3VGHA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltotriosyltrehalose
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
554
structure length
554
Chain Sequence
b'YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 189
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vghA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vghA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vghA02
5CEZH 5F9JA 3BUBA 2CSPA 2W9DL 4K3HA 5H94A 4JFYA 1CICC 5A6BA 1MFDH 2ZXQA 5LG1A 2G2RB 3D2UD 2R4RL 3N1MC 3QIBA 1ZA6A 4PY7B 4I0PA 3WIHL 3KPQB 3DO3A 2ZNXA 4PTUA 3O11A 2QTEA 4NQSB 1FRGH 3MRRA 3RDTC 5INDA 5AC4A 1JHTA 3ALXA 4PJAE 5BVJA 5MENB 1IE5A 5IHUL 3NA9L 1MQPA 3MO1B 3RVWD 3WJJC 1JZ6A 3QDMD 2DPEA 3FOLB 3IFNL 1AHWB 5T1KA 4KMLB 2M1KA 2R0ZH 3TN0D 4JN2A 4TVPE 2VISB 5FK9A 5B39G 4QTIL 3D5OF 4TQEL 4Y5VC 1K9DA 3IDGA 1TVNA 3DGGB 5IEKA 1FDLL 3VDCA 3AXXA 1P4BH 3G6AB 1UKQA 1UXWA 4AZCA 1FE8H 4RX4A 4GW1A 3WDJA 1JWSA 1MFDL 2LAAA 4PMQA 4IM8A 2WNGA 4KK9D 1WCBA 3SY0B 1R46A 5CEXB 4X6CE 1NKOA 1LO4H 1UT9A 4TUKH 4NSKA 2PXYA 5DRNA 3DTXA 1JHLL 1SY6L 1ZHLB 4N1HB 1NANH 1QKZL 3SQOL 3TTSA 3VXSA 3T0EA 1BIHA 4EDWL 4PGDB 1OY3B 2JJUA 2QV2A 3KAAA 4GG8B 3UTQB 4MVBC 3RIAK 5E2JA 2NZIA 1WCQA 2HKHH 5CINH 1KBGH 1UVQB 2GTZA 4PJGA 4HWZA 2DF3A 2AV7B 2OR9L 5FYKD 1QOKA 4JFED 3JUGA 4PJCF 1JNNL 3ZDYF 3ZYZA 3KLAA 5E70A 5FFLA 1KC5H 1EV2E 1QLRB 1XH0A 1KTKE 4OQTL 2XKNB 3QSKB 3ZKXC 1B3WA 5A2BA 5MEPA 4X4MA 2RFXA 4KZDH 1DE4B 4RAVA 3VFWA 2YA1A 1CD1A 4J28A 4P23B 2VITA 3NCMA 5JIHA 2G3MA 2HTKD 3FB6B 3CHEA 1RQ5A 3EKCA 3ARBB 1T2QH 4JO1H 2UZYB 1MELA 4TPRL 1FE8L 2D31B 1AXSB 4JFDA 2EYRA 3MRMB 3B9EA 4ODTH 3FQXA 2F7OA 4K68A 2BK8A 2IALB 4PJ7A 1T1XB 3VMNA 3M45A 3H9SE 1LO4L 2R9HC 4TUKL 4HUUB 4WFGE 4QWWC 3V6OA 5LKNA 3WUFA 5LWYL 3MV9B 1C5BH 1F4XH 4MNKA 3N12A 4Y7MA 3B9AA 4GXPA 4BKLA 43CAB 2XYCA 4K7PY 3O2VL 2X9WA 3TJHC 4KVNH 3PWUA 4X5XA 5ITFA 4YC2C 5HHVL 1NGYA 4WO4B 5IB4A 2CDEA 5J11B 3PTMA 5KVGH 4QNPF 3EGSA 4AIZA 4FS0A 2W1NA 4F9LA 1CFQA 1YNLH 2JJTA 4D3CH 2DSVA 5FB8A 2G75B 3P0YL 4Q0XH 4YFEA 5D2LB 3VIOA 3BJLA 3PBGA 1BJ1H 3MFFA 3CZEA 1T2QL 1BX2B 3QIWB 1HP5A 4YHIB 4I18A 5DD1L 5HDBE 5I9QB 3LIZH 5AAMA 3RIAF 2NY5H 4MCZB 5D8WA 4MDJA 3G5ZB 2VE6A 1HKIA 4PGEA 5I73B 3BXNA 4NUGH 2Z31A 5IR1A 4PS4H 43C9A 2PUQT 5H37H 5I1EH 1TVBB 1OQOA 4P3DB 1RFDL 4HGMA 3S6CA 3V7MA 3KLKA 1SJVA 4NHCL 1FGVH 1C5BL 2CUIA 3EYFB 3M46A 4AMWA 2BOBB 1D9KA 4FXGB 5C0IB 2VRKA 3RVWC 5HDRA 4FOMA 4JN1L 1R0AH 3GSOA 4XCNA 3TT1H 4YHML 4D0DB 2VZUA 4G6KH 4MA8L 3GMQA 3MUZ1 3TN0C 4ZUTA 5CBEA 1YNLL 1FYTA 4Q0XL 3EDDA 2W0FB 3ZR6A 3EJJX 1HL8A 1XH3A 1YC7A 1G1CA 1EEQA 1I4FB 2V17H 5C09B 4UTAH 1WBXB 3WD3A 1N8ZB 1WZKA 2YPLD 3LIZL 3PZGA 5GGSB 4B5EA 2A9NL 3CH1A 1IGYA 3KYMB 3PDOB 1MW2A 4G9FD 1W2PA 2YDRA 1H2JA 3LDBB 4KK9C 1FJ1B 1DR9A 4IPNB 4PS4L 3PWPA 5JUVA 3SCWA 5I1EL 2QSTA 1U8JA 4CVXB 3GNRA 1EO7A 3TOPA 3EYVB 2DKUA 4FQQB 4X9HA 3I85A 3WBEA 1A6TB 4XUYA 1CG9B 4MQSB 4Q6IC 4ZYKB 4M5YH 1GXEA 2Q3AA 3C6LA 1H11A 4XBPA 4U1GC 3RILA 2WSKA 3VDHA 1LWHA 1R0AL 4PLNC 3HI5H 1EEZB 1E4JA 1OHQA 2HJKB 3WO4B 2UWEA 3EYQD 3OHXA 3TT1L 2ZCLH 4E4PA 4U1SB 4F7CB 3ES6B 4G6KL 4JE4B 3HZVB 5HPMB 1C8XA 1K8IA 3T0EE 4HZAA 1G6RB 5D1XC 5DMYA 4HIIB 5TDNA 4HDIA 3SUWA 2HTKC 4FP8H 5FKAA 5ADPH 4IM4A 1T7XA 5CEZD 5L2JA 4PJGE 2KQNA 4P5MA 3QCTH 2X4SA 2IPTH 5D2NA 3GZKA 1BOGA 3BP4A 4XXCC 4HCRA 4P59L 1F3DH 1ODAA 1W1YA 3T0BA 1KCVL 1QW8A 2ADIA 1K6QH 3BH8B 3ECBB 1J1PL 1RK0A 5JR1H 1AGBB 3MJ7A 4X4ME 2UY5A 1U2YA 3QWRD 5D8JH 3E1F1 2RR3A 1FZJB 4ZD3L 4OKDA 5FEBA 3MV9D 3SCNA 5JPMB 1AVAA 3DX2A 3F6LA 1QWNA 3F7YB 4M5YL 4AEEA 1HP4A 1LD9A 4KQ3H 1MJ7L 1QLEH 5T3XE 1EHLL 5E1AA 4PJ7E 3HI5L 5F9AC 1I3UA 3QCVL 1P7QB 1VEOA 2ZCLL 4JKPH 1WDPA 2D7TH 1MW3A 5CSUA 1LK3H 1DN0A 3BT2L 1JDDA 3CH8A 3CD4A 4LDEB 3KNBA 3QBTB 1A7NH 5BV7H 1Z5LA 4FFVD 1EQPA 4ELKB 1WJ3A 5ADPL 5E2UH 3W5NA 3TVMB 1WE5A 1CXLA 1NSNH 2IPTL 1TR1A 4XX6A 5C9JB 3VKKA 2BMKB 1VKXA 4YEEA 3C5ZA 2DTMH 1PKQB 5IFHH 1YPZE 4H25B 4JDVB 3AREB 3C60A 1CXKA 1ZLVH 5GRJH 5D93B 5D8JL 2JALA 3WKNA 4CL7A 1U8PB 4WWID 3WH7A 1JFQH 1A1NA 3RZCB 3IKCA 2OP4H 3ZKNC 3EJSA 3KYOB 4YDKL 3AYRA 4NXKA 1M7IB 4BA8A 3MRLA 1SJHA 1K4CA 4XNXH 2FH6A 1UCTA 4YDIH 4KQ3L 1H5BA 3BAKA 1QLEL 4WNQB 4EI5B 2WAHA 5C08B 4P4RB 2YD1A 2D7TL 4NN7B 1LK3L 4PJBB 5AUMA 4OFIA 1ONQA 3MBXH 5GRXG 1IM3B 4A2LA 5GISL 3BD4A 3PF2A 4BQ8A 5BV7L 2C4FU 2UVFA 3DURA 4RGNB 3BZEB 3AZTA 4AYGA 1E6OH 1NGXA 4NJ9H 5JORB 1MHCA 5D7IB 2IEPA 3AS3A 5MP6H 5F21B 5DJ0A 4PMUA 3RGHA 5JUEL 2DTML 5A16B 5IFHL 3VGAC 2F54E 1FH5H 2YPKB 3IXAB 4FLSA 4MQ7A 1BD2B 1I75A 2DLIA 3ARSA 1FYTE 3V9FA 3ZSTA 3GBML 4X80H 5D1XA 4XP6H 4GRLD 1LILA 1JFQL 1AR2A 4OLYL 7CGTA 2RJMA 1KB5L 4G5ZH 3UC0H 2IPUG 4XAKE 5DTFA 4ZUWA 2PWGA 4N8VA 4NKOA 3BAJA 1YJDH 3KPRA 3IB4A 4P46A 2WWMC 4YDIL 1R5VB 4DKFH 5J4MA 3B8YA 3MXWL 1BFOA 1HIZA 2YXFA 2BOCA 1M05B 5ANMA 3PWPE 4NPYA 4M80A 4UFHA 1YEJL 4QLJA 5DT7A 1W9DM 5CCKL 1UZ8A 2NW2B 4QEGA 5EUOF 4TVSa 1WNOA 1HT6A 1T3FA 5JLZA 4XNZB 3OKKA 3LRLA 1AQ0A 4D0CB 2VX4A 4P23C 2F18A 1LQSR 1E6OL 3I2CL 4PREA 1NCWH 1QFUH 2NLJA 2XZCH 3VIJA 5LYRA 1F4AA 1BLNB 5HYJB 1VBUA 4MJ6B 