFTA 3RCNA 2FJKA 2OG9A 4KH2A 2OOFA 3W0KA 3SCVA 2ZZ6A 4HK6A 4IMDA 4RE0A 2YCEA 4E2DA 4EX4A 4K2SA 3NZ1A 5HQLA 3KE0A 3ABXA 2JQXA 4ONVA 3P14A 1ICSA 3K1DA 1RUSA 4D8ZA 1GVYA 1TO3A 4H7CA 2YYUA 3TN3A 4DXXA 1MMFA 3E38A 2H3DA 1KFCA 4MWAD 3T8QA 2INZA 4BQ3A 1Y5XA 2ZZ3A 1TJ1A 3GAYA 2ZVRA 4LXFA 3BL3A 1UR0A 1GG1A 5ABFA 4A05A 5FSDC 2DH2A 1VFUA 4BQ4A 5I78A 2J27A 2WC3A 1XLGA 4QITA 1H7WA 3H7RA 4ZOEA 5DO8A 3O07A 2OZ8A 2G4FA 3MKCA 4NZ4A 3W07A 4ORIA 4AVNA 2BGSA 3CLWA 4IMFA 4I9TA 3W2KA 4JN6A 1TA3A 3L5LA 4UTTA 4AD2A 3KBNA 3WUFA 3VIMA 1O1ZA 3PZTA 4DJDC 1GKPA 1B31A 1U1UA 2GJLA 3W27A 2NV2A 1UWUA 3QV7A 3WDRA 1GOOA 1US0A 3GAKA 4I90A 1XUZA 1CCWB 1TWSA 1WXZA 4ES4A 4MHBA 5C8BB 3U5UA 2PC8A 1EF2A 1Q6RA 1V0LA 4HYRA 4Q8QA 4YVXA 2BMBA 3WF2A 3AYVA 2WQPA 4AYGA 1EKOA 1HKWA 4CVWA 2F84A 3TH6A 1XD0A 1EEPA 1JGIA 3V35A 1H3GA 1Q45A 5TAOA 2C3ZA 4RDVA 3H6OA 1JDAA 3EWWA 5CJNA 1FFQA 1W1ZA 1K9TA 1PKYA 4DZ5A 3GIYA 2PU0A 3C3NA 2TYSA 4WIWA 4ERGA 5D09A 1RBAA 4LNYA 1QNOA 1XLCA 3GTXA 1NY1A 2DSWA 1PZ1A 1AH3A 1UB3A 2OYLA 3SY1A 2PWFA 3EA3A 3L4XA 1L6GA 3VOGA 5BXSA 2J7CA 1E51A 4GQQA 4I7UA 4N6FA 3P93A 1K7FA 3B8SA 2E1DA 3D3AA 1KC7A 3OLDA 2CFFA 2VNCA 1PSCA 4KFPA 1V0MA 4GABA 3KLLA 3QY8A 4WGHA 3IJ8A 1XFCA 3AHYA 5CPMA 3PPFA 4GNJA 5LIKX 1M1BA 2QCDB 5JQ9A 4KW2A 3GFZA 1MW3A 3OYZA 1WPCA 3CL6A 4QE1A 4ALDA 3RM4A 5LNWA 3VGDA 3BXWA 4LRTA 3VABA 4C5ZA 2XFRA 4KEMA 4DBUA 4ZSUA 1JEZA 1FWIC 1ML1A 4XX6A 1CGYA 1CPUA 1W54A 4P7OA 3QC0A 5FAGA 3PZ9A 3IAPA 4HZ7A 3BJTA 5L6UA 3W75A 4UTWC 1S39A 4IJCA 3QGKC 2OFJA 4MPKA 4GNVA 3WMLA 2X42A 4GUHA 3WYZA 3UF9A 1KXVA 2WMHA 2XH0A 3FCPA 4IG2B 2F7FA 3H2CA 4IPIA 4EF9A 2YA2A 4JOMA 4NYUA 3KOXA 5FCZA 3KBMA 4AD4A 2VFFA 2XU2A 4HHHA 4FNPA 1IXPA 3L4TA 4D9PA 5FEPA 3FA5A 4CQCA 3MANA 4MZ8A 4ZXOA 3W81A 1NP2A 3F1QA 3EAUA 3GVRA 2ANUA 5CSUA 3GXIA 2ZX8A 3AS1A 3W6YA 3M1ZA 4H9TA 3F4CA 5TD4A 4B90A 5HR6A 5AHFA 4AIBA 5FF4A 1DJGA 1RD6A 3F4DA 4XZWA 4LJ3A 2EKGA 4HN4A 3FNDA 4B9ZA 4K68A 2YKKA 4LEFA 1DIDA 1TCDA 1ESWA 1ZBCA 2OGJA 4R85A 3THCA 4OTKA 1NWSA 3SECA 