3VGHA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltotriosyltrehalose
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
554
structure length
554
Chain Sequence
YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords Malto-oligosyltrehalose trehalohydrolase
total genus 189
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vghA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vghA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vghA02
3SE9H 1B0GA 4XVTH 1DE4A 1AHWB 4LARL 1UD8A 3WLWD 3AXLA 4U31A 3ARFC 2J6EA 3MV7A 2WMIB 4DFHA 3VI3F 4A6YB 1E55A 4LGSB 2A0LD 2CDGA 5I0DA 1N5YL 5TDOA 2EPKX 4X7TA 4OV5B 1RHHA 2VLRE 4ZS7L 5J56B 3RWIB 1KBBA 1AQ0A 3GJFK 1QA9A 5FYLL 3MTRA 1OQXA 2VQ1A 4HWEL 4HSQA 5A3ID 1R0AL 5GSRB 2EICA 1M04A 4PGEB 4FA8A 1DQDL 3K1DA 1SEBA 3LHPL 1BBDL 4NRXB 3BC9A 3IKCA 3IJHB 5JPMA 3RUGF 5ADPH 3BLKA 1B9ZA 4MS8D 5FYLD 4R0LB 3MYZA 2DYPB 4XPHH 3GYCA 5CEXA 4PY7B 1RU9L 2FJFB 1QA9B 2O9RA 4OCWH 5IHUH 3OKMA 2EDLA 4WW2A 5IMMA 1TQVA 3MSPA 1XGTB 5CSUA 4UT7H 5JLZB 2A74B 5GRVL 3AXLB 2NW2B 3P11L 1ZU8A 2BNQE 4KUCF 3EYFB 3OKLB 5LAXA 3PHSA 1T83C 4OTXH 3RNQA 2FATL 4H04A 2QR0A 3PABB 5FCSH 4JFQA 1XCTB 1OSPH 3N1MC 4YEEA 3BZFA 1I1RA 4DN4H 2YD2A 1E71M 5IB2B 2DQFA 3UBXG 1A7BA 2VN7A 1BPVA 1X5YA 2NY6D 1G7LB 1LO3L 1VSCA 4ZE4A 3DDGA 4W7WA 3BGMB 4F7CB 4XWGL 4D0DB 4CKVX 3WEZA 3QUMB 3S2CA 3UERA 2BX5A 5CJOL 4LVHB 4FHBD 5BRPA 4D6JA 2W63A 2J7EA 3AZTA 3RJXA 1UZ8A 1DUYB 2CIKB 4RFEA 3SUUA 4X0KB 4HKBA 4KRPB 1K3IA 1DBKL 4BA0A 1I3RB 2VCAA 1WV7T 4ATLA 4RDQG 3WIFB 4IHOA 2B31A 1J86A 1V8HA 3GI9L 1Q0YH 5HHME 1HHJB 1C1EL 1QBML 5CP7B 1XD1A 2WVSA 4NO2A 3BAYA 2ADIA 3EJZC 3VNZA 4ML4A 3I6KB 1NDMA 4Y1AE 4AY1A 2XKNB 2EYTA 3CUJA 4HIHA 2GDUA 1HILA 2ZUYA 4XGZB 2UY3A 2HRLA 1T04B 4OM0H 1E4KC 2D24A 4Z2JA 1DQQB 4I18B 4Y4KD 43C9B 3LN5B 4CN1A 3QUZB 4TX8A 1RIHH 5EPMB 1CXEA 3TIEA 3RKPA 1RHFA 2D7OA 4EE9A 1W72L 4P2QE 3CMOL 3VIKA 3BXNA 3Q3GB 3IJYB 3SQOL 2Z92B 3GMMB 2CPCA 3HMWL 5BVPH 4OT1L 4RA3A 3R8QA 4FLQA 1BWWA 1WEJL 1I8MA 5DEGA 5E2WH 1KIPB 5J12B 3RX5A 5GS2D 4FABL 4N0YH 3SBWA 5HBFA 3AIBA 4AL8L 3KDMB 4IEFB 5FO8A 5BW7A 3P0VL 3VRLE 3WXVL 1TVBB 4OZ4B 3C60C 5HDBF 4C83B 1GAFL 5GIRA 2XPGB 5BO1L 3SCNA 3VVGA 4P23B 4RNRB 1WBYB 3MV9A 2J8UE 3L1OL 3UTQA 3B9KB 5DQDH 2RR3A 1HHKB 5I73B 2DM3A 1T6WA 1JWUB 5EOCH 2CGRL 2G4FA 1XF4A 1EX0A 1NGXB 2X89A 4R7NA 3GSQA 3QXDB 2BOBB 2JIXD 4POYA 3CSBA 2ZG2A 2NLJA 1DWGM 4N8CL 2DDQL 3UCQA 2E8ZA 1MHPL 3UJJL 4HJ0C 4PJ5B 1JFHA 1JXJA 1CZ8L 1G7JB 1ADQA 4G3YL 3S37L 4F9DA 2HMIC 1Q9OB 4P2CG 3PGFH 3QZWA 3QQ4B 3G08A 2YA2A 4NRZA 2BSTA 4K68A 3QPQC 4QRPB 3TO2B 2VH5L 5M5DA 5F3HB 4OGAC 5IHLB 2QSVA 3HG1E 3P4NB 3GJFB 3IDJA 3MUHL 4EOWH 1CICD 5EN2A 4ODUB 5B8CC 5EU6A 2YFOA 3GMNB 4BFGA 2X4TB 5J89A 3SDXF 5GJTL 4IRZH 2Z31C 1UEMA 5IJKA 1M71A 4LRNH 3RGVB 1QSFD 5EMYA 4ZEPA 4YAQB 4HJGA 2C3GA 1PS3A 5ANMB 4F8XA 2GTWA 4OZIA 4ATWA 3D0VB 3ZDZF 4NQSA 2J12B 1T7VA 1IC4L 4PJ9D 3WUBA 3T0WA 4R97C 2OWXA 5FUZH 3O3UN 2D31A 3MQIA 2FIKB 2ZOKB 2AAAA 3AS0A 4ZS6D 1MRDL 5E2UL 4JO2L 5BRZB 5FYKU 3ZOAA 4BK5A 5CD5C 4OD2B 3L3IA 4MQSB 1F45A 2BFVL 1Q1JH 1CLYH 3DVGA 3TBWB 2GJ6D 2VXQH 2Y23A 1DWIM 2JIXA 3FRUB 3V5KA 1T83A 2YRZA 2IH1B 4F8TA 5C3LD 1TQBB 2HTKD 1R85A 3U2SB 2JALA 3BAIA 1IKNC 2EH7L 3FT3B 1L6ZA 4NQEE 3POCA 4KK5D 1JHTB 4WW2C 1YDPB 4NM8H 1Y0LA 4QEGA 1FJ1B 3LN9A 4X98B 1AJ7H 1JHKH 1U8OA 2YRPA 4GRWH 4GXVH 2A3EA 5IXEA 3S36X 3NZ8B 1J1OL 1EAPB 1KC5L 2JJSA 4HMEA 4WEBH 3HC0B 5ILTH 4ZE5A 5C8JA 3ABZA 3LRLA 5A8QA 1EFXD 5C0BA 4NQSB 3OJDA 4WSKA 4TUKL 4PTTA 5I66A 3UEQA 4PJAE 1LF1A 3WD3A 4AZ6A 4ERSH 2HJLA 1J8KA 4I1NB 1KB3A 2BC4B 2NY1B 4P2OA 4UNTA 1LO4L 1GGBH 4B41A 3WO3B 2EYRA 2FHFA 5FK9A 5KJRL 4AIUA 4RFOL 2DEPA 2RFXA 5DQ9B 4RX4A 5FOBA 4GLRI 3CHCA 5A8MA 1ZA3B 4Y4KA 2E9BA 4GQ9L 2EXOA 3Q5YA 1TZGL 1QZ1A 4I0CC 4PRPE 5D8WA 1JPTL 3IDJB 1VF8A 2FJHB 3NIDE 4FFZL 4N5ED 3MLSH 4X6DA 3VD3A 4JM4L 5IT2L 2W9LA 5IESL 4WY7H 3LEVH 4KJQD 2WBJD 1X6NA 3QQ4A 4PUBL 3WF4A 4XNMA 1BQLL 2FH6A 2NNAB 2GHWB 4HOXA 3EO0A 4PRDA 1EZVX 3ZLQC 2R56H 2FO4B 1TXKA 5DD6A 5F9WB 4E8CA 3MRDA 3H54A 2UY7A 2VLKE 4LDEB 4PRID 4Y5YA 2FD6H 4PLKC 3GMQB 1P4IH 1N59B 1INQB 1EERB 4Y0GA 4LCWA 4KI5F 3O41A 1QLFA 1FNEB 4JFFE 1W3KA 1JWUA 3SEPA 1UC6A 5GGSA 3ZKQD 3D5HA 1EO8L 3EGSB 5DTFB 3QB7C 2BVEA 2A9NH 1YMHA 3F12B 5I1EL 1NEZB 2WVUA 4E2OA 5E2TH 4ALAH 2JB6B 3MROB 3U7AA 3VFMB 3DARA 4HJJL 5JR1L 2LAAA 3P40A 1KXQA 1OF2A 1MCPL 5GNZA 4J23A 5HVHB 2Z35B 2VCCA 3E3QE 3H9SA 1I8MB 3T2NL 1AC6A 1HH9B 5J4MA 2H45A 1S46A 3BLBA 4AIEA 1U8OB 1EEQA 2Y36H 4NZCA 3NFSL 4Q7NA 4KKBD 3BSZH 1C5BL 2NX5E 4GAJL 1TZHB 3HE6B 1W8NA 3GH5A 3OF6A 3ILQC 4TUOA 5GJSH 2F7PA 4EVNB 5BXSA 2GK1B 5L2JA 2GIYA 4B7IA 2N4IA 2F58L 2PUQT 3S5LA 3MKKA 3O6MH 4Q0XH 4KRUA 2VXVL 3HI1A 3UTSE 4U2YA 1AI1H 3QOMA 4OQTH 1E0OB 4B9YA 1IC1A 1JF5A 1HIMH 4CNIB 3K4ZA 3T0EC 4H5SB 3V7MA 5AZEL 5D72H 3RL1A 2WW5A 5SV3A 5FECB 4Q74A 5DMYA 2OR7A 1ORQB 3KNBA 4NRRA 4K8RL 4IM4A 4LHUB 4L3EA 5ID0A 1EXPA 1R5IA 4QLRA 1ISXA 3QFDB 4NQED 1EK3A 2B4CH 5IBLC 3VFUB 1JDAA 4PRBA 4WO4C 3O2VL 3VWJA 3BD5A 2A6IA 1CDGA 2B1AH 3KPPA 3BIKA 2BOCA 1KB5B 5E8PA 3ZKMC 1RI8A 