2ZFAA

Structure of lactate oxidase at ph4.5 from aerococcus viridans
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
367
structure length
352
Chain Sequence
YNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRDFGMPIVQRYLRGTAEYGASKQKISPRDIEEIAGHSGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactate oxidase
publication title X-ray structures of Aerococcus viridans lactate oxidase and its complex with D-lactate at pH 4.5 show an alpha-hydroxyacid oxidation mechanism
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
total genus 128
structure length 352
sequence length 367
chains with identical sequence B
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zfaA00
2J24A 3BV4A 1KM3A 1F5ZA 1TJPA 2C6QA 3NGJA 3PULA 3P8IA 1TSIA 2GVLA 4JY9A 4O13A 3S5OA 2NWRA 3TDFA 3UXDA 2RDTA 1ME8A 2YW4A 3SW6A 3JRKA 4TU1A 3HBLA 2GPTA 3M41A 5ABTA 1GVOA 1XXXA 2W79A 3BG9A 3S1XA 3CWNA 3LHZA 3W2JA 1HO4A 1DV7A 3LXBA 2QDHA 1MEIA 1O60A 4UNKA 2CW6A 4LS2A 3DH7A 3IIPA 2ZZ5A 5DN1A 4N9DA 1XBVA 4BWLA 2XFWA 3NQEA 1KFKA 3W84A 1EEPA 4L4LA 2NZLA 1Z48A 3LRLA 4MFEA 1W5QA 4O8RA 3JR2A 3LLFA 5D02A 3GNDA 3VCRA 3BW3A 3GAYA 4K7YA 5K3VA 2WKJA 3S5NA 4O4WA 3S6DA 2ZZ3A 3RLVA 3SJ3A 4I9AA 1G6CA 3W1XA 4FIRA 3IGXA 2ZRUA 4BI6A 2WOQA 3I6RA 3WJZA 3LI0A 5C2XA 1OFDA 1EIXA 4IOTA 3VI2A 4O50A 4AMAA 4Y96A 1H7XA 2AGKA 2WNZA 2ZZ7A 1YTDA 3THAA 2RDWA 3FS2A 3KXQA 4O16A 1IXQA 3GYEA 2QCFA 2P0OA 4GUIA 4LVGA 2V30A 1IF2A 5FF4A 1OFBA 5LNUA 1TTPA 3LDVA 4R53A 5KMYA 2ZDRA 1KLZA 2H8ZA 2Y7FA 1W56A 4N6FA 3LCLA 4K36A 1KFLA 3W3OA 3TQ0A 5AYYA 3CWOX 1SUXA 4O1BA 1JQVA 4AHOA 3HPZA 4NQ1A 3DGRA 3F03K 3HG3A 4GUJA 4BI5A 3KRZA 4POCA 2FTPA 1O5KA 4M5PA 3LV6A 4O19A 3GDTA 1KFJA 1YLVA 3C8FA 4UTJA 2ZRZA 2FPTA 3EKLA 2V8ZA 1B3OA 4JR5A 3TNOA 3T55A 3DFOA 3LCXA 3W7NA 1DQXA 3S9YA 4UTHA 3MI2A 4P61A 1E51A 2NXIA 3TAKA 2QEZA 4S2BA 4K8EA 5DY2A 5D2VA 1K7FA 1PV8A 2FLIA 2WSRA 4Z0JA 2C0AA 3A5FA 5C6MA 3W2NA 1ZALA 1NAL1 4UC5A 4AF0B 4R33A 3NPWA 2TRSA 4JY8A 4M7TA 4FEZA 4UR7A 3G1VA 2E77A 1SZGA 2DORA 1G7UA 5DBTA 1OYBA 1K3UA 1QR7A 4A29A 1GOXA 5K9XA 3LHWA 1XL9A 1QPOA 3MP3A 2R94A 4DF1A 3NQFA 3W22A 4MOZA 1FWRA 2C14A 3CM4A 2XN0A 2TPSA 1XM3A 1TPDA 3P61A 1XUUA 3BG3A 1LTDA 3QMTA 1L6WA 3G1AA 4UMAA 1VH7A 4Z1DA 2QJHA 4K39A 2WSYA 1TMHA 1NF0A 3SIZA 3FYPA 1K7XA 3W7LA 3I7RA 2Y6ZA 3I65A 4MZ8A 5BRBA 5HWNA 3LM7A 3OA3A 2QJIA 3B05A 3TW6A 4O0ZA 2EHHA 3W7MA 4DO5A 4LOCA 1GVFA 1WDWA 3W7JA 3A22A 3HG4A 3H53A 4GUHA 4HKPA 6ALDA 4UFHA 1R2RA 4H6KA 5C54A 2RFGA 2ZZ6A 1F05A 2OT1A 2Z2UA 1GYNA 4RXGA 1F73A 4PODA 1JVNA 5LSMA 2WO5A 1GJPA 2Q8ZA 3PG8A 4MZYA 4HSOA 3NR0A 3DXIA 2DZXA 4FO4A 3INPA 4YLWA 1B9BA 1Z41A 1PIIA 3CLMA 2QAFA 2YGYA 1P0NA 5AFDA 2EPHA 3PM6A 5DCEA 2EGZA 2NXGA 3L9CA 3TK7A 4GBUA 3GIYA 3PSVA 1G4SA 3L5LA 2NWSA 4AHPA 3G22A 1YXYA 2Y89A 4ADSA 1OJXA 4BI7A 3W1TA 3R8RA 3QF0A 4MY8A 3ZWSA 2YFOA 3QPYA 1DHPA 5D38A 5J5DA 1OFEA 1O4UA 1K02A 2GOUA 3G18A 3W7IA 1JCMP 3BPWA 3MI3A 4MUZA 2DZVA 1FCQA 3PVFA 1DVJA 4R7JA 3LCHA 3UPWA 3W1RA 4YCOA 4LUIA 3TE9A 3NL6A 3R89A 4EF8A 3TFCA 3UZ5A 1XBXA 4LC6A 2KZHA 5K4ZA 1LRTA 1ZY9A 3M43A 5TBOA 2V5BA 4LS0A 5EPDA 4ORMA 3LCIA 3BW2A 5LGZA 2FPYA 2X2GA 4FXRA 4NNAA 2WPBA 1HTIA 1FXQA 1SO5A 3NL5A 3OEXA 4RLIA 1H1ZA 1BKSA 4KFPA 3NVTA 2H3DA 4EOUA 4EWND 2NV2A 4UTKA 4E0CA 2Y63A 5LHFA 4OV9A 3M5YA 3S1WA 4ICNA 1WA3A 2Z0IA 1FXPA 2CLKA 3GVGA 5DY3A 3PBWA 3N3MA 5BMXA 3W74A 2AQWA 4MKNA 1VR6A 1LLWA 3T44A 3W75A 1SSDA 2YZRA 1IGSA 4IWWA 3CTLA 3EX6A 3PSWA 1B4EA 3G1SA 4QSHA 4GC4A 1EPXA 3G1HA 3TROA 5DXXA 2QJGA 5HWJA 4FX6M 2R8WA 3HOJA 2DZUA 1KM2A 1OX4A 4O12A 2NX9A 2Y61A 3E9AA 4GFSA 4IX2A 1GPWA 1AW1A 3M16A 4DF0A 2CLOA 3ANYA 3NNTA 1DQWA 4WOQA 4DELA 1YXCA 3HGJA 3CB8A 4ZQPA 2GQAA 3L5AA 1A5BA 1TQJA 5HJLA 3GR7A 3O07A 3UNDA 3IVUA 3L68A 1UB3A 1MSSA 1L9WA 1QPRA 3NPVA 3HJZA 2ZZ1A 1VGAA 1TPEA 5TIMA 1GVQA 2RDUA 1IXNA 1XFBA 1KTBA 1UJPA 3N14A 1VLIA 2V2DA 3LBMA 4A22A 4QQ3A 3B0VC 2YR1A 5I3HA 1WXJA 2QCLA 3B04A 4FNSA 3QW4B 4PL2A 2OX1A 1B57A 2V9DA 4Z08A 1TYGA 1RR2A 4ML9A 1VS1A 1OVDA 4I7UA 5D2WA 3BVJA 1LRNA 3LBCA 1EP3A 4JYDA 4CNOA 1L2UA 4DO6A 4PEKA 1XUZA 2BX7A 4LNYA 1OFRA 1G67A 3EWUA 1EP1A 2HS6A 3C4UA 3UY7A 1DBTA 4ADTA 3BG5A 2QCCA 1W1ZA 3TR2A 1WOBA 2QDGA 3B8DA 3TQKA 3DBPA 4MZ1A 3L5MA 4UTIA 3FJ6A 1SZNA 1ALDA 2YXGA 3NXFA 2ZQ0A 2AAMA 1IIGA 1YTEA 4EVZA 2J9ZA 1SW3A 2Z6JA 3M44A 4Z1CA 1FBAA 4UTUA 4N4PA 5HUPA 3P62A 3W1AA 2V82A 2PC4A 3EXTA 3QC3A 1KA9F 1QWGA 3LI1A 5CSSA 3U2OA 3W1NA 1LZOA 4JYEA 5HWMA 2GUUA 3RF9A 1ZCOA 2OCZA 3DI0A 2E1DA 1J2WA 2J88A 3N2MA 4UMCA 1X7FA 2IQTA 5DCDA 4HNUA 4UFIA 5D32A 4TO8A 1ZHAA 2BSLA 4OQVA 3O16A 3W87A 5LZLA 5CGQA 2R91A 1S5WA 1QNVA 3FA5A 1RZMA 2YW3A 2O7SA 4LV4A 1UBSA 2YPIA 1OF6A 4ZVJA 3I68A 4O52A 4XUGA 4M19A 4N9CA 4Q33A 4ZL1A 1S5VA 1T8XA 4IPIA 3DZ1A 4IUOA 1XC4A 3BK0A 5T26A 4FX8A 5AB3A 1QOPA 4PC8A 1JCLA 1W0MA 4RCXA 3TUUA 2UV8G 4E2DA 4H3DA 1TV8A 5IM51 3W86A 1KLYA 3GXNA 3MP5A 1OFQA 3CU2A 3DFPA 5C5YA 5KZDA 1OK6A 2PRHA 4O17A 1C9DA 4XBKA 4XTIA 3L0GA 3TC6A 4FX7A 2NXHA 2QCHA 2D73A 5I3GA 3W23A 4RK8A 3VKJA 1FWTA 1BWLA 3W6YA 3O63A 5K4XA 2ISWA 3W1PA 3WK1A 5F4XA 5MHBA 3UD6A 1Q6LA 2FQIA 2BLEA 4CCDA 2P10A 