1XH2A

Structure of the n298s variant of human pancreatic alpha-amylase complexed with chloride and acarbose
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 175
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xh2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xh2A01
3CHCA 1SR0A 5I78A 5JBEA 3M6DA 2VT0A 1MFUA 2YIHA 1KB3A 1JF6A 3BVWA 3MI6A 3AXIA 1J0HA 1UR8A 4WSKA 4NXKA 5BXTA 1UH3A 4JKLA 1BPLB 1BYAA 4J3TA 3AIWA 1W2PA 5CXPA 3N17A 2BXZA 2F7OA 3NSNA 3WDPP 4GO9A 1JZ4A 3RDKA 3OLEA 4AZGA 3O2LA 1S46A 1V0LA 2YFOA 1KBKA 2ZXAA 3ZJKA 1LWJA 1UZ1A 4IUGA 3WDQA 2BVYA 3EDKA 2EPNA 1JZ6A 3I3DA 1G94A 3BCDA 1ISZA 1PEZA 2PI6A 2BFGA 2W61A 5GPRA 2WMGA 1HL8A 1EDQA 2DSVA 3OB8A 4NSBA 3TP4A 3DX4A 3RM4A 2ZUTA 2XM1A 2X0YA 4XZWA 2OW6A 1E9LA 3ARXA 4KRUA 4CU6A 3IJ7A 3OGSA 3VMNA 3MUIA 4LYPA 5E0FA 3SCRA 3AIRA 1TE1A 2YBUA 3A3HA 3EJRA 1QBBA 2VC9A 1M01A 4OBSA 1QHOA 1MW1A 1V6VA 1VBRA 2DT1A 4A3HA 4TTUA 1FHLA 4JL2A 4PMYA 1JZ2A 1CGUA 3AIUA 1ZL1A 5A95A 1J0IA 1EGZA 3K8LA 4DO4A 1OB0A 3PZVA 4UFHA 2PBGA 4FLOA 2J78A 1TUXA 5A3HA 4W93A 1HJVA 1UR4A 2WHJA 3ZJ6A 4HTYA 4AZCB 1TR1A 4LGXA 1V6UA 4AYSA 2FHFA 4J3UA 4Z2JA 3EJTA 3T0BA 1KCLA 3SIMA 3AHVA 2ZE0A 1ZU8A 2Z1SA 2WBKA 1V3HA 3WY2A 1XSIA 3SUTA 5HXMA 3CHEA 4JKMA 5A6SA 3EDDA 3AOFA 4KRTA 4HPGA 3GTNA 8CGTA 5HPOA 1KCKA 1BYBA 4AMXA 2FGLA 3W6LA 1KWGA 2Y8VA 3K4AA 2WVVA 5A2BA 2EABA 2WHKA 3GXTA 1BVNP 1WO2A 2CKSA 3VMPA 4MJ4A 1VEMA 2QF8A 1Q6DA 1TQSA 5D8WA 3WQ8A 1UYQA 3WQ5A 1LJYA 2O92A 3CZKA 1WAWA 2VMFA 4DWSB 5GNXA 5E70A 2PBOA 5FL0A 2VQTA 2G8ZA 1KR1A 3ZT7A 4UQ9A 3VD3A 1HNYA 3S5YA 1R47A 2XIBA 2Y2WA 3DX0A 2ZUWA 1HJUA 4HOZA 3WD4A 4J3VA 4M56A 4BCEA 4HZ6A 1HJQA 3ZM8A 3VGHA 1VRXA 2WMKA 4ATLA 1XC6A 4YPJA 2QV4A 3II1A 3SCPA 4CN1A 3LRKA 1JFXA 1DP0A 1R75A 4LQ1A 1XCWA 3VVGA 4S3JA 4IISA 3NSMA 3BUBA 3DHPA 4UZUA 3DDGA 1KFWA 3CZNA 1K9FA 3B9EA 5CGTA 3OG2A 2BY2A 3WQWA 2ESCA 3W38A 3DYOA 3W26A 4H41A 3EMZA 4ATWA 1YQ2A 3PTKA 2DH2A 1JF5A 2CERA 3MUZ1 3WY4A 3BAWA 2PF0A 1UR9A 3BVVA 1QW8A 2E40A 2PWDA 3AHTA 3UR7A 1UA3A 1EDGA 4TUFA 3FHQA 4C7DA 2FHCA 1TQUA 5A1AA 3AS2A 1CZ1A 4CVUA 1HJWA 4GZIA 2RGMA 3T2PA 4NX0A 1JG9A 4H8HA 2VX7A 2WMIA 5AC4A 4W5UA 3N18A 1DWGM 2YOCA 4ACYA 3BAIA 2IXUA 2CNCA 1HKJA 1DWAM 2ZXBA 3RM8A 1V0MA 3WFZA 3ARSA 2ZWZA 1GQLA 1UWSA 3N1AA 2VNCA 3WD0A 4EAMA 1W2VA 2YA1A 5A6MA 4BQ3A 2DPEA 4WLCA 4FNTA 1MW0A 3CMJA 5CPSA 4GI8A 3EDJA 4MDPA 3LMYA 4D6IA 3BCFA 2PWFA 1E6PA 4OOZA 2VVSA 3ARTA 4OOUA 3FNDA 3ZT6A 3PHAA 5E9AA 5IHSA 1V3MA 3AYSA 2EEXA 3AMGA 2G3IA 4BF7A 5BROA 3CZJA 1J01A 1W1VA 1W1TA 3SCSA 2G3MA 1E4NA 2V3FA 1QWNA 1BF2A 3EJQA 4UFLA 3BLKA 4AD5A 2PWEA 4DUWA 2ZUMA 5EFDA 2XFRA 3ZJ7A 2A3BA 2WSPA 1ZB5A 2CHOA 4FMVA 1DHKA 4H8UA 3T08A 4UR9A 3DHUA 2HISA 4U31A 1SYTA 4UNIA 1BGAA 4OGZA 1E6RA 2XJ7A 5CG0A 1TVNA 1NWTA 1RP9A 4W85A 1E5NA 3WH8A 2WZEA 3RJYA 2WC4A 5DMYA 2GK1B 1G01A 3LXAA 1XH1A 3UG5A 3F5LA 1J0KA 5C70A 5HBFA 5I2UA 1R46A 3BUPA 3B9AA 1EQPA 5I5RA 3RMEA 3FAXA 1BHGA 3VX0A 1E43A 1J0YA 2F2HA 3QHOA 3VDAA 1EO5A 2JIEA 3M46A 3VIOA 2XFFA 5JBDA 2WC3A 2XVNA 2AOSA 1UUQA 4TX8A 4MB4A 5BCAA 1JZ8A 3BAKA 2VQUA 3GH4A 5LYRA 3A6OA 5AY7A 8A3HA 3MSGA 2E3ZA 3PZQA 2WVTA 3EDFA 1J12A 2WPGA 1B3WA 5A2CA 4DUVA 2EQDA 4CD8A 4ZE5A 1GW1A 2W66A 1HJXA 2W5FA 3VIMA 4F9DA 2BS9A 3PTQA 5A8PA 2OSXA 1GHSA 2QPUA 3UEQA 1HVQA 1CBGA 2WANA 3CUJA 3QGVA 5EMYA 1BGGA 2Q8XA 3FW6A 1BYDA 1ISWA 3MMDA 3BLBA 4KH2A 4B15A 3AZRA 4NZJA 3UERA 3VM7A 1UWIA 3ZO9A 2JEQA 2J79A 4E8CA 3TA9A 3BAYA 4UCFA 1NQ6A 1ZBKA 1B2YA 1G9HA 1JNDA 3K46A 1H49A 3ALGA 1UHVA 2CBVA 2MANA 1DWIM 3EJUA 3BSHA 2DSKA 4PN2A 2CIPA 2J75A 1PBGA 2EO7A 1BQCA 1E5JA 2CEQA 2YL5A 2ZUNA 2XGIA 1OSEA 3BVXA 1IT0A 1EQCA 3I3BA 2VURA 2G3NA 1ZJBA 2W4XA 4DWSA 2OSWA 2C0HA 3DC0A 5C8BB 4D6CA 2D24A 5EFFA 2ZXDA 1R85A 2VL4A 2OYLA 4BZYA 3M07A 1Q4NX 2X2JA 3VSVA 3WMSA 1JGIA 2VI0A 3PZOA 5E6YA 4J3SA 2X05A 1UWQA 1MW2A 2YFNA 3KL0A 1GJUA 3T0DA 1M04A 1OGGA 2J8GA 3ZR5A 2WMFA 2V5CA 4CN6A 1H09A 5BXPA 3ZSSA 1BYCA 2OW7A 3WY1A 4ZXOA 4ML4A 4PTMA 3RO8A 4E4PA 3TOPA 1H0IA 1R87A 1CPUA 4ACZB 1HP5A 1QI0A 5CLWA 4NRRA 5HPCA 5IFPA 2D2OA 4RE3A 1HP4A 3LRMA 2BY1A 1K9EA 4P7OA 1E6SM 2X1IA 1UQYA 4NZCA 3AISA 4H8VA 3WNLA 2NT1A 1LL6A 2XSBA 2WLZA 2D3LA 4PTWA 1H1NA 4X0NA 4FLRA 1XGZA 4URIA 1VENA 4CU7A 2J25A 4WSJA 3ALFA 1ZBCA 4HMDA 3OIHA 1R7OA 3VDCA 4P8VA 4Z2KA 4PMDA 1QWUA 2XSAA 4QLLA 3GNPA 4RE2A 1UKOA 4Z2LA 3U5UA 2NW0A 1LG1A 2OSYA 2YA0A 4OIFA 2YKKA 2OWWA 1G5AA 4HMEA 5CPTA 3HMCA 3VD4A 2YL9A 4F66A 1I1WA 1JI2A 2V3EA 1UKTA 4HZ7A 3AYRA 2XIIA 2VCBA 2AMGA 3UETA 4D1JA 1V3LA 3NUKA 4GINA 2XPKA 1WPCA 2GVYA 5A6BD 2EAEA 4MTVA 2VTFA 1Q6GA 4E2OA 3M7SA 5A8MA 1E6QM 1V3KA 3GYCA 2CXGA 1K9DA 3W29A 1XH2A 2WHMA 1JZ5A 1IZJA 3D4YA 1VFFA 4U5IA 2WSKA 3LXBA 1W3LA 1PZ3A 2VX4A 2YDQA 1CDGA 2XVGA 2JE8A 5A6JA 4C7FA 1R8LA 3CUHA 3GZAA 4H2CA 1EOMA 4GI6A 3MMWA 1E0XA 2VRJA 1J11A 2DSUA 3DECA 1G0CA 1WE5A 2DEPA 2V5DA 1XSJA 2OWCA 4CCEA 4CD7A 1JD7A 2WKGA 1RPKA 2ZICA 3BC9A 2XYLA 1TMQA 3K4DA 3WDHA 1C8QA 1UOKA 1UKPA 3CHDA 1IV8A 1QNSA 2WCAA 1E40A 1TQWA 4FLSA 2AAAA 2UY2A 4U2YA 1CXFA 1DWFM 4PSPA 5GQBA 1E0VA 1CECA 1UQZA 2CBUA 5D8ZA 4UFMA 