2XFRA

Crystal structure of barley beta-amylase at atomic resolution
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
487
structure length
487
Chain Sequence
VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-AMYLASE
total genus 191
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xfrA00
1J0JA 4FLOA 3AIQA 2DIJA 3EDDA 3THDA 2G3MA 2J78A 1WDPA 3NDYA 3CBWA 1XCWA 4X0VA 3K8LA 3AXIA 3WQVA 5CJ5A 2D23A 2J7EA 3CHDA 2WZIA 2WKLA 4YN5A 1NWUA 2WC7A 1KB3A 4W89A 1BHGA 4QLLA 1PBGA 1XC6A 2YIHA 1UG6A 5DMYA 1UR4A 1SYTA 2WAGA 2E9LA 3N12A 3WMBA 1CGTA 1U33A 2Z1KA 4P7LA 4AWEA 1QHPA 3CZJA 2JF6A 1PX3A 4OKDA 1NOUA 3VPLA 1JZ3A 4CU7A 4BA0A 2ZUVA 5A6AA 1FH7A 4U31A 3ZM8A 2WC3A 4KWUA 2F8QA 2WANA 1NOFA 1X1NA 1Q6DA 3B9AA 3K46A 2WVSA 4IISA 5E0CA 1AQHA 1OCQA 4HU8A 1AQMA 2D0FA 2CHNA 1OIFA 5JBEA 2HVMA 5A8PA 1RH9A 1C3FA 4W86A 5D4YA 4JFTA 1E72M 2D24A 1CXIA 1PX4A 1HXJA 3F5KA 3WDRA 4D71A 3AXHA 3UG3A 2G8ZA 1JFHA 1WZLA 3IJ9A 4LX4A 1ISWA 2VC9A 4UQCA 1C90A 1HKMA 1W1YA 2X2YA 1GQIA 4N42A 5EBAA 3PZQA 3JUGA 5IDIA 1HP5A 1GOQA 4AZ7A 4UFMA 2D3LA 1PJ9A 2VQUA 2O9PA 1Q4NX 1UKOA 3NSXA 1ITXA 2DSZA 4M80A 5CPSA 1WZKA 4W85A 2PF0A 1NOWA 1CLXA 5D9NA 1MW2A 3ARWA 1E5NA 4AZBA 4U3AA 5CSUA 2QV4A 1K9EA 2BY2A 3LPPA 3EDFA 4BQ5A 1GOWA 5DF0A 4A3HA 1D7FA 5JIPA 3AMGA 5DO8A 1UR2A 3MMDA 5D8ZA 1M7XA 1LLOA 3WIJA 2GJRA 3CZEA 1MFVA 1WZMA 3MMWA 4UNIA 2DGAA 4C7DA 1Z32X 2E9BA 5TD4A 5A94A 3SUWA 1WPCA 4PMZA 2D0HA 4MAZA 4W84A 4GZJA 1FH8A 4MADA 2OWXA 1UKTA 2E8ZA 4PMQA 5GNXA 3K4DA 3ZJ7A 4AD4A 3SURA 1W3HA 3WUBA 4JFSA 3VNYA 4WK9A 4J3UA 1NM9A 2ZWYA 4W7UA 5AYIA 2FGZA 2EPOA 2YLAA 3MS8A 3TONA 4HOXA 1QI3A 3VD7A 1GQJA 4AEFA 1LL4A 2J7FA 1TVNA 3U7BA 4W5UA 4ZE4A 2XTKA 1KXTA 4QLKA 3ZO9A 1JGIA 1EDTA 3T0AA 5A2BA 2E0PA 4PUEA 5I5RA 1H49A 4QLJA 4B9ZA 2WVUA 5GNYA 3QGVA 1W1PA 4PUDA 1KQYA 4PN2A 1E73M 3WH7A 2A3HA 1UD8A 1CIUA 1QHOA 1UD5A 1E4NA 2VCCA 4B16A 3WEMA 3G6LA 3GH5A 5EFFA 3RMEA 3FNDA 4D6FA 4DWSB 3WL1A 1LWJA 3L4UA 3PZ9A 3ZOAA 1C8QA 1JG9A 3BCDA 1GQLA 5CZKA 2J25A 4HPHA 3WDIA 4CN6A 3WMCA 1YHTA 1JXJA 5A3HA 4QCFA 3MV11 5A95A 1JL8A 3I3DA 5IHRA 3WKZA 2YOCA 4NRRA 1TA3B 1OT1A 2NT0A 1KR0A 5BXPA 6CGTA 1CECA 3PHAA 1MW1A 4AZCA 3VGEA 2EEXA 2WWCA 3W6MA 4XB3A 2OYKA 4P7NA 1WDQA 2YL9A 4WJXA 2X8RA 4J3XA 4NF7A 5FOOA 4PBGA 3A4WA 4XUYA 2YDSA 1ZL1A 9CGTA 3T0DA 2EPKX 2VX7A 5BXSA 2WMIA 1RPKA 3VGDA 2ZE0A 1ISXA 2WVVB 1QBBA 2VX5A 3RPMA 1HL9A 1MYRA 1QBAA 1G5AA 4OUEA 4M82A 4D6IA 1UH2A 4UFLA 1VENA 2GUYA 4W7VA 1E4MM 1UWTA 2VNCA 3N13A 4JFWA 4H41A 4P7RA 3PZMA 1GOMA 2PBGA 4WSKA 2W66A 4WF7A 2XJ7A 4ACZA 1V3IA 3IJ8A 1RD6A 1LQ0A 1EA9C 1MW0A 3VTRA 2XHYA 3ALFA 2YL5A 2F61A 2W92A 1OSEA 2FDMA 3W37A 4TX8A 2RGMA 2BY3A 1W2PA 3GH7A 3IANA 2WM0A 5A6MA 4LYPA 4MB4A 2VRKA 3IJ7A 2JIWA 1DWFM 1ZS2A 4EK7A 1EOKA 1VEPA 1B3XA 1OB0A 4CVWA 3W27A 2BXZA 1E0VA 4MDOA 4IM4A 1IV8A 4W7WA 1LWHA 3FHAA 1F4HA 1E0WA 3WELA 5HPOA 5DFAA 5IXEA 3CZ8A 5M5DA 4U5IA 5EFDA 2QMKA 2UY4A 2W67A 4P7QA 2VZSA 3VX0A 1OGBA 2VRJA 4UQAA 2CESA 1J0YA 3WNMA 4J3SA 2G3JA 1KBKA 1UYQA 3WNKA 4AIEA 2QMJA 1CGVA 1EQCA 4H7VA 1XYZA 3MO4A 3ECQA 1SMAA 3SCRA 2WVTA 1EO5A 3AISA 3VGBA 1QI2A 4LPCA 2VUYA 1E6XM 5A6KA 4PMVA 3ZT5A 1TG7A 4EE9A 1U30A 3SUVA 4LYRA 4PMOA 3SCOA 4UQDA 2WHLA 4W8LA 3LMYA 4D1JA 3AROA 1VJSA 3ARPA 3BAYA 3UG5A 2J7DA 4JAWA 1OINA 1WB0A 4JHOA 5EMYA 3CZKA 1V3HA 4AXNA 4D72A 3PZTA 3WFLA 4EKJA 1BYAA 3NDZA 1WAWA 4QAWA 3OGSA 1B3WA 1MQPA 1W1VA 2VZUA 3BGAA 3VD3A 3WF1A 4OJYA 2WKGA 3GNPA 1E0XA 1JI1A 4J3WA 2VR5A 2WB5A 4M8UA 2NSXA 2D1ZA 5ABFA 3VGHA 2D0GA 2YDQA 1PZ3A 2WHMA 2XSBA 1M01A 5LYRA 3BC9A 3AS3A 3ALGA 4W8BA 4KRUA 3VVGA 4CCDA 3WBAA 3BCFA 4MAVA 5HXMA 1PX8A 1GPFA 1CZ1A 2XG9A 1H09A 1WCGA 3EDKA 1B1YA 1TR1A 3K8MA 1CPUA 2VURA 2DH2A 2V3FA 4GINA 2BHYA 4S3KA 3WH5A 3RM9A 3B9EA 1CNVA 4B15A 2CBUA 3VMOA 5A6BA 1UD4A 3BMVA 4F9DA 2JFEX 1KQZA 1JZ6A 1J12A 4TVUA 1RP9A 1XHGA 4PMYA 4PTXA 2PWFA 1JYWA 1IZJA 2O9TA 5BRQA 4AMCA 5HDRA 2Y24A 1DWIM 4K68A 1GNXA 1ECEA 2EO7A 3BLPX 1CBGA 2VJXA 2Z1SA 2YBTA 1ISVA 3WF0A 3THCA 4HTYA 3WDHA 1R7AA 4YHEA 4ZXLA 4ZFMA 3DHPA 3PZGA 2E8YA 3E1F1 1HL8A 4PCTA 1CXKA 5HOSA 1TFVA 1J0ZA 1KCLA 4A3YA 3PZVA 2VT0A 4CU6A 1H0GA 2W5FA 2WSKA 5CPQA 3T2OA 1TCMA 1UWRA 4UOJA 3CLWA 1VF8A 2VTFA 3L4YA 1O6IA 2BY1A 1KXQA 3UCQA 4P8UA 3OLDA 1EDQA 4GZIA 1PIGA 2XVNA 1OGSA 1HX0A 1GOKA 1C93A 5LA0A 2ZOXA 2FHCA 2WWDA 3VIOA 2YDRA 3AS0A 1JZ4A 3AHXA 3GDBA 1BQCA 4JKLA 3WDPP 3W38A 3W4RA 2DPEA 2WLYA 2J7BA 1H0IA 2YA0A 5FKYA 2D3NA 4CCEA 5HNNA 1HKKA 2JF7A 4DM2A 5BROA 1CGXA 1B0IA 2DSKA 1E1FA 3WNNA 2PWEA 1E3XA 1BSIA 1V0LA 2V3GA 1OM0A 2J77A 3MUY1 5E6ZA 3VDHA 2ZX9A 4OBRA 1V02E 1FH9A 1ZJBA 1CYGA 1HJSA 5FD0A 2WHJA 4CD5A 1KGXA 2YLLA 3AICA 2CNCA 4PEEA 5A8NA 3PTKA 4PSPA 4X0NA 5LA1A 4PMNA 6TAAA 2J7CA 1HJQA 1E4LA 2VR4A 1UHVA 5BYWA 1CXHA 4UZSA 2BS9A 3W29A 3WEZA 1V6WA 3DHUA 4QCEA 3K8KA 1UD6A 1E9LA 5ABEA 3KEHA 1B2YA 3WH6A 4D6GA 1GOIA 1MW3A 2E9MA 1OD0A 3DYPA 1KWKA 8A3HA 4XZWA 4M81A 1W32A 4Z2KA 2WW5A 1PAMA 2NW0A 3VIPA 1L8NA 3ZJ6A 2WCAA 1JAKA 3SCVA 3OA5A 5JUVA 2ESCA 4ML4A 2BVDA 1TE1A 4JKMA 3BAIA 3SUUA 1MWOA 1V03A 3WBEA 3AYRA 1QPKA 1AMYA 3MMUA 2XIBA 1OBAA 3D5HA 