3GH7A

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12 in complex with galnac
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
519
structure length
506
Chain Sequence
HHHHSSGLVPRGSHMATSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords beta-hexosaminidase
publication title Molecular cloning and crystal structural analysis of a novel beta-N-acetylhexosaminidase from Paenibacillus sp. TS12 capable of degrading glycosphingolipids
pubmed doi rcsb
source organism Paenibacillus sp.
molecule tags Hydrolase
total genus 194
structure length 506
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gh7A01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3gh7A02
2CBJA 2HISA 2XVNA 3WDPP 4MB3A 1CYGA 1H4PA 3HMCA 3WQ8A 2ZICA 1Q6CA 3BMWA 3CZGA 4FLSA 1JF5A 1GHSA 5LYRA 4BS0A 5A2BA 3TA9A 4AIUA 4J7RA 2GJXB 1JYNA 1HP4A 4DUXA 3WH6A 2VJXA 3K4AA 3AYRA 1GVIA 2X05A 1ODUA 3BAYA 2WNWA 4QDMA 1E5NA 4GI9A 1ITCA 3SUUA 3VPLA 1CBGA 1HN1A 3CZLA 1WDSA 1ZL1A 1XGZA 3U5UA 4WSKA 2E9LA 2Y2WA 4GZIA 3WMCA 2DT3A 2CHNA 2YDQA 1LQ0A 1DEDA 5C70A 1PX3A 4U3AA 1IZJA 4OJYA 2PWEA 1KCLA 3UESA 3WMBA 5I3DA 2DSVA 5FL0A 3WD0A 1KBBA 2E9MA 2J25A 2BNJA 1E72M 1M7XA 4DUVA 2D22A 1US2A 5A8MA 5BXSA 1UR0A 1LG2A 2BY2A 3K8LA 2JALA 3VD7A 1UR1A 2XVPA 2FDMA 5JBEA 2JE8A 2D20A 3SUVA 3AHZA 3AIBA 1KFWA 1UD2A 1U33A 4JCLA 1QVBA 1W91A 1EH9A 1D3CA 4A4AA 4Z2GA 3RMEA 4WK9A 2WVTA 1VFMA 2XTKA 4PYSA 1J10A 1LG1A 1FP8A 4KGLA 2WLYA 1QBAA 5EMYA 4AISA 5C71A 3ALFA 1QI4A 4GKLA 2J8GA 1CEOA 2QV4A 5A6MA 3K8KA 5HOSA 3SCWA 4R5EA 4A3YA 3WUBA 3MU7A 1GJWA 3O2LA 3BCDA 4GQQA 1B9ZA 3NDYA 3UG4A 3KWXA 4S3KA 1J0ZA 2RGLA 2Y24A 3PHAA 3UR8A 2EPLX 3EDFA 2EPMX 1GVYA 4F9JA 1CZ1A 2OWWA 4PMXA 4DM2A 1QHZA 4NSBA 2ZUTA 3EMQA 1FH7A 4UFHA 1MYRA 1J18A 1ISYA 1DWGM 4U5IA 3WFZA 4W8LA 3D5HA 2QHAA 4UQEA 3AI0A 1H11A 3IK2A 3T08A 4MNMA 3CMJA 4JHOA 4W8AA 3CTTA 1JD9A 4P8XA 3VNZA 1XCXA 2ZXQA 3U57A 3ZJ7A 2VVNA 1OGBA 3AIQA 1KXHA 2XFFA 1HJQA 1D7FA 3GNPA 5JIWA 2VX6A 3OLGA 5LA2A 4B9YA 2WMJA 4D6EA 4HP5A 4HMCA 5A69A 4J3XA 4PTWA 5EFDA 4ZEPA 1GQJA 1UD3A 1E6NA 3T2PA 4M1RA 5I77A 2OYMA 3RILA 4TTUA 3CO4A 1HIZA 4FLQA 4JZ5A 2GK1A 2ZUMA 4U2ZA 1W9UA 2V3FA 4W7VA 3UG5A 1E15A 2YA0A 1E71M 4TVUA 4XV0A 3CUHA 4IPLA 5A6AA 1CXIA 3VD4A 3WKZA 1QI2A 3WDHA 4N42A 1JI1A 2YKKA 2GK1B 1B3YA 6CGTA 3VDAA 3AXHA 3W37A 4V27A 2ZXAA 4UQAA 3EDJA 2J7FA 1UD5A 2ZOXA 2W66A 4TUFA 2DT2A 2YL6A 2V5DA 1GOKA 3ALGA 3QHMA 1H0GA 1CGXA 3N12A 5HNNA 3CBWA 2OYKA 3T0BA 3WH5A 1DWHM 3SCQA 4BQ5A 2O9RA 1FOBA 3WD3A 2J79A 2DIEA 1L0PA 1JYVA 4QP0A 3VD9A 3SIMA 5BXTA 3W6LA 3VIMA 3AFBA 3HN3A 1OIFA 3PTQA 3GYCA 4B3LA 4W87A 3WNLA 3BSGA 2UWFA 3ARYA 2WW5A 2JEPA 5AC5A 2WCAA 3OBAA 1XD0A 4UFIA 5D8WA 2V38A 3RDKA 1ISWA 1PBGA 1JYXA 2XIIA 2G4FA 4B16A 3FXYA 3W82A 5KZ6A 2VT0A 2FH6A 5ECUA 5CLTA 2PB1A 1NOUA 4NF7A 4PN2A 1CWYA 4GO8A 1W1YA 3MSDA 3QOMA 4PTXA 4UFMA 4MDOA 5AYIA 2ZX7A 1SYTA 1A3HA 2WHMA 1LL7A 2BY3A 1BYCA 2OSXA 1OIMA 4X0NA 2X8RA 2E0PA 3GH5A 2WZHA 4GIAA 5DFAA 2EJ1A 3GBDA 1W2VA 5A6JA 3VGFA 2VRKA 4JFUA 1JZ5A 3QR3A 4CKQA 5HPOA 4WLCA 3CUJA 3WF1A 2IUZA 3D3AA 2E9BA 1FHLA 1GOOA 2NT1A 1EHNA 3UETA 3WN6A 3L4WA 4LYPA 1J9YA 5HDRA 1W1PA 2E4TA 5DT7A 5A95A 1C8YA 4JFTA 4BQ3A 1JI2A 4PTVA 1E6ZA 2WLZA 4FF5A 3AIVA 2XM2A 3OGRA 3PZGA 1CLVA 1MVYA 1BHGA 4JHZA 3BAIA 1GONA 3ARSA 4HA1A 2GVYA 5JUVA 1XH0A 1E6PA 5FL1A 1CDGA 1KR0A 3AHTA 1LWHA 2WC3A 3APGA 4F9DA 1XSKA 4ZE4A 1QBBA 1KXQA 2XGBA 3AS2A 3RIKA 1MW3A 3MMDA 3LPOA 1PZ2A 2A3EA 3M6DA 3AHVA 1H09A 1OINA 2ESCA 4H8VA 3WD1A 2D0HA 2ZX8A 1OSEA 1CGYA 2E8ZA 1UR2A 1E1EA 3F4VA 4PMRA 2G41A 4AMCA 1H41A 2Y8VA 3N11A 1LLOA 3ZIZA 3KEHA 2VZTA 1E3ZA 3CLWA 3WDJA 3QGVA 2F8QA 1ZB5A 3THDA 4J3SA 4AD5A 3NIYA 2WZIA 1DWFM 1UH2A 2PWFA 1LF1A 3RM9A 3I3EA 1A47A 2E8YA 4U3CA 1TVNA 1M03A 1XYZA 1WDQA 2UY4A 3W29A 4MAZA 2Y8KA 1VFUA 4LXFA 4AZ6A 1JZ2A 4MDPA 4LQ1A 2YA1A 4OUEA 3L4YA 1J11A 3NCOA 2WYSA 3MV01 1E0VA 3ZQ9A 4J27A 3MV11 4AD4A 3OLDA 2W67A 3U7BA 1JDDA 2QLYA 4F8XA 4WSJA 2CEQA 1TG7A 4PRWA 1B90A 3CHFA 2DSZA 3EMCA 5CPSA 5FIPA 2CPUA 1CXHA 3GBEA 5A6SA 3RM4A 3UR7A 1CXKA 3VGEA 5E0FA 1UKOA 3PZ9A 5BWFA 3J7HA 4HPGA 3WD2A 2BVTA 5E70A 2WMKA 4Z2JA 1R7OA 4LYRA 2ZUUA 3AICA 3WFLA 1GOMA 1CTNA 3W28A 1EDTA 3BSHA 1HJUA 1HVQA 3W25A 1WCGA 3BGAA 1XH1A 2NSXA 3LMYA 3DECA 1X6LA 3POHA 1V6VA 5BRPA 1XD1A 2EPOA 1W32A 4NI3A 3ZT5A 2VZSA 5A2AA 1BVNP 4AZHA 3EBVA 1Z32X 1UR9A 4B9ZA 3WL1A 1JZ7A 3CHCA 4CN6A 3WIJA 1PJ9A 3UEQA 3ARUA 3ZOAA 4Z2HA 3ZR5A 5GQBA 4UNIA 4GZJA 2BS9A 1Y7VA 1JNDA 1C7TA 1ZBKA 1ZU8A 2ZUNA 3AS0A 4M24A 1CIUA 3SCVA 3OIHA 3MUZ1 2A3HA 4D6IA 4H8UA 3F5LA 3WF3A 2W5FA 1VEMA 1R86A 5FOOA 3AMDA 1FH9A 2ZX9A 3UCQA 1UKPA 3VILA 4QAWA 3FHAA 3IJ8A 4JKKA 2VX7A 5E09A 4AD1A 3OLIA 2CXGA 3W53A 1B3VA 1WKYA 4M29A 1NP0A 3QHOA 1XSIA 1HKMA 5DF0A 3ARWA 1C8XA 1EO7A 1JD7A 3OB8A 2WHKA 3JUGA 2PWDA 1J0HA 3EYPA 3VTRA 2WM0A 5CZKA 4TOQA 1BYBA 1CGTA 4J3WA 3ZJ6A 2DQXA 3O6AA 4PMOA 1U30A 1MQQA 3BCFA 1FA2A 2X2YA 4JCMA 1JXJA 3N9KA 3PZNA 1K6AA 1AVAA 1RP9A 4KRTA 4P8WA 4P7NA 1TE1A 1VAHA 3WH9A 1JG9A 2UY5A 2XSBA 5AYBA 1R8LA 1JYWA 2QPSA 4MNLA 4ZXLA 2A3AA 2WMGA 2O9OA 1JZ4A 1M53A 3WF0A 2WZEA 1AQ0A 3AIRA 4CD4A 3MUY1 