2ZFAA

Structure of lactate oxidase at ph4.5 from aerococcus viridans
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
367
structure length
352
Chain Sequence
YNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRDFGMPIVQRYLRGTAEYGASKQKISPRDIEEIAGHSGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of Aerococcus viridans lactate oxidase and its complex with D-lactate at pH 4.5 show an alpha-hydroxyacid oxidation mechanism
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
molecule keywords Lactate oxidase
total genus 128
structure length 352
sequence length 367
chains with identical sequence B
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zfaA00
1YLVA 3C52A 5CG7A 5FESA 4O15A 3HG2A 2TSYA 5CPOA 3EEGA 5C54A 3LRKA 3KRSA 4JXCA 1EUAA 4PL2A 2DORA 3W7EA 2OJPA 1VS1A 1K7XA 3C56A 3K30A 4NU7A 4KFPA 4KFOA 4PODA 4RK8A 4PL1A 2NUYA 3SZ8A 4X22A 1JCYA 4HSNA 1OABA 1KM5A 2WSYA 3ZR4A 4JIPA 2YDAA 3QYQA 1ZAHA 1KW1A 2TPSA 3HGOA 4AVFA 4AH7A 4WXZA 1NFBA 2A7RA 4BR1A 3R13A 4GUGA 3W73A 2PCQA 2NXHA 4GXMA 1FWRA 2HSAA 1G4PA 1JCXA 1YXCA 4YXGA 2XN1A 3MW7A 4QAIA 3TK7A 4MOZA 4OT7A 3TFCA 3S8HA 2E77A 4S2CA 4Z08A 4U28A 3TUUA 4JEQA 5D09A 4FF7A 4JIQA 4RXGA 3ZS4A 1AL8A 3W2MA 1QPNA 2VFFA 3R12A 5HJLA 3LHYA 1L9WA 2DZSA 1L6WA 2QCHA 1G67A 3LCLA 4N6EA 4CQ8A 2W0UA 4HPXA 5FF0A 3GAYA 1SO6A 4AWUA 1OVDA 2E68A 2J27A 2ZQ0A 2Y6ZA 1H1YA 3R5EA 3UWYA 4JY9A 3FOKA 1O4UA 1PCKA 1N7KA 3PVFA 4QQ3A 3EWYA 4O10A 1ICSA 2ZFAA 3DAQA 4YLWA 3SGZA 4FIQA 3THQA 5TBOA 4OV4A 2VFGA 2O7SA 1KM3A 4LC6A 3M44A 1SSDA 2JGYA 2A1YA 3EX3A 1LBMA 3L0GA 3NA8A 1A53A 5HR7A 3M5ZA 3BW3A 1YTDA 2V2CA 5DCEA 1LROA 3ABOA 3O6DA 4K8EA 1EUNA 3NPWA 3G1HA 2CLLA 3UY7A 3BPWA 5K3VA 3P8JA 1DV7A 2F7FA 3UNDA 4AHPA 3W7GA 3A5VA 1GTHA 3B04A 4FX8A 5DLCA 1H7NA 2W6RA 4WX2A 3P8IA 4ONVA 1ZY9A 5A5WA 4MPQA 5CGQA 3I6RA 3HPXA 3HMJG 5LNUA 1B4EA 4Z0JA 3W2KA 4O8RA 3MWAA 4E2DA 1LOLA 1SFJA 2RHGA 2X16A 3YPIA 1JCJA 2H3BA 3T4CA 5CPNA 3C2RA 2NZLA 4NXSA 4DBEA 4JS3A 4NT0A 1FDZA 1VCGA 2A4AA 3CU2A 1KLYA 5D03A 3F1QA 1G6CA 3WJXA 2ZZ3A 2CU0A 2HMCA 2NX1A 5D04C 3I65A 1C29A 3TSMA 1TPUA 3L5AA 5U4NA 4MUZA 3KRZA 3R89A 1UJPA 5AHFA 3KVLA 3QM3A 5K9CA 2J24A 3L0KA 2Q3RA 5T26A 3OG3A 2B7NA 3W83A 4UTUA 4S2BA 1G69A 1W1ZA 1O5KA 1FUYA 4NNCA 3LXCA 5LGXA 2QCCA 4UFMA 2VFHA 4LV9A 1JCNA 2NX3A 3STEA 4AHQA 4XUGA 3GDLA 1H61A 2Q8ZA 2CLEA 1LLWA 2QCLA 1KV8A 3F03K 3R2GA 1K8YA 4OE7A 1J2WA 1RD5A 2EF9A 4RCXA 4Y90A 4UMAA 1TRDA 3HO8A 4JTSA 2ALDA 4O4WA 4ADTA 1HL2A 1WXJA 3MHUA 3QMSA 3B05A 4M19A 3U2OA 1NF7A 3C6CA 1MEWA 1F7BA 2NV2A 4CCDA 1TV7A 4XTIA 3W85A 4ML9A 4RZ4A 5DN1A 3CTLA 2WSQA 3T40A 1N55A 2V81A 1KA9F 2Z1BA 3MMTA 3N19B 3VNDA 2Q3OA 1KBIA 1AW1A 4M7SA 3TIMA 3LI1A 1VCVA 1W8SA 3HOJA 4Q4KA 5DY2A 2B7OA 3W1RA 4IX2A 1XKYA 3GR8A 3B06A 2P1FA 1PL9A 2ZRWA 2DU2A 1S5WA 4YL2A 4YMZA 3QEZA 5FEPA 1UUMA 4JNMA 4IJBA 1SSGA 5K7JA 1GYNA 4UMBA 5AC6A 3BLEA 5MHBA 2WO5A 2Y70A 4DPQA 1GVOA 3PR2A 1XBXA 3G1YA 2YW3A 1GJPA 4UTTA 1R2RA 3QPYA 4IMFA 3PB2A 5AOUA 3W6YA 5AC8A 4E2BA 3JR2A 3Q2DA 1RPXA 3NQEA 1X1ZA 1I2OA 3P5YA 3HIJA 2ZA2A 4HT3A 3W07A 4XZ9A 1TPB1 3DI0A 4HHPA 5BRBA 4NXKA 1I2QA 3G8EA 1KTBA 1M5WA 4O1BA 3TH6A 3LGEA 4LVDA 3LHZA 2ZRVA 2OCZA 1HO1A 2HTMA 1TSIA 2YXGA 1JUBA 2GVGA 1M7OA 3HG4A 4ALDA 2NWSA 3NG3A 2ZZ7A 1IXPA 2BSLA 2X1SA 3PSWA 1BWKA 3KHJA 3G0XA 3IVSA 2Z2UA 2ZZ6A 3TNOA 3LXAA 4MZYA 4GUFA 3FKKA 2C6QA 3N2XA 2V9DA 3L68A 2CFFA 2OT0A 1XC4A 2TMDA 4IWWA 5LNWA 2G5WA 4HPJA 4IMCA 3IIXA 3TROA 1VJIA 4R7JA 4EOUA 4Y6GA 1FY6A 4LWWA 2FPVA 4TMBA 3Q37A 1ZNNA 1MO0A 1Q6QA 4PH6A 4O18A 4RXFA 3MI3A 1TPWA 1CW2A 3M6YA 2KZHA 3MP3A 3OBKA 4Z1CA 1ME9A 3TAOA 1VHCA 3KOFA 2P10A 1OFEA 2A6NA 5F4XA 4CQ9A 3EWXA 3SGUA 2R14A 4MJMA 4N2YA 1F73A 3O63A 5DBUA 5AHLA 1YTKA 4N9CA 4UUIA 2ZBTA 5TIMA 2RDWA 3GDRA 1F6PA 1R2TA 4Z1DA 2G96A 3W23A 4MZ1A 3V1PA 1O60A 2NV1A 3NR0A 1SR9A 3BW2A 2ABBA 3FFSA 1K8ZA 2XFWA 2VKZG 2FLIA 4KKXA 4UTKA 4RZ6A 3TQVA 2CZFA 4DO4A 2JKEA 3P67A 2QCMA 3DFTA 2NX9A 4JYFA 1YTEA 3NNTA 3S1WA 3DFNA 2C3ZA 2QDHA 4H3DA 3WK1A 1Q6OA 3MYOA 1AW5A 1ICPA 2FTPA 3O6YX 2PC4A 3E49A 1J4EA 4O16A 3UPWA 4W9TA 1LOQA 2WQPA 4JDYA 3TKFA 2CW6A 3TSBA 4E38A 2QAFA 3NPUA 3NL2A 3CEUA 3M9YA 4LT9A 4BFAA 2VXNA 4GBUA 4UR8A 4CCCA 4QJ1A 2A0NA 1JCLA 3M5YA 4M6PA 1GYLA 4NNAA 1OF8A 2QJGA 5LZLA 3QMRA 5FEWA 2YZRA 1IXOA 3BO9A 2JGQA 2V30A 4NJJA 3NAVA 2A6LA 4DF0A 1W3TA 5CKSA 3NEVA 5HWJA 1M6JA 3U6WA 3QSTA 2BZNA 1KTCA 2GJNA 3W1NA 4JYDA 4HN4A 1Z44A 2G95A 3ATYA 3ELFA 1CI1A 4Q32A 4O17A 2YR1A 1SFLA 5D2WA 1DHPA 1FWNA 2OMAA 5CZ0A 2RKXA 4CCEA 2YPIA 1X6UA 2NXIA 1B4KA 3UYCA 3DKJA 3EXTA 2C18A 3W7CA 4JDBA 2E6AA 2XN0A 2WJZA 1OX6A 2V2DA 1LM1A 1TPDA 7TIMA 2QCFA 1XUZA 3JRKA 2GJLA 1A5SA 3C4UA 5HWNA 4O4VA 4N4PA 1G4EA 2TYSA 1UCWA 2VEPA 3L0NA 4QISA 4DO6A 1ZAJA 3STCA 1WX0A 3UWWA 3GKFA 2QCGA 4MFDA 2C14A 3FA5A 1WOAA 1W5PA 2ISSA 3M5XA 3PWAA 5HUPA 2BLEA 2ZZ5A 4BF9A 4QNEA 1KLZA 1O94A 3M16A 3LCWA 4UTJA 3C8FA 3PB0A 2RH9A 3E02A 1RVGA 5HNRA 1SQ7A 3T44A 1DJQA 4IX0A 3UWQA 4CNNA 3UXAA 1TQJA 5EA9A 5EPDA 3RMJA 3NQ7A 1P4CA 1ZJIA 3I7SA 4KWVA 1H7WA 3IIVA 3A24A 5KZMA 4RV8A 4UFLA 4UFKA 1I8JA 3T55A 5HR6A 1AL7A 1K7EA 1ONRA 4FX7A 1MSSA 