1J0JA

Crystal structure of neopullulanase e357q complex with maltotetraose
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
588
structure length
588
Chain Sequence
MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLYSGEEKLVYTEKGFYFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPSISPEGSRPWGSEDPTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGESSKYKDWFHIHEFPLQTEPRPNYDTFAFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGQIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRSLRRGEISFLHADDEMNYLIYKKTDGDETVLVIINRSDQKADIPIPLDARGTWLVNLLTGERFAAEAETLCTSLPPYGFVLYAIEHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords neopullulanase
publication title Three-dimensional structure and substrate binding of Bacillus stearothermophilus neopullulanase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 193
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.2.1.135: Neopullulanase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j0jA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1j0jA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1j0jA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1j0jA03
2ATKA 1K85A 4RWYL 2CHOA 4RMWA 4MCZB 2A83B 3PDGA 2I9LB 1DQLH 2HLAA 5I6SA 1QYGL 3QO0A 4FQ1H 2NY0D 5CEYB 3RY5A 4NWTH 2CLZB 5FGCB 1JAEA 4OGXH 3QUML 1ZVYA 4OLEA 3A67L 4QWWD 1AXSB 4MAUL 3WUEA 5IBUB 4IRJB 1HH9B 4P48A 2RQ8A 3TO2B 3GTNA 4LCIL 5DK0A 3IFPA 3T0ED 4CNIA 1TQUA 5DQJA 2VXVH 3C5ZC 1DR9A 2Q76A 2ICES 2RHEA 3O4LD 1ZLWH 3LHPH 3OLIA 1I1AD 4J3SA 4HUUA 4WHTB 1V7MH 4PJAE 1JPFB 3MR9A 4NQVA 1JYVA 3ULUH 1TPXC 2IQAA 4W84A 2B4CL 2YSSA 4JKMA 4ZTPL 2BHZA 5SWQB 4ATDA 1U91A 2GJZA 4BQBA 5E5MB 3WQ5A 1MLCA 5HD8D 5I1LB 1VAHA 3WENA 1WAAE 3V5KB 1WICA 1LL4A 3ARDA 1WZLA 7CGTA 4FQXC 5MEOB 5D5MF 1FAIH 3S96A 2VLRB 3PP4H 3PHSA 4LVNC 1UM5H 1H3XA 4NO0B 2AQ3A 2IF7A 2ZG1A 1N0XH 3DV4B 1J18A 3FRUB 4QRSA 3CZGA 4NDMA 5JOPD 1F4HA 4PY7A 3MXVL 3BH8A 5DK2B 3T2NL 3ZR5A 4M5YL 1QR1A 3OGVA 5FKPA 2BFVL 4YHZH 1C7TA 2ADFH 2D3VA 3SGJA 3U1SH 1B9ZA 1WFOA 5TDNB 4UI2A 5DHYB 5IFJB 1TQCC 4PJ5D 1LO2L 4IMLA 4K71B 3GI9H 1LEKB 1M04A 1Q9LB 2DT0A 1S5HA 1T1WB 1MSPA 4R7NA 2ZOLB 1JIBA 2ADIA 4LAJH 1MCOH 1IAIL 2OW6A 5CSZB 5B39A 4QHUB 1EEYA 3G6LA 4QYOA 4HUWA 3MGAA 3DXAE 3PV7A 5EOQH 4PB0L 5J1SC 4QRRE 3SOBL 5MEPB 5M95B 1KJMA 3LKRA 4RFOL 1YEIL 2W65A 3BP4B 4HIHA 4FK9A 4X4XA 1SVCP 2XN9D 3BAWA 4AD2A 5CUSL 5K9JH 2WHKA 1OF2A 3S5LA 5E99L 3DWTA 5ANMB 2RCSL 5KSBE 2NTFA 3M1BA 1NDMB 1M53A 3BP6B 3CK0H 4FP8L 1CL7I 4U0RB 2P5EB 3C87A 4TNWK 4LLYA 1DBML 4H1LA 3AB0B 1U6AH 1JZ7A 5HYJE 1KCRH 3RKDC 1EOKA 3MLTB 5D9PA 1DTUA 1F11B 3EYFA 3ULUE 1H5BB 1JGDA 4G6ML 5IB4B 4MZ2A 4J3XA 1EV2E 3Q0HA 4PBXA 3QQ9D 4BQ4A 4J1UB 3WXVL 4NPYA 1WIOA 3HG5A 2L7UA 1YPZE 4LYPA 4OZHA 1D5XA 3WD3A 5I76A 4AEEA 5FF6A 2VLLA 4ZXOA 1FZMB 1HP4A 1QSEE 3V6BR 1EJOL 4OT1H 1YEEH 4Y19E 4EEEA 2NZIA 3B2VL 2JIXB 1NDGB 3GH7A 1V3KA 3M8OL 3T0EA 1OLZA 2CKBA 1KB9J 2QQNL 4IJ3C 3AIBA 2IBZX 4GBXD 5DEFA 1UC6A 1V0LA 3O4LA 2ARWA 4RGNE 3NFNA 1I1AA 5DUMH 3VIGA 1OP9A 1A0QH 3N04A 1P69B 3ARDC 4N1EA 3TBYA 4GZEA 3AQUA 1HHKB 3RWIB 4Q2ZA 1F6LL 4WUUD 4YK4B 4IOSD 5E03A 3D69B 3RVUC 2VR9A 2YOCA 4OLUL 5MENE 2EC9T 1FO0A 4QY8B 4B41A 1OGAD 4RWYH 1MFCL 4M48L 4L4TB 5HGAA 1C8XA 3SGJC 1QYGH 2E9JA 4PLKD 1MEXH 3A6BL 4P57A 3DO7B 1TXKA 2EE2A 3QUMH 3C6LD 4QNPF 5E8NA 2RIKA 5F9OL 4GG6E 1NBZB 1GOOA 2GEEA 5EU6D 1JXKA 4MAUH 4XP4L 3LRSA 1V0KA 1J1XL 3MRNB 5DEGA 5GGRA 1KB5A 2H9GA 3WIIL 4OFKA 3VXSA 3BKCL 4LCIH 1DBAH 5ABFA 1MCJA 3KPNA 3TIDA 2FX8L 3HZMB 1UB6A 1MJ8L 2F9BT 2ICWI 3KPPB 4RIRB 1GHSA 1JUFB 1M6OB 3CUIA 3MUHL 2EPNA 3CIVA 2B4CH 4ZTPH 2B7DT 3JV6A 1GGIH 3BVTA 2OWCA 2YC1A 2ZCHL 3RI5K 1AGFA 1BZ9A 1FFNA 3WH7A 1KT2B 4FFYL 3O6LL 2XN9A 3LDBC 4CMHB 1JRHI 4CVXB 2QKIA 1E6ZA 4FQ2L 4AT6B 4P23B 2HT3C 3F6LA 4A2MA 1EHLL 1F90L 4X6BA 3VSTA 5DDHB 2EJ1A 1A6WL 2ITDA 1JK8B 4XVJL 5CKAA 4PRBB 5FM5O 2ZWYA 2F54B 3MXVH 5HHME 2OYPA 3T2NH 3EJTA 4M5YH 4ZS6C 2PKDA 1T5XB 4LKCB 3O6AA 2BFVH 2F5BL 4HBQA 2NY0C 1IT9L 2AXFA 1T0NB 5GS2H 4WO4A 5C3LD 3L2MA 4JFTA 2V17L 5I18L 1LO2H 3DETD 3ROLA 3D51A 3X14B 2XM2A 3L7EB 4L29A 1ISVA 1IAIH 1KQZA 1A1MA 4PMNA 3GSXA 3T0EC 2X2HA 2NPLX 4WLCA 1U8KB 3LEYH 1O5DT 3KJ4B 4PB0H 4ACZA 4N90D 1EAJA 1I1AC 2BY3A 3SOBH 4CD4A 2X41A 1EGJL 5E70A 3P73B 4RFOH 4AK1A 1YEIH 4TYUA 5J8OA 4LSPH 5CIPB 3MS8A 1FVEB 1R46A 5DI8A 4GBXA 4G8GE 3BLBA 1E27B 1K2DA 1XR8B 3AMLA 3HUJA 4GRWH 1UGNA 4LHUD 5CUSH 1VHPA 5KEZA 1KN4L 4LPWA 2J8UB 1UZ4A 4OCLC 3WFBL 2GSIA 1X5ZA 1SMDA 3P0GB 4FP8H 4WUUA 3QNYB 4H8VA 5CLWA 5FAAA 5D5MB 1G7QB 2AJZB 1KJVA 3LKOA 5J6GB 1KLUB 4EUPH 5IW6A 1ZBKA 1DBMH 4W8AA 1MWOA 4AIXA 3DHUA 3ILPA 4NKQB 4FLRA 3I50H 4GLRH 2GK1B 3SUUA 1I8IA 1LE9A 5ITFA 2IPUG 3SJVE 2DQUL 2ICWJ 1GXEA 5BJTB 4G6MH 2VXSL 3W39B 4KGLA 1V02A 3PTQA 1TVHB 3WXVH 5GRXG 1QOXA 5DQ9A 2WWMC 1LD9B 3C6LA 1MFEL 4BK4A 3CHEA 4J6RH 4ODTL 5EU6A 1EZVX 4AIUA 3RGVD 5GRVL 4RE3A 3SBWA 3QDAA 2OTWB 1EJOH 1G7IA 4FMFA 1PIFA 3DARA 5EO9B 3O2WL 3B2VH 1SYTA 1HE7A 1WT5A 5BVPL 1BFNA 3M8OH 3OTTA 1CE6B 2ITCA 3QFJD 4L8SA 4PJ7E 2QQNH 2XSAA 4UAOB 4CD5A 3OXSA 5CJOL 3FT3A 3PE9A 4P5MB 5DUPL 3GDBA 2LFGA 5J1AB 2YL6A 2J8GA 2NY3D 1MQ8A 