1XH2A

Structure of the n298s variant of human pancreatic alpha-amylase complexed with chloride and acarbose
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 175
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xh2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xh2A01
1PZ2A 3WNLA 1ZU8A 4F66A 2J7EA 1D2KA 1H0GA 4CN4A 3EMZA 3GH5A 4M81A 2WBKA 3WL1A 2WVUA 4BZYA 4JAWA 1XCWA 1NWTA 1NWSA 4NZFA 2HISA 2VZOA 5GQBA 3RO8A 1OGBA 5CZKA 2XVLA 4J3SA 3CGTA 2X2IA 1UQYA 1UASA 2YOCA 4AYGA 3PZIA 3T0DA 1BYCA 2WCAA 3SCRA 1JG9A 3N04A 1EQCA 1W1VA 2O9TA 4BF7A 4UOZA 2BNJA 1VEMA 4PMQA 2YL8A 1GOOA 3CO4A 3N1AA 1W2VA 3MO4A 1EH9A 1LWJA 2ZX5A 2ZUUA 2ZOXA 1JZ3A 3L2MA 1TA3A 3AZRA 2J77A 1V08A 1ZB5A 2VVSA 3NUKA 4OZOA 3FN9A 3TV8A 1H49A 1GVIA 2BVDA 2JF6A 4OUEA 1CGXA 1BGGA 2VX5A 1MXDA 1ITXA 2WHMA 1MFVA 3N9KA 3THCA 1FP8A 2GFTA 3QOMA 1E43A 3K4AA 3UERA 2WBGA 4LX4A 2VO5A 2V38A 1GOWA 2XIBA 1E6NA 4HMEA 4M82A 1JZ5A 4AZCA 3OLGA 4Q22A 3ECQA 2IGTA 3ARUA 3D50A 2YA2A 3GTNA 4PMDA 3W53A 3VD7A 3WDJA 1MQQA 1TQUA 3BAXA 3RCNA 1EA9C 3AS3A 1IT0A 1V6VA 2J78A 5BCAA 5A2BA 3THDA 4UQ9A 1H11A 3EJQA 1AMYA 2F7PA 4W85A 2AMGA 3G6MA 4C7FA 4PMRA 1QPKA 3L4WA 2PI6A 3TTQA 1ZBCA 3D4ZA 4FNPA 3ZOAA 2PWGA 4FK9A 4B15A 1CNVA 2VURA 3PN8A 1WDPA 5BROA 4S3KA 3GNOA 1PEZA 2XFFA 2E8ZA 3VD9A 3AIWA 5D4YA 3CTTA 1UH2A 3SCQA 1UHVA 2G3JA 5EFDA 2EEXA 3OA5A 3OGVA 2XTKA 2V3FA 2G4FA 3I3DA 2W62A 4CCEA 2YDRA 3GXTA 4AMCA 1MFUA 2DQXA 1QOXA 1C92A 3BAYA 3WNPA 3OG2A 3LPPA 5AY7A 4DO5A 3MV11 4PN2A 3AIEA 2F1AA 3CZGA 3BLKA 3KLLA 5JIWA 3UR7A 1XC6A 3AIRA 1WP6A 1QWUA 4C7DA 1LQ0A 3IK2A 2CXGA 2EPNA 1EDQA 4TVCA 3W28A 5DT7A 1OCQA 1MYRA 2FH8A 3MUZ1 3TOPA 4X0VA 3F4VA 3VILA 1BHGA 4PMXA 1CEOA 4IM4A 2Y4SA 4A4AA 4D6EA 2OSYA 5IFPA 2XHYA 2D20A 5ABGA 3K46A 2GK1A 3AMKA 4UQDA 4MB3A 4CCDA 1UKOA 3GH4A 1UR0A 4GIAA 3FY1A 1J12A 1UWUA 4FNRA 4MNKA 4BQ5A 4TVDA 4CN1A 4UTFA 2NT1A 4J28A 4ZENA 1EDGA 4DUVA 4OKDA 3ZM8A 3IJ7A 3SCNA 1R7AA 4JFTA 2E8YA 5M3WA 2FGZA 4YN5A 3CUGA 2VTFA 1JDAA 3VGBA 1NARA 1H1NA 1K9FA 2GK1B 3SCPA 1HNYA 3CHEA 1TZ7A 2F61A 2WM0A 2NSXA 2WZEA 3VIHA 1JYWA 1VFOA 1ISVA 3VD4A 1J0YA 5IFTA 3AS2A 3FNDA 3S5ZA 2CERA 4D6GA 3NDYA 4CVUA 3AHYA 3KL3A 1E9LA 1K9TA 2C8NA 2YL9A 2CBUA 5DT5A 2DGAA 4LGXA 2YDSA 2WLZA 3K8MA 2QF8A 1JD7A 2ZXQA 4AEFA 1NQ6A 1QHPA 4Y7EA 3NIYA 2YBTA 3PZTA 4PTWA 3WY3A 4AD4A 2VZTA 1WPCA 1KXVA 2NT0A 4MB4A 3LRKA 2GJXA 4NRSA 2J62A 3VIIA 1B3ZA 1HJVA 2DDXA 1CGVA 2WCSA 1QVBA 4CN6A 4MJ4A 5A3HA 1PX8A 4HZ6A 3POCA 5HNNA 2D22A 1VEPA 3GBDA 1KCLA 4HPHA 4J27A 2FHBA 2BXZA 2J8FA 2WZIA 3VIOA 3ARZA 1LWHA 1R7OA 2D2OA 3WY2A 4L4PA 2DIEA 1GQIA 2EJ1A 2PWHA 1UWTA 2VJXA 2XVPA 3O2LA 2GJXB 4UNIA 4JFWA 3BAIA 3HMCA 3UCQA 5FCZA 1TMQA 2V3GA 4EE9A 3W24A 1RH9A 4ZFMA 4XV0A 4X9YA 4PTVA 3AMDA 4UQCA 4MDPA 1PZ3A 1E4MM 4B3LA 3IANA 8A3HA 3OIHA 4PCTA 3FW6A 2J7DA 5A2AA 4W5ZA 1FH9A 4K68A 1QI0A 4Z2JA 5A6JA 3ZR5A 3ZJ8A 1UR2A 3F5LA 4FF5A 4HTYA 1VB9A 3HJEA 4YPJA 3VGEA 4JKMA 4QLKA 4Z2LA 1UD2A 2WHKA 3BAWA 4UQEA 4UFJA 4B9ZA 2V5CA 2GDVA 5ABHA 3QHMA 3T2QA 2WMGA 1T0OA 3AS1A 3WIJA 1CWYA 2J7FA 3WQ5A 3K8KA 1GOIA 5JBEA 2CYGA 1QI2A 4HA4A 4U5KA 3OLEA 2YIHA 2X8RA 5FIPA 3KL5A 1GORA 1D7FA 1I75A 3GM8A 1GONA 2WMFA 2G3MA 1EHNA 5A95A 3VKKA 4PMVA 3WF1A 1FHLA 1LJYA 1M03A 1Q6GA 1W1YA 3ZQ9A 3VD5A 2UWFA 1UA3A 3ARYA 4MJ2A 3BMWA 4KH2A 2WMIB 2D3NA 1R87A 4Z2GA 5A6LA 1WZKA 4H2CA 4AZ7A 5EB8A 4P7RA 4GI8A 3DX0A 4M56A 3VINA 4QAWA 3WMSA 1CYGA 3SCWA 2JEPA 3E1F1 3PZUA 2IUZA 3HZ3A 3WUFA 2PWDA 2VZSA 1OGSA 2Y5EA 4HOWA 3A24A 4CCCA 5CLTA 1W32A 1E70M 5ABFA 3QHOA 5BXRA 1JXJA 5M17A 1M53A 1MVYA 2OW7A 3CUHA 2CETA 3VNZA 2W61A 3VSTA 1BAGA 3WY4A 4W93A 1DTUA 5EBAA 4W7WA 2ZX9A 1HKMA 3N12A 1BF2A 4CU8A 5HDRA 2E3ZA 2PWEA 2WWDA 4TXEA 2J4GA 4NXSA 3BUDA 5BRQA 3ARVA 2WCGA 3WENA 1E73M 3EYPA 3EDEA 1LL6A 3EJUA 2IXUA 1EOMA 3APGA 1OIFA 2BY1A 1LLOA 2PF0A 4PMOA 3WH6A 3GXNA 2GUYA 1HTYA 2GJPA 4BQ2A 1U30A 2XM2A 5DMYA 3EDDA 3RM4A 2FGLA 2WC7A 3O6AA 1DWAM 5I77A 1EHAA 5CXPA 3ARQA 2Y24A 1KWGA 2FHFA 2BY0A 4TTUA 2F18A 3VIGA 2AAAA 8CGTA 1E56A 2EABA 3VMNA 2WW5A 3SUUA 2F2HA 2FHCA 3RM9A 4AWEA 1HP5A 1WE5A 4EK7A 1CXHA 1C93A 2OYLA 2E4TA 1TVNA 2WHJA 1WDRA 4PBGA 3GXIA 1HJSA 5CQ1A 1XH1A 3AQUA 1SMAA 3VIFA 3SEPA 4OBSA 1HXJA 5BXSA 3QR3A 5JBDA 3RMEA 3A4WA 1H09A 2CKSA 1Q6DA 1LF1A 3NYDA 4KMQA 1V6XA 4FMVA 1VJZA 3WEZA 1TVPA 3FAXA 4CU7A 1B31A 4HU0A 5JUVA 1IZJA 5CLWA 1TG7A 4OOZA 1V03A 3VTRA 5JBFA 1UR9A 1W9BM 4WKFA 1VFFA 1CECA 5FKYA 5CG0A 1UD8A 2ZWZA 3F5KA 4W8AA 4MAZA 2O9RA 4S3JA 2WB5A 5I23A 1KQYA 1X6NA 1FP9A 2WVVA 2XWDA 3SUVA 3AZSA 2BS9A 4UZSA 1U2YA 5A8QA 3B9AA 5BXTA 7CGTA 1HX0A 2O92A 3PTMA 5BWFA 4AD2A 3PTQA 5GNYA 3CMGA 2C7FA 1G0CA 4AD0A 3SUSA 4DWSA 2ZXDA 1J0ZA 4AZGA 4PMUA 5A1AA 3J7HA 2UY3A 4D72A 3OBAA 2YA1A 2YL5A 3T09A 4KRTA 1O7DC 4GI9A 3BVWA 4HMCA 1HF6A 2W67A 1UUQA 1Q6EA 3VVGA 4D6DA 3BCFA 3MSDA 2BHYA 3CZ8A 1EGZA 4TTGA 7TAAA 1FA2A 5A8MA 3VU2A 3CUJA 1R85A 1V0NA 4M1RA 2YFOA 3D52A 3CHDA 3CIVA 4J3TA 2WPGA 1FFQA 3WD4A 3N11A 5E09A 2YA0A 3VM5A 1QHZA 3AHXA 1OT2A 4AISA 5D9OA 2UY4A 2DH3A 3A6OA 5C71A 4UOJA 1EOKA 1CDGA 2ZUMA 3U5YA 3W27A 2CNCA 4OBRA 2EPLX 