2ZFAA

Structure of lactate oxidase at ph4.5 from aerococcus viridans
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
367
structure length
352
Chain Sequence
YNAPSEIKYIDVVNTYDLEEEASKVVPHGGFNYIAGASGDEWTKRANDRAWKHKLLYPRLAQDVEAPDTSTEILGHKIKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQNRDILDEAKSDGATAIILTADSTVSGNRDRDFGMPIVQRYLRGTAEYGASKQKISPRDIEEIAGHSGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Lactate oxidase
publication title X-ray structures of Aerococcus viridans lactate oxidase and its complex with D-lactate at pH 4.5 show an alpha-hydroxyacid oxidation mechanism
pubmed doi rcsb
source organism Aerococcus viridans
total genus 128
structure length 352
sequence length 367
chains with identical sequence B
ec nomenclature ec 1.13.12.4: Lactate 2-monooxygenase.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01070 FMN_dh FMN-dependent dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2zfaA00
1KFLA 5LHFA 1OFQA 3LRLA 4UMCA 4WOQA 1SO5A 2YYTA 3SSJA 4LOCA 4TIMA 1K3UA 3PBWA 3TJLA 1I2PA 2X30A 1RQHA 4YWIA 1Q6LA 2YFNA 4IMFA 5KSWA 1TQJA 4DPPA 3RLUA 1W3TA 3U2OA 3CM4A 1XDLA 2ATMA 2V5BA 1M7PA 1OFDA 2VEKA 5I3HA 4MPQA 1VGAA 5EBUA 3VFLA 3WFAA 3LDVA 1LBMA 3T4CA 5CPNA 1DQXA 3LV5A 3P5YA 3FKKA 4BI5A 4MY1A 3ZS4A 5BOOA 1FXPA 1G6CA 4YMZA 2Q3RA 1O60A 1LOQA 4JDYA 1VYSX 2QCLA 2E6AA 1FCVA 3TMLA 3BV4A 5AHEA 1ZENA 3HG3A 1BEUA 1F6PA 4AH7A 3NQ8A 2XN1A 5BRBA 1H7WA 1L9WA 2BLEA 1KBJA 1UB3A 4FNRA 1VPXA 3V75A 5FESA 2A2IA 3GDMA 4L4LA 3EXSA 1MEWA 2JKAA 4N6EA 3NPWA 2WNQA 4ADUA 1FXQA 3NQFA 1BKSA 5TIMA 3W2LA 4NX5A 3TV8A 1H63A 3E12A 3UYCA 4Y96A 2QAFA 3W73A 3MJYA 4UXDA 5G1TA 4GJ1A 4CNOA 1UBSA 4MOZA 1KFEA 5KZDA 4WX2A 2ZRXA 4E38A 3DBPA 3NDOA 1KM6A 1P1XA 5F2GA 2V2HA 3F4WA 4NXKA 4IQLA 1NF0A 1SR9A 1YPFA 1YXYA 3MHFA 3NO5A 3P61A 4M19A 5C5YA 3IIXA 4LRTA 5DY2A 3S0CA 1XI3A 3MI3A 4CCDA 4OQVA 1G4PA 3M16A 4B5NA 4O52A 4YL2A 1AW2A 2V5LA 4N6FA 4HT3A 2B7QA 4DXVA 2BX7A 1J2WA 1ICSA 2H3DA 4XKYB 3VI2A 1T8XA 1OFEA 4E0CA 2V2CA 2NWSA 4O8RA 1G7UA 1I8JA 1ME7A 2EAWA 2Q8LA 2C3ZA 1GPWA 2Y88A 4UTWA 4U4MA 4LY8A 3W7NA 5D38A 5MHBA 1GVOA 3TXZA 1EPXA 2GVLA 2RH9A 3IIZA 2ZDRA 2Y63A 3TQVA 2JKEA 2CFFA 4JYFA 2AAMA 5E0KA 3DGRA 4JIPA 1WA3A 1XUUA 4O1AA 4MVAA 5DCEA 2GQ9A 2OX1A 5HR6A 1Q6OA 3NYZA 3W70A 5FF7A 5HWJA 3TR2A 4BR1A 4XBKA 1LRQA 1GOXA 3LCWA 1KW1A 2C6QA 4UFMA 4O4WA 2QCCA 2WKJA 3B05A 1F74A 1SW0A 2DORA 4K38A 2H8ZA 1LYXA 2FTPA 3IEBA 3LTSA 4I7WA 2DP3A 1EX5A 4TX9A 2B7OA 4IX2A 4A2SA 2OZ0A 3HG5A 4LRSA 1HO4A 3HGJA 2NWRA 1KM1A 2A7PA 3GNNA 4JY9A 4XBSA 2YZRA 2DZXA 1WXJA 3JRKA 3SIZA 3BG3A 1AG1O 1XBXA 5AN7A 3W85A 4MKNA 3O6DA 3WJSA 3W7PA 5F4SA 1EP2A 1K7EA 1X7FA 3NVTA 1YDNA 1LLZA 1H50A 1KM2A 5EA9A 1W8SA 1JUBA 2QCDB 3MHUA 3C56A 4RXFA 2KZHA 3KRSA 3TC6A 3WJWA 3NQMA 1A53A 4YXGA 1JR1A 4JN6A 3ABQA 4ICNA 4MZ1A 1TPWA 3W7EA 5BW6A 5F1UA 3ZWTA 3NXFA 3G8EA 3DFQA 1OX4B 3UWYA 2GVJA 5J5RA 1XC4A 3EWXA 3MWAA 4DO4A 4Q4KA 3G1YA 3T55A 1IXNA 1NF7A 3FEMA 4A22A 3Q37A 4X22A 2YDAA 2X1SA 4RX0A 2E5BA 2QCGA 2OMAA 1QPQA 3G1XA 3BK0A 1H5YA 1KFKA 3BW4A 2ZZ5A 3NA8A 3C61A 2C18A 4DO5A 3G24A 3TAKA 3NM3A 2EPHA 1VC4A 3SJ3A 1O5KA 5HNRA 2PC4A 1WQ5A 2DZVA 3KOFA 3LCIA 1LLWA 3EXRA 3I6RA 1QPOA 6TIMA 3WK0A 3HPXA 3IVTA 4MFDA 3PWAA 4EF9A 3PB0A 5D33A 1I4NA 1L2UA 5AYZA 3W71A 1FDZA 3I7RA 2A6NA 3LCXA 1YTEA 4OT7A 1L6SA 3GXTA 4AWTA 1FCBA 3P8IA 1H60A 1K8ZA 4MY8A 3LCHA 4R7JA 3EWBX 3LTPA 4IMGA 2CZFA 3CB8A 3G1DA 1ZCOA 2YX0A 1OHLA 5HULA 1QOPA 2Q8ZA 3L65A 4LVFA 3CPRA 4Z1BA 5G2WA 2X2GA 4RZ5A 3W9ZA 1NFBA 4AWUA 2V9DA 2QDGA 3NQCA 4BI7A 5KTLA 1LBFA 1R2RA 3CTLA 4Z0JA 4NJIA 4ZQMA 2UV8G 1DOSA 1TTIA 3BG5A 4LV9A 3O63A 3UY8A 2QUVA 2V30A 3S1WA 3MW7A 2QJIA 4Q32A 2CLKA 4UC5A 3GDTA 5G2IA 3NQDA 1TPB1 2Y6ZA 4OU1A 3QW3A 4OWGA 3KAOA 3CWNA 1WDWA 3L2IA 2HSAA 3PG9A 4O0KA 1R2SA 3ZR4A 4O1DA 3RU6A 1H1ZA 3DZ1A 1KM0A 1ZAHA 4JTFA 5CPMA 3S9YA 1KM5A 4WY0B 3RLVA 3DKJA 4OV4A 1W31A 4OE7A 4M7TA 3RK8A 3TROA 1GVFA 1QMLA 1EP1A 3G1VA 1GWJA 1EA0A 4CQAA 1I2NA 1QO5A 3HGOA 1A5BA 1H51A 1RD5A 2WSRA 3ATZA 3IIVA 3NQ6A 5KINA 3C2RA 2A5HA 4PA8A 1KM4A 2XN0A 2A85A 5D2WA 2ZA3A 3EEGA 4CCEA 3GXNA 3PM6A 5H91A 3TW6A 1FDYA 1RVGA 3S1XA 3GDRA 2FJKA 5G5IA 2G95A 2ZYFA 3QRHA 3OA3A 4N2YA 1W1ZA 3M0ZA 5TQLA 4GXMA 3UQNA 3FJLA 4X9SA 2B7PA 4MJMA 2R94A 4DBDA 3P81A 3KVJA 5D2YA 4NNBA 2WPBA 1RR2A 1O94A 4GUHA 1XUZA 3W74A 1XCFA 1NAL1 4Z0SA 1FX6A 3MBFA 4LC8A 3DHDA 3TKFA 4K6AA 4UCGA 4J9JA 2YPIA 4JD4A 4XUGA 4BI6A 1PIIA 4CCCA 3P74A 4UNKA 1LOSA 1VJIA 2YFOA 1IGSA 2FFCA 4L4MA 3O1NA 3B0PA 1VCFA 3IIPA 2DZUA 4O17A 3F1QA 3THQA 2A21A 3UNDA 1AW5A 1EUNA 5HJLA 4GUIA 3O06A 4LTSA 5I3IA 5CKSA 3QJAA 3GIYA 3B0UX 4BWLA 3A22A 3EWUA 2AQWA 1VYRA 5U7SA 2GJLA 3OVRA 3U8GA 2DZWA 2ISSA 3HQ1A 3B06A 4XQ6A 1XBZA 4UNLA 1M5WA 1H1YA 4ONVA 5TBOA 3H53A 4RLIA 3FYOA 4AF0B 3N73A 3A9IA 1QFEA 1P0KA 3DENA 2CLEA 4AEOA 1YLVA 2FPYA 3USBA 3O6CA 7TIMA 2C1HA 1GYLA 4JX5A 2CLLA 1VCGA 3I7SA 1GYNA 4XZ9A 3D0CA 4NVTA 1Z41A 1FWSA 2RFGA 1LP6A 3G0SA 3HIJA 3N3MA 1XXXA 2NX1A 2RKXA 3EXTA 4PC8A 5HUPA 1QAPA 3C6CA 3QH2A 2CLMA 2YW3A 1LROA 4RZ6A 1TQXA 2ZTKA 2D73A 5CSSA 1BTMA 3TC7A 3QMTA 4LV4A 2J24A 5C55A 3FOKA 3M47A 1TTPA 1D3HA 1SU5A 