2BHUA 1AO7E 5DT7A 3PHOA 4JFDE 4XCCH 3I75A 5CXPA 5CHNA 3O6FA 3TT3L 3PWUA 1ZLVK 1X5LA 5F44A 4WUKL 4RGOL 3QYCA 1XGPB 3GSUA 4OLUH 3UYRH 1HH6A 1CZ8L 1M7DA 3HRZA 1MVUB 4YPGA 2IPKB 4HFWA 3U0TB 3V0VB 4LNRB 3IKKA 3RM9A 2Y23A 1AR1D 1MFCH 4JZOB 4M48H 4M1GL 3AGVA 5HYSB 2B39A 3MV8B 3CLWA 3GXTA 3G04B 2GI7A 3WEMA 4C57C 4DWSB 4WO4C 5CD3A 3A6BH 2FBJL 4P5TA 2DD8L 4YGVA 3ZDXF 1XGQA 2NXZB 4IRZL 1BVLA 5KVEL 5F9OH 3KLLA 1SFSA 3V6FA 1KGCE 1PS3A 1UYQA 2FSEA 3WD5L 1W0YT 5E2TL 4R9HA 2BSSA 4GRWE 4XP4H 2NY5L 4P7NA 1J1XH 2H2SD 3CDYA 3QQ9C 3S34L 2DMKA 1FJ1A 5TH2B 3UAJD 5KSVA 1K9FA 3BCDA 3L9RB 3BKCH 3BXWA 1UR8A 2FCBA 2HVJB 1U3HA 1KGWA 5SWSE 2CH8A 3ZKSD 3EJQA 5LGJA 2FX8H 3MBEB 2W5FA 1MJ8H 5ACMA 3PBGA 3BN9D 5ITBL 4IRSD 3RJQB 4X5XB 2XTJB 3VUPA 2EC8A 3P3YA 1WO2A 4LPCA 2MTPA 3VFSB 1UH3A 3FT2B 4GBXC 4L4JA 4L8CA 3WD0A 1V05A 3PDDA 2WBGA 5DRNA 1DWHM 2YIHA 2YKKA 5I73B 2ZCHH 1YDPA 4Y5VB 4QF1B 3BI9X 5F9JB 4FFYH 4F7EB 3OKYA 3O6LH 4FTVE 4BQ3A 3IJSB 4FQ2H 1JGLL 4HX1A 5D96C 2EDFA 1EHLH 2CNCA 4JM2F 1F90H 3GIVA 2F15A 1NUDA 1UQSB 4K3GA 1R5VB 4LHUA 5GS1A 5IB2A 2FE0A 2XZCL 1A6WH 5JA9A 5BCAA 3BEVB 5CMAA 4AWEA 1U92B 4XVJH 1MFNA 2NT1A 3F5KA 2XFXB 2W61A 1I3RA 5D9SB 5FCZA 4OSUL 2F5BH 4OD3L 1GZQB 1RZIA 4PLKC 1IT9H 2VRAA 5IUSA 4PJHA 2DEPA 2V17H 5C0BB 2EYTB 1EXPA 2DI8A 5IVZB 1Q0YL 2EDKA 1U95A 4OV5B 3MRDB 3SBWC 5HVHC 3W9EA 5KS9E 4F79A 1FN4A 3MO1B 2WC4A 1WT5C 2UY4A 4XV0A 4X99B 3MRKB 4L8SC 2YD5A 4X7SH 4NIKB 1MJJB 3RKPA 4UOW1 1SEQL 5FCUL 3MO4A 1PQZA 1KXVA 2OW7A 1K9TA 1EGJH 3HRPA 4K9EC 3CZ8A 1P7QB 3QFJA 3PHQA 1T0OA 1WSST 1OTUC 3ARZA 3CFDA 2E9IA 5JW4N 3O6FC 5FECB 3TBVB 1KN4H 4QRPD 1W3HA 1CFQA 5D72L 3B6SA 1YNTA 4P2OB 3AS1A 5BRZD 3WFBH 3RCNA 5C8JB 3GM0A 2VSCA 4NO5B 2V2XA 3OKMB 1XF4B 1RZFL 3PZUA 2D0HA 1JZ8A 1JWSA 4KZDL 4HMDA 5FGSA 1DDHA 1BBJA 3JVGA 3EJSA 4P5TC 2APWA 3VWJB 2GJ6E 3PGDA 5I6XB 2V7NB 1QHOA 2DQUH 3IU3B 5DXWA 4Z95L 2VXSH 5F7DA 1M7XA 3G6MA 1R3LA 4UQAA 2VLKB 5E9DB 3MLWL 4C83B 3ULVL 5CGTA 3WLWD 1U3HC 3P9MB 1S7QA 1CFNA 4ODTH 4D6HA 1IQDA 1Z0MA 2G75B 3HHRB 5I78A 4F37F 4X6EB 4MS8D 1UZ6E 4KTDL 5KAQG 3HNTL 5BVPH 3MXWL 5IBLC 1OWRM 2QBWA 1CL7L 5HHOE 3I84A 4P2QB 4HZLA 2FATL 1JZ5A 1U8LA 1QLRA 2YXFA 4WIQA 2MMXA 3U5UA 5ERWA 4IRSA 2GITB 1ZLUH 2AK1H 4PG2A 3CMGA 5DUPH 4ZOEA 3AFLA 3OKLA 3T65B 3GJEA 3P77B 1P2CB 2X4NB 4JPIA 2UZYB 4P7RA 1CN4A 3ZHKA 1SJVA 3BW9A 4KJWD 1NSNH 2E3VA 3E2HB 4OZFG 5I0DA 4WUKH 4NO3A 1WF5A 3TNMB 1CZ8H 3SKMB 2A0LD 3TOPA 5D6CB 3VDCA 2X4UA 5EPMA 4UIMA 3BUQA 3V95A 1XF3A 4M1GH 1RMFL 3DTXB 2NR6C 1S7VA 3T77B 2FJFA 5T3ZH 1WQVT 2FBJH 5JHDB 4F2MA 2DD8H 5SWZE 3QQ4B 4IRZH 2I07A 3V0AC 4U1SB 5KVEH 3G08B 3WD5H 4EN3D 5E2TH 5KN5A 3DNKA 1LWRA 2NY5H 1UG6A 5KZ6A 4NC1E 3S34H 4FG6D 3P4OB 3HLAA 3BD3A 4WHYG 3VD3A 2CGRH 4FMVA 5I8CB 3VFVB 3MLYL 4NFBA 2ESVB 4D9QE 1QVOA 1WBXA 2RGMA 4JKWA 1ZGLA 1LLOA 4W8BA 3FOMB 4F58L 1KXVC 4F15C 5ITBH 1P1ZB 3QWRD 3STZA 1M71A 4Y5XA 5JLZA 3HC0B 2XXCB 2DAVA 4NZDA 4FQCL 2XG5A 1I8MB 5ENWB 1PY9A 3T4YA 3MZGB 3BP5B 2EXYC 2NY3C 3VG0L 1DWGM 4GG8A 1IM3A 3WLBB 1JGLH 3EYVB 4UTBL 4IHOB 3NPSC 4R4FH 4MJIB 3MRGB 4QRPA 3VRJB 2BSRB 1BOYA 5BRZA 5EOCJ 2PTUA 3JVGC 3RNKB 5FYJU 3ESVF 1CGSL 5E8PA 3L5XL 4M62L 4NX0A 2BOBB 3OKDA 3QIUD 4OSUH 1YMME 1OSZB 1B30A 4OD3H 3BH9A 4S1DC 1MCRA 4D9RE 2UUDH 1QACA 1A7RH 1BX2A 1BBDL 2BVDA 1Q0YH 4ZENA 1IGFL 43CAA 4NOFA 1E5NA 5DMJB 2ORBL 3WNLA 2DIEA 3U2SB 1JRHL 2HN7B 1XGUB 4S10A 4QOKE 5M94B 2OZ4A 4JZ5A 4HD9A 5JIWA 1WWAX 1SEQH 1EDTA 3BN9C 4IRSC 4PG2C 5JIKA 3EZ8A 4JL2A 4XBGB 3AXLA 1OGTA 1NAMA 1R6VA 3SDAB 2IFFL 1PG7L 4G9DB 4OZOA 1BQHG 4OFYD 2J7DA 1A6UL 2JB6B 1IL1A 3M07A 4ACPA 3DX1A 3ES6B 1JF1B 4P5KB 1QBML 3TA3D 4Z78A 3NCOA 3WF3A 5DMGD 4JFSA 2K7PA 5D7JD 2A74B 5D72H 2FIRT 4NRXA 3NAAL 4M00A 2D24A 4D0BA 4Z7UA 4YGAB 3MROB 4KZDH 4BCEA 1RK1A 1Q94B 3SDCB 4J23A 3GXIA 4AZ6A 3LV3A 1U3YA 1V0NA 4IOFC 5DS8B 2FLBT 1KPUB 1NEUA 3KLAA 5IVOA 5DFWH 2WYSA 4PUEA 4M1DL 2ZCKL 5EUKB 4J8RB 3PABA 4J3UA 1BZ7B 1KCKA 3DXAD 4QRRD 3MLWH 5HGDA 4PJBA 5IK3B 3CH9A 4PCTA 1A2YB 4TNWF 3V4VL 1K8DA 4HA3A 3THCA 1Z3GL 5INCA 1AC0A 4PYGA 3RWFA 1K4CB 2HJFB 1T7XA 2AJVL 1NWSA 5IG7B 5A8QA 3TV3L 2DQXA 3OZPA 4JPWL 1VBRA 3OAUL 4KTDH 2J1KA 3VFWA 2C3VB 4Y5XC 3MXWH 4PRIA 1CL7H 4X6FA 1M1SA 5DWUL 2FATH 1FZOB 5GJSL 4I0KA 3CH1A 1JWMB 1N59A 3HPJB 1NGQL 3IFLL 3QWRA 1F3JA 2SEBA 3F7YA 5EO1B 3VFMB 2X4PA 3NFSL 5MI0C 2D73A 1G7PA 1IAOA 1G9NL 4YQXL 1GGYA 4XVSL 2OJEB 3BYTA 4PYHA 3UTZB 2EBNA 1CE1L 2IUZA 4D6CA 1RUPL 4XI5D 3MSDA 2E7LA 4QGYA 1OL0A 1QRND 1DN0B 1S7SB 4NCC2 1QNRA 5E9AA 1RMFH 1C8YA 4X0KA 1TTGA 3RWEA 1HT6A 3SE4A 3RHWK 3R06A 4NKIH 1OPGL 2WNWA 4WKFA 3DX7B 3QIUA 5TF0A 3QDMB 3REWA 3ALFA 5FV2A 4DO5A 4RGND 4NQXB 3WSQL 4LYRA 3LMJL 4OZGF 3MLYH 4PJAA 1O7SA 3A6CL 3OLGA 1CXIA 5E1AB 5CSYA 2DM7A 5HGHA 2XKNA 3R0MA 4MJ5B 1BLNB 1VFAA 2ZG2A 2CRZA 2EXOA 1WAAA 2DQJH 4Q9BA 1QFHA 3UDWA 1A6PA 3D3VE 1CLCA 2ATPB 4N0UE 4GMTL 2CUHA 2A6IB 2X89A 5DEZA 4FQCH 5IEKB 5A2CA 3RJYA 1NQ6A 3HE7D 2XWDA 1I4FB 4OUUA 4LAQL 2ZWZA 3ULVE 3MUIA 2XACC 3VG0H 3U7AA 1Q9OB 4OFYA 4ELKB 1L8NA 1J10A 2Q3AA 3NFPB 4LVEA 4WEMB 4CAGA 1UR1A 3GGWA 5D1ZB 1JGEA 1FNGA 4TUJA 3TBTB 4IPLA 1EMTL 3LEVL 3SPVB 2UWEF 3EDFA 4NBYB 2CIKB 4KRPB 5I1JL 2M26A 5I2IA 2FYVA 1CGSH 