2ZFAA

Structure of lactate oxidase at ph4.5 from aerococcus viridans
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
367
structure length
352
Chain Sequence
b'YNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRDFGMPIVQRYLRGTAEYGASKQKISPRDIEEIAGHSGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactate oxidase
publication title X-ray structures of Aerococcus viridans lactate oxidase and its complex with D-lactate at pH 4.5 show an alpha-hydroxyacid oxidation mechanism
pubmed doi rcsb
source organism Aerococcus viridans
molecule tags Oxidoreductase
total genus 128
structure length 352
sequence length 367
chains with identical sequence B
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zfaA00
1V7YA 1H7RA 1GZGA 3BPWA 1L2UA 3KRSA 3NA8A 3NOEA 3QW4B 4TMCA 3MUXA 4IPJA 3DFQA 2EGZA 1VZWA 3DFOA 3M6YA 1O5XA 3NL2A 2ATSA 3N9SA 1T0OA 5EBUA 4LC6A 5EMUA 3WJXA 4UUIA 1EP2A 4XKYB 2RHGA 3DI0A 3TX9A 3IIZA 2BWGA 2R8WA 2ZDRA 2YFNA 3N2XA 1ML1A 5G1TA 1LLWA 3P67A 5CSSA 4WXYA 3TC6A 1PIIA 4CLMA 4GNJA 3P5YA 1TCDA 3W7DA 3STCA 1I2PA 4IOTA 4LS0A 3PM6A 1J2WA 4O50A 1A5BA 1LTDA 1KFJA 2FB2A 3C2FA 1W3NA 1H50A 3LCXA 5KMYA 4CQAA 1ZFJA 3SGUA 1Q6RA 1HG3A 5D2YA 4NNCA 1FCQA 1NAL1 1T99A 2GJLA 3O1NA 1KV8A 3NQ2A 1NF0A 5LSMA 2VFEA 5D2VA 3FJLA 1KA9F 3W71A 4JEQA 4EF9A 3NDOA 1HO4A 4TIMA 4PC8A 2E6DA 5DCBA 4M7TA 2VEIA 3UYCA 3W7MA 4FIQA 4LRSA 3W7GA 2NUXA 3I7SA 2C19A 2Z6JA 4KKXA 3PUOA 3Q2DA 4N02A 2JKAA 1OK6A 3LERA 2GQ8A 3PVFA 1KM4A 1O5KA 3NVTA 5D03A 5AYYA 1AL8A 4HNUA 1VCGA 2WKJA 4LW7A 4O57A 3ZS4A 2ZZ5A 2EHHA 3R89A 1G4PA 2RDWA 3M44A 5TBOA 1YLVA 4O18A 1VHCA 3B05A 3NXFA 1G7VA 3NQGA 1NVMA 4BI7A 3DHFA 3F03K 2GPTA 1XXXA 2X2GA 4O17A 5HQEA 1Z42A 3T7VA 3RNDA 3GNNA 3EXTA 1K7EA 2C18A 4IX0A 5KSWA 2Q8LA 1ZHAA 2YGYA 2QCEA 1KW1A 1HUVA 1K3UA 1OHLA 1P5BA 3ZFHA 1PL9A 1A5SA 3ABQA 5AHIA 3W2LA 3PG9A 4WXZA 1TTPA 4K7VA 1XC4A 4GUJA 1LP6A 2DORA 2R91A 3DXIA 1XDMA 1SPQA 2OX1A 3LV6A 3UNDA 4JTJA 4HNNA 4FXSA 2XN1A 4LVBA 5LHEA 5AC6A 5KZMA 1GTEA 4JX5A 3NQCA 5KTLA 3NAVA 3LTSA 4NZJA 1QR7A 3G1HA 3PB0A 2QF7A 3ZR4A 2DZPA 2GVGA 3MI6A 1LOLA 1IXOA 5J5DA 3TQ0A 1F2JA 1KM6A 1SW7A 1X7FA 2QCDB 4PL2A 4LU0A 3OBKA 1R2TA 3GKFA 4FEZA 4NJKA 4O10A 2WNNA 3L0GA 4JTSA 1G6CA 1L6YA 3UY8A 2JGYA 3L66A 2RKXA 3W1RA 3WK3A 4OT7A 2ABAA 1O60A 4FB7A 5D32A 4GUFA 3JR2A 4Z1CA 2Y7EA 2Y89A 2Z1BA 3EKLA 3HIJA 4YMZA 4UMCA 1Q45A 1RD5A 4CCEA 1VS1A 4N6FA 2H8XA 3N14A 3C52A 4N6EA 2XN2A 5HR7A 4HN4A 3HO8A 1KM3A 3EWXA 3VNDA 4UXDA 3OEXA 4MUZA 2DP3A 2ISVA 1CW2A 5ABTA 3QMRA 2TYSA 3NG3A 3S8HA 3VE9A 3R5EA 1X1OA 4JTUA 1JCYA 3M5XA 2B7QA 3BLEA 1U5JA 2ZZ2A 3HJZA 4UFHA 3UPWA 5AHEA 4QNEA 3BARA 1OFRA 2E6AA 1XKYA 1X8FA 1H62A 1IXNA 5G2IA 4JGDA 3E49A 3L21A 4NNBA 4M6PA 2CLLA 3F1QA 4RJEA 3BW2A 4TMBA 5A5WA 1T96A 4MKNA 2J27A 3L0NA 1JCLA 3LV5A 2IQTA 3TSDA 4JX6A 5G5IA 1WAUA 5HWJA 1PCWA 4JYFA 3LHVA 1GYLA 1XUUA 2PRMA 2R94A 4O15A 3W07A 4I9AA 1WOBA 3P8JA 2E6YA 3EKZA 2X30A 3M9YA 3O16A 2B7OA 3W1QA 2WOQA 4DO5A 4YL2A 3RU6A 1TPUA 5I3IA 3A22A 5DN1A 3L68A 3C2RA 3C61A 1IF2A 3MO7A 3V75A 2NZLA 4HSOA 3AO0A 4DF0A 1HO1A 2FJKA 2DJLA 1SZNA 1LORA 2CZEA 2YXGA 1LCOA 1H5YA 3HG4A 3NQEA 3TR2A 3C2VA 3QQ0A 1UUOA 1MEWA 5CZSA 1SO5A 2CLMA 5BOOA 2A7RA 1VYPX 2I14A 3F4WA 1ME8A 3LGEA 2ZA2A 3NGJA 5F1UA 1DJQA 2BXVA 3DHDA 1W31A 3GIYA 1OF6A 1G4EA 2VKZG 3EEGA 4R53A 1J4EA 3FKKA 3TK7A 3LCFA 2X16A 2NXIA 1HTIA 3TC7A 4UIOA 4X3ZA 4LVDA 1TPVA 1Z48A 4JYEA 2DZVA 3W2KA 3QPYA 3G1FA 1F6KA 2WJZA 2WV8A 4S1FA 4GBUA 3TMQA 1SO3A 3MP3A 3UD6A 1R2RA 2G97A 3PBUA 4FX6M 3NZ1A 1HL2A 1GVSA 3LOTA 1KFLA 3NO5A 4O54A 2ZA3A 4X9SA 4LS1A 2C1HA 1SZFA 3W22A 1U83A 4R7JA 4UMBA 4MZYA 4PEKA 1NSJA 3L9CA 4RK8A 1JCJA 5H2ZA 4PFMA 1VLIA 5EYWA 1JCNA 3CTLA 3L0KA 3KAOA 3LRLA 2HMCA 1VPXA 3Q37A 3RLVA 2QR6A 1H7WA 2ZYFA 1KLZA 4AEOA 1YDOA 4A2RA 1LRTA 3TDFA 1TYGA 1ZALA 3NPUA 3DFNA 3UWYA 3LLFA 3W84A 1A50A 4EOUA 2P10A 5DXXA 2DZXA 5C55A 5FEPA 5DBTA 4M6QA 4O52A 5CZ0A 2VFDA 2A4AA 4OQVA 1QO5A 1VC4A 3W85A 5CPMA 1JCMP 1KLYA 2C13A 4HIBA 5LNRA 3QH2A 2QDGA 2NV2A 1OYAA 2FPVA 3G3DA 5AHFA 2X1SA 4MZ1A 4XUGA 3M41A 3S0CA 4GC4A 4LS2A 1VRDA 4MOZA 4JTFA 4RV8A 3TA6A 1V5XA 1OG0A 2FPYA 4BR1A 3ANYA 3GVGA 2ZTJA 3EB2A 3N3MA 4UTKA 1F7BA 5C2XA 4H3DA 1KM2A 2FQIA 1F5ZA 1ICQA 2NWRA 1SR9A 4JIPA 3UXAA 3P82A 2CLOA 2ISSA 2C0AA 3PBYA 2BX7A 3I6RA 3LXAA 3O05A 1QFEA 5G2HA 1L9WA 2Y88A 1ME9A 4X22A 3N2MA 1QNVA 4POCA 3W9ZA 1K03A 1M6JA 1YYAA 5HUPA 3L67A 3W7LA 1G69A 4BI5A 4K6AA 3W7JA 4MFDA 3T40A 4ZL1A 1TQXA 4O0KA 1XUZA 4E2DA 1VYRA 3ATYA 2EPHA 1GQNA 1FCVA 3A23A 2VC6A 4LY8A 4XTDA 3B0PA 3HMJG 3PSVA 3EWUA 3LHYA 4PODA 3IIPA 2HS6A 4XWUA 3G1VA 1SU5A 3NQFA 3EX2A 1OFEA 4MLJA 4JTKA 1OX4B 1O94A 2ZTKA 3E9AA 3QYQA 1XFBA 3FYOA 2WSYA 1M7OA 4GUIA 3IVTA 3S5OA 4GE8A 5D33A 3STGA 5HR6A 2XN0A 3W2MA 4LC8A 1OABA 1UASA 5C5YA 5L9FA 2E6FA 4DQWA 2YW4A 3SZ8A 1LRQA 2DZWA 3KVLA 1AW2A 4UTIA 2VEPA 2ZRUA 4RX0A 1LBFA 1SW0A 4UCGA 4QITA 2NUWA 3C56A 4O19A 2FFCA 2QCFA 3UWZA 4MY1A 1LLZA 3N9RA 1KV5A 3MBFA 3AJXA 3CPRA 1DHPA 1F73A 1KTNA 5AC8A 1KBJA 1YDVA 4FHAA 4JY9A 4LUIA 2ZRYA 5DLCA 2ABBA 3NL5A 3DGRA 2G5WA 4UNKA 2OZ0A 1FWWA 4MY8A 1EP3A 1I45A 4K38A 1O95A 