3W29A 3OLIA 1C8QA 2EXOA 2ZUVA 1K6AA 2Z1KA 3SCTA 2WVTA 3A5VA 1VIWA 3LXAA 2VRJA 3TONA 1HL8A 3BXWA 1E0XA 1B9ZA 5GNZA 1LG1A 2CEQA 1E6ZA 1XD0A 3MV01 1WDSA 1G5AA 1KQZA 1R8LA 1XHGA 4GZEA 2VQTA 3FAWA 5LA2A 3DHPA 4MPKA 2BY2A 1GQKA 2G8ZA 5CJ5A 1UD4A 1DWGM 2E9MA 2VL4A 3ARTA 1BG9A 2CESA 1OIMA 2XVNA 5AYIA 1V0MA 3EDKA 5E70A 2BXYA 4DWSC 3WNKA 3AROA 4FNUA 2ZICA 4P8UA 1GPFA 5F7UA 3AXHA 2JEQA 3HG2A 1QNSA 3EBVA 1SZNA 3CZEA 4M8UA 4NI3A 3TTSA 4FLQA 3KL0A 4HA1A 1UKQA 2WKGA 1CENA 3S2CA 4EANA 4Q7NA 3BVVA 3OGSA 3QOKA 3UR8A 3PZMA 4W7UA 3S6TA 4FNSA 1GJWA 3TTYA 1UKSA 1DEDA 1ISZA 5I24A 1R34A 3HG3A 2XYLA 5A6BA 3KWXA 2XPKA 1E1EA 1P6WA 3N18A 3D51A 4JZ5A 1DHKA 2PWFA 2VRKA 3AHTA 3WSUA 3LXCA 2J75A 4AD3A 1UD5A 3NSMA 1B2YA 1VENA 2CIPA 3WDHA 2PB1A 2XSAA 1H2JA 1HJXA 1PPIA 3BUQA 3KLKA 4P8WA 3L4XA 1SMDA 3LPFA 4JL1A 1HVXA 1HJWA 1E71M 3DYOA 1PAMA 1QNOA 1TQVA 1KFWA 1ZS2A 4XB3A 4ATLA 2NW0A 1E5JA 4WKAA 3DX3A 3VMPA 1E55A 1CXLA 4HZ8A 1UR1A 5IDIA 3W26A 1WB0A 3N17A 4HP5A 3AIVA 4GZJA 3SIMA 3AMGA 2WMKA 3U7BA 1CLVA 5D8WA 1GNXA 5D9NA 4JFVA 4FLOA 1UG6A 1TQTA 4URIA 5E6ZA 1E0WA 4JCMA 1C8XA 3POHA 1W3JA 5FL1A 1JNDA 3ZT6A 1E6QM 4ZXLA 2ZX8A 3DC0A 2W92A 3TA9A 2OW6A 4AMXA 3SUWA 3BVUA 3WF2A 2XFYA 3WD3A 3HG4A 2VX4A 5FOOA 1RP8A 2YFNA 1V3MA 4WSKA 1WKYA 3II1A 3H53A 2DEPA 3F5JA 2QPSA 5E0FA 4HOZA 1O7AA 1JZ8A 1UR8A 2DIJA 2CHNA 2ZXBA 1UD6A 4AMWA 1J0JA 3AJ7A 3VDHA 1HN1A 1UD3A 2VRQA 2DSKA 4LYQA 1UWQA 4P7LA 4V27A 1JF6A 1YQ2A 4DM1A 4NXKA 2J79A 1XD1A 1E0VA 2B31A 1KBBA 2DH2A 3B8SA 3DDGA 1UKTA 3WNMA 2PC8A 4JCLA 2EPOA 3VOCA 3A4AA 1JI2A 1K9EA 3AS0A 1YHTA 3N15A 5HPCA 2WNWA 4ATDA 4A3HA 4GPNA 3EDFA 2VC9A 2W91A 3MU7A 3WUBA 5IHSA 1J10A 2WVSA 1V0LA 3EDJA 4H04A 2G41A 2X2YA 1ZL1A 4HZ7A 1CLXA 1UZ4A 4ZE5A 2W4XA 5D8ZA 3M7SA 1ISWA 1BPLB 2ALWA 4FLRA 3MUAA 3NJ3A 4W7VA 2QLYA 3WQWA 4PMZA 1GOKA 4D6HA 5FD0A 1N82A 1V6UA 3GXPA 3GDBA 4ACZA 4GQRA 2XJ7A 1XYFA 4PSPA 1W3LA 6CGTA 3AIQA 4H8HA 3WD0A 3PZ9A 1K9DA 1E40A 4AZHA 4A3YA 1E6XM 1I1XA 4JHOA 2C0HA 4QDMA 4H8VA 1S46A 4WSJA 2D0FA 1KGUA 3OZPA 2RGMA 3VDAA 1ITCA 5A8OA 1I1WA 3CZSA 1NWRA 4ACZB 1CXKA 2E9LA 1UZ1A 4X0NA 2OWXA 2VI0A 1DWIM 3WDQA 3BUPA 5HXMA 4PTMA 2XUCA 3OZOA 4NRRA 1DWFM 2FH6A 2VQUA 5CPQA 4LYRA 1QNRA 1HIZA 3GZAA 1VAHA 1QW8A 1J9YA 1UR4A 3AMCA 1PJ9A 4IPNB 3IJ8A 4AZBA 1VBUA 3DX1A 2WMIA 3PHAA 3SUTA 4B3KA 2DT2A 1EO5A 4TX6A 1WNOA 4JFUA 4MAVA 1LG2A 3UEQA 4BQ3A 2WC4A 3CHCA 1JFHA 3AMLA 1JI1A 3EJPA 1XRVA 4MNLA 2YBUA 1EQPA 1HL9A 4PCSA 4AZIA 2X2HA 1X6LA 1U33A 2V3EA 4DUXA 1B3WA 3FXYA 1ZJBA 1EIBA 2XSBA 4D71A 1R47A 4Z2HA 2F1BA 5DF0A 5HBFA 4MB1A 3RDKA 1KB3A 3BH4A 1CGWA 2ZUSA 2E0PA 1OGGA 5JIPA 2EBNA 3ZSSA 1KXQA 5EFFA 2PBOA 1GVYA 4U33A 1JGIA 2D24A 2WHLA 1CXFA 3M07A 4AEEA 3MSGA 1WDQA 1J01A 4J3WA 1D3CA 1QW9A 4WJXA 1JFXA 1UKPA 2ZXAA 2XG9A 4ZEPA 2EPKX 1OD8A 1E15A 2Z1SA 4UFKA 4D6JA 3WNOA 3BCDA 3T0BA 5GNXA 4PSRA 3VM7A 1CIUA 1M01A 4D1JA 2WAGA 2ZUNA 1UH3A 1ZBWA 4V28A 4WK9A 3VO0A 3G6LA 3GXMA 1CXEA 4PEEA 4BCEA 1W3KA 4IPLA 4ZXOA 2X05A 2D0GA 4H7VA 4CVWA 1QBAA 2J7CA 3L4TA 4MB5A 2XN1A 4H41A 3VDBA 3DX2A 2G3IA 3WUEA 3DDFA 3CUFA 2Y8KA 1HP4A 1QBBA 2D73A 3WH5A 1OB0A 2CCRA 2CBVA 4D1IA 1C7SA 3FHQA 4QLLA 1BYBA 3UG3A 3CC1A 4AIOA 2X0YA 3L4UA 3HU7A 1UWSA 2WSKA 2OLHA 2D3LA 1XSKA 2FDMA 3WQ4A 1BG4A 2DSWA 1KGWA 4WF7A 3RILA 1DP0A 3LX9A 1W9XA 4MNJA 2BVYA 1QWNA 3K1DA 1QI3A 3NSXA 3CV5A 3DYPA 3WDPP 1V02E 4YHGA 2XGBA 3WDRA 4MTVA 1VFMA 5LA0A 2PBGA 3LMYA 2X2JA 4XZBA 2Y8VA 2OYKA 3ZJ7A 3T2OA 4ATWA 2EACA 2BFGA 3UG4A 2OWWA 2UY2A 3M6DA 3WMBA 4KGJA 2BVTA 4CD6A 1M04A 3GXFA 3RJXA 4PYSA 3OGRA 1H5VA 3WD1A 1HVQA 1Q6FA 3AICA 4ACYA 1FHDA 1PX3A 3PBGA 4ML4A 3ZJKA 3O9NA 3H54A 4E8DA 3QGVA 1J11A 1OWQA 2VR4A 3CLWA 3WEOA 2DT0A 5ABEA 2X1IA 3VMOA 1JAKA 1C8YA 1SR0A 1JD9A 4IUGA 1E4IA 1UWIA 1E4NA 3GH7A 1GJUA 3WH9A 2ZX7A 3WL0A 3K4DA 1GOQA 1E5NA 3WBAA 4TVUA 1WZMA 1B90A 2ZIDA 3W38A 5E1QA 3VGFA 1XYZA 6A3HA 4F9DA 5DEZA 4F8XA 3ZMRA 2A3EA 1KBKA 1FOBA 1R86A 4B16A 4W87A 3KZSA 3CZNA 4AC1X 2E9BA 3VDCA 4R5EA 3T08A 1WZLA 1KTCA 3A47A 1QNQA 1W9VA 1JYXA 1GCYA 5C70A 1NM9A 1W91A 4E8CA 1RPKA 2Y2WA 2X09A 4YHEA 1CTNA 1QHOA 3OB8A 4IISA 5A6BD 1E4LA 1W9DM 1EXPA 1US3A 5BYWA 4P7NA 1PIFA 2FE0A 3NSNA 3WFLA 2A3CA 1H0IA 1CGUA 3A21A 4BS0A 2BV9A 1JIBA 4QLJA 1VRXA 3BAKA 5A94A 4QCEA 4UFIA 3AZTA 3WNNA 5D9MA 1PS3A 1B3XA 1V3IA 5E9AA 2YDQA 3I3BA 2AOSA 3MMDA 3VSVA 1SYTA 1Y7VA 1RP9A 1C7TA 3WF3A 4UOQA 4CUCA 1GQLA 4XX6A 1DWHM 1HKIA 4NF7A 4UQBA 3N13A 1NP0A 4F79A 2W63A 2J7BA 1G01A 3AHZA 4GKLA 1QI4A 2JIWA 4GINA 4AIEA 1TR1A 3IAQA 4UR9A 1JL8A 1R33A 2XVKA 3L4VA 1TUXA 1UYQA 4LQ1A 3CZKA 3KE0A 2XVGA 4QFUA 5A6MA 1BGAA 3BUBA 1VEOA 2IXVA 5I78A 4D6CA 3W82A 1J0HA 3WQ8A 4FNQA 2DSUA 5E6YA 5CPTA 4UCFA 3OLDA 5FL0A 4JL2A 4BQ4A 4AY1A 2VR5A 4HOXA 3MKKA 4KRUA 3LRLA 2XIIA 5A8PA 1WAWA 1E6RA 1B1YA 3VNYA 3W25A 5CPSA 1LL7A 4GI6A 3GNPA 1NOFA 1JZ6A 3ARWA 3SCSA 4OGZA 1E6SM 1MW2A 1ZBKA 3WUGA 3LPGA 2VUYA 4UFLA 1JDDA 2ZUTA 1NH6A 5D9PA 3IGUA 4WKHA 1NOUA 5EMYA 4HU8A 4PMNA 2VX7A 3GXDA 1TA3B 2GDUA 3BVXA 4QCFA 2J8GA 3MANA 1C3FA 2YJQA 5AC5A 3CUIA 1UQZA 3S5YA 4FLSA 3L4ZA 5CSUA 3CZJA 4NSBA 3WN6A 4U31A 2RGLA 1G9HA 