1J0JA

Crystal structure of neopullulanase e357q complex with maltotetraose
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
588
structure length
588
Chain Sequence
b'MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLYSGEEKLVYTEKGFYFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPSISPEGSRPWGSEDPTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGESSKYKDWFHIHEFPLQTEPRPNYDTFAFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGQIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRSLRRGEISFLHADDEMNYLIYKKTDGDETVLVIINRSDQKADIPIPLDARGTWLVNLLTGERFAAEAETLCTSLPPYGFVLYAIEHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords neopullulanase
publication title Three-dimensional structure and substrate binding of Bacillus stearothermophilus neopullulanase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 193
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.2.1.135: Neopullulanase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j0jA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1j0jA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1j0jA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1j0jA03
1A1NA 1IC1A 4LLQA 1GGBH 3CPLB 3WH6A 5A2FA 3ZR6A 3EIFA 1UKTA 3QNYB 3QQ9C 2LAAA 4YBHA 2YSSB 5BXPA 5C0FB 3HS0A 1MWAB 3LMJH 5EUKB 1AP2A 2PBGA 4Y88A 4WDIB 5EORH 4PV8A 3IGUA 3P4NB 4AC1X 3VSVA 4ACYA 4PJ8B 4GRWB 1GGIL 2W0LA 3LAFA 4Z7VB 3SN6N 1JF6A 4PG9B 4CRPA 2CETA 4QFUA 1TDQA 3V6ZB 4YDIL 4HKZA 4W8BA 3ZOAA 4UTBL 1S9XA 5ILTH 4NUJB 4JN1L 2Y25A 1SR0A 1QNPA 5E1QA 4JPKH 5DUBA 3LKSA 1GOIA 4UV7L 3DX7B 3EYUL 3MV11 3BGFC 5MI0C 4IPLA 4D9RD 3O11B 2VXSL 3UTTD 2HTKC 3O3AB 1LWRA 3CUHA 4OZIF 2HT2D 4WNQA 1S7SB 1CLYH 4Y2DA 1IEAB 1CL7I 1VFBB 2BNQA 4G43A 1NC2B 2BNRA 5DS8B 4CD8A 4ZPVA 2XN9B 3HMCA 2OSXA 3OA5A 2QMKA 5DRWA 3GKWL 4K7PL 2OTWA 4PB9L 4YXHL 4FA8A 2HVMA 4XXDB 5GIRB 3L3IB 4XP4H 2DD8H 4GKNA 5DVMA 1UM5L 1OVZA 2H8PA 3GI8H 5ANME 4G6KH 2Y36H 5GRWA 4HC1H 5EB9A 1TPXB 4TSCH 3N85L 4X5WB 3P9MA 1AIFA 1CIDA 1TIUA 2BHZA 1TFVA 5E08H 3QGVA 2YBRB 4QWWC 5T1DL 1UR8A 3MCKA 4NYLA 3P9LA 3EYVA 3SDDA 4EVNB 3HUJB 4CJ1A 3QCVH 1OP5H 3KLLA 2R8SL 1Q9OB 2DIBA 3W2DL 4M56A 1FG9C 2J8UF 1NCNA 5J6HB 4UOJA 3UBXA 2DQGL 3JBG7 4XCYA 1EEZA 3P73B 3A22A 3HN3A 4GXUM 4XMKH 3VFOB 4AMCA 4PRBA 3R1GL 2BSSA 4DN4H 1WIPA 2EKSA 3IJHA 4IOSD 4U6XA 2FR4B 3JVGC 3SO5A 4Y5VA 4LHQB 3RVWD 1VADB 4PUDA 2OMBA 4NZDA 3FONB 2WBJA 5CBEA 1RK0B 1U8JB 5F1OB 2DQTH 5A6BD 5JDSA 4R27A 4IRZL 1IGYB 4GW4B 4V28A 5C2BH 3F5JA 1N82A 3OLDA 5FO7A 3V6OC 1I1YA 1I1AB 5EO0A 3U0PA 4FXGA 3MZGB 2CKNA 4LGPB 5TDPB 3ZHDA 4BS0A 1G84A 5HDRA 2XPGA 2CIIB 3HFML 3OGCA 4XVUC 3WL1A 1HKIA 3WKML 2BDNL 3QEQE 1WFUA 2VZUA 2WUCH 3T1FB 1MCWM 1R3KA 3CZFA 1GC1C 3MFFA 4YEFA 1K4DA 1QFWH 2G75A 2OSLB 4ZO8A 1FH5L 4HUUA 1MJ8H 5DD1H 1QNOA 4OD1H 1DCLA 1AE6L 3OLEA 2DI7A 1RJYB 1SEBA 2VDLH 4GMSH 3BKML 5INDA 1HJWA 3IJ8A 3PGCB 3W25A 2GAZA 5JQ6H 3U4EB 4EKXA 3RIAF 3VXPB 3STLB 1BOYA 3LRSA 4OFYD 5ISZB 5I73C 1N2RB 5D93B 3H53A 2BSTB 3JSSA 4BFBD 4B15A 1OAQH 5BZWB 3UMTA 3UTZA 2EACA 3DJ9A 2AOSA 3O8XC 3FT3A 2OL3H 4KVNH 5SWZB 1RZJL 1JNHA 3E3QC 4HS8L 3S34H 5CSBA 3DECA 1FFRA 1F4XL 1OP3K 3PHOA 3W28A 5E94B 2EDJA 4MNMA 2EDXA 2AXGB 4PJBE 2GK1A 4IMLA 2VAAB 3SDYL 4F7MB 5EU7E 1ETZA 3DWTA 4NQEE 3SKJH 3FQTA 5D70L 4W87A 1MRFH 3BD5A 2HVJA 3VWJB 4ZE5A 3H42L 1HKMA 3IANA 2EJ1A 2FGLA 1FFOB 4WUUA 1JVKA 1K8IA 4HWZB 5C07A 4CAGA 3WDHA 4XPFH 4XC1L 2AW2A 3LKRA 3AXLB 3AICA 1YEDB 4S0TD 5GGTH 3FJTA 2BC4B 2Z92A 2I9TA 1FCGA 4DVBA 5KSBB 3DO3A 4S1QL 2HH0L 4OI8A 2IALB 3DPBA 3RDTA 1L7IL 3T8XB 2EYRA 4NCC2 3VWKC 3KL0A 4AH2A 3TFKD 3SCUA 3U82B 3KPNB 3HG1A 4F7EA 1QOKA 1LNUB 1YEGH 4FQ2H 5IB1B 2FNBA 1WBYB 1AGFA 4FXKA 1FGVL 3B8YA 2J4WH 3VMPA 1LJYA 4YHIA 4UZUA 2R0WL 4PGDB 1CGYA 5C0IB 1BEYL 4HH9B 5I1HL 2R9HC 3CH1A 4FZEH 5CP3H 3DHUA 5HGHB 3WUWB 4K8RH 5CHNA 3L9RA 1A7PL 5EU3A 1FNEB 5DHVA 2YBTA 1A64A 2JJSC 5C0CD 3BP7B 4YK4B 3OAYH 1UQZA 4QRPB 5KSUA 5L6YL 3GK8H 1YYLL 5FL1A 4PTTA 1T03L 1K6QH 3APGA 3TZVC 2F53B 2WNGA 3A6OA 4WI5A 4PJIE 3W6LA 1TITA 2QHRL 2V5CA 2HJFB 3PNWB 1V0MA 3RVXC 4P4KB 4Z0BL 5GS2H 1U8QB 5D9SB 3CSYA 1UKOA 2V9RA 4Z2JA 1F6LL 4I77L 5FUZL 4AIXA 1UWXH 3RFZC 1LEGA 5F9WB 3CFDB 3SDAB 2KH2B 3DHPA 3HE6B 1HCFX 1QVOB 2PI6A 2Q7YA 2ZPKH 4YHOL 4LPXA 3SGDI 4BQ3A 3RHWF 4GQPH 2ED7A 3W0WD 4E4PA 1ZS8A 3LRMA 2DQCL 4G8IB 4MJ5B 1RZIB 3HC4L 2VCCA 3RU8H 4NQCB 4LPVA 1XH2A 1HHIA 1OPGL 4NKMB 2C3HA 3NYDA 2QSCL 2HKFL 1C5BL 3RWJB 4A2MA 3H9SE 2YPVH 3F65A 5KS9B 1FN4A 3FQUB 1KB5L 4KKBD 2MPAL 3QDJB 3WIFB 3GSWA 5HDBE 2GY5A 4GRLC 4MHHG 5E70A 1JI2A 3RPIA 3Q3GA 4PRIB 5IB2A 4MX7A 4YFLI 4O58L 3GB7B 1ZVYA 1NCTA 4I4WA 43C9A 3TBWA 4ATDA 4Z77B 2EIEA 1XD0A 1AJ7L 4LDOB 4PV9B 2HYMA 5GSVA 1BX2B 4GW5B 1HHHB 3ARGC 2OYLA 4JAMA 2KPNA 1JDAA 4X9GA 2VIRB 4Q7NA 3HMWH 5KEZA 3MJ7A 1E6XM 1E9LA 4OFKA 1Y7VA 2OM5A 1AXIB 1ED3B 5DT5A 3FW6A 3DX9B 2VURA 3QIWB 3U2SA 4I0PB 3I6LE 4NCC1 1DBKH 2Z31D 4JRYB 4U2ZA 2UWEB 2JIWA 4HPHA 1UZ6E 1R3HA 1ISVA 1JTTA 5B3NA 4I3SL 2WZIA 2VDPH 4PTXA 4WVRA 5C2UB 1MNUL 5T1MB 4CD5A 3RWHB 5C8BB 2VXUH 4XWGL 1MCPL 1TZ7A 3TOPA 1GOGA 4UQCA 1A7QH 4ZOBA 5E6IA 3RNKB 3VILA 3T0WA 4P5TB 3GXTA 4MQXC 5L8LB 