4C6FA

Crystal structure of the dihydroorotase domain of human cad bound to substrate at ph 6.5
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
364
structure length
363
Chain Sequence
KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DIHYDROOROTASE
total genus 119
structure length 363
sequence length 364
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6fA00
4H9YA 1WXYA 4BY3A 1FWEC 3IRSA 3LY0A 4OFCA 4C6NA 1UIOA 4J2MA 3AU6A 4QTGA 1EYWA 5AKQA 3GRIA 1EJTC 2ZC1A 3TN5A 3HM7A 2PAJA 3EWCA 1YNYA 2QVNA 1V7AA 1UMLA 1P6CA 4EPDC 4V1XA 2Q09A 3LU2A 3OQEA 3S2MA 3F2BA 1KRMA 4BKNA 1GKRA 2ADAA 5FSDC 4XD4A 2VHLA 3GG7A 1NFGA 4HK7A 2EG6A 1FWJC 3MKVA 4IFKA 3UF9A 1NDVA 3UPMA 4Z42C 4L6DA 3TN4A 1ITUA 1FWIC 3TNBA 4DIAA 3E74A 4DNMA 1XRTA 1FWHC 4KESA 1A5OC 4KF1A 3DUGA 1RJQA 1FWDC 1A5NC 2OOFA 2DVUA 4HA0A 2GZXA 3EGJA 4PE8A 1FWCC 5FSEC 3GTIA 4C6BA 2P53A 1V79A 4IH3A 4KERA 5E5CA 3URQA 1M7JA 3RHGA 2F6KA 4KETA 2AQVA 1IE7C 2VUNA 3WYZA 1R9ZA 2Y1HA 4PBFA 3ORWA 4B91A 1ONWA 1J5SA 2O4MA 3UR5A 4LCSA 3QGAC 3MVTA 4LH8A 4LAMA 4WVXA 3A4JA 3N2CA 1PO9A 1PSCA 4RDVA 3G77A 2Z2BA 4NP7A 3GU9A 1EJRC 4XD5A 4DLFA 1KCXA 2GSEA 3PBMA 3C86A 1POKA 4R7WA 3AUOA 3ISIX 1P6BA 4QROA 4LALA 4IGMA 4DLMA 2P50A 2EG7A 4RDYA 4ERIA 3E38A 3LA4A 4NG3A 3K2GA 2R1MA 2PUZA 3FDGA 1V4YA 4IFRA 1R9YA 3IV8A 4KEVA 2W9MA 1JGMA 3E0FA 3F4CA 2GWGA 1BF6A 2I5GA 3PANA 4GZ7A 3RN6A 1RK6A 1GKPA 4H9VA 4HK6A 1XRFA 2RAGA 3CAKA 1A5MC 3LS9A 4C6OA 1M68A 1EJSC 1RJRA 3MTWA 3FEQA 1E9ZB 4XAFA 5LXXA 4LAOA 2Z28A 3WZ0E 3NURA 1UBPC 4IF2A 4C6MA 1E9YB 1FKXA 4G7EA 1KRAC 4QS6A 4HK5A 4GYFA 2VC7A 2Z4GA 2YB1A 1FWBC 2HNHA 2R1LA 1GKQA 4ZSTA 4M51A 2BB0A 4RZBA 3TN6A 4D8LA 4C6KA 4GX9A 4IFOA 2D2JA 4KQNA 2WJEA 3LSBA 2EG8A 4H01A 4CQCA 2VR2A 3GTXA 3QY8A 1O12A 2PGRA 3KM8A 2Z7GA 2E25A 1J6OA 4IFKB 3AU2A 4C6JA 4H9TA 1ITQA 1K1DA 1KRBC 3EWDA 3IGHX 2AQOA 3B40A 3B0XA 2ANUA 4IGNA 2HPIA 4EPEC 4BJHA 1DPMA 4GK8A 3HPAA 4EP8C 3URAA 2QT3A 2R1PA 1NDYA 3MSRA 3HTWA 1RK5A 3RYSA 4L9XA 4GY1A 3T8LA 4IQJA 2FTWA 4EPKA 1RAKA 4V1YA 4XAYA 2UBPC 2I9UA 4C6LA 2OODA 4C6EA 3S2JA 1XGEA 4C6QA 3ID7A 1M65A 2KAUC 3JZEA 4LFYA 3RCMA 3URBA 4DI8A 3IPWA 3MVIA 2GOKA 2Z27A 1ADDA 2HQAA 4GBDA 3GUWA 2GWNA 4GX8A 4DZIA 3WMLA 4XAGA 4UB9A 3F2DA 3QY6A 2OGJA 3S2NA 4INFA 3LSCA 4R88A 4QRNA 1K6WA 2R1KA 3MDUA 4LCRA 1J79A 2PLMA 4H9UA 4XD3A 1PB0A 3E0LA 4CEXC 4F0RA 4DYKA 1J6PA 3GIQA 2Z00A 3O0FA 2D2HA 3UR2A 4ZSUA 3S2LA 2OQLA 5HMEA 4R85A 4ERGA 1A5KC 4CEUC 4G2DA 3SFWA 1O5RA 2Q01A 4YIWA 1FWFC 1YBQA 3ICJA 1V77A 3OJGA 2E1WA 3PNZA 3QGKC 4C65A 4J5NA 4TQTA 5A6TC 3V7PA 1QXLA 2XIOA 4I6KA 4GC3A 4PCPA 3GU1A 3DCPA 1A5LC 2QPXA 2A3LA 4C5YA 2DVTA 4IG2A 1RA0A 3NQBA 4G7EB 4GOAA 5G4HC 1FKWA 4C5ZA 4H00A 3S4TA 4H9XA 4E3TA 1VFLA 1EJWC 3BE7A 1A4LA 3URNA 4QSFA 2YB4A 4XAZA 4CNSA 5HMDA 3MPGA 3PAOA 4WHBA 1YIXA 1K70A 4UBPC 4B92A 2DVXA 1EJXC 3DC8A 3GU2A 4GY0A 4LEFA 3O7UA 4C6FA 1A4MA 3OOQA 4P5UA 4C6IA 2VM8A 1EF2A 3OU8A 2FTYA 3SO7A 3IARA 3GTFA 1HZYA 4WGXA 2WM1A 1S3TC 3LNPA 1EJVC 4C60A 4LCQA 3T1GA 4EPBC 3F2CA 3NEHA 4KEUA 2G3FA 5CH9A 1I0BA 3PNUA 1RJPA 3GIPA 1XWYA 3UBPC 3ITCA 4JOMA 4J35A 2R1NA 4RDZA 2HBVA 2PGFA 4AC7C 4DO7A 2D2GA 4CNUA 3R0DA 1YRRA 3E2VA 4GXWA 3K5XA 3A3WA 4B3ZA 3IJ6A 1ONXA 2HBXA 2CZVA 1YBQB 5HMFA 3IACA 3TN3A 1EZ2A 1NDZA 2WJDA 2HPMA 4F0SA 4ERAA 4F0LA 1FWGC 1I0DA 2Z29A 4DZHA 2O4QA 1UIPA 1WXZA 2IMRA 3OODA 4IG2B 4QS5A 2AMXA 1QW7A 4KEZA 4C6PA 1R9XA 4RDWA 2FVKA 3E3HA 3CJPA 2ICSA 2VC5A 3D6NA 4H9MA 3QY7A 4GY7A 4CQBA 2Z2AA 3GTHA 4LANA 2BGNE 2YZ5A 4C6DA 1W1IE 2UZ9A 4B90A 1FWAC 4C6CA 2FFIA 4DI9A 1PTAA 1P1MA 2Z26A 4RE0A 1NDWA 1V51A 2OB3A 3CS2A 3LGDA 1EJUC 3A3XA 4ICMA 4KIRA 1KRCC 2Z24A 4LAKA 1ZZMA 4XD6A 2Z25A 3OVGA 3MJMA 4I6VA 1POJA 4H9ZA 4AQLA 3B0YA 4HJWA 4MUPA 4CNTA 2FVMA 3K4WA 3T81A 4NI8A 2YXOA 4PCNA 1RA5A 4PBEA 4CQDA 3FDKA 3LGGA 3F4DA 3MDWA 1YMYA 2QS8A 2WJFA
