3VGHA

Crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltotriosyltrehalose
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
554
structure length
554
Chain Sequence
YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 189
structure length 554
sequence length 554
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vghA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vghA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vghA02
1EVTC 1NGXB 1WBZA 3B6SA 4DN3H 2HTKC 3EJJX 3AOFA 5IDIA 4L3AA 3SDDD 1BJ1H 1EAJA 2GQHA 1ZLSH 4MQTB 1RMFL 4TVPH 4WI4A 2OSWA 1AHWB 3G6MA 3NIFE 3F65A 1FL5A 3UTTB 1ZEAH 1G9NL 4YPGB 1KLGB 5I15H 3GJFB 4U1JB 1BZ9B 3NIYA 1G6RA 2JLLA 3TNNB 3U82B 1T0MA 3NFNB 4TNWK 3L9RB 1CWVA 3F5WA 4FNLH 1I7RB 3BQUD 2VX6A 2GITA 1LP9B 1WFUA 5FOBA 2QTEA 2DM2A 4FLQA 4KV5E 1SEQH 4IPLA 3R1GL 1XAUA 4KVCH 1BHGA 3IFLL 2H6PB 1NM9A 2B5IB 3E6FA 3AHXA 4NRYB 3VIIA 3W0KA 4OKVA 3PGCA 3O2VL 3FRPA 4G6KH 1JDAA 1EMTH 1CXFA 4NN6C 4BUHA 5IBUB 2NY7H 2PW2A 1DSFL 3MRHB 2ATKA 3OAUL 2VX5A 3MLTA 3TO4B 4PJGF 4LHUB 3BP7A 3QNXB 3OLDA 4JB9H 4ZPTA 4FQIL 3NBNA 4F2MA 1A3HA 5CUSH 3T0EA 1YN6B 3EKCA 5ACLA 3KNBB 1RZ8A 1BAFH 3VD9A 5F89B 2DBJA 5FA4B 3QP3A 3JXAA 4LIQL 2IFGA 3HPJB 3RIFK 2CO7B 5DD3H 5SWZD 2W07A 5DVLA 5IM7A 3P0YH 4JPIB 4DK6A 2J75A 4XNMA 1CU4H 1HHHA 3MUJA 3RWEB 2WINB 1C5DB 1RZIA 4S1DC 3VH8A 1EBAA 5KSUB 3VXUA 2I5YL 4ODSL 4U2YA 1KB3A 5JBEA 3FFCD 4AMXA 3GGWB 3VXPA 1NLBH 4HZ8A 4OFYD 5FV1L 2EH7L 4FHBD 1RV6X 3KVQA 5L6YL 1GW1A 2B1HL 1Q9OA 1XR8B 15C8H 1T4KB 2HWZL 5J57B 1CIUA 4KROB 5BO1L 2HTLD 4H8HA 4JFDE 2EH8H 1YEFH 3E1F1 3MCKB 5EOTA 3Q0HA 3BVWA 1A6AB 1UT9A 1T03L 2E7LC 5EZJB 1A7RH 3A4XA 4ACZB 4FQJL 1ULVA 4RZCA 3ROLB 4W8AA 4JLRB 3BQUB 1ZA3A 4E4PA 4XAKE 3TA3C 2NNAB 3X3GH 4IISA 1MCDA 1F3JB 1VFUA 2PCPA 1WFTA 2RBLA 2W63A 1M7IA 1MUJB 5IG7A 3BMVA 4XCEB 4OZHE 3BP4B 3EFDH 3S36H 5ALBL 5I73B 3W27A 4PJAE 2VDOH 3NIGF 2C3GA 4TNVF 2VOTA 4RX4D 1V6YA 4H20H 2RCSL 2IPUG 2ZUWA 5I1LA 1PPIA 2ZSVA 3MXWL 4K8RL 2Z4QA 3EOAA 4KKLC 3PTQA 4ZTPL 2OTWB 3AHYA 3T2OA 3DYMA 3W28A 1UYQA 5SWZB 2DMCA 1KPVA 4AISA 1OAKL 2WWDA 3RGVC 3M6DA 5GGSB 3K80A 3S98A 2VL5B 4FQ1L 2IADB 4LBEA 5F96H 1EJOH 3TVMC 3FFCB 1U8JB 4E5XA 4L8SB 5C70A 2R4SL 3OKMA 4PCSA 3V79C 1HH6A 4ZEPA 1JI1A 3WNKA 1OB1A 5BYWA 1REIA 1QBBA 5M95B 5FYKE 5CEYB 2ZOKB 1BM3L 4Y16C 1QBAA 1CVRA 3VE0B 2FYYA 3PZIA 2ARJA 1SY6H 1DCLA 3CK0L 4OT1L 1WISA 2GFBB 2A9MH 2D7TH 3V7AG 4W68A 1QNRA 2DSKA 1SJEA 4HC1H 3GXNA 5LWYL 2FHFA 4HHAB 1QI5A 3AS3A 2BSTB 5L9DH 4YE4L 1XCTB 3T1FB 2D4DA 2W66A 2JB5L 4GH7B 1FC1A 3M1BB 3QDJD 4X9FA 3A24A 4QEGA 5T33H 5JA9A 5DDHB 1HIZA 4MNQD 3UTQA 1GJUA 4AG4H 4OCWL 1XCQA 3L7FB 3CUJA 3IDGA 3SE3A 1INEL 1A9BB 4ELKB 3IANA 4LYPA 3KLDA 4ZYKA 4HLZH 3MJ6A 3FCTB 1J8HD 3W37A 1FZJA 2WUBL 5HI5D 3X14A 2NW2A 1CLCA 5E2WL 4N8CL 1BJ1J 4OLVL 5HGDA 4G5ZH 5C7XH 2PW1A 4OBSA 2W60B 3T3ME 4FNQA 3QPXH 3W5MA 3ALFA 2F58L 5E8PB 5ISZD 2DTMH 2J7GA 4OF7A 4QRUB 5EU5B 3EOBA 2EDYA 3KPOB 4WHYH 3HZMB 4FQHA 3T8XB 3ZDZF 2IH1B 1BBJB 2OMBA 1QLEH 4UDTB 3VJ6B 2GSJA 4B3LA 2FO4B 3D9AH 4D9RE 3IDMB 3L4XA 5BVJA 1CF8L 2AXGB 4AL8L 3ARQA 4KJYA 3LV3B 1MCHA 2YPVH 4R6UA 1X7QB 3LKOA 4XWOC 4KZEL 1BP3B 2P42B 1E4IA 3KPSD 5L88L 4FLRA 2Q76B 3WIIH 3K2UL 4DGYL 5KSBB 3PDOA 5IBLC 3VG9C 5CBEB 3FQXA 5JW3H 5H94A 4HH8A 5FKPB 1TUXA 1TQBC 1KCSL 4GRWB 5JHDD 2F15A 1SMAA 4IOFD 3GSUA 2Q6WB 3LIZH 1D5BA 5KVEL 1HHKB 1JK8A 1EHLL 2FBJH 1EFXA 2GW5A 4QCIA 2UY4A 5DT7A 3O3EB 1DEEB 4MVBC 4N0YH 3SQOL 1QFWM 1AIFA 4YHPB 2C26A 3AMLA 4HCRL 4WWKA 2OP4H 2VZTA 3BWUC 3QDJB 5GHWH 5I1DA 4JFXA 3L3IA 4P4RA 3UTOA 3O45B 1KCUH 4MNQB 2DYPA 4Z2GA 3CIVA 4OLWL 4GO6B 1XIWC 1NEZA 1W72L 4KWUA 1GOWA 4F33B 1WC7B 1J8HB 1S8DB 2JF7A 3KG5A 1AR1D 3KXFD 3EO9L 1CZ1A 1E27B 3RTQC 2V9RA 3D2UD 4XUYA 3V0WL 3B2UC 4D0CB 3UBXB 1W9UA 3GM8A 5FD0A 3WUEA 1EEYB 5ISZB 5IFTA 5EZIH 3WY1A 2XFYA 1NCWH 4LDOB 3BZEA 4JE4B 2NX5E 5ITFA 1K9EA 1H5BB 1UCBH 3LQAC 2PO6D 3AS1A 4TN9A 4RGOH 2OSYA 1XCWA 1ZAGA 4P5MB 4PBXA 4KRPC 2WCAA 1OCQA 5IBTL 5L0QB 1ZS8A 3OXRB 5F44A 4QLKA 4DUXA 1A6TB 3RPIA 3S34H 1P9MA 3BIKB 3IVKB 4OCRL 4NJAH 4LLMB 3BZ4A 2H9GB 4JZJA 4PB0L 4WRLA 5GNYA 4QLJA 3G5YB 3FQNB 2DQTL 3EIFA 1KR0A 1CVSC 3OSKA 3MRKB 2C9AA 1BD2A 1N4XL 1AY1H 2C4XA 2H3NB 3K4AA 4NWUH 2YPLD 3AISA 4MNLA 5F1KC 5JHDB 3BDXA 3R0NA 4KQ4L 1LMKA 4O58H 5DI8A 3A0OA 2VITB 1TCRB 3L95B 5I1IL 1HZHH 3CLEH 1I8LA 2Z1SA 1O0VA 4PJGB 5LGJA 1NGPH 2BSRA 4JKWA 5E24E 2ZKHH 1T83A 3U5YA 1B3WA 3RZCA 2R1YB 2SEBA 5IJKC 1N0XH 4BQ2A 1HKMA 1U0QA 4EI5C 3O6FD 3VUPA 2DQHH 3QI9D 4AH2A 5FO7B 3HNVL 2RHEA 3EW3B 2GJZB 1AKJD 5D2NE 2XN2A 1PD6A 4PP1C 4DZ8A 4EQ2A 2F5AL 3TJHC 2BERA 2YD4A 2ICES 1VENA 4LLUB 3TNMB 3KXFB 1B31A 1ZWIA 1EUTA 4LSDA 1U8HA 3TH3T 4R8WL 4HX1A 1CGSH 4ZO8A 5CFHA 3WY4A 5KVFL 2H2SD 2HFEA 2PO6B 5JDSB 4ZDHA 3NIDF 3DO7B 2ITCB 1OAZH 5JOFB 1CGYA 1D5IH 2MCPH 2YWZA 1UWRA 2AK1H 2XQYG 4F9PC 2H26A 4OB5H 2A74A 3MGOA 1MAKA 1K8IB 1N2RA 2O5ZL 3PP3K 3L4YA 4NPYA 5EFFA 5KSVA 2M8XA 3G5ZA 4MB5A 5C0BE 2OW6A 2Y8KA 4PJXE 3A47A 3GMPA 2XNAB 1EHAA 5GJTH 4M9PA 1KN4L 4DCQA 2IGFH 1OM0A 3WN6A 2CK0H 5KZ6A 1R3LA 2YPLB 3CSPA 1IGJA 