2R8WA 3EXRA 4BWLC 3WJWA 4IUOA 4B5NA 4TO8A 5F4WA 4N9EA 1GT8A 3FIGA 1MZHA 1UASA 5HUOA 1TTQA 5BMWA 2I1OA 4LS0A 4EIVA 3G24A 2YW4A 3L5LA 3O1NA 4QIUA 5HMSA 4WOZA 3MBFA 3FYOA 2GUUA 3EKLA 4BI7A 4N4QA 3E12A 4L4MA 1W5NA 1SO4A 1D3GA 4BI5A 3BLIA 1QOPA 1XI3A 3S5NA 3RU6A 1QPQA 1FDJA 1XBYA 4O28A 3OHIA 1EP2A 4MFEA 4K7YA 2ATMA 3CWOX 1B3OA 1LCOA 1W3NA 3STGA 2YSWA 3UWZA 3W1AA 1M7PA 1AMKA 5AYXA 1OFOA 1I45A 3CPRA 6TIMA 4I7WA 3W22A 1XFBA 5CPMA 2ZDRA 2J9YA 3W7DA 3MBDA 4UTLA 2JKAA 3G18A 4O53A 1NEYA 5EY5A 1PIIA 1BEUA 3M41A 2WNQA 2YYUA 4LVFA 2IQTA 4CNPA 3W1TA 5J5DA 1PHQA 5IBXC 3UWUA 3WK3A 2H3DA 4ADSA 1B57A 1SW3A 3ANYA 1ICQA 3UWVA 4O12A 1SZFA 1SUXA 3TFXA 1H1ZA 2Z0IA 3P5ZA 4P61A 4FXSA 3PM6A 4A2RA 1KTNA 1JCMP 2GQ9A 1SW7A 3HQ1A 1IIGA 3B0PA 4O0ZA 1EIXA 1KM2A 4DF2A 2NUXA 2NLIA 1F76A 4L4LA 3CIWA 3M43A 3USBA 4H6KA 2E09A 3GXPA 4XQ6A 5D05A 1PE1A 3E9AA 4DPPA 2VOMA 3IIPA 3G0SA 3LLDA 5KSWA 1LBLA 3OEXA 4FNUA 3U8GA 4UFHA 1IF2A 4IMGA 2C0AA 2UV8G 2B7PA 4NZJA 4EWND 1OFQA 2VFEA 1Q3NA 5D32A 4DEFA 3N14A 4UCGA 3NL6A 4LU0A 4MIMA 5ABTA 4O1CA 3ABSA 4FIRA 2VEMA 4X2RA 5K4XA 3PBYA 5FF2A 3NPXA 4IMEA 1QO2A 1I2PA 3AO0A 4AB4A 4HNTA 3HB9A 4M5PA 3W1MA 3BG9A 4O57A 1TV5A 3DKLA 3BG5A 1VCFA 3NPVA 1EX5A 5TQLA 4LW7A 3INPA 5D2YA 3UZJA 4ZZ9A 5HQEA 4PC8A 5DBTA 5I3IA 3AJXA 5I3JA 3M0ZA 3T7VA 4IXXA 2FPTA 4AHOA 1DORA 5KITA 2C19A 3TC6A 3GXNA 3IGSA 1TJRA 4AF0A 4UTWC 1JUEA 3H53A 3KVJA 2YYTA 3HG3A 3OVPA 1TPFA 4JX5A 3C2OA 1R47A 4A21A 5LKYA 3DENA 1YDNA 2RFGA 1G7UA 1VZWA 3SI9A 3W2UA 4CNOA 4WD0A 3GAKA 5D02A 1FCUA 2BX7A 4IGHA 3E96A 1OYCA 3EKZA 2QCDA 5F2MA 3WFAA 3EXSA 3LXBA 4WXYA 3W7HA 5KTLA 6ALDA 1DKWA 1GOXA 1R2SA 2GQ8A 3EWBX 3GVGA 4QNWA 4WJEA 5DXXA 4FNTA 4JR5A 3W71A 3C2VA 3S0CA 3S1VA 5C5YA 1QWGA 4BI6A 5IM51 2I14A 3G1DA 1TJPA 3TSDA 4RX0A 3SSJA 4FNSA 1JQXA 3W7IA 1FQ0A 2J88A 1ML1A 2PRLA 3L66A 3N9SA 3KVMA 1ZHAA 5AN7A 3S6DA 1BTMA 4AF0B 1S5VA 1OFBA 4GFSA 3PS7A 2WPBA 1SO5A 3UQNA 4R34A 4GC4A 2ZRUA 2DJLA 4X9SA 1OK4A 5AFDA 2V5BA 1R46A 1K03A 1QR7A 3SECA 3DZ1A 3LCGA 3NQ6A 4QSHA 4HSOA 5LGZA 3TCEA 3GDKA 4A22A 4DBDA 1F5ZA 3NQ2A 5U7SA 5L6UA 5EBUA 1UBSA 3G3DA 2CLHA 2C16A 3PAJA 4UTMA 4MY9A 1BWLA 3LTPA 3NO5A 3P81A 1F6KA 1TREA 1GVRA 3LBCA 1FCVA 1VYSX 3QC3A 4LUIA 2FB2A 3HG5A 3Q94A 2GVLA 2B0MA 5HULA 2Z6IA 4JTIA 1RR2A 2E5BA 2HS6A 2X1UA 1C8VA 3DFQA 3LRMA 3LV5A 4Z1AA 1KM1A 1SZEA 3GNNA 4PCFA 3W72A 4A3UA 1PCWA 3QSRA 4QITA 1GEQA 4ZQNA 5I3KA 5GVJA 3RF9A 2QAPA 3OVRA 3TV8A 3S5YA 3C2FA 3D0CA 2BXVA 2VC6A 4LS2A 4O1DA 1ZAIA 4ZMGA 3IVUA 1NF0A 2PURA 1GG0A 3TAKA 3S5OA 3HGJA 1E51A 2LLEA 3NQDA 5DCBA 1TV8A 4I7UA 1G4TA 3NZRA 1FBAA 1W5QA 1WV2A 3EX2A 3TE9A 1JUKA 1W54A 1DQXA 1DOSA 4O54A 4K8HA 5AB3A 2F84A 3CB8A 1IXNA 1NAL1 1NSJA 4DF1A 3WK2A 3W86A 3EX6A 3EWUA 3PF3A 4UTIA 3P82A 5SWUA 4JTLA 2V82A 4IPJA 3IIOA 1C9DA 3PBWA 2NXGA 3DH7A 5KZDA 4U4MA 3GYEA 2Y63A 2H8ZA 2Y7DA 3NQ8A 3VE9A 2X30A 4RZ5A 3GR7A 1UUOA 1XBVA 1WDWA 5EKYA 4MY8A 1TPH1 3EWZA 1V5XA 2VEKA 1H60A 1WBHA 3BG3A 1H50A 4OGZA 5F2GA 4M7TA 1YPFA 4GRSA 4UTTC 1W5MA 3NGJA 2C1HA 3RK8A 1XUUA 2AGKA 4K6AA 2ZA1A 4UFIA 4HNNA 2CLKA 3UZ5A 3ZWSA 1I4NA 4M6VA 3TW7A 2RDTA 1TPEA 4RLIA 5BW6A 4NJGA 1DL3A 1D3HA 3G3MA 3W9ZA 2Y7GA 4C1LA 3W7JA 4WZHA 2WOQA 2DZVA 5CSRA 3N34A 5CZJA 5AHNA 3SIZA 1P0KA 2EGZA 4GJ1A 2V2HA 1XDMA 1ZALA 4FNRA 3BLFA 3G1XA 1R30A 3EB2A 4DQWA 2XN2A 1H7PA 1VYPX 5G2IA 3LHUA 1JQVA 1ADOA 3CEPA 1OFDA 1XDLA 2YX0A 4AWSA 1X8FA 2O7QA 3IGXA 4ORMA 4WUIA 2QJIA 2YFNA 3LCHA 4RR4A 5BNKA 1FXQA 3M1ZA 1K02A 3WK0A 1RQHA 3BVJA 4A29A 4OV9A 4LVAA 2CLMA 1UB3A 1WA3A 3W84A 1KFBA 4JX4A 3G22A 1QOQA 4ZQOA 5G1YA 3S9YA 1WQ5A 5G4WA 3PSVA 1A50A 3S5ZA 1OX5A 1VR6A 3GX9A 4K7VA 1SU5A 5I3HA 4PTNA 1QFEA 3LRLA 2X1TA 4UTHA 2EHHA 1VLWA 1O5XA 3BGJA 3LLFA 3QW3A 1EP1A 3NXFA 5CZTA 1DBTA 3CT7A 4NX0A 4MVAA 1Q6LA 1F74A 1OHLA 3H55A 2A21A 2VEIA 3VKJA 3QQ1A 1GVFA 5EMUA 3W74A 1LRQA 3HF3A 3MP5A 2CZEA 1FXPA 1XCFA 3LHTA 5FI8A 1GZGA 1SZGA 1BKSA 2DJXA 1I2NA 2EPHA 2ISWA 3SFKA 4JTFA 4XBSA 1LOSA 1QNVA 1N8FA 3N3MA 3BW4A 5FF7A 1LZOA 3HPSA 1TO3A 5AYZA 3VI2A 1EB3A 3STFA 3EWWA 1QCWA 1YYAA 2QUVA 4MYXA 2CZDA 3P84A 4JTHA 2FQIA 4WQ6A 5E1QA 4CLMA 4QM1A 1KBJA 3KVKA 4R33A 1LP6A 1W56A 2YGYA 1TPC1 1QMLA 3P62A 5LHEA 3S42A 1ZENA 1RZMA 1OX4A 4N9DA 2C13A 4NNBA 1ME7A 3L65A 2DZPA 3DFPA 1GQNA 1LORA 4ICNA 1AK5A 1W3IA 2E6FA 2A2IA 4JX6A 3TU9A 1T0OA 2ZRYA 2TRSA 1W37A 2YFOA 3W7LA 3LTYA 4N9BA 4JTEA 4K37A 4LC8A 3W7PA 2NWRA 4XKYA 1KV5A 5AYYA 3IGUA 1H5YA 3G0UA 4HKPA 5H91A 2WNNA 4OU1A 3LHWA 4G1KA 3TMQA 2W79A 3TJLA 3KRUA 5D33A 1WYIA 1GVQA 1GTEA 4Y96A 2OT1A 5G2WA 5G2HA 3EX1A 1VRDA 1OFRA 3E0IA 1FCBA 1KM6A 2G97A 3W1XA 1EWDA 3CIXA 4JTGA 5F2IA 5CZSA 4PFMA 5KZEA 2GQAA 1W0MA 5C6MA 1Q45A 3CWNA 5AHIA 1I2RA 4KFNA 2CZ5A 3TX9A 4YWIA 1W31A 3HGSA 2FB3A 1ZFJA 5G4EA 5C55A 3TQ0A 3I7QA 3NDOA 3T78A 3MI2A 3PC0A 1EEPA 4S1FA 3MP4A 3PBUA 4C1KA 2ZTKA 1SO3A 2QUUA 3C0JA 3EX4A 4RJEA 4IOTA 3NYZA 3ZWTA 4ZVJA 4LOCA 3A23A 1YDVA 5DY3A 4FNPA 2Y62A 4JTUA 2CWNA 3MO7A 4GNJA 3ABRA 1QPOA 1H62A 3FS2A 1NVMA 1JRCA 3IIZA 4UIOA 3C61A 1L6SA 3TXZA 3PBVA 4NJKA 3QMTA 1P1XA 3GB6A 4IPIA 4WY0F 3CM4A 5BMXA 1A5CA 3W2NA 4UNLA 1MEIA 3N2MA 3NQMA 3LM7A 3R8RA 2ATSA 