2F7OA 1HWWA 2JALA 3MUY1 3WH8A 4AZCB 1B3YA 2XM1A 1VJSA 1A3HA 4NZJA 1BYAA 4L4OA 1ISXA 4Z2IA 3RJYA 3MI6A 2FYVA 2CHOA 1M7XA 1LL4A 3WELA 3GBEA 1OSEA 5M03A 3EJTA 4J7RA 3WQ6A 1ZJAA 4E2OA 4KWUA 5CGMA 3W6MA 5A6AA 1H4PA 3W37A 1KR1A 4CD5A 2J47A 1H41A 2XWEA 1Q4NX 1TCMA 1Z32X 4JIEA 4PMYA 3ARPA 3W0KA 3WD2A 1PBGA 2Q8XA 5C8BB 1ODUA 4AYSA 1GOMA 2XN0A 4AD1A 1AQMA 1BLIA 1PIGA 3VGHA 1O6IA 2CPUA 3SCVA 2WSPA 3BVTA 1XH0A 3AXIA 3T0AA 2O9OA 2X0HA 4W5UA 3VIKA 3HN3A 4P8XA 7A3HA 1G94A 2V3DA 3L2LA 3VGGA 2WXDM 3CMJA 2GJRA 3U5UA 1W1TA 1XSIA 2ZE0A 3CZLA 1XV8A 2VZUA 5A69A 2O9PA 1GQJA 1HT6A 1TQSA 1J18A 1E1FA 1MQPA 3VUPA 1NP2A 1RD6A 4U3CA 2VCAA 2VCBA 3VIMA 1BQCA 2HVMA 4RE2A 2CBIA 1HJUA 5LA1A 4F9JA 1X1NA 2OWCA 3AOFA 1R75A 1UH4A 3BLPX 1JXKA 4AIUA 3CHFA 3BUIA 5I3DA 3VIJA 1H3GA 4J3XA 3ZR6A 1JZ2A 3TP4A 3KEHA 5HOSA 5DO8A 3PTKA 2JE8A 1KR0A 4ZE4A 4PTXA 1Q6CA 3T2PA 1ISYA 3ARRA 5M5DA 4UZUA 2MANA 3I3EA 2UY5A 3SCUA 1MW3A 1GHSA 3EMQA 1B0IA 9CGTA 3AFBA 4FNTA 3W4RA 2A3HA 3NCOA 4CD4A 3CPUA 5LYRA 4RL3A 5I5RA 4PUEA 3ARSA 1US2A 2OYMA 1QX1A 3D3AA 4P7QA 2DPEA 4W8LA 3B9EA 1UWRA 4E4PA 1FFRA 1UA7A 1V3KA 1W9UA 3LXBA 3UG5A 4EAMA 1ECEA 4CU6A 1C90A 3W6LA 2QV4A 1KCKA 2VVNA 3EJSA 2F7RA 3PZGA 4R27A 1HKJA 1GUVA 1TE1A 3WY1A 3WF0A 3WDIA 4U2ZA 4LXFA 1W3HA 2G3NA 3SCOA 4Z2KA 3WKZA 1GW1A 1VFUA 1KWKA 3DYMA 2GSJA 1CGTA 2BY3A 3L4YA 3U7VA 2TAAA 3VSUA 1QNPA 1OT1A 6TAAA 2VZVA 1WO2A 2F8QA 2WC3A 5E0CA 1NOWA 3AISA 1IZKA 2EO7A 1G1YA 3VIPA 2QPUA 5CSYA 3IJ9A 2JFEX 2QMJA 3BSHA 2EAEA 3NDZA 1XCXA 2WZHA 1OINA 3VGDA 4MNMA 3AYRA 3ALFA 4AZ5A 4DO6A 1ODZA 3GNRA 3PZNA 3ZIZA 1C91A 1GZJA 1MXGA 3M46A 2DT1A 3EJRA 3U57A 1J0IA 4HA3A 1CPUA 3DX4A 2E40A 5KZ6A 2D0HA 3A23A 3AYSA 4W89A 2DSVA 4MDOA 1MW0A 3ZT7A 2ESCA 3JUGA 4B9YA 4GO8A 3ZT5A 1ESWA 4UFMA 3RIKA 3WQVA 2XGIA 2A3AA 4GZIA 5BRPA 2QHAA 1CGYA 2J74A 3VX0A 3MUIA 2BHUA 5KEZA 4CGTA 1BFNA 4D6IA 4BA0A 2YLAA 4OOUA 3ARXA 5I0DA 1VF8A 4XZWA 3K8LA 1EO7A 1B30A 3ZO9A 1V6YA 1UOKA 2OSWA 2CITA 3B9DA 3PZVA 1TFVA 4MADA 3H55A 1CZ1A 2XN2A 3WMCA 1AQ0A 5TD4A 2WK2A 1EDTA 1VBRA 3WF4A 4H8UA 4PUDA 4UFHA 2YL6A 4OJYA 2A3BA 4JKLA 3AIBA 4WLCA 3AIUA 4M24A 1L0PA 3RM8A 1JYVA 2VMFA 5DFAA 1QI5A 3A4XA 3CH9A 2OSXA 2WWCA 4DWSD 5I79A 3VD3A 4DUWA 1AVAA 1FH8A 4P7OA 2JIEA 1OM0A 5A6KA 2XFRA 1HKKA 4N0RA 4KGLA 3MS8A 3TTOA 1E3ZA 1BVZA 1CXIA 1F4HA 5CGTA 4LPCA 1JYNA 1E3XA 2VT0A 1JDCA 1V6WA 4NX0A 4AXNA 1OD0A 3ZJ6A 1W2PA 4WIWA 5ABFB 1ZBVA 5ECUA 2EPMX 4UQAA 3WFZA 1JZ7A 4CKQA 4JKKA 3ZSTA 3RPMA 5A8NA 1V3LA 1BSIA 2W5FA 3LRMA 1NWUA 2WMHA 4EKJA 5A2CA 3D4YA 3MMWA 1XH2A 1HXKA 3AHVA 4GQQA 3CBWA 5GPRA 2QMKA 4P8VA 3D5HA 5IXEA 4AD5A 3A22A 2DT3A 3BGAA 4TUFA 4D6FA 2ZUWA 2WKLA 4M80A 4CD7A 4W8BA 3MMUA 2ZX6A 4NZCA 3DECA 3VPLA 1V3JA 1DWJM 3WBEA 4JFSA 1WCGA 4GXPA 1W9PA 1MWOA 1V0KA 2ZWYA 1L8NA 1JF5A 3PZOA 1SFSA 2D23A 2CBJA 1CBGA 2D1ZA 1E6PA 3FHAA 4JHZA 2V5DA 1WZAA 1AQHA 2J7GA 2BHZA 1BYDA 3UETA 1J0KA 3VX1A 4RE3A 4W86A 2VOTA 4W88A 2JF7A 3BMVA 1MQRA 4DO4A 4AZ6A 4LYPA 4V2XA 4DM2A 2J7HA 1V02A 2EADA 4U5IA 1IV8A 4M29A 4GO9A 5AYBA 2DSZA 3QHNA 4W84A 2WANA 2W66A 5I6SA 4U2YA 3AXXA 4HPGA 1JZ4A 3BC9A 1E72M 2YKKA 1MW1A 3WEMA 3GYCA 4C7GA 3SURA 4HMDA 1B3VA 1A47A 1TQWA 2VX6A 2YLLA 4TX8A 3LPOA 3PZQA 3EMCA 1GHRA 1OBAA 2WYSA 4TOQA 1BVNP 3DHUA 5A6SA 1KTBA 5AC4A 4J3UA 1FH7A 3IAPA 1KXTA 1HJQA 3BLBA 2F7QA 1JNEA 3W81A 1R46A 4CD8A 3BAJA 4J3VA 3HG5A 3AI0A 1XSJA 5BXPA 1KGXA 1V3HA 2WLYA 2J25A 2VNCA 4U3AA 5IHRA 2WVVB 4XUYA 1KXHA 2WMJA 5I2UA 2CKRA 1XGZA 1F4AA 2EQDA 2VCCA 4RE4A 3BSGA 3WH7A 3UESA 4QP0A 3A3HA 4AW7A 1JAEA 5HPOA 1BTCA 1PX4A 4N42A 4DWSB 2GVYA 4PRWA 4OIFA 1W1PA 3ALGA
chains in the Genus database with same CATH superfamily
3B1UA 5JXAL 5HPMB 5FJOA 2WVUA 3RPIA 4XAWL 2DVUA 5DHDA 3T9WA 4K9JA 4RPPA 4HLZH 1ZUAX 3KYKL 3T0DA 1CL7H 2F19H 2IOOA 1D9EA 4FX5A 4MMXB 5CIPA 2HUHA 3D3VA 3VFOA 4UTKA 5CPMA 3PL6D 1MNNA 1JNJA 2BINA 4HJ0C 1TV5A 4APXA 5JIIA 5JU6A 2VLKD 1SDYA 4TQIA 3W7KA 1O5DT 5AHIA 3QUYA 2OKTA 4ZMTA 3QJZA 2E9WA 2X1RA 4Q22A 2IGTA 3DLQR 3GTNA 1H3UA 4G7EB 4G8AC 2P47B 4F7MA 4JW3A 1NAML 4LAQH 4WGHA 4DGYH 3QR1A 6FABL 5D5MA 3P74A 1DQVA 1SFDA 3PWPB 2OL3H 3H4WA 5DUBB 2ESVA 3VFTB 3BE1H 5MEPA 3D39A 1F11A 1UWEH 4FK9A 3LS9A 4EIVA 2PR9A 2VITA 3NVTA 4B5XA 1BZDA 4P05A 4DQAA 1P0BA 5I02A 3BN9D 3TXAA 2OPJA 3UXIA 4NP9A 4O2FB 3BGGA 2XOTA 1PTAA 5I71B 5GRJH 1QTPA 3QE5A 1C92A 4PBXA 3EX2A 3BAYA 4OV4A 4PCFA 2QJNA 5I74B 1THFD 3N40F 5FUZL 5HYJE 4G6JL 4I8DA 4O4YH 5TQ2L 5IQ7L 1N8ZA 1U95A 3OAWA 3N9SA 3MLPA 3FONA 1FN4B 3QNYB 3H0TA 4U7SA 2A73B 3LH2H 3MP5A 5CJNA 2YC1B 4IJRA 4ZGYA 1HZYA 3NCBB 1NFGA 4ODVL 2VTFA 5LCVL 1NARA 4X9GA 3GDMA 3OGCA 1L9TA 4PJ6A 3O81A 4PL2A 3UADA 1P4BH 4WD0A 3AS2A 3FNDA 4Q8UA 2VAAA 4D6GA 1ZANL 4R7NB 3I6LD 4DBSA 4GVGA 5DUPH 4Q4IA 1BF6A 4KZEL 2X4RA 4F2TA 3PGDB 4WI9A 2OKOA 5H2ZA 1I3UA 3H9SD 3CLEL 3JWOL 3E8UL 2I7GA 2R7EA 4C56D 2E7FA 4OCYL 2GBVA 2BXZA 2BFVH 4GACA 2DZTA 4JQXC 5FPIA 2XWCA 4PUMA 1RZGA 5E8NA 3O2LA 2ADIB 2QCDA 3D18A 3T6XA 3UCQA 3U0PB 2L8AA 5I1HL 4NUWA 2X12A 3C61A 3WYRA 1ORSA 1IEWA 1BGXL 3SDXB 2UXFA 1IGJB 2HWGA 3MP4A 2ODIA 5IESL 1K8YA 4K15A 5A6JA 1N8IA 