1XH2A

Structure of the n298s variant of human pancreatic alpha-amylase complexed with chloride and acarbose
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 175
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xh2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xh2A01
1HJXA 3VIOA 3VD5A 1KCLA 3BAXA 2DT0A 2UY4A 1HJSA 7TAAA 1RH9A 1V02E 4H8HA 4W93A 2OYKA 3WN6A 1V6WA 1GQKA 5A8MA 5DT5A 1HIZA 1V0NA 2PC8A 3L4UA 1R7OA 1HJVA 4MNJA 2ZXAA 4HTYA 1W9XA 2XWDA 2BFGA 1CXHA 2WMIB 1XGZA 4HU0A 2VURA 2BVDA 3ARTA 3QOMA 1CXKA 4W88A 2XN2A 1DWJM 3HN3A 3IJ9A 4XZBA 1TCMA 3I3BA 3OB8A 3NJ3A 3THDA 1V3JA 4AZIA 2F1BA 1NWUA 5D9OA 3CZKA 2BY2A 1HX0A 3H54A 1A3HA 4J28A 4UR9A 1O6IA 5A8QA 2WHKA 4UTFA 4JFTA 3KWXA 5E70A 1BSIA 1JG9A 2OSXA 5E0FA 4WLCA 2WVTA 1V08A 5CPQA 3GH4A 3AHYA 3OBAA 1JF5A 4NZCA 1UH3A 4BA0A 1VIWA 1W9DM 5A2BA 4AD2A 5AC4A 1E6XM 1VF8A 4AEFA 3IANA 2Y5EA 3LPPA 4PBGA 4C7GA 2WCAA 3AI0A 3WD0A 3VIKA 2V3EA 4PMRA 4CCDA 2F1AA 4FNQA 2J7HA 1W3LA 3MV01 4UQAA 3WDIA 4PTMA 2EXOA 1QOXA 1F4AA 3OZOA 4CD7A 3VIPA 3GH7A 3EYPA 1NM9A 2WK2A 3CZJA 1PX4A 1QX1A 2CKSA 2ZUUA 1BTCA 4A4AA 1WZKA 3QGVA 4IISA 4CCCA 1K9TA 3SCSA 5KZ6A 3AICA 3CGTA 2EPLX 1H49A 2YFNA 4CU7A 1E6PA 4AYSA 1H41A 3A4WA 3HMCA 2XJ7A 3GNPA 3HG4A 1B3YA 3IAQA 3ARZA 3L4XA 1W1PA 3UCQA 3PHAA 5A95A 3TONA 4AD0A 2WLZA 1CDGA 2QHAA 3ZR6A 1E4LA 2WC3A 1SYTA 4TOQA 1JL8A 3CMGA 4Z2LA 5I24A 4U3AA 3AMDA 1Q6CA 4BQ4A 3IK2A 4AIEA 1VFFA 4EAMA 2QPUA 4F9JA 1C7SA 3BC9A 3WDPP 1LJYA 3GNRA 4PMNA 4AD3A 4FMVA 3BSGA 2W66A 3ARVA 3APGA 4AZBA 4W87A 3L2LA 2OSWA 3AOFA 3D4YA 3PZOA 4PTXA 5M03A 4C7FA 3W82A 2X2HA 1DWIM 4KWUA 3TV8A 4BS0A 3KE0A 3SEPA 2D24A 4A3HA 3AIUA 6A3HA 3NIYA 1GOIA 1XSKA 3VX0A 2VMFA 5GNYA 1ISVA 1MVYA 2YBTA 4OUEA 2DQXA 4U2ZA 5EFDA 3BGAA 4D6JA 5A6JA 3BAYA 2YOCA 3WEMA 5E9AA 4DWSC 1CEOA 1EA9C 3BCDA 5BXSA 1VEMA 4C7DA 4P8UA 3SCQA 1I1WA 1OGGA 4M8UA 5I78A 3WL0A 1J12A 1HF6A 2OW7A 3A23A 1ODUA 2VR4A 3AXHA 2BV9A 2WMKA 2JFEX 1GOMA 4PTVA 2WBKA 2C8NA 3EMCA 2VI0A 3ZM8A 4D72A 3CZGA 5HBFA 2GJRA 2XG9A 2XSBA 4JFUA 1CXFA 1E1EA 1T0OA 1KXVA 1W9VA 3BUBA 1E56A 4UOQA 1UKSA 4D6FA 1KBKA 1B0IA 4CCEA 1D2KA 4DM1A 2OW6A 2JF7A 2OLHA 1PPIA 2YLAA 1JZ4A 4ZXOA 4DM2A 1KTCA 3LRMA 5A69A 1W2VA 4HU8A 4BF7A 3PZIA 3IAPA 2XM2A 1U2YA 3W25A 3CHCA 3PZUA 1UOKA 2D2OA 4S3JA 2C7FA 3VDAA 2XSAA 2X2JA 1WZAA 1RD6A 4GZJA 3WNMA 1KGXA 3ARWA 1L0PA 3FHQA 1NARA 1NQ6A 4GI9A 1FHLA 3WBAA 1GQIA 3N9KA 2VL4A 1JZ8A 1MXGA 5A6BD 4U5IA 1O7AA 4D71A 5IHRA 1HL9A 1QWUA 1V3KA 1CGVA 2NT0A 2AMGA 1V6UA 2XFYA 2IXUA 2JIWA 2GDUA 4GI6A 4B3KA 4PRWA 3GXDA 1GOWA 2V38A 2PI6A 3ARQA 1MW1A 3LPGA 1OT2A 4AD4A 1PX8A 4EKJA 1B90A 2WM0A 3IGUA 1H3GA 4LXFA 2EQDA 3RJYA 1Q6EA 2XGBA 3WMSA 3ZT6A 1GONA 1H11A 1X6NA 1R86A 3AHVA 3OA5A 3GYCA 2JF6A 3VDHA 4OZOA 2J7BA 4JKLA 2VR5A 4YPJA 3FY1A 4ZEPA 1C8YA 1LL6A 2W91A 5CSUA 2E9LA 3LXAA 4AXNA 4W8AA 3THCA 2PWEA 1KWKA 5DF0A 4GQQA 2G3IA 3WBEA 2PF0A 3CUGA 2YL9A 2FHBA 4MNMA 4R27A 2IXVA 4M81A 1NP0A 3AXIA 2OYLA 1EDTA 3WQVA 1W91A 4UQDA 3A5VA 1VFOA 1OIMA 3AHXA 4W8BA 4TVCA 4MB3A 2EJ1A 4UOJA 4Q7NA 4QLLA 4CGTA 4AY1A 3MUZ1 1FP8A 2D20A 5BRQA 1W9UA 3SUVA 2D73A 1HJQA 1HP5A 3UEQA 3ARPA 1QNRA 3N17A 4H8VA 4BQ5A 2E9BA 2Y2WA 5C71A 4DUXA 2O92A 3VMOA 2MANA 2VZUA 4HOWA 4F9DA 2BVTA 2WZHA 3FW6A 5CSYA 4PMUA 1HT6A 1E6ZA 3GDBA 2DSKA 3BH4A 2XM1A 3AMLA 3S6TA 3EDEA 1TR1A 2WB5A 4NZFA 3BVVA 5CZKA 4MTVA 5ABGA 3J7HA 2VCAA 3DX0A 1IZKA 4JFWA 3VDBA 2PWHA 1E3XA 3PZGA 2W92A 3VGHA 2E4TA 1QWNA 1CWYA 2QPSA 3WQ6A 1XSIA 3MS8A 3VO0A 4QAWA 3WNPA 1UR4A 3VD3A 2ZUSA 1K6AA 1NWRA 1JZ3A 3RM9A 1BHGA 4W84A 1UWSA 1WKYA 4TXEA 4JHZA 3N18A 3W0KA 3VMPA 3BSHA 1S46A 1BGGA 3RDKA 4IM4A 4TX6A 5C70A 1UR2A 3ZJ8A 1EOMA 1G9HA 4LYRA 1ISWA 1KCKA 4MPKA 1GPFA 3K1DA 3WY2A 2EEXA 2FHCA 2CBVA 2D22A 2J79A 3W6LA 5EMYA 2VQUA 4W5UA 1LWHA 1QPKA 4MAZA 2BHUA 5I5RA 4WSJA 2VX4A 5IXEA 2ZUVA 1QHOA 4LGXA 2WHMA 3VTRA 3VNYA 5EB8A 2G3JA 2C0HA 2XHYA 3B8SA 2EPNA 3AHZA 2EAEA 4IPLA 1UZ1A 4XZWA 3DYPA 2VX6A 1FH8A 3SCTA 3T0DA 2XWEA 3GXIA 1W9PA 3WD1A 3WNKA 1E4NA 3OLIA 1EGZA 2CKRA 4JKKA 4OJYA 1RP8A 1JZ6A 3DC0A 1CXLA 1GZJA 4K68A 4UCFA 2D3LA 2OYMA 2G41A 3WNNA 3F5LA 4GI8A 2Q8XA 2XVNA 5CJ5A 3A4XA 1HXJA 2GFTA 4FLOA 5BCAA 2VZTA 2WXDM 2IGTA 1UR8A 1LG1A 4ZXLA 2X0HA 3AS3A 2AAAA 1KWGA 3WENA 3N13A 1SMDA 3BLKA 4X9YA 1XHGA 3LXCA 1BYAA 3UR8A 4KGJA 4J27A 4NSBA 5AYBA 1JD7A 2ZE0A 1R34A 2XIBA 2YDSA 1WZMA 3WDJA 1V6XA 4HA1A 4NZJA 3EDDA 3DX3A 1KGUA 2Z1SA 2XN0A 1FOBA 3CHEA 3BVUA 1MW3A 4P7QA 5FOOA 2G4FA 1E5JA 2RGLA 4J3XA 4OKDA 2FH6A 1EQPA 3VU2A 2DT2A 4FLRA 3B9AA 1E73M 1XYFA 1E0XA 4E4PA 1JDAA 1BF2A 1OCQA 2WZIA 4QLJA 2PBOA 3WY4A 1EHNA 2X2YA 3QOKA 2DDXA 2PWGA 2UY3A 1HP4A 2J4GA 1Q6GA 1BQCA 2VNCA 2BS9A 4JL2A 4GZEA 4DUWA 4WF7A 3OLEA 2J75A 1HWWA 3BLPX 1GW1A 1GJUA 3EJSA 5HOSA 1QW8A 3MKKA 2WYSA 3WY1A 3VGBA 1MFVA 4FF5A 3HU7A 3MUY1 4W7UA 1MQRA 1AQ0A 3VD7A 4D6EA 4UOZA 3SCRA 3PTQA 2DSVA 3DHUA 4OBSA 5LYRA 1C91A 1DWFM 1X6LA 3VIIA 3AROA 1KR0A 5ABHA 2BNJA 2A3HA 3AZTA 3G6LA 3PZMA 2J7CA 2EO7A 4PUDA 4AWEA 4HA3A 1TVNA 2F7RA 5I3DA 2WKGA 5BXPA 3ARXA 1JZ5A 1E3ZA 4UQCA 3LPOA 2Y24A 5HPCA 3WDQA 2DSZA 3WY3A 