2XFRA

Crystal structure of barley beta-amylase at atomic resolution
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
487
structure length
487
Chain Sequence
b'VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-AMYLASE
molecule tags Hydrolase
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
total genus 191
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xfrA00
3S2CA 3WF1A 2VR4A 1V02E 3EMCA 4W93A 1TCMA 4CCDA 2CHOA 3A3HA 3QHMA 1CNVA 2HISA 2A3AA 4W85A 2GSJA 2C7FA 3AISA 3UR8A 3ARRA 3ARZA 3MUY1 1CGVA 3WH8A 3AXHA 3APGA 4UNIA 2J79A 2XM2A 5D9OA 1ISYA 1UWTA 2DT1A 5IHSA 1UZ1A 4AMCA 3AXXA 1XD0A 3W27A 3QGVA 1GONA 2J62A 4PMQA 4EE9A 1E1EA 1PIFA 2YL5A 4TVDA 3AS2A 1ISVA 1WAWA 4JKLA 5JBFA 1UH2A 1MVYA 1I1XA 2WWDA 1TE1A 4XV0A 3L4VA 2BY3A 2W62A 3G6LA 3K4DA 1UWQA 1RD6A 4W88A 1VIWA 1WKYA 1U2YA 1PIGA 1UD6A 3W25A 5A2AA 1UKQA 1H09A 1JNEA 2GJRA 3CZKA 1EO7A 4GI9A 3AMKA 5A6SA 2AOSA 4JFSA 4GXPA 4UQBA 2ESCA 2WMGA 3GH4A 4C7DA 4U2YA 2JEPA 4N0RA 3RJYA 4AZCA 4CD6A 1J0HA 3CBWA 1KGWA 3L4ZA 2GDUA 3VOCA 3VX0A 4UZUA 1XSJA 4FLRA 4WF7A 3ZOAA 1JYVA 3A47A 4JCMA 5GNYA 2DIEA 2W66A 2WB5A 5D8ZA 3ARVA 2VTFA 2XYLA 1G0CA 1V6UA 4U31A 1XSIA 4U5IA 1VFMA 3K4AA 1VEMA 3NDZA 4AEEA 2IXVA 1BVNP 2DT3A 1C8QA 4ZENA 4UCFA 4S3KA 2FDMA 3SCTA 4AD4A 1XD1A 3WF0A 3RDKA 3WMBA 5BXTA 4AZCB 3EYPA 5E6ZA 3ZMRA 1GQIA 1E4LA 1TMQA 1CYGA 1EOMA 1KWGA 3M7SA 1SR0A 1GQKA 3PZQA 1UYQA 2PF0A 1KXTA 1UA7A 3K8KA 4CN1A 1N82A 1MQRA 3WMSA 4WKAA 3VTRA 3RM4A 4D72A 4MNKA 3WQ6A 1XH1A 4MNMA 4F66A 3AXIA 2A3CA 3WDHA 4NSBA 1V3IA 3QOKA 4D6CA 1XCWA 1J01A 4FLOA 3ZQ9A 1W2PA 1JIBA 4J28A 4EK7A 2O9PA 2F61A 4OUEA 2J8FA 3VIMA 3CTTA 1LL4A 3MO4A 2OWXA 4GZEA 1PPIA 4D1IA 4BZYA 1JGIA 2WMFA 5HPCA 2WBKA 2WMJA 3LPGA 1CLVA 1E73M 2GUYA 4W8AA 2ZUNA 4UFHA 3WSUA 4C7FA 1CGUA 3ZT5A 1BYCA 1TFVA 2XPKA 1DWJM 5LA1A 1E5JA 2JIEA 2UY4A 3SCPA 2WZEA 2J77A 4K68A 3ZJKA 3N17A 1UG6A 1UHVA 1HF6A 1E0XA 3ARXA 3U57A 4Z2JA 5AC5A 3CMJA 1C3FA 4MB4A 4URIA 2CXGA 1OBAA 2WLZA 5M03A 1QBAA 3VD3A 1W9UA 1WE5A 4TXEA 3ALFA 2ZUTA 4EANA 4AD3A 4PTVA 3VMPA 1JAEA 4B16A 3KWXA 5AC4A 4DM1A 3WD1A 2WW5A 4J3SA 4U5KA 3VGFA 5CSUA 5BCAA 1GZJA 1GJUA 1DWHM 5LYRA 4M56A 3VU2A 2C0HA 3MKKA 3OLIA 2W61A 1AQHA 3AZSA 3UERA 3GXMA 1E70M 4H8HA 1LL7A 2XFFA 4JL2A 3W82A 1Q6EA 3BAWA 5M5DA 2YDSA 2J7BA 3VNYA 4ATLA 4X0VA 4JFWA 3D3AA 3EDFA 2VZVA 3SUVA 5F7UA 2CNCA 4CD8A 4GI6A 2XWDA 4GQRA 3PZNA 5JUVA 4A4AA 1BF2A 3VDBA 1L8NA 1UWIA 2J7EA 3VM5A 3RCNA 1QI5A 1ESWA 4WJXA 1K9EA 1WDRA 1MYRA 3NIYA 3FXYA 3GXFA 3VIKA 1E6RA 3BLPX 3L4XA 2WWCA 1NH6A 1MFUA 1HP5A 1CGXA 2EPLX 1BPLB 1DWIM 1V0NA 2WZIA 3W28A 5A6JA 3WENA 1UKPA 2XVGA 3NDYA 3OGRA 3F5JA 1C91A 3RO8A 1V0LA 4GZJA 4V28A 3F5LA 4EAMA 2XIIA 3M46A 4ZEPA 1EXPA 4JHOA 1B3VA 1E0VA 1BLIA 1BGAA 3EDEA 1UKTA 5EFFA 4Z2KA 4UQAA 1FHLA 1VENA 1QNOA 4DWSD 3SEPA 3OLGA 2Y4SA 5AY7A 1HJXA 3PZMA 4ZE4A 3GBDA 4ACZA 4D6HA 3FN9A 3WELA 1JI1A 1GJWA 3ARUA 2YKKA 3SCQA 5CLWA 4U33A 2OLHA 2BXZA 5D8WA 4H41A 3IJ7A 4XUYA 1YQ2A 4E8CA 2X0HA 3DC0A 2PBOA 1CECA 4DWSC 3RPMA 1DWFM 4RL3A 4HMDA 1V0MA 3CUGA 2ZXBA 1GPFA 2HVMA 4W8LA 1LQ0A 4ATDA 3GNOA 2F2HA 3TTSA 4Q22A 2BVYA 4R27A 1PX4A 2O9RA 2UY5A 2B31A 3GDBA 4MAVA 3OA5A 1DP0A 4YHEA 3MMDA 4GKLA 1BYAA 3CUHA 2ZX7A 3WUGA 1H0GA 2ZX5A 5FCZA 3OGVA 1K6AA 3SCUA 2W92A 5I6SA 2VCBA 3CH9A 3N12A 1NWSA 3WBAA 2OSWA 4F9JA 1XH2A 4MB5A 1GOMA 3AMLA 2JEQA 3EMZA 5CPTA 3OB8A 1GNXA 1QBBA 3WNMA 1HNYA 1E6SM 2VMFA 3J7HA 2VJXA 3BCFA 2F8QA 5BXPA 1QHOA 3O9NA 1FH7A 5M3WA 2O9TA 1GHSA 4B3LA 1Q6CA 2GK1B 4U3AA 1E3ZA 3PTMA 3CHDA 1MW2A 1B30A 2X09A 3RM9A 3IAQA 1E9LA 3IANA 1C7TA 1C8YA 4PTMA 1U33A 4UZSA 1C90A 2DIJA 4RE3A 1OCQA 3IJ8A 1C8XA 3M6DA 4AD0A 5JIWA 3N1AA 2CBUA 4PTWA 4AISA 1M53A 4PYSA 1CXFA 1OSEA 2O9OA 2FHBA 3AICA 1J18A 2V5CA 1D2KA 4DWSA 2VQTA 4RE4A 3PZVA 1R7OA 3ARPA 2VL4A 1O7AA 1DEDA 4P7LA 1JYNA 1XGZA 1E1FA 2FHCA 2WLYA 2VX6A 1QHZA 2BFGA 1H3GA 3U7BA 1OM0A 1TA3B 3T2QA 4BQ2A 1U30A 3LMYA 2PC8A 2WZHA 4JL1A 1ZBKA 3MSGA 4PSPA 4A3HA 1B9ZA 2PWFA 3FNDA 2WMKA 4FLQA 3U5YA 1QI0A 3MUIA 4KH2A 1ZJAA 4IUGA 2Y8VA 2DGAA 4JKMA 3TP4A 1UUQA 2NW0A 4HZ8A 5GNZA 1WZMA 2E40A 5BXRA 4WIWA 1VJZA 3PTKA 3VNZA 4XB3A 2DSZA 5HOSA 5AYIA 3FY1A 4HOXA 4TTUA 4L4OA 1KGUA 1E4NA 1ECEA 1QHPA 5FL0A 4HMCA 2YLAA 3UEQA 4CD7A 5KZ6A 3MV11 3AOFA 1B3WA 3AYRA 1UR4A 2OWWA 1V3LA 4MJ2A 2YLLA 2WHMA 2OYLA 2EQDA 1V08A 2WKGA 4MPKA 2X8RA 2QPUA 2NSXA 3UR7A 1PZ3A 3BMWA 1G5AA 1G9HA 3WUEA 2BVTA 3WNLA 3MV01 1BG4A 1BHGA 1E5NA 4V27A 5EMYA 5BYWA 2VT0A 3AIWA 3OZPA 1RPKA 4W5ZA 1Q6FA 3RMEA 2VUYA 4PMUA 3T08A 2ZX6A 1KB3A 4QLJA 1FFQA 2O92A 4L4PA 3MS8A 1V6VA 3T0BA 3QR3A 1Y7VA 4UFLA 2CETA 2G4FA 3WL1A 4JAWA 3SCOA 3BAKA 1MQQA 4ACYA 3WNOA 2JIWA 3KL3A 5CXPA 5ABGA 3SUSA 1UQZA 3PN8A 5I78A 1B3XA 4E8DA 4TUFA 3AIEA 1OIFA 5HNNA 3AJ7A 4BCEA 5A8OA 1NWUA 1EHNA 3I3BA 2WK2A 3ZSSA 5A6KA 2DT0A 4H8UA 3DYPA 1GOQA 5A6BA 4PSRA 1ZL1A 3RJXA 3CIVA 2Z1KA 2ZUWA 2BS9A 5BXSA 5ECUA 3VIOA 3VD9A 3AHXA 1BSIA 1XC6A 5CSYA 4HPHA 3PHAA 3WF3A 3QOMA 3BCDA 2CCRA 4D6GA 5ABEA 5DT5A 3HJEA 3KEHA 4BF7A 3ARYA 1R7AA 2VCAA 4P7RA 1CBGA 1XSKA 1EOKA 4Z2IA 4BQ5A 2BVDA 2FHFA 3PZUA 1RH9A 3T0AA 2YL6A 4XX6A 