5L9DL 4HUWA 1FH5L 4M02A 5GGSY 2J8FA 3ZSSA 3M07A 5IROA 3DXAD 2BVOB 3SDYH 2G9HA 3UC0L 3FY1A 5C0BB 1S9KC 3VWJD 4P2OD 3PG2A 1JGLH 3AXLA 3S88L 2LTQB 4NQED 4DKFL 3HNSH 3BMWA 3MBED 4V1DD 4MHHI 2K9UA 3GHEH 2R1WB 3I3DA 5BRZB 4RZCB 3F58H 2FJHB 5IHRA 1E3XA 1E6JH 2G2RA 3BPOB 4K94L 1AKJD 3OLGA 4PY7A 4FFVC 4XC1L 5DS8B 5JQ6H 3KPQA 1MCFA 4LQ1A 4BH8B 4NQSA 1U3HB 1NP0A 4FNLH 1J12A 1NCWL 1QFUL 2HT2D 3QXVA 2XZCL 5MENA 4P2YA 3KWWB 5I9QC 2J1KA 3FOLA 1AHWA 4NZTH 4P2CG 1AQHA 4QDMA 3OF6A 3B4NA 5I73C 2Q6WB 2GSGB 4WUKL 2VSDA 2E5EA 4KKCD 1TETH 3ARED 3LVEA 1DWJM 1FLRH 4PRHB 4IOIB 3SDYL 4EZMA 2VISA 1ES0B 1H5VA 5F1IA 3E6FA 4H1LH 3DGGA 3G6AA 4G6FB 3GNMH 5IQ7L 1K8DA 4ZOCA 3HNSL 3TEUA 3MRIB 3U7WH 4ZUSB 3KPMA 4PJ9D 2NY4D 4EI5D 3FO2B 3F58L 2K7QA 5D7KE 4OCRL 5CEXA 4JRXB 3SPVA 1B4RA 1ZHLA 4PCSA 2OI9B 3BI9X 5JQ6L 1JYWA 3DV6A 5DRXA 1EFXB 4M29A 4PGDA 2EC9U 4GG8A 4FNLL 3GIVA 3UTQA 3D1MC 1BM3H 1PIFA 4NZCA 5DQDL 1RUAH 4QYOB 3DDFA 2AV7A 4FLQA 2RGSA 4NFCA 3UG3A 2EIEA 2NXYB 1QLRA 3LDBC 2WUBL 3QDGB 4UV4H 5D6CB 1BYBA 2YD4A 1MCKA 2XKNA 3LSOB 1TETL 3DJ9A 4GRLC 1UG9A 1M7XA 1DE4A 2HT4D 3V5KB 1IZJA 1GQIA 1CBVH 3TESA 3FB6A 4CCCA 5CPTA 3ARBA 5EU4B 4X9GA 1L7IH 2D31A 1AXSA 1N0LA 3MRMA 2JJSC 2PB1A 5D6DC 2W60B 4NBZB 2P5ED 3U7WL 5FHBH 1MJ8H 2P48B 3HN3A 1MRFH 1U3ZA 1T1XA 8FABB 4DJMA 1O5DT 4YLQT 3U7BA 4HUUA 3ME0A 3BVUA 1C08B 4UV7H 4YR6B 3KPRE 1BQHA 2FECI 4XNMB 2NY5C 4H8VA 3QA3A 1A6UL 1BM3L 5HHOB 3BHBA 4MAUL 1DQQA 1H8SA 1E43A 1RUAL 5I5RA 1LO3H 4Z5RB 1GOFA 4FQPA 4MQTB 4WUUD 4WO4A 3ZJKA 1EMTH 4R96A 5HYJD 4ODUB 4UV4L 4H1LB 5LCVH 4ZTOL 4ODHH 5B38B 3GMLB 2V38A 1A21A 3CDFA 5J7CC 3RY5A 3KZSA 3CAFA 3UCRA 5EOTB 4P2OC 2AJUL 3IFLH 5E5UB 3HG2A 5LGHH 1BX2A 3FFCB 3QIWA 1C8QA 1L7IL 4YHIA 1BECA 1PZ3A 4MPKA 4QRRD 4J3TA 4U1LB 1MJ8L 3G5ZA 4GW5A 4LRNH 5AZ2H 4G6ML 5BRZD 3SDAB 1CN4A 1OTUD 4BELD 3PHAA 4P3DA 1R33A 1Q6DA 5I6XB 3F12B 4RRPG 3EYFA 3T3PF 2AJZB 1CK0H 3TBYB 2BOBA 1CLZH 1Q8MA 2DQFB 2HT2C 4PG2A 1ZBWA 5F89B 4FXGA 5I1HH 3EDJA 3ROLA 5HBBA 1LO3L 3FB7B 1KPUB 4ESKA 4OFYD 5HY9B 2FH8A 1WWAX 2PF0A 3QXTA 1EMTL 1XHGA 4D0DA 1WPCA 1HKJA 4KKCC 2V3EA 1UB5A 3AREC 1F00I 1ZSDB 2H1PL 5TDPB 2WWCA 3AC0A 2Y7QB 2ZX5A 3L7FB 1VFOA 4KV5E 4LQFH 3BGAA 2R23B 1ODZA 2W0FA 2VT0A 2GDVA 3HI1B 3IFLL 2GK0B 4JQXA 5E00B 5GZOD 5MENE 1I4FA 2ARWA 5C09A 4G7VL 1WBXA 2RHEA 3W6MA 1N8ZA 3IGAB 3VXRB 4G6FD 3VXMB 4UOZA 2TAAA 4LKCB 4I8DA 3KYMA 2NY4C 4EI5C 4KMTH 2VDKH 2OLDA 5DVKA 4H0IA 5AZ2L 3H42H 3UJTH 2HMID 4NN7C 5LVEA 3GB7B 1I8LC 2XG5A 4WCYH 5HGGS 4HLJA 3EYVA 5F9WB 3HPJB 1CK0L 3L3DB 2VL4A 3ARPA 1A6TA 1CLZL 2HLFD 1MAKA 2CIKA 5I1HL 4QXGL 1WICA 4OLVH 4PUDA 4XV0A 2CLZB 4PMRA 5HI5D 4U2YA 3RVXC 5BROA 3X11B 2R29H 1E6NA 1EEZA 5KS9F 5T5NF 2DM4A 2DL2A 1JE6A 4FQJL 4AD2A 2G3NA 4F7CA 4NCDA 3ES6A 1T4KB 1FFNB 3PWVA 1JDAA 5BW7C 2UYLA 1G6RA 1XGQA 4AENA 2AJVL 4HIIA 3RWDB 4XVUC 3LD8C 1W9UA 4I0CC 15C8L 3ARUA 2XICA 5KVMC 3SKMA 1QNQA 5DURB 4KMTL 1ZGLB 2VDKL 3BH8A 3ECBA 1S7RB 2WQRA 2E9JA 3BQUA 2EDJA 1AD9B 3H42L 3MROB 3B8SA 4JM2B 2XIIA 5KVDL 5B3NA 4OAWB 1KPRB 4XNZC 2YC1A 3A0OA 4C83B 4YX2H 4UZGA 5JPMA 3E2HB 1NH6A 5T1DL 3F7YA 5JTWA 4H7VA 4PCTA 4Z7UF 1N0XH 2EXYD 2X05A 2VNCA 5TF0A 4DUWA 3U1SH 2DAVA 2R29L 4X7SH 5JOPD 3O81A 1P7QA 2O9RA 1OOAA 2YS4A 4GI8A 4IS6B 3MKKA 1XEDA 3GH7A 4RGOH 2AJ3B 3LMYA 4B50A 1BMGA 4DN4H 1UGNA 3MV9E 4WVRA 3MUGB 3JWDH 4ELKA 3SDCB 1G9MC 3TVMA 4XGZB 4Z78B 3MRDB 2DQTL 4XNQB 2CIIB 2EDTA 1UM5H 2BMKA 1PKQA 2WAGA 3MV8D 4Y5YA 4ODVH 3UEQA 3GXMA 4JDVA 3OAZH 1JUFB 1LDSA 1OTUC 1UKTA 3V0VB 1SJEB 3BPOC 3WS6C 1U8PA 5D2LE 3GUTB 3RZCA 1SVCP 3KYOA 2VVSA 4ACZA 4YX2L 1M7IA 1R3KB 3OGCB 5TE6H 1YC8A 3GIZH 2FEEI 1GGTA 3BAYA 2AQ3A 4M7JH 3U7AA 4X6DF 4MNHA 4WNQA 4R2GD 4M3JA 3BXWA 3U1SL 3QEQB 4X7SL 3UG5A 2OYMA 4QTHB 3CV5A 1F11B 4PJBA 1G7PB 4RGOL 1YJDC 4LGXA 4RWHA 5DC4B 2D3LA 1N64H 3OB0K 3ARFD 3SDDA 5I8OH 1PSKL 1YEGH 3QO0B 5IEHB 2UZIH 3BZEA 4PJHF 3RUGF 2J7BA 3N1GC 5ID1B 2YD6A 5B22A 5D7IA 4N9GA 2E27H 4ZFOB 1UR1A 1UM5L 3SGJC 3VXRD 3DSNA 5I16A 5A16A 3WEOA 2YPKA 3IXAA 5TQ0L 4W8LA 2HMIC 1BD2A 3QEGH 5TF1H 3ZYIA 1JNJA 3OKOB 5F7NC 2CKSA 2QHAA 3B43A 4R26L 4M6NH 4XXDB 3D51A 2DN7A 2KBGA 1E4LA 3K46A 5C09E 5TE6L 2HLFC 1GNXA 3GIZL 4BYHA 1U8KB 3GK8L 1MY7A 3NIYA 5HI5C 1R5VA 4M7JL 5CUSL 3VX1A 3VGFA 2EH7L 4CD6A 3FN0H 5BS0D 3QUXD 4HXAH 1E6PA 5AYUH 3FOMB 4X6FB 4NNPL 3BUIA 5SX4I 1OAQH 3QWQB 4IISA 1XGPB 2CBUA 3MLXH 4OT1L 3GXFA 3IRPX 4PJCB 4D0CA 2Z91A 1F2QA 4WU7B 3HC3L 4I4WB 2X9XA 1NC4B 5A8QA 4W6WB 3DROB 2E27L 3VFNA 4PV9B 3DOSA 1BLNA 1OF2B 2H8PB 4MJ6A 3DRQA 1XCWA 2ED7A 3GRWA 1RZJH 5DURD 4YJZL 5JW4M 5TF1L 3ECQA 5GQBA 2VQUA 4GO9A 4N0CD 3X3GH 3QHOA 3BH9B 2BVOA 4JM2D 5I1AA 4ZDHB 1AGDB 1MFBL 3CU1A 3IGUA 3J7HA 3GKZA 5C0BA 5ICXB 4KI5D 2CKNA 3VA6A 1A22B 1YA5A 2J4WL 1CGTA 3RWCB 4LGSB 4JFSA 2BVYA 2MCPH 2FIRT 5ESAB 3ET9F 3KPOB 1UYWL 4DCQB 5BJTA 4HXAL 4QY8B 5AYUL 3CHFA 3SCPA 2R1WA 4QXWA 3CZJA 3B5GA 3AMDA 4RZCA 3VFPB 2FJHA 3BJ91 3BGFB 3WSQH 1OAQL 2WWDA 1E1FA 3WS6A 5C2BH 5IWLC 2CERA 4N1CA 4YO0B 1QFWI 5FA3A 5CHNB 5DS8A 2OQJA 1IAMA 4BH8A 1ZOXA 1U3HA 3W38A 3UZEA 1IC5H 2P8MA 4M82A 2DQDL 3FMGH 2A6DB 1J11A 