1J0JA

Crystal structure of neopullulanase e357q complex with maltotetraose
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
588
structure length
588
Chain Sequence
MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLYSGEEKLVYTEKGFYFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPSISPEGSRPWGSEDPTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGESSKYKDWFHIHEFPLQTEPRPNYDTFAFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGQIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRSLRRGEISFLHADDEMNYLIYKKTDGDETVLVIINRSDQKADIPIPLDARGTWLVNLLTGERFAAEAETLCTSLPPYGFVLYAIEHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords neopullulanase
publication title Three-dimensional structure and substrate binding of Bacillus stearothermophilus neopullulanase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 193
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.2.1.135: Neopullulanase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j0jA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1j0jA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1j0jA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1j0jA03
3QHFL 3T0EB 3O3BA 3IFPB 1CE6A 3X17A 3GSNL 1BLIA 3DMMA 3RWIA 1NC2B 2CGRL 2XQYK 4NQEE 3V0VA 4NKOA 4X8JA 4YXLH 3UG5A 3ARRA 2P4AB 4OV6F 5GJTH 1FCCA 1N2RA 2Z1SA 4NP4H 3EMCA 1KN4L 5JORB 3QH3A 4O9HL 1OTTD 3AQUA 2BSSA 2ORBH 4XVUD 3G9AB 1I3UA 2CIPA 5SX4H 4ODSL 3OA5A 3IU3A 2N7BA 1E4WL 4FQXD 3U4AA 5HVHC 2FJGA 5DRZB 3M7SA 3QUXD 3QFDA 4GKNA 1MW3A 1OY3B 2BFVL 2DLTA 3VFTA 4GG6B 2OI9C 3Q6FA 3GSNA 1AO7D 1PEZA 3EYSH 4DGVH 5DJYA 2FB4L 2F18A 3KL0A 2KDGA 1OW0A 2EDYA 4I4WB 5A2KH 4NO3B 3ARGA 1MRDL 1H8OA 1WBZB 4OJFL 4YDLB 4OGYH 4LIQL 5CGMA 1XGQA 3U46A 3RGVC 3BYTA 1W2VA 1I1CA 1LMKA 3QXDB 4V1DE 2VURA 4NZRL 3RWHA 1RJYB 3KPNB 1DR9A 3I2CH 3I84A 5E9DB 1OP9A 1Q6CA 2AXGB 3GMLA 1QG3A 4GBXC 4AMXA 4OCWL 3TPUA 3OAYH 2AGJH 3SEPA 3KLSA 2RCSH 4RFOH 2ICWI 1P4LB 2XZZA 5J11C 1Y6MR 3CPLB 5FO7A 2XWBA 2YD2A 3KPLB 3MRHB 2R1YA 1OARL 4UDUA 4E8CA 3QIWB 3HG3A 4JRXE 1HHGB 2WMIB 1WAWA 1QR4A 1NBZB 1FZJA 3FCTB 3E6HA 2HFGH 1K2DA 2NY7H 1CG9B 2H32A 3RRQA 8CGTA 1UWIA 3MRFB 3WDJA 2X9YA 3D51A 1FSKB 4HMDA 5BXFA 3DPBA 1U93B 3RBSA 1NMBH 5IMLB 1KIRB 4MD5B 3NSMA 4U2ZA 4G8EB 3OHXA 3PF2A 2VH5L 2X4SB 2YPKB 1CBGA 3TFKC 4Z5RA 4N42A 5DJ8B 3CFKA 5GGRA 4NC1C 1P4BL 1C12B 1NUGA 3FO0L 3TO4C 3ZKMD 2LAGB 1OWWA 2XNAA 2OMBA 4I0CC 1KJ2L 4DO4A 3DHPA 4PJEE 3SGKC 2XICA 1W0YT 5B3NA 4U1SB 2EDKA 3CZEA 2F7PA 4W81A 2IFFL 3SCMC 1AXSB 5HHVL 1QNOA 4JAWA 1J9YA 5ENWA 2QHAA 4JRYE 2WINA 1QSFE 5HVWA 1WTGT 2EJ1A 1DBKL 2UZIL 2Y06H 1UR0A 5GRYA 2H9GB 5E2VL 5EB8A 1AY1H 3PXHA 2OSLA 3WY1A 1NC2D 4Z2KA 4NN5B 4F66A 1I8MA 3HNTH 2F53E 1H3UA 5JMRA 4HAFA 1YEHH 1ZVYA 1KQZA 2DLGA 2AK4E 3V9FA 2JIWA 3U79A 3HHRB 5J9PB 5ECUA 4WTZA 1FL5B 1B88A 3LV3A 1OB1B 3G6DL 1N6UA 4JM4L 4NBXB 3DV6B 1GJIA 2O26U 2X2IA 4QXGL 3EYVB 3CVHB 4M9OA 5C70A 3NJ3A 2IPTL 5JO5A 2Y72A 3ZSTA 1BQSA 3RZCA 2HVKB 5F1NB 1S7UB 1A7RH 4JPIB 3VFUB 3U4EB 3KPQB 3WMCA 2W38A 4RGNB 1KYOK 4HMCA 3SCVA 5CBEA 3SCWA 4MGXA 1WDQA 3IDXL 5HHNB 1G1YA 4JJHA 3KG5A 4OF0A 1YJDC 1OL0A 3FRUA 3OKNA 4HUMB 3VDAA 1BMGA 4LCYB 4I3SH 4QRPB 4HWEL 5I19L 4ALAH 4Q7NA 1B90A 4LARL 3QDGB 5E9DD 4P5TC 5C8JB 3PZGA 2JEQA 3KJ4B 2WK2A 4XMKH 5C08E 4AYSA 1CLOH 1CICC 3SKMA 3GXPA 1EAJA 4AD0A 2H1PH 4YE4H 3SKNA 2R0LL 5GSVA 4NGHH 3BEVB 1VFBB 1RD6A 4G6ML 4K94H 4W8BA 4IMKC 5IROC 1WICA 1IKNC 3BQUA 3MCKA 1P1ZB 1WBYB 2L7JA 3D1MC 5HTSA 2IAMA 1XGUB 3AC0A 4LPWA 4XAKD 4OZ4A 3HI6L 1RU9L 3ARPA 4F33A 1JPSH 3G04B 1VGKB 1D5ZA 1NOUA 3CSYA 2D23A 1OD7A 4NF7A 2OWCA 1KXQE 4JVWA 2DQDL 2YD4A 35C8L 3L2LA 4RBPH 1NGYA 3QHZH 2CKBA 3TT3L 1MPAH 3MO1B 5GISH 3G6AB 4JO4L 1WCBB 3AFBA 3BT2H 3UO1L 1UR2A 2HWZH 1S8DB 5ID1B 4X7CC 2EZ0C 2JJTC 5GRWA 1A7PL 1GAFL 4I18B 4RWYL 3RKDC 1AP2B 3HS0B 1G6RA 1JV5B 3IVKA 4KY1H 4MAVA 3T4YB 2AJXL 4JDTH 3W27A 3HC0B 4LSSH 1QNPA 4LLYB 2ITDB 1KELH 1FP8A 1V7ML 1ZS8A 3NGBB 5EU5A 3CFEA 4WJ5B 1Y7VA 1G9NH 4U4BA 3ABZA 1YYLL 4GPNA 4UNUA 2IF7A 3P0VL 2PWEA 4QKXB 3NABL 3C60C 1CGSL 2AKRA 1QBAA 2WV3A 2X4PA 5ADPL 1ACYL 3VFWB 3GNPA 5CEZL 5D2NB 2VUOA 1KCSH 1WEJH 2QHRH 3B3IA 1MCCA 1NCWL 3DX7B 4X6BB 3GXNA 3QXAB 4PTTA 1T80A 4XBEL 2J79A 3LKOB 3QUYB 3CU1A 4P23B 3OPZH 4JGJA 4F7EA 3HMCA 3SDYH 4U0QB 4IM8A 1TTFA 1YEGH 4UQ3B 2GJ6B 5BQ7B 3U0TA 5EOCH 1LK2A 4AXNA 5JW3H 4JFEA 5A2JH 4LLDA 1GUVA 2YLLA 3K7UA 4M56A 3SCRA 2W59A 4W85A 5I6XC 3MREA 4RGND 3L1OH 2E6JA 4ZXBB 5IIEA 1C08B 1KCVH 5LCVH 2CRYA 3BD3A 1SYTA 4JKMA 3H7LA 5KS9F 3AXIA 3DROA 4P9HC 3EO0A 2PO6A 1AHWB 5DD0L 3MNZB 4QRPD 1KJ3H 4M6ML 2J88H 3QDGD 4AZCA 5H37H 2OCFD 3RTQC 2FIRT 5ICXA 3ZDXE 3AHXA 5A8MA 3TV8A 1OAKH 1SBSL 1NLBL 3VW3L 5EH1A 5KVDL 1V7NH 3LOWA 1IKFL 1V6XA 3ZE2E 2DBJA 3LB6D 4R4NC 4RMUA 1KB5H 4HPHA 4H2CA 2CLVB 3ARQA 5DQJA 1ZLUH 4X6CF 3RUGA 1F6FB 4HBCL 5D70H 1DDHA 4QTIH 5SV3A 4JIEA 1U9KA 1T5WA 1JWSB 2ZX7A 3VM5A 5FKAA 5GSRB 2X4OA 1DP0A 1LNUB 1P7QB 4R26L 4Q9RH 4WLCA 1A6VL 2D4DA 1RK1A 5J3HD 3CZGA 1QA9B 3X11B 4LNVA 5CGYC 5JUEH 4PLKC 1ZAGA 3VTRA 3CLFL 4KKCC 4UU9A 5TFSH 1DQDH 1GSMA 4JAMB 3AMCA 2NX5E 4TNVK 4JZOA 4XP5L 4LSQH 1DSFL 5T1KA 5KS9B 4KKBC 5E1HB 