3GH7A

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with galnac
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
519
structure length
506
Chain Sequence
HHHHSSGLVPRGSHMATSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular cloning and crystal structural analysis of a novel beta-N-acetylhexosaminidase from Paenibacillus sp. TS12 capable of degrading glycosphingolipids
pubmed doi rcsb
source organism Paenibacillus sp.
molecule tags Hydrolase
molecule keywords beta-hexosaminidase
total genus 194
structure length 506
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gh7A01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3gh7A02
4W88A 2Q8XA 4OIFA 1V6YA 2WZHA 3AZTA 3AXIA 1R86A 3WD0A 2G4FA 4N0RA 3WELA 2WC7A 3AHXA 1FP8A 4J3TA 1MQPA 4XX6A 3MMUA 4WLCA 3OB8A 1DTUA 2CETA 3CH9A 4C7DA 4NI3A 4HMCA 4BA0A 7A3HA 4H7VA 1QI4A 1C7TA 1WZLA 4M24A 3W38A 1JD7A 3W82A 1B1YA 3EMCA 5A6MA 3CTTA 4DUWA 1XRVA 3WNPA 1KQZA 2D24A 3WSUA 2W91A 4JL2A 3QOKA 2JFEX 1CXEA 2O9OA 5BRQA 1M04A 3CZGA 2YBUA 3IAQA 1ISWA 1OWQA 3ZM8A 5DT5A 3OIHA 2VX5A 1KB3A 3SCOA 2W66A 2JEQA 2WZEA 3PZMA 1KFWA 1ZBKA 5TD4A 1GZJA 3BLKA 3PTKA 4GPNA 4PEEA 4X0VA 4AD2A 2EXOA 3WMBA 4B3KA 1P6WA 1W2VA 5AYIA 1I1WA 3PZIA 5IDIA 1UD3A 1JDAA 3GH5A 1ODUA 2ZXBA 4D6CA 1W91A 3RIKA 3AIVA 3WDHA 2WHLA 4C91A 4FF5A 2VZSA 2WK2A 1UD6A 1UWIA 3SCVA 5M5DA 1HJQA 4LX4A 5GPRA 5BYWA 3VD9A 2QPSA 3BMVA 2YL8A 2J77A 4CGTA 3FAWA 3CHFA 1AQ0A 2VOTA 4MPKA 3KL5A 1KGWA 3KWXA 3WENA 4BS0A 3IK2A 1JNEA 1E71M 1JD9A 2YIHA 3UERA 4OBSA 2OWXA 1N82A 1H0GA 1JYVA 2DT2A 3VD3A 3WMCA 1WZMA 1CGYA 2EQDA 3DHUA 2Y24A 2FHBA 3ARQA 4YPJA 1GOKA 3GBDA 4QAWA 1H1NA 1JZ4A 1B3ZA 3F5JA 1BLIA 3AMCA 4GI6A 4OBRA 4OKDA 4ACYA 1XGZA 2EO7A 3HMCA 4U5IA 1QOXA 1HJWA 1MW0A 3ARZA 3WDQA 3GYCA 3AYRA 1AQMA 4V28A 4JHZA 3CIVA 1C8XA 1M03A 2GK1B 2ZUNA 1J0YA 1GHRA 3BMWA 1BG9A 3NSNA 1W3HA 3GZAA 4AZ7A 1BVNP 1SR0A 4LYRA 1ECEA 4GZEA 4D1IA 2WSKA 5D9PA 2YA1A 4N42A 1CXHA 3CUJA 7TAAA 2IXVA 5A2CA 2XM2A 4JKLA 3VGDA 2WC4A 4CD4A 3MMDA 3KZSA 4FLOA 2D3LA 4AD5A 2WXDM 2AAAA 4NF7A 3VIHA 3W29A 2NW0A 3GXDA 2WC3A 2DIJA 4MADA 1PX4A 1MW2A 3IANA 1R7OA 2XIBA 2AOSA 4HMDA 4D6JA 1UUQA 3AHTA 3WL1A 2JIWA 1VEPA 4H2CA 1JYNA 1OGGA 4H8VA 4P7OA 3SIMA 4NRSA 1EHAA 1GUVA 1DWJM 3VPLA 1WNOA 4UTFA 4P7QA 4ZXOA 1GQKA 3ZJ8A 1VEMA 3QHOA 1A47A 4B16A 1R87A 1KR0A 4S3JA 4GZJA 3W24A 3OGSA 5DEZA 1CLXA 5E70A 4UZSA 5GNXA 4J3XA 4F9JA 1ZB5A 2EPMX 3ARYA 3T2QA 3WH8A 1E6NA 1TG7A 3ZQ9A 1CXLA 1R8LA 4QLLA 1V0MA 2CITA 4WKFA 2QMKA 1KCKA 3TTYA 2FHFA 2WHKA 2XM1A 2OLHA 5D9NA 3BCDA 2J8GA 1V3LA 4HA4A 3SCQA 5HBFA 1EGZA 2UY3A 1UR4A 3UETA 1E3ZA 2CESA 1CPUA 1E6RA 3D5HA 4RL3A 3BC9A 1E4NA 1NH6A 2BVTA 1AVAA 1UR2A 5D9MA 2QF8A 3OGVA 3IJ7A 1J01A 3AJ7A 3AZRA 2WWCA 4MB5A 5BXSA 1NARA 4ATDA 1BHGA 3WQ5A 1E43A 4UQBA 1V02E 1XV8A 1UKTA 3VTRA 3UCQA 3WL0A 1GOOA 3PZGA 1HKKA 2J7DA 2FGLA 1H41A 1W9BM 3MUZ1 2GK1A 1JZ6A 3RM4A 2WYSA 2WMGA 1H09A 5CXPA 1J0KA 2QLYA 1PZ2A 1QI3A 3W0KA 3WF1A 3PZOA 2PF0A 1J10A 1MYRA 2E0PA 1LWHA 5HXMA 4FLRA 4X9YA 2J25A 1ZBWA 4BQ4A 2Y8VA 2V3FA 3KEHA 3BAJA 4GXPA 2XSBA 2PWEA 5I24A 3WNLA 3FW6A 1QNQA 1TA3B 1W1YA 4IUGA 3ZT7A 1TMQA 4HA3A 1LF1A 1SMAA 2XIIA 3CGTA 1IT0A 2JE8A 1JI2A 4W8BA 4XZBA 4NSBA 2VJXA 3CZKA 2EBNA 3J7HA 4UFKA 3W28A 2OYMA 4AZGA 2BY1A 2X0HA 3NSXA 3T2PA 3AFBA 4EAMA 3L2MA 1C8YA 5D8ZA 1GOQA 1LL6A 2VR4A 3M7SA 2E9LA 2FGZA 2ZX7A 3VX0A 2OSWA 2IXUA 5CG0A 4A4AA 3SUVA 1V3HA 4CVUA 1B30A 3VGGA 4W93A 4KRUA 4RE4A 3WFZA 4MDOA 1EDQA 1GW1A 1SYTA 4MNJA 2DDXA 4AIUA 3JUGA 1JDCA 2VCCA 3PN8A 4ATWA 4UOJA 1OBAA 5CJ5A 1H49A 4A3HA 1LJYA 1E4LA 1ZL1A 1PBGA 3W6MA 4BQ5A 2X8RA 2ZX6A 1FHDA 2XPKA 1CYGA 4AIOA 4QLKA 1H11A 1EH9A 2V5DA 1WP6A 5AC4A 1EXPA 2HVMA 4C7GA 4U5KA 5A6AA 3UR7A 4OUEA 4UCFA 4GO8A 4JFWA 1DP0A 1HKIA 3SUTA 2DSWA 4PN2A 2JALA 4W7WA 2YOCA 1B2YA 1HKMA 2J7BA 5BROA 4HMEA 2YKKA 3QR3A 3MV11 3VIPA 1GQJA 1BG4A 4WSJA 3UG5A 1QNSA 3U7BA 2XFRA 1C90A 1V3JA 3KL0A 5E09A 3BCFA 2ZUTA 2BHUA 5JIWA 4PMZA 1QHZA 2DH3A 1NQ6A 3GBEA 3WDIA 3TTOA 1HN1A 3T0BA 3M46A 3N17A 5BWFA 1VB9A 1W1TA 3VOCA 4AEFA 4MJ4A 2J47A 1O7AA 1Q4NX 1DHKA 1VIWA 4YN5A 3RJYA 4TVCA 4AY1A 1JZ8A 1CXKA 4W5UA 1PX3A 3CUIA 4HTYA 2TAAA 3AIBA 4WSKA 2QHAA 4CN1A 4U3AA 2OSXA 3U5UA 2WVTA 3MUIA 2UWFA 4D6FA 1E6PA 1G0CA 2XVLA 3ZMRA 3BSGA 1K6AA 1VEOA 1GONA 3OLGA 2WZIA 2YDRA 4HOWA 3GNOA 3TA9A 2OWCA 3K1DA 3RM9A 3M6DA 2WANA 3O6AA 4LQ1A 4L4PA 5CQ1A 4YHGA 2GJRA 1UWUA 1WZAA 5LYRA 2YDQA 5HDRA 3II1A 3T2OA 2ESCA 3OA5A 1U33A 1CLVA 2WCSA 2CHOA 4WKAA 1J0HA 3APGA 4C7FA 3WH7A 3W6LA 5I79A 3M07A 3CUFA 3NDYA 2E9BA 1NOWA 3L4XA 4HPHA 2O9PA 4PCSA 3WN6A 2J8FA 3W26A 1J12A 2DQXA 2A3BA 1IZKA 3K8KA 4JAWA 1W9VA 1BPLB 3OLDA 1C92A 5FD0A 1AMYA 4Z2IA 2A3CA 2C7FA 4UFMA 3ZR5A 2YDSA 2PBGA 2XG9A 1ZBCA 5A6LA 3PZNA 1RD6A 3WQ8A 1J18A 1OCQA 2ZXDA 2ZXQA 3E1F1 3BH4A 3FHAA 3HN3A 3AMLA 5BRPA 3CMGA 4EKJA 4ZEPA 1EQPA 2WCAA 2WVVA 4AXNA 3RMEA 3SCTA 3RILA 1V0KA 2WVUA 4D6EA 3BAYA 5ABEA 5D8WA 3AHVA 2VZUA 2JIEA 2PWHA 1E55A 3WH9A 1V3KA 1ODZA 3WD3A 2ZUUA 1ISXA 4X0NA 4W8LA 3WIJA 1Q6CA 3W27A 3RPMA 1QNRA 1UD4A 5CGTA 3WD2A 1JXKA 2PC8A 2X05A 1E5NA 1Q6GA 3ZO9A 3PZVA 1KXHA 3VINA 3VGEA 