1XH2A

Structure of the n298s variant of human pancreatic alpha-amylase complexed with chloride and acarbose
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 175
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xh2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xh2A01
2VC9A 4W5UA 3WUFA 1UR8A 4NZCA 4F8XA 2GK1B 3WDQA 2DT2A 2EPLX 3T08A 5IHSA 1V3KA 2VZOA 2G3IA 2DEPA 2WVVB 2D1ZA 3TTSA 5CLTA 3AZTA 2J25A 3W6LA 5A8OA 2XFFA 3UERA 3ZM8A 4LYQA 2XPKA 3NIYA 4D6HA 3BVUA 3VOCA 1J0KA 3VTRA 2F1AA 1RPKA 1WDQA 1WZAA 1JF6A 4P8UA 2HISA 4OBSA 1R46A 1M04A 2EJ1A 1CXLA 1KWGA 3BUQA 4B9YA 1B3YA 1RP8A 3W25A 3AIWA 3RPMA 4B9ZA 3WMSA 2J78A 2JALA 4PTVA 1MQRA 1W3KA 4OGZA 2WSKA 3FNDA 2DIJA 1LJYA 3F5LA 4U31A 3WDIA 1H5VA 3OZOA 1J10A 1M03A 4PSRA 2PBGA 1BF2A 1GOOA 5ECUA 2X8RA 1W3LA 2CESA 1PIFA 3GXFA 4KMQA 3PN8A 1XYZA 5A8MA 3VSUA 2D23A 2XSAA 1HJVA 1W91A 3RM8A 2F18A 3N13A 1G0CA 3U5YA 3WDRA 3N9KA 3MUIA 1QHOA 2VX5A 2PBOA 4ZXLA 4NRRA 2ZX6A 2CBJA 1C93A 1W9PA 5IFPA 5A6KA 3VGBA 3WBEA 2BV9A 3VX0A 1Q6CA 2DGAA 2QV4A 2MANA 1OD0A 3BCDA 1FFRA 4W88A 3CUGA 4HPGA 3AMGA 3VIPA 2JEPA 5EFDA 5A3HA 2GUYA 4UQDA 4C7DA 1E0VA 4W7WA 2F7QA 3WNMA 4WK9A 5CG0A 2VL4A 3D52A 3DYMA 3L2LA 1DP0A 4GO9A 3GBDA 2Y5EA 1V02E 4AD1A 1ZU8A 3MKKA 1US3A 1FOBA 1UOKA 1BYAA 1WKYA 4B3KA 1UR0A 5E0CA 4B15A 3WQWA 3BCFA 1QI0A 2J79A 3DX4A 2WMIB 4R5EA 1VBUA 5A6BA 2WBKA 2WPGA 5ABGA 3UR7A 2PWGA 4HZ8A 2WC3A 4DWSB 2WLYA 3CHDA 5DEZA 1CZ1A 1WDSA 1GOKA 4X9YA 3M7SA 5D4YA 2WB5A 4XUYA 1GNXA 2J4GA 3A6OA 3BLPX 3ZJ6A 4Z2LA 2X09A 4NSBA 5ABEA 2WHMA 3OBAA 3NDYA 4HU8A 2QPUA 4B16A 1UH4A 3SCQA 2V3GA 1UWRA 4DM2A 2UY4A 3D50A 2FH8A 4Z2IA 1B3XA 5JIPA 2ZUVA 4Z2KA 2QF8A 1GQJA 4UTFA 5D8ZA 2A3AA 4J3TA 5I0DA 1HXJA 1JNEA 4U33A 4P7RA 1EH9A 5I24A 4H8HA 3BLKA 2C7FA 1JG9A 1OD8A 3BAJA 3O6AA 1QNQA 2V3DA 3K4DA 1TQUA 1UWTA 4HA1A 4HOZA 5CZKA 2J7BA 4RE2A 3K1DA 5BXSA 3FHQA 2GSJA 4M24A 3IJ7A 3ARXA 9CGTA 4AZGA 1D3CA 4A3HA 4J3UA 1TR1A 1VF8A 5DT7A 3AMKA 5HNNA 2WK2A 3LXBA 4JIEA 3B9AA 4U2YA 4AD5A 4GXPA 1Z32X 4W5ZA 1EO7A 3WSUA 1C8XA 1BG9A 2ZUTA 4QLLA 2FYVA 2V3EA 2DQXA 3OGSA 5BRPA 2Q8XA 3IGUA 1B9ZA 2GJXA 4PMZA 5GNXA 2OWCA 3L4XA 1DEDA 2YL6A 4ATDA 4C7GA 4JFUA 4TVDA 1KR0A 1BTCA 3AMCA 1NARA 4QAWA 4WSJA 4CCDA 4ATLA 2XTKA 4GI6A 2O92A 3AS3A 4LGXA 3CUJA 3MANA 2DSUA 5DFAA 2Y4SA 1UR9A 2DT1A 1Q6DA 3OLEA 3GYCA 2WM0A 1V0LA 1BYCA 1GHRA 1IT0A 3T0DA 3NDZA 4CN6A 1JGIA 1ZJBA 4GI9A 3WFLA 4NF7A 1CLVA 1HL9A 5KEZA 1MW0A 3HG4A 3HN3A 3TOPA 5FL0A 3ARWA 1PEZA 3PZIA 3M46A 1QPKA 3BVVA 1V3HA 2BS9A 2G41A 2EABA 2ZUNA 2EO7A 3MI6A 2WYSA 3UESA 1NP2A 5I79A 2G3JA 2G3MA 4AC1X 1LG2A 2E8ZA 3VMNA 2CCRA 1GQLA 3OA5A 1BGAA 3N18A 3IJ9A 5BROA 1MFVA 3SEPA 1C7SA 4K68A 4DO5A 3CH9A 2UY5A 4D6FA 2X2YA 3BAYA 1EDTA 1ISYA 4CU8A 4MDOA 3GXPA 1VIWA 4H7VA 1C7TA 4N42A 2EADA 1CXIA 4XZBA 1M01A 1UKTA 5D9OA 2WCGA 2DIEA 4S3JA 1SYTA 3ARQA 2XSBA 3L2MA 3CGTA 3CIVA 3QHOA 2YDSA 3LRKA 1QW8A 2VOTA 1LL7A 3AOFA 3DYPA 3AMLA 3ZT5A 1IZKA 1NP0A 3ARSA 3GNRA 1HN1A 4D1IA 1KWKA 3WD3A 4DM1A 2UY3A 3SUVA 1W32A 1GOQA 3VGEA 4HZ7A 2GJRA 3LPOA 3JUGA 5BXTA 5A2CA 3T0BA 4JL1A 3W37A 2QMJA 1UWUA 1E4MM 3KLLA 1DWGM 3EYPA 3II1A 3WNPA 1CWYA 2WZIA 1XD0A 1JYXA 4NX0A 1CGUA 2XN1A 2EPKX 2W67A 1ISVA 1V6VA 3CZEA 1KR1A 1E71M 1Y7VA 3ARVA 1MQPA 4UFMA 2WWCA 1GHSA 2BVYA 2CKSA 1NOWA 3BXWA 1C8QA 1NOFA 1VJZA 2WZEA 2PB1A 4KRUA 2ZXBA 1NM9A 1GOWA 3PTMA 1V0KA 4ACZA 1X1NA 3T09A 2BY2A 5A94A 4RL3A 4MB4A 1E4LA 4UFKA 3ALFA 5D9NA 2WSPA 2WMKA 3SUTA 1AQHA 1V6XA 3K4AA 2WHKA 4NI3A 4ACYA 3ZR6A 3WEMA 2GJPA 4ZFMA 2NW0A 1V3JA 4YHEA 2DSZA 3ZT7A 5HXMA 3GTNA 5F7UA 5A1AA 2Y8KA 2PI6A 3FY1A 5ABFB 1XH2A 3AIQA 1XV8A 2F7RA 4GI8A 1HKMA 3WMBA 3AICA 5I77A 5AC5A 3VD4A 1FH7A 5IXEA 1JXKA 3WH6A 1LQ0A 4UOZA 1KCKA 5IFTA 1UKQA 3BAXA 3LPFA 4CGTA 3UG3A 1W9VA 1G5AA 5HBFA 1FHDA 2HVMA 4GQQA 3HMCA 3SCWA 4D6CA 3AS1A 3RILA 3EJQA 1AMYA 1V03A 5C70A 2BY1A 3VGFA 1KGXA 3D51A 3UG4A 2XVNA 3E1F1 4UFLA 3DX1A 4E8CA 2WCAA 2W5FA 4HMCA 2C0HA 3BAWA 4UQCA 4MAZA 8CGTA 2A3CA 3VINA 3WDPP 1UD2A 3QOKA 1E40A 1KTBA 3W29A 3MMUA 4DUXA 5CPSA 1KBKA 1V0MA 1CGWA 3RJXA 4MTVA 3L4UA 3K8LA 2VVSA 2FGZA 3U7VA 4BA0A 1VEMA 1Q6EA 2ZWYA 2VX7A 4ZXOA 3A21A 4LPCA 1BYDA 1SZNA 3N04A 5DMYA 2WBGA 2YA2A 5D9PA 1QWNA 2J8GA 4W8BA 1X6LA 4UQEA 3VX1A 3SCNA 2D0HA 4GIAA 3W6MA 4AD2A 1G1YA 3OB8A 1QWUA 1BHGA 2X1IA 3ECQA 2E3ZA 4Y7EA 1EHNA 2RGMA 2TAAA 3OLGA 3B9EA 1ZB5A 3VNZA 4ATWA 1V6YA 1H4PA 1H49A 1QBBA 2OSYA 1SMAA 2XVPA 1B3VA 1NWUA 3M6DA 5GNYA 3ZQ9A 5FCZA 5E9AA 5CSYA 2YLLA 1W9XA 2QMKA 3ARZA 4HA3A 4PUDA 1OCQA 1E72M 4CN1A 5IHRA 1VB9A 4LYPA 4U5KA 1K6AA 5BRQA 3VDBA 3KE0A 1D2KA 1SFSA 1OT2A 2J7FA 2GJXB 3W53A 1ISZA 1TQSA 2WVTA 1XC6A 2X0HA 4GINA 3AHTA 3RDKA 1GQIA 3VGGA 5E6YA 2Z1KA 1UH3A 3LPGA 3SCRA 3VU2A 4FLQA 3CHFA 5A8PA 3HG2A 3MU7A 2DSWA 3HJEA 1E3ZA 1ODZA 4M82A 1QX1A 4J3XA 1HIZA 5E0FA 5E6ZA 1H2JA 1PPIA 4X0VA 3ZR5A 1D7FA 1MYRA 4M80A 1CNVA 5M5DA 5AYIA 1ZL1A 3BUDA 4TX8A 1L8NA 4TOQA 2V5CA 5FKYA 3RM4A 1ZJAA 1OM0A 4EAMA 4MB1A 2IXUA 4UQ9A 2WVVA 5EBAA 2WHLA 1CXFA 1TQVA 4OJYA 1EOMA 1QI3A 4TTGA 1GORA 3UG5A 4AZ6A 4J7RA 2J7CA 2VO5A 1JNDA 1KBBA 4U5IA 4M8UA 