4KH2A 3L5XH 1MFVA 4MQ7B 1N4XL 2ZCLL 3C09B 2MNUA 5FO8B 3CUPB 4NJ9L 3PWVB 3IJYA 1CLYL 4KAQL 3D2UB 1WPCA 1N3NB 3CSYB 4J7RA 3WYRA 5CEZL 1BBDH 3HR5B 1Z9LA 4OCXL 1IGFH 1DUYA 5F8RC 3DXAA 1R5IB 1I8KB 2Z92A 3QZWG 4IPNB 2ORBH 4LCYA 4NYLB 2C1PA 2Z8SA 4QRRA 4KRTA 4G6FB 5A6KA 1JRHH 4PJIE 4UQCA 3F62A 1EXUA 2CESA 4JFPA 2VE6B 5EFIA 2TAAA 4UQ3A 5T33H 4XMLL 4XB3A 2I5YL 2XTLA 3MRIB 5T5NG 5A2BA 5KSBA 4XXDB 4R7DB 2IFFH 3HI6L 4F33B 1PG7H 1EFQA 5C0DA 1A6UH 2ADGB 1ZSDB 1QBMH 4RAVB 1QI0A 1HEZA 2J6EL 4N8VB 2E7LC 5CP3H 4MA8L 3NAAH 4ZO7A 4ZPVA 5T5FH 2H45A 4MADA 3QBTB 3C5JA 2X7LA 3AU1B 5EB9A 3HZKB 5C6PB 2J77A 4ALAL 3NPZB 4HKBB 3GMRA 3U6RB 5FM4A 5DO8A 4JQVA 4PY8J 5D7KD 4CDGC 1VBUA 5IVXE 3SE4C 1YPZA 5C0AB 3NA4A 3FO0H 1B0IA 2EDNA 4Z7WB 3FJTA 1ISWA 1EBPA 4M1DH 2AQ2A 3QIUC 3WV0A 2L7JA 3QO1B 1I7ZB 3DX9B 4JDVB 4Y19A 4JO4L 1KIQB 3V4VH 4RGMC 1JWUB 1MWAB 4I5BB 5C0CD 4XPFH 4AZHA 4ONHB 1JNHA 1IFHL 4NNXA 3TV3H 4XZWA 3H3KA 3S4SB 4JPWH 1S9WB 1P4BL 3OAUH 1MI5B 3CLEL 2VIRB 5ISZB 3UDWC 5DJXB 2BY0A 1HN1A 5DWUH 2J7EA 5GJSH 1H0IA 1PFCA 2YRLA 3QXDB 1OGBA 5CGYD 1R7OA 3WIHL 5J89A 2V9QA 3IFLH 1C7SA 2CRMA 4D8PB 3OLEA 4ATWA 5BRQA 4Z0XB 5F1SA 2DYPD 4MHHG 1SYSB 4OF6A 3NFSH 5F88A 5MENA 2ZX5A 4CD6A 1VEOA 3U4BL 1G9NH 4YQXH 1FFOA 4XVSH 5T1LB 3B4NA 1HDMA 2VR4A 1G0YR 2ZSVB 3SJVD 3TV8A 3OF6D 3HE7A 1CE1H 2VDKL 3A6OA 5DMGC 3CD4A 3EHBD 1RUPH 1JYNA 2WPGA 5D4QA 1CDIA 3QAZB 5EOCL 5EU4B 3VFUA 1ZXQA 2FECL 1T7YA 1VKXA 4PMXA 4AD0A 4U1MA 1JN6A 2HA1A 3MRRA 3U9PL 3RWDA 4PJCB 2YHGA 5CSUA 3QDGD 3EFDL 4POYA 2QV4A 2VNCA 4R97C 3TBSA 1X6LA 5B3NA 1SJHA 1QD0A 4ODHL 3X12B 5KZCD 1WZKA 3BAJA 4GAYB 1JNEA 2D1ZA 2OP4L 4JO2L 3NCJH 4N5UA 2PWHA 1OPGH 1OINA 1K4DB 4N42A 4MQSB 3AMGA 5F89A 4TTUA 1Z5LB 4Q9QL 2UWFA 3H53A 4TNVK 2AK4D 3WSQH 4O51B 4DKEH 4GT7A 3VNYA 5GS2D 4W6WB 3W9DB 3POHA 3CIQA 4KJYA 3A6CH 4WFGE 2EH7L 1CTNA 4GRLC 3RNQA 1AGDA 5FUZL 4PGBB 3HNSL 4WF7A 4JFDD 3KLSA 4XC1L 2A73A 2VZTA 1G6RB 4ZUUA 4DFIA 1SY6L 2DGAA 1HJQA 4XVUD 4E5XB 1M03A 5ALBL 3MRBB 4GMTH 3LKQB 2J5LB 5JO5B 2UV3A 1EQPA 1EVUA 1JPTL 1G9EA 6TAAA 7A3HA 3L1OL 4JANB 2DWDA 3GNMH 3LIZL 4LAQH 3DX6B 3Q5YA 4D3CL 1XSKA 1H1NA 3O3DA 3OJVC 3ULUC 1AGEA 1EMTH 3LEVH 4XI5C 5CZKA 5T1DL 5C09D 3FTGA 3D3AA 1OAUL 4HLZH 2UY2A 3J7HA 3MNZB 3OJDB 5I1JH 5ID0A 3PWPB 3RIAK 3M17B 4JREC 3L5IA 3B8YA 5SWSD 4PGJA 4KKAC 1N4XH 4JRYD 2ZCLH 4MNGE 5L8JB 3GHEL 4NJ9H 1MHCA 1CLYH 2YN3A 4KAQH 3TO4D 4JRWA 3CZSA 5CEZH 4EIGB 5J11C 2J7CA 4Z7VE 4LSVH 2ZJSL 1QNZL 1B3XA 1YECL 5DT1L 2EDQA 4HUVA 3L4TA 1UWGL 4RGNC 4XP1L 3MRCB 1LK3L 3N06B 4HOZA 5H35B 2EDJA 4DEPC 1UR0A 3T3ME 3QUMA 4OZGB 1CFTA 3BQUD 4UUJA 1NMCB 3KPQA 4YHPA 2ZXDA 3VXPA 4XMLH 4FXKB 2ZPKL 4KVNH 1UWIA 3SKJL 2ZSWB 2FR4A 2MQCA 4WWID 3HI6H 3W11D 3U0PA 3QNXA 4OD1L 3DECA 3MGOA 3MLVL 2OX5A 5I1AB 4B15A 1OCQA 4MA8H 5FGCE 3MCKB 3WHXA 1R3HB 2RGSA 4LEOA 5HHNB 3SJVA 4CMMA 5HHQB 3OF6A 3GHBH 4XBPB 3MTRA 5FGRA 4ALAH 4HXAL 3SCRA 4M1RA 5ICXA 3JUGA 4HW6A 2UWEB 4WFFD 5B3JE 3LDBB 1I1WA 4NP4L 3QDGA 2EEXA 2DT3A 4OD2B 3C9NA 1W0VB 5E6IA 4S2SA 3MMUA 3AYRA 1BVNP 1VJSA 4JO4H 4TRPL 3EJYD 4U1IB 5TF1L 3KLDA 4ODBD 2VDLL 1BQHB 2P24A 4PJ7A 5EIQA 2GAZB 2Q6WA 5I3DA 2O9PA 1IFHH 5JOFB 1P4BH 3ZT6A 3CLEH 4G9FB 5HHPA 3KPSB 3VIHA 3CLFL 5FUOH 1RAMA 4ISVB 3SY0B 1KTLA 1RZGA 1WVZA 1AO7A 1JF5A 4L9LC 4RQQB 3VE0B 3ZO0A 5IHZA 5KTEL 1PX8A 3MUY1 3IDNA 4JFDA 3WIHH 2YZ8A 4OCNC 3H54A 5F1NB 1TCRB 3R0NA 4LCWB 3IB4A 4YR6A 2EO9A 1KG0B 3O3EA 5CEZE 4Y8AA 1LK2A 2GJ6D 2VDKH 3MMEB 4XTRD 3RMEA 1KXTB 1YYLL 5F1KC 5EOCH 2I60L 2XWTB 2YN5A 2OWWA 3FQWA 2CDEA 5FOBB 4ATLA 4KROB 4PJ9A 4HUMB 3IAGC 1F2XK 3KPRB 4QCIA 5I71C 4RMRA 1KXHA 1W0WB 5C09A 1NBYB 3FO1A 3GMMB 3FCTB 1A5FL 1QEWB 2BNUB 3VH8A 1I7UA 2OYMA 2OSLB 2H8PA 4ODHH 3OB0H 3O8XB 3EMCA 3DROB 4FQJL 1MCBA 4FQHA 2OP4H 1LP9E 1CGYA 4JO2H 3W2DH 1XCTA 5SWSA 5HHOD 1BQLL 3OWEA 4Q9QH 1CGUA 4EUPA 3TO4A 2WWCA 1KJ2B 4OCSL 3K3QA 5DJ2A 2XZQL 3KYNA 4DGYL 4CN4A 5L2KB 5FUZH 3HNSH 4L4VB 2DM4A 4F3FB 3PWNA 4XC1H 1E28B 1B0GA 3P4MB 2I25N 1SY6H 3ARGA 1FNSH 4MWFB 2MHAB 5ALBH 2P5EE 4ENED 3REVB 3QNZB 1VERA 3BQUA 4FTVA 4G7VL 5C6TL 1JPTH 5A16B 2FDMA 4U1KB 3L1OH 3T1FA 1PW3A 3K8MA 2Q7YB 4D3CH 4PTUB 2DSUA 3CFKB 4W86A 3PZTA 2C26A 4NCC1 3WDIA 2APXA 5IBTH 5SWZD 4U5IA 5IHUL 1I1RA 5T1DH 2B4CC 1XAUA 4JFOB 4XNZB 2OI9B 4MD4A 1ZHNA 4G43A 3DLQR 1LQSR 5AYIA 1WUNT 3JWDL 2PYED 4CU6A 4R3SA 4JR9L 4JZJA 4JN2B 1JZ4A 4AW7A 4W5ZA 3LPFA 2XN2A 5I9QC 3EMQA 4NT6B 5H37G 4D9QD 3KAAA 3GHEH 5E6IC 2PYFA 4P4RA 1GAFL 4RISL 3NCCB 4KK9D 5KS9A 3LAFA 1A6AA 2D2OA 1IGTB 4OV6F 1J8HD 2IAND 1N8ZB 2WVUA 4UR9A 4IOIB 2ZJSH 2QHAA 1QNZH 1T4KB 5DT1H 4BH7B 1UWGH 4XP1H 3UC0L 2HLFD 4WSJA 2Z1KA 3CUGA 4FFVC 1LK3H 4HUNB 3L3DA 1ZS8B 1FSKC 3O45A 3FQRA 1T22B 2ZUWA 3IU4H 1U8IA 2ZPKH 4DKDC 1AI1L 3SKJH 1CDCA 4U5KA 4D6FA 1FYTE 3WS3B 4QLLA 4D2NA 1W72L 4L4TE 3MUAA 4OD1H 1M7IA 4GKNA 3MLVH 1JFXA 5CSGA 5B38G 1HHHB 1OM3L 5CIPH 1YMMD 4JN1L 1NC4D 1O6IA 3TBWB 5C0GB 4PR5B 2Q86A 1G7MA 4PJ9C 2GJ6A 2O5ZL 5J6HA 1PD6A 2EZ0C 2Z4QA 4HXAH 5TDPA 4LVHB 1HILB 4U1NA 1W3KA 3N1GC 4X7TA 2Y5TB 5GIRA 3W28A 4UQ2A 4YXHL 2QHRL 4UOW0 4UZSA 4JZNB 4A3HA 1GC1L 3SDXF 4NP4H 1S7UB 3ARED 3RDTB 4JRXB 2X1IA 1Q9KA 4I48B 5J06A 3TO4C 1GQKA 2X2JA 4URTB 4TRPH 5JW4Q 