2ZFAA

Structure of lactate oxidase at ph4.5 from aerococcus viridans
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
367
structure length
352
Chain Sequence
YNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRDFGMPIVQRYLRGTAEYGASKQKISPRDIEEIAGHSGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactate oxidase
publication title X-ray structures of Aerococcus viridans lactate oxidase and its complex with D-lactate at pH 4.5 show an alpha-hydroxyacid oxidation mechanism
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
total genus 128
structure length 352
sequence length 367
chains with identical sequence B
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zfaA00
4E2BA 3IVSA 1XUUA 3DI0A 3MBDA 3HMJG 2FLIA 4Q32A 4Z08A 3UY8A 3W7EA 1B9BA 4JIQA 1FQ0A 4UTUA 3IGUA 4PEKA 4UC5A 1M7OA 2GPTA 1HFBA 4UCGA 4UMCA 3LV5A 1KBIA 2XFWA 4MJMA 1PIIA 2X1TA 1EB3A 1LRQA 2E5BA 5G2HA 4OGZA 3KFTA 4HNUA 3CEPA 3NZ1A 3WJSA 1KTCA 2WO5A 2X1RA 4Z1BA 1JQXA 2J6XA 4H4IA 3GXNA 1QDSA 1ZFJA 3N14A 3UWQA 3N19B 3U8GA 3L5AA 2QUVA 5IBXA 3CB8A 3M5YA 4NJJA 1ALDA 1QPNA 4WY0F 1CW2A 3PUEA 1SSGA 1AMKA 2ZRYA 4O16A 5D2YA 5F1VA 4UMBA 1QAPA 2QCDA 1GYLA 2OJPA 3Q37A 2H3BA 4UFIA 4WY0B 1KM5A 5HWMA 4O17A 4RJEA 4O10A 4LVGA 4S2BA 4RX0A 5D2XA 2CLLA 3TUUA 2H8ZA 4KFPA 3P67A 1OABA 5C55A 3W76A 2ATMA 5G1YA 3HG3A 4O52A 2V8ZA 4EVZA 1JJKA 2YW3A 2ABBA 2E68A 4UNKA 2QR6A 3G0UA 5AYYA 2G5WA 1SSDA 1SR9A 2BLEA 1OX4A 3WJWA 2A85A 3UZJA 3FYOA 3N2XA 4HHPA 3ZWTA 3EX2A 2YSWA 1Y0EA 4JTTA 2HS6A 4GUJA 1GVQA 1PE1A 4LRSA 3UPBA 4LVBA 1YPFA 3W72A 2DJLA 5AC7A 3GXPA 3CIXA 2JKEA 4LV4A 1H7RA 4QNEA 1A50A 1H7NA 1VZWA 1Q3NA 1R30A 2V2HA 3WK1A 2I14A 3NAVA 5J5DA 3IIZA 2FPTA 3LLDA 2ZZ5A 1DOSA 3QW3A 2Q3RA 1F6PA 3B8DA 3MW7A 3MUXA 1FUYA 2V82A 2C19A 1XC4A 2E09A 3W7MA 1I2QA 3BK0A 1RD5A 1SZGA 4JTGA 3INPA 3OHIA 1XUZA 4MIMA 3W1MA 3WJZA 2ALDA 4YCOA 1K8YA 1OF6A 2ZDRA 1Q45A 3TW7A 3PBVA 1M6JA 5BRBA 5LZLA 4JTKA 3HQ1A 2VELA 2GUUA 2ZZ6A 3TE9A 4ORMA 4O50A 1TTJA 1O5KA 2E5CA 1P4CA 4AB4A 3W2KA 3W7KA 1W5PA 2WNNA 3TIMA 1KLZA 3WK0A 2CW6A 1C8VA 3GZ3A 1PS9A 4LUJA 3FJLA 3P5ZA 1ICPA 1NAL1 3TQVA 5TBOA 4KFNA 5BOOA 2E1DA 1X1ZA 4XKYA 2FQIA 2CLKA 4JNMA 3TFXA 2WV8A 5LGXA 3C56A 2H90A 2J27A 2WKJA 3NQMA 4IWWA 2FPVA 1ZAHA 4U28A 3G1SA 1QFEA 2NWSA 1W5MA 1T0OA 1QNVA 2NX1A 3TA6A 3LCWA 1LM1A 5L9FA 3PVFA 2X1UA 3P62A 1FWWA 1I2PA 3ZR4A 3M9YA 3P61A 4UFMA 4O18A 3LHUA 4PODA 3O06A 1W31A 4Z1DA 4DF0A 1OYBA 4AEOA 1ZY9A 1D3HA 2YXGA 5FF3A 3W7OA 3TQ0A 1VYPX 1SZEA 2A7RA 1VH7A 1P5BA 3TROA 4JY9A 3ABRA 1OYAA 3B0PA 2FB2A 3O6DA 3FIGA 3CWOX 4ZQOA 3ATYA 4K7YA 3HG5A 3M1ZA 4AWTA 3C8FA 5K7JA 2H6RA 3M41A 1VHCA 3MHGA 3W6YA 3GVGA 3ANYA 3C2RA 3VKJA 1D9EA 4IGHA 2ZTKA 4LT9A 4OU1A 5AN7A 1AW2A 5U7SA 3DFPA 1I45A 3LCFA 3S9YA 3FKKA 3PB2A 3S5OA 1HO1A 3ZFHA 1LBMA 2HSAA 3M6YA 4RCXA 2CZFA 2I1OA 2P0OA 4WQ6A 1LOLA 1OFEA 4Q4KA 3KAOA 1NFBA 2P10A 4WZHA 1V5XA 4XBSA 3W7CA 1UUMA 3PUDA 3EX1A 1B3OA 5K3VA 2BXVA 4X2RA 1O4UA 1SZNA 1KFLA 1G7UA 5EA9A 1TTQA 3QYQA 1W1ZA 1OK4A 4N6FA 3BV4A 2X16A 1VYRA 3NEVA 4HPJA 4R7JA 5FF4A 4BR1A 3TAKA 2ZA3A 4ADSA 5K2ZA 3HBLA 4QITA 3FOKA 1LOSA 3W1PA 3CT7A 1W3IA 3KRSA 3SSJA 1ZALA 2C13A 4XQ6A 5D04C 1XCFA 3E0IA 3N2MA 4IX2A 4NVTA 4IPIA 5AC6A 1VRDA 4ZQCA 3BO9A 5AHNA 2E6YA 2DU2A 1SQ7A 2GQAA 2J9XA 1O95A 4JDBA 3TSBA 3SR7A 2EHHA 3HGOA 2Z1BA 1P0KA 3MP4A 3LXCA 5D05A 1W54A 1I8JA 5DCBA 1TMHA 5DXYA 2V2CA 3MYOA 5H2ZA 2DZSA 1FWNA 3BG5A 3HO8A 5FEPA 1RQHA 4U4MA 1L9WA 4ADUA 4EF8A 3IV3A 1OFPA 3W07A 3W87A 4DO4A 3A5VA 3W88A 4O54A 1JCLA 1KM2A 4MY8A 1ZCOA 1Q6LA 2I9EA 3OVRA 1G4PA 3OBKA 5HULA 3NQGA 3CIWA 3SZ8A 4WXYA 4K38A 4BI7A 4XBKA 3BARA 3SGUA 1HTIA 3HG2A 2FFCA 1J5TA 4UTMA 1TIMA 2A2IA 2NV2A 2A21A 1F2JA 2TMDA 4O15A 1A5AA 3NPWA 1F76A 2W79A 3H55A 1JR1A 1S3HA 3KXQA 4FIQA 1GQNA 1YDVA 2ABAA 4P61A 2CLMA 3IGSA 1N8FA 1FXPA 1MXSA 2ZBTA 4UTIA 4BF9A 2J9ZA 1L2UA 3FS2A 4MLRA 4NJKA 3N3MA 2VEIA 4ZMGA 4A29A 1H61A 4JD4A 1U5JA 4K39A 1F5ZA 1OK6A 2A6NA 1H1ZA 1X1OA 5HUPA 1JRBA 4Y96A 4JDYA 4NXSA 5HR6A 1G4SA 3FKRA 1OG0A 2E5DA 4YL2A 3W83A 3DH7A 2ZRWA 4NJIA 1F6KA 1X7FA 1FCVA 3A21A 5MHBA 1G69A 5AB3A 4K8EA 2Y7FA 4LC8A 3I7RA 4IPJA 1OVDA 4WY0A 5AHEA 2VEMA 4AWUA 3L2IA 5K9CA 3IIVA 4RLIA 1H50A 4N2YA 3GLCA 4K37A 4JR5A 3TKFA 4LV9A 4HNNA 4DXVA 3NL2A 1VLIA 2QCNA 2ZA2A 1XDLA 3M7WA 3BLFA 3OEXA 5LGZA 1W5NA 2CZDA 3LX9A 3M5XA 8TIMA 2E77A 1XKYA 3KX6A 3DFSA 3L65A 4JTLA 2DZWA 5C5YA 3W1TA 3PS7A 2YYTA 1ZAIA 3S0CA 1YLVA 3SFKA 1H62A 3DKJA 4M6VA 1KFCA 2QJGA 4UXDA 1TQXA 1W56A 1MO0A 1T99A 3GAYA 5EBUA 4O12A 3I7QA 3LI0A 3T4CA 4OE7A 2H3DA 5AYZA 1ICSA 3O1NA 1PCWA 1O5XA 4DQWA 2BX7A 5C54A 4MJZA 3W1QA 5IBXC 1GOXA 3L5LA 5D33A 1TCDA 3B03A 2PRHA 4JGDA 3VE9A 1QWGA 4MKNA 2YCEA 3GX9A 4O28A 4NJHA 1ME9A 4IQLA 1T96A 3U2OA 2GVJA 3W1UA 1YXYA 2R94A 3DENA 1W5QA 1WA3A 3HIJA 5EKYA 3N9RA 3S5ZA 3T40A 3A9IA 4D2JA 4JICA 2PRLA 2A7PA 3EB2A 4NXKA 2CLHA 5DBTA 2Z6IA 3W7DA 3LCHA 2O7QA 1GTEA 2VEKA 4DBEA 1H1YA 4S2CA 4UTWA 4ALDA 3S5NA 3W7NA 1WBJA 3S1WA 3IGXA 5CSSA 1DVJA 1I2OA 2NX3A 4Z0SA 3F4WA 4LS0A 4CCDA 2WSQA 3DFNA 4YLWA 3NM3A 3THAA 1AL7A 1TB3A 3NPXA 4O14A 3GKFA 4LUIA 3QQ1A 4DPQA 1OFAA 4IX0A 5CZJA 