3GVVA

Single-chain urod y164g (gy) mutation
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLYESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uroporphyrinogen decarboxylase
publication title Substrate shuttling between active sites of uroporphyrinogen decarboxylase is not required to generate coproporphyrinogen.
pubmed doi rcsb
source organism Homo sapiens
total genus 123
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3gvvA00
1U1JA 3PPFA 1XDJA 3CYVA 4WSHA 3T0CA 4L64A 1R3SA 1J93A 1XPGA 1U1HA 2Q6ZA 1XR2A 2EJAA 3BQ6A 3PPGA 4L65A 1JPIA 3GVWA 4L6HA 1T7LA 3GVVA 4ZR8A 4EXQA 4AY7A 1R3VA 4L6OA 2INFA 1R3YA 3L7RA 1R3QA 2Q71A 1UROA 1JPKA 1R3RA 1U22A 1U1UA 3PPCA 3RPDA 1JPHA 3GVRA 4ZTXA 3GW3A 1YPXA 3GW0A 1R3TA 3GVQA 4QQUA 2NQ5A 3PPHA 3BQ5A 4L5ZA 4ZTYA 4L61A 1R3WA 4AY8A
chains in the Genus database with same CATH superfamily
4AD1A 3CTLA 3SY8A 4IGMA 1EZWA 3CUIA 1IEXA 1I45A 2Z27A 3KTXA 1FKWA 2OG9A 3WK2A 4B5TA 3G8RA 3CHCA 3NZ1A 4F8XA 1V02A 4NHVA 4OU1A 2OSYA 2GLKA 2NZLA 4KPLA 3IVSA 4UMAA 4XKYB 1UJPA 4TOQA 2W4XA 4UQCA 1UKPA 5K3VA 2V63A 1EJTC 4PB4A 1TPFA 1LRTA 3UR8A 2J77A 2V5LA 4S39A 4HCHA 2ZA2A 3EA2A 1UD4A 4FR1A 2VVSA 4XSLA 4QP0A 1MW0A 2V6AA 1JFHA 5C55A 3ZMRA 1A5AA 1E73M 1S5WA 4LPCA 4Q7BA 4NI8A 3VOIA 1TTIA 3L2LA 1PCWA 3KZPA 1KFKA 3P81A 4QLLA 2J79A 4DLMA 4GO8A 3BOFA 1KM2A 3GNNA 1XL9A 4LOCA 3UJRA 3VILA 3DBPA 4Z2GA 1NDWA 4RZ4A 1K9DA 1LLOA 5I07A 5FJUA 1MDLA 4C65A 1KR0A 1W9VA 1JDCA 1ONRA 2GQ8A 1C8QA 1ZJHA 5A8OA 5G1TA 3FHQA 4DPQA 2FZ8A 1S38A 1S5NA 3R79A 4PULA 3HGRA 2NQ9A 1VBUA 3IJLA 2CXEA 3A24A 2CKSA 5D2WA 1VCVA 3FFSA 4IM4A 4BI6A 5J04A 4LUTB 1SMDA 1KRMA 3N13A 4GY7A 3TC6A 2ZZ5A 2W61A 3CM4A 2MNRA 3MMUA 3NQBA 4Y9OA 4PBEA 2DUXA 3COTA 1MW1A 5DCDA 4XVDA 4IXXA 3R94A 3EX6A 3S5SA 3GSMA 3RLVA 1BYDA 5FJRA 4IP4A 4NZ4A 2BGQA 3EPMA 2Z00A 4M5PA 1ENUA 3APTA 5B7ZA 1TRDA 2WSKA 4JN6A 1H4PA 1QW9A 2OO6A 2YZ5A 2WPGA 1I2RA 1EL3A 4GQGA 5F4SA 4D72A 1WB0A 4GY0A 4Q7NA 1SZEA 1XSKA 1XQLA 2CZ5A 4Z1BA 4AY7A 4HU8A 3CIVA 3PF3A 3MANA 3T0DA 2BVWA 4KW2A 1EC9A 2OTDA 2AL1A 3D6NA 2QMJA 4X61A 3TROA 4JKLA 5I23A 5AHEA 3VOHA 4C7FA 3QPZA 4M1RA 4NZJA 2WJFA 3T08A 4NXKA 3SRDA 5CPTA 3HV9A 2GWGA 3GVWA 4QJ4B 2J7CA 3BLDA 4LY4A 4OQVA 4X22A 1CX9A 5I03A 1HO1A 2A2IA 3W0KA 4R88A 2YXXA 1N2VA 3H26A 2JKAA 4NRRA 3IGHX 2WHJA 2V3GA 2P8CA 2CHOA 4QDMA 1W3KA 2Z0IA 3U2EA 3LCWA 2D2JA 5FF4A 4JQ3A 3NPXA 4O57A 2EG8A 3P74A 1H3GA 1U1JA 5CLWA 1C90A 2V2DA 3OIXA 1EIBA 3NXLA 1PE1A 2PGEA 3PZNA 2DH3A 2C19A 1BWVA 4O1AA 3UY7A 1NF0A 5LNSA 4F9DA 2NLIA 4XD3A 1MQPA 4JIHA 3KBJA 4QDWA 2W6RA 3BURA 6TAAA 3U2ZA 1QMLA 3TTYA 4UNIA 4JIRA 4AZ7A 3G77A 5CPLA 1VC4A 4OV9A 3ANYA 2X16A 1W2VA 3NFUA 3TN4A 1HN1A 3IGXA 3E6EA 3W00A 2POTA 1KBIA 3RCMA 4N9DA 3RM8A 1AL7A 4E5TA 1QOQA 3T44A 1ZAHA 1LBLA 5E9AA 3P67A 5FACA 4DJDC 1MRQA 1T7LA 3EDKA 4UTTC 1F2JA 2AMXA 1GVOA 4F0RA 4F0SA 4CKQA 3MUAA 1N8FA 3OGSA 3IJ8A 3SUUA 5A5WA 1XIGA 3ZR6A 1B5TA 2B7QA 4YS1A 3LD5A 3IK2A 1AQFA 1V08A 1Q2SA 1GCYA 2PZ0A 2ISVA 4N0RA 5LA2A 2J7HA 1A5NC 2CEQA 2I7GA 1C9DA 4KS0A 1X39A 3ZFHA 3P7YA 4ML9A 3M0YA 3KLKA 1HKMA 4NJKA 4C6NA 3UZWA 4NJJA 1WDDA 1PTDA 2EHHA 2WSRA 1CGYA 4CN6A 3SIMA 3UWEA 2Z1VA 4KEMA 5JVLA 2PEVA 4XBKA 4J27A 5LIXX 1TQXA 5DCEA 3GNPA 3ITGA 2Y7EA 1NIUA 1UZDA 2FJKA 3GDKA 1IYXA 1EOKA 4IJCA 3H12A 1A49A 2OX1A 4ICMA 4JQ1A 1OFDA 3P2VA 3HU7A 4PMUA 3W1TA 2ZQ0A 2XVPA 3H2AA 5AYZA 5HMSA 4H01A 4AEEA 3EEZA 3VUSA 1JCLA 1ONWA 3C5QA 4Z2LA 1CXLA 4H7CA 1IWPA 3FIGA 4US5D 1CIUA 5I24A 4S23A 4C6KA 1ITCA 3I10A 3VO0A 2HNEA 3TOPA 1WDSA 4ZXOA 3M0LA 3WN6A 4WDWA 1JDEA 1KCXA 3A21A 2PGRA 1FDZA 1MMFA 1RK5A 3ALFA 4JFWA 1UWUA 5BYWA 3E2VA 4DWSA 1EX5A 1PCKA 3KWXA 3CZJA 4HPHA 3QSTA 3VIPA 1DYSA 4GUIA 1SR0A 4I9MA 3AQUA 1JL8A 1R9YA 2YCEA 1GVQA 2OT0A 4QGCA 3Q45A 4XZ9A 2E77A 4RK8A 1XICA 3WIJA 3WQ8A 4YN5A 4DRSA 3UXLA 2PLMA 3S42A 1O12A 2ZDSA 3K4AA 1QCWA 2WQPA 3DFYA 4JKKA 3GW0A 3UG5A 1WNOA 5HNTA 1EXPA 1SR9A 2QCNA 1VP5A 1IZCA 1Y7VA 1EF2A 3MYPA 3EWWA 4LW7A 1VBHA 4AVNA 2AAMA 1EGZA 3CC1A 3FOKA 3KBWA 3F5KA 2FGZA 3SDOA 3MO7A 3S2NA 2PRHA 1FWAC 4JTTA 1KBLA 1FRBA 3KBSA 4P7QA 3UXIA 1H62A 2VNCA 2VCAA 5C7HA 3DFNA 1XCXA 3GR4A 3EOUA 1LL7A 1UWTA 3NDZA 1WXJA 1XLEA 3G2GA 4B5UA 2HTMA 2NX9A 3RJYA 5U7SA 3W37A 3WUFA 2HROA 4JTUA 1X6UA 5AC6A 4AZ6A 1K77A 5I3IA 2ZRYA 2OGYA 1JCJA 3BAYA 3JRKA 1KBBA 2WCGA 2ZRUA 4ZOEA 3BGJA 2NQ5A 3M7SA 1DJHA 3AHYA 4PSRA 1X8FA 4WXYA 3LXCA 4PMQA 2NLYA 4XO7A 1NWTA 4L6OA 2YA0A 4NVTA 3EKGA 3UJFA 4JCMA 3BW2A 1EQCA 1ZS2A 3UCCA 2NV1A 3TC7A 4WVXA 1GJUA 1I75A 3LCXA 4AWEA 1V0LA 4WR3A 3UWUA 4PMJA 3AAMA 3VD5A 2C15A 4QQ3A 4J28A 2XN2A 3TLQA 2ASHA 2Y7FA 1JCYA 3BW4A 3VGBA 1SO5A 3GU2A 1J5SA 5FSDC 4P61A 2XVNA 3O15A 2XHYA 3KS5A 1C7SA 4TX8A 4DI9A 3UGRA 3QY8A 2PZNA 3PP7A 2GPTA 4FO4A 5CZ0A 3VVGA 4BWLA 3MDUA 3SUVA 2YYTA 3OBAA 1E40A 1I1WA 3G6LA 4K36A 3QZAA 3M0JA 1XFCA 4ZBCA 3DHDA 2HRWA 1AQMA 1KLYA 1RQBA 2XVLA 1BSLA 3LDVA 4MNMA 3RGTA 2XU2A 3CUFA 3JU2A 2J66A 1U5VA 1EBGA 5A8MA 4A4AA 3CWNA 1UR3M 2UY4A 3HGJA 4D8AA 1KD0A 5PTDA 1B2YA 3HJEA 1CGTA 2BHUA 4JX5A 3WFZA 5DN1A 1EDTA 3WF2A 3BSMA 4KERA 3KM8A 2E8YA 2V67A 1ZLPA 4LYQA 