5D8ZA 2DZBA 4DWSA 1LM1A 1WDDA 4C6QA 4TVDA 4MFEA 1W1VA 3QHNA 2C0HA 2Y88A 5D9PA 4JIIX 3FLUA 1Q2RA 3H12A 3ARVA 4Y9AA 1R85A 1OX4B 3VD5A 2Z4GA 3A3HA 1JRBA 1BG9A 3LCGA 4M80A 2ZOXA 3TWAA 1H7XA 2PDYA 3HQOA 1BVWA 3T4WA 2HPMA 5HWNA 2W5FA 1W9VA 3VX1A 1Q5MA 2Q6ZA 2P76A 4XO6A 3ZVIA 4J3XA 3OIXA 4J2PA 3BAXA 3OO2A 1AA1B 1HGWA 1P6BA 3V7PA 1SFSA 2J8TA 4Q4QA 3SRFA 1UUOA 1CXEA 2NUXA 3RDKA 1IR2A 1VZWA 4PCFA 1I1XA 3NVTA 4LH8A 1GEQA 1GG0A 2G50A 2JKAA 3QYQA 3CH0A 3AJ7A 1XGDA 1E56A 4PMXA 3MCMA 1HX0A 1VENA 5FEXA 3G0XA 4NX5A 1TV5A 5E6YA 3A64A 1XKYA 1PEZA 4LCQA 3EDEA 3NQDA 3AMLA 1GEHA 4NF7A 3NQ2A 4JYDA 2INEA 5CPSA 3HQPA 3W00A 4H9MA 3W72A 4NX0A 3B4YA 2J62A 1VF8A 4M7SA 3QZ6A 3WLQA 2DV0A 3IANA 2ZRVA 9XIMA 3R94A 2WKJA 4LY4A 4GWEA 1F05A 3CHCA 1OT2A 1UA3A 3WMCA 3QQWA 2ZUTA 2HK1A 4AZCB 1TJRA 4M29A 3AS3A 3GHRA 1TSIA 3MO4A 1ZB5A 3QR0A 1FH8A 2E0PA 3ITCA 2R9RA 3N9SA 5AZ1A 4QCFA 2I5IA 2IKIA 4NNAA 4Q8OA 1QU4A 1S38A 3R43A 3G5EA 1JCNA 4OV4A 2QAFA 1T40A 4YCPA 3HPXA 4J4KA 1KBKA 3W7CA 2PFHA 2WC7A 3TR2A 4H01A 4RDYA 3FYOA 1E0VA 4LUJA 2ZA3A 5DMMA 1JCLA 1H7OA 4B5VA 3QGVA 4OOUA 4JKLA 4UFKA 3MP4A 2P10A 3CK5A 3EX3A 4FAMA 2NLYA 3GHTA 1XBXA 1RCOB 4XZBA 2ACSA 3NXLA 1HNYA 4R5EA 2PRHA 2FHCA 3G24A 4GZJA 4F2TA 4YMZA 4C6EA 1GVRA 2PBOA 2QMJA 1YPFA 1WOAA 3T78A 2PBGA 1S2CA 4J7RA 2DUZA 7TAAA 1EZWA 3L4UA 4C7DA 3MSDA 3W87A 3V16A 1H09A 3CZKA 1UWRA 2Y85A 3GU1A 3IJIA 1ONXA 4ZTYA 4HOWA 3PZVA 2GZXA 3FXYA 4UTHA 1BVZA 1ZS2A 3PBVA 1X1ZA 1IIGA 5AYIA 1UHVA 3M0JA 1FDYA 1OK4A 1NWUA 3LNMA 4AHOA 3K8MA 3S1WA 5FL0A 4MWAC 4Q8WA 1R8LA 3LS9A 4W8LA 1XINA 2CZFA 4E5TA 1SO3A 1SO5A 5FESA 1YDNA 1W56A 1P0KA 3RMEA 3L12A 1XP3A 3BLEA 2P5NA 1PTAA 3RUBL 5I3DA 1GQJA 2WNZA 1V3JA 4OBTA 2C15A 3E2SA 1UA7A 4NZ1A 3TU9A 5AC8A 4GJJA 5CGQA 1VEPA 4PE8A 2FTPA 4TXEA 2PGEA 1S5VA 4DYKA 3G18A 3WNNA 2H8ZA 5EB8A 3ZJ7A 1EP1A 3CWOX 3PWAA 2D0FA 4GUIA 1TVLA 3C0QA 4GLEA 4C6MA 3P2VA 3JVAA 4KF1A 4B5TA 2WLZA 4DM2A 5FJTA 3W9ZA 5J5RA 3U3HA 2A3EA 3EOOA 4GG9A 2I17A 2B7OA 1S2VA 1YE4A 3FHAA 4LEQA 4HPJA 3MW7A 