1E6NA 3AXXA 3HZ3A 5A8QA 1R34A 2ESCA 2XM2A 4HMDA 8A3HA 3GM8A 3EDJA 1E6SM 1FP8A 1UKPA 5JBFA 1B30A 2ZOXA 5DF0A 2ZUWA 3G6LA 3ARTA 1KQYA 3GXDA 2IUZA 4HU0A 4DUWA 4AIOA 3VD9A 2Y24A 1C91A 2CETA 4PRWA 2WMHA 1QW9A 3M07A 2Z1SA 4CCEA 3AFBA 3VKKA 5IDIA 2YL8A 2J47A 1FH9A 5DO8A 4D72A 2J7EA 2YFNA 2W92A 5HPOA 3CTTA 2W66A 1V3LA 4N0RA 1C92A 1F4AA 3VIMA 1G01A 4EK7A 1JYVA 1E70M 4EKJA 5CXPA 3WDHA 3GXTA 1E1EA 4M81A 1E0XA 2BY3A 1LG1A 4DWSA 4Z2JA 2XVKA 3TONA 4AD3A 2CBIA 1MXDA 1QVBA 2CKRA 3W27A 4P7OA 1HJQA 1CPUA 3A4XA 1B3ZA 2GDUA 2PF0A 3ALGA 1CXKA 3SCOA 3VDHA 4S3KA 4P7NA 2D3LA 3VSVA 2VCBA 4QCFA 2O9TA 1XSKA 2ZXAA 5M03A 3LXCA 3RM9A 4J28A 4AMWA 1O7DC 1EDQA 2CEQA 3GBEA 3QHMA 1QNPA 1LWJA 5A6JA 4PMYA 4P8VA 1IV8A 3AS2A 1N82A 1L0PA 1JXJA 1TZ7A 4PMQA 4P8WA 1JD7A 1GUVA 1EDGA 3VM7A 2FE0A 3L4TA 4CU7A 4BCEA 3WENA 2OSXA 3CZGA 4MB3A 4FLOA 3VNYA 1QOXA 1M7XA 3CUIA 2CERA 1JDAA 2VX6A 4BS0A 1UD6A 2JFEX 1RP9A 1MW2A 3AHZA 3I3DA 2XUCA 1JDDA 3UEQA 1LL4A 3RMEA 2IXVA 2WMIA 2XGIA 3VIOA 1S46A 4OBRA 1UR4A 5CSUA 2G8ZA 3D4ZA 1ESWA 1H11A 3APGA 3BMVA 1TA3A 1DHKA 1JI1A 3EDKA 3IJ8A 4IISA 1HJUA 1SMDA 1OIMA 2F7OA 2D0FA 3AROA 1NWTA 3PZVA 3W38A 3VIHA 5I78A 3CV5A 3WF4A 3DYOA 3CZNA 1GJUA 1DWJM 4NXKA 1GPFA 4WKHA 1JL8A 1UZ4A 2VQUA 3GH5A 3BC9A 1HXKA 3OIHA 1VFUA 4ML4A 2YBUA 1E4IA 2F61A 3RCNA 4V2XA 3K8MA 1WE5A 4Z2GA 4AEFA 5CGMA 3AJ7A 3WUEA 1LF1A 3L4YA 1E56A 3CZKA 4W86A 3WEZA 1CGTA 4LX4A 2XFYA 3EJSA 4HPHA 1OGSA 3MMDA 3IAPA 3KL5A 2XHYA 3WN6A 3BLBA 3BSHA 4JL2A 1QHPA 5EB8A 1HVXA 2AAAA 4UZSA 4HP5A 2C8NA 4H8UA 1OIFA 4D6IA 1W9UA 1AQMA 4PMDA 4D6JA 3PHAA 4RE4A 3H54A 4PUEA 3A22A 4JKLA 1JFHA 4UZUA 3MUAA 3AXIA 1W2PA 1H41A 5D9MA 2VRKA 1HL8A 3SCUA 4GZEA 1PX8A 1R86A 4D6EA 4HOXA 5A6LA 4CCCA 3VUPA 1ITCA 4UFHA 1GVYA 5I2UA 1CGXA 1EO5A 1ODUA 1VRXA 4L4PA 1TMQA 2NT0A 4AZIA 4PMXA 4AW7A 1PX4A 2WKGA 1FFQA 3AMDA 3ZJ8A 4L4OA 2CYGA 4H8VA 4KWUA 2O9PA 3T2QA 1BAGA 2BXYA 2XFRA 3S5ZA 3WMCA 5JBEA 2WMGA 2XJ7A 1J0JA 3VDCA 4H04A 1I1WA 4W8LA 5A95A 3VIFA 1E5NA 4HTYA 1B90A 3SUWA 4D71A 2YBTA 1ISXA 3LXAA 5LA0A 4AMXA 2VZVA 4WF7A 4NZJA 1HKIA 4NRSA 3EMZA 4KGJA 1ZBCA 3O9NA 1ECEA 2BVDA 1O6IA 4W7VA 3EMQA 4J3SA 1HT6A 2F2HA 1J12A 2ZE0A 1JZ8A 2JEQA 1HJSA 1JYWA 1B31A 5A6MA 4E4PA 1TVNA 2NT1A 2VRJA 2RGLA 3WD2A 1JZ3A 4AZCB 3VDAA 1ZS2A 4LYRA 3BSGA 1B0IA 4UOJA 3WQVA 1U2YA 4H2CA 4D1JA 4MAVA 3WF1A 2XIIA 2BHUA 2OW6A 3D3AA 2YOCA 2JF6A 4WIWA 4GZIA 2J62A 5CQ1A 2VJXA 2VMFA 1J11A 3WL0A 3VGHA 2W62A 1GJWA 3PZ9A 4UFJA 5BYWA 3EDEA 4CD8A 1B3WA 3EDDA 1US2A 2XVGA 3UETA 1FHLA 4CN4A 3VPLA 5KZ6A 4PTXA 4W84A 3VIJA 1GZJA 3NYDA 5FOOA 1JI2A 4E8DA 1W2VA 2EPMX 3I3EA 4DO6A 2ZXQA 2EXOA 1XGZA 3CZ8A 2BY0A 1C8YA 1ZBVA 2XVLA 3IAQA 3U57A 1U33A 2ZXDA 4GPNA 3UR8A 2D2OA 2YLAA 1W1YA 4PCTA 3HG5A 3EJRA 4HOWA 4W8AA 1R75A 3S6TA 2F8QA 3GXIA 4PMOA 4QCEA 5M3WA 1G9HA 1E1FA 3ZMRA 1FH8A 2JIWA 4AY1A 3WELA 1TFVA 2XYLA 1VEPA 1HX0A 4J3WA 3MUY1 5LA2A 4IUGA 4F9DA 2WZHA 4OIFA 2CITA 2J7HA 3DC0A 3H55A 1CECA 1E0WA 3L4VA 4GQRA 4CUCA 3WY1A 1HWWA 3VD5A 3BGAA 3WQ5A 3WNNA 3WFZA 1C90A 2VZUA 4QP0A 4F66A 2WLZA 3DX2A 4QFUA 1JZ7A 4FMVA 4D6DA 1K9TA 2YL9A 1UUQA 4AISA 3KWXA 1JD9A 3F5JA 2YIHA 1WPCA 3H53A 4TVCA 1QI5A 4FNTA 4DO4A 4JFVA 2FHCA 4AZ7A 3O2LA 4U3AA 4AZ5A 3AIRA 2PWFA 3AHVA 2JF7A 4JHZA 5ABHA 1HJXA 1E15A 4MDPA 3EJPA 3ARPA 1J9YA 4HA4A 3AS0A 1TQWA 3I3BA 1Q6GA 1VJSA 2VURA 2DH2A 3RO8A 4BQ3A 4B3LA 2YA1A 3N15A 1WAWA 1QI4A 4TXEA 2VI0A 2E8YA 1EQPA 1K9EA 1R7OA 1UD4A 2X0YA 2PC8A 5C71A 1DTUA 5BCAA 2ZX5A 4BF7A 3OZPA 5A6BD 5LA1A 1UWQA 1KQZA 3BUPA 2WHJA 1Q4NX 3SUSA 4P7QA 4AIUA 3HG3A 3WEOA 1UKOA 4JKKA 1R87A 1V6WA 3CUFA 1GONA 1VAHA 4PMVA 3BUBA 2BXZA 4RE3A 1CGYA 1W9DM 4PN2A 3VMOA 5HDRA 3RJYA 4DWSD 5FD0A 1NH6A 1YHTA 3F5KA 3N17A 2VCAA 2XWDA 1UWIA 3GH4A 1KGUA 2Y8VA 1E6PA 4V27A 1UG6A 4CD5A 2GK1A 3FHAA 4D6GA 2BHZA 3T2OA 2X2IA 3ARYA 1TE1A 1W3HA 3WUGA 2EACA 5GQBA 5I6SA 2ZX8A 5LYRA 3DECA 2B31A 3FAWA 2EEXA 4AD4A 4JHOA 1UR1A 5GPRA 3TTOA 1K9FA 4J27A 4UNIA 1CTNA 1HJWA 3LRLA 3SCPA 5I23A 2V38A 3AHYA 2VTFA 3WH7A 1KCLA 2WVUA 3GNPA 1MW3A 1V08A 4PYSA 2W91A 5C8BB 4CVUA 3VIGA 2J77A 1O7AA 3WQ8A 3VO0A 4MPKA 1H09A 3K8KA 5CPTA 4YN5A 4MB5A 1W9BM 1E6XM 1G94A 1DWIM 4OOZA 4TUFA 5AC4A 1AQ0A 1E73M 2QHAA 3GDBA 1C3FA 1W3JA 1V3MA 4MNKA 1KB3A 1E9LA 1WO2A 2OYMA 4Q22A 3SURA 1JZ4A 2WCSA 4F79A 1KFWA 2D73A 1H3GA 1UD5A 3BUIA 1WDPA 3A5VA 3TA9A 3AXHA 5A69A 3FN9A 1VFMA 4GO8A 3PBGA 2DH3A 3DHPA 3SUUA 1BVZA 3QOMA 1HVQA 2O9RA 4AZBA 1PIGA 1OGGA 4UR9A 6CGTA 3T0AA 2D22A 3WNKA 1LL6A 3CBWA 2BHYA 3A3HA 2Y2WA 4W85A 3POCA 2UWFA 5I3DA 2F7PA 4IPNB 4Q7NA 4M29A 1DWFM 3W24A 1MFUA 5CJ5A 1UD8A 3GNOA 4PMRA 4J3VA 2CBUA 1BGGA 3GXNA 3WY3A 2JE8A 4ZENA 1PBGA 2FGLA 1A47A 1ZBWA 3ZOAA 4PCSA 4TVUA 1JAEA 2E4TA 4URIA 2GVYA 4MNJA 2OW7A 3IANA 3VIIA 2OWXA 3N12A 1WDRA 3QHNA 4WLCA 2VZSA 2WANA 1V0NA 5EFFA 1UHVA 1J0ZA 2DDXA 4DUVA 4WKFA 3VMPA 3F4VA 4PSPA 3NSNA 2WC7A 4FK9A 3W82A 2J75A 3CUHA 4V28A 1EHAA 1ISWA 1MW1A 4UQBA 3DHUA 1V3IA 1UR2A 2VUYA 4AXNA 4BQ4A 1CLXA 3PZMA 1BVNP 1RH9A 3EBVA 4P8XA 1W1TA 1W1VA 4FNPA 3CC1A 3WF2A 5BXPA 1EQCA 1XH1A 3WD1A 5AYBA 3VVGA 1HTYA 2DSKA 1R85A 2XGBA 3A23A 1DWAM 