4GIAA 1RP8A 2F2HA 1X1NA 4DWSB 3IAPA 3U7VA 1W32A 1ZS2A 4M82A 3K8LA 3WMSA 4CU8A 4PTVA 1C7SA 4PTWA 1FFRA 1XD1A 3AS3A 1H3GA 5DMYA 4TTGA 4B9ZA 5JBDA 1K9DA 4H8UA 2W92A 3VIFA 3TTSA 1TCMA 2WBGA 4UOQA 3K8MA 4PMUA 2XSAA 4F8XA 4JFVA 2YA0A 2F61A 4PMDA 5A6JA 2D20A 5CLTA 1B3YA 1H2JA 3HJEA 1KQYA 4AD4A 4AZCB 4D6IA 2CKRA 5D9OA 5FOOA 1K9FA 2VX6A 5AC5A 5I23A 1UH4A 1E0XA 3VGHA 1HX0A 5C70A 1DEDA 3KE0A 1E9LA 1W9PA 4P8WA 1UD2A 1HNYA 2WM0A 1QI5A 1U2YA 2GDVA 1E15A 1EOKA 2ZUMA 5FIPA 1EO7A 4DUVA 4AC1X 3WEOA 2RGMA 1QW9A 4PMYA 3CZLA 3THCA 1KWGA 1C3FA 1ISYA 3PBGA 1Q6DA 1FFQA 3DHPA 3WUFA 4H8HA 5E0FA 4JL1A 1BF2A 3AICA 3SCWA 1UKQA 3EMQA 5C8BB 2D22A 4CVWA 3TOPA 4W85A 2VZVA 4DUXA 4Z2KA 1CGVA 4W7UA 2XVKA 1BYCA 3ARTA 2WMJA 5DFAA 1WO2A 1XH0A 4W89A 1C93A 1ZBVA 1EHNA 2PB1A 3A6OA 1HT6A 2PBOA 1EO5A 2OYKA 1LWJA 1LLOA 1GCYA 1E4IA 3CHEA 4B3LA 4UZUA 6CGTA 3SEPA 4W84A 5JBFA 3ZT5A 3ZJKA 1QHOA 1JGIA 2GVYA 3MANA 5A8PA 2CCRA 2X0YA 1A3HA 2G3NA 3WQWA 2WMIA 3VIGA 2IUZA 1QNPA 5DF0A 2O9RA 5GNZA 2XWDA 5EB8A 3WQ6A 3MSDA 1I1XA 1D3CA 1QBAA 1V6VA 1E6XM 5EFFA 6A3HA 4YHEA 2C8NA 1OT2A 3SCNA 5BXPA 1GNXA 1TFVA 5LA2A 3PZQA 1AQHA 4OJYA 1VENA 1B90A 3UG4A 2YLLA 5CGMA 1ZU8A 3GXMA 1E40A 3QHNA 1E6ZA 3NJ3A 5HPOA 3AHZA 3GNRA 2WBKA 1JFXA 3AMDA 3F4VA 3CO4A 2VQUA 2CYGA 3GDBA 2GDUA 4PRWA 2XJ7A 1WKYA 1OT1A 4DWSD 5CPSA 1WB0A 1NWSA 2D0GA 2A3EA 3WEZA 4WJXA 1OSEA 2UY4A 4MJ2A 3ARVA 2AMGA 3CHCA 2FH6A 5E6ZA 2WW5A 2XUCA 4OOZA 1DWAM 3ZSSA 2E9MA 4LYQA 2QMJA 4GI8A 1WPCA 5EMYA 3VX1A 3CUGA 1UWRA 2VRKA 4E2OA 4CUCA 1WCGA 1VFFA 2CNCA 3GTNA 3GXFA 5AYBA 5IXEA 5A2BA 4EE9A 1KWKA 1UZ1A 3BSHA 1KXVA 4AISA 5A3HA 3NYDA 1QNOA 1VAHA 3N13A 1VBRA 1HL8A 3WF3A 1JZ7A 3K4DA 5EFDA 3WF0A 4DWSC 2XVNA 1IV8A 2V3EA 3UG3A 3ECQA 4MNLA 2VURA 2DH2A 1JAKA 4D6DA 3WUGA 3VMPA 1E56A 3VNZA 2YL5A 2VZOA 4GQRA 1V0LA 2GUYA 4J7RA 4Y7EA 2RGLA 3DECA 3GM8A 1CGWA 5CLWA 4UR9A 1UR0A 4XZWA 3GH7A 4C90A 4M81A 2WMFA 5I78A 3FXYA 1H0IA 2DSZA 4BF7A 1K9TA 2CEQA 1LL4A 4HP5A 1V02A 4TVDA 2ZWZA 5CSYA 4HZ7A 1F4HA 1E0VA 1UKSA 2VZTA 3T0DA 1WDSA 2J7CA 4JFSA 2CIPA 4AZHA 2GJXA 5CPTA 1VJZA 1SFSA 3PHAA 1G1YA 1W1PA 4CU7A 4Q7NA 2DIEA 1OB0A 3QGVA 2WMKA 2WKLA 1BVZA 4UQEA 2J7GA 3TONA 1DWGM 2HISA 3POHA 1JI1A 3ZT6A 2VMFA 4WIWA 1WZKA 4A3YA 1MQRA 1J0ZA 4L4OA 3W53A 1W3LA 2W4XA 3AIQA 4DM1A 1GVYA 1NWUA 3N15A 1UYQA 2OYLA 2NT0A 2D1ZA 2DT0A 1PZ3A 1PEZA 1V0NA 1D2KA 2G3MA 3I3BA 1BGGA 1V3MA 1MQQA 4PMXA 3WDJA 3MV01 3W37A 2BXYA 4D1JA 4TVUA 1G94A 2W61A 2E4TA 3EMZA 1QI0A 2CBVA 1B3WA 1MVYA 4UQAA 3L4YA 1UH3A 4Z2HA 2WHMA 3VIMA 1MW3A 1UR9A 1ISVA 4HOZA 2J79A 1XYZA 1XSKA 4UNIA 3L2LA 4PUEA 1GJUA 5JBEA 1M7XA 3AIRA 4R27A 2VR5A 1CXIA 1OD8A 3WDPP 3NDZA 5AY7A 4RE3A 4CN6A 4F79A 4PMVA 2EPKX 1E5JA 4LGXA 4E8DA 3LPPA 4ZE4A 3EDKA 2J4GA 3KL3A 3RO8A 1GOMA 3I3DA 4CCDA 4W86A 1C91A 2MANA 1JF6A 1CGTA 2V3GA 5I3DA 2WKGA 3N12A 5LA0A 4IISA 1B3VA 2FHCA 3AQUA 2G41A 1US2A 2B31A 1BFNA 1BYAA 4P8UA 1EA9C 3AYSA 4DWSA 2J7HA 4EK7A 1CZ1A 2NSXA 4E8CA 5D4YA 1UD5A 1RPKA 1MWOA 4AYSA 7CGTA 4UFHA 1E6SM 3SCPA 4AEEA 2V3DA 2OWWA 1KXTA 1L0PA 2VRJA 4QCEA 3UESA 2CBJA 2WB5A 4E4PA 4PTMA 5A1AA 2E8ZA 3VMNA 4PYSA 1GORA 1DWIM 2CBIA 3BLPX 2UY2A 1L8NA 3FHQA 2E40A 5I0DA 4KGLA 3B9AA 3UR8A 3WKZA 3MUAA 1H5VA 2ZWYA 1EIBA 3CZEA 4BQ2A 3VKKA 3N9KA 2WPGA 1HJSA 1GJWA 3BAXA 2O92A 1HJUA 4TOQA 1W9DM 3NCOA 4JCMA 2BY0A 4W87A 2G3IA 2W63A 4F9DA 3ZJ7A 4R5EA 4AZIA 4FLSA 5M03A 3DYMA 3ALFA 3ZIZA 3EDEA 1NWRA 1R85A 4Z2GA 3WH5A 1UKOA 2YL9A 2WHJA 4K68A 1W1VA 4AIEA 2GFTA 3VNYA 2DEPA 5BXRA 1UWQA 1KCLA 3VIJA 4UQ9A 3CLWA 4W7VA 1OINA 4IPLA 1MFVA 4KRTA 1CXFA 3T0AA 4PMRA 3L4TA 1XSJA 1E6QM 1HIZA 2XTKA 4W5ZA 4TX6A 1UG6A 3MUY1 1UR8A 2VRQA 3FNDA 1OGBA 4V2XA 2ZXAA 4PMQA 3VDAA 4WKHA 1PPIA 1JG9A 1NOFA 1WDPA 2Z1SA 2Y5EA 4PCTA 5KZ6A 3VIKA 4Z2LA 3WUEA 1VFUA 1LG2A 4PTXA 4D71A 3VIIA 1WDRA 3W25A 2DSVA 2BY2A 3WQVA 1FH7A 1TVNA 1NP2A 2CBUA 5BCAA 2VI0A 1XC6A 2J74A 1XCXA 8A3HA 5GNYA 1DWHM 1G9HA 1UA7A 1HVXA 5E9AA 1HKJA 1W9XA 4HZ6A 1RP9A 5JUVA 2VTFA 4QFUA 2A3AA 1UOKA 1BTCA 1E1EA 1GQLA 3MSGA 8CGTA 3IJ8A 4J3WA 5A6BD 1J9YA 2FH8A 1WE5A 3EBVA 4FLQA 2ZUSA 2JF7A 2A3HA 2O9TA 4AZ5A 1NM9A 2DPEA 4CU6A 1JZ5A 5A6SA 2QV4A 2WNWA 3PTQA 4M80A 4TTUA 1KXQA 5A8QA 1XH2A 2DSUA 2X1IA 3DC0A 4MAVA 2E8YA 4B9YA 2DT3A 3ALGA 3B9EA 4UFIA 5ABGA 3VGBA 3F5LA 1QPKA 5JIPA 4IPNB 3A47A 1W3KA 3L4UA 4GINA 1H4PA 1JAEA 2W5FA 2XWEA 1V3IA 2EPOA 1S46A 3FY1A 4MB4A 2Z1KA 3TTQA 5I6SA 4URIA 2EPNA 3BAKA 1KBBA 3VVGA 3AS2A 2BVYA 1M01A 3GXIA 1ZJAA 2ZX8A 1HVQA 1CTNA 4M56A 4S3KA 3EDJA 3VD5A 4ACZA 1KGXA 4FK9A 2BFGA 2ZIDA 3LPGA 1UD8A 1VRXA 4KWUA 1HJXA 3BGAA 3O2LA 4U3CA 2BXZA 3O9NA 1BQCA 2YBTA 3AMGA 3WH6A 2ZICA 1PIFA 1UKPA 3PTMA 1HP5A 3K46A 1SMDA 3I3EA 5A6BA 4QCFA 2BV9A 3RJXA 4P8VA 3ARRA 5CPQA 1HP4A 2V5CA 2VNCA 2D23A 3VDBA 5M3WA 2WAGA 3W4RA 3MS8A 5CSUA 5FKYA 5IHRA 1UR1A 2WVVB 5DO8A 3OGRA 2WWDA 4GZIA 3S6TA 4M8UA 3WBAA 1IZJA 2UY5A 4M29A 4GI9A 4J3SA 1TZ7A 2G3JA 3UEQA 4AWEA 3MMWA 5IHSA 3EDFA 4XV0A 4EANA 1EQCA 1OIFA 1GHSA 2EPLX 3F5KA 2GSJA 1QBBA 4B15A 1UQZA 1JF5A 2EEXA 3WFLA 2JEPA 1CEOA 3PZ9A 4XUYA 1B3XA 3DYPA 4FMVA 3PZTA 3MO4A 4MB1A 2GJPA 1FH8A 5M17A 4HZ8A 3CUHA 3ARSA 4J27A 4MTVA 2CHNA 2PWDA 4GQQA 