2XFRA

Crystal structure of barley beta-amylase at atomic resolution
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
487
structure length
487
Chain Sequence
VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-AMYLASE
total genus 191
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xfrA00
3W28A 1BGAA 1MYRA 4CGTA 2VUYA 3RJXA 2PC8A 4AY1A 3WF4A 1KR1A 4QDMA 5CZKA 2DGAA 1HP4A 4QLLA 3O2LA 5FL1A 4HPHA 2VRKA 3RPMA 4HA1A 4WLCA 2B31A 2EJ1A 4ZE5A 1NOUA 1UD8A 4HP5A 3NYDA 2OLHA 2E9MA 4AD5A 1QNOA 3BSGA 2J78A 3U7VA 4PMNA 3OA5A 1QNSA 3FAWA 1QHPA 4ZEPA 2XSAA 2O92A 2WW5A 1JDAA 2VJXA 2DSKA 2XWDA 3CMGA 2JF6A 1MW1A 5DMYA 4PTVA 2E8ZA 3WMCA 2WK2A 1B90A 1LG2A 4BQ2A 1X6LA 2WSPA 4M80A 1GJUA 4PSRA 1OWQA 1HJQA 1ODUA 1CYGA 3F5KA 2G3MA 1ZS2A 3OLEA 2WC7A 3TA9A 1VEPA 3GXIA 2J7CA 2WZHA 3AXIA 1UWQA 4PUEA 1E15A 1V3JA 1Z32X 3B9DA 1CENA 3AZTA 4HMCA 1FP9A 1KB3A 4FLSA 1BG4A 2PF0A 1EH9A 2W63A 1GVYA 1VAHA 4Q22A 1B30A 3FN9A 3EMZA 5FKYA 1CXKA 3WF0A 1U33A 1WKYA 2WMIB 3MUIA 5CG0A 4GZEA 5CGTA 1JNDA 3WFLA 2XTKA 4W7WA 1HVQA 1QI2A 1CBGA 2YDSA 2BXZA 5EBAA 2J4GA 4AZHA 1WB0A 1LLOA 2WMFA 3T0DA 2ZICA 2CIPA 1DHKA 5A2CA 5AC5A 3KE0A 3VINA 3VDCA 5A8NA 4DUWA 2WHMA 3PZIA 4MNKA 1DWGM 3MO4A 3K46A 1WP6A 3VUPA 3WKZA 1M04A 4UOZA 4JFSA 3N11A 4X0VA 2WLZA 2XM2A 3U57A 3ZJ7A 4UQDA 3WD2A 2W62A 1KGUA 4JFTA 3A4XA 3AYSA 2OSWA 3KL0A 1E43A 3OGSA 1MFVA 4H8HA 1K9EA 1LL7A 4UQAA 1GOWA 4PSPA 2A3EA 2GSJA 3L2LA 1BGGA 4D6EA 4CD4A 2BHZA 3GDBA 2OYLA 3OZPA 4ATDA 2VL4A 3SCPA 2WANA 3AYRA 3WEMA 1ZB5A 1NARA 3GXDA 1JNEA 3CZKA 4UQCA 1CNVA 2WMHA 4PCTA 4J3XA 4UFJA 2J74A 3VGEA 4GI9A 2NW0A 3KEHA 5A6SA 1PEZA 2BY3A 3GBEA 3SCUA 4IM4A 1GOIA 1EQCA 1FH8A 2J62A 5CSUA 4W5UA 2OWCA 3O9NA 5DF0A 1MXGA 5CSYA 3ARRA 1IV8A 4WKFA 3N12A 1BTCA 4PMXA 1V6WA 4AXNA 1JYNA 1EGZA 4P8WA 1B3WA 3GM8A 1Q6GA 5JBDA 2J47A 1V6YA 3AHXA 1Y7VA 1IT0A 2GUYA 4K68A 1J10A 5F7UA 3IAQA 1ZBWA 3WQVA 2D22A 4WF7A 3ZR6A 4U3CA 1GVIA 4C7DA 1LF1A 2J8FA 2O9RA 3ZT7A 3T2QA 3GXFA 1D2KA 2G3JA 3WN6A 3A6OA 2VOTA 3CPUA 5EMYA 4NF7A 1JZ6A 1ISZA 3RM9A 3ZSSA 2G3IA 1BSIA 4OUEA 4XB3A 1UWUA 1ITXA 2O9TA 4H7VA 1QW9A 1MQPA 1J12A 2ZX6A 2J77A 2WCSA 4GIAA 4OKDA 1EO7A 1JZ7A 4EAMA 4QAWA 2YA0A 4OBRA 4PTXA 2UY2A 2YBUA 3MMWA 3G6MA 4PBGA 3BAKA 1CGTA 2WCGA 1H41A 1Q4NX 4W89A 2BY0A 4Q7NA 2IXUA 1LJYA 3II1A 4ACYA 1K9TA 1UWRA 5AC4A 2QF8A 3PZUA 3VIMA 1JZ4A 1HL9A 1BQCA 1OD8A 4XUYA 4Y7EA 5DEZA 4B9YA 4CVUA 1PZ3A 2YL8A 2X0HA 3WIJA 1C8QA 4C7FA 4W88A 3AMGA 2GJPA 1W3HA 4B3LA 1VENA 4JHZA 1FHDA 4B9ZA 3NUKA 3MKKA 2XVLA 3SCQA 4KMQA 3AXXA 5A2BA 1H3GA 2BS9A 2G8ZA 1UKSA 2E40A 2F2HA 3AIRA 3FHAA 2YL9A 1CWYA 1E4IA 4AWEA 2IUZA 4QCFA 4M81A 4HZ6A 1GQLA 2V3DA 2WMGA 2E8YA 2GJXA 3ECQA 1WDPA 3CHCA 4JFVA 4U33A 5A6AA 3S6TA 3L4ZA 1O6IA 2ZUTA 2GDVA 1D3CA 1NM9A 3QHOA 3W4RA 1NOWA 2VVSA 3AXHA 2WCAA 3N15A 5DO8A 1EQPA 4W93A 3W24A 3MUY1 5A3HA 3WBEA 3PTMA 1VBUA 2E3ZA 1PPIA 2OSYA 1EA9C 1OGSA 3QHNA 4DM1A 4QLJA 2WYSA 1RH9A 1EIBA 2OYMA 1V6VA 2MANA 4A3YA 4HMEA 1E0XA 3AHVA 1B9ZA 4Z2GA 2CKRA 1AQMA 1JXKA 3DYOA 1GOMA 1UZ1A 1VF8A 1PAMA 3FY1A 4ZE4A 1W1VA 5EFDA 1XC6A 4W8BA 2JE8A 3A3HA 5BCAA 4FLRA 4CN6A 2VT0A 2OWXA 1GOKA 1TR1A 3GH7A 5M17A 3A47A 5GNXA 3AIVA 2QMJA 2CPUA 1H09A 3BAYA 1E4LA 1PIGA 1W2PA 1UKQA 4FK9A 2V5DA 5GPRA 3AZSA 2PWGA 3WSUA 1XCWA 4BS0A 2VX7A 5D9NA 1E5JA 1VJZA 5I3DA 4WKHA 5DT7A 2YKKA 2ZUUA 5D8WA 1SR0A 2WVVA 2J25A 1V6UA 4RE4A 3AS1A 3BGAA 2XUCA 1MVYA 4P8UA 4AZGA 2O9OA 1B3ZA 1VEMA 4S3KA 1OD0A 2W61A 3ZSTA 2WNWA 2ESCA 1C8YA 1KXQA 1TMQA 1EXPA 4IPNB 4AD2A 3PZTA 4Z2HA 4PCSA 3RIKA 2VZTA 1JI2A 1G5AA 2DT2A 3NSNA 2J75A 2YL6A 2DEPA 1C92A 2J7HA 1CGYA 3K8KA 3SUWA 1W9XA 1UH3A 1US2A 3W29A 4D6IA 1LL6A 2WB5A 4BA0A 4D1JA 4QFUA 1R85A 1B0IA 1VFMA 1DWFM 4QLKA 3NDYA 5A8OA 1E71M 1V08A 2FGZA 4JKKA 3CZ8A 3AI0A 3AMCA 4A4AA 1OINA 2G4FA 2ZUNA 4GI8A 1I1WA 2YDRA 5E09A 2UY4A 1J0YA 3FNDA 4MB4A 2XJ7A 5TD4A 4Z2LA 2J7DA 1MW0A 4JL2A 3KL5A 1BYDA 1QHZA 3GH5A 4NSBA 4W7UA 3MV01 2FHCA 1DEDA 4M56A 3CTTA 4JHOA 4OJYA 3THCA 3AISA 2J8GA 3UG4A 4D6CA 2YDQA 5A8MA 1BPLB 3AHZA 4F8XA 1BG9A 1D7FA 3AS2A 3L4UA 4XZBA 3AIUA 1E0WA 1SMDA 3DHPA 2WZEA 1QI4A 1GPFA 1BFNA 4JIEA 3MSDA 5A8PA 5HNNA 1FP8A 4PTWA 4GO8A 2VCCA 5LYRA 4M8UA 1TCMA 1CLVA 4PMOA 6CGTA 1JYWA 4V2XA 1GJWA 4AZ7A 1HKKA 1E3XA 5D9OA 3SCWA 3VD3A 5ABHA 1JZ5A 3FAXA 3POHA 6TAAA 3A4AA 4HMDA 4MAVA 2EPMX 1BYBA 3N9KA 2WBGA 2OSXA 5D4YA 1DTUA 2WBKA 2UY5A 1P6WA 2QPUA 1UYQA 1QNPA 3WQ4A 1QI5A 2VURA 2CHNA 3CGTA 1NWRA 2ZX5A 3WQ6A 3WQ5A 4GZIA 3SCOA 3OLDA 3QOKA 3E1F1 4HTYA 1W1PA 2QLYA 1C8XA 3MUZ1 1WZLA 1ZBVA 2WVSA 5BXRA 1WCGA 1E72M 2ZIDA 1Q6CA 4E8CA 3AOFA 1JYVA 5CGMA 3ZJ6A 3ARSA 3NDZA 1HKMA 3K8LA 2CESA 1NQ6A 1OSEA 3OIHA 1E5NA 3I3DA 2CEQA 3PZQA 3F4VA 2QHAA 2PBOA 1W3JA 3GNOA 2FH6A 3LPPA 3OB8A 4MTVA 3ARUA 3M7SA 4GI6A 3BCFA 1TZ7A 4PUDA 1K9DA 4JL1A 2X8RA 8A3HA 4H8UA 3VDHA 3K4DA 1C7SA 5KZ6A 1JI1A 2W91A 4JKLA 4PMUA 3WNLA 3QHMA 1KR0A 3AIWA 1FFQA 2F61A 2WHJA 1HJSA 2V3GA 3UR8A 4HA4A 4MB1A 1JF5A 2EO7A 2WWDA 1JGIA 1S46A 1BVNP 1R87A 3PBGA 1U30A 5GNYA 4ATWA 2WC3A 1GNXA 2PWDA 3PZ9A 4MB5A 1XHGA 1K9FA 3B9EA 3WENA 4JCMA 1KQZA 4CKQA 3WNOA 1PBGA 5A6KA 