3GVVA

Single-chain urod y164g (gy) mutation
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
356
structure length
356
Chain Sequence
FPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLYESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate shuttling between active sites of uroporphyrinogen decarboxylase is not required to generate coproporphyrinogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uroporphyrinogen decarboxylase
total genus 123
structure length 356
sequence length 356
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 3gvvA00
4EXQA 1R3QA 1U1JA 3GW0A 1XDJA 3GVRA 2NQ5A 4ZR8A 4L6HA 1XR2A 4ZTYA 1J93A 1R3RA 1R3WA 3PPFA 3CYVA 3GVVA 1U1HA 4AY8A 1XPGA 1YPXA 1JPHA 1T7LA 2Q6ZA 2Q71A 3PPGA 1R3YA 3PPCA 3GVWA 1U1UA 1R3VA 4L65A 1R3SA 4AY7A 2INFA 4L61A 4ZTXA 1JPIA 3L7RA 3GW3A 3T0CA 4QQUA 1JPKA 3PPHA 1UROA 2EJAA 1U22A 3BQ6A 3GVQA 4L64A 3RPDA 4L6OA 4L5ZA 4WSHA 1R3TA 3BQ5A
chains in the Genus database with same CATH superfamily
3WBEA 3RNDA 1MEWA 3CMJA 1P6WA 1J96A 3G6MA 1OM0A 3TAOA 4YL2A 5A94A 4DXVA 1W9XA 5A6KA 3HBLA 3GWQA 1YDNA 3RR1A 4ZA0A 4A3HA 1AH3A 1A3XA 1QPRA 3TN4A 4LGXA 3MVIA 1F6KA 2FB3A 3AXHA 1CNVA 4GFIA 1KD0A 5AC5A 2D22A 4HPGA 3O15A 2BHYA 1XG3A 4HYRA 1W3HA 4RE3A 1NM9A 3E0LA 1FVPA 4O15A 4IX0A 1YADA 1TX0A 2J8GA 1ICSA 4WJXA 4AWUA 3MHFA 1YNPA 1VBHA 3FA3A 1T7LA 2C1GA 1XLFA 2YCIX 1W2PA 5G5IA 2O4MA 4RZBA 1EJ7L 4HSOA 3R7MA 3M07A 2PCQA 3DGRA 3F2DA 1RALA 1O1ZA 2J9ZA 2OOFA 3G3MA 4K37A 2PAJA 3BAYA 2PDCA 1XLKA 3DGBA 3UZZA 4ZCWA 1LWIA 2OLSA 2ZC8A 3M0HA 2X2YA 4F0LA 2GUUA 4P7LA 3BC9A 3RITA 2ZA2A 4OUIA 5A2CA 3PB2A 1MQPA 5C9RA 2FLIA 3B03A 3JVAA 1W5QA 3T0BA 3SCUA 5AHEA 1XLEA 3KL5A 1BF6A 3C2FA 4R53A 2BNJA 3C2VA 3OW1A 1PYFA 4GIAA 1VEOA 3BGGA 3LBOA 3LHTA 2I5GA 4EPKA 4QLKA 4LALA 2W79A 4HK7A 4IGHA 2NX3A 1ECEA 1QU4A 1TJ1A 4FNRA 3W76A 2QW5A 3O2LA 3U7BA 3CB8A 4FB7A 3KBMA 3GW0A 3BCJA 8RUCA 2JFEX 4HYVA 1DIDA 4ZOCA 2BXZA 2CLOA 1SVDA 3ID7A 4JTCA 1J0YA 3LG3A 2EF9A 2PDBA 1F4AA 1PX8A 3EB3A 2CHOA 3EX2A 3VINA 5FF7A 3YPIA 4W88A 4KWUA 3OHMB 2QCHA 3L4VA 3D5HA 3M0YA 2G96A 4O57A 4B5VA 1VB9A 2ZA3A 3NQ8A 1CXIA 5E93A 5DXYA 3R8GA 1AG1O 1KBJA 3ZLHA 4K3ZA 3RJXA 2GVJA 4DHGA 1R3QA 1SFJA 2HZGA 4RNIA 4YCPA 4XD5A 3N19B 2GWNA 3T81A 2Y7EA 1XIIA 2E6DA 1OFAA 4LBRA 4PUEA 3CL6A 4RE2A 4LCQA 4HMNA 3TKFA 1L9WA 1S2WA 4M6QA 1KFEA 2OPJA 1JULA 2R1LA 4DZ5A 2EPNA 4WHBA 2EXOA 3TOYA 4O4VA 4NZ5A 4CU7A 3OZPA 1V6XA 4FX6M 3VCCA 1U5VA 3GDKA 1UUQA 4E4PA 3USBA 4AAJA 3NG3A 3T05A 3WQEA 4LVDA 2FDMA 4QROA 3DHFA 3QMTA 3ZO9A 4RKAA 5D32A 1P0EA 4JYDA 3SFWA 4IIGA 4V2XA 1G4EA 4ALDA 5EMJA 1AW1A 4FSAA 1Q7ZA 3HURA 1ENUA 3ZIZA 4LCRA 3WDRA 1GQJA 3RF9A 1K7EA 5D04C 4WGHA 3SDOA 4Z17A 3EOLA 3RM4A 5LA1A 4UQ9A 1JDFA 1KW1A 4YNGA 4BQ2A 3W1PA 1OJXA 3ARWA 2VFFA 2ZVRA 4N6FA 2WCSA 3NL2A 4LUTB 2D0GA 2B7NA 3NQEA 3L21A 1YKWA 1FHUA 4UR7A 3NXFA 1Q13A 2VP8A 1VCFA 2REQB 4D6FA 2VO5A 3XINA 2VEPA 2HPIA 3BTNA 4AIOA 1KBLA 3NL6A 3C2YA 4MLRA 4OKDA 2QUTA 4DUOA 2VOMA 3WBXA 3FSUA 2YCJA 3MWCA 1HGWA 3RPTA 3C0JA 1IWBA 2V69A 1KGUA 1RUSA 3PTKA 3H4WA 1B9ZA 3W53A 4NP7A 5JQ9A 3PWGA 1PX4A 3TV8A 1BHGA 4K68A 2GGJA 4N6EA 4PFMA 1EJRC 2J7EA 5AC6A 4L5ZA 3IV8A 2WZTA 4CQAA 2Q09A 4O1FA 1U5JA 5CXPA 4IG2A 4O4WA 4AVNA 1Q6CA 3WD1A 3QSRA 3GUGA 4NJKA 1IXQA 4AZ5A 5JBEA 3DFYA 3VOJA 3AIRA 1L6WA 3CEUA 3VMOA 1PWMA 1FWDC 4HVXA 3Q37A 3RX2A 2VDHA 2FHCA 5I3HA 1QK2A 2V63A 4NRSA 3G8RA 4KPLA 1JUEA 4XUYA 2D2JA 4D72A 3VO0A 4YHEA 3TUUA 4O52A 3QFEA 1W91A 4FAMA 1LL6A 5DLCA 3M7SA 1PTDA 1A5SA 1US2A 4IICA 1EOMA 1TPEA 1F73A 1I1XA 1S2UA 1CWYA 4KERA 2OT0A 4WKHA 3GIYA 4HD5A 4IXXA 4F2TA 1NP2A 2D2GA 5T26A 4JTTA 4DO5A 4B3KA 2QUNA 5CSRA 2VEMA 3VDBA 4P7QA 4Q8MA 1MDLA 4H83A 4FX7A 5FJJA 2ZRVA 3LMZA 5CPSA 1VHNA 1UIOA 3W7IA 5IHRA 4QX4A 4LUYA 4Z08A 5HWJA 4AZGA 4CVUA 1UD2A 4PBFA 1CXHA 3P93A 1BGAA 3WF2A 3TMQA 2PGWA 3ANUA 1NFGA 3BAXA 3ARTA 4H9VA 1HL8A 4NAEB 2R6OA 1X38A 5FAGA 1R38A 3DX5A 3CV7A 4PUJA 2G97A 5KTLA 1Q7MA 5HUPA 5FJUA 1V6WA 1XLDA 2SFPA 3TC7A 4QP0A 3R11A 1M03A 1F61A 2PTWA 3AYSA 3P81A 3W88A 1A5MC 2EPKX 2YZRA 2PDPA 1EA9C 3CH9A 4HCLA 3GQYA 4UB9A 1MW2A 2E67A 4U10A 3F03K 3CQ0A 2HMCA 1MYRA 1NFBA 4F8XA 1N2VA 2HJPA 1LBMA 4WJEA 1Q3NA 2ZDSA 2IS7A 4PTDA 1V02A 5BMXA 2Z7GA 1KXVA 2C7FA 1D3GA 3DKJA 1EP1A 3C6CA 3OBKA 2GDQA 4EK7A 3AYTA 3GC5A 3ARVA 4GFSA 1TVNA 2RDTA 3QPYA 2HXTA 3OLIA 1HKJA 1ZFJA 3E49A 4L80A 3U0HA 1FH9A 5F1VA 4ZQRA 4UTIA 3OGRA 3O05A 4ORMA 1ZTVA 3W7NA 4JY8A 5HJLA 3NJ3A 4WXZA 1TB3A 1F3WA 3N11A 3MI2A 2IPFA 2A0NA 1TSIA 2V0TA 4GYFA 4J27A 4JYFA 5F2LA 2WW5A 4D8ZA 3LENA 1QBBA 4Y8EA 4X9SA 4J3UA 3MKKA 1KC7A 3URQA 3NZQA 3ISIX 1VZWA 4B5XA 4EKJA 4H00A 3DENA 3KBSA 4PMVA 3UVAA 2XISA 4HIBA 4HNOA 1VFLA 1EDTA 4WSJA 1GOMA 3EZ4A 3U2OA 1G4SA 3ONCA 1GYLA 1GVFA 1T40A 3O06A 1G7VA 3SUSA 3F2CA 3T2PA 4F79A 4Q7NA 3GTXA 2F61A 1XUUA 1XLMA 1AL7A 2YSWA 4KH2A 4I7UA 3TYCA 5FF0A 1QJWA 4HZ8A 2PWUA 5BWAA 1YRRA 4E3TA 3G8EA 2PC4A 2NV2A 3W70A 3W7JA 3UU0A 4IQEA 1BYDA 1WKYA 1OCBA 1ONWA 1XIDA 4AX7A 3M0JA 1M6JA 1J10A 4H7CA 3TJLA 3NVDA 3K30A 1UD4A 4X3ZA 4JTUA 4GUFA 4UTTA 1VIWA 3OP2A 3B05A 4RE0A 1R46A 4LBUA 4UTJA 2WSPA 2AL2B 