1XHGA 4WF7A 4ACZB 1E1FA 4J3VA 3A4WA 1K9EA 1GOWA 1PIGA 3CHDA 9CGTA 4QDMA 1D7FA 2J75A 4AD0A 6TAAA 4CN4A 1W9UA 3GNPA 2XGIA 4HU8A 2VL4A 4PBGA 1VJSA 4AD1A 4MDPA 1V08A 2YL6A 1NP0A 5ABFB 4JFUA 3AOFA 3DYOA 3S2CA 1MFUA 4LPCA 4CD6A 1YHTA 1GQIA 2DSKA 4PSRA 1E3XA 3OBAA 4AMCA 1HJVA 4LYPA 1B0IA 3OZOA 2QPUA 3WEMA 1M53A 3WNOA 1OIMA 4D72A 2VVSA 4LXFA 3VDCA 2BHZA 5EBAA 1CNVA 5E0CA 4BZYA 4P7RA 3VM5A 1JL8A 4D6HA 3FN9A 1VF8A 4V27A 2CPUA 4JHOA 4CCEA 5HOSA 4PMNA 1JXJA 3VILA 1PX8A 2DT1A 4AZCA 3L4VA 3A4XA 4MNMA 2W67A 4U2ZA 3AIWA 2VX4A 1TR1A 1G5AA 5GQBA 1FHLA 4WK9A 2ZUVA 2C0HA 3BAIA 1FOBA 1JDDA 1CGXA 3B8SA 1G01A 5I77A 3VD4A 2YLAA 2VX7A 1FP9A 1RH9A 3WNMA 1ITCA 3AI0A 1NOUA 2CERA 1U30A 2VT0A 2WLZA 1NWTA 1JZ2A 2E3ZA 4UQDA 1WAWA 4JKMA 2XFFA 3PZUA 4MNKA 1FH9A 3VM7A 2VC9A 3QOMA 3THDA 4HU0A 2Y4SA 1EOMA 3SUUA 4NRRA 3ARUA 3TP4A 2V38A 2PI6A 2FDMA 1KGUA 1ITXA 3L4WA 4NZCA 3G6LA 5A69A 5A8MA 3EYPA 4F66A 1QVBA 1JIBA 3ARWA 5A94A 1OD0A 5KEZA 5E6YA 4J3UA 2BNJA 3T08A 1BGAA 2GJXB 4TX8A 4JFTA 4P8XA 3N1AA 1ESWA 1X6LA 1GOIA 5IFPA 1J11A 2BVDA 4AW7A 4BCEA 1CGUA 2ZUWA 4JCLA 4DM2A 2VQTA 2G8ZA 4CD7A 3RCNA 4ZENA 4M1RA 5BXTA 5DT7A 2VCBA 4MAZA 2WMHA 3SUSA 5A95A 4AZ6A 3SCRA 3NIYA 3K4AA 1XYFA 3ZSTA 5FL0A 1BYDA 3SCSA 3T09A 2J78A 4ZE5A 4PMOA 2DGAA 2X2YA 4UOZA 2Y8KA 1UQYA 2J7FA 3G6MA 2YJQA 4GO9A 2JF6A 1I75A 3N04A 4UFJA 1MW1A 1CIUA 1HF6A 3ZJ6A 1QW8A 1C8QA 3LPFA 4GKLA 4JIEA 2XHYA 1W3JA 1TE1A 3VDHA 3WDRA 3VMOA 2D0HA 1PAMA 3WF2A 1QHPA 3VGFA 1E70M 4CKQA 1UHVA 3AXXA 2WCGA 2WMIB 4U31A 4ML4A 1JNDA 1TUXA 1KR1A 3SUWA 5I5RA 4IM4A 4PSPA 4CCCA 1LQ0A 3OZPA 3B9DA 3WY1A 1Y7VA 1V6XA 5CZKA 2W62A 1HXJA 3AS1A 4OOUA 4P7LA 4W8AA 1LL7A 4D6GA 4TXEA 1E4MM 1CBGA 1O6IA 2XGBA 2NT1A 1V03A 1FA2A 3WF4A 2WSPA 3POCA 1LG1A 1BYBA 1XCWA 3CBWA 4J28A 4XB3A 3WD1A 1CENA 3VIOA 4AD3A 1ZJBA 3EDDA 3IJ9A 2ZE0A 3AZSA 4MB3A 1US3A 1HL9A 3NSMA 3BXWA 5A6KA 1DWFM 4ATLA 1E0WA 4PUDA 4Z2JA 3ARXA 4JKKA 1TA3A 1BAGA 3VD7A 1EDGA 3CZ8A 2CKSA 5A8OA 2XVGA 5HPCA 1X6NA 3AHYA 1V6WA 1KBKA 2F8QA 3AS0A 3WQ4A 1JYXA 1VBUA 3N11A 1UWTA 3AIEA 5FL1A 4UQCA 3LPOA 2BY3A 2ZX9A 4U2YA 3U57A 5C71A 3A3HA 2XFYA 3WNNA 1GVIA 3NUKA 3ZOAA 3BAWA 1Q6EA 2EJ1A 3ARPA 1XH1A 3WD4A 1EDTA 4RE2A 1UA3A 3AMKA 3CMJA 5ECUA 2BHYA 3VO0A 1TVPA 1F4AA 4QLJA 2VUYA 1CDGA 3L4ZA 5HNNA 3SURA 3AROA 4U33A 4BQ3A 5F7UA 2XYLA 2VVNA 2CXGA 3N18A 1VFOA 1CECA 4H04A 2WLYA 3CPUA 1MXDA 2J7EA 1XSIA 2VO5A 3LMYA 3U5YA 1UZ4A 5ABHA 2PWGA 4KGJA 1V6UA 3A4AA 1CWYA 3VU2A 3AISA 2BS9A 4CD8A 1VFMA 1OGSA 2D2OA 3WNKA 1Z32X 3D3AA 1W2PA 3AXHA 4HA1A 3FAXA 4OZOA 1B31A 2OSYA 5I2UA 5IFTA 4QP0A 2ZX5A 3QHMA 2X09A 4ZXLA 2Y2WA 1QI2A 4HOXA 4KH2A 3VUPA 1JZ3A 4HPGA 3OLEA 1OM0A 1R7AA 3MU7A 5A8NA 5LA1A 1PJ9A 2PWFA 1B9ZA 3AIUA 3GH4A 1Q6FA 3MKKA 1J0JA 1E72M 1BSIA 1UWSA 2VCAA 3OG2A 1E73M 3WUBA 1UH2A 1YQ2A 2WVSA 1WDQA 2D0FA 3ZR6A 1J0IA 4ZFMA 4CD5A 2XVPA 5FCZA 3CZJA 4TUFA 3RDKA 3SCUA 3HU7A 4KMQA 2YA2A 2D3NA 1ISZA 1GPFA 3WBEA 4JZ5A 5A2AA 4AZBA 4UFLA 3W81A 1MXGA 2ZOXA 4H41A 4Q22A 3RM8A 1XD0A 2J62A 5ABFA 1JYWA 1JFHA 4P7NA 3OLIA
chains in the Genus database with same CATH superfamily
4C6OA 3HG5A 1V6YA 3AZTA 4IIHA 1R86A 3WD0A 1FCBA 2G4FA 3DFSA 2VFHA 2WC7A 1FP8A 1WQ5A 4J3TA 4XX6A 3MMUA 3QTPA 4Y8EA 3N25A 4IL2A 3W83A 1NDWA 1DYSA 5D2XA 1DTUA 1XF0A 4NI3A 4C7DA 4HMCA 1DIEA 1QI4A 2V82A 3CTTA 3TFXA 1Z44A 2TRSA 2CLIA 1S5WA 3OPSA 3PPCA 3MI6A 2JFEX 2O9OA 1L9WA 2YBUA 2V5KA 1JUKA 4Q8MA 4RW3A 5DT5A 3EX1A 3OIHA 1S5TA 3SCOA 4DF1A 4EACA 1W37A 4IJBA 2INFA 3IIOA 4KCUA 3PZMA 4S39A 3FYOA 3VCNA 4RK8A 4ZB2A 5D2WA 4N2YA 1EUNA 3E02A 1G7UA 4X0VA 5GJMA 2EXOA 2J9ZA 4I9JA 4C6KA 3LD5A 1B54A 5IDIA 3ZXWA 1UD3A 3GH5A 1ODUA 2ZXBA 5H8MA 3OQEA 5FF0A 3W85A 3SCVA 1P0KA 1E9ZB 5M5DA 4GQ0A 3UY7A 1D7KA 3P67A 1XM3A 4Q8OA 3LBOA 2DVTA 4FOUA 3LCLA 3NL2A 3FAWA 4FSAA 3KL5A 3KWXA 5C2GA 4FNQA 2V5BA 4XQ6A 3IK2A 3MCMA 5FJTA 1JD9A 2EG7A 4LUTB 1F6KA 4OBSA 4QRNA 1OVDA 4C1NB 5FSEC 3WLJA 1CGYA 3DHUA 2FHBA 3ARQA 4YPJA 4EOUA 3F5JA 5I3JA 4GI6A 1EGVA 1A80A 3HMCA 2X42A 3KAOA 3VFCA 3TOYA 3RCMA 5CH9A 3WDQA 3QFWA 1AQMA 2DV0A 5TAOA 3M0KA 1M03A 2GK1B 3PTDA 4NP7A 5F4WA 1TTQA 1BG9A 5H91A 5EJ1B 1S5MA 3GZAA 4AZ7A 1BVNP 2V30A 4ADUA 4MMWA 4D1IA 3NQDA 4XVEA 4JIPA 3CUJA 7TAAA 5A2CA 2XM2A 4JKLA 2WC4A 3MMDA 3KZSA 2D3LA 3KDOA 1R47A 3M47A 3MYPA 4Y90A 5CZSA 3SGGA 4HK5A 3TMQA 2SFPA 2YCLA 3TYAA 4EPEC 1OADA 3AXKA 1MW2A 3IANA 4D6JA 1UUQA 3WL1A 4H2CA 5K2ZA 5CBBA 4H8VA 4JTCA 1GUVA 1DWJM 3NNTA 3GXPA 1WNOA 4DO7A 4M7SA 2PD9A 4P7QA 3UFYA 1HKWA 4ZXOA 1GQKA 1VEMA 4MPQA 4WVXA 3QHOA 1XICA 3C3UA 4B16A 3TR9A 1PE1A 2EKGA 2I9EA 4S3JA 4GZJA 3W24A 3OGSA 1OC7A 4XZHA 3C2RA 4S3GA 1ZB5A 4F0LA 1Z6KA 4JS3A 4XD3A 2BZNA 1N8FA 4ZQMA 4YCOA 4HNNA 4WUIA 1CXLA 4B4FA 4RR4A 4DB7A 4UCGA 4WKFA 5EMLA 1KCKA 3ERPA 3MHGA 4LJ3A 4WGXA 1U1JA 4JTQA 4HA4A 2UY3A 2HS6A 2CESA 2YPIA 4RL3A 2IS7A 3ITVA 1NH6A 2BVTA 1AVAA 4FZIA 1YXDA 2Y5SA 3IJ7A 3G1SA 1QU4A 1NARA 4ATDA 4PEKA 3VOGA 3AO0A 4I5UA 1OK6A 5PTDA 1NVMA 2V2DA 3WL0A 1GOOA 1HKKA 5CCZA 4WQ6A 3MUZ1 3B8TA 1JZ6A 3S5OA 2WYSA 2QCLA 5HATA 5I3GA 1QI3A 1JRBA 4HN4A 4IG2B 3L0KA 3PZOA 2PF0A 1J10A 1BD0A 1LWHA 3UJFA 1TPFA 5HXMA 3V0UA 3VOIA 4X9YA 3QSRA 