3GH7A

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with galnac
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
519
structure length
506
Chain Sequence
HHHHSSGLVPRGSHMATSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular cloning and crystal structural analysis of a novel beta-N-acetylhexosaminidase from Paenibacillus sp. TS12 capable of degrading glycosphingolipids
pubmed doi rcsb
source organism Paenibacillus sp.
molecule tags Hydrolase
molecule keywords beta-hexosaminidase
total genus 194
structure length 506
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gh7A01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3gh7A02
3TTOA 2J7EA 4AD1A 4OJYA 4EAMA 5LA0A 2ZXQA 3VOCA 2WSPA 2UY3A 1J0KA 1X6LA 2WVSA 3WQWA 4W8BA 2WMIB 4QLKA 3WNOA 1FP8A 4UFIA 1V3JA 3AHTA 1HNYA 4PCTA 5DF0A 1VEPA 2D0FA 1ZBCA 1E55A 1QHOA 1JNDA 1DWFM 4UNIA 4UOQA 1K9EA 3PZ9A 4Q7NA 1FH9A 1LJYA 2E9MA 3SCSA 1IV8A 3SCTA 2WMKA 3PBGA 2XUCA 4W86A 1GHRA 6A3HA 3M46A 3S6TA 3N9KA 2VVSA 4Q22A 4KGJA 1OCQA 2CETA 2BXYA 2OSXA 1H0GA 3WH5A 1B3XA 2V5CA 4PTXA 1BYBA 1ESWA 4Z2IA 1E6RA 3BCDA 1O6IA 4WIWA 1ZJAA 3QGVA 3O6AA 4M1RA 2BXZA 3ZOAA 1KGWA 1LL4A 1MFUA 4P7RA 1B0IA 2Y8KA 3W28A 1LWHA 2JE8A 1ISVA 1TA3B 2UY4A 2VX7A 3QHMA 4UCFA 3WF2A 1MFVA 2IXUA 3WD4A 1H41A 1D2KA 4XZBA 1EHNA 3IJ8A 2JEQA 4H8UA 2UY5A 1XRVA 1SR0A 4CVUA 1UR8A 1GNXA 8A3HA 2NT1A 3AYRA 1WDSA 1JZ6A 1E40A 1E15A 5GQBA 3MMDA 1LF1A 3ARTA 2WHJA 3WEZA 2DPEA 2G4FA 2B31A 1J0IA 2FDMA 1ZL1A 4H2CA 3BAYA 4W88A 3WL1A 3AFBA 5A1AA 3SCPA 3B9AA 4AXNA 4CCDA 1W1YA 4OBRA 2VT0A 5I24A 3BLKA 1QW9A 1QW8A 2DDXA 3W4RA 4J3XA 3CTTA 1TG7A 2VL4A 1CXEA 2ZX9A 2BNJA 1I1WA 4HPHA 3ZSSA 3WF4A 1XSJA 4YHEA 3OLIA 4HZ8A 1W9DM 4CKQA 2ZUNA 2EPKX 2CXGA 4PYSA 2WBKA 3MO4A 1NOUA 1V3LA 3CHDA 4J3UA 2QPUA 1V08A 2ZICA 2PB1A 4YPJA 3IK2A 1SMDA 1AQHA 2X0HA 3AMKA 4H7VA 4J3SA 5JBDA 3SCVA 4Z2JA 1W3LA 3OLEA 4C7DA 1J01A 1KCKA 2E9LA 5EBAA 3W25A 1GJWA 1B2YA 2YDQA 1RP9A 6CGTA 1MW3A 1E0WA 1E0XA 2IXVA 5BWFA 4JFVA 1KR1A 1CENA 4J3TA 1JF6A 2ZXAA 1UA7A 1DHKA 4AISA 2A3HA 3W27A 3PN8A 3WFLA 4V2XA 2VR5A 2WHMA 1QNRA 3PZMA 4F66A 2O9TA 3NSMA 1MVYA 1UYQA 3S2CA 1H2JA 3GXMA 3WMCA 1KXQA 3ARYA 1G94A 1HP5A 4D1JA 1BFNA 2J7HA 2XIBA 7A3HA 3U7BA 4UQEA 1WDPA 1XGZA 3QOKA 2JF7A 2PI6A 3AIQA 1ITCA 3WNKA 1EH9A 3AXHA 1HL8A 4AZIA 3GBDA 1J10A 2VOTA 3WF0A 1J9YA 4A3YA 4DM1A 1BVNP 3WFZA 1E6SM 2GVYA 1Q6DA 2J47A 3NIYA 2DSZA 1B31A 3MV11 4TX6A 4BS0A 3L2MA 4QCFA 3QR3A 4PUDA 5CPTA 3CZKA 3U5UA 1JAEA 3N12A 5A6AA 1EGZA 4LYQA 5A6MA 3KE0A 3B9DA 1TFVA 4P8UA 3AS3A 5A8MA 4DUWA 3WUBA 3CPUA 3CZEA 1NARA 3GXDA 5DMYA 2PWHA 4L4PA 2WYSA 3VX1A 4UQDA 1S46A 4JL2A 3K8LA 1WPCA 2YL6A 3IANA 1FHLA 3L4YA 1UWIA 2EPLX 3QHNA 1SFSA 2WHLA 1EO7A 3HJEA 1J11A 4OOZA 3AIVA 5A8QA 5BXRA 1XC6A 2WSKA 4DUVA 2EBNA 4W7WA 3BMVA 2WANA 1HKMA 1E70M 3N17A 4OUEA 1B3WA 2J7GA 1JAKA 1HKIA 3DHUA 3GZAA 3F5JA 1ISWA 4ACZB 3T08A 4WF7A 1JYWA 1CECA 1EOMA 3WNLA 5AYIA 3BSHA 3CBWA 1DTUA 1HJWA 4AIEA 2WMGA 4U5IA 2EJ1A 2VQTA 3GBEA 5CG0A 3A47A 1GW1A 4D72A 4ZE4A 3ZO9A 2WWDA 3NSNA 1HVXA 1F4HA 4WSKA 3VD3A 3PZGA 1B9ZA 3AMCA 2AMGA 1B90A 4LQ1A 1V3IA 1GOOA 1QNPA 5I0DA 1Z32X 2OYKA 1UKTA 3OIHA 2CBJA 3VD5A 1MYRA 2OSWA 1OINA 1R7OA 4TVCA 2PBOA 4Z2KA 3MUZ1 3FHQA 1JG9A 1XH2A 4JFTA 2W5FA 2XSAA 2FGZA 1G9HA 1NP0A 3I3BA 2VCBA 3LPOA 1CTNA 5LYRA 3G6LA 1WNOA 1CLVA 1IZKA 2DEPA 4RL3A 1VENA 1Q6CA 5HXMA 4AZGA 4ACYA 4JKLA 1HKJA 2G3NA 4AD3A 4HTYA 1WB0A 4HOWA 5A95A 3AHZA 5IFPA 3SCUA 2E4TA 3GYCA 3ZR5A 1UKPA 4WSJA 3RDKA 4A3HA 2DH3A 2WNWA 3OGVA 2DSKA 1K6AA 3L2LA 1PJ9A 1OGBA 2FGLA 3PZTA 2J78A 2JIWA 2GDUA 4P8VA 2C8NA 1CNVA 3GH7A 5E0FA 4H41A 2ZIDA 2QHAA 3BAIA 3PZUA 4MNJA 2WW5A 1HIZA 3VGBA 4MPKA 1N82A 4P7QA 5E70A 3CUJA 2XVLA 1JI1A 2W4XA 4PSPA 4UQBA 1QNQA 1LLOA 5A6SA 4JFSA 3WDQA 3AI0A 4FMVA 4JHOA 5HOSA 3VIOA 3L4ZA 4FLQA 4PMUA 1KBKA 1CXFA 4TOQA 2XFFA 1UR4A 2F8QA 1DWGM 1OGGA 4UR9A 3ZM8A 1WAWA 2FHFA 2J77A 2EPOA 1KQYA 3CUHA 1C3FA 4GZEA 3VMOA 1B1YA 2DT2A 1XYZA 3MS8A 3AS1A 1G0CA 3TA9A 1CGWA 1I75A 3EYPA 1H1NA 4MDPA 3EDDA 1JD9A 1JD7A 3OBAA 5HPOA 1XYFA 1EDTA 5C8BB 2BS9A 4CN6A 2WC7A 1MXDA 3D5HA 3D3AA 3HN3A 1JXJA 1TCMA 1V3MA 1W1VA 1LWJA 5CSYA 1HT6A 2W67A 2ZUMA 2ZE0A 1JNEA 3PTQA 2D1ZA 2W92A 2WBGA 2O9PA 2CHOA 4MAVA 3PZNA 4J27A 3OGRA 1KBBA 3VPLA 4B9ZA 4PUEA 3VDAA 2GFTA 2D0GA 4AD5A 1UQYA 3GNRA 1EIBA 2J7DA 2JEPA 2VX6A 3KWXA 3ZMRA 4X0VA 4CCEA 2W61A 3TOPA 2AAAA 3NYDA 1U2YA 1W3KA 3ZSTA 5JUVA 1IZJA 2ZUSA 3CUFA 3CO4A 2XVPA 3VNYA 3GDBA 1R8LA 1ISZA 1WO2A 2PF0A 2YBTA 2W91A 1E6QM 1UH2A 1VJZA 3O9NA 4AYSA 1NOFA 3KL3A 3CZ8A 1WZLA 2YLAA 3WNMA 4HZ6A 1HVQA 3K8MA 3WMSA 4CN4A 1TMQA 1GQIA 2PC8A 4QLJA 1UQZA 1XV8A 2BFGA 1KFWA 2GJXB 1DEDA 4FLRA 2PWEA 2DH2A 5D8ZA 3CZGA 1W1TA 2XVKA 3ARXA 1QI3A 2WVTA 5ABFA 3HU7A 3VIGA 4HZ7A 1ZJBA 1TZ7A 4JCLA 3RM8A 1NP2A 1GONA 1XSIA 1JGIA 1A3HA 4LGXA 1PIFA 1TVNA 1DWAM 2FHCA 1LL7A 3L4WA 4IPNB 3RILA 2VNCA 2JF6A 2RGMA 2A3AA 3W29A 4HMDA 3UG3A 1ISXA 1EA9C 2J8GA 4UFMA 1QNSA 1V6XA 2OWXA 1CIUA 2BY0A 2JALA 4PMNA 1X6NA 1US2A 2UWFA 3ARSA 2GDVA 4AMCA 2FH8A 2OYMA 1UD8A 3NDZA 1HX0A 4FLSA 3UESA 1VIWA 1E0VA 2BHUA 2WC4A 1HJSA 1V6WA 2D2OA 7CGTA 