1J0JA

Crystal structure of neopullulanase e357q complex with maltotetraose
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
588
structure length
588
Chain Sequence
MRKEAIYHRPADNFAYAYDSETLHLRLRTKKDDIDRVELLHGDPYDWQNGAWQFQMMPMRKTGSDELFDYWFAEVKPPYRRLRYGFVLYSGEEKLVYTEKGFYFEVPTDDTAYYFCFPFLHRVDLFEAPDWVKDTVWYQIFPERFANGNPSISPEGSRPWGSEDPTPTSFFGGDLQGIIDHLDYLVDLGITGIYLTPIFRSPSNHKYDTADYFEVDPHFGDKETLKTLIDRCHEKGIRVMLDAVFNHCGYEFAPFQDVWKNGESSKYKDWFHIHEFPLQTEPRPNYDTFAFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHEFWREFRQEVKALKPDVYILGQIWHDAMPWLRGDQFDAVMNYPFTDGVLRFFAKEEISARQFANQMMHVLHSYPNNVNEAAFNLLGSHDTSRILTVCGGDIRKVKLLFLFQLTFTGSPCIYYGDEIGMTGGNDPECRKCMVWDPMQQNKELHQHVKQLIALRKQYRSLRRGEISFLHADDEMNYLIYKKTDGDETVLVIINRSDQKADIPIPLDARGTWLVNLLTGERFAAEAETLCTSLPPYGFVLYAIEHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-dimensional structure and substrate binding of Bacillus stearothermophilus neopullulanase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords neopullulanase
total genus 193
structure length 588
sequence length 588
chains with identical sequence B
ec nomenclature ec 3.2.1.135: Neopullulanase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02903 Alpha-amylase_N Alpha amylase, N-terminal ig-like domain
A PF16657 Malt_amylase_C Maltogenic Amylase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j0jA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1j0jA04
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1j0jA02
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 1j0jA03
3CO4A 2O9RA 3IJSA 1T2JA 2WUCL 1FNLA 1IAOB 5F71A 1CGUA 3O4OB 4PRWA 4Z7QE 2LVEA 5DJXA 5D7JC 2C3WA 3S88H 2P8MA 4S0TD 3OAYH 4KDTA 1I85A 3H9HB 3GO1H 4RE2A 4UIMA 3C2SA 2NR6D 4H20H 5EOTA 2QQKH 1YQVL 3DMMA 3HKFA 3HUJE 3MV9D 3TZVC 2P5WB 5L88L 5CXPA 1RK1A 5IV2B 1I85C 5DEZA 5K9OB 4NGHH 1A7NL 3S5LG 4XVJH 5L2KD 2J8UA 4TSCH 3QCUH 2YL9A 4DGIH 2VXTL 3JV5A 4R0LC 5F70A 2P5ED 2DKMA 4BZ2L 5MHSD 1H9VA 5SV4A 1J7VR 1NC4B 1W1YA 3HFML 3REVA 1DBJH 3OX8A 4PB9L 1UA6L 3KG5A 3AMCA 2BVTA 3VXPB 1OPGH 4OLEA 1U8NA 1ZGLP 3GI9L 3PZVA 2CXKA 4TUJA 1F4WH 3KLDA 2DQFB 5JLZA 1BQCA 1BGAA 1T66C 1C8QA 3SOBH 5TPWH 4L8BA 4P8VA 3K3QA 1SMAA 3MLVL 5LGHL 4Q6IA 3M46A 3PWJA 4HX1A 1IL1B 3O2VL 4BJLA 5I1LA 3N04A 2HFEA 1P84K 4G7YL 2VISA 4GKSB 1BYAA 1R5VA 4Y4HD 4PJ9C 3KLHC 2X4TA 4ZFZB 4YHOH 3DVNA 4KDWA 1QFHA 5DDHA 1FA2A 4NRZA 4HIXL 1M6OB 5IVXF 4YDVA 5EU7C 4DKFH 3R1GL 1CENA 3FB5A 1DWGM 1IGFL 4QY8A 5HHOD 1U8QB 4LSPH 4HIIA 3PZQA 3L5HA 1MCEA 1UH4A 1GONA 3SY0A 2RBLA 2WWKT 4GSDH 4TSBL 2NY4B 3D2UD 1YMMA 3MV8E 5D4QA 5E2JA 5MENA 3EJYD 2EE2A 1A6AB 1TLKA 3QT2A 3WF4A 1P9MA 4OUOA 1G6VK 2EDYA 2FJGB 1SJEA 2VQ1A 3GFUA 4GOSA 4X9HA 5DRXA 2Q7YB 1N3NA 4X99A 5ID0B 3GBLA 5I16B 2DWDB 1TR1A 2ZUQB 1G7IA 2J1KA 3P30H 5A43C 2X1XR 1JIBA 5F7KC 4P5MB 4PJHA 3WV0A 4L4TB 4BFGA 5DTFB 3F7RA 4Y5XC 2J79A 4ZXBB 4PTMA 2X70B 1RMFL 5CCKL 2QLYA 4YUEH 1CE1H 2RGMA 1TZIA 4GKZA 3GJFA 1HEZA 3QUMH 2WKGA 1HHIA 1BQSA 3CVHH 5HHNB 3G5VA 1M1SA 3ZZ1A 4NZUH 3DX7B 3WN5B 5ALCH 2OW6A 2IFGA 5ETUA 2H3NB 4OKVB 5DGQA 4ZMAT 3AREA 3HRPA 1CGSL 2EE3A 1H8SA 4QRPD 5AD0A 1MCBA 2EE9A 2YOCA 4POZD 2MHAB 4G8GD 5IMOB 4YQXH 2VL5B 4ZSOA 4NHCL 3U9UA 4HZAA 1CTNA 2X7LA 3UTTA 1Q6GA 1R24A 2A0LD 1Q9KB 5F1OB 3VE0B 5DMKB 2RAMA 1K6QH 5BO1H 3BGMB 3WH8A 3K80A 2NW2B 2DRUA 4LASL 3S2CA 1MCFA 4H8UA 1PX3A 1JPTH 5CIPH 3EHBD 4Z77A 4JFEA 5E99L 1U95B 4FN0A 2CESA 1T21B 4X4XB 1UM5L 1BQUA 1NCWL 2WZEA 3FB6A 3VFUB 2ZOKB 4ZS6C 2A1WH 1CCZA 1W72B 5A6KA 1HVQA 4LLMA 3TTYA 2GY7B 3KJ6H 3PWPB 3AHXA 2IG2L 1FL5B 2P24B 2HTKD 3OKMB 4LGPB 1VJZA 3MLTB 2Z31B 3GMRB 1EO8L 4XI5D 4PJGF 3HS0B 2R0KH 3WQ4A 2X4OA 5E94A 1KIUA 5IFHL 2HG5A 1QR4A 4BQ6A 3TV3H 5ILTH 4N8CL 3QUYA 3MRJB 4M43L 4NQCB 2BXYA 3HFMH 3T0AA 3RIAK 2XVGA 3BIKA 4RMVA 1PS3A 3BDYL 4OZFH 4LOUC 2CDEA 1G0YR 3O3BA 1L7IL 4R2GC 1JV5A 1QZ1A 2R4SH 1N7MH 2L4OA 4U0RB 4CMHC 5CPSA 1MWAA 1QFUL 4L9LB 1JF1A 3MFGB 3VXSB 1EVUA 4PJCE 3WENA 2DDQL 3ZE1E 4GAFB 4EN3B 3MKKA 4IMLB 2F9BT 3KL3A 4N8CH 3PZNA 5F1NA 3IJ7A 1JPGA 2DF3A 3EMQA 3MBXL 3TA9A 3VCLA 4I0KA 1F58L 1AGDB 4PP1C 2J7DA 2VAAB 3O9WA 1EUUA 1R3JB 2CK0H 4HJJH 5DR5H 2OTUB 2ZG3A 4EI5D 1CD0A 3L9RA 5DJ0B 1UXSA 1AGFA 5K9JH 5CGTA 4TVPE 5EOTB 1E6RA 5I8KL 8A3HA 5HYSB 4NQUA 3LN5A 1UYWH 2VRAA 4OLZH 3BLKA 2VQUA 1BPVA 4XAKE 3PWLA 4UQDA 4PRBA 3HPLB 4GO6B 1ZT4A 1NWTA 3TVMB 1QSFB 2HFGH 2X1PA 1QA9B 1GGYA 1A6UH 1WCGA 3O6ML 3B9DA 3BOVA 4K8RD 1PBGA 1OGAB 4JRXE 3BUYB 1ZA3B 4G6JH 1F4XH 3N13A 2DIAA 4OZGE 3SE4A 3B3IA 3LKSA 3CIVA 3FONA 1BGXL 43CAB 4DZBA 2UY6A 4RFOH 5AZEH 4QCIB 2L7UA 4P5TA 5FGBA 5IEKB 3RVWD 1YEFH 3CIQA 3AVEA 5AZ2L 2HVJB 1IAKA 3KPSE 4H7VA 2RGSA 3S6CA 5I1LB 4WKFA 2J5LB 3KPNA 4EBQH 4IPLA 3JVGA 5IR1A 3V8OA 1TDQA 2F53A 3BD3A 3IDNB 1AD0B 1YN7A 3I9GL 2VZOA 3BVWA 4W4OA 3QEUA 1FVCB 2RR3A 3VGHA 3GXPA 3WN6A 2ZKHH 3VKKA 3GJEB 4YAQA 3F5KA 4J3XA 3MX0A 3H9SD 4PCTA 3MRLB 5IFJA 1ZKAA 3VVGA 2B8OT 5E6YA 5I2IA 1KOAA 5F1IB 4LKXB 3OJMB 2BDNH 3TO4C 2V2TB 4E0RA 4LEXH 3IJ9A 3OR6A 2OI9B 1XSIA 3VXSD 4FQXB 3BLBA 3EJZD 1E6ZA 1YJDC 4KI5E 5BRZD 3WBAA 3MGAA 1HKMA 1FZJA 3O6FB 4XHJC 5FKAA 3HCVB 4GO9A 3L6FB 2Z91B 3HRZA 1G7IB 4Y2DC 5DTFA 3DTXA 1DP0A 1UCBH 2CJUL 5I1KH 5DD0H 5D9OA 