4LPCA 4UCFA 1JZ3A 2VZVA 4BA0A 1B3XA 1JF6A 1LWJA 5IDIA 4GZEA 2HVMA 4UQBA 4PBGA 2TAAA 2C0HA 2Z1KA 3A4AA 4Y7EA 1EGZA 2VQUA 1WP6A 3VX1A 4CD6A 5I23A 3BXWA 3ZR6A 2W4XA 2D0GA 5A3HA 1DWJM 4V2XA 3WNOA 2VR4A 1C8QA 4MB1A 3AZSA 2FHBA 1KWKA 4MB4A 2DSWA 2FHCA 2W91A 1Q4NX 4QLLA 3W38A 1C91A 4TVDA 1V02E 1Q6FA 5KEZA 2J7HA 4CN1A 2DSKA 3SURA 1I1XA 3KL5A 2CKRA 2DIJA 3AIEA 3GM8A 4W7WA 1RH9A 1QNRA 2CIPA 2OLHA 1NH6A 1CGWA 1SR0A 2WCGA 1KGUA 1V3LA 1K9TA 1I1WA 5ABGA 4C7FA 2PC8A 2BHYA 5BRQA 2EPNA 1PAMA 3PZIA 3UG3A 4UFLA 3AHYA 1UZ4A 2WVUA 4D6GA 3FAWA 4NRSA 1KR1A 4UFKA 2QMKA 3ZSTA 1ISZA 1Q6EA 4J3TA 4M80A 4YN5A 4MTVA 4R27A 4S3JA 1VB9A 3SCUA 4CU7A 4U5KA 4HOZA 4HOXA 3SUTA 1MW1A 2WMIA 1MW0A 1TVPA 2Y5EA 3CHEA 4ACZA 2BHZA 2IXUA 1LL6A 4XX6A 4RE2A 1HXJA 4CGTA 4P7LA 4AEEA 2J77A 3AJ7A 3OG2A 2W63A 1CGVA 3F5KA 4JKMA 1C90A 2J4GA 4GO9A 2GSJA 3AS1A 5JBDA 1E0XA 1EQPA 5GPRA 2WMIB 4ZENA 5I78A 1E0WA 3MKKA 4ACZB 2YLLA 1UH3A 2EBNA 2GDUA 5I2UA 4QCEA 1E6RA 2BXZA 4AZ7A 1UWSA 1TMQA 1TUXA 1TCMA 2CBVA 1DWIM 1VF8A 3NSNA 3MMWA 2Y4SA 4WF7A 1J0JA 5M3WA 5JBFA 3FN9A 1WO2A 4LYQA 2WXDM 3SEPA 3WUGA 1JDCA 2C7FA 1OWQA 3WEZA 4H41A 3VINA 2WB5A 5IXEA 5CG0A 3VIHA 1W9BM 1B0IA 5A2CA 1MQRA 1MXGA 4CVWA 1NWUA 3GNOA 1X1NA 3BAXA 3DC0A 2XWDA 1H2JA 1HKIA 1OT1A 1RP8A 5CGTA 3A6OA 1G9HA 2E3ZA 1XCWA 4H7VA 4AD0A 3ECQA 4UFJA 1G1YA 1V3HA 1HKKA 4X0VA 4AD2A 3L4TA 3VIJA 3VOCA 4AC1X 4UQCA 4JL1A 4AY1A 3WQ6A 1AQHA 4HMDA 3ZJKA 3BAWA 1KGXA 4ATWA 4C7GA 2GJPA 1XH2A 1KQZA 4PSPA 4KH2A 4F66A 3DHPA 4CD5A 3B8SA 4EK7A 7A3HA 4HU8A 5IHRA 3ARRA 1ODZA 4HU0A 2YL8A 1JFHA 1JZ6A 4DWSC 5DO8A 4HA4A 1G5AA 4PMZA 1V6YA 1E55A 4X9YA 5F7UA 1CNVA 4TXEA 4UR9A 5A6BA 3VD3A 2UY3A 1V0MA 1OCQA 1ZBVA 4J3VA 2VUYA 1JAEA 1FH8A 3WUEA 1D2KA 3L2LA 2DSUA 6A3HA 2V5CA 1UHVA 4QFUA 4W8BA 4XZBA 4BZYA 1OGSA 3RCNA 3WQWA 2DH3A 5BCAA 4B15A 4L4OA 5DT5A 9CGTA 4CU8A 1UUQA 2G3MA 1NOFA 1NWRA 2JIWA 1KXTA 1OT2A 3ZMRA 5FCZA 1KCKA 4TTGA 1ZS2A 4P7QA 3ARTA 1N82A 1OD8A 1TZ7A 1DHKA 3OZOA 2YL5A 2WC7A 4GINA 1UOKA 8A3HA 5A8PA 3WD4A 4Z2KA 3VGHA 1OM0A 3PN8A 2GUYA 2DGAA 1CECA 3PZQA 4JFVA 1KWGA 5A1AA 3B9DA 2J78A 3QHNA 3W81A 1UA3A 2YLAA 5TD4A 2AAAA 2JEQA 3AYSA 3WMSA 1B31A 2VL4A 1WE5A 1LL4A 1O7AA 3PTMA 4J3UA 1GQLA 3VMOA 1HF6A 2CKSA 4AXNA 4OBRA 2J7BA 1GQIA 1E4NA 1EDGA 1K9DA 3HJEA 3G6LA 3LPFA 4E4PA 1NOWA 1OB0A 5M17A 1YQ2A 3WEOA 5E6ZA 3PZMA 2VI0A 1F4AA 4HZ7A 3GDBA 1XC6A 4HMEA 4WKHA 1Q6GA 2BV9A 3VM5A 1GCYA 2BY0A 5HXMA 3KE0A 3VGGA 3AMKA 4LX4A 2O92A 1W9PA 3GXIA 2F2HA 4MJ4A 4HZ6A 1W3HA 1EIBA 1V3IA 3B9EA 1PEZA 4D1JA 4PTMA 3IANA 3AMLA 1UG6A 2X1IA 4PMYA 5C8BB 3A4XA 1ZJAA 1GHRA 1HP5A 5IFTA 5I0DA 1UWIA 1X6NA 5CPTA 1V6XA 2J7DA 2A3CA 3WSUA 3VIIA 5AC4A 2CERA 4MB5A 3VM7A 1NARA 1V08A 4AZBA 5A6BD 3AHXA 1UD4A 1E73M 4GPNA 4TVCA 1CENA 1FFRA 3NUKA 3LPPA 4EE9A 1V03A 1K9FA 1VFFA 4IUGA 4KMQA 2WBGA 2JFEX 4D6FA 3GNRA 2OWCA 2VX4A 3A3HA 3KZSA 1F4HA 1DP0A 2J74A 1EQCA 3VD5A 3AS3A 1C3FA 5A8NA 1U2YA 1E1FA 3N15A 1HNYA 2CBUA 1C7SA 4AEFA 2WVVA 4AIEA 3WF2A 5HPCA 4ACYA 3ZO9A 5M03A 2O9PA 5DMYA 3TONA 1XV8A 2ZE0A 4QCFA 1VFOA 3WL0A 4HOWA 1P6WA 2WPGA 3BLPX 4M8UA 2WVVB 1GUVA 1J0IA 1R7AA 4PMUA 4NRRA 2D0FA 4AIOA 2YBUA 1OGGA 1FP9A 4QLJA 1E6SM 3SCPA 4FK9A 5I79A 2BVDA 3ARQA 4WKFA 2VR5A 1EXPA 5D9OA 3O9NA 2VTFA 1UWQA 3HU7A 3MMUA 3CIVA 3OLEA 3AZTA 3VMNA 4EAMA 1GJUA 1QI3A 1VJZA 4PUDA 1EO5A 3AOFA 1E5JA 3A47A 3PZTA 1UWTA 1XRVA 3CMGA 3DYMA 3GXMA 2JF7A 3II1A 2ZXBA 3I3DA 4CN4A 2EQDA 2EPKX 4P8VA 4P8UA 4RE3A 3K1DA 1WPCA 1WDPA 2BY1A 2XGIA 3WH8A 4CCDA 4PMVA 4ZFMA 1H0IA 2UY2A 3VGBA 1VENA 2GFTA 3N1AA 2PBGA 5BYWA 3WDIA 4ZE5A 1GZJA 1V0KA 1WZLA 1E56A 4V28A 1GOWA 5CXPA 5I24A 3FW6A 1UKQA 3EDKA 4JAWA 4H2CA 3W24A 5IFPA 4IM4A 3AROA 3VVGA 3WY1A 2WVSA 2NW0A 2PWHA 4OOZA 2OYLA 1CXLA 2PWGA 2EO7A 4CD8A 1QNPA 2X0YA 4PUEA 3AQUA 1EDQA 1IT0A 3ARPA 1HL9A 1WAWA 4AYSA 4GXPA 4N0RA 1BPLB 5A8OA 3SCRA 1HKJA 4W85A 3DYOA 2XSAA 4D1IA 4D6JA 2VCCA 3AIWA 3CH9A 5M5DA 1W9VA 4TX6A 1ECEA 1GNXA 1L8NA 7CGTA 4MADA 3VGDA 4DWSA 1SMAA 2WWDA 3QOKA 2FHFA 1ZJBA 3RM8A 5D9PA 1JZ8A 1NQ6A 3GH7A 3L4ZA 4UQDA 3VIKA 1H3GA 2VRJA 4UTFA 3W6MA 1K9EA 1BFNA 2VZUA 5CSUA 4DWSB 1E6XM 4EANA 4CCEA 1GORA 5LA0A 1ESWA 1H1NA 1HT6A 1BGAA 1E9LA 5AY7A 2G3IA 2YOCA 1GW1A 4LGXA 1BG4A 5CQ1A 2X0HA 1M01A 1CGUA 3M7SA 2VOTA 2XFYA 4CUCA 2DEPA 3AMGA 5A94A 3WQ4A 2WANA 3WNNA 4U33A 4MPKA 1KXVA 4HPHA 1H5VA 3TTQA 2AOSA 1UD6A 1VRXA 1ITXA 1MW2A 1TR1A 1OBAA 3W26A 4W84A 2PF0A 2D23A 1TA3A 3VIGA 1V3KA 1MFUA 2YJQA 3L4VA 1W3KA 3IAQA 4W5ZA 4BCEA 5DEZA 3E1F1 3VDCA 2VX5A 1J12A 5E0CA 2DH2A 3LPGA 3B9AA 4MAVA 3MUIA 4IPNB 1V6UA 2J7GA 5ABFA 1JDAA 2DT0A 1HX0A 4K68A 1TA3B 2ZUSA 1VEPA 1CPUA 3FY1A 1UH4A 3UERA 4ML4A 3AXXA 1BLIA 2O9TA 4C7DA 1QNSA 3EMZA 4D72A 1UWUA 1BVZA 5JIPA 1G94A 2ZUVA 3S6TA 1PX4A 3PZVA 3CZEA 4AZIA 3CZJA 5ABFB 4OIFA 2WK2A 3RJXA 1BG9A 2YIHA 1W2PA 1E4IA 1C92A 2A3BA 2VMFA 3WELA 3TTSA 2YBTA 2ZWYA 4MNJA 1W9DM 1QPKA 5D8ZA 3DYPA 3W27A 3SCSA 4YHGA 3G6MA 1E6QM 3ZT7A 4PEEA 1QHPA 2D3LA 2FGZA 3FAXA 4UZUA 1R87A 4AW7A 2ZUWA 1WDRA 3SUSA 3VDBA 3CPUA 5BXRA 4PMNA 4DWSD 2VNCA 1FHDA 3OGSA 4ATDA 3WUFA 2XIBA 3WENA 1UYQA 5CPQA 2PBOA 1RPKA 3T0AA 4P7OA 4OBSA 4FLOA 4OKDA 3CUIA 1UZ1A 4JIEA 