3RLUA 5LNSA 3MP3A 2ATSA 2DZUA 3M0ZA 4Y90A 3PF3A 5F4SA 4M19A 1JCYA 4R53A 1SO4A 3QZEA 3NQAA 2VFDA 3QFEA 3QW4B 2R14A 3BW4A 2QEZA 3W2LA 1IIGA 2PE4A 3W1RA 3DFQA 1A5BA 3G1DA 3ZS4A 3DFOA 1R47A 1GVFA 4X3ZA 1KTBA 3BLEA 1B57A 3G1FA 3T78A 4PC8A 3CQ0A 5LNVA 3O07A 2WNQA 1EIXA 5FEXA 1ADOA 4PTNA 4DELA 1J4EA 1GVSA 2ZQ0A 4YWIA 4LOCA 3C2EA 3H54A 1R2RA 4I7UA 2CFFA 4FNTA 1GJPA 4PA8A 1TPEA 3O6CA 5E93A 4MYAA 3EX3A 3V1PA 2Z6JA 4NQ1A 3LDVA 3UNDA 1OX6A 1V7YA 3LXBA 4RXGA 3W7LA 3G22A 4W9TA 5F2LA 1VQTA 3W9ZA 3IVTA 1K8ZA 1W37A 1R2TA 1SO6A 1KV5A 2NWRA 2R8WA 1LDCA 1TPUA 2Y7GA 4IXXA 2OT1A 3L0NA 3TSDA 3CTLA 1ONRA 3D0CA 3V75A 4JX6A 2JKPA 3UWWA 1JCJA 1YDNA 3NYZA 3CWNA 1H7WA 2CZ5A 1FWSA 2EKCA 4LU0A 3W7JA 3GDKA 1XBVA 1H63A 1QCWA 3DZ1A 2JGQA 4FNRA 2JGYA 2RH9A 4ZVJA 1H7XA 4N6EA 1A5SA 1LROA 4Q33A 4DF1A 4Y9AA 1SO5A 3E49A 4DPPA 3G0XA 4LS2A 4AH7A 1AK5A 4OV4A 2OMAA 2YR1A 2Y89A 4A21A 1DL3A 4LS1A 5D09A 1SFLA 4E2DA 4ZQRA 2BSLA 3OVPA 3LRMA 3TC6A 3L67A 4NZJA 5FI8A 1FDJA 4LVFA 1LRTA 5G4EA 4CQ9A 3PAJA 4MPQA 5DN1A 3M5VA 3PULA 3S42A 1HUVA 1EX5A 4GNJA 2QCHA 2QJHA 2BTMA 3P5YA 3G1AA 3TXZA 5E0KA 4AHOA 5GVJA 2GJLA 4QIUA 3C2VA 5AHFA 2PC4A 5DCEA 5TIMA 2YGYA 1XI3A 3HPSA 3PSWA 3GNNA 3KRZA 2NXIA 1WDWA 3TSMA 3TXVA 2NXGA 1QO2A 2QDGA 4AMAA 3IIOA 4GBUA 3G8RA 1OHLA 1JVNA 1NSJA 2YPIA 4FEZA 4K36A 3USBA 3WK2A 5TQLA 1F73A 3HGSA 4JXCA 1FCUA 4JTFA 4DO5A 1YYAA 1XBZA 4O1AA 3LCGA 3GR7A 3GYEA 1FWTA 4BK9A 4A2SA 1FY6A 3S1UA 4WX2A 3NQEA 1WAUA 5LSMA 3NM1A 5AC8A 3G24A 3P8IA 1I2NA 3NVTA 4TMBA 3RF9A 3VCRA 2VFEA 4JTIA 1DJNA 3CLMA 2Q8ZA 1OFRA 3MJYA 5K4XA 1YDOA 4JTEA 4JTUA 4TO8A 3EXTA 4ML9A 2GJNA 3B0VC 3MO7A 1HO4A 3C52A 3FA5A 1A5CA 2EAWA 2C15A 2QCFA 2YX0A 1JUKA 3FEMA 1OYCA 5K4ZA 4OT7A 1K7XA 2FIQA 2ZTJA 3I68A 2FB3A 5G2IA 1KTNA 1XM3A 3QMSA 1SU5A 4NNBA 1R2SA 4XUGA 1JUBA 1LYXA 1TSIA 3P60A 4UR8A 3EWXA 1GVRA 3UWZA 5D38A 3PUOA 4XTIA 5K9DA 4N9EA 4CCEA 1PCKA 2TPSA 2C6QA 3R13A 3E96A 4EWND 3F1QA 5DLCA 5DXXA 4IJBA 5AHMA 4JYFA 1K02A 2A5HA 4UTHA 3EKZA 3NQFA 2B4GA 1WQ5A 4TU1A 1AW5A 3A23A 3W73A 3MP5A 4TR9A 4N9CA 3LLFA 1QR7A 2EGZA 5HUOA 2NX9A 2RHGA 3NGJA 5F4WA 4NU7A 1WOAA 2QAFA 2ISSA 3PWAA 4IMCA 3BGJA 4MY9A 3R89A 3BLIA 3UZ5A 4LVDA 4UUIA 3FLUA 2FJKA 3KVJA 3R5EA 5DY3A 1EA0A 1GT8A 1PV8A 2ZZ2A 2CWNA 1LBLA 3NNTA 3NQVA 2VFHA 3W2JA 2E6DA 3O6YX 4GXMA 3P81A 3MMTA 4ADTA 1U83A 3IIPA 4RZ5A 2O7SA 2B7PA 2PCQA 5EMUA 3TAOA 5G2WA 1WV2A 1T8XA 3W1LA 3BW3A 3NR0A 5AFDA 5LNRA 4JN6A 1Q6QA 4WOQA 3W85A 2NUYA 1TPFA 1JRCA 2Q8LA 5G1TA 3P8JA 3UXAA 1W8SA 2UV8G 1B4EA 4QAIA 3LOTA 5U4NA 2X1SA 4JTHA 2CLOA 2Q3OA 3EWWA 3BG9A 1KFJA 4MZ8A 4N4PA 3O8AA 2HTMA 5I3IA 2VEPA 4M6QA 1TO3A 1VCGA 3ATZA 1GYNA 1G67A 2V0TA 4M7SA 4PL2A 2QDHA 3CEUA 4NJGA 4WD0A 3NL6A 4LNYA 3TNOA 2QCGA 5C2XA 1QPRA 2TSYA 3C2FA 4FXSA 4QJ1A 2C0AA 1H5YA 2C16A 3LTPA 3DU0A 1A53A 3LTYA 4L4LA 1EWDA 2TYSA 4IOTA 4LC6A 3G3MA 3C61A 4TX9A 1O60A 3JS3A 3HF3A 4I9AA 4HT3A 1IXNA 4NX5A 5AHIA 3TC7A 3EXRA 3GB6A 5F2GA 1C29A 5T26A 4JX5A 4MUZA 3R12A 1J2WA 1QPQA 1RVGA 4GUIA 1VHNA 4LVAA 4RZ6A 1KV8A 1TYGA 3H53A 1MEIA 1VCFA 4GRSA 5CSRA 4QM1A 3DI1A 5KSWA 5C6MA 1O94A 1VJIA 1KFKA 4ZQNA 3NPVA 1YPIA 1X8FA 3I6RA 1KFBA 3CPRA 3B04A 3SJ3A 5FF7A 3G1YA 3O16A 3W70A 3PC0A 3O05A 1RZMA 4HSOA 3RNDA 5AOUA 1SO3A 1Z48A 5F4XA 3ELFA 3P74A 4O4WA 3G3DA 1DQXA 3QRHA 1RPXA 1TPC1 2VC6A 4NZFA 4AVFA 3NQ8A 4UTWC 1LORA 2ZRVA 4B5NA 3LI1A 3PSVA 5DY2A 2J24A 5LHFA 1H51A 2J9YA 3FFSA 2ISWA 1SW7A 3L0KA 4PFMA 3QMRA 3VE7A 1THFD 4UR7A 1N7KA 2Y7EA 1S5VA 1FX6A 5D37A 3LGEA 3QC3A 2WSYA 3T44A 2V5LA 3MYPA 5D2WA 1X6UA 4IMGA 3ABOA 3HGJA 1DHPA 4HN4A 5LNWA 2NXHA 2Z2UA 2Y70A 3TR2A 3TDFA 2AQWA 1YXDA 3C3NA 4WXZA 3UXDA 2NZLA 5D2VA 3KVMA 2CLEA 2TRSA 1TJPA 3EWZA 1QO5A 3QSRA 1LLZA 3DKLA 4ZQMA 3KRUA 1MEHA 2G96A 2ZRZA 3N34A 1VR6A 2YYUA 3IEBA 3LBMA 1XBYA 2ISVA 2G95A 3TCEA 1YTEA 1JULA 4HKPA 2GVGA 4DBDA 5DBUA 2HMCA 4O13A 4GUHA 2X2GA 1TPH1 2QJIA 4UFKA 5H91A 2GQ9A 4UTTA 5D32A 4RV8A 4KFOA 4HNVA 1TPDA 4JYEA 2PRMA 1GWJA 4EOUA 3GDMA 3S8HA 4K6AA 3C6CA 1WOBA 2RKXA 1TTPA 2YDAA 3WJYA 2JKAA 3BGGA 4N9DA 3STGA 3BVJA 3ABQA 1ME8A 4H6KA 3GKAA 1OFBA 5KMYA 3LHVA 2VOMA 3EWBX 4CCCA 2IQTA 4AHQA 4OV9A 4FX8A 3WJXA 1XL9A 1XBXA 3GNDA 3JRKA 4ZL1A 1L6WA 1XFBA 1P0NA 4AAJA 3B06A 3DBPA 1WBHA 5CZ0A 3T55A 1G4EA 3Q58A 5BMXA 2QCLA 3JR2A 5EPDA 3RMJA 3BW2A 3PBWA 5CKSA 1LRNA 1W0MA 2W0UA 1PHQA 3HPXA 4X9SA 1ML1A 3ZWSA 2WSRA 3DXIA 3N73A 1ME7A 4P2VA 1YTKA 3G8EA 2QUTA 2A0NA 3GDRA 1EPXA 4UFHA 1SW0A 3O15A 1L6YA 1IIHA 1EP3A 5EL1A 4IMEA 3TW6A 2GOUA 3I7SA 3QJAA 4JX4A 1ZAJA 3QF0A 2KZHA 4JY8A 3QSTA 1YXCA 2A6LA 3W2MA 3LBCA 3TMLA 3QQ0A 3TU9A 3BPWA 5AYXA 3GDLA 1LP6A 3EKLA 3TH6A 3OVQA 3CM4A 2AGKA 4BI6A 1GG0A 1FCBA 2Z0IA 4Y8FA 3M47A 3UWVA 3W71A 4GJ1A 3W2NA 3OA3A 4AXKA 3WK3A 1KBJA 4O1DA 2YW4A 2V5BA 1TPB1 4AF0B 3NA8A 1SPQA 5HR7A 3UD6A 4O4VA 2NV1A 2XN2A 4KKXA 1FCQA 3HPZA 5D03A 5ABTA 3LV6A 4RR4A 3F03K 1SW3A 2JK2A 2ZZ1A 2Y62A 1Z41A 3QPYA 5BMWA 3S1VA 4UIOA 4RKAA 5D2TA 1PL9A 1Z42A 3SY5A 3QEZA 3R8RA 1IXQA 3A22A 3FYPA 4OWGA 4POCA 3U6WA 1EUAA 4GWEA 3S1XA 4OBTA 1Z44A 2Y7DA 1EP1A 1D3GA 4KWWA 1YADA 4AWSA 1VS1A 5HQEA 5LHEA 3C0JA 2WJZA 4LY8A 1MSSA 1MEWA 1TREA 1KA9F 1CX9A 