3VGHA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltotriosyltrehalose
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
554
structure length
554
Chain Sequence
YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 189
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vghA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vghA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vghA02
1FL3A 5BJTA 3QIUB 2DWEB 4QF1A 2F53A 3DROA 1MCLA 3FOLB 4R96A 4E5XB 1YECL 1S78D 3WH6A 2YWYA 4XGZA 1LP9F 3IVKA 5FKAA 2VX7A 4L8SA 1P2CB 5FO7B 5HBFA 3PGDB 1OCWL 4KK8D 1P7QB 3KLSA 4GLRI 1QSEB 4OOUA 4ZUSB 3KPRE 4WKHA 5HYJD 4HG4J 2Y07H 3ZE1E 2PW1A 5EU4B 5HHXH 5EU6A 2IADB 3FFCB 3LKPB 1FE8L 4FQXD 1H0DB 2GW5A 3FO9A 4OZHA 2F2HA 1UEYA 1Z0MA 5L8KB 1QR1B 1JJUA 2YC1A 1V3LA 1QFUH 3IFPA 5BQ7B 4CDGC 2XPKA 2DQGL 4NUGH 1MFDL 3QNZB 3V6OA 1MF2L 4UB0H 4YDKL 1BAGA 2F5BH 3QNXA 1EFXA 3V4VL 2WPGA 4TSAL 1PKQB 1JWSA 4Z7VA 2NQCA 4RMQA 3K1KC 4KV5F 4OCNC 2BXYA 1CLVA 4X5WA 3T0XA 5D71H 2NY7H 2BZDA 2R15A 2X7LB 3SURA 2DJSA 4CGTA 2BMKB 5C7XL 1A7BA 3QQ9C 2O9PA 3PZOA 1DQML 3SCMB 1MCWM 3B9KC 5F72S 4Y5YC 4W6WB 1VF8A 5DVLA 4QYOB 1VFMA 5DC9B 3RDTA 4BZ1L 1IGTA 2YD9A 1NBVH 2PTTA 4HZAA 4WGWB 3C08L 3EJTA 1Q9KB 1LE5A 2CLZB 2NCMA 4L8DB 3SHSA 2AJZB 5F3BB 4YUEH 4IRSC 3SDCC 1MAKA 5GGRB 4NKOA 2VDQL 4CL7A 2PWHA 5T3ZD 1QI4A 4MADA 3OKEB 4NPYB 2YL9A 5BRZA 1MQPA 1UHVA 1E72M 3UBXB 1I4FA 3ULUE 4FNRA 5DQDH 4MNJA 5ID0A 5I1KH 4P8VA 1R3KB 4M56A 1NEZG 4APQC 1ADQL 1WLHA 1BWWA 5D2LE 1FFPB 1ZBVA 1EXUA 4P2QA 3SCNA 4W7WA 8A3HA 4L4TD 5HHOD 2BVPB 3L9RA 2WMFA 3UYRL 3ZL4H 3O4OC 4N9GA 1WFTA 5DO2C 3H9SD 4L5FL 5HHNB 1CGVA 3K8MA 1F3JB 2YUZA 3TA3C 4OQTH 2HT4D 3PUCA 3WFDL 4HK3J 2FO1A 3DLQR 1NCWL 3TBYA 5J6GB 4XCFL 2AJSL 1GRWA 4LCWE 3V4PL 1FSKC 3EZJB 4MQXD 5IW1B 5ESVA 1E9LA 3NGBC 4KZDH 3ARWA 3PQYE 4GXUN 4HXAH 3O4LA 4F7EB 1JYWA 1FORH 2OL3H 3V8CA 5J4MA 5EC2B 1CDYA 4JY4B 4F9DA 2W0FA 4W93A 5KN5A 4AD0A 1I8LA 2HFFB 4Z18A 1P5UA 4QRRB 1ODUA 1H8OA 2VSCA 1J0IA 5DEGA 4XI5C 3CZGA 4WCYL 4CVWA 4MNHB 1PGRB 1MCHA 5DJDA 2V5MA 1MELA 4ACPA 2Y07L 4CUCA 3PHSA 1DQQB 5HHXL 1CFSB 2A2QT 2FGZA 3GSUB 2AEQH 1HCFX 3QEQE 2EEBA 4LIQE 3FCTA 3QIBD 1QFUL 4NHUB 1AIFB 3DURB 2IH3B 2GJZB 2YA1A 1GOKA 4NUGL 1V8HA 2R2EB 5E99H 2C8NA 3REVA 4UB0L 3MV9D 4X9YA 1KR0A 3B5GA 2F5BL 3OTTA 2CSPA 1RJYA 5ANMB 5FOBA 4X0KA 3ROOA 2ZUUA 3G6DH 1DFBH 2OQJA 4JEGB 5TGBA 2DQEL 2GYSA 5D71L 2NY7L 4D3CH 5LAXB 5HSFA 4C4KT 2OI9C 4ODTH 2EE2A 1J8KA 5A8OA 5INCA 1FV1B 4LNRB 4QRSA 4X8JB 4H0HB 2BNRD 4IHOB 3HMXH 2YRZA 5SV4A 2ZSWA 3HZMB 5B8CA 1HZHL 2IMNA 5MEND 1VSCA 5DURD 2IANE 4M48H 1V6YA 4NHCL 4RE3A 4HLZH 3RWHA 4IRSD 1E6PA 1H1NA 1MUJB 3SDCD 2Q76B 2AJUH 1QHZA 3GRWA 5DQDL 2J8UA 2EEXA 5D2LA 5CZXC 4L8SC 3F65A 3UXFA 1AP2B 4G5ZH 3V8OA 5I1KL 4JY6B 4N8VG 5JXEA 1AD9A 3T0WA 3L5XH 3C5JB 1WB0A 5AUMB 2VL4A 3ZL4L 4F3FA 5A6MA 1NGZB 1S5HB 1UXWB 1XF5A 3U36A 1MYRA 2OWWA 4BS0A 3QDMB 4JGUA 2BCKA 3RWJA 2OLHA 4OQTL 1FIEA 2E3ZA 3HZYB 1FO0H 3IGAB 2AXFA 1T22B 5J89A 1GGBL 1GQIA 1MW3A 2B4CL 2OXGA 1BFVH 2UZYB 3SUSA 3O9WD 3MYZA 2WMJA 3V6OC 3DX1A 1IQDB 4JREC 4JRXB 4J3TA 4PTTB 4HGMA 1NJ9A 4KZDL 3VCLA 4RGOL 1P53A 4V28A 2WMKA 2D1ZA 4HXAL 1FORL 2OL3L 1UR8A 2Z8WC 2WUCH 5DJ0A 3UX9B 5JPNA 3CSYA 1REIA 2NX5B 2AXHA 1U3ZA 4UNVA 1B6UA 5T3XD 1UR4A 5E2WL 1A1OA 4X7TB 1CNVA 4MJ5B 2RCSH 2DQDH 4CAGA 1H0GA 3ALPA 3GFUA 1LEKA 3RDTC 3GXIA 4XI5D 1AGEA 1NGWA 4G8FA 4LHUG 3HG5A 4PP2A 5MEOA 1MJUH 5E4EC 3W38A 3ARPA 2AEQL 3T65B 4UFJA 2ALWA 1YMHB 2J7FA 2V3DA 2OL3B 3VFPA 1Z5LA 4CMHC 3U79A 2FO4A 3GIVA 3BJ91 5E8NA 3NUKA 2A3EA 3RM4A 2CRIA 4QRTA 1CDIA 1HKIA 5E99L 1AXSB 4U0QB 2X9XA 4YHPA 2WWMC 1W9BM 1AGDB 3CV5A 3ARGA 4P8UA 3MRIB 1XF2A 3C2AH 3G6DL 1TPXB 5DJ6B 4IRJB 2D4FA 3K7UA 1DFBL 4KJYB 3BAIA 1RUQH 2VUYA 4PJEB 2XKNA 4D3CL 1I7UB 2AV7A 4I3GA 4FNSA 4NXKA 3VNYA 3GMPB 4ZE5A 4JJHA 4P23B 1JHTA 2IEPA 4ZUWA 5A2BA 1HP4A 5GSVA 3RWFB 2VLRD 1IAOA 1UVQA 3BXNB 3HMXL 5IHBA 3HC0B 1CFQB 2IANA 5CKAA 2UYLA 4WDIA 4C7GA 5EU5A 2Y23A 4M48L 2EIZA 3BOVA 3T8XB 4LFHD 2YPKA 1J10A 4ZUVB 3ARRA 1LL4A 2PYFB 3MUAA 1I8LC 1E6OH 4K7FA 4PJ9A 2AJUL 1LO5B 1B6DA 3VJ6B 5TQ2L 2PWFA 4NOBA 4G5ZL 4JKLA 3PP4L 1TJHH 3MJ9A 1JHLH 1Q94A 4HPOL 4OD3H 1LD9B 5C0AE 3B3IA 1S8DB 2C9AA 1MLCA 2YUXA 1WFUA 5FM8A 5FA3B 2B1AH 3S5ZA 5LQBH 1A1NB 3GKWH 5FHBH 3D3VE 1BQLL 2GTZA 2H41A 3BUPA 5B4MC 2ED8A 4R4BB 5DUMH 2EH7H 5EU6D 2L0DA 2WBWB 3PWVB 4NQCB 2E6PA 4OZFG 3SE9H 2IUZA 1A7OH 4OGXH 5HYSG 1FO0L 2NY3B 2AOSA 2JF7A 4OFYD 1T6VN 3AGVA 5DS8A 1BFVL 2FYYB 3MUZ1 4NQEE 3ET9F 4JZJA 5E1QA 3BW9B 3TYFB 3S37L 1EK3A 3AZSA 3K81A 4LYQA 3MGOB 5GRZA 4D1JA 4GW5B 2QADB 4Z7NE 3OA5A 3KPNB 4NO3A 1K3ZA 5CQ1A 1FC1A 2WUCL 1CICB 3LRGA 1B30A 2I5YH 4NBXB 5J7CC 2Z31A 3ALGA 3GK8H 3F7VB 1D5MB 1KPRA 3RI5K 1U8IA 2RCSL 1FO0B 2DQDL 2VI0A 4LSQL 1PZ2A 1A64A 3H42L 3RDTD 4GJTB 3NPSC 3RIAK 5B8CC 1E0XA 1MJUL 3OKMB 2X4PB 5I8EB 3QP3A 1EBAA 3RQ3A 4A6YL 3OJMB 3QB7C 4OLUH 1E56A 1FL5A 4QNPF 3AMKA 2A74A 3A4AA 3T0EE 3EJPA 4DO6A 1NARA 3S5LB 4PV9A 1YPZF 1XD0A 2AXJA 5EA0L 5B22A 4UOW0 3MRCB 4MJIB 1XGTB 3L3DB 2AXGB 5JXEC 1BZ7A 2EIDA 3BQUB 3NBNA 1DEEB 