4JRYE 2XWTB 5E6IC 1S7VB 1E6XM 3CXHJ 1NFDF 2YC1B 2I25N 1CI5A 4M43L 1R5WB 4P4KC 4Y5VA 4ZPVB 5DZNA 3OGSA 3LSOB 1A3RL 4PFEA 5GS2D 1U8QA 1V6WA 1MHPL 2WBGA 3RHWF 1CT8B 2F5BL 1F6AB 2VMFA 2UVFA 2HH0L 5CEXB 3O6FB 5EUOA 3QI9B 5DVMA 3AZRA 2ESVB 1HDMB 4URTB 2Z35B 1AKJB 1ZT4B 5CSZB 2Q7YA 4NGHH 2VDPH 2B39A 1IGIH 1MW0A 4N5ED 4OLYL 1V3MA 4HFUH 3CH8A 4U1LA 5FUOL 2Z92B 1I1FA 5EU3A 1N59A 1N6QL 5C9JA 3V5HA 1S5IH 2X40A 4LLDA 4HUXA 4Y4FD 2V5CA 1KPUB 3ULVE 1A1NA 2NY6C 1M71A 3STLA 1W1YA 1QYGH 3UC0L 4EQ3A 2XOTA 3LX9A 1CL7I 4XPBL 1T0NA 3H3BC 1V7NL 2NMSA 3I3DA 1DQML 1HQRB 4J23A 2HJLA 3DUUA 4YZFF 4KJQC 1G0YR 1WAWA 4BS0A 3VI4F 2CLRB 1HH9A 2EO1A 1WBYA 4JQIL 1H3XA 2W1NA 4FG6D 2EXYD 2GJXB 3HNTH 3N17A 1DE4B 3REWB 5A3IC 5GXBB 5IKCA 5C0JB 1L4IA 4TSBL 5EO1A 1I8MB 3WENA 2WK2A 1NL0H 2ZCLH 1FL3B 1LQSR 4OCMC 4D6DA 4WW2A 4PMRA 1N6VA 1RZGB 2DBLL 4M62H 3ZYZA 4MDIB 1GC1C 3UAJC 3QFDA 3FB8A 4XRCB 3DLQR 1PG7H 4FTVE 4PJFA 2O61A 1FZKA 4HGKC 3OAZK 1RPQA 2A38A 4GQ9L 4QKXB 3STBA 3L3OB 1UZ1A 3NUKA 4PYHA 4HU8A 2JF6A 2OL3L 3D25B 4PRAB 1OM3H 1FCGA 1XH3B 2DQJL 5HGHB 5J11B 5ESQA 5I8KH 1MCCA 1M1SA 1U30A 2VR9A 4Y19D 4OLXH 1S78D 3U7BA 2AVGA 2RIKA 4OGXL 1IL1B 4W70A 2WB5A 1OARH 2VZOA 4N1CA 1MFCH 2DQDH 3L1OH 5CMAB 3V5DA 2DPEA 3GMNB 1P6AB 1MHEA 4AQ1B 2EYSB 4ZE5A 4PJ5A 4M02A 2XIIA 4D6HA 1PLGL 4NQDE 1H3PH 4M5YL 4U1KB 4XCCL 5D2LE 1SMDA 4AEEA 1WZ1H 5I6SA 3A3HA 5JHLH 1U8KB 1E0OB 2BHYA 4Y4FB 3WDHA 1JZ3A 2VR5A 4MD0A 4Z78A 1E4LA 1LEIA 2NY2D 4PJHE 4GQQA 3TIDA 1KGUA 1G7LA 5GGUA 3CU1A 1I1WA 1HCFX 4ORGA 4YHMH 5DEGA 1CNVA 5D1XD 2YDRA 4W88A 4X5LA 4PTXA 2H45A 3RILA 2ZUUA 4YHYC 1KXTB 4L3ED 3P73A 4KMQA 1YECH 4NQSA 2NY4D 1HNFA 3QH3B 5K9JH 1MREL 4KTEL 4M5ZL 1KACB 1DQJA 1KWGA 4RAVA 1CLYL 4JFQB 1S5HB 4BZYA 1V3KA 3I2CL 5C71A 2HLAA 2R56H 4ODTH 4RFEA 4YGVB 4RMWA 3OKDB 1I9IH 2JJTC 1G7MA 4LIQE 3T4AB 5I2IB 2BSED 3AJ7A 5GRWA 3D52A 2VDRL 4FMVA 2BVQA 4U6XA 2OLDA 4ELMA 4MNKA 2I60L 1KENH 3WFCH 4O5LL 2WBWB 4LL9A 3IJ8A 1NLDL 1ITXA 1IAIM 2YD1A 5IW3A 1VEOA 2XM2A 3BYTA 4TUOA 4FQXC 1FO0B 43C9B 3PGFH 2DQGH 1D5MA 1JHTA 1CL7L 1IGTA 3I6KB 4U0QB 5DT1H 2DSWA 5EULV 3U5UA 4Y19B 2IXUA 4EI6A 1UR0A 4MA1B 2LVEA 4I0PA 1IVLA 3IFPA 3VGAC 3C08L 1FIEA 4MA3B 4J3XA 1TMQA 5DJDB 2EXOA 4G6AC 5C0AA 2HN7A 3QUMH 3VFPA 4DZBA 3MRCB 1OWWA 4RMRA 5AC5A 4Z7VA 3VWKD 1RJLB 4WFEE 4W89A 4PMQA 5DMGD 4HXAH 4FP8L 4NJ9H 3WUZA 2YRPA 5D7JA 2JJUA 1SVZA 5FOOA 3QEUA 1ZTXH 3MRFB 3CUPB 4IRJA 3MRNA 2JCCF 2NY2B 4IOIB 2C4FU 4JN2A 1MH5B 3TJEH 1YEIH 2VB5A 5JIIA 3QHMA 5I8OL 1NCCH 3NTCL 5D1XB 4JJ5A 1JHLH 4P7RA 3CUHA 1J87A 2I9TB 5EBWB 2PTTA 2W67A 3RWCB 3C60D 3RA7L 1J0HA 3OZ9H 4L3EB 2CHOA 2AJSL 1IT9H 3OAYH 2NY4B 3DX8B 2X6MA 2GUOA 1S46A 5KVDH 1OD0A 3SKJH 2FGWL 1E0VA 3VNZA 1KJ3H 1I1AD 1SJHB 1YEHH 3FO2A 4WUUA 3GMMB 1R3KB 3VGHA 4HMEA 3F7YA 2ED8A 4F7TA 3LXCA 3NIFF 4JY5L 4HFWA 3WJLC 3ZE0E 1GSMA 1FFOB 1XF3A 4MGXA 1MEXL 1UD5A 4ONHB 4X4YB 5ABEA 1JGEA 4E8CA 4MSWB 1OAYL 5HGBA 2CKSA 1UXSA 1GHFL 4XC3H 2GJPA 3VI3E 1V5JA 1HYSD 4W84A 3K74B 5EC1A 1XR9A 5HJ3A 3ZDYF 4V1DA 4UTBH 4M82A 1MQKL 1X5HA 4CRPA 3MBEC 3MA9H 3MLSL 3MOBL 4X6EA 3MRMB 3Q6FA 3UPAA 1X5ZA 4X7SH 3BIAX 4L9DA 3RNQB 2FH6A 4E41A 2IANE 2AGJL 4KV5F 2FJFB 2X1OA 2XG4A 4OD3L 1B0RB 4RDQG 5CXPA 3VWKB 5IQ7H 5C0NC 4QHLB 4MNGB 4F58H 1W0VA 5ACZB 3G9VA 3QZWA 1PKQA 4XCFH 1LEKA 3UTPE 1BQLH 4OGYL 3LB6C 3HUJE 1CFBA 2ZX7A 2DQEL 1A3LL 1FJ1A 2YBRB 3IU3B 4QT5A 3SKNA 1ZOXA 2BVYA 5HYEA 5ITBH 1U8PA 5E1AA 3S6TA 4QXTA 2EIZB 3M8OL 3PP4H 4JY6A 2V7NA 3QDGA 2A1WH 4IRSD 5EFIB 4YNYA 4P5TD 1NFDB 5J6HB 1YPZB 1XD1A 5HPMA 3C60B 5ERWA 2Y7QB 3SKOA 5GNXA 4JDVB 3HZVB 4K7PL 4X80H 4GPNA 2CD0A 4LARH 1TVBB 4BZ1L 3KPNA 1SY6A 4XXDA 4CNIB 1XRVA 1DL7L 1GCYA 3QCVH 5CAYB 4S1RL 1I1AB 4JHWH 4HC1A 1P4IH 1MFNA 4F80A 2C5DC 4IUGA 2ICEA 1YUHB 4UV4L 2AJ3B 3QIBA 1KPRA 4NO2A 3CFBA 4M56A 4GKSA 1MFAL 5CD3B 3GI9L 5D7LA 32C2A 4HF5H 3E8UH 2CRIA 2J8UA 5FKAB 2EAEA 3OGRA 3RNKA 1RUKL 3UDWC 4JM2F 5HYJD 3OX8A 2BHZA 4KKCD 5FYKU 2VKWA 4JVWA 1UWSA 3ZT7A 1ED3B 3O3AB 3ZYJA 1J11A 3KPQB 1QI4A 5ABDE 4GINA 3QWRD 4HUMB 4OZHF 4ZOBA 3EYSH 2WHKA 4HUUA 3WO4C 2DLEA 4PJAF 4PR5B 4H8WH 4ODUA 5IOPA 5MEQB 2AQ3A 3VFOB 1G1YA 4CU7A 3GNMH 3MLVH 3WELA 2A9NL 4UQ3A 5CJ5A 4XP4H 5IFAL 2P8PB 4OZGF 5FYKH 1Q72H 5D7IA 2J5LB 3SE8L 1T6WA 5F7EH 3HE6A 2PKDA 4IRSB 1OPGL 3LPGA 5T5FH 2VXSL 1NUFA 4I4WB 3V5KB 1F4AA 2BFVH 3LRHA 1NP2A 4HKXB 1UA7A 1TMCB 1UZ6E 1A1MA 4NCC1 1ECEA 5DRXA 1VGKB 3GBMH 4EK7A 3OQ3B 2YBTA 4QLLA 3K7UA 4K9EH 2BNUB 2PETA 1I1XA 1I8KB 5CD5D 2VSDA 5AUMA 5DJ6A 2XPGA 1AQDB 5CP7B 1UJ3A 3G04B 1T5WA 5AG8A 3FQTA 3IKCB 2A6IB 1NCDL 1CZ8H 5DUML 3LQMA 3U4EA 4QGTA 2F8XC 3MV7D 4J4PA 5C07D 3VXRA 1E56A 5FYJL 4Q9QL 1WIOA 2B4CL 2BC4B 3RAJL 4QP0A 1X3DA 1HILB 1ETZA 2AXHA 1XGPB 3HZKA 3EJSA 1JNHB 4NSBA 3HAEH 5EOCH 1TLKA 4K23L 4JHAH 3TESA 2V5TA 3VD7A 5TE4H 5TJWK 3DNKA 1QSED 1T2QL 5GRJL 5HYJB 3ARFC 2P5EE 4LSRL 4NC2B 4AWEA 5AAWA 1H4PA 4OZIB 3VFWA 1KTLB 1JGLH 4PLJC 1U3ZA 2EKSA 1WBZB 5CJQL 4NUJA 4EBQL 2ADJB 2BCKA 3WH8A 4WV1C 5JIHA 2FEDC 1M6OA 3QFJE 3UPRA 3L7EA 2HT4D 3KHOA 5DMYA 2EO7A 3KPMA 3UYRL 3HZYA 4PJBE 5JLZA 3VGDA 3BH8A 4IDJL 4G7VH 1FZOA 4LSTH 