1T8XA 1Z41A 2GUUA 3TNOA 3W87A 1S5TA 3BG3A 4JIQA 5A8GA 1IGSA 5AYZA 3O6CA 2Y62A 2GQ9A 3CIXA 2ISWA 1X6UA 1R47A 1EIXA 1QOPA 3PWAA 4Z0SA 4ZQCA 4ADTA 3L5AA 1BTMA 1KFEA 3TFXA 4DF1A 3YPIA 4R34A 5G4WA 3CEUA 3M43A 3PBVA 2ZRZA 4AMAA 3EXRA 2QKFA 4D2JA 2VXNA 1XBYA 4NJJA 5K3VA 1OX4A 2NXGA 1TB3A 1QPNA 1LOSA 2ZZ4A 1JQVA 3FOKA 3QQ1A 5D02A 3M5VA 5LNSA 5I3FA 1KFCA 3G8RA 3TU9A 4XBKA 2I1OA 2CFFA 3C8FA 2Q3OA 1XBXA 3NR0A 3H54A 3G0UA 1DORA 3NQ7A 3L5LA 1FWRA 5KINA 4O8RA 1H7XA 4OU1A 2GVJA 3ABSA 1JUEA 3N34A 5F4XA 4DELA 4DEFA 1EA0A 1P0NA 3W7KA 3GNDA 1JRCA 5EKYA 4AHQA 2WO5A 3NPVA 4BWLC 3C6CA 3NQDA 3R12A 3EWWA 1B3OA 2Y70A 4BFAA 1VLWA 1R46A 4O1DA 1W5QA 3DENA 2J9ZA 4IXXA 2W79A 3TQKA 8TIMA 3HG5A 1RZMA 4E2BA 3DAQA 5FI8A 2GQAA 5AOUA 2CU0A 1H7NA 1MEHA 4LUJA 5AYXA 2VELA 4WY0F 3W1AA 4UR7A 7TIMA 2DJXA 3OA3A 3S5NA 4UTUA 1TV5A 2YFOA 4QM1A 2G96A 3GX9A 3NYZA 5D2XA 3CM4A 2PURA 2QDHA 3STFA 1YPFA 2ZZ6A 2XFWA 1EWEA 2OT0A 1M5WA 3P61A 4A22A 3W83A 3LB0A 3B8DA 4CQ8A 3VCRA 4HSNA 5I3GA 1EB3A 3LRMA 1UB3A 4UTHA 4E0CA 3M16A 1TREA 1NF7A 3QFEA 5L6UA 1OYCA 2EAWA 4I7WA 5FF3A 2QAFA 4DBEA 3LCWA 2J88A 4A21A 2GJNA 3C2OA 1W3TA 1SFJA 3S1XA 1QPOA 3MI2A 4MJMA 3TIMA 5DBUA 3W74A 4KFPA 4MYXA 3SR7A 1MSSA 1R30A 4FIRA 4Y6GA 4LRTA 1JJKA 3S1UA 3PULA 4FNPA 1H1YA 3OVQA 1F6PA 4NJHA 1UCWA 5AHMA 5CPOA 2R14A 4TU1A 1TPFA 4FO4A 3PS7A 4L4MA 4ZMGA 3LTYA 3HGRA 3P5ZA 4WOZA 3JS3A 1C8VA 2WNZA 4GUGA 4Q4KA 1ZENA 3LHWA 2W6RA 1QAPA 2QCMA 5F1VA 3NQ6A 4UFKA 4L4LA 1LOQA 1WV2A 5DY3A 4IUOA 2B7NA 4MVAA 1JCXA 3PF3A 2YSWA 4NX0A 1G4TA 1K8ZA 5D05A 4DPQA 4UNLA 3TAOA 2VFFA 4FNTA 3G3MA 1W5OA 2ALDA 4AHOA 3S6DA 4MIMA 3IGXA 3RF9A 5IBXC 3UQNA 3PB2A 3W7HA 1DBTA 4LT9A 1P0KA 3KHJA 3GKAA 1SSGA 2CZDA 5SWUA 1R2SA 3SW6A 2H3BA 4MJZA 2TRSA 1TV7A 1SW3A 3GXTA 4ORMA 1Z44A 1ZAIA 2F7FA 4UTWA 3G24A 5F4WA 2JGQA 3C2EA 3CWOX 1AK5A 2TPSA 3EXSA 3DFTA 5F2MA 3W1LA 3A9IA 1F74A 4OV4A 1VH7A 1WX0A 3L5MA 3R2GA 3W73A 3HG2A 1DOSA 1AMKA 1KM1A 4O13A 3B0UX 1PV8A 5I3KA 3B04A 4NJGA 3G1AA 4P61A 4UFIA 5F2IA 1B4EA 3MWAA 1KBIA 1OFQA 3NZRA 1PHQA 1G67A 4UFLA 3LM7A 3W23A 4N9DA 1W56A 2JKEA 1N8FA 4RXGA 2NX1A 3W7CA 1BEUA 1LRNA 3UWVA 3O6DA 1SO4A 1OF8A 2H6RA 1QPQA 2NWSA 1D3GA 4RCXA 3W3OA 4LTSA 5CPNA 4IQLA 3LCLA 3IGSA 3INPA 3R8RA 1WA3A 4UTTC 4FNRA 4JICA 5FF4A 1SUXA 3DZ1A 3M5ZA 3ZWSA 1FCBA 1RVGA 4O4VA 3VI2A 3NQ8A 4AB4A 3I65A 4K36A 3G0XA 4QQ3A 3GXNA 3DKJA 5I3HA 2WSQA 4OV9A 4EF8A 4WOQA 3HGSA 1GPWA 1KTCA 3WJYA 4Y9AA 3I7QA 2QAPA 2CZFA 1D9EA 1FXQA 5K4XA 3CU2A 4Q32A 1OYBA 3TKFA 3LX9A 1H7PA 4XQ6A 2Y7FA 3BGJA 1A5CA 5DXYA 3F4NA 5D30A 1TQJA 1YTEA 4P2VA 3QPZA 1TRIA 4MFEA 5D04C 2Z0IA 1OFOA 3SFKA 1LZOA 2V9DA 2CWNA 4TX9A 4O0ZA 1ICPA 4QJ1A 2A2IA 2QJIA 1WBJA 1MZHA 1PE1A 1G4SA 1RPXA 2DU2A 3BV4A 2FIQA 3EX4A 2Z2UA 4WX2A 3GDLA 3B03A 1DQXA 1Q6OA 4AWTA 5HUOA 1I8JA 1N55A 1B57A 2H8ZA 3IV3A 2QUVA 3W7QA 4LNYA 2YYTA 3U6WA 5K9XA 2W0UA 1XCFA 4LWWA 2FPTA 3E02A 3ABOA 1XBVA 5G1YA 1FUYA 5F2GA 4Y90A 3W75A 4PL1A 2V81A 3FIGA 5LGXA 3IRDA 4NVTA 3FKRA 4O1BA 1G7UA 4M5PA 4H4IA 3MW7A 3GDRA 1TPEA 2Y63A 4LVFA 3JRKA 4GUHA 4X2RA 3CQ0A 1L6SA 1KFKA 4JD4A 1JVNA 3QM3A 1KM5A 5TIMA 4FX7A 1DKWA 3ZWTA 4N9BA 4QSHA 4LV4A 1KTBA 1KFBA 1SZGA 5DCEA 3MP4A 1VCFA 3KX6A 4XBSA 2DZSA 1AG1O 4Z1BA 2VFHA 3M7WA 4IMDA 1TRDA 2B0MA 2OCZA 2PE4A 3IGUA 1GYNA 1KM0A 3P84A 2Y85A 3CHVA 2QUTA 3WJZA 3HBLA 4I7UA 1H60A 3TQVA 2YR1A 3UPBA 5HJLA 5H91A 1ONRA 3IIVA 4JN6A 3G1DA 1EPXA 1FWTA 1DV7A 1H1ZA 2H90A 4AH7A 3QC3A 4RZ5A 1K8XA 3QSTA 3G18A 4KFNA 4PH6A 4A2SA 1NEYA 1WQ5A 3FA5A 5LZLA 3KXQA 4Q33A 3UZ5A 1N7KA 4H6KA 1MO0A 1GT8A 3LXCA 5HWMA 1TPWA 4Z0JA 3CLMA 1YADA 5FF7A 1PVNA 4ZVJA 3EWYA 3P80A 1FBAA 3LI0A 4JTTA 4RLIA 5FF2A 3HPXA 3OVRA 3KVJA 4O16A 1WDWA 3RMJA 5AFDA 3B0VC 3LBCA 3TW6A 1UUMA 3HF3A 5BMWA 4CNPA 3WFAA 5K4ZA 1JR1A 2RDTA 4XZ9A 4UTLA 1TTJA 3PSWA 3UZJA 1YXDA 2HSAA 5EY5A 3LLDA 6TIMA 1TV8A 5T26A 1TTIA 5KITA 4Z1DA 2QUUA 3QMTA 4O28A 3T4CA 3CWNA 1EUAA 3WK1A 4LVAA 3S5YA 2AGKA 5FEWA 2QJGA 3PY2A 3ABRA 4CNOA 3QJAA 4OHQA 2ZZ7A 1PCKA 3HG3A 3E12A 4NU7A 3WK2A 3GAYA 5F4SA 3ATZA 2A7NA 5D2WA 1OX6A 4IWWA 2WNQA 3TXZA 4DO6A 4UTMA 4YLWA 1J5TA 4O1CA 2F84A 1FY6A 3QMSA 3A24A 2CLIA 5HNRA 5FESA 4R33A 3G1YA 2Z6IA 4NXSA 2J9YA 3KRZA 1CX9A 3DU0A 4JTIA 4O14A 5AHNA 2YCEA 3VKJA 4OBTA 5FEXA 3KRUA 3NPXA 3DKLA 1OX5A 3MP5A 4LOCA 3LI1A 1XBZA 3MYPA 5G4EA 1F76A 3PUEA 5AN7A 2BSLA 1GWJA 3S5ZA 4YWIA 4EWND 2A1YA 3G0SA 3W72A 4JNMA 4GRSA 1GTHA 1MXSA 4U28A 5G2WA 4NUWA 1ZNNA 4FF7A 3P7YA 1JUKA 1S3HA 2X1UA 3THAA 2E09A 1OFBA 1QOQA 3PR2A 4JDBA 3RK8A 4ZQOA 3CC1A 4C1LA 4G1KA 4JTHA 3QF0A 3OVPA 1W0MA 2P1FA 2WSRA 3GR8A 1AW5A 3EX3A 3LCHA 1NFBA 3KVMA 1CI1A 5D38A 1BKSA 3NQVA 4NNAA 3TJXA 5U4NA 4DBDA 2QCNA 4AWUA 4JYDA 1ADOA 3HPSA 4UMAA 5KZEA 3TJLA 4K7YA 1ICSA 3LCGA 3UWUA 3QZEA 3I68A 1I4NA 2YYUA 1IIGA 4ZZ9A 3W7NA 3PG8A 2B4GA 2YDAA 2YZRA 1WXJA 1LDCA 1I2QA 4A3UA 1LBMA 1VYSX 2PRHA 3GLCA 4JDYA 1IXPA 3W2UA 4K37A 5CZTA 4NQ1A 3BLIA 5HULA 3SI9A 3G22A 3KFTA 3PBWA 2A7PA 1DL3A 3R13A 4CCDA 2V2HA 1OFPA 2P0OA 2YX0A 3W1MA 4NXKA 3T44A 1XM3A 4O11A 5K7JA 2A21A 1FCUA 1SSDA 4WUIA 1K02A 4ZQMA 2YPIA 2C16A 1Y0EA 2PC4A 4ICNA 3LHZA 2C6QA 3N19B 3MI3A 4IMFA 1OVDA 4TR9A 1B9BA 4RZ4A 