4PJBF 3P9MA 3QEHA 1MCRA 4N0FA 3CHFA 4X4YA 3RWEA 5K9JH 2A38A 3MFFA 1TQUA 4H1LB 5CEXA 3AXLA 2ZX8A 4HW6A 3I6LE 1E4XL 2CBJA 1MCWW 4X0KB 2YMXL 2OJEA 3MLZH 1SVZA 1V6UA 4OQTA 5FOOA 1E4KA 3GHBL 2D24A 1XCTB 2FO4B 1QNQA 4NC2B 1T3FB 3ROLB 4HKJB 1UKOA 5ITBL 2ZCKH 1MHPL 4XPGL 4JO3L 3TJHD 1ITCA 1FH5L 1J0IA 3WXVL 3NFSH 4W84A 4P3CL 4X6CB 1K6AA 1DFBL 3ULSB 1U41A 3BJ91 1E4XI 3BPOB 5A2IH 4PP1C 1IGTB 1XYZA 3JV6B 5FA4A 3MXWH 1H9VA 3KR3H 2Y07H 4OT1L 5E5UB 3FFCA 4G42B 1F2XK 3CCHB 3I6GB 3QUYD 3ARFD 4P23D 3WDIA 1FFNB 4P2RE 1BX2B 3SCSA 2AJ3A 5D9SB 5EULV 5BJTB 2XVPA 1XCQB 1XR9B 4P4RA 1G7IA 3MRMB 1S7TA 4PJBB 3LDBB 4HIEA 1RMFH 3A24A 4R97C 5CMAA 1K85A 4XZUB 1H3GA 4L5FH 3TWCL 3EDKA 1ZBCA 3UEQA 1CT8A 1J87A 4L4TA 5DRNB 3RPIA 1A5FH 4OUUB 2DSKA 2LE9A 4JCMA 3NH7L 4NRXB 2LU4A 2PXYB 5IVXF 5EU4B 4S1QH 4GI9A 4UIKH 5L0QC 3T65A 4R0LC 4BUHA 4RWHA 2W65A 5TGBA 3MLUH 2G5BB 4K7FA 1TA3B 3VXUD 1HI6A 5ERWB 1EUTA 2EDRA 3QI9B 3GSWA 1JUFA 1KG0B 4NNXB 3SOBL 4X9YA 3ECBA 4QXUL 2ZUYA 3R0NA 3KYOA 4NYLA 4PR5B 1S3KL 1CQYA 5ESVB 4P8UA 5AG8A 1QSZA 4FQJH 4NHUB 4G9FE 3S9DB 3B5GA 3FL7A 1IC5H 1S7RB 3AREC 5HHOD 4AT6B 2WANA 3PV7A 4OD2B 1NWUA 2VIRA 1C8PA 1P7QD 2VLJE 4WV1C 4HXAL 4Z0BH 4ORZC 1XR8A 3V5DA 1ZTXH 1HHKB 3MA7A 1ES0B 3U7YH 3A6BL 4N5EC 4NQEA 4MXQC 1LDSA 5CXPA 5IVNA 4NT6A 5I8OH 5EDXA 3RWDB 4YZFE 3CC5A 4EN3C 2IBZY 4XZWA 2UZYB 1HILA 4P5KA 1XMWA 4GXUN 1M7IA 1AGDB 1U8HA 2DMBA 5D5MF 1BPLB 1C5BL 5IVXB 1MJ7L 4UAOB 1L0QA 5JOFB 3DRTA 4KAQL 1ITBB 1H8SA 4HIHA 1NCAL 1E4JA 3D9AL 2F8QA 3MV01 1HVXA 4WI3A 1ZHBA 1UR9A 4RE4A 4AZGA 1OQOA 4WW2C 3FT4B 3RWFA 4XCYA 1ZEAL 5KZ6A 2NYYD 2YPVH 1SMAA 3GUTB 1MWAB 1CDHA 3IXAB 2I07A 5BW7A 2WB5A 3C6SB 1CFVH 4E41B 3ETBF 1INDH 3TBVA 1NGQL 1RSFA 4LHQB 3APGA 3E2HC 4ZTOH 3SDXE 1YY9C 1RV6X 2Z8SA 5ACZB 3WUWB 4K8RC 4M62H 4XB8A 2PR4H 3W39B 2ADJA 3RIFK 1MCIA 5AUMB 4FTVD 4M3JA 4F7CB 1UENA 3BSZL 1JYNA 2RHEA 1FCGA 4D6DA 5IHRA 5MHSD 4Y2DB 3C08L 2AV7A 1CXIA 3CFJB 4FFWC 1CLYL 5I76A 4Z8FH 2YL9A 2LTQB 5LVEA 5I17B 1UWGL 3D2UD 1VDGA 5D5MB 1C16A 4B3LA 3DUUB 3BC9A 2ZCLH 5IBTH 1C7SA 1XZ0A 1MRFL 5LGJB 2YUZA 3WD5L 4YDIL 1C8XA 1UASA 2Q8XA 4LLUB 3PHAA 4GO8A 3GJEA 3L4XA 3RY6A 3K46A 1JNNH 4OZFA 4XPTH 4QXTB 2DQJL 5A6KA 3UTQA 4GUPB 3QI9D 4HC1L 2W0FA 1KEMH 1FLRL 3EJYD 4D9LH 5DURB 3AZSA 4QCEA 3QPXL 4D6GA 4LSUL 1HKLH 4PJEA 4XPFH 1VB9A 2AAVA 5B39A 4G7VL 4ZUVB 3VGAC 4DAGL 5LA2A 5KVGL 1Z3GL 3FQNB 5JXAL 3GMOB 1FP5A 1GGBH 1JPFB 1XF1A 2HVJB 2UYLB 1TZGH 1YDPA 2BX5A 4O5LH 5DJ2A 1C1EH 2OYPA 1MEXH 5ABEA 1TMCB 1QSFA 2E7MA 4G6AD 1KB3A 4XCNA 1E0OB 4PB9L 2YLAA 4PY7B 2WAHA 4NZTL 1TNNA 2XUCA 1S7XB 1PYWA 5EC1B 4LMQE 3L3JA 3DO7A 1EA9C 5HDLA 2IALA 3S5LB 1PLGH 4OUEA 4PP2A 4PUDA 3CMOL 4HH9A 2DIJA 4PB0L 1OTTC 2AK4A 4LCCB 3UC0H 4U1JB 1WF5A 4XVUC 4FABL 1LE5A 2X2JA 1W2KT 2X41A 5JPMA 2ZX9A 4FQXC 1W3JA 1LEGA 1TPXC 3QUXC 4XXDA 3RBGA 1IM9A 4MCYB 1BFVL 4OV5A 1RUQL 5T5NG 4K3DH 1NLDL 3LKSA 1MJ8L 1K8DB 3H9HA 3O8XD 2WVUA 5CSBA 4HGMA 2IH1A 1B4JH 2IBGA 2FYYA 3HRPA 4YQXH 3C5ZC 4PGJA 3UG3A 3MCLL 1NAMA 1I9RL 2CJUL 2DEPA 2YSSB 1LEIA 2JB6B 1GCFA 1QOKA 3DI3B 5GS1C 4E41D 1UHVA 1ZLVK 3DOSA 1T0MA 4PRPE 2X1PA 4JKWA 1OP3H 3R1GL 4ZUSB 1KTRL 3OAZH 2ESVD 5EUKA 2ZNXA 4CVUA 4Z7UE 4WFHE 3WNLA 3GH4A 4W7UA 4AD5A 5DK2A 3UPCA 2WIIB 2WKLA 3L3IB 3O6ML 1BBJB 4K2UH 5FKYA 1JGDA 4O2CB 4Y2DD 1OAXH 1I3VA 2VUYA 5E8PB 5ETUA 4Y1AD 4UINL 4S10A 3V5HB 2G9HB 2RFXA 4NKIL 4F8QA 4CVZB 1KXQA 5F89B 4MYWB 3S5YA 1BQHA 1X5XA 5JIHA 4FNLL 2A2QT 2D31A 3BIKA 1O7DC 2ZSWA 2WVSA 2C4XA 3NCBB 3AHZA 1UM5H 3NDYA 3FONB 3QQ4B 1WC7B 5I1IH 4TOYH 3DRQA 2UZXB 1KIUA 2ICEA 1UT9A 3TTOA 4ZAKB 5I1DA 3ZKMC 3G9VA 4XBPA 3MRQA 1I3RB 5GJSH 1TENA 3KPPA 3MX0A 4TTDD 4NO2B 4UUJB 4L4OA 3FQUA 4C56B 1C7TA 1W1TA 4GKSB 4IUGA 1K4DA 1FLTX 1UB5B 2RR3A 4CBPA 3VRJA 4WTZG 1LJYA 3SKJH 1E15A 1AQDA 2AQ1A 4LSDA 4YWGH 3TYFB 1KV3A 3UCQA 1V6YA 3EYOB 4K23H 4X6FA 1PD6A 3QIUB 1RULH 3VXRA 3QHOA 4XMPL 4E0RB 1S7VB 3MODL 3D5OF 3BSHA 1BZ7A 5EOTB 4WKAA 5DD1H 3WIFA 4HF5H 4TUOB 5SWSB 1T20B 4J3UA 5DSCA 4OCYH 4WO4A 4P46B 1C5CH 4V2CB 3BE1H 4G43A 4NJ9L 3PTMA 2FR4B 4TYUA 4PJXF 2A1WH 3D50A 3JSSA 4YXKH 1JFQL 1IGMH 1IBGL 4PGBA 4R90H 5DD5L 2HA1A 2ZJSL 1YPZF 2DQFB 1U8IA 4DWSA 5C0RH 1TZIB 4LVHC 3U2SA 5AG9A 1I1AD 3SDCD 3OQ3B 4MAUL 4JFDB 1J1XH 4NZUL 4X7TB 3NCCB 1G9EA 2Z31B 1Q1JL 3TNMA 2WLYA 1QFHA 4M82A 1DBJH 1UKPA 3EYFA 2VL5A 4POYA 2OTPA 3V4VH 1W0WB 1HIML 4X80H 2MCPL 5IGXH 2ATKB 4P8WA 4IRSD 1CFBA 2DDQH 1OGAA 1BFOB 5FGBC 1QYGH 4NNYB 1GC1L 3A4WA 1KB9K 5TE6L 3CH1B 2FX8L 1GGIH 4XH2A 2BNQB 3INUL 2E7LC 1YNKL 2QBWA 5EZOH 1F3JB 1DUZA 2PW2B 1EMTH 2DT2A 3VNZA 3BVNB 4X5XA 3EGSA 3CXDH 1UWEH 3I9GH 4WY7H 4F9PC 4NQDD 4ZUWB 5ALBL 3UZVB 2XACC 1CLCA 3NCMA 4PJXB 3GMMB 1E70M 3C5SA 2G3IA 1N64L 4LCUA 1NCNA 4JL2A 1E4NA 4YHYC 1JMXA 1YPZB 1QRNB 4N0UE 1FSKC 1KT2B 1ZK9A 3UTTB 1MQQA 4MWFB 3QCVH 1WO2A 4M1GH 1IAOA 4UILL 4MX7A 1Q9KB 5JXEA 3EJQA 2VVNA 3K81A 5DK3A 2PTVA 2F54B 2NX5A 2X42A 5HPMA 5DJCB 3TBYB 5KVMC 4P2OB 4RL3A 3O3DB 3TZVB 4KRLB 4HG4K 1TLKA 5CJXA 4F9LC 1DEEA 3GHEH 3QGVA 1WB0A 4QHNA 4N9GA 2C1OB 4AM0A 4X0VA 4BH7B 2GYSA 2E9MA 3AIUA 1AH1A 1R34A 4ZQKB 1A7BA 2JFEX 2AXFA 1CBVL 1BQUA 4R7NB 2Q3AA 4PG9B 5HGAB 1E27B 5BO1H 5E4EC 4RMVA 3L9RB 1NMAH 1PKOA 