4QDMA 1DWJM 2DT3A 2XFYA 2OYLA 2BY0A 3AMDA 3AS2A 1S46A 3AMKA 3WD4A 1DWGM 1LF1A 2OYMA 2CCRA 1FOBA 4HU0A 1E70M 4JCMA 4KMQA 1NWSA 2VX6A 5AC4A 5E0FA 3BAJA 4W87A 4BCEA 3ARXA 1CXFA 1H3GA 4BQ4A 4IPLA 3AS1A 4PMDA 3WD1A 1V6VA 4NI3A 4NSBA 2EXOA 3GXIA 1XD0A 5A8QA 2XGIA 5HBFA 3L2MA 1UD2A 3QHNA 1C91A 1J10A 5IFTA 3GNOA 1UOKA 2XWDA 4OBSA 3KL0A 1FP9A 1MQQA 3VMPA 2XPKA 2E4TA 3RCNA 5CXPA 3WNLA 3WD3A 4UTFA 1NQ6A 2Q8XA 3T0BA 2IXUA 4PTVA 1BG9A 4GKLA 4TTUA 3VD9A 2W91A 2V38A 1C8YA 2W63A 3EYPA 1JDCA 1H1NA 1MXDA 4NZCA 4D6CA 4Z2JA 4WLCA 2VO5A 3OLGA 1V6YA 3N15A 4ATWA 1R85A 1KR1A 1GCYA 1TZ7A 3WF2A 5LA2A 4HP5A 3WF3A 5I77A 2D2OA 2CBVA 5A2CA 2BHUA 3AHTA 4ZE5A 3GXMA 1BFNA 1BVZA 4WKHA 3WQ4A 4URIA 4UR9A 4OOZA 2GK1B 3CUHA 2J4GA 4HA3A 4HZ6A 1H4PA 4HMEA 3SCTA 4M1RA 4DM1A 1G1YA 4YHGA 3ZSTA 4AIOA 2FH6A 3WH9A 5JBFA 2IXVA 1W3KA 3A4XA 1Q6CA 2J74A 5FL0A 1TA3A 5KEZA 3RO8A 2BXYA 1B90A 2EPNA 2DT1A 3ZR6A 1I75A 2X0YA 4Z2LA 1W9DM 1BGGA 2ZUMA 4L4OA 3VMNA 2O9RA 1PZ2A 4XV0A 1I1WA 4BF7A 2DEPA 2OSWA 3N1AA 2VX4A 1W9XA 1EXPA 3AMCA 3APGA 4D6JA 1ZBVA 3SCUA 2VCBA 3SUSA 2EBNA 3W0KA 4M29A 3L4WA 3PZNA 2VZTA 4X9YA 3LPFA 2CPUA 4W5ZA 3TOPA 3VNZA 1GZJA 2EQDA 3AMLA 2WC4A 4PYSA 4V2XA 5GNZA 3WUEA 4FK9A 4HPGA 3AZTA 1UR0A 2G4FA 2OLHA 4CU8A 3KL3A 2VOTA 1JYNA 4PTWA 3WQWA 3O9NA 5AYBA 1W9VA 4U2ZA 5A6BD 4MB5A 5E09A 2XYLA 1UWQA 1GORA 4UZUA 3GXFA 1Y7VA 4AYSA 2Y8KA 2Y8VA 1HJWA 2WZHA 3SCPA 1MXGA 1VJZA 5I78A 4D1IA 4UFJA 3K1DA 1NP2A 1R8LA 4AEEA 1D2KA 2WXDM 1HNYA 4ATDA 3PN8A 7A3HA 1DP0A 4CGTA 1N82A 4FLQA 1JDAA 4TVDA 5FL1A 2J8FA 2UWFA 5M3WA 2G3IA 2WMKA 2CBJA 1B3YA 1X6NA 1JD7A 4IUGA 3CTTA 3OZPA 1XH1A 1VFFA 1Q6GA 3W82A 4ACYA 2EPLX 3A4AA 3AHYA 4JKKA 1VEOA 3VU2A 4ZXOA 3BAWA 4C7FA 3DYOA 5I6SA 1IZKA 4E8DA 1R86A 2ZWZA 1JNDA 3A6OA 1SR0A 4UQ9A 2A3EA 3VO0A 3AIRA 2X05A 1JZ5A 2WCSA 1CXLA 2J8GA 4ZENA 2MANA 2NT1A 4PMUA 1LL6A 2ZX6A 2YA1A 2VVNA 3CIVA 4LYQA 3WH8A 1W1TA 2XWEA 4LXFA 3RM8A 2GJXB 4JFVA 4PTMA 1QNRA 2WMIB 1XYFA 4GO8A 1ZJAA 1GOOA 1VIWA 3HMCA 3EDEA 1MFUA 2DSUA 2CYGA 3CUIA 1HKIA 2RGLA 1VFUA 3VD4A 5CGTA 3WF4A 4P8XA 3AIUA 4MJ2A 5BWFA 2FGLA 3UG4A 1HF6A 1OT2A 3I3BA 3AQUA 1GVYA 2AOSA 3VDCA 4AC1X 2WHKA 4AW7A 2VZVA 1ZU8A 1BLIA 2XFRA 3ZIZA 1EHNA 2D20A 1PIFA 1EO7A 7TAAA 4UFHA 3VX1A 2W61A 5C71A 1J18A 1RP8A 5I0DA 3CGTA 3ARTA 3WMSA 1J0HA 1H5VA 1W2VA 1E6SM 3POHA 5F7UA 1WNOA 1HJVA 2XVLA 4ZEPA 4AZGA 3GTNA 5D9MA 5A2AA 3NIYA 2TAAA 2BFGA 4DWSA 1JDDA 1B9ZA 3ZSSA 4AZIA 1FHDA 2ZXBA 4W88A 4HOWA 3TTQA 3M46A 4KRTA 3ARVA 5CPTA 1D3CA 3AIVA 1BYBA 4E4PA 1BGAA 2GVYA 5DT5A 3ARSA 1G01A 3I3EA 1CGUA 1AVAA 1A47A 4U3CA 4M24A 4TUFA 3L4VA 4PCSA 4F8XA 3WNOA 1GUVA 4KGJA 2HISA 1UKSA 2JEPA 2FHBA 4PMXA 3O6AA 3F4VA 2EPMX 2XIIA 3N18A 1Q6EA 1XD1A 1M53A 5I2UA 3CO4A 5D9OA 1GQKA 1BF2A 1UA3A 4AD1A 2GFTA 2UY2A 2WBGA 4RE2A 2PWHA 3FW6A 2V3DA 3WENA 3GBDA 1CENA 4H8VA 3M07A 2WYSA 3B8SA 2DT0A 3VIKA 4GXPA 4Y7EA 5DEZA 3AXXA 3DYMA 5A1AA 1E6NA 2BVTA 1ZBWA 4QP0A 2JIEA 1BAGA 4QFUA 3T09A 3G6MA 1OIMA 1WO2A 5CLTA 3W81A 1UWSA 4TX6A 4CD4A 3N9KA 4J3VA 4H8UA 5I79A 4KGLA 2VVSA 3QOMA 2ZICA 1EQPA 2UY3A 1LG2A 6A3HA 1A3HA 2QPUA 1HN1A 1NARA 3GNRA 4AZHA 1JD9A 3TP4A 1C92A 3W24A 2YKKA 4GI9A 5A69A 2XGBA 3BAXA 2JALA 2WMFA 2OSYA 1E56A 4GPNA 3EMQA 3UEQA 1E55A 8CGTA 4OOUA 5A6SA 2BV9A 1B31A 1WKYA 2FHFA 3PZOA 3U57A 4GI8A 2XVKA 2GJPA 3CZLA 1BYCA 3VGFA 1DWHM 2OWWA 1J11A 2WMHA 3RM4A 4V27A 1UKQA 3M6DA 2WCGA 3UESA 3D3AA 1GONA 1E71M 3EMCA 1GJWA 3U5YA 7CGTA 1UWUA 1BYDA 4AIUA 3KWXA 3AIEA 2W62A 3EMZA 3VD5A 3AIWA 3CUGA 3CUJA 4TOQA 5C70A 1JF5A 3ARQA 1JZ8A 3ARYA 5E70A 2WMJA 5CLWA 2PWDA 3T2QA 3OGVA 1ITCA 3TA9A 3SCQA 4CUCA 3FAWA 3FN9A 3SCSA 1ZBCA 5FCZA 5D8WA 4A4AA 5CGMA 2DIEA 1EDGA 1FHLA 2XVPA 4J28A 1KBBA 1ISZA 4E2OA 1H2JA 1HVXA 3MU7A 4CD6A 5A8OA 1XH0A 1EH9A 1GVIA 5AY7A 2V5CA 3L4TA 3VIMA 1K6AA 5BRPA 4DUVA 3SIMA 3WQ6A 1YQ2A 3UETA 2WVVA 2GDVA 4XZBA 4Z2GA 4H04A 1E6ZA 3RJYA 1E4IA 2J7GA 2G3NA 3CHEA 4MPKA 1M03A 2PB1A 1VAHA 1UKPA 4UFKA 3OLEA 1CGYA 1DTUA 3K4AA 2WMGA 2VQTA 4GIAA 1IT0A 3ZJ8A 1P6WA 1KGWA 1LL7A 4IPNB 3AHVA 5C8BB 4UQBA 4B3KA 2QLYA 1CEOA 3WN6A 3MSDA 2BHZA 2B31A 3RDKA 4EANA 2DQXA 1E3ZA 5BXTA 4CN4A 4C7GA 3VGGA 3NYDA 1W9PA 3BSGA 4AD3A 1EOMA 5A6JA 1DEDA 3VIFA 1NWRA 4RE3A 3FY1A 1E15A 2CKSA 5CSYA 4CD7A 1BG4A 1QVBA 3ZMRA 1BTCA 3AZSA 4Z2IA 3SUTA 1UA7A 2QPSA 2DT2A 1V0KA 1TUXA 2DSVA 3LPGA 1DWAM 3L4ZA 1C7SA 4P8VA 3KE0A 2JEQA 1BPLB 1GHSA 4D6HA 2GSJA 3AFBA 3N04A 2O9OA 3VIJA 1ZB5A 4UOZA 1V3KA 3DC0A 4E8CA 3WEOA 4RL3A 1WZAA 3ARRA 1R7OA 5ABGA 1JZ7A 4ACZB 1QNPA 1U2YA 1V3MA 2VL4A 1HKJA 2G41A 2J62A 3F5JA 3OB8A 3CMGA 1J01A 2E3ZA 3W6LA 1XCXA 1W3LA 1H11A 3NCOA 3WUFA 4F9JA 3WL0A 4FLRA 2Y5EA 3WFZA 2WBKA 1UQZA 4BQ3A 2WK2A 4HZ7A 4JHZA 5M17A 4BQ2A 4OIFA 3PZUA 3PBGA 2GK1A 4MB1A 1R87A 3GYCA 1V0MA 2O92A 4TXEA 2V5DA 3VDAA 2GDUA 3EDJA 3GM8A 3T2PA 1ODZA 2Y4SA 3GZAA 2WLZA 3BSHA 3IAPA 4AY1A 1C7TA 1CWYA 3WNPA 1M04A 3KZSA 4CCCA 4V28A 4UCFA 1V08A 4MJ4A 1XV8A 2YJQA 4DUXA 2ZUSA 3J7HA 3VM5A 2A3AA 2CBIA 2JE8A 2OSXA 1VFOA 1CDGA 1FFQA 1I1XA 4UFIA 5I24A 4FF5A 1J0IA 2E40A 2J47A 2CITA 5GPRA 4HOZA 1O7AA 3FAXA 2WSPA 2YBUA 3DECA 3MUAA 3W25A 