3GH7A

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with galnac
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
519
structure length
506
Chain Sequence
HHHHSSGLVPRGSHMATSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords beta-hexosaminidase
publication title Molecular cloning and crystal structural analysis of a novel beta-N-acetylhexosaminidase from Paenibacillus sp. TS12 capable of degrading glycosphingolipids
pubmed doi rcsb
source organism Paenibacillus sp.
total genus 194
structure length 506
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gh7A01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3gh7A02
3VOCA 4W7VA 2FDMA 1IT0A 5E70A 4BCEA 1E4NA 2W61A 3N18A 2WWDA 5BXSA 3SCQA 4MB5A 1JZ6A 1ITXA 4B9ZA 2NW0A 4D6CA 4C7FA 3AIBA 1UKQA 4J28A 4CCDA 1NM9A 3T08A 4S3KA 3FNDA 5A6LA 1Q6DA 1UD5A 3VD5A 3CZLA 3SCSA 6TAAA 1CGVA 3CTTA 2GJRA 3IJ8A 2J8FA 1EO5A 2RGMA 2VZSA 3CUIA 1ISZA 3W6LA 2YKKA 1UH2A 2D0GA 3RDKA 2G8ZA 4TX6A 2ZUWA 1XSJA 4LQ1A 3ZJ6A 4M8UA 1E72M 3AHVA 1ZJAA 4C7GA 5FOOA 1G01A 2WZHA 4GO8A 1TA3A 2J7BA 3AYSA 2UY2A 3VDHA 2W4XA 3AYRA 2F2HA 2ZX7A 3AJ7A 1B3XA 3ZSSA 1W3HA 2QPSA 3PBGA 3TP4A 3OGSA 4QLJA 2WVVB 4YPJA 3VUPA 2D20A 1E6ZA 4OOUA 2G4FA 3WDPP 3CHFA 3CZEA 4PTXA 1UWQA 1VBUA 4W85A 2PF0A 2A3AA 2XVLA 4D6IA 4PTWA 2Y8KA 4FLRA 1CEOA 2E9BA 4HPGA 1Y7VA 4HOWA 5BXPA 4MTVA 2WMGA 5BRQA 2O9RA 1UUQA 2JIEA 4P8VA 1JAEA 1E43A 1UA3A 1NP0A 2VT0A 2FGLA 4TTUA 3WQVA 3SUVA 2BHYA 2WBGA 2WCGA 1KWKA 4Q22A 2OLHA 4D6FA 4PCSA 4WK9A 1UKOA 1CGUA 3II1A 1JDDA 1G94A 1GQLA 4KRUA 4XX6A 4HMDA 1JZ2A 4XZWA 4BQ3A 5HOSA 2JALA 2FHBA 2VX7A 3OGVA 4JZ5A 5AYBA 1EDTA 3ARZA 1CENA 1RH9A 3AIVA 4ATWA 3MSDA 3ZIZA 3W37A 3DECA 5HXMA 1XCXA 2J77A 2XGBA 4MNMA 1ZU8A 3PZIA 2CCRA 4YHEA 1DWJM 3VIKA 2WMKA 1NWUA 1E1EA 4S3JA 5A69A 5M17A 4FLSA 1UD4A 4ACZA 4HMCA 1UZ4A 5BRPA 1M04A 2W92A 1HVXA 5A2BA 1TA3B 3HN3A 1JYVA 1ISVA 4QDMA 4FMVA 3L4WA 5I78A 1E5NA 2VZOA 3LPFA 2DDXA 5CXPA 4AEFA 1TMQA 1OM0A 2VRQA 1XV8A 2PC8A 1HKIA 1SFSA 2YBTA 2DGAA 1VEOA 4OOZA 2UY3A 4JL2A 3WNKA 1XCWA 4CD6A 2EO7A 5JUVA 2VCBA 3CMJA 4IUGA 2QHAA 4GI8A 4NZCA 1TCMA 2EXOA 2BV9A 3O2LA 3WEZA 2GJXA 2VRKA 3BCDA 5FD0A 3NIYA 3BH4A 1OCQA 4F8XA 4UQCA 3I3BA 3EYPA 3VILA 2VOTA 3GNRA 5HPCA 5EBAA 1HVQA 4M1RA 2E3ZA 1MW2A 4HU0A 3BXWA 3A3HA 4R5EA 1OD0A 3MMUA 1BF2A 1E40A 3GZAA 1CNVA 1IZJA 1MVYA 1VFMA 1HJVA 4OBSA 4WSJA 3WF0A 1BHGA 2WVSA 3VIIA 2XHYA 3QOKA 4C90A 3AICA 3VM5A 2VX5A 5LA2A 1J01A 1GUVA 2CHNA 2OSWA 1FA2A 4H2CA 4ATLA 1W9DM 5DT7A 5GPRA 4X0VA 1TR1A 4M81A 2WSKA 3RIKA 4CD4A 4M29A 4UOJA 3PZTA 4CD8A 2BY3A 1E1FA 2D23A 1WAWA 1J0JA 4JKLA 2ZUNA 1W2PA 1GQKA 1CGXA 1J11A 3EMZA 2EPOA 4MNLA 3VX0A 2EJ1A 3OLEA 3SCVA 4ACZB 3BAWA 2FHFA 1KCKA 3A4XA 4RE2A 4NRRA 4U3AA 3VIMA 3WDHA 5D8WA 3GXMA 1PAMA 3TTQA 1E3ZA 4AC1X 1DWFM 4D1JA 1E0WA 1Q4NX 1HKJA 1UR9A 2AOSA 3GH7A 3W81A 1G1YA 1FP9A 1UR2A 4P7QA 1E71M 1ITCA 2WVUA 4AW7A 4PRWA 1PX4A 1W1PA 4L4OA 5M03A 4OBRA 3N17A 2VI0A 4W5ZA 4CD7A 1OB0A 3BAYA 1OSEA 3LPGA 3VKKA 1FFRA 5IHSA 2GJXB 3AS2A 5I0DA 4PTVA 5A6SA 1J0HA 3VGGA 2C8NA 1QNOA 3W24A 2IXVA 1PIFA 1WNOA 1ZBWA 2YLAA 4UCFA 2WHKA 3U7BA 2XG9A 3KL0A 3MANA 4D1IA 4UFMA 2VCCA 3VIOA 1AMYA 4DWSC 2E0PA 1ZBCA 4K68A 3L4XA 3EDKA 4N0RA 4AISA 9CGTA 3IAQA 2J7DA 3QOMA 4P8WA 5I23A 3E1F1 1KR0A 2QMKA 1HXJA 4U5IA 2VO5A 1VF8A 1CXIA 3ARWA 5A94A 1XH1A 3HMCA 5BWFA 1J0ZA 3AHTA 3GBEA 1M7XA 5JBEA 2ZX5A 3KEHA 1C8YA 4NF7A 3APGA 4NRSA 1V6XA 1M03A 4JL1A 1HN1A 4Z2JA 1J0KA 1QPKA 3KE0A 4C91A 3W82A 4GXPA 5FL0A 1B2YA 3O9NA 4PN2A 5M3WA 3DYPA 1EQPA 4CVUA 3QGVA 1RD6A 4CGTA 1JAKA 5CPSA 3PTKA 4D72A 2QPUA 5IDIA 1YHTA 2XYLA 3IJ7A 3VMPA 2CKRA 4FF5A 2X0HA 1GVYA 1TVPA 1C92A 3NUKA 5CG0A 3W27A 1H09A 4UQDA 1HL8A 3SUTA 2XM2A 3A47A 3EDEA 1MXDA 4W93A 5ABGA 3MSGA 4D6HA 3VIFA 3TOPA 2X2YA 1EOMA 2VQTA 1GONA 1W2VA 3L2MA 3GBDA 3AQUA 1EHNA 3WFZA 1EA9C 1UH3A 1V03A 1V0MA 1CXLA 1GOKA 1UD6A 1KXQA 1TUXA 3MV11 2YA2A 4UFIA 4B16A 3VMOA 2TAAA 1P6WA 4FLQA 2J62A 3WD1A 1A3HA 2ZUMA 1ZB5A 1UOKA 3CLWA 3CMGA 4AZCA 3WNMA 1CGYA 3T2OA 1GORA 5I79A 4WLCA 2XFYA 2C7FA 5CGTA 1V3KA 1PPIA 1U30A 3OLGA 1QBBA 1E6PA 1LG1A 1QHZA 3KL3A 5JIWA 1KBBA 4TTGA 3B9DA 1V0LA 4AZ7A 4HPHA 3EMQA 1BGAA 1PZ3A 2VZUA 2VX4A 4AIUA 1UWUA 1LL4A 4ACYA 4HP5A 2D3LA 1WP6A 3BSGA 1UA7A 3VO0A 3WH7A 4GIAA 1TZ7A 1CIUA 5C71A 1GQIA 1RP8A 1K6AA 1OT2A 1O6IA 2BY1A 1US3A 3SCUA 2A3EA 4AMCA 2WXDM 1EQCA 2W91A 3WMSA 2PBGA 3UCQA 1V3LA 4GI6A 5AC4A 1NWRA 4TOQA 4P7OA 4V27A 4B3LA 4CU7A 5LA1A 1HJWA 1C90A 2Y24A 4R27A 1BVZA 2YOCA 1CXFA 1EGZA 1EOKA 5KZ6A 3ARRA 5HPOA 1IZKA 2BVYA 1W9PA 4W88A 1E3XA 2Y4SA 1WE5A 1UWRA 3WFLA 2YDSA 5IXEA 2WHJA 1EH9A 3VVGA 2VVNA 1TVNA 1JZ7A 2YJQA 7A3HA 5GNZA 4PMNA 3UG5A 3VIHA 1JIBA 2FHCA 4V28A 3RM8A 1ESWA 2WCAA 4LYRA 3QHOA 2PB1A 1E73M 4BZYA 4CCEA 1MWOA 2BVDA 2CBIA 1DP0A 1QI5A 2VURA 1V6YA 5IFPA 4F9JA 4AZIA 3T0BA 3VD4A 2BY2A 1QI2A 1B3VA 3CIVA 3L4YA 1CLXA 1C8QA 3A4AA 5D9OA 2IXUA 4UFHA 5BYWA 1VFFA 3AISA 5KEZA 2VMFA 4UNIA 4WJXA 1H0IA 4LX4A 4CN1A 1V6UA 4E4PA 4OZOA 2HISA 4W89A 3CO4A 2DSUA 4JCMA 5CQ1A 1V3HA 3G6MA 5A8NA 1KGUA 3ALFA 5JBFA 1KBKA 5C8BB 3CHDA 2A3BA 3MUAA 1MQQA 3WUEA 3MU7A 2J7FA 