1FQ0A 3GH5A 2H6RA 3NO5A 1XV8A 2BVTA 4AD5A 1EB3A 2J62A 1IGWA 4QSFA 3VMNA 3VUSA 4DWSA 4CUCA 2XFWA 1T41A 3E0WA 4HK5A 4LC6A 2C6QA 1F8IA 1UQZA 2Y62A 5GQBA 4WK9A 1MZRA 4RW5A 3FXGA 3TK7A 2OGJA 1UH4A 1AH4A 3RYSA 3VIOA 4MYXA 1O4UA 4C91A 2GVLA 3GDTA 5HNTA 3V5OA 4U3CA 5TBOA 3I3EA 3JRKA 4JTIA 9CGTA 1EJSC 4KWOA 4I5XA 4HNVA 4Z2LA 3TNOA 3UGRA 3LA4A 1E6QM 4PMZA 2DUZA 4MB5A 2Z1SA 4XBSA 4KGJA 4Z1YA 1SR0A 3WMLA 4DRSA 4YTUA 4C65A 1JPKA 2V30A 1DOSA 1KRCC 4RLIA 1PIGA 4Q22A 2PF8A 2QVHA 1OCJA 3GY1A 5T91A 3N2XA 2Y8KA 1C93A 3NGJA 1JUKA 3B8UA 1M68A 3DXIA 4LCSA 4UZSA 3HFTA 2A6NA 4LYKA 6A3HA 2PD5A 1AW2A 2VT0A 4QJ1A 1KTCA 2CXGA 4DNHA 1EP3A 4DBUA 4HSNA 3H7VA 1TWWA 2ZWYA 4RV8A 3WDPP 3CHVA 5CBIA 5C0QA 1A0DA 1LT7A 1LOQA 5AYIA 2ZCGA 3S6OA 4IMEA 1CB7B 2NQJA 1EQCA 3SW6A 1BVZA 3RO8A 2GPTA 4ZBCA 4JDYA 2PWVA 4QFUA 1NH6A 4Q8UA 1QR7A 5FACA 1VBRA 4Y8FA 4W7WA 1E4IA 3W75A 1UWTA 3MCNA 1H09A 5G4WA 1A5CA 4IG2B 1R85A 2ODOA 3K2GA 5AYYA 1OC5A 4Z2HA 3QKZA 4ZB0A 3FGCA 1VQTA 4TMBA 4TX8A 3NA8A 2WQPA 3K1GA 1FKXA 3N18A 4OWGA 1C8QA 4AC1X 2YR1A 3NSMA 1TRIA 2FPTA 4JIRA 2VC9A 5I78A 1RBOB 1XH2A 3EWXA 1EZWA 3BLDA 4E4FA 3TXVA 2CHNA 3P60A 3N14A 3N29A 1XGZA 4OQVA 1TV4A 2PODA 3W6LA 2MANA 4DO7A 3WFZA 1AJ0A 2RFGA 5IBXA 2HWGA 4JX4A 3AICA 4OZOA 1Y0EA 3UWYA 4WGXA 1JD9A 2ZUVA 3U2EA 3EXSA 2QGYA 3VIFA 2PLCA 4HNCA 1DJWA 3I6TA 1ITQA 3IUHA 2ZZ7A 4YMZA 2WJFA 4HTBA 1RLDA 2QCDB 1A5OC 3B97A 2D2OA 1WOAA 4MB1A 3C56A 5K9XA 3LOTA 4CN1A 3V16A 1VFUA 5D8WA 1J01A 3FHAA 4GUGA 1UOKA 4ZXLA 1IYXA 1PDYA 4C7GA 1H7OA 3ES7A 3WFAA 2RUSA 4GE8A 2QCDA 2QMKA 5KEZA 1OWQA 2FZNA 4AZ6A 2XFYA 3CAQA 5ENLA 3B0YA 3VZXA 5AZ0A 4GUJA 1GPWA 3UXKA 3CUFA 1ZNNA 3L4XA 2QIWA 1PJ9A 3LRLA 4IMGA 1W8SA 1KO0A 4IPIA 4JXCA 1GGOA 1F76A 3APYA 2ZC1A 2V2CA 5FL1A 3HU7A 1WAWA 3ZYZA 1JPHA 3EKGA 2FGZA 3IJIA 2CZDA 1NDVA 3N34A 4OECA 4JIQA 3AWOA 3O07A 5FL0A 1VPQA 3LN3A 3AXMA 5LIWX 3PTMA 4IP5A 2QT3A 1IR2A 2GQ3A 3A3XA 1EEPA 4S3EA 3KP1A 3TFCA 1DWJM 5KZ6A 2DUAA 1HX0A 5EKYA 1H3GA 3WQGA 5T9CE 2FZBA 1YLVA 2NXGA 3QMRA 5C54A 3F2BA 1DEDA 2ZA1A 2EO7A 3A5VA 2XIOA 1KNWA 2GZXA 5BMWA 2CU0A 4RNFA 3WDJA 2PLJA 1S5WA 2X41A 5CG0A 4PFHA 5FJTA 3TLQA 3KP0A 4D6DA 3TX9A 1DIOA 2QPXA 3G1HA 1HXJA 3CUZA 2ZX6A 4GZJA 1ZCCA 4UIOA 3IIVA 2V5BA 1CGUA 2QAFA 1Q5MA 2GQAA 1QHZA 1BKHA 1KWGA 4XWUA 5FAJA 1S38A 5AY7A 4YXGA 2DU2A 3WQ4A 1VJSA 4GA8A 4QS5A 3CHCA 1RQBA 1UR4A 4HQVA 5C5YA 1TA3B 2J79A 3HPXA 3PC0A 4C1LA 1EA0A 2G5WA 3W37A 3PZMA 3FX4A 3L9CA 3G1FA 1K8CA 4B91A 1LYXA 3FKKA 1KTBA 2H3BA 4GQRA 5EMMA 2BVDA 4JTFA 5CLWA 1MRQA 2UY4A 1SO5A 3QZEA 4BR1A 1S3HA 1IQ8A 3MO4A 3WLMA 1IV8A 1UH2A 2J66A 3R6IA 1DKWA 2PDMA 1TCMA 2VFGA 3OPSA 4QGCA 3IJLA 2OZ3A 2BHUA 3WNPA 2E4TA 4B2DA 3H2NA 1GQLA 4GKLA 4B3ZA 4Y9AA 3Q67A 2BBFA 3UPBA 4AZ7A 3H21A 1ZJBA 1HQTA 5CZTA 2EKCA 3ARXA 5I00A 1BRLB 4PGLA 3IJ8A 3RHGA 3WQOA 4CU6A 4ZTYA 3UZXA 3DEQA 3O6DA 1V3LA 4IIHA 3ALGA 3E74A 1CW2A 4GI4A 1FA2A 1KRMA 2REQA 4F0HA 3GB6A 4ML4A 1VS1A 1Z44A 4UOJA 1TV7A 3PR2A 3W2NA 4JQ4A 4RCXA 3L66A 3SUUA 1KCLA 2PEVA 3DUGA 4CQBA 3O9NA 3DFHA 2F2KA 2I16A 3E0IA 4I9JA 3UERA 2DZPA 1W9PA 4KGLA 5HOSA 3CHFA 4M0XA 5KSWA 7PTDA 2DPEA 3DFPA 4JFVA 3LHWA 4QEHA 5I23A 1UC5A 3M16A 1EGZA 3EX1A 2X16A 1P6BA 1KA9F 2BOFX 3AFBA 4OOZA 4UMBA 3AIEA 3MZNA 1VYSX 4Q8VA 4A4AA 3NZRA 3CNYA 2XIIA 1BAGA 5F2MA 2WV8A 4MLJA 1ZRQA 5IHSA 1SSDA 5K9DA 3HB9A 1XCWA 3NQAA 4XX6A 4AY1A 4ECLA 3F5KA 1EC9A 3OQEA 1FCUA 1N7KA 4JKKA 4EACA 2PDNA 4PTVA 2OZ0A 3OOQA 1ZJAA 4L6HA 4QLJA 3W6MA 1W54A 5I3JA 2X0YA 2Z1BA 2WC3A 3GNOA 5A6MA 2D3LA 4DUVA 1TMQA 4NL1A 5K9CA 1UKTA 3SQSA 5A8OA 3AIBA 4NZ1A 1UHVA 1ZAIA 3SCQA 2GGIA 4DELA 3K8KA 4GI8A 2GDVA 2YW4A 2WZIA 2XINA 1F4HA 3G0SA 3PBMA 4QJ3B 5BXPA 4CQ9A 3ZR5A 4IHCA 4LRSA 5CAHA 4LAMA 1W1B1 5A6LA 3CGTA 4HK6A 3RILA 2B0MA 4FP1A 4DJDA 4GGHA 3MZ2A 3CUJA 5ECVA 3PN8A 3PZIA 4PTWA 4O1BA 2QLYA 3ABOA 4AD0A 4MUPA 2GFTA 5HMDA 5MHBA 2ZUUA 4U5IA 5I7GA 5I2UA 1BFNA 1SZFA 1E51A 1Q6OA 5A6SA 4XK2A 3DHDA 1YEYA 2X7WA 3R8HA 3MUCA 5C2GA 4ZOBA 2PURA 1DWGM 2JK2A 2WKLA 3TOPA 3PUEA 3L2IA 3FYPA 1HT6A 3KVMA 1H1ZA 4DJEA 2VQTA 3CZ8A 2GWGA 3P61A 2OYKA 2YLAA 4FNPA 1RHCA 3KTSA 4YS1A 4UFHA 3D47A 2AOSA 3QV6A 4GVIA 2ZZ4A 4F9JA 4C6KA 1DWHM 3SGZA 2JALA 2XVLA 4GGBA 1H61A 2OO0A 3N1AA 3SIMA 2GVYA 3WLKX 1EF2A 3KZSA 1E5NA 4U33A 5T9BG 4IPJA 4KFPA 2NXIA 3H70A 5G4HC 4JHOA 3RIKA 3NWRA 1U2YA 2DIKA 5CZJA 3UCCA 1E9LA 2E9MA 1JYNA 2W9MA 2Z2AA 1WCGA 1A5BA 1JDAA 3RLVA 1V0MA 4G6CA 1LOLA 5EL1A 3WY1A 1CGWA 3UYCA 5GPRA 1J0KA 3BAJA 4S23A 4PMJA 7XIMA 3UQNA 4R7JA 2GSJA 4E8CA 2FVKA 1FRBA 1UA7A 2WSRA 5ABGA 3CZGA 3S42A 3BMWA 1J4EA 1JUBA 5HQEA 1J5SA 4X9YA 1TPH1 3GR7A 2VZTA 3BH4A 1THFD 4CD6A 2YXXA 3KBVA 1CGXA 3PFMA 2CITA 4EXQA 3UF9A 3LCLA 3GD6A 1POJA 3PSVA 3BLLA 3F4NA 3QPZA 3QHNA 1EBHA 3IGXA 3KBNA 5DRIA 3UG3A 7REQB 4UWMA 1M65A 5DANA 1EHNA 2QCFA 3VIJA 1MRAA 4J40A 3SUVA 3R1ZA 5HMFA 4WRHA 4OV4A 3SCPA 2V81A 4Z2IA 2ISWA 4MAZA 3KL3A 1S1RA 3TDFA 1R3SA 5DN1A 2Z1WA 1Q6LA 1LQAA 4G7FA 3GG0A 2GL5A 5BXRA 3GAKA 2AL2A 2OWWA 3L4ZA 1IR1A 2Y2WA 2H3DA 1KV8A 4KWVA 4ZO6A 1JAEA 5H8MA 3G5EA 5DRCA 4IMDA 1RBAA 2OU4A 1PIFA 1FXPA 1QO5A 3EWZA 5C71A 1B3ZA 1D7KA 4R34A 2FTPA 4O14A 