3WL0A 2F8QA 4PMUA 2WHLA 1KGUA 2J74A 3EJPA 1FH7A 1TA3B 4PMRA 2E8ZA 3QHMA 4Q22A 2BXYA 2UY4A 4P7NA 4ZEPA 1EOKA 3RILA 3A4AA 1FA2A 3CMGA 1FH9A 3WH7A 4JZ5A 1TVPA 1SFSA 1GZJA 2W91A 3U7BA 4PCSA 4JCLA 3ARYA 1QHPA 1E1FA 1QBAA 4S3KA 1L0PA 5LA0A 1NH6A 2WVUA 1UD4A 2O9RA 2WWDA 2NT0A 2VZVA 3NDZA 3CUFA 1ZS2A 3FY1A 4CD6A 3WNPA 1J10A 3IK2A 3EDEA 3IAPA 2J4GA 2ZWYA 1UD3A 1TCMA 3VTRA 2D73A 3CZLA 1NWRA 3AJ7A 4U33A 1QI3A 4WKAA 3BVUA 3WMCA 4X9YA 3GNOA 2YL6A 1E4IA 3TONA 2J7BA 1NWSA 5DT5A 2YDRA 1Y7VA 5IXEA 1EHNA 1A3HA 3SCUA 1J9YA 1UH2A 1GJWA 2ZX9A 5I24A 1V6YA 4C7GA 3PZGA 5HOSA 1C92A 4M82A 5D9OA 1C91A 3WF2A 2NSXA 4HA1A 2YLAA 1U30A 2OLHA 3PN8A 2V3DA 1HIZA 1B3ZA 2WW5A 1FP8A 1E70M 2WWCA 4Z2HA 1R7AA 2QMKA 3H53A 1TFVA 5CPQA 4TVCA 2WLYA 3NDYA 1MYRA 3VD7A 4J7RA 3OLDA 3SCTA 2Y4SA 2WZHA 3ZQ9A 1SMAA 4PMVA 3QR3A 4NRSA 5KZ6A 3GXNA 5LA2A 1LL7A 4V27A 1JYNA 3N04A 1KXVA 3MU7A 4P8WA 2DQXA 2J77A 2XVPA 4DO5A 3U57A 3D4ZA 4P7RA 3HZ3A 3MV01 3CZGA 4WIWA 2X2YA 4Y7EA 4A4AA 3N12A 4J3WA 2G3JA 4B3LA 4M1RA 4AY1A 2JF7A 1UZ4A 3N13A 4AZBA 2XWDA 3DX2A 1BVZA 4CGTA 1BSIA 3W37A 3POCA 4MDOA 3ECQA 3IJ8A 5BRPA 4JHOA 4UTFA 5GNYA 3F5JA 1AQ0A 5ABFB 2WMIB 3FN9A 4DWSD 1E4MM 1JAEA 1H3GA 3PZMA 4QFUA 4PEEA 1CYGA 2WXDM 2IXVA 3TTSA 4AEFA 4PRWA 2JEPA 1PX8A 3VSTA 3WQ4A 1O6IA 1UWUA 3SEPA 2FH8A 4PSRA 4YHGA 3A4WA 2WVSA 3AI0A 3OBAA 1QNPA 1W1PA 3WDIA 2WMHA 3EJSA 3L4YA 1KTBA 2EPMX 1PIFA 1P6WA 3VINA 1OD0A 5M17A 3HG2A 4M80A 4DM2A 3A47A 1E56A 3W28A 3ZSTA 1CLXA 2VR4A 3PZUA 4PMNA 3THDA 2A3CA 1R86A 1KQYA 3KL5A 4GXPA 3VIFA 3CGTA 3DX1A 1OBAA 2JIWA 1CENA 3ZJ8A 1D3CA 1FH8A 4JCMA 2W92A 4W7WA 1XV8A 1W9VA 4IM4A 1LQ0A 4MADA 1V08A 2XVKA 3AMLA 1SZNA 4W86A 3D52A 3LPFA 1E71M 1WZLA 5A2AA 1GCYA 3OLGA 3WFLA 4CU8A 3CUIA 2GJRA 1B1YA 2YLLA 2XG9A 1LLOA 2V3GA 2F7QA 3WNOA 2VOTA 1JXJA 2BVDA 1I75A 1B3XA 2CYGA 2J7FA 4P8XA 5CGMA 3S6TA 4GKLA 1CTNA 1W3JA 3VO0A 3CLWA 4QCEA 2E4TA 3CUGA 4JFWA 3PTMA 2G41A 2J62A 4IPNB 3GH5A 4PMQA 3O6AA 3AIEA 1C93A 2YBTA 4L4PA 1HVXA 3WEOA 4D71A 1TG7A 5CSUA 4GZEA 2WNWA 3VGDA 1QI4A 1W9PA 3O9NA 1HX0A 3AFBA 2ZUVA 4UQAA 3MS8A 4MJ2A 3AQUA 1E3XA 1W9BM 1V6WA 1X6LA 2VRKA 1RP8A 5FKYA 3AXHA 2XWEA 3U5YA 1CXIA 4MAVA 2E9BA 5D9MA 1R34A 5M03A 1TA3A 3VILA 1KXQA 3A24A 4QLKA 4ZE4A 4YHEA 1EA9C 4RE4A 3PZIA 2ZUUA 1US3A 4M24A 1VBUA 1MFVA 2ZX7A 4D6FA 2ZXQA 1PX4A 4AD3A 3CH9A 1GPFA 2W67A 4TVDA 3OZOA 3QHNA 5D9PA 1JDAA 1GOMA 4BQ4A 3W25A 5A6AA 5E0CA 1K6AA 2FDMA 1E6NA 2VZUA 3TV8A 3MMUA 3AHXA 1VEPA 3PZ9A 4EANA 1OIFA 4TX6A 3ARQA 1KBBA 1LG2A 3GNRA 2XN1A 4XB3A 1E6ZA 4R27A 5CSYA 1E15A 2WAGA 4UOJA 1BTCA 1LL4A 1Q6CA 1VFMA 3BGAA 3E1F1 1HKKA 3RPMA 3VIPA 2VCAA 3W24A 3S2CA 4A3YA 4CD5A 3D50A 4TVUA 3AMCA 1PIGA 4OBRA 3UESA 3ZR6A 2F1AA 4AD1A 1EH9A 1GOKA 3KLLA 2V38A 3WN6A 3WF1A 5D4YA 2F7PA 3BAJA 1H11A 1EIBA 4PMZA 2FH6A 1J0ZA 3HN3A 3VIKA 4CCDA 1MWOA 3MSDA 4JFTA 3HG5A 4QLJA 4V28A 3N11A 3AXXA 3VD5A 3UR8A 4HU0A 1MW3A 2EADA 1BFNA 1XCXA 1B3YA 3EYPA 2CKRA 2PC8A 4UOZA 1XD1A 3LPPA 1DEDA 4X0VA 5BXRA 1W9XA 5I23A 2J7CA 5IFTA 1OIMA 4U5KA 7A3HA 1H4PA 1KXTA 1GVYA 5CZKA 3VNZA 4PMOA 2BHUA 1C8YA 1B31A 3K8MA 3QOKA 3ARRA 1NOFA 1TQVA 4AZ7A 1QNOA 3ZOAA 4B9YA 1VB9A 4QCFA 4AMCA 1WB0A 3GH7A 3N9KA 3K8KA 2OWXA 1JFHA 1U2YA 3WBEA 1CGYA 5EB8A 2D1ZA 2FE0A 3FAWA 3SUUA 1PJ9A 3AMDA 1CNVA 4CCCA 1BG9A 3K1DA 1QW9A 3S5ZA 2GDUA 3VGFA 3CBWA 1BG4A 2CCRA 2G4FA 1V03A 2XM2A 3ZMRA 4FNUA 1W3HA 5ABEA 2VZTA 3WUGA 3W53A 1W32A 1X1NA 1HTYA 2IGTA 2BHZA 5DF0A 1LF1A 4UFJA 1CGWA 1FHDA 2J8FA 3PZTA 5ABGA 2ALWA 4AZIA 1AMYA 6CGTA 2GUYA 3DYPA 3MUAA 2Y24A 9CGTA 3SCNA 1QNQA 2WC7A 3ZIZA 2F61A 1V0NA 2O9TA 3PZNA 1MXDA 3GBEA 2WCGA 1HKMA 4PUEA 2EACA 3KZSA 1E3ZA 4AW7A 4AEEA 4JIEA 5LA1A 2A3AA 1UH4A 1JL8A 5F7UA 4JKKA 4W84A 1OM0A 5IHRA 3L4TA 1E4LA 1DTUA 4MB3A 3BMVA 5I0DA 5AYBA 1GOWA 3J7HA 3CZ8A 4MNJA 1UR2A 3WD1A 5DO8A 1CXEA 3WH9A 3WNMA 2F1BA 2DDXA 4BQ5A 1QPKA 5FCZA 2GJPA 3MANA 1XYZA 3RIKA 4MAZA 3HG3A 1ODZA 2WYSA 3WL1A 1CIUA 1J0JA 1D2KA 2XHYA 4D72A 2GFTA 4HA4A 1HF6A 1T0OA 3IGUA 1JZ7A 3BMWA 1KR0A 1GNXA 4L4OA 4NZFA 1QVBA 4DO6A 1US2A 2BY3A 4J28A 3WUEA 3GXPA 1CXKA 5IDIA 3A22A 2J7GA 3UG3A 1XH0A 3SCQA 1VEOA 4IPLA 4H7VA 1WZKA 1WDPA 2JF6A 3VGEA 3NSXA 4XUYA 1VJZA 4MNLA 3WF0A 1CXHA 2WM0A 3WEZA 1E6XM 1GORA 1ISYA 2DSZA 2C8NA 2D3NA 1UD8A 1UASA 1JNEA 1A47A 2FYVA 3W82A 1XSKA 3WF4A 1PPIA 3SUVA 4JFVA 3GXDA 2OYKA 2A3EA 1VAHA 1E73M 4DWSC 3WENA 3LRLA 1GOQA 1H41A 1CWYA 1B90A 3L2MA 1VF8A 3POHA 3ARZA 1B9ZA 1WZMA 3MKKA 1C8XA 1WP6A 1OGSA 4NI3A 3SCVA 3VGBA 1XD0A 4W8BA 5I6SA 2GJXB 2D23A 3VDHA 5M5DA 3WY3A 2EPLX 3NCOA 1ITXA 1E0WA 4FK9A 2ZIDA 1JI1A 4GQRA 4F9JA 1PS3A 3L4WA 1WDQA 1IZKA 3BXWA 4N42A 1HWWA 1AQHA 3APGA 4AIUA 3WH5A 5I77A 1OGBA 2Y5EA 1J18A 3AICA 1GUVA 3ZT5A 2W63A 3WMBA 1B3VA 2J7EA 3AHZA 2RGLA 2BY0A 3RJXA 5FOOA 4Z2IA 4LYQA 1FFRA 3MV11 4M29A 3F4VA 4XV0A 4AIEA 1V02A 2J7HA 3KWXA 3LXCA 2Z1KA 2X8RA 3SCOA 1Q6FA 4LPCA 2DGAA 2EPKX 3ARVA 3B8SA 4HMCA 5C71A 4F79A 5A6KA 5KEZA 4W88A 3TTYA 3ARPA 3F5KA 3T2OA 3EMCA 1V02E 1U33A 5E6ZA 2GJXA 4LXFA 1R33A 3HG4A 3UG4A 2ZOXA 1GQKA 1W9DM 2FGZA 1VFUA 3CC1A 3HU7A 2A3HA 2E0PA 4OKDA 5ECUA 3ARWA 1YHTA 4CD4A 