3AIWA 4NKMA 15C8H 1E5NA 4MSWB 2WWMD 3C2AL 3F4VA 3WQ4A 4QRUB 1IGCL 3O6KH 1RUQL 3LQMA 1AQHA 3TF7C 4J3UA 5E2VH 5JUVA 2EC8A 4XNXH 4DN4H 1W2PA 2V6HA 1R3HB 4XNQA 3JTTB 3FB5A 4W4OA 4YFLI 1IM9D 3FO1B 1RHHB 2X4OB 1KV3A 3WY1A 3GKZA 4JM4H 3HZKB 1U58B 4QHMA 3WSUA 1BJMA 3FO0H 1FNAA 3II1A 2V9QA 5DRZB 5KSVA 1HJVA 4RSVA 4PLKD 1GXEA 4OLYH 2PKDA 2EQDA 2DLFH 4NRRA 1NBQA 4YDLC 3NCMA 3BZ4B 2XPGB 4I9WD 5BVJA 5E1AA 1X4YA 2ADJA 4QT5B 1JHLL 5FECA 3KPRD 4NQUA 4KRPB 5EZIH 4EJ1C 32C2B 3HG1B 4GG6E 4NO5B 2G3MA 4RAUA 2L7JA 5LQBL 1JFHA 1J87A 2XZAH 3NACH 3GKWL 2A83B 5FHBL 1BG4A 3EYUL 5I0DA 5DUML 2EH7L 1UH2A 4Z7QF 2BVEA 4PV8A 4P57B 5E6ZA 3A0OA 3SE9L 1FH8A 1WWCA 3VFRB 4NQEA 4OGXL 3TH3T 3CZSA 2GKIA 1RI8A 4CVZA 3D4ZA 3DMMB 4UQ2B 4L8CA 2YFOA 5JBDA 3WD3A 3QUZA 1WAAE 1UM5L 3WFEH 4W8BA 1WDSA 2YSSB 2OYKA 4LPCA 4ZFZB 3ARGC 4UNUA 1AGBB 4KVCH 3PE9A 3ROLA 4M7LH 5K33A 3BGAA 3KPSA 4P4KB 3CUIA 4R2GB 3SQOH 4PRAA 2A6JA 2HH0H 5KS9E 4W68A 3T2OA 4R8WH 1QI3A 5I2IB 1V05A 2BNQB 3LDBB 1PZ3A 3REWA 2RJMA 1UKTA 4HHAB 3UTZA 5C0IA 3KR3L 4Q7NA 2VDNH 1YY8B 3BH9A 3QUKB 1KIQB 5KSBE 3T0EA 5F7DB 3AREB 5HI3D 4OLUL 4PJDE 2A6IB 3MV11 4KY1L 3DHJA 1MHCA 3MNWA 4PJ9C 4Q74A 3ULUD 1BSIA 1BD2E 1TQTA 2NYYC 1FOBA 1WFOA 3TBSA 4OTXH 2AI0H 4JFFE 3PDGA 2XVKA 5A8QA 1IKFL 4ODBD 5C07A 3L6FA 4HT1L 3WIHH 1UXSB 3SUTA 5JXED 15C8L 3RNKA 1MJ7H 2LVCA 5CP7A 5CSGA 4PTUB 4FQHB 1CQYA 1H3WM 2DT1A 5E2VL 5ELIA 2XG4A 4G43B 3WNKA 2EE6A 3NFNA 4PPTA 1ZLVK 3IS0X 3ME0A 2ITCA 3EMZA 2O5YH 3SDAB 5SWSE 1U8JB 4LCWD 4JZJC 1QW8A 3MJ7A 4JM4L 1UB5A 2XACC 3FRUB 4Z9KB 3UPRA 2VURA 2XQBL 4R97B 4RDQG 4JFHE 3V52H 3FO0L 1V6WA 3PWPE 5CILH 3PQYD 2XYCA 1ZHNB 3AXHA 4Z7UA 1YEGL 3GXMA 4OLYL 2J7CA 2ICWA 5ISZE 2DLFL 1Q9OA 2ARJA 2Q7YA 4ELMA 2Z31C 5HHMB 1MQ8A 2D73A 2AABL 4P8WA 1N5AA 2BDNL 4LLQB 5A8PA 4U0RB 1S7XA 4IS6A 4O2EA 2MOVA 1A7RL 4J6RH 5A2FA 1ZBCA 5DMGC 4KROC 4GG6A 5C0FA 4ZFGL 4I2XA 3WXWH 5EZIL 3MRLB 2DT3A 4TTGA 1HDMA 3SKJL 5FEBA 3MMEB 1M53A 2XZAL 3NACL 3JV4B 3QEQD 2X70B 4J3SA 2WNGA 3ES6B 3GB7B 5IKCB 1T21B 3WIJA 4AD1A 1ZLUH 1WAAA 1DQTA 4KH2A 1IVLA 4ORGA 4KTEH 1KNOA 1E43A 3WDQA 1YN7A 5GGQL 1BREA 2BSTB 3WFEL 3QAZB 3IDUA 2I25N 2F7QA 2DKSA 5CBAA 3LMYA 1MH5A 4KVCL 4OAWB 4M7LL 1CD1A 1I3RB 3ARGD 3MRQA 3WF1A 3NA9L 1S7SB 2FE0A 2P8PA 3RGVA 5KS9A 1MEXH 3PZ9A 2D7TH 3T0VA 3HE7D 5IIEA 8FABB 3O8XB 5BS0A 4W4OC 2WVSA 2HH0L 4QP0A 3BAEH 2ICES 2P5WB 3GSXA 3P4NB 4Y16B 4MAYD 1CD0A 2ICWI 4ZG1A 2VXQH 4WO4A 3MBXH 3ZJ7A 5FB8A 4AG4L 1MFBH 2BOCB 2IAND 2J7BA 2G60H 1WZMA 3MRDB 3ZE1F 3P9LA 1MFVA 3BPCB 4Z7WE 4ELKA 3LN4B 4E42B 1BD2A 4ZO6A 3QWOA 2D3NA 1LG2A 4ZO7A 3RIAF 4JFFA 3FQNB 5D2NB 5T33H 4PJ9D 3RAJH 4LCYB 2NYYD 3P11H 4UTBH 1W3LA 2VJXA 3WIHL 1MJ7L 3GI9H 3OMZA 4PB0L 2BNUA 1JPFA 3L3JA 2WHJA 5HD8C 3NIGF 1A6WH 1YUHA 4P46A 3Q1SH 4KFZC 4OCWH 3ZTNH 1XGQB 3QRFM 3O2WH 3GSNH 2DYPA 4L8BA 4MCZA 2R2BA 5DUBA 4M1RA 4AZCA 1WWAX 1AD0A 3HI5L 2VERN 3VXQA 3PWPA 2WLYA 1FN4B 3QUZC 3MC0A 1UZ8A 4EN3B 5I79A 5ABDE 3V52L 3MRBA 1QTYT 5CILL 3VILA 2D7MA 1G9NH 1UR1A 3U0PA 1QRNA 2XA3A 4Y5VB 5T5FH 1RZIA 3WDPP 5GGUB 4JIEA 1S9XB 3I50H 3RKPA 2VDPH 1VKXA 2X9WA 2DQUL 3DBXA 1U93A 3BVTA 4E0RA 1GZQB 2Q20A 2C26A 3QZWG 1NUGA 2GIYA 3RWIB 1KJ2A 3OX8A 4TTDD 3HG3A 4M1GH 2Z31D 5ESAB 3LS5H 3RTQA 4W86A 4OZGB 4PJBB 2NY6C 3ULUF 3SJVE 1CDBA 4PGBA 2AQ2A 3WXWL 4X6FA 4ZQKA 5FGCE 5TH2B 4DKAA 3L7FA 5AYUH 3ZR6A 5DVMA 5IQ9A 3SKOB 2DB8A 4LPVA 3T0EC 4HPGA 1G1YA 5FKPB 2EACA 3N1FC 4XB7A 4O00A 5JORB 3KXFB 1R24A 1I3UA 4XZBA 5HHPB 4G6MH 1R7OA 3PL6A 2Z1SA 3CLEH 4X4YB 5K9QI 5KTEH 3IDJB 5F89B 2GJXB 1QSFA 4JFDB 4XP5H 3GMQB 4J4PD 4NO0A 4AQOA 1PS3A 2EKSA 3BIAX 1XF3A 2BY3A 1A4KB 3VFTB 1URLA 1BQHA 4HDIA 5JHLL 3BVNB 4GQ9H 1FFNA 1W1VA 1FNSH 2IGFL 4OCMC 3I6GB 4DEPB 3CC5A 2D7TL 3INUH 1EEUA 5D9NA 3GNOA 3BAEL 4WV1A 1MCNA 1GIGH 4JRYE 3ILPA 4JFEE 4AZ7A 1MJJB 3DYOA 2VQTA 2Z92B 1OF2A 4LP5A 4JN1H 5SWZB 2Z8VC 3MBXL 1OGTA 3IT8D 2G60L 2K7QA 4JR9H 4IIQB 2XN9A 1DANU 3CFKB 3I9GH 4QTHB 1DVFA 2ESVB 1Q72H 4BA0A 5JTWA 3PJSA 5DHYB 1ZT7A 3VO0A 2I9LB 2YLLA 1FFRA 4Y4FB 3FB6B 5ICZA 2N7BA 1F3DJ 3MROA 4UI2A 3RAJL 2YMXH 5C0AD 3V4UH 1BPVA 1R47A 3P11L 3DECA 4UTBL 4BF7A 3GI9L 5KAQG 2YKLH 4V2XA 1LO2H 3L3GA 4LCCB 1UJ3A 3D3VD 1NLBH 3BYYA 3ARYA 3HAEH 3Q1SL 2SEBA 4B3KA 1ZU8A 4OCWL 5HD8D 1WISA 4QHNA 4ODWB 3O2WL 3PDOB 3QCUH 5I76B 1EV2E 5CEYA 4L3EE 2J75A 4KI1A 4CKVX 4NQED 4NNYA 4MQ7B 3MRNB 3AY4A 1QZ1A 4X6CB 5DFWH 2DT2A 2Y8VA 4L4VE 3GJFK 3QUZD 1QRKA 5ADOH 1SYSA 3U0TB 5C9JB 1D5BA 3KLLA 3CUPA 1I1AD 2DWEA 3I50L 2VDPL 4XRCB 4MVBC 1QACA 1BHGA 2CR3A 4N90E 4WW1A 3NZHL 3C60B 3N1PC 3RGVC 1MCOH 4M8QA 3SKMA 1TA3A 1J8HE 1KPUA 2HT3C 3ARSA 3GSNB 3KJ6H 3AS0A 1UCBH 4M1GL 3LS5L 2O9OA 1ZLWK 4X9GA 1T7XA 3RX5A 2WC7A 1GOQA 2V2XA 2P8LB 3QEGH 2NY6D 3WLBA 5FK9A 3GJEA 2EC9T 2RR3A 4WO4C 5EO9A 1UCTA 2NY5L 2XFYA 2LVEA 1YEHH 3MUHL 4PREB 1WBXA 4IDJH 5JHDB 1U8NA 3RHWK 3RWCB 2WINA 3DETC 2EZ0C 3SDYH 5BQ7A 4OCLC 3DXAE 1KLUB 4FQPA 3MYJA 4G6ML 4U2YA 4XMPH 3CLEL 3DX8A 2F61A 1AKJD 3S6TA 5GZOC 4XP5L 4X9FA 3WFBL 2CHNA 4AZ5A 5F9JA 3A21A 3BJLA 2X4TA 4PMDA 1XCQA 2FECI 2GEEA 4Z0XB 5HI5C 4P46C 3EO1B 3K0WA 1FNSL 3B6SB 