5AHLA 3W76A 3TSBA 4WY0A 4KWVA 3E96A 4FX8A 3WJSA 2KZHA 4Z08A 3C4UA 2DZTA 4OE7A 3H55A 4NZFA 4AF0B 3SIZA 5BW6A 4N9EA 2CLHA 2PCQA 3BLFA 2VEMA 3P74A 2LLEA 2V0TA 1QCWA 3FFSA 3BGGA 5K9DA 4M7SA 4HHPA 4YCPA 1FWNA 1GVRA 4ADUA 2A5HA 5U7SA 1VQTA 3BW4A 3OIXA 4NX5A 3MMTA 3A21A 1RQBA 1W5NA 1Q3NA 1TSIA 2RH9A 4IX2A 5CKSA 1FWSA 3Q94A 3LTPA 2ZFAA 3P81A 4NJIA 3G1SA 3W2JA 1WYIA 4MPQA 4CNNA 3EX1A 2FDSA 3TMLA 5IBXA 3TROA 6ALDA 1EX5A 1ZAHA 3KVKA 3CEPA 4XKYA 3UY7A 4JS3A 3C3NA 3W1XA 5K2ZA 1TPDA 2BLEA 1PHWA 3K30A 4O4WA 4S2CA 4ADSA 1W3IA 1AL7A 5EL1A 4O53A 1GOXA 3NL6A 2V2DA 3P62A 2B7PA 4A29A 5FEZA 1JULA 1EEPA 3BVJA 4K8HA 4WJEA 4AWSA 3L65A 1K7XA 3W1TA 2A85A 3GB6A 3THQA 2WPBA 5E93A 1QDSA 1GJPA 3IVUA 2J24A 2E5DA 2V30A 5C54A 4IJBA 1H63A 4Y96A 5D2TA 1FDZA 1SQ7A 1K8YA 2J6XA 4IXHA 4IMCA 2V5BA 3CB8A 2RFGA 4N9CA 2CLFA 3IIXA 3W86A 3CIWA 3BW3A 4DF2A 3STEA 5CG7A 1LM1A 1MEIA 4AF0A 1B4KA 5E1QA 3TSMA 4JTGA 4DPPA 3QRHA 3SSJA 4W9TA 3NEVA 2FLIA 4JTLA 4JXCA 5FF0A 4UTTA 2QCLA 1GVQA 3FJ6A 3RFAA 1XDLA 4E38A 3PUDA 2C3ZA 3W1UA 3HB9A 1WBHA 2BTMA 2NUYA 4GWEA 4Y8FA 2CLEA 1FQ0A 1FDYA 2Q3RA 4QIUA 3BG5A 3BK0A 4LVGA 2QCGA 3W2NA 2JBMA 2AAMA 5LGZA 4ML9A 4HT3A 3GXPA 5BRBA 3LDVA 1THFD 3NQAA 4JY8A 4CCCA 4AAJA 4PA8A 1H61A 1TTQA 2G95A 4ORIA 4MY9A 5LNVA 3I7RA 1SFLA 2H3DA 3GR7A 5LHFA 2ZCGA 4PCFA 1QO2A 3T78A 3S9YA 1DJNA 3LCIA 4RR4A 2ZZ3A 5TQLA 2A6NA 2ATMA 2QEZA 3GK0A 3NL3A 1YTKA 2EF9A 4JX4A 1AW1A 1FX6A 1D3HA 3GYEA 3DBPA 2QJHA 4IMGA 1P1XA 3TXVA 4CQ9A 4IMEA 4S2BA 2O7QA 4C1KA 4QNWA 1WOAA 3DH7A 1W5PA 3B06A 2Y6ZA 1Q6QA 2X1RA 4Z1AA 2ZZ1A 2ZQ0A 4N2YA 3M5YA 3QW3A 1OK4A 2V8ZA 1JRBA 4PTNA 3EX6A 5EA9A 4KWWA 3TFCA 3EWZA 3WJWA 4JR5A 4QISA 3S42A 1TJPA 3W7RA 4K8EA 4KFOA 3W7IA 2WQPA 5MHBA 2YW3A 1I2OA 4MYAA 1ALDA 4IPIA 5CZJA 2QCDA 3SJ3A 1OFAA 5D37A 1I2NA 3W7PA 3D0CA 1TPB1 2CZ5A 3E0IA 1UBSA 4MZ8A 3W7OA 1QPRA 4HNTA 1GG0A 5K9CA 3LHUA 4MLRA 2CW6A 1ZJIA 3TW7A 3TUUA 1ZY9A 2OT1A 3QEZA 2V82A 3W88A 2ZBTA 2EKCA 1LYXA 5EPDA 3NQMA 1C9DA 3LBMA 3G8EA 3O07A 4QAIA 4M19A 2Q8ZA 1W8SA 2BZNA 2JKPA 3A5FA 3BO9A 4UTWC 1GVFA 5C6MA 3TCEA 1W5MA 5BNKA 4YCOA 1F05A 5AB3A 2CLKA 4RXFA 2UV8G 4FNSA 1OFDA 1H51A 2V5LA 3SY5A 3M47A 3SGZA 2DZUA 1VR6A 2TSYA 3GZ3A 1A53A 1QWGA 1FXPA 4O1AA 4DO4A 3FLUA 3O63A 4K39A 2JK2A 3DFSA 2FTPA 3O15A 4N4PA 2OMAA 3O8AA 1ME7A 1A5AA 1DVJA 2Y7DA 5DCDA 2ZRXA 1GG1A 1GVOA 4FNQA 4U4MA 1VHNA 1BWKA 2HS8A 3B4UA 4AVFA 4EVZA 3NPWA 2GVLA 2RDUA 4ONVA 4XTIA 3G1XA 3W70A 4ZQPA 4OWGA 1C29A 1W37A 1P4CA 1BWLA 1IXQA 3LRKA 4FNUA 4DXVA 3ELFA 3FYPA 5J5RA 4AHPA 3VE7A 4IGHA 1SZEA 3H53A 2E5BA 4N4QA 3NNTA 1K7FA 3GDKA 5DELA 5HINA 1W54A 3MHGA 4BK9A 5LKYA 1W1ZA 4BF9A 3DFPA 2AQWA 3EWBX 5LNWA 2Y61A 3P8IA 4UFMA 3C0JA 1VCVA 2E77A 1H7OA 1OJXA 4HKPA 4FXRA 4WD0A 1LBLA 2J9XA 3LXBA 1RQHA 4UFJA 2NLIA 5AC7A 4UR8A 4O12A 4YXGA 1X1ZA 3W7EA 2HTMA 5GVJA 3PAJA 4GJ1A 3S1VA 2NX3A 2O7SA 3FEMA 1TIMA 1GEQA 3NM3A 4M6VA 3GDTA 4AXKA 4ZQRA 1YDNA 1QMLA 5BMXA 1TPH1 1O4UA 2VFIA 2NXHA 2ZRWA 4WQ6A 5I3JA 3IEBA 2A6LA 2PRLA 4HPJA 1ZAJA 2VOMA 3RLUA 1EUNA 5HMSA 1HFBA 2ZA1A 1FDJA 5CPLA 1TO3A 2VENA 3HPZA 5CGQA 3TH6A 4UC5A 4BI6A 3MYOA 1ZCOA 3MHUA 3N73A 2I9EA 2C15A 5CSRA 2A0NA 3IVSA 3FS2A 5DY2A 3UXDA 4TO8A 3A5VA 1SO6A 1LROA 2VFGA 3BG9A 3CT7A 3HQ1A 1DQWA 3GAKA 1VJIA 1YXYA 5LNUA 2D73A 4J9JA 3W6YA 2X1TA 4UTJA 3GDMA 3M1ZA 4ALDA 2QCCA 4RKAA 3VFLA 1RR2A 3UWQA 3U8GA 1RQEA 3QSRA 5D09A 2E68A 1TMHA 3T55A 2Y7GA 3UWWA 3M0ZA 1E51A 3NM1A 1EP1A 3Q58A 2NX9A 3TE9A 2VEKA 1TJRA 3OG3A 3HGOA 1JUBA 2GOUA 4WZHA 1S5VA 4HNVA 1Q6LA 1PS9A 3WK0A 5IM51 4GFSA 1VGAA 4B5NA 1XI3A 3W1PA 3TV8A 3LHTA 3MJYA 3U2OA 3MBDA 3SECA 1JQXA 4NT0A 3V1PA 2TMDA 1TPC1 1YTDA 3O6YX 3OHIA 4ZQNA 2QCHA 3DI1A 1L6WA 4WY0B 1I2RA 4EIVA 3PC0A 3S1WA 1YXCA 1RV8A 2V2CA 2FB3A 5E0KA 2NV1A 4I7VA 3USBA 3MHFA 3O06A 3L2IA 2OJPA 1M7PA 1IIHA 3W1NA 1UJPA 4BWLA 2C14A 3HGJA 4LV9A 4RZ6A 4GXMA 5KZDA 1S5WA 2ZRVA 3HOJA 4HPXA 2E1DA 5F2LA 3IIOA 1YPIA 1XL9A 3KOFA 1EWDA 3P60A 2E5CA 4OGZA 5HWNA 3TAKA 4JTEA
chains in the Genus database with same CATH superfamily
1OC6A 1Q8AA 3DFQA 3MMDA 3DFOA 4LJ3A 2J7CA 3AS1A 4U5IA 3SCNA 4JFTA 4ILSA 3LMYA 1ZJHA 4GI8A 2CIPA 3LBOA 1EP2A 3SEPA 1RSCA 2R8WA 2YFNA 3RGTA 1VFUA 4FLRA 5D9OA 4LCSA 5G1TA 3LLXA 3W7DA 2OEMA 3FVDA 2WC3A 1E0VA 4P7RA 1LTDA 1W3NA 1H50A 4TVCA 3OOQA 1ZFJA 1KBLA 1HG3A 1K9FA 3W25A 3O1NA 4S3GA 2WWDA 3NQ2A 1V6TA 4NAFA 1NF0A 4F3HA 4HN8A 1S46A 5B7YA 1EDTA 5REQA 2HROA 3SQMA 1ITXA 4Q8UA 3AZTA 3UYCA 4AYGA 3W7GA 1ZJBA 3HM7A 4A4AA 2VGBA 1CENA 4N02A 5M2FX 1K77A 2PDMA 2GVEA 5FKYA 5AYYA 4QX4A 1P6WA 3S9ZA 1KD0A 3TC3A 2WKJA 4LW7A 4O57A 2EHHA 1FFRA 2J25A 4PE8A 1C8YA 3RCYA 2RDWA 2FZBA 1GOIA 1YLVA 3VNIA 1NVMA 1LF1A 4B16A 2Q02A 3ZYZA 1XXXA 2X2GA 5HQEA 1E4IA 4CVWA 1GVIA 2PDQA 4DHGA 1PBGA 1Z9AA 5DMLA 3VGHA 3GNXA 1A5LC 2XIJA 2XM1A 1ZHAA 2YGYA 2WHKA 4B15A 2ZX8A 4E6MA 1GW1A 4XIAA 4HPNA 4FXJA 1PL9A 4H6RA 3W37A 3CXOA 4S39A 3EPMA 3N4EA 4GQ0A 1JD7A 2EEXA 2XHYA 2DORA 1BHGA 3E5PA 1VJSA 5DFAA 5FL1A 4BQ2A 3OTRA 3QGVA 1KXVA 3GYCA 5M5DA 4Q4SA 5ABGA 4TTUA 2GQ3A 2CHNA 3ISIX 5MF5A 4LVBA 4NSBA 5AC6A 3NQCA 4R88A 3E2QA 2WMFA 1J10A 2YL5A 4JBRA 2CC0A 4M8UA 2HCVA 1ZBCA 3GIPA 1WKFA 3MWCA 