1VIWA 1PPIA 1JL8A 4UOQA 4CCCA 2XG9A 4XB3A 2VURA 3VO0A 3PZUA 1B3WA 2WHJA 4D6CA 3VIOA 6TAAA 3VIFA 1QHOA 1YHTA 3POCA 2V3EA 4MJ2A 2D2OA 3OA5A 1V3MA 4Q7NA 2VCAA 2WCSA 2XM1A 3I3BA 3U5YA 4W5UA 2NT0A 1QNOA 2VZOA 1ZBWA 3BC9A 4W88A 2WC4A 3NSMA 3GZAA 3WBAA 1VBUA 4W86A 2VC9A 5GNYA 3F5JA 4Z2LA 1BTCA 3DHUA 3N13A 2QPUA 5A6KA 3VDHA 3VIPA 4U31A 2D3NA 2WBKA 5I5RA 3CZ8A 3EDEA 2XHYA 3T2QA 3VKKA 4W89A 4UOJA 3ARXA 4XUYA 1IZKA 2XYLA 4OOUA 2OSWA 2XJ7A 1E4LA 4DUWA 2DT1A 1XSJA 4BF7A 4RL3A 3WNMA 2WSKA 3PBGA 4H8HA 4NZCA 2D1ZA 4QLKA 2EEXA 4YHEA 4D6DA 4D6HA 2W92A 3NDZA 1JFXA 1NWSA 4DM1A 4E2OA 2WWCA 3TTOA 5E9AA 3GXDA 2VVSA 2YDRA 4U2YA 1JXKA 4WJXA 1VBRA 3RO8A 2RGMA 3KL3A 3SCOA 4UZSA 3IAPA 3WQ5A 4E8DA 2VO5A 2CBIA 3NYDA 1V0LA 5LA1A 2XUCA 4JL2A 4C90A 5CSYA 1EHAA 3WDQA 2VQTA 1PIGA 1NP2A 1J0KA 2QMJA 5HBFA 1H49A 1QI5A 4AZGA 4E8CA 4F79A 3PTKA 1BGGA 4KGJA 3BH4A 2OWXA 1HJVA 4TX8A 3AISA 1JAKA 5ABEA 2YDSA 1UR8A 2G3NA 4YPJA 3GXFA 5D9NA 2OSYA 2XVKA 2WMHA 2V3GA 2JF6A 2VRQA 3T2OA 1SFSA 1VEOA 3L4UA 2EXOA 3MS8A 5A8QA 2MANA 3WNPA 3A4WA 2DPEA 3PZOA 1O6IA 1JGIA 5BROA 2BFGA 3ZM8A 3BAKA 4JFWA 4PMDA 4D71A 2XFRA 2B31A 3NSXA 4WKAA 4CD7A 4MNKA 1DWAM 5I6SA 5E6YA 1S46A 1GOQA 2ZX5A 1NM9A 1HJXA 3KL0A 3OGVA 4P7RA 2J47A 1BYDA 3TP4A 3NJ3A 4A3HA 1OD0A 3RJYA 3VUPA 2XVLA 3VU2A 2AMGA 1R85A 4ATLA 2CESA 2GDVA 5ABHA 4H04A 1UR4A 1UKSA 3WF4A 4HZ8A 1PX8A 1E40A 1M04A 3MANA 1WB0A 1V0NA 3CZKA 4FLRA 2CHOA 2XVGA 1W9XA 4M82A 2W62A 1UWRA 1LJYA 2XPKA 3AZRA 4M56A 3K8MA 4M81A 1BQCA 4XZWA 5GNXA 4JFSA 1PZ3A 1QW8A 2WKLA 3ARVA 4BQ2A 4EKJA 3CHDA 1WZMA 3WBEA 3N17A 1CXFA 5D4YA 1SMDA 1G01A 3L4XA 2J75A 1WZKA 4HA3A 1W1VA 2PI6A 3M07A 4CVUA 2D24A 3GH4A 1BSIA 1US3A 1VJSA 3GTNA 2YA2A 5D9MA 1GPFA 2J7EA 4IISA 5FD0A 1KGWA 3SCNA 2YL9A 2G8ZA 1GQKA 1C93A 3IJ7A 1JNEA 2DDXA 3MUAA 5CLWA 2WHLA 3SUWA 3THCA 5GNZA 3WQVA 5A6LA 1MWOA 5CGMA 2ZIDA 3FNDA 2VCBA 2FGLA 2V3DA 1QW9A 4C91A 1AMYA 3IJ9A 1XHGA 1JIBA 4AZ5A 1PIFA 1WNOA 3N04A 2QF8A 4CU6A 3BLKA 4AD3A 2Q8XA 2Z1SA 1XYFA 3K46A 4KWUA 2CITA 1W3LA 4Z2IA 2J7CA 1UA7A 1CLXA 5FKYA 1B1YA 1WZAA 2FH8A 2J62A 3AXIA 1KB3A 2CYGA 3T09A 5BXPA 1B30A 3CUGA 2G3JA 3MSGA 1W1TA 3CUFA 1AQMA 1EA9C 4PCTA 3RPMA 1V3JA 4B3KA 8CGTA 4KRUA 5EFFA 4UOZA 4PMQA 1UQYA 3L2MA 1FFQA 4ZXOA 2ZWZA 2JIEA 1QOXA 1BYAA 2CETA 1KQYA 1B3ZA 4OZOA 1QI0A 1CXEA 2E40A 3ARZA 1V6WA 4W7UA 4BQ4A 1MXDA 2BVYA 4L4PA 1ISXA 3ZSSA 3WEMA 1KBKA 1HJSA 3BAJA 1UKTA 3FHQA 3AIUA 1E3XA 1V02A 1E4MM 4AZCA 4J28A 3M46A 1Q6DA 3ZT6A 1B2YA 4GI8A 3BMVA 2F61A 2GJRA 4GQRA 1E43A 2WSPA 3W4RA 2BHUA 4Q22A 1ISVA 1G0CA 4AZCB 3OZPA 1BAGA 1HL8A 3VMPA 3WNKA 2W61A 1BF2A 3EDDA 1J0YA 5EB8A 1UD8A 4HTYA 1ZBCA 3VNYA 2XWEA 3WDRA 4URIA 2ZX6A 1EOKA 2C8NA 1GOIA 3CGTA 2J8FA 1RD6A 3U7VA 4AWEA 4PSRA 2WMFA 1HVXA 1DTUA 1EOMA 1I75A 1MQPA 2X09A 4FMVA 1E70M 3AMCA 3W0KA 2IXVA 1J01A 2WAGA 4JKLA 3MO4A 1UQZA 1HJWA 1IV8A 4W93A 4UQ9A 4RE4A 1TFVA 3TOPA 3T0DA 2CNCA 3K4DA 4GI6A 7TAAA 1NWTA 2CCRA 3TTYA 5CJ5A 3S2CA 3ZJ8A 4PCSA 2BXYA 3VX0A 5IHSA 3SCTA 1MFVA 1QNQA 2ZXDA 2WKGA 3N18A 3WH7A 4WIWA 5EBAA 2GJXA 1W3JA
chains in the Genus database with same CATH superfamily
3EOUA 1VR6A 3SRFA 5JVLA 4IHCA 3G0XA 3V4BA 5LYRA 4ZSUA 4K3ZA 1EEXA 1XLGA 1GPWA 3KRSA 3E38A 4DUXA 4HYVA 3GIYA 2JKPA 2INFA 3SUUA 4YCPA 3CZLA 1WDSA 1XGZA 3MSRA 4E2VA 5KZEA 4WSKA 3TV8A 1LP6A 3W1LA 3B06A 4HNNA 1F73A 4R34A 4HGXA 4HN8A 2SFPA 5C70A 1SM9A 3L9CA 3RRXA 2PWEA 5I3DA 2PD5A 1OEPA 1TMHA 2DSVA 2Z24A 5FL0A 4F4RA 3GHRA 2BNJA 1M7XA 2V81A 3V75A 4JPGA 4RX0A 3GC2A 1CLKA 1TB3A 2X1RA 3K8LA 4WX2A 2JALA 3VD7A 2XVPA 3W75A 4DZIA 4GZ7A 3SUVA 3AIBA 1UD2A 4Z2GA 1QO2A 4A4AA 4IQDA 4WK9A 2CLOA 4UTIA 2XTKA 1P5BA 1E1CB 1J10A 3KRUA 1XQKA 2ON3A 4GKLA 3K2GA 1CEOA 2QV4A 3TTEA 5HOSA 3SCWA 5CJNA 1KNWA 4A3YA 2GDQA 2L5HA 3WUBA 1GJWA 3O2LA 4Y9MA 4GQQA 4G8TA 3KWXA 4H9XA 3BICA 2RGLA 2Y24A 3PHAA 3QZ6A 3LI1A 2EPLX 5G1MA 2OG9A 3R58A 6PTDA 5AHLA 4LFYA 1GVYA 4F9JA 3SQLA 3UZXA 1QHZA 2GWGA 4X9SA 1UB3A 3BGGA 1DWGM 1DKWA 4NXKA 4FA3A 1CB2A 4HYRA 2A2IA 5EU9A 4MNMA 1LBFA 2OLAA 4W8AA 3CTTA 1JD9A 4MY8A 3L7RA 4RNHA 2AGTA 4PZVA 1UP3A 1OFQA 4G7EB 3D6NA 4B90A 2Y62A 3U4FA 2XFFA 1HJQA 3P93A 3GNPA 2VX6A 4EVZA 4D6EA 1J2BA 4HP5A 4NX0A 2QCNA 3JZEA 4OECA 1GQJA 1W1IE 3RX4A 4BKNA 4KERA 1GEHA 2HZGA 3KOWA 4M1RA 5DXYA 3RILA 5I77A 4FLQA 3MI3A 4U2ZA 3W7CA 3QSRA 3SY8A 5FJPA 3UG5A 2ZZ6A 1CXIA 5T26A 3N2BA 2OOGA 3NG3A 4F2UA 3RK8A 5E9XA 1B3YA 3AXHA 4DJDA 4LY8A 3WLSA 3KBMA 4UQAA 3CL8A 5D05A 2C1HA 2P88A 2ZA1A 1YE6A 3TFCA 1XIMA 1AL8A 4WDUA 5HMSA 5D2TA 2YL6A 1FVPA 2P8BA 2V5DA 2CLPA 1LOQA 3QHMA 3T8QA 5AFDA 4EIVA 1GVFA 4IIGA 4NNBA 5FACA 3NM1A 1DWHM 1TTPA 5DELA 1L6WA 1L0PA 2R1LA 4AF0A 4B5XA 3FSUA 3Q94A 1X1OA 4L1XA 3W6LA 3AFBA 1OIFA 3PTQA 2E6FA 4R7OA 3BLOA 3IGSA 4JEQA 5DRIA 3WNLA 4N6FA 1XD0A 3RDKA 2Y5SA 1JYXA 3EXTA 2XIIA 1KW1A 3CQ0A 3DOPA 2FH6A 4O1BA 5CLTA 1TV5A 3H2FA 1XI3A 3NQ2A 3QOMA 4PTXA 1DJQA 3V5OA 5AYIA 1TQJA 1YADA 1S3HA 1FCBA 2ZX7A 3LHWA 1XGEA 2VOMA 4YTUA 4JN8A 3NQAA 1X8FA 2EJ1A 1J96A 3GBDA 4O1DA 4PUUA 2XN2A 3W01A 5A6JA 3VGFA 1HZYA 2C3ZA 2C15A 3EXSA 3QR3A 3CUJA 2Y7DA 3NWRA 1TPVA 3P62A 5FJUA 1A5OC 1OF8A 2ZA3A 3UETA 3WN6A 3PSWA 3GHSA 1LORA 