3VU2A 4HU8A 4AMWA 3AZTA 7TAAA 5DFAA 3LPGA 3RM9A 1Z32X 4GI9A 3BUDA 1CGVA 2DT2A 1GOIA 4JHZA 1D7FA 1FFQA 4ACZA 1UD5A 2J7DA 1HJSA 2Y8KA 2CBJA 4MB1A 4AC1X 1NP0A 3VKKA 4D6EA 2XGBA 1UD6A 5ABFA 1CEOA 3H54A 1XRVA 1F4AA 1SMDA 2UWFA 4QAWA 2PWGA 5CJ5A 3L2LA 1VFOA 2DT0A 3A5VA 4W8AA 4UFIA 1JIBA 1ESWA 3MUY1 1VIWA 1BAGA 4GPNA 2WK2A 4FLQA 2DIJA 1QOXA 3AZSA 3WDJA 1E55A 4U3CA 5BYWA 1JDDA 3DX3A 5AC5A 3CHFA 2VCCA 4CVWA 3A4XA 4LX4A 3N15A 5A6BA 1FOBA 4JAWA 3GXFA 3CZSA 4MNMA 3VX1A 4AZ5A 1UR1A 4KGJA 3VOCA 1NOUA 2UY3A 3AIBA 1QI2A 4N0RA 4UQBA 1UKQA 3IAQA 3G6LA 2X09A 2VVNA 2J47A 3GM8A 4HPHA 1ISXA 4AYGA 1WZAA 3OLIA 2YJQA 2D0GA 1H5VA 4ZFMA 3WQVA 1F4HA 4HOXA 5JUVA 3TTOA 1UG6A 1HXKA 2X0HA 1NM9A 2E9MA 1W1YA 3BUQA 2VO5A 2WMJA 2VUYA 4AZHA 4WK9A 1UA7A 1X6NA 2VX5A 4WF7A 1NARA 3FXYA 1JDCA 4B16A 5A8NA 1CXLA 3WQ6A 3WUBA 4GO8A 1E1EA 4BS0A 5A69A 4XZBA 2WCSA 3THCA 2PWHA 2QLYA 2BVTA 2VR5A 2DSWA 4EE9A 1GHRA 5FIPA 1CGXA 1ISVA 3W4RA 3WKZA 3WELA 1HN1A 2GSJA 3WD3A 4D6GA 2IUZA 3L4UA 2DIEA 3UCQA 3AS1A 4J27A 1MQRA 1JYVA 2QMJA 4OJYA 3RCNA 4WKFA 4OZOA 1KGXA 3AIQA 4KGLA 1M7XA 3WD2A 4AIOA 1CLVA 3CIVA 3KEHA 4NXSA 1TZ7A 2XFYA 3WIJA 4Z2GA 4MB5A 4AWEA 2XVLA 4P8UA 1MQPA 1TQTA 2WKLA 4P7QA 4UQDA 2WBGA 3W27A 1OT2A 5TD4A 4AZ6A 1JZ3A 5FD0A 2ZUSA 1JD9A 2B31A 1HT6A 4R5EA 1UD2A 5A94A 2D0FA 4GIAA 2XTKA 4W89A 4D1IA 4AISA 2VRQA 6TAAA 5JIWA 1BLIA 4AD0A 4B3KA 1OINA 3LPOA 2JFEX 4ZXLA 5JIPA 3NJ3A 2DT3A 3MO4A 1PZ2A 1HKIA 4EK7A 2OYMA 3VMOA 3OGRA 4W8LA 3T09A 3W81A 4YN5A 2EBNA 3FHAA 3KLKA 5I79A 5ABHA 1C7TA 1ITCA 1RH9A 1WDRA 2E9LA 3G6MA 2D22A 1OT1A 2F7RA 3D5HA 4D6HA 3KE0A 1QHZA 4W87A 5FL1A 3DDFA 3SUWA 1V6XA 4V2XA 2CESA 4GQQA 3CTTA 2CETA 2X2IA 1V3JA 2D0HA 4MPKA 3GDBA 4E8DA 3GBDA 4TXEA 3T2QA 3WUFA 1JXKA 3CO4A 4W7VA 2ZX8A 2XN0A 1VJSA 3B9DA 3NYDA 3L4ZA 1QNRA 3SCWA 5JBFA 3CZEA 3AHYA 4FNRA 3CV5A 1OCQA 4D6JA 1EXPA 3WEMA 4UQCA 4KWUA 4OUEA 2VZSA 5HNNA 4EKJA 3IJ9A 3NIYA 5DT7A 1GQIA 1RD6A 1C3FA 2PB1A 1CGTA 2GK1A 2O9PA 1ECEA 2DH3A 1OWQA 1QI5A 1HXJA 5E1QA 4UFKA 1E72M 4TOQA 3EMQA 4ZENA 1V0KA 2JALA 2WVVB 1UWTA 2FHBA 1UWRA 1H0GA 3VIJA 3GXMA 4JL1A 2ZX6A 4HP5A 3BH4A 1UR0A 1DWHM 1V3IA 1Q6EA 1XHGA 3CPUA 3WSUA 3BLPX 1MXGA 4AXNA 4RL3A 1NOWA 1W3KA 4GZJA 2VX6A 4HOWA 3JUGA 4HA3A 1KQZA 5EBAA 4M81A 4M8UA 4AD2A 4WKHA 1OD8A 2O9OA 3WDRA 1LWHA 1AVAA 5BRQA 4K68A 3D51A 2BV9A 5BXSA 3VD9A 4HZ8A 4FNPA 1G1YA 4DM1A 4J3XA 4F8XA 4XX6A 3WNKA 3IANA 1WNOA 1JYXA 1EO7A 1EDTA 2CBIA 3OGVA 3D3AA 4W5ZA 3L4VA 3AS0A 4QP0A 4PTVA 2EPOA 1O7AA 2CITA 3HJEA 2WZIA 3ARUA 4BQ2A 3DYMA 4PCTA 4TTGA 6A3HA 1MQQA 3VNYA 3BSGA 1K9TA 3AS3A 3VPLA 3VDBA 4UQEA 3TTQA 1W9UA 4PMXA 2YA2A 3I3EA 3WBAA 4W7UA 3VIIA 2YL8A 3BUIA 5CQ1A 2EXOA 3W0KA 1NP2A 1JYWA 4QDMA 1M53A 5AYIA 4FNSA 1M03A 1O7DC 2YDSA 4PTXA 1WCGA 1B0IA 1L8NA 3AIVA 1W91A 5E09A 3VSUA 3LX9A 1KTCA 3PBGA 3SUSA 2WB5A 2W62A 4AZCA 1XYFA 1DWJM 3VIHA 1NWUA 2D20A 5M3WA 2QPSA 5A8QA 4P7LA 1WKYA 1MVYA 3QOMA 3EBVA 4U2ZA 1GQJA 2EJ1A 3AROA 1ZBVA 3T0AA 5HDRA 1ZBWA 4MNKA 2HVMA 2TAAA 5A8OA 1H2JA 1AQMA 1I1XA 3VM5A 1FP9A 3H55A 1ODUA 2XUCA 4B9ZA 3BAXA 1PX3A 4U3AA 2XN2A 5D9NA 2QHAA 3WH6A 2CPUA 2C7FA 4CN4A 4PBGA 1KXHA 1KWKA 4UZSA 5GNZA 3OA5A 4WJXA 2F18A 1JAKA 4BA0A 1EHAA 3WNNA 4FF5A 5A6LA 3GXIA 4AD4A 3A21A 7CGTA 4NF7A 2BNJA 3VGGA 2VJXA 3OZPA 4DUXA 1B30A 4CUCA 1WDSA 5I3DA 2E8YA 3U7VA 4CKQA 1UKSA 1C7SA 3SURA 3KL3A 5CLTA 1GVIA 3L4XA 3VIGA 3W6MA 2UY5A 5DEZA 4KMQA 3WF3A 3A23A 1C90A 2CHNA 5BWFA 2VZOA 2ZX5A 1GONA 3AMKA 4H04A 1KGWA 4ATDA 1N82A 1PAMA 1ZJAA 4D6DA 4PUDA 3BVTA 2GDVA 4PYSA 4JFSA 1QX1A 2BHYA 1GOOA 4LYRA 4UOQA 3VUPA 4Q7NA 4FNQA 2X2HA 1HL9A 4JFUA
chains in the Genus database with same CATH superfamily
1D7DA 2CLFA 1S7RB 3AUWB 5E8EB 4TVPD 5L2KB 1AQDA 2VM3A 2ICWB 3MLUH 1P7QB 5JO5B 1X9UA 3ZMNA 5LDUA 3NR0A 5HNRA 2AV7B 4BQ6A 5FECA 3W7PA 3W5MA 1TX2A 4LVGA 1TMCB 5DWUH 1AW1A 2V7NA 1UUOA 2E6YA 3LCHA 1H8LA 2XWZA 3BP5A 4GQ9H 4H9TA 2UZIL 1KBVA 4MSWB 4X8GA 4XAKD 1TVHB 4NXKA 5BXTA 3S5NA 2WW8A 3O6FA 3QEQA 2O56A 4UBDD 2G60L 4PJHB 1OYCA 3GDRA 4BWLC 4IBYA 4J3TA 3AIWA 1W2PA 1KXVC 3ENLA 4MY9A 4ZS7L 3U36B 5ALBL 2K9UA 3EGDA 3NSNA 3S96A 1F05A 2AEPH 3QV7A 2ZP8A 1H5YA 2WINB 4F91B 4R96A 1A65A 5C0CE 5D7LA 4U1LB 5BZZA 1V7YA 3T3MB 3TNMA 5IW6B 1SJMA 3KPQB 5J12C 2X4QB 3GVRA 5DXYA 1RCOB 1WICA 2YFOA 1A5MC 2O5XH 1S5IL 5EO0A 3N0AA 5BOOA 4DBEA 3TN3A 2BVYA 1MH5B 3EDKA 3UMTA 3MLRH 3QP3A 3ZYOA 3LOWA 4H8QA 4UU9A 1W0WB 5I6NA 5CKSA 1R3VA 4KVCL 1SVBA 4N2NA 5I8OL 2BFGA 2Z7YA 2FO1A 1ISZA 1OK4A 5EBUA 4WJ5B 3PGCA 5AVXB 1OP3H 3D48R 1NCDH 4LIQL 2W61A 2WMGA 3O07A 1EDQA 2EXTA 2DSVA 4NSBA 4ETQB 1JGUL 2H2PD 2CCWA 1BBJA 3FU0A 4P57A 2ABBA 2UXGA 1IX2A 1WBJA 1BVOA 4R0LC 3LSOB 2WQ8A 5E2UH 3WTVA 2I14A 3GIQA 1AZZC 4MS6A 3DIDA 1PVHA 1DBTA 3ARXA 3ARDA 1E9LA 3GF8A 1HFBA 1WV2A 2P5WA 3P61A 4CU6A 4KRUA 3IJ7A 1P6FA 3OGSA 4J8RB 2AQRA 1KTDB 1MHCA 1GS6X 3B34A 5CJXA 4XP4L 5J6GB 1HGWA 2WWMD 1JPFA 3A6CL 4DI9A 4PJEE 5IMOA 4F4RA 3U6RB 4XNXH 5EO1B 3PANA 2PTUA 4GRLC 3T8XA 4FF9A 3P2DA 2PA6A 4LHUG 3GKAA 3EWZA 4FQXB 3N73A 1DVFA 4KY1L 3BYTA 1U58B 2X3AA 4N90E 1XISA 1M01A 3RZWA 1QHOA 4ABUA 1X38A 1MNZA 