2DQXA 4M82A 1H1NA 5TD4A 3TONA 1K9TA 4D6FA 4MDPA 2WAGA 4W89A 2V3DA 1JDDA 2QLYA 3IAPA 1E6NA 4XZBA 2EO7A 3OG2A 3NJ3A 1GOWA 3WEZA 4PMNA 2WCGA 2VRQA 1AVAA 4YN5A 4HA4A 3FAXA 3VILA 2V38A 3QHOA 3TTQA 3MANA 4CGTA 1JL8A 1TR1A 3AHVA 1WZKA 1M03A 5CGTA 3BAYA 4LQ1A 1PAMA 2EPMX 7CGTA 2J7DA 1UD8A 3W6MA 5CPQA 3NSMA 1XH0A 2AAAA 4NI3A 2WHKA 8A3HA 2VZSA 1EGZA 1W3KA 1GOOA 1DHKA 4CU7A 1W2VA 3ZO9A 2A3HA 2FH6A 5ABHA 3UESA 4P7QA 3SCRA 3U5UA 1JZ8A 1BGGA 4GI8A 3VGBA 4KGLA 1WDQA 1V3JA 4CUCA 3UG3A 4MDOA 4AWEA 1OT1A 7TAAA 3WDPP 4W84A 4WSJA 3T2PA 4W7WA 4QDMA 2WMIB 2ZIDA 2QV4A 2PB1A 3K8LA 3HU7A 1HP4A 3NCOA 4KRUA 1PJ9A 4C7GA 1W9XA 4J3WA 2MANA 4H2CA 2WVSA 3B9AA 4WKHA 5I24A 4PMDA 1CWYA 1VFOA 2RGMA 5A8QA 2E8YA 3I3EA 5A95A 2E8ZA 4PUEA 2GJXA 2XFYA 4OOUA 2CESA 2PBGA 3OIHA 4W8BA 1YHTA 2XM1A 1ISZA 4PUDA 4MTVA 2WVUA 4AYSA 1H41A 1FA2A 2YBTA 1CXIA 1O6IA 2BHUA 2WPGA 2X0YA 4UR9A 1ZS2A 3GXDA 5IHRA 1E6PA 2G3JA 3WD0A 1HJQA 1ITCA 1G1YA 5FKYA 1QNSA 2JALA 4NRSA 5JIPA 1A3HA 1W91A 2JF7A 3SUUA 2QHAA 3DYOA 2ZUVA 2D1ZA 2VRJA 4S3JA 2XGIA 1EA9C 3OGSA 5LA2A 2GJXB 3HN3A 2ZUUA 3JUGA 4R5EA 3VDCA 1HKKA 4AC1X 3MUAA 3RIKA 3G6MA 4E2OA 1QVBA 4HA1A 2JFEX 4UFKA 3FHQA 1MXGA 3ZM8A 1VEPA 3MMUA 3II1A 3PZOA 3N04A 1B1YA 3O2LA 3EDJA 4D1JA 1NP2A 2XSBA 1EIBA 3TTYA 1Z32X 3GM8A 3AIRA 3CGTA 2ZX9A 4CCCA 4HOWA 2OSYA 3ZT6A 5CJ5A 3E1F1 4BQ4A 3N13A 5M17A 3K1DA 4AZ7A 2D20A 3A6OA 1D3CA 2VZTA 2QMJA 1XHGA 3SCVA 4AW7A 5LA0A 2EXOA 3WQ4A 3GTNA 3VIJA 5BRPA 4Q7NA 1CXLA 5CGMA 4B9YA 2WMHA 1CDGA 4PMVA 2EEXA 4MJ4A 3VMOA 3UG5A 2D22A 1HKIA 1JF5A 1V3MA 1ISWA 4QAWA 4M81A 4QLKA 1B90A 1VBUA 3CMGA 4Z2HA 3UETA 4TVCA 3T0DA 1GW1A 4ML4A 4J3TA 4CD5A 3W6LA 2D3NA 3WQWA 5I3DA 3BGAA 1JYXA 2DSWA 2XUCA 2W63A 1J12A 3BH4A 4TVUA 1R8LA 2DH3A 1TG7A 1HXJA 3O6AA 3KL5A 1EQPA 1X6NA 3K46A 4KGJA 1V03A 1I75A 4D6DA 3WKZA 4UQDA 1GORA 4CN4A 1CXHA 4H7VA 2E0PA 2XVPA 2YBUA 2J74A 2GDVA 3F5KA 3MU7A 2WC3A 3GNPA 4ACZB 1E6ZA 3WH7A 3ZJ6A 2WC7A 3AHTA 3CUFA 1KWKA 5JBEA 2J7HA 4J3XA 1MQPA 1V6YA 2QMKA 3SIMA 1UH3A 3L4UA 3CZ8A 4LX4A 4EKJA 2TAAA 1XCXA 4ZXLA 1IT0A 2YOCA 5I5RA 1B31A 1SMAA 4HTYA 3CUIA 2WXDM 3QHNA 4AZ5A 4WK9A 5E9AA 4P8VA 1GHRA 6TAAA 1OIMA 2WHJA 1IZKA 4NZCA 4KRTA 1E4IA 4AZGA 1HVQA 4TX6A 4X9YA 3W53A 4BA0A 4V2XA 2A3BA 5IFTA 1NP0A 3MUZ1 1QPKA 4B15A 4HOZA 3T09A 1OT2A 2DPEA 1HL9A 2WVVA 2G3NA 2NT1A 1CTNA 1W9VA 4LYQA 1PX3A 2CEQA 1E40A 3GZAA 1Q6DA 6CGTA 5CQ1A 2QF8A 1EO5A 1GCYA 1KBKA 5A2CA 4QP0A 3WH5A 3WQ5A 4UOJA 2GJPA 5FL1A 1V02A 4PN2A 2J25A 2CKRA 2BHYA 3SCSA 1UR8A 2WCAA 1EH9A 2EBNA 3TTOA 4P7NA 1JXJA 1W1YA 5A8NA 2PWGA 4PMOA 2VO5A 1JF6A 3BLKA 4JFUA 4LYPA 3BMVA 1RP9A 2E4TA 3VGDA 3DECA 1WCGA 5EBAA 2VI0A 3EBVA 5D4YA 1KQZA 5DEZA 1DTUA 1R86A 1ODUA 4CN6A 4B9ZA 3NUKA 2XHYA 3WF2A 2V3EA 2W67A 1NARA 3T2OA 4NF7A 1KCLA 4UFIA 1M01A 3FAWA 2A3EA 1B2YA 1QI2A 3VMNA 1VB9A 4DUXA 1LWHA 4FK9A 5IDIA 3BSGA 2Z1SA 5I79A 5A6MA 2XSAA 4DWSB 2CBIA 4AD5A 2WSPA 4HMEA 5I0DA 3CO4A 1E72M 4PEEA 3VIIA 3ARWA 5D9NA 4D71A 2X05A 3VD5A 1GQLA 1US3A 3PZGA 3WDQA 5FD0A 3DHPA 3VIFA 2XJ7A 5C71A 5I23A 5HDRA 2FH8A 3MSDA 4GO8A 1JXKA 3BC9A 3ZR6A 2C8NA 1QOXA 3I3DA 1H49A 4M29A 4Y7EA 3AROA 4P8UA 3WNPA 3AFBA 1QI4A 1CEOA 1R85A 1UR0A 4FMVA 2IUZA 4W87A 3CZGA 5HXMA 2IXUA 2ZICA 1QI3A 1M7XA 1HT6A 1XV8A 3IJ9A 1CGTA 1D7FA 4GQQA 2Y8KA 3VM7A 2DSUA 4IM4A 4E4PA 1JZ2A 4AZBA 3B9EA 5A2BA 3AIBA 4DM2A 3VO0A 4AIOA 4DUWA 3AMGA 2UY2A 3CHEA 3N18A 2J8GA 2J7CA 1VEOA 4F8XA 4PCTA 1FFRA 3CPUA 4JHZA 1LF1A 3PZTA 1ISXA 1KR1A 2VX4A 3KZSA 1VFUA 3OBAA 2VURA 2X2YA 1VRXA 3WNKA 1BYBA 2GFTA 1I1WA 3VDAA 1CGYA 1L0PA 1H0IA 4HPGA 5BRQA 3AZTA 2PI6A 1UA3A 1E56A 1HKJA 2CIPA 3OZOA 2J78A 1UD2A 1E3XA 2XIBA 1SFSA 1US2A 1CIUA 3ECQA 1WZAA 5EB8A 4AZ6A 4Z2GA 3SURA 1G01A 1LL6A 2YA1A 1UH4A 1JFHA 3WUBA 2YDRA 3THDA 1R87A 1SMDA 3VD7A 1OGBA 2ZXDA 2QPSA 1LG1A 3POCA 1CZ1A 5CZKA 1ZBWA 1EQCA 1QNPA 4WLCA 1E55A 1J10A 1V3HA 2OYMA 2VRKA 1CLXA 4AD1A 2ZUMA 2VZOA 1OINA 2OWCA 1A47A 4UTFA 2VX5A 2WHLA 4QFUA 3AMCA 2E9LA 2G8ZA 4OIFA 1C92A 5CLTA 1F4HA 1XYFA 2D0GA 1PZ2A 4W86A 2EPOA 2OYKA 2PWDA 3W24A 3VIHA 3A4WA 3WIJA 3WEOA 3VGGA 1AMYA 3ZSTA 2BY2A 4PMZA 3AI0A 1J0IA 4YHGA 4D6IA 4OBSA 3AMDA 4N42A 1W9PA 3WDJA 4ATWA 1JDCA 5A94A 1DWAM 4WKFA 3DYMA 4KMQA 3SUWA 4AD2A 4JKKA 3AQUA 4X0NA 5A1AA 3M07A 4MNJA 2ZWYA 1BQCA 1GOKA 3WY1A 2VVNA 1NOUA 2VCCA 3VINA 1GVYA 2GVYA 1OD8A 1JFXA 5E09A 1JZ6A 2VQUA 1UOKA 2NT0A 2WVTA 5DT7A 2DH2A 3VGHA 2WC4A 1FP9A 2WSKA 4HA3A 1EDTA 1KXVA 1CPUA 3W4RA 3S6TA 2CERA 4B3KA 4AIUA 1VAHA 1UWRA 3AHYA 2JE8A 5A8PA 4J3VA 2RGLA 3BAJA 1PEZA 1E71M 1J0YA 1JYWA 1TZ7A 3AIVA 3L4YA 3THCA 2PWHA 2DDXA 3WQ8A 2AMGA 3DHUA 1TUXA 2BHZA 1C93A 4MB1A 2D0HA 1WDPA 3TOPA 4F9DA 2G41A 1UQYA 2Y2WA 2X1IA 4M8UA 3AYSA 4UFJA 2J47A 1PX8A 2WKLA 3L2MA 1H11A 2YIHA 4CU8A 1CGWA 1W32A 1NQ6A 2ZUSA 3N11A 2YJQA 2D0FA 4LPCA 3AIUA 3W37A 4FLSA 1W3JA 1AQ0A 4Z2LA 4U2ZA 5GQBA 1UD4A 1WNOA 1EHAA 1JD9A 3GXIA 5DF0A 5A6BD 3MMWA 4GPNA 1VF8A 2D24A 5DMYA 1W1PA 5IXEA 5BROA 3BXWA 1FH9A 3NSNA 3W26A 4AEFA 1BVZA 3SUTA 2J75A 3VIGA 4ZFMA 2VVSA 4JZ5A 4W5UA 4PRWA 2VX7A 2BV9A 4TOQA 1W1TA 4U3CA 1HVXA 1ZU8A 2XTKA 1K9FA 2Y5EA 3ZJ7A 1JAKA 1HJWA 2ZX8A 