3VGHA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltotriosyltrehalose
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
554
structure length
554
Chain Sequence
YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 189
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vghA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vghA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vghA02
1FZJA 3VCLB 1OLZA 2LAAA 3VFNA 4MJIB 2YPLA 5D8JH 1CS6A 1N64L 1Q6GA 1OHQA 1TA3B 5IVNA 4NKMA 5T1KD 1WE5A 4BSJA 2OK0L 1BQSA 3EDKA 3C5ZC 3A4WA 3UJJL 2VRAA 4ACPA 1J88A 4LPTA 3EHBD 4KJYA 5ICZA 5F1NA 2DBLH 4B7IA 5J6GA 3FB7B 1AGEA 4NO0D 1N6UA 2VISB 1E4NA 3O2LA 2XQBL 1VEOA 3FO2A 5L0QC 3CVIL 5TD4A 4KRTA 3KYKL 4PJGA 3BDXA 3IXTB 5T1MB 4I48A 5SWZA 1PKQA 3WLWC 5GRVL 2RCSH 1CLZH 2AGJH 3OGCA 1G7QB 1OT2A 1CBVH 2X8RA 1MVUB 1CLOH 4X6CA 1UR9A 5J11C 4LRIC 3MJ8B 4WKAA 2PWHA 1MXDA 4R0LA 3HG5A 4BYHA 1UYWH 4M1GH 2CGRL 4OD1L 1J10A 5F88A 3MV8B 5FYJL 2HJFB 3OG6B 4LKXB 3STLB 1D5BB 1S9KC 1UXWA 4JJ5B 5A40E 1RZ8A 4W5ZA 1E43A 2EDHA 3RHWK 5ESQB 5JIPA 1B3WA 1YC8A 3HAEG 4ELMF 3LKQB 2VLJE 1I8MA 3TESA 1ZT4B 2NYYC 5CCKH 1UVQA 5JPNA 3FO0L 1LO4L 4XZWA 1IGML 4JQVA 3VXSD 4HBCL 4MA7L 2YEZA 5EBLB 3GBDA 4PG9B 1HJWA 3CVIH 3D39B 1KPUA 2OR8A 1JGEA 4LYQA 2I27N 1MRFH 4MD5A 4PD4K 3LMJH 4DGIL 4U1NB 4L9LB 3C5JB 1KB5H 3C5SA 1E6JH 3DURB 4ODBD 1LO3L 4W6YB 5DMYA 3T3ME 3C6LC 5C0AE 4D72A 3U4EA 4G6JL 2A73A 3QULB 3GH4A 1W9DM 2H32H 1ZGLA 1RJLA 5EBMB 3ROLB 5L6YH 4JKLA 2WBWB 5D2NC 2G2RA 3G6DL 5DRZA 4XTRC 1Q1JL 1MHPH 1H8OA 3GNMH 2X9XA 4AEHL 4JPIA 2GJ6B 5FL0A 4R7DA 1NMBL 1QBLL 3B9KA 3MUGA 1UG6A 3AICA 4ZSOB 4NRZA 1B9ZA 3W2DL 3ECQA 2XVKA 3BPNB 4JFHD 2ZG1A 3WH7A 3EYQD 1FYHB 4F7EA 3WFHA 4U4BA 1ES0A 2XM2A 3EOAB 4GSDL 1OP5H 3WUWB 3OBAA 4U1MA 4OF0A 2C3XA 2VN7A 1NDMB 1AXTH 5EO1B 3KJ4C 3RO8A 2I9LB 4FRWA 5TE7L 3RVWC 4OZFH 1D9KD 4W87A 2F7OA 1WCQA 4Z7UB 4M29A 4JZJC 2EE6A 4YEFA 1FVCA 4DGIH 1CIUA 4CD7A 1BFVH 4YQXL 1FVDB 3NZ8B 1BD2E 1M05A 5IP4A 4DKAA 4WCYH 4D6CA 4YHIB 3VTRA 1CGUA 4X99A 1MAJA 1PIFA 1JHKH 4JIEA 3X3GL 2MQCA 5GZND 2N56A 4MDIA 3DBXA 4NPYA 3U0PA 4PJFE 3GI9H 4P3DA 4XNMA 3AZTA 1PLGL 1HCVA 4BQ6A 4J27A 3IRPX 1JMXA 1CICB 1S7WA 1MFDL 3C60A 4MNQE 2ZOKB 3MRJB 5DJCA 4DZBA 1NMBH 1NCAH 2G3IA 4KVCH 3RKPA 1PBGA 1EJOL 1TDQA 4GQPH 2FEEI 2A83B 4OCYL 3HPJA 1ODZA 3DUSB 3SKMB 3NPZB 3NDZA 2OZ4H 1IAKA 1WWWX 3MNZA 5DR5H 1BVLB 2EEDA 4OLVH 1UR0A 5LXGH 1XEDA 4TUJB 3WD2A 5AG9A 5HNNA 3UYOD 1OW0A 4NKOB 2WNGA 4Y4HA 1OAKH 4QAWA 2D3NA 2IANA 4OLWH 3QH3B 4HCRA 4D0CB 2EDNA 5D1QD 5TE7H 2F74A 3V0WL 2GCYB 4Q9QH 2ICCA 4NM8H 5T1DL 1N59A 1FG2A 2GJPA 2X89A 4W68A 4YQXH 1R5IB 3IDIB 2P5WB 2ZUQB 2EYRB 1QNSA 1S7QA 3TT3H 3S4SB 1FAIL 3CX2A 5GISL 1U8HA 3G6AB 4UFHA 3QDGD 4XPHH 5CLTA 2V17H 4WFHE 2EH7L 3MRLA 4UAOC 5F7LB 1ODUA 1FVEB 2Q3ZA 4PJXF 1JBJA 2FZ3A 2R0ZH 2VL5A 1EBAA 2VXUH 4QHLB 5E2VH 4IOIB 1MAKA 2VR4A 4OCLC 4R2GC 4U7MA 5E4EC 1MJ8L 4G3YH 1MPAH 4GRLB 3CUPB 2AW2A 3UCQA 3GNPA 1FGVL 1A6AB 5AUMA 1UWSA 2H3NA 5C0BD 3EOTL 4GI6A 1ZTXH 3WL0A 1BM3H 1KXTA 2IALB 5D7LD 3OKKA 4ORGA 2DM2A 5HYIA 4LCYB 3WJLA 3ZKMD 5JQ6H 5DK0B 1N3NB 5LKNA 1GIGH 3FFCE 3MNWA 3WEXA 1QR4A 5EBWA 2BSRB 3SCTA 4YZFF 3TO4B 1E6SM 5I78A 5CZKA 3QDME 3QZWA 4X9HA 3CC5A 3Q5OA 2XOTA 3AXHA 3H42L 1MLBB 2VDOH 1AHWC 1U8OA 4G5ZL 3HE7D 4L8SB 2HH0L 3PGCB 3TPKA 2LQRA 4ZODA 1ROWA 1CD8A 5KSAD 1ONQB 3PG2A 1CFSB 4TRPH 3WNPA 3KLHC 1MFUA 1BLNA 2DH2A 1BYDA 1UACH 2Q6WA 1VSCA 3TBVB 1YN7B 2EDFA 3CZKA 2X5PA 3MV9A 3VM5A 1F4WL 3IFPA 2M1KA 4FQXA 3EYFB 4WJ5A 3S34L 5F70A 1B6DA 4M6NH 1YNKL 2VLKA 1OTTD 1XF2B 5DC0A 3OHXB 5GGTH 1U8LB 1XCTB 3VFMA 5KANG 1UZ8B 5FGSA 3HNVH 4S1DC 2E40A 3TM6A 4KI5C 4MQ7B 3CDGA 4O9HL 1GC1L 2C1PA 5EOTB 3HE6C 2FDBP 3UAJC 4OGXH 1PZ5A 1UM4H 5D9SA 3S98A 2AS5M 1KIPA 3TCLA 4TSBL 1KYOJ 5I1CL 2F54A 1H1NA 2DSUA 3WL1A 2HVKA 1JIBA 5D7IE 1FSKC 5DHYB 4NNXB 4BS0A 1CT8A 2WAHA 1AQKH 3C5ZA 3KYNB 4G9FE 2HRLA 3AS3A 2YK1L 5KSBE 2WYSA 3VRJB 4Z0XB 1QNPA 1QLRA 5GGRY 5E00B 2UV3A 2J7GA 5FOJA 5H8DA 2J88H 5CIPB 3BRDA 1EUTA 3CFEA 5E2TL 4MA3B 5TQ2L 1T20B 1BZ9A 3DGGB 1U3HC 1XD1A 4G5ZH 1INEH 1MCPH 2BHYA 2MANA 3LXCA 3CZ8A 3IDXH 4OD3L 3FO9A 4LGSB 4OUEA 4KPHL 3VILA 3ZM8A 1REIA 2GQHA 4ZXBC 1EXUB 5KAQF 1RK1A 1YJDL 4BQ2A 4NIKB 3MXWH 3PP3K 3EYSH 1VIWA 4OCNC 2CLZA 4X4XB 1AGDB 5GRXG 1U2CA 3D69B 1LK3L 1FHGA 5AAWA 3KZSA 3DIFA 3WFLA 1YNKH 4RFOH 5CUSH 5I66B 2ESVB 3AZRA 2XG9A 4LRIA 5LBSL 4RIRB 5C8JA 1CENA 3SPVB 3G6JF 3MRGB 1GGCH 3MA7A 3BIKB 5GS2H 2PUQT 2W38A 3LS5L 4PRAB 5HHQA 1HXYB 5I30L 4G7VL 4NWUL 4JPVL 4W7WA 4QRRB 2DLFL 2AK4A 5DVOA 5ID0A 3FT4B 3MRRB 3UROR 5CSYA 1YY8A 4GG6F 1G9NC 3MRNA 1R34A 5T3XE 2ESCA 3OIHA 1T6WA 5DRNA 4G6AC 1UH4A 2DOCA 3WD5H 5HGAB 3FQXB 1N82A 5D5ME 4JRXD 3QIWC 5FO9A 2C7UB 2YK1H 3A5VA 5D72H 2JJTC 4EE9A 2JIXD 2DI9A 4LVEA 4JY6B 5TQ2H 1GHSA 3T4AB 1H9VA 4Z7QE 3HC4L 1BTCA 4LCWA 1HINL 2VAAB 2BNQE 4YDKH 4GKNA 1MXGA 3ROOB 4EI5D 1YMMD 3MSGA 1QRKA 2DQCL 4OCXH 3TNMA 3IAGC 1I9EA 2WAGA 5HPCA 2Y6SD 1FBIH 1IGTB 3LVEA 4PGZA 4ISVB 4E2OA 3SDXF 2OTUA 1F3DH 3GZAA 1HDMA 1NC4D 4HWBA 4PJ7E 3TYFB 5FF6A 4KV5F 4FXGB 2QPUA 3C6LA 