4WI8A 4FXGB 4XVJL 2BVQA 5SX5H 4PU2A 1JF1B 4UXDA 4A3HA 5TDOB 2FJHA 2WXJA 2FWUA 5GS0H 4GP4B 1JUFA 2HWZH 1N64H 1ZL1A 2EPHA 3AIUA 3KM8A 5H4ZA 3PWGA 1Z8AA 3ZS4A 2A38A 5KZCB 3WEXA 1NANH 1HUVA 1LYQA 4QRRB 1T22B 4L0ZA 3BQUB 3SIKA 5IWLC 3S2LA 1VS1A 3RI5F 3WO3B 4FLOA 4UFHA 1OX5A 3VRJA 5EMUA 3RIFF 5A3HA 4UR7A 4XIMA 1S7SA 1LOSA 1HJVA 2EC9T 1ZLVH 4DGYH 3PUGA 1XF0A 3VUSA 7REQA 4Z7OF 4X5LA 2J71A 3ETBJ 2V5YA 3H2WA 2X40A 1VSCA 2IDCA 3ISRA 2A3LA 4AZCB 2J2ZA 4AYSA 4J3UA 1CDHA 1F2QA 3DOPA 3TCLB 4DNMA 5JYMA 2VLKB 3SIMA 2ZE0A 1MCDA 4JFOB 4DSYA 3GQYA 5IG7A 5I73B 3ATDA 3IV8A 3Q2VA 1I85A 2CDFA 3QFJE 2WBKA 4J3OF 2FO4A 5BJTA 1V3HA 3S97C 3OWRA 2MEJB 3PRZA 2FX7L 5D6DC 1KM5A 1SFTA 1RI8A 3THMH 3HZKA 2J9YA 2VC7A 3G1HA 4I18C 2IWFA 4R5VA 5I1HH 1PE1A 4NT0A 5D7LE 1F41A 4HG4J 4GEJA 4YVVA 3E0LA 3DX9A 3LY0A 3T77B 4CJ1A 4ZTPL 1DL7H 1GYNA 3VXRA 3ZGIA 3DXIA 5A6SA 3GDTA 3SRDA 5KVDH 5E1HB 3HHSB 4K94H 5F2IA 5HGDA 2Q7YB 2X0VA 4G56A 1S9WA 2BG5A 4GRLD 4NQSB 1TTRA 2FNWA 2HYMA 5L9DH 1JZIA 9RUBA 1PO9A 3CU2A 1I1YB 2DL2A 5TQ0H 3OF6D 2FGLA 1VPOL 1D6VH 3HMWL 1ZA3A 4BZ2L 3W6LA 3EH4B 1XGRB 3H9SD 3K4AA 4K55A 1A6TA 5A2BA 2QAPA 4QTHA 2QDGA 1KENH 3BKYL 3DIFB 1XGPB 3D1MC 3RL2B 5AENA 2NY4D 3IJSB 5ICZB 1DO6A 4WXZA 3VZZA 2ZD0A 3BG5A 5C7XL 1X4YA 3MJGX 2IH1A 4GW5B 1FUNA 5IBUG 1P0DA 4OD3H 4WWKC 2YD6A 1YPZE 4S0TD 3NRFA 3MLVH 1LNUA 5DC2A 1O7DE 4ZFGL 4PTTA 4YSAA 3X1EA 3FQTA 1B88A 1S2CA 5AW5B 4URKA 2PXYB 3CVBA 3L3DB 3IE9A 3VNMA 5ICYA 4J6RH 1LQBC 4Q9QL 1LHZA 5MHSD 2CGRL 4QRSB 4CSPA 4A04A 4NRXA 3L17A 2LFGA 2G8ZA 4HS6A 1M71B 2ILLA 4XB7A 4XPBH 4ZMOA 5BV7B 2I9EA 4H6QA 2OMVB 5ITBH 5I76A 1OZMA 3C08H 2XIBA 4DN3H 2R69A 4D9LH 3HFTA 4DP6X 2WNKA 2Y25A 3DX0A 2INEA 1BMGA 1RUMH 3ISYA 2Z31A 2ZYIA 1AH1A 3ARGB 4B96A 1O66A 1HDMA 4J5VA 4J3VA 3CB8A 2R2EB 3QIBD 3H4GA 4I1RA 3MHGA 1DE6A 1QFEA 2VLLB 5CGYD 1JBJA 2FZNA 5IREA 2N7AA 1ZHBB 1RZKL 1I4FA 4Y5XB 3JYBA 3EO0A 1HESA 5E9DE 2YZRA 3GG0A 4JJOA 4M6VA 1DP0A 3LRKA 3CMOL 5DGRA 4ZAKA 4WEBL 5EZOL 1JFXA 2QUVA 4C54A 3PPSA 3MLPA 3TQ0A 1XCWA 4S3JA 2UWEA 2OMZB 4XMLH 4N2IA 3C2FA 4N8CH 1QWGA 4ZUWA 4FQLL 3BUBA 4OCRL 2QVIA 4L8BB 3ESVF 2CH8A 4LLUA 3FCSA 1XQLA 3TO2B 3UBFA 3CZNA 1KFWA 2V0TA 4GWEA 1U8KB 5JLZB 3B9EA 5ADPH 1YDPB 3C5ZC 1AUSL 3OG2A 3TIDA 3S1WA 2W60B 4K5NA 1TVBA 5DFWH 2VDQB 4BE6A 2P53A 1WF5A 4OLEA 4WW2C 3PJXA 2E9WA 1EXUA 4GKOA 2VENA 1SO3A 1QR1B 5DJ8A 2DH2A 1LO2H 1JF5A 1T40A 3R5EA 5MI0B 1US0A 4Q6YA 4X7EC 3MUZ1 3WY4A 1YEJH 2PF0A 4G1KA 1XGQB 4U1MA 1JCXA 4DN4H 4Q8TA 1QNZL 1XF2B 4F7CB 1AZBA 4PFHA 4Y9GA 1MAJA 4G1EA 3HPSA 1KM1A 5DMMA 2E40A 5ELIA 3VQ2C 3E6HB 3CCHB 3RY6A 4LF3A 2X1TA 4YS4A 3AHTA 2B1OA 4US5D 5IQ9A 1C9SA 3W71A 3GMPB 5AKSA 4P49A 3CFEB 4HFUL 1EDGA 1HHIA 2AK4A 2BIIA 5JPNA 4G8GD 3PJLA 2EIMB 4TUFA 1TELA 3GB7A 4KKRA 2FHCA 1TQUA 1N8ZA 5DEGA 4LVHC 4ZSTA 3KHDA 3N9SA 4NERA 2V8MA 2X4NA 3IRPX 1BPVA 4IJ3C 3G1FA 3D9AL 3ZE0E 1HJWA 5TNVA 4NVTA 3HE6C 1T1WB 4IKJA 5CM1A 3QZBA 5CGYC 4G2DA 4HUVB 1EWDA 2Z6FA 3HHMA 5EORL 1U93B 4H8HA 4ONHB 2UY7B 1TZAA 3IFPA 5ILTL 4E9VA 1F3XA 4BR1A 1MJ7H 2UBPC 2F5BH 2GSGA 5I07A 2HA1A 2ADYA 4X5XB 1RAMA 2CRIA 3SBWA 3BW9A 3ECWA 5AAMA 2INZA 3NEXA 3WGUB 2IXUA 3I4EA 1RY8A 3VNJA 2EDBA 4Q8BA 3DERA 3QYMA 4V33A 4XVEA 2UY6B 2CO3A 7FABH 5E9DD 2VITA 4RNJA 2AJ3B 4DZAA 5K4ZA 3BKJH 1AG1O 1RCQA 4DLMA 2YD4A 2G5BB 4L1WA 4TM9A 1CZ8H 4Y6GA 4V1DB 1LWRA 3FFCD 5JW3H 3GSQA 2JJUA 4EAMA 3MA8A 1VBJA 1OVZA 2OMXA 5G4OA 4QHUA 2GFBB 4Y16C 1PVNA 3L9YA 3QQXA 3IGHX 4PVLA 2UV3A 3BUVA 2ADJB 5TE6L 3U2EA 3F84A 1N3NB 1VZIA 2CKBH 3JXAA 1PG7W 1KV7A 2FX7H 4K8RD 5EZIH 3RWEB 4X9FA 1I9CB 1IWAA 3JW7A 3R1ZA 1J05B 2O1AA 3VFUA 3G1SA 4MDPA 1S7UB 5FYKD 4HU2A 1VZGA 3DV4A 3F58H 2VW7A 3ARTA 3LNDA 3LIZL 2FQFA 4O00A 3ULSA 1Q6RA 1LP9E 2ZRZA 3FOLA 4LLDA 3D3FA 4OOUA 5E9AA 4ZUTB 2EEXA 3LEVH 4ZUUB 3L65A 3DV6A 4MRCA 5JMUA 4BF7A 2ROYA 1AW5A 1KCRL 1NSNL 3QEGH 1OX4B 1CTOA 2YJLA 3RBGA 2YD0A 1LBLA 3CUPA 5MHBA 4C60A 1W1TA 4U0QB 1A7NH 2AKZA 1CW2A 4AD5A 1QWNA 4C91A 3L3JB 3HVDA 2RCSL 5EZLA 1IKFL 1FVPA 5EFDA 3ZJ7A 1T5WB 3MUHL 1LQ2A 4J40A 3WLRA 3PV7A 1ZHNB 1ZB5A 4K2UL 3ITGA 3ABZA 1MWAH 2KDYA 3BLEA 3JVAA 1FI8C 4HJ0C 3RIAK 3LCFA 2GOKA 1L6XA 5BQDA 2NY3C 1XF5A 4B0MM 3ICJA 1L0XA 2OYPA 3TZVD 1IEVA 3C61A 2NXIA 2ZXWB 1TSIA 2HWGA 4I0PA 4S0HA 2HFFA 4U31A 1SYTA 4AC7C 5GGSB 4HUNB 3LKNB 5LGHH 5JDJA 1BGAA 5HGAB 1E6RA 4EUPA 1MAKA 3GBML 1OC5A 3EXTA 4PLKC 1LBFA 4HFWA 1N7KA 4PRPB 3D05A 4I48B 4XPBL 1NFGA 2OX1A 3H22A 4TUUA 4S1RL 2EDXA 3QQWA 5E5LA 4ZMNA 5SWQB 3MOBH 3LXAA 3QFJD 1G01A 2Q6ZA 4S39A 3UG5A 1VPQA 4ZB5A 3P4NB 5HBFA 3KFTA 5KBKA 1GK8A 3MP3A 2Z4TA 2EG6A 3HPJA 3B9AA 3U4EB 4LL9A 4JO8A 4I9TA 1AKPA 1XIMA 3TOYA 1F8MA 3RMEA 5D2NE 3TQPA 2ZA1A 3PSVA 4AG0A 1THAA 4HKXA 3Q65A 4UOW0 4NZRH 4RAUA 1D5IH 1QEWB 3H9ZA 1J5HA 1KFCA 3DUSA 3QHOA 2PR4H 2X87A 3UAJA 3VDAA 4OI7A 4YDNA 2FB4H 3VIOA 1CL7L 2XFFA 4D0CA 5AD0B 3T0XA 5U4NA 3AY4C 3UADA 1GMEA 2B20A 2EDTA 1R9ZA 2N59A 4IEFB 4MQXC 2Y7GA 1R3HB 4K9JA 2X9ZA 4ZS7H 3SPVA 2F19L 4FXGA 2WC3A 2MOQA 3BHBA 2AOSA 4XPHH 3QSRA 1TPUA 1UUQA 1LP9B 3O2WH 1RU9L 1ADDA 4BFFA 1WXZA 3TNNA 1JZ8A 2OP4L 3GH4A 5LYRA 4DBWA 