chains in the Genus database with same CATH superfamily
3FHAA 2Y63A 1OCQA 2C19A 2E5BA 5LGZA 4C6NA 1S39A 1UIOA 2D20A 1WX0A 3SJ3A 4PH6A 3GG8A 4AYGA 2HVNA 2J88A 3LHUA 3I7SA 5DQPA 1EJTC 4H1ZA 2QJJA 4ZQCA 4W85A 1MEHA 4I8DA 3PJTA 4MMWA 3ZIZA 3IJIA 3W28A 4UTLA 8TIMA 4CCCA 4F2TA 2W66A 1U30A 3F2BA 1V0MA 5CSYA 3VX1A 1GTEA 1RY0A 2QV4A 2VJXA 1WOAA 1HTIA 1B0IA 3GG1A 4FLOA 1R3SA 2I57A 5I3HA 1FWIC 1NIUA 1LG1A 1VIWA 4KESA 2ZWZA 4X22A 4S3KA 3HOJA 1JVNA 3BTNA 1H7RA 3BLPX 1DYSA 4UWMA 4BHYA 4M81A 3VKBA 1WAUA 3D5HA 1DIOA 1WQ5A 4IQLA 1RSCA 4PL2A 2F6KA 2OYMA 3CH9A 3FIGA 1WBJA 2XPKA 1O5KA 1C29A 1JR1A 1ZL1A 1J5SA 2RJGA 3B4UA 3BICA 3W82A 2CLPA 4YL2A 2GJRA 4E8DA 5EU9A 4JTTA 3ATYA 1R2TA 2IW0A 3OVRA 1K9DA 1RD5A 2W3ZA 3VVGA 4O13A 3GXFA 3FKRA 2DPEA 3BWWA 4LNYA 3UWWA 1CIUA 1PIIA 1QNPA 5E9XA 1CLXA 4XZWA 3RLVA 1A0DA 1TJRA 4W4QA 2XN2A 2OKOA 1IZKA 4MZ1A 3RDKA 5EA9A 1MRAA 5FJOA 4XO7A 4FF5A 2O9OA 3U6WA 1EJSC 2EHHA 1V3LA 4QITA 5CAHA 3FOKA 3L0GA 4XAFA 4QJ4B 3HQOA 4G7EA 4TVDA 1JRCA 3RPMA 3AIEA 4JEJA 1OEPA 5T9CE 2DQWA 1D8CA 1E4LA 1W3TA 3TU9A 1J9YA 3WQPA 4AWTA 2EF9A 4HN8A 1XQKA 2WJEA 4TV6A 4W84A 2VEKA 3OQ8A 4GCXA 3CHDA 3W6YA 4QLLA 1OYCA 5A6LA 1VC4A 1OYAA 3LMZA 4GJJA 5BRBA 2DZVA 1G01A 1P4CA 4HT3A 3VD4A 4JNMA 4M7SA 5G5IA 4MZ8A 5LIWX 4IQDA 4F66A 3FYYA 2FQIA 1KQZA 4MNLA 3LTPA 3R43A 4C6LA 4IJCA 2DT3A 5KITA 4ZCWA 1QNOA 3POCA 4TTGA 2CERA 1KCLA 1JPKA 1GEQA 3AQUA 4INFA 4NX0A 4L9ZA 3CUZA 2BXVA 3POHA 2PDJA 1W37A 4HHMA 3W71A 3MWCA 3BAKA 1UZHA 4M5PA 2J8FA 2QPUA 4N9CA 3NSXA 2J9XA 4HVXA 3S2LA 2XDFA 4DYEA 2FGLA 1GK8A 1LQAA 3B0VC 1J0ZA 4YIWA 2D0HA 1SO6A 4FXRA 4XSMA 3APGA 5AY7A 1T96A 3MYPA 3AOFA 3IUIA 1AVAA 1OCBA 3NQ6A 2OMAA 2GJXB 2QDHA 4CD6A 5AOUA 3LNMA 2VFDA 3C2YA 2WV8A 1J2WA 2QLYA 4YS1A 1XHGA 4PB3A 1GQKA 2BXYA 3R1ZA 1T40A 5LNRA 5GNYA 3SCRA 5AHNA 5XINA 2E1DA 3Q4DA 1IF2A 3W25A 5LIXX 2J24A 1EJXC 3WQOA 3FNDA 3OOQA 3WQCA 1ZJBA 1EYEA 2VD8A 2WKGA 3LRKA 1HZYA 3EEGA 4UXDA 4OIFA 3RIKA 4ZQPA 1P0DA 3IJ9A 3CNYA 3VDCA 3F2CA 4PUUA 2BODX 3B3DA 4MFDA 2D69A 3PZTA 2J7HA 3EDJA 3LCIA 2QCFA 4MNMA 4CQ9A 2X1UA 1K4HA 3LG3A 4Z2JA 1QK2A 2EPNA 3GYEA 2A6NA 3TFXA 3K5XA 4PMNA 1BQGA 3UETA 2V30A 1HKKA 3CBWA 3UYIA 1GVIA 3TC7A 5HATA 3B9OA 1RP8A 2P3ZA 2X2YA 1DORA 4IG2B 3KOWA 3O2LA 1QW7A 2WMIA 1QNSA 5I3IA 2CLMA 3AO0A 3CJPA 3L4ZA 2D2OA 3TJLA 1R3QA 4AWSA 2R91A 3VCCA 2QCCA 4GPNA 5FJJA 1W8GA 2NXIA 4EK7A 3MYOA 2D3NA 3DI1A 4B2DA 1KNWA 4CNOA 4DHGA 1SQ7A 3DC0A 6REQB 4ZO8A 3NQMA 3SN4A 3D47A 2VQUA 1AH4A 1POJA 3CYJA 3M64A 4GISA 1U2YA 1KTCA 2ZTKA 4EF9A 1G7VA 4K7VA 2YXOA 1T5AA 3R6IA 1RUSA 4Z1BA 4L7ZA 5HXMA 1XYBA 3VGBA 4Y6GA 3BOLA 1X6NA 4PMYA 3UXLA 3SCNA 1US0A 4DXKA 5FL0A 2YBVA 2QUNA 1M03A 4GUIA 4NZCA 1AH0A 3U8GA 5XIMA 2XN0A 4H6EA 1EOKA 2WW5A 5HWJA 3WQ6A 3LMYA 1E71M 3P60A 1UUQA 2VEPA 4ZB0A 1LBMA 3GDTA 3W7NA 2D1ZA 3HQNA 2FDMA 2ACSA 4YN5A 3VIHA 1EQCA 2C18A 1JCJA 4MPQA 3TA9A 4IFKA 4RKAA 1AL7A 3UPMA 3U5YA 2YR1A 5ABTA 2GK1B 4ICCX 3ZR6A 2ZZ3A 3II1A 1J12A 4UQCA 1Z44A 3NO5A 3SR7A 2BVDA 2I1OA 4DNMA 1H49A 3H7RA 4DF1A 4IM4A 1N8WA 1KBIA 1WE5A 3CASA 3DFPA 3CWOX 1NOUA 1Q2SA 3EWWA 1GWJA 3W7KA 3MV11 1IYXA 3V1HA 3T4CA 3H8AA 3SUWA 1QOQA 4UTKA 2V5LA 2VUNA 4HBKA 1PCKA 3WK2A 3UWZA 3ARUA 3ORWA 3LQGA 3FN9A 4LYKA 3TW9A 3UR5A 4UR8A 1YXYA 3RO6A 3PC0A 5D8ZA 4MB3A 2PF8A 4ZOAA 1FRBA 1Q4NX 3K13A 2E8ZA 3WJXA 4F2BA 3ONBA 1QW8A 2VVSA 1VKFA 3N25A 4FXFA 3NSNA 1I4NA 1SSGA 2CITA 4PUWA 1VD6A 3CUXA 1FWRA 2V2CA 4GZ7A 1DWAM 3E5PA 1RY8A 4CNNA 1MQPA 4MG4A 4OQVA 4L1GA 1KLYA 5AYZA 3C8FA 1PWMA 2CYGA 1UBPC 2C1GA 4MWAC 4GNJA 2D73A 1MEWA 1CXFA 1MQRA 1I1XA 1V8EA 3N4AA 3QPZA 4JIIX 5A3HA 1TCMA 4RZ4A 2D22A 9XIMA 4HA3A 4HGXA 3HMJG 2HNHA 1W1VA 4UCGA 1J18A 3EX1A 1PTGA 1SSDA 1UG6A 3RCYA 3W37A 1F73A 3QJAA 1FXQA 5MKGB 3WG6A 1WO2A 4C1KA 1ODUA 4UQDA 5DT7A 2XVNA 1FHUA 3MSGA 4ZE5A 4H4IA 