2EE9A 4TVPL 4DGIH 3BW9A 4LEOB 3QIUD 3QUMB 1FVEA 1J8HD 1SYSB 3HE7A 1TJIH 1X4YA 2VITB 4OQ1A 2NY3D 5HDQL 1KN2L 2P5EA 3G5ZB 2ZXQA 5FAAA 1RZJC 3NMEA 3TM6A 1R8LA 1AR1D 4FQPA 1WGOA 4KMQA 3L3HA 4Q6IB 1KPUA 1X4ZA 5DEFB 5DJ6B 5J57B 3UBXB 5GGTA 3WQ8A 1PS3A 1T22A 2WUBH 4W88A 5F6IB 3MA9H 5BVJA 2XIBA 3KPTA 4XP4H 2VTFA 4PJFF 1HTYA 1RZIB 3HKFA 5D2LF 6TAAA 4K9EH 4FNPA 3WSUA 4PGEA 4QWWD 4HUWB 4M24A 1KIQA 1JNEA 3BZDA 3O2DH 4GRMB 2R69H 2Z8VC 4RGNC 1RFDL 5IDIA 2ZOLA 4C57C 1R3IH 2M2DA 1NFDA 1HNYA 4Y16B 4Y4FA 2XTJB 4MJ6A 3SE3C 4QEGA 3BWUC 4CADB 1G5AA 3BAEL 1DLFH 1HH9B 3FB7A 1F02I 1FGNH 4U1LB 4OZIE 3H3PH 1HNGA 4WWKB 3SGEI 2CSPA 5DQDL 3KJ4C 1XEDA 4JLRA 2R2CA 3SJVB 2WHMA 1A21A 4FP8H 4LLWA 4YHZH 3UPAA 4PLOB 4QLJA 2BNQD 3LB6C 3D0LA 5M03A 5EU6B 1I8KB 1N5YH 5FYKL 3V4UH 2HLAA 1AD9A 3TBTA 5D7SL 6FABL 4G9FA 4NO5B 1R24B 5ICYA 4LRIA 4PJFB 2VLJA 4XAWH 1KBGL 4OFYD 5D2LB 3MUJA 3FQRB 5J3HC 3MV7E 4FFYL 4U6TA 3PWUB 2BDNL 3U6RA 2GUOA 4RZCA 2MQ3A 3K8LA 1BVLA 5D9MA 3O9WD 2F54D 5EWIL 5AWNL 4PTWA 2MQ0A 3D18B 4NCC1 4WI5A 4Y19B 4KJPD 3F58H 3GSXA 1OM3L 1GNXA 2WXDM 1S5IL 2EAEA 2EE3A 1FNEA 2VISB 1MVUB 3OKKA 4TPRL 1N5AA 3EOTL 4I18C 5ICZA 3C2AL 1NUFA 4IRJB 4Y4HA 3FAXA 4GMTH 1JPGA 5T3XL 1VKXA 4NWUH 2DRUA 4CVXB 5B8CA 3IXTB 1OHQA 5E94B 5F72S 1B0GA 3IFLL 3NDZA 5FL1A 1EFXA 3LSOB 1MCOH 3P4MB 2CXGA 2F58H 1ISYA 4NRRA 4MJIB 4B5EA 3NGBC 2X89D 4NHCH 1EQPA 1C91A 3KXFE 2F5AH 3TJHC 4X7FC 2EC9U 2VZVA 4PGDA 2O5YH 2UY4A 1DBBH 4Q6YA 4TUFA 1JNJA 4NXKA 1R3KA 4HZ8A 2YBTA 4W6XB 4U1KA 1X5KA 5D2NC 1WFOA 1TETL 4YDJA 4J4PD 5FB8B 1OSEA 1ZBVA 1TJHL 2WWKT 3QUYC 3ARFC 4P23C 3QFJD 3GBML 3POHA 1UJ3C 4YDKH 1JWUB 3BJLA 3VFOA 3D69A 1NFIA 1N6VA 4NKMB 5T5NF 5TE7H 4NBYB 5E6IB 5EBMB 4I0PB 2IBZX 5TDPB 3UJJH 2MOVA 1KSRA 3O3BB 1GHRA 4JPVH 3MJ9A 2XG9A 3RWIB 3IF1B 1FV1A 2GSIB 2ZKHH 1NGWA 2MSPA 3QH3B 4QRQB 2XTJD 1NFKA 4PSPA 2XM2A 5FA3B 2Z93A 1AHWC 4K7PH 3NCJH 4UIMB 4HOWA 4OCSH 2WC7A 1P5UA 1U95A 3I85A 5FCSH 2QR0A 4ONGH 1FBIH 1NCBL 1RIVH 2VC2L 4O02H 4M6OL 1Q6FA 1SM3H 5E1AA 3VFTB 4ZFZA 3SJVD 1D5XB 2D7OA 3Q6FB 3GSNB 5ISZA 3RDTB 1WCGA 1X5GA 1IC1A 5AYIA 4JFYB 5MEQB 3X14A 1UXSA 1L7IL 2DSWA 1U8NA 1LO4H 4HWZA 5EU6D 5HGGS 5IQ7H 1N26A 1QNRA 4LU5H 4KTDH 4R7DA 1JZ4A 2YHGA 3U46B 3A21A 2IBBA 5FD0A 1SEQL 5IMKA 5T1DL 1R3HA 1S7SB 3MLRH 1A6UH 3GJFB 4AZ5A 1UUQA 1EHNA 4JR9L 5D7JD 5DGRA 4HIJA 2W60A 2VDOH 1JPTL 5IK3A 5TE4L 1H15A 4FXKA 5DD6A 5JHLL 2ICWB 5ESAA 2MNUA 2EIBA 4Y19D 2GK1B 2R1YB 1I3GH 2QJDA 4YXLL 3KLDA 1YY8A 2GTWB 4ODHH 2F8VA 4PV8B 4RDQG 3RL2A 3SE9H 1VGEH 5GJTL 1F58H 1MIMH 2VXQH 4Z78A 1V0KA 2R9HD 4NP4L 4APQA 3SIMA 1MUJA 1BZ9B 4IOSD 1QBBA 3E6HB 4JQXA 1BWMA 1BPVA 3C6LA 3U7VA 2ORBL 2UUDK 4WUUA 1K4CB 2BVUA 4YDVB 3WN5A 5E00B 5BXFB 5JOPE 2Y7QA 2IH3B 1AKJB 1PIFA 5JTWA 1CZ8H 5C07E 3DX9A 4MAYD 5H8DA 4XNZB 3Q5YA 3DDFA 5JUVA 3EYSL 4DGVL 1SYVA 3DGGA 3LMJH 4CMMB 2NYYC 5SWZD 1KLUA 4YO0B 4M7ZC 2DYPA 1NGZA 1Z9SA 1GOOA 4OGYL 1LP9F 5ABHA 4IMLB 4ETQB 1W9XA 4KMTH 5SX4I 1UQSA 2DKUA 3BPOC 1ZT4A 3X3FH 5C3LD 1YMMD 3S35L 1REIA 2F8XC 3RPMA 4YX2H 4E5XA 3I2CL 3PQYA 5CCKH 5K93A 2XN9B 4QHKJ 1MAMH 1K9TA 1DVFB 5HHMD 2YD6A 4Z2JA 3CX5K 3NN8A 5ENWB 5IFAH 2WINB 4OZFG 2AGJL 5E6ID 4OZHF 4I0PD 1PFCA 5F9AC 5ADOH 2RCSL 4RFOL 3GSVB 4ZODA 2AMGA 3WQ4A 5D1XB 3DMMD 1KJ2B 1OGTA 5C0GA 3LDBC 3CMJA 3OLGA 3NPZB 4R27A 5B39G 2X4RA 3WHXA 4TX6A 2Z8RA 1RZ8B 2FL5B 4BA8A 2PKDA 3NZHH 1OP5H 3VH8A 2GTZA 4MNHB 1P9MC 2HFGL 2NY7L 4LEXL 1IL1A 4LPCA 4U1IA 3WFBL 3Q6GH 4IIQA 1PQZA 4NIKB 1ZGLM 1NMBL 5EUOF 4G9DA 5E6YA 1A7OH 5AYQA 4BFGA 5KAQG 2DLIA 3U4BL 4JFPA 2OL3L 4UQAA 5E8OA 5F3HA 2VCBA 3QI9C 5HYFA 1HX0A 4N0CD 2HT3D 3L5WA 1FNAA 1G7MA 2I9LA 4LHUA 4PRIE 3VMPA 3EJYC 3K1DA 4I2XB 1LP9B 2EEBA 3BRDA 2YFNA 5EBWB 3HR6A 1JMZA 3I75A 4Y4KA 4RGMB 5CSYA 4L4PA 3OKNB 4YAQB 2DWEA 2CH8A 3RHWK 4D3CH 2I25N 2CHNA 3RFZC 4WEMB 5I1AA 1A14H 5CHNB 2ED9A 3N17A 4L29B 2R2EA 4OZGF 3GSRB 2ZXDA 3MC0A 2OL3A 4ODWB 1QVOA 4G6AC 3TBSB 3SKMB 4J8RA 4P2QB 5CINH 4J6RH 2MCG1 1QWNA 4OZHB 5J13C 1IVLA 4PCSA 4JZJA 5F6HI 3ARSA 2JJSA 2Y06L 3QIBA 4H5SA 5EIIA 1AY1L 4OGAD 2G75A 1M7DA 2IAMB 5EO9B 5IR1A 4OZ4B 3HNTL 1YEHL 4LAJH 4F33B 1UWXK 3VIJA 1R0AH 1D5ZB 1I1FA 2W9EH 4PV9A 3IKCA 1A22B 4UAOC 3A4XA 4JZ5A 3GNRA 5EUOB 4S2SB 2CIKA 5CJOH 3V95A 3OZOA 1AKJD 2QLYA 3TT1H 3PHQA 4GXVH 3O8XC 4EANA 2EXYD 5E2WH 1JNDA 3VPLA 4U33A 1A7RL 1RIUH 4YEEA 3TO2A 1UZ8A 4XX1E 5DO8A 3P9WB 1JGEA 5GGVH 3TA3A 4U05A 4PJAA 4XVTH 3TJEH 1AO7E 2CR6A 2NY2B 3K2MC 4OZGB 1BQHG 2WWDA 2N7AA 4I3SL 2CDFA 2IGFH 4ALAL 5IHZA 1CD0A 1EBPA 2BMKB 3TN0A 4XMKL 5FDWA 1DVFD 4B3KA 1CLOL 1NGXA 5EU5B 5CJ8A 2WMFA 2H1PL 3B9EA 1F2QA 4YE4L 4NGHL 1SZNA 4Y2DC 4K94L 4N90D 1YJDH 3EIFA 1SY6A 4KHXH 2AJVH 2AKRB 2LTQC 5IB4A 5EG6C 1E6XM 3CLWA 3IDJA 5BRQA 3KDMA 3DX6A 5FKPB 4PBGA 1JPSL 2BVQA 3WEOA 3SKOB 2QEJA 4Z77A 5CUSH 1JTTA 2OYKA 4BQ9A 1HJSA 5JDJA 1ZGLA 5DRWA 3AMGA 1YMHA 4OGZA 4X7SH 3U7WH 4YBHA 5IB5B 1MPAL 4DVBB 3RZCD 1F4YH 5EU3A 1YEFH 2X9WA 5GISL 5F8QC 3QJHB 3AM8A 3WY3A 2ZUNA 2AW2A 2I5YH 4TTDC 3DX8B 3BT2L 2HWZL 3WY4A 2D03H 4XVJH 1B0RA 1G7PB 3DROB 3UJTH 2Q1EA 1WAAE 2XKNA 3QQ3A 4W4OC 3ZHDA 4J3VA 3GKZA 4FXGB 3V79C 1AGCB 3BESR 1JBJA 3B9KA 3UR7A 3ZR5A 3WH8A 1KB9J 3EJUA 2HLFD 3JUYA 3DV4B 