3FKUS 4KRPD 3SKMA 4HDIB 3QDJE 4G43A 3WIJA 1JN6A 1G7MB 5BYWA 1CZ8H 2IQ9H 1C8PA 1HKLL 4HIHB 5EPMB 4CD8A 3ZT5A 1JWUB 3CDFA 2FIKB 3OLIA 2QF8A 4G6AD 4NN6B 2IQAA 1JZ4A 3CLEL 3O11B 2WVTA 2OSLB 5J3HD 4XHQA 2VJXA 3UYRH 4GI8A 1D5MB 3VFTB 3RA7H 3FZUC 2NMSA 3O8XB 4P4KA 1CE6B 3DX0A 2VDOH 2VLLA 1HXYA 1MLCA 2Z93A 2IWGA 4FTVB 1HKLH 5IFTA 2V5MA 3MFFB 3QDJB 5CUSL 3SE3A 3RDKA 2HKHL 3V0VB 3CMGA 3V5HB 2XFRA 2B31A 3X12A 1DLFL 3SDDA 1ZLUK 3RWDA 3MRHA 5E9DE 4M5YH 1AO7E 4Z7WA 2XKSA 4QCEA 3ME0A 4ODSL 3CMJA 4JAWA 4TVSa 2GSIA 3LV3B 4MJ4A 2X1OA 2LVCA 1CDYA 2ATPA 2NXZD 4X4MA 2AAAA 1FORL 4MD4B 3WXWL 5L2JA 4ODBD 3HNSL 2UZXB 1DLHB 4GG8B 5IHLB 1MHHA 3GI8L 4X6BB 2ZUTA 5K9JL 4MCZA 1GZPB 5BXFB 4FA8A 4R3SA 3K8KA 3MRMA 3G6JE 4UNUA 4IOIB 3SQOH 3AC0A 1FHDA 3OGOE 4JDTH 1F4YL 3WH7A 3OIHA 4M1CC 4HOZA 4UINH 2W62A 5DJXB 2WIIB 3QUZB 3TO4B 2EPLX 3CUIA 1J1XH 1GOMA 2Y36H 2D23A 3QNYB 4PGEA 2AERT 1RHFA 4D9LH 1D9KA 2FWOB 1AQDB 3MOAH 4K71B 3MODH 1IC7L 5FGSA 1PSKH 1NAMB 2Y7QB 4TVUA 2CQVA 1AQ0A 4AMKH 4PR5B 3BKYH 4L3EE 5HGDA 4LLQA 2P5WD 4JZ5A 4YUEL 4PRHE 1CE1L 1G7LA 1MFDL 3BC9A 3GIZL 3MMWA 2G3MA 3EO9L 1C08A 3BE1L 1U9KA 1HQRA 1K5NA 1MI5B 5HDRA 1QKZH 1QSFE 3MGOB 4F2MB 1AGDA 3V4PL 3OLEA 4EUPH 4M5ZL 1QYGH 5SWSB 3FY1A 5CBAB 3Q6FB 1R3IL 3HC0B 3SDCA 3FT3A 5DO2C 3N50A 2E3ZA 3L9RB 5DJ0A 1ORSA 1PKQB 3P4LA 4OZGB 1BEYL 4L8BB 2KL6A 4B3LA 2PN5A 2IADB 2APXA 5E2UL 2X4SB 1NEZG 3PABB 1PIGA 3QP3A 3HNVH 4X5XB 5ICXA 4YJZL 5ISZB 3K81A 2GJ6E 2G75B 3A6BH 3U1SH 3S88L 3WY1A 5D72L 1FDLH 2CNCA 1YPZF 2J7EA 1S9XB 1ZT4B 2NY4C 3OKOB 4KHXL 4J28A 4URIA 5CEYB 4LASH 3QPQC 5BCAA 1OAUL 3ARVA 4FQHA 3WUZA 4OCSH 2D22A 2LTQC 2OR9L 3HC3H 1MFBH 3MRNB 3SCMB 3FHQA 4JL2A 4DWSB 5E08H 1H0IA 1H5BB 2JB6A 2WBKA 3IFPB 4JM4H 4AM0A 4ZNCD 4PRHA 1ZA3A 1YJDH 3P77B 3B3IB 5TFSL 3T3MF 3THMH 3O3EA 3X3FH 1A7QH 3DI2B 1XSKA 1MJ7L 4M24A 2DS4A 3G6JB 4NQED 1A9BB 5LAXA 2MWCA 3WJLC 4LU5L 4JZJB 4F7TB 5HPMB 4UQAA 1N5YH 1IGTA 4P4KD 4XCNB 4YXHH 1OWWA 5DRXB 4RA3A 4XXDB 1ADQH 1Q72H 1BLIA 3SIMA 3ZR6A 2NR6C 5TFSH 2IH1B 3VRIB 1EAJA 3BLPX 4LNRA 3LQAC 3CLEH 2W1NA 2J62A 5K9QG 2YXMA 5IKCA 2EPKX 5D6DC 5I1HL 3CDGA 3OPZH 3WN5C 1KLGA 2ED7A 4GW5B 2WMIA 3O2VH 1XH0A 5A6LA 1FP8A 5J89A 4N0UA 3TO2A 2OL3B 2FEEI 5HDBF 3RWCB 3STBA 3NACH 4HQQH 1VFMA 2FATH 5DZLA 4JO2L 5ANME 5JDSA 2JJSC 3TWCL 5CSUA 4Y4KB 3HE6C 5C92A 4G9FD 3VFWA 4M5YL 2I07B 3O6FA 5MI0C 2D0GA 2UUDH 3PGCB 3O4OC 5F9WC 3L4YA 1QVOB 2K3TA 4XCCH 3PF2A 2ZUYA 5E0QA 5E1AB 3BPNB 4GKNA 3VWKB 2G41A 2RCSL 1SMDA 3EO1B 1R24B 1UJ3A 3VUPA 1FZOB 2VXVH 3GXMA 3MRIB 3H9SE 3H9SA 1I1XA 2PETA 3G6DL 4QHUA 3IKKA 2ZXBA 1LNUB 4UMGA 4U3AA 5E03A 3BO8B 2DLTA 2V7HB 1AFVH 1KELH 2B0SL 4RMQA 4AMWA 1KGCE 1KIQB 1RIHH 1R34A 5EU6B 1OCWH 2R0ZH 1HX0A 2LE9A 2NXYC 3RWGB 4U6TA 1TQBB 1OTUC 2WMGA 1J1OL 3QIWC 4TXEA 4P46C 5F9OH 4GUPB 2OZ4A 4DWSC 5TDNA 3QDJA 5FGRA 2AJUH 5ANMA 3U9PL 1ZHNA 1KELL 2B0SH 1QVBA 2V2WA 2H2SD 5D2LA 4CRPA 5DMJB 5C09B 3VINA 1YNLL 4YLQT 4JFEE 4EBQL 5GRZA 5HXMA 3EO9H 4LPXA 5EBAA 5JA8B 1K2DB 3X17A 4HEPG 4QRUB 3ALXA 3S37X 5HDLA 3U30C 3ULVF 3O3BB 4WFHD 5D1QB 1MHHB 4QYOA 4BH7A 3GM0A 5BXFA 2R69L 3BKJL 5ITFB 3SURA 4QO1A 4BK5A 1I9JL 2JELH 4M8VA 1BAGA 2NPLX 2W0FB 1JPGB 3QEHB 5EC1A 3B5GA 1TQCB 2A77L 1QBBA 4W6WB 3QNXA 5T1MA 4QHNA 4NFBA 1CD1A 3LEVL 3GSOA 3MNVB 4IDLA 5EOCL 2P1YA 1VERA 3G08A 1GC1H 3BI9X 2Y4SA 5JOPE 1V03A 3DHUA 4G6KL 3UXFA 3QOKA 2KPNA 3OJDA 1JNHB 2P46B 3HMXA 1CU4L 5CHNB 5T5NF 3CC5A 4U6YA 5E08L 1JXKA 1BZ7A 2A6JB 4H0HB 4NKMB 4WDIB 5AUMB 5CAYB 3KYAA 3BZFA 5T1DH 4JRXA 4RGOL 4JRWA 1FLRH 1KJMB 1NSNH 1MJ7H 4NQDA 4DWHA 2J7CA 1NUDA 1U8PA 3BPOC 5I16A 4P7RA 1CU4H 5FKPA 4BM7A 3THCA 2X9YA 5TE7H 4N0FB 1SJHB 4NSBA 3WBEA 2VXQL 2Y6SD 1P6WA 5TD4A 2CR6A 5GSVB 1RZ7L 3QWOB 4LQFL 4OM0L 2W07A 4XNQB 3CX5K 1U93A 2WMPA 4HMEA 2IXUA 1QFUH 4RX4D 2YL6A 1TZHA 2DDQH 2B4CL 5ICYB 1C16B 4F7EA 3OGRA 5EIQA 2BSED 1RUQL 4N1CA 4Z7VF 5CUSH 2PTVA 4L8CA 4GBXC 3OGVA 5IVXB 1FYHB 1F4WL 3U0WH 2ZWLT 4OKVA 1EQCA 1S7XB 4LYPA 1KT2A 3RGVB 1RK0B 5DT1L 1HDMB 1XAUA 5IMLA 3KPPA 4OOUA 3SCMA 1RUQH 4MA1B 2JJSA 2X7LB 3UTTB 1WP6A 1I9IH 1BJ8A 2C5DC 3K1KC 2CKBA 1YPZB 3U82B 1QSEB 4JPIA 2Y8KA 3WMCA 4TVCA 4OJYA 2ZCKH 5I1IH 4JLRB 2GIYA 4KPHH 1IGYB 3GMMA 3RY5A 2GSJA 2A2QT 4Q6YA 4NUJA 5EBWB 3TPKA 4FTVD 1INDH 2NY6B 4HC1A 5F6HJ 2R8SH 3IDXL 3FNDA 1MY7A 2CLRB 1R5WB 3VIOA 5HI3C 1IJ9A 4KDVA 4PEEA 4G6JL 3CFBB 3ULUF 4GRWB 5A2AA 1F6AB 1JK8A 5C0RH 5GGSB 3EHBC 1MH5A 5JIIA 4OGAC 4DKEL 1OCWL 1SEBB 3MOBH 5E6ID 4GRWH 1I1FB 3MNWA 2Y07H 5DC4B 1Y7VA 2DJUA 4MQ7A 3RZWA 5J1AB 3BGFB 5DUML 4XB3A 4Z5RB 3FW6A 2R0WL 1R8LA 3ULVL 4R26L 1BOGA 4ZUTA 2ZUXA 3ZDYE 2ICWI 3O11A 4MJIE 4EUPG 4DKEH 3A67L 4FXGA 1XIWD 5JIHA 5J6GA 1RH9A 1D5MA 3VFTA 4HTYA 2SEBB 3BX7C 1IAII 2XN1A 2D3VA 4V2BA 2DM3A 3B5TA 5DVMA 3QXUA 2XXCB 3MMEA 5KS9F 4TULH 3VFGL 3MLYH 3I6GA 3P0GB 1UM6L 3HN3A 2R2HA 2H32H 2UY2A 4PN2A 3VNYA 3VJ6A 3IAQA 3KYKL 4OQTH 3ZDZF 2J5LC 5DD5H 3CZJA 2WIMA 1D5BB 2NY5C 2ARWA 4NT6B 3ZE1F 5C2BL 3N9GH 4PJEE 4HJ0C 4PJFB 4ODTH 1ZA6A 5HDBE 4JCLA 2H6PB 2YL8A 4W8AA 4U1GB 1NC2B 3BP5A 1MFBL 5EOCJ 2VIRB 2QQNL 2AJVL 1TUXA 4PYGA 2OTPA 2YD5A 1UWRA 2XZCH 1GXEA 4NSKB 3X3FL 2FO4A 3D69A 1XR8A 4U7KA 1VKXB 1WWBX 3UETA 3VWJB 5A6JA 4ZD3H 1NARA 4WHYH 4LU5H 5B3JF 2NY6D 1HJWA 4TNWF 