4FXRA 4CLMA 4NX0A 4GE8A 4R33A 1BKSA 4JS3A 2DJXA 5DCDA 2WQPA 3F4NA 1WXJA 5KZDA 2ZZ7A 1ZJIA 4A2RA 1GVOA 4MZYA 1JCNA 5E1QA 4N02A 4G1KA 3MWAA 2WPBA 3YPIA 1LZOA 3L68A 2E6AA 1K7FA 4MFDA 3STFA 4C1KA 3TJLA 2ZA1A 3B0UX 3UWUA 3LCXA 5F2MA 2GQ8A 3LRLA 5FF2A 1FXQA 3W7HA 1EEPA 4FNUA 1XXXA 1NVMA 5LNUA 2DZVA 4YCPA 5CGQA 1CI1A 4QISA 1S5TA 4JEQA 2GVLA 4FNQA 5CZTA 3VNDA 5L6UA 2A4AA 4FX6M 1RR2A 4NNAA 4BWLA 1YTDA 3DHDA 1VLWA 3IRDA 1FDZA 1LLWA 3G1VA 4N4QA 4PL1A 2X30A 4I7WA 3PR2A 3TQKA 4I7VA 3MI2A 1R46A 4IMFA 4WUIA 3UY7A 3G0SA 1KM6A 3K30A 5KITA 4M5PA 3CHVA 1DORA 4XWUA 3PB0A 5CPOA 1UBSA 1OFQA 4O0ZA 4UFJA 1GTHA 1BEUA 3P80A 3N9SA 1KW1A 3W1NA 3GXTA 3OIXA 2RDTA 2OCZA 1C9DA 1L6SA 1RQBA 1KM4A 5D02A 1UASA 2AAMA 3NDOA 2DORA 2Y88A 2QCMA 4JTJA 4RK8A 5F1UA 1TPVA 2VFGA 5KINA 2B7OA 1PVNA 1I4NA 2C18A 3E02A 3T7VA 1EP2A 3KHJA 2OT0A 4LRTA 3MI3A 2CLFA 2C3ZA 1AW1A 1SUXA 3PG9A 5HMSA 4ICNA 4O8RA 4GUFA 2DZPA 2A1YA 1UCWA 3A5FA 3SI9A 3NQ2A 1TV8A 4MOZA 1LOQA 4EIVA 1H7PA 2XN1A 2V30A 4H3DA 1F7BA 5HNRA 4MYXA 2FTPA 4K8HA 3PY2A 2F7FA 1W5OA 4HSNA 3S5YA 2NUWA 2CLIA 3OG3A 4ONVA 1Q6OA 1DV7A 1TRDA 2VKZG 1K03A 4BFAA 4C1LA 2YZRA 1NF0A 5HJLA 3NL5A 2OX1A 1LBFA 4WOZA 1EWEA 3NXFA 1VPXA 3PM6A 4QSHA 3QPZA 4NUWA 3L21A 4LWWA 4LW7A 3M5ZA 4Z0JA 2G97A 2V9DA 1WX0A 2DZXA 1F05A 5HWJA 5BNKA 2PURA 4MFEA 1HL2A 4UTJA 4NT0A 3NZRA 1UJPA 3M43A 4E0CA 1IXPA 3KOFA 3LHWA 1HG3A 3G18A 2VENA 4MZ1A 2ZFAA 3NG3A 1S5WA 2Y61A 3W23A 2D73A 2ZRXA 1KM1A 2QCDB 3P7YA 5FESA 1E51A 1RQEA 1FDYA 2R91A 4PCFA 4NNCA 1IXOA 3LB0A 3NQCA 4TIMA 1TJRA 1TV5A 4Z1AA 1XDMA 1TRIA 3C2OA 3LHYA 4QNWA 2ZZ4A 5AHLA 4O57A 4R34A 4MY1A 4S1FA 1G4TA 3EWUA 2CU0A 1TQJA 3LRKA 4K7VA 2F84A 2A7NA 4N9BA 1FBAA 1LTDA 2E6FA 3MHUA 3RFAA 3P82A 3QMTA 3TMQA 4MLJA 3EWYA 3UWYA 2VFIA 5HINA 1AG1O 1OX4B 3M16A 1QOQA 4ORIA 2BWGA 3WFAA 1UB3A 3QH2A 3SW6A 3W7RA 4YMZA 5CZSA 1K7EA 3RLVA 3QM3A 3NL3A 1B4KA 3GAKA 1ZENA 2YFOA 4UTLA 4CNOA 2NLIA 3DFTA 1NEYA 5FEZA 4HIBA 4TMCA 2DZTA 3VI2A 7TIMA 1DKWA 3W75A 2EPHA 2NUXA 3L0GA 4FIRA 1OFDA 5J5RA 1RV8A 3KVLA 4GC4A 3E9AA 5CPMA 2QAPA 3B4UA 5HWNA 2ZZ3A 4UFLA 1VGAA 5CG7A 3DGRA 3NQ6A 4JYDA 3I65A 3NOEA 4DEFA 6TIMA 1ZHAA 3L9CA 3PBYA 1H60A 3EX6A 2OZ0A 3W3OA 3NQDA 4A3UA 3A24A 3LERA 5SWUA 5A8GA 4Y6GA 3HOJA 3B05A 2V81A 4PH6A 3W7QA 3W86A 4CNPA 4UTTC 3SECA 2LLEA 4UTKA 3BG3A 4OQVA 3NPUA 5IM51 5I3KA 5DELA 5CPNA 2RDWA 1M5WA 4CQ8A 2QCEA 4M6PA 3STEA 4E38A 3HGRA 2CZEA 4O1BA 4IXHA 1DBTA 1OJXA 3LCLA 4HPXA 4ZQPA 1K8XA 4FF7A 5KZMA 2V2DA 1IGSA 1BWKA 3O63A 3EX4A 1QOPA 3NO5A 2YFNA 4FNPA 3LHTA 2B7QA 4XKYB 1TPWA 4FB7A 3LCIA 5BW6A 1KLYA 3RU6A 3W84A 5FF0A 2C1HA 4KWVA 3EEGA 2B7NA 3MI6A 4AF0A 1OF8A 3E12A 1GEQA 3PBUA 3L5MA 3ABSA 4MVAA 5K9XA 2QCCA 4XZ9A 2QUUA 5G4WA 5A5WA 2EF9A 1SFJA 3TK7A 3KVKA 2WNZA 1OFOA 3G1XA 5EYWA 3L66A 3RK8A 1VC4A 4YXGA 2P1FA 1ICQA 3UYCA 3W1AA 4L4MA 5FEWA 1FWRA 1BTMA 4EF9A 2QF7A 3CC1A 3SGZA 1QPOA 2Y85A 5I3HA 3HB9A 1F74A 5I3GA 4O53A 2ZCGA 2Y6ZA 3LTSA 2JBMA 1W3TA 3SIZA 3R2GA 2FDSA 1GG1A 3Q94A 1N55A 3Q2DA 3NQ7A 2QKFA 3W22A 4X22A 1PHWA 4FHAA 1AL8A 4FO4A 5G5IA 3TJXA 2XN0A 3GDTA 1MZHA 4CQAA 4RXFA 3W2UA 4IUOA 1M7PA 2ZYFA 3S6DA 4GUGA 4O0KA 3G1HA 5KTLA 4XTDA 4HNTA 3MHFA 3EXSA 3VFLA 2WOQA 4JTSA 1JUEA 4O19A 1SZFA 3TV8A 1G7VA 2B0MA 2H8XA 5D30A 5I3JA 3GK0A 3DHFA 4A22A 1BWLA 3GIYA 3FJ6A 1GPWA 2C14A 2RDUA 1KM3A 3P84A 1JCMP 1DJQA 2HS8A 5KZEA 4OHQA 1G6CA 2FPYA 4FNSA 1UUOA 1VCVA 1ZNNA 4FX7A 1KFEA 2DP3A 3DAQA 3IVUA 3W7IA 1DQWA 3HJZA 1K3UA 1Q6RA 3TX9A 2VFFA 3W7GA 5F2IA 4ZZ9A 4QQ3A 3AO0A 4RZ4A 3C4UA 2J88A 4IMDA 3CU2A 2W6RA 2Y63A 4GFSA 5I3FA 4DF2A 3M44A 4UNLA 6ALDA 3PG8A 1TTIA 3MBFA 1NF7A 1LCOA 4Z1CA 4BI5A 2ZRUA 5EY5A 3TFCA 4O1CA 1I2RA 4JIPA 3STCA 4O11A 1GZGA 1TV7A 3W7PA 1QMLA 1W3NA 1P1XA 3THQA 4AHPA 3UQNA 2VXNA 3AJXA 1H7OA 1EUNA 4M7TA 4WJEA 5LKYA 5CPLA 4LTSA 3LHZA 4DO6A 4UMAA 1WYIA 1OX5A 4J9JA 3W1XA 1JCXA 1KM0A 3LM7A 4BWLC 3LXAA 3HG4A 3GR8A 2BZNA 2RFGA 1JQVA 1VYSX 3UPWA 3IIXA 3W74A 1IF2A 4CNNA
chains in the Genus database with same CATH superfamily
4U5IA 3IVSA 4DXKA 1XUUA 2GZXA 1Z9AA 4C6FA 3HMJG 3WBYA 2FLIA 4Q32A 1PB0A 4QG9A 2IPGA 4ENLA 4XSMA 4ERIA 4F48A 1OB0A 3IGUA 4PEKA 1R85A 2O56A 2X1TA 2E5BA 2MANA 3R10A 1H1NA 4H7ZA 4HNUA 1QI0A 3CEPA 2IW0A 3NZ1A 3RCNA 1GOWA 2ZUMA 4EE9A 3VO0A 3VU2A 1XLMA 1ZFJA 4W93A 1H0GA 4MKVA 2RGMA 3CB8A 4NJJA 3RITA 1CW2A 1SSGA 3KBWA 2ZRYA 1ODUA 3RILA 1QAPA 1R86A 3CUGA 3GU9A 1R87A 2H3BA 2NQ9A 3CZGA 5HWMA 1KM5A 1PZ2A 4O17A 4RJEA 1NQKA 4HP5A 1TUXA 4S3FA 4S2BA 2WMFA 4W86A 1U1UA 5D2XA 1O1HA 3TUUA 2H8ZA 3P67A 3B40A 1UKPA 5C55A 4RV3A 5M1TA 4WK9A 4EVZA 3GE7A 2OYLA 2E68A 3NFUA 5AYYA 2QW5A 4ZE4A 4PRWA 4R27A 1UP2A 2FHFA 3UZJA 2X40A 3BOXA 4DN1A 2HS6A 3W53A 4GUJA 1PE1A 3FXGA 4LVBA 4AQLA 5AC7A 3CIXA 4QNEA 1E4NA 4LV4A 2QUNA 1A50A 3N15A 3DG6A 1Q3NA 1R30A 2IPWA 3WK1A 5AC4A 5I3DA 2HPMA 3IIZA 3E0FA 1CEOA 3TP4A 2ZZ5A 1F6PA 3B8DA 4H1ZA 4US5D 2OZ8A 3MW7A 1FUYA 5FIPA 3S9IA 2IXUA 3PZVA 2V82A 1S2UA 5A8PA 2E09A 3W7MA 2PDJA 3LA4A 2WKLA 1RD5A 2YA1A 4JHOA 3B9OA 4X2PA 4IT1A 3LZ5A 1AZ1A 4MIMA 3W1MA 1V03A 3K8MA 1K8YA 2VZVA 2RJHA 2ZDRA 1TV4A 3HV8A 5GJNA 3TW7A 5BRBA 3V5OA 2OQLA 2OWXA 3NGFA 1EKOA 1UWAA 3PWGA 