1RUQH 3B2UD 4TNVF 5SWQA 4IPNB 1CU4H 4P9HH 4PJGB 4Y4KB 2B5IB 5IIEA 3EOBB 3G6LA 5EPMB 4WGVB 4RCAA 2B1HH 5CAYB 3REVB 4CD4A 2KBGA 5GS1A 1KENH 4MPKA 3BVNB 3O4LE 5IB4B 4GG6A 3VH8A 3TIDB 4HQQH 5CLWA 2FB4H 4HUXA 5JR1H 4KK5C 1S7WB 4MSWB 3ECQA 5ICZA 2JJVA 2V7HB 5BZDB 1KXTA 5D8JL 2GHWB 2F54D 3NIYA 3VXMB 4UQ2A 1SEQH 4LKXB 2XG5A 3DYOA 2QKIA 1NGWB 1NKRA 5DJXB 1CGXA 4F8QA 1J8HA 4ETYA 2PR4L 3TPKA 2V3DA 4PJ9A 5D7JD 3VXRB 4S2SA 5IHUH 4PR5B 5GXBB 4OZFB 1QFHA 2V5MA 4FFZH 4MQTB 3F6LA 3Q6FB 4R0LA 4JAWA 3QHTC 4Y19E 5DD5L 3OKLB 1KXHA 1N64L 4LP5A 2GTZB 4N0UE 4OCYL 1LEKA 1KCSH 1XV8A 3BUIA 4MS8C 1R5WA 2GDUA 4JE4B 3U83A 1MWOA 1QD0A 3O9WB 2AKRB 3WN5C 3SKMA 5DD6B 1QW9A 5F7KC 2EDEA 4ZTPH 2B1AL 5IGXH 4JANB 2APTA 3CUGA 3LQAL 2VO5A 2XIDA 1T5XA 3CUIA 4U1MB 5HI4D 1FP9A 4EK7A 1A1OB 3MRBA 3IKKA 2X4SA 4OZGE 1AH1A 4HJ0C 4EN3D 4IMKC 2Y9RT 5FA4A 5FUCE 2ITCA 3WD5L 2Y8VA 1DQLH 3WXVL 4OUOA 5D1ZB 5A3IC 1UWGH 2ZCHH 2ZKHH 3MCG1 5EZIL 4NHCL 1UXWA 2WINB 1F3JA 4KJQD 4YDVB 4LCWB 2OI9C 3SCPA 4G8EA 3BGAA 2NX5D 1OM3H 4MJ6A 2XICA 3S37H 1BD2D 4BH8B 5DTFA 3D4ZA 1E28B 2XWJA 4DM1A 3KPMB 3EOYG 5CEZH 5I19H 3R0MA 3FB5A 2NTSP 2X10A 1S7VA 2CCRA 2LU7A 5DUPL 3PWVB 4OJFH 2OWCA 1MJJB 3ROOB 1Q6CA 2CDEB 4PJHB 4TVSa 3WFZA 5E2JA 4Y4HD 2NXZD 5FHAH 4UNIA 3EJSA 1WITA 1ZT7A 1UB5A 2D73A 3M8OH 2DBJA 2XWTA 1RU9H 1W3JA 2O9TA 1WBXB 1TFHA 5DJZB 1UQSA 5EUOA 4PGEA 4FQQA 3BUYB 3RM8A 1KJ3L 1ZXQA 4ELKB 4NQDE 1NSNH 3CZGA 3AOFA 4IRJB 4X5XB 3UZEA 1MCJA 4ISVB 3WF3A 4G42B 3L4YA 4QHKI 4ZDHB 5HD8D 4PJEF 3P2TA 5E1AA 4YN5A 3GHEL 5I77A 1NARA 5H8DA 5IWLC 2DQFA 1EGJL 3JWOH 3NH7H 4QTHB 3RGVC 1S7XA 2BVPA 5CQ1A 1XGRB 4JFQB 3IFNH 3TNMB 3QWOB 2FEDC 2EH8H 3BPLB 4PJFB 4TTUA 5GGVL 3V5DA 4H5SB 2I5YL 4AL8L 1MFUA 3VRIA 4K71B 2P24A 2V5TA 1DSFH 3N1AA 4XZBA 1IC7L 3ZO9A 4XWOC 4U7MA 4PY7A 1MEXH 1FNHA 3DXAE 4WI6A 1I9IH 4LGSB 3C5JA 1DLFL 1VEPA 1JYWA 5CJOH 3TH3T 3LVEA 5JW3L 2NY6B 1D5MB 3RX7A 4EBQL 2XQYG 3PV6B 3V7AG 3SCQA 2RGLA 5I1IL 3AAZA 4DAGH 1XEDA 3TO4D 1LK3L 3WDPP 4MQ7A 1CFQB 3LN4B 5DC4B 4UFIA 3SGEH 4ODHH 1P4LA 1CFNB 5IFAH 2ZUVA 4X8JB 1JI1A 3P30H 4HV8A 3V4UL 4CN4A 4ZSOA 2VRKA 1EJOL 3T2NL 2YN5A 3LHPL 2NY4C 4LPCA 3RVTC 4HS6A 5C0CA 2O5YL 2W9EH 4LVHC 1IRAY 4U31A 2ZWYA 4Z76A 1FZOB 2GI7A 2V7NB 3BISA 5JPNB 4MCYB 4Z2HA 4U33A 3PUCA 4YDJA 1KB9J 4X9HA 3ARRA 4HIJA 1NCCH 3B3IB 5HVGB 1EEUA 3U79A 1T5WA 4WV1C 2TAAA 1OD8A 1TQTA 3NPSC 1SBBA 5IW3A 4TVPD 1HHKA 1D5XA 2J78A 2IH1A 2PWHA 3OG4B 5FYKE 3D39B 3S5LB 4JFOB 2AXHA 4WCYH 3Q5YA 1GOHA 3FFCB 5ENWB 1TJGH 1JGEB 4U1GB 5AUMB 1GOFA 3FQWB 4YR6B 4NKOA 1GONA 3BRFA 4X9IA 4X80H 3SQBA 4C56D 3I6KB 2EYTA 1WPCA 4JLRA 4QHLB 5JO5B 5EN2A 3EAKA 4HKBB 1EUTA 1H09A 1P7QB 3NFNA 3QUYB 4W81A 2QADC 3O0RL 5IVXA 4D3CH 3QO0A 4OZIE 4HOXA 4ERSL 4ODVL 3BW9A 2LFGA 4L3EE 2W66A 4HIXH 4YXKL 2AV1A 4UIKH 2ZSVA 4XC3L 5CPQA 3QP3A 3GSNL 3F6IA 4CVWA 4OKVB 3HRPA 4OIFA 3KLAA 4NN7C 2XTJB 1OB0A 5E9DB 1JXJA 2DLEA 1BFSA 1RSFA 1T2XA 1TZIA 3IJSA 5ISZD 5IM7B 1EXUB 1CD1A 2BJML 2CK0H 4K3JL 2ERJC 4RMTA 2ENSA 4U1NA 1NWUA 2IXUA 2YEZB 1KV3A 1M05A 1PD6A 4A2LA 3PZTA 4Z7UF 4LAQL 2H9GA 3QZWG 5BMFL 4S1DD 3GJFK 4KMTH 3WJLC 1U41A 2AJXH 5DJ6B 3IS0X 5GGUA 2W92A 3SE3C 5SV4A 1JFQH 4KPHL 4O02H 4M1DL 4NNPH 3C6LD 3FKUS 3GMMA 5JUEL 3ZYZA 4AT6B 5FUOH 5D2NB 1DN0A 4BKLB 1JP5A 4DKEH 1R3JA 1P4BL 5JORA 2Z31A 4XUYA 2J8UE 4IS6A 3UAJD 4N90E 1NAMA 1CFSB 3TC9A 3ELAT 1A7RH 4LSQH 4DQOL 4ONGL 3VFPA 3BEVA 1VGEH 4V2CB 2X4UA 2OR9H 4MCZA 1GOOA 1UWEH 4JHWL 3L4WA 2V17H 3EDDA 2CRZA 4QXTA 3RY6A 3GSXA 4W85A 4OCXL 1AMYA 3WIHL 3FMGH 5DMIL 4PMNA 1KTRL 4LKCB 4ZTOL 4UT6H 2VXTL 3X14A 2P4AB 4LCUA 1LD9A 3E3QE 2X9YA 3KR3H 3QULA 3BJ91 4X7TA 1REIA 3OX8A 4YX2H 3CLWA 4Q0XH 4MYWB 3B9KA 4NQED 4GXVH 3X17A 1R7AA 5HYJA 3P11L 5TE6H 5IB5A 1C1EH 1RVFH 4HXAL 2ZCLH 4LVEA 2H32A 3E6HA 5C0GB 2WSPA 3LKPA 2WC4A 1ORSB 4K7FB 5E8EB 1A9BA 1AD9A 2CRMA 3MO1B 3AREB 3QUXD 3ILPB 1HKLH 1P5VA 3DV6A 4Y0GA 1JPSL 4R90H 4M8VA 3SDXF 3LEXA 2F54A 3Q0HA 4NOFA 1YMMA 3SKOB 3ULVF 1IC5H 1RJLB 4EZMA 4WJ5A 1D5BA 3MV8E 2VISA 4HKXB 1WB0A 1OF2A 3BZ4A 3KPRA 5LBSL 3MBXH 1UCBH 3VFWB 3T1WA 1J9YA 3EMZA 3AIRA 2F53D 1DDHB 2X4PA 5HYEA 5FYJD 3KZSA 1BOGA 4RMSA 1CGVA 4MMZC 3SURA 3FCTA 1ZKAA 4Q9BA 4P4KD 1KLUA 3SE4C 4PJCA 1AGDB 3CTTA 2P5WB 2Y72A 4Y16D 4HA4A 3OZOA 3SDAD 3EFDH 3WQVA 3ALGA 2R2EB 1KBGH 4NJAL 4Y5YB 4KKLC 2R69H 5KVFL 5F97E 4UR9A 3EZJB 4AMKL 1B0WA 2VXVL 3EOTL 1J0IA 4UNUA 2XM1A 1G9MH 2E7BA 5IHZB 5F88A 5F6IB 5EIVA 3ARFD 3ILQD 5ABGA 5IMKB 3VGAC 4JKWA 3ULVC 1B3VA 4DZ8B 4L9LA 4EEEA 3MJ8B 1KJVA 4EN3A 3MANA 4MD0A 3D48R 4CU6A 4KK8D 3QDMB 5KG9B 1U3HC 4LSRL 3V0VB 4KGJA 1NFDB 2AQ3A 5GRYA 3VNYA 4IEFB 1CICB 4HKJB 4N0FB 4P2QE 5AG9A 3WY2A 5ALCH 4RE4A 4W68A 1T7VA 2E7LA 1VSCA 3VDBA 1LG2A 1BD2A 5DZLA 1MHCB 4R97C 4TUFA 2HA1A 4AD2A 1AGEA 3LH2L 4FTVE 5L9DL 4HHAA 3U30C 2J25A 3RUGA 3IGAA 4K94H 4HZLB 1EIBA 1NFIA 3RILA 2X4RA 4AZCB 3NN8A 3CPLA 2PYEE 2Q8BL 1ZVSA 3H9SD 3QNYA 3HI5H 1V02A 4Y4HA 1KCRH 3NOIA 2DL2A 4GQ9H 4MNQB 1MWAA 4JM4L 2N7AA 1QSEB 2PO6B 2ARJB 4RE3A 1H3PL 4WDIA 3ULUL 1IKNC 4YHLL 5C0EB 4DOHB 3P4NA 4PJ8A 4DWSB 5D7IF 3LEYH 4Z7VA 1EDQA 5HHOB 4QXGH 4GFTB 4PG9A 5BOPA 4NRRA 3TLRA 2QQLH 4AZ8A 5BV7B 2F1AA 1UG6A 3WH8A 3RVVD 5JUVA 1WLHA 1WZKA 