4MAZA 2PTTA 3GKWH 4JVUA 5EZIH 4PJFE 1ZS2A 4HXAL 4PMDA 2GT9A 5FOJA 4NBXB 3PXJA 1E27B 1ISZA 2VH5H 3L7EA 1F3DJ 5GISH 5C0NC 3U4EB 3GH4A 2D31A 4Y2DB 5C71A 4J3OC 1MUJA 3CPLB 3VFOB 4JZOB 3W39B 4QCIA 4ZD3L 5L2KA 1T83C 4W70A 2FGLA 1ED3B 1YMME 1XZ0A 4X7SL 4Z78B 4LVHC 4LLQB 4NP4H 1CZ1A 4BQCA 3T0DA 2J78A 3W28A 2XXMB 4XCEB 1AR1D 5FUOL 3FHAA 3L5WA 3LXBA 4NZTH 3VDCA 3II1A 4C56D 2E7LA 3EOBB 1S9VA 4S1DD 3WIFB 1T1YB 2A6KA 4HQQL 4MLIA 3T0VA 3FFCA 1OW0C 2ZX6A 4LMQE 5BZWB 1UR8A 1N4XH 5C0GA 1L7IH 5E9DB 3GI8H 5E1HB 4DEPB 1IAOA 1MEXH 2EICA 1W1TA 3ZYJA 3PHAA 1UKPA 3IJ8A 5F1IA 3AMGA 2EZ0D 4I2XB 1LP9B 1XCQB 5C07D 2Q8AL 3C6LC 2FYVA 2V2TA 4AZCB 1BMGA 4X5XA 3D85B 3STZA 2G75A 4YWGL 3MUGB 1N4XL 5FKYA 1NUFA 4P9MH 4TOYL 4S1QH 1YEIL 2YA1A 3Q2CA 1GQLA 5I8KH 2HVMA 1UG9A 4FS0A 5F3BA 1JCKA 4M80A 3W25A 4ZO6A 1UA7A 3IFNH 2BMKB 1U42A 3QFDB 2JFEX 2XFXB 4WHTB 3ARDA 2HFGL 5LAXB 3GM8A 3AB0B 1AXTL 1T1ZA 4MNKA 4QRRA 2OYMA 3HI1A 4WTZA 3VXPA 3NSNA 4X6CF 4UV7L 5I1JL 1EGJH 2YSSB 1G9MC 1RZGB 4RQQA 4U1MB 4FQ1L 3VFPA 5HHQA 3VFVA 1OP5H 3VX1A 3WNPA 4HG4J 5GS2D 2VC2L 3T0XA 1MFVA 1W8NA 5T1KB 1N6QH 5HGGS 5I30H 2ESVB 1C5BH 1I7RA 3O41B 1A14L 2DQCH 2H2PD 3WNOA 4ZXLA 5FYKE 5KEZA 3QIBA 4I18A 1RJLB 2EDNA 2CKBH 2YXFA 5IROC 4KVNL 2A6DB 3TCLA 3VWKC 5KS9A 1M7DB 3QUKB 1Q1JL 1OAUH 2QEJA 5HVGB 2F54A 2JELL 2PR4L 1OWQA 5E70A 2GI7A 3W2DL 1QI3A 3LRSA 7CGTA 4MJIB 1MCNA 4FQCL 3SJVA 5L2JB 4MLSA 4HP5A 3VILA 4GG8A 4WTXA 5DO8A 3QUZC 3T0BA 1V6VA 2HT3D 3OJ2C 4IDJH 1HCFX 4U31A 4UQ3A 1S7VA 1U6AL 2PXYB 1S7TB 2GCYB 3VGEA 4LIQE 5GRVK 3AIEA 1DR9A 4QHUB 1US3A 4W89A 3C6LB 4GRMB 2YPLD 2CMRL 2D7TH 2V3EA 4HOWA 2BNRB 4B7LA 1JHTA 3TOPA 1NH6A 3RWFA 5E2VH 5FUZL 4ACPA 4PJ7B 5I1HH 2C4FT 1F6FB 4PJEB 1RIUH 2WMHA 4D9RE 4YDKH 2R2BA 1ZVHA 1LO5B 3DLQR 5HTSA 3KPLB 5CIPB 5HHNA 1OARL 2UWEB 2HVKB 4RIRA 1IEHA 1F00I 1HILA 3AIUA 1H15A 4NJ9H 5D2LB 1WE5A 1MFEH 3VDAA 3QSKB 4ZPVA 1PGRB 2JF6A 1U3JA 3ARBA 3SO3C 1K5NB 3U30B 1UZ1A 3IDGB 2YA0A 4ODUA 1HJQA 3HAEA 2VKXA 4JFZL 1XF5A 1RZJH 5FHBH 4AYSA 5IVXE 1HYSC 1UACL 2HKHH 2WVUA 4MJID 3VIKA 5DC9B 2FZ3A 3BGMA 1F3JB 2WM0A 4O4YL 3OKLA 1N59B 2HA1A 1BD2B 2Y2WA 2V9QA 4F57H 4JN1L 5A95A 1GSMA 1K4CA 4YHIB 3D0VA 2DB8A 3QUMB 3LKPA 5D96B 1IGIL 1A6TB 1H5BC 1W0WB 2IAND 4OT1H 5I73B 1FVDA 4P5KB 4JR9H 3B8YA 4PRPE 3MXWL 4ATLA 1YYML 4QOKD 1YMHB 4N1HB 4XPHH 3DO3A 1GGUA 5CG0A 3A6CH 3HI6H 1A22B 5EFIB 2DLGA 2PTTB 2NSXA 1GZQA 1H5BA 2JB6B 2AK4D 4P4RB 1FHLA 3LKOB 1HL8A 5LJYH 3OB0K 4YIQB 3QRGL 5IM7B 1QHOA 4WW2C 1U33A 3TF7C 3QNZB 4JDZA 3WF2A 3FTGB 3KL0A 2OWCA 2BNUA 2VDKL 1T0PB 3VWJD 4JFOB 4LSSH 4Y5VB 1DBAH 4JFYA 4PJBF 3G6JF 1AXSA 3UAJD 3ZE2F 2CHNA 4XX1G 5KVGH 5F9WB 4Y1AD 3U0TB 4JQIH 3U83A 3VGBA 4OLXL 3S5LA 4F8XA 1J0HA 4HJ0D 2X2YA 4P2OA 4TOQA 5D4YA 1BHGA 3A67H 1FPTL 4OZ4B 43C9B 5IHBA 3CHEA 3IT8D 3EDKA 4XNQA 1KEGL 4AENA 1E0OB 1JXJA 3AY4C 3C09B 2H8PB 3WJJA 4HV8B 3RGVC 3TVMD 2EIDA 1WQVT 4CU6A 1K9FA 5FYLL 4UV4L 1OM3H 3T2NH 1S7RB 2ITCB 2C1OA 4O9HH 4EK7A 1OGTA 1HWHB 4AH2B 1QRKA 4HKZA 1N64L 4LL9A 2W65A 4P2OD 5CGMA 3K1DA 4PTWA 1MVFA 3MU7A 1E4WH 3QIWB 1YECH 4XP4L 3ETBF 5HYSA 5JIKA 4C56E 2XYCA 5M94B 1LF1A 2CBIA 2XVNA 1Q0XL 2PBGA 3WNKA 3PZOA 3ULUL 4WCYL 4J4PD 4PJXA 3BH9B 5C0CA 3UG4A 1UB6B 3QH3A 2FSEB 1T89C 3TJHC 1FV1B 3EAKA 5E0FA 3KJ6L 4M9PA 4XMLH 4OCRH 1I8MA 1X4XA 2Y8VA 2EYTB 4PJAB 3OQ3B 1ZSDA 2WWKO 3O81A 3SKJH 1W72H 4DAGL 5LVEA 3U7WH 2CJUH 1Y18B 1XGQB 2QSTA 3FQTB 2GJZB 4PJGA 3IS1X 5HHQB 5JUVA 3OGCB 4R97C 2F7QA 3JUYA 4U0QB 4QOKA 4ZUVB 1UYQA 2E9WA 2XRAL 2IANA 1N5YL 3GHBH 1W3JA 3P4NA 3MV8B 1I7RB 3BDYH 3RVUD 2CIIB 3RVTD 1NQ6A 1V0LA 5IOPA 3WLWD 4Y7EA 1OARH 4BK4A 2XWBA 4M7JH 2AXJA 3TFKD 1M04A 3UTOA 5BRPA 4C58B 2O26U 4HD9A 5GNYA 1MW0A 1JJUA 5D6CB 3T4YB 2YUWA 3JTTA 2JF1A 3LRSB 2F74A 4IRJA 5FYLE 5CLTA 2EAEA 4X8XA 5C09E 1OD8A 3BJ91 3U48A 2KUTA 1UA3A 1W9DM 4FFYL 2V6HA 1UACH 3C60D 5CEZL 4WRLA 1LGVA 1FZJB 4WW2F 1GJIA 1CGVA 2WBWB 3EOAA 5T1MB 1BFVL 2ENSA 4CN1A 3LSOB 4GXVL 1V3KA 4G5ZH 3C6SB 3CFEB 1UQZA 5GGUA 4HUWA 1I3GH 4FFYH 3RWFB 5F7DA 5EG6C 2GUYA 5C0IB 4UUJB 1QRND 1RZIB 1ONQB 1KTLB 3SE8H 1T0MB 4X8JA 2A9MH 2APFA 3T3PF 3BVVA 3OAYK 4UINL 2E9MA 1I1YA 3IETB 1OVZA 1AD9B 1PFCA 4OGYL 2Q87A 2K7PA 3ULVH 3BPCA 3BDBA 5CMAA 4QT5A 1M4KA 4GXUM 1DEDA 3SBWA 4CKQA 2BSRB 4UTAL 1SJHA 3PWVA 1J1OH 5I1JH 5F9OL 2JJVA 5F6HI 2F54D 3G5ZB 2YKLL 2VC2H 4NKDA 4HIJB 3GIZH 4ZXBC 2QR0B 4YHZL 1WO2A 4XP1H 4L3CA 5C9KA 4GAJH 5IMMB 4D9RD 3F6IA 2GJRA 5I8CA 1DVFC 3K7UA 4PRPA 1CDGA 1FRGL 3KYNB 1IQDA 1WDRA 2AAVA 5FO9B 3BEVB 5DHVA 5C2BH 4Z2JA 5BXRA 3MGTA 1I7UA 1X4ZA 2BDNL 5HJ3A 4EDXA 1U91B 4XXCA 1HDMA 1Z5LB 1H4PA 1P69B 2CCRA 4MNLA 1N82A 4M4RA 1AXIB 5GPRA 5CILH 3L3DB 4LPCA 1Q94B 3QQ9C 3WSUA 1MAKA 2QQNH 4MXQC 3WO3B 4NFCA 4XXCC 1BX2B 1B3ZA 5F21B 2JALA 3O0RL 3UROR 3OWEA 2ZSWB 4HS8H 4OCMC 1HVXA 3SKUD 4Z8FH 4JFXA 3FTGA 3QXTA 1XH2A 1VFBA 2CLRA 4FHBD 3ZTJH 4WFEE 3AIRA 2X41A 2G3IA 4JM2D 1NUNB 3MJ7A 3CFBA 3UPAA 1UQSA 3OZ9L 3PQYD 2WZIA 4V1DB 4UR9A 3AS3A 4JM2B 3O0RH 3UBXG 5A6SA 1FZKB 4P3CL 1OSZA 1SBSH 4ZS7H 4YXHL 1QRNB 1I1AB 4XGZB 4WHTA 4HBQA 4TUFA 2AK4E 3D0LB 1TNNA 3CVIL 4IRSB 3VFMA 1HQRB 3SDCC 1MW2A 3SEPA 3TT1L 5BMFL 2G9HB 5D8ZA 4P59H 3G5VB 4PJ8B 2ORBH 4UOQA 2F18A 1SFSA 4GBXD 2E7CA 1NFIA 3WFCL 1K4DB 1I9EA 5F7UA 4NRXA 