3GVVA

Single-chain urod y164g (gy) mutation
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLYESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrinogen decarboxylase
publication title Substrate shuttling between active sites of uroporphyrinogen decarboxylase is not required to generate coproporphyrinogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 123
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3gvvA00
3L7RA 1JPIA 3GW3A 1U1HA 3PPFA 4L6OA 4ZR8A 1U1JA 4ZTYA 1JPHA 1R3SA 4QQUA 1R3YA 4AY8A 3GVRA 3PPGA 4L6HA 1XR2A 3PPCA 2Q71A 4ZTXA 1R3VA 4WSHA 1JPKA 4L64A 1XDJA 1T7LA 1R3RA 2Q6ZA 4L65A 4AY7A 4L5ZA 1U22A 3BQ5A 3GVQA 1XPGA 1UROA 1U1UA 3GVVA 3PPHA 2NQ5A 3RPDA 1R3TA 1R3QA 4L61A 1YPXA 3CYVA 3T0CA 3GVWA 3BQ6A 4EXQA 2EJAA 3GW0A 1J93A 1R3WA 2INFA
chains in the Genus database with same CATH superfamily
4M5PA 3CUXA 2QCFA 3MKKA 2FJUB 3EXSA 5EPDA 3D6NA 3HV8A 2PLMA 1NTHA 1CW2A 1PZ2A 4K37A 4TMBA 1HL9A 2P5NA 2GOUA 1WXZA 2WANA 4KERA 4JX6A 1H63A 2WKGA 4WX2A 4MMWA 4MWAA 4NNBA 3VKBA 1IYXA 3EWYA 1AQHA 4QG8A 4LUTB 2A1YA 3PPGA 3NEHA 1X1NA 3T8LA 1JNEA 4UBPC 4JFUA 4K2SA 1Q6RA 4UTTA 1LF1A 3RJXA 1NQ6A 4MVAA 3EWCA 3H6OA 3BE7A 2VD9A 2WBKA 1TPWA 1X38A 4PUDA 4JTKA 4I7WA 2PC4A 3QH2A 3TC7A 1WXJA 5E1QA 1IGWA 1RAKA 4Q6JA 2HRWA 3EX2A 3H4WA 4RNFA 1G4EA 1FHUA 4IFKA 1TV2A 1NP2A 4H9UA 3QPZA 1YNQA 5D37A 3LNMA 4JAWA 3AHXA 4JBRA 1V93A 3AHVA 4NL1A 1W1ZA 2D3LA 3C4UA 3DHUA 2ZYFA 1R3VA 4BWLA 1L6FA 1K77A 4I3GA 3QV6A 1P0NA 1TVLA 1VRXA 4UOJA 3TA9A 3A3WA 3R4IA 2JF7A 4IMEA 3N14A 1P6BA 1XLBA 3N2OA 4G7EB 3SCPA 3PTKA 5GJNA 2GVLA 3ARQA 5I7GA 3F2BA 4Z2JA 2X1TA 5DXYA 3XINA 1SFLA 4K3ZA 1Q7MA 5KEZA 2ZDSA 4TX8A 4P61A 5DEZA 5IBXA 1W56A 1W5NA 3BLIA 1TPFA 2IS7A 1GOOA 5LHEA 3K13A 1Q5MA 1OYCA 4H8NA 4LAOA 2C13A 3ZLFA 3I7SA 5H1WA 2DSKA 5BW6A 1H51A 1RCOB 2J88A 3SRDA 3GB6A 3USBA 1EA9C 5F1VA 2XIIA 4R5EA 2VP8A 2OQHA 4AW7A 2AKZA 4OQVA 4Q32A 2V5JA 2DT1A 2PRHA 3HMJG 4K39A 2GVEA 4ORIA 1MZHA 4GYFA 1GQJA 2ON3A 3L2IA 4AIUA 2C6QA 3WEZA 4ZQOA 1YTDA 4XO7A 3AIWA 3EX3A 3JZUA 1BPLB 2WXDM 1Z89A 1K8YA 2ZQ0A 4FEZA 1GPFA 4H9ZA 5JMUA 3AS2A 4EPDC 3UZWA 1RY8A 3QMSA 4YLWA 4LF2A 2PF0A 1YXDA 4XAPA 1FWWA 1KBBA 3SW6A 3OBAA 3SECA 1NWUA 4MB4A 5FI8A 3ZM8A 4C6LA 2Q8LA 1CGWA 3QOKA 2Z2BA 2ZE0A 2FZDA 1QPKA 2DUXA 4HD5A 3C0QA 2BOGX 1OFAA 1UR8A 2DH3A 5CBJA 4O57A 2GUBA 1SUXA 5I79A 2H3DA 3KXQA 3W3OA 3K2GA 1VFOA 2J62A 2AAMA 2PWVA 2J6VA 4Z1CA 3PK7A 1BLIA 4AZCA 2J25A 4ZOEA 5GJMA 1CGXA 2NQZA 3GXTA 1G7VA 1Z32X 1P4CA 3ZSTA 1P0DA 1C9WA 5FACA 1PHWA 4QEHA 1ALDA 1E0TA 3CGTA 2ONEA 1ADOA 2Y88A 1JXJA 2OLHA 3FHQA 5H8MA 1XYAA 4RNHA 1N55A 3K8MA 2HEJA 4IPJA 4XD4A 4J3ZA 3DN5A 4AC7C 3FW6A 4UIOA 1W9BM 2NWRA 4QITA 4GUIA 3CLMA 1UUQA 3MHGA 2X16A 3S2LA 2R8WA 3VDHA 1R2RA 4OT7A 2E40A 1IEVA 4FXRA 4LW7A 4HNTA 1MFUA 1WUFA 2WC7A 3N04A 4R9XA 4N42A 3GTXA 4UWMA 4B16A 4Z08A 2KX9A 2HPIA 1NVMA 1ZJBA 2XFYA 4NILA 2Y70A 4RZ4A 3W7LA 4NZFA 1O7AA 5CSRA 3W2NA 1UROA 3CV7A 4JYFA 3WENA 4PEEA 5KINA 1XRTA 2WKJA 3NQFA 3MJMA 1RD5A 3GQYA 3MS8A 4IIHA 1V03A 3I6RA 4RXGA 3M0YA 4HCDA 4LWWA 5LNRA 2CLOA 4PTMA 1TR9A 2J8GA 5G1TA 2X09A 5EBUA 2G4JA 3C6CA 3T1GA 3T55A 3ITTA 4GYKA 3G2GA 4GUHA 3XISA 3W74A 3PBMA 4IP5A 1A5UA 1CGVA 5DMMA 5BRQA 4W5ZA 1K3UA 5D33A 1IV8A 4E4PA 4KEMA 3ONCA 3UU0A 3C86A 3VD7A 1U2YA 3S5OA 3KBWA 3LD5A 3BVJA 3W75A 1P0EA 1OK6A 2Y8VA 1S3TC 2PB1A 1FHDA 2QV5A 3POCA 4GQGA 3PNZA 3GG8A 5I3DA 1EKOA 1MW0A 3RLUA 1DXFA 4KEVA 2OLSA 1XRVA 1ZP4A 1OX4B 4FR6A 3NDYA 4MFEA 1H1ZA 1HL2A 1KRBC 1KW1A 2VD8A 1WCGA 4L64A 5FJUA 1E43A 1FWEC 3ZJ8A 3QBUA 2FH8A 2E9BA 4QJ1A 3SURA 4C6QA 1DIDA 3QMRA 2Z29A 4DWSB 1Q8JA 5F4XA 1RUSA 1UWQA 3GR7A 3QC3A 4OIFA 4ZMGA 3NDZA 4ZO9A 2W61A 4GH3A 5IFPA 4LV9A 3CTLA 2WNWA 2LLEA 2CHOA 3DFQA 1GHRA 3UJFA 3VFLA 1QNVA 5HXMA 3AIRA 3VIIA 1EJTC 4QRNA 1H50A 2BMBA 1V0LA 2PMQA 4Z17A 2FPTA 2GFTA 4GIAA 1KXHA 3R10A 4EPBC 4RCXA 1XS2A 3L0NA 2FHCA 4EXBA 4Q8VA 3V16A 4GMEA 3SI9A 1O66A 3OZOA 2ZTJA 4AXNA 2EAWA 1VGAA 4BF7A 1H1YA 3EX4A 2FLIA 2HXUA 3N9RA 4O1AA 4LALA 4DAFA 1LZOA 3PJTA 3EZ4A 2XGBA 3VCCA 4QDWA 3ERPA 4DZAA 1XRSA 4G1KA 3VC6A 2PBOA 4H9XA 2ACRA 1C8VA 1TR1A 1K1DA 1VFLA 1RVKA 6PTDA 4ZBCA 2A5HA 5LIUX 3LPGA 4OBRA 4IQLA 4R85A 2E7FA 5AY7A 1BRLA 1JCJA 5EBAA 1S39A 1R86A 3SUVA 2BOEX 5J5DA 4PZVA 1L2QA 3W0KA 4Q7NA 4YN5A 5L9FA 3MANA 2OWXA 1KCZA 2QUVA 2PSNA 4S3CA 1VRDA 3G0SA 5CJMA 1E1FA 3W7MA 3MO7A 3NTYA 2ZX5A 3TMQA 1JVNA 3P5YA 3FNDA 3IVTA 3TJXA 2J9XA 2BXZA 4AYSA 2V5LA 1SSGA 3QTPA 3WQVA 3LZ5A 2P0IA 1R47A 3H2MA 3LA4A 1NDZA 1C8YA 3CMFA 4S38A 1FWGC 4M6UA 3SCTA 3T4CA 4UTWA 1R8LA 4L9XA 3M7WA 3MVTA 2WZEA 3AIEA 3CHEA 3C0SA 1EUNA 1QMLA 2NV1A 4GISA 1ZJAA 4KIRA 1FKXA 1TTPA 2PURA 5A8MA 1TE6A 1LM1A 3VKAA 4LH8A 3BLFA 4JCMA 4PMYA 3VFCA 1JD9A 3KX6A 4YCPA 3L12A 2CETA 2CFFA 1E1CB 1V79A 2OQLA 2Z27A 1JQVA 4E2BA 1B5TA 3HQNA 3N18A 3OODA 1A5AA 2CERA 4GJ1A 4U33A 1NP0A 5AC8A 3REQA 1Z3NA 3ICJA 1TPUA 3ENLA 1XYFA 1XIIA 3OYXA 1AD4A 5HR7A 4DF2A 3Q45A 4B5UA 3SCSA 6ALDA 3OEXA 3E6EA 5E0CA 4A3HA 3OG2A 5CJNA 4E8DA 2PZNA 4JFTA 2ZCGA 2WHKA 2C71A 1DJYA 1O68A 1FUYA 4HIBA 4UFHA 1WDRA 5M2FX 1CI1A 1JGMA 4OFCA 