1JCJA 4G1KA 3C2EA 3THQA 4AWUA 2NX1A 2NV1A 3S5ZA 8TIMA 2ZYFA 4ADUA 3C61A 3QSTA 2WNQA 4OHQA 2BZNA 3C2VA 1RQEA 2HTMA 4LVFA 2XN1A 4AWSA 1KV5A 1QOQA 4JDYA 1WV2A 4XZ9A 1JCXA 4GUFA 3PS7A 4LVDA 1W5OA 1H62A 5D04C 1O94A 4QISA 1FUYA 2G96A 3W88A 4Y8FA 1LRQA 2RHGA 2Y88A 4FNUA 4UTLA 1Q6RA 3W2MA 4QIUA 2TSYA 1LORA 3KOFA 4O54A 1C29A 1AL7A 3KRSA 1WX0A 1EB3A 1I2QA 2DP3A 4LRSA 5D2TA 1RD5A 1H7PA 4Q32A 1OFAA 3S0CA 1SO4A 4HHPA 3RLUA 1NFBA 3QM3A 3TMQA 5G5IA 3KFTA 2ZFAA 1DJQA 2H3BA 2JBMA 5CZJA 3ABOA 4NUWA 3EX4A 1LLZA 1FCVA 1JUBA 2R14A 3G1FA 3NQ8A 5AHNA 3LHTA 1GWJA 1I45A 1QPQA 5AHLA 3HPSA 3G1DA 3W7PA 2DZPA 3IGSA 4DBDA 3USBA 4RR4A 4YXGA 1NF7A 1EX5A 2ABAA 3BLEA 4O0KA 3P81A 3MYOA 3STGA 1XBZA 1OABA 2I1OA 2I9EA 3LTSA 5CZ0A 3TKFA 2A21A 3W1MA 1P0KA 5H2ZA 3M6YA 4WY0B 2CLMA 5AC7A 3NL3A 2E5BA 1PCKA 4AF0A 3N9RA 3SR7A 5CZSA 5D37A 4PH6A 2Y70A 2RKXA 5DBUA 1SPQA 1W31A 5AYXA 1W3IA 2Y85A 3RFAA 5FF2A 4FNPA 5TQLA 1SFJA 5AHIA 3W1LA 2LLEA 1ZAIA 3HMJG 3EWXA 3LGEA 3EX2A 3E02A 1KFEA 1LP6A 1TTJA 3B06A 2NUYA 3IIVA 5U7SA 4IXXA 4NU7A 3PBUA 3W1UA 3GKAA 1YADA 4NNCA 4I7VA 1GZGA 3F1QA 2GVGA 2Z6IA 3C2FA 3MO7A 3IRDA 4JTIA 1D3GA 3C2OA 4ZQMA 4Q4KA 3L0NA 2NX3A 3JS3A 5CPLA 3P7YA 3IIXA 1Q3NA 3W7DA 2CZDA 4QM1A 4HNTA 5KINA 3GK0A 3CIXA 2YSWA 4Z1AA 4LS1A 3AO0A 4CNNA 1H7OA 2ABBA 1Z42A 3KVMA 2A4AA 1WBHA 4IMEA 1XDLA 4LVBA 3NZRA 5U4NA 1KM6A 1UUOA 1W5MA 2ISSA 3F4WA 3B0PA 5FEWA 4WZHA 2E6FA 3TQVA 1VHCA 3TV8A 5DELA 3W76A 3TAOA 3P74A 2C19A 3VE9A 2J9XA 1C8VA 4KWWA 1F6KA 5FESA 4MPQA 2QAPA 5I3FA 2WNNA 5F1UA 1JCNA 1EP2A 4A2RA 2H90A 4C1KA 2V0TA 4E2BA 1W5PA 3LRMA 2VC6A 4ONVA 4UTMA 1Q6QA 3DFTA 1YPIA 4UR8A 3M9YA 3QYQA 4A21A 1L6YA 2J9YA 1YPFA 4JX4A 1H51A 4MJZA 3E0IA 1KTNA 4MYAA 3P84A 1V5XA 1VCFA 5I3JA 4GWEA 4A2SA 1AG1O 3O6DA 4NZJA 4IGHA 5I3KA 2Y7EA 2I14A 4P2VA 1QO5A 4MIMA 3NQMA 1EWEA 1KBIA 2DZTA 2ZA2A 5G4WA 4GXMA 1JCYA 3C56A 4XWUA 4GRSA 1O5XA 1VYRA 2Q3RA 3FYOA 2E6DA 3G24A 2X16A 3FLUA 1GTEA 2A0NA 5L9FA 1ZNNA 4NT0A 4YWIA 5EMUA 1HO1A 4IJBA 1SO6A 2GJLA 2QF7A 3W7QA 1MEHA 5AHMA 4MY9A 4RX0A 4OWGA 5DCBA 1T96A 1A53A 4WUIA 4N4QA 2B0MA 5LNWA 2E5DA 4NXSA 3UWUA 4FNQA 3QW3A 2JK2A 4CCEA 1I4NA 3ZR4A 4MJMA 1FCUA 2A85A 3O05A 2YYTA 4E38A 1TTQA 5CKSA 5FEZA 2QCEA 1S5TA 4OV4A 3G8RA 4N6EA 2DZWA 4DO4A 3UQNA 4MFDA 2VEPA 4JIQA 1YDVA 4O28A 3QMRA 2PURA 2PCQA 2WSQA 3GXPA 3R5EA 3S1UA 4UCGA 4A3UA 4DEFA 3T4CA 3ABQA 4GNJA 1MEWA 3RU6A 4UFJA 3R13A 1D3HA 3EXRA 4FXSA 4MLJA 5HR7A 3D0CA 4H4IA 3MYPA 1ZAHA 1IXOA 2H6RA 1ICPA 4JGDA 3W73A 3HF3A 4HNVA 1OG0A 4Z1BA 1SFLA 3U8GA 6TIMA 3C6CA 4WXYA 2WQPA 4PCFA 3WFAA 4LRTA 4NJJA 4DF2A 4M6PA 3NA8A 4JICA 3N2XA 1SZFA 3PB2A 2FB3A 3QH2A 3LCWA 1TPFA 3GNNA 3R2GA 3OG3A 1HG3A 3W83A 1EA0A 4RJEA 2EAWA 3W85A 1FDYA 2X1UA 3V1PA 1FWNA 5D09A 1G4TA 1H1YA 3P5YA 1UCWA 1K03A 4WXZA 3KAOA 3SSJA 3HGSA 1ME9A 1VYSX 5D2YA 4M6VA 1FWWA 1T99A 5HUOA 3GLCA 3TA6A 2WV8A 3GDRA 3NM1A 2QCDB 2VEIA 2NLIA 4KKXA 4TR9A 2TMDA 3NEVA 5HQEA 2X1SA 1XI3A 2A6LA 3L0KA 4FB7A 3V75A 1W5NA 3BARA 3GDKA 4ZQNA 1SQ7A 3SFKA 4WD0A 1FCBA 2ATSA 5CZTA 2ATMA 4UFKA 3VFLA 3LHYA 1YTKA 2CWNA 5K7JA 3R12A 4O57A 1SZEA 2GVJA 5FI8A 4CQ8A 3S42A 1F76A 3O06A 1R2TA 3LXCA 5EBUA 2A1YA 3W2LA 1H7NA 3PC0A 1Q6OA 3MHUA 1G4EA 2E6AA 2VFFA 1GG1A 1FY6A 4JTGA 2JKPA 1JJKA 4O15A 3IIZA 5AYZA 1J5TA 1KM0A 2ZTKA 4PL1A 2CFFA 5LGXA 2B7PA 1F7BA 4AH7A 3WK3A 3FFSA 4LW7A 1WOAA 2E6YA 5CSRA 3HO8A 1M6JA 3S8HA 1OHLA 5G1TA 1Q45A 1VC4A 5K9DA 3Q94A 4MLRA 3W2UA 2A7PA 3N34A 3EEGA 3NL2A 3ZFHA 5SWUA 2E09A 1AW2A 4NVTA 1LROA 5D05A 4UFMA 3CT7A 4JXCA 3W7OA 4GE8A 3GDMA 3IEBA 5IBXA 5BNKA 3ABRA 4QITA 4HIBA 1LBFA 1IIHA 3WJXA 1U5JA 3ATYA 2CZ5A 1SW0A 3PBVA 4IXHA 5CG7A 3UWYA 3S1VA 1RQBA 4C1LA 1GEQA 2CZFA 3DKJA 3UZJA 5G2IA 1PE1A 2PE4A 1K8XA 4X22A 3P5ZA 1N8FA 3UWWA 1K8YA 2A5HA 3LRKA 4N2YA 1H60A 3BLFA 1EWDA 1WBJA 2G97A 4IMFA 4NJHA 1LDCA 3NQ7A 3LB0A 1X1OA 4ZQCA 5LHEA 3L66A 4FHAA 2PRLA 1ONRA 2QCGA 5L6UA 4RZ6A 2E5CA 2HSAA 3KX6A 5G2WA 3PG9A 5KITA 1N55A 3OBKA 4TIMA 1G7VA 4JTLA 1CW2A 1BTMA 3P82A 3NQ2A 4YL2A 3SGUA 3NQCA 1W54A 5C55A 7TIMA 3SZ8A 3DHFA 1H63A 3RK8A 4U28A 1KTCA 1TPB1 3BGGA 4Y90A 2NUWA 3W70A 1SW7A 4K6AA 1DKWA 1M5WA 3EWBX 4K8HA 3NOEA 4O4VA 2C3ZA 3FEMA 1O95A 3TSBA 1JRBA 3DFNA 3G3DA 1TO3A 5D03A 2VFDA 4JDBA 4JYFA 1FDZA 5H91A 4KWVA 4IPJA 1W3TA 4XKYA 4HNNA 1G69A 2JGYA 1PVNA 3GB6A 2OMAA 3G1XA 1PCWA 2G95A 3B0UX 4U4MA 5E93A 1BWKA 2JGQA 3A9IA 4KFNA 1TB3A 4QNWA 3H55A 4NJIA 4AB4A 2A7RA 3G1YA 4RZ4A 3QPZA 1H50A 4ZQRA 2GQ9A 1LBMA 5EA9A 2TYSA 3B03A 3LHUA 4PTNA 3LTPA 1AL8A 4JD4A 4Y9AA 3TH6A 4HSNA 5K2ZA 4RXFA 4NJGA 4JX6A 1LOLA 3Q2DA 5FEPA 3W2KA 5EYWA 2DZSA 5I3IA 2F7FA 2VFGA 2QCMA 5EKYA 4LVAA 2DJXA 4JTFA 3PWAA 1GVRA 4K38A 2A6NA 2BTMA 3EB2A 4O11A 5BOOA 3NO5A 4TX9A 3CPRA 3GKFA 4XKYB 3DFSA 3ZWTA 1OX6A 1A50A 3W7GA 5K9CA 2YX0A 3O6CA 1OFPA 1DOSA 4ZMGA 4JTKA 3WK2A 3MP4A 4M7SA 3GZ3A 4OU1A 4WY0A 3HGRA 3G0XA 3QEZA 3CC1A 3FOKA 2ZTJA 3LERA 1R46A 3F4NA 1VJIA 1JUEA 4TMBA 3M7WA 4FF7A 2YCEA 3O8AA 2JKAA 4IMGA 1PHWA 3GDLA 2ZRVA 5CPNA 1VYPX 1F2JA 1VQTA 4NJKA 3ABSA 1K7EA 3MWAA 4RZ5A 4N9BA 1TPVA 4UUIA 1ML1A 1LOSA 1KFBA 2QCNA 3N9SA 5CPOA 5E0KA 3TJXA 1TRDA 3EX3A 5FF3A 3OVPA 3RMJA 4UTWC 