2ESCA 5DTFB 5FA3B 3T3MF 2VCCA 3HS0A 1WF5A 5C6WH 3P30H 3NABL 2ATPA 1VKXA 3OLEA 5I79A 5JW4M 5LXGH 4LSUH 2WQRA 5B38B 4D72A 2ORBL 4NX0A 3SCRA 4BQ5A 1U58B 4WJ5B 1Q0XL 1T21A 2O5XL 5DYOB 2A83B 3LVEA 3MCLH 1UCTA 4M1DH 1S7UB 2GITB 4AZ7A 4XMKL 2GY7B 5FOBB 4M6AA 4P2QD 1JNNH 5DJCB 2XZCH 1P7QD 4MAVA 3HI5H 4AEIL 4PS4L 4YR6B 2AJYH 4GG8A 2MKWA 4Q6YA 2X7LB 5CGYD 3PWPD 2XZQH 5GGRY 5D93C 4JO3H 1NMAL 3S6CA 2PW2B 4EZMA 3HMXL 1BSIA 1RZKL 4YK4B 2X4RB 3MLTB 1JNDA 5F71A 3TV8A 3W2DL 3MV7B 5GRUL 4PMOA 5C07B 3SDAA 1AD9B 4K3DH 3ALGA 3QUZA 4J7RA 1T3FA 4RRPA 4ZPTB 4F2MB 5CCKL 4FFZL 3RRQA 2OW7A 3REVA 1A7NL 1A6ZB 1IBGL 2JELH 1RZ8B 3H2WA 3W9EA 3MNVB 2W61A 2WVSA 4L1DA 3WN5A 5DGQA 2JCCB 2ERJB 1QSEB 4MJIE 5JXAH 4Y5YB 4LEXH 1HHHB 1RZIB 4HKJA 1HKLH 1AGFA 3VXUB 3SCUA 1UYWL 3GIVA 3CLFL 5F3BA 3VXPB 1U92B 4R4NC 3S5YA 4ZFMA 3FZUD 3TBWB 5FEBA 4R7DB 1KJVB 2JTDA 1QNZH 3HI6L 1C7SA 3W0WA 4U1HA 2BZDA 4FFYH 3AMDA 5GSVA 1KJ2L 2VZSA 2ZUQC 3CH1A 5HGAA 1KQZA 4J1UA 3FMGL 4M7LL 2VRJA 4RZCB 2OZ4H 2X4SA 1ZA3B 5E2VH 3HB3C 1OTSD 5J7CC 5JIWA 3SGKA 4DQOL 3F58H 4P2QB 5C0CE 3KJ4C 4JM2D 1M7IB 1F3DH 1P7QB 5IG7B 3ARZA 5FM5M 3SHSA 1U95A 3NDZA 4JFOB 4Q2ZA 3VD5A 3TZVD 3MI6A 4J3WA 3RDTA 4MB1A 4Z2HA 1RQ5A 5TE7H 4KQ3H 2APWA 4RFNC 1QPPA 1S7RA 5AYUH 4PGBA 5I1LB 3RBGA 2ADIB 4G7YH 3RDKA 4JJHA 1A0QH 2Z4QB 1JF6A 4X6BB 2VERN 1ZXQA 5DJZB 5FK9B 1CFTA 3SDCA 4ZSOE 5ACMA 4MAYC 1A6UH 1BF2A 4KK8C 1Z0MA 5B8CA 3ZKND 4XPHL 2F74A 1WEJL 5J9PA 4F8QA 4N8VG 1GQIA 5GGTL 4N0CD 4XNQA 4WUKH 2A0LD 3EMQA 2CSPA 1ZT1A 3B9KA 5FGBA 1K5NA 1N26A 4C54A 3U4BL 4E5XB 4XPTH 4HXBL 2ZCKL 4HS8H 4X6DE 2QJDA 5JOPE 3UG5A 1OB1B 2EC9U 1G0XA 1UD4A 4EVNB 4FK9A 3FT4A 3V6OE 4CADB 3MLRH 3RVXC 2DSVA 3BKCL 2HAZA 1H3TA 3WDIA 1K9DA 3PWLA 2R8SH 5CKAA 5GGVH 1ZA6B 1EFXD 4WI5A 4UBDD 2N1KA 1V03A 4A4AA 4OCYL 2QSQA 1OP3K 3S97C 1SJEB 4NO0A 3TFKD 1NCTA 4H5SA 3SUSA 2NW0A 5D1ZC 3QEQD 4YDLB 4Y4KA 1T7ZA 4ETQB 3H42H 1DBAL 4MQ7A 1T66C 4PJDA 5EOCJ 3ET9F 3U6RA 5KVGL 2JKXA 2AS5M 1LG2A 4M48H 4HUWA 5C6TL 1IKFH 5B22A 3UTQB 4LGRB 3ZYIA 1MJ8L 1U6AL 3GRWH 4M1CD 1CD1A 2YL8A 1Z0NA 2V6HA 3TZVB 5CZXC 2DKSA 1F02I 4B9YA 1RJYA 2DI9A 4ZYKB 4B0MM 4PJXF 4GO9A 2VQTA 4XXCC 2W9DL 4WENB 3TBSB 43CAB 1SBSH 4FFWC 5AYIA 4PREB 1OP5H 3L3DA 2FATL 4PD4J 4CJ0A 2Z8RA 3N13A 4I3RH 4PCTA 3WH6A 3G6DH 2ZG2A 3MX0A 1HHJB 1KYOJ 3UJIH 2PXYA 3BUBA 4OZGB 4GAJL 3ULVH 1U3JA 1AO7A 1BEYH 2J7FA 4EDXB 4NBYB 5HY9B 5L8KB 1X1NA 1I3RA 2QPUA 1CR9H 5BVJB 3OKYA 2A3HA 2IF7A 5I6XC 5GGVY 4NXSA 25C8L 2XSAA 1UM6L 5EO9B 2PWGA 2DD8H 4KJYB 4E9LA 5KS9E 1US3A 4XPGH 1T6VN 4Q9CA 3CPUA 4NDMA 5JORB 3IDJA 5LVEA 1ZBCA 3F6LA 5HHXH 4C56A 5J6GB 3S37H 1YC8A 4HIJA 3DC0A 3PDOB 1XGTB 3TPUB 3EO1A 2Y9RT 1XHGA 2G4FA 2FX9H 3A21A 4X6FB 3VW3H 3SKUD 2UZIH 2Q8AL 4DVRH 4F37K 1UQZA 3GSUB 3ULVF 1W1PA 4KTDL 4OFKA 4XVTH 4ZUTB 1UR2A 1EFXB 1DP0A 4LLVB 1VJZA 1AHWC 1IAIL 4JG0H 2H8PB 4ODVH 4R90L 3QEQB 4WWKB 3EYUL 3EFFB 2WCGA 5I1DB 4PEEA 1RMFH 1LK3L 1FVEA 4JFXB 4Z9KB 3EBVA 5IVXE 4QYOB 1R6VA 4I0CC 4NNYB 4JO1L 1T1ZA 3U1SL 2DT2A 1QTYT 4JFZL 1G9NH 4FQQB 5I19H 2V5RA 3LS5L 4ZODA 1P7KA 2MKLC 2JIWA 3VFUA 1UD6A 1HWHB 1NDGA 5DEZA 1F11B 4JPVL 1SZNA 3QUMA 4ONGL 4XMLL 1PS3A 1KJMB 3ME0A 1PZ5A 2YKLL 4GZEA 1T22B 5I16A 5CBAA 5ITFB 4WEUD 2AXJA 2CQVA 3GMOA 4NFBA 4OFDA 4APQD 4XNYL 4LLAA 2NY1B 1EGJA 1MCWW 3R1GH 3DV4B 2GTZA 3IFLH 1B3VA 3TO4C 1S3KL 5HVWA 2AXFB 2PF6A 2GKIA 2WWMD 1E73M 3WEMA 1H11A 5T3ZL 2E7BA 3WSUA 2WKGA 1NWRA 1DSFH 2BFGA 4J6RL 1GOFA 4XTRD 3OAUH 1X9QA 5ANME 4M6OL 5C0DB 1AH1A 3BZ4B 4TOQA 4FQIH 4NNXA 4P9ML 1T7VA 2R29L 2ZUVA 3AXLB 4GRLC 5CS7A 5D2LF 2OWXA 1F42A 2GFTA 3P0GB 4IDLA 3QO1A 4LNRA 5K59F 2QQQA 3SDDC 3SCPA 4PJHF 1FH8A 2FIRT 4AZIA 5HYSG 5BS0D 4XBGA 2UWEE 1MLCA 2BSRB 1JUFA 2I5YH 4AC1X 4ODSH 3RZCB 4QRRE 5LQBL 4MXQD 5F3HB 2EH7H 4RFOL 5SWQA 4F7MB 1OD9A 1UXWA 3DBXA 3QJHA 5FUCE 5GISL 3DURA 2TAAA 1KBKA 2B1HH 4AH2B 2R1XA 1E71M 2HWZH 5DSCB 3MZGB 1BAGA 3GSWB 3MRRA 5CSYA 5BO1H 3LPPA 1AFVL 4AYSA 1WLHA 2GSIA 4PN2A 1Z9LA 1I1YA 3BQUC 4KC3B 2CIPA 3L3JB 1FFPB 3B2VL 1T03H 1ZWIB 4X7TB 3KE0A 4WFHE 2JJWA 1HHGB 4YXKL 3SDXF 5JMRA 4YDKL 4FQJH 3ZO9A 2IG2L 3KPRD 5HDBE 2HISA 4HX1B 3RVWD 1DQQA 2CHNA 2WV3A 2HFEB 4Z7UF 3HTLX 1JPTL 5I76A 4APQB 1FBIL 3DMMA 2PYEE 2AJUL 4E0RA 3WKZA 1A4KA 1Y7VA 1JHKL 3HE7A 1EGZA 1YHTA 3CJJA 5ALBH 2X1QA 1YJDC 3W39A 4TX6A 1JWMA 2H26B 3BVNA 1DWJM 3OAZH 3WQ8A 3WFDL 4DO6A 1U8IA 4NPYB 4JFDA 1GXEA 3LMYA 2RCSH 5KSVB 5IHZA 3G5ZB 4WFGE 5DJ2B 3BRDA 2VL4A 3QXAA 1QOKA 4K8RH 2EYRB 1U93A 2CDFA 2EE9A 4OJYA 3WBAA 3U2SA 3CX2A 3P4MA 4GW5B 3MC0A 5F9WC 4ZTPH 2VAJA 3UYPA 5BRZE 3LEVL 1IAKA 1UM4L 5HD8D 4XV0A 1EA9C 4ZS7L 4KI1A 4Y5XB 3PN8A 2MHAA 1OAKH 4PJ7E 1YEEL 3BXWA 4Y5VB 5BS0B 1U36A 4FQ1H 4JRYD 1U3HA 3EJRA 1VHPA 1G7IA 3HG2A 3V6FB 4MWFA 3WCYA 1FVCA 2HTLC 2A3BA 1Z32X 4U6VL 1DUYA 4U4BA 5ABHA 4ZQKB 4DAGH 2DLFL 4H2CA 4JO4L 2ZX5A 3R0MA 1F4YL 1MCJA 1W0WA 1BM3H 3MV8D 2Q7YB 5C0IA 1W9DM 5F1OB 4DUWA 4HIXL 4GBXD 4ALAL 2EYTA 5D1QA 5J13C 2BVPB 1ZS2A 3SCMD 4U1LB 4DVBA 1IGCL 1I1RA 2Y4SA 1INQA 3CVHA 4JPWL 3CK0H 2Y2WA 2O92A 4FXLA 2P46B 2ZOLA 3ZE0F 3KPRB 4GUPA 5LWYH 2Z93B 1QRND 4YE4H 5E94A 3LRMA 