2NW0A 4P5MA 5C6PB 1INQA 2BMKA 3FT4B 4JRYA 3INUL 4JFYA 1UG6A 1FL6A 5D8ZA 4GG8A 5D7IB 5DJZA 1H11A 4JVWA 3VRJB 3D18A 4JN1L 4PBWD 3ULSB 2PWGA 4EOWL 4NZCA 4IBLT 4MCYA 4CADA 1S7WB 1C12A 1JGUH 4JQXC 1YNKH 3OL2A 2XTJE 4U1NB 1O7DC 4JR9L 3RVXC 1BECA 5BVPL 3I9GL 2EDKA 1IKNA 4PJ8A 3PWLB 4KGLA 1HKJA 3U6RA 1JCKA 1DWGM 3SN6N 4UQEA 4GFTB 3RTQC 2LQRA 2YMXL 1FNFA 4YWGH 3V4UL 3D1MC 3IFNH 1KCKA 1WCGA 1DN0A 2YKLL 1LO2L 3DI2B 2JCCE 5H35B 1NLBL 3KL3A 3WNNA 5GS0L 3P77A 1HH9A 3DDGA 5MP6L 3VIFA 2NY4D 2ZUQB 1VFAB 4MD4A 1C92A 4Q22A 4NQSB 1BJ1J 4QCIB 3PL6C 4JZNB 5JPMA 1WZKA 4GINA 1GVYA 5FDYA 3RJQB 2YKKA 4L4VA 1ADQA 1HH6A 4M8UA 4HKZB 3BO8A 3ZHDA 3VDAA 1YC8A 5CJXA 1J1OH 1UFUA 3ZE2F 5ADOL 1IT9L 4WI8A 4X0VA 3LZFH 1P1ZB 1NLDL 3LQZB 4AMCA 2GDUA 4WKAA 2DDQL 1T0MA 1HHGB 1J8HA 1N2RA 2HFFA 3HAEB 1MCOL 4J8RB 2W4XA 4MVBD 2Y2WA 4PN2A 2FR4B 1LWHA 3KJ6L 1UCBL 2RIKA 4WV1C 2DN7A 3TJHC 4UZUA 4M6MH 2HT3D 4MB4A 4RE4A 1OGBA 5FCUH 3PG2A 5AWNL 4DCQB 5GGVH 3QEGL 4LSUH 4ZDHB 3ILQC 3NDYA 2ZUVA 1QFWM 1I7RB 2A9NL 2ZUNA 4PJGB 1YEHL 1U92B 4IDJL 4LP4A 3DXAA 1T4KA 3EFDH 2A3CA 5LA1A 1PZUB 1DVFC 3DVGA 3SDYL 1RIHL 4NHUA 4JO4H 4NBZB 5C08B 1BD2D 1L0XA 1P6FA 3U48A 1NBYA 2N56A 2V5RA 1U3HD 2X42A 2FH8A 3ZT5A 2IXVA 4JFFD 2YD4A 1NC2A 3N04A 2DT0A 1AGCB 3VGBA 5EFIB 2GVYA 4NWUH 4OV5B 4Z7NF 4QEGA 1UJ3C 4TUOB 2H45A 3IU3B 1XH2A 3BUTA 2YUWA 5HI5D 4P46D 2VITA 1JYXA 5E8EB 2VOTA 3BGFB 1AXIB 2OW7A 3RVVD 4X7EC 2DYPD 5SWSD 1PG7W 1KC5H 4IJ3B 1U8OA 3AY4C 1OOAA 1Z32X 3MFFB 4JFHD 4YE4H 3F58H 3PWPD 1CU4H 1YNKL 4XCEA 3W26A 2VIRA 4Z77A 3P4OB 1NEUA 3G6JE 3G5ZB 3D52A 2CO6B 2EXYC 2OZ4H 4KK9D 5JIIA 5ISZD 3RVXD 5DJ2A 3CDCA 3QXAA 1OIFA 3RU8H 1OGAE 1HILB 5IUSA 2OMNA 1MRFH 4WI4A 3W0WA 3W39B 5LXGH 2YEZA 5I9QB 2HJKB 4YWGL 1JVKA 2BC4B 1Y18A 5FL1A 2JCCA 4PJAF 5F1KC 4RAHA 3RKDD 4Q2ZB 1HL9A 1UXWA 3ECQA 1W0YT 4JFXA 4PY7B 1HIMH 1QBLH 2VCBA 5DD1L 2HJLA 4OZFA 2FIRT 1JTPA 1B31A 1E4LA 5HYSA 1UUQA 4Z76B 1UEMA 4JHWH 4S3KA 1NBZB 3FZUC 4UFLA 4BZYA 4GAJH 2VQUA 3AHZA 5IB2B 2RB8A 4N8CH 4JM2A 4RGNE 2XN0A 3QQ3B 3S97C 5EC1B 1J1OL 1LLOA 4CD8A 4NO0D 3UCRA 1EAJA 4PJXE 5LA2A 2ATKA 4LNVA 4KMQA 5JNYB 3L5JA 1FYTE 4LSPH 2AK1H 3DUSB 3GMNB 4L29B 4LU5H 4OQTA 3PV6A 4PRBA 5IVXE 4NRZB 1QPXA 1FBIH 1FZJA 4M6ML 4QHKJ 1JGEA 1SJHB 1ZLVH 2UY5A 5FCUL 1EO5A 4U1GB 3DHMA 3MR9A 4NCC2 3B2UD 4LSUL 3G9AB 2QR0A 2UY6A 3AM8A 1IT0A 5EIIA 4R3SB 3ILQD 4J1UB 1K85A 5E9DB 3BUBA 3ORJA 1DSFH 4HGWB 3CDGB 4PJ8C 5IXEA 1GJWA 2DD8H 2FIKA 4MPKA 2WMIB 4HEME 3JV5A 4NJ9H 4CN1A 3BIKA 5D5MF 4QWWC 4HF5H 3O6FB 1UA6H 2G3JA 3HB3D 1JRHI 4PMQA 1IEBA 3HHRB 1TZ7A 2P48B 3IJHA 5IBUG 5JIPA 2F8VA 4C56E 1LEIA 3OPZH 4D0CB 3KYOB 3MLZH 1A4JA 3RBSA 5BXFB 1R3JA 4ACYA 3L3IA 4W88A 1KC5L 2JELL 4YC2C 1VRXA 5EU7E 1OLZA 5I8OH 1T1XA 2VSDA 3G6JA 2FJGB 1UKPA 5CJXC 4YE4L 1I7TA 3F58L 5JXAH 2X4QB 2XVGA 1CU4L 2P5EE 3WY4A 1CR9H 4OFDA 4OZIA 1IL1A 5IWLA 3FAXA 2OZ4L 4DKEH 1B88A 2ADIB 4HFWB 3CZFB 5KSBF 2HAZA 4Z5RB 1RAMA 1NCAH 1MCFA 1QNZH 2A73B 2EXYD 1YY9C 4N68A 5A6BA 3WH7A 4H20H 3IJ7A 2F58H 1JZ8A 5EZOH 2AJYH 5IW6A 5LXGL 5GGRY 3SJVD 4DTGH 5JIWA 3KPQA 2Z8RA 1IQWH 4GQPH 1VFFA 1EO8H 3MBED 4QLKA 5D7JA 3JV6B 3V5HB 4PJHB 3IKCB 2O26U 1HIML 3UTTA 2DM7A 1SYVA 5ACZA 2WHMA 1L4IA 4E4PA 3LEXA 4PRPE 3GTNA 4JHWL 3HNSH 2G5BA 1QYGL 2H8PA 1QFWL 3W5NA 2EH8H 4GAJL 4FNUA 4HUXA 2A9MH 3FZUD 4PJXA 1K4DA 1WV7T 4YBLC 1MVYA 4M6AA 5ICXB 1QWUA 5I75C 4ONGH 2CBIA 2XV6B 5F9WB 4P5TB 4LSPL 4U1LA 5HJ3A 2YD5A 3L7EB 4LU5L 1YEDA 1PFCA 4B16A 1TLKA 1MIMH 3H7BB 3W81A 1FBIL 1YQ2A 3M46A 4JFED 4G7YH 1YMME 4OFIA 2BY1A 2XTJC 2Y06L 1U3YA 4RAVA 4PMVA 3QBTB 2EKJA 1R5WB 3HTLX 1NMBH 4HK3N 3UTSB 3VXSE 5DSCB 1CFVH 1DSFL 3NDZA 4FOMA 3WUWB 1AQDA 5GRJH 1M7DA 2VTFA 2MMXA 5F7NC 3WELA 4U6YA 4PJ8D 1Q38A 2DD8L 3K8KA 3O2DH 4R9HA 3VXNA 1XGTA 3W0KA 1RIVH 3VH8G 5I1LA 3SGJA 4WFFD 2CKBH 5T1LB 5GNZA 4U7MA 3NZ8B 4PUBH 1EZVX 1LF1A 1JV5B 4HF5L 4X8XA 1UA6L 4YHOH 2B5IC 4BH8B 1E0WA 2ZUYA 4A6YA 4BSVA 4WY7H 4P4RA 1TQBC 2DSUA 5FOJA 1NOFA 4D6EA 1L0YA 3OPZL 1TNNA 5D1QA 1KB5H 1KFWA 4FLQA 3FO1A 4L3ED 5GISH 1CE1L 1K5NB 3MV8E 5FYJU 4KVNL 4P9HH 2W9DH 2WV3A 2XHYA 2G9HA 2AVGA 4N0FA 1HHJA 4JM2C 2P5EA 1IAIM 2CDGA 4D9QE 4L4VD 3M45A 5JXAL 2GUOB 1AVAA 3EOAA 3QXVA 3O6LH 3FQUA 1E55A 3LAFA 3C5ZA 4ODSH 4WJXA 1V0KA 2E7LA 4DKEL 1SVCP 1LL6A 4N90D 2DQFA 3NCFB 1NCAL 4YHIA 1QNZL 1IARB 3BWAA 4Z7WF 2V5DA 1PLGH 1J8HD 2WVVA 1S7VB 4Q7DA 4H20L 2F58L 2P42B 4ZODA 5IB3A 1G5AA 4RNRA 1OAXH 3FOMB 1PY4A 1YY9D 3PWUA 5EZOL 2Q8AH 5IK3B 1OB0A 4JPWH 1DP0A 2AP2A 1HJSA 4FNLL 1IQWL 5EBMA 2ZE0A 1EO8L 5DJXB 2P7TB 3DSFH 5CP3A 4LHUD 3AM8C 2B0SL 3J8F7 1ZV5A 4PRPA 3MRMA 4QY8B 4W81A 2KQMA 3KPPA 3RWGB 5D8JH 3BWUC 3VSVA 3OB8A 1E28B 3OGCA 1QBBA 1QA9B 2BXZA 1KXTB 4FTVA 3S9DB 2EH8L 2VISB 3I6KB 2I60H 4QXUH 4PRHB 2VLLB 3WF4A 2A9ML 1DBBH 2BV9A 1QQDB 4AISA 3TNNB 4P7QA 1H3PH 1F8TH 1KUMA 2YD7A 4OGZA 4AZGA 3RL1A 4UOJA 4AEFA 4ONGL 1MXDA 3IDGA 4LVEA 1R0AH 4AM0B 5H8DA 3GO1H 2E7HA 3VXPB 4UDTB 4XCNA 4XC1H 1YMMA 4I5BA 5E5RB 1EGJH 3VA6A 4PGZA 2BNQA 4G7YL 5E7BA 4YEFA 3EO0A 3CXHK 7CGTA 1DHKA 2XTKA 1B4RA 3MRFB 4RIRB 4G8GE 3UBXG 3VXSA 2XTJD 4F9LA 2B31A 1JTOA 1NMBL 