3C56A 4S3FA 3UZZA 1GG1A 2PWEA 2NQLA 1PIIA 4C6JA 1GPWA 3EEGA 2PTDA 2PTYA 2QCEA 5BNKA 4E5TA 1JI2A 1XIHA 3LRLA 4MY1A 4Q33A 2EBNA 4IPPA 4AZGA 5EGRA 3NSXA 1C8YA 3WLOA 3DFYA 3FSUA 1LL6A 1N55A 1S2WA 3UXDA 4N9BA 3FEQA 3KXQA 2R8WA 4A4AA 1V3HA 2C15A 4HPXA 3VGGA 4W93A 1EIXA 2OMAA 3OJGA 5HJLA 1G4PA 3WFZA 4C6LA 1GW1A 3CUZA 3BL3A 4LF2A 4XKMA 3VA8A 4ATWA 3BW4A 2QIIA 1ITQA 2OFJA 1JEZA 1H49A 1ZL1A 1H61A 4HU4A 3UA4A 2ZX6A 1AH0A 1CYGA 4DBUA 3ITGA 4AIOA 3G3MA 1WDWA 2HVMA 5A6AA 4GO8A 4ASTA 2OZ8A 3SUTA 3M43A 4PN2A 4UMBA 3CTLA 3NZ1A 5KZEA 5BROA 2YKKA 4IFRA 3UD6A 3HJZA 4JNYA 2GDQA 1MI3A 3G1XA 3GYEA 3LM3A 4N02A 5E09A 3BCFA 2NVAA 2PRMA 1TJPA 2DH3A 1JULA 3TTOA 2AKZA 3T0BA 3RRAA 4TV6A 3PBUA 3TK7A 1VBGA 5CZTA 3QR0A 1OFRA 3VOCA 3A9IA 1LBLA 1DKWA 1W5QA 2PA6A 4IJCA 1O60A 1MUWA 2HQAA 1PX3A 2BGSA 3BLFA 3OYXA 3E2QA 3U5UA 2WVTA 2UWFA 4D6FA 2OLSA 4BI7A 2XVLA 5K3VA 2Q8ZA 4GY1A 4S2BA 1VEOA 3CLMA 3EXTA 1GVEA 3CS2A 2OR2A 3GNOA 3TA9A 4F48A 1GYLA 2IKJA 4QQ3A 2VENA 4G9PA 1SO4A 4LQ1A 1IT7A 1NFPA 2PDXA 2UZ9A 1UWUA 2YDQA 3GR8A 2OODA 3II1A 3GAKA 4IPJA 4NAEB 3OA5A 3M4HA 1CLVA 2RFGA 4WKAA 3APGA 2XSXA 1R46A 3EX3A 3Q58A 2J9XA 3M07A 5F2IA 3CUFA 2NQ5A 3GTFA 4X61A 3NDYA 1A5SA 2GSEA 2O9PA 2OXNA 1J12A 2DQXA 3GHTA 2DU2A 1IZKA 2E28A 4JAWA 4AWTA 1BPLB 2A3CA 3ZR5A 3CUXA 5CPNA 4DO4A 1J18A 4XK2A 2OGYA 2PODA 1N8IA 1W54A 3AMLA 5BRPA 3CMGA 1GZGA 1ZCCA 2DZTA 4M5PA 1EQPA 3R58A 2WCAA 3MVTA 1FDJA 3RILA 3CQHA 3CXOA 4IXHA 1DQUA 3A3WA 1UUMA 4IQDA 3JZEA 4J5NA 1A5MC 1BXCA 4YIWA 2JIEA 2PWHA 4X63A 4A3RA 4PL1A 3KRSA 1ODZA 3WD3A 4IL0A 1CI1A 3LG3A 1KKRA 5XIMA 3WIJA 1S2VA 1Q6CA 4JY9A 4E3TA 5AYYA 1KFJA 3MA8A 5CGTA 2FZNA 5BOFA 3B8DA 4NZ1A 1TQJA 3WD2A 1XYCA 3QV9A 1VP5A 3U2CA 1KXHA 2HCVA 4V1YA 4MVAA 3G1FA 4EVZA 2F2HA 1X1NA 1TZ9A 3U7VA 4M82A 5CG7A 4QJ1A 1JCYA 3I7RA 4TTGA 1H3GA 5CZ0A 3N2OA 2XINA 4JYEA 4N9EA 3K8MA 1TV2A 2ZRXA 5KZMA 2XSAA 4JFVA 1OFEA 1QXLA 3ANVA 4L7ZA 4MLRA 1B3YA 2O55A 3HJEA 4LVDA 3P0XA 4Q8NA 5D9OA 4PBFA 4V33A 4XZLX 1EC8A 1PDZA 2YSWA 1NTHA 2ZYFA 3FVMA 4P8WA 4EF8A 1UD2A 1HNYA 1XIEA 3HF3A 3FVDA 1O95A 2QCDA 1E15A 1EOKA 1V4YA 1EO7A 3GSMA 3HPZA 2ISSA 3CL7A 1QW9A 3G24A 3QYSA 3BJSA 4NYYA 2I17A 2VDHA 3FDKA 3SJ3A 1FFQA 5E0FA 3SCWA 1DXIA 1UKQA 3EMQA 5C8BB 4JN7A 4FXRA 1K8ZA 5LZLA 5BRBA 5I3IA 3G18A 2E6YA 4E2VA 2DJXA 2ZTKA 1C9WA 3KS6A 1EHNA 2ATMA 2PB1A 2PBOA 1XX1A 2OYKA 1GT8A 4MFEA 4FO4A 4B3LA 3O6YX 2WJFA 5JBFA 3ZT5A 1R30A 1JGIA 3A21A 1BKHA 5A8PA 2CCRA 1A3HA 2G3NA 3D47A 4NNAA 3TWBA 3HMJG 4XUGA 5EMKA 2PLKA 3QLDA 4FF7A 1F61A 4AXKA 2O9RA 5GNZA 5EB8A 3WQ6A 4DI8A 6A3HA 3OOQA 4YHEA 4ZQPA 4LBUA 3SCNA 1IEXA 2VDGA 1YW1A 4OJYA 1B90A 1TMHA 5DY2A 4UB9A 4GBUA 1E6ZA 2GPTA 2CZVA 1PHWA 1O5RA 1RBLA 2ISWA 2Z25A 3UPMA 4MKVA 3H21A 3V5OA 3DG6A 3GX9A 4LVBA 2XJ7A 3DKJA 1XFCA 4L56A 2Q3RA 2FB3A 1VLWA 4DQWA 5I07A 3QVQA 2GVLA 1OY0A 4OHQA 3BURA 1GWJA 5KZDA 1ADSA 1H1YA 1I2RA 1UWAA 1WDDA 3T6CA 5E6ZA 1OX4A 2XUCA 2OELA 2AKMA 2E9MA 1VC4A 3QYQA 2QMJA 1WPCA 3N2TA 2VRKA 1Q13A 1F3TA 1VFFA 2GLKA 1OG6A 3GTNA 3PJTA 2QCHA 2I57A 2FKPA 3MYOA 4WR3A 2V81A 4GXMA 1KXVA 5A3HA 1QNOA 4LANA 3ABQA 5EBUA 4JTGA 3WF3A 3BO9A 2E6FA 1FWHC 4CNUA 2X30A 3UG3A 4XG1A 3QV7A 1YDYA 2DH2A 4XZIA 3DAQA 3VMPA 3TAOA 4XIAA 4DO5A 3V0TA 2YL5A 4OUIA 3W7NA 3OVGA 2NVDA 2RGLA 3E74A 1CGWA 3IACA 5DMMA 1UR0A 2JQXA 3RX2A 5FACA 3UNTA 2WMFA 4PFMA 1IEVA 4O8AA 4A8NA 1DJYA 3EA1A 5C54A 1YXCA 4BF7A 3PK7A 2PZNA 1QRQA 7PTDA 2Z2AA 4JOMA 1KCZA 4HU3A 4QSHA 3P0WA 3BANA 1K6WA 2ZWZA 1RUSA 4HZ7A 4QXIA 1UKSA 1TQXA 1FCUA 3PAOA 5FJPA 1XIIA 3ZWTA 1WDSA 4JFSA 1Q6RA 1AD4A 3GFZA 3SBFA 4AZHA 4IH3A 1OFPA 5CPTA 1VJZA 1T8XA 4M19A 4XKYB 1OK4A 3W71A 3PHAA 3KM8A 1G1YA 2PDBA 3PWGA 1X8FA 1EX5A 1OB0A 2HWGA 3BLOA 1W5OA 2BGQA 3TONA 1DWGM 3POHA 3GVQA 3GHRA 4D2JA 3C61A 3ES7A 4L4OA 5MKGA 4DM1A 4GACA 4JN8A 3P60A 1GVYA 3GD6A 1MEIA 2HK0A 5HMEA 2E5BA 1DE5A 1PXGA 2D1ZA 4M51A 3LN3A 3SN0A 5KETA 1PEZA 3H54A 4NVTA 1LTDA 5FF7A 2E4TA 4H2HA 1MVYA 3SRFA 1O12A 4Q7BA 3RMJA 1ISVA 1AZ2A 5FESA 1G6CA 3STCA 1SSDA 1QPOA 1ONXA 1OD8A 1MXSA 3L23A 4WDXA 4RE3A 1EKOA 2OZTA 3BUVA 3E38A 2EPKX 1UUOA 1EFZA 3OVRA 3K4WA 3I3DA 4CCDA 4S2CA 2FMNA 2MANA 2Z2UA 2V3GA 4DPPA 1KKOA 3BICA 3B0XA 5I3DA 2WKGA 3N12A 1E1CB 4DYKA 1EA0A 4P8UA 1CZ1A 3V35A 5D4YA 3HA1A 3W2KA 2V3DA 2OWWA 1ADOA 2FZ9A 3UESA 3C3NA 3STEA 4FOKA 4R85A 1TYGA 4N9CA 3MCOA 1TJ0A 2VC6A 5A1AA 1AFSA 3TX9A 1RSCA 5LGXA 4PYSA 1A5BA 1DWIM 3QXBA 2I9UA 1L8NA 2PDQA 4UIOA 6TIMA 2PDCA 3M5YA 4J9JA 4GXWA 3NL3A 1H5VA 3KTSA 1R3TA 1ZJIA 3VKKA 1KM5A 5FEXA 1HO4A 5D37A 1FWBC 1HJUA 3WFAA 4FNTA 1W9DM 3TYCA 5EJZB 4G1KA 3LBMA 3V1HA 2BY0A 2P5NA 3IRDA 1K7FA 2VC7A 4R5EA 3ABRA 4FLSA 1YDOA 3BGJA 3ALFA 1NWRA 4IIGA 1TPEA 6PTDA 1S2CA 2XISA 1XYBA 4K68A 4F0RA 2GFTA 3SY5A 1YDNA 4DO6A 5BXRA 3MBFA 3VIJA 2J66A 3PBVA 1X96A 1GYMA 1DIDA 1ZZMA 3T0AA 3BG5A 5TIMA 2XTKA 1ZENA 3MUY1 1LM1A 5REQB 2VRQA 3U9IA 3D0CA 3FNDA 4PMQA 1PPIA 4HCLA 2J13A 1KD0A 1JG9A 3MBDA 4PCTA 3DN5A 2DQWA 2QCGA 1R0MA 2WSRA 1WDRA 2BY2A 2AAMA 4GOAA 4RLIA 4QDWA 1NP2A 2CBUA 5BCAA 2VI0A 1XC6A 3WK3A 4DHGA 5GNYA 3TYBA 3GRIA 4NZ5A 1HVXA 1W9XA 4HZ6A 2FDSA 3DI1A 1RP9A 3EA3A 4QFUA 2A3AA 4FR1A 3IJ8A 2AQVA 1RD5A 