1G94A 2X1IA 3VNYA 2YJQA 5HXMA 1HL8A 4UFLA 4CCEA 3VKKA 1WAWA 4UQ9A 1OM0A 4ML4A 3N1AA 1ECEA 2VC9A 3W26A 4MNLA 2PBGA 1MW3A 1UG6A 3EDKA 5JUVA 3GNRA 1C93A 1BLIA 1E6ZA 2ZE0A 3DYMA 1CLXA 1KGXA 1ZJAA 5C70A 3O6AA 3FHQA 3BLKA 1E6PA 4MAZA 1TFVA 3WFZA 2X05A 3WF2A 2EQDA 1QI3A 1CIUA 4AIUA 3AQUA 3OZOA 3CZJA 4P7RA 5A69A 3TP4A 4Z2KA 1XSKA 1ISXA 1MFUA 2CBVA 4AZBA 2FHFA 3PZGA 2FGLA 4H41A 1KWGA 1JG9A 4HOZA 3SUVA 1UD3A 1UD6A 3NIYA 2WVVB 5FD0A 5A6LA 1QI0A 3T2PA 3NJ3A 5BRQA 3VM5A 3GH4A 3PTQA 5ECUA 3CZLA 1JZ8A 2Y5EA 3LMYA 5I5RA 4ZXOA 2VCBA 4D6DA 2YA2A 3ARZA 1KXTA 3HU7A 3ARTA 3A4WA 2YBTA 2IXVA 1J01A 4E2OA 1WPCA 1GQJA 1HIZA 5CJ5A 5HOSA 4L4PA 4LGXA 4DWSC 1PIFA 4DUVA 3VDBA 3CZGA 2OWWA 4D6HA 1EDGA 2CBUA 2CITA 3ALGA 4HZ8A 1M03A 2D23A 5EB8A 4WKAA 5BROA 2GDUA 4MNMA 4QP0A 2WC4A 1VEOA 3FW6A 4U3AA 5I23A 2EPKX 5E9AA 2ZX9A 2X2YA 3DC0A 1V02E 4ACZA 2VVNA 3EDDA 4MNJA 1VFOA 1NH6A 1UA3A 4YHGA 2VQUA 3SUTA 8CGTA 3UEQA 2DSZA 1C90A 4TUFA 3PHAA 2PWFA 2WPGA 4PYSA 4LYQA 1XCXA 3VIGA 3WEOA 4WSJA 4J3VA 1GORA 2WAGA 2J79A 4D71A 1L0PA 7TAAA 4KH2A 3W27A 3UG3A 3WH7A 2XG9A 3POCA 1UD2A 3K8MA 4D6GA 4ZENA 4CU6A 3LPGA 1U2YA 3D3AA 3TOPA 3VIHA 3OG2A 3VD5A 3K1DA 1GHRA 5M03A 3KL3A 4UNIA 1UWTA 2YOCA 3VU2A 1J0ZA 3VILA 2PWEA 2RGMA 1HVXA 3UCQA 4HU8A 1NWSA 1PJ9A 2J7GA 2NT1A 2VR4A 3CUGA 1TA3B 3VMOA 1AQ0A 4PMRA 1CXFA 2VR5A 3OGRA 4NRSA 4BF7A 4W85A 2EEXA 1ZL1A 4PMDA 2GFTA 1GONA 1V0KA 2J7BA 1DP0A 2DIJA 4AD3A 2DPEA 3NSXA 3NCOA 4HZ7A 3UETA 3ZMRA 2BY2A 3OLIA 4U2ZA 4IPLA 2AAAA 3ARXA 5DT5A 3VGHA 4PN2A 2RGLA 4X9YA 2ZXQA 1PX4A 3CUIA 5AYIA 3CBWA 3BXWA 3PZVA 4OIFA 2WWCA 1GOOA 2ZUSA 3HJEA 1PX8A 1MWOA 1ESWA 3CUFA 4GQRA 2BNJA 1XGZA 1R7AA 4P7LA 3PTKA 3VGFA 1WDSA 2WM0A 2ZXBA 4WK9A 1QNRA 1EHNA 2CNCA 4E8DA 1JF6A 2GK1A 3VD9A 4CU8A 3BSHA 4GZJA 1JIBA 3ZOAA 2WHKA 4MDOA 9CGTA 2JEPA 3WH8A 1J18A 1WDRA 3AS3A 3EMCA 1UR0A 1R86A 4W5ZA 1J9YA 5A8QA 2BHYA 3IAPA 1E6RA 4W8AA 2GK1B 3IJ9A 2DT3A 2E0PA 4V27A 2JEQA 3UESA 3BCDA 1E3ZA 1H4PA 2VCAA 3PZNA 1G0CA 4BCEA 3AICA 4J28A 4DWSA 3CHEA 1AQHA 1W9UA 3ZQ9A 4NRRA 5AYBA 4AIOA 2G41A 3WH6A 2BY1A 4P8VA 3IANA 3AMLA 4H8VA 4JZ5A 1TG7A 1W1TA 4UFKA 3WF3A 4U31A 2YLLA 2G3NA 3RO8A 1XRVA 1J0IA 3WUGA 3ZT6A 1HN1A 1OT1A 2HISA 2V3FA 4GINA 3W37A 1H0GA 2BVTA 1EOKA 1RP8A 3THDA 2DT0A 1TE1A 1V0NA 4HOXA 3MSGA 2DIEA 3QGVA 4MADA 5D9MA 1NP0A 2Y8VA 3MMUA 3M07A 3RM4A 2D1ZA 1I75A 1GUVA 5A6BA 1OT2A 1RP9A 3I3EA 2ZOXA 2A3CA 4XZWA 4BQ3A 3VOCA 3AROA 4DUXA 4GPNA 3QR3A 4R5EA 3QOMA 1MXDA 4AMCA 5HPOA 4AZIA 1EHAA 3N13A 5ABEA 4CUCA 2GJXB 3EDFA 3IK2A 2WKLA 5BXTA 2CKSA 1RD6A 2C7FA 2D20A 1R8LA 1CGVA 2XWEA 3BAJA 2VNCA 1WZAA 3SEPA 5E6YA 5BWFA 5KEZA 3WL1A 4LX4A 1XSJA 1ZBCA 2OYKA 1DWHM 4AISA 1HX0A 4HA3A 3ZJKA 4MPKA 4GQQA 2YLAA 4JAWA 5CXPA 5E0CA 3T0BA 1NOFA 3IJ8A 1XD0A 7A3HA 4TTUA 4CN4A 1SMAA 2NT0A 3T08A 3GXMA 1CXIA 1H5VA 4J3SA 2VI0A 2FDMA 2CCRA 2TAAA 4W87A 4CCCA 4RE3A 1JFHA 4AYSA 2W92A 3W81A 5CPQA 1UH2A 1CXHA 1X1NA 4CU7A 2NSXA 1HKIA 1TVNA 1V6XA 3VPLA 2JIWA 1ISVA 3WH5A 3VD4A 1W3LA 1HXJA 1GHSA 5A2AA 4P8XA 2PB1A 4EANA 3DECA 5A6JA 4GO9A 2DH3A 1W3KA 4PMZA 3VX1A 5LA0A 4KWUA 3G6LA 4RE2A 3ZR5A 5A95A 5I79A 1UD5A 4P7OA 1US3A 4Z2JA 1FOBA 3B9AA 2Y8KA 2AMGA 1EDQA 2WSKA 1R7OA 1A47A 1UA7A 4V28A 3VGGA 1KXHA 2W66A 6A3HA 3WF1A 1WZMA 4LQ1A 3MMDA 4FF5A 1ISYA 5CLTA 1MQRA 4BQ5A 5I2UA 4NZCA 4FLOA 2Y24A 4B15A 4UOJA 1UR4A 4MDPA 1W32A 2XVKA 3VIPA 4KGJA 1VJSA 5ABFB 3AFBA 1LWJA 3AIQA 3WH9A 4J7RA 2VX6A 4TOQA 2VRJA 4LPCA 1N82A 1QW8A 2DSUA 2O9PA 1V3HA 1UZ4A 2XM1A 3ARVA 1IZKA 2CETA 4N42A 1GQKA 1LWHA 5A94A 1UR1A 1KFWA 1OB0A 1XH0A 1H0IA 3WQWA 3WNKA 3WMBA 4UFHA 3W25A 4UFIA 5CPTA 4XV0A 5A6BD 1BYCA 1VRXA 4W86A 4M82A 2Z1SA 3WNMA 5LA1A 1NWUA 3RMEA 3W6MA 5I77A 1FHLA 4P7QA 4XX6A 3N18A 4IISA 1TUXA 1ODZA 5D8ZA 1FA2A 2CBJA 1WNOA 3RM8A 4D6JA 4DWSB 4HPGA 3F5LA 1JAKA 1KWKA 3TTQA 4PRWA 1CXEA 2ZUWA 2CXGA 2ZUMA 1E4NA 2A3AA 4ZFMA 4ATLA 3EBVA 3AMDA 3RDKA 1ZU8A 2WLYA 1HF6A 4GXPA 4AW7A 2DSVA 1HT6A 3L4YA 2GVYA 1F4HA 4UQBA 2WVUA 3BAIA 3GYCA 2VX4A 1GZJA 3WD4A 3AHTA 3WD3A 3T09A 1JYXA 2D0HA 4URIA 3EDJA 4CCDA 1H49A 3MANA 1JAEA 1C3FA 3M6DA 4H04A 1V0MA 4UQEA 1BVZA 1PZ2A 1XD1A 5E6ZA 4X0NA 1JD9A 4M24A 5FOOA 1UR9A 4BZYA 1FFRA 2CHOA 1G9HA 4EKJA 1SFSA 4UZSA 1V02A 2VTFA 4PTMA 3RCNA 3WELA 1B2YA 2EPNA 3KZSA 1E55A 3DHUA 4DM2A 4AEFA 2WVTA 4UTFA 1FH7A 1TA3A 2PI6A 5D9PA 3PZMA 3IJ7A 1E9LA 5IHRA 4WJXA 5M5DA 2PWHA 2E9BA 1JD7A 2Q8XA 5JBEA 3TONA 1HKJA 2QV4A 3VIFA 2XPKA 1VIWA 4M1RA 1YQ2A 2BXYA 1IZJA 3VGDA 4AZCB 4HU0A 1UQZA 1TVPA 4OOUA 3VIKA 2V3EA 3EMQA 2ZWYA 5E70A 1UQYA 4CD5A 4P7NA 1A3HA 3AIEA 2JALA 3WQ8A 1QBAA 1M53A 1BF2A 1H2JA 1UKPA 4F66A 5C71A 1XH2A 3J7HA 1WO2A 1J0KA 2XGBA 5I6SA 2BV9A 3AHYA 1E6QM 3BMVA 3TTOA 1J0HA 3EDEA 2CYGA 4JFUA 3GBDA 5BRPA 2X09A 3WL0A 4HOWA 1EDTA 3SURA 3SCNA 4L4OA 5A1AA 1SYTA 4PMQA 2V38A 3PN8A 1GOQA 1KBKA 1DWAM 5IFTA 2VRQA 2WKGA 3VDAA 2EBNA 1GCYA 4LXFA 1OGBA 5HDRA 1ITCA 4B16A 2D3LA 3SUUA 3W53A 1YHTA 4FLQA 3D5HA 3CLWA 1RPKA 1W2VA 4J3TA 1E1EA 3VM7A 4MJ2A 1CECA 2WMKA 4F9DA 1F4AA 4JKMA 2VO5A 1VB9A 1VFUA 2XIBA 2HVMA 1UKTA 5BXSA 1AMYA 2D0FA 1B31A 1QBBA 1J0JA 3MS8A 3N04A 3BAXA 