4XX1E 4P5TD 2NY6B 4WHTA 3QO1A 4DHGA 5ESAA 3OB0K 4AEIH 3KWWA 4TV5A 1XUZA 3ET9F 4Q4MA 5I1KL 4WTWA 1A7RH 5DZVA 2XA8H 5HPMA 2E7BA 2HNEA 2MCG1 2OM5A 3AB0B 4ZJ9A 2X4OA 4KFZC 1J12A 3LEXB 2WTRA 1JGMA 3U0TA 4O10A 3NN8B 4RDQG 3WQPA 4A39A 4LNYA 1DJGA 3PY9A 1AJ2A 3DFPA 1B3WA 2YD2A 1A7QH 5J6HB 3MXVH 4XBGA 1ADWA 4I7VA 5AKQA 4YHNB 2B1HH 4ZE5A 1HKLH 4ICMA 5ICXA 4U6TA 4F9DA 1B9BA 3QFDA 4N2DA 2VQ4A 4A2FA 1M05B 3FQYA 1BFOB 2JELL 2QPUA 3CD4A 4PTUB 3UEQA 4Z7WB 2D2JA 4GRWH 1YY8A 1AKJA 1NEPA 3IWVA 2OQHA 4QIUA 1L5GB 1KB5B 3QIUB 4ZSOE 3CQQA 5C0IA 2Q8XA 1NL0L 4XCFL 1R6WA 2GJ6A 1W0WA 3ULVL 3WAKA 2PDYA 4BUGA 1IE5A 1C5BH 2YXOA 4GAYA 4JFPB 4RDBA 1UENA 1OM3H 1BFVH 3RX5A 3T04D 2OKTA 4G71B 4OCYH 5FJJA 5DFVD 4RX4D 5L4JA 3STZB 3PJNA 5MEQB 1UWIA 2FLRT 1LL1A 2OZ8A 3PUOA 3TYCA 4NASA 2JEQA 3PK7A 4H8WC 3NTYA 3MV7D 2Y7LA 4O51B 2XY1A 3V6FB 3BQUD 5C0CD 2CJSA 4FTVA 3CHOA 2MTAA 1UBSA 4HGWB 1KUMA 4JFYA 4POZD 2B0MA 3D6NA 4RGOH 4GACA 3WUGA 1UC5A 3WFDH 3OVPA 2OJZH 2YGVA 1DVQA 4UTJA 1SDAB 4W9JC 4QJ5B 2WBJD 5TH2A 4PBXA 4AQ1C 5LWYL 1E9PA 1D8WA 3IRCA 3G5VA 3MRDA 4IOIA 3R0MA 4XAKE 3VXOA 3K46A 2A73B 1H49A 2BNRE 3DURA 4XXCA 3VXNB 4LZKA 4CBZA 2CBVA 4G5ZL 3B2MA 3EJUA 3W0WA 4EI5C 3BSHA 4HDIA 3EOAA 3HG1D 3RGHA 1SR9A 3GUFA 2DSKA 3BKCH 4JE4B 1P7TA 3XIMA 3N9RA 4XI5D 4L3ED 4GW4B 4WV1A 1QSVA 4LLQB 4JM2A 4OJEH 4MZRA 2ZXEB 4NJKA 4IKLA 4OIIH 3KCJA 3ROOA 1V27A 3X14A 1JPST 3NCJL 3PJSB 2OEKA 5FYJE 4I13B 4AOFA 3EUDA 4MCYA 4OLWL 1ZP4A 3THML 4JZJC 2YL5A 3CFDB 1KG0A 4P4RA 5I16B 3MROA 5IHWA 1EQCA 3I3BA 1O12A 4ZNEE 3P02A 3QJHB 4NQCB 4GT0A 2K1MA 1MHHB 3ISIX 4FQHB 4ZBJA 1NAKL 1U8IA 1DQJB 2GIMA 3EYQC 3II3A 1HSAB 4GXUM 4RMTA 4Q4IA 5CR8A 5EFFA 2E1WA 4BZYA 3NGBB 1HIML 4XAZA 4BH8B 4R9XA 1F6LL 1MIEL 2DRUA 1S9YB 3VSVA 4XZMX 3WMSA 1JGIA 1PG7X 4YDJB 4BZ2H 1RLWA 1YRRA 1BQHG 2H3NA 2R4RL 3S8HA 2WYHA 2A6DA 2NUXA 3AICA 4NKIH 2W3ZA 4EPBC 3COTA 1LK2B 1RY0A 1IQDB 2YXGA 1FH2A 3V0WL 1A3LL 2COQA 4IQHA 3SKNB 4BK5C 1OGGA 2J8GA 1NLBH 4H5SA 3ZR5A 2C3GA 1H3PL 3I6LD 4OD3L 4OUUB 3GSXB 2WMFA 3ITVA 4BHYA 12E8L 4MZ1A 2ZSWA 5F70A 2V2XB 2WO5A 4ESKA 2QPXA 4ZXOA 4K8GA 4IU2B 3GTTA 1H6EA 3MNZB 2WLNA 2C14A 3ZL2A 1AJZA 4JX5A 2C9RA 4S3DA 5D7JB 3TOPA 4XCYA 3U7YH 1H0IA 1RIHL 1I2RA 1S1RA 2ZG3A 1EFXA 3Q9QA 4MMZA 1FWAC 1BXVA 3V0GA 3ZLGA 2WP3O 2FB4L 3EOBB 3LBCA 1JGLL 3QYQA 2VDML 1RUML 3VWJB 2FEDC 4IS6B 4GSUA 3UJTL 1HP4A 3LRMA 4ZXBA 2XH4A 4ZQTA 1E6SM 1Q13A 4IL2A 4D3CL 2WZMA 4C6NA 3HC0A 2XWJA 1YEIL 3ASNB 4NZCA 1QPOA 3GK8L 1SXZA 4O4WA 4A38A 3VFLA 2NQ9A 1NMBL 1FTXA 2NT1A 1D7CA 4WNQB 1VJIA 3X13B 2AJUL 3TS8A 2IDUA 3OX8A 2XSBA 3QG7L 4DJDA 2WLZA 1FL6B 4PRHA 2Y7SA 1MRAA 2JIXA 3K7UA 3QPXL 3Q45A 3EHBB 4FLRA 1KCXA 4A2MA 5C09D 2MUCA 4AVIA 4ZGYA 3A67L 4HWZB 3P73B 4Y5YC 2MCAA 2MQGA 3QHZH 2VR8A 3ZDWA 5DR5H 1SY6A 3FO2A 4KV5E 4CU7A 4M43L 1LORA 4GRWE 2GPTA 3R2GA 1X4XA 3KD4A 4LSTL 3UTSB 2AK1H 4B60A 4HULB 4RPQA 3OIHA 1FF5A 2PLMA 5AW4B 5HQLA 4UYPA 5FKPA 1NEZA 2PYEB 4AHQA 5F96H 1I9RH 1QFOA 4HXAH 1B9KA 2YPKB 1QWUA 3T0ED 3ZGHA 1XLEA 1QFWI 4PMDA 2BHFA 2I7SA 4G5AA 4FD0A 3RTQA 2XWCA 3L8QA 4PB9L 4PJ9D 4JFDE 5J5RA 2EDNA 3CDFA 3QJRB 3CFBB 1GG0A 2PODA 3MQTA 5IQNA 1ZGLM 4HUMB 4GG9A 3G04A 2CA4A 1A3RH 2UYLB 4MA3B 3QW4B 1LG1A 5SWSE 3QDMD 1S5HB 4H44C 2XTJE 4GKTA 4Z78A 1RLCL 5L4IA 5IOPB 1AE6H 1VFAA 1WV7T 4JG5A 1KM6A 3UTZA 4N9BA 3JWOH 2WYTA 2GL5A 5SWSB 3QIBC 1X7QA 3J27A 3LKQB 1K85A 4WO4C 4EO5A 1OK0A 2ZUYA 4WJG3 4L8SA 2J72A 5D1XE 3RVXC 1B54A 4XAYA 2W79A 3VFGH 4UTAL 2QIIA 2OWWA 5T5NG 4S1DD 1S78C 5LN8A 5CPTA 2Y7OA 4JG1H 4JQ2A 4L9DA 5EZLB 3S1UA 4PUNA 1KB9J 1X39A 2MOVA 4IJTA 1N12A 3NPSC 2YAMA 3C09B 4DPBX 3GJFB 3N14A 1AIFA 3DX6B 2YL9A 3S42A 1WWBX 4KXZH 4CQAA 3BFQG 2J1KA 3ALGA 1IVLA 5J5DA 4HZ7A 4WUKL 1KCUH 1WFNA 2J88L 2XIIA 4EDWH 2AMGA 2QZ5A 3D85D 4PJEF 5DEFB 4FTVD 1HHIB 4OJAA 1V3LA 1KBPA 5T3XL 3ZQWA 4GINA 4K9EC 3OBKA 1KYUA 4PJXA 3PWAA 4TR9A 3LQAL 5TE4L 2HXTA 1ZS8A 3B9OA 3IJLA 2VUOA 3C60A 3CCHA 3I75B 3NIGB 4JFHD 3WIIL 1TV3A 1OAYL 1T83A 1PSCA 2EAEA 4JIPA 3THQA 4IMLB 3TN0B 3ATYA 2V67A 3WE1A 3UTTB 3U46B 1ZHKA 3ZKMC 1CK0L 2NNCA 5EN2B 3M7SA 2C1IA 5D1ZB 3TPUA 4OIIL 4J2QA 3UACA 2NY2D 5K9KB 1EANA 4X4ZA 2HVKB 3PIQA 3V5KA 4AM0Q 4APQD 1DR9A 2EUXA 2XISA 4GIYA 2ZSVA 1K9DA 2EP6A 2G2RB 3BO8A 1UEYA 3CFQA 3OZ9L 3ZO0A 4FA8A 3MRGB 1JPSL 1NU5A 4NQXB 1XO8A 2XRAL 4Y4HC 2ZDSA 4G9FA 3DI3B 2VITB 3PDOB 4W1TA 4OU1A 3USZA 2CDGA 3UYRL 1CBVL 1MFAH 3OMAB 2PP7A 4PJ8B 1R8LA 2Z0IA 3CUHA 1U36A 3GZAA 1HIMH 1N8OE 3KPSD 4H2CA 4UM8B 1BIHA 3RHWF 1ZRQA 5F7MC 4F93B 3GC3A 5EA0L 1R19A 2HN7A 4AH2A 3NZ1A 1XIWC 2YEZB 5GS1C 3QMRA 4CCEA 1LEGB 1JD7A 3HZYB 4G8IA 3ZE0B 4MJZA 1OCWH 2ACQA 3FFCB 2J8HA 2QFPA 1FCCA 1B2WL 2PFHA 3WYRA 4YR6B 1TFPA 3WDHA 1I8LC 3TEZA 3NM1A 1IT7A 2GSIA 5DN1A 3GSOB 4XNQB 1JF1A 5JXQA 5ADOL 5HQEA 1JTOA 2DZAA 3CHDA 5INCB 5BZAA 4CVZB 2BTMA 5JDSA 1N59A 4LKXB 1G7JB 5F9WB 1NAL1 1QPNA 4U1SA 3O4LB 4XNUL 4I9AA 2O6FA 4NN6B 1A7PL 3N41B 5FW7A 2AAAA 2X30A 4BD4A 3MRMB 4DF0A 2NR6D 1YSOA 1CXFA 3WJWA 3IJQA 1WAAE 1G1CA 3TYAA 4OLXH 4AQ1B 4LLDB 2UZYB 1LVEA 2IAMB 2HT3C 1CLZH 2KLRA 2YN5A 3QO0A 2I5YH 4QLWA 1S5MA 2E68A 5D8ZA 