5CLXA 1S7XA 1ZSHA 1IEBB 2BSEA 2ON3A 5DCDA 4DEUA 3IARA 3GTIA 1T0OA 3ILDA 5I1KH 2ENJA 4XMKL 2IMRA 2BW5A 4HPOH 1MSSA 2X8RA 4PLJD 1GORA 3SRKA 1I75A 1GONA 5SWSB 4WO0A 1GXEA 1YIXA 4PMVA 3KBSA 2J2ZB 1URIA 1BSLA 2EYSB 4H6QA 2OR2A 1T2XA 4KRNA 5K1VA 2D3NA 3WUWA 4G70B 3ABQA 3ZWSA 4TVPE 3SCWA 2GJNA 1VPQA 1FO0H 1OGSA 3MOBH 3PVFA 5ABFA 4UOW0 2HNEA 3MHZA 1QLFB 4GH7B 4WTZG 3CHPA 4PBFA 5FYKH 1D6VL 4HWBL 4K7FB 3P4NA 1XHHA 3K30A 3ARVA 3P9MB 4J35A 1PKOA 1G7LB 2A5UA 1WA3A 1LBLA 1W0MA 2PF0A 4X4ZA 5DWUL 3GXNA 4KQ4L 3NIDB 4I8YA 1HTYA 1EFXB 1QSFD 2HXAA 3U83A 1F4XL 1YDVA 5C0NC 1OX6A 2XM2A 4NN6C 1SSDA 2C6QA 4IRJD 3SPCA 3TBYA 3SYCA 5F6IB 1KWGA 3R0NA 2IMMA 8CGTA 2WW5A 3MRDA 2Y07L 4YSTA 4XMLH 3OZKA 3DTXA 4H83A 1WDRA 5FOBB 4DZIA 1B9BA 5BXSA 3L7EA 1POKA 3DV4B 3MLSH 2UZXA 3NJXA 2BOEX 3GMPB 3UXDA 4KRPD 5F3HB 2QDDA 4GK8A 3D3VD 4Z23A 1OFEA 3T4AB 2F9BT 2QSCH 1DDHA 4JO2H 4M6OL 5I23A 5FYLL 3AZSA 1U2YA 3H2CA 3AO0A 5HHQA 3RRAA 3PTQA 3QUYD 4AZGA 3B3IA 2MEJB 4KFPA 2UY3A 1A5CA 3GSMA 4JFHE 1LQBC 3T07A 5D8JH 2TSAA 3IDUA 1C29A 4QWWD 4NJGA 4GSDH 4FAMA 3P5ZA 2ESVD 3D39D 2V7NA 3ZRFC 3D30A 4YBHA 4W9IC 2DQUL 1CD0A 4K6AA 2FT7A 6PTDA 5I19H 3ISWA 5LIUX 1CDGA 5F2GA 3WSQL 1GJIA 2ZSVB 4QISA 1YXCA 1X4ZA 3OLIA 5BPPA 5IMKA 2GFBA 4LS0A 3EAKA 1XXFC 3BXWA 1WA1X 1JGUH 3KBFA 4F40A 4IGBB 7XIMA 3O6FA 2AW2A 5HDWA 1JHKL 5G4HC 3BT2L 15C8L 3H2PA 4Y96A 5JDJA 2AEQL 3DHPA 1QNZL 4YWGL 4UWMA 1FYHB 3NZPA 4WKXA 3N2TA 2E9MA 1BZEA 3V5CA 4MCNA 5JHBA 2E6AA 1MI5B 4NKMB 3QB7C 5DVMA 4GRSA 2VDRL 4IOSA 3FV9A 3WIIH 3PHQA 5F7UA 3VQLA 4L4MA 3SYAA 3X1BA 2PPDA 3VFSA 2DDQL 4Q8VA 4HF5L 4UT7H 3S2CA 4JO8A 3PWAA 3MLWH 4OQVA 3M17A 2NUTB 1RZ7L 3WL9A 5DJAA 2KMWA 2WXFA 5AZ0A 1ZT1A 4JN2B 1CFMA 1UP2A 3ROOA 4DTGH 1DZ0A 4WDIB 3OVUB 3UDWC 3N3TA 4YHML 3CFBA 3DBPA 1HJBC 2IDCA 2FWLB 4LCQA 2HJFA 5G5DB 1BZ7A 1TQVA 3BGMA 4JAMA 2J12B 4S3EA 1A7QH 2RFXA 4NSKB 2ZP8A 1NPNA 1J2WA 4ODHL 4AYEC 5B8CA 4HCGA 3DDMA 5E6ZA 2Z65C 1F86A 2QVMA 1E6QM 1LE9B 2GLKA 4KJPD 2UZIH 4GXUM 4MOZA 2YFNA 3C8NA 1XCQA 4XPTH 3AREB 3TFXA 2DIJA 4OZGA 2WZ0A 2VDLB 2BSED 3AJ7A 4P2RE 4D8OA 2JCWA 3S6OA 4UI2A 2J1WA 3BRDA 3IGSA 4MJZA 3CFNA 2FZDA 1VFAA 3FUIA 2Q6ZA 1M57B 5K2ZA 3GJFB 5ICYB 3SYOA 4J2MA 5H94B 3UJTH 3AJXA 3WD5H 4ATDA 1FXQA 2QDEA 3NCMA 3RGVA 4I88A 3MJ7A 3NVDA 1G7IB 3ZMNA 1XX9C 4KJQC 2W4XA 4K7PY 2ALWA 1QFUH 3MUAA 4FZIA 1EXHA 3TWCL 5EPMA 3ZHNA 3VAVA 5BNXD 3MOQA 2R56H 1HXMA 1RURL 5HDQH 4A3YA 3W7CA 4PAZA 5D32A 4Q8TA 6XIMA 3KCPB 2VN4A 3JU2A 3A12A 1ITCA 1VD6A 4U7MA 2IDUA 2YSTA 1RD5A 3TA4D 4GG8B 4XODA 2QUTA 1KO0A 4U1LB 2FH6A 3QQDA 4WTXA 1HINL 4QHKJ 3F7KA 5HI5D 2N59A 3TO4A 5G4EA 4E9XA 1UR3M 4O02L 3IJ8A 1LO3L 3S4TA 4FTDA 4G8GE 3Q2LA 1EBAA 3D0VA 4B5TA 4E38A 1N9PA 2QVTA 4RZKA 3NXLA 2SEBB 1EF3A 2E86A 4GUIA 1UA6L 1DBML 1H51A 1HL5A 3LQLA 3WQDA 1XR9B 2Q76B 4HFWA 4DPCX 3RRXA 2XYBA 1KNWA 1XXXA 3QEGL 5BWAA 1OGGA 4HCHA 3HBGA 5JIPA 3A9BA 2BCKB 2ICWJ 4LDLB 1ULVA 3W23A 2IC2A 2GTZA 4DP2X 4QRRB 2YGVA 1F41A 3SSZA 3QIBC 5HTSA 4EN2A 1G6RL 3VCLB 1XDMA 1G84A 2XV0A 1YEYA 1N0LB 2OL3B 2O0TA 2XXMB 3CX2A 3R12A 4Y8AA 4ERGA 4I48B 2XNAB 2ZF9A 3APDA 1JK9B 4QLRA 3P11L 4PJ5A 3K2MC 2N0KA 1XGUA 1P2CB 1H0DB 2PD9A 5J6SA 1F6PA 2F53E 1PKQA 3HS0A 4MDJA 3EKZA 3NSXA 3LUTA 1LBFA 4TRPL 2XGBA 4W9JC 2NX3A 1T0PB 2Y8VA 2HFEB 4ATWA 3FN0H 3O6FD 2YXGA 4I5RA 3MV7B 1H5VA 2W60A 4JFYB 3B6SB 5CBEA 1I60A 3IFOA 3TZVC 3T2NL 3ZJKA 3KCWA 5IBLD 3NCXA 4K9EL 2FEJA 5HVHB 1PNCA 1X96A 2VOMA 4ZCWA 2IQ9L 4NUJA 4JRYB 4MG4A 1YC8A 3TSDA 3BXNB 4IOSD 1FWBC 3NO3A 3STBA 3CHRA 1W5OA 2KDYA 2ZIDA 1TWZA 6A3HA 4OVXA 3W7GA 4F8XA 3HM7A 3X3GL 2AITA 4NC2B 3ES6B 1FOBA 2MH4A 3ABRA 1Y8BA 3U4EA 3M1BB 3ALXA 5C0AA 3T04D 3CUPB 3P2VA 1WH0A 2Y2WA 1OFDA 1QHOA 2Z1VA 4LARL 4ALAL 2E7LA 1CLZL 4XPFH 2WSYA 3OQRA 1J5OL 1PG7H 2JWYA 4MA8L 1B4EA 1PIFA 4NGHH 4C8XA 5T3XD 2P7TA 2ATSA 5KG9B 4MRBA 4I2XE 4ELKB 1B3XA 1T1WB 1TG8A 4QS5A 1PD1A 4QAIA 1ADSA 1T5KA 1WVZA 5FO7B 3HBLA 5GGTH 3BFQG 3RVUC 3B2VH 1T5XA 3SQBB 2INFA 5AG9A 5IQOA 4D6CA 3PY9A 4ZXBA 3WQ8A 1KYOK 2PDJA 4YSQA 1G7MA 2YHGA 1FKXA 1FWXA 3IDYB 3UTQB 4PJ9A 2ICEA 4P9MH 4BF5A 1OIOA 4LBEB 1GAFL 4ONHB 2V5SA 3V8CA 1WXYA 4EPEC 4LLWA 4WI2A 4ZUUA 3S5LG 1IGMH 2R0ZH 2W38A 4IF2A 3OJMB 3GXDA 4WI8A 1YVLA 1JPSH 4HCDA 2VMJA 2APTA 4XBKA 4FS0A 2HK1A 3S5YA 1K7FA 3C60B 1SN0A 1V5XA 4HIPA 4J5NA 4IP4A 3RZWA 5E5UB 5MEOB 3I65A 4Z7QB 3RGVD 1FO0B 5C0JB 1SO5A 1EHLL 1ENUA 1IEHA 3GTFA 1BYAA 1YO4A 4BQ6A 4AUJA 1RUSA 4XCCL 4N0CC 3I6TA 3QAQA 3BW9A 1SM3H 2DUZA 1VSCA 4YK4C 2R2BA 4GQBA 4FP8H 1MF2H 5A2FA 4AIZB 3TEYA 2YQBA 5DR5L 4AD1A 1AQMA 1DJWA 5DJ2A 3L5MA 3RI5K 4HB7A 3W74A 4YYCA 1P5UA 3CMJA 2P53A 1W1TA 5AVUB 2RH9A 1OFRA 3TO4D 5E8OA 5MHBA 2XXFA 5HDLA 2FZNA 4QHKI 1QO5A 3JRKA 3WCYA 4LHUB 4ZFGH 2NY2C 3VUPA 1X5YA 2B1HL 1XIDA 2EDJA 1VC4A 4E41B 2WLMA 3FQTA 2CBIA 4I0PB 4DKEL 1RJZB 1PHQA 5LKNA 4Y19B 1TV3A 3ORJA 3EFFB 5TDOB 4J3XA 4Y2DC 5HYSA 4IH3A 3KEHA 1NOAA 3UTSA 4LSPH 1MCQA 2JE8A 5E7BA 3QDGE 3QG7H 5FIEA 3HRZA 3ZTCC 3LB6C 1LYXA 5FXCH 2XIMA 2Y7DA 2YGQA 1FVDB 1QX1A 1AZUA 4JO4L 2NSOA 3QO1A 5HI4D 4QQ3A 3EGSA 2WQXA 2X6UA 3MRIB 4ZAKA 2ICWI 4ZJ9A 1TJIH 