4JQAA 4HVXA 4XIMA 5IFTA 2E6YA 2NX9A 3TSBA 1E0WA 4BQ3A 4YWIA 1S5NA 2OB3A 3TK7A 1Q6OA 5HJYA 3NOEA 3KP0A 2A6LA 3RM4A 1R5YA 2O92A 1DTNA 5AN7A 2QZRA 3PZ9A 4MDPA 3TDFA 5HQLA 3O1NA 4GI8A 2HISA 3WD1A 2PDIA 4X61A 4IISA 2BY0A 4K6AA 3PZGA 1V02E 4ICMA 4ZO7A 1AQ0A 5F7UA 2V63A 2DU2A 2FFCA 2NXHA 2R1PA 4CU6A 4XBKA 4GQBA 3LUTA 4NZCA 1NU5A 2C0AA 1X1ZA 3W1XA 3GAKA 3GFXA 2HE8A 3GNXA 4BR1A 4L4PA 4YMZA 1EJUC 4KRUA 1QUMA 3RLVA 2VOMA 2Y63A 3OIHA 2R91A 3AHTA 3V0SA 3GNRA 3BURA 4LC8A 4W89A 1OINA 1W5OA 1VIZA 2BGQA 2Z26A 4B4FA 1OBAA 2JGQA 2V30A 4MLRA 1KFKA 1YYAA 3BCJA 1A5MC 4U3CA 1PPIA 3SGUA 1PWLA 3BW2A 1UPMB 3WLHA 1OGSA 2NQHA 1PZ3A 1LWJA 2RKXA 1I2RA 3EB4A 1GJPA 3NQVA 1D9EA 1UUMA 1JZ2A 1VZWA 3GLCA 2E8YA 1AL8A 2HSAA 4TO8A 3M0ZA 3SUWA 4IICA 2ZRZA 1KM3A 4KEZA 2D69A 4DNHA 4X2RA 8A3HA 4DX3A 2BOFX 1ECQA 4LVDA 1W9XA 6TIMA 1A47A 4US6A 1ENUA 4FZIA 4AY1A 5AVHA 1OWQA 4WF7A 4UTJA 2YZRA 3W38A 1IEWA 1US3A 2ZXDA 3W02A 1TB3A 3CYJA 2I9UA 2D2GA 5REQA 3W71A 1QW9A 5I23A 2V81A 2X1UA 4N0RA 5FJPA 1KNWA 3DI0A 2OT1A 3K8LA 5B80A 4C1NB 2YDRA 3E0IA 4DWSD 1XPGA 1EGVA 2CLEA 1AVAA 3W1UA 2EG6A 3G8RA 1IXOA 1S1RA 3GHTA 1TWIA 2HDJA 2ZICA 3UA3A 4Q8TA 2DZAA 4ZTYA 3R43A 1R3SA 4PR4A 4WKHA 2E28A 1DE5A 3WMLA 3AUJA 3S2MA 3LZ3A 4LUTA 3TMLA 1MDLA 2V3DA 3TEVA 2W92A 1E9YB 2W27A 3T0DA 1EC8A 4CNSA 3E2QA 3P0WA 1UD8A 2AQWA 3FYOA 4LBRA 3NNTA 3S3GA 3SCOA 7A3HA 2OGJA 3GZAA 3W83A 4BS0A 4K8EA 3KM8A 1GG1A 2DPEA 1XIMA 3TW7A 1EJXC 3BW3A 1I4NA 1KBKA 3GFYA 3LTSA 1Y8BA 1VEPA 2XFRA 3M0IA 4AHQA 2XIQA 4CCDA 2UY3A 1SW3A 2BV9A 3AIVA 1RD6A 4N7QA 4WDUA 1OYBA 5C0QA 5DMYA 4QFUA 3GIQA 3NQ6A 3KBJA 3NOYA 5DO8A 2ALRA 4DHGA 1FWCC 4DWSC 3EWDA 4G7EA 3VNMA 4P7NA 3CL8A 2R24A 3P8JA 1W1VA 2WYSA 3QW4B 1A4LA 1I6NA 2PZ0A 1LRNA 3RMJA 3EMZA 1ADDA 4CQ8A 4XIAA 3DKLA 3CEUA 5A3HA 3WF3A 1RP8A 3RM9A 3GK0A 2OYLA 2WVVA 3E0WA 1OFRA 1MO0A 3AALA 1WBJA 1SZEA 2Z24A 4LGXA 1B1YA 1BXNA 1F07A 1F61A 1Q7QA 4FLQA 1W3KA 1HL8A 3N9KA 3EAUA 2GJXB 4QGCA 1A5KC 1Z9AA 2VUNA 1FP8A 1F8MA 1LOQA 3P62A 5G4HC 1R9YA 1EZWA 4Z42C 1XBYA 4ML9A 3VKDA 4B5VA 3CAQA 3LBCA 1UP3A 1Z44A 2GUUA 1U5JA 3GNOA 2IUZA 5LIWX 4GKLA 3T7VA 1O60A 4RE0A 2CPUA 4O8AA 3S9ZA 2ZBTA 1B3XA 3NL5A 1VBGA 3WBEA 5FL1A 3I10A 3WFLA 4C6JA 1EPVA 4AWEA 1YMYA 2F38A 5DX7A 4FK9A 2PU0A 2J7CA 4WDXA 3VM7A 2MNRA 1F73A 1T8QA 1E3XA 3BZGA 3C8NA 3FJ6A 1E9IA 4QNWA 4CNOA 3CHFA 1YRRA 1YPIA 3CO8A 4MKNA 4PMQA 5IHRA 1AD1A 2OKTA 3C5QA 3U4FA 1BWLA 4NRSA 1XX1A 3O6YX 3WFAA 2V5DA 3UCDA 3DOPA 1JI1A 3II1A 3CZEA 3W2KA 1T96A 3ONBA 1GEHA 1QHOA 1N8WA 2CLKA 2EJ1A 3N6JA 1KM0A 1EPXA 3S1XA 4O4VA 1OFEA 4GI9A 5A8GA 3A4XA 3MP4A 4KWSA 3GC5A 3MCOA 2ISVA 3L4YA 5AB3A 1Q6EA 5E0KA 3CK5A 3RYSA 1LTDA 1KM6A 5HJLA 2Z2AA 3OHMB 1WKDA 3OA3A 3IEBA 3MMTA 1KM4A 4LNCA 2O7QA 1E6ZA 4MZ8A 4MKVA 2W0UA 4JNYA 1JCMP 4W8AA 1OSEA 5AC6A 3IJDA 4F9JA 3DHPA 3EKGA 4XZLX 5A6JA 2J78A 2PWUA 4X2PA 1J0HA 1G4PA 5AECA 2PD9A 4TV6A 4EK7A 4GVFA 1VD6A 1WV2A 1RK5A 4UQAA 2X41A 1EH9A 4LYQA 2RDTA 5M5DA 2ZZ6A 2J7DA 4IJCA 4Y96A 3MVIA 1OD8A 5D2YA 4F0SA 1VFTA 3N17A 4Q4OA 5H6HA 4IX2A 3WNPA 1TIWA 1HT6A 4L1WA 3WQEA 4FNTA 3TOPA 4KBXA 4QISA 3CNYA 1K9DA 3GRIA 5JBFA 2QJIA 3VCNA 1VF8A 3T07A 3MKCA 1F7BA 1HP5A 1YDNA 1JDDA 1JYNA 2DSUA 4I7VA 4MG4A 4UFJA 1F5ZA 4XD3A 4XTDA 1HVXA 4W85A 4F3HA 1IT8A 3K5XA 5A2AA 1XYLA 2X7WA 2D3NA 2FGBA 3HG3A 1KGWA 1C9DA 4WKAA 3N34A 3UR8A 4HKPA 4XD5A 7TIMA 2X1SA 3G1HA 1HKJA 1R6WA 4FX8A 4O8RA 2WZIA 3EGJA 3S9YA 4HTYA 1WQ5A 4CVWA 4IIGA 4RDVA 1VFSA 2GSEA 1AJ2A 3OVPA 5BWAA 1ME8A 1M6JA 1YTEA 4AMAA 3QN3A 4PFHA 2INFA 3MZNA 3DECA 4V15A 3RO8A 5LNVA 3WBXA 3THDA 4PUMA 1NWRA 4DWSA 2ZXBA 1GONA 4AZ5A 1FP9A 3W7NA 4UC5A 1AJZA 4Q4PA 5CPQA 3NUKA 4JXCA 3RIKA 1XDLA 1FH8A 4FXJA 2XYLA 1RVGA 2OMAA 3E96A 4PMRA 3NDOA 1QPRA 2VC5A 4P8XA 3M07A 4HK5A 1B4KA 4DUWA 4IGMA 3TSMA 1EYWA 1R0MA 4HGXA 5M1TA 4HA3A 3EKLA 2W62A 2VC6A 1OK4A 2ATSA 3APGA 3W72A 3NCOA 4NRRA 2BS9A 2YB4A 1W31A 5BNKA 1ZBWA 4NX0A 4UZUA 2HE5A 1B3WA 4O54A 3AIQA 2VMFA 2PDNA 4AWUA 1T7LA 1CPUA 3M0HA 5CXPA 2VR2A 2ZTKA 1E56A 5EMYA 7CGTA 5D2XA 1OQFA 1V8EA 3JR2A 1H7WA 3QLLA 3TN4A 3MW7A 1RQBA 1DORA 2E5DA 4IMFA 2CESA 2QCMA 1GW9A 1J4EA 3ZXWA 4EF9A 3ELFA 1EJRC 2BY3A 4PCSA 3W2JA 2OT0A 4YS1A 1UKTA 3N3TA 1GNXA 1T8XA 4JQ3A 1JDCA 4JIPA 1UWAA 4HNCA 3CQIA 2BY2A 2F6UA 4N9CA 1XIFA 2XVNA 2JKAA 4N2YA 1QTWA 1E1EA 4OHQA 4WK9A 1UBSA 3NQMA 3TYCA 2OOFA 3MO4A 1UASA 3E2VA 4B2DD 3RPMA 3KVLA 3M1ZA 3LPPA 3L21A 1B2YA 3TX9A 3POHA 4XG1A 4Y9PA 3NZGA 4HU4A 4ZXLA 1Y5XA 4JFSA 4MM1A 5JH1A 1DJXA 3ZVHB 3DEQA 4IL2A 3F2CA 1G67A 4HCLA 3EOEA 4J28A 3UBPC 5C9UA 5I78A 5IDZA 2OR2A 2DZWA 3G0XA 1OCBA 2PAJA 1VS1A 1EXPA 3VDAA 4A29A 4PULA 3N13A 3B8VA 1GTEA 4OZOA 1GT8A 3VNJA 5A8NA 1A0CA 3COTA 5LXXA 4ZB0A 3NQDA 3EDJA 4C6DA 4KCUA 4S2CA 3QC0A 1K70A 4M3PA 3FKRA 1R87A 1JZ5A 1XLMA 3TTQA 4Z0SA 5GJPA 3VOFA 4Q8MA 3P6LA 1QXLA 4O11A 5C54A 3RR4A 4RJEA 4ZEPA 3OJGA 5BMWA 2OX4A 2A3LA 2PP3A 4MADA 4JR5A 4IL0A 3WNKA 2VURA 4PGLA 4NXKA 3TWAA 4LANA 4JN6A 2GUYA 4HHMA 4GYPC 4RV8A 3SADA 2PDGA 1E1CA 3U8GA 3LN3A 3BO9A 3W7JA 5D32A 1HKWA 2QJMA 3OYZA 2WCSA 4PE8A 4ACYA 3RCNA 3A3XA 1P43A 2MUCA 3ATZA 1TZZA 4RZ6A 1EP3A 4AIEA 4R88A 