1SYVA 1FZJB 1NUNB 1UJ3B 4QT5A 3NCJH 3MLSL 1ACZA 3LKSB 3MC0A 2DF3A 5FYJE 3KR3L 5DHYB 5CUSL 1XGPB 4HUXA 4UOZA 5L6YL 4L4VD 3NCYS 4IPLA 2AJXL 1KR0A 5D2LE 1GQLA 1RK0B 3QDAA 1BWMA 1GZPB 2CLZB 4ACZA 3KLKA 4JFQB 5GRJH 1E28B 1Q9KA 3GIZH 4I77H 5C7XL 1A64A 4N8CH 3D4ZA 4O58H 3T1FA 3FB7B 3G5YA 4EUPB 1G7MB 3GO1H 1E0XA 3NFPB 2JJTC 5JLZA 2QSQA 4L3EE 4XNXL 5D8ZA 5ADOH 4IS6B 5EC2B 4ZXBC 5IG7B 5DO8A 1WDPA 1Q38A 4XVUC 2FBJL 1FZOB 3FO2A 5F1SA 2CMRH 4FP8H 2IAMB 5E9DA 2XZCL 4YAQA 3WKZA 5CEXB 1F4WL 4RAUB 2HLAB 3HZ3A 3CIVA 5IW6A 5KJRH 3ZTNH 4F37F 2CUMA 5CEZH 4Q9RL 5LBSL 1EDGA 1SEBB 3ARGB 5TQ2H 2WINB 3G04B 2FEEL 4JZ5A 4F66A 4MQXC 2BMKB 2Z0BA 4M03A 3HUJE 5A8NA 4HC1A 4S3KA 1CLXA 3GZKA 2J7GA 1OCWL 2Y6SD 1LO2H 1A14L 1KCUH 2BSTB 1P7QB 1VADB 5HVHC 4X9GA 2BVDA 3I6GA 1XGUB 5ID1B 2EADA 2GSJA 4MA3B 4GI6A 3NABL 1BM3L 4P4KD 3H53A 3QDJD 2A1WH 4WFFD 1GOHA 1WFNA 3RVTC 1MI5E 3ARRA 3KPSA 3TONA 5CXPA 4LCIL 4PRHE 4U3HA 3EMCA 5K33A 4PRNA 3X3FH 5KANI 5HYSG 3WJLA 5ABHA 4MJID 4GW1A 2J7HA 3QR2A 1E1EA 2ORBL 1EFQA 4KUZH 1TCRB 1YJDC 4CN4A 4BSWB 3PJSB 4L1DA 2P5ED 3DUUB 4M3KB 1FNHA 4GO8A 3VKKA 4F7PB 4B7LA 1QOKA 4LGRB 4EN3B 4HF5L 4Y2DB 3SQOH 4MLSA 2OSLB 4ONOA 5F71A 2RGMA 3C5SA 3PWJB 2CHNA 2BZDA 3QQ9C 3GI8L 4E42B 5FCUL 4QY8B 1S7QA 4XHQA 2FEDD 5D1QB 1KNOB 5I9QC 1IGJB 3AYRA 3QHOA 4Z77A 1NDMB 4X4XB 2N7BA 5E6ID 5IHZA 2VNCA 2VSCA 3WS3B 3KGRA 4CVZB 4MCZA 1MJ7H 1NLBL 4JHAL 4DWSD 4QCEA 1U30A 5DEGB 1MQPA 3MREA 1RZ7L 5BRZE 4XMPL 4F58L 4JN1L 2XG9A 2BY0A 3NFSH 4K94H 1V6XA 3PDDA 4IRJA 1LP9B 1DLHB 15C8L 4WWKC 1IGCL 1U8PA 4XP6H 5GS0C 3THDA 5ICYB 4X0NA 1R24B 3IDIB 4XNZB 4G6ML 2G3MA 5FA3A 2QSCH 1FE8L 3CUIA 3TP4A 2DTMH 2R9HC 2VXUL 1KG0A 4K3EH 4AIOA 2DQJL 3LEYH 3OAUL 4LLAA 3QA3B 4QGTA 4AIXA 4F7TB 3PWVB 5CCKL 2RCSH 1UZ4A 2UY4A 5AZ2H 4AZCA 4X5XB 1QLEH 1T0PB 4CD7A 2BK8A 5DZLA 2ZUVA 1L6XA 4XCYB 2DWEB 4KHXL 2OTWB 3RVWD 3FT2B 1HKLL 3O45A 5DZNA 3T2QA 4DGIH 3L7EB 3CAFA 3CC5A 1DCLA 1FL3A 4Y7EA 2EDDA 3PUCA 1QEWB 3WIFA 5LXGH 1TA3B 1HXKA 4MCZB 3TYGL 2DLEA 1P7QA 2HT2C 1NFIA 1B2WH 2GJ6B 4OD3H 3O4LD 3KPLA 4OIIL 4N0CD 4QHKI 1VBRA 3LDBB 4P2OC 1I1FB 4B15A 4L5FH 4TVPD 3OPZH 3P2TA 4TSAL 5HXMA 3RVUD 2Q7YA 4OF8A 3RX7A 4YFEA 4IDLA 3AMDA 5JIKA 4PGEA 1PKQB 1BX2B 1QLRA 2QQQA 4YNYA 2PKDA 4K3DL 3O4LB 1HEZB 2APFA 4GSDH 1FVEB 4QGYA 2B2XL 4G9FE 3HPJA 3MO1B 4LSDA 5EH1A 5FUZL 2VABA 5DD5L 1J0HA 3PP4H 4OM0L 4XC3L 1AP2A 5AG9A 5BXFA 4DEPC 5ABGA 3DX3A 1FH8A 4NQDE 2IH3B 3KPSB 3MZGB 3CPLA 3KPNB 2VAAA 1U3HB 5I6XB 2PYEE 1XGUA 5ID1A 1FC1A 3U9PL 2JTDA 3MV01 3QIUB 3P9MA 5I1GL 4LNRA 1FYTA 3OLDA 1WWCA 5BXRA 5ALCL 2BNUB 1WBXB 4PGDA 1Q9KB 1CIUA 4BKLB 1KUMA 5GGRY 1K9EA 1FPTH 4XB7A 3H9HA 3GHEL 3ZTNL 4Z7UF 1L4IA 3IJHA 3LQAL 3UZQA 3N1QC 1WB0A 4JZOB 4X9BA 3TFKC 3GM0A 1E43A 5DRNB 2VQ1B 1KN4L 3GSWB 1IGFH 3LRSB 3EYQC 4TTGA 4I8DA 4PJGB 4APQC 5D7IA 4HCRA 4UNIA 3KPPB 3QHNA 3MRHA 4Z2HA 4D9LL 3CXDH 1W0WA 4RA0C 2WMFA 4Z7VE 4MPKA 3UJIH 3E8UL 1HINL 1HHIA 1URLA 5SWZA 1OTUD 2D2OA 3RIKA 1TG7A 3SCRA 5EZJB 4BQ4A 4J27A 3IJSA 3M1BA 4JFZL 4WHCA 1KGCD 1QLEL 2DN7A 2AEQH 1LO5A 3RU8H 3SDXA 5JHLL 4XNZC 3TVMD 4KROD 4X5XA 1BFOA 3WF3A 3VXUE 4XVJH 5DRWB 4W70A 1NBYB 2DH3A 4AZIA 1P5VA 3A6BL 3HUJF 5JW3H 3O6AA 2R0LL 4O02L 4AYFA 2O5XH 3WH7A 4BQ6A 4U4BA 2KL6A 2R4SH 1D5BB 2HH0L 1N26A 4PJBB 5JPNB 3QFDA 1II4E 2AK1L 3VFUA 4Y19A 25C8L 1S5IH 3W25A 3GMLB 4XBPB 2EXYD 4PJCB 5SWQB 4D0CA 1HVQA 4UT9H 3QUYD 4MNQD 3MZTA 1Q72H 4POZC 1MW0A 3W0WB 3W5NA 5HHPA 5B39B 1MUJB 5E8DL 1JDCA 5JQ6L 5A2KH 4YDLB 3WNLA 4JZNB 1UUQA 5F9OH 2FECL 3HFML 4ODSL 2XWJB 1ED3B 3AB0B 6A3HA 5IFPA 4K8RH 4RFOH 3EJQA 1CDYA 2DQGL 4H20L 4EXPX 4Q22A 3S5LB 1EEZA 3UJJH 4D3CL 4LQ1A 3DWTA 1DUZA 1NOFA 3KPMB 2RJMA 2P8MA 1CT8B 1F4HA 4FFVD 3GMRA 5B4MD 3QCUH 1E0WA 4IMKC 4L3CB 3WJJA 3MRMA 5I71C 3B5HA 3F58L 3WJLC 5DK3A 1V6YA 4GW1B 1MHEB 5DD1H 3GSVB 4LKCA 3P77A 4RISL 4WTXA 4EANA 2BXZA 2C8NA 2OZ4H 2E9WA 2CPUA 3V4PH 4E8DA 1C16A 5EZIH 3QNYB 2R29H 2LVCA 2B0SH 1YPZF 4WUKL 1MVUB 1BM3H 2R0KH 1E4XL 4JDTH 1RPQA 3DXAB 2Q76A 4FQXD 1I3UA 3ZDZE 4V28A 4O2CA 4M8QA 1JHLH 2L7UA 4OKDA 2X70B 2IANB 4KJPC 3LCYA 1XIWC 1WGOA 4G8FA 3A6CL 1R87A 2OYLA 4Y16A 1ISWA 3MCKA 1OSPL 1AQKH 5FM4A 4XT1C 4V2XA 3SKMA 1AXSA 2WBJA 3L9RA 4R26H 3WFDL 4NP4H 4MXQD 4N0RA 4JRWA 1I7UA 1X5XA 5A16B 2CRIA 3EOYG 1W1PA 1VCAA 4AT6A 5A8PA 4ODSH 3RWJB 4LDLB 5C0CD 3U0PA 4TULH 3ALGA 3VXMD 2J47A 4DM1A 2CR6A 4JL2A 1QP1A 1F8TH 1G1CA 4Z7UA 1H2JA 4PJ8C 1MCJA 3V6OA 1QKZH 3IU4L 2QQNH 1I4FA 1XC6A 3AXIA 2JJTA 2RQ8A 3VFPA 5J3HC 4PTMA 3L6FB 5EO9B 1XV8A 1CFQA 3HAEB 4JANA 5FCZA 5C07A 1Y7VA 3RJQB 1FJ1A 1NFDE 1RZ8B 5HYJA 2EABA 4ZOCA 2E6PA 1GPFA 4WEUD 4IIQB 3L5WA 4NYLB 5DGQA 9CGTA 4XX1G 3MNWA 4I0PD 2WVTA 3CVHB 1RZGA 4RSVA 5HHNA 2EZ0C 1UENA 3FB5B 1VKXA 4JL1A 3CD4A 4OFYA 3BI9X 3GSNH 2W0FB 4WW1B 4YHNB 2V17L 4YHGA 2OI9C 2F8OA 3F65A 2BC4A 3BO8B 3FO1A 1KB5A 3WHE1 1I3GL 3MMEB 2F5BH 4N9GA 3W2DL 5FV2A 1QI5A 3PGFL 1HKKA 5IIEA 1JYNA 1CU4L 2DQHL 3VXRB 2P8PB 4ZAKB 1IM3A 1PBGA 1HKLH 5CD3B 2D3NA 2CDEB 4JO4H 4G8EA 5C8JB 1WDQA 3S96A 1A1NB 2DM4A 3HC0A 1GGBL 1P84K 4R8WH 5CINL 2OJEA 1PJ9A 5BV7C 5FKYA 2H32H 3RNKA 5JMOC 2EPOA 