2CHNA 1DLHA 4LSSL 2XA3A 1ZLWK 1X5LA 1W0VB 5C0RH 3DX3A 1RUML 1FNSH 3VDAA 2EE6A 1RZJL 4PJFA 1WGOA 4WEMB 1NUGA 5JHDD 4A4AA 1QI2A 1MWAH 2GSGA 4QHNB 3SDAC 3DSFH 3OTTA 4NRYB 3MUHL 3X3GL 4PRHA 4IOIA 5KSUA 1Y6MR 4ISVB 2F8QA 1ES0A 5KAQF 1N2RB 3GGWB 3VH8A 5I6XC 1DBMH 3VVGA 4IMKA 4NKIL 4Z7QE 5BOPA 5C2UB 1DQLH 1TDQA 2XWJB 3TPUB 2IC2A 2A3HA 3HC4L 4R2GC 4TULH 3QIUA 2D22A 1PKQE 3BYTA 3LKSB 5HVGB 1K5NB 5D1ZA 4ZUSA 3UBXI 3A24A 2ZUNA 3BC9A 1HWWA 4Y8DC 4A6YB 3PNWB 3FO2A 3PL6A 4S10A 4PJEF 1DN2A 4L3CB 3WSQL 3CHDA 1UR0A 4JRXA 5C2BL 3AU1B 3IKKA 3ARFC 1E4KC 1INEH 1EFXA 4DKEL 3ROOB 5C71A 1IC5L 1I8MB 4D72A 4PJ8A 1QSFB 4QYOA 3HLAB 5C08E 1GOWA 3HMXA 1P1ZA 4NOBA 4GRMA 3BOVA 1BBDL 1FNSL 4K23H 4J2XA 4PJBE 5JOEA 2P45B 3QDGA 5D6CA 4ZFZB 1XIWB 3PUCA 1UM4H 3LSOA 3DSFL 1NWSA 1HX0A 3TZVB 3MYJA 3V5KA 4RGNE 3TPKA 1U8NB 1RUQH 5FM8A 5F9WC 5IMLB 4NQCB 5D7IE 4HD9A 1I8IB 4LHUD 4MA3B 3RWHB 3RL2B 2GFBB 3T1WA 3M8OL 2G5RA 2VRJA 3B6SB 3BDXA 3O6FA 1BD2E 3ELAT 3ARXA 8FABA 5SV3A 2PYEB 1H8OA 3L4XA 5BXPA 3IFOB 5IW6A 4WV1B 3D52A 4ETQA 3Q6GH 4MB5A 4MS8D 5GGVH 4NGHH 2XJ7A 4M93B 5EA0H 4XNMA 4HPYL 3OZOA 3JV6B 5HHOA 3VWKB 2ADJA 1UH3A 3QFDA 1HVXA 2HVKA 3JVGC 2DQJH 1NC4D 4Z5RA 3CUIA 3WKZA 3TBTB 1MCQA 3EHBC 1Y0LB 2YDSA 1I3GH 1EXUB 1EA9C 3O3DB 4X7TB 1T0PB 5IHSA 4OCLC 4C57C 2DS4A 4ELMA 1HNYA 4ODUA 4N0CC 1UM4L 1V6WA 4JM2C 1KJVB 3LS4H 1YMMB 2A73B 4KI5C 3CUPB 3MZGB 5EOTA 1RUQL 1TVHB 2AK1H 1M01A 4WF7A 1KIQB 2ILLA 3DECA 1E4XH 3U7VA 4X98B 2A83B 1C16A 4PJ5D 3FFCA 4NC1C 4EUPH 1BAGA 1W72B 5HD8C 3L95B 1GJIA 5JMOC 2ZKHH 5HYJE 3MI6A 2GJZA 5GGQL 2A1WH 2FNBA 3EYOB 5DQ9A 3SDAA 4G6JL 1G94A 3P9LA 4OM1L 4YHLL 1XD0A 1R34A 3NIDE 4UDUB 3EYSL 3RY4A 4HS6A 5C0BE 3Q6GL 1JHKH 5GGVL 1MJJB 3QQ3B 4MJIA 4UAOC 3AMLA 1KR0A 3WUEA 2AJZA 1SEBB 3SDCC 3TBYA 3HG5A 4WK9A 3IFPB 2DQFA 4Y4FB 5F89A 3EAKA 3NUKA 3FB7A 1KPUA 2YMXL 4PBGA 1S8DB 5D72H 4L3ED 5HY9A 1I3GL 1X5JA 1KJMB 5BRZE 5I1LB 1YEEH 1M53A 1I1AD 2WMPA 3S98A 3W39B 4JY6B 2GSJA 3TT3H 1A02N 4L29B 1QD0A 4NNYB 4QRUA 1ZSDA 1HJSA 4JVUA 2J79A 3LS4L 1JPSL 2Y7QA 3L7FA 1O7SA 2R23A 3OKEB 2AK1L 3HI1A 5ALBH 1E4XL 4P7QA 4UIKL 5F93C 3VD3A 4Y16B 4R4FH 3VXMA 2ZKHL 2PF6A 4Q9QL 1WAAA 1LMKA 2E7CA 3NIFE 1ERNA 4PRHE 4HS8H 4IHOB 2CO7B 4Z7OE 3GB7A 1JHKL 5DJZB 1T1WB 1UWGH 3OG6B 4G3YL 3L3DA 4NHUA 4LDLB 2N7BA 4WIQA 3NAAH 5IBUB 4V28A 3X11A 2EDYA 3W2DH 2A6IA 5FUCC 2Z93B 4JRXE 5KSAB 3O2DH 4OLXH 1W9VA 2ZE0A 1T4KA 1FFNA 3FQWB 4UQ2B 1QRNA 4N8PA 1XIWD 2WYSA 4HKJB 5IFJB 4X9BA 3CCHB 2ICEB 5IVZA 3TZVD 3CZKA 1XGTB 2B31A 1U33A 4PRID 5J8OA 1H41A 4ONFH 3QEUB 3V6FB 2YEZA 4J23A 1LP9F 6CGTA 4R4FL 4M03A 1FSKB 2AJXH 4NKDB 5DD6B 3BVXA 3F4VA 1F5WA 4NM4H 1S7RA 3QDGE 5CIPH 5SWSD 3JWDC 4PB0L 1MHEB 1AD9A 3MRBB 3JBG7 4HS8L 4YH6A 5FGRA 4MS8C 2PN5A 1FP9A 1KPRA 2EDQA 5DK0A 2ZZUT 1YEFH 1H3XA 4C83A 1NOWA 3WQ4A 4HT1H 4CBPA 3N18A 4FNQA 1VFFA 2B1HH 5JW3L 1F6AB 1UOKA 3GSQB 4XVJH 3SUUA 3NAAL 4DWSD 4QFUA 4OZIA 4QRQB 4IRSD 3W2DL 3P73A 4UQCA 4JL1A 4NO0D 4QAWA 4IS6A 1UWXK 1Q38A 3O2DL 5A6JA 3QFJB 1EDGA 3EBAA 2AJ3A 4D94A 5D96C 3O6AA 3MUGA 5HHOE 3SDCA 1EFQA 5ABGA 1VHPA 4XGZA 2OL3L 2X4TA 4Z78A 1IC1A 3MRDA 4U1JB 5BQ7B 3FHAA 3OIHA 1IGCL 4NQXB 3WDIA 3UTSD 2FL5B 2AJXL 4P9HL 1X6LA 1GL4B 2UUDK 1RV6X 1YMHB 1BQCA 1QHZA 2DH3A 4BSVB 1JUFA 5L2KD 3BWAB 3BGFC 3V0VA 1UWIA 1P6FA 3PTKA 4OGXH 1U8MB 2PBOA 2A9ML 4K71B 3OJ2C 3GUTA 3E6HB 2IANB 4ZAKB 3QDJA 1YEFL 3GSWB 4W4OA 5GRUH 1R3KA 1J0YA 3OGCA 3H9HB 2NTFB 3FFCE 1WUNT 3FRPA 2E7LA 4R8WL 2WHMA 1JF6A 4WKHA 3OJMB 1T6WA 1NGPH 4OF7A 3DDGA 1TJHH 3QEQA 1I1AC 4OCYH 2JIWA 5E1HB 3OB8A 3HR5B 1U9KA 5DR5H 1F11A 2OSLB 1G7PA 4YHZH 2HP4A 4OBSA 5CILL 3IDJB 1RULH 4KFZC 3MLSH 2OCFD 4GSDH 3BPLC 5I1KH 3QO0A 5IEHA 3OXSB 2AXHA 5ID1A 1Q6CA 1NEZG 1IZKA 2MKWA 1GVYA 4NRXA 1RP8A 3EJPA 2WZHA 2QPSA 1Q72L 3K4DA 1OAXH 1RHFA 1WIOA 2JB5H 4RIRB 4HUXB 1IAOB 3OKOA 1G7HB 4OGXL 1W1VA 3RNKB 3WFEH 4XXDA 5C6TL 4OUEA 5ITBH 3QPQD 3MTRA 3R8QA 5F97E 3VXRE 1U8KA 3VXME 1RZJC 2VO5A 2DJUA 2D7QA 5J1AA 3LV3B 1NGPL 2GW5A 2VJXA 1TJHL 3TP4A 1HJUA 5SWZB 4OCYL 5DRWB 3FOMA 3P2TA 4ERSL 1A64A 1IAIM 5EC2A 1Q0XH 4B9ZA 3CVIL 1H3WM 4WI6A 2VQ1A 4PMXA 2Q7NA 3G5XB 1XIWC 5ERWB 1RULL 1VCAA 3TZVC 4PJCA 4FQXD 5I1KL 1GGIL 4WU7A 1FV1B 1QHOA 4I4WA 4ZODA 1BGXL 4HHAB 1LE5B 2RCSL 5M94B 4FMVA 1HYSC 4AMKL 2AK4D 3T0VA 4ZSOB 2JE8A 3MV11 1V3IA 2XY1A 3JV4B 1OF2A 3U4EB 1OAXL 1PX3A 4KJPD 1QLFA 2OZ4L 1FO0L 1K9TA 1TITA 5F9DC 5EOQH 2EDDA 2WCAA 3HZYB 3WO3B 1JV5B 3BH9A 3STLB 2FGLA 1CDHA 4WV1C 1AGDA 4ZDHA 1C5CH 4OZFA 5ITBL 1JPGB 4M93C 5DJ8B 3PZVA 3RWCA 2D4FA 3FQNB 5ESAA 3KPOA 3LEYH 4NN6B 4DWSC 2DTSA 4MNQB 4QOKB 4W6YB 4IRSC 3RHWK 4Y19A 4DCQA 4MNJA 2AV1A 1OPGH 2BSSB 1HKLL 1Q0XL 4WY7H 3VFPA 4L5FH 5J6HB 3CLEL 2PWEA 4KI5E 2H32H 1J9CT 4LYPA 1MQ8A 1NOUA 3BISA 3MUAA 3MSGA 4CKVX 5FKYA 2A6DA 3A67H 3WNNA 1UJ3B 1KJ2H 4LHJB 4BFIB 4XI5D 3HZ3A 2ENYA 3HAEH 2EDBA 1GQLA 5EU7E 3LEVL 4RBPK 1CQYA 1EAPB 2GIYA 1A0QH 1MCLA 1T1ZB 4U1HB 1JPFA 4NRYA 3VXUB 1DBAH 2RIKA 3IJSB 4IMLB 4B15A 3WH9A 4HOZA 3SE9H 3LPPA 4ZAKD 2BSTB 4M3KB 1S9WA 5KVFL 3SJVA 3LEYL 4HZLB 3ZE1E 1CDJA 5DHYB 1FP8A 2AAVA 3O2WH 1LO0H 3LKSA 1JDCA 3P4MB 