2JB5H 3STLB 4NRRA 2P24A 4DM2A 1NOFA 1CGUA 3IJ9A 1HE7A 2YL6A 1N8ZA 2R69L 2VWEE 3ULVD 5A3HA 4PRDA 2WMJA 1T0NB 4OCWH 1WCQA 2HJLB 1QFOA 3DUUB 3L5XL 3R06B 3RWHB 4WO4D 1INEH 1UWXH 1WBYB 5IHRA 1NBQA 4ERSH 1KCVL 2EO9A 2WUBH 3BPNC 5FYJE 5IKCB 2DJSA 4AYGA 4N8CH 4OLVH 3WS6C 2G60L 1PKOA 4ZE4A 3EJZD 2F58H 2X4NB 3ZO0A 4LCWD 5E08L 5ADOL 2FEEI 2BMKB 4HMDA 1PBYA 5HVHC 3CBWA 1IQWL 5CJXA 3AIVA 3W25A 1T1WB 3VWJD 4DWSD 1MFBH 1HVXA 2O61B 1WE5A 4TSAL 2NLJA 3FOMA 3GJEB 2MANA 4AL8H 4NFCA 4YHNA 1VF8A 2VLLA 1OGSA 4KZEH 4YHLL 1KB9J 4R26L 1J1XL 2UY5A 1BVNP 1K85A 4F7CA 5L88H 3K2UH 5IQ9A 3W9DA 2EDWA 2BY1A 1U42A 2OK0L 4XZWA 4Y2DA 2D23A 3MV8B 3HAEA 2OX5A 4HWEL 1NEUA 1FZMA 4GBXB 4J8RA 2QQNH 3SCMB 4POYA 4ZFFA 1W8OA 3TIEB 1JYNA 1RK1B 4AY0A 2WMIA 5KVEH 5GGRA 1EHLH 3HG1D 5D7JD 3L4UA 5E0QA 3TONA 5AY7A 2OJEA 4NKIL 3RM8A 3SQOH 1EEZA 4YO0A 4GSDL 4XC1L 3RZWA 1QRNB 3W53A 2JEPA 2H32B 4XBPA 1CICD 4HCRH 1WIPA 5GGUB 1NKRA 1OT1A 2ENYA 4TQEL 2WWKT 4ORGB 4ODWB 5HHME 1YJDL 2ICWJ 5HI5C 1GJWA 3PWJA 1OGGA 3DIFA 3CDGB 4KJWC 3U4AA 4OLWH 2J8HA 2EEBA 4O2EA 5SX5K 4WI2A 4WO4B 1W72H 3T0AA 4P2RE 4KK5D 5BXFB 2ZXAA 4HKBA 4PTTA 3QRFM 4PRBB 1UQYA 2CXGA 3NCYS 4W85A 5FKYA 1NFIA 3DVGA 4RAVB 2UUDH 4QRPE 3NYDA 3EO9H 3WFBL 3VXSD 2ZNWA 3FB6A 3WIHL 2XYLA 2HLAB 3EYOA 5KANI 3PV7A 5KBNC 5E4EC 1K8DA 4MS8D 2A6KA 4B50A 1NDMB 1HXYB 5L0QC 4LCWB 3IJ7A 4OQTA 4MTVA 4U3AA 2BVQB 1YY8B 4H8VA 1VADB 3L3GB 4K3HA 5F7DB 3DHMA 1BFSA 3BVUA 1MJJA 5CSGA 5I71B 1KBGL 3VA2C 4K7FA 3NZ8A 4G8GD 4KUCF 4JFYA 1T7XA 5DFWH 1QVOB 4MB4A 1D5MB 3NH7L 1JHTB 1BZ7B 2F1BA 3UBXI 5JDJA 3CHDA 4NOBA 4AYFA 4R97C 4EI6B 4PY8I 1L0XA 4NYLA 1FOBA 1JN6A 2QMKA 3PL6A 3ZR5A 4IOFC 2X4TA 4OCRH 2XN9E 2O9TA 3QQ9D 4I0PB 4R4FL 4PB0H 1GGUA 2AK4D 2DQTH 3HJEA 3IFNL 1QVBA 4NF7A 1A02N 1X44A 1I3GL 1RZFL 3LN5A 1N4XH 3P4NA 5HHOA 3OKLB 1OLZA 3B9VA 1YEDA 2C3VA 4L29B 2NX5A 4UU9A 4ZD3L 2D7QA 1KEGL 3QCUH 2WYSA 4BJLA 5I1IH 2FEEL 5D7JB 3NOIA 1DWFM 2VDMH 3QEUB 3H0TA 1AJ7L 5IB4B 3MRNB 2ITDB 3S88L 5FXCH 1JMZA 4TUJB 1CICB 4JN2B 2AV1A 2GVYA 1V3IA 1VAHA 1Y6NR 3PWNB 3QQ4A 4NQXB 2KZ1B 2D3NA 3ZT6A 2HJFA 4G43B 3PJSA 1J10A 3HNVH 4WVRA 1YNLH 2JE8A 5BRPA 4PUEA 5C8JA 3STZA 1YN7B 2PTTB 3DSFL 1GHSA 3BVVA 2VRAA 5IFHL 2F5AH 3HHRB 2FWOA 4NN5B 3T2NL 1A6VL 1OGAE 3R4DA 2PO6C 4IJ3B 3UTSD 5C0RL 2BNRE 1G84A 5A8PA 3IXTA 2LFGA 3VXSB 1FNGA 3GYCA 1PZ3A 4M24A 5ALCH 1FAIL 1OSPL 4WUUB 4NO5B 1ZLVK 5JR1L 3F7YB 5GSRA 4PSPA 2QKIB 3PQYE 3OG6B 5E5UB 4FA8A 1XF3B 1JNJA 4C7DA 2GYSA 4MQXD 5KAQG 4QXUL 2PN5A 1JGEB 3R8BB 2ICWB 2GI7A 2PF0A 3QQ3A 3SDXB 1JV5B 4G8GB 2Y8VA 4ZUUA 3AICA 1XZ0B 5IJVB 2DM3A 4FMFA 5EC1B 5IB3B 1L8NA 2O5ZH 2R2BB 4V1DB 4QTHA 3RVTD 4LPCA 4MA7L 3AYSA 4Z7UB 1AXSA 3VXMA 5TE6L 5GGQL 5JO5A 3WL0A 5J1AB 4U6YB 4E41B 3MRGA 2AK4B 1KN4H 5DRWA 3BWAA 3QQNA 5EO0A 5I3DA 1FN4B 4I13B 4ZNEA 1UWUA 1MIEL 4HJJL 2L4OA 1W0VB 4JFSA 2F8QA 2N56A 5DK0A 3GMLB 4M43H 2R0WL 1NBZA 1XF5A 2DAVA 3C5SA 1ZLWH 1X5IA 3BN9C 2R23B 3QI9C 1ZLUH 3C5ZD 3QNYA 1A3RH 1FV1A 5HDRA 1MHPH 4WSKA 4UQ2A 4QXTB 2V7NB 1MJUL 2F5BH 3HE6D 5DFTA 4CGTA 4YNYB 2HH0H 1G9MC 1YNKL 1NMCB 2OI9C 5C0BA 4NQCE 1UQSA 3VXNB 2GT9A 5KSAD 5C0GA 4LGXA 1K6AA 1D5XA 4OLYH 3RWGA 3VIFA 4GG6F 4XNZB 2DT0A 5FUOH 3KPNB 1N6QH 3UTSB 3BIBX 1EAPA 4WEBL 3LXBA 4HIIB 1JP5A 4HJGA 3CZEA 2XVGA 2AJZA 1W3LA 5IMLA 4GMSL 5B3JF 4GXPA 1QW8A 1XGUB 2QHRL 2QBWA 3WHE0 2ICEB 3WEZA 3UC0H 4J4PD 5FCZA 4YJZL 2VXTL 1KPRB 4AZGA 4NO2B 3CHFA 3GRWA 1V7NH 1DQMH 4GKSB 4UAOB 32C2B 1MCQA 2VIRB 2XTLA 4K3JL 2CKBA 1D9KA 4JQIH 3QIWA 4LYQA 3RNKB 5H37G 3VINA 4QFUA 1C08A 1QO3B 3BKJH 3OX8B 4HS3A 4TSBH 4X6CE 5GIRA 5INCA 4XB3A 5F70A 4NQTA 2NXZB 1KLUB 3KHQA 2DBLH 3MRLA 1TE1A 2C7FA 4FNLL 3MS8A 4PYGA 1S9WA 3WJJC 4HUUB 5J11C 4LSQL 5CWSB 4RDQF 1JWSA 4GKOA 4HUVA 1C16B 3FB5A 4QTIL 1S7SB 5HHNA 1QUNA 3PHAA 3DX9B 4GQ9H 4UQ3B 5LA2A 3G08B 2DIJA 3C5ZB 4BZ2L 2DQJH 5D7IB 3RJXA 4ZFOA 6FABL 4L4TD 3D0LB 1WDPA 2FRGP 1FP5A 1YQVH 4OGXH 3HE6B 1PZ2A 2Q1EA 1DVFA 4LF3B 2FE0A 5C08D 5ECUA 1HN1A 1OF2B 1FFNB 3CDYA 1XC6A 5LA1A 1A1MB 4ONFL 5DRXB 1BAFL 5DRNA 4H7VA 1PLGH 1U33A 1A2YA 4NT6B 3IJSB 4GRMA 1CS6A 3HR5A 4M5YH 1TTUA 4XCCH 1FP8A 4GXVL 5DD3L 5AUMB 4FTVA 12E8L 4GOSA 1UJ3B 4KH2A 3D3VD 3I85A 4X6DF 7TAAA 1FHDA 1UGNA 4ZXBD 5KN5A 4YBHA 1BYCA 4TRPL 4R4BA 4NZUH 5MP6L 4ZUWB 4N42A 2DH2A 4NI3A 4R3SA 2YZ1A 3QUZD 4OZFH 1F97A 4L9LB 4OI9A 1CQKA 3SE4C 4Y4HD 2W65A 1ZB5A 2EH8L 2F54E 4P8VA 4KTEH 4M5ZH 3ISWA 4BQ8A 4NQDA 2IPKA 1L0PA 1E4XI 1EUUA 1CLYH 3H7LA 1KGCE 3CC5B 4CVZB 2EKSB 4Y2OA 2HFFA 3GNPA 3S35X 3WD4A 2VDRH 4FXKB 4M6NL 5HYFA 1M6OB 5C2BL 1OVZA 2CXKA 3WE6A 5KEZA 4PJHA 1GOGA 4O5LH 1UG6A 3SUUA 1NLDH 2XHYA 2F7PA 3NA9L 3PXHA 5E1QA 1ESWA 3HZYB 4RBPK 1UKSA 3BHBA 1FNEA 4MA1C 3V52L 5JLZB 3QFJD 3EFDL 4J3TA 3ZJKA 1CFQB 2WZEA 4M61B 5ETUA 5A6BA 1CL7H 3T0WA 3HS0B 5MEOA 1JGDB 4L4TB 1G9ML 1OT2A 2AAVA 4TPRL 1TPXB 1YEKH 1PGRB 5HI4D 5C08B 5BJTB 1CK0L 3APGA 1LEGA 4M03A 5GZOD 4OD2A 1JPGB 1JF1A 3C08H 4LYRA 1NC2A 3VOCA 3LEXB 3QDMA 5SWSD 1UUQA 4LSVH 3BCFA 3RP1A 2E9WA 2EE3A 1KTKE 4K07A 5ILTH 5EA0L 2XQBL 3MBXH 2Z8VC 1Q94A 4KRTA 2GEEA 5I1AB 5FIEA 2IALA 3W82A 5KS9F 4EN3D 1RIHL 3IAGC 