3TC6A 3NXLA 1C8YA 1UJPA 3UNDA 1E6ZA 2WLZA 3OVRA 2PDCA 3BVJA 3S5SA 1BHGA 1UR3M 4L5ZA 1GONA 2VGBA 3H55A 2CLLA 1EWDA 2YZ5A 3APGA 1QBBA 4TO8A 4UMAA 1FWCC 3A24A 1MW3A 3MMDA 1PZ2A 4FNTA 1H09A 1OINA 4FNPA 5DMNA 2D0HA 3NURA 3H22A 2E8ZA 3T55A 4LTSA 4ZZ9A 3E0IA 3ERPA 4I7UA 2HK0A 5E93A 1BSLA 1V7YA 2A6NA 3LENA 2G41A 1TWIA 2PDXA 4GOAA 3P14A 4JOMA 2C18A 2ZRUA 3N11A 5SWUA 1MDLA 1W3IA 3CLWA 4J3SA 3OP2A 3LCFA 4AD5A 1PDZA 2PWFA 4U3CA 1TVNA 3S47A 1EF3A 1XYZA 4ZQRA 4HSOA 3BW3A 1VFUA 4AZ6A 4YVVA 4MDPA 2YR1A 5AHIA 3W73A 1W3TA 3L4YA 4DELA 1QW7A 4J27A 1B3OA 3KFTA 4JIHA 4AD4A 4DLMA 1XL9A 2W67A 4WSJA 5B80A 4PRWA 1VYSX 4B5NA 1CXHA 1BD0A 4AHPA 3ZLFA 4NAEB 1JJKA 4Q33A 3RAOA 3RM4A 4DF2A 1CXKA 5FEXA 4E3VA 4ZBCA 1UKOA 4XBJA 4K37A 3W2KA 3NPVA 4HPGA 3NM3A 3DFTA 5E70A 1YPFA 3BOXA 3W85A 3WFLA 3EPMA 3QPZA 3FDKA 1CTNA 4QJ5B 4MUZA 3N9SA 3QSTA 1XRTA 1HJUA 2ZZ2A 1PKYA 3BSMA 4JTHA 1X6LA 5HR6A 1V6VA 3PB2A 1JPMA 1H5YA 3EX2A 1XD1A 2EPOA 1W32A 6XIMA 1RY8A 3B0XA 4AZHA 3SM0A 1EB3A 3FGCA 2HJPA 1UR9A 1PKNA 3BQ6A 2A7PA 3UZ5A 1XF0A 1UC4A 4I8DA 3ANVA 3MMTA 4P2VA 3R8GA 2ZZ4A 1V8EA 1JNDA 3AS0A 4M24A 4ZOCA 5D37A 3F5LA 2PRLA 3WF3A 3KS6A 1R86A 3EZ4A 3LB0A 1W5OA 2DZBA 1G7VA 1L6FA 2C1GA 3AMDA 1UKPA 3PP7A 4QDWA 4QAWA 4JKKA 2VX7A 1PCWA 1QATA 3S5OA 1KKRA 5D2YA 2E5CA 5C9UA 3ONCA 1XLMA 5J5DA 3NQ8A 1S38A 1HKMA 1BKHA 1P7TB 3VOHA 3Q4DA 3ARWA 3EKZA 4XIMA 5BOOA 4GWEA 4IMEA 3ZJ6A 5CC5A 4O50A 2X2YA 4JCMA 1I2RA 4LC6A 3PZNA 4G56A 4AVFA 2PC4A 4NZ3A 4P8WA 2EHHA 3WH9A 4DQWA 1PZ1A 2QJHA 2UY5A 1XG4A 3HQNA 1R8LA 4GQGA 4MNLA 4TV5A 1PDYA 3M7WA 1JZ4A 3VKJA 4ENLA 3AIRA 4CD4A 4WXYA 3MUY1 2B7QA 4UCFA 1YX1A 3N34A 4BA0A 1Q45A 1LWJA 4MJMA 4GZEA 1TWDA 2Z1KA 4Y7EA 2MNRA 1WP6A 3BXWA 4ZB5A 1DWJM 1OFEA 4US5D 5I3JA 1NSJA 1E9ZB 2FB2A 4MB1A 4KEUA 3AZSA 3C5QA 3NZGA 2WM1A 4GGBA 3E0WA 2BSLA 3KL5A 1EL3A 2G3FA 1V93A 1RH9A 2WJDA 1Z7AA 4UB9A 3MQTA 3O3RA 5C55A 3RRAA 1KGUA 3WLKX 2PC8A 2YCJA 3ZLGA 4IFKB 1JCNA 2PGWA 4GD0A 4GI4A 1KM6A 1UZ4A 3FAWA 4GRSA 4UFKA 3RITA 4N4PA 1GVOA 3NO3A 1SJBA 4YN5A 1VB9A 3SCUA 4U5KA 3MJMA 2WMIA 1HGYA 1NY1A 2BHZA 2IXUA 4XX6A 4RE2A 2JQXA 4EWJA 4P7LA 4AEEA 3W74A 1M6JA 1HO1A 5HUOA 4G7EA 4O0QA 1V4YA 4FX7A 3IJQA 2QAFA 1FWIC 3NQCA 3LA4A 3O6DA 3N2MA 2O55A 2VGFA 3M4HA 4FNQA 2Z1XA 4ILSA 4FS9A 2BXVA 4GUHA 3QV6A 1FDYA 1TCMA 4XD4A 2VEPA 3GDTA 1F3WA 4C1NA 2R14A 2W3ZA 3T6CA 3TQPA 4RLIA 5M3WA 1WO2A 3SEPA 4D8ZA 1JDCA 3H70A 1JULA 3QN3A 4DVOA 1K8XA 1YDOA 3AYVA 4H41A 2PP1A 3BOLA 3AYTA 4LEQA 4XAFA 2YXOA 3RPTA 4U28A 2PTDA 2XWDA 1HKIA 3FFSA 1OT1A 4HHMA 3A6OA 5CGTA 2E3ZA 3JZUA 4H7VA 2YXGA 3E49A 3S2NA 3ECQA 3TN3A 4UFJA 3PSVA 1V3HA 1WKDA 1Q7ZA 1VH7A 4M7SA 3VKBA 3QY8A 3C2EA 3R12A 1DXFA 5XINA 4AY1A 3S9IA 3BAWA 5XIAA 2GJPA 3M44A 4PSPA 4H00A 3M0ZA 3EWDA 4Q7IA 4NASA 4CD5A 4EK7A 4DYKA 4HU0A 1HGWA 5JQ9A 1UUOA 4AQLA 2HSAA 5IDZA 4M5PA 1G5AA 4PMZA 4I5UA 4YXGA 3DX5A 2AMXA 2QCHA 3S5YA 3AJXA 4Q7BA 3W71A 3OVQA 1OCQA 4XZ9A 4J3VA 2VUYA 1EBHA 1QAPA 1VBJA 3L2LA 3N3TA 4W8BA 3JW7A 6XIAA 3GY1A 4B15A 3NGJA 1CW2A 2G3MA 1NWRA 2Z00A 1KXTA 2DVUA 1OT2A 3ZMRA 1NFPA 3UNTA 2VHLA 3TQKA 2VR2A 1HUVA 3CV7A 1TTQA 3S1UA 4Q8UA 3U48A 3WD4A 3EOSA 1IIGA 2DUXA 3BJSA 5LIWX 3R0KA 2DGAA 3PPFA 1KWGA 3LQLA 3BV7A 1TR9A 3O16A 1U1HA 5TD4A 3WMSA 4IMDA 4K7VA 1WE5A 4RZ4A 5HJXA 1RQBA 2NZLA 1ZALA 2DV0A 1HF6A 1KKOA 2CKSA 3V0SA 1GQIA 1NFBA 1Y5XA 3HJEA 5DXXA 3G6LA 4RZ5A 4XVEA 2AL2A 5M17A 1VFLA 4O28A 4Z1DA 5T8GA 3A13A 4LF1A 2BOEX 2YPIA 4BWLA 4QROA 1XC6A 3O6YX 3NL5A 4OQVA 2ZRZA 1GCYA 4LBUA 3KE0A 1W9PA 3GXIA 4HZ6A 1EIBA 2DVXA 3I65A 1GW9A 1TV7A 3IANA 2WSQA 3F03K 2WSYA 2RDTA 3FIGA 2ISSA 4A8LA 1HP5A 5I0DA 3WQGA 5CPTA 1TRDA 1FWGC 4IXXA 7TIMA 3VIIA 1RZMA 4E38A 4MB5A 1A5UA 4GBDA 4YYFA 1UJQA 1KA9F 3W1UA 3WLLA 1CENA 1FFRA 3NUKA 4PFHA 2IQDA 1K9FA 1VFFA 2NQJA 4UNKA 1AW1A 1W6TA 1PTAA 3B05A 3W7GA 3BLEA 4RZ6A 1DP0A 4NY2A 3PAOA 2ZZ5A 5H91A 4GVGA 3AS3A 3RX2A 3SFKA 4A2SA 1FDZA 2CBUA 2NVDA 2O9PA 4LCQA 3TONA 3GYEA 1XV8A 3E5BA 2FYMA 3LSCA 2ZE0A 3IK4A 4JQ4A 3TLLA 4HOWA 3L0NA 3QKEA 3TZFA 3QMRA 4I7VA 1R7AA 3H7UA 2X1UA 4QR6A 1HKVA 5TIMA 1FP9A 4TU1A 1R9XA 1SO4A 3ARQA 3PPCA 2VD9A 3CV2A 4WKFA 2RKXA 2VR5A 2HNEA 2PDBA 1QWGA 2GL5A 3QTPA 1UWQA 1RALA 3STEA 3OLEA 4JBRA 4B91A 1VJZA 1SU5A 3AOFA 1UWTA 1XRVA 1KC7A 3II1A 2ZXBA 1E9IA 4AY8A 2EQDA 3RR4A 4DI9A 2EG8A 2XGIA 1MSSA 4JTCA 3VGBA 3N1AA 4WDTA 3GVVA 4ZE5A 4V28A 4NKCA 3R25A 1SPQA 3GR4A 1VCGA 1F76A 1ZGDA 3NPXA 2GGJA 3WY1A 1L2QA 1CXLA 1TTJA 1XDJA 3HURA 1YTKA 1H62A 4N0RA 1TWSA 1XCFA 2BBFA 4O54A 3LY0A 5LIXX 2D2HA 1PTGA 3N29A 3AIWA 3CH9A 1REQA 4BWLC 4GG9A 2UBPC 4MWAD 4TX6A 4UTHA 3BPWA 4MADA 1SMAA 3TN5A 4NYYA 3QOKA 3ENLA 2DW7A 3RM8A 2A85A 5D9PA 3MCMA 3GFXA 4GACA 4PRRA 3NOEA 4XG1A 4ZO9A 1XG3A 1H3GA 1K9EA 5G2HA 2VZUA 1IYXA 3AU6A 3TA6A 4J3ZA 1EXBA 2VM8A 3HPFA 3FV9A 2OGYA 4IFOA 3OZMA 1YPIA 2HROA 5FF7A 2YOCA 2X30A 2Q8LA 1I6NA 3UGRA 4LV4A 3CEUA 3L0GA 3QFEA 2PZ0A 2PSNA 2X0HA 2EKCA 1CGUA 3WBXA 1F3EA 5K9CA 2O4MA 3BLFA 1XLKA 1H5VA 3B9OA 1UD6A 3G22A 1ZSXA 4M0XA 5CBIA 1WAUA 2VFFA 3KCOA 4WQ6A 4GVHA 2D23A 3VIGA 1V3KA 2YJQA 3MYPA 3QKZA 3O07A 4XSLA 3SJNA 1S2WA 5IRPA 1WUFA 3G1SA 4W5ZA 1GK8A 3E1F1 3B8TA 2DZPA 5D2WA 