1H7WA 2XISA 3NG3A 4CQAA 5HR7A 2BHUA 2V6AA 3B0XA 1TPEA 4XIMA 4BI6A 3PF3A 4HMCA 3HPFA 1F5ZA 4Y9AA 4W7VA 2VZOA 5D38A 1DIDA 2YL8A 1NWTA 4IQJA 1J01A 1LUCB 3ITVA 4QAIA 3S9ZA 5IFTA 1W3IA 3MUXA 4M6VA 1K8XA 2ZRZA 1CLKA 2PD9A 4PUKA 2A7NA 4AB4A 4HA1A 3F1QA 1C8XA 4P8UA 3G1SA 3M46A 4KPLA 4GYKA 3LLDA 3LSCA 3N13A 2R1KA 4RE3A 1XL9A 4AZIA 4HNCA 3BQ6A 2INZA 1C7TA 4O53A 3IVTA 4FA3A 4X2RA 4KWWA 5I03A 3CHCA 4ZE4A 3VINA 3EA3A 2HDJA 1Q7MA 1O5RA 2QCDB 3CUHA 1LTDA 5LGXA 4X3ZA 2W27A 4B5XA 2XIOA 2XGZA 3N9KA 2A3LA 2PDIA 3KBSA 1BSLA 1R7OA 1KM1A 3G0XA 1FKWA 1K7XA 2XIJA 1K9FA 1VFLA 3UCCA 3L4WA 2VZTA 2J8TA 2DSUA 5D2WA 4IMAA 4PL1A 3NTYA 4L6OA 2VENA 5CGQA 4XAPA 1V3HA 2C71A 3STPA 2OZ8A 1E72M 4XK2A 3B0UX 3W7MA 3M0HA 5CCZA 1A4MA 1VRXA 5EFFA 3N73A 4MB5A 1LT7A 1MRQA 3R11A 3AXKA 2VVNA 2Y8KA 1PDZA 5CPMA 4PYSA 1UMYA 3FVDA 6CGTA 5DX7A 4K1GA 2Z1SA 3M07A 3QSTA 4Q7IA 5IFPA 2OWWA 1WCGA 3IIVA 3CZEA 2RFGA 3ARRA 4FS9A 3VM5A 3UG5A 3E2VA 1DWIM 5D05A 1UJQA 2I5QA 1RQHA 2HBXA 4WY0F 4F3HA 3IACA 1OX4A 1XIHA 3NWRA 4GJ1A 3SI9A 1F3WA 3DGRA 4NAFB 1L6FA 1OC6A 4U3CA 2C91A 2HMCA 3BAXA 3GW3A 2AKMA 5K3VA 3WQ4A 1GVSA 2WC7A 1MFUA 4RDWA 3CU2A 2QGHA 5FJTA 3Q94A 2VFGA 3GC4A 3BARA 3N9RA 3ZVIA 3W2JA 1PYMA 2Z2AA 4QNWA 5LA2A 2X1IA 2YDSA 3QZEA 2PEVA 2IPGA 3E5BA 4WSHA 2POTA 3I3BA 4ICMA 1NQKA 2DZWA 1BEUA 3REQB 1E15A 5K4ZA 3LCLA 3AUJA 1EPVA 4GINA 2E68A 3TROA 3NQFA 1F76A 1SFSA 1Z42A 2QMJA 3BW2A 3T81A 1KCKA 1UCWA 4JFTA 4M0XA 4O19A 5LXEA 1FCUA 4JYFA 1ECQA 2YYUA 1V6XA 3LOTA 1WXYA 2Q6ZA 2J4GA 3IJDA 1RXOB 3HURA 3PJUA 1CEOA 1CGUA 3E49A 3AIBA 4FNUA 3M5XA 4FI4A 2X1RA 5A6SA 3ITGA 3GB6A 4US5A 4HN4A 2ZRXA 4MWAA 1ZLPA 3U2CA 1TPUA 1RH9A 2Z1BA 2NXHA 3QV7A 3CZGA 4MKSA 1Q6FA 5ABHA 3W88A 4OECA 4L6HA 2H9AB 2D0GA 4UFIA 3DUGA 3WK0A 1FWDC 1H7PA 4QBXA 2HS6A 1TWZA 1HW6A 4RR4A 3T07A 2INEA 2GGEA 3WLLA 3UT0A 3WBEA 1QI5A 3L7RA 4XBKA 2BVTA 2VKZG 5E5CA 4CN4A 1IXPA 1M7JA 3UR8A 1A5CA 4IZGA 1MNSA 3CTLA 2Y6ZA 2Y1HA 1Z89A 4WDUA 3SEPA 3EPMA 4XVEA 3LI0A 4DJFA 3H2OA 4WVXA 1BRLA 4K1WA 4JHOA 1CXLA 4RDVA 4R33A 1XBYA 3GU9A 5I7GA 1D3HA 3MANA 4OGZA 4MTVA 2X1SA 3PG9A 2HISA 3C61A 4URIA 4LALA 1LF1A 1HL9A 4JIPA 4JQ4A 2GDVA 1WXJA 4ZGYA 5TQLA 3F7JA 4FIRA 1RCXB 2YBTA 1GKPA 4HK6A 2HNEA 4B3LA 4UMAA 3WEOA 1LQ2A 3JUGA 2EJ1A 3FEQA 3WQGA 3VM7A 1ESWA 4M1BA 3TEVA 2J79A 1VIZA 5KZDA 3VTRA 5A8MA 3KBJA 1OM0A 1OFQA 1WKYA 3C52A 3M41A 3TTYA 3WLQA 3C2RA 4IFOA 4A3RA 2O7SA 5F1VA 5CZSA 3KL0A 2XH7A 4H41A 3QY8A 5AN7A 1J6OA 1OK6A 5EMJA 3VGGA 1VENA 4Y9PA 5A2BA 2AQOA 2CESA 4O0KA 2NSOA 3TAOA 3WF1A 1B4KA 3KTSA 3HPAA 3S1GA 1CXHA 1TCDA 3VIJA 4A22A 4N9EA 3WN6A 4ZQNA 1IWBA 1X97A 4NY2A 4D71A 2B4GA 1F9CA 1RAKA 5A1AA 4LQ1A 3T05A 4U28A 1SMAA 3EX6A 5BXSA 2QAFA 3S2JA 4OBSA 1UD3A 1WDWA 1X38A 2G3NA 1R85A 3LUTA 4LFYA 4B9ZA 4ECLA 2G95A 3F5LA 5M1TA 4F8XA 2C1IA 3CM4A 1EHAA 4HPNA 4QIUA 2Z0IA 1XLBA 3WJYA 1HGWA 5DRCA 4FNRA 4PMZA 3LZ5A 5BYWA 1CENA 2DT1A 1DL3A 2I14A 2WCSA 1W9DM 2DY3A 3AS1A 2PD5A 3DYPA 1XXXA 5M2FX 2HSAA 4MKNA 1ELSA 3RFAA 1OCNA 1FWFC 3EZ4A 3PAJA 1ADOA 4Q6JA 5IHRA 5FKYA 3WDPP 4HYRA 3CZ8A 1QU4A 1C92A 1BHGA 3HFTA 3QGKC 3O9NA 3NCOA 3LN3A 3PZVA 3SCQA 1FHDA 2E8YA 3PBWA 1SZFA 3KRSA 2PDFA 1UR4A 3STEA 2OQHA 3PTKA 2R24A 2ZVRA 2WC3A 4G7EB 4UFMA 3VKKA 2PWGA 1B3XA 4QFUA 2IKGA 1UWTA 4LY4A 4H9XA 1EL3A 2CETA 4HMNA 1W1B1 5K7JA 4MPKA 3E02A 1XICA 3PAOA 2NWSA 4Q4OA 4UBPC 2E67A 3LI1A 1CGWA 1NAL1 1I2QA 3BCJA 3N3TA 5G2HA 4DUWA 3SSJA 3BLLA 3QLDA 4ZXOA 4G1KA 1Y0EA 1F6KA 1YE6A 1CT5A 4GQGA 4Q7BA 4OUIA 3H22A 3MC5A 4AIEA 1JDAA 2WVTA 1HKJA 3ZR4A 1WP6A 3N3MA 2AL2A 2FZDA 1PUDA 1FH9A 2XIQA 4DXVA 4RDZA 5C9UA 2C0AA 3HG3A 2WHJA 5HPOA 2V3EA 5I3FA 1GYLA 1TVPA 3FSUA 3KTXA 1A0CA 4DJEA 3MW7A 4GI9A 5AHIA 1J8VA 5LZLA 3LHWA 5M17A 4K8GA 1UIPA 3WD4A 2Q8ZA 2NVDA 1SJCA 2EBNA 4PN2A 3T0TA 3LCWA 3NO3A 1H60A 1R9XA 3C3UA 3ITOA 1CB2A 4GQQA 4H7VA 1L8NA 