5EB8A 3ZR6A 4HA3A 4WKAA 3VINA 1XCWA 1A47A 3SCWA 5HBFA 2YKKA 3A4XA 1E72M 1AVAA 1E6NA 3SCNA 4ZFMA 1EO5A 1V6YA 2ZUTA 4KWUA 1GUVA 2CESA 1V6VA 1DWIM 3VIJA 4U5KA 3UG5A 1Q6FA 5E0CA 5M03A 1PPIA 1ZBVA 4D6CA 3VDBA 3PTMA 2D22A 1SMAA 3WMBA 5KZ6A 3WBEA 4HOXA 2DIEA 3ALGA 3U5YA 2VRQA 2JIEA 1OM0A 1UKOA 3VKKA 1EDQA 1NWRA 2G3IA 2UY2A 4HA4A 1UD6A 4YN5A 3M07A 1M04A 4W7UA 4AD0A 1XSKA 4M82A 3VGDA 1GOQA 4X9YA 3AMGA 4DWSC 1OBAA 1JIBA 3VMNA 4CVWA 2DT1A 4Y7EA 2J62A 1C8XA 4GI9A 3AMLA 6TAAA 1BG9A 3MSGA 3AHYA 3WQVA 1OT1A 4ML4A 1E6PA 1UZ4A 3MUY1 3THCA 1J12A 1VF8A 1E4LA 2VQUA 1V0LA 4P7LA 3PTKA 4D6GA 3VGGA 5FIPA 3WH8A 2VTFA 4GZJA 4D6HA 4Z2LA 1BF2A 5D9NA 3VIMA 2VI0A 3POHA 1QOXA 3EMCA 4W89A 3GXFA 1TVPA 2BVDA 3MSDA 2XM2A 1UG6A 4L4OA 3WD3A 4PTVA 1PX8A 4MADA 3WF1A 4AZCB 1ECEA 1UZ1A 2VZTA 5HPCA 3RPMA 3OZOA 3AZSA 2V5DA 2XIIA 1FFQA 2YA0A 1UKSA 4BQ3A 5BXPA 2WZIA 2W66A 4BQ2A 1JI2A 2CEQA 1VB9A 4V27A 1HXJA 1W3JA 5GNXA 2ZUVA 2CBVA 2D23A 3ARWA 3WDIA 1ODZA 1UWSA 5A8PA 4AD4A 3FXYA 1C90A 4J28A 2J79A 3ZT7A 3L4VA 4BCEA 4FLOA 2ZOXA 2XFRA 1UKQA 2W62A 1WZAA 2VCCA 2E0PA 2CPUA 4P8WA 4KRUA 2X2YA 4PTWA 2Y2WA 5AC4A 2YJQA 4N42A 3ZJ7A 1B3ZA 3CGTA 5GPRA 1B3YA 3GXIA 5CJ5A 3RM4A 4W5UA 1Y7VA 5I23A 4B3LA 4CD6A 4LYPA 2DQXA 4CU7A 3SUUA 3MUAA 2YL9A 1R7AA 1CLXA 1EDGA 1PZ2A 4JFUA 2DIJA 4UTFA 4CD4A 1OIFA 1JYVA 1OSEA 1JZ8A 3CZJA 2D3NA 1QI5A 1QHPA 2J74A 3J7HA 2DSWA 4UZSA 4JAWA 1V03A 1C91A 1GJUA 3BH4A 3KL5A 4PCSA 4J3VA 4E8DA 2WMJA 2XGBA 5IDIA 1BGAA 2ZXDA 1CXLA 4HU8A 3A4WA 2XJ7A 3U7VA 2PBGA 2XTKA 5ABEA 1GVIA 1SYTA 1C7SA 1UHVA 2YA1A 3AIRA 3RCNA 2WKLA 3SCRA 4NSBA 1DWJM 1JXKA 5CSUA 3SURA 3GTNA 1HF6A 3T2OA 4QCEA 3T0AA 1W9VA 3PZOA 3W37A 1C8YA 1JZ7A 2V38A 3VIHA 1O7AA 2GK1B 2GJXA 3AOFA 3II1A 4J7RA 4UQCA 4GINA 2GUYA 4MJ4A 4PSRA 3WY1A 3LPGA 5A2BA 3ARRA 1BHGA 1UR9A 5I79A 2BHZA 4UQ9A 1GQKA 1CGXA 1JFHA 4U2ZA 4UFLA 1OD0A 4IUGA 2V3GA 2TAAA 1BLIA 1C93A 5A3HA 1UA3A 3FAWA 2CHNA 3RJYA 4TVUA 1V6UA 3CHCA 3B8SA 5DT7A 1QI0A 5I5RA 2C0HA 3BAKA 1RD6A 1VBUA 1JDAA 4OZOA 2J25A 2X8RA 1G01A 2Y8VA 2WVVB 3SUVA 1HL9A 4D6JA 3AIBA 1NWUA 1W2VA 4M8UA 4BQ5A 3WL0A 1RPKA 1KWKA 4QDMA 3MMWA 3MANA 4HOZA 1VFMA 3NCOA 3K4DA 1V02A 1PX3A 2EPNA 2VZSA 4KMQA 4W85A 4XV0A 2Y24A 1WE5A 1E4MM 3RM9A 2WCSA 4RE3A 1CEOA 1FHDA 2J7BA 2VZOA 1GOMA 3VGFA 2ZX7A 4H8VA 2CYGA 3T2PA 4UZUA 1GQJA 1UUQA 5CLTA 2CERA 1ZS2A 3AHVA 2CBIA 4W8AA 2DGAA 1E5NA 3CHEA 4AWEA 4IM4A 3CMGA 4CCCA 1LG2A 2YDRA 5A8OA 1WP6A 4QP0A 3RJXA 3W82A 2BHYA 1JZ3A 4B9YA 5IFTA 3VTRA 3IAPA 3ARVA 1VRXA 2VZVA 3VD7A 1W91A 5M3WA 1D3CA 2ZWYA 1NOWA 1CYGA 1P6WA 2V3DA 3LPFA 3SCOA 1TA3A 1BTCA 2XWEA 3VX0A 3IJ9A 3I3EA 1UD2A 1GOKA 1MWOA 3WKZA 5FCZA 4N0RA 1K9TA 3ZJ6A 4U2YA 1ZBKA 4W93A 4MJ2A 1D7FA 4ZE5A 1C92A 5E6ZA 4OBSA 3GNPA 3WNNA 4KH2A 2WPGA 2EQDA 1RP8A 4UOZA 2O92A 2WMIA 2VO5A 2HVMA 1GOIA 2A3EA 3OLDA 3W6MA 4EKJA 1H4PA 4JIEA 1KR0A 2WLZA 1JDCA 3EDEA 1KQZA 4U31A 3CUIA 4TTGA 1CXHA 2CITA 3KEHA 3W24A 5BROA 4JFWA 2E3ZA 4GXPA 4MNLA 2VJXA 1I1XA 3WUEA 3NUKA 1UWUA 1BYCA 3WQ5A 3W0KA 3EMZA 1G5AA 4PRWA 4PMVA 5JIPA 2D3LA 3VD4A 4W5ZA 1MQPA 5CXPA 1BAGA 3DYMA 1EHAA 4R27A 1R86A 1E5JA 1VFOA 4PN2A 1MXGA 3WD0A 1BGGA 4GQRA 3NSXA 4EANA 2VURA 1H09A 3WUGA 2VRKA 4W84A 2GJRA 3ZIZA 4MNMA 3ZQ9A 4F9DA 1FP9A 4M80A 1E4IA 2G3JA 4PEEA 2XFYA 3ARPA 1QPKA 4Z2HA 2WKGA 1Q6EA 4V28A 3OZPA 2G8ZA 4JCMA 3UR8A 1E9LA 3WBAA 1VFFA 2IUZA 3BMWA 1V0KA 2A3CA 4A4AA 1QI4A 1EQPA 1W9BM 3PZVA 5CQ1A 3T0BA 4ZENA 1E6XM 1YHTA 2EPMX 2WB5A 1M7XA 4AIOA 5BYWA 3UEQA 1BSIA 1WDQA 2HISA 2ZUWA 5DFAA 5D8WA 1AQ0A 1HN1A 1PZ3A 5A6JA 3APGA 1L8NA 1QVBA 2YLLA 2CNCA 2VZUA 4AEEA 4PTMA 3TTSA 4JHZA 4HP5A 3WH9A 3W26A 1C8QA 3AZRA 4GI6A 4WKFA 4D6FA 4YHGA 1KGUA 5DEZA 3VIIA 3WIJA 1EXPA 2NT0A 5A2CA 4HMCA 2J7FA 1K9FA 3GH5A 3L4UA 4OIFA 1MW2A 4D71A 1LG1A 4C7FA 3DYOA 3BAXA 4HPGA 3SUSA 5I77A 9CGTA 1U30A 1MQQA 2FH6A 4ATLA 1JZ2A 1CGTA 2F61A 1EOKA 3WEMA 4B15A 3ZJKA 4QLLA 5DT5A 4FF5A 4M29A 1V0NA 3LMYA 4TXEA 3U57A 3EBVA 4UOJA 1GCYA 1XH0A 2ZXBA 3E1F1 1MW0A 1PBGA 5E6YA 5FL0A 2BV9A 3PZQA 5I78A 4ACZA 5GNZA 3AIUA 4QFUA 3VD9A 4TUFA 4ZEPA 5FKYA 3MV01 5IXEA 4GO9A 4PMYA 2CKSA 4AD2A 3MMUA 1XD1A 2XWDA 1M03A 1KXTA 5I2UA 4PBGA 2FHBA 3FN9A 1H0IA 3ARQA 2E8ZA 3KL0A 3VIKA 2XHYA 1E56A 1UD3A 1KGXA 3AMDA 1UOKA 2WAGA 3ARUA 4PMXA 1FA2A 4LPCA 1JYXA 3AZTA 1J0JA 1HKKA 4WKHA 1TUXA 1R85A 1US3A 3UERA 5E09A 2D0HA 2VMFA 5A94A 1MW1A 5M5DA 3N15A 4UQAA 3UR7A 3T2QA 1GQLA 4GIAA 4MAZA 2DT3A 4IISA 2QMJA 4JKMA 1CGUA 4RE4A 4DM2A 3WSUA 3BSGA 3F4VA 1E71M 2QLYA 2V3FA 4W8LA 3N11A 1H49A 3ECQA 4GQQA 1DWHM 2QF8A 2WVVA 2D24A 1IT0A 1BYDA 1XH1A 3AISA 3MUIA 4LYRA 1BPLB 3IAQA 1E73M 4ATDA 3ZT5A 2VX4A 4AZ6A 4X0NA 3VM5A 1CPUA 1NM9A 1E3ZA 2WHKA 3VNZA 4NF7A 4CD8A 1WKYA 1UH3A 2Y4SA 3GH4A 1UR2A 3SCQA 1V0MA 1GPFA 4E8CA 4H04A 2NSXA 5GNYA 1NH6A 1W3HA 2ZUUA 2X0YA 3F5KA 2YIHA 4HU0A 5BCAA 3DC0A 4HMEA 2JFEX 1FOBA 4AIUA 4IPLA 1MQRA 5TD4A 4PMQA 3VUPA 2XYLA 1JFXA 2EO7A 5F7UA 4M81A 1KXHA 5FL1A 5ECUA 4EE9A 3OLGA 1J0YA 1WDRA 4F9JA 1E3XA 1QBAA 1OIMA 2X09A 2WZHA 2WM0A 3VU2A 4AY1A 3RO8A 4OKDA 4M24A 1CWYA 3WD1A 4BA0A 4R5EA 5E9AA 2XVGA 3BAJA 1ISYA 2VR4A 3THDA 2RGLA 3TONA 3LPPA 3O2LA 1OB0A 1Q4NX 2BY3A 1KCLA 2XG9A 