4UOQA 4JCMA 7CGTA 1UQZA 1V6UA 1A3HA 2BFGA 1QNRA 2XN2A 3N11A 1UH2A 3GH7A 2A3EA 3TTQA 1HNYA 2EAEA 4JCLA 3AZRA 2ZICA 4PMUA 4X0NA 3GZAA 1CXEA 6TAAA 4ZE4A 2GFTA 2WKLA 1MXGA 4CKQA 4EANA 1XRVA 2YKKA 3VIKA 3WBAA 2ALWA 4PBGA 5E70A 4NXSA 3VGDA 3BAIA 4WSKA 1J01A 4U2ZA 3A4AA 4ZEPA 3ZJ7A 4MNLA 5E09A 1CDGA 1PJ9A 2VCCA 3MSDA 3W4RA 3WL1A 3RIKA 1JIBA 4JZ5A 1JYNA 2XM1A 1QI2A 2WNWA 2ZWZA 1EIBA 1VENA 4AYSA 2J7DA 2QPSA 1CENA 3AZSA 2X05A 3NJ3A 2V3FA 1OB0A 2J8FA 2QLYA 5HPCA 2CXGA 2EQDA 4MJ4A 2VZTA 3PZUA 3OG2A 3D4YA 5A6AA 1R47A 1TQTA 5DT5A 3WUBA 1OGBA 4QLJA 1XD1A 1PZ3A 4WJXA 3CHCA 3T2PA 2GDVA 5CLWA 1M53A 4UQAA 1EOKA 2VX4A 4UCFA 7A3HA 1XHGA 3MMWA 2DPEA 3UCQA 3MV11 1UZ1A 3PTQA 3ZT6A 1FA2A 2E9MA 3CZJA 4AIEA 3KL0A 1ZBKA 5ABFA 2FH6A 4JFSA 3IK2A 3WY2A 4XB3A 3WD4A 2ZUMA 3LMYA 4OZOA 5CPQA 3EDFA 3CZSA 4DWSC 1WP6A 2BNJA 3AQUA 3N1AA 2VQTA 2WWDA 2W4XA 2ZX7A 3L4WA 1TG7A 4W7UA 2WVSA 2D3NA 1UA7A 1P6WA 1XSJA 4OUEA 1YQ2A 1JFXA 1GOIA 1H0GA 4YHGA 3ZIZA 3AI0A 3OLIA 4A4AA 4UFIA 2CHOA 1WZMA 3TP4A 3TTYA 4IPLA 1WZKA 5A6SA 4GZJA 4JFWA 2E40A 5FIPA 3WH8A 5TD4A 1J18A 1CIUA 2UY2A 5EMYA 3WD0A 4AD0A 4GKLA 2YL5A 1MWOA 2XWEA 1XCWA 2VRQA 1KXVA 4M1RA 2WXDM 4CVWA 5JUVA 4FNRA 1I75A 3GXMA 1TCMA 3DDFA 3LX9A 2EBNA 1GW1A 2OYLA 2VT0A 2PWEA 2E9LA 4KGLA 4WKAA 5M17A 5JIWA 1EXPA 1FP9A 2DT3A 3OGVA 2CHNA 1UD3A 4CD6A 1EA9C 2DT0A 1TVPA 4F9JA 2FDMA 4KRTA 4TTUA 3WH5A 1E3XA 1KTCA 3PZGA 1JDCA 5HOSA 3SIMA 3BH4A 1F4HA 3K46A 1KXHA 1PX3A 4H41A 3NUKA 3A47A 1E6RA 3ZSSA 2XG9A 3PZNA 1UKSA 1B2YA 3AHXA 4C7FA 3AIBA 3B8SA 4A3YA 4AZCA 1UYQA 3FAXA 3THDA 3MS8A 2VR5A 2YDQA 3PZTA 3MUZ1 1XH0A 3BAKA 1CBGA 1QBAA 3NCOA 2ZIDA 5E1QA 4YPJA 2J7GA 1ITXA 2X2JA 1HKJA 1OSEA 4QLKA 1HKKA 2OYKA 1VBRA 3WDJA 4AZHA 2G4FA 3ZO9A 3WNOA 3KEHA 2X2HA 2YFOA 2ZUUA 2F1BA 1BFNA 2CNCA 5A2BA 1OINA 3CO4A 4JFTA 2IGTA 2OSWA 1CEOA 2NSXA 2PWDA 2D0GA 1TUXA 3PZOA 3DX3A 3D5HA 1XSIA 3FXYA 2V5DA 1NQ6A 1KXTA 2WC4A 4U3CA 2XIBA 1HP4A 3HU7A 3DDGA 4AMCA 1UASA 2AMGA 3CZLA 3LRMA 1JZ5A 4W89A 3B9DA 3QR3A 4IM4A 1J0HA 1NOUA 3WNLA 3MSGA 5BWFA 3NSXA 1BLIA 4P7LA 4JKMA 1W1PA 4FNSA 2FHBA 3OGRA 4KH2A 3WQ4A 1QNSA 1WNOA 4CD7A 1K9DA 5GNZA 5A2AA 2YJQA 3ZSTA 3AIUA 3U5UA 1SR0A 3WIJA 1I1XA 1LWHA 4LXFA 1XYFA 2VR4A 2WW5A 4CU6A 5AY7A 1GOMA 4XV0A 3L4ZA 3A4WA 2XN0A 4JAWA 1U30A 3J7HA 4HZ6A 1VFOA 4BZYA 7TAAA 2CBVA 1UQYA 1UA3A 3VILA 3BVXA 2CIPA 4M56A 4TX6A 3SCVA 1E4NA 2A3HA 4Z2HA 1OT1A 1HP5A 4W87A 1OWQA 5I5RA 1DWHM 2D20A 4E2OA 1E55A 1Q6FA 4FLRA 1UWSA 2FHFA 1CXHA 3PTKA 4HMEA 1BYBA 2D24A 4PEEA 1AVAA 1E43A 3WH9A 3KL3A 2WMFA 3A24A 3AYSA 4QDMA 1BQCA 1H1NA 2EPOA 4PTWA 4CD4A 3WF3A 4MJ2A 2OWWA 3MV01 1GQKA 3CHEA 1WZLA 1HF6A 4W93A 1PAMA 3ARRA 2W63A 3S2CA 4MNMA 2E9BA 1EGZA 1GVIA 3WY4A 3CLWA 1WB0A 1E6QM 1MVYA 4ACZB 4FLSA 2YDRA 3TV8A 4LQ1A 2WAGA 2WMJA 3EJUA 4AYGA 3VSTA 3SCSA 2J74A 1B1YA 6A3HA 1R7AA 3CPUA 3KLKA 1GCYA 3W81A 1TA3B 2W61A 2YA0A 3VD3A 2PWHA 3S5YA 1VEOA 3AYRA 4OOUA 3W0KA 1JF5A 2BVTA 4PMNA 1JAKA 1CGVA 3AIVA 4FF5A 4OKDA 1BPLB 1KXQA 1PS3A 1QHZA 4ZE5A 3U7BA 3EMCA 3BVTA 1R8LA 4FNQA 3CMJA 1X6NA 4PTMA 3QGVA 2EPNA 3VD7A 1KGWA 2E0PA 3W28A 3WQ6A 4NZFA 3POHA 3G6MA 5JBDA 2VVNA 3CMGA 3AISA 3W26A 5A8NA 1BG4A 5CGTA 1OBAA 3THCA 1CYGA 3KZSA 1IZJA 3AIEA 3BVWA 3NSMA 3SCTA 4XX6A 4FNUA 3DX0A 1T0OA 1NWRA 2CPUA 1E5JA 3WF0A 3VM5A 1BSIA 2ZX9A 3FW6A 1H0IA 3LPPA 2ZUSA 1RD6A 2JIEA 4MADA 4EE9A 4BQ2A 4BQ5A 3ZJKA 1J0YA 4AWEA 1J0IA 3WKZA 3OLDA 1MQQA 4AEEA 5BXRA 1E6ZA 2AOSA 1V02A 4XZWA 3PZQA 2OLHA 2VNCA 1JZ2A 3EJTA 1NWSA 1R33A 4R27A 1XCXA 5FL1A 3MO4A 3BMWA 2DSVA 1WCGA 3ARUA 1JZ6A 2G3NA 1QNOA 5D8WA 1PZ2A 2O9OA 1VFFA 2A3BA 1LLOA
chains in the Genus database with same CATH superfamily
3V0GA 4PGEA 2GTQA 4WXYA 2GQ8A 4IKLA 2ZRWA 3WIHH 3RWEB 3ZE2E 2D03H 3MN8A 1EEPA 4YDKL 4GYJA 3VI4B 1JGMA 4W5UA 4LPUA 1O6SA 3QIBA 3P4MB 5IZ7A 1UR8A 1X7SA 3H7UA 4NZCA 1CD0A 5HHME 3VI3A 3C6CA 1MRFL 1IL1A 3US0A 3RWHA 4NZ8A 2GBVA 3I85A 3BN9D 4Z0BH 1XICA 4DYEA 3NPZB 3ZU8A 2DQFB 2WZMA 1AD9B 1P6BA 4HMNA 4S3BA 1WFJA 3PNUA 1RJYB 2PUZA 4PV8A 2FGWH 3TN0A 2EINB 1IGSA 3OA3A 5ICXA 3DHJA 4I5RA 1D5IH 2GJ6D 3QB7C 3W7IA 5D2LA 4LU0A 4I87A 2X4SA 5LAPA 1DCLA 4FFYL 3TTSA 2Y7QB 1QACA 4XXWA 5A8OA 3O41A 4EE2A 2XFFA 3PSVA 4GXWA 1JOIA 4BKSC 2MKWA 4KEVA 3ZM8A 3GD1C 2BSTA 3MC0A 2G3ZA 4DP6X 3GF8A 3EF7A 1UC4A 4YHLH 3E5PA 3BKCH 3RGVB 2H8ZA 5D04C 1HK6A 1NLDH 5H4ZA 2HNHA 4O1CA 4V15A 1LE5A 3KVLA 3VXSD 3HS9A 2F1AA 5EYWA 1MCHA 5DVMA 1MFMA 1NMAL 1S7QA 1IFRA 2AJSL 2AKZA 4O50A 1XFPA 2G60L 4EIBA 5IGXH 1ZT1B 4MD4A 1TPDA 5ISZD 4JPIB 3IKCB 5LSMA 1GCFA 3B7UX 1M04A 3FEQA 2IDTA 3B4NA 4IOFC 4M9PA 4WHBA 1CXLA 4JREB 3GR4A 3S3CB 4R0LA 3ULVF 1EGVA 2PDQA 4M6NH 1T5WB 4ZMXA 3W25A 4EDWL 4KRPB 1SSDA 3L5WB 5EUKA 1JFQH 3I65A 1NGQL 4GXMA 2ADJB 5LGXA 3N4AA 3U2SB 3A4FA 5F7WC 1JP5A 2NY6C 2BCKA 1W3KA 4LF1A 4K94L 3S9ZA 2DIJA 3QXBA 2ADJA 5ESVA 2J1ZA 3WDIA 1QLRB 1FH2A 1NWPA 1EJRC 1NFDA 1YN7B 3GSXB 1M03A 3L7FA 2HG0A 3UJTH 2YRBA 5DJ6A 3MO1A 3FO9A 5CU9A 4NAFB 1XF5B 4JS7A 2QGYA 5ECUA 2GI7A 3SB3A 4ABQA 4PWHA 3EGSB 2X8RA 2A1WH 3PAUA 3BVDB 4N8UA 4F8NA 3G0UA 1RIUL 4E9QA 4KKZA 4U1LA 1F61A 3DIPA 3GXFA 