1OSEA 3GJFH 1CFVL 5IWLC 1E27B 3ARQA 5E5MA 4JDZB 2V9RA 4C54A 3RWEB 4IDLA 4NDMA 4MNQB 4PJ5A 5EOQL 2Q86A 1E6SM 3O2DL 2YBRB 1ZK9A 4IMLB 5J1AB 4HC1L 4PG9B 2W65B 4U6XA 2FEEL 1RIVL 1DBKH 1B3VA 2JB6B 1W1YA 3ULVE 4R7NA 5E03A 1ZLWH 1RSFA 4PUBL 1ZJBA 5I19H 4EBQL 1U8QB 4HJGA 4DOHB 3QQNA 4GMTH 4KQ3H 5DJAA 5D7JC 5F1OB 5F96H 4WY7L 2BOBB 1KTLA 1XH3A 1QEWA 3Q5TA 4HEPG 3MV8A 5ABFA 1KB5L 1HVQA 1CK0H 4OZ4B 5GISL 1G7HB 1F6AB 1BJ1H 4P9HL 1QFHA 2PO6B 2W9DL 3MRHB 3R06A 4RGNC 3T0BA 1L6ZA 3VFWB 4C83B 3VFUB 1NOUA 4QOKE 3VINA 3D85A 3WV0A 1KTCA 4Y4HD 4MS8C 3SDXE 1BVKA 2WWDA 1Y6MR 4RZCB 4OI9A 3TPUA 2CKBB 3O6LL 1J86A 1LO0H 4EDWH 4ODSL 4XCCL 2B2XH 5C9KA 1EZVY 4LSTH 3W9DA 4EUPH 4KDTA 3E6HB 1PLGL 1SQ2N 1OAXL 1KB5B 1YNLH 2QPSA 3LD8C 5F7MC 2Q8AL 3HUJE 1CL7I 4JPWL 3ALWA 3KLAA 2CRZA 3CXHJ 4M5ZL 3DYPA 4C4KO 5L2KD 3DSFL 5HGGS 3AU1B 5JOFB 1UR9A 5D7LE 4OFPA 5EOCJ 1G1CA 2E9IA 5C0BE 1V6VA 3U0WH 1OAZH 5DMKA 1NANH 5C0GB 1TFHA 1TVBB 2I60L 1DBBL 4IM4A 1NGYA 3SGJC 1E4KA 1ZWIA 2FX8H 2ICCA 3PP3K 4TN9A 4KUZH 1H3PL 3ZTJH 1F8TL 5MHSE 4GW4A 2ADGB 5AAWA 5KANI 5I74B 5IFJA 1AC0A 5CHNB 5CEZH 1R0AL 3A6CH 4C7FA 3GO1L 1Q0YH 5D1QC 4AH2A 3ZHKA 5CFHA 4JKMA 1EGJL 3G9VA 3P4NA 1Z3GH 1TQCB 3QDJA 4G8GA 2TAAA 4ZXOA 2N4IA 5E8OB 1NAKL 1T1WB 3PWNA 1JD9A 4JFVA 2H9GA 3SDDA 5FO8B 1UZ4A 5I66A 3DX6A 3C5ZC 3BP6A 4EI6B 4GRWE 1VBRA 2E7LC 5CGMA 1UG9A 5ABGA 4MJ4A 1OGAD 4GUPA 4BELD 4KAQH 3D2UA 1AMYA 1F58H 3OR6A 4WWKB 3PBGA 5I6SA 4HK0B 5ACLA 2WIIB 3VUPA 3EJRA 5H94A 3VFMB 1DBKL 3BAWA 2R0LH 1ZL1A 4GKOA 5I19L 5GNYA 3OKDB 4GMTL 4KQ3L 5J11B 4U1KA 3QH3A 2DQCH 1B9ZA 4YHNA 2QSQA 2JK5A 5D7JD 3GJFB 1NCBH 3TVMD 2NSXA 3L5HA 2COQA 3B9DA 1JDDA 4FFWC 4KXZH 5C09B 4UOW1 4MNLA 1KG0B 1JN6B 2ZWLT 1A1MB 5FV2A 5HI4C 3PZIA 3DI3B 2CGRL 4M43H 2QKIB 2DMBA 3D9AH 3OHXA 2C1OA 1LO0L 3DX4A 4XCYB 4LLMB 2KH2B 4D9RE 1UQSB 4HZLA 4I0CC 2B2XL 1FYTD 5JW5B 4LSTL 5HGAA 5F88A 5BXTA 4NUJA 4PJCB 4YHMH 1M6OB 3LCYA 2X05A 3WN5A 2JIEA 2BK8A 5EZLA 3RNQB 1YNLL 4KDWA 3WMSA 3CFDB 3CX2A 5LBSH 1KIPA 4OKVB 1IAKA 3D69A 4U3AA 3VKKA 5D7LA 3S98A 1N3NB 4F9LC 5DRXB 5C0BA 1PIFA 5EB8A 3SO5A 1P7KB 4N0CC 1U95A 2ATPB 4YX2H 3FTGB 2HTKC 43C9B 2WSPA 3AC0A 1KGCE 3VW3H 3AHTA 1E4XL 4MNGE 1A6VH 3U0WL 4H8UA 4EUPB 3S3SA 1OAZL 3DO7B 1GJUA 4DZBB 4H25A 4HIEB 1OSPH 3LKRB 4OF7A 1BMGA 3CFJB 5F93C 5IV2A 4DZ8B 3TA9A 5L2JA 1LWRA 3TIDB 2FX8L 3PZQA 4KUZL 1UWUA 4NO2A 5ABHA 1RJLB 3CDYA 3PNWB 1S9YB 8CGTA 4G6FD 4XP6H 4C56D 5CEZL 2DRUA 2IMMA 3A6CL 2CIIB 1Q0YL 2Q7NA 3HMWH 3QG6B 4P2CG 1ZS2A 3LXBA 1GQKA 4MWFA 3SQBA 3AISA 4QRPE 4UMGA 4OD2B 1D3CA 5J12C 4H8VA 4LXFA 3FB7B 4DWHA 4HP5A 1PBYA 3GUTB 3GI8L 4FNTA 2E0PA 2P5ED 4K71B 4LLUA 3PHQA 2XSAA 3PWJB 5EUKB 1M05B 3LV3B 4L9LB 4KAQL 1J1PH 4KDTC 1F58L 4UCFA 1ZA3B 4M7KH 3TONA 4OJYA 2H26A 4KHXH 4JO2H 1ES0B 2R0LL 1YN6B 4HLZG 4K2UH 2GFBA 3APGA 4AD4A 4HWUA 2LE9A 4LCCA 3TNMB 1FNHA 1G0DA 2MTPA 5DRWB 1UWXH 1U8MA 2DQCL 3LPGA 3SGDH 1S7UA 4ODWA 1NCBL 3PDOA 4PRPD 3FW6A 5IG7B 2ZZUT 4XZWA 1N6VA 2Q6WA 4AD2A 3QUMA 4LARH 3RWDB 1GH7A 2AK4B 2Q3ZA 4TNVF 2CLVA 4LEOA 1WKYA 1B0GB 4UAOC 1RVFL 1E4KC 1OM3H 2F7OA 1BYCA 3V5KB 3U0TA 1FZKB 1SJXA 4YXHH 3TO4B 3ALXA 2X4SA 4IOSD 1CT8B 3F7PC 1JPGB 1DE4A 2VLKE 3KPOA 3ZKSD 5B21A 4YHML 2UVEA 3QFDA 2CXGA 1ITCA 2NY2B 5EUOB 5JDSB 2VE6A 3KGRA 2O61A 2YFNA 2J77A 1L6XA 1YNTB 5LBSL 4HU8A 3HS0A 4XVUD 4YHYB 2B1HH 4R4NC 1Q8MA 3OJDB 3C6LB 5ALCH 5GSRB 3S5LG 4YZFE 4JQVC 5J9PA 4BSWA 3SDDC 3W6MA 1RFDH 4BQ4A 4R7DA 4OZHF 3MRPA 3VXSD 5JHDA 4MNGA 5EU3A 4ZUTA 5CEXA 5EN2B 5FFLA 4YX2L 3VW3L 1Y0LB 2ICEA 4N0CD 5J57B 1KTBA 1A6VL 5F6IC 3ARBB 4H1LA 2HTKD 2YN5A 4J3VA 5GGSY 3BVWA 2BVDA 2C7FA 1E6ZA 3ULVC 4BUGA 5HDBE 1OSPL 3UPCA 2GT9A 4MA3B 3HZ3A 1BBDH 5ESQA 2WCAA 3MLSH 4RGMC 1EEZA 3LKOA 3RX8A 1C91A 3FHAA 2RBLA 4DGIH 2PXYA 4XP6L 1K8DB 4QRPA 5L0QC 2YDQA 2OSLA 4O2FB 1T66C 4MD0B 4X4MA 1UB6A 2XYLA 2FGWH 1CE6A 5IVXF 2WZHA 3MV8D 5HDQH 2YOCA 3ISWA 3EYOB 1DN2A 4D9QD 3PZTA 1NGPH 4NF7A 2WBJC 4F7CB 2XNAA 2CRYA 2O5XH 2XT1B 1NFIA 2APWA 4NSBA 2IGTA 2OBGA 3EFFB 5IB1B 4P5KB 2NXYB 1MW2A 5IR1B 1J1PL 5IB4B 4M7KL 3WN5C 3QULA 4HCRH 1I3VA 3WXVL 4WLCA 3N9KA 1IGML 4KHXL 1FNGB 1MVUB 4JO2L 3BAKA 4PLOB 5EG6C 1EDQA 3MLXH 4K2UL 3F5WB 3BKMH 3VG0H 3MUY1 3O3AB 5ITFA 3AHYA 5AC4A 1DZBA 4PP1D 1BX2B 4Z78B 2YHGA 1BGAA 2CO7B 3OKOA 3CZJA 4AEIL 5E8DH 1OQXA 1TITA 3BDYH 4FQXB 3T0AA 1RUAH 2V5YA 3V0AC 1I9IH 4I0KA 3EDJA 4G42A 2XIBA 3KWWA 1T1ZB 3OLEA 4JGMA 2OTWA 3QIWD 1FVEB 3RPIA 1GYAA 2R2HB 4ETQB 4OCXL 4PGEA 4YXHL 1M01A 4Y19B 1DQJA 5I1GL 4CU6A 1XIWD 4OIIH 3IDYC 5BO1H 4RDQF 3WEZA 2E7MA 3S36X 3FT2B 4JN2A 1WIPA 2H32A 4KJWD 4MDJA 2GSIA 4X4XA 1SM3H 1QLEH 5E8PB 1WZAA 3MGAA 2PYEA 3JSSA 4HIJA 5IQ7H 1NSNH 4NN5C 1BFOB 4ORZC 5T3ZL 4Z2LA 5MEPA 1HYRC 3VDHA 5L7XH 1NDGB 2WMPA 3KNBB 4G8GD 4LCIH 2J7EA 3BI9X 5ALCL 4LPUA 4Q6IB 1S9WA 1L8NA 1AO7E 5D96C 1RFDL 4ZXBA 1SEQH 5HVHC 4S11A 3SDDD 1QFOA 2CK2A 5DYOA 5TFSH 2ESCA 5HBBA 5DZLA 3LKQA 1WCBB 1ZT4B 3M1BB 4P2RB 3S4SB 4AD5A 1RK0A 1V7MH 4U7SA 3V0VB 5E1HB 3QT2A 1JGDB 1OGSA 3OKNB 3V79C 1MCRA 2HLAA 5FAAA 3CDFA 4EVNB 3ULVD 4JVPA 1CLOL 3D25B 1BBDL 4ACZA 3K2MC 2R1WA 2VXSH 4YGAB 1W8NA 