4KY1L 4X6EA 5FOBB 4MDOA 2DS4A 4JDTL 4G5ZH 4LSSL 2WZPD 4P2QD 1KELL 4XBGB 4XNXL 5A8OA 2M1KA 4X5LA 3CO4A 3P0YH 9CGTA 1G9NL 3UERA 2X1OA 5FYJD 4PYSA 3WL0A 2UVFA 3BQUD 4ACPA 2IAMD 1WFNA 2Z1KA 5HDBE 4YR6B 2V2WB 3DURA 3P4NA 1U42A 2X2HA 5FKAB 3LQAH 1VAHA 1KCSL 1WEJL 2QHRL 3GB7A 1Y18A 1XF4B 1L0XA 1R3LB 1V3IA 1I1AC 3C8KA 3SDCC 4YHNB 1E9LA 3OPZL 3WFEH 3SDYL 1K5NB 2ZSVA 1YEGL 5EOCL 1A1OB 2X4NA 4U1NB 5EPMA 5JW3L 4CKQA 1RAMA 1AJ7L 3U1SH 1U92B 2BXZA 3VXOB 1E6OH 2HFFB 3MGTA 4MVBD 1CNVA 3IDNB 1LHZA 3L1OL 1KCVL 4LCWB 1ADQH 5LCVL 4BKLA 1NBVH 3OX8A 3N85H 1EGJA 2D2OA 4GG6E 3IDIA 5DJXA 4IRSC 2EICA 3MU7A 5TQ0H 1NCUA 3L3OA 5FYLD 4C4KT 1JZ2A 1KJ3L 2R29H 2J88L 4WIQA 2NW2A 3BVTA 4M8UA 3H54A 1M04A 3JXAA 3H53A 3N11A 5KJRL 3GXFA 4W93A 3B2VL 1GPOH 1OAKL 3EJJX 3BD5A 5JA8B 4HS6B 2IMNA 2SEBB 3FFDB 1H3PL 4F9DA 1V7NL 5FGCB 4G8FA 5E9DE 3WFZA 1NCDH 1KB5L 4MJ2A 4P9HH 2J6EA 2EKSB 4HUUB 1N7MH 1S46A 4M4PA 1O7VA 3FB5A 1AQMA 4QTIL 5SWQB 5FA4B 1IGIH 2X70A 2YC1A 5EBLB 5LXGH 3MV7A 2QADB 1OD8A 4Q9RL 3OMZA 3LMYA 1UXWB 4X0NA 25C8H 5D6CA 2FLBT 3VXPA 3RIAF 3H9SB 5JUEL 4XHJD 5CEYA 5K59F 4JFED 1DQDL 4UT6H 3RAJH 1KEGH 1S7TB 2EYSB 3SDDA 4EI6A 3ARZA 4KKLD 5C9KA 4LSQL 5FL0A 3CMGA 4WHYG 5DLMH 4Z7WF 3EYUH 3AMLA 4MQTB 3EOBA 5ILTH 2CR3A 1XC6A 1FO0A 1CT8B 5K9JL 4QY8B 1A6PA 1FORL 3RPIB 1RH9A 4G8GB 1HQ4B 3DC0A 4JGMA 1FZOB 1TVHA 5FOJA 2V38A 4JM2A 4LQFH 3ZE1E 3QIUC 2B31A 4GAYB 2W65B 5TGBB 3MLZL 2XG4A 1L9MA 1TFHA 2NY3C 3R4DA 3GSWB 3EMQA 5FYKU 3FT2B 1AR1C 2BJMH 1MFCH 3QDMA 3P9LB 3DIFB 2VRAA 3LKNA 1R7OA 2ZCKL 4P57B 4NYLB 3NFSL 1CXHA 4DKDC 2E9IA 3DUSB 3H3BC 1K8IB 5CSZB 4CJ0A 3WS3B 4CDHA 1CDIA 4OFDA 4RGOL 4WK9A 3B8YA 4KHTH 1ZA3A 3MXWL 3KR3L 2Y07L 4E4PA 4QWWC 4NJAH 1E55A 5CJQH 1XR8B 5CS7A 3MA7B 3V6ZA 4JREC 2E4TA 5GGSA 5DJ0A 1R86A 4QNPF 3QCUH 1JXJA 4MA3A 3ZKXB 1FAKT 2E7BA 3VXSB 3WJJC 2WC4A 5T1KD 3U82B 3CX2A 5F1KC 4Z7WB 1Z0NA 4QP0A 1RMFL 4Z76B 5TQ2H 4HU0A 1TVNA 4EZMA 1YN7A 2C26A 1A5FL 3GK8H 3DRTB 1D2KA 1FVCA 4WFGD 1LO0H 3LHPH 4RGNE 1ZVHA 1A6TA 4AMWA 4S1QL 2XQBH 4UIKL 3VFVB 3WFHB 1KENH 4CL7A 1EGZA 4LPTA 2A83A 1EPFA 1HWHB 2WZEA 1VEOA 3MLUL 4TRPH 1EO7A 4GG8B 1CIUA 5A2LH 1DANT 1J9CT 1ZANH 4QRPE 2WP3T 5HD8D 4PRWA 2J25A 2YEZB 3FO2B 3QDGE 4OCLC 1XCWA 2BNUB 3QXTA 4OZOA 4W7VA 1ODUA 5CWSA 3TBVB 4KC3B 2Q3ZA 4FQJL 4YGVA 3W81A 1IC5L 4DCQA 1T7WA 3IFNH 1CWVA 1S9YA 2NR6D 1G6VK 2QADD 2GAZB 1A1NA 3FFCD 1U6AH 2X10A 3BKCH 4OAWB 3T8XA 3VJ6B 4MDJB 4Z0BL 5GRUH 5I8CA 4PUEA 3O9WC 4UTFA 1ZTXL 5KAQF 3U7YL 3WJLC 3IJ7A 3FW6A 4KJPC 3CIQA 4U6XB 3B5TA 3PV6B 5I8OL 1Q9LA 2W61A 5DMIH 4WV1A 4X6DF 2E9WA 4GRLB 1HF6A 1RPQA 1OGGA 1R5WB 1MHEA 4L9LA 4D6JA 1IAKA 5IW1A 1CPUA 1X5IA 3IRPX 5JW5A 4L4TD 3MBEB 3FB8A 4L8DA 5IV2B 5C07A 4RISL 5K9OA 4LLMA 1XSIA 5JBEA 1CLZH 2VX7A 5MERA 1DUYB 3ZKND 1HKMA 4HUNB 1PAMA 4F2MA 1U8PA 4GO6B 3QWRA 2DKSA 3VG9B 4YK4B 3QISA 2BV9A 1NDGA 1JVKA 2YPVL 5A16B 1NQBA 1S9XB 3K4AA 3S2CA 2LVEA 2H3NB 1CFVL 4PJ9B 4J4PC 1A6WH 1INDL 4H0IA 3FMGH 4DN4H 1KJVA 4ZPTB 4ZTOL 3LQZB 1E6JH 1HIZA 3NIDF 5A6MA 4M62L 2PR4L 1CL7H 2J7LA 4XCNB 4CCDA 5FK9B 3M46A 2KH2B 4F57H 1S9VA 1D9KB 4JN2A 4NQED 4JY6A 3WQ5A 3FNDA 4OCXH 5D2NE 1EFQA 1J5OH 4X6DB 5DZOA 4F7TA 3MLYH 4HH9B 3O3UN 2JIEA 3MRPB 3ZT6A 3T0VA 2XTJC 4Z8FL 1BBDH 4S1SH 3S3PA 3FOMA 1GOGA 4RMWA 5LA1A 3MRCA 4A4AA 1CDJA 2ZCLL 1U3ZA 5IBTL 1L8NA 4MCZA 5IXEA 5HYQB 4K8RH 5AAMA 3L6FB 1U8QA 3ARYA 4U7MA 2I27N 5DD3H 2XOTA 1BVNP 1NUNB 4NQUA 2FECL 1X7QB 1CFTA 2D20A 4L1HA 2PW1A 4XPTL 4H8HA 2ARJB 4K71B 2FYYB 2Y5TA 3HCVA 4ZFFA 1KEML 4YPGB 1QP1A 4D9LL 5I8EA 1KUMA 5AC5A 1KTKE 2CKNA 1VA9A 2IPKA 3VIPA 1HKLL 3MMDA 4XPFL 3PDOA 1WDSA 2BCKB 3VXUE 4ZUTB 5DF0A 1QWUA 1GGBL 3R0MA 3MNWB 2ZOXA 4RMRA 2FECI 5D7JC 2VLRA 1OGBA 1HXYA 1A6ZA 2QSTA 4O5LL 5DWUH 1C1EL 1MEXL 5GRJH 2DQTH 1P2CB 4GQ9L 5HHPA 3DGCR 3CSPA 3G6JA 4HHAA 2F9BT 1FOBA 1JGDB 5HHOE 3PABB 2VSDA 5FM5M 1NBYA 3KS0J 1PLGL 3V6FB 2R9HC 2J74A 1AIFA 3GXTA 4ODUB 2HRLA 4HJJL 4GRLD 3OGOE 4ZOEA 5BRZA 5C0EB 1BQHB 4D6CA 2APFA 3MBED 3BIKB 2HFEA 2ZSWB 1BYDA 2YZ1A 4MAYC 1R7AA 2HN7B 4K3DL 5FIPA 1JN6A 4NRYA 5C9JA 1FHGA 3DRQB 5AZ2H 2BNRA 1DBMH 2ICEB 5IW6A 1EK3A 2ZUVA 1B4JL 5JQ6H 3D6GA 3PHSA 1YA5A 3VD4A 4KK5D 1FN4A 3MSGA 4YQXL 2A3EA 5D71H 3VH8G 4PBVC 2JK5B 3NA4A 2R8SH 4NCDA 4PJ9D 5HGBB 3V5KA 5I71B 3QHTC 3EJZD 4Y5VC 1S7QA 4O2EB 5EZIL 4X6CE 1WWAX 1QSFD 5E6IC 5TJWK 1T0PB 4ISVA 4I0PC 3MLTB 2NY5H 3GIZH 3TIEB 2DM4A 4LHUG 3L4ZA 3DMMC 1SJHA 5BCAA 3F5KA 5DK0B 1RY7B 3WD3A 3VFSA 5KEZA 1NMCC 4EAMA 4JO2L 4K2UL 5I73C 4D6IA 2NZ9D 2WCAA 2J62A 1S9KC 1OAXL 4JCLA 3ES6A 4HPOH 3STZB 1CWYA 3U83A 4PD4K 1VADB 1OF2B 3QNYB 4FTVE 4WU5B 3LEVL 2WMPA 1MJUH 1CD8A 3IJ9A 5JOEA 5MHSE 1AD0A 1XSJA 1U8IB 3GRWH 2PC8A 2ADGB 1IM9D 3U2SB 5INDA 4M93B 3QUKA 1ZMYA 1UM5L 4BUGA 4PIRF 4UNTA 3OGVA 4NQXA 4W4NA 1EEYA 3NBNA 2QPUA 3GXDA 1V03A 5I1IL 4N0CC 2HT3C 1OW0C 3OKOB 4TOYL 4PJ5B 3TNMB 4KROD 3E0GA 4UTAH 3N1PC 4M6AA 3MOAH 4HCRA 2VL5B 1WAAA 4Z2GA 3UPRA 5H2BB 4R4BA 5E9AA 2OBGA 3SKJL 4YWGL 1OGAB 1XF5B 4HKXB 2K9UA 5I2IA 2OWWA 1NWSA 3LAFA 1CVRA 2B39A 4K23L 4B0MM 1DWGM 5DRXA 4WW1B 1RULL 3THDA 4M6NH 1ZT7B 4ATLA 5ALCH 1R3JB 2E40A 3N0PB 2XN2A 5IB2B 1FZMA 1UH3A 4WHTA 5EU7C 4OGAC 4X5XB 4JFQA 5DD1L 4LASH 4HF5L 2VQTA 