2Q3OA 4UIOA 3P80A 4J9JA 1LOQA 3FKRA 4UFLA 2C18A 3L65A 3M47A 1T0OA 4K37A 1Z44A 2CLHA 5DXYA 1VCGA 3LTYA 3N73A 2FDSA 3GR8A 1KM5A 2QUUA 4JTHA 5BMWA 4ORIA 3QJAA 1V7YA 1SU5A 1UUMA 1NVMA 3K30A 3EWYA 2VEMA 3W7KA 3G0SA 5F2IA 3SECA 3UWQA 4DQWA 3O1NA 5D30A 3PUEA 1XKYA 4HN4A 3DKLA 4LC8A 2ZZ4A 5G4EA 1TPH1 1VLWA 3MI6A 3TFXA 2X30A 3UY8A 3QMSA 4OGZA 3EWZA 2HMCA 1KV8A 4AHQA 2BWGA 4FNTA 3PR2A 1CX9A 3IIOA 3KVKA 1XDMA 1KW1A 1QCWA 3BGJA 4AXKA 4UTWA 1PS9A 3ELFA 3YPIA 1VZWA 2X1RA 3BLIA 3W07A 1YDNA 3I7QA 1VPXA 1WQ5A 1EUAA 1R47A 4JN6A 3WJSA 2VENA 2G5WA 5KZEA 3W7RA 2ZCGA 3TXZA 5HNRA 4O10A 3M5ZA 3KRUA 4QNEA 5LNSA 2VFEA 1A5SA 2ZBTA 4UTTC 3Q58A 2V5LA 2Y62A 1R2SA 4JEQA 3SY5A 3TC7A 1DORA 1KM4A 1P4CA 2C16A 3W7EA 2ZA1A 2J6XA 4K7VA 4DPQA 1OF8A 1SSGA 5F4WA 3NPUA 3CEPA 2P1FA 1QFEA 3CIWA 4XBSA 3LCGA 4JTSA 3DI1A 2FFCA 3TW7A 4LUJA 2VEKA 1M7PA 3HG2A 4EF9A 1TQXA 2VELA 2E68A 3CEUA 3STCA 4O1DA 4DXVA 1L6SA 1FQ0A 1OK4A 1F6PA 3MUXA 3C0JA 4XQ6A 4AEOA 4O1CA 2FIQA 4Y6GA 4JS3A 3IGUA 5AOUA 3EWWA 4M6QA 1OYAA 4CCCA 3NQVA 4WJEA 1TV7A 3L21A 3MW7A 1JUKA 3QQ0A 3NQAA 1QPNA 4O18A 1H7RA 4UTTA 3I7SA 2ZRXA 4DPPA 3NPXA 2QUVA 3UWZA 4QAIA 5LKYA 3UXAA 4JTUA 3PBYA 1VHNA 1I2PA 1R30A 2BXVA 4X3ZA 3TMLA 3W72A 5KTLA 3DFQA 5D2XA 3GXTA 3QSRA 3PAJA 1KBJA 4LU0A 3C2RA 3QFEA 3MJYA 3AJXA 3NDOA 5HULA 1I2NA 2EF9A 4LV9A 5BW6A 5LNRA 2DJLA 1FX6A 1Y0EA 1ICQA 1N7KA 2B7NA 1LM1A 2CZEA 4TMCA 1EUNA 3PB0A 1XCFA 4PFMA 1DJNA 4ZQOA 4AVFA 1QMLA 2F84A 1YDOA 2YFNA 2VOMA 1TPUA 3ATZA 3DU0A 4GJ1A 4Z0SA 2CU0A 2OZ0A 1X8FA 2C13A 3CQ0A 2Y7DA 1JQXA 4YMZA 1XBYA 1TV5A 3SI9A 2W0UA 3NQGA 3FJLA 4MY1A 1SO3A 1RQHA 4IX0A 4OE7A 4LY8A 5HINA 1KM1A 4NNBA 5EL1A 4D2JA 2V81A 4KFOA 1H61A 2OT0A 4MYXA 5DLCA 5FEXA 3LV5A 1G4PA 3TXVA 1M7OA 1D9EA 5A5WA 3NG3A 2QR6A 1OX5A 2A7NA 1HFBA 2H8XA 4S1FA 4CLMA 3MMTA 4N02A 4O53A 3NQ6A 2GQ8A 1I2OA 2PRMA 1NEYA 1OYCA 2ISVA 1PL9A 1TCDA 2DU2A 3W9ZA 2QCDA 3PY2A 5GVJA 3FKKA 1W37A 4WX2A 3KVJA 3DENA 2YYUA 3LHVA 4LT9A 3NZ1A 1P1XA 3KVLA 3QQ1A 1KFCA 2GJNA 4UXDA 1X6UA 4W9TA 3ZS4A 1P5BA 3O15A 4MVAA 4ZZ9A 2FB2A 1RV8A 4LTSA 1GG0A 1U83A 3M5XA 5D33A 5AC8A 4NZFA 4OT7A 3QZEA 3A24A 4R34A 3HGOA 3Q37A 4S2CA 4X9SA 3DAQA 5EY5A 3HIJA 1HL2A 2Q8LA 1LCOA 4NX0A 1SR9A 2FJKA 4BF9A 4BR1A 3GX9A 3C52A 1GTHA 3HPXA 4RKAA 4JIPA 5F2GA 3STEA 3TX9A 2QUTA 3A5VA 1OFOA 2CLLA 1H5YA 4GUGA 4B5NA 1ADOA 3TSMA 1TPC1 1WAUA 2V2HA 4HPJA 1RPXA 4JTEA 4NXKA 1TIMA 5IBXC 5FF0A 4QJ1A 4RV8A 2V2CA 5A8GA 3UPBA 3T40A 3MBDA 2ZRYA 1GVSA 1MZHA 1NSJA 4PA8A 1GYLA 1A5AA 3PUDA 3M0ZA 4IQLA 4LWWA 1MXSA 1TJRA 3M5VA 3NAVA 2O7QA 3A23A 3P8JA 3L67A 1CI1A 2QKFA 5HMSA 3B4UA 1LYXA 1B4KA 4JTJA 3T7VA 5AN7A 1AK5A 4YCPA 3PUOA 3RNDA 1A5CA 1FDJA 2B7QA 3TU9A 3HQ1A 2A2IA 3LLDA 1OX4B 3MBFA 3E96A 3W71A 1THFD 1HUVA 4EIVA 3DHDA 1RVGA 4UNLA 2C15A 1ME7A 4FIQA 2YDAA 2B4GA 2FPVA 3H54A 1TREA 5F4SA 3LCFA 4FNRA 3N19B 4ALDA 1AW5A 3SGZA 2J27A 3HB9A 3NYZA 4BK9A 1WYIA 5E1QA 1F74A 1S3HA 5J5RA 4IMCA 2VFHA 1PHQA 2X1TA 3IV3A 2W6RA 3EXSA 2ZRWA 1ZJIA 1TPWA 1AMKA 4JX5A 3FIGA 3KHJA 5FF7A 2C1HA 4IMDA 3P60A 3HG5A 3A21A 3E49A 4L4MA 3BW4A 3P67A 3TJLA 5G1YA 3G8EA 3LXAA 5AHEA 5LNVA 2HS8A 5F2MA 1JRCA 4AWTA 1QO2A 3EKZA 1UASA 4CNPA 2WJZA 2ALDA 4WY0F 2Z1BA 4HPXA 3WK0A 3QRHA 1H7WA 4BFAA 2CLEA 3OVRA 4I7WA 1TTIA 2RH9A 3NQDA 3G3MA 3LX9A 1J4EA 1VRDA 1BEUA 3T78A 3IVTA 1YYAA 1ZENA 5KSWA 1GQNA 4OBTA 3C3NA 3UYCA 3NM3A 1GT8A 4CQ9A 1K8ZA 3BO9A 2JKEA 4WOZA 3OVQA 3VNDA 3W7HA 4NX5A 3G0UA 2EKCA 2Y7GA 1FWSA 1W8SA 5AC6A 2CLIA 4X2RA 1QAPA 3LOTA 2ZA3A 3MHGA 2B7OA 4WQ6A 4O1AA 2CLFA 1ICSA 1ZAJA 3M1ZA 1TRIA 3UWVA 4HT3A 3O6YX 2NUXA 5G2HA 5HR6A 1LBLA 2VKZG 2ZZ2A 4XTDA 4JTTA 1JR1A 5AHFA 1QDSA 1W3NA 3E12A 4UMBA 1ZFJA 1I2RA 1JULA 4JNMA 4BWLC 5F2LA 2VXNA 3PF3A 2OJPA 4CQAA 4DBEA 3WJYA 4N9EA 2XN2A 3STFA 3EX1A 3CHVA 1I8JA 1VCVA 3S5YA 4O14A 3VE7A 3MHFA 3W7CA 3TCEA 3IVSA 3TSDA 2VFIA 3GAKA 1YXDA 3OIXA 1MO0A 3WJWA 5KZMA 4AAJA 1X1ZA 3TIMA 3W1QA 5F1VA 5CPMA 1DL3A 3OHIA 3L2IA 1IXPA 3U6WA
chains in the Genus database with same CATH superfamily
3H22A 3CUZA 4HMEA 3BV4A 1TJPA 3P8IA 1TSIA 2ZX7A 2RDTA 1ME8A 3MQTA 1KBLA 6A3HA 2OO0A 1GKPA 3URBA 3F5LA 2IKHA 2XH7A 1XD1A 1TWZA 1HO4A 1OSEA 3LNMA 2AL2B 3ZJ7A 1CGTA 4LS2A 3DH7A 3IIPA 3WUFA 3RX4A 4MWAA 1B3VA 3LRLA 1KD0A 3XIMA 3LLFA 3A4JA 5D02A 3VCRA 5JVLA 2ZZ3A 4GABA 4FIRA 1BSLA 1EJWC 2WOQA 1WKYA 3M6DA 3CUXA 3LI0A 1GORA 5C2XA 2ON3A 4H2HA 2OYKA 3GNRA 4NYUA 4EP8C 1YTDA 3GYEA 2QCFA 1ONXA 1OFBA 3ES8A 1TTPA 2ZDRA 2OQYA 2OGYA 2Y7FA 4HU4A 1D8CA 3LCLA 4QHRA 1UR8A 4HMCA 3CWOX 3LPFA 2VRKA 2Y8VA 1R3SA 1NJJA 1Q8AA 3DGRA 3F03K 4K1GA 3U7BA 3KRZA 4CN4A 1O5KA 3SN4A 3ZJ6A 1D8WA 3AXHA 4O19A 4GACA 4UTJA 1U1UA 4PUWA 3FSTA 3EKLA 4IFKA 1KQYA 3LCXA 4P61A 1E51A 3CL8A 4K8EA 5JMUA 1HF6A 4OFCA 4Z0JA 4AZ7A 2D0HA 5GJPA 3T08A 1DXIA 4AF0B 3NPWA 4DLMA 4FEZA 3G1VA 1XYZA 1UUQA 1XWYA 2E77A 1SZGA 3VNKA 5DBTA 3AIUA 1BD0A 3TC3A 1J0IA 1GOXA 1P7TB 5K9XA 9RUBA 3MP3A 4DF1A 1GOIA 3NQFA 1E1CB 4AZBA 3DN5A 3W22A 1FWEC 4MOZA 4FLRA 3MJMA 3VX1A 4IIFA 1AQMA 3SIMA 4HN8A 1EDGA 4C7DA 5G4HC 2R1LA 2YL9A 1LTDA 3PUGA 4DWSB 1MFVA 4Z1DA 2QJHA 2WSYA 3FYPA 4MB5A 3H2AA 1MW2A 7A3HA 5BRBA 2VEFA 3LM7A 3OA3A 2QJIA 3B05A 