1XH2A

Structure of the n298s variant of human pancreatic alpha-amylase complexed with chloride and acarbose
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
total genus 175
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xh2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xh2A01
3CUIA 2EBNA 5AC5A 2X2HA 2JF7A 1K9FA 4AZCA 1XHGA 4UFMA 3THCA 4V2XA 1HP4A 3AXHA 2XIIA 5BXTA 2OLHA 2XFYA 3LRMA 1HP5A 1K6AA 3ARQA 1J18A 1GVIA 2WKGA 1V0KA 3CV5A 2BY3A 4AIOA 3WQ6A 3DX0A 3AMLA 1W2PA 3VGHA 4PBGA 3ZQ9A 1B0IA 3KE0A 1WKYA 4PTMA 3WL0A 1XH2A 2XYLA 2D1ZA 4NZJA 3WN6A 1B3XA 4EKJA 1K9TA 3ARXA 1W9UA 3PTQA 3SCVA 1I1XA 3WQ4A 1GHRA 4AW7A 3EJUA 1OD8A 5E9AA 1KQZA 1RD6A 1QBAA 4B3LA 3WD4A 3K8MA 2CYGA 1UA3A 5ECUA 2G41A 1MYRA 2WZIA 1JZ7A 1XD0A 4DWSC 4X0NA 4P7QA 4D6JA 4GO9A 3K46A 4XV0A 3MV11 4W93A 1H0GA 3VO0A 1GOOA 2PB1A 3W82A 3WF2A 3W0KA 4LGXA 3TP4A 3N1AA 4H8UA 5EFDA 4AD3A 3LPGA 5A3HA 4AZ5A 1UWTA 1ESWA 4GI8A 4AD1A 2A3HA 3UR8A 3WF1A 1M7XA 2JEPA 4D6HA 3RILA 4YHEA 2YJQA 4BZYA 2VX5A 1HJQA 1L0PA 3IJ9A 2WHJA 3WNLA 3D4YA 3RO8A 3CC1A 5A69A 1GQIA 2J8GA 3SCWA 3WIJA 2BY0A 1LG1A 1MQQA 2J7DA 3AFBA 2XFFA 5D9PA 2BHZA 3ARYA 1W91A 1UR0A 2WMIA 5DEZA 3OGSA 3WUBA 1VRXA 3ARTA 4PMUA 3UR7A 4JHZA 3WMSA 1A47A 1KQYA 1B1YA 1QOXA 3K4AA 1OIFA 2WWDA 1EOMA 1GHSA 4EANA 1TQSA 2OW7A 1CBGA 1HNYA 4CCEA 3MUY1 4UQCA 4GO8A 3ARWA 3NUKA 1CXLA 3L4XA 1DWAM 1WCGA 3TONA 5E0FA 2CCRA 4UFKA 1ZBKA 4P8VA 2ZUMA 5M5DA 1QW9A 1CLXA 1LWJA 4AEFA 1E56A 1CZ1A 2EJ1A 1Q6FA 4DO6A 1UWSA 3MMWA 4P8UA 2ZOXA 6CGTA 5A8NA 1E3ZA 5A6AA 4P7NA 1UH4A 2DSWA 1GW1A 2VX6A 4D6GA 5I24A 4URIA 1VFUA 5HBFA 1JI2A 3M7SA 5JIWA 3WEMA 3AHYA 1HL8A 3PN8A 2JFEX 3VIPA 2VUYA 3WD1A 4X0VA 1TFVA 4WK9A 2V3DA 1GPFA 5CJ5A 2DPEA 3CLWA 5D9NA 1E43A 3EBVA 1CXFA 1HL9A 4W88A 1EA9C 3S5YA 1ZJBA 7TAAA 3AHTA 4YHGA 3RDKA 2FGZA 1FP8A 2NSXA 2DSKA 3DX3A 3L4ZA 2XN2A 3VNZA 3OLDA 4D1IA 1B9ZA 5BXRA 4PUDA 1WDSA 5E09A 3APGA 3AZRA 1OINA 2BY2A 4RE4A 3MU7A 1GOWA 3U5YA 4M1RA 4WIWA 4YPJA 5CPTA 1NARA 4TXEA 2PWGA 3VUPA 2ZUVA 5CPQA 4ATWA 2RGMA 3OBAA 1E4MM 2WKLA 3GXDA 4FLQA 4CGTA 1BYAA 1NOWA 3GXPA 4AZGA 2YL6A 3AIRA 4UFHA 4UQAA 4BQ4A 2BXYA 3ZO9A 4AZ7A 3BAXA 4P7OA 3VIJA 3GXTA 4Z2GA 4Z2IA 2QHAA 2JF6A 4JFUA 4W7UA 1HWWA 3SCTA 4NZFA 2Z1KA 5A6KA 1PBGA 4QLJA 1V0NA 3IANA 3PTMA 4PCTA 1MQPA 1E0VA 3KLKA 4AZ6A 2EABA 4CU8A 2PI6A 2W62A 1B30A 3AIVA 4WKFA 3CHDA 3AZTA 1UZ4A 4MTVA 5CLWA 4U3AA 1HN1A 1BYDA 2WVVB 2WWCA 3RMEA 2VX4A 2CHNA 1EXPA 3OZOA 3WNOA 1HVQA 2XM1A 2VCBA 2O9TA 2JEQA 4DUWA 2UY3A 3D51A 3UG4A 1WO2A 1CYGA 2E0PA 2ALWA 2XN0A 1GORA 5I78A 2YL8A 2F1BA 1HKJA 4AZCB 5A8OA 1W3KA 2WMGA 2X0HA 5A2AA 4DO4A 4GKLA 4EK7A 3BUQA 3S5ZA 3O6AA 3HN3A 1Q6GA 2D3NA 3AHVA 1H3GA 1B2YA 3SIMA 2X0YA 2WAGA 2YFNA 4BF7A 3VX1A 1PEZA 4LYRA 2D0FA 3WUFA 4HTYA 1VEOA 2YDSA 1XV8A 3BSHA 2J74A 4TX8A 2VO5A 4UOQA 3T0BA 1J10A 1HXJA 1QNRA 1V02A 3NDYA 3A3HA 3AS2A 1ODZA 1JXKA 3CMGA 1MW0A 5GQBA 2DH2A 1NWRA 3GNOA 4HPGA 2IXVA 4A3HA 3LMYA 2WCSA 2C7FA 1V08A 4MNLA 3GBDA 4OJYA 2DT3A 3VGEA 3WH7A 1V6WA 1RPKA 5CGMA 3RCNA 1OGBA 1UZ1A 1EQCA 3AHXA 1ZBWA 2C8NA 1OCQA 5M03A 4E8DA 1G01A 3VILA 5E70A 2CPUA 1SFSA 3WH9A 3VMPA 2G3NA 4M82A 1TQUA 2DH3A 4U5IA 5KZ6A 2FHBA 3WNKA 1UR2A 3BUPA 3AIUA 1LQ0A 5HPOA 5CQ1A 3WD2A 2ZX7A 2ZUWA 1CENA 1ZS2A 1E0XA 3RM8A 3AMKA 1GVYA 3WDPP 1R47A 3SUWA 4M56A 4QLLA 1CGYA 3BLPX 1V3IA 3L2MA 3CHFA 1KWKA 1CEOA 2FGLA 2IGTA 4OGZA 1ZBVA 2WCGA 1BPLB 1JZ4A 2JIEA 1QNOA 3ZR5A 2E40A 3CZSA 1UKPA 4NXKA 2AOSA 1QHZA 2GVYA 1J0JA 1EDQA 2W4XA 1JNDA 2J79A 2WMIB 3WDRA 3HG5A 1IV8A 1V3KA 3D52A 1QNSA 3MUZ1 1KGXA 1QNPA 3MUAA 3A22A 3BH4A 1YQ2A 4MADA 3WMCA 3A6OA 4AIUA 3GYCA 3F5LA 3I3DA 2EACA 3AROA 4PUEA 5IHRA 4IISA 1JGIA 2EADA 3BGAA 2CBVA 2BV9A 2WW5A 4MNMA 3WENA 3W6LA 4TVDA 1RP8A 2Q8XA 2ZIDA 1W9BM 1NP0A 5FD0A 1EHAA 3W25A 1LF1A 3WQ5A 1HT6A 1UUQA 3VSUA 2X09A 1J0KA 3AI0A 4IPLA 1DWGM 4AMCA 4D1JA 3AMCA 4M81A 1V03A 3N18A 2YDRA 4KH2A 2YBTA 3PZOA 4FNTA 3PZNA 4PMVA 4P7RA 2ZX6A 3FW6A 1K9EA 2E9LA 2D3LA 4NI3A 2G3JA 4UFLA 3SCRA 3VIHA 4HZ8A 5FCZA 3BC9A 4JAWA 1T0OA 4HA3A 2EPKX 5M17A 1GOQA 2VURA 1HVXA 5F7UA 1KBKA 1TR1A 4CD8A 1WZLA 2PWDA 1UKSA 2WSPA 4D6IA 5C8BB 3ZM8A 2RGLA 2XFRA 1E3XA 1KTCA 1R8LA 5DF0A 3ALFA 4E4PA 2WZEA 3AJ7A 3DYPA 4NXSA 5LA2A 4HA4A 4PSRA 3EDDA 4UZSA 2F7PA 3SUTA 3VKKA 1UD4A 3WD0A 2GSJA 2W67A 4WLCA 1MFVA 3VDBA 1UQYA 2VZVA 4JZ5A 3CZ8A 3VD3A 3U7BA 1B31A 4YN5A 2VNCA 4S3JA 2IUZA 2ZUNA 2WHLA 4P8WA 1W9PA 1GJUA 1OB0A 2F18A 1JFXA 3WQ8A 4JHOA 4ZE5A 1O7AA 2O9PA 5I77A 2F2HA 3GXIA 3L4VA 2WSKA 2DT0A 1WNOA 4PMOA 3UG3A 4HMDA 1C3FA 1PZ2A 1ISVA 2BS9A 2DT1A 4AZBA 3RIKA 5FIPA 3U5UA 2YA2A 1UD3A 4JFTA 1E6QM 1LL4A 1E6RA 2XVKA 3AS1A 4WKHA 2A3CA 1UOKA 4J3SA 1XGZA 1TCMA 2YA1A 3N04A 3LRLA 3VSVA 3DC0A 1M04A 4PMXA 4UOJA 4GQQA 2W92A 1UD6A 4J28A 2J77A 1JDCA 3WBEA 4LX4A 3OB8A 1W32A 1QX1A 2W91A 1PS3A 4XZBA 2A3BA 2X2YA 2IXUA 2J47A 1KBBA 4CD7A 1WP6A 3BAWA 1FHDA 3VDHA 4K68A 5HNNA 1MXGA 5IDIA 1W2VA 5C70A 1Z32X 5E6ZA 3QOKA 2V3FA 2VTFA 1EIBA 2XGIA 1H11A 1HF6A 3VSTA 4PMDA 2OWCA 3HG2A 5BXSA 3L4YA 3VDAA 3U57A 4ATDA 3IAQA 2WLZA 5BROA 1JFHA 2WMFA 2Y2WA 4MJ2A 4KGLA 