4JX4A 3VNMA 3THAA 3GTIA 4K68A 3UWZA 4LUSB 1S2AA 1CPUA 4XAGA 3LTPA 5C7VA 4LUYA 3VZZA 1N8FA 4XO6A 4D72A 3TN4A 1Q8AA 1BRLB 5JIPA 2ZUVA 3SB0A 4HCLA 3KW3A 3PZVA 3ORWA 2R6OA 4IIBA 2GQAA 1Q6LA 2YIHA 1W2PA 1C92A 1PB0A 2QW5A 4DRSA 2DZAA 4R53A 2Z1BA 4MGGA 2QUMA 1QPKA 2ZTKA 3DYPA 3W27A 4O53A 4YHGA 3G6MA 4O13A 4AX7A 4PEEA 1QHPA 1XIFA 2D3LA 3DFYA 1GOXA 4UZUA 2XH2A 3RHGA 3I10A 5K7JA 1WDRA 3SUSA 4WZHA 1OF6A 5HUPA 1EPVA 3CPUA 2P3ZA 3WLOA 1M3UA 4ATDA 2Y7EA 3N14A 1EGVA 3HQPA 2E6DA 4LJ3A 4UBPC 1UZ1A 5CEWA 1EYWA 3KZPA 3H26A 2PF8A 4C1KA 3ABSA 1JPIA 4CCCA 1XYLA 2XG9A 3IUHA 4XB3A 5AYXA 1BWVA 1A5CA 4POCA 2ABBA 4Q8MA 2WHJA 4D6CA 1DJYA 1QHOA 1YHTA 3UCDA 4YTSA 2WV8A 1PKLA 1JCXA 1FWBC 1F8IA 3I3BA 2RAGA 2NT0A 3BC9A 5AHFA 2OQLA 3NSMA 3KCLA 1VBUA 3BCJA 5GNYA 3B03A 1HQTA 2H9AA 4Z2LA 1CT5A 1TV2A 3UXKA 4INFA 4DB7A 2NQHA 5LIYX 5I5RA 3CZ8A 3KUMA 2PLCA 4W89A 4XUYA 4LBRA 4X61A 2OOFA 1E4LA 2Y89A 1E0UA 3QQ1A 4UTJA 1OQFA 3UZZA 1R38A 2ALRA 4KW2A 1H7PA 4C6EA 2DZXA 2WSKA 5J5RA 4H8HA 1O5XA 4QLKA 5K2ZA 3GDMA 5TNVA 4D6HA 3OVGA 2W92A 3CWOX 5FEWA 4I9MA 4B3ZA 1JFXA 1IHIA 4N4QA 2GZXA 5KMYA 3RMJA 4E2OA 5E9AA 3UJ2A 4GH1A 3C8FA 1W5NA 2FPTA 4U2YA 2FZMA 3W1PA 3HMJG 2XIOA 3KL3A 3MI6A 3IAPA 3LCLA 3GUWA 3CTLA 2XGZA 2BOGX 5LZLA 3HFTA 3VCCA 1GZ1A 3TDFA 4C90A 5CSYA 3SECA 3C86A 2FMOA 2QMJA 1H49A 3LNPA 3CB8A 5CJMA 1F6YA 4Y8EA 3W72A 1J93A 3CM4A 5K9XA 2YDSA 5FSDC 4E2DA 3SR7A 3SW6A 5D9NA 2V3GA 2VC5A 2YB1A 2W79A 3LSBA 2JF6A 1L6YA 5AZ0A 1SFSA 1VEOA 5F2LA 3MS8A 1AW2A 4GY7A 2MANA 1GJPA 3S1WA 5HMFA 2DPEA 1F61A 4F48A 1MRAA 3UZJA 3VC5A 3M0IA 3DI0A 1KFKA 2DZSA 2HPMA 1A0CA 3NSXA 4LCRA 4WKAA 3RLHA 4MNKA 1OFRA 2ZX5A 4KWSA 3OGVA 2J47A 1JPDX 4A3HA 4B92A 1DJNA 2Z4GA 2XVLA 3VU2A 4OT7A 1R85A 3TZNA 4ATLA 5TAOA 5ABHA 4H04A 3G1RA 3WF4A 4HZ8A 5LNRA 3MANA 2Z2AA 1KM3A 4O14A 4CQDA 3G2GA 4DBDA 5D30A 3L5MA 3MUXA 2XVGA 5TBOA 2VENA 1T8XA 3SN0A 3G18A 1XLLA 3KVKA 4DBSA 1DPMA 3AZRA 3K8MA 4M81A 4YNGA 3LM7A 4JFSA 2QIWA 1Z8AA 4NZ4A 3S3GA 3QM3A 2QAPA 1XIEA 4MKVA 1G69A 2POTA 3RPDA 4DNHA 3GNNA 3LXAA 1ZFJA 1YW1A 2QDDA 3NO5A 1B4KA 2J75A 4HA3A 4DWDA 4FXSA 2ALDA 2VFGA 2CZ5A 2NUYA 2WJEA 3GH4A 3F2DA 2YA2A 1ECQA 4IISA 1KGWA 3DIPA 3PULA 4QE5A 1XRFA 1C93A 1A5SA 3HV9A 5DBTA 3MUAA 3WK0A 3SUWA 3THCA 3B0YA 4GNKB 3WQVA 1MWOA 3QGKC 1QJWA 3LZ3A 2VCBA 2FVLA 3I7RA 4MIMA 3TJLA 2FGLA 2V3DA 2NLIA 2WSRA 4O11A 4C91A 1JIBA 1PIFA 1WNOA 3N04A 3TR9A 4TMCA 2QF8A 2WKJA 3QV7A 3BLKA 3CQIA 3IARA 1XYFA 5AHMA 2JKAA 1MZRA 3CAVA 2E5DA 1UA7A 5FKYA 1M9HA 2YZRA 1KB3A 1K8YA 2CYGA 1VPQA 4JEJA 2RJHA 3CUGA 3HFYA 2G3JA 5HMDA 1EA9C 1EZ2A 1KLYA 3RPMA 3EWXA 3LG3A 1P0KA 1AH0A 2NQLA 2ACQA 3C0JA 2ZWZA 2JIEA 2Q3OA 3MYOA 1BYAA 2CETA 3IEBA 1IXPA 1QPQA 4DBWA 4OZOA 1G67A 3C4UA 1QI0A 2PTYA 2E40A 3ARZA 1V6WA 3WLRA 4W7UA 3W1QA 1MXDA 3LBMA 4L4PA 2WQDA 2QS8A 2BZNA 1FXPA 4IOTA 3WMLA 1MMFA 1O94A 3BAJA 1BTMA 4MY1A 4D9PA 2X16A 3AIUA 3EEZA 4YWIA 3M46A 3GAYA 3UWUA 1B2YA 3OTRA 1I8JA 3MHUA 4JTAA 5RUBA 4GQRA 3W4RA 2YXXA 1ISVA 4AC7C 4JIRA 3V1PA 1S2CA 3B0UX 3OZPA 1UW9A 1OCBA 1BAGA 1ALDA 2HQAA 3WNKA 2W61A 3EDDA 4LV9A 1EBGA 2PDMA 4NYUA 2OFJA 3VNYA 3EB3A 4H2HA 3WDRA 4URIA 3CGTA 3U7VA 1XBYA 2RUSA 3GG7A 1I75A 1DIEA 3XISA 2X09A 3EWYA 2Z2UA 2R1PA 3W0KA 4GNJA 3WQPA 4HG6B 3MO4A 5CAKA 1AJ2A 2YCLB 1IV8A 2I5QA 4W93A 4UQ9A 4FOKA 1XIGA 2V68A 1UZHA 3AU2A 1NWTA 3S2CA 4PCSA 1XIIA 3L0KA 3SCTA 8XIAA 2ZXDA 5EBAA 2F9RA 1EX5A 1KV5A 3OQ8A 2QJGA 3LMZA 3APTA 3THQA 1Q6CA 3BMWA 3CZGA 3P0WA 4FLSA 3A5FA 3TA9A 2GJXB 4O15A 1JYNA 5CZSA 3K4AA 3BAYA 5D2VA 1E5NA 2QVHA 3N2CA 1IXNA 3VPLA 1CBGA 3PVFA 1ZL1A 4O17A 1XKYA 3PJTA 2Y2WA 3MHGA 7XIMA 4HYWA 5I02A 1DHPA 1LQ0A 3R1ZA 2FTWA 3O6CA 4LAMA 4OJYA 3UESA 4PMJA 2NSOA 3TCSA 4H8NA 2NUXA 1M5WA 2E9MA 1EC8A 4QJ3B 1UR0A 4DYEA 2QCFA 2YYTA 3BOFA 1UR1A 4JS3A 4ZMGA 1OYCA 1V7AA 2P5NA 4JCLA 1U33A 1QVBA 1FP8A 4R7WA 5H8MA 2WLYA 5EMYA 2ZCGA 2C14A 1ZAJA 2AAMA 4S3BA 4L6OA 5FF2A 5HANA 1FCVA 2GVLA 5EJ1B 2DJLA 1Q2RA 3MU7A 1B9ZA 3NDYA 3MDUA 4CEXC 3VNKA 1J0ZA 1S5MA 3WK1A 4I90A 1POJA 2HEJA 1UUMA 3EDFA 2PDHA 1JCTA 3C6CA 5E5CA 3BZGA 5U7SA 4NSBA 2ZUTA 4KEZA 4UFHA 1MYRA 1RSCA 3WFZA 4W8LA 2QHAA 3NPWA 3AI0A 1H11A 3T08A 3CPGA 3CMJA 3W2NA 3VNZA 3DAQA 1N8IA 4HJFA 4O18A 1XCXA 2ZXQA 1DJWA 1TTIA 2H8XA 3ZJ7A 1VLWA 2B7OA 5EIYB 5JIWA 5LA2A 3URAA 2WMJA 1C9WA 3DKLA 1AJ0A 5AC7A 4ZEPA 3VOIA 3STPA 1ONXA 3DFQA 3P84A 3LHZA 2OYMA 4TTUA 2Y70A 4JZ5A 3A5VA 2EAWA 1EUNA 4NJIA 4IIFA 4TVUA 3CUHA 1NDVA 3WKZA 5HWMA 4N42A 2ODOA 2GK1B 1SZGA 1R5YA 4AEOA 6CGTA 1XLJA 1OC7A 1LQ2A 4HT3A 1XKJA 1UD5A 2ZOXA 4WY0B 5GVJA 5CG7A 1GOKA 1BVWA 4QQUA 4ZOEA 1BWKA 1RA0A 4KWVA 3N12A 2R1NA 3M9YA 1UBPC 3E3HA 1V79A 3K4WA 3T0BA 3WH5A 3SCQA 4ECLA 1FOBA 1A4MA 2XZ9A 1SO3A 2Y88A 2QCGA 4QP0A 3SIMA 5DCEA 5BXTA 5CBJA 4B5SA 1OX4B 3BLLA 4LUJA 4GBUA 2FTPA 5HINA 1YDVA 2PS2A 4W87A 4UTWC 5I7GA 2UWFA 3ARYA 2WW5A 2JEPA 3CMFA 5F1UA 3LRKA 2CW6A 5D8WA 4HNOA 4B16A 2V0TA 5KZMA 2QDHA 2VT0A 2GQ3A 1R2SA 2QCDA 2PTZA 4PN2A 1CWYA 4Q8PA 2PPGA 1W1YA 4L9YA 1NFGA 3CQHA 1A3HA 1Q4WA 1LL7A 2HTMA 2BY3A 2X8RA 5DFAA 3HTWA 2VRKA 9XIAA 1JZ5A 3DCPA 4DF1A 5BNKA 1KM4A 4LAOA 3NR0A 3KBWA 3USZA 1G4EA 2FIQA 4X22A 3P61A 1D9EA 1J9YA 2BLEA 