4YFLI 5JMOC 2X44D 1R8LA 1KFWA 3RDTD 5D1XC 2ZCHL 3D3VB 5F96L 1C91A 4WKAA 1RK0A 1J9CT 2W0PA 4ZXBB 3GHBL 2GIYA 3RWJB 3MR9A 1O7VA 2VLKD 4MDJB 3FO9B 4UOQA 3JV0A 1JDCA 1WFNA 5JUVA 2EDLA 5I8OH 3QUZB 3NTCH 2JFEX 1D6EA 4WHTA 2DTSA 1R75A 4L4VA 4NBZB 3RA7H 5D72L 1KULA 3N1AA 4Y4HB 5DQ9B 1R47A 2AJSH 1U8LA 4X98A 5ESVA 3W26A 1HEZB 3WS3A 1JDDA 1OBAA 2WMGA 3RL2A 2VUYA 4FRWA 1MELA 1AXIB 3MUIA 4JGJA 2ED9A 4DO5A 2MQ3A 1R5IA 3B9KD 5DQDL 5T1LD 2BJML 2FDMA 1AGFB 2D7TL 1EX0A 2FZ3B 3ARBA 5L9DL 1CGTA 4JHBA 4JY5H 2AKRA 4HKZA 1XF2B 2NXYC 5IIEB 1MEXH 1Z2KA 3UTTE 2IXVA 4UINL 5DVKA 1OAYH 4JCLA 4PV8A 3SPVB 3BAEL 4U1HB 4ZS6C 1Q6GA 2VZ1A 2V3FA 5LCVH 4HK3N 1N5AB 3K2MC 5GSVB 1WQVT 1MQKH 3VWKC 1I1CA 5HGAB 1H3VA 4YAQA 5BZDA 3MLSH 3MOBH 5DMGC 1WGOA 4NO0D 4GW4A 4WHDA 1LP9E 5M94B 4FN0A 2AGJH 5SWSB 1IZJA 1E6NA 2LU7A 4OD3H 3G6AA 3F5JA 2P7TB 3FT3A 1YEGL 2EC9T 2XACC 1BYAA 2OBGA 4KHXL 1LE5A 5HHPB 5A6JA 4S3JA 1QLEL 5JQ6L 4EN3B 3BVXA 4OGYH 3D9AL 3LRSA 4ONOA 4Q2ZB 1WB0A 2QSCL 1GOHA 3GSNB 3RDTB 1A3LH 2XFRA 1A47A 4R7NB 4CKQA 3C60C 3M8OH 1RD6A 5I0DA 1N6UA 1V6UA 4MX7A 1CFTB 2FX7L 3FAWA 4P46D 1I1AC 2L7JA 3SJVD 5CEZH 4P99A 2R0LH 4LQFL 3BSGA 3I6LD 3JUZA 4K7PH 3IGUA 4XNQB 1GL4B 4X9IA 2MTPA 1DL7H 1FO0L 1OL0A 4UT7L 1ZT1B 3B9KB 4S1RH 5T1LB 1ORQA 1BFOA 3HUJA 1MVUA 3TH2T 2DQCL 3MV11 4I48B 1LDPL 3OKKA 2B8OT 4C56D 4GG6B 3O6LL 4UV4H 1OD8A 2FLRT 5CHNB 1MFAH 3GI9H 5D4QA 3ZHLA 5E03A 4DTGL 4UQAA 1FNSL 1YDPA 3SDCC 4ZAKD 5HDBF 1RUKH 2XTJD 3WH7A 4LP4A 1WZKA 5FUZL 3QO0A 2DL9A 5BXTA 4PIRF 4NO0B 4OFVA 2GAZB 1R24B 3P2TA 1ROWA 1KXVC 4MQ7B 3U6RB 4TXEA 2J5LC 1MCIA 3BKYL 2IQ9L 4QF1A 5GNZA 4PG9A 2J12B 3AMKA 4IM8A 1H41A 1CD1B 3MJ7B 4K7PY 4P5TC 5I75C 5IFAH 5EZLB 3SCSA 4JL2A 2P49B 1OTTD 3SE8H 4IMLA 1KG0A 4O02L 2FSEA 1U8NA 4KRLB 2BXZA 1FDLL 1OPGH 5TFSL 1SHMA 3PWUB 1TZIB 4PG2C 3WHXA 2CLZA 5D9SB 4W6WB 3SGEH 2QSTA 3VFTB 3AB0C 3OLGA 1SYTA 3D85A 4P46B 1W0YT 5SWZE 2E7LA 5FYJU 1BIIB 4WFFD 1I3RB 1H3GA 4POZC 2EC8A 5DJ8A 4IHOA 4KMTL 4Y4KC 3TA3A 3MJ9A 3FFCE 4I8DA 3U36A 4BELD 3AXHA 3CLEL 3BH9B 3FRUA 3ZLQC 1NGPL 1UWGL 4C83B 5L2KA 5KOVC 1CD9B 2DIBA 4HCRA 4NCDA 5DUMH 2FJHA 2YKKA 5FOJA 5TD4A 1F90H 4U05A 2A2QT 1KNOB 1F4WL 1IAOA 3I75A 4C56B 5F7LB 4HIJB 4U3XA 5FYJH 3ARDA 2HG5B 4Q9QH 3WY3A 2XGIA 2B4CH 5EBLA 3RAJH 1QHOA 1WBXB 4KKCC 4LVOB 4MD4A 3EO1B 1OSZA 4CW1B 1W72A 2CUMA 4K23H 4H1LH 1B4RA 1JXJA 4ZAKB 2XTJB 2JK5A 4BH7A 1T2QH 4JAMB 5GRJH 2HP4A 4LSRH 4KXZI 4PGCA 3P9LB 1UB5A 2CIKB 2KKQA 5GRYA 3MGTA 4EBQH 5CJQH 4PJ8D 4DKEL 3K4DA 2IAMD 3B9DA 3RGVA 4WIQA 3D51A 1FVEB 3PIQA 1CDIA 3BAXA 3TTQA 3VFVA 4ZUVB 1S7TA 3TVMA 3UYRH 5JPNA 3ULUD 1T1ZB 3JV6A 2WM0A 2EDBA 1BG9A 2LAGB 3LD8C 4PP2A 4IDJH 2RAMA 2AK1L 1V0MA 4N0UA 4PGDA 4ZO9A 4HV8A 5D6CA 4JFFD 3NABH 1NAMB 2VLJD 1MY7A 3MU7A 4Y16A 4RMQA 3ZE2F 1ZBVA 5F7NC 2ORBH 2P48B 2P5EA 1T0OA 1Q0XH 1MWAH 2O5XH 5CD5C 3TN0D 4RWYL 3QIUD 4OV5B 2C3XA 4KJPC 2J88H 2IGFL 3WUWA 1CYGA 3MUY1 3GMOB 4XMKH 2MMXA 3VG0L 4UV7L 2LV4A 2GTZB 4AEIH 5TDOB 2G41A 2HJKA 3DWTA 4HBCH 1LQ0A 1PW3A 4PJBA 3MRDA 3T65A 2X89A 1JZ2A 5KSBE 1NMAH 4G3YL 2D73A 3HMXH 3VXOA 1KC5L 3QHFH 2YJQA 1RZKH 1X5AA 3W2DH 5E99L 5GRUH 1LLOA 3X11B 1ZHNA 2MNUA 4GRWE 5CCKH 4FFZH 5CJBA 1A7NH 5ELIA 3SCTA 3TCXA 2AI0L 3VIJA 3VXQB 1SYVA 2HRLA 3QO1B 3VMPA 4LNRB 3U0TB 4GKZA 1A14L 4HFUL 3GNOA 3GBDA 1Q0YH 3O6AA 2QADB 4XBGB 1MLCB 2EIDA 1TJGL 3QDJE 4LLQA 1TITA 2Z8SA 1UYWH 1TA3A 3CLFH 3MRIA 4LCUA 1FGVL 4AM0B 1AD0A 4MNQE 3OR7A 2IAMB 5DD5H 5JUEL 2F7OA 4U0RC 3QJHB 3LQZB 3DURB 4W6XB 4YC2B 5HDLA 4UQDA 2EPKX 2HVKB 4TNVK 3HI6H 1L7IL 5A8OA 1J8HE 3ALWA 2EBNA 4Z77A 5IUSA 3A4AA 4WI6A 2DS4A 5CLTA 5KG9A 2OSLA 3VD4A 3KYOB 1KJ2H 4MCYA 1Q9KA 2VLJB 4XI5D 4YBQD 5ISZE 3D4YA 1VBRA 3WF1A 3BD5A 3FMGH 2GJ6A 4EIGB 4M7LH 5DD1L 2G5RA 4MJIA 2WBJD 4PTUB 3IDXL 1M4KA 3TN0B 4C58B 3QIUB 2CPUA 4I2XA 5CGYC 3VXTA 3C6LD 2B1AL 3ZTJG 4DQOH 1X5GA 5CEZD 2K1MA 3ARGD 3NA4A 4OKDA 3HPLA 4R2GB 2YK1L 3RWDB 5IW6A 1EHXA 3BPCA 3E6HA 1LK2A 3Q3GB 4I18A 4DK3A 5IHZB 2DL2A 3GB7A 1ISWA 2Z31D 2GK0B 2B0SL 3LKNA 1MFCL 4WGWB 4UFLA 5JHDE 3P4MB 3ZZ1A 5EN2B 1HWWA 5IGXL 1GIGL 2VXUL 3BPLB 2IBZX 1QNOA 4P49A 4ISVA 1GPFA 4XPHH 1G7QB 1AQ0A 3IGAA 5EOQL 2BDNL 4JM4L 3OF6A 3U46A 3O41B 4PJGE 4QRSA 5GGTH 1ERNA 2MHAB 4WDIB 1MRDH 3FZUC 4LLYA 3BGFC 4N1HB 4UNIA 1B0GA 1NANH 3MFFA 4RAUB 2DQFA 1J1OL 2Q7NA 3KYMA 4NUGL 7CGTA 3WY2A 2BOBB 5HYIA 1FVCB 3U7WL 3U4BH 4YHIB 3V4PL 4TSCH 4HXBH 2ZCKH 3C8KB 4LCYA 4OSUL 4U7KA 3WYRA 3PF2A 5EC2A 1TJIL 2X2IA 3VFSA 1LL7A 4V2CB 5DJXB 3EDJA 4ZO6A 3P9MA 3LEYH 3QUYD 5D1QB 3KXFE 1LWJA 3RI5F 5SX5H 5JW4N 1VFBA 2WNGA 3CVHB 2V7HA 1WCBA 4MA8L 5F6IC 3D50A 1X5LA 2BSSA 3DI3B 4OCYH 4N9GB 4JM2C 2XWEA 2WBJB 4JDZB 3MLYL 3TZVC 3C6LB 3BAWA 1RUPL 3GH5A 5CGTA 2YIHA 3F7RA 3K8MA 3KS0J 5KVGH 5M5DA 5E9DD 1KTCA 3L3KA 5DHYB 3VVGA 4PRDB 3BSZL 3ARGB 5J12B 4P7OA 1U6AH 2F9BT 3MNZB 2CR6A 4NN7B 4QXGL 4FNPA 5I8CB 1JAEA 4NHCL 4HPGA 2OL3A 2YHGA 4W7WA 1XGQB 3CXHK 3MRJA 3PGFL 3V6OA 1QHZA 2W9DH 1Z3GL 2LVCA 5FHAL 5DT1L 1RHHB 3KLSA 1NBVL 4GZJA 2D31A 3PNWA 2Z31B 3QJFB 4XP1L 4N0CC 3HRZA 3NIGE 4PMNA 3ARED 1FSKB 3ES6A 2YPLE 1UB6A 2XUCA 1MJ7L 2A0LC 1HKJA 3ARUA 