3BAIA 5CG0A 5A6AA 1LWJA 1B3ZA 4HZ6A 4J7RA 4M24A 4JIEA 4UOQA 8CGTA 3KL0A 3VUPA 3W81A 1ZBCA 1EDQA 1HX0A 1JDAA 4PCSA 1OD0A 4XZWA 1CXEA 4AXNA 5KEZA 3EDKA 5E0FA 2D3LA 2VZUA 4AY1A 3RM8A 5CPSA 1HL8A 4AZHA 1UR2A 1ODZA 2WCSA 1B0IA 3OLDA 3GNRA 2PWEA 1GVIA 4JFTA 2WMIA 2UWFA 1BYDA 5JBDA 3B9DA 1V3KA 1VJSA 3ARTA 1W1VA 1ZBVA 3WD4A 1UWUA 3VKKA 4H04A 1HJVA 1MXDA 1QW9A 1KGXA 4W7VA 1GQJA 4GIAA 5A3HA 2XFRA 3PZ9A 3UG4A 4TTGA 1Q6GA 1J11A 1KBBA 4HP5A 3AZRA 4A3YA 9CGTA 5D9PA 3VIPA 1TA3A 3VPLA 2XVLA 4P7OA 1OWQA 1E0WA 3WFLA 2YL8A 3SCNA 4PMYA 2ZXQA 4HZ7A 2E9MA 1KXQA 4BQ3A 1E43A 1G94A 4CU6A 3NSXA 4AZIA 2VC9A 2YA2A 4IPNB 3CUJA 4CCEA 5HBFA 1FOBA 3K8MA 1H4PA 1M04A 1NWTA 3GYCA 3A4XA 4CVUA 1V6XA 4F79A 4QCEA 1DWGM 4MB3A 5EFDA 2CBJA 1E15A 4H8VA 4LYRA 4KWUA 4MNLA 3WDRA 2CITA 5IFPA 2EPNA 5I77A 1B3YA 3F4VA 3L2LA 2D2OA 4LXFA 1JZ7A 2WYSA 7A3HA 5GPRA 1UR9A 1OGSA 1FH8A 2VR5A 3ARSA 2GK1A 5FIPA 1LJYA 5C70A 5C8BB 1CENA 2XWEA 4MAZA 2VOTA 3AS0A 1UKSA 1WPCA 5A8MA 3WH6A 1XYZA 2DSVA 1LLOA 3WEMA 5HPOA 1WO2A 2CHNA 1JZ4A 2WANA 1GOIA 3L4TA 3D5HA 1H2JA 3POHA 2OSXA 1OB0A 4DUVA 3WNNA 4QCFA 1KFWA 2WVVB 1IZJA 1JZ5A 4M80A 4UQEA 3A4AA 1HKMA 3LPFA 4OZOA 2DEPA 1KQYA 1NOFA 3N15A 3WD2A 4PBGA 4WSKA 2WNWA 3CZEA 3EDDA 1BG9A 1EDGA 4FF5A 2CBVA 5FOOA 5GNXA 2BNJA 3SCWA 3PZIA 1UZ4A 3CHFA 1HJSA 1UR1A 2CYGA 1C7SA 1UD3A 1WB0A 2V5DA 5D9MA 3WH9A 2CPUA 3U7VA 3GH5A 1GUVA 1HIZA 1P6WA 1TVPA 4GINA 2Y24A 4PMXA 4QLLA 4RE2A 1MWOA 3CHCA 2WBGA 1BAGA 1F4AA 4PTXA 3WN6A 1V0KA 1MW0A 3WD3A 4UOZA 3LPPA 4PMRA 2J7FA 1VFFA 1E6XM 1PBGA 2FGZA 2JF6A 2YL9A 4J3UA 2W4XA 3W29A 3VX1A 2FGLA 1QW8A 1BTCA 4OBRA 2BY0A 5E0CA 3WMCA 3ARQA 1E6QM 3W38A 2V3FA 3ZR5A 1J0KA 1SYTA 1X6LA 2Q8XA 4P8WA 2V3GA 1FP8A 2G3IA 4JCLA 4IPLA 1W9DM 1HJUA 1H5VA 1KR0A 2J4GA 3L4WA 3WBEA 4M1RA 1NWRA 1X1NA 1J0ZA 3EMQA 3AIQA 3TA9A 5BWFA 4OOZA 3BSHA 1VBRA 1NOWA 2WM0A 1MFVA 1AQMA 2D23A 3OLEA 1NM9A 4UQCA 2W5FA 1MW3A 1CXKA 5A69A 4IISA 4BS0A 2ZXAA 2ZWZA 2ZOXA 3GBEA 1J9YA 4OKDA 3WFZA 5ABFB 3GH7A 1JD7A 1W3LA 4W7UA 4MADA 1QNRA 4HU8A 2XVKA 1UD5A 3CZLA 3VD4A 1J0JA 1S46A 1JI2A 2XVNA 3WF4A 3B8SA 4D6JA 5E70A 1IV8A 1MW1A 4NRRA 5DFAA 1WP6A 4YPJA 2VNCA 1E4MM 1JG9A 4HU0A 2DSKA 3ALGA 4J27A 5A6LA 4D6EA 1XRVA 3ZJ8A 1KCKA 1W3HA 2YA0A 3HMCA 3CLWA 2EJ1A 1K9DA 5I2UA 4ZXOA 4GZIA 2XGBA 1ZB5A 1LG2A 2W91A 4ZE5A 3VVGA 2YDQA 3WUFA 4CVWA 2ZE0A 3NYDA 5ABFA 2J7GA 3ZT7A 4JFVA 1OGGA 5AYBA 3AS1A 3ZIZA 4UFMA 1FHDA 3WDIA 3WQVA 3LPOA 3CZJA 1HN1A 1QNQA 2BY1A 1WZLA 1BFNA 2G3MA 3UCQA 1V6WA 2E9BA 3KE0A 3BAXA 1ZJBA 5DO8A 2E3ZA 4CKQA 3IK2A 4LGXA 4TX8A 3PTQA 4OJYA 1WDSA 5E6YA 3VDHA 2UY3A 3VGEA 3RILA 3WL0A 2BXYA 1UKOA 3FHAA 1UWSA 1RP8A 2CKSA 2DT2A 3FW6A 1TVNA 1Q4NX 3W0KA 4AIEA 2EPKX 3N9KA 1JZ3A 1W9BM 3PBGA 2XG9A 1JNDA 6A3HA 1ITXA 1KXHA 4P8XA 3AHZA 3AS3A 4UQ9A 4GO9A 4CD4A
chains in the Genus database with same CATH superfamily
1OCNA 2P3ZA 1BXBA 2VR4A 1QPRA 4MGGA 2PA6A 4N9DA 2C1GA 2CHOA 3A3HA 3CWHA 3QHMA 3NZ1A 1QDSA 4GZ7A 3UW6A 4A8IA 1ZTVA 2VGIA 3UFYA 2R6OA 3UR8A 3ARRA 4Y96A 4XBSA 2QF7A 3W1UA 3G1YA 3OVRA 3H53A 4IFOA 3APGA 3W76A 1M6JA 2XM2A 3BG9A 3GVRA 5GJNA 5IDZA 1ISYA 1UWTA 3MMTA 5C7VA 4NXSA 1YE4A 1ML1A 3N9RA 4B5UA 1JQXA 4GD0A 3AXXA 4UXDA 1XD0A 1GONA 4PMQA 1E1EA 2YL5A 4N4PA 1XS2A 3AS2A 1WAWA 3A9IA 4OBTA 4YTRA 5FEXA 3KRZA 1GZ1A 4EXAA 5BU6A 4ZO7A 3UJSA 1PIGA 3W25A 3M5VA 4HGXA 1XI3A 3KS5A 1S2CA 4JFSA 3LTYA 4GXPA 4Z1CA 1FWFC 4KFPA 4N0RA 3RJYA 4AZCA 1Z8AA 4CD6A 3CBWA 1HTIA 3STPA 3O6YX 3C0QA 5CBBA 3XINA 3VOCA 1XIIA 4AH7A 4UZUA 4WF7A 3H2AA 3KAOA 1XBVA 2C1IA 3ABZA 1ICSA 1YLVA 4QEEA 2PAJA 4K6AA 1K8CA 1G0CA 3LYEA 4U31A 3QMRA 1LP6A 3TWAA 1WOAA 3NDZA 4L61A 5I3IA 2DT3A 3GC2A 1C8QA 4ZENA 3SCTA 4AD4A 4PB3A 1XD1A 4JTEA 3WF0A 2XDFA 3RX4A 3GHUA 3RDKA 2OODA 3WMBA 5BXTA 1EC9A 4M6VA 2Y0FA 3S5NA 3EYPA 4Q4OA 3DAQA 1R9YA 2ATMA 3N2TA 4DJED 1GQIA 1TMQA 1S1PA 3CC1A 1R9ZA 1XDJA 3FKKA 3S42A 3PZQA 4CN1A 1DJWA 1WX0A 4Q4PA 2MUCA 4DQWA 3DENA 3WQ6A 1KV5A 3QFEA 3LCFA 2A3CA 3VKCA 3WDHA 3LRMA 1YEYA 3ZQ9A 5DMLA 3M47A 5IOBA 1W54A 4ZB2A 5DMMA 3WFAA 2YFNA 3R8GA 1VPQA 2O9PA 4UTIA 4O19A 4Q8OA 3QPYA 3CTTA 1VFLA 1AZ2A 4M7TA 1UJPA 3LXBA 2CWXA 1QO2A 1FWAC 2GUYA 2ZUNA 1IGWA 1VKFA 2YXGA 4MF4A 2C3ZA 2BDQA 4IUOA 4KETA 3P8IA 1Q6LA 1EPVA 1Z41A 4M51A 5F2GA 2UY4A 3SCPA 3M0XA 4G7FA 2J77A 3N17A 1UG6A 1DIDA 4Q7BA 2V2CA 3I6EA 2Z1XA 2CC0A 3G1VA 4MB4A 3ITYA 3KHJA 3H4GA 1DQUA 4TXEA 2DZXA 4EANA 3WBYA 1AH3A 3KWXA 2A85A 3WD1A 3O1NA 1LBLA 3IIOA 1J5SA 5CSUA 5CZTA 5FJRA 4ZQNA 1Y5XA 3RRXA 3VABA 3PBYA 3VU2A 1EC7A 2PDBA 2C0HA 3EB4A 3AZSA 3GXMA 4IQDA 2PODA 4E2VA 3BAWA 2YDSA 4RW5A 4LVDA 3OO2A 3TZNA 1DOSA 3D47A 4LAUA 4LEQA 3W75A 1RQEA 3V5OA 2VZVA 5F7UA 2ALRA 2FFCA 4L65A 2XWDA 3LTPA 4MWAB 5JUVA 4A4AA 2EG8A 1BF2A 3VDBA 3HGOA 2GUBA 3QPEA 1UWIA 3RCNA 1ESWA 1OC7A 1WDRA 1MYRA 2FMNA 3NIYA 3NQ7A 2YX0A 2CLMA 3BW4A 4KWSA 1AH4A 4W9TA 5AC7A 1MFUA 1CGXA 2EPLX 1DWIM 2WZIA 1T41A 4KEMA 4LYKA 5A6JA 3P0XA 4O50A 3WENA 4ZFCA 2XVGA 3NDYA 1QAPA 1C91A 3MA8A 1OFEA 4NAFB 3HV9A 4Z1DA 2VEMA 4JY8A 4L6HA 3S5ZA 4ZEPA 4B90A 3IWPA 1ZCOA 3A13A 4RZ5A 4NJHA 4LFYA 1E0VA 1BGAA 1YXCA 3K4WA 4UQAA 4DWSD 1GVQA 2Y4SA 