2WWDA 2XI9A 5IFTA 5CSUA 5GRUL 4NUJA 3IXTA 5GRVL 3MLRL 3L7EB 3RPMA 2Y5TB 2R4RH 3DX7A 1C16B 4JR9H 4FLSA 1WVZA 3WL9B 1EEQA 1MRDH 2HFEB 3LOWA 4FN0A 3O3AA 3MMDA 3V4VL 4F3FB 1ZLSL 2QHAA 1S7SA 5HVWA 4M1GL 5ESAB 3S97C 1IEAA 1VFBA 4P8XA 5EDXA 2Q86B 4G6AC 4Z7QF 5C9JB 2WANA 1NC2A 5DS8A 1B3XA 4V1DE 2HG5A 1U95B 2C3VB 4FQCL 3Q1SH 1H5BC 4M3JA 3SCMD 3GBDA 2XFXA 4G6JL 5EU4B 4POZC 3ZHLA 4P23C 2UY5A 3LEVL 2J3SA 2XTKA 4DN3L 2HMID 5IFHL 1C8PA 2YUWA 4XXDA 2J62A 1CTNA 1DVFB 3GRWA 4U2YA 1W0WB 4JJ5A 3EOAB 1G7HA 1IGFH 5GGRY 4CVXB 4OZOA 3SGJC 1YEFH 1T6VN 4ATLA 3NDZA 3D0VB 3VXRD 1EHXA 2VX5A 1J8KA 2NYYD 5L2KE 4AWEA 5ABDE 1ZHNB 4X5WA 1QLEH 3OZ9L 4PG2A 4PRNB 1FDLH 4W7UA 1V5JA 2YBRA 3QSKB 2CR3A 3MA9H 2X8RA 1OSZB 2C4FT 2CIKA 3DOSA 1S46A 5T3ZH 3WSQH 3JUZA 4PPTA 3JV6A 3HUJA 4N8PA 3A47A 1GPOL 1DWFM 2C7UA 1Q9OA 1T7WA 4JIEA 1TNNA 1NM9A 3ZR5A 5HPOA 3QT2A 2HISA 1MLBB 3P73A 1LILA 1BLNB 1OW0A 3LZFH 3O9WD 3VFOA 5JBEA 1YEEL 4G8GE 4UOW1 5T3XE 1MREL 2FR4A 1MCOH 1JNNH 4QXWA 4YBQC 1HE7A 1VADA 2AAVA 4AG4L 2NY7H 3FONA 4OSUL 2YDQA 1RK0A 1M7IB 4IHOB 1IGYA 5FL0A 5DVOA 5EFIB 3ZKQD 5DJ0A 2VMFA 4EI5D 4MZ3A 3UP1A 4HK0B 1I1AA 2ZOLB 5E2TL 4C56A 1W3LA 4HCRA 2DSZA 3L5IA 5DZOA 4HWNA 5I6XC 2CIIA 3BYYA 4LCWD 1F3RB 4F9JA 4HMCA 1Y6KR 5FKAB 3P4MB 4X9FA 2NY5C 3T1FA 1HWGB 4PJDF 1OOAA 2Q20A 3RO8A 2BY2A 3MBED 3RWGB 1MOEA 2OSLA 4WTWA 3CHCA 1W0YT 4WO4B 3VFUB 5TGBB 1LWJA 1QHZA 5J13C 1RJYA 4MVBD 5GGSY 3W11C 4XHJC 1KJ2A 3PGCA 2VLME 3DVNA 5J9PB 3PTKA 2NY5L 3ULSA 3VXPA 3STLA 2MQCA 5ISZA 2FLBT 4XMPH 5AY7A 3KHQA 4ZXLA 1EO8L 4TRPH 1MPAH 5BZWA 1MCKA 1BP3B 5IHRA 5A8QA 2X1XR 35C8L 1EVUA 3EJYD 5SWZA 3NCFB 3RBGA 5JIIA 4WSKA 1NGZA 2IXVA 4G5ZH 2BHYA 5E94A 2AXGA 4K23H 5HY9A 4XV0A 1FORL 1KIRB 3C6LA 4M61B 4F7MA 3GSQB 4KZEH 2XY1A 1TJHL 2DAVA 2WLZA 4WWKD 3ZKND 5EB8A 3VWJA 5DK0B 3AQUA 1FFOA 3K0WA 2Z8RA 4CMMB 1E56A 3POHA 2VC2H 4HWZA 1MW1A 3ZT7A 3D50A 4QP0A 4ODUB 2OJZH 1Z6JT 1YC7A 4YUEH 4S0SD 1TZHA 4M9OA 2ALWA 1L7TH 3AXLA 5CEXB 4KXZH 1FJ1B 2X5PA 1YEDA 2WM0A 4PUEA 1LQ0A 2BC4A 3CIVA 4HT1H 2WP3O 4GXUN 3NCBB 1HINL 3PE9A 1JNLH 2IALA 1IAIM 4H8WC 2JF6A 1SY6H 5E8DH 4NQDD 3RGHA 4J6RL 1JTPA 1T1XB 3FN9A 1JPTL 3KPNA 3CAFA 1NUNB 4RZCA 5F7EL 1LNUA 4NNYB 1P9MC 3N9GL 2WWCA 2R2HB 5IB1A 1WBYA 4TOQA 4XCCL 4EE9A 4ODSH 1DFBH 5BRZE 5C3LD 4PGDA 4ZOEA 1LO5B 3RIAK 5C0IA 3C08L 5LKNA 2ZXBA 4C58B 2VVNA 4OUUA 5GJTH 1UA7A 5HGHA 4Z5RA 4NSBA 3WFEH 2UZXB 1GGBL 1FNEA 1HCVA 3C60C 1KTLA 1WEJH 3N13A 1I7RA 1OAZH 3BP7A 4HZ6A 3LMJL 5SWSD 3OB0K 2BOCB 1F3DH 2J8GA 1T1ZB 1LO0H 1WWWX 5HTSA 2F53A 4KRMB 4PLJC 4P2YA 1VA9A 4S1SH 2VLRB 4J4PD 1LF1A 3PNWA 2VVSA 4P4KA 4ZFZB 1JK8B 1U8QA 1UJ3C 3NVQA 5D9SA 2NZIA 4RQQB 4RX4A 4CADB 4W70A 4DO6A 3SDAA 5ILTL 1CQKA 1J87A 5HHPA 4TSBH 5D6CB 3HE6A 1NOFA 5C0RH 1OSEA 1QVOA 1D6EA 3AIWA 4JPKL 4PJ5E 1W32A 5MENE 2ESCA 4PJEE 3ARDC 3RP1A 1R46A 4FFYH 4JFYA 4G8IA 1INEH 5KZCD 1RZIA 1SZNA 2PW1B 2MMXA 3WE6B 4NQCA 1E1EA 5DDHB 4NKMA 1CLYL 2F8VA 3MRQA 4LDLB 4DEPC 5CJXC 1S78C 2XVGA 3RWJA 3QPQC 2ZJSH 3VX1A 3TA3C 2QMJA 1JYXA 3FQUA 2OR8A 2N56A 5F7UA 3W5MA 2RAMA 3MOQA 5EU6B 5CD5D 5IV2A 1ZGLM 2PXYC 2XTJD 4XX6A 3BAKA 1AKJB 4PRIA 2G5RA 2DQXA 5AYUH 3GB7A 4XP4L 2DD8L 2E3ZA 2K1MA 3N11A 1U92B 3GI8L 3NPZB 1RZKH 5J8OA 4Z77A 4PV9A 4YHZH 2Y36L 4NT6B 4ZNCD 3D4YA 2O9PA 1BX2A 4GW5A 4HC1L 1HHHA 3SPVB 4TSCL 1XHGA 4CD6A 3NSXA 3ROLB 2NY0B 5E08L 2VIRA 2ZX8A 4YAQA 4X6DB 1A6PA 3JTTB 3TV8A 3BAJA 4L3ED 3KXFB 1ZK9A 5HDQH 4OGZA 3HNSH 3UBXG 4HMEA 1ED3A 1OBAA 3MOBH 4YPGA 5F1NB 5C08B 4M9PA 4HF5H 3QIWA 3QCVL 5HYIA 4IDJH 4ODXB 4I0PA 2NY2B 2ZG1A 5C09E 2DJ4A 3RTQD 1DQJA 4JRYA 1NGYB 2UWEA 1ZGLP 1S9WB 1RY7B 4XMKL 4XP6H 3IDJB 2OQJB 1PKQB 2CRYA 2R29H 4RFOH 5FB8B 3RWHA 1RH9A 1KTKE 4DN4L 4HWBH 3PGDB 4OOUA 4OM0H 3RIFF 4LXFA 3EJRA 1V3HA 1G7MB 3GSNB 4CD7A 5F8RC 4P5TA 4U1SB 1J05B 2DQTL 1XD1A 4FNTA 2GJXA 1U8PB 4XVUD 5H2BA 1CTOA 3HZYA 1FLRH 4JFDE 4KVCH 5C2BL 4Y4KA 5EPMA 1HSAA 3J8F7 5JHDB 4BFGA 1PYWB 1TVNA 1A6WH 1JGUH 4Y5XC 5FECA 2WUCL 3DX1A 1OTTC 5IB4A 3TIDA 2EKJA 2HRPH 1QFWL 4MA1B 2FO1A 1EMTH 1QACA 1MJ8L 4HW6A 5F44A 1S7WA 4MSWA 2YD5A 1ZJBA 5DD1L 4W4NA 1M6OB 5HJ3B 1PEZA 2V7HA 2P1YA 2VDLL 4GMSL 3MJ9A 5T5FH 5JQ6L 4LKXA 1NGWA 1YY9C 4UV4H 1KIPB 1KN2H 4GIAA 1MCBA 1EHNA 5TQ0H 1OAQL 2E8ZA 4WKFA 2DSVA 1NUGA 5DMGD 3VXRA 3BP6B 4KVNL 5KSAC 4BUGA 2W5FA 4OGXH 4PR5A 3KLKA 1B9ZA 1CD0A 3S34L 3OJMB 3DETD 1TVHB 3JUGA 3KYKH 3I02B 3GUTA 3VG0H 5ANMB 3SKJL 3OKLA 1C12B 3DNKA 5DURB 3WUGA 5GS3A 1MRFL 2GTZA 2NLJB 2P49B 3EJUA 3WY1A 1MHEB 3O9WA 2W0FB 4OLEA 1KBBA 1AGBB 4P2RB 5CZKA 5DD6A 2UYLA 3GXFA 1NBZB 3RWEB 1OHQA 4XPFL 2YZ8A 3MSGA 4JANA 3LIZH 4TNVK 1B3YA 5IQ9B 5GGTL 1OD7A 4H8UA 1MY5A 1NPUA 1P1ZB 4U1MA 1A1OA 1NP2A 2BXYA 2HKHH 5IVZA 1AHWC 2UUDK 3OKMB 4NZRH 4WI9A 4QLRA 1TQCC 3P0GB 4KWUA 2IPKB 5D1ZA 4JO3H 5HNNA 1G6RB 4D6JA 3DIFA 2RGSA 5FYLH 2IGTA 3IF1B 4YDVA 3RAJH 2FX7H 4LCWA 2VSDA 5IFJA 1I1FA 2IAND 3FT4B 1LQSR 1YEGL 4FQ2L 4BSVB 1S9KC 2R9HD 5F1IB 4BH8A 3QDAA 4NN6C 1E28A 4Y7EA 1F2QA 2J4WL 5CJQH 3KPMA 1TVBB 4RAUB 1BSIA 2W65B 3MBEA 3HE7D 2EECA 4GRWH 3SDCC 4PRHE 1MI5E 4FZEL 2JCCF 1V03A 4H25B 4K8RL 1MJJA 4XHQA 3ROOA 1A22B 3TZVD 3B9VA 3DMMB 3GJEA 4PJHA 1Q8MA 1FLTX 3SDXE 3UDWC 3ULVE 1IGTB 3QEQB 1WDPA 