1VBGA 3A4AA 3B9EA 1VFOA 3HQNA 3TWBA 4AZCA 3VGFA 2HZGA 4AB4A 3VIIA 1GQJA 2WNNA 1XGDA 2J25A 2WJEA 3AMKA 3CMFA 3MUIA 3GZ3A 4M0XA 4LUJA 3TQVA 3FA3A 5DF0A 3BCFA 3QV6A 2BVTA 4KFNA 5BOOA 2VDIA 4XIAA 2WBGA 4XKYA 2R9RA 2CLKA 1E0WA 3QHMA 5LGXA 2A3BA 3W25A 4FLSA 4U28A 4O1FA 2Q8XA 1W5MA 1RBOB 1QNVA 2NX1A 3MSDA 4UTFA 3E5PA 4LEQA 1LM1A 2CBUA 2CXGA 3OG2A 3PVFA 1I2PA 3KHDA 3M9YA 4LJ3A 4PODA 1W31A 4DF0A 4W85A 1OYBA 3V7PA 1ZY9A 4EX4A 1J96A 3KL0A 2DFAA 3W7OA 1VYPX 2HBVA 1LT7A 3ITCA 2DSVA 3LN3A 3HMCA 4I3GA 2FB2A 4ZO9A 3CWOX 1K4HA 4GC3A 4S3EA 3HG5A 1PZ1A 1B1YA 3GNOA 3M1ZA 3C8FA 3N9KA 2H6RA 3MHGA 2VGGA 3E38A 3RIKA 1D9EA 4Z2HA 2ZTKA 1AW2A 3POCA 3F2CA 1V79A 4PTDA 2D2HA 5HK4A 1UD8A 2I1OA 1OWQA 2P0OA 2DSWA 3PJTA 4MNKA 3WQ6A 1XICA 3N6HA 1KCKA 1UUMA 3B97A 4B2DD 3GXDA 2GUBA 1JAKA 3WUEA 1O4UA 3TTOA 3KDNA 1BGAA 4PMQA 1S5NA 4IPNB 1G7UA 2PDFA 3FY1A 3NO1A 1TTQA 3M4HA 3QYQA 1OK4A 4N6FA 1ZJHA 3CASA 3DG7A 3TZNA 4L7ZA 4LYKA 3GTHA 4BQ3A 1XPGA 4ADSA 4AMCA 1R7OA 3ARYA 3G6MA 2AQVA 4C6OA 4PUEA 4DM1A 3CT7A 1ZALA 1MW1A 3UF9A 3LY0A 4NVTA 3COTA 4IPIA 5AC6A 4KCWA 4GYPC 3VAVA 1O95A 2VOTA 1BYDA 1OCQA 5I06A 5DRCA 4J2MA 1TVLA 3HQPA 1W54A 2G50A 3UR2A 3T1GA 4FSAA 4HNLA 4ADUA 3IV3A 1TJ2A 1PDYA 3WD0A 1I0DA 4O54A 1CNVA 4LANA 1G4PA 1V8EA 5HULA 3MDUA 1HP5A 3N2TA 3GC4A 3BLLA 1NDWA 4UZUA 2FFCA 1J5TA 4UTMA 2DW7A 1PKMA 1CPUA 1F2JA 2Q71A 4JPGA 4QJ3B 1FH8A 3BQ5A 1JR1A 2X2YA 3KXQA 1YDVA 1V6WA 2CLMA 2EBNA 3QXBA 1P0BA 2J13A 2WW5A 3E2QA 1QNPA 4J3ZA 2BGSA 4MLRA 4NJKA 3KW3A 1PPIA 1F5ZA 4CEUC 4F0HA 2ZDSA 2OEJA 2ZXAA 2E5DA 1E3ZA 3W83A 5BXTA 1F6KA 2OB3A 1X7FA 1FCVA 5MHBA 4K8EA 2OODA 4EACA 1OC7A 2VEMA 4AWUA 3CNYA 4J5NA 4N2YA 4K37A 1V08A 1O12A 3EMCA 2D20A 1UD3A 1VLIA 3L4ZA 1W5NA 1E0TA 1JIBA 1EF2A 1ISZA 4MWAC 5C5YA 3C86A 2YYTA 1NIUA 1G5AA 3SFKA 4ZFCA 1H62A 3DKJA 4M6VA 1KFCA 4UXDA 1KKRA 1A3XA 2VEFA 3LD5A 1W9DM 1XCXA 2A3AA 4HGXA 3CXOA 3DIPA 2PF8A 3LI0A 3STPA 2NQLA 3EOEA 2VVSA 2BX7A 4DQWA 4W87A 3ANUA 4ATDA 3NZPA 3EPMA 5D33A 4MAVA 4UQ9A 2WZTA 1ZGDA 3T2QA 4MKNA 2PWFA 3KL5A 3RR4A 3OJGA 5FJTA 2WQDA 1L2QA 1A3HA 5C9XA 5EKYA 3PN8A 3A9IA 1FWIC 4G8TA 2CLHA 1XW8A 4H9UA 4WDTA 5HQLA 1CXFA 3RM8A 2IKHA 3S1WA 3VFCA 2DSKA 3AWOA 3F4WA 4CCDA 3NM3A 5CGMA 1KWGA 1AL7A 4YS1A 4L65A 2PEVA 4JOMA 4O14A 1QW8A 1RBAA 1WZLA 3QQ1A 4IIHA 1OFAA 4QQUA 2PDLA 3D5HA 5JBFA 4CQCA 4Y90A 3QOMA 1V7AA 4S3GA 3HTWA 4JL1A 1JL8A 3NQAA 3V1HA 1H5VA 2BY0A 3QW4B 1HKJA 2R14A 2CBVA 3B8IA 4A4AA 2PE4A 1EBGA 2NVCA 1GVFA 5FEXA 1ADOA 3CWHA 1NFPA 4DUOA 5HJXA 1IEWA 2EPMX 4LOCA 3FSTA 2W63A 1HL9A 4PMDA 4PMYA 2WCSA 3WN6A 2ANUA 4X0NA 1HKVA 2CFFA 4PA8A 3LSBA 1NOFA 5E93A 3V1PA 1YDYA 4IPPA 4LY4A 2WMKA 1US3A 2OFJA 3XIMA 1FH9A 2GJPA 3IAPA 3OOQA 4HZ7A 4ZO7A 1J0YA 1K8ZA 1R2TA 1SO6A 2NQJA 2JALA 4HOZA 4PRRA 5FJUA 2ONEA 3FDGA 2VX4A 1S2WA 3QPEA 4JX6A 2JKPA 4EXQA 1EJRC 3BCJA 2Y24A 4GYKA 1YDNA 2CZ5A 5I00A 1FWSA 2QGHA 3L4UA 4GGBA 4LU0A 5CC5A 1FTXA 3M0HA 2J7DA 2JGQA 3AHYA 1HL8A 2F6UA 2JGYA 2RH9A 9CGTA 3WMSA 2D0HA 4N6EA 1W17A 4F0RA 3UYIA 3KBJA 2A3CA 4L9XA 3VDBA 4LYQA 3E49A 4AH7A 1RJPA 4A21A 1VBJA 5D09A 4E2DA 1BQCA 2REQB 4LNCA 3OVPA 4NZJA 4KF1A 1A49A 3LUTA 4F40A 4LX4A 2ACUA 2NVAA 5G4EA 4MPQA 3N18A 5DN1A 1US2A 2ZUTA 2PLCA 3PZGA 3S42A 3AS3A 4NRSA 2QCHA 3PTQA 3I3EA 2QJHA 4MHBA 1BRLB 5CBIA 1UP0A 1Q6FA 1TA3A 1XI3A 3TQPA 2X0YA 4HMEA 3GXFA 3U48A 1JPIA 2NXGA 1EA9C 1QO2A 3IIOA 3MSYA 2W92A 3WD3A 1Z8AA 3GBEA 3DDMA 3U7BA 1NWTA 1E5JA 3KWSA 3WUGA 4R3UA 3ONCA 4FEZA 3USBA 1DWIM 4H2HA 4JXCA 4JTFA 5CPTA 4DO5A 4D1JA 1YYAA 3OHMB 1Y5XA 1A47A 3AISA 3WNMA 4A2SA 1TR1A 4V27A 2XM2A 4FR6A 1WAUA 5LSMA 2FHCA 3ZM8A 5LXXA 1EO5A 3P8IA 3MKCA 4DJDC 3TNBA 3WQ8A 1NDYA 1DJNA 5K4XA 1YDOA 4NP7A 4JTUA 3EXTA 1TWSA 3VKBA 3TOYA 3CBWA 1K4GA 3QLDA 2FTWA 2PDWA 2INEA 3GO2A 4Q8PA 2WM1A 1OYCA 2POTA 3GTNA 5G2IA 3ZSTA 1WB0A 1LYXA 1TSIA 4UR8A 5G4HC 5AECA 4ROQA 1GVRA 4AD5A 2R1NA 1BD0A 3LQLA 3KP0A 4TTUA 4XTIA 5K9DA 4CCEA 2RAGA 4EWND 5DLCA 3V36A 5DXXA 4JYFA 5CC3A 2A5HA 8RUCA 3P14A 3SO7A 3H2EA 4NAFB 2B4GA 2XH0A 3W73A 3MP5A 1XYLA 3N4AA 2ISSA 4MY9A 3D3AA 3R89A 1NDZA 3O3RA 4LVDA 3F5KA 4D6EA 3R5EA 5DY3A 3AFBA 1GT8A 1PV8A 2ZZ2A 2CWNA 1PEZA 3VGHA 2VFHA 3EAUA 2E6DA 5GNZA 2ZICA 3MMTA 3S47A 3AJ7A 2B7PA 2PCQA 5EMUA 5G2WA 3URBA 2G3JA 1VJZA 1M1BA 5AFDA 1US0A 1Q6QA 4WOQA 1KNWA 2VTFA 4QAIA 4IP5A 4LBUA 5U4NA 2X1SA 2CLOA 1MRAA 2HTMA 5I3IA 1J8VA 1BG9A 3USZA 5C9UA 3ATZA 1D8CA 2FMOA 2OVLA 4GXWA 4H8NA 1G67A 1FWGC 3GTXA 2C1IA 3AHXA 4GD0A 4WD0A 3NL6A 4LNYA 4FXSA 3VOCA 1S46A 1QI5A 2C0AA 1B3XA 1VBUA 2EPKX 4JN8A 4DWSC 1EWDA 2TYSA 3C61A 4V33A 3S6TA 2ON3A 1POJA 4J3VA 4I9AA 2JIWA 1IXNA 1XGEA 1EDGA 2XIIA 2Y5EA 5AHIA 4E4FA 5MKGA 4OBRA 3GB6A 1C29A 3CK5A 2P0IA 4JX5A 4MUZA 3VGEA 1CGWA 1QPQA 1WPCA 1ECEA 1QATA 4AZCB 4X0VA 4DLFA 4S3AA 3GG7A 4CVUA 2YXXA 4QM1A 3WF2A 3LMYA 1WDDA 4ZQNA 4QS6A 1YPIA 1KFBA 3G1YA 3O16A 3O05A 4HSOA 2XIMA 5AOUA 1SO3A 2QVNA 2P3EA 1Z48A 2G0WA 4B2DA 3P74A 3KCJA 1MWOA 3HJEA 1JF6A 1FRBA 2G3FA 4YU1A 1DQXA 2ZC8A 4GA8A 2VC6A 4NZFA 2ISDA 4UTWC 2ZRVA 4B5NA 1UW9A 3LI1A 2DQWA 1C9WA 4X63A 5A6LA 4PFMA 2BFGA 1HQTA 1CGVA 3EDKA 1KC7A 3H2MA 5G1MA 1W1TA 2Y7EA 5D37A 4XG1A 1P48A 3P0WA 