3VMPA 1KCKA 3HMCA 5BXPA 1B3XA 5I24A 1K6AA 3VX0A 4UR9A 3UG5A 1W9PA 5GNZA 2Y4SA 4RL3A 3CMJA 3ARWA 3EYPA 3WUFA 3N17A 4MJ4A 1XYZA 1C7TA 1W91A 2VMFA 3CHFA 2C8NA 3VO0A 2XGIA 1CPUA 1UUQA 4U5IA 3I3BA 1Q6EA 1O7AA 5EFFA 5CLWA 1B3YA 3L4VA 1BAGA 3RJYA 3WD1A 4H2CA 1C91A 2Y2WA 3M46A 2XSBA 2E4TA 3ZT5A 5JBFA 3CO4A 2VZVA 2AOSA 1BYAA 2QMKA 4CN1A 1HNYA 2J7FA 5AY7A 1GW1A 4CD8A 4YN5A 1LL4A 1E56A 2WHLA 2C0HA 2EPLX 1JZ2A 4MB3A 1CEOA 4U5KA 3SIMA 1NP2A 1XH1A 2VQTA 4J27A 4TXEA 1I1XA 1E6NA 3WDQA 4D72A 1CGXA 4D6FA 4TTGA 5HPCA 5M3WA 1JZ3A 4AD1A 3WNNA 3RILA 2UWFA 5DFAA 3GZAA 2WZIA 1MQQA 2XHYA 3SCTA 1JDDA 1J11A 2FHBA 5ABFA 4TVUA 5IXEA 1AVAA 3L2MA 2D2OA 1E70M 4M29A 3LPOA 1JL8A 2CERA 3VIJA 4IUGA 3ZO9A 1X6NA 2WMIA 3W82A 3L4XA 5IDIA 3TTYA 1W1YA 1KQYA 1V3IA 2V5CA 4YHEA 5I0DA 2A3BA 2DH2A 3DYPA 2D3NA 2EPOA 3WNPA 5IHSA 1UOKA 3CUJA 3UR7A 1UWSA 3VD7A 3CH9A 3SCVA 1B3VA 1W9VA 3MUAA 4YPJA 5BYWA 3WEZA 1UH4A 4N0RA 3OGVA 2ZXDA 1KXVA 1OIMA 1DWJM 2WXDM 3CUHA 1UWIA 2Z1KA 4LYPA 3AJ7A 2DT1A 1G1YA 1Q6DA 1OCQA 3HN3A 3MV11 2XYLA 3WD0A 1E4MM 4UZUA 4UCFA 3VGBA 1E0VA 2XFYA 1E6XM 1W9DM 1XSIA 3U5YA 2JFEX 3BLPX 2UY3A 3OLGA 4U2YA 1V3KA 1JFXA 1M01A 1W9BM 5ABGA 3VIOA 2JF7A 2FH8A 4AC1X 4ACZB 5A6MA 4KRUA 3W38A 2VZOA 2DDXA 4KRTA 3VTRA 1HP5A 2EXOA 4AD4A 5JIWA 1VBRA 3VNZA 1UR2A 4WSKA 4UFMA 4A3HA 5LA2A 2YL5A 4W84A 1OGGA 2ZWZA 1E73M 1E6SM 1CGWA 1V3LA 1V3MA 1EOMA 4F9JA 4AZ6A 1BHGA 3SCRA 2DSWA 3ZIZA 3LPFA 2WMJA 1WDQA 2XVNA 1ZBKA 2BFGA 1HJUA 3WUBA 2DQXA 1M7XA 3T2OA 2XFRA 2BHUA 1H1NA 4S3JA 1ISWA 1UKOA 4C7GA 1CDGA 2BVYA 4OOZA 1EO5A 4R27A 4EE9A 1XV8A 3TTSA 3CZEA 4NI3A 3WBAA 3MU7A 1MW2A 1WE5A 2E9LA 3WDJA 3GTNA 5CQ1A 1JDCA 4PEEA 4CD7A 1OBAA 4CVWA 4AD0A 4FMVA 1NWTA 2QPSA 3W6LA 1V0LA 4D1IA 1KGWA 3AIBA 1HJVA 1QHOA 4CD6A 4AIEA 3B8SA 1OIFA 1HJXA 3CIVA 3VVGA 2W4XA 4OZOA 2J7EA 4ZXLA 2W67A 1CZ1A 2VX5A 3ARQA 3BH4A 5I78A 2JIEA 1CXLA 1WZKA 3U5UA 3GNPA 2ZX7A 4GKLA 4J3WA 3K4AA 3UERA 4EK7A 3WMSA 3AMKA 3S2CA 1H11A 3W0KA 1LQ0A 5GQBA 1QPKA 3FXYA 4TVCA 3WDPP 4TVDA 4AZCA 3VMNA 2XVGA 4JCLA 3JUGA 2D0GA 3L4TA 2YIHA 2W5FA 1HJWA 1E40A 5FIPA 3T0AA 1LG1A 3ARYA 4AEEA 2XVPA 4JFWA 1CGUA 4PMVA 3ALFA 1KCLA 3ZJ8A 2BVDA 4KGLA 4J3UA 1FH9A 2D24A 4TX6A 1UR8A 2XFFA 3WDIA 2CBIA 3BMWA 3WDHA 4TX8A 1UD4A 4QCEA 1QVBA 1ZJBA 4AZ5A 1B1YA 4BQ4A 4OBSA 1L8NA 3PZOA 3VIIA 3SUSA 2ZX8A 4E4PA 4PMYA 5CPSA 3U7BA 1QOXA 3WUEA 3APGA 2ZXAA 2X0YA 3AZRA 4W8LA 3SCSA 5JIPA 1UHVA 1G01A 1V03A 3WY1A 1E1FA 5IFPA 2XIIA 4LYRA 2ZUVA 3ZM8A 4F79A 3BAWA 1GQIA 3L4WA 2GJRA 4W7VA 1Q6FA 2A3HA 5FL0A 1KBBA 4WIWA 4UOQA 3BC9A 1VFFA 4Z2IA 2VZSA 3KWXA 1PX3A 2F8QA 4DWSD 3AS0A 1DWIM 1QNQA 2YA1A 3CHDA 5C8BB 1JXJA 2VZUA 1CTNA 4B3KA 1XYFA 5E0FA 3ARPA 3WDRA 5FCZA 7CGTA 3NSMA 5HBFA 3OBAA 3F5JA
chains in the Genus database with same CATH superfamily
3BLFA 1PSCA 1QOPA 3BG5A 1EJRC 2VUYA 3L9CA 4AY1A 5EY5A 5CZKA 4QLLA 1UC4A 4GISA 4G7EB 4Q8VA 5FL1A 1M7PA 4FOJA 4HPHA 4HA1A 4WLCA 1NOUA 4HP5A 2E9MA 2H3DA 2Y88A 2J78A 1JPMA 1ONWA 3VE7A 3QPZA 1VLIA 1MNZA 4DZ5A 1O12A 3WJZA 3FAWA 1W5QA 1QHPA 3DZ1A 4ZEPA 4U28A 1O95A 2WNQA 2WW5A 3HB9A 3LB0A 1RCXB 3CMGA 2JF6A 8TIMA 1Q7ZA 3W2MA 3CT2A 5AC7A 4XTIA 2E8ZA 3ANVA 3QMTA 4M80A 2H9AB 3F5KA 2WC7A 3L65A 1VEPA 3TA9A 4Z42C 3TX9A 4HGXA 3K30A 3AXIA 2HMCA 1E15A 1V3JA 1Z32X 3KRZA 3PFMA 3AZTA 4HMCA 3NFUA 4I9JA 3E0LA 4NZJA 2PF0A 1B30A 3EMZA 2Q01A 1CXKA 1U33A 4IQDA 4S3CA 2WMIB 2NQHA 3MUIA 3IVTA 4I5UA 4UMBA 1GEHA 3BE7A 1JNDA 1YTKA 4JQ2A 4RZ6A 4IGMA 4W7WA 1HVQA 1UIPA 4B2DD 2PAJA 3WJWA 4CQ8A 5EBAA 4AUBA 2J4GA 3HO8A 3EB2A 1BQGA 2WMFA 4KEUA 2V82A 1DHKA 4PBFA 4AHOA 5A2CA 1A5MC 1XBYA 5F4SA 3IS4A 1UPMB 3P62A 4KEZA 2B4GA 3MO4A 4AVNA 4X0VA 1EGVA 2GGEA 3ZJ7A 3MC5A 4UQDA 3WD2A 1F2JA 1KGUA 1XLGA 1NELA 1SUXA 3AYSA 3KL0A 1GOWA 4PSPA 2A3EA 4FB7A 4CD4A 4ATDA 4JTIA 3BJFA 4YVXA 3SCPA 2E7FA 3AYRA 3V4BA 1M7OA 1LORA 4WJEA 3GXDA 3RX4A 1BVWA 4UQCA 3GXPA 4UFJA 2J74A 4C6KA 2PZ0A 3VGEA 4DJFC 2B7OA 2Y70A 1PEZA 3GBEA 4JIHA 2QCCA 1TV8A 4IM4A 2IKGA 3WLJA 2QEZA 2J62A 2QW5A 3V1PA 3O9NA 4QJ4B 1EP2A 1MXGA 1EBGA 1GG1A 3ARRA 4YTTA 1R2RA 5D2YA 3N12A 1BTCA 1V6WA 2GGIA 4U4MA 1JYNA 1EGZA 4P8WA 1B3WA 2PGWA 5JBDA 1SO3A 4GNKB 2YBVA 1Y7VA 1IT0A 3COTA 4XD6A 5F7UA 2VEIA 3AO0A 4L4MA 1JGMA 1U83A 3LENA 3ZR6A 3TIMA 4U3CA 3NXLA 3TW6A 3GXFA 1OK6A 3CV7A 2VYOA 2VOTA 3I4KA 3BOFA 2G3IA 1BSIA 4OUEA 1JPIA 1UWUA 2PDBA 1YDYA 2QJJA 2XDFA 1MQPA 3HPZA 2ZX6A 4OKDA 3S5NA 4QAWA 2YA0A 2DZWA 1LRNA 3S9ZA 3V35A 3PPGA 1N55A 2XN1A 6ENLA 2WCGA 3NL2A 4Q7NA 4G9PA 3SJ3A 2QJGA 3W3OA 3WLQA 2CW6A 2QF8A 3VIMA 1BEUA 3GVWA 1BQCA 3A64A 4Y7EA 1Q7MA 3MYPA 3WIJA 1XLCA 3GDKA 4TR9A 1WOAA 3AMGA 2X42A 2GZXA 4G6CA 4JHZA 4A22A 3GDRA 1FHDA 3FDKA 4NNCA 2BS9A 4QS6A 2CLEA 1UKSA 2F2HA 1K77A 2F6XA 5JVLA 1K8XA 3TSDA 4O1FA 2W9MA 3LOTA 4LRTA 4Z1AA 4WXYA 1GQLA 2V3DA 2E8YA 1SM9A 1LBMA 1MEHA 3CHCA 2OZ3A 4F4RA 2H6RA 4U33A 1O5XA 1O6IA 3DFNA 2GDVA 3MHUA 4H6RA 3R8RA 1D3CA 3TW9A 1GKPA 3TWAA 4L6HA 1ONEA 2EPHA 4IG2B 4OTKA 3PTMA 5D03A 1PPIA 3PAJA 4DLMA 1OGSA 1S3TC 4NXSA 4DM1A 3KLKA 1N7KA 3OZMA 4BY3A 3IJIA 5EBUA 2CKRA 1AQMA 3E0WA 1UZ1A 2ABAA 1DJYA 1YEYA 1HGWA 3B05A 3GR7A 5I3IA 