4UZUA 8A3HA 4JKLA 3CBWA 1NOFA 4D6DA 3N13A 3SUSA 3VGFA 4HU0A 5HPCA 5BRQA 2WYSA 2Y4SA 3IK2A 1K9DA 3AMDA 2CBUA 3F5JA 2WM0A 2G3IA 1UR8A 1GUVA 3EJQA 3MKKA 3PZ9A 2EO7A 1VJSA 3ZSTA 5IFPA 2XG9A 3WQVA 1UR9A 1IT0A 2CIPA 4H41A 3LPPA 2XGBA 3HJEA 1JD9A 1WE5A 4GZEA 1S46A 3AS0A 5BXPA 3EJRA 4CD5A 2VJXA 2OWXA 1HKIA 1KCLA 2XHYA 2PWEA 4QAWA 3VM5A 1NOUA 2UWFA 4WSKA 1VFFA 3AIWA 5EB8A 1HIZA 2DGAA 2GJPA 3T2PA 1JYWA 1GZJA 2XVNA 1NQ6A 3GNPA 4HU8A 1B90A 1X1NA 1E71M 2YIHA 1JZ8A 4UQBA 4MAVA 4QP0A 2QPSA 2WANA 5EFFA 4Y7EA 1L8NA 2J7GA 3CHEA 2OYKA 3IJ7A 2WPGA 1J0YA 4GINA 4TTUA 1GOMA 4JCMA 5I3DA 3BUDA 3B9AA 2NW0A 3VIIA 2ZWYA 3MANA 3G6MA 5HXMA 1DP0A 1M53A 1CGUA 1EDTA 2WC4A 1AMYA 4B9YA 1EGZA 4B9ZA 3ARSA 4CCDA 4KWUA 1JYNA 4XUYA 1KXTA 3MMDA 3SCQA 1JYVA 4JKMA 4BA0A 5E6YA 1BLIA 1QHOA 1QI2A 1VBUA 4W8LA 1M03A 2VVSA 3VGDA 3LXAA 5E0CA 3MS8A 5CG0A 1CWYA 5DO8A 1GQLA 4HMEA 2FE0A 2DSUA 3W6MA 2CBIA 1UH2A 4U2ZA 2XVPA 1U33A 1E4LA 4CN1A 1C91A 1C7SA 1V3LA 5AYIA 3EDKA 1GQJA 5A6SA 4D72A 3S6TA 1WDPA 3EDEA 5CSUA 2ZE0A 4J27A 4RE2A 1E72M 1RP9A 2CBJA 4Z2KA 4MNJA 4Z2LA 3ZIZA 3GXFA 5JBEA 1C90A 3GZAA 1BQCA 4D71A 3W81A 2PWFA 3DDFA 1BFNA 3RPMA 3BSGA 4J3VA 1H1NA 1HKKA 2EPOA 2BVYA 1UR4A 5I2UA 5JIPA 1CXHA 3WUEA 1XSIA 2G8ZA 2E4TA 4HZ6A 1R86A 1BF2A 3EMQA 4GI6A 4J3UA 1FH7A 4FLRA 2F7RA 1B3WA 3KLLA 2A3AA 3GDBA 3NSNA 2YKKA 1KTBA 3VMOA 3HZ3A 2O9OA 1VBRA 5AYBA 4UFJA 1UD2A 4LQ1A 2F7QA 1E70M 4QFUA 3DECA 3A4XA 1VF8A 3MMUA 1V0MA 1WDQA 3ZT5A 1JF5A 4CKQA 1E55A 2ZXQA 2QV4A 2F61A 2GDVA 2XM2A 3W26A 3BUBA 1SMAA 1H5VA 2DT2A 5A8QA 5GPRA 3VX0A 5A6BA 2J75A 2FH6A 4D6FA 3DX4A 3W24A 1EH9A 4CD6A 2XPKA 1PPIA 1XCWA 2X2IA 4AZIA 3PZTA 4F9DA 2W5FA 2D2OA 2AAAA 5CZKA 5JBDA 1DTUA 5I79A 1CGXA 2GJXB 1F4AA 4CUCA 3ZOAA 3PHAA 1LL7A 3WFLA 1AVAA 5I5RA 2VCCA 2YOCA 4P7LA 4DO5A 2ZICA 1TZ7A 5A8PA 1BG9A 4FF5A 1W1YA 4M29A 4WF7A 4H8HA 1TG7A 3H55A 4QCFA 5E1QA 4WKAA 3A4AA 1H4PA 1UD5A 1J9YA 7A3HA 3T0AA 1OT2A 1HJUA 3ZJKA 1W9DM 1I75A 1E6NA 4M24A 1HJXA 4JFSA 5A94A 3II1A 3L4UA 4W7VA 1JIBA 3AXXA 1FFQA 2HISA 3W53A 1Q6EA 1VFMA 3VPLA 3KL5A 1H09A 1CECA 5AC4A 3CUJA 1J11A 1ISXA 4OIFA 4C7DA 3DX2A 2EPLX 3UERA 4NF7A 2X2JA 1TA3B 4H7VA 2BNJA 3WBAA 2OSXA 1A3HA 1UKQA 1SR0A 3CMJA 4UR9A 4E8CA 1R85A 3GH4A 2WMKA 4UFIA 1O7DC 1KGWA 2VZUA 2VZTA 4OZOA 3VIGA 3GTNA 1VAHA 1JD7A 3CUGA 2HVMA 4DM1A 4ZXOA 4F9JA 3QHOA 1UA7A 3SURA 5JUVA 4PMYA 4NX0A 1KCKA 1PX8A 2VI0A 1TVNA 2E8YA 5D8WA 3NSMA 5DMYA 1JZ6A 4XB3A 4DUVA 1H0IA 2CXGA 2YL9A 3L4WA 3ZSSA 2O9RA 1Q6CA 4IM4A 2EPMX 2O92A 3GXNA 4LPCA 5ABGA 3CZGA 2Y5EA 1NM9A 1XD1A 1BAGA 1LWHA 2QMJA 3FAXA 3RJXA 2CERA 4PMRA 4TVUA 1UH3A 2JE8A 1WZKA 1OD0A 2Y24A 1ITXA 3SCPA 3ARRA 3WY1A 3TTSA 3AISA 1Q4NX 1PX4A 1LL6A 1GCYA 2J7BA 3AQUA 3I3BA 1E40A 2A3EA 2DQXA 2XUCA 3L4TA 1BYCA 3IGUA 2YDQA 2VVNA 4W8BA 2Y8VA 3VTRA 3TTQA 5A6LA 3CUHA 3EDFA 1EDGA 2EQDA 1DWIM 3U7VA 4W87A 1NH6A 1E73M 1KXVA 4UOZA 3PZVA 4F8XA 2VR4A 3WDJA 1GQKA 3QHNA 1UWIA 1KFWA 1BSIA 4FNSA 3AZSA 1W1VA 3WNNA 4XZWA 4A3YA 4BCEA 4TVCA 5ABFA 4ACZB 5CXPA 1YHTA 1ZB5A 2VX7A 1G9HA 5BCAA 1D7FA 1KR0A 2WVUA 2ZX8A 4R5EA 2XVLA 2OYMA 3ARZA 3W29A 1EO7A 4JFWA 3EJTA 1TVPA 4PMQA 3WEOA 1QI5A 3CZJA 1UR1A 1HXKA 1ISZA 1U2YA 1J0ZA 3D50A 3AHZA 1WAWA 2UY4A 2D24A 3VOCA 1E6PA 3HMCA 3T0DA 4GPNA 4F66A 3TTYA 3OG2A 3CO4A 1PAMA 1E6XM 2ZXBA 3KWXA 1UYQA 2XSAA 4DWSA 1E4IA 5C71A 2ZXAA 5BYWA 3RM9A 3CTTA 3VGGA 4ZE4A 1IZJA 1UQZA 4NRRA 4AD0A 1Y7VA 3LXBA 1R75A 1ISYA 2VZSA 3MV01 1QWUA 1PIGA 1OGGA 3WDHA 2E8ZA 5LA1A 1BG4A 3FN9A 3UCQA 5GNYA 4J3XA 5BRPA 2B31A 1QNQA 3H53A 4AD5A 4PTVA 3K8KA 4M80A 1BHGA 1J0HA 1OBAA 2J4GA 4PCSA 1BTCA 2TAAA 1UWQA 3CZNA 2NT1A 1V6YA 5A6JA 2OWWA 1CXEA 1G5AA 1DWFM 4MPKA 3WF0A 1XH0A 3TTOA 1U30A 1E6ZA 1FOBA 4AD2A 4UQ9A 1H49A 3HG3A 1SYTA 2E9MA 2EEXA 3W4RA 1UD8A 1W9XA 4N0RA 3T08A 5CLTA 2PWHA 3TV8A 2W63A 4JCLA 1JXJA 1C8XA 4B3KA 2BXZA 2VQUA 1E1FA 1QI0A 4PEEA 1C8QA 2PBGA 2ZX5A 4CD4A 3OGVA 2CKSA 2VC9A 2GJXA 4KRTA 1MFUA 4AC1X 5TD4A 1KB3A 1JAEA 4FK9A 4ZFMA 3VM7A 1HX0A 2ESCA 3BVXA 1NP2A 2VT0A 1Q6DA 1OT1A 2WMHA 5LYRA 2WK2A 1AQ0A 2QPUA 3NYDA 4Z2HA 4QLKA 1E9LA 1CNVA 1MQRA 3AMGA 4C7GA 2MANA 3AYSA 5ABEA 2G3MA 3N15A 1ZJAA 4MB1A 1CPUA 5IHSA 5A6MA 3DHPA 3AOFA 1CXKA 1JZ3A 2VRQA 3EYPA 2V5DA 1R34A 1CXIA 1XCXA 3UETA 1TE1A 2D20A 3AICA 1TA3A 4D6EA 2VR5A 3DYOA 2CNCA 2XWEA 4WJXA 2OW6A 4MB5A 3VDCA 4Q7NA 5FL0A 1JZ5A 2EPNA 4W85A 2F8QA 4FNUA 3OIHA 2GK1A 1R87A 3AYRA 2GUYA 1PJ9A 2QMKA 1KR1A 3WH6A 4FMVA 5CSYA 1WB0A 4GQRA 3NJ3A 1GOIA 3BAIA 3ZJ8A 2BHUA 1KGUA 2V5CA 1V3HA 2GJRA 5A6BD 1JL8A 3A23A 1DHKA 2BVDA 2PBOA 2WC3A 3AIBA 5HDRA 3PZUA 1FH8A 1P6WA 2WBGA 4MNKA 3ZJ6A 3LXCA 1MWOA 4UQEA 1GOKA 4BQ2A 4CCCA 1VEPA 2DSZA 3BUIA 1WZAA 1JF6A 5A1AA 3BLKA 4W5ZA 4BS0A 2YLLA 1V6XA 3ALGA 1TQVA 1UG6A 2J78A 5GNZA 1QI4A 4MDOA 5I23A 2X1IA 2YFOA 2JALA 1DWJM 4U31A 1G0CA 3WNPA 4FNRA 4DUXA 1CTNA 3A4WA 1JI1A 5I6SA 3EJPA 3ARVA 3CH9A 3WFZA 1B3ZA 3NDZA 4U3CA 3N17A 2Z1SA 3ARUA 1GJWA 4HPHA 2VZOA 1JYXA 4AIEA 1W1PA 2UY2A 4AEEA 3N11A 3WD3A 1BVZA 3OLIA 6A3HA 3POCA 3JUGA 1BVNP 1OWQA 3SUUA 4AY1A 3WELA 2D22A 3VIKA 4FNQA 1W3LA 1WPCA 5DFAA 3WH5A 4ACZA 1C8YA 3WDQA 4AYSA 