3TQKA 3PUDA 2VENA 2A85A 1TIMA 2QEZA 1KFJA 5BOOA 3LOTA 1PVNA 2Y61A 3O15A 4JGDA 4OHQA 3QW4B 3P61A 3TXVA 4XBKA 3TR2A 1J5TA 4CQAA 1RQEA 3I7RA 1TQXA 2P0OA 4Y9AA 3O6CA 4JN6A 3S1XA 4P2VA 1TCDA 3A5FA 4AWTA 1VQTA 5DCDA 2C15A 1X7FA 5D2XA 2EAWA 2V8ZA 2RDUA 3QJAA 3P80A 1WOBA 3CQ0A 4DXVA 2V0TA 2A5HA 4TMCA 3NM3A 4NUWA 3PUEA 3ZFHA 4AEOA 4IQLA 3FLUA 3MYPA 3DHDA 3DU0A 3VE7A 1TTPA 2PRMA 3CC1A 4RKAA 3QRHA 4JD4A 1FWSA 5LSMA 2JKPA 1QAPA 2E5CA 3W76A 3V75A 4GUHA 2A7PA 1OFPA 4JYEA 5A8GA 2DP3A 3LERA 1JJKA 5K2ZA 4UR7A 5K9XA 3S1UA 1U5JA 2X1RA 3B03A 2Y7FA 3NOEA 3WJYA 4MJZA 1H7OA 3RFAA 4O50A 1LYXA 3W7OA 1Z42A 3BGGA 3G8RA 1OF6A 3LHVA 4YCOA 4NJIA 2QCEA 4K38A 4O13A 4XWUA 1PHWA 1PV8A 5H2ZA 1QDSA 1D9EA 3GKAA 4LUJA 3GLCA 5AHMA 3NQCA 1T99A 5KMYA 4TX9A 2AQWA 1HUVA 3G1VA 1YXYA 1G7VA 4LV4A 1CX9A 2FJKA 2Y85A 1LBFA 2QKFA 4E0CA 4MKNA 3VFLA 1THFD 4ZQPA 5K9DA 4GUJA 3TJXA 4HNVA 1OFAA 4FNQA 1HTIA 3W70A 3L67A 1TMHA 4O0KA 3W2LA 3OA3A 2ZCGA 4ZQRA 1G4SA 3LI0A 4GWEA 4LVBA 3O8AA 4MY1A 5LNRA 3QF0A 4XTDA 2VELA 4GE8A 4NJHA 3W7RA 2FIQA 3SY5A 1FWWA 2FPYA 4NZFA 3HGRA 3TC7A 3LTSA 1RQBA 4J9JA 4UFJA 2E5DA 1L6YA 3W2JA 3B8DA 3N73A 3PG8A 1HFBA 3IRDA 4IMDA 3L21A 1B9BA 2QJHA 1RV8A 3CHVA 4PA8A 1U83A 3FKRA 2HS8A 5F1VA 3GDTA 1H7RA 3GXTA 1WAUA 3W7NA 5KINA 4MLRA 3BV4A 3F4NA 1A5AA 4Z0SA 1KM0A 1Z48A 5D38A 4Z1BA 3DFSA 1FX6A 2J9ZA 1SZNA 4HIBA 1ME8A 3LCIA 3W7KA 2E6YA 3LX9A 4R53A 3B4UA 1JULA 3HJZA 2CLIA 4M6QA 2ZTJA 3RNDA 3WJSA 1YADA 1LRNA 4O19A 4TIMA 3BARA 3W1UA 1JVNA 3PUOA 4TU1A 2E6DA 3KX6A 1KFEA 2FDSA 3LCXA 3TA6A 1MEHA 1QO5A 4I9AA 1Y0EA 2DZXA 3QFEA 3QH2A 2H90A 5E93A 1IIHA 3RLUA 3GK0A 3QZEA 4XKYB 3L2IA 2QCDB 1Q6RA 3PY2A 3KFTA 4LVGA 1IXQA 1H51A 4ORIA 2WNZA 4LNYA 1P0NA 3LBMA 3M7WA 2J6XA 2OZ0A 3L5MA 4K36A 2PE4A 1KFCA 1XL9A 3NM1A 3UPBA 3NZ1A 3W75A 2QR6A 5L9FA 4WOQA 1W5OA 4N02A 1L2UA 2B7QA 3MI6A 1OYBA 1IGSA 4EF8A 4JICA 5FEXA 1VGAA 1QPRA 1K8XA 1DVJA 4UMCA 4FHAA 4KWWA 3MUXA 3QQ0A 3UD6A 1LLZA 4PEKA 4FO4A 4BWLA 3G1SA 2A7NA 3I68A 1YPIA 2CLOA 4DO5A 1TTJA 2H8XA 1XBZA 1T96A 4EF9A 3DBPA 3KXQA 4O52A 3W87A 1DQWA 3LDVA 3PULA 4JTKA 2Q8LA 5LNVA 1XXXA 2R91A 3GNDA 2BWGA 3CLMA 3OVQA 1KM4A 3UXDA 3JS3A 4FXRA 1FWTA 5C2XA 1EA0A 5DELA 1ZCOA 3O05A 3HBLA 3W1LA 4LTSA 2J9XA 1GWJA 2ISVA 1TTIA 2VFDA 4LS1A 4POCA 1TYGA 3B0UX 2EKCA 4N6FA 4NX5A 1FCQA 5D2VA 2Z6JA 2BTMA 3NQGA 3TDFA 1YDOA 1LDCA 1KFLA 3NL3A 4MZ8A 1A5BA 3GIYA 5K4ZA 2QDGA 4MYAA 2PRHA 4LRSA 1WBJA 1VHNA 2Y89A 3THAA 3IVTA 2ZRZA 1VLIA 1HG3A 4AMAA 1O95A 4O1AA 1Z41A 3W7QA 4I7VA 1SW0A 4O14A 2QUTA 2R94A 1ALDA 3NQVA 1VH7A 4YCPA 2CLFA 1AW2A 5F2LA 2JBMA 3P74A 1OG0A 5FEZA 5IBXA 3IV3A 3ABQA 5D37A 3MHFA 3W88A 4OQVA 4FB7A 2ZYFA 3FJLA 5HWMA 3NQAA 2ZRXA 3GDMA 1T8XA 2JK2A 3O06A 4Q33A 1OJXA 2WSRA 2ABAA 2V5LA 3UY8A 3HPZA 1S3HA 4UTWA 4JTJA 4LY8A 5D2TA 2I9EA 2H6RA 4DELA 1OX4B 2ZZ2A 3GZ3A 3NQFA 3SR7A 3BK0A 1VYRA 3RLVA 3M5VA 1OYAA 1AG1O 3IEBA 3W3OA 4UC5A 2NUWA 5EL1A 4H4IA 5DXYA 3A22A 5I3GA 4AAJA 4LRTA 1VPXA 5HINA 1MXSA 1K7FA 1TPVA 1TB3A 2ZZ4A 3VCRA 4NQ1A 1GPWA 1P5BA 3PG9A 2WV8A 3QPZA 4WY0A 1EPXA 2VFIA 3C3NA 4WY0B 3DHFA 3A9IA 5D30A 4ADUA 3FEMA 5AHEA 5CSSA 3W1PA 5CPLA 4JTTA 1SPQA 4MLJA 2ZZ1A 3DXIA 2DZWA 1JRBA 2AAMA 3O07A 2QF7A 3TW6A 1FDYA 4UXDA 1HO4A 3LV6A 3FJ6A 1S5TA 5G1TA 3B0VC 2FFCA 1EP3A 3DI1A 3KAOA 3NVTA 5LNSA 4JY8A 4AXKA 5G5IA 3SW6A 3W7MA 4OBTA 3L9CA 3SJ3A 4D2JA 3LCFA 5FF3A 4OWGA 1PS9A 1F05A 4ZL1A 3G1FA 2GOUA 3ATZA 5J5RA 4BK9A 3P7YA 2WKJA 1DJNA 2YCEA 4ZQMA 5EYWA 3DGRA 5F1UA 3O16A 5FF4A 3F4WA 1V7YA 4UNKA 1GG1A 1XM3A 2B4GA 1YXDA 1KFKA 3N9RA 4A2SA 5F4SA 3MHGA 2Y88A 4IXHA 3DFOA 2DZTA 1F2JA 2GPTA 3H54A 4X3ZA 1X1OA 5I3FA 1JR1A 3G1AA 1VC4A 2D73A 5LHFA 3WJZA 4EVZA 3MJYA 2GVJA 3C2EA 1H7XA 3Q58A 2OX1A 4Y8FA 4ZQCA 2Y7EA 3W1QA 3M47A 4FEZA 4O11A 2ZA3A 3P60A 1EWEA 3TMLA 2QCNA 1TRIA 4FX6M 1H63A 2E1DA 8TIMA 1GVSA 3LB0A 4NVTA 4HNUA 3OIXA 5E0KA 4TR9A 4GUIA 1LTDA 3NL5A 2DZUA 2X2GA 3A21A 4K39A 5AC7A 1K3UA 3FYPA 1OK6A 1LRTA
chains in the Genus database with same CATH superfamily
1LWJA 1KGXA 2HK1A 1YLVA 3C52A 3TN5A 5FESA 5CPOA 5DT5A 5EMYA 3OW1A 1XG3A 2XGBA 5C54A 1ZGDA 3KRSA 2IS7A 1EUAA 2L5HA 2WJFA 5HNUA 3K4DA 4A3RA 1XR2A 2OJPA 1VS1A 4RPQA 4BKNA 4KFPA 4CCZA 3I4EA 3COTA 3BZJA 1JCYA 4WVXA 1DIKA 4XO6A 3SCNA 1KM5A 2YDAA 1PX8A 3GY1A 3HGOA 4A8IA 4AVFA 3L2MA 4W86A 4AH7A 2TAAA 3TYZA 1X8CA 4YVXA 2G4FA 2Y2WA 3F4DA 1H0GA 4XIAA 2W5FA 2A7RA 1CEOA 2O4MA 4BR1A 1UUQA 4GUGA 3I6TA 4IP4A 3V4BA 4GXMA 5BXTA 1CGYA 3MW7A 4HYRA 3TK7A 1Z89A 3S8HA 4AW7A 1A5KC 3QR0A 4K1WA 4JEQA 3WNPA 4JIQA 4H8VA 2XHYA 4L9XA 3WBYA 1WKDA 2DZSA 1L6WA 4HYWA 4MHBA 2E9BA 4CQ8A 4RV3A 4H6EA 2G37A 1Z7AA 2PDHA 1XQLA 1ZL1A 4ZR8A 2J27A 1PCKA 3DFHA 3VO0A 4IICA 4XG1A 2Z1VA 1ICSA 2XSAA 3DAQA 1FWEC 1EZ2A 4OV4A 5TBOA 4M1RA 3BZGA 5A8PA 4LC6A 4G7EB 1QOXA 3M44A 4JCLA 2JGYA 4MM1A 5A8MA 2ZUNA 3RCYA 4RNIA 5HR7A 3CQKA 3V36A 2V5JA 3O6DA 3KL3A 1WZMA 3G1HA 1XYMA 2D2OA 3UY7A 1DV7A 2AOSA 3UNDA 4IGSA 4AHPA 1XV8A 1GTHA 3BLDA 4XZBA 3T08A 2W6RA 1ZY9A 4MPQA 1IZJA 3I6RA 2KX9A 3IJIA 3HMJG 3PK7A 1CGVA 2JIEA 4EPBC 2I16A 4M8UA 2PGFA 1LL6A 5EGRA 4URIA 3UA4A 4NXSA 1FDZA 2A4AA 3CU2A 1XIJA 1KLYA 4DZHA 3KUMA 1A0CA 4L5ZA 