3GH7A

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with galnac
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
519
structure length
506
Chain Sequence
b'HHHHSSGLVPRGSHMATSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords beta-hexosaminidase
molecule tags Hydrolase
source organism Paenibacillus sp.
publication title Molecular cloning and crystal structural analysis of a novel beta-N-acetylhexosaminidase from Paenibacillus sp. TS12 capable of degrading glycosphingolipids
pubmed doi rcsb
total genus 194
structure length 506
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gh7A01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3gh7A02
3GNPA 1UUQA 4D72A 1UWRA 3WNMA 2DT0A 1MWOA 1KGUA 2E9BA 4X9YA 5I24A 4M29A 5CPQA 2GJRA 4M24A 1WKYA 4EKJA 1B0IA 1TVPA 5HXMA 1X1NA 3A47A 1E15A 2FGZA 3CHFA 3FW6A 4UFMA 5I6SA 3AIEA 4PUDA 2XM2A 1EDTA 1W9PA 2FDMA 1ZL1A 3VINA 3WBAA 5CSUA 1S46A 2X0YA 1CGXA 1GONA 2XFYA 1E4NA 3WF0A 4B3LA 2XG9A 1E3XA 4U31A 1C90A 5CPTA 2VZTA 2WYSA 1DHKA 4MJ4A 1BF2A 1JZ6A 1US2A 4B9YA 5ABHA 1V08A 1E0XA 3L2MA 4EK7A 3UERA 1UHVA 3VGBA 4B15A 3OG2A 2Q8XA 3WF4A 3A4XA 5F7UA 3RMEA 1PIGA 1UD8A 1U33A 1IZKA 3GBDA 3OGVA 2G3JA 4PTMA 1MW3A 4OOUA 4D6EA 1CPUA 1NOUA 1VRXA 3G6LA 5A6JA 1W2PA 4JFUA 1D2KA 4XX6A 5A8QA 2D1ZA 3VMNA 4UOQA 1W91A 3AIQA 1HN1A 3SCOA 5HBFA 4PUEA 3A6OA 1MFVA 1EH9A 3CHDA 3M6DA 2BVYA 4WSJA 1UKOA 4JCMA 2OSWA 4PBGA 5A95A 1O7AA 1XV8A 1B1YA 3WNOA 3WUGA 3CZLA 4LPCA 4F79A 2WHLA 2GJXA 3WQ8A 2WHMA 1WZAA 1PX4A 4UFLA 4L4PA 4AZCB 2VX7A 1UD6A 2WVVA 2OWWA 3WNKA 1RP9A 3O9NA 4UQEA 2YIHA 4AYSA 1W9VA 1LF1A 3RM8A 1B2YA 1H41A 2O92A 4GZIA 4CKQA 4UCFA 4NI3A 3PZMA 3AS3A 3WEOA 3UG5A 1KXQA 4YPJA 1ODUA 1WDSA 3DYOA 3ARQA 4HP5A 4DM1A 1B31A 1NP2A 2OYKA 2O9RA 4CCDA 4LXFA 3GBEA 4GQQA 1WZKA 2NT1A 5JBDA 2ZXBA 5BYWA 3WQ5A 5A2CA 1OD0A 1J18A 3I3BA 3ZQ9A 1KR0A 4LYRA 1UR4A 4A3HA 2EPMX 3OLEA 3IANA 2DH3A 1K9FA 1NWSA 5JUVA 1CXEA 3AS2A 2FH6A 1AQMA 1HL9A 2G3MA 1G9HA 2GK1B 2XVGA 4NRRA 4PCSA 4CUCA 2WC4A 4RL3A 2ZUWA 5FL1A 3MUZ1 1C7SA 1ZJBA 2RGLA 2XFRA 2EO7A 2UY4A 3W25A 1GVIA 3O6AA 4MAVA 1VEMA 4P7RA 1VBRA 2NSXA 4FK9A 1BLIA 3IAPA 4DWSA 3AIVA 5LA0A 3VIJA 4GKLA 4Y7EA 2WZEA 2XSBA 3PZQA 4BQ4A 4H8HA 4M8UA 4HZ6A 1DP0A 3TONA 3PZIA 1JAKA 1EHNA 1QOXA 2X1IA 5IXEA 3BLKA 2DSKA 2VCCA 1NARA 1GOKA 1JYWA 3T2QA 3CTTA 2BHUA 3ARTA 5C71A 1B3WA 2O9TA 2G4FA 3A4WA 3AQUA 1EHAA 1UR9A 1M53A 1FA2A 1WDRA 4U3CA 2CBUA 3EYPA 1BYBA 2GVYA 3BCDA 1HKKA 4ATLA 4EAMA 1R87A 3AIUA 4GI6A 2WMJA 2J7EA 1JFXA 4HA4A 3O2LA 1OGBA 4J3VA 4ACYA 1M01A 2E9LA 1L0PA 3WDQA 1QHOA 1GHSA 4H8UA 1E71M 2BY0A 3U7VA 4AD3A 4AZ5A 4UTFA 3UETA 1KCLA 1ISYA 4URIA 2J8FA 4CCCA 3AIWA 4E8DA 4D1IA 5CJ5A 1R85A 4BCEA 4Z2KA 1J0YA 2E8ZA 1ODZA 5CZKA 4KWUA 2CBJA 2ZICA 2YA2A 1NQ6A 1QI3A 2D23A 1PJ9A 5TD4A 1AMYA 1U30A 1H5VA 4U5IA 5A2BA 3W6LA 4DUWA 2XVNA 1WE5A 3ZJ7A 4J3WA 3U7BA 4L4OA 3VKKA 2VO5A 2ESCA 4PEEA 2FH8A 1C92A 5EBAA 1E6RA 1HIZA 1V02A 1E4IA 1FHLA 1VIWA 2WMFA 5BXPA 1HF6A 4FF5A 1UD4A 2DSVA 1M04A 1ZBVA 2D22A 1FH7A 4MNLA 1D7FA 3WQWA 4P7OA 1WZMA 5A6MA 4IPLA 4PMYA 1TUXA 5GNYA 3WN6A 1IT0A 2YDRA 4J28A 1XSJA 4BZYA 1G0CA 4U33A 1CIUA 4DWSC 3GXMA 3QGVA 4WLCA 2BY2A 5BCAA 3HN3A 1Q6DA 3GXFA 1HJSA 1PX8A 1C7TA 3AZRA 3SCRA 3BAYA 3AICA 1PAMA 4OZOA 1CGVA 5AYIA 1GNXA 1E1FA 2O9OA 3A4AA 1UR0A 3RILA 3CMGA 3QHMA 4W8AA 2DSZA 5ABGA 4CN1A 1QI2A 2HISA 1PEZA 3WH6A 1TG7A 5A6LA 3NSXA 2DH2A 3MV01 1QNSA 3T2OA 4CU7A 3N12A 1FH9A 4PTVA 1JL8A 2CBVA 2VCAA 4OOZA 2PBGA 1EDGA 2W62A 3CUFA 2UY2A 3RO8A 3SUUA 1UYQA 4UR9A 4AISA 4MB4A 3MUIA 1TVNA 2J25A 4MB3A 4J7RA 2JFEX 4M56A 2WHJA 4TTGA 2XTKA 2G3IA 4H7VA 4E2OA 5GPRA 1E0VA 3VGEA 4QLLA 4W8BA 3CPUA 1LQ0A 4P8WA 3AHVA 4MNJA 1B30A 3VGDA 3GH4A 3MV11 1VFUA 2UWFA 1VJSA 1BHGA 4WF7A 4A4AA 5E0CA 2WMGA 2JALA 4QCEA 1ZBCA 4HOZA 5ABFB 1RD6A 4PMOA 1M7XA 3MKKA 3GM8A 2QPSA 1SMAA 1UWTA 4B9ZA 2G3NA 2EPOA 2ZX5A 1JZ4A 1CXHA 4KGLA 2WWDA 4HU0A 3VIOA 2ZUTA 4MDOA 1GQJA 3WL1A 3WKZA 3F4VA 4BQ2A 1AQHA 4BS0A 4PSPA 1OB0A 1ZU8A 1JXKA 1WNOA 2Z1SA 2J4GA 4J3UA 3T0AA 3CZEA 3AJ7A 4OIFA 4ATWA 2WSKA 3VPLA 2PC8A 1HJVA 1UH3A 3UESA 4JIEA 1W2VA 2QHAA 1JAEA 4FLSA 1ISXA 2WK2A 1PX3A 3APGA 2EPNA 3BMVA 1TA3B 2CCRA 4MJ2A 3WMBA 5ABEA 2VCBA 1W9XA 4IUGA 2W92A 4UQDA 3N9KA 3DYMA 2ZUMA 1WP6A 3GZAA 2UY3A 2X0HA 1V6XA 3AYSA 2W4XA 2WCGA 1DWGM 2J7DA 5EFDA 2OWCA 4FLQA 2C8NA 3VD5A 5I2UA 2JE8A 4PMXA 1UWIA 3WD0A 3QOMA 2BXYA 3CUJA 1AVAA 1O6IA 2VURA 3DHPA 3E1F1 4TVCA 1QVBA 1QW9A 3NSNA 4PMNA 3PHAA 5A6AA 2OSXA 3PZOA 4UOJA 1B3VA 2WCAA 5D8WA 1YQ2A 3CBWA 5M03A 3M07A 4MB5A 2BHZA 2F61A 4TX8A 2ZOXA 3NSMA 5GQBA 3SUTA 4M81A 4B3KA 2Y24A 2XWDA 2OWXA 4AD2A 4D6CA 2C0HA 4Z2GA 1G01A 3KL5A 1M03A 4P8VA 5D9PA 1K6AA 2W63A 4TXEA 2WVSA 1DTUA 4KMQA 4AD1A 2ZUSA 1R7AA 4AZ6A 1HKJA 4HTYA 3WENA 3AIRA 4LQ1A 4QCFA 3K1DA 2AMGA 5HPOA 2JIWA 3BLPX 5I23A 1HNYA 5A8MA 3T0BA 2DGAA 3OGRA 3PTQA 4HMCA 3N13A 1W9DM 4W84A 4PMZA 4W88A 4D6HA 1JDDA 3CZJA 2J79A 1OSEA 3CHCA 1H11A 1MQPA 2J7GA 3WD1A 4FLRA 4DM2A 1LG2A 2WZIA 1WO2A 3WL0A 1CDGA 5CGMA 1NWUA 1QI0A 1W3JA 4JFTA 4AIUA 4Q7NA 5A3HA 4NF7A 4UFKA 4HMDA 3VVGA 1JZ7A 3K8LA 1CGUA 2VX6A 3BMWA 4CN4A 3IJ7A 1HVXA 