1UD3A 3VOCA 2CXGA 1X6LA 3WDQA 1JFXA 2CHOA 5BXRA 3NSMA 2XM1A 1V6UA 3OBAA 5I23A 3N17A 4H8HA 1QI5A 5EB8A 2ZUNA 4CN1A 3M7SA 3EBVA 3NUKA 3WD2A 1KCKA 2UY5A 2ZX8A 4KH2A 1XSJA 2WNWA 2X09A 2J75A 4GI6A 1V0NA 5M03A 4MNMA 3AYSA 3HU7A 3AI0A 3ARZA 2CKRA 1V3LA 1W3JA 3OZOA 3AOFA 3LPOA 1KWGA 2XM2A 2OWCA 2DDXA 3RILA 5CG0A 2PWGA 3WUGA 4WKAA 3CPUA 3QHMA 4CVUA 4R5EA 3MANA 2VZOA 2IUZA 3RIKA 1VFMA 3IK2A 1FP8A 1UUQA 5IFPA 1K9DA 4PSRA 4RE4A 4D6DA 1CXEA 3CMJA 5JIWA 3VIIA 3GH4A 4P8WA 3SEPA 3OG2A 4Z2HA 1ESWA 4XX6A 1NWTA 2C8NA 3L2LA 5E9AA 1E6RA 3UR7A 1LJYA 4FMVA 4D6EA 3PZIA 5IHSA 3MKKA 3MSGA 5ECUA 3VUPA 1EHAA 4B3LA 1G94A 2A3BA 2YL6A 1OGGA 1UWIA 1VBUA 2ZXQA 1KXHA 3PTMA 4DWSD 4BZYA 3WQ5A 1KXVA 3IAQA 3FHQA 2CIPA 2ZXDA 5E6YA 3GXDA 2EJ1A 1ZBKA 1CLVA 3AIBA 1FA2A 1W91A 3ZR5A 1JF6A 3ZQ9A 3MV01 4YPJA 3QR3A 5D9PA 4Q7NA 1TVPA 4TTGA 5AC5A 3L4XA 2VI0A 3QHOA 1MQRA 5CQ1A 2Y2WA 4JZ5A 4JL1A 1J9YA 1EGZA 1SFSA 2X1IA 2DSWA 1BVNP 4UQEA 3TTOA 1WP6A 1LG1A 2PI6A 1JI2A 3MUIA 2ZUTA 1SMDA 1JXKA 2YA2A 3AZRA 2BNJA 3AJ7A 1E6QM 4J3TA 3S2CA 3SCWA 5JBDA 1DHKA 3CZGA 3HN3A 4MB3A 3T08A 1W9UA 1VBRA 1V6XA 4NRSA 3TTSA 2DH3A 1B3VA 4R27A 4GQQA 1NP0A 3VILA 1UH4A 2C7FA 3OIHA 4F79A 3WY1A 3HJEA 3A3HA 4L4PA 3POCA 1QW9A 1XSIA 1HJUA 2XFFA 1QW8A 4JFUA 5FIPA 1JYVA 3FXYA 1V3JA 1HVQA 1E40A 2PC8A 1UR8A 1OWQA 3S6TA 4AD0A 2WPGA 4N0RA 3WDJA 3VINA 1WDSA 2AMGA 3WD0A 3VDBA 1KFWA 1OD8A 1XRVA 3U7VA 2VRQA 3N11A 1UR9A 4FLSA 2J7HA 3ZT6A 1JNEA 3BXWA 4TVCA 2X0HA 1GJUA 3VM7A 2GJXA 3ZJKA 1QI4A 1L0PA 3KL5A 4W93A 4AZ5A 4MTVA 1E43A 1HIZA 2A3CA 4P7OA 3F5LA 5GQBA 1TMQA 5DT7A 1QI0A 5A6LA 4H2CA 4MNJA 4U33A 1ISYA 1JYXA 4BS0A 4W8AA 3W28A 3RJXA 4JCLA 1ODUA 1CGWA 4B9YA 2ZUWA 3O2LA 2V3EA 3OGRA 3NSNA 4ATLA 2ZXAA 3WSUA 1G0CA 2CEQA 1US2A 4UOQA 4HMCA 2XSAA 1QNQA 5BCAA 4HZ8A 3BMWA 1B3ZA 3W26A 2ZX5A 1E5JA 3BAKA 3VIHA 1AQ0A 1PPIA 1B30A 1K9TA 4S3JA 2AAAA 3GBEA 2FH8A 3A47A 2C0HA 4GQRA 4WSJA 4HMDA 4DWSC 1FFRA 3VKKA 4WIWA 4GO9A 1UR1A 4HA1A 4CKQA 3BH4A 5I3DA 4PRWA 1J0KA 3VIGA 4CD8A 1JAEA 1V02A 4MNKA 3ZT7A 4Q22A 1E6PA 2W4XA 2VMFA 1US3A 1UQYA 5ABHA 2D22A 3CHCA 2VCAA 3CH9A 4U2YA 2ZUUA 3II1A 1JZ2A 4AZCB 1E1EA 1H41A 5ABFB 1JIBA 1KGUA 1XSKA 3UERA 4AISA 1HT6A 3AHZA 1UZ4A 4LQ1A 1EIBA 1QNOA 3QOKA 1XH2A 2QHAA 2WZEA 3SCNA 2XUCA 4PMRA 3BLKA 3PTQA 3NJ3A 1GW1A 1HP4A 1NH6A 3UR8A 1VEMA 4LGXA 1QHZA 3ARUA 3WQ8A 4MDPA 4JIEA 4EAMA 4DUWA 4OZOA 2ZX7A 2CETA 5A8MA 4WKFA 5HPCA 1UZ1A 1G9HA 2YL8A 1GHRA 1WE5A 4M56A 4JL2A 1UH3A 4F66A 4GZEA 3TTYA 3W53A 4AZ6A 1VRXA 1MVYA 2XVGA 1C8XA 1WDRA 3B9DA 2CERA 2ZIDA 1VB9A 4J7RA 3CUFA 4MNLA 2QF8A 4U5KA 3CHFA 1XGZA 4J27A 3OLIA 2BVYA 1F4AA 4HA4A 1K9FA 1QNSA 4AD2A 2PBOA 1Q6FA 1W9BM 3MUZ1 1PEZA 1CTNA 2J79A 1HJXA 3U5UA 4AD5A 5KZ6A 2F2HA 1QOXA
chains in the Genus database with same CATH superfamily
3EDDA 3THDA 1RBLA 3KCOA 3GFZA 1V5XA 2XSXA 2XIMA 1LP6A 5HMEA 2HPIA 3WQVA 1T0OA 2D23A 3MZNA 3GU9A 4YYCA 1YEYA 4I7WA 4YN5A 1F6PA 4IP5A 2QUTA 2V5BA 4QLLA 1IYXA 1PBGA 1XC6A 2YIHA 5DMYA 4WGXA 4L80A 1P0BA 2QCHA 3MKCA 2P0IA 2E9LA 1CGTA 3QQWA 1U33A 2YGYA 4H9YA 3S83A 1D7KA 2G4JA 3FJ4A 4F0KA 1R3QA 3KTCA 3TIMA 3LQGA 1QHPA 3HV8A 1IEIA 4UNKA 4BA0A 3GU1A 3TYBA 3QGKC 4ERIA 3KRSA 1HGYA 2WC3A 5DRIA 2F8QA 4H83A 4JDYA 4DI8A 1X1NA 3QLLA 4UIOA 3ZXWA 2CLMA 5LZLA 1R9YA 3O1NA 2FPTA 4NYYA 3TN5A 1AQHA 1UB3A 1O5XA 6ENLA 4X9SA 4KIRA 5JBEA 4O1FA 4J1OA 5A8PA 4LRTA 5KZDA 5K4XA 5KMYA 3URAA 3GR7A 4O4WA 2PC4A 1HXJA 3NQAA 3AXHA 1JFHA 1Q3NA 2PUZA 3P7YA 2VEGA 1KLYA 2WSQA 5EA9A 4N42A 5EBAA 1D3HA 3MP3A 4D8AA 1TTQA 2HEJA 4AZ7A 3IARA 4EP8C 1PJ9A 3QKEA 3W3OA 1UKOA 4Q8QA 4W85A 2RFGA 1M7JA 1NOWA 3CAVA 5U7SA 1YXDA 4L64A 2XH0A 5D05A 1D9EA 2DZWA 1TB3A 1K9EA 2QV4A 5AC7A 5C9UA 4A21A 1GOWA 2CWNA 5FEXA 4PFMA 2PGFA 4Q4KA 3KOXA 4DN1A 1X97A 1J2WA 1O94A 3LHTA 3BLEA 3LN3A 2MNRA 4FF7A 5I03A 4UNIA 5HWMA 1XLFA 4UTKA 1Z32X 1DIOA 4L56A 2NXIA 4MAZA 4W84A 1AZ2A 4GZJA 4AEOA 4GACA 4PODA 4PMQA 5J5DA 3CHVA 1CX9A 4JFSA 3VNYA 4RDVA 1JCMP 3QLDA 3KOYA 3EWWA 1TPC1 3TONA 3HA1A 3TN6A 3VD7A 1GQJA 1VRDA 4L9XA 2ZZ3A 3LM3A 4W5UA 5EKYA 3E0VA 1A3XA 4MY8A 2ATSA 4RUBA 1H49A 2OOGA 3G3MA 1EBGA 3EOSA 3GG7A 5GNYA 3M41A 3PPFA 1NY1A 3WH7A 2QCDA 5XIAA 5LIWX 1FWGC 4DJDC 3G6LA 1JUBA 3GH5A 4Z1BA 4JTAA 4D6FA 3MBFA 1OFDA 3E74A 3TZFA 1EGMA 1HG3A 2XN1A 3WLSA 1GQLA 1I60A 2J25A 1T8QA 3M9YA 1FWSA 3VABA 3WMCA 4K2SA 4QCFA 4E5TA 3MV11 4ERAA 2XU2A 5D03A 4DZ5A 1JL8A 3I3DA 4RDWA 2YOCA 1POJA 1SW0A 4I90A 4PB4A 1OT1A 3G1XA 1CECA 2QDEA 1KFLA 2WWCA 2BOEX 4P7NA 3MSRA 1XLBA 1EX1A 1H51A 4WJXA 4XQ6A 1Q4WA 3KDOA 3M1ZA 3E38A 4J3XA 5G2IA 1S1RA 4PBGA 3S2MA 2SFPA 2YDSA 1XQKA 5FJOA 1ZL1A 3T0DA 2EPKX 1MUWA 5F2LA 4AVNA 4NILA 1IXOA 3HG3A 3RPMA 3W87A 1Q6RA 4E6MA 1G5AA 1UH2A 1PCKA 3T4CA 3O0KA 1A5CA 1UWTA 3WG6A 3N13A 4H41A 2RUSA 2PBGA 4JX5A 1QMLA 2PGWA 3WLMA 1MUCA 3GSMA 3DHFA 1TPB1 1LOLA 4Z17A 3GE7A 5HQEA 5A5WA 2Q02A 3NURA 2P76A 3QZEA 1YDOA 4PUKA 3YPIA 3UWEA 2EG8A 4LYPA 3KP0A 3W1PA 2BB0A 1GZGA 1ICSA 4EK7A 3HIJA 3T81A 3CWNA 1W5NA 3H4WA 4Q6XA 4JEJA 3TCEA 3W27A 4JYDA 4FEZA 4H6RA 2Z1WA 5LIKX 4IM4A 1LWHA 5HPOA 3DKJA 4LUSB 5DFAA 3CZ8A 1UOZA 3ZLGA 1TX0A 4ZQRA 3C61A 