5I5RA 4U31A 5AC5A 1JFHA 1H49A 3POCA 4JFVA 2ZXBA 3EDDA 4DWSA 3VDAA 1WZLA 2WC3A 3VGDA 3AHYA 1J18A 1UWIA 1BAGA 4F9DA 3BMVA 1VB9A 1EHAA 3ARXA 1G5AA 2O92A 1I1WA 2D2OA 2WK2A 1WZKA 2GDVA 2CYGA 4KWUA 2D22A 1HP5A 3T2PA 2BFGA 4JFSA 3W28A 4AD4A 1QNRA 4BQ4A 2WMJA 2BVTA 1JDCA 3DYMA 3AFBA 4WKFA 1HNYA 3K8MA 1E5JA 2J75A 2CBJA 3B9EA 4ZXOA 1W9UA 4GZIA 3ZM8A 1AQHA 1AQMA 4MPKA 4QLLA 1JGIA 2A3HA 3VX1A 3VD3A 1JXKA 1PX3A 5DEZA 5GQBA 3O6AA 2JFEX 1ZS2A 5JBDA 1WZMA 4MB1A 1FH9A 2VUYA 3FAWA 3PZMA 4QCFA 3CUJA 3FHQA 3ARTA 2GDUA 2OYKA 5BCAA 2X1IA 4W7WA 2ZXQA 4H04A 1UYQA 4GZJA 3CZGA 2WBKA 3PZQA 4Z2IA 4AD1A 1BYBA 2IUZA 4CUCA 4J3WA 2DH3A 1LL7A 4E8DA 5ABEA 3WMCA 1AVAA 1W32A 3AMLA 4UFJA 1GOQA 3CHCA 1CGWA 3W53A 5I24A 3UESA 1R86A 1C7SA 4DWSD 5FIPA 4ZENA 5F7UA 2QF8A 1TE1A 4GQRA 2V3DA 3FAXA 3RJXA 1IV8A 2J7HA 1BSIA 4PSRA 4DUVA 2GVYA 3AROA 3VMNA 3N12A 4A4AA 2XWDA 3AMGA 1SR0A 4HZ6A 1QNSA 2OWCA 4DWSB 3WH5A 3SUWA 3AZSA 1R7OA 5E6ZA 1QBAA 5BXTA 1E15A 2WKGA 5CGMA 3AMKA 1R8LA 5A8MA 1W1VA 1GHRA 1XH2A 1RPKA 2WC7A 1NQ6A 4H8HA 2G3JA 6CGTA 1NARA 1W1YA 3DHPA 4JKKA 1CWYA 4M24A 2XPKA 1PIGA 4C7DA 2Z1KA 3FY1A 2J8GA 3VPLA 2JEQA 1VRXA 1WDQA 3TTYA 2CBUA 5A95A 1UQYA 1JZ5A 3VIJA 3W4RA 4OUEA 2VZTA 2D0FA 4NSBA 2X0YA 3WQ5A 3S2CA 1GJUA 2VVSA 1UHVA 5D9NA 1Q6EA 2CPUA 2NT0A 3POHA 1W91A 2DPEA 1MW1A 2OWXA 2J7GA 2XGIA 1E4IA 1SMDA 3VD9A 1KGXA 5E09A 4UZUA 2MANA 1J10A 2QMJA 1PJ9A 8A3HA 3WNPA 4HMEA 4TVDA 1BYCA 3VNYA 4JHOA 3ZR5A 1QVBA 2ZX9A 3VIPA 3ZT5A 2V3GA 3AXIA 2XFFA 4GI9A 3RCNA 3WH8A 3OGRA 5A1AA 2E8YA 2AAAA 1D3CA 1KQYA 2WW5A 4IPLA 3L2LA 2YLLA 3AIRA 2YDQA 3U5YA 5I77A 4EK7A 3L4VA 2F8QA 3VGEA 2J7EA 1K9TA 2D3NA 5EMYA 1UR1A 4JCLA 4U3CA 1H3GA 2DEPA 2J79A 1FHLA 1PZ2A 3MKKA 3VDBA 4PSPA 1BPLB 1E4LA 5A8OA 2OSYA 1VIWA 4PBGA 4U2ZA 1CXHA 1HP4A 1WPCA 2BXYA 1V3IA 2V3EA 2PWFA 1LLOA 1XH0A 4IM4A 3W6MA 2ZIDA 1XD0A 1EO7A 1WDSA 4BF7A 3RMEA 3BAIA 4PMYA 1LWHA 3L4ZA 2JF7A 4OKDA 3FXYA 2E4TA 2ZUUA 3NSXA 3WBAA 3AI0A 1E70M 4KMQA 1YQ2A 4OJYA 3T09A 3THCA 2Y8VA 3MS8A 5AY7A 3WD2A 3AXHA 1WDPA 1W9VA 3CGTA 1CECA 1WCGA 4PMUA 3GDBA 1C8XA 1CDGA 2E40A 3WBEA 7TAAA 4LPCA 2BS9A 3TONA 3SCWA 2GUYA 3WN6A 4M56A 2Y2WA 1VEMA 4WKAA 3VDCA 4D6GA 1ZJBA 2YL5A 2X05A 1EDGA 2CBVA 4HU8A 4ZFMA 4QCEA 2DT2A 3B9AA 3UEQA 2DQXA 5BROA 5EFFA 2WNWA 1PBGA 5IFTA 4D6DA 1UR8A 4A3YA 2GJPA 5CPTA 2PWGA 3WDJA 1KFWA 2WCSA 2XSAA 5AYIA 3EDFA 3EDJA 2FH6A 3GXDA 1C91A 3U5UA 3VIGA 1VFUA 4PCTA 5CSUA 3ARVA 2F61A 2YA1A 3MUIA 2Q8XA 5CLWA 1BYDA 1E6XM 1B90A 2X09A 4PMVA 4D6JA 4DM1A 4W5UA 1LQ0A 3RM9A 1ZL1A 4E8CA 1QOXA 1GZJA 4WSKA 1V0KA 3VGFA 1HKMA 1NH6A 2X8RA 3CUHA 3OB8A 3CBWA 2GFTA 1PX8A 2DT0A 2WYSA 5DO8A 4W84A 2YL8A 4HA3A 4UFKA 3N1AA 1DWIM 1JYWA 3I3EA 1K9FA 2CETA 1HL9A 2WMIA 3BAKA 3MO4A 2V5CA 1ISWA 2WVTA 1V08A 2O9PA 2YL6A 4HTYA 3AMDA 1U2YA 1HX0A 1C93A 1NOFA 3GXFA 1VEPA 1GOWA 2J47A 3OBAA 1V02A 2G3MA 3ZT6A 3ZJ7A 3IANA 2UY5A 4QP0A 3A4WA 1D7FA 3W38A 2BY0A 4B15A 2OYMA 4Z2HA 5D4YA 2WWCA 4EKJA 1ODUA 1QNPA 3W26A 4UZSA 2EQDA 1GOMA 2PBOA 4ZEPA 3RO8A 2UWFA 2FGZA 4CKQA 2V3FA 1E6NA 4U5KA 1E55A 1B3WA 4W8AA 1OWQA 3NSNA 2PWEA 4H7VA 2WKLA 4Q7NA 4CU8A 3WUBA 1GOOA 3AS3A 1HJUA 3VM7A 1B3ZA 1SMAA 1H4PA 4HZ8A 5LYRA 3T0AA 4XV0A 4EAMA 2XTKA 4PUEA 3MUY1 3RM4A 4AWEA 5A3HA 1XHGA 2BNJA 2ESCA 5GNXA 4W86A 3F4VA 1X1NA 2CEQA 3QHNA 2VJXA 4X0NA 1MQPA 3ZR6A 4D6EA 5CZKA 4U2YA 3PZOA 4MDPA 1EIBA 2Y5EA 5D8ZA 2WSPA 4MNKA 5A2CA 2W63A 1CTNA 1UWTA 3K46A 2CIPA 3NSMA 1MYRA 3PZUA 4U33A 2OWWA 1K9EA 3AS1A 5CJ5A 1J0YA 1V02E 1E9LA 2O9OA 3HJEA 2EBNA 2PWDA 1DEDA 1XD1A 4MB4A 1M53A 4DUWA 4MAZA 4MNJA 1HJQA 3NYDA 1OINA 1CPUA 1MXGA 2WMIB 3UR7A 1QNQA 5TD4A 3WQ4A 5HNNA 2JEPA 2OYLA 1FFQA 1JDAA 2WAGA 3UERA 1V0NA 3SCPA 5I2UA 4EE9A 3QR3A 4XB3A 4FK9A 4AD5A 3L4UA 1QW9A 1JYNA 2DSKA 2G3IA 1X6LA 4ML4A 2G3NA 1B31A 4NI3A 4PMQA 4TUFA 3SCTA 4OIFA 3AXXA 5FCZA 4GZEA 1NOUA 3IK2A 2V38A 3RILA 4TVCA 4J3VA 1A47A 1VBRA 4AZGA 4P8UA 1W1TA 1UR4A 3BAXA 1OGGA 3ARPA 3KZSA 4UOZA 5A8PA 1NP2A 2W66A 4Z2KA 1VENA 4P7NA 1E0VA 1HJSA 1JG9A 5M5DA 3EBVA 1B0IA 5D9MA 1GVIA 1WKYA 2VZVA 3G6LA 1BQCA 2NSXA 3PTMA 3PZNA 5D9PA 2J78A 3ZMRA 4L4PA 3ZOAA 3GYCA 4LYQA 4AYSA 3WNLA 4BA0A 2DT1A 2WC4A 2CXGA 3L4TA 1BYAA 1B30A 3WEMA 1MW0A 1K9DA 3ARYA 2DH2A 5I6SA 1WO2A 1KR1A 3GNOA 4KGJA 2ZWYA 4LXFA 4PTMA 3K4AA 4DUXA 1JYXA 2XIBA 5GNYA 3SUUA 2WMFA 1CGTA 4YHGA 3WH6A 2JE8A 2XJ7A 3W25A 2YDRA 4M82A 2VX6A 2YBUA 3FN9A 2QV4A 1UKTA 4M80A 4BQ5A 1VFOA 2XIIA 3WUFA 4HA4A 1KXHA 4GQQA 3ZT7A 1GNXA 2DSWA 3PTQA 2WZEA 1JD9A 3D5HA 3NCOA 2QLYA 3K1DA 3F5LA 4ZE4A 7CGTA 3ZO9A 1CLVA 2J7CA 2VR4A 4V2XA 1BG4A 3WQ8A 2XUCA 3N11A 4ZXLA 4J3TA 3VTRA 5A6MA 2WHMA 4B3KA 1GJWA 1UKPA 3D3AA 3OLDA 1UKSA 1W3LA 4BS0A 1R87A 3JUGA 1JNDA 5FL1A 5CSYA 3OIHA 4XUYA 2ZUTA 1MFVA 5DFAA 3DC0A 1CYGA 1GW1A 4F79A 3GXIA 3KWXA 2AMGA 4GPNA 1EXPA 1OT1A 2XVGA 4N42A 2W67A 3AZTA 1WB0A 4GKLA 1QW8A 2XSBA 4UQBA 3AIEA 2WHLA 2ZXDA 3HU7A 4H41A 3BLKA 1XGZA 2VL4A 1XRVA 1E6SM 5FKYA 3WENA 2WANA 2D1ZA 3QHMA 3BGAA 3N15A 2O9TA 5E0CA 1AQ0A 3CZ8A 4XZBA 4WIWA 3BLPX 4LGXA 3ARQA 3UETA 4J7RA 3WF2A 3N13A 1WDRA 2J4GA 1RP9A 3ARUA 4Y7EA 2Z1SA 1G9HA 2EPKX 5CLTA 1LG2A 1JI1A 1OGSA 1QHOA 1KCLA 1HT6A 3BC9A 3K8LA 