2XN1A 2CKRA 4ACYA 3K4DA 2CEQA 3CZLA 3MUIA 3CGTA 4GZIA 3MSGA 2E3ZA 1MW2A 3RM4A 2F1AA 3VD5A 3BCDA 4ZXLA 2ZWZA 3BAJA 3QOMA 4HOWA 4JIEA 2JIWA 3VD9A 4PYSA 1RH9A 3KEHA 1UKTA 1CGWA 1CIUA 1BGAA 4JFVA 1QW8A 4DM2A 3WQWA 2XVGA 1JG9A 4PMZA 2BVTA 3QGVA 1LG2A 3K1DA 4AZHA 5ABFB 3D4ZA 3SUVA 2WMJA 3WY2A 1FH9A 4UQDA 4CN4A 1C93A 4MJ4A 3L2LA 2OSYA 2V3GA 1HKMA 4V28A 4A4AA 3UG5A 3N12A 2OSWA 1ECEA 4ATLA 4J3WA 1SZNA 3M6DA 1HJSA 3B8SA 3CZEA 4W84A 4NSBA 5FKYA 1UASA 3VMNA 4ZENA 1KWGA 1KXHA 3MO4A 2FH8A 3UEQA 1R33A 2ZX9A 4DWSB 4J3TA 2J7CA 3D3AA 4AISA 3EMCA 2NT0A 3BVVA 1MXDA 4QCEA 3FY1A 3ZR6A 4OUEA 1W3HA 4B16A 3PZGA 3AXIA 3T09A 5HOSA 4OBSA 1BGGA 2J7EA 4H04A 1JAKA 1C7TA 2EXOA 4X9YA 3FNDA 3VD4A 3VNYA 1QI3A 1ZL1A 1UWUA 1UKOA 4CU6A 3TOPA 3VU2A 4QDMA 1E0WA 2UY5A 2WVTA 4HA1A 2CHOA 4PTXA 1R7OA 2WHMA 1AQMA 2XIBA 1CLVA 3BVWA 4L4PA 5CGTA 3SCSA 2W66A 1QPKA 1JDDA 3FAWA 1N82A 2VQTA 3W28A 3THDA 2EAEA 1J01A 1EO5A 1I1WA 5DT5A 3AIQA 3FHQA 2XSBA 4CVWA 4B15A 4BQ5A 4WSJA 1C92A 1W3JA 3F5KA 4MDPA 3LX9A 3W27A 1GNXA 3O9NA 4AD4A 4IUGA 3DDGA 1VEMA 3WMBA 3VINA 4H8VA 4XX6A 2OYLA 2PF0A 3G6LA 4DWSD 5FL1A 4EE9A 3PZQA 3AS3A 3A21A 1G1YA 3A5VA 2WZHA 3BAKA 1CGVA 1X6LA 2FHCA 2AMGA 3BVUA 1ISWA 4F79A 4D6CA 3AIEA 3WUGA 1HJVA 1E4NA 1ODUA 5D9MA 4UTFA 2WHKA 4NRSA 2GFTA 1VENA 3KL0A 1R7AA 2YLAA 2VRKA 2WLYA 4E2OA 3WF4A 2D0HA 1PIFA 3CHCA 4PMNA 3VIOA 1D2KA 2D73A 2VCAA 3VVGA 1ZBCA 4HP5A 1V3MA 1QBBA 2E9BA 2WNWA 3DX1A 3A47A 1W9VA 2ZUUA 2J7FA 2BY1A 3F4VA 5LA0A 4ML4A 4L4OA 2BHYA 1LLOA 1SMDA 4TOQA 4GIAA 4LYQA 1JNEA 4OBRA 3WEZA 4KMQA 2J62A 4W86A 1VIWA 2WC7A 4RL3A 2GK1B 3VGBA 3BAYA 4PSPA 3IAPA 3LRKA 4MB4A 2ZUSA 3WY4A 3ARPA 3J7HA 3M07A 4GXPA 2CESA 1QWNA 1WDRA 4ZEPA 1VFOA 4AXNA 4J7RA 4EAMA 1TMQA 2YA0A 3W37A 2YBUA 1E6SM 1FFRA 3GNRA 3ZJ7A 4LYPA 1XYFA 3ZT7A 1V0LA 1X6NA 2DIEA 4CVUA 3I3EA 3TA9A 2BFGA 4AWEA 3SCOA 1EHNA 3T2QA 1HJWA 1XSJA 1OSEA 2FHFA 4C7FA 3PZIA 4Z2JA 8CGTA 1US3A 9CGTA 4UNIA 3DHUA 2XJ7A 1H2JA 1XH1A 2WB5A 3CUFA 2V38A 4W89A 1E5NA 2CITA 5IXEA 1EOKA 1XC6A 1ZU8A 3MI6A 4S3KA 4PTWA 4JL1A 1MW1A 2ZXDA 4U2YA 3VD7A 3B9EA 4BQ3A 3B9DA 4MAZA 2D23A 4IPNB 4N42A 5ABHA 4TTGA 2V3EA 1V02E 3LPFA 3VIFA 3EDJA 2F7OA 3M46A 3BCFA 2J7HA 4U5KA 3WKZA 1OGSA 2VOTA 5EMYA 4JKKA 2VRJA 1US2A 2GDUA 3LPOA 6TAAA 4V27A 1B3VA 5EBAA 1VB9A 1DWHM 3GM8A 3H54A 1QVBA 1PZ3A 4NZCA 2QLYA 1FP9A 3NIYA 2FDMA 2D0GA 4UCFA 4AMXA 3EMZA 4AYGA 5GNXA 4TUFA 4AMWA 3KL3A 1E15A 2C0HA 5JBFA 3K8LA 1H41A 3DYMA 5A95A 3ECQA 5KEZA 1XYZA 3SCUA 5I0DA 1TQWA 2W61A 3BXWA 5IFTA 3WY3A 1WZMA 3CIVA 4CU7A 1F4HA 3HU7A 3FHAA 5D9OA 3IJ8A 3GH7A 3T2OA 4M8UA 3ZT6A 3OA5A 3S2CA 3WH8A 1CGTA 1V6VA 1HTYA 1LJYA 1OIMA 2XWDA 2DDXA 4R27A 4KRUA 3BLBA 4RE3A 4FNPA 1JDAA 3ZMRA 3OGRA 1DEDA 4KGJA 4GZJA 1IZKA 1G94A 5DT7A 5M3WA 2QF8A 2WVSA 4OKDA 3W38A 1W1TA 4HOXA 2Y8KA 3PBGA 3KZSA 1OM0A 1QHPA 7CGTA 4PN2A 1D3CA 1NWUA 1J0IA 3QHMA 1UHVA 3BMWA 1R46A 3WNMA 3OLGA 2YL5A 4PRWA 3GBEA 4H2CA 1NWTA 2DEPA 3A24A 1FHLA 4W5UA 1NWSA 3NSXA 3WDIA 1MVYA 5AY7A 1O6IA 3MSDA 1PX3A 1KXQA 3UESA 4LXFA 4U33A 1V3JA 3PZMA 3OLEA 4GI9A 2XTKA 4P8XA 4FLSA 2ZUTA 4OOUA 5A8MA 4W8AA 2J8FA 2VL4A 5A2BA 1EQPA 3N9KA 3FXYA 2VMFA 1XRVA 4HMCA 1AQHA 1BYBA 1ITCA 3POHA 4Q22A 4FLOA 4JL2A 2J25A 1UWRA 4HZ7A 3NCOA 4W7WA 1TUXA 3SEPA 3VIMA 2WCAA 2X05A 3WSUA 3SCNA 3WL1A 1E1EA 1TQTA 1M01A 3O2LA 3CZKA 3OZPA 1MW3A 1GONA 1CDGA 5A2CA 3EJSA 5D8ZA 2WBKA 3HG4A 3PTKA 4OOZA 5BWFA 1FA2A 4MB3A 2X8RA 2CETA 1E5JA 4TX6A 2WXDM 3BVTA 3D5HA 2DIJA 3WF3A 3RJYA 1J12A 1V6UA 3GH5A 5FOOA 3QR3A 2WVVA 3CPUA 1XSKA 5CPSA 1VJZA 3BMVA 2DSVA 3GXMA 4CN6A 4HOZA 1JZ2A 2PC8A 1B3YA 3E1F1 2G4FA 5D4YA 2FYVA
chains in the Genus database with same CATH superfamily
5C7XL 2H1LM 1BYNA 4BSJA 4DN3H 4JFHE 4QRUB 2XFYA 3P40A 3S5LB 2KQMA 4RGNB 2PYEE 3Q67A 1U0QA 1A3RL 1GVSA 3T0EA 3IIVA 4O8AA 4JJOA 1FIGL 1B0IA 4OT1H 3VI3B 4PVBA 4NZ5A 4XPTL 4ODXA 5H37G 5I2IB 5G5DA 3DC8A 3AQYA 1XXFC 3ES6A 1OD8A 2NYZA 1BVNT 5CUSH 3MCYA 3K72B 5FF3A 3VNJA 2WBXA 4DKTA 1BYPA 3W1UA 4D6JA 4XBKA 1L5GB 3DHMA 4HFUH 1EJWC 4UI2A 1NCWH 3QJVB 5FUCC 3R4IA 3HE7A 3LPGA 1FKXA 1ESWA 4EDWH 2UXTA 2JEPA 5TFSL 1VLIA 2VEGA 3MTRA 4LGPB 3M88A 3BLDA 2R1PA 2WHJA 1QEWB 2VR6A 3CC1A 3RO8A 2Y23A 2FZ3B 2Q9OA 3AQZA 4IIZA 4QTIH 5D9PA 1XGYH 1EWDA 5DZNA 3BN9D 2ORBL 3RNQB 2Y07H 3PP3K 3KDNA 3DAQA 3V9CA 1ZT7A 3P1VA 3TEZA 3GNDA 1GHSA 4NN5B 3I7RA 5JIQA 2OW7A 4DAGL 2CLOA 1CBVH 2VC2L 2EDWA 1BJ1J 1C1EH 1IUZA 2CCRA 2ZCLL 4P8VA 3HNVL 5M5DA 4AEFA 4G6JL 2XA8H 1H15A 1TELA 2D8KA 1IGTB 2QR0A 3V4VB 1O95A 3TBWA 5A8NA 5A6AA 2ZOTA 1JRHL 5I24A 3MSPA 4ECLA 3EB4A 5JIWA 4KQ3L 1L6FA 2PCXA 4RLIA 3PN8A 3E49A 3IF1A 4RGMB 4G1EA 5CP7B 1IAOA 1D9KB 1J5IA 1PG7L 1E43A 5DFVD 4K9EL 4JFZL 4QRRD 2P53A 1M7UA 5AW1B 1ASOA 3APGA 5CGYC 1RULH 4BCXA 4QNWA 2CO7A 5F4SA 4MUZA 4M1RA 3KWSA 2H32A 4OIIL 2GAZA 2CLVB 3OBAA 2VLLB 4QIRA 4G83A 5HHPB 4UTKA 4ZTOH 4MXVE 1UURA 3LOWA 3QNYB 3N73A 4NG3A 2JF6A 2H47C 3HBZA 3OHXB 3NL5A 3OAUL 4YOKA 1MREL 1E0VA 3KLKA 4UV7L 5A3ID 2WQWA 4XMLL 5CLWA 4R4NC 4HC1A 2CDEA 3DBSA 5IWLC 3W7QA 3OZOA 4C6NA 1Y5XA 4XMXA 2DZAA 3V4UH 4BEQA 1CIDA 1G7JA 1HKJA 1V8HA 2BIOA 