3GSXB 5SV3A 1ETZB 2IH3A 2AOSA 2NX5E 2ADGB 3H2WA 3MRRA 3RDTA 4DM2A 3RKDC 3PABA 2X4PB 5IMOA 3KXFA 3CDCA 3MA7A 5IFPA 1HSBA 3SJVE 4W84A 2Q76B 3ALPA 4Y1AE 1GGCH 2Z4QB 1VFAB 3BCFA 5FM5M 1V3IA 4CCDA 3NPSC 3L3IA 1MCLA 4H5SA 1SM3H 4UDUA 1YEIH 5KS9E 5KS9B 4XWOD 4FQHB 5ECJE 1NANH 1CDBA 3CZNA 5D70L 3OXRB 2YPVL 4GZJA 2OQJA 4KTDL 3WUWB 5BVPH 4HLJA 5CEXB 5F96H 2IC2A 3B8SA 4A6YB 5DFWH 4AMXA 4DGYH 4HUUB 2PF0A 4Z0XA 4WKHA 3DXAE 1T7XA 3A6CL 3HI6L 3AIWA 2NY1D 2VX4A 3L4TA 1T20B 2R2EA 3ZKMC 4AD5A 2JLLA 2UZYB 5I1EL 3ILPB 3BAJA 4I0PA 4KY1H 4MAYD 1S7VB 2PXYA 3BXNA 4HPOL 1QLEH 1BM3L 4KJPD 5KVFH 1UADC 2OL3H 4WU7A 5E5MB 1W1PA 2V5TA 4XPGL 1V3MA 4PYSA 4LHQB 2VLKB 1I7TA 4Y4HB 2JB5H 4KV5F 2TAAA 4I0PC 5INCB 4Y8AA 3LHPH 1KEMH 2MKLC 3H3PL 3IKCA 3QBTB 2MKWA 3DRQA 4NN7B 1NWUA 4ZENA 3OAUL 1J1PH 4AEEA 4DUXA 1KPUB 1C90A 4XP6H 3VMNA 3CZFB 2F1BA 5DUMH 4DCQB 3DUUB 2CKBL 2EYSA 4KDTC 4WFGD 1NLDH 5D7SH 3MA9H 5CJ5A 1VBRA 2DLFL 4YHZH 3DDFA 4BELD 1B0GB 5D7IF 2I07A 3LB6D 1MCRA 1JI1A 5F1NB 3ECBA 3GNRA 3F6LA 4I9WE 1KFWA 4NQSB 3CFIC 3T0WA 5DUPL 2CITA 5BZWA 1CS6A 4XVTL 2BSTA 1XIWA 5B22A 5FGCE 2Z8VC 2YZ1A 4XNZB 5E4EB 4M7KL 2P5WA 5DQ9B 5GRWA 3H7BB 4G6MH 2DLFH 2NZ9D 1FZOA 5GRXG 1TITA 2AQ1A 3LRHA 1RZIA 5JW4M 5DJDA 2Y9RT 3O3AA 2VAJA 4PRIB 4MAUH 1ZBVA 1EFXB 4UT7H 4JFDE 4RNRB 3RWEB 3MUGA 5BQ7B 1WZAA 1T66D 3HPLA 1OAZH 5IF0B 4P5KA 1JGEA 1NEZB 1QA9A 4ISVA 1ND0A 4X6DF 1AGEA 1EO5A 2XI9A 4LCYA 4LRIA 5A16B 4ZSOE 5L88H 2OW7A 2Q8XA 1S5HB 3GI9H 3IDYC 5I1CL 1W9XA 3ES6A 1ADQL 4P7NA 4H26B 4EQ3A 3MUIA 5H35B 4PYHA 5HSFA 1JL8A 3MJ8B 1M7IB 1G9ML 3ESUF 1ZT1B 1UZ6E 3DVFA 5DRNA 1X1NA 2IALA 3EFFB 2HKFH 4NXSA 3ARDB 2AEIT 4OCYH 2D4DA 5JO5A 4XZUB 1WV7T 1NAKH 2D2OA 1QRNE 4PJXF 1E4LA 4W5UA 1HHKA 3STLA 2CIPA 1VENA 3KGRA 1XGPB 4EDWL 5C3TA 4X98A 4UDTB 5FIPA 3SDYH 1RZ7H 4LQFH 4YHOL 1RZJL 1WBYB 4F8QA 5IG7B 2GKIA 4Y16B 4NO5A 1ODZA 5BVJB 5T1KA 3RU8L 2GK1B 4Q7DA 1MW3A 3A0OA 4BCEA 2MJWA 4PJ9B 1DQLH 1V3LA 3IU3B 3QHFL 3UYPA 2FHFA 4S2SA 2X09A 1IGFH 2B4CC 2EE6A 4MHHI 4ZQKB 3U36A 4RRPG 3D3VD 3CUPB 3P0VH 5HHOE 2EEAA 4ALAH 2UY3A 3O6FC 4NWTL 2CLZA 4LSTL 25C8L 3U7BA 5EIIB 2A3AA 1HYSD 4RL3A 1S7RA 1M7DA 4RX4A 2NY3D 1N3NB 3QQ3A 2BNQB 4AIZB 2VXVL 1MPAL 1JHLL 2DKSA 4U6HB 4U1KB 8FABB 5INDB 1HNYA 1S8DA 3CXHK 1JZ5A 2QQLL 4YXKL 2F2HA 1PQZB 1SR0A 2YLAA 1I7ZB 2P45B 2OM5A 1X5LA 3WFLA 3P30L 2VZUA 4WO4C 2RFXA 5I1IL 3FRPG 1CBGA 3HE7B 2X70A 3NFPA 1I3GL 4XCYB 1IC4L 4WDIA 3DROA 1CLVA 2G8ZA 2IBGA 4JRXB 1ITXA 4H8WL 1INEH 4F15B 4FQQA 5CEZD 5CD5D 2QPUA 2X9WA 3IGAB 5HY9B 2V5RA 2E7MA 5I1EH 1WNOA 2IAMB 5IBUB 4KY1L 2IGFH 4NO0A 3ZJ8A 1QLEL 4PLJC 3VW3H 4YNYB 1XF2A 1HINL 5GXBB 4PUBH 1IGMH 4NPYA 3VXQA 3CAFA 3X11B 1RP9A 1V3JA 3LRKA 1MWAH 4MDPA 1W9VA 1G9NH 1GW1A 2Z8RA 3TTOA 4K71C 3RVVD 5FYLH 1G9HA 4XV0A 3OHXB 2IGFL 4DN4L 2D73A 4X7DC 1MJUL 2Z4QA 4XC1L 3OAZK 4Z7OE 5C0FB 1OQOA 1TVPA 3D50A 4PJ5A 5CSGA 1P4BH 2R1XB 1NGXB 5I18L 3QHOA 4FG6D 3WS3B 1DBKH 1T22B 4PJIF 4BKLA 4J3UA 4TVPL 1A6PA 2FBJH 2PBOA 2CKBB 2FGWH 2OXGA 4MAVA 4U1JA 1J5OL 2APWA 3BGAA 1PZ2A 1BZ9B 3WQ5A 4UT9L 1ZVSA 1R0AH 1GOHA 1QR1A 3OKMA 5M3WA 3PIQB 2J3SA 4X9GA 1KJ2H 4JKWA 4UBDC 3G6AB 4XPAL 4UAOB 3S34H 1QW9A 4HS3B 4OBRA 4NZRL 3D39D 2PR4H 1Q4NX 3CLWA 4TVPH 1P9MC 5I9QB 1UFUA 1NWRA 3IXTA 1VADB 3IGUA 5JBFA 1HSAA 1VFFA 2YC1A 4HUVA 5GGSA 1WCBB 3NZ8B 5ILTL 3TV3L 1IGCH 1BFSA 5F7NC 3QCTL 6TAAA 3HZVA 3FAXA 4K9EL 1CLCA 5HYJD 2PKDA 1MCQA 1IQWH 3WELA 4CNIB 2OMNA 1CF8L 1S7QB 1NCAL 3VNZA 1CFNB 3O6KL 1T5WA 2NXZC 2E9BA 4TX6A 2EDJA 5F3HA 2EYSB 2NTFB 3ARXA 4UB0H 1VSCA 4NQDE 1NLBH 2X89A 4NDMB 1UWXK 1KFAH 4OCYL 4U0RC 3VCLB 4CMHB 2FLRT 2C26A 4BFEA 1U3HB 3AREB 2Y5TA 1AGCA 3MYZA 3PWVB 2D3NA 1VPOH 5D1QC 1J0ZA 3ARGD 4GKLA 1REIA 4NCDA 1AKJD 1FFQA 1L7TH 2P44B 5BRZB 1JGVL 4JFWA 2WW5A 3RM9A 5HHMD 3V6OC 5FM4A 3SO5A 3V6OE 4F7PB 4G80A 3MJ6A 3IJSB 1RZ8A 2AJ3A 4XMKH 5DMKA 4HH9B 5FHAH 4NJ9L 3NCFB 1XD0A 5KSBB 3W29A 3WKZA 4PGZA 1UWIA 2I60L 2X4SA 1CICB 4X7EC 2ZG2A 5ICXB 1DWAM 1WF5A 4AYGA 4WUUE 4NN5C 3V6ZA 2IPKA 2CK0L 1LO2H 4HKZB 1UR9A 2IBBA 5T3ZD 1U95A 1ZHLA 3ZL4L 2WNWA 5HJ3B 4AL8H 2ZUSA 4R97B 2O61B 4MA3A 2CYGA 1RK1B 3SE8L 4XX1E 5EU3A 2VIRA 3IJYB 1FNEA 1S5HA 1TCRA 4JJHA 3BAIA 3QHMA 1DSFH 2J8UB 2DYPA 2W9EH 1E4NA 2Z92B 3LMJH 3P9LA 2G2RB 2VLMD 1Q9WB 4OV6F 4XNYH 4S1QL 3QI9A 4LLAA 2NY1B 3LPWA 4PMOA 3DC0A 1YEHH 1B31A 3TH3T 3MBEB 5A2KH 5HPOA 5FCUL 1DE4B 5CSZA 1HKKA 5GGRA 3QI9D 1V05A 1RU9L 2YD2A 4G8FA 2AVGA 2IF7A 4HWBA 4MA7H 4HWEH 4GXUN 4X5WB 2R29L 4AZGA 4Y5YB 1OGBA 4PUBL 3SPVA 3H3PH 2P49B 4KTEL 3UTTD 1CQKA 2FBOJ 1T1WA 1IGJA 1AQKH 3JTSA 4UNVA 1PEZA 4HOXA 5JPNB 1N0XH 3WLBB 5DK2A 2AEPH 4PPTA 3L5IA 1ZGLB 4W4NA 2CLZB 4LCWE 1JNDA 3AU1B 1JNJA 5IVOA 3GMOA 3LKQB 3SDCD 1L4IA 1U8JB 2P8PB 1F3DH 3ULVC 3GSXA 1HIZA 3L6FA 5HI5C 4P2RD 5DD5L 2J6EH 4PLNC 5F1SA 3PGCA 4X9IA 4RCAA 1QVOA 5B4MC 4NRRA 1AKJA 4POYA 1QFOA 4IHOB 4OIFA 5I15H 4H04A 5KAQG 4OKDA 2E6JA 4NC1E 3CGTA 1RULL 1MCHA 3L7FB 1CD8A 1SY6L 4YGVA 5FOBA 1O7SA 5DJCA 1IC1A 5C0ND 5KSAC 3MRKA 1D9KC 5ID0A 3LPPA 3D3VE 5DS8A 1BWWA 1TQBC 2AJVH 2RB8A 5DVOA 4MD5B 2X4QB 2XZCL 3C6SA 3HUJB 5GS2H 3WFDL 1FFRA 5GGUB 1BWMA 1PYWB 1WBZB 1MFCH 4HIEB 4FQPA 3O8XA 4PRNB 5DD0L 4LCIL 4KH2A 2ED9A 5CSBA 3VXQB 1T03L 3QXDB 3ZKND 2O5XL 1AQMA 1BBJA 5MEND 