2Q6ZA 1TPFA 4O54A 2A3EA 2ABBA 3B8IA 3CAWA 3S3GA 4Q8QA 3BW3A 3CHDA 4P7NA 1LQ2A 2YZ5A 1XM3A 2O4QA 3WX7A 2QJHA 4H9XA 2Y4SA 3KFTA 3W7DA 3BPWA 1A5UA 3BK0A 3QMSA 4DJDD 1DXFA 4JFSA 3FDKA 2GQ9A 1LRNA 2DW7A 1LBLA 3VKDA 1JIBA 5AB3A 3ENLA 1QWGA 4XTDA 4O0KA 4ZEPA 3S5OA 1JF5A 1FCVA 4RW3A 1XW8A 2OTDA 1ZJHA 2DH3A 4C7DA 2D0FA 4ZR8A 4FHAA 4DJED 2WSYA 1JJKA 3VOGA 1AQFA 5KITA 3H54A 3VNDA 2Q3RA 2DEPA 1VH7A 3DI1A 3M6YA 4W84A 3GXMA 4DZHA 5AHFA 3EYPA 2Y1HA 5BRPA 3DDMA 2ZXBA 2PB1A 4KT2A 4JQ1A 4JY9A 3T0AA 3CO4A 3EWDA 3KE0A 3BWWA 8CGTA 4AW7A 3NXLA 1RD6A 3NCOA 3ABXA 3VGGA 3BV4A 1D9EA 1UZHA 3W7PA 1XBZA 1BLIA 5EB8A 2OEKA 2P3EA 2EKGA 4Q8OA 3B9AA 3LGDA 1FH7A 1E40A 1ADDA 2RKXA 5BXSA 1UOZA 3GU9A 1YPXA 1IWAA 1FTXA 4NYYA 1HVQA 5D9MA 4GY0A 1Y65A 1RQHA 3G1DA 1XWYA 4C5ZA 4DF1A 2VKZG 5LNRA 4KF1A 3VZZA 4AIUA 2P5NA 4BCEA 5HQLA 4MYAA 3TYZA 4HPJA 3W84A 4UTKA 1BPLB 2HCVA 4MPKA 1JGMA 3T0TA 3ITCA 3KRSA 4MVAA 1AUSL 4UQEA 4Y6GA 4OBTA 2C16A 2DSKA 3VD3A 1GTEA 2BOGX 4J4KA 3LRKA 3QW3A 4M5PA 2OZ8A 3WK2A 2BY0A 4HPNA 4S38A 2I56A 1MWOA 2VX5A 3EKLA 1QDSA 3WLQA 1RK6A 1P0NA 3U7VA 5M2FX 3LPFA 2ATSA 3DYOA 1CEOA 1ZBKA 4PUWA 2ZIDA 3KHDA 3L4WA 2Y63A 4QG6A 4NASA 4X0VA 3BZJA 3S1WA 1WX0A 2QCMA 4KRTA 1E70M 5D2YA 4ML9A 3MV11 1KCZA 3AAMA 1Q63A 1JZ2A 4I8DA 4EPDC 5I09A 2H9AA 3AZSA 4HNNA 5F4XA 3H2AA 4CD4A 1Z8AA 2R1NA 2C1HA 2FZ9A 3WMCA 5A6BA 2J9YA 4L56A 3VC5A 1VFMA 4W8AA 1NWRA 5E9AA 3MSYA 4C6NA 3EX3A 2C71A 1VP5A 4WLCA 1JG9A 3P67A 5KMYA 3TJIA 4EVZA 5JIPA 5J5DA 4GNVA 4LW7A 4REQB 1AQ0A 4JNMA 4A8NA 1XPGA 3MYPA 4NAFA 1V0NA 3HQOA 8XIMA 4MWAD 5HWNA 1P6CA 3SCWA 4O13A 4DY1A 1KTNA 1OGBA 4QNWA 3IIXA 3KRUA 2I9UA 3WLJA 2VUNA 1HKWA 5JMUA 1PBGA 2WBKA 3L0NA 3A21A 4CN6A 2P3ZA 3GNNA 4QE1A 4PTXA 3W1TA 5LIKX 4KEMA 4PH6A 1W31A 1H7PA 1KFLA 3E9AA 1XLAA 1V3MA 4Y90A 3OVGA 5I24A 1R3RA 4P7RA 1MXSA 5D03A 4HKPA 2D0HA 5E0FA 4YIWA 2PBOA 3WLPA 2A3LA 1GJUA 3ITLA 1E6ZA 1Q6DA 1GOQA 3PNZA 1BTCA 4P8UA 1FWTA 4ZB2A 5HWMA 4XKYA 2NVDA 1TMHA 3WNKA 1CLXA 1RCOB 3MUZ1 3IS4A 4QISA 5L9FA 4KFOA 1FWHC 4AG0A 3W7HA 3C3NA 3MCOA 3H23A 3PHAA 3NQ6A 2VFHA 3SGUA 3COTA 5DCEA 4UQCA 3OEXA 2TPSA 4GC3A 4DXXA 3QBUA 1G4TA 3H55A 3PWAA 1AQHA 4L1XA 2R1MA 1G01A 2ON3A 5BYWA 3R8RA 4ACZA 4RNHA 1CX9A 1UH3A 4L7ZA 1DTUA 3IUIA 1O7AA 1QAPA 5TD4A 1EJUC 2FZMA 5H1WA 3VILA 2J88A 4W85A 1QW8A 3QLLA 3T1GA 1UD3A 1FDZA 2OSWA 1IEIA 4AZCA 3QR3A 5A2AA 5BRBA 1UZ1A 2OELA 4MJ2A 1OYCA 1TR1A 4EWJA 4HGXA 5GJNA 4LNCA 2QPSA 3TA9A 4UOQA 1LRQA 5FKYA 2WCAA 4H9ZA 1XIBA 4ACYA 1WXJA 2YX0A 2HS8A 3CEPA 1OFRA 1LG1A 2XGIA 2GK1B 3UJSA 1LDCA 2FH8A 2Y5JA 3TYEA 3WMBA 2G3IA 5C9XA 1CLVA 1QOQA 1ICQA 2QV5A 3QY7A 5I3FA 4GC4A 3U8GA 2VVSA 2G3NA 1JF6A 5D33A 1MFUA 3IV3A 1JCLA 2O9RA 1GJWA 4GVFA 1FOBA 2C79A 3NNTA 5GVJA 1DQWA 1G7UA 3CV2A 4LPCA 3RMEA 1LLOA 2HVNA 1MZHA 3HOJA 4P5UA 2Q8XA 3TTOA 1GG0A 3K1DA 5CPOA 4NQ1A 4RZ5A 1BVWA 1H5YA 4JN7A 3HA1A 1E6PA 2J27A 1Q6QA 3I4EA 4KEVA 4J3VA 4HYWA 1VGAA 1E0XA 3FY1A 4ZVJA 1XIGA 2OQYA 5CSSA 1IEQA 3AWNA 2PDYA 4JTAA 4AXNA 2RDUA 1U22A 3BOLA 3ZT6A 4DLMA 4W86A 4W8LA 4M7TA 1K4HA 4HA4A 4AEFA 4IIDA 1R2TA 5XINA 1PCWA 1FY6A 3I68A 2V38A 3UT0A 3ARUA 3ITTA 1H63A 1EXBA 1OYBA 3QPEA 3P3BA 5G1MA 3WSUA 4AQLA 4DQWA 1UWIA 3M0LA 1P1MA 1W2VA 2FHBA 1J6PA 3W7CA 3VKKA 1KM1A 2YFOA 4D6CA 3B0PA 3MSDA 3H4XA 1SR9A 3MI3A 4DWSD 2DZSA 3L7RA 4UXDA 2WB5A 4LS2A 3TYDA 5MF5A 4GZ7A 2XUCA 1KBIA 1W1TA 3ARZA 1OX6A 2WMJA 5U4NA 2PDUA 4H8VA 4RNJA 4YPJA 1EUAA 1TFVA 1H50A 4ZMGA 4L65A 1GZ1A 3AOFA 2NUXA 6TAAA 1SO4A 2CXEA 3HTWA 4KCTA 4K36A 4IGMA 1XLJA 3VKAA 3SY5A 1TE1A 3EWUA 1VYPX 1PE1A 3A23A 4G1KA 3JS3A 4OBRA 1A50A 9XIAA 3MUAA 4LEFA 1UKPA 1CCWB 2JIWA 4HPXA 3T07A 3UEQA 4EX4A 3UG8A 4HHHA 3GBEA 5EFFA 1UWQA 3APTA 2ZYFA 5JH2A 2ISVA 4XZHA 1KRAC 4L64A 1ITUA 3VD5A 4C1NA 4BFAA 1V4YA 3E2VA 4PEEA 5D8ZA 3OBAA 1E55A 2R91A 5GJMA 3BG3A 1WP6A 2Z6IA 1GZJA 3CTLA 3O6CA 4IX2A 3REQB 4B5SA 2DIEA 3ZLFA 2A7NA 1K7FA 2OCZA 3NQFA 1N82A 3GM8A 1C8YA 2AAMA 1CENA 1XRTA 3MKVA 4S39A 2EPOA 3BSHA 2VDGA 4TV5A 3R10A 1AL8A 2WZEA 3B04A 3FNDA 3TYBA 1TTQA 2CYGA 1KM6A 1SJBA 2A4AA 2A7PA 2F7FA 5BROA 4N2YA 1GTHA 3ZJ6A 4U28A 3ZSTA 2XSXA 3B06A 1H41A 1MO0A 3VGEA 3KRZA 4F48A 4NZCA 3KVJA 1YBQA 2QJJA 4Y9OA 5F4WA 3UXDA 2R94A 4M81A 3GTIA 1U5HA 4MJMA 4D9PA 2GJLA 3BLPX 3NQGA 3UZ5A 4GBDA 1LT8A 3GBDA 2WWCA 1NY1A 4A35A 4R33A 4AZCB 4JHMA 4OIFA 3RLUA 5A3HA 3LHVA 1K3UA 3PPGA 3K8MA 4O19A 3SQMA 2YA0A 3SAZA 1OC6A 4JTJA 3KX6A 3MQTA 3RX4A 2EPHA 1E3XA 1WA3A 1ML1A 4H2HA 5C9ZA 3SRFA 5AZ1A 3Q58A 2WWDA 3W28A 1JD7A 1A49A 4X63A 1FWWA 5DMLA 4C6IA 1TJ2A 2CW6A 4NNAA 3F4DA 1O5RA 3TP4A 5FF4A 3WF0A 5TF0A 2EAWA 1ZENA 4JR5A 4TVUA 1E56A 4UFLA 5BU6A 5I0DA 3PY2A 3AS2A 2WM1A 1NWTA 2YDAA 3H2MA 3U48A 7CGTA 5FJOA 4CQ8A 3DC0A 3N9SA 1VFOA 1UP3A 3AS1A 2JEQA 2QV4A 4IUOA 4XZWA 4NI3A 1VIZA 4GJJA 3HMCA 3W22A 3WQCA 3VDGA 4ICMA 3GKFA 3WQWA 4JKLA 1GK8A 1EDQA 3BMVA 1ISYA 2AQVA 4GCXA 3WUBA 4H9MA 3LPOA 4G7EB 4LS1A 1GQNA 3V0TA 1HIZA 4NJGA 4UCFA 3QGAC 1OZMA 1PPIA 2IUZA 3EGJA 3FYOA 3N73A 1E4NA 3GHTA 1TZ9A 1O5KA 3SUTA 1ZPTA 3PM6A 3E02A 2DSUA 3OBEA 4J3XA 4NZJA 3PF3A 1A5LC 3RR4A 3L0KA 4QDMA 4LUJA 2ANUA 3UZWA 1XIJA 1U83A 3P8IA 1GVYA 1TJRA 3UXIA 