1AL8A 3QRHA 3HM7A 5E9XA 3PUOA 4ZO9A 1J0YA 3WNMA 4X2RA 4J3SA 3JZUA 1RCQA 5E5CA 5LIYX 1OJXA 3A5FA 2NQ9A 2QMJA 2YDAA 5KZEA 5KSWA 1VIZA 6TIMA 1EGVA 5J5RA 4EE9A 2HK0A 1QT1A 2H3BA 1XJBA 3S8HA 4UQDA 2WHLA 1NF0A 3AROA 1BXCA 3ARPA 3UG5A 4QNEA 1TV3A 2J7DA 4JAWA 1WB0A 3CUXA 3CZKA 5E0KA 4AXNA 4D72A 4C1LA 1UUMA 4FO4A 5BNKA 1TE6A 1WAWA 1XPYA 4Z1AA 4ZO7A 4UC5A 2QDHA 1MQPA 2J13A 5DY3A 4EXBA 1XRFA 1A0DA 3WBYA 1YNYA 4MF4A 3FA4A 5BU6A 1E0XA 4J3WA 2C0AA 5AC8A 3VGHA 1PZ3A 1OFBA 4GIEA 1VBJA 3BC9A 3AS3A 3ALGA 4CCDA 3WBAA 3BCFA 2QJGA 1PX8A 1GPFA 3DERA 2XG9A 2DUXA 1B1YA 2Y7EA 3V18A 2DH2A 3UGVA 3PJUA 4E2DA 1B57A 3B9EA 4YYFA 3V5FA 3MJYA 1UD4A 1IXPA 3CL8A 1JZ6A 2DZBA 1XHGA 5HA7A 1XG4A 3GG0A 1TWZA 2PWFA 1IZJA 5BRQA 1G69A 3L23A 2OZTA 4DYJA 2H8XA 3NXLA 3GDLA 4K68A 3M6YA 4E4UA 2EO7A 4NNAA 3U9IA 1CBGA 3TQPA 2VJXA 2Z1SA 2QCLA 4HTYA 1M3UA 4WGHA 1R7AA 4ZXLA 2FVKA 1IR1A 2C19A 2UV8G 3R79A 3E12A 4GNVA 4ZFMA 3DHPA 3GUGA 3PZGA 1OG6A 4IQJA 2E8YA 4M7TA 4QSFA 4ROPA 5HOSA 1T96A 4WVXA 1KCLA 2A2IA 1EPVA 4B90A 1AD4A 2J9YA 1P0KA 2A21A 2TRSA 1LLZA 1TCMA 5AVHA 1VF8A 4I8DA 4ALDA 1Z6KA 3E02A 1VYPX 2IW0A 4ORIA 2I5GA 4GZIA 1RA0A 4GMEA 3QV8A 2Y0FA 4RNFA 5LA0A 1MXSA 4LEQA 2WWDA 3AS0A 1BKSA 4C65A 3C3NA 1BQCA 1I2PA 3CS2A 1KM1A 3ONBA 2NQJA 2J7BA 3STFA 4N2YA 2D3NA 4DM2A 1B0IA 2C18A 2DSKA 2XISA 3RRAA 3BOXA 1PKNA 4GJJA 5D04C 3ES7A 3VDHA 3BANA 2ZX9A 2BDQA 3ITTA 2VFHA 1JCTA 5DBTA 1ZJBA 1CYGA 1HJSA 2WHJA 4OGZA 4CD5A 1KGXA 3NO3A 4HYVA 3AICA 2VWSA 3S47A 4R7JA 4KW2A 1EUNA 4PSPA 2PD9A 6TAAA 2R82A 3QV6A 3OHMB 2VR4A 2OOFA 4ILSA 3O6YX 3P80A 5DMLA 2QGHA 1DORA 1V6WA 3TYEA 1IWBA 3KEHA 3WH6A 1TWWA 4UCGA 4O14A 4X63A 1OD0A 3B97A 3WCZA 4GX9A 1J96A 2E7FA 3LHVA 3IUDA 2NW0A 3VIPA 1JAKA 3FLUA 3PTDA 4CQ9A 5REQB 1Y5XA 5B7ZA 2ESCA 3EWBX 4GQGA 3M0HA 1LOQA 1V03A 3WBEA 1SZFA 3MMTA 1AMYA 3MMUA 3C0JA 1LF1A 4JX4A 5U4NA 1E70M 1NWSA 1YPXA 1KM0A 2ZC1A 2R24A 5TQLA 3O63A 3KOZA 4BCEA 3M0YA 5HMFA 4JTHA 3ZZ1A 1I2RA 3A9BA 1JDEA 3AS1A 4O15A 1VHNA 3BE7A 4DLFA 3PULA 5CCZA 3DI1A 1C91A 1J10A 1UOKA 4MOZA 2DZXA 4QR6A 4XSLA 2OU4A 1EEPA 3RCNA 3PFRA 3WD3A 4UTFA 1VYSX 2Q8XA 5HR7A 2IXUA 1BG9A 3BO9A 3TX9A 1IEVA 1JDCA 5DMNA 2NX1A 1REQB 3P0WA 3ZVIA 1KKOA 2V5JA 4WLCA 5ABTA 1UUOA 4XD3A 4N02A 4WD0A 3WF2A 5L9FA 3ITCA 4KWSA 3B4YA 3QQ0A 1BFNA 3WQ4A 1VCFA 4OOZA 5T91A 3RX3A 2Z26A 1KV5A 4I6VA 1H4PA 4HMEA 2IKIA 4YHGA 1VYRA 5BRBA 2FH6A 2OO0A 1PE1A 3A22A 4HPJA 1B90A 4N4PA 2W3ZA 2PAJA 1W9DM 1AW5A 3S1WA 2O9RA 4AWSA 3ENLA 2OSWA 4TV5A 3P81A 4QGCA 1TTIA 1KFJA 5J8LA 4D6JA 4G1KA 5T9CE 3SUSA 2EBNA 3W0KA 3L4WA 4X9YA 3USZA 5CBBA 3MCNA 1GZJA 4J2PA 3AMLA 4PB5A 4KIEA 4FK9A 3CMFA 4AQLA 1FUYA 3QJAA 2ZZ4A 3AZTA 3CPRA 5C2XA 5HULA 5HAOA 4JIQA 4HQVA 4XD5A 3WQWA 2ZTJA 3FA3A 3DBPA 3C2OA 1GOXA 3A4JA 1G4PA 1QNVA 3B0YA 1EBHA 1GYNA 4AYSA 2Y8KA 1FKXA 2RDTA 1XLJA 3SCPA 3FXGA 3PPGA 2WXDM 5D2YA 3GRIA 5KETA 2OLSA 2Q01A 3MHFA 3VZXA 3C86A 1NDYA 2ZVIA 1REQA 3MZ2A 4FOKA 4PGLA 4UUIA 4L7ZA 3MYOA 2QXWA 3JU2A 1XH1A 3S9IA 4QHRA 3FIGA 4E0CA 4H6QA 3CQ0A 4NL1A 2V2CA 1JDFA 3AHYA 3TE9A 4KEVA 5FJIA 1VEOA 2NVAA 4ZXOA 2WO5A 3DYOA 3W02A 2FZDA 2A3EA 3N4FA 2AL1A 2X05A 4XTIA 4CEUC 1GGOA 1UC5A 1DIEA 3BVJA 3JRKA 1S5VA 4PMUA 2IPWA 2PEVA 1ALDA 3WH8A 2X40A 4E4FA 3MY9A 1A5UA 1SGJA 4RKAA 4LB4A 4JFVA 1WA3A 2NV2A 1GJPA 3MPGA 4GO8A 5EPDA 2ZZ7A 1VIWA 3AWNA 4JIHA 2NQZA 2QAFA 2NXGA 4JTIA 1B4KA 5EYWA 4G2DA 3L5AA 1YNQA 2BOFX 2RGLA 4JQ3A 3FX4A 2FGLA 3UG4A 1HF6A 3I3BA 3AQUA 5JVLA 4AC1X 3UWYA 2R1LA 4Y8EA 2VZVA 1ZU8A 1UP0A 2YCLA 4DBUA 3VNKA 4UFHA 1KBIA 1J18A 3ARTA 3WMSA 1J0HA 1H5VA 2A0NA 4U4MA 1TREA 5I00A 4MSSA 4BI6A 3GDMA 4ZEPA 5A2AA 2X7VA 3F2DA 3EXTA 4AZIA 2ZXBA 1FWDC 3CL6A 3DFTA 4AUBA 2Q8ZA 2QCEA 2DZUA 2IPGA 2F6XA 3ES8A 3FYYA 3S5YA 3NO1A 1GT8A 5CPTA 1D3CA 4FOUA 1BYBA 1QPNA 4E4PA 4J3ZA 4GLEA 5DT5A 1HKVA 3H55A 3I3EA 4O54A 2FB3A 3S2NA 1A4MA 1O5KA 1M7PA 4GK8A 4N4QA 2PPGA 2A6LA 2GGIA 3CV7A 3WNOA 1GUVA 2FHBA 4WOZA 5JQ9A 1ZENA 2XIIA 1XD1A 3W2NA 1XUUA 3DBNA 1BF2A 4AD1A 1TPVA 2GFTA 2QJJA 3P5YA 4GUHA 3FW6A 3V4BA 3WENA 3W74A 1W8SA 2YZRA 2WM1A 1TPWA 3UJSA 4GXPA 3UVIA 1FDZA 1NU5A 3UPBA 3CYJA 4G6CA 1TQJA 1XLEA 5DEZA 2ZZ5A 4S1FA 4O10A 5A1AA 4EX4A 1ZBWA 5CZJA 4HYRA 3URNA 4CNPA 3PC0A 1WO2A 1PYFA 3W81A 3AU6A 1IQ8A 3KFTA 4TX6A 2WNQA 4KGLA 4GBUA 4WJ8A 6A3HA 1A3HA 1HN1A 3GNRA 4DX3A 1JD9A 4E3TA 1IEWA 2E5DA 3CB8A 2J9ZA 3OZYA 4GBDA 1XBVA 2XGBA 3TAKA 2A4AA 1E56A 2OKOA 1LQAA 4GPNA 1OF8A 3V0SA 1JJKA 3G77A 3SB0A 3GXPA 1D3GA 4GI8A 1JVNA 3CZLA 2OQYA 3SGGA 4FALA 1J11A 3AXMA 1IEQA 1SW3A 3D3AA 1VPYA 1I2NA 4UTTC 4H9MA 1E71M 4NXKA 3BZJA 2VEKA 3N9RA 1UWUA 4FSAA 4GNKB 2ATMA 3AIEA 1LDCA 1TJPA 1VFHA 2AAMA 4TOQA 5C70A 1JF5A 3ARQA 4YTQA 1Q45A 3KBVA 1JZ8A 3ARYA 2PDNA 2W9MA 3K5XA 3TN4A 4Q8PA 4CUCA 3UPMA 3SCSA 4IOTA 3LEPA 1KCZA 4IX0A 5K3VA 1S2CA 2OZ3A 1YYAA 4E2OA 1H2JA 1W3TA 1HZYA 1XH0A 1GVIA 4FS9A 5AY7A 2GLKA 3VIMA 4DBDA 1QUMA 3LHYA 3FDGA 1K6AA 4A8NA 4ZOCA 4XZNX 4Q8WA 2GDVA 4Z2GA 3OHIA 3RJYA 3CHEA 4NX5A 4B5SA 2WMGA 2C15A 1GYLA 3E2SA 1P1XA 4WY0F 3RLUA 4JIRA 1P6WA 3T4WA 3AHVA 3STPA 3BLFA 1TSIA 5IOBA 4QNWA 3EXRA 3WN6A 5LIXX 1RXOB 4Q4SA 3TKFA 4K1WA 