1V02E 2XVGA 2X41A 1GVFA 4RZBA 3QLLA 1UC4A 4HKPA 4J3TA 1GEHA 4H6KA 4AD2A 1UD2A 3GIQA 3GTNA 2ZZ6A 1F05A 3D5HA 4RXGA 4ZSTA 2PLCA 3R11A 3FA4A 1GJPA 3PG8A 3NR0A 2FHFA 4FO4A 3WEOA 3VM5A 1UH2A 1B9BA 1BF6A 1PIIA 2PC8A 2QAFA 2GVYA 4Q4SA 1BAGA 2EPHA 1Q4WA 2REQA 1R3QA 3PM6A 2XTKA 2CERA 1XLHA 2Y89A 3UG5A 3E5BA 3VGGA 2X42A 4C6OA 2XYLA 3EKGA 3R8RA 1BVWA 2J7BA 3ZWSA 2YFOA 4IIEA 2C79A 5D38A 1NWUA 5J5DA 2XGBA 1OFEA 3IV8A 1E4NA 1BSIA 1SMAA 1HJSA 3G18A 4NKCA 1PTAA 1HGYA 4YJ5A 3PVFA 1DVJA 2EO7A 3LCHA 4HNOA 3UPWA 2G0WA 4YCOA 3QZAA 3R89A 2XIJA 3AS0A 4IPNB 2ZUNA 5K4ZA 4LFYA 1FHDA 3WIJA 1WAWA 4TVDA 3M43A 1KRCC 2VDIA 3WL0A 1DWJM 3CO4A 3GXDA 2AKZA 2X2GA 3PWGA 1Y5XA 4NNAA 1REQB 4DN1A 1SO5A 3NL5A 5CZKA 1H1ZA 3E0WA 4AD0A 1BKSA 1XHGA 1HKKA 3TNBA 4KFPA 2OWCA 3VKDA 1P6BA 2H3DA 3LNPA 2D2OA 3S1WA 1FXPA 4GYJA 4XIAA 5BOFA 2YIHA 2RUSA 3PBWA 3TYBA 4MNJA 4F2TA 3MCOA 4IL0A 3W75A 1QATA 3U48A 1PIGA 4PR4A 1W2PA 5DXXA 4W84A 4QE1A 2H9AB 2NX9A 2Y61A 1UD5A 3HMCA 3B9OA 2GZXA 3F7JA 4EAMA 1PKLA 4LUSA 2ZC1A 4WOQA 3MC5A 4M24A 1UR1A 3EMZA 3HGJA 3CB8A 2Z00A 3MKKA 4ZQPA 1OIFA 3DFYA 3GR7A 4JZ5A 1W9PA 3IVUA 3L68A 4CD7A 3NO3A 3ICJA 3VUPA 3AHZA 1VGAA 2YCIX 1EHAA 2RDUA 4JAWA 3WLOA 4GQ0A 1IXNA 3P3BA 4B9YA 1XFBA 4OUEA 3L4TA 2QMKA 3LBMA 4IL2A 1WXZA 2QCLA 4V33A 5MKGA 1DIDA 4HNCA 4GVGA 4Z08A 3SCWA 1RR2A 2PGRA 3SQLA 3B9AA 2J79A 1Q6EA 4F79A 1BKHA 3LBCA 1SJCA 5C8BB 2BX7A 4EAYA 4AQLA 4LNYA 1OFRA 1XYAA 1PEZA 4HU8A 1XLAA 1EP1A 1RSCA 1ZUAX 2HCVA 4Y9MA 3UY7A 2CBJA 3BG5A 2QCCA 3QFWA 4KIEA 4XISA 2PTXA 3OZPA 2WMFA 3TQKA 2WSKA 4LEQA 3C2YA 4W8LA 4UTIA 2VQTA 3L5MA 2R1KA 4H9UA 1ALDA 1YDYA 1TVPA 4EVZA 1SW3A 1UD6A 4O0QA 3U57A 1XG4A 4X2PA 1OINA 3GXMA 4XVDA 4WLCA 5CSSA 3AXXA 4I3GA 2PLKA 2WMJA 2A79A 3N2MA 1E72M 2IQTA 5DCDA 4LB3A 4GJIA 1ZHAA 1QNRA 4M80A 1TA3B 3DG7A 4LF2A 3O16A 4GVFA 5CGQA 1CBGA 1S5WA 1RZMA 4BQ5A 3NSMA 2YPIA 4YYCA 3W82A 4Q33A 3RPDA 3IJIA 4PMQA 4MG4A 4BQ2A 1LF1A 2PBGA 5T26A 4QQUA 1CB2A 3GNXA 1UIOA 4WJ8A 3PJUA 4H3DA 4P8XA 1US3A 1TV8A 3GXNA 2PBOA 3MP5A 2J47A 1DP0A 1OK6A 2PRHA 4XTIA 1EO7A 4AD3A 4FX7A 2HZGA 4GIAA 3B8WA 3RR1A 5I3GA 4RK8A 2XIIA 1ONEA 4LAZA 4EACA 1IQ8A 5K4XA 3WK1A 3U9IA 1R8LA 2BXZA 5FSDC 5F4XA 1QI0A 5LIKX 3BTNA 3L4VA 2Z1VA 1GHSA 3KTXA 2QYGA 1DXEA 5DMNA 3THQA 3WF0A 4B9ZA 2NV1A 3S5ZA 1IEWA 1KC7A 4ADUA 2PDKA 5I06A 4OHQA 1X38A 3WELA 2BZNA 2HTMA 4LVFA 2XN1A 4AWSA 1SVDA 1JCXA 4B16A 4KRTA 4GG9A 4YVPA 3NUKA 2ZX9A 2G96A 1S2CA 1FFRA 1LRQA 2RHGA 3EWCA 2Y88A 3W2MA 1PX4A 4QIUA 3KOFA 3SQMA 5A6TC 1WX0A 1EB3A 5D2TA 4LRSA 1H7PA 3DCPA 2GWNA 2P50A 1NFBA 3QM3A 2ZFAA 3RM4A 4PEEA 3EX4A 1EJ7L 1LLZA 3EAUA 5I07A 1FCVA 5AHNA 3NQ8A 2VEGA 1MDRA 1QPQA 3FXGA 3UR8A 4HPHA 4NZ5A 3IK2A 3G1DA 4S3KA 4DWSC 2VMFA 3IGSA 4DBDA 4RR4A 1IEVA 4H7CA 3SCUA 3PHAA 1UPMB 3W27A 2DT0A 3B9DA 3MYOA 4GY0A 3VX0A 1XBZA 1EQCA 3QY7A 2I1OA 3LTSA 5CZ0A 1A3XA 1P0KA 5H2ZA 5F7UA 2CLMA 3LN3A 3NL3A 1R9XA 4D6JA 1PCKA 4AF0A 4ICCX 4LAOA 3SR7A 2OKTA 5D37A 1DPMA 1XIDA 5DBUA 1SPQA 2DUXA 5AYXA 2G37A 2Y85A 3IUHA 2WCAA 5AHIA 3W1LA 2LLEA 1ZAIA 3HMJG 3BLPX 1P7TA 3LGEA 3E02A 1KFEA 1LP6A 1TTJA 2DZBA 3AWNA 3B06A 5U7SA 4DM2A 1E1CA 4NU7A 4OBRA 3PBUA 1BF2A 4I7VA 3PTDA 2IPFA 5JUVA 3DESA 1PDZA 3IRDA 3C2OA 4DWSA 4ZQMA 4XZMX 4H19A 2P8CA 5CPLA 3IIXA 5DQPA 4QM1A 1XLIA 1IEIA 1MXGA 4KEVA 4AIBA 4KESA 5I2UA 4CNNA 1V3HA 1RA0A 1WBHA 1A5KC 1XF0A 1E70M 3VCCA 4HGXA 1KM6A 3ARXA 1UUOA 1XRTA 4KCUA 5FEWA 1HJXA 1ENUA 3M0YA 3LQLA 2QIIA 3EPMA 1ZBWA 2J9XA 1EBHA 3BLLA 3OIHA 1OB0A 2QAPA 4MPQA 5I3FA 3H7UA 1NWRA 2NSOA 3VOIA 5F1UA 1W5PA 4M0XA 3DHPA 1ECQA 3A3HA 3CAKA 5CLWA 3AISA 3W28A 1YPIA 4A21A 2J7HA 1TR1A 1L6YA 4Q7BA 5BWAA 3BMWA 1RA5A 4P8VA 2CHNA 5J8LA 4MYAA 3H24A 3WLHA 1JZ4A 4GWEA 3UF9A 4A2SA 3O6DA 1ZGDA 4IGHA 2ACQA 5D9MA 1QO5A 3AJ7A 2DZTA 2ZA2A 1W32A 3KDOA 4XWUA 1T6MA 1VYRA 4MHBA 4G56A 1V0LA 1WKEA 2XVLA 3FLUA 4HNLA 1AH4A 2A0NA 1ZNNA 5I77A 3GDBA 3I6TA 1HO1A 4N7QA 3WEMA 2ZX8A 3L7RA 3H21A 4RX0A 1UWTA 4D8ZA 1E0XA 3AHXA 1REQA 4H8HA 4N4QA 2V38A 4K8GA 4FNQA 2UBPC 1I4NA 1EBGA 1FCUA 2A85A 4C6MA 3O05A 3VDGA 3LMZA 4E8CA 5FEZA 2QCEA 1S5TA 3ALFA 1YBQB 1US2A 1H0GA 4DO4A 4DUXA 4W87A 3RRXA 3MT1A 4O28A 3B97A 3EPNA 4US5A 3WDQA 1IE7C 3CBWA 4Q6JA 2ZUTA 3S1UA 2NQHA 3THDA 2FH8A 5JIPA 2NSXA 4Q8WA 2H9AA 3RU6A 1JYVA 4DVOA 3RM8A 4W7VA 1D3HA 4XD4A 1W9UA 5HR7A 2O92A 3BANA 3D0CA 3MYPA 5CG0A 2PF8A 1ICPA 1K9EA 4JGDA 2CCRA 1KR0A 4J3SA 4Z1BA 1SFLA 1A3HA 4PCFA 3WFAA 3WH6A 3RR4A 4JICA 1SZFA 3PB2A 2FB3A 1TPFA 5FJRA 3JVAA 2VC5A 4GI9A 2X1UA 2DVTA 3V1PA 1H1YA 1UCWA 1K03A 3SSJA 2PWVA 3HGSA 1AA1B 2EJAA 1P0DA 5D2YA 3K4AA 1FWWA 3NDZA 1T99A 3WH5A 3GLCA 2Z29A 3MU7A 4KCVA 4O1FA 2TMDA 3R58A 3VOHA 2X1SA 1XI3A 2A6LA 4ZOEA 3L0KA 4FB7A 1W5NA 3ZVIA 4ACYA 3GDKA 3AIBA 4ZQNA 1KRAC 3VUSA 3BMXA 4GY1A 3TN4A 1DJHA 3KP0A 4MTVA 2DY3A 2NT0A 3AHVA 1SZEA 3CK5A 3M0VA 3E74A 4LXFA 3GU2A 3RUBL 1E6RA 5EBUA 3CNYA 5D8ZA 1Q6OA 2G3IA 2PTWA 3K1GA 2VFFA 4EKJA 2HQAA 4Z2LA 3EDDA 4JTGA 3AFBA 1GOWA 1Q6CA 1DJWA 2CFFA 5LGXA 1NDYA 2QZRA 3WK3A 3S8HA 2O9PA 1Q45A 1CXFA 1AW2A 1JGMA 1RY0A 2HVOA 4AC1X 3V3WA 4Z42C 4JXCA 3GDMA 3ORWA 4QITA 1U1JA 2YJQA 3VGFA 2QJMA 2J77A 3AMCA 3MWCA 4P7NA 5CG7A 