4N0YL 4MNMA 1E6OH 3VXRD 3MPCA 5D8JH 3ECBA 3RUGA 1T7XA 4HJGB 2QLYA 1CLZH 1SMOA 4PB0H 1XCWA 5A3IC 1JI1A 1VFMA 4EN3D 1RZ7H 3S88H 2DQIH 2XWEA 1OGSA 4LEOA 2X4QB 3W26A 3FONB 5IVXB 3BHBA 1QFWL 3ALWA 1DN0A 3QWOA 1N4XH 3UJTL 1MWAB 2WNGA 2I26N 1FNSL 1E6XM 3ARZA 3J8F7 3W24A 1PQZA 4JG0H 4YDJB 5E6IB 2O5YL 2WWCA 4OZGE 4UUJB 4M61A 2FX7L 5MHSD 1U36A 2E9JA 1OTTD 3GSNL 1A6TA 2N7AA 3WQ8A 2VOTA 4YO0A 5D7LD 1M7IB 4MDJA 4QHLA 5I8CB 3QO0B 2YPLD 3JV4A 1G7HB 1KYOK 5HJ3B 4RWHA 3CMOH 4AZ5A 3MUGA 3LPOA 3KVQA 2VXSL 3RIFK 2GQHA 1V3LA 4OI7A 1KCVH 2FGWH 2PYEB 1NQ6A 2VO5A 3ALPA 3QIWB 3MV7E 2OLHA 1KXTB 3ECQA 2ZG3A 3MV8D 5FYJH 4O4YH 4L8SC 1WAAF 2HRPH 4IRSB 1AD0B 2AK1H 2FB4H 1UM5H 3MLPA 2FD6L 1S5HA 4UTAH 4RMQA 4RMRA 2ZCKH 2ESCA 4Y5YB 4HW6A 4JFTA 2VX4A 1L0PA 3QGVA 1TZIA 4HA1A 3D39D 3MFGB 1HXMA 5I79A 1P6WA 3TPKA 2F19H 1BOGA 4LFHD 1E4LA 4YJZL 1OD8A 2R1WA 4NQCE 4EZMA 2R23B 1I8KB 4YO0B 5D9OA 3O2DH 2CUIA 3AHXA 1PEWA 5KZCD 1DLFL 2ICWB 5GGVH 4Y88A 3HG2A 3GSVA 1IMHC 2WMGA 4KMQA 1GJWA 3GBDA 5E6IA 5AWNL 4YEFA 1IQWL 1P7QD 1UXSB 3OX8A 3QZWG 5IQ7H 1TPXC 1XF4B 4JFDA 5GGQL 5SWSE 4FQXA 4DZBA 2A83B 3BX7C 4KQ3L 4MZ3A 4AEIH 1ODAA 1CL7L 1DBBL 2XSBA 3U4EB 1GOGA 3ZE1E 3BSZL 3SCWA 1V6UA 1MLCA 3VINA 2XOTA 3U6RA 2NY2D 2WPGA 2P5EA 4AQ1B 5C0JB 3BUPA 1JZ7A 4P5TC 3SKNA 4U05A 1NJ9B 2XY2A 1OTSD 3EJTA 3OJDB 3GJEB 1M05B 1T4KA 3BQUD 1IAOB 1QQDA 4Z76A 4IHOB 2V9TA 5C92A 4JY4A 4OUEA 4NZFA 3WDPP 1KWGA 1KTLA 1GSMA 1YEGL 5BV7L 1NGZB 1YEGH 2WMHA 4F33A 4GSDL 6CGTA 4CVXA 3BE1H 3ARBA 4LSPL 3RVXC 3I02A 2A3CA 1DL7L 3GNML 3DX8A 4NPYB 2Y24A 5DWUH 3K4DA 5SWSA 3V7AG 2Q7NA 1GQJA 1OGTB 4J3SA 4HWBA 3U9UA 2R69H 3OKDB 4LIQE 2ZE0A 5DUBB 1BAFH 1RULH 5F7FA 1JFXA 5IB2A 2KH2B 3Q1SL 5DO2C 4ZUVB 3CFEB 5A43C 2DSZA 1UCTA 4G6JH 1L9MA 3VW3H 1G9EA 3HNVH 3EHBD 3I6KA 2HWZH 1NOWA 5E8EB 5FM8A 4Z5RB 1NANH 2APVA 2V7NA 4C57C 2CK0H 4JEGB 1GGCL 5DI8A 4PYHA 1FFPA 3WFCL 5JW3L 1BD2E 3WY3A 2X6MA 2FIKA 2ZOKA 3B6SB 1AGEA 4GMTH 1FBIL 4U1KA 1UB5B 2Y2WA 4HDIA 2K7QA 3V6OC 3TJHC 4APQB 2ZSVA 4MHHI 1FVDA 1KJMB 3TNNB 4P7RA 4GKZA 1CQYA 2AV7B 4G80B 3RWEA 4H25A 2FJFA 3FMGL 5DRZB 4W7UA 5E0QA 1XR8A 4KU1A 3KPTA 5FUOL 3DMMC 2DIBA 4MMXC 4D0DA 4JB9H 4P2RB 3JTTB 2BSSB 4DN4L 4JO1H 5JPMB 1RUMH 4Z0XB 5DEFB 1RURH 2J8HA 4IRSC 3MBEB 4UR9A 3PWPB 3QCVH 1FL6A 1FP8A 2YC1A 2WLYA 5JHDE 4UQ9A 2VQTA 3CVHH 4JPVH 4LPXA 1ZT4A 5IVXE 3S34H 3KWXA 4OFPA 1MCWW 1J01A 4QOKD 4ALAL 3RNQB 4JE4B 3WIJA 4WCYL 5ETUB 5LG1A 1QHOA 5HVFB 3HE7D 3H55A 4FN0A 3U0WH 1AR1C 4Y4HC 1TR1A 4BZ2L 5IFHL 4DWHA 4LF3A 5E03A 3T65A 3W0WD 4OGYL 2JF6A 3JWOL 5JW4M 2V3DA 1UKPA 5GS0H 4WIWA 3QI9D 5K9JL 3HI5L 2CK0L 2FX8L 1D6VH 4WV1B 3HE7B 4HKZA 3HZVA 3CU7A 1WQVT 1RUQL 1XGYH 1YNTB 2LABA 5SX5K 3VFWA 2HTKC 3RDTA 3AZRA 4UT7L 4W88A 1XF2A 1RY7B 3DHUA 3CFDA 3NMEA 1OINA 2LU4A 3VJ6B 1LWHA 2X1XR 1NMBL 3MU7A 4WFGD 3RGHA 2Y25A 5L2KE 4ONGH 1JE6A 4PY8J 1ND0B 4EQ2A 3CC1A 1PIGA 1MY7A 3C60A 2CDFA 1F90L 2XPGA 2VLRB 4WKAA 3S35H 2RGLA 3CFKA 4HBCL 3IU3A 2ZWLT 5DYOB 1OD9A 3BKCL 5CKGA 4PJ5D 2IBGA 4LAQL 2X41A 1NBVH 3TO4D 3MBXH 3T2OA 1SMDA 2J7FA 4K23H 1TJGL 3LRHA 4F3FA 1UWXK 4KRPC 4H26A 2ZXBA 4IOIB 1T22A 4PJCA 5EU7C 2V5CA 3KYNB 5D2NE 1MNUL 1T21B 2GYSA 4AD1A 5TFSH 4Z7WF 1NCCL 3LQZA 2QQNL 4QRRB 4GI8A 4DWSB 4HD9A 1GIGH 1GVYA 4KI5C 2WC7A 4YPGA 5SWZD 1S9YA 4H8WC 1BVLA 3BWAA 2Y7QB 4YGVB 1AGBB 2H1PH 4PLOB 3TTOA 1FZMA 4I18A 3CZNA 3QWQB 2HG5B 3WSQH 4U5IA 4P57A 4K55A 3OR7B 5D1ZB 1OSEA 3OG4B 3GNOA 3H7LA 5I76A 3SCOA 3DO7A 3EBVA 4RCAA 5D1XD 4Y16D 2WCSA 3BISA 4XPTH 4HUWA 2EDKA 2W9DL 4OD1L 4LEXH 2VXUH 3KJ6L 4HIIA 3MJ8B 4Y5VA 5KAQF 3GBEA 3AM8C 1OWRM 5A6SA 3R0NA 3EOBB 2GFBB 4L8DA 3SE3C 4Z78A 5M3WA 1N0XL 1QBLH 2EC8A 2D0FA 1LK3H 2BY3A 1LL6A 3BAEL 1QYGL 4HHAA 1SMAA 2CDFB 3IETA 5HHQB 4E41D 4F8QA 5I1CL 2GJZA 2FYYA 5I74C 4IDJH 4HGWB 2ITDB 3HAEG 2ZKHH 1JK8A 4OCNC 2X1PA 3LKRA 1NC2B 3MOBL 4Y2DA 2V6HA 3EYUH 1JPTH 3BPOC 4GS7B 1D5XA 4I48B 4N0UE 4XH2B 2HWZL 1B0WA 1P6AB 4WU5B 4ZNEA 1EQPA 2GY5A 2P44B 3RWFB 1X5AA 3EYFA 5DT1L 3OGSA 2UZIL 5E2JA 4D6CA 1PYWB 2OXHA 2AJXH 1JAEA 4YXKL 5DHVH 3E2HB 2OI9B 2BRRL 2QMJA 5HPMA 3BRFA 4DCQA 3CPLB 1I7RB 3RRQA 4TVPL 1WZMA 1KJVB 3MX0A 4BELD 1A6WH 1NCDL 5A6BD 3FRPA 4HKJA 2N1KA 3B9AA 3MUY1 4UT6H 3RWFA 4RAVB 1FFOA 5JA8B 1HDMB 1NAML 2VLJD 5F7NC 3BZEB 4WU5A 2V9RA 3C5JA 1PG7X 3IFPA 5EA0H 1QVBA 3D85B 4X6FA 3T0EB 2QPUA 1HCVA 4TUFA 3WUEA 4F79A 1HEZA 5T1DL 4G6JL 4YZFE 1L7IH 5IR1B 2A2QT 2VZOA 1MCBA 5GXBB 1I9IH 4W5UA 4A2LA 1OAKL 4FXKB 4J3XA 2JEQA 1EZVY 1R75A 2A73A 2IAND 1I1YB 3PWLB 3DGGA 4RAUA 5T1MB 3SDCD 2J4WH 5I1JH 2CRYA 3KPLB 2UY2A 5DMJB 5F7MC 1MYRA 3IETB 3HPLA 2WAGA 1P69B 4M4RA 3LKOA 5FHBH 3C6LB 5JOPE 3DX9B 1T6VN 2ZIDA 4C56D 3MRCB 1G9NH 4PLJD 1MQKL 3O6LH 4ZUUA 1UYWL 4PJEB 4LGXA 1MAMH 1NC4D 1P7KB 4HC1H 1TE1A 4HC1L 1MXGA 1W72A 2B1HL 3OAZK 2CIPA 3PE9A 1GGYA 4GAJH 4JY5H 1D6EB 5CKAA 3V0WH 4XP6L 5FHAH 5F6IC 5DFAA 4Y5XA 4U33A 5HI4D 3S34L 1O6IA 3O2WL 3UESA 3O2WH 5HYQB 4XPTL 3BDBA 2YPLA 4ODWA 5IJVA 1XGPA 3DX8B 3CSGA 2NX5A 4OB5L 3CDGB 3TCLB 5BZDB 5DK2B 4OTXL 4KKAC 1PVHA 2IAMC 3ARBB 4LMQI 4CADB 4HWZB 1WBZB 3IXAB 3B8SA 4FQ1L 4KROB 4S11A 2BJML 4YC2B 1IQDA 