1OFPA 3NTYA 1JI1A 1KCXA 4C5YA 1HG3A 3NQBA 1GT8A 5CLWA 1GPWA 3TLLA 3NQEA 3PJUA 5D8WA 1S2TA 4XUYA 2PBOA 1CECA 4FEZA 4QR6A 4Y2WA 2B7QA 3BW3A 3CUGA 3FJ6A 5K4XA 1A5CA 1ZNNA 3C0LA 3KS6A 2HVMA 1XISA 4ATDA 1TELA 2DUXA 2OZTA 2F2HA 2I14A 2BVYA 1PX4A 2O9RA 3GU1A 2E6FA 3GDBA 4L7ZA 4AB4A 4MAVA 3OA5A 1DP0A 2HE8A 4MLRA 2Y63A 5G4WA 4K1GA 1BYAA 1NELA 4GE8A 3BICA 4FNUA 3TC3A 1H0GA 4R88A 2ZX5A 3LLFA 2W92A 1P0BA 3BG3A 5I6SA 3GC4A 1ZY9A 2QKFA 2ZVRA 3SY8A 3AMLA 3EMZA 1S38A 3LB0A 5CPTA 1S5VA 4AQLA 3P2VA 2VJXA 1RA5A 4XIMA 3ONBA 1XM3A 3M64A 3ITGA 3WX7A 1QHOA 3O9NA 4XTDA 1FH7A 4QQUA 2FJKA 2WKJA 3FJLA 3QV6A 4B3LA 1P48A 3TSBA 1NF0A 1RLDA 3L65A 4AF0B 2DZUA 1PKMA 2FZBA 3UWVA 1XLKA 1YDYA 3IAQA 4DBEA 3PPFA 3NDOA 4RDZA 1U33A 1C90A 4XQ6A 4BR1A 1FBAA 1OCQA 2G50A 2PP1A 3HG5A 1YDVA 2O9OA 3H6OA 4QISA 3AICA 2Z7GA 2V5CA 3IK4A 4CNOA 1I2OA 3S9YA 3THQA 4MUPA 1LT8A 1MSSA 3ARPA 4HHPA 1O7AA 3QM3A 3CQHA 5CJNA 2R24A 5CSRA 5C0QA 4EWND 4IIEA 4ORMA 5AVNA 1E1FA 3OQ8A 2VX6A 1EYEA 1QHZA 4UTWA 1H3GA 3CPRA 2OOGA 4K7YA 7REQB 4JL1A 4PSPA 1Q45A 1X1OA 2CLPA 4KH2A 3LCHA 3SN4A 3QC0A 4JKMA 1AA1B 4C91A 4F0HA 2JKEA 1WZMA 3PK7A 4WIWA 1VJZA 1XLAA 3NEHA 2VELA 1UPPA 1RD5A 5AYIA 1FDZA 5HQMA 4JDBA 1LQ2A 1E4NA 4L4LA 4GBUA 1NDWA 4CNPA 2HDJA 1ZJIA 4HMCA 2NUYA 4H3DA 3UEQA 3GHSA 3PPGA 1B3WA 3AYRA 4FNTA 2IQ0A 1IEQA 3PJWA 4G2DA 3LU2A 3HO8A 1R5YA 3WO8A 3PS7A 3GG0A 1YDNA 4DX3A 3GC5A 2V8ZA 4KRZA 3G0XA 4INFA 1S39A 2QPUA 1PZ3A 3N2XA 3N14A 3LZ5A 3WUEA 3MV01 4IJCA 2A5HA 3G3DA 1BG4A 1E5NA 4NZ5A 3ONCA 4V27A 4HHMA 1RPKA 2NQZA 3RMEA 1C9DA 4PMUA 3T08A 1KB3A 2IMRA 4QLJA 1FFQA 5I03A 2O92A 2AKZA 2QCMA 2HVNA 3THAA 3SCOA 1IEIA 4DPPA 3WNOA 3N2OA 2ADAA 1XPGA 3SUSA 1UQZA 3PN8A 2E1WA 1H1ZA 3QGAC 3AIEA 4U4MA 3AJ7A 6XIMA 2PRMA 1WKFA 2XISA 2ZKMX 1EHNA 2HCVA 1VHNA 5FF3A 3ZSSA 3FGCB 3LV5A 2L5HA 4O1BA 3VFCA 1GOQA 1DJIA 4AYGA 3B03A 4JIIX 5DMNA 2WJEA 4J1OA 1KTCA 2XH0A 3CIVA 3NR0A 1CLKA 4RNFA 5EPDA 4MKVA 3B9NA 5J04A 1IXQA 4HNCA 5I09A 3ANYA 4IFKB 4IIBA 2FDSA 3PHAA 1WA3A 3WF3A 4S3AA 4D6GA 4A3QA 1GJPA 3HJEA 3KEHA 5DT5A 1UW9A 4S3BA 1R7AA 2HS8A 3WQEA 4LS2A 1EOKA 3W07A 1EUAA 4RDVA 1PXGA 3DHFA 1RH9A 1KRAC 3IJIA 4XD4A 2AKMA 4MDPA 3TLQA 2V9DA 4G5DA 5K9CA 3W1LA 4R85A 2FFIA 3QW3A 1KRBC 1EBHA 3OG2A 4PUMA 2ZRZA 3SAZA 2PZ0A 3EZ4A 3TFXA 3HFYA 4GBDA 3IV8A 4Q8NA 4YN5A 4NT0A 4G8TA 3VILA 2V38A 3A64A 4A8NA 5BRBA 4RNHA 3C0JA 3QFWA 1BKSA 1N8IA 2W27A 3KVJA 4CGTA 3G24A 3LUTA 3DHDA 2BTMA 3QRHA 3H23A 3BE7A 4LQ1A 4GHRA 1PAMA 4NX5A 1TREA 2ZZ5A 3VNJA 7CGTA 2C91A 2QCGA 4FXSA 2YCEA 1XH0A 3NQMA 2AL2A 1IIGA 2WHKA 4E5TA 1DHKA 2E77A 4CU7A 1W2VA 1W1ZA 1YKWA 1I0DA 5ABHA 1LBFA 4HSHA 1B57A 1G69A 3UESA 2OX1A 1EJRC 3IUDA 4KGLA 1V3JA 4O1EA 4AWEA 3BURA 2OO6A 1KFJA 3SRKA 4W84A 3T2PA 4QDMA 3VOJA 2WMIB 2QV4A 3IRSA 2PB1A 4HN8A 3TWBA 1LDCA 1S2VA 3NCOA 1HP4A 4O54A 3H26A 1ZP4A 2ISSA 4J3WA 4H2CA 3CV6A 2BGQA 5XINA 1S5NA 2FVMA 1XYMA 2NQJA 2FGBA 1VFOA 2E8YA 3DU0A 5A95A 2E8ZA 1MZRA 2CHRA 4LB4A 5D05A 4Z08A 3IVSA 3TN3A 5E5CA 3B8DA 2OLAA 3URQA 4KCVA 3P82A 1PWLA 4MTVA 4Q6JA 4AYSA 1H41A 2BHUA 1ZS2A 4NNCA 1FCUA 1KO0A 2C15A 5IHRA 2G3JA 3GW3A 4I7WA 1G1YA 3FA5A 5FKYA 1A3HA 3H2OA 1W91A 3SUUA 4JXCA 4PCNA 3C56A 4LB3A 3SY1A 3GXTA 1Z69A 3V5CA 2GJXB 1IIHA 1HKKA 4XBJA 1W0MA 1BXCA 1RBAA 4OTKA 2JFEX 1MXGA 3ZM8A 2TSYA 1B1YA 4S39A 4IF2A 4H01A 3B9OA 2XSBA 1QMLA 5EMJA 3TTYA 3AIRA 1LROA 3ITVA 3K1DA 4AZ7A 3N34A 3A6OA 2VZTA 5H2ZA 2FB3A 1VYRA 2IW0A 2NVDA 3H7UA 3VIJA 5BRPA 4DJDD 3PM6A 3MCNA 2EEXA 3VMOA 3GIYA 3UG5A 1KFBA 4JQ4A 4QLKA 9XIMA 1V77A 4Y8FA 3UETA 1TCDA 2Z7KA 1IHIA 1P43A 1O1ZA 3NZQA 3QZAA 4CD5A 1J79A 4DRSA 3W6LA 5I7GA 3WLQA 3BGAA 1JYXA 2DSWA 2W63A 3BH4A 3GX9A 4TVUA 1R8LA 4LUJA 3O6AA 2I56A 3UPWA 1IZCA 3RMJA 1V03A 4D6DA 1XLJA 3LSBA 3R6IA 2FPYA 3C3NA 3SO7A 5DCDA 3UA3A 3OHIA 3MU7A 4YYCA 3CUXA 4GGBA 4GY1A 4UTKA 3KCOA 4EIVA 5CPLA 3NZPA 3WH7A 4EXQA 4R3UA 3SY5A 4L5ZA 3AHTA 3CUFA 1M68A 4IG2A 4Y9NA 2O4QA 2ZTJA 1A4MA 1UP3A 1MQPA 2QMKA 4R7WA 3LLXA 2OEKA 3CZ8A 5AC8A 4KEZA 3FSUA 5D09A 3QR1A 1IT0A 3RO6A 5I5RA 3L0KA 2X16A 3B4YA 1X7IA 3QHNA 1TIMA 1TPFA 5E9AA 6TAAA 2YGYA 4L6OA 1T6MA 1LQAA 4KRTA 4I9MA 4GYPC 3MBFA 4AZGA 4RNJA 3MUZ1 4JTTA 4D8ZA 2WVVA 3DG3A 5AFDA 3HGRA 4NZFA 1CTNA 4LYQA 3NZRA 4PZVA 1E40A 3GZAA 1UCWA 2QVHA 3KDOA 3W88A 2H90A 3DBPA 4FPSA 5G4HC 2CLHA 2PDUA 3WH5A 4HIBA 5FL1A 3T4CA 3ABRA 2BHYA 3SCSA 5HR7A 1UR8A 3NO1A 4MWAC 2WCAA 1EH9A 4NX0A 4P7NA 1W1YA 1F3TA 5A8NA 4PA8A 5CJMA 1JF6A 1YNQA 4POCA 1WXZA 3E02A 1AJ2A 2DVXA 2ZRXA 4GJIA 4O53A 3REQA 4GCAA 1HO1A 1UP0A 3EBVA 1OX4B 5D4YA 1KQZA 1DTUA 1P0NA 3PUDA 4CN6A 3Q4DA 4F3HA 2V3EA 3EXSA 3LZ3A 2QCHA 3DFTA 2O7QA 1TTIA 4CNSA 3CB8A 1RK6A 5DXXA 4L64A 3PUGA 1K77A 4NZ3A 3S5YA 3DOPA 2CBIA 4OWGA 4HMEA 2PP0A 2Q3RA 1YTDA 1E72M 3ARWA 4ZB5A 3N6JA 4MKNA 2X05A 1FRBA 3AC0A 4LU0A 2V30A 3WDQA 3VIFA 1KW1A 2FH8A 4L9YA 3MSDA 4YIWA 3E0WA 2P3EA 2VR2A 4C6FA 1UROA 4H2HA 4C6KA 4P8UA 1X97A 3AFBA 3IS4A 4E6MA 3ZZ1A 3FLUA 1R85A 1UR0A 1L6GA 1RSCA 5HXMA 4UTWC 4S3GA 2IXUA 2V2DA 2ZICA 4ZTXA 3NL2A 2TODA 5FACA 3FK4A 3NA8A 1CGTA 1D7FA 2I16A 3NO5A 3VM7A 1TWIA 3RRAA 1QWKA 4E4PA 5I3HA 4DBDA 3VO0A 1XYBA 1EWDA 