5ABFA 2XVPA 1FHDA 2UY4A 3DHUA 3NDZA 4PYSA 1B3YA 1Z32X 1W9XA 2WLYA 3OG2A 1JFXA 5BXRA 1Q6CA 4QLKA 3W29A 5EB8A 1R85A 1GQJA 3AHZA 1DWGM 1BG9A 4UFLA 1FH7A 2BHZA 1GCYA 4W8LA 1I75A 1XYZA 3F5JA 4HOXA 4J27A 3WF1A 4JKMA 2G41A 3WD4A 3GTNA 4MDOA 3MV01 4FLOA 1XYFA 2XFRA 1J9YA 3ZQ9A 1H2JA 4RE4A 1H41A 4MADA 2VR5A 4AZ5A 4AZ6A 1UD2A 4IISA 2C0HA 2VRJA 3M46A 3SEPA 3AHXA 1QI3A 5A6BA 1JF5A 1QI4A 2EPMX 1CXKA 1V6VA 1ISXA 1KWGA 2WM0A 3OA5A 1F4HA 1JD7A 1VAHA 2ZUVA 2W5FA 3UR8A 1GOIA 1ZBKA 2E8ZA 5IHRA 3WY1A 2DT3A 1UH4A 1GPFA 3CUFA 3BSHA 1CXEA 1H1NA 3WUGA 1O7AA 3WH9A 3VD7A 4TVUA 3THDA 2BHUA 4YN5A 5HDRA 4D71A 3CHEA 1KXTA 4UTFA 4PUDA 2ZX8A 3NJ3A 3VNZA 2EPLX 2ZOXA 4CD5A 2ZWZA 3OZOA 1H5VA 1X6NA 1BTCA 2ZXAA 2JF6A 1BFNA 3ECQA 3ZJ8A 4QAWA 3SCNA 5ABFB 1VJZA 1E0XA 5E6YA 3ALGA 4AD0A 4W87A 2XVNA 1D2KA 1JL8A 3A6OA 2ZX6A 2GK1A 4MAVA 3ARSA 1LWJA 2CNCA 3WDIA 2VNCA 1BGGA 3RPMA 1E56A 4URIA 3TTOA 3WMBA 2YIHA 3CUGA 4UQ9A 4Z2LA 4PMOA 4PMDA 1J0IA 2DSZA 4RL3A 3SUSA 5A6BD 3CPUA 3KL5A 4AEEA 1ECEA 2NT1A 4IPNB 1E6QM 1JZ4A 1KGWA 3K8KA 3PZ9A 4CVWA 2V5DA 4J3XA 4JIEA 3B8SA 1OGBA 3AIWA 1KQZA 3PN8A 5DT5A 5E0FA 2YL9A 4W7UA 5A6AA 1MQRA 2ZICA 3CZKA 1ISYA 4AD2A 1OD8A 3MMWA 3WL0A 3ZSTA 5A8QA 1UQZA 4UOQA 1XSKA 4PEEA 2J25A 4RE3A 2YA0A 3AMCA 2E9MA 3CH9A 5E9AA 5A2AA 1UD8A 2BXZA 4QFUA 4Z2GA 3TTSA 2CITA 4GINA 1DWAM 2E9LA 4JFWA 3U57A 1JI2A 2XVKA 4PMZA 4JHZA 4MJ2A 3M6DA 2ZUSA 1TG7A 2VC9A 5LA0A 2VTFA 1HF6A 4TX8A 5I3DA 5DF0A 1C3FA 3SCRA 4P7RA 4F66A 3AS0A 4HA1A 2DSVA 1US2A 3GNPA 4MB3A 4J3UA 4CN4A 1G0CA 4KH2A 3LPOA 4X9YA 2GSJA 1OBAA 1FH8A 2VQUA 1UR0A 2GK1B 5CPQA 3WSUA 3N9KA 1DWHM 2W62A 3BAJA 3LMYA 1FP8A 5A6JA 2VCAA 2HVMA 2DIJA 4H8VA 5HBFA 4BQ2A 1KB3A 6A3HA 3SIMA 3WEOA 3CZJA 2WB5A 4KRTA 3F5KA 1JF6A 8CGTA 3WDRA 2XM1A 4AZBA 1L0PA 3AIQA 4CN6A 1FOBA 2CESA 4EANA 1W3KA 1HIZA 3ZJKA 1GHSA 1B9ZA 1U33A 4PMRA 3IJ9A 2WLZA 1V3JA 2WMHA 4HZ7A 4AIEA 4ZE5A 3IAPA 3GM8A 3S6TA 3WD0A 5DMYA 3RJYA 4LYPA 4UQEA 3T2QA 2EEXA 1C7TA 4GO9A 3VGHA 3WF3A 3LPPA 3K4DA 3M7SA 1ODZA 4P8XA 4TXEA 3PZVA 2PWHA 3WELA 5ECUA 1HKKA 1BLIA 1M01A 1R7AA 3VGBA 2FH8A 1OIMA 4E2OA 3SCOA 5A6KA 1JZ8A 1Q6GA 5C70A 3OLIA 1H11A 3AZRA 2JIWA 4WF7A 1V6WA 4UR9A 2CKSA 1E6RA 3PZGA 4HOZA 4H8UA 4J3SA 3PHAA 3AOFA 3TA9A 4CU6A 2WPGA 4AXNA 1W3JA 1XC6A 2DIEA 3WDQA 1I1XA 2B31A 1S46A 4WKHA 3VINA 3M07A 2CERA 3BCFA 4AD3A 1UD3A 1OIFA 1UWSA 1MW3A 3WIJA 5EFDA 2A3CA 4B9YA 5ABHA 1LL6A 1JXJA 1W9BM 2D24A 5JIPA 4JFUA 1JZ3A 4AIOA 3VU2A 4CCCA 4JFTA 3WL1A 1H0GA 3FW6A 3MUZ1 3WQWA 3WF4A 3WD3A 4P7LA 3MMDA 3OZPA 3NDYA 1V3MA 4UQAA 2WZIA 2CHOA 1EDQA 3WNNA 1QI0A 1UZ1A 4ATDA 1UG6A 3EMCA 3GH5A 1DTUA 4AY1A 1E4MM 1L8NA 3UG3A 4KGLA 4PMXA 1VJSA 2ZE0A 2XWEA 3AIUA 1WZAA 1HJXA 1PEZA 3SURA 3W0KA 1CZ1A 4A3HA 1F4AA 4DM2A 1KXVA 1MFUA 1LJYA 2WVVA 3DYOA 1NWSA 1B1YA 1CBGA 2EPNA 3FHAA 4JAWA 3GH4A 3T0DA 1N82A 2PI6A 2RGLA 2D0HA 1QHPA 4MJ4A 3WNOA 3WKZA 1J12A 1TFVA 3I3DA 1JNEA 1NOWA 1DHKA 2J74A 4AZHA 1Q6FA 1ZBVA 1LF1A 3BMWA 2OSXA 3U7VA 1BVNP 3UG4A 3WQ6A 4AZCB 1SYTA 1NWTA 1XSIA 3J7HA 4W8BA 3N04A
chains in the Genus database with same CATH superfamily
1AODA 4PUUA 1FWFC 2CLHA 4V1YA 1FWCC 5E70A 5M1TA 4ADTA 3IGXA 2W61A 5SWUA 5KITA 4B9ZA 4HPJA 4LTSA 3AIBA 1UKQA 4CCDA 1NM9A 3SB0A 2WJDA 1XIDA 3OW1A 4JTUA 3VD5A 3CZLA 3SCSA 3OIXA 1QRQA 1DIDA 2GJRA 1VYRA 3W01A 1XLAA 2VM8A 2D0GA 4A29A 3W85A 1P6CA 1TTIA 1XSJA 2OQLA 3QZAA 2F7FA 1TIWA 1X38A 1ZJAA 4LAOA 4GVGA 4C7GA 2B7NA 2P0IA 4X2RA 1P1XA 4GO8A 1TA3A 3O0KA 3AYRA 4E6MA 3TDFA 2F2HA 2ZX7A 3AJ7A 3W02A 1B3XA 2XH2A 3ZSSA 3XINA 2E09A 5FSDC 2WVVB 4FAMA 4YVPA 2Y62A 2Y7GA 3CHFA 1UWQA 1TVLA 1LWIA 1RR2A 3THUA 6TIMA 4NUWA 1PYFA 4P02B 5JXQA 4D6IA 1C29A 2Y8KA 3BW4A 1XXXA 4HPGA 3WLOA 3ITYA 2O9RA 4DN1A 2QCMA 1NP0A 3TLQA 1QK2A 1OG0A 3HFYA 3IRSA 3W1NA 4TTUA 4N9BA 3SUVA 3QFWA 2BHYA 3BQ6A 3DGBA 5LKYA 2V81A 2NXHA 4WXYA 3BOFA 3NQ6A 1RVKA 1FX6A 2QCGA 2VUNA 3FDGA 3REQA 4KWVA 4BQ3A 2JALA 5AYBA 3ARZA 4XZMX 3DFTA 3PP7A 3MSDA 4US6A 2PP1A 1J2BA 2Q3OA 3R8RA 4OV4A 3NQVA 2GOKA 5LHFA 3T8LA 3PBVA 4LAKA 1NWUA 1PV8A 1OX5A 4HPNA 5J04A 2PTZA 4DY1A 1VZWA 1UD4A 1YBQA 5BRPA 2IPWA 5MKGA 2HS8A 1HVXA 3BVJA 4FX8A 1JYVA 1Z3NA 1XX1A 2QS8A 3WK3A 3L4WA 1E5NA 3B04A 4K37A 1TWDA 4B5SA 4E0CA 3LPFA 2NQHA 2Z28A 1RUSA 1HKIA 1AJ2A 2DGAA 2GPTA 1KFJA 2RJGA 1XCWA 4CD6A 3CMJA 4Z1CA 1S5MA 4JPGA 7REQA 2QHAA 1EB3A 4LH8A 3APTA 1TCMA 4S23A 4LY4A 2EXOA 3WEZA 2GJXA 3WQDA 2VRKA 3U2OA 1QAPA 2CLKA 5FD0A 4S1FA 3E74A 2XN0A 3IJQA 2VOTA 3GNRA 3HOJA 4HK6A 3FGCA 4WDUA 5KMYA 3STFA 3N2MA 3MBDA 4IMGA 4MHBA 3OYXA 5HINA 4K8EA 2YXXA 3LERA 1MVYA 5CZJA 4OBSA 1W5PA 4UC5A 2C1IA 2IPJA 4PRTA 3AICA 3VM5A 4YMZA 2OSWA 4H2CA 1MMFA 1D8WA 3UXLA 3DFOA 5GPRA 1PL9A 4X0VA 1TR1A 3RIKA 2WSKA 4CQBA 1FTXA 1TQJA 3PZTA 2BY3A 2PPGA 3VNMA 4WY0A 1WAWA 3MA8A 3GVQA 1S2AA 1W2PA 1P48A 1GQKA 3R13A 3EMZA 1MUWA 2MNRA 3VX0A 2FDSA 4ACZB 3KTSA 3LUTA 1KCKA 1QPQA 3PK7A 1AJ0A 3AUOA 3A5FA 2ZRWA 1DWFM 4LUYA 4E2BA 2QDEA 3CYJA 9XIMA 2AOSA 3GHSA 5T9BG 2WVUA 4PRWA 4L4OA 4JHMA 2VI0A 4CD7A 1OB0A 4M6PA 1FDYA 3LPGA 2QJHA 3VKKA 5ENLA 3OHIA 1BKSA 1RV8A 4PTVA 4PUNA 1UOZA 1B4KA 2C8NA 1TPH1 3W24A 1PIFA 3PULA 1K03A 3BJFA 3BLOA 4UCFA 1XRTA 