1X6LA 3JV6A 3QG7L 4DJMA 2FIRT 3QQ3B 2CD0A 1DUYB 5D2NA 5GS0H 4HK0A 4B15A 4KAQH 3DO7B 4FFVC 4OQTH 4H1LH 2Z93A 5C0CD 4NWUH 3ARXA 4GLRI 5MEOB 4U1JB 4ZD3L 4O51B 4MQSB 2HT2D 3JTTB 4KROD 1WT5C 4NQTA 4QRPA 4F7CB 2XYCA 1SJEA 4CW1B 4PJ8C 1UXSB 5JNYB 5MHSD 5E2WH 2ADJB 3ME0A 3ARBB 2GFBB 3FN3A 1ZLUK 1TNMA 3LKPB 2FB4H 2YA1A 3LX9A 2Z8WC 3NOIA 3OKNB 2WHLA 1Q0YL 1MWAB 4X6EA 5DDHA 1N6QL 2BJMH 2PBOA 3WFCH 3GSXA 3FOLA 4W4NA 4KUCF 5GGSA 4E41E 1FLRL 3H0TB 1BGXL 2Q20A 4P46B 4BA8A 5FOBB 3CHEA 1V03A 1KEML 5SWQA 3ZO0A 5T5FH 4JZJA 1QFWH 4P9MH 3BAIA 3KG5A 4V1DD 4MQTB 2CDFB 2ID5A 4XPFH 2WBKA 4J6RL 1YNLL 5LCVL 4FG6D 5TE6L 1M7DB 4PRHD 5EIVA 1Y7VA 1J9YA 4Q97A 1DFBL 5KZ6A 3OAUL 3QWRD 1QFWM 1YY9D 1MCCA 3UBXI 3ZT7A 1R24B 4ZFGH 3EO1A 2XUCA 3DDFA 3PV6A 3QIUC 4XP9L 4N68A 3TWCH 2DLEA 3KHOA 3BWUC 3OF6D 2GVYA 3PXJA 2CRMA 3P40A 3A6CH 1EAJA 5KS9F 4YLQT 5K9KB 1RSFA 4YDVA 3A6BL 4ZYKA 5FO8A 1DBKL 2W9LA 2DJUA 1J05A 1MHCB 3QWQB 3STZA 5B4MD 2Z8VC 1J5OH 2IG2L 1UEYA 3S36L 1C12A 2PXYD 3DSNA 5DD0L 1PJ9A 2PETA 2XZQL 4KJWC 4PGEB 3GXFA 1SBBA 2EIBA 1FZOB 3CLFL 3ISWA 4MCZA 1MCJA 2BS9A 5FYKL 3QQ4B 1TETH 4ZUWA 3WDRA 3T0ED 2ZUTA 3BZFA 1YHTA 1NCDL 2DL2A 2MPAL 4H26B 3AIWA 4LGRB 4RQQB 4RFNC 1NJ9B 3MV7D 4ODXA 3EO9L 4S0SD 2CPUA 5E95B 3KS0J 5TE6H 3QCTH 4F7PA 4QOKB 3IU4H 4D0BA 2O5ZH 1LO5B 2YBRA 5CBAA 4PY7A 3S2CA 4OCWH 2GJJA 3RZCB 3VVGA 3BSGA 3D25B 4FQHA 3VKKA 1IEAB 2V7HB 4ZFMA 1MCFA 1ZT1B 3FT3B 2O92A 4I18B 2VT0A 1JP5A 3BO8A 1NAKL 1R3HB 4PB0L 5L88L 3RWEB 5HDRA 3GEWB 4NDMA 3ZSTA 3C2AL 2PN5A 3QI9C 3CO4A 4XNQB 1T7YA 4NN5C 3DC0A 5E6ID 2DLGA 4YHML 4PSRA 5FD0A 2HJLB 4U7KA 1KXQE 3JV5A 3VXPB 2M26A 4JKMA 1VEPA 2BDNH 1P84J 4CRPA 4TVDA 3OKEA 4TQEH 1I9JL 3ZE2F 2C3VA 4KKCD 1XGPB 2DQTH 5J56B 1D7FA 2XRAL 2Q8BL 1IT9H 1FL6B 3I02A 3KPOA 5JR1L 1V05A 4JEGB 4MAYD 2W62A 4JGMA 3ZKND 1LHZA 1HQRB 5IHUL 1AHWA 1JPGA 2WUBH 2MHAB 4CVXB 4K3HA 3K4AA 1I9IL 1NGYA 5J13C 1W0WA 4Z2HA 1RURL 3T65B 1HH6A 3IDYB 1CDJA 4DZ8B 3VXNB 4ACZB 4JFDB 4MQXC 5GS1C 2FX8H 4KRLB 2FSEA 4PTTA 4KZDH 4NP4H 4WENB 5I1EL 3UPRA 1MCRA 1FOBA 1KNOB 4XHQA 4LNVA 5E8NB 2JIWA 3FJTA 4BH8A 1NAKH 5K59E 2YR3A 4YC2B 1HILB 4UQAA 3GSWB 4U1KA 5EU6B 3WY4A 1UEMA 5HY9B 2IBBA 4OBSA 3RVXC 4J3SA 1LP9E 1VFOA 4LU5H 5FUOH 2BOCB 5BVJA 3HE6A 4HD9A 3LMYA 2XT1B 4H41A 5HI5C 1D6VH 3OTTA 1X4XA 3WN5C 3ARFB 4GKOA 1OP9A 4X7SL 4G6FB 4FZ8L 5DGRA 4D1JA 5AD0B 5K93A 2A74B 2HA1A 4LLDA 5L7XL 1GJWA 1JZ5A 5DJ6B 3LXBA 1BF8A 5CKAA 3OB0H 5ESAA 4JAMB 3BGAA 4LSVL 1U3HA 1RU9L 2CRIA 1LL6A 2R4SL 5FM5O 3L7EA 2HWZL 1U8MB 5JOPD 3ES6B 1BLIA 2LU4A 1T1ZB 5C0AD 2ZJSL 5DUBB 1UJ3C 5IQ9A 2DMCA 5JDSB 4ZXBA 5CINH 4Y0GA 5INCB 4GKZB 4CADA 3JV4B 3OKYA 1GGYA 2WCSA 4CJ0A 1ACYL 4QYOB 1ULVA 5IMKB 4PY8J 3MJ9H 2EKSA 4MNHB 5ICXB 1EO7A 3EJQA 3RUGB 4KTDH 3QCVH 3VIOA 2X4SB 1P7QA 4PGBA 1ZLWK 2I24N 2R1YB 1QA9B 4LCIH 1GNXA 1EHNA 3LHPL 3QXUA 3C6SA 3X14B 4JFTA 1LD9B 3AU1A 4RFEB 3MFFA 4L8BA 1B4RA 3CZNA 4HHAA 4NJAH 2MWCA 3WL9A 3OR7B 1IAMA 4HKXA 1QFPA 3HMCA 2D23A 4JPWL 3CFDA 5KVEH 3OKOB 1E4WH 3WFEL 5I1KH 1F6AB 1XRVA 3VD4A 1DP0A 3E2HB 4HMEA 3QIWA 4QCFA 3ZMRA 1IEBA 5TF0A 3MYJB 3CFCH 2JJTA 5F7DA 4KKBC 4UCFA 1K4DB 1RULH 2XWJA 1PEWA 3NTCL 1U36A 5H2BB 3ARGC 2YZ8A 2VSCA 5J9PA 1KIQB 1EZVY 3CV5A 4LSVH 3WE6B 4F66A 1RU9H 3JXAA 2BSTA 3WF4A 5I8KL 3RTQB 3S5LB 4G8GD 1YEHH 5DA4A 4JKWA 2IC2A 3CK0L 4YWGL 1UD4A 5ALCH 1AMYA 2J78A 2JIEA 5CPSA 5DURB 3WCYA 4KRPB 4PJ9D 1X4ZA 4OLXH 4PJIF 2TAAA 1QYGH 5FCUH 3BGMA 2CK0H 3WF1A 1GQJA 1SEBB 4P8VA 3G5YB 2R1WB 1VGKB 1ITCA 1B2WL 4NSKB 2FEDC 1HHGA 2CBVA 2OSLA 1MJUL 1QLEL 4DCQB 3HAEH 1EEZB 4J3OC 3H7BB 3H9ZA 4U1HB 4YGVA 4M1CD 3SDCB 1U8PB 5AYBA 3WKMH 1BBDL 2AEWA 4AZ5A 1W3KA 4GQ9L 4NHCH 5DD5H 5DEFA 4JG0H 3U5UA 2DQGH 2GYSA 2DN7A 1WT5A 5IJVB 3NH7L 5HGHA 2HLAB 3AMKA 3FB6A 4X4MA 3WNKA 2D73A 4E0RB 1EGJL 3MCLL 4JPWH 1WICA 4PJ8A 2XI9A 3G5VA 3DHPA 3FNDA 3BXNA 2VDQL 1IZJA 5IOPA 5GSRB 5A6AA 3RU8H 4LVHC 1AIFB 1WGOA 1P1ZB 3MPCA 3CVHA 2VDML 4QRUB 2WBJC 4TNWF 3CUGA 1KBGL 1QI4A 1AE6H 3D5OF 4I0PD 4PMYA 3SDDD 4PP2B 1DVFB 4LSDA 2NXYD 5CP3A 1CFQB 3UTQB 4GZIA 4TSCH 3A23A 2KQMA 1US2A 3P4NA 3D39E 4ZFOB 4Y89A 1UM5H 4OZIB 1MELA 2X41A 5HHVH 3VOCA 1C08B 4Z5RB 4Q6YA 3T2NH 1LE9A 3VXMD 4PV8A 1W0VB 2VLJA 3QDJB 1DBAH 1HNFA 4P57B 1V6WA 3HPLB 2R2EA 2ZXAA 4KQ3H 1YC7A 1V7ML 3CFJA 1NAMH 4D6GA 1EMTH 4M6AA 2X0HA 2DB8A 5I16B 3UMTA 3ILQD 4HFUH 2PO6C 4JGUA 5DUPH 1UD5A 2JTDA 3QIUA 4MWFA 4LHJB 3PQYB 3MV01 4L29B 3CIVA 4PJDF 2EH8L 4BSVB 4HKZB 3M07A 4F2MA 3LN5A 5B39A 1J0YA 2R56L 1FFPA 3W27A 4PRPB 1EGJH 3LEXB 3QZWG 2NX5B 2Y36H 1V3LA 4WV1B 5IMMA 1UWGL 4GQRA 3QDMD 4JCLA 4E5XB 2ADGA 3SY0B 5SX5H 2VDMH 1NFDA 1GHRA 2G3JA 3E8UL 4ZDHA 1KG0A 2ED8A 4U5IA 3M1BB 1RI8A 3OZ9L 3JWDC 4XNZB 1DEEA 4WI8A 3D5HA 5FK9B 4Z7UE 3BMWA 5GSVA 1G0XA 4YJZL 1A6UL 5K9JL 1KJ2H 1FL5A 1CDCA 1WAAF 3OXRA 4JFPA 2VB5A 1W9XA 1EO8L 2O9RA 5F1SA 3AM8C 4JFFA 3NSXA 1FPTH 3Q1SH 3JBG7 2CXGA 5I2IB 1TZIB 3EYVA 1JK8A 5ESVA 3AY4C 5IKCA 5IFJA 3EJUA 4K2UL 3LD8B 4LSRL 3CZFB 3QWOB 1UB5A 4MJ6A 1DANU 3MBED 4P3WA 1BD2A 3U7YL 5EUOE 3GJFK 1NLDH 4WTWA 3RWJA 1DWFM 4J28A 3L2LA 3QI9A 4IM4A 3PTMA 3L5WB 3SCWA 3S6CA 