5LXGL 4LIQL 4X6FB 4BQ8A 2BCKA 1MHCA 1CFBA 3VSTA 3U46A 2BZDA 4XTRD 1P5UA 5DMIH 4OCRL 3JWOC 4PJBA 1ZHNB 1RPQA 3RBSA 3FQXB 1XYZA 2YSSA 2ORBL 2WHJA 4WW2A 2HLAA 1A0QL 3VFVB 1NCAH 4DZ8B 1NFDF 3R0MA 4RAHA 2W38A 3O6KH 1AIFB 5SX5K 3RUGB 5FM8A 4P2QA 4HA4A 3AXLA 4JY4A 1GOFA 2XNAA 2XG5A 3HZMB 2HJFB 5ENWA 3BPOB 3V0WL 3MC0A 1C91A 1TE1A 4ZFGH 5CINL 5E5UB 1GJUA 1F5WA 1VESA 2MMXA 4R2GD 3TYFB 2EDEA 4F9PA 3V5KB 5B38A 1QNRA 4QRSB 4S11A 2GEEA 1VBUA 2GVYA 4U4BA 4XNZC 1JGUH 1A6WH 2F54B 2IFFL 5DC0A 2VN4A 1CT8A 3V5DA 5BVPL 5IB4A 4R9HA 3NBNA 4F9PC 1HP4A 4D0BB 3WLWC 4IISA 3SJVB 1JZ6A 1R87A 1U91A 3QUXA 3TJEL 3A47A 3OKDB 3BH8A 3OXSA 4JFFD 1JHLH 3MLSH 1HSAB 5C8JB 1V02E 4PLOB 1GOKA 2VRJA 3O6AA 1JGUL 1NBQA 1FL5A 1UVQB 3QWRA 1GOIA 1BVKA 3CXDH 4D1IA 1I8LA 4IRJC 3RNKB 2NYYC 4Y89A 3D18A 2B2XH 5FOOA 3VIMA 5JXEA 1NUGA 2JCCF 1JHKH 5L7XH 1WVZA 4JFXB 3GSRA 3L95B 2NTFA 4LP4A 5F7HA 1KLUB 1W2VA 3QUYB 5C0BD 3TZVD 3TJHD 2YLLA 3WUFA 4ZFFB 4OQ1A 3X14A 4PJIA 4XP6L 5FYJH 4H26A 1A3LL 1BFOA 1IGML 1FNSH 3F7QA 4AXNA 2WP3O 1MI5E 2MSPA 4IMKC 1BEYH 4PJDF 3V5HA 3PBGA 3DHMA 4CD5A 3SDDB 5ISZA 1EERB 2WLZA 1HKIA 3BHBB 1E1EA 5DJYB 1XC6A 3IF1A 4KTEH 5E95B 5BJTB 4L29A 2D7NA 3EJJX 3STLB 2HYMA 3RGHA 1KENL 4FQJL 3R8QA 4L3EB 1A3LH 2IPKB 1OBAA 1CR9L 3V6BR 4Y8DC 4NQXA 2ADJB 4NRXB 1F4AA 1TJHH 3BPLC 1J8HA 5SWQA 4ZUUA 3LOWA 3O3UN 4KVNH 2C8NA 2WUCH 4S10A 3FO0H 3OB8A 2W63A 4JHAH 2F53D 4GAJL 1N8ZA 4BUHA 1PLGH 4GPNA 1RUAH 2YHGA 3UTPD 4UT7L 1J5OH 1FRGH 2X2JA 3S96A 1ZHKA 2OYLA 3NGBC 5IW6B 1BF8A 1SQ2N 3IAPA 3W37A 3W5MA 4N9GB 4WNQB 2JEQA 3MBEA 1BG9A 4JE4B 4HXBH 3WIHH 4NQEE 5I2UA 1GZQB 4JCMA 2OWXA 5FO7B 1PG7L 3BUYA 1C12A 3L4UA 3MRFB 5C2UB 4QCFA 3LRGA 3GMPA 4GW4A 4KROD 4WCYH 1EXUA 2JJTC 5IKCB 5T3ZE 2ZUVA 4DKDC 1H2JA 3CH1A 4E9LA 2WVVA 2PW1A 4LLWB 4S3JA 2ZSVA 5E2VL 3TBTA 5E8DH 3F4VA 4PMNA 2Y5EA 1G7LB 2BHZA 4HWZA 3EOYG 4MADA 5HHPB 3M07A 4OZFG 3LZFH 3ZO9A 4TTUA 1BLNA 3QXAB 1HN1A 1WFOA 4M61B 3U0TA 1FFOB 2NX5A 4UB0L 1F8TL 3FB8B 5EOQL 2GSGA 4KV5E 3AMLA 1E4JA 4WI3A 2DTSA 4EI5A 4TUOB 4P3CH 1O6IA 1F2QA 1TIUA 2PO6B 2DD8L 1VPOL 2HT4D 4FFVC 2OSXA 2WAHA 4OZHA 2APVA 2NQCA 3MV7E 1KXVC 5J11C 3MMEB 3OR6B 5DRZA 4R7NB 4OI7A 1B2YA 4NYLB 2NLJA 1PX8A 1M03A 3VRJA 1FO0A 4P2RA 3GK8H 1WWCA 3F7VA 3MRCB 5CZVH 1LNUA 5D1XA 2OWWA 4UOW1 3PZTA 1LO2L 1ZK9A 1BJ1J 2QHRH 4WTWA 2BOBA 2XM2A 3QB7C 3GMNB 3L3HA 3UG3A 1YY8A 1CLYL 3P77A 3FT2A 2ADIA 2EIBA 4JY5L 2QJDA 3LCYA 5IEHA 4RMSA 1UD6A 4WWKD 1NC2A 3OR7B 2CPCA 1FV1A 4FLSA 1HH9A 4PJAA 2HMIC 4J3TA 3S3PA 1I3UA 3KHQA 3VI4E 1QFWM 2XGBA 5ABDE 4XXDA 3NGBB 1LO0L 2HLAB 3HI5H 1UWGL 3WCYA 5CCKH 1AIFA 5I75C 1S9WA 2A9ML 4P2QB 3IDMB 3CSPA 1PG7X 5HGAB 4K07A 1GC1C 4WV1C 2AV7B 1ZJAA 4JFED 3ARFA 4LMQI 5EUOB 1JGLH 4PJHF 3CHCA 4X6DE 5KVGL 1RUML 2B5IC 3GBMH 4G42A 5KVFL 3RTQC 5JMOC 4DO4A 3T0EB 2C1PA 2EXWC 4M1RA 2XWBB 4QF1B 1E4KC 5D7IB 1HHKB 5EMYA 2Z8WC 1MRFL 1AQKL 4AEHL 4Q9CA 4G8EB 3DX3A 4P57B 4OZFA 4G8GA 4O51A 2BFGA 1QD0A 5DQJA 4W87A 3EYFA 4O9HL 4JVWA 1MYRA 1LDSA 1E4XI 3IK2A 4K68A 3GNPA 4JQXA 2EDRA 4G80B 3BWAA 1UJ3B 4J6RL 1KJ2L 1U92A 2PO6C 4D0CA 5DSCB 3BKJH 3ZJ7A 1BVKB 5E99H 4AEFA 5HGBA 1UD5A 3WD0A 1KLFA 1QSEE 3ARGA 5DRWA 3B9EA 3HUJF 1PPIA 5DI8B 3L3KB 3OKNA 5E00B 1BG4A 3TBVB 1PKOA 2YDRA 1OL0A 3A22A 3L4VA 5LQBH 3OKEA 3UDWA 4PY8J 3IDJA 5F88B 3EYSH 1T0MA 4X8JB 4YDLB 5KANI 4WSJA 3MV01 1OPGL 3LPGA 3U2SA 3WNLA 5TDNB 1KIRA 1Y6NR 3DROB 1A7RL 3SBWC 5CWSB 4XMPH 4JFFE 4YHPA 2OS7A 4RGOH 1C08B 1JRHI 4E5XB 2JJTA 3MLVH 3LS4L 1MI5A 2OK0L 1A2YB 2PXYC 4R0LB 1Z0NA 1UASA 5IVXA 3AHVA 3HMWH 1E1FA 1LWHA 4CD7A 3U4BH 4OZIB 3D39A 3AS0A 5ABGA 3DBXA 4ZS7L 4NHUA 3JVGC 5EOQH 2AXFB 1A7BA 2CLVB 3BH4A 2FEEL 3X3GH 5KSAA 2ED8A 3EMZA 1C5DB 3BEVA 3ZKSD 2I9LA 2ZNWA 4M03A 2OR7A 1MCSA 1LLOA 4M8QA 4L5FH 2J88L 3PV7A 1Q9OA 3N0PB 2R1XA 5A2JH 2DICA 3GH7A 1RFDL 4FQ2H 2AK1L 1H1NA 3BMVA 3WS3A 1R5WA 5F9AC 4YO0A 1TJGH 4DVBB 2NY2C 4CVXA 3DSNA 5IFJB 1CNVA 1C12B 5I2IB 5C08D 4HCRH 3NDZA 1ZU8A 2W92A 4KKAC 4OF6A 4NWTH 1ADQA 3LY6A 4WWKB 4XNYL 3MLWL 3VGFA 5JZ7C 3BVNB 3OTTA 4OZHF 4UTBH 4TNWK 1I3VA 1F97A 1VFBB 4Z7VE 3IDXH 3GXFA 4KRUA 4KC3B 2B1HL 5DFAA 1E6JH 1WC7B 3DIFB 3FT4A 3ALFA 2QQLH 2E27H 3QJHB 3U7YL 3N1PC 4NO0D 5BOPA 4YHYB 4OLUL 1MQRA 1FFOA 2NX5B 3DMMD 3LQMA 1GJWA 3BISA 4I0CC 1MCKA 5C6TH 4UTBL 3SKMB 1N2RB 1U8OA 2QHLA 4GW5A 4M1CD 2NY3B 3HG3A 4Y4FD 4UTAH 4GG6F 5T33L 5TF0A 4E8CA 3V95A 4LKCA 3I6GB 4WIWA 1CFNA 4GMTH 4JFSA 3UPRB 4NHCH 2R2HB 4XPGH 2V3DA 4KAQH 4PS4L 3GUTA 1CVSC 3O6LH 4CD4A 4ACYA 2WWDA 2ZPKH 4PJ8D 1P6FA 4OJFH 1YEGL 1U58B 3I6LD 3KDMA 3MRQA 4XP1L 5CP7A 2IPUK 2QV2A 4AZ5A 5EO0A 4PBWD 4XHJD 1MQKL 4LARL 4R4NC 3CBWA 2NCMA 3WS6C 3SUTA 4LSDA 3GSUA 3N9GL 2HJFA 4J3VA 3EYVA 3FB6B 3VFUA 1JYXA 2BSSB 3H0TA 5MEPB 1XHGA 4GH7B 4KUZL 3D3VA 3CFCH 4MQSB 4IIQB 3NCBB 5IW3A 4FXKA 3V5KA 5B38B 4FLRA 4AC1X 1O5DT 4MAYB 2ZXDA 2IGTA 1RUKL 4Q74A 2GK2A 3MV7D 5EZJA 4XVTH 4MX7A 1G6RH 3RY6C 1NCCL 2ATPB 2XTKA 3BUIA 1JFQH 3TNMA 4OV5A 1EO8H 5FAAA 4OB5H 3QDAA 2GITA 4ONHB 1LJYA 3OKDA 4PY8I 4PJAF 1T20A 2R2EB 4JRYE 1O7AA 5EFIA 5GJTL 4G8IA 1ISXA 4QXWA 2XVKA 2EDOA 1O7DC 3ILPA 1R3KA 5DMIL 3C08L 4LCWA 4M1GH 3QZWB 3BP7B 3LEYL 3QFJD 4NBZB 4NNPL 1AE6H 5JORB 1DQQB 3GGWB 2X0YA 4WGVB 4F37K 3LRLA 2BNUB 4DOHB 1HXMA 2Z1KA 4NM8L 5GS0D 