3E3HA 3FJLA 4IMDA 1XQLA 3L2IA 4LANA 1GQLA 3UCDA 1KGWA 2UY3A 2PLJA 2AOSA 2PWDA 1V5XA 3PBUA 3SB0A 1NDWA 4LBSA 1DVJA 5AHMA 3LGDA 1AMKA 1TPFA 3A3XA 1UPPA 4BQ3A 5BMXA 4FNPA 1TWDA 2XH0A 3UJRA 3RU6A 3QZAA 1J10A 5HNRA 1BYBA 1JUEA 1DJQA 8RUCA 2QIWA 1SJBA 2QJGA 1HP4A 1GNXA 3N2MA 2OLAA 4FIQA 3ANYA 1E0XA 1MDLA 3AXIA 1VYPX 3DYMA 2JBMA 3DFHA 3RK8A 3MS8A 3LHZA 5C8BB 1TJ0A 4S3FA 3TUUA 3E6EA 1UZ4A 1CB7B 3NM1A 2ZIDA 3TYEA 3VGEA 2X09A 3MSDA 3O6YX 1E70M 4DF0A 3DBPA 2ZC1A 1GVQA 3TN5A 4AX6A 3F5KA 1EGMA 4JR5A 4DBDA 4ICNA 4V27A 3EWCA 1OIFA 5AFDA 4RL3A 3JS3A 2ZZ7A 2H8ZA 2QVNA 4LRSA 2BV9A 4YWSA 1G7UA 2BMBA 3OQEA 4O1BA 1CGTA 3WF3A 1DEDA 2Q8XA 4JYEA 4BKNA 2JEPA 4AIBA 1XDMA 3HJEA 5JMUA 1FDZA 2QNEA 1LL7A 2VFFA 3NL3A 3UF9A 4QQUA 1ITXA 3CB3A 3O05A 4S2BA 2Z6JA 3DENA 3AIRA 2NUWA 3GDBA 3S2CA 1GVRA 3LPPA 1UH2A 3GXNA 3M6YA 2V67A 4MJ2A 2GZXA 4AWUA 5ABFB 1V3KA 3WNMA 1DKWA 3NL6A 4Y2WA 3WD1A 1JZ2A 2E5DA 1KM4A 3W7QA 3ELFA 2J7CA 3ITLA 4IPPA 5I6SA 3WYZA 2YKKA 4JX5A 3P7YA 3AICA 4K36A 3TYDA 3NO1A 6REQA 4NHVA 3QGAC 1UP3A 3BG5A 2E40A 2G5WA 3GVQA 4XSLA 1JZ3A 4B5VA 1KCXA 5F2MA 1W9BM 1P6BA 4IGMA 3SGZA 3RXZA 2R1MA 4B16A 4IFRA 3RO8A 5G2WA 5I24A 1JGMA 3HV9A 3UQNA 3NGJA 3QMRA 2ZZ6A 1GHRA 2O56A 1EXBA 5I3GA 3VIFA 2FZNA 4ZVJA 3L0KA 3N2XA 3W29A 4RK8A 3C3NA 1QVBA 4Z1YA 1UH3A 1Z69A 4JTGA 2QCLA 2Z28A 3SY1A 1EHNA 3VYLA 3MHUA 1KWKA 2GQAA 4WDXA 2X8RA 4A2SA 1QW9A 2HXUA 3VIMA 3ABZA 3FCPA 1QPNA 2ZX7A 4M51A 5K2ZA 4D8ZA 5KETA 2G3IA 4UTJA 3L4YA 3IS4A 3ITXA 3RMJA 3SURA 1UP0A 1E73M 5CZKA 4F0HA 4ZB2A 2RKXA 1KO0A 1K1DA 5C9RA 4C91A 1Z7AA 1VYRA 1DTNA 5CLWA 1DHKA 4I90A 2OU4A 2DJXA 1OGSA 2G4FA 4G5DA 4YHGA 4H04A 1Q65A 4ORMA 1VPXA 5EMYA 5J5RA 1OZQA 2CBUA 4C7DA 3O63A 1VPQA 4RZ6A 3O15A 1J0IA 1TQXA 4AD2A 1LJYA 4CU7A 2CZFA 4LOCA 3L4UA 1HG3A 1D2KA 4D9PA 3GQYA 2VO5A 4GZJA 3RJYA 2Y2WA 3IVUA 2C15A 2I5IA 2O7QA 2CU0A 5F4SA 1SO3A 1VBRA 1PS9A 4A3HA 3MVIA 5EBAA 2Z27A 2Q02A 3BK0A 4DJED 3RGTA 3W74A 3TYAA 1LWHA 4JFWA 2MANA 1K6WA 1M5WA 1XBZA 1FX6A 1F4HA 1W56A 2WVUA 4JTSA 4HHPA 5I5RA 2FZ9A 3QBUA 3D3FA 5JIWA 7PTDA 4KWOA 3WQ5A 2DUXA 1N7KA 2QCMA 5JBDA 3A22A 1XX1A 3CPRA 1QXLA 4TUFA 3BXWA 1XLMA 1YEYA 4M6QA 1RA0A 3WF0A 3WD3A 3EOLA 4HSOA 1EQPA 1UZ1A 4ZQOA 3N2BA 4EXAA 1EJWC 2YL9A 3L23A 2BSLA 3AYSA 3RITA 1VFFA 3L5MA 5BCAA 1GOWA 4OJYA 3ZMRA 3O0KA 1KFLA 4J28A 3OU8A 2ISFA 3W9ZA 1EJVC 2OWXA 3PUEA 1KM3A 4JBRA 1OFPA 3KE0A 4IMEA 1M9HA 2PMQA 3LLFA 3PY2A 2DSKA 4KRZA 3B8UA 4JOMA 4HNTA 3KZSA 3FJNA 4UQBA 4UTTC 4TVUA 1RVGA 3SCOA 8XIAA 4UOZA 2HROA 5BW6A 2GGGA 3KOYA 5C5YA 5HMFA 4S3EA 4UNIA 2E7FA 3HO8A 1LUCA 5A94A 5AC7A 1VZWA 2XVPA 2YW3A 4HHLA 3WIJA 3IJLA 3ZJKA 3BJSA 2O4QA 4YHEA 4UZSA 5HJLA 4AF0A 3U7VA 3TLQA 1UW9A 1TWSA 4W93A 3M0IA 2J6VA 1XRVA 3QZ6A 2OELA 3CAQA 2VC5A 1VF8A 3M43A 1GVYA 4CQBA 3B9EA 3WMBA 2UZ9A 3AJ7A 2B81A 2PWEA 3A12A 2PDLA 2I17A 4DZ5A 3BAWA 5FESA 4WOQA 4XZIA 1F07A 4M19A 4F4RA 4AMCA 4FAMA 4GLEA 1A5BA 2WZMA 1EJUC 3B8TA 3SN0A 3NNTA 3V4BA 2W92A 4LB4A 4LAKA 4J3SA 2LLEA 1ZZMA 3SUVA 1UD2A 1AODA 3T0AA 3W07A 3AZTA 1YPXA 5JH2A 1SO5A 5FEZA 2WHMA 1E6XM 1Z32X 5I07A 2E77A 1KV8A 1TYGA 3KL3A 3A13A 4ZMGA 2RGMA 1D7KA 4OHQA 2C7FA 3FX4A 4XKYB 5HQEA 1DQWA 1VQTA 3THCA 4S3GA 3V0UA 3PB0A 9RUBA 1M1BA 1HL2A 1GZJA 4FZIA 4V33A 5FAJA 1W5QA 3EX2A 1F6PA 2Q8LA 4M82A 3K4AA 1ONRA 3MUIA 3I6EA 4LRTA 3MO7A 1L0PA 2YLAA 1JDDA 5KEZA 2QUVA 4GCAA 4O1EA 1NY1A 2E6AA 5I0DA 3W23A 2CWXA 1GOKA 3MKVA 2DW6A 3AFBA 2YCJA 4LU0A 3L5AA 4AZHA 1TREA 1K3UA 2R14A 3UY7A 1N55A 2WCGA 1XLHA 4PMXA 2PLCA 4REQB 5FA5A 1A5OC 1VLWA 4KF1A 1A5NC 1SFTA 2FYMA 4LXFA 2DT2A 1A53A 2QCHA 1UR9A 4L1WA 3EEZA 2RGLA 2ZC8A 3M9YA 5LIUX 1XPYA 3QH2A 5C9ZA 1DWGM 1TE6A 3ES8A 1ZCOA 2WZIA 5D9PA 1TJ1A 1V03A 1E4IA 3CTTA 5CXPA 4KRUA 3GHSA 4RLIA 1OVDA 5AVHA 4LAMA 4KBXA 1TPDA 1FP9A 1FTXA 4IMFA 4Z08A 4Q6XA 1JF6A 2VFHA 2CCRA 4MNKA 2ZX6A 4LWWA 