3C2OA 2NUYA 4ZOCA 2BVTA 5BMXA 1W2PA 3TROA 4JPGA 1A0EA 2QDDA 3IV8A 3G8EA 2BB0A 1YHTA 3A24A 2OPJA 3B04A 3SY5A 1V4YA 5EMUA 4F40A 3LHWA 3H54A 3S83A 1ITUA 4JTLA 2WMJA 3PG8A 2CLHA 2Z1VA 3WG6A 3W26A 4TTGA 1AZ2A 1OVDA 2E0PA 3B4UA 2G41A 2OYMA 4M1RA 1E4NA 3NSXA 4ZB5A 4KEUA 2P1FA 5DRIA 3LLFA 5M17A 2E67A 2KZHA 1J18A 4W7UA 3VUSA 4HMEA 4OU1A 1UQZA 4UTMA 1AH3A 1CB2A 1OM0A 2FH6A 1WNOA 2V5KA 1RJPA 1K8CA 2OLAA 2FZBA 3U7VA 3M5YA 4LEFA 1IWBA 1O6IA 3PBGA 3KE0A 3RK8A 2Y2WA 5A1AA 3L5MA 2DEPA 3NYDA 4HNOA 3WLOA 2L5HA 1W1YA 2J8FA 1LL7A 1S2VA 5C2GA 2ALDA 5MHBA 4L4OA 3WD0A 4KQNA 2I17A 1JD7A 4HN4A 1PDYA 3R7MA 2XIMA 2WHMA 3CJPA 3IAPA 3P5ZA 1HW6A 4YIWA 4AVFA 3BPWA 3O3RA 1TPVA 2WWCA 3NA8A 5HMDA 1NDWA 4JTEA 3U2ZA 3HJZA 3BG3A 3IJIA 4D6HA 4XISA 2CLLA 5ABGA 3CB3A 4OBTA 3NQ2A 1UWTA 3W4RA 1ITQA 1NEYA 3FIGA 1OG6A 3WBYA 3G0UA 1KGXA 3CBWA 2DZUA 2FGLA 3PWGA 2ZZ2A 2VRQA 3CAWA 2H9AB 3R13A 3UFYA 3FXYA 3QY8A 2R82A 3A4WA 1BSIA 3M0XA 1B54A 1G4SA 3VINA 3HURA 4YTUA 2PTYA 4Y7EA 3PFRA 2RH9A 3CMJA 5FEZA 3O6DA 4RZBA 4DQWA 4C90A 3L4TA 1V0MA 3RF9A 4LUJA 3GNNA 1WZMA 3C61A 2A3CA 3WK2A 3VNZA 3F5KA 3OZYA 3VGDA 3NM3A 3AXKA 1SR9A 6CGTA 3MBFA 1EEPA 5T8GA 4CQAA 1A5OC 4O18A 5A6AA 4C1NA 1I0DA 4D6CA 3WLMA 3CIVA 4JZ5A 4L6DA 3FK4A 3AJ7A 2VEFA 4U31A 1E4IA 3UVIA 3NJ3A 5IXEA 2INEA 4DLMA 2PRMA 5BRBA 4C6CA 3GIPA 2P8CA 3R94A 1S5WA 1W3NA 1ZZMA 3BOXA 4OGZA 2HMCA 4D6JA 3ARXA 4YHGA 3MA8A 1V6WA 3S0CA 3MUZ1 4N6FA 4W87A 1BGAA 4LRTA 4HZMA 2JIEA 3O0FA 1J01A 4ZO6A 1V02A 1BXBA 2DP3A 2TSYA 3ZZ1A 4UNKA 4DZHA 1EXBA 3UP8A 1HGYA 3T2PA 3ZVIA 1A0DA 1HZYA 4HSNA 3W25A 3AS1A 1CXHA 4E4FA 1EO5A 3URBA 3FA4A 2BXVA 2XTKA 1YDYA 3HOJA 3AROA 5BYWA 2GGJA 4JHOA 3L2MA 4XB3A 2ZZ1A 2J9ZA 3N2TA 3FSTA 4MJ2A 1BHGA 6XIMA 1GOKA 1ZL1A 4H00A 2CWNA 3QYQA 1W9VA 2O9TA 1DHPA 1SVDA 5DCBA 3C3UA 2VENA 1XIEA 2I5GA 4QBXA 3KCLA 4RZ5A 4GYPA 1ZY9A 4GUGA 2QUUA 3WK3A 4E2VA 1HKMA 3GG0A 5FOOA 4B2DA 3CPGA 4MY9A 4HZ6A 1NH6A 1VHCA 1HKVA 3GKFA 4JTAA 3DBNA 3INPA 4UCFA 3WLKX 3QYSA 3SQLA 2YOCA 5C2XA 4DYJA 3QGKC 3IIPA 3GDMA 3H21A 1M3UA 3CPRA 3USZA 3VE9A 5CCZA 1C8XA 3C3NA 3R5EA 4M0XA 2BVWA 2GJXA 2HCVA 2NLYA 3PZQA 4D8ZA 3VNLA 3TE9A 1NWTA 1UZ4A 1QNQA 1YNPA 4R3UA 3KL0A 3E49A 3RLGA 4FS9A 2C3ZA 1PO9A 4PFMA 3O6AA 4Z2LA 5HNNA 3PBYA 1QI3A 3ATYA 2VX5A 1H5VA 3N9SA 3UXAA 3UJEA 1Z7AA 4CQCA 4PBEA 4D1IA 1F3XA 2CLFA 2SFPA 2EXOA 3MT1A 4E3VA 4I5UA 1TWDA 3EWUA 1UIPA 1XKJA 2BBFA 2FGZA 4A2SA 1UD4A 4Q8PA 4A6GA 1GJUA 2VQTA 2C91A 1UB3A 1EOKA 1V6UA 4ML4A 3DGBA 3ZLHA 3U3HA 1JAEA 1GORA 5H2ZA 1R9XA 3DFOA 1S46A 5ABTA 2ZADA 4NX5A 1CXKA 3VNIA 2XVKA 2I9EA 3BC9A 2OODA 3CASA 3N12A 4Q4SA 3UT0A 4C5ZA 2X0YA 5HWNA 9XIAA 3E12A 4Y9OA 1DJWA 2WOQA 4Z2KA 3QHNA 4FB7A 1P0KA 3BAXA 4N4PA 3WLIA 3UVAA 5KZEA 4D8AA 2BHUA 3H2NA 1G9HA 4AEOA 4FMVA 2VRKA 3V1HA 2HTMA 2DDXA 1NF7A 5D8ZA 5BU6A 4NUWA 3RDKA 3AS3A 4U28A 1TV4A 4QG6A 3IK4A 2E3ZA 1BTCA 2YKKA 3JW7A 4LAMA 3SR7A 3QR1A 3WMCA 3A12A 5KZ6A 1TZ7A 1YEYA 1DJGA 1RH9A 1QW8A 2QVNA 1TE1A 5D02A 4PTVA 4QXIA 4DXXA 4G2DA 1VIWA 2YDSA 4HMDA 3GKAA 4LNYA 1QU4A 3RU8X 1M1BA 2XGIA 2YDAA 3AOFA 1ZB5A 3GDLA 3L4VA 4M56A 5AVNA 3BGGA 4ZQPA 3OW1A 3TWBA 1SYTA 3L4WA 3B9AA 4UTHA 2NT1A 1E9LA 2VM8A 2O4MA 3M5XA 4GXMA 3K8KA 3VC5A 4F48A 4MPQA 1EOMA 1ZNNA 1J0IA 3M0MA 2O4QA 3GIYA 3ARSA 3LRKA 4PMVA 3MP3A 1RXOB 3TN6A 3ID7A 2PD5A 4P8UA 3IUHA 3SN4A 1TWWA 4ENLA 3BV4A 2HNEA 3TOYA 1J9YA 5HR6A 4PL1A 1U1HA 2C1GA 3TYUA 4B15A 4ZODA 3CUIA 1DV7A 2XHYA 1OT1A 2VZUA 3SCVA 3GG1A 2XFWA 3MWAA 3VILA 1EC7A 4Y90A 1XI3A 3R25A 2NQJA 3W87A 3ZYZA 4NT0A 4OJYA 4BI5A 3RILA 1J2BA 4GACA 1ITXA 1ESWA 4I9MA 4J3XA 4XWUA 4MY1A 2XM1A 2QJHA 5EU9A 3I68A 4BY3A 4G9PA 1CYGA 3UWEA 1WDWA 2F2HA 5KMYA 3GVWA 3GHSA 1WKFA 2W3ZA 2QJGA 2GWNA 1TSIA 3I6EA 3UXIA 3O6CA 1P6WA 3OHIA 3CZLA 2J8TA 3RU6A 3TTOA 5A94A 3DFSA 1F4AA 1QI5A 1TTJA 3M0JA 4HQVA 3P14A 2VZTA 2EPMX 4ERGA 2OO6A 4GBUA 1QNSA 1OFQA 1V6VA 4HU3A 3GHUA 1CCWB 3VD3A 1V7AA 4YPJA 1FTXA 4ACZB 3AICA 2A0NA 5TQLA 3DDMA 4N9DA 4HHPA 4XUYA 2CEQA 2GZXA 1EJ7L 1LROA 4KIEA 2QCEA 3U48A 2CLIA 4WEVX 7TAAA 5ECVA 4UOZA 5BOOA 3T42A 1E72M 1IWAA 1CGTA 3TNBA 2WJDA 3GS6A 3LYEA 4WSHA 3AFBA 3BTNA 3H55A 3GXMA 2WMFA 4QJ3B 4MPKA 3SCWA 1L6GA 3P82A 4UFLA 5E6YA 1DJNA 4JKKA 3GNDA 4TMCA 1U1JA 4XV0A 5AC4A 1IXNA 3W73A 4AD1A 3HGRA 3KOYA 4M51A 2QMJA 4Z2HA 4PODA 4MZYA 4JY9A 4AWSA 1FRBA 4QIUA 1BYCA 4RPPA 4B5TA 4O4WA 3EOOA 3DAQA 4IMAA 4W9TA 1DIEA 1GK8A 3NEVA 4XZMX 5A6TC 2Y1HA 4RX0A 1Q45A 2DQXA 1XLLA 4KF1A 4QNEA 3LCGA 3PUOA 1ZGDA 2X40A 1VYPX 8CGTA 3CHCA 2J75A 3EDFA 2G5WA 3N2CA 3DC0A 3TSDA 3LMZA 3ZVHA 3S1UA 1EDTA 5DBTA 2WJEA 3CIXA 3WLRA 5CC7A 3P80A 3JU2A 2Z4GA 5F2MA 4JICA 1WXYA 4ZVJA 3OU8A 1G6CA 3RXZA 5K3VA 3UWZA 3UWQA 1GVYA 1F6YA 1HXJA 2YCEA 5FD0A 3TU9A 2E4TA 3UQNA 2QF7A 1A5NC 5G2IA 3IJ6A 1TPC1 1A5LC 4O1BA 3Q67A 5DXXA 3SN0A 2XH7A 1E4MM 5DFAA 3VA8A 5SWUA 2V3FA 2VCBA 1GKQA 1CTNA 4MJMA 4ZXOA 1GZJA 1F4HA 5FESA 4LAUA 1I0BA 4LY4A 2ODOA 3RGTA 1IIGA 1FWFC 4GBDA 2Z2UA 1HTIA 4S3DA 1DQXA 2Q8ZA 4PMZA 1HP4A 1KA9F 5BRPA 1M7PA 3WMBA 1U5VA 4HHHA 1M04A 3OB8A 2VRJA 1XLFA 3UYIA 1Q3NA 4C7GA 1QO2A 2GPTA 3DCPA 1LRQA 4AHOA 3B8SA 3L66A 4JIHA 4HU8A 