3UJFA 1A0CA 4Y8EA 1IEQA 4CN6A 1GOKA 1RSCA 3P8IA 3ITTA 3USBA 3V0SA 1XGEA 2Z24A 2QMJA 1AH0A 4FP1A 2GWGA 2EKGA 4GJIA 3SN0A 1J93A 3KXQA 3AZSA 2BOFX 3EWYA 1E5JA 2VEMA 4Y9MA 1PTGA 4JTEA 2WVVA 3TQPA 4RE4A 4DJEA 3AS1A 2QUNA 4RDWA 2O9OA 1VEMA 1YYAA 2OFJA 2WNWA 4JN7A 2ABBA 1TMQA 3U4FA 3UXAA 4BI7A 4CNPA 4JQ3A 2YR1A 3LD5A 4DY1A 3EZ4A 4PCSA 1KM5A 2J75A 1OX5A 2YL6A 2PLCA 1C92A 1KA9F 3MDUA 4QISA 1CGYA 3FGCA 4QGCA 2GJNA 1XF0A 2O0TA 1ICQA 4NNBA 2NQLA 3CK5A 3GS6A 4Q4PA 4OT7A 4D1JA 3A3WA 3UJRA 2GVJA 1VFMA 4QLKA 5A8OA 5G1MA 1B9BA 1E71M 1GPWA 3RRXA 4PB4A 3QPYA 4A4AA 2FVLA 1OINA 2PD5A 4JIQA 1XG4A 4IIGA 3W23A 1U1UA 1JCXA 1POKA 4CCZA 2XJ7A 4AX7A 4Z2LA 1CX9A 3KL5A 1BYDA 1GYLA 3GH5A 3EEZA 3P81A 4NSBA 5CAHA 3QW4B 1R3TA 2W3ZA 4KWSA 4JHOA 4NNAA 3AXKA 3AISA 4TIMA 3UG4A 4D6CA 3W6YA 5JU6A 1D7FA 3L4UA 4H9YA 1A4MA 1VCVA 1BD0A 1E0WA 1SMDA 1QU4A 4FNRA 5HNNA 4PTWA 4GO8A 5LYRA 2E6FA 3EKLA 3VXGA 4JTGA 1FWBC 3SQMA 5AYXA 4V2XA 4ML9A 3V7PA 3UWYA 1IEVA 4J4KA 4HNLA 1LYXA 3G22A 5D9OA 4MLRA 3VD3A 4D8ZA 2PDYA 2PTYA 3FAXA 6TAAA 1Q85A 3DHFA 3N9KA 5D30A 1Y5VA 4GYJA 3PJWA 2QPUA 1FXPA 1QI5A 3TN5A 3CGTA 3GNDA 1NWRA 1A3WA 3GD6A 4BWLC 1XLFA 2O56A 1W1PA 4DZHA 2QLYA 1C8XA 3LMZA 2HJPA 2A5HA 1XLIA 3EEGA 1ZBVA 3PR2A 4E8CA 4KKXA 3NDZA 1HKMA 1JDFA 1XLKA 3PAOA 2CLPA 3GNXA 1GVEA 2CEQA 4IPJA 2XINA 4LUSA 3LRMA 2TPSA 4GXWA 4GIYA 3W1TA 3QLDA 3VDHA 1C7SA 3URNA 1JI1A 2W91A 1EGMA 3GVVA 2ACRA 3AIWA 1FFQA 4ALDA 2F61A 4DO6A 2I14A 3B8VA 2X7WA 4Z1YA 3TWBA 2EO7A 3ANYA 2FFCA 3L7RA 1P0EA 3PBGA 2VGFA 4K6AA 4AIBA 1Q6QA 1XHGA 4MB5A 1XCFA 2V2HA 3GO2A 4YU1A 4CKQA 3WNOA 5A6KA 1ZZMA 3R43A 2V9DA 4UFLA 1Y8BA 5LGXA 2DUZA 4LALA 4A35A 1XLEA 4O0KA 4U10A 3T44A 1MDRA 1UG6A 3EDKA 1C93A 4O1CA 1GEQA 3DYMA 3M41A 4KESA 1DORA 3RX2A 1FTXA 5C70A 3GFYA 5FESA 3O6AA 4GE8A 4I7UA 3BLKA 2C79A 5BU6A 2X05A 2EKCA 3WF2A 2E1DA 2FVKA 2AQWA 4WOQA 4P7RA 1XSKA 3W7PA 2XZ7A 3EXTA 4GUFA 1YTDA 3W7JA 3G1HA 3VOGA 1AH3A 1KWGA 3W72A 1FY6A 1UD3A 5FD0A 1M68A 5A6LA 3T8QA 2FZ9A 3NJ3A 1ZY9A 3VM5A 3MP3A 3DG3A 3MUXA 4JY8A 4O4VA 4JX5A 5I5RA 3GNNA 7ENLA 4O11A 4XQ6A 4X61A 5AECA 2Y85A 3ITOA 4YIWA 3NQ8A 3S5YA 1HIZA 4LGXA 3EOUA 4JTAA 2WSQA 4XAZA 4DUVA 1PE1A 2OZ0A 2XZ9A 3B06A 3PB0A 1ZLPA 1HTIA 3BOXA 3UT0A 4HZ8A 3FX4A 4WKAA 5LNWA 2GDUA 4MNMA 3NYZA 4PB3A 4UTJA 3KBVA 4LAZA 4CNOA 4YS1A 4F2BA 1VFSA 4GVHA 2Z0IA 2X2YA 1FVPA 1V02E 1WBJA 4ACZA 4ORMA 1G67A 4MNJA 1NH6A 4IQEA 1OHLA 3L66A 3M0XA 3UEQA 2V2CA 2VGIA 2QV5A 1VS1A 3IIVA 4J3VA 4D8LA 2J79A 4D71A 2MUCA 1K8ZA 7TAAA 3UG3A 1KKOA 5TBOA 4CQCA 1UD2A 2QJIA 4D6GA 2P53A 3MTWA 3UZJA 1TIMA 2RJGA 1U2YA 3D3AA 3IV8A 3VD5A 2PGFA 1J2BA 1UWTA 2NV1A 4EXQA 3GX9A 3B04A 1DJIA 1NWSA 4BI5A 2NT1A 1TA3B 4Q4SA 4Q8PA 2VEKA 1CXFA 4NRSA 3DFHA 3CC1A 2EEXA 3CO8A 1ZL1A 3I7QA 2FMOA 3C3NA 4JYDA 5FSEC 4FEZA 2DPEA 4OQVA 4UIOA 1XKJA 3BOLA 4HZ7A 4OFCA 1JRBA 3UXLA 4U2ZA 2AAAA 1VD6A 5DT5A 4TU1A 4H6QA 4QQ3A 1VC4A 2HQAA 3DG6A 4L9YA 5IRPA 3MJMA 1R3SA 1LLWA 1DYSA 4G1NA 3CBWA 1ADOA 3BXWA 3PZVA 3FJLA 1YE6A 1OFEA 2WWCA 1GOOA 3BW2A 4HYVA 3HJEA 1ESWA 3CUFA 4HK6A 2BNJA 4O18A 2G0WA 4LV4A 2Y0FA 4AH7A 1RR2A 2ZXBA 5AYZA 3Q2DA 5J5RA 1HG3A 1QNRA 4HJFA 2OU4A 4Z0SA 3VD9A 3N9RA 1JIBA 3ZOAA 4HSHA 4MDOA 3HG5A 3LLFA 2X0SA 4LVAA 3B8DA 4XD3A 3A4JA 1R86A 4W5ZA 4JTHA 1J9YA 2VDHA 3IAPA 3PVFA 4FPSA 1E6RA 4W8AA 2GK1B 3IJ9A 2E0PA 2JEQA 3UCCA 3PZNA 1FWIC 1R46A 4DWSA 3GUGA 2NWSA 2INEA 3B0UX 4AIOA 1B5TA 4NG3A 4ROPA 5HMFA 4HCDA 3IANA 1R3VA 4RNIA 3W2NA 3H2EA 4UFKA 3WF3A 2YLLA 3RO8A 1KBLA 4JDYA 3LZ5A 4ADSA 1SJDA 1HN1A 2VUNA 4K36A 1MEIA 4A3RA 5CCZA 4JDBA 4QEHA 5IDZA 5G4HC 3CIXA 3THDA 1V0NA 3ITXA 1KFEA 2DIEA 3N2TA 3QGVA 3WJXA 3CUXA 3NR0A 4Z1DA 4JTSA 1REQA 3RM4A 1FWEC 4XZMX 5L9FA 2D1ZA 4HSOA 3I3EA 1RP9A 2ACUA 4MKSA 4C5ZA 2ZOXA 1ZRQA 1OEPA 3C2OA 4XAPA 1EL3A 1MEWA 3THUA 1LQ2A 3H12A 1MXDA 4AMCA 4Q33A 4A05A 3O63A 3CL8A 4AZIA 1EHAA 4GMEA 2NLIA 2ZRZA 3UXDA 2WKLA 2ZA1A 2CKSA 4YYCA 2XWEA 4DPQA 2VDGA 3WFAA 2VNCA 4MY9A 5BWFA 4LX4A 4KCWA 3S3GA 4AY8A 3O6CA 4B92A 4HA3A 2Q8LA 3WQEA 2PLKA 4QM1A 3K2GA 3SZ8A 3G1SA 1UB3A 4CN4A 1FWWA 3Q37A 1H5VA 2FZMA 4J3SA 2CCRA 4DBUA 4CCCA 4MJZA 3QY6A 3L0NA 2W92A 3E0VA 3W81A 3ZLGA 1JUBA 2EAWA 3KM8A 4CU7A 3GIQA 5CC3A 5XIAA 1XIBA 1YRRA 1ISVA 1I2QA 2Z6JA 3WK3A 4NJJA 3C56A 4E6MA 1QASA 2NXIA 3H55A 4KETA 1L6FA 4B5NA 4DJEC 3VX1A 1BWKA 5LA0A 4RE2A 3CEUA 3ZR5A 5I79A 1DTNA 4LT9A 3FVDA 3MB9A 2ZYFA 3QYQA 3UWEA 1QO2A 1T99A 5C9ZA 4Z2JA 2OELA 1O1ZA 4KW2A 1XBXA 4HIBA 2W66A 3WF1A 3B40A 3RYSA 3MMDA 1A53A 1MRAA 1IIHA 2JBMA 5CLTA 1FUYA 4JX6A 4BQ5A 1R3WA 4Z17A 3LCFA 3B9NA 4MDPA 2XVKA 1YXYA 1VJSA 4KGJA 1Z41A 1LTDA 3AFBA 3FCPA 1NDZA 4N42A 3UBPC 2P5NA 1GQKA 5LNVA 1OB0A 4HNNA 3DFQA 1W3TA 1UJQA 2P76A 1W1B1 5BZAA 3MKCA 1OC5A 1DJNA 1DL3A 2QAFA 3HFYA 4IL0A 1C9WA 2GOUA 3W6MA 5CZSA 3RUBL 4LH8A 5FEPA 4DRSA 3N18A 4EWND 3BW4A 1FA2A 3E2RA 2CBJA 3L0GA 5RUBA 3CYVA 4S2BA 3WQCA 4EF8A 2C1HA 3NQ2A 5H8MA 1XS2A 4A3QA 4ATLA 3AMDA 3RDKA 4IGSA 5DX7A 2HBVA 3OVGA 1HF6A 3SRFA 3UWWA 4EP8C 3HG3A 4HA0A 1A5CA 2ZRWA 4IP5A 3CTLA 1F4HA 4NZ3A 1XIDA 1Y0EA 3ZZ1A 1W5OA 2WVUA 3BAIA 2I16A 4C6OA 2VX4A 4C6FA 3AHTA 4NJGA 4J2MA 