4K94C 4R27A 3S37X 4NPYB 3WDIA 4LPWA 4RPQA 1I0DA 3ECWA 5D1ZC 4YWSA 4JHWL 3W7EA 3ASNB 4WI4A 2EO7A 3CVHA 3CIXA 3VUSA 4YBLB 3M0YA 4PJ5D 3OZMA 2QMJA 5J06A 3DGDA 4K71B 3LTSA 1AKJA 3PZNA 3NAAL 3M46A 1J6PA 5DRWA 3QULA 1G4TA 3GG0A 5A2KH 2DSVA 4GA8A 3QUZA 3ZT7A 5HGHB 1SQMA 4J3ZA 1OC6A 3V9EA 4MAUH 3ZT5A 3V4VB 4A8IA 3SDAC 3NZHL 5C09B 2J66A 3VX0A 4G2AA 3QY8A 5CZSA 3CDZA 3GSWB 1AR2A 4LCWE 2EG6A 5GIRB 4S0SD 3LSOB 1XQLA 1KCUH 1HDMB 3FT4B 1AGCA 2AMUA 4KUCD 1JPDX 1NMBH 1AVAA 3K6SA 4LLMA 2K8QA 2GWGA 1CXIA 4B9PA 5KUMA 1HKLL 1JYNA 1QLRB 1QRNB 5H8MA 1RHHB 1YRRA 1LK2B 1XISA 3HS8A 1KENH 3GEWB 2NV1A 1XBYA 1KTDA 2NSMA 2PDXA 4EQ2A 4MNQB 2J27A 4DJEC 2Q3OA 5DU7A 3AHVA 2X7LA 3UAFA 4D6FA 2ZUWA 4PRHA 4M80A 2FKPA 1ZHBB 2XH7A 5EBMA 2PCFA 3GO1H 4MNGB 1SN2A 1V0KA 1TJGL 1ZV9A 1KJ2L 1KBGH 1E6PA 3S2MA 3LN9A 5HWNA 4UCGA 4TMCA 1BYDA 1RUAL 3KPSE 5D37A 4RE3A 3A4EA 2JF7A 4RAUA 3MB9A 3LZPA 4QEHA 5GGUA 5CBBA 5TDNA 2JKTM 3QEZA 4NP4L 5D7IE 5FJTA 1Z7JA 3S3GA 1CB7B 4PJ9D 1AP2B 2PYEB 3OZ9H 4C7GA 1FHUA 4U1JB 3KMDA 4TQPA 4TX8A 1G9MC 3O6ML 4RMUA 1KXTA 1HJQA 4X9FA 4QGCA 4U1GC 3HG5A 3NZGA 3UWZA 1IBBA 3TYAA 2WLYA 2JVUA 4UILL 3CVIL 4OM0H 1Q2RA 1S78D 2EQDA 3QPQC 3BSGA 3BHBB 3BP6A 4KBXA 3IIPA 1TNNA 3BW4A 1P43A 2DLEA 5HHPA 2GT9B 3IBEA 1PZ2A 2RDXA 1U8MA 2XUWA 4OTXL 5AOUA 1P6FA 3T1GA 4AQAA 1XCWA 1NWTA 3EYUH 2HISA 5KINA 1MREH 4ZFCA 1RY7B 1A0DA 4KJYB 4FFWD 4IRSC 3S3BB 3C09B 4BF7A 5T1LA 3GK8H 1KGYE 1TEFA 1AD1A 4QR7A 3UBXI 1W5MA 3BJFA 2C7UB 4JG0H 3FB8B 5ESQB 2EDQA 3MJWA 1E5AA 3LVEA 1BGGA 1BVKB 4Y9OA 4I77L 3P73B 2VGLM 1Q85A 1E43A 1S7VB 4K8RC 2CDEB 3B37A 2VO5A 4JTFA 2OCCB 4HMEA 3D2UD 2PGRA 4WNQA 1YJDH 2FEDC 5CZVH 3M6YA 2WWOA 5E1HB 3ZYOA 3EA1A 2WLKA 4JE4B 2WIMA 5SWZE 3L6FB 3DG7A 4XNAA 3IVSA 3JWNE 4FL4B 5EBWA 3NIFE 2JQAA 4YXHL 3UTSD 4QHNB 3VXUE 3Q2CA 2HBVA 3RPTA 2O26U 1QPKA 2PI6A 1JPKA 4HAGA 5A40E 3UJEA 4S1DD 4ZD3H 3VG9B 1RJPA 4R9HA 1S2EA 4G6KH 2CR3A 1SXSA 4WENB 4CNPA 3AUVA 4L8SC 1DFBL 4QOKE 4LOCA 1UHVA 1ACZA 4K8GA 1D7CA 2A6NA 4M93C 1HWHB 2G4FA 2W62A 4GIYA 2JKIS 4BFOA 4YL9A 5GVJA 1TYRA 2VC7A 3KLLA 4FDWA 4KKNA 1KNOB 5I3HA 3FT2B 3T3PE 1AGDB 4I6VA 1EDQA 3F03K 5GS0C 5KS9A 1I1CA 4NQEE 1KM5A 1AR1D 2ITCA 4UDUA 2AQ1A 3TN0C 3F4VA 1MCWM 2QNEA 4KF1A 3UO8B 2DIBA 3CZFB 5HD8D 4ZDHB 1MQKH 3I02A 4GIPD 5D7JC 2OX1A 2LR4A 3IJ7A 1AKJD 1QTYT 3EO1B 4GMEA 4HK3N 1XLIA 3CUGA 3CXHJ 1ZAJA 3F5WB 3QLLA 4ZMNA 3L5LA 4AYFB 1VRDA 2F61A 4PB4A 3W1UA 2B0SL 1KGCE 5DI8B 3Q67A 3ESMA 3GYEA 3MWCA 3D7PA 2PR4H 5IT2H 2WLZA 2QF8A 4X50A 2BZDA 1FCVA 4AD4A 1Q1JL 3PJUA 2EVFA 3TFKC 5AQ0A 2GJXA 4M62H 1L0YA 3NJKA 2GY5A 2JSFA 3IIZA 5EOCJ 2FLMA 3HPXA 1LO5A 5F2IA 4ZO6A 1JWSB 3CAVA 3PAJA 3R8RA 3SE8L 4U0RB 4NO0B 3WY2A 1TIMA 3H7BB 5C5YA 1ETB1 2XVPA 2XBZA 2PC4A 3BAIA 4FP1A 3GJEB 1OTUC 3TEVA 1SRDA 2V30A 5C92A 4K8EA 4PJBB 4QRSB 3ZJ8A 1RJLB 1VB9A 1JRHI 1QOKA 3V5KA 2X41A 2XZ7A 1JMZA 1H8SA 1UWGL 4PRHD 3QHMA 4HH9B 4NNAA 1MMFA 1MHCA 3AG4B 5FGCE 2DQGL 2WYHA 2Y5JA 3KL5A 3GM8A 1XX1A 3GVQA 4E5XA 3JS3A 5I76B 2YW4A 3RFZA 5IF0B 3N85L 1B2WH 4YMZA 3O8XD 5EB8A 3CU1A 3PM6A 2XXGA 4IRZL 4NUQA 3T3ME 2PF8A 4LF1A 3UBGA 5FACA 1M41A 5F7LB 1XUUA 1SJHB 2O7QA 1J9CT 1WGVA 3ESPA 1E70M 1JZIA 5U4NA 3SDXF 3CUHA 4JM2A 4AIXA 5I1GH 2YS4A 1KMGA 3G1HA 4HLEA 5HDRA 2E3ZA 5JMOC 4XP5L 3B56A 4NXSA 3SY0A 2GEEA 4N4YB 5DVKA 1DUZB 3WENA 1OE3A 2K6YA 4C59B 1TQXA 1UADC 4PJGA 1EBGA 3OPZL 2AEPH 1T1ZB 2VDMH 5DMYA 1K3UA 3IETB 1NCAL 5E9DE 5DDHA 1WYJA 3QF0A 5C7XL 1KJVA 4EDWH 3RM9A 5B39A 4EVNA 4EK7A 3L2IA 1VYSX 2E28A 4A2RA 2BJMH 8XIAA 2B5IB 4KU1A 3V5DA 1OGAD 1AI1H 3U30B 2NUXA 4FMVA 5T1LD 1JGVH 3B2UC 4OLVL 2C71A 5EEYA 4F2MA 1WV7T 3E12A 2EG7A 3GFUA 4HIQA 5CG0A 1BBDH 2C1GA 4Z5RB 1X6NA 4H9TA 4Y1TA 2RQEA 4CMHC 7CGTA 3VFGL 2O92A 1G0CA 4P5MA 4DAGL 3T77A 3CDGB 3NIDF 4Q9RL 1K3IA 3RY6A 3LQAH 4D72A 1HE8A 2RJHA 2VR3A 3LHUA 4YXGA 2W67A 1YMHB 3FC8A 3U2JA 1R0MA 2X30A 5KYXB 1XAKA 3SODB 1FTXA 2CLFA 4K5PA 3V4LA 2YA0A 3AHXA 3FUFA 2AXGA 3I9AA 1IU1A 3MKCA 4GLRI 3RNKB 4RR4A 5EIIB 1EZSA 4OBRA 1GW6A 1PSKL 2EXOA 2F6XA 2P4AB 1K6AA 4PJDA 4RGOL 1VIWA 4UV7L 3TONA 2W27A 4U1SB 1UYWL 4QHLA 2VM4A 4ZMWA 2Z31C 3C0SA 3GB6A 2HE5A 2CEQA 1FVPA 3L3KA 3ZTJH 4NO5A 4C54A 5J0BA 5ETUA 3T6WA 3P4OA 3TX9A 3UPCA 3PAVA 4RBPK 4ZTPH 3S8FB 1KN4H 3GMNA 3BZJA 1DWGM 5I3KA 2YWYA 2OXHA 1XBRA 2ZICA 1F07A 2A6DA 2KT6A 1SXBA 1ZEAL 1YDPB 3ZHDA 4X6FA 2V5JA 3HNSL 3I6GA 1U91B 4R97C 2DZUA 2Z92B 4EANA 1S4IA 4G6MH 4UTWA 5CEYB 2ZXWB 4G9DB 1EX0A 2WXRA 2VL5A 3RN6A 2CJ3A 4TSAL 4QCIA 2J57A 3LV3A 5BS0B 3DGGA 4XNUH 3S6CA 2GSGA 4F7CA 2PXYB 3FTSA 1IM3A 1J8HE 3DROA 2NV9A 1XI3A 5I2IB 3UGXA 5DXXA 4WUUA 1AGFA 3PABA 1E71M 4PBVC 5TIMA 4HCFA 5AOJA 3VMPA 1ACXA 4YR6A 4HP5A 4RWHA 4W6WB 1IC4H 2DEXX 1PKLA 3UFYA 3O2DH 1BOGA 2F74A 4BHUA 2V2TA 1VCGA 5FL1A 3SJVA 3VNDA 5BV7H 2DZEA 2FZ3A 4WHBA 2Z4TA 2ZDRA 3DURA 2HVJB 3FSVA 1V3MA 3NYKA 3O2WH 1XINA 4YSSA 1I8LC 5IG7A 3RR4A 4QGTA 2WZAA 4EAYA 3W07A 3NZ8A 4POUB 1UWQA 5KBMA 3GNDA 4REQA 3SN4A 2IXQB 5E8DH 3QORA 5H37A 2PGFA 2PC8A 2J1KA 5TBOA 4BEIA 1Q0XH 2WBWB 3Q43A 3BWZA 1RK1A 2V33A 2VC9A 1URLA 2VFIA 1MCCA 2G60H 1S5HB 3JWNC 1EYWA 4W4NA 1TKWA 