3SCTA 1KFKA 3AU2A 4ONVA 2BTMA 4J3SA 4F3HA 2JGQA 2OB3A 4AISA 4O16A 2QUMA 4B92A 3LHZA 2FJUB 5D02A 2XH2A 3EX6A 3UVIA 3CPRA 3P62A 1YE6A 1CGYA 3SJNA 4BY3A 1PCKA 3AS3A 3GDRA 4DYKA 3TTEA 1EQPA 3FVDA 1HTIA 2DT3A 3LRMA 4HB7A 3WJYA 4Q6XA 1JZ8A 3AIQA 1E4MM 3WD0A 3QJAA 3JZUA 1FWJC 1JQVA 3QYSA 5DELA 2EG8A 5CZKA 4L1GA 2PWFA 3RU8X 4JS3A 3AYRA 3HG5A 4FNTA 3N3MA 4DF2A 4MFEA 3VAVA 1CXEA 4E6MA 2A85A 3MU7A 2C15A 3EBVA 3QEZA 3ZR4A 1DIKA 4WDUA 3RPMA 3VUPA 1XLIA 4NF7A 4PMOA 1IGSA 3C86A 3S2LA 2Y70A 1TVLA 2ALDA 3H8AA 1XYBA 2V5CA 1HO1A 2HTMA 3E12A 3FAWA 1QI3A 4H6QA 1TPDA 1K77A 4GY1A 4WOQA 3FK4A 1C8XA 4JCLA 3LDVA 1ZQ5A 3THDA 2E9LA 2DZXA 2Y85A 1G1YA 4PMXA 1UWAA 3E2RA 2P88A 3W00A 4Q4SA 4U2YA 1TTPA 3ME3A 1FX6A 3G22A 4HJFA 3LV5A 2GJNA 3CZEA 4BK9A 1GVSA 3HPZA 4DAFA 1U1HA 2ZUTA 3H2OA 4B16A 4MY9A 3ARRA 1KFWA 1W3KA 2E6YA 4MUZA 1R8LA 4AY7A 4JAWA 1QI5A 2G37A 3R0KA 4PL2A 3BXWA 5AOUA 3S9ZA 4JTDA 4A21A 3P2VA 2C3ZA 4J1OA 2ZKMX 3M5XA 1W56A 1CBGA 4I5UA 2GYIA 1XYCA 4NZ3A 2HVMA 2VEFA 1CGTA 3BOFA 1FWCC 3RRXA 3CV6A 3WUGA 4JTSA 4IFKA 6TIMA 3N3TA 3KAOA 3ZT7A 3F4VA 2W6RA 2VQUA 4AWTA 4CLMA 1GPFA 5FEWA 5AKQA 4O11A 4PBEA 1I2NA 4URIA 4UFJA 1XLBA 3CZKA 3GHRA 2EJAA 1KM5A 2PDGA 1AFSA 2IQTA 2G95A 3NOYA 3EA1A 2XSBA 3PG9A 1REQB 4JIPA 4KMQA 3TIMA 3W1NA 4WD0A 4C6LA 3F4WA 3WF1A 4GNKB 1SU5A 5A5WA 2IMRA 3S47A 4MWAE 3QQ1A 5K2ZA 1SFSA 1NIUA 2HK0A 4QJ5B 3N12A 1BD0A 1YMYA 3EDJA 3MO7A 5F2GA 4EPEC 1BVNP 1I8JA 2XM2A 2XJ7A 1KXTA 2PDJA 3STEA 2XU2A 4DLFA 1SSGA 3LEPA 4HHPA 4Z2GA 1GW9A 3WD4A 2DGAA 4NXKA 3S83A 1HNYA 1MQQA 4UTTC 2DSZA 4L9YA 4AYGA 2PS2A 5DCBA 2W66A 3GDLA 6ENLA 2O56A 4K39A 4D6EA 1AJZA 5HBFA 4E2BA 1MW0A 2GSEA 4X22A 2A2IA 4CD8A 3TR9A 1XC6A 2CLIA 1HKIA 3ANYA 4L6DA 2CZ5A 3OA3A 3W1LA 3GFZA 1XIFA 2P8CA 9RUBA 3AMCA 3G1SA 1UWSA 3XISA 1EZ2A 4J9JA 1RJPA 2Z28A 2Z25A 3F7JA 1UR2A 4HNUA 1YBQB 5D37A 4UFMA 4WSKA 1ZBWA 4K7VA 5XIMA 4XBJA 3PZQA 2PU0A 4NUWA 3MDWA 5HMSA 2QXWA 1UKSA 6XIAA 4MIMA 4Q6JA 3IIZA 3UWEA 5JBFA 2YCKX 1O5QA 1SM9A 3G1XA 4FIQA 3CPGA 3S1GA 2GJRA 4GOAA 4RE4A 5KETA 1AD4A 1XD0A 3WDQA 3M0KA 2VUYA 1L6SA 2Y5SA 3IPWA 3PTQA 4B4HA 3M5VA 2O9OA 1XL9A 3HG2A 1ITCA 4RL3A 1QNOA 3TSMA 2I17A 2XFFA 3B8SA 1YPFA 2WSQA 4QAWA 3W2JA 1OX4A 3IJQA 4MNKA 4MFDA 1AK5A 4FR6A 1T99A 4EAYA 4Z0JA 3BLFA 4HZ7A 4ILSA 4L4PA 2QPUA 3VOHA 1TQJA 4LAUA 4K8EA 4WIWA 3LTPA 2X1TA 2CLEA 3ONBA 2NX1A 4FLRA 4KKXA 1C7SA 4HZMA 4NJHA 4WY0F 5FSDC 1DVJA 3ZJ8A 4O50A 1JXJA 2CEQA 1ISVA 3ZWSA 4P61A 4LEQA 3MHUA 4H6KA 1XX1A 5DQPA 4MZYA 5ABTA 3GE7A 1FWEC 4QM1A 1Q6EA 3R58A 4Z2JA 2R1PA 2X1SA 2RGLA 2HE8A 2WVVA 2E09A 3B8DA 4UTHA 4IT1A 4W4QA 4GYKA 3E2QA 3L5LA 3SN1A 4AVFA 1VLWA 2YCEA 1TUXA 1AODA 2E40A 3DERA 3W1RA 2E1DA 2OZTA 3KOYA 1YTDA 1W5PA 3LI1A 1EIXA 2YDSA 4MDOA 1TVPA 2G41A 4DN1A 2VYOA 3OLDA 4J7RA 3PAOA 4GLEA 3E6EA 1X6UA 3I7QA 1M04A 1DXEA 2YOCA 2ESCA 3VKBA 1PVNA 1E1CB 2BHZA 3PUGA 3WJWA 1H49A 3OVRA 2X1IA 3S2MA 4AUBA 3NQCA 1TWSA 4UFKA 4YVVA 2QKFA 1W9BM 3HIJA 2DORA 4F40A 1GOXA 1GOOA 1DYSA 4MPQA 3GHUA 1M9HA 1O5XA 2PP1A 2NV9A 3E0VA 1SGJA 4K38A 5HMEA 1BWVA 2E8ZA 2E5BA 3WH6A 4D71A 2YA2A 2WBGA 1NF0A 3B8TA 1C3FA 6CGTA 2CESA 3VNLA 3ZVIA 3WBYA 2VZVA 1K8XA 5DBTA 1OC7A 1XGEA 3M64A 4O12A 4PB5A 2Z4GA 3N2OA 3SN0A 2XFRA 3CIWA 2IXVA 2A79A 3EA2A 1R0MA 4PB3A 2HK1A 1NWSA 1DL3A 5FEPA 2GUYA 4PEKA 3T2OA 3IIPA 3LM7A 1C92A 1XIHA 2E1WA 2DDXA 2ZVIA 4D2JA 5DMNA 3K4AA 4AFYA 3AS0A 4NXSA 3CHEA 3NL3A 3NPXA 3UZYA 4IMAA 4QRNA 4KIRA 4FLQA 4BI7A 1UD5A 1M7JA 3TN3A 1F5ZA 4PUMA 2E5DA 3POHA 1QI0A 5CBJA 1FWNA 1IXPA 2NWRA 4MB3A 2J25A 2G3JA 1LORA 4NHVA 2I14A 1DWIM 3O16A 1DIEA 2VGIA 4IPLA 4Q4PA 5LIXX 1BYBA 2J7BA 5H6HA 1EBGA 2QYGA 4J28A 2VZOA 4L4LA 5I02A 3CH0A 3W9ZA 4FNSA 1SZRA 4RJEA 1B5TA 3WNMA 3SSJA 5I3GA 2OWXA 1XH0A 2WKGA 4P7OA 1HL9A 1MXDA 1Z69A 3N2TA 5KINA 2OMAA 5CQ1A 1MUCA 1SMAA 4B2DD 5AC8A 4FOKA 4UMAA 4DUXA 3AIWA 2Z26A 2PTYA 4RR4A 5I3IA 1RV8A 1OD8A 3C0QA 5ABEA 2BSLA 3KDOA 1CYGA 4AXKA 1FWSA 1H60A 1Z9AA 4R3UA 4CNNA 2PGFA 1M41A 2D69A 2C1IA 4I7WA 1O1HA 3KCJA 3VGBA 4R9XA 1H7NA 4AVOA 2VHLA 1UZ4A 1SFLA 3M7WA 5D38A 2O55A 2QCEA 4H4IA 2ISSA 2OFJA 4LXFA 3WK3A 4LWWA 4Q4KA 1A53A 3NEVA 5D30A 1KBBA 3BARA 4MZ8A 4BQ3A 3HPSA 2E0PA 1PHWA 5B80A 1I60A 1GEQA 2AQWA 3NQDA 3PULA 3CASA 3PS7A 3MMWA 1P4CA 4LY8A 2HE5A 4GXPA 3WQ5A 2DT1A 5DY2A 1UKQA 1TYGA 2YPIA 3SZ8A 4EIVA 3ICJA 2V2DA 4LB3A 3SY1A 3DU0A 4WOZA 1EJTC 3S2JA 1XINA 2V5JA 1SJCA 4DM2A 4NNBA 1PTAA 1EGMA 3W3OA 3F1QA 1AH0A 1HW6A 8XIAA 3R12A 2UWFA 2X05A 3SR7A 3W24A 3B9EA 3UR5A 4HZ6A 3MWAA 3R89A 1BQCA 1R7AA 2Y24A 3PWIA 4LVBA 4C6JA 1OIFA 2XGBA 4JTGA 3EPOA 3R79A 2ZICA 2QHAA 3P74A 1I0BA 2E77A 4NAEA 4PCTA 3T78A 4LB4A 3BAWA 1NARA 4P8WA 4M6VA 5LA2A 4LVAA 1WXYA 3KS5A 1ISZA 2PDHA 3FCPA 5E0KA 5PTDA 3MJYA 1AVAA 1REQA 2DFAA 3A3WA 4JIEA 3EWWA 2J7FA 3KOFA 1AMKA 3MI6A 4HMCA 4NIRA 4AEEA 3KZPA 3QVQA 5FESA 1K70A 1QW7A 1ECQA 1H1NA 3N9RA 3FS2A 3FW6A 3EMCA 2WHMA 4UR8A 3AZRA 1W9DM 4LY4A 3NYZA 4F9DA 5K4ZA 3HN3A 1F6YA 3M0ZA 3UA3A 3OYXA 4A2SA 1NEYA 3NQMA 4K2SA 3RMJA 2OX1A 2QCLA 5DMMA 1HKKA 4GJIA 5E6ZA 4JDBA 3UNDA 4H19A 1NFPA 3NO3A 1KM3A 2YDRA 4JICA 1J8VA 1ONRA 2Z1XA 1X6NA 3S8HA 2A3BA 1OX4B 4F4RA 