3PN8A 1K5NA 3F7RA 3PZUA 2HRPH 3G9VA 4WY7L 3PNWA 1X5AA 4M24A 4KTDL 4L3CA 3MR9B 4OFKA 4W4NA 3A4AA 1UADC 2ZX7A 1ADQH 2PWFA 2I07B 5FYJH 2XVNA 2HFGH 3D2UA 2JCCF 4WKAA 1NP2A 1N4XH 1CDYA 3RJYA 1AP2B 2FGWH 3ROOA 3BLPX 1ZJAA 2NQCA 1VGKB 1Z2KA 5JMRA 3Q6FB 3GBLA 1AH1A 1QSFA 4OLZH 3QEQE 1W3LA 3HLAA 4Y16C 2ZUVA 4JEGB 3A23A 1PW3A 4XVTH 4DGYH 1IQWL 2WVTA 3RHWF 3AIUA 1SJXA 1ZLUH 3U36A 4ZFZA 5KW9L 2MMXA 4CW1B 1DBAL 4NSBA 1OL0A 1W32A 1P2CB 3REVA 3MRJB 3SE9L 1V6YA 1U8NA 5IMLA 4NQCA 1WCGA 2IPUK 4V2XA 3P77B 5DJXA 2PETA 1I8IA 4MA3A 4XMLH 3EJUA 3RL2A 5FUCE 2AP2A 4OLEA 4NF7A 3O2WL 3P30H 4M8QB 3Q3GB 1D6VL 3I75B 4XCCL 3B6SA 4V2CB 2HRPL 2J7LA 4FNSA 1CFTB 3I6KB 1B0IA 4GZJA 1FNEA 4HA4A 5AC5A 2FIKB 2PYEA 3SE4A 3BAEH 2HFGL 2Q1EA 4WV1A 1N4XL 3WCYA 2A6JB 3FB5B 4FQXC 5KS9B 4XNYL 4IPLA 4XX1E 4GMTL 3JV6A 3VWKA 2OXGA 5LXGH 5KANG 1ZEAH 4OLZL 4XVSH 1T0MB 1Y0LA 1FSKC 1EXUA 3NN8B 5EO1B 4XVTL 4DGYL 1I3VA 4K2UH 1FCCA 4S3JA 2CGRL 3DC0A 1VESA 4GKOA 3L3JB 4MJ5B 3S35X 4PJCE 2DDQH 1YMMA 3ZDYE 5HYSA 1H49A 1TVHA 3QZWB 1FHLA 1KIQA 4XP5H 4X98A 1XH2A 2N1KA 4RFEA 1MRCH 1W72A 4K8RL 4O2EB 1M04A 2R2EB 3P30L 2KUTA 4MNQD 5HI4D 1UWRA 5EU6A 4WW1A 1RUPH 4TVUA 2ADGB 3NFPB 2KZWA 1EIBA 4Z7UB 2JJWA 2XTJB 5HGAB 2ZSVB 5H35B 3GSNA 4JLRB 2YKLH 1MJJA 3QQ3A 4I48B 2W38A 4NIKB 1TA3B 4Q7DA 1SEBA 1WZAA 4Y4FA 2D9QB 1VJSA 4AC1X 4Y4HA 1ZEAL 4QO1A 5C3TA 4XVSL 5C0GB 1S8DA 1E5NA 3TBVB 4FLRA 1KJMA 4GRWH 5I1LA 2DMCA 1DBKL 1ZBKA 2ICWJ 3GXPA 3S2CA 4YBLB 4MQXD 3LXCA 4L29A 2YIHA 2ERJC 3D9AH 3L6FB 4NNYA 3U2SB 1HJXA 3GI9L 3O9WA 1IGTB 2X6MA 4K71C 4LF3B 1MQQA 1V0KA 3OKEA 3EOBB 4XNUH 4ZAKC 3RWIB 4QNPE 5JW5B 4PN2A 3EYPA 3UPRA 3IDMB 1QBML 1BAFH 1U0QA 1MRCL 2V7HB 4J6RL 4Y16A 3QXUA 5CZXD 2E8ZA 1TZ7A 4HX1B 2W4XA 3C08H 1OSZB 1NBZA 3MUY1 5SX5K 3EIFA 3MO4A 1X44A 5F7LB 2Y4SA 2IMMA 4IHOA 3FONA 3OX8B 3N1PC 1UR8A 2O9PA 1KACB 2QADD 4X6DB 2XT1B 1HSAA 3QG7H 1ZTXH 1EHXA 2QL1A 3CLFH 2VI0A 5DJZA 1OD0A 1T1WA 3UAJD 2XN1A 5D9MA 4YNYA 5DMIH 3RKPA 1T7YA 4NXSA 2GQHA 5FECB 2J7FA 4BQCA 2BVUA 4XP9H 4R7NB 4HKXB 4YHYB 1DWIM 3WF2A 4U6HA 1JCKA 4H20H 1Z32X 4PRWA 3L3HB 2P5WB 4PJHB 3RUGB 1UM6H 5KSAA 1CFSB 3WH8A 3FQWA 4UQ2A 1U30A 1YEHH 1OT1A 1U6AL 4HKJA 3WELA 5DQJA 3CCHA 1N3NA 3AUVA 2DQCH 4RSVA 4XNUL 3CO4A 5IG7A 1B9ZA 4UBDD 4DZ8A 1QSFE 1YECL 1PAMA 5I8EB 5IB5B 4Z2IA 2WVUA 3HFMH 3TO4D 2MTPA 3H54A 4UQ3B 2WW8A 5DJDB 2XN9B 4F8QA 3C08L 3REWA 1FFRA 4K9EC 1XCQB 1MHEA 3MRBA 3CK0H 1SEQH 2FHFA 3SE3A 1BVNP 4HC1A 2FRGP 3LN4B 1A3LH 1KR1A 5IP4A 4L4VA 4BSJA 2ZWYA 3O41B 3CLFL 3M7SA 2D9CA 3WD2A 4NQCE 3MLWL 3QQ9C 2Z92B 5DMIL 2WMKA 3WDPP 1EH9A 1K85A 1F6AA 4G6AD 3GSQA 5EUOA 4OZGB 4XP9L 2Y07L 4EIZC 4HK0B 4QRQA 4H20L 3GMRB 1B3JA 2OJZH 3AXIA 3MYZA 2PYEE 4TN9A 3V5DB 2E6QA 3QFJA 1UA6L 3MV7D 1AQKH 3IYLW 5JBEA 3N9GH 3MSDA 3BP6B 2ICWI 4K3GA 4EQ3A 4W8BA 1QNZH 2DQCL 3MQIA 3EMQA 2OW7A 3POCA 5E95B 3DV4B 1UQYA 4FXLA 3RU8H 1MREL 1MFEH 4U1JA 3T1FB 4AD5A 5LGJA 4NQXA 3C8HA 4EK7A 4MXVF 1EDQA 2FL5A 5HI4C 5DF0A 2CPUA 4BQ4A 5JZ7D 5FYJD 5LA2A 2AS5M 3DLQR 1TFVA 3WDRA 1OT2A 4BSVA 1SY6A 3CK0L 3VRLF 3EUUA 3QG6B 2EH8H 4JO4L 1YMME 1U8MA 3OKYA 1KB9J 5HHQB 3NPZB 1GGBH 2IANA 1DJSA 2VDOH 5HSFA 2XGIA 1QQDB 1A8JH 2WBKA 2NTFA 3UDWC 3GJFK 3WFZA 4NFBA 4YDVA 4JY5H 2E3VA 3BIAX 3WUZA 4HS3B 1IGFH 2DSZA 4OQTA 4QT5A 2OJZL 2ID5A 1G9HA 3HR5A 3VFGH 5CPQA 1VPOH 2OSLA 1AQKL 1M6OB 3D3AA 1UQZA 3N9GL 3IDJA 3MRKB 3WHXB 2R56H 1CS6A 1G9NL 2ZG1A 2IWGA 2BDNH 4Z2LA 3OXSA 3DPBA 3RU8L 3SBWA 3HUJF 5CZXC 3FXYA 8A3HA 4ODWB 4PMVA 5A2CA 4PFEA 1B90A 2QQLL 3FZUD 3FRUB 4CUCA 2C1OA 4RIRA 4IJ3B 4HUXA 4DVRH 1S7QB 3MXVH 5DSCB 2HN7A 2QADC 4JFHE 2J2ZA 4GS7C 3RNKA 2WINA 3QI9B 4FQIH 3AGVA 3SCMD 3WQ6A 4R0LB 3PXHA 4CDHA 1RZKC 2XXMB 4JY5L 3QNZB 3OWEA 1W0WB 3CDYA 1PLGH 5SWZA 3DMMD 5DRWA 1CL7H 5FO8A 2A3BA 1CZ8H 1VPOL 2P5WD 5LA0A 2PO6D 3G5XA 1OQXA 2ARJQ 4PMOA 2OJEB 3A6CH 1BBJB 4BFGA 4UBDC 3KE0A 3FFDB 3PWNA 4HBQA 1FV1A 2BDNL 4UB0H 2Y72A 1YYMH 3IF1B 4HHAA 1A5FL 1LE5A 3ZHDA 3SEPA 3TO4C 3TYGH 1HI6A 4NRZB 4XWOD 4ZSOA 5TPWL 3JV4A 3U4EA 2EO9A 4O4YL 5KSBF 4H8WH 4DVRL 2WHLA 2R4SL 2ZJSH 1MW1A 1SHMA 1JV5A 4YAQB 3STLA 1VEMA 4O2CA 4Z0XB 4H2CA 4WI5A 3INUL 4URTB 3QOKA 3GXIA 5DJ8A 3FQNA 4JANB 2DD8H 4QGTA 2EAEA 2Z35B 5FYLH 4TVDA 4LGRB 2WKLA 2P24B 2WVVB 5GS0H 4QOKA 1NGQH 5AZEH 2F9BT 2FYVA 2EEAA 1PLGL 3MC0A 3BCDA 4I13B 2NY2D 1TZIB 1I3RB 3CMGA 2BSSA 1V0NA 5J6HA 1DVFD 1CZ8L 1IAKB 5LBSL 5TGBB 4HLZH 5GRYA 3IDIB 3UTOA 1BG4A 4G8EB 3A6CL 1FVEB 5ENWB 5FHAL 3QUMH 3T04D 3BE1L 3TM6A 4LCUB 4BA0A 1XF3B 5D7JB 3O6KL 4LSRH 3UDWA 1QUNA 4GXUN 1YYML 5CS7A 4WI4A 1IJ9A 5JIKA 2AGJH 3PHQA 4LVNB 4P2QD 1R6VA 1LDPL 1UJ3A 1KB3A 5JZ7C 2FX7H 4BFIA 3QFJE 1KLGB 3ULVH 1FGNL 1EAPA 4H8WL 4UQAA 1T1ZA 2ZJSL 4U1HA 4HOXA 3L5WB 3VXUA 3WNMA 3RTQD 2VZ1A 4IMLA 2XTJC 4JVPA 3O4LD 5I19H 3NCEB 3Q48A 5J0BA 3MJGX 3LRGA 5K59F 2BSTA 2DD8L 3NCCB 5DMGD 2D73A 4S1RH 2QQQA 4RFNC 4ZOBA 4HZLA 1TFHA 4O02L 4JZJA 4XP4H 1XCXA 3TA9A 1NGQL 5AZEL 3G5YA 3GXNA 5IQ9B 4U6XB 4HGWB 1L8NA 1IAII 3CFBB 3MR9A 4HJJL 4D1IA 3O3AB 2I07A 1GZPB 1RU9L 2IANE 1U3JA 3QUML 4KVCH 3L2MA 1ISXA 3OSKA 2F74B 4LSPH 1AP2A 1GJWA 4LSRL 1GGCH 