3UO8B 4DO4A 3MRDB 4JN8A 1XKJA 5I6XB 3VX1A 2QDHA 2VLRB 3WUFA 4HTYA 1Y1DA 1XV8A 3AO0A 1PLCA 3CBKB 1T7VA 3W2NA 2KUTA 4U1HB 3CMGA 3GFYA 2V5LA 3WG6A 4X4ZA 1QLEH 1EUNA 3I6RA 2BVOB 2ERJB 2Y5TB 4OCRH 1QCWA 1CR9L 4GXMA 1MAML 2MH4A 1EZWA 1TWDA 3JWDH 3DERA 1FP5A 1P6BA 2EYSB 3BUPA 5HPOA 3NJFA 4APQD 3HJZA 4NJAL 1DSYA 3FUDA 5GSRA 3BLPX 2HX9A 3L3KB 4LLMA 1SBSL 1AH4A 3MHGA 4F2FA 4Q6IC 1QNOA 4MCNA 2DS4A 5DQ9B 4YL9A 2YN3A 4PRHE 2A6DA 1IZCA 1UWEH 3TCEA 4KMTL 4LBEA 4B4HA 3CG8A 4RZ6A 4LB4A 3TH3T 3EA1A 4MNMA 1OTTD 1XYBA 4TVDA 1CN4A 1Q0YH 4A7UA 4XO5A 4LTSA 2OTUA 2E7CA 5FWQA 3LPWA 1TZAA 2Y70A 3R4DA 3P3SA 5FCZA 3ZWSA 3RFRA 1HINL 2X9XA 2Z8RA 4HA3A 3QZWG 3N6HA 2NUXA 3BH8A 2OCJA 2GTWB 5I0YA 1OTUC 3ARFC 3UBGA 3CQPA 5IW3A 5IV2B 1T2QH 4G7VH 1X4YA 5IVZA 4FFWC 3ALFA 3LV5A 5AZEL 1E4XI 4LUJA 5FO7A 4LT9A 5GRVK 3OKMA 1H3WM 5H94A 2XTJC 3CWOX 3PWNB 3IWUA 3NEOA 4NKDB 2FR4A 3QCTH 3UIYA 3U7BA 3PWIA 4G42B 5BPPA 2XFXA 4G56A 3QUYD 4NYYA 1J6OA 2DQJH 3JV0A 5I77A 4J2PA 1CFVL 2AKMA 2PA6A 2K6WA 5AYQA 35C8L 3C6LA 3DJZA 4WTQA 3B8DA 4LH8A 1RZKL 1PZ2A 4ZZKA 5DJZB 3CH1B 2YA2A 4F27A 5JXQA 3RZCC 4Y90A 1LL4A 3KW7A 1BLNB 2PTTA 4G9DB 1DFXA 3FSAA 3ZDYE 1DQMH 5LGHH 2AKRA 4JG0L 2YLKA 4QNPF 1PS3A 4I48A 3ZVVA 4P4KA 1BQHA 3MW7A 2XDFA 1KBBA 4B5WA 4PJXA 2WCPA 4K68A 1I4FB 1URZA 1MNNA 3EHBB 5D04C 3SDCA 1SJEA 1Z7AA 1WT5A 1NAMB 2QULA 3LS5H 2H2PD 2EKJA 3PYCA 2EDYA 1KCUH 1IM9B 4XIMA 2EEBA 2H2SD 2IG2L 2FJSA 1M05B 3FQUA 3HRPA 4Y5XC 5AUMB 4HU0A 4GVGA 3AUVA 5DFTA 5F3BB 2ENSA 3VAVA 3O11B 2EDQA 3SY8A 3MV7B 3FTVA 4DTGH 4OY9A 1X5YA 1RUSA 2R1YB 1O7VA 2IGFL 2L7EA 2G0LA 2XKUA 2R4RH 2OMAA 5LNWA 2ZADA 3WKQA 4B91A 4PJ8C 3QNZA 3WEAA 3F12A 3D0LB 5EEWA 1E65A 3QORA 5ID0A 2DB8A 3WUWA 1KJ3H 4FLHA 2AJYL 2GJNA 1G1KA 4Y2DB 3ZTDC 4Y9BA 3S3DB 5EZIL 4LVEA 2RMNA 2Y25A 3MS8A 4MHHG 4NUJA 1NEZA 1BJ1H 2XKNB 1GR7A 4PS8A 2WYHA 2VXTL 4ETQA 1WDPA 3FJNA 3UAJC 2RACA 1I9RH 4KRLB 1YDOA 3LSCA 1RZJH 5C0DA 3KTSA 5H4ZA 1BOYA 3W9ZA 3D08A 5DA4A 1CXHA 2BNRE 5HYSA 1KELH 4ZUVA 2X70A 2N01B 2DYRB 4GS7C 4R96B 4JFQB 2NR6D 1RJPA 3NSDA 2C1HA 3DECA 4PR5B 1ZRUA 5BOOA 5D9SB 5ILTL 4ZW5A 3G5YB 5EIQA 3SKNA 5JQHC 1LM8V 3W73A 3BUBA 3UTQB 1TKKA 1HL5A 4PJIB 3GSWA 2NY2B 4S2CA 4FFYA 4F2ME 5AFDA 3MWAA 4LLYB 5AVWB 1HL4A 3W24A 1L7TL 2JKJA 3V55A 4L8SA 5A2JH 2LQRA 4JFFD 2GTZB 3WFLA 4DW2H 5AAPA 3L48A 4WKXA 2V17H 8FABA 5BZWA 7A3HA 3ITVA 3HN8A 5IFHL 3ARGA 1KN2L 1H09A 4GW4B 2GUOA 4JG5A 3PWGA 5G1YA 1XZWA 4DBWA 4Q14A 1GGYA 4L5FH 1RZFL 2P8PA 1R0MA 1ZA6A 1RLWA 1KG0A 4PGZA 1O7DC 2I57A 2BFVH 2RJMA 3BVNB 4G1NA 3M0ZA 1YN6A 4DOHE 1SJHA 1CDUA 3C09B 2JK5B 3C8DA 3NSMA 4TO8A 1GVOA 4KKZA 2ZJSL 1TUPA 2F08A 1H0IA 5GGQL 2HVNA 4DQOL 4AL8C 1FDZA 2IH8A 1LP9B 1QRND 5FYLL 3FAXA 5TQ0L 1XCQB 3LD8C 4P5MA 1VDGA 4LIQH 3K1GA 4FXRA 1Z1WA 1Z89A 1FZMA 4Y4HA 3N2OA 5JHDB 3SPHA 4DH2A 4YYCA 4W9EC 5FYKU 3NQ8A 5E6SB 4NJKA 2X4OA 5T3ZL 1GQKA 3L95B 1YNQA 3TVMB 5TE6L 4ACZB 5CXPA 1XF0A 1YHTA 3EO1A 2HK0A 5MENB 1PDYA 3DROB 5DRNB 4R5EA 2G60H 5KJRL 3D12B 1I1AB 4PJHB 3WEOA 3DPBA 4TMBA 2AABL 4JPGA 4PS3A 4RQQB 3ABLB 1KEMH 1E6PA 1F5WA 4PFMA 4QJ3B 4OLWL 1UXSB 2EDLA 3KWXA 2XSAA 3T1FB 5FGCE 3W39A 1E4IA 1A6WL 3FSUA 3IVKA 3COTA 1Q1JH 4NQSA 5ADOH 4D9RD 1BFSA 3HJ0A 3QHTC 3MHZA 1N5YL 3CAWA 4L05A 1T4KB 1EERB 2WZPA 3GDCA 4XWOC 1FWCC 4Z77B 2J6EH 4QEGA 4WGKA 2Q01A 4IMFA 3QZEA 4KJPD 4XNZC 3W7PA 3G6JA 3TTOA 1YEGH 3GYRA 4OZ4B 2X3BA 2L7UA 4N0RA 2BB0A 1KJ2H 4B5ZA 4U6TA 2XTLA 2W63A 3GC3A 4FXFA 3BH9B 4B3KA 1E1FA 2NXIA 4HVBA 2QSTA 1K4DB 3IT8D 3WQPA 4U6VH 3B97A 2EUWA 1F1GA 4NI6A 3O16A 3IU3B 5AVUB 4FK9A 4WUUD 3RPTA 3O2DA 4F57H 3VKDA 1BJMA 4HSQA 4YCPA 3R0MA 3B2DC 1JWUA 4YSOA 1SOKA 2H26B 2MANA 4UM9D 4RGOH 1TPDA 1P4CA 3RPKA 4JPKL 3NYKA 1K7FA 5FF4A 3AICA 4ZFOB 1U8QB 3PQYA 5D2LF 2VR5A 3BEVB 2QUMA 3IFLL 1JZ5A 1E27A 1IBHA 4JN1H 4A7GF 2C9QA 1FVCB 3E0FA 1ITQA 2Q0ZX 2NY4C 1KLUB 2A7RA 4Y16C 1RBAA 4L61A 4NN7B 5F7DB 2GJRA 4Z7VA 4V1DE 3BP5B 5LNUA 1DHKA 1V55B 1EBGA 2DZXA 4JGMA 4UQEA 2HX7A 4HGMA 4BK8A 1REQA 3GLEA 2YFOA 3KGRA 3X11A 2YGYA 1BMGA 3FNKA 3PG2A 4FNRA 4DKEH 3OKLB 1I7RB 1NF7A 5JIKA 5D7LB 1QOQA 1E6OL 5E4EB 3TA3D 2DVUA 5FHAL 4CMMB 4LEBA 3GIZH 4LVOB 4XG1A 3CFCL 3NCEB 1LOQA 3K7UA 3WIAA 3N11A 1BEUA 2V33A 3Q13A 5KTLA 3TIDB 5LDUA 4B6ZA 5DJ0B 3OV6A 3ZN6A 3SQOH 5JXAL 1A22B 2N3JA 4U1SB 3RN6A 1TTGA 5GGUB 3V0WH 5SX5H 3B5TA 1QRKA 2LVEA 5DVNA 4JK0D 3UPMA 2BLFA 3LAFA 4XMKL 4KVNH 4X6DE 3B9KC 4Q8TA 4JO4L 1YEKH 3MACL 4OJFL 1MVUA 1BEYH 2NX3A 3E0WA 1RA5A 3P9WB 5T9BG 3ZLHA 3I9GH 3WQCA 4AY8A 4X5WA 4YGAB 4MZRA 3UEQA 2HTLC 2RQEA 2BLEA 4K5NA 3D3AA 3I6SA 2ZTKA 3M0HA 5H91A 5G2HA 4FQQB 3TNMB 4D3CH 2CM5A 4IX0A 5E00B 5HOSA 2DLFH 1QUNB 4KESA 1QI3A 2XG4B 3GBMH 3TOPA 4NENA 2VDLB 3VFCA 3BZDA 1ONQB 1XGUA 5D7IE 1HZHH 4L4PA 5AAMA 3SCSA 3FT2B 5IG7B 4GEIA 2IALA 1IJ9A 5HGAB 2P0IA 3DXAA 1MFCH 4RRPM 1YMYA 1W3JA 3FU0A 5I09A 5FW8A 2HRGA 4JAMA 3C9NA 3B2PA 1WYJA 4ZODA 3SO3C 3DX9B 2F9BT 2J13A 3RLUA 5CN1A 1YNKL 3SGEH 3X17A 3A5VA 2FHCA 2Y6TE 1L7IL 4KS0A 1HJVA 4I2XB 1ODUA 4DJFC 2WHKA 4HJJH 2FT7A 1YVLA 2NNAB 5C07D 3AU2A 3QSTA 2VDML 2MNJB 1RJYA 3WSQH 3TWYA 1ZBCA 2WSDA 3MRRB 3STCA 