1WX0A 4CCDA 1S39A 1C3FA 3C86A 3M6DA 2AQOA 1XD1A 1A0DA 1JD9A 1AW2A 1G9HA 4UZSA 4MG4A 2J88A 3RO6A 1V02A 1PO9A 1E55A 4JTLA 4TV6A 4UTFA 2ADAA 4JEJA 2BG5A 2PI6A 3SRDA 5D9PA 2BVWA 1XYAA 3PZMA 5LIUX 4F0MA 1E9LA 4LU0A 5IHRA 2J6XA 5DLCA 5M5DA 4N4PA 1L6SA 4P61A 2Q8XA 3TONA 1HKJA 3IIOA 3SO7A 4YTUA 3RG6A 3H23A 4H9XA 1ZCOA 4ZFCA 4F0KA 3KBWA 4AZCB 4HU0A 3WZ0E 2POZA 4DJDC 1XRFA 3EMQA 1BF6A 2ZWYA 1KKRA 4CD5A 3LERA 4HHPA 1A3HA 3AIEA 4AYGA 1M53A 2Y8UA 1UKPA 1TX2A 2X2GA 1WO2A 2ZCGA 3FA5A 4IPIA 2BV9A 4H1ZA 2PTDA 1PWLA 4JFUA 4F0HA 5A1AA 1HQTA 2QGYA 2V38A 3OG3A 1F3WA 3DC8A 1KBKA 4WD0A 5IFTA 3G8EA 4UTLA 3V0TA 2PP3A 4GABA 1SGJA 4UWMA 5AHFA 1OZQA 1V5XA 3AALA 1ITCA 3SUUA 4S2CA 2BGQA 3PANA 4FLQA 1JDEA 4GH1A 5FA5A 1RD5A 1VYRA 1E1EA 1KD0A 2GUBA 4MJ2A 4Z1CA 4F9DA 1VKFA 4JKMA 2VO5A 2BOGX 4XD5A 1VB9A 1VFUA 3MS8A 2WOQA 3BAXA 4EWJA 5BXPA 3KS5A 1XUZA 3R0KA 3UG5A 4DWDA 5GNZA 5FF3A 2BSLA 3CMJA 3EYPA 4LS2A 3SQLA 3IGSA 4MJ4A 1Z44A 3KTSA 4JTRA 1EC7A 3CHFA 4O28A 4KFPA 4JTQA 4QQUA 2XGIA 1UUQA 4U5IA 3PY2A 5EFFA 5CLWA 1B3YA 2J9YA 3RJYA 4H2CA 2E4TA 4IMDA 1JCNA 1UOZA 2YX0A 1OJXA 3ZT5A 5JBFA 2VZVA 3TMQA 2AOSA 4ZB2A 1Z48A 3C0LA 2QMKA 2PP1A 4J9JA 3P14A 2QIWA 1E56A 2WHLA 4AU0A 3TFXA 2C0HA 5U4NA 1WUFA 4LVFA 1Z7AA 1NP2A 1KM0A 4J27A 5IM51 4GG9A 3NQAA 4D6FA 1JZ3A 1WDDA 2E5DA 4LBRA 2WZIA 3UVAA 1XJBA 1MQQA 2HWGA 3OYZA 3SCTA 1JDDA 1VFHA 5H8PA 3TLLA 4TVUA 4NQ1A 4RXGA 3TR9A 3LPOA 3QN3A 1P0BA 2OKTA 3OQEA 2CERA 3VIJA 3ZO9A 1X6NA 3H2FA 1W0MA 1Q8JA 3MVTA 3W82A 1A5OC 3FYPA 4XBSA 3OYXA 4LVDA 1H5YA 5IDIA 5BU9A 5AHIA 1V3IA 3QZ6A 4CLMA 2V5CA 2DH2A 2O7SA 3U3HA 2EPOA 3EOOA 1O94A 4B3ZA 1DOSA 3CUJA 2VKZG 1QTWA 4Q4KA 3SCVA 3WEZA 1DKWA 4S1FA 1H1YA 4MLJA 4NHVA 1HKWA 4M6QA 2DT1A 2DUXA 4IHCA 3HN3A 2REQB 4UZUA 4ZOBA 4BHYA 4MKVA 4UCFA 4GBUA 2XFYA 3GTXA 4U2YA 2VGGA 2A6LA 2HROA 4ACZB 4AC1X 4NAEA 4V1YA 1E0UA 2DDXA 3F4CA 4DF2A 3GRIA 1HP5A 2NVCA 3QXBA 1KC7A 3WMLA 1VBRA 1UR2A 1L2UA 1V79A 1U5VA 4W84A 2ZWZA 1A5NC 1US0A 4LUTA 1CGWA 1V3LA 1DQXA 4F9JA 4AZ6A 1BHGA 2DSWA 4LV9A 2ONEA 3H70A 3LPFA 3U2ZA 1QK2A 4M0XA 1ZBKA 2BFGA 4DF0A 1T8XA 3W2UA 2R1LA 2DQXA 1N8WA 2PDKA 2Z1BA 4MWAE 4XD4A 3T81A 3T2OA 2BWGA 4J3ZA 2DZUA 2PS2A 3DKLA 4AF0A 2PWUA 1RVKA 2VEPA 5L6UA 2V69A 4QNWA 3SQSA 1XV8A 3W1AA 4NI3A 5TNVA 3IK4A 4FNPA 2HE5A 3WDJA 1PZ0A 3GTNA 4G2DA 1SZEA 1EUNA 4FMVA 2Q8ZA 1MSSA 4L65A 3CWNA 1KGWA 3AIBA 1QHOA 2PURA 1KM2A 2V81A 4POCA 1P0DA 5KETA 4ZXLA 1CZ1A 3ARQA 3M0JA 1WZKA 3R1ZA 2HE8A 2ZX7A 2RUSA 1DXIA 3K4AA 3CAQA 3IWPA 3WMSA 2PUZA 3AMKA 4I8YA 3S2CA 3PSWA 4GD0A 5FJJA 1H11A 3W0KA 3NQGA 5GQBA 1S2AA 1QPKA 4TVCA 2WQDA 4AZCA 4MMWA 2R94A 2XVGA 1DJHA 3XINA 4ZGYA 2YIHA 4N2YA 2YYTA 3B0XA 1F73A 2HS8A 3B8WA 4GC4A 4C1NB 4H9MA 3D6NA 3PG8A 2D24A 2NQ5A 1XIIA 3KVLA 4TX8A 1W1A1 2F84A 1XPGA 2QKFA 1B1YA 3DOPA 4ZQNA 2DZTA 5HJXA 4CNNA 1ZALA 3PZOA 3F4WA 5CKSA 2ZX8A 4E4PA 2BDQA 1EWDA 2PRLA 2IPJA 1TE6A 3M0MA 7ODCA 3U7BA 3QTPA 2A79A 3WUEA 1NF0A 1JUEA 1SW7A 3BSMA 3M0ZA 2ZXAA 4W8LA 1I9CB 4EACA 3WY1A 3TJIA 5IFPA 2BGNE 4LYRA 3A9BA 4HBKA 4E2VA 3DFOA 4K1GA 5FL0A 2A3HA 4WIWA 4UOQA 3BC9A 4Z2IA 1REQB 3AS0A 4EXAA 2W27A 1YW1A 3W7DA 2OT1A 1EJXC 3CHDA 5C8BB 2VZUA 4K38A 2WQPA 5XIMA 1CTNA 5E0FA 4GH3A 2FTWA 4QG8A 2HVOA 4UC5A 5HBFA 5CPMA 3W28A 4Y9OA 3S0CA 2DZVA 2VM8A 3R5EA 4CGTA 4NJKA 4GI4A 4OE7A 5K3VA 2R1MA 3O6DA 2X1RA 3H4XA 3WF4A 3UYCA 4ZB5A 4RZ4A 4EPDC 3S5SA 4O4WA 3RPMA 2FDSA 1VZWA 3SIZA 1T0OA 2RFGA 3HPFA 1O5QA 2CLLA 4AD5A 2OLHA 4CQBA 3BSGA 3EKZA 3OA5A 3TR2A 3N4AA 1PB0A 3PSVA 1LROA 2O92A 2WZMA 1JDAA 2VJXA 5A5WA 1MW1A 1HO4A 5DMYA 4PTVA 3WMCA 1B90A 2EG6A 3E2VA 4BQ2A 2CLFA 3UPMA 3QRHA 1QR7A 2G3MA 1ZS2A 3VE9A 1J2WA 2OGJA 2FMNA 4E5TA 2J7CA 2WZHA 1LCOA 3GU2A 2PDPA 3B9DA 1CENA 1T8QA 1IR1A 3IJ6A 1KB3A 4FLSA 4DX3A 2OZTA 1EH9A 5HWJA 5GJMA 3H6OA 3M0VA 4Q22A 4IG2A 3FN9A 1O1HA 4DJFA 1FWRA 1RJQA 4G1KA 3LCLA 1ADDA 3WFLA 2C1IA 1BWVA 2XTKA 1QI2A 1CBGA 2YDSA 2FLIA 4LBUA 3F2DA 1TTQA 2BXZA 3LHTA 3WK2A 5D2VA 4IIHA 2D2HA 4WXZA 3KTCA 4AZHA 1WB0A 4AHPA 3NL5A 2CIPA 3KE0A 3VINA 4ICNA 5A8NA 1DWGM 2J9ZA 3KBNA 3LGGA 1SZNA 4GQ0A 4YLWA 1M04A 1TV7A 1TCDA 2ZQ0A 4L80A 4K8GA 4XKYB 5T9CE 1MO0A 4IGNA 3U57A 4FS9A 2W62A 1ITUA 3OQ8A 3F1QA 2YZRA 1E43A 1XR2A 2ATMA 1LL7A 2PZNA 1M7JA 4UQAA 2MNRA 4Y9AA 1BGGA 1GK8A 5DRIA 4Y8FA 2BHZA 3M0IA 3MWAA 4GCXA 2OX1A 3T8LA 2OO6A 2GSHA 2WANA 4JEQA 3VOHA 5EMMA 1ZB5A 2WMHA 3WLIA 2RDTA 2ZADA 4N6FA 1W6TA 5DRCA 4DI8A 5A6SA 2BY3A 1JRCA 3SCUA 5LSMA 3DBNA 3SADA 1EQCA 4O1AA 5T26A 4W5UA 1XISA 1TO3A 4K8HA 5HINA 5DF0A 2NUYA 2QCFA 5CSYA 1M65A 4WKFA 1M41A 2AL2B 4PMXA 3PC0A 4AXNA 3UNDA 5TQLA 1T6MA 3V5OA 4DVOA 5G2IA 4K68A 2I9EA 4UTKA 3IAQA 5AYYA 3WQVA 2D22A 2AAMA 2GOKA 4GQBA 1GVIA 1LF1A 3ZT7A 3W86A 4AMAA 3B9OA 4V33A 1D2KA 2YW4A 2G3JA 3WN6A 1XRTA 1ZJHA 3WJYA 1X8CA 3QC3A 1ISZA 2Z1VA 3RM9A 2YFOA 3FV9A 5DCBA 1QW9A 2PLMA 3T05A 2F6UA 4F0RA 2J77A 3U4AA 5CZJA 3S42A 4ZMGA 4OBRA 1SW0A 2UY2A 5B80A 1UP3A 1XIMA 1S1RA 4LAUA 1KTBA 2LLEA 1R5YA 1K6WA 5PTDA 3N4EA 1H7WA 1GOXA 4MFDA 1K9TA 4L1GA 3NQFA 3TSBA 1JZ4A 5LIXX 1OD8A 1YBQB 3W7LA 4CVUA 2YL8A 1O5KA 3H8AA 1C8QA 3RR1A 3BVJA 5HJYA 4NUWA 1IHIA 