3RMEA 5FOOA 3F5LA 2WVUA 2YL5A 2BVYA 2VX5A 1ZU8A 2WCAA 2E40A 3WELA 1DP0A 2WMHA 4TTUA 5A6LA 3WH6A 4AZHA 2XGIA 4XZWA 3SIMA 3FNDA 4PMDA 2Y5EA 3B9EA 2Z1KA 5CPSA 3AIEA 2O9OA 2YOCA 3TP4A 4EK7A 3CLWA 3TTYA 4BQ4A 2BY1A 3SEPA 5IHSA 4MDOA 2Q8XA 2AOSA 3SUTA 3PHAA 2OWWA 4C91A 2OYLA 3ALFA 3DYPA 3AROA 3N04A 4GI8A 4JZ5A 4OOUA 4U3CA 4Z2GA 2CKRA 3W6LA 1JYNA 4MTVA 1V02E 3BGAA 3NDYA 3CH9A 3K8KA 1JZ5A 2WMFA 2XPKA 3WQ6A 1QI2A 5A8NA 3DECA 3WUFA 1GOWA 2ZX5A 5I6SA 2VRJA 1RH9A 1LL6A 3CUGA 1CBGA 1UR0A 1TR1A 2OLHA 1X1NA 3K4AA 5AYBA 3OGSA 1GVYA 1UWTA 1U33A 2J75A 5BRPA 1E43A 5EFDA 1W32A 3WQ8A 4NI3A 1NWSA 1PX4A 4F8XA 4U3AA 5A6BD 1E1EA 3AQUA 2A3BA 4AC1X 4CD5A 1XCXA 4NZCA 5D9MA 3WEOA 3ZJ8A 4UFJA 3WDPP 2Z1SA 1H3GA 4MNKA 1VAHA 4ZXLA 1UD4A 4C7GA 3AXXA 5AC5A 2WLYA 3W38A 1VJSA 3UCQA 2WK2A 5M17A 1W9UA 2X1IA 3BCFA 1TE1A 1M53A 1QNOA 4MB1A 4QAWA 1FH8A 1C7TA 5IHRA 1W2PA 4D6IA 2ZWZA 1CDGA 1AQMA 4WJXA 1PAMA 5AY7A 7TAAA 1F4AA 4GPNA 4JKKA 3ARZA 5I3DA 1UWRA 3T0DA 3L4XA 4BF7A 1BG4A 3VILA 5JBEA 1B3VA 3VGEA 1J0HA 3HMCA 1J18A 5HNNA 2PWGA 5ABFB 1Q6GA 2G41A 3WDRA 4E2OA 4P7OA 1FH7A 1L0PA 3VVGA 2XM1A 4NRRA 1UWQA 4ATWA 5ABHA 3N13A 3MKKA 2X05A 1G1YA 1BYAA 2GJPA 3IJ7A 4TVDA 4CN1A 4K68A 3I3DA 4KRTA 4AW7A 5CGTA 3WN6A 1PEZA 1B30A 4CU8A 3EDJA 4RE2A 3AS2A 4D1IA 4AZCA 3GM8A 1HP4A 3A3HA 3TTQA 1KXVA 2EEXA 5CGMA 1VEOA 3UETA 1CXIA 3W53A 1KWGA 4D6DA 2ZX8A 1UH4A 3CHFA 4CUCA 1UD5A 3RIKA 3W81A 4UFKA 2CBUA 4M56A 1GHSA 1E1FA 1HJQA 2BVTA 3WF3A 2VCAA 3PZIA 4S3JA 4TX8A 3ZT6A 5CZKA 3EMQA 3BXWA 5HDRA 1OT2A 1XHGA 1BVZA 1GZJA 3WD2A 2YL8A 3VM7A 2F2HA 1EQCA 2DSUA 4P7NA 3WNPA 3VDHA 3QHOA 4LXFA 3CIVA 5EFFA 2ZX6A 1ZB5A 4B16A 2YA2A 4FK9A 5A69A 2WCGA 3BLPX 5A2AA 4B3KA 3OA5A 3VO0A 2VC9A 3AYSA 3EDKA 5LA2A 5BRQA 2XVNA 3G6MA 1GORA 1WZKA 3SUWA 3K46A 4MB5A 4U33A 4W7VA 2QV4A 1OWQA 4KGLA 4W87A 2VUYA 2V3EA 3VGHA 3BC9A 1HJUA 1H11A 2OWCA 4URIA 4GO8A 4AEFA 4S3KA 2CCRA 3L4TA 3OG2A 3CZLA 3FW6A 5CLWA 1CZ1A 1UR1A 5LA1A 3AS0A 4MB3A 1KB3A 1V3KA 1ZBWA 5C70A 2GSJA 3VDCA 1ITXA 1E6ZA 1JZ4A 3POCA 4DWSB 5D9OA 1OGSA 3FHAA 3EDFA 3VMPA 2GK1A 2YDSA 1VBRA 2NW0A 2E9BA 1YQ2A 5BXTA 3M7SA 1JDDA 1CGVA 1OD8A 2VVNA 3VIFA 1W9XA 1BQCA 1XD0A 4XX6A 2WXDM 2J8FA 2MANA 3NJ3A 5D4YA 3MU7A 2QMKA 2BY2A 4D6EA 3N18A 1H5VA 1NQ6A 4C90A 3OB8A 1K9DA 3AJ7A 4HA1A 3A4AA 1HJVA 4WLCA 2PWDA 3FAXA 3GNOA 5JIWA 4MB4A 4CD7A 3UG4A 2WC3A 5CPQA 5BXSA 4H8HA 3FY1A 5KEZA 2G3MA 4WK9A 5DO8A 2EXOA 1JL8A 3WENA 2CIPA 4DUXA 2YBUA 2O9RA 2W63A 2QPSA 4ZXOA 3AHXA 3WDJA 2WZEA 3AIWA 4UFHA 3AXIA 5FD0A 4XUYA 1R87A 3AICA 4XB3A 2J4GA 1ODUA 4GZIA 1CXKA 3JUGA 2OSYA 2DT0A 4AZBA 3M6DA 4CU6A 1WZMA 4BZYA 1E4NA 1QBBA 1VEMA 4AZ5A 2ESCA 4NRSA 4PMOA 1W1PA 4JL1A 2C7FA 1VFUA 3T09A 3A6OA 4DWSD 3WQ4A 5ABGA 3BAWA 1AMYA 8CGTA 3KZSA 4DWSA 3K1DA 1J0ZA 2DSVA 1V3HA 1NWTA 2WWCA 1M01A 5D9PA 3N1AA 2XSBA 3VIPA 5JBFA 5A6KA 2D20A 1PIGA 4GKLA 5EMYA 4F79A 1LQ0A 4P8XA 3DHPA 2PWFA 3CMJA 4PMZA 4PMRA 1JF5A 2E8YA 4LX4A 4E4PA 3WH7A 4CGTA 1QHZA 3QOMA 1W9PA 1WCGA 2J7CA 3WDHA 1FFRA 4J3WA 1HJXA 4AZ7A 5C71A 1CGYA 5A6BA
chains in the Genus database with same CATH superfamily
2R1LA 1FX6A 3GY1A 3KLKA 1OFPA 3VOCA 2UY3A 1IEQA 1SW7A 1J0KA 3NQ8A 2WMIB 2AGTA 3NZGA 4H6RA 4Q6XA 2C91A 4IGSA 3V0SA 2OODA 4JYDA 3M41A 3LCWA 3H4XA 1JNDA 4B2DD 4C6CA 3PZ9A 1S2AA 3GDMA 4O17A 3SCTA 2WMKA 3PBGA 3SECA 3FYOA 5CG7A 1ALDA 1O60A 3M46A 3S6TA 3M16A 2VEGA 3MI2A 4LUSB 5I3JA 1RUSA 4ICMA 1B3XA 4AG0A 1MRQA 4XD6A 1BYBA 3C0QA 4WIWA 1ZJAA 1EBHA 3O6AA 1F3XA 1GWJA 3H53A 1AODA 1MFUA 2IPWA 1B0IA 3W28A 3N4AA 1OFEA 2WZTA 4KESA 4WDTA 4KWOA 2XN0A 1ISVA 3NGFA 2UY4A 2VX7A 2G37A 3OVQA 3WF2A 2R82A 4XZBA 3IJ8A 2JEQA 4LUTA 1JQXA 1UR8A 3UPMA 1GNXA 3QZEA 3AYRA 1JZ6A 3WK1A 1Q6RA 5GQBA 3M0YA 3IGUA 2Z7GA 3ARTA 3C2YA 4D8AA 5C9UA 3UA4A 3WLKX 2G4FA 2B31A 2FDMA 2WO5A 4PTDA 3ITYA 2NLIA 3C6CA 3CWHA 1W1YA 4WGXA 2GJLA 3BLKA 1ICPA 1ML1A 3RK8A 1K02A 4J3XA 1GYMA 6REQB 4EP8C 2NWRA 1K8YA 2OLAA 4HPHA 5FF2A 3WF4A 1XSJA 4HZ8A 4CKQA 2DVTA 2EPKX 1PSCA 2CXGA 1JCYA 2DZAA 3NWRA 5CC6A 3TH6A 3VZZA 1UZHA 4J3UA 1J6PA 2AKZA 2VM8A 1S2UA 4MG4A 1GGOA 4C7DA 2PDNA 2E9LA 5AHFA 1TIMA 4R88A 3W76A 4RJEA 1ONXA 4N9EA 2FFIA 1MW3A 2WNZA 1E0WA 3N25A 3QV7A 3XINA 1CENA 4ZQOA 3PN8A 3GG0A 2Z00A 1DE6A 1YMYA 2I7GA 4GGHA 3O0KA 1MVYA 4ROQA 3GXMA 3WMCA 1PDYA 1HP5A 3T8QA 4US5A 3MVTA 4LVAA 3LMZA 2PI6A 3AIQA 3WNKA 5XINA 3GC4A 3TYUA 1HL8A 3GHUA 1J10A 3NQEA 3WFZA 1E6SM 4GUGA 1Z44A 4WQ6A 4PL2A 2F6KA 2HE5A 1VLWA 3DDMA 2QT3A 3QYQA 4L7ZA 1B31A 3MY9A 7TIMA 3F4NA 4QCFA 5JU6A 4PUDA 3CZKA 1EGZA 4LS2A 1M41A 3VC5A 4HHLA 2GYIA 2DZVA 3NFUA 4IXHA 2YYUA 2VEKA 4KW2A 1IGSA 3GXDA 2PWHA 3NAVA 2ABBA 2HE8A 1S46A 4JL2A 1BRLA 3HG5A 4I9JA 3HPSA 5D2YA 3PF3A 3VABA 1PTDA 3PUDA 5CC3A 2V67A 4R33A 3CIXA 3QKZA 1U5JA 3WQFA 1SFSA 4LUJA 4MY8A 4N4QA 4HN8A 1XDLA 4OWGA 1VP5A 4OOZA 3AIVA 4RZBA 5EIYB 3FA3A 4EPDC 3WK2A 2CLHA 1VBJA 1LOLA 2WANA 3W1UA 5KZEA 2ZVIA 1B3WA 4LCRA 1ZRQA 1JAKA 3ZFHA 3F5JA 1UASA 4UXDA 3VDGA 1EOMA 1PTGA 5AYIA 1X7IA 2OU4A 4C6IA 4E4UA 1DTUA 2PDJA 3KCLA 1AW5A 4GYPA 4U5IA 3M5VA 2VQTA 5LNRA 3B4UA 1GW1A 3C0LA 3ZO9A 3PPGA 3NSNA 3P2VA 4FNSA 4O19A 4H7CA 3IACA 3VD3A 3PZGA 4LOCA 2GVGA 