1K4HA 1OCNA 1ZP3A 1I45A 4JQ4A 2ACSA 2WM0A 2E6FA 1LT7A 4M8UA 3W2UA 3IUDA 4GJIA 3DFPA 1ZAIA 4F0LA 4E8GA 4Q4RA 4NXSA 3S1GA 1AA1B 3OTRA 1UZ1A 3D5HA 5EFFA 3TZNA 1VBJA 4O13A 3KS5A 5FEWA 2PS2A 1B31A 4PMNA 4FF7A 1IR1A 5A6MA 3NO1A 4MB5A 4FO4A 1B90A 3OPSA 2DSZA 4PCNA 1MEIA 1J2WA 2X0SA 3IIVA 4UR7A 4A8NA 4L6OA 4P7LA 4QQUA 5A95A 4TOQA 3TLQA 1XPYA 4H2CA 2YLLA 5GPRA 2AMGA 4C6KA 3GH7A 3CL7A 3LX9A 2YXGA 2QS8A 1I2NA 3LNPA 1GJWA 4RDYA 2VI0A 1JL8A 5C9WA 5I00A 3MI6A 3IK2A 1TVPA 1AW5A 3SIMA 3LCXA 1MXSA 2PBGA 3WLPA 1XH2A 4GVIA 1X8FA 3TLLA 3KBSA 3KS6A 4I8DA 1R3RA 4GNJA 5L6UA 1AQFA 1BVZA 4LYKA 3STEA 1PB0A 4BQ4A 3UWVA 1TKKA 4ADTA 3GW0A 4QR6A 2BHZA 1PVNA 2R1KA 3O06A 5D38A 2JKEA 1H7NA 2WM1A 4H6EA 3IANA 3MMDA 1XG4A 1GPWA 2Z1KA 3G1VA 3SIZA 3TYBA 4WUIA 2NZLA 4ZQCA 2BVDA 3WQ6A 1UH2A 4UZSA 1JXKA 5C55A 2BDQA 1KCKA 1REQB 4IUGA 4DZ5A 1UP2A 1OZQA 3LCWA 1LWHA 3PFMA 5I09A 3TYDA 4MF4A 3BLLA 4QQ3A 2H9AA 4LBUA 2X7VA 1RV8A 3MTWA 1CT5A 4J27A 3HQPA 2POTA 2RGLA 4OOZA 1CLVA 3BG5A 3WQGA 5LXEA 2VGBA 4R33A 1B3OA 3HGSA 2XUCA 3CQJA 5D9NA 1FWRA 4MTVA 4Q8QA 2XZ7A 1D7KA 3NZRA 2G96A 2WC4A 4FX6M 1W5MA 2YDQA 1FY6A 2CITA 4LAZA 2EPNA 3MHUA 4QCFA 4C6EA 2HJPA 2PF8A 4KWVA 2VGIA 1QWKA 4PH6A 5D09A 1F05A 3IVUA 4QSHA 4N9EA 4W4QA 1QI4A 1JRBA 1ECEA 1EYEA 1KQYA 1YKWA 5DRCA 3FAWA 2UV8G 5EY5A 3BJSA 4IIFA 3BUVA 3CO4A 2DJXA 2PP1A 4WXYA 1GVRA 4CNPA 5LNUA 1SGJA 1MRAA 4V27A 5D2TA 2YW4A 2V5CA 5DT5A 1R46A 2NUXA 2VR5A 3DESA 4TR9A 3QPYA 5CPTA 5BROA 4QAWA 2ZUUA 2G3MA 2ZA2A 3BW4A 3AMKA 4TVUA 1SO6A 4LUSB 4XUGA 4G6CA 1MQQA 3IIZA 3M7SA 1SO3A 2YCKX 3PANA 3U2OA 2BP1A 3FVDA 3IWPA 4GX8A 2FZ8A 1NFPA 3MY9A 1GOXA 4FI4A 1JCLA 3F5JA 2BXYA 5KZDA 4M1BA 2WSQA 2A7PA 1KR1A 2PDQA 4CEUC 4UFKA 1SQ7A 1SZFA 2NUWA 2Y7EA 4A3QA 5D2VA 3M6YA 3QFEA 1DPMA 3KCJA 3W6MA 2GJNA 1POKA 2CIPA 3UY7A 1J0KA 2FKPA 3U7BA 2YBUA 4J40A 4MZ1A 3TJLA 2HQAA 3IIOA 3QPEA 1H7RA 3UERA 1QI2A 4E2DA 3EPNA 3PY2A 3G5EA 5ABEA 4UQ9A 4AZIA 1PHQA 3KEHA 4CD5A 2FB3A 3QKEA 2GQ8A 1LYXA 4HNUA 2EBNA 2DT3A 2VCAA 2I14A 1TQJA 4WOZA 1NF0A 1DKWA 1A53A 4NZJA 2ISDA 3M16A 3QXBA 2A7RA 1JYVA 1FA2A 3DUGA 2ISWA 1U1UA 3H8AA 1MXGA 4LUIA 3AUOA 4CCZA 4GXPA 3W22A 2WBGA 3HPFA 3K4AA 3NQCA 3ZFHA 3PUDA 2WHLA 4AISA 1BF2A 1TQXA 3FA3A 4K68A 3CUZA 4DM2A 3W84A 3LHZA 3SBFA 3ZSSA 1XLJA 1NOFA 4HN8A 3AWNA 3F5LA 3WBWA 4JCLA 4S3EA 2VC7A 2CXEA 1TJPA 1DJQA 3AXXA 5D9PA 3VPLA 3E0VA 4RXFA 1ODUA 1EBHA 3UZ5A 1GW1A 4NY2A 1W6TA 2CHNA 2FVMA 3WQWA 5AOUA 3KRZA 4C6PA 5HINA 4H01A 2VUYA 4EAMA 4RDWA 2W91A 1TVNA 4PTNA 1XCFA 4DRSA 3OVRA 1DIOA 5K4XA 1JCTA 4EVZA 5CLWA 3P0XA 3TYAA 4RDZA 5GNZA 1US0A 4LPCA 3FLUA 5JBDA 2YIHA 5CQ1A 3SAZA 1IEQA 1XIBA 3FKKA 4XKYA 1PBGA 2DT2A 3W1AA 5FEXA 2FYMA 1E5JA 4HYVA 1MUWA 2V5BA 3WNMA 4OWGA 2B7PA 1ZS2A 2XN0A 3ALFA 2FZ9A 4Q8OA 1KD0A 1QNRA 1IHIA 3KTCA 1UQYA 3PM6A 5CPMA 1UD2A 3U0HA 1B3YA 3CUHA 3DH7A 4I90A 2WSRA 3KBMA 1OIMA 5CH9A 5TAOA 1K8ZA 2D0HA 3SFKA 1XSJA 1SJBA 3EKZA 1DJIA 1X6UA 2J4GA 3CT2A 1FHVA 1XQLA 2XZ9A 4FNRA 2YA1A 5CG7A 4XBJA 2CZFA 2QCDB 2W5FA 4KETA 2Z0IA 4J4KA 1TMHA 1J6PA 1V6TA 4H7ZA 3GVVA 4X0VA 1DOSA 4P7QA 3I65A 4MOZA 4FXFA 5C7VA 1VENA 3P67A 1UWRA 4NI3A 4PMUA 4QAIA 5MF5A 2A7NA 1O1ZA 1H4PA 1PKLA 2HV5A 3W28A 1SMDA 2HROA 4ERAA 2QIIA 2UY5A 5F2IA 3M43A 3KVMA 1A3WA 1KV5A 2XINA 3KP1A 4ZB2A 2A2IA 3B4YA 4ROQA 2EG7A 4JYEA 2RDXA 3GTIA 4QLLA 3S4TA 3WQCA 4O52A 5F2LA 2OXNA 2W9MA 2VFHA 3PZMA 4GLEA 2CWXA 1HNYA 2ZZ7A 3PF3A 1PYMA 4Q4KA 3TP4A 1W5QA 4O14A 3V5OA 4PB4A 5CBIA 4K38A 2ACUA 3R8HA 4CN1A 3BSGA 3HGOA 2G3NA 1VBHA 2DJLA 2V69A 4KCWA 3BLDA 1ZCOA 1CGYA 1ISZA 3BLKA 3P93A 1V3HA 3KFTA 3U4AA 3VIKA 4H1ZA 3OGVA 4MGGA 2GJLA 4XD6A 4CKQA 3NL6A 1QK0A 4Z1DA 4IWWA 4GGBA 4G1NA 5CZKA 5CC3A 1TIMA 3IARA 3O16A 4R9OA 1TMLA 5FEPA 4GUJA 4DF0A 4PB5A 3L67A 2PDBA 4M19A 3WSUA 3F1QA 5HMSA 3AS0A 5GQBA 2PODA 4IUOA 2OG9A 4HK6A 4NYYA 3UPWA 4AZBA 4QDPA 3AI0A 5BWFA 3C2RA 2ZUTA 4PUWA 2I16A 2JFEX 3LI1A 4WJXA 4CEXC 3STGA 3MUY1 1XH1A 2HBXA 3LTPA 3BL3A 3QMTA 4GZEA 4GI6A 3N2MA 1JUKA 3PZIA 5CC6A 2XM2A 3K1DA 2D0GA 1PE1A 3C56A 3CUGA 3TC3A 1SZNA 3HPZA 3VGEA 3M47A 1D8WA 2WC3A 2W6RA 3A9BA 5LIKX 4F0MA 1FDYA 1EP2A 3V5CA 3J7HA 3L68A 4NG3A 4UTUA 3OVGA 3G22A 4DO4A 1GOMA 1JEZA 3VZXA 1H62A 1UUOA 2NLIA 3M6DA 2WMIB 1XCXA 3U57A 4HMNA 2OU4A 1KB3A 4ZSTA 1B9ZA 4E0CA 2KAUC 1G5AA 2EKGA 3HM7A 1TZ9A 4MNLA 4WKFA 4CCEA 2R6OA 2FDMA 5FF3A 4JNZA 3STCA 1ZJIA 2JQXA 4ACZA 3JZEA 3C2FA 3APYA 1UR0A 3NWRA 3CT7A 3SUTA 1MUCA 3LK6A 3FXGA 1UD6A 4JL1A 3B8IA 4X22A 1AUSL 3ARPA 1H41A 3L4ZA 3WH6A 3NQAA 4F9DA 5E9AA 2ZA1A 4E8CA 8XIMA 2PLJA 4MUZA 3IRDA 2Q3RA 4DI9A 3SO7A 2ZXQA 3HV9A 3ZR6A 3S2JA 5I77A 3DFTA 3LG3A 3TAOA 2ZC1A 3HMCA 1Q6FA 1L9WA 3BXWA 4AWTA 1F3WA 3SN1A 1NARA 1L2UA 3NVTA 4JHMA 5HMEA 3GC2A 5C9XA 1Q6GA 1GVFA 4K7VA 1GQIA 1HQTA 4JIRA 3IJ9A 1L0PA 4G56A 2HVOA 1LUCB 4ZCWA 3BICA 3PN8A 1LT8A 4Z0JA 3AU2A 3UGVA 1WDSA 5XINA 3SB0A 2B81A 4GQ0A 2AQOA 3UJSA 5D8WA 4JTFA 1V0NA 2WW5A 3MHFA 2EPKX 2JKPA 2EG8A 2D73A 4DBWA 1DQUA 3ARRA 3O63A 3O7UA 3QJAA 4WXZA 5HWJA 3WH9A 5AKQA 4GNVA 2ZUSA 4M80A 4CLMA 3THCA 3SDOA 1V3LA 5A5WA 3TFXA 4CGTA 1FWSA 1VPYA 1P1XA 3QSRA 2ZWYA 1OX5A 2Y7FA 2CLPA 3CEPA 