4P2OD 4GAJH 3GSXA 1UR4A 3V8OA 4C59B 2MFNA 2D3VA 1WZAA 5DD0L 2HFGL 3FJTA 4LVHB 3TBTB 25C8H 4YHNB 4P3CL 2G2RA 4YHEA 2WP3T 4TX8A 4UFMA 1P1ZB 1RJZA 2ESVE 3PL6D 1BGAA 1YEIL 4XGZA 4UI2A 1BQHG 1F58L 4F9PA 1ODAA 3Q5OA 4N8VB 2E3VA 3WIFB 4OZFA 4XVSL 3W9DB 3IDIA 1QI2A 4UBDC 4QCEA 3IDYB 4GMTL 3QUYB 3TFKC 4F7PB 4U3HA 2Q8AH 4Y1AD 1Q1JL 2BNQD 3EMZA 4KTDH 4GO8A 4U1SA 4MAUH 3EDKA 3ECQA 2ENSA 5KVDL 5ABFA 5B3NA 4A3HA 2OJEB 4YIQB 3D39D 1KJ3L 1EEZB 4R90H 1D6VL 4M1CC 1J0JA 3GMQB 1YMMD 3IYLW 4K2UL 4K9EC 5E6IA 1IT0A 1UEMA 1OINA 1KF9B 2YN3A 3EYUH 1YY9D 4P4KA 2WVVB 4HZLB 1B3YA 1LK3H 5I74C 1UEYA 4L8BA 3PWJB 5BQ7A 3PZTA 5GS1B 1A4JA 4JVPA 1CFSB 3HFML 2AEQL 4HWBL 3U1SH 3O0RH 4HSQA 4X6CF 4JFZH 5B39A 4A2LA 4PJCF 4PTTB 3C9NA 2VDNH 3LS5H 3AIEA 2BOCA 1NFIB 2ZUYA 3B4NA 3DVGB 5BOPA 4KKAD 1BLNB 4P2RD 4P57A 4JPVH 2VE6A 3AREB 4ONGH 4XMLH 4LKCB 5DMIH 4M29A 3H9SD 2YKLH 1CE6B 3WO3B 1LE9B 5IEKB 2E6PA 1T20B 4XNYH 3C5JA 1MJJB 3M07A 1IQDA 4K7FB 3NZ8B 5IVXA 1S3KH 4JFYB 3BUYA 3MRPB 5EIVA 5HI3D 2MJWA 3ZDZE 1AGBB 5ITBL 1JYVA 2ZICA 3P4LA 1BJMA 2V2TA 3BX7C 3OTTA 4J6RH 4NP4L 4RIRA 3PL6B 3VXMD 1E6RA 5D7SL 2X4TB 4OIAA 1UHVA 4M6OH 2YPKA 2JIXD 1DHKA 1LO3L 4P9MH 5INDB 4YEFA 1WITA 2R29H 4OF8A 4LEOA 4ZOAA 5HHOB 1BTCA 1U8OB 4Y1AB 2C3VB 1MW3A 4UU9B 3SUWA 2BNQB 3O11A 2A77L 2ZXDA 4OOUA 3H0TB 2GSGA 3QCVL 2LTQC 3UMTA 2XG9A 3BUPA 4JHWL 2WLYA 1YMMB 5HBFA 1P4IL 3V0VA 3IF1A 1T7WA 2X1WL 4RFOH 1W2KT 2DM4A 5GISH 3IETB 5MHSD 5EBMA 5ANMA 2HJFB 4YDJA 3PHQA 2ADFL 4XCNB 4AD1A 1AFVH 2IH3B 1TVHA 2YD6A 3KPPA 4MJ6A 5E7BA 3B8YA 1F3RB 4TTGA 1E6OL 3B2VH 3NVQA 2ADGB 3DTXA 2XVLA 2WIIA 3IXTB 3TO2A 4YDKH 1IEAA 2DLTA 2IG2H 4L8DB 2AEPL 3CFEB 3DO3A 2UWEA 3H9SB 5GSRB 4EUPH 3H9HB 1E6ZA 2E8YA 1FG9C 4G9DA 8FABA 1ZGLM 3QXUA 4QRRA 1JPTH 4HMCA 5BV7B 4AW7A 1DDHB 1UKPA 2YXMA 1FBIH 1Y18A 2AJUH 1PG7W 1G7PB 1XGRB 4XTRC 1JHKH 3QQ3B 1LF1A 1EXPA 3P9WB 4Y19E 3S96B 3RHWK 4CU6A 3EDEA 3IJHB 3EZ8A 3WFDH 3QXDA 1Q72L 4X7CC 2X4QA 3DXAD 4LGPB 3VXMB 4OAWA 4QHNB 2MQ0A 3DGGA 5JO5B 3M17B 3BGMB 4XX1E 4UUJB 1QA9A 2JIXB 4HK3J 3RX5A 2CYGA 4QRQA 2FD6L 1P5VA 1KN2L 5DRWB 1KTDA 2DMKA 2ZSWB 2DWEA 3LEVH 4XPFL 1OY3B 1UM4H 2UV3A 2WC4A 3WFEL 4ZS7H 1RVFL 1BPVA 1A1OA 5DS8A 4MXQC 3SCQA 1XYFA 4K9EL 1YEEH 2LQRA 3B3IB 1XF5B 4GXUN 2PYEA 3VIKA 4NBXB 3GJFH 3QNYB 4XCYB 3K81A 4RGMC 4UZGA 2QMJA 2X2JA 1UASA 4G8EA 2ZUTA 4PJIF 4FQXA 2COQA 2MQCA 1BFVL 4U6VH 2PNDA 4R0LC 5JXEA 3VH8G 4I3GA 5D2NC 4L3EE 3LH2L 2DLFH 4JO4H 1E28B 3CHEA 4TOYL 4H04A 4NKDA 1CLVA 3GFUA 1F4YH 1UOKA 5HYSB 2CBVA 3SCOA 4HIXH 4ALAH 4QHKI 1D5XB 1TDQA 4UIMA 5EOCL 3JTSA 3RVWC 5F7UA 5TE4L 5BRZA 1IGCH 5JPMA 4JPWH 3RGHA 2F61A 2PR4L 5E4IA 3FB7A 2FJGA 2ED7A 4PJ7A 4LX4A 4XWGL 4XPAL 1E1FA 3N1PC 3ILPA 1EDQA 2QHAA 3ELAT 4DKFL 2W92A 1UG9A 3BC9A 2VN4A 1B88A 4Y89A 2XN1A 2RGSA 3FN0L 1HNGA 4Q58C 5IB1A 3FQWB 3O2DL 1S7XA 3O3DA 5DHVB 2CITA 7FABL 3NGBB 2CKBB 4CVXB 3MUZ1 3L4TA 1RZ7L 3NIDE 2G3JA 1KCVH 4BSVA 5TF0A 4OQ1A 4V27A 2QR0A 3DXAB 3FQRA 4HS3B 3KLLA 3VFNA 1I85C 2AJVL 3PDGA 4X8XA 4KK9D 3S35L 5GIRB 2D20A 2V2XB 1FVDA 1QWUA 4QCFA 1H15A 4MNGE 1BFTA 4QO1A 5ICYA 3MRLB 1KTBA 1NWUA 5E08H 5EH1A 5ADOH 1VEMA 5D8WA 1BVLB 1S9WB 4DN4H 1IQWH 5CZVL 1A22B 1WO2A 3OKNB 3WDPP 1FG2B 4HUVB 3FB5B 1JNNL 4UOW1 5EIIB 3RX8A 4DJMA 2JB6A 4TSAH 2DOCA 1A9EA 5MENA 1OGTA 1E3XA 5A6BD 3TP4A 2I24N 1UM5L 3WJLA 4M1RA 3FO0H 3AI0A 4ZFOB 2XZQL 1LL4A 1JI2A 1NFDE 1YPZE 3WQ6A 5GQBA 4GBXC 4YHLH 3LN4A 4KI5F 1J1XH 1DVFB 4R26H 3KYNB 3SCMC 4CBPA 3WH9A 1N7ML 5AD0B 1D9KC 1HXMB 2HKFL 3QIWC 1QSFD 3H3PL 1GPOL 1WDRA 2BVEA 3CDFA 3QDMD 2OK0H 3G5VB 1I8IB 3MBEA 1TQVA 1YEJL 4TVUA 4WNQA 4HGMA 5DRNB 4RNRB 3LKPA 1XH2A 1E3ZA 4KGJA 1JIBA 1ONQA 2BVOA 2FL5A 4KRNA 1G7HB 1CBVL 1TTGA 1KV3A 5C09A 3ULVC 5IHBA 4LCIL 3O2LA 4E8DA 3J7HA 4H88L 4NKIH 4P23D 4XC1H 5FGCB 5FO8A 3H54A 1HP4A 4WO4C 1BFNA 3NAAH 4TQEH 3W38A 4JQXC 4G9FD 3P4OB 1YJDH 4HWZB 1HJUA 5HPOA 3LPOA 1ZKAA 5EORL 1HJXA 4H0HB 3RU8L 1X5JA 3CCHB 3DJ9A 2WSKA 4L4VD 1GQJA 1DTUA 3EJZC 2WVTA 2D9QB 2P44B 5F7WC 1BOGA 2IPKB 1C8YA 3WFBH 3PBGA 3VI4E 1T1YB 3VWJC 3BOVA 4DWSC 4BQ3A 3WIHH 3UCRA 2E40A 4M80A 5J4MA 2OZ4L 4CD8A 3KDMB 3F12B 2XICA 3ARTA 4NKMA 3C87A 4M8QB 3S3JA 3WE6B 4XB8A 1X6LA 3BZFA 1FYTD 3U7VA 4G42B 1R3HA 1KBGH 3BHBB 3JWOC 4Z76A 2DH3A 1HXKA 3TWCL 3NH7H 3HI1A 4UZSA 1ODZA 1BBDL 3HC0A 3HMXA 3C09C 3QUKB 1EK3A 3C2AL 2UYLA 3T4YA 1G9NC 4PY7A 4QRPA 1QSFB 4DEPC 2F7QA 3IFNH 3QDMB 3UDWA 2UY3A 4GZIA 2IBBA 1I3GH 1RZFH 4OM0L 2ZOXA 4MJ4A 1JPSL 4ZD3H 3RPMA 1CICC 1KEGH 4EANA 5E0FA 4AEFA 4J27A 1AJ7H 2AW2A 3GKZA 3WD0A 4P23B 5DGRA 2FECI 5GGSY 3S88H 4JKLA 4D6EA 2X4UA 1R85A 2G9HB 3MR9B 3M7SA 1S7WB 4KK5C 1U2YA 1IKNA 1H8OA 3QG6A 4G9FB 3KAAA 1D6EB 4IJ3C 4JY4A 2XN9A 4JFED 5KVMC 4L4VB 3DSFH 5HYJE 3OAYK 1H49A 4X98B 1U8LB 5ESVB 3WEXA 4AXNA 5EPMB 1C8XA 4OZIE 4ATLA 1KJ2A 2LABA 3T2NH 2DM7A 1F2QA 1A6VH 1KIQB 3HC4H 3O8XC 4I5BB 4C4KO 4RMTA 5C0RH 2WZHA 4I0KA 1NEZG 1R5IB 4C55A 4D8PA 3AQUA 1FAIH 1OSPH 1T7YA 5A6AA 3IB4A 3CSYA 2IFFL 1OOAA 1NWSA 4EDWH 3F7VA 3NFPB 2APXA 4X5WB 1CG9A 3PABB 2AKRB 4HKZB 5JIPA 1MI5D 3MRBA 1OAQL 4QXUH 1RURL 2G3MA 2PWFA 3QQ9C 5I17B 4GRWH 1NGZA 