1QO5A 2E28A 1OG6A 2X1SA 4CNNA 3ID7A 4JFTA 4O1FA 1YTDA 4PTVA 4IGNA 1XLAA 3F1QA 4F2TA 3VAVA 3PZGA 1OHLA 4AWSA 1NQKA 3WO8A 4XAZA 4JHZA 2V2CA 2A4AA 5FF3A 1XH0A 1E6PA 5FL1A 3AHTA 1WUEA 3LHVA 3O06A 4L9XA 2WC3A 3PJUA 4WUIA 1XSKA 4ZE4A 2R82A 2ZYFA 1KXQA 2XH7A 3RIKA 3LPOA 3QLLA 3MPGA 3L23A 4LC8A 1XWYA 3M6DA 1RVGA 1OG0A 3QW3A 2A7RA 2ESCA 1VCVA 2BGQA 2ZX8A 2CWXA 1OSEA 1CGYA 2HBXA 1UR2A 1EWEA 3A64A 3SO7A 3S5ZA 1IT8A 3NEVA 5MKGA 5HA7A 4JY9A 3W7HA 2HVNA 4LVAA 3B8VA 6ENLA 3P81A 1H41A 2Y8VA 1LLOA 3OG3A 3ZIZA 2VZTA 1PIIA 1E3ZA 1YKWA 3LGGA 1O60A 2YYUA 1VS1A 5FEPA 1UH2A 1U1JA 2MUCA 3E2VA 1A47A 3LRLA 3UJFA 1WDQA 3WBWA 2UY4A 3UYCA 1JUEA 2QULA 2YA1A 4B2DA 4ROQA 3NCOA 1E0VA 3ZQ9A 1RJRA 2F84A 1G4TA 3U7BA 7REQB 2QLYA 4F8XA 1ZY9A 2CEQA 1TV8A 1QCWA 3EMCA 5CPSA 3M64A 3TN6A 5FA5A 4XKYB 4QISA 4XK2A 2OO6A 4HJWA 4CEUC 5EY5A 4ZQOA 1YDYA 4K2SA 5E0FA 2YB4A 4LWWA 5BWFA 1O12A 3W88A 1S5WA 2WMKA 4WDXA 1XW8A 1PTDA 4Z2JA 1R7OA 2NV2A 2VEGA 3W28A 1WCGA 3FVDA 4REQB 2NQ9A 1Z6KA 1J6OA 2ZZ7A 4AHQA 4KS0A 6TIMA 1W54A 3ZT5A 2VZSA 3LV5A 1TPUA 1R3YA 3H2MA 5CZJA 1BVNP 3S4TA 3EBVA 4IMFA 4I5XA 1JZ7A 4CN6A 4FPSA 1KFBA 4IMGA 3FYPA 3ARUA 1SFJA 3LUTA 3D47A 3ZOAA 3ZR5A 5GQBA 1X98A 4GZJA 1Y7VA 2ZUNA 3C2YA 2RH9A 2CZDA 4IUOA 1Z48A 3OIHA 2QVNA 8TIMA 4O10A 3GVQA 4ZB2A 1VYRA 4DY1A 1IXOA 2X0SA 3VILA 3FHAA 1AG1O 1ICSA 3PBVA 5E09A 3FJNA 1OABA 1FWJC 3I4EA 3QHOA 3PR2A 2OKOA 1C8XA 4PC8A 4IG2B 4AMAA 2PWDA 1J0HA 3VTRA 5CZKA 3ITOA 1CGTA 5LHFA 1MRQA 4MLRA 2Z6JA 4J3WA 5H8PA 1R6WA 1IGWA 4PMOA 1U30A 3CT7A 3VUSA 4WJ8A 4FALA 3N9KA 1ADSA 5HWNA 2G50A 3B4YA 1K6AA 4GABA 1DOSA 4KRTA 1JG9A 4AUBA 5AYBA 4LUTB 3VZXA 1JYWA 3BW2A 3KTXA 4ZXLA 4Y9OA 2HDJA 3R0UA 2O9OA 4QXIA 4FNSA 2Z1VA 4WCJA 2AL1A 1UC5A 4LPCA 4YTQA 4K36A 1JZ3A 1B3XA 1WXJA 3N9RA 1A50A 4A05A 7ODCA 4UQBA 3A4JA 3DESA 4LS1A 3QQWA 1VBHA 4CD6A 5I23A 1Q85A 3WNOA 3JVAA 4L4MA 1ENUA 1OFBA 3DFOA 4GCAA 2FHBA 1KWKA 4A35A 2FHCA 3W38A 1C91A 4RUBA 1K3UA 4TVDA 1Q6FA 4I8YA 1KRBC 4CN1A 2DSKA 5HATA 1CI1A 4FOUA 3PUOA 3GNXA 1CX9A 1YNYA 1QNRA 2CIPA 2Z2BA 2AKMA 1GG0A 3W1NA 4D8AA 4YU1A 5ABGA 4C7FA 2G97A 1RAKA 1RY0A 5FAGA 3U6WA 2EPNA 2IKJA 3UG3A 3WQDA 2WVUA 1KR1A 3SN4A 3ZSTA 1ISZA 1Q6EA 3TNOA 4R9OA 4JQ2A 4MTVA 4HOZA 4HSHA 1POKA 1S39A 1DORA 5BU9A 1HXJA 1L8PA 2J77A 3AJ7A 1H1ZA 4I9JA 2TSYA 1CGVA 1MNZA 1TWWA 2DZUA 1XFBA 4JKMA 5HWJA 4GO9A 5EGRA 3WLJA 3M41A 5I78A 3NQBA 3MKKA 4ACZB 4R9XA 2EBNA 2E5BA 3PB0A 2WJFA 1Z69A 3PUGA 1E6RA 4AZ7A 1UWSA 1TMQA 2OZ8A 3RXZA 4Q3MA 1DYSA 1KO0A 2OTDA 3NSNA 2X40A 3R89A 1X1ZA 2Y4SA 3WLPA 1K70A 2ANUA 1YDNA 3WUGA 4KEMA 4PRTA 4R85A 3TVAA 2C7FA 4PUMA 3QVQA 3U4AA 1OWQA 1WDDA 3CH0A 3WEZA 4IQLA 3S6OA 3LCIA 3VINA 2WB5A 3RLVA 5CG0A 3VIHA 1W9BM 1B0IA 2OZ3A 1NU5A 3ZVIA 2C79A 5A2CA 4KRZA 1DE6A 2B4GA 1NWUA 3RU6A 2GYIA 4S39A 5CSRA 1DIDA 3EXRA 3GB6A 4QEHA 4J9JA 2A5HA 4GYFA 4AD0A 1ME9A 5AYZA 4A3UA 1HKKA 4X0VA 1QRQA 3W7RA 3L4TA 4UQCA 1FWEC 3CT2A 4ATWA 3AWOA 3MBDA 1H7XA 4GMEA 1UMYA 1OX4A 1XH2A 3UT0A 4KH2A 4F66A 3B8SA 1U5JA 3ARRA 1ODZA 2YL8A 2D2GA 1SQ7A 4HA4A 4AHOA 4X9YA 4YTTA 1CNVA 4TXEA 2YFNA 3N4AA 4UR9A 5A6BA 1DE5A 4ORIA 4DI8A 2C16A 6A3HA 2V5CA 4QFUA 2EJAA 3Q2DA 1D7KA 3PANA 3RCNA 2XH4A 4ONVA 5DT5A 1X38A 4AG0A 4C6MA 4HBKA 3WX7A 5I3KA 5FCZA 3MDWA 1QASA 4TTGA 1ZS2A 4HMNA 4K6AA 4FEZA 3TIMA 4FAMA 1N82A 1OD8A 3OZOA 2YL5A 3H4GA 2PRHA 3R11A 2Y7GA 5DX7A 5A8PA 3QC3A 4HVXA 3FA4A 4S2BA 2GUYA 3THUA 1CECA 2PE4A 3N2TA 6REQA 1WYIA 2J78A 1RUSA 4LAZA 4ZOAA 1JQVA 1Q13A 1SO5A 1GQLA 4MKSA 3S83A 3VMOA 4C6CA 2NWSA 4Z08A 1V5XA 2QDEA 1E4NA 5FJOA 1K9DA 4HZMA 1JCJA 4C6LA 4ZO8A 3LPFA 4RPPA 1NOWA 4E4PA 5FF0A 4OVXA 4UWMA 5F2GA 3WEOA 3MT1A 3MY9A 4PULA 2VI0A 3TLQA 1SJDA 4HZ7A 3GDBA 2FZNA 2H90A 4HMEA 1Q6GA 4RV8A 4WGXA 2BY0A 5HXMA 1QDSA 4NILA 3REQB 4LX4A 3TC7A 4B5UA 3H23A 5G2IA 3B9EA 4D1JA 4HTBA 1MNSA 3C0LA 5C8BB 4CQ8A 4F0LA 3LXBA 3MZ2A 3A4XA 1ZJAA 1GHRA 1UWIA 2E6AA 3WJYA 3U3HA 2OPJA 4JTJA 1SW7A 2J9XA 4ZTYA 1OY0A 3WSUA 5H8UA 1OVDA 2CERA 2PZNA 3T0CA 1DQXA 4US6A 3TCEA 1H61A 1IWAA 4GPNA 1DJGA 4LOCA 3LPPA 4EE9A 3BG3A 4IUGA 3SBFA 2OWCA 2VX4A 3A3HA 1GKPA 5D02A 1KRAC 4O8AA 1C7SA 3PBWA 3RNDA 4AEFA 1H7OA 2WVVA 3H6OA 5HPCA 4HB7A 5M03A 5E0KA 1JDFA 3IGUA 1VQTA 4ZO7A 1IXQA 3BQ5A 3DG6A 1FTXA 2R1MA 4MWAB 4O12A 5DY3A 3RCMA 3W7JA 3WL0A 4N6EA 2I17A 1GKRA 2J88A 4S3EA 4I9AA 4F2BA 2H8ZA 1PXGA 1IWBA 4PMUA 1YNPA 1VFHA 3P5ZA 4NRRA 2D0FA 1O5QA 4JNZA 2VFHA 1FWRA 1LDCA 4FK9A 5I79A 2BVDA 3GE7A 5REQA 1X8CA 1EXPA 4GGHA 2Q3RA 3O9NA 3QY7A 3WLQA 2PCEA 3MMUA 1XLEA 3AZTA 3VMNA 5LNWA 2GVEA 3PUDA 4WGHA 1GJUA 5G1TA 3NGFA 3A47A 1KM0A 1A4LA 1T41A 1F2JA 3CS2A 4H6QA 4CN4A 1KLZA 2EPKX 3STCA 4P8UA 1P4CA 2XN0A 4RE3A 3LHUA 3K1DA 3WG6A 4ZFMA 1FQ0A 2UY2A 1VENA 3WDIA 2GQ9A 1V0KA 5CXPA 4CQBA 2ZRVA 5I24A 3NNTA 2REQA 1UKQA 3EDKA 5DN1A 2Z27A 4O16A 2YW3A 3AROA 3FXGA 2NW0A 1C29A 2PWHA 2QXWA 2EPHA 1Q5MA 3DFSA 2X7VA 1QNPA 4D2JA 1EKOA 2YBVA 4MPQA 3TOYA 4F0MA 3HPXA 2C19A 2EG7A 3W1RA 4AY7A 1BPLB 5A8OA 2PU1A 1NEYA 1HKJA 1W17A 3M0LA 1S1PA 1JRBA 1QNVA 4Q4MA 5I09A 1L8NA 3EB2A 3UFYA 7CGTA 2PTXA 4DWSA 4CQAA 4BFAA 4LYKA 3I6RA 3W2UA 1IZCA 1ZP3A 4TX9A 4UQDA 5CSSA 4UCGA 1SJCA 2VRJA 1NJJA 4UTFA 3HIJA 