3AYRA 1XGZA 5A6KA 3EMCA 3PTMA 4V2XA 3DC0A 1GCYA 3W81A 3AXHA 5HDRA 3L4ZA 5BRPA 2E0PA 2WAGA 3OZPA 3GNOA 1CLXA 2EEXA 3BAKA 3VNZA 1KWGA 5M3WA 3ZM8A 4MTVA 2VTFA 3QR3A 1OBAA 2DQXA 4MAZA 5AC4A 5CG0A 1GQKA 1BFNA 3BAXA 4NRSA 1JFHA 4HA3A 3GH7A 2VOTA 4H2CA 5E70A 3F5JA 3ZR6A 1DWJM 2J7BA 1EXPA 1E1EA 3KEHA 2G41A 3VX1A 4FLOA 1I1XA 3AMKA 1E40A 1VF8A 3QHNA 3L4YA 5CLWA 4S3KA 2A3EA 4RE3A 3WDHA 2B31A 2BY1A 3GH5A 3ARUA 4D6JA 3WQVA 3WQ6A 1Y7VA 1JYVA 1FH8A 1C93A 4A3YA 2VVNA 1Q6EA 2VZUA 1TZ7A 3OB8A 3SUVA 1IV8A 1NH6A 1BGAA 2WBKA 3N04A 1SMDA 5IDIA 5C8BB 2GSJA 1KFWA 2WPGA 4MNKA 4ZEPA 2F2HA 1W1YA 2GUYA 5EB8A 4OJYA 3PZVA 3ARPA 2PWFA 3WEMA 2WHKA 3SCPA 3SCSA 1E6ZA 2EPLX 4P7NA 4YHEA 4E4PA 5KEZA 1CBGA 4LYPA 5FIPA 5HNNA 1E4MM 1E6QM 1XCXA 2CYGA 1JIBA 1KQZA 5BRQA 4LGXA 3OIHA 3VIKA 3UR8A 4AY1A 1BYCA 2DPEA 2XHYA 2Y8VA 3S6TA 2JF7A 2YBUA 5FOOA 1V0MA 3RDKA 3KE0A 3WD4A 5DF0A 4UFHA 3VM7A 5LA2A 2WVUA 5FCZA 2V3GA 3WUFA 2ZX8A 2EXOA 2V5DA 4D6GA 1NWTA 4AZIA 3IJ9A 5HOSA 3SURA 1XD0A 1MYRA 2RGMA 3OLDA 3WNNA 5FD0A 2J8GA 3B9AA 1W1TA 4CVWA 1HJWA 1GVYA 4S3JA 2XVPA 2CEQA 2VZSA 4D6IA 3WBEA 1V03A 1EGZA 1V0LA 2YBTA 3GXDA 2J77A 1V02E 3SCVA 2V3FA 5AY7A 3M46A 1Q6FA 2WLZA 2OLHA 2XYLA 4TVDA 2CPUA 1ITXA 2V3EA 1W1VA 3HU7A 3CUHA 2BVDA 4JKLA 3GNRA 4XV0A 1EDQA 2ZIDA 3POHA 2WVVB 3MUAA 4D6FA 1EOMA 3VGHA 4K68A 2VI0A 2DIEA 2WZHA 3D3AA 3WDJA 3VD9A 3TTQA 3VX0A 1KXVA 1VEPA 2YLLA 1BG9A 5BXTA 4AXNA 1UKPA 4DUXA 1E73M 1UZ1A 1CNVA 1NOWA 2XJ7A 5A69A 2DSWA 4P7LA 1W3LA 1H1NA 3W82A 4X0NA 4IISA 1CLVA 4Z2IA 2FHBA 3W37A 5AYBA 4U2ZA 1GW1A 2WNWA 2AOSA 4WK9A 5BXRA 3WH7A 1JDCA 5LA1A 2HVMA 1CXKA 2BVTA 3WDIA 3SCTA 1JF6A 5I5RA 3WF1A 3FAWA 1ECEA 4DWSB 3EDJA 1VFMA 1OGGA 2O9PA 1ZBWA 5A6SA 5I3DA 4MNMA 1WPCA 5DO8A 2VZVA 4OKDA 5I77A 3W26A 1CXIA 1B90A 3W29A 1XRVA 1JG9A 2XGBA 4AMCA 5I79A 4WIWA 3THCA 1UD2A 1EO5A 2QLYA 2VX5A 5A6BA 1C8YA 1J0JA 4GZJA 1UWSA 3AMDA 5BXSA 1QNOA 5DT7A 1KCKA 1UQZA 4BF7A 4PMRA 5CQ1A 1E0WA 3AMCA 4C7DA 2EPKX 1US3A 3CO4A 1CEOA 3BXWA 2FGLA 2DT3A 2PF0A 3L4VA 2WMIB 4XZBA 3AHYA 3WD3A 1B3YA 1QI4A 4JKMA 1TE1A 2D0FA 2WXDM 2FHFA 3DYPA 3ZSTA 2VQUA 3UEQA 4EE9A 2BNJA 1K9EA 1E72M 1OIMA 3LPFA 2E40A 3EDKA 3PZNA 2WC3A 5M17A 3F5KA 4KH2A 1BGGA 4GQRA 4GZEA 3POCA 4AZCA 4PSRA 4W5UA 4B16A 5CGTA 1CGWA 1FP9A 3FNDA 1DWFM 1WDPA 2XVKA 1UWUA 2W66A 2OSYA 4EANA 1ITCA 2C7FA 3DHUA 2ZXAA 1PZ3A 1R86A 1UR8A 5E0FA 2WWCA 3RPMA 2E9MA 5IHSA 2YL5A 1NWRA 4X0VA 5JBEA 2CBIA 3JUGA 4AZGA 4QLJA 5KZ6A 4H8VA 3AS0A 1KGWA 3WFLA 3ARYA 4ACZB 4JHZA 4N42A 1Q6CA 2CIPA 3VUPA 1V0KA 1PZ2A 1BVZA 3UCQA 3MSGA 3VDCA 2FHCA 1E6PA 3GXIA 3VMPA 1X6LA 1VAHA 3CZKA 5D8ZA 1ZBKA 1LJYA 4C7FA 2J7CA 2XWEA 1GQLA 2XVLA 3CH9A 2ZX7A 3W28A 3K8MA 5BWFA 2D3NA 4AC1X 1HP5A 3LMYA 2JEQA 2YL8A 3SEPA 2VR4A 1OINA 4PYSA 3EMQA 4JL2A 1HKMA 3ARWA 2D0HA 3T08A 2Y2WA 1H0GA 3TTYA 1J11A 1UKTA 1W9BM 1TA3A 5CXPA 1LLOA 3EDFA 1RP8A 1KB3A 4N0RA 3VGFA 4UQ9A 1ISWA 2X8RA 4AEEA 3VGGA 1PBGA 3VDAA 2YLAA 1MQRA 2ZUNA 4ZXLA 2QV4A 4P8XA 2QMJA 3AS1A 5A8OA 4C91A 3WDPP 4JZ5A 1J9YA 1H3GA 2VUYA 1VEOA 3WF2A 3RIKA 5DT5A 1GOWA 2E8YA 1P6WA 1CXLA 1EQPA 2JEPA 2GFTA 4ML4A 1CWYA 3FY1A 3L4WA 1LWHA 5ABFA 1MFUA 1QNPA 3BAWA 3W24A 1BSIA 1NM9A 4HPHA 3WF3A 3CHEA 3DECA 3VIMA 4WSKA 3EBVA 4TTUA 3NUKA 1NP0A 1QHZA 4CD8A 1J12A 1SYTA 1XYZA 5GNZA 2QMKA 3MMWA 4KRTA 3N17A 4Z2LA 2VQTA 1XSKA 4PMQA 4CU8A 1OM0A 1H49A 1K9DA 5D9NA 5HPCA 4CD5A 2X09A 1VFFA 4AZHA 1IZJA 2CKRA 2WKLA 3VTRA 4HA1A 1E43A 1NOFA 4HOXA 2A3BA 3NYDA 1LL7A 3OGSA 1UKSA 3PN8A 2V5CA 5FKYA 1EQCA 2VRJA 4U2YA 4F66A 2J78A 1CYGA 3W27A 3SUSA 3ZOAA 4LYQA 1D3CA 5A6BD 4GO9A 4YHGA 1V6WA 4H41A 4RE4A 2CITA 3K8KA 3NIYA 2BV9A 1C3FA 2Y8KA 3T2PA 3TTSA 2VNCA 4F9JA 1V6VA 2CNCA 3BH4A 4UQBA 1UD3A 2A3CA 3N11A 1HKIA 3WDRA 1CGYA 1OWQA 3I3DA 3SCQA 4RE2A 4ZFMA 1OIFA 1Q4NX 3ZR5A 2WANA 4ZENA 3AMGA 2ZUUA 3SCUA 4TX6A 3GTNA 1OGSA 3L2LA 4QAWA 3ZJ6A 3IK2A 1LL6A 1N82A 1EIBA 4OBSA 3AXXA 2V3DA 3VM5A 4W89A 3G6MA 4WKFA 1VENA 1GHRA 3M7SA 3NJ3A 2XFFA 1GZJA 1KQYA 1V6YA 2ZWZA 3FXYA 4ZE4A 2J75A 4HMEA 5IHRA 3PZ9A 4GO8A 1H2JA 1BG4A 2BFGA 2QPUA 2XSAA 2G8ZA 5EMYA 3SCWA 2D20A 1KXHA 3WH8A 2WSPA 4Q22A 1GOQA 3OA5A 1OD8A 1EA9C 1UR1A 1ZJAA 3IAQA 3WQ4A 4HPGA 1FP8A 2VL4A 6CGTA 3SUWA 4JFVA 3AIBA 5JIPA 4CGTA 4H04A 1H09A 2YA1A 1CGTA 1XSIA 4W93A 3ARXA 3UG3A 4Z2HA 2Y4SA 2IXVA 4UZUA 1BAGA 3S2CA 3UG4A 1DWAM 2VR5A 1LG1A 2D2OA 3WMCA 4GI9A 4W8LA 5BROA 3THDA 4DWSD 4M82A 3VILA 5M5DA 1Q6GA 3ARRA 4M80A 2PWGA 3U5UA 2YJQA 3TA9A 4W5ZA 4D6DA 1FOBA 5D4YA 1GJWA 1KXTA 1ZS2A 3KL3A 4PCTA 5A1AA 3CIVA 2VC9A 2VMFA 3EDEA 4NZCA 2V38A 1VFOA 3MUY1 4PMDA 3VIHA 3AHZA 5E6YA 1E9LA 1LWJA 3CMJA 3UR7A 1XC6A 4CVUA 4JAWA 2XIBA 3MS8A 1V6UA 4V28A 3ARSA 3WUEA 1DWIM 3B9DA 1OT1A 1W1PA 1WCGA 2W91A 4HZ7A 1QPKA 1V3IA 4QDMA 1J0ZA 1AQ0A 1UG6A 1ISVA 3L4XA 1UD5A 3WNLA 1VJZA 3I3EA 4AEFA 3AFBA 1JDAA 4ZXOA 2E3ZA 5CPSA 1W9UA 2WVTA 4M1RA 2PBOA 7TAAA 7A3HA 3TTOA 2ZWYA 4TUFA 1E6XM 5FL0A 1MXDA 1QI5A 4BQ5A 2XIIA 3EDDA 3L4UA 3OLGA 3VDBA 2J7HA 1G5AA 2ZE0A 1GOOA 1CXFA 4PRWA 4R5EA 1UH4A 4UNIA 2DIJA 4W86A 1E5JA 1R8LA 3K4DA 2XM1A 1CECA 1SFSA 4J3TA 4J27A 2WKGA 1BTCA 2WBGA 2WMIA 4WKHA 1XH2A 3NCOA 1GPFA 3ARZA 5AC5A 1ZB5A 3PTKA 