2CU0A 2HMCA 4PMUA 4Y9PA 1FWBC 1DJZA 2Z1WA 1C29A 3WQWA 3ARSA 3H6OA 3KRZA 3KVLA 2J24A 3L0KA 4R85A 3RCMA 2B7NA 3W83A 1A4LA 4C91A 1O5KA 2EBNA 1JCNA 2VZOA 1V02A 3OA5A 4OE7A 1J2WA 1RD5A 2EF9A 4RCXA 2F6XA 4UMAA 3HN3A 4ACYA 3HO8A 4JTSA 2ALDA 2F6KA 4Q8WA 2Z27A 3B05A 1Q7MA 1HT6A 1JDDA 5BXPA 4YTUA 4CCDA 2ZUTA 3W85A 4RZ4A 2BOEX 3UA3A 2PWEA 2WSQA 4ASTA 4CNUA 2YB4A 3BTNA 3WH5A 3MMTA 3VNDA 1R9ZA 1TJ0A 1E0WA 4C7GA 2D0GA 4KT2A 4XD3A 3CHFA 2HWGA 5A2BA 1MW1A 4I9TA 1IEWA 4F3HA 1O1HA 1T5AA 4PTVA 3WLJA 1JZ7A 4Q4KA 5A6BD 2ZX5A 4IX2A 1TJ1A 2G8ZA 4NYUA 3GR8A 3UG4A 1PL9A 1S5WA 4O1EA 4YMZA 1C8QA 1LG1A 2X1IA 3QEZA 3A13A 1XYBA 2YCLB 3LBOA 2VEFA 5AC6A 3HFTA 2UZ9A 1S2AA 2Y70A 4DPQA 4PR4A 4GY0A 3G1YA 4NKCA 1GJPA 1M04A 2PCEA 4UTTA 3MSYA 1UOKA 3PB2A 5AOUA 3W6YA 1J6OA 3M0JA 3HIJA 4HT3A 1V93A 3TTOA 3PFRA 3DI0A 4DWSB 1OC7A 2J7DA 2PSNA 1M5WA 3QHNA 4H7ZA 4IQDA 4YYCA 3R11A 2HTMA 1TSIA 1JUBA 3HG4A 4ALDA 2PZNA 1L8PA 3MKKA 3BAKA 3H70A 3PSWA 4KF1A 4QLJA 3VIFA 1G01A 1C7TA 2F2HA 4OVXA 5AC4A 4MZYA 3E5BA 3N2XA 3L68A 4PTDA 1JG9A 2OT0A 1D2KA 1Y65A 1JI1A 5JIWA 4HPJA 3PTMA 3ALFA 4EOUA 3T6CA 4ZB5A 2FPVA 1ZNNA 2EEXA 1DIEA 4PH6A 4O18A 3SEPA 1JZ4A 3U5UA 1K1DA 3TAOA 4WGXA 2A6NA 2RAGA 3S6TA 4DX3A 3DECA 3OZMA 1VIWA 5AHLA 4BCEA 4N9CA 1E6NA 6PTDA 1V0NA 5I07A 3G77A 2YOCA 2OXNA 1HKMA 1R2TA 4HA0A 3KWXA 4CD7A 1I6NA 4NY2A 2R1NA 4Z1DA 2G96A 2IXVA 1B3ZA 1ZUAX 1LUCB 2DW7A 4HU4A 2NV1A 3NR0A 4N7QA 3CMFA 2WVTA 3WENA 3EDJA 4GHRA 2FLIA 2E9LA 4UTFA 4UTKA 3TQVA 4AVNA 2VZUA 4XIMA 4F8XA 3FA3A 1Q7ZA 1DJWA 2C0HA 4AZCA 4H3DA 1J6PA 1XRVA 3WK1A 2FTPA 1US0A 5M1TA 1XD0A 2OLHA 3KLKA 4HA3A 3UPWA 3CZ8A 3TTQA 4W9TA 1GCYA 1LOQA 1MW0A 3CZKA 1JI2A 3TKFA 3TSBA 1KGUA 3W01A 1XC6A 2ESCA 2QAFA 5C2GA 3A47A 3NL2A 4YHEA 3CEUA 3M9YA 1UD5A 4BFAA 4UR8A 2VRJA 1XLHA 4WJ8A 4QJ1A 1D8CA 2A0NA 1JCLA 3U5YA 1P1MA 2QJGA 5LYRA 5LZLA 4LBRA 3QMRA 4R7WA 5AVNA 4LSBA 2RJHA 3QSTA 3CT2A 2WZMA 3UXKA 4JYDA 4HN4A 2Q01A 4DXKA 1XYLA 2QVHA 1YHTA 3PPCA 3ELFA 1IZKA 4Q32A 1EJ7L 1V3HA 1FWCC 3OB8A 2BV9A 5D2WA 3EMCA 3ARRA 4HK7A 1M03A 5CZ0A 4CCEA 4RDZA 4JFVA 1U1HA 2Y5SA 4I9JA 2BS9A 3EXTA 1MFUA 4JDBA 3XIMA 3W6MA 2WQDA 2V2DA 4J40A 2QCFA 1R3TA 2VTFA 3C4UA 4L7ZA 1ZB5A 1P48A 4N4PA 2TYSA 1UCWA 2YL5A 4IIFA 4MAZA 1UZ4A 3IK2A 3L0NA 3RX3A 5A2AA 2QDEA 1ZAJA 1JDFA 2BXYA 1TR9A 2VQUA 5A3HA 5EFFA 3IAPA 3M16A 2CNCA 2NQZA 4ZTYA 1B54A 1RVGA 1SQ7A 3T44A 4DXXA 1ISXA 4TVCA 3UWQA 4CNNA 1UKPA 2IQDA 4PSPA 2WC3A 3FSUA 5EPDA 3FK4A 4D9PA 4C1NA 1P4CA 4AZIA 4FA3A 9CGTA 1H7WA 4DZAA 1UR8A 3CO8A 1Q2SA 4UFKA 3ZOAA 3FNDA 3THDA 1AL7A 4FR6A 3DIPA 3V7PA 3ZZ1A 4B5NA 1F8IA 1S2CA 1VEPA 3QZAA 2WLZA 3K4AA 7ENLA 1GT8A 2C7FA 3FIGA 1TTQA 4LBUA 5BMWA 2I1OA 2FVLA 5TAOA 4LS0A 1DWIM 4EIVA 1EXPA 1FOBA 1AJ2A 2VUYA 1ZTVA 3WFLA 4R7OA 3MSDA 1J96A 1XI3A 3RU6A 1QPQA 1FDJA 3AZRA 1QBBA 1DJXA 2WHMA 3MMWA 2I9UA 4I90A 4GJIA 2J66A 1ODUA 1NDZA 5T8GA 3ZVHA 3CMGA 2FDMA 4QS5A 5I78A 4B5TA 1W3NA 3CAVA 2YSWA 3N29A 3W1AA 3ERPA 4S38A 3MUAA 4RNFA 3B0XA 6TIMA 4W7VA 1F4HA 4ZO6A 4AX6A 2DDXA 1GZJA 1AVAA 1I60A 2IUZA 1J0YA 4PTMA 4ERGA 1HW6A 1PIIA 1EQCA 3M41A 2WC4A 4YJ5A 1WKFA 2O0TA 5J5DA 1PHQA 1RHCA 1AJ0A 3UWVA 3E0WA 5ABGA 4UQAA 2QLYA 3S83A 4FXSA 2WKGA 4A2RA 3HQ1A 3SRFA 4O0ZA 1EIXA 4DF2A 2NUXA 2ZDSA 4AIOA 4XZWA 1KBKA 1PKMA 4L4LA 2HBXA 4WKHA 1KWKA 4WK9A 2GOKA 3AYSA 3WQ5A 4GKTA 1WXZA 3E9AA 1X98A 3IIPA 3G0SA 4R27A 3ICJA 3EYPA 4BEUA 3E2QA 1KQYA 2PFHA 3TYAA 4UFHA 4EXBA 3W37A 4KPLA 4NAEA 5GQBA 4Q4QA 5D32A 3LY0A 1ECEA 4V33A 1XLIA 4O1CA 4IMAA 3AYRA 3OLEA 3FN9A 2PP3A 1ZP4A 3FVDA 1I2PA 4AB4A 3HB9A 4NG3A 4M5PA 3W1MA 4O57A 3DKLA 3BG5A 2YBUA 5FD0A 4RE4A 3INPA 1EOKA 3XINA 4AD2A 2WXDM 4AEEA 1EL3A 1RLCL 4E8DA 1W1VA 2YL6A 4GK8A 1DORA 1KD0A 1XIFA 1ZBKA 3TC6A 3IGSA 2HK0A 3T2PA 3KVJA 4JX5A 3R25A 2BB0A 3RJYA 1R47A 2NW0A 4A21A 5LKYA 2B31A 1RBLA 1Y8BA 1VFTA 2C1IA 3CUXA 1JZ3A 4NILA 2BX7A 3E96A 3EXSA 4WXYA 3AS1A 3P2VA 3LENA 3W7HA 1NM9A 2GGGA 4QQUA 4DB7A 4S3AA 2GQ8A 1EHNA 1TWWA 4WJEA 1MXGA 3KOXA 5DXXA 3OBAA 1DXEA 2CXGA 3S0CA 1UHVA 3RYSA 2I14A 1TJPA 3ALGA 4DJEC 3W27A 3PBMA 3SSJA 4S3BA 3GVQA 1JQXA 2Y1HA 2E25A 3KVMA 1ZHAA 4NZCA 1BTMA 4P8WA 4F0SA 3UZXA 4V2XA 3CV1A 1V6YA 4GC4A 2E67A 2P53A 1L6FA 4X9SA 1OK4A 4ROPA 1GVIA 2V5BA 4CD8A 5HMDA 1QJWA 4QSHA 3WQOA 5LGZA 3GDKA 4AZGA 2OYLA 2CLHA 3PAJA 5AECA 2PODA 4UQ9A 1UZDA 3NO5A 1UOZA 1UWRA 4LUIA 4MJ2A 3NSMA 1W1A1 2B0MA 5HULA 4JTIA 3NUKA 1RR2A 1OZMA 3LV5A 2G3MA 3RGTA 4W7WA 2Q02A 2E9MA 3SCVA 2XM1A 5GVJA 3N6HA 3K8MA 4F0MA 3ZJ7A 3BLKA 4H04A 3POCA 3B9AA 1NF0A 3CV7A 2PURA 1GG0A 3S5OA 3WFZA 1MDRA 2LLEA 3NQDA 2J7EA 5LA0A 4I7UA 3S46A 1S39A 1WV2A 1WUEA 4KMQA 1JUKA 2OYKA 1BTCA 3UG5A 3N2OA 4K8HA 1IHIA 4DF1A 3WK2A 3EX6A 2XIOA 1NFPA 1RSCA 4L61A 4ZB0A 3IJ7A 5A6LA 3N11A 1F6YA 1EJTC 3DH7A 3AUOA 3VINA 2OELA 3CIVA 4OOZA 1W1PA 5EKYA 2VZTA 4MY8A 2WKLA 1IR1A 2VEKA 1H60A 3CXOA 4EKJA 1M01A 1WBHA 3MCOA 1H50A 1YPFA 4CVWA 1XFCA 4B9ZA 4F9DA 3O3RA 4TVDA 2P88A 4B5SA 3WLHA 3LNPA 1XUUA 3SN0A 1XLBA 4UFIA 3OLDA 4F0KA 3GR4A 2RDTA 1PZ1A 5BW6A 2C79A 5ENLA 2FH6A 2Y7GA 4C1LA 3D47A 3W7JA 5EMMA 5CSRA 5AZ1A 3N34A 3VD7A 1C7SA 3GW0A 4KESA 4ZO9A 1P0KA 2EGZA 5IHRA 1ZALA 2VVSA 2OO0A 4DQWA 