3FA4A 3NVTA 5AZ0A 4B3ZA 2F6XA 4DO6A 4M6PA 1F73A 3OIHA 5D09A 5DMMA 1JEZA 4Z2KA 1RK6A 1EPVA 5D2XA 4PCPA 3O3RA 2XSAA 4ZQMA 2HMCA 5C7HA 5HR7A 3GU9A 3LPOA 2IKHA 5LYRA 2PCEA 1KKOA 1Y5XA 2IPJA 3UNTA 1TCDA 3CT7A 3SZ8A 1BQGA 4HOWA 5IFPA 4UMAA 1MZHA 1UKPA 7REQB 5G1MA 2OEJA 3BJFA 4A3HA 3W1TA 3BE7A 2X42A 3KBMA 1PYMA 3E0WA 4S3GA 2OQLA 4EWND 3W72A 5J5DA 3GVRA 1LROA 2F7FA 3QRHA 3PZUA 1P4CA 5CPOA 3WQCA 4XUGA 4P7QA 1XYBA 3CUJA 4NJKA 1MEHA 3PANA 5E0KA 2D2HA 5FJUA 4MGGA 1QNQA 3OVPA 3WQPA 5A6SA 4JFSA 2G3FA 3WDQA 4FMVA 4JHOA 5HOSA 3W22A 3RLVA 4IG2A 3RG6A 4RDZA 4PMUA 1AL8A 3LCIA 5I3FA 2HZGA 3NQCA 3KBVA 1MDLA 2XH7A 4C6LA 3TN6A 3FIGA 5AZ1A 2C1HA 1X8FA 4ORIA 1YBQB 3MI6A 1KQYA 1B1YA 5DCBA 1XYZA 1G0CA 4K1GA 3FCPA 1JULA 2BOGX 1YTDA 3OBAA 2ANUA 1S1RA 5HPOA 1XYFA 4OQVA 4RPPA 2BS9A 3C2EA 4CN6A 4DB7A 2PEVA 3D5HA 2R94A 3SRDA 1V3MA 1LWJA 1HT6A 5K3VA 1JNEA 5HANA 3S9YA 5LIKX 1E9IA 3H2CA 4GH3A 1TJPA 1A3WA 1A4MA 2GQ3A 1TPB1 1R0MA 4K37A 2XIJA 3PZNA 4TR9A 4ADTA 1XS2A 3KBSA 2R1PA 4AD5A 5LIWX 3DFPA 4CCEA 1W1IE 2A4AA 5B7YA 3O6DA 5FA5A 2AAAA 5BWAA 1TWDA 1IZJA 5C9ZA 4MKSA 3CO4A 4H01A 4FXJA 4QE4A 1ISZA 2PUZA 2YBTA 3BLFA 1HZYA 4E2VA 1E6QM 1XLJA 1VIZA 4LAZA 4TIMA 4Q8VA 2V5KA 1B54A 1H7NA 4JTGA 3O9NA 1EJSC 4X22A 3NDOA 4JN7A 3XIMA 3NQDA 4LY8A 1WZLA 1A5KC 4PUKA 4HZ6A 3SY1A 4CN4A 1TMQA 1GQIA 2PC8A 2XN1A 4RR4A 2P0OA 1L6WA 2Q3RA 2BFGA 4H19A 3GNDA 1VFSA 2ABAA 4Y96A 4WCJA 1DJIA 3EOSA 3NQBA 2ZTKA 2XVKA 2PD5A 1QI3A 2OT1A 3YPIA 3DGBA 3GW3A 3BSMA 5C9WA 3B40A 4FEZA 3AWOA 4X9SA 1NP2A 1GONA 1XSIA 1Q8JA 1PIFA 1TVNA 2W0UA 3KBJA 1ADDA 1KRMA 4QISA 4NAEB 2JF6A 4XK2A 3BTNA 4HMDA 2J8GA 3UXAA 3W6YA 3E12A 3QLDA 3B3DA 1ITQA 2BY0A 4YTRA 3GFXA 1EJRC 2Z4GA 2RUSA 3ARSA 2B7PA 2Q02A 4O1EA 2FH8A 3W7LA 3BL3A 4LS0A 7CGTA 5EB8A 2WJZA 2VHLA 3VINA 1XCWA 2TYSA 1A47A 3A4XA 1J6OA 1GQNA 1Q85A 3C2RA 3EOUA 1Q5MA 3T55A 4JY8A 2ZUTA 1EGMA 4U5KA 4U10A 3Q37A 1A5BA 2Z28A 1GOXA 2Y62A 4X60A 4G2DA 4XO7A 2C1GA 2OOGA 4D6CA 3VDBA 4HPNA 2OELA 2D22A 4HOXA 3U5YA 4MY9A 3VKKA 2JIEA 1OM0A 3OG3A 4HA4A 4M6VA 4HZMA 3MUXA 2X40A 3QPZA 1LRQA 1HUVA 1RHCA 3TAOA 4EOUA 4L56A 1DOSA 3IIOA 2DT1A 4PUUA 5FESA 1C8XA 3AMLA 4C6MA 3SJNA 3W1LA 5D05A 1OT1A 2Q8ZA 3THCA 3ABXA 1X38A 4BJHA 5FIPA 3WQGA 4D6HA 1FWTA 2NVDA 4Z2LA 6REQA 5EJ1B 1UP3A 3EMCA 4D8LA 3ORWA 1R5YA 2BVDA 2Z2BA 3WJWA 2XM2A 2DUZA 3BOXA 1T8QA 4WXZA 3B8DA 1S5MA 4AZCB 3PG9A 2V5DA 1NEYA 2XIIA 3EB4A 5IRPA 1UKSA 4MWAE 4BQ3A 3ELFA 3HGJA 4UTJA 5D2VA 3UPBA 3KVKA 4UTKA 1O5RA 3HQOA 4V27A 1HXJA 1W3JA 1UPMB 3FVDA 3H4GA 4DJED 1ODZA 3FXYA 2RFGA 1O5XA 4EPKA 4FLOA 3G77A 3B8TA 4P8WA 3VK5A 4DXVA 2X2YA 2WJFA 3DX5A 3C8NA 4HPXA 3BJSA 3P3BA 4WZHA 3W1PA 4O1BA 4N42A 3CGTA 3XISA 4C65A 5CJ5A 2VUNA 4PTNA 1IQ8A 1IWPA 1FWFC 4W5UA 1D3HA 2C16A 4L9YA 5XIMA 2VYOA 1CLXA 3D47A 1EDGA 1XYMA 1EL3A 3T7VA 1E1CA 3RAOA 1FUYA 3E74A 3CZJA 3PVFA 4MWAA 3QZ6A 4DY1A 2A85A 3GKFA 3J7HA 3LHYA 4N9DA 1MUMA 3L12A 1XIHA 4JAWA 4XVDA 3SSJA 4EVZA 3CHVA 4PCSA 4J3VA 4E8DA 5IDIA 1BGAA 2H8ZA 4OECA 4RX0A 2ZXDA 1BF6A 3BG9A 3A4WA 2UV8G 2XZ9A 2VOMA 5AVNA 4C5YA 2PDMA 4KFNA 3AIRA 2WKLA 2G4JA 2PDHA 4O18A 3STFA 1JXKA 1XGDA 4XIMA 4E38A 3TYCA 1Q13A 1GW9A 4XQ6A 4Y6GA 3T0AA 3PZOA 3JR2A 1MEIA 2Z26A 1H7XA 3G1YA 4ZOBA 5FF4A 1O7AA 2GK1B 3I7QA 2GJXA 1TREA 4OTKA 4AWUA 1FWSA 1H61A 4FS9A 1RQEA 3H2AA 3WY1A 3LPGA 1B3OA 5I79A 1K7FA 2AQVA 3F4WA 1XLAA 1JFHA 3BK0A 4U2ZA 5HK4A 5AC8A 4DRSA 2XSXA 2CHNA 5HUPA 2OOFA 1V6UA 2HS8A 2V81A 1P1XA 3B8SA 3QC0A 1RD6A 4MLJA 3K2GA 1EJ7L 2HVNA 3APYA 2DVUA 5G2WA 3AIBA 3VC6A 3LRMA 1W2VA 1KO0A 3I10A 3WL0A 1RPKA 3MANA 2HVOA 3NCOA 2GUBA 1PX3A 1RVKA 3QW3A 4XV0A 1QXLA 1FKWA 3LY0A 2Y24A 3NQ2A 1WE5A 2EJAA 3WMLA 2BOFX 4RE3A 3IUHA 3MWAA 1GOMA 3HM7A 2XH0A 2ASHA 3WG6A 1AK5A 3S2JA 3HGOA 4DJDA 4Q3MA 4W8AA 1XKYA 4GC3A 4GCXA 3CHEA 1W1ZA 2QPXA 2CLMA 3N2OA 5CBJA 5DX7A 3PUEA 2E6AA 3RJXA 3AUOA 2CWNA 3RR1A 1M68A 4Q8NA 4BFAA 2VZVA 3VD7A 1PKNA 1XIMA 1BTCA 2XWEA 3W1QA 4H6KA 4U2YA 1ZBKA 4W93A 1K70A 1KRCC 3O07A 3W3OA 3EOEA 4ZE5A 3ZXWA 5E6ZA 3UWQA 3IUDA 2WPGA 2EQDA 3CL7A 1LBFA 2O92A 1RBLA 4JX5A 2A3EA 3W6MA 4EKJA 4IFKB 1OK6A 3EDEA 3BZJA 4O1AA 3FKKA 4PFMA 2PLKA 1DJHA 3KEHA 2Z27A 4GY7A 3RU8X 3R7MA 4P61A 2DFAA 3CB8A 4GXPA 3DBPA 4XTDA 5EA9A 3V1HA 3F4DA 3TW7A 4XAZA 2O7SA 3W0KA 4KPLA 5LXEA 3G0SA 4PRWA 3L23A 4QSHA 3URNA 3MCNA 1BAGA 3DYMA 4PUWA 1I2PA 3HOJA 1E5JA 1VFOA 5BOFA 1MXGA 2X2GA 3WD0A 5HULA 2V82A 1IT8A 1Q7ZA 4NNBA 4H9UA 4F4RA 5CJNA 1T8XA 4DJEC 3CL6A 2WNQA 1DTNA 1I8JA 1FP9A 1E4IA 4RK8A 1ICSA 3EWDA 3OZPA 5T8GA 1H62A 3W2LA 5C9XA 3UWUA 4QS5A 4WJ8A 2JQXA 4A4AA 4NQ1A 3S1WA 3PB0A 3KFTA 1EQPA 3PZVA 1GKQA 4CNTA 4ZENA 1ZAJA 1E6XM 1SR9A 1YHTA 3T81A 2VD9A 3FEMA 4RNFA 2OKOA 5BYWA 1TYGA 4US6A 3N29A 2FQIA 2E1WA 2OT0A 2BTMA 4GNVA 1PZ3A 3APGA 2OLSA 1QVBA 4HNVA 2GGJA 1F3EA 4R3UA 1X1ZA 4EF8A 2QCMA 3AAMA 1GPWA 4J1OA 5DEZA 1EXPA 3G1HA 4DLMA 1BVWA 2J7FA 1K9FA 3GH5A 1R30A 3L4UA 4OIFA 1YXDA 3AJXA 1LG1A 5D03A 3LCGA 1IEXA 5I77A 4NHVA 3UPWA 1TV5A 4ATLA 5CEWA 1JZ2A 3WEMA 1CW2A 5CBIA 1Y8BA 4LALA 4QLLA 3GVVA 2YXXA 3HBLA 4I5RA 1V0NA 4GFSA 2Z7KA 4TXEA 1O5KA 3EBVA 5FJOA 1PIIA 3DN5A 1TMHA 3HB9A 3QR0A 3M44A 5MF5A 1XH0A 2ZXBA 2OZ8A 