2HTMA 3KL0A 3H12A 5TAOA 4UFMA 1XUUA 4DWSC 2E0PA 1K4HA 5H2ZA 2E6DA 3IAQA 4MFEA 4Y9NA 5CC7A 1G69A 2VO5A 5EMMA 2WJEA 3K4WA 1AW1A 3SSZA 4IMEA 3AHTA 2C91A 4EPBC 3LHUA 2ZX5A 1KFLA 2A7NA 4FNTA 1V6XA 1SGJA 4IG2A 4Z2JA 1QPKA 5CKSA 3KE0A 4MMWA 1YYAA 3CPGA 1M1BA 5FL0A 1M6JA 1LUCB 1IXOA 3QGVA 1HO4A 5BU6A 5LGZA 4ZTXA 4D72A 1TPDA 2AAMA 1K7EA 3UR5A 5C6MA 2D73A 2Q8ZA 2I9UA 2INZA 3IJ7A 3BW2A 3VMPA 1G67A 5REQA 4ZQCA 4S3FA 5AECA 2FLIA 5IBXA 4DJED 4LF2A 4UQDA 3C61A 3EDEA 1F61A 4MJZA 5ABGA 3ZS4A 3MSGA 3SN0A 3N6JA 4F3HA 2EKGA 3L2MA 3GDKA 2IQ0A 1EA9C 4WR3A 4AIBA 1TPUA 1RQBA 1KRCC 3DI1A 3QMTA 2BX7A 4X63A 4HJFA 2VENA 3MHFA 4HMNA 4FR1A 4ECLA 4KCTA 1VR6A 1TWWA 4C6DA 2TAAA 1P6WA 4ROQA 4NNAA 4AZCA 2XIQA 3XISA 3WNMA 2R6OA 3RK8A 3T2OA 4LEQA 5I79A 4WLCA 2VFHA 2YBVA 3W1QA 4PE8A 4A3RA 3GDLA 3NL6A 1OX4B 3A4JA 1E6PA 1NDYA 2O56A 1FHUA 3KL3A 2CLFA 4QDWA 5JIWA 2AQVA 4BK9A 1KBBA 2QXWA 1V0LA 4XVDA 1O5XA 4EIVA 2AL1A 2V6AA 4AIUA 3LLDA 2GL5A 3RITA 4ACYA 2CHRA 5T26A 1L6YA 3GSMA 2GQ3A 3S9ZA 3H2MA 1GQIA 2PGWA 3W1PA 1OC6A 1US3A 3SCUA 1DPMA 4ZR8A 3G8EA 1LP6A 2W91A 2YCLA 2VKZG 1AMKA 3LXAA 3MJMA 4P7OA 4TX9A 4CU7A 5LA1A 3ME3A 1BXNA 1HO1A 1PXGA 1TJRA 3F2BA 4GC4A 1WDWA 2DQWA 4ZQOA 3TJ4A 3W74A 5HPOA 3CC1A 2FKPA 1VLWA 2WNNA 1L8PA 3CJPA 2IPFA 4W88A 2H9AB 1HZYA 4F40A 4S2BA 1LT8A 1UWRA 1IXNA 1VPYA 1EH9A 2CWXA 2A6LA 2E5CA 4DNHA 1YX1A 5GNZA 4PMNA 2DUZA 4XZ9A 2FHCA 2C6QA 1Q7ZA 3KUMA 4LYRA 3L21A 3QHOA 1MWOA 5AC7A 3F2DA 1DP0A 1GWJA 1UW9A 3FEMA 4ADSA 3VD4A 1YADA 4RKAA 1GPWA 2GZXA 1CLXA 1Q7MA 1Q4WA 4PMJA 1C8QA 3VFLA 2WPBA 2OEMA 1VFFA 3B0UX 3VKBA 2TMDA 3VC5A 2VMFA 1TRIA 2BOFX 3PPCA 4LX4A 4CN1A 1UBPC 3D46A 5CQ1A 1ZPTA 1DJNA 2NQJA 3GC4A 1KGUA 4YTTA 3HURA 3CHDA 4KWOA 3TCSA 4IX2A 1TPB1 3MUAA 3WUEA 2PE4A 3MU7A 2Y5SA 5AC5A 1H49A 3W7EA 3M0ZA 5C7VA 3KDNA 2WC3A 2E6YA 2W9MA 3U9IA 1BAGA 3MTWA 4F9DA 3CB8A 3F4CA 1G5AA 4LEFA 4HNVA 1F3TA 4I3GA 3RCMA 4KWUA 4DYEA 1HP5A 4PZVA 1FKWA 1X96A 3URAA 4AD4A 3PM6A 3B4UA 3K8MA 2VGIA 1W9UA 3M0VA 3ZM8A 3GIPA 4QLLA 1JGIA 2PDBA 1G4PA 4FXRA 3NQBA 3H4GA 4O50A 2CWNA 2JFEX 5JBDA 1WZMA 3EXSA 4UWMA 3FAWA 4QCFA 7ODCA 5I3KA 3KW3A 5CSRA 1VIZA 2X1IA 4W7WA 3WJWA 1UYQA 4YVVA 2ZRXA 1ICSA 3WG6A 2A85A 4AD1A 5TNVA 4ZMGA 2VEKA 4CUCA 1W31A 4JIRA 1PVNA 3MJYA 5HMSA 2DH3A 1LL7A 1LLWA 5IDZA 1SFLA 1W32A 3QRHA 4FEZA 2ZZ2A 2WSRA 4AWTA 1CCWB 1G6CA 4ZB5A 3SQSA 1TE1A 1M7JA 3MDWA 3NYZA 1WKEA 3H26A 3FAXA 3RJXA 3IEBA 2OX4A 2GVYA 3GU1A 4HJWA 2OWCA 2ADAA 3SGGA 4L9ZA 5E6ZA 2HXTA 4K6AA 4FNUA 1EJXC 1PTAA 3QSTA 3R25A 1R8LA 5A8MA 4NJHA 1W1VA 1I2OA 1AJZA 4QRNA 4GQ0A 5AHMA 1S2UA 4KPLA 4A22A 3WLPA 1CWYA 5F4XA 1LROA 4GYKA 4HCLA 2Z1KA 3NZRA 1EL3A 1L6GA 1VRXA 4C1NB 4GKTA 3TTYA 2CBUA 1MSSA 3NOYA 4MF4A 3QV7A 4WVXA 4PODA 5MHBA 1PB0A 3VNKA 5CZTA 3DG6A 3S2CA 1GJUA 2DW7A 2CPUA 2OPJA 2ATSA 2HS6A 2J24A 1E4IA 3W00A 3V0SA 1SMDA 3VD9A 2ANUA 1A0EA 4Z0JA 3WJSA 1PJ9A 8A3HA 4WOZA 1TJ0A 1FY6A 2CU0A 4TVDA 2NLIA 3UJSA 1QVBA 3VIPA 3ZT5A 1REQB 4L1WA 2V3GA 2J9ZA 4C6QA 4GI9A 3NEHA 3DH7A 3T0CA 4H2HA 1WQ5A 1KM5A 1D3CA 1HKVA 1DKWA 4A05A 1TPWA 3W7LA 4HYVA 4P61A 4QR6A 3VNJA 4AY7A 1TCDA 3NQDA 5DCEA 1FHLA 3EXTA 4LVBA 1PZ2A 3MKKA 3H2CA 3SSJA 1P0KA 3TW7A 1CXHA 3QV8A 1HP4A 1TPEA 5K7JA 3LZ3A 2WZTA 1ZZMA 4O0KA 3RHGA 5CBIA 1XH0A 2ZIDA 1SVDA 2AGTA 1XD0A 3WLTA 2G0WA 4ICNA 4BF7A 3HQPA 3FX4A 3RMEA 2J27A 2PGRA 1KCZA 4RNIA 4C6OA 2ACQA 2RDXA 3DHDA 2I1OA 3VOHA 2ZUUA 4JQ2A 4M6VA 4JR5A 3WBAA 3AI0A 4KMQA 2ZZ5A 3UA4A 1G4SA 4HZMA 3GFXA 2VP8A 3P14A 5G4WA 2ONEA 3AXHA 3FYYA 3CGTA 4O12A 1CECA 4PMUA 3CMFA 5LIUX 2XISA 1CDGA 1YMYA 2OQYA 3WBEA 1S2WA 4LPCA 3TONA 1YLVA 3S2NA 1WXJA 2EG7A 2GUYA 3UBPC 3R94A 3WN6A 4ZOCA 3WLIA 2Y2WA 1KRBC 3TU9A 1ZJBA 4Y90A 4MWAB 3UEQA 1OX4A 2DQXA 2L5HA 2EPHA 2I14A 1YW1A 3TYEA 4HCDA 3EPMA 1FBAA 3B8UA 2PWGA 2VHLA 1BWVA 2WCSA 5AYIA 4FA3A 5KINA 3EDJA 4RNFA 5CPOA 4Z1YA 4JY8A 3GXDA 5KETA 3VIGA 4GI4A 4PCTA 5CSUA 3FDKA 2J88A 4I9JA 4E2DA 3OVPA 3EOEA 2F84A 4PFMA 1XINA 1B90A 3TE9A 2X09A 4TU1A 1IWPA 4EVZA 2RDTA 4O53A 3M44A 3EEZA 3C0SA 3RM9A 1YRRA 3KLLA 3LD5A 3NPVA 3RCYA 4B5TA 1Q45A 1E0UA 1HKMA 1NH6A 2YCIX 3TXVA 2GFTA 3SN4A 2WYSA 2PWUA 3TN5A 3GVRA 4ZO9A 2A3LA 4HA3A 4UFKA 4L7ZA 1DWIM 1JYWA 3HQOA 2OEJA 4ZFCA 1ISWA 1P7TA 1V08A 2DUXA 5C2CA 2EHHA 2H9AA 1EX5A 1HX0A 3ATZA 1NOFA 4K1WA 4FNPA 1QFEA 4MSSA 1NJJA 1S3TC 3ZT6A 1AG1O 3IANA 1LQAA 4QP0A 5EY5A 3RG6A 2OFJA 3FJNA 2RUSA 4Z2HA 5D4YA 4EKJA 5BNKA 2PD9A 1ZNNA 4JTGA 1TJ2A 1GOMA 4ZEPA 5HNTA 2C71A 1E6NA 4U5KA 1E55A 3KOWA 2WKLA 4QQUA 3HG5A 4CU8A 1GOOA 3VM7A 3T8QA 5LYRA 3KX6A 2XTKA 4C6JA 2YSWA 3MUY1 4H6KA 3RM4A 5A3HA 4NAEB 4QS5A 5GNXA 4W86A 3GTFA 1A3XA 3PZOA 2F2KA 4K3ZA 4RJEA 5CJNA 3LCIA 2YB1A 5A2CA 2PLJA 3K46A 2CIPA 5RUBA 1JGMA 1K9EA 3AS1A 3PFMA 1KM1A 4YCPA 2QCCA 1Q6RA 4G56A 1HKWA 4QJ1A 6ALDA 3LYEA 3MPGA 4H19A 3WQEA 1H62A 2PWDA 3UR7A 3NAVA 3WQ4A 3NWRA 2FQIA 3L66A 1JDAA 2Q3RA 2VC5A 4EE9A 4XB3A 3OVRA 3GG8A 3L4UA 3Q67A 3PJUA 3CQHA 3BV4A 4KWSA 4ML4A 4OIFA 1A49A 2OR2A 2YYUA 4BF5A 2IMRA 4GZEA 1DXEA 1NOUA 3BCJA 4N7QA 2PDIA 1JCMP 2BTMA 1PTDA 1FDJA 3PBWA 1W1TA 4JQ1A 1OGGA 2PTYA 3EX6A 1A5UA 1F6PA 2W66A 4DI8A 3W7CA 3WLRA 1HJSA 1KRAC 1W54A 4CQAA 3TKFA 