1HW6A 3LGEA 1R0MA 5A2AA 4HCDA 2Q09A 1X6UA 2VZTA 4LAZA 5LNWA 2NXHA 3AMLA 4P5UA 3C3NA 3LBOA 3CT2A 2NZLA 1TJPA 3EWZA 4ZQMA 4DIAA 3KM8A 4KT2A 1FWDC 1EBHA 1MEHA 4IF2A 1D7FA 4AX7A 5H1WA 1VR6A 3IEBA 3LBMA 4AZGA 2G95A 1M7XA 1YTEA 4KERA 4HKPA 5HOSA 1MYRA 2GVGA 4O13A 1UMLA 2QJIA 1RCOB 3L2LA 4J40A 1REQA 4UFKA 5D32A 4PB5A 1V6UA 2PRMA 1S2VA 2ZKMX 3DN5A 4U3AA 3OLGA 4ES4A 4N9DA 3BVJA 4E4PA 3LS9A 3K46A 4XD5A 3GKAA 4GVFA 1F8MA 3EWBX 1GOKA 4QHRA 3ISIX 1G0CA 4ZL1A 5LA1A 1P0NA 3WBWA 1XLDA 3KZSA 1G4EA 3Q58A 2QCLA 2FZ9A 1J0IA 3RMJA 3TN3A 1UOKA 1K6AA 4QXIA 3BW2A 5CKSA 1LRNA 2W0UA 3NZQA 3LM3A 2DH3A 2BOEX 1RVKA 5CBBA 3ZWSA 1MQQA 1EXBA 3BAJA 3DXIA 1MI3A 1ME7A 3NSXA 3G8EA 3GDRA 1EPXA 3QGAC 2Z7KA 1L6YA 1IIHA 5EL1A 5BXPA 1E0XA 2HDJA 3I7SA 2XVLA 2CZVA 3QJAA 1ZAJA 1W1A1 4JY8A 4PCTA 1FKXA 3B0XA 2A6LA 3PBGA 4LH8A 2DUXA 1Q2RA 1PX4A 3QQ0A 1Y65A 3GDLA 1E1CA 2JF7A 1VENA 1K1DA 3OVQA 3UGRA 2AGKA 1QHOA 4ATWA 4PTVA 2QT3A 1RBLA 4EK7A 3W2NA 4A6GA 3K13A 4PEEA 2BS9A 2FTYA 1RCQA 5HR7A 3WKZA 3UD6A 2OELA 4KKXA 4G9PA 4LPCA 4MWAA 1FCQA 1BF6A 3F03K 4RR4A 2YKKA 1Z41A 3S1VA 4DZ5A 4UIOA 4P8UA 4RKAA 3VNIA 4NASA 1S1RA 4Q6XA 4NG3A 4CCZA 1XIHA 4HA3A 5M3WA 4OBTA 2GOKA 1TWIA 1Z44A 4KWWA 3Q65A 5CSYA 1E73M 5TF0A 3CZKA 3VGBA 1ISVA 3AHTA 5BRPA 4NX0A 4IUGA 2GGGA 4AZ7A 4AD3A 5JBDA 4A2RA 4QE4A 4FMVA 4N02A 3YPIA 2WPBA 1J10A 5AKQA 5H8MA 1O5RA 3TLQA 1VD6A 2FKPA 3FVMA 1KB3A 2EKGA 4D8LA 5BWFA 3OZMA 5F2MA 1FXQA 3KLKA 2L5HA 3TW9A 3NURA 3VIJA 3U2ZA 3NIYA 2ISFA 5AZ0A 3VABA 1YNQA 1M9HA 3F4VA 1LL4A 4FNQA 4F2TA 2A4AA 2PZNA 1RR2A 4NNAA 4P7QA 4J3TA 1YTDA 3L4TA 1JXKA 3AXMA 4L1WA 4Q7IA 2GJXA 3IJIA 2PD5A 4AIOA 1FDZA 1LLWA 3IJQA 2FZMA 4N4QA 4H41A 4H8VA 2X30A 2ESCA 1R46A 4IMFA 3IUIA 3N25A 5BCAA 2BGNE 1KM6A 3K30A 4M5PA 4BY3A 1OZMA 1XRTA 1UPPA 2TAAA 1DJHA 1OFQA 4UFJA 3UR5A 1EO7A 2VC7A 4MDPA 2E4TA 3H2CA 2AL2A 3IJLA 4MNMA 3W1NA 3GXTA 4K3ZA 4OVXA 4DHGA 2OCZA 1RK5A 3VX1A 5D02A 4FAMA 2Y88A 2QCMA 1UWSA 2XVPA 1OT1A 2VFGA 5KINA 3IK2A 2B7OA 4H9YA 1I4NA 2OXNA 4L64A 4Q4SA 1EP2A 2V67A 3MI3A 1IEVA 1FWCC 1HKWA 5A6SA 5HMSA 4RPQA 1K77A 3B9DA 2PDNA 2PP3A 1SFTA 3AROA 1EHAA 1H7PA 3C0QA 4UOZA 2XN1A 3CQHA 5HNRA 4GMEA 4MYXA 2QGYA 4K8HA 2F7FA 1W5OA 4HA0A 2XIQA 3T08A 1W9UA 4ONVA 3IARA 2ZX7A 1K03A 3EOLA 2PPGA 4GACA 3WBXA 3CV2A 4HK5A 2OX1A 1LBFA 2EPOA 2ZADA 5BOEA 1BXNA 3UJEA 3VC5A 1LUCB 2BG5A 1VBRA 5CCZA 4Z0JA 2V9DA 3ZOAA 3GS6A 3HZ3A 5BNKA 4AIBA 2E9MA 2VVNA 3E0WA 1LLOA 3KBNA 3B3DA 3M43A 4E0CA 4CQDA 4QBXA 5JH2A 3LHWA 3G18A 2F61A 1Y5WA 3NG3A 4ACYA 3D46A 1V0NA 5ABGA 4UQAA 2WLYA 1RQEA 1FDYA 2WVTA 5CC7A 3LB0A 1TJRA 4PUKA 3VDAA 4S1FA 4I5UA 2GGIA 4QLJA 2CU0A 4YTTA 1PJ9A 3DX5A 3ZSSA 3KDOA 3GC2A 4MJ2A 1DQUA 1YMYA 4Z17A 4G7FA 3UFYA 2FYMA 2QS8A 2A7NA 1AD4A 2WVSA 3AIQA 1BKHA 2E6FA 3MHUA 4PYSA 4XZBA 3QMTA 3APTA 3LPFA 3RYSA 2FGBA 3UWYA 1X96A 1A80A 1RXOB 4XBJA 3WUFA 3GH7A 3RAOA 5E6YA 2BWGA 2I9UA 4RDVA 3T0BA 4QDWA 1E9LA 1K7EA 2G3MA 3RLVA 2PWDA 3QM3A 1W1PA 4G1NA 1M41A 2XYLA 4PMRA 4LALA 1VFMA 4W84A 4HIBA 1LWJA 3WCZA 3VI2A 7TIMA 1DKWA 2VR5A 3JW7A 5J5RA 4DBUA 1RV8A 2YB4A 4WJ8A 3B4UA 1K9EA 5CG7A 4CD4A 4WGHA 3GHSA 3NQ6A 1I9CB 1O68A 3NOEA 3PBYA 4MPKA 1TA3B 1V3IA 4A3UA 3A24A 4RL3A 3HA1A 3HOJA 2PF0A 4PH6A 3W7QA 4HYWA 3UERA 4UTTC 3SECA 4XO7A 4L1GA 2IQ0A 1X1NA 5IM51 5I3KA 5BZAA 1BWVA 4CQ8A 3WIJA 3I4KA 3NZGA 2QCEA 1V77A 3PBMA 5A2CA 5B7YA 4E38A 1KD0A 3BSMA 4WDXA 4O1BA 3ARVA 9XIMA 2EG8A 1N2VA 1PZ3A 3IUDA 4ZQPA 1K8XA 4C6JA 5KZMA 1E0UA 3RO6A 4KW2A 3LHTA 1WO2A 5D9OA 4WRHA 3LCIA 4H9MA 2ADAA 5AY7A 2CNCA 1RA0A 3W84A 5FF0A 1C93A 4PULA 2C1HA 3EEGA 2B7NA 1DIKA 1GOOA 3E12A 3WEZA 4B5SA 4HTBA 4MVAA 2OO0A 2YOCA 4HA4A 2CC0A 1P7TA 1E6PA 3TK7A 4HYVA 4R9OA 2E3ZA 4IFOA 3VM5A 1JZ2A 3NUKA 2J7BA 3EB3A 3RK8A 3GFZA 3UYCA 1FWRA 3W6LA 4UOQA 2QF7A 2WZHA 2F9RA 4GLEA 1JF5A 3APYA 1XS2A 1QPOA 2Y85A 2G3IA 1F74A 5HMEA 1EC9A 1E0VA 2ZCGA 5C7HA 3BURA 4JFUA 3ZVIA 3VZYA 3ZR6A 2HK1A 1G94A 3SIZA 2FDSA 3ARPA 4M1BA 1EPVA 4TVUA 1M01A 2XIOA 3NQ7A 3WQFA 4Y9NA 4FHAA 2DVUA 3TYUA 3TJXA 1VKFA 4RXFA 3W2UA 2Z2BA 1HGWA 3V0TA 4C6BA 2QIIA 3LK6A 4HNTA 3EXSA 3HFYA 4W88A 4A05A 5I07A 3B8WA 3R8HA 2H8XA 3H6OA 3GK0A 3N29A 1TKKA 3RRXA 3SM0A 2C14A 1KM3A 1UD2A 5EU9A 2PWHA 4KRUA 4OHQA 5CG0A 3S9ZA 4EPKA 1WKYA 1O1ZA 3M6DA 3V5CA 2YDQA 3WY1A 2HROA 2DP3A 3H2OA 1UQZA 4H01A 1TCMA 3W7IA 2P76A 2PDYA 3HJZA 1Q6RA 2VFFA 3AO0A 5EMMA 2VJXA 1FH7A 3C4UA 4GFSA 5I3FA 4UNLA 1B3WA 1TTIA 3MBFA 1NF7A 3MUAA 1YX1A 4H9TA 2AKZA 2OZ3A 4BI5A 5I24A 2ZRUA 1DJZA 3TFCA 1W3HA 4G2DA 3STCA 2XH7A 3ZZ1A 4IL0A 2XPKA 3URAA 2VXNA 1IYXA 1H7OA 2OLHA 4M7TA 1J01A 3W37A 3U4FA 4F79A 4DO6A 1UR2A 1VFFA 4C91A 3Q67A 4UQDA 1OX5A 3EPOA 1PO9A 4DWDA 2QMJA 2VCAA 3HG4A 3QZ6A 1SJCA 2YCLA 2R82A 1JQVA 4BA0A 3W74A 2PSNA 4A8IA 4E2BA 1HJWA 1P1MA 2PWVA 1KCZA 1F4HA 4Z08A 4N42A 2PU1A 3IACA 4JQAA 1RSCA 4P8WA 1C8YA 4UTUA 1T7LA 1W91A 4XK2A 1M7OA 4UCGA 4UMCA 3WLHA 2GGJA 3L4WA 2XFWA 4MJMA 1PIIA 1EB3A 5D8ZA 4AISA 5G2HA 3DC8A 4KQNA 3CUZA 1OD0A 5IFPA 3KL3A 1W3KA 2HWGA 5KEZA 3V5FA 4Z1BA 4IIDA 4IFKA 4GABA 5J04A 4UBPC 4BKNA 2VR2A 2QUVA 4Q8OA 5EMKA 1M3UA 3CYJA 3PUEA 4MNJA 3CL8A 5F1VA 4UMBA 2VRKA 3EDDA 3Q37A 3TWAA 3CUHA 3AOFA 