1XLLA 3WLIA 2J27A 2FH8A 1WE5A 4FLQA 1KFEA 2OB3A 5AC7A 1QATA 1FWRA 1W8SA 2A3HA 1UASA 3RO6A 1GKPA 5A6SA 2WNWA 3PTQA 4GGBA 3GY1A 1NQKA 1XH2A 1GVOA 4GH1A 3NQBA 3DC0A 2ZC1A 4MAVA 5AHFA 3W88A 3H4XA 3E3HA 3B9EA 4FB7A 8XIMA 3VGBA 3F5LA 3PWIA 3AU2A 5I7GA 1ONWA 4IPNB 3CT7A 4RZ6A 4NJGA 1R9ZA 1VPYA 4I7VA 4B92A 1JAEA 2W5FA 1Z41A 1PKNA 3QR1A 1S46A 1MEWA 3FY1A 1K8CA 3TTQA 5I6SA 2PEVA 3BAKA 1D9EA 3AS2A 2BVYA 3GXIA 5AB3A 1ZJAA 1X7FA 1HVQA 2RKXA 4S3KA 4ZOEA 3EWCA 3VD5A 1EBGA 1VHNA 1VRXA 1JPIA 3MTWA 4O11A 4XIMA 1R2SA 2QDHA 3O2LA 3IS4A 1FWGC 3BK0A 4Z08A 3LNPA 4QROA 1XKYA 3L7RA 2YBTA 4I7WA 2ZICA 3KRZA 3GXTA 1B5TA 3Q45A 3PTMA 1SMDA 4LSBA 3I3EA 1DJIA 1DHPA 4PFHA 4GC4A 5A6BA 2BV9A 1DJQA 1PCKA 2D23A 1O1ZA 1Y5WA 2QUVA 4HYWA 4NZJA 5AYXA 5AHMA 1XIBA 3GVRA 5CSUA 5IHRA 1G4TA 3OGRA 2WWDA 4M8UA 2FVMA 3WBAA 3VNMA 3NXLA 4GI9A 4FA3A 4AVOA 3QEZA 3BJTA 3MMWA 3EDFA 1OIFA 2EPLX 4JD4A 1QBBA 4CEUC 3GNDA 3WBWA 1KNWA 2EEXA 1RK5A 1CEOA 4GQGA 1KTBA 5AZ0A 5M2FX 1XDJA 4MB1A 2GJPA 1EJRC 1AJZA 4HZ8A 1AL7A 3CUHA 4NIRA 3B4UA 1ADDA 4ACZB 3A4WA 4C1LA 1XRSA 3DFTA 4QDMA 1D7FA 1OCNA 2J75A 2GGIA 3MJYA 5D38A 4UTWC 2VL4A 2PF8A 1EPVA 3LM7A 3P3BA 4L1XA 4MJZA 3UYCA 1V08A 3GDKA 3WK2A 3GFYA 2H8ZA 4YTTA 2BODX 3A5FA 4CD6A 2DSKA 4YWSA 4JEJA 4AMCA 3BQ6A 3CM4A 4M6QA 4ZOCA 1OIMA 4D72A 3DFQA 3L5MA 3TR2A 1WUEA 1P1XA 5E5CA 3C8NA 1XYLA 3RNDA 4P7RA 5HUOA 3VM5A 1JL8A 4D6HA 1VF8A 3KX6A 2CPUA 2CLOA 4PMNA 1B4EA 3S5ZA 2W67A 4U2ZA 2VX4A 1TR1A 1THFD 1G5AA 4WK9A 3XISA 1LRNA 1TKKA 2C0HA 3SY1A 1FOBA 3B8SA 4WD0A 3EB4A 5DANA 4B2DD 3S9YA 1ZNNA 3GO2A 3ITLA 2D73A 3PNZA 2CERA 2VT0A 1XG4A 2WLZA 3OEXA 3GIPA 4GC3A 1UIOA 1WAWA 2XFFA 4MNKA 3VM7A 2VC9A 4ICCX 3THDA 3TTEA 4KWWA 4K38A 3TP4A 3TC7A 2PI6A 2FDMA 4LCSA 4C6PA 1QPNA 1TV5A 1A5UA 5A8MA 3QRHA 4S23A 3PVFA 5DRIA 5E6YA 2CLEA 4AQLA 5IBXC 2ISVA 4P8XA 3N1AA 2EAWA 4Z1BA 1LOSA 1GOIA 4A8LA 5IFPA 4RZBA 3H2EA 2I14A 4L64A 4Y9OA 4AW7A 4BCEA 4IZGA 1CGUA 4KIRA 4CD7A 8RUCA 3NPVA 1QTWA 2CWNA 4O18A 4ZENA 4M1RA 5BXTA 3G1DA 4AZ6A 3EWYA 1Z7AA 3NIYA 3ZSTA 4O0KA 2QVHA 3FA5A 2EGZA 4ZE5A 2QJGA 4Z1DA 3NM3A 4UOZA 4P2VA 1UQYA 1AL8A 1TTPA 2VHLA 2QAFA 1OC6A 3B4YA 4UC5A 2Q01A 3ZJ6A 2HXUA 3G3DA 3B8WA 1U22A 4JIEA 1FUYA 4YL2A 3VDHA 3TKFA 1HTIA 3FJ6A 3M5VA 3ZFHA 1VCVA 3WF2A 4CCZA 4JQ3A 3LMZA 3IVUA 4CKQA 3ABOA 3HQNA 5GJNA 1FX6A 4ML4A 4O1BA 4DAIA 3F4WA 2PFHA 1C8VA 1KLYA 4K8HA 5CC6A 4IM4A 5A6TC 1LZOA 4CCCA 4FIQA 3MSYA 1XBXA 1POKA 1XL9A 4XO7A 3M64A 3SW6A 5EL1A 3HQ1A 1HXJA 4KF1A 3QPYA 1NEYA 3S2JA 4D6GA 4TXEA 4US5D 3R7MA 1UP2A 1TVLA 1G4EA 2Z4GA 1FA2A 3AXMA 3HPAA 5M1TA 4WGHA 3V36A 4KS0A 3GVGA 4LAMA 6ENLA 4MF4A 3OZMA 1XCWA 1R5YA 2YDAA 1CENA 4FIRA 1FHUA 4JR5A 3EDDA 3RLUA 2ZE0A 3AZSA 4GGHA 4MB3A 3ZLHA 4NJHA 2Z29A 1WOAA 4H01A 2E1DA 4LU0A 2OCZA 1ZAHA 5K9CA 5T91A 3ZR4A 1FDZA 4L65A 1PDYA 3M0HA 2R6OA 4JTUA 1Q3NA 1R2TA 1EDGA 4W9TA 2Y61A 2PSNA 3DGBA 3FK4A 4GABA 1J2WA 3M0VA 2ZZ7A 2H9AB 3ES8A 4PH6A 1VBUA 1PKMA 3KVJA 1UMYA 3T4WA 4UQCA 4BEQA 3EWZA 1L6WA 2QDEA 3WNNA 3NUKA 3S42A 1Q6EA 3EAUA 3FA3A 3F03K 5GJPA 5DCEA 2VP8A 3B06A 5CPLA 2V2HA 1EDTA 4Y9MA 4J35A 1F4AA 1XC4A 3CPGA 5CAKA 1OC5A 3A64A 3AROA 4U33A 3V3WA 3WLRA 1YRRA 2A21A 4DIAA 2QF7A 2VVNA 5CC7A 2ZVRA 2Q09A 2CLLA 2X16A 3TNBA 1CX9A 4YTRA 1TPWA 1L8PA 3N4AA 3TQPA 3OYZA 3CV6A 1YTKA 2VO5A 5ABHA 3B40A 3WG6A 3E6EA 4DF0A 1ELSA 3DU0A 1KM1A 1CWYA 4CNTA 3AISA 2BS9A 3IGHX 2P10A 4H1ZA 4MKNA 4CD8A 1OF6A 3D3AA 4BI6A 4OZOA 2XZ9A 3WJWA 4CNSA 5IFTA 3NEVA 2ACUA 4MGGA 3NQCA 2ZX5A 2X09A 4L5ZA 1F73A 1QI2A 4HOXA 3A12A 2XH7A 1PJ9A 3WCZA 4C6CA 3R6IA 3C0SA 4MZ1A 2QW5A 4U28A 3MKKA 6XIAA 2VCAA 3OG2A 2GQ3A 1YQ2A 1RJQA 3DX5A 1IWPA 2A7PA 4UBPC 3ABXA 4IUOA 1ZLPA 3B9NA 4JIIX 1I8JA 3IUHA 5K9XA 4AZBA 3BVJA 2R24A 1V93A 1MXGA 2QUNA 2YCJA 3I7SA 5LNRA 1QPRA 1FRBA 1IHIA 1H51A 1AA1B 1EL3A 2J62A 4ROPA 1ICPA 2QKFA 1Z42A 3PG9A 4OIFA 3TIMA 3JVAA 3URAA 1KRBC 4JTDA 1XIMA 1H5YA 7XIMA 4EP8C 4S3DA 1O68A 1OFQA 1FXQA 3BOLA 4BA0A 2QAPA 4H7VA 4F0MA 3W38A 1B1YA 2V6AA 4O1EA 4MFDA 5DRCA 3W7KA 3WSUA 2W91A 3QOKA 2YZRA 2RHGA 3W1UA 3VOHA 1M04A 3CZGA 4MUZA 3ZM8A 2OEKA 2WSQA 1YNPA 4IPIA 5FEZA 1F6PA 2WZEA 1KFWA 4ZTYA 5TD4A 2ZA2A 5I02A 1JCMP 4GPNA 3RK8A 4ZQRA 3WMBA 4LS1A 4B3KA 1P6WA 1ALDA 2OT0A 3RR1A 3PZIA 3USBA 1JDAA 3RUBL 3G1VA 2E25A 2KZHA 2FPYA 3WDHA 4WY0B 4IJRA 2WHLA 4C91A 4FF5A 2VZSA 3C2OA 3GG8A 3HQOA 5REQA 4LX4A 3TJIA 4F2BA 4C65A 2E09A 5BYWA 1DIKA 3NO3A 3E2RA 3RFAA 3BMVA 3WYZA 3TQVA 3UWWA 4IOTA 2J77A 3P84A 4CGTA 3DBPA 1IR1A 4MPKA 2Z1WA 1FBAA 1OFDA 4GJ1A 2PCQA 1LRTA 3HG4A 3CU2A 1D3GA 5BU9A 4X3ZA 4K39A 5A5WA 1T0OA 2DT2A 4QS5A 3VD3A 3WMCA 3IWPA 4LCRA 4AMAA 1WZMA 4S3CA 1DXEA 1RALA 2OQYA 1GOKA 2YXGA 3AMCA 1NF0A 1XGZA 2XDFA 1PV8A 4U5IA 1QOXA 5J8LA 4Q8PA 1MW0A 3EWDA 1SO5A 3GYCA 1XIGA 5LXEA 4AH7A 2ZUNA 1PTDA 1GHRA 4QE4A 2YYTA 4Z17A 4LWWA 4Q4PA 2WSKA 2NUXA 4O50A 5D9PA 2YA1A 4N42A 1CXHA 3TH6A 3SQMA 3VGDA 1RA5A 3KOFA 4LY8A 1VBJA 4AD5A 5CPOA 3IARA 2AAAA 4NF7A 3GE7A 3VIHA 3W72A 4L6HA 1AK5A 2NW0A 3NZRA 1NAL1 4K7VA 1Z89A 1UPMB 2Z6JA 3U2OA 3SSJA 4AF0A 5LIWX 3MC5A 3RGTA 3TCSA 1VEPA 1JYNA 1QO2A 1M1BA 2FPVA 4P7OA 5FJUA 4NRSA 3N2BA 3UYIA 4KCTA 4LAOA 2ZCGA 3NQMA 3QY7A 4O19A 