3QDHA 4ETYA 1MIML 3MGOA 2X4NB 3O45A 5H94A 1ORSB 4EJ1C 4G42B 2IH3B 1OVZA 4LKCB 3ALGA 3N11A 3NYDA 1FO0H 2EE2A 4PJFA 4OM0L 3L3DB 3UR7A 3U1SL 1BPVA 3VG9C 4HA1A 2ADFL 4MNQA 4DN4H 4XRCB 5ACLA 4KXZH 4OV5A 4PJEE 4NHUA 4X98A 4XNXH 4KJPC 1GVIA 5E5MB 4NJ9L 3FFDB 3AHVA 1RUKH 1A6UH 3KR3H 2HTKC 5TDPA 5L2JB 1DQDL 2GEEA 5K33A 3BVTA 1S3KL 1HSBB 4PJBB 4P4KC 3AHYA 3HNTL 3HZMA 1H0DB 5DLML 1NEZB 1RIUH 3TTYA 3EOBA 5GS1A 1MI5E 3QUMA 1E0WA 1PG7W 1U58A 3KPTA 1W3JA 4QCEA 1YEJL 4FNUA 5EULV 1MFCL 1WWAX 5L2KB 3VIHA 3X13B 4X0VA 4W8AA 4QT5A 1A7QL 1UWEL 2XIBA 3DVGB 3GIZH 2Z31C 4NOBA 3QRGH 2Y2WA 4J12A 3O6LL 2DICA 1M7IB 2BNRB 4ODTH 4ZOEA 4YK4C 4JFEB 1JN6B 5FHAH 1FYTB 1JNHA 2ZUNA 2P7TB 5C0EB 1WCBB 4HJGB 1S9YB 5HYJE 3IJ7A 1PGRB 2OMBA 3WN5A 3BP6A 4IOFC 4Y5YC 4KHXH 4WTXA 3ALFA 2G9HA 4HUUB 1ZT7A 2OX5A 5TFSL 5MEND 3MLVH 5EC1A 3VI3F 4OT1H 4OUOA 1DHKA 5ANME 3FOMA 1KGXA 1CPUA 4A6YH 3W4RA 2PYED 3GIVB 5FA4A 2YWZA 4O2FB 4EQ2A 3GSNL 4JPKL 5CKGA 1PQZB 4CMHC 3L3OB 2NY1B 1S3KH 4IRJD 4U6YA 4BF7A 4G8FB 1G0DA 4PBWD 1HYRC 2R0WH 4RE3A 4JZ5A 5C09D 3WMSA 2J74A 3RFZC 3LV3A 3FFCA 1UJ3A 4ZUUB 2NW2A 5J0BA 1G6RA 2AEQL 3RVUD 4QDMA 5I1LA 4MAUL 4S3KA 3RIFF 4X5WB 3ULVL 4MJ5B 3EJRA 1MFBL 3TV3H 4JO1L 5JPMB 1KCUH 2VERN 1U2YA 1XGQA 1MHEA 2YXMA 3RA7L 3SCMD 2H8PB 4G43A 1U93A 5C07E 2DL9A 5HI4C 1ZLSL 4FQIL 1NPUA 4PJ5A 4R96A 3ZKSD 1ZS2A 2BMKA 5EORH 1BIIA 4Y4FC 3CHCA 4WLCA 3H54A 1PY4A 3FQWA 3MRFA 3K2MC 5C86A 4P8UA 1FH5H 1JGIA 1LF1A 1CL7I 4PLJC 1U8JA 3GGWB 4ZG1A 3LKRA 1WV7T 1BG9A 5TFSH 3O6FD 1DBBL 1WEJH 4OZ4A 2IAMC 1OARL 3I75B 2XWBB 2YBUA 5M5DA 1QKZL 3KPPB 3AREC 2X09A 2QSCL 3ARGA 2R8SL 1OCWH 4L8DB 4DQOL 1E6QM 3IXAA 1W32A 2QQNL 4DWSB 1K8DA 2EYTA 3SDAD 2X4OB 1HZHH 1KACB 2F5BH 5IIEB 2UY7A 2B2XL 3MODL 4PS4H 3QUZD 2UYLB 3ULVF 2Z35A 3HI1A 1G6VK 4Z78A 4G9FA 5KSBA 2FJHA 1U95A 4JREC 3TN0C 2EC8A 2NY2D 3U7VA 3Q5TA 4UILL 1KXVC 5INDA 4HS8L 2R4RL 3HUJE 4H88L 3ULVH 1OSPH 2OS7A 5GGQL 4JN1L 2D0GA 1MFBH 2AV1A 4Y1AE 1ISYA 1E4IA 3CMOL 1A1MA 1T4KA 4Q0XL 3WXWL 3DWTA 1UQSB 3O8XD 2XGIA 3W6MA 5T3ZD 2DT2A 3U2SA 2AJSH 4UV4H 1RJZA 4WI5A 3BDYH 5D6CA 3CSYA 3O4LD 1MQRA 4Y19D 3OG2A 4HF5L 3P9MA 5FHBL 3VWJC 4CNIA 2UWEB 3I50H 1IBGL 2LTQB 5DK3A 2B31A 1J1OH 1ZE3C 2CLRA 2EDJA 3MLZL 4GPNA 5D8ZA 3DYPA 5CJQL 4Y5XC 3H9HB 2WBJA 1JZ6A 3WFZA 2XTJC 3LPFA 3MNVB 2R8SH 1F2QA 4P2CG 4NZRL 5K9QG 2AERT 3RX8A 3CXDL 1A0QL 2B2XH 5C9JB 3O2DA 2HT3C 5DWUH 5D5MA 5JMOC 4RGNB 4TSAL 4OLUL 4JG1L 5FAAA 1SYVB 1A6VL 5CGYD 3LZFH 1HN1A 1I1FA 2NXZD 5F6IC 4K8RD 2E6PA 4JN1H 2BNQA 4J4PC 5ABHA 3MCKB 4I4WA 3IVKB 4A2LA 2PO6A 1MLCB 3LPGA 1TCRA 3PHOB 4ODUB 1RUML 4EDXB 2QMKA 2NY6C 5DMKA 3K3QA 3C08L 1P9MC 5C0FB 2HVJA 3CU7A 1I1AB 1V02E 2IXUA 3D0VB 3GJFA 3WELA 4PJ7A 3IANA 4J3TA 1B31A 1EHXA 2DH3A 1L9NA 5C6TH 4U6VL 3UX9B 4M80A 1SY6A 1TLKA 2CLVB 5D1XB 2KUTA 4OGYL 3ULUF 1QW9A 1Z5LB 4XPAH 1DDHB 4Y16C 5DJXA 2AKRB 1I3RA 3QXTA 1B88A 3WIIH 3V0AC 3VXQA 1LG1A 2OLHA 3CXDH 2Y24A 3ULUH 4UQCA 1HXMB 4WUKH 5F7YC 3QPXL 3TVMB 1EHAA 4PN2A 1Q6EA 1OQXA 1MCOL 2AAVA 5DHVB 5C08A 1ISZA 1NC2A 3EYUL 4TSAH 4HPHA 5DGQA 1D5ZA 4Z8FL 4JG1H 2VABA 3ARUA 3BQUD 2B39A 1BZ7B 3L9RB 3QO0A 3LS4H 1XSJA 3AM8A 1KT2B 1SJHB 4E41A 2NY0C 1INDH 4TTGA 4OZGF 3REVB 2ZNXA 4GBXC 3KWWB 4AD5A 4MCYA 3BWAB 4ENED 1NBZB 3AY4A 4ATWA 2DQXA 2GSIB 4L9LC 3IJ8A 3QQ9C 3DI2B 2WMPA 1KCKA 3FO1A 3DXAE 1QOKA 3IETA 35C8H 3GKWH 1XF5B 5IHLB 3KVQA 1U91A 1RZGB 4U0QB 1IQWL 2IEPA 4W89A 3DX8A 3V0VA 5IHZB 4LPVA 4NN6B 4ONHB 4X5XA 3H3KA 3WH6A 2ATPA 5D70L 3HNSH 3KPNA 2IPKA 4I3RH 2Y8VA 4PR5B 2RGSA 4ELMB 1A7RL 5IBUG 1D5XA 2EC9T 1N7MH 4ELKB 3QNYA 4RZCA 1IFHH 4FS0A 2YJQA 3PWVA 5E9DB 4LEOB 3VINA 1QSVA 4PG2A 4TNVK 3T0WA 4E42A 1MCOH 2VXTH 4D8PB 3FN0H 1DE4B 1F8TH 1JHTA 1QO3B 5F3BA 3MRHB 1FGNL 4LQFL 4WUUD 1P7KA 5KTEL 4P4KA 4ATLA 1DSFL 2GJZB 3QHFL 5I74B 4AT6B 4QOKE 1LE5B 4WKFA 4L3EE 4MDPA 1RP8A 4YFLF 2V7NA 3DX7A 1IGYA 2H32B 3HR5B 5EZJA 1ZVYA 3T1FB 5FDWA 1E27A 4OF6A 2QLVB 2V5TA 5BRQA 3FZUC 1NSNH 5D4YA 1OAYH 1F3JA 4PLKC 3GM0A 5E5UB 1A14H 3ET9F 1QQDA 2ATKB 3S96A 2O26U 3FQRB 4PJGF 1RUQL 4AIZB 2YD9A 5GZOD 3L3GA 3O0RH 2BCKA 2Z31A 5LG1A 1I8IB 4XCFH 2C9AA 1S9XA 3S88H 3BX7C 1FN4B 2QLYA 3EO0A 1DR9A 4MJID 4ZUTB 4R90H 3UCRA 4HW6A 4JJHA 3CXHJ 5BS0B 5BV7H 2ICEA 4X6CF 3BFOA 2ZUXA 1AQHA 4C7DA 5F7EL 1TR1A 1SBSH 3BAWA 4UT6H 3AB0C 1T0PB 3H3BC 4Y5YA 2OR7A 4L1DA 2D0FA 3TBSA 1T1YB 2CQVA 4OZFB 4PTVA 4YXKL 3GMOB 5IHBA 3UP1A 1T2QH 4J1UB 5ACMA 5E99L 1I1YA 5AC5A 3CLEL 3WD3A 1MOEA 2AJZB 2CIKA 2BVOA 5MERA 1IEHA 1WFUA 5AWNL 4WHYG 1E1FA 5IFTA 4FN0A 5CBEB 1DSFH 3W37A 3S6TA 3LRGA 2AJ3B 1G1CA 1OGAE 1I7RA 1N5YH 2B1AL 5CWSA 1K3ZA 3V95A 5CPQA 2QTEA 1YPZE 1WFTA 4O2CB 1FE8H 1Z0NA 3EDDA 3AYSA 4JVPA 4K71B 1LWRA 1J8HB 2P43B 1H09A 1A7BA 2DT0A 2W0FA 4S1SL 4HU8A 3MV8D 4NYLA 4WDIB 2A9ML 3TIDA 3HG3A 1WBYB 2ORBH 2WLYA 2OW7A 3MRBA 4WFFE 3L4TA 1VESA 3DV6A 4QTIL 5JLZA 5D2LF 2IXVA 3V79C 4M93C 5EU6E 5LA1A 1JF6A 2Z92A 4QF1B 4M03A 2XA8H 4UDUB 4LEXH 4YDIL 4NX0A 5MEQB 1W8NA 2W07A 3MSPA 3K7UA 5T3ZL 4GRMA 3QIBC 2DMKA 5HGBB 4M43H 4X6FA 5EFFA 3PDDA 4Y4FA 3L4XA 3WMCA 1RZFL 5CJBA 2NW0A 5JW4N 1H0IA 4QO1A 3DUUA 1YUHB 1JF1A 