2X05A 4JCLA 5IFTA 2EJ1A 2DT1A 3MMDA 1E6NA 3F5LA 1B9ZA 1L8NA 1JZ8A 1G94A 4AD4A 3B8SA 3CZGA 2CERA 2Z1KA 4AIOA 3MANA 1GOMA 1HT6A 3IJ8A 6TAAA 3AHTA 4UFJA 1TCMA 2YA0A 2GJXB 1B3XA 3VD3A 1RH9A 4UOZA 1BQCA 2A3HA 1V3MA 1E3ZA 2ZX9A 1KGXA 3U5YA 3VU2A 1A47A 2JIEA 1V3JA 1HJQA 3KWXA 4LX4A 1E56A 5GNXA 1DWHM 1MVYA 3LPGA 3EMZA 2IXUA 2CESA 1KWKA 4U5KA 3AMLA 3KL0A 1J10A 2W61A 1XD1A 3GDBA 4MDPA 8A3HA 1HX0A 3WELA 4PTXA 1JYXA 1SR0A 1MQQA 5EFFA 3OZOA 1J0KA 3MSDA 3WIJA 2VRKA 4JHOA 1TR1A 3RM9A 3J7HA 2DSUA 2WMKA 2Y5EA 3D5HA 4ACZA 4UQCA 3FHQA 3CGTA 2XGIA 3VOCA 2CXGA 3PZTA 2D24A 4D71A 1JI2A 1MW1A 2D0GA 1EO7A 1MXGA 3ARVA 2MANA 1R7OA 1ESWA 3N18A 3ZO9A 3W53A 4FMVA 5CLTA 3HMCA 2WMHA 1K9TA 5A94A 2WLYA 1HVQA 1DEDA 2F8QA 3AHXA 4QFUA 1JZ2A 2J62A 2TAAA 1TMQA 5D9MA 5A8NA 4XZWA 4QP0A 3WMSA 1H0IA 2YL9A 4PN2A 3RM4A 4CN6A 4BA0A 3SCNA 3ZIZA 2IUZA 3CUIA 4J3SA 4QLKA 1VB9A 3WEZA 3RJXA 1XHGA 3NDYA 4UZSA 4PMVA 2ZX6A 1KBKA 5LYRA 1HXJA 3AZTA 3KZSA 3VIGA 5I0DA 1HP4A 1UWQA 4GXPA 2EBNA 2PI6A 2YDQA 3CZ8A 4IM4A 4AWEA 4CD4A 3BSHA 1W3HA 1UA7A 1VBUA 4AZ7A 1W3KA 4ZE5A 2PB1A 3ECQA 3CUGA 2WW5A 1MW2A 2VVSA 1KBBA 2CHOA 3W0KA 1TFVA 2YKKA 3CLWA 3WY1A 4W7VA 1QBAA 1WDQA 3PZGA 2XPKA 4W7WA 1E70M 5CSYA 1E6SM 3VNYA 3OBAA 4D1JA 3BCFA 3U57A 3LPOA 3T09A 1LL4A 4MB1A 1EOKA 1GQIA 2ZXDA 1UR2A 2WCSA 5JBFA 1JI1A 2VZOA 4AD5A 2OYMA 3BAIA 4IPNB 3AROA 4W7UA 4YN5A 5DEZA 1E4LA 1GOIA 1GJUA 1KR1A 3RJYA 3VIFA 1G1YA 3MO4A 6A3HA 3LPPA 3W38A 1CTNA 1XYFA 3L4TA 2ZUVA 1Z32X 4JFWA 4KRUA 1QNQA 1GUVA 1E55A 1JGIA 3ZMRA 4UQAA 4JKKA 4OUEA 1FHDA 4W87A 5E09A 2VT0A 3SIMA 4C7GA 5D9OA 5DFAA 1F4HA 2J7FA 3MMUA 2XUCA 4ATDA 5DMYA 4P8UA 4OBRA 2BY3A 2YDSA 3PZUA 1PPIA 5A8PA 4JFSA 3TP4A 2DT2A 1BYAA 4J3XA 1W32A 1HL8A 2D3LA 2VRQA 4PMUA 2X2YA 1JZ3A 2W5FA 1V0NA 2WC7A 3FAXA 2PWDA 5I78A 2NT0A 2CHNA 4F9DA 4TOQA 4PTWA 2PWEA 3PBGA 1WZLA 2BXZA 2J47A 3AOFA 1XH1A 1JD9A 1WB0A 4GINA 3WFZA 3AISA 3II1A 2J74A 3RCNA 4C90A 4DUVA 2QF8A 3VMOA 3NDZA 3FHAA 3VDHA 1U2YA 1V3HA 1JNEA 4AW7A 2NW0A 1OT2A 4CD6A 4R27A 3AXIA 4U3AA 1GORA 1JZ5A 1BPLB 3MU7A 4AZBA 3VD7A 4UFIA 3ALGA 4HOWA 3WD2A 2BS9A 3ZJ8A 4CD7A 4Z2JA 4AD0A 5A2AA 1I75A 3FN9A 3HJEA 2YL6A 3K4AA 4CU6A 3VO0A 3BAJA 3WNPA 1CZ1A 4MADA 1UA3A 3QOKA 3A3HA 4HU8A 5JIWA 1E5NA 4TVUA 1JNDA 3VD4A 4GIAA 3VIIA 3BSGA 3VIPA 1MW0A 3W4RA 3B9EA 3BGAA 9CGTA 2GJPA 2DDXA 1FFQA 3AZSA 5E6ZA 4CCEA 1XCWA 1QW8A 2AAAA 8CGTA 5C70A 2VJXA 4XB3A 2CETA 2ZXQA 3N15A 3ZT5A 4GPNA 4P7QA 2A3AA 5IFPA 1OCQA 1C91A 1WAWA 5ECUA 4F8XA 1J0IA 1UH2A 3ZSSA 4AIEA 1CENA 1BVNP 3W6MA 1J0HA 3ZJKA 1HJXA 4E8CA 1V3KA 4W85A 3AI0A 1H4PA 4MPKA 3K46A 1F4AA 2JF6A 2CKSA 2UY5A 1X6NA 1C8QA 1A3HA 2BHYA 1V3LA 2YOCA 2DEPA 2GDUA 3ALFA 3TOPA 3WH5A 2OYLA 1QHPA 3QHOA 4JL1A 1UZ4A 2WM0A 3WUBA 4HZ8A 1C8XA 4XUYA 3OLIA 1BYDA 4NSBA 5E9AA 2EQDA 1B3ZA 1RPKA 1QBBA 3WH9A 2GDVA 3T0DA 3N1AA 1UOKA 7CGTA 2W67A 1UKQA 1XH0A 1JD7A 1QNRA 2VX4A 1JXJA 3WSUA 4BQ3A 3ZT6A 1YHTA 1UQYA 2GK1A 2PWHA 1PIFA 3BC9A 1ISZA 4V27A 2E4TA 1JF5A 1HJUA 4WKAA 4KGJA 2WB5A 1J01A 4WJXA 1FFRA 3ZT7A 1I1WA 3GYCA 4GI8A 1JYNA
chains in the Genus database with same CATH superfamily
3DBNA 3M0KA 2NV1A 3IWPA 2C1HA 3O8AA 1MWOA 1KGUA 3MWAA 5I24A 3S6OA 1SSGA 4B92A 3G8RA 3MYPA 4EKJA 4C6MA 3A47A 2WSYA 2ZE3A 1GVSA 3TZNA 2ZRYA 3M44A 4PUDA 2XM2A 1EDTA 4WJ8A 1W9PA 3TU9A 1P6BA 1ITUA 3RYSA 4V15A 3KZPA 4IP7A 2WYSA 4C1LA 4MJ4A 4R9OA 2XFWA 3MKVA 3V1HA 1E0XA 3L2MA 3W6YA 2R1MA 3QFEA 3DAQA 1ZGDA 3I6EA 3KS5A 1VCGA 4WDUA 4LCQA 1A0EA 1UD8A 3VKAA 1G7VA 4PTMA 3IRSA 4KRZA 1SW0A 3DI0A 3W7NA 5A8QA 3VMNA 1YXDA 3D46A 4MGGA 1MFVA 1V8EA 3CHDA 4WSJA 1UKOA 2OSWA 4FNPA 3FCPA 3HV9A 5FSDC 3NQ6A 5AYZA 4ZOEA 2ZADA 4FF7A 1AD1A 1B9BA 2WHLA 3I4KA 2GJXA 2QF7A 1PX4A 3EGJA 4L4PA 1WXZA 4DELA 2QCEA 5EMKA 1TV4A 2OWWA 1RP9A 3O9NA 2YIHA 3RM8A 2O92A 3LCHA 3H2EA 4RXGA 4DI9A 1ODUA 2NWSA 3PPFA 1UUOA 3V4BA 3ARQA 4HP5A 4DM1A 1B31A 1MUMA 4WRHA 2CC0A 2CZVA 4LXFA 1S2UA 4GQQA 4F0RA 4XKMA 1WZKA 5JBDA 2ZXBA 3H2CA 5BYWA 2PD5A 2W3ZA 2Y63A 1NQKA 1KR0A 1D3HA 4S3EA 1G4TA 1I8JA 3IGUA 3IANA 3FV9A 5JUVA 3KW3A 5G2WA 3LU2A 1HL9A 1G9HA 1KTNA 2GK1B 2XVGA 4MYXA 2WC4A 1WOAA 4RL3A 2ZUWA 1UB3A 2RGLA 2UY4A 4JTGA 5HNUA 1TR9A 3IAPA 1XCFA 1XYCA 3AIVA 3LG3A 2E67A 2NXGA 4GKLA 4Y7EA 3C3NA 2XSBA 4LV9A 4BQ4A 3TZFA 4H8HA 1ZQ5A 1QPRA 1D7KA 3PZIA 3GW0A 1Y5WA 3GHSA 4S3FA 4ZQRA 1RY8A 1S2AA 3PUGA 3C2VA 5C71A 4O1FA 2G4FA 3A4WA 4NXSA 5LNRA 1M53A 1FA2A 4U3CA 2CBUA 1F73A 1BYBA 5REQA 3URAA 1PTDA 3GVQA 3E2QA 1AZ2A 1HKKA 4ATLA 4I9JA 4EAMA 3KWSA 3QKEA 4GI6A 1OX4B 1JFXA 3FYYA 5TBOA 3S2JA 4HA4A 1OG0A 1R38A 2Z6IA 3SR7A 3N3MA 4OU1A 5K9CA 3WDQA 4O1EA 3LXBA 3U4FA 4AD3A 4UTFA 1DXEA 1KCLA 3S1XA 1PDYA 1RY0A 3HQOA 1GJPA 2E8ZA 3QW4B 1UMYA 4U28A 4KWUA 1M7JA 1KM5A 1SUXA 4LYKA 1QI3A 1JRCA 2HEJA 1AW2A 5T8GA 4L4MA 1H5VA 3WLSA 1S3TC 1JCMP 4PH6A 1WE5A 3FDKA 2B7PA 2VO5A 2FH8A 4C6EA 3ATZA 2JGYA 1HQTA 1RLDA 4XBJA 1VIWA 3B40A 4XD4A 5BXPA 1HF6A 5XIMA 3RO6A 2DSVA 3HQPA 3UWEA 3L2IA 5A6MA 4B91A 1OADA 3DI1A 2YDRA 2QUVA 3SY1A 1XSJA 3RXZA 1B3OA 4U33A 4MKNA 2ZZ6A 1BXBA 4H9UA 3SQLA 9RUBA 1WYIA 4HU3A 3GXFA 4M19A 1LOLA 3C56A 4Y9NA 4PUKA 1CGVA 3VNJA 1GNXA 2YBVA 3T42A 3LBMA 4ILSA 3RILA 