2NVCA 1GYMA 2I7GA 5KZEA 3P5ZA 1VJZA 3T0DA 2E8YA 1PO9A 5LYRA 4GO9A 3QR1A 3QLDA 1GJPA 2ZUSA 3TCEA 5GJPA 5C2XA 2CPUA 1B31A 4DJFD 1Q4NX 2VENA 3MMTA 3TZNA 3QR0A 4HT3A 4ES4A 5K3VA 3L68A 3W27A 4AH7A 3NPUA 4O0QA 5EA9A 3MSRA 4DJDC 1SUXA 4GUHA 4JX6A 1L8PA 1V79A 4CNTA 2WNWA 2J8TA 3FA4A 1AZ1A 4IQJA 1CDGA 1F3TA 4E8DA 5G4EA 2ZX7A 4FPSA 2WVVB 3LX9A 4IGNA 5E1QA 4XO6A 1E15A 4MOZA 1KFCA 1XDLA 4Q8WA 7ENLA 5E9XA 2ACRA 3QYQA 3F5LA 4GQGA 4DF0A 4XAZA 1XP3A 2JF6A 2PZ0A 2RDWA 3VDHA 4AD1A 3VIKA 1P0BA 2DQXA 1VEPA 3KM8A 3S1VA 1QTWA 4IPNB 2RJHA 3DIPA 4DBSA 3WH7A 1MEHA 2DJXA 5C9WA 4YTTA 2IKGA 1B1YA 5I5RA 4GWEA 1Z6KA 4EP8C 3CQJA 4ZQNA 3TZFA 1WBJA 3UD6A 4UTMA 1SW3A 3QOMA 6XIMA 3L4YA 1AJ2A 5IDIA 2GGGA 3MUXA 2OG9A 4JQ3A 4M1RA 4IM4A 3AHZA 3SCRA 2V5LA 3FVMA 5GNXA 3THQA 2V82A 3A22A 3PZGA 2W67A 3ITXA 4GMEA 3FJLA 4UCGA 1JQXA 3SJ3A 1Q8JA 2D23A 3CIVA 1A5NC 3S5NA 3W4RA 2BY3A 3DG6A 3WH8A 2PSNA 2HDJA 4QAIA 3KHJA 5EBAA 1H5VA 2VR4A 2PDFA 3N4EA 1JZ3A 4JPGA 4H8HA 3OA5A 3PG8A 2XN2A 4I9AA 1JYWA 3VABA 3L0GA 1NDWA 4GI6A 3FSTA 1RXOB 1J0ZA 1A4MA 1DJGA 1T6MA 6REQA 1EP2A 3OIXA 1OIMA 2C19A 2WSKA 3TW7A 2GOUA 1NJJA 3KUMA 3UY7A 3ERPA 5I79A 4AF0A 1LM1A 2OT1A 3LXAA 3NO1A 3UBPC 2PDKA 1F07A 1MXGA 4NJJA 3QC3A 1B54A 2CCRA 3SCNA 3WLTA 1I9CB 1TE6A 2HNHA 1FWBC 1O95A 2YIHA 4FF7A 2Y61A 1OY0A 5H2ZA 2PWDA 3EOUA 1UA3A 2CLHA 1XCXA 2X2GA 1P48A 3IAQA 2AGTA 4LUTA 3E96A 1KR0A 3S5SA 1F6PA 2IPWA 5K4XA 2ZUMA 3GH4A 4UZUA 4Z1CA 4C90A 1V6YA 3PZUA 1HVXA 3IANA 4PMRA 3IJDA 3NL5A 1XYFA 2FZDA 2GJXB 4HA1A 2VFIA 1KGXA 2WHLA 1XHGA 4W93A 3BW2A 2NT0A 1KB3A 4NYUA 1R5YA 1GWJA 4JGDA 5ABFA 3AJXA 1PKNA 4HHMA 3NSNA 2QEZA 1NVMA 2YB1A 4C6CA 4XZMX 4ZQOA 1TV3A 4DAIA 4DZAA 4S3FA 5EMUA 4S3AA 3KW3A 3QC0A 4HNTA 4PUNA 1Y5VA 3K4WA 1KXQA 4NSBA 4K1GA 3GTHA 1FHLA 1X7FA 2F6UA 2WVUA 1VFFA 2BFGA 4HOZA 5HR7A 2YBVA 1VCGA 3UJ2A 3KLLA 1TPVA 1TQXA 4I3GA 1KWKA 2V2HA 2VFEA 3I65A 3CV1A 4LFYA 5BOEA 2OEJA 3E3HA 4K7YA 1NDZA 2HXUA 3NURA 2IKJA 3MMDA 1S2TA 2FMOA 2VNCA 2YA1A 1RCQA 1DHKA 4KBXA 4DPPA 3ARYA 1W3NA 4H41A 1YW1A 3LXBA 5TNVA 3R0DA 4TTGA 2OLHA 3IJ9A 3U5YA 1UWRA 3WQPA 4WDTA 3WFLA 1BXBA 2AKMA 3I3DA 4HOWA 1SQ7A 4DBWA 1RA5A 3CQKA 3DFOA 1I75A 2FDSA 5JXQA 3OZYA 1V77A 3GVQA 4F66A 2VGGA 2PF0A 3CU2A 4MNJA 1EIBA 1L6GA 2QQ6A 1XLLA 3GX9A 3L2LA 4HU4A 1UQYA 2WLZA 3EB4A 4PMUA 3ITVA 1TJPA 2CLKA 3E2SA 3VYLA 2ZRZA 4S2BA 1H2JA 4JIIX 1UASA 1PXGA 4DEFA 1HFBA 2QZRA 5CGTA 5FF2A 4LF2A 3TE9A 1EYEA 1UJQA 1V6UA 3A9IA 3OG2A 1XISA 1QMLA 1JI1A 5CC5A 2BV9A 3M5YA 5HAOA 4BKNA 3E5BA 3BCDA 1E1EA 3PBUA 1BYAA 5A6AA 1RR2A 4WDWA 3U3HA 5JBDA 2WHKA 3MHGA 1G5AA 2XZ9A 3TQ0A 3MS8A 1KR1A 5H8PA 4PTNA 2Z1KA 4JBRA 3GVVA 3ES8A 3IGHX 3AXIA 3FKRA 1WDQA 4XD6A 2YGYA 2D1ZA 1BXCA 2OEMA 3ABSA 1YX1A 5I03A 4N9EA 1K9EA 4E3VA 1E9YB 3GNPA 3PPFA 4D6GA 2QDDA 3VKCA 4V27A 1ICPA 3M0VA 2CZEA 3ZM8A 1IHIA 2BP1A 4A3QA 1D2KA 1RLCL 3H26A 8TIMA 2VX6A 2CKSA 1DV7A 3SECA 1F9CA 1LCOA 4NI8A 2OWCA 2NVAA 1J79A 3L4TA 3WQ6A 3A12A 3D3FA 4GKTA 1RPKA 4I5RA 1L2UA 3HPAA 4GIYA 3A9BA 4JN8A 3EEGA 3A24A 1A5KC 3AU6A 2CLPA 2ZRUA 4L6OA 4JFTA 2VWSA 3GUWA 4C5YA 4GINA 4M1BA 4PMNA 2Q02A 1C9DA 1R6WA 2KX9A 3QQ0A 2HRWA 1NSJA 1KRBC 2DJLA 5D2VA 1X39A 3LY0A 1G69A 1JCYA 1TELA 3GIQA 2LLEA 3GR8A 2HSAA 5KZMA 3AIUA 3H24A 1MNZA 2V9DA 3H7RA 3BICA 4XZNX 3NIYA 2DIJA 1U33A 1QFEA 3P0WA 4DYJA 1QUMA 2Q01A 3W71A 2J24A 5DEZA 3CMGA 1QHOA 1H4PA 3VNKA 2VMFA 3LS9A 1OFEA 3W02A 4DBDA 1OBAA 4HA3A 2VC6A 4UR9A 5BNKA 3W1XA 1TV5A 4FOJA 1P5BA 1GQIA 1J0HA 2YFNA 2QDHA 2FMNA 4KESA 4A8IA 1HJSA 1GVIA 3GKAA 1TG7A 1JFXA 3WLOA 1XC4A 4D8LA 1LRTA 2VZUA 3CZLA 2E28A 3GG8A 1C91A 3AROA 4MADA 2XZ7A 1C29A 3CYVA 4X60A 3VX0A 4ATDA 3CL7A 4J3WA 2EG7A 4BI5A 1W1A1 1L6FA 1IZJA 4FI4A 4KCWA 2CBIA 1Z7AA 5M1TA 1LL4A 3ATZA 2CWXA 3NEHA 5I6SA 1FCBA 2Y8VA 2B81A 1W1VA 2YCLB 1QPQA 5KZDA 4A6GA 3H4GA 1OSEA 3AMDA 4GACA 3UNTA 4PMDA 1UIPA 3LUTA 4H04A 4GYPA 1X8CA 4Y9MA 4CVWA 2BGSA 3SN4A 4A05A 2Z24A 2BY2A 2AKZA 3G6LA 4AIBA 1WZMA 2CFFA 1RJRA 1QT1A 3T9PA 4REQA 3JU2A 1AZ2A 3C8FA 3VVGA 1E71M 1F8MA 3WQFA 3RCNA 1VRDA 4AHQA 2OSYA 3HF3A 4J2PA 1WO2A 4RZ4A 1R87A 3AXKA 3PFRA 3PBWA 3KBJA 4AD4A 1Q2RA 3G1AA 2FVMA 3UP8A 2ASHA 3PB0A 1JCMP 1WZLA 3P14A 2PU1A 1W3JA 3LPPA 3G77A 4FR1A 3W85A 2RGMA 1RBLA 3ZMRA 3VCRA 1K7XA 4POCA 4YCOA 4Z42C 1CGVA 3SEPA 4CCZA 1LP6A 2J9XA 2Q8ZA 1MEIA 3ZVHB 1H0IA 3JZEA 4OFCA 3SY8A 5AHMA 1F7BA 3UCDA 3UR8A 3IK4A 1WDSA 2FZ8A 1LLZA 2OYMA 4ERIA 3CUHA 4JZ5A 3KLKA 1H0GA 1J93A 3SQLA 3GLCA 4GIRA 3VMPA 3DYMA 3NZGA 2GGEA 1GQKA 3MVTA 4DO4A 4PSPA 3IRDA 3GTNA 3WN6A 2VRQA 4GVGA 4ERGA 1XGDA 3GHSA 1KQZA 1W8GA 4V28A 3INPA 3B8VA 3WNOA 2PBGA 1UBSA 3M1ZA 1BEUA 2F9RA 1EJWC 1WUEA 1MFVA 1HJVA 4CQDA 5LXEA 3VGHA 4A3RA 2NUWA 5AYXA 1S5TA 1ODUA 3N2BA 4GIEA 2CLFA 3QHMA 2GQ8A 3U2CA 1W1ZA 2DH2A 3UETA 4O1AA 4LNYA 4JD4A 4CCEA 1HL2A 2DQWA 3IVSA 4CCCA 3S5ZA 3TQKA 2Z27A 4YTSA 2QAPA 4TUFA 3HG3A 3PZVA 3UR7A 1QPKA 3CWHA 1J2WA 1P1XA 3VNJA 3H2FA 4P2VA 1N8IA 4AEOA 2WJZA 4B5UA 2BS9A 1J0IA 4JTHA 1Q4WA 1TMLA 1EJXC 3TYUA 5G2HA 1GZGA 5LGZA 2FH6A 5FOOA 1EWEA 2FHFA 2V6AA 2ZWZA 4L4OA 4HMDA 2R8WA 5LIUX 1RY0A 2PDIA 2PGRA 3QTGA 2AMGA 3SB0A 3EDKA 3PTDA 3BAIA 4J35A 