3UWYA 4B3ZA 3S1VA 3RX3A 1ITXA 1GEQA 2CZFA 3DKJA 5G2IA 1X6LA 4N0RA 4KWUA 1N8FA 1PX8A 4UR9A 3FY1A 3ZLGA 3UESA 2G97A 4G1NA 3EMQA 3LB0A 4FHAA 2PRLA 5L6UA 4RZ6A 2E5CA 2HSAA 3PG9A 4GYFA 4CU8A 1N55A 4TIMA 1G7VA 1XG3A 1BTMA 1HT6A 3NQ2A 3OGSA 1W54A 3DHFA 1XH1A 1H63A 1GJWA 3CV2A 3K4WA 1KTCA 2KAUC 3BGGA 2NUWA 3O7UA 3WLSA 3TTSA 2OLAA 3G77A 3O6AA 4K8HA 4O4VA 1O95A 1PIFA 5FJTA 2F38A 2OYMA 2VFDA 1S5NA 1W3TA 1KXHA 1PBGA 1O68A 1G69A 4HSHA 4GGBA 3KL0A 4GQRA 1PCWA 2G95A 5E93A 5E5CA 4PBFA 4R7WA 1BWKA 4J3ZA 4J3WA 2A3CA 1TB3A 4IHCA 3H55A 1UR9A 1NIUA 5EFDA 5MF5A 1K6AA 2XVNA 1LBMA 3B03A 4PTNA 2YOCA 5BOEA 1DJYA 8RUCA 3MZ2A 4NJGA 4B5SA 4B90A 1LOLA 3Q2DA 1CT5A 1S5MA 1ISYA 1BLIA 2F7FA 2QCMA 5EKYA 4GYPA 5AYBA 4JTFA 2CXEA 3UT0A 2A6NA 2WM1A 3H8AA 3VD4A 1JZ6A 1F8MA 4KEUA 3L4WA 3PNUA 4DJDD 3O6CA 4Q8QA 5JXQA 3TOYA 1GQKA 3WK2A 2E67A 4JTRA 4OU1A 4PUKA 3QEZA 3KOWA 3LERA 3TLLA 3NZPA 4LSBA 2WLYA 1JUEA 5CJMA 3KCJA 3M7WA 3FCPA 2C91A 4XO7A 2YCEA 4RDYA 5HATA 5HJYA 4IMGA 3GDLA 3NSNA 2BASA 2ZRVA 1F2JA 2D0FA 3MWAA 3FVMA 1KFBA 2DW6A 5CPOA 3TJXA 1TRDA 3RMJA 4UIOA 1J12A 4J9JA 3WUEA 2UY3A 3KOZA 1WZAA 5BU6A 3LTYA 2BVWA 2WHLA 3R8HA 2A3HA 1OC7A 5TF0A 3QJAA 1NVMA 3K30A 3EWYA 4W8BA 2CEQA 5FL1A 2IXVA 4GXPA 3SECA 3SGGA 3O1NA 3T0DA 4HN4A 4A3YA 3LG3A 2ZZ4A 4WSHA 4BQ4A 5G4EA 1TPH1 1FVPA 3MI6A 3UY8A 3QMSA 4C7FA 4IIBA 4OGZA 4NAFA 2IQDA 1NELA 2BWGA 2X0YA 1QK2A 1CX9A 3KVKA 1XDMA 5CJNA 4AXKA 3I3DA 2D3NA 1PS9A 1Y7VA 2DH2A 1TJ0A 3YPIA 4S3CA 3T81A 1K9DA 2PDQA 3PJWA 4WDWA 3VOCA 4ZTXA 3WQPA 3SUWA 4C6FA 1D7FA 4DAIA 1EUAA 4A35A 3ZXWA 4B3KA 1TV2A 4DUOA 5KZEA 3CGTA 3PZQA 4DB7A 2XSXA 2XSAA 2CWXA 4NILA 2BXYA 2VFEA 2VX7A 2ZOXA 2YL8A 2Z1SA 4M81A 1C93A 4JEQA 3L23A 4UZUA 4FMVA 3SN1A 2C16A 4K7VA 4P7LA 1TV3A 4OOUA 3T8QA 3BAYA 5F4WA 5CH9A 3CIWA 3OP2A 1PXGA 3DI1A 3VIJA 4LUJA 1XYFA 4IICA 4D6EA 3ID7A 4LYKA 1Y65A 5HQMA 1EQPA 3TYDA 1L6SA 1F6PA 4GO9A 4GLEA 4M6QA 1OYAA 1SR0A 5KEZA 4WJEA 4R3UA 1A47A 4I8DA 3NQAA 2BOGX 3SCPA 1KXTA 1YBQA 3I7SA 3WD1A 4DPPA 4IJCA 3UWZA 3URNA 3GH5A 1Q65A 3E1F1 1XV8A 3UXAA 1TUFA 4JFTA 1TMLA 3OA5A 1R3WA 4Q8OA 3DFQA 1JPMA 4HYRA 4LU0A 2DV0A 3MUZ1 4P7OA 3MJYA 3KDNA 3W00A 4QLJA 4CKQA 1ESWA 3AI0A 1I2NA 4Y9PA 4BY3A 3KTSA 4JPGA 4LV9A 2ACSA 2DJLA 4IQDA 4Q4OA 1FX6A 1XR2A 3UW6A 3UGVA 4KWSA 1TWIA 4C6EA 4FI4A 1CXHA 4ZTYA 4TMCA 1SYTA 4XZWA 1TX2A 1UQZA 4CN6A 1DJNA 3FXYA 4AVFA 1Z8AA 3GG8A 1W8GA 3PZIA 2VOMA 4AG0A 4DUVA 3L2MA 3ARPA 4ZE4A 4TOQA 2CU0A 1J2BA 3UNTA 1X8FA 2C13A 4YMZA 5M1TA 1XBYA 3SI9A 3FJLA 1SO3A 5C0QA 2TODA 4PMRA 2W66A 1KM1A 3AOFA 5C9XA 4D2JA 2PDYA 1H4PA 1YMYA 3S2NA 4PCNA 1QPKA 4PCSA 4AMCA 1CDGA 1M7OA 3UETA 4YTRA 3NG3A 1OX5A 4Q22A 1KGWA 2A7NA 4S1FA 3MMTA 4XZLX 4O53A 5CSYA 3L4ZA 4W8AA 2PRMA 2ISVA 1P6WA 3PY2A 3HA1A 5GVJA 1V6VA 4ZO7A 4QCEA 4PUMA 1VFFA 3WQ5A 2W4XA 4WX2A 4LT9A 3NZ1A 3T2OA 1E0VA 4W9TA 4HOZA 2E9LA 3ZS4A 4K1WA 4X60A 1P5BA 1J8VA 3O15A 3TJ4A 4LNCA 3AIEA 1BRLA 3KTCA 3QZEA 3A24A 3HGOA 1Q63A 3D6NA 3Q37A 4W88A 4AVOA 2A3LA 3A6OA 3POHA 5LIUX 3DAQA 1YW1A 4JTCA 1HL2A 1LCOA 3CPGA 1SR9A 2OSYA 4BF9A 3GX9A 3C52A 5ABGA 3SEPA 1EYEA 1GTHA 2VR4A 1UZ1A 1C3FA 4H9YA 4JIPA 4B5XA 3TX9A 4MAZA 2BHZA 4U2YA 1TPC1 3E6EA 2V2HA 1DTUA 3AHTA 1ISZA 5IFPA 1IGWA 3PJTA 4QS5A 1XX1A 4Q6XA 1J5SA 4D8LA 3F4CA 1GYLA 1W3JA 2GFTA 1A5AA 4IQLA 3N2OA 3P8JA 1KXQA 5HMSA 3B4UA 1BYBA 1B4KA 1P6CA 5AN7A 1AK5A 1GOQA 4WRHA 4GGHA 3RNDA 4LALA 1GQLA 2P88A 1A5CA 1FDJA 1OX4B 4EPDC 4TV6A 2QJJA 3DHDA 3H26A 2FPVA 4JKKA 4WKAA 2FGLA 4G7EA 3LCFA 3N19B 1AW5A 2QPUA 3PFRA 4R27A 3NYZA 5E1QA 3VA8A 2XVPA 1S3HA 5J5RA 3LA4A 1UWIA 1PHQA 3IV3A 4A4AA 3EXSA 2VX4A 2POTA 1YE4A 4NL1A 3L2LA 3GC4A 3T07A 2WNWA 1EPVA 3K5XA 3KHJA 2C1HA 1JDCA 3RLHA 4O8AA 3EDJA 4M1BA 3A21A 3P67A 3TJLA 3G8EA 5BXRA 3CS2A 5F2MA 1UBPC 1IWAA 4DO7A 4TV5A 4LYRA 3UXLA 5A6AA 1XIIA 4GNVA 2AOSA 2R82A 4NZ4A 1GUVA 3LGGA 2CLEA 3MANA 4AZCB 1IZKA 3IJ8A 2WHMA 1O5RA 4GNKB 3WLQA 3I3BA 3C3NA 1WP6A 2OZ8A 3NM3A 4CQ9A 4B5TA 2EPOA 5DRIA 4NX5A 3FA3A 3G0UA 1MUWA 4QJ3B 2Y7GA 3CZ8A 3CZKA 4HTBA 3ARUA 4L64A 3H2OA 1PSCA 1XCXA 2EBNA 4O1AA 4ROQA 2HE8A 1G01A 3GE7A 1CECA 1TRIA 4DYKA 4UQDA 2JF6A 3O6YX 4ATLA 5G2HA 5HR6A 1UR2A 1LBLA 2OVLA 1FA2A 2G8ZA 5AHFA 4E8DA 3HFYA 1ZFJA 1I2RA 4GC3A 2YA0A 1Z89A 3H6OA 2ISDA 3RILA 2VXNA 2WWDA 2OJPA 4E2VA 4K3ZA 2BGQA 2GWGA 1B5TA 1VD6A 3EX1A 2ESCA 2IW0A 3U7VA 3OODA 3BAWA 3FX4A 5GNYA 4AX6A 2VFIA 1MO0A 3WJWA 3WQEA 3KCOA 3BAKA 2PDXA 1EO5A 1N8IA 4AZGA 1DL3A 1V3KA 3S83A 1F5ZA 2GVLA 1LJYA 4O13A 3OQ8A 4J1OA 3SW6A 1W1PA 5BRQA 3REQB 5I5RA 3W2JA 4LJ3A 1DV7A 3EOEA 2FTWA 1FH8A 1TIWA 3KS6A 4KCWA 3ARQA 4KIRA 4PMNA 3MTWA 1XBVA 4J3UA 3W84A 3GH7A 2NZLA 1Z48A 4O8RA 1W5QA 2PDHA 4HHHA 1OC6A 3S5NA 3F5JA 3LZ3A 3RLVA 2J7FA 3W1XA 4IISA 4Z2JA 2ZRUA 3KL5A 3M7SA 3N9KA 5BZAA 1BGAA 3E2QA 5BYWA 2CBIA 3T42A 5LA0A 2I16A 2OSWA 1QW7A 5E6YA 4NY2A 4CU6A 3VI2A 3H2EA 5HPOA 3AMGA 4HVXA 4I6VA 1R6WA 2C8NA 1E1EA 4RE0A 1IXQA 4GUIA 4UOQA 3GU9A 3LDVA 5ECVA 2QHAA 1VFUA 1MWOA 1W56A 1KFLA 3ZIZA 1SUXA 4O1BA 2WK2A 3HPZA 3HG3A 4GUJA 1GOMA 1NDZA 1V4YA 1ZB5A 4POCA 2FTPA 1MW0A 4NG3A 3GDTA 1EZWA 4JQ1A 2FPTA 3E0FA 1B3OA 1F3WA 4JR5A 2A3BA 2XM2A 3U2EA 1Q6FA 3W7NA 3S9YA 