4MUZA 1BQCA 2NSXA 3PZNA 5D9PA 1FCQA 1WBHA 4JOMA 4PRRA 3WNLA 3UJRA 1DV7A 5XIMA 2WC4A 3L4TA 2BB0A 1MW0A 4S3BA 4Q8QA 2DH2A 4O8RA 5DY3A 4DJEC 3ZLFA 1ZENA 2EKCA 4RR4A 2XJ7A 3SGZA 1EYEA 3KLKA 3FCPA 1GVQA 4M82A 2YBUA 1SZFA 3JR2A 3TTEA 4I90A 1EJSC 2QW5A 3UCCA 2XIIA 4RXFA 1FRBA 3C8NA 5CAKA 3LQLA 4NXSA 5D2VA 2WZEA 3NCOA 2QLYA 3K1DA 4N6FA 5EYWA 3F5LA 1O60A 3BOXA 1FWGC 2CLMA 7CGTA 3ZO9A 1W1IE 4RPQA 4I7WA 2XUCA 3MUCA 1IYXA 3N11A 4ZXLA 4JTAA 5A6MA 3R1ZA 3QLDA 1UKPA 1W3LA 3HF3A 3PANA 3HGOA 5FL1A 4LVAA 1TJPA 1TYGA 1KM0A 4AWSA 3LGDA 3RNDA 2PTDA 4G9PA 3CQIA 3GIYA 2AMGA 3GW0A 3QM3A 4HGXA 1N55A 2ZDSA 4R7JA 1QPRA 5HAOA 2YCJA 2Y88A 1YE6A 2WHLA 4H9TA 5BOFA 3A9IA 1QT1A 2Z1VA 3SAZA 5LNUA 2VL4A 3WBXA 2YYTA 1A0CA 2PDLA 1A5CA 4AF0A 1VCVA 4IGMA 2D1ZA 2QUMA 4AVNA 3TW9A 4XUGA 2O9TA 1AQ0A 3TFCA 2HNHA 4XZBA 3FJ6A 1YPXA 4L6DA 2OG9A 4XD6A 2I9EA 3WF2A 4JN8A 3EGJA 2V68A 1RP9A 3ARUA 4Y7EA 5HJXA 2EPKX 2WQPA 3N9RA 1LG2A 1H7RA 2Y7FA 5E1QA 1QHOA 2Z1WA 1KCLA 2OKOA 1YTDA 3CS2A 3IGHX 2DU2A 3C2OA 2V5KA 5CC5A 4JYDA 3NDZA 4EWND 1SW3A 2ZZ4A 3IVUA 3QYSA 1LBFA 5D37A 3WQPA 3OG2A 3GAYA 1JCXA 3PTDA 1JFXA 3H2AA 3W29A 5EB8A 5DRIA 2P1FA 3TWAA 1BG9A 1B4EA 2NV2A 1XQKA 2P8BA 2PP3A 1FH7A 2XIMA 3QC3A 4HNOA 3GR7A 3IJIA 3KZPA 3F5JA 1OG6A 4JS3A 3WF1A 1DJIA 4GX8A 1F6KA 1H2JA 2PZNA 3IJLA 2ZZ7A 4MLJA 3DGRA 4IISA 2C0HA 1JR1A 2VRJA 2CZEA 4O57A 3AHXA 1XPYA 5A6BA 2EPMX 3UGRA 4Z08A 4GVFA 1SJDA 2QDDA 4MWAA 3CPRA 1ZBKA 3WY1A 3A23A 2CLIA 5K4XA 1XYBA 3V0UA 2O4QA 1RBOB 3LK6A 1PKYA 3LY0A 4B4HA 5LIXX 5D2XA 4KEZA 3QMSA 1O7AA 4LUSB 4BJHA 4QG8A 3THDA 4EXBA 4YN5A 1TTQA 3VZZA 4IMCA 1DTNA 2RDUA 2DY3A 4M5PA 1H5VA 3KRZA 3W2KA 4OVXA 3FSTA 2REQB 3SCNA 3NDOA 4AD0A 3NA8A 2QGYA 4MAVA 2VNCA 1BGGA 1Q6OA 1S3HA 4NZJA 4IOTA 3KP1A 1UIOA 2RDWA 4OBTA 2P3ZA 3TTOA 3WMBA 3TYDA 2YIHA 3EX2A 4UQ9A 1KKOA 3BW3A 4AG0A 2G97A 2AQOA 3KL5A 4AEEA 4YTSA 1E6QM 4BI6A 3CEPA 3K8KA 3PZ9A 4FI4A 2ISFA 3URQA 4ADUA 2DJXA 4J3XA 3MHGA 1KO0A 1NDVA 3PN8A 1TRDA 1GVSA 3LENA 5AVHA 4PUWA 4JTSA 4UR8A 4MY8A 1R9XA 2A1YA 2W3ZA 3ZSTA 4UOQA 2R1PA 5A5WA 4EAYA 4IIDA 2J25A 4RE3A 3WQFA 3QXBA 1XIMA 2YA0A 3AMCA 2ZRZA 4HN4A 3MI6A 4RDYA 4QFUA 4QSFA 3WYZA 3WFAA 4Z2GA 3TTSA 2V5JA 1DWAM 2E9LA 4ALDA 3NFUA 4ERAA 2ATMA 3GXPA 2TSYA 3M6DA 2VC9A 5B7ZA 4TX8A 1J96A 4JTCA 5I3DA 5DF0A 1C3FA 4OFCA 3GNPA 4DJDD 4Q33A 3UPWA 4J3UA 3TXZA 4KH2A 1NY1A 3TSBA 1TWIA 1P0NA 1UR3M 4NJKA 1UROA 4MVAA 3N9KA 3SR7A 4B5XA 1FP8A 4DJFA 3ITCA 1QMLA 2NQ5A 5H6HA 2Z0IA 3RXZA 4BQ2A 4HNCA 5KZMA 2WB5A 4O1AA 1W1A1 3W70A 2YCEA 8CGTA 2OVLA 3ANUA 2J6XA 4CN6A 3HZ3A 2GJLA 3ZZ1A 2CESA 1U5HA 2XIJA 1HIZA 3W76A 2ACUA 2YXOA 1GHSA 4NZ1A 1YXYA 1U33A 2I56A 5D05A 1R47A 2IS7A 4NASA 1OZQA 4F2BA 2I17A 2B7OA 4AIEA 4I7UA 3IAPA 3QQWA 4KRZA 3RJYA 4LYPA 3NQ7A 1ENUA 3VGHA 1E9ZB 3WF3A 1VJIA 4XAFA 3W23A 9RUBA 3M7SA 4TXEA 2PWHA 3WELA 4Q8NA 5ECUA 4E2OA 3SCOA 1Q6GA 4WF7A 1XG3A 1E6RA 3GDRA 3WLNA 1UP0A 1GYMA 1U1UA 3TA9A 3LGGA 4CU6A 3IIPA 3QYQA 4AXNA 3D3FA 3QQ1A 1XQLA 1XC6A 2QVHA 3ELFA 3S1XA 1PDYA 1KV8A 2O4MA 4O28A 1XDLA 1AZ1A 1W9BM 3OYZA 3EWUA 2D24A 4JFUA 4GIYA 3W72A 1GTHA 4A8RA 3I65A 4JN7A 5EIYB 1F7BA 4P7LA 4DBWA 2Y8UA 3BLLA 4UMCA 4UQAA 2WZIA 3ZFHA 3VNDA 5HUPA 4RZ5A 5K9DA 1UZ1A 5AB3A 3GH5A 4NJIA 5HJYA 1MRQA 2ZE0A 3KOFA 3DHFA 3AIUA 4GISA 2GQ8A 1CZ1A 3LNMA 1XFCA 4TR9A 4GJIA 4A3HA 2Y89A 2QCDB 3CV1A 1BXBA 1Y5VA 1NWSA 2GGHA 4GXMA 1F73A 3EPNA 5EKYA 3GIQA 1I6NA 3EWWA 3HV9A 3FJLA 4J4KA 1QHPA 2PLMA 1J12A 3I3DA 3S1VA 4EWJA 4GBUA 3DFNA 4PTNA 3BMWA 1H1YA 1LCOA 5ECVA 1H7WA 3QKZA 4UTWA 3N04A 5TQLA 4J2PA 3HPAA 3RLVA 3VOCA 2FDMA 2OZ3A 3T9PA 4BCEA 4L9YA 4Q8VA 1E4NA 3N18A 2WWDA 2IQDA 3MZNA 4C6FA 3IIXA 4RNJA 1A50A 3DZ1A 3O05A 1FWIC 5GJNA 4C7FA 4CEXC 5J8LA 4UNKA 3FKRA 5BZAA 1JCLA 1TTJA 3KTXA 4O17A 4XSLA 1UD5A 4XISA 3ISIX 3CTTA 1LORA 1FWRA 3G1SA 1WDDA 3UY7A 2RGMA 3CUIA 3TC3A 2YKKA 3M0YA 3P74A 2CXEA 4AX7A 1OYBA 2XU2A 2G8ZA 3EB4A 1UC4A 4LQ1A 3E5BA 3W2NA 4O54A 5DANA 1G01A 3UXAA 3VDHA 2UY2A 5C55A 2P76A 1OQFA 2QPSA 1Z48A 3B4YA 3PBGA 4Y8FA 3GNDA 2D20A 1E6ZA 4OOUA 1BRLA 2VC6A 4EACA 1E0TA 3WDPP 4PTXA 2OELA 4LJ3A 4W9TA 1VBUA 4W85A 5IOBA 2A3AA 3G1RA 2VEGA 2XGZA 4H01A 4ZSUA 1TZZA 1CEOA 1SZNA 3LCLA 4HOWA 1FXPA 1Y7VA 3T81A 3IVTA 4MTVA 4G1KA 3E0FA 2WMGA 1UUQA 2JIEA 4P8VA 1E43A 1UA3A 1Q63A 1CW2A 4I6VA 1KTNA 5IBXC 1XPGA 2FGLA 1LOLA 3WQVA 2WBGA 3AUJA 4NXKA 1KWKA 2OLHA 4WK9A 1UKOA 3SBFA 3OZYA 1CGUA 5FI8A 3II1A 1EEPA 3RF9A 3UVIA 1G94A 1JCTA 3PUOA 4XX6A 3L5AA 3IGUA 3HG4A 3U48A 2FHBA 3LXCA 1RH9A 4NZFA 3W37A 3U2ZA 3HQ1A 5HXMA 1MXSA 1XCXA 3Q37A 2XGBA 5E5CA 3ITXA 3LEPA 2REQA 4BR1A 1IEVA 3V75A 2Q09A 1Y8BA 3KBMA 2GVEA 1UZHA 1I8JA 4RX0A 4FLSA 1JCJA 1TJ1A 3W1LA 1IEWA 3LRMA 2PDJA 1E51A 3V3WA 1KKRA 4QDMA 4FMVA 3RUBL 1Q85A 3I6TA 3NQEA 4GVHA 2DDXA 4LUTB 1TMQA 2WJZA 1W1ZA 4ZQNA 3V36A 4B91A 3K5XA 4I8DA 4IMFA 1XBYA 4OOZA 4DELA 1AD1A 4QBXA 3G18A 2QUUA 2EO7A 2VCBA 3C2VA 4GI8A 1Q65A 4PB3A 3STGA 2D2JA 2E1DA 4FIQA 1TV2A 2PODA 4HT3A 3ZVHA 4LOCA 4OT7A 4ZTYA 3BCDA 2I5IA 4JIPA 2PDYA 3C2YA 3TJLA 2GUUA 4O14A 4RZ4A 5E0KA 3F4DA 1UZDA 3O3RA 3R8GA 1MW2A 4JIIX 3YPIA 2CLOA 1JCYA 4GABA 4OECA 5AZ1A 5FJPA 2R1KA 1OD0A 1E40A 3GZAA 