1G7VA 4N9CA 4XZIA 1R86A 4JTRA 3HA1A 5A6SA 3K4WA 3MB9A 3L12A 4Z2IA 5ECUA 3JW7A 3WYZA 1DXIA 3N6JA 2PWEA 3LCLA 4CLMA 3ISIX 1TELA 4GUFA 3KWSA 5I7GA 4HZ6A 3M0MA 3ZJ7A 1K7EA 4DWSB 3MP4A 2UWFA 1RPXA 1T99A 2VFIA 3NO3A 4ZSTA 1TMQA 3H24A 2KZHA 2OZ0A 1JEZA 1KXHA 4Q8QA 2X1SA 1TSIA 3U4FA 4HPXA 3B0XA 4MF4A 2KX9A 3NL5A 3HB9A 1E55A 4PMZA 2E3ZA 1H7OA 4W89A 4TTGA 4Q4MA 4O1EA 1OC7A 2ZOXA 3AC0A 2EPNA 3NQEA 4IF2A 4MKSA 2XIJA 4NNCA 2I5IA 2QKFA 3S1XA 3EWCA 4DJFA 3A12A 3SAZA 4AD4A 1PKNA 5H91A 3BZJA 3W6YA 3AMDA 4L5ZA 4IL2A 4HZ7A 5G2WA 3ZSSA 1E56A 3ITCA 4DELA 3DU0A 5HJLA 1MEWA 3VGEA 2PP1A 4XAGA 2H3DA 4UR9A 2EG6A 2V68A 4DUVA 1CLKA 4B2DD 3IJ9A 4UFIA 4C1KA 2D0GA 3UNTA 4LVFA 1FWTA 2OMAA 1MXGA 4AUBA 2B7PA 2EKCA 5GJMA 3VZZA 3BDKA 1VFLA 3S5ZA 3C8FA 1FFRA 2WLZA 1ZJBA 1KO0A 4AY1A 4GKTA 4ZO7A 1IXOA 3T0TA 3II1A 1I2NA 5F4XA 3OBKA 1HJVA 3AXKA 1IHIA 3DC0A 4NT0A 2Q02A 1S3TC 5FKYA 2DSKA 3U48A 3ATZA 1GW9A 1TJ0A 3W83A 4E6MA 1KV8A 1FWGC 3OGVA 1CW2A 2YDAA 1YW1A 1XPGA 5DBUA 1YKWA 3ITOA 4W88A 4XKMA 4ZL1A 2WSQA 4M7SA 6TIMA 3VMNA 3EEGA 4JDBA 4Q4QA 4P8XA 3R7MA 1FWSA 2ZZ3A 2Z7GA 4LSBA 2OXNA 2WWCA 3FY1A 1WXYA 2XVGA 4DY1A 2YXGA 2XM1A 4KCVA 3EGJA 4RLIA 1OFAA 2X09A 4GC3A 4M82A 3SJ3A 2EPOA 5FAGA 3PBMA 3V0SA 1B4KA 3WNNA 1YPXA 2PLKA 3BLOA 4JAWA 1QNOA 5E6YA 4O19A 4GZ7A 3S3GA 3V4BA 3WH6A 5JBEA 3CV7A 4Y7EA 3LX9A 4UOQA 2JIEA 2NUWA 2R6OA 4FNSA 3R8GA 3PJUA 4GHRA 4OJYA 1UZHA 4V1XA 3T2PA 1FXQA 5C9RA 3WLSA 2QULA 3ZSTA 1CECA 1MRAA 8CGTA 3CYVA 3LM7A 1R3SA 4TV6A 3GHRA 3NVDA 3FA5A 4DF2A 3VIKA 1JIBA 2R94A 4O11A 3N4EA 2WM1A 4IH3A 3WLNA 1UOZA 1CGUA 4O13A 1T41A 2ODOA 1X1OA 2CHNA 1JZ4A 2ZZ2A 4DZIA 4N42A 4Y9PA 1V0MA 5H8MA 1KM4A 1QI2A 4NNBA 4XBSA 2Y8UA 5DBTA 4YTUA 4QJ3B 1E0TA 4GZJA 3T7VA 3AS3A 1SJCA 3SGUA 4LS1A 4HNNA 4QEEA 4GX8A 2IXVA 1EPVA 3UVAA 3VE7A 1Q6QA 1V5XA 2BY0A 4YLWA 4AAJA 2F2KA 4V2XA 1KGWA 3OW1A 1EP3A 1ZHAA 4GISA 3ZT7A 5A1AA 4PBFA 3T42A 3QVQA 3PNZA 3WDRA 4E0CA 1GQKA 3TW9A 3CMJA 4V33A 3UT0A 1RVKA 1JUBA 2BXZA 5K9XA 1SZNA 2GUYA 4XBJA 3CO4A 4UC5A 3TNOA 4AG0A 1G67A 4ALDA 1NFGA 1CXFA 1RLDA 3L0KA 3W29A 1PZ2A 2AL2B 2J24A 2FMNA 3BH4A 2PSNA 3BLPX 3RFAA 4FA3A 3CV1A 1E1CA 3HF3A 1XLBA 3P6LA 3D3AA 3G0SA 5HDRA 5AVHA 4HOWA 4W84A 3WDPP 4AEOA 4O28A 1KM6A 2E09A 3K4DA 3PPFA 1A5OC 4HYWA 2YXOA 1R8LA 5BRQA 1VGAA 4RKAA 2DIJA 3LV6A 2C16A 3S2MA 1RQEA 4FHAA 3SUSA 1VHNA 3DKJA 1S2TA 1JXJA 4HNOA 3W2MA 4D6IA 4B5SA 3CAVA 4NAFB 4AVFA 4FR6A 5DRIA 5CQ1A 4NILA 3U0HA 1E1FA 2A3CA 3P60A 2DV0A 2J88A 5D37A 1TWDA 2VEMA 1ZQ5A 5GNZA 2WAGA 1YYAA 2F61A 5KZMA 4XAZA 2DFAA 3ITVA 2ACRA 1REQA 1QU4A 2V5DA 1ICPA 1YPFA 4J40A 3AYSA 3ZYZA 4A35A 1W9DM 3INPA 3OQEA 4LVBA 2RKXA 3STCA 2I56A 3W82A 4LFYA 3TA6A 1YXYA 1ISYA 4B3ZA 2XWEA 4ACZA 4LU0A 4WY0A 3UW6A 1IZKA 4EF9A 2OZTA 3VYLA 1PTGA 1XYBA 2Z1BA 3VPLA 1GZGA 1B3YA 4ZB0A 4WSKA 1J93A 3KOZA 3N3TA 5CAKA 3HM7A 3T6CA 1JULA 2VZOA 2ABBA 1AG1O 4L1WA 3GBEA 1UBPC 3PY2A 4AH7A 4CCZA 3ZQ9A 3TUUA 4K7YA 2EG7A 4NASA 5IHSA 3R58A 3AYRA 4UTWC 3NPUA 1KLZA 4E38A 1X7IA 4F2TA 1NARA 1F3WA 4K2SA 1KWKA 1PHWA 2WPBA 1TJPA 2B7NA 1IT0A 1CXHA 1VZWA 3W7JA 3PJTA 2WJEA 3TA9A 3RF9A 3WZ0E 2FZBA 1Q6OA 3EDEA 1FDYA 5CSYA 3KLLA 1VBRA 1FCQA 2OCZA 1A5LC 1XIDA 1R38A 4OVXA 4L4LA 2DSVA 3ZJ6A 4PA8A 2PD5A 2BGNE 1YHTA 3PBWA 4L7ZA 3CQJA 3F2BA 3VTRA 3B9NA 1W1TA 3GAKA 1D8WA 4HTBA 1A47A 5I77A 5JBDA 1EJWC 3NL3A 4GXPA 5BXTA 1SVDA 4ILSA 2C0AA 4PCPA 2PPGA 4DUWA 1JCTA 2J74A 4P2VA 2GVLA 3QV8A 4HJFA 3W75A 4PR4A 5LGZA 4QFUA 4E3TA 2Z29A 1I6NA 1M03A 5FL0A 4JFTA 2W62A 1V6XA 4K68A 4RDZA 5IDIA 2WNNA 3NZPA 3RHGA 4CQAA 3R6IA 3FS2A 1W5OA 3O9NA 1RBLA 3OBEA 1ECQA 2OWXA 3GFZA 4D9PA 1UWAA 3IACA 1E1CB 4E8GA 3W1XA 4DO7A 1JYNA 4JR5A 3B3DA 4NX0A 4XO6A 2PTWA 4U3CA 2HPMA 3WBAA 3F5JA 4E4PA 4O17A 1VFUA 2YDSA 1OK6A 4J5NA 2YW3A 1X1ZA 3T05A 2EQDA 3AS2A 3QHMA 1E3XA 4EACA 1QOXA 1KTBA 3P80A 1A5MC 1D3HA 1UD6A 2GZXA 2JEPA 5D2XA 2BP1A 1IR2A 1K4GA 2BZNA 4JY9A 3VDBA 3KL5A 1BF6A 4UQBA 3GR7A 1KTNA 4IXHA 2P0IA 3CH0A 1AD4A 2CBUA 3L9CA 1RPKA 1E6NA 5TNVA 3V5OA 2BTMA 3ITLA 2PC4A 3VIFA 2AGKA 3C0QA 1XUUA 4HHHA 4GFSA 3S46A 5BRBA 2HISA 1REQB 4PFHA 3B9DA 2R14A 3VU2A 4ZA0A 1BYBA 2PCQA 1R87A 4UXDA 5JH2A 3OO2A 4Z1YA 3RG6A 4ACZB 2WZIA 4WY0B 5GNXA 5BU9A 3SCSA 5KMYA 4M6UA 3S1WA 1DV7A 2O4MA 1T8QA 1VS1A 2PDGA 3SQLA 2WV8A 1C29A 3KAOA 5A6KA 2NX3A 3S2JA 1JUKA 3RUBL 2FTWA 1EDQA 2E1WA 1JDFA 1XLFA 3PB0A 4PTMA 5DELA 3FYOA 2V38A 2YPIA 3QTPA 3MKKA 4AZIA 2YBTA 4JOMA 4PUEA 2W92A 3W1AA 2NVDA 4A8RA 2C7FA 1L2UA 3T8QA 2VL4A 5B80A 3DKLA 1RVGA 2VDIA 2QCHA 3IRDA 2ZUUA 4DJED 4UBPC 4YJ5A 2ZDRA 1EC7A 2DEPA 5EL1A 4LB4A 1F6PA 4HVXA 4AF0A 3W7QA 1W1PA 4JTAA 4LEQA 4CU7A 4RZ6A 1QWKA 4BF7A 3BL3A 2OEKA 3RRAA 1KCKA 1I9CB 3K8KA 3AIUA 1XGEA 4XZBA 1CBGA 4XIAA 3WLQA 5CC5A 1Q66A 4OGZA 4LUIA 2W63A 2P76A 4Y8EA 4K38A 3RILA 4C5ZA 1IIHA 3TTEA 3F4VA 3NZRA 5I3GA 1VLIA 4LS0A 4ZZ9A 4QRNA 4ZEPA 1EZ2A 4FOKA 4AU0A 1D9EA 3ITTA 1M5WA 4ADUA 5FF0A 4GZIA 1TUFA 2TMDA 2BOEX 2PLJA 1HL8A 2XDFA 3SCVA 3H53A 4Z0SA 3KE0A 3A47A 1YTDA 3WQPA 2INFA 2HZGA 5D9OA 4FPSA 4Z42C 3ABRA 4HPJA 2BBFA 2Z6IA 3URAA 4XQ6A 1UR1A 3IGUA 3LBMA 4JDYA 4GK8A 2E9LA 3M5ZA 3PBGA 3WK0A 2J4GA 