2LE9A 4OB5L 4JDZB 4CD5A 4GW1B 3BT2L 3NCJL 2IAMA 2HYMA 4YXKH 4Z0BH 3PIQA 3D39D 5E99H 3AREA 1AKJA 1LP9A 2A38A 1YEDA 1BOGB 3F58L 5F7UA 1CZ8L 3MOAL 1UD6A 3L3IB 2FYYB 2WKGA 3WY3A 1T5XA 1YN6B 5CILH 3TO2B 2V5YA 3KYOB 3U9PH 2WMIA 3WIJA 1NCTA 1DQJA 1T7XA 1CGYA 4H0HB 3GMPB 3EMCA 2B1AH 1QEWA 1IGJA 4L3AA 5IBTH 3F5LA 1OAUL 4HEPG 3TN0A 2HT4C 1KXVA 4LXFA 5B39G 2GJ6D 4PJXB 3IJYB 4HCRL 3GMNB 5A95A 4BQBA 3BKYL 5DJ2B 4GW5A 1YZZA 4M6OL 5CSBA 4UQBA 4KMLB 4H5SA 3SO3B 2OBGA 5FB8A 3KNBA 3QJFA 3KE0A 4RISL 4ERSH 2JELH 5KN5B 1KGCE 3RVTD 3I2CL 2ZXBA 3UTTE 4JB9L 1RZFH 1FNFA 5I1IH 3IS1X 4NQEA 2NTFA 3S35L 1C90A 3HI6L 3ZKQD 5F1KC 3VWJA 4K94C 4WI6A 3L3KA 4FP8L 3BT2H 3NCJH 4FFWC 5IMLA 3RDTB 1V7NH 1KB9K 5CMAA 5C0DB 2O61A 5BVPL 3OKDA 4HX1A 3SCVA 1V0LA 4Y5XA 3E6HB 3O3AA 4XPTH 4H7VA 2CUMA 5CSUA 3VCLA 4Z77B 2ZZUT 1WBXB 4JDVA 3LDBB 3CFBA 3LN4B 4GXPA 4WU5B 3WD4A 2YLAA 4XNUH 1VEMA 1T5WA 5ABEA 5F9OH 3PZQA 3JZ7A 5DJDA 5CG0A 2CKBL 3OB8A 1Y6NR 2DDQL 1LEGB 1MCNA 4M61A 4C83B 3A24A 4PP1C 5B3JF 4QXUH 4LMQI 1FFNB 1CICD 1OPGH 4GKSB 1S7XA 4J4PA 5DTFA 3AMCA 1S7TB 5KG9B 5ADOL 5H37G 5D7KD 3U4BH 1PPIA 3P30H 4LSPL 1R87A 3GSQA 5FO7A 5TDOA 5EIIB 4M8QA 2P24B 1K9EA 1P9MA 4MB1A 5FECB 3BD3A 4F15C 5DZOA 1O7DC 1HL9A 2E3VA 5I8OH 1A9EA 2N1KA 3MOBL 2B1HH 4PMNA 4YNYA 5ITFB 4PYSA 3NDYA 4I2XE 3IDMB 1MCHA 3MRIB 3A67L 1T89C 4YBLB 4FP8H 4O58H 1XGTB 2Z4QB 3BAJA 3SKOA 4NQSB 1G9MC 1XGRA 1CDGA 3INUL 5T33L 5ENWB 1CDUA 4Y16A 3WSUA 3QISA 1AQDB 4QHKJ 2P5WD 4LKXA 4BZ1H 3TLRA 3HZ3A 1FFOA 3IDNB 3VFVB 3SGDH 4C56B 1Q38A 4N0UB 4H0GA 1A4KA 1ZT4A 4MS8C 2WSKA 3LXAA 2DDQH 5IW6B 2W60A 4NQDB 4TOYL 1MQQA 1T22B 4IDJH 3W5NA 3GHBL 4OZHA 4POZD 3N06B 4X80L 5EZIH 4GAJL 3VGEA 1A22B 3WUEA 4RDQF 1T03H 3NSNA 3NCFB 4AD0A 3QEHA 3PGDA 4K9EL 3GHEL 4GRLD 1HL8A 4WU7A 4GBXA 3ZE0E 4HPYL 4NFDA 1OLLA 1JZ4A 1ZSDB 4L9LA 3G6JB 2D31B 3MRCA 5GJSH 1AY1L 3N1FC 2WINA 2WB5A 4GW4B 1IE5A 5LWYH 4UTBH 1E6RA 4MTVA 4PRPE 1BVKB 4WVRA 3V6ZA 4GG6B 3OWEA 2GDUA 3WF2A 1M53A 2DGAA 4X9IA 3BH9A 5J6HA 4JFZH 4JLRB 2C26A 1AD0B 3TO4D 2VC9A 4I0CC 3I6LE 2V2WB 3RWFB 2YD6A 4GOSA 4YXLH 2J77A 1UA6L 5E1AB 1VHPA 5I15H 1WJ3A 3O11A 4XP6H 1EUUA 4JN2A 4KKAC 3T0XA 1Z32X 1MFAL 3OX8A 5IB4B 3OAYK 3RBSA 3F6IA 2NY3B 3ARVA 4RGMC 1NGPL 2PW1B 5A3HA 3MLTB 3RHWF 4AIOA 2Y06H 1B4JL 1BBJA 2IMMA 5IW1A 5ACZB 1UKOA 2XN9B 5HVHC 3RGVD 5I1JH 2YA2A 4HUNB 3SDXB 3QHOA 1X5YA 3M7SA 4GAJH 3D9AL 1HSAB 4G9DA 3B6SB 1MJJB 2FGWL 1KTDA 5JW3L 2GJXB 2ZX9A 1XF1A 1GGIL 1BQHB 4H1LB 4OCRL 2I07A 4MB4A 3V7MA 1HYSC 2IQAB 4MX7A 1MCBA 1ZANL 1ZLVK 3RKDD 5F44A 3SKNB 2W92A 4TUOB 3MRKA 4M7JH 1KB5A 3QXAB 1J0HA 4AH2A 1QSEB 3HC0A 1D2KA 4PMVA 2B20A 2FD6L 4K3GA 3T2PA 4HGKC 3UTOA 1Y0LB 4AYFA 1QZ1A 4S1RL 5CLWA 4BCEA 1R3JB 3GSVB 3SBWC 4HIEB 1K4CA 4HWBL 1KBKA 5GS0C 3KJ6L 3LH2L 1KN4L 1UA7A 1JGUL 2CH8A 4QGYA 4BM7A 4NRRA 4RMWA 2D7TL 4IMLA 5J3HD 4B9ZA 2ZOKA 3MRJA 4EXPX 3RP1A 5EUOA 4PPTA 3BUQA 1ED3A 2X4PB 4M24A 2YKLH 5ITBL 4EKXA 1S7RB 1LWJA 3LIZH 3D85B 1DWGM 3GMMB 3TZVC 2ZUYA 3TP4A 4AD4A 4HIXH 5C0ND 3UTZA 3DVNA 4R7NB 1PVHA 4NUGL 5C0JB 3NCCB 3G5XB 4YEEA 3MI6A 5A16A 5E8DL 1VF8A 2ESVD 3SCPA 5FCSH 4PJEA 3AQUA 4U1SA 4K3EH 5H35A 3RIKA 1X5GA 3VXTB 3A4AA 2CBJA 5BOPA 1O6IA 2Y1VA 4HWUA 4DVBA 1S9VB 4TVPE 1IC1A 1CK0L 2JB5L 1ZANH 4QRRD 4HV8A 1TVNA 4NRYB 5DFAA 5F9JB 5E2UH 2XG5A 1IV8A 1KCRL 3M17B 2ZPKL 4JANA 4GUPB 4D3CL 1I7ZB 5IB5A 2ALWA 3B5GA 5KSVB 2DPEA 1MI5A 5KS9B 5I0ZA 4M02A 4RX4D 5F9WB 3RRQA 1RHFA 2EDQA 3KGRA 2BRQA 1VGEH 5EFIB 3D1MC 3QIBA 5BRZA 4HWBH 5HSFA 1YNTA 2QADB 3HRZB 1KN4H 3TBWB 2VLLB 5EU5A 4EBQL 3HMXH 5JHDE 3FQTA 4JZOA 1TVHB 2D7TH 32C2B 4S0TD 3R8BB 3LSOB 4R4BB 3LPPA 1NOUA 1D5IH 3UDWC 1A6AA 1KJMA 1Z3GL 5IVZB 2QL1A 3G5ZA 4JHWL 1QSFE 4RE4A 1R3KB 1JFXA 2OR9L 4JFXA 2OZ4A 2GW5A 1OGBA 5HYJA 3GB7B 4MHHI 1A7OH 1E5JA 4APQB 4F8XA 5DYOA 3GMQA 2J8FA 4NUGH 2V9QA 1RVFL 5DEZA 2BSRA 4ESKA 5ANMA 2DQEL 4G80B 4CMMA 3TPUB 2WMFA 2AABL 4RNRB 1ZAGA 1F58H 3CUIA 1H3WM 1PEZA 1T7WA 3W9DA 4C54A 2XKSA 5CEZE 1L6ZA 5GXBB 4Q74A 5IESH 4JL2A 3AI0A 1ZHKB 5IVXE 4P23D 4AEEA 4PY8I 1KCRH 1S78D 5BCAA 2AK1H 3RWCB 1ONQA 5A8NA 2YLLA 1FRGH 4MPKA 3AIVA 4W7VA 2GITB 2P8MA 5HYSA 2AJVH 1QUNA 1E4XH 2FEEL 3ARBD 1KLGB 5AG8A 4L8CA 5GQBA 7TAAA 2X7LA 1M04A 4EBQH 4NQVA 1TQTA 4WFGE 5C6PB 3PABA 4OIIL 3WUFA 4I5BA 3DROA 2XZZA 5A3IC 3G04A 4P46D 2YUXA 2EE3A 1P4LB 2QKIA 4EUPA 2HKFL 1MJ7L 3WIFB 5C0IB 3BN9D 3B83A 2CPCA 5C07A 4DKEL 2W9DH 2OR9H 2AI0H 4XX1E 2FHCA 1ZMYA 3L3JB 1L7IL 2A0LC 1T2JA 5D7JB 4OCSL 3W5MA 4PLOB 2J4WL 2R9HC 4GMSH 5GGUA 1CNVA 3UEQA 1HIZA 5D96B 4GG8A 3RJDA 4D6FA 1JWUB 2CDGB 4NUJB 5E8OB 5J12C 1AP2B 1UB6B 1F6FB 2EIZB 2B5IB 2AEPH 4OI8A 1T20A 3DGGA 4I9WD 4BZ2H 1R7AA 3QEGH 4R9HA 3WS6C 1CGXA 3MRDB 2V5CA 1XF4A 2OTPA 5IB2B 2N7BA 4PTWA 4M1DL 1NOWA 1FORH 3VFWB 4W84A 1HIML 3HZKB 2J4GA 3BD4A 2DQFB 4O2EB 3PWJA 1KJVA 2B0SL 4PRNA 4NQCA 1W0YT 4GRWE 1OAZH 2QQLL 4LOUD 1K5NA 3BKJL 4XXCC 1JNNH 4Y4KD 1Q94B 3ZTNL 1JWMB 3HUJA 2FBJL 4K3JH 2MKWA 3ZJKA 4LLYA 1P4BH 4FNQA 2PKDA 4WI9A 1I9RH 1T89A 1ZJBA 4Y1AA 1E6PA 4L4TE 3SPVA 2WWMD 5IJKC 4M62L 5GGTA 5BZDA 1WZ1L 2HKFH 3BIKA 3VGGA 3POCA 8A3HA 1HXYA 