3N43F 5IW6A 1XG3A 1QPXA 5A8MA 4EPBC 2JQXA 2XWCA 2GG1A 3QPXH 5HY9A 5AB1A 1HJVA 3H85A 1AW1A 2D23A 3N13A 5CG7A 1G0CA 1TLMA 1CT5A 3O6ML 1X7FA 5DJCB 3VK5A 4FFVD 2DKUA 4F58H 5CCGE 3DXIA 3WDRA 1IKNA 3CB3A 1M57B 4BRVA 1QHOA 4FXGA 4M4PA 2VX5A 1CFMA 3VXGA 2VDMB 2ZX6A 4P5TB 1OP9A 2IXQA 1C93A 3S83A 2Z8WC 2R4RH 4LO9A 4PAZA 5IFPA 2BDQA 3UD6A 3MV8E 2QV4A 4LEXL 3OKEA 1OD0A 3K30A 3L7EA 3HBZA 4EPSA 3ZDXF 3AMGA 4XG1A 1SXZA 1U8HA 4N28A 5EKYA 1ASOA 2EDFA 1C29A 4NN7B 2GTWB 1KEGH 4LH8A 3W9DB 2C9XA 2VW6A 4AZUA 3Q44A 4JTIA 1N59B 5DUML 1K8XA 2H8XA 4Y1AE 2PGRA 1P9MC 4MUPA 1VESA 3RIAF 2ZKMX 4C7DA 4AQ1B 4N0UA 3TWCL 5FYJU 3QV8A 2FTWA 1EEZB 4U6YA 4DXKA 3GSNL 4I9JA 4HAGA 4LBSA 5I18L 3HE7C 3QFJB 3CLFL 4LVBA 5CEZD 3DYMA 1MN4A 4RZBA 1DP0A 1FHVA 4EN3A 1I85A 1HHHA 5E4EC 4GO9A 3VFMB 1SJDA 4KBXA 4KY1H 4RLIA 2Y5EA 4DHGA 2GBUA 1V02E 1XGQB 2L0DA 1EANA 1RQ5A 3ARGB 3HFML 3MKKA 3NJXA 4RFEB 1ZU8A 4E4FA 4QNPE 2FPYA 2DPKA 5DWUL 1M1SA 4F2MB 4E2BA 4PVBA 4ZW6A 3BEVA 2DJMA 5EV7A 3FPYA 1HEZA 3O8AA 1XLAA 4Y16B 3C6LA 5E0CA 2WXRA 1IARB 1EF2A 3ES8A 4Q7IA 1HEZB 3BCFA 1FO0L 3UC0H 1AHMA 2M1KA 1H3PL 2DQHL 2WMIB 4QXGH 1NBYA 4O02B 2GSGA 2NXZB 4BH8A 4GRMB 1BOGA 4O4YL 4X6DF 3TC9A 1KM6A 2MJWA 5L7XH 1W72H 3UR7A 3VI4F 4R7XA 4D3CL 2QAPA 4HZ8A 3S7GA 4WI7A 5E9XA 5I6OA 2WC3A 4OD2A 4U6HA 2WLYA 1NCDL 5FLVA 1ACYL 1SJHA 4LEOB 3SKJL 3W7MA 4ETQB 2VDNH 4JEJA 1H61A 4QIUA 2J8UB 1RCOB 1FFTB 3ME0A 1TPXB 2PDFA 2NYYD 2XN9A 3QHFH 4ETQA 5IQ7L 3M7SA 5D4YA 2WB5A 4IX0A 5GGSA 5DEGA 2NY3C 3L3GB 3QQ9C 4URKA 2QQKL 1MY7A 2WLKA 4I2XE 3A6OA 3SCMC 2QZQA 5IESL 3HQOA 1I3GH 3KP1A 2P47B 4HVXA 3QXDA 4Z2LA 1H3TA 1QMUA 3CXDL 4XO6A 1ZHBB 2BSED 2MPAH 5D6CB 4PREA 3P0YH 2DW6A 3BGGA 2OJEB 3B0XA 4B16A 4ZFZB 5C0BE 3B56A 1UWRA 2CBMA 4N2KA 4MS6A 4ZUSA 1A8ZA 2FH8A 2UY4A 2QJDA 4F7TB 5JIPA 4LCCC 4Z2KA 2AJ3B 2QF8A 4WI4A 1Y6NR 1GQJA 3U1SL 2VDKH 5D8ZA 4HG4J 2GQAA 4M1CC 4M48L 4FHJA 3U2ZA 5GHWH 3WKNA 4IMGA 2K3HA 1T3FB 4LVNB 1MNSA 3OMAB 3UNDA 4BSWA 3W1MA 1OF2A 1R19A 3QR2A 3U0WL 4KNQA 3TXVA 3FTUA 1AKPA 2TPSA 4XTDA 1EH9A 5ABTA 4RAVB 1OY3B 4IW4C 3BLKA 5F21B 4F7MB 1KLGA 4XP9L 2D3VA 4WUKL 3VH8B 2L3BA 5D03A 4R7JA 4BHYA 4AQ1A 2KC0A 3O6AA 2NR6D 5IB3A 3F58L 4TPRH 4JW3A 4PJGE 3KX6A 3QVQA 4G7VH 1J1XH 2V3DA 4KZDH 3K4DA 3CPGA 3QYCA 5KVFL 2DMGA 1TQUA 4HF5H 4LB3A 3UAJD 3P60A 4KTDH 3EUUA 3RVXD 4JG0L 5BOPA 3I68A 2DL9A 3VFMA 1IT9L 5KUKA 1EC9A 3MUCA 2JI1A 3B2PA 3ZN6A 2GSJA 1JGLH 2ICES 1AIFB 5EY5A 3IJ7A 3FUJA 5DFVC 5KBMA 1EEUA 2Y7OA 2YZ1A 3R89A 4KHXL 4LCYA 4Z0XB 2GY7B 1FBIH 1IFGA 3LB6D 2ITDA 1NINA 3F6LA 1W80A 5E24E 1TR1A 5KSUB 3VB8A 3K5XA 2DZEA 5A2FA 1LD9B 1U91A 3O2DH 4HS3A 2HRWA 4ODHL 3N34A 3NL5A 4N6FA 4HUVB 3FKUS 4JIEA 1COBA 1T96A 1HKFA 3LN9A 2HH0L 3OKLA 4LJ3A 4TV6A 2ZTKA 1Z32X 2WPBA 4GXPA 4AD5A 4CMMA 3VWJA 2IAMA 2YQGA 4XOAA 3T44A 3E3QE 1BGXH 3MBEA 4EIUA 1A3ZA 4R5TA 3FCTA 4R83A 5K9QG 4Z1DA 1LEIA 1C8XA 4UMAA 3APMA 5CMAB 4R4ND 4DNLA 4QLLA 4DZ5A 5KS9A 2FYVA 1SJHB 2CKNA 3OGSA 3I4EA 1XO8A 3MNZB 2Q8XA 1MJ7L 4NC0B 1FLRL 2CZFA 4TX9A 2OWCA 1SO4A 3L4XA 4IX2A 5DD0L 1FBIL 4ICMA 2EIEA 2DLGA 2GSEA 4WSHA 4MAYC 4TVDA 3ATFA 4QJ3B 1J5SA 3AMCA 1WUNT 3STZA 1ZENA 4IIGA 2HH0H 3OMNB 2HRGA 4QRTA 4FXJA 4Y19B 4U0QB 2PURA 1TZ9A 3P0VL 3FT9A 2XTKA 1ZK9A 4FQ2L 1OK6A 3QDHA 1FTXA 3CUJA 3CNYA 3P5ZA 4WGHA 4TNVK 3OKDA 3FTWA 4LNRA 3MNVB 1V0LA 5I1JL 2X1RA 3GJEB 1BYCA 2Z24A 4ZT1A 3ITGA 2VWSA 2DD8L 1SLWA 5H37H 4LT9A 3FK3A 3SYOA 3ABSA 3RGBA 4X6EA 4H4IA 4UV4H 5C9RA 1ZIAA 3GRWH 4QF1A 4O12A 3RYSA 2JKLA 1AZ1A 2ATKA 4JAMA 3AFLA 1JPEA 3Q2DA 3NIDF 3GI8H 2A7NA 4Y2DA 1QPNA 3KCPB 4RNJA 4WFHE 1JK8B 2R0KL 3NCMA 5FW7A 2CKBL 1MW0A 3DAQA 1P4CA 5CPLA 3CXFA 3HG4A 4XZHA 3KYNA 4LVHC 3D47A 1B4RA 1VLXA 4MMWA 3BSZA 4DQOH 4ANKA 2H0PA 4HKXA 2XNAA 2IANE 5F1NB 4NO2B 2AJXH 3VXUD 1JWSA 4J5VA 1H7PA 3FPXA 2PA6A 4XVJL 4Y4HB 2MOQA 3GBLA 3JS3A 2J8UF 4JRWA 1S78D 2E86A 5TDPA 1I3VA 4YQXL 5JLZA 4Q52A 5DMKB 4JZNA 1S5NA 3BDKA 1ITBB 1KOAA 5DC9B 3OHIA 1TQCC 4B9CA 5TH2B 5XIAA 4BK5A 3S4SA 4IZGA 2C1PB 3UESA 4HKZA 1YEFL 2G3JA 5C2BH 1LG2A 3A3XA 3BN9C 4QHMB 1MFBH 4GXFA 3FU8A 4NUJB 5DT1L 3E6FA 3VMNA 3C5QA 4IFRA 1DLFH 3IMVA 1XAKA 3Q6FA 4KOBA 1EC8A 2Z25A 3TSMA 5F7EL 1OGAD 4D9RE 1ZA6B 3QAZC 3N18A 4I7ZC 4JB9L 5BROA 2IGFH 3SEPA 2FIRT 5I07A 4DO5A 2ZKHL 4IRJD 4LSUL 3HG0A 2JJSA 3OMIB 5FUOL 3SCQA 4N1EA 5DJDB 3TM6A 5T5NG 3JWDH 5D72L 3T0CA 3BQ5A 2OYPA 3SAZA 2I85A 1IKFL 1IFHL 1ISYA 1NPNA 1NUDA 1F18A 4Z7OE 4HK5A 1H8LA 2I9LB 4DEPC 4RWHA 3C56A 1RA5A 1VIWA 1UG9A 1NGXB 3LN3A 1C7TA 1F3JB 2P8CA 4OLZH 2GTZB 4ZB2A 3WJWA 5D1XC 1BZEA 3FUKA 1RQEA 1TJRA 2BPBA 4FGMA 4L5FL 3VI4E 2BXVA 1Z6KA 2OL3L 3AU1A 3IDIA 4BFIB 4NNCA 4Q6IC 5FYKL 4XP1L 2YC1B 2PLKA 4P2CG 3HC0A 2Y36L 1GRWA 3CGTA 5FB8B 1BQHA 3CIVA 3UJRA 2F7IA 2W88A 3NJMA 1FDZA 2VDIA 4ZQNA 4GRWH 4NQED 4NBZB 2EDLA 1BD2E 4A2EA 3DYPA 2F68X 3ZT5A 3QZ6A 1IZKA 4GLEA 3B0UX 3DJTA 2IPKA 1AG0A 1FYHB 1HN1A 3RMJA 1FQ9C 5E2UL 2OGJA 3UC2A 2CBOA 5AVNA 3MMEA 3SUVA 4AIBA 4Z7AA 1IGWA 5FYJL 1TPFA 1DBJL 2XOTA 3VGEA 3URBA 5HGBA 5DY2A 2J88L 4MZ3A 4RWYL 2QCGA 5BXTA 1S9YB 5ANMA 3FYOA 3T0BA 2AFNA 4N1CA 3ECWA 3FTYA 3OHXB 1BXNA 