4O10A 3PZIA 4LVGA 1E9ZB 4LAOA 4QFUA 1OABA 3W76A 1RLCL 2ATMA 1F6YA 4GK8A 5E0CA 2NVDA 2R1LA 1JJKA 2ABBA 4JKMA 3OQEA 1QW9A 3SCQA 4UNKA 4OFCA 4H04A 2RDXA 4GVHA 1ZL1A 3TN6A 1EDTA 2G5WA 3BH4A 5HPCA 5HDRA 3IPWA 1JGIA 2AAAA 3H2AA 2XVKA 3N2XA 3VOFA 2YSWA 2G8ZA 4GCAA 4YHEA 2ZOXA 3AQUA 1BYCA 2KAUC 3ITOA 1Q2SA 2I14A 3SCTA 4CD7A 3GVVA 3VD7A 3WEMA 3B9AA 5CPQA 4DBSA 3PJUA 1I2QA 2J78A 1SZGA 1ZBCA 4JTGA 3VXGA 1XUZA 5HNUA 4RNJA 3KBVA 4B3ZA 2V38A 4O1EA 3WJZA 4OTKA 1JZ8A 1ZZMA 3T2OA 1NP0A 3AWNA 3VGGA 2VZOA 1LL7A 5LZLA 1RAKA 1X8CA 1EGVA 3MZ2A 4GO9A 1EOKA 4HMCA 3WQWA 3EA2A 3VD3A 1EL3A 3QVQA 3K8LA 4H7VA 3TTSA 1P4CA 2QVHA 5FL0A 3W7KA 2V63A 2HJPA 2VGBA 4S3KA 2P88A 1E6QM 3FJLA 1ICPA 2HE8A 4AZ6A 1U2YA 2E1DA 4PUJA 2O9PA 4BCEA 2FQIA 3TFXA 3WF0A 1ZBVA 3WLPA 3TA9A 1JYVA 3C56A 2FPVA 2AOSA 3BUVA 3NTYA 3G1SA 5A3HA 2NWSA 4REQB 1T0OA 2XH2A 3LCWA 5L9FA 2X1UA 1FWWA 5CC6A 1X97A 1IGWA 3ZR4A 1XLBA 2ACSA 4DZAA 4O18A 2CESA 4U5KA 1LQ0A 3WLNA 5BXSA 3S3GA 4K68A 5LYRA 1M04A 3TQ0A 2A7RA 1K9FA 5BROA 1CXLA 1HX0A 1SYTA 5A6MA 4ZQOA 4K7YA 2PBGA 1PXGA 4S39A 4J3UA 5K7JA 3THDA 4OOZA 4QX4A 2DZAA 3C2RA 4IGHA 4YYFA 4LT9A 4OU1A 3JU2A 5U7SA 6CGTA 3S9YA 1HVQA 2G3NA 3S5OA 3AHZA 1HO1A 1I0BA 3CAVA 1LBMA 1VEMA 1KR0A 3WQPA 2EJ1A 3II1A 1LOLA 3KAOA 5T91A 4B5TA 3QC0A 1TWZA 5I2UA 2DPEA 3KTXA 3W7CA 3VKDA 5K3VA 1B3OA 2F8QA 5D9NA 1Q4WA 2HNEA 4X2RA 1IZJA 3IK4A 3KLLA 3ZT6A 1KFLA 5A94A 1W1ZA 3BV4A 1ZSXA 3O9NA 2WBKA 2X16A 7REQB 3EWDA 4UQEA 3AS0A 4R7JA 2GJXB 4DAIA 2ZA3A 4HNOA 4ZXLA 2WPGA 3GHRA 4QITA 2FVMA 3PNUA 4TUFA 3W1PA 3ZVHB 1W3IA 3KRSA 5C9ZA 2BY2A 2OOGA 4IX2A 3N11A 1VRDA 1J2BA 5AHNA 3GQYA 2E6YA 2GQAA 1SQ7A 2W91A 4LEFA 2OQYA 2AL2B 3SR7A 1PBGA 4M56A 4MDOA 2O92A 3LXCA 5A8NA 3PTDA 5D05A 1B54A 5MF5A 1I8JA 3W01A 2V2CA 4LFYA 3ZQ9A 3UCCA 4U4MA 4DJED 2DW6A 1XIDA 4EF8A 3W07A 1OFPA 4DWSD 3UG4A 3A5VA 4DI9A 3A13A 3CQKA 1EC7A 3PANA 1JCLA 5A8OA 4MY8A 4FXJA 1Q6LA 4H9ZA 3OBKA 1Q13A 4M29A 3NQGA 4WCJA 5DQPA 3VD4A 1Z3NA 4S3CA 1HNYA 2PLKA 3SGUA 3HG2A 4Q8WA 1EH9A 4YTQA 1F3WA 3R1ZA 3CAWA 2NV2A 2A21A 1VIZA 4O15A 1A5AA 1F76A 3AALA 4JBRA 1UWUA 1CGUA 3H55A 1S3HA 1XQLA 3IGSA 4F4RA 4UTIA 4BF9A 2J9ZA 3SUWA 4U31A 4ZMGA 2VEIA 4JFVA 4A29A 4JD4A 1U5JA 1DJYA 4C6EA 4AYGA 4K39A 1OK6A 5FJJA 3MWCA 4NSBA 4LUTB 1H1ZA 5JUVA 5HUPA 4Y96A 1AUSL 4MAZA 4NXSA 5HR6A 2OLAA 1OG0A 4GZEA 1A5KC 3H4GA 5JH1A 1OINA 2ZRWA 3DH7A 1OY0A 2VO5A 1DXEA 4LC8A 3ZJKA 1FOBA 5I78A 4CVWA 2AGTA 3PHAA 2ZC1A 1MW3A 2PWEA 4RLIA 3XINA 4L4PA 3N6QA 4R85A 4H6QA 4HNNA 1A4LA 4DXVA 2QCNA 1MFVA 3M7WA 1AH0A 2ZWYA 5LGZA 2CZDA 3I6TA 3M5XA 1R9XA 3L65A 3W1TA 2Z2AA 1UBPC 1LQAA 1BF2A 1ZAIA 1CXEA 3WQ5A 1P0EA 1K6WA 4Z2IA 4O12A 2WM0A 4XAGA 7ENLA 4WHBA 4DXXA 4AIUA 3CB3A 1ICSA 4W5UA 4C6QA 4GH3A 2XZ7A 4DB7A 3WQEA 4FLQA 1CDGA 4JFTA 3L5LA 4X9YA 1TCDA 2YCEA 4HU4A 3GX9A 4ZODA 4O28A 3UZYA 4BZYA 2JIEA 1ME9A 1E55A 3GW0A 3SQLA 1A5NC 1W5QA 1WA3A 3HIJA 4DJFC 4LAMA 4D2JA 4JICA 4AX6A 3TJ4A 3T81A 2IXVA 3W7DA 5JIPA 4DBEA 2VEKA 1H1YA 3F2BA 2WXDM 3W7NA 4HPHA 3O6AA 2YCKX 3ABXA 4Z0SA 5BOFA 3DFNA 1VFHA 1RHCA 2E0PA 4YLWA 2YIHA 3PJXA 4S3BA 2VCBA 4I9JA 4K1GA 3T4WA 2D2JA 3VIOA 3GKFA 2GUYA 4LUIA 4BJHA 4IX0A 1AH4A 1UWRA 5LNSA 3MP3A 3C0LA 2WVUA 4GI4A 4R53A 1JDEA 4OJYA 4Z2JA 3GFYA 1MUMA 3WX7A 1SO4A 3QZEA 2VFDA 3HFTA 2WHLA 3B8SA 4PB4A 3W2LA 3D3FA 3DFQA 3G1DA 3TYBA 1R47A 3BLEA 1B57A 3G1FA 3T78A 1HVXA 3O07A 1P43A 5JMUA 3LGGA 4IQEA 4E2OA 1GVSA 2CLPA 4ML4A 4PTWA 1R3QA 5BWAA 1R2RA 2P3ZA 4KEVA 4PMXA 1GJPA 4KGJA 1LF1A 4B3LA 5JIWA 3EX3A 2Z6JA 4NQ1A 1OX6A 2BDQA 2GYIA 5DFAA 5LIXX 2J7CA 2YA0A 4RXGA 4ZENA 1Z7AA 1PWLA 3W9ZA 1C92A 1W37A 1KV5A 2R8WA 4S3DA 1TPUA 5H8UA 2Y7GA 4HMNA 1PIFA 1JGMA 3TYEA 3KCLA 3H21A 3TSDA 4ZTXA 2JFEX 4PCNA 4UCFA 1TZ9A 1NQ6A 3NYZA 4XVEA 3CWNA 1JXJA 2CYGA 2EKCA 2ZVIA 3W7JA 3SY8A 1GOMA 1M7JA 2VUNA 2WKGA 1XIBA 4ZVJA 3WLTA 1A5SA 3OIHA 1TWDA 1SO5A 3E2SA 4Y9AA 1X38A 4LS2A 5A2BA 2OMAA 3A3HA 4LS1A 4P8VA 3LRMA 5TNVA 1WAWA 3M0XA 3VOIA 3V0UA 4LVFA 4LF1A 3EYPA 1LRTA 2JEPA 3UA3A 4CQ9A 1Q6DA 2CETA 4XAZA 1SZRA 4C5YA 4NRRA 1IE7C 4V1YA 3PPCA 2VR4A 2W9MA 4V2XA 3UZZA 3OW1A 2BTMA 5ABHA 2C91A 2GJLA 5AHFA 3LU2A 1UZ1A 5DCEA 3GUGA 2NSOA 3PSWA 1GPFA 1NOUA 4HHMA 2NXIA 2ODOA 3UETA 2XFYA 1LG2A 1WDWA 3TSMA 1UP3A 4GBUA 2DT3A 3DBNA 1JVNA 1E9IA 1W32A 4OZOA 4KIEA 2BY3A 1XRFA 1H11A 4U2YA 2CERA 3SCSA 4IIFA 2OU4A 4GH1A 4H6RA 1UJQA 1TZZA 3LCGA 3WBAA 3GYEA 1KO0A 4BF7A 2G41A 1KR1A 4GINA 1PTGA 3S1UA 2OSXA 4WX2A 4UR9A 5AC8A 1D3CA 4QJ4B 2D0FA 3OA5A 1KXQA 4JTIA 2Q8ZA 1AVAA 2YXOA 4HK6A 4ZB0A 3F2DA 4JTEA 4ML9A 4HOXA 2PDMA 3MO7A 3C52A 1Q8AA 1V3JA 5CSUA 2EAWA 3BZJA 3E1F1 3GHTA 4BF5A 2DVTA 5K4ZA 2Z26A 4OT7A 5FKYA 4NILA 2FB3A 1KTNA 1XM3A 3QMSA 3UZWA 1TE1A 3QBUA 1SJAA 1R2SA 2Z1VA 2O9RA 3SGGA 3CUIA 3ARTA 4IFKB 5D38A 3UVAA 2ZX5A 4LCQA 3AZSA 3AIWA 2TPSA 2C6QA 3VC6A 2V3DA 4RE3A 2PGFA 3EEZA 2Y5SA 3ZR5A 4HB7A 5C7VA 1K02A 2QJMA 3HM7A 4UTHA 4AC7C 4F3HA 3MCOA 4UZSA 4TU1A 3WF4A 3LLFA 1QR7A 2EGZA 2YDRA 5CJNA 2NX9A 3NJ3A 2QAFA 3PWAA 4QDMA 4LUYA 1V6YA 1GQKA 4G6CA 4WDUA 4S23A 4UUIA 3FLUA 4QR6A 3C5QA 3G2GA 3KVJA 1EA0A 3SIMA 1LBLA 3NQVA 3ITGA 3W2JA 3UR7A 3QV7A 4LYRA 5HNTA 3O6YX 4GXMA 3MO4A 4ADTA 