4Z18A 3MV11 4HGWA 1KCKA 4XVSL 4P5TC 1WAAA 2X2IA 4ZPTB 4G8FB 4A2LA 5J6GB 3I02B 1KGUA 3GXDA 4ZFGL 4S1SH 1G9MH 2SEBA 2X6MA 1SZNA 2DQTL 2OXHA 4AIEA 5A6BD 4UZGA 4N9OB 5DR5L 1DLFH 4JG1H 2C3VA 3KEHA 4WLCA 1MAMH 1UXSB 5GS0C 4GKOA 4QYOB 2VABA 1YDPB 3VI3E 4YBQC 5E8EB 3I85A 3LKRA 5L2KE 3D85A 4L9LC 1XGZA 2QPSA 4DM1A 2ITCA 1ZLWK 1TENA 4HK3J 1TMQA 5C1MB 3TVMA 4UU9B 1MXDA 3AIVA 1GGBH 4JREB 2FJFA 3QDMB 4ETQB 4PJFA 3FO2B 5TE6H 1WWWX 4XMKL 5MERA 2E6PA 3BN3B 4KKCC 3IDJB 5F88A 4YHLH 4KTDH 4GQRA 3BDXA 4D0DA 1NAMH 1NMBH 4JVPA 2Z9TA 5JHDB 2XFXA 3RNQA 5CSYA 1P7KB 2GTZA 1CTOA 3MNZB 4NBYB 3BH9A 3VWJA 3LD8C 4K3JL 2MQ3A 2HVJA 4MAYC 1XD1A 2P8LB 3KPNB 3S37H 2EYTA 1XH3A 4U1IA 5KSVA 5GS1C 3SDAA 3BUPA 4YEFA 4JG0H 2LU3A 4Z7NE 3WFBH 5ERWA 2W9EL 3RWIA 5KVDH 3V8CA 3OGCA 1ECEA 3MQIA 3EFFA 3NDYA 1UR1A 3SKNB 1F45A 4MDIB 4XZUA 5H94B 2C3GA 1TETH 4R96A 2GUOA 3THDA 1OQXA 3S35H 4S3KA 4K3DL 2DLEA 4PJBB 4YPGA 5C0JA 1FBIH 1XEDA 1EOMA 2BXZA 2RQ8A 1W8OA 4YFDB 1R3IH 4OZIF 5AYUH 2IH1A 3VRIA 2QQQA 4KHTL 3B5HA 35C8L 1RK0A 3CU7A 5DVNA 5EA0H 4ELMF 4FMFA 3N9KA 3FRUB 5DZOA 2PO6A 1U8QA 1NPUA 1G01A 4Q22A 1G1YA 1ZLSH 1NCDH 3T77B 4YH6A 4N5EC 1MF2L 4IRJB 4ZXOA 3WY2A 3LIZL 4MXVF 1IGYA 3GMMB 3CC1A 3WEXA 1GYAA 4XPBL 3U4AA 4J6RH 4MNQB 1YQ2A 3CFCL 2CBVA 2FEDD 1FO0B 4P2RB 5CP3A 4D6DA 2FJGA 1WZKA 1DTUA 3A23A 1NCDL 2VUOA 5C0EB 2CMRH 5I1DB 5JW4Q 5M7QA 3BPLB 2HLFC 1KJ2A 1PKQE 3GMNA 4JREC 4L9DA 5E7BA 5JMRA 4XPAH 5DMGC 1X6LA 5C0IA 1OGGA 1HYRC 1W9UA 3MRIA 4RMRA 4FFZH 3RA7L 1QBLL 5JDJA 3OG2A 3WY4A 5E0CA 1Q72L 4JRYA 3GBDA 3WDQA 2DOCA 1JZ7A 1BJ1H 2YMXH 4PTXA 3HI1B 3KS0H 3FB7B 1IM9B 5ESVB 3OF6A 1EMTH 4GW1B 2VZTA 5D8JH 5HGHB 1EBAA 1KTDB 3WKML 3X11A 1GQIA 2RHEA 4R2GB 2IUZA 2WBJC 2Q20A 5GQBA 3FFCE 1OF2B 5E5RB 3CLFL 3MUJA 3MLUH 4JO2H 5I8EA 3ARGC 5HHOB 4IIQA 3EW3B 4I18B 5LGHH 4NO2B 2V5CA 4XT1C 5DHVH 1R7OA 3C87A 3P11L 2A6DA 1V08A 4BQBA 5D7KD 3EDDA 1J12A 1W0WA 4DEPC 4KZDL 1JD9A 2X4TB 4ZFZA 1PY9A 3QIBD 4IRSC 4ZFMA 2J25A 5CGYD 5DHVB 2QHRL 3W82A 3MGTB 3RAJL 5IB5B 4DN3L 2VLKE 2EKSB 4L8SA 4PRPD 3H42L 3GBNL 4GLRH 3MXVL 1J18A 3T8XA 1QNQA 4O4YH 1IKFH 5J8OA 4LLMB 1HXKA 3WDRA 4KUCF 3PDOB 2UZIH 4HWUA 4JN1H 3AAZA 4XNXH 3ULUE 4XNMA 1A9EB 2FX8H 1T3FB 5J11B 5KOVC 1OD7A 3MLZH 2FO4B 2QKIA 2H32B 4HWNA 1VRXA 1G7JA 1RIHL 2YN3A 1NMBL 4QRRD 1IC4H 1A4KB 1MQ8A 1AO7B 1MFDH 32C2B 3OKNB 5IDIA 4JFYB 4JGUA 4JPKL 5FM5O 3GSWB 3MV7A 3OJDB 2YS4A 4RZCB 3TBWB 2D31B 3DHJA 3VXTA 3RBGA 1NWSA 3LMJL 4K8RL 1M05A 3HPJB 1A7OL 1AY1L 2FIRT 2ZIDA 1RUMH 5A2IH 2DL2A 3V4PH 5K9KB 3BFOA 4TVPD 2C3VB 1JV5B 1EZVX 3JUGA 1KJMA 4NQDB 4NDMA 3QEQE 1QRNA 3L3OB 3VSVA 2WXDM 1RU9H 3EOBA 4NC0B 1FC2D 4N8VA 5M95B 3RIKA 3ARBB 1DBAL 4M61A 1ODUA 3REVB 4R0LA 1R3JA 3QFJE 4OCXH 4OF8A 1BFNA 1UC6A 1K9DA 2BNQD 3VSUA 3CCHB 4HFWB 4JFQA 3REWB 2FJFB 3QDMA 1TG7A 4KHXH 1PG7W 4X6CB 1KEGH 4Y4HC 2J2ZA 2VL5A 5DZNA 3U9UB 3RRQA 1I9JH 2NY2D 1FAIH 5ELIA 2CGRL 4Y4FA 2NW0A 3LN5B 3DDGA 1RZKC 3E6HB 3PWLB 1R5VB 4OAWB 3SDXE 3RVTC 3HG1D 4H0IA 3I3BA 4AZ8A 3OB0H 4WIQA 1FL6B 1YMHA 4LFHG 4LVOC 4Z77B 2X5PA 3KPSD 4WWKC 3FO0L 4NRZB 5I75B 4JFEB 1OSEA 2AK4B 1NKRA 2E7LC 1TZ7A 2DPEA 2WANA 1QFPA 1FNEB 3KR3H 3RI5F 1FGVH 3VG0L 4JHAL 1W72L 3WF3A 4RRPA 1DWFM 5A8QA 2VDQH 3SY0B 3QEGL 3QCUL 1UENA 3DX1A 4QXTB 2FH6A 2V38A 4OGXH 3MACH 1T6VN 5ABHA 3E6FB 1TTFA 1P7QA 5MEOA 1HQ4B 4X7TA 2DQUL 4HEME 2GUOB 1KYOJ 2EEBA 4P23D 3AZRA 3QPXL 4ZNEA 3NAAL 4XP5H 2NY3C 4APQB 1LL7A 1PG7H 4X99B 3W5NA 4MSWA 3W4RA 3IDNA 3K46A 4TYUA 3VXSE 4X5WA 4HAGA 1K3ZA 3UTQA 2XIDA 4K94H 2XKNB 1GHRA 3UC0H 1BIIA 2K9UA 4GRWE 3GZAA 5A3IC 3DUSB 4PD4J 1TNMA 5C0CD 3D5OF 3SO3B 5FFLA 1LG1A 1K8DA 1UZ8B 3OSKA 1JGDB 4JN2A 1KV3A 2DQTH 1MWAB 1NP2A 4OF0A 3VXME 5GGVL 5JW4R 1N7ML 1BFTA 2JK5A 2J88H 4PRDB 4K94L 1SYVB 3ARZA 4X7CC 5JTWA 3EOAB 2VDLL 3CFDB 1E4MM 5FL0A 1J01A 2Y06H 3GJFH 3VM5A 2W61A 1Q6FA 4HJJL 4GXVH 3DVGB 3CFJB 2QLVB 4GLRI 5TGBA 1AFVL 2YPKB 1UWEL 1TZGL 2Q86B 3UBXI 4ZYKA 1AI1H 3AQUA 5TE6L 1UHVA 4GJTB 1WZMA 2CBJA 5MP6L 2DSUA 1AP2B 1GVIA 3UPCA 1XF1A 1G7MA 4HG4K 2ZX7A 3I75B 1BVZA 3SGEH 1JF5A 1U8IB 4JRYB 3GMQB 4D72A 1LWRA 3ABZA 1PY4A 2DBLH 3R0NA 1AO7D 3QG7H 5D2NC 2P43B 4W6YB 4B50A 4MTVA 5BV7L 1KTDA 1MY5A 2HRPH 2DQHL 1R46A 3C9NA 1EA9C 1LO5A 1BQHB 3MCKB 2DL9A 3DWTA 3ZKMD 5T33H 3KPRA 4ZUVA 3PWPA 1GH7A 4ORGB 1H3UA 4V1DE 1BGXH 1S78D 4P5TB 3P4NB 4PV9B 3VD3A 1DUYB 4P46B 2PUQT 3BP7A 5D1QA 5HYQB 3X12B 1UWGH 4BH7B 3ZE0F 3HS0A 2OYKA 3AXLB 3VA2C 1NGPL 2HG5B 5I71B 3DUHA 5F97E 3DRTB 2AEQH 2YKLH 3NPZB 5IB5A 3IVKB 5ALBH 4JPWL 1OB0A 2GK1A 2MOVA 1H8NA 3MUY1 4CL7A 1JF1B 1UD8A 4Q9QL 3ARFD 1YDPA 5C86A 1BVLB 4YC2B 3MRMB 1M71B 3ZDYF 1YNTA 1S9VB 1T3FA 3VI3F 4L3ED 2OR8A 1NCCH 2QKIB 1LE5B 3C5JA 5AWNH 1Q38A 3MRGB 3TN0B 2F7OA 4PBGA 1KGXA 1D5XA 2NY0B 3LSOA 3FN3A 4OB5L 2OTUA 3UTZB 4U1NA 5FKAB 5FUCE 1FLRL 4ETQA 4KKBD 1RJCA 3GSWA 1H41A 1OAXL 2IG2H 2EXOA 4F15C 4MHHG 3GSQB 1NCTA 1FGVL 2JTDA 3PHQB 4R7DA 5GS1B 5IQ9B 4IS6B 2HISA 3IXAA 4HGMA 3RNQB 2XFFA 2FRGP 2H41A 3ROOB 2RIKA 4XB8A 3VD4A 3L3OA 3BUQA 2VWEC 3B9KB 3UJJH 3ULUD 4XVSH 3WH9A 2QHAA 5C6WH 1YEDA 2B1AH 3RQ3A 4RAVA 3PZGA 2BRQA 4MDOA 3QUZD 2I27N 2FECL 3P9MB 5E8DL 5FYKH 3RWIB 1WIUA 3FT3B 4RAUB 4IM4A 4X6CA 3KPPB 4OCWH 1ERNA 5J7CC 4NZTL 1HTYA 3CLFH 1U8KA 3GB7A 4F9LC 1WK0A 