1XGEA 5FF4A 4CN1A 3N4EA 1QI2A 1P1MA 1PEZA 3WH6A 3T07A 3NSXA 3UY8A 1C9DA 1FWFC 1R3VA 1QNSA 4PRTA 2R8WA 4PTVA 1JL8A 1FCBA 1RPXA 1Z3NA 1EDGA 2W62A 3H70A 3N6JA 2FVKA 2PEVA 1T99A 1P0NA 3TEVA 1SJCA 4M56A 2WHJA 4H7VA 3JRKA 3QY7A 4REQA 1O5KA 3EKGA 3CMFA 4HK7A 5D03A 3W7HA 4J9JA 4K2SA 2V0TA 1XYBA 2WZTA 3A3XA 1IIGA 1Q4WA 3USZA 3DFPA 1VFUA 1SFTA 3IGSA 4WF7A 1V4YA 2WMGA 1YPIA 1TMLA 1M7XA 2Z29A 3GM8A 1A50A 1UWTA 3ICJA 3R13A 4LCRA 2EPOA 4XZHA 4QE1A 1ZAIA 1CXHA 1ONWA 2ZUTA 2Z4GA 3F4VA 3F1QA 4BQ2A 1AQHA 4XZ9A 1Q6QA 3OOQA 3PBYA 5F2LA 4DNMA 3O16A 4TV5A 4LEQA 1HJVA 1XBVA 1W2VA 3W7RA 3TMQA 4PGLA 3KBWA 4IX2A 3I10A 3W73A 4EX4A 1O68A 3MDUA 4DZAA 1TJ0A 1TPH1 3GZAA 4L6HA 1V6XA 4PL2A 4LY4A 3QM3A 2F9RA 2YXGA 3ZYZA 4NJKA 5C7VA 4A8LA 1A5NC 3EOOA 5D37A 3NQEA 4S39A 2BXYA 1L6FA 3E1F1 3KAOA 2PE4A 2VFDA 3NL2A 3TK7A 5A6AA 1VYRA 1JUKA 3DFYA 1VR6A 3M5XA 3W1UA 2OELA 5FACA 4LALA 3GWQA 2W0UA 5I02A 3IRDA 3RU8X 2MUCA 5DRCA 1YQ2A 4G5DA 2QT3A 4MB5A 3W1TA 2BHZA 4TX8A 4GZ7A 3NSMA 3ITGA 3B8WA 3SUTA 3TV8A 4XBKA 4GISA 3O06A 2XWDA 1M03A 4TXEA 4MUPA 2WVSA 1DTUA 4KMQA 1R7AA 4RDYA 3WENA 2I9UA 1IEQA 4H83A 2R82A 3KHJA 3BLPX 3DG7A 2DGAA 2XH7A 3VCCA 1W9DM 5A5WA 4H9VA 4UTTC 4D6HA 1JDDA 5C7HA 5HQMA 4K36A 4LB4A 2TRSA 2FKPA 3RK8A 4N9DA 2I5QA 3KM8A 3MUCA 1FRBA 1WO2A 4Q3MA 5D05A 1IQ8A 4PB3A 2XIOA 4MSSA 5CGMA 1W3JA 4JFTA 4AIUA 4Q7NA 2G50A 3GYEA 3DBPA 3GHUA 3UXIA 3P14A 4UFKA 5I06A 4HMDA 3MP3A 2Z00A 4AWSA 4CN4A 3OIXA 4ES4A 1HVXA 5FF0A 5AVHA 4FP1A 1GCYA 6XIAA 3BG5A 4BF9A 2VTFA 4IP4A 2ASHA 4RZ6A 3L5AA 5LHFA 1JFHA 1M3UA 2QCDB 1TPC1 4H2CA 5E70A 2UV8G 3ZR6A 1AJ0A 1T8XA 2QNEA 3GW3A 4JYDA 2ZA2A 5KITA 2Z28A 3UXKA 1TMHA 3AMKA 2P0IA 5G1TA 3EWCA 4XK2A 1GVOA 1SZRA 1D8CA 2BY1A 3E0VA 2PGFA 3GH5A 3TC6A 4K39A 4WXZA 2NVAA 3B97A 4A3YA 2VZUA 2PGWA 1NH6A 5E5CA 3NOEA 1SO5A 1BGAA 1XIIA 3E5BA 3FA5A 5C8BB 2GSJA 4EP8C 3MY9A 2WPGA 1XLGA 3VXGA 4H6EA 3V75A 1H5YA 5CAKA 4UTWC 2WHKA 3V35A 1E6ZA 2EPLX 4P7NA 4E4PA 4ZQNA 3RHGA 4U10A 1YDNA 3R11A 1JIBA 3M43A 2GOUA 1KQZA 5BRQA 4LGXA 3ONCA 4AY1A 1X97A 2DPEA 1R3QA 1MUCA 4FX6M 5EMJA 3HB9A 3P74A 3W7PA 3S6TA 2ZDSA 4HKPA 4DF0A 1K8XA 1KFCA 3B06A 5JMUA 3AUOA 5LA2A 1EIXA 5FCZA 3WUFA 3CYVA 1YYAA 4Y8EA 2V5DA 3GE7A 5E1QA 5CBJA 1XD0A 1TWWA 4JN6A 2J8GA 1W1TA 3EX1A 2DZXA 1XRTA 4S3JA 2XVPA 5FEXA 3A23A 4D6IA 3WBEA 3EXTA 1V03A 3CEPA 1V0LA 3N2TA 3GXDA 1N8WA 3A64A 2L5HA 2DVXA 3HU7A 4LAOA 3NG3A 3LY0A 2BVDA 2Y85A 3R0UA 2GGJA 2ZIDA 9XIMA 3STGA 2WNNA 3NM1A 4IUOA 3MHGA 2WZHA 5AECA 3D3AA 3IV8A 3SN1A 5EU9A 5FESA 1PE1A 2VGGA 5HA7A 1O60A 5C55A 4IL2A 3S0CA 4G2DA 3COTA 3WJYA 3OHMB 3NQCA 1MXSA 1UKPA 1V51A 4LAKA 1UZ1A 2PRLA 1CNVA 2QVNA 2DSWA 1H1NA 3BLFA 1REQA 4JY8A 3QYQA 4RNFA 4Z2IA 3OHIA 2FHBA 3RF9A 5AYBA 4JQ2A 4BY3A 4WK9A 2WNZA 3VI2A 3WH7A 5LA1A 2HVMA 4XD3A 1CXKA 3WLMA 2C71A 3VAVA 1JF6A 3V18A 3VOHA 2A79A 3W7CA 5I5RA 4TMBA 4HQVA 1J8VA 5HJXA 2G4JA 3KRSA 3W22A 1VFMA 3FA3A 1UIOA 3WQPA 2QR6A 3AYTA 1V7AA 1KBIA 4FNSA 3GNDA 1TSIA 1EJVC 1CXIA 1MMFA 3W2MA 3W29A 5FA5A 1RBLA 1NAL1 2BP1A 5I79A 4P02B 3THCA 1OCJA 1RHCA 1DORA 6XIMA 3L5LA 1F2JA 2NZLA 2A3LA 3TN5A 2ANUA 2BVWA 3W7MA 2ZTKA 1QNOA 3JU2A 1UQZA 4PUUA 4BF7A 1E0WA 3AMCA 3LGEA 2EPKX 3BOXA 1ALDA 4LW7A 2FTWA 4JKMA 2WXDM 3K2GA 3ZSTA 4JY9A 3UEQA 2BNJA 3C0LA 3E96A 5MKGA 1UROA 1OIMA 4B5TA 3I65A 3EB2A 4HSHA 5H91A 3W87A 2VP8A 3F5KA 1AL7A 5DN1A 5DELA 4XO7A 4B16A 3UP8A 4C5YA 5CGTA 1FP9A 3FNDA 2DUXA 1DIDA 2XVKA 3UJFA 5GJPA 2CLOA 3Q65A 5E0FA 4NZJA 3RPMA 2XINA 4IIBA 2YL5A 5I3FA 2IQ0A 4HNOA 3MI3A 5DCEA 3VKCA 2F6UA 2CIPA 2HE8A 3B4UA 3VDCA 3RGTA 4ZR8A 1E6PA 1X6LA 1QWGA 1G6CA 3QH2A 4B5UA 4XO6A 1ZUAX 3CM4A 2G95A 4C7FA 3LHZA 5CJMA 3CH9A 2ZZ1A 3ORWA 5D33A 1BQGA 3K5XA 4QXIA 3HFYA 4ZO8A 1VC4A 1CB2A 4NZ1A 3G0XA 2C6QA 3WLNA 1ONEA 4JL2A 1HKMA 3ARWA 4NP7A 4KIEA 1J11A 5CXPA 1RP8A 2ZRZA 1KB3A 3VGFA 3EX6A 2YGYA 1XDMA 1ISWA 3NTYA 2X1UA 4L4LA 2HNHA 5G2HA 1GTHA 1N55A 2QV4A 3EWWA 5B7YA 3V16A 3AS1A 3E9AA 1R30A 3HFTA 4C91A 2BBFA 3GZ3A 3WDPP 3PUDA 2VUYA 4YMZA 1VEOA 5DT5A 1GOWA 4R88A 2R94A 3H2OA 1CXLA 2JEPA 4DAFA 3SQSA 3S5ZA 3CPGA 4XVDA 2GGGA 4A21A 4MUZA 4DYKA 5MF5A 4BF5A 1LWHA 1MFUA 1QNPA 3W24A 1XR2A 1BKSA 4PUMA 2F6XA 2X42A 3WF3A 1T5AA 4C6OA 2FZMA 4WSKA 4IIFA 5FJPA 3G1XA 3EBVA 4KS0A 1NP0A 3NUKA 3VFCA 2QMKA 4YVVA 1P7TA 4KRTA 4Z2LA 5F1VA 4JIHA 1B57A 5EPDA 4JOMA 4PMQA 1J93A 4JTJA 4K8GA 5CZTA 5D9NA 3N2XA 2X09A 4YTTA 1TO3A 5FF3A 3KBSA 4PFHA 3L5MA 4RDZA 3GR4A 2GQ8A 3H2NA 1FWHC 3CASA 2VRJA 4F66A 3O0FA 2QW5A 1T8QA 4TX9A 5KZMA 4JTKA 3GDTA 5LGZA 3AO0A 4GO9A 3RCYA 3H2MA 1FWDC 3W1PA 3BO9A 2QUTA 2YZ5A 2FZNA 1MO0A 3NIYA 2Y8KA 4HK6A 4G56A 2OFJA 2VNCA 4JTUA 5I09A 2R91A 4S38A 3N34A 3AU2A 3QV7A 3F4CA 3LA4A 3SCQA 4ZFMA 4HYRA 3QGKC 4JEQA 2WANA 1B4EA 4ZENA 2OLSA 1ZJIA 4ZZ9A 3GTXA 3QEZA 3ZJ6A 3LYEA 1A5SA 1TJPA 2EG8A 4OBSA 4KCTA 4QJ4B 4JTDA 3ES7A 4DO7A 3S1GA 4KQNA 1XINA 3WK3A 4N6EA 1NF7A 2GZXA 4XZLX 3ABXA 2XFFA 1GZJA 2GSHA 1V6YA 1W6TA 4HMEA 4GO8A 3DXIA 3VFLA 3UNTA 1Q5MA 3R4IA 2BFGA 2QPUA 2G8ZA 3ZWSA 3LNMA 3R2GA 3SCWA 3IVUA 3GAYA 1UR1A 3WQ4A 4HPGA 6CGTA 3GDMA 4RDVA 3SY8A 3I7QA 2QCMA 5JIPA 4CGTA 2EPHA 1JCXA 1H09A 1ONXA 2YFOA 4G7FA 4ZA0A 3L65A 2GDQA 