5E6ZA 3HPFA 1QK0A 3IIPA 2O7SA 4RZ5A 4EAMA 1OEPA 2QF8A 1CLVA 4GCXA 4HJFA 3OLIA 4CN6A 1MDLA 4YJ5A 3QHOA 2NUYA 1ZP3A 4XISA 3UXAA 1W8SA 1Z89A 4GQRA 3D47A 3LOTA 3SURA 5DT7A 3IJ6A 1KFJA 4DUWA 2ZX6A 3SB0A 3NQBA 1YNPA 2KX9A 3VD9A 3R0DA 2V0TA 1RJRA 2DZBA 3CPUA 3WLLA 3EB4A 2QCGA 5C2XA 4QCEA 3C2FA 2C16A 4GYFA 3FN9A 3LTPA 4L4LA 1R3WA 4LC6A 1O60A 3JS3A 3H2FA 2Z25A 2XZ9A 4AD0A 1VPYA 3EXRA 2E9BA 3QGKC 5T26A 3R12A 3A9BA 2J7HA 2C79A 1RVGA 4GHRA 4GUIA 4LVAA 4D1IA 4KIRA 3E2VA 3OZPA 1LG1A 1A5MC 3ZT7A 1NWRA 1O94A 3AYVA 1KFKA 3NPVA 1JI2A 4PBFA 1X8FA 3S6OA 1GHSA 2DEPA 3CHEA 3CPRA 3B04A 3SJ3A 4J35A 2DUZA 1RZMA 4IJRA 3SADA 3PZ9A 4YNGA 4HHHA 1OC6A 1XIMA 7CGTA 4TVCA 4JEJA 3MV11 1RPXA 1TPC1 3ALFA 3A64A 4AVFA 1TUFA 5LHFA 4YHGA 4J27A 3FFSA 2ISWA 1XF0A 2YB1A 4RUBA 4RE2A 3MJMA 4UR7A 1N7KA 4F8XA 4Z2LA 1S5VA 3QC3A 2WSYA 2V5LA 4GG9A 4GISA 4Q3MA 1KCLA 3HGJA 1DHPA 4HN4A 3P3BA 2Y70A 2WSPA 4ZO8A 3ZLGA 1L6GA 3H12A 3RM9A 2AQWA 3DESA 4WXZA 3CZEA 4D8AA 3LQGA 5D2VA 2INZA 4TV6A 4YN5A 1QO5A 3VX0A 3KRUA 1TWWA 2ZUVA 2OX4A 3NSNA 3PFMA 3N34A 1R8LA 1XBYA 3CAQA 2ISVA 3KTSA 4HMDA 3FGCA 4Q8TA 4DBDA 4GUHA 3AYSA 2X2GA 3U2EA 4I90A 1TPH1 4KWSA 4RV8A 3AUJA 4XVDA 1UWTA 1Q6CA 4TTGA 2FVLA 3S8HA 3CS2A 4EPBC 1WOBA 1TTPA 3B9NA 3WJYA 2JKAA 3ERPA 5KMYA 3CH9A 3SSZA 4CCCA 3G5EA 4OV9A 4I8YA 1XFBA 2MUCA 2Z24A 3DBPA 2PD9A 3CHFA 4C90A 4J3WA 3CZLA 3OGSA 5EMYA 1UPMB 1PZ0A 2CHRA 3PBWA 1BRLA 1W0MA 1PHQA 4A8LA 2FH6A 4Q8QA 3HPXA 3T07A 4JIRA 3NCOA 4D6JA 2J47A 2H9AB 4W4QA 1QHZA 1YTKA 1HJVA 4UFHA 2ACRA 1SW0A 3CUXA 3O15A 3BAKA 4GY7A 4IMEA 4RE4A 4PMVA 2PDHA 1UR4A 1A3WA 3K5XA 1AFSA 3DC0A 4GX9A 2OZTA 2QUMA 1OC5A 2PTXA 4JKKA 7A3HA 4CNTA 2EXOA 4QEEA 4MSSA 4GX8A 1FCBA 4MTVA 5FJOA 1UQYA 2Z0IA 4Y8FA 1UZHA 3M47A 3UWVA 1GYMA 4C6NA 4YPJA 4PZVA 2XTKA 1XQKA 2C1GA 3WK3A 1KBJA 5JVLA 3WF1A 4QG6A 2YW4A 2V5BA 4GIAA 1SPQA 3GTIA 5DMYA 2FGZA 4O4VA 1J6OA 2XN2A 4CUCA 1NH6A 2WAGA 1XSIA 4GQBA 3HPZA 5D03A 4GIRA 3LV6A 2JK2A 2ZZ1A 4UQBA 1OM0A 5BMWA 3VCCA 4MB5A 2PP1A 5D2TA 1OG6A 4IG2A 4NZ3A 2X1IA 2WANA 1YE6A 3A22A 4POCA 3UWEA 3ARUA 5HBFA 5LIUX 4NZCA 1UD6A 3AZRA 4AWSA 3SN0A 5LHEA 4L80A 4MMWA 4RW5A 1A5UA 1R3TA 4HCLA 1CX9A 4FXRA 3H70A 3O0KA 4JCLA 4R33A 4NAFA 3AIVA 1W3JA 3QOKA 1JCNA 4DJFA 4IP7A 3L68A 1K7FA 1VEOA 1X6LA 1S2AA 2OWWA 4MFDA 3A3XA 4W8BA 3N4FA 4MF4A 1F3TA 3B0UX 1KBKA 3W4RA 4IH3A 3GXIA 1NVMA 5LNUA 1CI1A 4QISA 4JEQA 4YVVA 3PJWA 1R3YA 3V16A 3QTGA 4UNIA 2GVLA 3H24A 5CZTA 3VNDA 3WG6A 3WH9A 4BWLA 1EXPA 2ZXBA 5I7GA 3TN5A 4I7WA 4I7VA 1XG4A 4WUIA 3UY7A 2XISA 2QZRA 3CHVA 3WFLA 1DORA 1KBLA 3N04A 1EQCA 1UBSA 1BEUA 3P80A 3LPOA 1QW7A 3VPLA 1C9DA 1L6SA 1KM4A 2AAMA 2DORA 4RK8A 3MDWA 3RJXA 2YL8A 3BE7A 3T6CA 4ICCX 3E02A 3R11A 5REQB 2J7FA 1ITQA 5A6BA 3A5FA 3OODA 3LGDA 3KOXA 4MOZA 3EA3A 1F7BA 2WMJA 2XM1A 4ZOCA 3PY2A 4HSNA 4FOUA 3V3WA 1DV7A 1TRDA 2JF6A 4J7RA 4BFAA 5HJLA 4QGCA 1CBGA 1M68A 3BXWA 2YCIX 4AY7A 1VPXA 3PM6A 4NYUA 3RLHA 4NUWA 1E6XM 1H2JA 3UPMA 2G97A 3T0CA 4WDWA 1F05A 1JDCA 2R24A 4UTJA 3ZXWA 3M64A 3GYCA 4V28A 3VMPA 1HG3A 4MZ1A 3MKVA 2RUSA 2ZFAA 3Q45A 4L61A 3CGTA 2QCDB 3P7YA 4IFRA 1E51A 3DFYA 2R91A 3UCDA 4NNCA 1J5SA 1AD1A 1IXOA 4TIMA 3LHYA 4S38A 1WUEA 3CH0A 4DAFA 1X6NA 4MY1A 2ZX8A 4K7VA 5DMLA 2PA6A 4JHZA 1GZJA 2F84A 4N9BA 1IR2A 2OEKA 3P82A 1PYFA 4C1NA 1JDAA 3TMQA 2CWXA 1AG1O 1OX4B 3M16A 1QOQA 4ORIA 3ZJ8A 2Z00A 4XAFA 3OYZA 2VDHA 2GLKA 2BXYA 4KRTA 2GK1B 4ZR8A 3GAKA 3M7SA 2YFOA 4O8AA 4UTLA 2NLIA 2HQAA 3QKZA 5A6TC 3MMUA 1MNZA 4D6IA 4TMCA 1GZ1A 3OTRA 2D23A 1TG7A 5IOBA 2C71A 3VOHA 5GPRA 2BXZA 1GNXA 2QAPA 5HWNA 2ZZ3A 4QROA 4JYDA 3I65A 2ZUWA 3OZOA 4QG8A 4IJCA 3SRHA 2A79A 1ZP4A 3W3OA 1XDJA 3NQDA 2PTWA 3W24A 4Y6GA 3B05A 2V81A 4CNPA 2PDKA 4UTKA 3DEQA 4OQVA 4AZ5A 2YBUA 4EXAA 1WKEA 3TVAA 1S39A 4XAPA 3CQIA 1UYQA 3BSHA 4YWSA 2J62A 2VHLA 1FFRA 2WLZA 1OJXA 5DMNA 3ITLA 4U3CA 3RG6A 2V2DA 1IGSA 1BWKA 2O9OA 3VGDA 3EX4A 1QOPA 1C90A 1JAEA 4Q8NA 2B7QA 1NP2A 2NQHA 1OCJA 2D22A 3T0TA 4H9VA 3RU6A 2R1PA 3H4XA 1SGJA 1OF8A 5FAGA 1UD5A 3PBUA 3ABSA 5FSEC 3CLWA 1MUCA 5K9XA 1JCTA 5AYIA 2QCCA 4XZ9A 2QUUA 5A5WA 1QI4A 3QTPA 3S1GA 2XVGA 3JVAA 3KVKA 2YDSA 3RDKA 3G1XA 3MVTA 4MWAE 5CJ5A 2Y4SA 1IQ8A 3R94A 1BTMA 1F3XA 5A8MA 3WO8A 3AICA 3T0DA 3SGZA 2DGAA 1NDVA 5I3HA 4QTGA 1CYGA 5E70A 2Y6ZA 1AQ0A 2BHUA 2W67A 2Y0FA 5JQ9A 2MNRA 1E9YB 3UEQA 3GU2A 3OVGA 1J18A 2QKFA 3R0UA 3W22A 3FAXA 1AL8A 4RDZA 4FO4A 5G5IA 3SUVA 3AS1A 2EPNA 2W62A 3NDZA 1OCBA 3MCMA 1U1JA 1B5TA 3S6DA 4ZB5A 5FSDC 4O0KA 3G1HA 5KTLA 1GORA 3HURA 4PUUA 3VKCA 2WOQA 3ANVA 1SZFA 3TV8A 4E8DA 1UA3A 2B0MA 2VX7A 1PX8A 4A22A 1BWLA 1MW0A 3FJ6A 4NYYA 1GPWA 5DRIA 2RDUA 2I57A 3P84A 1QHPA 3GXMA 4WVXA 4WF7A 2HS8A 1QNSA 5XINA 5KZEA 1G6CA 4LBSA 3VDGA 4FNSA 1UUOA 1VCVA 2DSUA 2XSAA 1KGUA 1KFEA 3DAQA 3IVUA 5CXPA 1K3UA 4ZOAA 1I75A 3DGBA 1QXLA 4NF7A 1QJWA 2UY5A 5F2IA 3TYZA 4RZ4A 3CZ8A 4IMDA 1RPKA 3CU2A 1RD6A 1UROA 6ALDA 3NYDA 3VVGA 1LCOA 3SCPA 2J75A 5ABEA 5GJMA 4O1CA 4KEZA 1L8PA 1TV7A 4JNYA 3W7PA 3BDKA 4AHPA 3UQNA 3L2MA 2CBIA 1W2VA 1HJXA 3RR1A 1EUNA 3EOOA 4WJEA 1OGSA 4NIRA 3BAWA 4DLMA 2XSXA 1V02A 4J9JA 3W1XA 1JCXA 1TV2A 2WZEA 3LM7A 2BZNA 1Q4NX 2RFGA 4EWJA 1VYSX 2UBPC 