5KMYA 3PVFA 1QDSA 1C8VA 3QC3A 3C3NA 3TSDA 2E1DA 2YGYA 3C8FA 4TMBA 3L66A 4JICA 5HR7A 4O28A 5LSMA 3L5MA 3WK3A 1TYGA 4UFKA 3W72A 2WNZA 1L6YA 3QPZA 1PE1A 3PUDA 4JTGA 1TIMA 3LV6A 3W1UA 3NL6A 1HG3A 3L5AA 3PB2A 4OHQA 1VH7A 2CLIA 2QCNA 1B3OA 2EF9A 4OV9A 2C14A 3R5EA 5F2IA 4ADTA 3VKJA 3UZJA 2NUYA 4ZQPA 3DFTA 1XL9A 1EWEA 2FPVA 1EWDA 3WJXA 4CNNA 4UR7A 1XFBA 3MP4A 2QCMA 4FB7A 1GVSA 2E5DA 1ADOA 2VXNA 1K7XA 2F84A 1K8YA 4QNWA 5I3GA 3R2GA 1OVDA 4Y8FA 3RMJA 4UTKA 2J27A 3M5XA 3UPWA 3W23A 5CZ0A 1JRBA 3GLCA 3QPYA 1WOBA 3TSMA 3MUXA 5CPLA 5CG7A 3O05A 5F1VA 1TJPA 1VS1A 1X1OA 1KTCA 3O16A 3B8DA 3WJYA 5IBXC 1W3IA 3OBKA 3NQAA 4RCXA 3W83A 1GTEA 1ZHAA 4N02A 4N4QA 4C1KA 2WV8A 3MI6A 5AHNA 3CLMA 4AWSA 1GQNA 5D09A 4QM1A 5HWMA 1SSDA 3BVJA 1PHWA 3P67A 4JGDA 3QEZA 3TX9A 4KWVA 4N9EA 3NQVA 3HMJG 3FJ6A 3NAVA 3UWVA 3EKZA 3LXCA 4RV8A 4O1CA 1OK4A 1FWTA 1S5VA 3HO8A 2E6DA 3HB9A 4WOZA 5CGQA 5HINA 3W7RA 1GEQA 6ALDA 1O95A 4ZZ9A 3KX6A 1OF8A 4FNQA 3V1PA 3UXAA 3GVGA 3LHWA 1PVNA 3G3DA 4O0ZA 1FBAA 1TPC1 1A5SA 4NJHA 5DBUA 3ABSA 3Q2DA 3C2OA 4Z08A 4WJEA 1TSIA 5EMUA 4DELA 1H7NA 1ICPA 4MLJA 4BWLC 4NUWA 2JK2A 3S5YA 2VELA 5E93A 5GVJA 3P8JA 2GQ8A 4W9TA 4RJEA 3G8RA 3C52A 1LZOA 3VE7A 1ME8A 4UFJA 4MJZA 4LVDA 5D30A 4CNPA 4HSNA 3DHFA 3INPA 2F7FA 1P0NA 2HS6A 1JUKA 4HSOA 1RQBA 2AGKA 1KBIA 3R89A 1Q3NA 1G4EA 3G1HA 2BWGA 5F2MA 1K7FA 2Z2UA 5FF2A 4NJKA 3IRDA 4HKPA 2A0NA 3M9YA 4GUFA 3C0JA 3G22A 5D03A 3HJZA 3NNTA 3UD6A 2H90A 3LXBA 5CZJA 2PCQA 4D2JA 3STFA 3MP5A 4ZQOA 1TTJA 3N19B 2XN2A 1GT8A 1SFLA 3O6YX 4QNEA 4U28A 5D2TA 5F4WA 3TQKA 1FUYA 4M5PA 3L5LA 5LNWA 3SW6A 3LCLA 2QDHA 4NXSA 5AHIA 3OIXA 4KFOA 2LLEA 3PSVA 4FNSA 5G4WA 2ZZ6A 5AOUA 1ALDA 4FNPA 2P10A 4DPQA 4AVFA 5KZEA 2EHHA 1BWKA 3W1QA 4FIRA 4XTIA 3IGUA 2VEPA 5DCBA 5DCDA 3BGJA 1KA9F 1GG1A 2YR1A 1C29A 4O12A 2YYUA 3NPVA 2J9YA 4FXSA 3T7VA 4JTSA 3TSBA 3MYPA 3NZRA 4GE8A 3AO0A 3GKAA 3QYQA 8TIMA 5K4ZA 4FO4A 1MEIA 3I68A 1MEHA 3O8AA 1LRTA 3TUUA 4UTHA 4DBEA 2TMDA 5C54A 1OX5A 4I9AA 1W5MA 3FLUA 5EY5A 2BTMA 1W0MA 2X1RA 4KFNA 2GVGA 4BK9A 2J6XA 3N34A 1HTIA 5U4NA 3CU2A 3IIOA 3DFNA 2JKPA 2ZRVA 3RFAA 3T44A 3GNDA 4BFAA 4NZJA 4QISA 3EX6A 1A5AA 5J5DA 1EP3A 1M6JA 3NPXA 2WSQA 1OG0A 3MYOA 3C2FA 4FNUA 3FFSA 2TSYA 3FIGA 3W7GA 1LTDA 4UTUA 2WNNA 3M6YA 5BMWA 2J9ZA 1QCWA 1R30A 3I65A 1AL7A 2FPTA 1QOQA 2I1OA 4Y9AA 5LNSA 3DAQA 3TCEA 1H7XA 4KWWA 4NX0A 1MO0A 3KHJA 1K8XA 1E51A 3M1ZA 2P1FA 2JBMA 3FS2A 2QUUA 4JTEA 1TO3A 2DZPA 4ZQNA 3NQ2A 2OT1A 4HN4A 3Q58A 4DEFA 3S5OA 1OYBA 2ZFAA 1S5WA 3STCA 3MBDA 1T99A 1UJPA 3R8RA 4QSHA 1YTDA 1D3GA 1TV7A 5D32A 4JTUA 4S2BA 1W56A 2ZBTA 3TAOA 4H4IA 2RHGA 1WBJA 4JIQA 3BGGA 3SZ8A 1Q6RA 3ABOA 2CW6A 1XDMA 1I45A 4O1BA 3QQ1A 3KRUA 1HL2A 4JTTA 2Y7FA 4O53A 3W7OA 3STGA 1TCDA 4P61A 1YXDA 4S2CA 3AJXA 4QQ3A 3B04A 2VC6A 3PS7A 1D9EA 2RDWA 3O07A 5L9FA 2G96A 4LUIA 3HPZA 1FCQA 1W5OA 3F03K 1KLZA 1LCOA 4QAIA 4WY0A 3QF0A 2I9EA 2YSWA 3BARA 1JCXA 3BLIA 1VYPX 2WSYA 1QPNA 3NQGA 3GAYA 4O19A 3LHYA 1F5ZA 1T96A 4IUOA 2BZNA 1GTHA 5AB3A 2Z0IA 3W1LA 3M5VA 5HWNA 4AB4A 3ABRA 4Y90A 3LOTA 5AYYA 5KITA 4UTWC 2V0TA 3M5YA 3QFEA 5CPOA 2QCFA 3B03A 4FEZA 4HHPA 3TJXA 4PL1A 1HUVA 4ORMA 3BLFA 1F6KA 2NLIA 2PRLA 1PV8A 1EB3A 3LCGA 5LNUA 2CU0A 2PRHA 4UFHA 3W75A 5F4XA 1F2JA 3TK7A 3OVQA 2QUTA 3MP3A 2OCZA 3W2UA 3EWYA 2I14A 1JUEA 2X1UA 5AC8A 5CZTA 4JNMA 3M43A 3W88A 4EWND 1VHNA 2QJHA 2R91A 3WK1A 3LXAA 2VFFA 4M6QA 4MZYA 5DBTA 5I3KA 3EKLA 4ZMGA 2ZZ3A 1XKYA 2CWNA 2W6RA 3W1XA 3EWWA 3DH7A 3HF3A 1F7BA 3LHZA 2NXIA 4NQ1A 1XM3A 4IJBA 5D04C 2ABAA 4RKAA 5I3FA 3NGJA 5IM51 1SZEA 4A29A 1Z48A 1TRIA 3P80A 4C1LA 3DFPA 5D2XA 3L0KA 4EIVA 1TPVA 4IPJA 4WY0F 5FEPA 4DF0A 3UWWA 4ZQCA 3ZWSA 3BLEA 1VLWA 4JXCA 2JGQA 1OFOA 5LGZA 4RXGA 4WXZA 1TB3A 4MFEA 2C0AA 3P7YA 3W7JA 4K8HA 2Y70A 4JYDA 2WOQA 3A21A 5K9XA 2GUUA 1QNVA 2ZA2A 3R12A 3C2EA 1YXCA 1IIGA 3KVMA 5AHLA 4HNUA 5G4EA 1V5XA 3IVUA 1F73A 2EKCA 2VFGA 2ZTJA 3G1AA 4S1FA 1AW1A 3A23A 4JX6A 4Z1CA 3HG2A 1KM3A 1JVNA 4I7UA 2Y7GA 2ISWA 1JULA 1GZGA 3G0XA 1GG0A 3LTYA 2RDTA 1A50A 1WBHA 1GVRA 2E6YA 3IGXA 2YW4A 1R2TA 1KV5A 1DVJA 1JCLA 3LHVA 3CT7A 5G2HA 3W76A 2FB2A 4IX0A 4AXKA 5CSRA 1EEPA 1R47A 3W1MA 4AAJA 4AHQA 4JEQA 4WQ6A 5E1QA 5FI8A 4UMBA 3QM3A 3S1UA 4TU1A 2TRSA 1VQTA 4GRSA 3UWZA 5H2ZA 2HMCA 2E6FA 4PH6A 2QKFA 1VLIA 2CLHA 3F4NA 3L0NA 1G4TA 4BF9A 2VFIA 3H54A 1B57A 3CEPA 3ZFHA 2QF7A 2Y7EA 1KLYA 1DQWA 5I3JA 4FHAA 3HG4A 2VFHA 1O5XA 2JGYA 1RZMA 3LERA 4MUZA 1PCKA 3W7KA 2A1YA 4JTLA 3GDLA 3LGEA 4Z1AA 3OVPA 3E49A 5K4XA 3SR7A 2W0UA 1ZNNA 3PG8A 1X1ZA 1J4EA 1VR6A 4HPJA 4ZQRA 5D2VA 2ZZ1A 3G1FA 1SO4A 1VCVA 1GJPA 3BPWA 1A5CA 5L6UA 3QW4B 3W1PA 1F76A 2TPSA 3W7LA 4X2RA 2C15A 4M6VA 2IQTA 3W6YA 4UTJA 5EPDA 4IXXA 4RZ4A 1OFBA 1RV8A 5C6MA 3SI9A 2DJXA 3SECA 1KFJA 5FEWA 1OF6A 3I7QA 4KKXA 1ML1A 4LT9A 4YLWA 3BW2A 3H55A 4MIMA 1TV8A 2PE4A 3N2MA 1SZNA 2WQPA 2VOMA 1FY6A 3G3MA 1YTKA 3NR0A 5HUOA 4HIBA 3U6WA 1SPQA 1SW7A 5BMXA 3DI1A 3GR8A 3DI0A 4UFLA 2A4AA 3PBUA 1K03A 1VHCA 2ABBA 2H6RA 3G18A 4O4VA 4POCA 4UIOA 3S5ZA 2DJLA 3NZ1A 3TU9A 4JTIA 5LNVA 3NL3A 4JX4A 4O14A 1ONRA 3W2KA 4N9BA 4EF8A 3TMQA 4R53A 4PEKA 2C16A 3M7WA 3C4UA 3RF9A 1FWNA 4TR9A 3W2MA 2NX9A 2P0OA 3L0GA 2ISVA 4IMCA 4P2VA 2B4GA 