5CC5A 1R3YA 4BY3A 2B7NA 3Q37A 4EPKA 4XISA 1EOMA 1DEDA 3NQCA 1MNZA 2R1MA 3IACA 4RE3A 2ALDA 1AW2A 3XISA 1BG4A 3CNYA 3PM6A 3G0UA 3B8DA 4IIFA 1BTCA 5HWJA 2G96A 2Z0IA 2DT2A 4JNMA 1GW9A 2GDQA 2PRMA 1C7SA 1RJPA 1XRSA 3R11A 3AFBA 3N04A 1WXZA 2PDLA 3S1XA 3U2ZA 3GQYA 1FWNA 2GJNA 3WEOA 3LCHA 4CQCA 3N6HA 3K13A 1ECQA 1F7BA 3G1RA 3QMRA 1Q63A 3CMGA 3C0QA 3FFSA 3OBEA 3NCOA 5C7HA 2Y5EA 1UQZA 3GVRA 3OQ8A 3PZUA 1R2SA 2OXNA 4NZ1A 1R87A 3CEPA 3OTRA 3RLHA 4GNJA 2V5DA 3RCYA 4UTLA 4ASTA 2Y70A 4GYJA 4B5NA 3AXKA 3GZAA 3BSHA 3KBJA 2QUUA 1VCVA 4MWAE 3KZSA 4O1BA 4MJ4A 2YJQA 1XDJA 2OSXA 2CBIA 1GK8A 2G50A 3EPMA 1CDGA 2PDXA 3PWIA 3W1QA 2YZ5A 4ES4A 4PBEA 2E40A 1WBHA 1OVDA 3FAXA 2WSPA 3TC6A 1UD3A 2Z7KA 4GCAA 1JFXA 2CHOA 5BXRA 2HV5A 1TIMA 2B7QA 4PUWA 2GJLA 3LXAA 4XAFA 1RQEA 2HRWA 3MKVA 2E68A 3NUKA 3HGRA 2VFIA 3UXKA 4MY1A 4XZMX 3T7VA 4GI6A 1V0NA 4C6BA 1X6UA 1QFEA 1Y5WA 2CKRA 2PLCA 3LTSA 4DO5A 3CK5A 3OZOA 3OEXA 2JQXA 3AOFA 2XM2A 2OWCA 1ZHAA 1FWAC 2YCJA 3GVWA 2OODA 3Q45A 3IVTA 4L4MA 1XIMA 5PTDA 2PURA 3W1UA 2VR2A 2V69A 4BEQA 2VZOA 3SI9A 2IUZA 4REQB 1YNPA 3RIKA 3VOIA 3IK2A 1RK5A 3WYZA 4EXAA 5IFPA 4IUOA 4JXCA 3VIIA 5G4WA 2OFJA 1ESWA 1DIDA 4KWOA 3KDNA 3WX7A 3UXLA 1LJYA 4D6EA 1UP2A 3LLFA 4XSMA 3MKKA 1W31A 3MSGA 2A3BA 4BWLC 1A5SA 2ZXQA 4IL2A 2TSYA 3WQ5A 3IAQA 1I4NA 3BARA 3KTXA 4F2BA 1AZ1A 1ZBKA 1Z7AA 3L5MA 4L9YA 3TC3A 5K9XA 1W91A 2DU2A 4K39A 3B06A 2FB2A 3VFLA 3LGEA 1VQTA 1YMYA 2VI0A 3QHOA 1MQRA 3PP7A 1K8ZA 1ML1A 3KZPA 4PZVA 1EGZA 1SFSA 4HSOA 1O5QA 4ADUA 4E2BA 3TTOA 1WP6A 3SBFA 3MUIA 2PI6A 3KBNA 3XIMA 4H6KA 3LBCA 1JXKA 2YA2A 2BNJA 7REQA 1H7OA 4LYKA 1KBJA 3SCWA 1KRBC 4MB3A 1ZJIA 1LUCA 1G67A 2BODX 4R27A 4IMAA 4GQQA 3SECA 3A5VA 1WOBA 3EB2A 3L65A 3SADA 4US5D 3UW6A 3A3HA 1QW9A 3LDVA 2J8TA 4FA3A 3TEVA 2FTYA 4O18A 1X38A 4Y9MA 5C9RA 1JYVA 2ZDRA 3FXYA 1FX6A 1JPHA 4YCOA 1V3JA 2PC8A 1UR8A 4AD0A 2WPGA 4HNLA 4N0RA 3DXIA 3WDJA 1WDSA 3WD0A 3VDBA 1NIUA 1KFWA 1XRVA 3U7VA 1UBPC 2PWVA 2J7HA 4FZIA 4GZ7A 1JNEA 2BWGA 4C1NA 3ZJKA 2VEMA 1L0PA 2YYUA 4YLWA 4AZ5A 2OX1A 4P7OA 2HVOA 3F5LA 4RW3A 4S3AA 3NPVA 1QI0A 5A6LA 4H2CA 4GVFA 3NVDA 3OU8A 1FWJC 1OYAA 3LA4A 1S3HA 3HG2A 3SSJA 1MEIA 3RJXA 3V0TA 4H2HA 3QF0A 2P53A 1OX5A 2ZUWA 1OCJA 5CC3A 1KBLA 1G0CA 5M2FX 3N6JA 2XSAA 1IIGA 3GYEA 4G5DA 3BMWA 1EC9A 3WLLA 3L9CA 3W7KA 2EG6A 1B30A 5HJLA 2AAAA 4C5YA 2CLLA 3A47A 5A6TC 4WSJA 3E0WA 4HA1A 3BH4A 3CQIA 4PRWA 1V02A 4MNKA 3OBKA 4GG9A 3QGAC 4O17A 2W4XA 1TPFA 2ABAA 3L12A 3FCPA 2VOMA 3U8GA 1J93A 2R8WA 1UMLA 4AZCB 1E1EA 5ABFB 1JIBA 1KGUA 2WQPA 4PL2A 4FNTA 2E67A 1XSKA 1EYWA 2FTWA 1EIBA 2YBVA 2QHAA 1LUCB 4QS6A 3PTQA 5TF0A 4RDZA 1J5SA 3M0LA 2F6KA 3UR8A 3BICA 2FMNA 2VM8A 3WZ0E 5CGQA 4RNJA 5C0QA 4HCLA 4NZ4A 3MI6A 3GDKA 4MZ1A 1VCGA 3GVGA 3CQHA 1UH3A 2Q09A 4PUMA 4YIWA 2OMAA 4ZBCA 1MVYA 1RVKA 2XVGA 3H12A 4MM1A 2PRHA 2ZIDA 2GGGA 2GSEA 3CHFA 3G1VA 4YTUA 4J27A 4S38A 4EPBC 3OLIA 3LTYA 2VDGA 1GTEA 3LRMA 2EPHA 3QTPA 1K9FA 4M6QA 1Q6FA 4GH3A 4HZMA 3MUZ1 1LT7A 3TSDA 2BP1A 3U5UA 5FF2A 4AD5A 2ACRA 4WQ6A 3OO2A 3T1GA 1TX2A 3AIQA 2DIJA 1PXGA 1W17A 2J78A 2AGKA 4IMDA 3WK2A 3DHDA 4ZOEA 3K8LA 1P4CA 2V8ZA 5I07A 2NUXA 1O68A 1XIJA 3C3UA 3MB9A 5CJ5A 2IPFA 3CAWA 2PLJA 2QR6A 1KB3A 4W89A 1FWWA 3CT2A 4Z1CA 3NYZA 5D38A 1UG6A 3WFAA 3W7OA 4RJEA 4FHAA 1SYTA 3N12A 3WMBA 4A6GA 4L65A 2Z1KA 1SW7A 3C0SA 1OFAA 4P7LA 4AF0A 6XIAA 5JH1A 4JEQA 4TO8A 2BMBA 3WQFA 3PVFA 3WK0A 4OKDA 3NL3A 1AFSA 3VAVA 5AZ1A 4I6KA 3GVQA 5D32A 3EX6A 1DE6A 3T07A 4Q4MA 2AQOA 5A6AA 5HQMA 4IQEA 4U31A 3LCGA 4X22A 3DN5A 3B9AA 4BHYA 4PC8A 3BJTA 1PTAA 2WVSA 4IISA 2GGEA 3W07A 4EOUA 1F2JA 1R3RA 1AQMA 2JKEA 2P3ZA 2D0FA 4ZO6A 4M1BA 1Q6OA 1OIFA 3LXBA 4W86A 5D4YA 3Q58A 1IT7A 3GFXA 1TR9A 3WO8A 3VC5A 2E6AA 2AKMA 4LNCA 4XKMA 2D24A 4US6A 1CXIA 3WDRA 4D71A 3F2BA 3CV2A 3EAUA 1ISWA 1WKEA 1C90A 3AWOA 2E5BA 2IQ0A 1PZ1A 1GQIA 3PZQA 3QTGA 4M0XA 3JUGA 1DYSA 3TR2A 1OFOA 4G7EA 3B3DA 2O9PA 4J40A 2DSZA 4M80A 1WZKA 3REQB 1UWAA 2ISSA 2ABBA 1B9BA 5CSUA 4I3GA 5LSMA 1UR2A 5D8ZA 4UTUA 1M7XA 3WIJA 3IJDA 4LUTA 4FXRA 3CZEA 1WZMA 2OG9A 4U28A 3H2FA 1QWGA 4TMBA 2F7FA 5DMMA 1GVFA 1AMKA 3KLKA 2BGSA 3B0VC 1FWTA 2O4MA 3Q67A 4PMZA 1S2AA 1FH8A 3NQFA 4FNRA 4MADA 4UB9A 5GNXA 4HNNA 3DG6A 1M68A 3N2CA 4J3UA 4O1AA 4Z42C 2ZWYA 4HNCA 2FGZA 4IZGA 5I3IA 3B8IA 3GTIA 1TELA 2E09A 1DQWA 1OYBA 1TVNA 3MT1A 3T0CA 3U7BA 4ZE4A 1H7XA 1KXTA 1BXNA 4LUSA 4QLKA 3HB9A 3LSBA 1H1YA 2F38A 3IRSA 4PUEA 4QLJA 4B9ZA 4QJ3B 3GNDA 3M16A 3QGVA 3BK0A 5C2GA 4YJ5A 2A3HA 1UD8A 1CIUA 2DZPA 1BSLA 1E4NA 1H61A 4B16A 5FF3A 3LRLA 3KCJA 1UJPA 5EFFA 2Z25A 4DWSB 1LWJA 3L4UA 2V68A 3L67A 1AQFA 4MPQA 1F76A 4CN6A 3LTPA 2HS8A 1JXJA 2CLKA 5AYZA 5BOFA 3WLOA 5HNRA 3GXNA 3OODA 3W1AA 5A95A 1B4EA 5FSEC 5F2MA 2YCLB 4GYPA 3EX3A 1YW1A 1YKWA 4BFAA 5BXPA 6CGTA 1KM4A 4JS3A 5FI8A 5HMDA 1MW1A 4AZCA 2EEXA 4XB3A 3SW6A 3TH6A 1KTCA 1Z44A 4M5PA 2QCMA 1AODA 4RXFA 4NF7A 3E6EA 3A4WA 4A35A 1RUSA 2NSOA 2O0TA 3F7JA 2ZE0A 2VDIA 3G3DA 4GISA 2VX5A 1HL9A 3FEQA 4XVDA 2FPYA 3DIPA 2GUYA 4W7VA 3M5ZA 1E4MM 2VNCA 4PBFA 4P7RA 5FJPA 3V1HA 5D09A 1XR2A 4WSKA 4WF7A 3L0GA 4QROA 1V3IA 5TNVA 3IJ8A 3NQ2A 9RUBA 1RD6A 