3GVGA 1T0OA 2R24A 3L9CA 4ACZA 3UWYA 3P82A 3VD9A 4PMYA 2CKSA 4HU3A 4AD2A 3MMUA 2H8XA 5I2UA 4PBGA 3VKJA 4HTBA 4Q4SA 2FHBA 2E8ZA 3KL0A 4MLRA 3WLSA 1QK0A 4L9XA 4NNAA 3PJTA 5JVLA 4LPCA 3AZTA 1HFBA 4GBUA 4HT3A 1X1OA 1YPIA 3VZYA 2E7FA 1MW1A 3AYTA 3EOOA 3MTWA 4UQAA 4A29A 1GQLA 5DY3A 4GIAA 4MAZA 3F4VA 4C6QA 3UGRA 4DBDA 4MZYA 2X1UA 2PGRA 2WVVA 2Y7GA 4C6KA 4YCOA 3O15A 5XIAA 1E73M 2GPTA 2TODA 2YCLA 4AZ6A 4DVOA 2H90A 1KLZA 3QXBA 2GOKA 3GW0A 3VA8A 2WHKA 4NF7A 1KM1A 1WKYA 1UR2A 3SCQA 3IGXA 1HTIA 2LLEA 3RCMA 4H04A 4QQUA 4HPJA 3LM7A 3R13A 1NH6A 2ZUUA 3GYEA 4LCQA 3UYIA 4KS0A 3UWEA 1XIGA 1KBLA 4HMEA 1FOBA 3GUGA 3WZ0E 4E5TA 5TD4A 2XYLA 2PC4A 3V3WA 3BLEA 4LC6A 4LY4A 2ZDSA 1M9HA 1E3XA 1QBAA 1OIMA 1K8ZA 2X09A 3M43A 3ZLFA 3RO8A 3QLLA 4BA0A 4FB7A 2VR4A 5A8GA 1V5XA 3TVAA 4GUHA 2PP3A 3T9PA 1Q4NX 2BY3A 3RMEA 2WNNA 4POCA 5D04C 4KEUA 2YL5A 2BVYA 1ZU8A 2WCAA 4M51A 2ZRYA 4PC8A 1NDVA 4RNJA 2EHHA 4Y9MA 4TTUA 4MWAD 3HPFA 5A6LA 4LRTA 3FNDA 3AIEA 3CH0A 4EK7A 3CLWA 5B80A 1NF0A 4JTTA 4LCSA 4BQ4A 3SDOA 3E2QA 5HMFA 3EXSA 3SEPA 3EWYA 4MDOA 1QR7A 5EBUA 3PHAA 2OWWA 2OYLA 1HGWA 3ALFA 2QJJA 1PHQA 1E1CB 2P5NA 4ICCX 2WM1A 4YVVA 4OOUA 2P50A 4PA8A 3W6LA 1JYNA 4O10A 4GYJA 3BGAA 3NDYA 2HXTA 3CH9A 2EGZA 3ONBA 3DFYA 2VFGA 1QI2A 1FWIC 3KXQA 3GR8A 4K38A 3W7KA 3TJXA 1RH9A 2NUWA 1I2NA 1EEXA 4ADSA 3L5LA 4R9XA 5E5CA 4FNRA 1FRBA 1RJPA 3ITXA 1E43A 3SQLA 4DHGA 4F8XA 2A3BA 1WQ5A 1DJWA 2E25A 3FGCA 5C2CA 3MPGA 5AFDA 4NT0A 1JCMP 3WJZA 4UFJA 1R2RA 1P7TB 3PY2A 2ICSA 2WLYA 3W38A 2ALRA 1YDNA 5M1TA 1QOQA 3P80A 2FKPA 4EPBC 4QAWA 1FH8A 5IHRA 1W2PA 5C54A 4WY0B 2CFFA 3A4JA 4IX2A 4Q4QA 4KWSA 3LHVA 3DIPA 1WX0A 3NTYA 5FJRA 2BP1A 2YGYA 5HNNA 3CMFA 4S3DA 5ABFB 3QW4B 3WDRA 3C4UA 4P7OA 1A0CA 4WY0A 1XG3A 1XW8A 1FH7A 1L0PA 3IIXA 2XM1A 5K9DA 3C2FA 3DG7A 1UWQA 4ATWA 1UOZA 2DZSA 4DBWA 3IJ7A 4OT7A 4TVDA 3I3DA 5HAOA 3MP3A 2YCLB 2OGYA 5CGTA 2B7OA 2I56A 2Z1VA 3O1NA 1NAL1 3LM3A 3AS2A 1NTHA 4AZCA 3R4IA 4MUZA 1EJWC 3SAZA 4X3ZA 3AUJA 2XINA 3GM8A 3A3HA 3K1GA 5CGMA 3SRKA 3UETA 3W53A 1TZZA 4Y90A 3CHFA 2YXOA 1X39A 1XUZA 3RIKA 2Q01A 3R0KA 3TXZA 3LXBA 4FOUA 3TQPA 3ZT6A 4C1NA 3OU8A 5TF0A 1OT2A 3DUGA 2Q3OA 3W1XA 3WD2A 4IWWA 2YL8A 2P1FA 2F2HA 4GY0A 3CV6A 2ZRZA 4IZGA 3WNPA 4LBSA 3CIVA 1NSJA 3QC3A 2FVMA 3H70A 3SADA 3S4TA 1Z8AA 2YA2A 2NQZA 4FK9A 3BLPX 3F4CA 2D2GA 1ZALA 3CQ0A 5I3HA 3QV9A 3OA5A 3LA4A 2VC9A 1MZRA 4DJFA 2XVNA 3G6MA 3GX9A 5G4HC 1GORA 5HJXA 3SUWA 3K46A 2IMRA 1Y5VA 4KGLA 3NPXA 5GVJA 1SJCA 3QMSA 1HJUA 2GWNA 1S38A 2BMBA 4PFHA 5CLWA 4PGLA 4DXKA 5C70A 4RCXA 3RNDA 3VDCA 1JZ4A 3POCA 3PNZA 2QUTA 3EDFA 2ACRA 4WSHA 3VMPA 2GK1A 1Z41A 2E9BA 4UC5A 1SO3A 2DVXA 4KCVA 4Z1AA 1YTEA 3D3FA 3BUVA 3CAWA 1XD0A 5E93A 1S3HA 1UC5A 4AX6A 4NVTA 1UW9A 5I09A 1H5VA 9XIAA 3L0KA 4B2DA 3A4AA 1HJVA 3KCJA 3FAXA 2GZXA 3AYVA 3DFQA 5CZSA 3TNOA 5KEZA 4WK9A 4FOKA 5DO8A 1JL8A 4ZB2A 1XBZA 4HCHA 2CIPA 3BCJA 1DIEA 5D02A 3SY8A 3AHXA 1V77A 2ALDA 1ZTVA 4XUYA 1XIJA 2J4GA 1TV4A 1ODUA 2HDJA 4AZBA 4HK5A 3O6YX 3FX4A 1WZMA 1NU5A 1QBBA 3GKAA 1VCVA 3TFXA 4HGXA 4JL1A 1SZNA 2C7FA 5LIXX 4HA0A 3LYEA 4DWSD 1WAUA 1AMYA 3P7YA 3K1DA 1A5AA 5EGRA 3MCMA 5JXQA 5CPMA 3RMJA 2QZRA 5D9PA 4QIUA 1TR9A 3DI1A 1KM3A 1LQ0A 3KBWA 2WKJA 3VNIA 2PWFA 3SGZA 3WLTA 4LS1A 4RZ4A 3F1QA 4AVNA 3BQ5A 3KRBA 4LX4A 1QHZA 5EMJA 1WCGA 5I7GA 3WDHA 2H3BA 5EJZB 1XYLA 4ZCWA 3RCYA 2NWSA 2WZMA 3EA3A 2Z24A 1XKJA 1OF8A 2J7EA 4Z42C 4OJYA 4EAMA 2WSPA 4Q4PA 3U2CA 3JVAA 4ADUA 1TJRA 4ZMGA 1FP8A 1TPFA 4JIPA 5J5RA 3KCOA 1OZMA 4PCTA 1VEPA 1AJ2A 1XWYA 5CC7A 2VDGA 1XIIA 3V36A 1E55A 4GYKA 1QASA 3M64A 3M0JA 1FH9A 1FXPA 1LJYA 1OCNA 1RCQA 4TV6A 1P0DA 4W86A 1XIEA 4AWTA 1W37A 3N9KA 4ERIA 4KGJA 5CZTA 2CETA 2BXYA 2XH2A 4QEEA 3WH5A 1DJYA 3IVSA 4PTXA 2VFDA 1W17A 2GVLA 4DZHA 1O6IA 1XBVA 4GMEA 4HK7A 3S42A 1QAPA 1KGWA 1LL4A 1U1UA 1LDCA 3IJQA 1ADSA 1K1DA 4P7RA 2Y8KA 3N19B 1LWHA 2NXGA 3N2TA 3QHMA 4I8YA 4UCFA 4GQGA 1R2TA 1XIBA 5FEPA 3WD4A 2HJPA 5JH2A 4OGZA 2R1KA 2UY5A 1SR0A 3QMTA 8A3HA 4YCPA 2NT1A 3FFSA 4M3PA 1E15A 3MMDA 3MT1A 1LF1A 1SZFA 2JBMA 4JHMA 4D2JA 2DPEA 1DVJA 1J0IA 3N6HA 4H2CA 3R6IA 3U8GA 3FDGA 3SCPA 2IW0A 3LBMA 2VT0A 5I24A 3B8WA 8RUCA 2EAWA 1EX1A 1F8MA 3DCPA 2DDXA 4BWLC 3CTTA 2VL4A 3KDNA 4YWSA 1J2BA 3MYOA 3ZSSA 3DG6A 4NU7A 1DIKA 1PE1A 2H9AA 1W9DM 3FJ4A 4C6FA 2C3ZA 4D9PA 3MO4A 4XD5A 5I3GA 1O5QA 4NZJA 1V08A 3B8UA 2I5GA 2ZICA 4IMDA 2FJKA 3GB6A 2ZBTA 3T8LA 1XDJA 3AMKA 1RCOB 4H7VA 5JBDA 3SCVA 4Z2JA 2VC5A 3MWCA 4F0SA 4UMBA 5LIUX 1IEIA 3BVJA 1B2YA 2YDQA 1RP9A 2Z6JA 1F6KA 4KCUA 1K6WA 5BWFA 3F2DA 4JFVA 4C6EA 2BODX 4FX8A 4C6DA 4J3TA 1JF6A 3VKDA 1UA7A 1ONEA 1UP2A 4AISA 4G7EA 1CLKA 3C0JA 3LGEA 3SY5A 1G4PA 4V2XA 2VR5A 2WHMA 1QNRA 3PZMA 4JIIX 2VWSA 5E1QA 3NSMA 2ZFAA 3S2CA 1KTBA 1TPC1 3NO5A 1A5SA 1KTCA 1TJ0A 4DF1A 2J7HA 7A3HA 1EP2A 1WDPA 3QOKA 3LD5A 4HYVA 1ITCA 4KF1A 3LN3A 3HQNA 1YNPA 4O54A 2C13A 1GEQA 7XIMA 4RDYA 5EKYA 1PCKA 1YE6A 4LEQA 3UNDA 2J47A 3P81A 2DSZA 2NQ9A 3HURA 4ZR8A 4MJMA 4GJJA 3MV11 4BS0A 2I57A 3U5UA 3N12A 5A6AA 3EX2A 2R91A 2JKEA 3A9IA 2PDGA 4Z08A 3OHIA 5AN7A 3UU0A 3CZEA 3H21A 2X16A 4IFOA 5DMYA 5BNKA 1M6JA 4FF7A 5HQMA 1WPCA 2YL6A 1KM0A 3NQFA 3EX1A 1UJPA 1P6BA 3DHDA 