1GW9A 3TYBA 5LA0A 1X5JA 3FQXB 1DUYB 4FPSA 4BELD 3H56A 4WJ5A 4JRXD 1PDKA 4KMQA 2CLHA 2IMNA 2ZRZA 4PRNB 3ZXAC 3TFBA 2ZUSA 3ARPA 3J7HA 1UWYA 4A66A 7ENLA 4LRSA 3APTA 2HYMA 5IY5B 1KCBA 2YGVA 2YPKA 1WOAA 1V5JA 1GGOA 2Y0FA 1URIA 3QPZA 3D18A 1J1PH 1N4XL 1XHHA 4Y9AA 5I1CH 3LKRA 4PRBA 3PS6A 3QPXH 4HJUA 1PL3A 3NIGF 4YTUA 3PJWA 2XV6B 2WB7A 1XRSA 2PLMA 1MW1A 4V2BA 1JCNA 2BSEA 3ZO0A 5DT1L 3W5NA 5BRZB 2X53A 3LZFL 2VRJA 4G8AC 4IIQA 5HWNA 1GOHA 1KFLA 3EXSA 4KKQA 3CB3A 2QLYA 3TLRA 1OCNA 3MV9D 2VLJB 5A6IA 1X1ZA 4XBMA 4ZDHA 2P7TA 2VO8A 5TPWH 1KNOB 1DBKH 2DVXA 4QKTA 5CJ8A 3TCLB 4N2EA 4M8UA 1CE6B 2PO6C 1V6VA 4PU2A 2WGNB 3BAEL 1XKYA 4JEGB 3KUMA 4ERIA 3BLBA 1M7JA 3C0JA 4AM0B 4DT2A 1X5AA 3W38A 3NJKA 2WJZA 4R7VA 1M9SA 4HF5L 1TZIA 4JGUA 2QVHA 1PCXA 1R46A 4JN2A 2EYRB 4YC2C 4DZ8A 5KZCB 1NWTA 1EJRC 5E9DA 3OWRA 3L5MA 2ZOUA 2VN5A 1WISA 1UZ8A 1YPZF 2UYLA 4I8YA 4LSBA 1VADB 1YADA 2KS0A 1F74A 1OC6A 4POZD 4QHNA 2PDKA 4M1CC 3OLEA 5IHHA 5BMXA 5KS9F 3VXRB 1FZKB 3UY8A 5GRZA 2J8FA 4P0DA 4K1GA 2UV3A 1BYBA 2VH5L 4Z0BL 2DYPA 4BFIA 2VDOL 1EK3A 2BRRH 3WLIA 2NX5D 3N4AA 4E0RB 3ZIMA 2BP5M 3NCOA 2ED6A 2UX6A 5DI8B 3OHIA 3KS0J 2EP6A 3PHQA 4X5RA 4YVPA 2P76A 2CMRL 1RSCA 5IBTL 3RCMA 2YARA 4KK6D 1OW0C 3UGVA 3NOIA 2Y5JA 4O58L 1VHCA 2F8OA 7REQB 1CLOL 4PP2A 2F6XA 3REWB 3BPCB 1TVBA 1RZMA 1U4FA 5IFAL 4PW9A 1MIEH 2NY5C 4L4VB 1CG9B 4IBZA 4HYVA 2HJPA 2VKZG 2PW1B 2FPVA 2AL2B 1K9FA 3HPJB 2XIIA 4NRZA 1SEBA 1NGXB 1K6AA 3CV5A 2ZRVA 2WYZA 5B3SB 2NY6C 3W6YA 3P73B 1ZK5A 2BM3A 2A85A 3I6GB 1WKYA 2RBLA 1YECL 4UBPC 1WA2X 4FOKA 4MA7L 3L7EB 4PZVA 1JWMB 3G5VA 2CKNA 4Y5VB 4EKJA 1GEHA 2KKQA 5J3HD 3G8EA 1M6OA 4MWAC 5IOPA 4KO5A 3RTQC 3ZQXA 1XZ0A 2P8LA 1MYRA 3K0YA 4P7QA 4PWIA 4O2CA 4G8GA 2NXYB 4LSSL 2FZNA 3Q5YA 4H8UA 4HLZG 2IAMA 3DURB 2ZUQC 3DMMB 3WF1A 1M7XA 2JI3A 3NVDA 4K6AA 3BWUF 3V0VB 3TMQA 2ANUA 4ELME 3B3BA 1UJTA 5EFIB 1IFHL 3SDAB 1AJ7H 4Y0GA 2OMYB 3LNIA 4OF3A 4GRWH 4JG1L 4LOEA 4QXVA 3MUY1 3OZLA 4L3EE 3EG9A 3SOBL 2Z0UA 1EZ2A 3AITA 1ZBKA 1PKQB 1MCSA 2UY7B 3DFQA 3JYCA 1QW9A 1E56A 1JPDX 1P4IL 5DRCA 4RXFA 2KI6A 3ALPA 2ZOXA 2BCKB 1SQMA 3LRSB 4ZO6A 4IDLA 4FEIA 2J6XA 4Y9MA 2J20A 1XIFA 3NG3A 5F89B 2YW3A 4J4KA 3UZEC 2GCYA 1QSFE 5TH2B 1EC7A 3FT1A 1X8FA 4S11A 3VAEA 2Q8AL 5LAPA 3RDKA 1ICSA 3T6CA 3LNPA 5CH9A 3DX3A 2FO8A 3R89A 1Z7JA 4R4BB 1Z41A 1MCEA 4D0CB 4PUDA 2F7IA 1IQDB 1PS9A 4QLRA 3KH4A 1JCVA 3D30A 3KPPA 4XP1H 1FG9C 3GMOA 3U5YA 1ZVNA 3HAEA 3RWCB 1GC1C 4PPTA 2PWGA 3NZUA 2VYRE 5I6KA 2ZKHL 4MMYA 3U1QA 4XN7A 4G6MH 1I3GH 5GRVL 5HYQB 1AR1C 2NY7H 3C52A 2W07B 2R0ZH 5HGBB 2V5YA 4ZSOA 4S0HA 1KULA 1TQCB 2Z1KA 3MUGB 4Q8OA 3CHDA 4PVNA 4Y4KA 1BYDA 1INQA 2VCBA 2O9TA 1ZLSH 1R3TA 4DXXA 3ISYA 2DZBA 3O7UA 4IBLT 3IDNB 2R0WL 4NUPA 2E0PA 1JGVL 4XNUL 1V93A 2WMGA 4ZQPA 4PGEA 2KZ1B 1R19A 4AQAA 5IESH 5G1TA 1DJGA 2HFFB 1OVZA 4Z7OF 1BBJB 1ONRA 1KFGA 4CJ0A 3IDMB 3B83A 2P8CA 4WFEE 1AHMA 3MNZA 1LQSR 2D69A 4H8WH 2E67A 5HHQB 5FGRA 1RK5A 1Q6OA 1RCYA 3ES8A 5LXVA 3MJ9L 3VGEA 5JR1H 3H7BA 5KYWB 4FZEH 5I6MA 1G01A 2OMWA 4XAWH 2NOYA 4H7CA 2CM6A 3QQ3A 3WLOA 2OP4H 3LGGA 3AIUA 3ZE1E 1ZPUA 3T0ED 3SODB 2VM9A 3MX0B 2EXYD 2IGTA 4KIEA 1HH9B 2I9LA 3KPSE 1NU5A 2AOSA 1QHZA 4Y9GA 5KSUA 4IU3A 2GVYA 2IOMA 1R17A 5B7FA 3EOAA 4NJ9L 3BH4A 3WMCA 2EACA 1CICB 1FC2D 2CBVA 2E1DA 5E23A 4IRSA 3ILQD 3KOWA 1RP8A 1T5XA 1U8KA 2KL6A 3U82B 4UIKL 4BE6A 3HE7D 4PJFF 5KSBA 4LHUG 5FYKE 3F2LA 5FPIA 2X1OA 4U6HA 2WYTA 5J6GB 1KBVA 4XP4H 1TOXA 3D47A 3QUZB 1LCOA 4L4TB 4Q7DA 3NQGA 3MRBB 4HKZB 4XPGL 4RGNC 1BZ9B 2WOQA 1P6AB 2XWXA 3QG7L 2DZPA 2RGLA 2R1LA 5IHWA 5K69A 5AKSA 4K7PH 2QZRA 3DYPA 4JIIX 2ZOOA 3A9IA 1QBLL 1ITBB 4LRIA 3ABQA 1SU5A 3M0JA 3B7RL 4FJ6A 3VDBA 1XBXA 4AV0A 5C0GB 1XS2A 1MEHA 1MDAA 2I07A 1NIFA 4R3SA 1JFXA 4PRDA 3DGDA 3QUXC 1LEKB 3EYVA 3EOYG 5FKAA 3H2AA 4FP8H 2G97A 2DKMA 2CBMA 4JFTA 1U8JB 5L2JA 1E6RA 1XDTT 4GK8A 5EMLA 1XGZA 1J8RA 3MYJA 4GIOA 1ZTXE 1TCMA 2V81A 1XF3B 2G3XA 3C5XA 2W92A 1LDPL 1GOFA 3SJNA 3G1FA 1R9YA 1JDCA 3B2VL 4AV5A 4AXWB 3CT2A 1FPTL 4NN5C 4PGJA 4ONHA 3V9FA 3UYPA 1OF2A 4KNQA 5HNNA 3UYRL 2NX1A 1I3UA 1Z32X 5E6ZA 4XAYA 1N8OE 5D1ZB 5GZNC 3DRTA 1NMBL 4QEHA 3MJ8B 1X4ZA 1A3QA 1POJA 3VABA 2WMFA 4GUGA 4O10A 3UDWC 3KG5A 3W9DA 1OV8A 2H8PA 1MFDH 3F5JA 3HZMB 1NQBA 4PJCA 4NNPL 4HPXA 3TAKA 4H41A 1NVMA 1AIZA 3G5WA 4RGMC 5B3JF 5BRBA 3FO1B 5IIEA 5CWSA 1KCLA 2DY2A 1D9KC 5MP6L 4Z3HA 5E5MA 3T2PA 3QEGH 1W8NA 1IKNC 2MHAA 5AFAA 4IGSA 5JMOC 3TESA 2XWJB 1L8NA 1R5WA 4YHLH 3D8MA 4K2SA 2BXVA 4XNYL 4B9YA 2AK1L 4UUJB 4F9PC 4BV1A 1AP2A 1GTEA 3VXUE 4GKSB 2HT3D 4OZHF 3Q6GH 4H25A 4WI3A 2FE0A 3PL6A 3QDGA 1C91A 2EGZA 4XMPL 1V3LA 5AYIA 5A6SA 5AKVA 3OHXC 2WO5A 4IS6B 3GG1A 3N43F 4PJDB 1MCDA 4S1FA 4XH2A 2Z0IA 4ES9A 3R1ZA 3VUSA 4RZ5A 5HNRA 3ZYIA 4G70B 1TEGA 5EOTA 1SFLA 4NQEE 5I2UA 5FO9B 4XVUD 1Q6RA 3MRQB 3L67A 1S7TB 4WDUA 1YJDH 1FNEB 4PB4A 3RLSA 2NUTB 1SZFA 1YEJL 3A6BH 1YEIH 2J88L 3VMOA 4OJAA 5I6XC 2O4QA 5CCZA 4N9DA 1INEL 1OP5K 1JGMA 1XBYA 1A6VH 5IQ9A 3GHTA 1XPYA 1LWIA 1R30A 2J5WA 4OZGB 4UNLA 5FA3A 4QNPE 2YD3A 4GGHA 1MH5B 1UOWA 3B0VC 4KFPA 2PTWA 1F5ZA 1XIEA 1NEUA 5BUAA 2ERJC 4JTTA 1UM4H 2TRHA 