1B4EA 1JCMP 4QITA 2J88A 1SUXA 5FEZA 1I2OA 3S6DA 3IGSA 4DF2A 2Y62A 3NM1A 3RNDA 1O4UA 3FA5A 4K36A 3CIWA 4FF7A 1IF2A 1JQVA 1OYCA 2QEZA 4CQ9A 4NJGA 4XKYA 4GFSA 1YDVA 1IXPA 5DY3A 3NOEA 4ALDA 1FDJA 2ZA1A 5LNRA 3UWUA 3W7CA 1F05A 5AC6A 5FF0A 5K9DA 3W07A 2Y85A 4GUJA 3DXIA 2E5CA 4JDBA 4FIQA 1BWLA 2NXGA 1SO3A 3E0IA 1CW2A 3LRKA 3FYPA 3QQ0A 3ATYA 3EX4A 4IXHA 1DJNA 4K7YA 4NNCA 2NX3A 1SZGA 2YXGA 3BW3A 2E09A 3E96A 1SW3A 2EGZA 4XTDA 3N9RA 1LOLA 3W1NA 1ICQA 3GX9A 5FF3A 2ZZ4A 3N2XA 1AMKA 4YCOA 1FWWA 3LI0A 3GDKA 5D05A 1S3HA 2OT0A 1MZHA 4LW7A 4MYXA 3N14A 2NUWA 4PL2A 3GZ3A 3CIXA 5LGXA 4IMDA 4KFPA 1H7OA 4IMEA 1W3NA 4LS0A 4AMAA 4GUGA 4AHOA 3MHGA 3LLFA 5DN1A 2ZQ0A 1G69A 1FWRA 2W79A 3L9CA 3NL2A 4PFMA 3L21A 3M44A 5HMSA 2PRMA 4PTNA 1EIXA 3HGRA 5EL1A 1LORA 1UUOA 3EB2A 2FDSA 2V8ZA 3VE9A 3CHVA 4WUIA 3W7MA 4N9CA 1H7PA 1OFPA 4IPIA 4O10A 1ZAIA 2QCDA 1P5BA 3S8HA 1N7KA 1OABA 2NUXA 3PSWA 3ANYA 2VEIA 3GYEA 4ADSA 2FLIA 3IV3A 1Y0EA 2R14A 1S5TA 3PC0A 1HFBA 1QWGA 1ZALA 1OX4A 3E02A 1KTBA 3CEUA 1UASA 1JCNA 1WX0A 1TV5A 5K7JA 1W54A 1H61A 3PBVA 5BNKA 4E2DA 3W22A 2QR6A 1OK6A 3KVLA 3UPBA 1ZY9A 3BO9A 4UTIA 1T0OA 2HS8A 2V82A 2X16A 4PODA 1NEYA 2DZTA 3SY5A 4FXRA 3YPIA 1JCJA 3OEXA 3QSRA 5G1YA 3TA6A 3W84A 1OX6A 3NQ7A 5A8GA 3L67A 2ATSA 4H3DA 2DU2A 2PURA 4MY9A 1QR7A 1TPDA 5K9CA 4OGZA 1YPIA 5K3VA 1IIHA 5T26A 3LBCA 3CWOX 3A5FA 3DU0A 2ZRWA 1DKWA 3BG9A 4IWWA 5KZMA 2NV2A 3GKFA 4NT0A 4EOUA 2WO5A 2HTMA 4LNYA 4HPXA 2Z1BA 3EX2A 1VZWA 1XBYA 4JS3A 3T40A 5DLCA 3W7DA 5K2ZA 4XWUA 3HGSA 2O7QA 4EVZA 2GOUA 4LU0A 1RPXA 3EX3A 1WAUA 2VFDA 3LHTA 3P82A 4UTTA 1EUAA 3W2NA 4K8EA 3PUEA 1CX9A 4RR4A 4Q33A 3PAJA 4O13A 2NXHA 5FEXA 2A7NA 4N4PA 3TIMA 3SGUA 2ZRUA 1B4KA 4GBUA 4MYAA 1L6WA 3HBLA 4GNJA 4NNAA 4CQ8A 3WJZA 4WD0A 2O7SA 3GB6A 5EYWA 1LRNA 4K7VA 3B0VC 5HQEA 3LBMA 2ZZ7A 3P60A 4FX6M 4YCPA 3MI2A 3N9SA 4A3UA 1DJQA 1ME9A 4OBTA 1OYAA 1P4CA 2VEMA 4M7SA 4N9DA 3GAKA 5AFDA 1MXSA 1N8FA 4UTLA 1Z42A 2GPTA 3W7IA 3W7HA 3NEVA 2BSLA 1THFD 4UTMA 2CLFA 3QMSA 3FKRA 1DBTA 3QMRA 2NV1A 4JTHA 3QZEA 5AHFA 4IOTA 1H62A 3R13A 1DHPA 3PY2A 4AHPA 1HO1A 3Q94A 5F2LA 2E68A 4K39A 3TQ0A 1W5PA 2VFEA 4G1KA 5D02A 3W87A 3LHUA 1PCWA 4JTJA 3W86A 3THAA 2C19A 1X6UA 2Y61A 2Z6JA 3E9AA 3LX9A 3UZ5A 1TPEA 3W1AA 3QSTA 3KRZA 4M6PA 2Q3OA 3DFSA 5ABTA 2RDUA 1J5TA 1TRDA 2QCHA 1CI1A 1JRCA 1FCUA 4NZFA 3EX1A 4ML9A 1TJRA 4WZHA 3DFOA 1RQEA 3IVSA 1QO2A 3TNOA 2CLOA 4Z1DA 1SZFA 1FQ0A 5FF4A 1SQ7A 1DORA 2FB3A 3W7QA 1KFBA 3W1TA 4H6KA 3JS3A 4TMCA 4ZL1A 1TMHA 3TE9A 3LM7A 2H8XA 4HNTA 1YDOA 3STEA 3DKLA 1KFCA 1W5NA 2GJNA 1B9BA 3MMTA 1JQXA 2YCEA 1TTQA 3HPSA 3K30A 1NSJA 3NPUA 3G0UA 2J9XA 2X1TA 4ORIA 2G5WA 5A5WA 3LB0A 4R34A 4LC6A 4PCFA 3CC1A 2B7NA 1DV7A 2WJZA 4FX8A 1WYIA 4WXYA 3TH6A 2QCEA 3W3OA 3LI1A 4JR5A 3PR2A 5SWUA 3LRMA 5IBXA 1LBLA 4JTKA 4O15A 3OHIA 1V7YA 4HNVA 1JJKA 1LDCA 4NJJA 3OG3A 2E77A 3S1VA 1AK5A 5AYXA 2ZRZA 2ZZ2A 1YYAA 2FQIA 1Q45A 4LVAA 4LVGA 2V2DA 4AF0A 4UFIA 3NL5A 5D37A 2VENA 4NU7A 1R46A 5CZSA 4LUJA 1OJXA 4GWEA 1NVMA 1U83A 3A5VA 1ZFJA 4K37A 1UCWA 3TFXA 3P5ZA 4CLMA 1PL9A 4Y6GA 3PUOA 4JY8A 2XFWA 1OFAA 1AL8A 2TYSA 2DZSA 1IXQA 3HOJA 5DXYA 5EKYA 4O18A 1LM1A 2CZDA 1XBVA 1YADA 1TPUA 3VNDA 2FIQA 3TXVA 1QPRA 4FX7A 1PS9A 4LWWA 5AC7A 3S42A 3A24A 3W1RA 4UTTC 1W37A 5LHEA 2QAPA 1G67A 3GXPA 1OFRA 3UXDA 4TO8A 3JR2A 3MO7A 1IXOA 2G97A 3W2JA 3L68A 1ZAJA 3KVKA 2GQAA 1ZJIA 2CZEA 1MSSA 3B4UA 1VRDA 3M5ZA 3M41A 1W5QA 2OJPA 3O15A 3CQ0A 1Q6QA 1UUMA 4IGHA 3NQEA 5LKYA 1KV8A 1DL3A 1Z44A 3GK0A 5C2XA 3T78A 4DF1A 2VKZG 3P62A 2ZRYA 1GVQA 2B0MA 4I7VA 1TREA 1TPH1 1K02A 3GR7A 2H3BA 1SSGA 2ALDA 1SFJA 5AHMA 2C13A 3PF3A 4A21A 4QIUA 5DXXA 3UWQA 3ELFA 4LS2A 3NG3A 1WOAA 1SO6A 1PHQA 2A7RA 5LZLA 2QJGA 4O11A 2CZ5A 3PULA 3VCRA 4DO6A 1M7OA 4UR8A 1JCYA 3KXQA 3WK2A 4X3ZA 4O50A 4E2BA 2Z6IA 1KTNA 4MZ8A 3UY7A 4GC4A 3SFKA 1C9DA 1G7VA 1U5JA 3LCFA 4QJ1A 1I2QA 1X8FA 4LVBA 4LS1A 4MLRA 3EWZA 3TDFA 5DELA 4RK8A 3P84A 4DQWA 2BXVA 3LLDA 3PBYA 2NZLA 2Y7DA 3KFTA 2R8WA 4UMAA 3TFCA 1I2RA 1TPFA 4O54A 3SGZA 3TW7A 4A2RA 1G4SA 4JYEA 1WV2A 4R33A 1H7RA 4FNTA 1N55A 4O57A 2V81A 3C2VA 3G1SA 4ZVJA 2A6LA 2Y89A 3S5NA 4HNNA 4O16A 4UUIA 2ZCGA
chains in the Genus database with same CATH superfamily
4GY1A 4AD5A 5C71A 2E8YA 1QPKA 4FSAA 1TWSA 1OFQA 3PZGA 4UMCA 4U2YA 2PSNA 1JGIA 3SSJA 4TIMA 1DWHM 1NJJA 4GHRA 1EBGA 2YFNA 3N4AA 4DLMA 5KSWA 5I6SA 3AS0A 1XDLA 2ATMA 2PDHA 2V5BA 4B3ZA 3SSZA 4UZSA 3MA8A 4MPQA 1Q2SA 3LDVA 3QY6A 1DQXA 1XJBA 4A35A 3BANA 2AQOA 3FKKA 4MY1A 5BOOA 1WXZA 1G6CA 1MMFA 2Q3RA 1EFZA 4JDYA 4GX8A 1NIUA 3WH5A 3NQ8A 2QJMA 1UB3A 4HYVA 3TOYA 4DAFA 5FESA 1XV8A 3EXSA 1TE1A 1OT1A 2QHAA 3LU2A 1FXQA 2GJPA 3VILA 4N42A 3CS2A 4PZVA 4NX5A 1NWTA 3L2MA 4C6CA 2QAFA 3MJYA 5G1TA 4CNOA 1CB2A 3RR4A 4XZBA 1UBSA 4Q8UA 4WX2A 2X8RA 2W62A 2ZRXA 4E38A 1KM6A 5F2GA 3CMGA 1OQFA 2VEGA 3F4WA 4NXKA 3DYMA 3ALGA 3MWCA 4GO9A 1YPFA 3VNLA 3CZJA 2FHBA 4TUFA 1AJZA 3PHAA 3OLDA 1IHIA 3S0CA 1GEHA 3PZVA 4HSHA 4NI8A 4GVIA 3EOEA 1AH0A 1AZ1A 1JPDX 3EOUA 2V5LA 4J2MA 4WKFA 1GJWA 4O8RA 2XU2A 1G7UA 1I8JA 1ME7A 4DZIA 1QRQA 3Q67A 4BS0A 5M1TA 1V02E 4AC1X 3TXZA 4JHOA 2CFFA 3TONA 5E0KA 2FMOA 3DGRA 4JIPA 1XUUA 3TTEA 1EOKA 4QR6A 3AWNA 2GQ9A 