1UUOA 3DZ1A 1TWZA 2WHLA 4QJ5B 4M6UA 2CZDA 3FJNA 1KLYA 4QDPA 3B06A 3HPAA 3BW3A 4Y9AA 1DJNA 2BBFA 3U4AA 4J9JA 2QIWA 1E70M 4OUEA 2J7GA 1IWAA 2V2HA 3VUSA 3GZAA 1ZQ5A 1XXXA 2QUNA 2A3LA 1JVNA 1EFZA 3URBA 3T08A 1CECA 3WNLA 2E09A 3TKFA 3BSHA 3CBWA 1XISA 3CQJA 5HWNA 2YB1A 4YIWA 3N2MA 4AIEA 4LVGA 5PTDA 5FF3A 4F48A 4ZE4A 3LSBA 3KLLA 1F4HA 2VFHA 4JD4A 2QCEA 3AMCA 5DMLA 3W2UA 4B5VA 3DFHA 4G8TA 3TIMA 1QNPA 3QVQA 2OYKA 1UKTA 3RN6A 1PUDA 3VD5A 1K03A 2OSWA 3CQHA 2ZRXA 4NXSA 2CWXA 1ZZMA 1R7OA 4AHOA 4TVCA 2PBOA 1SSDA 5DCEA 5CZJA 3MUZ1 1JG9A 2W5FA 2FGZA 2PLJA 1G9HA 3I3BA 2VCBA 2X41A 3S5OA 2G50A 2ZZ6A 2YW3A 3JS3A 1LUCB 4CNSA 3BDKA 5HXMA 4HHHA 1HKJA 2G3NA 4MVAA 4MKVA 4JTFA 2A7PA 1TJ2A 5A95A 1UZDA 3AHZA 1OFBA 2E4TA 3ZR5A 3FSUA 1AD1A 3RR4A 3KZPA 2V0TA 1A50A 3W85A 2POTA 3VOJA 3ZYZA 2F84A 3RDKA 1HKWA 1EP3A 4E8GA 5C7VA 3QMRA 2PRLA 2DSKA 3L2LA 4H3DA 1CI1A 4QNWA 4P8VA 2VENA 1ELSA 5E0FA 2ZIDA 3BAIA 4MNJA 1WDDA 2WW5A 4MIMA 3VGBA 2NX9A 3D46A 3UXDA 2HPMA 2XVLA 4UQBA 1EP1A 4JQ4A 1SFJA 1V93A 4IF2A 4FLQA 1GVSA 5LHFA 1CXFA 4TOQA 2XFFA 4DELA 4UR9A 3P61A 1WAWA 1XP3A 2IKJA 4J35A 3CUHA 1C3FA 4GZEA 1K4HA 3TA9A 1CGWA 1EJTC 4GD0A 3NR0A 1H1NA 3BW2A 3EDDA 3W23A 3S2MA 5C8BB 3TU9A 2J8TA 1DE5A 2QEZA 1MXDA 4DPQA 3LZ5A 4DI9A 5CSYA 4R9OA 3RLUA 2W67A 3MBDA 3QY8A 2ZE0A 1VHNA 3PTQA 2D1ZA 3GR7A 4KEZA 2CHOA 3ABRA 3WQDA 1R3RA 4DAIA 3OGRA 1F6YA 3VPLA 4B9ZA 1RLCL 4L6OA 2PDKA 2J7DA 2VX6A 3TOYA 1U2YA 4MZ8A 1R3YA 5T9CE 4YTUA 3GDBA 4NUWA 2FJUB 3NOYA 2BLEA 4QE5A 1RR2A 3R10A 4QS6A 1XX1A 2W91A 1DIOA 4GBDA 3V0TA 4IOTA 3T05A 2RJHA 4LYKA 2QDHA 4DQWA 1VJZA 3N3TA 5G1TA 3KL3A 2YLAA 3OHMB 3UXLA 2ZKMX 4QJ1A 3LQLA 3R0DA 2PTYA 1XV8A 4AUBA 3TYDA 3S2NA 2PWEA 5AHLA 2DH2A 4DEFA 3URQA 1SO5A 6TIMA 3VIGA 2WQPA 4HZ7A 1ZJBA 4JR5A 1TZ7A 5JMUA 3TDFA 2PPGA 1BWKA 4JCLA 3RM8A 3S2LA 3GTIA 2BDQA 1JGIA 4LGXA 2IQTA 1I9CB 4E4FA 4Q4KA 2QVNA 2YPIA 3B05A 2QCCA 2VC6A 3PPFA 3S0CA 4IPNB 2G0WA 3RILA 2ZA3A 3MQTA 1EYEA 4S3BA 2A3AA 3W29A 5AVHA 1W3TA 3TQVA 3UG3A 2I9UA 1QNSA 1V6XA 5K4ZA 1MUWA 1N8IA 5TAOA 3C3UA 5DCDA 2GDVA 4AMCA 2OYMA 2J24A 9RUBA 4FLSA 1E0VA 3EKGA 3UZ5A 4QM1A 4FP1A 2D2OA 5H2ZA 3QZAA 4HA3A 2PTZA 4GX8A 4X2RA 3SCWA 4ONVA 3PBWA 4HNCA 1EO5A 5D30A 5BOOA 3SRFA 2CESA 1V6VA 1DWIM 2HV5A 3WBWA 4K7VA 3SN1A 1OYAA 1UROA 1RQHA 2FPYA 3CIWA 5FJPA 1XLCA 3UG5A 5E0CA 3R8RA 1WUEA 5M03A 3L66A 3PPCA 1ZBVA 1SMAA 2AL2B 5KZ6A 2NUYA 2VRQA 1PKMA 4FI4A 4R53A 3ABQA 3UF9A 2UY2A 1UD6A 3EWWA 2TSYA 4Q4OA 4I7VA 5F4WA 4ZO7A 4ERAA 4AFYA 1QMLA 4GIYA 1SM9A 3QSTA 4B5XA 1GOQA 1T6MA 3AMGA 2PAJA 1P1MA 4IGNA 4CVWA 1YTKA 4Y7EA 3STCA 4GI9A 1U5VA 1NIUA 3KTCA 1BG9A 3MSGA 2AGKA 3WQVA 4XVEA 4IFRA 4I5XA 1J12A 1E4LA 3PC0A 3NZ1A 2J13A 1I60A 2CZVA 3UW6A 4C60A 3S6DA 2VTFA 1UJQA 1BF2A 1YADA 3ATZA 3POHA 4W89A 3IWPA 1YRRA 1YW1A 5U7SA 1UG6A 4L4OA 3R58A 3LHWA 3WF1A 1UZ1A 5HPCA 4PULA 1TRIA 4INFA 3PBUA 1ZJIA 4JBRA 5BXPA 7ODCA 1R3QA 2WZIA 3TNBA 3QH2A 4Z1DA 2ZUVA 2D23A 1W3IA 4BKNA 4ZODA 3A24A 4NZ5A 1JRCA 3CASA 3ERPA 1ME7A 2VXNA 1ADOA 1XLGA 2VCCA 4JTDA 3W71A 3OA3A 2PDPA 5AC4A 4Q32A 1Q7QA 4DO5A 3R2GA 4GUJA 1AZ2A 3ZJ7A 1B3ZA 4ZQRA 1B3YA 5JH1A 3G1SA 4QTGA 1Y7VA 1OABA 3WJYA 1DXIA 4LYPA 4CQ9A 1H1YA 1PVNA 1R7AA 2PSNA 3A3XA 3PAJA 1AQFA 4ZB5A 1GTHA 4I6VA 3BLOA 4UTFA 1V7AA 4CD4A 1OIFA 3ABOA 1QI5A 3P8JA 3Q94A 1RZMA 1V03A 4WOZA 1C91A 3KHJA 2XGBA 3DKLA 5CPLA 1XFCA 1OJXA 1MDRA 2OZTA 1PKYA 3U7VA 1NDYA 1UHVA 2YA1A 4LUIA 3RCNA 2F2KA 4NSBA 1X98A 3V75A 2H3DA 5CSUA 3SURA 1HF6A 4Q8QA 3FJLA 3VKBA 1BD0A 1C8YA 1JZ7A 4DBUA 3BGGA 1CB7B 3NQGA 2FZ8A 3AOFA 2GWGA 2GUYA 4JX4A 4GI4A 4IT1A 4PSRA 1SQ7A 3AU2A 3NEVA 3T4CA 4AWSA 1GQKA 1CGXA 4ILSA 2XDFA 4XKYA 3ZVIA 2TAAA 1L2QA 5IDZA 5A3HA 4AX7A 3VNMA 1KFEA 5DT7A 1QI0A 2PP0A 2QJIA 4BY3A 2VDHA 1T41A 3BMXA 4OZOA 2Y8VA 1W0MA 2HRWA 3AU6A 4HSOA 1OFRA 5G2IA 2IPGA 1KWKA 3C5QA 1V02A 2EPNA 2VZSA 3SW6A 4KMQA 1VLIA 2JGQA 1O4UA 3WQEA 1YXYA 1E4MM 3RM9A 4HVXA 1E0UA 1JPHA 2HWGA 3QBUA 1T5AA 2ZX7A 1A5LC 1EKOA 1GQJA 3V16A 1UUQA 4DUOA 4DBEA 3T78A 2CERA 1IXNA 5CAKA 1ZS2A 3AHVA 2CBIA 3GHTA 3KUMA 1Q63A 1FWBC 1V6TA 3CMGA 3STPA 4CCCA 1MNSA 4H8NA 3KP0A 4JIRA 1O95A 3TWBA 3W82A 3U2EA 2NV2A 3VOIA 1XBXA 4B9YA 1JZ3A 4AAJA 4H9VA 4RNHA 3TMQA 1VRXA 4BF5A 1FWCC 5M3WA 2ZWYA 2V3DA 3TSDA 2QW5A 2R1NA 2INFA 1MWOA 1IE7C 1K9TA 5HQLA 2ZQ0A 1MEWA 4TV5A 2QJMA 3HPZA 4QITA 3GNPA 2YCIX 4HYRA 1H60A 4UOZA 3QV6A 3RHGA 1E9ZB 4JTKA 1J96A 2A79A 3VYLA 1GOIA 3OLDA 4JIEA 1KR0A 2WLZA 1EC8A 1W5MA 3GZ3A 1JJKA 3TUUA 1A5OC 3TCSA 4S3EA 1LZOA 1EA0A 2NX1A 3P6LA 4MNLA 4JIQA 1YXCA 1BEUA 3LRKA 1I1XA 3WK3A 3WUEA 3NUKA 1BYCA 2NXIA 3EMZA 4PEKA 2DZBA 1YEYA 2D3LA 4RV8A 4Q7BA 2QKFA 3UY7A 4BI5A 1EHAA 4R27A 3FGCB 4PN2A 2V63A 4XZHA 5G2HA 4GQRA 2O55A 2VURA 2VRKA 4EACA 2R9RA 1FWHC 5F4SA 2BGNE 4LH8A 3EB3A 3H7UA 2QGHA 2XFYA 4F2BA 1EZ2A 5H8PA 1LQ2A 3O06A 2PLMA 5IOBA 5DMNA 4V28A 2G8ZA 2ZZ3A 3UR8A 1PWMA 1SW0A 1R3VA 1MI3A 1M7OA 4KFOA 1XLMA 3BMWA 2A3CA 2ISFA 1WBJA 4BI6A 3EGJA 3IJDA 1W9BM 3WBXA 5CQ1A 3T0BA 1M7JA 3INPA 1ZHAA 2WB5A 3SRHA 5AB3A 1H1ZA 3VZXA 3T07A 2YDAA 3OYZA 1WDQA 1VC4A 5U4NA 2GQAA 5DFAA 5D8WA 5JQ9A 3KW3A 4FO4A 5FSEC 1HN1A 5A6JA 4ICNA 3TSMA 1L8NA 2R1MA 3UJEA 