1F74A 3PPCA 1ZJHA 5JQ9A 5C9RA 3QHMA 1TRIA 2HS8A 4HSHA 1Q2SA 4NKCA 3CQKA 3HFTA 3GO2A 3PJXA 3BZJA 1XRFA 4GY1A 3CS2A 4NAEB 5HJXA 2QKFA 3HZ3A 3QW3A 4AD5A 4ZO8A 1CXFA 3EOUA 2D20A 4YYCA 4HOZA 3WJSA 2YYTA 1ZAJA 1TJ1A 1JPMA 4J9JA 5HOSA 1TPH1 5T9BG 1UWIA 1EIBA 3DHFA 3N1AA 3BARA 5FAGA 1W3TA 1KBIA 4AG0A 1S2WA 1UH3A 1FWJC 4DUVA 2VVNA 1X7FA 4FAMA 1QNPA 3FA5A 5EMKA 1PSCA 5CJ5A 2OZ8A 5FF7A 1PX8A 5HDRA 1KXVA 1C8QA 1W2VA 1LCOA 3RO6A 1R7AA 4UQBA 3ZIZA 5RUBA 5J04A 3AMDA 4JL2A 2PDPA 1JR1A 3SJ3A 2Y7DA 3B8WA 3W82A 3VUPA 1VCFA 4D1JA 3CWNA 3W07A 4ZE5A 3RX4A 4TIMA 2X1IA 1K6AA 3GTNA 3W81A 3VIMA 5D9MA 4CU8A 2YZ5A 4Y8EA 1H5YA 3GXDA 3G1RA 4IPNB 1VR6A 2QVHA 4S3AA 2VX6A 4QJ4B 1A49A 1FCQA 4LCSA 4GCXA 3WQ5A 1FVPA 3K4DA 1Z69A 2AKMA 3AXHA 7ODCA 1D8CA 1ZPTA 2ISFA 2QPSA 2UZ9A 4TX6A 3GDTA 4I9JA 3NPXA 1WZAA 2EQDA 3VX0A 4U3AA 1YNYA 5I06A 3UZJA 3S9IA 2WCGA 3WK0A 1K6WA 2E25A 1A4MA 4J35A 2EF9A 5H8PA 2Y0FA 4BQ5A 3W1LA 2TRSA 2V82A 1WP6A 1HGWA 1BD0A 2EGZA 1FKWA 2J79A 3GDRA 3ABRA 1XLDA 4M24A 1J8VA 4W88A 3V5FA 3FEQA 3MSGA 1AMYA 3SUUA 2R14A 3N73A 2ZX7A 1GYMA 1E71M 1DXIA 1D3HA 3N29A 4IH3A 1MI3A 3O8AA 3OGRA 1FDZA 4AQLA 4O1CA 3WZ0E 3B0UX 3G18A 3UJ2A 3D46A 3FS2A 2D22A 3MI3A 5FL0A 4F2BA 1BGGA 4QJ5B 3UG5A 1A80A 4B5XA 5HBFA 1E6PA 1A5BA 3AQUA 1EX5A 2IKJA 3ALGA 3SQMA 2B7OA 2Z7GA 4WHBA 3OLIA 3UWUA 5KETA 4LSBA 4JIQA 2A3BA 3SFWA 3CXOA 3CUFA 6A3HA 1TPDA 3VMNA 2CZEA 1AW2A 2IXVA 1KRAC 3VM5A 3WEMA 4IFOA 4C6FA 4H7CA 4QTGA 2VFFA 1REQA 1ISWA 1W32A 1AZ1A 4PA8A 3GH5A 4NJJA 4P7RA 3WYZA 4WJ8A 4LJ3A 3VU2A 4LS1A 3UPMA 2YBTA 4RNIA 4FLOA 4DI8A 4LB3A 4JD4A 3W24A 1VC4A 3WY1A 2QYGA 4MB3A 2VWSA 4GA8A 4TX9A 4Y6GA 3GXPA 5GNYA 2Y24A 1TPEA 5K4ZA 4YNGA 1P48A 4MSSA 3B9EA 1E6XM 3TTSA 2WLYA 1T6MA 4P2VA 4QE4A 1XFBA 2VDGA 2NX3A 2YX0A 1NJJA 1OIFA 1UH4A 1A3HA 3VZZA 3LTYA 5A8QA 1R9ZA 3NG3A 4XSLA 2X42A 3ITGA 2CHRA 2WZTA 4A8RA 2CXGA 5U7SA 2YSWA 4DUOA 4H2HA 1PJ9A 1EQCA 3C0LA 1GG0A 3EB2A 3WK1A 1XLGA 1CLXA 3W6YA 2ZE3A 5J8LA 4BJHA 4A2RA 3UR5A 2CU0A 2GLKA 5EL1A 3BGJA 4MKSA 1DEDA 1M01A 4KWWA 1NWSA 1JPIA 2FHFA 3DZ1A 4C1LA 1HUVA 4AX7A 3D3FA 3ORWA 3EEGA 3T8QA 1VFUA 3S46A 2H6RA 3ABOA 4U10A 1UZDA 2TPSA 1YPXA 4G8TA 4F2UA 1A5CA 4LUSA 3RFAA 4D6IA 4DELA 3H12A 2HZGA 4C7DA 3NL2A 1HX0A 3QRHA 3WQDA 1V6YA 1E73M 5DMNA 4XKMA 4BI7A 2YLAA 3W29A 2TYSA 4GQRA 3T9PA 1XCWA 2WLZA 4QG9A 2FDSA 2FFIA 3WH8A 3AHZA 3CM4A 2PWGA 2VXNA 3GYEA 2HNHA 4BI6A 1ONXA 2GVGA 1K7EA 1DIKA 5FA5A 1QDSA 3NGFA 4WIWA 4B5WA 3S8HA 2QV4A 3NR0A 1V51A 1XIHA 2GGHA 5AHEA 3OVQA 4LQ1A 4ES4A 3OOQA 5D04C 5HQEA 4GIEA 2Z7KA 4FR1A 1RY0A 3LSCA 3FCPA 3GZ3A 1H0GA 2Q71A 4PTDA 1M7JA 3LM7A 4DO5A 1J10A 2X0HA 3H7VA 1PCWA 1QJWA 4Z2IA 2OWWA 1QI0A 3CUJA 5K2ZA 2OTDA 1M9HA 4H9YA 3EDEA 1YE4A 3A21A 2OGYA 4AY8A 3WJZA 3QQWA 3VI2A 4L65A 3WUBA 4H9VA 3VIJA 1FWIC 4BEQA 1M5WA 4UB9A 1RSCA 3WNNA 3TC6A 2QDHA 1EGZA 3CZGA 2GL5A 1NIUA 2C15A 4IGHA 2JEQA 2VJXA 3AO0A 3FFSA 4IOTA 1GKPA 2DQWA 3VTRA 1C29A 4XBSA 4BEUA 2IXUA 1FWDC 3DFYA 1JULA 3CV2A 2XJ7A 2PDKA 3PULA 4M6QA 1BG9A 3VOGA 1FCUA 2RFGA 1BVWA 1XDJA 1JRCA 2W4XA 3IV3A 5CGQA 4EWJA 2J7HA 3A4AA 1KV8A 1H7XA 4FIQA 1XBVA 1ONWA 4QP0A 2WMGA 1G69A 3LM3A 3BCDA 1JFHA 3V0TA 3SCRA 2H90A 4QS6A 3O07A 2DIJA 3QR3A 3HN3A 1OY0A 3UG4A 2J7GA 4NIRA 2QDEA 4L1XA 3DENA 3V4BA 1U22A 3LB0A 1IWPA 4HMCA 5I3FA 5LGXA 2R94A 2WSYA 1OT2A 1WX0A 1S2CA 2CC0A 4AD2A 1LWIA 1CXLA 1QK2A 3K46A 2DZVA 3NVDA 3VE7A 5XIAA 2QCDA 4GXWA 3Q65A 4CD7A 2BLEA 4W5UA 2QEZA 2VOTA 3AZSA 2J7BA 2YGYA 3NYZA 3PUGA 1VCVA 2P53A 1J0ZA 3E9AA 3MV11 4PUJA 3GR8A 3L9CA 4O0KA 5CGTA 2Y62A 4DM1A 3GYCA 2FVLA 4H19A 3FOKA 2CBJA 2O56A 1KXTA 5LKYA 3TNOA 1EJSC 3BAYA 1YDOA 1Q85A 3BOFA 3TUUA 1MVYA 2OEJA 3KUMA 4MAZA 3QVQA 4JKLA 3T0BA 4WSJA 2QHAA 4JTJA 3KVJA 2QPXA 4I7UA 3G24A 3QQ1A 4L4MA 2V8ZA 2GGGA 2R1LA 5JUVA 2A4AA 4WGHA 3PB2A 4C6IA 1CEOA 4K1WA 4PC8A 4NU7A 5XIMA 2E09A 1L6SA 1ZTVA 5LYRA 4HNVA 4LVGA 3CWHA 1RQHA 3PBVA 5LSMA 4LRSA 3G3MA 3M46A 2XIJA 1GHSA 2XWDA 4J3WA 4KWUA 4S3JA 3ZT5A 3W1TA 1KM5A 4DJDD 2G37A 2GSHA 2WO5A 3RLHA 3HU7A 1J79A 4S3FA 1J93A 3TR9A 3B03A 4CQ9A 2AGTA 3W7RA 4AD3A 3E2SA 4EACA 1N8FA 4GOAA 4YHEA 4B5SA 2V3GA 4AD0A 3G3DA 1VQTA 1D3CA 3UESA 3PZTA 4ZGYA 1MUMA 1W9DM 4M29A 4HPGA 1F8IA 2WAGA 3ES8A 2AL2B 4HP5A 1AJ0A 3T09A 4UQDA 1JQXA 1F3TA 1XDMA 2ANUA 4O0QA 4JN8A 2D24A 3BOLA 1SJAA 4X3ZA 1QHPA 5HNUA 3RCMA 5BOFA 1M7XA 3MV01 4C1KA 1MW2A 3W86A 2G3IA 3JUGA 2C8NA 5A6KA 5I2UA 5FAJA 1SR0A 2WMIA 1HN1A 1CNVA 4BWLC 4K36A 1X97A 4UR9A 4IMDA 3BAWA 1F6PA 3TIMA 2TODA 2WQDA 4F0KA 4HB7A 3GR4A 3M0LA 4DJDC 5A6LA 4NVTA 1W91A 3ABSA 4Q7BA 5HNRA 3LPOA 1A50A 3E5PA 4PMXA 3C52A 3W53A 2QJJA 4UNLA 2NV2A 1RK6A 4HSOA 3UPBA 1XHGA 4HPXA 1BWKA 3MUAA 1RPXA 3VVGA 3H7UA 1Q8AA 4WSKA 4Z2GA 3KLKA 1CB7B 4FSAA 4KW2A 2Z1XA 1PV8A 1I2PA 3LGGA 3UXDA 5DCDA 4JN7A 1L8PA 3V0UA 2ABAA 2QGYA 1IT0A 1EEXA 2PCQA 5JIWA 1E0VA 4GIRA 3M44A 1TV7A 3TR2A 1M68A 3TW9A 3WLJA 3OLDA 4UTKA 3GX9A 5CGMA 3PP7A 2XSAA 3T40A 1LUCA 1K9FA 1Q4WA 2WKLA 1T5AA 2C0HA 4RL3A 2WZHA 2PWHA 1TX0A 2HPMA 1N2VA 4LTSA 4CNTA 5FIPA 2QAFA 3PPHA 5JBEA 1AMKA 2F61A 1V77A 2VYOA 4W7VA 3ZS4A 3CIWA 1JCXA 2BX7A 3CZKA 4O1DA 4O19A 3CH0A 