1NWSA 4KIEA 3OYXA 4XO6A 4XBKA 1E4NA 2AOSA 2QCCA 2WKJA 1NFPA 2VX5A 4YYFA 1F74A 1SW0A 4WDWA 1LWJA 4J3XA 4X60A 1LYXA 3LTSA 5C70A 5AVNA 3PZMA 1EX5A 3AWOA 3CUJA 1MW0A 2XYLA 1TE6A 2PA6A 3T0CA 4NRRA 2OZ0A 3HG5A 1HO4A 2C71A 1KM1A 2INFA 3OBEA 2A7PA 4JQAA 4XBSA 2EO7A 4L64A 2YZRA 2QGHA 2DZXA 3JRKA 3SIZA 2I16A 1E72M 3KM8A 3FVMA 2OYLA 1H41A 1MFVA 3O6DA 2PI6A 5F4SA 5FIPA 1X7FA 3DYPA 3NVTA 1M9HA 4PRWA 1LLZA 4M24A 3MHUA 1G0CA 4AD1A 4YWSA 1RD6A 3NQMA 1A53A 1J6PA 3HV9A 5BW6A 4MZ1A 1XH1A 1TUXA 2FZNA 4J3ZA 1HP5A 3NXFA 3PTQA 1NDZA 3UWYA 2ZUUA 1RJRA 5BOEA 4B15A 1QUMA 1PTDA 5LA0A 3DIPA 3G1YA 1IXNA 3FEMA 5CAHA 1W3HA 4X22A 2X1SA 4EPEC 3T8LA 4E4UA 4G8TA 1QPQA 3QR1A 4K68A 5HJYA 3CHEA 3G1XA 3QR3A 1KFKA 4C5YA 3WL0A 3RIKA 1E6SM 1NDVA 3M64A 3GSMA 4UQDA 1BLIA 2EPHA 4C6PA 1DTNA 4RDZA 1W17A 5HNRA 2DZVA 2RDXA 3F4DA 4HB7A 1LLWA 1M68A 2ZVIA 4KESA 5JQ9A 4V1XA 4EF9A 1DIDA 4X0NA 5AYZA 3W71A 2BVWA 1FDZA 3I7RA 3LCXA 1OCQA 1FCBA 2NQ9A 1N8WA 3O6AA 1K8ZA 2ZDSA 3EWBX 4IGNA 1S46A 2O9PA 1WDRA 1FHVA 3CB8A 4IQDA 3RPDA 2YX0A 1OHLA 1E43A 4LVFA 3CPRA 4Z1BA 3O7UA 5G2WA 4Q8WA 3W9ZA 3WH6A 3FAWA 1LBFA 1R2RA 1XIBA 1DOSA 3O9NA 1M7XA 1F6YA 3O63A 2QUVA 1R5YA 4Q32A 1RY0A 3SADA 1FHDA 3E38A 5A1AA 1O12A 3QW3A 3CWNA 4CNSA 4JTDA 1WDWA 3L2IA 4L9ZA 1E9LA 4BQ2A 4B5TA 5D8ZA 4QJ4B 1V3MA 4WDTA 2J75A 2GYIA 4LEFA 2VRQA 1ZAHA 4WY0B 3BQ5A 3TROA 1GOQA 1QMLA 3G1VA 4KIRA 2VCAA 3AYTA 4IQEA 4CQAA 1I2NA 3N04A 1UR1A 3HGOA 1B3WA 3ZR6A 4UR9A 5KINA 1W3LA 5BZAA 1J11A 2A85A 3EEGA 5DRCA 1W9DM 3UR2A 1Q66A 3V16A 2QGYA 2HQAA 2VWSA 3VM5A 3EA3A 1M53A 1RA5A 1LT8A 1WO2A 3PFRA 3VXGA 4Q4MA 1UA3A 4I6VA 1EQPA 3GUGA 3VIPA 1DWFM 1WKEA 3M0ZA 2WXDM 5TQLA 3WQWA 4GXMA 3UQNA 4EAYA 4X9SA 1QBBA 2B7PA 4ZENA 2BODX 1YE6A 4DBDA 2WPBA 2DIJA 3BMXA 3KCLA 1E9YB 4LC8A 4XUGA 2YFOA 1IGSA 2FFCA 1IZKA 1AQHA 4HYRA 1HVQA 3WELA 3UNDA 4TV5A 3E74A 3PBMA 2XIBA 3GFYA 1J18A 1XLHA 3MCOA 4BWLA 3HFTA 4ES4A 4ZCWA 2GJLA 3WUBA 3POCA 4U10A 2DZWA 3WDQA 4IP4A 3HQ1A 3URBA 3B06A 3SY1A 2QW5A 5TBOA 4DJFC 4CUCA 3IAQA 2R9RA 2X2YA 3A9IA 2CWXA 1Y7VA 3BOFA 4MNMA 3MV11 1NH6A 1KBLA 5HNNA 1Z9AA 3D0CA 3M0IA 2BGNE 1LP6A 1LF1A 3B4YA 4JQ3A 3TZNA 2DT0A 3BH4A 1UC5A 2CPUA 2J79A 3F5KA 3C6CA 2YW3A 1LROA 4M0XA 1SFSA 3NCOA 1TVNA 1TQXA 1L2QA 2OODA 1WAWA 1Q6CA 4U5KA 3NEHA 3LK6A 1OC6A 2CHNA 3M47A 2F61A 2Y8VA 5A6AA 2E1DA 2YGYA 3C8FA 4L4OA 3L66A 1EXBA 2PGRA 3H6OA 2BXYA 3L5MA 1TYGA 4GO8A 3SIMA 1PE1A 5I79A 2XG9A 3STPA 1HG3A 3L5AA 3ZO9A 3PB2A 4OHQA 1VH7A 3HMCA 4HA0A 3EOLA 2QYGA 2FTYA 2QCNA 2GJXB 1KXVA 1XSKA 3UZJA 3TQPA 1K77A 3AIEA 3WO8A 4YHEA 1EKOA 1A5UA 2CXGA 1XFCA 1GVSA 1K8YA 4A6GA 1OVDA 3RMJA 4UTKA 5HBFA 2J27A 2Z28A 1QBAA 3W23A 2FH6A 2O0TA 1VFLA 3E0VA 3GLCA 3T0TA 3RAOA 3MUXA 5CPLA 2GSJA 3SCNA 3ZJ7A 5CG7A 3W0KA 1VS1A 3CAKA 4H04A 3O16A 4B2DD 3KZPA 4JFTA 1TJ0A 4P7QA 3B8DA 5IBXC 4WKAA 4M6UA 1W3IA 3LPOA 1IT8A 2G4JA 3OBKA 3AICA 1D8WA 1MQQA 1KGXA 1WPCA 2D3LA 1RVKA 2WV8A 3MI6A 4AWSA 1LWIA 4DJEA 1GQNA 1DIKA 1YE4A 3BVJA 1LG2A 3QTGA 2IMRA 5D9MA 4D6GA 4JGDA 4ZXOA 2GGJA 3QEZA 2PEVA 4RNIA 4KWVA 1W9PA 4US6A 2GGGA 4RV8A 4PMOA 1S5VA 4XSMA 2J7FA 1V79A 2V3EA 1F8IA 4W86A 4AY8A 3OO2A 1OF8A 1XD1A 3V1PA 4NHVA 4CVUA 1PVNA 1V6UA 4H7ZA 3CUZA 1UHVA 1G5AA 3WNKA 1QASA 3Q2DA 4Z08A 4WJEA 3THDA 1H7NA 4J3SA 1ICPA 5REQA 3COTA 3KP0A 3BJTA 2C79A 3TZFA 3G8RA 4KRZA 3KLKA 1SJAA 2Q01A 2XDFA 3BV7A 6ENLA 4K1GA 3VE7A 1ME8A 1T8QA 1SJDA 4A8RA 1QI2A 3DHFA 3INPA 3RHGA 1M04A 2YL6A 1G4EA 2VGIA 2BWGA 1K7FA 5HNUA 3H70A 3MVTA 4NJKA 3IRDA 4M1BA 2W27A 3M9YA 1E15A 1CECA 1J2BA 1KR1A 1S38A 2VR5A 2F9RA 3HJZA 4G7FA 5CZJA 3UETA 2VCCA 3UJFA 1SJCA 1U22A 3MP5A 1E0WA 1H0GA 4WR3A 1GT8A 3AAMA 1EO7A 4QNEA 4U28A 3DOPA 4H2CA 2VZTA 9XIAA 5D2TA 3TQKA 4M5PA 4B5UA 5I23A 1ADSA 1RCXB 3L2LA 3LCLA 1ZZMA 3WG6A 4NXSA 3RO6A 2RGMA 3R10A 4S3CA 2YL9A 4GYPC 4AUBA 4GLEA 5CGTA 4R27A 3V4BA 3GG8A 1B3VA 3IAPA 2VDIA 3I3BA 3WDJA 2XFFA 4DPQA 3UVIA 1ZP3A 3SCOA 2JFEX 1WDQA 5CXPA 2XGZA 3T81A 1GYMA 2Q6ZA 3BGJA 1GG1A 1FWFC 1C29A 1A5KC 4W85A 1DWIM 4JTSA 4CN1A 3T8QA 1IEQA 8TIMA 1DIOA 1OBAA 3ARSA 3FY1A 1MEHA 3KEHA 2OEJA 4JIIX 3MPGA 2QMKA 4UTHA 2FDMA 2P8CA 1FH8A 3WDIA 2XWDA 2AQVA 1T41A 1W5MA 4QS6A 2D0FA 5EY5A 4D6HA 1OT2A 3R0UA 2OFJA 3VDBA 4X61A 2J6XA 4L7ZA 4DWSD 2DUAA 2JKPA 3GNDA 4NZJA 1BVWA 4QISA 1RLCL 2OWXA 2Z1VA 3NPXA 3W7GA 3N11A 3WF1A 1XIJA 3SFWA 5FA5A 1RCQA 1R30A 1AL7A 1E73M 2FPTA 4KEUA 1Q2RA 1PZ3A 1LQAA 4NX0A 3IWPA 4DZ5A 1E6PA 3CUHA 3VGHA 2PLCA 3M1ZA 2QUUA 4JTEA 4HN4A 3Q58A 3MBDA 1T99A 1UWTA 1YTDA 1UMLA 4S2BA 1W56A 2YA2A 3BLDA 5M2FX 4H4IA 1C7SA 3N6JA 4ZE5A 4E3TA 2CW6A 3OVGA 3U57A 3WQDA 2HNEA 3QQ1A 1XQKA 5CBBA 1JI2A 3BLKA 4QJ5B 1YXDA 4S2CA 3PP7A 3A12A 5MF5A 2CZVA 1OIFA 1HJXA 3PZNA 2G96A 3A4XA 4LUIA 3UZWA 4EKJA 1KLZA 4R3UA 2YSWA 2PBGA 1DHKA 1JCXA 5LIUX 3SCRA 3GU1A 1VYPX 2BBFA 3NQGA 4QROA 3LHYA 1F5ZA 1A4MA 1WKYA 1JZ5A 4FR6A 2QJJA 3EMZA 4AB4A 3C0LA 4UTWC 3G6LA 4B91A 3M5YA 3QFEA 2QCFA 3B03A 1R7OA 5I2UA 4IUGA 4HHPA 1ZBWA 3TJXA 2D2OA 4PL1A 3VKAA 1HUVA 4E2OA 1TR9A 5IFTA 2RGLA 3W75A 2Y24A 1MI3A 1P7TB 2J8TA 2PB1A 3UESA 2XTKA 3QBUA 4D6DA 2PZNA 1JUEA 2X1UA 1G1YA 1A3XA 1DIEA 3W88A 3LLXA 2QIWA 4J40A 4G7EB 3WLKX 4GCXA 4MZYA 4YTQA 5I3KA 2Z27A 3EKLA 