4PTDA 1GWJA 1OYAA 3RYSA 3KBVA 2XINA 4C65A 5H6HA 3C61A 4CCEA 5LA0A 1ESWA 4HNUA 2V63A 1HT6A 3ZVHB 4UTTA 4QE4A 2G3IA 1P1MA 5CQ1A 2ZADA 4MLJA 4H6EA 1M01A 3SGGA 4DZAA 4PUWA 3EOLA 3UG8A 2VOTA 5GJMA 2DFAA 3GU9A 1UP0A 3QYSA 4GXWA 2I9EA 4NUWA 2WANA 4ASTA 3WNNA 5D04C 4MPKA 1KXVA 1GQNA 4DXVA 3TTQA 2QF7A 1OK4A 4U10A 2GUBA 5DCDA 4ADSA 4EWND 4BR1A 4EXAA 5K4XA 2XFWA 3PY2A 2D73A 1Y8BA 1OBAA 1J2WA 4F0HA 1TA3A 2ACSA 1MFUA 3L4VA 3GQYA 2NX3A 3G8EA 4IP5A 4NG3A 4ZTXA 4TIMA 1J12A 5E0CA 3PK7A 3UU0A 4PCPA 4B5VA 3B9AA 3MUIA 4QG6A 4HPNA 4IPNB 2J7GA 5ABFA 1YXYA 2V82A 1HX0A 3PG8A 1E0TA 1VEPA 2VFEA 1JEZA 1TVLA 3L65A 2VC6A 4ZOBA 1BLIA 1TQXA 1W37A 1QNSA 1TELA 3Q58A 3CQKA 5H1WA 1G94A 1KD0A 4EACA 3BW4A 4C60A 3MSYA 3FOKA 3JS3A 2KAUC 1E4IA 4UTLA 3DXIA 2CLMA 3KM8A 3SRHA 4DBUA 5CZ0A 3SCSA 1E6QM 3ZT7A 1IE7C 3FAXA 3P3BA 2OEMA 2QR6A 4AW7A 1KM1A 4J4KA 4MHBA 1XFCA 3D3FA 2VNCA 4L64A 3OGSA 5HJLA 2ZA2A 3BG9A 3LCWA 3P82A 3U2ZA 2XIBA 3RFAA 3WK2A 5CPQA 1RPKA 3PPHA 3T0AA 4JQ3A 4PR4A 4OBSA 1ZP4A 3CUIA 4QGCA 2I9UA 3W02A 1J5SA 4UOQA 5EMJA 4MY9A 3H8AA 3TYZA 2QUTA 2VURA 4B4HA 1FHUA 4P5UA 3VIOA 3VIFA 2V3EA 2HXUA 4MJ2A 3OA5A 5AYYA 1EEPA 3P8JA 3WLHA 2NV1A 3U5YA 2WCSA 3E0LA 4W5UA 4W88A 2WC4A 4Q32A 2CU0A 4W86A 3SIZA 1W5QA 4HNTA 5CPLA 4A2RA 3CV6A 3N13A 1AK5A 1U1UA 3VDHA 4GVIA 3VIPA 2D3NA 3W7OA 3QR0A 2WBKA 5B7YA 4WY0F 2V6AA 2XHYA 3EDEA 4O1AA 3VKKA 4OOUA 3R8HA 2OSWA 1JQXA 3TEVA 3MP4A 5GJNA 3GR8A 1JGMA 4GIEA 3UQNA 4IQEA 2DT1A 3T4CA 9XIMA 3QLDA 2OX4A 4BF7A 1P0BA 1DIOA 4WRHA 1Z44A 1AD1A 4C6JA 2W0UA 5LGXA 1TV3A 2IPGA 4YHEA 3SDOA 2DP3A 1TSIA 3CUXA 3O1NA 4FR1A 1NWSA 4YMZA 4XO7A 3QGAC 2WWCA 5AC8A 2VVSA 2YDRA 1RXOB 2H3DA 1VBRA 2RGMA 4AB4A 5LSMA 4YWSA 3C2OA 4UTTC 2CBIA 3HM7A 1R30A 1V0LA 5LA1A 4JL2A 2A7NA 1EHAA 4O57A 2VQTA 3F4CA 1I2NA 1ICQA 1TJ0A 5ENLA 3XINA 1NP2A 1J0KA 3F2CA 1QI5A 4AZGA 5CC6A 4E8CA 4C1LA 4GY0A 1BGGA 4KGJA 3JRKA 2Y63A 2OWXA 3DEQA 1XR2A 2QEZA 4TX8A 1LUCB 4Y9NA 1AZ1A 3UY7A 4V15A 1MEWA 2ZDRA 3RGTA 3DERA 3GXFA 1ONWA 3KBJA 1R3TA 1V51A 4L80A 5AKQA 3IIPA 3OZYA 1D8WA 4GKTA 4I6KA 2VRQA 2CFFA 3T2OA 3R5EA 4ALDA 3G1HA 4DJFA 3OJGA 1XLDA 1LRTA 1RHCA 4QSHA 4ZFCA 4IP4A 3PZOA 5FJIA 1JGIA 3EGJA 3FK4A 2PDJA 1YYAA 4XTIA 3W2LA 4UUIA 4DJEA 1P0NA 3W9ZA 4CD7A 4KCUA 3KBSA 1LT7A 3LM3A 3TP4A 1OD0A 3VUPA 5LIUX 5D32A 2F6KA 2CESA 2GDVA 2ZC8A 3W23A 5HULA 3T40A 1UKSA 4DIAA 1M04A 2NQZA 1WB0A 4HIBA 4FR6A 4IPJA 4MJZA 4FLRA 4PTNA 2CHOA 1VFTA 2ISVA 1W9XA 4C6OA 1EIXA 4LS2A 3ZWTA 2W62A 2P50A 1BQCA 4JR5A 4L6DA 1ZCOA 2IW0A 4MVAA 5GNXA 1PZ3A 3ARVA 4BQ2A 5AC6A 2NV9A 3KHJA 5D4YA 3R13A 1G01A 1ICPA 3L4XA 1WZKA 1H51A 1W1VA 1X97A 2PI6A 3M07A 2D24A 3GTNA 1N7KA 4GVFA 2OODA 2J7EA 1YEYA 3MP5A 3IWPA 5KZDA 3IJ7A 4F0RA 2Z29A 1JNEA 2ZQ0A 2DDXA 4QHRA 3W1XA 5GNZA 4ZO6A 5CGMA 4F0SA 3FNDA 3LHTA 2PDNA 1XIBA 4RDYA 3IIZA 1QW9A 4QE1A 2J9YA 1AMYA 1MEHA 1XHGA 3QW4B 2QJMA 1Q2SA 4E6MA 3DFPA 1RV8A 1KTCA 4JYDA 4DJDC 5LNSA 1O1HA 4PODA 3ICJA 3ZLHA 2CITA 1W3LA 1CLXA 1B1YA 4XAYA 2J62A 3UZWA 3ANUA 4UTMA 4XBKA 1W1TA 3FEQA 1TCDA 1AQMA 3B3DA 2HS8A 3W07A 2ISDA 4EP8C 3CASA 5EFFA 4X60A 1VPYA 1FFQA 2ZDSA 4I7WA 4ZCWA 1KQYA 1TIWA 3E74A 4DZHA 1CXEA 4YYCA 1TPWA 3W6YA 3L12A 2ATSA 4BQ4A 2PDIA 5LIKX 1QMLA 1KBKA 2PLMA 2J13A 2X2GA 1PL9A 4ES4A 3MWCA 3BUVA 4AZCA 1PCKA 4J28A 5CH9A 1AODA 1Q6DA 4GI8A 2J66A 4GY1A 4DNMA 4DJFC 2BHUA 3SAZA 1QOQA 1G0CA 2IKIA 1HL8A 4A8RA 2XIMA 1ZBCA 4MZ1A 3M0XA 2C8NA 4DPPA 2C91A 2WMFA 1HVXA 3N25A 4ZGYA 1EOMA 4XD3A 4J5NA 2DW6A 4OU1A 4WHBA 4FMVA 1Y5VA 2IXVA 2V8ZA 3LD5A 1H1YA 5JH1A 2GPTA 7TAAA 2CCRA 3W2JA 4NZ1A 1XP3A 1SZEA 3RO6A 1H50A 1QNQA 4HNLA 3NL6A 2O7QA 4WIWA 1W3JA 5EA9A 2CBJA 3V1HA 2LLEA 2F6UA 2HISA 4J1OA 3TW7A 4MB3A 1CYGA 3HMCA 2I5GA 1JF5A 1GHSA 5A2BA 5AB3A 4J7RA 3G1YA 4FNRA 2BODX 3WH6A 3G3DA 3LN3A 3AYRA 5JMUA 2X05A 1ODUA 4QDMA 3MKCA 4GI9A 1ITCA 4ML9A 3DH7A 3CL6A 1ZRQA 1YE4A 1RK5A 3H4WA 4GZIA 3TROA 2RFGA 4Q8OA 1A5NC 1MUCA 1FKWA 3KTSA 3GVWA 2YDQA 4QS5A 1RPXA 4KBXA 5BU6A 1TZ9A 1IZJA 5TF0A 3WZ0E 1SSDA 3PNUA 2V2HA 1AUSL 3QF0A 3LOTA 3WD0A 4PE8A 1KBBA 2J25A 3ZFHA 1E72M 2Q71A 1DL3A 1E1CA 3NQFA 1US2A 5A8MA 1RBLA 1ZJHA 1LG2A 2BY2A 3GHUA 2V5LA 2Y61A 2FDMA 5JBEA 4N9CA 1IEQA 4WDWA 1KFWA 4UR8A 3RMEA 4H9MA 2WVTA 4GUGA 1NDZA 4KGLA 1QBAA 2Z7GA 4AISA 3FKRA 2UZ9A 4GJ1A 4P00B 3LTYA 3F4NA 1QI4A 1TPFA 2DZVA 4HNVA 5A6MA 3GW0A 1VFSA 4R5EA 3TH6A 3TSDA 3SQSA 3BCDA 3UG4A 1C9DA 2YW4A 3M47A 4AWTA 3IV8A 1YMYA 4GFSA 4KESA 3SRKA 4IZGA 3UR8A 1XLHA 1YIXA 2V69A 2EPMX 1CZ1A 1G4SA 4PMXA 3GUGA 1R2TA 3VABA 1ISYA 4U5IA 3D5HA 4UQEA 3IK2A 3M5ZA 3K13A 4JHOA 4G5DA 4P8XA 3QMSA 3ZR4A 2QYGA 1KFJA 3TW9A 3U57A 1KFCA 4MF4A 2VVNA 1OGBA 4P02B 1KXHA 3NQVA 1D7FA 1GVSA 3OLGA 4B9YA 4DZ5A 5CCZA 3H2AA 5A69A 4J3XA 5EFDA 4A21A 4WSHA 1E6NA 4O19A 3T2PA 5BRBA 5KTLA 5M1TA 3CO4A 4PFMA 4C6IA 3GXPA 2NUWA 2VUNA 2XDFA 3L5LA 2V3FA 4W7VA 3I7QA 3K30A 1VYPX 2YA0A 1E71M 3LX9A 1F3XA 4IPLA 3AWNA 1M41A 4WXZA 4XQ6A 3VD4A 2YCIX 2NXHA 3W7NA 4Z42C 4RE0A 1XLCA 3ZYZA 1QI2A 3WDHA 4NIRA 2YKKA 1P48A 5DANA 3VDAA 2P0OA 3EDJA 2J7FA 3CV1A 3ELFA 4EPEC 3GIPA 4TUFA 2QT3A 4BI7A 5D2XA 3OOQA 1KFLA 3K1GA 2NWRA 1UCWA 4Y9PA 4M6QA 9RUBA 1H0GA 4IIEA 3C3NA 3VNJA 