2GJPA 1W3HA 1VENA 3HGRA 2Y7DA 3TXVA 3W88A 4B9ZA 1S2VA 3SCQA 3H22A 3AXXA 3IGHX 2G8ZA 3FJ6A 3WLKX 2FGBA 3UYIA 1GW9A 2A6NA 2XN0A 3OTRA 4LCSA 1U5JA 4UNKA 2E25A 2IUZA 4R53A 3QSRA 2DZXA 3LG3A 3WK0A 2GJXA 3W7OA 3FIGA 3LU2A 1WDPA 4JFVA 5A6AA 3S6TA 1Q2SA 1YDVA 4ASTA 2PDXA 3RPTA 1H7OA 4HNTA 3W4RA 4IMEA 1TPDA 2WCAA 4QITA 1AD1A 3G1RA 1EQPA 3E12A 2TMDA 3BQ6A 2OT0A 3ZR4A 3C8FA 1TV2A 2WYSA 4WY0B 1LBFA 5DMNA 4Z2GA 2OYMA 3KWSA 4HMEA 4FSAA 5C55A 1JXKA 1TQXA 3C8NA 4I7WA 2QJMA 1V93A 4L9XA 1PAMA 4HNUA 4ZE4A 3W2JA 2DZAA 1W1VA 4KWWA 1F3TA 1JUKA 4W8BA 3QV9A 3W02A 3QJAA 3GH7A 3A47A 3EOEA 1PUDA 4FIRA 3P3BA 3BAYA 3FKKA 4GY0A 4ERGA 1PIGA 4LEFA 4Y2WA 1JPHA 1NDVA 3F03K 5GPRA 1G7VA 3A5FA 3BICA 2PWGA 3WSUA 4BS0A 2F38A 2VX7A 4FOUA 4JTTA 4KWVA 1VJZA 3HIJA 5I3DA 3KBSA 3G1VA 1IQ8A 2ZUUA 1ITQA 4LF2A 3GXNA 1OX4A 2XUCA 2OJPA 4A2SA 1EIXA 1X39A 3ZSTA 5DMLA 1C8YA 4CNTA 2CXEA 1EP3A 3HG4A 4IPNB 3W1LA 3PJTA 3PZTA 1LOQA 3HJZA 1S5TA 2VHLA 1QMLA 2J24A 2DT2A 2HS6A 3I4EA 2DEPA 4DF1A 1RY0A 2PDLA 4D6IA 2V68A 1LL6A 2WB5A 4BF9A 1THFD 5CSSA 1TV3A 5CGQA 3U8GA 4X9SA 4LC8A 1V08A 1R38A 4E2BA 3AMCA 2G4FA 1I1WA 5E09A 1J0YA 5M2FX 4EXBA 3JVAA 2J7DA 4KWOA 3MI3A 5EMLA 5REQA 1XQLA 1Y5XA 4OJYA 3PBYA 3THCA 3PULA 5E9XA 3N25A 2YDQA 4FHAA 3UZXA 4F8XA 4XZBA 3AIUA 5JH2A 3VDGA 3HQ1A 1SPQA 3DHPA 4DYKA 1GPFA 3DIPA 1UASA 1FP8A 4S39A 2VCCA 3M0HA 1XGDA 1TTPA 3VNJA 4DBWA 1CB7B 1OX6A 1JQXA 1ECQA 1JYWA 4FXFA 1A5UA 5AC8A 3PG9A 4AZ7A 4MKNA 4GX9A 5ABHA 4C6EA 4HMDA 3LNPA 1VP5A 3BMXA 5D4YA 1JJKA 2UY5A 1P6WA 3BWWA 2VURA 4ZO8A 4XVDA 4DJFD 2CHNA 4F40A 3OLDA 3E1F1 4HTYA 1YIXA 4ZQCA 5BXRA 3E3HA 4GNVA 3ZJ6A 3R94A 4I9MA 3PB2A 2QCHA 1E5NA 3ATYA 4I6KA 3PZQA 3GC4A 3MCMA 3TLQA 3F4VA 2PBOA 3GNOA 3V5CA 4Q7BA 4B5WA 3ARUA 4RUBA 3BCFA 2PU1A 4PUDA 1GVOA 3R12A 1K9DA 4JL1A 3QZEA 3WBYA 3S2MA 2O4MA 1TJPA 2I56A 3K4DA 2R1NA 4HU3A 2Q02A 2RDWA 2WHJA 1G6CA 2DY3A 4HK5A 4L6OA 4YVPA 3UR8A 4MB1A 1DJZA 3SRHA 3OPSA 1HKVA 1TPEA 2WWDA 4XAYA 1ONXA 1BVNP 1R87A 1M9HA 4DQWA 4US5A 4ATWA 2NQZA 2WC3A 1C9DA 2PWDA 4N7QA 3T4WA 5CZ0A 3PPFA 1UMYA 4BF5A 3HGOA 4JCMA 1KQZA 1PBGA 2BZNA 1W8GA 1G94A 2YJQA 5HXMA 3FGCB 4CCEA 4C1NA 5DXXA 4EF9A 1OM0A 4FAMA 1ECEA 3T55A 5FJTA 3GNRA 1TZZA 3WQDA 1D3GA 1BTMA 1K4GA 3PWIA 3TYZA 3LNMA 1SZRA 3MO7A 1CI1A 4XO6A 1E6PA 2NX9A 3WFZA 4JN6A 2EQDA 2Y5JA 1QI3A 1CIUA 3P0XA 3E49A 3QLLA 3LCGA 5A69A 4Z2KA 4Q3MA 1ISXA 1MFUA 5AHNA 4HPXA 3CV6A 1UZHA 4IP7A 5SWUA 3NWRA 1JG9A 1XIJA 3M0LA 3SUVA 2WVVB 2PTWA 3GH4A 4R7JA 4LC6A 2Y5EA 4TQTA 4YWIA 3R89A 4ZXOA 1SJAA 4D6DA 4M7TA 3HU7A 3CM4A 3ITCA 3KS6A 4MZYA 1WPCA 1MNSA 4S3FA 3SJNA 5D37A 4J1OA 5CJ5A 5HOSA 4L61A 1SJCA 1F76A 2I9UA 2E68A 3VKJA 2DVUA 3VDBA 2Z2UA 3CZGA 2OWWA 4D6HA 4Q8QA 1OADA 4X2RA 3TTEA 2QDDA 3CLMA 5IBXA 2CBUA 4UTTC 1TTJA 1KM6A 5TIMA 2CITA 3EOSA 1M03A 3UJSA 4O1DA 2WC4A 5FF2A 1VEOA 1DE6A 5I23A 2VEFA 4GZ7A 5E9AA 2ACQA 2VVNA 3KX6A 4YHGA 3DESA 2VQUA 8CGTA 3CL7A 3PHAA 2WPGA 3KRUA 4LYQA 3VIGA 3BZGA 2AGKA 4PZVA 1AW5A 3LXCA 2WAGA 1NU5A 5EL1A 4KH2A 3W27A 2PA6A 3N14A 5C9UA 3AJXA 1S3HA 4ZQRA 3EA3A 5LKYA 1XXXA 3GDMA 3TOPA 3VIHA 3K1DA 1GHRA 5M03A 1IXPA 1YXCA 4UNIA 4KFNA 3M4HA 1TYGA 1J0ZA 3VILA 2PWEA 2RGMA 4NL1A 1I6NA 3VZYA 4GVGA 3UCQA 1PJ9A 3Q94A 4PRTA 1AQ0A 4PMRA 3ITLA 3CT7A 3MSYA 1X1ZA 1IIGA 4LAOA 4OHQA 3N3MA 1S5VA 2R91A 5KMYA 1GONA 3QBUA 4ZB0A 2J7BA 2ODOA 4I9AA 4AD3A 5F4XA 3G5EA 4S3DA 3IVSA 3NSXA 3NCOA 3EX1A 4WX2A 1QDSA 2BY2A 3HPAA 1B57A 4MF4A 3TNOA 3D46A 4BJHA 1YNPA 2PCEA 2I1OA 2ZA3A 1KBJA 1CLKA 2RGLA 2W79A 2ZXQA 4XAFA 5MHBA 2BX7A 3GE7A 5AYIA 1XLDA 3VAVA 1QPQA 4IL2A 1QW7A 1PX8A 4JQAA 3JZEA 1R7AA 3FA3A 4JTCA 3PTKA 3PF3A 2E1WA 4WGXA 1SZGA 5CC5A 3GDLA 2OQLA 4GZJA 3W7MA 1M3UA 4KCTA 3WH8A 3KVMA 1UR0A 2VENA 3LN3A 2GVLA 2BHYA 3PJUA 5E0KA 2DT3A 4V27A 5DY2A 3DGRA 3BCDA 3DENA 3N29A 1H4PA 1G0CA 2HTMA 3QR1A 3AICA 4LY8A 1QCWA 1W9UA 3ZQ9A 1O4UA 4NRRA 5D05A 5AFDA 4Z0JA 4Q8WA 4P8VA 4WHBA 1HL2A 4UR7A 1J0IA 1AUSL 1XBVA 4AWUA 3WUGA 4C6PA 2J8TA 3ZT6A 4CNUA 5KZDA 1S5MA 2V3FA 3KDOA 3W37A 4H9UA 1RP8A 3O8AA 3A23A 3W76A 1TE1A 5DY3A 3NA8A 4HOXA 2REQA 4X3ZA 2JGYA 2Y8VA 1FWGC 4PTDA 3M07A 4L64A 5FSDC 1DJGA 1GUVA 5M1TA 1UIOA 4Q4OA 3SSZA 4BQ3A 2WZTA 3VOCA 1MXSA 3O0FA 3B0PA 4DUXA 1F6KA 3GVRA 4GPNA 1P5BA 1Q4WA 3N13A 1SFJA 1UP0A 4CUCA 4R33A 3IK2A 2C7FA 3T6CA 1RCQA 4F48A 3BAJA 1WZAA 1E1CA 1N8IA 1E0TA 3WL1A 3WLRA 3L67A 1VFLA 1XSJA 1ZBCA 2OEKA 2OYKA 4AISA 1X8FA 4MPKA 2YLAA 3I6EA 4PB5A 1PXGA 3KW3A 2VFEA 1W5MA 3HFTA 2CU0A 3LHVA 1V77A 5E0CA 3IJ8A 1XD0A 4FOKA 2NT0A 3OJGA 3TAOA 1AJZA 3O15A 5BOFA 4AEOA 1OK4A 1RBAA 2VI0A 4H2HA 2AMXA 2TAAA 4W87A 4RE3A 1H7PA 3BPWA 1JCJA 2OOFA 3HG2A 2A7RA 1UMLA 5AHEA 2QJHA 2XH2A 1ZSXA 1LZOA 4LNCA 1RA5A 1W3LA 4B5VA 1GHSA 4P8XA 2PB1A 3AC0A 3DECA 2DW7A 3KCLA 3P0WA 3Q45A 5G5IA 5A6JA 1YDOA 4GQGA 3W83A 3CAKA 4IQLA 1UP2A 2R6OA 4KWUA 5A95A 3LTPA 1G4PA 1UD5A 8XIAA 1US3A 4GKTA 1V4YA 2D2JA 1IE7C 1EP1A 2WSKA 3ZLFA 1A47A 3MYOA 3DFSA 1KO0A 5FJPA 3G3DA 2OO0A 1ISYA 2INFA 3THQA 2J9XA 3R2GA 3STPA 4OU1A 3TN6A 2PP0A 4FLOA 3T0TA 4BK9A 3GTIA 4KIEA 4UUIA 3QTGA 5ABFB 3ABXA 1H50A 4H01A 3AIQA 2ZTJA 2AL1A 4J7RA 2NV2A 3QR0A 