2XU2A 2UY2A 3OODA 2HK0A 2J8GA 1D7KA 3DGBA 1V8EA 3G5EA 2GQ3A 3O15A 1FFRA 5C5YA 4ERIA 1LF1A 1SW0A 3PZTA 2VX4A 2Q8ZA 3NVDA 4PBFA 1GWJA 4DO5A 3MY9A 2HEJA 1R3TA 1BYBA 2GFTA 1H0IA 4HPGA 5BRQA 2GZXA 2DVUA 1UA3A 1KLYA 2QW5A 4RDWA 2CIPA 3OZOA 3VDGA 3C2FA 5KZDA 1F6KA 1US2A 2ISWA 3VKJA 3LNPA 5EB8A 1XF0A 4WY0A 3MP4A 3KM8A 4AZ6A 1LL6A 3URAA 1DQWA 3WUBA 4LT9A 2YDRA 3DUGA 2HZGA 2VFEA 3U2CA 1SJBA 3EX1A 1R87A 3VZXA 2QPSA 1R3YA 2FPVA 3HTWA 1ITUA 4QTGA 2C16A 2A3LA 1QNPA 4WLCA 2V67A 1TPEA 3MP3A 3O8AA 3BLEA 1CLXA 2ZUMA 2VZOA 3GR4A 1QPOA 2OWCA 3UWUA 1NFBA 2DUAA 3VOIA 5I3GA 2WHLA 1A50A 3TJLA 4MKSA 3E0LA 1EP2A 4AVNA 5HMEA 2D0GA 3KW3A 3LHWA 4HT3A 2EPOA 3W84A 2OYKA 2PWDA 4CQAA 4N9EA 1KM6A 4CQCA 3A4WA 3VGGA 1W5MA 3IJLA 4PMZA 1SPQA 1A5LC 4OBSA 2FTYA 1VLIA 1X8FA 4UB9A 1T99A 3WDJA 4REQB 5CC7A 4O0QA 1XBYA 3P60A 4LY4A 4I3GA 1MMFA 2EG6A 3PY2A 3B8VA 2CLLA 3BK0A 1IR2A 1UOKA 3U4FA 1PHQA 3LS9A 1JCMP 3VGHA 1RALA 1XWYA 2XH7A 4GKTA 4HA3A 4JTCA 3STGA 3W4RA 1CPUA 2VYOA 3E2QA 1TQJA 4AIUA 4B3KA 3HURA 4HYVA 3FSTA 4QXIA 1DORA 4QHRA 4J3VA 3BAJA 4M0XA 1ONWA 1S5TA 1E71M 3T81A 1PCKA 2CZVA 1TZ7A 3THCA 2PWHA 2AMGA 3NVTA 3DHUA 5FAGA 4MB1A 2NQ9A 1WDPA 3WQDA 4OU1A 1GYNA 4X9SA 3AYSA 2F6KA 2J47A 3LENA 3RFAA 2A21A 3UYIA 1W37A 2WKLA 3M43A 3L2MA 4Q3MA 4CU8A 1CGWA 3MO7A 3JR2A 3M0ZA 3I10A 2X1UA 3GVVA 2YJQA 4G7EB 4DO6A 3AIUA 4Z2LA 2UBPC 3NM3A 4K8HA 1BXNA 2Z28A 2JKPA 1EJSC 5DMYA 1Y5VA 2PE4A 1FH9A 4AEFA 2KAUC 2J75A 1DJGA 2QCLA 3K5XA 4MSSA 4JZ5A 1M3UA 4W5UA 1P1XA 3IGUA 2BV9A 4TOQA 2VDGA 1W1TA 4IL0A 2XTKA 4Q33A 1HJWA 6ALDA 3P67A 2EHHA 4HZ6A 4M24A 4JIEA 4YCOA 3AWNA 4O57A 3G22A 4UNLA 4PCSA 1OD0A 2B81A 4KCTA 4L1WA 3EDKA 3OIXA 1XIBA 3C6CA 1I2QA 2OVLA 2VXNA 3M0HA 4PODA 5HINA 2WCSA 3UZ5A 1B0IA 3GNRA 1AFSA 4Z1YA 2IKIA 3F7JA 1TJ1A 3MVTA 5LNVA 1PYFA 1XL9A 4G56A 1VJSA 3ARTA 1ZBVA 3BMXA 4AX6A 4NP7A 4H04A 1HJVA 4JS3A 4FR6A 4H9VA 4X3ZA 1GQJA 1K1DA 5A3HA 2PRHA 4FOKA 4F2UA 3L9CA 1KBBA 4HP5A 4A3YA 4E3VA 9CGTA 1OQFA 4GMEA 5F4XA 3NQVA 3VIPA 4A05A 1YTEA 4CQ9A 3W7QA 1XLFA 4UCGA 4F0RA 1YBQA 1G94A 4AZIA 3AWOA 2YA2A 3TYZA 3CUJA 3TXZA 3OVGA 2ZADA 3OPSA 4LAZA 3EXTA 1AODA 4S38A 4GRSA 4EF8A 1A5OC 1UIPA 4QCEA 1DWGM 1H7RA 5EFDA 4H8VA 4KWUA 3H8AA 4PTDA 5I77A 3F4VA 5PTDA 3EPMA 1EEXA 2FMOA 1RJRA 1R6WA 5FJJA 1OGSA 2VR5A 3JW7A 3SW6A 5C8BB 1CENA 3EA3A 2XWEA 2VOTA 1LUCB 3EOOA 4IIGA 4IMEA 5A8MA 1FWDC 1R3VA 2DSVA 2CHNA 3R89A 1JZ4A 1CCWB 3IIZA 3N6HA 1H2JA 4DUVA 3WNNA 3LA4A 1KFWA 1UBSA 3B04A 2E1DA 1V6TA 3C2OA 1Z6KA 1F8MA 2PGWA 2OB3A 1JPMA 4PBGA 4WSKA 2WNWA 3CZEA 4Z17A 4PL1A 3SCWA 4XAGA 3PZIA 3CHFA 1TV2A 3C0SA 1LUCA 1B5TA 2CYGA 3BJSA 2P0OA 1C7SA 3IV3A 3GVGA 2V5DA 3UCDA 5D9MA 5LXXA 3NXFA 3E6EA 3WH9A 1HIZA 1EFZA 4RE2A 4IPPA 3QSRA 3O16A 4DZ5A 3CHCA 4PUUA 2WBGA 1BAGA 5C2CA 3VCCA 3WN6A 3ES8A 1TTQA 3CL7A 2QAPA 3WD3A 4HJWA 3VX1A 1HZYA 3JZUA 2Z4GA 1XYLA 2Q8XA 2V63A 5FF0A 3NQ8A 2G3IA 4IQEA 1H5VA 1KR0A 5C9UA 4HSNA 2EJAA 3CEUA 1F07A 3N19B 1H7XA 1NWRA 2A6LA 2Z1BA 3AU2A 3TNBA 4KFNA 5BWFA 4OOZA 1VBRA 1CX9A 3NL3A 2O4MA 2TYSA 1XX1A 1XBZA 1NM9A 2Y85A 3HB9A 3W85A 1RJPA 3LV6A 2W5FA 1MW3A 4K36A 3RX2A 3R7MA 2ZXAA 2ZWZA 3CPGA 1J9YA 3WFZA 5ABFB 3GH7A 1W3LA 3PG9A 1EF3A 1LLWA 4MADA 4ONVA 4HU8A 3QZEA 1YMYA 1UD5A 2DV0A 4H6RA 2DORA 5BMXA 1JI2A 5F4SA 4DXVA 3B8SA 3NQ6A 5T91A 1KD0A 3PANA 4AVOA 3AJXA 4YPJA 1E4MM 1MUMA 2YB4A 3T44A 4GX8A 1QTWA 3BSMA 3HMCA 4PRTA 1WKEA 4GZIA 2XGBA 3W7DA 3WQGA 1QT1A 4G6CA 2PDMA 1VPXA 3UJRA 3ZT7A 4ALDA 5LIYX 4P61A 1D8WA 1I2PA 2NX3A 2XIJA 5D37A 3ZIZA 4UFMA 1YX1A 4PB4A 3ZS4A 3TAKA 4DIAA 4WXYA 1QNQA 3GXNA 5LIUX 4I7UA 2H3BA 4RDYA 2HV5A 3W7GA 1DXFA 1BTMA 4B4FA 5GJPA 1O5QA 1XUZA 4M1BA 4CKQA 4RZ6A 1VQTA 2FVKA 5FSEC 5HUOA 2BXYA 1UKOA 3FHAA 1UWSA 3FW6A 1IT8A 3N9KA 1F6PA 1EF2A 2PDKA 1JNDA 3W2KA 4QNWA 2Z29A 4EPBC 6A3HA 1PTDA 1EX5A 5DRIA 1XXXA 3AS3A 3V18A 1EIXA 4UQ9A 4WEVX 4LVAA 3PFMA 3WF1A 3UG8A 4W93A 5D03A 3GDRA 1GOXA 2HISA 1Z44A 3MB9A 3M0MA 4W85A 3S2NA 2ZZ3A 2C7FA 1O5XA 2QYGA 2F38A 3W1AA 3WH8A 3RU6A 4BI5A 1XGEA 5D9OA 2PDCA 4R9OA 4JGDA 1SVDA 1UZ1A 3AUJA 3PG8A 3UCCA 1Y0EA 3WJZA 3W27A 1KTBA 4QEHA 4FALA 3DG7A 4TVDA 3IGXA 1ISVA 1UH2A 1MVYA 1QWGA 2WWDA 2NVAA 3L4VA 2W62A 4WCJA 1UWQA 4W88A 1WKYA 1U2YA 2QUTA 2WOQA 4O28A 1IXPA 1UKQA 1H09A 4K38A 1YW1A 3ME3A 4GI9A 1JUEA 2ESCA 3SGUA 5AN7A 4U2YA 2TRSA 3ZOAA 4GNVA 2OGYA 1WV2A 2WB5A 4RK8A 3ARVA 1EL3A 1KM2A 1U1JA 4DUOA 1DE5A 4C6OA 3EKLA 1VHCA 4I5RA 3MKVA 1VEMA 2ONEA 3H2MA 4R7OA 4AEEA 4S3KA 2FDMA 4DAIA 4JY9A 3UXAA 3TU9A 3L68A 5HK4A 1A53A 3DG6A 4HSOA 5E6ZA 2R1PA 3ANVA 5L9FA 1E4LA 1KWGA 3H4XA 2PF0A 3K8KA 3OJGA 1N82A 3WMSA 2A6NA 3TJIA 2PLMA 1Q63A 2I5QA 2VDIA 1C29A 4QE4A 4MNMA 3HPFA 3SM0A 1QASA 4AMAA 4C6JA 3EWWA 1R3RA 3SSZA 3G1HA 3UA4A 1F7BA 5T9BG 3B8TA 3QOKA 1XCWA 1J01A 3L23A 1W2PA 4QDPA 1ZGDA 4M6UA 3ZVIA 5K2ZA 1JIBA 4EK7A 1OG0A 4XKYA 2PWUA 1XICA 4Y9PA 4H83A 3VIMA 1PKYA 5BU9A 3MO4A 2OWXA 3GDTA 2WMFA 2WBKA 4L4MA 2WMJA 3NO3A 4JNMA 4UFHA 4ORIA 3L0NA 1J8VA 1E5JA 4OT7A 2WZEA 1XRFA 3GAYA 1W5OA 4TO8A 3ZJKA 5D32A 1OC6A 1MEIA 3ARXA 4Z2JA 5AC5A 1TUFA 3BPWA 2GJLA 1OBAA 4K3ZA 5E0KA 3VD3A 1WE5A 4YVVA 1XRTA 4YCPA 3F2CA 