4LANA 3I68A 2EG6A 4Q8NA 3QPYA 1KM4A 3UWYA 3UG4A 1DWAM 2NVDA 4M82A 4GYFA 3ARRA 3W1AA 4XWUA 2ZYFA 2YXXA 4AQLA 2A2IA 3TA9A 4US5A 1FOBA 2OU4A 4RK8A 4ZQCA 1PV8A 2VC6A 5D4YA 3KL3A 1ZS2A 3TR2A 4PCTA 4XTDA 1Q6OA 2VC9A 2VMFA 1M41A 1UJPA 5EBUA 1D9EA 2V38A 3V3WA 4PMDA 3VIHA 1OYCA 3UR7A 3U9IA 3MP5A 3MS8A 3ARSA 2H8ZA 4RLIA 2PDHA 2C1IA 1WCGA 3CWHA 1FDJA 3O05A 1QPKA 3QJAA 4UTIA 1Q6RA 4GIEA 1VBGA 1FWEC 4CQ9A 4WGXA 3L4XA 1F61A 4H3DA 3BURA 2XSXA 4QEHA 1FKWA 3IPWA 1YNYA 3R8GA 4ZCWA 1GKRA 2PBOA 4O12A 3TTOA 3BLDA 2RHGA 4BQ5A 2XIIA 1HFBA 3CUXA 5CZSA 2ZE0A 1TWSA 3WQOA 2OEKA 4JQ1A 1JPDX 4Q4QA 1GOOA 3DFOA 3LTSA 4Q4PA 3UXDA 2QQ6A 1LOQA 1QXLA 2DIJA 4Y2WA 3TJXA 3A3WA 2Z1XA 1SFSA 4J27A 1BXCA 2WKGA 3OBKA 2GQ3A 1HO4A 5AVNA 1XBXA 1W1IE 1ZB5A 2X05A 4MLRA 2EJ1A 3CXOA 4BKNA 1DPMA 4HJFA 1NDYA 3F5LA 4H6RA 1JZ8A 4PFMA 4HNUA 4HMNA 2CERA 5CJNA 1HZYA 4O53A 1GOMA 6TAAA 4H9ZA 2YA0A 2PDIA 1I4NA 2A3HA 5LKYA 3G5EA 1E3ZA 4NY2A 1QTWA 4MWAE 2A0NA 1A47A 3S1WA 2RDWA 3KWXA 3WLHA 4Q7IA 1DWHM 1MVYA 2FJUB 4JEJA 4O17A 3HO8A 2IXUA 1WXJA 4ERAA 1KWKA 4HK5A 3AMLA 2PWVA 3KCJA 3KL0A 3VNLA 1W0MA 2Z6JA 4ZO6A 4MDPA 8A3HA 3WELA 4JIRA 5C9RA 3THAA 5EFFA 3KFTA 1NVMA 5CC5A 2Y7GA 1OCNA 4JHOA 2HBVA 4UQCA 5IBXC 3CGTA 2XGIA 1IR2A 4HYWA 3S5OA 3PZTA 3H7RA 5TIMA 1AG1O 2D24A 2QDGA 4DJFD 4D71A 1JI2A 4IIHA 1I60A 4HJWA 3E02A 3G1YA 3G0SA 5C54A 2VDGA 3W53A 1XYLA 3I6TA 3MCNA 1HVQA 1DEDA 1RQBA 3LM7A 1BWLA 1EJSC 2R24A 2TAAA 5D9MA 5A8NA 4XZWA 1H0IA 4PN2A 4CN6A 4J40A 4Y9OA 1TV5A 1RLCL 3H26A 2EAWA 4C6JA 4JHMA 4JTEA 2Z24A 2IKJA 1R0MA 3RJXA 2Y61A 3NDYA 3TROA 3Q94A 2ZX6A 1KBKA 1KM3A 1HP4A 4EWJA 3E6EA 5AN7A 1A4LA 3CU2A 1UA7A 3PBVA 4AZ7A 1A3XA 1MW2A 1KBBA 2CHOA 3BPWA 3UWQA 2YKKA 4W7VA 3FYOA 1I2PA 2RH9A 1FHUA 1WDQA 4XAFA 4Q4SA 2XPKA 3BJFA 4DVOA 4AX7A 3PUOA 2YCLA 5IM51 3OBAA 4QG6A 3U57A 2PRMA 3UNDA 1OX6A 5HWNA 5JBFA 1JI1A 2FZDA 1FVPA 2PGEA 4UMAA 4AD5A 4W7UA 4YN5A 2VWSA 4PR4A 5DEZA 1Z6KA 1G1YA 3EPMA 4Q8VA 5ENLA 1XYFA 3Q45A 3HMJG 4K37A 1Z32X 1S39A 4DYEA 4KRUA 3UGVA 1GUVA 2IMRA 2NX3A 3G22A 4W87A 1DJGA 1POKA 2VT0A 3SIMA 3TNOA 4A8IA 5DFAA 2XUCA 3IJLA 5DMYA 5M1TA 3LENA 4OBRA 2DQWA 5ABTA 2BY3A 3F4DA 1K4HA 1BYAA 1W32A 4ZQOA 4HPNA 3CIXA 2WV8A 4TMCA 2VRQA 2X2YA 3HZ3A 3LCFA 3FAXA 3HTWA 5I78A 3W7IA 3W1NA 1P0DA 4PTWA 4PZVA 2DJXA 4GYPC 1XH1A 1XG4A 1JD9A 1WB0A 4LU0A 4Z1CA 3AISA 4KFNA 4E6MA 1M68A 3LGGA 4XUGA 2QF8A 5AC7A 1EL3A 1W3IA 1XIFA 2F38A 2Q8ZA 2FGBA 3W1MA 3NPWA 3W7LA 3OA3A 4KWVA 1JNEA 4CD6A 1OFRA 1GORA 2QCFA 1JZ5A 3HIJA 1BPLB 3MU7A 2FLIA 3ALGA 4M5PA 4F0SA 1ENUA 3CQJA 1R46A 4AD0A 2NV9A 1I75A 1VYPX 5EY5A 3SIZA 3U8GA 3WFAA 1EKOA 3WNPA 4LH8A 2VHLA 1CZ1A 3QOKA 1E5NA 5B7ZA 3N2CA 4Q4RA 3VD4A 2FZ9A 2A1YA 3VIIA 3BCJA 3PULA 3UBPC 4HB7A 2Q09A 4DIAA 5LIKX 4TV6A 3AZSA 5E6ZA 4CCEA 1EX1A 1QW8A 4QX4A 2VJXA 1IIHA 3QFWA 1A5OC 1QOPA 2VEPA 1Q8JA 3ZT5A 5KETA 4P7QA 3VDGA 4LF1A 3VABA 1OCQA 4GIRA 1C91A 1NELA 4M6PA 5ECUA 3N25A 4RV3A 1QDSA 1Q7MA 1UH2A 1VZWA 3ZSSA 1BVNP 1N2VA 1YTDA 4LWWA 1V3KA 3VA8A 4ZMGA 3AI0A 3OBEA 4MPKA 4M1BA 4L9YA 1WKFA 2CKSA 2V2DA 4UMBA 2CLHA 1GZ1A 3E2SA 2O56A 4H1ZA 2GDUA 3ALFA 1UBPC 1EPXA 1VBJA 2WM0A 3B04A 1RCQA 2FJKA 4XUYA 1S5MA 5MHBA 4IHCA 1EEXA 3KBJA 1OFDA 4CEXC 3WH9A 2GDVA 1Z8AA 3TYZA 2ZZ5A 2EKGA 1UOKA 4HTBA 7CGTA 1UKQA 2NLIA 3B0YA 4Q32A 2JK2A 4GQBA 3CAWA 1W56A 1OVDA 4C1NA 2BX7A 1PCWA 2VFEA 2WNQA 3B8IA 3C4UA 4L80A 4W4QA 1LORA 4YS1A 3Q37A 1E9IA 3LM3A 5LNUA 3OG3A 3BC9A 3QQWA 1BEUA 2QJMA 2A7RA 1ZRQA 4KGJA 2AL1A 2WB5A 1J01A 3GIYA 1I1WA 3GNNA 4GI8A 1JYNA 3GNPA 2OGJA 4D72A 2DT0A 4LUTB 1RUSA 4LFYA 3PP7A 4O52A 1F7BA 4M29A 5CPQA 3KUMA 1AA1B 4N7QA 5F4XA 3STCA 1QATA 1X1NA 2FZ8A 3VC5A 3JW7A 3UG8A 3NXFA 5T91A 3WF0A 4CQAA 5T26A 4B3LA 2XG9A 1F6YA 1LRQA 3CNYA 3QKZA 5CPTA 4GOAA 2VZTA 2X40A 1RAKA 3SDOA 3IV3A 3QV9A 1QWKA 4U4MA 4B15A 2IKGA 5LNSA 5G2IA 3SN4A 3DFHA 2GL5A 3WF4A 3T9PA 3NVTA 5F7UA 3D47A 3RMEA 1PIGA 3DZ1A 5AHIA 3PC0A 1U33A 3NFUA 4W9TA 3BJTA 1IZKA 2A5HA 3GBDA 2G3JA 5D30A 4KCUA 1MW3A 1TV8A 4DZ5A 1NOUA 4HU4A 3G6LA 5A6JA 4JFUA 4XX6A 1W91A 3AIQA 4GJ1A 5HBFA 5AYXA 3A6OA 2FQIA 1EH9A 3FEMA 1SFJA 3UZWA 1QJWA 4PBGA 5A95A 1O7AA 1GG0A 2OB3A 1XV8A 1HGWA 4A2RA 1H7RA 1P5BA 3WNOA 1W1A1 3CZLA 2Y89A 2IQTA 5I3GA 5EJZB 4M6VA 4PCNA 3QPZA 1XF0A 3LTPA 4MFDA 2WHMA 1WZAA 1NDWA 4N9BA 2VX7A 1UD6A 4OWGA 1AW1A 3UZXA 4UQEA 5TF0A 4AYSA 1B2YA 4GZIA 4CKQA 4F0MA 5J5DA 3HV8A 2PWUA 3APYA 4NI3A 3PZMA 2PLKA 3PR2A 3U6WA 4D8LA 3DYOA 4OV9A 1LRNA 1U1HA 3C6CA 3QTGA 4BK9A 1MSSA 3GBEA 3ZZ1A 1OYAA 3WQ5A 5A2CA 4X2PA 3HJZA 1J18A 3ZQ9A 3OVQA 4I7UA 4LYRA 1UR4A 1P43A 3H2FA 3NXLA 1Q66A 2RAGA 5FAGA 3QVQA 1GKPA 2CXEA 2ON3A 1E0UA 3P82A 2HXUA 1NWSA 3LK6A 2FH6A 1AQMA 4L64A 3QC3A 4NRRA 5DY3A 4GG9A 5FL1A 1IWAA 1UPPA 4C1NB 1C7SA 1ZJBA 2EO7A 4YCOA 1GVIA 4MAVA 5F2GA 5KZDA 1XPGA 4IQDA 4DWSA 1PHQA 5HMDA 2OCZA 2WZEA 3R89A 3NQBA 5C9WA 4JQAA 3PZQA 3HQ1A 4M8UA 3TONA 1AODA 2DZUA 1EHNA 2ODOA 2X1IA 5IXEA 3FJ4A 2VCCA 2DW6A 3ARTA 5CBIA 1DVJA 1DE5A 1PYFA 3SM0A 1ZSXA 3AQUA 3NOYA 1UR9A 3TFXA 2POTA 4WEVX 4XZIA 1ECQA 2CW6A 1R87A 4GQ0A 3FSUA 3AIUA 5K3VA 4IF2A 2J7EA 4GMEA 1M01A 2H6RA 4H8UA 1TV3A 3GVWA 4K7YA 4RX0A 4AZ5A 4F0KA 3BLIA 1ISYA 4RNJA 