5B7ZA 3ULSB 4HGXA 4BQ8A 3ULVD 5E2JA 3S35H 5CN3A 1Q9KA 4DJFD 3UXFA 2X4SB 1OQXA 1E40A 1KPUB 3A4FA 3C8FA 1TZGL 1MJUH 2HBXA 2XRAH 2EDOA 5C86A 1XG4A 3BEVA 4XVUD 4CCZA 3LNFA 5DO2D 3PDGA 3P60A 3CZSA 3TFBA 3F7VB 3WDQA 2OK0H 1DWIM 3RHGA 3E49A 5HQEA 2V5RA 3S47A 4YXLL 1BXUA 3O4OC 4Y9AA 3Q05A 4F7PA 3F6JA 2Z4GA 2Z7UA 1A3RL 1KSRA 5D09A 1T0NB 5IVXE 1EL3A 1EO5A 2VFFA 1BZ8A 2P5WE 3S48A 1LG2A 4ZYKA 2DMBA 3NL5A 4M7ZC 1DBTA 1UXLA 4UT6A 3IPEA 1JFHA 2XPZA 1JULA 3L95A 1OAZH 2V3EA 3WQPA 1DYZA 4PRNB 1P4CA 1I4FB 5DF0A 2PDKA 1LE5A 3RDKA 4PRAA 4KFMA 2NY6C 1QACA 1MNZA 1U92A 2Y6SD 5FESA 4NQCE 3VKBA 2FECL 4G2DA 3O41B 4GW4B 3FUMA 1D3CA 1E7VA 1QUPA 1YKWA 2UUDH 1EJVC 2EPKX 4QO1A 4WW2B 5TGBA 3WJLC 2WXOA 3R06A 3FB5A 3GY1A 3DK2A 3K7UA 3CFCH 4WK9A 5TF1H 4I3SL 1ML0A 5C9RA 4KESA 5AAMC 4HUVB 4KWOA 2R91A 4ENZA 2R1KA 5DQ9A 2A5HA 3V1PA 2X0YA 3FGCB 4TUUA 5F97E 1WHPA 2FDMA 4LQFL 2Y5TA 4YVVA 3LX9A 3RTLA 3STEA 1YECL 4YHGA 4IBQA 2CZFA 5CPNA 1U93A 2PBGA 3URAA 2JXMB 1U3NA 3HR6A 1K72A 1YYML 4P5TA 5FO2A 3IJDA 3FQRA 3ULUF 4TNEA 3JUYA 1PX3A 1DO5A 3QGVA 2DLGA 1BMWA 4YTSA 4S1QH 2PDBA 3NZRA 4UDTA 3IJHA 1KPRB 5HHNA 1GJUA 1QLEH 4M8VA 4NZ4A 2W3ZA 2J1ZA 3O07A 1DSFH 1MFDH 4CQBA 1B90A 3OHXA 5E1QA 4OJFL 4JEQA 4PHXA 5DEZA 3BKJL 4ZS6D 1P7HL 2F5AL 4L1LA 5LNDA 1FZKA 3MLZH 3CH1A 4R5EA 1SYVA 4YDLB 3BT0A 5IEHB 3JV6B 3WIAA 2ID5A 1R9XA 1KEML 2G2RA 4DIAA 2ENSA 3TW6A 3QCVL 2KZ1B 3CWOX 1IM3D 1J9SA 3CAKA 1WXZA 4NYLA 4WUUD 3PJLA 2LT9A 5D9MA 4OLZL 5INCA 4OV5A 4AG4H 1SLVA 2CIIA 1HCYA 1CL7I 3S6DA 3VSVA 3MCG1 5D7HA 1GGYA 2WLIB 1NFBA 1FORL 1MEXH 3IFNL 1DWHM 3LOTA 5CC7A 5D2LA 2W63A 3V0VA 4OR1A 1JHTB 3BQ6A 1R33A 5LG1A 3DERA 4HYTB 3LS5H 4QFUA 3SJVD 2QT6A 5KVEE 3BVJA 4MNHB 5DZOA 2VR5A 4Z9KB 1F00I 4MCZB 3MMEA 3NXFA 3H85A 4RGNB 4W68A 4L3CB 1ZA6A 4YAQA 1DBJL 4YVPA 3WFAA 2X1WL 4ONFH 2AL2A 4Z7IA 2MPAL 2PD5A 3QORD 2QKIC 5EZPA 1B4JL 3OQEA 1A7OH 3MANA 1WDWA 2DQHL 2NUYA 4FLSA 3MSRA 4Z7WB 5CSUA 4P9HH 3V3WA 2X4QA 3B2XA 2R29L 5C8JB 4GX8A 3UA4A 1KM4A 1MPAL 2OODA 1RLDA 2FYVA 1EEYA 4OIAA 2Q0ZX 2ZONA 4N2EA 4P61A 1F42A 1OSYA 2HKFL 1K2DB 1H3XA 1U8LA 4KWUA 3O3UN 2XWEA 2VXVH 3JW7A 2EVHA 3UQNA 1KCVH 1CBVL 4KXZI 4X7CC 4HJJL 4NQDD 3G6JE 3RDTC 5C08E 2VE6A 4W5UA 1OCCB 2YD4A 4FA7B 2VDMB 1TLMA 2GTQA 3FVDA 1O4UA 4PRBB 4HS8L 4ABUA 2JJVA 2FQFA 3ZN6A 3GE7A 1M1SA 3J2PA 3DA0A 3FQNB 2CUMA 3CH8A 3LM3A 3HG1D 2A9AA 3LZFH 5I6XB 1XF3B 4Z7QF 3APFA 4MSWA 2RCSH 3CPRA 2XGZA 3V5OA 1R75A 3L23A 2WLJA 1JXKA 4BH7A 4OLXL 3K6DA 1LK3L 2NXZB 3QISA 4N8VB 2HSAA 2EC9U 5L9DH 1QKZH 2GC7C 1G4EA 2R51A 3LG3A 2ERJC 5CEXB 4OCNC 4DFIA 2OYMA 5IGXH 3EWUA 4ZB0A 2A9BA 1FFRA 3II3A 2A9MH 2YGPA 2HT3C 4HYRA 2ZYSA 3TBSA 2QCMA 1F5ZA 4H8WL 4Q8QA 3DOHA 2XVBA 2NXGA 4P2YA 1WFTA 5DEJA 1GIGL 2QGBA 4LESA 3NABL 3BIBX 1MCRA 1AHMA 3OR7A 1FH5L 1DVTA 1A80A 2EC9T 2CLZB 4JPVH 4N20A 3IFLH 4Q8PA 2EAEA 1EFZA 4AF0B 3QPKA 4A22A 3LVTA 1A9EA 2AJUL 5FECA 2OLAA 2FYYA 4L9LB 4P5SA 3DVNA 3FQ4A 3EJRA 3LN4A 2CO6B 4BZ2L 2IDSA 5KMYA 4LMQE 5B3SB 3DUSB 1ZWIA 3A23A 3UACA 2ESCA 2JB5H 3BZGA 3ILPB 2EUXA 4P5TD 4OZHE 3RUGA 4ZW3A 1KG0B 2E47A 5EBLA 2J74A 3W3BA 3P0YL 4E9WA 1N5AB 4M1DL 2OZ0A 1VF8A 3GVWA 4G6AD 1V6YA 1ETA1 5I3JA 5BZDB 4ZMAT 4GRLB 2J6EH 3CFEB 3VTAA 2YL6A 3AIBA 5BO1L 1UIOA 1QWKA 3BWWA 4HLJA 4FQ1L 1L6ZA 1H61A 4E9VA 1BJ8A 2JIEA 4D0BA 4WHTA 3RAJL 3MO7A 1DN2A 4K2UL 3FMGH 4OI9A 3H9HB 3G9VA 4KXDA 2N4IA 1ZBVA 5J11B 3ENLA 3QFJE 3RVVD 3AGWA 5D02A 4C6PA 1NKRA 4XG1A 1MAMH 1XH2A 4YL2A 3N2MA 5IXEA 3GD1C 4HWZA 4QSFA 4KKAD 4C1NA 4ZMQA 1NC4B 2Y62A 3HB9A 3LV5A 4ANXA 5D6DA 1DBBH 3FFDB 3FU3A 1UB5A 5ISZB 1PGRB 4M1BA 4GD0A 3KDMB 5I18L 4YFLF 5C6TL 5EU6B 4O10A 3IM1A 4GWEA 4UYQA 4G9FD 4CNTA 4PN6A 4XCNA 3X17A 3IIOA 1BFVH 3GYRA 5BV7B 1D5RA 1FQ0A 4AZ6A 4WV1C 4HC1A 1NGWA 4IFKA 2J3SA 2Q3XA 1X97A 3IE4A 4GFXA 5I28A 1LP9E 3KHDA 2YKKA 4NYYA 5GS1C 1M05A 2X5PA 2G4EA 4U4MA 3MZ2A 2CR0A 4PR4A 3RX9A 5MENB 2VYOA 2EECA 1OBAA 3FUKA 2VENA 4JFPA 4FFVC 2YB1A 2O5ZH 1A25A 4IQLA 1XSJA 2LTQB 1JV2B 4PGBA 3MOAH 2DZBA 1SEQL 3NH7H 2WVVB 1FRGL 3A64A 2WBJD 4HPYH 4N42A 1CLCA 4PPTA 1W1PA 4ONGH 3SKJH 4RFEA 1NUNB 4H2AA 3HAEH 3ALGA 4C6DA 4NUGH 2MOGA 3I68A 3WL1A 2WZ5A 4Q8BA 4PJFB 3GVVA 1J1OH 4YNGA 3EBIA 5F9OL 2OMBA 3SO5A 3IFPB 1K8IA 1KKRA 5D7LE 4YHLH 3OKKB 2CZEA 3SCRA 1DSYA 4HWUA 5IOKA 4JX4A 2VXQH 4Q4OA 5EOTB 4QTHA 5CAKA 2DKUA 4R4ND 3KBNA 5D7SL 3OAYK 1PE1A 4PIRF 3VKAA 3WAKA 1GVIA 1NCDH 4YSOA 4IDLA 4MJJA 2HZHA 4XZUB 5D1QD 3R1ZA 1GOWA 1E6NA 2QF7A 2OZNA 2VXSL 3LEVH 3O4LB 2K0RA 4X9IA 2X4OA 1JHLH 4Y4KB 4N2KA 3S3DB 4PJ8C 3MRPA 5H6HA 3FKRA 1W8GA 2AK1L 3RFRA 1A5SA 4UAHA 4JYFA 3LQMA 1ZA3A 2WJ5A 1J1PH 3ZKQD 4FNPA 4ZSUA 3DXAE 3W0WE 4X4XB 3QZWB 4ELMB 5DT1H 2EF9A 3FQXA 1SBBA 1YEHL 4ECLA 3VXPA 2C4FU 4S38A 1UH2A 1NGPH 4H3DA 2YAMA 2RTTA 4QXWA 5EEWA 2NXHA 1ZAGA 3MRJB 4PN2A 2VN6A 4Y4HB 5A16A 3AIRA 4XD5A 4PCKA 1ZPUA 5DYOA 2CXGA 2EPNA 3RA7L 2BNQB 4TVCA 3L54A 4F9LC 3TOPA 1LUCA 1QW7A 4TNWF 5LAXA 2FVNA 4YE4H 3MJ6A 4GIAA 4WDXA 4U6VH 4FNRA 1IM9D 3LLDA 4FQXC 3GRIA 4J28A 1E8YA 4JB9L 3WCZA 3N44B 3UPMA 2YEQA 3SRHA 3BPCB 2C79A 3Q9QA 1TZ7A 2DU2A 2C4FT 2WM0A 1IF2A 5ENLA 5ALBH 