1VFMA 1HJVA 4WSJA 3WF0A 1W1B1 2XHYA 3QOKA 1MEWA 3N2XA 2VX5A 1F5ZA 2I16A 4HU3A 3SM0A 5I3IA 4M81A 1JPHA 4M29A 4UOJA 1QO5A 3TSMA 4JDYA 2WJFA 1YDYA 4ERIA 4IQJA 2ZUNA 1D9EA 1CGXA 4LT9A 3DFSA 2EPOA 3FS2A 2AQWA 4XBSA 4DUOA 3AXKA 3OLEA 4WCJA 5FACA 3SCVA 2IPGA 4RE2A 4U3AA 5G4EA 2CLPA 5EA9A 5D8WA 1E3ZA 4QE4A 1D3GA 1EBHA 2VGGA 4AC1X 4GXWA 4D1JA 1E0WA 4PCFA 3IRDA 3EOSA 4NHVA 2DVXA 1FP9A 1UR2A 1I2NA 1Q66A 4GY7A 2J66A 3O7UA 1JULA 4AW7A 1K7XA 4Q8WA 2Z6IA 1UCWA 3E9AA 2AL2B 4W5ZA 1FWNA 2HROA 1LBLA 1EZWA 4DO6A 3AS2A 5I0DA 1W8SA 4L1XA 5A6SA 4GLEA 3PWAA 3TAOA 3VGGA 3LSCA 1UMLA 1WNOA 3VYLA 2YLAA 2V2HA 1PCKA 3UW6A 2DVUA 4QROA 2P3EA 4L61A 4D1IA 1AMYA 1ZBCA 3C0QA 3L4XA 3EDKA 4AISA 3ZVIA 3QOMA 5I23A 2QMKA 1HXJA 4JNZA 4R7OA 2TODA 1SR9A 2PDGA 1J0ZA 3NZPA 1OYAA 4BHYA 1KLZA 1M7XA 3JU2A 1LRQA 3LM7A 1C8YA 3TVAA 4HNTA 1HN1A 1ELSA 1EC8A 3W82A 2OGJA 1V93A 5EMKA 1EQPA 3G77A 4CGTA 1JAKA 4IZGA 2FYMA 5CPSA 2R1MA 1ITQA 4HNLA 4Z1BA 2OT1A 1C8VA 2XYLA 5LSMA 2AKZA 3OEXA 4FF5A 2X0HA 1GVYA 4RW5A 1C92A 5KTLA 1G4EA 3NUKA 4HYWA 5CG0A 3W27A 1TPFA 4AH7A 2ZFAA 3EPOA 3AALA 4EF8A 5MF5A 2YDAA 3UPMA 2C19A 4W93A 1KBJA 4S3DA 2Z29A 1EYWA 1GONA 1H1ZA 3GBDA 3AQUA 1LYXA 4O1DA 1LDCA 2QEZA 1UP3A 3H4WA 3V5OA 1V0MA 4HB7A 3QJAA 1SM9A 1GYLA 2BDQA 3BO9A 4O1CA 2P10A 2NVCA 1TUXA 3MV11 4E2VA 5E93A 3SRKA 5H8MA 2E67A 1IIHA 3TYAA 1GORA 2VR2A 3UWWA 4IIHA 2FZDA 1XR2A 1W17A 5BMXA 3OLGA 2VGFA 2Y1HA 2V30A 2DJLA 1QHZA 2A5HA 4TTGA 5B80A 5HQEA 4AZ7A 1PZ3A 3SECA 2VZUA 4Y9OA 4M3PA 2D3LA 3BSGA 3N4AA 3WH7A 4GIAA 1TZ7A 1CIUA 3QFEA 1RP8A 4A8LA 2VD9A 3QF0A 3DXIA 3L0KA 4N6EA 1O6IA 4LANA 4LNYA 4LB3A 1SO6A 3V0TA 2WXDM 4LW7A 3WMSA 2PBGA 3UCQA 1V3LA 3KOZA 4GI6A 3MI2A 3W7MA 4V27A 1PWMA 2W79A 4R27A 4WJ8A 1EGZA 2PZ0A 2CZ5A 1XLBA 3W1UA 4O13A 3OVGA 1T99A 4ICCX 3FA5A 3GTHA 3S5NA 3THQA 1ZRQA 3VOGA 2Y4SA 1WE5A 2ICSA 1QWGA 3BG3A 2B0MA 3WFLA 1VHNA 1LRTA 4I5RA 1Q6LA 2DIKA 2JK2A 3E5PA 5I3GA 1TVNA 1XJBA 3LG3A 4MYAA 2ALRA 4V1XA 3UG5A 3VIHA 1TMHA 1L6SA 4CNPA 3W6YA 1ML1A 1ESWA 3WBWA 2PB1A 1P43A 1E73M 2BVDA 2QF7A 4Q8MA 4PB5A 4AZIA 2QCFA 3V18A 1KFCA 4H1ZA 3STEA 1ZJHA 1B3VA 5D9OA 2IXUA 1WKDA 4DJDC 4GH1A 3AISA 5KEZA 4OZOA 1F74A 1S1RA 2HISA 4LAMA 4WOQA 2YCKX 3G6MA 3B97A 3ALFA 4JNYA 1KBKA 5C8BB 1XLIA 2A3BA 2VGBA 4F2UA 4E8GA 5I5RA 2ON3A 2Y6ZA 1JFHA 4JFVA 2BLEA 1P4CA 2ZBTA 1EGVA 2FMNA 4NX0A 3W7JA 1DHPA 1VB9A 4QAIA 1EHAA 3ARXA 3VZXA 2O92A 1I1WA 3TZFA 1AW5A 2QPXA 3H55A 4GUFA 2D22A 4GA8A 1A5MC 1IHIA 4IIFA 3OP2A 4JFSA 3W28A 4AEOA 4BQ4A 3EA3A 2BVTA 1JDCA 3FJ4A 4WKFA 4F4RA 3DKJA 2J75A 1YNYA 4YVXA 4ZXOA 3DN5A 4GZIA 4ENLA 2GVLA 3SZ8A 3VAVA 1DXFA 2A3HA 4IP5A 3VD3A 1K7FA 1PX3A 1RY0A 3W75A 2UZ9A 2EG6A 1Q2RA 1ZS2A 2ASHA 4HSNA 1FH9A 2R91A 2VUYA 3KRUA 3UCDA 3CUJA 3FHQA 1JPDX 3WK0A 1O12A 3ARTA 1OVDA 5BCAA 2XZ9A 4UTIA 4DYJA 3L12A 1Z9AA 3EKZA 3P67A 3CWOX 4UTHA 2FTYA 1BYBA 3N29A 4IX0A 3BG9A 1X97A 1AVAA 3AMLA 4GNVA 3CHCA 4GMEA 3P0WA 5DX7A 5I24A 4DWSD 2OZ8A 4D8ZA 3TWBA 1PUDA 6XIAA 5FIPA 4FPSA 2QF8A 4NQ1A 4TMBA 4A8IA 4NVTA 3A64A 1SJBA 3S9IA 1IV8A 2J7HA 4MUPA 4AAJA 1G4TA 1A53A 1QNSA 4DWSB 3G1FA 2YR1A 2V9DA 3WH5A 3SUWA 3BLIA 3AZSA 4L4LA 1R7OA 4UMAA 5FEZA 4FXFA 4JTFA 4UBPC 1Q6QA 2RFGA 3KDOA 3QY6A 3T55A 3CV6A 1HGWA 3R8HA 4H8HA 2MUCA 6CGTA 1W1YA 4JKKA 1CX9A 2XPKA 4Q8OA 1PIGA 1BEUA 1XBVA 4FOUA 3FY1A 3DFYA 1WDQA 5F1UA 3LTPA 4XO6A 3TQVA 1OFAA 2X41A 3PR2A 4NSBA 3DBNA 3R43A 3ONBA 2PTWA 5K3VA 3S6OA 3POHA 1MW1A 1OFRA 2PDFA 3KVJA 1NFPA 3C3NA 2E68A 4XAYA 4GJJA 3IJ6A 3PUDA 1KGXA 1W3TA 3VABA 4QJ3B 1O95A 1J10A 4N9CA 1HUVA 4AWUA 2GSHA 3VNYA 4H6QA 1VPXA 2ZX9A 4NIRA 1JDFA 2C0AA 1F8MA 4R85A 3CQKA 4XAZA 1F8IA 3L67A 3S47A 4CQDA 3OGRA 1KQYA 5CPNA 2F6XA 2WW5A 1Z42A 3T78A 2YDQA 4EX4A 2QIIA 5I77A 3TZNA 1J6OA 3OVQA 4EK7A 3L4VA 2F8QA 4I6KA 4I8YA 3VGEA 3N73A 1X1ZA 5EMYA 2GLKA 1UR1A 2CC0A 4JCLA 4U3CA 2W6RA 4MZ1A 5FJRA 1T40A 4HQVA 1UB3A 1KRMA 3KBWA 3VDBA 1E4LA 4PULA 5JH2A 1D8CA 1WPCA 4H00A 1LZOA 2ACRA 4ZB0A 2BXYA 4ZL1A 1V3IA 3B8IA 3GR8A 4DBEA 4C6IA 4IM4A 3EKLA 1EO7A 5AHIA 1LWHA 3L4ZA 2JF7A 1DIOA 3HB9A 1RHCA 3FXYA 3TUUA 3NSXA 4XD3A 3DKLA 1MO0A 1E70M 4GD0A 3M5ZA 5HULA 3THCA 1OCNA 4JEQA 3MS8A 4KETA 4G5DA 1Q8JA 5HMDA 4CNTA 3O6DA 3BTNA 4KW2A 1EJ7L 1WDPA 4X3ZA 4CQ8A 3A5VA 1WCGA 3PBYA 3GDBA 2E40A 3MHUA 7TAAA 1DE6A 4I9TA 3N4EA 4H7ZA 4M56A 4H3DA 3W1AA 1F6YA 1RK6A 3GHRA 3GUWA 3VDCA 3N14A 3HG2A 2X05A 3DDMA 4C6EA 3T1GA 2DT2A 2QCEA 3W71A 3EWZA 2QDGA 5EFFA 1XYCA 4D6DA 3H7VA 1M9HA 1KFWA 3AAMA 3B0XA 3QH2A 2OXNA 2R14A 2YA1A 3MUIA 5CLWA 5D09A 2BGQA 2PURA 3W2LA 2Y70A 1T8XA 4PUKA 2O0TA 1DE5A 4PMVA 3TNBA 4W5UA 4E8CA 3L68A 5I7GA 1QOXA 1P5BA 1GZJA 1P0EA 4XVEA 1JQVA 3C0JA 4H9VA 5FEPA 1GTEA 3OB8A 4KF1A 4DZIA 1R2TA 1CT5A 4W84A 1EPVA 1YPFA 4TIMA 5HQMA 1K9FA 3BAKA 3MO4A 4ZOBA 2V5CA 2YL6A 4EPDC 2BP1A 1U2YA 1MNSA 3MCMA 1US0A 3GXFA 1VEPA 4NZ5A 1LRNA 2ZVRA 1R3SA 3OBAA 4B5WA 3S3GA 3ZJ7A 4LWWA 1EJTC 3DFPA 1A0DA 3M1ZA 4REQB 3URBA 2QAFA 2XSXA 2OYMA 4QM1A 2WWCA 1ODUA 1QNPA 4UZSA 2EQDA 4KFPA 2PBOA 1RZMA 3RO8A 3CL7A 4CKQA 1I2QA 1R30A 4Q6JA 1B3WA 4AY8A 3K2GA 3NZGA 4LS1A 4W8AA 4CEUC 3NSNA 2FZNA 3AS3A 1HJUA 1VFLA 1GG1A 3DFQA 3TR9A 4LBUA 3B03A 4PUEA 1OZMA 