2YRZA 4AZBA 4TVDA 1YYML 2JIEA 2YBUA 5JW5A 4HGWA 1SBSL 5BZDB 2WMHA 4PGEA 3MQIA 5TE6H 4LCCB 5GGQH 1QKZH 1VB9A 1OGAA 3JWDH 1R7AA 3RL1B 4CU8A 4JRXD 5TGBB 3G6AB 3CFCH 5BWFA 3FT3B 1MIEH 4HJJH 2V5YA 4QOKD 5ICXB 5IR1A 4M4PA 4L1HA 1AVAA 3ULVL 5GGTA 1BEYL 4S1DD 4U3CA 3PQYA 1ZJAA 3FT2A 1Q9WA 2R0WH 3BCDA 5KSBF 3LRSB 3ROOA 1VBUA 5EIQA 4WV1A 3QISA 1ISZA 4ZOCA 3DUSA 3MV7E 2PI6A 1A8JH 5C07E 3OR6A 2DD8L 2J7CA 3I02A 1MJUH 1C1EL 3CDCA 2ZPKL 4NO3A 2YRLA 1YNKH 4JFEB 2JCCE 1QSEE 2FX9L 2VVSA 1QLFB 2E5EA 2WW8A 2XWJA 3POCA 1DLHA 5F7YC 4QHUB 4PJIB 4U6HA 4KI5D 3VXUE 1VPOL 4G6ML 4WEBH 1JXKA 5I9QB 4GMSH 3VO0A 1L9NA 4UAOC 4ODVL 1XF4A 2QHRH 3EYVA 2LAAA 3I84A 1CN4A 3OKKB 3JWOL 1MI5B 4P3DA 2FECL 2VXTH 4NSKA 1W2VA 1C12A 2VDQL 5F1IA 5I8EA 4KROD 1INDL 3TV3L 3ULSA 3MV9D 3SUTA 1UJTA 2ZJSL 4K3JH 4NQCA 5IB2A 4KRUA 1M7XA 3WLBA 5I19L 4KKLD 5IESL 1LO2L 3MCG1 2Y5TA 1A7QL 1WWWX 4K3EL 4DKAA 3AFLA 3GXPA 1JGUH 4JRXB 3UO1L 3ZDYE 2G8ZA 1PIGA 4IOSD 4LAQL 4P2QE 1J05A 5DR5L 1I7UB 2X05A 2YN5A 3ZKXB 5LBSL 3RGVD 3RCNA 3C5ZC 4QOKB 2HVJB 1K4DB 4LSQH 3EO0B 3ZL4L 1H0DA 3VCLA 4PG9B 3PWPE 2X70A 2J77A 4QTIH 3TVMD 2N7AA 4M9OA 5A2LH 5F93C 4MLSA 5DFVD 3O9WC 1BPLB 4KVNL 4BZ2H 5K33A 6FABH 1BX2A 3ZQ9A 2FNBA 1KG0B 1VFAA 2L0DA 5KSAC 2R2HA 1VFOA 2HT2C 5FIPA 2WHLA 4AT6A 1E6SM 2DQXA 1YNTA 1UC6A 1J01A 3D85B 4UMGA 2H2PC 4ONFH 1LD9B 3SKMB 5LGHL 4LLWA 1KCKA 4CD4A 1HNYA 4PRPD 1NCBL 2OTUB 5LAXA 4GXVH 4NC0B 1TZ7A 12E8H 3ALXA 5E5MB 4LDEB 5L2KB 4L9LC 1R3IH 2VISB 4Z5RA 3CU7A 1E4NA 1F00I 1I4FA 3GIZL 3MPCA 4TRPH 3V6ZA 1ZK9A 1MCKA 5MP6H 4BKLA 3CZFB 1JJUA 1IAOB 4U1IA 2KDGA 4X0KB 3CPLB 1OSEA 2B31A 1KEMH 2BX5A 4HDIB 2ZWYA 4KY1L 3IDNB 3MLXL 1OSZB 1IEBA 3MV9B 1B3JA 3NMEA 4Z7OF 2OSXA 3BLPX 5E00A 2WZPD 4Y7EA 3WMSA 4MAYA 4YX2L 3RY4A 5HYQA 3F7PC 3DROA 1E9LA 5CP3H 2J4WL 2J47A 1CGWA 1KXQE 2X1PA 4KMLB 1W91A 2CKRA 2WWCA 3MGTB 3CZNA 3L2LA 1QQDA 4O2CA 4PD4K 1LILA 3RIKA 2BVUA 4M6NH 3RGVB 5TH2A 3RX7A 5C2BH 1I7ZA 4YWGL 3PIQB 2X4PA 2OYLA 4H25A 3OXSA 3U30B 1JRHI 3NA9H 3TVMB 4UILH 5JPNB 1TPXC 2XKNA 3JV6B 3V52H 4H41A 2ZG1A 4CCDA 4WF7A 4YEEA 2NW3B 3P11H 1MFEL 2VR4A 4N0UB 1G9MH 4HV8B 3ARDC 1ADQA 5TQ0L 1AGDA 1C5CL 4M7ZB 4TPRH 5IBLD 1E4MM 2F53D 1CK0H 2GJ6D 2DDQL 4JN1L 4OZGE 2DJUA 2W0FA 4WW1A 1PJ9A 2O93L 4HZAA 4PJEF 4FNSA 4Z7WF 4FF5A 4M7LT 3EJPA 1FYHB 4YDVA 5EA0H 2XQBH 4ZXBC 3KR3L 4LSSL 1DLFL 4ZO7A 5DVOA 4PRPB 5D9PA 3BUDA 5D1ZA 4F7EB 1RIHH 1WP6A 3BRFA 4XNUL 3QWOA 1O7AA 2NY0C 3NCMA 2ZCHH 3TGXA 2Q86A 1PYWA 1MF2L 1LWRA 3GHBH 3MZTA 3VXOB 3S3PA 1XIWD 2R9HC 3DRQA 1WNOA 1ZHNB 5TDNA 5DHXB 3WDQA 4B15A 3G6JA 2ZUSA 4XXCA 4BFIA 1UH4A 1ORSB 4DAGL 5IT2L 5I24A 4HOZA 2NT0A 4AENA 5D72H 4YPJA 3EBAA 3RTQD 3OF6D 5IFJA 1W1TA 3U57A 1SYVB 5IHUL 3B2UD 1T5XA 3BLBA 4M4RA 2X41A 3DUHA 4Z0BL 1NKOA 3QEQE 2P5WD 5DQDH 2BJMH 3T04D 5GS2H 4LLQB 4PY8J 3ZMRA 1TA3B 4IRZL 4I77L 2XRAL 1MWOA 1KFAL 3W11D 2FR4A 3W5NA 4RGND 4W4NA 1IM9D 5E2JA 1KCRL 4PRNA 5F88A 4UINH 5HI4C 2FHBA 4Q6IA 4UQEA 3BAEH 5GZOC 4L8CA 1DWIM 5KG9B 2OSLB 4TUFA 5DZOA 3CUIA 2J25A 3MANA 4P8XA 1MCNA 1ZVHA 1V3HA 1DEDA 2P47B 4ERSL 4MCYB 3VG9B 1CFNA 4LVNC 4AJ0A 2WC7A 5E2TL 1MXDA 2F53B 2GJ6B 4LNVA 1TQBB 5H35A 5DJAA 1EQCA 4WEMB 3WNMA 1VACB 4EN3C 1GOIA 4E42B 4I2XB 4U1GB 4CAGA 1OAXL 4H26B 1AHWA 1YEGH 4KHXH 5T1KD 4X9HA 4S2SB 4GAGL 5JQ6H 1MFBL 3WLWC 5IW6B 5AYBA 3T1WA 3O9NA 1GQKA 3UTTA 2Y6SD 2QSCH 4YPGA 3VDAA 4OUEA 1P4BH 4LU5H 4U1JA 4PRHA 4EI5D 1JRHL 1LK2B 5DWUH 3GB7B 4NQUA 1QBML 5DEFA 3TNNA 1XIWB 2IMMA 3LRGA 4GS7B 2VO5A 3NFNA 1P69B 3LKNB 1I7RA 2FX7H 3TEUA 2WZIA 5E8EB 1CD0A 1LP9A 4ISVB 3RTQB 4LQFH 4NCC2 4QRSB 2QQNL 5ID0B 4OV6F 1FC2D 2H6PA 3N9GL 3EUUA 4LLYB 4NRYA 5FO9B 2EJ1A 1FO0H 3GSQA 2P5WB 4X9BA 1B0GB 4UT7H 5A2IH 4P59L 3KYMB 2FHCA 5EDXA 3NSMA 2DQCH 3TO4A 1LDPH 4LCYB 1CIDA 4LHUA 3O6LH 4RGNB 3VRJA 2NSXA 1IM9B 4G8IB 1FNAA 1YN6A 3NN8A 4PGZA 4I18C 3VFSB 3P9MB 5F89A 5FA4A 1PFCA 4KAQL 3HPJA 4JHZA 1N64L 4DTGH 1FNSH 5IMKB 5LYRA 4JPIA 4CVWA 2V7HB 2YMXH 3JV4A 3IAPA 4OZ4A 5FUZH 2XG5A 4GRLA 2WINA 1C5DA 2EDNA 1S9KC 1GVIA 3SQBA 5E8NB 4LVEA 3SDDA 3PV6A 3F7QA 4NQVB 4LASH 3FOLB 3GI8L 3BKYH 1XR8A 1T4KA 2IQ9H 5T1KB 4YFLF 2R2CA 4W81A 2R0ZH 4YXHL 1IV8A 1HJQA 3BO8B 2J62A 2VVNA 2OL3B 4EI5B 2PBGA 3MRJB 2KQNA 5I23A 4DGVL 1A6AA 2E9MA 1OP5K 3WFHA 1LGVA 3V2AR 4P46C 4JZOB 5EZJA 3QZWG 1J86A 4O02H 2D31B 1FDLH 5TFSH 4ACZA 2HLFD 3JSSA 4PRID 3ES6B 1HT6A 1UB6B 3BQUA 3FHQA 4HJ0D 5IVNA 1PZUB 1I3VA 2NNAA 5I77A 3NCBB 3VSTA 1F3JA 1TNNA 5BS0E 4RE2A 1MUJA 4XCEA 4KMTH 5HVGB 3QCUL 4AIZB 2VDML 1UWGH 2EPMX 2AERT 4YN5A 4YLQT 1BZQK 2J7EA 4KZDL 1RJZB 3GH4A 4XGZB 1F4WH 2VDLL 3L6FB 5D6DC 4ZAKC 3WIJA 5CIPA 3V6OC 4ODXB 2X1XR 1ND0A 2NTSP 2ESVD 1YNLL 2OTWA 2XA8L 5DUPH 4F9LC 4M7KL 3HCVB 3RKDC 5SWZA 3MRQB 4LPUA 3POHA 4PJ9D 3RKPA 4HG4J 1TQCB 2OWWA 3KPRE 2H1PL 3QT2A 5GGSA 2IADA 1P5UA 3GSNL 3UAJD 3WD5L 5H2BB 3GSVB 4AMCA 2GDVA 3T0XA 4HLZG 5CG0A 2Z8WC 4HIEB 3FFCA 1U8JA 5ALCL 1P84J 4OFYA 4DKEH 4X0NA 3WQVA 3VIPA 2EPLX 1OTTC 5GS3A 4X4XA 1R34A 3A22A 3DVIA 1MHCB 5BQ7B 1A4JB 4YUEL 5HPCA 3WF4A 4WHYG 5BZWA 4WI3A 4NZJA 4HPOL 4OCLC 4FZ8L 2BOCB 1UR1A 2GJRA 2GFBA 4ZMAT 4UOZA 5IMOB 