3ZVHA 1K6WA 4CCCA 3AIWA 1RK5A 2R9RA 1R85A 4PODA 4Z2KA 4LOCA 3SO7A 5HINA 1D3GA 1ODZA 5CZKA 2PU0A 2DFAA 1S38A 2CBJA 2YCLB 4YTUA 3ERPA 2D23A 4BEUA 3V36A 4AB4A 4GVHA 3XISA 4N2YA 4DUWA 3O3RA 4B5VA 3P5YA 3ZJ7A 3SJ3A 2FZBA 4J3WA 1R47A 3VKKA 4CCZA 5EBAA 5EMMA 1HIZA 1V02A 4DJEA 2JKEA 3MC5A 1RR2A 5EJ1B 3QZAA 2GVEA 3EX4A 1FQ0A 1M04A 3GQYA 4OV4A 4RJEA 1D7FA 3RMJA 1X96A 4EXAA 4P7OA 3WN6A 2X41A 1CIUA 4PA8A 1V5XA 5JVLA 1BVWA 1DKWA 5BCAA 2YPIA 3HN3A 1XQKA 3CL6A 1EBGA 4O10A 2QEZA 3AZRA 3EX3A 2PTXA 1I2NA 3WLOA 2X16A 3NQGA 3AICA 1PAMA 2VD8A 4WOQA 4NAFB 4GFIA 5AYIA 2O9OA 2PRHA 3A4AA 2INFA 1BWKA 4X61A 1K02A 4J35A 4EPEC 3QHMA 4S1FA 5ABGA 2REQB 3M0JA 2ISFA 1WUEA 3URQA 4I6KA 3WLJA 3IUHA 3T2OA 3TN3A 3W85A 4QGCA 3RO8A 4AWTA 3SUUA 1VPYA 4IGHA 4DQWA 4WDTA 2E28A 3DGRA 4UCGA 4QQUA 4AISA 3RAOA 2ZTJA 2JFEX 4BJHA 4JTCA 3I7RA 2XTKA 1E0VA 1YDVA 3E12A 3S2LA 4ECLA 3KRZA 1MEWA 4MNJA 2O7QA 1RV8A 4NJJA 4GGBA 2JKAA 2UWFA 3CH0A 3N4AA 4WY0B 4A4AA 3KDNA 5E0CA 3N2OA 4L9XA 1EJRC 4IFKB 4QIUA 4DF1A 3CLMA 4HOZA 4PL1A 2GQ9A 5U7SA 4GI4A 4MWAD 1XLKA 1SMAA 2QPSA 1JJKA 3KDOA 4LF2A 4UTLA 1CB7B 2VUNA 3C0SA 3B9OA 2H90A 4MDOA 1GQJA 1R6WA 4M6UA 3CQHA 5FJRA 1XKJA 3SJNA 2HMCA 1OB0A 3FDGA 2A4AA 2NXIA 1ZU8A 1QUMA 3WJWA 5I03A 1WNOA 2Z1SA 3ITOA 1EZWA 3RUBL 3VPLA 1GEHA 1UH3A 4JIEA 3MVIA 1Q6LA 1JAEA 3CIWA 3MMTA 3N2BA 3BMVA 4D9PA 4MJ2A 3T4WA 3LZ3A 3MQTA 1JPIA 1WUFA 4IUGA 2W92A 3DYMA 4L6DA 2NQHA 1WKEA 2W4XA 2WCGA 2AQWA 2QULA 4JICA 3SN0A 4FLQA 2C8NA 1KFBA 3VD5A 3QZEA 2DP3A 4AHPA 4GK8A 4PMXA 1AVAA 1O6IA 3TR9A 2VURA 3DHPA 3BJSA 1Q2RA 4JIPA 5LZLA 3U3HA 4UOJA 1YBQA 4AVNA 2CLEA 2F61A 4JDBA 4XZMX 5EGRA 5LSMA 4MWAA 4M81A 2OWXA 4UNKA 5D9PA 2W63A 1LQAA 4JXCA 4XAPA 3S8HA 2AMGA 4M3PA 4DJDA 3OYXA 4OE7A 1BKHA 3C5QA 3T0BA 3PTQA 2O4QA 3PB2A 1HUVA 3N13A 3SGGA 2J79A 3CHCA 4GKTA 3MSRA 3D0CA 4FLRA 3S83A 2QV5A 1FXQA 1S5VA 2Z2AA 4NF7A 3TCEA 2PDPA 1XIGA 4XD6A 2OO6A 1QT1A 3H7UA 3K8LA 2Y62A 3PWAA 2E1DA 4Q6JA 4WVXA 3AYRA 1XGZA 3HPXA 4YTSA 4V2XA 2QCLA 3LS9A 2DORA 3HGOA 3L4ZA 5BRPA 2WAGA 4FX7A 4HBKA 3LB0A 1KWGA 1UC5A 5M3WA 1Q13A 3LUTA 1IEXA 1DV7A 4QM1A 3SBFA 1OBAA 1RBOB 2AL2B 4MAZA 1GGOA 5AC4A 3W02A 5CG0A 1QOQA 3BAXA 4NRSA 2VOTA 2OZTA 1QU4A 3UXLA 3KEHA 1DXFA 5HUPA 1KM1A 1J79A 3L4YA 3B03A 2DJLA 3P0XA 5CLWA 3TQVA 2ZQ0A 2A3EA 4RE3A 2B31A 4D6JA 2VDHA 1JYVA 4B2DD 1LUCA 3GXTA 2WKJA 1Q6EA 5HWJA 3OB8A 2PUZA 2E1WA 2REQA 4JIIX 3SUVA 3MKCA 3P7YA 4GBUA 3WMLA 3HG4A 1AW5A 1SMDA 4UTHA 1KFWA 2YCEA 2CLPA 4NHVA 3BSMA 1TE6A 2E25A 4LVGA 2FPVA 4IG2A 2BGQA 2QJGA 1JCJA 2WSRA 1M5WA 3SCSA 4YHEA 5KEZA 5FIPA 1LT8A 3RX3A 4KWWA 1XCXA 3WX7A 2GGIA 4FX8A 1EJTC 3UR8A 1BYCA 2OOFA 2XHYA 4KCVA 4F2BA 5FOOA 4GXMA 1V0MA 3RDKA 3LNPA 1DIEA 3DHDA 5DF0A 4PUNA 2NUYA 3G1VA 3VM7A 3WLTA 2WVUA 1OHLA 6ALDA 1KRCC 4NUWA 4B4FA 5CC3A 4FO4A 5JXQA 3PNZA 5HOSA 3OLDA 3NURA 5FD0A 1R9YA 4MOZA 3B9AA 4CVWA 1W5PA 1GVYA 1KCXA 3SY5A 2CEQA 3CTLA 2VZSA 1ITQA 4AWUA 1JGMA 2B7QA 2YBTA 3QGAC 3DUGA 4LVDA 2J77A 2W9MA 1PL9A 2VC5A 2WLZA 1IXNA 3UZJA 2XYLA 1EEPA 1ITXA 4L1GA 2BLEA 3CUHA 4H00A 1A5AA 1KRMA 3GNRA 3HPZA 4XZNX 4XV0A 3UCDA 1OG6A 3SRKA 3EAUA 2WVVB 3MUAA 3VOFA 4DAIA 1H7WA 5TNVA 1JULA 2Z2BA 3FFSA 2V68A 3NZQA 3LI0A 3ES8A 4NIRA 1TELA 4PUWA 4XTIA 3NZRA 3WDJA 1F9CA 1KXVA 1T40A 3BARA 1VEPA 4WJEA 1RALA 3EXSA 1XLHA 4DUXA 4F4RA 1Q63A 3AAMA 1W3LA 1FWWA 3P61A 4PRRA 3W82A 2HS6A 1ZJHA 4X0NA 4IISA 2F6KA 1CLVA 3SFKA 2PDYA 3W37A 1OK6A 1TWDA 5I3JA 3TYBA 1EFZA 2AOSA 3M4HA 5BXRA 3RCMA 4M7SA 3M0VA 3IUDA 2PDKA 3UYCA 5CGQA 1XIDA 2QCCA 3L0NA 3QQ0A 4KBXA 3M7WA 5D2WA 5T9BG 4JX6A 1ZBWA 2Z2UA 4RR4A 2V2CA 3NQDA 1P7TB 1NSJA 3BV4A 1GKQA 2ZCGA 3EPOA 1B90A 5I3HA 1XLIA 2PDQA 1JG9A 2C1GA 1UD2A 4M6QA 1S2CA 4DJDD 2HV5A 3KCOA 1C8YA 2CZDA 3AMDA 2VM8A 1PWMA 1AH3A 4DXXA 4C7DA 3LQGA 4C6KA 1CEOA 4I8YA 3NL3A 3RRXA 2P0OA 3IJIA 2WMIB 3AHYA 1B3YA 4P61A 1TE1A 3PJUA 1FDYA 2PP1A 4XKYA 1E72M 1G67A 3LPFA 3W76A 2CZEA 3PZNA 1EPVA 1TX2A 1BGGA 4CNUA 4CQBA 4GQRA 3P8JA 5D2XA 1A5CA 1LRTA 1QR7A 3S5NA 1S3HA 4WY0A 1CGWA 3ZWTA 1WDPA 2OSYA 1JPMA 4I5RA 2C7FA 3EEZA 1EP2A 3DHUA 2PDMA 4C6NA 3BICA 1SO6A 5C2GA 2NUWA 1R86A 2TSYA 2WWCA 1IE7C 1NWRA 4X0VA 4WZHA 3CV6A 4Z0JA 4C65A 3UWZA 2F2KA 3BUVA 4H8VA 1KGWA 2QDEA 3WFLA 2PDBA 4N42A 3H21A 3QV8A 3BANA 1UW9A 3ZLFA 4O14A 3BG3A 4N6FA 3RX4A 3VMPA 4ORMA 3KTSA 3W72A 1XIHA 4HVXA 3CZKA 2VD9A 3RITA 5I3KA 1YTKA 2J7CA 1GQLA 2XWEA 3S2MA 2ZX7A 3W28A 3K8MA 4R7OA 4FHAA 3MZNA 2E5CA 1FX6A 2RKXA 7REQB 3M64A 3SEPA 3PWGA 4AX6A 1Q85A 3OZYA 4E8GA 3SRFA 2Y2WA 3TTYA 4G6CA 1LLOA 1A5KC 3EDFA 1R3RA 3EOEA 4G8TA 3TYAA 1NY1A 4UQ9A 4AEEA 1A80A 2X1TA 2NSOA 4GUIA 2YLAA 2V2HA 4RV8A 3L66A 3ABZA 1GG1A 2QIIA 2C79A 1EC7A 4O0ZA 4EPDC 3TLLA 4JZ5A 1J9YA 5IOBA 3WF2A 3RIKA 3ANYA 4NNBA 1EQPA 2BGSA 2GFTA 2QZRA 3P2VA 3MCOA 4ML4A 2QUUA 4I3GA 6REQB 3FY1A 3L4WA 4IL0A 3BLEA 5J8LA 1BSIA 1NM9A 1PDZA 1EUAA 2ACRA 4HPHA 3CHEA 3Q4DA 2QGHA 4GNVA 4ZFCA 3EWZA 2Y0FA 1OX5A 3QYSA 3UVAA 2BTMA 1OC7A 4TTUA 3A24A 4ZSUA 1QHZA 1J12A 4HCHA 3WQDA 3MMWA 4P00B 3NWRA 1SJBA 1XSKA 1DJXA 2ZC1A 1EJXC 3LOTA 1OM0A 5EKYA 1K9DA 5HPCA 4ZB5A 4YIWA 2WKLA 3VTRA 4HA1A 1E43A 1DJYA 1NOFA 4RPQA 3CB3A 1LL7A 3OGSA 1W5MA 