1E71M 4OCYL 1NCCH 5F9OH 3ZHKA 2YRZA 1C5CL 1KWKA 2Z35A 3BE1L 4HPGA 1T5XB 4P4KA 5KVFH 3T0EA 3IFPA 3QO0B 4YXKL 1IGML 1NC2A 1RZGB 4R90L 2CHOA 1MXGA 1IAOB 3WIHH 5C0RL 1VEPA 2VRQA 2H2PD 3F62A 4XNZC 3LKPA 2ATPB 3KYAA 2EXYC 1B2WL 4JFZL 3S3SA 1J1XL 2EPKX 3VGDA 4JHWH 2DPEA 3WF1A 5DRZA 4AZIA 5IVXE 2P8MB 3SE4A 4GG6A 1NFDF 1UA7A 2OSXA 2CK0L 2R1WB 3V4VL 4OJYA 2C4FT 3LPPA 4NO3A 2AXFB 1WBZA 4HK0B 2JJWA 4P0DA 2DDQL 1DVFC 1QYGL 2A6DA 1RVFH 4H8UA 2R4RH 4WJXA 3BW9B 3VXRD 3RDKA 4HPYH 3QXDA 3BH8B 2OYMA 3KPNA 1J7VR 5E9DA 5EZOL 1NSNH 4E41E 1EMTL 2AXGA 1U8KB 3CXDL 1E72M 5E08H 2ZG3A 1CGVA 3I9GL 4WY7L 3RU8H 2DD8H 3RGHA 4NQCB 1HXMB 1TIUA 4LGXA 2E7LA 4R9HA 32C2B 2G41A 1P4LA 3W9EB 2ICWJ 3CPLA 5BVJB 3KPLA 4R96A 1PKQE 3SHSA 4PMYA 3MRHA 3DVIA 3QIWA 2W9DH 1HHGA 2WMIA 4DWSD 3KHQA 3OR7A 3RJXA 3GDBA 4JPKH 3CSBA 3RZCC 2EYTB 3UR8A 3MV8B 4Y1AE 1IGFH 5D5ME 3MRFA 3QDJB 4BSWB 4PJ7F 4I1NB 1MCNA 5HHQB 1TQVA 3UROR 1U93A 2DQHH 4M5ZH 4XCCL 4R2GB 1NFDB 4RGMC 1KIRA 4MD5A 1Q6DA 3QWOA 3ZHLA 1LO5B 2CERA 4G8EA 3GHEL 3GBNH 2YPKA 5DMYA 3FB7B 4PRHB 2Z91A 5DJ8A 4AZ7A 1L4IA 2HLFC 2J7CA 1HXJA 2GFBB 1C12A 2XXMB 1OGAD 2IPUG 5BO1L 5D96B 1ISVA 2J7EA 1NMAL 4UR9A 3MJ8B 4DGIL 5AD0A 1OP3K 3ET9F 2AP2A 4JRWA 2E27H 4F3FB 1TJIL 2KUTA 3BVWA 2HLAB 3BQUC 1AXSA 3JWOC 2IAMC 1PY9A 1C93A 1D5MA 5ICYB 2E9BA 5D9OA 5AYUH 4Y5YB 3GM8A 4KDTC 3VGEA 2H9GA 2WUBL 3O3EB 3MA9L 1RZKH 4Z2HA 1UG6A 4XP4L 5A6AA 5I8KH 3G5XA 3MRGB 4K9EL 4D1JA 2ILLA 3WE6A 3ZJ8A 5JXED 4PJ7B 2LABA 3O2DL 3BZFB 1FL5A 1OB1A 2R69L 1CDGA 4MVBC 4Y5XB 3DV6A 3CJJA 5CBAB 1UYWH 1IT9H 4QT5B 3ZL4H 3EYVA 2BK8A 1R3IL 3CVHA 3CZ8A 5DVKA 1BFNA 1N5AB 3T0DA 1BOGB 5I15H 4UB0H 1EO5A 2HVKA 4J12A 3VD9A 1E0VA 5F1NA 1T0NB 4JPIA 3VFUA 3U4EA 4FZ8H 2DWDB 2WWMD 1W72H 3AYSA 1FGNL 2GITB 3H3PL 3NA9H 3RI5F 4NXSA 3GZKA 3IDGB 4P59H 1N0XH 1E6PA 2MQCA 1QHPA 4FP8L 4YHZL 1T2QH 1HT6A 4JG0H 4M7JH 4ODXB 2H6PB 4GAGH 4LCYA 3BP5A 4LLAA 3RJQB 1TTUA 4NO0B 3IS1X 3HE7D 3QDGA 3O81A 5C8JA 2P5ED 3BAXA 4PGDB 3WFCL 4D2NA 3V4UL 2VERN 5EOQH 2N56A 2NXZB 1R3KB 3QP3A 3MBXH 3W25A 4NQCD 4PUBH 3BEVA 1O6IA 2W0KA 1KBKA 2VT0A 4U6YB 1IC7H 4XAWL 4YFLI 1EHLH 1P1ZA 3VXNB 1WZKA 1XGUA 5LQBH 1SJEB 4XHJC 5LWYH 3LRMA 3VMNA 2D3VA 4TVUA 2XT1B 1VGKA 3G04A 2J1KA 2XHYA 5DZLA 2R56H 1KIPB 4C7FA 3OBAA 3QDJD 4KKLC 1XCXA 3F58L 2VXSH 4OCRH 3EO1B 4Y4FD 3FHQA 1VPOH 1TR1A 3MO1A 5GHWH 5IUSA 2BVPB 3U5YA 3G6AA 4GMTL 4F8TA 4PG2C 4JKKA 4NWUL 5FUZH 1WCBA 2B7DT 1S8DA 1X3DA 2OR9H 4EXPX 5ID1A 1CDBA 4YFEA 4M1CD 4KVCH 5E1AB 4I18A 2FHFA 1FC2D 1AQKH 2Y25A 5L88H 3HS0A 1B3WA 3X14B 1FHDA 4NHCL 1JV5A 1QSEB 3T4YA 2F5AL 3WO4C 3EZ8A 3HC0A 1WWBX 1Z5LB 4LLYA 1JI1A 2O5YL 4MQSB 4XGZA 4ACZA 4C7GA 3BFOA 3GO1H 1DBBL 5IHSA 5M5DA 1OT1A 4PTMA 5HYJB 2EE6A 4GAFB 4WJ5A 3JV0A 4WU7A 1R3HB 3T0WA 4PMQA 1IZJA 4HOXA 43CAB 1P84J 5DFVD 1KPVB 5J6GB 3LRKA 3VD5A 3Q0HA 4QRUB 5SWSE 4O4YH 1I7RA 4YDKL 3NPSB 4HIJB 5HBFA 3DX3A 5TE7L 3VFWA 5D2NA 2KPNA 3UJJL 2OS7A 3HI1B 3DX7A 4X6BA 3VUPA 5BYWA 1XGRB 3QXAA 2VQ1B 4JPVL 1YUHB 5BVPH 4P23A 4UQ3A 3RL2B 4ESKA 2GJ6A 5CPSA 5BQ7A 4MA1B 4K7PL 4Y4HD 1UZ1A 4FLRA 2DM7A 3NIYA 4JFDE 4TNWK 3WN5B 1JXKA 2GSJA 4OI8A 4DOHB 4OCSL 2VXTH 4ZXBA 2Y7QB 1C08A 5A69A 3AXXA 4ONGL 4XMLH 2AEPH 1EFXD 1FBIL 1RIVL 2A6JA 4DKEH 1SM3L 2ZOKB 2J7FA 3CUPB 1E4KC 3DGGB 4RRPA 3MNZA 5JQHC 4ZUUB 1QLRB 3WYRA 5HD8C 3PZTA 1YN6B 5JNYA 1A7NH 2X8RA 2DYPB 2HTLD 5CSUA 4D71A 1LO4L 3ILQD 2XVLA 2BY0A 2NCMA 1NBQA 5IQ7L 2P24B 4LU5L 1HWWA 1EEZA 2NXZD 1JGVH 3S5ZA 4Y0GA 2BNQE 4UV4H 2P5WA 1VENA 1FFRA 4E5XB 3PQYB 2NR6C 3MLRL 2QADC 3P73A 4NZCA 1ODAA 1A6UL 2BRRH 2CLVA 2WWKO 3NN8B 5B3JF 3EJSA 3G5VB 1YEKH 2P8LB 4PJXE 2VDOL 1NQ6A 4P9MH 4U1HB 5GSRA 2R2BB 1LNUA 2FGWH 1U8JB 1YPZE 4Q0XH 3EZJB 3UTTE 5C0GB 1UOKA 4A6YH 1R75A 1MAKA 2VZSA 4EXKA 5A2AA 4ZE5A 1QA9A 2PYFA 2X4RB 3PWNA 4ODHL 4QTHA 3SE9L 3X11A 2YBUA 2CRIA 2VXQL 1F58L 1MIML 1I1WA 2UY7A 3GFUA 3IDUA 3QCTH 2UWEF 2F54E 2YD7A 1QZ1A 1WFTA 1KULA 5K33A 1MNUH 5KS9A 4DWHA 1VACA 3ZKNC 1CYGA 2V9TA 1CZ8L 3MGOB 5ISZD 4XP6H 4U5KA 2X40A 4EUPH 5F3HB 1H5BA 3LMJL 1NP0A 4LMQI 4KXZI 1MCEA 3R8BB 1ORSA 2DI7A 1B0WA 4NDMA 3I75B 4X0KA 5DC0A 5HBBA 3D85B 4KI5F 5FECA 4H1LH 2EO7A 4PJAF 5TPWH 3OB8A 3S97C 2FO4A 3X3FL 5I1AB 2A6IB 1JZ7A 2BFGA 1Q0XH 3ROLA 5GS3A 3VI3E 3S35X 4YX2L 4M5YL 4ZNCD 1D5IH 3MOBH 1Y6KR 2OL3B 2D7NA 4X6CA 5CCKL 1HK6A 4P2YA 1ZLVH 2BY3A 1MAML 4J8RB 4Z18A 4ERSH 1XIWB 3ULSA 4HWBA 5IFAL 1IGTA 4YHKH 1H0GA 4KQ4L 3A0OA 1PDKA 3AY4A 4LPUA 5ADOL 2BVDA 3ZKXC 5EIIB 1HJXA 5B38B 4G42A 3CCHA 3I6GA 3CHEA 3QFJE 1M7DB 1FFNA 1BX2A 3GNML 4JDVB 5D9SA 2GJZB 2UWEB 2AVGA 2IG2H 4APQD 3NZHL 5BJTA 2D0FA 2O61B 1XCQA 1I1FB 3WMSA 1XR9A 1BGXH 2ED7A 3IKCB 1UM6H 3MRMA 2W9LA 2YOCA 3O4OB 4WUUD 4JFWA 4PJBA 5I77A 3Q6GL 4W68A 4XZUA 1A7OL 1IQDA 2XTJE 1MRCH 1XF2B 4XC1H 3WLBB 1UD5A 4HGWB 4NRXA 2PXYA 3MUY1 1TCRA 2Q6WB 1UZ8B 5EU4A 2VC9A 2DYPD 4RX4A 2TAAA 3TA3B 3H42H 1TJGH 4PJAB 4UQCA 5BW7C 3SJVE 2DMCA 1PEWA 4YBLC 3UYOD 4NN6B 1TA3A 1KCRH 5ERWA 2HRPH 3WL9A 3QI9A 2Q8BL 1KG0A 4XPBH 4NNXA 2CDFB 1D6EB 4FQHB 3B43A 1A14L 4HFUH 4MNKA 4RSVA 3BUYA 3PQYD 4X9FA 1LQSR 5EU6E 1MH5A 1FH7A 5IFPA 3RVXD 4NNPL 2BVEA 5ESVA 5CINL 4H88H 3KYMB 4J6RL 4NHUA 2I26N 1UCBL 3CXHJ 4XNUH 3UYRH 1MCLA 3OZPA 