5FI8A 4YHGA 1W37A 1ADSA 2XSAA 2WNQA 3KS6A 3DFSA 3LM3A 1ME8A 1V08A 4XBKA 2CZVA 1M5WA 4AIEA 2X7VA 2VGBA 4UNLA 4US5A 4B5NA 4GCAA 5E70A 3NZ1A 5BW6A 3T55A 4ADSA 3FJ6A 4GABA 1TV8A 3IACA 2WOQA 1OABA 1JR1A 3U4AA 3A4JA 3MP5A 3PAJA 1XICA 3DBPA 1WYIA 3VIGA 3RCYA 1GCYA 4Y7EA 3AHYA 5JU6A 4XTIA 3RUBL 4KW2A 3CUGA 1JPDX 2OODA 1LUCB 4MJZA 2G8ZA 4AYSA 2P10A 4PUDA 2OJPA 4HCHA 4OJYA 3W7QA 4JTEA 4Z1AA 1OX5A 3PJTA 3ZT5A 1RD5A 4YYCA 2L5HA 2QVNA 1QASA 2WPBA 3T8QA 1RPXA 1FWRA 4PRTA 4CCDA 1X1OA 4NILA 4R88A 4PODA 3DOPA 4V1YA 3C2EA 1E6RA 1LZOA 2WVSA 1QVBA 4BF7A 3VIHA 1U1UA 2YLLA 2PDXA 3ALFA 2WXDM 3LI0A 1B2YA 3BAKA 2XIJA 3GXPA 3V35A 5IM51 3VFLA 1UP2A 3CC1A 3O0KA 1RP8A 3UW6A 4BWLA 4PCSA 3W74A 1K9TA 3O0FA 2DP3A 1XD1A 2ZTKA 4A2RA 4LJ3A 4UFIA 2YKKA 4LUSB 4B15A 4ZL1A 3M44A 2BXYA 2NW0A 2XWDA 3VOCA 2VX7A 2O9TA 1RH9A 4QR6A 1XYLA 1Z3NA 3BGJA 3NQ2A 4LF1A 3WEZA 1CXFA 4RDWA 3OYZA 2MUCA 3R4IA 4AD3A 3RCMA 4DYEA 2JKPA 5REQA 3RX3A 2YDQA 3C4UA 3GXDA 4JYEA 3FJNA 4U5KA 4ZB5A 5AYBA 3RGTA 2A7RA 2OO6A 3P5YA 4XVDA 3VIIA 5HA7A 1UCWA 4WDXA 1J12A 4ZODA 5REQB 4Q4MA 3UCQA 3RXZA 3HPFA 1DQXA 3RDKA 1XG4A 1E6NA 4HP5A 2E6FA 4N9DA 3PJWA 3TNBA 5C7VA 4L61A 3MBDA 2A3AA 5HUOA 1MUWA 5DF0A 1EL3A 4H8NA 1M7OA 2J6VA 3EDEA 1C9WA 1H7RA 5FSEC 2IKHA 1LF1A 2E6AA 4PMYA 1S2AA 1UMYA 4LU0A 2KZHA 3B9NA 2VGFA 2QJGA 4DJFC 2ZRXA 2DY3A 2ZUNA 5D2TA 2HV5A 3SRHA 1GKPA 3WMSA 4ERAA 3EDDA 3MA8A 2J6XA 3IIOA 3AALA 4WY0B 1XI3A 2Z7KA 4FXJA 3GK0A 1J0JA 5EU9A 1AMYA 3PZOA 1X1NA 3V0SA 2V5KA 3C2OA 3TYAA 1TUFA 3LLDA 1V3HA 2VD8A 2VM8A 4WY0A 1HF6A 1TJ0A 5ABHA 3N9KA 1SFTA 1XUZA 5A8PA 4F0RA 4HMEA 3MYOA 1RJQA 1SW7A 4KWSA 3DFQA 1YXCA 3QF0A 1RK5A 2UY5A 3V7PA 1Q6RA 1XLHA 2O7QA 4AX6A 1BWKA 2WAGA 3PANA 1IXOA 4INFA 4G2DA 5ABFB 1TPB1 1IT7A 2VXNA 1R2SA 4G8TA 2D24A 2H9AB 2FB2A 3IEBA 1GOIA 1VF8A 4C6DA 3UY8A 5CAKA 3GXIA 2NSXA 3BUVA 3N6QA 3CS2A 3FIGA 7REQA 4YWIA 1QCWA 3NDOA 3P80A 3W23A 2OLAA 2Z29A 1HUVA 5A8GA 2P0IA 4RK8A 1EJVC 3GC4A 3W2KA 1B30A 2XDFA 3LTSA 1TV2A 3W83A 2FFCA 4A3YA 4D6HA 5FJIA 4FMVA 1LOSA 1S2VA 1X96A 3NSXA 3PZNA 3M41A 3GVGA 1F2JA 3MMUA 1IIHA 4S3JA 4E4UA 4ATWA 4GQ0A 2B4GA 1QOXA 5CJ5A 3SRKA 4B4FA 3UPWA 5BCAA 2VCCA 1IIGA 1TIWA 4J5NA 3ITGA 3WD2A 1NOUA 3C5QA 3CLWA 2OVLA 3AHTA 1PZ0A 4XIAA 2WJDA 3RK8A 5C55A 2BWGA 3KDNA 3FHQA 2J75A 1JZ4A 3AIVA 5B7ZA 3GG7A 3N4FA 1JCTA 4O1CA 4YLWA 4R7WA 2CETA 5E5CA 3M9YA 3GXFA 3KEHA 1KCKA 4DXKA 3LSCA 2A3CA 2G4JA 1E3ZA 1ONXA 1E6XM 5IBXC 3T40A 3UWZA 3OIHA 3BDKA 3WJSA 4IL2A 3RM8A 4QITA 4K8HA 3U2ZA 2ACQA 3HGJA 3PBVA 1H11A 3G0UA 1JZ5A 4QG8A 3IAPA 1M53A 5D9OA 2VURA 2PTZA 4N9BA 3NVTA 4M6UA 2Y0FA 3S6TA 3W7EA 2X30A 3CTTA 2JQXA 5AHLA 3WL0A 1GNXA 1EOKA 3FOKA 4DJFA 2PUZA 2BG5A 2ZXDA 4Z1BA 5JVLA 2OYLA 4UTLA 1C7TA 1OK4A 1S2CA 1R9XA 4FLOA 1R3TA 4CGTA 1NOWA 1QPOA 4MKSA 4NZ4A 4Q4OA 4RX0A 4XG1A 4ADTA 2NX9A 4MHBA 4IJBA 2PC8A 4WCJA 1LL7A 4R27A 4W7VA 1Y5XA 2EJ1A 1W9VA 4AD2A 3G24A 2Z0IA 1I2RA 3UA4A 1DQUA 2JGYA 2FTYA 1PZ2A 1V51A 2VX4A 4RPPA 1YQ2A 3W29A 3R13A 4GG9A 5IRPA 1W5OA 2QCGA 5H8UA 3CPUA 3THAA 4JKMA 5D2WA 2GDUA 1E0TA 3NDYA 2PP0A 4KEZA 3HQPA 3H2CA 1QNRA 1Z41A 2EBNA 3C52A 2J4GA 4E2OA 4JTKA 2YL5A 3DHPA 4MY1A 1QRQA 1EHAA 3EOSA 3W01A 4HBKA 1QPNA 2XH7A 3R43A 3DI0A 3HGSA 1WDWA 3W1AA 5BRQA 1VJIA 1FXQA 3I6EA 1DBTA 1VFHA 3RO6A 2VR2A 4O0ZA 2RAGA 2J7HA 2GK1A 3CUIA 1EX5A 3GG1A 3L23A 4S3CA 3O6YX 1D8WA 1JDDA 4N42A 3CMFA 4M24A 4O17A 1FKWA 4ZQCA 3ZR6A 4KIEA 1WPCA 3QHOA 5IXEA 1J2BA 5I3KA 1DP0A 2YL6A 1A3WA 1JRBA 4ICNA 4DZIA 3TC6A 3AUOA 4QCEA 3A6OA 1UPMB 5LNUA 3LYEA 3THUA 3P8JA 5HNRA 4AU0A 3M46A 5CLTA 1IXNA 3BGAA 4UNIA 1F74A 1PKMA 3N6HA 2X09A 4IISA 1WV2A 3URBA 3TQPA 3DFNA 1YTEA 2VCBA 4IMCA 3TSBA 3VFCA 4PR4A 2X8RA 4GQQA 1R9YA 4WKAA 2TMDA 4ZO7A 5BOOA 3SIZA 1Y8BA 4M7SA 1E4LA 2AAAA 4GH1A 4HA0A 2XIBA 5LZLA 4OOUA 3N4AA 3WCZA 1VPYA 3I10A 1OFOA 5M5DA 2D73A 3V1HA 4DX3A 3M0IA 3BLEA 1EDGA 2W91A 3H7UA 2JKAA 2BMBA 3T8LA 3UG4A 1I4NA 3IGSA 3LXCA 2DUXA 3JR2A 1E5JA 4XAYA 3S6DA 1ZBVA 5CC7A 4N4QA 3VIMA 4U31A 3D46A 1SZNA 3F5JA 3QV7A 2FTWA 3I7RA 2Y7DA 4XZBA 4MMWA 3TC3A 1YTKA 4XAPA 2RJGA 4LX4A 4GBUA 4HU0A 2XHYA 2ISDA 2XH0A 4PA8A 4BJHA 3GDBA 1XJBA 5BU9A 3ITYA 1HJWA 4MNMA 2OKOA 1KXHA 1O68A 1Q65A 1UB3A 4LVGA 4DWSB 4O1EA 3VGFA 1JAKA 3GFYA 3W81A 3BW4A 1DJYA 1R3VA 3GO2A 1YYAA 4JOMA 3IRSA 5EFDA 5DY3A 4AWEA 4NY2A 2VWTA 4RDYA 2FKPA 4UTWA 1K4GA 4BEUA 1L0PA 1Z89A 1W32A 1PIIA 3BVJA 3IUDA 3B0VC 2NQZA 3L67A 5TAOA 1HKMA 2VEKA 4PSRA 3EWCA 3S1XA 1EFZA 3T4CA 3GSMA 2PRMA 3LCXA 3ZVHA 4FLSA 4BS0A 4KETA 1QHPA 5FEZA 4IOTA 1IE7C 3WLSA 1G6CA 4LRTA 2POZA 1NQ6A 2I5IA 4FOUA 3VKJA 4I90A 5M3WA 1QI4A 2OGYA 3I3BA 4TU1A 5HPOA 2C0HA 4DWSC 4Q8TA 1OQFA 3EMZA 1UC4A 3N13A 1Q6FA 4B3LA 3UWVA 1WAUA 4O8AA 3VCNA 1A3HA 3DH7A 3BURA 3PUOA 3L65A 4WVXA 4C6PA 1I2QA 1GHSA 4RPQA 1RP9A 3S5YA 2Z6JA 3TTSA 1IT0A 3ATYA 4C6BA 1D7FA 2IXUA 3N2CA 5E09A 4IFOA 2QJNA 3DBNA 3WDIA 1JXKA 2YYUA 3SGGA 3FFSA 2JIEA 1SO6A 1EUNA 2DZTA 3O6AA 2UV8G 4CNSA 4D6JA 1HN1A 4R9OA 4ZZ9A 3BQ6A 1OADA 1T5AA 4H2CA 5FA5A 4MAVA 2VL4A 2A21A 2FPVA 5D2XA 4QE4A 2DV0A 1TA3A 3M43A 1CECA 1WOBA 1E0UA 3DCPA 3U6WA 3VTRA 3BJSA 1VFSA 1UUOA 5CGQA 1QW9A 2VVNA 3S46A 1NOFA 