4BH8A 5ISZD 1E6JH 1QI0A 3MYJB 3WEXB 3KPRA 1KTLB 1JGEB 3PF2A 4PRBB 2JK5B 4GJTB 1YPZA 1QBBA 3VRJB 1T1ZB 4J3UA 3UTSA 1RSFA 3S5YA 3KL3A 3QHZH 4CJ0A 1WDSA 1V7NL 1B3XA 1CTNA 4LPYA 4MB1A 3D5OF 4GOSA 4NBXB 1CGUA 1UWSA 4WHYH 4KZEL 4Y19D 3SKNB 5MERB 4KZDH 3LN4B 4FQQA 3MLUL 1G0DA 4HK3J 2AMGA 1RUKH 3QUYB 2EDYA 4JRYA 1KEGL 2XN9E 1TETL 5D70L 3PL6D 3W9EB 4P9ML 4PJDF 1QFWM 2YPLE 3U4EA 2NT1A 1J87A 1BP3B 4GZIA 3QUMH 4E4PA 2BRQA 3UEZA 1PDKA 3QUXC 1TVPA 3FKUS 4RGNB 3VX1A 4OGXL 3CDFA 4QCIB 3GMPB 2CKRA 2JB5L 1HQRB 4NJAH 2VZTA 3BAJA 1GHRA 2O5ZL 3MNZB 3BQUB 5D2LA 4OZIE 5A95A 2RCSL 1EMTL 4QLKA 4NNXA 3WQ4A 1JGUH 2VRKA 1U95B 4Y89A 4C56E 4FXGB 4P5TB 2C9AA 2ZUXA 2BERA 2E7LA 4M8VA 3ETBF 4GRWF 2ZZUT 3S4SG 3FFCB 3QI9A 3TH3T 1FVCB 4H41A 4F80A 3EJUA 5F7YC 5LYRA 3HG1B 4PJIF 3LVEA 3GXPA 4GI9A 1ACYL 2WINA 4ZDHB 4UQCA 3BUTA 1H11A 4JHAH 1KJ2L 4GXVL 4P2RA 2DI7A 1QSFE 3ME0A 3DRTB 4P59L 3Q0HA 2F5AL 3MCLH 1MCCA 2C5DC 4CUCA 4KH2A 3GSOA 1QPPA 1FVDB 1JVKA 1KJMA 2VRAA 1G0XA 2PBOA 5T1LB 3MLXH 1JGDB 5C0CB 3QEGH 1XR9B 4XNMB 4Z95H 3QUZC 2YZ1A 1BIHA 1FFPB 5BOZG 2E3VA 3QG6B 5E4EC 2E5EA 3V6ZA 2EIZA 4J28A 1OAZL 1GNXA 5DJ2A 3STBA 3C5ZC 3ARGD 3MBED 3PGDB 4BSVA 1OIMA 1BEYL 4YIQB 5I18L 4MD4B 3F4VA 3KL5A 3U9UB 1BZQK 4GAYB 4FQQB 3PWNA 3ULVE 3RIAF 3LD8B 4X6EA 2XZQH 3OXSA 5JUEL 2YSSB 3HMXL 3OZOA 2QHRH 3DNKA 1B2WL 5GNYA 4GINA 5CZXD 1HOCA 1UEYA 4ZFOA 4QTHB 4PP1C 4G8EB 1G84A 1WFOA 2VXVH 3AIRA 3HLAA 1JGEA 1ZLWK 2XGBA 3QR3A 1T4KB 1DEDA 2IPTH 3ILPB 3MCLL 4Z7QE 3OKOA 5LA2A 2HTLC 1HI6B 3KLAB 5E00A 2X4UB 3OHXA 1KFWA 2JKXA 4Y4HB 4L4PA 3V0WL 2X4PB 2P5EB 3KZSA 1HZHH 4DKEH 3BVUA 4A3YA 4PJHF 2VUYA 35C8H 4ORGB 35C8L 4CU6A 4M6NH 4NZRL 1DLFH 1YYMH 4ODBD 3STZB 5E24E 1MLBA 5DGRA 5HHNB 1TQCB 4HUNB 3D87B 2MCPL 3D69B 1E6OL 2NY6B 2NY3C 4XX1E 4DZBB 3PGDA 2B20A 3WKMH 2I9LA 5ADPL 1QFHA 5IM7B 3TBWA 3HE6A 3VILA 4MNGE 5GS0L 3WBAA 3TO4B 5I1GH 1K5NA 1K4DB 3KJ4B 3SO3B 2DWDB 5TE6H 4UTFA 2DLHA 1DBMH 4OM1H 2XA3A 4JR9L 4L1HA 4IPNB 2D31B 3U36A 2OK0H 2VIRB 3TZVA 2F8XC 4WEMB 4I2XB 3M46A 1I7ZB 2AQ1A 5AY7A 4KRTA 1MFEH 3CFIC 3W6MA 3PWLA 5T1MA 1T1WB 3QIWC 4G7YL 3F5JA 1NMCB 3FZUC 4PJAF 3MROA 5LJYH 3VMNA 2OW6A 3O6KL 4XZUA 3KLHC 4W6YB 1HX0A 3SOBL 3MRNA 3GSUA 4E0RA 4E5XA 2AJ3B 3MCKB 1ZHNB 3D85A 4X6FB 5D2NC 3L9RB 4L8BA 4AG4L 4Y5YC 3MV8B 1LP9E 3N04A 2FR4A 2EDWA 3FB6B 1JNHA 3OB0H 3WL1A 3LMJH 1V7NH 3FCTA 4M6OH 1CGWA 4LKXA 4HK0A 3T3ME 4D8PA 1I9JH 1MVUA 5T1KA 5CBAB 2PO6D 2CK2A 1IFHL 4MAYC 4J3VA 4NNXB 3O3AA 1LP9F 2VE6B 4OUOA 3LH2H 2X1OA 1ZMYA 1HQRA 3P0YH 4XH2A 3V4UH 5IB3A 3D52A 1I8LA 3GBNL 3FB8A 1PSKH 2XI9A 1WC7B 2HKFL 4R6UA 7FABL 5MENE 2AK4D 4MNQA 2XRAH 4Y4KC 5SX5H 2H8PA 4KWUA 1UKQA 3DVFA 1RH9A 1DN0B 3QWOB 1FE8H 5GJTH 5FOBB 1EVUA 2X4QA 3TN0D 4KKCC 3B9KD 2WSKA 3BPLB 4WI4A 4BQCA 4Q9CA 3EJSA 4GBXA 3VSVA 1KXVA 1JGLL 1NUGA 3IS0X 4KFZC 5DFVC 3S35L 4DQOL 5EIIB 3FN9A 3RMEA 3WDHA 4JZNA 1FG2A 5I9QB 3QDJA 4KXZI 4HFWB 4UQBA 2FBJH 4D0CB 2ESVB 4YDVA 1BECA 3FHAA 4OKVB 1D7FA 4M48L 1S9WB 2MFNA 3MLTB 3WL0A 1WVZA 2DT1A 1QSZA 1ZHKA 2CKBH 3C60D 4PJFA 3OLEA 5I71B 5DJZA 4Y4FD 3BN9D 3BXNB 3TBTB 3IKKA 5LGJB 1BBDH 3SCTA 1GIGL 1JTPA 1S8DB 5DVNA 4F2MB 4YHZL 3JWOH 3F58H 3Q6FA 4NO0B 1ZS8A 5HY9B 2WP3T 2YMXL 4Z9KB 3ULVF 2ZCKL 5F1IA 2WXDM 3RWCA 5GRUL 2XN9B 1DQQA 1KJ3L 1G94A 1OAXL 5DHXB 5HYQA 5I1AA 2ZXAA 3V5KB 2AJUH 4O00A 4PJHA 1D6EA 3FN0H 5IVZA 3T4AB 6FABH 3WUFA 2CJUH 1Q4NX 2G2RB 3G6JF 4UQDA 2YN5A 1QO3B 4U6VL 5SWZB 1W0VA 1NAMH 3ZIZA 3HAEA 1F90H 3UCRA 5IBTL 2W0LA 4J4PC 2YJQA 4P48A 1T5XA 2QSTA 1BHGA 4HP5A 4HKBB 3C6LA 2D7QA 5JOEA 5BVJA 2EDBA 4PLNC 3DHMA 3FQWA 2FYVA 2WHJA 3HC4H 4RWYL 1IBGL 3NCCB 4QLJA 1B4JH 5D9NA 2Z31A 1B3ZA 3UYOD 1ONQA 3DMMB 1N0LA 1ZAGA 4P2QA 2AXJA 2PF6A 5DUPL 5KVDL 8FABB 3VFWB 5IR1A 1NPUA 5CSGA 3WQ5A 1E6RA 1G9MC 4MCYA 1SVZA 3S3PA 4NBYB 1DBJL 3WD5L 4BKLA 3BVTA 3M17A 2D9CA 3K46A 2X1WL 3IJ9A 4N1CA 4XWOC 4PMZA 1H5BA 5DFTA 4E41B 1JYWA 4O51B 2GK0A 4HS3B 4PJ9C 1TJHH 1Y6NR 2VAAB 3MRLA 1QW8A 2DD8L 3AMGA 2Y06H 3FO9B 5EUKB 2W91A 1U3HA 5IUSA 1WNOA 4UFIA 3BH9A 2XT1B 2H9GA 2MHAA 2XFFA 3CZLA 3MRFA 1WISA 2GY7B 2HFEA 3A24A 3M7SA 3N1GC 3RA7H 3D39E 4NKIH 2H26A 4WV1C 1CLYL 4EBQL 3W11D 5IFHH 3MSGA 4ZNCD 2VX7A 3U46A 3JV6A 2B8OT 3GMRB 5DEZA 2V7HA 4KTEL 3WEMA 2IGFL 3N0PB 5EULV 5GSRA 2Q7YB 1JF1B 2IC2A 3MA7B 1BF8A 3CLFL 2DM2A 1EUTA 4GRLA 5IB5B 1WEJH 3SE4A 2XWJA 5I1JL 5DXWA 3QDMB 3GHEH 1LL4A 2GJ6A 3O9WD 2HH0H 3O0RL 3ULUL 2V5SA 5I73C 2IQAB 2OJZL 3B6SA 4YPJA 1INEH 1NP2A 3V79C 3T4YB 3CSYA 4TSCL 1A7OH 4XMPH 3BKJL 4K7FA 4F58H 1E15A 2BNRB 4H8HA 4LLQB 3MJ8A 2Q8AH 5IVZB 2VLJE 4PRPD 3HNSL 5A3HA 2JELH 5E99L 2YUWA 3HG5A 4TNVK 3H7BA 2AJUL 4JRXB 3C2SA 3L3KB 2AERT 3BE1L 3QULB 3EOTL 1XF3B 5IB4B 1JZ8A 3OR7A 5D1ZA 3MJ9A 5HHXL 1XGRB 1XF3A 1U2YA 4LVNB 1NUFA 4L4VE 4K07A 3Q6FB 3OKEA 1SY6A 4GKNB 5DD0H 4LCCA 4N5EC 1OD0A 1RZFL 2Z91A 4AY0A 4YHLH 1A21A 2NXZD 2APBA 4NN5B 2ZX5A 4HIHB 1QNRA 1AKJD 4AD2A 1G9NC 1XFPA 4GRLD 3X12B 5K9JH 5KG9B 3SY0A 3KYKH 1Q6EA 5FYLE 4JJHA 4U6HB 3EIFA 4ODTL 3DXAE 1EGJH 4AZ7A 1U42A 2ARJB 3MJ9H 4UB0L 4WTZG 3VGGA 5MEOB 2NR6D 1NJ9A 2WIIB 2XIDA 5DJ0B 3O2LA 4PG9A 2M2DA 5BYWA 