3RM8A 1BLIA 3N04A 4AZ5A 1VBRA 3G6MA 1HJUA 2JEPA 1CGWA 4PMOA 4FLQA 4GZIA 3QHMA 3TP4A 4GINA 2VX5A 3DX4A 3LPFA 3GNOA 3EJQA 3N12A 3BXWA 3SIMA 4X0VA 3BAKA 9CGTA 1C92A 1FH9A 4WIWA 3D50A 5A8PA 1QNQA 5LA1A 4CU6A 4KRUA 2J25A 3AZSA 2G8ZA 1BGAA 3KEHA 2VC9A 1WO2A 2ZX9A 4N42A 1KB3A 3UG5A 5CLTA 3W37A 5JIWA 1BAGA 1IV8A 4Z2JA 3CZSA 5E6ZA 1HNYA 2ZXDA 2WC4A 1EQCA 1UZ4A 4DWSA 1VBUA 4AMWA 5GNZA 1XV8A 3BVWA 3VX1A 3NCOA 4V27A 2D1ZA 3N15A 3VOCA 3WFZA 4AMXA 2ZICA 4OOUA 1E71M 3WMCA 1EHAA 4ACZA 1UUQA 4GXPA 1G5AA 1IZJA 1BVNP 3LRKA 4M24A 4KMQA 4TTGA 5CG0A 2DIJA 1AMYA 3MSGA 3RPMA 1ZJBA 3CIVA 3OLGA 1V0KA 1E0WA 4UFKA 3F5JA 3EDKA 2YBUA 3VSTA 2ZUMA 4JAWA 3A22A 4Y7EA 4UZSA 5CPTA 1UA7A 2CEQA 4DWSD 3SURA 3WD2A 3TTQA 2ALWA 4AZCA 1UH2A 5M17A 4CVUA 1J01A 4UNIA 4JKMA 3A21A 8CGTA 4A3YA 3WQ8A 4ACYA 1JFXA 3WD4A 4E2OA 5FD0A 4M80A 1K9DA 2J47A 1FFQA 5HPOA 4CKQA 1JIBA 2EBNA 3WQ5A 1GJWA 1IT0A 1BFNA 1M04A 1TUXA 4HOXA 1N82A 2QV4A 1VENA 1J11A 4WKAA 1LWJA 3QHOA 1LQ0A 1US2A 1WCGA 4U33A 1GHSA 3MUIA 4UZUA 3PZNA 1CLVA 3POHA 1TA3A 1E4MM 4NXSA 4PMDA 3PN8A 1H1NA 2XVGA 2WPGA 3S2CA 1WAWA 3MV11 1W1YA 2Y8VA 1Q6FA 4YHEA 4U5KA 2XIIA 1PEZA 2VRQA 3OGSA 3DDGA 1ISYA 3D3AA 2Z1KA 3W4RA 4N0RA 1UD2A 1GHRA 5FL1A 4AZCB 3ARYA 3KL0A 1H4PA 3RILA 3AMKA 3UG4A 1E15A 4W7VA 1DEDA 3AYSA 2ZXBA 4GO8A 1XRVA 3I3EA 3K8KA 2FGLA 4MAVA 4HPGA 8A3HA 1MWOA 1OB0A 2XN1A 2J74A 3CLWA 4KGLA 5AYIA 4RE3A 3BMVA 4W5ZA 2BHZA 1G94A 3D5HA 1TE1A 5E1QA 2NW0A 1HXKA 5FIPA 4UQEA 4WSKA 3ECQA 1XD1A 2OSYA 4D1JA 1PX3A 1LL7A 1V3IA 5BXTA 2W67A 3VDCA 2BY3A 4JFSA 1HVQA 1JAEA 4RE2A 3WH8A 4U31A 5IFPA 2UY5A 1VB9A 4AZ6A 1NWTA 4KRTA 2GJPA 2CYGA 1US3A 4W85A 1QHPA 3L4WA 1MW0A 5DT7A 2WVUA 2BHYA 3KL3A 2ZUWA 4MNLA 3WF2A 1BYCA 1GORA 1QI3A 4DO4A 4MB5A 1AVAA 4CUCA 1PAMA 2CPUA 3OGRA 1KGWA 3W81A 1JAKA 2VVNA 5JBEA 4W89A 5GPRA 5ABFA 4CN6A 2A3CA 3TA9A 3W26A 3MMWA 1M03A 2NT1A 3VMNA 1W9BM 4Z2IA 4RE4A 1DWAM 1OGBA 1HJWA 1UWTA 3SCUA 4AMCA 2D0FA 2GJXA 3MI6A 1UR0A 3RJXA 1JYNA 3VM5A 5CGMA 3WH9A 2HISA 3W38A 5A6KA 3L4VA 2V3GA 1JNEA 4OBRA 2O9PA 3SUSA 3IJ8A 1UWIA 2CHOA 2PB1A 5GQBA 4HP5A 1ZBCA 4UFLA 5BXRA 5IFTA 2F8QA 2VCBA 2VZVA 4EANA 3CZNA 2VO5A 3L4ZA 1R87A 5A2CA 3ARUA 3VSUA 3WQ4A 3GBEA 1WDRA 3CZ8A 4J3VA 1DWHM 1B9ZA 3TTYA 3GXPA 1HN1A 1NH6A 3MSDA 3SCWA 1M7XA 4HPHA 3B9EA 1E70M 3M7SA 3WDRA 1XC6A 5D9MA 3K8MA 5A94A 3RM4A 2WLYA 2YKKA 3AS2A 1UKQA 1QI0A 5I79A 1WDSA 4X0NA 3ZSTA 3ALFA 4PCSA 2YA2A 3VUPA 4UFMA 4PUEA 2OWWA 2EPKX 4GO9A 1W2PA 5C8BB 1WDQA 4NF7A 5E09A 1C8QA 4E8DA 1JDCA 4AW7A 1OD8A 4TTUA 4DO5A 5ECUA 2CIPA 4LX4A 3OLDA 3AHTA 2WWDA 4AC1X 4FNSA 1J0ZA 2YDQA 3ARSA 1OWQA 4QFUA 2WMFA 5LA2A 6CGTA 1JXKA 3RMEA 1UD4A 4TX8A 2G3NA 4ATWA 2XFRA 3AIRA 2WHLA 3CUFA 2JEQA 2QLYA 2E8YA 3CUJA 1MW2A 2VQTA 1CENA 1UR1A 3GXFA 1QNPA 1CZ1A 1O7DC 3CZEA 1JGIA 4H2CA 1KR1A 1HTYA 1GNXA 1OGSA 5A8NA 3CPUA 3M46A 2GVYA 1UKPA 3T09A 1EXPA 2WVSA 1OSEA 4DUVA 1GCYA 4MDPA 1UR9A 1DP0A 2WVVA 1I75A 2E40A 2X0YA 2J8FA 4MB1A 4WKFA 2ZX6A 2BY1A 1PZ3A 1W3JA 1K9EA 4CD6A 4UQBA 3KLLA 3K46A 3OGVA 2QMJA 2GK1A 3VVGA 1AQHA 2W5FA 1R7AA 3CBWA 4HMDA 3WKZA 3HG3A 4EK7A 4PSRA 2WWCA 3CC1A 4XUYA 2ZX5A 1KFWA 5I77A 1GVIA 2CXGA 3W29A 2VZOA 5EBAA 1ZJAA 1J0IA 1UWUA 3CHDA 3VD4A 1KTBA 2VRKA 5FCZA 3GBDA 3T2OA 4Z2KA 3CUIA 1UKTA 3O6AA 1V03A 4H41A 1FH7A 3RO8A 1C3FA 1QHZA 1V6VA 2YL5A 3CHFA 2CHNA 4CN4A 4IUGA 4D6GA 3ZT7A 1TVPA 1NOUA 3VILA 4HZ6A 4H04A 4M82A 3UETA 2Y8KA 2W62A 3GXNA 1H0IA 4ZE5A 5BROA 2DH2A 4AZ7A 1R85A 1E0VA 1EO7A 4F8XA 3W28A 1CTNA 3B9DA 4PSPA 4BQ2A 1CGUA 2WVVB 1TQSA 1RPKA 2WANA 4D6DA 3PTMA 4UFIA 1V0LA 2F61A 1HKMA 1J0HA 4KH2A 1G01A 2GK1B 4ZFMA 1TG7A 5JIPA 1JZ2A 1G1YA 1GOKA 1MQPA 3WELA 3BAWA 4QDMA 5HNNA 1KXQA 4V2XA 1TFVA 3WF3A 2CCRA 2VTFA 1H09A 2VT0A 4P7NA 2DEPA 4D1IA 4J3TA 4FNUA 1CYGA 4QCEA 4PMVA 3SCOA 4ATLA 2GDVA 3HJEA 1ZS2A 2ZX7A 2V5CA 5EFFA 1WE5A 3MMDA 2NSXA 3BLBA 2ZXQA 3ZSSA 1B31A 3LMYA 2J7DA 1VFUA 4OGZA 3O2LA 1GOOA 3NSMA 5BYWA 4B16A 3VIFA 2J7FA 2WMIA 3VSVA 3DECA 2YJQA 2X05A 3LXBA 1J18A 2WBGA 4CU8A 3TTOA 4AZGA 2FGZA 2X2IA 4AIOA 1XYZA 3PZTA 4E8CA 1GUVA 4L4OA 3NDYA 4FLSA 2EPMX 3AZRA 1SZNA 2WMHA 1KBBA 4TUFA 1FHDA 1UH4A 2WKLA 2XUCA 4ML4A 3GXTA 3T08A 5CLWA 3RIKA 3K4DA 1E5NA 4PYSA 1WP6A 1CXEA 3HG2A 1E72M 1HKIA 5CQ1A 4CD4A 4F66A 1B3XA 5ABEA 3AJ7A 3H53A 3LRLA 1QBBA 1C93A 1JI1A 3BUDA 1YHTA 1EO5A 7A3HA 2XGIA 4B15A 2CERA 2O9TA 2DPEA 3PZ9A 3AIEA 4MJ4A 4J3SA 1CBGA 3AS0A 2G3MA 2J62A 5D9NA 3N11A 3GM8A 4XV0A 3HG5A 1ZBVA 3WEZA 2F2HA 3FAWA 2V3FA 6TAAA 1B3WA 1H5VA 1U30A 3BAIA 1MQQA 3BUQA 1UWRA 2BVYA 3VIMA 4P7OA 1UWQA 4LPCA 2DGAA 3D51A 2X09A 1UKOA 1CGTA 4Q22A 4UFHA 1OT1A 1J0YA 4W7WA 3EBVA 3ZMRA 3DX2A 5I2UA 2CETA 1OM0A 3K4AA 1C7TA 5A2AA 1QW9A 3KLKA 3A24A 4Z2HA 4MB4A 1UQYA 3AXXA 3PZQA 3ZJ7A 5DEZA 3T2PA 5A6LA 3CH9A 3N1AA 4PMQA 1P6WA 1JI2A 1K9FA 2WSKA 2W4XA 5JUVA 3MU7A 3WH5A 1VEOA 2XYLA 2J8GA 3DYMA 3F4VA 1JFHA 3MUAA 4BCEA 1E9LA 3WQWA 4FK9A 4U3CA 2J78A 1CPUA 2D0GA 3AFBA 4P8XA 3VIGA 3O9NA 1M53A 5IDIA 3VGFA 5F7UA 2YDRA 1BG9A 3AIWA 2XVKA 3FHAA 2FYVA 4B3LA 4PCTA 1XD0A 3WUBA 4H8UA 1U33A 3AMGA 3FNDA 5M5DA 4D6HA 5LA0A 1R33A 4FNTA 3ARRA 7CGTA 1TZ7A 