3UAJC 3G04A 4TVPH 5FCSH 4DGIL 2EPMX 1T5WA 3MLUH 3VIMA 4L4TB 1BAFL 1I7ZA 3FO2B 4FABH 2DH2A 3CFEB 1RUKH 3K4DA 2FGWL 1QLRB 2UVFA 1CLYL 5HDQL 1X5GA 1CLZH 4QOKD 4F15B 3J7HA 3TN0A 1F02I 1MXGA 4FFZL 1NGPL 4LGSB 1OP9A 1ORSB 4NZJA 1FYHB 5CJBA 2QV4A 2HA1A 2P49B 2NY1B 2WBJD 1P4LA 5L9DH 1ZSDB 1A5FH 1BOYA 5EBLB 3RL2A 1QSEE 2V9TA 2GTWB 3VE0A 1GJIA 4NNXB 4LLWA 4OUUA 4HCRL 4GLRH 5F97E 3KG5A 4LCUA 3FFCE 5CCKH 4BZ2H 2ZX8A 4JAMA 2NXZB 4WHTB 3MLXL 3MRRB 5CBEB 3BKML 2CK0H 1NUFA 3TOPA 5IFHL 3X3FL 5JOEA 4HUVA 4C55A 4EDXB 2C3VA 1V0NA 4X6DF 3P4MB 1KSRA 3GBML 2WLZA 4JDVA 1IEAB 3TBVA 5E8DL 1XZ0B 3HPJA 4IUGA 1RUAL 1QBMH 4XP9H 3BZEB 4PBVC 3C6SA 4X99A 5IMLA 5JR1L 3MLYH 3IF1B 2EO7A 3L3KA 3STBA 4NNPH 1X9QA 4Y88A 4HIXH 2D0HA 5MHSD 1P9MA 2NY5C 3OAUH 2XGIA 5CD3A 3MV9B 4OIIL 5BO1L 5DT1H 1RZKC 4WJ5B 3G5XA 4CU7A 1JFQL 2CETA 3VI4F 1QLEL 4F7TA 1K4CB 2VZSA 2CLRA 5IQ7L 1NSNL 4MDIB 4NRYA 5FM5O 4HWZA 2FH6A 3HLAA 4GZIA 5J3HD 2WAHA 5L7XL 1AO7A 3EYSH 2VH5H 3KVQA 4OOZA 1U36A 1T7ZA 4S2SA 3BUIA 1SEQL 4LLDB 4OB5H 3B9KB 2FJFA 1T7WA 4Y5YB 3DIFA 3QUXD 5TFSL 3CDGA 2R56L 3LN9A 4NP4H 5IVNA 2LFGA 3A5VA 1XGYH 5EO1A 1BVLA 3WHXB 5DURB 1A21A 3F6LA 3MFGB 4MQSB 2VLME 2NNAA 3MLVH 4FXKA 4NJAH 1TJGH 4E2OA 3EJSA 5C0JA 1IGYA 4HPYH 1FG9C 4UU9B 3SDCB 1KBGH 4ZD3L 3VXUB 3A6BH 5HHVH 3NN8B 1TQVA 1I1FA 2M8XA 1HI6A 3PABB 2VXSL 3CC1A 2W67A 1JWUA 2DQJL 4WHYH 5DEFA 4AK1A 1HKLL 4X6EB 3S5YA 1DWAM 1P4BL 3MLUL 4APQB 4XVTL 3KYOA 4HQQH 4POUB 4FABL 5E2TH 1GCYA 3NIYA 2PW2B 1CN4A 4DGYH 1RUKL 1JXJA 3MOBH 1JP5A 3O4OB 3BAYA 3SE8H 1OARH 1XAUA 4M3JA 5IESH 3WS3B 4PGCA 4NRXA 4ZUUB 5IW3A 2FJHB 2FEDC 3VFSB 3TA3B 4HUUA 4MX7B 1XRVA 4GRMA 4NQDA 5D1XA 1FG2A 2V7NB 4U1IA 1BLNB 3PP3H 3FQWB 4D9RD 2ADIA 2GI7A 2NZ9C 5F3HA 1A5FL 1FSKB 1DUYB 2WZPD 3UZQA 5F1NA 4OT1L 1G94A 3NGBB 4Y5XA 2YD3A 3SUUA 2DBJA 1VHPA 3CK0H 3CH8A 4RWHA 5CCKL 2EE9A 2F18A 2IAMA 5FDWB 1NCDH 4TVCA 2CK0L 4ZXBC 3VFNB 3U83A 1UA3A 1TJIH 3TO2B 3DO3A 3NCBB 3WL9B 1L9NA 5ITBH 1OTTD 1KGCD 1KJ3L 3VRLE 5KAQF 1NFDB 4BFIB 3N06B 1QBML 4KKAD 3AB0C 4WU5B 3UC0H 1KGUA 4XP9L 3H55A 1HEZA 3THDA 2VCAA 4MLIA 3MLYL 3RVTC 3MNZA 3WIIH 5I17A 5D9SA 4TSCH 5FGBA 2NY0C 1UZ6F 4AIOA 1OTUC 1A47A 2QHRL 2NW2B 3SDXF 2CXKA 4YDJB 5DT1L 5CINH 1UD5A 1AR2A 3KYNA 2W0KA 2X10A 4ZFFB 1N5YH 1RZFH 3TCLB 1G9ML 3TM6A 4P7OA 3WUGA 5LCVL 5E9AA 1TVHB 1KENH 4QRPD 2ICWJ 2Z93A 2NT0A 4QXGH 1IJ9A 4ISVB 1JNHA 2AQ3A 4POZC 4NQVA 5D7SL 2I9TB 3HUJF 5FA4B 4ZAKD 1XSIA 1W0WA 2VH5L 4O2CA 4UIMA 2X2IA 3DGGB 4GOSA 3TN0C 3VWJA 1XYFA 2V3GA 4N0RA 1OGGA 4ZNCD 2OI9B 1FAKT 1QBAA 3BD5A 5DSCA 3PGCA 1SMAA 1VACB 1LK3H 1OB1B 3X13B 1BZQK 3IETB 4NP4L 3CPLB 5EFDA 1XGYL 3OKYA 1KLGB 4LDEB 6A3HA 5A3IC 5KOVC 2EDQA 3FRPG 3MLVL 3WO4C 1K9TA 4NJAL 1ODAA 1TJGL 1JZ6A 1FL3B 5BJTB 5CXPA 4QF1B 3CMGA 1KBGL 2F53B 1HOCA 3DROB 4R96B 2YWZA 3A6BL 1KT2A 2KUTA 5HHVL 2DLIA 1JZ3A 4XGZB 3IVKB 5FKAB 5JLZA 1DBJH 4L8SB 2J7DA 2J7HA 4K8RC 4M6OH 1RZ7L 4HQQL 5E2TL 1JHKH 3ARDD 4JRXE 4DGYL 3MOBL 2PW1B 3KL5A 3SE8L 1OARL 5EU6B 5IESL 1JBJA 4QXTA 3FO9B 2A6DA 4JJ5A 4FLSA 2GUOA 2XFFA 2NX5E 3VD9A 1QPPA 2FEDD 1NL0H 2YC1B 3BKYH 3IFPB 1P9MC 1VEMA 5C8BB 2VLKD 4YHZL 1W9XA 4JREB 2NZ9D 4GRWF 5HOSA 2AJXH 1HJUA 3QNXB 1EFXB 3W4RA 4HWEH 1JWSB 4KRLB 4Z7VB 4YJZL 3EZ8A 5CUSH 3CK0L 1SBBA 1RQ5A 4X5WB 1CFTA 1NCDL 1HQ4A 3QOMA 2D7OA 5ADPH 4KWUA 4FQJH 1TZIA 1U91A 1WTGT 3GRWH 4EIZC 1A9BA 3P73A 4QY8A 3TGXA 1TJIL 2V5CA 2QSCL 5ITBL 4HS6A 2X2YA 3RDTB 3WL0A 1IGTB 4J23A 5ACMA 1KCSH 3G6AA 2PTTB 1S7RA 4HUNB 5E4EB 1T0OA 1LE5B 2O5ZH 4CBPA 1BQCA 4MDPA 2CH8A 3WIIL 4NKOB 4CMHB 4PSPA 4TSCL 5BRZB 3M8OH 3RVTD 5F9OL 1OSZA 5CJ5A 3CTTA 1T7VA 1JGVH 1I4FB 4LRIA 4GXPA 4LOUD 2NY0D 2PF6A 2VZOA 5ID0B 1RUPH 1OTUD 1PG7L 1BQSA 1TDQA 2IH1A 4AM0A 1N5YL 3RUGA 3EJUA 1RZFL 2W62A 4OF5A 4XPBH 5KVDH 1EXUB 4P2QB 1JAEA 3L9RB 1KENL 4N9GB 4JZ5A 4PJIE 1D9KD 1WGOA 4FMKA 1MCSA 5GRUH 3PDDA 2ZCLL 4POZD 4GS7C 4LHQB 5D1XC 5E6YA 3TN0D 2P8MA 3TBYB 4S1DD 2HLFC 4NZRH 5HDLA 4P2OA 5ESVB 1KGXA 4WFEE 2ZP0T 4Y5XC 3O4LB 3MSDA 5D9OA 2CIKA 5LGKA 2IAMC 4M5YH 3RZCD 1WIOA 2W0FB 1JAKA 1U8QA 5KN5B 4NQCE 1UM6H 3PZGA 4ZFMA 1FA2A 1ZVSA 3MSGA 4CD4A 3N15A 5DEGB 3IJYA 4NC2B 3DRQA 4V1DD 5C2UB 1JK8A 1H3TA 4HMDA 3KPTA 2E6QA 4M6OL 5GGVY 5DJDB 4LSVH 3VPLA 5E6IA 2ORBH 1FH5H 4GI9A 3D39A 4HC1A 1VERA 3HAEG 3TV3H 2X44D 4Y7EA 3MREA 3QO0A 3VD4A 1OP3H 4XTRC 5GJTH 3FCTB 3SCMC 3DJ9A 2GY5A 5T5NG 5INDA 1E4JA 3HE6A 1R7AA 2EEAA 2VB5A 5HY9A 3REVB 4L3CA 5AD0A 4WW2A 3O6MH 4JE4B 4NQXA 4R26H 2W59A 5LG1A 4CN6A 1RJYB 2R0KH 5FOBB 4X0KB 3ROOB 4GO9A 5CUSL 4UILL 4N0UE 4M7JL 2OQJB 5TGBB 3UTQA 2DIJA 3FY1A 1U8PA 3MUGA 4FQJL 1AO7D 5ADPL 3VWJC 5C92A 4D6GA 2ITDA 1LK2A 3MJ9H 2EDBA 1KCVH 1KTKE 5INCB 4PJFA 4QRSB 5DA0B 1O0VA 3UETA 2RGSA 5AEAA 4MJIE 2VC2H 1KCSL 2EAEA 3NPSB 2ZSWB 5B8CB 4S10A 4PJ7A 2P24A 2PUQT 4BFGA 1FIGL 2O5ZL 5TE7L 1RJZA 5TDPA 3T77A 3T1WA 3X11A 4OCSH 4MJ6A 1BJ8A 1LP9E 1IE5A 5TDOA 4I3SL 3RWHB 2YN3A 5KZ6A 3M8OL 2X1OA 4JANA 4LQFH 1RV6X 4DM1A 2R0ZL 2ENYA 4MXVF 2J8UB 5D2LB 1R34A 3QUYA 1VPOH 1FCCA 3TC9A 2YJQA 3VDCA 5IJKA 5KVDL 1AD9B 1GOIA 1XT5A 3QFJD 4PJIA 1H15A 5M95B 4F3FB 4AIZA 1XF5B 5D72H 