5DELA 3NQAA 1MWOA 2Y89A 4XWUA 3AUOA 4JCMA 4O1DA 1R38A 2AL1A 1GQJA 1XUZA 4NG3A 4HJFA 1KTNA 3ABXA 5DO8A 1W9UA 3GAYA 1XD0A 4HMEA 4S1FA 1V93A 1ISYA 4AEFA 4AY8A 3MP3A 4FEZA 2EPHA 4JTHA 1TPC1 1CGVA 2DIJA 4DO4A 1DE5A 2OWCA 1BXNA 1HGYA 2GVYA 1Y5WA 3N19B 2NQLA 3WLRA 4LAOA 4DVOA 1N2VA 3KOXA 1KBJA 3ME3A 1E3ZA 1FDJA 3BV4A 4MLJA 3PHAA 4B3KA 1VP5A 3LM3A 3UU0A 1HQTA 4H6QA 4C6KA 3OG3A 3TW6A 3PS7A 2D3LA 2NUXA 4Y9NA 5A6JA 4GD0A 4CU6A 2PP0A 3EWBX 5HMSA 4Y96A 3AU2A 5C2CA 3UFYA 4J3VA 2WPGA 3KFTA 3TSBA 2CLKA 3SCPA 4OOUA 4QJ1A 3H4WA 3MI2A 1C9WA 3SIZA 4EP8C 4G56A 4DO6A 2NQZA 3G6LA 1A5UA 1UC4A 2CIPA 4PRTA 2NV2A 3MUY1 4EXBA 3KBMA 2J47A 3LHVA 2XSBA 4UMBA 1HO1A 3OO2A 4C6EA 3IK4A 5BMWA 3N17A 1BG4A 3M0XA 4NSBA 3S1WA 3HFYA 3JZEA 1QDSA 1RQBA 5I09A 1GVOA 4WXZA 4N4QA 4LTSA 1TMQA 4UB9A 3F2DA 2F7FA 3AS3A 1XSJA 5LIKX 2DSZA 1EF3A 3MI3A 2QDGA 3N15A 2I9EA 4BCEA 3E0LA 4F0RA 4ML4A 3LRLA 3M0ZA 1F3EA 2D2HA 3GHUA 4LT9A 4MOZA 4S3BA 4CEUC 5EMUA 3T2OA 1ZQ5A 4G2DA 5K9DA 4P8VA 1PKYA 3ICJA 4WUIA 3IV3A 3THUA 5AC6A 2PTWA 2VT0A 5GJMA 3P8IA 1NJJA 1J5TA 3CHVA 3NM3A 4BK9A 5E9AA 1V6TA 4PCPA 1W3JA 4NNAA 2QPXA 4UTWC 4C5YA 3KS6A 3BAYA 3BSHA 4F9DA 2NT0A 1N8FA 4GOAA 2CXEA 1RALA 5CBIA 4XUGA 3W6MA 4DELA 5H8PA 3B8WA 1OFOA 1CXIA 1GYNA 1T0OA 1M3UA 3GFZA 4I5RA 4NZ4A 2G97A 3O3RA 2Z2UA 3DC8A 1XC4A 4QCFA 1OX4B 3ATZA 3GTFA 3EXRA 3OIXA 4GUJA 3HA1A 4XTDA 4NJJA 4YCOA 4NKCA 3BMVA 2CBVA 1MZRA 2YA1A 5LKYA 3H12A 4D6DA 4IGHA 2J9YA 1GJPA 5CBBA 2ZUVA 1AQFA 1H09A 2XYLA 3IJ6A 5EMLA 1B3WA 2GGJA 3V0SA 1FHLA 3TQVA 3WNNA 4B2DD 4ATDA 1WUEA 3HGOA 1FWGC 3DXIA 1PE1A 1H0IA 5IRPA 1TV3A 4PTMA 4JTRA 1UP2A 3IUDA 3L2MA 3EOSA 5LNSA 4K2SA 3A4AA 1X8FA 2OOGA 2ZXBA 2X41A 2OQYA 3G1XA 3SW6A 4A21A 3WUEA 2Z26A 4WY0B 1E6RA 1VYSX 5C9WA 3J7HA 1T8XA 3GW0A 1VEPA 2GLKA 4HTYA 3W2KA 3CQHA 4E5TA 4AISA 5H1WA 4HYWA 1EWDA 3QXBA 2V2DA 1VAHA 2ZYFA 3ZWTA 4XD6A 1US2A 4LC6A 2HE8A 4JTIA 4L1XA 5HR6A 2A4AA 3W1NA 1GJUA 4PFMA 5A5WA 4PBEA 1OFBA 1BQCA 4AXKA 2YZRA 3NZ1A 1A3HA 3IRSA 2BOEX 3QTPA 1XM3A 4J2MA 2YCLB 1KCZA 2E0PA 1TJPA 4QTGA 2W62A 3TTEA 3HM7A 2CLHA 2PAJA 2ZWYA 4QE5A 4K68A 1GYMA 3UNDA 4HZ7A 2ZTJA 1E55A 4LAUA 3LU2A 5IBXA 3PB2A 1DIKA 4UTFA 4DN1A 2RDWA 1P0BA 3DGBA 3GNOA 4O8AA 5FF0A 3AHVA 3W26A 2YL5A 2XVGA 4RZ5A 4OZOA 2NX1A 2ZUMA 2OZ3A 2WWDA 2JKAA 1ICSA 3DOPA 4OU1A 4LSBA 3WY1A 3OVPA 3PPHA 3TONA 3TNBA 3IVSA 4GUHA 2WQDA 2BOFX 3OBEA 1RJQA 1QO5A 3UCQA 3WL1A 5D2XA 3HGRA 3WELA 3A64A 4QHRA 2J9ZA 5BZAA 1U22A 3QC0A 4EWJA 3W1TA 4IH3A 3TAKA 3E2RA 4MIMA 1AQMA 1M04A 4QEHA 3QPYA 1KFKA 2VEGA 1OY0A 4DWSC 4O1FA 2QDEA 3W87A 1A0EA 4NP7A 1O68A 1HKMA 4PA8A 4OKDA 2EG7A 4UTWA 3B8VA 5CC7A 1JYVA 1US3A 3PK7A 5KINA 4PEKA 1PJ9A 2WJZA 3CB8A 2Y88A 1QK0A 3ALGA 4JTQA 3VFLA 1FHVA 1R47A 3D46A 3ZWSA 3SBFA 2IKJA 4HOXA 2PGEA 4KCWA 3BJTA 3L4TA 4KCTA 4E8GA 4TU1A 1E9ZB 4RNIA 2ATMA 4O15A 1R3VA 4HK5A 3W7EA 1PYFA 2YX0A 2J7FA 4O4VA 5T8GA 1TPWA 3PVFA 1JJKA 1TWIA 4NQ1A 3WQFA 7ODCA 4D8LA 1QI0A 1K02A 1KKOA 3N18A 4DX3A 3WK1A 1NF0A 1JCTA 1NM9A 2WKLA 3RR1A 3KLLA 1EUNA 1XW8A 1NEYA 4R53A 3LCGA 3H21A 3VNMA 1CI1A 1EP2A 4BEUA 4GVIA 4NL1A 3E2QA 4IGNA 1ZFJA 3WNKA 3L67A 2F61A 3W2LA 4Z1CA 1S5VA 1KBKA 2CHNA 1W9XA 2QT3A 3CMJA 4PMJA 3VFCA 3M0LA 1EB3A 2HS8A 2OCZA 1P7TB 3FA3A 1PAMA 1MW2A 1BWKA 1ADSA 2XU2A 3HF3A 2CKSA 4ZFMA 2XG9A 3S8HA 1IXQA 4YJ5A 1M65A 4V2XA 3RX4A 3VNKA 3IPWA 3CT7A 2GOKA 1QT1A 4IL2A 4X9YA 3L0NA 1IIHA 3RX2A 2V81A 4IP7A 4R88A 2C13A 3EOOA 5D2TA 1EP3A 1XKJA 4EIVA 4PMQA 4PUNA 4OBRA 1IEVA 2Z1VA 3K46A 4LPCA 4GH1A 3ARWA 4O17A 4JY9A 1FH8A 3UR2A 3PSVA 3UY8A 3QHNA 3Q45A 4RXGA 4M8UA 1FCQA 2C79A 3DU0A 2GVGA 5HULA 1KC7A 3BLDA 5DEZA 1UD4A 3DG7A 3GUGA 4J5NA 4GVGA 3AI0A 1TV7A 2J78A 2EPOA 3OZOA 3GU1A 3DCPA 3T2QA 4XB3A 4B9YA 3FV9A 1YDNA 3GXDA 3AMDA 2WANA 4E3TA 3U2OA 2FFCA 2P5NA 3ERPA 2QULA 1A4LA 1EEXA 2YFOA 1NWRA 1JPMA 4O57A 3W27A 