1DWGM 1E4MM 1A4BA 4JOMA 4QD2E 43C9B 5IFJB 3KDNA 2EDYA 1RZ8B 1RZ7L 3TNMB 1G7IA 1CWYA 1FYTB 1HESA 4A05A 3BPOB 4G6KL 3B2DC 1KB5A 2P5PA 1IEBA 3L81A 4GNVA 1WF5A 2WUCL 3LKSB 1XD0A 3V4UH 2OKTA 3ZLHA 1NDWA 2W80C 1A5LC 4P2RB 1ZAGA 2K45A 2HFFB 2O1AA 2OCFD 2R51A 3QI9D 2VQ1A 4P05A 5BV7C 2L7QA 2F38A 4YN3A 3KCOA 4XD5A 3GU2A 2P8PB 4A2LA 3VABA 4EI0A 4CNSA 4F3HA 1PZBA 3QNXA 4U1JB 1AFSA 1P4BH 4ODWA 5CJQH 4C60A 3NCYP 3ZHFA 2CHRA 3S6DA 1EJVC 1OYAA 1R3TA 3BV4A 4MZYA 4UFMA 5LGJB 5HYFA 4OB5L 1T80A 2BVYA 1GHSA 5E2VL 3Q8EA 2CKSA 3H6OA 2ZONA 4HIIA 1NOFA 3P2DA 4M6OH 2WZEA 2X7WA 3NO1A 4ANUA 4HWZA 4F7CA 1GOWA 1N8FA 2CHXA 5DX7A 2KLSA 3REWB 5EIVA 5JO5B 2PLCA 2X9ZA 3LHTA 3C6EA 2JIXB 4ELMA 4NX5A 1OAJA 2ZJSL 5E7FA 4YSCA 3T09A 5FUZH 4GFTB 1V4YA 1HQRB 1HQ4B 3JYCA 1U8QA 1L9QA 2A9NH 4MB4A 4XVOA 5AAWC 4PM1A 3SKMA 3ALFA 3HGRA 1K8YA 5D9NA 3SO5A 4QHRA 3QXVA 1P4LA 3P1VA 4P2QB 3LZFL 3KCJA 1VFLA 4K3EH 1H8OA 1T1WA 1UADC 2B4CL 2CLVB 3H2QA 2I9LA 4RMUA 4RX4D 4D9QD 3ATAA 1Q5MA 2YPIA 4PA8A 4S2CA 4NI3A 4Z7OF 3LHAA 1KJ2L 4HD5A 4A6YB 15C8H 1AH3A 1FN4A 1NEUA 4HV8A 4M8VA 1UT2A 2VL5B 5JW4N 2ZCLH 4NN5C 4YBQD 4TUUA 1EZVY 4ZFGH 2WTPA 4R33A 3WEMA 4EPEC 4IDJL 3VC6A 1KJ2H 3GDRA 4IU2A 3UFYA 4ZOEA 2B59A 4WFFE 1YDPA 5EC2A 5IBUG 5HXMA 4GQGA 2VC2B 4JYDA 5F7UA 4K8RC 1G4EA 2XH2A 3CU2A 2EE3A 2YMXH 4PJBB 5A1AA 2A2IA 2DZUA 2PI6A 3MCMA 5KBKA 1YBQB 5H8PA 4IKJA 4X6DE 4ZUTA 4O4WA 3FUEA 2GJLA 1JCNA 4F7EA 4NQXB 4GI8A 1XIFA 3AIQA 4MDIB 3B0VC 1YY9D 3S98A 1H7NA 3WMBA 3HURA 5CD5D 3B7RL 2VLRE 3Q2WA 2J7LA 2VMJA 5I2IB 2OGYA 5C9UA 3MXWH 4XWOD 2YUXA 5AC5A 3UQNA 1T04B 2Q20A 4XMUA 2VELA 3K1GA 1E6JH 4XI5C 1L6WA 2NNFA 4C1NB 1XF1A 4XNZC 4JZOB 3KWUA 1LQ0A 1L9NA 3O4OC 1GGTA 3P3UA 3M86A 1MI3A 1BJMA 5IVNA 4YHMH 1KIQB 3MRCA 1G5AA 3UIZA 1ICQA 3HMCA 4GQQA 4Y7MA 2J20A 2VAAB 3TT1H 5E08L 3RWDB 3R4RA 4D6CA 5D09A 2I5YL 4E9XA 3S3GA 2HJFB 4LGPB 2BW4A 1NBQA 4XVTH 3LKOB 1PTDA 2R1MA 2K7QA 1TOXA 2O61B 1V03A 3ZS4A 5F0JB 4ZMNA 2OXGA 3IETA 3UYOD 1AR1B 4GS7B 5JQ6L 3AWOA 4TU1A 4YDZA 2VQ1B 4FFWC 5D1QD 4BFFA 4HVBA 3U0WH 3VGFA 1ASPA 2A9CA 1UZHA 2XVNA 4I0PC 1ZNNA 3E1F1 1SPDA 3L3DB 1POJA 4MYXA 1IKFH 1IFHH 3VXUE 3IFOB 3V6OE 5JHBA 3BG5A 1EXBA 4IJBA 4LUSB 4H8QA 3UYPA 2ENJA 5F2GA 2DUXA 4G7VL 5DHEA 5SWSB 2YGQA 4OCRL 4RAHA 4ILSA 4OLZL 4JGMA 2NR6C 4P3CH 3UAAA 4O00A 1O4UA 3V3WA 2VLKB 1Q72L 2P5EB 1EBAA 1QCWA 3WJLC 1MWAH 1V0MA 3ZRCC 4OIIL 5IB5B 4AE0A 1F90H 2EDDA 3CZFB 2W9LA 1CLZL 4P2QA 5DC2A 2KKQA 1BEUA 1TYGA 3SE3C 2AI0L 2QT3A 1U8NB 3QEQD 5JTWA 2NY4C 3A6BH 3IJSB 2EDWA 2P1YA 4NENB 3D2UD 4ZXOA 2Q3OA 4RFOH 4ZXBB 1XIWD 2FSDA 1BYDA 3QM3A 3AG1B 1A7NH 1SZNA 2JKRM 2VCOA 4UIKL 2J2ZB 2R1WB 4JFOB 5CZXC 1YCSA 1H5YA 2C71A 2PF6A 5A2LH 4AJ0A 1QWNA 1UOVA 4N2AA 4HGWA 5DDHA 1OY0A 3LZPA 2ZSWA 3TEUA 3VWKC 1NJJA 5D4JA 4OIIH 5IBLC 5ACZB 5E7BA 2ICEA 1YECH 4UQEA 4OF0A 3SCNA 2VXVH 2GGIA 4XMKH 4G8GB 1G7QA 1UOWA 4UR8A 2DLTA 5ETUB 3NIGF 4UAOB 3MLPA 4FQHA 2BP1A 4IP7A 3NJFA 1QWUA 3KYKH 1GVSA 3R06A 4O1EA 2X1IA 4QHNA 5LG6A 5FHAH 1QFEA 5LNGA 3LHZA 1JHLL 2VC5A 2XG5B 4WV1C 2RGMA 4GRWF 1M3JA 3BW9B 4KWSA 1OAUL 1JMZA 2OOFA 4JFHE 3SY0B 3LD5A 5HI3C 1W1IE 5BO1H 3QI9B 5GZND 1FO0H 5TE4L 3UC0L 4CKVX 4OFKA 3HAEG 3VJ6A 3JQOB 3LKOA 5LCVH 1DE4B 4AIXA 3IU4H 5GSVA 2FIQA 3CMOL 1ONQB 1NWUA 1CBVL 1JPTH 3MNMA 4HSAC 1GC1L 3QTPA 3PIQB 5CSYA 2QMKA 3SO3C 1I8KB 1SJBA 1CQYA 4M43L 1AGCA 4PUDA 4IRJB 2WO4A 5LGHH 1E72M 2NQ9A 4PTTA 3UGEA 4NLHA 3VW3H 1X8CA 3ANVA 3SFWA 1ZANH 5AZEH 2PRHA 4N86A 2Z4QA 3VDBA 4WW2F 5D7HA 3S6CA 1ZHAA 2K7PA 3HI5L 3MCKB 4HFUH 3OKOB 4OTXH 2GJXB 1I8MB 1IC7H 4LCIH 1QLFB 3GVVA 4JPGA 3W53A 1QZ1A 1YJDL 2EP6A 1XC6A 3AHTA 3RDKA 2HSAA 5MERA 1JZIA 3VGGA 1KN4H 1XIWA 1L9SA 4CILA 4XZMX 2GKIA 3NP4A 1JGDA 2XPGB 3KLAB 4MJ5A 4WW1A 1PZAA 3Q8CA 1I8UA 2ZSVA 3RBGA 4G42B 2VLJD 3BT2L 3RY6A 4WU5A 4XH2B 4BXVA 4C59B 3EB3A 4HPXA 1MWAA 2DSWA 3R43A 2ZA2A 4RBPH 2WB1A 5IMOA 4P2QD 4YL9A 2X0VA 3LYRA 4WNSA 4XHJD 2R1LA 3QJHB 3O45A 4QO1B 2C18A 1LP6A 4R5VA 1GJIA 1NC4B 1RIVH 4XO5A 4P5TC 5E0FA 1NDVA 2XIMA 1L0XA 1PAZA 5IEHB 2FJUB 1IXOA 1EX5A 2ERJB 1PPIA 3QDMD 5CFAA 4JR5A 2Q86A 3OTRA 1MIML 2MNWA 4FXGC 1BD2A 3UAFA 2P24A 3ZR5A 5IJKC 3LENA 1PSKH 3BZEB 4JIQA 4HC1H 5SWUA 4XPGH 2GQ3A 4FTVB 3W7PA 3MNDA 1X5AA 2FUQA 3CFMA 4JPKL 4KMTL 3COTA 1CR9L 4NZTH 1WZ1L 2YCKX 5F2LA 1T7XA 5DJXB 4CC4A 4TOQA 2V5CA 1CU4L 1XCFA 2IC2A 2FEEI 5DURD 1VYSX 5EUOF 3DG3A 2QUNA 4RXFA 3ETBJ 4R84A 1LE9A 1DQUA 4IMAA 1LQAA 4GD0A 4DZHA 4GCXA 1JSYA 5DMJB 3G7TA 3MCG1 3WKML 3VFWA 2R1XA 3N1PC 1N18A 3V0DA 5JXAL 4I5XA 4HHGA 4FOKA 3NL6A 4GXVL 3IARA 2BJMH 1VZWA 3V5HA 1DUYB 5EBAA 2NY6D 3LQAL 5EO0B 3MRDB 1Y1UA 4IBQA 1CXFA 3FOKA 1QWGA 3L5IA 4OJYA 5I19H 5MEQB 2K70A 1I1YA 2HRLA 3DMMB 4N0UB 4D8AA 1QI3A 3KH4A 3TJ4A 3VXTB 3QYMA 2C15A 4AHQA 1GORA 3O6CA 5JHMA 2ED9A 3PGDA 4KKAC 2FEDC 3BPCA 3S8FB 4J7RA 4AZ6A 4EZKA 3LKPA 1XXXA 3QEHA 1KBBA 4A7GF 5CIPA 1JNDA 2PU1A 4HWBL 4U5IA 4V1YA 5CZXD 1KGCE 3TTEA 2V8ZA 3LEXA 1ZHKA 1DTNA 3DIFA 3P69A 4TNVF 4KCWA 2OZNA 1Q6RA 4UOW0 3LRSB 3W7QA 3QUYC 5IBLD 2P7TA 4U1HA 2FFCA 4FQCL 3OL2A 5FGSA 2RUSA 2OEJA 3CDGB 1HO1A 1KCWA 2X1TA 4X7FC 4P3DA 5FA3B 