3GK8L 1IL1B 3F5WB 1K6QL 4H2CA 2X40A 4D6GA 4DWSD 2E5EA 2AEQH 2IF7A 2AERT 5DJZA 3KS0H 1ZLVK 3SJVB 3W37A 3WO4B 5I18H 4M7KH 3BUYA 4PJAF 3ZE0F 4ELKA 4FTVD 2QSTA 1JPGA 4J1UB 4IRJA 1U36A 3PZQA 4X5XA 3AROA 4G42A 3QXAB 4F2MB 4KDTA 3ULUE 1US3A 1N5AB 4ZDHA 1MW3A 2ZPKL 3T4AB 5GZNC 1BAGA 2PYED 2NTFB 3KLHD 1H8SA 3T0EC 4XNZC 2J75A 2V3EA 4QTHA 1GOWA 1B6UA 3LKOB 4MNLA 2HLFD 3BQUB 3RU8L 3W29A 1XGRA 3TNMA 3QWOA 1XGTB 1T21B 4PS4H 4FNLH 3QWRD 4PJFA 4FNQA 1RFDH 4GRLD 4H5SA 2A2QT 2VLKE 4ZD3H 2XN1A 4HK3N 2YPVL 4J12A 3BLKA 3UO1H 4PRAB 3B9EA 4O2EA 3D85B 5HHQA 1VIWA 4FQXC 3QI9B 5A6AA 3WJJC 1YN6B 1FHDA 1D5MA 4JFHE 4XPHH 3PV6A 1JWSB 1WE5A 3D6GA 4QRQB 4ZS6D 1F00I 2OW7A 1I8IB 3INUH 3BH8B 3LN4A 4JRWA 5CMAB 3L5XH 2VX6A 3HMWL 1CFNA 4X8JA 1S5IH 4XTRC 2QSVA 4V1DD 3PQYE 5D1QC 2G9HA 1TCMA 1FZOA 4RWYH 3WD1A 4JDZA 4HUKB 5SWSA 3MMWA 4MCYA 4KQ4H 4ACPA 5J11C 1V0NA 1DBKL 3OSKA 3BN9D 4CVZA 3I3EA 2YRPA 3II1A 4J4PA 2XA8L 3GNMH 1NOWA 4P5MB 5D7IE 3B3IA 2VDPL 1B0GB 1V7NH 3L5WA 4HCRH 5DO8A 1F11A 4RGOH 2VXUL 3ZTNH 3IDIB 4HXBH 4APQB 1A7QL 2IEPA 2RGMA 2AXFA 4M6OH 4M8QB 4JFOA 3S5LA 3FFCA 5ENWA 3EBVA 1KXVC 4LSDA 1JGEA 1RUQL 1V7MH 1QQDB 3FQWA 4YR6A 1CU4L 4P9HL 5CSYA 5I1GH 2NY3B 5MHSE 4N68A 1R34A 1F97A 3I6KA 4HEME 3VH8G 1EFXD 4JGUA 4OQ1A 3V8CA 2B1HL 3QUZB 1E4NA 4QHLA 3NACH 5JO5A 1KENL 5C6TH 4KK5D 5CIPA 5GZOC 4YHGA 3QUYA 1HP4A 3L4UA 1FZKB 4HQQL 1M7XA 2FB4L 3CNKA 5JR1L 4Z7QE 4YZFF 4G8GD 3VI4F 2F15A 5T3XD 3L3OB 3IAGC 4OKVA 3VIPA 25C8H 1U91B 5DT7A 5E9DA 5T1KD 1FHLA 4AZIA 1N7MH 1SEQL 1PIFA 3HZVB 3QBTB 3FY1A 3O6AA 5IM7A 1EXUA 2GSGB 2ITDA 4JFFB 2V2TB 2XZCH 3QNXB 2YEZA 5B4MC 4QOKB 3KPOB 4X8XA 1MF2L 4A3YA 1N59B 1E3XA 5IHUL 5ETUB 4NQSB 4W4OC 4EQ3A 5DJYA 1T0OA 5MEPB 2X4QA 4FFZL 5HI5D 3VFGH 4AT6A 4X4ME 1R87A 2N4IA 4X99B 5D2NA 4BKLA 2ATKB 2AAAA 4ZXBB 1PIGA 2JJWA 3RMEA 2COQA 1KCSL 7CGTA 3GSOB 1CFSA 1ZVHA 5MEQB 4NIKB 2Y6SC 2X6MA 3DVIA 1P53A 2ADIA 4ZTPL 4HJ0D 5IGXL 1YHTA 4J8RB 4PTMA 1U58B 3QJHA 1GZPA 3MRJB 2CK2A 4L4OA 1TUXA 3ARUA 4C7GA 1QHPA 1K6AA 4LKCA 1CCZA 4TYUA 4PRPE 4W89A 2ZCHL 1BECA 2ZKHL 4O00A 4U0RC 1G94A 2IH3B 3KHOA 5F9JA 2YC1A 3EYQC 4BK4A 3RRQA 2HJKB 2I07A 2WZHA 1X5FA 4BUHA 4F8XA 1OM3L 3S37L 4OLYH 4N1EA 1LP9F 3AUVA 5EU5B 5C0GA 4H41A 1QEWB 1XCWA 1UGNA 3V2AR 5CEZL 5I19L 1ORSA 5E8EA 3RJXA 1AFVH 1XGPB 2VRAA 5F6HJ 4MNJA 3MO1A 4HDIB 3ILPA 4OJFL 2PW2B 2NW3B 5BVPH 3SKOA 5E8OB 5HYSB 1N0XH 5FHAL 2CGRH 3F62A 1RJLA 2Q8XA 3N1MC 2P5ED 3O4LB 1C8YA 4HKXA 4Y2DC 3VFWA 3M8OL 1HK6A 1DDHA 2VQUA 2Z91B 4LEOB 1RU9L 4HLZH 3MRMB 1E1FA 4X6CE 2HT3C 2PYFB 5A2AA 4NO0B 1DBAH 1NQBA 3EMQA 4P46D 3ARBB 3OJ2C 1AGDA 1BFOB 5BW7A 5BRZD 1NSNL 4D8PB 4MXQC 4JQIH 4JN2B 2R2EA 4Y5YA 2J12B 2ADJA 5GSRB 3S6CA 2MWCA 3BH9B 3WV0A 1KPVB 5J12B 4OTXH 3V95A 1OTUD 4LNVA 1CDHA 4GBXB 3JWOL 3NH7L 5IHZA 2X1QA 1KGCE 1NQ6A 5IMKA 1YNKH 3CUPB 3IFNL 4EOWL 4PN2A 4MQSB 1MFDH 2EH8L 1AQDA 3ZDZF 4DZ8A 3SDDC 2A6KA 2JLLA 3MJ8A 1UYQA 1H11A 1A6TB 4FRWA 3QDMA 3PWJB 1MEXL 5KG9A 4E41D 4LYQA 1NFDA 3GH4A 1I9IL 1HQ4B 1M7DB 2UZIH 1CICA 2AQ1A 2IANA 4HKJA 4N0FA 5CJOL 2BZDA 3N1FC 4PJ5D 4AY0A 5MEND 1JHKH 4Y5VC 1MHCA 4R8WH 2WHMA 1PG7H 5CJ8A 3QHMA 3BH4A 1SYVA 2HJLA 2WBJC 1SMDA 2V3GA 5D2LA 4DAGL 2C5DC 4HJGB 3ZQ9A 4FFVC 3HE7A 5A2LH 4JKKA 3QHOA 2NY0D 1S7UB 4ODHL 1JUFB 4OGYH 1WUNT 3FTGB 5IFAL 4MHHI 2BFVH 3P30L 5JMOC 2X89D 3VFMB 5I2IA 4M1RA 2HFFB 4XNYH 1B0IA 2W9EL 4D0BB 2DTMH 5C08D 4RGMC 5I3DA 4ZENA 1P7KB 1QSEA 3CMOH 5C7XH 2PO6A 2NY2D 3MXWH 3ORJA 4F9PA 5EFDA 3WUBA 1E6OL 3ARYA 4WEBH 2EBNA 2GCYB 4X7EC 1QNSA 4DWSA 4ZS7H 1NCCL 5E03A 2HP4A 4V2BA 3NDYA 1PX4A 5KJRH 4BYHA 4IIQA 4B41A 5EBMB 4O2CB 1XIWD 4U05A 3TO2A 4AIOA 1FC1A 3S9DB 1MVUB 4XZWA 1XSIA 2DM7A 4WCYL 1S9YB 1TJGL 1TCRB 1DN2A 5IMLB 1J0ZA 3L7EA 2Y5TA 3C8HA 1ZGLA 3PZ9A 1C16A 3I75B 1J11A 4X80L 4M6NH 4X6FB 4ZYKB 3WLWD 3WL9A 1ZANH 2HFEA 3DRQB 3JV0A 3PL6B 5JHDD 4DM2A 3X3FH 5BXFB 3BSHA 4NO5B 4F3FA 5F9AC 4QRTB 4D3CL 5ESAA 1GZJA 1EFQA 3WS6A 1G9NC 2Q86A 4R7DB 5C9JA 3DV4B 4HIXL 1K5NB 3G6DH 4UIKL 2C3VA 3MXVH 5I23A 4I48B 1FSKC 5EU4A 4OZFH 3B8SA 4G9FB 5ELIA 1E4IA 1RUKH 1ZSDB 1DVFA 1W0WA 1A6VH 32C2B 1W1TA 2XFYA 2APVA 1BVZA 5A43C 5C0NC 2CK0L 4LPWA 3QEHA 1HYSC 3DROB 5LGHH 5L0QC 2JFEX 3D0VA 2ZUYA 2EO1A 1NCUA 3RDTC 4KMTL 2AJXL 1M71A 4HFWB 1M04A 4R2GC 5IQ7H 2XZZA 3DXAB 3WCYA 1OSZA 3WQ5A 4M93C 1AD0B 3DVFA 4O02L 4NNPL 3L7FA 5FUOL 3ZM8A 4AK1A 4DKEL 4BM7A 5HYFA 1GQLA 4PY8I 5FM4A 5IMOB 4YHKH 4LFHG 1A7RL 4LSQL 4X4XB 5MI0B 1VGEL 5L2JA 2D31B 2OR9L 3CC5B 1S3KH 1UWEL 3T77B 2V17L 2JALA 2A3AA 1A5FH 1N5YH 3KPSE 3MV7B 4OZHB 3FMGL 1L0PA 3PIQA 4OLWH 1BVLB 2PCPB 1M7IA 3VG9C 2EEAA 4NKQB 2AJSH 5EFIA 4UT6L 1BZ7B 5D4QA 4FQPA 2Z1KA 3KR3L 4ZOCA 4YX2L 4HK0A 5F96H 2L7JA 4Q0XL 3CHFA 2Y5EA 4GXVL 4WW2A 1E4XH 3KYMB 2D0GA 5TE6L 2VX4A 4ODTH 5FKAA 3P4MA 1C1EL 1RVFL 2ZCLL 3WEOA 2CITA 2OL3B 3MACH 4NC0B 4YHYB 4HA3A 3NCEB 5ECJE 3RWGA 3VXUE 2QEJA 3MV9D 4WO4A 3RJQB 3WBDA 5C6WH 5TGBA 1HKLL 1KNOA 1X4XA 4YNYA 4R90L 5A2JH 2FDBP 5J9PA 1QSFE 3I3BA 4ZPTB 5IBUG 2XNAA 5HBBA 1IC5L 4G8FB 4WENB 3HPLB 3F7PC 3MBXL 1UCBL 3DVGB 4OI7A 4KI1A 4KJYB 2A3BA 3OR7A 1O7AA 2QF8A 1F42A 1N4XH 2EZ0D 1OGAE 4LCCA 1URLA 4Z0XA 1KIRA 3SKUD 3EFDL 4QT5A 3GSQA 4XI5D 1KBGL 1JZ6A 1IGIH 2DEPA 