3O2LA 1F2JA 1SW7A 4KRUA 3THUA 2P76A 4BCEA 3EYPA 1GZ1A 4LU0A 1D8WA 3GKFA 3L0GA 4JTSA 1G6CA 4A8IA 3BSMA 1V3IA 1RHCA 3BC9A 3M0XA 1TX0A 3WK3A 3EDEA 5D32A 5D9MA 3GQYA 4E5TA 4Z1CA 1ZP4A 2BV9A 3PJXA 3OYXA 1L2QA 1Q45A 1RD5A 3OJGA 4A8RA 1L8NA 1TR1A 2H8XA 2CXGA 1UIOA 2WHLA 2XN2A 5HR7A 2XIMA 3EWXA 3VNDA 4YTSA 3VC6A 3OEXA 3A4WA 4I9TA 4YIWA 3CUXA 4MUZA 2ISVA 3QMRA 3I10A 2TYSA 2KX9A 3O0KA 1EYEA 4ZB2A 3JW7A 1LT8A 1QNQA 1U5JA 3BARA 1XKYA 2DT0A 3FSTA 2O56A 3PUGA 1UYQA 3RR1A 2WLYA 1EF3A 3EDDA 1FWEC 3W4RA 4L9ZA 4PFHA 2J27A 1WAUA 5HWJA 3KOXA 1XUUA 2PRMA 5CBJA 3W07A 3GS6A 1UWSA 1HJQA 3AWNA 4HU3A 5G4HC 1OCQA 4YYFA 1M65A 5HJXA 3CZLA 3UR8A 3RU6A 4J3TA 3RDKA 1O1ZA 3QHOA 3A22A 3UZWA 3C61A 3MO7A 2NZLA 5DQPA 5HMFA 5D9PA 2HXUA 5A95A 4N7QA 4DF0A 1EDQA 3LQGA 3AYSA 3ZQ9A 1UG6A 1TWDA 2WK2A 3WDPP 3NQEA 4Z2HA 2WJFA 3P2VA 2VRKA 3M0VA 5CZSA 1W3LA 4TQTA 5A6JA 3NGJA 3WG6A 1DJQA 1PJ9A 3GIYA 2VEGA 4H2HA 2Q01A 3FKKA 4KMQA 3TK7A 3LCFA 2X16A 2NXIA 3T81A 1HTIA 5A6SA 4XZMX 3GG0A 2NQLA 4FAMA 4C7GA 3G1FA 1F6KA 4S1FA 3N2CA 4GBUA 3UD6A 4JFVA 4GISA 1HL2A 1GVSA 3LOTA 3UP8A 4M6UA 3R0DA 4QR6A 1US3A 4PUWA 3MA8A 4BEQA 3H7VA 4W86A 1UR2A 3UZZA 4B4FA 1U83A 2I5GA 4W5ZA 3CH9A 1NSJA 5A94A 1BRLA 2OWCA 5H2ZA 1VLIA 2OR2A 3OHMB 2YB1A 3G6LA 3CTLA 2HMCA 2AMGA 3UCQA 3NEHA 4HU0A 2NLYA 3GDBA 3ITYA 3M0LA 1KLZA 4AEOA 1CIUA 3GU1A 1AQFA 4IH3A 2YB4A 4M0XA 1TYGA 3RHGA 3RPDA 1OSEA 2ACRA 3NPUA 6TAAA 1CWYA 1M41A 2VZTA 3U9IA 3MSRA 3MVIA 4EOUA 2P10A 3R8GA 2DZXA 1S5MA 3HTWA 5D9NA 3RX4A 3DHPA 1UJQA 3WNMA 3REQB 3APTA 2C13A 5LNRA 2C0HA 1AA1B 3RU8X 3AYRA 3G3DA 4PMUA 1X1NA 2NQ9A 5I6SA 4XUGA 1CGWA 3M41A 4GC4A 1A5OC 4MOZA 5A8PA 3AQUA 3TA6A 1E6XM 1F7BA 2FQIA 3T6CA 1UD2A 3AUJA 1CXFA 2BX7A 5G2HA 3VM7A 3ES8A 2C71A 1F8IA 1K03A 2IMRA 3EOLA 3OLGA 2ON3A 3T40A 1TQXA 2VX4A 2ESCA 3CHDA 4KESA 1VYRA 3VC5A 3ATYA 2O9PA 1P0EA 2O92A 4LY8A 1X96A 3BLKA 2WXDM 3RM8A 3P0XA 4LNCA 2GLKA 2FFIA 1CDGA 4LF1A 2D0FA 4PBFA 4CVUA 3WH7A 1O94A 2PDXA 3QYQA 4UQCA 2PLKA 4HNCA 4NAFB 3AIRA 3S5OA 5D33A 1RVKA 5T9BG 5C5YA 5I7GA 5L9FA 5EBAA 3ARVA 1VEPA 2DZWA 3W01A 4Z2KA 4KPLA 3OU8A 3PPFA 5AY7A 1V8EA 1TX2A 3UWZA 3A47A 3UJFA 3Q45A 1LLZA 5BXSA 1KV5A 2JEPA 1KBJA 4TV5A 1YDVA 5DLCA 1PDYA 4AD2A 2OZ0A 2J7BA 3DCPA 4MY8A 3GFZA 3OA5A 3U5YA 2CKRA 1JYWA 3GXFA 5A8GA 3LGGA 2GQ9A 1E73M 1XP3A 2ISWA 3NUKA 1LG2A 4AIEA 3FA4A 1YNPA 1QOPA 4Z0SA 1MUMA 3OLDA 3TFXA 5DRIA 3YPIA 4GABA 4R34A 5G4WA 2ZIDA 1A4LA 3I3BA 1I60A 2QKFA 1XBYA 4NJJA 1EHAA 4UOJA 3VNMA 1UIPA 3WDRA 1JQVA 4NIRA 3FOKA 3VDAA 4KT2A 5JBFA 2XZ9A 3K4DA 3DG7A 4CGTA 3ITLA 3PJUA 3G8RA 3W81A 5LA2A 3TTSA 3I3DA 1J6PA 1DORA 4C6DA 1M53A 4JCLA 5KINA 3CQHA 1V7AA 2I56A 4ZXLA 3PZQA 5F4XA 4RNHA 1YPXA 3WLRA 1OT2A 3E0FA 3ONCA 3GNDA 5EKYA 4AHQA 2WO5A 4UBPC 1E55A 1BVNP 4BWLC 4GIRA 4PUJA 1V3MA 2VX6A 1CXIA 1C7SA 1OC7A 4P7QA 2NVDA 1KRBC 2W79A 3NZGA 3HG5A 1RZMA 1REQA 3AMDA 5AOUA 2A3HA 1NQ6A 2AOSA 1MEHA 5IXEA 1VB9A 4LUJA 5AYXA 2VELA 1D3CA 5FACA 3S2NA 3NGFA 2XGBA 4C7DA 1TE6A 4DXKA 3OGVA 4QP0A 4W7UA 4IPLA 2G96A 3NYZA 5D2XA 1HJSA 1JIBA 3UPMA 3CM4A 4H04A 1B90A 3QKEA 2ZZ6A 4ZO8A 4HMDA 2OT0A 4B91A 2UY5A 4QEHA 4A22A 3VCRA 4UTHA 1FHUA 1T8QA 1TREA 1NF7A 3PFMA 3RAOA 3WH6A 4H7CA 4I7WA 2QAFA 1RP8A 2PDJA 3VZZA 1UR4A 4NYYA 3C2OA 6REQB 3MI2A 4MJMA 5DBUA 4MYXA 3SR7A 1R30A 4AC1X 1W2VA 1Q7MA 1JJKA 4CU7A 4JNZA 3OVQA 1F6PA 1ISYA 4PCTA 1UR1A 2PWUA 4DJED 3TLQA 4TU1A 2W9MA 3WLHA 4A3QA 4Q6XA 1J2BA 4NZ4A 3PS7A 3LYEA 1ADSA 2PUZA 2XIQA 3VA8A 2VQUA 1CGVA 1ISZA 1ZENA 1UKPA 2W6RA 4J2MA 2NQHA 1M9HA 1MDRA 2QIWA 4L4LA 1UPMB 1KBKA 2B7NA 4S3CA 1XIHA 2YSWA 3MSGA 3KP0A 3R4IA 4TOQA 5D05A 2HJPA 4ROQA 4L6DA 3VINA 3RG6A 4WF7A 1IGWA 3RF9A 4DNMA 1XYLA 3UQNA 3PB2A 1HQTA 2IW0A 1P0KA 3GKAA 3ABXA 4RUBA 5SWUA 1R2SA 2BVYA 3AS3A 3SW6A 2H3BA 3K8KA 3UERA 4JKMA 1I9CB 1PIGA 1ZTVA 1ZAIA 3S1GA 2POTA 3ARQA 3G24A 2TPSA 3DFTA 3W1LA 1F74A 1GOQA 4HK5A 1ZJAA 4J40A 3ARTA 1V77A 4CEXC 1AODA 5HNNA 1VFHA 3W73A 2OLSA 1DOSA 1Y5VA 1AMKA 4NJGA 4UFIA 3QOKA 4ZTXA 4HZ8A 1CEOA 1KBIA 2X7VA 1CBGA 4LGXA 3UJSA 4N9DA 2ZADA 4GYFA 3FV9A 1N8FA 3QVQA 3UWVA 1SO4A 2NWSA 1XIEA 3W3OA 4QHRA 3CHFA 5CPNA 4IQLA 2W4XA 3INPA 1XLFA 3VILA 4JICA 1SUXA 3EA3A 3DZ1A 1X6LA 2I5QA 3HN3A 1WZKA 2Z28A 4D8AA 3NQ8A 3I65A 3G6MA 1AH4A 2GJPA 4DI8A 1ZB5A 4LEQA 3GHTA 1XPYA 7ENLA 4EF8A 3LMZA 1KTCA 3STPA 2QAPA 5CSUA 2CZFA 4PUEA 3IK4A 2VVNA 3CU2A 3WLLA 3TKFA 2Z1VA 2XVKA 4XQ6A 3BGJA 4TXEA 1TQJA 1YTEA 3AZSA 3CZ8A 5C9RA 1TRIA 2Z0IA 1VEMA 1Y7VA 3AAMA 4CU6A 3TEVA 4O0ZA 4C6FA 3R0KA 1JZ3A 4WVXA 3H8AA 1GONA 3EX4A 1A5KC 5KEZA 4QJ4B 3W6LA 4B92A 2DZBA 3ITXA 1EGZA 1K4HA 1Q6OA 4A05A 4AWTA 3VUPA 1I8JA 5C70A 4ZXOA 2QUVA 1MZRA 2IQ0A 1R3WA 2V69A 1POKA 4Q8NA 1XBVA 3ARSA 4Y90A 1IWPA 4KS0A 4G8TA 5LGXA 4E4UA 5A8QA 4UCFA 1RPKA 1V6UA 5HATA 3W38A 3FGCA 4I90A 6CGTA 4ZFCA 3MMUA 2GDUA 4JD4A 4RDVA 4FX7A 3ZWTA 1XRVA 3CL6A 1XCWA 4JFUA 4L5ZA 4CD8A 1N2VA 4IG2B 5DCEA 1VCFA 3KX6A 1FWAC 4XBSA 2Z2BA 3GNPA 3WQFA 4Z1BA 2VFHA 1UP0A 4XAPA 1TRDA 2B0MA 3BCDA 3UXKA 3VX0A 1UMYA 1WZMA 3B8WA 3MTWA 3WF4A 3FSUA 3CO8A 3L12A 3CNYA 5HJLA 1TWSA 5H91A 1JYXA 1MUWA 1EPXA 1ECEA 3WELA 1XC6A 2JQXA 1H1ZA 3OZMA 4Z42C 4YTRA 3G18A 1DE5A 