1K70A 3HIJA 1HJVA 5TF0A 1KFBA 2J13A 3DAQA 1IEQA 4IIBA 4GY0A 4LEFA 3TP4A 3O7UA 4UOQA 1QI3A 2FZBA 1UJPA 1JDEA 1G4PA 3EA2A 3EKGA 3OYZA 3SO7A 4WGXA 4O1AA 3BJFA 2C3ZA 3RLUA 5FL1A 5DBUA 2P88A 1XYMA 2V3GA 3PFMA 4DWSD 1IHIA 3UERA 1W3LA 1K4GA 1DJNA 2ISDA 3V36A 1F6YA 4GXWA 4LVDA 1KD0A 4DAFA 5FIPA 3S47A 1DTUA 1KA9F 1I6NA 4F0SA 1XIJA 3FA5A 4LB3A 1W2VA 5E6YA 1B90A 3QQ0A 2A85A 4UNLA 3DFNA 1WKDA 5CG0A 1IQ8A 4PR4A 1DJGA 4G6CA 5CQ1A 4C6CA 1IXNA 4LC8A 3AHYA 2ZADA 2PC4A 2OB3A 4XIAA 1FXPA 1W3KA 4GYJA 1IWAA 1RHCA 1SR0A 4HD5A 2QJIA 1HXJA 1YLVA 4MUZA 3GHTA 3VILA 1TKKA 1CWYA 2Z24A 4DM1A 3H2MA 1MUWA 3DFTA 1TVNA 3CQKA 4ZZ9A 3GK0A 3GM8A 4WZHA 4UTIA 3OZPA 3SECA 4D1JA 4HJWA 4R5EA 1LOSA 1U83A 2XZ9A 2WLYA 5I78A 4PCNA 1WDQA 5AC4A 3MKCA 1WUFA 3FDKA 1DQUA 3TTSA 1V79A 2WJFA 4PFHA 4LGXA 3W1LA 1K77A 2Y5SA 4JQAA 1X96A 1Q6EA 2WWCA 3DH7A 4NAFA 2VDIA 3AZRA 4GGBA 1TE1A 4JIHA 1NTHA 1OK4A 2NWRA 3AMGA 5ECUA 3ZYZA 3HU7A 3TCEA 4EE9A 1XLIA 1XP3A 4EPDC 1DE6A 4TV5A 5B7YA 4NZJA 4X63A 3S2MA 4HPXA 4BF5A 1D8WA 4KW2A 3FAWA 3SIMA 3SRHA 1BFNA 2ZCGA 3BV7A 2VHLA 4RPQA 2A3EA 1SUXA 1F8IA 3EDEA 4W86A 3UXKA 1HKVA 1Z8AA 2E6DA 3EMZA 3AXMA 2A79A 1JCYA 3LXCA 1KXHA 1JYXA 5DCEA 1E0WA 3GVWA 4NZ5A 1OABA 1FWHC 1XLEA 1OHLA 1ME7A 1OX5A 3ARTA 4K39A 4X9SA 1AJZA 4HA0A 4XG1A 3NPWA 1FWSA 5FSEC 1R3TA 3A4XA 2QIIA 4IXHA 4WJ8A 3WMSA 1X7FA 2OVLA 3URQA 5D09A 1W5PA 4ENLA 1I2PA 4Q4MA 1JAKA 2PDBA 3O07A 3TMQA 3QR0A 3RJXA 3TE9A 1AA1B 1FY6A 3CHEA 4KIEA 2VR4A 4LCSA 3VO0A 4AIOA 1IT7A 3TYUA 2C16A 3NEVA 3DDMA 5BRQA 2Y7FA 4FK9A 3IIPA 2Z2BA 3PBGA 5HAOA 1EDGA 1XLJA 2XINA 4HU8A 5J8LA 2XIBA 1EGVA 4QROA 1ZJHA 5FEPA 1RCQA 3LA4A 1P7TA 1MYRA 5A6AA 1OB0A 3FDGA 1CDGA 2FB3A 1K7EA 3QV9A 1P43A 5HBFA 4KEVA 3NQVA 2JALA 3PANA 3UZZA 2RAGA 1IEXA 3WDJA 2JIEA 4XKYA 4QQ3A 2V8ZA 3P81A 4IF2A 2YXXA 4QS6A 4W88A 3S3GA 1HO4A 1GT8A 3GNDA 1V02E 3LV6A 4L4PA 5LNUA 2YLLA 4OUEA 3IGUA 5AECA 3BH4A 4TTUA 1FP8A 1JCMP 4ZEPA 2I56A 3D0CA 2VZUA 2VDHA 2NV9A 4H01A 4JQ1A 3GTXA 2JF7A 3UJEA 1O12A 3EPOA 3LK6A 4P2VA 5JIPA 4MWAD 4IOTA 2YGYA 1F61A 1RPXA 1OYBA 1ZPTA 4AF0B 1OG6A 1ZP4A 3W86A 3LTSA 4U2ZA 3VZZA 4DRSA 3NPXA 1W9PA 2INFA 5FF7A 1QFEA 2CLFA 3GR8A 2CBIA 2ZDRA 4LEQA 4A3UA 4HKPA 4BA0A 4IT1A 3GAKA 3OLEA 4A6GA 2X0YA 3URAA 1NQ6A 2WMKA 1FVPA 3WMCA 4DJFC 2VCCA 1VLIA 2HVOA 4PMDA 2UBPC 3BMWA 3SDOA 4BI7A 4BFAA 3VI2A 4XTIA 1R86A 4MADA 1BVNP 4CKQA 5C54A 2QAPA 2FZ8A 1EX1A 5G1TA 4MB4A 1HJXA 1V6VA 1MQQA 3U2EA 4TVCA 4UTMA 3QY6A 4XZHA 4QRNA 1MMFA 1Q6DA 4L56A 4LCRA 1DXIA 1J79A 3PJXA 3PG8A 2PRLA 3W24A 4DYKA 1M6JA 3STGA 3WBYA 3LRMA 2YCKX 5CZTA 1ICQA 3AYRA 3LCXA 5ABGA 2VI0A 2ZX5A 1J0JA 3R4IA 1E1CB 1UD6A 3RAOA 1TA3A 1YBQA 3BPWA 1V77A 2OR2A 3M16A 4AVOA 3U7BA 3OA5A 1PWLA 1UZDA 3ZR5A 1YPIA 2E09A 4FALA 2A0NA 2WBKA 4M29A 3XIMA 4NJHA 3W4RA 4ZO6A 2JE8A 3E0VA 1MVYA 2GJNA 4FNSA 1E3XA 4G7FA 3CYVA 4I5XA 4MGGA 3B9NA 3ZJ8A 1YNPA 3MPGA 4DF2A 2A7PA 1JQVA 4R9XA 2ZUWA 2PDGA 4UTTA 3WH5A 4JS3A 2JKEA 1UWUA 3GHRA 4C6IA 4Y8FA 2WSYA 2FPVA 2MNRA 4B5NA 1NARA 4GUGA 2UV8G 4G8TA 3A5VA 5HJXA 4GNKB 5AYBA 3HQ1A 2EPLX 4AFYA 2GVEA 3UXIA 1JNEA 3MWAA 2C8NA 2WZEA 3WBXA 3IIOA 1TQJA 2VX7A 1UH4A 1DJYA 3VGFA 2D2GA 3MBFA 4O8RA 4CNPA 3A3WA 3GBEA 2D24A 1CYGA 4DPQA 4PMVA 1NDZA 3M7WA 1QI2A 2BTMA 6XIAA 5MHBA 2NQ9A 1U33A 4IUOA 4DZHA 2E9MA 1XYCA 2TMDA 3T44A 5CC5A 4FX7A 5IHSA 2Y61A 2YPIA 1WDDA 3QGVA 4NF7A 5LNVA 1FCBA 4OT7A 2HEJA 4PGLA 2ZA2A 4B90A 1EJ7L 4ZO9A 2OO6A 1DJHA 1TG7A 1ZUAX 1S5MA 5D2VA 3PN8A 2V5KA 2WVVA 3LPOA 1XF0A 4PCSA 1X98A 2F2KA 3K4DA 2YCLA 3F4WA 3CPUA 4RNJA 4FR1A 3MJMA 4IIGA 4L64A 1ISWA 2RH9A 3OGRA 4F79A 2F38A 3B06A 3ANVA 4NI8A 3QF0A 3FAXA 1MXGA 2D23A 2X05A 1KGUA 1OT2A 3O06A 2ATSA 4Q4RA 1YMYA 3ZM8A 4C90A 3SADA 5DF0A 4ZA0A 1GVEA 3TZFA 1OFRA 3BQ5A 3G2GA 1O94A 1W0MA 6TIMA 4I9MA 1G4SA 4GHRA 5I3KA 1IEIA 2IQTA 1G9HA 4V1XA 2WVSA 2QXWA 3GS6A 3AMKA 