5TF1H 1OOAA 4DZ8B 3OJMB 5T3ZD 5HHOA 2VDLH 5JORB 1G7HA 3UPRB 2BMKB 5JW5B 3MRLB 1INQB 4NQCB 1UYWL 2EAEA 4GXUM 4U1LA 1QNQA 4QHNA 4RAUA 4IS6A 3WFDH 4UDUB 5F7FA 3ARGC 3TH4T 4XMKL 3CLFH 4UOZA 4GKSB 4UT6L 4LSRL 4C56B 4N1HB 3HG3A 5KTEH 1RJYA 2WAHA 2VN7A 3EYOA 4U05A 2AXHA 2X0HA 2GTZA 2Q7NA 3IXTA 1EQCA 5HVHB 5IMMB 3W11C 3C8KA 4P4KB 2X6MA 3T09A 2G2RA 4EI6A 1YYLH 1VIWA 4WTXA 4Z7NF 2I60H 2NX5D 1EGJA 3BAEL 2DLTA 2PCPA 1L7IL 3P9LA 1S46A 1DWIM 5GSRB 4JFHD 4JZJC 4OUOA 3VXTA 1DANU 1QPPA 4LBEA 5SWZA 4LFHD 4L5FL 3N11A 1A5FH 4RRPA 2AEIT 3S88L 1QFWI 4DWHA 5FHAL 2GK0B 3TIEB 2X2YA 3B2UD 1IRAY 1MAML 2NXYD 5EZJA 3CBWA 2IADB 1J05B 1DBJL 2BERA 3IFOA 1U0QA 3GMNA 1BQLH 2CKSA 3TPKA 2BJML 4TX8A 3ULSB 4WFEE 3VFPB 2IANA 4Y5YA 2P5WB 2XZQH 4DGYH 3CXDL 2VT0A 5GZND 5E0FA 2J8UE 1UXWA 3RHWF 1KBGL 3MODL 2WMGA 4GO6B 5K59F 5INDA 4B7IA 4HJGA 3EOBA 5D5ME 4FZEL 4G7VH 5C6TH 4XP5L 4PV9A 3WH5A 1EO5A 2YPLB 3LPGA 1M05A 1R8LA 3MRPA 4Y0GA 4UNUA 4F7PA 4NN6C 4XTRC 5IHUH 3QUZB 4DCQB 5DD6A 3N1QC 1YMMA 1NC4A 4OF3A 2GQHA 3JWDH 1XIWB 3DV6A 4JR9H 3QCUL 1NGXA 4P2RD 1NC2D 1YMHB 2WV3A 4ETQB 1D6EB 4JY6B 2FGZA 4WJ5B 3QEUA 1GAFH 3PZIA 4RISH 4TVUA 1UCBH 1UM4L 4KTEL 3AREA 5JHLL 4QOKA 1L4IA 5ICYB 3HAEB 1AHWB 3ARRA 4PJBF 4PBWD 3UC0H 3W25A 2EO1A 1A3LL 3DYMA 4V1DB 2VZOA 3S97C 2G41A 1OTTD 1WBZA 4LRNL 4Y2DB 5JPNA 1LJYA 3HG1B 2FD6L 1CD9B 1FDLL 1U2HA 2APBA 3QOMA 4W70A 3JV5A 1LDPL 4X4ZA 1AI1H 3O6KL 3OGCA 2BVYA 5DC4B 3MV8E 4MQTB 1CT8B 1DVFD 1A4KB 2PW2B 3CMOL 3TTOA 1SEBB 3QH3B 4ORGB 3KPOB 3MZTA 2W07A 1P4LA 1OM3H 4DQOL 4JN1H 3I2CL 4L3CB 3QSKB 1LG2A 5BVJA 1MY7A 4TULL 2O5ZH 4G8IA 5IB3A 2XRAL 4Q6IC 1B2WL 1ZT7B 3FB8B 1HJSA 2NX5A 4NC1C 1ZBWA 4JM4L 3KPMB 3UETA 1DL7L 3ZIZA 4FNSA 3AOFA 2QHRH 3QI9B 1J7VR 1HHGB 1GC1H 1JDCA 5D4YA 4M80A 1YC8A 4A3YA 5ABEA 4WWKD 2XTJE 1FL6B 2NNAA 2JE8A 5C0RL 4PTTB 1Q0XL 2HJKB 1INEL 5ID1B 1Q6FA 2EH8L 4NZJA 3SKOA 4JFVA 4BUHA 2YD4A 5BQ7B 3ZL4L 1UYWH 5CZXC 3O9WB 5ALCL 5DZNA 5KSUB 5GRVK 1YZZA 1S9XA 4WU5A 4XMKH 5DA0B 3CVHB 1F6AB 5DJ6A 5F9WB 1ZGLP 3VG9B 4KKBD 4LSRH 4OLXL 1F13A 3BPCB 1OSPL 3BZ4B 2WZPD 1WAAF 3HB3D 1W91A 4JKLA 1IGJA 2WWDA 1E6RA 4JKKA 3BVVA 5JNYA 2NMSA 2P8LA 3N1FC 1NP2A 3MMDA 3L3JA 3CHCA 5A8PA 5C0BE 3EFFB 3BAEH 1T66C 1L7IH 4DUWA 3MLZL 3TP4A 5HHVL 1VCAA 3MYZA 4H5SA 4O2CA 5BOPA 5HYQB 1AGBB 4L5FH 3S88H 1BIHA 4N0CD 4Z8FL 1JNDA 3PNWB 5FHAH 1MW0A 3BGAA 1E3ZA 2Z31B 1MAMH 3LKSB 1DBJH 5FM8A 3FB6B 3AREC 2CBIA 3FRPA 5MEQA 4GO9A 5BXTA 2W0KA 2BJMH 1G7LA 3SDXB 1QLEL 1R3KB 3L4WA 1U42A 2NLJA 1YUHA 3N85L 1KIUA 1ORSA 4RX4A 3AIUA 3IK2A 4E0RB 4MDJB 3TVMB 3VILA 2NY5C 3S36X 2YL5A 1MIEL 1EFXD 1KBGH 3NCYP 4R27A 3MODH 1VGKA 5DYOA 2H26B 2QV2A 4LPYA 5DD5L 3SEPA 3WIFA 4TNVF 4HG4K 4PP1D 3EJZC 4PJ8C 4FZEH 2OTPA 2DMCA 4P8XA 2DLEA 4XP5H 3A21A 3ARWA 3NSNA 1VADA 2PO6B 4NFDA 5E4IA 5JXED 2EE3A 5KSBF 3T0XA 1TENA 3SCMD 1UKTA 3L3OB 1GVYA 1A7PL 1F8TH 1DEEB 4P46D 4GH7B 1LDSA 1DVFA 5DD3L 1D2KA 3K80A 2WZIA 1FZKB 2VLKE 5E9DE 3ECBA 3VW3L 2DPEA 4X8JA 5IESL 3WSUA 5I74C 3QCUH 4L1DA 4QO1A 3ULUF 1FL5A 3VFNA 3K2UL 4EDWL 5MI0B 4K7FA 4LHJB 4R0LB 4HHAA 3DVNB 3UJTL 1RIVL 3SKNB 1HKMA 4Z2LA 2FHFA 2FH8A 2DQFA 1UM4H 3L2LA 3KHQA 1N6VA 3B9KC 4HQQL 4KTEH 4Y4HD 5JHLH 3VI4E 4JQXC 2DH3A 1NCDH 2BNRB 1U8QA 4LXFA 3RIAF 2JALA 4TTDD 4DZBB 3CFJA 3LY6A 5HGBA 3RWCB 4R90L 2C4FT 1DQDL 3IXAB 3OMZA 5ESAB 5GHWL 3RZCD 1V6XA 4UQ9A 4LRNH 2VABA 1HZHL 4BQ9A 2VKXA 1FNAA 2FD6H 1ZLSL 1FDLH 5GZOD 3GBML 4KQ3L 3U7VA 1AH1A 2Z8RA 4NC0B 1FIGH 1LDPH 1KNOB 1U93B 1ZT1B 3CDGB 3WS6A 1OGGA 3O6KH 2DTSA 1J01A 1FA2A 3S98A 3JZ7A 1X5KA 3BVNB 1J0JA 3WN5A 1FP8A 5JHDE 4F7MB 1GGUA 3PN8A 4DQOH 5I16B 3DJ9A 1UD8A 3K2MC 5IVXA 3CHDA 1LL6A 5LVEA 4TULH 2R15A 1AD0B 1ED3B 4EOWL 4ODWB 2XRAH 1W2KT 3WHE0 3DI3B 1ORQA 3MRHB 3NOIA 4DUVA 4EKJA 1ZVSB 4CD7A 1PYWA 3QHOA 2ESVE 3ZYOA 3SUWA 4JM4H 4BSVB 3VWKB 1DL7H 4LLQB 3MUGA 4PLJD 3WBDA 3HTLX 4GG6F 1QA9A 3OKOB 1L6XA 3V9FA 4ZUSA 4APQD 1FZJB 4UT9L 2D31B 5EOTA 3EDEA 5BZWB 2XIIA 5C0RH 1Q0XH 3JTSB 1INEH 1LE5B 5F1IA 4I0PD 4UZGA 5DJYA 2EH8H 3VD9A 3D0LA 3SO3B 2ICWA 3NIGE 3OKNA 2QADC 4MAVA 4ZNEE 3SCWA 5B38B 3G5YA 2HH0L 3GJFB 5ALCH 4Y89A 1MWAL 3S35H 3ULVC 3U4EB 1RZ8B 4OGAD 4MAYB 4JVPA 4MJIE 4KVCL 4OLXH 1X5AA 1OSPH 2O5YH 4ZUVA 4OFVA 3SE3A 3TN0A 3ZQ9A 5GRYA 2V2TA 4IRJD 5A1AA 5JR1L 1EFXA 5A6BD 2ILLA 2EQDA 3B43A 4E42A 2V7HA 4PP2A 3VGAC 4O2FA 2QLVB 1DVFC 1YEGL 3EO0B 3QFDA 4LLVB 4QRTA 5D1QA 3SCMA 2B1AL 4MHHI 3WNPA 4C54A 7TAAA 3MLZH 3ARTA 3I02B 3FFCD 4YAQB 3IDMB 2X1XR 5FK9A 1GOWA 4P49A 2FJHB 4Z8FH 1AE6L 5CP3A 4OQ1A 3MA9L 4KZEL 1BJMA 2OQJA 5IIEA 1C16B 2I9TA 1RZ7H 2NY2B 2VLRD 2JEPA 4R4BB 5DHVB 3U30C 4NO0D 3M45A 4FNTA 1BYCA 5B39G 3TYGL 3PJSB 3GSWA 4B50A 3BSHA 1JYXA 4OLWL 4WNQB 3N85H 3VKKA 4Y4HA 4YC2C 5ESQA 5F97E 2XA8L 3QIWB 5BS0D 4NN5C 5CEZD 4JY4A 3RUGB 1DQJA 3TNNB 4WI3A 1W3LA 1LL7A 3BAKA 1HXYA 1MIEH 5EO0A 3WS6C 1U8MB 3RZCA 3S2CA 2EDTA 3KYMA 1H3WM 5I8OL 2GDVA 5DD5H 2XVKA 3NCBB 1N2RB 4KKBC 4PGEB 1UXSA 4XCYA 1EPFA 5HVFB 4CD8A 4F7TB 1HKLL 1T1ZA 3PQYD 5IKCA 3OSKA 3BZFA 3DRTB 1G6RL 1PEWA 5EZLA 1ZHBB 5ACZA 1OCWH 1EX0A 3EYQC 3T3PE 1R86A 5DJ8A 3ROOA 3T4AA 5M03A 1PIGA 5C9JB 3EO1B 5DD3H 4I3RL 4MNGA 1TTUA 3ZKXC 1J9YA 3VW3H 2Z35B 4HKJB 2C7FA 2DWEB 