5TD4A 4A2SA 1NEYA 2OPJA 3R8HA 3CQJA 5DMNA 3UZ5A 1N7KA 5BOFA 3LXCA 3CLMA 3M7SA 2UZ9A 3ZSSA 2PDFA 3P80A 1FBAA 3LI0A 4RLIA 5BRPA 3HPXA 1EA9C 3RMJA 5AFDA 2VHLA 1UUMA 3O0FA 3TW9A 4N42A 1XGDA 3WFAA 1OWQA 4XZ9A 5CBIA 5K4ZA 3KHDA 3PSWA 3UZJA 2YA1A 1PDZA 4V33A 1DIOA 4X2PA 4AZ6A 1Q7QA 5A3HA 1M04A 2QULA 2VGFA 1KC7A 1OQFA 2HVOA 3IJLA 1IZCA 3GBEA 3S5YA 1F3TA 1IHIA 2AQOA 1GKRA 4M29A 1IT7A 1A80A 4NYUA 5CAHA 1XYZA 5F4SA 4DZHA 1YE4A 2A7NA 3FHAA 1CXKA 2XWDA 1E15A 1TVLA 2WNQA 4YLWA 3BTNA 3B8SA 4BF5A 1V02E 1W1IE 3A64A 1FY6A 3QLLA 3QY8A 3KCOA 1A47A 2P0IA 4MHBA 2VP8A 4IPNB 4CUCA 4PMDA 4IGMA 2YCEA 2ZX5A 3V3WA 3DKLA 3MP5A 4LOCA 4PMNA 3MCMA 1XBZA 1V08A 4GYKA 1F76A 1AJ2A 3B4YA 5AN7A 2BSLA 4YWIA 3DG6A 4JNMA 4GRSA 3L4VA 4EXBA 4U28A 2Z26A 3EWDA 4NUWA 1ZNNA 4PB3A 3WQPA 3P7YA 3R94A 4JDBA 1OFBA 1C7TA 1P6BA 1QOQA 3QV6A 3CC1A 3VOCA 4JTAA 3QF0A 1AD1A 3CQIA 3DIPA 1REQB 2P1FA 5BYWA 2ZE3A 3ZSTA 3GR8A 4US5D 3EX3A 3LCHA 4ZO9A 5D38A 5AZ0A 5C7HA 4DBSA 4QLJA 5C7VA 2CERA 3LCGA 1KGUA 5FAJA 2HZGA 4MB1A 3QKZA 4ZZ9A 3TOPA 3W7NA 4AZHA 3PG8A 3BOFA 4L64A 3PTQA 4GVIA 5E0FA 1MXGA 3GLCA 1E0XA 1IXPA 4GY1A 1LLOA 1XH0A 5CZTA 4OBSA 4NQ1A 3V0SA 5ENLA 5HULA 3KFTA 3T44A 4RL3A 1Y65A 5K7JA 3MKKA 1X97A 4WUIA 4ZQMA 5BXPA 1GK8A 2XFRA 1Y0EA 4ICNA 4TX6A 4IMFA 4GVGA 1PX8A 3RRAA 3WH5A 4RZ4A 3W76A 3TSBA 3HJEA 4WY0A 4KWVA 3E96A 4FX8A 2OZ3A 4F79A 4XD5A 2DZTA 4OE7A 2JEQA 2GSHA 2WYSA 1WP6A 9XIMA 1BFNA 1E3XA 2Y5JA 5CLWA 3BLFA 3P74A 2D2GA 2LLEA 1QCWA 4FOKA 3CV6A 4M7SA 4YCPA 1GVRA 1GVYA 4ADUA 5C0QA 4MNMA 4EK7A 1EL3A 4IGSA 4V28A 3T1GA 4NX5A 3B8UA 1RQBA 3M6DA 4PTVA 4ACZB 4IX2A 3U7VA 4NJIA 3G1SA 5AZ1A 1S2TA 1IZJA 1EOKA 4XKYA 1RA0A 1UD8A 1E1CB 4H8UA 4IP4A 4S38A 4S2CA 1MNZA 4HMNA 1GOXA 3E2RA 3P62A 1JULA 1EEPA 3AUOA 4K8HA 1KBBA 3GVWA 4F9DA 3L65A 2GJRA 1E6SM 1K4GA 3FY1A 4IIEA 4JAWA 3MKVA 4O1EA 2V30A 4YTQA 5D2TA 4Y8EA 1I6NA 4IMCA 3CB8A 3MSDA 1YHTA 1JFXA 2NSXA 3GWQA 3IIXA 3CZGA 4J2PA 3EOOA 3BAJA 4W8LA 4PB5A 5CG7A 1O5QA 1MEIA 4AF0A 1B4KA 4PMOA 3QRHA 3T07A 4W9TA 3TQPA 4A3HA 2W63A 3WBAA 4RDWA 3D46A 3KTSA 1SGJA 2O9RA 1GVQA 1R3SA 3E2SA 3WLIA 4E38A 1WBHA 2BTMA 4GWEA 1P6CA 3BGAA 1FQ0A 4GI9A 3WBEA 3BK0A 2JBMA 4WKAA 3VD3A 2XFFA 8XIAA 4B9YA 2GFTA 3LDVA 4OOUA 4QJ3B 3U5UA 3WH8A 4CCCA 5FSDC 1V02A 2FDMA 3BSHA 1PWMA 4JFWA 1QXLA 5ECVA 4KRZA 3B9OA 1DJNA 1OGGA 3H2FA 2ZZ3A 2OELA 4E4PA 1Q6CA 1ZSXA 3IANA 1KKRA 2EF9A 2OYMA 3RCNA 5I2UA 1J79A 4JQ1A 3RLHA 1CLXA 2QJHA 3ZJ8A 3U0HA 4Z2IA 4QAWA 5H8UA 4ZOEA 1U1JA 3UZYA 2Y6ZA 4DLMA 4QS5A 3BCFA 4Z1AA 2ZZ1A 4HZ7A 3FGCB 3EX6A 5EA9A 1B5TA 3TFCA 3EWZA 3S42A 1E5JA 9XIAA 1TZ7A 1VAHA 3WUGA 5MHBA 4DJFC 2YW3A 2FJUB 1ALDA 4IPIA 5CZJA 4C91A 1EO7A 3FAXA 3OP2A 4Q8VA 4MZ8A 3SCPA 4BHYA 4FP1A 1GG0A 4MLRA 1ZCCA 3TW7A 4U3CA 4L6OA 4K3ZA 3VABA 2V82A 3P3BA 2JIWA 2EKCA 2PA6A 2OU4A 3WNNA 3LBMA 1XLCA 1DJYA 3KL5A 1W8SA 2A3LA 3BO9A 5LIXX 1GVFA 4RV3A 3TCEA 5BNKA 1F05A 3WN6A 1VIZA 2UV8G 3IJ8A 3C2YA 1S2AA 3SGZA 1SJBA 1A53A 1ZU8A 2JK2A 4FOUA 1ITUA 2V5DA 3DFSA 2FTPA 2OMAA 4AZ7A 3U4AA 3E3HA 5DCDA 3GC4A 3VCNA 3KW3A 1LQ0A 3SUSA 1VFSA 1JPDX 2HS8A 2PDLA 3B4UA 5I00A 4EVZA 3SRFA 2GVLA 4XTIA 2V3FA 1BXNA 2OGYA 3WBXA 1BWLA 3GRIA 3LRKA 2R1LA 3VXGA 3GTHA 1FWBC 3CWHA 3XINA 3ELFA 5J5RA 1PZ2A 3VE7A 1UD6A 4H7VA 1K7FA 1IEWA 1UR9A 4BK9A 2FHFA 5FA5A 5LKYA 3W6MA 3P8IA 3TWAA 3SCSA 2NQZA 1E5NA 4DJDC 1VCVA 2E77A 4XB3A 4HKPA 3AXKA 1CCWB 1RLDA 2IXVA 3BJFA 3BANA 4AD1A 4MM1A 1RQHA 3IPWA 4O12A 5CEWA 4YXGA 2A3CA 5GVJA 4GJ1A 1YIXA 3GH7A 5E0CA 1US0A 3HPAA 3R6IA 1J96A 1QI4A 1TIMA 5JH1A 4M6VA 4ZQRA 1RUSA 1YDNA 1QMLA 1QU4A 3SIMA 3ZLHA 2VFIA 4WQ6A 2VJXA 2WM1A 1PXGA 3ZMRA 3KBNA 2A6LA 2DUZA 3RLUA 1NM9A 1NDVA 1HX0A 4PMYA 1HFBA 3SN1A 1FDJA 3ZXWA 5A2CA 3W00A 3DBNA 3MHUA 1NWUA 1R9ZA 2OG9A 4EKJA 1W9VA 2ASHA 1S38A 2D0GA 3GAKA 1YXYA 2WSKA 3OZYA 3GDMA 3M1ZA 2QCCA 2YDQA 3U8GA 1RQEA 2P3EA 2PBGA 2YZ5A 1EFZA 3NOYA 1CB7B 4FXFA 4GFIA 4AD0A 2NX9A 5EFFA 1BG4A 1V3LA 5I79A 2PDCA 7REQA 1BWVA 1ODZA 1TJRA 1I75A 4GMEA 3U2EA 2VR5A 1KQZA 3WK0A 4X60A 2YIHA 1VGAA 4B5NA 4PEEA 3MUCA 1JQXA 2ZUWA 1YTDA 3H6OA 1M1BA 2QCHA 3DI1A 4WY0B 2J7DA 4YTUA 3NDZA 3PC0A 1R7OA 3KCJA 3VKDA 3APYA 2FB3A 2XINA 3PBMA 4S3FA 1C8QA 3MHFA 4B2DD 5CPSA 5TF0A 2OJPA 1IT8A 1IIHA 4OECA 4L9XA 4BWLA 3HGJA 4RZ6A 4WHBA 1YNQA 1T40A 3WY1A 2E8ZA 2WKGA 1EIBA 3IGHX 1EWDA 4PYSA 3P60A 2E5CA 1M7XA 4HMCA 3ZVIA 3BPWA 1J93A 3NA8A 3QW4B 1VZWA 3M6YA 1QUMA 3NL2A 3ZLFA 3II1A 1NWTA 3N9SA 3CMGA 4GNVA 3BL3A 1JZ5A 2VWTA 1EZWA 2XGIA 3VOIA 1WXYA 4XKYB 3U2CA 3ZVHA 3TX9A 1E0TA 2FGBA 2QDEA 2PDBA 3KBVA 3EOUA 1LLWA 3P67A 4Q22A 1PIIA 4IIGA 3PM6A 4M81A 1J2WA 4O50A 1KFJA 3TP4A 3C2FA 5KMYA 3MZNA 3I6TA 1JGMA 1F3EA 4IIBA 2FKPA 4MJ4A 4NNCA 3PTDA 1V0MA 1FCQA 1NAL1 2GDQA 2GJLA 2G3JA 2QMKA 1GGOA 2R9RA 3W71A 3VNLA 4F0SA 2CZVA 1XSIA 1CXEA 4EF9A 1HO4A 1NARA 5HQLA 4DUOA 4QG8A 4PC8A 5C2CA 4ZTYA 1R0MA 1IV8A 3W7MA 3QR3A 4FIQA 4LRSA 1R86A 4S3DA 3I7SA 5A1AA 4F9JA 3RILA 3PUOA 1TE1A 3LERA 3QV7A 4A35A 3NVTA 1G01A 2Y4SA 1AL8A 4PTDA 5EU9A 4Z17A 1FKWA 2BOEX 5HNUA 3WH9A 1G4PA 4PUUA 3K1GA 1G7VA 2QJMA 4YS1A 4BI7A 3IJDA 3F03K 1FP9A 1Q65A 2GPTA 4CD7A 4O17A 3T7VA 4J3UA 1YKWA 1H4PA 1VRXA 2C18A 4IX0A 