4FP1A 5BROA 3QM3A 3BLEA 2OPJA 2PDBA 3W38A 1FHLA 4JTJA 3W22A 1XLDA 5J5DA 4PBGA 5AHLA 2HSAA 1GQIA 4NZ1A 1V3IA 4DNHA 3E38A 4JTKA 3KOYA 3ARZA 2QR6A 3NUKA 3TFCA 1DJQA 2GK1A 4QSHA 3L65A 2J7EA 2G96A 3K5XA 2PTXA 5CG0A 4AXKA 1P0EA 1UR0A 1HGWA 2ZWZA 3KVLA 1XJBA 4EWND 4DEFA 3SCWA 4GCXA 3E1F1 4UQAA 5KZDA 5LA1A 1FWJC 4PFMA 1MEHA 2VR4A 1ML1A 3TYZA 1TTPA 1Q6RA 4GUHA 4O0KA 1XBZA 5G2IA 4ZQOA 4AISA 3M41A 3GS6A 1E9ZB 4A3YA 4JYEA 2EPKX 2QQ6A 4LYRA 1U22A 4DVOA 3WLHA 1L6SA 1CLVA 2J7BA 2IUZA 2QPUA 2QUVA 1J2BA 1M9HA 3V36A 1DIEA 1XYAA 2B81A 1IF2A 2X2YA 2VJXA 3FW6A 2O9OA 1V4YA 3EXTA 4I6KA 1X7FA 3A64A 4R9XA 1L6GA 2MANA 3LRLA 1V02E 1KKOA 2XUCA 2DGAA 5CLTA 3LMYA 4X0NA 2PWDA 4XVEA 3W3OA 1GQLA 1RY0A 3TQVA 1X8CA 3QRHA 4LUJA 1G4PA 3MW7A 3W7PA 2Z7KA 1GVSA 1LLZA 4MZ8A 1PZ3A 1XKYA 3E9AA 3ZOAA 3IJQA 4MWAC 2PDUA 3L5LA 4DWSD 2YIHA 1MO0A 4JNMA 5D9MA 1XXXA 4LYKA 2ZTJA 4LTSA 3DXIA 1XGDA 4HN8A 1EA9C 4MSSA 1FOBA 3B97A 4IQLA 4M3PA 4AF0B 1AMYA 1G4SA 1IEVA 5AC8A 4JHMA 1GPFA 4WX2A 4EK7A 1W3TA 1TPUA 4BK9A 2WM0A 3SJNA 2J47A 1UMLA 3TWAA 3HURA 1JCXA 1I2OA 3KRBA 3GVQA 2VFFA 4L9YA 3O06A 5CC3A 2XYLA 4KGLA 1PKMA 4DO5A 5F4WA 3MUXA 2RGLA 3CL7A 3OVPA 4EXAA 1OFEA 3A5FA 5BW6A 2VDHA 1E5JA 4C6FA 1EUNA 2PRLA 3AIQA 3UXDA 2FTPA 5FEXA 3NNTA 1ZU8A 1FHUA 3F7JA 4E2BA 2UZ9A 4BF5A 1UWRA 3F2CA 4EXBA 4DM1A 2YB4A 1TJ2A 2I1OA 1XLLA 3GYEA 3AMGA 1PTAA 3RPTA 3CGTA 4GG9A 4C6CA 3GIPA 2EJ1A 4GUGA 3G1RA 4HB7A 3ARWA 4P7RA 3JUGA 1MXDA 1KFEA 2G0WA 4RNFA 3M9YA 4K6AA 5HWMA 1DBTA 3EOEA 1TPEA 4LX4A 3S8HA 2QPXA 1FCBA 2GK1B 1F3XA 3THCA 1FTXA 4B92A 5HWJA 2ZXAA 3EB3A 1T8XA 3QGKC 3BOLA 1J0KA 3OHMB 5A6BA 1EX1A 4AW7A 1ZBCA 3AI0A 3CAWA 4HTYA 2WC7A 4XZMX 2POZA 3VNLA 3QY6A 3N1AA 3ARRA 4LEFA 3TVAA 4L64A 4GVHA 5A6MA 2DVUA 2YCIX 5H8PA 4R34A 3EWUA 4UTFA 3NQ7A 3NGFA 3L0NA 1V6TA 3QYSA 3UYIA 5D02A 4GIRA 3PWGA 4HCLA 1Q65A 2VR5A 3E0IA 2QDHA 3THAA 4F0HA 3U57A 4UCFA 5BXSA 1UPMB 2DJLA 1J0ZA 3RM9A 3W1LA 1BXBA 4MAZA 4KH2A 5I79A 1DTNA 5ABHA 1VFOA 3PZGA 2D0FA 3A5VA 3IJDA 3AIRA 1FCUA 4GVFA 1W54A 1PSCA 4MFEA 1I1XA 1OFRA 4J3UA 4EAYA 2H8XA 3M6YA 1WP6A 4HT3A 3UWVA 3MDWA 3LHVA 1VBJA 1FP9A 5G4WA 1D7KA 1KM5A 4KCWA 1I2PA 1NOUA 2G37A 2J13A 3B03A 1HJQA 3QPYA 5FA5A 1GOQA 3KTSA 1OX6A 2Y5SA 1UWQA 4GIYA 3TK7A 2OYLA 3QGVA 4K1WA 2XZ9A 5CJ5A 3AO0A 1U5HA 4LC8A 3CZKA 1RBOB 4IPJA 3ORWA 3V1HA 3W1MA 1Z8AA 2FYMA 4YXGA 3D47A 1K4HA 4PSPA 4NU7A 1B57A 1PUDA 4KIRA 3GVGA 3EAUA 1UA7A 1Z44A 1L6YA 4DJFD 4CN4A 4YVXA 1W17A 1ME7A 1UKSA 4J9JA 4NRSA 1MI3A 2BFGA 3ES8A 3ZVHA 4GI8A 1HT6A 3K8MA 1GYMA 1AK5A 2ESCA 3GC5A 4H6RA 5CPNA 1US2A 4FNPA 1BWKA 1LT8A 3PZUA 5AZ0A 5EPDA 4RZ5A 3CIXA 2G50A 1OT1A 5KEZA 5CSSA 3BAJA 1XI3A 3PULA 4CNSA 1PPIA 3FEMA 4H8NA 4GYKA 1S2UA 3TDFA 1E51A 2DZSA 4FZIA 5I06A 4GABA 7ODCA 3W7HA 2PF8A 4OFCA 4OV4A 4WJEA 2ATSA 5ENLA 3LV5A 1MYRA 1DQWA 3WQWA 1VJIA 4GMEA 4PODA 1R3RA 4GYPC 2FGLA 4JZ5A 3GTFA 2PURA 1Z3NA 3B0YA 3UU0A 4BQ5A 3CB8A 3VGHA 1E6RA 1AA1B 4W87A 1GORA 1E70M 1LOLA 3RMJA 1XW8A 5EMJA 1A53A 4HMCA 1CGVA 1TPH1 1KQZA 4ORIA 3W1NA 4YHGA 1NAL1 3WUBA 4LYPA 4NQ1A 2QCLA 4ZQMA 3ANVA 2PLCA 1SO3A 1SZGA 2TRSA 4C6QA 1XDMA 1ITUA 3SQMA 2PWFA 3SSJA 3N2MA 1LL6A 3PTDA 4FXRA 5I5RA 2ZE3A 1OSEA 1K1DA 2ZRWA 3C61A 4XAPA 3CO8A 3EDJA 4B15A 5CAHA 4NX5A 4BJHA 3DFSA 1E43A 1LYXA 1R2RA 1GVIA 1UA3A 4A6GA 2F7FA 3HQ1A 1A0DA 2J8FA 2TYSA 2E9MA 3U4AA 5B7YA 3FJLA 3BQ6A 3IIVA 1JZ2A 2DZXA 3V16A 2ACUA 4U4MA 3W72A 3NO1A 2GJRA 2FHBA 2QHAA 3MMDA 3KX6A 3W01A 4KQNA 4ZFMA 2IMRA 1P1MA 4RZBA 3LTSA 3RU6A 2LLEA 2XVKA 4RE0A 2R91A 3AMLA 3OPSA 3E2SA 2GUBA 2G4JA 1ZBVA 1XQKA 2P3EA 4M19A 4JCLA 3PPCA 3S4TA 3GNOA 1XWYA 3N15A 4XSMA 2QJMA 1TPWA 3KHDA 2EF9A 3S1UA 3VZYA 3ZZ1A 4OKDA 3SW6A 4ZODA 5CPSA 4NJIA 4ERIA 2XIOA 3CPUA 3EB2A 3B0PA 1IT8A 5XIMA 3L4ZA 1KM0A 1OINA 1YBQA 4HJWA 4YTSA 4FAMA 1B9BA 4GKLA 4LCRA 3A9BA 3UETA 2W66A 4UQDA 4JFSA 1OEPA 3OVQA 3DFHA 1PIFA 4ZE5A 5BWAA 1DXFA 3ZVHB 1OT2A 3SEPA 1FWRA 1D3CA 3RJXA 3SFKA 2A7RA 1BGGA 3KEHA 4O1CA 4TQTA 2YSWA 4H19A 1GUVA 5HR6A 4S2CA 4CN1A 3CU2A 3EPNA 1QOPA 1DP0A 2OGJA 3GYCA 1V77A 5L9FA 3NQ2A 3VDGA 3VIMA 5I3FA 3MC5A 1GJPA 2FZMA 1UWSA 3G3MA 4ZB2A 2BHZA 1XHGA 2ZX6A 1QO5A 3AYTA 1XIIA 2C0HA 3H4GA 2REQA 4CD5A 2YX0A 4MB4A 1LDCA 3MV11 3NA8A 3CJPA 5G5IA 3LPGA 4FI4A 3MVIA 4IZGA 4FB7A 3LZ3A 3GG1A 4O8AA 3IPWA 4PN2A 1SW7A 3BQ5A 3NVTA 4WUIA 3UJEA 3M0ZA 4TMCA 4MHBA 3EA1A 3AROA 1YTEA 3ARVA 2CFFA 1K8YA 2YCKX 2O0TA 5LNWA 4XZWA 2G8ZA 4DO4A 1VPQA 3NYDA 3QR3A 3SURA 1QK2A 3UPMA 2PBGA 3SRHA 1NM9A 3BAIA 1MFUA 4G7FA 3BPWA 4NY2A 1LG2A 3G0UA 4FXSA 2JFEX 4IIGA 3ABOA 3LHWA 1VPYA 3VFLA 2WNZA 4DNMA 1LM1A 2Y4SA 1K8CA 3TCEA 3TONA 1EJVC 5CZSA 3VCRA 2HE8A 2XIIA 4AIEA 4TV5A 3R12A 1EHAA 2A5HA 1RLCL 3G24A 4MJMA 4E2OA 1J2WA 3BLLA 3FN9A 3W76A 4DBDA 4QNEA 1W1B1 1ZAIA 4AWSA 1PVNA 2FVKA 1YNPA 8XIMA 5M1TA 5E5CA 4TO8A 2CLHA 4ACYA 4PTNA 1UR2A 3MJMA 2CYGA 4IT1A 1WOBA 1P0KA 4GY1A 2AGTA 1CEOA 2EAWA 3TZFA 3F2DA 4HA3A 4MYAA 4POCA 4PH6A 4B9ZA 1WBJA 1XCFA 5HMEA 4FLQA 3MMTA 5LXEA 1J79A 3SGZA 3H4XA 5AVNA 3T2QA 1XH0A 5XIAA 4C6OA 4NSBA 4PMVA 1EOMA 2Y88A 1W5MA 1DJWA 5D2VA 1Q6GA 3OQ8A 2IKJA 4IX0A 3KCJA 4J4KA 4JTCA 2HS8A 1LOQA 