1HKIA 5IESH 2PNDA 2F7RA 1U8OB 4N0FA 5B22A 5CEXA 3GXDA 4HTYA 4PJFB 4QTIL 2X4OB 8FABB 3K2UH 3MLUL 1HJUA 4EDWH 1WKYA 4Z7VA 2O61A 1OB0A 1RIVH 1IKFL 2AKRA 4N0CC 2P45B 5D8JL 3VXNA 3MREA 1ZK9A 4N9GB 4HQQH 2VDML 4G8EB 2W60B 4LF3B 2NYYC 4WRLA 2B31A 3BKML 3KWWA 2EKJA 3VXUB 2BVOA 4AH2A 4XZUA 3HE6B 2V9RA 1FV1B 2EPLX 1FVCA 4R90H 1ZGLM 1DQDH 5GHWH 1LMKA 3KL3A 5EG6C 1MCWW 2DL2A 4JIEA 1W9VA 1HZHH 3D87B 1ZLSH 4MCZA 3W29A 2A83A 3GBMH 4LDOB 4KQ3H 2I9LA 4MCYB 3SE3C 3TN0C 1MHEB 1UA7A 5CEYA 3VX0A 2CLZA 5E95B 1SMAA 4PP1C 2R9HC 1AXSA 4RCAA 3L4ZA 3BC9A 4GRLB 3JWNC 1HH9A 4IRJA 4EQ2A 1GRWA 1TTFA 1PDKA 4WDIB 4D9LL 3VINA 3TO2A 3QEGL 5D1QC 4ZG1A 2JIXD 1YY9D 1EO8L 4XP6L 1DWJM 3CX5J 2EKSB 3QDME 4NZTL 4KUZL 4EOWH 1KF9B 2NY6B 3KGRA 3X13B 2VB5A 2J7HA 4WHTA 1L9NA 2F53D 1JPFA 1I9RL 1XH3B 3AS0A 4Z2JA 1R75A 1RU9H 1JNNL 3IANA 5SWQA 2K3TA 5I1LA 1OP3K 4W6YB 3V5KA 3ZKNC 4K7PX 4ONOA 5MEOA 3R1GL 1BGAA 3PZVA 3FO9B 3HI1B 2VLRA 4Y4HC 4MNQB 2DSZA 2NY1C 3SUTA 3NABL 4NO0A 4TTDC 5DMIL 4L4TD 3DV4A 3P4NB 3FRUA 2V38A 3GH5A 2NW3B 2HH0H 3D85B 1MWAH 1NQBA 1QSEB 4O02H 3RZCC 3W26A 3LQMA 1K3IA 4NNYA 3BUTA 5DK2A 4YBLB 4CVWA 3AUVA 4KVCH 4HMCA 5GZOC 1FFRA 1G94A 4TOYL 5TDNA 5JR1H 5DHYA 5IFJA 3CFEB 4V28A 4QGTA 3ILQC 1BLIA 1LEKA 5C0IB 2ZUTA 1Q9LA 2HT4D 1T1WA 4EE9A 1YEGH 2APFA 4DEPB 2ZOLA 4JLRB 4AZBA 1W8OA 4QT5B 3DUSB 1OM0A 5KSAB 4LYQA 5GGVL 1WCGA 3UBXB 1S7WB 4X7EC 5CSZA 4QHUA 2B1AH 3AAZB 1KQYA 2N7BA 3ZT7A 2PXYD 1KBBA 1RPKA 1G9NC 5MEPA 4TQEL 5BWFA 4Y4KB 1G5AA 1AE6H 2Q8BL 3CPLB 3BP4A 3C5SB 3EYSL 3MA9H 4PLJC 1D7FA 3M46A 1BM3L 4G42B 2W92A 2GT9B 2VWEE 3NA9L 2GVYA 3BRDA 4GG6B 1ISZA 2R1YB 3TYGH 5ANMA 4UNIA 5CQ1A 1NDMA 2YFNA 3BP6A 3BX7C 3DX2A 4OLWH 3NACL 1FHDA 4G7YL 2F54D 2XA8H 2P5EA 1OIFA 1C3FA 1GZPB 2YA0A 4QXUL 3ZLQC 3H55A 1KJ2L 2VDRH 3MLTA 2ZE0A 4PRDB 2W0FB 2VRKA 5C86A 1GCYA 4OGAC 1F11A 1H5BA 1FNLA 4K3DL 5B8CB 3UG4A 5IB4A 1HKLH 2E3ZA 2YBRB 3I6KB 4NUGL 1X9QA 1G6RH 4LCUB 4J1UA 3G5XB 1J0KA 5C0AE 4PUBL 4YXKL 4Z7WE 4L3EB 2XTKA 1IT0A 1OQXA 1FZMA 2DBJA 2PR4L 1D9KB 4TSAL 1BAFL 4JFWA 4L9LB 4M1CD 4PMOA 1TA3B 2G5RA 3WIHA 4B16A 5C9KA 1RVFL 1NDGA 2JIXA 3FAXA 4XCEB 4NZUL 4QTIH 3IDJB 4WFED 3BDYL 3MLUH 4NXSA 3K81A 4WKHA 3MA7B 3SO5A 1UD5A 4PUDA 3KVQA 5FOJA 1MI5E 1IKFH 2QSVA 4KKCD 5ISZE 1WISA 5D8JH 1TVNA 4H8UA 3QIBB 4RL3A 1HHKA 4U0QB 4EVNB 3RWIA 1IGCL 4S1RH 5EBWB 1HCVA 3PV6B 4PTXA 2VDMH 2XN1A 3BKMH 3D69A 3G9VA 1UZ6F 4HZ6A 4QP0A 1X3DA 3FQXB 4QY8A 1XGZA 5E2VL 3VGEA 4L4TA 5JIPA 4K3JL 4W7WA 4GKZB 4LOUD 4K71C 1MY5A 1T0MB 3CTTA 4PJCE 1NBZA 3VD7A 2WQ8A 3IDIB 3MRNA 2V5SA 4BELD 2JCCB 3N12A 2GFTA 1XZ0B 1JAKA 3QEGH 2FBOJ 5E4EB 5KANG 5EC2B 3U7WL 1SY6A 1EO8H 1TDQA 4XP6H 5DT5A 1QP1A 2IBGA 4NZTH 5EC1B 4KUZH 1FBIL 3HZMA 4X6CF 4BM7A 5DRXB 4HXBL 3ZKMC 3S5ZA 1H3GA 3KPPA 2AGJH 4RIRA 2B8OT 1JGIA 4LSTL 1NMBL 1M6OA 2X1QA 1ZTXL 4X6DF 2EYRB 2F2HA 1X5HA 1YNLH 1JNNH 3OIHA 2OMBA 3LKNB 4PMZA 3H9YA 3AZTA 1N0LA 1TQSA 1LO5B 1KT2A 1QBBA 3FZUC 5FYLL 3R1GH 2Y6SD 4Y1AD 4CVXA 1RZJL 2YFOA 4CVZB 4PS4L 4AT6A 1OTSD 4U0RC 4P23A 2BFGA 3NABH 3AVEA 3NN8B 5I9QB 5DDHA 5LG1A 1JK8A 4X5LA 4DWSD 3K4ZA 2NXZD 3MJ7B 1MYRA 2F54A 1I7RB 1H5BC 3GBDA 4PD4K 3JUYA 4XNQB 3FN9A 4JO1L 1T5XA 4LKCA 1NCAL 4PV8B 2OWXA 4YIQB 4TOYH 1T0NA 3PWPE 5DVLA 4OZIE 2PTVA 4Z77B 4JFEB 1IQWL 4N5ED 3BIKB 2VRQA 5A8MA 4LHUG 4DOHB 3K8KA 2HTLC 3THMH 3X14A 1Q9WB 3L7EA 4FS0A 5HOSA 3GK8L 1US3A 4YHKH 5GGVH 1FVDB 3JV0A 4KDTA 4MJ4A 1DLHB 3EDDA 2WNGA 25C8L 3LN9A 5D9OA 1U8KA 1NCWL 3CCHB 3HS0A 2J8FA 1ZANL 3G6AB 3VGGA 4TQEH 4J4PD 3P73A 3DMMD 2IAMB 3EYSH 2PC8A 4OIBA 5CIPA 1FVEA 5D9MA 1BM3H 4PGDB 2W59A 4YK4C 1E27A 1XR8A 2B0SL 3NA9H 3DBXB 3QXWA 2O9RA 1A47A 1KFAL 4PB9L 4ESKA 2YLAA 1U30A 2J8UA 3WFZA 3WE6B 1CBGA 5FO9B 3S96B 3WCYA 4DAGL 3NACH 4HJ0D 4OFIA 4G7YH 2VH5L 3QNYA 5D5MA 1G7QA 2AJZA 3NGBB 1KLUA 5J6GA 4ODXB 2FHCA 4QXUH 1U8JB 3RM4A 2KBGA 1KJ2H 3H6JA 2EYSB 4EDXB 2GK1A 2DI9A 2IG2L 2DMBA 2NY7L 1QR1B 4V27A 2VXTL 5BJTA 1VFFA 4K3DH 4HIEB 3H3BC 3W39A 4NUGH 4MNHB 3TYFB 1TVHA 1LD9A 1CGXA 4PUBH 3S9DB 1CLXA 1AGCA 2ID5A 5HNNA 4ZXBB 2YUWA 3N50A 1B4RA 4N9OB 5I75B 2PR4H 4TSAH 2OTWA 1BAFH 5B39B 3LN4B 5EO9A 2AABL 1KYOK 1RVFH 5CJ5A 5AD0B 2XIBA 1A9BB 4WU7B 1CE6A 2WVSA 3CVIL 4NZUH 1NBVL 3L5HA 4QRQB 3BDYH 1JMXA 1E73M 2WVVB 2VCBA 4PTMA 4P5MA 5J1AA 4GSDL 4G9FE 4HJJL 3KPSE 1IAKB 2EDHA 4P2OD 3ZJ6A 3U4AA 1R0AL 3UG5A 3O3AB 4CMHC 1IGCH 2AJXL 4TSCL 4B3LA 1KIPB 1MJ7L 4P23C 3ARVA 3CU1A 3CC1A 3UG3A 2Q3ZA 3N9KA 4LCWE 3TPUB 5J13B 4GXUN 3D0VB 5FYKU 1XGPA 4M9PA 3BUBA 3VWJD 2IPKA 3HCVB 3U0TA 3V0VA 3GBEA 4LNRA 4MJ2A 4WEUD 5E2VH 1ZLVH 4JZOA 1MXDA 1FLRL 5HYSA 3MV8A 4JVWA 3G04A 4DWSA 1CLVA 3LB6D 3OAZH 3FB5A 5L8KB 4RMSA 5LYRA 3KPRE 1NANI 1YHTA 3A4AA 2AI0L 5TH2A 3IJ7A 4YDKH 3L9RA 2J4GA 3DX8B 3RVXD 2HVJA 4M7LT 1ETZB 4KDTC 4L3AA 4OLZL 4S1QL 3GXFA 3QG6B 1N5AB 2XZAL 3EDJA 4P2QD 5A6LA 3W53A 3MBEA 4RE2A 5DSCB 1T2QL 1FBIH 3KJ4C 4HXBH 3FQUB 4P59L 2Q87A 5F7WC 2ZXBA 4X5XA 3WFCL 4LSTH 5IJKC 2O9TA 1NMBH 5HI4D 3GMOB 1ZTXH 1E0WA 1UKQA 3F5JA 3D18B 1ZA6B 3VFSA 3FT2A 2PETA 5L2KE 4M8UA 3NCMA 4L4VE 1NOWA 5IF0B 4GQ9H 4KKCC 4Y5VA 4QF1A 5F9JA 4NN6B 3W0WB 1A6ZB 3TEUA 4F7EA 3BO8B 4DVBB 1D6VL 4Y16B 1QNPA 1RZJH 1I9JL 3KHOA 1UEYA 2EDWA 3IJSA 3O2VL 