2B1AL 4Y16D 1A1MB 1SPDA 1XCQB 3NJGA 3G2GA 4NP7A 4KXCA 4WUUA 3UMNA 4QRUB 4LUTB 3RMJA 3SE3A 1FWEC 5L4MA 3IDMB 4QDMA 1SLVA 4KTEL 2E8ZA 3DJ9A 6FABL 1TVLA 1IT9H 3GS0A 2VDMB 2ZA2A 3KPTA 3GK8H 5FAAA 4O0ZA 1T5KA 4DETA 5F2GA 2UY4A 4AX6A 1NAML 4P7NA 3AVEA 4FABH 3TA3A 2N01B 4NNXB 4XPTL 3D4CA 1IBFA 1EOKA 1GR7A 2R2CA 3VRLE 2OZNA 1YMMD 5I8EB 3VRIB 1QR7A 1SZFA 2FWSA 3QDJA 3CMGA 3PXHA 3UY7A 4HPOH 1ZXQA 1FH9A 1KJ3H 1RK1A 1WRFA 4F0RA 4X6EA 4MXVE 2ADFL 1EK3A 1KIPB 3KBPA 4PCSA 3TX4A 1F76A 4JS3A 3URAA 4X8CA 3C5JB 1ZNNA 2HZGA 3NPVA 1T80A 3U2IA 2WVUA 3DOIA 4H20L 4CL7A 1RQ5A 3FB5B 3GNMH 1L6YA 1QTWA 2BNQE 4QXUH 1ANUA 4QRBA 3TSMA 5TH2B 2YD9A 1ZT7A 4CC1A 2EYTB 3T8XB 3FY1A 4LAMA 4CD6A 2R7EA 5C9RA 1E4KC 3IK2A 5IBTH 3MGTA 3BJLA 4FHJA 2H3BA 5JH2A 3KHQA 3WL9A 3NCMA 2R14A 4YXKH 2B9AA 1NGPH 1UD3A 5CSBA 5J6GA 1PLCA 3L3GA 1NWRA 3CZLA 3L6FB 4I1PA 3KVKA 5ID1B 2FAUA 2AQWA 5LXVA 1Z1WA 4M3HA 4DOHB 3M43A 3CAKA 2YXWA 3E80A 3IPBA 2B4CC 3WN5A 4NG3A 3IU4H 3S5OA 1RK0A 2Q8AH 5DJCA 2FKPA 3P2VA 2PO6C 3A13A 4O58H 4X9YA 1MNUL 5DT5A 2J7BA 3TONA 5DJ0A 3RU8L 1Y7VA 1G43A 4L1LA 4QRPE 1EHNA 5IOKA 3S8WA 3T0EA 5T3ZL 1J9YA 3SCUA 4A6GA 1YMHB 1F97A 3CUZA 1UH2A 1SJHB 4Z18A 5I24A 1JUFB 1JGUH 4X7FC 3RWGA 4E0RB 2WM1A 2X7VA 1U91A 3LS9A 2E7CA 2Q86B 2E7LA 3PZGA 2IPTL 4AY0A 3QZAA 3S2MA 5KWYC 5IHLB 1C92A 4UNKA 1U8IB 1EJOH 4AENB 3MAWA 4OT1H 2R2BA 5CP7B 3GIPA 5EU6A 1BFVL 3F4WA 4Q8NA 2CUIA 1P6BA 3DAQA 4KFOA 1S3TC 2YQBA 2NSXA 4XNDA 5IW1A 4Z1DA 4LBUA 2DLHA 2Q3AA 5DJYB 1KYAA 4XZUB 4N3TA 1ZVHA 5BRZA 2FX8L 1JNLH 1NCGA 3OAYK 3ALPA 1VYRA 1Z9SA 2VDRB 2WW5A 2EDRA 3SY0A 3WSQL 4YIQB 5I82A 3CWNA 3BLFA 1ZSDA 3IWPA 2TRYA 4RNIA 4Z2HA 1R7AA 4WOQA 4JYFA 4BF9A 4HU3A 1E7UA 4KUCF 4NT6B 2WLYA 2OG9A 2WNNA 4E9SA 2DLFH 4OUUA 5GVJA 4A7UA 4Z7OB 3N2XA 3KG5A 4ODUB 1OQXA 1WEJH 4OCXH 2Y4SA 5KJRH 3S7GA 3KLHC 3CN2A 1Z41A 1AC0A 5AZUA 5DQJB 4H9MA 2A6LA 5E4AA 4JS7A 1RUAH 1SMAA 3SBQA 3ZQ9A 3LD8C 4PCKA 4G83A 3E0VA 1NFDB 3GDLA 2GZXA 1EXUB 5LA2A 3B2VL 4U4MA 3TCSA 2WXGA 4IMEA 4G8FB 1KA9F 3OZ9H 4MDRA 1Q4WA 4IBUA 1OF6A 3F4DA 3W2JA 1MUWA 4HUWB 1UFGA 3CDCA 4LPXA 4NRZA 1YPZF 5HI3D 43C9A 1EXBA 1CD1A 1UIPA 3WJYA 2DICA 4QOKD 1F1DA 3D87B 4FTVB 4W9EC 3D0LA 2L7EA 4X6CE 1M3UA 3WLQA 3ZFHA 3SY1A 2DKSA 3MDWA 1NGZA 3QS2A 4M1CC 3MU7A 2HVNA 4P8WA 2GTZA 5C2BL 5E6IB 4DF9A 1I3VA 1RKRA 3UC2A 3D4ZA 4DO5A 4K6AA 3U57A 3MV01 4PJ5E 3CZGA 3F6JA 3O4LD 2R8SH 2X2YA 2WLMA 5CCGE 1OFBA 1NC4B 5AWNH 3BJTA 4WIWA 2GSMB 4A22A 1LDSA 4EF3A 2NXZB 1QMLA 3HOJA 3N12A 4M1RA 4AY1A 3KW7A 3O9WC 2BRRH 4R84A 1UZ4A 3WKPA 3VI4B 2JF7A 2XHNA 3PGDA 5J5EA 3VYNA 3T0CA 4AZBA 4TNVF 4IIGA 1BVZA 3W37A 3PABA 2FZ3A 3M17B 1CDBA 1QZNA 4UTHA 4R4NC 1KTNA 3QXAB 4OSUH 2IDTA 2EXYC 5BRPA 4ZTPH 4ZW6A 1EYWA 1YPFA 3GKWL 4MGGA 5GNYA 1XG4A 3F5JA 3MVTA 5DFVC 3PHQB 3D4GA 3BPCA 1TKWA 1TO5A 1SN2A 5CC5A 5ABFB 1FYHB 1M7IB 1R3LA 1U41A 3FN9A 1H3GA 3MJ7B 4WV1B 4XH2A 2Y22A 2DMKA 3E3QC 4PEEA 1ZT1B 5TFSL 5JQHC 1YN7B 3Q7JA 1LUCA 3EJYD 2EDEA 1R3IH 1OSPL 1PNDA 2YAFA 1D6VL 1RIUL 1U21A 1YEEL 2J4WL 3HMWH 4KK6C 1PX8A 4WVRA 2ROXA 2QJHA 2V17H 2XGZA 1F3TA 2XZ9A 3B1UA 1CD8A 1GZQA 2PDHA 3B5GA 1D5ZA 1R5IA 2FH8A 3QWOA 1XR8B 3IEAA 4PSRA 2WVSA 2X6CA 3WIHL 3VD2A 3AO0A 4HLJA 4F58H 1G6CA 1F11A 3PL6C 5HHMD 1QNPA 2XBZA 4DGIH 3WDIA 2EDYA 3QCUL 5HHOD 1MPAL 3OQRA 3GMLB 5KYYA 3TVMD 4GRWF 3QQ4B 1PIFA 2RFXB 3MCNA 5DVPA 2XWRA 3BD4A 5AEAA 2X70A 3FO1A 5CEYA 1PLGL 3UJTH 2DTSA 1GY2A 4Z3JA 1ZFJA 4RDWA 1EVTC 3MGOA 4X5PA 3W56A 3B8WA 2R1YA 2QVHA 1TQBC 2AJYH 3BZEB 3MUGB 5JHDA 3IGFA 3QUYD 3DV6B 1K6WA 4K37A 5I1CL 1E56A 5T5FH 2UZXB 1CURA 5KSBB 3PZUA 1H3VA 3THDA 4PMNA 3B43A 3VFCA 1W8EA 2N1TE 5F6IC 3I10A 3N3TA 4ZQMA 3SBFA 1KQYA 3TWAA 3WFCH 1CMOA 1A9EA 1AGCB 1DQQB 4GXPA 3VIFA 1P0KA 1XLDA 3CGTA 3BPNC 3DX1A 5B3NA 2JIWA 4DP8X 4U3HA 4F7CA 1D3CA 3ZJ8A 2XPZA 4HHHA 1Y65A 3HN5A 3IDXL 1U95B 3QARA 2C4FT 1RSFA 4IM4A 1Q9OA 3VA2C 1VD6A 2PE4A 2FD6L 15C8L 3MLWL 4OZ4A 4O5LL 3AMLA 1SZNA 3QULA 3CK0L 3CC5B 3W9DA 1G7HB 4LBSA 4DCQA 1E71M 4QS6A 1I7TA 1N6QH 1DANU 4JTJA 5EU9A 2GVLA 4QRQB 3N34A 4DRSA 3DXAB 3OLGA 4H0GA 1N5YH 4ZFOB 2XG4B 1B57A 2GQ9A 3V0VB 1A3QA 1SJCA 4HOMA 4QRNA 3F01A 1U93A 1J5SA 3QDME 2VOTA 5EC1A 2GVJA 3CX5K 2JLPA 4GXVL 3A6BL 2AQSA 2A6JA 4PRHB 2WJZA 2CDGB 5F7DA 1FCQA 3RUBL 4U10A 4RRPA 2BVDA 1I75A 2DQDL 1EYEA 2YPLB 1JYWA 1URLA 2FTWA 4GMTH 1BQHA 2CYGA 1QUMA 1MCOL 1U8QB 1Y0LA 5LJYH 3I6EA 3M0HA 4QXTB 1Z3RA 4LVFA 3ARBC 3S6TA 4AQAB 3HFYA 4OU3A 5IJVB 2FX8H 4X8XA 1K6QL 1NL0H 1CTMA 4LARL 1ZLSH 1PDYA 1CT8A 2NY3D 1R3HA 4PRBB 3KOZA 4QCEA 4JRYE 2ARJA 5HA7A 3R10A 2Z4QB 3AITA 1WCQA 2PDMA 3H9HB 3RNQA 3GH5A 4G9PA 3MACH 4J8RA 1WFJA 3MJ8A 5FV1L 3LB0A 1T1YA 4TNFA 5KG9B 1C93A 1P4IH 1OFEA 4FJZA 3KXFE 3L1GA 4MYPA 5C0AE 3GRBA 3S4SG 4L4PA 4Z0SA 4DP5X 3EADA 3FB6B 5F1SA 4ILDA 1RHHA 5LXGH 2D8KA 1AK5A 2WNWA 3CNKA 3DSNA 4MA3A 2AXWA 1XFCA 2VB5A 4RAVA 1HCZA 1QI4A 1UA6H 1AHWA 3B2VH 1HQRA 1KD0A 1W9PA 3O9NA 4UUJA 3LNFA 2K9FB 4Y4HB 5E2TL 1BM7A 1HX0A 1T1XB 2RBLA 3PP3K 4WGKA 5CFHA 2ZUVA 4MJ2A 1XXFC 5DJDB 3GPEA 3VH8B 3OWEA 1VKXB 3UTQB 3AQUA 1E3XA 4KKNA 8FABA 3STBA 4IDLA 1W9BM 3RU6A 1R3TA 