3MI2A 1G94A 2OFJA 5C9ZA 3TAKA 4DHGA 3VAVA 5CC5A 4DLFA 4S2BA 5DY2A 1ZJAA 1D3CA 1KCXA 2P5NA 2DSUA 1WZLA 2PLJA 2FLIA 1A4LA 1SJAA 3A5FA 5C6MA 4P8UA 1TZ9A 4UC5A 4AIUA 1E0WA 1E6XM 3TN5A 4MB4A 4W5UA 1KXVA 2TRSA 4JY8A 4M1RA 4UR7A 4R85A 2I9UA 5C71A 2DORA 5M2FX 3AROA 3TQPA 2VZOA 3CXOA 4L9YA 2Z1XA 3GHTA 2I5QA 2AQVA 4OUIA 1QPOA 3CH9A 2R94A 4S3GA 1C90A 1BXBA 1DJZA 3CM4A 2XN0A 3H4WA 1XM3A 1W1YA 3P61A 1CGWA 5LA1A 3KE0A 3WQ4A 3SN0A 3UWEA 1Q66A 3RDKA 1JNDA 4UMAA 4K39A 3CYVA 2W62A 3OPSA 1K7XA 2Y5JA 5LXXA 3EB4A 3I7RA 3N13A 3TJIA 1OADA 4MZ8A 3ZR6A 5HWNA 2WLZA 5C2CA 4B4HA 4IIGA 1RUSA 5JH2A 4J4KA 1YX1A 3TW6A 4QFUA 1HVXA 3PTMA 2FZMA 1JIBA 2OXNA 3PZOA 4DJDC 4LOCA 1JF6A 4HA3A 2V6AA 2OEJA 2VM8A 1WDWA 3HG4A 5FCZA 4GUHA 6ALDA 1R2RA 5C54A 2J74A 3M0MA 2RFGA 5JBFA 1M01A 1GYNA 1Q7QA 1F73A 4PODA 1JVNA 2Q8ZA 4MZYA 1RPKA 4YLWA 2G4JA 3VKCA 3PBGA 4HYVA 5AFDA 5AVHA 5DCEA 1SFSA 1VFMA 3L9CA 4GBUA 3PZUA 2QGYA 2GYIA 2J7GA 3GIYA 2PD9A 2NWSA 4AHPA 1YXYA 4ADSA 1OJXA 3UZWA 4BI7A 2PU0A 3W1TA 2VOTA 3HURA 2PP3A 1R3YA 3EOSA 4M56A 2XH2A 2DIJA 1CGYA 2EXOA 3T2QA 3P14A 3ES7A 1I1XA 3VZZA 3ZMRA 3EEZA 3W7IA 4RE4A 4MUZA 4GY7A 3WLRA 4DJDA 1AUSL 2O9RA 3S5SA 4F2BA 4D6CA 2NT1A 4GYKA 4LUIA 1AVAA 3RAOA 1V0KA 2AMGA 3W29A 4QDWA 1Y5WA 4UQCA 1ZY9A 5TBOA 4LS0A 3LCIA 3BW2A 3AYTA 2J8TA 5IHSA 2FMNA 3ONCA 1FXQA 2WM0A 3MCMA 3OEXA 1VIWA 3DC8A 4RLIA 3POCA 1A0DA 5C7HA 3TW9A 3IACA 2NV2A 2ZADA 5B7YA 4OV9A 4MUPA 3USZA 2PDBA 4YHEA 3GVGA 5DY3A 1UHVA 3N3MA 4DZAA 1BHGA 1XH2A 1VR6A 1LLWA 3N6QA 3ARSA 3BSGA 1B4EA 3G1SA 4V27A 3APTA 6ENLA 2VI0A 2YB4A 3GS6A 4GBDA 2QJGA 5HWJA 3QGKC 4FX6M 2R8WA 1OX4A 2BOEX 1P0BA 1RCOB 3E9AA 1AW1A 3NNTA 5A2CA 1XRFA 1B90A 3GXIA 4MB1A 7CGTA 4DELA 1YXCA 2BVYA 4Y2WA 2GQAA 2DSZA 5CC3A 3KM8A 2PU1A 5C9UA 5E9AA 2DPEA 1MSSA 3E5PA 1QPRA 4M82A 1TPEA 1KTBA 1UJPA 2VD9A 1TUXA 3AICA 3RCMA 2YR1A 3QW4B 3P2VA 9XIMA 2OX1A 1J11A 1B57A 4WDTA 1TYGA 2F8QA 2CKRA 3BVJA 1R85A 1F4AA 1LRNA 4J40A 1EF2A 3EWUA 1X8CA 4I5XA 4AZCA 3CAQA 3C4UA 1YNQA 1VJSA 1DBTA 4V1YA 3B8DA 4HU0A 4HD5A 2AKMA 4D1JA 3V4BA 3ZLHA 4MZ1A 4IPPA 4DBSA 5FIPA 2FZ9A 1E43A 2EPKX 3VGEA 1IIGA 2ZWYA 1VENA 2ZWZA 5KETA 1FBAA 4JL2A 4N4PA 5HUPA 2V82A 1A49A 1VBHA 3EXTA 3SSZA 3QC3A 2CETA 3U2OA 4PFHA 2ZX5A 5HWMA 3ARTA 3HTWA 3RF9A 1ZCOA 2OCZA 1EXBA 2VCAA 4UMCA 1X7FA 4FOKA 2GJPA 1NY1A 3MY9A 4QG6A 1RLDA 3GFXA 1QNVA 4O52A 3VIFA 4IPIA 1J96A 3VO0A 3CB3A 1JF5A 1FWCC 3L4YA 1GCYA 4H2CA 1Y5VA 6REQB 2UV8G 1J93A 3W86A 1KLYA 4EX4A 3H70A 3CU2A 5KZDA 2V3GA 1Z32X 3MDWA 4K68A 4O17A 3HQPA 4XBKA 3WQCA 3RMEA 3E0LA 3CHDA 3L0GA 3REQA 2QCHA 2D73A 3W23A 4F2UA 1M65A 4E5TA 3DIPA 5CQ1A 1XIJA 3VKJA 2I17A 3WO8A 3W6YA 4REQA 1TVLA 2ISWA 3ITTA 2WW5A 2O4QA 3UD6A 1Q6LA 1TE6A 4J7RA 4BA0A 1HZYA 4B5VA 3T05A 3EA2A 3WH9A 2NX1A 5M3WA 1E4MM 8TIMA 3LS9A 3C61A 3T1GA 3KHDA 1UWQA 3GG1A 1QOXA 4V2XA 2J13A 1CXKA 4C6DA 3C2VA 5HDRA 1KV5A 1QOQA 3S1GA 1WV2A 4XZ9A 3M0HA 3D46A 1OCQA 5D04C 1FUYA 1RP8A 4JHMA 4C6IA 4FNUA 3RRAA 1Q6RA 3D3FA 5LXEA 4O54A 1C29A 1AL7A 4Q32A 1OFAA 4ZB0A 4EXAA 3WMSA 1CGXA 1NOUA 4ZOCA 3UVIA 1ZTVA 4HHPA 3RLUA 1S2VA 1OCBA 1PAMA 3KFTA 1W1A1 3PNZA 3VNIA 5CZJA 4IQJA 3ABOA 4NUWA 1O6IA 5M17A 3G1FA 2DIEA 1POJA 1I45A 2ZE3A 3EGJA 5GJMA 3UXKA 2DZPA 2C71A 2Z28A 4YWSA 5A6BD 1HVQA 1O1HA 1CZ1A 2ABAA 4LAKA 3BLEA 4O0KA 3UGRA 3STGA 1CENA 3GO2A 5CEWA 3AIRA 3IUDA 2A21A 3W6LA 1ZP3A 4HZMA 1XRSA 2E5BA 2R6OA 3N9RA 1NQKA 2X1IA 2HPIA 3PWIA 3RFAA 4NZ3A 4A8NA 4F0HA 3KBJA 5TQLA 2WBKA 3EWXA 3WQDA 4AIEA 2F6XA 5IOBA 4DI9A 2NUYA 3IIVA 4GJJA 2QDDA 3GIPA 3T6CA 1UROA 1LQ2A 3GKAA 2HK0A 1U1HA 4NNCA 7PTDA 4HK7A 1GZGA 3LEPA 3WQOA 3V5FA 1DHKA 3UXIA 2Z6IA 3C2FA 1GZ1A 3GQYA 6XIMA 4JTIA 6PTDA 2FKPA 4IM4A 4L1XA 4UTFA 3L0NA 4YNGA 2CZDA 4HNTA 3GK0A 3SUTA 1V02A 1UP3A 3M46A 2Y8KA 2P3ZA 3R4IA 1Z42A 3KVMA 2A4AA 1Y8BA 4W7UA 4Y9OA 3B8SA 3CZJA 1S2WA 2E6FA 3CL6A 5AKQA 5DELA 3W76A 5BROA 1POKA 3VE9A 1PB0A 1V77A 5D8WA 3GW3A 3ZVHA 1I9CB 2QV4A 1AQ0A 4KWWA 1F6KA 1QRQA 4LGXA 5FESA 1U5VA 4PTDA 2WANA 4KT2A 1JCNA 4C1KA 4A2RA 2H90A 3LRMA 2GGJA 4GIYA 4LX4A 2PZ0A 2BP1A 1XD0A 3GSMA 2UY5A 3DFTA 4UR8A 3QYQA 3UG4A 3XISA 4GPNA 4JX4A 8XIMA 1H51A 3UG8A 1J0KA 1KTNA 1V5XA 2CPUA 1DIOA 3OVGA 4QS6A 5I3KA 1DXFA 3NYDA 3E38A 3NQMA 1EWEA 4UNIA 1C8YA 1JCYA 3DECA 4GRSA 3FYOA 4HQVA 4XAFA 5CC7A 3G24A 3MUY1 2X16A 1GTEA 3TYUA 4YWIA 2OQLA 1M3UA 3VNYA 4EWJA 4IJBA 4H04A 1SO6A 3GG0A 2Z25A 4ERGA 1JFHA 3URAA 5A8OA 4DI8A 4J2MA 2JF7A 2VDHA 5ABEA 3QW3A 3V36A 4E38A 1TTQA 3AIVA 4YHGA 2O0TA 4N6EA 1WB0A 2D22A 4TX8A 2DZWA 4MPKA 2HK1A 1CYGA 2EG8A 1Z3NA 2PURA 2PCQA 4IJRA 4QAWA 1FWFC 3EDKA 5DF0A 4DAFA 4UCGA 1RLCL 2XGIA 3CUIA 3ALGA 3T4CA 3ABQA 5H8MA 4GNJA 5I7GA 2XU2A 3R13A 3WBWA 2FGZA 3R94A 1G5AA 3EXRA 1UWAA 1ZAHA 1ZL1A 3K1DA 3V0UA 3N17A 2AL1A 6TIMA 3N2CA 3C6CA 2WQPA 4NJJA 1MNZA 2CXGA 1MFUA 3Q65A 1MQQA 3WF4A 3NA8A 4AWEA 3R2GA 2GVEA 1HG3A 3W83A 3GTHA 3B40A 4H7ZA 4ZFMA 5EMMA 3DFHA 3P5YA 2PZNA 4E3TA 4TTUA 4A3QA 4HOWA 3NXLA 3SUSA 1XICA 2DGAA 4M6VA 2Y24A 3OLGA 5BXPA 3M0LA 3WF1A 3IGHX 2WV8A 3NM1A 3URQA 3WCZA 3JZEA 4A3RA 5AVNA 4EE9A 3KLKA 1LWHA 2AMXA 1V93A 3MB9A 4RE2A 3SRKA 3VFCA 1FCBA 1M9HA 2ATMA 4NRSA 2G3MA 3VM7A 5K7JA 