4PS4H 3MOQA 1GJIA 2VITB 1IMHC 1UQSA 1R5VA 2IEPA 1H11A 3BEVA 1U92A 1NGZB 3VXQB 3BGFB 5JHDD 3FY1A 2XFXA 1JD7A 3SCPA 2EICA 1HI6B 4JO1H 5D9SA 1NCAH 1A6VL 2D7NA 4C4KO 1GZQA 2OSXA 3THDA 3ULVF 4LOUC 3CVHL 4E8DA 5C0BA 1IQWH 2N1KA 3CZFB 3LD8B 4ZOBA 3S6CA 3CH8A 2ESVD 5IVZA 1J11A 4Z7QF 4KK5D 4OV5A 4J27A 3MRDA 1P5UA 2PWFA 4GAJL 4PJ5B 5JDJA 5FFLA 5HDLA 5FO7B 1DN2A 3MO1A 3GEWB 1WDRA 5D2LB 2YA2A 4OF8A 3MRKA 25C8H 4NSKB 1MJJA 4UAOC 2AV7B 1NCWH 5FM5M 1ZANH 2KQMA 2WZHA 1AP2B 5HVWA 3LPPA 2R39A 2WP3T 3DRQB 5ABDE 4JAWA 4X6CB 1P7QA 2XFFA 2APTA 2ZX6A 3LQZB 4Q22A 1AGFB 5FECA 3TBVA 4MJID 4X6DB 1KFAH 4PB9H 5JQHC 5I1KL 4Q6IB 4P2OA 4HDIB 2KUTA 2Y6SC 4PJIF 5C8JA 5LQBL 1V7NL 5EU7E 4U7KA 4DAGH 4NO5A 3AICA 3OKMA 1XF4A 2VH5H 4D1IA 1I85A 5F7YC 2DBLL 1KCUL 1B0RB 2XOTA 1ULVA 2IQ9L 5I30L 4DWSC 4OQTL 3VWJA 3SCUA 2NXZC 1GUVA 2IG2H 2V7NA 2NY7H 3IU3A 4HS3B 2VXTH 4I2XE 5CWSB 1PSKH 4D1JA 4UB0L 3BESR 2XFYA 2EC9U 3HG2A 1FNFA 2VLKA 5E9DA 2WXDM 4C83A 2EDRA 4FNQA 5FYLE 5HJ3B 4N5EC 2YMXL 2VDNL 3P9MA 4D6IA 5IB5B 2E9BA 4OCWL 4JRXE 1Q6DA 5F6IB 3MBEC 2G75A 4X6EA 3EYUL 4DKFL 2XTJC 2AABH 3BP7B 4YWGL 5IVXF 5E00B 3CVIH 4P2QA 2BK8A 1NBVH 1HXKA 4BJLA 1PVHA 3LOWA 4G8FB 4YX2L 5C0FB 4TUOB 3ZJ8A 3G9AB 2HISA 2GITA 4NRZB 2EDDA 4GSDH 4HJJH 4Y5VC 1A3HA 1PX3A 2VVNA 3T65A 2BSED 3FO2B 1R0AH 2P7TB 1RD6A 4KV5E 1P2CA 4C56E 1N5YL 2AJXH 2X4NA 3JWDC 3DSFH 4TSCH 1BFSA 4MX7B 1T83C 6FABL 4WHCA 1MJ7H 4RA0C 5CJBA 2AEPL 2G4FA 4CCEA 1QWUA 1IBGH 3D9AL 3QJFB 4JM2D 3TNMA 3SKMA 1X7QB 1AKJB 2J8OA 5D6CA 5E2WH 1UASA 5EWIL 2YPVL 3HAEH 4JDTL 3KLHD 3WDJA 1UENA 2CYGA 5EZIL 1E6SM 1FLRH 1MCEA 3DTXA 4M7ZB 5FXCH 1CZ1A 3T77A 1CGVA 4OM0L 1KGXA 5JHDA 2V5RA 1OGAB 3QQ4A 4MDOA 4U1SA 3EO9L 5C2BL 4XHJD 2NZ9C 2EDXA 4LQFH 3CO4A 2AI0H 5CG0A 2I27N 3P4OA 2ICCA 1WDQA 1MFAL 4Z6AT 3ZSSA 3X11B 5I8CA 3VFVA 2HFFB 3NDYA 4S1QH 2PTTB 4OLZH 2ESVA 3N0PB 2XZAH 4D0CB 3H9ZA 4MSWB 4NNPL 3FOMA 4BFBD 1MQRA 1P1ZA 1JVKA 3GSVB 3WFCH 3KS0J 5E8OB 5MERB 3LRKA 3HC0A 2P5WE 4LU5L 1ZT4B 2AERT 4NHCL 2Z91B 3P0VL 1ITXA 2J4WL 1I8MA 5ENWA 3FT4B 2JTDA 1QX1A 1UWSA 3BP5A 5A2FA 1LG1A 4ZNEA 1D6VH 3QULB 4KI5E 1JD9A 1I9JH 3EYVA 3NIYA 4IHOA 1TQTA 1I85C 1MFBL 2YPLE 2J7FA 4MJIA 2P44B 3MRGA 1GC1C 1B3YA 3VRJA 2BSRA 3ZO9A 2DIBA 1NCCL 3RNKA 3VWJC 1UD2A 3IS1X 1D5IL 1H0DB 1FFPB 5I1DB 1IC5H 2BOBA 3IGAB 1BWWA 3QDMD 1A6VH 1OSZA 1WITA 3D39D 4JJHA 1N6QL 4MB1A 4U1HB 1GZJA 1KB3A 2Z93B 3CVHH 2XVLA 3KYAA 3PIQB 5DVOA 4GAJH 3U2SA 2D7PA 3BCFA 2HN7A 1II4E 1XGUA 1CXKA 1OAZL 3BAYA 1WE5A 3EJPA 4AM0B 5FUCE 3VM5A 2R2BB 2IH1B 3FN3A 3M6DA 1MCDA 1A21A 4V1DE 4XBGA 5HI4C 1DQTA 3SDAA 3C60C 4G9DA 5B4MD 5DRZB 4NQEE 4Z7VF 2FZ3B 4ZFZB 2JB6A 1JGVH 3ES6A 1JF1A 4P5KA 1GJWA 3E2HC 4PMVA 5I1KH 2A74A 4KHXL 3BXNB 3LKPB 1V7NH 4ODSL 2YUVA 1ZJBA 3T3MF 5GS1B 3ZSTA 5F7LB 2DBLH 3MROA 2Q8AL 4EIZC 1R47A 1BQUA 2CETA 3AISA 3SDCA 3IDYB 5I30H 4W8LA 4OQTH 5DS8A 3D2UD 3CZJA 3F7RA 5HXMA 2J25A 3KEHA 2DSWA 1KPUA 4GJTB 1F4XL 1C91A 2EE6A 5EUKA 2PB1A 4UB0H 3QQNA 4J8RA 3D3VB 4WW1B 1BZ7A 4N0UB 5DLML 5J9PB 5T3XL 2XY1A 4G6FD 5IK3A 4N1CA 4MNMA 1A2YA 2YMXH 1QUNA 2VDNH 1CIDA 1CK0L 4OCWH 1K4CA 2HJFA 2AXJA 4HZ8A 1X6NA 5IG7A 3I3EA 4DKFH 4W85A 2C3VA 1F4AA 2AEWA 3MC0A 4YWGH 2OXGA 4PTWA 3RGVB 1FZOA 1O0VA 3DGGB 4POZD 4YX2H 1MLBB 4XPGH 1V6YA 1JWMA 5E7BA 3HPJA 3VGAB 1BWMA 1LEGB 3RPMA 1RHHA 1U36A 3C5ZD 5C08B 5EO1A 3VFMA 3MSGA 1IEAB 1NJ9B 1N5YH 4P99A 3HR6A 1IGML 3GB7B 1UVQB 4PEEA 2O9OA 6FABH 5KJRL 2AEPH 4NF7A 3D9AH 3D4ZA 1DN0A 1G7JB 1S7SA 4I3SL 3OXRB 1BHGA 3BEWB 4FQXD 3F8UB 5EWIH 4JDTH 1XH1A 2BOCB 5EZIH 1XGRB 4UFIA 1V08A 2BVQB 4KRNA 1C92A 2VQ1B 1GOGA 4OM0H 1T5WB 5IWLA 4CCCA 4F8XA 4UFKA 3EO9H 5C2BH 1HWWA 1GL4B 2CPCA 3DX7A 3QDMA 2JIWA 4H8WL 3BAXA 3KJ6L 5F7KC 3VXMD 2FYYB 1MFAH 2Y5EA 1NGWB 4NQXA 4C7DA 5ISZD 3DGCR 6CGTA 1IQDB 5E1AA 4BFEA 5DJCB 4NNPH 5TFSL 1WAWA 1QO3B 2ZNWA 3SDXE 5HI3C 3AHVA 4MJ5A 1BLNA 2J62A 4XRCB 5A95A 4XX1G 4LU5H 2ATPA 3SDAC 3P0VH 2ZXAA 1LP9F 2A6IA 3P30L 4HEPG 1WWCA 2HKFL 4WIWA 2J4WH 5IEKA 4J3WA 5T1LD 2EIBA 5FYJL 1I4FA 1VFBB 1VPOL 2IALB 2UY6A 2D23A 1Q9OA 3FQTB 4ELKA 3NFPA 5D1ZA 4MD5B 3TBTA 2G5BB 3VMOA 3SPVA 5GJTL 3SDCC 2CIKA 1VFOA 2C9AA 1NCCH 5JDSB 2F74B 2LVCA 2WW5A 1JPGB 2WCAA 3TESA 4MQ7A 2WW8A 5IHSA 5FO8A 3CUPA 3ZDYE 3PWVA 3GMQB 5EBLB 3HMCA 3GJFH 5LCVL 3D2UA 3INUL 2P1YA 3CSYA 5EIVA 4XGZB 5HYIA 3HZ3A 1KGUA 3HR5A 3RKDD 1NEZB 1R5IA 1I8KA 5GNYA 4NYLA 1D5MB 4HUKB 1CEOA 5FKAB 1OAZH 4N8PA 1MAJA 4ONGL 4TVSa 2VE6A 4JHWL 2IPUK 1I1CA 1U9KA 3UZQA 4YDIL 2ERJB 5TE6L 1QLFB 3MRIA 2R0LL 2YD8A 3WFEH 3A24A 3ZDZE 3ET9F 4PJDB 4XXDA 4KWUA 4R7DA 4Z2GA 1OARL 5A2KH 2ADGA 2BSTB 1ZSDA 3T4YB 1TZHA 5GXBB 4RAVA 1ZS2A 1Z9MA 3C2AL 4MZ3A 4N8VA 2IXVA 2XPKA 1RFDL 4KHXH 1NLDL 3WNKA 2OK0L 1ES0B 4ODSH 3PWPD 5IM7B 5HYEA 3AU1A 5DHVH 3HZKA 4TUKH 1P84J 2Q8AH 3WF1A 1F4YL 1AR2A 3QHZL 4HKBA 3U6RA 3DSNA 3CJJA 5IWLC 4GW1B 4UZUA 1G0XA 4YHGA 3RVUD 4HC1L 5C0AA 1F4XH 4Z7WA 5AY7A 4QEGA 5DLMH 1JI2A 2NY1B 3RJDA 5T3XH 4NOBA 2A3AA 3QO1A 1I7ZA 1BX2B 3DX9A 4JDVA 1KIQA 2IBZY 2GYSA 2J7GA 1JWUA 5GQBA 2YBUA 2B5IC 1MWAA 4A2LA 4I5BA 1CK0H 3GUTB 3Q3GB 4ONHA 3WO4B 3S4SA 1S9WA 1IZKA 3U79A 3OGSA 4W4OA 2XVGA 1MI5A 5ISZA 4W89A 5DJXA 3FL7A 4BZYA 3QXAB 1BPLB 3UYOD 1CD0A 1QI3A 