4HWBL 1VGKA 3CJJA 2Y9RT 3Q6FA 4YHPB 2WMHA 1KUMA 3L5XH 1XGYH 2WANA 3QUYD 4Z2GA 1KIPB 3GKWL 3FZUC 3VD5A 2VZ3A 5GGTH 2EDXA 2AABH 3MOBH 3S4SG 4ORGB 1P6WA 3K2UH 5DD0H 2EADA 3PQYA 1YY8B 3VG9C 1FNHA 1XYFA 1S78C 1P2CA 2IF7A 3MRJA 4WFFD 3SCMC 1VFBA 5IDIA 1T89C 1KB9K 3JTSB 2YZ1A 3QI9D 3P77A 1DDHA 4S1RL 1WFOA 4U6YA 2ATKB 2GUYA 2VLRB 1EGJH 1P9MC 1LEIA 4M8QA 3DMMC 3Q3GA 4YHYC 5M3WA 4OSUL 2CNCA 4WWKA 3I6KA 4PP1D 1AC6A 2WBGA 3OKLB 2PO6C 2ZPKH 1WT5C 1DEEA 3CFCH 2XZZA 4OTXH 4J1UA 1HILB 4UNTA 2A6JA 4NT6B 4LOUC 4KVCL 1DBJH 5KS9A 1BP3B 4LSPL 4C56B 1TJIH 5J13B 4JFZH 4D0BA 1NMAH 4JHZA 5F7EL 2CRZA 1GGCL 3K4ZA 4JHBA 3WXWL 4GKZA 1V03A 2DQEL 2XQBH 3SGDI 4XWOC 2FO1A 2XVKA 5SWZE 3L5XL 1XGYL 2UY4A 3IRZA 3G5VB 3NPSB 3NN8A 2R2BB 4Z0BH 5EO1A 5IB3B 2AABL 1VDGA 3AMKA 3MJ9H 3N85H 2VRQA 1VA9A 5FUOH 2X7LB 2WC3A 5ABFB 4P8UA 3SCSA 4WI8A 2MJWA 1LP9B 3L3JA 4LIQH 2Z9TA 4MJ5A 4OF8A 1H3GA 4K3JH 2ENSA 4ZQKB 5E03A 1DBBH 3FT2B 2M8XA 2WW5A 4GZEA 2E9BA 4IDJH 1BHGA 3DGCR 4JPIB 2Q7YA 4ZSOE 5JQHC 4UFLA 4O2EA 1H4PA 2R2EA 3DUSA 2NY2C 4UT6H 1UQSB 5E7FA 1CWVA 2OS7A 4JO3H 1DVFC 1RPQA 3BKMH 5EBGA 4AEIL 2A2QT 2ZPKL 2ADGA 1UWXH 1BFTA 4IOSD 3CFCL 2C4XA 3WIFB 5I1CH 4OTXL 5B39B 2ZSVA 5H35A 4JLRA 1DBJL 2VXVL 3O2LA 4WTZA 4H26B 4JFZL 1UEMA 1BF2A 5D7JD 5BVPL 4MNQE 4QOKE 1KBBA 4J12A 2XQBL 2ZUTA 5C0GA 1H0GA 1U8OB 3TBVA 3W0WB 5T33H 1KXQA 3MJ9L 3N85L 3NABH 1H09A 5FUOL 5BZDB 2O61A 1XT5A 5A3HA 1KB5A 4Z9KB 1AJ7H 3QOMA 4K3JL 4V2BA 1IGTA 1DBBL 1H3PH 4LF3A 3EOBA 5JW5A 4IDJL 3VJ6B 5DMGC 4E41D 3IDMA 2G60H 5TH2B 4M6OL 4QRTA 2WCGA 2VLJD 3PZ9A 1UCBH 1G7QA 1KPVB 4IRJB 4DK6A 2W63A 5DHVB 3KXFB 3L4ZA 4YHEA 1B6DA 4UT6L 4FFYL 1EJOH 3RWFB 1OSZA 3U7YH 1OW0C 1X4ZA 3AS2A 3C09B 4Q22A 4JO3L 1T0NB 2EIZB 4AD3A 1K4DB 1MXDA 3EBVA 3VXUE 4IIQA 2APFA 1S5HB 4POZD 1B4JH 5GGRY 3HNVL 3QCUH 4U1IB 3TBSA 4WKFA 1OTSD 3VU2A 1DUZB 4X5WB 1T89A 2FE0A 3WLWD 5I1JH 3LS5H 4P7LA 1AGCB 4YE4L 1JI2A 4BQ6A 3S8WA 2VQTA 5FECA 3WN6A 4R7NA 4HKXA 4IOFD 4WHYH 3T3PE 4GKNB 3L3HA 3MA9H 5F1NA 5T33L 2I60H 3LOWA 1FORH 3RUGA 4RMQA 3QJFB 1CFSA 1PEWA 1WT5A 4IJ3C 1UA3A 3G04A 3DETD 5FYLD 1H3PL 3CC5A 2VX7A 5GS0D 3N17A 3ARRA 4JGUA 4M56A 4YXHH 3QI9C 1WZLA 2GUOA 3HE7D 1BYCA 4R0LC 5JPNA 2Y5TA 1UCBL 5EIVA 1A4KA 2Z0BA 3P4OB 2P46B 2XN9A 3RAJH 1UENA 35C8H 5FOBB 4PP1C 1C91A 2FATL 3WJLA 4EDXB 2OM5A 1TQCC 1R47A 4KGJA 2YL8A 1TCMA 3O41A 4Q97A 3BUYB 2I27N 2GJXA 3A6BL 2X4PB 4FFZH 3H7LA 3O4OC 4C56D 3GH4A 3LS5L 2B2XH 4XCFH 3U9PH 3T3MF 4I3GA 4JY4B 4TSAH 4PGBB 5DUML 3IK2A 3ULVD 3VIIA 2D2OA 5DVOA 4LPWA 1DQDH 3U48A 4ALAH 4ZXBB 2DWEA 2B20A 2J4GA 5KS9E 2COQA 2MANA 4JKKA 4LPYA 3BSGA 2YD5A 2X89D 5I79A 4DO6A 2XG4A 4YXHL 3DV4A 3QHFH 4D9RD 4A2MA 5C0JB 3O3EB 3T1FA 3WUWA 1R3JB 3HI6H 5E8OB 1MLCB 2HISA 1TMQA 2A3CA 4WI3A 4XMPL 3MV01 1MVYA 35C8L 3BLBA 1U93B 2YD7A 5ISZB 2BJML 4ZPVA 2DLFH 4ZTPH 3TCLB 5F96L 5GS1A 1Z3GH 2XVPA 3R0MA 5CAYB 4GMSH 2F2HA 3JV5A 3S34L 3QULB 3O3UN 2FWOA 1AO7B 3ARDB 5HHQA 4RE3A 1QQDA 5GPRA 6A3HA 5D7JC 1LF1A 2BZDA 4NWUL 4Z77A 4CADA 3U9PL 1IV8A 4LMQI 4TSAL 3ZL4L 3O45B 4HH8A 3T8XB 4M48H 2GEEA 4XZUB 1OW0A 4HS3A 2O5XH 4O58H 3VW3L 2GDUA 4L3AA 2OSYA 4P2RD 4TVPH 4WIWA 1B3YA 1DQDL 4ZE5A 4Z7UE 4B16A 2XTJE 1M6OA 2F1BA 3LKOB 4RMTA 1QG3A 2O92A 3MRKA 3WHXA 3CPLB 3HG1D 4AMCA 2UVEA 4X0KB 5DZNA 1NMCB 4H8UA 3KJ6H 3TWCH 3CC1A 4J4PA 5GGUB 1GPOH 2Z4QB 1RHHA 1JGVH 4ODWA 3L9RA 5FIPA 1FL5B 3FRUA 5IT2H 3KXFD 1GC1L 2OYKA 2AEQH 4LLVA 2DLFL 3OXRB 5DSCA 4C4KT 5IMMB 1Z3GL 4Q74A 1SR0A 1S9VB 4MAYB 4FN0A 3WLWC 3VD9A 3OA5A 3CZFB 5HOSA 4IRZH 4MDPA 4PJEA 4YEFA 3HA0A 4AZ8A 4PIRF 2XVLA 3KPLB 5HXMA 2AJSH 1FBIH 2ARJB 2JCCB 1AI1H 4M48L 1ETZB 2VLKB 3QNZA 4H8WC 4IOFC 4M9PA 1W0WA 1J8KA 4GZIA 1YQVH 3EOAA 1BWWA 4O58L 4AZHA 1RK1B 3AYSA 1BYDA 3BPNB 4TVPL 4LSDA 1SZNA 4F7EB 3PV6B 4KZEH 4X6DE 3V8OA 2YUXA 4NKMB 5EBMB 1QOXA 4PPTA 1BBJA 1EJ6A 5GS0C 5T5FH 2C3XA 4GXVL 4F8XA 2GY5A 1AD0B 4XMKH 4AL8H 4CN6A 4X83A 5IUSA 4U6TA 3NTCH 5CGMA 4FHBD 3KJ6L 5GS2H 1YN6B 3FAXA 1GONA 3GBDA 1GPOL 1JGVL 4XPTL 4LSQL 4NRZA 3KYKL 5ETUB 2P5WE 4PJHE 4YWGH 3RUGE 1ND0B 4FQ1L 1XF4B 2HFFB 4MB4A 3GM8A 4I77L 5AYQA 3T4YB 2F53D 4YAQA 4YQXH 2XN0A 4PG9B 4E8CA 4Z0XA 3RY6C 1EVTC 4JANA 4M4PA 2E4TA 5GNYA 3WV0A 2Z35A 5F7YC 3S36H 1F02I 1FBIL 3A47A 4JKWA 1LWJA 3ULVC 4CMHB 4LP5A 2XN9E 2XFFA 2APWA 3U9UB 1YQVL 3OZ9L 3B5TA 3NPSC 1TZIA 3OKDA 5CLTA 1I3RA 1WO2A 4F57H 1XSIA 1UKPA 2VCCA 1KGUA 1X1NA 2Q3ZA 1IAKA 3K1DA 4JPWH 5TGBA 4QCIB 4JFTA 3IDIA 4G8EA 2XKUA 1FVEA 2BNQB 3LAFA 4HKBB 3MLZH 4WFHE 4YGAB 1NCTA 4LCUA 1XF3A 1EUUA 4XMKL 3SKNB 4JJ5B 1NFIB 1EHNA 4OZGE 2D0GA 3ARVA 1JMZA 3C5JA 5T1LB 1V7MH 2JIXB 5DJ6B 3DUHA 2ITCA 2VXQL 2OMBA 3DVGB 5M17A 5IJVB 5ISZD 4XTRD 3H0TA 2X2HA 3CDGB 5H37G 3TJEH 4YQXL 4YXLH 3JTTA 4HUKB 3ARDD 1TZGH 4YHOL 2IADB 2DL9A 4N0FB 2XA8H 4L8DA 3E3QC 3NJ3A 5E4EB 1ACYL 3G6DL 2IAMD 4YIQA 3MOQA 1KCSH 2VAAB 3FO9B 5GIRB 5IQ9A 5KJRH 1QR1B 1C7TA 4D1JA 4HGWA 1BJMA 2BC4A 4ATWA 3UTTA 4AG4H 3A4WA 3CFBA 4ACPA 5C86A 1CTNA 5KVEH 3QXDB 4Z8FH 3LKRB 3SUTA 1GZPA 4OGYH 2WIMA 3MLZL 3UX9B 2F74A 2NY6D 1AE6H 1NKRA 3QR3A 4YHPA 1RZ8B 3KLLA 1C5DB 4PGCB 1Q94A 1KIPA 3VFRB 