3DCPA 2ZUVA 3BMXA 4O1DA 2XFFA 4JTIA 2PTZA 4C7DA 1S1RA 4O54A 1O1ZA 1JNDA 2E7FA 1EQPA 2TAAA 4GBDA 4KEUA 3WQOA 1YBQB 3HGOA 3U2CA 3G6MA 1IIGA 1NEYA 5LNRA 1L9WA 3IWPA 5EMMA 2P5NA 1K8ZA 3MZ2A 1QNRA 1GT8A 1Z69A 1WUFA 3P0WA 2PDWA 2FB3A 4GI6A 1NELA 1XPYA 3N2CA 5ECVA 3PSWA 1R3WA 1QHZA 3UWWA 3VIJA 1DE6A 4JIQA 2FGBA 1LCOA 1LTDA 2C8NA 1TMLA 3GO2A 3OA3A 4AIUA 3OG3A 1AQ0A 1JF5A 4HYRA 1EC8A 4N4PA 4UMCA 1TCDA 3M47A 3IGSA 4H00A 4H2CA 3RYSA 1J12A 4NKCA 1HKJA 3BG5A 1F74A 4Q22A 4G5DA 1VYSX 3TXVA 3R0UA 3STGA 3BSGA 1R7AA 2YCJA 3PTKA 4M6QA 5F1UA 4YYCA 5A2BA 1UOKA 2QJGA 3NXFA 3VKJA 4EIVA 3C2RA 5FF7A 1EWEA 2X1UA 4ADSA 4E4UA 1QPQA 2REQB 1TPVA 3TEVA 1LBMA 3ITXA 1ISVA 4MNJA 1XV8A 1P4CA 4OTKA 3UG4A 1BF2A 2YBVA 3GNXA 2NT0A 3EWBX 4QM1A 1LP6A 2YL5A 1NTHA 2W91A 3TSDA 1SZFA 3EOOA 4G9PA 3TTQA 4PUMA 1HKIA 2F6KA 3C56A 1JYXA 3URNA 2YZRA 4MNLA 1HG3A 3USBA 3G18A 1RZMA 1W1ZA 4UFLA 3WH7A 2PDFA 5T8GA 4DZAA 2XFWA 3W2NA 1KFJA 4GLEA 1OZQA 2NX1A 3FEQA 2CLLA 1Q8JA 1NQKA 3QW4B 1W1IE 2BVDA 4JPGA 1FY6A 1FWCC 3MUIA 3ARPA 3B4YA 1JCMP 4HD5A 1TG7A 3NDYA 3VD7A 3BAKA 3TNBA 1EJXC 1F9CA 3PAOA 3DDMA 4FK9A 3ARTA 5LZLA 4F2UA 4O8RA 5D33A 4U33A 1HUVA 1E6XM 3O6DA 3QQWA 2IW0A 2J9XA 5T26A 1TVPA 1UKQA 3B8IA 4BQ3A 3R0KA 4CEUC 1L6FA 1RK6A 2J8GA 4RNJA 1DJNA 4B4FA 1LG1A 6CGTA 3C2VA 3TJ4A 3ONBA 3EMQA 3P62A 4KRUA 3UWQA 2CPUA 1PAMA 3UG3A 1TVLA 1M68A 4D8LA 3W7OA 3NM3A 2GJPA 5DANA 1MVYA 5CGTA 1NY1A 3GH7A 3BTNA 2WBKA 3WLTA 3U5UA 4W7WA 3MV01 4JTQA 2BB0A 2D24A 3LGGA 4GOAA 2R1KA 1R85A 2BODX 5DT7A 2CLKA 1IWBA 3PTMA 1GJWA 3EKZA 1K9EA 4Y2WA 5KINA 3Q94A 3TE9A 1Q6EA 4MUPA 2RFGA 3HN3A 4JL2A 1QHOA 2XIQA 2IS7A 1CNVA 1H1YA 2OWWA 1PX4A 2RDWA 3KUMA 3UR7A 1U83A 1IZJA 1JCNA 1TV3A 1W1YA 1GVFA 3AJ7A 4HGXA 1GYLA 3KDNA 2QNEA 4AWTA 2WVUA 1ZBWA 1SJBA 2QJHA 3AMCA 3VM5A 4ZOCA 4Q8MA 2PGWA 1AQHA 1JUEA 1F73A 3WEZA 5H1WA 3VNZA 2BDQA 3LA4A 2WXDM 4H9UA 4GQRA 3W7KA 1ZALA 3TOYA 3CQKA 1DKWA 1S2CA 1J9YA 2V9DA 4I8YA 1XISA 2DSWA 1C7TA 4B3LA 4IL0A 5HNRA 4UUIA 4PB3A 1TTQA 5K4XA 5AOUA 4IIBA 3MBFA 1VEPA 3M5XA 3ZR4A 1JGMA 3I6TA 5TAOA 5C6MA 4HOZA 4A8IA 3LSCA 2D2HA 3L21A 2V3EA 1M3UA 1UH3A 3GQYA 4UQ9A 2INZA 2J75A 1ECEA 2VT0A 4Q6JA 1H2JA 2BWGA 5D03A 3LCHA 4KRTA 1TV7A 2C71A 3XINA 4LRTA 7PTDA 3R0DA 1YE6A 2OX4A 5CJMA 4OWGA 1EP2A 3W85A 4GNVA 3STFA 4QG8A 4JS3A 3HJZA 2GGEA 4X2PA 5D8WA 1XLCA 3UG8A 2FDSA 4I9JA 3KVJA 4WK9A 4INFA 5FJTA 3ARXA 1HNYA 3LCIA 3LY0A 4O0ZA 4QG6A 4MB3A 4U3AA 1B31A 2WC4A 4WCJA 3W74A 4NIRA 3DENA 5CJNA 3BAXA 4Q4SA 2FZDA 4F0LA 1M6JA 2ZX7A 4AZCA 4YCPA 1UH4A 3CL6A 4ENLA 4XV0A 1Z41A 3BLFA 1HJXA 4MKVA 4YMZA 1YDYA 1XINA 1ICQA 3AWOA 4X60A 5EMKA 1AH4A 4RNHA 2TSYA 3G1VA 5I0DA 4IX2A 3HV8A 1RAKA 3M46A 3W87A 3GXIA 3SBFA 4MY8A 4PRTA 4N6EA 4I3GA 4LY8A 4DJDA 4K39A 1V79A 1H1ZA 4C91A 3NZGA 4D8ZA 1KFLA 1CCWB 2F9RA 5A6TC 3RX4A 4UTTA 1Y65A 3TYCA 3TYEA 2WKGA 4IFKA 3NQ6A 1J4EA 3HG3A 3L4VA 4WSJA 2V30A 2HVMA 3FXGA 4GQBA 1OX4A 4D2JA 2ZICA 5HUOA 4JFUA 1SZRA 2YW4A 2YBUA 1H7XA 4E8CA 3GZ3A 2F84A 4G2DA 3VOFA 1WDWA 4TU1A 2V5JA 2AMGA 3G1FA 5DMYA 2A7NA 4UR8A 4MAVA 1TB3A 1M7OA 2V8ZA 1R0MA 1U33A 5G2HA 1OFQA 5KZ6A 2WQDA 4CD6A 1UP3A 3AS1A 5HXMA 3A13A 4QITA 2YGYA 2QAPA 2J7FA 2QCFA 4AYSA 4BCEA 4TX9A 3POHA 2OJPA 3T09A 1K6WA 3EXSA 1FDJA 4LAOA 4WKHA 1DWIM 1R47A 5HMDA 4WZHA 2VGIA 1V8EA 2GWNA 5E0KA 3GDBA 2YDQA 2WW5A 4Q3MA 4HSOA 4S1FA 4GIAA 4AX6A 4ZCWA 4QEHA 4MUZA 3WQVA 5SWUA 1B0IA 2GJLA 4H04A 1VRXA 1ME8A 3LRMA 1OBAA 1ZAJA 3LQGA 3EYPA 3AISA 4K1GA 4H9VA 3TQKA 1EGMA 4PMOA 5DY3A 1AJ2A 1ZZMA 3WH5A 3BANA 3AYVA 2QCMA 4GC4A 4ECLA 3WNPA 3N4AA 1ALDA 3DG3A 1E3ZA 4H9MA 4HSHA 3HPAA 2XWDA 2Z1XA 4FXFA 3QXBA 3ZT5A 1XIEA 2XN0A 1YXCA 2GVJA 5KTLA 3EWDA 5C70A 4KBXA 5CBBA 2E8ZA 2GVGA 1EO5A 4R85A 1XCWA 3VAVA 3OLEA 3P82A 2W5FA 1OHLA 1VFSA 1WQ5A 5E09A 5I2UA 3WDQA 3QY7A 5F1VA 1OF8A 4CQ9A 2CZDA 5ABFA 2QT3A 2PAJA 2X42A 5K9DA 4Z1CA 4QBXA 3GTNA 2CNCA 2VZVA 1QUMA 3SCUA 2PRMA 5D8ZA 3MSGA 3UWZA 1RJRA 1KFWA 1TX0A 1TYGA 3HPZA 1BHGA 1E0XA 4AZCB 4F0MA 5K4ZA 5GQBA 3AWNA 3CNYA 1R6WA 4E4FA 3M5VA 3QW3A 3SECA 4AWUA 4TVCA 2NT1A 4FIRA 1O5XA 2G95A 5LIYX 3BZGA 3CZGA 1RXOB 4QISA 1ISXA 2FH8A 1V0NA 1W6TA 2CLPA 3GM8A 3GFXA 5KSWA 1HKVA 4P8VA 1GNXA 3LEPA 2DPEA 4IQJA 2Y7DA 4RL3A 1V6UA 1FWHC 4XD5A 1XC6A 2DZAA 4Q4RA 2O9RA 1R46A 1W56A 4YL2A 4IFKB 4O16A 4PTVA 4AEFA 3IRSA 3E96A 1NJJA 4Z2KA 3BSHA 1OX4B 2X40A 3TXZA 1I0BA 3BVJA 2V5KA 1V93A 2PP3A 4W85A 1B90A 1XH1A 4E2VA 1V7YA 3CUHA 3WQ5A 3GXPA 4IWWA 1K7FA 1E4LA 5DMNA 4UTIA 1PKLA 3WDJA 3IV8A 3QV6A 4LAUA 1QTWA 1L6WA 1ONXA 3M1ZA 4HA1A 4HK5A 1R9ZA 3I4KA 5AHIA 2OWCA 3K2GA 3QR1A 3OJGA 3APGA 2JGQA 6ENLA 3CT2A 1VFTA 2VUNA 4RDYA 3RX2A 3T07A 4HNUA 1GGOA 3TN6A 4LVAA 3C4UA 5CH9A 3FKKA 2HVOA 2WC3A 4KWVA 1W5PA 4KETA 4FF5A 3WD3A 4V15A 1BVZA 5FJPA 2JF7A 1FWBC 3A4XA 5T91A 2VFHA 2PDQA 2XGZA 3LZ5A 1MSSA 2KAUC 3T2OA 3N9RA 5IFTA 3GG0A 2PDIA 2PWGA 3QTGA 1JPKA 2HV5A 2PFHA 3C2YA 4NZFA 4CNTA 5JIPA 2ZXQA 3CQHA 4Y8FA 1QNQA 3UP8A 2ZWYA 4B90A 1NDYA 3O6YX 1GZ1A 4HCDA 3PUEA 4FX8A 1XH2A 3OEXA 4EWJA 3GFYA 5HWNA 1FKXA 3MI3A 2A3HA 3KS6A 3QV9A 4JTFA 3T0BA 3WJXA 3LLXA 4QJ1A 5ABFB 4LC6A 3KVMA 3OTRA 1LT7A 1Q4NX 2WHLA 