3CBWA 2OYKA 4BQ5A 2VEMA 3EKLA 3WD3A 4R33A 3HBLA 1A80A 1NAL1 2DIEA 2J79A 3P2VA 4XISA 2QV5A 3W7IA 1JYVA 4ADUA 4NZ5A 3B8UA 5LXXA 1A5BA 2GOUA 5G4HC 1OFAA 3GYCA 3GU2A 4B3LA 3BSGA 5AC5A 2WCAA 3OBAA 4UFIA 2V38A 3QMTA 1ISWA 1PBGA 2NXIA 2G4FA 4AF0B 4YVPA 1M7OA 2VDIA 3U2CA 5KZ6A 5ECUA 2GVJA 3WJXA 4BHYA 3HG5A 1DXEA 4NXSA 5BMXA 4NF7A 4GO8A 5XIMA 3MSDA 3AC0A 3P7YA 2WHMA 3AAMA 3H53A 1BYCA 2OSXA 1MO0A 3G1DA 4GYPA 3TW6A 4AAJA 2PA6A 3TQVA 1X96A 4AYGA 1NELA 4GIAA 1G4PA 1NF0A 3UPBA 1H7NA 1QT1A 3WF1A 2AQWA 3P60A 4L9ZA 1A0EA 2GLKA 3IRDA 2NT1A 1EHNA 1PKMA 1KM5A 3VZYA 3DBPA 4JN7A 3H2EA 3KBNA 3L4WA 2VDHA 5FSEC 1U22A 2Y5JA 3QPYA 5DT7A 5A95A 4BQ3A 1JI2A 3W3OA 3VYLA 1FRBA 4PGLA 2PDGA 1CLVA 4OV4A 3O8AA 1WBHA 2A3LA 3VE9A 1TPH1 1SFLA 3A9IA 3VFLA 2I57A 4LANA 3V36A 3IRSA 4HA1A 5JUVA 5DMMA 4LNCA 1QK2A 1E51A 5C2XA 1DQUA 3TR2A 2GGHA 3CUZA 3AS2A 3FLUA 1TV4A 4KFNA 4RJEA 1GVQA 3AHVA 3IJDA 1P1XA 3GS6A 4H8VA 3SRDA 4QG9A 5HAOA 3HJZA 2ZRWA 3QBUA 3UJRA 3NQEA 3UYIA 1R47A 3EAUA 4MUPA 4GIYA 4AMCA 2Q01A 5H2ZA 4HU4A 3KEHA 2F8QA 1ZB5A 1RQHA 3NIYA 2WZIA 1DWFM 3M0KA 5A8GA 2E8YA 1M03A 3CEPA 3W29A 2ZRXA 3EX4A 4FXFA 4LXFA 1W5PA 3GXTA 4XBSA 4NAEA 4LQ1A 3VI2A 3NO1A 2WYSA 3MV01 1BQGA 5ABTA 4DBEA 3OLDA 3KOZA 1JDDA 2FZDA 1QPOA 2IPJA 1TG7A 5FIPA 2DU2A 3GBEA 1B9BA 2R8WA 2CC0A 2BWGA 3KLLA 3VGEA 3EOOA 3C2VA 2BX7A 1WXYA 3PZ9A 1TX0A 3J7HA 1C8VA 1SZFA 5G5IA 1WOBA 4ERAA 5E1QA 1M1BA 1TRIA 2ZUUA 1B57A 2WOQA 1EDTA 3PBYA 2AQOA 1HVQA 4M6UA 4AU0A 1T0OA 2NSXA 3LMYA 3DECA 3POHA 5BRPA 4A3RA 3O63A 1O95A 4XSMA 1Q63A 2VEKA 3SGZA 3OODA 4IIDA 3WL1A 3CHCA 3WIJA 1PJ9A 3UEQA 4FIQA 2ZZ3A 1VP5A 2CWNA 1YXCA 3UVAA 3IV3A 1VRDA 1EA0A 4XD5A 3WFAA 1S5TA 3GNDA 3OBEA 3DGRA 4GYPC 1JDEA 1CIUA 1LWIA 1X39A 2XIQA 3FGCB 3SCVA 1A5AA 2A3HA 3DUGA 1AMKA 2OR2A 2H3BA 2V9DA 2W5FA 2Y1HA 4FSAA 2A79A 1P7TA 2ZX9A 1F7BA 3G77A 3QFWA 2P1FA 3B0PA 3TAOA 3IJ8A 4MWAE 1WDWA 4AD1A 4EPKA 3BJFA 2CXGA 3W53A 3TYBA 4PH6A 1WKYA 4M29A 1NP0A 3ZXWA 3TAKA 5CPNA 5C54A 4OGZA 4NVTA 4NJJA 5DF0A 2G96A 1AH3A 3OB8A 1IEXA 3JUGA 3EYPA 4FI4A 1B54A 1LTDA 4B2DD 4LBSA 3BLDA 1MQQA 3ABXA 4KEVA 1FA2A 2VGIA 3T1GA 1GGOA 1HW6A 3EA3A 4PEKA 5F2IA 7PTDA 1AVAA 3NQGA 1VAHA 2IPWA 2WNNA 3TQ0A 2XSBA 2EF9A 2QPSA 3HPAA 3SY5A 2A3AA 1MEIA 1A3WA 1M53A 1AQ0A 3GTFA 4CNPA 4M7TA 4CNSA 1JF6A 4O4VA 5IDIA 3R6IA 2TAAA 3LZ5A 5HQMA 3A4AA 2JGYA 1EGZA 2DVTA 3VX1A 3KCJA 3SSZA 3ZR6A 2D0GA 1DJHA 1HL2A 5A3HA 3IJIA 5I3IA 2DUZA 2VR4A 4LVDA 3QEZA 3U8GA 2CLEA 3W7EA 4NL1A 4JTTA 3UP8A 4EPBC 1OX5A 1Z3NA 2DSWA 1ZLPA 1Q4NX 1UP2A 5CBBA 1S1RA 5AN7A 5EKYA 3FJ4A 3VNLA 2J7HA 5L9FA 3G3MA 4IFKA 1HO4A 1I1XA 5C5YA 2CKRA 3N4EA 2DIJA 3GM8A 2OXNA 1K8ZA 3N6HA 2OLHA 4C6KA 1CGWA 3W1TA 2WCGA 2PRMA 1K9TA 2NX1A 1Q6RA 3GFYA 2Q6ZA 1EJSC 4S3FA 1T7LA 1XLFA 3PZIA 3TYAA 4JTGA 3AHYA 4XIAA 1KV8A 3UXDA 3U2EA 3KLKA 4NRSA 1XBXA 4ZA0A 1TREA 1XX1A 4J3TA 4M80A 4RNJA 4MG4A 3G1VA 4S3JA 3OBKA 1Q3NA 2ZC1A 3SUTA 3STGA 1MW1A 1MW0A 2Y5EA 3CHEA 1R9YA 3MHFA 3GHTA 1LL6A 2PTWA 4CGTA 1R3SA 2W63A 2PEVA 5T9CE 2BB0A 4GE8A 2GSJA 5AVHA 5F1VA 1E0XA 2WMIB 1K03A 3HGJA 1JPHA 2YLLA 4A6GA 1UH3A 3HGOA 4FO4A 3O05A 4QCEA 2TODA 2HWGA 4J2MA 1X7FA 4G2DA 4HK7A 2BXZA 3GDKA 4FNUA 4A3QA 1TUXA 3W86A 2CBVA 1DWIM 3A21A 3BK0A 4Z1AA 3S42A 2QJIA 4O1CA 4WF7A 1PWLA 2IQ0A 2EG6A 1VHCA 5JBFA 5KINA 3FN9A 3C52A 4DYJA 3VCNA 4DHGA 4KT2A 3TNBA 4LCSA 1W5MA 1MUWA 3WLNA 5LXEA 4C1NB 2IKHA 4Q4SA 2RHGA 4CVWA 4DAFA 2VGGA 3O15A 4A8IA 1FDJA 3WLTA 4YLWA 1S2UA 1G9HA 1XCWA 5HNTA 1TZZA 3M16A 1DJXA 4JTSA 4UMCA 5DMLA 3N2XA 4C6FA 1IQ8A 1TPDA 5GJPA 1DJZA 3VIJA 4AC1X 4LNYA 4JL1A 1RD5A 3WQ6A 1AQHA 4JIIX 4HMDA 1VZWA 1KGXA 2CLFA 3KP1A 4Q4OA 2PDFA 5I00A 1X6UA 5IHRA 4HK5A 4C6PA 3GIQA 4JYEA 1JFHA 2OVLA 1JZ6A 1XUUA 2YSWA 5DO8A 2GJNA 1E55A 2GQ8A 1EGMA 3F4WA 3N6JA 3C2FA 5F7UA 1UOZA 3R2GA 3VD3A 1EJUC 3W87A 4YIWA 1ZBVA 1JAEA 3WUEA 1D2KA 2DSUA 3FYYA 4V1YA 1UHVA 4Z1CA 3NYZA 4C6QA 4LSBA 3K5XA 4JTDA 4BZYA 1OGSA 4KPLA 3WQWA 3UY8A 4ICNA 1SVDA 3V5CA 4L4OA 9CGTA 4CU8A 1UUQA 3URNA 4KKXA 1NOFA 2JIWA 4UR7A 3OIXA 1KCKA 4J2PA 4MFDA 4P7QA 5DLCA 4RPQA 1RK6A 3B8IA 1UIOA 2F2KA 2HV5A 3URQA 1TZ7A 2WC7A 4GINA 1TIMA 3VOJA 4H6KA 4K7YA 4LAKA 4Z2KA 5L6UA 3MCNA 1OFDA 3PN8A 3NVDA 4ZSTA 4C5YA 3PZQA 4UTKA 4JFVA 2R91A 2BTMA 3B9DA 1XM3A 3EWWA 2EKGA 3W84A 2A0NA 3W81A 2YLAA 4IMCA 1FWWA 3AYSA 1EJTC 1LL4A 3PTMA 4J3UA 1JCYA 4OTKA 4AXNA 4OBRA 2J7BA 3H54A 1XLIA 1YQ2A 3B40A 3FEMA 4FZIA 5AHEA 4EOUA 1F4AA 1P43A 2R94A 1O5RA 4JHMA 2BV9A 2OX1A 4GLEA 3VM5A 1ZJIA 3MVIA 3AMKA 2AL2B 4KWOA 1W3HA 1D8CA 4C6BA 1GYNA 4FX8A 2WPBA 4PTMA 2X1IA 3WJSA 1ADDA 4PBEA 1J4EA 2W6RA 5IFTA 3UXAA 3M5VA 1FCUA 2PWVA 1XINA 4L65A 2J7DA 2A3CA 4RKAA 2X7WA 3MTWA 4LEFA 5AC4A 4NJHA 2QJNA 2Z26A 3LLDA 1NARA 1V08A 4IF2A 5A6BD 3AHXA 4TVCA 1YRRA 4ROPA 1V03A 3T78A 2PDKA 2WBGA 2H6RA 3KOFA 2PAJA 3GNRA 1PZ0A 3KZSA 4RNFA 3BJTA 4KWWA 4I5RA 4JDBA 1EQCA 3VD5A 2R1KA 3DHFA 1C3FA 5A8NA 4IP7A 1E1FA 3N15A 3M0VA 4AXKA 1HNYA 3H2CA 4DO5A 4AIEA 3WF2A 3SADA 4ACYA 3GDRA 2HE8A 5DMYA 3IIOA 3EWCA 4QCFA 2BVWA 4OWGA 3IPWA 1VFOA 2PURA 2P3EA 3BLPX 3EX1A 5FAJA 1GUVA 1JPKA 3PM6A 1DVJA 4QG8A 3TJXA 2RDUA 4Q6JA 3U0HA 1W56A 3PFMA 4MOZA 4AIOA 4UXDA 2YBUA