3PWIA 3WEOA 3LSCA 3SURA 2QPXA 3AMLA 1FWAC 1QHZA 2QJIA 1TA3B 2YFNA 1ZSXA 2VD9A 3E5PA 3HJEA 1K02A 3WK0A 3BVJA 3MV01 2Z2BA 3W84A 2CZVA 1JNEA 4JX4A 4ZSTA 1WQ5A 4ZXLA 2WZHA 2PAJA 1VR6A 1Q66A 3MY9A 1XCWA 2FKPA 2DW6A 1E0TA 5I3HA 4PTNA 1FH7A 4LUSB 2EHHA 2HNHA 5ABHA 3FV9A 3LLFA 1HJUA 3QW3A 1EP1A 3ISIX 3OTRA 5CZTA 1DBTA 3CT7A 3ARPA 1SFTA 4KCWA 1Q6LA 1F74A 1OHLA 3UERA 2VEIA 1R8LA 3QQ1A 4LJ3A 1LRQA 1XYFA 3MP5A 5LIYX 3N1AA 3S4TA 3O6AA 4M1BA 3LHTA 4MTVA 1E4IA 4D6DA 3SFKA 2HQAA 2BVTA 3K46A 4XZIA 1LOSA 3R8GA 1QNVA 3N3MA 2IKIA 3HPSA 3EWWA 4JHOA 3FEQA 1GJUA 1HKJA 1F07A 3VOCA 2FQIA 1KCLA 2EG6A 3KVKA 3P0XA 1VFUA 3GZAA 3SRDA 1TPC1 3AXXA 4J3TA 2VRQA 1UR4A 1QK2A 2HDJA 2XH7A 2QV5A 2P0IA 3ZLFA 2NT1A 3DFPA 4ICNA 2E6FA 2A2IA 3DG7A 1IQ8A 2ZRYA 1FHLA 3W7LA 6REQB 4LC8A 1XYZA 2BY0A 1RBAA 2WMIB 2NWRA 1TKKA 5AYYA 2PDQA 3A12A 3A3XA 2PDGA 2FTWA 4QTGA 3LPOA 4Y96A 2OT1A 3DG3A 3EX1A 1VRDA 4HN8A 5EMJA 2FMNA 5CJNA 1JAEA 1BYDA 4GA8A 3W1XA 2WVVB 3WN6A 4JTGA 1KCXA 2GQAA 5HQMA 2J4GA 3CWNA 4H7VA 3UW6A 2DSZA 5JQ9A 2YCJA 3HGSA 3PBGA 5G4EA 1QHPA 4MB5A 3NDOA 3ZLGA 4D71A 4JAWA 1N8WA 1EEPA 4GBDA 2J6VA 4Y9OA 2VRKA 2CHRA 4QGCA 2V3DA 3MP4A 3CK5A 1IE7C 2YZ5A 4FLOA 4RJEA 4WJXA 4ZVJA 1YDVA 4U5KA 4FNPA 5JVLA 3QV8A 1J11A 1QNQA 4JTUA 4ZA0A 3RLHA 4GNJA 1H62A 3FS2A 1C8YA 3UU0A 2V69A 5ABFB 1GHSA 1R3VA 5FIPA 4IPIA 1UKTA 3W53A 3W2NA 4CN6A 1GOWA 3TQKA 2IPFA 3ZLHA 3U0HA 1TIMA 3DN5A 1KFJA 4ACZA 5BOOA 1KCKA 4YIWA 3QV6A 1KXQA 2D24A 2WM1A 4JN7A 3RM9A 4GVFA 2X0SA 3UVIA 5I00A 3QW4B 1EJVC 4N0RA 3UCDA 1J5TA 1DJGA 4ERIA 1JZ5A 1TQXA 2P0OA 4Y9AA 3ZJKA 4RZBA 1TCDA 3GDBA 4RE0A 3GHTA 4RDVA 2OQHA 2A5HA 2PF8A 4TQTA 2NV9A 3FLUA 2PRMA 2Y8VA 2AQOA 1E71M 3CNYA 2ZIDA 3KLLA 1UD8A 3TWBA 3V75A 4GUHA 4DJFC 4HD5A 2A7PA 3WBAA 1OFPA 1TV2A 4JYEA 3AXIA 2PLCA 4CD6A 1NH6A 1H49A 4Z42C 2X1RA 2GQ3A 4MJZA 1H7OA 4KRUA 3RFAA 4D1IA 2XFFA 1XRSA 3WBWA 3OHMB 4HJFA 1ECQA 1PHWA 5H2ZA 3W82A 2HVOA 1ONXA 4LUJA 3MUY1 2VC9A 1XSKA 2ZX7A 4TX9A 2AQWA 4ICCX 3UT0A 3BJTA 3T1GA 3RITA 1G7VA 3MCNA 2YKKA 3QQWA 4JIHA 3SQLA 3IARA 4WDWA 3TJIA 4E0CA 4EE9A 3R43A 3RPTA 4GUJA 2PDUA 3W70A 2QHAA 3GXDA 1TMHA 1NWTA 3L67A 3W2LA 2NVAA 4B9YA 2ZCGA 4OECA 4ZQRA 5A95A 4B5UA 4U5IA 5LNRA 4XTDA 2VELA 2R9RA 2GVEA 4NZFA 3HGRA 3RM4A 1CIUA 1W9PA 3VYLA 2E5DA 4LF1A 3ECQA 3VKDA 4E5TA 2WWDA 4IMDA 4J3ZA 4R88A 3FDGA 3VCCA 3XISA 3UFYA 4F0HA 5TF0A 1E6QM 1RV8A 3CHVA 1JEZA 2XZ7A 2WPGA 2WC7A 1KM0A 2R24A 1Z48A 4Z1BA 1QU4A 1SZNA 1UP2A 3EOSA 1XCXA 1KGWA 3ARWA 4M6QA 4PE8A 3K13A 1JF6A 1DTNA 5JXQA 3BARA 3BAWA 2BVDA 2EG8A 1NIUA 1JVNA 1O6IA 3MS8A 4TU1A 3LCXA 4DWSC 3TA6A 1QO5A 3NDZA 4I9AA 3R7MA 3WZ0E 4DRSA 3QZEA 3GFZA 1EC7A 5FKYA 5A1AA 4D6JA 3VKCA 2PWHA 1RA0A 4UNIA 1PJ9A 3USZA 1P0NA 4LNCA 1EA9C 1FWGC 3OZPA 4K36A 3QTPA 2PE4A 2XVLA 3AXHA 2VDHA 2D1ZA 5L9FA 2FYMA 4Q3MA 5M17A 3VUPA 4KWSA 1DVJA 3V18A 1UZ1A 3UETA 4FHAA 3QQ0A 3GVWA 4YNGA 3K1GA 4PEKA 3KZPA 4BWLA 1ZBWA 3I68A 1M53A 3A6OA 3U57A 4L9YA 1T96A 3CUHA 4JQ1A 4O52A 1Q4WA 1DQWA 2WCSA 3LDVA 5LNVA 2BNJA 2R91A 2UBPC 3OVQA 1DJIA 3JS3A 4FXRA 3V3WA 4Q4OA 5I2UA 5DELA 1HN1A 4XKMA 1ZCOA 3PP7A 1B3WA 1X39A 1V6WA 3VDCA 1TYGA 3B0UX 2EKCA 1FCQA 3DG6A 1VPYA 2BTMA 5I24A 1XD1A 1LDCA 1KFLA 1OGSA 2NT0A 1XIHA 6CGTA 4MYAA 3B9OA 1K6WA 3AI0A 3PN8A 2WHJA 3AMKA 4PMQA 1PXGA 1SW0A 2R94A 1OT2A 1ALDA 3P0WA 2CLFA 1FHUA 4FALA 4WHBA 5F2LA 1C3FA 1JFHA 2DZBA 3NZPA 2VX6A 4Z2JA 4XSLA 3NQAA 3N6QA 4XO7A 1HNYA 2JK2A 4Q33A 1OJXA 2WSRA 2V5LA 3TNBA 2I9EA 2H6RA 3GM8A 5C7HA 4DELA 1A3XA 4ERAA 3LEPA 4H8UA 4M0XA 3U48A 2Z26A 1PKYA 3GZ3A 3M0LA 2JALA 3IEBA 3E0FA 1HF6A 1ZP3A 4UC5A 3W3OA 4CD4A 2BG5A 3WLNA 4US6A 4J1OA 4AAJA 2ACSA 1SM9A 1A5OC 2BOGX 3PJXA 3VCRA 4WY0A 4L1WA 2VGGA 3DHFA 5D30A 1N8IA 2ZVRA 4ADUA 1CXFA 5REQA 2I17A 5CSSA 4ZOBA 3W1PA 3AICA 1V3JA 2ZZ1A 3DXIA 2DZWA 5JBFA 3O07A 5C9XA 2J8FA 1GQKA 1EYEA 4GO9A 1Z6KA 4W4QA 4GY7A 3H21A 4L4PA 5G1TA 4I5XA 3WCZA 2QXWA 2XVNA 3KAOA 3T8LA 5LNSA 4JY8A 3ITXA 2W63A 3PZMA 4JFSA 4F48A 3LCFA 1F8MA 1F3EA 3NO3A 3H7RA 1A5NC 1F05A 1SYTA 4ZL1A 2GOUA 1A0DA 3NEHA 4FR1A 1XH2A 3ATZA 4GCAA 4WEVX 3QLDA 3DGRA 1RH9A 1ZPTA 3GH4A 4LAMA 3F4WA 4H6QA 1GG1A 3PHAA 2F8QA 1YXDA 4HGXA 3MDUA 2PD5A 4IXHA 3ITYA 4K8GA 4GNVA 2GPTA 3H54A 1AMYA 4X3ZA 3CH0A 5I3FA 1JR1A 1ZZMA 1VC4A 2D73A 3WJZA 3B8TA 2P3ZA 1R87A 3MJYA 1XKJA 2FHFA 2Y7EA 3M47A 4O11A 4UCFA 3H2NA 2ZA3A 5H1WA 4NZ1A 4YTSA 3U7BA 3SCTA 2AQVA 3ZT7A 1H63A 2NQ9A 1J8VA 1MZRA 1GVSA 1E9ZB 3QR1A 4HNUA 3FGCB 3OIXA 5E0KA 3AIBA 3NL5A 1X6LA 2DPEA 1XGDA 5JBDA 1Y5XA 4LV4A 3IS4A 3KM8A 5DRCA 2Z1XA 4O15A 3HG2A 4Q6XA 3EEGA 3KBVA 3RCNA 5I77A 3MPGA 1TUFA 1IWPA 2DORA 4IQEA 3W7EA 4C90A 3C56A 1XQKA 2NUYA 1EHAA 4X22A 4YWSA 1OABA 1CXEA 4EACA 1ZAHA 1KW1A 4GYPA 3VDHA 3VNZA 4X60A 3H26A 3NYDA 3ONBA 4XBJA 1TZ7A 3VNLA 4JKMA 4TV6A 4H2CA 3R13A 4S3JA 2PCQA 1KBBA 2HSAA 4CQCA 1G4PA 2Z25A 4OT7A 3B0YA 2Z4GA 3WKZA 4Z08A 3T0AA 4XX6A 4XZHA 1E1EA 3TUUA 5D09A 1O5QA 4RXGA 5JUVA 2PDIA 3AIUA 1CYGA 3GAYA 1SO6A 4B5XA 3TZNA 3VOJA 2ZQ0A 4HTYA 4ATWA 4QAWA 4PCTA 4PUKA 4QQ3A 2I5QA 4E8GA 5I23A 3N04A 2PWFA 5F7UA 3K5XA 3L0GA 1A53A 3BW3A 3N18A 1YTDA 5DCEA 2A3AA 2ACUA 1LROA 3ABOA 3L4YA 1GGOA 2X0HA 1JPMA 