3CO8A 3PN8A 2NV2A 4NAEB 5KINA 5HUOA 4O28A 2WQDA 4LRTA 1CYGA 2GWGA 2E6YA 3DC8A 4YHGA 3LTYA 4A2SA 1DJZA 4H41A 4AMAA 4K8HA 4GUHA 3T55A 3K8KA 4D8AA 3RN6A 4F9JA 1V6VA 3DKLA 4RW3A 4UR7A 1ICQA 4GX8A 1Q65A 2E6FA 4ADSA 2ALRA 3UJSA 4OQVA 4UQBA 2A3CA 1HKIA 1CX9A 1KM6A 3WDRA 1YXCA 1CGYA 1BXNA 4WDXA 4RE2A 3TTEA 4E2VA 3LI1A 2ZUUA 5C9XA 3L2LA 4QAWA 3IK2A 1EIBA 2DUZA 1ML1A 3G6MA 3VKBA 1VENA 3NO3A 3M7SA 4F3HA 3FXYA 2J75A 5IHRA 3PZ9A 1H2JA 4RKAA 1BG4A 4FXSA 1MNZA 1YADA 1ICPA 3JR2A 3FS2A 3KBMA 4JTAA 1GOQA 3OA5A 1F3EA 4CQCA 3ZR4A 1ZJAA 5BNKA 4IQEA 4K6AA 2VL4A 1X98A 3QBUA 1KTBA 3AIBA 1Z7AA 2C0AA 2YA1A 4P2VA 4W93A 3EKLA 1EBHA 2IXVA 3GFZA 2BOGX 3OQ8A 3GU1A 2YDAA 3MI6A 1A53A 2VR5A 4PBFA 2D2OA 2CLFA 1V77A 4QRNA 3WMCA 3L21A 4M80A 1P4CA 3DHFA 2Q71A 1OY0A 1XLMA 4ZOAA 4W5ZA 4QAIA 1K7FA 4D6DA 3TQ0A 2HJPA 1YX1A 3GG0A 4G1KA 3TDFA 1LBLA 4Y8FA 1GEQA 4NZCA 1VFOA 3MUY1 4JQ4A 5E6YA 1LWJA 2YCIX 4DHGA 2KAUC 4GXWA 3H12A 3NA8A 3UVIA 2I1OA 1TPFA 2WPBA 1DWIM 3DKJA 4A3QA 3UJRA 1OT1A 1W1PA 2QCNA 1IGSA 4B90A 1SVDA 2Z1VA 3NVDA 2PTWA 1UG6A 1ISVA 2I17A 5RUBA 3MYOA 1VJZA 2J66A 4GBDA 2HQAA 4AEFA 4B4HA 5CPSA 3WBYA 4DLFA 1R3YA 1PO9A 4C6BA 2D73A 4M1RA 3SQMA 1NU5A 2Z27A 2ZWYA 4LV4A 1E6XM 1KRAC 2WJEA 5FL0A 1QI5A 1WX0A 3K30A 3DEQA 3KP0A 3L4UA 3VDBA 2PDNA 3BE7A 3W2KA 2A6NA 5HAOA 1MRAA 2QDDA 3MT1A 1E5JA 1FWCC 2QJIA 2VEFA 1S2TA 3C8NA 3LBOA 1BTCA 2WBGA 1RZMA 3L0KA 5DBTA 1R3WA 4MF4A 5IFTA 2I57A 1DXIA 1TYGA 3AWOA 1E6NA 4AXKA 4IP5A 1L8NA 1OFOA 2WJZA 4DXKA 3L68A 4KF1A 4N9EA 4Y96A 1R9XA 4UFJA 1TCMA 2GJXB 3GDLA 1BQCA 3UA3A 2PS2A 2O7SA 5H6HA 2BOFX 3N4FA 3GUWA 2V5BA 3R1ZA 1K03A 2OZ0A 1V3JA 1HJQA 3IJQA 3EZ4A 4E4FA 3UPWA 2HVNA 1YNPA 3QR1A 4XVEA 4NNCA 5G4WA 4FALA 5FF2A 3QRHA 4PB5A 1N8FA 2IPWA 1XLBA 4PTXA 5I7GA 4JNMA 1PTAA 3W70A 4AG0A 3MSDA 1W8GA 3OYZA 3WIJA 1H51A 1TR1A 3RM9A 4ACZA 2WMKA 3D5HA 4YNGA 3UR5A 1KLZA 3LRKA 2JBMA 3FHQA 2C3ZA 3VOCA 2QAPA 3SAZA 1TB3A 1MW1A 1MXGA 1AJZA 4YL2A 3HMCA 2WMHA 1K9TA 2OX4A 5A94A 2PTZA 4IGNA 4O16A 4Q8WA 3TH6A 3TLQA 2PDCA 4S23A 3WMSA 1IXQA 5CCZA 3CL8A 2BZNA 2YL9A 5LIYX 5D04C 4C6CA 3RM4A 4BA0A 2ZBTA 4HHLA 2ZZ4A 3NO5A 4FR6A 3G3MA 3CUIA 3TJ4A 4IFOA 3MCMA 1XM3A 4B5NA 3VYLA 1RVKA 4UZSA 4ZVJA 1NFPA 3GSMA 5LYRA 2QPXA 3DFTA 3KZSA 2PSNA 2PDJA 3SGZA 4Q4KA 2PI6A 2YDQA 4EPBC 1BWVA 4CD4A 2PZ0A 2XH2A 3BSHA 4XG1A 4ZE5A 3F7JA 3M6YA 3PFRA 3W7GA 3NGFA 5C6MA 3TXVA 4ZTYA 4QG8A 1VKFA 1UPMB 3GVGA 1TTPA 3BK0A 1TTJA 1GVFA 4E2BA 4FIRA 4C60A 4W7WA 4H9YA 2OQHA 2QUNA 3EXRA 1DJNA 5K4ZA 3LPOA 3SECA 3T09A 4DJFC 5DY2A 1EOKA 1GQIA 1DIKA 1UR2A 2XDFA 1KNWA 3BAIA 1DOSA 4IPNB 1GOIA 3UY7A 1DJIA 3RJYA 3LPPA 3W38A 3A13A 3L4TA 2ZUVA 3E49A 3IJ6A 4XSMA 1W17A 4IG2B 4JFWA 3RRAA 1E55A 3ZMRA 4UQAA 4OUEA 2Z7KA 1BRLB 4LVFA 3FYPA 3O6CA 2G96A 3RG6A 3SZ8A 4D2JA 4C7GA 3G8EA 4RZBA 3TA6A 5D9OA 1PUDA 1UBSA 1F4HA 1YDOA 2J7FA 3MMUA 1LUCB 1OYBA 4WUIA 3TW7A 1X6UA 4YU1A 5CPNA 4EIVA 2FPYA 2V5LA 3PZUA 4WX2A 3STPA 5A8PA 4JFSA 3TP4A 4J3XA 5EIYB 1HL8A 3QLLA 1JZ3A 1V0NA 3UJ2A 3K1GA 4BI7A 2PWDA 4K3ZA 3A9IA 3BWWA 4LNCA 4S3CA 3IARA 4HHPA 4DUOA 4F9DA 4TOQA 5C9ZA 4FAMA 3E0LA 3SSJA 1RCXB 2J47A 3VOGA 3K4WA 3WFZA 5SWUA 4H2HA 4H19A 4O0QA 4ICNA 5F4WA 2DZVA 1U2YA 1V3HA 4AW7A 5CPMA 1LQ2A 2NW0A 2YFNA 3MJYA 4R27A 4U3AA 3VD7A 4UFIA 4HOWA 2ZRXA 3Q58A 3VNKA 3ZJ8A 2YL6A 2HVOA 4M7TA 1TRIA 1H61A 4MADA 1UA3A 1TPWA 3LEPA 4LVAA 3HA1A 4TVUA 4UTJA 3TFCA 1U5VA 7TIMA 2AGKA 3BSGA 1MW0A 2B81A 1IWPA 3RLGA 2CLKA 4IT1A 1P0BA 9CGTA 3MWCA 2IKHA 4YTQA 4HYVA 4MKVA 8CGTA 4GCAA 1FKXA 5C70A 4KWOA 1JR1A 3NNTA 2CETA 3N15A 1RVGA 3UZZA 1CLKA 3NQ8A 3N3TA 1WAWA 2B4GA 1OF8A 1GW9A 5TAOA 1R3TA 3BVJA 2CWNA 5CSSA 2Y5SA 3TAOA 3S9ZA 2AKZA 4LRSA 4N4QA 3QW3A 2UY5A 2OX1A 4GUGA 1X6NA 1W5NA 3U2CA 2ADAA 2BHYA 1JCNA 3IGXA 1QMLA 2A85A 3TCSA 4NZ5A 5XIAA 2OVLA 4JL1A 3LSCA 2GPTA 3IK4A 4AAJA 4KPLA 3GVVA 4FOKA 4NSBA 4BWLC 3FEQA 4J1OA 3W7JA 3N1AA 3NQ2A 3PG9A 4JTSA 2VX4A 4BFAA 1JXJA 1Y8BA 3WSUA 1TZZA 1OZMA 2PWHA 3MBFA 2VFHA 1E1CA 4EOUA 3QR0A 2R14A 1F3TA 4WJXA 5HJLA 3D3FA 3ZT7A 3TW9A 3MBDA 5G1MA 1UWRA 3WNMA 3W1QA 5CSRA 4GVGA 2NUXA 3LQLA 4IH3A 3VZZA 3QY6A 2ISWA 3FXGA 3LCWA 4X9YA 3GY1A 3V7PA 2J6XA 4MJZA 1ZZMA 4M24A 3QSTA 3PVFA 3KTCA 1OABA 1OCBA 4KKXA 1WKYA 4LC6A 5HXMA 4KW2A 2VDIA 4IQLA 1E15A 2FGZA 3F4WA 4JN7A 2FFCA 1EX5A 4H7ZA 3AIEA 4UTUA 3MSYA 3N6HA 1GVEA 1NJJA 5FEZA 1CGXA 1GONA 1L2UA 3M9YA 3EA3A 1TV2A 2IPFA 2OODA 2HCVA 2NQJA 4U31A 1C90A 3EKZA 3FOKA 1DHKA 1US2A 4B9YA 2O4MA 4UBPC 1FUYA 3GTFA 4PEKA 1F3XA 4EK7A 3UERA 2ATMA 2ABAA 3VGBA 3NQVA 4RUBA 2Q8XA 1S5NA 4L65A 1KFLA 1UP3A 3N9SA 3A4XA 3V1PA 3KCLA 2E77A 1R2SA 3LCLA 1A5MC 1KTCA 3P8IA 5D09A 4ERIA 1YBQB 5C9UA 2Z25A 1CPUA 1VRXA 1W2PA 2VR2A 1D2KA 2OKTA 3NAVA 4NKCA 4DJEC 1IZCA 3WK2A 2C18A 4V33A 3LHUA 2PTYA 4PUEA 3M6DA 3PBMA 4MJMA 1TJRA 3NQMA 1ZENA 4QSHA 2GYIA 4HCDA 3QMSA 3EOUA 3NZGA 2I16A 3EA2A 1YE4A 1J4EA 2V82A 3WUGA 3LHVA 4Y6GA 3AXMA 4F79A 4O54A 3A22A 4QDPA 2BMBA 3WQFA 4TU1A 2WSQA 2WVVA 3WNKA 2TYSA 3FVMA 4DPQA 3GC5A 1HTIA 1W9VA 5MKGB 1LF1A 2VGBA 4UCFA 1OC6A 4DEFA 3AS3A 1XDJA 2GSEA 3WEOA 3UG5A 4YPJA 3S42A 1SZEA 3S9YA 3W83A 4LNYA 2OYKA 3BTNA 2VELA 3FX4A 4QQ3A 1OD0A 3I3BA 4A3HA 