2ZUTA 4LUTB 4PTVA 2G95A 4S2BA 4B16A 5AC4A 2W0UA 2PTDA 5CKSA 2R91A 3GK0A 3GLCA 3WCZA 3FVMA 1M1BA 2VWSA 2A7NA 4J3SA 4LUTA 1VS1A 3PVFA 4LV9A 1VYSX 3EB3A 1LCOA 5D2TA 5LYRA 4D9PA 2NX1A 2W61A 1IE7C 4M6PA 5KETA 4AX7A 1TX2A 4CNUA 5HMDA 1PHWA 4FXJA 3SGGA 4IMAA 2IPGA 3O06A 3M0KA 1GYLA 3LM7A 2PGRA 1KLZA 3R8HA 1P7TB 2RDXA 4IPIA 4WJXA 1PV8A 3DFSA 3LXAA 3FXYA 3L4XA 1H7OA 1NH6A 3H21A 2Z1VA 3N2BA 1GG1A 4LV4A 1AD1A 1JULA 5TBOA 1Z9AA 3EA1A 1BPLB 5CGQA 3W28A 4BI6A 1FWWA 1UKPA 3F5JA 3KOYA 5HJLA 4L56A 1YNYA 3RO8A 2JGYA 2Q6ZA 3L67A 3V1PA 3U8GA 3DFQA 4HMNA 3WMLA 3F5LA 3HG2A 2Y5JA 3W7CA 3BTNA 1EXPA 4JHOA 2XSXA 2XH2A 4C90A 4L9XA 2QJJA 2QDHA 2RDTA 1SZNA 3FKRA 4BHYA 2QGHA 4UC5A 3N4EA 1UKTA 4DYKA 2X0SA 1QNOA 2BP1A 3SEPA 5AY7A 2X2GA 1HJXA 3PZMA 4ZE4A 1JPHA 3GBDA 4PL2A 3FN9A 3WELA 4D6HA 4F0LA 5FEWA 3WG6A 4U33A 4H41A 3C4UA 3IJ7A 5F1UA 1JEZA 1ME8A 1CW2A 3SFKA 1ZCCA 1WQ5A 1V0MA 4LBSA 2ZXBA 3B97A 4W8LA 1LQ0A 4Q6XA 3GNOA 2QCDA 1SR9A 3TTSA 3TYCA 4R27A 1KV8A 2UY5A 3FV9A 4IOTA 2B31A 2VFHA 4IMCA 4J40A 1EJTC 4LEFA 4YHEA 4GKLA 4B2DA 1K70A 3IJQA 1PTGA 1NDVA 3BDKA 3W22A 3WUGA 2QIWA 2GQ9A 1VCFA 4NZ4A 4GY0A 3LTSA 3N6QA 2VCBA 3N12A 3WBAA 1NWSA 3H22A 2OSWA 4F9JA 1XQKA 2FZNA 4MB5A 4O14A 3LGGA 3R0UA 1B4KA 4LAMA 3TYAA 2VEPA 1F73A 3OB8A 3UNTA 1GNXA 1QBBA 4IXHA 1YPIA 3PSWA 3WNMA 1HNYA 3J7HA 2FKPA 1V5XA 3BCFA 2C19A 2F8QA 5TNVA 1TIWA 1EJWC 4XUGA 5BXPA 1Q7QA 5M3WA 2ACRA 2GK1B 1GTHA 1Q7MA 4WSHA 3CHDA 1B30A 2X09A 1OC5A 2PPGA 2OGJA 5KITA 3IANA 3VCRA 1C7TA 4YWIA 1ZZMA 4PTMA 1YE6A 4UZSA 2DIJA 3EWDA 3EOSA 1C8XA 1A5AA 4AD0A 3DH7A 5JIWA 1XLCA 1AL8A 3CWOX 1IT7A 2RJHA 5K7JA 4PYSA 1OSEA 1J18A 3OYZA 1OG6A 4NXKA 4AY8A 5CPNA 3MT1A 1DEDA 4GYFA 4ML9A 2CZFA 1XGZA 1EJUC 3TCSA 3Q65A 3URNA 4CNTA 3U7BA 1TA3B 4JNZA 3UZXA 4BQ2A 1TKKA 1U30A 3W7RA 1BD0A 5B7YA 1JPIA 4PBEA 2ACUA 2C6QA 3BV7A 2OG9A 1QI0A 1HGWA 1V79A 3PP7A 3SRHA 4IUGA 2QDGA 2DGAA 3WLPA 3QV9A 5LGXA 5GNZA 6XIAA 4P2VA 4QITA 4JN7A 1DKWA 4PUWA 3IACA 2VC5A 3B0UX 1KRMA 4L4OA 2V69A 3OOQA 4GLEA 4JTFA 8TIMA 2YLAA 1NSJA 1BQGA 3BLFA 1UR4A 4MJ2A 3E5PA 3SRFA 1V7AA 2Y61A 2YLLA 2OYLA 3S4TA 2V82A 3TQKA 1WOBA 2X8RA 3IIPA 1FWCC 2NSXA 3UR7A 2A2IA 4E2DA 1G5AA 5RUBA 1XLDA 3S1XA 3WNLA 3W9ZA 2AQWA 2VT0A 3AIWA 4LANA 1ONXA 1Q6FA 2F7FA 1TPVA 2VUYA 1VIZA 1FWGC 1VBJA 1UUMA 3T0BA 3R11A 3E5BA 1UMYA 2E67A 4JTDA 3QQWA 4JAWA 3DBNA 3Q58A 2BX7A 2QCCA 2JIWA 1NFGA 5CXPA 3G1FA 5ABGA 1YYAA 4F2TA 1XPYA 2ZRUA 4JHMA 5I78A 1B3XA 4E8DA 3P0WA 1S3HA 1NJJA 2QR6A 2HXTA 1TJ2A 3OP2A 1HUVA 3DI0A 2ZZ7A 2HJPA 4QJ5B 2WK2A 4C6NA 3KTXA 5A6KA 5B7ZA 5E9XA 4PEKA 4KERA 1ZL1A 3RJXA 4C1NA 3HQNA 4RCXA 3CV2A 3GVQA 3W7HA 5BXSA 3OBEA 4XAYA 1RCOB 3PR2A 4LOCA 5ECUA 4FP1A 3ORWA 3RXZA 1ZALA 3HJZA 4DF2A 5CSYA 1RJQA 3QOMA 4A2SA 4FX8A 3ARYA 3CYVA 4P7RA 2ZFAA 3BJFA 1CBGA 1A4LA 1XSKA 3APTA 4KESA 4FX6M 4Z2IA 4PGLA 2FHFA 3ITXA 9RUBA 2FZDA 4XX6A 4M82A 1H1NA 5TD4A 4ZO8A 2WAGA 1VRDA 3LCWA 3KP1A 3THUA 1FWSA 5HA7A 2FLIA 2QLYA 1REQA 3CUZA 1E6NA 4XZBA 2EO7A 5K4ZA 3M6YA 1GOWA 3KTSA 4PMNA 2WCGA 1O60A 5CC6A 4LCRA 3FAXA 4JIHA 3STEA 5JXQA 3WQFA 3QHOA 5M2FX 2DU2A 4JX6A 2ZYFA 3MANA 2GSHA 3T0TA 4DF1A 2QIIA 3PTDA 1TR1A 1OFQA 5CGTA 4BEUA 3BAYA 4GY7A 4JQ1A 2EPMX 3QV8A 2J7DA 1UD8A 5EY5A 1O95A 2HNEA 2AAAA 4NI3A 8A3HA 4DBUA 3ZWTA 3C8FA 1TTJA 1TJPA 4P7QA 4GUIA 1JZ8A 5G2WA 5I02A 3NEVA 4CUCA 4HB7A 3QEZA 1OT1A 2DUZA 4X2RA 3LCXA 1H7NA 3K8LA 1W8GA 5DCEA 1PJ9A 1W9XA 2PCEA 2MANA 3HMJG 3L5LA 1SO4A 4KW2A 3B9AA 4WKHA 1C9WA 4O11A 2ACSA 2V6AA 2BOEX 5A8QA 3LHVA 5AZ0A 3I3EA 4NUWA 3O6DA 2XFYA 4OOUA 2XN2A 2CESA 2PBGA 1N2VA 4W8BA 5H8UA 1CXIA 1O6IA 2WPGA 2X0YA 4UR9A 1WUEA 3GXDA 2HE5A 1F2JA 4EXBA 1HQTA 4NRSA 5AYZA 5TIMA 2RJGA 4O8RA 1OYBA 2ZUVA 4DN1A 2D1ZA 1SFJA 4BJHA 1EA9C 3OGSA 1TTPA 3HN3A 4R5EA 1K8YA 1RCQA 3MUAA 3CQJA 4KEVA 3EWCA 3GS6A 1G7VA 1KCZA 3FHQA 1VEPA 3MMUA 2NV2A 4C60A 3PZOA 4YVXA 1LRQA 1TE6A 3O2LA 1W3IA 4L1GA 2IPWA 1D8CA 5IBXA 5T26A 1Z32X 4Z0JA 3NQCA 1TV4A 5CJ5A 3GIPA 1DJZA 1D3CA 1ELSA 3B8WA 1XHGA 5LA0A 3S3GA 2EXOA 3BVJA 3WLOA 2ASHA 4ZCWA 3KBWA 3GZ3A 3W73A 5CGMA 2C1HA 3A24A 3W83A 2WMHA 1PE1A 4MJ4A 1V3MA 1ISWA 3G1DA 4QAWA 4IX0A 4YLWA 1PL9A 3VCNA 1QPQA 4G9PA 3USBA 4EPEC 2D69A 2PDWA 3WQWA 5I3DA 3QTPA 1J12A 2DH3A 3CEPA 1HXJA 3KL5A 4JTIA 1RZMA 3K46A 1XIFA 1OABA 2CFFA 4KGJA 4UQDA 3TAOA 3W1TA 2XVPA 2J74A 2GDVA 4I8YA 3V35A 3ZJ6A 5HUPA 2WC7A 4X63A 4ERGA 5HWNA 1KWKA 4Q8WA 4JTRA 4J3XA 4MWAA 1SJCA 3CAQA 3L4UA 4LX4A 2XZ7A 1XCXA 3ICJA 2YOCA 1KBLA 1B31A 2OFJA 1LOLA 4ADTA 4WK9A 2GPTA 4P8VA 3OZMA 1GHRA 3PWIA 4NAFA 3ITOA 2GVLA 3MP5A 3T78A 2D73A 4ZVJA 5D04C 4X9YA 3GU2A 4N9CA 3PNZA 5IFTA 2ZDSA 1QPKA 3BLLA 3NNTA 2QQ6A 2YW3A 3T09A 4XZHA 2G3NA 3PBWA 4AWUA 1MEHA 1EJ7L 2MNRA 2NT1A 1UUOA 1POKA 1PX3A 3TN6A 1Q6DA 2Z0IA 1EO5A 1GCYA 3GUWA 1DQXA 1KBKA 4Q7IA 4HHHA 4UOJA 1FDYA 3WQ5A 5H8PA 1HL2A 4J2MA 4BWLC 3SZ8A 2CKRA 2Y62A 3B4UA 3WK1A 3GXPA 2WJZA 1JXJA 1YNPA 3NOYA 2Y7EA 2PWGA 1GVFA 4PMOA 2Z2AA 3OW1A 5DY3A 4LYPA 3R4IA 3AYTA 3MSRA 3QC3A 3P61A 2VI0A 3OYXA 3IVTA 1TZZA 4BY3A 2VHLA 4M6QA 4GXWA 3RR1A 3RGTA 4UFIA 3FAWA 4WY0B 2IKGA 1IGSA 1SO6A 3NYZA 2Z1SA 3CU2A 4S3CA 3ITCA 5I79A 3UP8A 