3U57A 1WDPA 1UA3A 4JCLA 1E55A 2UWFA 5D8WA 3L4YA 4GKLA 3KZSA 4AD5A 3EDJA 2DT3A 1UQZA 1UASA 2QF8A 5A3HA 4RL3A 3DX1A 4H7VA 1ITXA 2DIEA 2O9OA 1Z32X 3GXMA 1TQWA 2VZSA 3A3HA 4NXKA 4JZ5A 1RP9A 1ISXA 4HMEA 2BXYA 1SMAA 3WF1A 4YHGA 2Y4SA 3AQUA 2UY2A 4JCMA 4LQ1A 3BCFA 2E9MA 5GNXA 3LX9A 3OIHA 4DWSB 1XH1A 5HXMA 2TAAA 1LF1A 4TVDA 2D0HA 3VPLA 2O9RA 2X1IA 3UG3A 3H55A 3WL1A 4NX0A 2WAGA 4CD8A 5I6SA 3WDHA 1JNDA 1B3VA 1C8XA 4ACZB 3UERA 2F7QA 1A47A 3AIBA 1TQVA 1TMQA 5A6MA 1LL4A 5M3WA 3TTSA 1LLOA 4M1RA 1R47A 2AOSA 3OG2A 1ZB5A 1BPLB 5DFAA 1J9YA 4P8WA 4QP0A 4U2YA 1Q6DA 3VINA 5CPSA 2YL6A 5I23A 3VM7A 1PIFA 4NRRA 4AISA 1J0JA 4WJXA 2A3BA 1L8NA 1JYVA 4BQ3A 4Z2GA 1EOKA 4CD5A 3WSUA 1TQTA 3VGGA 3D4ZA 4GPNA 2YA0A 1ODZA 1PZ2A 3WEOA 1GVYA 3U5UA 2IUZA 2VX7A 3GH5A 2D23A 3SUUA 3CZLA 2OWCA 3BUPA 1GOQA 1VRXA 1PIGA 1JDDA 5AY7A 1UG6A 2OWXA 3BAJA 4W8LA 5E6YA 3M6DA 1MFUA 1DWGM 1TA3B 2EACA 5DMYA 4JIEA 2RGMA 1G0CA 3FXYA 5DO8A 5A6BA 5AC5A 4XB3A 2YL8A 1PS3A 1J10A 4J3WA 3VIJA 3NUKA 1WPCA 2FHFA 2WW5A 1JXJA 3DYOA 1B1YA 3A6OA 1M01A 2JALA 3CO4A 3JUGA 1XSJA 1QI4A 3DDFA 3MANA 3OZPA 3WUGA 4D6IA 1OD0A 2DH3A 2EABA 4V28A 4AEEA 1E6QM 5HDRA 3EMZA 3SCNA 1GQLA 2WCSA 4UFJA 1ZL1A 1UD5A 3QR3A 1VJSA 2A3EA 3W53A 3S5ZA 5I0DA 4DO6A 3ZOAA 4AZHA 3A4AA 3M07A 3AS1A 1EDQA 3NSNA 4JFVA 1EH9A 1UYQA 2YFOA 2CBUA 2E8ZA 3CTTA 4CN1A 3TOPA 3QHNA 3EDFA 3T0AA 2ZX8A 2ESCA 1TQUA 1F4HA 1ISZA 2WCGA 2WC7A 2DT1A 2XPKA 2WMJA 4PEEA 3AMCA 1WB0A 4NI3A 3FAXA 3ZR5A 1H0GA 2JE8A 5BRPA 1VAHA 1BVZA 4ZENA 1KXHA 1QBAA 4QLKA 2VCCA 4L4PA 4R5EA 1CECA 1OBAA 1R8LA 1YQ2A 2W61A 3AIVA 1E6RA 4LYQA 1ZU8A 5KEZA 3POCA 3VIHA 4D6CA 1UD6A 2X8RA 2PWDA 1XH0A 5BWFA 1QNOA 5ABFB 4FNRA 3SUTA 2B31A 2XVLA 4PTWA 2F18A 3AYRA 3W6MA 3WMBA 3L4TA 4MDOA 3BVTA 1D3CA 2VRJA 1Y7VA 2GJXB 3SCVA 1JF6A 3K8LA 1E6NA 2VVSA 2CESA 4AIUA 2ZWZA 3T2QA 3VGEA 4JHOA 4P7LA 1JYXA 1R46A 3W24A 3A47A 3DHPA 2ZUTA 5FL0A 3E1F1 3UESA 1R75A 3PZVA 4UQ9A 2ZUNA 3ZJKA 1V0MA 4XX6A 4GIAA 1QI2A 5D9PA 5A8OA 3ZQ9A 3WF4A 3WUFA 4ZE4A 1CGYA 1W3HA 3BUIA 5CXPA 3CUHA 4NRSA 3WNOA 4PN2A 5TD4A 1FP9A 1BG4A 1EDGA 3WF0A 3ZT5A 1MXDA 3CMJA 1WNOA 1NOWA 1DHKA 1UD3A 1E4IA 2F7PA 2F7OA 1SFSA 3ZO9A 1C90A 4EE9A 1B3ZA 1CXIA 1E43A 2V3DA 3EJTA 1SR0A 4PMYA 5A6SA 1HL8A 3GZAA 1UHVA 3WH7A 4HZ8A 4B9ZA 2YIHA 4M56A 1JZ7A 1FFRA 1V02A 1XH2A 1WZLA 4W86A 4J3UA 1NWSA 3EMQA 3ZJ6A 3KL5A 4IPNB 1W1TA 1GQJA 1BYDA 1PJ9A 1AQMA 3WIJA 1B2YA 1CLXA 2ZIDA 2BY0A 3S5YA 1ZBKA 2YA1A 1VJZA 2WHJA 1NP2A 1W3KA 3F5KA 2CBIA 2PWFA 1JYWA 4F79A 1I1XA 1DTUA 4J7RA 3IJ7A 5CGTA 2J77A 1NOFA 4HZ7A 1HVXA 3NYDA 1QI5A 1V3MA 3EJPA 3VGDA 2J7GA 4WK9A 2GUYA 2W63A 1QVBA 2DSWA 5D4YA 2PBGA 3L2MA 3EJRA 5A1AA 2FDMA 2D3NA 4LYPA 3SCPA 1EIBA 1E6SM 2VOTA 4M29A 2WMGA 1Q4NX 1LG2A 2FE0A 4CVWA 3D52A 1W32A 4MNKA 1QNSA 4GQRA 1UD8A 1E1FA 1MYRA 3NDZA 3U5YA 1CGXA 2FH8A 3I3DA 3W27A 4S3KA 3WFLA 1E40A 2EPOA 3U7VA 3WD3A 3WH6A 1VFMA 1XCWA 3U7BA 4TVUA 4JL1A 4OOZA 3EJUA 5IHSA 3FN9A 1CNVA 1J0KA 4PMZA 2EADA 3PBGA 1HKKA 2YLLA 2WSPA 2WZEA 3CV5A 5FKYA 3T0BA 3VNZA 3RCNA 3BMWA 1V3HA 2A3AA 3AISA 4P8VA 3MO4A 1X1NA 5E0CA 3VD9A 1ITCA 3NSXA 3MMUA 3BVXA 1OIFA 3VKKA 2CNCA 2BXZA 4B9YA 1H2JA 2VJXA 3PTKA 4AD1A 4URIA 4MJ2A 5JBFA 3UR7A 2JIEA 1ZBWA 1BYBA 2XVPA 4HOZA 3AIQA 4FNPA 1FA2A 2XFFA 2V5DA 1KQYA 5JBDA 2E0PA 3WNLA 4OIFA 1VEPA 4P7RA 4BZYA 4PMXA 2E3ZA 2VUYA 2DSUA 5A6AA 1KXTA 4AYGA 2QMKA 3ALGA 1V6YA 1KQZA 2CITA 4QCFA 3HZ3A 3WUEA 2GSJA 1HKJA 2ZWYA 2XTKA 4HA4A 4WKHA 1JD9A 1CIUA 1W1VA 1OINA 2HVMA 3SUWA 3II1A 1ESWA 1XCXA 2ZOXA 1PBGA 4YN5A 2WNWA 2CBJA 3GTNA 3ZIZA 1B30A 1D7FA 4ATDA 4MADA 5D8ZA 1V3LA 1ECEA 4HMCA 2J7EA
chains in the Genus database with same CATH superfamily
3LIZH 5AW6B 4OZFB 2DT0A 1RH9A 1N26A 5DT5A 4U1NB 1PKQE 5F1NB 1NFDA 3SN1A 2CGZA 3G1VA 2XWDA 1CXHA 2VFFA 5FHAL 3MT1A 4I8DA 1NPNA 1V8HA 1YY9C 3EHBD 3JWDH 4AWUA 4H20L 4Z17A 4RGMC 3CTLA 4C6IA 4OCYL 5FV1L 1EGJL 4KTEL 2BY2A 1NC2B 3RPIB 1PSKH 1JPGA 4D0BA 2G4EA 5A8QA 2WHKA 2N7AA 3QUHA 2PEVA 2D7QA 5DS2A 3PM6A 4JEGB 4IIZA 4L9YA 4XMKH 3OBAA 4M8VA 1FIGH 4NCC1 1W9DM 5AC4A 4GABA 2Y5EA 5BS0E 3NCBB 5IJCC 1KNWA 3MLTA 2X4NA 5BWAA 3TXAA 4S1FA 6FABH 1NDMA 4Q4RA 1ZPUA 2X4OA 4LU5L 5DA4A 3QDHA 1W16A 2NX3A 1Q9KA 4OF5A 3V6ZB 3C6LA 4PEKA 4A7TA 3Q45A 3AJXA 4KCWA 1BWMA 5D1QE 2GWNA 3PE9A 5CN2A 4Z2LA 1M7DB 4BUGA 3Q9PA 5KOVC 5I0WA 1H62A 3WBWA 3MBED 5GGSA 5I17A 3RJQB 1YNPA 3CX5J 1K7XA 3WDPP 3F5WB 1FV1A 1IGTB 1ZHLB 1UUMA 3UQNA 4F2BA 3N6HA 2XBDA 1YDOA 1LORA 4XC1L 2W9DH 4A2LA 2WMPB 3VX0A 5TE6H 1XRSA 2F5BL 4CLMA 4DBEA 4YNYA 1FPTH 4DZAA 2EIZA 3WEMA 2ZDRA 4LRIC 3NFPA 2DLGA 3HRZB 1CI3M 3NZ8A 3DOIA 2WMKA 3NVTA 2VLKE 2H8ZA 1UPMB 1YN7B 5E6SB 3IPFA 1GEQA 4Y19E 4GW1B 1BTMA 1UKSA 2BVOA 1U8OA 2Z35B 2W9EL 2DLEA 4K94H 3ECWA 4DM1A 3ABKB 3QO1A 4BXVA 5FYLH 4JDVB 4XTDA 4LLDA 1W2VA 3L54A 1D5ZA 3JR2A 2F6AA 4HSHA 4KFOA 3W25A 4WI9A 4I2XA 2QHRL 2X2JA 3G1HA 2FVNA 2WUBH 1RD6A 3HFML 2CLZA 3ARWA 3FHQA 1LOQA 4YHNB 3KYNB 4HPOH 1QWUA 3NURA 3PJUA 3OHXC 2FD6H 3MUJA 2FSEB 2NNAA 4FQLH 5FOJA 1QU4A 5KS9F 4PRWA 4GOSA 3PWNB 3RA7H 4AENB 4YHIA 5KSAB 1QFWL 4MQ7A 4DIXA 2IQAB 3ZW3A 5I19H 1IKOP 5FLUA 