2WC7A 4B9ZA 3EOEA 4NT0A 3EEZA 1EWDA 3PNUA 3UPMA 3WUFA 1TPUA 1UR3M 5J8LA 4F2BA 1I0DA 1PB0A 1QXLA 4C7FA 3FJ4A 4ZENA 4W89A 3LZ3A 1CLKA 1PZ1A 3AI0A 1SYTA 6ALDA 4H7ZA 3HV8A 1E72M 1QO2A 3N04A 3TMLA 5GNYA 1XDJA 4DB7A 3QV8A 2QUUA 3QRHA 3WLRA 3WZ0E 3KWXA 4I9MA 2Q71A 3NOEA 5CJMA 4TV6A 2I5QA 4KS0A 3GXNA 1TKKA 5F2IA 2PWHA 4D8AA 1BQGA 1NELA 4L9XA 4ZXOA 4CQCA 1DJQA 5LA0A 1XRSA 1ZB5A 5CC3A 3LGEA 1XYAA 3CAKA 1EPXA 4HCDA 1XBXA 1JYVA 3W7LA 3VE7A 3SI9A 4RXFA 4W8BA 3N17A 2B7OA 4ZOAA 3OTRA 1SZGA 3GAYA 1EC7A 1SPQA 1I6NA 4MNLA 2EPLX 1LROA 1IEWA 2VC5A 4B5TA 2ZRWA 1OCQA 4UTFA 3BLIA 3TFXA 3ZJ7A 1W5NA 2ZTJA 2RDXA 4JEQA 4XIMA 3STCA 4EXBA 3QY6A 1JNEA 1Q6GA 1E1CA 4KRZA 2O92A 4KEUA 3V3WA 3HJEA 3OG3A 3DG7A 2XN1A 1W1YA 1OGGA 4BEQA 1EGVA 4CNUA 5D9PA 4X2PA 3MC5A 3GTFA 3TEVA 5CZ0A 5HINA 3MV01 2CBUA 4PL1A 2Q3OA 3W86A 3WYZA 4E0CA 1FWGC 1WNOA 3W82A 2W92A 1RY8A 3QW4B 1TZ7A 2JBMA 2W61A 3I4KA 3GU1A 4YN5A 2O9PA 1S39A 4I6KA 2J7CA 2V5DA 1ZY9A 2PMQA 1FUYA 1KBKA 4LS0A 5DT5A 3A47A 1PSCA 1GT8A 5AHNA 4PUKA 3CL8A 2E25A 1SW0A 3LD5A 4C6EA 2X1UA 1E0WA 2J78A 2JF7A 3BMXA 1JCXA 3NM3A 3WIJA 3KRBA 2NSOA 1QWKA 4PULA 3DG3A 1CIUA 4ZQMA 1JI2A 3K8LA 4O10A 4FNUA 4JN6A 4GVHA 3FA5A 1MW3A 3O3RA 1JYXA 4CU8A 5CCZA 3TAKA 2WQDA 1VCVA 3MBFA 4BI6A 2V3DA 3REQA 4IIBA 1EYWA 3R25A 1P0DA 4H9UA 1VEMA 1UPPA 1MI3A 2YYTA 5J5RA 3BLOA 1PZ3A 3KCOA 1DPMA 4NJIA 1UP0A 2OXNA 2PDWA 3T2QA 2ZE0A 3QZ6A 5U7SA 4TMCA 4XQ6A 4K1WA 3AMKA 4IF2A 4US6A 1XLCA 2WK2A 4GX9A 4PCNA 1XKYA 4WKFA 1UUMA 5EBUA 2WM0A 4YTRA 3LLXA 1KCXA 1MNSA 2PZNA 1UR9A 3BV7A 1GONA 3SRDA 1VAHA 1VC4A 2WO5A 2WPGA 3OVPA 4EF8A 4QTGA 3BO9A 1JNDA 3VIPA 4AZBA 1YDYA 2ZXQA 1TWDA 2V8ZA 3VOFA 1ZS2A 2V3EA 1HKVA 2FJKA 3PBGA 3V5FA 3W25A 5MKGB 3USZA 1ZCOA 2J8FA 5DFAA 1Q2SA 3OVQA 1ZGDA 3SUWA 4L9ZA 1XCFA 3W2MA 2PLKA 1A0CA 4C1NB 1GYNA 3TJXA 4XO7A 3RLGA 5DO8A 3MKCA 1KV5A 1OFDA 3W26A 1ESWA 4JEJA 3B8WA 1LWHA 1W3LA 1QI2A 3RPDA 3STFA 3FYYA 1S5NA 3OU8A 4Q4RA 4QNEA 2G4FA 3B9DA 3SSZA 3RLHA 5D9NA 4QSHA 3STPA 3GDMA 3LCFA 4UOZA 4NG3A 1TR9A 3CM4A 1TO3A 3CBWA 4TR9A 4GO8A 4WF7A 4ZQPA 5HATA 2QJMA 3LMYA 4Y96A 4AHOA 3WEOA 4G1NA 3A4AA 4YJ5A 1FFRA 4XB3A 1HGYA 4A3UA 1B3YA 4AC7C 1OG0A 3T09A 1LQ0A 3NQBA 4LT9A 4NAFB 3AJ7A 1DJHA 2VRJA 3W2UA 5AFDA 4EXAA 1XSJA 3UJEA 4KCUA 3E0FA 4GPNA 1TZZA 3NTYA 3MDUA 4LSBA 9XIMA 1XDMA 2GVEA 4GD0A 4KCVA 5EYWA 2DZAA 4YVXA 3QQWA 2GGHA 4JHZA 1XLGA 1OG6A 2XYLA 4YVPA 4S2CA 7TAAA 3GRIA 3AYVA 3ZSSA 1ME7A 2XVKA 4TVDA 2W3ZA 4JTLA 5BWFA 1OF8A 2XG9A 2HQAA 3CWOX 1M01A 3TSDA 1ZLPA 3P84A 5CKSA 4OU1A 1DE6A 2Z00A 5CPMA 1G67A 2ZZ5A 2V67A 5FCZA 3E38A 2OKTA 1ME9A 3VPLA 1W1IE 2WNNA 2CZFA 3WNNA 2WNZA 3EPNA 3EB2A 3V36A 1TTIA 4GISA 5LHEA 3P6LA 2E5CA 2RH9A 1L8NA 3LCWA 5FEXA 4PN2A 4JCMA 4PCPA 1DWFM 3VX1A 5HXMA 4ROPA 5EMKA 3UJRA 3IVUA 1H1YA 3SBFA 1TWZA 3IK2A 4Z2KA 1RSCA 2X42A 3WLIA 5I77A 1E73M 1QNPA 3F4CA 3W72A 5C6MA 3MB9A 3B9OA 1T0OA 3HQ1A 5BZAA 1Y5WA 3H22A 1XSIA 2OR2A 4Q32A 4MF4A 1OD0A 5DMYA 4ACZB 1HZYA 1UR8A 4G7EA 1BG4A 3MUIA 4M19A 3PBYA 1NF7A 4JQAA 1JGIA 4MJ4A 3N25A 3ZOAA 4KWWA 1DWAM 5HR6A 5DXXA 1XKJA 1WZKA 3GXTA 3WNLA 4XKMA 5L6UA 3K5XA 2D3NA 2BY1A 1R47A 1WDRA 2YL9A 3RN6A 3N15A 2W0UA 4QLLA 1ZHAA 1E1FA 3QSTA 3UESA 1QBAA 3UGVA 2BASA 3T6CA 5AN7A 5C8BB 3GVWA 2J7DA 1IZKA 4UTUA 2NLIA 5LHFA 4JIHA 1FCQA 1BXNA 2IKIA 1B3XA 3ANVA 3GYCA 4GNJA 4V33A 5LIYX 1V5XA 4LYRA 2F6KA 4XKYB 1AD1A 2C0AA 5G2WA 3OODA 4MWAC 2GJPA 3DAQA 3XIMA 3PSWA 3R5EA 3NPWA 3LLFA 1J11A 3GH7A 3S1UA 4IJCA 4DI8A 1KM0A 1UROA 3L5MA 1HJQA 4NKCA 1KM4A 3SURA 4IGSA 2BVWA 2PWEA 4Q7BA 3RG6A 1XF0A 3LHYA 4AMAA 3L5AA 4F2UA 2Y7GA 4JFUA 2QMJA 3NYDA 4XUGA 3FN9A 3GZAA 1MMFA 4Q4QA 1B57A 3MT1A 2FIQA 2YBUA 1BRLA 1Q8AA 3ABZA 3D6NA 1A4LA 3PJXA 2FYMA 3SADA 4XZ9A 2FQIA 3PUDA 2R1KA 3C61A 3UXAA 1R7OA 4UBPC 2CWNA 3SM0A 4LBSA 2XTKA 1BYCA 3IGUA 3S2NA 1HO4A 4S3KA 4W7UA 4H01A 2Y89A 2TAAA 1YE4A 2QGHA 5AVNA 2FFIA 5LGXA 1DE5A 2NQ5A 2VR5A 3HO8A 3WLHA 3W73A 4C6OA 1UG6A 3TTQA 4B90A 1IT8A 1R2RA 4US5D 6PTDA 3CLMA 1X7IA 3L4UA 3SCVA 1PHQA 1Q85A 1YIXA 4QG9A 1V93A 4FO4A 2B31A 2Y88A 1ONEA 1Q66A 1SJAA 1J9YA 5FF3A 2QJIA 1ADOA 3B0XA 2NUYA 4RZ6A 5D09A 4NNCA 3UXLA 4L1WA 5CH9A 2ZX5A 5H91A 3AMLA 4NVTA 4QJ4B 3VC6A 5T8GA 2PTDA 4JX5A 4LH8A 2RHGA 1ZU8A 2AGKA 4DBEA 1CI1A 5IDZA 3LQLA 1VENA 5A8NA 1UD6A 2Z2BA 4IH3A 1JL8A 2C8NA 5CJNA 3WUEA 3CXOA 2R24A 1TPC1 1N8FA 5CPNA 2ACSA 1XBYA 1FDJA 2DZBA 5CPLA 1J6OA 2X40A 3CT7A 1EO5A 2OSXA 2FGLA 3TW9A 4F0KA 3OGSA 2PA6A 1V03A 3OLGA 3RAOA 4N7QA 1ZUAX 2ZXAA 4F0MA 2CLLA 3Q65A 2BX7A 2F2HA 4FK9A 2Q8LA 2A6LA 1XFBA 4PRRA 1O6IA 1X97A 3UZJA 3LV6A 2WMFA 4KRUA 3BG5A 1I2PA 3R0UA 1B3OA 1I1WA 4HSHA 1LWJA 1R3YA 3N6JA 4IWWA 1VFTA 4IUGA 3LB0A 3C8NA 3M0XA 3KOZA 2V3GA 4IXHA 1EX1A 2X1RA 4N02A 4NZFA 4JL2A 1J5TA 3QKEA 1H62A 4ZGYA 1L6YA 1X1ZA 3WQ8A 3V4BA 3LU2A 1PDZA 3Q45A 3IJ6A 1FHVA 3U5UA 3TCSA 1JDEA 4XISA 1PS9A 1K9DA 3CWNA 1DJXA 4HU3A 4V15A 1PX3A 2TSYA 2J13A 1W9UA 1PEZA 4TQTA 3WKZA 3W7KA 2GLKA 2ALRA 2Y8UA 4BHYA 4E2VA 1BWLA 3M0MA 4I8YA 1CT5A 5K7JA 3QFWA 4ENLA 3VDAA 1OCNA 3KL0A 3AHVA 3QTPA 3SCSA 2XN0A 2VZSA 5CZSA 1RVKA 1LTDA 2UZ9A 2NXHA 3GIPA 4C1KA 3C3UA 1XYZA 3QN3A 4M8UA 3WK1A 