5A6MA 2XSAA 1X39A 3USZA 4KKXA 4QX4A 2WSPA 2GLKA 4QG9A 2OKOA 4LCSA 4Z42C 4PEEA 4H6QA 1LLZA 5D9NA 3VNKA 1GQLA 1US3A 3KVKA 3ERPA 2UZ9A 5I23A 3F2BA 3CQIA 5HJYA 5BOEA 3EX4A 3T6CA 1JXKA 3BC9A 3ZR6A 2C8NA 3UNDA 3GFYA 2ABBA 4UWMA 3SB0A 1N8FA 2IUZA 3ABXA 4A3UA 1QI3A 1XV8A 4IP7A 4GQQA 1OADA 3UWWA 1QCWA 4YMZA 2Y8KA 1JZ2A 3SQSA 2OZ3A 2CZEA 4HTBA 1DE6A 3VC6A 4AIOA 4UIOA 3KLKA 5BW6A 3N18A 1VYPX 2J7CA 4F8XA 3LI1A 1UB3A 2VFGA 1ISXA 3OBAA 3W71A 2AL2B 2VURA 3G1AA 3HG3A 1LOQA 5JU6A 1I1WA 3ENLA 1L0PA 4I9JA 1L2QA 2PI6A 4DXKA 4ZQCA 1HKJA 2JBMA 2ZA3A 3LI0A 2XIBA 1DBTA 1SFSA 1CIUA 3ECQA 3DZ1A 3KUMA 1FVPA 1TR9A 2CZDA 2NXHA 1UP2A 4KCUA 2O56A 2NSOA 1FCBA 1SMDA 3TYEA 1OGBA 3POCA 1CZ1A 5CZKA 3UT0A 3CASA 1BKHA 3D3FA 4NL1A 3GAKA 1HO4A 1V3HA 3ITTA 3R13A 4WZHA 3KLLA 2OYMA 1OINA 1KM1A 3TW6A 4DVOA 4UTFA 3M0IA 4D2JA 3QKEA 3QY7A 2EF9A 5FJOA 4GUFA 3XIMA 2OT0A 4W86A 5DCBA 3LHUA 1X1ZA 3WIJA 3ZSTA 1J0IA 4YHGA 3EWBX 1J96A 4N42A 4PCPA 3TTEA 3HOJA 2ZC8A 1K3UA 4WKFA 4GNJA 1KM5A 4AD2A 2PDXA 4YL2A 4TMBA 1NOUA 2IQDA 4AIBA 4NI8A 3VINA 1QPNA 3LBOA 3R12A 1OD8A 4IQLA 1SQ7A 3P80A 5E09A 1QU4A 2VQUA 4WHBA 4A22A 1GK8A 3QV7A 1F3EA 2HVOA 5DT7A 3S1UA 2REQA 3WJSA 5H1WA 3LHTA 4DO4A 4US6A 1QOPA 1J93A 3U0HA 3V16A 1SGJA 1EDTA 1KXVA 2CERA 1VJIA 1VAHA 3RLHA 2J6VA 1H1YA 1YIXA 1PEZA 3MHGA 2ANUA 3DFNA 2FZ8A 1J0YA 2G97A 4A6GA 3DFOA 4IGMA 5DRCA 4MWAD 1JCTA 4K39A 1EX1A 2VC6A 1C93A 3V3WA 1G4EA 3TOPA 2G41A 1A5UA 1UQYA 2Y2WA 4HN4A 2ZRVA 2VEKA 1F05A 4GOAA 4UFJA 3AU6A 3WLLA 2VKZG 2BG5A 2ZUSA 5CSSA 4O10A 1LTDA 2D0FA 4LPCA 4Z0SA 3QVQA 1OZQA 4U2ZA 3W7OA 5GQBA 3LBCA 1EHAA 1JD9A 3W87A 3LCGA 4B5WA 4GPNA 3O3RA 1VF8A 2X7WA 2PUZA 3H55A 1P6BA 5LSMA 1E9ZB 5BROA 3BXWA 2NX9A 1BVZA 3SUTA 4DEFA 4IJBA 5G1MA 1XJBA 1S3TC 1OF6A 5D2YA 1NFPA 2VX7A 5JMUA 4U3CA 1I6NA 1HVXA 1SU5A 2Y5EA 3RF9A 4NNBA 1JAKA 3O63A 3CLMA 5CG0A 1LWJA 1V93A 4J7RA 4UOQA 3KL0A 3W81A 4RE0A 5SWUA 4L6DA 1EDQA 1HX0A 1JDAA 1H51A 1Q3NA 4RZBA 1CXEA 4HU3A 4AXNA 2VZUA 4UMCA 4AY1A 5CPSA 1HL8A 3F2DA 3COTA 3SJNA 1ODZA 1UZHA 5JBDA 1I60A 3SRDA 1SFTA 3DFYA 1W1VA 1R30A 1W31A 1XIMA 1EWEA 3VKKA 4ECLA 1N55A 4CEUC 2POTA 1MXDA 1KGXA 4W7VA 4CCZA 4GIAA 5FEPA 2XFRA 3PZ9A 3UG4A 3C86A 4LVBA 4DY1A 3SN0A 3MWAA 2GUUA 3C2RA 3MUCA 4F48A 2XIQA 3DERA 2XVLA 5G1TA 2BB0A 3T42A 1E0WA 4FNRA 2CWNA 2QS8A 3KBJA 3KZPA 6PTDA 2C71A 2DJXA 2VC9A 4HVXA 2PGFA 2HXUA 4IPNB 3TC7A 3BQ5A 4IPJA 5HBFA 4I5UA 2GDQA 3I4KA 3K8MA 4LBRA 3IIVA 5G1YA 3GW0A 2CBJA 4LYRA 1H7WA 1P1MA 4MNLA 5IFPA 1FWNA 2EPNA 3S83A 3BWWA 3OQEA 4LXFA 3EX3A 3TQ0A 3WQCA 7A3HA 5GPRA 1VPYA 3O6CA 4I7VA 4MZ8A 5EL1A 4BI7A 3ARSA 4C6LA 3MCOA 1LJYA 2DP3A 4G1NA 3AS0A 1UKSA 4MHBA 1JCNA 5H8MA 3WH6A 1VZWA 5CZSA 5HPOA 4J3ZA 1WO2A 4H9ZA 1XIJA 3AUOA 2WANA 2E6YA 3D5HA 3POHA 4TR9A 3TC6A 1ADOA 2RDUA 3FX4A 3E96A 4QCFA 1IZJA 1JZ5A 1X6UA 4E3TA 1L2UA 1HKMA 4OZOA 1UWAA 2DEPA 1KQYA 1NOFA 4WX2A 1A5BA 3B05A 1S2AA 4LALA 5CAKA 1EDGA 3H2NA 5FOOA 1EP1A 3GFZA 1UZ4A 2NQLA 4UTTA 4TU1A 2GVGA 4QE5A 2VEIA 4GWEA 3IGHX 1UD3A 1WB0A 1PB0A 3P5YA 1XYAA 3TH6A 3U7VA 3SQMA 1GUVA 1TVPA 3SIZA 2Y24A 2OPJA 1TPWA 1EB3A 4ZGYA 1F4AA 5HNUA 2IKHA 4MJMA 1MW0A 4XISA 3PC0A 2J7FA 3EA2A 4J3UA 2W4XA 5E0CA 1E6QM 2F6XA 3VA8A 4GUGA 5FI8A 1W9DM 5REQB 2J4GA 1T7LA 3L4WA 3P81A 3WBEA 4JTLA 3EKZA 3DC8A 1WDDA 3P14A 4GI4A 3WLNA 3RLVA 4B5NA 2ATSA 2QV5A 1XGDA 2CLKA 1T40A 2WM0A 1MFVA 3OLEA 8RUCA 4UQCA 3VE7A 1LZOA 2ODOA 1JR1A 5A69A 4IISA 4BS0A 1KFLA 2J9ZA 5T9CE 1UBPC 2XFWA 3WLHA 1JD7A 1QNRA 2J6XA 2FYMA 5AHLA 1F61A 1S46A 5U4NA 2A1YA 4RXFA 3WF4A 4FXFA 4D6JA 7TIMA 3GY1A 1IV8A 4NRRA 1DIOA 3LXCA 2E6DA 2O55A 2VNCA 2DSKA 2JQXA 3I7QA 1KA9F 1ZPTA 2X1TA 3BOLA 4KPLA 3TW7A 1K9DA 5AHIA 5LIXX 4MUZA 1EXBA 2PCQA 4BKNA 2H9AB 2YDQA 1TPH1 2INZA 1Q13A 2J7GA 2OT1A 3T40A 3CT7A 1LRTA 1N7KA 2D2HA 2KZHA 3WJYA 1OGGA 4H9XA 2PP3A 3VAVA 2DZTA 3WQVA 3V0SA 2WO5A 3MYOA 1OF8A 2G3MA 3VC5A 1V6WA 3BAXA 1ZJBA 5DO8A 1B4EA 3GVWA 1WDSA 3VDHA 4KWOA 6REQA 3VGEA 3RILA 3WL0A 1DJYA 3MPGA 4QDWA 4PUNA 2ZBTA 4XBKA 1Q4NX 4ADUA 4AIEA 2EPKX 4LW7A 1K4GA 3WK3A 1W9BM 2XG9A 1OFBA 3UQNA 3OHMB 3CMFA 3CK5A 1TRIA 1ITXA 4P8XA 1XINA 4H6EA 4CD4A 1YDOA 3U4AA 1ZAIA 4ES4A 1V02E 4H19A 2IQTA 3TVAA 1ENUA 2A3AA 1BF6A 4KIEA 2GSJA 2WM1A 3AISA 3ARZA 3RPDA 3AXHA 4UNIA 5FA5A 2D2JA 2R82A 3G1SA 4NIRA 2F6UA 1RBOB 3CT2A 3A23A 2FTWA 1XLGA 2GJNA 5REQA 4ZOCA 4AMCA 2J62A 4FI4A 4EE9A 1JGMA 5DQPA 1BSLA 4JKLA 1I1XA 5MF5A 1OYAA 2GGEA 1P5BA 4UMAA 3SDOA 3SR7A 6TIMA 3G6LA 3WLJA 4B92A 1DXEA 4XZIA 3T0CA 1KKOA 3GNNA 3Q2DA 5A2AA 4R53A 2VWTA 2V5LA 1MZHA 2GJRA 3CZKA 1EO7A 3CL8A 2H6RA 5A6SA 2AOSA 4JTKA 2W79A 4UQBA 2WMGA 3GH4A 4HPXA 4C7DA 3BO9A 3CV7A 1J0HA 1KGWA 5A5WA 1XSJA 4NZJA 4FLRA 5GNYA 1ZENA 2DIEA 2XGZA 2VTFA 3QKZA 2XYLA 1BWLA 1PSCA 1V6UA 2I7GA 3VI2A 4U5IA 1VFMA 3K4AA 2IXVA 1BVNP 4UCFA 1A0CA 1EC8A 1XIEA 3S9ZA 4AZCB 3UXLA 1IR1A 3ZMRA 1CYGA 1EOMA 1GEQA 4D8LA 3E9AA 3FDKA 2PD5A 1SR0A 1GQKA 3RHGA 1UA7A 1MQRA 4WKAA 4Q8PA 4D72A 3KDNA 4ZOBA 3UR2A 4W4QA 1AQFA 4MNKA 3M0LA 4HK5A 1XH1A 4N7QA 4F66A 3AXIA 3N3TA 4AWSA 4ENLA 4NSBA 3RK8A 2YZRA 3EX2A 4IWWA 4D6CA 4ZQOA 4FLOA 3FCPA 2CU0A 1XUUA 4Q8TA 2YYUA 3TX9A 