3IGUA 4BFAA 3T44A 2B31A 1X39A 1DYSA 3JRKA 4Q3MA 3GU9A 1ONEA 1OC7A 5EYWA 2E68A 3B8TA 3L5AA 1WKEA 1YADA 2GVJA 5K9DA 5HMFA 4C7FA 4C6MA 3BMVA 2Q8XA 1KRMA 1XINA 1U5HA 4UOQA 3A3HA 4S2BA 4NAEA 2PDYA 1SZGA 4WR3A 1ELSA 2ZX8A 4IP7A 3LHUA 4L1GA 3VIHA 1IQ8A 4V1YA 2PWEA 3WLLA 3ANUA 4LOCA 5C7HA 4UTIA 3FHAA 2W63A 5FSDC 2DW6A 2O7SA 2QCLA 1GYLA 3W7PA 1ZUAX 1FOBA 4AAJA 4HK7A 2A79A 4JTDA 2WMHA 3NIYA 4RV3A 4IQJA 1SPQA 3R89A 2GJPA 2I57A 1H2JA 1KCLA 5CZJA 1PTGA 3WDPP 2XG9A 2RAGA 3M5VA 4ICNA 1Z6KA 3B0XA 1JPDX 4WLCA 1ICQA 4JS3A 2GDVA 3S1WA 2YW3A 4V28A 4MAVA 1RJRA 4M7SA 3LCHA 2NW0A 1EWEA 3GDKA 2HS6A 1VEMA 1S5MA 1GQLA 1OZMA 3ZOAA 3W2MA 5CBBA 4KH2A 5CEWA 4GVHA 3GU2A 3LU2A 3MSYA 4Y9NA 4AHPA 3URNA 4F0HA 2YXOA 4PEKA 4HHLA 3NAVA 1EF3A 3A47A 3T05A 3VDCA 2OSYA 4FOJA 5DANA 3C8FA 1VYRA 4QSFA 3ANVA 2Q09A 1QPOA 3TFCA 1Q6DA 3WF0A 2DORA 4HOWA 2I5IA 1I75A 2F2KA 3ZR5A 8RUCA 1PEZA 4EE9A 1W8GA 5HULA 5KTLA 2AQVA 4YXGA 2O9RA 4J3UA 1XBZA 1MQPA 2IQDA 4NASA 1TV8A 4NSBA 3SCUA 4GX9A 1WA3A 2B7QA 3SQSA 4AVNA 2Z00A 3H2FA 1P7TB 2HVNA 3E0FA 3FEMA 2HK1A 3W85A 1BXCA 2DVUA 3AZTA 1VJZA 5JVLA 4GYJA 1ZLPA 1ML1A 1DVJA 3HF3A 4PRRA 4IJRA 3OIXA 1R7OA 2VO5A 3DG6A 2E9MA 1TREA 3LGDA 3FSUA 3QZ6A 2O0TA 1CLKA 2DSVA 1JPKA 4H8VA 4LVBA 1C92A 2VT0A 3CYVA 3KOFA 4O10A 3GSMA 4OOUA 4GNKB 1OX4A 5FJJA 4DJDA 3ZWTA 2XU2A 3V7PA 4QE1A 4D71A 4W8LA 2QUNA 3KWXA 5LA1A 3H53A 3O9NA 4GH1A 3QY6A 1RBAA 3E0LA 4JTRA 4F0RA 2XN2A 1SO5A 4MFDA 1SW7A 4XTIA 2PTDA 1RA5A 4GJJA 3EA1A 1L6WA 3WD4A 3VOCA 1GVIA 1MQRA 2WVVB 1ISVA 1JYWA 2P0OA 1QPQA 3WJWA 3PAJA 2F84A 3VIPA 1IZJA 1XM3A 4MY8A 1G0CA 1ZAHA 4ZFCA 2NQ5A 3OBEA 5DLCA 4OV4A 1SM9A 4AZGA 3AU6A 4I6KA 2PPGA 1W3JA 1WDDA 4I5XA 4YTTA 1V08A 2G50A 3LMYA 1KTNA 2XH4A 2ZRVA 3LI0A 3CV1A 5HPCA 1J96A 5IRPA 4KFNA 2OVLA 3BLOA 1GCYA 3EEZA 1KFCA 1KTCA 1H7OA 2QGHA 4AUBA 3KOWA 5AYXA 2ACQA 3OO2A 1KGUA 2YJQA 1P5BA 2RJGA 2NVCA 3GVGA 1BF6A 4AYGA 3FJNA 3IUIA 3BCFA 2FMNA 4QS5A 1LBLA 4FXSA 5M03A 4L9ZA 3T0TA 3P61A 4LYPA 1HJQA 1E55A 3LLXA 4UCGA 4J1OA 1UJPA 3PZNA 4R7OA 3DU0A 2Y6ZA 1MDRA 3MP5A 1CDGA 4DF1A 3TXVA 2PFHA 2OSXA 4ZENA 1PX3A 1VJSA 5HATA 1W1TA 3FJ4A 2WZMA 1LP6A 5CPLA 5EB8A 1MEWA 2IPWA 1CWYA 3O15A 3RRAA 3KZPA 4GUFA 3UZXA 4IXXA 2PE4A 1RR2A 4GCAA 3ARTA 3G1SA 3GTFA 4X9YA 2I56A 4REQB 6REQB 1Y65A 3N6HA 4JTSA 3KL3A 4OBSA 5I3KA 4K8GA 3IIXA 4C6BA 4UTWC 1PXGA 3FDKA 2PTWA 2G8ZA 3WLQA 4MLJA 3N2XA 5ECUA 4NQ1A 2QCNA 3PVFA 3THQA 3WELA 5CZTA 2DVTA 5G2HA 3ZJ7A 3I6TA 1ZBKA 3SUSA 3VOHA 1XR2A 1W3HA 2QCHA 4DAIA 1XUZA 3WCZA 1NQKA 3OBKA 1RLDA 1S1PA 1S5VA 3W70A 2XVGA 3LQGA 4IZGA 5A6BD 3GNPA 3CMGA 1WAWA 3WX7A 4WDWA 1CXEA 3F2DA 1TUXA 1G4TA 1T40A 1XYCA 3L4XA 3N19B 2ASHA 3DC8A 4ZSUA 1K7FA 1XSKA 3G1YA 7REQB 1VLWA 3M9YA 3ARUA 1KFLA 2EPOA 1B3VA 1JCYA 1CECA 3L23A 5FJOA 3NO5A 2R1NA 2VDHA 3TJ4A 3DERA 3VX1A 3OP2A 2PUZA 1C7SA 4O53A 3H4GA 3B0VC 3ARWA 1E5NA 1FWTA 3OA5A 4PYSA 1BYAA 1WPCA 4S3KA 2NSOA 4NJIA 3P3BA 3DIPA 5T91A 1AODA 2DY3A 2Q01A 4A22A 5BXRA 3D3AA 2IMRA 4US5A 1XYMA 2OELA 1FWHC 4H6KA 3DYPA 5CAHA 4EPKA 2AGKA 2CBUA 3UWYA 2P10A 3A9IA 5DY3A 5E0FA 3QOMA 4FF5A 4D2JA 4I9AA 4ORMA 4XAYA 4TVCA 3AZRA 2PGWA 1OGBA 3UZYA 1UWUA 4E6MA 2GDQA 4S3BA 1YPFA 2X1RA 4QX4A 5D9OA 5CG0A 4UFMA 3PB0A 1YX1A 1RALA 1BEUA 3DYMA 3S2CA 2G3FA 1R30A 2ZUVA 5IHSA 1R3QA 1FH9A 1GWJA 5KITA 2RHGA 2PDXA 3HB9A 2G97A 3PTMA 2XIBA 1JZ7A 1CGUA 4PCFA 2C1HA 1MZRA 5TF0A 1CBGA 3QV8A 2ZRUA 3QHOA 1XYBA 4CD8A 1K9TA 3RN6A 4D8LA 4NI8A 1GKRA 3EYPA 1GVQA 2FMOA 4KPLA 1K8XA 4KGLA 1ZBCA 5D30A 2IKIA 4Q7IA 1ITCA 5AC5A 3NQEA 1EA0A 3W2LA 4WZHA 1Y7VA 5D2WA 1XW8A 3WO8A 3CL6A 3H70A 3P2VA 4X9SA 1UP0A 4KKXA 2BSLA 3N2BA 5EA9A 2Q6ZA 1UA7A 3RAOA 1KFWA 1Q66A 4HU0A 4MIMA 2OCZA 1XBXA 4PUEA 2EPLX 3KWSA 4YVVA 3FJLA 4LAKA 2X8RA 5G5IA 3SGZA 1D3GA 1VAHA 5CKSA 1LLOA 5G4WA 4WY0B 1XKYA 1QOXA 3RPDA 3ZO9A 2XISA 2G95A 3MC5A 2OO0A 4PRWA 2BGNE 2BWGA 3P74A 4RUBA 2A85A 1OCQA 2CLMA 4J2MA 1EC9A 1PZ1A 3STFA 2Y7GA 3BG9A 4BQ2A 3TCSA 1F2JA 4AXKA 2P3EA 3BAJA 3DBPA 2TAAA 3UJRA 4FNUA 1OD0A 3I4EA 4G7FA 4O1EA 1H60A 1UA3A 3A22A 4B3LA 4WQ6A 5LIXX 4JDYA 2OQYA 1TTQA 5BXPA 2JGYA 3B8UA 3BMWA 2GDUA 4HYWA 1KKRA 3KDOA 1JUEA 5I07A 4S1FA 4LT9A 3ITOA 4L61A 2PGEA 4IT1A 2NQ9A 3GUWA 1H09A 3OQ8A 2JK2A 2Y8UA 2A6NA 4N9BA 3FGCB 4H9TA 3SZ8A 3HIJA 5DT7A 3EB3A 4H83A 2C79A 1FHLA 4IMCA 3EWZA 5HQMA 2VEIA 1WKYA 5AYYA 1DJHA 1W8SA 4JTUA 4EANA 2FZMA 5HPOA 2PRLA 4JHZA 4L9YA 5LHFA 1DXEA 5AZ1A 5I3IA 2Z25A 5LZLA 4KCVA 3UETA 2AL2A 3DFNA 4PRTA 4Q8NA 1EF2A 2V0TA 3R0KA 2Z1BA 3APTA 3R6IA 4JTGA 3IJ7A 4HJFA 3PSVA 2YA0A 3R79A 2NVAA 3GG7A 1UC5A 1JDAA 5I3HA 3VOIA 1E4LA 1G01A 4HA4A 3W7KA 3V18A 3VIFA 4E4UA 2GK1B 4BF9A 1VP5A 3G1XA 2F9RA 1JFXA 6ENLA 2VX4A 2WPBA 1BQGA 1JCNA 2YL9A 1SFJA 3S42A 1TJ0A 3B97A 3AHYA 4JIIX 2FJKA 3BMXA 1UKOA 3WIJA 3DGRA 3E3HA 4AF0B 1H1NA 3B9OA 3S47A 1BQCA 7XIMA 3MQTA 2TMDA 1KLYA 1YQ2A 5A6SA 4GRSA 4NAFB 1FFRA 4YWSA 4OTKA 4MJZA 3B0PA 3CWOX 3FN9A 1EDGA 3DG3A 3BK0A 5A2CA 3OG3A 1Z42A 2NQLA 3LLDA 3ARZA 3PS7A 3EX1A 1RA0A 1M53A 4FNQA 3LBOA 3WUEA 4ASTA 1KFJA 1YTKA 1YDVA 1DWHM 1BYDA 1DWJM 1RCQA 1O5KA 3TAKA 3MPGA 2RGMA 3IJLA 4CD6A 4DO6A 4MHBA 1LQ0A 