2XGBA 4WY0A 1AIFB 5CU9A 4FQ2H 4NO5B 3RL1A 5IZ7A 1TQXA 2JF6A 3CFBA 1DBKH 4ZX3A 4RDQF 1A0CA 2A83B 5HVHB 1KWKA 3CXFA 1PG7X 1GW9A 1EEQA 4M81A 1WIPA 4GKTA 4UOJA 3PDDA 4LQFH 1KLGA 1H6EA 4D7PA 1R3JA 3WX7A 2EG8A 3A3WA 4MFEA 3IETA 1OFBA 3TN0A 5D71L 1AHKA 4TTDC 4X5PA 2GSIB 1PSCA 3C5SA 2VW4A 1W80A 1R3IH 5AVQB 3SQOL 5FM4A 3GSNB 1A0QL 1E3XA 3KYMA 3DI3B 1AOHA 3QE5A 2XG4A 3MS8A 3MQTA 3WNPA 5BZAA 3EUUA 1HG3A 2OB3A 1TTIA 1AZRA 2ISFA 2O26U 1IT8A 2XI9A 4EKXA 4O5LL 1PU0A 1XZ0A 4Z7QE 4HU2A 5DLLA 1ISWA 3NPZB 1LUCB 4Y89A 5I0XA 2YPLD 2FZBA 4PJCE 4ORIA 2W65A 3U9WA 5HUOA 4LSTL 3NQDA 2V17H 2YMOA 3HI1A 3V5KA 2XHYA 4D9LL 4DSYA 4IPLA 1EKOA 1MVFA 1M42A 1E8ZA 1E4NA 3J07A 3IDGA 4OJYA 3K6OA 1JZIA 5JOFA 3DC0A 5CEZL 4XIAA 2YLKA 5ANMB 1W6TA 1GS8A 4AF0B 1Q8MA 3FO9A 4E3TA 4NJAL 2MQGA 4XOBA 1UR8A 4DAFA 4F2EA 4N8VA 1LEGB 3K72A 2YDSA 3UXKA 2SEBB 5LSMA 4ERSL 5F7WC 1QPXA 3H26A 3Q2WA 4P7QA 4YSEA 4PWEA 2PMQA 5FYKH 3V0EA 3T65A 5I7GA 3W1RA 1CBJA 2VH5H 2PLKA 2WXKA 3FU9A 1BQCA 5EZIH 5D2YA 2BS9A 1AQKL 2IDQA 2R0LH 3TIEA 3NCWA 3ILPA 1X9LA 1DQXA 1PTAA 1QW8A 4YC2C 4WNQB 2LGNA 1DIOA 4GVHA 1TNMA 3COOA 2ETWA 3SODB 4B4FA 3QMTA 5DD0H 1C91A 4ZOCA 3CFEA 5E0QA 2VDQH 4HA3A 2NQCA 5H37A 3R8BB 1OF6A 4K39A 1X5KA 4HU4A 3U9IA 2XN9D 3NTYA 4XZUB 3HQOA 2ZG2A 2O5NA 1HJUA 2YAFA 5TDNB 2NNFA 4PJHE 2ZCKH 4X7TA 4AQOA 3DFTA 2V6AA 4K9EL 1MFAL 2PCPB 5A8PA 4GRLB 4QTGA 4L37A 4L65A 4LVNB 3MGOA 4HNNA 5E6ZA 1HNYA 4PPTA 1XV8A 4JG1H 4UM9B 2PD9A 2DVTA 2UXFA 2ORBL 5IB4B 2H3DA 4KPHH 1SDAB 3VI4E 2ITFA 4L1TA 3RTQC 5B7YA 2FUQA 5J5EA 1ROWA 3UJSA 1ZEAL 4ZB2A 1IEQA 4JZJA 3MSGA 3CIVA 3VSTA 3N44F 5HDBB 4ACTA 3V5HA 1CFSB 2WP3O 2Y8UA 3ZQXA 4A3YA 2FYYA 4YX2L 1X4ZA 2R91A 5HHMB 3KRSA 4FKKA 4LCQA 1I7ZA 3QIUB 3I6KB 2PTDA 2XU2A 1LOLA 2L7UA 3RGHA 3SO3C 1YEHH 1KY6A 4OZ4B 3KPRA 1HSAB 1DO6A 4N2DA 1SXZA 5IQNA 4GY7A 2CWRA 1FWRA 3RWJA 1CU4H 1IEIA 1M6OB 2E6QA 4JBRA 4QLWA 4X6EB 2CIKA 2VZ3A 3LGDA 1REQA 4TNVK 5FCUH 4G83A 4W9GC 3GD6A 4GXVL 5EMKA 4XP6L 1FJ1B 2OTDA 2KI6A 4YLCA 1WQVT 2FGLA 3DN5A 8RUCA 8A3HA 2IJ0C 4PUBL 2VFIA 3ILEA 4OGXH 4OZIF 3OO2A 4IBYA 4Y4HA 5I6LA 3B4UA 3C2VA 1B9KA 4D1JA 2EIDA 2IPKB 1OP5H 1WV2A 2V2XB 3P30H 2UY5A 2QQ6A 1OWWA 2CLVA 2BLEA 5LNUA 5F1KC 5GSRB 3WKQA 2DY2A 4DO4A 1AVAA 5E2UL 3QR0A 1OX4A 5JDSB 3W81A 3US0A 3CVHH 4PH8A 3L95B 3D8MA 3RB7A 3BO8A 1T0MB 4CA4A 2D7OA 5L2KB 1MI3A 1HJWA 3SCUA 4GRWB 3MI6A 3LZ3A 3ARFB 2IOMA 2HISA 3W38A 4Q4SA 5LNSA 4HWBH 2VDPH 4O13A 1ZS8A 4IX0A 2VZVA 5AB3A 4PRAB 3VSUA 3DAQA 1PWMA 4JVWA 2FEEI 4RBPH 1MIEH 1SQ7A 3RX5A 1AKJD 4LEEA 3MAWA 3M7SA 1UB5B 3UTSA 3M0ZA 2FZDA 1T22B 5F1VA 2QJMA 3BUTA 5I5JA 4X0NA 2AK4D 3FX4A 4PCSA 1FHNA 1PTZA 1C8QA 1PD6A 3CVBA 5ECUA 2CZ5A 4BK9A 1QR7A 3B9OA 3TX9A 1XF2A 2FJGB 2NX9A 5FHAH 5D6DA 4TX8A 1ZSDB 4NO0B 4H20H 2FEDD 3EYOB 1Y5XA 2E8YA 1IAOB 4OCYH 4H5SB 4WJ8A 1QSFA 1EGJH 1RK1A 5JA9A 2LU7A 5MKGA 2GZXA 3M46A 1BQHB 2X30A 3APNA 4KEZA 1BVKB 3QFWA 3IIZA 4MB1A 2H7WA 4ALAL 4IWWA 3OR7A 5MERB 3TDFA 2QIWA 2QMJA 2HBXA 4P9ML 3EUDA 4P5MB 2ZX5A 2POTA 4TUOB 3FRUB 4ADGA 4BCYA 3QORD 2DYPA 3RNKA 4GKSA 4DN1A 2FB4H 4MGGA 3UTQA 4KDWA 4LU5H 1CWVA 4HA0A 2QTVA 1SW3A 1B4RA 4AQLA 2AJSL 4M48H 1OSPL 4RQQA 3MR9B 1GMIA 3W1TA 3UXIA 1PZUB 2REQA 5EOQL 1SSDA 3I85A 5IJDC 3GDMA 5C09B 1CGUA 2YQ3A 1B0RB 3VWJA 1NFGA 3X1EA 4RK8A 2POZA 3EBAA 3FH7A 3L68A 2FGWL 5JLZA 2X3AA 4NKQB 3LHPL 3TN0C 4TF4A 3FQUB 4IXXA 4XC1H 1K5NB 1TZOA 2EDFA 1U95A 3RTLA 4ZGYA 1BXVA 3ULUE 1DCLA 3KCWA 2F5BH 3ATZA 4PMVA 1RUQH 3LEXB 2DW5A 1S4IA 4H3DA 1J8HD 3T8MA 5F3BA 3VSVA 4KDTA 4L4OA 4RX4D 4NQUA 3PHQB 4P9HH 1DE4B 2W9EH 3IRCA 3GXTA 4PJGB 3ZXAC 4QM1A 3QI9B 1A4BA 3SDOA 4J4KA 2Z7KA 2YRPA 5G5IA 1T89A 1JS4A 4YS4A 1TRIA 2DI7A 2O9TA 3HFMH 4UBDC 2TPSA 2GCYA 4G43A 1FAIL 3UAEA 2NY4C 5JR1H 5ANME 4ZQRA 1MY5A 1UOZA 4X5RA 1A22B 4MDJA 4OHQA 1ZGLA 2X09A 3JWNC 1CGTA 1XMWA 1NA8A 1J0YA 4M1GH 3C0JA 1H9VA 3HGRA 4M1DL 2X4TB 3H8AA 4Z95L 5FHBH 3AU0A 4J8QA 1CFNA 1XCTB 3AXXA 5DEZA 2KZWA 3RGVB 1P6WA 5A40E 1W3NA 3UJFA 2J8GA 5HI3D 2GQ8A 4X7CC 1N59A 3NSJA 3H4FA 1JNHB 5EU4B 2ZUXA 4PJXB 4ALDA 3O9NA 4B3LA 5KSWA 3BHBA 2ZF8A 2H3NA 1KYAA 5LA0A 1FWFC 1R33A 5ICYB 4EEEA 1DKWA 5T1KA 4Y7MA 4BKLA 3NJIA 3W7PA 5CLYA 3PAVA 4PJDE 4TU1A 2Z4TA 4YAQA 4NT6A 5D71H 5ILTH 1PTDA 4NUMA 4LUTB 4JZ5A 1RP9A 4MXVF 1AR2A 1JWUA 5MEPB 4JCMA 1VPQA 3DVIA 3OG3A 3OSKA 1X5FA 1J88A 2D0HA 3SQOH 2X89D 1A0QH 1A3LL 2WLJA 3HMXA 5C2CA 1UWYA 4GXWA 2F7QA 1NAL1 1A47A 2EDJA 3FN0L 3OKKB 5KYWA 1X5YA 3ZWTA 1RMFH 2R39A 2JJTC 4H40A 2CO1A 3VXPA 4O5LH 2AL2B 3VWKA 1I1AB 1D7DA 1ROCA 1XCQB 1CS6A 1KUMA 4H1LB 1EMTL 4JTHA 4ZFFA 3ZZ1A 4ONGH 2ISWA 3RO6A 4JRYA 5IKCA 1B4LA 1YZZA 5FYKD 1GKQA 3GC2A 1JRBA 1A6UL 4D9LH 4UNKA 5BVJA 1G7JB 3VXOA 3T6CA 4ZFCA 3DX7A 3CZFA 5I06A 3PPEA 2NY2C 1WV7T 4LOFA 3RR1A 2Y6SC 1NGZB 1MFUA 1F1AA 3R7QA 3T2NL 3IWPA 3JYBA 3FVMA 4JIEA 1G0CA 3UA3A 3OAYH 5AC5A 4NJAH 4OFCA 2YDAA 1AGFA 5HHME 4MMYB 2QDHA 3GC5A 4PY8J 3JUGA 2KKQA 1BZ9A 3FXGA 4A29A 3TO4B 3IS1X 2B7QA 3DFOA 4P23B 4QJ1A 4OZFH 1A49A 1R30A 1O6SA 1GK8A 3WJLA 3WFCL 3AGVA 4H0LC 3AMCA 1AQKH 1WB0A 1PD0A 4Y1AD 4FAAB 2IKJA 4JR5A 2ODIA 1BQ5A 4ZENA 1U8IA 