4AT6A 3SURA 4PJFE 5HOSA 3MMUA 3RL1B 5D2LE 5ABGA 1B4RA 2GY7B 3E6FB 5I9QB 5EIQA 4GRLC 4J3OC 1HHKA 2HFTA 2DQIH 1ES0A 5INCA 3LH2H 2IQ9L 5JZ7D 4BQ3A 2E5EA 1OLZA 4X5WB 3VXQB 4Z77B 1R0AL 3ULUL 4DKFL 4Y19E 2W9EL 4GRWF 4ODTH 2HJFA 4AY1A 1YMHB 1AGDA 4NRZB 5CJOL 5C7XH 3W4RA 3RY6C 5IESH 3SUWA 4XC3L 3TT1L 5I30H 4GXVL 1S78D 3BVVA 3KHOA 1G0DA 5E2WL 4WI4A 4WEUD 3VG9C 3WSQH 4LHUD 5DA4A 1RIUL 2XYLA 2IEPA 2C4FU 4KK5C 3VXTB 4Y4KD 1A3LH 4RNRB 5IBLD 5GGVL 4MS8D 5BS0B 3DJ9A 3TJEL 3ZOAA 3FT4A 4MJIE 4PJ9C 4LYQA 1QFWM 3WL1A 5SWZE 2JTDA 3EJZC 1W1PA 2IGFL 3GUTA 2PETA 1MWAA 2XWJB 4QYOB 2YN5A 3FQXA 3IXAA 2KKQA 2A9NH 2W1NA 3EDDA 4E41A 1XIWD 1XSKA 2YXMA 1A9EA 4HFWB 4J3XA 1T1ZB 3GZAA 3FY1A 3WUWA 3QIBD 5KOMC 5A94A 2Y6SD 3W39A 4N68A 1YJDL 3UP1A 5AUMA 1OINA 4KHXL 2AJVL 2UY6A 3QSKB 1R87A 3KPSB 3GXIA 3P4NB 2X7LB 1AGBB 3HZMA 2VX6A 1ACZA 4GRWB 1SHMA 1Y18B 3CFJA 4M8VA 1DQJB 1M1SA 4PTXA 5CUSL 2ZSVB 3WDHA 1G7QA 1QKZH 3DUUA 1PY4A 4X7SL 2X4NB 4GW5B 4KROC 2OP4H 3L3KB 1GOQA 1T1YB 3U7WL 1DHKA 1X5JA 1JF5A 1F4YL 5LGJA 1GJUA 1GOWA 3T77B 1YEFL 3AGVA 3O6FB 2JCCA 3MGTB 1NWTA 3WEZA 3QULA 4LLUA 2I5YL 4L3CA 2ZP0T 5T5FH 4KI5D 4BKLB 4UBDD 2D03L 4XPAH 4XVJL 5ACMA 3TA3D 4M48H 3UJTL 5DJXB 2NY1B 3L3OB 4LLQB 1RUMH 4GUPA 5A3HA 1A3RH 2XN1A 1BYCA 4JL1A 2BHYA 2W0LA 3CAFA 5TH2B 1P6FA 5A1AA 3CUHA 5ACLA 4ZUVA 4G5ZL 3L3GB 3AIBA 2X4QB 1IRAY 3GMOA 2DIAA 1JPFA 3ARTA 3MXVH 4IOFD 2HVJA 3P0YL 2UYLA 4W8LA 4G8FB 2VO5A 1TFVA 2MHAB 3D3VB 2Y8VA 3UXFA 1MJJA 1KXVA 2WPGA 3CV5A 4G8IB 5EC1A 2WBJA 2XZAH 1DQMH 3S5LA 3MV9B 4LIQE 3LQAL 3VFNB 4OLVH 2Y5EA 4OSUL 1MQKH 2H2PC 5EU7E 1OP5K 3LPFA 1NWRA 4UT7H 4LCCA 4U1JA 1NAKH 3WFEL 5DA0B 5CP3A 2DF3A 4FZEH 1KB5B 1LE9B 3TTYA 4MCYA 4OLWH 3U1SL 2Y9RT 2NPLX 1VBUA 2OQJA 1CS6A 5BROA 2D1ZA 5J56B 3ZDZF 1ADQL 1NBVL 2P45B 5BS0D 3N85L 1K8DA 2D7PA 2WC3A 5FUOH 4R8WL 5TQ0L 3VA2C 1NKRA 1CFQB 3WEXB 4XI5D 3B9KD 3F65A 4ELMF 2R29L 3BRFA 1JYXA 1M05B 3VWJB 4CD8A 5IFHH 2LVCA 3HG2A 3TA9A 3MRRB 2YSSA 2PCPB 5DI8B 2JB6A 2BVOB 3QXVA 1GPOL 3MR9B 3T09A 3WENA 4ZUSA 4LYPA 4BQ2A 1CZ1A 1I1RA 1NCDL 4P9HL 1CXEA 1N7ML 1CGXA 2C3XA 3I50H 5E8EA 4XRCA 3HE6A 1BBJA 2DIEA 1RZFH 5H35B 1IGIL 4U31A 2V5YA 1KJMB 5LXGL 2NTSP 4ZDHA 4O2CA 4DWSC 4I0KA 4N90E 4IPNB 4AK1A 4M93C 1L0PA 3L3DB 3HMXH 25C8L 1ZBWA 3V5HA 4B15A 2G9HA 4X4MA 5DJ0B 4CVZA 3FT3B 3OGSA 4ATDA 4MA8L 1RZ7H 1TQCC 1MELA 4UT6L 3RAJL 3EDEA 2X2YA 2PWDA 3O6FD 1KEGL 3FONA 3QQ4A 4YC2B 5LGHH 4LPXA 1WC7A 4TN9A 5GS0D 5DLML 1N0LA 3EYUL 2XWEA 2P49B 5ILTL 1UG9A 5C6WH 3AYRA 2NY1D 4ZAKA 4C4KO 4ELMB 1FVCB 3HZVB 1I3RA 4I2XE 1CFNA 1LP9E 4NO2A 1KTCA 4LQFL 4C56A 3K4DA 2FRGP 4GKSA 4Q9CA 1UB5A 4BQ5A 3BLKA 4GJTB 1JHKH 2L7UA 3TYFA 1IGYB 5BV7C 2BJML 3N18A 2XM1A 4JB9H 5F7EH 4E0RA 1G7LA 2EXWD 4NFCA 2OW7A 1T1XB 3D3VD 4P2QE 4U49A 3SO3C 2R15A 2JJUA 3LPWA 5EOTA 4RMTA 3RY5A 4TUOA 3RILA 5SWSA 4KHTL 1T20A 1FNSH 1SVCP 1MCPL 1NEZB 3MV7D 4P46A 4GH7B 1CECA 5FYJE 4CNIB 3EFFA 1DWFM 1UR8A 5JXEC 1TQTA 4NJAL 2FR4A 4Q9BA 2QKIA 5CJQL 2LV4A 3WV0A 4FLSA 1CI5A 1MOEA 5L6YH 3QCUL 2DQFA 3UDWA 4WTXA 1RQ5A 5CJXC 4XB7A 1Q9LB 1TZIA 1N3NB 3SDDD 1VESA 3HR5B 5EUOE 4MNMA 3NOIA 4LXFA 4JFDA 1KACB 3PUCA 3CNKA 2WWMC 4X7TA 2Z31A 4LVNC 4UDTA 3TH4T 2CPUA 5TQ2L 2D7QA 8FABB 5K9OB 5GRVK 4LLMB 4AD3A 1LO0L 3LHPL 3PZNA 4JM2D 2YRPA 1W0WA 3OJ2C 1K9EA 1IGJB 2XQBL 3BKJH 1KENL 2V7HB 3HE7C 4F2MB 3IETB 3QEUB 1U8PB 4TRPL 1JTPA 2RB8A 5IFJA 1BFOA 4NNYA 1A6AB 1ZANL 3OZ9L 2EXOA 3QDMD 4WI7A 4ZOAA 1MI5A 2F5BH 2WCSA 3CH1A 2OZ4A 5FIEA 3BUPA 4J28A 1F3JA 2Y2WA 1R85A 4HJGA 2PW2A 3N04A 3BVNA 3MRKA 4GI8A 2EKJA 3WEMA 4ZUWA 2F19L 5IEHB 1WP6A 3BKCL 1U6AL 3GMMA 5IJVB 4XNYH 1KWGA 2WIMA 3W28A 4OFYA 1YPZA 1QRNA 3EW3B 1KT2A 3UTTA 4MWFA 1EO8H 2BS9A 2C3HA 4Y4FC 4WWID 4W7WA 4BSJA 5DMIL 3FOMB 1Q9KA 1GHFH 5L2KB 3POCA 2KZ1B 1ETZB 2F54A 1UADC 2ZPKH 1ZJAA 3WJLA 2IPUK 2APTA 4P2OA 4MCZB 3O3DA 5MENB 4JFEE 3TZVA 4V1DB 3WKNA 4ENED 5DFTA 4M1CC 3MUIA 5D96C 2BHZA 1U8QB 1CLZL 2C1OA 5E6ZA 4LNRB 4BH7A 2P47B 3T1FA 2VDQH 3BVUA 5TDOB 3LXCA 2PW1B 1W3HA 2ARWA 3IJYA 4PG9A 5HGAA 1AXTL 5HI3C 4UFJA 1E27A 2WP3O 2Y5TB 3L9RA 1QEWB 4ZFFB 3DHUA 1ZBKA 4X9GA 2JB5H 1UM4H 4LEOA 1KCUH 1CGTA 2IPKB 3KYNA 3L7EB 4JRXB 4KZDH 3BISA 1SYSA 4LRIC 4Y5YC 1UWUA 3TP4A 2VITA 5DFVC 2XKSA 4JN1H 3VX0A 1X6NA 3G5ZA 1UH2A 3FMGL 1XGTA 3VDBA 1QLFB 4DN4L 2VLRB 4D6FA 1HL8A 4Q6IA 1WPCA 5DEFA 5C0CB 1E6JL 5DJ6A 2OYLA 1KBBA 1BD2A 1CL7L 3UBXA 4RRPG 4FMKA 2EPOA 4Q9QH 1F3RB 3NZ8A 4J4PA 1JDDA 3AMKA 3O11B 4F57L 4EI5B 1RZIA 1K9DA 2JELH 2EEAA 1NBYB 1J5OL 3UEZA 4QRSA 1QNSA 3MLYL 4HUWA 1UKTA 1BBDL 4S1SL 4Y4HC 5C6TH 1BG9A 2A3BA 3PBGA 4DM1A 3K2UH 1WDRA 5B8CC 3IDYB 2FSEB 4K8RL 1V3LA 4QHLB 2PNDA 1CL7I 4Y16A 5CSGA 4NX0A 3BPCB 5C2BH 4CADA 2ERJC 1H11A 3D25B 3V4PL 3TCLB 3TVMA 5IT2H 4NPYA 5DD3L 4JRYB 1VIWA 4JANB 2BNRB 4U1LA 4HA3A 3HAEA 5DJZB 2HTLC 4WWKA 3CH9A 3ILQC 3QWRD 4EKXA 3MRIB 4C83B 3VXMA 3O45B 4WFGE 1UA6H 2QMKA 5E99L 2XA8H 1FN4B 5A2CA 2NXZC 2R0KH 5H94B 3TYGH 4CMHC 3OJVC 4LGSB 1G9MC 3CFIC 5C0FB 3ALWA 3O2VH 2YFOA 2HYMA 3W0WA 4XXCA 5FGCE 1DQQB 2P42B 1E3ZA 3K80A 1G0YR 4JJ5B 5DWUL 4NO5A 1R24A 4N0RA 4BZ1H 1HSBA 4W8AA 4KQ3H 5GRJL 2DQTL 5D6DA 4PJFA 3ZQ9A 1NKOA 1SJHB 2X4TB 1OAUH 3GTNA 3QHMA 4IJ3B 3SQBA 4DZ8B 