3IANA 1P6WA 1C3FA 5FEZA 3VC5A 1D8CA 5I6SA 3WFLA 3MHUA 3M5YA 2ZA3A 3EDDA 4M56A 5M17A 4GD0A 3CHDA 3KP0A 2OT1A 1SUXA 4AMCA 1DJYA 2X05A 1AFSA 3VIIA 2RJGA 3ENLA 4Y9NA 2E6FA 5C9UA 3LI1A 4Q8NA 2VGBA 2OZ3A 4PEEA 2P53A 1V3JA 3R43A 3WLIA 3S2CA 4B5XA 3TQ0A 1GKPA 4FNRA 1W91A 3CB3A 2FHCA 3H6OA 1OZMA 5M03A 1F5ZA 3LBOA 4ATDA 4QQUA 4IGSA 1AUSL 3NM1A 4S3FA 4PCTA 1XDLA 2E28A 2EJAA 3LCGA 3RX3A 4EXQA 3VCCA 9XIMA 4V27A 1OYAA 3QF0A 3AUOA 1UMYA 1XLKA 2PDYA 1L0PA 2WHKA 2X0HA 1KFBA 2OODA 1XUZA 1E71M 3RO6A 4IMGA 4KESA 3FYPA 3GDTA 4C1NA 1IGWA 4L9ZA 2XM2A 3RNDA 7REQA 2A4AA 1UCWA 5CSRA 3O3RA 4YVVA 2ZZ4A 3BAWA 3PUDA 2JEQA 5HMFA 3B8DA 1IEWA 4QLKA 1AW1A 3S1VA 2XJ7A 4EP8C 2A21A 3UPWA 2FH6A 4UFJA 5AC7A 4RXFA 2XFRA 1CPUA 1TR9A 3V3WA 3FCPA 4HYVA 1BGAA 3ZJKA 3PWAA 3S83A 2VC7A 2PA6A 1TFVA 2ZTKA 1MW2A 1TJ1A 1C92A 4H7ZA 4G6CA 3AXMA 1OGBA 1WKDA 3I7SA 3U7BA 4PL1A 4XTDA 3E5BA 2AAAA 3FV9A 1XR2A 4CCCA 3CH9A 3GE7A 2ZCGA 3SQSA 1VFHA 1OF6A 3TIMA 4DF0A 2GYIA 1FWEC 4OZOA 2DIEA 5FI8A 5A69A 1EJ7L 2CLEA 1P6BA 2CLMA 4Q8WA 3MPGA 1ZTVA 5EKYA 1D7FA 1IE7C 3N25A 4MNKA 2ZZ6A 2DIKA 5CG7A 3TMQA 4A29A 2ACSA 1GZJA 1TZ7A 3SN1A 1XYFA 4DN1A 3WKZA 1SO6A 2YFNA 3MKCA 3VNKA 1TREA 2WVVA 2E25A 5FAJA 3CL8A 1Z32X 1JD9A 1HZYA 4FEZA 3UCQA 1HFBA 4UFKA 2YJQA 3STPA 3U8GA 3UR5A 1EEPA 4KRZA 4GA8A 1OCNA 3GH4A 4S3BA 1KC7A 2GDVA 3S47A 3RN6A 3VIOA 1VJZA 4RE4A 4URIA 3WK3A 3PB2A 5MF5A 3BCFA 2AKZA 3W28A 2R1PA 3E0FA 3UD6A 1QWGA 3KHJA 5TD4A 1GVRA 4J3VA 2FPYA 4WDXA 3ICJA 3L4UA 4Y96A 1CDGA 4RX0A 1SM9A 4TIMA 1B3OA 1Q63A 1IXNA 3LM3A 2ISWA 2GDUA 1MDRA 4W8BA 3DG7A 3N2BA 1YNYA 4JTHA 4AD0A 4AC1X 1EH9A 5LYRA 4IIHA 4PRWA 2B7OA 1RA0A 3E12A 4M7TA 4Z1DA 3SR7A 2AQVA 4HU4A 9CGTA 3VKDA 4Q8TA 2FKPA 3OG2A 3WMBA 5AHFA 3TV8A 3VNMA 3LOTA 3B9OA 1VAHA 3AS0A 3HG5A 3T1GA 1W31A 5AECA 5CXPA 2H9AA 3UBPC 2JGYA 3CUXA 2DORA 3K1DA 3OLIA 4Z1AA 4TMBA 2XIBA 1V6WA 1QPOA 3HOJA 4U10A 5FCZA 1MZRA 1EO7A 5F7UA 2VO5A 1E4MM 1JGIA 2YB1A 4QJ5B 5H2ZA 3FJ4A 3SCOA 2RHGA 4LCSA 4CUCA 2R1MA 4DYKA 3N11A 2VHLA 1LL4A 1ADDA 3OB8A 4CNPA 4N4QA 1LORA 3HMJG 2HK1A 3FJ6A 4PMDA 1FWDC 2X1IA 5A8PA 2VEKA 1R30A 3LXBA 3R8RA 2A7PA 2PU0A 1N8IA 3GVRA 1Z48A 4C1NB 4JN7A 3PBVA 3FAWA 5DRCA 7REQB 5HR7A 1XDJA 2ISSA 1UR9A 3QMRA 1BWLA 3PUOA 2D3NA 3L0GA 1U1HA 2ANUA 4BFAA 3BV7A 4MZYA 4AYGA 4L4MA 1ESWA 4Z2HA 1HKKA 3I6RA 3M6DA 3IJ7A 1Y8BA 1WAUA 3GW3A 1G4TA 4Q8OA 2WLYA 4I7UA 4GH3A 1Y5VA 2R9RA 3LLFA 4C6PA 3ALGA 4MIMA 3DEQA 2CERA 1WYIA 4HU0A 1BEUA 1KM1A 2FDMA 1DVJA 3NQDA 3O6CA 4FIQA 1ME9A 4UTWA 2X1TA 4Q4OA 4KCUA 1NFPA 2OOGA 3LHYA 6XIAA 1W9BM 2D23A 5A8GA 3NEHA 1W3IA 2OO0A 2GQAA 1UBSA 3H4WA 4XZLX 4DF1A 3SSZA 4JKMA 2GGGA 4HNVA 3KRZA 5C2XA 1W3JA 3AXIA 2VEIA 2ZUSA 4W93A 2VX4A 4LAMA 4M8UA 2Q71A 4GQ0A 3H2MA 3ID7A 3KZSA 4RE2A 3IEBA 1FHVA 1ISWA 2P1FA 5BRPA 2WVVB 3AICA 2FLIA 2ZUNA 1XIMA 3MKVA 3S6OA 3K1GA 3QMSA 5ABTA 3BXWA 1LRNA 1TX2A 4Q8UA 2ZRZA 4O0QA 2Y70A 2ZYFA 1ONEA 4TVDA 5AC5A 1AMKA 1QJWA 2Y89A 1KKRA 2Y2WA 3QKZA 1H61A 3BV4A 1ZBKA 5DQPA 3BARA 5HA7A 2PWHA 2GDQA 4LBRA 3VM7A 3CMFA 1M04A 3CAQA 4V1YA 2E9BA 4GYJA 3D0CA 4F66A 5C9XA 2UV8G 4Q33A 3ABZA 4QS5A 2DQXA 1PZ1A 3AZTA 4MJ2A 4DM2A 5FOOA 2C91A 5IBXC 1UD2A 4AHQA 1JZ7A 3A4JA 4U31A 3ZR5A 4DYEA 4PUDA 3I65A 1E15A 1B3WA 3C3NA 2QUMA 6A3HA 1Q6DA 1CENA 4ATLA 3AALA 1UHVA 3WLKX 5LXXA 3NWRA 3TAOA 2E5BA 4CD8A 4ZQRA 3MCOA 3IS4A 3V75A 2H9AB 4R5EA 2WJDA 3GBDA 2AL2A 3TCSA 2VFGA 1GKQA 2Q09A 3DFTA 3WQCA 5HANA 3TTSA 2FTYA 2ZVIA 4W9TA 1E72M 1E5NA 4Z08A 4MZ1A 1GKRA 1EJRC 3NIYA 3U3HA 1UUMA 4LXFA 4X3ZA 4NUWA 8RUCA 1UD8A 2O9TA 2XINA 3N17A 1OCQA 1OVDA 5D9NA 3EX1A 5DMLA 5MHBA 3UWYA 3IIPA 3FDKA 4IOTA 4RDVA 3DYPA 1TRIA 3RXZA 1DWGM 2DT1A 2CBJA 3ZWTA 4UWMA 2HDJA 1FWIC 2C1HA 4AB4A 1JPDX 2E68A 2WWDA 4NAFA 2ABAA 1GHRA 4J2PA 3PR2A 4Q8VA 4TR9A 4Q32A 1KXQA 2RDXA 1Q7ZA 3F5LA 3UF9A 3LMZA 2I9EA 2WZHA 3NAVA 2NQHA 5J5RA 3THQA 3GY1A 3GXTA 2ZVRA 4PCFA 1RCQA 3B04A 3A23A 4K7VA 3UXKA 2TPSA 3DYOA 4L9XA 4ZENA 1OC5A 5A3HA 3N18A 2XN1A 1OABA 1LLWA 1KXVA 3W6MA 2V2CA 2GOKA 2GOUA 4HN4A 1PHQA 4LALA 1Q7MA 5HQEA 4AXNA 5J8LA 2PTDA 5I3DA 2VFDA 1YADA 1BAGA 1NDVA 3W71A 2QV4A 3C52A 4EKJA 4YHEA 4FLRA 3ONCA 5DF0A 4LV9A 4IIFA 2A3LA 5FSEC 2BX7A 3TFXA 1G94A 3S1GA 1E9YB 1RUSA 4ATWA 1UW9A 4ROPA 2IXUA 3N2XA 1PKYA 1SW0A 1SFJA 1LUCA 4IJBA 3K8LA 4RPPA 1RD6A 3EMZA 2WMJA 3HQPA 2FVLA 5HPCA 5TF0A 3M16A 1EIXA 3C0SA 2OOFA 4UCGA 1YLVA 2ZFAA 3CQIA 1H5YA 1O5QA 2QUNA 1JI2A 1KTCA 5C2GA 1TV5A 1D2KA 5E93A 2OYKA 3TX9A 1S3HA 4IMEA 3WD4A 1RBAA 4KFPA 5CPMA 2RDUA 1PV8A 3GTIA 3AZSA 1O6IA 4J3XA 3DG6A 4W8AA 1BKHA 1LWHA 2Z2BA 2HXUA 2FIQA 1RH9A 2PDHA 4EPDC 3CUZA 3VCNA 4EANA 3G1AA 2ZX8A 4C6LA 1RP9A 1EYWA 4IMDA 1IEIA 4PRRA 1VHCA 1YX1A 4B9YA 1UZ1A 4IMFA 1HJWA 1DHPA 1WDQA 4DJDD 3CUJA 3DGBA 1PX3A 3V0UA 2NSOA 4MGGA 1WKEA 3ARYA 2IKIA 3M64A 2WANA 2R1NA 1M7JA 2NVAA 1XYLA 5D2YA 2VXNA 3RR4A 1BXNA 3DOPA 3D5HA 3O0KA 3IJIA 1YDNA 1XIHA 4K8GA 4B16A 1TKKA 2I14A 3LK6A 3PWIA 4ZO6A 5IM51 3PPHA 1TQJA 2VRKA 1E1EA 1WZLA 3QQ0A 5BCAA 3NEVA 3N73A 5IOBA 4MKNA 3BICA 1YNQA 3KXQA 3WQ6A 1WAWA 3MI2A 3NURA 3PZ9A 3NPVA 2O7QA 3HTWA 3NQMA 2Y62A 5CPQA 1S5TA 5HULA 2ZX9A 4L65A 2DUAA 