1BJ1J 5DT1H 2R69L 1N6QL 4E2OA 5F7DA 4L1HA 3H3BC 1P7HL 4CMMA 1G9ML 1A2YA 3GH7A 3ARQA 1E6QM 3SUWA 1ZT1B 1ODZA 5CEXA 1JZ2A 1FJ1A 1GAFH 5FM5M 3C5ZB 4HGMA 4QTIH 5D1XB 4GG6F 1U3HD 4MDPA 1CXEA 1E72M 2XT1B 1X5JA 5EMYA 3K8MA 1UH4A 3AM8A 2PWFA 1OAXH 4E42B 3V52H 5I1LB 5B8CA 1T1XA 5FOBB 3D85D 4DCQB 3EO1A 4NNYA 5EZJB 5ALCL 5GNYA 3ULUD 2VH5H 1P4IH 2R2HA 1MQQA 2FE0A 4AD4A 1AY1H 5E6IC 3ZT5A 2WC7A 1FYTB 4J28A 5HHNA 3BESR 1HI6B 2K7QA 3O8XB 1QKZH 1LO5A 3GHBH 3QQ4B 3T0EE 4AW7A 5ITFA 4K94L 2JCCE 3RJDA 4WFHE 1MVYA 2AK4E 4G7VH 2VLKD 4NRSA 3HI5L 1KCRL 1F8TH 3VD7A 2X42A 4GQ9L 2P5EA 2X9WA 2BOCA 2KQNA 3AHTA 1T1ZA 4K68A 4YFDB 4EUPB 3BLPX 1B90A 1KC5H 2VLRA 3LEYL 3UPRB 3EDFA 1H9VA 3ECBB 5D96C 4QXGL 4OCWL 3N17A 5BS0E 4ZFZA 1JK8A 2QQLL 4JFHD 2BXZA 5IHBA 4NRZB 3DHMA 4PJAE 3UTQA 4CADA 4KZDH 4Q2ZA 5BRZA 3ZE0E 5IKCA 4PGCB 1UFUA 4HU0A 1SVZA 3MV8B 5D6CA 1PSKH 4XB3A 1BFTA 2VDNH 2BVQB 3RI5K 2F18A 4PJ9C 2X05A 3VWKB 2R4RL 1NUDA 4FQIH 1CS6A 5EO1A 4JR9L 1FH9A 2IQAB 1MRDL 1YY8B 3QUZD 5ADOH 2YZ1A 2ED8A 2PW1A 3JV4B 1FZMB 3WE6A 1RZ7H 3TH2T 2Q1EA 3GIVA 5DDHA 6FABH 3CHEA 1YC8A 4R0LC 3QR2A 3MQIA 3Q1SL 3QIBD 4I9WE 1EJ6A 3QXUA 3DTXA 5EU6A 2VI0A 4E41A 1JZ3A 4YH6A 5I24A 3MNVB 1UG9A 3I6GA 3JWDC 1Z0MA 1B0RA 1RIVH 1U92A 4JFFD 1QX1A 1IGFL 4JCLA 3TVMD 5MHSD 1YEFL 4NT6A 3BP4B 5DYOB 4G6FD 3UTPD 1Q1JH 3O4OC 1QLEL 3ROLA 1FDLL 1V3LA 4EIZC 4X6DA 5EUOF 3MA9L 1BQLH 2AABH 2X89A 4DGIH 3O3UN 3KXFA 4JB9H 4P2QB 5T3ZL 5F1NA 3WSQL 5C08A 3GBNH 3L95A 3VX0A 1R3IH 1NGYA 3V0AC 2Z9TA 1JF1B 2RBLA 1S9WA 3BAWA 1C5CH 4YBQD 3LZFL 1S7QB 1MAMH 2DQIH 3VGDA 1R3LA 3MRKB 1F45A 5FB8A 1RZGB 1JG9A 4RAVA 1XIWA 2I9LA 3PGDA 3SOBH 1MCOL 2JIXB 4JGJA 2OK0H 1JNNL 3TPUB 3D2UD 3K4AA 2NY7L 2X4TA 1ES0B 3GSNA 4U1SA 5DO2C 4BZ2H 1D3CA 1U8PA 5D9PA 1FVDA 3F7QA 3VIKA 4O2FB 5DXWA 4RISH 2E8YA 5FIPA 5JHDA 1PYWA 2ZUQC 2ZICA 3QDGE 5D8ZA 5IK3B 5T1LB 4DK3A 1JTOA 5H37H 1HVXA 1A9EB 4BQ8A 1CFVH 2FGWH 4K7PY 4ZFMA 4XHJD 5EIIA 3VFNB 3ARGB 1ONQB 3R06B 3VI4E 3GNOA 5TH2A 1OAUH 5HJ3A 3BX7C 1L0YA 1U8NB 3CFKB 4X98B 2VABB 4LLDA 4NBXB 4H1LH 4ZO7A 4GKLA 2VLJB 4M3KB 3BDYH 3QCTH 15C8H 2VQ1B 3VM5A 3KVQA 4TVCA 1KIPA 1FBIH 4XMPL 3JWNC 2FCBA 2JJUA 2D7TH 2FJFB 1AGCA 1UT9A 3KJ4C 4TRPL 1MPAL 1YEHH 3RZCD 3FAXA 2EE3A 4KH2A 4KJPD 4W7WA 2PTTB 2C3GA 4G5ZL 1QFWI 1TVHA 4F9LC 3PDGA 2JF7A 4K23L 3I02A 3WKNA 5A2KH 4FNPA 3QAZC 4KZEL 4X0KB 1B3ZA 1W2VA 2GJ6B 1T0MB 5J56B 1I3RB 3D3VB 3RIFK 2EIZB 4ALAH 5L2KB 3QJFA 2KZ1B 2VC2L 2W0FA 4P2RA 3QB7C 3VIMA 3RWEA 3GTNA 3BAEH 2OJZL 4IDLA 4YUEL 1L7TL 1R85A 4RMRA 1FGNH 5IVXF 5ESQB 5IQ9A 2R1WB 1QNRA 3AS1A 1P1ZA 1PJ9A 5D5MA 3CVHH 2BNQE 4HT1L 5EZLB 5FDWB 2GUYA 2BNRE 2HTLC 4JQVC 1JNLL 3OKMA 5I8CB 4KI5F 4QY8B 4F58H 4MNHB 2F9BT 5KVGH 1RPKA 1SY6L 2IPKA 3L5HA 5E8DL 2ESVB 3IF1A 3S96A 1WZ1H 5F71A 2FIRT 3ES6A 2A3HA 4BSVA 2J5LC 1ZHKA 1TVBA 4ODSL 4RAUA 1DFBL 4N8CH 2DMKA 3UROR 3GXDA 1FP8A 5GJTL 3MV9A 1FFNB 5GRJH 3WFEL 2X1PA 3MR9B 5BV7H 5F1SA 2XVKA 3DMMA 1PAMA 1WEJL 1AI1H 1IGTA 1OAZL 4IOFD 5BJTB 1YMHA 5F3HA 4HX1A 3VUPA 1GPFA 3K8KA 1IL1A 1ZLWH 4R7NB 1LO0L 3AHVA 1JFHA 2CXGA 4S1SL 1HXJA 3D5OF 3JXAA 3OAYK 4C83B 3T2OA 4KI5C 1TQWA 4KMQA 4F33B 6A3HA 1OAYH 3NZ8B 4KKBC 5I8EB 1NCWH 3BSZH 4UAOC 3SJVA 5ICXB 4N1CA 4BQ2A 3X3GH 4XP1H 1XF5B 1EQCA 3BGMA 2JEPA 4J1UA 3LKQB 5CWSB 3RCNA 4TSBL 2EDQA 3F8UB 12E8H 3DBXB 3QXAA 4OM1H 5C0RL 1W2KT 3SCTA 4AYFA 5KN5B 3T4AA 1OM0A 2NTFA 2OZ4H 2O5ZH 4FFYL 1KJMA 1S78D 1GSMA 1INEL 3LKOA 1R5IB 3BQUA 2OI9B 1V3JA 1JN6B 3EJQA 4JRXD 2PUQT 4QF1B 1HKKA 2DT3A 1XGTA 1T21A 2OW6A 1FFPB 5HHVH 4AEHH 2ZJSL 3DUHA 3WY4A 2M2DA 1VEOA 5TFSH 1Q9LB 2Z31C 1OL0A 1HT6A 1V6VA 1XGUA 4KRNA 3D85A 3BPCB 1CDYA 5AYUL 1YN6A 5IBLD 4NKDB 3RY6C 1RZKL 3ZZ1A 1DBBH 3VNZA 1CIUA 4YHZL 5T5NF 1SM3H 1BPLB 3VM7A 1JWSA 3OKNA 4AEEA 2VDRH 5DD3H 1I8IA 2GFTA 4WFGE 4JFZH 4FLOA 2N7BA 1I7ZB 3M6DA 4GI8A 4PJCF 4W6WB 1H3TA 2EIBA 3B9KC 3V0WH 2W61A 3KAAA 4P48A 2IUZA 2XWBB 5HDQL 3HNSL 2X7LB 3MOBL 2DMCA 5I30H 4H0IA 4HF5L 4UFJA 4OLVH 4IDJL 4RBPK 3OBAA 2GTWA 1TTFA 3VD3A 5HDLA 3WO3B 4XP6L 3K7UA 4JCMA 1B0GA 4LGRB 3RGVB 2R29L 5C07E 4PCSA 4RFOL 3OMZA 2KDGA 3EYSH 3PWLB 4G6MH 1PY4A 1C92A 4OM0L 3W5NA 3PGFH 3IDIA 4APQA 4M8QA 1GNXA 3TV3H 1PPIA 3IU3B 3OKYA 3FOLB 2VDQH 1QQDA 2YPKA 4KVCL 5D7JC 5DSCB 3OGSA 4GKSB 3CFJB 4HG4J 3MGTB 4UFLA 3QUZA 4MDIB 3ETBF 1Q9KB 3EO0A 4ZFOL 4CL7A 3HG1E 3TWCH 1A6WL 1JGUL 3D1MC 3VRLE 2PNDA 4N1HB 1FZKA 1DLHA 3CCHA 2HRPL 1XYFA 4LLVA 4L3CA 2F74B 2DOCA 1EMTL 3QIBA 1G7LB 3LMYA 3L3OA 2XGBA 1HNFA 4LQFH 3TM6A 4LNRB 2CIPA 4PJEB 2VXQH 3S7GA 4GZIA 1U91A 3KPSD 1V3KA 1KYOJ 3WUZA 2J8OA 5T5FL 2SEBA 2NY4B 3HZVA 3MFGB 4UV4L 4LVHB 4YFLF 5KSAD 2WZEA 2GSGA 4JFFA 1KN2L 2B7DT 1JAKA 2MNUA 1PZUB 4OZFG 5TQ0L 3QNXA 3BWAB 4LVOC 4QOKA 5HI4C 2OTUB 3KPOA 4GI9A 3MGAA 4LBEB 1G7JA 4L9LC 4FP8H 1N59A 5C71A 4Z7VF 1J18A 4RDQF 4EN3C 1MXGA 3QRFM 4NQSA 4OGXL 1P69B 1OWWA 1CXHA 5MEPA 3LN5B 1U8MA 3LCYA 4D6IA 2EH7H 1Z5LB 4KJQC 3VXUD 1FNSH 2FL5B 3KYKL 5EOCH 1TLKA 4X99A 3VG0L 2E7LC 2ATKA 3GM0A 4Z78B 1OP3H 2XKNB 1CVSC 2OSYA 2NY1C 3BWUC 3GSOA 5MEQA 5ICYB 2GQHA 3MLXH 4L5FH 2WUBH 2CO6B 2Y06H 2RHEA 1NJ9B 3C8KB 4RGNC 4UT7H 4NRXB 1HL9A 3LIZL 4J8RA 3L4ZA 1U58A 1TQSA 3F12A 4PJXA 3TBYB 3DX8B 1QI4A 4Y4HC 2NXZC 