4UUJA 3SBWA 3KCOA 1HO1A 3AIVA 1TZ8A 3ECBA 2FX7L 4LFYA 4X83A 3THMH 2PWDA 3MRHA 5D4QA 2YSWA 5KVFL 4YHYC 3P67A 3SUTA 3V2AR 5DD5L 5DUPL 2Q86A 4RNRB 3L1OL 2OOFA 4Y4HC 4R3SB 2DPKA 3MO1B 1RK7A 5D30A 1KBIA 1UXWB 2PDPA 1F6PA 1V7ML 4V1DA 4XTRC 5LLIC 2B7OA 4NO2A 4R8WL 4Y2DD 4KFMA 3M5XA 3WF0A 1GZPB 5T1MA 4GT0A 1ZWIB 4K9EH 1DZBA 4FADA 1MFAH 3IMBA 3Q43A 5A2FA 1P0KA 5GS0H 5EUOF 3BPNC 5I5MA 2IBGA 2BO0A 3GYEA 4QE4A 1GYNA 4QCIB 1J96A 3TIMA 4B9ZA 2ORBH 4M56A 1XH2A 5C54A 5F0LB 4WHDA 2W38A 5AYYA 2VE6A 4LNRB 2Q6WB 1J8SA 3JVGC 4G80B 1XGTA 2GC4C 1AR1D 4R88A 5L2JA 1EFXB 3QQ3B 4KI5F 1NOFA 4K36A 2AEWA 2FBOJ 1QI5A 2YRLA 4ELKB 5D4YA 4YX2H 1P6BA 3DNKA 1TV8A 1QZNA 2J5LB 2V9DA 2YSSB 1VCAA 3A9BA 1Z9SA 1RZJH 4GQRA 1E1FA 3VFMA 3VUSA 1NFKA 3MZ2A 3UZWA 1YRRA 3FQWA 2Q9OA 3QDGD 1GOHA 3WD3A 5D6DC 1M6JA 5FK9B 2E7CA 5A7EA 4NQSA 1ZGLM 3EA1A 3MO4A 1ITQA 1N0XH 1EJRC 4ZBJA 4JRXB 3NGJA 4GXVH 3QEQE 1OIFA 3CVDA 5JBFA 1KLFB 4XP6H 2DKMA 4D3CH 2JIEA 3AIQA 1MCOH 4OIIL 4GAJL 3ES6B 2YAPA 3KGRA 1L9SA 3VG9C 4WGKA 4PUBH 3E0LA 2Y89A 3MLYH 4E5XG 4I87A 3QFJA 2WZPA 2VUYA 3QQ0A 4MKMA 2A5UA 4G1MB 3IJEB 4GVGA 5E5MB 2ZWYA 3SE6A 4TSBH 1JD9A 5HYIA 4BE6A 4BKNA 4DP7X 2NQLA 1J9CT 2GBAA 2GAZA 3O8XD 5C0EA 2H8PA 2VM9A 3U79A 4PJEA 4N9CA 4OT1L 1QSEA 1TWIA 1AAJA 2WUCL 1RU9H 8FABA 3OBEA 3WO4C 3LB0A 2Z8SA 3GSRA 3IRZA 3LHAA 3VWJC 3HS0C 2XWCA 4A39A 4M4RB 5TFSH 2VLRD 4RA3A 4KNTA 3FIGA 2XWJA 4AX6A 3IJYA 3UNDA 4J28A 4IIDA 3DJSA 3TC6A 3V75A 4CNIA 4HAGA 2VDLB 4OKVB 3L48A 3RDTD 1U8KA 5CJ8A 2GITA 2OEMA 3AALA 1Y07A 1OCCB 3RVXD 1WXZA 3RF9A 2FTYA 3GSNH 1GIGL 1D5XB 4NQDE 3FJ6A 4UQAA 1FZJA 3IWUA 4HZMA 1NM9A 1BMGA 5AHNA 4RETB 3NA8A 3FUKA 4UTMA 1IQDB 1I9JL 2FPYA 4CCCA 1XF4A 2Q76A 1WAUA 1QG3A 4ZPVB 3T04D 4RV3A 4LCWE 3HMCA 3W1XA 3K6NA 4AZ8A 2NW3B 5I76A 1BVLA 1MCQA 2QHAA 2H47C 1SYTA 2EDXA 4TOQA 1PL3A 1OTSC 3VVWA 1W5PA 5AHEA 1K8IA 1FLTX 2B7NA 3IGFA 3M17B 4ALAH 3KCLA 3APGA 3W2DL 3WV0A 1NMCC 4YBQC 3PZOA 3W2LA 2I5YL 3OR6B 3RWDB 1JN6A 4IBVA 4LF3A 5ESVB 3D85D 4JPKL 5I1DA 1T99A 2LOEA 5E9AA 3OU8A 1H8NA 3BCDA 4HIPA 5GGUB 3HA0A 1WH0A 4XVUD 4IKKA 1VEMA 1T7LA 5EIIG 5C55A 2AJSH 4PJXE 2OW7A 4F1SA 2WLMA 1OSPH 5J6GB 3TN5A 2CDFB 4KKLC 2GUUA 3PBWA 2JKEA 3CYJA 2IGFL 4IFOA 1YNKL 5HR6A 2BIPA 2YQBA 2WO3B 5D05A 4R96B 3JBG7 3NIDF 2FGWH 3LRMA 1XJBA 2O72A 3U9UB 3IAPA 3LHPH 1U2YA 4K7PY 5SWSE 2BHFA 3W70A 1YEWA 4BZ2A 1MZZA 1KGXA 4TV3A 3HKZA 4JKWA 2A2QT 5FM8A 3S0CA 1TDQA 3KNBA 3UTZA 4CVZB 5IHRA 3INPA 3BZFA 3T55A 1LQ2A 3I4KA 2IXUA 1KTLA 3JWDL 4YDKL 5CZJA 2PI6A 3VWKC 3PTDA 3AQYA 2CKBA 1PSKL 2WBJB 2WXQA 5D2LF 5IVNA 2GABA 1FCVA 4LOEA 4PRHE 1LE9A 3LH2H 5AB2A 2PWEA 1FIGL 4J39A 5B1JA 3ZDXB 5I07A 3MNVA 3KOFA 1W91A 1FAIH 3AHXA 2DY3A 3A6CH 4RKAA 2IOIA 2PYEA 1TX2A 5AZ1A 5IW6A 4IL0A 4AKOA 3ZUCA 2HJPA 3ARGD 4Z7WA 2CUAA 1QFOA 1T3FB 1S5NA 4Z95H 4JO2H 3KRUA 3M86A 1XIWA 5JIDA 2VKZG 5GGSY 4QF1A 1XBYA 3W71A 3LGGA 3IIXA 1QWNA 5HYSA 5EBLA 3ATEA 1EJXC 2P52A 3L08A 1UR4A 5FKPA 1EYEA 2J44A 4JY4A 2BWDA 4MBRA 2NY3D 2OTUB 3H9SA 1BGGA 1HUVA 3H7RA 4MPKA 4FIRA 2WB7A 5GVJA 3ISRA 4TVPL 5EBGA 4G9FE 2A77H 3SBWC 3FO2B 4JFED 1FPTL 4AK1A 2J55A 4Y9CA 1FA4A 4Q32A 3P40A 2I9UA 2QGEA 2AEIT 3VNYA 4R4ND 1YRKA 1A6WL 1IAIH 4HWZA 1Y0EA 4ISVB 3T0DA 2PR4L 1SFLA 4HX1B 1QW7A 4QRNA 4HH9A 4OFDA 2EVJA 2XWBA 3CFJB 1A3LH 5CEZD 1BZEA 3LEPA 4EDXB 2YD2A 3CIXA 4U7KA 4UWQB 1PKQB 3UR5A 3WFHB 3PGFH 3GKZA 4B5NA 1HXJA 3FN0H 2YN3A 5K9OB 4G59C 1X96A 4FLOA 2M8XA 3GMNB 5FYLL 4GS7B 2VDMB 4DVRH 1IJNA 5KANG 2C4FT 2CC0A 1V6XA 1P7HL 2QKIC 4JM2D 4FI6A 4OKDA 1VPXA 3SI9A 4U3SA 3E8UH 3V1PA 2NUPA 5SX5H 4PLKD 2G50A 4FQLL 2VOMA 4HS3A 4HUUB 1ICPA 4P05A 4GIOA 2Z93A 4LLWB 4JL2A 3HR5A 5BS0B 1GW1A 4QT5A 4WOZA 1TJGL 4PGEB 1T5XB 3WY1A 1SJHB 2QKFA 3BJFA 4GYJA 3S4SA 4QXUL 1L3NA 3WD5H 4I0PB 3AROA 2CO7B 3HA1A 2BNJA 4TULH 4DKDC 1AY1L 3NYZA 2YEZB 4AWEA 5E94B 4HPXA 2WKGA 5BXPA 4F2UA 2VJ0A 3ERPA 1JZ5A 4LAUA 2WAHA 1YPZA 5D1QB 1Q0EA 4PWHA 3G6MA 2WXHA 1WFIA 4K8RC 1LDCA 1WVZA 1XGPA 3QZOA 1SDDB 4OZIE 1GPOL 4Q9BA 4A7VA 1KXTB 1TQCB 4GC3A 3WK3A 5CZ0A 4YBHA 3S35X 1OAYH 2HFFA 2I5IA 2YLHA 3G5EA 4G2AA 2L04A 1N2VA 3WFCH 4KRUA 4PV8B 4N42A 4F9PC 1PLCA 3U1SL 2R4SL 3W2NA 1R3RA 4EI6A 1JRHI 4LRIA 2FX7H 4OZFG 3BVWA 1E27B 3TE9A 1AD0B 1N70A 4BF5A 5DD5H 5LB1A 2CSPA 4HVXA 3L1OH 3QUYB 3M88A 2HWZL 1A6ZB 4MHHI 1QLRB 4NUPA 1E0WA 1V0KA 1KTJA 5EO9B 4XP9H 4LBSA 1LYXA 5EUKB 5SWZA 4EN3D 2ALWA 4Y19B 5JMRA 4OZGF 3A21A 1FVCB 1YEJL 1V7MH 4XD4A 4QG8A 2V17L 4R8WH 1YN6B 1EC8A 1D6EA 1XHHA 2P45B 2QCMA 2C79A 1AL8A 3AYVA 1SJBA 4FTDA 1A6AB 3PGDA 1XPGA 5HNRA 4AUUA 4ES9A 2IAND 1T1YA 2QGBA 1BKHA 3CIAA 1RHHB 1TCRA 1HL5A 1XIGA 3OHXA 4HFWA 4A68A 3EG9B 4AYID 2WKOF 4PMDA 4TNFA 4NUJB 4J1UB 4BFIA 4L3EE 2R1PA 1ZVSA 2ZONA 2AXJA 4Y9OA 1AGDB 4ZTOL 2VRQA 4HXAL 4BHYA 4XZHA 5AVRB 2E5CA 5GRYA 4JY6B 5BOFA 3KL0A 2APFA 3AYSA 1W37A 2AKRB 1ICSA 2AERT 1AE6L 5HHOE 3DXIA 1GGCL 1BFOA 2NW0A 2OLAA 1ZK9A 1ZOXA 1SLVA 3OWRA 1V3IA 3QDME 4FQIH 1E9YB 4HHMA 3WH8A 1P7QA 4DB7A 2R0LL 2QR0B 4AZ6A 3RWIB 5C9KA 5DT7A 1KFJA 4BGDA 2UV3A 1J5HA 4MNLA 4JFXA 1GYUA 1QI3A 4OLZL 4PVLA 3LDBB 1KRAC 2PD5A 5AUMA 1UJ3B 5EFIB 