4PRIB 1CLXA 3WNNA 2VE6B 4HHAA 2BSTA 3T1FA 4M7JL 4RWYH 3LCYA 1KB9K 3M1BA 3AZTA 2DJ4A 3B43A 5DDHA 3VG0H 5SV3A 2LU4A 4G8FB 4UV7H 3GNRA 3WFLA 1IQDB 1YPZF 2IQAB 4A6YB 1Y0LA 1KIPB 2NY6B 3WHE1 1ZE3C 2P8MB 3FCTA 4PJEB 4RX4A 4Z7WB 3KWWB 2O9RA 4JCMA 3GEWB 3O4LD 4G3YH 2V2TB 1KC5H 1EJ6A 1I3UA 5I18L 2W60A 5E99H 3IAQA 3MV8E 5E8PA 1YMHB 5C2UB 5EU5A 4LXFA 1RULL 3HZMA 4HEPG 4LEOB 2AI0H 2IH1A 4LOUC 1WAAF 1BBJA 2IWGA 1DJSA 4PJ8C 3VJ6A 2PYFA 3WS6A 2H41A 4C7GA 4W8LA 1WT5A 2FO4A 2IAMC 1A14H 4PJ9B 3BPOC 2G75A 2OYPA 1Y6MR 3LKSA 5BW7C 1QRNE 2AXGA 2X9XA 3C6SB 1EVUA 1NUNB 2GSGB 2OYMA 4X0VA 1TJGH 2OS7A 4YFDB 3LV3A 3CFKA 4ZFZB 1X7QA 1FGVH 5JUEH 1MCLA 5CQ1A 3MMEB 4W6YB 2I07B 1RZJC 2ILLA 2XSBA 5B4MD 5CBEA 5ADPL 1C7TA 4O4YH 4U1MA 1L7IH 3V7AE 5CSUA 5FKPA 4GIAA 3EJYC 5FGSA 3TN0C 2Q6WA 2V5DA 3JUGA 1QZ1A 3D18B 1HP5A 3WBEA 1HHKA 3DTXB 1GGTA 3QG7L 2YL5A 3BKJL 3PG2A 5J06A 2WIIB 4OGAD 4LCWE 5DD1H 1DEEA 3U7AA 5TF1H 3IDXH 4YHPA 2CUIA 3QDJA 4KXZH 5HHQA 4Y8DC 1PBGA 4HIHB 1NARA 3SGJA 2B1AH 4G9DB 4ZG1A 3LDBC 5I1EL 2YEZA 4MNQA 5BOZG 3TYFA 1UACL 4UIKL 2YK1H 3BW9B 8CGTA 4FABL 1JZ5A 3EYFA 3I50L 4F33A 1J8HA 2DQUL 2P1YA 1FH9A 1S8DA 4D9LL 3O4LB 4MZ2A 2EDDA 3DX1A 1T04B 2OLHA 1F5WA 1E27A 4KKNA 3EJQA 4OAWB 1YQVL 1IC5L 4NQED 4YHYB 4N68A 4PTMA 4ZOEA 1IGYB 2I27N 3DDFA 1EEYA 2B0SH 5ISZA 4QRQB 1GNXA 3CUGA 5IGXH 1GIGH 1H5BA 2VXUH 4W4OC 3RY6C 1F4HA 3HG1E 2BDNH 4JM4H 5EOQH 1TZGL 2C1PB 1EZVX 1GZQA 1II4E 3OHXA 4ZXLA 5DS8B 4P5MA 4RRPG 3LZFL 3ZR6A 4JL1A 3OXRA 5MEND 4U1NA 1E6JL 1A6TA 3OB0H 3DHJA 2WUCH 4K55A 1HK6A 1J1OH 3T3PE 4GAYB 3U0WL 4NUGH 5H8DA 7A3HA 4LKXA 5K59E 2EECA 3WV0A 3U7WH 3BIKA 5FUCC 1NAML 3IVKA 5DA4A 5EU6A 3KPSA 3V4PH 4LLMA 4LFHG 2H9GA 4OSUH 4NZUL 1H8SA 4XI5C 3GUTB 4YBQC 3MRKA 1TJIH 4OZIF 4NKDB 3VIGA 1TFHA 5C0EB 2H3NA 2F1AA 2K9UA 3NPSC 1U8MB 5A6MA 3OA5A 3V4UL 3TYGL 3DYOA 2VITA 3VXSE 5JW4R 5JPMB 4WUUE 3E0GA 1X6NA 4MA8H 3MV01 4PJGA 3RBSA 2BNJA 1AXTL 5C09D 2FJGB 5FDWB 1S9XA 5J12C 3BXNB 4N5UA 4NN7C 3MLYH 1RUPH 3SDXE 3VGFA 4O51B 4G8GE 1IGML 5IMMB 5IB1B 1ZHLB 5FO7A 3BSZH 2EPNA 2GJZA 3QCTL 2Z31C 4V1DE 1JPFB 4QXGH 1UWXK 4NHCH 4Z7UE 4X99B 1WZMA 3BUIA 3JWNC 3FO1A 5JXEC 1Z3GH 5FHAH 3TNMA 3KXFA 1NBVH 4Q9RH 2WMPA 2AK4E 2YUVA 3D2UA 4NQEB 2A73B 4XP1H 1YEKL 4JREC 2OQJA 1S7QB 1MCRA 2PTVA 2D9CA 1MJ7H 1LNUB 3DRTB 3KL3A 4LVHC 1AE6L 2PO6A 5JDSA 3WXWL 1NH6A 4LSVL 3DO7A 2ITCA 5DD0H 3S4SG 4G6JL 5ILTL 1B90A 3MBXL 3MOAL 1TETL 4WKHA 3D4ZA 2HFGH 4HD9A 2JB6B 4X4ZA 3ULUL 4AD5A 1A9EB 2AV7B 5MENB 3HLAA 3C8DA 2DI7A 4P3CH 3IDYC 1RZJL 1GAFL 1G7JA 3MROA 3LN4B 1ACYL 4AZ5A 1F58H 4R5EA 3QUXD 4RMUA 3X12A 5A8NA 4XVSH 3BDBA 1M05A 4GMTH 3MREB 3MBEB 5ICZB 3EGSB 2YPLA 2XWTA 3UTSE 5D96B 5I1GH 4N0RA 2YC1A 4YXLL 4OCSL 5BVPL 3L3HB 1Q1JH 2FL5B 1R5WA 2XT1B 4ZPVA 5CP3A 5C09B 1CLOL 5GS1C 4OGZA 3K8KA 1D6VH 4K2UH 1CT8A 3D1MC 5DO8A 2VWEC 3PTKA 1SMOA 1U41A 4IIQB 5CEXA 2VZUA 3O6FA 1DWAM 1ZBKA 3QI9A 1KCLA 5FCSH 3D48R 4XZBA 2Y07H 3HFMH 2Z35A 1AKJA 2IBGA 2AEQH 1ZT4A 4HWBH 5CSZA 3A6CL 5D9MA 3PGDB 5MERB 3AREC 2C7UB 2W5FA 3VFRB 2B4CC 5LCVL 2UUDK 1EEUA 4P2OC 5I1KH 1Q6FA 3D69B 4JFHD 4OJFL 2E9BA 3A67L 4IBLT 3CC1A 4EKXA 1KPUA 4OOZA 1YC7A 3E3QC 3BN3B 1W9PA 1XYZA 4H8UA 1VGEL 4N0FB 1JL8A 4RA0C 1TIUA 5DFAA 5IVZA 5EZOL 1HQRA 4XVUC 1RY7B 3KL5A 2NYYD 4EIZC 5JOEA 2E8ZA 4F9JA 2VXQL 2VSCA 2CLRA 4WU7B 3HI1B 1VFMA 1ZJBA 2GJXA 1U2HA 1DE4A 3HC0B 3MJGX 2BVDA 3CVHL 4NP4H 4OM1L 1BF8A 5D7SH 4CCEA 3T4YB 1NCUA 2V3DA 1FL3A 1NMBL 3JBG7 3QUXB 1N3NB 1LO3H 1RZGA 5DK3A 3QRGL 2WC3A 4MDIA 1Z9SA 2V17L 3LXAA 2ZUMA 1P4LB 3S2CA 3ARFD 4AMKL 3CZGA 1AGEB 5C0FA 4ACYA 5CEZL 2R0LL 1D5ZB 1NGYB 4PLJD 1H2JA 2A77H 4F57L 2N4IA 4MJ5A 1UWEL 4PMXA 5L2JB 3D25A 4HH9B 4PRAA 3WJJA 1V0KA 3FONA 5HGHA 4JZNB 3WO4B 1BQHB 3RUGB 1KOAA 3PZVA 2EICA 3CFDA 4V2BA 2EEXA 5D5MB 3A23A 2X4UB 4NRXB 1IL1A 1OWRM 3U7YH 5EU4A 3AVEA 2VCBA 2OXGA 4B53A 4ML4A 3GSRB 2E27L 5CMAA 3UJTL 3CTTA 2EYSA 4KKAC 2ADFH 4Q97A 1SR0A 1RZKC 4LHQB 3MMUA 4CDGC 4U1KA 1R87A 1E6OH 1R3JA 4CKVX 3D0VB 2GDUA 2AQ1A 5EMYA 4CUCA 5JNYB 3O2WH 3PTMA 4Y4FA 3RIAF 1J12A 2AEPH 5HXMA 1FCCA 1P2CB 2QLVB 3CSYB 1TQTA 3MJ8A 5I1HL 1VCAA 3N1MC 4V2XA 3BVTA 5M17A 3MRBB 4Z7NF 3GHEL 3BISA 1R46A 4L4TE 3O6KL 5F9JA 2JEQA 1NGZB 1IKNC 5E8OB 5C08E 3O3UN 3M46A 3ARYA 4CJ1A 5HBBA 3QXVA 5FM4A 3RMEA 2J74A 1RUMH 3PHSA 3VNYA 1S5HA 3GXTA 4LHJB 3SE4A 4CMHB 4YGVA 3DECA 1AMYA 2FD6H 2B20A 1KN2H 1VESA 4GLRI 5E5RB 1KB5B 3ARFB 5I2UA 1HQ4B 4XPFH 3GXFA 5IR1B 3WFEH 1RVFH 1AC0A 1CECA 3D3VE 3BUQA 2ZWZA 1R86A 1ZLWK 3ROOB 1FO0A 5E0CA 1ZLUK 3TT3H 4BFEA 4CCCA 2WCSA 3I6KA 3DUSB 3R8QA 4Y19A 3OJDB 3RM4A 4HT1L 5E95B 3D5HA 2G5BB 3PDDA 4Z0XB 1G6VK 3OPZL 1BFVH 5KZCD 2J4GA 4L4OA 1W2PA 3CUFA 1F90L 1S9VB 2YFOA 5DJDA 2BS9A 3LH2H 3N12A 3B5HA 4TOYH 5DQJB 3VFGH 4OQTL 3T0ED 2XWJB 4PUBH 3SEPA 1BECA 2FGZA 1DLHB 5DJ0B 4Q7NA 4D1IA 1LG1A 1QR1B 3H53A 5FYLD 2PR4H 2E9IA 3WL1A 1E0XA 2OYKA 3OKOA 1P7HL 1AGCB 4XWGH 4XPAH 2CDGB 2VABB 1N5YL 3LRLA 1JFQH 4IOIA 1XF4B 3VXUD 1MH5A 4PPTA 3MSDA 3B6SB 4DOHB 2V5MA 4DKFH 4JQVA 5D4YA 1WWCA 3BDYL 3VDCA 5D1XA 1HINL 1QSZA 4P3DB 3WQWA 3FN0H 5D93B 2R0KL 4LSPL 5IHSA 2E0PA 3FNDA 5EBWA