3W88A 2FMOA 1VH7A 1T41A 3IIVA 1ZJIA 3SRHA 1AH4A 3QN3A 1X1NA 3QHNA 2I5QA 3P8JA 3MVTA 2IKGA 1MQPA 5CZKA 5FAGA 2W63A 1JPKA 3F4NA 2V5BA 1B9BA 1XIHA 3NSMA 1MYRA 2FVKA 2WM1A 1YNQA 2GVGA 3CHVA 1O66A 2C3ZA 1XD1A 1GJPA 4MNJA 3BICA 1YXCA 1MXGA 2WMIB 1A80A 1QNQA 2JEPA 2FPYA 1XLHA 2WAGA 2V5LA 5I2UA 3QR3A 4FK9A 4GYJA 2OODA 3TR2A 4AD5A 4YWSA 4PR4A 4M7SA 1X6LA 5AHEA 3CO8A 4NI3A 1V7AA 4HK7A 4TUFA 4Y96A 3SCTA 4O0ZA 3JS3A 3N9SA 4HYRA 4LFYA 3IK2A 2V38A 4J3VA 4FNSA 1A47A 4P8UA 2PGEA 1UR4A 5F4SA 1Z69A 3IGSA 4H9YA 2Q8LA 4GUHA 3C86A 3H54A 1NP2A 3QZEA 4Z2KA 1VENA 5AVNA 1E0VA 5M5DA 2A21A 4WSHA 3PPFA 4HIBA 3G6LA 3UJ2A 1XLGA 4G2DA 1HGYA 4L4PA 3QV6A 3ZOAA 3GYCA 2VWTA 1VHCA 2DT1A 1M7OA 2PRHA 3M5YA 2CXGA 1B30A 3CUZA 1FCBA 4RDVA 5I6SA 2FPVA 1KR1A 3W2JA 2ZWYA 4UCGA 1QR7A 1JYXA 4FX6M 5DMLA 3CT2A 3SUUA 3L7RA 4UTTA 4C1LA 3W25A 1MZHA 2BSLA 4GQBA 2R1NA 2VX6A 3E02A 1RCXB 1X7FA 3W7RA 1VFOA 3G1AA 3PJTA 4HA4A 4WD0A 4GQQA 1GNXA 1XRSA 2DSWA 2Z1XA 3U8GA 3DOPA 3R0UA 4Y6GA 4ZE4A 4M19A 4M6UA 1CLVA 1RY8A 4HKPA 4IHCA 3M0LA 4ILSA 2NWRA 1BG4A 3PAOA 3O16A 4A8NA 4J3TA 4WDTA 1LOQA 3G0XA 3OLDA 2IW0A 4BS0A 2ZTKA 1OY0A 4TV5A 5CSYA 4O4VA 3OIHA 1SFJA 1UMYA 4NP7A 5DFAA 4FB7A 1CB2A 3GXIA 3NL5A 3KWXA 3HBLA 2H90A 4BWLC 3RPTA 4N42A 2FTPA 3ABZA 1WB0A 3G0SA 1S1PA 1QW8A 2XSBA 4DJFC 4QISA 3AIEA 3HU7A 4HN8A 3BLKA 4K8GA 2FB3A 1AA1B 3OQ8A 4ZODA 5C9RA 1XRVA 3ATYA 4JQ4A 4JBRA 2OOFA 3W7QA 1TREA 3NO1A 3N15A 1RCOB 5FJTA 2NUYA 1GQNA 1H61A 3VUSA 3BLPX 4LGXA 3OJGA 3UETA 1XLLA 2J4GA 3EXRA 1T7LA 4L5ZA 3C2RA 1XDJA 5CLTA 1JI1A 1I4NA 3BWWA 3M0XA 2H6RA 2ZVIA 2NXGA 1HT6A 4MZ8A 3BC9A 3VNLA 4LF1A 5ABFA 1FHDA 4QG9A 1PYMA 2BZNA 3E12A 1L2UA 3B40A 3VC6A 1EUAA 1O1ZA 3AYVA 4QLKA 1GVRA 3P60A 3NZQA 1R46A 1R85A 5I06A 1RLCL 4IICA 3GTXA 2BHZA 3FK4A 5G5IA 1GCYA 4W8LA 1I75A 5CAHA 5JQ9A 4HOXA 3UZXA 4J27A 3N19B 2G41A 3BGJA 4KFOA 3W22A 4LU0A 3WD4A 3GTNA 1PTGA 3GVVA 3I7QA 1XYFA 3ZQ9A 4KT2A 4XKYB 1TB3A 2VR5A 1RBAA 5HUOA 3SEPA 3M46A 3UZWA 3LCHA 5FA5A 3N4FA 4DBSA 2V2DA 1CXKA 5G1YA 1V6VA 3FXGA 1ISXA 1KWGA 1DJGA 4M1BA 3RRXA 1RCQA 2ZUVA 1VAHA 1SZRA 5EJZB 3R5EA 3BZGA 3NQFA 5A6TC 4H7CA 5IHRA 1XM3A 4J2MA 1UH4A 4E3TA 2R1LA 4KIEA 1W0MA 1XC4A 2Z27A 3MSYA 1CXEA 1EJUC 3UWZA 3ZR4A 2XH0A 2AKMA 3VD7A 3QPEA 2VDHA 1WA3A 1A5LC 1V5XA 3F2CA 3B8WA 1KXTA 3VNZA 3BJSA 3TLLA 2ZWZA 3GRIA 1X6NA 1XWYA 1BTCA 3ZJ8A 1POJA 4W87A 1D2KA 1V51A 4AHOA 4EPKA 3VOIA 3B0YA 2B4GA 4DIAA 4UTWC 2B7QA 3UNDA 1XF0A 4ML9A 3ARSA 2F38A 2CNCA 3WDIA 4HHLA 3RPMA 2X40A 4URIA 3WO8A 4NJGA 3I4KA 7PTDA 2CFFA 2X2GA 3CUGA 4DBDA 3QMRA 4A35A 5C9ZA 4PMDA 1TPVA 1EKOA 1J0IA 2DSZA 3SUSA 3CPUA 2JKPA 1Y65A 4IPNB 4K39A 1JZ4A 2QAPA 4MOZA 1NDZA 4CVWA 4M51A 2V5DA 3TA6A 3UWQA 1KQZA 4AQLA 5E0FA 2YL9A 4EP8C 3KFTA 3SGUA 3GXTA 1R5YA 2NUXA 3WL0A 4GC3A 4B5UA 2GOUA 1UQZA 3QQ0A 1HW6A 4DNMA 1TIMA 3W2UA 3CLMA 3O6YX 3EOLA 2E9MA 3CH9A 3LCFA 1ZUAX 3D0CA 3QGKC 5TF0A 3DENA 1LOSA 4LY8A 1AH3A 3NR0A 4GINA 3MDUA 1A5OC 4JFWA 3NL3A 2EAWA 4PMZA 3P80A 2ZUSA 1TG7A 1S38A 3O8AA 3EOOA 4ES4A 1JQXA 3B8TA 1HF6A 1VFTA 4O0QA 2OOGA 3SCRA 3FFSA 4YU1A 1OYCA 4F2TA 1MEIA 1M65A 2INEA 1US2A 1G0CA 4ORMA 4X9YA 2GSJA 4E4UA 5GJMA 1ITUA 1KTBA 4IWWA 2GGIA 3R4IA 4FXJA 4R9XA 2HCVA 2GK1B 4QHRA 5K4ZA 1DWHM 3BAJA 3FKKA 3LMYA 1Z41A 5I02A 4XTIA 5HR6A 2HVMA 4DAIA 4H8VA 4Y9AA 4GQGA 2HDJA 3DU0A 4GUJA 3GFYA 3F5KA 4F0MA 1JF6A 3TQ0A 3U3HA 2XM1A 4AZBA 4Q7IA 4OUIA 3AIQA 4DLMA 4EANA 1GVOA 1EWDA 4DHGA 3ZJKA 4CQ9A 1XLJA 1B9ZA 4S39A 3IJ9A 3SQLA 4ZOAA 1V3JA 2WMHA 1XFBA 4GIEA 1F76A 3R0DA 1NAL1 4XAPA 1BXCA 4JTKA 5DMYA 4UQEA 4Z1DA 5C2GA 3T2QA 4GO9A 1TV8A 3OG3A 1S2CA 3K4DA 4P8XA 3HO8A 3PZVA 4F0HA 4NJJA 4XSMA 5I3JA 1DVJA 1OIMA 1SW7A 2FFIA 3ABSA 1QXLA 3ANYA 1X8CA 2QJJA 3AZRA 4IIEA 4IFKB 4UR9A 1S5VA 2CKSA 1OABA 3PZGA 4HOZA 4H8UA 2HE5A 2P88A 3AOFA 3PHAA 4GUGA 3E96A 1NELA 3P93A 4R34A 2CERA 3S5OA 5AN7A 2Y5JA 1JPIA 2PDXA 2VC7A 1R9ZA 1OFDA 3FYPA 2HMCA 1XISA 2A3CA 3MP5A 3PBUA 5JIPA 3QR0A 1JZ3A 3N6QA 3CT7A 3MUZ1 2HWGA 3FW6A 2O7QA 3CQJA 1TV7A 1Y0EA 3MMDA 4IT1A 1V3MA 1X8FA 3HPFA 4IP7A 1IQ8A 1PKNA 1UPPA 1QI0A 2DZXA 4ATDA 1UG6A 1DXIA 4Y2WA 4GHRA 4NZ4A 1ONWA 3UG3A 3MI3A 4LAZA 4IIGA 1R9YA 3MSRA 1VJSA 3GW3A 3E49A 3DG3A 4PUMA 2BXVA 2O55A 1DJZA 3SURA 1XIBA 3QTGA 4DM2A 4C6NA 1KXVA 1MFUA 2JKAA 3B8VA 2WVVA 4O52A 3WQGA 2EPNA 2G96A 4JAWA 2X0SA 4IPJA 3T0DA 1N82A 2VEPA 2RGLA 1I60A 3WNOA 3KWSA 1TFVA 1JNEA 4EF9A 3CIXA 2HPMA 1NOWA 1DHKA 4GGHA 1E9YB 2NQZA 4AZHA 3N2OA 2OSXA 5D2YA 3M0IA 3U7VA 3WQ6A 4WJEA 1XSIA 3H21A 3NGFA 1TMLA 3S1UA 4AX6A 2QZRA 2GGJA 3TAKA 1IT0A 4Y8EA 1FQ0A 1JJKA 3L9CA 4GYPA 4XTDA 4AC7C 5HATA 4FXSA 4MB5A 1JZ6A 1KA9F 3QV9A 2NW0A 4D6CA 5DN1A 4WZHA 5HR7A 4Q4KA 4S3KA 5LNRA 5EL1A 2ISSA 1F3EA 1XRFA 6TAAA 3W3OA 1CGVA 4MZYA 4H9UA 5TBOA 1ISZA 3W6LA 2CLEA 4TO8A 3FEQA 2EF9A 2Z6JA 2ZUWA 4Q4QA 2OMAA 2FVLA 5KZEA 4PBEA 4ROPA 2X1UA 4M8UA 2HQAA 2J7BA 3AYSA 3HJZA 4DRSA 3OOQA 4LALA 1IGSA 4AYGA 1EWEA 3CAVA 3TP4A 5H8PA 5LNWA 1SSGA 4JD4A 3CZEA 4LRTA 2JBMA 2PDHA 2OZ0A 1VCFA 4LUIA 1F3WA 2E6FA 1KFEA 5C9WA 1ZGDA 2XVLA 3GAKA 4XKYA 5F2GA 8XIAA 2X16A 1UC5A 1GYNA 4C6KA 5BRQA 1JAEA 4CLMA 2VT0A 2Q6ZA 4XIAA 1XYAA 3MMTA 5G1MA 5BOEA 1POKA 