4DKEH 1ORQA 2K7QA 4R26H 1WSST 2GUOA 3BYTA 5EZOH 3PP4L 3SN6N 4WWID 1XIWC 3TA3C 1RZJC 2WVVB 5ADPH 4QOKD 1HXKA 2P45B 2Q8AL 5DJYB 4S2SA 3RZCD 4AJ0A 3M46A 5GRUH 3OPZL 5SX4H 3PGFH 5TE4H 1XGYH 5DQDH 3UTSE 2P5EA 2KBGA 2HLFC 4HMDA 4XVTL 3V5KB 3EBAA 3U6RB 4MNLA 3RTQC 2VDRH 3IJ9A 3V8CA 5MEPB 3ROOA 4LQ1A 1OINA 2JB6B 2VXQH 3BGFB 3OMZA 1C5CH 2R1XA 4UQEA 2ZIDA 5EMYA 5HHPB 3O3BB 4P2OB 1OM3H 4BQ5A 2IH1A 4Q9CA 3D2UA 2IFGA 2FBJH 4Z7WA 4F3FB 2HN7B 4PIRF 4KDWA 3B2UD 3PP3H 1IC7H 2R2BA 5HDQL 4KVNH 3GRWH 4XI5C 4Z76B 3GBNL 3WSQH 2P49B 4H25A 5BXFA 4QLLA 1WZAA 2UZXB 4QXTB 4N0CC 4KI5F 1JWSB 4YHLL 4UINH 5HD8C 1V02A 1AC0A 2P8LB 1ZVSB 1TE1A 4JO3H 2D4DA 1TZGL 1KFAH 4MDJB 2O5XH 2PWFA 4CW1A 4JFDD 4OLZL 1UXSA 1F5WA 1TPXC 2BERA 2D03H 5E4IA 4DOHB 5HI3C 2F8OA 1G9NL 1AJ7L 4UR9A 3MGTB 2F53B 3K4ZA 4KWUA 1ZA6B 4LBEA 5FGCB 4XGZA 4PJIB 1GOHA 3RL2B 3OB0K 4LSUL 4R4FH 2QMJA 4D9QD 1A3LL 3H0TA 2F5AH 1AXSB 1X5FA 2X4TA 3EJZC 3HAEB 4WFFD 2DKSA 3SDYH 4LRNL 4NO3A 1ZWIA 1IGIH 3CH1B 1ETZA 5DD3L 5EU6D 1I3GH 1S5IH 4FTVA 4ZFZA 2CBIA 5L8JB 4ONGL 5EOCL 1Z0MA 2GK1A 1IVLA 4D71A 1E28A 4K7PL 3ARFD 3DV4B 3CUFA 1HQ4B 4G6FD 2W61A 4QY8B 4XUYA 1LNUB 4QHNA 3THML 1A4JB 1VFUA 2Q1EA 1HHIB 3U30C 1A02N 1B0RA 2AJXL 3OLEA 2VXVL 3DMMB 4BUHA 5IB1A 3VNYA 3UBXA 3PWPB 3SBWA 4WHCA 3ARYA 3P77A 3QUKB 1J0IA 3HC3L 2VKWA 1N5AB 4LF3A 3DOSA 4B3LA 1MEXH 4OQTA 1NMCB 2J3SA 1EEYA 3TNNB 1AGBA 1NH6A 2DI8A 2E9WA 3DXAA 3Q48A 5E9DE 3PDOA 1LL4A 4ACYA 1MF2H 1QRNB 1QHOA 3P11H 1RZ7L 1FJ1B 3VXRA 4C59B 1Q9OA 2ARJA 5I17A 1RJYB 3TZVA 4P4RB 4R4ND 3AROA 1WTLA 1RFDL 2X40A 2R0KL 3D3VE 1FNSH 1EDGA 5JIHA 1QP1A 3IKCA 2W9EL 1E40A 1A6TB 1A3LH 1B0WA 2A1WL 1YMHB 1KR0A 2CDEA 3QFJB 1WISA 2PF0A 5D71H 4AY0A 4UT9L 5FYJE 3BKML 2H45A 4ONGH 3V7AE 3RMEA 4P5KB 3AIQA 4F37K 2HFGL 1DWJM 5J1AB 4BKLA 4POUB 4PJDB 1DBMH 4L3EA 1A2YB 4EAMA 3SUVA 2J75A 2UWFA 4Z2GA 4H0IA 1UH2A 3KLAB 1X7QB 5JORB 3AFLA 1DLHB 25C8H 2LU7A 1LWHA 3LRMA 3CZLA 3GJEA 5BXRA 3FMGH 4RAUB 4YHPA 4ZO6A 2QF8A 5LA0A 3DLQR 1KIUA 4LSSH 4WHYH 4TVSa 1K8IA 2F8XC 4NI3A 1FZKA 1U41A 3GBMH 1UWXK 4R8WL 5A1AA 1DL7L 4TTDC 4PTUA 1C92A 4DAGH 3UDWA 4AZCA 3SJVB 2GSGB 4LCCC 3AIRA 4KDVA 4ZTPL 1SYTA 1RK0B 3IGAA 4KRPD 3BD5A 3OLIA 2V6HA 4ZO8A 4MXWL 4GO9A 5LYRA 2FJGB 1D6EA 5DFVC 2R0KH 4MSWA 5TPWL 2BHUA 2BSED 5D1ZC 2I60L 1VADB 1I1XA 2VZOA 1E6OL 1BAGA 3CVHH 3B2VL 2BFGA 3U9UB 4PGDA 4NKIH 5GJTL 3SDCD 1QBML 1FLTX 3EGSB 5E8EA 1HWGB 5CP3H 3EMQA 1NGXA 4GS7C 3MGAA 4OAWA 1A64A 3V5HA 3SE4C 4DZ8A 3N1MC 2GK0A 3W11C 4WWKC 3HZVA 4JRYB 3MJ7A 3EDFA 1OGAA 2EPMX 2KZ1B 1HHHB 1FO0B 4UIMB 4QHMB 5CD5D 1YPZA 2V2XB 5E94A 1BVNP 5HHOB 2A6JB 3W9EA 3FRUA 5M7QA 3BUIA 3MLXH 2XKNB 1N2RB 4RAVB 2W0PA 2X9WA 2C3GA 1AC6A 1DVFD 4WO4B 1T0MA 1OB1B 3U83A 2VKXA 1ZHLB 1CGTA 3EYPA 1U8QA 4LSTL 1JUFB 2BRRH 1FIGL 3T3MF 1OCQA 3BCDA 3FCTB 4I13B 3X3FL 5FYLD 2IADB 1PX8A 4O5LL 1JF5A 4JM2C 2BXYA 3R1GL 2HRPH 3S8WA 1KCSL 3QDJD 4O4YL 1OAQL 4V2CB 5I6XC 2VZVA 4JO4L 5A6SA 1ZS8A 2EZ0D 1KC5L 1NMAH 4PGCB 1NP0A 3T2OA 1AO7B 4NCDA 4HIIA 4P5TB 1NFDF 5CGMA 5D4QA 3BVWA 1TJGH 5SX5K 2ZG3A 5GGRA 4MLIA 5EOCJ 4KK9C 5ISZE 4ZQKB 1Q9KB 3BZEB 1S7UA 2OI9B 1NL0H 3UJTH 3PQYD 1H3GA 2JJSC 4M4PA 4HWZB 3AXLB 1QBMH 3CPLB 2G60L 4PREA 1PX4A 3WS6A 1XR9A 1EOMA 1KLFA 1T3FB 3QUXC 5I19H 3ES6A 5MI0C 4N90E 2VSDA 4PRPD 5JDSA 1CXIA 2E6QA 5INCA 2NX5D 1FNEB 4NGHL 3G08A 3FKUS 2EO9A 2Y23A 4XXCA 4YO0B 3UC0L 3GUTB 1G7IB 2UY3A 3I3BA 4HXAL 4RCAA 4F7MA 4Z2JA 2OTWA 4U0RB 1JYWA 4KZEH 1CLYL 3TTOA 4A6YB 1RIVL 2IGFL 4MVBD 4LSTH 5CJOL 3DX3A 4UDTA 5IJKA 5JO5A 5DD1L 3X3FH 2AV7B 1LD9A 2Y72A 3F7VB 2CERA 3WUWG 4LVOC 2NR6D 3Q6FB 3R1GH 4BA0A 2MCPH 3MXVL 5EDXA 2KPNA 3NFSL 3UTTA 3TA3A 1XIWA 3MLSL 3HG1B 4PJFF 8FABB 4EOWH 4HS6A 4UNVA 2ZX7A 3UO1L 5EUKB 5H37H 4YHYC 4QCIB 1KN2L 4HUXB 1JFHA 3WDPP 5F89B 2MTPA 1A1OB 3NMEA 1W3LA 1CXKA 1HOCA 3GXDA 4YHKL 3BE1H 4HXBH 5IHSA 3U0WH 3SGKC 5F7HA 1WLHA 1P4IL 5F8QC 4LMQE 3ZKXB 5I1AA 3RTQA 2D1ZA 3VIGA 1C1EH 3SE8L 3H2WA 4KDTC 2BNUB 1JTPA 3ZYOA 4HWEL 1J11A 2R0LH 3QR2A 2XWTB 3L6FA 5CHNA 4WSKA 2EDOA 1B0IA 2C1OB 1OGTA 1ZHNA 3IT8D 4UTFA 2X4UA 1U33A 1T1XA 3TH2T 2ENSA 3QUMH 4NRXA 5DRXB 1G6RL 3MJ9A 4XBGB 2DQDL 5DD6B 4JKPL 3GK8H 5CJOH 1EEZA 3V4UH 4TN9A 4B53A 2BVTA 1U8PA 3E6FB 5F9DC 2MSPA 1ZLWH 5JA8B 4HT1L 4HIJB 3FHAA 4AENB 7FABL 2N4IA 4G8GB 4JDTL 3UO1H 2VITA 4I2XA 1FHDA 3BKCL 1C16A 1KN2H 3T04D 2E7CA 1LDSA 4L3CA 4M5ZL 1JYXA 4ODWA 5L2KD 4Q6IC 3NBNA 4HK3N 2JCCE 4JY4B 3RNQA 3QR3A 1HTYA 1G7LB 4P2QB 1CE1H 3S4SG 1GJUA 2A9NL 3BVUA 3WO3B 1MQKL 2P8PB 1O5DT 3HCVA 1KEGL 4OTXL 2BNRD 5D7SH 4U1LB 3GDBA 1FP9A 4JFED 1KPVA 1FYTD 2VH5H 4NT6B 2E8ZA 1G84A 5DI8A 3N1AA 5FYJU 5F7KC 3RWGA 5EO0A 1UQYA 2FJFB 2VLRD 3W39B 3G6JE 4XCEB 3VFGL 3RAJH 1CWYA 2Y07H 4EN3C 4PJHE 2FO4A 1OSEA 4AMKL 1FZMA 5EWIH 4KKNA 1CFVL 1LO2L 1K3IA 2GK2A 4JAWA 1IC4H 4EIGB 5JZ7D 1FNLA 2VQ1A 4OGZA 3NN8A 5SWSB 2ZNWA 2NT0A 3GMRB 3EJYD 2D7OA 3VFRB 2R2HA 4F57H 3GXMA 4FQJL 1IGCH 1S9WA 5CSZB 1I1AC 4IIQC 3MLPA 1HKIA 1PYWB 3VXSE 4U1IB 5EU3B 2NY1D 2ERJC 3KPRA 3MA9H 3QHZL 4HT1H 3F8UB 2HAZA 3ZTJG 1W72A 1NLBL 1N0XL 4XWOD 3NGBB 4JDTH 2DQUH 4FZEH 2NY5L 3SQOL 3O9WB 3QGVA 