4JIHA 2HMCA 1L6FA 2NLYA 1A47A 2VFDA 2Y7EA 4YLWA 1US0A 2CXEA 4RNHA 3CH0A 3OBEA 4O0ZA 5DEZA 4G1NA 5GNXA 4J3XA 4ZA0A 1FKWA 3DH7A 3LXAA 3F4NA 2DZUA 4LVGA 2EPMX 3ARYA 3BMXA 4WOQA 3WH8A 3KBWA 1E6NA 3DERA 1R8LA 3B05A 1VPXA 2ALRA 1OHLA 3TTYA 5CEWA 2O4MA 2OLHA 3UCCA 1XYMA 1U1HA 1TRDA 5HBFA 1QOPA 1IQ8A 3D5HA 2GOUA 3EX6A 1XYAA 5EMUA 2VR2A 2FZMA 1EEXA 1E43A 3ITTA 4EX4A 3VTRA 4DN1A 1XQLA 1S2AA 2J7DA 1W9BM 2YR1A 3AUJA 2GK1A 3WQGA 1H09A 3GG1A 1LOQA 5BOOA 3N9RA 2OO0A 1EJXC 4DYEA 3CL6A 2ZRVA 2G0WA 1ZBWA 2V3FA 3TDFA 5FEWA 3A23A 3C6CA 1J4EA 1QNQA 3PP7A 3WNLA 1TA3B 3U4AA 4O4WA 2RDUA 3WK0A 4GVIA 4DJFC 1XLKA 1SMAA 5HA7A 3BQ5A 5FI8A 4FR6A 3H2NA 3CGTA 2JE8A 3TJLA 1TJ1A 1W17A 1E0UA 2VJXA 3UNDA 3K13A 3CZKA 4UTKA 3W28A 4ZO6A 2BY1A 2X0HA 3DBNA 3T2PA 3AFBA 3W7GA 5D8ZA 1GOQA 3M7SA 4BY3A 4IHCA 3W2UA 5CG0A 3SUVA 1IXQA 4CVUA 1B30A 1KM2A 1M6JA 4BK9A 1TR9A 1EDQA 1OX4B 4AIUA 3BV7A 2MNRA 4GKTA 2VCCA 4LALA 4GX8A 4MHBA 4UOJA 5CJ5A 5H8UA 3CEPA 1E4LA 1EJVC 4KEMA 1PBGA 1FHDA 1B9BA 2X1SA 2V68A 4DNMA 1H11A 2V5DA 5I3FA 1EXPA 1XIDA 1XQKA 4C7GA 3NFUA 1BRLA 4JFWA 2X41A 1EJTC 2FZDA 2JALA 2YOCA 1TIWA 4TQTA 4HMEA 3SADA 3Q67A 1D3HA 3QR3A 4IICA 3AALA 4LFYA 3MV11 3VIPA 4WSJA 4L4MA 3U7BA 4PR4A 5C0QA 1C90A 3KL0A 3DIPA 2HNHA 5K7JA 5JIWA 2J8TA 3G0XA 2BTMA 3LEPA 2TYSA 5BWFA 4IMCA 2F84A 4AEFA 1UC5A 3GNNA 3URQA 2P88A 3TE9A 5G2IA 1PTAA 4TVCA 1VIWA 4YN5A 1O5KA 4QG6A 1UR3M 1CXKA 4W5UA 5D2YA 3GR4A 3HV9A 4PBEA 2TAAA 5AECA 4GYPC 3PR2A 4K1WA 2XIOA 4PCNA 1MSSA 3ZMRA 1K4GA 2B7QA 3BSGA 3IEBA 1JPDX 1O5XA 2CZ5A 1GONA 3OLGA 2WZIA 3NPUA 5L6UA 4V1XA 3FV9A 3K1DA 4LC6A 5K4ZA 3M6DA 2WANA 3O6AA 2ZRWA 5CQ1A 4YHGA 2GJRA 2CFFA 4LEFA 1EJUC 3FSTA 3IUDA 4UXDA 1S38A 4Q8WA 4LAKA 1TO3A 1AQFA 2WNQA 4F3HA 1XWYA 4C7FA 3WH7A 4IFKB 5I79A 3PPGA 4PE8A 3FYPA 1MUCA 1KCXA 3PANA 4DX3A 2O7SA 4HPHA 4K37A 1XKJA 4RJEA 2A3BA 2OJPA 3V0SA 1W9VA 3OLDA 1C92A 4Z2IA 3E0LA 1FHVA 4LC8A 4I6VA 3CO8A 2ZXDA 4DRSA 2J6VA 3HN3A 3NQFA 4EKJA 4ZEPA 3QN3A 3SCTA 4ICMA 1V0KA 3VFLA 3VYLA 3BAYA 5D8WA 5G1TA 3AHVA 3UJRA 2VZUA 3WJXA 1O1HA 3WH9A 1RV8A 3W7CA 1W5NA 2CLMA 2TPSA 4OT7A 4X0NA 4LAZA 1QNRA 1UD4A 5AVNA 1P6CA 1TV3A 1KFKA 1OEPA 3QW4B 4H9YA 5H1WA 3CMFA 5CKSA 2X05A 1E5NA 4EAYA 1Q6GA 3ZO9A 4H9XA 1OG0A 3PZVA 1IR2A 5K9DA 3R4IA 1LROA 1MMFA 1J79A 1HW6A 1RP8A 4N6EA 4O8RA 3W7QA 2DUZA 1W32A 3AC0A 3WMSA 1C7SA 2L5HA 3AS3A 5CJNA 1K9DA 3S46A 3HPFA 1H7RA 1TCMA 4KCWA 2YA0A 4EXBA 2ICSA 4NHVA 1FVPA 1TMLA 1XLDA 4AD4A 1KQYA 2BP1A 2PGRA 2IPFA 2CKRA 4D6IA 5AC5A 5CC3A 2PDNA 1W1IE 2FIQA 1E0XA 4O54A 3ICJA 3S5SA 3SN4A 4TV5A 4FNPA 1A5CA 2ZRYA 4B5WA 4GG9A 3M0IA 2GDVA 4AY8A 3B0VC 2PE4A 4IGMA 4WJEA 1M3UA 2I5IA 4RPQA 1AJ0A 2C71A 2X7VA 3TN6A 3BOXA 4C6DA 4G56A 1C3FA 3WQDA 3APYA 5CJMA 2QVNA 1M68A 2Z26A 3DHPA 4HK6A 3HURA 4CVWA 3UBPC 1HFBA 1PWLA 2VZVA 3STPA 1CGVA 4W7UA 3Q65A 1TV7A 1BYCA 3ARTA 5U4NA 3EX4A 4JYFA 3ZVHA 3HBLA 1XXXA 1ZBVA 1Y0EA 3A6OA 1ZRQA 3BCJA 1GCYA 3JRKA 3CHEA 3H70A 6CGTA 2BGNE 3SEPA 3MANA 2XIQA 2X0YA 3GG7A 2B0MA 5IBXA 3VIGA 2MUCA 2VEKA 1IYXA 4LNCA 1QNPA 4NUWA 2QPXA 4MM1A 1XFBA 2XWDA 3H7UA 2OVLA 3FGCA 1D3CA 2VWSA 2PGWA 1V51A 4KT2A 4PUKA 4EWND 2ZZ1A 3I6TA 2GUBA 1TFVA 1XBZA 1J5SA 3PZQA 2FTPA 3WLPA 1VENA 3JR2A 4B5TA 3NJ3A 1XGDA 1S1RA 5IM51 4ZZ9A 9XIAA 3LBCA 1G69A 3F4VA 4HHMA 1J2BA 5KITA 3IUIA 3GC4A 2CYGA 4HNVA 3GDBA 2GDUA 4PRWA 3TAKA 1N8WA 4DWSD 5AHEA 4CQ8A 2A3EA 4WJXA 3HGSA 2UY4A 1TTJA 2XH4A 3FJNA 3LTSA 1FQ0A 1MRAA 3ZSSA 4LYQA 4XWUA 4R7WA 3MY9A 1FWAC 2CZEA 3CUGA 3WZ0E 4CUCA 3P74A 5A2BA 3TYZA 3LV5A 1XW8A 1SJDA 2DW6A 2WV8A 4D9PA 3BSHA 4LF1A 3FJLA 3NYDA 2B7OA 4A2SA 4D8LA 1HL8A 3QJAA 4H8NA 3R2GA 2NQJA 3WF0A 4DELA 4DWSC 3SN1A 3GUWA 4UTTC 1MO0A 2GZXA 4Y96A 3RR4A 4C60A 5J04A 3ECQA 4MYXA 3USZA 1O4UA 4RE0A 2VURA 4UR8A 3STFA 3WJZA 4FP1A 4FNUA 1Q6LA 2HBVA 1ENUA 3ITYA 1HZYA 3GM8A 4KFPA 2GUUA 3IIZA 4UR9A 4E6MA 3EOUA 3R25A 1Q66A 3MKVA 1NSJA 4LVAA 3UXAA 2GQ9A 3FXYA 3W7DA 1YNYA 3I4EA 3EKGA 1K9TA 1NDZA 3TU9A 1KTCA 2AL2A 1F8IA 2BMBA 4NASA 2Z24A 5CSYA 2UBPC 1E0VA 1DJXA 2J7CA 2CIPA 1GEHA 1AJ2A 5HJXA 4O17A 5DBTA 1SFSA 3W7EA 5C6MA 2PGEA 4Q7NA 3QGVA 4HSHA 3DESA 2WMKA 4PB4A 4WEVX 2WKLA 1BVZA 4UQEA 4TIMA 3ZT6A 2VMFA 5J5DA 4A3YA 3W53A 5DBUA 4GYFA 2W4XA 3TN4A 1NWUA 1TTIA 1VFTA 2NT0A 3WLTA 4DZIA 2AGKA 4ZBCA 3FJ4A 1S3TC 2KX9A 3TQKA 3CT2A 3MV01 3W37A 1A5NC 4JBRA 4Q4OA 1CLKA 5D2TA 3L4YA 4C6MA 1RVGA 3LZ5A 1MW3A 4OU1A 4Q6JA 3GW3A 3LDVA 1AW5A 2J79A 1XYZA 1M7XA 3AIRA 4R27A 2VR5A 1CXIA 2Y7GA 2VEGA 4MY8A 2ABBA 4E8GA 4LGXA 3LPPA 4ZE4A 2HE8A 3RO8A 4W86A 2ZFAA 2VDIA 2DJLA 3P61A 1WKDA 4ZMGA 4C5YA 4OV9A 3FLUA 2FHCA 4J40A 3AQUA 3UPBA 2HDJA 1BFNA 3TW6A 1EA9C 3AYSA 4DWSA 3GNXA 1VKFA 4XZ9A 5C5YA 7CGTA 4NX5A 4AEEA 3GAYA 3UWYA 1VLIA 2G4JA 2WB5A 3R1ZA 4PTMA 1W5PA 3VMNA 1GORA 4UMAA 2CBIA 5EIYB 1AH3A 2UY2A 5F2GA 4IGHA 3ITOA 3B9AA 3WKZA 5DN1A 3IJQA 3MUAA 1BWKA 1QT1A 2ZWYA 3CWNA 3W7PA 4HNOA 5C7HA 3DFPA 3N9KA 2PMQA 3BAXA 2O92A 4O15A 5E93A 3LOTA 3S8HA 3TSBA 1TIMA 4O10A 2G3IA 2W63A 3M0LA 4F9DA 1DTNA 3VNJA 4FOJA 5JMUA 4AZIA 4Q6XA 5M03A 3LSCA 4W4QA 3DYMA 3URBA 3QGKC 1EEPA 4IFKA 1TWWA 1XLHA 1W1VA 4AIEA 3VNYA 3MQTA 1KCLA 4KBXA 4UQ9A 3CLWA 1F05A 2ANUA 