3EOTL 3QXDA 3OR6B 3SDDC 4XWOC 4ZPTB 4D8PA 3LMYA 3BT2L 4Z0XA 1W9XA 2H32B 2LAGB 1EDGA 1KXQE 2DH2A 1SYSA 1E0XA 4UILL 3DC0A 1IGMH 3BHBB 2EE9A 3QXUA 5T1LA 2E6JA 2ZSVA 1XCQB 5D1ZC 3VJ6B 5IEHB 1MRFH 5FA4B 5KJRH 4Q97A 2VCAA 2Y36L 2VN4A 2OBGA 3QA3B 4KRPC 3TTSA 5EU4A 4YDJB 4UOQA 1FH8A 4I3SH 3TCXA 5GGUB 4AIZB 4PJCA 4YHEA 3C09C 3LQAL 1UZ8B 2A6JB 4RBPH 5KOVC 5M3WA 2HT3D 3AMDA 1E5JA 4MDIB 5SX5H 4DK6A 3X12A 3HMXL 2EPMX 4GAYA 4JFYB 2XSBA 1D5ZA 1ZHLB 2VURA 4ZOAA 5A2IH 4D72A 1K4DA 3BDBA 3BRFA 4H8WH 3FOLB 1Z5LA 3KJ6H 2MFNA 4Y4FB 5F3BB 4D6EA 4OTXL 4ZS6D 4O51A 4HWZB 4EN3B 4NKDB 3W9DA 1E4IA 1FNHA 3GXPA 5GGVY 3EUUA 3NIFE 5TFSH 4PGBA 3VH8G 2VWEC 1G6RA 2DT1A 3QHTC 3MV9B 4LCWD 4RMQA 1NKOA 3QUXB 4E5XA 5KANI 3CUFA 3MRBA 2FHBA 4DM2A 4POZC 1DQQB 1T1YB 3LKQA 3RUGE 5C6WH 3BGMB 3P30H 2HKFH 5JO5A 1A1OB 1LNUB 4ORZC 4EUPG 1OD8A 3B83A 1CWVA 4JANA 5A43C 5T3XE 1VPOH 3DX6A 3VVGA 5CBAB 4NKMB 1NANH 3OGRA 2P47B 2H6PB 3W37A 4KROD 1Z6JT 3B9EA 3WKNA 2J8UF 2FJGB 5GS0L 5GJTH 1HQ4B 3MNZA 3OJDA 1OAYH 3HG4A 3H42L 3PWPA 3GSRB 2HVKB 3TWCL 3M17A 5E24E 4AZGA 2AW2A 3N17A 5H8DA 4O00A 3KNBB 4JHZA 2F19L 1NWUA 2YJQA 3INUH 2E40A 1HL9A 4B9ZA 3IETB 3LSOB 4PJFE 4HAGA 2Y8VA 5FB8B 4X9IA 2XHYA 2XQYG 2VZSA 3VIMA 3N9GL 3D6GA 4ZNCD 5L2KD 4L4VD 4PRPB 3WIJA 3VX1A 4HPHA 1ZE3C 5FIEA 5D6DA 4W4OC 2IXUA 4CN6A 3MRCA 1W2PA 5H35A 3VXSD 4ONGH 5CILL 2WWMD 4JHWH 4HPOL 4OZGA 5HPMB 3MRQB 1NCUA 2VISB 4JHAL 2EEAA 3VXUE 4CADB 4YDIH 4FXKA 3FQNB 5TE6H 2R0LH 3NMEA 3SURA 2YR3A 2ZSWA 3U36B 2ZKHL 1OARH 1QNSA 2BNJA 1XR9B 2VLMD 5I1GL 4HA1A 5I1AA 1LP9B 1RFDH 1GGCL 3MCKA 3QAZC 1NLDH 1R3HA 2OK0H 1QPXA 3RP1A 3HZYB 4HG4J 1Y18B 3P0YL 5A69A 4AIOA 3TA3B 5HHNA 5HHQA 1E4MM 5D7JB 4XBPA 1F4YH 3QHZH 4XBEL 3OX8B 3D5HA 4QXGL 4HK0A 2C3WA 2OL3B 4QXWA 2Q1EA 3CUJA 3TCLB 4NZFA 3O2DH 4HC1H 1EZVY 2E27L 2UWEA 4MNJA 4QCFA 4RDQG 4E9LA 3IJYB 4ZFOB 4OD2A 4WI5A 1W0VA 1JHLL 2EXWC 4KQ4L 1GYAA 5FYJE 4QKXB 3PZQA 4U1IA 4WV1B 4WO4D 1BQHA 1E4XI 2GAZA 2C3XA 1RUML 3H7LA 5JOFA 1HVQA 2AJ3B 3T0AA 3F5WB 2YEZB 3KS0H 4G9FA 2YD3A 3KPSA 4MNQE 4ISVA 3SY0A 3WF2A 3VE0A 3OA5A 5DHXB 2J5LC 3EOTH 4RQQA 3O41B 4HK3J 2A3EA 5AYQA 4EI5B 5F1NA 1TCRA 3SCQA 3BT2H 4LCWA 3ZHDA 3G6JB 1KG0A 4UILH 5LWYL 3K74B 2MCPL 5I8KL 2C8NA 1GORA 3MMEA 4M5ZL 4X4ME 3OB8A 4AQOA 1KXTA 4Q0XL 2XWTA 2QPSA 3QOKA 4M81A 1A4JB 4OF0A 5FOBA 1OP5H 3KPRA 2OXHA 2A6KB 2PF6A 1W0WA 1QRNB 3Q6FB 3RDTD 1NBYA 3GMMA 3LQAH 3FCTA 1QEWA 2BNUA 3VCLA 3QEQB 2OSLA 2WWKO 1A1NB 3UERA 3HMXH 3O8XA 3DROA 4P3DB 4HGWB 2MOVA 4A6YB 4YHML 1VFMA 3ZTNL 2GJPA 2RFXB 1A9EB 2A9NL 3I3DA 1T6VN 2DJ4A 3KYOB 1G1YA 3W5MA 4NQCD 1FYTB 4OTXH 5TGBB 1I7TB 4KJPD 4F7CB 1KJ2A 5D6DC 4WW2C 3ZTJG 1LEIB 2FO4B 1U41A 3WNMA 2KZ1B 5L2KA 2OMNA 1NMCC 4G6AC 4L4VA 4F3FA 3A67H 1LVEA 1E28A 3QT2A 4U1JB 1UT9A 3P4MA 5DTFB 3WQ6A 1M01A 3LEXB 4MLIA 4QHMB 4MWFA 2MHAA 3REVA 3QNZA 1IC1A 2Z0BA 1ZWIB 1Z9SA 4X9BA 5A16A 4PJXF 2HG5B 4U1KA 2W62A 4HU8A 5JOEA 3QCVL 2Q7YA 1TNMA 2YK1L 4R8WL 2DF3A 4PTUA 5E08L 3CFKA 1HDMB 2D0FA 4FQQB 2XZZA 3GI8L 1G0CA 4J2XA 4YHYB 4MPKA 3EBAA 1OTUD 5ECUA 4JFOA 5GS0H 2PUQT 4L3EE 3O6FD 1N7ML 3H42H 4P0DA 3TWCH 3Q6GL 4JN2A 4NT6A 3OKEB 4Q58C 5HDBE 3D50A 5ESVB 5DFVC 1CICB 3S3JA 3QPXL 4RFEA 3UJIL 4X4YB 2RB8A 1IGTA 1UADC 5KG9B 4WK9A 4H0GA 3NSXA 5AZEL 1N8ZA 2XICA 4IOIA 2CUMA 4P5TD 5EBMB 1T4KA 2X4QB 4BH7A 3N9GH 4HF5L 4Q74A 3H9HB 5GRWA 4CRPA 3AIWA 1ZS8A 5CILH 3MLRL 4HPOH 4CU7A 2EDOA 1T22A 5ICZB 3MYJB 1U3HD 3AHZA 4GAFB 3AHYA 3IRPX 2R56L 3KG5A 2CBJA 2YPLD 2ED9A 3IT8D 4RDQF 2E6PA 2JK5B 5EUOB 4NRSA 1GOHA 1JE6A 1KTBA 1JL8A 4WFHE 2ZKHH 3WS3A 3SGDI 5IBLD 3VI4F 2Y7QB 1H8OA 2WUBL 5I1GH 5IOPB 1HHHA 1WCBB 1GGCH 2XI9A 4HS6B 3TBWA 2CMRL 3OR7B 3IGUA 4R4NC 3P0YH 3L3KB 5C0GA 1DUZB 4KROC 4PR5A 2EDBA 5IFHL 2WSPA 4YEFA 5LXGL 3BPNC 5CJQL 2CD0A 1HILA 2JCCE 4QXGH 1TMQA 3EZJB 2Y5TA 3LVEA 3O8XC 5E99H 4FLQA 2RCSH 5JBDA 2MJWA 4JZNA 1S7UA 4PRHB 3RDTA 5CSBA 4JRXA 3RRQA 1CLZL 1JHLH 4I48A 1TLKA 4KQ4H 2VSDA 4UBDC 3NTCL 3DO3A 2HWZL 2I24N 2VLJE 1UKPA 4V1DD 2NR6D 3HPLB 4JFFB 4DZ8A 3B5TA 2XXMB 5IHBA 5JORA 1K9EA 3UPRA 2BMKA 3NZ8B 4OZ4B 4PRNB 5JW5A 3MRLA 1INQA 1AY1L 3HG1D 2NT0A 1RUMH 4NQCA 1YEJL 2V5MA 1JDAA 3PZ9A 3TGXA 4UDUA 1CNVA 4LFHG 1RSFA 2NY4B 5C0CB 2AS5M 4GKSA 4OIIL 5A8NA 4C56A 4YNYB 4CCDA 1FGNL 1GGTA 1J9CT 3AMKA 3KDMB 2LE9A 3BLPX 1RUQL 2DM2A 4BYHA 4U1GB 5L0QB 5IMMA 4WSKA 4NJAL 5LWYH 2VO5A 1T7ZA 2MCPH 5I8KH 4P4KA 4M5ZH 3NYDA 3K7UA 4UFMA 3U5YA 2DYPB 3NIGF 1OQOA 4Q0XH 4XNZC 2OI9C 4JFEE 1T0PB 4L8BB 3EGSB 3CXHK 5GSRA 4DOHE 2EXYD 4R96B 3QI9D 1SBSL 1JTOA 4U33A 4KKNA 4L9DA 4O9HL 2WKGA 3TIEA 1UOKA 1NGYB 2BVUA 1K5NB 2P42B 2IADA 1J05A 4YHMH 1A22B 1F42A 3ZTNH 4EK7A 2X09A 2A9NH 3OAZK 4X98B 5IB1B 5KZCB 5A40E 1XYZA 3O9WD 2XG4A 3ULSA 3VFPA 1QG3A 2R23B 2WIIB 2P5WA 4S1DD 4NXKA 3A47A 1PKOA 3WY2A 1ECEA 2HJLB 2AK4B 2YZ1A 2BZDA 1PZ5B 1V6VA 1NWRA 3WMBA 5TDOB 2JB5L 2V5YA 4LCCC 3WIIH 4OKVA 1HHJB 3OBAA 1H15B 3FRPG 3IDNB 5EU7C 3MNWB 1Y6KR 3RGHA 2FWOB 4WGVB 4AMWA 1IC7L 2D9QB 2YPLA 3IS0X 2VC2L 3QCVH 1J0HA 4KRUA 4R8WH 1DP0A 1XGYL 4NQSB 4XPBL 5E56A 3CFBB 2ZX9A 5E08H 4XNXL 1TFVA 3GI8H 1TQBB 3UR8A 4DCQA 4LVHC 1RJLB 2GDUA 1U8PB 1E1EA 1EEUA 4NCDA 3SCTA 1N7MH 1X5IA 1UB5B 1XIWA 4JJ5B 2E9MA 3VIIA 1IKNA 