1A6WL 2ORBL 2XRAH 4ORGA 1BTCA 3C09C 3AB0B 2HFEB 1YY8A 3TH3T 3LXBA 3TJEL 4AZGA 4YXKH 1DWGM 4X7CC 4YXLL 1IMHC 4JHOA 2R0LH 3JTSA 5C0AD 5KZCD 3WFCL 2FCBA 4ONOA 1CYGA 3KL0A 2GJ6D 1R3IH 2VLRA 5I30H 5EOCH 2J8HA 2VLKD 2W9EL 5KJRL 4NBYB 2C0HA 4HJGB 5EULV 3TC9A 2DMBA 3OKLA 3D3VA 4KRPD 5BXFB 5KVEL 2BNUB 2JF6A 1MRDL 4G80A 4Z8FL 3G6LA 1ZVSA 4NT6A 2OL3B 3PHSA 1HHKA 2RQ8A 2WHKA 1HDMB 1ZVHA 2VDQL 5MI0C 1JZ3A 2R1XB 5F3BB 4PR5A 3G5VA 2XRAL 3KPSA 2BXYA 2FBJH 2X7LA 1B0GB 3T09A 3WEXA 5H94B 1MUJA 4JFYB 4TVCA 4I0KA 1LP9A 1B2YA 1KXVA 4WHCA 3Q2CA 1NC2D 4YXKL 4ZQKA 1E4NA 2F61A 4OLWH 3FT2A 1FFPA 1WZ1H 2PTTA 1ZA6B 1GQJA 4WGVB 4I0PB 4AIEA 1QSEA 3HRZA 2XWEA 4PEEA 2FD6H 4PTUB 3O11B 3NIGF 3MRRB 4JPIA 4P7NA 4TVPD 4GQ9H 5I30L 5EOCL 1JNHB 3S36X 3PP3H 3II1A 3WMSA 5BVJB 4H0HB 4MD0A 2FX8L 4OGAD 1UQSA 3EDFA 4NOFA 5EZOH 4HFUH 5I1DA 1XSKA 2VXUL 5T1KB 3RVUC 3WIFA 1AY1H 1S3KH 5B39A 4NQDA 3AMCA 4NO2B 2APTA 3TV3L 5BXTA 4NZRL 4H26A 3NFNA 1KIRB 4JQVA 4U3HA 2MKLC 4P7OA 3I6LD 4N1EA 1MCPL 5I75C 1TENA 2VR9A 1XR9B 4OD1H 2X1XR 5T1LD 3MRFA 5A1AA 2CKRA 3W0WA 3Q5TA 3NCJL 2FBJL 4AEHH 1JK8B 5BZDA 4PJDF 1N59B 1M71B 4XTRC 1JWSB 4UI2A 1UR4A 4F79A 4N0UB 1I9IH 4NSKB 2PXYB 4OLWL 5DRNB 3ARDC 3BLKA 1VBRA 3PZIA 5T3XL 3VJ6A 1VFMA 5ESVB 2IXUA 3VXSB 3QNXB 1XFPA 3O8XD 3ZT5A 5TH2A 1CXIA 4GQ9L 4IRJA 3L7EB 2J74A 5DHVA 3GH5A 4HWZB 4DTGL 3KHOA 3RWFA 5EZOL 3U0PB 1F6FB 2NY1B 4PLJD 3VFMB 3LH2L 1S5HA 2EEDA 2X9YA 2XQYK 4GJTB 4XPAL 1AY1L 5A3IC 1LE9A 4U1IA 1SYSA 1X9QA 5GS2D 5MEPB 1DUZA 4X5WA 3C8KB 5IHZA 4EN3D 5BYWA 1AGCA 2E7BA 3BKCL 4WFGD 1Q6FA 1NMCC 1NM9A 4M43H 2F5BH 3CZSA 3FN3A 3VNZA 2H3NA 4OCWL 1IC4H 3WY2A 3ZKSD 5FXCH 4ODXA 4OD1L 1FO0B 4GKNA 1XGZA 3CH9A 4JFDB 3FT4A 4AEHL 2ZUYA 2VZSA 3HNTH 4D6DA 4OJFH 3HUJB 2DQIH 1BVLA 1I9IL 1X5YA 2QSCH 1V7NH 3MOAL 4KRLB 4O5LL 4OUUB 1MFVA 1NCDH 2F8XC 5GSVA 4RWYL 3OGVA 5E2WH 3ZJ7A 2XNAB 1ACZA 3NDYA 3QAZB 4BKLB 1H3TA 3ZE2F 1RIHH 2J8OA 4UQEA 4LGPB 5FOBA 1GORA 3PWUB 5ITFB 3D69B 3K80A 5C07A 1G1YA 1NGYB 1MVUA 3MRCA 5EH1A 3BPNC 3KJ4B 12E8H 4KRPC 4P3CH 5FYLE 2DLTA 3S6TA 2CDEB 4ZENA 3Q5OA 3EGSB 2J88L 4AIZB 1UD8A 3BUYA 2PNDA 1C8PA 1OSEA 5FB8B 3GJEA 3QJHB 5I71B 5E8PB 3SGKC 1UKOA 2VLRE 2F5BL 4KU1A 5SV4A 4BM7A 3TTYA 1JJUA 3MFFB 1R75A 3ZM8A 1KJ3L 4U3AA 3THDA 2W61A 4Z76A 4FNUA 4BK5A 1X5IA 1KLUA 2VE6B 4PGEB 3BXNB 4OJFL 4ZXBA 1UD2A 2Z31B 1K6AA 4C56E 1K9EA 2O26U 5A6BD 3GJFB 3TH2T 1ZA3B 4DEPB 1AQMA 2IUZA 3QIBD 5C0JA 5BWFA 3O3EA 1KIUA 4I0PD 2DIJA 5E2WL 1EX0A 1R3JA 5AYIA 1AIFB 1MLCA 2DICA 3PWJB 1FP5A 4RMRA 2YD9A 3WFDH 4OGAC 3ZMRA 1RIHL 1NBYA 1U93A 4DFIA 4F33A 1LP9E 5GNXA 4AISA 2EPKX 2GK1B 1UH4A 3TCLA 5DWUH 1E27A 1OB1A 4NM8H 4U1MB 5T1KD 2X4NB 2R15A 1MEXL 3QULA 1AO7A 4LSTH 1VFAA 5CBEB 3NFSH 4K55A 1E73M 2WIIA 4HH9B 4MDIA 1D3CA 5E8EB 5D1QA 5F88A 2AOSA 3O45A 3T8XA 2KDGA 4R7DB 4YDLC 3EO9L 1W9XA 1Z9OA 4Y1AB 4UIMA 2Y6SD 4YPGB 5BO1H 1YNKH 2WBJB 4RX4D 1CE1L 3ILQD 1ZHNB 2WP3O 3ARGA 1ED3A 3RO8A 4UFMA 1PZ5B 2OR7A 3CPLA 2PXYD 3E3QE 4X0KA 4GOSA 3O8XC 4H1LG 1CLOH 5B38G 3VXSD 2F19H 3T0ED 3MMDA 2Z4QA 3WXVH 3QNYB 1QBLH 4JDZB 3W0WE 3FW6A 3C6LB 4PBVC 3BKJH 3ZO0A 4Y4KB 1FL5A 4XBPB 2ICWB 2EXWD 4KQ4H 2ZUMA 1LQ0A 4F3FB 3WUBA 4O2FB 2UWEB 2NY1D 4OLUL 5L2KA 5IMMA 4NM8L 3SKJH 1S9VA 4LSTL 4MAYA 2B5IB 4PUBH 4JR9L 2NYYD 1K8IB 1Q1JH 1W2VA 2XOTA 3NFSL 3CZFA 4EN3C 2A3AA 1FIGH 4DGVH 5FYKU 5TDNB 2PKDA 1EO8H 2P8PB 3KXFE 2JCCA 2NSXA 2GK2A 5D2NB 2VCBA 2B39A 3ALWA 1RK1A 4K7PH 3D50A 2IPKA 4JFDD 5BO1L 4F7EA 4F2MA 1YNKL 1U91B 3AB0C 4Z2JA 5J12B 2BNRB 4NKMA 3VM5A 3MJ7B 5EBMA 2MHAB 2GJRA 4NNXB 1A1MA 1U92B 2HA1A 4RMSA 4UINH 4O9HH 3BDYH 1AXTH 2IH3B 3P9WB 4HUMB 4AQOA 3GBNL 3WXVL 1QBLL 3A5VA 5E0CA 3VIMA 1RMFH 1LD9B 2XWTB 3BKJL 4X4YB 4ZO9A 3C2AH 4HBCL 1XF4A 5DEGB 2HFFA 1NGZA 5GSRA 1NCBH 4UZUA 1CGSL 4DKDC 3T4YA 4FK9A 1PQZB 1IL1B 2HRLA 1S9XA 1DN0B 1EZVY 4G8IB 4PUBL 3SKJL 1KWKA 2J7GA 5IVNA 1Q1JL 1QNSA 1U58B 4TSBH 3WDHA 1CGXA 4DGVL 4XHJD 1OP9A 3MRHA 1G0XA 1M03A 4WI9A 2R1YB 1CLYL 3U9UA 3JWOC 1ORQB 2QF8A 4P57A 4K7PL 5EUKA 2FLRT 4KRMB 4PJIF 1VKXB 3C5ZB 1HQRB 4PB9L 5JXEC 2NW0A 2AEPL 5FYKL 5EZIL 5DT1L 2Z31D 2BNQA 4HKBA 4S3KA 4NJAH 4MAZA 1GUVA 2ICES 4W88A 3CNKA 1A47A 3DX7B 3IJ8A 5CJXC 3OJDB 1X5HA 3SKNA 2XSAA 4UINL 1LHZA 4I0PC 4JJ5A 3A3HA 1NFIA 3BDYL 2CYGA 3BESR 4CVUA 2JIXA 5DJ6A 1IKNA 3B83A 1D9KD 1MCIA 4K3EH 3WL1A 2O5YH 1KQZA 1R3HB 4UILH 2XI9A 4PJXF 3O3BB 1IAIH 4BZ1L 5DJ2B 1MLBB 5EIQA 1LEKA 5EN2A 2F54D 4U33A 5DFWH 3K8LA 1DWAM 5IB1A 3QWOB 4TSBL 1FVDA 1CZ1A 3AICA 4R90H 1FZMB 3DNKA 1FYTD 1WKYA 3DURB 4N0FA 1JZ4A 2J7CA 4XAKD 5ALCH 4LSUH 4FTVA 5DJ0B 5GIRA 4N68A 5ISZE 1QR1A 1HWGB 3ZTJH 4X9IA 5EFFA 3VD7A 4OFPA 5IJKA 3ILQC 3QXDA 3VGDA 3LKRA 3EYUL 1AO7E 4MQ7B 1BIIA 2VX5A 3PWPD 2WBWB 2PXYC 1F4WL 3H3PH 3FJTA 2YL6A 4X6EB 1L7TH 3CFKA 3T0EC 4N8VB 2WKGA 1D5BB 1RZ8A 5IGXH 1C5DA 2NY7H 3GM0A 3UJJH 1MQRA 3VFRA 4K3EL 1OAUH 2O5YL 1KG0B 1BFOB 3C6LD 3QHZH 3CIQA 1W8OA 4QRPA 4UILL 2NY1C 2HFEA 5ANMB 4X0NA 2X40A 2C1PA 3WD1A 4Y2DB 2AQ2A 2XZQH 4GFTB 5F8QC 3AFLA 4PRDB 4QWWD 1T3FB 1T6VN 4R90L 5D8ZA 3OKKB 4OZIF 1CENA 4WJXA 3N06B 4NX0A 1A3QA 2F58H 3B9KA 1RJCA 2LV4A 4OQ1A 