5D9NA 2VM8A 5FJTA 1A0DA 3ANUA 1ZSXA 4GYJA 3W53A 5C9RA 3DH7A 1PZ0A 4HTYA 3APGA 1QHPA 4NQ1A 2NXIA 1BKHA 4JPGA 1XM3A 3NURA 3H4XA 3RM4A 1BHGA 1BVNP 3SQLA 3HPFA 2ABAA 1JPHA 3NGJA 3LGDA 3LN3A 4A3QA 5HPCA 3E3HA 2OLSA 4A29A 1Z48A 1BYBA 1XYAA 1TRIA 5AZ0A 4PB4A 3QGAC 1AQMA 1RBOB 3WLHA 2PTWA 1X97A 1OCBA 5A3HA 4ZQCA 3ZWSA 1A47A 2PAJA 2QMJA 4AC7C 4PGLA 1TB3A 3K1DA 4AZ6A 3P7YA 3REQB 4DZHA 2XVKA 4MGGA 2WOQA 3A21A 4HMCA 3RJXA 3C2EA 1IIGA 2PCEA 3GTXA 3IVUA 4J3WA 2EKCA 3MZ2A 3G1AA 1US2A 4J7RA 4HN8A 2GFTA 1PZ2A 1JVNA 2Y7GA 3AMDA 2ISWA 4AZCA 3SRHA 3G0XA 1GVRA 2YW4A 3CT2A 4OJYA 2QPSA 1KV5A 3MS8A 2YIHA 2Z25A 1JCLA 3MV01 3CT7A 2FB2A 2Z26A 3SURA 1W6TA 1XYZA 4AAJA 3AIWA 3WLLA 1EEXA 3URNA 2WMFA 4WQ6A 5C7HA 5FI8A 3GM8A 1KKRA 7XIMA 3S1UA 2TRSA 4V2XA 4IFKB 1TFVA 2PP1A 4QE4A 4GRSA 2HMCA 2CLHA 3F4NA 2W91A 4EE9A 3VU2A 2RAGA 5JUVA 4ZSTA 2WWDA 1CZ1A 3ZFHA 3ZM8A 3RR1A 5I3JA 3ES7A 3B3DA 4GD0A 2VFHA 4UOJA 2YA0A 1PCKA 3LBOA 3W7KA 4C91A 1EJWC 1JGMA 3WNLA 3OG2A 4NAEA 3SM0A 4W8LA 2PWDA 1GVIA 1ZNNA 3PG8A 2AKMA 3RCNA 4HPJA 3BSHA 5A6SA 3G1FA 3U2ZA 1AD4A 1A5CA 3THUA 1CLKA 7A3HA 1SVDA 1E70M 1I9CB 3UGVA 2C15A 2R24A 1I0BA 1DWJM 5E5CA 3VIHA 3R0KA 5C6MA 1RV8A 1RJQA 4XIMA 2BOGX 3ZIZA 4EPBC 2YBVA 2NT0A 4YLWA 3GH7A 3WF2A 4L9XA 1E6XM 2WBKA 4MIMA 4RE3A 1TV8A 1VENA 3LPFA 1KR0A 2PLMA 2WQPA 2J62A 4LYKA 3G3MA 3E2RA 3NR0A 4IJCA 3U6WA 3FDKA 1QNRA 5EGRA 1CGYA 4WGXA 3AMCA 3WYZA 1VFOA 1VEPA 5JXQA 2ABBA 3N3TA 2OX4A 3S5ZA 2IW0A 3GC4A 3M0JA 4I90A 3GIQA 4C90A 3W2KA 4N9BA 1BAGA 3TMQA 3VZZA 2H9AA 1QNPA 4AZHA 3C4UA 2P76A 1S1PA 2J7DA 4PMXA 4J2PA 2ISVA 4IMCA 4FF5A 2J88A 5FEZA 1I2OA 4RNHA 5AY7A 3HURA 2VDGA 3GTFA 4K36A 3KTSA 1IEWA 1IF2A 2O55A 1V6TA 2HZGA 1GQIA 4JN8A 3LGGA 5HMEA 3V7PA 4ALDA 1XPYA 1UOKA 3EDJA 2ZA1A 5AC6A 2V5JA 3UZXA 5K9DA 1UA7A 2Y85A 1WUEA 4BQ4A 1Y5WA 1FOBA 5HJXA 1VFHA 2FVMA 2NVCA 3GW0A 2NXGA 3U4FA 3TYUA 4R9OA 4BCEA 3CV7A 4Q8OA 3ATYA 4IXHA 4M1RA 1GOKA 5EFFA 2YXGA 2E09A 1S2VA 1NY1A 3DEQA 1JXJA 1LOLA 1ICQA 4MTVA 3CTTA 1AMKA 3QQWA 1UC4A 4UQAA 2YCLB 1MZHA 3N14A 4JNZA 3GZ3A 3OQ8A 4LS0A 3R94A 3LLFA 1X96A 5DN1A 4PBFA 3EWDA 1G69A 1JZ3A 2CEQA 4PFMA 3M44A 2PRMA 3VC5A 3HGRA 3AXKA 3GBEA 3H2MA 1LORA 1UUOA 2FDSA 5IOBA 1NP0A 3MB9A 1TVPA 4H19A 3W37A 4WUIA 4XAGA 3NFUA 1UKOA 1OFPA 4LCRA 1SGJA 3E2SA 2RJHA 4JOMA 5IFPA 1OABA 2X0YA 4AY1A 4MWAB 3ZVHB 3MANA 2ZADA 2FZ8A 3WNPA 3E6EA 3EA2A 4XAYA 4EP8C 2R14A 1S5TA 3WQ5A 3ZQ9A 1Z7AA 3T0AA 4H9UA 1UASA 1REQB 1EL3A 3PBVA 2YXXA 1ITUA 3W22A 5A95A 3BO9A 4UTIA 4C60A 2HS8A 1BXNA 5HMFA 1AJ0A 4E8DA 2G50A 2WMJA 4R88A 3OEXA 3TA6A 1OX6A 3NQ7A 3L23A 5ABFB 4XBJA 3MU7A 2GGIA 2OSWA 8XIMA 3T0BA 3CAWA 2PURA 4Z1YA 5K9CA 4I6KA 1YPIA 1RUSA 4QHRA 1IIHA 1I6NA 2O92A 3LBCA 3QTPA 1POJA 4ASTA 2F2HA 3BG9A 4IWWA 2UY3A 4QXIA 3R58A 4EOUA 1B5TA 2I17A 3PWGA 2I7GA 4LNYA 2Z1BA 1XBYA 3N25A 3M46A 3W7DA 4XWUA 3L4ZA 4LUSA 3W24A 4UTTA 2JEPA 4K8EA 3OTRA 1B54A 3LS9A 2GWGA 3EDKA 1Q85A 1BYAA 2WQDA 3DUGA 4PMQA 3SGUA 2ZRUA 3TIMA 4DJFA 1L6WA 2XH7A 3HBLA 4GNJA 4NNAA 4S3DA 3WJZA 5MKGB 2PGWA 5CLWA 1IGWA 4IL2A 1RCOB 4RE4A 4WSHA 5HQEA 3LBMA 2ZZ7A 3PZ9A 3P60A 3ZT7A 1DJQA 2VEMA 4Q4SA 5AFDA 1Z32X 3RG6A 1FWHC 4UTLA 4LXFA 1Z42A 1JL8A 1C93A 3W7IA 1XLGA 3CPGA 2BSLA 2CLFA 2O56A 2WK2A 4JTHA 1J96A 4Q7BA 4ZBCA 4A8IA 3CZ8A 4AHPA 1H1NA 2X40A 1D2KA 4K39A 3TQ0A 3VIIA 1FWBC 2VFEA 5A2BA 2PFHA 3W87A 2G3MA 3BJFA 2WCSA 3THAA 2C19A 1MQPA 1X6UA 2Y61A 1KCLA 3GUWA 1YEYA 5A2AA 3LX9A 2E0PA 1BF2A 5A6LA 4Y9MA 3QV6A 3W1AA 3GQYA 3KRZA 2Q3OA 3KUMA 3ZJKA 4I3GA 4MKSA 4CU6A 1J5TA 4PUDA 4AY7A 4BF7A 1TRDA 4NIRA 1Q6GA 1JRCA 4NZFA 3A64A 2BNJA 4WZHA 3RJYA 3WUEA 4TMCA 1IWAA 3LM7A 2H8XA 2D0GA 3VMPA 4EX4A 3U7VA 4GZJA 3DKLA 5DX7A 3UZZA 1W5NA 1CENA 4Y2WA 4Y8EA 2WMIB 2QLYA 3EEZA 4DHGA 3DHUA 3CO8A 1QI5A 3LZ3A 2BP1A 2B7NA 1WYIA 1BF6A 4AD0A 5HQMA 4JR5A 4GKLA 1EGVA 3PR2A 1E9IA 1VRXA 1UP3A 2XFRA 3LRMA 1M01A 5IBXA 3OHIA 3DGBA 2WMKA 3CUGA 2OU4A 1GHRA 4YNGA 1GW9A 3CZGA 5BWAA 2CBVA 1YX1A 2ZRZA 3IJ8A 2EJ1A 4QDPA 1XDJA 3MMDA 5D37A 4E3VA 2AL1A 1UR0A 1R46A 4NU7A 5CZSA 1KQZA 1HX0A 1LG1A 4LUJA 3V0SA 1OJXA 2VVSA 3ZSTA 1ZFJA 4K37A 1PL9A 1XQLA 4GIAA 3VOHA 4HQVA 1JD7A 2X42A 3HOJA 4Z2IA 4PTVA 5BROA 4O18A 1LM1A 2CZDA 3TXVA 3EMCA 4W5UA 5AYIA 4RNFA 2CESA 2FHFA 4DM1A 5AC7A 3S42A 3CMJA 1W37A 4S3AA 5LHEA 1ZP4A 1G67A 3GXPA 3BZGA 5BWFA 1MRAA 2WCGA 3V5FA 1ECQA 1E5JA 1V6WA 2G97A 3W2JA 1ZAJA 2ZX7A 3KVKA 2FGZA 1MSSA 4BY3A 3B4UA 1LUCA 3N12A 3M41A 1DJHA 1TX0A 4FP1A 3O15A 3F2BA 1Q6QA 2B81A 5D8WA 3WNNA 2NQZA 3T78A 4DF1A 1FKXA 2YKKA 2IUZA 2D1ZA 3VGBA 1PYFA 3D3AA 1B3XA 1ELSA 2YA1A 4MF4A 3T05A 1IR2A 4ZOAA 4W7VA 3PF3A 1K8CA 3C5QA 2XWEA 2WJEA 1KB3A 3BOLA 2YXOA 4NKCA 1J5SA 5HANA 4UBPC 1OB0A 5LZLA 3EPMA 2QJGA 4O11A 2HVMA 4Q4RA 4AD2A 4E2BA 4O50A 4GYPA 4S3EA 1OCNA 2Z6IA 5A6TC 1E6QM 2ZC8A 2D69A 2J78A 2XFYA 3VOJA 1G7VA 3LCFA 4QJ1A 5H8UA 4LS1A 3KL5A 3EWZA 4CN6A 5DELA 4DQWA 3P84A 3PBYA 2UY4A 3AMKA 2R1NA 3KFTA 3TFCA 3HPAA 3QY7A 1EYWA 3TW7A 1Q8JA 2R1LA 1H7RA 2NQJA 3Q45A 3VD5A 1FWDC 2A6LA 3S5NA 3U2CA 3RX3A 3XIMA 1KFLA 4QG9A 5LHFA 3PTDA 1OWQA 2IPGA 3UVAA 2YYTA 4W93A 1K3UA 1AMYA 3TJLA 1I2PA 2D22A 1FWEC 2AKZA 5HATA 4ROPA 1OD0A 4IMFA 1H11A 4H41A 1W3TA 2VUNA 3SUUA 