4DWSB 3VX1A 3KDOA 1OHLA 3ZFHA 3SM0A 3VDHA 3ABQA 4D6JA 3JZUA 1SZRA 3W2LA 3PG9A 1VD6A 1W32A 4QDMA 4K7VA 1ESWA 1XC4A 1LP6A 3DXIA 3LS9A 2VZUA 1XDMA 4ICMA 1SPQA 1PIFA 3LV6A 3UNDA 1XW8A 4JTJA 4IL0A 5D8ZA 1A5NC 1IR1A 7ODCA 1XYCA 3T08A 1DTNA 1GTEA 2XSAA 4W8BA 3BUVA 1XINA 4DBUA 4JN8A 3PB0A 4AZCB 3DESA 1UWRA 1DJIA 2G3IA 4F66A 3MI6A 4W84A 4E3TA 1W3HA 4PL2A 4O10A 4REQA 4KWUA 4GO9A 2JGYA 1UH2A 2OOFA 1O60A 1QHZA 3AMKA 1PTDA 3LZ3A 3K46A 1OBAA 1SM9A 2Y89A 2Z1BA 1H0GA 3CZKA 2F6XA 3BXWA 4LY4A 1OCBA 3C52A 2BOGX 4N6EA 3ERPA 1M68A 3FCPA 1QW9A 3T0TA 2PDWA 2BXZA 1Q7ZA 2VX7A 2YBVA 1X1OA 3NFUA 1Q66A 3UPWA 5AHEA 4QNEA 4QFUA 2E6AA 3CPUA 3BICA 5G2IA 3XIMA 2J13A 5A6TC 4NNBA 3EDJA 4M6PA 2CLLA 3FXGA 3BW2A 2E0PA 3OGRA 2AMXA 4GLEA 3L0NA 3LV5A 4Q4OA 2WPGA 3B9AA 4JX6A 3SUTA 4KF1A 1AVAA 1PCWA 4JYFA 5JIPA 1GYLA 2GL5A 2FVKA 4MTVA 2VT0A 1ENUA 4I9AA 3P8JA 3TA9A 2X30A 2O55A 3KM8A 1EYWA 4DO5A 1TPUA 4BJHA 1ZPTA 3L68A 4FK9A 1OG6A 3V75A 3N04A 4MNKA 2WZEA 4BEUA 4BY3A 1ZUAX 2IS7A 4HHMA 3WZ0E 1EJ7L 1LORA 2UY2A 3V35A 3NSXA 3PPCA 5HNTA 1Q63A 1H5YA 3MZ2A 1SMAA 2O9TA 4JL2A 3N4FA 1MEWA 2CLMA 1VYPX 1R6WA 3HMCA 4XISA 1U30A 2BXVA 2BHUA 2Q8XA 1W31A 1OF6A 2D20A 1XD0A 3EEGA 3P93A 1J4EA 1P0DA 3EAUA 1TPVA 3T0CA 4JYEA 4LUSA 3W2KA 4YN5A 4PRRA 3LZ5A 1B1YA 1HN1A 1CLVA 3TMQA 1XIJA 1SO3A 3MP3A 1ZP3A 1R2RA 3PNUA 5JH2A 2FTWA 2G97A 4NZCA 2HVNA 1MQQA 1KFLA 4CN4A 2TAAA 5H8MA 4GA8A 4WDXA 2ZA3A 2A3BA 4X9SA 4LS1A 4LYQA 4QJ5B 4W93A 1RP9A 2VDIA 4UMBA 4MZYA 4PEKA 4PTWA 2WAGA 3L9CA 3CV1A 1E6RA 3L2LA 1ZBKA 1HXJA 3WO8A 3MQTA 1A3HA 3K1DA 1OCJA 1UD5A 4ZB0A 2H9AA 3Q37A 2QR6A 4MMWA 1W1YA 4Z2GA 5LXEA 4LEFA 1EX1A 3HFTA 1LRTA 3HFYA 2OSYA 1B3ZA 4RE0A 1PX4A 2OWXA 3TJIA 1G1YA 1A50A 3THCA 2WBKA 1KB3A 3CO4A 3VNYA 5DXXA 5C55A 5FEPA 1LWIA 3F2BA 4M6QA 4KEVA 1HKVA 2XGZA 2A4AA 2DEPA 4UQEA 5CPMA 1KLYA 1EBGA 2PP0A 3GH5A 5AECA 3QH2A 3ZO9A 2QDGA 1KRAC 1OYAA 3GFYA 1P48A 3RN6A 4XAFA 3L4XA 3KTCA 4MZ1A 2XSBA 3OO2A 2DSZA 2OSXA 3S0CA 2E9MA 1VRDA 1DIEA 2X0SA 2DIEA 1L0PA 4RV8A 4AEFA 1Q4WA 1V5XA 1UD3A 1M3UA 2FPYA 4G7FA 4BR1A 3ANYA 4H3DA 1UP2A 2AGTA 2NWRA 1SR9A 2ISSA 1EZ2A 1V79A 3PBYA 1UD4A 3LXAA 3O05A 1ISXA 2WHMA 3SBFA 1L9WA 1AJZA 1XSKA 4X22A 1F3XA 1YX1A 5AVNA 3LPFA 3W9ZA 1BQCA 3T42A 5HUPA 3ZVHB 3L67A 1J6OA 1G69A 4K6AA 2OWWA 4O0KA 4E2DA 2EPHA 1GQNA 1FCVA 3GVQA 2VC6A 5DT7A 3B0PA 1B54A 3LHYA 4PODA 4DBWA 3IIPA 4AWEA 3ALGA 4XWUA 3G1VA 3EX2A 4MLJA 4JTKA 1OX4B 5H1WA 1OEPA 3E9AA 1RCQA 1XFBA 1XICA 2ZWZA 1M7OA 3AALA 1XFCA 3GUWA 3N2BA 4MB4A 4GE8A 2JIEA 3STGA 4CNUA 3AICA 3W2MA 1OABA 1UASA 2E6FA 2YW4A 2F8QA 4DJEA 1AW2A 4UTIA 2VEPA 4I8YA 1C91A 1LBFA 4I5RA 1GUVA 1R87A 2PP3A 4QITA 3SADA 3I3EA 4R9XA 4HJFA 2PTYA 1VFTA 3WLSA 1KTNA 3B3DA 4LUIA 2ZRYA 3NL5A 4GPNA 1FWWA 1MQPA 4H41A 3BG3A 4JIQA 1IGSA 3WUBA 4S3AA 3V7PA 3KLKA 2Y62A 3CIXA 2P5NA 4UQBA 2X1IA 1HVQA 5TNVA 2QMJA 3PWAA 3UG8A 1BTMA 1KFEA 2DY3A 1WDQA 2YCJA 4O1FA 3CEUA 3M43A 4AMAA 3EXRA 2NXGA 1W3KA 2EPKX 1RBAA 2J8FA 2QLYA 3GXIA 3BJSA 4KEZA 3MC5A 3M5VA 5LNSA 5XIMA 1BXBA 3IAPA 3TU9A 3CUFA 3WLNA 2Y8UA 4F0KA 2GVJA 3ABSA 1JUEA 3N34A 3BAXA 4MSSA 1UP3A 4S3JA 4DEFA 1EA0A 1P0NA 4EXQA 2X05A 3DDMA 5IDIA 1JRCA 4IFKA 3CQKA 3VGDA 3NPVA 3C6CA 3EWWA 1B3OA 2ZDSA 5HA7A 1R46A 4O1DA 1W5QA 3SUUA 1NQKA 3F5JA 1WNOA 3UVIA 4L1WA 8TIMA 3CASA 2CLPA 2QIIA 4E2BA 2QT3A 1UZ4A 2GQAA 5BRQA 2HPIA 2G3MA 2WSPA 3RLGA 4GYPC 3L4ZA 4WY0F 1WZAA 1W1B1 2XVLA 4UR7A 3VMOA 3FEQA 7TIMA 2VMFA 3QGKC 3G2GA 3R7MA 4QM1A 4ATWA 3DGBA 3L7RA 3W0KA 3KOZA 3STFA 1EWEA 4ZBCA 2VC9A 3W83A 4BF7A 2ZVIA 2D3LA 3GC5A 2ALRA 1UB3A 2Z25A 3M16A 4QE5A 5L6UA 4AZIA 4DBEA 1UZ1A 2J88A 4HOZA 2Y5EA 1W3TA 1OZQA 3S46A 1GHSA 1V51A 5FJIA 3TIMA 1MSSA 4FIRA 4LRTA 3S1UA 1KGXA 3ALFA 1UCWA 5AHMA 2O4QA 2F2HA 1TPFA 3ZR6A 1NH6A 1KFWA 4JIRA 4FLOA 3KEHA 3WF3A 4WGXA 4WOZA 3JS3A 3WD2A 3OPSA 2WNZA 1FFQA 4Q4KA 3WF0A 3WBYA 1QAPA 1MRQA 2QCMA 1DJXA 5F1VA 3NQ6A 3GH4A 4UFKA 4G2DA 1QI0A 1WV2A 2ZICA 4DJFA 5DY3A 2ZUNA 3PF3A 1D2KA 5FL0A 4NX0A 2HE5A 1K8ZA 4UNLA 5ECUA 2VFFA 1FVPA 1OINA 4FNTA 1W5OA 3KBWA 4MIMA 5IBXC 1E9ZB 3TTYA 5E5CA 3NZQA 4XAYA 1DBTA 3E0VA 2EQDA 2HXTA 4JCMA 3UVAA 1SSGA 3GHRA 4MJZA 2GGHA 3N29A 1X8CA 4PRTA 4ORMA 1Z44A 2F7FA 4PTMA 1RD6A 5F4WA 3CWOX 1EF2A 4YWSA 3AISA 3AZRA 4O13A 4QROA 5I3KA 3G1AA 4GBDA 1FWGC 3S2JA 4RE3A 3HQNA 4UQDA 1OFQA 3OODA 2HRWA 3TYAA 4B90A 1FWJC 4KEUA 4FALA 3WLKX 4O0QA 2IUZA 4OIFA 1NJJA 1W9BM 2NX1A 3W7CA 3B40A 2ZWYA 2H6RA 1QPQA 2EO7A 3H7UA 1JGIA 3JZEA 2PZ0A 4L61A 4K8GA 4AG0A 2P8CA 4FNRA 3O7UA 5FF4A 1PYMA 3M5ZA 3FNDA 1FCBA 2POZA 2H9AB 4XUYA 3SUWA 1X7IA 1DQUA 6ENLA 4QQ3A 3DKJA 5I3HA 2WSQA 3BLDA 1FHDA 3WJYA 4Y9AA 3I7QA 2FYMA 4DJDA 4US6A 1TUFA 3K2GA 5K4XA 1US2A 3QV8A 3CZEA 3OW1A 2R6OA 3ZT6A 1H7PA 1TUXA 1JL8A 2V63A 5DXYA 7A3HA 4K68A 5I06A 2ZKMX 4HA0A 5JIWA 4P2VA 4E2VA 3CZJA 4ICCX 3OZPA 1OFOA 3SFKA 1LZOA 4QJ1A 2QF8A 2A2IA 2KAUC 2QJIA 1WBJA 1PE1A 3POCA 1QW8A 4ZO7A 1WZLA 1VPYA 2FIQA 3UGRA 3T0DA 2YLAA 4WX2A 1QNSA 4B3ZA 5B80A 2O9OA 2H8ZA 3W7QA 2XIBA 5I0DA 1FWIC 3U6WA 2W0UA 1XCFA 2VRQA 4LWWA 2FPTA 4US5A 5G1YA 1FUYA 5F2GA 2V81A 3A12A 3D3FA 1EEXA 2YCLA 2VD9A 5BCAA 3FKRA 4MF4A 4Q8WA 1H09A 1HVXA 1MWOA 4H4IA 