3KBJA 1X6LA 1UC4A 1SM3L 2VRKA 2BSRB 3VKDA 3RY5A 1KCSL 2XWEA 3MCKA 1MUMA 2QCDA 3O15A 3VQMA 1OF0A 4GT7A 3QI9D 4F57L 5D9MA 4XPFH 5GJPA 2P44B 1IL1A 1R34A 3JZ7A 3QT2A 5C0CB 3W7EA 4D9QD 3R13A 1ZIBA 1R5WA 3A24A 5BPPA 4C56D 3B05A 1SNRA 3LM3A 3OJGA 2DVXA 4WHCA 4RE4A 5SWZA 4DP1X 3S47A 2JKXA 1XGUA 1VBUA 1MFVA 3V6OC 3N6HA 5AZ2L 2ICES 3WQEA 4P46D 3I6LE 2ZXQA 4AD3A 2QR0A 4FGMA 3SJVD 3HQNA 2O30A 1JVOA 5GRWA 4POCA 3MI3A 4RFOL 1FFOB 3S3DB 3EKGA 4TVDA 3OZOA 3Q3GA 4QYOA 1DN2A 5ESVB 2JJSA 3KR3L 4I89A 3H0TA 3U46A 3N2BA 3BW4A 1QSFE 1JDAA 1AACA 1YEDA 1GOMA 3FOMB 3JWNC 3WLSA 3PJUA 5C07A 3L3KB 1HH6A 1RIUH 2ODOA 4PY8I 2W95A 3LTPA 2ZOUA 3SUWA 4KX8A 1A6PA 1ZXKA 2VZUA 3IFOA 2O4QA 3KCPB 2FX9L 3RAJL 2NZIA 4JK0D 2V8ZA 3JU2A 5CJOH 2W8CA 1QEWA 3IVUA 1A80A 4M19A 4JAMA 5B1JC 2Y5QA 3G5VB 4JBSA 4CA4A 1YTKA 1LG2A 2QTEA 4PUMA 4HLZH 5DD1L 4TSCH 2ZTJA 3U9UB 5E5MA 3QCTL 2I5YL 4JX0A 4TMPA 2D69A 3LHAA 5DMGC 4GY1A 5AZ0A 4MXQD 4XOBA 4ODVH 3SDCC 3M6YA 2V82A 1I9EA 3GSOA 4XNQA 1HJBC 4UTFA 3IPWA 2A4EA 1RZPA 2VFDA 3IBOA 4F40A 1BZQK 1I0BA 4W4OA 3F5WA 2C1HA 1NM4A 4EPSA 2QDHA 1WYJA 3PBWA 3NT0A 5ISZA 1HKKA 4G3YH 4OW6A 1ACYH 2W65A 3RGVB 3ECBB 3EG9B 3MRMA 3EXSA 5GGUB 2X88A 4IRJD 1DZ0A 4CD5A 3P3BA 2Y1AA 3P93A 4C6DA 4DW2H 5IHZB 1G7JA 3KGTA 4IT1A 2R69H 3DK0A 1LYXA 1A49A 3B9NA 4TKWA 1SF3A 4UAOC 3FJ4A 3QXWA 3VKCA 1GOKA 4NUQA 3LTSA 2Z31B 2AJUH 1NDGA 3WN6A 3Q1SL 3TAOA 2AP2A 5IG7B 1NCIA 3CEUA 5CC3A 4F2ME 2K8MA 3BAJA 2C16A 3CPLB 3TN0C 3RN6A 4DF2A 1H3TA 5L0QB 2P50A 4IX2A 5REQA 2Q8LA 5IMKB 3HN3A 1JRHL 1OHZA 3TCXA 5TPWL 3MV8B 4OCNC 1BX2A 5IF0B 2BXVA 4CCDA 3VWKD 3P9MA 4JO1H 3R0DA 2VXUL 4YXKL 1JRCA 1KM3A 4N0YL 3W1NA 3SE4C 5DA0B 3DJRA 2JXMB 2O4EA 4WI7A 3HG1B 1LE5B 1ZY9A 3D09A 2JFCA 1MW3A 2EADA 2VO8A 3IGAB 4X99A 4RRPG 2RKXA 3QE5A 3SIZA 1IJ9A 4KI5F 4EF9A 3NCYS 1E4XL 3C5JA 5D4JA 3S34H 2Y7DA 1OAXL 2ICWJ 3K4ZA 3L13A 3TBTA 4ELMF 2CKRA 3EYPA 4JHUA 1MY7A 4XUGA 2VDIA 3TZVB 3UP8A 3IN0A 1PTGA 1FZJB 1A6TB 2XKNB 1Y0EA 2BCKB 4JFEE 2YPIA 4LBEB 1LRTA 1MCOH 3R4IA 3MXWL 3TKFA 3BZFB 5T3ZH 3QC3A 3FU5A 3BOLA 2VIRB 4R5TA 2L0DA 5CILH 1D8CA 1IIHA 4E4UA 4ZXBB 3M45A 2EEDA 1GVYA 4GG6F 2PWUA 1FZOA 1I7RB 4OAWA 1P9MC 2OEJA 1C8YA 1B31A 4YYCA 1MRQA 3QOKA 3ABSA 1XYAA 4X2RA 3BUTA 5C07E 3S4SA 3K74B 3HUJE 1OD9A 3RA7L 1OAJA 3GFUA 4UTIA 1EFQA 3W72A 1IAKA 2UWEF 5CBIA 4JG1L 1RA0A 2CHRA 1T2JA 2FBRA 1QQDB 4HUCA 4PRIA 1VQTA 1LP9F 4U7MA 4PVNA 2OPCA 1NIBA 3WBEA 2Y36L 2OL3L 2XPYA 3D34A 1BJ1J 3QIUD 1HI6B 5FSDC 5EBWA 1PJ9A 3FF7A 5ICUA 2MPAL 1S5NA 3BGFC 4P23D 4U1NA 1U8PA 2J88H 5CD5D 3ZE1B 4GS7B 3VOFA 2X89D 4BDVA 2I24N 4IHOB 4PJBB 3VGFA 2G4FA 3CBWA 1A2YA 4L3EA 2W0FB 4BQCA 1T04B 2J5LB 4NZ3A 1EF3A 1JXDA 4P2YA 5D8JL 1NF0A 2G96A 1POKA 5B7YA 2P0OA 4JR9H 4EZMA 2XU2A 1X1NA 3KOWA 3EH2A 1DJXA 3ZJ6A 1IC7H 3BRGC 1FUYA 5DF0A 4ERGA 4FSAA 1DLFH 3CAFA 4FXTA 4DESA 3LHWA 5LQBH 1G5GA 3OPZH 4IBWA 2GUYA 2XZCH 1R0MA 1X7QB 3LKQA 1TVBB 2CUHA 5F44A 3TXZA 1ZEAH 2B15A 1C5DB 3QNXA 4HWBH 5C0BE 2HMCA 3VQLA 3STCA 3KYOB 2DI9A 4PGZA 5E6RB 4A6YB 3C8FA 3FSUA 3JTSA 4Y5VB 1FSKB 1F3JA 2NUTB 2E09A 3ZDYF 4LLVB 3PZNA 3QGKC 1MXDA 3QVQA 3S48A 3L3IB 5KSAD 1IKNC 5CHNB 1KBGH 5DMIH 5IHUL 4HJGB 4Q32A 2BSED 4HIXL 3DXAD 4CNUA 4PJFB 1FNEB 3ME0B 5JPMB 4TU1A 4JIEA 1D5MB 3NEVA 3AM8A 2CR6A 4OZGB 5F9OH 3KBSA 3UZVA 5J3HD 3AZUA 4OZ4B 4Z7QF 1ONRA 2GTZB 5F7UA 4HN8A 3S3GA 5ALCH 4APQA 1VGAA 4NNBA 3RPIB 1XR2A 3TUUA 1Z9NA 3D0LB 5A2LH 5E08H 2PTXA 5I0DA 2X16A 4H2HA 3BPOB 5AYBA 2I25N 5DO2C 2XWJB 3CZ8A 3P80A 4KBXA 4MNJA 3QUYC 3TASA 1I31A 5CWSB 1NQBA 1F4YH 2BJMH 4GG6B 1UR2A 3LDVA 5DO8A 4XXWA 2WWOA 1JGVH 3PUCA 3C5ZB 5KJ7E 5BUAA 2EXSA 1EHLH 5IIEB 2H3KA 1JPTH 3KOFA 3V0WH 2A1WH 3SPJA 1QPKA 4NKMB 3ABLB 2ICCA 1ROCA 3L7RA 1XYZA 3FQ2A 2J66A 5F21B 3O3BB 2X4QA 1RUKH 4PC8A 4R85A 3SQBA 5D2LB 3X1BA 2W9EL 3MV9A 3B8YA 1MJJB 1CIUA 5MI0C 2YCLB 1J0JA 1D2KA 3WXVL 4AF0A 3ZK0A 2ZC1A 5BNXD 4KXAA 4KWOA 1MHEA 4R7VA 4OZFG 2W0UA 1JMXA 4PGDB 1FAIH 3FFCE 4H9ZA 2X53A 3DU0A 2AJYL 3IGUA 3KLQA 3OR6B 4JQVC 5KW9H 5DD0H 2IMNA 5BRZE 1AD1A 1B4RA 1VERA 2CXKA 2LU4A 2ZF8A 3JVFC 5H37H 1US2A 1CXKA 2NY5C 3VA8A 1XR8A 3QUXD 5AHEA 4O0QA 1T0NA 2J6EA 4U1KA 1IAOB 4YCOA 1IGYB 3OJVC 4RR4A 5L88L 3BE1H 3CHVA 4IQJA 3WJJC 2X89A 5CS7A 5DMKB 4ONGL 2IAAC 3SCMA 2DUAA 2JF6A 4OT7A 4DVRH 5A3ID 2QVKA 3A5FA 5C0ND 1Z7JA 4L23A 1B0GA 1WD9A 2H9GA 1DFXA 2J7LA 5E6IC 1VJZA 4XN8A 4MNLA 4IOSD 4LAJH 3WF0A 3WEZA 3EYSH 1RZJC 4QF1A 3IS1X 4MLJA 4ZTXA 4PGEA 3BJ91 4NC2B 2I1OA 1UD8A 1UASA 3FA4A 1A47A 2EVJA 4JGDA 4JZNA 3W82A 4PB4A 1AS7A 2X1PA 3BPLB 4H1LB 4X80L 2GIYA 2ZKWA 2ZOWA 4GEIA 4ZD3H 1DJQA 1CC3A 3GXDA 4WHYH 4PRNB 5LZLA 2FJGB 2VXSL 4R3SA 5AW8B 5HNUA 1NJ9B 1YMMB 4ONFL 1U3ZA 1W3LA 1KZYA 1PY9A 2XG5A 3FB8A 3HNVH 4PG2A 4RMWA 5J11C 3MWCA 4UTKA 4H8WH 1SZEA 3TH4T 2FQGA 5ANHA 4A3UA 5E1IA 1USQA 4KMTH 1SBSH 1K4CA 3LRLA 4GSDH 4ZXBD 2OK0L 3LV6A 1UWAA 2VDQL 3IMWA 1XBYA 4Q8OA 1B90A 4N6EA 2LABA 3K72B 2ZCHL 3K2GA 1EAPA 1H15B 3VFVA 1XAUA 3RZCD 4PBEA 4YHOL 4LARH 1TTFA 4LGPB 2LE9A 1C8XA 1RXLA 1BOYA 1IEXA 1WP6A 2G2RA 3W6MA 4PJDE 5FEBA 1OE2A 4UT9A 3NIFF 1EB3A 3VGBA 4XVSH 5DS8A 1XD0A 