1FC1A 4PREB 4BS0A 3OMZA 4OI9A 2AJYH 2IH1B 4C59B 1QI5A 4U5KA 3LKQA 3QQNA 1VADA 5BXFA 4TSCH 2BNUA 4Z2HA 3X3FL 2UY3A 4R9HA 5K9QG 4JFXB 2OL3A 5C0EA 3V7AE 2AMGA 4AH2A 1EDTA 4KHTH 3K2MC 2I9LB 5DDHB 3V6OC 5A8OA 1HDMA 1SMDA 2JCCE 2VLKE 5F3BA 4FFWD 5IGXL 3WD4A 1P6AB 2V2WB 3OAYH 2NY7L 3QAZC 2BHUA 1IQDB 5I17A 2F8VA 1OAUL 4GLRH 1B0GA 1CLCA 3VDBA 3UEZA 2JEPA 4X0VA 2ESVA 1J1XH 5JXEA 3KJ4C 4P5TA 3LY6A 1NQBA 2XZQL 5CJXA 2NZ9D 4F9LC 2JJTC 1TPXC 4XHJC 3W26A 1T04A 2HJFB 4PMNA 3F5WB 2ZCKL 1OGSA 4OB5H 5IB2A 1JNHA 1CNVA 1OM3L 2AJYL 4I18C 3WIIH 2VN4A 3ARWA 4LHUG 4XX1G 5D5MF 1HIMH 2BXZA 4TSCL 5EIIA 3PZOA 4PTTA 2Z31C 4LEOB 4NO2A 3D0VB 3C60D 2HLAB 3TONA 5D7KD 1KIRA 4YGVB 2F7PA 5CSYA 1ZVYA 3BCFA 5F1IB 3E6FB 1MCHA 1RD6A 1X5XA 4FZ8L 1D9KC 5HVHC 1K8DB 1XR9A 1OP5H 1A9EB 3I50H 2P43B 4MWFB 5EZJB 2A6KA 5CEZL 1JK8A 4HW6A 3KPMB 1N59A 1M71A 1EBPA 3H2WA 2EICA 2BNQE 4UNUA 2UV3A 4TUJA 4N0UA 3I6LE 3SPVB 4Z7WA 1GCYA 1PG7X 4Y2OA 1MCRA 5ESVA 3DV6B 5DRXB 3QNXA 3WN5A 3D4YA 3AXHA 1FRGL 2EDWA 3LHPH 2B4CC 4OB5L 3GIVB 3V95A 3L7EA 2QQNH 3QGVA 3BRDA 3BUTA 3I02B 3U0PA 2VLLB 3VI4F 3VFMA 1HIML 1WDSA 4HMDA 2R0ZL 3KGRA 3C8KA 1MHPH 5D1XD 3T0AA 1MQKH 1DZBA 4G8GB 4KROB 2EDOA 1P4BL 3SCUA 1YY9D 3KPRD 3BZ4A 2OZ4A 1FO0A 3SKUD 5I1IH 4P46D 3SDXA 3D4ZA 3PZQA 3C6LC 2ZWZA 2IFFH 1A7PH 3AS0A 3BP5B 3L3GB 3HUJA 5E6YA 3BD5A 3WF3A 3TV8A 1LNUA 4F66A 2B5IC 1J9YA 4NKQB 2EDEA 4GUPB 2FX9H 3KVQA 4MMXC 2I5YH 4OUUA 1BQHB 2XNAA 3LHPL 3QA3B 5EU5B 2XTLA 2HKHL 3BHBB 1CECA 1DQQB 5CINL 1KBGL 2QQNL 5D2NC 5MEQB 1MF2H 4WHDA 3D69A 2M26A 1VERA 4GT7A 4R96B 1KC5L 5BRQA 5J12C 1QVOB 1C92A 2Y23A 4KZDL 3QH3A 1MHPL 3QJHA 3CFDA 5E8PA 3QR2A 2VC9A 3GEWB 4FFWC 5D7SH 3F5KA 3ORJA 4JO1L 3UYRH 3IDXH 1G6RH 4ODBD 2IFFL 4ODTL 1A7PL 2CHOA 4P8WA 2YR3A 4GW5B 1MCWW 4JFWA 4JVWA 1BLIA 5DGQA 2A77H 4RGMC 4RRPA 1OGAB 3PJSA 1J10A 3GJFA 2NZ9C 2CRYA 1ZA3A 4JRWA 5KSBA 2I5YL 3ZKND 1F4XL 4JRYA 3U46B 1AIFA 3PWJA 2XM2A 3ROLB 3WEZA 2RB8A 4XWGH 1Q9OB 4KVNL 5ECJE 1DQTA 5MEND 3TYFA 5L8LB 4AWEA 3C5ZC 4D9LH 2GK1A 4AZ6A 3CLWA 5KVGL 1UB5B 2B1AH 3C60C 4U1MA 3OF6D 5CLWA 2X4NA 4D3CL 1E0WA 5I77A 3STZA 4HH9A 5E8EA 3ZT6A 5D7SL 3WFHA 4S2SB 3UYRL 4WU5A 5EBAA 4MA7H 4R7DA 4J7RA 3BW9B 1H5BC 2NY5L 4FABH 4YHNB 4Y1AA 4YPGA 2WBJA 4NUGL 2VOTA 2A77L 1ZHNA 2DEPA 1JIBA 2R2HA 1PZ5A 1NMBH 2OLHA 1FGVL 2XM1A 1B3XA 2NX5A 2EKSB 5EBWA 2Q8AH 1JI1A 3QNYA 2CIKB 4JDZA 5J6GA 2WWMD 4Y4KA 2FJGB 2ICWA 2KH2B 3I84A 4F3FA 1UD3A 4O2FA 1WSST 2CK0H 2IBZX 4MXVE 5TDOB 4N0UE 3C2SA 3IANA 2B1AL 1PX4A 3PWVB 2EIDA 3VXSE 2UYLB 3MRGA 1M4KA 1XGQB 3VRLE 1ZWIA 4AENB 5F7MC 3PGFH 3W9DB 3N15A 2P8PA 4P23D 1MFAH 5ABDE 3W28A 25C8H 1YY9C 2V17L 4UTAL 1QP1A 4P46C 2FEDD 1IEBB 3ARBD 4DUXA 5FGBA 3SKMB 2X10A 4NFDA 4OZ4B 3THMH 4FABL 2EDLA 1WWBX 5I74B 1UD5A 5HPCA 1ECEA 1JWUB 1U91A 4TUOB 1U8IB 3BQUB 2BNRA 4OIFA 3WYRA 2MHAA 3D39B 4Y2DC 2V5DA 2FB4H 2I26N 4NNXA 1DANT 3LPOA 2J5LC 1U92A 4LCIH 2YC1B 2IH3A 1JGEA 1Z9SA 1IGMH 2Q8AL 4EXPX 4HZ6A 4JFDE 4PMDA 2XWTA 4X4YA 3SCVA 4RISH 1QTYT 1NJ9A 1D5MB 2IBGA 3HUJE 3QXWA 5DEGA 1UWEH 5I6SA 3EJZD 4AD0A 4WO4D 1CLVA 3W11D 1PQZA 5D7LB 1IL1A 1P7KB 4G8IA 3V6OE 1CGUA 3SO3B 2C26A 3MUJA 1QI3A 3L5IA 2D7NA 5IROC 1U58A 3N1AA 5HHMB 5C7XH 3MGAA 3PGFL 4FP8L 1GVIA 1MFAL 25C8L 2R1YA 5T3ZH 3QCTL 1MCEA 4APQA 1ORQA 5CZKA 3AM8A 3NH7H 3QIWD 3THML 4JFOA 1HQRA 4Y5YB 1K6QL 2H41A 5E8DH 3T77B 1OWWA 4DW2H 5JR1L 4UR9A 4UT9H 3OAUH 4MNGB 2FB4L 3DX7A 3GHBH 2IXVA 3OJDA 2V5TA 3GRWH 3BX7C 1KWGA 2ZCHH 4ACZB 3WIJA 1KN2H 1ZT7B 4LNVA 4EUPG 1FNAA 3ZDZF 2PWHA 4JG1H 4RISL 2DJSA 2QHLA 4MNHB 1G9MH 5F7DB 5CZVH 1R3HA 4LLWB 2QMKA 2FZ3B 1UWEL 4BQ3A 3O3BA 1AHWC 3VMPA 2YBUA 5DJ2A 1UWTA 4JKPL 1MLBA 3CBWA 1QFWM 1H0DB 1HHGA 3K1KC 1DQJB 5JNYB 3QWOA 3SDDB 1NEZB 1A7NL 3H3KA 5C7XL 3RNQA 1FZMA 5E2UL 4EVNB 5JW4N 4N5UA 1NSNL 2OWXA 4KMQA 4N9GB 5C09D 3CVHB 3NH7L 4HZ8A 4LK4A 1ZMYA 3T65A 4D9QE 5I16B 4PD4J 3TFKD 4L8SA 4JFFA 5E8DL 1U2HA 4ATDA 5B8CB 5GRJL 1XR8B 3OAUL 4P0DA 5E24E 4DO5A 2BFVH 1KCKA 3RVTD 3GHBL 2DT0A 3U83A 4X6EA 2BV9A 2OP4L 3ULUH 4PJDB 1D5BA 2YXMA 1OP3H 1KN2L 4XNXL 3LB6D 4EIGB 2IBZY 1GGYA 5CSZB 3BMVA 1F3DJ 3P0GB 4Y1AE 1KG0A 1G9ML 5CZVL 4D6HA 3DHMA 1UH2A 2JIEA 5C3LD 4PYGA 1V08A 5E0FA 1A9BA 1DP0A 2D3VA 4GI9A 3AFBA 5JDSA 4Y2DA 4AK1A 2Y36H 4P9MH 4PRDA 1L6ZA 3MBXL 1GIGH 4MXWH 5DFVD 1IBGH 4OD2B 5HGDB 3AHTA 2Z91B 2NPLX 5DJAB 4NJ9L 2FEDC 3OQ3B 4BCEA 1NFDF 3ARBC 5MP6L 5K59E 1OIMA 1ZE3C 1R7AA 3VFNB 4LAJH 2IH1A 2UWEE 3ZT7A 3DRQB 4P4KB 4KDTC 5HJ3B 1HK6A 2FDBP 4JFXA 3BQUD 3EJQA 2JELH 2V5RA 2BFVL 4X80L 4XP6L 3O9NA 1FNFA 5I1AB 2I9LA 5DDHA 4TOQA 3VRJA 2WSPA 1IRAY 3IS1X 4G5ZL 1KCLA 3HE6B 4GKSA 4XPGH 1AXIB 5FL1A 1KTDA 3ZE0F 3WQ8A 1YJDL 5D2NE 2QHRH 2V2WA 1GGUA 1G0CA 3EOTH 1IQDA 5E2TH 3SGEH 5BJTB 4EKXA 4LX4A 4QCFA 5MERB 4BFEA 3EJZC 2BNRE 4N90E 4WO4C 3BSZH 2J47A 3W11C 1P7QD 3F65A 5J11C 3U5UA 1J7VR 1TTGA 2Y36L 1ZT1B 1GIGL 2C5DC 5FA3B 4XPHH 2OQJB 1IBGL 2HJFA 2VTFA 3TBWB 4NZUH 5CQ1A 3F5WA 5HHMD 5DUPH 5JW4R 2P8MB 1FFQA 3MMEB 3MREB 3TVMD 2DLGA 3QIWC 4MYWB 1DLHB 3W82A 4LVHB 4GINA 1JTOA 4JO2H 5DYOA 4PJFB 1HYRC 2LQRA 4LEOA 4TXEA 4AMXA 3D0VA 3TH4T 2HLAA 