2VLJA 1UM6H 1J8HA 4LSSL 3D25A 4M7JH 2RAMA 3B5TA 2LFGA 3SE9L 4W81A 1LQ0A 4X4XA 2X7LB 4PMUA 1DBJH 1FNGB 5JXEC 4AISA 1E4WL 3FAWA 2ZX7A 5ISZB 3EDDA 5D1QA 2GTZA 1XHGA 4OF0A 1ZWIB 4MA7H 4TRPL 3OAZH 4RRPA 2ESVE 1MQQA 2H8PB 2X89D 3CZKA 4OJYA 1UKOA 4MNQB 3W38A 2OSLA 3T8XA 2Y06L 2HFGH 5L8LB 1CFSA 4IJ3C 5ALBH 1OBAA 3ARFB 2XICA 1T66D 4AMKH 2BNUA 2CKBB 2L0DA 4OAWA 3BH9B 1TPXB 3P9MB 3QIUA 2XV6B 2IMMA 2UWEA 4HS6B 1IEAB 5D9PA 4LL9A 3P4OA 3I6GB 1US3A 3WQVA 4Z2KA 4Z0BL 2DQCL 1VADA 1A1MA 5SWZE 2Y9RT 5ADOL 1SJVA 1WZ1L 4OCXL 3VW3L 1MQRA 1LGVA 4D72A 3HRZA 3T09A 5E94A 4D1IA 2E4TA 3B9DA 5I19L 4K3GA 1YEIL 1OAXH 1F3DJ 4ZQKB 3BEWB 2ZJSL 4MDPA 1CFVL 3MBEA 3UX9B 5L7XL 4LOUD 3RTQD 3EYSH 4NC1E 4D0BB 3LIZL 3II1A 1FL6B 4MJ5A 1B88A 3NCMA 4IRZL 4M93B 3RHWF 2HLAA 2VZUA 5HGDB 3ZKNC 4NI3A 1XR8B 3DXAD 3QP3A 5T1KD 3TTQA 3VIGA 1MIML 3T0ED 3VXTB 5C6WH 4XZWA 3X13B 4UQ2B 5HDOA 2W07A 2ZXQA 5IB1B 4PBXA 3NJ3A 2P5WE 3JTSB 4JHWL 5AYBA 1MQ8A 1TQCC 1RUPL 2XTJC 2J25A 5IBLD 3MJGX 3AIUA 4OIBA 4JFWA 3HR6A 5D6DA 5DVLA 4EUPA 2X4RA 3G5VB 2NY0C 5GS0D 1C7SA 4I3RL 1IRAY 2PWGA 3ALXA 4Z5RA 2BSRA 4OFYD 3LKPB 4PY8I 5IVXF 5CJXA 2DMCA 4QYOB 4BH7A 1F4YL 3OKDA 4XXCC 1E72M 3U9PH 3OXRA 3T2NH 1JGIA 4HUXB 2X4OB 2ZICA 2R2BA 3WFHA 4XTRD 3PTQA 1LMKA 3GIVB 3TPUA 1S7TA 1S8DA 4M1GH 4NN5C 2BNQD 3SCMD 2C3XA 4F2MA 4AIZA 4TXEA 3VWJB 2YZ8A 1UJ3A 3ULSA 4FQHA 5E00B 2R0KL 2D20A 3D39B 4RQQA 1KLFA 2P5WA 1ACYH 1XZ0A 3U7WH 1T3FA 5IK3B 3FFDB 4YXLH 2XJ7A 5FKPB 4H8WL 5EFIA 4HWNA 4X9IA 2D22A 1AGFB 3PHAA 1UH3A 4ZFOB 4H5SA 1OGAA 3FQUB 4P4KB 1AE6L 3QDJB 4MD0B 2H3NB 1M05A 5IBUG 5F7EL 1JAKA 5BV7B 5C0RL 4HF5H 3U6RB 2YD4A 4MB5A 2GCYB 1B3VA 1WIUA 1OAKH 4WFGE 2B39A 4N0UB 1W9VA 1H3UA 4HH9A 1WZLA 5HYJD 4E42A 2NYYC 3PWUA 3VXME 3G6AA 4X7EC 4XC3H 4OLUH 3I3EA 4G7VL 3CFJB 3I2CL 2XPKA 4TUOB 2UVFA 2C7UA 5E56A 1UXSA 4Y2DD 4QRUA 1DP0A 3ZTJG 5L2JB 3BP4B 1I9JL 3WMCA 1UB6B 1MCKA 2NTFA 2E7BA 5GGTA 3ZKSD 1YN6A 2UUDH 2X1QA 3QUKA 5JW4Q 1I8KA 1ORSA 1QSEE 2VVSA 2Q8AL 1S78C 3K2UH 5C0CA 1YEIH 4MD5B 1GL4B 5DSCB 2DJUA 5CLWA 5AC4A 1C8PA 2QHAA 1LEKB 2CHOA 1BZ9A 4HWBL 3SGJC 3WDQA 2O5YH 1WP6A 4G6MH 1IEBB 1JNHB 4LCIH 5A94A 4LCWD 2FCBA 3RWJA 4BF7A 4UT6L 5CJQL 4LARH 4RMSA 1CDBA 2X2IA 5A16A 1EUUA 3BH8B 3N9GL 5D5MF 5KVGH 3A6CH 1DVFB 1JNEA 1S9VB 3TBSA 1AI1L 3VDCA 4ZFZA 2YA0A 3FHQA 4JQIL 2AJ3A 3VXQB 4WUUB 3SGEH 3WY1A 4FTVD 2DL9A 1TJIL 3TT1H 4BQ9A 1HYSD 3VXPA 2EEXA 1B3WA 3QHMA 1KQYA 2PW1A 3RWDB 5LA1A 3G6MA 1LD9B 4JKLA 2QBWA 2VDLL 3SGDI 1CGYA 1Q9WA 5MI0C 1UXWB 1ZJAA 3UPRB 1KLUA 1AXIB 1TMQA 5CJ8A 1CPUA 2JCCB 4DWSC 1MSPA 3ELAT 4Z7WA 1O7SA 5JHDA 1KV3A 4MDJB 1LDSA 2OYMA 1V0KA 3OR6B 4GRWE 2WHMA 1B6DA 3BVNB 3QO0A 1ZK9A 2NXYC 4F9LA 4UTAL 4ESKA 4UOQA 1CFNB 4MA7L 2ZUWA 4TRPH 3DDFA 4V1DD 1K9FA 2J8OA 1BJ8A 2WM0A 4ODXB 1AHWC 1LEIA 3RUGE 2FJHA 4GZEA 1ADQL 4QLLA 3RI5K 1A6VH 1ODUA 3THCA 3D18B 4ZD3L 5AAWA 1RJYA 1MEXH 2VR4A 2PO6B 5INCB 3GIZL 4L4JA 4R4NC 3NA4A 2ADJA 2YFNA 4URTB 3VIPA 4U1JB 2PTTB 3SUVA 4OI9A 3U7YH 2F53A 2ZX8A 4QXGL 3OZ9H 5EZLB 4X5WA 3B3IB 2DYPD 4UV7H 3FQUA 1D9KA 1UA6H 4PRHB 5JA9A 1TJGH 1U58B 1OD7A 5F9OL 1ZHBB 4WI5A 1N5AA 1KJ2B 1YY9C 3DYMA 4C4KT 2YBTA 3KPRB 3IFOA 4Q9RH 2R1XA 2P8PA 3NVQA 4RMTA 4ZAKA 1PW3A 5TQ0L 3C6SA 2X2JA 2H32B 3QIUD 2OR9L 1ETZA 4NJ9L 4MXVE 3FO0H 4MD4A 5FD0A 2R2BB 3OJVC 3UG4A 4PCSA 1MCEA 4WFHE 1BYCA 1JNLL 3BZ4A 3RZCC 1EHNA 3VWKA 1AXTH 1RJLA 1ZVYA 4AYSA 2MNUA 1MRFH 3MUIA 5K59E 2JIXB 1HINH 3AHTA 4JG0L 2QV4A 5KBNC 2B2XH 1WO2A 1INDH 5ICZB 3MXVH 3U7VA 1P7KA 5GRVK 1I85C 4NKIL 1CDUA 4LSQL 5T1LA 1TFVA 3H2WA 1I4FB 4P7NA 5L0QB 3P30H 2XN1A 1SBSL 3PNWB 1W1TA 4CW1A 1UWGH 3RZWA 3D48R 1YC7A 4PP2B 4OZGF 3TWCH 5IV2B 3OKKA 1U33A 4Z7UB 2F53B 1X5JA 3IF1A 4I0PA 3HAEH 1YZZA 4Z18A 5H35B 3U5UA 1K9TA 3ROOB 3HG4A 3MLVL 1W3JA 4YFLF 4YR6A 5F3BA 4H20H 4HUKB 4J7RA 1UG9A 4U1NA 3QIBC 1WITA 3M07A 3LIZH 5DR5L 5JHDD 1LEGA 3NCEB 1CVRA 3IVKB 1JYVA 1A7NH 4QRTA 4KPHH 5E9AA 4LHQB 5D2NB 1OW0C 3TCXA 1KN4H 1WBXA 4JVPA 1B4RA 4X99A 4LPCA 5ESVB 5E1QA 1HP5A 3BP5A 1ZANL 5FGCB 5HGHA 5GS1B 5I3DA 3P0YL 3V4UL 4C54A 4OCWL 2Q87A 1RAMA 5ABDE 3RY6A 5FGCE 5C71A 3VIIA 1HWGB 4U3AA 3VSTA 3TLRA 5CD5D 5EO0B 4Z7WB 2YPKB 2CKBA 3O4OB 1QPKA 3GMPA 4B3LA 4KROC 3AROA 2EPMX 3L3HB 3QJFB 3A21A 2PXYC 5GRXG 3T8XB 1AQKL 1MFAL 3VXPB 3MLZL 2ARJQ 1NGXA 3TA3D 4HFUH 5KVEH 3JWNC 3B4NA 1J0JA 2VXTL 2OW7A 4C83A 4HV8A 4L9LB 1JN6B 3WFCH 2FYYB 5T3ZH 1FNGA 4PJBF 1E3ZA 4NT6A 3AZSA 3EOAB 3ARDB 3Q5OA 1S7RA 4XPGL 4NQCB 1CLCA 1PG7H 1CLVA 3WFEH 1TVBA 4PJCF 1TA3A 1XGQA 1KIPA 1UM6L 3J7HA 4Z8FL 3QUYC 5CGYC 4NIKB 4ZFFB 3E6HA 5B39A 4LIQL 4JO3H 2F74A 1T1ZA 1WCQA 4OIIH 4TUJB 5JIHA 1H15A 4JG1L 1T3FB 4YBQD 5IK3A 2BNJA 2ENYA 1AQMA 4ATDA 2IFGA 1IL1A 1LWJA 1CD0A 5CP3H 3CUHA 3GRWA 3E3QC 3IJYA 4UNVA 5GGVY 2J6EL 3PL6C 5A6JA 5HVGB 4AIZB 4CADA 3WMBA 3CLEH 2EDNA 4KK9C 1G9MH 1XT5A 3TIEB 1FO0A 2ITCB 2WQ8A 4M43L 3I50H 4P5MA 4I3GA 5E8NA 4GAFB 1MFBL 1NCBL 1YNLH 2A38A 2QQKL 5CAYB 5JIIA 1KBGH 2AGJH 3AOFA 4QYOA 1NBYA 5ACMA 3BUYA 3B8YA 3VFNB 5JW5A 3W53A 1F97A 2HVJA 4M82A 4Q2ZA 1FZKA 3SGEI 3W81A 3NSNA 4HJ0D 3UDWC 4JDVA 5KVEL 2FZ3B 4K2UL 4XPHL 2Q3AA 3V5HA 1OP5H 