1QI5A 1M68A 3FXGA 4W84A 3P8JA 1F9CA 3B04A 4FX8A 5DLCA 1W17A 3B8VA 4H8NA 1XSJA 3CB3A 3HPXA 3OOQA 1PSCA 3OQ8A 4HHLA 3WO8A 3MWAA 3H23A 4E2DA 4QDWA 1SFJA 4FZIA 2PDYA 5CPNA 1BAGA 3C2RA 2NZLA 3VOHA 1HGYA 4JHZA 3VVGA 5D03A 3IJQA 4ZOCA 4QE4A 2YXXA 1ELSA 1EDQA 1KKRA 4MUZA 2WLYA 2QZRA 3R89A 1UJPA 5AHFA 4KW2A 1HL9A 5K9CA 3OG3A 3REQA 3L4WA 4S2BA 4Q4PA 2Y5JA 5LGXA 4HZ7A 4UFMA 5FL1A 4AHQA 5E9XA 1W1B1 2CLEA 2QCLA 1KV8A 3EZ4A 3F03K 3R2GA 1S2UA 4BHYA 2A3BA 5I02A 5DRIA 3HFYA 4GVHA 2VYOA 1J79A 3ZO9A 4O4WA 4QE1A 1WXJA 1YEYA 3MHUA 2C71A 3QMSA 3AMDA 1MEWA 5A6TC 2J25A 1TV7A 3N12A 1XGEA 5DN1A 3CTLA 3T40A 1N55A 3MUIA 1KA9F 3SAZA 3EA2A 4H7CA 5CCZA 3TJ4A 3N19B 1J0ZA 2Q3OA 2FFIA 1KBIA 3LG3A 1Q8JA 3F2DA 1OC6A 3CJPA 3F5JA 1D7KA 5A8NA 2WZTA 3W1RA 3GW3A 1KB3A 3QR3A 3B06A 1WNOA 4YL2A 2OU4A 4DI8A 5FEPA 1UUMA 3HQOA 4JNMA 2Q8XA 4MB4A 2P5NA 4FLQA 4PMXA 3BLEA 2WO5A 4W89A 1RVKA 4L9ZA 5IXEA 1GVOA 3PR2A 1P0EA 1K9EA 3MQTA 1W9XA 2YW3A 1P43A 2V5CA 4A3YA 1WZLA 3KW3A 3E2RA 1E5NA 3AJ7A 1ISVA 1LL7A 4E2BA 1HP5A 3GS6A 1I2OA 1P0DA 3P5YA 2ZA2A 2PDXA 5JU6A 3W07A 4XZ9A 3D3FA 2CBUA 5BRBA 1G94A 3H2EA 3NSNA 1ITUA 4QJ5B 5ECVA 3TH6A 4ES4A 3UR8A 4H01A 1XF0A 1JGMA 2OCZA 4AG0A 3NG3A 1FH8A 1ADDA 2BSLA 3U3HA 3KHJA 3WBEA 1UD4A 1CPUA 4G2DA 1RJRA 2Z2UA 1A49A 3EGJA 3B8WA 2E8YA 1XH0A 1YBQA 3SM0A 1X7IA 3FKKA 4GUFA 3VNJA 1XC4A 2TMDA 4IWWA 5LNWA 4IMCA 4LCRA 4K3ZA 5GNZA 1XW8A 3WQ6A 4Y6GA 5GJPA 1OBAA 4TMBA 1MO0A 3LZ3A 3LA4A 1BRLA 4L56A 3MI3A 5BXSA 1NU5A 3TWAA 2W3ZA 5BOFA 4US5A 1AD4A 3M6YA 3MP3A 4Z1CA 2GFTA 3F4VA 1UC5A 3WD0A 5FJPA 2BGSA 3NO1A 3RAOA 5LIUX 3KOFA 4C6LA 1NDVA 4L6HA 2DT2A 5F4XA 3ARQA 4CQ9A 3SGUA 1WP6A 2R14A 3ES7A 4NZ3A 4Z2HA 1E1CB 3F7JA 4JNYA 5DBUA 1PO9A 1SJDA 1OWQA 3IJ8A 3B4YA 5GNXA 3BQ6A 5TIMA 5ECUA 5CQ1A 3DBNA 3AQUA 2IKGA 1W3HA 2OZ8A 4RW3A 3WNOA 1UWQA 1SR9A 3BW2A 1V08A 3R79A 1E56A 3FFSA 1C9WA 4DUXA 2VKZG 3K2GA 4LY4A 3EPNA 3SSZA 4KKXA 5HNTA 2CZFA 3P67A 3DFTA 2NX9A 3IWPA 3W6LA 4KIEA 4AD5A 3S1WA 1MW3A 3GXIA 4H9TA 3DC8A 3DFNA 2G41A 4HHMA 1Q6OA 1ICPA 2X42A 3VDAA 3DX5A 5HAOA 3PJTA 4O16A 4JDYA 4FSAA 2VHLA 1MQRA 3NZQA 4AISA 4E38A 3WD3A 3WX7A 1UMLA 3WDHA 1UBPC 4LT9A 3BSMA 5KZ6A 3M5YA 3IUHA 1OF8A 4NHVA 1E3ZA 3GNPA 4IISA 1V6XA 3M4HA 3ANUA 3HQNA 3T2OA 5FEWA 4JL1A 1HVQA 4NJJA 3W28A 4DF0A 5HWJA 1M6JA 3BJSA 2X09A 3MO4A 3L4UA 4Q22A 7REQA 1LQ0A 2PU1A 3W1NA 1PBGA 4W5UA 3QKEA 1HIZA 1SFLA 4QSFA 3L23A 2DVXA 4X0NA 1B4KA 4P8VA 1VJSA 3DKJA 3GUWA 3LZ5A 4JTRA 4LBSA 5DO8A 4L1XA 2E6AA 3THCA 4PUNA 2WJZA 1OX6A 1LM1A 1VBUA 2J75A 2Q6ZA 1VBHA 2OEKA 2BBFA 3TA9A 4Q8OA 4NASA 2V3EA 2VEPA 4I9MA 4QISA 1XH1A 4DO6A 3STCA 1WX0A 3UWWA 1TE6A 2WCGA 3MU7A 2VUNA 3GKFA 4UQBA 3BSGA 2QCGA 1XLFA 1WOAA 5HUPA 2POTA 3BCFA 2BLEA 1TFVA 4H9MA 4EAYA 3A64A 4UTJA 2RH9A 5HNRA 1D7FA 1DJQA 1NWUA 4IX0A 3EMQA 1M1BA 2J7BA 5EA9A 3RMJA 4RDYA 4D72A 1OGBA 3NQ7A 1SJBA 3V5CA 1ITCA 1VIZA 3L2LA 2OSWA 2NLYA 3A24A 2P3EA 3C0QA 4UFLA 4J35A 1UA3A 5HR6A 4PRRA 4C6JA 1ONRA 4FX7A 4BQ5A 3WJWA 3ITLA 4TO8A 3L4TA 3VNYA 3QVQA 2QF8A 2X7VA 4DJDD 5HUOA 3LK6A 2D3LA 2HPMA 4GGBA 2YW4A 4ENLA 3FYOA 3TCSA 1IZCA 3LQLA 3E12A 1J5SA 4L4MA 4FLSA 1SO4A 3RO6A 4BI5A 1EFZA 5T91A 4J4KA 3E3HA 3GU2A 3V5FA 4P7OA 1QATA 3STPA 3BOXA 5HJYA 1JPIA 2D23A 1J12A 2PC8A 4G7EA 3V0SA 8XIAA 1E9IA 3ZIZA 3IJ6A 3SRKA 5AYXA 1OFOA 1I45A 3WD1A 3WLTA 3ARYA 1IEXA 5A6MA 4DJFA 4C6IA 3MBDA 5C8BB 2ACQA 3CHDA 1VFHA 4JCMA 2ZOXA 4UTLA 3E38A 4O53A 3OYZA 3TLLA 1BEUA 2UWFA 2WNQA 4LVFA 4CNPA 4LEFA 5IBXC 2ISDA 2OX4A 4ADSA 3TYBA 1FWHC 1PKLA 1POJA 1Z8AA 3GG8A 1VFFA 3UXLA 1S38A 1SZFA 3ZSSA 1H1ZA 3P5ZA 3KEHA 1JCMP 4G7FA 3B0PA 5LXEA 5DANA 1W9BM 4LF2A 4XAZA 2VZVA 3GU1A 2F38A 2NLIA 4X0VA 3M43A 2MANA 2E09A 1EZWA 5D05A 1PE1A 2E8ZA 1UIOA 4H9YA 3HU7A 1M41A 4ZEPA 2PDFA 4H41A 1LBLA 4IP5A 3OEXA 3U8GA 4H8HA 2CESA 1Q6CA 4EWND 4NZJA 1EBGA 1S3TC 1AJZA 4M82A 1N82A 1TWZA 4UCGA 4LU0A 4MIMA 4FIRA 4GYKA 4U3AA 3CQHA 2VEMA 4X2RA 2VZSA 1LG2A 5CBJA 3LS9A 3PBYA 2DGAA 2FZ9A 5DMLA 1QO2A 4DVOA 4HNTA 1OM0A 3OODA 4H2HA 2ZUUA 1D8WA 3BG9A 2PDBA 3M0KA 1VCFA 1EX5A 5TQLA 5DX7A 1OD0A 2PTDA 1QBAA 4PMZA 5HQEA 2E7FA 5DBTA 3AJXA 3OZYA 4W8LA 3M0ZA 3CV6A 3SQSA 1B3YA 2FPTA 5KITA 3UP8A 2PWGA 2FTYA 1X96A 4AF0A 4UTWC 2ODOA 4DJFD 3H53A 4UZUA 3HG3A 4S3DA 1U5VA 3M0HA 4HU3A 1TPFA 5ABEA 3WH9A 1G7UA 2PTZA 4CNOA 2J8TA 5M5DA 3HA1A 4DJDA 3GAKA 1FCUA 4IGHA 1OYCA 5F2MA 3WFAA 2CWXA 2IMRA 1WDPA 4GACA 2G3JA 1GOXA 1S1RA 4L64A 2OWXA 1CENA 3GVGA 2ZICA 4FNTA 3KOZA 4JR5A 3C2VA 1UP0A 3S1VA 5C5YA 2ONEA 4UZSA 3CUFA 4NAFA 3SUWA 3G1DA 3TSDA 1WXYA 4FNSA 3CAKA 2QJNA 1HJWA 2WSKA 3L66A 1ML1A 3N9SA 4IJRA 4M29A 4N42A 4IGNA 3WLOA 4AF0B 3EA3A 4K1GA 3PTKA 1EEXA 2D0HA 5A69A 3N15A 2DJLA 3NTYA 4AY1A 3EB3A 2PWVA 1XICA 2HVMA 1K03A 4LYQA 3DZ1A 3LCGA 3WYZA 3LD5A 4GI4A 4HSOA 3ARZA 5E0FA 2O4QA 3ARVA 3J7HA 5A2CA 2CLPA 5U7SA 3TTYA 2QMJA 1UBSA 3G3DA 4IPLA 2DQWA 4UTMA 4MY9A 3P81A 2R1PA 4I6KA 3A3WA 3LBCA 1FCVA 3WQEA 4A4AA 2XG9A 1L6GA 3OYXA 3FW6A 4AC1X 3DFQA 3L7RA 1RAKA 3GHSA 1PZ3A 3KBJA 3LYEA 4H9UA 1RUSA 3I3BA 4PCFA 3W72A 1PCWA 4QITA 1TE1A 7A3HA 5HMFA 5I3KA 3VGBA 3WF4A 2HZGA 4ICMA 3S5YA 3C2FA 4QX4A 2BXVA 3IVUA 2XH0A 1JZ8A 4GX8A 4GQGA 