4NO0D 3O2VL 5JBFA 3T0EE 4NO5B 3T81A 2ZOXA 1EFQA 2LGNA 2YN3A 4L3EE 5I1IL 3G6LA 2OLDA 1KQYA 5TE6L 3W70A 5JIIA 1SOKA 5B7ZA 4MWAB 3P74A 3M0HA 3B43A 4U6HB 1XF4B 4XOBA 1J8SA 5SWQA 3VD9A 3PNRB 4JPVH 1C91A 2CETA 3PG9A 4BUQA 2PR9A 4TN9A 3PL6C 2E7BA 3LD8C 3RNQB 2ITEA 2VABA 3M07A 2ZCHH 2Z1SA 4YDLC 1DVJA 4JQIH 1J9CT 3DA0A 5LXXA 4IJTA 3GC5A 1KM5A 5AW4B 1RLWA 2J47A 1H3PH 4Q4QA 3D39D 5GRVL 3VFNB 3FKKA 4AL8L 1K8DA 5DO8A 4D72A 3S46A 4S1RH 2PW2A 1NCNA 2YFNA 3ZTDC 1Z5LB 2A4CA 1UXWA 3LIZA 3DBPA 3Q01A 3G5EA 3T3PE 1JHTB 4IJCA 2YZ5A 4KI1A 1IE5A 4N8VA 1L7IL 5T5NF 2AJVH 3GC3A 5EEYA 1T7LA 2CLIA 3S36X 2EKCA 2W3ZA 2R82A 2H0FA 1WISA 3NGBB 1CDHA 3NJVA 3UOAB 3UXFA 5JW5B 3VIMA 1F4AA 5FJTA 4M9OA 1G01A 3W2KA 2IXQB 4K5LA 3DGCR 4AH7A 3EBIA 1JYVA 2F74A 1E70M 4U4BA 4YHPB 4UTLA 2P9RA 5T1DL 4L4TE 4J12A 4ZS7H 4ZX5A 4MMYA 4HTBA 4Y9MA 3CVCA 5DUBB 2E1WA 3VXMA 3WDHA 4WR3A 4ZUUA 4DGVL 3B2UC 1E1EA 1F3TA 2NXYC 4XVJH 2PDYA 2PTZA 4B4FA 2DI9A 1E0XA 2BY3A 3QUKB 4KDWA 1IGIH 3W9DA 4CGUB 1QZNA 2XVKA 5H37G 5L4JA 1WKEA 2NXHA 4Z2JA 2B15A 3V4LA 2C1GA 4OQTL 2D7OA 3T4AB 3VFOB 1MXDA 1PIIA 2CKRA 1A6PA 3R12A 4PLJD 4FX8A 1EO8L 5C2BL 4L4VE 4IBUA 5CBBA 3CN2A 2YEVB 1SJCA 3W27A 3NPSB 1X9LA 3MV7D 1FZMB 4DW2L 4I3RL 1GVFA 4TV5A 1WEJL 5J6HA 5LWYH 1JMXA 2XACC 1U9KA 5DXXA 4AWTA 1CXKA 3IXAB 5IG7B 4BELD 4OSUL 4ZUWB 4LS2A 3MACH 5I0XA 1YNQA 1I4FA 5IB4B 3IXAA 2YD7A 2I7GA 4F0HA 3IB4A 4GAAA 4JDVA 3SODB 3R1ZA 4NJJA 4HGXA 4GKNA 2DYSB 4AFYA 4XAYA 5DTFA 1OC5A 5GJMA 4IMKA 4HGMA 2O9TA 4OU3A 3U0HA 4ZTEA 4YSUA 4LLDA 4H7CA 4AMWA 2HFGH 5ADOL 3N3MA 2JXMA 5DLCA 1MJUL 1LWJA 5SV4A 1QNPA 5BZWB 3SQBB 4DIXA 3ZYZA 2X0SA 4P8VA 1T0PB 3DG7A 4WI9A 2R29A 1M7DB 3AS2A 4N90E 9PCYA 5I03A 1MG2C 2J44A 1TZ7A 5EBLA 3T6ZA 2ESVD 3ARDD 3QZNA 4PGDB 1PU0A 8PAZA 4I2XB 4XXDA 5ENLA 3WBWA 2J8UA 2ED6A 1IIIA 2M83A 3B8YA 5D7KD 3W11C 5ITFB 1ELSA 4JHAL 2FEDD 4MZRA 1M3UA 1G7JA 1YNTA 3EGDB 3L4TA 5GGSB 3V36A 1SYSB 3ZMEA 3OAUL 3O11B 4NP4H 2OSXA 5KVGE 1NLDL 4OF6A 3DFQA 2VFEA 4ZQOA 1T66C 2OZ4H 4QS6A 2Z93B 1GYLA 4C8XA 1TPWA 1M7XA 4I48B 4Y1TA 3TJHD 1IBFA 5HAOA 4A68A 1FHNA 3RVVD 4F9PC 2OVLA 1HHKB 3MPGA 1I3RA 1DBJH 1B4EA 5F9JB 5F88B 3IYLW 4HYVA 5A3IC 1JS4A 1RP9A 2C3VB 4KKRA 5FW6A 1M6UA 1MW2A 3AHZA 4KJQD 4EIGB 5HVHB 3EJCA 3UEQA 5I8CB 3MYZA 3IVKB 3RMEA 1U8JA 1KJMB 3O8XD 2V6AA 4HHLA 4EAYA 3X14B 4ERSL 2Q8ZA 4OBRA 1GPOH 3FYEB 4QTIH 1AMKA 3O3DB 1ZSHA 2GC7C 1NMCC 3HZMB 2RAMA 1G43A 5REQB 4UTHA 1QTPA 1KTDA 2CLLA 2G8ZA 5DBTA 4BZ2A 3GFZA 3TA3D 3G1FA 1NGPL 1RVFL 3AG4B 4ELKA 4Q9RL 3BMVA 3MV9E 3ZE0F 1TA3A 3ENLA 5I30L 1JI1A 1W5NA 4C83A 1QASA 2WINA 4L4MA 4RW3A 2V4LA 2FJHA 5FO7B 3EWBX 3WO4C 5IW3A 1LO3L 4WAFA 3MHFA 1KF9B 1A8JH 3CK0H 4LHUA 3ML8A 3SKOB 1TTFA 3QDJB 3KPQA 3AROA 4KK5C 2UX7A 1EJTC 3HB9A 1GSMA 1Z1WA 2D9CA 3O6LH 4OCSH 3ZKMD 2C0AA 3TYAA 3UA4A 4M1DL 3ITCA 3QZWB 1U8HB 2XNAB 3DYOA 4RGOH 3M1ZA 5D2XA 1KMGA 5G4OA 3J27A 3B1TA 4MNGB 1PCSA 4HCRH 3GSUA 3VWKD 2ZXGA 4ASTA 4NXKA 1U5VA 3DRTA 1GPFA 3TVMA 1S2CA 4DBWA 5KSAD 5I0VA 2VOMA 1T5KA 5KYUB 1QXLA 3D25B 4GZ7A 3GH5A 3AUWB 2KI6A 3TVMB 3UTSD 3TR9A 4X5PA 1XGDA 3OIHA 3D25A 2MCPL 1FFNA 4GSDH 5BV7B 2WNNA 4K7YA 3H3BC 2DQTL 3NR0A 5EPMA 4N0FA 1E4IA 2F61A 3L3OA 3GFYA 4K3EL 4HIHB 5ISZB 3RCNA 4BWLC 5HSFA 1KTLA 4S0TD 4X6CF 1EFXD 2MQ3A 2Z0UA 4DIAA 4NZUL 3IWVA 4AEFA 3V10A 4RGMC 3L4YA 3HBQA 4W86A 4U3HA 3TDFA 4PRPB 4WW2B 4XNZB 2NYZA 4PLJC 1DSFH 5A5WA 3G1YA 1YEEH 2XFYA 3IJDA 3ARBB 1MCWM 3PDOB 4EI6A 1DIOA 1OGSA 2VENA 2FYYB 2JCCA 3DFTA 4HNLA 2J56A 3X1NA 4GAYB 5TFSH 2YPLE 1AY1L 4E0RB 3DI0A 3CFJA 5L0QB 3BK0A 4XIAA 1OPOA 3BLBA 4WTWA 1LDCA 1NLBL 4GUGA 3TFXA 1EAJA 2YPKB 1QHPA 3CFTA 3HI5H 4OD2B 1N6QH 1L9OA 4NPJA 4G3YL 1XYAA 3E02A 1MI5A 4KNSA 4GE8A 4NUWA 5HULA 3SRHA 4NWUL 2P88A 4U1NB 1S78C 4HP5A 4CCZA 2FJFB 2C8NA 4YDKH 3QCTL 1RULH 3RY6C 1LO0L 2J1YA 1AQMA 5ECJE 5F9JA 5JUEL 1W9UA 1XUZA 4PMDA 5LO7A 2OR2A 3G22A 1F1DA 4XAPA 3B9NA 1YEHH 4YWIA 4MZ1A 4CNTA 4R2GC 3S4SG 5LDSA 4HPOL 1XIEA 4ONVA 4ZMGA 1CI5A 3LZLA 3RIAK 1CVSC 2H3KA 1JWUA 4HUMB 4Z7UE 3V4PA 1Q63A 5AKQA 3QUZA 4JHWH 4KFMA 2YAOA 5JOFA 1ED3A 2RA1A 3RFZC 3KDPB 3UY8A 5CCZA 1TV7A 4RETB 1NCBL 2B5IB 2IOIA 4Y5YA 5DJ2A 3SCUA 3E2HC 5D4IA 1YPZE 3DSNB 4MWFA 4NAMA 1E9OB 2J66A 1XC4A 2HJKA 4CADB 5AC8A 1RUKH 3HE7B 1NFDE 4NCC1 3SECA 5GRJL 1SXSA 4FFYH 5CEZL 1J48A 4X6CA 4UBDC 3RUGA 4AH2B 2HJKB 2WWKT 4CADA 4CCCA 3QQ1A 1SUXA 4KC3B 5J9PA 2EYRB 5D2LF 4X98A 1FC1A 1RH8A 1ADSA 2Z1XA 3WK0A 1KIRA 1GGCH 3HZKB 4KWOA 2EXWD 2WBJB 2ZRXA 5F9WB 3RVVC 4EI5B 1BF5A 2DZSA 3CXHK 4R4BB 4CLMA 3RL1B 3NZHH 2NT0A 3RX5A 1S7UA 4K07A 3URAA 1CFVL 1W72A 1PX4A 3SDCA 3WLQA 1Y65A 4DLFA 1KLGB 2DV6A 4QT5B 2CW6A 3EWYA 3FH5A 4GG9A 2BXYA 3QIUC 3S5ZA 1TETL 5JBEA 2WMGA 2NXZC 3GO2A 1IBYA 3QCVH 4NUJA 4OV5B 2KZWA 4K7FA 3RPBA 2YW3A 3EUDA 1VGEL 5GGUA 2CJUL 3P3BA 1CDCA 4W8LA 1PXGA 2F9BT 3IDJB 3SPGA 4KQ3L 4E5XA 2VIRA 4EOWH 2J24A 4HTYA 3R8HA 5A95A 5I6NA 1B90A 5ALCL 2WV8A 4MLJA 4OKVA 3NG3A 5FCSH 1F8IA 3R8BB 2XISA 2DBJA 5SWZD 4WZ9A 3ZQXA 3T6QC 2EIZB 1X5LA 3I7RA 5H35A 3O8XA 1IC5L 1AQ8A 3TYFA 3R94A 1SEQL 1SVBA 3SJVD 1TTQA 4XKMA 1BBJA 3L3JA 3MRJA 2NY3B 