3O07A 5LGZA 4IPLA 2IKGA 4KRTA 1CXFA 5FSDC 3QM3A 2AGTA 4TX9A 3L4TA 4CEXC 1KBJA 3LNMA 4O14A 5DMNA 1UG6A 2ZZ3A 4A8IA 4MUPA 2OPJA 4JX5A 3U4FA 1IE7C 3K30A 4WKHA 2KAUC 2PDJA 1WDPA 5KZ6A 4JICA 3VIKA 4HJWA 1B57A 3M0ZA 1QAPA 1TREA 3VIIA 3TC6A 2G5WA 5D2VA 1TVNA 3NOEA 3UXKA 4C6EA 2FTWA 7REQB 3KWSA 4LAUA 4DJEC 3EWUA 2FTYA 3PPFA 4RNFA 4H19A 1TRIA 8A3HA 3RYSA 5F2MA 1DWHM 1G9HA 4PUWA 3E96A 5JUVA 1E1EA 3MSGA 4C6BA 4L9XA 5HJYA 4NL1A 1J9YA 3CB3A 1AUSL 3DKLA 2WOQA 3R10A 3GTHA 1XP3A 2O9TA 4JXCA 1DVJA 2DPEA 3T0CA 2RJHA 2QV4A 4H9VA 4TTUA 1SZEA 4R33A 3O7UA 1L6GA 4NZ4A 3KRBA 4EPBC 3GFXA 1BEUA 5B80A 3O63A 4OTKA 2PDWA 4B9YA 3GK0A 3ALGA 5LIUX 2J9YA 4UFIA 2PZ0A 3UJSA 5J5RA 3TEVA 1SSGA 1XBVA 3KLLA 4INFA 4M7TA 2P0IA 1ONRA 4GINA 4MY9A 2EPOA 7ENLA 2CWXA 4LCQA 1SFTA 4LS2A 1ZP3A 3NQGA 3VVGA 4HA0A 2ZX8A 3W75A 4HCHA 3EDJA 4ACZA 3YPIA 4GLEA 4FK9A 2BFGA 2HS8A 2Z1VA 1UD8A 1EBHA 3VOJA 2EJAA 4M6PA 3A22A 1EWDA 3O6DA 1I2PA 3BGAA 3LENA 3P8JA 3BWWA 4A35A 4A6GA 2PD5A 2YX0A 1UKPA 1HP5A 1I0BA 1X8CA 3Q2DA 2ZZ2A 3KOYA 4PMJA 4JIRA 3GDLA 4EPKA 5CPQA 1HP4A 1VYRA 3S5YA 2V5CA 4QQUA 2VNCA 4NZFA 2CLKA 5M3WA 3W4RA 1T6MA 1L2UA 4Y9NA 1UR1A 3DI0A 1DJWA 4M0XA 2BXVA 3S6TA 4IG2A 4NQ1A 3KP0A 5BMWA 1IZJA 3NQ8A 3XIMA 1T96A 2PRLA 4JTAA 4H3DA 4J3SA 1TZ7A 2G3JA 3SQLA 1OCBA 4AWEA 5IHSA 3PAJA 2NV1A 2GSJA 1A5KC 1UQZA 1JF5A 4UTUA 2O56A 3M44A 4IX2A 3P6LA 3PJUA 4XUYA 4FMVA 1GG0A 3LI0A 3T4CA 1FH8A 3QZAA 3REQB 4G2DA 1SGJA 4J27A 2CHNA 3RXZA 4GQQA 4WF7A 2PGFA 3R8HA 5G2WA 3ZS4A 4XBJA 1K9EA 4RKAA 3CHDA 1EP1A 2NQ9A 2IQ0A 1GK8A 4CN4A 3S2NA 4MG4A 1W9UA 3GNPA 1S5NA 4R88A 3LCXA 2YL6A 1JCNA 2C1IA 1NP0A 4YJ5A 4JFUA 1A50A 3NVTA 3MDUA 4HBKA 1HJVA 3H23A 1B0IA 3OZOA 3QMTA 3WEMA 1UW9A 1OYAA 3WNOA 1JCLA 2VVSA 4CQDA 2BHZA 1ME7A 3H12A 3TN3A 5EBAA 4BZYA 3MVIA 3C2VA 2GJNA 4V27A 2R82A 5HNRA 1LCOA 3VILA 1PX8A 3L4VA 4MNMA 4LUTA 3AIWA 1J5TA 1TSIA 4O1FA 1J6PA 2ZUVA 3BAIA 4C1NA 1ONEA 2VX7A 2GGGA 4Y6GA 2EG6A 4HJFA 3NDOA 3AI0A 1NOUA 3KRUA 1EJSC 2Z00A 2E3ZA 4LBSA 2DVXA 2B7PA 3N14A 3U8GA 3LI1A 3KVLA 2ZDRA 3ARUA 3UWZA 3T05A 2CHRA 3P8IA 4UR7A 2IKHA 2V38A 4IMDA 1IF2A 4KESA 1XIFA 3IGXA 2DZSA 4NZCA 4OBTA 2OOFA 3EYPA 4F66A 3ARWA 1EUAA 2QUMA 3KOXA 2X1TA 4J3UA 2BNJA 4L9ZA 1FXPA 1BGAA 4TX8A 3HIJA 4JFTA 3C2FA 2VFGA 1PYMA 1TWSA 1X6LA 2R1KA 4H7ZA 1J11A 1OF8A 2BVDA 3AWNA 2D2GA 2RDWA 2DUXA 4JCLA 4DM2A 2VQTA 5HK4A 4OQVA 4MOZA 4JN6A 3MKCA 3LHWA 3UVAA 1I60A 1LBFA 2INEA 3WJYA 4MAZA 3SUSA 5FL0A 1A3XA 3GVWA 1HUVA 3VI2A 2J78A 4PMOA 2HTMA 4LEQA 4P61A 4JQ1A 4R7JA 2X2YA 1P6BA 1E51A 2PP3A 4O57A 4XAZA 3U2EA 1NDYA 1I75A 4UFJA 2FYMA 3C8FA 1CIUA 2I16A 4LRSA 1DQWA 4Q4SA 1HF6A 2ZKMX 5DMLA 1QW8A 3G0SA 1ZTVA 3KZPA 2HRWA 1EX1A 3BOFA 4GKLA 4PL2A 4GCAA 1TE1A 1PAMA 2VFFA 3V16A 4DZAA 3HQPA 1PKYA 2H3BA 3VGFA 1O66A 3AXXA 1AODA 2WCGA 2GL5A 1JNDA 1KR1A 1WBJA 4R9XA 5I5RA 1F74A 1YYAA 3TZNA 2BVWA 4KEVA 3O3RA 2CU0A 1H50A 3R0KA 1V6XA 1YE6A 4E4FA 5CZKA 3H4WA 3DGRA 1JGMA 2G95A 4O0QA 3E0IA 3S9IA 1ME8A 4P7LA 3VCCA 3PBYA 4PB3A 1O6IA 1CBGA 4XBKA 1V03A 3WF4A 4L61A 3RU6A 7ODCA 3AYTA 2RJGA 1XJBA 1BYBA 3NO1A 4XB3A 3VIOA 2R14A 1WA3A 5T8GA 3CAKA 4XZMX 3L65A 1T40A 2R91A 3W7MA 3SECA 4ATLA 4GMEA 1BAGA 5CSSA 1XLGA 4TR9A 3BW2A 3CZ8A 3LK6A 2CKSA 2XVGA 3RRXA 1V6WA 4Z0SA 3ZYZA 2PDGA 5E1QA 1D8WA 1ZALA 3AS0A 2QDDA 2YGYA 3N11A 1UWTA 3AIEA 4HGXA 1Q85A 2HXTA 4ONVA 5IRPA 4DYJA 3NL6A 1K1DA 2ZX9A 4U2YA 4BEUA 3ZOAA 4MWAC 3BAWA 1O94A 3B3DA 1QO5A 4GJJA 4ML9A 2BX7A 3TJ4A 4RE2A 1UA3A 3DHDA 1F3WA 3AMKA 3CMJA 3Q4DA 2BHYA 5ECUA 1TVPA 1CDGA 3L4ZA 3SURA 3N3MA 2ZQ0A 2Q6ZA 2XYLA 3N18A 3PUDA 5BWAA 2EF9A 3CPUA 1RK6A 3U5YA 3L5LA 5ABTA 3B8VA 3P80A 2YXOA 5G1MA 2ZVIA 3PSWA 3A4AA 3GU9A 3QV8A 1UBPC 3LLXA 4XAPA 4LV4A 2P76A 2AQWA 1V5XA 1VFMA 3I7QA 2EHHA 3DFOA 4HN8A 2GVGA 1XLJA 4QS6A 4R34A 1Q8JA 3S2MA 1B31A 3NM1A 2X0SA 2OSYA 2QGHA 3WLLA 3QHMA 4ZXLA 2Y2WA 1A3WA 1JZ3A 3IGUA 2PWFA 1EF2A 1UBSA 2HNEA 1E72M 2Y6ZA 3BTNA 1UWSA 1E73M 4E4UA 2WVSA 4Y2WA 3B03A 2WNZA 4ZFMA 1Z48A 4G7FA 2CC0A 3N73A 2XVPA 3HU7A 4K36A 3HPSA 4IIBA 5FJIA 3UF9A 3CPRA 3C0LA 3WBEA 4JZ5A 1W1B1 5LIYX 3R11A 1Y5VA 1RXOB 2VGBA 5I00A 2ZOXA 1H63A 1LYXA 5C9RA 4O4VA 4EF9A 1P5BA 3RM8A 1QNVA 5ABFA 3QV6A 4RW5A 4P7NA 4AX6A 3OLIA 4JTSA 4W88A 2Q8XA 2AQOA 3FEMA 3PBMA 2NUYA 5DQPA 5HWJA 4Y9AA 3AHXA 1MQPA 2GWNA 3SI9A 1S1PA 3T1GA 3W84A 3RLHA 3CB8A 4JX4A 3KTCA 2CETA 3BARA 7A3HA 3ZLFA 2YFOA 3NL5A 3G8RA 3GHUA 3JW7A 4AX7A 3EMCA 5A6MA 3BE7A 2NQHA 3TC3A 3NA8A 1F3EA 3FA4A 1R3RA 3QMRA 1TPH1 4OE7A 5BRQA 3LHVA 3UGRA 2FB2A 3IAQA 2QS8A 3S2LA 3SAZA 5HQEA 2VX5A 2H6RA 2A6LA 1ZBKA 3BLKA 1A49A 2WJEA 4AD2A 1MEHA 3UA3A 4K8GA 1X38A 4GVHA 1I1WA 1PL9A 5D09A 3OHMB 4FNSA 5I3HA 5C9ZA 1W91A 3FKRA 3RIKA 3AIVA 4A05A 2WK2A 1KRAC 5HR7A 1UD6A 1UWIA 1OX6A 5H8PA 1HJQA 4EIVA 3W1AA 2HVNA 2C13A 4ZO7A 4XTDA 3FCPA 2C79A 1WUFA 2YL8A 4H9ZA 3CHFA 3GB6A 2VOTA 1EZ2A 3RCYA 3LV6A 2H90A 1XR2A 3R8RA 4XD6A 1Q45A 1Q2SA 1TX0A 4U4MA 3UT0A 2OWXA 1H0GA 2FPTA 1K4HA 4JTJA 3P14A 4YYCA 2QXWA 1LQ2A 2ZDSA 2ALDA 2Y24A 4K3ZA 4QAWA 1H1NA 2NV9A 1BLIA 5HMSA 3TFCA 1JCTA 3RLVA 2EO7A 3S1XA 1HJWA 4TU1A 1ZJHA 1P4CA 3KBJA 1X98A 3AYRA 2PDLA 4IP5A 3CIVA 1C8XA 1J0YA 3BMWA 3UZXA 