2VRJA 4LPCA 1QW8A 1IZKA 3TYBA 5A94A 5D2WA 4C5YA 1H0IA 5BOOA 3WMBA 1PKLA 1TRIA 4IJRA 3W25A 4UFIA 2ANUA 5CPTA 1OFDA 4XV0A 4M82A 1MRQA 3WQFA 1MZRA 5LA1A 4ZOEA 4YNGA 4HD5A 5I77A 3MZ2A 4IISA 1FCQA 2R82A 4L56A 3PBUA 5FJRA 1QPOA 3I7RA 5AZ1A 1JAKA 3TTQA 2ZUWA 2CXGA 3RAOA 2A3AA 4NX5A 4ZFMA 3EBVA 1DPMA 1H62A 4I7VA 3RMJA 2DSVA 3QY7A 2DJXA 3IACA 4RX0A 2EG8A 3L4YA 2GVYA 3P60A 4WR3A 1UR3M 1BWLA 5DQPA 1GZJA 3WD3A 3JU2A 3NL6A 1JYXA 2D0HA 3MANA 4H04A 4KEMA 1V0MA 1IWBA 4B4HA 5E6ZA 4X0NA 3URBA 3GU1A 3WJSA 5HNUA 4M24A 1UR9A 4BZYA 1PKYA 4FI4A 1DIDA 1GKRA 3OOQA 1JPDX 5JQ9A 2ISVA 3LM3A 3SGGA 2EPNA 3OU8A 5EMJA 2JKPA 1IEIA 5C2XA 4I90A 4XTDA 1PDYA 3IARA 3R4IA 4ERAA 3MP5A 3BUVA 3BLDA 1AFSA 3DFTA 4GA8A 5JBEA 3IUDA 1Q6OA 1BKHA 1VIWA 1DXFA 4AVFA 4M1RA 1YQ2A 4ZSTA 4NX0A 2BASA 3SY8A 1UQZA 1TVPA 2CZVA 4GXMA 1D9EA 1S2TA 3QH2A 1UQYA 1I0DA 5ENLA 2CLHA 3WQ8A 5LGZA 1PWMA 1BF2A 1TVLA 2PCQA 5CJMA 4S3EA 5I6SA 8RUCA 1EF3A 5B7ZA 4HYWA 3TNBA 4C6DA 2B7NA 2RDUA 3EDEA 3BW3A 3MBFA 5XINA 4O13A 3AU2A 2E09A 2Z4GA 2QAPA 4GY7A 1O60A 1EDTA 3SCNA 3LHYA 1YKWA 3GHSA 3APYA 1LOSA 3WG6A 3VDAA 4BR1A 3UZYA 5KZEA 3AWOA 4R7WA 5I07A 2NXHA 3KZPA 3W2LA 3G1XA 5DBTA 3DCPA 3HA1A 4RZBA 1XLMA 1YHTA 2P3ZA 2R1KA 3UPWA 3V75A 3MPGA 3EWWA 3W53A 1K4HA 3CWOX 1WAUA 1W2VA 4ZVJA 2WMKA 1RPXA 4NAFB 1MMFA 5DMMA 2Y1HA 3GHUA 3PWGA 2ACSA 4HN8A 2BB0A 3IIXA 2R9RA 1QBBA 3N04A 3HMCA 5I24A 3LRKA 3L23A 4NYYA 1W9PA 1FX6A 4QNEA 2Q09A 2Y4SA 4EPKA 1F7BA 3U2OA 1C7TA 4UCGA 1OC7A 1LUCA 3BZJA 4H9VA 2V5BA 3CMFA 4C1KA 4HVXA 3M44A 3I3BA 1Q6EA 1WXZA 3JRKA 3M46A 1KNWA 4RV3A 1XM3A 3EOLA 2FPYA 5T8GA 3NQDA 3RU6A 2Q3OA 2E6YA 1HNYA 3ZVHB 2J7FA 1GW1A 7TIMA 2PC4A 4MB3A 1F3XA 2OLAA 1CEOA 1VH7A 3LXAA 1XH1A 2VQTA 3C0SA 1AH4A 1I1XA 1E6NA 1WA3A 2Z2AA 3AU6A 1PHQA 2VWSA 4WOZA 3WNNA 1W8SA 1OYCA 2DZSA 5DFAA 2NVAA 3W85A 2FHBA 4HYRA 3DH7A 6PTDA 3ABRA 1TWDA 4J35A 2D2OA 1E70M 3MCOA 4M19A 4JD4A 2XN2A 2NUXA 4IUGA 3SBFA 3S2NA 5C5YA 3W2KA 1EJ7L 4E3VA 3L4XA 3THAA 1R9YA 3G0UA 3VNDA 5KINA 1IZCA 2FZNA 3ITVA 1LDCA 3E96A 1ZAHA 2GYIA 2Q3RA 4JNZA 2Y63A 4IFKB 3WNPA 1RJRA 2XIOA 1OYBA 3RPDA 4M5PA 3UR7A 5JXQA 4FXSA 3GUWA 2VFGA 3MUAA 4BWLA 5I00A 2ZRXA 4AAJA 2ZXDA 1FCUA 1OIMA 3RCMA 1GJPA 5A8GA 4QJ3B 1UWIA 2RH9A 1GWJA 4LYPA 3FEQA 3MV11 4IJCA 3VI2A 2FTPA 2IS7A 2XYLA 5HA7A 3VGBA 1E0VA 1TPC1 1W9DM 4ZQMA 3CWHA 1XSIA 2JFEX 3DGBA 4HU4A 1V3KA 1JFXA 1W9BM 1UC5A 9RUBA 3VIOA 4AWSA 5A6MA 3H26A 3C2EA 2CLKA 1OYAA 3CV1A 4KRTA 1J6PA 1ZFJA 1TJ1A 2EXOA 2VFIA 3VKAA 4AD4A 5H91A 3GTFA 3NEVA 5LA2A 4Q8OA 1M6JA 1RHCA 3MVIA 4IX2A 1H7NA 1RBOB 1TELA 1E73M 4PUMA 4K7YA 5FAJA 1E6SM 3LCWA 3W74A 3RGTA 1EOMA 1D3HA 3I6TA 1P0KA 3SCRA 3ZIZA 2G37A 3QC0A 2WMJA 2IKJA 3VA8A 1WDQA 2YB1A 5U7SA 1HJUA 2F7FA 4XIMA 4IICA 3WUBA 3F2CA 3I65A 1FWJC 3QKEA 2GGJA 2PDUA 1H1NA 3PNZA 1UKOA 1J6OA 1CDGA 1IEWA 4OOZA 5LHFA 2GSEA 4R27A 3VOJA 1X38A 4IXHA 4N9DA 1MW2A 1WE5A 2E9LA 5CQ1A 4XZHA 1JDCA 3SAZA 1PDZA 1W5NA 4CVWA 4GIRA 4X63A 1NWTA 3Q67A 5HULA 5CBBA 1V0LA 1X97A 4D1IA 3PJXA 3NZPA 5KITA 5K9XA 4LAMA 4AIEA 1J8VA 3B8SA 1HJXA 3VVGA 2W4XA 3BDKA 3LK6A 3I68A 3LGEA 2VX5A 1IR2A 3EB3A 1LBLA 1Z6KA 4C6LA 1X1OA 1CXLA 4Y6GA 1GZ1A 3HGJA 5HJLA 1W37A 5E1QA 2HK0A 4GKLA 3W7NA 1XFCA 4EK7A 2BLEA 4H7ZA 2PDMA 3RXZA 3N34A 3R0UA 1FWNA 1LQ0A 3R11A 3PTDA 2ON3A 2C14A 1PYMA 2PDHA 4JCLA 2D0GA 3L4TA 2W6RA 2RJHA 1HJWA 2H9AA 1E40A 5FIPA 3T0AA 1LG1A 4UR8A 4AEEA 4B91A 2XVPA 4JFWA 1CGUA 1P6CA 1Z89A 3ALFA 3IIPA 4A2RA 1KCLA 1K70A 2ALRA 3OHIA 3LCIA 5I3FA 1GKQA 3UY7A 4TX6A 3ATZA 3WDIA 3S9IA 4HPJA 3LHUA 2CBIA 2YCLA 3BMWA 3WDHA 1UD4A 5IBXC 1A5LC 5DXYA 1QVBA 4PFMA 3TJ4A 3GR8A 1DIKA 4GOAA 3TC7A 3WLTA 2J66A 1IGSA 4J40A 2A0NA 2GL5A 5HMEA 5F2LA 5IOBA 3TFCA 4RNFA 6REQB 1Z9AA 2X0YA 3AZRA 3P6LA 3SCSA 5JIPA 1JULA 1UHVA 3XIMA 4DXVA 2E77A 1V03A 2XIIA 4F79A 2BOEX 5G1YA 3CU2A 4FF7A 1KFLA 4ADUA 4LYKA 5G4EA 3BK0A 4NZFA 2VZSA 2F8QA 4JIIX 4ADTA 1XYBA 4JNMA 5B7YA 4XK2A 4Q8MA 1JXJA 5CPNA 3U0HA 3RLVA 4NAEB 1I2NA 3OBAA 2OR2A 1TJ0A 2FQIA 2GDQA 1BGAA 5AKQA 4ZO6A 4ZOCA 4F2TA 4H00A 4QDMA 2VOMA 3GB6A 3O2LA 1DIEA 3LEPA 4TMBA 5C2CA 3S46A 2EJ1A 4ZE5A 3SN1A 2ISDA 2KZHA 4O52A 1QNOA 3N2OA 3U7VA 4PUWA 2RHGA 1QNSA 1FQ0A 1JCTA 5E5CA 3NG3A 3ZYZA 4JIPA 2DSKA 3NPXA 2X7VA 4FR6A 3QGAC 1OFAA 3W1PA 2WK2A 4A8NA 4DB7A 1X6LA 2WSPA 1XYMA 3TQ0A 4PSRA 1OWQA 4HQVA 1CYGA 1JCYA 4EPEC 2B7PA 3GXIA 4LFYA 3VNKA 2BODX 1UWQA 4PUEA 3LV5A 3C2FA 4DZAA 5F2MA 3UQNA 1FP9A 3BJSA 1XLHA 3ZFHA 3IGXA 1E51A 4DZIA 4DBDA 2W63A 1GVYA 3WF0A 3CASA 4YYFA 1O66A 4HNCA 4GZEA 3R25A 5G2WA 3L68A 3R79A 5D38A 4REQA 2HVNA 3TMLA 3A3XA 5C7HA 1MZHA 4DNMA 1LLOA 1R3YA 3T0DA 2C19A 5CEWA 4O53A 3HGSA 1I8JA 1OFOA 1QAPA 4GX8A 3PZIA 4MNKA 3K46A 5EKYA 1WP6A 1K7XA 1LM1A 3N11A 1I0BA 2WLZA 4O1BA 4PRRA 3O05A 4UMCA 2PDJA 4XSLA 4LJ3A 4MZ1A 4JFTA 3A4XA 4C60A 4H8HA 1K9EA 1J5TA 1SO4A 3L2LA 1F9CA 4D6EA 1VIZA 4ICCX 3GDBA 3NZRA 2OYLA 2C16A 1E9YB 4PTNA 2VL4A 4RJEA 1AD4A 1NARA 2ALDA 3DBPA 1JNEA 2OG9A 3CZKA 3WBXA 5BW6A 4PCTA 4J3XA 4R9XA 3RHGA 3KEHA 3DXIA 2QJNA 3MA8A 3TC6A 4LANA 5CSUA 1IGWA 2OWCA 2FFIA 3QV7A 5BOEA 2Y61A 6XIMA 3SI9A 4KS0A 3SW6A 3Q4DA 2YB4A 4RE0A 