1IEQA 2VUNA 1ZE3C 3IFNL 5C07B 4DTGH 5ACZB 2GK0B 2W27A 4AGNA 2Q8ZA 4IIFA 1A5KC 4ZYKA 3MI2A 4R7DA 4X83A 3HQOA 4MCNA 1VADA 3KYNB 1QK0A 4JRLA 2QGHA 2FNBA 1H50A 3TIMA 1QRNB 5C3LD 5GS0L 5FM5M 1F3RB 4N1HB 5K7JA 5M95B 4GQRA 4RMUA 3M0XA 3V5FA 3FSZA 2YZ8A 3BSZH 3HS0B 5GJTL 2A6NA 1IZKA 4L4VB 4OLYH 1CT8B 3QYCA 4Q4QA 3PFQA 3FXIC 1RJYA 3FO0H 3M0JA 4NO0B 2E27H 3TK7A 5BZWB 5IVXF 4GRMB 1UC6A 4AGMA 3PBVA 4AIUA 1MI5B 5IR1B 1OKEA 1LEGA 2HK0A 2XI9A 5DMLA 1GVEA 2W63A 1IF2A 4HX1B 2F0CA 3HA1A 4DVBB 1B3VA 2J7EA 4H7CA 5B1BB 3AHZA 3C0JA 1D5BB 3RJXA 1NCCH 4F27A 4KCUA 2YUZA 5KYUA 4ADGA 3PB2A 5CCHE 4HS8L 1FFRA 1LO0L 4L4JA 3RKPA 2AJVL 1C9WA 4XV0A 4CEUC 1ECQA 1M1SA 2ITEA 5KBMA 1UZ6E 4EEEA 1V02A 1RHHB 2W59A 1YE6A 5F7WC 4KS0A 4R7JA 4RW5A 4BFJA 4LLQA 4J1OA 3U4FA 3KWXA 3LXCA 2JBMA 5GISH 3JWOC 3HQ1A 2YWYA 3IV3A 5FF2A 5F9OL 2OQLA 3CHRA 3U4AA 4CMHC 3CPLA 4PS4H 5FJIA 1Y1DA 5ALCL 4OQTL 2XKSA 3ARVA 3FMGL 3B8SA 4HMCA 4PJDB 3BQVA 4LVHB 2TSAA 2BIPA 2LVEA 3B3IB 3VFSA 5D7KD 1YTEA 4XE0A 5HJLA 4PODA 3EBIA 5IB1A 4JO4L 5FGBC 3EMCA 1IL1B 5C0CA 4FJ6A 5FA4A 2Y62A 4MDJA 1AH0A 2A1WL 4P0DA 3CV1A 4O50A 1OT4A 2NY5L 2VP8A 1R33A 3OKDB 1RK1B 4MMXC 2VDLH 3VC5A 1XWVA 3LQZB 1GQKA 4HHWA 2BPBA 4PV1C 4IBZA 4LSDA 2KZ1B 4QXVA 3WIHH 2NOYA 3D2UB 4JHWH 2DQIL 4M1DL 4A6YH 2XTSA 5C8JB 1LQAA 2IPWA 2PGFA 2H45A 3HU7A 2A3HA 3PNZA 4KEZA 3RRAA 4ERIA 5CSSA 4GAAA 4CD4A 5ESVA 3PPEA 4F7EA 4HK7A 3ITTA 4HCRH 2GB2A 4I6KA 4D8LA 3LPGA 3DGCR 4OM1L 3UXKA 1PLGH 5DMGD 4GABA 3QI9B 1T6WA 4F0SA 3I9PA 3G5YB 4H1LH 1XSOA 2J7DA 1HJSA 1B3OA 3HGOA 4DZHA 2CBJA 2OL3A 2O93L 4MB1A 4AC1X 3RLSA 5D1ZC 3WFCL 4ROPA 4HK0A 2QKIC 1AKJD 1J86A 4G2AA 2HFEB 1TSRA 1NP0A 2Z7GA 4DOHE 1DJNA 5TDNA 3W73A 2YR1A 2V5JA 3HPFA 2ENJA 3MP4A 3H1ZA 1T41A 3ESOA 3FU8A 2XGBA 5I3IA 1JS4A 4BDVB 2DMBA 1TSHA 5ABFA 3NSYA 3RGBA 4U1JA 3W2UA 3SKOB 1OD7A 3OSKA 5C08A 4ZB2A 1DQMH 1IZCA 3QS3A 4MKTA 2Q5BA 2DN7A 4XVTH 2VQ1B 4IRZH 4E0RA 2UWFA 4P2OD 3CFCL 4CNIA 1AZ1A 3EB4A 3WQDA 4QHMA 2IV9A 9XIMA 2NX5A 4P2OB 4JY8A 5CJ5A 4XO4A 4OB5L 2HE8A 2H32H 5AOMA 3O2DH 4KEMA 3ZMEA 1I4NA 4QCIA 3P3RA 4CEXC 2D7TH 2G97A 4XAPA 4ODSH 4XMKH 4FIQA 4HUXA 3QJXA 4ODUA 5B21A 3APTA 2DBLL 5D1XB 5KZCD 2DIBA 3MXWH 4C7GA 4LNRA 3IJHB 4JBRA 2EJAA 1SJEB 2BOLA 3C2AH 6ENLA 1HDMB 1E55A 4RZKA 2HT2D 3B03A 5FUCE 1JDDA 1AGEA 4M00A 3VB9A 2K3HA 1EUNA 2A6IB 1GS8A 4IMDA 3CHFA 4E9TA 3LZLA 1BVLB 2EE6A 3OF6A 2ZOLA 3BGFB 4HIPA 4LHQB 1FG2A 3GZQA 3OQ3B 2IOMA 4G9DB 3N15A 5A6BA 2C9PA 4G7YL 3WCZA 2V33A 3A6CH 4JAWA 5FYLD 3U1SH 4KTGA 1VFSA 4B4HA 1N55A 3UAFA 1NDVA 4JTHA 1NCNA 1FO0H 1NBYA 3NCWA 1P4UA 5CAYB 5L6UA 2X38A 1O5DT 1AQKH 2YZ1A 3V4VB 3MUCA 4UTUA 1JHTB 5FOBA 1NOUA 2DUXA 3VI3E 1JWMB 3AIBA 4JDZB 4LASL 1D5XA 1QI2A 4OQVA 4YNGA 1V05A 3WO4B 5ABDE 5HWMA 5KTLA 1WK0A 4MX7A 2VVNA 3SD2A 2J47A 1URIA 4HPHA 3W7LA 3HI1A 1I7TB 4KNQA 3G3MA 1WZAA 3OX8B 2G30A 4L56A 4KI5C 3A64A 2XJKA 4NHVA 1P7QD 1KLUA 1ORSA 4JR9L 4UTLA 3S37X 4IMCA 1WT5C 1IC7L 3BPWA 1Y5WA 4YS1A 3EB2A 3DXAE 3QB7C 5AOUA 5EC1B 4TVPE 3CLFH 1UG6A 1WBYB 3ULAB 2IKGA 3GMRA 1XTLA 2XH0A 4HS6B 1S7QB 4Y8FA 1KEML 3F7VA 5LIWX 1A6UL 2E9MA 1N10A 1W1YA 4MJ6A 1TKWB 3Q6GH 2WMJA 4EUPB 4P4RB 2M1KA 5I16A 3AUVA 4IMAA 3R94A 1FH5H 2H2SD 5BU6A 2G3XA 3E9UA 5DK3A 1SGJA 1L3NA 3MLTB 4WI4A 2F2KA 2ZZ7A 3EAKA 4MD5B 3DFTA 1JJUA 1U8PB 4GJ1A 5J04A 3KLAA 4JY5H 3WQFA 4C83B 1MJUL 3BIBX 3SDDD 5L0QC 3NA8A 1JDCA 2Z4QA 4B16A 1A6ZA 3SGJA 1E90A 4YLWA 5KS9E 4IPPA 4E9XA 1O1ZA 3L3OB 2BERA 4HEMA 1O5XA 2HKHL 4NOBA 4BS0A 5A69A 4KWWA 1U1UA 2WCSA 4PY8J 2X42A 1HYSC 4JGMA 1D3HA 3VUAA 3DENA 4DEUA 4WNSA 1OCJA 1TZ8A 3F3HA 1NWOA 2J44A 3SOBH 1GHRA 4MA7H 2DQHL 1SMOA 4ABQA 3WKZA 2C9UA 3LXUX 3WELA 1BBDH 2GSJA 3WD3A 4PH6A 4D6GA 2JKAA 4O2FB 3U2JA 1HHHB 2IUZA 4KKQA 4OV5A 2FJGA 2R83A 1A8JH 1S7RA 3T6WA 1R3SA 3L3IA 1S2TA 3TURA 1FL3A 5G4NA 2NNRA 1EHLL 1HCVA 4I5XA 2XG5B 4XP5H 1JYVA 3PWPB 5I0WA 3R06A 4KKAD 1NBVH 1EX0A 3QO1B 2X1OA 5ITFA 3RCNA 5IB3A 3O4LA 3VI2A 3E02A 2CPCA 5GGVH 3U0PB 4G7EB 3ML8A 3E96A 1KGXA 2BP0B 1M7XA 4D9RD 5EEXA 5C07D 2UZ9A 1CLVA 4YWSA 1LTXA 4OLVL 3CIVA 3KEHA 3CH8A 2PGWA 3LZ5A 1CFNB 3VWJD 5CSZB 5D93C 4R6UA 5T9CE 4Z2GA 3IMUA 5IQ7H 5J12B 2OJEA 4NZRL 4MB5A 3UTTA 4AWEA 3I50H 3V75A 4EN3C 1CL7H 2L3BA 4IK6A 4CSTA 4DCQB 3H6AA 3DEQA 1KBJA 4IJRA 2GTWA 4ZMVA 1DQDL 1HILA 3QFDB 4OF5A 2FL5B 1FXPA 2EC9U 3RDTA 3JV6A 4UQDA 2F19H 3QXDA 2P0IA 3IDUA 3W27A 3H21A 1AY1H 4WKXA 4PAZA 3QORD 2JWYA 1L6ZA 2R9HD 3O6CA 4O2EB 3ALWA 3FONB 3KOYA 2FWLB 2B31A 3LTYA 4X6DF 4YHKL 1SHXA 3LS5L 4LMQI 4NC1C 1A7RL 4R5EA 4F7MA 5A94A 3HGJA 4UT7H 3ZTEA 3STZA 3O8AA 1JV2A 4ZFQA 5LAXB 5JIWA 4AIBA 2G75B 3HZMA 3VCCA 4P2QA 3NIFE 1MREL 3SRKA 3BOVA 1UM4H 3KRZA 2VR9A 4JPWH 4B3KA 3G6AA 1DSYA 3NP4A 1GRWA 3NJ3A 1NELA 1GKEA 2J8UA 1SGKA 2N7SA 4RE2A 3FH8A 5DD5H 5KYUB 1GOGA 3UIZA 1Q0YH 3CWGA 3EYQD 3QQDB 4M6AA 2WUCL 5JDSB 1MEIA 3VMOA 3NO1A 3ZRCC 4DKEH 3OGRA 3T09A 1K7EA 1SQ2N 4YN5A 1FYTB 3HE6D 3REVB 1RUPL 4N0CC 2Y7FA 1I2QA 3NQ8A 3FHAA 3UWYA 4UTWA 1H7WA 3UVAA 2WSYA 3SPVB 3GYRA 4HF5L 4EIZC 1KC5L 5CMAB 1MN4A 3G6MA 5EULV 4FULA 5TDOA 1LP9A 4Q9BA 1C29A 1G4EA 4TF4A 1P0NA 1HS6A 4D6HA