4NRXB 2Y2YA 4E41A 1OGAE 1A0DA 2Q1EA 2EIDA 5LCVA 2Y85A 1A2YB 3HOJA 3E9UA 3BUTA 2GQ8A 2VR3A 2HH0L 3ENEA 4OF7A 2AEWA 4C57C 2QJHA 1ACXA 4HIEB 1T21B 3HMXA 4HGWB 4WF7A 5A40E 1EB3A 1JK8A 3CXDL 4DGVL 4ZJ9A 1T2XA 2GBTA 2YSSA 4M9PA 5BZDA 3WFEH 2MTAA 4PJ5E 4YHKH 3HN5A 3OBKA 1A1NA 2BJMH 2OSXA 2NSQA 4S1DD 2J1XA 1PU0A 5HHVL 2VZUA 3SD5A 4HXBH 4V33A 3VA2C 4GPVA 5AZ2H 3EWYA 1TJ2A 5FF7A 1OVDA 1JCLA 1EBAA 4J8RA 3PWJB 3INUL 3C6LD 5DMYA 4OB5H 5FUZL 4BD4A 2P28B 2X3CA 5D1XA 3SO7A 4DXKA 4B7IA 1Q6CA 1ME8A 1A5SA 3BESR 2CERA 1K6QH 4R7NB 4RIRA 3CVHH 4C6FA 1ITXA 4EPEC 1URLA 5G4MA 4DJEA 5ECGA 1SR9A 4P4KD 2VRAA 1AI1L 1M71A 2HJFB 1HZLA 3UCRA 3HF3A 2J7BA 5C0AB 1A5BA 4LDLB 1T89C 2Y8VA 3SDCD 1DWIM 4WI0A 2EIKB 1KXVA 1S2TA 1R5VB 1TJMA 3ULVF 3U9WA 3AZSA 2F38A 1EJSC 1DLFH 5MEQA 3K6OA 1BBDL 2FWOA 2CG9X 2XVLA 2OYMA 3BJTA 2CGZA 3LIZL 3IXAB 2GJZB 2UY4A 3O07A 1F6LL 5JNYA 1UENA 1VPXA 3DG7A 2WQPA 5DQDH 1LMIA 4ZE4A 1UQZA 1N7MH 4ABQA 1GY2A 4AD0A 1MHHA 1FWBC 4OLUL 4JB9H 4LLUA 2BSBA 1I31A 1GPWA 4RV3A 3QORD 2D2GA 3LZQA 3C5SB 3G5ZB 3W1TA 1OBAA 1PEWA 3W2DH 3EHBC 4Z7WF 1NBYB 2ZXWB 3VXME 4MPKA 3RDTB 1G87A 3P93A 3STZA 1I8LC 4O1CA 1MFAL 4DVBA 3CVIH 2BGNE 3I7QA 1MJUL 4FQXB 1WQVT 3AY4A 3ROOB 2FMOA 2GJXA 7PTDA 1MFUA 4K5OA 1FFOB 4AC1X 4MVAA 7PCYA 4GQBA 4UMCA 4UTAA 4GXUM 1G43A 4IRZH 1TWSA 1OT1A 1RZ8A 5SWSE 4Z2HA 2EVJA 3EAUA 1S7QB 4PW3A 2AJZB 3P9LB 2AQ1A 3OKOB 1U2HA 4PS4L 3CVCA 4UTMA 4HIHA 3HEIB 3IJIA 1R34A 4OCWH 1KB5B 3OKEA 3ZE0B 1UUMA 2Z91A 5LNSA 3DCPA 4LL9A 1D5RA 2WNGA 4MB5A 2QVKA 1HHIA 2X4TB 3BG3A 2Y7QA 3COOA 4Y2DC 1ZVSB 4OUUB 2WWKO 2WUBL 3GINA 3NA4A 5C3LD 1IAIH 3DETD 3CM4A 1ASPA 3W02A 3CHVA 5HVWA 1D2OA 4US6A 2YUWA 2NQDA 2GB2A 4JIQA 5E6RB 4ICCX 4PCFA 1ERNA 4FN0A 2E6QA 2AVGA 5I06A 5ETUB 1A64A 4XNAA 3WGUB 3ERPA 2C3ZA 2HRWA 2VFEA 3ARGD 1FHUA 3K5SA 5GJSL 3TBVB 1PWMA 4IIHA 4Q8PA 1DQIA 3H21A 1TO4A 6A3HA 3L5WB 5CJXA 1EFXA 5FKPA 2XLLA 2PZ0A 4AY1A 2D22A 2YD0A 4F33B 4FNQA 1RK1B 2MSPA 4J4PA 3DUSA 4PUUA 4ES8A 2VN6A 3MUIA 2CHDA 2ZWZA 5AOJA 3QI9A 2NY2C 2VWEE 3P30L 4B95C 2ZSVB 3SECA 3OPZH 3D4ZA 5E8DH 4BF9A 1T20A 2ON3A 1MFMA 1YDNA 2UZXA 1TDQA 4LB3A 5FGSA 3ZE1F 4UOW1 3DX8B 3L66A 3QY6A 1YLVA 1BTMA 5ESAA 1QT1A 2FH8A 4PE8A 2F6KA 4Y4HD 3LH2L 1OC7A 4QKXB 3SY6A 2ZYSA 2D7NA 4OBSA 4H04A 3FK4A 5C7HA 1XF5B 4B97A 3GIYA 3WFHB 1UWUA 3KP1A 2WHMA 1AQMA 4PJAB 4RAUA 1YEFH 2VL5B 2XJLA 4FXGB 3TO4A 2AK4E 1GH7A 4F15C 1N82A 3X3GL 1I1WA 3AIQA 3C09C 5D2LE 2P80A 3FCUB 4WSJA 3T4YB 4MDPA 5L9FA 3KPRE 4QHMA 3H3PL 1QZ1A 4EE9A 1CFSA 3ETTA 4OD2B 1X6LA 2AMGA 3G6AB 1E4NA 1ACYL 1AQKH 4KI5C 1MIMH 4O1DA 4IP7A 2WZPD 2BSSA 3FZUC 2BIPA 4WEBH 2YRLA 4GE8A 2WLYA 5GJTL 5A43C 3LD5A 6PTDA 4MDJB 2D73A 2VCAA 1JQXA 1XIGA 3USBA 5FYKL 1NCDH 4X7EC 4IFOA 2R29A 5ABZA 3LHVA 4GSUA 4JUSA 3S8GB 5DLCA 2EDMA 3TVMC 3TC7A 3C08H 5ICZA 1F8MA 3H4WA 2HSAA 3EWDA 3M07A 5DD0H 4PRRA 1QWNA 2L7QA 4AXNA 2ADJA 3GNRA 3N50A 3VFNB 3NA8A 1GGCH 1X6NA 1PD1A 4XC1H 1ZCRA 4DZBA 2FHFA 3WS3A 3PZIA 1T1XA 8CGTA 4XCFL 2ESVB 1GRWA 3ZTCC 2ZOWA 5LIXX 3B6SB 2YEVB 5ANMA 3RDJA 3CLEH 3GJFB 3P8IA 3QARA 3PQYD 3V0DA 3EXTA 2PP0A 4BI7A 3MHUA 1CTMA 4BXSV 3E5PA 2ZYIA 3QLLA 4AIBA 1BZ7A 3E3HA 3O81A 3NDYE 2H32H 5HHMD 5EPDA 2DQCH 2Y1ZA 1CW2A 5TF1L 4NKMB 3BWAB 3FBKA 1OARL 4M6QA 3VA6A 5TJWK 1QVBA 1R3JB 1ZTXL 1JRBA 4JQ1A 2OSLA 4LLWA 2Q3ZA 4HKJA 4A6YL 5IB5A 2C7UA 5JBFA 5JORA 3SKJL 2DLEA 4M5SA 2VERA 1EDYA 5AWNH 4XI5C 2ZC8A 3WIFB 1DANT 5F1NB 4HC1H 4MCYB 5DCBA 3IXTB 5DBUA 4PRIE 3O3DB 2X87A 3WH8A 1PCKA 1TJXA 2XKSA 2IWFA 1OAUL 4YTSA 4U7SA 3NPZB 1DEDA 1QUMA 1CF1A 2WWMC 3Q2LA 4YSCA 3UXIA 1UT1A 7CGTA 4PN2A 2R56L 1DXFA 1GG0A 3QHMA 5DHYA 1HILA 3V0EA 2Q3XA 3I65A 3OLGA 4YDKL 3GBEA 4G6KL 5GGVL 4CC1A 4HXAL 1MNUL 3KPQA 2H9AA 4AEIH 3V75A 2PDMA 5A8MA 4QOKA 5A2BA 2N1TE 5IOKA 1VCFA 1DBTA 4LSDA 2VMFA 4HMCA 1J1OH 2VFIA 2G2RB 3MRGA 5T1JA 1QFWI 2D7TL 5HHXL 1IIIA 4G8FB 1HFBA 2NY0D 3MRHA 3B43A 4YBQC 3PNUA 1INDH 2WNQA 1HKVA 2IDQA 1KB9J 5FHBL 3ZTNL 3ZS4A 1MDTA 1CDYA 2XXMB 4INFA 1BKSA 1YEHL 5E4EC 4M3HA 3LGDA 4IRJA 2IWKA 1NEYA 1FRGL 4HX1A 3BVTA 4LVOC 4UANA 3I2CL 2FX8L 3F65A 2ED7A 2VERN 2X4SB 1B3YA 2R91A 3PBVA 4DN4H 2D03H 2CRZA 3NIGE 1WH0A 3LRMA 3DXAD 4I18B 2V30A 1HNGA 4AIOA 2RCSL 5TE4L 1LD9B 1BVLB 4QEEA 5JW3L 1KM2A 1N10A 4IL2A 1DSFL 3T4AB 4XKYB 2BVPB 2NQJA 2NUPB 1BFTA 5G4HC 1GHRA 2B1HH 1FCQA 4LFYA 2FX7L 3K8MA 3OR7A 3Q2NA 3EH5B 4I7UA 5ICUA 1JZ7A 2TMDA 5K7JA 3RA7H 4HCIA 4GO9A 1H0GA 1E42A 2FBRA 1KD0A 2Z31B 5DD6A 1Q0EA 2V2XB 2HMID 2R15A 5IROD 5ICXB 1O4UA 4A8RA 3OGCA 2QJDA 4LLDA 4YHEA 3ZYZA 4R4FL 5JW4Q 1SGJA 2KLSA 3MRNA 3SCWA 4KKBC 2ZP9A 2BHZA 4Q4IA 2WMIA 1R2TA 3FSWA 3CU2A 4K3EL 3FTSA 3FTWA 1KQYA 2V5RA 1MUCA 1XSOA 3MJWA 1B1YA 1JMZA 5CEYA 2YZ5A 4F0LA 1UQSB 1YNLL 1YPZE 1F4XL 1P0BA 1CD9B 1BD2A 4U6YA 3ARWA 1ZLVH 2CK2A 4F0MA 3B9NA 1U3YA 1E7UA 4C1LA 4JRYB 1A7PL 4KUCD 4MLSA 5KS9E 2IOIA 1HI6B 1SF5A 1C5BH 2P5WA 3LKNB 4P8UA 1XVSA 5LKNA 2BSED 1HXMA 4ADJA 4DN1A 3VNDA 3VFWA 4WHCA 1VFUA 5JPMA 3V0SA 2F58L 3OQEA 3MLSH 3B8WA 4HWBL 1SPDA 1HL8A 1T04B 2VUYA 3MDWA 1FWWA 2HT4C 3BSMA 1FC1A 1A5FL 3ZDZB 1P5VA 3N9SA 4ZFFA 5G2IA 5CEZE 5KOVC 