3U36B 4RFOH 5GRUL 2C7UA 4M93C 3QIUD 4XBGA 4UT6H 2BCKB 3RWJB 4G9FE 1W9UA 4PCSA 3RILA 4YZFF 2AXFB 5C3TA 2MQCA 3BEVA 4NZRL 1QSED 4JGJA 5E2JA 1DANT 2HLFD 1NJ9B 3HG1E 3VCLB 5ETUA 4NZUH 2MCPL 1P7HL 1H3UA 4URIA 5FUCE 3FFCD 2CR6A 4DJMA 5DJ0B 4M5YL 5JPNB 3CSYB 4G8EA 5HDBF 3EUUA 1AQ0A 4YDLB 1UM6L 2IAMD 4PGDB 1A1OB 1LO3H 1K8IA 3IDXH 5JO5A 2FZ3A 1QO3A 1LEKB 1HKFA 3CZNA 1FZOA 2ILLA 1AGEB 4LSVL 1NGWB 4G8FB 2PTVA 1FH5L 4WIWA 4PP2B 5MEOB 2G3IA 1ZOXA 1TXKA 5GHWH 5IBLC 2CBVA 1OT2A 1GGIH 4FMVA 2D7QA 3TV3L 1UGNA 1BGGA 3VFPB 3MA9H 2QKIA 4ODVL 1EHNA 3O6AA 4EI5A 2VRJA 2FO4B 3GIVB 5E8NB 1JMZA 4LRIC 2GK0A 4LVNC 3SCMD 1WUNT 4PRIE 4QRTB 2YD8A 3QDGE 1L0PA 4YHPB 3O6ML 4R26L 1CXIA 1GPFA 2XG5A 3ARGB 2A1WH 3AXXA 1XF2B 2J8HA 5FO9A 5KBNC 2WK2A 2JB5H 4MXQC 2OP4L 1E71M 4AMKH 2XKNB 2AV7B 2DSWA 1ZHKB 3RJDA 4ATWA 3KDMB 2KZWA 1JHTB 3VWJD 3MJ9L 5D70H 1KCVL 3THCA 3EOTL 4ZUWB 3OG6B 3GM0A 43C9A 5GSVB 4Z2HA 1OTSC 2VC2L 1UVQB 4P2OC 2IANB 5GZNC 3OWEA 3UYPA 25C8L 2VLMD 3EYVA 3QGVA 1UR0A 4PMOA 2CEQA 2UYLB 2VUOA 1LP9A 4WDIB 2UWEF 5EU5B 2WZEA 2EIZB 2NZIA 4OCSL 3S3JA 2D31A 2YPKB 4OSUH 1OINA 4K7FB 3PNWA 4PJ9B 3PTKA 4RISH 4P3WA 1IAII 4UQ3A 1VPOL 4JPKH 4XNMA 2F7PA 4RFNC 1Q94B 4PR5A 1W0VA 4OQ1A 5LGHH 3B3IB 1MLCB 4H8WC 3P9WB 5E6IC 2V38A 1D5IL 3BDXA 1XF4A 4G9FA 4HS3A 5D72L 2GTZB 1HNYA 2WKLA 3F12A 1QHOA 1YEFH 2PBGA 1PKOA 5HHME 4AZHA 1J05A 2WSKA 4J28A 5DS8B 3HE6C 3OR7A 3U30C 4JHBA 1WJ3A 4JZJB 1UQYA 1DJSA 1CS6A 5EMYA 3F5LA 3N18A 4K3EH 1M04A 4WW2C 3VG9C 5CSYA 3X14A 4WFGE 1T20A 4IRZH 2EDJA 1FGNH 4NO3B 1ESWA 5AC5A 2M26A 4S0TD 4AT6A 1H49A 4QO1A 2UY3A 1HNFA 3BPLC 1FFQA 2Z31B 2LU7A 2EPOA 3SCSA 3MLWH 3EHBC 3P9MA 3V6FA 1KPRB 4BUHA 1U8IB 3IDXL 1V7NH 3WD4A 5KW9H 4KROB 1EQCA 3SKUD 4N1HB 3C9NA 5K59F 2HKHH 5T1KA 3AZTA 1AFVH 5D6DA 3AYRA 3NYDA 3HNVH 5GHWL 4JFSA 2E9BA 2AK4A 3IDNA 1GGIL 4QTIH 1EEYA 1FL5B 3MA9L 3OAYK 2A74B 1ZS8A 2BJMH 1FH7A 4PRIA 2J8GA 3IS1X 4PV9B 4W6XB 1MFAH 3MMUA 3D0LA 3QDGA 3HI1A 3NPZB 2ZWZA 4CD7A 2P5WE 3QUYC 1KBBA 4QDMA 1XEDA 4P3DA 1CG9A 3R1GH 1JPTH 5I1DA 4DO5A 1BZ7B 1QP1A 3QXWA 1BF8A 3NTCH 4NKMB 5T1MA 1C8YA 2A1WL 3BAJA 1A02N 2XFRA 4UTAH 3OJDA 3WUWG 1JPSH 3LIZL 4KMTH 1CIUA 4MXQD 3WNLA 5I2UA 3WF3A 3VD3A 4XNQB 3BVUA 5I23A 3FB5B 4FP8H 3AHVA 3ARUA 3LXCA 2CPUA 1XCTA 1R5IB 1VAHA 1JNEA 3LKNA 1XSKA 3CUGA 4QHMB 2ZKHH 5DF0A 5C86A 1BIHA 2E9JA 1OTSD 5IJVA 2LV4A 5HPMA 5KSVB 4R5EA 4OSUL 3WN6A 4JG1L 2F8OA 1FH9A 1WDQA 4RISL 5BVJB 1CFNA 1SEBA 2DIBA 5E1AB 3LHPL 2ADJB 4JPKL 1JD7A 5LGHL 5A2KH 4JRXD 3EYQC 4RAUB 5EULV 5E6ID 5DQ9A 3WLWC 5DFVC 4U6HB 4H0IA 4E41E 2NX5D 1HJWA 2D03H 4PV8B 4EI5C 2XN1A 1YEFL 4F7CA 1CD9B 1A2YA 1RMFL 4NQEB 2C4FU 3ZYOA 2X1XR 4CVZB 4PTVA 4ENED 2EXWD 5DJYA 4U1HA 4L8CB 2ZX5A 3QUZB 1JF5A 4K3EL 4LLYA 5IROA 5IM7A 4YBQD 3QPQD 3ZSSA 5EIVA 5GGSA 2D9CA 1FGNL 3ROLB 5LGJA 2MQ0A 2R23A 1US2A 3KPSB 3UZEA 2FNBA 4NT6A 4B0MM 4PRAB 5IFPA 3MLWL 2A6JB 5HYJA 2NY6B 4UT7H 3BQUC 1INEH 4BQ8A 5A6AA 1F4WL 3REWB 1BM3H 2CERA 1AFVL 1GOGA 3UTZB 4ZNEE 5C0IB 3HNVL 3CSPA 3BH9B 2WCGA 4QTIL 3T0EB 4JFUA 4C59B 2DEPA 2BJML 1LEGB 1MHEB 3MA7A 1MHCB 4AZBA 1AKJB 5GRVL 4AZ8A 5AZEL 3TBSB 5E8PA 3R1GL 1JPTL 3QUYD 4BQ2A 5C07B 5SWZE 3LRSA 3L6FB 1J88A 4O5LH 3NTCL 4D0BA 4NKDA 1BEYH 3RNKB 1WWWX 5HPOA 1X5YA 5CP7B 4UINH 3WFLA 5DMYA 1JPSL 4KMTL 1WFNA 2ESVE 1KJ2H 1AXTH 4M4RA 4OCRH 4XPGH 4NFBA 3NFNB 1FNEA 1KXVC 3WE6A 2QHAA 1MJ8H 3BFOA 2ITCB 3PTMA 3WD5H 2BNRE 1WBZA 3MJ7B 1UB5B 3UPRB 5FUCC 4WFED 3VRLF 1CGTA 4HV8A 3OLIA 2WBKA 1NQ6A 4Z7UB 4O9HL 1OD9A 3Q6FA 1K9FA 2XUCA 2JTDA 2ICWB 1Q9OB 2ARJB 4EXPX 2Q7YB 4NQCD 5JIHA 1NP0A 3RDKA 3DX0A 4ELMB 5CZVH 2AS5M 3HG4A 3C5SB 1N5AB 2A0LD 4JFWA 1S7XB 4IS6B 4O2EB 5HHOA 4GG6B 3GDBA 5C0FB 4I2XB 5B38A 3CPUA 1NKOA 4TOQA 1AE6H 4I3RH 3UZVB 4I1NB 3H9SA 5D6DC 4QCFA 1HDMB 3BD3A 2R0WH 4E41A 3UR8A 3K80A 3R0MA 4U6VH 4D2NA 1CICD 2D03L 1B3YA 5DFVD 4LVHC 3VFOA 1NMAH 3U46A 4OLVH 4EI5D 4MZ3A 2JJTA 3V5DA 3PZVA 4ORGB 4DKDC 1KNOB 3FFDA 1ISZA 1YN7B 3N1MC 4K7PX 4PMUA 3OZPA 4JO3L 2IXUA 4HH8A 4X7SL 2RHEA 1S9VA 5CBAB 2OSWA 1MH5B 2UY4A 1CD1B 3MRQB 5E56A 3LH2H 1HXKA 4X7DC 5GS2H 4CN4A 2P8PB 4IOFD 2ARJQ 3RGVB 5T3XE 3I2CH 5KS9B 4OJFL 4PCTA 3VWKA 5IIEB 3BMVA 5BS0B 3OKKA 3GSXB 4ZNEA 1CGUA 4UT7L 1KOAA 4MJID 1INEL 5I5RA 3BQUD 1RP9A 2AKRA 4WO4B 1QLFA 4PJDB 4GI8A 3LN5A 5FB8B 1GL4B 5GS3A 4UQ9A 3WNPA 3P9LB 3QIBA 3VTRA 1X5ZA 2EPNA 4W89A 4ELKB 1V6UA 1KWGA 3BLKA 1BD2B 2FBJH 5JBFA 3QWOB 5DJ8A 2CUHA 5AY7A 3SCQA 3IB4A 3CVHA 1PJ9A 2VMFA 4JFFB 5D7IE 1W3KA 2R39A 3D5HA 1B1YA 5F7LB 4MYWB 3RIKA 4O5LL 1H5BA 2HRLA 2LU3A 1BEYL 2BNUB 4DVRL 4Z7QE 4UINL 4DAGH 5IB5A 3MLPA 1JPFB 3L3JB 1V0MA 4N1EA 1YUHB 4P46B 4G9FD 3O3UN 4WI6A 1KJ2L 4OCRL 2DYPB 4L8BB 5SWSB 4MCZB 2R2BB 1MJ8L 2BNRA 5DUBB 4A4AA 4AZCB 3QJFA 1AD0B 2VLRE 3VXQB 3MO1A 3Q3GA 5C0ND 3PWPB 5MENA 3OIHA 5IROC 1UZ8B 4KRPD 4DUWA 3HG1D 3KE0A 3MRBB 1EIBA 3U0PB 1QRNB 1UWQA 1RZIB 3P30H 4IRSA 4BCEA 1S78C 5J06A 1WZLA 1VKXB 1M4KA 3UO1H 5C0RH 1YECH 3DBXB 4E0RB 2IQAA 1N8ZA 4KK8C 4PJEF 3QSKB 5CLTA 5CZVL 1KJ2B 3OX8B 4MA1C 3RTQB 1EAPA 3DMMD 3GSWA 3D4YA 2HTLC 2EO1A 4PGBB 2ZJSL 3MOAH 5EZJA 1G7PA 3BP4A 2MHAA 