3URNA 4P8XA 2VFDA 1IEXA 3J7HA 2R9RA 2ZX9A 3QZAA 1MVYA 4M6PA 1NDYA 1B90A 4QXIA 4QQ3A 4XZIA 3RRAA 5BXTA 4E5TA 3KVKA 2DW6A 4DUWA 3KBWA 3CK5A 3UG5A 1V7YA 1E9IA 1SO3A 1OT2A 4WR3A 4ZFMA 3UWWA 1CB2A 1TWIA 2ZBTA 2CERA 4OHQA 3WQDA 1W3IA 1TRDA 3LBMA 1FP8A 3BJFA 4BZYA 4OUEA 3FEMA 4GQBA 3PZ9A 2WC4A 4LV9A 2Y5EA 4QE5A 3OLEA 4L4MA 3VDCA 3H2EA 1A5AA 1ISXA 4ASTA 4AZIA 3EXTA 1K9FA 1FDYA 3MUY1 3ITOA 3W1UA 4C6MA 3TVAA 2ZZ3A 2BB0A 4H6EA 3VD7A 1VBUA 3MANA 3GVRA 2W5FA 3GNRA 5TQLA 1G0CA 2A1YA 1G9HA 2PGEA 3TN5A 2AQOA 2D2HA 2PI6A 1GORA 4E2DA 3VD4A 3NDZA 3Q2DA 4BF9A 3BLKA 1X6LA 3ZWTA 1NTHA 3KXQA 1JEZA 4PRWA 2XPKA 4F0SA 5C9UA 1NP0A 5TIMA 1C8VA 2CNCA 2HVOA 5HANA 4R7OA 4RDZA 3WELA 3WQVA 3UFYA 2I9EA 5A6BD 4H8UA 3NPVA 4XAGA 3TXZA 2QDGA 4CEUC 4UQBA 1K8YA 7TIMA 1I45A 1XSKA 3WH5A 1XS2A 4H6RA 1W3TA 1XFCA 3BANA 1VBJA 5IOBA 1B9BA 1YPIA 2AMXA 3WL1A 3B4YA 2TODA 1ZZMA 3EAUA 1RQEA 2F38A 1GUVA 1K8ZA 2F8QA 1PKYA 4FIRA 4G9PA 4LYQA 4IQLA 4Y2WA 4FF5A 4IP7A 1ITXA 1X98A 1WUFA 2BVYA 3MCMA 2XVGA 3HGRA 5JIWA 1GVQA 3W6YA 4HPHA 1O12A 1PYMA 4W9TA 4Q7IA 1LLWA 4IFRA 3G2GA 1V0KA 3AUJA 2E7FA 4ZTXA 1JPIA 4G5DA 4LC8A 4HJWA 1JZ6A 2WKJA 3M47A 2DSWA 3VNMA 4S3BA 1GW1A 2BGQA 1U1JA 5CPTA 5GNZA 1V6TA 5D4YA 4MB4A 4B5WA 4LVFA 2GUBA 4GRSA 3UR2A 3DFTA 4ZSUA 3DZ1A 5J04A 4XZLX 2JEPA 4MKVA 1K02A 3BL3A 3WEMA 3HQNA 3W0KA 1NAL1 3OZMA 3VE9A 4O8RA 1EXPA 2EG6A 1W17A 3EX4A 3POCA 3DESA 4PB4A 1V3JA 4O18A 1US0A 1FBAA 1V3IA 3W1QA 1IEVA 5XIAA 2DVXA 4HNLA 4GY7A 2QCNA 2QR6A 3TA6A 1EF3A 5F7UA 3G18A 4QCFA 4QEEA 2UY2A 4Y9PA 2WZMA 3S2CA 1JCJA 3TONA 5A95A 1BSIA 3GNDA 5F4SA 4EWND 4FX8A 1CPUA 3CB3A 4P8VA 2VOTA 4YYFA 4ICCX 4Q8PA 3U9IA 5M17A 4TX6A 1F05A 2WMIB 3V1PA 3M4HA 4ZO8A 4I9TA 3T4WA 2P76A 1DXIA 2GOKA 2IPJA 4H9YA 2CBJA 1WKEA 2WMKA 4GZIA 1JVNA 2C14A 3VK5A 2ZX8A 1F3EA 2I1OA 2Z2UA 3GU2A 1OT1A 3CUXA 3TR2A 5MKGA 1TREA 2PDLA 3QGVA 2C91A 2B7QA 4E38A 5A2BA 2EQDA 1ZAJA 2E3ZA 1JRCA 1AQMA 1XH1A 3O8AA 3K13A 1KFJA 4GXMA 4NU7A 4TIMA 1WDDA 2YCLA 1S3TC 2DT2A 4PYSA 3KTCA 3CIXA 3D3AA 4EF9A 2E68A 1VLIA 3I6RA 3MP3A 1OYAA 4HN4A 5JH1A 4S3GA 3WK0A 4K8GA 1BGGA 1GVOA 1RAKA 3T42A 3N2MA 1RCXB 4JQ2A 3BOXA 2ZDRA 5HK4A 4CN4A 4IL0A 1UR1A 3IWPA 3SO7A 2C18A 4W87A 5DT7A 4GJ1A 3AO0A 2PRLA 1QK0A 4D1JA 4PZVA 4V1XA 1Q7QA 5HJYA 2IQDA 2QF8A 1A47A 3R94A 3GW3A 3L2MA 4G56A 4E8GA 2FGBA 2NQ9A 4ATLA 2OQHA 3STGA 3LHUA 2J7GA 4QDWA 4LTSA 3R2GA 1B4KA 5I07A 3W7OA 4X2RA 1FWAC 4UMCA 1OFBA 3VNIA 3EWBX 3ZXWA 4OVXA 3ABQA 2QULA 4LAZA 5AVHA 5CSYA 4JFWA 1OEPA 2DVTA 4HTYA 3KWSA 3NQVA 3WLLA 3TU9A 1DJIA 2FPYA 3ECQA 5LNWA 4FALA 2PWGA 1P7TA 1OK6A 1WXZA 4DIAA 1UKOA 4CD7A 2XM1A 2EHHA 1HJXA 3OHIA 4D6IA 1OVDA 3TJ4A 7ODCA 2ZFAA 4ADUA 1VR6A 3VNZA 2BZNA 2VI0A 1CZ1A 5CBBA 1E43A 3G1RA 4IZGA 4GK8A 5FJRA 4BA0A 4MZ1A 1T8QA 3S9IA 1SJDA 4M82A 5CC6A 3CQIA 1ZP4A 4ORIA 4MY8A 1TTJA 3PZTA 1B0IA 1V0LA 2P53A 4WJ8A 1MW1A 4RXGA 3GC2A 5HJXA 1OFQA 4O1DA 2DVUA 2PE4A 1S5VA 2BOEX 1A80A 4FXRA 1KFBA 2GJXA 1G4PA 1XRFA 5AHIA 4M80A 1WQ5A 4GH3A 1KKRA 2NWSA 2B7PA 2W62A 3O1NA 1VBGA 3VU2A 3ZZ1A 2ZOXA 1UYQA 5M03A 2G50A 3FV9A 3VXGA 4IIFA 4AWSA 3HV9A 4NRRA 4CNOA 4QIUA 3NQ7A 3SCOA 4DJEC 3B4UA 2ZRYA 1EPVA 4DI9A 4IJRA 2QUVA 1RA0A 2JE8A 4Z0SA 1ZALA 4I7VA 1O66A 2VD9A 4UTWC 3GS6A 3WLNA 4YTQA 5E6YA 2P0OA 3JW7A 4W5ZA 3WO8A 3EOOA 4PUUA 3WJXA 1U30A 1US3A 1BG9A 1I2OA 1K6AA 2V68A 2BODX 5RUBA 2POTA 2UY3A 1TCDA 4HHLA 1JPMA 4M3PA 4TVCA 4EE9A 1ZBCA 5JUVA 4WXYA 2WMHA 3CQHA 1KM2A 3LNPA 1PUDA 3VM5A 4M56A 8A3HA 2NT1A 2HISA 2YXGA 1EC8A 2ISFA 2NZLA 4GHRA 3WF3A 4Q33A 1R86A 1VYRA 2CBVA 1LUCA 3BZGA 2QF7A 3IJ7A 4GX8A 3P0XA 1GVEA 1GKRA 3QOKA 4H7VA 1FH8A 3HG4A 3A5FA 1PV8A 3BSMA 4FA3A 4GYJA 3T44A 1YDOA 3FLUA 4H1ZA 1PWLA 2PPGA 1ALDA 1TPWA 2CKRA 1UW9A 1XQKA 3VA8A 5CGMA 2ADAA 2VJXA 3G3DA 4A22A 3ARQA 1V8EA 1EKOA 1O60A 3VD9A 3QH2A 2G0WA 4J2MA 3EMQA 1B3WA 5EY5A 2ICSA 3W2LA 3WH9A 3ZJKA 5A6JA 1ODZA 4LUIA 2VDIA 5HDRA 4BQ4A 3D0CA 3PPHA 1GEHA 3NZPA 5HQMA 4XV0A 2UBPC 2ZUWA 2NV1A 4AHPA 1GVRA 3K46A 1EO7A 3G1VA 1IWPA 1T96A 3TWBA 1YHTA 1N8WA 3LGGA 6REQB 3QM3A 4LUSA 2DT0A 2BDQA 4UNKA 1PL9A 3A4XA 1VHCA 4C6QA 3NAVA 1ELSA 5LSMA 3AISA 2XWEA 4TO8A 3QV9A 2P8BA 2PTXA 4WZHA 4IFKB 1FP9A 3C2RA 2WMGA 4TX9A 4X0NA 3NR0A 1ISWA 3TN6A 3TTYA 3NM1A 4KFNA 1QNQA 1WE5A 2HEJA 1WKFA 3FDGA 3CYJA 4I6VA 5DBUA 3I7SA 4HN8A 3HM7A 4PMQA 2INEA 3W7MA 3ZLGA 4JNZA 4WQ6A 4AZHA 3H12A 4JNYA 1J18A 4FNQA 1W0MA 3WJZA 4FZIA 3E5PA 1CXKA 4DVOA 1KKOA 3ZFHA 4ZFCA 3ARSA 1UZDA 4QS6A 1XR2A 4U4MA 1GHRA 1LBFA 2ONEA 4EPBC 3JUGA 4MM1A 4LANA 3E1F1 3AC0A 3BE7A 1XIMA 2WLYA 2WYSA 5I06A 2H8XA 4WEVX 5IFTA 3W1MA 4PC8A 1OZQA 2P50A 3T0CA 3S9YA 1X8FA 1XPYA 2W63A 1W5MA 1VD6A 3LQGA 3LZ5A 1M7XA 3MPGA 5C70A 1P7TB 5HULA 3TQVA 4OE7A 1W1PA 4BF5A 1HP4A 2XGZA 1OB0A 2D20A 5HNUA 1LJYA 3PPCA 4MDPA 2WMIA 3WDHA 1GOKA 1MSSA 2X0SA 4UUIA 3OJGA 4BQ5A 2A5HA 4D1IA 4FEZA 3UJFA 4HOXA 4IP4A 3S0CA 4QBXA 3TROA 3CO8A 1H7WA 3LCGA 1D3HA 2Y7FA 3PJUA 3B40A 3DC8A 2NQHA 2R14A 5FJPA 4ZSTA 4ROQA 2XIQA 3VI2A 2G3MA 1XYMA 3MY9A 3VM7A 3MTWA 2ATMA 2INZA 2GSHA 5LKYA 4ZOEA 1XRVA 5AECA 3GNXA 4UQDA 3FXYA 3AQUA 1M1BA 3RJYA 1EH9A 2IQ0A 1IZCA 5FD0A 1DHPA 4TXEA 1VPXA 3RFAA 2VRKA