3L9RB 5CEWA 3TA9A 3PSWA 2VDQL 3OKNA 4TUJA 3BESR 2APSA 4AMCA 2AJ3A 4OIIH 3RJXA 1WWCA 2NR6D 5I0ZA 3WLWC 1G4MA 3I7RA 5D1XB 2CHOA 1U3HB 4IQLA 4YSTA 3ARUA 3MFFA 1HHHA 3D3VE 4Z7QB 5FR3A 3BZ4A 1MHCA 4X99B 3SO7A 1Q9LB 1TFHA 4PW9A 2P5WA 4PJCB 4I88A 4FRWA 3OKMA 2YKKA 5I79A 1RQHA 3ZSTA 3VUPA 2HE8A 1VGKB 2WUCH 5KJRL 2ZFAA 4N4PA 4DNHA 1MCPH 4LX4A 3AHTA 5FO9B 3ARSA 4Z3HA 1QLFB 4AWSA 2YGVA 4JFDD 4FE9A 2K3TA 5AW2B 4LJ3A 1S5IH 3E2QA 3R25A 1KFAL 1E1CA 1TPUA 3GXFA 1CDYA 1JGIA 5HD8D 1DP0A 5EEXA 3WK0A 4F0RA 3NESA 1YEHL 2RQ8A 4CD6A 4DAGL 5D7LE 1DUZA 4S2SB 4XVSL 3MLXL 1CVSC 2CXGA 2ZWKA 4F7TB 1NC4D 4JHMA 3WQOA 2PZNA 5DA0B 3AWNA 1I9JH 4HK0B 1OPOA 3FFOA 2EC9U 4UTHA 3WE1A 3S47A 4HIHA 4XO9A 1DUYB 5B1JC 4RAUB 3A67L 3WEAA 5HP5A 3HF3A 1ODAA 3P30L 3BISA 1V0LA 3O2VH 4AUBA 3RGTA 1G7IA 1HE7A 4QGCA 3DX8B 1BG1A 3W2DH 1G1YA 4QDMA 2XVBA 3JWOC 3MJ9A 4PJHB 4PLJC 2J6XA 2XQYA 4JPKH 3GSUA 4Q8MA 1JWMB 3CVHL 1EJOL 3LB6D 4PVBA 1XIWC 3QPXL 2DEPA 4HCLA 1CDCA 4WHBA 3BJLA 1GVRA 4B5WA 2H32B 3WQDA 4N0UE 3SGKC 3EKCA 4PJ9D 2GKIA 3GW3A 4OGZA 3HV8A 5K2ZA 2PW1B 1I45A 1I1FB 4HWBL 3ZHLA 2VDPL 3RTQA 1F18A 3LS9A 3NOYA 5LNVA 4GLEA 3VI4B 2X2IA 3PZTA 1YNKH 5L8KB 2Y0SA 1NOLA 2GGEA 3QNYA 4P5TB 2GVJA 1DVZA 3D39A 3TROA 1GZQB 3EJZC 4JEJA 3UPMA 4R53A 4QKTA 4ZZFA 1YHTA 2NMSA 3GMQA 4C6DA 4PJ5E 1TPC1 4MJ5B 3L5WA 1E9QA 2H2SD 3CUXA 32C2B 5TDOA 4NRYB 1RIHL 4EACA 3KW8A 2WKJA 2HJFB 4NNPL 4HDIA 2BVYA 1AO7D 1UWRA 4E41D 4P7OA 4B5EA 3VFPA 1UWQA 2BXVA 4LRTA 3D51A 5CD3B 4C6PA 4YDKH 2CETA 2EXSA 4NGHL 4AGMA 4U1IA 3E38A 5A2AA 4YSSA 3A24A 3WUZA 5JW4Q 3PZQA 3USZA 2C34A 3DV6A 5LNEA 3OSVA 5JPNA 3EKGA 4TNWF 2F08A 2W4XA 3P11L 2O61A 4HNLA 4EIVA 5HGBA 1D9KB 4ZZ9A 1L6ZA 3FCBA 2X70B 4C4KO 3U2IA 5IDIA 5F7UA 1BG9A 5F71A 3JTTB 1SOXA 1A0EA 3CHOA 4B9FA 1FWEC 3GG1A 3EWCA 3EX3A 3MYJA 1QABA 1KB5L 4EXBA 5MF5A 4QGYA 2FB4L 1ICTA 3APYA 2Y69B 3SKMA 3VXMD 2VN4A 4LC8A 4M48L 1MHEB 3FQYA 3FQ1A 2BMKB 2HVJA 3D05A 4KRPC 4HKZB 3MREA 3OIHA 5KSVB 1OCNA 1LF1A 4PS4L 3QHTC 4PB4A 2NLJA 5J4MA 4CD8A 2YGOA 4R2GC 1B3VA 4APXA 2EDLA 4HETA 4MD4A 2Y1HA 2X9YA 1LLOA 1EFQA 4F0SA 3EZJB 4XNZB 1OFPA 4S39A 3TW7A 2PABA 1I4FA 2ENQA 4EMZA 5GRVK 2H2PD 1PKMA 4TVPH 1PIFA 2ESVE 4R5VA 3L3KA 1FRGH 1RUQL 4WJ5B 5MI0B 4YFLI 2ZQ0A 1I9IL 4G6AC 4G7RB 2KZ1B 3S6DA 5FO8A 4MPQA 4XSMA 1OGPA 2VDIA 1UUSA 1HIMH 1A6WH 2IADB 3WEOA 1A5SA 5EUOE 3VH8B 1JDDA 2PR4H 3M0VA 3STLB 3FK4A 2MOGA 3BAJA 4F9LC 1TTJA 5KWYC 3PJLA 1XI3A 1F0LA 2YHGA 4I7UA 4PLNC 4BBWA 3L3DA 4JKNA 4P9HL 4UTIA 1AFVL 3RBGA 2GOUA 4OTXL 2ADYA 5D09A 4L05A 4JNMA 3STCA 1WPCA 2YGQA 5D03A 3ESOA 3PB2A 1HOCB 2QFRA 1OD0A 4AQAB 3MRMA 1UOWA 4V28A 5IG7B 2HPIA 2ENYA 5JR1L 4WWKB 2XPZA 4ZMVA 3A4AA 1EDQA 1AOZA 1MFEH 3R1ZA 3BH8B 2V7HB 3F7VA 1UYQA 2HWGA 4G7EA 1BBJB 4JREB 5E24E 4M1GL 1TQUA 2ICWI 2IAAC 4NYYA 2XPKA 3V4PB 3W07A 1VAHA 5FHBL 3AWFA 1CF1A 1KYOJ 2OXGB 1TJGH 5B4MD 3KXFB 2Q10A 2R23B 3LSBA 1FFNB 3G5WA 4QXUH 2C5DC 4YWGL 1Z9LA 3ZKMC 3HG1A 3ZKXB 2HG5A 2F18A 4YPGB 4ZYKA 1NGYA 3L4TA 3PUUA 1AY1H 2H1PL 1BSLA 3Q5TA 2ZWZA 2VDLH 3BWSA 4JHOA 1KTNA 3MHFA 1TPDA 3N73A 2H0JA 4YEEA 4WDIA 2ZUNA 4XX6A 1QLEB 1TYRA 4PJBE 1JPKA 1A9EB 5EU3B 2C1OA 2AKMA 1CGYA 1GPOH 3B43A 3TEYA 3PWVA 5HJXA 1ZP4A 5ILTL 1Z69A 2HT3C 3U1SH 2R4SH 2ALAA 2QTEA 4ICXA 3RB5A 2CK0H 3WH7A 1J8VA 5D1XE 3CPLA 1MCLA 1V02A 1P4IL 3B8UA 1WZLA 4YBLC 3BH9B 4QR7A 1JK8B 5T9CE 2OMUA 2BP3A 1RMFL 2BSTA 1ZE3C 3PV7A 2HWZH 4GBXB 2CIIB 4FXTA 1IYXA 2OPJA 3G6JF 3F5KA 3V7PA 2BRRH 4ONGL 1A64A 1YEJH 1CLCA 3NYDA 1R5VA 3CL8A 4JN2A 3V18A 3L2MA 3VFNB 1TEYA 1ZD6A 2OSLA 3MYOA 3RU8L 1EXBA 3PF2A 3OXRB 1UD8A 4MQXD 1M7PA 3TW9A 4F7EA 3NDZA 4G7VH 4RFOL 2FH8A 3SDXB 4Y8DC 4Z1DA 2V2CA 1FVDA 3W7HA 2FIQA 3KPSA 4ZTOH 3E74A 2MRYA 4HXAH 4LT7A 1J05A 3S5OA 4XO5A 1AK5A 2C71A 4KJYA 1PKOA 4YHOL 4NDMA 3TJLA 3EO1B 4MJ2A 3EOTH 3FCTB 1R2TA 4YQXL 4GG8B 1ZALA 3KVMA 5H8UA 4NFBA 4K71B 4XCYA 3LQAC 2P24A 4OUUB 5I71C 3UPRA 4XRCB 1AE6H 3ZK0A 3GFXA 1GGCH 4HKJA 3BE7A 5IDZA 3CIWA 3NACL 4AYFA 5DJ8B 2XTKA 2OO0A 1G0XA 2EYSA 5J7CC 1FVEB 1OINA 4GO6B 1TIUA 3EWDA 1R3VA 2YAQA 2NCMA 3P0WA 3ZIZA 3THML 1UMLA 4OLZH 2RH9A 5K9KB 1USZA 2P5ED 5E9DA 4PJDB 3BAXA 3DKHA 3WN6A 1N3NB 3QB7C 4ELMA 1HKLL 2I9LB 2WZ6A 3TN4A 3RKDD 4WI3A 2YWZA 2I1OA 2W5PA 5C8JA 1AS7A 4IPJA 4KETA 3NJ3A 2I7OA 2JJTA 1U91B 1XISA 3DKLA 1R1CA 2DN7A 1KBVA 4WEEA 5GS0L 3VFVB 1TWDA 3MMEB 2WVTA 3M45A 1TOXA 1XDMA 2QL1A 3D0CA 4JN6A 4O11A 4D8AA 3MLZH 5E1GA 2QQQA 3QJFA 3GHPA 4NIRA 2XV2A 1JR1A 1XLHA 5KJRH 3ESNA 4PTMA 3VIPA 2WK2A 4MNQE 1I1YA 3WS3A 2QR6A 4XNUH 2ITDA 3ENLA 4U1SB 4NQVA 3VI3A 5ACZA 4ZSUA 2CM6A 1KFAH 1E2VA 3DFYA 2C16A 1XBDA 2Q7NA 2AITA 4M7LL 2RFXA 2BLFA 3DESA 2BNQD 2QPUA 3H1ZA 3P4NB 3GNRA 3SW6A 4ZW6A 4AY0A 4AD3A 1RZJL 3RWCB 4XCNA 3MJ7A 3BG5A 1KFKA 5ABTA 4DAGH 1JPST 4JIRA 3JTBA 4HN8A 4XVSH 1JRCA 3KE0A 3MLXH 4ZXBB 3UTOA 1U3JA 2Y7OA 2XIOA 4RESB 2YBTA 5D5MB 1BYOA 1B6DA 1N0XL 5JZ7C 3KMDA 3P2BA 4HSCX 5ESQB 5JPNC 4WDXA 4AJYV 1FNGA 5GIRA 1UCTA 4O2EB 2IPWA 4D3CL 2CFFA 1MCOL 4JYEA 4BH8B 2KHAA 2QVMA 3A23A 3GIZL 3ICJA 1R3KB 2RAGA 1NBYB 1YMHA 4XNYH 1E9IA 3MLYL 5C0BD 3A67H 4RJEA 4QHPA 3KYOB 