3PWUA 3FFCE 3ES6B 1YEDA 4HT1H 1QRKA 4N9OB 1UD8A 5DS8A 3BYYA 3PZUA 3H9SE 4PMDA 1UWXH 2R2HB 3S98A 5INDB 3UTZB 1MVUA 3TGXA 3HNSH 4IRJA 2AEQH 2AJUH 2FD6H 2W66A 3RP1A 3ZDYF 2MWCA 2MKLC 4CVXA 5AZ2L 3IXTA 2ICES 4LX4A 5E0FA 2NW0A 1LQ0A 3GMRA 3NUKA 2VCAA 1JK8B 2CPCA 5JQ6L 4XTRD 4LKXB 4MJIA 1UKSA 3UPRB 1QPKA 1AFVH 4PJGA 2B2XH 1F4HA 3ZSSA 2O9RA 1JHTA 5D71L 2O93L 4I3GA 1IE5A 4FNUA 1PPIA 1F5WA 2R8SL 2FO1A 2R4SH 1Z9LA 4NM4H 5I2IB 3BGMB 2VLRD 3TBWB 5DRXB 3CUJA 4OKVB 2EPLX 1AI1H 2PTTA 3B83A 2OLHA 2NY5L 3GIZL 4YJZL 1FZMB 1I1YB 5FB8A 2WVVB 2WWCA 3LRLA 3CZFB 1F97A 4EI5D 3KLHD 4MJ5B 3GMNA 1LL7A 1JWUA 5GRXG 5K9QG 4NKMA 3P4LA 5ANMA 5ID0B 2Z35B 4HPOL 3O41B 4P4KB 5TDPA 4APQC 2DSVA 4JQXC 2DM3A 4TULH 3C6LC 4HUXB 4MA1C 5K59E 2K1MA 3WN5C 1I9IH 3IF1A 1C5DB 5BRZD 4HMEA 1AQHA 1VHPA 3N06B 1MJUL 4PMZA 2GSIA 3GRWL 5FM8A 2OK0L 3MMEB 1JGIA 3VXSE 4QRQA 3ZE0F 4HLJA 3BSGA 3LKPB 4I5BB 5FA3A 2VSCA 3HNVH 4D0DB 2YA0A 3L7FA 4UIMA 2YL6A 2COQA 3ILPB 1MCBA 2BNRD 7A3HA 5FO9B 5KZCB 3MOAL 4F79A 2PWFA 1D5XA 3HG1A 3RDTA 4L8SB 5A3ID 3V52H 2AJYH 3HZYA 4JFYA 4MXVF 3VIHA 5MEQA 4PRDB 2FE0A 3Q5OA 3GRWA 2CCRA 2F61A 1DE4B 3QHFH 3AZTA 1V3KA 3GSNH 3RVXC 4FLOA 2A6DB 5GGVY 3ARBA 3KPRA 5J1SC 5JMOC 4JVPA 1B6UA 2EYRB 2QV4A 4HKBA 3FAWA 4M6NL 5I1HH 2J8UF 5ALCL 1S7SA 4AQ1B 3GJFA 3U36B 1WSST 4LASL 3WFLA 1I85A 1AC0A 1YNLH 5JZ7C 1HH6B 2VB5A 1NCCL 5F9OL 4KJWD 1NH6A 4DFHA 1PX4A 1ZE3C 5KVFL 4XCEA 2ICWA 2V3FA 4QNPE 4R96B 2GK1A 4IIQC 3HN3A 4PS4L 4OJFH 2GTWA 3EDFA 4PV8A 3OR7B 2HH0H 4F9JA 1BZ9A 1S78C 1YECH 3MRBB 1K4CA 2LU3A 2YA1A 3NVQA 4YDVA 5E00A 3WUWG 4MHHG 4JHWL 3DTXA 4Y4KC 2IH3A 1AKJA 1F42A 3QWOB 4N1CA 5IBLC 4NC0B 4MS8C 4NKDB 2H32H 3DVNA 4PMUA 3BRGC 2P8PA 4U7KA 4CMMA 2Z91B 4NQSB 3UTOA 2MMXA 4YO0A 4M1RA 5C09B 4IMLA 4ETQA 1R46A 3MACH 3MJ7A 1QVBA 2NY0B 1RVFL 1XIWC 2R4RL 3IAGC 3MKKA 5AD0B 3V7AG 3D52A 2J8UB 4JZJC 2DLHA 3STLB 2RGLA 4HPYL 4LSRH 2E7CA 2JJSC 3QIBC 1NSNL 2Y6SC 3H0TB 3DX0A 2XN9A 4BK4A 1I7UB 1DVFA 2F74B 5E08L 3RU8L 2DD8L 1D5MB 3O6KL 3HJEA 4O51A 3VWKB 4AG4H 2DL2A 3C8HA 4P4KD 2C3GA 3T0ED 3GSVA 4DUWA 1U33A 3U30B 5D1XA 3O4OC 1KJ2A 4ZTPH 3ARDA 1QLEH 3G5XB 4YFLF 4X6DE 2W9DL 4KGLA 2MJWA 4OD3H 1XH0A 3WE6B 1AC6A 1RZ8A 2FL5A 4Z0XA 5EFDA 1W9UA 4Y7MA 2VABB 4MNHA 5CLTA 1IGFL 4DK6A 1HQRB 3KVQA 1OAYH 4UCFA 3B9DA 2Z4QB 2LFGA 4PN2A 3R8QA 3BD4A 4KI5C 3AAZB 3O6LH 4M5ZL 2NY4C 4UBDC 1F90H 2Y8KA 3TA3C 4NN7C 3S36X 3MJ6A 4ZFGH 4NN6C 3GBNL 2E3ZA 4B53A 2QL1A 3S5LG 2Q20A 4EIGB 4I2XA 1LP9A 4YHGA 5EBWA 2V3EA 3TN0C 2G8ZA 5MEPA 1FAIH 2XKUA 4KMLB 3QB7C 3QBTB 4YAQA 3GSUA 3BP5B 4IOFC 2E27L 5CHNA 4L29A 3GSRA 4HV8B 1J0KA 1OAQH 2WZHA 4ODWA 3TBSA 5I9QC 4P2QA 3NIDE 1D5BA 2BVTA 1KTDB 4OZHA 4ZS6D 4DW2H 1DEDA 5E2UH 4JZNB 2IPTH 1J0JA 1ZLSH 4J23A 4LSVH 4ZFOL 1UQYA 4H7VA 5AYUL 3CDCA 1UD3A 4FQCH 1RZKL 3U57A 4YXHH 2R23B 5EO9A 3QIWD 2G5RA 5I8KL 4AYGA 4KK6D 1NANH 4UOJA 4Y2OA 1QFPA 4PRNB 1LD9B 5FYJH 4KUCF 4GSDH 1KGWA 2YN3A 4KDTA 5E8DH 3JWOH 1FFPB 1WFUA 3AM8C 5DHVA 5EUOA 4S2SA 1WZ1H 2KL6A 4IDLA 1UYWL 1IT9L 3ZL4L 1G84A 2JEPA 2DIBA 1CDYA 5I15L 3LKQB 4C54A 4XI5C 1TZHB 1L7TH 3B9KC 3JZ7A 4B9YA 4FZ8L 4OM0H 1EXUB 1W72L 5EO1B 4HS8H 4G6MH 2CKBH 3NA9L 3ULVL 3RVWD 2YBRB 2H26B 4P59L 3E8UL 2VDRH 1CLXA 4H0HB 2ZXAA 2XFRA 1T2QL 3WHE0 2Y4SA 4WDIB 4U6HA 4JG0L 1Q8MA 4M7JL 2L0DA 4OZGA 3BUIA 4GAGL 2KQNA 4L8BB 5FO8B 2WQ8A 3GSOB 1DWIM 1OD0A 2BMKA 3B9VA 4ACZB 5FYLH 4XGZB 3DSFL 1G6RH 4ZFMA 5EOQL 2V5SA 4P99A 4UQ2B 4PSRA 3VXRE 3MBXL 4WU7B 4PUBL 1ISWA 1O0VA 3GBEA 4R5EA 3A6OA 2NXYB 1T6WA 1IC7L 1BLNB 2V7NB 2AAAA 4JO4H 2NNAB 1I7RB 4QCIB 2C7UB 5LQBL 2XI9A 5L7XH 5F9JB 5LWYL 5FKPA 2CKRA 3SKOA 1F11B 3O6FC 1CCZA 2WVTA 4AZ6A 2ZCHH 1XV8A 3I3BA 2VXSL 3FO1B 3P0GB 4MZ3A 4FS0A 4EBQH 5GS0C 1W91A 4OCRL 1GOKA 1CF8H 1VPOL 3RVUD 4DVBA 5IB5A 2NY1C 5GHWL 2OLDA 1HSAB 3GSQB 5KBNC 1BJ8A 2EADA 3QJHA 2W07A 2ZXBA 3DX8A 2OR9L 1D7FA 4GXUM 1QI0A 4R4FH 1UH4A 1ZVSB 2A6JB 1G7PA 3P0VH 4UV7H 2YIHA 3KJ6H 2V17H 2A73A 3QXUA 2VDKH 3WNNA 5IBUG 4M02A 4PG2A 4FXGA 1AQKL 1AGCA 5L88L 1OGSA 5JNYB 3MZGB 3DI2B 4B16A 3DV4A 5FOBA 1OGAE 2EXWC 5D4YA 2DLFH 4UTBH 4ORGB 4ZSOA 1XT5A 4R6UA 3JUGA 1EEZB 4XBGA 3IFOA 1AQ0A 1WIUA 3ZTJG 3WFDH 2B5IB 2EO1A 2P5WB 5D93C 3UZQA 2XRAL 1R5IB 3SCTA 4XNMB 3P73B 4RQQB 4F7MB 3PP4L 2QF8A 1XH3B 5T3ZH 3VNYA 2XY1A 3RNKA 3T3ME 1QPXA 5HVFB 4YR6A 2V2WA 5D9NA 3RA7H 3OWEA 3VA6A 2DQGH 5DTFB 1Q9WB 3BGAA 3OJMB 4TSBH 1X5FA 1XF4A 1R3LA 3SDDC 3DVGB 1RHHB 4L9DA 5EC2B 3S37H 2A9MH 4YHNA 5BVPL 2UVEA 4KRMB 2PYFB 1K5NA 3PWNB 4QTHB 3WKZA 3EJTA 1A1OA 4U1NA 4PJ8A 5KSBA 3RNQB 1ZS2A 1X5YA 1OOAA 1SBSH 1BWWA 3SPVB 3VD3A 3VW3H 3WBEA 1U92A 5I74C 3VXOA 4KPHH 3A4AA 2HFFA 2VXTL 3IDNA 4JM2C 1HHJA 1VACB 4DZBB 4LCWA 2F8OA 4XMLL 2AEPL 1MREH 3QR2A 1LK3H 3FQWA 4DKEL 2NQCA 4LGRB 1H5BB 5IP4A 3CUIA 4HDIB 1VRXA 1A7NL 1ORSB 4NDMB 3TOPA 4KDWA 4QHMB 3W37A 3QWQB 5F7LB 2H8PB 2CMRH 4AWEA 5FECB 3HUJF 1R33A 2XPGB 3BKYH 4HS6A 1JGVL 3CLFH 4JDZB 2SEBA 3FFDA 5F7KC 2X0HA 4UV4L 3LXAA 4JGUA 3OJDB 5A8PA 4OQTH 1KTBA 2NXYD 2P5EE 3PWPB 1Q6EA 1YC7A 2EKSA 3QHNA 2BRRL 4HUUA 4ZXOA 2BXYA 3CZJA 1MQRA 2FGZA 4DO5A 1SMDA 2JIXB 5SWQA 4NQCE 1YEKL 1L6ZA 4U3CA 5EBLA 1X5HA 1KOAA 4P9ML 3WF4A 3LX9A 4UNVA 1A1MA 2FGWL 5SX5K 5DMJB 3OGRA 4TVPE 