4OD2A 2YOCA 3E6FB 3DIFB 2YD6A 4LLWA 1WF5A 3CPUA 1I3RA 3GI8H 5DA4A 3VFSA 2P24B 2XM2A 2IBBA 3TT3L 1J9YA 1PG7L 3VXUA 4OGAD 5TQ0H 2QHRL 4FFWC 1KNOA 2VL4A 1AVAA 2UZYB 1S7QB 2HYMA 5IOPA 2IALB 3GSWA 3QXUA 4YX2H 5FFLA 1MHCB 1U8MB 2HLFD 5AYUH 2NTSP 3JVGA 3RVVC 1N3NA 5IROA 5GHWH 3DETC 1HP4A 4X4ZA 4TN9A 3QEQB 3S6CA 4IOSD 1FAIH 1GJIA 1Z9LA 1GOWA 4K3DH 3GBLA 4AM0A 3ULUF 4NCC2 2GVYA 1J0YA 1B0RB 1BBJB 2ED9A 3GJFA 2WC4A 2J8UA 4PJ9B 4YUEL 5FYLH 4ELKB 3PBGA 1MHPH 3QNZA 3H42H 1BAFL 3O6FB 3IAGC 3G08B 1Q0XH 3AIEA 2HT4C 1FH5L 3RTQA 3QZWB 3FO9A 5EU6D 5IQ9B 1T03H 4FNRA 4YBLC 4OGYH 2ERJC 2UWEB 5J6HB 4NNYB 2X9XA 4OAWB 1WZ1H 4GRMB 4OCXH 4FFZH 4PJ7E 3VM5A 4G8GA 1U2HA 2FX8H 2DLTA 2IH3A 1AQHA 3VXTA 4FRWA 4PJ9A 3ZQ9A 1A6UL 1H5BB 3PQYD 4UINL 4XHJD 3WNMA 4KAQH 4ZO9A 4FNTA 4JR9H 1U8KB 1T80A 4Y8AA 4OM1L 2XKSA 3D9AL 5J9PB 2AP2A 1RIVH 3RHWK 2YC1B 4R0LA 5IKCA 4K7PL 1OM3H 4MJ5B 1K8DB 1W3HA 1CI5A 5B22A 1INDL 1JWMB 4MGXA 2VLKB 1GGIH 4ZQKA 4OBRA 3TN0A 5I8OH 3KJ6H 3RWIA 5C0IA 4FMFA 2ICWJ 5C1MB 5EBLB 2NY1C 3HRZB 3FN3A 2OQJA 1R3HB 3IK2A 2WIIA 3ES6B 3RBGA 1X4XA 3U30C 4P2RE 4ZXOA 2HTLD 4B16A 2YR3A 5TF1H 1W0VB 5DD5H 3S5ZA 3QDMD 3EDKA 3A22A 1QFOA 5KG9A 1ITCA 1CXFA 1R3JB 3CC5B 3HMXA 4FG6C 3L7EA 5HYSA 2VI0A 3N12A 1CR9L 3O9WB 5GGVL 1MF2H 1U92A 4M6MH 3CFEA 4UAOC 4XCCH 2IBZY 4FMKA 4OLYL 1RP8A 5A6KA 5ABFA 1KFAL 5LCVL 3IDUA 4KGJA 2PYED 2R1YA 3QCUL 3WDRA 2B5IC 5DHYA 3BEVB 3OF6D 3D3VE 5C0DA 4Z7UE 4H1LH 4OCSL 2OBGA 4YQXL 5B3NA 1V6WA 3D3VB 4LLYA 1WWBX 5ISZA 3VMPA 3NPSC 1U93A 3BAWA 5C07D 3ARBC 3P9LA 4P46C 4X7CC 3N85L 1S7UA 5I78A 2E27H 4DW2L 5JNYA 3QRFM 2KKQA 1QRNB 1GZQB 3G6DL 3T08A 3VXUB 3RWGA 6FABL 1QVOA 1J05A 1QPXA 4G7YH 3CSYB 4JZJC 4ONGL 3GSXB 5L88L 3N9KA 3L3GB 2F74B 4P4RA 4F57H 4OLEA 3BKMH 4LLVA 1RFDH 4YDIL 2G60L 3BAXA 3QIWD 2HN7B 3T0VA 3SDDD 2O9OA 5JNYB 3LS4H 3WS3A 1RZJH 1HKJA 1XAUA 1YEHL 1C8YA 3P9LB 3BCFA 3UTZA 5M94B 4M1RA 1XD0A 3CVHL 4JPVL 4HPYH 4N90E 4PJIB 4AEHH 4HK3N 1HH6A 3G5XA 1CE1L 4U2ZA 4AJ0A 4I9WD 4XNQA 1NWUA 5TDPB 1OCQA 3VJ6A 5I30L 4YHPA 4HOZA 3VIMA 4EN3A 5DZOA 4AK1A 5CEZL 2XTJE 2JFEX 2P42B 2COQA 2ZUUA 2LU7A 4UQ3B 2R39A 2C4FU 3IU4H 2OL3H 3CUFA 4F9PA 3S36H 3W39B 1FIGL 5A40E 4BSWA 1MREH 4AZ8A 5HHMD 43CAB 1NEZG 4GG6A 3AQUA 4NC1C 3OKLA 4FQPA 4LRIA 5IHUL 2MHAB 1LE9B 4YBLB 4S1DD 1H3PL 5EZIL 1NGWA 2Q1EA 1HKFA 1CGVA 3KPRD 4HU8A 2IEPA 3IFNL 4OZFG 2XQYG 3ES6A 3WH5A 1VFFA 5K9KB 3QHFL 3TBYA 2YLLA 5GISH 1DSFL 4NQEB 1PZ3A 4HOWA 4XP4H 3Q2CA 3HU7A 1IGFL 5DT7A 4NZTH 2J88H 3WFBL 5I1KH 1R5WA 2G60H 5CS7A 1BFVH 3P30L 4URIA 4QXGH 2IXUA 5CZKA 4OZFB 3K2MC 5L9DH 3M45A 4L8SA 5K9OB 2DQHH 1PLGH 5IKCB 2ZCHH 3OG2A 8A3HA 5TJWK 5DRZA 3QISA 1NCAL 1C12B 3B5GA 2O92A 4OUUB 3MRDB 4DN3H 4WO4B 5FCUH 2ATKB 3LSOA 5EOQL 1R0AH 4JHZA 3EYSL 3KPRE 4HDIB 4CW1B 1YNKL 3PP3K 2VIRA 3WD1A 5IG7A 2X05A 4HUVA 3CFCL 2B1AL 1P4LA 3MJ7B 1CBGA 5DDHA 4FTVB 1PEZA 5JIWA 2XTJB 4HKXA 2QHLA 3FB7A 2F7RA 5DI8B 1K4DA 4LASH 1OT2A 3NFPA 4ZPVA 4HT1L 1C1EH 4E41A 5A6LA 4BUGA 4PJHB 4ENEC 3VIJA 4OLXH 2OYPA 1KCSH 1HNGA 1V03A 1GZPA 3DX7A 3DLQR 3HNTH 3VE0B 3PZQA 1FSKC 4MJ6A 1E40A 4JFED 5DUBA 3KE0A 5E5MA 4F7MA 4MWFA 3FN0L 2XN9A 4WFFE 1OGTA 2CR3A 1NCDH 2VKXA 2EYRB 5FK9B 4CD4A 4PFEA 2JIWA 3EO9H 4P2RD 3WY4A 1M01A 4KI1A 2VLLA 5F88A 4HQQH 1A02N 3B83A 3O6ML 1MAKA 2J88L 3IF1B 2VYRE 4ZO7A 3OHXB 4JQIH 3ZKXB 1M7DB 5HD8C 5FO9A 4JM2C 3LX9A 4PJFB 1M6OB 5DUMH 4HUUB 2VISB 5DLMH 2AJSL 3G5ZB 1JZ4A 1O5DT 2YEZA 5AAMA 4UIKH 1ROWA 1BMGA 2BNQB 1IT0A 5DVOA 3ARWA 3VGEA 4KI5E 3HA0A 5CG0A 3QH3A 4JFDE 3RWHA 1I7TB 3QEUA 4WDIB 4JQVC 1EEYB 4TOQA 1LLOA 4UDUA 4M1DH 4QF1B 1JPSH 1E9LA 4HZAA 2DT2A 5JW5B 3RAJH 2GW5A 1JMXA 3DV4B 4QAWA 1GH7A 2DQDH 3G9VA 1GAFH 1S3KH 2MWCA 1JDDA 2C4FT 4PJFE 1P2CA 1VKXB 3GNRA 3OG6B 1VPOL 5D6CB 3QCVL 4FLOA 3WD4A 3NCFB 3C5ZA 2F19L 4YHOH 1WC7A 3TJEL 2EDXA 3V6ZB 4XRCB 4N1HB 3VXSE 1RZ8A 5HYJB 2R1XB 3IXTA 3QDME 3IDNA 5FA4B 1XGZA 2OYKA 1EDTA 3A6OA 3IFOB 1CFNA 1VJSA 1KACB 5HHXH 3DOSA 4Q7DA 1QW9A 3L6FA 4XXDA 3BKML 1RZFH 3AREC 5A1AA 1MPAL 2JCCA 3VIHA 1GOFA 2CBVA 1NLDH 2G3NA 1UR4A 3LMYA 4PTWA 3MV8A 3VH8A 4M56A 5FGSA 3SCMA 1AQDB 3UC0L 3KG5A 1IC7L 5IESH 4GXUM 3DX6B 1YJDL 4NQDB 3GZAA 3EJRA 5D4QA 1UZ1A 3GTNA 3QYCA 1L0QA 2F54E 1YY8A 2CBIA 4JKWA 1F8TL 3H8NA 4KK8C 3QQ9D 1Q6CA 3SDCC 1H4PA 1KPVA 1BLNA 1CLZL 1RK1B 4PB0L 1FNEA 3KYOB 1A7QL 5DD3H 4NKOA 1M4KA 2VDOL 3GI9H 1OP3K 1EHLL 4AW7A 4PJIE 5C0EA 3FOMB 2UV3A 2Q76B 1W2KT 1IGYB 4KRPD 3TNMB 5BV7H 5KAQG 2NY4C 1MJ8L 2AXGA 3T3PF 1OTUC 4BQ5A 1KULA 2GJRA 3DRQB 4OF6A 4PJ5A 1BZ7B 1CK0L 5J6GB 1G9ML 4QRRD 5E7FA 4AMXA 1ZT1A 4G6KH 3EUUA 4LKCB 4G42A 3AIVA 1VESA 4O5LL 2O5ZH 1RIUL 3TVMC 2NTFB 3QT2A 1W91A 5DJDB 3SDAB 5EBAA 4PTUB 3C09C 1ZSDB 4YHZH 5DQ9A 3MRNB 4HAFA 3DSFL 4Y4KB 3PWUB 3PHQA 4LQFH 1DWFM 2W66A 4CKQA 2CIIB 4GRLC 2DRUA 2EACA 4W84A 5FF6B 5FKAA 3G6JB 4S0TD 2J8GA 2ZJSH 1ZGLA 4YHKH 4S0SD 2KBGA 5CWSB 1EGZA 2OWCA 4PTTB 5I66B 5JUEH 3VFGH 1KTBA 1KN2L 4P3CH 3O6FD 1KSRA 4P23C 3TA3B 5SWQA 1NLBH 5GZOD 4M8UA 2PR4L 4L29B 4R3SB 3WBEA 2WMPA 5FA4A 5AYUL 2VC9A 4RX4D 1C91A 4ZXLA 4WF7A 4XRCA 5HTSA 2P5WB 2GJ6E 3E0GA 1GHFL 1U3HD 4MVBC 1RUML 4IJ3B 