3CV2A 3AFBA 2PWDA 4ES4A 4EANA 3BOLA 3CQ0A 4AX7A 5CGMA 1L6SA 3U2ZA 1JVNA 1TG7A 2GGIA 1KM5A 3FXYA 3QM3A 1DKWA 3JVAA 4P8VA 3PTKA 3MP4A 3MV11 4PUNA 1AG1O 5A6KA 3UXLA 3M7WA 4IMDA 4ZGYA 2F2KA 1J0KA 2PE4A 3IGUA 3CMJA 2Y85A 4GIEA 3CHVA 3GXDA 4GHRA 5EMJA 3HBLA 2QNEA 3UPBA 1O68A 4JN6A 4Z1YA 5DX7A 2W92A 1XKJA 3NO1A 4RZ5A 1K8XA 4PH6A 4HBKA 3B9EA 4QCEA 2FZDA 3KXQA 2OQLA 4KIEA 3ORWA 1FH9A 1SJDA 4Z0JA 4KW2A 4AY7A 4ZVJA 3FA3A 2ZC8A 5BROA 4OVXA 2P3ZA 4F0RA 5DANA 3F4VA 3IK2A 4O16A 3E38A 3B0VC 2QDDA 3KE0A 1BVZA 1V0KA 4D8ZA 2RDTA 4U5KA 3QFWA 4ZSUA 1WKEA 3I4EA 4UTLA 3ZJ6A 1TTJA 1YXDA 1BQGA 5EY5A 1WAWA 2QJJA 2VYOA 3LLDA 3USZA 1YBQA 4AISA 5KITA 4Z1DA 2QUUA 4O28A 1LUCB 3C5QA 3H2CA 1EUAA 4W89A 2OEJA 1XRSA 3S47A 2AGKA 2DQWA 3VNJA 1E4NA 3PY2A 4GCAA 3DG3A 2J6VA 3L2MA 4B5UA 1EKOA 4CNOA 3VPLA 3ITGA 1EJWC 1NDZA 1K9TA 2E4TA 3ABZA 3QQWA 3WD4A 1OX6A 4IWWA 3WQWA 4JL1A 5CCZA 1J5TA 1EJVC 1NY1A 4GXWA 4ZFMA 1VBJA 2CLIA 1TMQA 4U33A 2RUSA 4R33A 1KR0A 1ZL1A 3GE7A 1Q6FA 3DU0A 4O14A 1DJZA 3VKJA 1OX5A 2GJXA 4C1NA 3RMEA 3MYPA 2DH3A 3L4TA 4OZOA 3APGA 4TV6A 3WBWA 2R1PA 4XSMA 3RO6A 4LB4A 3VMNA 1S3HA 2X1UA 2VGIA 3PR2A 4ZQOA 4LF2A 5CC3A 4JTHA 3RR4A 4HJWA 2ONEA 3PZGA 4NHVA 3KVMA 1CI1A 1BKSA 2WVUA 3TJXA 4JYDA 3SCTA 1RBLA 3WX7A 5KZEA 3TJLA 5EGRA 3F4CA 4K7YA 1ICSA 1I4NA 2BGNE 3Q65A 3N18A 2YYUA 1IIGA 1VF8A 2GWNA 3KS6A 2B4GA 2R1NA 2PB1A 3V18A 2QS8A 5FJUA 3WLJA 3MU7A 3GC2A 4I5XA 1Q6DA 4A3UA 1LBMA 2DFAA 4H9UA 3CLWA 2J47A 4JDYA 1AFSA 2PCEA 4K37A 2WVVA 4E8CA 4PMRA 3PNZA 3SI9A 3G22A 2A7PA 3R13A 4H8HA 3THDA 2V2HA 1OFPA 4H9ZA 4O11A 1S2CA 1M01A 4UTFA 1SSDA 2C91A 2C16A 2VR4A 5LIYX 2C1GA 1SMDA 4ZR8A 2XH4A 3RCMA 3LHZA 3PN8A 4TR9A 2PTXA 1B9BA 1PKLA 3A13A 5AHLA 1CXHA 1XH2A 1WPCA 3WJSA 3C4UA 1U33A 1UH4A 3H55A 5CSYA 5BW6A 3WDJA 1Z8AA 2PCQA 2GGEA 3M0JA 5M17A 2V0TA 5K9DA 2RJHA 3S6OA 1GQLA 2BODX 3WLQA 3KBSA 1UC4A 1A0DA 4GY7A 3A21A 2OB3A 1W5NA 4OOZA 2CYGA 5IFTA 1ADDA 1J5SA 3FDKA 4W7WA 3W2JA 3V5FA 4QSFA 1CZ1A 2FDSA 3TMLA 1QI3A 3TROA 1VIWA 3UY7A 3BDKA 4JS3A 3W1XA 5K2ZA 3DX5A 3F5LA 1TPDA 4O4WA 1W3IA 1AL7A 5EL1A 3CYVA 3F5KA 4XO7A 3SGGA 2B7PA 3KBMA 4QGCA 2NQJA 1ONWA 7XIMA 1K7XA 9RUBA 5E93A 1XD1A 4NZ5A 1GJPA 4Q6JA 2J24A 1I1XA 2DZAA 1H63A 4IJBA 4Q4RA 5I07A 1FDZA 1SQ7A 1K8YA 1QTWA 2V5BA 1W9DM 2RFGA 4N9CA 2CLFA 1LL7A 3CIWA 1E3ZA 3BW3A 4HMEA 4QE1A 4PULA 4HD5A 3TSMA 1XYBA 1UWTA 3G77A 3SSJA 1XLIA 4A3YA 2FLIA 1RY0A 5FF0A 4HTBA 4UTTA 4R7OA 2WCAA 1XDLA 1OM0A 2VURA 5EMKA 2IPWA 4DUWA 1BGAA 2WZMA 2NUYA 1V3JA 3OQEA 4C90A 4EAMA 3BG5A 4LVGA 2QCGA 3W2NA 2AAMA 5LGZA 3P0WA 3NTYA 4ML9A 2VNCA 4HT3A 2IPFA 4B9ZA 2ACQA 3PK7A 4MY9A 4E4FA 5LNVA 3E1F1 4ERAA 1GKPA 5DMMA 3CAQA 4H83A 5IRPA 1FKXA 4ERGA 3O9NA 2ACUA 1QO2A 5I02A 4IP7A 3WQ8A 4FF5A 2REQA 4HU8A 3PZNA 5TAOA 1JI2A 3VOFA 1AW1A 1XLJA 1D3HA 1OD8A 4RW5A 4QRNA 1MXDA 2O7QA 1ONEA 4C1KA 3S2MA 4LAOA 2Y24A 2Z1WA 3B06A 1TZ9A 3V5CA 2G4JA 2W66A 1KO0A 1HKIA 2ZQ0A 3VAVA 3TN4A 4PTNA 3WJWA 2G41A 3W7RA 1GOKA 2WMHA 2AKZA 3TZFA 4MYAA 3A6OA 4HHLA 1DXFA 4QG6A 3SJ3A 3QGAC 2CZ5A 3E0IA 1UBSA 1MDLA 4S3EA 3DYOA 1J0HA 3NSNA 3LNPA 4HNTA 3LHUA 1ZJIA 1I0DA 1ZY9A 3W28A 2OT1A 5FOOA 3W88A 4LYKA 2ZBTA 4LBSA 2DH2A 1LYXA 1PZ3A 2DPEA 3O07A 3G8EA 4M19A 2NVCA 1GZJA 3UWEA 3CHEA 3LU2A 4XZWA 5AB3A 3BQ6A 4MGGA 4DAFA 3ID7A 4WK9A 4FNSA 4I9MA 3M47A 4AEEA 4B2DA 4Q8MA 1RJPA 2DZUA 1E6QM 1UMLA 3FLUA 2DUAA 2HE8A 4K39A 4C6JA 3MCOA 2GUBA 2DIJA 5JBEA 1DVJA 2F9RA 2Y7DA 2ZRXA 1GVOA 1MUCA 4LBRA 5A69A 5GPRA 2VZOA 4O8AA 3G1XA 3UR5A 3W70A 2VWSA 1JDAA 2BHYA 1IXQA 5EMLA 1GQJA 3FW6A 4DXVA 2DT1A 4AHPA 4IGHA 1SZEA 3IRSA 2E5BA 2WWCA 3GDKA 5DELA 2AQVA 4GC3A 3GBDA 1B0IA 1W54A 3TWBA 4L9YA 4BF9A 4K1GA 3WEOA 3SY8A 4KGLA 1H7OA 4FXRA 5CAKA 4WD0A 1LBLA 4AXNA 2X0YA 4EXAA 3LXBA 4UFJA 1UKSA 1BKHA 4D6HA 4JTRA 3W7EA 3PAJA 4XV0A 3RX3A 2EXOA 3UG4A 2ZXAA 3AWOA 3EB4A 3KBJA 1TPH1 3H26A 4DI9A 4U2ZA 1TWIA 3AHVA 4GNKB 1K9EA 2PRLA 1GQKA 1ZAJA 1EUNA 2ZA1A 2VENA 1FH7A 3ARRA 5CGQA 4UC5A 2HK1A 3MYOA 1ZCOA 4MB3A 2I9EA 3VOHA 2VD8A 5CBBA 3H23A 3IVSA 4F0LA 5FIPA 2F38A 1V0LA 4IQDA 2VC5A 4EPEC 1W3JA 4TO8A 2EBNA 3WLOA 2SFPA 2VFGA 1JYVA 3UEQA 5LNUA 1KR1A 2VCBA 4B4HA 3UWQA 1K8CA 3KWSA 3N4AA 3BMWA 3QXBA 3AU2A 2AL2A 2RJGA 3T55A 2INZA 3NM1A 3HPFA 3Q58A 4UOZA 3WEMA 4IUGA 1WE5A 1E6NA 3N1AA 3OLEA 1R38A 1S5VA 1Q6LA 2QUMA 4C6QA 3N25A 1JZ7A 2CHOA 5IM51 4WJXA 1A0EA 1XI3A 3EEZA 3TR9A 4OFCA 3TV8A 4PMQA 3U2OA 2QUNA 1NDWA 4NT0A 1TPC1 4RE2A 1E4LA 3TN5A 1DHKA 3VKKA 4E2OA 3UA4A 1RV8A 5REQB 3NJ3A 3T8LA 4I7VA 3K8MA 1QOXA 2HEJA 3O06A 3L2IA 3CUJA 3W1NA 3IJ6A 3GZAA 1UJPA 4TUFA 4IZGA 4LV9A 1E4MM 2ZRVA 3HOJA 1DWJM 2BB0A 4F40A 3KOFA 4D71A 4UNIA 2F6UA 2BXYA 4AIBA 4ZSTA 3AMGA 3V36A 1H7RA 1GZGA 3GU9A 3NOEA 1UROA 3MUXA 3NWRA 4GYPA 3C86A 2ATSA 1TV2A 1UOKA 5A6LA 1T0OA 1NOFA 5EBUA 2YJQA 2X40A 4LC6A 5DT5A 3SY1A 4GINA 4DAIA 2RDXA 4UUIA 4D6GA 3DI0A 4J3XA 4R85A 3QLDA 3HZ3A 4YHEA 3TC6A 5AC4A 1TCDA 2V5JA 4IOTA 2MNRA 2Q6ZA 8RUCA 4LS0A 3ZZ1A 3LCXA 1BG9A 4PUDA 4CQAA 5D2YA 3LD5A 4I3GA 1T99A 4ASTA 1EOMA 3BMXA 2VFEA 1BD0A 3FJLA 3F2CA 3SCQA 3NDOA 1IEVA 4L4OA 3CMFA 4TIMA 4AD4A 4HZMA 3KOWA 2E6DA 5LA1A 3RITA 5DCBA 1W1VA 1S2WA 2V3EA 5BXTA 4HGXA 4Y9NA 