3X1FA 1Q9KB 4Z18A 2CJSA 2O6FA 3KHQA 1WC7A 1JS4A 4NPYB 3ZMNA 3BGFB 3P82A 2HN7A 4FD0A 4UDTA 3OQRA 3KBFA 1S8DA 4WTZG 1LORA 4WJEA 4W7UA 3DX7A 2QSVA 5C6MA 5E9DD 1V0NA 1K3UA 2AZUA 4HSNA 1QSZA 4JTAA 4CU8A 4GW5A 3E1ZA 3QGKC 2UY6B 1JDEA 3UG4A 4ZCWA 3W1MA 2DYPD 4XIAA 5EZLA 2YBRA 4NYUA 4IMKC 1VGAA 4M1DH 4P59H 3WLHA 4HKPA 1OZUA 3EBHA 5H2BA 5CP3A 2WAGA 4HN4A 2LFGA 3FSTA 4K8HA 4H1LB 3SKMA 2MEJB 1ULVA 4KK8D 4M5ZH 5L8JB 4UOQA 3T0BA 3N6JA 2ATPA 3P4OB 1D3GA 1F1AA 4AEHL 5IQNA 4AKOA 2Q8BL 4Z78B 3SE9H 3U6WA 2DWXA 5B7MA 4PREA 2ZAHA 2DT3A 5CJOL 1B4LA 2VYOA 5K33A 3W1LA 1RQ5A 2C8NA 1OCQA 3QDJE 4DGWC 4MQ7B 5E70A 4GRLA 3O0LA 1FNLA 3IGFA 3ONBA 1ET8A 1T3FA 3QQ9C 4I3SH 2AQOA 2DBLL 3VE0A 5JUEL 1LO0L 4OVUA 5F7LB 5IOBA 3FB7B 2VDNB 5I5MA 4KOBA 1XCTB 4LF2A 4NC2B 3BX7C 3LHPL 4MS8D 3L3OA 4IIFA 1A5NC 3Q2DA 4N68A 3UZYA 3WUZA 2X89A 4XZNX 3O45A 3S34H 3BKYL 1W6WA 4NP4L 4G8GD 4OKVB 1DZ0A 1EF3A 2WXIA 5FACA 1C5DA 2IAMD 2NVDA 1V03A 1UC5A 2QAPA 3BPNB 3CDZB 2YBTA 3AYTA 3R13A 4FNTA 4F5CA 3T07A 3OVQA 3SCRA 3VIHA 1G4PA 3N1MC 3RHWF 2ICWB 3EX1A 4X5XB 4PJGA 2DVTA 5FW7A 1TR1A 3LQZA 5I07A 1IWAA 4XCCL 1AD4A 5I1IH 3NESA 3E12A 4JPIA 4Y5VC 1U58B 2ATMA 4LOVA 4L4LA 4MAYB 3MDUA 3V79C 2J8HA 3CZ8A 2A38A 3DOHA 4Z5RB 3SE3A 2F18A 2NXYC 1OFDA 2XIMA 4TS6A 3TROA 3DMMC 4Z7OE 2CLZB 3BI9X 1VS1A 4ES4A 4YE4L 3CFEB 1BFOB 5B8CB 1RVFL 5T1MB 4GQQA 3BOVA 3WLQA 2NQ9A 3SDAC 3NCBB 1W3IA 2CKBL 3GFUA 4LVDA 1XF1A 2IS7A 5I1JH 3BIBX 3QCUL 4J6RL 3GSOA 1EIBA 2YPLE 4Q9BA 3H2CA 2B39A 1TJHH 2VFDA 3DFPA 4UYQA 3ITXA 1KYUA 4XE0A 1QR1A 3GLCA 3HS0A 3OSKA 4P3DB 1BM3L 4MPQA 3AAMA 3ZMEA 3W7NA 3UBXI 4JKLA 3NSYA 3OHMB 1MCNA 4D6DA 1E2VA 3E6HB 2XQBL 4HUVB 2WMPA 2WYSA 3E2HB 3EO0B 3V6OC 3LTYA 3MP3A 3KR3L 4JANB 1VJSA 3ZSTA 2H6UA 1FN4B 1Q9LA 4DF2A 1LLZA 3GTHA 3UWUA 2DLTA 4H83A 3ATYA 4QYAA 4LCWB 5EB8A 4PLJC 2YXVA 3OPSA 2IQDA 1CD1B 3TVAA 3H4GA 5AN7A 2YIHA 2HA1A 4O02L 1Y18A 5LGJA 3BJSA 1PF3A 2Y6SC 3WK0A 3DKLA 2WANA 4PJFE 3S0CA 3FMGH 2IQ0A 3B9AA 3O2DH 4EACA 1I7TA 4DGIH 2DTSA 3WNJA 2VLKA 2WC4A 1REIA 3QGAC 3KWVA 2I14A 1YEEH 3C3UA 1SXAA 4GQZA 3EYUL 1NFDA 1QHOA 1IC7H 2ADIB 4C6QA 3HR6A 2FATH 3P54A 4W8LA 3K5RA 3NIFB 3I6LD 3H7RA 4HUWA 5CG0A 3QXAB 2EDEA 4DHLA 1ITUA 3SN1A 2NXZB 3WL9A 3EDKA 1MHCA 1TQCC 4GSDH 1HW6A 5KVDH 3ZLQC 4QSFA 1WWAX 4Z2KA 2F54E 3DVFA 1GZHA 3Q3GA 1BFNA 4ASTA 1FNGB 4NCC2 2ZOLA 4C6DA 1R9ZA 4JNXA 4OZIF 3ECVA 1L4IA 3AZUA 1KGCE 2YGOA 4TUKL 2F53E 4GAYA 2QQNL 2AMXA 2PU0A 4JFEE 2IFFL 4FLRA 3S35X 2GJLA 2YKKA 1WFUA 3MLXL 3QQ1A 1ZSHA 4PLOB 4OGYH 4KDWA 1YMMB 4P57B 3BURA 4MNGB 2X4NA 4IRSD 3HGRA 1JPSH 4NZ4A 3PGCA 4YFLI 5JOFB 3JWOC 1KLZA 2XM2A 4GVHA 3S4SA 4A68A 2HP4A 1SMAA 3PC0A 4YQXH 2GSGA 3D2UB 1EH9A 1UATA 5BVPL 3WTYA 5D8JH 1QKZH 3M6YA 2IANE 1TT6A 3II2A 3MRKA 1AVAA 4UT6A 3DTDA 3G0SA 3FS9A 1PYFA 4M29A 1F05A 2EHHA 2ODHA 2QSQA 1RUPH 1EVUA 1OWWA 2HNEA 4C6JA 2UV8G 3EJYD 3NPXA 4U05A 4ZVJA 3KHJA 3MJ6A 4MNHB 4Y88A 1VGEH 3KVQA 3CUJA 1JBJA 5B3JE 4RNIA 1TA3B 4I0PD 3BYTA 2WMKA 1CICC 3C5JA 1EGJH 1IHIA 1RZIA 3CUGA 4GSRA 3S36L 4ZXOA 1USQA 3HG1B 5CEXA 2YRPA 3HIZA 4FFVC 1MZYA 1FI8C 1Y0LA 4PRPA 3VFMA 4A3QA 4ABWA 3QUZC 2I5YH 5C0IB 1V7NL 1TWIA 3HI1B 3RJXA 4PMRA 3WXWL 4OZHE 4XAZA 4AKPA 3ARRA 5K39B 1AMXA 3HC0A 3AISA 1Z9NA 2Y7NA 2E7FA 5A2KH 1ROCA 3LQAL 1SYSB 3KPLA 3PV6A 4MQSB 3ZKQD 3G9VA 3TTQA 1BPVA 1ICTA 3STLA 3MGAA 4LOUD 4H40A 2HUEA 5ABFA 3XIMA 5EEYA 5DD3L 2C1OA 3KLAA 2DEYX 2WTRB 4F20A 5FYJD 3ISWA 2A0NA 3ARZA 3IVTA 3TN0A 3F5WA 3E6FB 1AQDB 1AQFA 4O0QA 3X3FL 1M1XB 2P44B 4OIBA 2QYGA 2Z9TA 1XYCA 3OG2A 2QSCL 4J1UB 4JQVA 1F3DJ 3MRCB 5ACLA 1O6VA 1YTKA 4I77H 4IDJH 1QWUA 3WDHA 3GE7A 3W7CA 1VSCA 5F9DC 3UCQA 3BZGA 4G71B 5GSVB 4Z6AT 1JVLA 5GNYA 4MCZA 3GUTA 4M6UA 3GNXA 3HVDA 3GSNL 2FL5A 3D39A 2RFGA 2QDVA 3KGUA 4OZFB 4M3JA 1BTCA 3CZNA 1KYFA 5DRXA 4ODTL 5D1ZC 3VFOA 3EH2A 1XH0A 4GBXA 5AHEA 3I84A 3HA0A 3BTNA 3QAZB 3FA5A 2PUQT 3PL6D 1RUAL 5B39A 4NIKB 2BXZA 3QDGD 5HI4C 2PFHA 5DUML 3HM7A 2BSTA 4Z7UA 2OU4A 2QZ5A 4LALA 1PUDA 1LJMA 2WNNA 3X14A 1FVDA 2WMHA 5LYRA 2QPUA 5E2WL 3MFFA 3AMGA 1AXSB 4HPJA 1Z9PA 1SDAB 2W9DH 4AZ8B 3S3JA 1DVYA 3H2PA 4MIMA 4KHTH 3V2AR 4NP9A 2HLAB 4WJXA 2VDQB 3L2IA 1T0PB 1HCYA 4FNUA 2C3HA 5JH1A 3SRFA 4A2HA 3V6ZA 2VDPB 2QMKA 1KR1A 1AZUA 2YK1L 4MXWL 1RERA 4GQRA 5EO0B 4NHCH 1QTPA 1XL9A 2CUMA 1UXMA 3SDXA 4AEOA 4D0DB 2GIXA 2PBOA 2WC3A 2IBBA 3AIBA 4RV8A 4ZUUB 3GDKA 2YAMA 5I18H 4E41D 4GT7A 4ICMA 2CZ5A 1IIHA 5CEZL 4Q9RL 2LLEA 5DJCB 3D0CA 4J12A 4GI4A 3LJ3A 4R97B 5I1GL 2NW2A 3M1CA 2WINA 3F6LA 2XN9A 4FMKA 3W9EA 5TE7L 3TWCH 3QR1A 2X1IA 3CQHA 3ULVE 2JALA 4MDIB 4AGLA 3EEZA 3HQPA 2PCFB 4NAEB 4NAJA 3C60B 3OG4B 4X50A 4LC6A 2RALA 1XB8A 3U9PH 2ADGA 3A4WA 5KVEH 4F7PA 1ME9A 4CW1A 3TXAA 4CGUB 3WK2A 2VDRL 1WKFA 1K4CB 1CURA 2BDQA 3DNKA 1BCIA 1G7PB 4TUJA 4HK3J 4QDWA 2PYFA 1M1BA 2J8UA 3O4OB 1IGFL 5DJ6B 1OAYH 4UV4H 4NNCA 3VFSA 2CHRA 1E2ZA 3QIWB 3W7IA 3GI8H 1ONEA 3R0NA 4ACYA 3WNIA 2E3ZA 1S5VA 5B1JC 4O4YL 3PAJA 3QOMA 4HOWA 4JIEA 1EDHA 3JUYA 3LMJL 1VESA 1QW8A 1HXYB 3C2FA 4D0BB 5D1XD 2MOQA 5C09E 1JG9A 2IH1A 4BWUA 3MBXL 4CLMA 4Z7WE 2X4UA 1I8MB 2HKAA 2V7HB 3C86A 4BINA 3LKQA 