1V6YA 3AHXA 4IFRA 4OV4A 4LSBA 3WLLA 4PC8A 1MUMA 1UW9A 3UZZA 3W1XA 3LQLA 4O12A 4NXKA 3S5OA 4WF7A 1XIGA 4D8AA 3PUOA 2J8FA 5D2TA 4GC3A 1OFBA 4PE8A 2I17A 3BLOA 3CPUA 3LCHA 1JZ6A 1RK6A 4G56A 4XB3A 3MT1A 1CT5A 4PR4A 1G4SA 1J12A 2WJFA 4GIAA 1EO7A 4EAMA 4PFHA 2YBUA 3OVPA 4IIDA 4M6VA 3MMWA 2FZBA 2HZGA 2ZVRA 2Z7GA 3BAKA 1CGTA 1H41A 1Q4NX 3NURA 4NJIA 3G1AA 2UBPC 2IXUA 1G7UA 3II1A 4ACYA 3REQB 1UWRA 3NDOA 5AC4A 4S38A 1TV4A 2GQ3A 4K3ZA 1HL9A 4I3GA 2CHRA 4XUYA 4LUYA 5DEZA 4B9YA 3R58A 2GLKA 1XWYA 3U2CA 4RW3A 3TEVA 2Y6ZA 3HTWA 4W88A 4LF1A 4XVEA 1CB2A 1T5AA 3W84A 3GG1A 1VLWA 3FXGA 5HR7A 3DU0A 2ZKMX 1IXOA 1VYSX 4ZO9A 5I02A 2XVLA 5A2BA 4KBXA 1KTCA 1H3GA 4DPPA 3L2IA 2E28A 1J4EA 3FHAA 4KQNA 3AAMA 2YL9A 1CWYA 3ZS4A 1E4IA 1KFKA 5AC6A 4PUNA 1TWZA 2PTXA 4QCFA 2YCLB 3XISA 2WMGA 3B03A 3ECQA 3KUMA 4B2DA 3P5ZA 3T78A 1EEPA 3I6RA 5KZMA 3PWAA 3BANA 2FJUB 1U1HA 2VEGA 3PPHA 4AB4A 3QHOA 3LY0A 1UUOA 1QNVA 2VVSA 3P67A 4GUGA 5DO8A 5D04C 3W24A 4ES4A 1V7YA 3MUY1 2QZRA 4CNSA 2A3LA 2QCMA 3ONCA 5D09A 2FTYA 3P84A 2DORA 2HSAA 3V18A 1EIBA 2CC0A 1V6VA 1W31A 2ZTKA 3EWXA 4L5ZA 3VNIA 4M1BA 3VKBA 2HDJA 2PPGA 4BEUA 4PGLA 3RR4A 2JE8A 4FLRA 5I3GA 3QMSA 2VT0A 3M5XA 3SM0A 1TR1A 5M17A 5F1VA 4INFA 1LT7A 7REQA 5GNXA 4XZ9A 3C2YA 2CPUA 1D7KA 1H09A 1FDZA 3EXSA 4GVIA 1E4LA 1W2PA 4JS3A 2ICSA 1AMKA 1HW6A 2PRHA 4FK9A 4Q6XA 2ZZ6A 3WQPA 2PDCA 1KLYA 2VFDA 4GIEA 3D47A 5D9NA 5CG7A 1DV7A 1RVGA 2YKKA 1H7RA 5D8WA 3GFZA 2QYGA 2J25A 1V6UA 1PIIA 3BGAA 1MVYA 4AZGA 1B3ZA 1U1JA 1IWAA 4S3KA 2VC6A 3LYEA 4DXKA 2ESCA 1KXQA 1KLZA 2PDQA 4WDTA 1TIWA 3MW7A 1A0EA 4JPGA 3F7JA 4Z2HA 3KOYA 3HOJA 4EVZA 1UWAA 3NSNA 2QT3A 3MHGA 1TMHA 1R3QA 3MSRA 1QO5A 3K8KA 1LRQA 1H1ZA 1M1BA 1BXCA 1UH3A 1H7XA 1US2A 3W29A 3E02A 3KAOA 1RXOB 1R47A 2E6DA 4E4UA 3BL3A 1ZENA 4QFUA 1R85A 4G5DA 1EX5A 2YW3A 1B0IA 1R30A 4XISA 3EPMA 3NDYA 1RA0A 1Q7QA 2V5KA 3UZ5A 2FGZA 5CSRA 4REQB 1XIHA 4JKKA 1ENUA 3CZ8A 1EYEA 4DHGA 4O0ZA 2ZUNA 1NFBA 4HCHA 4GI8A 2YDRA 3U6WA 4MB4A 5TD4A 4BI6A 1MW0A 4QJ1A 2H90A 2IKHA 4C6IA 3W7KA 4W7UA 3N2MA 2EJAA 1PTAA 2FHCA 1DEDA 4M56A 2ZZ1A 4MGGA 3B8UA 3ID7A 2DFAA 4WDWA 2J8GA 3AXMA 4S23A 1EJSC 3EKGA 3AHZA 3SFKA 3VOFA 1BG9A 3AS2A 5REQB 1XI3A 1EF2A 4CEXC 1WXYA 2ZZ5A 3LTYA 3W1RA 3QGKC 1QI4A 4ZQPA 3MSDA 5A8PA 3O1NA 4RPQA 2YXXA 3K5XA 2XISA 4M8UA 1TCMA 3M16A 4MWAB 4Q6JA 1CLVA 3GVQA 1N8FA 4OBTA 1RK5A 1GJWA 3P93A 2YYUA 1HKKA 3GG8A 3VC6A 3HV8A 3MWCA 4JTUA 4DXXA 1JZ5A 4MAVA 3T4CA 1MUCA 1DTUA 3KP1A 1UYQA 1QNPA 3WQ4A 1ZQ5A 1RUSA 4OUIA 3GIPA 3SCOA 3H53A 4NZ5A 4UTIA 2CZDA 2OQHA 3MUZ1 1WZLA 2WVSA 2PRMA 2Z29A 3S2JA 3OP2A 1E72M 2ZIDA 4NP7A 5FEXA 3AOFA 5CGMA 3ARSA 2QR6A 3SFWA 2CESA 3FA4A 1QWKA 4GUIA 1J5SA 1VRDA 1TV5A 3LPPA 3OB8A 1UBPC 4XIAA 3M7SA 4FXRA 1SW3A 2J13A 4H8UA 4XO7A 1EC9A 1VCFA 4JKLA 3WNLA 1Q63A 3TZFA 1QPRA 3QHMA 5I3JA 3GW0A 1HJSA 3BGJA 1JF5A 3UG8A 1VBJA 3YPIA 1JGIA 4H9TA 5GJPA 3KTXA 3C61A 5AN7A 1KRCC 4FX8A 3QKZA 1UUMA 1GNXA 1LQAA 3PZ9A 1K9FA 3B9EA 1VGAA 3QFEA 3NO1A 3KBJA 3WENA 1Q45A 3E5BA 1KFCA 2X1TA 2X1IA 1XLLA 2R24A 2ASHA 1WAWA 1W54A 2W0UA 3T40A 3TA6A 2A85A 3M43A 2VC9A 1GQNA 3VUSA 4MHBA 1MW3A 5FEZA 3DFPA 2A2IA 4RZ5A 1BLIA 4Z08A 2GQ8A 3LBOA 1CLXA 1ZJAA 4O1EA 1F6PA 3FHQA 1CCWB 1YPIA 3BCJA 1IYXA 4HHLA 1FRBA 2OXNA 2B0MA 4AIUA 4YTRA 3TN4A 4UXDA 2G3FA 1UBSA 3TP4A 1AK5A 1OCJA 3ZWTA 1KCXA 1B54A 4XKYA 3KOFA 4TO8A 2PWVA 3LTSA 4AZBA 4H41A 3N19B 1UD6A 3NIYA 3UPBA 2OKOA 1OX4B 1TX0A 4JIRA 4H3DA 5BRQA 4W9TA 3VZZA 3WCZA 3PTQA 5ECUA 4B5SA 3VZXA 2R1PA 3CZLA 5EA9A 3IUIA 2PDFA 2VCBA 2YA2A 2ZVIA 3ARZA 1KXTA 3CB8A 1POJA 1QJWA 2TYSA 3A4WA 2IXVA 1AL7A 4HCLA 4E2OA 6TIMA 1GQJA 1XFBA 3CNYA 4QIUA 1XPYA 3KRBA 1PIFA 1DE5A 5I03A 1AZ1A 3PK7A 1L8PA 4B90A 4HNOA 4JYEA 4E8GA 2AL2A 3BJTA 2D23A 3MMTA 5EB8A 4O15A 5J5DA 4XBKA 2ZX9A 1C29A 1FWTA 3ANUA 3VKCA 1UA3A 3LBCA 4JICA 3GAYA 1SZFA 2DSZA 4TUFA 1WYIA 2PWFA 2ZDSA 3CQ0A 3V16A 4PYSA 4RPPA 3WEOA 2VWTA 4K8EA 5FJOA 1ZHAA 1FWCC 2XG9A 3POCA 3TAKA 2ZFAA 4R34A 1NJJA 1GVSA 4ZENA 4UB9A 1HGYA 2YZ5A 2KAUC 3OG2A 5LXEA 4KEVA 3KL3A 1H51A 1Q5MA 3HM7A 5C2GA 3HZ3A 4AXKA 4HU8A 1ELSA 3DI1A 4ILSA 4PUJA 2CWXA 2VR5A 3KCJA 4HN4A 3OGRA 3NTYA 3SRKA 4BF7A 4N02A 2EHHA 5I06A 4W85A 4WZHA 1TZ9A 4N4QA 1V0KA 2Z6IA 3LI1A 2DIJA 3KLLA 2OOGA 3TCSA 5CPLA 3L12A 3ZMRA 1NY1A 3OLIA 3BO9A 3C6CA 3ARXA 4DEFA 1OC6A 4W4QA 1TRDA 3FFSA 3VGHA 5D33A 1PX4A 3KBMA 2A4AA 5AHLA 1LRTA 2VXNA 4PMJA 4GUHA 3FYOA 4HHMA 3URQA 4K1WA 4GACA 3VGFA 3BG9A 1WDSA 1Y5WA 2WM0A 4XWUA 4E2DA 4A8RA 4WK9A 4QXIA 4E8DA 3QEZA 1JF6A 2HV5A 3ES8A 4N9CA 4CU8A 2WHKA 9CGTA 1PS9A 4R3UA 4IMCA 1J18A 1WDRA 1XUUA 4IIBA 2DZBA 3FSTA 5A8QA 5K2ZA 1XL9A 2BTMA 1TJRA 3G77A 3W00A 3UESA 4NYUA 3QW3A 1E3ZA 2VCAA 3JS3A 4J28A 3CHEA 1IT8A 2G41A 1YLVA 1R9ZA 1XG3A 4H8VA 2I7GA 1O5RA 3C4UA 2XFWA 4U31A 3DI0A 3E38A 1XRVA 3GR4A 1A80A 2OMAA 1VFTA 2HPMA 2R14A 2FVMA 1OT1A 5C6MA 2X30A 3I10A 3IGUA 1H0GA 1SQ7A 3IVUA 1KRMA 1GTHA 3DUGA 1X98A 3KHJA 2V5JA 2O7QA 5D9MA 1NP0A 3MMUA 5CPOA 2P0IA 3ABQA 4OECA 4AY7A 2CFFA 1I75A 3WK1A 5A6BA 1W56A 1OT2A 1KRAC 4KPLA 3ONBA 1IXNA 4O10A 1U5HA 4XZWA 3NL3A 4FZIA 4IMAA 1WOBA 5HPOA 4N9EA 4PL1A 1TPW