1UXWA 2VMFA 4Q0XL 4YC2C 4A6YL 3RZWA 3CDGB 5HVHB 3D39B 2GJ6D 5C0DB 3PG2A 3H9SA 3R06B 1CU4L 3MV8E 4ENEC 2OI9B 1BFTA 2G3JA 3QCTL 5I1LA 3THMH 4GAJH 3AIRA 1MHCB 2EYSA 3QDJE 4EOWL 4HJ0D 2CESA 4OF7A 4M4RA 4ZXBD 5DDHB 1KNOB 5D1QA 1FH5H 1NFDE 3UBXG 4QHKI 4QRRB 1IQDB 4QY8A 4CU8A 2CQVA 1O7AA 4OLZH 1I9JH 4XP6L 1IV8A 2VKXA 4G8GA 1MFDH 2XWTA 1HQ4A 1H0IA 1FZOA 1A7QH 4H8WC 3RGVB 1TCRB 3NIGE 5IF0B 3GH5A 3BXNB 4JFVA 4OFPA 5CPQA 1MLCA 2CLRA 4GAYA 3HUJB 4F80A 2ZG1A 1QFUH 4ZS7H 5FUCC 5KSAA 4GBXB 3WL9B 5TPWL 3ULUF 3RX7A 1E73M 3FT2A 1GOHA 2P5WD 3P9LA 3DIFA 1Q0XL 4CU7A 3BUYB 2YZ8A 4P57A 3VFMA 1OBAA 1D5IL 5F7YC 1MH5B 3MOBL 1JTOA 5LJYH 2AQ2A 4PJDF 3DUSA 3QO1A 3N9KA 1K8IA 5CSZA 3WS3A 4ERSL 3HAEG 5I6SA 4YHKL 1HP5A 1DN2A 3T4AB 4RFNB 1SJXA 5INCB 4L9LC 3TEUA 2WCGA 5GZND 1P5VA 2BSRA 2CLZB 5E1QA 1E28A 3X12A 4RIRB 2IG2L 4PJ7E 5F3BB 1B3YA 3SCOA 1G0CA 1BGXL 3VXSA 4D1IA 1UM6L 4Z7WA 2HJFB 1YHTA 1GYAA 4QXUH 4KJYB 2C0HA 4Z76A 1G9HA 4XVSH 1MRCL 2OX5A 2IANA 4GLRI 4XC1L 2GT9B 2EH7H 3HPLA 2JCCF 2APVA 4KFZC 3WFHA 3VFVA 5LGKA 1ULVA 5ABDE 5CJ5A 3H42L 1EBAA 1TJGL 1B3XA 3SCMB 1BJ1J 4GG8A 2RGSA 4K3EH 4XPBL 2YEZA 3FO2A 4HFUL 4MNGB 4PJDB 5C0AB 1GGTA 2BNUA 1ZHLB 3FQXB 4PREB 2V3DA 5T3XE 1KF9B 4OF5A 5I1JH 4H88L 1A9EB 4Z2LA 4XNUL 3RIKA 4DEPB 2EDBA 2APWA 1E1EA 2FDMA 2AQ3A 2GAZA 4OAWA 3VJ6A 3II1A 4TVDA 1H41A 2OXGA 4MDJA 2IUZA 3DLQR 3RM9A 1E4IA 1KCLA 1TXKA 3U9UA 2DQIL 3DSNA 4AY0A 1EERB 3LH2L 3HZMB 1IAIM 4U6XA 3PV6A 1TE1A 4DKAA 1JWMA 4PGZA 1MFBH 3OB0H 5HXMA 5A6BA 4ODTL 4UOZA 2P1YA 3C8DA 4GRLA 1JD9A 1G7QB 1R5WA 3PIQA 2ZUTA 2J8HA 3GI9H 3CVIH 1CGYA 5C7XL 5IESL 1XFPA 5I30L 3MBEA 1UD4A 4PRBA 5IV2A 2JCCB 5GRZA 2PXYD 4LFHG 4XTRC 3WSQL 1N59B 3QULB 2VDLH 5IB3B 4L3CB 4UMGA 1DUYA 4MB3A 4RX4D 5FM4A 1BSIA 1A3LL 1I75A 2ZUUA 4GS7B 4LAQH 4CCCA 3LS4H 1T21B 5ISZE 4Y89A 2VX4A 3N13A 2DQEH 2V6HA 2O5ZH 4N0UB 4N0YH 1ED3A 4O2FA 5A16A 1S9XA 3V0WH 4OZFH 4MDIB 1US2A 1WQVT 2H3NA 2A9NL 5D7LB 5CIPA 3IDMA 1B31A 4PJ9A 5BXTA 5HYJE 4EI5C 3KLHC 2WHJA 4ZYKB 3KLKA 1WUNT 2YD9A 3LQZA 4ZPTA 5HI4D 3VU2A 1XGYH 1J10A 4PLJD 4YDIH 3W2DL 3RMEA 4YFDB 2NW3B 4HC1A 3CFDB 1MJJB 5FK9A 1YEJH 1D9KA 4PJHA 2WBJB 3IDYC 3VVGA 4X6DA 3MLVH 3A6CH 4OZIF 3VRLF 3MRPA 3MLSH 1EJOL 5DUBB 1QKZL 4DFIA 3RWJB 1OSZA 4J27A 4G7VH 5HYQA 4DAGH 1ITXA 2OP4L 3L6FA 1C92A 4H25B 5JXAH 4WUUE 4DOHE 4ZNEE 5A3IC 2OQJB 3MQIA 3BO8B 1OIMA 4Q74A 3FB6B 4NZDA 5T5FL 3PWVB 1GZQB 4XPAL 1RP8A 1X7QA 3EFDH 4M48L 1E6NA 3ULUD 4B9ZA 5EA0H 1RUML 2ARJA 1QOXA 1A3RL 3V2AR 1S5HB 3PTKA 4YPGA 5C0AD 4ZOCA 4EK7A 4LSPH 3C60B 1PZ5B 1MLBA 2BCKA 4ZUTA 3BWAB 1LEKB 2VDMH 2IGTA 4LSTH 1FYTB 3MNWA 3MXVL 4IJ3C 1NAMH 2K7PA 4NCC2 4WI6A 3PQYE 2IXVA 4KJWC 3W9DB 1UQZA 2AJZA 5HGHB 2ADFH 3QRFM 1P2CA 5T1MB 1RUKH 3QA3B 5E8EB 4XRCB 1I4FA 3HE6B 2OSWA 4S3KA 3E1F1 4OZIB 2XZAL 3PABA 4M81A 1DQML 4ZDHB 4Q97A 3V6FA 1HHIB 4F15B 4OLVL 1MQKL 4ODUA 4W5UA 1D6VH 5I6XB 3N1AA 1JZ8A 1IAIH 3JVGA 5KW9L 1HINH 1NAKL 1VJZA 4M03A 3KPOB 2XPKA 5C0EA 2BOCB 1I8LC 5MEOB 4JFOB 3REWA 4FQIH 2Q86B 1FL3A 2AJSH 4OLWL 2HN7A 3R1GH 3BGFB 1QBLH 3BH9A 1FIGH 1U0QA 3WBDA 2APXA 1YQVH 3RTQB 1NP2A 5FUOL 4HIIB 4E42A 2GFTA 2PWGA 1K3IA 1CFNB 5DURD 3TIDA 1CDCA 1A02N 1WZLA 4G6KH 4M43H 3NSXA 1VFFA 2CITA 4LK4A 3N9GH 3PWLB 5IFHL 4HTYA 5FCZA 2JK5A 5D7LD 4AC1X 1JI2A 1LGVA 5GQBA 5HGBA 3K8MA 5D7IF 4FQLL 4WI9A 4O2EA 2WUCH 3AMDA 3IJHB 3SY0B 2Z9TA 1HNFA 1G7LB 1GOFA 3PGDA 5B3JE 2PWHA 4OLEA 2M26A 3MLTA 4P4KC 3TIEA 3T0EC 3F7RA 2IQAB 3D4ZA 4OLUL 3I50L 5DK0A 1J0ZA 1FG2B 1NGPL 2WBJD 1RZFL 4F37F 4WI2A 3TESA 3EFFB 5J8OA 3S7GA 3STZA 2ZG2A 3W26A 3QT2A 1VADA 4NFDA 1OF2A 1WJ3A 2QKIB 3QNYA 3HMXL 4WU5A 1YYMH 1M71B 4GZEA 3UTSA 5IBUB 3WHE1 2WMKA 1KR1A 2HG5A 3MUHL 4BFIB 4UFHA 3ZYZA 1BQLH 5EBAA 1RZ7L 2CDGB 2X4UB 3WO3B 2ADGA 3SE4C 4FOMA 4M61B 1QI4A 3MLPA 5LGHL 2HT2D 1QPPA 4AH2B 3OKOA 5T1LB 4PJ5A 4UDTB 2J47A 4YDLC 1DTUA 1JRHH 5K9KB 2KZWA 3T2OA 3AHTA 4WEBL 2PYEA 5JIWA 2YJQA 2YWYA 3D87B 5H2BA 4KI5E 3MLXH 2FJHB 1ONQA 4PJAE 4HBQA 4AIXA 3FRPA 3IU4H 1L9NA 5D7IB 1GZPB 5IFJB 1E0WA 1JHKL 1SR0A 4NOBA 5CZVH 5DD5H 2P46B 1XF5A 4HKXA 1BREA 4NWTH 4KRUA 1MI5B 4ZS6C 1PBYA 4WW1A 1QO3B 4QOKB 1ZT7A 3EOYG 2ADIB 5F7EL 5IG7B 2YXFA 1R3JA 1YC8A 1EOMA 4HJGB 5IB2A 5DUPH 5EFFA 3MRKB 3HE6D 4NM8H 3QIWC 3S6CA 4CN4A 3BOVA 1FNSL 3WDQA 3M17A 4GKOA 5HDOA 4HUVB 4JFSA 4KK6C 5DHYA 4KRPB 4P5MB 1T5XA 3PNWB 4OF8A 3P77B 3TPKA 1FZKB 4KUZH 5BV7H 3QO0A 1RZGA 3VDHA 1LDPH 2IWGA 5L6YL 5JIPA 5D9PA 1PSKL 3VIFA 3LEYH 2EDLA 3PZ9A 1N6QH 4I3RH 2ATPA 4Y8DC 4FMVA 3UG4A 5ABFA 5L0QB 1BM3L 1JP5A 5D8ZA 1TQWA 3INUH 2O9TA 3TV3L 1QQDB 1HJQA 4ZAKD 3RVWC 4GQPH 5KVEH 4FMFA 2P8MA 4S0TD 3JWDL 5AYBA 1QSVA 4WW2F 4ONFH 3HZ3A 2R1WA 4LCIH 3RX5A 4C56D 2DQCH 4X4ZA 1KFWA 3T1FB 3BKJL 1JNHB 5BS0E 4HK0A 2F7QA 3IJYB 1TQSA 1C3FA 3BZ4B 4QGYA 2FATH 4A2LA 2FYVA 1Z0MA 3VDCA 4X9IA 1H1NA 3KYNB 2F5BL 2W67A 3BH8A 1AGEB 4D6EA 3EYPA 2J4GA 4P3WA 4NN5C 1XGTB 5SWSD 1U8KA 4KKNA 4OBSA 4P46D 4NQCA 4MNQA 1HXMA 4WI8A 4ODVH 4EN3B 1BD2B 32C2A 2D3LA 4XNYL 3W9EA 3NZ8B 3SE8H 4H20H 4G6JH 3TNNA 4EIZC 3KPSE 5F7DB 3ECQA 1EO8L 4G80B 4GRWE 4WHYH 1ODZA 4QRSB 5GGTH 3OKLB 1CD1B 3CFCH 3RVUC 1MFAH 2EYTA 3MV8A 1E0XA 5I1CH 1GHFL 1BOYA 4JFDD 2ZPKL 4BSWA 3QDJA 2Z31D 5T1LD