4XVDA 3ATEA 3FFCB 1WWBX 1E1CA 2K6ZA 3QEQE 4DJED 1JPTH 3VMNA 4U4IA 2E5CA 4HPOH 2JB5L 4IBQA 4KKCD 4ZQCA 4DWSB 1QLFA 1QFPA 1J7VR 1W8OA 4RKAA 2NQHA 2BOLA 2QL1A 3D5OF 4OUEA 4B16A 2HPTA 3WE6A 1JAKA 1QATA 1MNSA 3IIPA 3NZHL 1RK0A 1FYHB 3HUJA 1JPST 4PTXA 1IIKA 4YHOL 5GGSA 4OF8A 1FDYA 2P5EA 3QDMB 4OV4A 3WLMA 5CILH 3F5KA 3O8XB 5C0CB 4Q97A 4WI2A 15C8H 4CRPA 4BJLA 3QFDB 1OD9A 1UC6A 3A21A 2GEQA 2EE3A 2BSRA 5DURB 3B0XA 2Y0SA 1QSEB 1EC8A 1X9UA 5TBOA 4ODHL 1XH3A 3LEYL 1N68A 5HK4A 3SBWC 4JZOA 3WIHH 4HUMB 1CB2A 4IOFC 4OLYH 2AEQH 2Z7KA 5XIMA 3KLHD 1EEZA 4IKLA 4AQZA 5HR7A 2REQB 3VIOA 3ESOA 1M3JA 2CWXA 3WX7A 3WJXA 4PG2A 4N5EC 3NAAL 1ZKAA 4TOYH 1L9OA 3HV8A 1U3HC 4Z1DA 4PW4A 2J62A 1FLRH 4TXVB 4JDZB 2Y36H 3KHOA 3W37A 3TSBA 4JZNB 1EV2E 4RE0A 3MBEB 5D1ZI 4BF5A 3T2QA 5TDPA 1HJWA 4P05A 1KM6A 4ORMA 3WFDL 5LBSH 4QTFA 1ZAIA 4FYQA 5TQ2L 4JFDA 2JI2A 4HG4K 5B38G 2VM4A 2MPVA 5KN5A 2K8QA 3MI6A 2JELL 4JQ4A 3ZZLA 2DQEL 2ZXDA 3EB2A 5E1IA 2YD7A 4ODSH 3EKZA 1UB5A 2QFRA 4MAZA 4X6BA 1EYWA 4TTGA 1XL4A 1XTLA 3HAEH 5HNUA 3RDTC 1IGSA 4XQ6A 2INEA 2ZCHH 4JKKA 2OLDA 2NW3B 4MMXB 5K9OB 1YNTA 1R9FA 5EBAA 4UQ2B 1VB9A 3NTYA 5EOQL 4N0YH 4FQXC 4P06A 4GUPB 4QRSB 3NBNA 3FO0L 5K59E 2DP3A 3UJFA 1RU9H 2CO4A 3BQ6A 4XP9H 1M2VB 4LSVL 2P50A 3RG6A 3FHAA 3O6LL 5FOJA 4CNOA 5TTRA 5IB4A 1HTYA 3WO3B 3G8RA 4LEEA 4PTTB 1DJWA 4A8IA 3KYOB 1IZKA 1DYSA 3UAEA 1R3KB 4GFSA 1EFXD 1NWUA 1S7SA 1F3DH 4O16A 1BYOA 5AC8A 3FSZA 4PRWA 1DBML 1NCTA 4J4PD 2GY7B 1ZE3C 1FHLA 4R7OA 1LT7A 2JH2A 4C56A 3QI9D 1AGCA 2R1KA 1KBWA 4NQXA 1EQPA 1UP0A 4PL2A 4R7DA 3BKML 5SV3A 3IFNH 1W72H 1UWRA 4A6YA 1FL3B 3MMTA 3SY1A 1NDGA 3ZK0A 3FUEA 1D6VH 3QFJA 2QEZA 3KBWA 3OZPA 1GKOA 1JPFB 5FV2A 3ZBMA 4WXZA 3BXNB 4G7RB 3PTKA 4MB3A 4FXLA 3T9WA 2BGSA 4IQLA 3SYCA 3RJOA 3KJ6L 4NQDE 3IJYB 3O6FA 4E2DA 1XP3A 4TQEL 1X5IA 1GGUA 4KITB 5CPSA 4AM0Q 2J7LA 4OD1H 3M1BA 5C0BE 2Z93B 3QWOA 3TO4D 4GQ9H 3W57A 1OCCB 2VEKA 5F6HJ 4B9CA 2P80D 1RIHL 5I30L 3VGHA 1BZQK 1BZOA 3DTXA 2WLIA 1RXLA 4KTEH 3WN6A 3FEQA 1K9TA 4B60A 3E9TA 3D3VA 4BKLA 5E9AA 4CDGC 2CJUH 5ECUA 3WI9A 3VXOB 1BRLA 3UZVA 3BW4A 4DPCX 1U8OA 2ZZ5A 2NTFA 2CDGA 3NXLA 4BHUA 3FH5A 3W0KA 1XR8B 3FHEA 5EFDA 1Z5HA 4N2OA 3SN0A 1W37A 4LU5L 2OK0H 3E3QC 4FXGC 5EPMA 4LB8A 3CFMA 2J8GA 3M1ZA 3AFBA 4MNQE 5DEZA 3I10A 2GJJA 3US1A 1JCKA 4LCSA 3QIUB 3MKCA 3BDBA 3I02A 4G43A 4WV1A 3K2UL 1TQSA 1JZGA 3MUUA 1LWRA 1U93A 2DQUL 1DBAL 1T1ZA 2ZYRA 3RKDD 3ULUC 4X22A 1KENL 4MJZA 3MNWB 1CZ1A 2XU9A 3PDGA 3EZJB 4K3DH 1NDWA 2HZGA 3WN5A 4MZYA 4F8LA 4JN7A 5HJDA 2Z34A 3L45A 2GI0A 1QFWM 3TU6A 3M7SA 1RK6A 1EO8L 4PVMA 5ENWA 2JFEX 5IT2H 4Y4FA 3WD1A 3N06B 1TFVA 4P4RA 1UVQB 4ERSL 3KCWA 2QJNA 2DPEA 3T4WA 4B0MB 1QABA 3RHWK 4YDNA 1UB6A 4TSAH 3MJMA 2NSXA 4EAEA 2V7NB 4LCYB 3U1PA 3GZKA 4TMCA 2BZ7A 4FGMA 1T7ZA 2QT6A 2ENQA 1GOWA 4PY7B 4P2RB 1NGWB 2AJVL 3JWNH 4TXEA 3D85A 4MOZA 2VDGA 4EKXA 5FO8A 4NHUA 4GG8A 3L7FB 3F1QA 3FSOA 4N1EA 4ZBJA 3GXPA 5EMJA 1QPRA 2Z7WA 5ICYB 1GYMA 1D5IL 1U8CB 5DYOA 1J05B 4OQTL 2Q86B 4NO0B 4ONVA 3PAOA 4PCTA 4AYDC 1DQDL 3SGJC 1CVRA 1W2KT 3QPKA 5GRUH 2J1KA 3H4HA 1VBJA 5BUPA 1W6LA 2M1KA 2ITDA 2V8ZA 2PRMA 4RDQF 4GAGH 1DJZA 3EOEA 3LI0A 4QOKD 4N86A 5D2NE 4JTDA 1PBYA 3LH8A 2ALWA 4CILA 1W1ZA 2BOCA 1HE8A 2HWZL 3DIVA 5A2AA 3SDYH 3BKCL 2XSXA 3O6AA 4MHBA 4PCNA 4JBSA 4YTRA 1ENUA 2X0YA 4MZIA 4DK5A 3EWUA 3AU1A 4HK5A 2MPAL 2FIRT 1E5YA 1SVDA 3A3HA 2QJMA 4JPSA 2ZPKL 3ME3A 4IRJD 2DH2A 4PI0A 4MJIB 5GHWL 4NL1A 3LMYA 3TZVA 3WH7A 2YBVA 1WEJL 1L9RA 2XZCH 4ENZA 1UZ1A 1QFUH 1ZBWA 1D5BB 1EKOA 4A2FA 2EZ0D 4NNXB 3VWJB 4JR9L 1P4BH 3ELQA 1DDHA 2DRUA 3GMRA 4PBXA 3U0PB 4OGQC 2C3WA 4QLLA 2IQAB 3HZYB 1H51A 5DGRA 4WK0B 5LCVH 1P1ZA 5ACZA 3UF9A 3QUML 4RFOL 3I50H 4N9CA 5GIRB 3WDRA 1NMCB 2X4QA 3QQNA 4YTQA 2NWSA 4IPJA 3OX8A 4XNMA 1OFQA 5E2UH 2J24A 2E59A 2HROA 3V5HB 5KVGH 4HETA 3MRMB 5IFJA 1SGKA 1DUZA 4PHZA 1UUQA 4BCZA 1DWGM 3QULA 1UCTA 4M81A 4KH2A 1EMTH 2ZX6A 5AYYA 3MOAH 2GEEA 4ZUTA 5FX3A 3GS7A 2G37A 2D3LA 4UFLA 2AL1A 3ULVL 5M95B 2BWIA 3HFMH 3K13A 4ZMGA 1WAAF 3HQ1A 4ADSA 4I18C 1I8JA 1XXDC 1SHSA 4Y1AB 4R8WH 1UJ3A 5KW9L 4A29A 2O72A 1JTPA 3MGOB 4I3RL 1PZDA 2WAQA 3T4AC 3U7WH 3UTTA 3RY6C 1E9QA 4Q2ZA 3B3DA 4RDVA 4HPNA 1NMAL 4H44C 3VKKA 1MFVA 4XVOA 4A67A 1G4TA 3P02A 2P5WD 1UM6L 5C86A 1B4KA 2EJAA 2Z31C 1OB0A 4RWYH 2HJLA 1O7AA 4KROD 2E9WA 2PYEA 4Z7AA 2EEAA 3EWWA 4B2DA 4FABH 3Q5OA 1TV3A 4AZBA 4NWUH 4HT3A 2TYSA 3GSXB 4G3YH 2V2TA 4Q8BA 2CHXA 4GB9A 3CX2A 3KVJA 3OVPA 4PMXA 2NUYA 1FH2A 1BEXA 2IV8A 3ZHDA 2AV1B 1NL0L 3S37X 5KBNC 3T6XA 2AXGA 2W91A 3KM2A 2JMRA 4ALAH 5IVOA 1YBQB 2EDJA 4EAYA 4CD7A 4KQ4H 4LSQL 1FDLH 3TSMA 5E5RB 4KPHL 2VTFA 3MLZH 2M8XA 4YSPA 1YPIA 2ZRWA 2NUWA 3FOMA 2G0WA 1Q6QA 2WLZA 3CBWA 2B3RA 2X9WA 5BOJA 4W9HC 4XPBL 5BS0E 1THCA 3LCHA 4OCYH 3G6DL 5GS0C 5D30A 2UX7A 3CH8A 4XPAL 5BXPA 1P7TB 5EKYA 3VM5A 3FCSA 1P7KA 1Z69A 4YEEA 3RVVC 5CD5D 2XVNA 1HCZA 3RBGA 4XXWA 3R8RA 3QEHA 1FBIL 3NQ2A 3CHRA 4A2MA 2W6RA 3FGCA 4TTUA 5I3DA 3GSUA 3P5YA 4C5ZA 2BG5A 4IHOB 4UTAH 5I76A 3TR2A 1M9WA 1P9MA 3Q65A 3B04A 3MLTB 3EBGA 4DP1X 1ECZA 3MMDA 3DZ1A 2A4ZA 3BGFC 2IKGA 3IFPA 3GK8H 4PV8B 5E6YA