1PDKA 4FOMA 1YNTB 1ZHBB 3E2HC 2HKHL 5DQ9A 5C09B 4NZRL 1OGAD 4UQEA 1INQA 4L3AA 5EBAA 1Q9WB 2A6IB 1CI5A 4JFUA 4JO3L 4NN5C 1KR1A 4NN7B 5FYLL 4UB0H 5GISH 1UR9A 1BVKA 2XPKA 5A1AA 3RAJL 1VENA 1S9VB 2HJKA 2FX7L 1Q94B 2EYSB 1RZFH 1MIML 4BSWB 1QI0A 1EDTA 1P84J 2WMPA 1FYTD 2V9QA 5CJQL 3C2SA 5IMMB 1CLCA 4XPGH 5GS2D 1T89A 3EO9H 3BCDA 4HDIA 5HD8C 2NQCA 4LIQE 2PW2A 5FYJU 2L4OA 1W9VA 1PG7X 5HI3C 5E8OA 5HYSA 4D6CA 4HWUA 4WTXA 2OWWA 2EDFA 4H0GA 3CZEA 4HH8A 3MROB 3RZCA 3MRMA 3TEUA 1W8OA 2YPLD 3F58H 5BQ7A 4HOZA 4LLAA 2EPNA 2BP3A 5B39B 2WIMA 5I18L 3ARBA 4M7KL 1BFOA 2CO7B 2C1PB 2WWKO 1RHHA 5GZND 1KFAH 4JHOA 3SGDH 4OF6A 1ADQA 2H1PH 4CW1A 3PWPB 4JN2A 4MJIB 4QEGA 1XCXA 4WFHD 5GSRA 3BMVA 3U7WH 4W5ZA 3BH9A 2AK4D 3FB8A 1KPVA 1C7SA 3GYCA 4Z7UB 3IDYC 1BZ9B 3TO4C 1ZWIB 1OINA 5HVFB 4GBXA 2FX8H 5FO8A 4PG2C 4NXKA 5I16A 1IV8A 4DTGH 5JHLH 2IAMD 3CUPA 3SUSA 2EO9A 5BOZG 4PS4L 4FNLL 3UCQA 4GG6E 5E5MB 1RFDL 4ZD3L 2A3CA 1YJDH 1EXPA 5BS0D 3OLGA 3TNNB 2EO7A 2IC2A 4P57B 4IJ3C 3FO1A 4N42A 3THMH 3UO1L 1A6TA 3PWJA 4WY7H 4N0YH 3MGOB 1NDGB 3KYOA 1KXQA 2QPUA 1OW0C 4QO1A 3H54A 1L9NA 3H7BB 3AS3A 4QHMA 1WJ3A 1TETH 2Y24A 1J8HE 2CLRA 1QI5A 3MRFB 4X6EB 4XPHL 3O9NA 5CPSA 3MCLH 3BCFA 4HJGA 1CDCA 4AZ6A 3INUL 4ZG1A 3NIDF 3L5XL 3I2CH 5IXEA 1JUFA 3VGEA 5CSZB 3ZIZA 1S5IL 1I1AC 1FC2D 5DFVD 1D6VH 4Z8FH 3C6SA 2WB5A 1CN4A 4D0BA 1X5LA 4I9WD 3H0TB 1NEZB 3U7YH 4RWYL 1P7KA 2JTDA 3P0YH 3HLAB 4KQ4L 1FV1B 1V6UA 3GNML 1U33A 5I66B 4PRHB 1MI5B 3S5LG 2BOBB 1V7NL 4HCRL 4FQHB 3OKOB 1BIHA 1BBJA 4O2CA 4RGOL 1HIZA 4ZAKB 3ZTNL 4HXBL 3UBXI 4KROB 1QYGH 4M6OL 3BKJH 4OZ4B 2NW0A 3SGEI 1S9YA 2H3NB 4ELME 3PG2A 5D93C 7FABH 1V7ML 4ZMAT 1AQHA 4B16A 1HJXA 4NO2A 1CK0H 4EXPX 5I1GL 4PJBF 1H3WM 3I75A 3QZWA 4LP4A 3GMPB 4X6FA 5A8MA 2YKKA 1RZ8B 4WI8A 3NACL 3PL6A 2Z1SA 5C6TL 2YD8A 1DE4B 3OAZK 5M5DA 4K9EH 1ZHLB 4FQJH 4JRXA 4CGTA 1AO7B 4QRTA 1CEOA 4R97B 3C6LC 2WWMC 4R7DA 4DJMA 3DV4A 4UIMB 3ZLQC 1W9BM 2BVEA 3O6MH 3U30B 1Y18B 4I48A 5A2IH 5CG0A 25C8L 1ZB5A 3UJTH 5TE7H 3IDGB 4G9FA 4OI9A 2ZCKH 4UNVA 1N7ML 1ZSDA 32C2A 3SBWA 4GUPA 3QO1A 2ZX9A 5DUMH 2R1YA 2YL8A 2IFGA 2RCSH 2XZCL 3DROA 4MAUH 3VE0B 2CKBB 5IG7B 3FB6B 4GO6B 5BXSA 3CSBA 4LDEB 3QDGD 4QHNB 5FCZA 2ICWB 4HFWA 5EUOE 5HGBB 1AD0A 5DJ8B 1RUPH 3VFGL 3FO0H 4CDGC 5J06A 2EC9U 4LCIH 4OT1H 1E6NA 3RL2B 4RAHA 3PF2A 5DA0B 3VA2C 1QRNB 5D7SH 1I9RH 2EXYD 4ZFFB 5IMOA 4X4XA 1G6RH 1XR8B 1UB6B 5JNYB 2X2HA 2D31A 3CC5A 5JW5B 1QLRB 3QA3B 1AXSA 5FF6B 3T77A 3PZVA 5CEZD 4OQTH 1A7OH 1FZJB 1XT5A 3PQYB 1GVIA 3MV7A 4OZHA 5FGSA 4L4PA 4YK4C 4PJIF 1JPFB 3BO8B 2YD7A 1U93B 2PCPA 2XY2A 3KWWB 4DKDC 2G2RB 3HG5A 1H5BB 1BZ7A 2H2PD 3NAAH 2FATH 1J1XH 3BE1H 4P23B 1I8MB 1CWYA 2WPGA 1JNJA 4P4KC 4ZFGH 3KYMA 4OLYL 2FWOB 1HH9A 1NBVH 4UTAH 2OL3A 1GL4B 1OCWH 3QIUB 3VDAA 5J0BA 3SDAC 5DRZB 2QPSA 5LWYH 3WIIH 3HE6C 4NHUB 3GFUA 3K2MC 4X7SH 1AFVL 4BJLA 1GORA 2K3TA 1WFTA 4UINH 4BCEA 4Q58C 3QCUH 1MCHA 5HHME 3ZYOA 1KEGH 3GH5A 1HYRC 2FSEB 2CDGB 2BNQD 4ZSOE 2DKMA 5BVPL 2G3MA 2BNRD 4ZPTA 3W4RA 2DL9A 1N0XL 2CGRL 4EJ1C 5C0CE 3HPLA 1JGIA 5A6LA 1F58H 2IPUG 1J86A 2Z35B 4OFIA 4PTUA 6TAAA 5FGBA 4DUWA 3S35H 2DSKA 4DK6A 4RIRB 3KLDA 1HHGB 4X4YB 4M82A 1QPPA 2KQMA 3P0VH 5TPWH 4NWUH 4RL3A 4KK8C 2DYPD 1DBAL 2EAEA 4PGJA 2A9MH 2F1BA 4U0QB 4LLWB 4OF0A 2FBOJ 3JVGA 3WEZA 4XNMB 2JB6A 2BFGA 4UDUB 5C0AB 4K7PX 1NANI 4JQIL 5FK9B 3TTSA 1R8LA 3HCVB 4N0RA 1RK1B 1YPZB 1C90A 3C09C 4LHUB 4OTXL 3OKDB 3MUIA 3V6OA 1SVCP 5I71B 3I84A 3SDDD 1ZT1A 5I6XB 3VINA 4DW2H 1P6FA 1BFNA 1ND0B 1YNKL 5FHBH 5CEYB 2YLLA 1MFDL 3C5ZA 5D1XA 4NSKB 4Y1AD 3QIWC 4YO0A 5DI8B 1EBAA 4I0PC 3PN8A 4KI5E 1KACB 1WP6A 3WF1A 2DT0A 5J13B 5I1LA 2C3XA 4XZUB 5FM8A 1JHTB 2ZP0T 4DCQA 2A9NH 3S36H 1E71M 2UZIL 1HP5A 1CGUA 4MNGB 4FFVD 5EZJA 3CZSA 4E0RB 4FXLA 1T7XA 3SKNB 3F5LA 4NDMB 1JHKL 1JWUB 3RVVC 4R8WL 1NUFA 1PG7L 3LPWA 5EOQH 1FYTA 5DRXB 4S3KA 4HIIB 3BLBA 3IETB 1GGUA 2DWEB 3Q5TA 1U8OB 4JHZA 1HI6A 1IEBB 2J4GA 2BY3A 3QQ4A 4OGYL 2OYPA 4Y4KC 2B5IC 1LE5A 1H49A 2BFVL 2EE2A 5AZEH 2FBJH 1NBQA 4QRRB 5E9AA 5D71H 4XNYL 5SX5K 4KJWD 4L8DB 2DTML 3D25A 1VBRA 2LABA 3CMOL 3QRGH 5C7XL 3MXWL 4PJDB 1CE6A 5FA3B 4WEBL 4NOBA 4ZS7L 3ECBA 2YPLA 3G6AB 3N1PC 2ZX6A 2W63A 5KJRL 4PYGA 3AFBA 1BREA 4UUJB 1BHGA 4NRZA 4PGCA 3BZEB 3CHDA 1IT9H 4TSAH 3DX3A 1NC4D 1RI8A 4WFGD 1H0DB 3MRNB 5DHYB 1EHLL 3VWKA 4J7RA 1GQJA 4M6NL 4QHKJ 4YDLB 3ZTJG 5GS0H 1YY8A 1ZANL 5F9DC 3X3FL 3ARVA 1FZMA 5HYJE 4O5LH 3E6FB 4P3CH 4MXVF 1SJHB 4ODBD 1H3GA 3VI3E 2WSKA 4NKIH 5IW1A 4L8BB 3G6DL 5JLZB 3MJGX 1EK3A 3MXVL 2D3LA 4G9DA 3GGWB 4OCNC 1XAUA 5C0ND 3V5KA 3O9WC 1R24B 3G08B 2FIKB 4PJHF 3C60B 2F54E 5FV2A 1YMME 4OZGF 1A6VL 5FOOA 1N6VA 2W59A 2DKUA 4NFCA 3MRLB 3ZYJA 5LGHL 3KPRE 5FAAA 1KR0A 5DYOA 5KVEH 3CMGA 3TN0B 1QPKA 4BSJA 1KELH 2YJQA 3BDXA 2Q87A 1QSZA 5IQ7L 1CR9H 4PJCE 4TTDD 3CO4A 4U3HA 4D1IA 2DLHA 1VAHA 2IBBA 1CF8H 3OHXA 4IM8A 3GJFH 1U8LB 2Q76B 5E8NB 4GKOA 4EKJA 2A73B 5DRNB 3MBEC 1JF1A 4ZFOB 4YHKL 1SJEA 2B20A 1S7QA 1WWCA 3DRTB 4GLRH 5E09A 1IQWH 3MRKA 1S3KL 5ID0B 2HLAB 4MVBC 1C5DB 2WK2A 2JIXA 1LO2H 1RJZB 3GMNA 1A5FL 3TPUA 1N5YL 2Y7QB 4PJFF 2X4NB 4N9GB 3U4AA 4DEPB 3RIKA 4OLWL 3TA3B 2AJSL 4D94A 2BVOB 3DX2A 3LN9A 2PXYB 2W38A 5F96L 2APWA 4QYOB 