1WXJA 4KWWA 1R38A 2F61A 4OUEA 2J8FA 2PEVA 1P7TA 1LORA 3HQ1A 4I9AA 2QUUA 1DJNA 4D1IA 4GVFA 4JEQA 4LVGA 2ZTKA 1JGIA 4WR3A 5D2XA 3MI3A 3M5YA 3GNXA 3LPGA 3M41A 1CLVA 3WSUA 3MKCA 5LNUA 1CGUA 1BYCA 1TFVA 2XPKA 1DWJM 4DLFA 3HV8A 4XVEA 4LNCA 4K68A 4MWAE 4H7ZA 3QN3A 3NM1A 3WLIA 4LUIA 1HF6A 4OECA 1OY0A 4XSLA 3NURA 3U57A 1JCJA 3GDMA 2V68A 4J5NA 1O12A 5M03A 1QBAA 4JN6A 3NGFA 1MUCA 4FOJA 1FY6A 3ALFA 4AD3A 3PBMA 1F9CA 4V1YA 2Q01A 1GZGA 5C7HA 4JYEA 3GQYA 3C8NA 4S1FA 4U5KA 4OGZA 1EYWA 2Y89A 5BCAA 1TV5A 2G3FA 1GJUA 3F4CA 1K03A 3IEBA 1F5ZA 2OKTA 3MKKA 3OLIA 4X60A 3M44A 1FX6A 2PS2A 2Q02A 4LWWA 1E70M 3ABOA 1LL7A 2XFFA 2OCZA 2RAGA 1Q6EA 2YYTA 1Q8AA 4ZOEA 5KMYA 3A5VA 3VNYA 4KFOA 3TXVA 3MI6A 4JEJA 1RPXA 4X0VA 5AOUA 1AH0A 4JFWA 1KTNA 3GRIA 1O4UA 1W6TA 3B0XA 1L6FA 2CNCA 4CD8A 4UTMA 3LLDA 4GI6A 3PZNA 2WNQA 1M9HA 5EMLA 1L8NA 3JVAA 1DIEA 4MYAA 1K9EA 3BLPX 2WWCA 4C1NB 1ZSXA 3IUHA 2VD9A 2I1OA 4YTTA 1U5HA 1HP5A 4RUBA 2BBFA 4HYWA 2P1FA 3TQPA 3ID7A 1Q6OA 3WBXA 3MQTA 3OGRA 5TAOA 3LD5A 4XVDA 1YXDA 5DXYA 1V0LA 4GZJA 3W2JA 1A0EA 5FJIA 5CH9A 3O7UA 4ZQMA 2E7FA 4M19A 1Q65A 4WDXA 2OZ0A 1PWMA 5U7SA 3GSMA 3O05A 4Z2KA 5EFFA 4JQ3A 3OVQA 3VZZA 1F74A 5LXEA 1FHLA 3NQAA 3G8EA 2J88A 1GJWA 1VFSA 1M41A 2DY3A 3NL6A 2BXZA 2ZZ2A 2PDPA 2WZTA 4E8CA 5EMUA 4H00A 4Y9AA 1DWFM 4RL3A 1C8VA 1RY8A 4HMDA 2GGIA 2NV9A 1J6OA 3FEMA 4QBXA 2A7RA 1S2WA 4Q22A 3IGSA 4IG2B 1XDMA 3CHVA 4WOZA 3C2VA 1DIKA 3MMDA 2RKXA 3AALA 4EOUA 2B7PA 2VEGA 5H91A 4FS9A 5AHNA 3OGVA 1K6AA 3SCUA 2ALDA 1SZFA 5FF4A 4DJDC 4NZ1A 3CH9A 4LCQA 4S3EA 4AWTA 2I5GA 4GH1A 4NJGA 3W3OA 1XH2A 4GUJA 3N4FA 4OVXA 3RNDA 2YZ5A 2CLIA 1OX5A 5LHFA 4RV8A 4LNYA 1KRCC 1DJQA 4GH3A 3KVLA 4LVFA 1PTAA 2DZBA 2R9RA 1VBHA 1H63A 4N02A 2JK2A 1RV8A 3A9BA 1ITQA 3BLDA 2O9TA 1GHSA 3BW2A 1Q6CA 1HW6A 4ICNA 8XIAA 1E3ZA 3PTMA 2VFDA 1MW2A 4ZTYA 1LYXA 3EKGA 1E9LA 3GHTA 4XKMA 5TF0A 1MDLA 1C8YA 3BZJA 4CNNA 1R3QA 4RE3A 2R14A 3M6DA 1FKXA 4D8AA 4N4QA 4WRHA 5CAHA 2CBUA 3W7EA 2F9RA 4LUYA 1CXFA 4OHQA 1FWEC 3FYPA 3LG3A 1D2KA 4DWSA 4I8DA 3PZVA 3SECA 3TSDA 4JNYA 1WKDA 4P7LA 3IPWA 1US0A 3L66A 3QY8A 7PTDA 3T55A 2KX9A 3VKAA 4WUIA 1L8PA 2ACQA 1AG1O 1ZBKA 1QNVA 2WMKA 4FLQA 3MUIA 5BMWA 2HK1A 4FZIA 1SSGA 2POZA 2NW0A 2E40A 3OA3A 5BXRA 3PTKA 2DSZA 5HOSA 3FY1A 5CCZA 4TTUA 2NXGA 1KGUA 4WQ6A 2ZVIA 3GD6A 3E0VA 3TE9A 1MRQA 2P50A 3NPVA 5KZ6A 3MV11 4N6EA 1FCVA 3UR5A 1V3LA 2EKCA 2Q09A 1VFHA 4MPKA 2WNNA 3QMTA 4IGHA 2J24A 3BMWA 2BVTA 1BWKA 5EMYA 3LHZA 4W5ZA 3DDMA 2F2KA 3KOFA 3MS8A 1V6VA 1WXYA 4QJ1A 3QR3A 4AFYA 1Y7VA 2G4FA 2BXVA 3WL1A 3PWGA 1KBJA 3KHDA 4ACYA 3QYQA 2PDJA 3PF3A 2VEFA 1GVOA 3C3UA 2QPXA 2ABAA 4PUKA 2I5IA 2V5JA 4TUFA 1X7FA 4BCEA 1TMLA 3HGSA 1WYIA 3BGJA 1IQ8A 5HULA 2DT0A 4PUJA 4H8UA 3M5ZA 3TJ4A 3GB6A 1QO5A 4QS5A 3N2CA 5G5IA 3KRBA 2Z1KA 2ZUWA 1PYMA 2BS9A 3HPSA 5D30A 3EGJA 2VFIA 4HNOA 2WQPA 1E9YB 3VD9A 1U1UA 1Z89A 1BSIA 4BEQA 2CCRA 4RNIA 5ABEA 3LQGA 4BF7A 4YJ5A 2VENA 2VCAA 3T07A 3W00A 3H12A 3TCEA 3FVDA 4BQ5A 1VH7A 3PZUA 3FIGA 1R2SA 2BLEA 5D38A 1K9TA 1ONRA 1XLIA 4D6FA 2BGNE 3U9IA 4W89A 1JDDA 3IAPA 5HR6A 1OFDA 4UMBA 3G0SA 3IIXA 3WEZA 5HNRA 1GKPA 2VRQA 1AVAA 1FTXA 1XBXA 2YBVA 1LM1A 4QJ3B 4OV4A 1K8XA 3KX6A 3AHVA 4O17A 3P3BA 5F2LA 4XK2A 5CZJA 4GGHA 5CPQA 3MSYA 5FESA 1W3KA 4HQVA 2B7NA 3G2GA 3ZO9A 3SCRA 1XG3A 3U5UA 1BGGA 4GI8A 4MMWA 1JVNA 4XTIA 1RVGA 3R25A 3WDPP 3D0CA 1MI3A 3M5XA 2P53A 3JS3A 3HU7A 3L2IA 2RDWA 1XLHA 4K1WA 1CWYA 3EPNA 1RHCA 1EA0A 4QE1A 1JCXA 3W6YA 1EBGA 4PUEA 1QK2A 2GJXA 1XC4A 2W9MA 1RCXB 3C2YA 1YHTA 2XM1A 1ISZA 1R0MA 4PUDA 5J5DA 3ZR4A 3OVPA 1FA2A 1E6PA 1QNSA 2JALA 5JIPA 2JF7A 3EEGA 3DYOA 3G18A 4S3JA 4FX7A 1XLEA 2FVLA 4FNPA 1MNZA 4O0KA 5KZEA 3W7MA 5K9DA 2ZUUA 4Z1AA 2HROA 1KFEA 3VDCA 2ZZ4A 4AC1X 3C61A 3G6MA 3S6OA 4EPKA 4E2OA 1OX6A 1QVBA 5AHEA 2HRWA 2P0IA 4RPPA 4GVHA 1CB2A 3GFXA 3EDJA 4D1JA 3B8IA 1Y5WA 1DPMA 1NP2A 2Y7FA 1EIBA 3RPTA 3CGTA 4O1DA 4CCCA 4HOWA 3W1MA 3E1F1 3PJTA 2QCNA 3IUIA 4M7SA 3N13A 2D20A 1LOSA 3CB3A 4GCXA 4HK6A 4JTSA 3TROA 2XN1A 3RU8X 3WQ4A 3GTNA 4S3FA 3BZGA 3UGRA 3ABSA 5G4EA 2LLEA 4B9YA 5G2IA 1CDGA 3MC5A 2D22A 1HKIA 1PVNA 4M81A 1B90A 1VBUA 4MG4A 2PDIA 3MTWA 4FIQA 4Z2HA 3BLOA 3GTFA 1EGVA 8XIMA 2QNEA 3T0DA 5DELA 2YCIX 5D33A 4U10A 3NOEA 3R58A 2ZRWA 3TKFA 3BJTA 1EQPA 1NDZA 3T8LA 2BOGX 4DZAA 4HKPA 1I75A 1X8CA 3WKZA 2FB2A 4QQ3A 1GORA 4CN4A 4XAZA 2VGFA 4H7VA 2YBUA 4YTSA 3F5KA 1A5MC 1S5WA 3QQ1A 5L6UA 1G6CA 1L6YA 3T4WA 4JTAA 5JBEA 5E1QA 4JTUA 1V6YA 1YPFA 1FWRA 2FJUB 4EKJA 2PFHA 3OEXA 3E74A 3I6TA 2G37A 2R8WA 2YCJA 2YCKX 4PR4A 2EKGA 2YXXA 4GC3A 1BEUA 2PDQA 7ENLA 3R0DA 3EEZA 1WUFA 2WHJA 3TQVA 1IZKA 4X2PA 3TSMA 1AD4A 2NUWA 1E4IA 4JR5A 2OXNA 3AYVA 1HVQA 1Q8JA 3EPOA 4BA0A 2Z00A 1G4PA 2HPMA 5EKYA 4B15A 4HOZA 2CXEA 1OT2A 1HL9A 5CEWA 1W5PA 1JDFA 2ZRYA 1GVRA 2X41A 2ZZ6A 1SM9A 2CEQA 2AGKA 2JKAA 4S2CA 1NDYA 1X98A 2CLFA 3EWXA 1YRRA 4TV5A 1OZMA 2OQHA 5KZMA 4QP0A 1J2WA 1LRNA 2YFOA 3L0GA 1FWJC 4R9XA 1V02A 4PN2A 4LAKA 2J25A 4DWDA 5DLCA 3GG7A 5XIAA 3TTOA 4AG0A 3V36A 3E12A 2VO5A 5DBTA 4JFUA 1HGYA 3VKBA 3MZNA 4KBXA 4HYRA 2E4TA 3HIJA 3W74A 4O18A 1KM0A 3DECA 5DEZA 1R86A 5AVHA 4QAIA 3IRDA 4B9ZA