1P5VA 4YGVA 5KSUB 5E9DB 3MSPA 5EORH 3VH8B 3RZCD 4NO5B 3FHQA 1BVKB 1JGLL 4M1GH 3V6ZB 1JGDB 4PG2C 1A9EA 5E2TL 4B7IA 4MWFA 5EZJA 3OGOE 1JFHA 3QIUB 4GG6F 3GHEL 5D1ZB 1ZLSH 3S9DB 4M81A 3QPXH 4ZNEA 3P4NB 1XYZA 4GIAA 3PL6B 5C08D 3APGA 4OF0A 5BRPA 1E6JL 5JOFB 3ZJ6A 4AQ1B 3GXTA 1MOEA 2HWZH 5KOMC 2AW2A 1MAMH 4NZUL 2YWZA 4RGND 4NDMA 4JQXC 3A21A 4PJ8B 4TOYH 4KKAD 3I02A 3RVXD 1J1OH 1J8HA 3TFKC 1P1ZB 2VLLA 4U1KB 4W86A 4GRMB 2DRUA 3PP4H 4NZTL 1IT9H 3KLDA 1PVHA 4YK4B 1T5XB 2XKSA 1JN6B 3OLDA 2JF1A 4OZOA 5I24A 4LKXB 1BD2D 1FLRL 2VC2H 1INDH 3IDYB 3RVTC 5ABEA 3MYJB 2AERT 1VFUA 5EORL 1QPXA 3VIFA 4AXNA 4QXUH 4G8GA 4XVUD 4DGIH 3LB6C 2NY0B 3GNML 3LQAH 3O6LH 1ISZA 4G8FB 3BFOA 3IU3B 1ZLSL 3O6FB 3DX6A 4KDTA 3BP5A 2V5YA 3L3GA 4M7LH 3WO4C 1BZ9B 2Y2WA 1GAFH 1TXKA 5F7WC 1ZL1A 1UZ6F 1RY7B 4NQUA 5IW6B 2X44D 2V5SA 3C6SA 5DFVC 5T3ZD 1OTTC 1QBBA 1OSPH 4FRWA 4GBXB 4GUPA 4U7SA 5IVXF 4ETQB 1MAML 2W65B 1BFSA 4CD4A 1IT0A 3F8UB 3WHE0 5EU5A 5C8JB 2ADJB 3QFDB 1DL7H 1BG9A 3DHUA 2HVKB 4PBWD 4TOYL 1XF5B 5MEQA 4JG0H 4YFDB 1JGIA 3RJDA 1J1OL 5ANME 1GQKA 1IT9L 4OF6A 1JAKA 3WKMH 2YD8A 4ELMB 4KKLD 3BQUC 1QVOA 4PD4K 1ZHKA 2DQHH 5GRWA 5C0CA 5DD3H 2VC2L 5I66B 1INDL 3CPUA 2QPUA 2DI7A 2PTVA 1IGJB 1XF2A 1KELH 2H9GA 4I5BB 2DGAA 3TTQA 1CBVL 5I23A 1I1XA 4QXUL 1F4HA 1VB9A 5C0BD 4DGIL 3QUZB 1CDUA 5EPMB 1LWRA 2DQXA 1KCRH 5HYEA 1C16B 1S5IH 5E94B 2VXSH 3VGGA 2JF7A 2GJZB 4CGTA 5FHBL 2CDGB 1ZBVA 1MRFL 5DQ9B 4M7LL 4X7DC 4W89A 1BQLH 1UFUA 1GAFL 1OGAA 1E3ZA 2MPAH 3P9LB 3SO3C 4U1NA 4HS6B 1E55A 1U41A 1OSPL 1F3RB 3D85B 3DVNB 4MJIB 4UV7L 4DN3H 1TNMA 3OG2A 3U46A 1U3HD 3TVMC 2O93L 1DL7L 3C5SA 4POYA 4JG0L 1I9JH 1Q9OA 1S9YB 3LQZA 2Q20A 2YBRA 2M2DA 2XWDA 3QUMA 4WSKA 3WKML 4Y5YC 4JQIH 4XZWA 5LCVL 4ODHL 3ULUD 2W07A 4QRUB 4Z6AT 5EFIB 4P7RA 1A6PA 5DD3L 3WF0A 4HWBA 5D93C 2EXOA 1QHPA 1MI5A 4AT6B 4PJIB 4WW2F 4PRHD 1DLFH 3MFGB 5FM4A 2AEWA 5B4MD 3RZCC 3VILA 1CT8A 3Q0HA 3L5JA 3QHMA 3MMWA 2QLVB 5LGHL 3TA3B 1KCRL 4S2SA 1S5IL 5F7UA 3DBXB 4NZJA 5IFAH 5T5NG 5FF6B 3BW9A 4YHNA 3HAEG 3RRQA 3QIUD 1JYVA 4LAQH 5I1GH 4LRNL 5D1ZD 3RGVB 1BQLL 1KENH 2BY2A 3JV0A 3PL6D 1ZLVK 2NNAB 4DO4A 1FFOA 4JRXD 4X7EC 1A4JB 3SDDC 1TVPA 4PJXB 5J9PB 4DN3L 1EFXD 4RGNC 3TIEB 4NHUB 2EKSA 4PSPA 2J75A 3AI0A 2GJPA 4KKAC 4B9YA 2FJGA 1I9JL 3QZWG 4PJ8D 4ZNEE 2A6IB 2YN5A 3ARTA 4OCNC 5TDOA 2WM0A 1NLDH 4KHXH 2NXYD 1YNTA 1XCTB 1QRNB 3QDGD 4DAGH 4JM4H 1A3RH 5F6HJ 4LBEA 4LQFL 5IVZB 2H2PD 3W9DA 1B6UA 4J3VA 2AXJA 5CJQH 3VXNA 1RIUH 2YEZB 1MH5B 1IEBA 4OM0H 4OZ4A 3VGBA 3BAXA 3GFUA 4LAQL 1JWUA 1C90A 4TUOA 5TJWK 3CFEA 1U8IA 1KENL 4XC3H 3O6FD 3L2LA 3UJTL 1RVFH 3UJIH 7TAAA 2DSUA 1SM3H 3D39A 5LAXA 4QLRA 4WCYL 3CFJB 5DK0B 4G8GE 4GAYB 3STBA 1NAMB 1YEIH 3MPCA 5E6IB 1JRHH 3ETBF 4B3LA 4OLVL 5HHOD 4XP1H 2E7HA 4OZIB 1D5MA 1T7VA 3P73B 2AXGB 4YPJA 3TIDB 4KKLC 5DRZA 1UXSB 1IM9B 1NLDL 4KHXL 5D7LA 2DMKA 1P7KA 1JD7A 2PBGA 5I2IB 4DAGL 4JM4L 1A3RL 4UTBH 3I3EA 2GTWA 4MMZC 4KUCD 2ED8A 5MHSE 2AXFB 4OCXH 2V9TA 2X4TB 5K9OB 5DD5H 1RIUL 4E0RB 3I6GB 5HDQH 2OW6A 1YEDB 2LTQC 3FFCD 4OM0L 2MQ0A 1MCNA 4B0MM 5EU3A 3T77A 5DHXB 1OB0A 1RVFL 3UJIL 3BUPA 4MNGA 4YDJB 4ZFOL 2DH2A 3SDAD 4W70A 4Z7NF 1Q0YH 5F7HA 3L3KB 3EZ8A 2I24N 1XGUB 3OZPA 1E28A 3QDJB 4MJID 1U3HC 2VXTH 1YEIL 1JF5A 2CBJA 1JRHL 1ZT7A 4H0GA 1D5XA 4XP1L 1N0XL 4KAQH 3BD3A 5F7DA 4EBQH 4OZFH 2GAZB 4LVHC 4LLWA 2FZ3A 1OGAE 4LPCA 1CFNB 2NTSP 2XFRA 3VXQA 3ULUC 4CJ1A 1H0DA 1DQJA 4P49A 4DN4L 5JNYA 4UTBL 1NEZA 3JWDL 5B4MC 4JPKH 5D5MB 4CCEA 2VYRE 4QHUB 5C92A 4EVNA 4OCXL 4XCEA 4HWNA 1NAKH 4IMKC 5E5RB 5F6HI 5F70A 4BF7A 3RDTB 4A3YA 4NRXB 4L8CA 1I7UB 3CVHA 3RWEA 4DUVA 3QIUC 4H41A 3VXMD 2D24A 5D1ZC 4ODVL 5KSVA 3V4VH 3WNPA 3PL6C 5B8CA 1XR8A 4QP0A 1HKKA 4OV6F 4LSVH 3GMNB 1Q0YL 2QKIB 1LG1A 2ITDB 2OI9C 1CDBA 4PJDA 1OGTB 4OJYA 4CU7A 1EGZA 1P84J 1WFNA 4KJQD 5T1MB 4Y5VB 5CSZA 1O7AA 2P47B 1MFCH 5J1AB 4KAQL 4PJ8C 2DQGH 4EBQL 2QR0B 1MIMH 5D9NA 2CQVA 2VERN 4DFHA 5EC2B 4KWUA 1B0RB 1KULA 1B1YA 4YK4C 1XGRA 2VQ1B 2NXYC 3T0DA 2E9MA 5HGHB 4N5ED 3DO7A 4Q9RH 1N64L 1QRND 4A6YH 2H2PC 4LCCA 4OD2A 5HGDA 5I8OL 2DT3A 1YEGL 5FD0A 2WWKO 2UZIL 1T22B 1KNOA 3ARZA 4LCWB 4UDTA 5DJAA 1E9LA 3S37X 4UZSA 3EHBD 1MPAH 2B0SH 5FUZH 4DKAA 1QLFB 3O6FC 4P4KA 5HJ3A 5GS3A 3I3BA 1I9EA 2VSCA 3QEGL 4PRPB 1RIVH 3WF4A 2ZWLT 4LSVL 2OXHA 4M6NL 3FN9A 3CZNA 2ZOKB 3HE6A 4OZFB 4XHQA 4PRNA 4HUVB 3LX9A 1FVCA 2EEXA 3IETB 1HQ4B 1X3DA 5ID0A 1MFCL 5IK3B 5HD8D 3FN0L 1V3LA 4Y19B 4UT7H 2AV1B 5MERA 1MIML 2YN3A 4KY1H 1QI0A 4L4TB 3WBDA 1ZBCA 4W87A 1CIDA 4LMQE 1NWRA 3D39E 4M7LT 1UASA 1LG2A 1FL6B 5FO7B 1QPKA 3WL0A 3NACH 4Q6YA 3MLXL 3N1QC 1ZT1A 2X1WL 3N13A 2DYPB 4A6YL 4ODSH 3TBWA 3SDCD 5HPOA 3MMEA 2GJ6A 2DI8A 3MREA 4FQHB 4CU8A 5CSBA 1KXTA 3VINA 1YN7B 4ETYA 5FUZL 1EK3A 3ZO9A 5D7LE 1US3A 2YD2A 5CMAB 1JPFB 2WZEA 5HHME 1IKFH 1CXHA 4ZFFB 5K9QI 1ROWA 3S3PA 5E9DA 1JPTH 2D0HA 1TZHA 3L3IA 4QXTA 3TLRA 7FABH 1Q4NX 3W27A 4DVBA 1YDPA 1LK2A 3QDJD 3PDGA 4NO5A 3JZ7A 1CE6A 1S9WB 4HV8B 2MCPL 1BVKA 3JUZA 3SJVB 3V6ZA 1JGDA 5BOZG 3VFSB 1ZS8A 4Q2ZB 3CTTA 5GJSH 1BF8A 1BQUA 2K3TA 5LA1A 4LFHD 1FPTH 3P4NA 3QEQD 5INCB 3V6BR 4MNGE 1W72H 3NACL