2AXJA 4HGWB 1BFSA 2VLMD 3RWIA 1U8NA 1MW0A 4OQ1A 5DMGD 4KUZL 3MMWA 3QJHA 4KV5E 1TQSA 3P73A 3CPUA 4X6DE 2PCPA 5HYSG 3U0TA 1I1RA 1SYSA 1FA2A 2N7AA 4M7LT 5AZEL 1WCGA 5IEHB 3ARZA 5JW4M 3KXFD 2G8ZA 2YWYA 1TJHL 2QR0A 5KSBF 3NIFE 2VX4A 4XH2A 1QSEE 5KVDL 5FA3A 3O2DL 5IG7A 3RWDA 4N0FB 4JFHE 3DHMA 4NO5A 4ZPTB 2DIEA 1GONA 4LLVA 1CFVH 3QEQB 4EUPG 4DGYL 2DF3A 4LNRB 1FV1B 1NAMA 5DJ0B 3HR6A 3VGHA 2X10A 1OWWA 4D0DA 1T1WB 4Y8DC 4ZS6D 3SCSA 2R23A 5ABGA 1KLUB 1BJ1H 1A3RH 4P48A 4M9OA 4NNPL 2HMID 2YC1B 5IGXL 4DWSD 5A2LH 2J7EA 1N0XH 5EO9B 4W86A 1AGFA 4LCCA 3SQOH 3DGCR 3ZE1F 5I75C 4G8EA 4ZFOL 4ZXOA 1JGVL 5FYLL 2CETA 1PW3A 1PS3A 1JNDA 3OJDA 4P0DA 1CG9A 2GTWA 4CJ1A 4N9GB 3A22A 4S1QH 2OW6A 5GGVL 1U0QA 5FKAA 1KELH 4BFGA 3N04A 3ALXA 5D1ZA 1SY6L 2X4QA 5JW5A 1GZPB 5IR1B 5E9AA 3NZHH 2ZUSA 1A21A 2CIIB 2FIKB 3MO1A 3EJJX 3PNWA 4M7LL 5D5MF 4OZGB 3BSHA 4NZFA 2V2TB 2JFEX 3ARDC 3QNZA 1KJ2A 2J6EA 5T3XH 1IAIH 3CAFA 5I74C 3SE4A 4RAHA 5L8KB 3NA9L 4LFHG 1YYLL 4WWKA 1HI6A 3SCRA 1B3YA 5BXTA 4QRTB 1YEFL 4Z7QF 4IRSC 3WEMA 2AXGB 2RFXA 3VWKD 1IT0A 5CEXB 1IAIM 2W63A 5IM7B 4CGTA 1T21A 2OQJA 3MQIA 1KTLB 2E6JA 4X4YB 3DVGA 5IV2B 2FX9L 1MFEL 4NNPH 3ARQA 1FNAA 3NACH 4ZAKB 4FQPA 2MMXA 4NZUL 3MLUL 1U6AL 4PJ7F 4XVJL 4HG4J 2DYPA 3RL1A 2J5LB 5T1LA 3O2WL 1FZJB 4NZTH 2WW8A 1JGVH 3GJFH 3NVQA 1A6WL 4JM2A 4RGND 2EDBA 3T2QA 3VFNB 2YPLB 3ZDZE 3N85L 1R8LA 4NKMB 2P1YA 2V5RA 5JHDA 4LLQA 4HUUA 1JRHH 4YIQA 3J8F7 4YFLI 3P4MA 1IC5L 2YPVH 3B3IA 4KJYB 5ICZB 3KPSA 5F1NB 2EPOA 3MRPA 1QSFA 2FWOA 5J6GB 1AGEB 2AXFA 1OWRM 2JJSA 4M7LH 1G1YA 3FO2B 4LSQL 1W2PA 3JWDH 1TNNA 4PJGB 4AL8H 2J7HA 1O7VA 1F4YH 2EQDA 3QUXA 3W0WA 1PSKH 5BV7B 3WNNA 5L9DH 4I48B 5SWZB 5C0BE 1VAHA 1YEFH 1C5BH 3KYAA 3OGCB 5C0GA 4C57C 5D7LE 3BPOC 5D1XD 1LQ0A 5HBFA 4UU9A 4GMTL 4X6CB 5HDOA 2W67A 4OUUA 1I7UA 4OFYA 4NXSA 5A6LA 4DN3H 4R0LB 5HYFA 1RHHA 2JJUA 5IVXA 2FX9H 5IF0B 4KJQD 1BECA 4XHJC 3VM7A 5F88B 3Q0HA 2ZUMA 3TVMD 2AP2A 3VXUD 5I8CA 4D6JA 3SGEH 2VXSL 3N85H 5I73B 1RIHH 1UXWB 1VJZA 1RZ8B 5FUCE 1MRCL 2UY5A 5BJTA 1C8YA 1GRWA 2IPUK 1I8MB 1UVQB 5CD3A 1YECH 5JPNB 4P7QA 2XWBA 5JUEH 5BMFH 4U6HA 1DANT 2Y5TA 4NN7B 5ERWA 2OCFD 3FT2A 1LEIA 3QRFM 3SGKA 1X44A 3OLDA 4W4OC 2X4OA 1KPUB 2CR6A 1JGEB 4MXQD 3HU7A 4MD5B 5JUVA 4KDTA 4IRZH 1AFVL 5DT7A 3UBXG 3C5SB 3GSUA 4X8JA 3AIEA 3LRHA 3MRMA 3U4EB 3VDAA 43C9A 1IL1B 1MNUH 3QUYC 2A73B 5EOQL 4DW2L 1HK6A 1TZHA 1ZGLB 1RJLB 5B8CC 2G2RB 3U46A 5DRZB 2OXHA 3IDGA 3O6FB 1F11A 3NIYA 5FKPA 3ZIZA 2NPLX 4G7YH 2H2PD 4LIQE 1F45A 3SO3C 3BPLB 5E9DD 4JPIB 2H1PL 1H5BB 2GUYA 1KIRA 1BSIA 2VDLL 5F93C 4CKQA 4R7DB 3B9KB 3MUGB 3CIQA 1FDLL 3PWLA 4NRZB 1E0OB 2PB1A 1OTUD 2ZSVA 4GJTB 4QHKI 3CCHA 3KLDA 3UZQA 2OL3A 1P6AB 1P6FA 3WFHB 4F7EB 3HB3C 1QFUH 3VGAC 4PBGA 4M7ZB 1ES0B 1A7PH 4DUXA 3NPSB 1RUPH 4KMTL 2VRKA 4L4TA 1DWHM 1KYOK 2XSBA 3V52H 4QGTA 1NWUA 3B5TA 4Z9KB 4U1MB 4W6WB 3WS3A 4Q6IA 4OKVA 4K8RH 5IQ7L 3BSZH 4OGAC 3VFUA 1GZQA 4LPUA 5MP6H 4BQ4A 1NGQH 2QHRL 6FABL 3LDBC 2PWEA 4M7KL 5DZLA 4XB3A 4M00A 1FVCB 1WQVT 4FXKA 4JO2H 5FIEA 4JZNA 4BH7A 4PMRA 5BS0D 4LAJH 1A7NH 4P8WA 3X12A 1M05B 5LQBL 1GOOA 1EAPA 1NOFA 3SE9L 4EN3A 4M6ML 4I3SL 4X99B 3UTSA 3WXVL 4MDIB 2VDKL 3BW9B 3DBXB 4NPYB 3ARTA 5GHWL 3U0PB 1ZGLP 4P3DB 4XNMB 5IFAH 3MKKA 4H20H 3MMDA 4JFYA 4XX6A 1G0YR 1CD9B 1CL7L 1EFXA 1JCKA 1S7WB 5FDYA 3C60B 3CFIC 1JFQH 5DJCB 3S3PA 4DZBB 1I1AA 4IIQA 1FDLH 3HMWL 1ZHBA 5F6HJ 1GPOL 3L7FA 3VRIA 3O6KL 4AZIA 3HPJB 3P9WB 3QG6A 3BHBA 3T8XA 1IAKB 3MNZB 4X0KA 2ICWA 1R47A 2XVLA 2F61A 3P9LA 4DOHE 2BHZA 3C8KA 5HPOA 2OJEA 5IT2H 1SVCP 5K59F 2JF7A 1DQTA 3S37X 3TBYA 1CE6A 2WQRA 4JGJA 5DC9B 1BEYH 1J8HD 3EHBC 4HC1L 4Y4HB 4UQ2A 1Z5LA 1D3CA 5ALBL 2IANB 1LP9F 4UT7H 2DRUA 2IFFH 2D7NA 1MAML 2F74B 3S7GA 2ZUWA 2HP4A 2EDRA 3MMEA 2I26N 2OP4L 2GSJA 3S37H 1N59B 1FG2B 1HKLL 4X6BA 4XCNA 4ALAH 3IGUA 1S7QB 1CDYA 3I3EA 5I2UA 4DTGH 5DEGA 1YYML 3SE9H 4F58H 4XP4L 4UTAL 1U8HB 1TQCC 5IB3B 3WKNA 3MRLB 2BFVL 1DJSA 4YAQA 1IJ9A 5DVMA 3L4ZA 4N42A 2F19H 2FZ3B 2VL5B 2VR5A 1GC1C 3FN9A 2ZP0T 1UOKA 4EZMA 3BWAA 4DKFL 2G3MA 5KJRH 1XFPA 4JHOA 2ADIA 3SGDI 4FQLH 2EIEA 3VW3H 2H3NB 2I9TA 5T5NG 1EDTA 1GW1A 4N0YH 2AJUL 1KXTB 2GFTA 3PL6D 3OKKB 2YD2A 3MLRL 3MV11 3ZSSA 5M95B 1ADQH 3QEUA 2CKBB 2D2OA 4DVRL 5I8EA 2VX6A 3VU2A 3MNWB 3WEXB 5D93C 5EBWB 2A77H 4LLUA 3QZWB 1MAMH 3CC5B 1CF8H 4XC3L 4B3KA 1K85A 4MXVE 1U8OB 3RWHA 3QFJE 3RQ3A 1YJDC 4WW1A 1HKLH 4DEPB 4X9GA 3IRZA 1MY7A 3M45A 4RMRA 1A47A 2Y7QA 3ARDA 1MIEL 1RMFH 4L4PA 2XICA 2J8UE 1EPFA 1YYMH 2NW3B 1C8PA 1BLNB 3D3VA 3LKOA 2Q6WB 3ZL4H 2BVPA 5D8JL 3KPMA 3NCBB 2XWDA 3IFPB 5EB8A 1M6OB 2ZX6A 4FQXB 2CEQA 4IRSA 4WJ5B 1J7VR 1QG3A 4GXVL 3RDTD 3WEZA 2ATKA 2YRPA 4NC2B 4WHDA 2VLKB 4NQXA 4IJ3B 5I6SA 5EU4A 3VIPA 3VFMB 4ATDA 4Q2ZA 4L4VA 1IZKA 1B0GA 3CDGB 4Y2DD 4ZUTA 3T0EE 1B1YA 4KY1L 5DXWA 4LAQH 1PZ5B 3EYQC 5D9SB 1KIPB 1RV6X 3MV7E 3S5YA 2F54B 2HVKB 2RCSL 1CLZL 2AGJL 1NUNB 1CT8B 3BESR 1WAAE 1CBVL 2E9BA 3C5ZB 1KTKE 2A3EA 1CLOL 2E5EA 2NZ9D 2EEAA 4Z2LA 1QLRB 1T1YA 4LLWA 1J9CT 4MNGA 4PYHA 4PTXA 3IJSA 4XWGH 3CFEB 1D9KC 1BZ9B 1UYWL 4QRSA 4M1GL 4TNVF 3MUZ1 4HPOH 3WY1A 1NCBH 1H0GA 