5CC7A 5LIKX 2JKPA 3WDIA 4IHCA 3IUIA 2XH7A 4MLJA 4W86A 4HBKA 4S3AA 4UFHA 4GWEA 4XUGA 3VIHA 3PG8A 4UFMA 3MO4A 2OVLA 4PCSA 2VOMA 4GRSA 2OLHA 1H60A 1J6PA 2W0UA 4FXJA 3IAQA 1BQCA 3BK0A 2A0NA 4JGDA 2YL8A 4MJZA 4I5RA 1JAKA 8XIAA 3P8JA 1H0IA 4JL1A 2VMFA 1F7BA 1P43A 1VR6A 2OU4A 4F4RA 1ZGDA 3AMKA 1ZPTA 1O95A 3AFBA 1DL3A 4MWAA 5AB3A 3NTYA 1YIXA 4GVGA 3VI2A 1S2VA 1QFEA 1H1NA 1ISZA 1DPMA 3ARSA 5REQA 1F6YA 1IQ8A 3BOXA 5I09A 4D6CA 2VZUA 4A8LA 2DJXA 4MTVA 1TO3A 1F3EA 1PYMA 3IIXA 2R8WA 1V0KA 3F1QA 1LUCB 3VINA 5GVJA 1UD5A 1DJIA 2CZVA 1HIZA 4XZHA 2P0OA 2WNWA 4EOUA 3H21A 3NGJA 1EUAA 2ZC8A 2AKMA 3W9ZA 1XLGA 3SCRA 1F8IA 1XSJA 3PZTA 5TQLA 2VFEA 3MY9A 3TR9A 1GYNA 3GR8A 4OECA 3EWYA 3FAXA 2IPWA 2P3ZA 4O10A 2VURA 1UH2A 3WG6A 1DORA 5D32A 4XB3A 3M0KA 3AOFA 1K70A 2C14A 2CLIA 2QMKA 3N4FA 6XIMA 1WCGA 4JQ2A 1DIDA 4HMEA 1PEZA 3R4IA 2ADAA 3W24A 3MJYA 3BGGA 2J9ZA 5CBJA 2CLFA 4DBWA 1BVWA 3UZJA 1FXPA 1JVNA 5GJNA 7ENLA 1YMYA 1HP4A 4W5UA 3CS2A 5GNYA 1CZ1A 5K9CA 3OZMA 1YDOA 3QLLA 1W8SA 3UNDA 3W70A 1EF3A 1POKA 3VGDA 4O52A 1SFSA 1GEQA 1GW1A 2GSEA 5D05A 3WD0A 2HXTA 3EKLA 3EB4A 3FSTA 2QF8A 2Y85A 3CHFA 4M81A 4X63A 1O94A 3F03K 1TWWA 3AHVA 1AH0A 2C1IA 2EBNA 1J10A 3ABXA 3H2FA 5BXPA 1H49A 4GBUA 1ZL1A 3L67A 2D73A 1QNVA 3CWOX 4WSHA 2Y61A 2WMKA 1J18A 4NYUA 3V1PA 4IPIA 2ZXDA 1Z6KA 4F0KA 1A50A 4YTRA 1WZAA 4JNZA 2DUZA 3V7PA 1DJZA 4OOZA 2E5CA 4GYFA 4YIWA 4GINA 1K7XA 3NQCA 2YR1A 4I6VA 1A3HA 2XH4A 4J1OA 3VOGA 1JXKA 1KFCA 1RJQA 2XTKA 4TUFA 2Y0FA 1P6CA 2XZ7A 2HS6A 2P10A 4OBTA 5FIPA 2GJNA 3BJFA 3R8HA 4JYFA 1CYGA 2EO7A 1V3LA 4IPNB 5LKYA 1SJAA 3BC9A 3DAQA 3HQNA 1KM3A 3RITA 2Y1HA 3SO7A 3LHTA 1F6KA 3AIBA 4A3HA 1SJDA 1UWIA 2FFIA 5CKSA 2W67A 1JAEA 4C6EA 1EJSC 3E49A 1EFZA 1QW7A 1S5VA 4MMWA 4Q7IA 1R3YA 2D20A 2PDMA 3G22A 3POCA 2WNQA 3SN4A 4N9EA 4IPLA 5RUBA 4S3KA 2OKOA 4DZHA 4BKNA 2JKEA 4MWAB 1PJ9A 4MJ4A 3LPPA 2C1GA 5REQB 2Q01A 4LCQA 2DY3A 1NU5A 1Q6FA 1PXGA 4L4OA 1WDPA 2G3IA 3QC3A 1H11A 1G4EA 3AHTA 4GX9A 4NAEA 1XLMA 1SPQA 4GXMA 4RCXA 2EXOA 3W1PA 1IXQA 3RLUA 3S6TA 2DDXA 1DIKA 5LHEA 3FLUA 5HQLA 3QN3A 3OHIA 3MHGA 4HSNA 1G69A 3BUVA 1PB0A 3U9IA 4CQDA 3AXHA 4HPGA 4GZEA 2FHFA 1XG3A 5C2CA 2DZBA 1Z9AA 3GG8A 3D3FA 3GHTA 4N2YA 1F4HA 4S3CA 3W73A 2EPLX 4DJEA 2IPFA 4UQEA 3L5MA 3DN5A 3UZZA 1BQGA 2DZVA 3HPSA 1N7KA 2QGYA 5E1QA 9RUBA 1N55A 2RH9A 2VP8A 1FHDA 3LSBA 1NWRA 2JBMA 3EZ4A 4N6FA 3IIZA 2A3AA 2Q6ZA 3H2OA 2V3DA 3MHFA 3I3DA 3WLLA 3NZQA 3DH7A 4X9SA 3C0LA 4YNGA 4BEUA 1MQRA 2QJIA 1HVXA 3GZAA 3NR0A 4JQAA 1F4AA 3GAYA 1J0IA 4EE9A 3LS9A 4XWUA 4O15A 3WBWA 1HL2A 4L1XA 1H09A 3SB0A 3QOKA 3IUDA 5IHRA 1VPXA 3MSYA 5EMLA 4WXZA 1RCOB 3E2RA 1H7NA 2WMFA 5F2IA 2PDNA 1GTHA 2WYSA 4AZHA 1JNEA 1WZKA 4WHBA 4GYPA 4C1LA 2B0MA 3ELFA 1J0JA 1LROA 2FPVA 2GQ3A 4WIWA 2F2HA 2FB2A 4F79A 3URQA 4M51A 1AVAA 4MADA 4JTGA 2Q8ZA 3AIVA 1S1PA 4JIIX 4RJEA 3MP3A 7XIMA 2BMBA 3BWWA 1WKYA 1BRLA 4AD3A 4WKFA 1YPIA 4B3KA 2CLOA 3MCMA 4IIEA 2OELA 4F9JA 4PMRA 2BY3A 3UR2A 3WNKA 2OYMA 4JHZA 1GEHA 1XF0A 2CITA 1J11A 3NSMA 4IFRA 3HPXA 1BVNP 1NDZA 3H7VA 2PC8A 1H63A 1JFXA 3AIWA 2I57A 3N14A 2PWUA 1EJUC 3EDFA 5GPRA 3WK1A 5LHFA 1BXCA 1TMHA 4RNIA 3DI0A 4UR7A 2G41A 2BGSA 2ZZ7A 1L8NA 5G4EA 1NF7A 3A3XA 2Q8LA 1YQ2A 4GH1A 4NNAA 1KRCC 4LBUA 5EYWA 4O50A 3EX2A 2PD9A 4AMAA 1VBGA 2VD9A 4D6HA 1BLIA 1XSIA 4WQ6A 3CEUA 3FK4A 4W8LA 4WGXA 3C2FA 2V81A 3EXRA 2HEJA 2QZRA 2NV9A 2CWXA 2MUCA 3LNMA 2VR2A 2BLEA 4MDOA 5CZKA 2VKZG 4H4IA 3CEPA 2QUTA 4S3DA 1FX6A 2RGMA 4X2RA 1XFBA 4XISA 1ITQA 1HO4A 3SIZA 4CD4A 3WQEA 1KQYA 2RDTA 2QCGA 2ONEA 1E4NA 5EY5A 3UXAA 3KCOA 1C8VA 4F48A 2E67A 4UZSA 3TYUA 3O2LA 4NAEB 1M53A 1OCJA 5C54A 1F76A 2OQHA 4HHPA 4DXVA 1X38A 1E0UA 1K9FA 1QW8A 1R3VA 1BTCA 5A94A 5I3HA 3W2UA 4MOZA 4WDTA 1A3WA 4PUJA 4XK2A 4UTUA 2YA2A 4LNCA 1OIFA 3AUJA 2VX7A 2FPTA 1P1XA 4AX7A 4K8HA 2X0YA 1KW1A 3BLKA 1R9XA 1UP2A 4UTLA 3SY5A 3IK4A 4H6KA 5F2LA 5CGMA 3RAOA 2PS2A 1UKOA 3QV7A 4C6DA 1UROA 3R13A 3UZXA 4GGHA 1G5AA 2CU0A 1AODA 2OLSA 1BPLB 1LQ0A 4OHQA 4JYDA 4FLOA 1O1HA 3UVIA 3GNDA 2WK2A 5E0FA 4ADTA 2VZTA 1ZSXA 2CC0A 3TJXA 2WO5A 3N29A 1UIPA 4UOZA 1QBBA 4GJJA 1CT5A 1MWOA 3W26A 5DXXA 5U4NA 3S6DA 4Z2JA 1JPMA 3VNJA 1DIOA 1B4EA 5C5YA 1J0HA 4BS0A 1S2WA 3H55A 1GQJA 4I7WA 3NSNA 2GJXA 1CGXA 1RALA 1EP1A 4UOJA 5HBFA 3J7HA 2CZEA 3T8LA 1KRBC 1QI5A 1QO2A 1W1A1 3BW3A 3UFYA 4QS6A 2F38A 1CB7B 3NOEA 3VMOA 1KBJA 3FHAA 1KGUA 1BRLB 5EBUA 2P8BA 1HL9A 3GXDA 2G97A 1YEYA 3B05A 4D71A 1XIBA 1X1NA 3PANA 4UIOA 1CI1A 1KNWA 5BOOA 1SYTA 1G01A 5FL1A 1EDGA 3WBXA 2UY3A 1NP2A 3TYAA 3CBWA 1KV5A 2OR2A 3W7RA 1VF8A 1WO2A 2JK2A 2VC9A 1RD5A 1VIWA 2ATMA 2BOFX 2DZUA 2WMGA 4PL2A 4L6DA 5C0QA 1ZJIA 3T40A 4BQ2A 3SFWA 1I2QA 1W37A 4P8UA 3MT1A 3AHXA 3WUEA 1W5QA 2Y6ZA 5LIWX 3VX1A 3S0CA 4JX4A 2P50A 3P93A 1TPB1 4PCNA 2OFJA 3VK5A 3N6HA 1FQ0A 3U5YA 3PBYA 1OG6A 1TZ9A 1JZ8A 1D3GA 1TIMA 3CYJA 3MBDA 5KETA 2W9MA 4HNTA 1DQXA 2VVNA 4QAIA 3ZO9A 1HQTA 3L2IA 1FUYA 1ZUAX 3NO5A 3OVGA 1X98A 4DWDA 1P7TA 3PK7A 4NJGA 3H54A 1J6OA 1RJPA 4EAMA 5L6UA 3UERA 3G0XA 4AIOA 4RV8A 4LNYA 3SCQA 3GXFA 4CQ8A 2HWGA 3QSRA 4CNUA 2DZTA 2VM8A 3PZOA 1XRVA 1QR7A 4M29A 3W07A 6PTDA 3O6AA 5C7VA 