1TTFA 4X6CA 5DX7A 1KRBC 1WBZA 2WW8A 3V36A 1ZT4A 5IFJA 3LAFA 5H35A 4C6IA 4EIUA 4AVNA 4GKZB 2ZRZA 2ADJA 1VZGA 1F4WH 4L1HA 3GRWH 2GDQA 1QLEB 2FO4B 4KI1A 1EWHA 4LSUL 2LABA 4TVPL 4OCWH 1LWHA 5D2VA 4QDWA 4X8GA 1SY6A 1AS6A 2VJXA 4ZQTA 4PVMA 1BF8A 3C08L 1KDJA 4P57B 4NT0A 4NKOB 2E75C 3PPEA 3AM8A 2QSTA 4AENA 4AYDC 1OGPA 3LKQA 4N6RA 4EPBC 3P81A 4XPBH 5D7KD 4AGOA 5FUOL 4EP8C 5EULV 5ANMB 1W0WA 4X42A 4Y7OC 3ZR5A 1UR2A 2B7QA 4H20H 3BFOA 4HTYA 4QLKA 1UD2A 2WMGA 4F8LA 2CYGA 1KLGB 3B7SA 1OC7A 3TT3H 5BMFL 4UTBH 4DW2H 1HEZB 4IOTA 5CBJA 5J9PA 2P8BA 4Y9EA 3K5RA 1UA3A 4MJ2A 3QYCA 2FDSA 1KXVC 1L6XA 4BDVB 4KHTH 5A6LA 7PTDA 4F92B 1H6EA 3UAEA 5AZ2H 3G5XA 2OTWB 3LY6A 2IUZA 2R4RL 1U4EA 1L2QA 1QR1A 4ZTYA 2OW7A 1UZ6E 3Q6GH 2P8PB 4I89A 3WY4A 2EDTA 4W93A 2CKNA 2BRRH 4PJBF 1DCEA 3P69A 3PPSA 4DYJA 2FWUA 3GIVA 3QEQE 3LTVA 5JHLL 2ZKHH 1GT8A 2C5DC 2E7CA 1O7VA 3M0MA 1MY5A 4LAKA 1CI1A 2UY6B 4PJHE 1LLOA 5DJDB 1TU2A 3BGFB 4NN5B 3WLLA 2R0LH 1GGCH 1HS6A 2OI9C 3ARQA 4XNQB 4O52A 2OT0A 5DJCB 1I9CB 3PGCA 4JIRA 1CYWA 2OYLA 2QVKA 2VWSA 1WTGT 2EZ0C 3R58A 1QFWI 3EGXB 1TO3A 1HXJA 3LKSB 2HG0A 4WEBH 3O6LL 3P93A 1W72H 5FO8B 1Q6DA 3V4PL 3NCJH 5LXXA 4UIKH 4HU0A 4O1AA 2JBMA 3QP3A 3JZ7A 4FXLA 5AW9B 4ERSH 3T4WA 4WKFA 3OO2A 4G5ZL 4QXGL 3L9RB 1BD2D 5DHVH 2WTRA 1FP9A 1OTTD 2F8VA 1TV8A 2VXTH 5B3JE 2A2IA 5BXTA 1HX0A 3SGKC 1M1BA 2BMBA 4PRPA 3CJJA 4JPSA 1H6TA 2GTWA 5IRPA 1PVHA 1KB5L 4OGAD 4AGPA 1RZMA 1OVZA 3BKCH 1TJRA 4FX6M 1AIFA 2BVPB 4GSQA 1QPOA 2C9VA 1ZAIA 1OF2A 1MHPL 1A5OC 2DTML 2OMXB 1XYBA 3P77B 1L0QA 4KCVA 4YHOL 2ICWA 5BMWA 4ANWA 3DUUA 1FFQA 3KH4A 1UPMB 3O06A 4POCA 1AC0A 3NQAA 5KJ4A 1VYPX 1IRAY 3CV6A 4O1CA 1TIWA 1NCWL 4DXXA 2L3BA 1KBJA 4Y9MA 1NIBA 4LCCC 2WVTA 4N9BA 4DN4L 3EYSL 2EXWD 5IWLC 1JN6B 4FN0A 2KZHA 5I1JL 2GSMB 3C52A 4L37B 1B9ZA 3MRNA 1N2RA 4HYWA 5FK9B 4Q8OA 5CEZL 1YEJL 2EDWA 4AXWB 1SHSA 2Y2YA 2G8ZA 2A99A 4FX7A 5CBIA 1RXLA 2CESA 4N87A 5TFSL 1IT9L 2C1PA 3QPZA 3QRLA 4HIXH 3MUCA 4PVLA 4GMTH 4XX1E 5JPMC 3SOBL 4ZS7H 2VABB 2ILLA 4ZMLA 5H91A 4Y8EA 4XAGA 1YLVA 4KZCA 5A6BA 5LQBH 2IFGA 2PWFA 3U6RB 3MRGA 1B2YA 2CIPA 3S88L 2CHZA 4LPYA 2EINB 1CR9L 3ARDB 1SMDA 3HB3D 2FZBA 5C9XA 2MRYA 2E5BA 3RVXD 1T83C 1TPWA 1E5JA 4WKAA 4FYSA 3NPSB 3TBTA 1MG2C 1I8KA 2DAVA 4QXTA 2J71A 4CAGA 3Q06A 2QPDB 3L4CA 1F90L 5C54A 3OC5A 2HG5B 5AB2A 3D4CA 4J5VA 2VLKE 4Z3GA 3DSNB 3FHEA 5C2UB 2PDQA 5E5MA 1M7JA 3EHBC 4N22A 5GGVL 2QCLA 5E0FA 3FK4A 4HGWB 1SEBA 2O56A 2CHNA 1H62A 1PYWA 4NHCH 3HGRA 4INFA 4XI5C 4O0QA 1NL0L 1E4HA 4L5FH 1S1RA 1AG1O 3GR7A 3D2UA 4IIHA 1WBYA 2ZZ6A 2PTTB 3SDCB 2O6PA 4HIHA 1B57A 2B59B 3SKUD 4J1UB 3IIVA 3DCPA 1V0LA 4UTAH 4XC3L 1KCWA 5CSZA 5FKPB 4JQ2A 2ISFA 3TVAA 1NIAA 1R5VA 1O5RA 4LNCA 4QHUA 4NFBA 2WSRA 4CQCA 3WS6C 3GXPA 1K1DA 2XINA 3LGGA 5EA0H 4YPGB 3BIKA 1U8JA 3V2AR 3FFSA 5AC7A 1KRCC 4TUKH 3QXWA 1YNYA 1DVYA 4HKBA 4XX5A 1UZ1A 1T99A 2BLEA 3BUPA 2BSRB 3W85A 2KKQA 4G42A 2BSSA 3OX8B 2Y61A 5F7KC 4Z18A 4LYRA 2ITDA 3HAEB 4A67A 5I17A 3E9TA 2ZUQB 4ADTA 5AD0A 4WEMB 2WMIA 5EB9A 4LT7A 3KWWA 1WNOA 1S7TA 3TYDA 3OXSB 4ZFZA 1TENA 1K02A 3MLYL 2Y7QA 3CHCA 3BLLA 3CXFA 4PCSA 4XVJL 1TQCB 4GXVH 5C07A 3MRQB 1U33A 1FG2B 3H9SE 4AQ1C 4C56E 3S37H 1T1XA 3BH4A 3VFRB 4XPGH 4UM8B 3ARGD 1OGTA 3E02A 2G5WA 2AI0L 2V5YA 1HZLA 3L7FA 3LCYA 3MSGA 4ODTL 4KX9A 4LT9A 3BJLA 1HHKB 1H7WA 1PKMA 2OXGA 1SO4A 4PRPD 3KS5A 1MFMA 3BCDA 3T42A 4NASA 4POYA 1FNLA 1N0XH 2ZUNA 3EXJA 1QR4A 3F7JA 6PAZA 1AW2A 1NM4A 2EYRB 3L4TA 4MB5A 5H4ZA 2EH7H 5DFWH 2NW2A 2AVGA 2K8MA 1U8IB 4MD4A 3MO1A 3UG3A 2BP1A 4AIOA 1NBZA 3WQ4A 1GHFH 5B3NA 1Q9LB 3QV6A 5AOIA 4JANA 4R96A 1KB9J 1QI3A 4KQ0A 3LSBA 2WQVA 1WYIA 3QY6A 4YIQB 1N64H 1Z9SB 1O12A 3UT0A 3LJ3A 3GMOA 3LRGA 4OQTA 3VXRB 4Z95H 1IKNA 3S2NA 2YCKX 2QGYA 3FB7B 3MZGB 1CB4A 3FO0L 5ENWB 3I75A 5EO1A 1M2OA 3D85B 1LYQA 3LIZH 3HMWH 3O8XA 1C08A 4WW2F 3FO9B 4Y1AE 1FWAC 1R2TA 8PAZA 2QTEA 1GW9A 3VXQA 3TJHC 4QJ1A 4ROPA 4WY0B 1ADQL 4NIRA 1UZDA 3GH7A 5I1DB 3WL0A 1UVQB 1IEQA 2DZPA 4L2LA 2D3VA 3CIAA 4KVNL 1JCYA 2D7MA 4BUQA 1QSFE 3R8HA 2VC5A 2A3EA 4ZA0A 1K85A 2IDTA 5K9QI 4F57L 1E4JA 4O16A 5BNKA 3TBWB 5FCUL 4TR9A 4Q0XL 1RZJC 1A8JH 5A6BD 5AZUA 1E90A 3LH8A 2X9WA 3QUXC 3NBNA 1NMCB 1RQHA 3T2LA 2Y89A 3UCDA 1TPUA 2GJZA 1YN7B 4QLJA 4DQWA 4WFGD 3R6IA 1YX1A 3P3UA 4DP9X 1OOWA 2AOSA 1Y18B 1ID5I 2C3VA 1P9MA 4MDIA 3JV4B 2WKJA 1SYTA 2FJUB 2GITA 3MLVL 1L4IA 3D3VE 1GQLA 1GGOA 4XX6A 3ABLB 2R9HD 1BXCA 4Y5YB 2QAFA 3PGFL 3IXAA 1OGAA 4ZPVB 3UCRA 1DJYA 5ITFA 1DVXA 1ORQB 2EE3A 1MUWA 3NJVA 3SQMA 1WHOA 5M2FX 3L3OA 1AD9A 2XZQL 3F00A 4TMPA 3UTZA 3HN8A 5JUEL 4K3ZA 5EO0B 3IN0A 1MN4A 4LUJA 5T5FA 3QYSA 5D5ME 1MW2A 4DKFL 3HE7B 5B38G 2L04A 1NH6A 1A4KB 4LZKA 5D9PA 3IGUA 3D39E 4M7LH 1W5NA 2AERT 4EI5A 4XQ6A 2QADB 1TA3B 5EYWA 1CT5A 1E28B 5TE6L 3N50A 1UQZA 4CA4A 1E8XA 4BH8A 5F1UA 3PBYA 5IFAH 3CXOA 1KTKE 2CGRL 3FCSB 1YY9C 3WXVL 5T1DL 1QPRA 1M9HA 2OBGA 3TR2A 1GC1H 2V8MA 1Y0LB 3NZUA 1RVGA 1LWIA 1XTMA 4P46C 1EGVA 2LLGA 2J47A 1IWBA 4PMYA 4NZ1A 3VSQA 2VUNA 4PV8A 3WD2A 2Z4QA 2X6BA 3Q5TA 4MKTA 4OD1L 4OFKA 4XXDB 1L9RA 3KPMB 3TYFB 1NDWA 3GDKA 2IPKA 2CPUA 3F7YB 3HPFA 2P5EB 