4YE4H 3U9PH 1JDCA 1E4XL 1GCFA 1ZAGA 3FFDB 4M7LH 1V3IA 1WNOA 3MODH 4ODTL 2P43B 5FCSH 1OSPH 5IK3A 5T1LA 1BD2E 4AENB 5CXPA 2ZOKB 3ZHKA 4IRJC 3MACL 5BO1H 3GMOB 3QFDB 3QNZB 4GAYA 1CLOH 4KDTC 4B53A 3LDBB 3ZKNC 3CZLA 3BOVA 3D87B 3RUGE 2WLYA 1O5DT 1U8NA 3CFKA 2DJUA 4X98A 2VABA 3OGOE 4RGNE 5FYLE 5L88H 2VLJA 2FJGB 2X44D 2VQ1A 3BD3A 1OP9A 1JXKA 1SJXA 1I9JH 1V02E 1NCAH 5AEAA 1BFVH 3BPLC 3PHSA 1A3QA 3PJSB 5AD0B 1EAPB 4NZUH 5IP4A 3VTRA 4ONOA 4S10A 4K71C 2PTTA 4Z7VE 2P7TB 3O3DB 1N4XL 1F02I 4I2XB 3TGXA 1MFCL 5JPMB 1UHVA 3T0DA 3CZ8A 3TBTA 1ISZA 1G1CA 3OKKB 1VF8A 2OX5A 2D20A 3HA0A 3PWPD 4MJID 4XP5H 5HGDB 2F7OA 3RM4A 5DT1L 1T0MA 3D3VA 4JVPA 4LOUD 2EIZA 1UH2A 5E95B 4OB5H 1M01A 4PP1D 2MKWA 4UZGA 5I1CH 1GAFL 3TBVB 4NF7A 5DJCB 3W53A 2ENYA 4QTIL 4HG4K 2OS7A 5FDWA 4UOZA 4L29B 3L4VA 5IEHB 3R4DA 4MA8H 5I8CA 4QY8A 5I5RA 4MNHA 1OAXL 3BMWA 3V52L 4J4PC 5E6ID 1CT8B 4N8VA 4RMUA 4FLQA 3LXCA 4TUJB 3DUUA 3U48A 1T2QH 2VH5L 2CJUH 1P4IL 1NP0A 3AXXA 4LASH 5IEKA 1AY1L 1KYOK 5E99H 3VFVB 5JBDA 4QXUH 1EQPA 1QKZL 4U1GC 3GHBL 5F89A 5I79A 1Q6FA 1W9DM 3CU7A 3CUFA 1UXSB 1QA9A 3MR9A 1I8KB 2D7MA 4G7VL 2RIKA 4KQ3H 1E4KA 5BJTA 1F8TL 3RPKA 2DQUH 3HUJE 2DIEA 3WEXB 4R7NA 4GZJA 3GMLB 3KWXA 3M1BB 2W4XA 3AMGA 1KC5L 4AEIH 4P7NA 4C83A 1X44A 2A6JB 5HVHC 1Z2KA 3WS3A 3GMRA 3NZ8A 4F33A 2WIIB 5I8EA 1J8HD 2DYPA 5CD5C 2FO4A 1XC6A 2XTJC 3DYMA 4TVPE 5C0BD 1TNMA 4KZDL 4PJ9D 4H26B 4C4KT 5I76B 2XXCB 3LKQA 3CK0H 1VFOA 5CWSA 3GSRB 3RX8A 5I1DA 5MP6H 1PSKL 4G7YH 3MI6A 3DBXA 1Z32X 1QG3A 2VDNL 5KN5A 3HG4A 1TQCB 2V9TA 4ZUSA 1IM9B 4FQIL 3HMXH 2FJHA 4C56E 3K46A 1T20B 3VVGA 3QOKA 5ADOL 4L1DA 1OIFA 1R5IA 3O6KH 1GYAA 1KTBA 1JN6A 1BGXH 1RZ7L 3OQ3B 1HIMH 4QF1A 3HZKB 5K33A 6FABL 1E6JH 2XZQH 1FFPA 3MLUH 4Y1AA 5D2NC 2AGJH 4MAYB 3SDCB 4L4VB 1K2DA 1PVHA 2W60A 1P84K 3RTQC 2X1OA 5I2UA 5CP7A 5T3ZD 5ABFB 3BPCA 4W5UA 1RIVL 5ISZE 4OV5A 1VKXA 4MAZA 5JIKA 3NSMA 1NLDH 3H8NA 1Z9LA 3BPOC 1HVQA 5D7LB 5A6SA 4HLJA 4NZJA 1Q1JL 5SWZE 3RQ3A 2YD2A 3NIDE 1I7ZA 3HG3A 2VDKH 4EDXB 5A8NA 1BQLL 2AABL 4DGIL 2ORBH 3OB8A 2V5SA 4D6DA 3FQNB 4JB9L 4LLYA 3X13B 1CXIA 2X7LA 3PWUA 4JFEB 4ESKA 3GBNL 3AHZA 2WMFA 1MFBH 3QWQB 2WMGA 3FB7A 1ZLUK 3MRDB 3UTSB 1R3IL 1RZJC 2ZX5A 4B9YA 1C5CL 3TYFB 4NP4H 1NMCB 2FHCA 2F7PA 3T0EB 1MAML 3BP5B 2DQIL 5F70A 5DO2D 1Q72H 2XSAA 1VFAB 3SOBL 3PWLA 3O2VH 2X0YA 2OK0L 1EH9A 5KZ6A 1NGQH 1UWSA 1FO0B 5FYKH 2WCAA 4Y2OA 1NC4A 3QUKA 4BZ2L 1I1XA 5IVNA 1HKFA 3FOLA 3W2DH 5HHXH 4M29A 3QG6B 3EKCA 2AEWA 1RULH 3PWNB 4LEXL 5DMGC 4IRSD 1G7PB 5DSCA 1E40A 5EBLA 3D5HA 1XH3A 4GKSA 4RISL 1AXTH 3CFJA 1NFDF 3O2DH 4G3YH 3CDGB 1Q9KA 4FQXB 1WKYA 4U6VH 3NCJH 4WRLA 3DETC 4KTDH 3UYOD 5BW7C 3RKDC 5JXED 1CFVL 3WQ6A 3PZMA 5D2LF 2AJYH 2YUVA 4P8WA 2F74A 3C8DA 4Y5YC 3H3PH 4DKAA 1G7LA 1OAUL 1VB9A 3ZKMC 4LNRA 5C0JB 2VCAA 1G0YR 3ARTA 4ACZB 2ZE0A 4UNTA 5K93A 3LX9A 3BDYL 3QCTL 15C8L 5D1QB 2DDQH 1WTGT 1ORQB 1FBIL 1JRHL 1KN4H 3ZL4H 3WUFA 2D7TL 4WTZA 2E9MA 4WUKH 1YEHL 3BWAA 5J11B 1S5HB 1ISWA 3HAEB 1I1RA 2OTUA 4PMVA 2F53E 4XGZA 4LBEA 1DQQB 5FYJE 2FEEL 1YECH 4UQ9A 1I85A 5B38B 3B6SB 3IU4H 3Q6GL 3BKMH 5EO9B 3SHSA 4QAWA 2APXA 1MFNA 2PF6A 1CICC 1DR9A 1GC1H 5A95A 5DK2B 5HHMD 1KT2A 1BJ8A 4UQ3B 2MKLC 3U0WH 2J79A 3S6TA 4ALAL 3UCRA 4ODWB 4EDWH 1XR9B 3HE7C 5ICYA 3BAEL 3WNNA 3FN0H 2HTLD 1NJ9A 4AIEA 3C8KA 2CQVA 5EFFA 4NRXA 2FZ3B 4M7JH 4NQCE 1FGNL 2P45B 3TBYA 3CVHL 1PZ5B 3EYFB 1R86A 1BG9A 5A69A 4L4TB 2PO6C 3A67H 3BUQA 4F9PC 2B0SH 4F58L 1Q9WA 2A6IA 5KVGL 5D9OA 1P5UA 1U2YA 4DWSC 2VR4A 3MRCA 3SEPA 4FNSA 1S9VA 2BVYA 1WZ1L 4IIQC 4PRIE 3FZUD 4BSWA 5BV7C 3VKKA 3OV6A 3MREB 5FM5O 4LU5H 1NLBH 4J3WA 2DQHH 1QSVA 4N8CL 5KOMC 5IMMA 1DTUA 3ZKXB 4EUPH 2QQNH 4LQ1A 2A3EA 4HPOH 4K3HA 4ENEC 1G0CA 5GRJL 1IAIH 3SE3A 3KLHC 3VXQA 5FV1L 5BV7L 4PMRA 4RMVA 5GPRA 4HEPG 5BVJB 2YD4A 1CDGA 1AI1L 2HLFC 5BXRA 4KI5D 4NJ9H 3KGRA 3MROA 4JRYE 2YXFA 3DURB 2UWEE 4RA3A 2QJDA 2CBUA 1LL7A 1EGZA 1FAIH 1OAYL 3LSOB 1NCWL 3BSZL 5B39A 3OB0H 1HQRB 3X3GL 4DVRH 3WD4A 4XP1L 4JFVA 1DVFC 2G5BA 2R0ZH 3PWPA 1UD3A 4MJIA 12E8L 5F93C 4OM1L 5LVEA 4TQEH 2Q8AH 4PV8B 2XQBH 4OCMC 4GW1B 1ZEAH 2OZ4L 4PJGE 1BZ9A 4NUGH 1ZWIA 2XZAH 4ZS6C 3KL5A 2VTFA 4WW2F 2W9LA 2W9DH 1BF8A 4N9OB 2IGFL 3PTMA 2ZUNA 4U6HA 1Q0XH 2D2OA 1FL6B 4Q74A 5K9OB 3EGSB 5E5MA 5HHVL 4GKZB 4AEHL 4AZBA 1QBAA 2MQ3A 2VYRE 2OYKA 3KYNB 3TNNA 2GY7B 3S8WA 5TFSL 1CVRA 1D5ZB 1CFTA 5DUBB 1GXEA 3BN9C 3LKSB 2ICEB 3G6JA 4LFHD 2EEDA 1NDGA 3MGOA 3QXDB 2C0HA 5IESH 1JE6A 3WFHA 5EG6C 3H7BA 4Q6IB 3EJTA 1X5GA 4WNQB 1DBBL 4WI4A 1SM3L 4OBRA 3AIUA 4G43B 3CFCH 3VXRE 3B9KD 2VDRL 5DD3L 1QI2A 1I3UA 4JM2B 3TN0D 3BJLA 5HYJD 4JFZL 2ATPB 4XCNA 5CSZA 2JJTA 3V0WL 4WW2C 2QQKH 3OTTA 1T80A 3FHAA 4CN1A 5DZNA 3RVUD 5I30L 3H0TA 4RFNC 4OLVL 1LP9B 1QNZH 2DJSA 3HLAA 1H15A 4U6TA 3LXAA 1FV1A 1HXYB 4JY6B 2GSJA 1DUZB 3IDMA 1YMMD 5HPMA 1GOQA 3ZDYF 5JA8B 1AIFB 1VGKA 4WKAA 1Y6NR 4X9BA 1TQVA 5HGGS 3IRPX 3OKOA 1UD8A 4PMUA 3EYSL 4G6ML 3KPRD 4ZAKA 5C0BA 3PGFL 4X7CC 3MCKB 5E1HB 2J7BA 5IB3B 2H3NA 3TV3L 3ARPA 3O81A 3WELA 1GUVA 1HH6B 1QBMH 2LU3A 2ZZUT 2VDQL 3THCA 1WDQA 3KPLA 1PQZB 4XCYB 2LE9A 1EEZB 3GMPA 3V5HA 1EEYA 4NRYA 4KKCD 1RZ8A 5DC0A 2DQDL 4LCWE 3TWCL 1DE4A 2BSSB 2VE6B 3LQAC 5HI5C 2CPUA 4LCCC 2EKSB 