2ZXDA 2V63A 4YTSA 1VAHA 4O57A 3MMDA 3CZEA 4CQ8A 3V7PA 3S42A 1F76A 2RGMA 3O06A 4QCFA 3A4WA 3W2LA 1H7NA 3PC0A 2W67A 1D2KA 1ZRQA 3ITVA 1GG1A 1BVNP 1M04A 3TTQA 2UWFA 1FY6A 1JJKA 4O15A 3IIZA 5AYZA 3TR9A 4R9OA 4H41A 1YE6A 1E3ZA 1M7JA 1Q8JA 1FWDC 3HO8A 1S46A 1OC5A 3QPEA 5G1TA 3Q94A 5HK4A 4Y9NA 2A7PA 1JYNA 3EEGA 3NL2A 3ZFHA 5DMYA 2OGJA 4FR6A 4UZSA 1LROA 5D05A 4U31A 4KETA 1K1DA 2HISA 3W7OA 4I5UA 5AC5A 4HIBA 3AWOA 3PBVA 1SW0A 1VB9A 2D1ZA 4TVUA 1ZJBA 3LK6A 1F3TA 6REQA 3GTFA 1PE1A 1K8XA 4X22A 3P5ZA 3AAMA 4GCXA 4C60A 4QRNA 2GSJA 5CXPA 4WEVX 3ZQ9A 3ZSSA 3UWWA 1K8YA 1VBRA 1XP3A 2A5HA 3LRKA 1H60A 3LPPA 1WBJA 3WQGA 4NJHA 4NP7A 1BQGA 4ZQCA 5LHEA 3L66A 3W38A 1ONRA 3TYCA 1VBUA 3WDRA 3KX6A 3ANVA 4PUUA 5FJIA 2AGTA 3IWPA 4XG1A 3R6IA 2E9BA 2WMHA 3W70A 3MSRA 3PZNA 2VC9A 5D9NA 1DKWA 4ZA0A 1P48A 3E0VA 3QHNA 2DUAA 4PB3A 4FXJA 4CD5A 2YLLA 3UYIA 4J28A 3QR3A 1SGJA 3A64A 2X7WA 4XKYA 3K13A 5HOSA 3KWSA 2OEKA 3B0UX 2FYMA 7XIMA 3FVDA 1WDDA 4AB4A 4P8WA 3KCLA 3G1YA 1H50A 3RO8A 1YKWA 1BYDA 5T9BG 5EA9A 2ALRA 3VD9A 5CAHA 2IXUA 3GFZA 2WZMA 4Y9AA 4E6MA 3TH6A 2HXUA 4HSNA 3EBVA 5D9OA 4RXFA 2E1WA 4JX6A 4HOXA 5FEPA 4WDXA 5EYWA 4RNHA 4WVXA 2HNHA 3KBMA 2DJXA 1P0EA 1KGXA 3D47A 2BTMA 3EB2A 3ECQA 3ZOAA 3LPOA 3CPRA 1E5JA 3BE7A 1EXPA 2HEJA 3DFSA 3I4EA 1OX6A 2E25A 2YX0A 1E6PA 1YNYA 1DOSA 2WAGA 4JQ4A 4GISA 4M7SA 4IP7A 3GZ3A 5FAGA 3G0XA 3WNNA 3FOKA 1RK5A 2ZTJA 3C86A 3VMPA 1ZLPA 2WZTA 1VJIA 2GGIA 2VC7A 4XZNX 2WVVB 4IH3A 3BJTA 1GKRA 5HXMA 1VYPX 3HN3A 2F9RA 1GVYA 1K7EA 4D8AA 1EEXA 3ONBA 4RZ5A 4N9BA 1TPVA 4UUIA 4Q4QA 4H83A 3N9SA 5E0KA 3IAPA 3EX3A 5FF3A 3OVPA 1PZ1A 3IANA 5CPSA 1R3RA 5LIWX 2B31A 1LOQA 2WCSA 2C18A 4HCHA 3M47A 1T0OA 3QBUA 5C9RA 1Z44A 1HKWA 1ZP4A 2CLHA 3U4FA 5DXYA 3KOYA 3N73A 2FDSA 1RBLA 3GR8A 1NARA 3ITLA 2XGZA 1KM5A 4JTHA 5BMWA 4ORIA 4IIDA 1M03A 1UUMA 1WDPA 3W7KA 2ACRA 1HL9A 4PGLA 5A6LA 3UWQA 3PUEA 3DKLA 1EX1A 4LC8A 1XLFA 1CEOA 1VLWA 3VMOA 4AX7A 3QTGA 3EWZA 1EIBA 3EOUA 4E2OA 4FNTA 3UJRA 1B31A 3S4TA 4GMEA 3MMWA 1ISWA 4GVIA 5PTDA 1CB7B 1QCWA 4QJ4B 4IQEA 2VWSA 2YL6A 3WG6A 1WUFA 3WDHA 3I7QA 1VPXA 1WQ5A 1R47A 4L4PA 2VENA 2HE5A 1KRMA 1JD7A 3I10A 8A3HA 4O10A 3U2ZA 4QNEA 4WGHA 3R43A 3VOJA 4JIRA 5EBAA 4JTQA 2ZBTA 3WBYA 3Q58A 1R38A 2Y62A 1Q5MA 3SY5A 1DORA 3TC7A 1KM4A 4S3AA 1JFXA 2FMOA 4E8GA 3F4DA 6CGTA 1ZBKA 2FVMA 1OF8A 3CEPA 2P1FA 4JQ3A 3HZ3A 4FP1A 4C1NA 4XBSA 2G41A 3LCGA 3H2CA 1NWSA 2FFCA 2ZVIA 2WJFA 4QEEA 1UZDA 1A5NC 3DX5A 1FH7A 2INFA 2DVUA 1KCLA 2E68A 4S39A 2PFHA 3CUJA 4O1DA 1FQ0A 1OK4A 4DXXA 4AEOA 1NDVA 3BJSA 5E0FA 3IGUA 3EWWA 5CPTA 4L6DA 2DUZA 3NQVA 4O18A 1H7RA 1UH3A 1UQYA 4L61A 5FD0A 1ISVA 3KEHA 1VHNA 1R30A 3TMLA 4DXKA 1KBJA 2J75A 1WDQA 3AJXA 3NDOA 3DERA 2JEPA 5HULA 2EF9A 2Z27A 2Z4GA 5BW6A 4DYEA 2B7NA 3U0HA 1EUNA 3PB0A 4PFMA 5HJXA 1AJ2A 1Q85A 1ITUA 1O1ZA 1R9ZA 1QMLA 4DIAA 2F84A 3AQUA 3HPFA 1TPUA 1A0CA 4K2SA 4MJ2A 1VFHA 3AYRA 3KZPA 4S3JA 2PB1A 3KUMA 5I23A 3CQ0A 2BFGA 3RCNA 1CXEA 4MY1A 2POZA 1RQHA 1E55A 1T8QA 1Z9AA 5EL1A 1IT7A 2BGSA 4Q4PA 3BCFA 3LV5A 1XLLA 1QXLA 3TXVA 4R9XA 1RJRA 3TWAA 3NJ3A 3FV9A 2IQ0A 1HFBA 1OT2A 2Q71A 4H9XA 1NEYA 4QP0A 1RCXB 1PL9A 1UZ4A 4XKMA 4HA0A 3H12A 2ZIDA 4RPPA 5C70A 1UKTA 3VKKA 3OW1A 3KVJA 2YYUA 2WKLA 5A6BA 1KRBC 2V68A 1B2YA 1E5NA 1KFCA 1XIHA 1I1WA 4QBXA 2J7DA 1KQZA 2E28A 3M5XA 4GZEA 2D69A 1W1B1 5T9CE 3WL1A 2IMRA 4NHVA 1A5LC 4S2CA 2CC0A 3BAIA 3VD5A 5FJUA 1XIBA 2PDNA 2Q8LA 2FJKA 4BR1A 3QV6A 3BXWA 1QI3A 5F2GA 3STEA 1X97A 2QUTA 2XFRA 1RALA 1OFOA 2CLLA 1H5YA 4GUGA 1ADOA 1WAUA 4HPJA 4JTEA 3UR2A 3V5OA 5IBXC 4RV8A 3CAVA 1QUMA 1NP2A 5A8GA 3BICA 3PPHA 1GVSA 1MZHA 2YCLB 4PA8A 1C8QA 4TTGA 1MXSA 2BY1A 2O7QA 3MMUA 3F2BA 1UPPA 2QKFA 2NV9A 1TKKA 3H7RA 1U30A 3H2NA 4JTJA 3T7VA 4XO6A 2A3AA 3A4XA 3OZMA 5XIMA 3N29A 4UQAA 2DFAA 3WBEA 1IZCA 2WMGA 2B7QA 3E96A 3N3TA 1N2VA 2C15A 1TVNA 3OYZA 3H54A 3UCCA 1S38A 2Z7GA 1TREA 4FNRA 2W61A 3DHUA 3SGZA 3HB9A 1HKVA 1WYIA 2EPLX 1F74A 2YBVA 3BLKA 1O5QA 4IMCA 4YVXA 2VZSA 2OZTA 4ILSA 4RDZA 4ASTA 1E0TA 1TPWA 2BOFX 5DT5A 1AMKA 3B0YA 4JX5A 3P60A 2QW5A 3RCYA 4S38A 4L4MA 5G1YA 4BF5A 5LNVA 1JRCA 3ARVA 3V1HA 3AU6A 2V5KA 3M0JA 4PBGA 1DWHM 2JIWA 4AU0A 4M3PA 3SRFA 4WY0F 4PYSA 4HPXA 5TAOA 4AZHA 4A3HA 4MNMA 4MSSA 3WK0A 1H7WA 4BFAA 4JOMA 1TTIA 3NQDA 3G3MA 3VC5A 3ZYZA 1VRDA 2Z1KA 3T78A 3IVTA 1YYAA 1TG7A 2BNJA 2CITA 1TZ7A 4AY7A 1ZENA 1GQNA 3UYCA 3AYSA 2JKEA 2ZDSA 4WOZA 3OJGA 4LCQA 3HPAA 1BQCA 2EKCA 2VP8A 1FWSA 3KW3A 1W6TA 5BU9A 4X2RA 4S3EA 2ZA3A 1UMLA 5DFAA 1XSKA 1HN1A 1ZAJA 3OHMB 3UWVA 4IUGA 4W86A 4HT3A 2NUXA 2FVLA 4LPCA 2VUYA 3VNJA 2VKZG 2VRJA 3VDHA 4JTTA 1JR1A 1W3NA 4UMBA 4N42A 1JULA 4PB4A 4JNMA 4BWLC 1XCWA 5F2LA 1B54A 2AL2A 4CQAA 1GGOA 4MNKA 4PN2A 4PSPA 3STFA 1UP0A 1VCVA 3S5YA 3VE7A 1NDWA 2WVVA 3PN8A 4AYSA 2GLKA 1BXNA 3TCEA 3B8UA 2XDFA 3IVSA 1CCWB 1YXDA 3OIXA 2BG5A 1NM9A 1PJ9A 1UR3M 5F1VA 5CPMA 5HPCA 2Z26A 2QT3A 1IXPA 1KM3A 5A6MA 2C6QA 3W02A 3NGJA 3PULA 2OG9A 1GJUA 3UXDA 7REQB 3R25A 4I9JA 4TU1A 2GPTA 3BG9A 3S1XA 1XLCA 3TTOA 3EPOA 3Q67A 2P8BA 2OO6A 4IG2B 2RJGA 5A95A 4UNKA 3IS4A 2CW6A 2UY2A 3EZ4A 2ACUA 2X05A 4BWLA 5C9WA 3NQEA 1KFKA 2Y0FA 4L4LA 4XAGA 3UA4A 3JR2A 3APYA 