2IJ0C 5L0QB 4KKLD 5CBEA 1R3LA 1DCLA 3FO9B 4IHOA 5GNYA 6A3HA 2DWDA 2Z0BA 2X1OA 2ZCHL 3VH8A 1KWKA 4OZHF 2O5YH 2CLZB 3H7LA 2Z1SA 2VVSA 4YHOH 2X1PA 5HPMA 5GZNC 3GMLA 4KGLA 4KI1A 5FXCH 4WIQA 4GXVH 5DVKA 1MW2A 3DRQA 2YXFA 2FO1A 5CCKL 5A6MA 4XAKD 3X17A 5J11B 2DWEA 5C8JB 1HH9A 4NFBA 4UZSA 1QWUA 4AMCA 4B16A 1T04A 5D9MA 3MA7B 1MSPA 5HHQB 5E24E 2AK4B 5ID0B 4KY1H 4C56D 5FGBC 3BZ4A 1YY8B 2EXYD 3MRNB 1U92A 1MRFL 1XR8A 4U7SA 3LMJL 3GBEA 1NFIA 1BGGA 3OAZH 1KB5L 1E6JL 3SCQA 4DKDC 1VFAA 4JL1A 1RPQA 4OCMC 4Z7VE 4NQDD 5HVGB 2YD3A 4Z7OF 1NDGA 1I4FA 3GTNA 5FO9B 5J57B 1P5UA 3RVVD 1Y18A 4LHUA 2VRJA 4PJCA 5JQHC 5L6YL 5D1QC 3EBVA 4H8WH 5ABDE 4KTYA 2FECI 1MHPL 1UFUA 4ZUSA 2VQTA 3GNML 4LCWB 5F3HA 4GKNB 2BC4A 2ITCB 3DPBA 4W4OA 3TNMB 4G6ML 1ZEAH 4NBYB 4FMKA 5ELIA 2WNWA 4LCUA 2DSKA 1Z9LA 1WAWA 2ZCHH 2EPLX 2OTUB 4EI6A 4RA0C 4RWYH 1HDMB 5FF6B 2WW5A 4ODSH 5ISZA 4W88A 4IPNB 3C6LB 2QPSA 1S7VA 4K3DH 1GOIA 3JV6B 3QUYA 3T09A 3IKKA 5EZLA 5B8CA 5D2NB 4HK0B 1AXTL 4M1RA 1UWUA 5E08H 1IM9A 2Z93B 3S3JA 2NY3D 4R97C 5GNXA 4U6TA 4QRPB 2XFYA 1AGCA 1BFVL 1SJEB 2XN9D 2B7DT 2DQJH 4M3KB 5D2LA 4WCYL 3ZKMC 5JOPE 3KPQB 3HTLX 1JHKL 3VGDA 5EUOF 4NO2A 4X6EB 5DDHB 3PDGA 4W6XB 1DN2A 3GI9L 3GSXB 3FOLB 3KJ4B 3HE7C 1CD0A 5GGSB 1KCVH 3W82A 1AR2A 2C4FU 2Z8RA 3RDKA 2FGZA 5CZVH 4G6MH 3LN4A 1NCAL 1AR1D 3FB8B 1YEIH 4KVCL 5FUCC 5KSAC 4JZJB 1QSED 1E4XI 1R86A 2OJZH 1NBVH 1SM3H 5D96C 3ZHKA 2OZ4L 4YPGA 5DR5L 3BP4A 4PJEF 1EDQA 4OLVL 3RCNA 2XZCH 4X7TA 5A6JA 5LXGL 3FHQA 3LRSA 4P9HH 5BO1H 4BJLA 2PNDA 1CFTA 4PRIA 4YFDB 4NNYA 1FFNA 2PI6A 3EO1B 5F97E 1YEKH 1OTTC 1QR1A 1ZBKA 3PV6B 1H15B 2OYPA 1OAKL 4CVUA 2R69H 1R5WA 3JUZA 4OLWL 4HIHB 5TGBA 2CIPA 3ZHDA 1F4XH 4KUCD 4ZXLA 3TBTA 3TYGH 1MREL 4Q9QL 4YDVB 4ZYKB 4KFZC 4NM8L 5FO8B 3D85D 1J05B 3STZB 4LYPA 1N4XH 2BVQA 2MNUA 3F7QA 3TT3L 2NNAA 3H9SD 4G8GE 1AVAA 2QQKH 1C12B 5T1KA 2R29H 4XPHL 5CAYB 2V17L 2IPTH 4LVNC 3WIHH 2VIRA 1CGVA 5F71A 4W7UA 5E0QA 4AD1A 5HGDA 4MCZB 4H8HA 2R0ZL 2VXUL 5ENWA 2RR3A 5E2VL 2Y9RT 4ZUWB 4NO0A 1NEZG 3QAZC 4FOMA 4G3YL 2DIAA 1MPAL 4XBEL 4CD4A 3RM4A 5GIRA 1GVYA 4XXDB 3F12A 3N1QC 3BEVA 1BYAA 3VFVA 4ODXB 1WDPA 1DQML 2XTKA 1LILA 1HX0A 4ZUVA 1ZTXL 4OLYH 1BM3L 4F7PB 1QBAA 3VFTA 4D0BB 2YBRB 4WI7A 2QADD 2JCCA 5CBAB 4PY7B 4L1HA 4FFYH 3ZTJH 3N12A 1BFTA 5JQ6L 4FQHB 4UAOB 1UG9A 1TMCB 1GIGL 2YPKA 1AI1H 2LABA 5IFHH 1CFNA 5SWSE 1NP2A 1C93A 3BO8B 1GORA 4R2GB 5E4EB 2VDOL 5D9PA 1MREH 3RZWA 4NDMB 2LV4A 2B4CH 3GO1H 4APQD 4PJHA 1KPRB 5B21A 2X2YA 4F80A 5C3TA 1DUZB 5A2AA 4NCC2 4PEEA 4HULB 1CXHA 4TRPL 5SX4I 1UACL 1C8XA 1PZ2A 3I6GB 3OKEB 4AXNA 3B8SA 1P53A 3VXME 2C3VB 4XMKH 3BP7A 2VURA 2XVPA 4HUWA 1LO0H 4M6NL 3VXSA 3KPOB 3I02B 1GOKA 1ZV5A 4K94H 2FE0A 1F13A 2W1NA 4G6KH 5GGTL 4XBEH 4EI5C 4EUPH 4YPJA 1AHWB 3HNVL 2Y6SC 5AAMA 4K23H 1NGYB 1CXEA 5ID1A 1W0WB 1DQMH 1QVBA 3GI8L 2XXCB 3BAEH 4HOWA 1HH6B 1I7TA 1UKQA 4OGXL 1UM4L 3B8YA 3V6BR 2FSEB 3WJJC 5FIPA 1SFSA 4PTTB 1JPTH 5FYKD 3VDCA 3UPRB 1AQKL 4X6DA 4UUJA 1BQHA 5CIPH 3V6FA 3BP5A 1XGZA 4JQIH 4BH8B 2OWWA 3W38A 4KK8D 2J88L 2EADA 4XPGL 1Q0XH 5HBBA 2I5YL 2HT2C 4R27A 3L5XH 1INEL 1MCPL 4KROC 3WV0A 3OZPA 4U1KB 5D7JD 9CGTA 2YFNA 1HHKA 1N0LA 3T3PE 3IDXL 5BVJB 3HUJF 1XSKA 3HE6B 4U05A 5D6DC 3OSKA 2VZUA 2O9PA 4ZTOH 3EFFA 3MXWL 2VUOA 3EYSL 3AS1A 4M3JA 4XP5H 3VI4E 4XX1G 4AMXA 2DTMH 3BAKA 1FSKB 1KCLA 3RGVB 1XH0A 1J01A 1NMCC 2YMXH 4HDIB 4LLDB 5JIIA 4RFOL 5CUSL 1C3FA 4GH7B 1WVZA 5ESAB 2C4XA 1D9KA 4FLQA 1KQYA 3O9NA 4CN6A 1GGCL 1JTTA 1G9MH 1U3HB 4ETQA 3GI8H 4XVUD 3L7EB 1S7SA 3UEZA 5F1OB 1C7TA 4FG6C 2D0HA 5IQ9B 3OAYH 4UNUA 1JGDA 4ZXBB 2J62A 5HHXH 4CADB 3CMJA 1YY9C 3LB6D 3WD5L 5DSCA 4PUDA 1HEZA 2IBGA 3F62A 1ZA3A 3IF1A 1I1CA 1TJIH 2IBZY 5D72L 2JF6A 4KRMB 2GAZA 5HHMB 2XKUA 1CGSH 2EKSB 1FP8A 4XPGH 4MMZC 1WBZA 3IS0X 3JTSA 1P7QB 2G3NA 2H9GA 4PGBB 2I5YH 1VA9A 5AY7A 1N8ZA 4YDKL 3N17A 1I7ZA 2CITA 5B4MC 3C6SB 4Q9RH 1L6XA 4J7RA 4OCXL 1ZLVH 4OKDA 4Z7WF 4PRWA 3MFFB 2BSSA 4IPLA 4L8BB 2PXYC 1FBIL 5FGBA 3BZDA 4HHAB 2X70A 3WL9B 3T4YA 1VPOH 3RPIA 2CUHA 4HKXB 1BPLB 2H6PA 3CFDB 3O41A 1VDGA 5C7XH 1JV5A 4EDWL 3QIWB 4R4BA 5AYIA 4E9LA 1IEBB 1U3YA 2G41A 1E4LA 5B22A 5F7DB 3T0EC 1E15A 4M5YL 4QWWD 5D1QA 5GS0L 2XWJB 5J9PB 4KAQL 4QLRA 3C87A 4OQTL 4P2OD 1SEQL 2BSTB 2OWCA 3WUBA 4GLRH 5EBAA 4AM0A 1C7SA 2KKQA 2XG4A 2J7FA 1ND0A 2EDXA 5FKYA 5DJ8A 1KSRA 1T7ZA 3QDGA 5AZ2H 1UKTA 1X5XA 3BGMB 5E2WL 1JD7A 4G80A 5BW7C 4XPBH 2FB4L 3WLBA 2GIYA 4RGOH 2A3HA 1HHGB 2BJML 1ZHKA 2GTZA 2OSLB 3WFCL 2DT3A 1SJXA 5MENE 3EOYG 5TDNA 5E6IC 3VXOA 2PYEE 5C0BA 4MGXA 5DEFB 5T5FL 1QFWL 4P9ML 1QW8A 2EDYA 4BZYA 5HGHB 1W1VA 5D7LA 3G6LA 4IOSD 1MUJA 4XPFL 2EJ1A 2F53D 4KKCC 4PJ8B 4HJJL 5LAXA 3G5VB 4YHGA 1RZIA 2VE6B 5C09E 3BXNB 3DJ9A 3SEPA 4EDWH 3HMXA 5IOPB 4OOZA 3I85A 4UOW1 4ZFGL 1YEGH 4MAYC 4M5YH 1MHHA 5C2UB 3ZKNC 3KDMB 2DKMA 3IJHA 4NM4H 4PJAE 3TWCL 1FCGA 1G7JA 1SEQH 1I1WA 3HE7A 1IGFH 3A6CL 3P4NB 1A6PA 4P23B 3V4VL 2DS4A 5KSAA 3NCYP 1BG4A 2BOBA 4PRDA 1LE9B 4PV8B 2VLJB 1J5OL 2VQUA 1JG9A 2R2EB 3DMMD 4NUJA 3CSBA 4MNKA 1AP2A 1CLVA 1SZNA 3PWPD 5DQJA 3CFJB 3VG0H 1F4HA 5BXPA 3ABZA 3O3EA 1A9BA 2CCRA 1SR0A 