3D3AA 1KRMA 2GPTA 4O28A 4K37A 3ARVA 4GMEA 3IGSA 3W72A 1QNVA 1P1XA 3NL2A 2CKRA 2A6LA 3L65A 4DO5A 3TN4A 1QNRA 4MB1A 4Q3MA 5BOEA 5EPDA 1H5YA 3PZUA 1TX0A 1B31A 2H8XA 3CPGA 1SW3A 1Q13A 3H2CA 5E1QA 2VELA 3COTA 4AY1A 1R6WA 2DZXA 3L12A 3T7VA 3S5SA 2BVYA 2WHLA 1VJZA 1GPWA 4M7TA 2POZA 2ESCA 2OX4A 4KERA 1GVFA 1BGGA 7TAAA 3P0XA 1AFSA 3ARXA 4K8EA 3L2LA 5M03A 4HB7A 3W7IA 4D6IA 3CO8A 2F8QA 3ZJ7A 1BGAA 3DZ1A 3KWSA 4A3QA 1EJRC 5HQMA 5D33A 4DLFA 4WJEA 3UZWA 2XFWA 1UWRA 5BOOA 3E38A 4IHCA 2OG9A 4Q22A 2WYSA 3NDYA 1MW0A 4LNCA 1OFDA 3UW6A 1RQEA 3E0FA 3F4CA 1BF6A 2E9LA 1ZU8A 3RN6A 1AUSL 2PF0A 2VGFA 3LS9A 3NDZA 3WUGA 1HVQA 4WSJA 2R82A 1FWTA 3W7JA 3P5ZA 2J8GA 3SQSA 4DEFA 3WDRA 2V69A 4WQ6A 4F48A 4MAVA 3LTYA 5FAGA 4JD4A 3FJ4A 3CIXA 1K8CA 1Q4WA 2PCQA 2QCEA 1K9EA 2I7GA 1GQIA 3TTOA 2XTKA 4WJXA 1XLLA 2BBFA 1GW1A 2GQ3A 1W32A 1H1ZA 1E1EA 4Q8OA 4Q8PA 3NOYA 5G2IA 4GWEA 2Y0FA 3KL5A 1MUCA 4C6JA 1XH1A 1U1UA 4G9PA 3EKLA 1WOBA 2DEPA 3VD9A 2X42A 1H7XA 4B4FA 3A24A 4DWDA 1WZLA 1E6ZA 1KTBA 3LX9A 1DPMA 3DHDA 4JTFA 4O4WA 4QISA 3VAVA 3WNLA 1R2SA 3EYPA 4LV4A 2P76A 3HTWA 1MO0A 3N4EA 1KBBA 1W5MA 4KWVA 4UC5A 4DWSB 4HSHA 3KOZA 5DXXA 1C90A 3QFEA 4RV8A 1YNQA 4C6QA 2NV1A 1PKLA 3LPGA 5ABEA 4GUFA 2HJPA 5DN1A 3STCA 3W02A 3P67A 3BW3A 1BXCA 1K8YA 4Y9MA 3HMCA 5CPQA 1W2PA 4ALDA 2W63A 2XZ7A 1PB0A 5HJYA 1YTKA 3MZNA 4LYRA 4RPPA 1YYAA 5J04A 4MY8A 2TAAA 2W6RA 1O95A 3EX3A 2OQLA 4XZBA 3OVQA 5F2LA 1ZSXA 2X0HA 5FF4A 3VIIA 1ME9A 1J0HA 2B0MA 3S42A 1H41A 4HNUA 4EKJA 4C65A 5A6TC 4GFSA 1OF8A 5BROA 4I6KA 3AIQA 3S5YA 3DG6A 3Q37A 1BVZA 4IG2A 4YVVA 3I4KA 4ATWA 1E5NA 3TOPA 3QKEA 1AW5A 1BXBA 3CWNA 1LP6A 1T7LA 3LZ3A 3S83A 2IQ0A 5EBUA 1VFOA 4FLRA 5DMYA 3BLFA 3W1PA 4QJ5B 5LNWA 4C1LA 5AYYA 4I9TA 4QEEA 4J3WA 1HT6A 1NH6A 3SSZA 4C60A 3LD5A 5U4NA 1YADA 2ZBTA 3SUUA 5IM51 1XWYA 1QHZA 3KRBA 4OV9A 1S5NA 2XJ7A 3EDDA 3WQ8A 4ZO7A 1CXEA 4B3ZA 3BLOA 1O4UA 4XO6A 3BMXA 1FFQA 2VEIA 4Q8MA 1UB3A 1NWUA 2AGKA 3UESA 2IMRA 4YPJA 2AMXA 1S1RA 2QKFA 1WZMA 4GIRA 1CPUA 3M5ZA 2FVKA 2AGTA 3QFWA 1W5NA 4PBGA 2J62A 3E1F1 3MKKA 4QDMA 3WF4A 1TZ7A 3LV5A 3DFQA 4BF7A 5E6ZA 3LB0A 1V02A 4UFLA 3M0KA 2WMFA 4BEQA 3OVGA 1UR8A 3WJSA 2BG5A 4I6VA 3GH5A 2PWUA 3KUMA 4OTKA 1WAWA 3IANA 3MA8A 2W0UA 3VD5A 1UQYA 3VOHA 1O66A 3SN1A 3W22A 4JKKA 5FJUA 2VTFA 3GSMA 1OZMA 2FHCA 3MDWA 1ECEA 1TVLA 3HN3A 1FWEC 3LY0A 3AMLA 5IXEA 5FOOA 3VKCA 5K9CA 2XVKA 3AU6A 3R8RA 2QCNA 1ZENA 3SZ8A 4JX6A 4Q8NA 1VFSA 4X2PA 3NJ3A 1FQ0A 3GYCA 3Q58A 1M01A 3T78A 1RR2A 1ZNNA 5A6MA 1ISZA 1Q85A 3VUPA 3R89A 2WCAA 1GKRA 4JAWA 2ADAA 5IOBA 4D1IA 1TJ2A 3MT1A 3V35A 2XH2A 3SY8A 2VRJA 3G1VA 1E9IA 3RCNA 3TKFA 4NZ3A 2Y8UA 2FTPA 3NA8A 3LHTA 4J1OA 3VDAA 2DT0A 4CCZA 2YDAA 2PBGA 2J66A 3GDMA 3NVTA 2XH4A 3R2GA 4FSAA 3KVMA 5CSRA 1LZOA 5CPSA 4OE7A 4CGTA 5LSMA 4Q4SA 3RHGA 1E43A 1IE7C 3K8KA 3S1XA 3ARPA 4PRRA 1LRNA 2OEMA 2J7DA 4JX4A 1XLDA 3T6CA 1VFHA 2SFPA 1UR2A 2DP3A 3WSUA 1QOXA 3HGSA 5D03A 1UKTA 1XIEA 2FJKA 3MVTA 1L2UA 4O54A 4IICA 4NRRA 1LORA 1JUBA 2J7BA 3W2NA 2GL5A 3SUSA 1P5BA 9CGTA 2XWDA 4XD5A 2IS7A 1MDRA 1UR1A 1M7OA 2J27A 1UWAA 4US5D 3IJ8A 1XRSA 1E9LA 1ISVA 2P50A 1BYDA 3QR3A 4ERIA 2WZHA 3IV8A 4DNHA 1S5WA 4JL2A 3BG3A 3MP4A 2I5GA 2FJUB 3ZT5A 3T4WA 5A8QA 5TBOA 3B0PA 3P84A 4I3GA 5T9BG 1M68A 1XH0A 4AX7A 3CC1A 4CUCA 3KRUA 4FX6M 3NZPA 1V3IA 2HV5A 4CD7A 4LUTB 1Y5VA 3TW7A 5JBFA 4F0KA 1GOOA 2YB1A 3TJIA 1L2QA 2B7QA 2VZVA 3USBA 4RZBA 4WOZA 1J2BA 3MMWA 3MO4A 3H2EA 5EYWA 3E0IA 4B5WA 5A69A 3U4AA 4IPLA 1SFJA 4PMOA 2Z7GA 1WDPA 3DG3A 4F0MA 4FXJA 4HSNA 2ZE3A 5BRPA 4QE1A 1EBHA 3B40A 3ES7A 3W1RA 1JYNA 5CBJA 3HG5A 3MB9A 2ISSA 3PUDA 1X6LA 4P61A 1JYWA 2GGIA 4FLQA 2CC0A 3SFKA 2A3HA 2ZXDA 3YPIA 1TELA 2UY2A 3WLMA 4LV9A 1TTPA 4GQBA 4PODA 3U4FA 3O1NA 2PB1A 2HE5A 3K8LA 4MY9A 2OYKA 3W7OA 3FVMA 1SM9A 3JZUA 4M1RA 4E2BA 1PDYA 3LDVA 4MFEA 3T09A 4RXFA 3WLJA 3VNDA 