3KOYA 1H7NA 2DH3A 3P93A 3AS2A 1E51A 4LTSA 4RCXA 4PCSA 1BSLA 3LV5A 3SSZA 5B80A 2ZZ2A 4QSFA 4US5D 3QLDA 3MUZ1 3REQA 3W25A 1L6GA 3EB4A 3G18A 3O6AA 1VBRA 2NSXA 4FK9A 1BLIA 3HM7A 4GLEA 5F2MA 5LNVA 5LA0A 3XIMA 3UWVA 5KSWA 1IEVA 4H9TA 3ID7A 1K8YA 4QTGA 2DVUA 1QOXA 2C13A 1GVRA 4NYYA 3BLKA 1NARA 1JYWA 3DOPA 1VFSA 2BHUA 1VBHA 1EF3A 3NEHA 1XLLA 2O9TA 4Q8PA 4XIAA 1EHAA 3EX2A 1WDRA 1T96A 1ZHAA 2R6OA 3GG1A 4Y90A 2NVCA 3FJLA 3AYVA 3BMXA 2W6RA 2WMJA 2PDFA 3O2LA 1AD4A 4OHQA 4J3VA 2XN2A 2E9LA 1L0PA 1GHSA 2XISA 3M5YA 2R1KA 3U7VA 5GJNA 3T7VA 1PCKA 4URIA 3OPSA 1VCFA 1K3UA 1TJ1A 3LXAA 4NX0A 5CJ5A 1U5JA 1J0YA 3RLUA 2PDLA 4UTTA 2ZICA 3UR2A 4OBTA 3N2MA 3DH7A 3RFAA 1PJ9A 5CC6A 5TD4A 1AMYA 1U30A 1QPQA 4U5IA 4Y9PA 5A2BA 3W6LA 2PF8A 4DF2A 2WOQA 4GC3A 1JCYA 4WOZA 4PEEA 1ZY9A 1KA9F 1C92A 4Q6XA 1E4IA 3THUA 1U83A 1K70A 3IIOA 4FF5A 1UD4A 2D22A 4MNLA 1MI3A 4NG3A 1TUXA 4J28A 1G0CA 2X7WA 4IXXA 3ZVHB 5JH2A 3STEA 1T7LA 3DN5A 3R79A 3GXMA 3QGVA 1KV8A 1Q6DA 1HJSA 1ADOA 3FJ6A 3A21A 1YXYA 3SCRA 3BAYA 1E1FA 4ADTA 4K38A 5CBBA 4Z0SA 3O0KA 3CMGA 1XFCA 4W8AA 1I2RA 2HISA 5A6LA 1TG7A 3W71A 4AU0A 2V63A 2DH2A 2FFIA 2IPGA 2OTDA 3MV01 4Q4MA 5DRIA 4BHYA 3G0UA 4CU7A 3N12A 1US0A 1FH9A 2CBVA 2VCAA 1VJIA 1Y5VA 2PBGA 1IXPA 5HMSA 3CUFA 2UY2A 3GTHA 3W7OA 3HPFA 2BB0A 5K2ZA 4NJIA 3MUIA 3RX2A 4MB3A 4E2OA 1Z44A 2G3IA 2OXNA 4UUIA 1QW7A 4NJHA 3VGEA 4QLLA 3CPUA 5GVJA 1B54A 1ONRA 1B30A 2FVMA 3VGDA 4WY0F 3R5EA 4Q4OA 1FWBC 4WQ6A 4QJ5B 1RQHA 3UD6A 1VJSA 1BHGA 4KEUA 4L61A 4FXFA 3P62A 4LVBA 1CT5A 2JALA 1ZBCA 1UZHA 1J5SA 2Y5JA 5ABFB 3ITXA 3QY8A 1C29A 4AEOA 3MZ2A 2DZPA 4WGHA 3GB6A 1JZ4A 4ICMA 2WWDA 4HU0A 4GQGA 4O0KA 3VIOA 4A29A 4KFPA 4Z1DA 1O5XA 2RFGA 5LXEA 4MG4A 1Z42A 4QS6A 4BS0A 4PSPA 3L12A 4PTNA 3CHVA 1H1YA 4KEZA 3LMZA 3NGJA 2J4GA 3UPBA 4J3UA 1BF6A 2DZBA 2OT0A 3AJ7A 4OIFA 4ATWA 2WSKA 1UMLA 3UESA 3T40A 2QHAA 4K1WA 3DU0A 1ISXA 3W23A 1PX3A 3A12A 3APGA 3BW3A 3PM6A 3FGCB 3TYEA 3WMBA 3F2BA 4RZ5A 1W3TA 1DYSA 4L1XA 4QROA 2GLKA 1DJHA 1WP6A 4HPJA 2UY3A 4ONVA 1TV7A 2X0HA 1AQFA 3W75A 3G1DA 5EFDA 2OWCA 2PAJA 2JE8A 1UWIA 5FEWA 3QOMA 5A6TC 4HNNA 3F03K 4QHRA 2IS7A 1QVBA 1QW9A 1CCWB 1EA0A 3EWDA 3YPIA 4IGSA 2QKFA 2FIQA 2OPJA 3B9NA 2XGZA 3PZOA 1B3VA 5G1YA 3AC0A 2WCAA 4IPPA 2XZ7A 1AMKA 2TMDA 1WQ5A 1XP3A 3C3UA 3INPA 1REQB 8TIMA 2Y24A 5LGXA 2DV0A 2CHRA 5K9XA 4Z2GA 1K6AA 2HRWA 3LLDA 4GYJA 1HKJA 4OTKA 1GT8A 4QCFA 3W3OA 2JIWA 5I23A 1HNYA 3THQA 3MB9A 4HNVA 3OGRA 4HMCA 3G2GA 2NQZA 2ACQA 4W88A 2HXTA 2F84A 1Q2SA 2J7GA 2ALDA 1ADDA 3T05A 2KZHA 3WD1A 4DM2A 2J9YA 1FDZA 3WL0A 3URNA 3CEUA 1TPB1 4ROPA 4LS2A 5A3HA 1AH0A 3P6LA 2QJNA 1LZOA 1JZ7A 2C91A 2OLAA 4LUSA 1CGUA 5K9DA 4PCFA 4L6OA 3IJ7A 4MY1A 5A6KA 4HZMA 3GK0A 3PTMA 3W7QA 3W81A 3AXHA 5HDRA 1M65A 2E0PA 1CLXA 2EEXA 3W2LA 3VNZA 3ZM8A 4A3RA 2QUMA 4MTVA 3RPTA 3OP2A 5FAJA 2DQXA 3DERA 3R12A 1MUWA 4FPSA 1WA3A 9XIAA 3LCGA 4HA3A 3GH7A 3F5JA 1DWJM 2J7BA 3GS6A 1NFGA 2G41A 1LT7A 4Y9AA 1TTQA 3DG3A 4KFOA 1E40A 2F7FA 3QHNA 1G4EA 5HR6A 2GVJA 3FKRA 3P3BA 2OG9A 4JIQA 4O18A 3WDHA 1WBJA 3ARUA 4OVXA 1WXYA 1Y7VA 3B8VA 1FH8A 1C93A 3MTWA 1TZ7A 5CPLA 1IV8A 1WDWA 4X3ZA 2NWRA 4TR9A 1JQXA 4MNKA 1JUEA 4RPPA 2F2HA 4NI8A 1I2OA 3WO8A 1W1YA 2GUYA 3ARPA 3WEMA 1GYMA 5KTLA 3ABRA 4IQJA 1HKWA 1CBGA 4LYPA 5HNNA 1XKYA 1E4MM 1E6QM 3GU2A 1KFJA 1KO0A 4DO6A 3PFMA 2PCEA 2CYGA 2PLCA 3W84A 3BDKA 1KM0A 3OIHA 3P80A 4S3AA 3VIKA 4YJ5A 1JCLA 2GGEA 2Y8VA 1U22A 3G3DA 1SW3A 2JF7A 3I4EA 1Z9AA 2YBUA 2C19A 3KE0A 5H1WA 1F8IA 4UFHA 6ENLA 4DXVA 4HNLA 3QXBA 3W86A 3PPHA 2TPSA 2EXOA 1XRSA 3UXAA 1NWTA 2HDJA 3IJ9A 3SURA 1YLVA 3LLFA 4C6DA 2NLYA 4DBUA 1HJWA 2XN0A 3U0HA 1T0OA 4D8ZA 1OF6A 3B8DA 3UWUA 3B8TA 3SCVA 2INZA 5AY7A 3M46A 1Q6FA 1IYXA 4DBWA 4B5WA 2OLHA 4TVDA 4F2TA 5BW6A 2V3EA 2P53A 4YVPA 1EJUC 1FWTA 2WO5A 4JKLA 3BW2A 4K7VA 1TIMA 5EYWA 1SW7A 1JPKA 1EOMA 1YIXA 4S3GA 4ZODA 4K68A 5E0KA 3EOSA 3PUEA 4C6QA 3WBWA 3HURA 3QMRA 3TTQA 3VX0A 3IIZA 4NZ3A 4JTQA 1UZDA 1BG9A 5BXTA 4AXNA 3V5OA 1TPUA 2HWGA 1A5BA 1QO5A 1M7PA 3W2NA 3H4XA 3S2NA 1GVQA 2Z1WA 1ZALA 4S2CA 1A5UA 1F6PA 1GW1A 3LCIA 2WNWA 4DBEA 2XH0A 4QNWA 4M0XA 4KWSA 2MNRA 5DBUA 3SCTA 2J8TA 4DLMA 3FAWA 3W7EA 1ECEA 2O9PA 4HPXA 4F40A 1WPCA 2FDSA 2YW3A 5DO8A 4AIBA 5E93A 4ZGYA 2NXHA 1R2TA 4OKDA 3W26A 1J2BA 1K7XA 4R33A 2XGBA 4AMCA 3OVPA 4NVTA 3CUZA 3CQ0A 5A6BA 2PP3A 3QMTA 3TYDA 4KEMA 4GZJA 3NPUA 5DMNA 4GYKA 4Q8OA 1UWSA 5BXSA 5L9FA 5DT7A 1KCKA 3Q67A 3ZXWA 1XPYA 4UTWA 1I9CB 4N9CA 2ZA3A 4OGZA 2FGLA 1XJBA 2DT3A 2PF0A 3H22A 4XZBA 3VZYA 1YTEA 2D0FA 2CWXA 2FHFA 3DYPA 4DBDA 2RDXA 4EE9A 3GR7A 2E40A 1O95A 3DDMA 3T6CA 5HATA 4KH2A 2VGIA 4Z1YA 4GZEA 4PSRA 1VP5A 5CZJA 4RNIA 1UWUA 4DX3A 2W66A 4ZQMA 2Z0IA 3UT0A 2DU2A 1ITCA 2Q6ZA 2ZXAA 3H2AA 1PZ3A 5IHSA 2E9MA 2XIMA 4AZGA 3M1ZA 4QLJA 4NJGA 5KZ6A 4MWAC 3AS0A 3ARYA 4Z42C 1Q45A 4JHZA 1Q6CA 2OT1A 4IMAA 3OEXA 3HGRA 3VUPA 1LBFA 4O13A 4E2DA 1OJXA 1PZ2A 1BVZA 3UGRA 3UCQA 3MSGA 5C5YA 3BGJA 2B7OA 3C86A 3LRLA 5JQ9A 3BQ6A 1EYWA 2WJDA 3TE9A 5BWAA 4GE8A 1LJYA 3C2OA 3A5FA 1SR9A 4AC1X 1TWZA 3CWOX 3LMYA 5FJJA 2JEQA 1ME7A 3CAVA 4F2UA 3SADA 2VR4A 1X8CA 1JEZA 4C5ZA 1OINA 5HR7A 1HG3A 1X7FA 4IOTA 3EMQA 1NEYA 1AZ1A 1H0GA 1W9BM