1W3HA 2QCDB 3BW3A 2NXGA 1OYBA 4NAFB 1ECEA 4F0HA 1MRQA 3EEZA 3O05A 2XGZA 4AC7C 4NI8A 2IXVA 5JH1A 5AHNA 4HNUA 4QJ4B 3GXDA 3MDWA 2WC3A 2DIJA 5AC8A 4MADA 4PTDA 4Q32A 3W7JA 4DEFA 2REQA 3WLMA 3SIMA 4ZVJA 1BQGA 1BWVA 2E6AA 3PC0A 1SO6A 4UTFA 1E1CA 4GNVA 3GLCA 3ZJ8A 9XIMA 4A3UA 1F07A 3LTYA 4AIBA 5T9CE 1R87A 5D03A 3V4BA 1KR0A 5TF0A 4QNEA 4I9MA 1CLXA 4UZSA 4HNTA 4F9JA 2ADAA 3MI3A 3MUXA 1Q7ZA 2OQLA 3DG3A 4O1CA 1DQXA 4PZVA 5DELA 4L80A 3T2QA 3H7VA 4BWLA 3ZQ9A 4AU0A 3F4CA 3UR2A 4GQBA 2FHFA 2WHKA 3BCDA 2J8GA 5FJRA 3VNIA 3WO8A 1EGZA 1UR4A 1E6RA 2I7GA 1A0CA 1P0BA 1E9IA 4HMNA 3OP2A 5D9MA 4A3QA 3OGVA 2WWCA 5BXSA 3LCGA 1BHGA 3TJXA 4UQBA 1TE6A 1V02E 1DORA 3TLQA 2PC4A 3PUEA 1LWIA 2FZ8A 3H6OA 2W79A 4K1GA 2B81A 3H53A 1H41A 4OGZA 4H7CA 5CXPA 1GVFA 1JQVA 4J4KA 4P5UA 1HG3A 2YB1A 4GNKB 3WF1A 3LXCA 1TV4A 4E2DA 2J25A 4BQ4A 2Y8VA 2PDMA 3KEHA 5HR6A 1H1ZA 3BAJA 2XSBA 1EB3A 2VEIA 3U3HA 3VAVA 3FW6A 1W1YA 3PSVA 1TMQA 3MW7A 4HA3A 4H6EA 4QEEA 4RNIA 2P50A 1IT0A 3UW6A 1S39A 2QQ6A 4QDPA 1XPYA 4W8BA 2VEFA 5K4XA 2OZ0A 3EPNA 2WJZA 1JQXA 3J7HA 4UFKA 3PUGA 1RJRA 4G7EA 4H6KA 4AY7A 4BI5A 3L2MA 3F1QA 1FY6A 4ILSA 4O12A 1POJA 2VR4A 4QEHA 3UQNA 2E9LA 2FGZA 2ZX7A 4ADSA 4RE4A 1SYTA 4MNJA 3MSRA 1JDCA 5ECVA 4O52A 1RLCL 3LB0A 4JTFA 3W6MA 2X8RA 4OV4A 1XLIA 2XPKA 3CQIA 2YBVA 2Y62A 3U0HA 4XO6A 3V7PA 1EH9A 4ZL1A 1WP6A 5AC4A 3UWEA 2CZFA 2QV5A 3KHDA 4OUEA 2PWVA 2WM1A 4W7WA 1QK2A 2J7BA 4RPPA 2WO5A 1R3SA 4GYJA 3UG5A 3S6DA 4Z1CA 1V3JA 2ZUTA 2BHUA 2A4AA 5CGQA 1Q5MA 1ZPTA 2NXHA 5EMMA 3GBEA 3WDIA 1HN1A 4YVXA 3M46A 2V5LA 1VB9A 2QNEA 3B0YA 4MJ4A 4N7QA 2AMXA 3RJYA 4AY1A 1JZ8A 5I09A 3JS3A 1VR6A 4LY4A 2PDYA 4HTYA 4WSKA 3AIBA 4BJHA 1W8GA 3UPWA 4CN1A 4DJDD 2OSXA 3SRHA 1E6PA 5EMJA 1GVSA 3G1YA 2GWGA 4HOWA 2Y89A 1OFOA 2OWCA 1OX5A 1RCQA 4IIEA 3I6RA 3K1GA 2NUWA 1WZAA 1RY8A 3M41A 3HM7A 3PFRA 2YW3A 3MI2A 3HZ3A 3T2OA 2ESCA 3U48A 3G8EA 1U33A 4AHQA 1J0HA 1J93A 2IPGA 3W6LA 3WLNA 4O16A 1I2OA 5EA9A 2E9BA 4GBDA 4ROQA 3GDTA 3WN6A 4KEUA 2J8FA 3W26A 2P0OA 3I6EA 2QJIA 4UFMA 1SFJA 2BG5A 2XG9A 1JPMA 1ZBCA 3VC6A 5A6LA 3CAWA 3CL8A 3O0KA 2PTZA 1U5HA 4QJ3B 1OCJA 1J96A 2F7FA 1TJRA 3BH4A 3PULA 3FHAA 2XH0A 2ONEA 2C14A 4AXNA 4O28A 1TPC1 1T5AA 4H6QA 1AW1A 4D6EA 4R7OA 3W1XA 3W01A 1PS9A 1VQTA 2ZUUA 1XS2A 4YWIA 3CJPA 4MSSA 4PULA 4W8LA 3W27A 1YTDA 2GGJA 4ES4A 1K7XA 4ENLA 3L5AA 4AF0B 2E6DA 3VINA 5XIAA 2J88A 4DWSB 5D32A 1QOQA 3W9ZA 1ZS2A 4PB5A 2I5QA 2V63A 1P7TA 1FWCC 4CU8A 4PTVA 1XD1A 3L68A 4B9ZA 1M7PA 2W92A 3VIFA 3TTSA 4WXZA 4PMUA 5FF3A 4TO8A 4F8XA 3QSTA 2F61A 5A6JA 5CLTA 3VCRA 5IDZA 1H2JA 4PC8A 1K9FA 2HV5A 4JTEA 1UH4A 3W70A 5C70A 1IGWA 4UTLA 3KE0A 1E9LA 1W9PA 2PS2A 6REQB 3NQ7A 3UZ5A 1W31A 3N4FA 2ZUMA 5FIPA 4EPDC 1GTEA 4AC1X 4GY0A 1SW3A 3KLKA 4MLJA 2H8XA 1KWGA 1ISYA 3PBGA 1Q6DA 3NPXA 4H8HA 4JL1A 3AICA 3SZ8A 1ZP4A 4W85A 3MZ2A 4QAIA 2XVKA 3OODA 4C6FA 4IQEA 1WO2A 1XH0A 4W89A 4FX8A 3R5EA 1C93A 3N4EA 5MHBA 3NQEA 1EO5A 4JTIA 1LWJA 2WQPA 4ERIA 1E4IA 2W3ZA 2V67A 2E5CA 3UG8A 4W84A 3N6JA 4IP4A 4Z0JA 4F2UA 3ZJKA 1QHOA 2PU0A 1I9CB 2GVYA 3PFMA 4C6NA 2IUZA 4WZHA 4KIEA 5EU9A 4HVXA 1YADA 1GKQA 3UJ2A 1E6XM 3LQLA 5LXXA 3C0JA 1GNXA 5FJOA 3RX4A 4I8DA 4AG0A 1W56A 5LA2A 3P62A 1ZU8A 1KM0A 4RV3A 1RBAA 3L9CA 5HPOA 3AHZA 3GNRA 3AMDA 3FIGA 2C19A 4UUIA 3M6YA 2OKTA 3CO4A 2VQUA 3ANUA 1WKYA 5CPSA 4QITA 1WB0A 3R79A 1DJNA 1I2NA 3LHYA 1RA0A 3WEZA 3LCFA 3DFNA 4MJ2A 3ARVA 4E3VA 1KV8A 1XLMA 3G2GA 2XU2A 2FH6A 2WW5A 4ORMA 1SW0A 4GIYA 4GI8A 3T55A 3QY8A 1NF7A 5EMYA 3RN6A 1LT7A 3VX1A 2DZXA 4E2OA 2CNCA 4H9TA 3N19B 4HKPA 4EE9A 2ZTJA 1KWKA 1UZ1A 2XZ7A 3DC8A 3PM6A 4JDYA 1BRLB 4KWSA 5HINA 1VAHA 1VBRA 4JTRA 2HZGA 4EXAA 3K4DA 4FPSA 2OEJA 3E0FA 4PCFA 2X2GA 1H7NA 3FX4A 2XVNA 3VE7A 3AUOA 4LUSA 4AHOA 1IV8A 4GYPA 4HHHA 1BXBA 4MNLA 4NXKA 4JTTA 1JAKA 1IXNA 2VELA 4D6DA 4S3EA 3KHJA 1FCVA 4G7EB 3HO8A 2CZDA 2VZOA 5F4SA 2HSAA 4GQRA 1V0LA 2GUYA 1MDLA 4J7RA 4Y7EA 1T41A 3DECA 5CLWA 3LHZA 1ZGDA 5HUPA 1X6UA 4V15A 1VYPX 4IIDA 4Q4MA 3RF9A 3A5VA 2AL1A 4KETA 4I8YA 4RNJA 2QUTA 3N34A 4MWAA 4MKSA 2P8CA 4WHBA 1XGEA 1LDCA 3S9ZA 3LUTA 4HP5A 1AW2A 1V02A 2QT3A 4TVDA 1GZ1A 1S2UA 4JY8A 1F4HA 3U6WA 1YPXA 2FFIA 3NGJA 1YPFA 3KOWA 5DX7A 1CW2A 1VCFA 3E5PA 5LSMA 2O7QA 2GJXA 5C2CA 1VYSX 5TQLA 3LXBA 4MWAD 1W1PA 1GVQA 4MZ8A 4NT0A 3ZWSA 3IV3A 2J7GA 3DXIA 3KCJA 3O6CA 2HISA 1JI1A 1SZFA 3GG0A 3UP8A 1WZKA 3KBVA 3FXGA 5HNUA 4QG9A 1SJCA 1QJWA 2OYLA 2QEZA 3W76A 1PZ3A 1I4NA 2VGGA 1EPXA 1V8EA 1BGGA 1V3MA 3P93A 4PMXA 4KQNA 4D8ZA 1XG3A 2DZWA 4TVUA 4D1JA 4I7UA 2W61A 3KP1A 3EMZA 1ICQA 1QI0A 2CBVA 1B3WA 1R38A 2C1GA 3P81A 1GYNA 3VIMA 1UR9A 3EX2A 4JNMA 4H9UA 1XSKA 1R9XA 2NWRA 5FAGA 8TIMA 3RAOA 2Y85A 3H2FA 3NDZA 3WDPP 3BSMA 1AG1O 5G4EA 5AY7A 4F79A 4K8EA 4PMVA 5LNVA 4UNKA 5AC6A 4E8DA 1YKWA 5MKGB 3EDKA 4EWJA 1KFLA 2J4GA 1BTMA 1GOMA 1AD1A 1KM4A 5LNWA 2GJLA 5B7YA 1C29A 1JF6A 4R53A 4IF2A 1RAKA 4X22A 2OGJA 4IISA 2G41A 1US2A 2B31A 2QJMA 1IIGA 3SRDA 3QLLA 2QCMA 2J7HA 1XBYA 2XN1A 4E8CA 1Q2RA 1RPKA 4AYSA 2Z7GA 4AEOA 3GWQA 1UZHA 1L0PA 4UNLA 2VRJA 4QCEA 3VKDA 3MO7A 4GNJA 5TNVA 2CBJA 3N2XA 3ID7A 1F7BA 2E8ZA 3T42A 1HL2A 2FJKA 5D04C 3BLPX 2DORA 3ZVIA 3CYJA 1GEQA 3FHQA 2E40A