2CNCA 3CK5A 2I5QA 3TTSA 4IGMA 1XLHA 3W26A 4GI6A 4D6FA 3A3WA 4YHGA 5D2WA 5LSMA 3GTFA 3MP5A 2IPFA 3CV7A 1HG3A 2V9DA 3MW7A 4D71A 4C7FA 3BAXA 4REQB 4HPGA 3SUSA 1HGYA 1DL3A 1XRTA 3LV5A 1IXOA 2DIKA 4K36A 1CGTA 2F61A 1AMKA 5I3KA 3A12A 3LHUA 1YE4A 1RJRA 5GJMA 3LMYA 1LLWA 1M7PA 3ZWSA 1AJ0A 3U3HA 1S2VA 2OQYA 3U9IA 1VKFA 2V5LA 4GJ1A 1UIOA 4Q4MA 3AIUA 4QFUA 2CLKA 2A2IA 4TUFA 1FQ0A 1N7KA 5FKYA 3MV01 1XYCA 4B5NA 2WSYA 1XD1A 1KXTA 1C9WA 3FN9A 3RXZA 1H0IA 1JPKA 3VIKA 4L6HA 1UD3A 1TPH1 3NZQA 3S5ZA 3M5ZA 3SR7A 2O0TA 4LSBA 1WV2A 1KM4A 3GNNA 4PMXA 3TW9A 1FA2A 2XFWA 3REQB 4FR1A 1J0JA 4NAEA 4WKHA 1EYWA 3N9SA 1PKLA 1QJWA 5E9XA 5BW6A 4TMCA 1US3A 2PDBA 1E9YB 2D0HA 5B7ZA 5A94A 3CU2A 2QXWA 5M5DA 3N15A 3UR7A 3TAKA 4JKMA 4DM2A 1R9XA 1TX2A 1T99A 4GUFA 3ITVA 4KIEA 1BRLB 1E71M 2V3FA 4N9BA 1AG1O 4GA8A 4O0ZA 3K5XA 4LANA 3ECQA 4FPSA 1S5WA 1DWHM 2PLCA 2QF8A 3KOZA 2NZLA 1BWVA 1IT0A 2QDDA 3EPNA 1K8CA 2YBVA 3MUIA 1KM2A 3HZ3A 4LYRA 1BPLB 4ATDA 1PHWA 4UWMA 1E3ZA 1UH3A 1UCWA 3GH4A 1V0MA 1GPFA 5I00A 2DZTA 5DQPA 4I5UA 2ISVA 2NSXA 1EC7A 2E77A 5GNYA 1W3HA 1PXGA 4Z1CA 4HU0A 4O4VA 2JFEX 1AL7A 4XKMA 4IPLA 3VUPA 1ITUA 4YJ5A 3GIYA 1JFXA 2Y61A 4M81A 1KXHA 1PZ0A 3W75A 4FIQA 1WDRA 4F9JA 3A64A 1YPXA 3VU2A 1XPGA 3D6NA 4MYAA 4AY1A 4HNTA 3LUTA 4PCFA 1I0BA 3BAJA 2XN2A 1ISYA 4A8RA 1QW7A 3Q58A 3TONA 3O2LA 1KFBA 1KCLA 4UTTA 2VX5A 3WELA 3ICJA 2GGEA 2QIIA 3EPMA 3LCFA 3IIZA 2AAMA 4CQCA 5AHMA 1ME8A 2FZBA 2Y5EA 3BANA 2O9OA 2YOCA 4W9TA 3TP4A 2FZDA 3FXGA 3T6CA 3E96A 3FS2A 2BY1A 4L9ZA 1VD6A 4K8GA 4JYEA 3C2OA 4C91A 3VKAA 3R89A 5C5YA 4F0HA 5BMXA 2NQ5A 4MKNA 3MSYA 3AROA 3N04A 3MDUA 1FDZA 3LBCA 4GLEA 4Z2GA 3Q65A 4XO6A 5KINA 2VFIA 4MTVA 4P02B 5DBTA 1VZWA 3I68A 1JZ5A 4XZMX 3UT0A 5A8NA 3EX3A 3H55A 4FXFA 2CXEA 2INEA 4S3AA 3S5NA 2VRJA 1UR0A 3E0LA 1BXCA 3QSRA 4HQVA 3TW6A 2OLHA 5EY5A 1RY8A 2YW4A 3OGSA 4NAFA 4UR7A 3WLHA 4DZIA 4NZ1A 4U3AA 1D9EA 3ZVHB 4AC1X 4CD5A 1N55A 1HO1A 1BKSA 5D9MA 1VPXA 3C8FA 2Z1SA 1KV5A 4CNPA 1VAHA 1QPRA 4ZXLA 5EMLA 2FMNA 4C7GA 1VPYA 5H8MA 1TTQA 5M17A 3KWSA 1EIXA 1OYCA 1Q45A 4MB1A 4LVDA 2CZEA 3NPWA 4MOZA 1LOQA 2ZWZA 1GZGA 7ENLA 3PBMA 1GVOA 1LQAA 4YS1A 4GPNA 1O66A 3M0VA 2P10A 1IT7A 1UWRA 2J6VA 4CQBA 3L4XA 5JBEA 3VGEA 4XISA 2PWGA 2ON3A 1J79A 3ANUA 1Q6GA 2G41A 3ANYA 3LBOA 4IIHA 1KKRA 2E5DA 3VVGA 3PWGA 4CQ8A 4NRRA 3MKKA 1WBHA 1X6UA 1CX9A 2HTMA 4QG6A 1BYAA 2GJPA 4CN1A 3B0PA 4K68A 4O4WA 4CU8A 3RRXA 1ZPTA 2FB2A 3TC3A 3R11A 3HF3A 1IR1A 4D1IA 4Z1YA 2D73A 4Q4RA 3AWNA 4V15A 4B5UA 1KXVA 5CCZA 3TTEA 4O50A 1VEOA 4AVFA 5HJYA 4KCWA 4O8AA 3W81A 2CBUA 9XIMA 3W01A 3F7JA 2BVTA 3RLHA 2VCAA 2X1RA 3PZIA 4S3JA 4PB3A 4TX8A 3B8IA 3ZZ1A 4A6GA 3OOQA 2DJLA 1LT8A 2QGYA 3EMQA 1EF2A 3BXWA 4DJDC 4EXQA 1BVZA 4YVXA 2IS7A 4DF2A 4R7JA 4AQLA 1DJGA 2P0IA 4O11A 4GQBA 3DG3A 3R25A 1WKFA 3VDHA 2P3ZA 4LXFA 4EF9A 1ZB5A 2AL2A 1E0TA 4A3UA 3C61A 4N7QA 3VO0A 3AC0A 4RLIA 3AYSA 5DY2A 3L7RA 3REQA 3B8VA 3FOKA 3W1AA 3V0UA 1NDZA 2FPVA 3R79A 4W7VA 5EYWA 3O16A 3FKRA 4QAIA 2QV4A 1OWQA 4W87A 2V3EA 2CU0A 4FXSA 2DY3A 1QU4A 3LB0A 1PO9A 4N02A 2OWCA 4AEFA 4DNHA 3CZLA 3VAVA 1FCQA 2PRHA 4GVHA 4K3ZA 2XIQA 1KNWA 3CPGA 1ITXA 3QKEA 4DWSB 3FHAA 1GK8A 4HNUA 1QATA 5HNTA 4IP4A 1VBRA 3BOLA 2NW0A 3VCRA 3WLMA 1OD8A 2VVNA 1XG4A 3G1RA 4NAFB 1AW2A 4XX6A 1Y65A 2WXDM 4GHRA 4G6CA 1D3GA 2J8FA 4GIRA 3RGTA 2MANA 3NJ3A 3QY7A 2R6OA 3MU7A 4LAUA 2BY2A 2POZA 3UZYA 1MO0A 4IIBA 4JXCA 2PDUA 4KT2A 1PTAA 2ACUA 3AJ7A 4HA1A 5LXXA 2OR2A 5JIWA 4MB4A 2DZWA 3RUBL 3FV9A 5CPQA 3UZJA 4QROA 4IIGA 1VGAA 2BVWA 2W6RA 3PWIA 2BGQA 5DRIA 4DUXA 2YBUA 2O9RA 3UWVA 4AVOA 2WPBA 1MSSA 1GEHA 2O4QA 5HA7A 3O6CA 1FWGC 4UFHA 3AXIA 5FD0A 2ZA2A 3APTA 3HGSA 3JUGA 2OSYA 2DT0A 3TN5A 5KSWA 4CU6A 4BZYA 1E4NA 1VEMA 1W1B1 1D7KA 4F40A 4M5PA 3M7WA 1DHPA 3HMJG 5KITA 3A21A 1RBAA 4DWSA 4MFDA 5D38A 1AA1B 2DSVA 4HNOA 5G5IA 1NWTA 2WWCA 5A6KA 2D20A 4LRSA 4GKLA 1CCWB 2IKIA 2Q6ZA 4PMZA 1JF5A 2E8YA 2WOQA 4E4PA 4PB5A 3FLUA 1VHCA 1Y0EA 2ACQA 1W9PA 1VYPX 2J7CA 1QWGA 4FSAA 5CAHA 3GK0A 3G3DA 2X0SA 3DI0A 4JNZA 1GVRA 1RPXA 3H8AA 3T0TA 1VFHA 3MHGA 4JICA 5LA0A 3HFTA 4A8IA 1X6LA 4W8BA 4QLKA 1RK5A 4UFIA 4A2RA 3AHTA 1HNYA 1EB3A 2D0FA 3NM3A 4I9MA 2OO6A 2PDLA 4Y9NA 3H23A 7REQA 1DWFM 4UNIA 4UOQA 1K9EA 3T40A 3SCSA 2E9MA 1IV8A 1WXZA 3VOFA 3WLQA 3PJWA 1I0DA 1TE6A 4QNEA 2GJNA 3H7VA 3CTLA 1PZ1A 1O94A 1OCQA 1H0GA 3E2SA 2V5CA 2J6XA 1ESWA 4Z2IA 1E6RA 4CLMA 1SO6A 2ZA1A 4H83A 2BZNA 3QGVA 4HU4A 5C0QA 5K2ZA 2FPTA 3ZOAA 4E2DA 3NQVA 3UJSA 4AF0A 1JCJA 3NURA 3GIQA 2W79A 4Q6JA 2EKCA 3I7SA 3H2MA 1GYLA 3QFWA 3E5BA 3CYVA 2IXUA 2ZZ2A 2DP3A 1D2KA 1EHNA 2QUUA 4JNMA 4UB9A 1RV8A 2EPHA 4KFPA 1XRVA 1W6TA 4JIHA 2HROA 1WDSA 1E40A 3E6EA 1Z48A 1BWLA 2WHJA 1TPDA 1OVDA 3ITCA 2PP1A 1ZL1A 4Y8FA 4W88A 4AEOA 3AFBA 4O12A 5A1AA 3FEQA 4AXNA 3R12A 5F2LA 4OBRA 1QW9A 2REQA 1DXEA 2NVCA 2GDQA 1DBTA 3C52A 3GHSA 1CXEA 4UNLA 2ZX9A 2OQHA 1I1WA 4L80A 3RPDA 4JQ1A 5C2GA 1KC7A 1O1HA 3JU2A 3UZXA 4YHEA 3OLIA 2FVLA 4PYSA 2YFNA 2WBKA 4W4QA 3DFTA 1NOUA 3CHDA 2QPUA 3BV4A 4S3CA 1A49A 4YPJA 3UD6A 3IK2A 4V1YA 1SMDA 2X0HA 3JZUA 4J3SA 1KBIA 1W3LA 1J01A 1KCKA 5CKSA 3C3NA 5EBAA 4UBPC 5LGZA 4FZIA 4B91A 1E0XA 1P0KA 1R3SA 1UBPC 