1F90H 1P6WA 3QIUB 4MWFB 1TETL 4FQ2H 5A2KH 1GQLA 4KQ4L 5ETUA 4PRBA 1I8KA 4FLSA 1NUDA 1QRND 5DUMH 4R3SA 1ZBWA 4F2MB 3LN5B 4JM4H 5B39B 4MJ2A 1FFPB 3O6MH 1JZ2A 1Q94A 3AHXA 3QCTL 4HJJH 3BJ91 3IU4L 2O5ZL 4JHAH 2EEXA 4EANA 5GGVY 1DBJH 2Y25A 4OCWL 5IMMB 1R46A 2EDDA 4OIBA 5EBGA 2WZHA 2ADGB 5A6BD 1NFDB 3F7RA 4YDLB 3KYMA 2J25A 3QFJD 4ZDHB 5E6YA 3UTPE 1KG0B 5I9QC 2UUDK 2G5BB 1DEEB 4FFZL 3ARRA 4ZFFA 1IAOA 2APBA 2WVVA 5GSVB 1ITXA 1XYZA 3V4VH 4KK5D 1FNGA 2YD1A 3R06A 5ILTH 1FL5B 4RFNB 1UZ4A 1ZK9A 3OXRB 4L9DA 5T3ZE 4R6UA 1DN0A 2YUWA 5KVGH 2FX7H 4OSUH 3W24A 4ML4A 4KK6D 3V7AG 2BDNL 1US3A 4TQEL 4Y4KB 4AIEA 4JFFB 3MFGB 3O4LE 2IQ9H 1NCUA 4Y19E 2DQTL 3U6RA 4L5FH 4F79A 3MR9A 4HSQA 3EYVB 1JK8B 2HFEA 5ESVB 1VFFA 5HYQA 1IT9L 3P4OA 1E56A 3SJVD 4KQ4H 1F3DJ 3V8OA 4ZO9A 3I84A 3UR8A 3VSUA 1NCWH 1UB5B 4MJ6B 4KTEH 2XIIA 3GSRA 1BD2B 1QNZH 1ZU8A 4H8UA 2WUBL 1ZB5A 3RWJB 3QI9B 5C6WH 1YPZF 1NANI 2IPUG 4NN5B 3MGOB 5H94B 1JGLL 3O45B 3QOKA 2MCG1 2FX8L 4JRXA 1DWIM 4FNRA 4ZNEE 4KZDL 4NP4L 1F97A 3S3SA 1LK2A 2XFXB 2JIXA 3EDJA 4MNQB 4N8VA 1TENA 1JPSH 4OV5B 2IANE 4NHUB 5I1GH 1GL4B 4X98B 4FFZH 4NSBA 2HKHH 4XZUA 3HI5L 3VH8G 1GXEA 1URLA 3NAAL 3OKMA 4EI5A 5AYUH 1YMMA 4LASH 4YBQD 3MLWH 1UZ6E 5TDPB 4JRYD 3C09B 2E8YA 5T5NF 5J13B 5JOFA 4BFEA 2XN2A 4LU5L 5FUOL 4PJ9C 4HJ0D 1GGBH 5CZXD 5HHOD 1RZJL 3EOBB 1NC4A 4FLOA 1CQKA 5GS1B 1D6VL 3QUMB 1NKOA 3WJJA 1U58B 3HLAA 4J8RA 3RL2A 2VUYA 2WMKA 3GNOA 2PW2A 4WO4D 2YUZA 1MCSA 2O9TA 12E8H 4QT5B 3QNXA 3EJTA 1TVBA 3DX1A 3EFDH 4M1CC 4DGVH 3R0MA 5C0CA 4OIFA 3ILPA 4QXGH 3P3YA 4C4KO 1QFOA 3QO1A 1JNHB 5FL1A 4ZOAA 3QB7C 1JGLH 4LHUG 4B7LA 1AO7D 4P5TD 3CGTA 4XBPB 3OG4B 5D6DA 4AZ6A 1UT9A 4JY5H 5CINL 5AC4A 3WN5B 2Z91A 3GRWA 1JPFA 4CD6A 3AFBA 2K1MA 3T08A 2G9HB 1R33A 2YSSA 1ZT7B 4I0PC 3D18A 3SDDC 5EC1B 2NXYC 3FOMB 3F5WA 3HI5H 3MJ9L 4KTDL 3QCVL 5FA4B 3IDJA 3WDHA 2CESA 3NAAH 1JDCA 4HH9A 2G75A 4F33A 1JAKA 4LCIL 4FQ1H 1KJ3H 4U6YB 1UZ1A 4XV0A 1OP3K 3AZSA 4V1DA 4K7FA 1L4IA 1RZJH 1S5HA 3Q2CA 4XMPH 2LVEA 3FFCB 1FCCA 1UJ3B 4NJAL 4PRHA 4UIKH 2NW2B 3ZJ8A 2Z9TA 3QWRA 1G6RB 5I18H 5KVEL 1E4WL 3VMOA 3JWOH 5I1LB 4GAYB 3ILQC 4HWNA 5I1KL 1XHGA 5JIKA 5E8PA 4I77H 1CU4H 4MAVA 1K6AA 1NGZA 3ZR5A 1JZ8A 3D52A 3CFCL 1T66D 3V9FA 3KL3A 4E4PA 3OF6A 5D9NA 1RULL 2UY6A 1LVEA 3HG2A 2J8UA 2YA0A 1XGQB 2VDPH 3EW3B 3OGOE 3QPQD 1MHEB 2XV6B 5BRPA 2PTTA 3HG1D 3Q6GH 1U93B 4G43B 5IBLD 1YEHL 4WI4A 5EA0L 1HKFA 3RI5K 5F7WC 5JHLH 3KLAA 4PJ5B 4R96B 5ALCL 2BMKB 2PXYA 1BIIB 4OD2A 3FQWB 3MRFB 4JVUA 4WUUE 1MQ8A 4OLXL 4AK1A 1QYGL 5FCUL 2CK0L 1U8JB 2VR9A 3LKRB 3SO5A 1BWMA 5JXED 4OZ4B 2ZCKH 4KRNA 1WC7A 3NABH 3CH8A 2GSGA 3T0EA 2XPKA 2FLBT 3ARGB 4A4AA 1CDBA 1KWGA 2LAGB 1X5IA 1K8DB 2EYTB 5EPMA 3MV7A 1QVOA 3MLYH 3WKML 4EQ3A 4OV6F 4NHCL 5DD5L 3D51A 5GNZA 4JG0L 2DQGL 4H8VA 3NFPA 4P5MB 1UD8A 4MJIE 3L4WA 5DRWA 3AXXA 2Z35B 5BZWB 3HI1B 4Z78B 4G9FB 5KSBB 2FJHB 3DETD 1M7XA 1U95B 5F7FA 1VADA 2CJUH 2P4AB 2WCAA 1OB0A 5INDB 1CD1B 2NY7H 5BW7A 1EXPA 4F7TA 3S5ZA 1PFCA 3RU8L 4TPRL 2HG5A 3EGSA 1AE6L 2AV1B 2EC9U 3MBEC 1CQYA 4F37F 5LGJA 2OLDA 1A1MB 1T4KB 4TSCL 1OGGA 3LPOA 3O3DA 5HHNA 5E6IA 5EA0H 2AK4E 4TXEA 1UM5L 1KR1A 3U2SB 4UOJA 1RJZB 5HHVL 4M81A 2NY4D 4P7OA 1LEKA 1AD9A 5D6CB 4HZ8A 5E09A 3T2NL 2GDVA 3CSYB 1KBBA 3BLPX 3OXSA 5TJWK 1DBAL 1E4KC 3CXHK 3WO4C 3AHZA 4KQ3L 3P9MB 3ULVD 2VDNH 1E0VA 3X11A 4CNIB 5HDBE 4P2QD 3FB5A 1K9FA 1NAML 1EMTL 2CLRB 4YN5A 2H2SD 4LVHB 5KW9H 4HFUL 4MAYA 5DUPL 3AAZA 2WBJB 1WUNT 3PWUA 2CMRH 5IEKA 5EB9A 1QNOA 3QHMA 4CDHA 1MW1A 4WKHA 1UWXH 1OIFA 4YR6A 2FH6A 4ODHH 2D7QA 1E55A 3SKJH 1HWHB 3MV8E 1Q6CA 4IUGA 4GI9A 1BFOA 1OAXH 1W72H 1SMOA 3DX2A 4Z7VA 5D5MB 4QTHA 1F3RB 1QTYT 1G7MA 1FH9A 5GRJH 1UM6H 3WQ6A 4E8DA 2Y36L 3DRTA 5SWSD 1VFMA 1ZKAA 1I1FB 1HJSA 1GCYA 1NCCH 2ED7A 4FA8A 3BISA 4P2RD 4TPRH 4DO6A 3EUUA 4HS3A 2DD8H 2BNQB 1FC2D 4I4WB 3IYLW 2PO6B 4UI2A 2XNAA 1TCRB 4CN1A 1TVDA 3L4YA 1E1EA 5DMKB 3DSFH 3KPLA 3TIEA 2NSXA 2HVJB 5EU7E 3O9WD 1QOXA 5KVFH 3GJFB 1EQCA 1FNEA 4URTB 2DDXA 4PJ7B 1KJ2L 2J6EL 3M8OH 1W9BM 3GKZA 1L9MA 5GPRA 1DQQA 3ULSA 3IFOA 3FQUA 1IKNC 4UFJA 5DK2A 3MROA 3HZYA 3MACH 1FPTL 3Q1SL 1DWAM 2BY3A 3TJHD 4DUVA 1CZ1A 1YDPA 1QX1A 5EFDA 2AV7A 5DJXB 5A94A 3VPLA 1I3RB 3VXQB 1I3UA 5B38A 1V6VA 4IRJC 2GJ6E 1AXIB 1NLDL 4ZSOE 3RJQB 5C08B 5C0AA 1NC2B 4HUXA 1BQHG 1D5ZB 3QEQD 4JR9H 4YDJB 2BY2A 1A1OA 1WNOA 2VABB 3RVUC 4Y88A 2RIKA 1FO0L 3TT1H 1XCQA 4FQCH 3QO0B 1WP6A 4E41B 1X9QA 4XB8A 4N1HB 3RBGA 4DN4L 2Z1KA 4MCYB 3ZDYE 3ULUD 4XNXL 4HGMA 3IFNL 2W65A 3SGEI 1JXKA 2XACC 4MDOA 3SCMC 4JFQB 1RUKL 3KR3L 3WD1A 2J6EH 2F8VA 4NKDA 4UB0H 3IETB 4PCTA 3VX1A 1QNQA 5F6HI 2HTLD 2RBLA 1VENA 2XQYK 3K2UH 1ECEA 1RIUL 3CX5K 1NBQA 3DX8B 3DX9A 3V0VB 5A6KA 3O6FC 2ATPB 1V6UA 4XC1H 3KPNB 3BPLC 2IPKB 3PZVA 1H5BC 3GSNA 4YUEH 1NQBA 4PUBH 1D5XB 3L95A 4TVPH 3VG9B 4XCYA 5CEZL 4AW7A 1XCXA 3BIBX 1NBYA 4RZCB 1KTBA 4PBXA 1D5MA 2WIIA 3GIZL 4JM2F 1Y6MR 4AENA 3PWVB 3MUIA 4WEBH 3SDAC 3QRGL 2J8HA 4G8GA 5D7KE 3I9GH 4ODTL 2APWA 4E42B 5FHAL 2VZ3A 3QFDA 3QUZC 5F3BB 1JHTB 4BSWA 4EVNA 3Q5YA 1P7KB 1HF6A 1G7HA 4XCCH 4LDEB 4P4KB 1JD9A 3GNRA 4PJ9A 4AEIH 2V7NB 2NY2C