1ZHLA 4U6XB 5LAXB 3OZPA 1AO7A 1A4JB 4MXVE 1DEDA 5CS7A 2F5BL 3KNBB 4MWFB 2O93L 4U5IA 4XCEB 2WBJB 5CBEB 4UIMA 5FO9B 2Q3ZA 4YHMH 1VESA 5DEZA 1FNFA 3CFBB 3IYLW 1Y18A 4LQFL 3MSPA 1RHFA 4C55A 2VXQL 3IDGA 5FO7B 3EMCA 3U0PB 3U7BA 5D1XD 4ELMA 2CERA 2UY6A 4PJHE 3TJHD 3K1KC 3FNDA 4CU7A 4OLZH 1T1WB 1ZA6B 3VE0A 1FCCA 1YQ2A 4FNRA 1K4DB 2F61A 4FP8L 5IG7A 4HUUB 1CQYA 3FB6A 3QFJB 4NO3B 3B9DA 5CILH 4QHNA 2LVCA 3AM8C 2ICWA 1FHGA 3VMNA 1I1WA 5AZ2H 2OWXA 5B8CC 5TF1H 2EH7L 3MV01 2D3VA 1C08A 1R7OA 2NY1D 2EEXA 5EOCL 2YL5A 3PHAA 2YWZA 3LRSB 4WSJA 3RL2A 2WC3A 1IEHA 2AEPH 1QRNA 5FYLD 3UTZB 3IT8D 4RGND 1WZAA 1XR8A 4JQXA 1UB6A 3AMLA 3OJDB 4U1LA 3MLXL 4L5FL 5JW5A 1A8JH 1QLRA 2ZOXA 2Y06L 3QA3A 4KU1A 4A3HA 2QBWA 5FF6A 4UT7L 5T3XH 1T4KB 3PHOB 1A47A 4MAVA 4KKNA 2GK1B 1FZJA 4PJ8D 1T7YA 4PJFE 1JPFA 3BO8A 1U93A 3KWWA 5IROA 3HZMB 3NGBB 4I13B 2A77H 1H5BA 3BPNB 1FSKB 4IRSA 3CVIH 4P23A 4UB0L 4WUUB 5GISL 1ZBKA 1QBLH 1ULVA 5C07B 3GXMA 1RZFL 4P46C 2B1AH 2UUDH 1UEMA 2FWOA 3QXVA 5DJAB 3SGJA 2PTUA 4E9LA 5L0QB 2GFBA 1OB1B 3QIUA 5JXEA 1BGGA 1H0GA 2I9TB 5DRZA 4XPGL 1HL8A 5HI3D 3EO9L 5HYSG 3RDTB 2ZXAA 3S36X 1BF2A 3HI1B 1E0WA 4X6DF 1OTUC 4R2GB 1KF9B 2CDGA 5LGJB 3WFLA 1A6ZB 1NC2D 2XA3A 4F7EB 3MLWH 2XN9D 1M4KA 5ERWB 4JPVH 1OTSD 1MLCB 1JYVA 2Z35A 4P8UA 1ZBWA 5SWSE 1EOMA 4RIRA 4HJJH 2CKSA 3QQNA 1NWRA 2CLVA 4X4YA 3FQRA 4BQ5A 5FGCB 3F58L 1V6XA 2MTPA 4OAWB 3MYJB 1K4CA 3SGKA 4LLWA 4JHAH 2NXYB 2KUTA 4XNMA 5DHVB 1KFAL 4UDUA 3D39E 5C0AA 1DEEB 3BZFB 5IOPB 2H1PL 5FK9A 3FFCE 3GNPA 43CAA 1SY6A 1ZLVH 1RK1A 1YPZA 3U7WL 3SO3B 3PP3H 4F7CB 3GEWB 3HC3H 2FX8L 4HGWB 2HVKB 1UWUA 2NY0C 4BQ9A 2I60H 4DTGL 5JHLL 1DQDH 1ND0A 5CEYA 5JIHA 4QKXB 1LEGB 4NSKA 1LK2B 2D03H 4OIBA 3WXWH 4U1KA 4ZNEA 2F8QA 4HPGA 4OBSA 1YJDL 2C1OA 4Y4FB 2NY2C 4QRSA 3W9DB 4GAFB 3THML 2DQJH 3PZOA 3LKNB 2D23A 4YHPB 2IBZX 4WY7L 4N0YL 4XZUA 3ZYIA 2XTJE 3W82A 5E9DE 4PSPA 1N0LA 1G6VK 1JHTA 4CU8A 2J7HA 3FOMB 4DZBB 4MNGA 2JE8A 1XIWC 4KRLB 4XVTH 1TETL 1JWUA 1C8QA 1BYBA 1I1AD 1X7QB 3MCLL 3IETA 4HIIA 2BHUA 4XNXH 2DWEA 3VD9A 1U8OA 4Q9QH 1IEBA 5GGRB 4PSRA 1I8LA 1E6PA 1FVCA 2BSRB 4XB8A 3I2CL 5DA4A 2WVVA 1G5AA 2CHOA 3WLWC 4QRRA 1D6VL 4Z8FL 3TT3H 4KK9D 3UEQA 5I15H 5CPTA 3RPIB 5CCKH 4MX7B 1RIUH 5IB2B 1K9TA 1OT1A 4L8DA 3U7YL 5D2NE 3D18B 3TBWB 3P0YL 3ZE1E 3MSDA 3RY4A 5FA3A 1KWGA 3WF0A 4PMZA 1OQOA 2O5XH 4Z9KB 1WC7A 3G6AA 2Q7NA 2XVLA 3VPLA 2IPTH 4PLKC 4UUJA 4LPUA 2DRUA 4WI3A 2DWDB 1J88A 1QYGL 2F58H 3BKJL 3BZEA 3M17A 4K9EC 2JELH 5D5MF 4BZYA 5SWZD 2YK1H 4D72A 1ZA3B 3O41B 1XZ0A 3MRNA 1NDMB 5DHYA 1CK0L 1W72B 2GVYA 1UD2A 3NCMA 2WWMD 1LMKA 2OYMA 2WQRA 1OARH 4JKPH 4HUVB 4K9EL 3W6MA 3VWJD 2C26A 3E6FA 4FQJL 2MSPA 1DHKA 1SJHA 4UQDA 4L8BA 1J12A 2WHJA 3O6ML 4BQBA 4R9HA 5SWQB 1CLZH 4YGVB 1SYSB 3GGWA 4R3SB 2DGAA 4WIWA 1KCVH 5JIWA 5IIEB 3UJTL 5TE7L 1EX0A 3W38A 5F7WC 2QQQA 1R24A 2ZCKL 3G08A 2FIKA 3VXNB 3IJ9A 1GJIA 2CNCA 4GXPA 3UTTB 3RWFB 1K3ZA 1MAJA 5GGSB 5DUML 4UFMA 4LVNC 3MRLA 2RCSL 4MAUL 5I74B 2PETA 2OCFD 4HUXB 1IAKB 2X2IA 2WBWB 1F6AB 3PXJA 2J2ZA 3QHZH 3TN0A 4HWBA 5C9KA 5D96B 5GNXA 5ICZB 1QUNA 2XJ7A 2YL6A 4PJ7B 3U9UA 1RUPL 3UX9B 1VJZA 3FO0L 2P5WE 4UQ2B 4AY1A 4LCIL 1I3VA 3AS0A 2YLAA 3RWIB 1RMFH 2Q76A 2AI0H 1JNDA 3VXTB 5D7SL 4FQ1H 1I9RL 4KKAD 3DSFH 2ID5A 2A73A 5DRNA 2UY4A 3NTCH 2ICES 4ZFOA 1G6RL 3MLPA 5DVNA 4QRPD 3WNLA 5ID0A 2F8XC 3CX2A 2P42B 4OQTL 1A7OL 3DMMC 2BCKB 1CDIA 2Y7QA 4P2OB 2X4NA 2EDRA 4N9GA 3EYOB 4R0LB 4JPWH 3TA3A 1FE8H 3O3BB 5ABEA 5KANG 2C7FA 2BVOA 3BN3B 4H1LB 3NAAL 2FATL 2PF0A 2EDKA 1ZT4B 3QDME 4RX4D 4W86A 1J1XL 2PXYA 3BE1L 1NFDE 3EW3B 3DC0A 2EZ0C 1QFUH 3BIKB 3HE6D 3FFDA 4ZFGL 2FX9H 1HKJA 5DQJA 2IANE 1A4KB 4H20H 3ULUF 2P8MA 1UD4A 2UV3A 1NBVL 1PGRB 1VPOH 5A40E 4UTAL 1OCWL 2G3JA 1E4WH 2J6EH 1KULA 5LWYL 3WIIL 2CBJA 4XI5C 4X7SL 5D2LE 2X4SB 3GMOA 1LO4H 4UINL 5FA4B 3QCUL 2ITCB 2H45A 3O45A 4NQCD 1KEGL 2OBGA 3AIVA 1H8OA 2NNAB 1JZ5A 1BQHB 1F3JB 3J7HA 4OCRH 3GM8A 4UOQA 2FJGA 3MC0A 3BQUC 3UERA 1F58L 1NAKH 1QSEE 2DI9A 3QDJD 3E8UH 3S35L 4LLMB 3BC9A 1EAPA 4J3SA 4PRID 4DGYH 2XFFA 3P0VL 2P7TA 4NWUL 5TPWL 4CVUA 5HHOE 4CCDA 3BSGA 4I2XA 2A9ML 3UYPA 1GZQA 5TQ2H 2DH2A 1VJSA 3CVHB 3X11A 4GI6A 3OKKA 3VFSB 4PRDB 5I75B 3ULUC 5CLTA 4A6YH 5HGDA 2QV2A 5T33H 3AHXA 3K4ZA 4F80A 2F7RA 2JK5B 1XSJA 1TQBC 2BVUA 1ISYA 1QWNA 2YSSA 3MX0A 3BDBA 5C0FA 3QIWD 2ZUQB 5EUKA 3BIBX 1EPFA 4DW2L 5LQBH 5EUOB 4I0PD 4PGEB 2BY1A 5CSGA 3PABB 1A21A 4FQQB 5FHBL 4JRYD 1DZBA 3TBVA 4I3RH 5DJCA 2ADGB 4JZOB 4X7DC 3PZGA 5J6GB 3OXRB 4IISA 3V6ZA 2FECI 1CT8A 3RA7H 1UQYA 3HRZB 3ALFA 2A9NL 1S7XB 2AK1H 4P5TD 3S36L 4AQ1B 5E6YA 4FFWC 2DS4A 2V3FA 4APQC 4AXNA 4Y4KD 5EOQL 5C8JB 3CGTA 1H0IA 1GIGH 3O11A 3AJ7A 4JM2D 3QEUB 4FK9A 2YD6A 4F8TA 4AD3A 1UXSA 2NY3C 1I8KA 5AZEL 2FBJL 5J7CC 4KRPB 3MJ6A 3QUZC 3ULVH 2XN9A 1DWGM 4OGAC 1R33A 3QAZB 3QRGL 1XGQB 1K9FA 3WEXA 4KK6C 4D6EA 3FL7A 3RL1B 5E0FA 3M1BA 4XT1C 2YRLA 5KVMC 3AAZB 2CH8A 1JJUA 3L3IA 5GIRA 3VXMD 3WFDH 4GQRA 3QIBC 1H8NA 1UOKA 2A6JA 2WIIA 3EZ8A 5E4EB 1C93A 5TDOB 5L7XH 1RUMH 1U2CA 2VLLB 3NCYS 4H26A 4PJXF 3UC0L 5I76A 5ACLA 1WBZB 1IT9L 4TSAL 2VDOH 3GSRA 3DARA 1EERB 3TVMC 3DUSB 2EPKX 2EXWC 3LPOA 3NFPB 5IJVB 1IM9A 3DYPA 5SX4H 2EABA 4HIJB 4GT7A 2IFFH 5GS0L