1CXFA 3BUBA 1S3RA 4QMEA 4CCEA 4X4YA 3CXOA 4TSBL 3ATBA 5I3GA 5BOPA 3MRNA 5ELIA 3SPVB 3LBMA 1TPXC 3AQZA 2O0TA 1M1XA 3JZEA 2Y5QA 3WNMA 1EJOH 3BKML 1BP3B 2QSCH 3QPXH 1BF8A 2VL4A 1RU9L 4GT7A 2QDVA 2Q8LA 5K5YA 4K3JL 1T1ZA 4A55A 2QCCA 3TJHD 4YDZA 5E6ID 4ZQKA 4OUOA 2WTRB 5TFSL 5DSCB 1W0MA 1U36A 1A53A 3XISA 2QADB 3PANA 3PABA 3N9SA 4AJWA 2ZRUA 5DJ2A 4N24A 1BXAA 4GQGA 1OYAA 3BP6B 2PLCA 4HJWA 3ZT6A 1GONA 4YOKA 2WLLB 3JVGA 4F3FA 5EU6A 1INDH 5BV7C 5CSUA 2GVGA 4C1LA 4WTQA 3THCA 4GQQA 3A4FA 4JO4L 3MROB 4OLYL 3IEBA 3QMRA 1NJ9A 2D4FA 2DMGA 2G2RB 1AGBA 3GSNL 2C4FU 3ULUL 1RIHH 1BWVA 4AY1A 1RAKA 4B90A 2D20A 2PCQA 2B77A 4NNPH 4ABVA 3UEQA 1X38A 3NPXA 4N5EC 5EOTA 4U1GB 2E75C 3REQB 4F9DA 2IVFC 4Q8UA 1NFDF 1HT6A 2EZ0C 4NGHH 2OKOA 2Q8ZA 4YXGA 5CZKA 3CAKA 2RHGA 5LDUA 1OP3H 5EF2A 3P11H 1PKNA 2E4TA 4JG0L 4MJHA 3QEQB 2KX9A 4HEME 3DRQB 4HNTA 1S46A 5JTWA 1LP6A 1HAUA 1IKNC 1CJYA 4PG9B 2R0ZL 3AU6A 3DRTA 4ENZA 2CGRH 3K1DA 4AGQA 3BQUB 4XVDA 3WIAA 4GUQA 1FWIC 2VFGA 3KXFE 3BWZA 1V55B 1KB5H 2VX4A 3NG3A 5IXEA 2R2BA 3PPFA 2JIXA 1XLKA 3AT8A 3IDMA 1YADA 4PUMA 2VX6A 3MBWB 1E8YA 3ILQD 4ZPTB 4PS4H 2HT2D 3S3BB 5JU6A 1U8QB 5CZSA 4UCFA 1TJMA 3PLYA 3T0ED 2BOEX 1I7TB 1Z9OA 2WNZA 3HS0A 5GGQL 4G8TA 3QXAB 2WXDM 2WXMA 2X0HA 5FYLD 5K4ZA 3U4BL 4A67A 4F8OA 2E77A 4MMZA 5EZJB 2RDTA 4OZGE 4MFDA 1I9IH 1EQPA 3VU2A 2EVGA 4FLRA 1CG9A 3KDOA 5A43C 1OCQA 3X1FA 4GXMA 1EHNA 3QOKA 1DN0A 3IJSA 1TB3A 2J4GA 2PLMA 5KZDA 2Y5SA 1ZV9A 2X2UA 1JUFB 3OLEA 3GGWB 4EXAA 2B1AL 2R1XB 4H9VA 4NQDB 3T6QC 3SRKA 1Z5YD 3IFOA 1AFVH 2Q09A 1ML0A 3ANUA 4M00A 2SFPA 4OTXH 1X6LA 2OGYA 3LH2L 1PCSA 2O7SA 3AZTA 1LQSR 5KS9B 3C0QA 4LCWB 2PYFA 3U6XS 4KDVA 3IU4H 2EIEA 5KITA 3KWUA 1MOEA 3SDXE 3A6CL 3IDJB 1Q63A 1FL6B 3QSTA 5HYEA 4FLQA 4MY8A 4GINA 4ADIA 4ZX6A 3BXWA 3DOSB 1TZ9A 1AC0A 3V6OE 5LA1A 5IIEA 4JO2L 4FQXD 3RFAA 3F7PC 3APTA 3H7VA 1IV8A 3E2HC 4KOBA 4LRNL 2NXHA 4JX6A 5FDWB 2JB6B 4YWGH 5BUPA 4AMXA 2ZICA 2FQDA 1OY3B 4WHYH 2HRGA 4WY0F 2H1PH 1DJWA 2J12B 1TWZA 1BRLB 4QY8A 1PVHA 3DHFA 2L5HA 4ZR8A 3QUMA 1QUNA 1OHZA 3GG8A 5EB9A 5CP3A 5IK3A 1TQJA 3QUZD 2A77L 3UTTD 4JO3L 3QWOA 4R7LA 1H63A 4E5TA 4N28A 4KXCA 2OMAA 1FWNA 4MJIA 4DK6A 4PJIA 2OCJA 2C3VA 4AQEA 2E7FA 5DQJB 1IAIL 1ZUAX 1GJWA 5SWSB 1ONRA 1J2BA 3SKJH 3ESPA 1YDVA 1VENA 4GWEA 4ZUUA 2QZRA 1U2HA 4Y0GA 3VD2A 4JQIH 4M61A 2L0DA 2Z31B 1TA3A 1P4IH 3F12A 5LO7A 3PGFL 1PMYA 4BZ1L 1JCJA 4NB7A 3CHRA 5CSZB 5FB8B 4DVRL 5LZLA 1MCRA 4JTUA 1GHRA 3SCMD 4AQ8C 3GY1A 3PPSA 5CGBA 3BQ6A 1N8ZB 1MQ8A 1VADB 1CK0H 1UQSA 2J74A 3A13A 1FG9C 2JJVA 3E8UL 4CVXB 4PRHB 4RMUA 5CJQL 2Q7YA 1WFOA 3WJSA 2NVDA 4L4TE 5G5DB 1CFTA 2XX1A 4G6ML 3RU8H 3IJLA 2ZZUT 1T83C 1VB9A 2OTWB 3D48R 4RFOH 2WVUA 3NJLA 5I6MA 3TYZA 5DDHA 3U9PL 4JFFA 3WD5L 3OJMB 5MEND 1TZHA 5J8LA 3GMOA 3FTVA 4TULL 4F3HA 3FXIC 3F6IA 3VMNA 4YHOH 1D8CA 5IOKA 4H13C 3G1YA 3MNDA 3KTCA 5D9SB 4YQXH 1PZSA 4OUIA 1E2WA 2XXMB 3ESUF 4X4ME 2GK0A 2PB1A 4KVNL 3KPOA 1W8SA 4JIPA 4AMAA 4Z0SA 4YEFA 3NQ2A 5D5ME 1V05A 5D7JD 1OAYL 2V8LA 4PBWD 3NACH 4YJ5A 3VCLB 5LIWX 1IM3B 4YGVA 2FVMA 2QS8A 4G9FB 1ZZMA 3K8MA 5L4IA 2OQYA 5J9PA 2IPUG 3REVA 1UXSA 2ARJA 2IBZY 3BRGC 2WLYA 3TVMB 4NI8A 3EAUA 1T8QA 1ZVYA 5B3JE 2HVOA 5HI4C 3PL6D 3V0SA 3GDCA 1HKLH 4AC1X 4APQA 4AC4A 4XP9L 3CXHJ 4RISL 4RGOL 1D8WA 4CSTA 1KJVA 4QFUA 3W1PA 4ZUSB 2XFRA 1KPRB 3VXSE 4UT6L 1S2AA 4P2OB 3QY8A 4JG5A 35C8L 3V0TA 1EAPA 1QNPA 2BG5A 3ASOB 5KBKA 3BSMA 1LT8A 1WXJA 3TYBA 4C65A 2BX7A 4GBDA 2HJKA 4Q52A 3DEQA 4JQ2A 5BRBA 3N44B 4DBDA 4N0CC 2WVVA 4X6FA 2X0YA 2QKIA 3HZMB 2UWEE 5J5DA 3OGVA 1PTGA 3CWOX 1A9VA 1NGPL 3HG3A 4PSRA 5B7FA 2PTYA 2VLMD 3UCDA 1WAEA 5CGYC 3UP6A 1H3WM 2CZDA 2P8PB 4KVCL 4LDCA 2VRKA 1RBLA 1LJMA 2CRZA 4MIMA 2G2NA 1OOWA 2YC1B 2NW2A 5LGZA 4FKEA 3EH2A 3V79C 4M0XA 3KM8A 1U6AL 4C59B 5K1JA 4WUUE 2CLIA 3S2MA 4FXGC 2MFNA 5GS1B 4GK8A 4M7LH 3B9DA 4PSPA 4FQIL 4PD4K 3B3IB 6REQA 4CSZA 3KHQA 1N4XL 1RSFA 3T44A 2Z7YA 3BDYL 1K3IA 1G01A 4X8JB 4KROD 1BD2D 4RLDA 3VKAA 3BAWA 4ZFZB 2F5AH 5D96C 4EI0A 1A7RL 4N0FA 3N4FA 4MXWH 1MRCL 4OZIB 2BSED 3WF3A 2CCRA 4RZBA 2KBGA 1I2OA 2VQ1B 4F9PA 2OLSA 3FUEA 4GG9A 2ZX7A 1X6UA 3M0IA 1G7HB 3OF6A 1NIUA 2GJ6E 2LAGB 2BOLA 3GIZH 2WMIA 4BSWA 1I7RA 4WXYA 2R0WL 2WBGA 3GHSA 4KEUA 1IWBA 3S8HA 4XNAA 2NY1C 2PP3A 2WMHA 3FA5A 2R1NA 3OZMA 1JVKA 2KDYA 1G4SA 1WP6A 3KJ4C 1J9SA 5F9WB 1EUTA 1EHXA 3HE6D 3GE7A 1X5LA 1JI1A 7A3HA 2EXYC 3TZVB 1PFOA 4PBEA 1QRNE 3BKMH 5AW9B 2JK5A 4DJMA 1MCPL 3INUH 4E42B 4U1HB 3HFTA 4K3JH 3UOAB 4JBSA 1AGEA 5IVXA 5AL8A 1N67A 4JFYB 1S5IL 3ETBF 4Z6AT 3MRBA 3RIAF 2VAJA 3CJJA 3ZJ7A 4L3EB 4ZBCA 3T2PA 3NJKA 3TIDB 4MMZC 4WR3A 1QLEH 2KLRA 2H9AB 3WIHA 1N6UA 1L7TL 1JGMA 2ZZ4A 2ZAHA 4BUHA 4P0DA 2XH7A 4JO4H 3P14A 3QBTB 4OLYH 2XVKA 4F2MA 4JX5A 1MVUB 5HHOB 3DV4A 4H8UA 4EPSA 4MKTA 4QRPA 3ULUH 1H61A 4IU3B 5C9RA 3QDMB 4Z7IA 2ANUA 1W1ZA 2ISSA 4FNTA 3ZYOA 2YS4A 1E55A 4LVDA 1YC7A 5D8WA 3L4YA 1AZZC 4XBJA 1SF3A 4H7VA 5KS9E 4GYKA 3GSOA 3A3HA 2VSDA 1HO4A 2Q8BL 4L9LB 1OF8A 4L2LA 3US9A 3PBUA 2PAJA 4PFHA 3C2FA 4DPQA 1M7IA 1UBPC 2OMXA 5I15L 4JG0H 5TDPA 1YDYA 2WQPA 3O2VL 3BN9C 1TQVA 1LL4A 4HT3A 3OG2A 1GGYA 