1M7PA 2V38A 4NAFB 3BAXA 5EBUA 2RJGA 2OYKA 3TTYA 3WFAA 4ERIA 1F3TA 2HROA 3TYBA 3T4CA 1PEZA 3EMQA 3LV5A 4BI5A 3OGSA 3WD1A 4LY4A 4ZA0A 3ZS4A 3W6MA 4HA4A 1JZ7A 1LOQA 3VUPA 2QCLA 1E5NA 1V4YA 3MMWA 5AHEA 1ITCA 3HG3A 5EMKA 3GIPA 4AH7A 3HZ3A 1MUCA 1GQKA 5E6ZA 1BQGA 4KRUA 1L9WA 1GQLA 2BLEA 5BYWA 1KBJA 2A2IA 2POZA 3B9DA 2ZC1A 2YOCA 2JKAA 3VKDA 3NPWA 3NQFA 1BKSA 4QS5A 3QGKC 1H63A 3E12A 4Z42C 3WH7A 1AH4A 4DUXA 3R4IA 3VZXA 1KFEA 5KZDA 5CJ5A 3CV2A 4IQLA 1Z89A 5I09A 4RDYA 4B92A 3DFYA 3UWEA 4LRTA 3I3EA 5JBDA 4DNHA 4HNCA 1G4PA 4YL2A 4HZMA 4OFCA 3N4FA 1AW2A 1BPLB 4DI9A 5A69A 4RL3A 1ICSA 3MKCA 4XKYB 3VI2A 4E0CA 4CD4A 1UD3A 4HMNA 2Q8LA 3VX0A 4UTWA 5HPOA 4I5UA 3W7NA 7CGTA 2GVLA 3IIZA 1GVEA 1GKPA 1G94A 1XF0A 1MQRA 4MVAA 5DCEA 1Q6OA 3NYZA 5HWJA 4BR1A 1E1CB 4NI3A 1LRQA 4ATLA 4W84A 4QTGA 4UFMA 4O4WA 1HKWA 3EAUA 1UOZA 3IJDA 4MNJA 3MUIA 2FTPA 3IEBA 1TWIA 3AQUA 2ESCA 2DP3A 3O2LA 4HCHA 3IACA 5CPTA 2WKLA 4JY9A 4LAZA 4L1GA 2PDLA 3T0DA 1OM0A 2XH0A 2FGLA 6XIMA 1WXJA 4TX6A 4H6QA 2F6KA 4D6FA 2WBGA 3PTMA 1O7AA 3OQEA 4IIEA 2Y8KA 3WJSA 3W7PA 4GVGA 5GJMA 1ISXA 4FOJA 5LIKX 3A13A 1H50A 3W6LA 1KM2A 1X6LA 4RXFA 3KRSA 2EQDA 4ECLA 7REQB 3B8IA 2GGEA 3APTA 4IFOA 1HJUA 4ICNA 1TPWA 4US5D 2Q02A 1P6BA 3RPTA 2UWFA 3TJ4A 3DFQA 1XC4A 3EWXA 3MKKA 4DO4A 4Q4KA 2GK1B 3ZYZA 4WHBA 2WCAA 4MSSA 3S4TA 4E8GA 3R11A 4RX0A 2E5BA 3S2JA 3VNYA 2QCGA 5HDRA 1H5YA 3NA8A 3C61A 2C18A 1W1IE 2WVVB 3NM3A 1HP4A 3THCA 1VC4A 3SJ3A 3MCNA 1F4HA 1O5KA 4AFYA 1WQ5A 4MPKA 3LCIA 3EXRA 1I1WA 3I6RA 3GW3A 3WK0A 3HPXA 3BICA 4MFDA 2ZXQA 4LAOA 2PS2A 3VMNA 4C6KA 3PB0A 5D33A 1VJZA 4C1NB 1L2UA 4JKKA 4JQ1A 2A6NA 2OQLA 4OT7A 9CGTA 1D8CA 4FPSA 4EWJA 2PDUA 3MDWA 3TYEA 4MJ2A 1XLBA 3TYAA 3LCHA 4MDOA 3JVAA 4MNKA 3GNXA 3BURA 3KOYA 1MZRA 1ZCOA 5I7GA 4KCWA 1W3JA 1N82A 3OYZA 4HOXA 1P7TA 1XYMA 2X2GA 1V3IA 4AWUA 1EDQA 1IQ8A 2QDGA 4BI7A 2V5CA 4Z0JA 4ZQMA 2Z1KA 5H8MA 2UV8G 4LV9A 5B7ZA 4G7EA 4ENLA 3UT0A 2QJIA 2CLKA 3Q4DA 3OW1A 3WLIA 2BHZA 5G2IA 5DMLA 4QDMA 1TPB1 2Y6ZA 1KWKA 3VGFA 3NUKA 3SDOA 2ON3A 3PG9A 2OLHA 2G37A 4O0KA 1HKVA 3ZR4A 4O1DA 3RU6A 5CPMA 5I3DA 4OBRA 4OV4A 3KL3A 4M7TA 1IZJA 4H9XA 2BVTA 5KZ6A 1X8CA 1GVFA 3TR9A 1EP1A 3HTWA 2VX7A 4J3TA 2QVHA 3REQA 2WSRA 3C2RA 1UWSA 2A5HA 3GU2A 4PA8A 2TODA 2AMXA 5D2WA 4CCEA 4GI6A 3OLGA 2CYGA 4XV0A 2FJKA 1CGWA 1XKJA 2WB5A 3KBWA 4JFUA 3OA3A 5BCAA 6REQB 1V3HA 4PTXA 3P81A 3ABZA 3KVJA 1RR2A 4F8XA 1XUZA 3W74A 1XCFA 4Z0SA 3DHDA 5LXEA 4LF2A 3WLNA 2YPIA 4HPGA 1ZB5A 3L4YA 3HU7A 4C7GA 4CCCA 4UNKA 1VJIA 4XK2A 2Y5JA 4L4MA 1EHNA 4IFKA 2XZ7A 3VIMA 1BQCA 1VCFA 3IIPA 1XISA 4WKHA 3F1QA 1CWYA 3HV8A 2A21A 4J3VA 2G3NA 3WFZA 4ML4A 3OLEA 1EUNA 5HJLA 1YQ2A 3RM8A 1TWZA 5I3IA 5CKSA 4PUMA 2XIOA 2P88A 3GIYA 2DFAA 3LZ5A 1MYRA 2C1GA 4YVVA 3A22A 3U7BA 3MSGA 2GZXA 3NZPA 3OVRA 4LALA 5DFAA 2GUBA 2ZXAA 4X0VA 5ECUA 1M5WA 3NDZA 3H53A 2I5GA 4B3KA 5B80A 3H2OA 3N73A 1JF5A 5JU6A 3DENA 3PJWA 4GY7A 3F4VA 3O6CA 7TIMA 1V7AA 2C1HA 4AD3A 1DP0A 4NZ4A 1ZGDA 1B1YA 2WJDA 3FN9A 4KF1A 4FLQA 4RUBA 4DNMA 2RKXA 2PPGA 2FVKA 4DYKA 4WEVX 4PC8A 4IFRA 2GWNA 4IF2A 2VVNA 1QAPA 4JAWA 2ZTKA 4Q3MA 2D73A 2OWWA 2A3EA 5CSSA 1BTMA 3LMYA 3WLMA 3QMTA 1JPKA 4PRTA 3SRFA 1TTPA 1D3HA 3PVFA 4DBWA 1C8VA 4HJFA 4Q8NA 4HPNA 3SAZA 1UYQA 3WEOA 5CEWA 4UFKA 3W72A 2E9MA 2WNZA 2OB3A 1JZ4A 2IKHA 3PUDA 1YKWA 3LV6A 4IMAA 4JKMA 3W1UA 4TVDA 3NL6A 4JKLA 2HK1A 3N2CA 2G3FA 2QS8A 2EF9A 2INZA 5F2IA 4ADTA 3OIHA 1U1HA 5A6MA 3VKJA 3QHMA 1S2AA 3TN6A 2OR2A 2XVNA 1XIHA 3DFTA 1EWEA 4LBUA 2FGBA 1A3WA 1XFBA 5CSUA 3PJXA 4FB7A 2FMNA 1K70A 1RK6A 2E5DA 1ADOA 4ZE4A 2VXNA 2ZX8A 4CD7A 3R2GA 2EPOA 3M5XA 3WQVA 3UPWA 1HF6A 5C9UA 5CZ0A 2D24A 1QNSA 1JRBA 3QPYA 3AROA 3O05A 5F1VA 5LIYX 1E56A 1UZDA 4ZODA 3WJYA 3IJIA 7ENLA 1J0KA 4IP7A 3VIOA 3CL6A 4WF7A 1GTEA 3GZAA 4N4QA 4X9YA 2CIPA 2Z7GA 5T9BG 4QM1A 5HWMA 5AC4A 3P67A 1XRFA 2PDFA 3ITTA 1AD1A 3HMJG 4H8HA 3UWVA 1UWRA 3EKZA 2IKIA 3CB3A 1E0UA 5IHRA 5CGQA 1ZPTA 6ALDA 5LYRA 1O95A 3PZQA 5JVLA 1W1VA 3S2CA 4HD5A 4FNQA 3GVGA 5FOOA 3LHWA 2YCLA 1K9DA 1EA9C 3GE7A 1A5SA 3ZT5A 4AZ7A 3ABSA 1U1UA 2XSXA 4DELA 3P0XA 4EK7A 4XVEA 4PMVA 4BWLC 4NUWA 5AKQA 2XISA 3A9BA 4YTTA 1ENUA 5GVJA 1V6XA 3ONBA 4W9TA 4RJEA 4GKTA 1RP8A 3C52A 1LZOA 4UFJA 1FWJC 4F9DA 2Z1WA 3GTNA 2BFGA 4CNPA 2WMHA 5FJOA 3SQMA 4HSNA 3WQPA 5BXRA 2BMBA 3K5XA 3N6QA 2W92A 4P7RA 3ZVHA 2Z2UA 1R3RA 2A0NA 4XX6A 1LJYA 3AS2A 1V0NA 1SMAA 2WM0A 3NTYA 3LXBA 1W1PA 2PCQA 3STFA 1TTJA 4HGXA 1OCJA 1REQA 2J74A 1FUYA 4XZHA 1JZ6A 3SW6A 2VHLA 3I4KA 3PZOA 5AHIA 2QNEA 4C6JA 3K4WA 4FNSA 3QHNA 5G4WA 2ZZ6A 3WBXA 4ZR8A 1ALDA 5ABFA 4FNPA 1BSLA 4CEUC 1PIGA 3CK5A 3OZOA 1JYVA 2EHHA 3SRDA 3W1QA 4FIRA 4XTIA 2HJPA 2DSUA 4S39A 1DWAM 2VEPA 3CL7A 3OZMA 3GDBA 1KA9F 3VOCA 3EKGA 3VVGA 4O12A 2WNWA 3UXKA 4FXSA 3T7VA 1HVXA 3NZRA 4FLOA 2VP8A 3AO0A 4J4KA 3QYQA 5K4ZA 1KWGA 3CV1A 3CQIA 3BAYA 1EC7A 3O8AA 3DC0A 4IG2B 1PX4A 1H09A 1SYTA 2ZUTA 3AISA 1W1A1 3KOWA 2VI0A 2TMDA 5C54A 5BXSA 4I9AA 2AMGA 1XW8A 3UA4A 3LQGA 3WLSA 2JALA 1ODZA 1C92A 4HNOA 5MKGA 8CGTA 4BK9A 3PFMA 1G01A 1HTIA 4JHZA 5U4NA 2WJFA 3JZUA 3CU2A 2ZRVA 4JTRA 3T44A 5IXEA 3L4WA 4BFAA 3GH4A 4PUNA 3EX6A 1EC9A 1B9ZA 4DWSB 5J5DA 1M6JA 1FP8A 1OG6A 2WSQA 1OG0A 3C2FA 