1AE6L 4I3RL 4KI5F 4X6FB 4ZQKB 4F80A 4W7VA 3BSZL 3QRGL 3L7FB 2R0WL 3DX7A 3HR6A 1YPZA 2R8SH 4TUJA 4D71A 5IQ9B 4U6VL 4P4KD 2A6KA 3ARFA 1R24B 3P0VH 3SGKA 1NMAL 1JI2A 3O9WA 1I75A 3B5TA 1EVUA 3PL6B 1MFDH 3ZYJA 1QSFB 5D6CA 4HS8L 3X12A 2X2JA 3F8UB 4ODUA 4URTB 4NO0B 3BRGC 2EKSB 4Z2GA 1XR9A 1XF3B 4TOYL 4TSAH 3NSMA 3C8DA 1BQHB 4HDIB 3F62A 3JV0A 3T1FA 3ARED 4CNIA 4AIEA 1FFNB 2FDBP 4KTYA 4H26A 2FX7H 4EUPG 5C7XH 3CC5B 1DQMH 3U2SA 1BP3B 1W9DM 3UJJH 1HYSD 4WV1B 3UG3A 1TCRA 3ILPB 1OF2B 1ZKAA 4YXLL 2EYSA 3LRHA 4HA4A 1MW0A 1RY7B 3C08H 3VI3F 5GJSL 1JPST 4G9DA 1OGTB 1ONQA 4NKQB 3V6BR 4LKCA 1QUNA 2XN9B 4K7PY 4DVBA 1A9EA 1DVFB 2FECL 2ZOXA 3WKZA 3PJSB 4KK5C 1ZT7B 5ICZB 1ADQH 1IM3A 5FHAH 3MROB 3SDAD 1AH1A 3DX2A 5J56B 1PQZA 4HH9A 5GS1A 4AEHH 1E3XA 2QQLL 4S3JA 3L3GB 1UJ3B 2SEBB 4HA1A 4AC1X 3IJSA 1MI5E 1OLLA 4QHNB 4KK6D 2VLRA 4U1SA 5HHMD 2HFEA 1B0RA 2ZG1A 1OB1A 5CEYB 4MQXC 5JW4M 3U7VA 3JUGA 1WTLA 4NNYB 2EDNA 3WJLA 4D0DA 4K55A 4XPHH 1DL7L 1RK1A 3TH4T 5DT5A 4WEBH 2XZCL 2YL6A 3MXVH 1SYSB 1D5BB 3DV4A 3P30L 1D5XA 4CDHA 3CUPB 3UO1L 4GKZA 5C0RL 2A3BA 1RD6A 4WW1B 4BKLA 4I9WE 3GSVA 5D1ZA 3JWDC 4M8QB 3SKMB 1TA3B 3VWKC 1A6PA 1KPUB 1G9EA 4M00A 3CX5J 4WCYH 1RUMH 5FGCB 3ARXA 3O45A 4BH7A 2V2XB 3MOAL 3H2WA 1MCDA 5EBAA 2HTLD 3WLBB 5FK9B 1F2QA 1YDPA 3GJEB 4BQ9A 2BVQA 5EO9B 2R8SL 3MODL 4YNYA 2APFA 1WBXB 3QIBC 3MANA 1U8NB 4OFYA 1WE5A 4AWEA 2WINB 4YHKH 3P0VL 2VDLH 3MYJB 3O8XD 3DX8B 2P5WD 1BZ9A 4Y16D 4YEEA 3EGSA 3N11A 4M03A 5ENWA 1IBGL 2ZX7A 3NIGE 5F9JB 1H5BC 3BUQA 5TDNA 4IIQC 2X4TB 3NCYS 3SE3A 1B2YA 5IHRA 1XCQB 4MGXA 1V0LA 2DQEH 4P7RA 4YIQA 2KKQA 5MERA 2X8RA 3GZAA 4P5MB 1INQB 2YUVA 1RU9H 2FX7L 2FSEA 1F5WA 4JRYB 4JFYB 1G9HA 1FL6B 5GXBB 5BZDB 3Q5OA 3UJJL 4GG8B 5DJZB 5IF0A 3D18B 4MCYB 5CWSA 1HZHH 4CADB 1C12B 5C8JA 1FVCA 2J5LC 3W25A 1MRCL 4PTWA 3NOIA 4MHHI 4NHCH 3WNOA 5IHLB 1E6XM 4OZFH 1ZLUK 2IPTL 3L4XA 4PJ8B 1HSAA 2F74A 1JRHH 3MCKA 3U6RB 3EJQA 4DGVH 5DJCA 5B39A 4KK5D 5FHAL 4YO0A 3DUHA 3LSOA 3T4YA 5CPSA 4WUUE 1UC6A 2VDRL 3BCDA 1DN0B 3CNKA 3I02A 3RBGA 4AEHL 1MI5A 3CFIC 4H8HA 4B9ZA 2R4SL 3TT3L 1UWTA 3P77B 2AQ1A 3HRZA 1HH9B 4E41D 1IM9A 1L7IH 3ARFC 3ZZ1A 3SGKC 4MD4B 3O9WC 2XWTA 1GGBH 5ICYA 3OAYH 2B4CH 5JPMB 1JI1A 1LVEA 4YC2B 4L4VB 1YHTA 1HH6B 1FVDA 4XPHL 3TLRA 3BO8B 2X4NA 2IFGA 2GCYA 2KQNA 4WEBL 4RGOH 4DK3A 3CZKA 3MXVL 1C5DA 3ZDXE 3H54A 4PYGA 4PJHE 4I77L 1T0MB 1J8HB 1N2RB 2WB5A 5E2WH 3KPLA 5EDXA 4CCCA 2ZG3A 1TVNA 1T5XA 3KPRA 1T7YA 3EDEA 3UDWC 3WENA 1RUML 3U4EA 1WDRA 3VWKD 3NIDF 3ZKMC 1KULA 3DVNA 4JCMA 2DLHA 3TTOA 1T83A 1TENA 1FP5A 3KHOA 1NQBA 4GI6A 5B3JF 3FN3A 3DXAB 1T4KB 3DVGB 4YHKL 3VFVA 1R5VA 2VDLL 4XNUH 4X83A 4E9LA 1NBYB 3JWOL 2MSPA 2D24A 2X4UA 5I8CA 2XGBA 43CAA 1NC2B 5SWZD 3AFBA 4YBLB 2J2ZA 3ZKXC 5GS1C 1OL0A 5F9AC 5I75B 3MSPA 2YIHA 1F4AA 3MV01 2WWCA 2ESVD 1RU9L 2VITB 1Y7VA 1GOMA 3RIFK 5DRNA 4Y4FD 2PWDA 1ZBWA 1PAMA 4F66A 3IYLW 5BMFL 5CMAA 3WJLC 5IEHA 1U8OB 2Q3AA 2XTJB 1F2XK 4ZE4A 1G9MC 4H7VA 3QEUA 4XPFL 1DUZA 5ABEA 1SJVA 4HZ6A 4XCEB 2VIRB 2GJ6E 2J4WH 4Z77B 1DCLA 5ERWA 5DJ2B 4KZEL 3QXAB 4Q97A 3RZWA 1JRHL 5D1ZC 5TQ2H 2HN7A 4DGVL 1U8KA 3W0WB 2ZCKH 4TPRH 3PP4H 2HMID 4WUUA 5EB9A 4GKNA 2YEZB 4HPOH 3BGMB 1OAKL 1A6ZA 1Y18B 2JCCB 1X5KA 1QNPA 2V17L 5I1EH 1XGZA 3BESR 2B5IB 1BQLH 1OWRM 4JFXB 1D6EA 3S8WA 4Q9QL 1TQBB 1L7IL 2HJLB 2EYRA 2DPEA 4OZFB 5IHSA 1KIUA 5HYSB 1FGVH 4LCWA 3W28A 4XVJL 2YA2A 3ARFD 1MWOA 4F33A 1KXHA 3ZKNC 2W9EL 3VX1A 4K94C 3AICA 3PQYA 4XX1G 3S37H 1WT5A 4JM2B 2OTUB 3TZVA 5I15L 3AXLA 2D4DA 3STZA 2MKWA 3SE3C 2ATKB 4TQEL 4TNWK 1G7MB 2B20A 4L9DA 4PGDA 4UNIA 2W60A 3PV6B 4PRBB 5CJOH 3V95A 4M61A 5D7KE 5L8LB 4MXWH 3OXRA 1FZJB 1SYTA 3TFKC 3L4ZA 1JGEB 4LSQH 4PRHE 3MR9B 3H42H 3A24A 3MTRA 4NZTH 3QEQA 5GQBA 3ZKMD 5DD0H 2QR0B 3TJEL 5EIIB 4A6YH 3I3EA 5DR5H 5L88H 1MCWW 1U0QA 5JZ7C 2J7GA 4JRWA 5TJWK 1KJMA 5DTFA 4X9BA 5JW4Q 1HQRA 5FUOL 1V3HA 4HULB 4YAQA 2ZCHL 4WTZG 4XNUL 5EA0H 2FIKB 4RFEA 3TV8A 4P7LA 2VR5A 1VBUA 2PNDA 4WIQA 2G4FA 3BIKB 4OZGF 4PJBF 2ZUTA 4XAWH 3CGTA 3L95A 1DWFM 2OJZH 4NQTA 1IGCH 6CGTA 1IEBB 2AW2A 2ZIDA 3HE7A 2NPLX 3IJHB 4HAFA 4U1MB 1LEIB 3ZOAA 4UZGA 1ZHKA 1LE9A 2UY2A 1WC7A 1B90A 3KDMA 5F8RC 4MNQE 1A4JB 3VIJA 4MAYA 1S7QB 1FZMA 1R3JB 4FN0A 3L3IB 1PPIA 4LHJB 4QCEA 1VADA 3ZE2E 3K3QA 2GJ6A 1T1XB 6TAAA 2WM0A 3G6JB 4PLKC 5CP3H 5GGTA 1I7TB 3N85H 4I0PA 4E8CA 4LSSH 2J4WL 4DOHE 2DKMA 4OZIB 1IL1B 2W0PA 4WI2A 4RWYL 4ZFOA 2XFXA 1T1YA 3QNYA 3GMOA 4KRTA 2BVOA 1XC6A 1UENA 2CDEA 3PGFH 1DWJM 2ZCKL 4TPRL 5CKGA 3IRZA 5D1ZD 4F58H 4ZTOL 1Z0NA 5IW6B 1JZ2A 3A3HA 4HUWA 3KPQB 3S3PA 2P1YA 3GBNH 2VVSA 4HLJA 4XUYA 4GBXA 5I1EL 4DK6A 1T83C 5D7JB 3ZSTA 3EYUH 2CESA 2JALA 3UTTB 3RPKA 1HX0A 1SYVB 5ACZB 2BVYA 1HKMA 1GGUA 3LEXB 5A2AA 4PLJC 1FGVL 1QOXA 5D4QA 1Z6JT 2G5BB 3OZOA 2H8PB 4M9PA 4RGNB 2R1XB 1UM5H 4BQBA 4HUXB 3ZKND 4PJXB 2VABA 4BK4A 5A16A 1K4DB 1J9YA 2D3VA 3H3PH 1CL7H 1HJQA 1HHKA 3CZ8A 2CITA 4JQIH 4U1LB 5HJ3B 5IBTH 3BEWA 5CJOL 1YEDB 5F70A 1I1RA 4MXWL 1K6AA 3LD8B 1HP5A 1IILE 4EAMA 5DVNA 1IC5L 2XTLA 3TFKD 5I1HH 4QFUA 4ZTPH 3CHDA 3AS2A 1EUTA 3KR3H 4NZTL 5HI3C 4RAVB 1Q9WA 2VR9A 1ZANH 5DD0L 