5F89B 5DYOB 5LGJA 1F8TH 2ZOLB 1RZGA 4NF7A 3SJVD 2CPUA 4OSUL 4GG6B 3GRWA 3GHEH 4BH8A 2W65B 2E40A 4NUJB 2AJSH 5EO0B 3K2UL 5T3XH 4F7CA 5L8JB 3UESA 3T1FB 5DEGA 4GT7A 1AHWA 1KGWA 5ADOH 2ESVA 1X5YA 2R0LL 2V17H 4E41E 4HU0A 1WSST 1VAHA 3V9FA 4KMTH 4LKXA 3LEXA 4F7MA 3RWJA 5I17B 4NCC2 3BT2L 1FGNL 3DXAD 3TYGH 1A9BA 2UZIL 4K3JH 1DANT 4XNXL 5E8PA 4JZJA 4F7TA 5HPMA 2FX8L 5CD3A 1IGTB 4PRIE 5SX5H 5F96L 3WF0A 1J0JA 3MBED 1LK3L 1IZKA 1CFQA 3HCVA 4ZTPH 2ZOKA 4ZUTB 5INCA 4RFOL 5HOSA 4RBPK 2DBLL 2OMBA 5AZEL 3UTQB 3SCUA 4BZ1H 3G6MA 5B39B 4LGRB 1OT1A 3L3JB 3UZVB 3WE6B 1FNAA 5CLWA 1RURH 4UV7H 2ZXQA 4DTGL 3M17A 3QJFA 5LWYH 2P5EE 2YK1L 1I4FA 4W88A 4TULL 3VFGH 1J8HD 3HLAA 3APGA 1UM6H 2V5SA 4PJ7A 4JL1A 1DN0A 1QTYT 1HKFA 1XF4A 3MMDA 1TA3A 3RZCA 1I1AD 5IGXL 4I9WD 4GKNB 2VLRB 4HKJB 2BVOA 2COQA 3L5XH 1YEKL 4A6YH 1HKJA 4OI9A 1QLFA 5L0QC 4WTZG 3C5ZC 3VRJB 1UD4A 4EN3A 4HKBB 4U2ZA 2ITDA 2JF7A 5C9JB 4IRZH 3VD7A 5C0CE 3WD2A 5SWZD 3PQYB 5C0BA 3TZVA 5KTEH 1CICA 1ZHBA 3C5SB 3CJJA 5IF0A 2UWFA 1A1OB 4EUPB 3J7HA 1VKXA 1IKNC 5DT5A 3CFEA 5EBGA 3MO1A 2Y72A 4JZNB 4XRCB 4KJQC 3DYPA 1JPFA 4HZ8A 1YNKL 3FO1A 1EUTA 3LKNA 2LU7A 3NCYS 4J23A 4MA3B 2J7HA 4AM0B 5KZ6A 3QFJB 4ZUWB 2XWJB 4Y2DA 1KB5L 1HHJB 3H9YA 1QPPA 1YJDL 1CEOA 1FHGA 4K7PX 4JZOA 3W39A 3AFLA 4OGXL 4PJ5E 4OIBA 4FNUA 3QUYC 4C4KT 1I8IB 5FUZH 1T6WA 5A94A 1FFPB 5JW4N 3TN0D 3RILA 4NP4L 5ADPL 4LBEB 4UQ2A 3E8UH 5J06A 4LVEA 5AC4A 1CIUA 4QTIH 1T1YA 3LZFL 3DRQB 1UXWA 2OJEB 4Z2HA 5DA0B 1IM3B 3BUDA 2DMCA 4ORZC 4Z7WE 4GBXB 4OI8A 1TVHA 2BRRL 5JOFA 5IXEA 3HMWL 1DWHM 2OL3A 3KYNA 4FFWD 3QDGA 4KK6D 3P0VL 4ODWA 4ALAL 3S7GA 1W3KA 3TIEB 4KQ4H 2W0FA 1T0NA 2WCGA 3ELAT 4NC2B 2ZUMA 4JKLA 5LYRA 3EYFB 4CJ1A 4TX8A 1FVCA 2OJZH 2NY7H 4MQXC 1CBVL 4ZUSB 5D9NA 1DQLL 3QHFH 4HUMB 5A40E 2GJ6B 3PNWA 1EDGA 3FQNB 4OFYA 1HJVA 2ICWB 2GJPA 3VWKA 3QISA 4JQVA 3HE7A 3NFPB 4LAQL 5ACZA 2CETA 3BSGA 5D1XC 3RX5A 2DTML 2IBZX 1UCTA 2RCSH 1QI4A 1C8XA 2V17L 1B0RA 2XUCA 12E8L 3ARGB 3UBXA 4M48H 1OGTB 2X9XA 4IS6A 2VB5A 2NY7L 5DK0A 1WKYA 2C4XA 4GQQA 4PJIE 5EN2B 4FQQB 4FQIH 3C5ZB 3G9AB 5C0AA 3G5XB 1ROWA 1E71M 1V6WA 3BEWA 5A8MA 5EIVA 3A5VA 1LEKB 3MCLH 4OLWL 1JYVA 1MQQA 1FSKC 2F8OA 2AKRA 1I1CA 5FKPB 1CQYA 3ZO0A 2J8UF 1TVBA 5CEZE 4PSRA 2NTSP 4W8BA 4KRLB 2X4QA 2VCBA 4JFDB 3RHWK 5BV7H 1U2YA 4PRHB 3GNML 5GSVA 1NGYA 2DQHH 1MCIA 1LP9F 4DQOL 1V0NA 1VACA 2ICEA 4HMDA 2FSEA 4LSRH 4IEFB 3D0LA 2JE8A 1IBGH 1LP9E 2CRIA 1U8KB 1NCUA 4G9FB 2DSWA 5EFDA 5LBSL 5CPQA 4NN7C 4M62H 3GXTA 4BSJA 2I24N 3MS8A 3HAEH 4PJGB 4MDJB 4DZ8A 4L1HA 4DQOH 4BH8B 4WJ5A 4OTXL 1NKOA 4WUUA 4QOKB 1VB9A 4NO3A 1G0DA 5B4MD 1MRFH 4FTVA 2VZSA 3IU3A 4NQVB 1SYSB 1L0XA 2CGRH 3DUSA 3HB3C 3U36B 3VOCA 1EPFA 1EDQA 4N1EA 4CKVX 3U1SL 1YC7A 2BVQA 1OCQA 4R4FL 3AI0A 3ZHLA 4OIIH 5IB1B 2HN7B 2DH3A 1CFVL 2BHUA 4QRSA 3F7PC 1HJUA 1MQKH 4LARH 5T5FH 1DJSA 2JCCA 4AIOA 3MJGX 4HS6A 1J8KA 3P0YH 2E8ZA 2FD6L 1ZJBA 2FGWL 4URTB 4NQEB 3QUXB 1I75A 3IRPX 3SCRA 2VZVA 3R06A 4PJBE 2EPMX 3F58H 3NCYP 3T8XB 3CUHA 1F90H 3AAZB 4MZ3A 4O2FA 3VIPA 1G7HA 1S7QA 3S34L 2WNGA 3QPXH 2FD6H 4CVZA 1TJIL 5HYJE 5CBEA 3DURB 4M7ZB 3ZYOA 5I0ZA 5JXAH 1CLXA 5EUKB 2IAMA 1F02I 4NO0B 4Z7UA 1EJOH 1KFAL 5D1ZD 1OTSC 1OD9A 2EABA 5JNYB 3OX8B 4FXGB 4NQDD 3HAEB 1RQ5A 1HNFA 2V7NA 4JRXD 4PRID 2WYSA 3E8UL 3CUFA 5D9PA 3OKKB 3MROA 4M02A 2VDNH 1CD9B 4HH9A 1GCYA 3D52A 5ICYA 5IFHH 3TA3C 5LA2A 3KDMB 3PWJB 1NFDA 4PJ5B 1X5ZA 1DWIM 2W60B 1VDGA 4TRPL 2LAGB 1UWUA 1EGJA 1D5BA 3G5ZA 2PCPB 4ZUUB 2P48B 4G6FD 1H3TA 1E4IA 4PMXA 3O9WC 1PAMA 2R0LH 4K94C 5HYJA 4JPIB 3GMLB 2Y1VA 5A69A 1HHJA 5EZJB 1PEWA 3Q6GH 2A73A 4FRWA 4N0CD 2GAZB 3P73A 2YD7A 3S96B 3QNZA 3MLWH 4GI9A 1ZL1A 4O2EA 1GL4B 3LN4B 1EFQA 4YHLL 3MXVH 2VDKH 3F12A 4KK8D 1E6JL 2IMNA 3QIWD 2HTLD 4E4PA 5TDPA 3BD5A 3O4LD 2AJYH 2DIBA 2E27L 4U05A 3O4LA 2JCCE 4OGYH 3MPCA 3MJ8A 3MLXL 4MXWH 3QULA 4ZO7A 1P2CA 1MH5B 5DRNB 4PGDA 5AG9A 2YR3A 1DBBH 1EEUA 5C0RL 5L2KB 1I1FA 4H1LB 2X10A 4E2OA 2BNJA 4BQ3A 5F9DC 2MPAH 3IXAB 3O6MH 3SDXF 3KPSB 3WO4C 4NNXA 4FP8H 5EU4B 3NH7H 1FIGL 5HHPA 1CDIA 2V9RA 3HE7D 4UDTA 1N0XL 3UTTE 3LPOA 3VWKD 4MSWB 4DUWA 2E5EA 1QACA 1U3HA 2DIEA 4OD1L 4PJ5D 2NY5H 4M7ZC 3VFNA 4MA8H 4M62L 3H7LA 1NMCB 1RV6X 2UY4A 1JDCA 2LABA 1BQLL 2VABB 1CXFA 4LVNB 1E40A 5CS7A 1JGDA 1E4WL 1YYLL 1QX1A 1A5FL 3BP6B 3PL6B 3QDGD 4DFHA 1LP9A 1XCQA 3UTSB 3GB7B 4L4VA 2G9HA 3L7FA 5IP4A 3NFSH 3U57A 5I19H 4CDGC 3STZB 5E9DD 2XPGA 1SY6H 1UB6A 3QH3B 1E6NA 5D93B 3A21A 2NW2A 2DH2A 3BRFA 3WL9A 5K33A 1S7XA 5KBNC 2ARJB 3GH5A 1ZLWH 5KTEL 5A2FA 4Y16D 1OWRM 4V28A 1P4LA 1JPTL 5GGTA 3ALWA 5DQDL 4PG2A 4XCYA 5IJVB 1MFCL 2Z31C 2I5YH 5GZNC 1DBML 2Z92A 4X6FA 1D5IL 3LEXB 4F7MB 4TTGA 1FN4A 4OD3H 5GHWH 2WINB 2XRAH 2EYRB 3U7VA 2A9NH 3MV8A 2XT1B 4AEIL 2Z8SA 1A0QH 4N5ED 3HG2A 1INQB 2VDQL 4U1MA 3TLRA 3QZWG 5FYKL 3FOLA 5ADPH 1SBSL 3NCEB 4K3HA 2H1PL 4A2MA 1R47A 3L7EB 4K3GA 5HGAA 3BSZH 3BVUA 4QTIL 3ARWA 4RGND 4PRAA 2J7GA 4K2UH 4QKXB 5DJAA 2YMXL 2KBGA 2G3JA 4AEIH 1T5XA 3AREC 1JRHH 2P5WE 1EGZA 2VITB 3QJFB 1BECA 5T1KD 4ELKA 2HN7A 3CH9A 3M6DA 3HB3D 3G9VA 4NIKB 1ISWA 4YBQD 3WMSA 5FUOH 1NOFA 3B9KC 5ID1A 5FO8B 2VWEE 1I8KA 1F2XK 5I66B 5SWSE 1QSFD 3DRTA 2YPLE 4QEGA 3EYUH 1KPUA 5AEAA 2XJ7A 5C8JA 3WH5A 3EBAA 4HMCA 4PG9B 1TA3B 3OZOA 5CJ8A 