3S47A 3W25A 1LTDA 5BMWA 2J9ZA 1IZCA 1QCWA 3EPNA 3KBJA 1UROA 4DJEC 3I65A 5I07A 5LNSA 2PF8A 3DAQA 4PRRA 1CPUA 1H7XA 1CCWB 1K8XA 3HQNA 4R7OA 3FS2A 4DLFA 4ZQNA 3VKKA 2PUZA 1OYBA 2ZFAA 1UJPA 3R8RA 4B3LA 3NO1A 4QSHA 1D3GA 1TV7A 4JTUA 3PANA 1U5VA 3TAOA 4PN2A 4QE1A 1WBJA 3V0UA 2CHRA 4JIQA 3BGGA 3SZ8A 3W02A 3ZZ1A 2X7VA 3ABOA 1UIPA 4LF1A 1I45A 2PDMA 4O1BA 3UG8A 1DJZA 3KRUA 1HL2A 2GQ3A 2Y7FA 4O53A 1M1BA 3IJ9A 5F7UA 1XYCA 3WQFA 4MADA 2IXUA 2G8ZA 3AJXA 1W9XA 2VGFA 4DJFD 3PUGA 2PWUA 2VC6A 1D9EA 3ZJ8A 2RDWA 3O07A 1UKSA 5L9FA 1KFWA 3NO3A 4LUTA 1W5OA 4GIYA 1EHAA 1SR0A 1UZ4A 2QDEA 3BARA 2F8QA 3UBPC 4PUJA 3BLIA 3VCCA 1QPNA 2DUZA 4PYSA 1XRTA 5A6JA 2A3LA 1JIBA 4OVXA 1HN1A 4GYKA 4K2SA 1T96A 2Q09A 1B0IA 1GNXA 1XYBA 3W1LA 2C7FA 5HWNA 3ABRA 3I6EA 3FGCB 3LOTA 2G41A 5AYYA 3K4AA 5KITA 2O4MA 2A3HA 3SUWA 4FEZA 1LL7A 4YS1A 3WQGA 3B0XA 4ORMA 1K4GA 2IPJA 3LCGA 2BDQA 3ZVIA 3K46A 3ITVA 1F2JA 4Z2KA 2OO0A 3BLPX 3OVQA 3TWBA 1QHOA 3MP3A 2OCZA 3W2UA 4XUYA 1E0VA 4AEEA 4ZOEA 4FS9A 3TVAA 5CH9A 4EWND 1DJWA 1VHNA 2R91A 3LPGA 3LXAA 1HW6A 3GNRA 4LBSA 4ZMGA 1XKYA 2CWNA 4P5UA 3S3GA 1XHGA 3W1XA 3C3UA 3PTKA 4R85A 2PC8A 4HTBA 1F7BA 1CIUA 1EJRC 2PDGA 4WDXA 1TJ2A 1RXOB 3SO7A 4IJBA 2WLYA 5C9XA 3PBGA 5D04C 1PKLA 2YBTA 3Q65A 3P80A 3DFPA 3EA1A 4EIVA 4WY0F 5FEPA 3BLEA 4JXCA 4F66A 4GXPA 4JNYA 4WXZA 2Y8UA 2DZBA 3ZJ6A 4MFEA 2C0AA 1CNVA 1XSIA 1VBGA 3CPUA 2QDDA 1HZYA 2VX6A 3LG3A 1XIMA 4JYDA 1GKRA 2BY2A 2J7BA 5K9XA 2GUUA 1QNVA 3R12A 3QN3A 1TWDA 5AHLA 3SCVA 4HNUA 3LSBA 2VFGA 2DEPA 3H23A 1QNOA 1J0YA 1KM3A 4TQTA 5JBFA 3WY1A 4I7UA 1YIXA 2FZBA 1C8QA 1JULA 1EPVA 1GZGA 1GG0A 3WQ6A 2RDTA 1A50A 2DZAA 4PUEA 1WBHA 3UXLA 2E6YA 3FAXA 3RXZA 4XZLX 2DIEA 4PCTA 3W76A 4DXXA 5CSRA 1R87A 4EACA 5GNYA 4F48A 1B30A 4AHQA 3K13A 4KMQA 2WHJA 4C6FA 2JQXA 4IGMA 4TU1A 1XLDA 1R3QA 2X05A 1ZU8A 3ZMRA 2IPWA 2VGGA 2GSEA 2VC5A 3TP4A 1RY8A 1G4TA 3TC3A 3WDHA 3S2NA 3UJSA 2VC9A 4RE2A 4FHAA 3HG4A 1XCWA 4PCSA 3CJPA 4MM1A 2JGYA 4A05A 1RZMA 1XR2A 4W88A 3GR4A 3ITYA 3UR8A 3QR0A 1FVPA 4FZIA 6TAAA 1QI0A 1NWRA 3UXIA 3OVPA 5K4XA 3QV7A 1LWHA 1U1JA 3WD0A 3MT1A 1J4EA 1MNSA 1VR6A 4ZQRA 3SCTA 5AZ1A 4D6EA 1VCVA 3TTOA 3FV9A 4W5ZA 1F76A 3K4DA 3TEVA 4X2RA 2MANA 4NAFA 2IQTA 3RGTA 4YTSA 2W9MA 3AXXA 3NIYA 2EBNA 4U3AA 2DJXA 5FEWA 1OADA 3B9NA 3NZGA 1OF6A 2VD8A 3UU0A 1ML1A 4ROQA 3KS6A 5TNVA 1CXFA 1GONA 3CQJA 2A3BA 4A3HA 1MDRA 3H55A 1G9HA 4YHGA 4FA3A 1LLOA 4XD6A 2PE4A 1HGYA 4GQGA 1CXEA 4DUOA 3WNOA 2VWTA 1SW7A 1UH2A 3AHYA 1WUFA 5AECA 3SCPA 1J93A 3DI0A 4AMCA 3AU2A 2A4AA 4Z2HA 1DJIA 4C6DA 1K03A 2DV0A 1TUFA 1VHCA 2H6RA 1EGMA 4POCA 4UIOA 3OBAA 3SCWA 3U0HA 5JH1A 2A79A 4JX4A 4H83A 1A0CA 5E70A 3TN3A 4PEKA 2R1MA 1DEDA 2C16A 1UWUA 1FWNA 3ITXA 4TR9A 2NX9A 3BGAA 1PXGA 3DG7A 1S5MA 3VGDA 2W4XA 1AA1B 4P2VA 2B4GA 3CUIA 3URAA 3L4TA 1SUXA 2D23A 3S6DA 3IGSA 3RX2A 1C9WA 5I03A 3NM1A 3RNDA 1Q7ZA 2V5KA 3GS6A 1UIOA 1EF2A 1PPIA 3FJ4A 1ISZA 3C8NA 4NJGA 4XKYA 4GFSA 1YDVA 1IXPA 3M0LA 5DY3A 1AFSA 1FDJA 4BQ3A 1OC7A 5CQ1A 2VMFA 3IARA 3JU2A 5G1MA 3UWUA 3W7CA 3W07A 3BQ6A 4GUJA 1NTHA 4OIFA 4C6NA 2E5CA 4L80A 1X7IA 1BWLA 3AUOA 1YNYA 5LXXA 1SO3A 2VZSA 3LRKA 3KTCA 4U2ZA 4LQ1A 1ZJHA 3MDUA 3FYPA 4UZUA 3WH8A 1SZGA 1BFNA 1ESWA 3BW3A 3E96A 3WQ8A 3EBVA 3LYEA 4YCOA 4P8VA 2BVYA 1JAKA 2WAGA 1CGVA 2OT0A 2G3IA 4MYXA 2NUWA 3OGRA 1V8EA 1H7OA 3ME3A 5FJPA 4Q4QA 4AMAA 4AHOA 4DJDC 3D46A 1Q7QA 1MRQA 4PTMA 1QK0A 1FWRA 3VM7A 1CBGA 3L21A 4PTNA 1EIXA 1EH9A 4BJHA 3FVDA 3LSCA 3KW3A 2YCIX 4I5XA 3WSUA 3W7MA 4Q8QA 4IPIA 4WCJA 3IS4A 4XB3A 3AHTA 2QXWA 2NUXA 3PSWA 7REQA 5HOSA 4I5RA 8RUCA 1Z69A 1GQJA 2WYSA 2HE8A 4DUVA 4INFA 1BG4A 2FLIA 3IV3A 2PF0A 3PC0A 4P8WA 2PDYA 4KERA 4UOZA 3CEUA 4PTDA 1JCNA 5K7JA 1XC6A 1H61A 2Y5EA 4E2DA 3KVLA 2GK1A 3VKBA 3UPBA 3LM3A 3RRXA 4PODA 1NEYA 4HU4A 1HGWA 4YJ5A 4HPHA 1TVLA 1A5LC 5A8GA 3L67A 4GVHA 1C3FA 4H3DA 1QR7A 4G5DA 1M7JA 2VURA 3SB0A 5K3VA 3QGVA 3CWOX 4AD4A 3B0YA 3T09A 3ISIX 5KZMA 4ZTXA 5I78A 4TTUA 1V93A 4NT0A 2WO5A 4IPLA 4HPXA 3EX2A 1VZWA 3KRBA 3NQBA 1SFTA 3HJEA 4GC3A 1XLKA 2HPMA 2O7QA 2GOUA 4QCEA 4JFWA 4LU0A 3EB4A 1RPXA 3EX3A 3TLQA 3JUGA 2J4GA 3UZYA 4Q8PA 2VFDA 3P82A 4AX7A 3V35A 4PCNA 2IQ0A 4CEXC 1R9XA 3PAJA 3H2EA 4O13A 5RUBA 1V03A 2QQ6A 3CAQA 2Y2WA 2XSBA 2A7NA 2IQDA 4N4PA 4TVCA 1BYCA 2HEJA 1KXQA 4WD0A 1EJTC 2O7SA 3WN6A 1KO0A 3N2OA 4BA0A 1E40A 2VRJA 3B8VA 3MI2A 1J10A 1CXIA 4OBTA 3K8KA 3HM7A 2FHCA 3AHVA 4KWOA 3MUY1 3GAKA 1MXSA 5DQPA 2EPMX 4JL1A 3NVDA 2ZICA 5JBEA 1D3CA 1THFD 4AZIA 2WZMA 3MCMA 5CC7A 3QMSA 3FKRA 4MAZA 2Y4SA 1H62A 2PP0A 3OP2A 3R13A 3VDHA 2ZX5A 1HO1A 4XAZA 5D02A 2UY2A 1PCWA 1IWPA 1BSIA 3BXWA 2X0SA 2CKRA 2WC4A 1XPGA 4GZ7A 1KRCC 2J25A 2ALRA 4IPPA 4M6PA 5GNZA 3DFSA 7PTDA 3F2DA 5EB8A 2P53A 2IKJA 4TOQA 3CHFA 1CI1A 3H22A 1DPMA 3OZPA 1EIBA 3IVSA 3TNOA 2GSHA 4WSKA 3PK7A 1SQ7A 6REQA 3W7QA 3W1TA 3JS3A 3TE9A 5CC5A 1JXKA 2YB4A 3LPPA 4HCDA 3ANVA 4ZOCA 2HBXA 3VTRA 3EGJA 3N4EA 1X98A 4UNIA 1TTQA 3HPSA 3K30A 2PZ0A 2PD5A 2X1TA 1UR3M 3VD3A 1UR4A 2P3ZA 4KCUA 2FTWA 3CC1A 1DV7A 4HYWA 1IR1A 4FX8A 3TH6A 4PEEA 3LI1A 3GD6A 1E0TA 5SWUA 1LBLA 2PLKA 4KWSA 3A4JA 3GVQA 5BRPA 2ZVRA 2WWCA 1V7YA 2PWHA 4HNVA 2CLPA 6A3HA 1PAMA 4IH3A 3AIBA 2E77A 3S1VA 4AQLA 1AK5A 