1W9UA 1CGXA 4Z2KA 1E51A 1TV8A 3GXFA 3NZRA 1FBAA 1W5QA 1YIXA 3TE9A 4BQ2A 1B30A 3ITGA 1R3YA 5AB3A 3CB8A 1QVBA 1NSJA 3WDPP 3PZQA 4Q8MA 3W86A 3VDBA 3PF3A 4UTIA 1JD7A 1C9DA 1GOQA 3SUVA 1X38A 4U4MA 3GYEA 3BC9A 3UXIA 1NOWA 2DSWA 3NQ8A 5I3DA 3VE9A 3GR7A 4PUEA 2UY2A 1WDWA 4GIYA 5BWFA 1W1TA 3TONA 1V5XA 3TQPA 1C90A 3WUFA 7TAAA 4LX4A 1EH9A 3THUA 1ZJAA 4M7TA 3ZT5A 2C1HA 3OU8A 3RK8A 4L4OA 4K6AA 5D9NA 4I3GA 4HNNA 2CLKA 3H2FA 3ZWSA 1BLIA 1Q6EA 3TW7A 3GTHA 2D2GA 3ID7A 1DL3A 3EAUA 4CN4A 1VFMA 2NQ5A 1OCBA 2QIIA 4BQ3A 1TVNA 4GYFA 4WRHA 3G1XA 3HPAA 1E0XA 5G2IA 1JQVA 1ADOA 3FVMA 5BXRA 2J77A 4C60A 4AWSA 4U2YA 4KGLA 3A4JA 5FL0A 2BVYA 4ZODA 1FXQA 2XYLA 3M1ZA 1RQHA 1R9YA 2CLMA 5CG0A 2W27A 1QOQA 3S9YA 3PSVA 2DFAA 3S5ZA 3SFWA 4NRSA 1TVPA 4X63A 2JEPA 3U2EA 1GQIA 1QXLA 2X1TA 2VT0A 1VLWA 1O5XA 3UJ2A 4G56A 4J27A 1DJYA 1OEPA 8XIMA 4MVAA 3H55A 2A21A 3VKJA 1GVFA 2H9AB 1DYSA 2CZEA 3CO4A 1FXPA 1SZGA 1BKSA 1O7AA 4GLEA 2ISWA 4JFTA 4XBSA 2XGZA 1N8FA 3BV7A 1PX4A 5AYZA 2YB1A 4PFHA 3VI2A 1V8EA 3R0UA 4LAUA 2A3LA 1QCWA 1YYAA 5DMYA 1JDCA 4JTHA 1QHOA 5LIKX 4EX4A 1CXKA 1KBJA 4R33A 4Z17A 1GYMA 3GTNA 1EGZA 3G2GA 3BMVA 3S42A 1ZENA 4ZBCA 1RZMA 3BXWA 4N9DA 2YLLA 1ME7A 1V3MA 3L65A 2ZX6A 2J7GA 4AY8A 1XPGA 1GOOA 2JF6A 3LPPA 4JX6A 3RG6A 2DV0A 2TRSA 2ZXAA 4LFYA 3LTYA 2OR2A 3A4WA 2BGQA 3W7PA 1I1XA 4XKYA 2JFEX 3IGUA 2C1GA 4MSSA 4OZOA 5IOBA 4AD3A 2BY2A 3PPFA 2XIJA 5D33A 4FOUA 5M03A 3KZSA 4YVPA 5G2HA 2CHOA 1OFRA 3E0IA 2G97A 3R0DA 4C6NA 4FOKA 5F2IA 5CZSA 3BAYA 4PFMA 4PBGA 1JCTA 3WF1A 2QT3A 1W0MA 5C6MA 5AHIA 1V7AA 2OSYA 4C7DA 4Q7NA 1TVLA 4Q8QA 4B3KA 1W31A 2BHZA 1ZFJA 3TQ0A 2RGMA 3I7QA 1WDRA 4LGXA 5FAJA 5FOOA 3UVAA 2W66A 3H2OA 4KBXA 3PBUA 3CTTA 3WUGA 1SO3A 2BASA 3C0JA 2IKJA 3QGVA 1MFVA 1D3CA 1A5UA 3PAOA 5DY3A 4QJ3B 3CL7A 5GPRA 1DE5A 3MO7A 2GGJA 1QPOA 1J0HA 1NVMA 2W67A 1WB0A 2GJXA 3N3TA 3PPGA 3TXZA 4AD4A 3QMTA 3GB6A 1IYXA 5BMXA 3T9PA 1RK6A 4XZNX 2REQA 3NQMA 2F9RA 4AZBA 2FZMA 3KOYA 2VENA 1J0IA 5HXMA 2ZX9A 3LOTA 4OJYA 3KHDA 3ZXWA 6ENLA 1QT1A 1IEVA 2O55A 1Q13A 4JGDA 1O1ZA 4OHQA 4KEMA 3P61A 2VEGA 4E4FA 4A8NA 2I5IA 2OOFA 1NWRA 3SCRA 2EKGA 3PANA 4LUTB 5DCDA 2C15A 1X7FA 1VPQA 3FYYA 2RDUA 1U22A 5C9ZA 1MW2A 4KEUA 3CQ0A 1XRTA 3NM3A 3SN1A 4HZ6A 3DHDA 4PRTA 3VE7A 2PA6A 4RKAA 3QRHA 2ZUWA 2JKPA 5LSMA 3D6NA 3ZM8A 3FJ4A 1XSIA 3MSRA 4OOUA 3PJUA 2PDLA 1BG4A 3JZUA 3LERA 4GX9A 4WSJA 3S1UA 3RM8A 3B03A 4NZ4A 2Y7FA 2IQ0A 4IH3A 4M24A 4DY1A 1KRBC 3GHRA 1E6RA 2DH3A 4O50A 3BLOA 4B3ZA 4E4PA 3VTRA 1LYXA 1HJXA 2IKHA 5FJUA 3W7OA 3URQA 3DERA 3ZSTA 5C7VA 4LXFA 3G8RA 1OF6A 4PMRA 4NJIA 2QCEA 4O13A 1QDSA 4A05A 2GUBA 4GH1A 5AHMA 1WZKA 3L4VA 5KMYA 4I5UA 5A8OA 5IRPA 3G1VA 4EXQA 3WH6A 2WAGA 2FJKA 3CHEA 4TV5A 4MKNA 4D6CA 3CZGA 4KEVA 3VFLA 4ZQPA 3EA1A 4HCLA 1QPKA 2WJEA 2J7CA 4V15A 3OA3A 1PIFA 4KEZA 2GGIA 3O8AA 2VI0A 5BU6A 3QF0A 4DAIA 1WPCA 3W7RA 5BRQA 3SY5A 3SCOA 4H6RA 4J9JA 2DY3A 1TWSA 4UFJA 2BDQA 1WUFA 1XLGA 3AMGA 3B8DA 3PG8A 3IRDA 2XISA 4V1YA 4NRRA 4X9YA 1B9BA 2QJHA 4PA8A 1U83A 2HS8A 4DNHA 4WGHA 3GXTA 3RILA 1WAUA 4GXPA 3W7NA 3RMEA 3MCMA 3BV4A 3F4NA 3RPDA 5D38A 1FX6A 2J9ZA 4HIBA 3W7KA 2Y0FA 3BDKA 4REQB 4ROQA 4IT1A 3HJZA 2FGLA 2FVMA 1AQ0A 4JFUA 3O0FA 4TIMA 1VEOA 3W1UA 1WKEA 3AXMA 4DZ5A 3AHTA 2UY3A 2FDSA 4PUWA 4E6MA 2OLAA 1L8NA 1UWSA 2OPJA 5EB8A 1Q5MA 3QFEA 1TMQA 3L4ZA 2PPGA 3RLUA 2DIEA 4XKYB 4NF7A 1FA2A 1UD6A 1IXQA 1H51A 4S3GA 3DEQA 4MWAC 4QP0A 3VD3A 1H41A 2J6XA 1GZ1A 1XL9A 3UPBA 1OINA 4C5YA 3NZ1A 2J13A 3BMWA 3N4AA 5CC3A 5I0DA 4WOQA 1W5OA 1L2UA 2B7QA 3WIJA 1OYBA 4EF8A 2G3IA 3A4AA 5CSUA 1VGAA 1QPRA 2YCKX 1B3VA 5C9RA 3MANA 3IJ9A 3G6LA 4UMCA 4EPEC 2VP8A 4MWAB 1S1PA 4FO4A 3G1SA 3DUGA 2A7NA 3WH7A 4DO5A 4GVIA 1E5JA 3AALA 2BFGA 3W87A 3TYUA 1DXIA 4LUYA 4JTKA 3PULA 3CGTA 2Q8LA 2BOFX 1XXXA 2AGTA 2BWGA 3GNDA 4AD0A 3M0IA 3C3UA 3VDGA 2VC5A 1EA0A 3EBVA 4B2DA 3HBLA 3W1LA 1LWIA 4LTSA 1HL8A 2J9XA 1GWJA 2ISVA 3GC2A 4UQDA 3LUTA 2QUNA 2VJXA 2Z6JA 1XYAA 2Z28A 5LA1A 1NFGA 3M46A 2PDCA 1Q63A 5K4ZA 2PRHA 1P0BA 4JQ4A 3OZOA 3QY6A 1IEQA 1JL8A 4B90A 4GKLA 3ABXA 1E1CA 1X97A 1RXOB 3NQVA 4YCPA 5IDZA 3WQGA 4PULA 2DUXA 3OP2A 2FGBA 3U2CA 4FXJA 3FJLA 4QRNA 5XINA 3FGCA 4WSHA 4JTAA 3UY8A 5D2TA 3SCQA 3QYSA 3PJWA 3KP1A 2QDDA 1DE6A 1CLKA 3PFMA 4RL3A 3SR7A 1VRXA 4GXWA 1OYAA 5BOEA 4AWEA 4H4IA 5CAKA 4CNTA 1AUSL 2HCVA 1B9ZA 2BY3A 2ZZ4A 2NQHA 1GPWA 4JTCA 3PG9A 5E0CA 4WY0B 3EPOA 4D8ZA 5KEZA 3FEMA 5HBFA 2B81A 5CPLA 4MF4A 1JRBA 4AZ7A 5E09A 2GGHA 1ZJHA 3TW6A 3Q65A 1BRLB 1FDYA 1HO4A 1S5TA 3B0VC 2FFCA 5HANA 4J3VA 4O8AA 4A3HA 3SW6A 4OBTA 3SJ3A 1O12A 3FAXA 3GNRA 1NELA 2XM2A 2JQXA 1IWBA 2EJ1A 4FP1A 5EYWA 2AKMA 1ITQA 5FF4A 1XM3A 4A2SA 1XS2A 2A79A 2Y88A 1QASA 1F4AA 1HQTA 3DFOA 2PLMA 2DZTA 1F2JA 1B0IA 3G1AA 1EJXC 1E0UA 3O7UA 5LHFA 5DT7A 4QDMA 1M9HA 2GVJA 3C2EA 3Q58A 2V67A 4Y8FA 1CWYA 4C6MA 4FEZA 3T09A 5A6JA 2OG9A 1EWEA 3SJNA 3UR5A 5CBBA 2DQXA 4IIHA 5C0QA 2CBIA 2QCNA 1TRIA 4FX6M 3E2VA 4JIIX 4F79A 1W3LA 8TIMA 3SN4A 1QK0A 2PDKA 2DIKA 3TN4A 3GD6A 4QCFA 3SY1A 1US3A 3CMJA 1OK6A 1RCXB 4GY1A 5CG7A 1LT7A 2TSYA 5BWAA 3LRKA 4JXCA 5LIXX 4EPDC 5IFPA 1R3SA 1K7XA 4NU7A 1H1NA 1EJRC 1S46A 4PODA 4PL1A 1V6TA 1VD6A 1WAWA 3OQEA 