1O5DT 3WG7B 4KXBA 2R0ZH 4WW1A 1XBVA 3LI0A 1XH3A 4MA7L 4CNNA 5CS7A 1JYVA 3TEZA 3D3VB 4XAZA 4HEPG 1TPVA 1KIRB 3AU1B 4O2FA 2MQCA 1ODZA 4PRPD 3STZA 4YHZH 2IUZA 3GH5A 4QRSB 3BUPA 1VRXA 4UIMB 2ASHA 1TTPA 2PU1A 1WDAA 3NQEA 4KCVA 2YEQA 1YDNA 4Z7VA 3OXSA 2PXYD 1DWGM 1IEVA 1SXAA 4Y8FA 5A3IC 5CBJA 4MA1B 3FTUA 4FL4C 1QPOA 1EUUA 3C5JA 4LKCA 5GGQH 3NPWA 2XTLA 4XX1E 1BMWA 3U4BH 4NX5A 1XEUA 1Q9OA 3ZXWA 3G6JE 4CMHC 1C16B 3D34A 3NIFF 5ID1A 4JFQB 5F70A 5JORA 5GGVL 4UFJA 1ZL1A 1EEZA 2G0KA 1KJ2A 1QAPA 3KWWA 5EA9A 5CMAA 4AIZA 4QRUB 4RWYL 2FLRT 5D7LB 4DCQB 3P9MB 4BH7A 4OFYA 1URZA 1TENA 2OXHA 3ZR5A 1WX0A 2B1AH 2FL5B 4QO1B 4LYQA 1A6TB 3RHWK 3POCA 1EVTC 1U5JA 5BWFA 1QNOA 3C60D 2B31A 3AYRA 3MV8E 2R1YB 3OKOA 3LV6A 3QARA 2YZ5A 2WIIA 1IIGA 3KLAB 3T2QA 1GGBL 3VGEA 4KWSA 3DHPA 4EI5D 4UR7A 4QTFA 3W9DA 3PZVA 5DCEA 1NGQL 3PV6A 1NY1A 2JQAA 3WUFA 2RALA 4F33A 3UBXG 2H6PB 3DGCR 3IUDA 5JHDA 4PE8A 1MXDA 4QSHA 3SFWA 1YW1A 1SYSA 1XYMA 1WNOA 3PVFA 5IBLD 4QNPF 1N6QL 4LRNH 3ZKSD 1DL7H 1T1WA 1GAFH 1IC5H 5HUPA 3OA3A 3SGKA 5ALCH 1MJ8L 4N0UB 3F2LA 4UOW1 5KG9B 3KBMA 3K2IA 3I50L 5BOEA 3S5YA 1WS7A 1I0BA 1TEFA 2R1WA 4MWFA 1I1XA 3SKNB 1RL1A 3TAOA 2FFIA 1FRGL 4WHYG 4JO3H 4J7RA 4RWHA 1YEEL 1OZUA 2DJUA 3V52L 4UDTA 4IIQC 1QXLA 5EO1A 1HIML 1YBQA 4YSDA 4ICCX 5IM7A 1G0DA 1XC4A 2VEKA 1Q4NX 1LG2A 3MLWL 1W5MA 5I1KL 1B88A 4PJ5B 4APQC 3W27A 4M9OA 1E40A 3VFSA 3U7BA 3PBGA 5DD6B 1ZGLP 2I5QA 4JS3A 3WYZA 4BZ1H 3IXAB 3ZTDC 3H4GA 2NXYC 2GUOB 4X63A 1X1NA 4L5ZA 2FECL 3QAZC 5B21A 4E0RB 1HFBA 3W1QA 4ODUA 3HB9A 1BV8A 3RIFF 3ZLHA 1MCFA 5FOBA 2QZQA 1AD9B 3CXDL 1QAWA 2RDUA 1OM9A 2PDQA 1RJYA 1MFEL 4FP1A 3IDXL 5CJQH 2AJZB 4DHGA 2WQUA 1XYLA 2JFCA 4AYGA 1TSIA 3Q2DA 4G6MH 4HMNA 2YCLA 4GRWH 1TVBB 3STPA 4PV9B 1ZHBA 1D7FA 1TU2A 1M9HA 3ULAB 4P4KD 3U2EA 3U9PH 4OR1A 2BVWA 2PE4A 3IXTB 1ZSHA 3ARBB 3MRGB 1NC2D 3BW9B 5D37A 4K73A 5DYOA 2IH8A 5AVSB 4MDRA 2VDLL 2YZ1A 2ZXAA 1W9XA 5LBSL 3KLHC 4XB7A 1NDZA 2OV0A 2HFGL 1IHIA 8PAZA 3PUOA 5TF0A 5C7VA 4I9JA 4KVNH 1B3OA 3MUUA 1FZMA 1I8IA 3TJXA 1ZXKA 2E7DA 4O0ZA 2WQSA 4IRSC 1N0LB 5CSGA 1HZHL 4AG4L 3NSCA 5KBMA 4YTQA 5GS0D 4UQIM 2ESVB 3WKMH 2CK0L 3HJZA 1MWAA 1Q0XL 2W88A 1JCXA 1FFOA 3BUYA 1A4JB 2AVFA 2FO4A 2J2ZB 4F9LA 5EUOB 5I66A 1F9CA 4JJ5B 4RISH 4A4AA 4RGOH 3NYKA 1L9MA 1RXLA 5AHFA 3GDTA 2E6YA 1M41A 2BRRL 4UT6H 2XJ7A 2XSXA 3L4XA 5A95A 4A05A 5I8EB 35C8H 4KWVA 4OWGA 1XB3A 1EJSC 3SDAC 3O4LE 3P77B 3SJVA 1MCBA 1T4KA 2F53B 3ZYZA 1EZLA 1K70A 5J5RA 4OD2B 3CUPB 2TYSA 3NN8B 1YA5A 3NZ1A 4G7VL 3QIWA 1EPFA 2CA4A 1EXHA 4EQ3A 2P1FA 4IJCA 1NGPH 3OVQA 3CU2A 4BQCA 2HTMA 4WNSA 3VXTA 3NIYA 2QVFB 1UC6A 1SZRA 4HUXA 4L4LA 3LNIA 4KVCH 3DUSA 1JPFA 3GSVB 4DWSC 4WFGE 3QZWB 4B5TA 1TV2A 3EOTL 2B59A 1NFDE 1U6AH 3JU2A 3KPPA 1MCWM 2BIIA 4PC8A 1XF5A 4FHAA 3CPRA 2NQ3A 3EYVA 1XIHA 2XG9A 4QRTB 1W9VA 1T0NB 3VYOA 2HVKA 4IOIB 2AI0L 5ACMA 1N4XH 5F72S 5BRZA 3BDYH 4M93B 4X4XA 4BF7A 4B41A 2Q71A 2IWFA 1NCGA 4PJBB 3NM1A 2J73A 1A7RH 2DLTA 3DI1A 1QPNA 1MRCH 5IHWA 2XH2A 4WV1B 2EEFA 3N9KA 4YK4B 2X4QB 4FP8L 4U5IA 3D6GA 2FQIA 4XQ6A 2XFYA 4KKPA 3UGUA 1O1ZA 1TMCB 3AFLA 1KM2A 1S7RA 4WI5A 2DWYA 2R0WH 3UTPD 5IB5B 1WS8A 4OTKA 3LGEA 3K6FA 3V7AG 2ADGB 1IC1A 4EKJA 3B06A 1CTOA 1XXDC 1R86A 3UZ5A 3OA5A 3GYCA 4IZGA 4HK3N 4AXNA 3IBEA 1QWHA 3MPCA 3C8FA 1F1GA 3MLZL 4KO9A 3N0AA 4IKJA 2GSGA 3QNXB 1FN4B 4W8BA 4K1WA 4Q7NA 4PJEF 5BRQA 3LI1A 4XNUL 1SO3A 3P0VH 2HFTA 3LKSB 1HK6A 3N25A 3FW6A 4E9QA 5IQ7L 2XM1A 5LQBL 3TNNA 4YMZA 1TR1A 2AEPL 3FQNA 2VCAA 1IZKA 3VDBA 2JKIS 3P4OB 4G7YH 1RQBA 1OE3A 1P1XA 2K0RA 1L7TH 2PNDA 4IOFC 2F9BT 3GD1C 1LBMA 3HURA 3EIFA 3D2UD 3VMPA 3DX9A 3TCSA 5J12B 4XE0A 3W7NA 3ZJ8A 4OI9A 2F7IA 1G9HA 3QJRB 1KCKA 4IHBA 2FZNA 4HFUL 5I2IA 2ICES 1LWHA 3REWA 2X38A 3CHQA 3BJSA 4I2XE 4MAZA 2BHUA 5DD1H 2Y9RT 1NF0A 2BCKA 4ZMWA 4BJLA 4EWJA 3O3EA 1T5AA 1JQXA 4NIKB 2G3JA 1QT1A 2VDML 4GJ1A 1CD8A 2Q8BH 3DYPA 2MNWA 4OJEH 4RPQA 1Q2RA 4XNYL 1DYSA 3MV7A 4H1LH 5CFHA 4PRBA 3QO0A 4KK9D 3LCFA 4F7PB 5I15H 2OYMA 3QS3A 3LKOB 4GI8A 1OAZL 1PZ5B 4C56D 3TYAA 4ASTA 4G8EB 3GZ3A 3S96B 3WENA 3MUXA 1BYAA 1ENUA 1ZLWK 3WIIH 3BWWA 4J3OC 2APVA 2G9KA 4NZJA 5C9JB 4DXKA 4HJ0D 3BZJA 2QSCL 5F89A 4MA7H 1R6WA 2PDNA 3NIDB 1E5JA 2DT2A 1VACA 1E73M 2CALA 4QLJA 3WY4A 1UZ8B 3ESVF 4DLFA 2X2YA 5JHMA 5AW3B 5IFJA 4MXVE 1E4XI 4KKAC 5KSBA 1OTUC 1TLMA 2YN5A 5D1ZB 7XIMA 1NGWB 4BFFA 3NQBA 3L67A 4MNQB 4YO0A 3DHUA 3VZXA 1SJDA 1INDL 4AMKL 4PGLA 2GT9B 5B7EA 3RRXA 4GRLD 3ARXA 3RRQA 2WYHA 2Z65C 4PR4A 5C0CA 1QK0A 1E3ZA 3WDQA 2V63A 5D2LB 5GGVH 4AZ5A 1R3TA 5IHUH 2EKJA 3SGUA 2HPMA 1ZA6A 4UM9D 5AW7B 3MUHL 3CFKB 2P8LB 4RWYH 3CG8A 1H7OA 4ZMGA 5I0YA 3W01A 2CZVA 4G8IA 5C0JB 2ZT9C 2OAAA 3GIVB 1ACZA 3QXUA 1KV7A 1IFHH 2GK2A 4QRRB 4YFDB 4HYRA 4U1JB 4XGZB 4GSDL 3N5AA 4A2DA 4HCIA 3WG6A 1HXYB 2QVHA 3LRKA 1TTRA 4PM1A 2ACRA 3QIUD 1GGBH 1KIPB 4NQQA 4GRMB 3OGOE 2CGRL 1OEZW 4HIEB 2BZDA 1EGVA 1NGQH 1OAKH 4D0DA 4DBWA 4GQ9H 2VW6A 2FR4B 2PPCA 3DI2B 3GSXB 4ORMA 5JIKA 4C6LA 3LMJL 3T0WA 1FFQA 1Q6LA 3URAA 4ZTEA 4B2DA 3TNMB 1NMAH 1VDGA 2PPFA 4I13B 4Z7WF 3A9IA 3DO3A 1F2JA 1N6QH 2N1TE 3TMLA 3D0VA 1ES0B 3FOMB 1JDEA 4NXSA