2ZZ2A 5J8LA 3GWQA 2PWGA 1Q45A 2XIMA 4W7WA 4LVAA 4LVGA 2V2DA 4UFIA 4PMUA 2VOTA 4IIBA 4LEQA 4GGBA 3ZR5A 4DXKA 2HPIA 1GOMA 1FWAC 4GWEA 4WJ8A 3A5VA 3P5ZA 3PUOA 4GGHA 2XFWA 4RPPA 1AL8A 2TYSA 2DZSA 4YIWA 4ZFCA 4C6IA 1XBVA 1YADA 5D9OA 1TPUA 3VNDA 1OGSA 2V67A 3N9KA 4FX7A 3WKZA 2ZE3A 3ITOA 4LWWA 5I24A 5TAOA 4UTTC 4WK9A 2VR2A 1HKKA 4HMDA 1MWOA 4Y9NA 1QWKA 4DIAA 3UXDA 4TO8A 3GO2A 3P93A 1XLMA 3BCDA 3JR2A 3MO7A 1IXOA 3FK4A 5HK4A 7TAAA 4LAMA 4ACZB 3B8SA 4EXQA 2CZEA 3VIGA 2PGEA 4JFSA 4ERAA 3G6MA 1UR2A 1JYNA 4B4FA 1W5QA 2YLAA 2WZTA 3NQEA 1DL3A 3QV8A 1TMQA 4AXNA 3P62A 1GVQA 2Z7KA 1UZ1A 4I7VA 4L6DA 5M03A 3VIFA 3GR7A 1BYDA 5AHMA 1JPMA 1QXLA 3MUAA 5DXXA 3UWQA 3ELFA 4LS2A 4G1NA 3NG3A 2NV9A 4TTGA 1PHQA 3G5EA 4PSRA 4H01A 3ONCA 1ZS2A 4UR8A 3WQ4A 1JCYA 1NWUA 1BD0A 3WUFA 3KBNA 1KTNA 1WXYA 4MZ8A 4GC4A 2QULA 3SFKA 1KRMA 4M81A 4CQDA 5BXTA 3GHTA 3LNPA 1I2QA 4LVBA 5CLTA 4RK8A 1ODUA 2Z2AA 2Y1HA 4ZO9A 3CH0A 4GFIA 2WZEA 4WLCA 2HWGA 2NZLA 4REQB 4KEVA 2R82A 6CGTA 1TPFA 4O54A 4KWUA 3SGZA 4IJRA 1G4SA 4FNTA 4O57A 3H2FA 2V81A 1RJPA 3G2GA 1R86A 3NJ3A 4B5XA 1OINA 3WIJA 3A47A 2VR4A 1TZ9A 2V68A 1U2YA 5C9ZA 2ZCGA 3ARYA 3EDEA 4YU1A 3UNTA 2PTDA 3W26A 3N2BA 3H24A 1SO5A 3IJ7A 3A6OA 4XD3A 4GABA 2D0HA 2X30A 1IEXA 3ALFA 4YWIA 3VAVA 3DN5A 4XAFA 3VGGA 4DPPA 3R0DA 1E0XA 3U2OA 1OSEA 3RUBL 1OFDA 2Z00A 2PTYA 4L56A 1XGEA 1VGAA 3VFLA 2NVAA 4NYUA 1EQCA 5A8PA 1GPFA 3KCOA 2NSOA 1FP9A 1WDPA 3P5YA 1E6RA 1FXPA 4Q8MA 4C5ZA 2VZOA 4YMZA 1DXFA 4BZYA 4DI8A 1VYSX 1FCVA 1BXCA 3UERA 1BEUA 2I56A 4GY0A 1F6PA 3QV9A 1DJXA 1VPXA 3V75A 4L4LA 4U31A 2G4FA 3NYDA 4N6EA 1QATA 2WNQA 4KPLA 5TIMA 3GNOA 2UZ9A 1JDAA 4Y96A 4AIBA 3W73A 2REQB 4MOZA 1XCXA 4GQRA 4CN4A 3GBDA 1R3SA 3NDOA 1E4IA 1FH9A 3TOPA 3CUXA 1KXTA 2V2HA 1WKDA 1UQYA 1OD8A 1NF0A 2XSAA 3MHFA 4L6OA 4OECA 3PJTA 4K8GA 5DY2A 1XI3A 4CCDA 4OQVA 3M16A 1XLEA 4JQ4A 2G3JA 4N6FA 4HT3A 2B7QA 4DXVA 4BEUA 2H3DA 2I5IA 1T8XA 1HXJA 5REQB 2V2CA 1VJSA 2POTA 2HRWA 2NWSA 1MW3A 3UR7A 1C7TA 2C3ZA 2Y88A 4CCZA 3BSMA 4U4MA 4LY8A 4HU0A 2F6XA 4GQ0A 5MHBA 4GZEA 1GVOA 1EPXA 4B5VA 4IG2A 2ISFA 5EMMA 2RH9A 4UOQA 5A8QA 3TQVA 2AAMA 4O1AA 2OX1A 5FF7A 3LCWA 1KW1A 4J27A 2BASA 1VD6A 4K38A 4LYPA 3VK5A 1TZZA 4DWSA 4TX9A 4IX2A 4LRSA 3HGJA 2NWRA 1RSCA 3GNNA 1F8MA 3IUHA 1S1RA 2FZMA 2OLAA 3GVWA 2PDIA 3BWWA 3RPMA 3WENA 3BG3A 4DB7A 1PX8A 4B5SA 5AN7A 1VAHA 3W85A 5FJJA 1SJBA 3E0LA 4U3CA 1TMLA 1R3TA 4W89A 1FWCC 1E6ZA 3L4UA 3IV8A 4JL2A 2L5HA 2QCDB 1NOWA 3C56A 3TC6A 3NSMA 3GC5A 1JF6A 4GVFA 3GVRA 3C0QA 4WSJA 2NVDA 2DT2A 4JN6A 3W7EA 3VDGA 1WZMA 5DANA 4C6QA 4FLSA 3ZWTA 3G8EA 1QOXA 1V6VA 3FA3A 2BB0A 3Q37A 4FXJA 4HK7A 3ITGA 4GYFA 4PMJA 1UH4A 3V1HA 4OOUA 2XM2A 4DO5A 1DJYA 1EJSC 3G24A 4F0SA 3V3WA 5CG0A 3H7VA 2PC4A 4PUWA 5AYBA 1QPOA 6TIMA 5I5RA 3IVTA 1XYLA 5FJRA 3FX4A 3TYDA 1YTEA 2PDBA 5KETA 1CGXA 5CCZA 3P8IA 1AQFA 4DYEA 1H60A 4R7JA 3R7MA 3LTPA 2FH8A 2NT1A 2FYMA 3PAOA 5HULA 1QOPA 2Q8ZA 4GJJA 3S46A 4R7WA 3JW7A 3MUZ1 2X41A 3NQCA 1TELA 5KTLA 3CTLA 4NJIA 5TD4A 4GI4A 2XZ9A 1KQYA 2Q8XA 1ZRQA 1TTIA 5HXMA 1EC8A 3UY8A 3MSRA 1VIZA 2EG7A 1TV2A 5HAOA 4A3RA 3S1WA 3FHAA 4UC5A 4AISA 4FI4A 4G9PA 1GOWA 3GDTA 2VCBA 3KDOA 5IDIA 4WRHA 4OU1A 4OWGA 3APYA 3KAOA 3TN4A 1R85A 4XSLA 5A94A 5GQBA 2XHYA 3VC6A 3XINA 1Y8BA 1W9VA 4S3GA 4JTFA 1RPKA 3S9YA 2DDXA 3DKJA 1W31A 1FFQA 5A8MA 3RK8A 4E8CA 5CAKA 3ARZA 4C7DA 2F38A 2HVOA 3IGHX 1HJWA 3SRKA 2ZUVA 1CEOA 1RD5A 1YHTA 3ATZA 3IIVA 3NQ6A 2CERA 3HQPA 2DT3A 3ID7A 2XN0A 4PUUA 1V77A 3FA4A 2QF8A 3S2LA 1CLVA 1WDSA 2C1IA 3TW6A 1FDYA 4LFYA 3GDRA 3SQSA 1M03A 2PU1A 4O0QA 5G5IA 4JEJA 2G95A 2ZYFA 1VBRA 1D7KA 3QKEA 1H3GA 4YTRA 1TKKA 2QV5A 4K3ZA 3UGRA 4MJMA 2R94A 1XIGA 3G77A 1O94A 4GUHA 3WQCA 1NAL1 4UB9A 1UQZA 1DJGA 1L0PA 3MBFA 3BL3A 4ATWA 4K6AA 4UCGA 4J9JA 1Q7MA 2DVXA 4S3FA 1V51A 1I1XA 1XINA 3P74A 3PPFA 3O1NA 3B0PA 4QFUA 4DAIA 3IJQA 1GZ1A 2DZUA 3THQA 1JZ8A 2MUCA 1AW5A 3DG6A 3VIJA 2WANA 4LTSA 2DIKA 5EMYA 1FH7A 1P48A 3QJAA 1VEMA 2UBPC 3QVQA 1O1ZA 4N0RA 3EWUA 2AQWA 2DVUA 4LB4A 3U8GA 2GOKA 5HNTA 2ISSA 4XQ6A 1XBZA 4UNLA 1H1YA 4QAWA 2WC7A 2QUMA 4RLIA 3RM9A 4L65A 3GY1A 2DT1A 4GACA 1DE6A 4AEOA 1YLVA 2FPYA 1H5VA 1MXGA 4QLJA 4BF5A 1VCGA 2BS9A 1GYNA 4XZ9A 4M3PA 1Z41A 3SCSA 4ZB0A 1A0EA 3NXLA 1PKNA 3HIJA 4WJXA 2NX1A 2XUCA 3M0MA 5HUPA 2OELA 1PTAA 3QH2A 3NDYA 1ZBVA 2PBOA 4GBDA 3TC7A 4LV4A 3MJMA 2J24A 5C55A 1NFGA 3FOKA 4DJDA 4F0RA 4J28A 5KMYA 1QDSA 3GXMA 2XIQA 3C3NA 4HK5A 4LAUA 3WD2A 2OWCA 4XZIA 1E3ZA 4O28A 4P7OA 3O0FA 1PIFA 4YTUA 1O5QA 3SJNA 1ISVA 3M4HA 3QPZA 4GNKB 2R1KA 4DX3A 1K6AA 5D9PA 4JTGA 1TIMA 2E7FA 4KEZA 4C6OA 4ZO7A 1GHSA 2CLIA 4EPKA 3R5EA 1XH0A 3K8MA 3PJUA 2NUYA 1XL9A 1IEIA 2FPVA 1EWDA 3WJXA 2DSKA 4CNNA 2V3GA 5EMLA 4UR7A 2BHYA 3MP4A 1HKJA 2QCMA 3SCUA 1JZ2A 1XICA 5M3WA 4QNWA 4Y8FA 4MAVA 1EDTA 2ZE0A 4AVOA 4Y7EA 3RO8A 4DBUA 4KQNA 3GHSA 3N17A 3AU6A 4XD4A 1X1OA 3R43A 1KTCA 5JMUA 1YMYA 3GG7A 5FKYA 2OQYA 3NQAA 1CXKA 3CQKA 4ZOBA 3R8GA 3T08A 4RCXA 2PMQA 4N02A 4C1KA 3D3FA 3CLMA 2BY0A 1C90A 1YW1A 5D09A 4Z2LA 5ABEA 3TX9A 1VPYA 2XJ7A 3FJ6A 3NAVA 2PD9A 3LXCA 3HB9A 3HO8A 2E6DA 4WOZA 1GEQA 4MUPA 4ZZ9A 1PSCA 5A6BA 5CJMA 1XLFA 4FALA 3QYSA 1U30A 4GQQA 3TYCA 4O0ZA 2HDJA 3GU9A 1TPC1 3C2OA