3Q6GH 3AXHA 4IISA 5KBNC 3BD5A 1YMHA 1RZJC 4ETQA 2J8HA 2WCGA 1NOUA 1D6EA 2ZUUA 3RDTC 4JY6A 1I7UB 4WJ5A 5HPCA 5GISL 2PF0A 3QPXH 3UJIH 3HC4L 5CP7B 3S36L 4GUPB 5FDWB 4LSUL 4WCYL 1QR4A 1YEDB 4JRYB 5AZEH 3T3PF 5HYFA 4E2OA 4ZSOB 4IOFD 3TA9A 5D1XB 5ICYA 3HAEA 1RHFA 1AHWA 3VIKA 1Y6NR 1T03L 2P43B 4HF5H 4KJPC 1Z0NA 5MHSD 5D7SL 1QBLL 4V1DA 3FHQA 2ESCA 1BF2A 5IW3A 4FLOA 3F6IA 5EH1A 1FYHB 4Y2DA 5I18H 3MLRH 3R8QA 3W24A 5L7XL 3HG1A 1BVKB 5I19L 4NO2B 1XGTB 2BDNL 2R56H 1JHKL 1XC6A 2PO6D 3DYPA 1NUFA 1VACB 1DBKL 5D7IF 1EO7A 3BUYB 4P4KC 5L2JB 3WEXB 1CT8A 3PZGA 1A4KA 2PW2A 2WUBH 1SEBA 3QH3A 4ORGA 2EDEA 2Z9TA 3KPOA 3AI0A 1W72B 2DDQL 4PJXB 2CMRH 4L3CA 5LAXB 2AJYL 4I1NB 2ICEB 5IFHH 3V8CA 5LXGH 5CJQH 1V3IA 2MQ0A 1ZT7A 3FB8A 1K8IA 1JNLL 3PTKA 1IILE 2EO7A 2C0HA 3KPMA 2J7BA 5EA0L 3QI9A 4I9WD 1HHGA 3VGHA 3KPLB 4OM1L 4M82A 1V03A 4HGMA 2BNRD 1FL6A 2BVPB 3NTCH 2HWZH 4CVUA 2HJKA 5ID1A 4YFLI 4EJ1C 3WDHA 2CIIB 2XWBB 4U6YB 1ODAA 4K2UL 1AY1H 5BQ7A 3W0WE 1YEJH 3CX5K 3O9WA 3DUHA 5KSUA 2V2WB 2XWJB 3CVHA 1F6AA 4OIIH 3ZE2E 5DURD 3AS3A 4KI5C 4H88L 5EULV 4QAWA 1MFEH 1FH5L 2DOCA 3BPCA 4H25B 2ADJB 3BZ4A 1ZHKB 1RUQH 1A3RL 4EZMA 5I66B 4NC2B 2WK2A 1F5WA 1JBJA 4PJEF 1CU4L 5TQ2L 3O2WH 4QLKA 1A7OL 2FGWL 5E8EB 1KLGB 3WNOA 1S78D 5JOPE 3QUZC 5CJOH 2GUOB 3P9WB 3OPZL 3EFFA 2ZOKB 3WUWG 1XIWC 1E4XL 4W5UA 3VWKD 1WFUA 1IKNC 1XH2A 1T20B 3AHTA 1TVBB 4PPTA 1SBSH 2CDFB 3C60B 4PJ5E 3F12B 5HYQA 4O9HH 1AGBA 4M3KB 1C12B 4LMQI 4PGCB 5D2LE 3O11B 3TT3H 1RPQA 2X10A 1FC2D 2Z31A 4RGOH 2DQTL 4AEHL 3LKSA 1KPVB 3FB6A 4GZIA 1Q9KB 3WUZA 5GRZA 2GTWB 3N1AA 1WZ1L 1AHWC 5FUCC 4X6CE 3SDXA 4KI1A 4JO3L 1R3KA 4E41D 1BGGA 4OQTA 2ZUVA 1V3MA 4Y2DC 4MAYD 4X6DE 4K23L 4E0RA 3R8BB 5ADOL 2XN9E 4MDJA 3TVMA 1UWQA 2JB5H 5DVKA 3PF2A 5J12B 1FG9C 4L8DB 1PBYA 2H26A 2JF1A 3GXNA 2CRIA 1TZ7A 2YD9A 4PRID 4YO0B 5LJYH 5I17A 3PZNA 2X4SB 1CFBA 2A77L 2PO6A 1ZBVA 2GJRA 4XPBH 1XGYH 4PD4J 3L3OA 1DEEA 4NKOB 1UWEL 4EI6B 1FZKA 4H7VA 4GQPH 1E70M 4K94L 4YBQD 2FX7L 3VFRB 4U2YA 1H5VA 3QI9C 1R3JB 3SGKA 3DIFB 2WLZA 2NY2D 5T1KB 3BPOB 3CMJA 4R0LA 4KK6C 5EU3B 3DVNA 2PYEB 2GY7B 3SKNA 2QF8A 4ZQKB 5GISH 3HC4H 1NPUA 2XZCH 4LSUH 2QPUA 2X1OA 4WCYH 4Z7WF 3TM6A 3SGEI 1JP5A 5HBFA 4Z2HA 5C0NC 3MBXL 5CJ8A 2X9XA 2BNRA 4HV8B 5JUEL 4DZBA 3CSPA 1YYML 4KU1A 5HSFA 1PZ3A 4Q7NA 1J8HB 1YC7A 3O9WC 3RWCA 5TPWL 3G6DL 1QBLH 3BMVA 3IXAA 5ESAA 4K3HA 2YKLL 1QI2A 5F9WC 4D6GA 3VG9C 4U6HB 2PI6A 5L7XH 2UZIL 3PGCB 5I19H 2VDOL 1MCFA 2BDNH 3UO1L 1V3JA 2J12B 1U93A 1ZT1A 1KNOA 2CK0L 5INDB 3CDGA 3BVWA 3ZJKA 5DGQA 1DBKH 2W63A 3BVNA 3GSQA 3V2AR 4C59B 2XFRA 2X89D 3AM8A 4F7MA 5FCUH 3RL2B 3VFTB 1OGAE 2DDQH 1WBYB 4ACYA 5EBAA 1ND0B 2AJYH 3HJEA 3RY4A 1AD0A 4LLMB 1ED3A 1TIUA 1KTDB 4AMCA 4ODWA 5FA3B 3B3IB 4FFWC 4IIQB 3BKYL 3MRHA 1ZVSA 1JNLH 3I6GB 2Y24A 4BSVA 3VWKA 1JHTB 2Z31C 5EA0H 4LLQA 4JCMA 4PJCF 3RX7A 2QJDA 4H8HA 3OKOA 1D3CA 3WMCA 1E4NA 1FZJA 4X7DC 4HPYL 1KYOJ 1RZFH 2D31A 5KAQF 4PJGB 4R2GC 5BZWA 1AVAA 4Z7OE 3HE6D 3JTSA 1UJ3B 2HRPL 1LE5A 5F3HB 1WDPA 2PW1B 5IFAL 1MQQA 4ZUTB 1F97A 4K2UH 2COQA 4XB8A 1H3VA 3EOYG 3TVMC 4Z95H 4E41A 5B38A 2DB8A 2EIEA 3GJFA 3U4EA 1RZ8A 3ULVH 1KXQA 2V6HA 4MAYA 3FW6A 4H88H 1YQVL 4L1HA 4F57L 5M7QA 1FH5H 4HKXB 3PDOB 4DTGL 5JW3L 4GRLD 2CJUL 1X44A 2PO6C 1A3RH 2HYMA 3DVGB 3AC0A 4HH8A 1CU4H 5TQ2H 3MOAL 5KVDL 3HNTH 4OI8A 4W7UA 1A7OH 1NKRA 2FGWH 2BRRL 2R2EB 3MRFB 4MMZC 4AMKL 1IGYB 3ZE1E 1L7TL 4YN5A 3IKCB 2NY6D 3EO0A 5D7IB 4GXPA 2OTUB 4LLVA 1MUJB 1WFTA 4IM4A 4YHNB 4K7PL 1E4XH 4OAWB 2VYRE 3I02A 3ZE0F 3MCLL 3SGKC 4YAQA 3IDMA 5HYJD 1L0QA 4R0LC 4MAZA 4ZO9A 2WINB 1DBBL 2OM5A 3ULUD 4O2EB 2FJHA 1M4KA 1HK6A 4RNRB 4OZIF 1H4PA 3PL6C 4AEHH 3IYLW 3ALXA 2DQTH 1C16A 1AQMA 1MAKA 4R4BA 4JFZL 3MUZ1 5DHVA 5ELIA 5C1MB 1WZ1H 2J78A 3PGFL 1E0OB 4UV7L 4JFUA 1IAII 4KKAD 2NXYB 4JO3H 3PJSA 4KXZI 1ODZA 1B88A 1JV5B 4N90E 1QSED 4WNQA 1BG4A 2H3NB 3QIWA 4Y19D 4ZDHB 4K23H 3RUGA 8A3HA 5ADOH 2H1PL 3TNNA 4WW2F 4WU5B 3BISA 2D7QA 4UTAL 1U8MA 1D5BB 4CL7A 3UPAA 3W38A 3I9GL 4PGEA 1N2RA 5TE7L 4F7TA 1GOKA 1X4XA 2DSKA 2B5IB 2WUCL 1B0WA 3DRTA 3KXFB 2GJXB 1ZHBA 2VTFA 1IGJB 3AM8C 5KSAD 5EN2B 4F58H 2JJSA 3U7YL 4ZD3L 1T89A 4MTVA 1NCBL 4M7KL 1UWEH 5C9JA 3EO1A 1S78C 5MEND 3MQIA 4PJEB 4LIQL 3GKWL 4K94H 3SDDB 2DI7A 2Z35A 2FX7H 4HKJA 2DWEA 4FXGB 4HK3N 4M03A 4Y4KD 4GLRI 4AZCB 4RFNC 1U8OA 3RVVD 3VWKC 1CECA 4ZFMA 4O2CB 4PJFA 1MCCA 5J3HC 2X4OA 3S37X 4Z7QE 5C0JB 1OSEA 4UTBH 3PZOA 3E8UL 2L0DA 4P2RB 1NC2B 4N9GA 3UEZA 4PIRF 3L5WB 5K93A 5K9OB 1KBKA 4BH8B 2KKQA 3GJFK 3LXBA 2JFEX 4G8EA 1J87A 3MBXH 1VGEL 2W60A 4LF3A 3RI5F 3SO3C 5C08E 2GJJA 3QFJE 4M62H 3GRWL 3VXUA 2DSVA 4ZO8A 3HE6A 3NZHL 3F58L 1FV1A 2VUOA 4P8UA 5T1MB 5TPWH 3G6DH 2KDGA 1OIMA 2HMIC 2YKLH 3D48R 1UQZA 4MAYC 3TJEL 4MJ6B 1T1XB 2UZIH 2W91A 2EEDA 4JFXB 5DMKB 3GZAA 2VDOH 2CITA 4MCYA 2WMIB 3DVIA 3UO1H 1MHEA 2CK0H 4PRAB 4YUEL 3LXCA 3UYPA 2JJTA 4L3ED 2WMHA 4F9DA 5JUVA 4BZ2L 3BIBX 1D9KD 4XCNB 1Q1JL 4GRLA 4WI7A 1E56A 4WDIA 1KCSL 4XP9L 3VFGL 3AIQA 2DS4A 3HZVB 3RVWC 4KTYA 4HWNA 3FONB 2EKSA 2DLIA 3X13A 3FNDA 5AC4A 3OKKB 4YBQC 4FNLL 5HHMD 1S7TB 4L4OA 1XH3A 1DSFL 5A3HA 4KKLC 4B0MM 3Q5OA 2NY2C 5HYJA 1UD4A 1DLFL 2OL3L 2N7AA 4HPYH 2J74A 5AUMB 2D3LA 3WUBA 3SGDH 3V0W