1WDSA 3GFYA 5FA5A 3GNDA 3BW3A 3FNDA 1V08A 1H5VA 1YRRA 4QSFA 4AXNA 3S6DA 3AXKA 4I9AA 3IJ7A 4BI6A 3I6RA 2OOGA 3WJZA 3WX7A 4JTDA 4F40A 4NF7A 4FLSA 1EIXA 4IOTA 3OLIA 4Y96A 3WZ0E 4U5KA 4Z2KA 2ZE0A 1KCZA 3NFUA 4CD8A 3KXQA 4O16A 1AODA 2P0OA 5FF4A 4Q8TA 5LNUA 1V6WA 1OGGA 2WC4A 2JEQA 4MWAB 3GR4A 3K8KA 3W3OA 2R24A 3TQ0A 3WY1A 3IJ6A 1QU4A 4NQ1A 2PP1A 4BI5A 2X0SA 3LSBA 5RUBA 3WMBA 5I00A 3GWQA 1LG2A 4M5PA 3CAWA 3LV6A 1KFJA 3C8FA 4M51A 1EOKA 2WMIB 3T55A 3DFOA 4JIIX 4UTHA 5G1MA 2I56A 1EYWA 2YBUA 2QEZA 4CVWA 4S23A 3RPTA 3VGHA 3UBPC 2PA6A 3SRDA 2WYSA 3W2NA 1ZALA 2IPWA 2QGHA 4J27A 4R33A 3W4RA 4M7TA 2INEA 3M0XA 5DX7A 1KKRA 4MF4A 1UKOA 3A3XA 2Z2BA 1K3UA 3QVQA 4A29A 3FYYA 3LHWA 1XL9A 3TA9A 5H6HA 3ANUA 1Q2SA 3MKVA 3GC2A 3N25A 2C14A 3BQ5A 3M07A 3TTEA 4DJEC 3BL3A 3QMTA 3VD7A 1L6WA 3G1AA 2FH6A 1VH7A 1XIGA 3CMGA 4B5WA 2PTYA 1FWBC 1MXDA 4H6QA 1TMHA 1NF0A 4LAUA 2XWDA 3W7LA 4IT1A 3SO7A 3VIIA 3CL7A 2DSVA 1V6UA 3TYZA 4QX4A 3VIKA 4PMYA 4PTMA 4EK7A 4DO5A 4WJXA 3CLWA 3W7JA 3A22A 3H53A 4JFUA 1WXYA 4RNJA 2EG6A 3R79A 1EC8A 4WGXA 5LSMA 1VJZA 1ZU8A 4QE5A 4H6RA 3DXIA 3KBWA 2DZXA 1HP5A 1W17A 3INPA 3R7MA 2VZVA 3BZGA 2X8RA 4CUCA 5LIYX 3GHUA 4HYWA 3EOOA 3A9BA 5FJJA 2EGZA 1KGUA 3VIMA 1V6YA 3PSVA 5HANA 1A4MA 3S6OA 3BJFA 1JDAA 3QC0A 1E15A 3H4XA 3QPYA 4ZO6A 4HPNA 1K02A 1E0UA 3AS2A 2GOUA 4MAVA 1JCMP 3BPWA 4HK5A 5CGTA 4A8RA 2PDPA 3WKZA 2DZVA 1L8NA 1XSIA 1FCQA 1VF8A 3SRHA 3IPWA 4D6HA 3GUWA 3TE9A 4XB3A 4EF8A 3TFCA 3UZ5A 3TP4A 4KERA 1LRTA 4EXQA 3PZVA 1R5YA 1UJQA 4F48A 3KWXA 1GONA 3RLGA 5LGZA 3N18A 3SAZA 1ZJHA 2P0IA 2R1NA 2Y8UA 3VK5A 3KBSA 5T91A 1HTIA 1EC7A 3UR7A 3WQ6A 4RNFA 3BWWA 3T0TA 2HBVA 4EPBC 1EJRC 2PDGA 4EWND 4UTKA 2QQ6A 1H0IA 2Y63A 4E0CA 1QI4A 5LHFA 3CUHA 4ICNA 5A94A 3SCTA 1UOKA 2YCLA 2CLKA 4DWDA 3KP1A 3VIHA 1HL8A 5BMXA 3W74A 3UCQA 4MKNA 3V5CA 2HPMA 3T44A 5A6JA 1I75A 3DUGA 1IGSA 1C91A 4IWWA 3PSWA 1OM0A 4AW7A 4A05A 4HTYA 3ARYA 2X7VA 4QSHA 4GC4A 1EPXA 3G1HA 4YS1A 4FS9A 3VZXA 4ZO8A 2DZUA 1C7SA 3N4EA 3VPLA 4O12A 1EGMA 4MB3A 2PDIA 1GPWA 1Q6GA 4DF0A 4G9PA 5LA2A 2C0HA 1ADSA 2GGHA 5A2AA 1SJDA 3FHQA 3UNDA 5DO8A 1W9DM 3PPCA 3SJNA 2ZZ1A 4RV3A 2WVTA 3UZXA 4ES4A 4PMOA 5HNUA 3S47A 3TOPA 4TXEA 1M68A 1VLIA 2BODX 3WBAA 1GQIA 2PDUA 4A22A 3B0VC 3MSDA 1WXJA 3B04A 4FNSA 3W81A 4ML9A 1VS1A 4Y7EA 1OVDA 4WIWA 1LLOA 3BUVA 1EP3A 4LUSB 3OBAA 4JYDA 4CNOA 3T0AA 1QASA 1XUZA 1G67A 3ZT5A 1IEQA 3SUVA 1MQRA 2O9OA 2WZEA 3AZTA 1S3TC 4QDPA 3SY8A 4ADTA 4P7QA 3TR2A 5E0CA 1RAKA 2QDGA 4PB5A 1CNVA 1TA3A 3DBPA 4L1GA 1GKQA 1XLGA 1KR1A 3GG7A 1O66A 3FJ6A 3AIWA 1SZNA 4DX3A 3KS5A 4BEQA 1JDFA 1VFSA 2CZVA 3NSXA 2JALA 2J9ZA 4GINA 4Z1CA 4OZOA 3RYSA 1XYBA 4RPQA 2D24A 4KH2A 3W1AA 4LBRA 3WNOA 4C6JA 4UB9A 1Q7MA 4HK6A 3G2GA 3M4HA 3RJXA 5AECA 1LZOA 4HHMA 1XLKA 4GI4A 4KBXA 4MKSA 2E1DA 1JXJA 2J88A 4UFIA 5D32A 4TO8A 2L5HA 2GDUA 2R91A 1PKMA 3UA3A 2O7SA 2WVUA 4LV4A 3MV01 2QMJA 1OF6A 2E7FA 1E6ZA 2G4FA 4M19A 4N9CA 3MUAA 1S5VA 1T8XA 3DZ1A 4IUOA 1XC4A 3BK0A 3RHGA 4FX8A 4CGTA 2G3JA 4RCXA 3TUUA 5EB8A 1CWYA 2W91A 5C5YA 3DFPA 5EMLA 1H09A 2OLHA 2NXHA 2WJEA 4MWAC 4I5RA 2PDCA 3FDGA 1BWLA 3O63A 5HA7A 1EJXC 3FAWA 5MHBA 2VX6A 2FQIA 2BLEA 2P10A 5I03A 4PUDA 4OBSA 4WCJA 3UJ2A 2J6VA 4RDVA 3WQVA 2ZYFA 2EG7A 1D7KA 4PMJA 2D2HA 3SADA 2OR2A 5EGRA 4AFYA 2XIQA 3KBVA 3EA3A 2CYGA 4KCTA 5CCZA 1BGGA 2GUBA 2Z7KA 2PSNA 4LVDA 1R7OA 1O94A 5JIWA 3NDYA 3W88A 2HROA 3N4FA 4US5D 1E73M 2PI6A 4Y8FA 4PE8A 4UTLA 3CO8A 2WVSA 1CXIA 2CHOA 3KOXA 4QE4A 4PRTA 3VD3A 4LUTB 1A5UA 2WC3A 3S0CA 1SO4A 2VNCA 1L6FA 5EFFA 2OX4A 4WK9A 1JGIA 3TMQA 4JCLA 1DJQA 4WF7A 2H3BA 2JBMA 2WMIA 1WO2A 3AS1A 3OZOA 2R14A 1JUBA 3TVAA 1DIKA 5IDIA 2RAGA 1XIFA 2W3ZA 5ECUA 4FA3A 1NF7A 3QHOA 1EX5A 2DW7A 3P81A 1X39A 1MRAA 1OABA 1KBKA 3UR5A 3TKFA 3NCOA 4C5YA 4IPLA 3M6YA 2YL5A 4JNYA 4QG8A 5B7ZA 4ZXOA 1X7IA 2VL4A 4L9ZA 4FZIA 2Y70A 2RKXA 1KKOA 2ICSA 3NIYA 1S1RA 1QNSA 5FF2A 1SFJA 3UFYA 2YDSA 3D3AA 4XZIA 1UWUA 2WWCA 4DUWA 4BKNA 4AYGA 4Q8UA 4CNSA 4HZ6A 1V3JA 3L12A 1FKXA 3W1UA 1O7AA 2WQDA 3F1QA 1H49A 2GVGA 2EPMX 1XPYA 1XIEA 3MO7A 4TUFA 3WQ8A 1J0HA 2VVNA 4IMAA 4QLKA 1JEZA 1MYRA 3P7YA 3W7DA 5KINA 3CIXA 3IARA 3LPGA 1H7OA 3WLPA 3WF2A 4ZGYA 2O56A 2P76A 1F4HA 1ZBCA 3ARWA 3TCSA 4AUBA 3IK4A 4XZHA 1PO9A 3MV11 1JYXA 1BWVA 1WPCA 5EMKA 5ABFB 1GZJA 4Q7NA 3TQVA 3TV8A 2SFPA 3TAOA 2ZX6A 3N6JA 3P74A 3VIPA 2C19A 3ITCA 1C8VA 4V28A 4EXBA 4CEXC 2YLAA 3NVDA 4FPSA 4Q4RA 3VOGA 1E9YB 1NWTA 4HJFA 2CNCA 2WNNA 3W6MA 3T0CA 1EP2A 1SM9A 2V0TA 1NFPA 2J25A 3SDOA 2QS8A 1JPIA 3QQWA 1F3XA 4XBJA 1Q6QA 4JL1A 2VURA 1AFSA 3VNZA 2CIPA 3GVQA 4G2DA 2VYOA 3O0KA 4BHYA 4Q4MA 4MJZA 3E0IA 3ITYA 3P84A 1CLXA 5I3JA 4J35A 1VIZA 1AG1O 1BFNA 2J4GA 3N12A 1MRQA 4P2VA 3SY1A 2C1GA 3C56A 4IF2A 4QEHA 2WCGA 3XINA 2E6DA 2NQJA 2XFFA 3W01A 2VD8A 5L9FA 4MDOA 4NT0A 1W3HA 1WNOA 1RVKA 2GJLA 2QF7A 4FLQA 1MEHA 1R9YA 3LUTA 5AHMA 4O1EA 5FKYA 1A5OC 4OWGA 5DCBA 2J8FA 5GQBA 2B0MA 4OOZA 2C7FA 3FJ4A 4H8NA 1CTNA 3BOLA 3ZR4A 4X0NA 4FXFA 1VFOA 4ENLA 4CD6A 2YYTA 1U22A 2QVNA 1EL3A 3ZZ1A 4OV4A 3UP8A 1YIXA 1QW9A 2VEPA 3CYJA 4XD3A 2WZHA 1RH9A 3NO1A 3N04A 2PWUA 5M5DA 2WSQA 4QTGA 3RPMA 1MEWA 4F0KA 4XSLA 3VU2A 1UMYA 1U5HA 4FXSA <