3R5EA 4UMBA 5E0CA 1WBHA 3FXYA 5IFPA 1QATA 1POJA 2GGJA 1VYRA 5HPOA 1JYWA 3QEZA 3MA8A 3OZOA 4WEVX 2VX6A 1KXTA 2ZKMX 3PS7A 3UGVA 3W88A 3VD4A 1TE1A 2R1LA 3VC6A 2WMIA 3KL0A 1WA3A 4UTMA 3B9EA 3N9KA 3TH6A 3BG3A 3THDA 4EX4A 1TWZA 3ANUA 3GHUA 2E6AA 4RDWA 3TMLA 2O56A 2PP0A 5BZAA 2Y63A 3OYZA 1EXBA 1YXDA 4DJEC 4IQDA 2V0TA 1KCZA 1PBGA 4GNKB 2EPHA 3WFAA 4LF1A 4V28A 4OUEA 4HHMA 3MMWA 3E2QA 1LRQA 1EWDA 3N3MA 3V35A 3PNUA 4CU6A 3KOXA 2GJXB 3B0VC 1MUCA 4OIFA 1GG0A 4BF9A 3V18A 1WZMA 4JFVA 7A3HA 3TLLA 3VKCA 3A6OA 4G56A 2BXYA 2XG9A 3WLRA 1FCVA 4J3WA 2VELA 3STEA 3I6EA 5EA9A 4ZB5A 3LBCA 3WDHA 1I60A 2CZFA 4X9YA 1OWQA 3TWBA 4MPKA 5E70A 2OEMA 2Z2UA 3LNPA 3TAKA 3PTQA 1S2AA 3QKEA 3S5YA 3FKRA 4IQEA 1Q3NA 3JZUA 4DXKA 4FX7A 5C9ZA 1BG9A 2FFCA 4QX4A 4NJHA 5AFDA 2DVXA 5DLCA 2XIMA 4ICNA 2QIIA 3VX0A 3VZXA 2GVYA 4X0VA 1MNSA 1QNPA 3OYXA 1XKJA 5AYYA 3OVRA 2FMOA 3DFOA 3O05A 3W86A 3F4NA 4H7VA 4RE3A 2NVCA 2ZIDA 4BQ4A 3NYZA 2PTYA 1P5BA 4LJ3A 4QIUA 4ZQPA 3NCOA 4NG3A 3VNIA 2WZEA 1LF1A 1A5KC 3H2CA 2YOCA 1KBKA 3VGFA 3C3UA 2NUYA 4QROA 3SN0A 4KGJA 1C93A 4O1FA 1IT7A 4GIEA 2Y8VA 3UY8A 2YLLA 3F4WA 1SU5A 1FH7A 3GWQA 2CW6A 3CLMA 1SW3A 3R89A 4WLCA 1P7TB 2NQZA 2DW7A 3GHSA 3GXNA 3TR2A 2YLAA 1UUOA 1RY8A 5HJXA 3P84A 4ML4A 4RUBA 1UC5A 2VOTA 2WOQA 3PC0A 1A5CA 3HFTA 1OFPA 3WX7A 4HP5A 2E6DA 4K37A 1B9ZA 3B9AA 3M7WA 1EYEA 3M43A 3QQ1A 2JALA 3ARUA 4JBRA 3VFCA 1FBAA 3M0HA 2GGHA 1OD0A 4PMYA 3I7QA 4E3VA 1M65A 3TSBA 1OGGA 2A3EA 1R7OA 4QHRA 1PL9A 2XH0A 4WOQA 2YKKA 3WLMA 2Z1KA 4J35A 1QXLA 2WMIB 2QF7A 3WQ4A 1MXSA 3L5AA 1VCGA 3T0CA 1H5VA 1G6CA 1ZB5A 4DWSC 1HKWA 2D3LA 4O53A 4I9TA 1O5KA 2Y5JA 3AXXA 2VUYA 5D04C 3QYQA 2QCCA 1A80A 4WDUA 3TN5A 1LOSA 2QJJA 3UESA 7CGTA 3CXOA 3S5NA 2V5BA 4R33A 1ZY9A 2RJHA 2QPSA 2IKGA 2Y8KA 3M44A 4C5YA 1EEXA 1NVMA 5HNNA 4JTDA 2VCCA 1GOMA 1A5UA 4HA0A 4IMAA 1JYVA 3MI6A 4I7VA 4I5XA 1K9TA 3Q4DA 1FWWA 5D9PA 4JD4A 1DJXA 3PM6A 1Q5MA 1RP8A 5FEWA 4D6DA 2QDGA 1HF6A 5I3JA 2JE8A 3VKKA 4LAKA 1XBXA 3DHUA 4GO9A 3V0TA 3L2MA 2C3ZA 1PZ0A 2HBXA 3G1DA 3TKFA 3TYBA 2VEGA 1P48A 4NI3A 2UY2A 1DXEA 4G8TA 2PDPA 1UZ4A 2H90A 3PUGA 3GRIA 2XFYA 3EMCA 1R3TA 3FA4A 4H3DA 1Q2RA 3R2GA 5CEWA 4KEZA 1J01A 3ZJ8A 4PE8A 4IUOA 5DXYA 4KF1A 3R1ZA 2QIWA 3G1HA 5AHNA 3GDRA 3DZ1A 4MWAD 2Z6JA 3KVKA 3JZEA 1JQVA 2EPMX 3G5EA 1UJQA 2E40A 1XYZA 4LQ1A 2RAGA 1V03A 2OLAA 3MSDA 2XGIA 4H2HA 1SFTA 2BOGX 5H8UA 1JJKA 4ERGA 5IRPA 1X6LA 1THFD 4D6EA 1VFFA 1G1YA 4L80A 1XC4A 2ZZ1A 3FA3A 1UYQA 4NZ5A 2A6LA 5CBIA 1U2YA 5HATA 1T5AA 5CGQA 4BWLC 1UASA 2WB5A 1T96A 2P88A 2E0PA 4HHLA 1QRQA 2J9YA 4WY0F 4BI5A 4IJRA 3GLCA 3CAKA 3GU9A 4XD4A 4YTQA 5FF2A 2HNHA 5A2CA 3VIGA 1M41A 3MU7A 2V5CA 2WKJA 1OIMA 1DWFM 2ALRA 3VKBA 4QXIA 3KOFA 5DO8A 4Q6XA 5EU9A 4UNKA 1XBYA 2WHMA 1NH6A 4HNLA 1AL8A 1NSJA 2OB3A 1BSIA 4LBSA 3U7VA 2NXGA 4NP7A 1W8GA 1NOWA 5AYXA 5LA0A 3UEQA 4I5UA 2NQLA 5BOEA 4OOUA 2Z26A 1CGWA 3WENA 1PDZA 2DT0A 3QJAA 3QR0A 2OEJA 2DW6A 1EKOA 2ZE0A 3H7UA 3E74A 2BS9A 2DQWA 1H7PA 4A3RA 4DLFA 4UNLA 5KZEA 3SRFA 1OB0A 2R82A 4WJ8A 5I3KA 3GIQA 1ODUA 2F8QA 3DC8A 1AJ0A 3OIHA 4L56A 1QASA 2J6VA 2JQXA 3SI9A 4MB5A 3FVDA 2B31A 3I4EA 3UYCA 1JRCA 3N2TA 3WNLA 1IWAA 3P3BA 1XLAA 1QPRA 4OT7A 4A8NA 3BGAA 2I9UA 3USZA 3CV2A 3AHZA 1WX0A 1OGSA 2QUUA 4LWWA 3TYDA 1OK4A 3B06A 5ABEA 1V3MA 3SCNA 5DT5A 1JG9A 2VI0A 1SSDA 3BE7A 3YPIA 5XINA 4FOUA 3IUHA 5JQ9A 2PB1A 4DJFC 3DERA 1V6YA 1PO9A 3GKFA 1RHCA 1GONA 4CQBA 8TIMA 3TJIA 4CCEA 1JF6A 3QHOA 3G1XA 1WV2A 3MTWA 3OZYA 3WNMA 4H1ZA 4E8DA 1T40A 4NL1A 1SO4A 1W1VA 1ZRQA 5DEZA 3A4AA 1NP0A 3B8TA 4J3SA 2Z1WA 1MW3A 4EVZA 3GTHA 1ZCOA 1QHPA 4J3ZA 4NF7A 3DX5A 2O7SA 3N2OA 1EPXA 3ABQA 1FH9A 3VABA 4A3UA 4IISA 3UJSA 3RCNA 4D6FA 2PDXA 3NG3A 4HU3A 5TBOA 4OE7A 4YVPA 4FMVA 1W9PA 3QFEA 1M1BA 1TTJA 5H6HA 2RUSA 4FLSA 1RA5A 2BV9A 4ES4A 4D6JA 2HPIA 4IPPA 1J5TA 2PGFA 1Y0EA 1RR2A 3CPRA 1Q6CA 3VNDA 3E0LA 2DZWA 3E5PA 3GX9A 2BVYA 2O55A 1A0CA 2H6RA 5A6JA 1F8MA 1GOWA 2PI6A 4O12A 5HAOA 1XRTA 4HOXA 3BJSA 5I00A 3LQLA 1RQHA 3GXMA 5I78A 1L8PA 3KBMA 1MQQA 4AZGA 4U5IA 4IFOA 1MUWA 4RPQA 3ATYA 2QLYA 4G1NA 5HNUA 1FWNA 3W1RA 3C2EA 3REQA 4F3HA 3M0VA 3RO8A 2VENA 4PMXA 3G8EA 4MM1A 3K46A 1CWYA 3AU2A 3GC2A 1IGSA 3LB0A 3IV3A 1M7PA 5TIMA 2G3FA 1TR1A 1JZ5A 1MEIA 2YFOA 1ZENA 2J8TA 2J78A 4J3TA 4UZUA 3W1UA 5G4HC 1TPC1 3S9YA 3GK0A 1R2TA 5D4YA 3TQPA 3LGEA 2BVTA 4M0XA 2NW0A 4LF2A 1KCLA 2QDDA 2Z2AA 3F4CA 4AVOA 4DAIA 3PAJA 3LENA 4ZE4A 2HK0A 3WH8A 4C60A 4UTHA 5M3WA 4EPEC 1QPNA 2GGIA 2OSXA 4ZFCA 3W02A 1V51A 5C71A 2ISFA 4OBRA 3SRKA 8A3HA 3NL2A 4H9TA 3HG4A 1H0GA 1MUMA 1B3ZA 2IPGA 4Y9AA 1K8XA 1B54A 3VDCA 2NUXA 1PS9A 1V3KA 3S9ZA 3RRXA 5C9WA 1OG0A 3C6CA 1DTUA 4BEQA 4QNWA 3DYMA 3WNOA 2WKLA 4FNTA 3BCJA 3L23A 2YDRA 3KRUA 3ZIZA 5LNUA 3N34A 1DE5A 1EGVA 1XGZA 3MUZ1 3W2KA 4CCDA 1AZ2A 4YYFA 4H8HA 3SY1A 5KITA 3IAPA 5FJJA 2WCSA 3UZYA 4JTEA 1U30A 3MSRA 7TAAA 4ZR8A 5BU6A 5DMMA 4MWAE 4GVIA 2Q8XA 4IUGA 2GL5A 1TWSA 3EBVA 3BO9A 2NV2A 3S9IA 1XYMA 3HGSA 4RXGA 3WLPA 2QAFA 3PPGA 3EOSA 3DESA 2E1DA 4GUJA 4H8UA 4YWIA 3K13A 1B3VA 3Q58A 1ZCCA 4FNUA 4R3UA 3MVTA 4TX6A 1IR1A 3PJXA 3B8UA 4LH8A 2X0SA 3W7CA 3WJZA 3LI0A 4F2BA 3P0XA 1VQTA 