3LXAA 4G1MB 5E8NA 5F3FA 3BWWA 4Q14A 4QRUA 3WTTA 4Y9NA 1TJIH 3CH1A 2R39A 4TVPD 3GR7A 5FJIA 5DK2A 3IJYA 1CTOA 3LNIA 4M8QB 3NIGB 2O93L 3MLXL 4UU9B 3MKCA 3FN3A 5J8OA 3OKLB 5BMFL 5KSAB 4LEFA 1HDMB 4CA4A 3HBPA 5HMEA 3MCLH 5J12C 3ROLA 3HJ0A 5EULV 4XMKL 1A3WA 2HCVA 1H7RA 5L4MA 3W74A 2WWKO 1YECL 2R9RA 5L6UA 4L1HA 1TQBB 2ZE0A 4PFHA 1HIML 3KXFD 3EHBB 5EU9A 3FQ4A 1JYWA 2DZWA 1BXCA 1Y18A 3KWVA 5A6MA 1B31A 4F5CE 2QCCA 3ESMA 2NT1A 5EZJB 5D7IB 3LNEA 4AZCB 1IWBA 1FIGH 2MWCA 3BIKA 3L95B 4MDIA 1JWUB 2EDTA 4GW4A 3QRFM 2LW3A 4PJXB 5TE4H 2GUBA 4F7KA 3MRKA 3I7SA 4QY8B 4MAVA 4G8EA 5DYOB 4K1WA 3V6ZA 2I26N 2OW6A 3O6FA 5CD3A 1Q65A 3D3AA 2EKJA 3KS0H 3IJIA 4DBEA 4DYKA 1FZOB 5FFOA 3FSTA 3FT1A 5G2NA 2O7SA 1DL7H 1TVBB 3GB7A 5D1QB 5K9JL 2JF6A 1NQBA 1OLZA 4NNXA 4XXCA 2NY2C 2J62A 4MVBC 4QRFA 4X80H 5HHOA 1J11A 1N12A 5GJNA 2B7DT 4XCCH 3QAZB 5KSBE 3ZE1E 2Z0IA 1FN4B 2E74C 4HV8B 3WL0A 1QYGL 1ILUA 1T5AA 1YEGH 3H3PL 1B3JA 1XQKA 4NZRH 4N9DA 2G5WA 4UFJA 4HIBA 4QSHA 4DGVH 2X1QA 4OGYL 4HFUL 5JH1A 1US2A 3UETA 4TXVB 4LCSA 4HSNA 3KYNB 3F85A 5LBSA 4W9CC 3T77A 3ICJA 5C7VA 3QUHA 3VIJA 1GZJA 3RZCA 1OFQA 4HKXB 1VCBC 3P80A 5I16B 4UTJA 3SB0A 3H9SE 4XC1H 2DQJL 3CUPB 4LUSA 2ESVB 3REWA 1XLDA 5JHDA 3I3EA 3GK8L 5E56A 4HHAB 5E1IA 3V9CA 3BARA 4DO6A 3W1RA 1J05A 1XGZA 4MYPA 3CZ8A 4JM2B 4NNPL 4GC4A 2BY0A 3CYJA 2J1WA 3GWQA 4O16A 3IN2A 3VKKA 3DEQA 1RU9L 4B3VA 3FK4A 3U57A 4JLRB 4IXXA 3X11B 3IMRA 3KRZA 1N26A 2N7BA 4P4RB 1NEYA 3UR8A 1FSKC 2YLAA 2ZRYA 1W1YA 4PCTA 4ODHH 4WD0A 3CH1B 4ZODA 3JXAA 4W8AA 1UPMB 3OVGA 3UWWA 3DARA 2IDSA 3KBWA 3QWNA 4M5PA 3R4DA 4LDEB 4YHYC 3B2VL 3MV8B 4I5UA 3O3BA 3VCNA 5AC6A 3HMWL 1PQZA 1H5BA 4QCEA 2IAAC 1BTMA 1PLGL 3OM3B 2JBMA 3D3FA 2UY6B 4FKEA 4LCCB 4N9BA 1G9HA 2H8PA 3DVFA 3FB5B 4G7FA 4K38A 1SJMA 4ZTPL 5G5DB 4HKPA 1NEZA 2HRHA 4ONHB 1EJSC 3EOSA 2B2XL 3TYGH 1AS6A 4RCAA 1XLJA 3QUYB 3LEYH 4NFDA 1NEZB 1J8KA 4ONHA 3TLQA 4BF5A 3D8MA 3GMPB 4KETA 4IUGA 1U95B 4FF9A 5CJ8A 1X38A 2IF7A 3IFOA 4NQXA 2YS4A 2ZKHH 1RZJC 4NQCD 3D33A 2ALRA 4L29B 5CSGA 5ABDE 4YXLL 2CITA 1ZTVA 4MSWB 5ISZE 3UBFA 1LZOA 3PFRA 1FVPA 4PJXA 5JA8B 1U3HA 4JO4H 4GQRA 2KHAA 4V33A 1U3JA 4IHBA 1XT5A 4QJ5B 3VD5A 1DBBL 1JNLH 1M56B 2KBGA 2J72A 2VR7A 3BGAA 5TDNA 2HXTA 3RDTA 1C90A 2VZUA 4WWID 4QP0A 3RLVA 1T66D 4F66A 3GNMH 2Q87A 3F6IA 3UYRL 5IJDC 5ITBH 4WK2B 1JZ7A 1XF3A 2AK4A 1OW0C 4UCGA 3VCCA 3B04A 4D6DA 4QXGL 3RQ3A 1QDSA 2VAAA 3FO0L 5LZLA 3DXAB 1UUQA 1BAWA 5GS1A 4AISA 5E9DB 2QSCH 1JD9A 2HUEA 1R9ZA 2PXYC 2YIHA 5FO8B 4KQNA 3H70A 1ES0B 1SHMA 3H53A 2VC7A 3IEBA 4TVCA 4JFDB 1CYXA 2MH4A 3BD4A 2D2CC 2H5UA 3HS8A 4GYBA 4OFDA 3AADB 4XO8A 2FHCA 2DV0A 3O2LA 3SGJC 4X4XB 2ATAA 2WLIB 3WFEL 2D2HA 4WCJA 2ED8A 4EWND 1PE1A 2EIKB 3S35H 1IM9B 3AIRA 2IADA 4IH3A 1I7UA 2HT4D 1ZQ5A 1MH5B 2BODX 2JF7A 2DLEA 2D7PA 5ABHA 2PPCA 5E2WL 1U3ZA 3ARPA 4JICA 4GFXA 4Y88A 4ZX4A 2ISVA 1KZYA 4AQOA 1CZ8L 3QFEA 4HA4A 3C08H 2XA3A 4LANA 1Q6GA 1KB9K 1ZAJA 2Q3XA 1GIGL 3PHSA 3QG6B 2D7QA 1HKVA 3RO8A 4B3LA 3EH4B 3GVWA 5TE6H 4ODWB 2YA1A 4XVUD 3TO2A 4MJHA 2WQWA 4J2XA 3AITA 4HLZH 1HEJC 1WAWA 3N15A 3NRFA 4YLWA 2VI0A 1B57A 3SYAA 4AT6B 3Q6GH 2E8YA 1N68A 3JWNC 3GI8L 4L3EA 4Z76B 5SX5K 3S88H 1HW6A 2NXYD 1UD4A 1ZCRA 2JB5H 5C71A 3OMZA 2X0YA 3T6CA 1CGSL 4HWUA 4YHIA 4IG2A 1I8LA 2V5YA 5E8OA 3Q8FA 3T4WA 2BNQA 4Z23A 3A3WA 1M05A 2VDNB 5ID1A 3N9SA 1MCPH 3KVPA 4MX7A 3IACA 5BNKA 5A6BD 4RSYA 1ZLVH 3K3QA 4TSCL 4ZAKA 2JF1A 4K94H 1F00I 4ODVH 2V17L 5HTSA 3NEXA 2MCAA 5DEJA 1UKOA 4P7QA 4GUPA 3LYEA 5DD6B 4CVXB 4IYKA 4Z3TA 5DCEA 1ZK5A 3FOMA 2Z00A 1IQWH 5F9AC 4XP6H 3FZUC 5F93C 1VAHA 3H8AA 2J8OA 3HHMA 4LLAA 3EHBD 3MAWA 5I8OH 3CT7A 1QLEH 5BUAA 2E68A 4PCNA 2XV6B 3VW3L 3L13A 2J1KA 5BQ7B 2NY1B 4LB8A 4NRZA 1CDYA 2CC0A 1BFVH 1E28B 4NUGL 5FYKH 3GSOA 3QSTA 1J8HD 4NSKB 3DZ1A 3VMOA 3IJEA 1XXDC 5HDRA 3NAVA 3RJYA 1A7OH 4C6DA 1A3LL 1YDPB 1YHTA 2F84A 3FLUA 1HNFA 1YNKL 1R2RA 1OX6A 3QZPA 2VCAA 1U3HB 1ZV9A 4NUGH 1FAKT 1V5JA 2R0KH 4G6JL 5BVPL 5LKNA 1UWIA 1DUYA 5DJ6B 4LLYB 3GI9L 4NKCA 3GPEA 2GZXA 1ETB1 5KYXA 4W6XB 5DVKA 2R4RL 1IQWL 2V82A 1JNHB 1LM8V 4UDTA 2I25N 4Y8FA 1QEWA 2DWTA 2VSKB 4YK4B 2V33A 2IGLA 4Q4MA 4OGAD 5D5ME 5CAHA 4YFLI 3MYOA 2X2IA 4G7QB 2EACA 1INQB 1TU2A 2ZOKB 3DJSA 3IS4A 2VZ3A 2EDMA 2A6KA 1PZ1A 2A5HA 1C08A 4OD3L 3P0YL 4RGND 4LY4A 1U8OB 1I1AB 1W0VA 3CNKA 2GIYA 2AEIT 4FFZL 4ONGL 4YS4A 3IK4A 1MFBL 4PG2C 2NY5C 2ZUQB 3R10A 3FKRA 5C6MA 3BKCL 1WAEA 5DVLA 1Z9SB 4Y9PA 4IOSA 1DBMH 2QCMA 1AJ7H 2CZNA 4JHOA 4OF5A 1UR1A 4XK2A 4UDUA 1KPUB 2QSVA 1NKOA 3NIFB 3TTOA 2FBOJ 4LHUG 1K9FA 4L5FE 4JZJA 3OG3A 4XBJA 2Y1AA 2FIKA 4J27A 1PYWA 1AGDA 1CTNA 3FT0A 4UNIA 3O6FD 5SWSE 2BM3A 4X4YB 3LRLA 5D1XB 3SCPA 3ISRA 5I23A 5DO2D 5TJWK 4MTMA 2VTFA 2Y1ZA 5AW0B 3M17A 3MLTB 3NZUA 5FA4B 4G42A 1RXOB 2DJXA 3GNPA 5EU4B 4DPQA 4X99A 5C07E 3HUJB 1S2UA 3RGHA 4IPPA 1K3ZA 5EEVA 1V08A 4FQLL 5JR1H 2QSTA 3QBTB 5J06A 3UGUA 3O63A 4LC6A 1L6YA 3IKKA 2X6AA 1YEJL 5EN2A 2MQ0A 3WQDA 4GXUN 1HOEA 1WFMA 3CDFA 3HR5A 1I8MA 1VACA 1IEQA 5F4XA 1MREL 3UBHA 4A8IA 4DO7A 3LTPA 1RHCA 5C0RL 3NO3A 3SQOH 4NJGA 3O9WD 4KRNA 3KHJA 2WUCH 3MWAA 1G94A 4I6KA 4DJED 