4X0VA 2VDGA 4NXKA 4DO7A 4LUTA 3G8EA 2Y24A 1KM2A 4KEVA 1AW5A 1VEMA 1SZNA 2VEGA 3CV7A 1ICQA 1IYXA 4DJFA 1E0WA 1NARA 1R2SA 1IE7C 1SUXA 4M6PA 3EKGA 4JTEA 3ABZA 5E70A 4WDTA 1V02A 3P74A 4DHGA 1L2UA 2WSKA 3ID7A 2A7RA 1O60A 4ZQPA 3VZZA 4MB1A 1CB7B 4ILSA 5DXXA 3LCWA 3QV9A 3EEZA 4QX4A 3TOYA 3STGA 1TKKA 4ACZB 3T4CA 1K9EA 1BQCA 3GH4A 1FWJC 5CSRA 1P6WA 1OT1A 3MCOA 3N2BA 3NQGA 3UYCA 1B3YA 3WQCA 1JCTA 3N4EA 2F6XA 3OW1A 4QSHA 3HPFA 5E5CA 5M5DA 4JYFA 4D6HA 3B0UX 1MUWA 3FYYA 1RVKA 1N2VA 1W1IE 4PGLA 1W9UA 3NQEA 4MSSA 5CJMA 2MANA 3GHSA 5IDIA 3P3BA 4U5IA 1M65A 1TPB1 2NQHA 1JDDA 5BYWA 3W86A 3N2OA 3C5QA 3AMCA 1RPKA 2QHAA 7ODCA 4UTMA 3QRHA 3POHA 1E0XA 4KERA 4J35A 4K37A 4KGJA 4E2VA 1QWGA 2PUZA 3I6EA 4RZ4A 3IARA 1QNRA 3TA6A 3HZ3A 2AGTA 3THUA 1X38A 2CBUA 1EQCA 1X97A 1W32A 1B30A 1Q66A 1MDRA 3RM9A 3CZGA 1WAWA 3EWZA 3PUGA 3T81A 1JZ7A 3CTLA 4QM1A 1Z9AA 5IDZA 3QYSA 2PCQA 3MSYA 5LSMA 3CS2A 4QEEA 4W86A 1W1B1 5FF2A 4P8XA 1LQ2A 2WJEA 3POCA 3LMYA 3SGZA 3XISA 2P3EA 2VFDA 5AY7A 4HPHA 2PAJA 3WQEA 3LLFA 3QZEA 4DIAA 5C2XA 4UQEA 3WFZA 3W22A 3M41A 2ACUA 2VT0A 5CZJA 5HOSA 2J77A 1HJUA 3UJSA 4KFNA 1PUDA 3LN3A 3VGGA 2DZVA 3VFCA 5GPRA 4V27A 1GW9A 5AHEA 2CBJA 1RBLA 1W2VA 4N42A 4NI3A 1JZ5A 1J12A 2XIOA 1H41A 3D46A 1ZHAA 3U0HA 4E4FA 4CNTA 2EJ1A 4KRZA 5E9AA 3RLUA 4QTGA 4IFRA 2WZIA 2Z29A 2EHHA 4XB3A 3G3MA 5EA9A 2Z6JA 1JF5A 2YL5A 3TIMA 4XSLA 2PU1A 4A3RA 4I8DA 4UBPC 4IIBA 1J93A 1FX6A 1EGZA 3TXZA 1K7EA 1J96A 4YNGA 3DGBA 4NJKA 4U33A 1TREA 3MV11 4A2RA 4LYQA 4D6DA 4G6CA 2GQ3A 4AWSA 1Z69A 1A5SA 4UTUA 3DESA 4QAWA 3PP7A 1TX0A 4HZ6A 3VD7A 2NT1A 3QSTA 3T09A 1GYMA 1TZZA 1XDMA 1WQ5A 3RGTA 3HU7A 3BV4A 3GC5A 3TJIA 3SUWA 3W2LA 3W71A 3TAOA 3C8FA 4YCOA 4ERIA 3B8IA 2Z2UA 3CAVA 3PJTA 4OBSA 2B0MA 3A4JA 1ZPTA 1XIHA 2A21A 1XI3A 2E9LA 2NZLA 1CZ1A 1R3RA 2WK2A 3FW6A 3UXKA 2VUNA 4Q22A 3QLDA 3WBWA 1M41A 4MZ1A 3S46A 2QUTA 1MSSA 4PFHA 3WK1A 1BKSA 1CLVA 4CD5A 1JZ6A 5AYBA 2QAPA 3BQ6A 3VM7A 3H23A 1WYIA 3WH7A 2DIJA 2H8XA 1Y5VA 2FFCA 3T2QA 4QJ5B 3W23A 5A8NA 2HJPA 