1EA9C 2C1GA 1RR2A 1OADA 2Y63A 2R6OA 4L9ZA 3GVVA 2POTA 2RGMA 4GJIA 2BY3A 2WM0A 3IGUA 3ELFA 4MB4A 2VRKA 3IJ7A 1DWFM 4BR1A 3COTA 3KHDA 3M0JA 1EOKA 1JCLA 3KBWA 1TUFA 1US0A 3S9ZA 4MDOA 4LJ3A 2HK1A 1IV8A 2QDGA 2P88A 2QV5A 2GZXA 4ZSTA 3PJTA 5HQLA 1QPRA 3B40A 3NQDA 3UXIA 3VX0A 1OGBA 3M5YA 4IMFA 1VBHA 1GVOA 5CPMA 3ZR4A 2NWRA 5AOUA 4DXVA 4FX6M 1CGVA 4H7VA 3MO4A 2Q8LA 2GVEA 3M43A 5FJUA 3LU2A 3SCRA 3GKFA 2WVTA 4NZ5A 4N9DA 3NGJA 1KM6A 1XFCA 5CPNA 4UR8A 4KFPA 4RZ6A 1TG7A 1U30A 3VKAA 4WY0B 4PMOA 3N4AA 2EKGA 3DU0A 4DZHA 2YW4A 3VKDA 2HSAA 2TPSA 1OINA 3QH2A 4TQTA 3TA6A 3PZTA 1KRMA 3WFLA 4EKJA 1SO5A 3DX5A 3H8AA 2XZ7A 1IT8A 5F1VA 2VD9A 4JICA 3BLLA 1Y65A 3W7JA 3E3HA 2OR2A 3W7DA 1TMLA 4M8UA 2NSXA 3LZ3A 4FPSA 1M6JA 4PMJA 1TV7A 3EA2A 2D0GA 3GZ3A 2WHMA 4LS2A 1M01A 4D9PA 3RYSA 3BURA 3W7HA 3SN0A 1J4EA 4KRUA 3VVGA 1ZAHA 3WLTA 4MAVA 5HXMA 3V35A 2W0UA 3EDKA 1H09A 1WCGA 4AX7A 4GY0A 1MEHA 2EHHA 1QASA 3RM9A 3LYEA 4B15A 1W56A 3VMOA 2GQ8A 3BMVA 4IP7A 2FZMA 1FXPA 1BD0A 1KQZA 1AJ0A 2X0SA 4PMYA 3ZWTA 4F3HA 3EXSA 4AMCA 4L61A 2NX9A 3F03K 2V0TA 4Q8VA 1GNXA 3TCSA 3BLPX 4JIPA 3N2OA 3H70A 1TYGA 3MWCA 3C5QA 1EB3A 3E1F1 2Z2BA 3DFPA 4AHQA 3DFQA 4PCTA 3PBUA 3UJFA 2PCQA 4A3YA 4LVDA 1Z48A 2REQA 3GC5A 2VT0A 1YIXA 1H0GA 1RK6A 2CU0A 2W5FA 5CPQA 2O56A 3ABZA 1UWRA 1JPKA 4LRSA 4UOJA 4DZIA 3CQJA 4X60A 1JEZA 2ASHA 4IP4A 1R6WA 2VTFA 3R7MA 2J66A 3L4YA 3GC4A 3UCQA 4P8UA 2JK2A 1HX0A 5CZSA 1GQNA 2Z28A 3V5OA 2FHCA 3VIOA 1OYCA 2PGEA 4OVXA 3TUUA 4POCA 2DPEA 3F4DA 5FKYA 2YCKX 3P93A 3PAOA 1HKKA 5KINA 4LBRA 1TWDA 2PWEA 1BSIA 1H60A 3KAOA 2YR1A 5FD0A 2YXXA 1X1ZA 2YLLA 4QM1A 2OT0A 5A8NA 4U10A 1E1CA 3PTKA 5BU9A 1YLVA 4PMNA 1ZALA 5J04A 2J7CA 3GHSA 2BS9A 2Y1HA 3W29A 3WEZA 4QCEA 3K8KA 2EG7A 4HJFA 3H2EA 4WZHA 4N9CA 4Y8FA 2QCNA 3LCWA 4HB7A 4M81A 1W32A 1L8NA 3ZJ6A 1XBXA 5TBOA 2GUUA 2WCAA 1LM1A 1LTDA 3OA5A 3IJLA 4ML4A 2BVDA 1TE1A 3KRZA 3TFXA 3BAIA 3W1MA 3LM7A 1KD0A 3SUUA 1MWOA 1FWHC 3GIYA 1QPKA 2XIBA 1OBAA 3MTWA 4LSBA 3C0LA 2XFYA 2OYLA 4LVAA 1FCQA 1KTBA 3MSYA 4DUOA 1S46A 3AMKA 3WD4A 1DWGM 3DI0A 1K4GA 3EB4A 4GOAA 1FOBA 4JYEA 4YWIA 2HNHA 2ODOA 3KBSA 4OUIA 3D6NA 1EF2A 4KERA 4QTGA 4XBSA 3VA8A 3URQA 3JS3A 3UR5A 1V6VA 4JTQA 2ZZ2A 4NSBA 3GUWA 4IJCA 4CQDA 3W7LA 5A8QA 2XGIA 5HBFA 2PDFA 1UD2A 2V2HA 4NJJA 3C56A 3GNOA 3PS7A 4GYPC 1GG1A 4OBSA 1Q8JA 2X7WA 3P62A 1MQQA 4A8IA 4ZQPA 2E4TA 3P14A 3UWQA 2PF8A 5KZMA 1NQ6A 2HE5A 2C79A 1IIHA 3QFEA 4GKLA 1X8CA 1G6CA 3NZPA 2V38A 2WJFA 3EYPA 2DFAA 1F61A 2NQLA 3DGRA 3TJLA 2Z1VA 1TO3A 2VO5A 4LU0A 3S42A 3N15A 1MRQA 4ATWA 4FR6A 1KR1A 1GCYA 3CQKA 2ONEA 3RUBL 4S39A 4A2RA 2D2OA 4IG2B 2CBVA 5A2CA 3LLDA 3AHTA 3GXMA 3FJLA 2QYGA 4HA3A 1QATA 2J4GA 2OGJA 4MZYA 1S3TC 3GS6A 4HZ6A 3ANVA 3SCTA 1ADOA 1R30A 4AIOA 2OKTA 1W3KA 4ZGYA 1S1PA 1Q6CA 3SFWA 1TA3A 4QQUA 1RZMA 2PZ0A 2P5NA 3ZR6A 1YXCA 8XIMA 1VKFA 1BGGA 2XIOA 2ZUMA 1XIEA 1AA1B 1PZ2A 4RPQA 4MJMA 3THQA 2DEPA 1OFEA 2ZZ6A 4ZOBA 1SJCA 1I45A 1K77A 3R0DA 3OJGA 3AMCA 3SCUA 2VCBA 4A3UA 3PZNA 1M1BA 3LPFA 4C60A 2PE4A 2DJXA 1H50A 2CPUA 3TOPA 5IBXC 3FJNA 2DUAA 2EQDA 4AXKA 2WC4A 5CSSA 1FVPA 2FGBA 2CZFA 1J79A 3ABSA 2O55A 2V63A 1MSSA 1K6WA 4XBJA 4RCXA 4HPGA 3PG9A 5D2WA 3U2EA 1UR0A 1THFD 3KL3A 1JYNA 4PA8A 4DELA 4LC6A 3L5LA 3IGHX 2FZBA 3P74A 4IMEA 2XYLA 3NQEA 1Y7VA 2JBMA 2FFCA 1C29A 1HJWA 2WZHA 4YU1A 2ZADA 1MXGA 3GO2A 3VNJA 5I78A 1MUMA 3K1DA 1PHQA 1NP2A 7XIMA 1D2KA 1HNYA 1O66A 1KV8A 3R0KA 7A3HA 1N8IA 1DP0A 2CXEA 5FL1A 2H9AB 5M3WA 4HN4A 3HGJA 3IUIA 3UFYA 4QIUA 4R33A 3CTTA 1E9YB 3EGJA 3GB6A 3OZPA 4O0KA 1XIDA 4R53A 3IRDA 1Z3NA 1TV2A 3WMLA 4WDXA 4DEFA 2XINA 4C7FA 1QOPA 4JTUA 4W4QA 1IZKA 1V51A 2A3LA 4CNSA 4F2TA 1F73A 4YNGA 2E28A 2QT3A 1NTHA 2BG5A 1XLCA 3PG8A 1W8GA 4PUNA 2WCSA 3H21A 1E0TA 3DAQA 1W1B1 2INZA 4NUWA 2ZX6A 3LGGA 3PBYA 3G1HA 4WX2A 5DBUA 2ZYFA 2VENA 4LYQA 4DBEA 3RM8A 2GJXB 3TJXA 4PTMA 1QNRA 3GTXA 1NDVA 1XYFA 4C1NB 2PDGA 3PWAA 1P0DA 3LK6A 5CH9A 2DSUA 4NAEB 3CUIA 4UMCA 2FLIA 3TYZA 1VFUA 1OC5A 4FXFA 3T05A 2C14A 1W5PA 4UTIA 1W37A 3A9IA 5REQA 3OG3A 3CL7A 5HJXA 3ZIZA 1EHNA 1EO7A 3VX1A 2YB1A 3UJRA 5C71A 4NJHA 5C9XA 1L6GA 5I0DA 3CGTA 3PPHA 4JQAA 1W2VA 4B91A 1E6SM 5F7UA 1WNOA 1WXJA 4HPNA 4AZGA 3NIYA 3NL2A 2BFGA 4DWSA 2FZ9A 4YWSA 3ZSSA 4IMGA 4HOWA 3TTQA 2DY3A 3IEBA 4ERGA 4MGGA 5MKGA 4GY7A 2BBFA 3AIVA 3U2OA 3FKRA 1BGAA 5H1WA 1JPDX 2RAGA 3MYPA 1G01A 4Y9NA 4KCWA 1CGUA 1AVAA 5CEWA 1A47A 2GOKA 3PSWA 2D73A 4GABA 4PCSA 4F8XA 3S1VA 3W83A 2JEPA 1DQUA 1J6OA 4WDTA 3N18A 1M53A 3EX2A 2OO6A 5D9OA 4V33A 2R14A 2C6QA 4RE2A 3VUSA 2V3DA 1T99A 3E96A 2VFGA 4GC4A 4H8VA 4JNYA 5KZ6A 2WYSA 2AQVA 4S3GA 3B8SA 1RJRA 1XDLA 4ORMA 3MC5A 3IPWA 5FEWA 5LGXA 3H24A 1N2VA 3DYMA 4QXIA 2VHLA 2HPMA 4F0RA 1A50A 1FTXA 3T09A 3T8QA 3B8WA 3G6MA 3FDKA 5CLTA 1HGWA 4DAIA 3N9KA 4J3VA 2A79A 1DJGA 4H8UA 4PTDA 4UTWA 2VVSA 5B7YA 3IJQA 1EQPA 2HZGA 3TP4A 3W7NA 4HSNA 2HWGA 4GX8A 3ID7A 3ORWA 4C6QA 1YBQB 3BAXA 3E9AA 3N14A 4QX4A 2QAPA 3EMQA 3MCOA 1E55A 2G95A 4C6MA 3N2BA 2ZFAA 3W70A 1GKRA 2FHFA 5C55A 3U57A 1PDYA 4NNBA 3OVQA 2XVKA 1EF3A 3F1QA 3VGFA 1KW1A 4EF9A 3R89A 1A0CA 1UKQA 2AQWA 5H8UA 3WQDA 2WCGA 4H7CA 1GONA 