4O28A 2ZXAA 3IRSA 1DHKA 1W5QA 5C6MA 2PGEA 1J8VA 2E6DA 3GG7A 1OY0A 3WFLA 3W73A 1B4KA 3G0XA 2O9TA 4DBSA 1EXBA 4ALDA 4D1JA 3LGGA 1BFNA 4MWAC 1O1ZA 4ZO9A 1XGZA 3OTRA 1EH9A 3H2FA 2ZZ1A 4ASTA 4AZIA 3GBDA 4Q8UA 3TC7A 5CPNA 1NFBA 2Y1HA 4DM1A 2OG9A 4E3VA 1ICQA 2BOEX 3TJIA 1Q2SA 3NIYA 4C6PA 1S2TA 3EAUA 4H9MA 3TR2A 4Z17A 4NJGA 4TX6A 1S2CA 3L2MA 1XLKA 3QR3A 1DQUA 1I2RA 5CPTA 1X8CA 2NLYA 1JAEA 4LYQA 4A22A 2ATMA 5HATA 3B9DA 3ONCA 1TFVA 2J9ZA 1F6PA 3AS3A 3TQ0A 5A8MA 1SJAA 1K3UA 4DUWA 1IHIA 4LNYA 1IZCA 1NARA 1A4LA 4FA3A 4O15A 2WYSA 3VX1A 3LEPA 4UQDA 3GFYA 3GAYA 2ZZ5A 4PRRA 3OIXA 3L4YA 1UWIA 2FYMA 3E2VA 2EPLX 3QHNA 3QQ0A 1W1A1 3USBA 4DYEA 3QQWA 4WXYA 4GX9A 4WUIA 1XC6A 3DC8A 4DUVA 3BMVA 4O16A 1HKMA 3N17A 1HKIA 4K8HA 3DHUA 1VYSX 3LU2A 2I1OA 3MJYA 1ISWA 5F2GA 2OKTA 4ACZB 3E0IA 3A23A 4QJ3B 1DXFA 4UIOA 1YPFA 4ZZ9A 1H5YA 1HJWA 2CZ5A 2EJ1A 3GBEA 3A47A 3MKCA 3WJXA 5AYXA 4QJ4B 5LNWA 1HVXA 1ZNNA 3TFCA 1S5NA 2QAPA 4H4IA 1B9ZA 2AMGA 1VYRA 1B90A 1V3IA 1TX0A 1THFD 2ODOA 3ME3A 5TBOA 1Z32X 3KS6A 3VCCA 3QV8A 3MHFA 3G0UA 3QM3A 1OINA 3R0UA 1N8WA 3UR2A 3FHQA 1KCXA 1XH2A 1QK2A 3LTSA 2YB4A 3CJPA 2XU2A 4D8ZA 2XH4A 1CLVA 3GXPA 4JEQA 6PTDA 2CLFA 4RL3A 1VENA 1Q6CA 4AZGA 4ACYA 2FB3A 2FGBA 4HTYA 3G22A 4CCZA 4LNCA 3UVAA 3CAQA 3UXIA 4KKXA 2B0MA 1EEPA 2P8CA 4XSMA 2PZ0A 4S3FA 3BZGA 1FCBA 2WNWA 1L6FA 3W07A 3OGVA 3NYZA 1OGBA 2FGLA 3PZTA 4ZGYA 2C8NA 3UJFA 1CNVA 2NV1A 5H91A 2HK1A 4H41A 3QFEA 1NJJA 4Y9PA 2XGZA 4B5WA 4PL1A 4MPKA 5E70A 4CNUA 3MSRA 2PCQA 4MHBA 2W4XA 4PSPA 3GO2A 4L6DA 3LNPA 2V5BA 3AI0A 3BLDA 1QUMA 3W83A 3L4ZA 1KBKA 5IBXA 2VGBA 4DYKA 2F8QA 3S1VA 1L9WA 2FHFA 3DU0A 2J77A 4DJEA 2YR1A 4UCGA 3AS1A 2DZUA 4DAFA 5EMMA 2QQ6A 3S3GA 3ES8A 1SVDA 1OK4A 4MDPA 1JD7A 2Y8UA 2UBPC 1JCNA 3SO7A 1EDTA 4L5ZA 5CGQA 4US5D 2WC7A 2CLEA 3D3AA 3HN3A 3I7RA 1JXJA 1TCMA 1W1VA 3GLCA 1I6NA 3W87A 1VR6A 2AL1A 2ZUMA 5D33A 1Z69A 1AZ1A 4IPIA 3LTYA 4NJIA 2O9PA 4E0CA 5FEZA 4J27A 4MAVA 1KBBA 3W7PA 2GFTA 1UQYA 5LKYA 4IPPA 3M0KA 3ZMRA 3GE7A 3M1ZA 4DIAA 4A8NA 3VXGA 3NYDA 2A5HA 3ZSTA 5JUVA 1O12A 4AIBA 3CUFA 3VNYA 1R8LA 2QR6A 1WO2A 2PF0A 2Z6IA 2HEJA 3CL8A 1FXQA 3EWXA 2CLOA 3A5FA 3BGJA 2OO0A 3EWZA 5HNUA 3GFZA 4NASA 1ZP3A 4Y9OA 3EA2A 1NOFA 3CB3A 1YLVA 2PTXA 1TV2A 4XIAA 1FWRA 3N34A 1RLDA 1U5HA 2A21A 1HVQA 3K8MA 3KVLA 3WMSA 1S1PA 4QRNA 1HL2A 3V1PA 1UQZA 3Q2DA 4DXXA 1DEDA 4IIEA 4FLRA 3GR4A 2J27A 5F2MA 3CZGA 2OTDA 1W1TA 1EC9A 3ARXA 1C8VA 2WVTA 5ABFA 4L4LA 3G1XA 4LAKA 5BOEA 4UTHA 5A5WA 2KZHA 2QVHA 1A3HA 4GNKB 1A5NC 1V79A 1P6CA 3U2OA 3E38A 4BEUA 2OZ0A 4HCDA 1LL7A 3PFMA 3L4WA 3GIPA 2VNCA 3QY6A 5C2XA 2DW7A 2RGMA 3UJ2A 4KWVA 3PTDA 4GXWA 1EA9C 4UFMA 3OW1A 3ABZA 3O63A 1CIUA 4EAYA 2JALA 4PMNA 2E67A 1X6NA 1US2A 2NXHA 2I14A 5DXXA 1UD8A 1OG0A 1HX0A 1S5VA 3UESA 1GVFA 1FDYA 2BHUA 5A6TC 4ZQCA 2WC4A 3ZR6A 2H9AB 3TK7A 4WKAA 4AMAA 3W02A 2YKKA 5ENLA 4J5NA 4GGBA 4HJFA 1P0EA 3SCNA 4A3QA 4JDBA 4NIRA 5HINA 3VIJA 3VOHA 1A0DA 1VPQA 4RZ5A 3VFCA 1Q6FA 5K4XA 4ZFCA 1QTWA 3I4KA 4TMBA 1PPIA 2HCVA 1OZQA 2PTWA 4P00B 1P43A 3BW4A 3PTMA 5I07A 4LAOA 3WMBA 3CEUA 3WBEA 1UKOA 1EDQA 1NWRA 2G3IA 3CEPA 3M07A 5DLCA 1IF2A 1M04A 2PWUA 4I9TA 3PNUA 4W7UA 4U4MA 1XSKA 4OU1A 5EPDA 3VGDA 4X9YA 1DQXA 1JIBA 3VMNA 2PTDA 5FJTA 4RDVA 2GGGA 3KAOA 3K30A 2C14A 3AHYA 1M5WA 3GG1A 3GSMA 3W7NA 4ML4A 4LEFA 3N3MA 1VF8A 2VQUA 1V0LA 4P7LA 3PTKA 2REQB 4D6GA 4GZJA 4MMWA 4O52A 1QOXA 1UBSA 4DO4A 3GXFA 3BICA 3MO7A 2XIMA 3PUOA 3MSDA 3IVUA 3HV9A 1W56A 4PTVA 3TYZA 1ECEA 2WJEA 2Y63A 2VZTA 5LIYX 3RPMA 2PGWA 3GC5A 2YA0A 5HWJA 3LTPA 4NJJA 3TSBA 2W66A 2B7QA 3T4WA 2EF9A 3V5OA 3HQ1A 1JI2A 1AH4A 1V8EA 5GNXA 1TB3A 2ISWA 3ARWA 4LT9A 1UWSA 3TLQA 5A8PA 3IJIA 4AD4A 1C90A 4J28A 5HUOA 1XJBA 5HMDA 3ZT7A 3G8RA 1VQTA 3L4VA 3LXCA 4IGHA 2ZOXA 1UKQA 2W62A 2E0PA 5CJMA 1KD0A 1GG1A 4KRUA 1WYIA 3DXIA 4IIDA 3QGKC 4ZSTA 1XLLA 4DN1A 4FNPA 2RDXA 5GPRA 1UIPA 5K7JA 3PBVA 3RM4A 1VBHA 2WSQA 4B3LA 4IP7A 4CD6A 2DQXA 4HSHA 3MUAA 4H2HA 1TV8A 4LTSA 1U83A 3M0MA 4GVFA 1PZ2A 4JFUA 4YXGA 2DIJA 4MPQA 2VGFA 1JRBA 1JZ8A 3P8IA 2D3NA 1TVLA 1QHPA 3FDKA 2J74A 3Q45A 4UTWA 4OV9A 5EU9A 1XIFA 2OXNA 3G18A 4AHQA 4C6OA 4H6QA 4B90A 3K13A 4HB7A 4LV4A 4P2VA 4JQAA 1OC6A 3EWCA 1FWAC 1CXLA 4O57A 4HU8A 2XJ7A 3S6OA 2PBGA 2XTKA 5ABEA 1GVIA 1SYTA 1C7SA 4ZO6A 3SCRA 1DWJM 1ME9A 3T2OA 1ENUA 2QCNA 2YCEA 3SN4A 2Y85A 1W5PA 1WXYA 3W37A 2GOUA 2V38A 3VIHA 1FY6A 4J7RA 1GJPA 5LNUA 3G1DA 3KRZA 3PPHA 2YCJA 2C79A 3ARRA 4FX6M 4J2PA 4RE0A 2BHZA 1XINA 4TQTA 4O14A 2C15A 1EGVA 1XLEA 4O8RA 4EIVA 4HG6B 4UFLA 1OD0A 3H2NA 4IUGA 2V3GA 1BLIA 1C93A 3RJYA 4MM1A 4TVUA 3CHCA 1OF6A 4O13A 2C0HA 1VBUA 3LNMA 5L6UA 3C0SA 3PAOA 3P0XA 5CH9A 3LHTA 3GXTA 2WVVB 3SUVA 4D6JA 4R85A 3EXRA 4Q8MA 1L6YA 2A1YA 4M8UA 1WA3A 4BQ5A 1RA0A 4H9YA 4QDMA 3TYBA 3MMWA 4AXKA 1VFMA 3NL2A 3LX9A 4E3TA 5T9BG 4PE8A 2Z25A 1XRFA 3AXMA 2WCSA 4FIRA 4UUIA 1KA9F 2J7BA 2VZOA 5CZ0A 4F0RA 1XLDA 2CYGA 1W31A 4UZUA 1PDZA 2X7VA 2Z29A 4TU1A 4JTCA 3BARA 1LBMA 4PBEA 4IQEA 3THAA 1KRAC 4G9PA 3C56A 1E5NA 1SSGA 1TPEA 2E68A 4HKPA 4AWEA 5FSDC 2DZPA 2YDRA 5A8OA 4UTTC 4HIBA 1I45A 1EJUC 1JPIA 3TE9A 2KAUC 3KVJA 1AH0A 3IAPA 1D3CA 3UJRA 1NOWA 1CYGA 1P6WA 3LPFA 3SCOA