4LYQA 3TIDB 4HIXL 15C8H 2BSED 1IC5H 3CUPB 4D6EA 2M26A 1FP9A 1P2CB 1JHTA 3QFJE 5F9JA 5EORH 2ZPKH 1WZAA 1Y6MR 1T04A 4W5ZA 4U1MA 4PG2A 4NUJA 5C08D 4R90L 1SYTA 3SJVB 5DQJA 1LO0H 2X4PA 3LKPA 3CVHA 1I7TA 1T66C 4HIEB 4C7FA 2AEQL 3UBXA 4GW5B 4N1EA 1NLDL 4PS4H 5HI5C 3VRLF 2J77A 2FGWL 4P4KA 4PJEA 3ULUD 1QFWH 5CHNB 3JVGC 2BNQA 5DMGC 3GEWB 3V4PL 1ITXA 3C6LD 1D9KB 1M7DA 2OK0L 3SCSA 1W0WB 3K3QA 5GQBA 3B2VL 3REWA 5FO9B 3WNKA 4JFEE 1G6RA 4RZCA 1GOOA 3G6JA 3LRSA 5I8OL 4JM2A 4P0DA 1JTTA 1VA9A 5I17B 3BJ91 4Q0XL 5A2BA 5ITFB 4MNQE 1V3MA 1HHHA 3L1OH 1J8HE 4PREA 5DLML 3OLGA 4C7GA 1KENL 1G6RH 3MGOA 3MOAL 4HIJB 3BW9A 5EU4B 4ZUWA 1RZJL 2YWZA 3MLRH 4H2CA 1LNUA 2CMRL 3CLEL 2EIZB 2Y8VA 4FLRA 2YXFA 2F15A 5GS1C 4JGMA 3QG6A 4NRZB 4NJAL 3BD4A 4JCLA 2DKSA 2KZWA 2UYLA 1NC4B 2FIRT 3BGFB 3A23A 5TFSL 3KPNA 2QL1A 2D73A 1VBUA 1QUNA 3DV6A 1A5FL 1IGTA 4R27A 3GRWL 3RI5F 3KYMB 2CRZA 5GZND 3BUDA 5CEZD 3TNMA 2E7HA 3EJZD 4ZOAA 3CMGA 1EJOL 5D1XA 2NLJB 2E40A 1XCQB 3BP7B 1XMWA 1YEFL 2AW2A 3U4BH 1K2DA 3SDAC 5K9OA 1TFHA 4W8LA 5L6YH 3CTTA 4MNGB 4X0VA 3O81A 1PBYA 1PSKL 2ZSWB 3RWDA 1V5JA 4DGYL 1GPOH 1NGYB 3WHXA 1EA9C 4JQXC 4Y2OA 5J0BA 1Z9MA 4P23A 4HEPG 2EDQA 2GTZB 1HJWA 1S5IL 4HGWA 4KK5C 4M7ZB 5K9KA 3DC0A 2YDQA 5F7WC 3ARDC 3X11A 1OAQL 4NQEA 3VH8B 3O8XC 1U91B 2BCKB 3BPNC 3KDMA 3MACL 3AB0C 5EIQA 1ZV5A 4QHUB 5F44A 3F7VB 2BJMH 2VL5A 3BSHA 5D96B 4WI7A 5L9DL 1A3HA 1LK3L 3LS4L 4DTGH 3DPBA 4XV0A 5IFAH 3E8UH 5ACZA 4FZ8L 4XXDB 4ETQA 4HH8A 2OL3A 1DEEB 1X4ZA 2Z92A 4CD8A 2CO6B 2XACC 4PJBA 4Z7NE 3QPXL 3GXNA 4O4YL 4NQVA 4XCCL 2G5BB 3FQTA 5IEHB 3O2VH 4F7EA 1UCBH 1T2QL 1X1NA 3LZFL 2VDNH 1ZLVH 1KG0B 3CFJA 2YMXH 4XNQB 5BO1H 3BDYH 5IHRA 1XGRA 1H0DB 3AMKA 4JJ5A 4LHUG 3UTSD 3CZSA 3OGCB 5GRWA 1UKSA 2BHYA 4KAQL 4Z7OE 5ICYA 4EI6B 5IFJB 2EYTB 1C5BH 4JPWH 4M7LT 4X9HA 4XGZA 3NYDA 1BLIA 3L5HA 3L4UA 1OTTC 4WWKA 5DK0A 5CZVH 4R5EA 5CZVL 1HJUA 4X6DE 3CHDA 1CF8L 3GSXA 2WWKT 5C6PB 3PTKA 2XYCA 3T0BA 1RIUH 2YUZA 1T0NA 1J1OH 4Z6AT 5EFIB 4EQ3A 1ZEAL 2JK5A 2IQAA 2MPAH 2CUHA 4GRWB 1LK2A 3O3DA 1GQKA 4KJPD 1QVOB 5T1DH 3HS0B 2CLVB 2OSYA 1I75A 4LAQH 1A7RL 2OX5A 5DYOA 4LLYB 4XPFL 4FLSA 4LLUA 2ZUQB 3ULSB 2WHLA 2ZUNA 2A9NL 4ZPTB 1ZTXH 3CCHA 2AXFA 4LCUB 5B3JE 3CIQA 3VWKD 2WUBH 3L5XH 3WFHB 2J4WL 3FQNB 3RM4A 4TVUA 3HMXH 1OPGH 2N56A 5KSVB 4XP9L 1ZLVK 4BH7B 4MJ6B 3VWJD 3CFCH 1VHPA 3SDDB 3CFBB 1KGUA 3VE0A 1E4WH 2WBWB 5GS2H 3W29A 3NDZA 1ESWA 5SV4A 2PO6C 2X4RB 3G5VA 3LB6D 1X9QA 1GHFH 3QEQD 3SCUA 4K3JH 1GOIA 4DCQB 1B2YA 4PUBH 5EU3A 3VXRE 5E08H 1EHAA 2A1WL 2VN4A 4CAGA 2Y07L 4NM4L 2YUVA 3GXIA 1U91A 2BCKA 4YXHH 2DM7A 1QSEA 5BXFB 4KDTA 5I16B 2E6JA 2BDNH 4U1IA 3FFCE 2FJGA 2OSWA 1KBGL 4J3TA 5AC5A 3A4XA 4MJIA 1FVEA 3EFFA 1PY4A 2DQJH 3LEYL 3OAUH 3MA7A 3KPOB 4HPOH 5KS9B 4WFED 1AE6H 3EYVA 4UFLA 4D1JA 3ZDYE 2IGTA 2OTUB 5D7JC 8FABA 3TN0C 1QBLL 2R4RL 4H0IA 1P4BH 5KTEL 3UAJC 4NP4L 4MNLA 1LDPH 5IW6B 3AY4C 1OB1A 1U3ZA 3SCQA 4UIKL 3C5JB 5FM5O 2LVEA 1AY1H 1HNFA 4CD5A 2PTVA 4YBHA 2E8YA 4AMWA 4K9EC 2E9IA 1CDIA 5FGRA 2Z93A 1TVDA 5LWYH 3BIAX 4GKLA 1AGCA 1KIUA 4AD3A 1AFVL 4OJFH 1KR1A 3QO1A 3UG3A 3EJJX 2FBOJ 4JFHD 4XCFL 2V2WA 1KN2H 4P9HL 4KDTC 4NNYA 4MX7A 2K7PA 2WMIA 4Z8FH 2QADD 2OL3L 3ZJ6A 1NDGA 4LLMA 1AGEB 3P4OB 5I2UA 1AJ7L 1JHKL 4JDZB 4LHUD 5I1DA 4HS6A 3O6FA 2C1OB 3WN5A 3CO4A 1B0GB 2DQIL 7CGTA 5IMKA 4RISH 4HS8L 4NHCH 3KLSA 4IRJD 5C0AD 4AZCB 1B0RA 2R2EB 1T20A 4JLRB 2I07A 3SDDA 2OM5A 3DSNA 5FHAL 2GJXB 2JJUA 1G0YR 3LKRB 4TSBL 3MRGB 4HXAH 5ITFA 1E27A 3HN3A 3UZVB 3WIHL 1NBQA 3DROA 4I9WE 5HYJE 2DQGH 4HQQL 3NGBC 4MQTB 3NPSB 3AICA 5HGAB 4LSVL 4EBQH 2ZUSA 1EMTH 3N9GH 5KVGL 5JDSA 1BVKA 2OXGA 4N5UA 4LXFA 3PG2A 1YECH 3IANA 4QP0A 1HSBA 2GI7A 4P49A 3CZFB 4RBPK 2ZCHL 3JSSA 1BIIB 2FL5A 2ZCLL 3WEOA 2G3IA 3V5HB 5FECA 1IBGH 1WIOA 3GJEA 5J8OA 2FZ3A 4CVZA 2YD8A 3MXWL 5D7KE 3VRIB 4N8VA 3JWDL 1IGIH 4PJAB 3KAAA 1U8HB 1XYZA 3QG7H 3NSXA 1RZKL 1S7UB 5DQJB 1UR2A 5HHVH 2OR9H 1S9XB 3S3SA 4NUJB 2V2TB 2NY5L 2AEPH 5I1AB 3NTCH 4U0RC 3BP6B 1B1YA 4BZYA 4HBCH 3L3DB 2Y1VA 3CUPA 4HX1B 4JFDB 4K8RD 1XH1A 4YPGB 1LHZA 1W9PA 2GJXA 1UASA 3DI3B 5LGJA 2JCCF 1A4KA 3Q6GL 2DSKA 4QOKB 5IEHA 2PCPB 4AG4H 3PL6A 1T2XA 1NUDA 5EU5B 3OKNA 1VGKB 5A2IH 1YQVH 3AGVA 2QEJA 3E6HB 3L3OB 1DSFH 1S9WA 4IOIA 4TUJA 1A6PA 4U6YB 1T2JA 3RVTD 4H0GA 3T4YA 5LQBH 3OAYK 3GO1L 2VL5B 4QWWC 2HA1A 1IM9A 3O8XA 1GOQA 1YEEL 2P5WD 5CWSA 3OWEA 3UR7A 1SFSA 2PXYD 4TVPE 1S7RB 3CFKB 4RGMB 4WRLA 1T0OA 1FYTD 5GGTH 2CLRB 3KXFD 4QTIH 3VD4A 5HDRA 1WCBA 4L9DA 2A3HA 5E9DD 1A1OA 3AHZA 3TN0B 3NAAL 3V4VL 2VR5A 3N11A 1CS6A 5IEKA 2W92A 2FNBA 4YHKL 2WWDA 1R5VB 4JDTL 4MNGA 1OIFA 1JD9A 3EYVB 2PF0A 3IDGB 3IFLL 1SYSB 2NY2C 1N59A 4KJWC 4MJ2A 5ECJE 2DT3A 1BD2D 4JY6B 1KIRA 3PQYE 3QAZB 3B2UD 1MIMH 1IAMA 1PX3A 5DF0A 4I4WA 4ONHA 3HE7A 1T1WA 2XA8H 1WSST 1FFQA 2KQMA 4JO1L 2V3EA 3K8MA 3MRFB 3FQXA 3HMCA 4U7SA 4D9LH 1G6VK 1HJSA 1KELH 3KWWB 4N0FB 1CICB 3OZPA 4UV7L 2F7OA 1UH4A 2X2YA 2HAZA 3ZHLA 3CX5K 1X5GA 4KKLD 4D8PB 4NC0B 2OLDA 1XF1A 4G6KL 4NCDA 3A4AA 1NC4A 1PKQE 1K5NB 4PD4J 3IT8D 3NACH 3I3DA 1A0QH 2F53D 3JUYA 3VD7A 3ZKMD 3LEXB 5IHSA 4PR5A 3KHQA 3IJ8A 4X99B 