4LVAA 1IXQA 4NJKA 3LXBA 4B90A 5CLTA 5PTDA 4Y8FA 4BK9A 4JNMA 5DY2A 2OZTA 2D2OA 4MYAA 1CENA 2ABBA 3LV6A 1LBMA 3BJFA 1J12A 1HJUA 3AXIA 5A6BA 4AFYA 3ABXA 1ZSXA 3S6TA 4ZL1A 3TKFA 2E9LA 3WD3A 4D9PA 9RUBA 2WCAA 2J13A 4A4AA 4JQ1A 1Q2RA 4DXVA 2V3EA 8XIAA 4YTSA 2WPGA 3C2VA 1E9ZB 3B40A 1H61A 4DBUA 1VYSX 2PEVA 3S2NA 4O1FA 3EWXA 3LOTA 1EJVC 1I1XA 1PX4A 3N3MA 3U5UA 1UD5A 2BODX 1RQEA 3W1RA 1YLVA 3WBAA 3OLGA 3JS3A 2Y85A 4O0ZA 3D0CA 3CQHA 2NWSA 2VR4A 2ZZ3A 5AYIA 3SSZA 3GAYA 2P88A 1ADSA 3URQA 2DUAA 3PAOA 2EEXA 4PTWA 1UYQA 4RW5A 2VZOA 3A5FA 2VQUA 2BG5A 4DJED 4LBSA 1GQNA 3GFZA 3H22A 4H6RA 3LS9A 4UUIA 1IEIA 4IIEA 1C90A 2WV8A 4UQEA 1U30A 2F6KA 2FTYA 4WVXA 1TMQA 1TO3A 1H11A 1QNOA 2V2CA 3NPWA 4A8IA 3BAKA 5I3JA 3QF0A 2PDLA 4S23A 3NSNA 5A8PA 5MKGB 3TZFA 4X63A 1EL3A 1KR0A 3N4AA 1KFBA 4D6FA 4KCTA 1VHNA 1NFGA 3HBLA 4XSMA 3WDQA 4GFIA 4XQ6A 4CN6A 5HAOA 4PUKA 1TJ2A 1ONRA 1K9EA 1OFBA 1K02A 2PCEA 1M65A 3ES7A 5DMLA 2ZZ4A 1VPQA 4DJFD 1NELA 3H2CA 3WLSA 4QE5A 1W3IA 3VNYA 3NPUA 1FBAA 4CCCA 3MB9A 4LF1A 1OFOA 4HNNA 4XVEA 2O55A 4IFRA 5I02A 4CD4A 3GD6A 5BCAA 3ITCA 4DBSA 1EBGA 4Q22A 1HJSA 3CQ0A 3NGJA 4PBFA 2JALA 3U2CA 4DJEC 4Z1BA 3LERA 2JF6A 4MNJA 1YBQB 3IVSA 1FDJA 1TUFA 3WH5A 3KVKA 3GVQA 3HPXA 3VNDA 4IMGA 3VIOA 4PCTA 3TH6A 1J0YA 1N8IA 4E5TA 2NSXA 2WNQA 1XIGA 4NF7A 3RR1A 4IIDA 4KFPA 5DF0A 1V0KA 3THUA 4DZIA 3ABQA 1UIOA 2A21A 4EP8C 1W37A 2PC8A 1TTIA 1E6NA 4WOQA 1W1IE 1FWBC 1TWSA 3W27A 1D2KA 4MB1A 1TCMA 3CTTA 1P7TA 4PN2A 1R3WA 3MMUA 1WOAA 3LRMA 3W7QA 4F4RA 5HNTA 4OV9A 1JPHA 1K03A 2UWFA 3ME3A 1XLCA 5E70A 4YJ5A 3F4CA 2XSXA 2ZRXA 3ZT6A 3LEPA 1PZ0A 3VKCA 4DJFC 1LLWA 1UW9A 1YXCA 4ZQMA 3HFYA 3DKJA 4HT3A 1OC5A 3VAVA 4RNJA 3EMCA 2ZUWA 2ZRYA 3BANA 2OOGA 1VFFA 4WCJA 4PBGA 2CZDA 3EX6A 3RX2A 2OX1A 3L2LA 4JFWA 1QVBA 1BVNP 4LEQA 1ZRQA 3EDKA 4DEFA 1EHNA 4GWEA 3ITYA 2VEKA 3EXRA 1XC6A 2IKHA 3T4WA 4TVDA 5B7YA 5T9CE 3FYYA 1XSIA 1GUVA 5ENLA 1H7PA 4A3RA 3IGSA 3GE7A 2EHHA 2DZPA 3E1F1 4HA0A 3Q2DA 1VKFA 1K7XA 4C65A 1MWOA 3VDBA 3MYOA 4IGSA 3T0CA 1QRQA 5HK4A 1UR3M 4UXDA 5IDIA 4ZZ9A 2J77A 2Y4SA 4TQTA 4F79A 1FQ0A 2PTZA 1Q13A 1WDQA 4WGXA 5HUOA 2HBVA 4B3KA 3CAKA 2I7GA 4UTFA 3W9ZA 1XXXA 2VGGA 2WHJA 3I3EA 4QEEA 1J0JA 4H6QA 2YA2A 1JIBA 2ZFAA 4Y9AA 3HG5A 2ZC8A 1TYGA 3G6MA 4TU1A 4GC4A 1LOSA 3EXTA 2CBVA 3DYOA 2WNZA 3CPUA 2OEKA 3MWCA 1DTUA 4Z1YA 2FHBA 3QZAA 2PTXA 3PZOA 2YCJA 4C60A 1B4EA 3EDDA 3HO8A 4FIRA 1JG9A 3OQEA 4EIVA 2CKRA 3M4HA 5BZAA 1EIXA 4JGDA 2BNJA 4A35A 1DL3A 4EF8A 3W1MA 2E8ZA 3TVAA 4AC1X 1B3ZA 2ZIDA 2YB1A 1XLAA 4CQBA 3P60A 3ITVA 5E6ZA 3GW3A 3LQLA 3GH4A 2I1OA 3CAVA 3P7YA 2IPJA 3LCIA 4ZOAA 2Y5SA 3MCNA 1G94A 2EKCA 3T2QA 5C70A 2O9OA 1VPXA 4REQA 3KRBA 6REQA 3IJQA 3NZPA 3MI2A 3F03K 4JTHA 4INFA 3QLDA 4XAGA 2DZTA 2Y89A 3NO3A 5LNWA 3W7DA 5G1MA 2BZNA 2PLCA 3WN6A 3GDBA 4E3TA 4EPEC 2WJFA 1TCDA 2X30A 1GVOA 1F76A 1E70M 1XGDA 2ZZ5A 4AZ7A 4EOUA 3O0KA 3B06A 3PC0A 3ZMRA 4UFIA 4L80A 3TTEA 2J7FA 4MNKA 1SJDA 4IGNA 7REQA 3W7HA 1DHKA 4HPHA 3WNLA 3KBNA 1CXIA 1E6RA 4KESA 5C71A 4FA3A 3T2OA 4LV4A 3ZT7A 4KWOA 2DZXA 4PTXA 3EBVA 3RPTA 3WF4A 4L6HA 4AIOA 3KZSA 2ZVIA 3N6QA 1HKIA 1FFQA 5AZ0A 3SGGA 2X2GA 3LSBA 5HUPA 3WJYA 1KWKA 1QFEA 3F4WA 4CN4A 4XZHA 2NX1A 4U2ZA 1UKSA 5FF4A 4DJEA 2UY4A 1KLZA 3EA3A 1BKSA 4O12A 1HJXA 4Q4MA 3VDGA 2C19A 4D6DA 1VBUA 4O50A 3WKZA 1T99A 3LGEA 1EQPA 2GQAA 3QGVA 3W00A 2GOKA 2CNCA 1V3JA 4CQDA 2PWFA 1YIXA 2WJZA 1PAMA 3WDRA 3DFHA 1U83A 2EJAA 4AEEA 1SJCA 3S5ZA 2XIOA 1SFSA 3VD9A 3Q58A 4R7JA 4NZ1A 1BKHA 4ADUA 3BH4A 2XWEA 1Q65A 4AH7A 4A21A 3KDNA 3CZ8A 4IQEA 2G0WA 4DJFA 2QQ6A 5I6SA 3T6CA 3MBDA 4GE8A 5H91A 3W6LA 4NJHA 3CZJA 3R11A 4BKNA 5CZSA 3MJYA 2V67A 3R1ZA 4U2YA 3BJTA 3PBWA 2B0MA 3VMOA 3DI1A 4BZYA 2Y5JA 3A64A 2G4FA 5EMMA 1TV3A 2QJNA 3DG7A 3T78A 4KRTA 4WY0A 4N02A 4L5ZA 1R2TA 3W1PA 4BHYA 1OB0A 4AMCA 3HPAA 1SSDA 3TCEA 3U9IA 2XVLA 1NFBA 3PBUA 2CYGA 4GD0A 5I24A 2Y8KA 4W8BA 3UCCA 4DPQA 2CZVA 3M41A 3LCLA 1JNDA 4MDOA 1UKQA 2W67A 3ZLGA 1OGGA 2XDFA 2RDWA 1AL7A 3B9DA 1IT7A 1ISXA 2XPKA 2ZRWA 5FF0A 4M81A 1UR4A 3TN5A 4EXQA 1QPNA 1PKYA 3ZR4A 3DHDA 2JEPA 4CU7A 3VGFA 1O4UA 3N15A 3G77A 5B7ZA 4RPQA 4I6VA 3UG8A 4EWND 1UR9A 2YCLB 3R8RA 4YTRA 2QXWA 3VKJA 2YBVA 1DJZA 1FX6A 1C93A 3UXLA 4PSPA 1MXDA 3FGCA 4UQCA 3KRSA 2OJPA 1GVEA 1UPPA 3YPIA 1OABA 2RDUA 2PGFA 1KM2A 2JE8A 3NZQA 4M6VA 5C2CA 3NZ1A 4H04A 2VFDA 5H8UA 1X8CA 2V2DA 3VK5A 3DXIA 2NT0A 1IZCA 2DIEA 2Z1SA 2FTWA 1Y5VA 2IPFA 3VMPA 4B92A 1LLZA 1N7KA 2GJRA 4S3GA 3HQ1A 1G1YA 4YVPA 1JZ3A 1UCWA 5BXTA 4DUXA 4RLIA 4FLRA 1Z41A 2PDMA 4DN1A 1X6NA 4U4MA 3V35A 2YPIA 4IG2B 3IGXA 3SM0A 2DZSA 3MCMA 2ZX6A 1ZBVA 4GC3A 3LBMA 3U6WA 2ZA3A 4H41A 3CU2A 4V2XA 4KFOA 1IE7C 2R9RA 2GK1A 2R1MA 1EGMA 1W54A 4JKMA 3LHTA 2IQ0A 3W7OA 4DIAA 1V7YA 5CPOA 5K7JA 5C6MA 2V2HA 1PTDA 3A13A 3HPSA 1XQKA 4FOKA 4ATDA 1KC7A 5CC5A 1O94A 1QO5A 4HZ8A 2QDGA 3L0GA 5E9XA 3BLEA 5JH2A 3AYTA 1KKOA 4AF0A 2H8ZA 1UJQA 5D03A 4M7TA 4P7OA 3AWOA 2VNCA 4B9YA 1LDCA 1DP0A 3WNOA 4NAFA 1LG1A 1G7UA 4U5KA 3I3BA 1UG6A 4W86A 2VTFA 2J9YA 1WB0A 2PP0A 3C0JA 3EWWA 3KRUA 1W1PA 5C8BB 1XICA 3SSJA 5FJIA 2BVYA 1YW1A 4PUNA 2E5CA 3WH7A 3AIBA 3M64A 1QT1A 4NJGA 