5JXQA 2H1LM 1DANU 5AC4A 4J3OD 1JK9B 3FT4A 3ZDXB 1OPGL 4UYPA 4FXFA 4Z18A 3BEVB 3BJLA 1QO3A 3GDBA 3VXRB 3SQLA 2XV0A 4LPVA 4N0YH 3OSKA 2E28A 2IAMB 1DIEA 1E9LA 3PWIA 2XZAL 4KRPC 3V5FA 3ZVVA 4QRBA 1YYLL 4GIYA 5DMGD 4M7ZC 3P81A 4ZMYA 4MWAE 1XIHA 5C3IA 3K6NA 5HDBB 3NEVA 2PPFA 1JZ4A 4ORGA 5C9WA 1UIOA 4GKTA 2XHNA 3S97C 1IIKA 3M7WA 4R97C 5EF1A 1DN0B 4N2MA 1U8MB 4P2YA 3D0LA 2W9DL 2C34A 1MCLA 4MZ8A 4Q33A 5HI5C 4YLBA 3FN9A 2EUZA 4WY7H 6FABH 4O57A 4NIKB 2DH3A 1OHZA 4HH8A 1NCIA 4H8WL 4LCWD 4NHUA 3PBGA 3SUUA 1BD0A 3VFOA 2O9RA 4LLYA 2D31B 2E7LC 3AREB 2HYMA 4HBKA 4A3RA 1OTTD 1Q1JL 2RB8A 4RGOL 3TBYA 4OI9A 4UIKH 4BH7B 1BZDA 1SXBA 2NNXA 3RPDA 4LPTA 2Q9OA 2YWZA 2D22A 1EZSA 2PEVA 3BZFB 4AUBA 2WKOF 3V79C 1V77A 3C4UA 2BHYA 3EKCA 2A73B 1J8HB 2X2GA 2VWTA 2UWFA 5J6GA 2WXLA 2W38A 3HHSA 4HCHA 3TIDA 2K78A 2ISDA 5B4MC 2AK1H 3NJNA 5DTFB 1U4EA 4Y5YC 4QPEA 4RVBA 2ZF9A 4XNXH 3DDMA 4ZQRA 3NDYE 3L3IB 3OXRB 3ZKND 4EWJA 2NVDA 4JVPA 1M65A 2W0KA 1DQQA 4BQ6A 5AOLA 1SHWA 2LU4A 1SF5A 2JE8A 4QRPB 3CV6A 2XYCA 3NACH 1RLBA 3NESA 4FG2A 4PLOB 1S8DA 1QNVA 4PRTA 4Y16A 1BWVA 1MZRA 4FXGB 3ZOAA 3JSSA 1AE6H 2R94A 2MRYA 2PLTA 1XM3A 2OSLB 3THUA 3K0WA 3CDGA 2E4TA 3G5XA 3QN3A 1IL1B 2PMZA 4MNJA 1ET8A 3EYOA 3OPUA 1U1HA 2OWXA 5JH2A 4HJSA 4XQ6A 1JZGA 3MJGX 2VZSA 4IJ3C 5T1LD 4HLEA 4MRCA 1ME9A 4P9MH 3W2MA 1DSYA 1UHVA 2E75C 4QHMA 4H26B 3V7AE 2HFGL 3SGUA 2DDXA 1T6BX 2CRMA 2NSQA 4F5CA 2LABA 3ERPA 3P11H 4DESA 1T7WA 3ULSB 3NSNA 2G5BB 2WC7A 4BSJA 1WWWX 4MQSB 3W82A 2J75A 3LG3A 3PBVA 1IKNC 3PWPD 4MD0B 4L9YA 1S7RB 4GSRA 1WBXB 4AEHH 4F0KA 3SIKA 1JNJA 4X7CC 4UQBA 1N19A 3BWSA 3DHUA 3MA7B 1LTDA 1V3IA 4D9RD 3HR6A 1UR2A 1F8TH 2VUYA 1EJUC 2IPFA 4JFQA 3RPIA 4FABH 2ADAA 4KX7A 1G69A 3FB6B 4M5YL 2BP3A 2OTUA 1SQ2N 4LAQL 5AKSA 3W5NA 4KIEA 4R9OA 2X89A 1RJZB 3US1A 4RDWA 2WXHA 3F04A 3RX2A 2GIMA 2XKNA 4PTUA 1KYOK 1W1TA 5EBWA 2CQVA 3WF2A 4NQVA 3HG1E 5K4ZA 4NQTA 3F6JA 3BT2H 3WD1A 1OJXA 4PBFA 3VVGA 1TJHL 2VN4A 3BWUF 3KGUA 3PXHA 5DJXA 3RKDD 4WJG3 3ALXA 1IAKB 2GUUA 5CILH 2DQWA 1EX1A 2F1EA 4NZ3A 3KP0A 2I5QA 3LI0A 2N59A 3AREA 3FT2A 4YSSA 1V6UA 3M1OA 4HEPG 3URNA 1J9TA 3JV6A 1I6NA 1D5XA 4FQ1H 1QNRA 3G3DA 2XN2A 4U1GB 5DQDL 1GKRA 1YDOA 3PAJA 1O9ZA 3EB2A 3X12A 3TJPA 4WFFD 2DQIH 1G1OA 1CLYH 5D71H 3BPLB 1UB6A 1Z7AA 4N4PA 4K8HA 1ZT4A 5BRZB 3UZ5A 1BZ9B 4DWHA 4CKQA 1XRVA 3CQ0A 1T2QH 1E9ZB 1YDYA 4JHUA 2HPMA 4W9KC 1V7AA 2BDNH 4NGHH 2DIBA 2BSCA 2C4FU 2PO6C 3E2RA 5LG1A 4NXSA 4WHCA 3HS0B 3KGTA 3M0VA 1AIFA 1SZEA 2J88H 5AHMA 4Q6IB 3CVBA 2BVOA 1Q1PA 3UR2A 2P7TB 3MRFB 4I2XA 4XXDB 1R5WA 2Z1BA 4PUJA 4MNLA 3TMQA 2BHFA 2Q8BL 1BVOA 2QQQA 3MODL 3I9GL 4HUVA 3W4RA 4JZ5A 5DMNA 1DFXA 5A2KH 1ZGLB 2XM1A 4DVBB 4A4AA 4Y4FC 4C56A 5E2WH 1KA9F 3PM6A 3I10A 3GEWB 5HGAA 1N70A 2XV2A 1NCTA 3WLWD 1N8WA 1FNLA 4NQQA 2WSDA 2ZWZA 1TFHA 4H26A 2G2PA 5D72H 5JOPD 2NY7H 4JDYA 3APNA 3CQHA 1I2RA 5I6PA 5EEXA 4QE4A 2QPSA 4H20L 3TASA 3TZVA 2H6UA 4YCPA 2NLIA 5DJ0A 2X05A 3V4UL 1LTXA 1USZA 2V3FA 3BH9B 1MY5A 3G04B 4JVWA 4XGZB 5EOCJ 1KNWA 2J55A 3RA7L 4F37K 1CW2A 2ZE3A 5HPCA 2EQDA 2NW2A 3BKJH 1RK1A 2VXVL 3PZUA 3OG2A 3VFTB 3SGEI 4ICCX 1FC2D 1TQTA 1S9WA 5DT5A 3TA3A 2HTKD 4XNYH 1RJLB 4QLJA 3STZB 4QWWC 2KL6A 2OJEA 1X5MA 2XQYG 4NQEB 2GDVA 4K3ZA 1CUOA 2DIKA 3FTVA 1ZS8B 4V11A 1OCZB 5J13C 2WV3A 3OGCA 4Q6XA 1Z9NA 3KOXA 3WN5B 1EOKA 4KDVA 4PJAF 1VZIA 7XIMA 1N2VA 3FFCA 3M1BB 4YZWA 2NV1A 4WCYL 1ACCA 3UCQA 3BVJA 5KVDH 1LO0H 3X14A 3BD3A 4MMYB 1UZ1A 4PGCA 4DGYH 5CZVH 5D2NC 4PQXA 5T3ZL 7PAZA 2ZWSA 4D9LH 3MBEB 4G9FE 4OCWH 4G2DA 4KCVA 1HH6A 2PR4L 2Y5QA 4LEOA 1YNLH 3EEGA 3V0WL 4R4BA 4ZTOH 4XXWC 5BZXA 5L2KD 3KJ6H 5CHNA 2W0UA 4MY8A 2JK5B 4JFSA 4XAFA 2FAUA 3WY2A 4O9HL 4QEEA 5AB0A 2AJXL 3V0AC 3EDFA 5CN2A 4XKYB 4XODA 5CPQA 1YNKH 2YGPA 4LKXB 2X0UA 2GUOB 4IU3B 3OZ9H 1BVWA 2WWDA 3CD4A 4GKZB 5INCA 4POZD 1SBSL 4G11A 4W7UA 2WVSA 3TA4D 3SDCC 1TCRA 3TBTB 1R9YA 2A6LA 5KVEL 2WIIA 4OKVB 2YPLA 4N1HB 4PGBB 2INZA 3UEZA 5CPMA 4NQUA 3TPKA 5CBEA 5KANI 3GBMH 2IAND 3LCXA 4OZIB 3RKDC 4MA1C 2DM4A 2A74C 1I1AC 3DVIA 2NV9A 3CLFH 3TESA 3ABLB 4WUUB 4EPKA 2IGFL 3OLIA 4G1EA 3FQWA 3QMRA 1S7TB 2N1KA 2H3BA 3WBYA 3ZLGA 1R5IB 1GC1C 3O6MH 2JXMB 3QWQB 4FEIA 4X0KA 4M6OL 4W4OC 3TT1L 3VG0H 1INEH 5E00A 5LKYA 5DR5L 2O72A 5DLML 1E51A 1GYNA 3QYQA 4FI4A 5IW1A 4OF8A 3SRDA 3I50H 3GMNA 2E7DA 1JPDX 4EI5A 1SY6H 5ICYB 4N5ED 3WH8A 3DETC 1J18A 1CIUA 5EOTB 1IVLA 4DEWA 2QJMA 3G1XA 1TJGL 2VN6A 3VCRA 5CUSL 2AXGB 1TZGL 4ODXA 4Q8PA 1OF6A 1SJVA 2DQFA 2O4EA 2YL5A 1KB5H 2CIIA 1LOSA 2JKWA 1VBHA 4Z7NE 2VRQA 4DFHA 4FFVC 4OV5A 1P0KA 4DKFH 3VAVA 2IO5A 1X7QB 1SXCA 4Z7WF 4NQDD 4TTDD 3V6OC 3VFTA 4FNRA 1F07A 2XH4A 4DJFC 4NPYB 4LL9A 5C97A 2NTSP 2EBNA 2OYLA 2VT0A 1T7VA 2YO3A 3W07A 4X7TB 4OLXL 1DV7A 5CR8A 4KFNA 5FEPA 4Y9CA 5JIWA 3KTCA 1X7IA 1EXPA 2DT3A 2E77A 4LMQI 2DUAA 2E27L 2EDJA 1U22A 3OGVA 4I13B 2CHNA 1UD3A 5HVWA 2R2EB 4CD6A 3KBFA 1DBKL 4RIRB 5CPNA 3RFRA 2Y3AA 3FB8A 2DT0A 1P1VA 4XOCA 1T7ZA 2YK1L 5LIXX 1AACA 4P2OB 4TMPA 2OI9B 5JPNC 1ZGLM 1A0DA 1BXAA 3UPMA 2V2WA 3TC6A 2FDMA 3N6HA 2OZ8A 1S2EA 1UROA 1CD1A 3WH5A 3W39A 3NBNA 2XC8A 3KYMB 2HMIC 1T4WA 4LOFA 3MRMB