4MAVA 4LSTH 5F7UA 5DMIL 4S1QL 1SJEB 4DK3A 1IFHH 1AC0A 1Y18A 2WUCL 3DX6A 4LEOB 4B5EA 2QQLH 5EBWA 3QIBA 1S7SA 4XZUB 2VH5H 1FZJA 1KXQE 2EXWC 7A3HA 3P73B 4CVXB 3LKNA 3MXWH 2J7DA 3RVWC 4LLUB 3EMQA 2R4SL 3MNVB 5C6TH 4PP2A 1I1AA 1YMMB 1GGIL 4NFDA 4BJLA 2P24A 1EAPA 4X4YA 4GG8B 5DJXB 1KC5H 1DWAM 2V5TA 3WE6B 4X8XA 3EDFA 5J06A 5C0NC 5ICZA 2FRGP 2HLFC 4WW2F 4H7VA 1CD9B 1JPGB 4WFEE 2XFXA 1TQSA 3WNPA 1TENA 3BUYB 4DKEL 1ZXQA 4DGVL 3D69A 3PZ9A 3QEGL 2D7MA 3PWPE 1MLBB 4M43H 1HQ4B 3VD9A 3JUGA 1DZBA 1FFRA 4Q9QL 1MH5A 2Z8WC 3PDOA 1JPGA 4EDXA 4C7DA 1EEYA 3MNWB 3BAKA 3WKML 2VXQL 4EI5C 2JIEA 3QRGL 3C6SB 1HVXA 1D5MB 1MAML 4KHXH 1MI5A 1FV1A 2H1PL 4PV9B 4PRHA 3SE8L 1H15B 1TJHL 4Z7WE 3K2UL 5DQDL 3G6LA 1CDHA 3D50A 1EOKA 1YMMA 5I1IH 1J10A 3GBNH 4WI8A 1BOGB 3D2UD 4HFWA 1REIA 2VTFA 2Y07H 5ANMA 2IQ9L 1VFUA 1RVFH 2VDKL 1KPRB 3OXSB 3MXVL 2AJVH 3G6DH 5EZLA 1UD2A 3MRKB 4X6EB 1JGVH 4X80L 3PHQB 1ZLWH 3CUGA 1V7MH 2DIEA 3ESVF 1NANI 4JB9L 2ICCA 1FAKT 2I60L 4KQ4H 1MCOL 5E5MB 1U8LA 2HT3C 4KQ4L 3IYLW 3BRDA 3MI6A 2WC3A 2EC9U 3WHXB 3MLZH 3RKDD 4FQXB 3P3YA 4MNJA 4ODXA 4RGNC 1LEIB 4PTUA 2NY1D 1XRVA 4MJ4A 4M00A 4ODHH 4QRPA 4ODHL 2ZNXA 3L7FA 3VFTA 3BVNA 5DJ8A 3TVMA 4PMRA 1U95A 3KEHA 1EXUB 3KPQB 2XTLA 5EO0A 3HC3L 2C26A 3MGTA 3KPQA 3LHPH 4TOYL 4TNVF 1DQDH 1OAZH 2V2XB 4PJ7B 3F5KA 4O2FA 1I1AD 3DV6B 4P7OA 1MQKH 4LKXB 5F9WC 2E3ZA 3FOMA 1KIRB 5F89B 1A6AB 4YDJA 3GSQB 4LHJB 5MP6L 5I24A 4I3SL 3PZOA 4L8SB 3DURA 2J7LA 2P8LB 3F5WB 4R4FL 2OP4H 3VGBA 1O7AA 2V5RA 2TAAA 3HUJA 3KLDA 5IEKB 5CIPA 1Q94B 4E5XB 4KKAD 4L4OA 4PMQA 1JHLL 3VFVA 2ZX9A 1WKYA 1WBYA 4YXLL 4DUXA 1FLTX 3W9DA 5DRXA 1RJCA 1UGNA 3H0TA 2BFVH 5J1AB 2XY1A 3CV5A 3OQ3B 5EC1B 3ZO0A 2A6KA 1I9EA 3GGWA 1I3GH 1TJIH 3TT1L 4UOJA 1NGWB 5E8DH 4WI6A 4MD5A 3VCLA 3ARFD 1E4JA 3EYOA 1V3JA 3RDTC 3U36B 4Y19E 1IE5A 1V0MA 4ODTH 3SDDC 3NZ8A 1T89A 2ICEB 5H94B 2CDEA 3HC4L 2IADA 4XAWH 1UA7A 4JPIB 3SHSA 1MFNA 1X7QA 1JPFA 4XX6A 3PQYB 1FN4B 1A4KB 1K4CB 1G7IB 4NHUA 4GS7C 1W0YT 3HCVB 4ZSOA 3UTTD 3PV7A 1WBZA 4NJ9H 4OFDA 1J5OH 1H0GA 2VR9A 1KJ2H 1T7YA 4NKDB 3FMGH 3WD5H 1A9BA 3LH2L 1F42A 4WFHD 3F7PC 2J2ZA 3T0EE 1TNMA 2IBZX 3DV4A 5DRWA 4XP5H 2IXVA 4JHOA 4N42A 4XMLL 5TE7H 4ORGA 2NMSA 4MS8C 4NZUH 1R7AA 1F2XK 1RZGB 5CBEA 4OZFH 5E08L 4AYGA 3OGVA 1I3VA 5IMOA 4N8VB 1KWKA 5C2BH 4LX4A 4Q6IB 4Z2IA 1M1SA 5BRZA 4MB3A 2GUYA 1YHTA 4GBXD 4EK7A 3OKOB 2F8VA 3VTRA 3ARXA 1DVFC 3HLAB 3WE6A 3WQ6A 1AO7E 1F6AA 1Q9LA 1GZQA 2GKIA 3DVNB 3VRJA 1DN2A 3MRIA 1NM9A 4FQHB 2YWYA 1EIBA 5A2FA 3EKCA 1HIML 4PBVC 1M6OA 5C0AB 2WZHA 1U8NB 2W65B 3TV8A 4PRIE 3OGOE 3DROB 4M48H 4EKJA 1E27B 3D1MC 1I7UB 3NAAH 5I75B 5LVEA 4KTDL 3VXOA 4J8RB 1MCSA 5ESAA 2PO6A 2DQFB 3IAPA 5F96H 3VI4E 2EH8H 4CCCA 2NXYB 3QBTB 5DR5H 3AS3A 4CDHA 1NSNH 5DJ6B 3MLUH 1AD9B 4ZMAT 4IIQA 1HDMA 5CJXC 4JM2F 5BJTA 4AWEA 3AU1A 1OCWH 3E1F1 5DD1L 3CK0L 3ZTJH 1A4JA 4IIQC 5KW9L 3S4SB 2FO1A 4C4KO 1CFQB 1SY6L 2P46B 5LGHL 5F6IB 3ZYJA 5D6DC 2CGRH 2XVGA 1HKIA 5HGBB 3PXHA 1YEDB 2IPUK 1OOAA 1NAMA 3GSOB 1FGNL 5EBLA 4NWUH 4FQCH 1IAKB 3EO9L 2A77H 4HEME 4AMKL 1HN1A 3VGFA 5DJCB 1KXHA 4JREC 1Q9WB 4FXKA 1MFUA 1SYSA 1BX2A 1QLRB 1MJUL 1YEEH 3BEWA 2AKRB 4YNYB 2APWA 5A2LH 5SWSD 2H2PD 3KPOA 2IAMD 3SKMB 1JK8B 2P1YA 4PRAB 1ZLUK 4WKFA 3RFZC 3A0OA 4OI8A 1KT2B 2DGAA 1DVFA 3WO4B 4NQDA 4G8GB 5D5ME 4RAVA 3HE6D 1FNFA 5E94B 5DHVB 1R33A 2VCBA 2EH8L 5KSAB 4LRIC 4GKOA 1LEKA 3TYGH 1FYTE 1S7VB 1C16B 5CPTA 3F5LA 2EDRA 4WJ5B 43CAA 2W0KA 5EU5A 5KANG 4BM7A 3FJTA 1VENA 3MNZA 3MO4A 3WBDA 1GCYA 1D5BA 2EDFA 3NN8A 5MEQA 3OKNB 4FK9A 4AM0B 2E9MA 3V8OA 4UQ3A 5KSVA 1B31A 4FS0A 1ZBVA 4BQ2A 1E4NA 3QUZA 3ZE0E 2WZIA 4NSKB 3NIYA 5JBDA 1F5WA 3L3DA 2NY3D 5EG6C 5DWUL 3GXFA 4DO5A 2XVPA 4WJXA 5B4MC 3CCHB 4EDWH 1E6PA 1H8NA 4ZO8A 3TGXA 4IOFC 5C8BB 4OLZH 4YZFF 3GK8H 2FATH 4DWSA 2C3VB 5D5MA 1G9HA 3LN4A 2ZWZA 4S1QH 1S9XA 2GCYA 1YECL 4HHAB 1EGJA 4AENB 3RCNA 3GSRA 4UDUB 1MCQA 4KC3B 4P46B 4DKFH 4P4RB 1T0NB 3ZT7A 3B9EA 5FXCH 2ARJA 4U3CA 5IMLB 3SJVE 3EAKA 3QSKB 4JDVB 3SDXE 3FFCD 4HUWB 1C93A 3LQAH 1WJ3A 1X5IA 4M7JL 2RIKA 2C3VA 4G8GE 5D5MB 4NKMA 2EO9A 3T1WA 1OWWA 5GSVB 5T33L 4JN2A 3ULUE 3L95A 4W87A 4QHNA 4P57B 5GGUB 1EHLH 1FLRH 2J75A 2O9PA 2NY4B 2XUCA 3MUJA 4S1RH 3ZR5A 2VC2L 4X6CA 5ESQB 1BQHA 5FAAA 2HJFB 3ULVC 3LQZB 1IJ9A 5CIPH 3PN8A 1PZ2A 4LLQA 3MLRL 5ELIA 5I1CH 3HZVB 1KCRL 4HKZB 2NY4D 2VJXA 3HFMH 4ZFGL 5J1TC 2D23A 4NOBA 2C1OA 1UA3A 5KVDH 1BG4A 4H26B 1TQUA 5FHBL 1R3HA 5CSYA 1JUFA 4HCRL 3LKOB 4PRWA 4U1LB 2DQXA 2GSGB 1JNNL 5HSFA 1LVEA 1BGXL 1J1XL 5I1HL 4LASL 3TTYA 4KTYA 3PZTA 5TE4H 3TV3H 4PJGA 5C2UB 2PWFA 4AXNA 3ARGC 5IVOA 4WY7L 1A3LH 4AZBA 3LV3A 1R46A 5HGDA 3QFJB 3QHZL 2OTUA 1T1XB 3DUSA 5L7XH 1CZ1A 3VFOB 1KQZA 4BYHA 4D9QE 2MQCA 2NZ9D 3U7WL 4Y4FA 3ARQA 5DA0B 5C0GA 4MJIB 2K9UA 1B30A 12E8L 3TA9A 4UIMA 2YPKA 5HDQH 3MA9H 5EC2A 5EUKA 1PKOA 4GRMA 5EU7E 3RPMA 4A6YA 1YUHA 1JBJA 4BQBA 4DOHE 3MLXL 1IEAA 4OZOA 1U3HC 1YYLL 4CD6A 4Y5XC 1ZLSL 5MHSE 2WP3O 4XCNA 3FT2A 3K7UA 2V7NB 2GK0B 1BBJA 4HS3A 3H9SD 5FYKE 4XCYA 3CFBA 4Y4FB 4PJGE 3FL7A 3D0LB 3T3PE 3RIFF 5K93A 1A5FH 3MOBH 4NO5A 4U1NB 4ELMF 3RZCD 4OCRL 1ZVSA 3O3BB 3I85A