3AYVA 1I60A 4DO7A 3TYZA 4I9TA 1MRQA 5FF2A 3H4XA 1PWMA 3ITXA 1GTHA 4J3TA 2PA6A 2C7FA 4V33A 5CAKA 5J5RA 2REQB 2QUTA 3BDKA 1WZKA 4O16A 3F7JA 1ZFJA 2J6XA 1JGIA 4RE2A 3UGRA 3VYLA 3TYEA 4PMOA 2OWCA 3E5BA 4XZNX 1R85A 1O5RA 3AMLA 3XIMA 5FCZA 1CZ1A 3R58A 1EO7A 1XIJA 2QNEA 1H0IA 1E6SM 3V36A 4GHRA 2E6DA 1X96A 4L7ZA 2P3ZA 3WQPA 1JF6A 1GOQA 5CSSA 1I2OA 1TELA 4W7WA 1JJKA 1Z8AA 1KXQA 4B9ZA 1RCXB 2Y5EA 2CZ5A 4C6NA 2GSJA 2QUMA 2Z6JA 5AHNA 1E0UA 1XG3A 5BU9A 3GY1A 1ZCCA 4DPPA 2WNNA 1IF2A 1NM9A 2WK2A 3EOLA 3IAQA 4P8WA 2ZVRA 1EFZA 3NM1A 2O9PA 1PIIA 4A8LA 1PCKA 3H2EA 2D23A 5M3WA 3W7GA 1PKNA 1KQZA 2HWGA 2PGRA 4LUYA 3LV5A 1OYAA 3NQBA 3MDUA 2IW0A 2YR1A 1UKPA 3DX5A 2G3JA 4HYRA 3V3WA 1GEQA 7PTDA 3ZWSA 4YTQA 5I5RA 8TIMA 1KWGA 1R3YA 2Q3OA 2E6AA 3KAOA 1HF6A 1PTAA 2Y61A 3ZJKA 4PCPA 4XX6A 1BAGA 3N4FA 1GGOA 2J27A 3NXFA 1XD0A 1FXQA 5MKGA 3UF9A 1FWNA 1S2AA 3WQ8A 3F4VA 4IF2A 5HANA 2QPUA 1S38A 1IZKA 3UEQA 3RCYA 5AYZA 4GIYA 2GVYA 3SRFA 2YL8A 3ECQA 1MW1A 2ICSA 1W17A 1UZHA 1TPB1 3L7RA 3BSMA 1B57A 3TQPA 2F8QA 4W93A 3HQOA 1TA3B 1IIHA 2EO7A 2V38A 3EPOA 1B9BA 4LYRA 4MUPA 5ABHA 4POCA 2FIQA 4URIA 1M03A 4HTBA 4D6EA 4IHCA 1YBQA 3PTQA 2WMKA 5G2WA 3EA2A 3LCFA 2IKGA 6XIAA 2PDFA 1WAUA 1XIDA 1PIGA 1UMYA 3W7EA 4NHVA 3GUGA 2P76A 2QAPA 5I03A 1F6KA 2Z28A 4GY7A 4UNIA 3LRLA 2DVXA 2WQPA 4OUEA 3RRXA 3PNUA 5CZ0A 1Q7ZA 3GXFA 3WL1A 4FOUA 1LQAA 2GGIA 1XISA 3LDVA 4Q6XA 3RJYA 1RPKA 3RG6A 4Q8UA 3UD6A 3KHJA 3L5LA 3EOSA 4ZOBA 3FVMA 3WL0A 1S5TA 2HVMA 5KZMA 4ICCX 3NSMA 2BASA 5IOBA 1B30A 3G6LA 2D0FA 4A3YA 4H8UA 1AH4A 3SY1A 3GXIA 4GGHA 4XAFA 9CGTA 4H8HA 1NOWA 4XK2A 2BFGA 1IR2A 4R7WA 3A5VA 4TUFA 5T26A 1R3TA 1UOZA 4FP1A 1C3FA 2D2JA 3WLNA 2JIWA 3WD2A 2OFJA 5CSUA 1EDQA 4JEQA 4NZ5A 1XGEA 3WEOA 1E6QM 2DGAA 4GVGA 4N4QA 3W7CA 3G1DA 4AVOA 4XAZA 2W66A 4DVOA 2DW7A 3QQ0A 1FCVA 4OECA 1J5SA 2C1IA 2ESCA 3I7RA 3U5YA 1I9CB 5HA7A 3AMGA 2AMXA 3O2LA 4O15A 2V6AA 5C9ZA 3L65A 3PHAA 1VBRA 3AXMA 4X60A 4YCOA 1Y5WA 4FLSA 3AMCA 3TA6A 1VCGA 4AEFA 1U33A 4D6GA 4IPIA 1THFD 3E02A 1DBTA 3CV6A 3WMSA 1E3ZA 1VH7A 1ISYA 4JEJA 3VGHA 1QOQA 4ERIA 2E1DA 4LU0A 5ABFB 1FH7A 4TXEA 3NQ8A 1UR2A 1WYIA 4V1XA 3Q4DA 1QCWA 4UR8A 2QIWA 3QY7A 1XLIA 3WUFA 3PPFA 4HJWA 1EX1A 3S6OA 3A6OA 1JUBA 3V75A 1S3HA 4PB3A 4EX4A 2GWGA 4GINA 3WQOA 4F8XA 1RBOB 2J66A 3K1GA 4IJBA 4P5UA 5DCEA 4AD4A 4MWAE 3TJIA 2E1WA 4XKYB 1J11A 3W23A 3BSHA 1H49A 3B05A 3PWIA 1ICSA 1NDYA 3CHVA 1LORA 2VWTA 3ARYA 3FDGA 4MNMA 3UYCA 3VD5A 4PMDA 4AY7A 2WSKA 3M0KA 3LHYA 1O12A 3N25A 4GPNA 2W79A 4QROA 4PSRA 1EUAA 4ECLA 4YL2A 4EAYA 1W1B1 2PWDA 1CIUA 2CBIA 4J5NA 4LB4A 1UWSA 1NOUA 4WDTA 1HO4A 2CKSA 1FWAC 3NXLA 3PG9A 2POZA 1MNZA 4OKDA 1XF0A 3BQ6A 4GKTA 4QCEA 1DQWA 5E93A 2QR6A 3ZQ9A 2XGZA 1RHCA 2QCGA 4JFVA 3ANYA 4DLFA 3SCQA 2QLYA 2GQ9A 4LCQA 1AFSA 1TJRA 3T81A 4DWDA 2YL6A 4GZIA 1P0BA 5HWMA 5EFDA 4IX0A 2VFIA 1J6OA 4JTCA 1AK5A 2PI6A 3AISA 1X1OA 4GZ7A 2BTMA 2XSBA 5CSYA 2ZDRA 4KT2A 5AC7A 4OUIA 3PZVA 2DH2A 1BTMA 3B8DA 3TW6A 1S2UA 1W9UA 5A69A 3PUEA 3VOJA 1O95A 4FPSA 1M41A 2GGEA 4ADSA 3KOZA 4BCEA 1SZRA 3T08A 4BF5A 2RUSA 3I7QA 4RK8A 1JF5A 1MYRA 3TONA 3QTGA 2VL4A 4JOMA 4DY1A 1HIZA 2PDCA 3SCNA 4ROPA 3WUGA 3ZJ6A 1PS9A 3O05A 4N6EA 2YFOA 1C91A 3PWAA 4JTTA 4JX4A 1YE6A 3PR2A 4JTQA 3W88A 3WDHA 3GBEA 3MYPA 4JYDA 4YVXA 3RNDA 4MYXA 1W9PA 3RX3A 4C91A 1PYFA 3PTDA 5JIPA 3VCRA 3UNDA 3OZPA 1GOIA 1GYNA 4WJEA 4MWAB 1IEXA 3UCQA 1XLKA 3KHDA 3IACA 3RMEA 3W76A 1EJWC 3PJUA 1CX9A 3H24A 1TX2A 1VFMA 3GC4A 4P8VA 4LX4A 4ILSA 1EP1A 2VKZG 3MSRA 1KBLA 1DWAM 4DYEA 4LY8A 3AAMA 4Q8WA 1GVSA 4H9MA 4L56A 5GVJA 1OHLA 5FJRA 3AYRA 1E51A 3H2AA 1E15A 2D1ZA 3K4WA 3QV7A 4I5RA 2VELA 1XD1A 4O17A 3S6DA 1OCJA 1JZ6A 2VEMA 2E5BA 4XO6A 3TXZA 3CHDA 4QDMA 4IFKB 4S39A 2NVDA 4LXFA 1NDVA 3PZUA 1UD3A 3JVAA 1HVQA 4H7VA 4JTIA 4LCRA 2PDJA 1PKMA 4K1GA 1QHZA 2DT0A 3KLLA 3NQGA 1X98A 1W0MA 3L4UA 2NXGA 9XIMA 4RKAA 3AIUA 4E38A 3W37A 3WLTA 3NPVA 1JDEA 4FNPA 1XYZA 4LVFA 4GABA 4XZ9A 4UMAA 3STPA 4B91A 1Z48A 2IQTA 3I3DA 2QF8A 2AL1A 1I8JA 1PL9A 4WD0A 1LBFA 4HPNA 3HG2A 2BY1A 3GU1A 2X05A 4Q4QA 4L4LA 1UC4A 3NL3A 4AB4A 2OEMA 2OSWA 3T0AA 1KO0A 1L6YA 1XL9A 1BYBA 1AW1A 3TQKA 1Q63A 5GNXA 3P8IA 3P84A 4W84A 4HBKA 3NFUA 5TIMA 3P81A 1KBJA 1NSJA 2YCLA 3U2EA 4O28A 1SO4A 3HA1A 1DWIM 5E09A 3FX4A 4ATLA 2DV0A 4Z1AA 2GQ3A 2VFEA 3VABA 3TN3A 1MFVA 3R2GA 3AC0A 1W1A1 3AJXA 3S5NA 1HJVA 1KCXA 3H2OA 3H23A 2H3BA 4PUUA 1QAPA 1L8NA 4J3SA 4OVXA 2VFGA 4J7RA 3CLWA 4BA0A 3MMWA 3WQFA 3W7IA 4YU1A 3H7RA 3MUCA 3TQ0A 3B3DA 1Q6QA 5A8OA 2YYUA 3MUXA 2J24A 3KTXA 1K4GA 1XUUA 3BGAA 3FAXA 1P1MA 1HJWA 3QFWA 5I3GA 4DYKA 1WBHA 1OADA 1JYXA 1LQ2A 4EKJA 5C5YA 1OFPA 2UBPC 1MSSA 1H3GA 1SMAA 2INZA 1ZU8A 4IG2A 3LHVA 3HG4A 1JAKA 2YL5A 2WVUA 1WDPA 1XLHA 1SW0A 4QM1A 4AZCB 1JI2A 3FY1A 5AHIA 2MANA 2QCCA 5CPNA 2QULA 1XP3A 3GM8A 1HO1A 4NZ3A 1BWVA 1XWYA 1ZALA 1QATA 4Y9MA 2F6XA 3VIGA 2GYIA 5FJTA 3WDIA 2Z1WA 1EWDA 1KRCC 2OZ0A 4GY0A 5CPSA 1DWGM 3F4NA 1F3EA 3QZEA 4IPPA 1OC6A 3G1AA 3VD4A 1QASA 3RM8A 3PJWA 2ZXAA 3E38A 4M6PA 4U5IA 4IIBA 1KFEA 5DBUA 1VLIA 5AHLA 2P50A 2PDUA 1V5XA 1RZMA 3VXGA 4D72A 3ARVA 1WZLA 4M82A 2V68A 5E5CA 5AFDA 1HKKA 4PL2A