2FL5A 4X6CF 5DR5L 5KSUA 5L88L 3QOKA 1SBSH 3ULUC 4ATLA 4KY1H 1GGTA 5JZ7D 3U82B 1AQDB 3SKNA 1M7DB 1OW0A 2XM1A 4MD5A 5KG9A 2DLTA 4U6YB 4J4PA 5I71C 1N0LA 4HOWA 3VXNB 4PJAE 3BDBA 1IKFH 5KZCB 4TVSa 5I1LB 1UH4A 4HT1H 1E5JA 1MAJA 4YH6A 4XAWL 3I84A 5IMKA 1LDSA 4KKBC 3L4TA 4QRQA 3KYKL 2OJZL 4C56B 3SE4A 4MQTB 4A6YB 2FX9H 4BSVB 1A6TA 5EFFA 1MI5D 3MJ8A 4P4RB 4Z2IA 5D1QB 3EDDA 1TETH 5ILTL 2PC8A 2BY0A 4LLAA 1ND0A 4PD4K 1R5IA 4CVXA 1X6NA 4GW1A 2G9HB 5KVMC 1WT5C 2XQBH 4N0FB 3BN3B 1HHJB 2P5EB 3HZVA 5E94A 4HOXA 2CDGB 1JF1A 3TZVC 3D0VA 3N85L 1Q9LA 2YK1H 4LSSL 3EOAB 1QI5A 1U42A 1YEGH 3FQUB 1D7FA 3C5ZB 3GXDA 3RIFF 5KVFL 1R3LA 2DQFB 3EIFA 4YHIB 3BWAB 1J12A 2AABH 2WVVB 3MX0A 2BDNH 3PGFL 3N1GC 5C0AA 5IB3B 1A7RH 3BHBA 4RNRB 3PWUB 4F58L 1UD3A 3THMH 3LKSA 4M7ZC 4ZFGH 2XWBA 1J5OH 4PMXA 5D7IF 5EBMB 3D3VA 3GBNL 3H53A 3SKJH 3O0RH 4X4ZA 3STLA 4UQDA 2ZXAA 1MFEH 5EIQA 3UERA 2ARWA 4WHYG 4U6HA 3RJYA 4PRPB 3MRMB 1KPVA 4XNYL 4FNQA 3KPPB 1QPKA 3GMMA 1JWMA 3AIRA 3OGCB 4YR6A 1NWSA 4ZS7H 3WJJA 3KLDA 4FTVB 4GAYA 1UADC 1HWGB 5KSAC 4PLJD 4QAWA 5D5ME 5GGQH 3HPLA 1H3XA 5F44A 1MFUA 1UWRA 5AYQA 4BQ5A 1GOWA 1I1AA 1MIEL 3H3PL 1CL7L 4H04A 4PTMA 3RL1B 3QDAA 5E9DD 2CCRA 3NA9H 3HE7C 3IDGB 4JQIL 3LQAC 4DUXA 5IBTL 2WAGA 1YA5A 4TSBH 4XCNB 5EOTA 3TIEA 3ULVH 1YMMB 2D7NA 4I5BB 2IPKA 5J1SC 4MAYC 4D6IA 5C6TH 2XIIA 4M29A 4PD4J 3EO0B 4F2MA 5I1HL 4ZTPL 1QG3A 4TNWF 2H2SD 3BSGA 1ZANL 3VXSB 1E4IA 4I0PC 4AG4H 1KCRH 2X0HA 1XGRA 4XAKE 3O6FD 3PV7A 1SBSL 5E5MB 1MHEA 1LEGA 1I8KA 4OGAD 4X6BA 1HSBA 3VSTA 3MRKA 1AKJA 4NDMB 3ZQ9A 4PJ5B 4PJAA 2Q86B 4LF3A 4I13B 1BPLB 4G80A 2FYVA 2WQ8A 4U6XB 4WWID 5T5NF 4WUUD 4R7NB 1JZ7A 4PB0H 5I24A 1JNNH 4GBXC 3O3DA 1HINL 2R1YA 4HJGB 3GHEH 5DJAB 5IHZA 3S88H 4KKBD 2FX9L 3BKJH 1KTLB 4PJGF 3RY6A 1XH3B 4JPVL 2VRKA 1QEWB 3CFCH 1TETL 3A47A 3MV8B 5ABFB 4JY5H 4JZOA 3HI5H 4IOIA 5H2BA 5J12B 3FAWA 2EBNA 3R06B 4M24A 3D85B 5MEQA 2F54E 3H3KA 1BVKB 3TPUB 2YK1L 3TZVD 5I73C 3ZJ8A 4Z8FH 3GH5A 1E0OB 4KQ4L 2DQUH 3BPNB 1W3JA 4WU7A 3W9DB 4TTDC 3UG4A 1JNJA 4D6DA 3C5SA 1KYOK 5F7WC 5JMRA 3GBLA 3THML 2DS4A 1NMCC 1D2KA 3KLAB 4LGRB 5J6HA 5E08H 1J5OL 1G0YR 1I8IA 2A38A 3SPVA 4F7PA 3O0RL 3C09C 1MFEL 1V08A 5DD5H 5F1SA 4J3XA 1C5BL 1KTDA 1V5JA 1PBGA 3N1AA 1OW0C 1T0PB 5D5MA 4ZS7L 4J4PC 3VGAC 5EUOE 5DMKB 4WI9A 3T3PE 4PMNA 3SY0A 3BH4A 5KSAD 3N13A 1N59B 1NGYB 4UAOB 2BFVH 2WNWA 1ZWIB 5E2UH 4FG6D 2Z4QA 3WF2A 4Z6AT 4KRUA 1INDH 4GW4B 5JHLH 4QLJA 3SE4C 5B3NA 2IGFH 3BT2H 5IFJB 3WQWA 1O7AA 4TSBL 4AH2B 3ULVL 1K9DA 4O51A 5C6TL 3QDJB 4G8GB 3D3AA 3ARTA 1D5ZA 1ZMYA 3B9AA 4PRWA 4PG2A 3BN9D 3PWNB 4ODHH 4L1HA 4WRLA 5KSBA 2H9GB 1PX8A 5E0QA 4PJDA 3SDDB 3K2UH 1KCRL 2GJ6D 3RI5F 5I66B 3DX6B 4I0PD 5FV1L 1CBVH 3BP6B 1MW1A 2DF3A 4GUPB 5M7QA 3D2UB 1U3HA 5F6IB 3OR6B 3IGUA 1WAWA 3QUMH 1KYOJ 3MCLH 1C7TA 4RMRA 3HR5A 1UD8A 5H94B 3NSNA 1DWHM 3RRQA 5BXSA 4P99A 3D87B 5MI0C 1J1XH 1JNNL 1PDKA 4RGMB 3GHEL 4U1KB 3QA3A 3QH3B 3S88L 1MCKA 4GBXD 4YHNB 3BKJL 2JK5B 1KJVA 4M80A 5L0QB 2K1MA 4W4NA 5SWSA 3CFCL 4HWNA 5DQJA 4JY5L 4JLRA 4HXBH 3WJJC 2Q8BH 2F54A 4M1CC 3WEOA 3UR7A 1G7IA 1LO4L 1N0XH 4R27A 3KLHD 1CYGA 1CWYA 3UJIH 4JQXA 4H0GA 1I1AC 1SJEA 5ISZA 3OHXB 2C1OB 2WBJB 4ZOEA 4Z8FL 4HZLB 3FMGL 3VXOA 3NZHH 2GSGA 5HGAB 5AAMA 4H1LH 4S0SD 5F88B 4NUJB 3U9UA 5F7UA 5D7KD 3WN5B 3PZMA 5EZLB 4W85A 2WWKT 4PRHD 5E08L 4PRDA 1KIPB 1IAKB 1BF2A 3D69B 5IMMA 2Y6SC 2NY5H 5D7LB 1C1EH 5DD5L 3ZMRA 3K8LA 1RZKH 4Y19E 5C0BB 3F7YA 1U95B 4NN7C 3S96A 1DTUA 3FB8A 1K2DA 4H25B 5GNXA 1WF5A 2ZUWA 1FCGA 3WFBH 5BXPA 5IV2B 2BFVL 5K93A 4HJJL 1M7XA 5L2JB 4OLEA 5E2UL 5SWQA 1MHPL 3N9GL 5DD6A 3QHTC 4NO2B 3UP1A 1INDL 5CIPA 2MANA 3ZDXF 4RBPK 3IDYB 3BT2L 3IFOA 3NABH 5EPMA 2EDLA 3GHBH 3RY6C 1UH3A 4PJHF 1UKQA 4P2RE 4R0LA 1VEOA 1ZGLP 4MNQD 3TTSA 4MWFB 4NN5B 1Z9LA 2QSTA 4NX0A 3T4AA 4EOWH 2J7LA 3BP5A 4ODHL 2C1PA 1YYMH 4Z7WA 3DRTA 3K2UL 1X5LA 5HVHB 5BVPH 1MLBA 1CBVL 2GHWB 4HKBA 4ZPVB 4U5KA 4LLUB 5FKYA 3PHQB 3KS0H 4JPIA 1B0IA 2H26B 3QUML 1NEZA 3MCLL 4YHLL 1CTNA 2PO6D 5EH1A 3LMJH 4OBRA 4WFFE 3FXYA 2GFBB 1J1XL 2XWEA 2NY4C 5GS0H 4UZSA 4OCYH 1U8MB 5MP6H 2H32H 1S7UB 4UNTA 1YEEH 2F7RA 4HXBL 1FFOA 3WMBA 2Q8BL 2Q6WB 3U7WH 3VIIA 3QUMB 1N0XL 5I1AA 1Z9MA 2CLVB 4LEOB 1QVBA 3UJIL 4M1CD 4F9JA 4XX1E 3O3EA 4OI8A 1IT9H 1B4JL 1NLDH 2X1IA 4LPYA 5C6WH 1HXJA 3NCYP 2DDQH 2X4SB 1X1NA 2VLJE 1DE4B 2MFNA 3KPOB 4HZ7A 2FLRT 4QHKI 1EMTH 3QFDB 3SJVA 4GRLA 2APTA 2FWOA 2VE6B 2O61B 2DDXA 2GQHA 5AWNH 4F7MA 3MBEA 4A2MA 2XIDA 3HS0B 4PG2C 3FONA 4M7LT 5J9PB 2A9NH 4BSWB 3O3BA 4Q9CA 1C1EL 3VGFA 2EYTA 1RZKL 4R7DB 3DX9A 2Y6SD 3MRPB 4LLVA 4MNGB 5EU3B 4ZUTB 5CEXB 5EBWA 3IANA 1RIHH 2ICEB 1U3HC 4DFHA 2IALA 1K3IA 4H1LB 2YBUA 4FFVD 1E15A 3IDMA 4P9MH 2GT9B 1W9VA 4DKFH 2DWDA 3VFGH 1MWAL 1H41A 1T3FA 5ESQB 3POCA 1EEZB 3LKOB 2YZ1A 1FLRH 3NABL 2PXYB 1ISWA 3GHBL 2ADFL 2IFFL 3RVVC 1A3LH 4JFEA 4QRPB 2OSLB 2XY1A 3V0WL 5BZDA 3VSUA 4G6AD 4X7FC 1UB6B 3G5YA 4WWKD 1SR0A 1CE6B 3R8BB 4MNKA 3LEYH 3F6IA 4YPJA 1YYML 1JNLH 2ZUSA 3VXUE 1XGPA 4KK9C 2XNAB 4K8RH 1NFIB 5DZNA 1KEGL 3HKFA 2ED7A 3TEUA 3OXSA 1HKKA 4DQOL 1OVZA 2UY7A 3QULB 4N8VA 1HHIA 2I07A 3GGWA 5C09D