3FLUA 5D2WA 5I00A 4Q22A 4D6FA 3QW4B 2QT3A 3HV8A 1R6WA 3R12A 1WOAA 3LBMA 2PDCA 2D69A 4HMDA 4HU4A 4XZWA 5HOSA 4HG6B 3QKEA 4KS0A 3LB0A 5IM51 3AIVA 3EWYA 4ATWA 3ZIZA 1H51A 3VA8A 2PGFA 3QPYA 3UZYA 3A21A 2J77A 1QDSA 1ZU8A 2CCRA 1ZLPA 1ADSA 1Q3NA 3M7WA 1J6PA 1SZGA 4S3JA 5A69A 5FF0A 4ACZA 4L80A 4U28A 1QCWA 4HMCA 1UZ4A 3BSMA 5A2BA 1TA3B 1N8WA 1AQFA 4ONVA 3RR4A 3DFHA 4JTDA 4OWGA 3UR2A 4AEFA 1OM0A 2VRQA 1XV8A 3W7OA 3C2FA 2YBTA 5DRCA 2UY3A 1I2RA 2ZZ3A 3LI1A 5JUVA 4KEMA 4NZ3A 4IUGA 4NZCA 1T6MA 4IGHA 5C7HA 4L56A 3D6NA 3NIYA 3BH4A 5DLCA 3A13A 1OCQA 2J9YA 1XLEA 4H83A 3EYPA 5G1TA 5HPCA 4GK8A 4Y9MA 5EBAA 4LV4A 1BVWA 1HVQA 4HU0A 3BXWA 4N02A 3A3HA 4R5EA 3AC0A 1IF2A 4JYEA 1WBJA 2RAGA 2I57A 1CNVA 3LZ5A 3L0NA 1SQ7A 2Y7DA 4O16A 3REQB 4JN6A 4QNEA 2QDHA 3VIIA 3MUXA 5LA2A 3AU2A 1J01A 1GUVA 1TX0A 1FA2A 1YE4A 2XN1A 4ATLA 5DT7A 1OCBA 5HNUA 2YFOA 3C3UA 1E1FA 1LUCA 3RO6A 1DIEA 1GVFA 1J0JA 4IGSA 4JKLA 1AZ2A 4GNKB 2G95A 5G2HA 3N2TA 3ITVA 4MNLA 2J6VA 2V67A 5C5YA 5F2IA 4H9XA 3LA4A 4QS6A 3NNTA 3IIZA 1YBQB 4NG3A 3A4XA 5MKGB 1GZ1A 2KZHA 3KS6A 3QPZA 3GXMA 3E0VA 3GDMA 5LIYX 4WGHA 4MWAE 4AB4A 2QJNA 1Q4NX 4OU1A 1ZP3A 3W81A 1AK5A 4FR6A 2XN2A 3IUHA 1E71M 5HNRA 3O63A 1ITCA 4G7FA 3RLUA 2Z26A 1PX4A 5M03A 4BFAA 7REQB 3BAYA 2HVNA 4AHQA 2GJXB 1QWKA 1J0HA 4QTGA 1F3XA 4PTDA 1QPNA 1QNOA 2FZ8A 2IXVA 2E1WA 1ZBWA 4GY1A 4JY9A 3ZLGA 2XFWA 1YIXA 3WLHA 3TYCA 3MP3A 4Z0SA 3VIOA 3BMXA 4XZHA 1RD5A 4F0RA 4IQEA 4IFKA 9CGTA 1U1JA 1XLCA 1BF6A 4KEVA 4B92A 4P8WA 1K6WA 3E1F1 3MKCA 1E1CB 4D9PA 1VF8A 3GTIA 3ARWA 1XH1A 3D47A 5BWFA 2PD5A 3UY8A 3U4FA 4DF0A 1FWEC 1K8CA 4NF7A 3V4BA 4NRSA 4YNGA 1Y5XA 4V15A 2VD8A 4CNNA 4GXPA 3H2EA 3PPHA 4MPQA 4PN2A 2YW4A 1RD6A 1U1HA 1WOBA 3PTKA 3ES7A 3TW6A 5IDIA 4OV9A 3LV6A 2E5DA 4YCOA 2CKRA 4C1KA 3KVLA 1TVPA 5CH9A 3QZ6A 1HL8A 2XM2A 1MXDA 4YYFA 3S1WA 4D6HA 1UP2A 3VIFA 3W9ZA 4P00B 4FNRA 4IQLA 4H9MA 2X2YA 3UGVA 3S5SA 1W2VA 1EHNA 1J5SA 3QR1A 2FGBA 3NXLA 2AGKA 3CWHA 1V03A 3H53A 3LU2A 4S3AA 3DESA 4J40A 2J13A 1GOKA 1UD6A 1XIJA 1KXQA 3U6WA 4ORIA 2YA2A 4UFIA 2BGNE 2FZ9A 4B16A 1NF0A 4IFRA 4IJCA 1A3HA 3GO2A 2ZUMA 3OBKA 1ZB5A 1H50A 1CGYA 1PWLA 5M2FX 1XLMA 2C7FA 5CGTA 1V3KA 2ABAA 1PPIA 4KERA 1U30A 4X60A 1QBBA 1R3VA 2DZWA 3RLHA 2W0UA 2PAJA 1Q7QA 4IG2B 3TNOA 6PTDA 1EZ2A 5U7SA 1BGAA 3AWNA 6REQB 3PWIA 2VX4A 3T42A 4DEFA 5DELA 1LL4A 3NVDA 1YPIA 2QVNA 5L9FA 1DORA 4GJ1A 1AL7A 5FEXA 1LQ2A 5CBBA 3G2GA 1K6AA 1OT2A 5AYZA 2BY1A 2C15A 1K02A 5REQB 4KBXA 3G3MA 2NUWA 3V1HA 3LQGA 5AC4A 1NWRA 4QX4A 4TOQA 4PA8A 3NEVA 3RU6A 1C90A 4LBRA 3MBFA 4OHQA 4TQTA 3S4TA 2YOCA 1CXFA 1FWJC 5KZ6A 3VOFA 2H3BA 4FZIA 2QJMA 3ARRA 5E9XA 3PS7A 4GVIA 2BVYA 3VOJA 8TIMA 1W9PA 1Q5MA 1E3XA 4J9JA 1KCXA 3VVGA 4XZIA 3EWDA 3GX9A 3EX3A 4CQCA 1T8QA 2TPSA 3XIMA 1TKKA 5EMJA 2ZA1A 4V28A 2WCAA 3R11A 4K1GA 4CCEA 2ZC8A 5GVJA 1VFSA 3P6LA 4A2SA 4JIHA 5G4HC 2PEVA 1QI5A 2VURA 3TC6A 1EF2A 3ITTA 3T0BA 3H4XA 3BARA 4DQWA 2GVJA 3CIVA 3LDVA 3L4YA 1OADA 4JQ3A 4PH6A 4AFYA 4UFHA 2PDNA 1K3UA 2Z00A 1HG3A 1H0IA 4A6GA 3KS5A 2Z2UA 1V6UA 4R3UA 3C5QA 4W89A 3CO4A 2E25A 2DSUA 2WKJA 3PB0A 4JCMA 3NO5A 3NQ2A 4INFA 2YCLB 1MQQA 2J7FA 2WOQA 3TYZA 5C9XA 5FF2A 4U31A 3KBSA 3NG3A 2BGSA 1CI1A 3VGDA 5CSSA 1J18A 1UWIA 4RW3A 3BMVA 4CNOA 2ISDA 1IE7C 1QATA 2WK2A 1ICQA 3ABRA 2GDVA 3U0HA 1UWAA 2X7WA 3UXKA 2RJHA 3T2PA 2A7PA 3QGAC 3GR4A 2WMJA 1EA0A 3AFBA 3N34A 1E5JA 2CBJA 4C1NA 1ZY9A 3FA4A 1AQHA 1AQMA 2DZSA 4MPKA 4GG9A 4BEUA 1JXKA 4HHPA 1DQWA 5HQLA 4HCHA 1OK6A 3VZYA 3TN6A 1D3HA 5LGXA 3GHTA 3HGRA 1F2JA 3MB9A 2Z7KA 3MYOA 1TV5A 6ENLA 3PZMA 3MW7A 2PFHA 2H8ZA 4TMCA 3FA3A 3OODA 1L2QA 2ZRUA 3VE9A 3W7KA 2GDUA 5ABTA 2F6KA 4C6MA 4H04A 1TUFA 1PZ1A 1CB7B 3CZGA 3CB3A 1GKPA 2WBKA 3GKFA 3EZ4A 1BTMA 1PHWA 3LHVA 2IUZA 3B9OA 4V33A 4E8DA 6XIMA 1REQA 4UFJA 1GOQA 2QIWA 3PSVA 5DXYA 3HPXA 4C5YA 1H60A 1R86A 2QNEA 5F7UA 4GQRA 2V3DA 3T07A 3H24A 1U5JA 1BSIA 3MYPA 4PSRA 3AROA 2XWDA 1SR0A 2VWSA 3IACA 4Q4OA 4DXKA 1A5NC 4L65A 3WJYA 1QBAA 4M0XA 5BXTA 2P50A 1E15A 1RXOB 3AMKA 5AHLA 3KRSA 4O19A 4B3ZA 2E28A 1GHRA 2POTA 1XH2A 2WC7A 1C9WA 1NQ6A 3HG3A 3IIOA 4Q32A 1ONXA 4JTJA 1NARA 2D2HA 3R10A 2A79A 1H7PA 3BV7A 1J2WA 4XKMA 3CIWA 2J8GA 3VPLA 2JEQA 1W5MA 5JMUA 1H63A 4RDWA 1EJRC 4NI8A 2NX3A 5A95A 1UQYA 1FXQA 3UZZA 1Q8AA 1UJQA 3W4RA 3ZYZA 2D0FA 1ADDA 1IWAA 3F7JA 2QUTA 4DPQA 3WQ5A 1OF8A 3LRKA 2VVSA 1Q6EA 1W91A 2DPEA 2OB3A 1THFD 5I3HA 2J7GA 1M5WA 1VBJA 2RKXA 4UTJA 3W87A 3QBUA 3H23A 1B3OA 3GS6A 1E1CA 1LT7A 1R3TA 2KAUC 4DLFA 3WNPA 4HMEA 1F05A 1BYCA 4FSAA 1FWTA 4JHOA 4Q8UA 1IXQA 2XFFA 2YZ5A 3PUGA 4PFHA 5D32A 5A1AA 2E8YA 3DCPA 4YTUA 3L2LA 4XIMA 4GRSA 2J7EA 3CM4A 2D3NA 2GQAA 3G3DA 1GKQA 3SI9A 3TSDA 1SJCA 1NFBA 1IXPA 7TIMA 2OSYA 2JGYA 4PBGA 3LM3A 2EGZA 4ZQPA 3TC7A 1NEYA 1S2TA 3AJXA 5A8GA 4MY9A 1WDSA 2HSAA 1SO4A 1SUXA 4OKDA 1QTWA 2E4TA 3OO2A 1IR2A 2GUBA 4JTIA 4GCAA 1NFGA 1U5VA 5U4NA 4OJYA 3T09A 5HWMA 3COTA 3M43A 4IJRA 2QCHA 5AY7A 3CASA 3LXBA 1UBSA 1FWAC 1RA5A 1ZALA 4ZA0A 3IS4A 1W9VA 1ZHAA 5EPDA 5I09A 4UTTC 5TIMA 1C8XA 3LCXA 2BS9A 1S5TA 3O15A 1K1DA 3SCWA 3G22A 4E3VA 4DO5A 3UXIA 4BI5A 1VEMA 2GQ9A 3PJXA 2YL5A 2SFPA 4UXDA 4HU8A 4ZFMA 4QCEA 3E38A 3B9AA 2FPTA