3TXVA 4Z1AA 5IHSA 3W88A 4AZIA 1GGOA 1QW7A 1B3VA 8A3HA 1RP8A 3MYOA 4LY8A 3W7MA 2J7GA 4P2VA 1QNVA 3GE7A 3PZGA 3DHDA 4C6KA 2Z26A 2BGNE 1NELA 2AL2A 1E6SM 2Z1KA 1ZAJA 2XSAA 3WD3A 4HVXA 4GC4A 1LT7A 3SEPA 4M6QA 4MUPA 3KEHA 3FVDA 3BOXA 4A3QA 1IWBA 4W5UA 2QULA 3GDRA 3M7SA 3CHVA 1KD0A 1MUCA 1EJUC 2V3FA 3CPRA 3KRBA 3TSBA 2W9MA 1SZFA 3IRDA 4JYEA 3UCCA 3BO9A 1EX1A 3TJLA 2XN0A 3IIVA 4PSRA 3WH9A 4GX8A 1TWDA 3R1ZA 1X8CA 1DTNA 3W7IA 2W3ZA 3EWYA 2NVDA 2VEFA 3OA3A 1XV8A 1JRCA 2G4JA 2BY0A 3BOLA 3H4WA 4S3GA 2E5CA 3EA2A 1XIJA 4MYXA 1CXKA 1R87A 4YJ5A 3CPUA 1UJPA 1GZGA 1E9ZB 3FFSA 2YA0A 2CLFA 4PL2A 3WF0A 3U6WA 1SMAA 2VWSA 4WJXA 1YIXA 2VZOA 1IWPA 1WO2A 1DVJA 1E1FA 4WGXA 4Y9OA 6CGTA 3LBCA 5D2YA 3W76A 3KRSA 2OWWA 4ICCX 3KWXA 3THQA 2D24A 5F2GA 3UNDA 3SQSA 2VX7A 2FMNA 5DCDA 4CNSA 2FVKA 3HOJA 3GTNA 3VGHA 3E49A 4QLLA 1V8EA 3F4NA 2G41A 1YQ2A 3R58A 3CMGA 4MWAB 1JYXA 4JBRA 3OGSA 2VFEA 3BAWA 1W2PA 3WQOA 1M6JA 1G1YA 1KM5A 1VAHA 4ADTA 1TPEA 3VDBA 2OSYA 1TUXA 1SYTA 1WDRA 3KTSA 4TTUA 2E5BA 2X1RA 1W6TA 4QJ3B 5KZMA 1TELA 2L5HA 2EPNA 4NAFB 3UEQA 1CT5A 4RL3A 4HTYA 2GL5A 4EPBC 1ELSA 2DSVA 3QF0A 3TA9A 4O12A 2A6NA 5CZKA 4JIQA 3SCUA 3JW7A 4UFIA 2YIHA 2PDWA 3KS5A 4HSHA 3SJNA 1VH7A 5D30A 1ISVA 3WJWA 3TROA 4DZHA 2WPBA 3SZ8A 3DG6A 1OIFA 1FH9A 3TCEA 5D37A 3S5NA 4CKQA 3BV7A 1P1MA 3N2TA 4QLJA 1S5NA 4UNLA 2GGHA 1YDYA 3G1XA 2J25A 4EANA 4Q7BA 4GACA 4AZHA 4MB4A 2YCKX 3LERA 4DYJA 2YA1A 3ARPA 5DT7A 3FGCB 3SFWA 2BSLA 4MIMA 2IPWA 1FCQA 1WDQA 2OOGA 3LQGA 4WQ6A 1KV5A 1V6YA 1EO5A 2B31A 2PDUA 2X09A 4GJ1A 3VD4A 3QHMA 1F6YA 1WCGA 1Y8BA 1WX0A 2WHKA 3V5OA 3K30A 1QVBA 4QFUA 3KLKA 3QW3A 3ANUA 3IVTA 4DNHA 4WX2A 1LOLA 2DGAA 3ZFHA 1KM1A 2PLKA 3I65A 3E96A 3PY2A 3EB3A 3TC7A 3V0TA 3STPA 3FK4A 1HGYA 1NOWA 3KVJA 5JH1A 2J47A 4GFIA 1E71M 1KM3A 3AO0A 1E43A 3LTYA 5C7VA 4FNRA 1XIEA 4M6UA 1T96A 3IV8A 5AYZA 4C6JA 1E6RA 1OD0A 1DWHM 1GOWA 5DRIA 3QH2A 2WMIB 1LG1A 3EPOA 3FEQA 1K4HA 3IAQA 1D3CA 4JX6A 3TZFA 1ONWA 4XD3A 5D04C 3FEMA 4B91A 3ZLHA 1Q6EA 1QW8A 3PULA 3C52A 4DI9A