4YTRA 4B91A 1BSLA 4CNNA 1W9XA 2FHBA 4HZMA 3EZ4A 3UY8A 1XLKA 2XIBA 2A3EA 4J1OA 4XAYA 1QNQA 2GPTA 4NZ1A 1KBIA 4ERGA 3C0SA 4IZGA 1F8IA 1LRQA 1LUCA 2OGYA 4HHLA 3U57A 1X98A 1E6ZA 4OGZA 1RP9A 4H8UA 1KTCA 2WO5A 1E43A 2X1RA 3F5JA 1JQXA 1B9ZA 2J6XA 4H4IA 3SY1A 3N14A 5CZKA 1GKRA 3L5AA 5IBXA 3M5YA 1JDFA 1AMKA 1AJZA 5D2YA 2I5GA 4BS0A 3BMVA 1GYLA 2OJPA 4GQ0A 1W3LA 4WY0B 2DH2A 1A0DA 4J28A 3UJ2A 2J6VA 4RX0A 1ISXA 1M53A 4KFPA 2OG9A 2ZE3A 1UOZA 4HZ6A 1QI3A 3HG3A 1XIGA 3A12A 2V8ZA 3DYOA 4DWSB 2JE8A 2QR6A 3FGCB 4FZIA 1W2PA 1YBQB 2WMGA 5H8PA 4Q7NA 4Q8MA 1E3XA 1FWFC 3WJWA 4I8DA 3FYOA 3Q4DA 4HHPA 3IAQA 1Y0EA 4JTTA 1CXKA 1GVQA 2VQTA 1YPFA 4MNLA 3V4BA 3GXPA 1UWQA 2JKEA 1ODZA 1XIIA 2VI0A 1GJWA 4INFA 3NAVA 4AD4A 3LLDA 2VWSA 3OGRA 3QW3A 1ENUA 2Z7GA 3MUXA 1NARA 2GDUA 2CITA 4TOQA 4DUXA 1XC4A 5FJPA 3BK0A 1IZCA 3UXIA 2E8YA 3INPA 3VIFA 2VURA 3R4IA 2O0TA 3R43A 2BB0A 3O2LA 2VD9A 3WMCA 4YCOA 1OF6A 2QPXA 1Q45A 3PBVA 2ASHA 2F38A 4CU7A 1Z6KA 2TODA 3TE9A 4JTAA 4O50A 1VB9A 2XGIA 1TTJA 2E28A 4LUSA 1O5KA 4IICA 2WNWA 4WSHA 5DT5A 3W2KA 3TIMA 3MMDA 4EP8C 1ZB5A 1C8VA 2B81A 3P5ZA 2WC7A 1T5AA 3WQOA 4U10A 5TBOA 5DANA 1J0KA 3GR4A 3SFWA 1X1ZA 5HPOA 4JNMA 3LMZA 4E8CA 6ENLA 1PTAA 3LSCA 3GWQA 1AQMA 4PFHA 2FZNA 2WKJA 4L9YA 1RUSA 3IJ8A 1UH3A 4P7RA 4U33A 3TA6A 2VRJA 4I5XA 3LYEA 3P61A 4W7VA 4L5ZA 4UFMA 3C2YA 4Z1DA 4PBGA 4AEOA 3RGTA 1D3HA 4IG2B 4MKSA 2GGHA 1SZEA 1VH7A 1P5BA 1EJVC 3EA1A 3GTFA 4US5A 3ABRA 4U2ZA 3FIGA 3O7UA 4BHYA 2Y2WA 4Q4MA 4B9YA 3U7VA 4H9XA 4AWTA 3M41A 1LT8A 4KH2A 2PGWA 2PDIA 3KOYA 3ANYA 3UXLA 3RM4A 3VKJA 4A3RA 4M80A 5AN7A 3DFPA 3QHNA 2UZ9A 1I45A 3LCFA 2W3ZA 3PB2A 3CIVA 5EFFA 4RCXA 1E4MM 2CZFA 4DYJA 3UNTA 3WL0A 1NFBA 3CV6A 3VKKA 3IS4A 1MRQA 1Z69A 4WZHA 1V5XA 3AIBA 3PUDA 4AXNA 2XVNA 3QQWA 2XUCA 2BXVA 4UB9A 1E6RA 1WP6A 4B4FA 4Y7EA 1TFVA 4M8UA 3VMNA 2XJ7A 5EA9A 5EFDA 2Y5JA 1VYRA 3MA8A 1O66A 3NEVA 1I1XA 4FLRA 5FF4A 2GVEA 4QCFA 3N2OA 4BR1A 5I77A 3TAKA 1XYMA 2C0HA 1AODA 3J7HA 3LPPA 3G6LA 3I3BA 2GJRA 3KBMA 2XU2A 4YTSA 2C13A 1GCYA 4XQ6A 5D04C 1XYZA 4DY1A 3OZYA 1XCFA 2WJDA 1TMQA 1UUQA 2NW0A 4H00A 4GY0A 2NLYA 2XFRA 1H4PA 4ZQCA 3GU1A 4WR3A 2J9XA 4FOKA 3HGOA 4B5XA 1H0IA 2Z1BA 1P0KA 3MP4A 1F61A 2R6OA 5DCBA 1TMHA 2VM8A 3MYOA 3FJNA 1FWNA 1SVDA 4FK9A 1HZYA 2V5CA 2D3NA 4L6DA 3W87A 2UY2A 4HBKA 1X39A 4DO4A 3W88A 1CENA 4OUIA 1ZCOA 3AXKA 1GKPA 2I9EA 2J79A 1EJUC 2XWEA 3RXZA 2OYKA 1Q66A 3CIWA 4K38A 3VIGA 3NWRA 5T9BG 3GD6A 4OIFA 3N13A 4DRSA 4HU0A 3R8GA 3WUBA 4IGNA 3RJYA 2BHYA 3TC3A 4R7WA 1GQLA 2TMDA 2Q02A 3TEVA 3ARWA 5IFTA 2W79A 4K2SA 1WXYA 1GQNA 1XRSA 4JAWA 2ABAA 4GO8A 1N8FA 2ZBTA 2HISA 3FS2A 4DNHA 5BYWA 1CXHA 1QI2A 2VGFA 4C5ZA 4CD5A 1Q85A 4I6VA 2A6NA 4Z2GA 4L4OA 1X1OA 1CECA 1W6TA 3U5YA 4JDYA 2E7FA 4YVPA 1ZPTA 2IKIA 4YL2A 1SJBA 1B2YA 3VINA 3A21A 5AB3A 2V3FA 2UY4A 2Y7FA 3KUMA 3I7RA 4IPJA 3TLLA 4CQBA 1OVDA 1ESWA 5CJMA 1LL6A 2XFFA 1Q63A 5AHEA 4EPEC 5C2CA 3IIVA 4I6KA 4YIWA 1XV8A 2GSJA 3GLCA 4B3KA 4WEVX 2ZA2A 3WQVA 1R9YA 5EB8A 3LX9A 3KX6A 4JTLA 2DZWA 4G5DA 1X7IA 2Z28A 4C1NB 3DG3A 3AZTA 2QJGA 1BFNA 1TQXA 4ACZA 1T99A 3GAYA 2Z27A 5EBUA 1Q8JA 3SUSA 1CB2A 4D6CA 4NAEB 3VTRA 4OE7A 2H3DA 2J4GA 3O1NA 1JZ5A 1O5XA 1PUDA 1GOXA 4EXBA 3VZXA 3B03A 4JGDA 3VE9A 1FHLA 1QWGA 2DSZA 2V5KA 3UP8A 1E6SM 6XIAA 1HJUA 4IQLA 1T96A 3U2OA 4QE5A 2FMNA 4DYEA 4OOUA 3AYTA 3W1UA 2R94A 3DENA 3ZLHA 1TMLA 3LENA 2FZDA 3N9RA 4X60A 3T40A 3EB2A 2PTZA 3ARQA 3DFHA 5C9RA 1S2CA 3F5LA 3H7RA 3LCHA 4F2UA 4M6UA 3S5NA 1WBJA 3IGXA 4F2BA 5CSSA 3P93A 5E0FA 1I2OA 2NX3A 2DUAA 4XB3A 2WSQA 3FNDA 3M0IA 3VNZA 5D9MA 3THAA 1WNOA 1CZ1A 2XDFA 1TB3A 2E67A 3TZFA 4DPQA 4ZSUA 4NKCA 3WLMA 5CZJA 4IHCA 2VRQA 1EJXC 2WHJA 3TTYA 3BQ6A 1HF6A 2ATSA 2PB1A 2DZUA 3M0ZA 2CCRA 3RN6A 4M19A 1RCXB 4GY1A 2NQ5A 5CQ1A 3QFEA 1ZS2A 4BEUA 2WWCA 1IIGA 3W1RA 1A5BA 5JXQA 4X3ZA 4YVXA 4PC8A 3CQ0A 5LNVA 2ZWZA 4RPPA 2WNQA 1G01A 4JFWA 1XLJA 1U33A 4GBDA 4K8GA 3D6NA 2NV9A 4N0RA 1MNSA 1U30A 3RMEA 3C2EA 5C8BB 3H8AA 2Z29A 4REQA 1KCXA 4MM1A 3WLIA 4AWEA 5HMDA 4FNTA 4UQCA 1TPEA 3BOFA 3GG0A 2PMQA 4TX8A 3RCMA 3O6CA 1P6CA 4MYAA 5H6HA 3LDVA 3BMWA 3UNDA 2X7VA 5ECUA 1V7YA 4F66A 1CCWB 3LXBA 4ZB2A 3CUJA 3T42A 1BVNP 5F2LA 1DIDA 1VJSA 1VQTA 2WSKA 4C6KA 4IXXA 4PMUA 4P7LA 1B31A 4LBRA 1E40A 2OT1A 1XLHA 3D0CA 2Y1HA 3CMGA 3GRIA 3H22A 1OBAA 3UT0A 1XD1A 3KOWA 5GQBA 4MB1A 1WUFA 2GSHA 3GVQA 1P6BA 3GDKA 4C7FA 3VM7A 2Z1XA 2Q01A 1XBVA 1H63A 1QCWA 3DYMA 3DZ1A 2V69A 4FNRA 3AXHA 4JIHA 2QJJA 2X0SA 2PDBA 3AI0A 2QULA 4DF1A 2QIWA 4GJIA 4XZLX 4LAKA 4DPPA 2W66A 1KGXA 2YR1A 1F3EA 1Q6GA 2Y89A 2J8GA 1DL3A 3UA4A 3BJSA 4ZQRA 2BSLA 5FI8A 3F7JA 1FDJA 4B90A 7REQA 4NY2A 2X7WA 1EJSC 3M5VA 3PULA 5GNXA 1PKYA 3PZNA 4GNJA 3ZVHA 4XZNX 1C8QA 5AZ1A 3G1AA 3TXZA 5E0KA 4AHOA 3C2VA 2PC4A 1MUWA 1HKKA 2YGYA 4BEQA 3HPSA 1XKJA 2C8NA 4MJ4A 1KRCC 2OSYA 3TXVA 2CHOA 4AMAA 4CD6A 4JQ2A 3G8RA 1BPLB 4E3VA 1QNRA 5TQLA 3MUZ1 1ZU8A 3HGSA 3ARZA 1FCUA 3V18A 4X61A 4Q7BA 1QT1A 1UZDA 1XBZA 4O1AA 3MTWA 3GR7A 1UKQA 3WLJA 1XYCA 5C2GA 2P53A 3VKAA 3LPGA 4ZE5A 1WZKA 4D6GA 2ACQA 3ZJ6A 1UH2A 3NQEA 1W1VA 3EOUA 3NM1A 3MB9A 3WDJA 1XSKA 1HKMA 2QNEA 3NVTA 3RF9A 4DVOA 3VCRA 2D2GA 2YL5A 3QGVA 1OFRA 3MJYA <