4IP7A 3T0BA 2PTXA 3ZR4A 1UR2A 3GFXA 1R85A 3QYQA 2TPSA 4JEJA 1UWTA 3IK4A 1U33A 2CETA 1PUDA 4B4FA 1NFBA 4KIRA 4PTWA 3VC6A 3WF2A 1FWJC 4Y8EA 5JH2A 2NXHA 3UF9A 3VKKA 1VEMA 3PWGA 3NVDA 4YXGA 1YXCA 3WNLA 4QAIA 2E77A 4U28A 3AMCA 2ZWYA 4MWAD 1JPDX 1QPNA 2VFFA 1TCMA 2HBVA 1L9WA 2ALRA 4I5RA 1G67A 3LCLA 2DT3A 1E6PA 1M3UA 1R9XA 4HPXA 1V6VA 1KRAC 1JAKA 4XAGA 2EQDA 4AWUA 1OVDA 1RP9A 2E68A 1OY0A 1A80A 5E6ZA 4LAZA 1H1YA 3R5EA 2NVCA 3UWYA 1O4UA 3R94A 3RPMA 2YXOA 4YLWA 1CLXA 3SGZA 2EPOA 4FIQA 3THQA 2O7SA 1KM3A 4FOJA 2OFJA 2WBGA 2GWNA 1Y5WA 3UCCA 3UJSA 5DMNA 3WQ4A 2A1YA 3EX3A 1LBMA 2BODX 1OZQA 3NA8A 3RIKA 1FP8A 2V2CA 5J04A 4AIEA 5AY7A 2CLLA 1KO0A 5K3VA 3BPWA 3LPGA 3BANA 3SCPA 4PBEA 3G6MA 3KBMA 3W7GA 3A5VA 4DUOA 1H7NA 5JIPA 3OLIA 1GHRA 3P8IA 3B8IA 5CGQA 2PB1A 4GZIA 1FWDC 3SB0A 2W4XA 4Z0JA 3W2KA 2PTWA 1NQ6A 3HURA 4GI8A 1PDZA 3GWQA 3T4CA 4PZVA 3MKVA 4NT0A 4E3VA 4WR3A 3GVRA 4AY7A 4LALA 1G6CA 2YDQA 3WJXA 4AVOA 5FJIA 3EDEA 3O0KA 1T41A 2CEQA 2V63A 1JF5A 3I65A 1PTAA 1KQZA 1ONWA 3TSMA 1JXJA 3QV9A 3L5AA 3FJNA 5U4NA 3VD4A 4YPJA 3QM3A 4M81A 2WVVA 4EXAA 4HVXA 2Q3RA 5T26A 3WEZA 1EKOA 1G69A 1W1ZA 4DWSA 3LXCA 2VFHA 4LV9A 3VZXA 3STEA 4LUTA 2VCCA 4XUGA 2GGEA 3GDLA 1LLWA 3IPWA 1NQKA 1K8YA 4Y90A 3QC0A 6TAAA 1L0PA 5FSEC 3CH9A 1GOIA 1HL2A 3TZFA 2INZA 4IM4A 1NF7A 4JNZA 3VM5A 5DEZA 3C6CA 4Y9NA 3SCWA 5A6SA 1F7BA 4Y9MA 4PMVA 2NV2A 5HNNA 4XTIA 4ML9A 3T0TA 2V81A 2Z1BA 2J47A 1AW1A 4M7SA 3TLQA 1YQ2A 3TIMA 3LNMA 1J10A 2B7OA 2VR2A 3N2CA 5EFDA 4ACZB 4HA1A 1XKYA 2P1FA 1PIGA 2ZRWA 4KRTA 5HPOA 3FCPA 2WVUA 5MKGA 4IJBA 1R0MA 4Q4MA 5H8MA 4XUYA 4E4UA 4HCHA 1XBXA 3V5OA 3JZEA 1R2RA 2JE8A 4IMFA 1KFWA 4PMOA 5AC8A 1J01A 2CBVA 4IIBA 4JQAA 1E6SM 1E40A 2WMJA 3CQIA 3NGFA 1TPB1 2G0WA 4HHPA 5B7YA 3WLKX 1EJSC 4O1BA 3LGEA 2ZRVA 4PUJA 1M7OA 2HROA 2NWSA 2ZZ7A 1IXPA 1K70A 2HVNA 2X1SA 1XIGA 4HOZA 3P6LA 4IL0A 1IEIA 2Y24A 4DHGA 2ZZ6A 1VF8A 4DM1A 3LXAA 2E0PA 1EJWC 2C6QA 2V9DA 4YHGA 3TYCA 4H19A 4AZHA 1VJIA 1AODA 1IT8A 2E3ZA 4XVDA 4GNKB 1Q6QA 3PTQA 1YRRA 3T05A 4NSBA 4AU0A 1TPWA 2OEMA 4OIFA 5I6SA 3S9ZA 5AKQA 1VHCA 4BF5A 3B8UA 1OFEA 3UYIA 2O9TA 3EWXA 3ZR5A 3SUSA 1WDQA 4ZSUA 4IPNB 1F73A 1PWLA 2IPWA 3PTDA 1V3IA 4UUIA 1RY8A 3VZZA 2QGHA 3IACA 2QW5A 2RDWA 2DVTA 3QKZA 1X1NA 4I8DA 1XG4A 3WMLA 4FAMA 3V1PA 3V0TA 3Q67A 1J2BA 4MUPA 4PMYA 2PBOA 4D6HA 1TG7A 3KBWA 1K8ZA 4AIUA 1VBJA 3NDYA 3W81A 1HKKA 4RZ6A 4P7NA 1GKQA 2QCMA 2VR5A 4JYFA 1YTEA 5CLTA 3WBXA 1AH0A 2C3ZA 2QDHA 4GQBA 2H9AA 3VOGA 3MYOA 3OGSA 1J4EA 4P7RA 1J0KA 1O66A 3UESA 2YL9A 1JFXA 2XUCA 5FJRA 1JYNA 6REQA 1ZJBA 4CCCA 1E15A 1BF6A 4M6PA 4NNAA 3FHQA 2PS2A 1JIBA 2YZRA 1IXOA 3BO9A 3B9NA 2JGQA 1TWIA 2A6LA 4C6PA 5CKSA 3FA4A 3NEVA 4KGJA 3WLRA 1MI3A 2IW0A 2YLAA 4J3SA 2BZNA 3MUCA 2GJNA 3VIJA 1Z44A 2G95A 4PUDA 1C91A 3SUUA 3WDRA 1CXIA 1NY1A 2YR1A 3CWHA 4PUUA 4ZOAA 2ACRA 1DHPA 1ZU8A 3HZ3A 1GQLA 2YPIA 3UYCA 2C18A 3W7CA 1EC8A 4MWAE 1BD0A 3RXZA 3WQVA 3KDNA 2RUSA 1A5SA 1CB2A 4O4VA 3EDKA 1G4EA 2WHLA 3U4AA 1G5AA 5CGTA 1DTUA 1A3WA 1CGUA 3FAWA 3JW7A 2C14A 4MFDA 2ISSA 2QV4A 2ZZ5A 4ZXOA 1SR0A 5EBAA 1KLZA 1VP5A 1O94A 5AZ0A 3C8FA 3PB0A 2X05A 2DVUA 3Q4DA 4QG9A 2DT1A 4AYSA 3GG7A 2X2YA 4JN8A 3C0LA 3UXAA 1EO7A 1ZJIA 1ENUA 3NFUA 4J3XA 3I7SA 4KWVA 3IIVA 5KZMA 2RGLA 3PZGA 4JPGA 3DGBA 1I8JA 3VK5A 1RPKA 4IGMA 3EOLA 4F9JA 3APYA 3ME3A 3G24A 4ZE5A 1O5RA 3L5LA 4QIUA 5HMSA 4UBPC 3FHAA 4WOZA 4IPPA 4P5UA 3VMOA 3EKLA 4BI7A 2XIMA 4N4QA 3UJFA 4MJ4A 5IHSA 5M3WA 4WKAA 1D3GA 2RDXA 4EPKA 3BLIA 1E72M 1QOPA 1NDWA 4ILSA 4ML4A 1XBYA 4O28A 3OHIA 3WQFA 1EP2A 1DXFA 2ATMA 3CWOX 3PZIA 4IIDA 1CLVA 3UZWA 4QHRA 3STGA 3QHMA 4BA0A 3OJGA 1AMKA 4CNSA 1VBGA 3CPRA 1XFBA 5CPMA 5XIMA 3SIMA 1TZZA 1J93A 3QGKC 3W7DA 4HMEA 2PDNA 2JKAA 3G18A 2YBTA 3QPEA 4MPKA 5EY5A 1LWHA 2YYUA 2BMBA 3WK3A 3ARTA 1OIMA 3WL1A 3R8HA 1SW3A 3ANYA 1ICQA 4AYGA 3KWSA 4K2SA 1SUXA 3TFXA 4JBRA 2Z0IA 3PM6A 1XIBA 1KTNA 1IIGA 4HA4A 4JHMA 1YNYA 5IDIA 3USBA 4H6KA 1R7OA 1P6WA 3GXPA 4MB1A 1IGWA 1FKXA 4QDPA 3G1RA 3MSGA 2EXOA 2ZKMX 2OKTA 1ZLPA 4FNUA 3VKAA 3EOEA 4QG6A 5ABFA 4UOJA 5T9CE 2VFEA 4BF7A 3S5SA 4DEFA 3N14A 3NL6A 5ABTA 2WMGA 1J9YA 4XD4A 1J18A 1CB7B 1WCGA 1XPYA 3M64A 3NPXA 5BU9A 1PZ2A 4LPCA 2WZEA 2EG7A 4DN1A 1Q4NX 3GNOA 1QI4A 1R7AA 3UZJA 4ZZ9A 4PC8A 4K68A 2PF0A 5I3IA 3QHOA 4B91A 1MDLA 4WDUA 4F2TA 1XLJA 4AHOA 4IXXA 3NZGA 2C19A 2VGBA 3SY8A 1KXTA 3RRAA 2YYTA 1KXVA 1YMYA 7XIMA 3C2OA 2WANA 1YDNA 1WZAA 1PZ0A 1VZWA 2P8CA 3W2UA 4GIRA 2PP0A 3WF3A 3DYPA 3TYEA 3WL0A 4WD0A 1H3GA 2QCDA 3A4XA 2W91A 3E0LA 2CXEA 1PTDA 4QEHA 3II1A 5KTLA 1DKWA 3EWBX 1AQMA 3IUDA 5I06A 3W71A 5HATA 1QWGA 3DDMA 3WMSA 5IM51 3VGHA 4TX6A 5A8QA 4QR6A 3W7IA 2PRLA 1SMDA 4DYKA 1OCQA 4TUFA 4DYJA 3LMYA 3S6DA 1HVXA 3QBUA 3VCNA 1S5VA 3AUJA 4GFSA 1UKOA 1SO5A 4H9VA 1H0IA 3OG2A 4H9XA 4M3PA 1V77A 2ZRUA 4E3TA 4PSRA 5AFDA 3QOMA 4Y7EA 4PCSA 2Z7KA 3NQ6A 1AFSA 5G1MA 1VFOA 1F5ZA 2DSVA 2I7GA 1YE6A 1BWLA 1MNSA 3ORWA 1TREA 1DPMA 1GVRA 1UD3A 3QFWA 4UB9A 2J74A 3W25A 2P76A 1TR1A 3BLLA 3HG5A 3Q94A 1V0MA 2WWCA 2R6OA 4QLLA 1VENA 2FJUB 2E5BA 1C8VA 3LRMA 4WDTA 4U31A 3GNNA 1CCWB 4D1JA 2OZTA 3VIKA 3EWDA 1GEQA 1W1YA 4ZQNA 3RF9A 2ZADA 4DBSA 3OVRA 3TV8A