3T78A 1UPPA 1V7AA 4PUNA 4B91A 4XAYA 2J7DA 4AC7C 1VRDA 3SCPA 3SCTA 4ERAA 2XPKA 1HJUA 4EF8A 2HCVA 1XS2A 2DH2A 1YE4A 4L61A 4RW5A 3B40A 2AQOA 4QAWA 3URBA 4KEVA 2J25A 2GQ9A 1HTIA 1LQ2A 4CQCA 4TXEA 4GI9A 5DFAA 4Y9MA 1WUEA 1KGXA 4S3GA 1TV8A 2FJUB 2GSJA 3VOJA 4ASTA 2W3ZA 3CASA 1VLWA 3FSUA 4O4WA 4TVUA 3L4WA 3REQB 3QLDA 4DO6A 4AIBA 4L6HA 4C6BA 4HMNA 5AHMA 3A9IA 4XG1A 1PDYA 3WY1A 5D30A 2XSBA 3LCFA 3H7RA 2WSYA 4AHOA 1Q85A 3EWXA 2BY1A 4ORMA 1TWIA 1GVYA 2VGGA 3BMVA 4I9AA 5MKGA 3TTOA 4AZ5A 3VOCA 2L5HA 5HJYA 2VQTA 4O18A 1BYCA 4IP7A 5JU6A 5F2GA 4H8VA 4A2RA 3CUGA 1GG1A 2CESA 1ZP3A 3I7RA 1ZP4A 3QOMA 3LHUA 1LBFA 1AH3A 4IMCA 3EX4A 3H70A 5FJOA 4IICA 4XTIA 5IDZA 3P61A 2VRQA 1A3XA 2VD8A 3BCDA 3VNYA 1WE5A 2DP3A 4JNYA 1PIGA 1DWHM 2ZBTA 4B5WA 3N9SA 3PVFA 2PUZA 4DXXA 1RSCA 1GQNA 1T0OA 1O7AA 3CLWA 3UQNA 1OM0A 1OC6A 1UUQA 3EPOA 9XIAA 3Q2DA 2BXVA 4H9ZA 5A6LA 1S46A 2Y7GA 3FGCA 1WKFA 3GDMA 1J8VA 2HJPA 2VX5A 4HK6A 1IV8A 3UPBA 3B8SA 2QS8A 4M24A 2J7GA 3N04A 4W7UA 2F6XA 3T81A 4KFNA 1VCFA 2VZSA 2V3FA 1QBAA 3PN8A 1VFMA 1OFBA 4LANA 1G9HA 3GH5A 4W4QA 4DI8A 4R7JA 3V5FA 3LERA 3KCLA 5CPOA 5FF3A 4LV4A 2Z4GA 3I3BA 5A6BD 1W3HA 2YL9A 4JX6A 1C8YA 4R53A 4S3JA 2I5QA 1EB3A 1VJSA 3RLHA 1JDDA 3O8AA 1E6SM 4QDPA 5I02A 2FZ9A 3PSVA 3QBUA 3PFRA 1UR8A 1VENA 3PG9A 4GJ1A 1OYCA 4QCFA 3U2OA 1GK8A 2EGZA 1F3TA 5AYIA 4TTUA 3C0JA 3ZT6A 1LZOA 2YL6A 1GOXA 2VWTA 3B4UA 3M0IA 4ZSUA 3T0AA 4UB9A 2INEA 4IG2A 1VB9A 1ADOA 3O07A 1GOKA 1OJXA 3BG9A 5AYBA 4DBUA 4ZO9A 5FD0A 3QZ6A 5M5DA 1GPWA 3KDOA 3WMSA 3CMGA 4AFYA 1E6QM 3VDHA 4PMNA 4H6QA 4DUXA 3BJTA 5LIUX 3EA3A 1KB3A 4I8DA 5G1MA 1DHKA 4AQLA 4QSFA 2IQDA 5BWFA 2XGBA 4JTLA 3TW7A 5A95A 4ZO8A 3N19B 4JQ4A 3OODA 2DT3A 5CZJA 2WJZA 1E9LA 4W7VA 4L4PA 3PFMA 1TA3A 2NWRA 4R27A 4DIAA 3VMPA 2CCRA 2I5GA 3DHPA 2G5WA 1XM3A 2BASA 4KCTA 5HUPA 3SZ8A 1XIFA 2WBGA 4LAZA 2G3NA 3CHEA 4E2DA 3WH9A 1E4IA 2VGFA 3TU9A 1RCXB 1NOFA 3LTPA 1JR1A 5JMUA 4A3QA 1A4LA 1K02A 1Z42A 5MKGB 2CKRA 2HQAA 4MLRA 3RPMA 1H51A 2O92A 4U2YA 4BZYA 4AY8A 2D0HA 1VD6A 3CQ0A 1O68A 2PDLA 4LUYA 2CIPA 4U2ZA 2PDKA 1FVPA 2ON3A 5C8BB 4KWSA 4D1IA 1NQ6A 1TZZA 4GE8A 3W2JA 2A3BA 2J62A 2CHRA 3HMCA 3RK8A 4PUUA 5BXRA 5LGXA 4MFDA 4DUOA 4GGBA 1ZNNA 3G1YA 3GUGA 3P8IA 4P5UA 3UA4A 5EMYA 3WBEA 3FYYA 4GNJA 4P7LA 1XYCA 2C13A 4BI7A 1E0VA 3W7EA 2PE4A 1KRAC 2ZA1A 3FGCB 2QGHA 4FSAA 5A8QA 4KT2A 1RV8A 2V2HA 4ZOAA 3W23A 1UD3A 3DBNA 3E3HA 3W84A 3VD9A 3CT7A 3SADA 4N7QA 3L7RA 3QH2A 4IP5A 2PMQA 4HK7A 1P0NA 1LJYA 3L4YA 6REQA 1JZ3A 4R7OA 1J0YA 3KP1A 1E6ZA 5EFFA 4A22A 3LU2A 1PYFA 4R7WA 3GUWA 3T4CA 2C6QA 2I16A 1BKSA 5K2ZA 2HVNA 4WRHA 3WF1A 4Y6GA 3PZIA 3GKAA 1AZ1A 2VC5A 4D6GA 3IJ6A 2UY5A 1AJZA 2QCDA 3CTTA 3ZXWA 2GSHA 3EX3A 4IIDA 4JXCA 5IBXA 3VE9A 4HQVA 3LRKA 4HZMA 2OKTA 2PBOA 4KWWA 1QAPA 2X41A 4IG2B 1UR4A 5EGRA 3QGAC 4KFOA 5DY2A 1X6NA 1JI1A 1OD8A 3H22A 5AKQA 5CC6A 4WKAA 3O63A 1UQZA 3NSXA 2IQ0A 3N12A 4GI4A 1R2SA 2ZADA 4R9OA 1UP0A 4DAFA 4LUSA 3MP5A 3KBVA 3W7NA 3GTXA 3SGGA 3DFQA 2ISDA 1VH7A 3CPGA 3L4XA 2VEFA 3NL6A 3M07A 3HQOA 3V5CA 2X2GA 4GACA 4NZCA 1EHNA 2YYUA 4QTGA 2WZMA 4KMQA 4N9BA 2D22A 1VEMA 4JICA 4CVUA 2R24A 1XRFA 3OP2A 4PUKA 1TA3B 5BMXA 3LG3A 3MUY1 2E4TA 1JPIA 1H41A 3LPOA 1SMAA 3CZLA 4XX6A 4H41A 1O4UA 1JDAA 4K8EA 1VKFA 4NXSA 4WOZA 1YRRA 3LGDA 2D2GA 3QHNA 2X7VA 3PZMA 7TIMA 1N8WA 1O60A 3SM0A 3TW6A 1IXPA 1YDVA 2ZX5A 1B1YA 2ICSA 4LVGA 4MY1A 2ZUTA 3VD3A 4DBEA 3MWCA 3AJXA 3QFWA 3E0WA 3FNDA 3DECA 3IVUA 3G1SA 2QEZA 4HMDA 4FF7A 4F40A 1W3LA 4LGXA 4Q4KA 4C6MA 1E0WA 2PCEA 3ARQA 1M01A 1A4MA 1CTNA 4JIEA 2D1ZA 1S5MA 3CK5A 3WQDA 4FS9A 3WJSA 2O9PA 2Z28A 1OY0A 3Q65A 2V82A 1GOIA 1ZJAA 5E6ZA 2ZXBA 3W7MA 3B0UX 2E6YA 3CHVA 4D1JA 3APYA 1LWIA 2GFTA 3WO8A 4MYXA 3RMEA 1XLHA 2BSLA 2Z24A 1Q7QA 1SSGA 3Q67A 1TIWA 2G4FA 3QMTA 4S3EA 3WSUA 5E9XA 3Q37A 1TCMA 4GXWA 3WEMA 3E02A 6REQB 3HPFA 3F4DA 3RR1A 4HZ8A 3THUA 2G3MA 3H2EA 3W7DA 1GTEA 1JD7A 3WQFA 4RR4A 4O14A 2VDGA 5CSUA 3OLDA 2UBPC 5AC4A 2HE5A 4J2MA 1AW2A 1AW5A 2QVNA 1SGJA 4H9YA 3ZS4A 2Y24A 1X97A 5EFDA 5GJPA 3LTYA 2QW5A 3TJLA 4MB1A 3WUGA 4LVDA 1V3HA 2IQTA 4JHOA 3EWZA 1XLJA 4L1GA 1Q13A 2JIWA 1NWSA 4CD7A 3FVMA 3FX4A 4US5A 2QCDB 1GHSA 3H2NA 1QK0A 1J96A 4GPNA 1US3A 4W5ZA 3ME3A 4DZ5A 2V69A 4PUWA 3PZVA 3VGGA 3KRSA 1G0CA 1W3NA 1EBHA 3UCDA 3WJWA 2A85A 2CETA 4LRSA 4RV3A 3W7IA 5T9CE 2VWSA 3VUPA 2TODA 4HIBA 3PJWA 2CWNA 4PYSA 4MPQA 1LWJA 4FX6M 2XISA 4MVAA 4XAFA 1P0BA 2H3BA 4B5VA 1WDRA 4LUSB 3WMCA 2BY2A 3WF4A 1I4NA 3MYOA 1KWGA 5IXEA 2D2OA 1HX0A 1YTKA 1VYPX 1BD0A 3CWHA 3NPWA 2ZUMA 5A6AA 4WJXA 4P7OA 1QI0A 2VTFA 4M6PA 3ZM8A 4MG4A 5A2AA 2A6NA 2JF6A 4H83A 1XP3A 3W27A 3GC4A 3B8WA 2X1RA 4CNOA 4AHPA 1BTMA 2ZRVA 4XIMA 3GIYA 1H7WA 1TPDA 1T6MA 3T4WA 1LQAA 3CZEA 2OQYA 3WBYA 1XX1A 1Z89A 5CZTA 4BA0A 1C9WA 1HW6A 5HINA 3MWAA 3A3WA 3PZQA 3ZLHA 3QC0A 4ZVJA 1Y5XA 1U5JA 1VIZA 3JS3A 2WZTA 1DEDA 3O1NA 3WD2A 5F2MA 2QYGA 3OA5A 3WJYA 3P14A 3D46A 4M6VA 4ZQNA 3GNRA 4RW3A 5JH1A 3NDOA 3DFPA 2HBVA 3DI1A 1F61A 4C6IA 1XBVA 5D09A 3MUCA 2AQWA 3C86A 1W32A 3TN3A 3RDKA 6ALDA 1CB2A 1DOSA 2QJNA 3I3EA 1X96A 4N02A 2CBVA 3P5ZA 1HP5A 1W0MA 3DIPA 2Z1SA 3UZ5A 3WLOA 3B8VA 3VDAA