3VZZA 1GJWA 6REQB 3R2GA 3B0PA 3U5YA 4NXSA 4EWJA 1BYDA 3U4AA 2D69A 3DGBA 3KWXA 3HG4A 3Q65A 3AIWA 3CUGA 1AH0A 3CUJA 1KLZA 3C2VA 5TAOA 1I9CB 1XLGA 2WMJA 4RXGA 1ITCA 3TA9A 3G22A 4IXHA 3RGTA 3FN9A 1BWLA 5FCZA 2IKHA 5D8WA 3W7CA 4A4AA 1W0MA 3ITGA 4LUIA 3ABRA 3MU7A 1EH9A 4Z1DA 4HNVA 5I3FA 3EOEA 8TIMA 3C2FA 4RK8A 3TJ4A 2IQDA 2NLYA 2OZ8A 1PSCA 4H3DA 3P5ZA 3S1UA 3WQ6A 4ADSA 1YQ2A 1A49A 3UETA 2PD5A 2V5KA 4XZBA 3H7UA 4C91A 2EJAA 4H04A 1E4IA 2J7GA 2G3NA 1M03A 4DXKA 5HATA 3OLEA 3TWBA 5DANA 5EU9A 1ZQ5A 2Z7GA 5M1TA 4PE8A 4J9JA 1LBMA 4UQBA 4B3KA 3LNPA 9XIMA 1A5MC 1KCXA 2QLYA 1CEOA 2J27A 4M7SA 3NQ7A 1SUXA 2B31A 3E5BA 5I3JA 3UR2A 4CN4A 1XGDA 2DW6A 3FVMA 2E6FA 3NYDA 1W9PA 3I6RA 3VIFA 1NWRA 3W72A 1XFBA 2CKSA 5CSYA 3AZSA 4Z2IA 3R8GA 1MZRA 3LERA 4EAYA 1C8VA 4AY7A 3E0IA 3L4ZA 1YE6A 4NZFA 1D8WA 3SRFA 5FAGA 1N55A 2DZVA 3LGDA 3W7QA 1T41A 4D6HA 5B80A 1ZB5A 1V3KA 3DC0A 3GW0A 3UZXA 3RFAA 4RL3A 1FQ0A 1XWYA 1WZAA 3ARRA 1K7FA 2ICSA 2CZVA 4HK6A 1U2YA 1V3MA 4OFCA 4GHRA 5T26A 2G41A 3W6LA 4FNQA 1IE7C 3HF3A 3P8JA 1W3LA 3HURA 1SZGA 3GAYA 4F9JA 1RPXA 3WL0A 4HYWA 3WFZA 3S2LA 4BQ3A 5M17A 5C9WA 4OIFA 2XH7A 1RY0A 1NFGA 3OYXA 4MB1A 3GYCA 1V0MA 2ADAA 4CNUA 1AL7A 2O92A 4B5WA 1DPMA 3T2PA 4PULA 2WLZA 3IAPA 4S3EA 5BOOA 1M04A 4V28A 1VS1A 4UCFA 1K70A 4NIRA 4DUXA 3VM5A 3UYCA 2R9RA 4L1XA 2V81A 5BW6A 1ENUA 4JTFA 2F6UA 5F2IA 1TZ9A 2CITA 3RLVA 3W25A 2XGZA 3WDQA 4O4VA 2WV8A 3BW3A 2E25A 2E5CA 1XCFA 4LVFA 2IS7A 4NASA 3WD2A 8XIAA 1FXQA 4KH2A 2X09A 3CEUA 4XAGA 3QMSA 2B4GA 3PK7A 4N9EA 3AYSA 3HU7A 3ARZA 3NQ6A 3A13A 4AF0B 3TK7A 3T55A 1W3NA 4F48A 1Z9AA 4QDWA 1YE4A 2PWGA 2PTXA 4GE8A 4WKAA 3CPUA 1QAPA 3VFCA 3MANA 1GEQA 4V1XA 3EA1A 1AG1O 1K9DA 5FA5A 3CMJA 4K1GA 3SEPA 1L6SA 3CIWA 1NWTA 5E9AA 2X42A 4FMVA 1X98A 2P8CA 5HR6A 1EHAA 2I5QA 2YL6A 1H63A 5GVJA 1UWIA 1KXHA 2E1WA 2PDWA 3PTMA 1KXVA 3SGZA 2EJ1A 5MF5A 1FA2A 5AYYA 3NDOA 3V7PA 3ATZA 3MV01 3IIOA 2TYSA 4Q7NA 4HJWA 1NDZA 1TVPA 4TTGA 2I7GA 4JOMA 5CQ1A 4JZ5A 4DYKA 3R8RA 1DJIA 4DO6A 4OU1A 3CU2A 4B5UA 4AHOA 5AN7A 1LG1A 1JI2A 1U5VA 4QG8A 3K4WA 4NP7A 2VFDA 3W2LA 4Q7IA 1G7VA 3AZRA 4J35A 4Y90A 3AJ7A 2CFFA 5LNWA 2PDIA 1V6XA 4NRSA 3S46A 3TTSA 4DNMA 1OFRA 3KS5A 3PSVA 2VWTA 3G8EA 3LENA 3VNIA 3VILA 1TRDA 2IQTA 3KVKA 2C7FA 4G9PA 3OIHA 1SM9A 1Q2SA 3HJEA 4L4PA 3POCA 1XSIA 1XIBA 5G2WA 2CLOA 1V4YA 3A3XA 3FV9A 1XF0A 4JFUA 1QTWA 1QCWA 2V67A 2NQ5A 4F0HA 1OWQA 4LAOA 1OD8A 1NEYA 4HN8A 3EOOA 2E6DA 3ZT6A 3BXWA 4TVCA 3LV6A 2X0HA 1IGWA 4O8AA 3PJXA 4HVXA 1QI4A 2ISVA 3KL5A 1ZFJA 1XRTA 2A3CA 3G1YA 2PWUA 5DT7A 3DG7A 5IBXA 4BS0A 4W8AA 1SO3A 3UNTA 2NX3A 2V82A 3JW7A 1KNWA 4XBKA 4O11A 1O5RA 1J6PA 3O2LA 3EWYA 3HQNA 3KW3A 1OZMA 2FPVA 4EVZA 4HMCA 3PWGA 3MO7A 3QYSA 1WUFA 2FVLA 3KX6A 1OY0A 3O16A 3MQTA 3BW2A 1AQ0A 1FCBA 1K9TA 4Q4OA 4IFKA 5HNTA 3OA3A 4GQRA 4DWSC 3LHWA 2ZKMX 4WIWA 2QKFA 4CKQA 3LHZA 3C2RA 1ITUA 4DJED 1OC6A 3RRXA 3VIGA 3EKLA 4R9OA 2G37A 3DZ1A 2FYMA 1E6PA 2VMFA 1US3A 1K02A 3CHCA 2FVMA 4GVGA 2ZA1A 3EX1A 1BRLB 3K2GA 2ZUUA 3II1A 4TU1A 1JZ2A 2ZZ1A 2PDHA 1Q85A 5G1YA 4XIMA 3DC8A 3VNMA 1UZ4A 2Z2UA 1XLAA 4LQ1A 1QNOA 4ADTA 4JBRA 1XH2A 4IIEA 2XUCA 3N2XA 5HWNA 3QFWA 3USBA 1D8CA 2I57A 3H2NA 4JTCA 3G0XA 1NH6A 1S39A 4JN6A 4A2SA 1POKA 1VEMA 2DVTA 4LGXA 3PNZA 1N7KA 3G5EA 4OZOA 3M47A 4LBSA 2ZX7A 4WKFA 5HPCA 1E0UA 3OPSA 4B5XA 1XUZA 3NEHA 1WE5A 3DEQA 1C9WA 1F07A 4F66A 4GZEA 1W3IA 2RH9A 4UTMA 4FIRA 2PTZA 1Q7QA 1C8XA 1WDRA 2INEA 3LCIA 4JNZA 3SRHA 3NQ8A 2ACSA 1GVEA 1T7LA 4MUZA 1XGZA 4RW5A 3QY6A 4M6UA 3MUXA 4US5A 1F4AA 3HFYA 1L6WA 2VP8A 3HPSA 4HA4A 1WKFA 1QNSA 2V9DA 4AD2A 2PBOA 2P0OA 3W73A 1CTNA 1TZZA 4L5ZA 2TODA 3W2KA 1J0JA 4ZB0A 4RDYA 1R47A 3KTSA 3LB0A 1TQXA 4ZVJA 5C7VA 2VYOA 1WDPA 4GUFA 4NU7A 3CBWA 4X0VA 3AXIA 4IPPA 2EAWA 1SFTA 4O19A 2J7EA 3RNDA 1NWUA 2WC7A 4IFKB 5I3KA 4LTSA 4Q8TA 1LBLA 3BDKA 1H62A 2H6RA 2WAGA 4OV4A 1EC7A 3O3RA 4H19A 4Q8NA 2VDHA 4NYUA 1FHUA 1PX3A 3N25A 3W86A 1JZ3A 4CU7A 3S5OA 4HPXA 1F3EA 4XO7A 1BTMA 1A5AA 2VGIA 1FH7A 3N3MA 1NFPA 1UR3M 1M5WA 1PB0A 4KWUA 3IS4A 1NOFA 3K46A 1QU4A 4H1ZA 4LUJA 2VGGA 3CASA 4LY4A 4PRTA 4GVIA 1XYAA 1OCQA 4HU8A 4GUIA 2H8ZA 1SPQA 1O1ZA 3H22A 3V16A 3C52A 3OVPA 2HVMA 5CJNA 2NVCA 1RH9A 4G8TA 4BF9A 3SY1A 2A6NA 3PUGA 1JCYA 4BI5A 4EPEC 4REQA 1PX4A 1OC7A 3UVAA 3UG3A 4KWWA 1F3TA 3IJ9A 3QW4B 4UQCA 3UA3A 4GIRA 1W1YA 2X2YA 1HP5A 1ONEA 1GOQA 4UFMA 4ZO8A 2D3LA 2VQUA 3THAA 3P6LA 3NGFA 1S5TA 4ZR8A 3NSXA 1ITXA 2ZC8A 3DESA 1ADDA 5AHEA 1SVDA 1CLXA 5D9NA 1MW2A 1DVJA 2ZRXA 3ARWA 3MI2A 1E5NA 4AZBA 6PTDA 2BY2A 3LPPA 3EDFA 4L6OA 4BQ5A 1WYIA 5JIPA 3AMGA 4MZ8A 1EIXA 4F0SA 6ALDA 1LLOA 5D2TA 3WQEA 1UPPA 2DGAA 2E9BA 4O28A 3SUWA 1WPCA 1U5HA 2D0HA 1Z8AA 5DELA 2E8ZA 4B2DA 8RUCA 3ZLHA 3ZJ7A 4AD4A 1W3HA 3WUBA 3UPWA 2A1YA 3WJZA 3ITLA 1TV5A 4WK9A 1NM9A 4W7UA 4K8GA 4XIAA 1I2QA 2VEIA 3N19B 5K9DA 4LAMA 2FJKA 1AJZA 2YYTA 4MYXA 1F6KA 1U1JA 5IRPA 5K7JA 3T0AA 2CLFA 3WK3A 3G1FA 3LCLA 4XKYA 5I5RA 4IJRA 4DHGA 2F9RA 2WVUA 4IIGA 1KQYA 4PN2A 1E73M 3M64A 3NWRA 4HTBA 3UZJA 3H54A 5LXXA 1UD5A 4LWWA 3WEMA 2V2DA 3CWOX 3IJIA 5DXXA 4WDWA 3L0NA 3W71A 5HUOA 1LYXA 3RMEA 1QWKA 3FNDA 3WL1A 2AL2B 1FDJA 