4CN1A 5M3WA 1TMLA 2C19A 2Z6JA 4KKXA 2UBPC 3Q2DA 1OK6A 4WCJA 3PVFA 4Q8TA 4HNUA 3ARZA 1H11A 4RPPA 2ZZ5A 3R89A 1LG1A 5HAOA 3M44A 5TBOA 2E1WA 2PS2A 1YRRA 4AD5A 2J62A 3MJMA 3NXFA 1TR9A 3SRDA 3K5XA 3MDUA 3G1RA 3VDCA 2OYLA 3EMZA 5HK4A 4IISA 3GNNA 3RIKA 4UQAA 2CITA 1JDEA 2V5KA 4NI8A 2WMGA 1CYGA 2REQB 3SAZA 1OD0A 1J0YA 1KW1A 1HUVA 4L1XA 1EGMA 1JNEA 8XIMA 4FLSA 2DDXA 2ZVRA 3F7JA 4YHGA 3RUBL 5CC5A 3IUIA 2OQHA 3GM8A 1WKDA 3K4WA 4L56A 2R91A 4GUJA 4LAUA 2OOGA 1WDPA 2QV5A 2VX5A 1AH3A 4FXSA 1EXPA 1S2UA 2OLHA 4JX5A 1XX1A 3QR0A 3NAVA 1D7FA 4NZJA 3FN9A 1QR7A 3G1HA 5T8GA 3ANVA 4UQ9A 3TYUA 3ZR4A 2YL8A 4H19A 3VD4A 2OO0A 1LOLA 3EMCA 5J5DA 3TQ0A 4KETA 1KM6A 1X7FA 3LSBA 2GSJA 3MMWA 3GVRA 4R3UA 5E6YA 1W1A1 3OBKA 4NJKA 3W26A 4AIOA 3ARYA 1L6YA 3FYYA 5HXMA 3L66A 1KCLA 2RKXA 4GD0A 3W1RA 3KWXA 2ABAA 1DE6A 4GUFA 5BXRA 2BY1A 2Y7EA 3EKLA 3S5SA 3HIJA 1J12A 1QK2A 3NO3A 4HK7A 2HISA 4UMCA 9CGTA 3H12A 3V4BA 4J3VA 4N6FA 4URIA 4S23A 2XVNA 1GW9A 3GTXA 1KM3A 5CG0A 4UXDA 3NIYA 1F07A 2DP3A 2FH8A 1CW2A 4KCTA 3MANA 3AROA 2GGGA 3NG3A 3S8HA 3VE9A 2YXOA 2DW6A 1JCYA 1NDYA 3T2PA 3M5XA 2B7QA 1O5RA 2ZZ2A 4UFHA 3GD6A 1OFRA 2D24A 1X8FA 1IXNA 1C93A 2ADAA 3NXLA 3PZVA 3L21A 2VDGA 3VNZA 1U2YA 5A5WA 4AVOA 4NASA 1T96A 4MKNA 5IOBA 1FHLA 2QV4A 3SRHA 1JCLA 3EA1A 2IQTA 3TSDA 2DVXA 5G5IA 3S2LA 3LHVA 4TTGA 4MJ2A 2R94A 4O15A 1QJWA 1BRLB 3VKBA 1WOBA 1FRBA 3EKZA 1MW1A 3M9YA 3O16A 2B7OA 3WL0A 2IPGA 2WOQA 2YOCA 5I3IA 1CNVA 4XSLA 3C2RA 1PO9A 1IF2A 1NFPA 2Q71A 2Y2WA 3BV7A 4HSOA 1P7TA 4OUIA 2DJLA 1W91A 3BLOA 3EPOA 4ML4A 4C5YA 3VTRA 6XIAA 2CZEA 1LCOA 3HG4A 1BF2A 3QQ0A 1UUOA 3URAA 4P7NA 1V03A 3OYZA 2ZA2A 4IHCA 1F6YA 2CETA 3DHDA 1I0BA 1JFHA 4EPBC 3WFLA 3L4UA 4R53A 3A4AA 3H4GA 1QI2A 3WUFA 3TC7A 4LANA 1G9HA 4X3ZA 4LVDA 5CZKA 2R82A 3QPYA 4WSJA 1V6WA 3E6EA 1IWBA 3M46A 1HP5A 2HWGA 3PBUA 3ZOAA 4FX6M 2OODA 4YVXA 2BG5A 3A3WA 4LAKA 1AQ0A 2VGGA 1A3WA 4L1GA 4PSPA 2C1HA 1EDGA 3H70A 4PUMA 4R7JA 4BQ4A 3K4AA 3M07A 1JCJA 4HCLA 1VFOA 3VIHA 2AL2B 1JCNA 2UY3A 2GDVA 3KAOA 5LIWX 5AYIA 4LX4A 1VPXA 1FA2A 3RLVA 2X41A 1EJTC 4DJFD 2ZYFA 2PLJA 4PMZA 4H9TA 4DRSA 1YDOA 4A2RA 2DSUA 3TDFA 3N6QA 4K2SA 1SFTA 3UWYA 3LLFA 3W84A 2PF8A 3VOJA 3QC0A 3MT1A 1UA3A 1L6GA 3S6TA 4O52A 5CZ0A 4DWSD 3EZ4A 1D8CA 1QO5A 1JCMP 4TVUA 3UG3A 4HIBA 3DOPA 2ZUSA 4FOJA 3A9BA 3BAYA 1C92A 5A6BD 1EC7A 3LK6A 5HBFA 4GZIA 1JAEA 2FH6A 3KRBA 1BAGA 1JZ2A 2ZTJA 3N3MA 4UTKA 4ZO6A 1Z69A 3WMSA 1F5ZA 2XPKA 1JDCA 2QYGA 5BU6A 3P82A 2CLOA 2IPJA 4X0VA 1ME9A 4PN2A 1GVEA 3N2MA 1QNVA 4POCA 1XYFA 1M6JA 4HYRA 3ZJ7A 1A5UA 3W7LA 1J8VA 4HPHA 3W7JA 3A3XA 2J75A 2XZ7A 1XUZA 3GTIA 4C6LA 3I4KA 3OBEA 2PU0A 3UG5A 4XTDA 3HMJG 3PSVA 4CQDA 5XINA 3KDNA 4QS6A 3MSYA 5XIAA 2PTWA 3T05A 1KKOA 1SU5A 3NQFA 1BXCA 1RH9A 4MAVA 4P8XA 2ZTKA 1PYFA 2J74A 3FYOA 2WSYA 4H8NA 1EJRC 5AVHA 4DJDD 4GUIA 2P88A 4YNGA 3PFRA 5HR6A 2XN0A 5A6AA 3REQA 4FZIA 4ACYA 3SZ8A 3VK5A 1H49A 1SW0A 3TONA 3FDGA 4WEVX 2NUWA 3C56A 3G5EA 2FFCA 4MY1A 4C6IA 3AJXA 1YMYA 1F73A 3OBAA 4JY9A 3AIVA 4FHAA 5JMUA 4UNKA 1IEIA 5CC6A 1IYXA 1E6ZA 1T6MA 1I45A 2BVWA 4K38A 4J27A 1EXBA 5HDRA 3A3HA 1QNRA 1T8XA 4WSKA 3TNOA 3W87A 2WMJA 4P8WA 5AYZA 5I78A 2PWEA 1MRAA 2BY0A 2WJEA 1HT6A 1AZ1A 2VI0A 1MFVA 4OBRA 4ZQCA 4ADTA 4YYCA 3UJRA 4DF1A 2YBTA 3IUHA 1PZ1A 4JPGA 4HCHA 3ARXA 3PBVA 4D2JA 1DYSA 2VXNA 5K3VA 4ZE4A 1TB3A 1QPNA 4S3KA 1HIZA 5E9XA 2ZUTA 5D02A 5GJMA 4MG4A 5I3FA 1KFCA 1YQ2A 3C8FA 1DWAM 4QQUA 2NQ5A 3H54A 3PZTA 3B9NA 3NQ7A 1S1PA 1FWRA 3UF9A 2D1ZA 1XYMA 1KXQA 4XZHA 4OU1A 4GACA 3BH4A 4QXIA 1M7JA 3M0HA 2CBUA 2PZNA 2HBXA 3RPMA 2OSWA 3W7KA 5A2BA 3H7RA 4XBJA 4KCWA 1JNDA 1X98A 3NQDA 1J9YA 3R12A 4BFAA 4G1NA 4RZBA 4C5ZA 3BQ5A 1BPLB 2J9ZA 4ROPA 3QZAA 3E0LA 3URQA 4EACA 4XVDA 1XR2A 4MNJA 2BY3A 1AQMA 1HL9A 3IACA 3BWWA 1HKMA 5FI8A 2E67A 4Q4PA 2CU0A 4A8NA 4LCQA 3N6HA 1BSIA 4EPKA 3W1AA 4UR9A 4AZBA 4WGHA 3C8NA 4GIAA 4MUPA 2DJXA 3S5NA 3VYLA 4UTUA 1TV5A 2YFOA 5A8NA 3Q4DA 3ICJA 4DYEA 2QDHA 3LY0A 4NRSA 4V1YA 1YPFA 4PSRA 2XFWA 3EGJA 3PPHA 3N11A 1M5WA 1J0ZA 3P61A 4CQ8A 4Q3MA 1W1PA 4HSNA 5I3GA 3LRMA 2QPSA 4CN6A 3VU2A 5HOSA 3QFEA 3CAKA 1E9IA 3CL7A 5FF3A 1VBGA 4RNFA 3LCWA 2GJNA 3S1XA 2PWGA 1H41A 4KFPA 3VM5A 4Y6GA 1MVYA 4KCUA 4FNPA 1H1YA 1ZBWA 1OT1A 1UWQA 5CPOA 4H9YA 5CGTA 3VIOA 1Q6EA 4LCRA 4EPDC 4FO4A 3WQDA 4L4MA 2ZX6A 4ZENA 2J8TA 3HGRA 2I9UA 4PB4A 4WJ8A 4GUGA 3OVGA 1Q85A 3OLIA 3IAQA 2CWXA 5CLTA 3WDIA 4MVAA 1EBHA 1P7TB 4AW7A 5IDZA 2PGWA 1G4TA 2VCAA 1LWHA 3LENA 3CUGA 3G3MA 2HNEA 4EWJA 3Q67A 2XFYA 5I3DA 3IGXA 1P1MA 3S9IA 3W7HA 3AI0A 4EE9A 4R27A 3KHJA 4JQ2A 2TRSA 1TV7A 2AAAA 5I5RA 3GXTA 1RK6A 3C2EA 1AK5A 3EXSA 5F2MA 3A9IA 4OV4A 2BY2A 1G0CA 3L5MA 3AS2A 5FCZA 3R2GA 5KZ6A 1QATA 2G8ZA 1HJWA 3N3TA 4OJYA 6REQA 4J3ZA 5FAGA 2DT2A 5F2IA 3DERA 2BHZA 1E71M 3T0BA 5IFPA 5EMMA 3VIKA 3AIQA 3NZRA 1PHQA 1G67A 3LGDA 2OFJA 3LM7A 1UWUA 4LSBA 1UZHA 4MWAD 1KCKA 2FMOA 1FWDC 1W56A 2CXEA 3VD9A 3PTMA 2WQDA 3AHTA 1CT5A 5J8LA 1BEUA 2IKJA 3B0YA 1LRNA 4BA0A 4HVXA 3O6DA 1OF8A 2PEVA 1OGSA 1YE6A 4Y9OA 1D3GA 3WF1A 4RCXA 1TVPA 3WIJA 4LTSA 3LPPA 3E2VA 4XZBA 3IGSA 4JQ4A 3R8RA 2YA2A 2PLCA 1PKYA 4KEMA 3H2MA 3ZWSA 4FSAA 4O4VA 1C3FA 2ZXQA 2AL1A 1K9DA