1SDDA 1QMLA 3TT1L 4P8XA 2C9XA 3L2LA 4IUOA 4S3AA 1RZKC 1M7DA 4P2OA 5DD3L 1PZCA 2DLFL 5IB4A 4JJ5A 4EN3A 4Z7WF 1E1FA 1EK3A 3HNVH 1MQPA 1NP2A 3LQZB 4GJ1A 4LL9A 1EDYA 2W07B 3SCMB 1MAKA 1CD9B 3ZZSA 4PRIE 4AIBA 4AIUA 5DURB 2HS6A 1WWWX 2YEZA 1H3GA 4WFHE 1MVFA 1FCBA 5U7SA 1YNKH 1W72B 2YUWA 2W88A 4AC7C 1GZHA 4WJ8A 5C07D 5CJBA 1KR0A 5DK0B 1IVTA 3SPVA 1JR1A 1NDMB 3QKEA 1JZFA 5E5RB 3VG0H 3HF3A 4MAYA 5DHVB 4QNPE 1D3HA 4ADIA 1UWRA 1V3KA 3V4UL 1QPXA 3SD5A 1RJYB 3NA9L 5LNRA 4HEPG 3OIXA 4PS8A 1AMXA 4ISVA 1IGWA 4U2ZA 5DS2A 4Z2KA 1VFUA 4RRPM 3PL6C 3I85A 3J8F7 2BASA 2BY3A 1SO6A 3VCCA 3TV3H 2J8OA 5ALCH 3G5ZB 4PRDB 4EDXA 4N2BA 1JGMA 3IAGC 1RCXB 2C1OB 1N6QL 3N34A 2JFEX 3CU2A 1D7KA 5HHXL 4PJAB 1IEAA 2VH5L 1JNHB 4OW6A 3RIAF 4IMLB 1KY6A 1II4E 1TUPA 5KZ6A 5IHUH 1H15A 3DO4A 2YUVA 2QGDA 1N7MH 4ZQCA 2IPJA 3CAWA 3TQKA 1NQBA 2NXYD 1OP4A 3NL2A 4I9XA 3CL6A 4M7TA 1FE8H 1EO7A 2FB3A 3BN9C 1S7UA 4Q32A 1GGIL 1VBRA 3V5FA 4TQHA 1JWMA 4PWGA 4JKLA 1ESOA 2KZWA 3ZTDC 1KLZA 2Y85A 1INQA 4DJFA 3RKPA 1TTAA 5A6KA 4KO5A 3NK4A 5DD1L 1PZBA 4GYKA 1IUZA 1HXYB 1YLBB 2VT0A 4TL5A 4YHYB 1NKGA 5DK2A 3SE3C 4YHPA 2ZFAA 4P2QB 1J7VR 3T65B 3IF1B 1JPIA 3GNMH 4AVJA 4MQTB 3KZ8A 2JB6B 4X5RA 4ODWA 3LCXA 3L3IB 2W9EL 4L8DB 5A2CA 1WLHA 3N2JA 4GQQA 4J2QA 2YSSA 5E6ID 4IMKC 2P8MB 2F6UA 1IAKB 3DBXA 3OKLA 2JKJA 2A74C 4JRXE 4MKSA 5HATA 2ZX6A 1F13A 5FYJU 1LLZA 3VPLA 3TA3B 1MWOA 1OSZB 2C3WA 2MQGA 1ZLVK 3EUUA 2D1ZA 3V52L 2J7GA 4L1TA 2PTZA 1ZP4A 4JKPH 1USZA 1RIVH 4MWAB 4UNVA 2PP3A 4JGMA 2K1MA 4V2XA 1UFGA 3AABA 3AY4C 4I1RA 2V5MA 1PS9A 1CGSH 3OG3A 4A7VA 3ZLQC 1LEIB 1MW1A 3IRSA 4IU2B 4L4JA 3LPOA 4XCEA 4IKLA 4TOQA 3GFXA 4HKJA 1NY1A 2CO7A 4KMLB 4A6YL 2HJPA 4QRNA 2J5WA 5EMJA 3FSUA 4EI5D 2ZA2A 3MJ9A 5E2VH 1EXUB 3OKEA 1NTHA 1DJQA 1IZCA 5HGDB 4PG2A 1F4AA 3BLIA 2PU0A 4QRPB 2PPAA 3KXFA 5F7WC 4U6XA 1JAEA 3STLB 3EFOB 5BZWA 4OIFA 2NY1B 4WY7H 4LVOB 5EBUA 4X0KB 2J8UA 4PLJC 4CN4A 3BP7A 2VSDA 3GKAA 2I5YL 5C0IA 2FEEL 1FFPB 5HJDA 4D0DB 4YNYB 1MJ7L 4OUUA 2H1PH 1UASA 2BDNL 1KTRL 5AKQA 3Q48A 2XICA 4ORGB 1JG9A 3NZQA 3DN5A 4UOZA 4PREA 3BLOA 5FEPA 4PMQA 1Z3GL 3HOJA 5DQDL 3S4SA 1ZVYA 3DIFA 2E59A 1JZ3A 2Z6JA 1P1ZA 5FLVA 4N85A 3NRPA 4JDTH 1NBVL 2WJZA 4P2OD 4LLQA 2IH9A 2VRAA 4EN3D 2Y1HA 2GHZA 1Y5VA 4PS4L 3QXAB 2YPVH 1UJTA 3Q6FA 3OLGA 4HNCA 3D50A 3IGAB 3EF7A 3UU0A 2BIHA 4BQ9A 1DVFB 1IT0A 3N6YA 3OBEA 4QBXA 2DWEB 4PJFF 5JZ7D 4QJ4B 1UC5A 4IRJC 1BM7A 3VQ2C 1A6VL 5AC8A 1A50A 2X7WA 4XE5B 1DLFL 4BKSC 4MAYD 1PEZA 2QEJA 2E27H 2CGZA 3U9UA 4PI2A 4RLIA 1X1ZA 3DENA 3CZGA 3YPIA 4KRPC 4OZGE 2MCG1 2GG1A 4OZ4A 4HG4K 1XLJA 4DFHA 3R1GH 3FA4A 1HHHA 1NBCA 4IKNA 1TVHB 5ABGA 3AXMA 4FQJL 5TPWH 3QUYC 3DPBB 3VW3L 3FY1A 4BCZA 4XRCA 2EIZA 4TS6A 1FNFA 4GFTB 3FCTA 1VHNA 2XA8H 3TXVA 2FGZA 4M02A 1UZHA 3RLSA 4B96A 4ELMF 3L3HB 4HS6A 4QWWC 2EH8H 3IRDA 5E1GA 3DARA 5EF2A 1B88A 4NZ8A 3TS8A 3LLFA 4K23L 4Q4PA 1HWGB 1MFBH 1TVLA 1M9WA 3KL3A 4AM0B 1P4UA 2DGAA 2NY3D 2YDSA 3L17A 5LBSL 3VOFA 3NIYA 1QFEA 1X6UA 1WPCA 1W16A 1B3ZA 1CGVA 1CURA 2O5YL 2WCSA 4MJ4A 3AAMA 1PX8A 2WZIA 1BM3L 1FDLH 1I6NA 2WJFA 3HW7A 3L16A 4Y9PA 3DMMA 4C57C 2ROYA 3FXGA 1U8KB 5KANI 5FCZA 3FYOA 2INEA 3N44F 1PZ3A 4NQDA 3NPVA 2X0UA 5HK4A 1OP9A 3HJEA 3BVNA 4GBXB 3VGEA 5CZRA 3VFNB 4EQ3A 3WIJA 2J7FA 4ES8A 1LO2L 1CLOL 1T66D 1T8QA 4U5KA 4YGAB 3HG1A 2X40A 4RZ4A 4OT1L 1XGRB 1MUJA 4YN3A 2QSQA 2H6RA 3ZQ9A 4RISH 1IWAA 3PNZA 1ALDA 1NC2D 3B4UA 4EI6A 4D8ZA 1K4CB 2PDHA 4X22A 3K2GA 4P4KD 1KV5A 1GYVA 4YSAA 4YLBA 2Q8AL 1KCZA 1M7IB 1DQTA 1JXJA 4YDNA 2W61A 4NNCA 4FCAA 4L6DA 3O45B 1MRQA 2X1PA 4QAMB 2NYKA 3FRPG 3P9LA 4JRLA 4PJ5E 2WWDA 1DQQB 3RUBL 4TXEA 4GIRA 1WS8A 2BVEA 3S5NA 4WDUA 1G4SA 1S7RB 2R69H 1PKQE 3S5OA 3RL1A 2D4DA 4DN3L 1SOXA 3OJDA 4Z7AA 3BH9A 3NG3A 2YD6A 3WH6A 1J5HA 1RBLA 5MHSD 3KXFD 4X7FC 1VFSA 1TCRA 4LLAA 5IDZA 3O6AA 3PREA 3WJMA 4JFFB 1E67A 3QXVA 4YDKL 4ADGA 4H26B 3U25A 4N2DA 3HQ1A 4HUMB 4J8RB 1WTLA 5K93A 4WO4A 5REQB 4OBSA 2DEWX 3RMEA 3CLFL 1VJZA 1XCFA 1E50A 4KROB 3FAXA 2CKBL 4LSRH 5CLWA 5JBFA 3VTRA 1CK0L 2LW3A 3GS0A 4IMDA 5E00B 1TZHA 1U8OB 5JHDA 1TJXA 1TR7A 3KWTA 5A8QA 3B9AA 2XH4A 5C0AE 4FF9A 2AKRA 5I1EH 3EEGA 3PIQB 2KHAA 1KUMA 2CRYA 4AD0A 5DVPA 4MIMA 3HFTA 4W9TA 5A8GA 2ZC8A 2YA1A 3I6EA 4AY7A 3EB4A 3T09A 4M7SA 4QTGA 3CSFA 3V0FA 2YCIX 1N7KA 5TE4L 5HI5C 1K6QL 1UMYA 3PDOB 1VPYA 3SW6A 2FQEA 5LUMA 5I9QB 3NACL 1ZCRA 3WZ0E 2WPGA 1CW2A 1PY4A 4WI0B 4KAQL 5EORL 3PS6A 4I5UA 2GOUA 1IL1B 2O5XH 1ILSA 4DF2A 2Y1ZA 3M5YA 3O3AA 1R6WA 5GRYA 4AUYA 4IJTA 2IQAA 3SCTA 3RTQD 1XZWA 1JGDA 2NY0B 4LHJB 2AGTA 3QJFB 2GIMA 1HHGA 2I7OA 4G9FA 2YW3A 5I8OH 1M6UA 1NOLA 2UWEB 5GJSH 4DVBB 1JE6A 5BRZB 2CZ5A 3HLAA 3NJFA 2F8OA 3GBLA 1K7EA 3BOXA 1UD4A 4APQB 5DFVD 5EU5B 4MBOA 4A35A 4U4BA 4FO4A 5CP7A 3SDYH 4W4QA 4LCIL 3KFTA 5IMMB 4NQSB 2FBRA 4UQ3A 3V0GA 1R3WA 1MELA 4DK3A 1HG3A 5BUPA 5F9DC 5DGQA 2BK8A 3EYVB 1F3DH 1UKQA 1KIQB 4W7UA 1S3HA 4JDYA 2MQ0A 1GJWA 3QZMA 3PUUA 2ZOWA 1Y6NR 2VSMB 1DEDA 3N5AA 4HIIB 3X13A 4YC2B 2WBJA 1OHLA 3FKKA 3NSMA 3QQ3B 3CEUA 1I1FA 2DJSA 4XVDA 3V18A 2V2XA 4LIQL 4BSWA 3V95A 3HHSA 3USBA 1R2RA 4I4WA 1OE2A 3PRZA 1QNOA 4ATLA 2VC2L