3FGCA 3LS9A 3PZ9A 1P6CA 3ZOAA 3G1AA 1WUEA 5I3GA 3BCDA 4WHBA 4MKSA 4HPHA 4KEUA 3NZQA 1VLWA 1K8YA 3R94A 3QMTA 3REQA 5A3HA 3R43A 1HUVA 2I9UA 2AGTA 1XIIA 1FCUA 1JRCA 4NRRA 1X7IA 4TV6A 1TA3B 4L6HA 3K30A 4C90A 4YS1A 1IGSA 1KR0A 3BLIA 3PHAA 3VGEA 3W6MA 2QUVA 5I06A 1WDQA 2YL9A 3N2MA 7ODCA 2LLEA 3I6EA 3T44A 3DUGA 4B92A 3GIPA 3O6DA 3W1TA 2FFIA 9CGTA 3HGSA 2VX7A 1LZOA 3VKJA 4Q8UA 1ISXA 3QBUA 2WVVB 2OTDA 1QO5A 1QBBA 2PTDA 4LY8A 4JY9A 1QBAA 1EWDA 2TMDA 4OUEA 4D6IA 4UFLA 3TQ0A 7ENLA 3EOUA 4JFWA 2FZNA 1UJQA 2C71A 3PZMA 1OK4A 2XJ7A 3STCA 4UTWC 2PP0A 5I3HA 2Z4GA 7REQB 2OQHA 2QULA 4ZTXA 1ZUAX 2XHYA 2F61A 2W92A 1OSEA 3B0UX 2FDMA 4P2VA 4R7OA 2VGFA 1FY6A 3W37A 4TX8A 1MI3A 3DDMA 4CNNA 5A6MA 3R25A 2Z27A 5BMWA 3URBA 1TJRA 2Y62A 3QPEA 2BZNA 2KX9A 1ZS2A 1ZAIA 3S5NA 1VEPA 1OEPA 1TJ1A 1B3XA 1IXNA 4Q7BA 4CVWA 4K6AA 1P48A 2BXZA 3S3GA 1E0VA 3TLLA 4XD4A 4UWMA 3OOQA 3AUJA 3FHAA 1E0WA 1HL2A 5IXEA 5M5DA 4ONVA 5AZ0A 5AKQA 5EFDA 2QMKA 2UY4A 4J5NA 2VZSA 1UMYA 2HBVA 4Y9PA 1VPQA 5EBUA 1EQCA 1XYZA 4LT9A 3ECQA 2VKZG 4FNPA 1OQFA 4L1WA 1EO5A 3VGBA 1MEWA 1ICQA 4PRRA 5DCDA 4DPPA 2ZA3A 2VUYA 1V7AA 1E6XM 5A6KA 4PMVA 4C5ZA 4YXGA 3SUVA 3SCOA 2HQAA 4AFYA 4HKPA 4W8LA 4PCNA 4NVTA 1S2WA 1VJSA 2DORA 2PDMA 3WJYA 4JPGA 2PU0A 4J4KA 2C13A 4JHOA 5EMYA 4S3DA 3IGXA 3W2MA 1BYAA 2C91A 2QIWA 4QE1A 4JHMA 1PKMA 3RR1A 2XIJA 4QAWA 3WQPA 4H9TA 4NJIA 1B3WA 1GYMA 1W1VA 2G97A 3BGAA 3WF1A 3SGUA 3UGRA 1W5OA 3TW9A 2NV1A 4OJYA 2WKGA 3NEVA 1EPXA 1BXBA 2VR5A 5ABFA 2D1ZA 4PR4A 3VNDA 2XSBA 5LYRA 2Q3RA 1I2OA 4H9XA 4WR3A 1SSDA 5G1TA 4GKTA 3S9YA 4GFSA 4PH6A 5AHLA 1CZ1A 3MI3A 1KC7A 1TR1A 1KFEA 2VURA 3WJSA 1ZNNA 4GINA 4MWAA 3WH5A 2Z6IA 3I7RA 3GXTA 4QDPA 1B5TA 5A6BA 4NT0A 3IK4A 4F9DA 4HK5A 4FX8A 3EZ4A 5D02A 4TVUA 1R5YA 2QCGA 3PBMA 2O9TA 1HO1A 2Y24A 1DWIM 1ECEA 1FWBC 2HNEA 4WSHA 3BG5A 4PB3A 1IWAA 2YBTA 1ISVA 1NELA 3WF0A 3TTEA 3WDHA 2WJEA 4IIHA 2DVUA 1ITQA 1A5KC 1DOSA 3LY0A 4KCUA 1HL8A 1CXKA 3NR0A 1TFVA 1J0ZA 4OV9A 5L6UA 5JU6A 4CU6A 3GKAA 2WSKA 2YFOA 1XDMA 1R2TA 1GKPA 1LOSA 9XIAA 3NM1A 4MIMA 3CLWA 4F4RA 5G5IA 3VC6A 1PWLA 3N3TA 1O6IA 1X8FA 3IJ6A 4ZQNA 1EDQA 4XUGA 2XVNA 4HNOA 2OEJA 2EGZA 5ECVA 1C93A 2ZOXA 1J5TA 1O4UA 2ZQ0A 3RX4A 2YDRA 3AHXA 3IIZA 2GGHA 3GDBA 3WDPP 3QV7A 2YB4A 4DF1A 1H0IA 2YA0A 4XTDA 4CCEA 5HNNA 2JF7A 3PFMA 1CGXA 3HV9A 4Q32A 3WQOA 3WNNA 1V0LA 2V3GA 4V1YA 2J77A 2Z2AA 1TCDA 3C2YA 1V8EA 4OBRA 2Y7FA 3HOJA 1WQ5A 3E0LA 1O60A 1XYBA 3I4EA 4KCVA 3XINA 5D2VA 1ZAJA 4NZJA 5G4HC 4TX9A 4I7VA 3UWVA 2CLEA 4AAJA 1V93A 3BPWA 3VKCA 5G1MA 1HJQA 1E4LA 4ZSUA 4WY0A 1UHVA 4H9ZA 4XWUA 3TWAA 1E9LA 5ABEA 3ICJA 1GOIA 2E9MA 4I5RA 3DYPA 1ONXA 1UZHA 8A3HA 4XZWA 5LNUA 3PUDA 1VFTA 3GHUA 4Z2KA 2WW5A 1TJ0A 2Y8UA 1I0BA 1VFLA 4O16A 1H7WA 4FP1A 5RUBA 4KFOA 5K2ZA 4DI9A 3TU9A 1SU5A 1HKWA 1G4SA 4LALA 5DXYA 1B3OA 3W01A 4QDMA 4JGDA 2DT3A 3IGSA 3FSUA 3AS2A 3WJWA 4DO4A 4HU0A 4JCMA 4KMQA 4IL0A 3VI2A 2VX6A 1YXYA 5AC4A 3KM8A 3ZVHA 4K8EA 1YTKA 4BQ4A 4JN8A 5I09A 3W75A 3B05A 5E1QA 2C16A 4IPLA 1PIIA 4PMDA 1KFKA 4CLMA 4FX7A 4NI3A 2EXOA 2Y7DA 4R7WA 2G0WA 1XD0A 3CYVA 1CW2A 4HHLA 2P50A 3HFTA 3TYCA 5IFTA 3KHJA 2I56A 1QPOA 4IIDA 3KBMA 1ICPA 3CT7A 5CAKA 3T0BA 1PV8A 1KTNA 3BG9A 3OYZA 4MLRA 4DZAA 4TTUA 1DXIA 2VD8A 3TDFA 4ZA0A 3LQLA 3H2OA 4WXZA 2NWSA 1NFBA 1V6YA 5DN1A 1Q2RA 1SO6A 1R85A 2NZLA 3I10A 1LRNA 5FJJA 3SJ3A 2P3EA 5I77A 2BHUA 3P3BA 4DIAA 2WQDA 5D37A 4S2BA 4ZE5A 4DJDD 4URIA 2GK1B 3CUHA 1ZP3A 2B81A 4W9TA 3B4UA 3V5CA 4M1RA 1E51A 4K38A 3ISIX 4HHPA 3ZSTA 3WH9A 3A4XA 4BKNA 1FWCC 2J74A 3W7MA 1XS2A 2PTWA 2JGYA 1Q13A 4H8NA 4Z2LA 4L4OA 4XV0A 1I1WA 2WKJA 4QG9A 3HPFA 3R8HA 4BF7A 3N1AA 1QR7A 2RJHA 3PAJA 2EF9A 1W9XA 4AB4A 1NAL1 1Y8BA 1UW9A 4LCQA 1ZPTA 4MKNA 1K4HA 3NXFA 3NOYA 4CQBA 2IKGA 1N8FA 3FJ6A 3LBOA 3MVTA 2HXTA 1QXLA 3BG3A 3QPYA 1ZLPA 2VOTA 2PDBA 2XN0A 1EL3A 4PTWA 3SDOA 3O9NA 5AYBA 4I7UA 4MB5A 2CC0A 3Q94A 3PJWA 3RX2A 1UWQA 1GORA 2H90A 3WLPA 2Y8VA 3HGOA 2G5WA 3V0UA 2P8BA 4O50A 4N9BA 4EXQA 4NAEA 3O7UA 1RSCA 3GTFA 4AEEA 1LLWA 1DJXA 4RZ5A 2OZ0A 3PN8A 5AHIA 4FLQA 2Y85A 1JDAA 4TVDA 3MDWA 2J8FA 1DHPA 3FA5A 4B5VA 4ZCWA 2G3IA 2CBJA 1B3YA 3GHRA 1JD7A 4IUGA 5FJRA 1VFFA 3O15A 3MP4A 3W82A 2EPLX 3A4AA 5F2GA 3BAWA 1ADSA 2B7OA 1EKOA 2QDDA 1EEXA 1HTIA 3SRKA 5I6SA 4E8DA 3TNOA 3B03A 1JNDA 2BTMA 4DJFC 2PTYA 3QZ6A 1ME7A 4UQ9A 1WV2A 3R10A 3AIRA 4UXDA 1JZ5A 1R3TA 2QUNA 1CXLA 1QPQA 2MANA 2OELA 3DKLA 2NT1A 2DZSA 3NPUA 2Z24A 2ACUA 1LL6A 1Q8AA 2YA1A 1SSGA 2VVNA 2O7QA 1F9CA 1VC4A 1HW6A 1W1TA 4L4LA 1NJJA 4EACA 3OP2A 3DG3A 2WMIB 4GQ0A 2ISWA 2VGBA 1UASA 1Z69A 1GVRA 1RV8A 1WBJA 3EDEA 1MFUA 5C9ZA 1BF6A 5H8MA 3UG8A 4I9TA 4ICNA 1HKIA 3WK1A 5CGTA 3TZNA 3WF4A 3AIUA 2GYIA 1OT2A 1TJ2A 4DWDA 1F3WA 2WHKA 4AW7A 3TR9A 7PTDA 1C9DA 3DCPA 1PIFA 3UY7A 2NLIA 4K3ZA 3DFYA 1RP8A 4BK9A 2JKPA 3W7RA 3POHA 4A8RA 5LNSA 3F2CA 4GGBA 4JTTA 1PDZA 3C6CA 2XVLA 3GW3A 1V77A 5XINA 3GTNA 2TAAA 2VFEA 2PDPA 1B9ZA 3W76A 3C8FA 1FHDA 1M65A 4NKCA 4M19A 3SQMA 1SO4A 4XZLX 2YXOA 3M46A 4B2DD 4KRTA 4DY1A 3HQ1A 3ARVA 3GU2A 3BTNA 1Q7MA 3GD6A 4B4HA 3AC0A 2CW6A 3ARSA 3E5PA 4U3CA 4M24A 4TUFA 1A5NC 3L4VA 2Y5SA 4HK7A 1CI1A 4KGJ