3KLAA 4KMTL 2C3HA 3LXAA 4W7WA 2BFVH 3FL7A 4QWWD 3AROA 4OFVA 1NDMB 5ITFA 1ZAGA 4MMZC 3CXDL 4NM4H 4YGVB 2GJ6D 4HZLB 1S7TA 3V52H 2UVFA 4OLZL 4H25A 2EACA 1Z6JT 1NFDE 1Z0MA 3UTZA 1XSJA 4P9ML 4TOYH 1Z32X 2YC1B 3KPOB 2VI0A 1G84A 3MLSL 4ZOBA 1UA6H 1YHTA 4HA1A 5JNYA 1FG9C 2XICA 4JDTL 4OGAD 1BAFL 1EHNA 3GSNB 3Q3GB 1OIFA 5HBFA 2JKXA 3FONB 43CAA 1QQDA 1EAPA 3DXAA 4I77H 3W0WB 1PJ9A 4FXLA 4LRNL 4KROB 4YHPB 1F11A 2BY1A 1NEZA 2F15A 2Q3AA 1ND0B 4FMVA 3ESVF 4K8RH 4N0FA 1B4RA 1A7OH 1AY1H 2IANE 5CFHA 4FQJH 1KENH 2AQ2A 3U0PB 4MQXD 1KPVB 3BKYL 2ERJC 1MIMH 1E0VA 2HJLA 3KWXA 1FNSL 3NCJL 1LVEA 5D71L 3MZGB 5HHOA 1LG2A 4FQXC 5DUBB 1N6UA 2D4FA 2LU4A 3PZMA 3BKCH 3RWHB 3W27A 5IBTH 3NIFE 1F6LL 2AABL 4AMCA 5LGJB 1X5AA 1HH6B 2Z0BA 1T83A 1BPLB 4GG6A 1BOYA 1Z9OA 3VMOA 3WHE1 3P73B 1WZ1L 2CRZA 3MJ9A 3CZSA 1KG0A 3LIZH 3NCJH 4D6JA 1HF6A 5D7LA 1VEOA 4U1SA 4Y4FC 3L4ZA 5E4IA 4G9FE 1DHKA 5C0GB 3U5YA 3T3ME 1R85A 4M7LT 2DT2A 1X5XA 3FQNA 1X3DA 2OZ4H 5JOEA 5T3XE 1FDLL 4WSKA 3S3SA 2WAGA 4AY1A 4ESKA 1G7JB 1OAQL 1CL7I 2BVDA 3HR5B 4IDJL 4PJ7E 1BSIA 1UCBL 3ZT7A 3UR7A 1DUZA 2GCYA 4OCSL 1LO4H 1D5IH 3PG2A 2DI8A 3RHWF 4FFZL 3UZEA 3GKWL 4PTTA 4FNQA 1S8DB 4HIHA 3UCRA 4C55A 2BS9A 3TBWA 3H9ZA 4YHNA 5IVNA 2ZICA 3QEGH 1KGCD 2D7TL 1VF8A 3SUSA 3PWUA 3TT1H 1FL3A 3MYJB 3X14B 4EI5B 4LX4A 5D2NA 4CADA 5ITBH 3WFEH 1IZJA 5D8JL 1BFOB 3WKMH 2DQUH 3MV9A 4XCFH 3ROLB 1B3XA 1CPUA 1JMZA 1MXGA 2O5ZL 4PJ8C 4UFJA 2ADFL 2F8XC 2HP4A 2YDSA 1W2KT 5J1AA 1L6ZA 4C56B 4X4YA 2Q76A 2HT2D 2VDNL 4Z5RA 3L1OH 3UZQA 4NI3A 1CG9A 1I1AC 5SWZA 5C0AE 5ABFA 3NSXA 1KCRH 1WCQA 4JFQB 3REWA 1A1MB 5DHXB 4B7IA 3IYLW 1J86A 4TRPH 4B9ZA 4HC1L 5CP3H 2DD8H 5F7FA 2EO9A 1AKJB 2D7OA 4NKOA 2MHAA 3L3HB 3L1OL 2D7QA 3OHXA 3FT2B 3FN0H 5EO9A 1ZLUH 4HF5H 3TPUA 1DQDL 4N0RA 5AYIA 4B41A 2YRZA 4L4TD 3H42H 1MPAH 3PDGA 4U3HA 4FQIL 3NCCB 1CVRA 4MA1C 2Y06L 4MCZB 3PQYA 2B7DT 3NZHL 1ZHBB 3C5SA 3PWPD 1JFXA 5JQHC 1HZHH 3QDGE 1LD9B 3CHDA 3NPSB 3X13B 5AY7A 3PUCA 1D6VH 5E5MA 3NA9L 3WSQH 3HI5L 3WNNA 1JWMA 4X9BA 4TNVF 2VZ3A 1CI5A 4YDIH 2C9AA 1J1XL 3LKNB 1NMAL 2YUXA 2CBUA 1ZANH 1KQZA 3F7YB 3L2LA 5D8WA 4P5TD 2XPKA 4H88H 3UX9B 1GOOA 3BAEL 1NAMA 3M45A 4CMMB 2CK2A 1T5XB 3FQXA 5I23A 2R4SL 5EZLB 4P23B 1ZMYA 5D7IA 1J10A 3DURA 1G0CA 3RGVD 5JIPA 4LBEA 1SMOA 4UQ2B 1IT0A 3JV0A 3F5WB 5E94B 4OZFB 4PJDE 3BAXA 3BQUC 1TCMA 4AEHH 5FO8A 3BYTA 2E9LA 1E27A 2V2XB 1KCSH 4K3EL 5DD1L 2PYEE 4YHMH 3SDDC 3V6FA 3RJYA 4PGCA 1GORA 2DMBA 1OTTD 4P2OB 2XQYK 4DGVH 1E56A 1UR4A 4MA8L 1E0XA 2XY2A 1WJ3A 1EJ6A 4EI5C 5LWYL 2W9DL 2O9OA 5IIEA 4M8UA 2XWDA 5D71H 4OFIA 4F33B 3CUJA 4QLJA 5DD1H 4UV4H 1LL6A 2CEQA 3IDGA 2JIEA 3CZEA 5DI8A 2ICWJ 4PJDB 4WI6A 3CXHJ 4EI6A 5IVZB 3CZLA 5TQ0L 5HNNA 1BYCA 1EXPA 1TMCB 1RZ8B 3PP3K 1ZV5A 1F90L 3S3JA 3VD9A 1CFSB 2ADIB 5SWSD 4NZRH 7A3HA 1F4XL 3AIBA 4E42A 1CL7H 3KR3L 3PTMA 4D0DB 1U8IA 5F7WC 4JM4L 2WKLA 5HVWA 1M7IA 4KZEL 5JHDA 3GSRB 1P53A 3QUMA 3AOFA 2IALB 2AXHA 1FFNB 2VVSA 5DJ8B 4N0YL 1YZZA 4GAYB 1ZSDB 4NRYA 4P4KC 2EDFA 1W0VA 3MCKA 3S6TA 2YWYA 1XH3B 2WMKA 2WHKA 2C7UB 4MJ5A 2IPTL 1U30A 3PZIA 1FH5L 3W9DB 2ZP0T 4XP9H 1X44A 2XWTA 3EFDL 5GIRA 5T1DL 4DZBB 1P2CB 2L0DA 4NKDB 2KKQA 4KXZI 2QR0A 1ULVA 3QO1B 4LLYB 2D9CA 4HWBL 4Z0BL 4JB9L 4WUKH 1IC5H 4L3EA 1H49A 2EIZA 3VFPB 3IDUA 5DDHB 1NOUA 1AXSB 4L5FL 3EOTH 4LSTH 4NNYB 5GSRA 4D2NA 2WPGA 4FFVD 1RFDH 4FQ2L 3RUGF 2BNQA 2N56A 4U1SB 1DANU 4WFED 1PIFA 3DECA 4U1KA 3EYOA 1J11A 5D1ZC 1PQZA 3KYOA 1AR2A 3W6LA 3ZSSA 4WUKL 4Y16C 2MCG1 3VXNA 5I1AB 4ELMA 3X3GL 3WMBA 1CXKA 4P2OC 1T0OA 1X5JA 2VUYA 1CXHA 5GZOC 3KLKA 2NY2B 3L4XA 5C08E 4HFUH 4JQXC 3MRGA 4FZEH 3FN0L 3AU1A 3HR5A 4QNPE 1D5XB 1CZ8L 2OLHA 4GRLD 1DUZB 4U3CA 3L3KA 3DV4B 1INEL 4EVNA 4C7GA 1II4E 3AHYA 1FC1A 2ILLA 4PJCB 4GS7B 3VXMA 2EH8L 3N18A 4LSPL 4JFTA 5EO1A 3AS1A 4HFUL 4YNYA 1XF2B 1ZWIA 4J4PA 5C6TL 1YEJL 1SVZA 3H55A 3WSQL 2YPLB 1AC6A 1PD6A 3EZJB 5TH2A 1NMAH 3TA3B 3FRPA 2Y25A 4WI2A 4JQVC 1WDSA 1UT9A 3MRKB 3NH7L 1T7ZA 2R4RL 4RGMB 4H88L 5K59E 2BX5A 4RAVB 1KBBA 2V2WB 2FO1A 2DQJH 4JQIL 2FX9L 2GSGB 4I3RH 1SVCP 1NQBA 1NFIB 1CK0H 5IWLC 4KKAD 5BXPA 3B6SB 3QXDA 3KS0J 3RL2A 4P4KB 3SGKA 1T2QL 5IESL 4FZ8H 1J05A 4OCLC 1KSRA 1A5FH 5E2TH 2IANB 3W9EA 1Q9KA 5BW7C 2YK1H 4WW1B 4EJ1C 1YMMD 3LVEA 5FA3A 1MIEL 4DO5A 1IT9L 3AS2A 1BQHG 4M4PA 2CDFB 1JP5A 3BKCL 1YEGH 3RI5K 3G6AA 3UEZA 3T1FA 4HS3A 1T2QH 2UWEF 2VLJD 1RUKH 1XF5B 1T21A 1UJ3C 4X4XA 5HVFB 1G6RL 1YECL 4XP4H 2NZIA 2KH2B 3PZUA 2QADC 3X13A 3T4YA 4A6YA 4J3WA 3MLYL 3HE6B 5DJ6A 3RPIA 4HA3A 2XSBA 2A83A 2XOTA 1JWMB 3HZKA 4HUKB 4QHMB 2G3NA 5IEHB 2W0KA 3NZ8A 1GGIL 3SE9H 1Q6DA 4AD1A 1A1NA 1ZTXL 4LVNC 4RBPH 3NMEA 3EJRA 4WFFE 5C07E 4KQ3H 1U8HA 2HH0L 4XMLL 1AH1A 5B3JE 2A9NL 2XZZA 5FV1L 4HZLA 4NKMA 3TA3D 1H0DA 4P23A 2NYYD 2X4OB 4KRTA 3VU2A 1T03H 4P3WA 5FYJU 3IU4H 2VLKA 3BRGC 2M1KA 1NSNL 1WBXB 1YUHB 4I3GA 5LG1A 7FABH 1KR0A 4V1DA 4RFEB 2HTLC 2W5FA 5DJZA 4RZCA 4ENEC 2N7BA 3KPRE 4P0DA 1ITCA 4W6XB 4Z95L 1KUMA 3INUH 5ITBL 4Z2IA 2EXYD 1X7QA 5DURB 2IPTH 3VXRE 4DOHE 3K4ZA 2PTUA 1AE6L 3AM8C 5JXAL 1JWSB 2ERJB 1T4KB 3KPSA 1R3LB 4AK1A 3L95A 1C7SA 4KRPB 5B21A 1KLUA 4HXAH 3SUWA 4WI9A 2FJHB 4O51B 1EEZB 2DQEH 5IBLC 4JHZA 4ZFFA 4Z95H 5BZDB 3IJHA 5KG9B 5A6AA 3MRDA 3TO4D 3SUVA 4NQSA 2YEZA 2J6EA 1KCRL 5ESQA 3SQBA