1W1TA 1EH9A 2GWNA 4P7LA 1Z3NA 4LBUA 2EQDA 3WQDA 3GNRA 4YLWA 3QMSA 2W4XA 3BUVA 2NQ5A 2DUAA 3UZYA 1XLGA 1SJDA 3PPGA 3CL8A 4PTDA 1G94A 3GIQA 1IWPA 1HJWA 3VMOA 2PU1A 1W3HA 4NUWA 3REQA 3ZLGA 1MSSA 4XZLX 4LS1A 3XINA 3AHXA 3BSMA 2E28A 1O60A 2WMHA 2JKPA 4TQTA 4JTCA 1UC5A 4MF4A 3QPEA 5M3WA 3I4EA 2H3DA 3OB8A 1OD8A 2DVTA 3NQBA 4JDYA 3WLIA 1JDCA 5H91A 7TIMA 4XVDA 3EXTA 4QX4A 3W75A 4EXQA 1CGXA 1JXJA 1PKNA 1Q5MA 3BE7A 2JGYA 1VFMA 4HPJA 4ILSA 3H6OA 1QHPA 1HVXA 3T9PA 5I06A 5D8WA 2BDQA 4XAZA 3WDQA 1XISA 2J75A 2DVXA 2DH3A 3QV6A 2ASHA 4OVXA 1KW1A 4M80A 4J9JA 4N6FA 3WLPA 2VGBA 1Q7ZA 2PGWA 4XUYA 2WM1A 2CPUA 1S3TC 2XFYA 3VMPA 2V9DA 4EPBC 4GO9A 3NEHA 4XZ9A 4E4PA 4IIHA 4AZ6A 2UY4A 5FEXA 4NAEB 3PNUA 2FVLA 1C8VA 3C4UA 3U57A 1EA0A 2TODA 4PRWA 4BWLC 4AU0A 3G1RA 4JKMA 3R0KA 2XUCA 2XFRA 3TOYA 3T8QA 3INPA 3VD3A 2EGZA 1J0KA 2NVCA 1QOPA 4E2OA 4AD5A 4KT2A 4P7QA 3EKZA 3NIYA 3VIOA 4AVFA 3SCTA 2O92A 1E5JA 2ICSA 5DCBA 5GJPA 4GY7A 1TV8A 3FEMA 3L4XA 4I8YA 3GTHA 4PCFA 1JCLA 2BGNE 4KKXA 4DJDC 4JFUA 2F6XA 1W9VA 3G1AA 1AK5A 3HPZA 3ARQA 3BO9A 2PTDA 2FGBA 4P7NA 4HTBA 3CS2A 3C0JA 1VEMA 4CLMA 4JHMA 4IP4A 3APYA 4KCUA 3GXTA 3SAZA 1B5TA 4K8HA 1RV8A 1KRCC 3SRFA 4AD4A 1B3VA 3PZMA 2IPJA 4N0RA 1EIBA 3UXDA 3EWYA 4PC8A 2Z1WA 3EWZA 3S9YA 4OOZA 1XCFA 2FVMA 1GW9A 5CC3A 3ABRA 1Q8AA 4QM1A 1EC8A 2IPFA 2QUTA 4IMGA 2J7EA 3F4DA 2VQTA 1IXOA 4Q8TA 3FSTA 6A3HA 4H3DA 3KW3A 2Y5EA 4MWAE 4PSRA 2WMIB 1OF6A 3QN3A 3ZO9A 1F8MA 1UROA 2B7PA 4NASA 2DGAA 3FHQA 2GDUA 5F7UA 1V7YA 4AVNA 4WEVX 3MCMA 1X39A 1TFVA 1A3XA 2WMJA 3QQ1A 4FNTA 4AC1X 1UYQA 4L65A 3GZAA 2CNCA 4UR9A 4KFPA 5AB3A 1Q45A 1XDJA 2PFHA 1BYCA 1DWJM 3GG7A 3TQPA 4HMDA 4NNCA 1UWIA 1BSIA 3L66A 2IXUA 1CBGA 1K03A 2J25A 5LHFA 2BFGA 1ZTVA 2V63A 4N02A 1VPYA 1QMLA 3PULA 1Q6CA 1Z48A 4DIAA 1H62A 5EKYA 1UUMA 5DMNA 3P62A 1KFCA 3EGJA 3TXVA 4RW3A 3BSGA 3GFYA 5I23A 1B3OA 3GTIA 4XBSA 2WBGA 4PUJA 1C91A 1Q7QA 3JRKA 2FMNA 3BZJA 4GI4A 1THFD 1GCYA 4ZTYA 3JVAA 3TR2A 3MSYA 4YVXA 3FFSA 4PBFA 1ONWA 1AZ2A 3FKKA 2O4MA 2CZ5A 3W3OA 3P82A 1KXTA 2ISVA 3GDRA 1S2AA 3EMQA 4ADUA 1RP9A 1CLVA 3GR7A 3KOFA 3PM6A 3FLUA 3V3WA 4K38A 2E6FA 2DZUA 3CIVA 3LCHA 1JZ4A 2YOCA 3KS5A 2PWHA 2Y4SA 3K2GA 3VGHA 3GO2A 3AS0A 2ZICA 4GACA 3TNOA 4FOKA 4EACA 4GNVA 5C9XA 4WY0A 3NZGA 1JPIA 4XZNX 5LXXA 3NXFA 3C8NA 1E9YB 2Q3OA 5HWNA 3KDNA 3OLDA 1SVDA 4MZYA 3W1QA 3MCOA 1VFTA 3WQEA 4HNLA 2DZSA 1YE4A 1UR0A 3PZOA 4JTDA 1MFVA 1G67A 1BKHA 1CTNA 1L9WA 1AW1A 3H2AA 2OGYA 3P61A 3PUOA 3CMGA 4FPSA 5H8UA 3GVVA 1XIBA 1KFEA 2BY1A 3WEZA 4XV0A 4HU4A 4GGHA 4H8HA 4GI6A 1CCWB 3ABOA 2V0TA 4ZOCA 1E6QM 2ANUA 2FZMA 4GYPA 1DXEA 3HPXA 2AL2B 2FDSA 3RRXA 2ZA3A 1ODZA 1WKFA 4QSHA 2YXGA 1DV7A 4S2CA 4JXCA 3VX0A 4E4FA 1RK5A 3U48A 2P8CA 3G24A 2ACUA 4EPKA 1H63A 3IIZA 4LVGA 2OODA 4Q33A 3KBWA 7CGTA 1GOXA 5I2UA 4JDBA 2KAUC 5CAKA 4DI8A 2YJQA 3SCWA 4TX6A 4IUGA 5H2ZA 2P0IA 2PWVA 1XIDA 3HJZA 1TO3A 3SGGA 4W9TA 3A3HA 3GXPA 5BWFA 5C0QA 3VU2A 5AHLA 3C2EA 4AD1A 2YIHA 4EWND 4H9UA 2G0WA 5KTLA 2GUUA 1SZNA 2EKCA 2PTYA 4XKMA 5MKGA 3T0BA 3ENLA 4L4MA 4F9JA 2PS2A 3LGEA 2OPJA 2F9RA 4R85A 2BP1A 5M5DA 2BXZA 4DB7A 3VOJA 1KGXA 1WBHA 3O6AA 4TO8A 4PSPA 2E1WA 1KBLA 2R8WA 3V7PA 1NSJA 3AWNA 3B8IA 4JTEA 4D6GA 3RF9A 3G3MA 1TWWA 4GQ0A 1S46A 1X1NA 5U7SA 2IKHA 3W83A 4F2UA 1E4MM 1XG4A 1TR9A 1W31A 4U3AA 3S4TA 1B57A 4QP0A 1LOLA 5LHEA 2P3EA 2PBOA 4PZVA 4GIAA 2YSWA 3UG3A 3PTDA 5H6HA 3S1VA 1EBGA 2WNNA 3GU2A 1TMHA 3ZS4A 3UZJA 3A23A 3L5LA 2VM8A 1V0NA 3IGXA 3VUSA 4AYSA 1PTDA 4JGDA 4WRHA 4O50A 3OW1A 1IIGA 5A6KA 5EGRA 3GX9A 5GPRA 4HYVA 4DY1A 2AAMA 1FOBA 1W1PA 3E0WA 3MMUA 3NGFA 3QLLA 3PUGA 3ITCA 3PTMA 4PMUA 2D0FA 2YW4A 2WNZA 2AQWA 2G4JA 2QJNA 4N9DA 3BW4A 3TH6A 3TX9A 4Z2IA 1ONXA 4ZOEA 1JD7A 1HF6A 1TA3B 1YBQB 4JICA 3TN3A 4QR6A 4REQA 1BVWA 1X1OA 4KEZA 2ALDA 3QVQA 3VC6A 1UKQA 1J0YA 2V5CA 1R7AA 2WC4A 4UR7A 5TAOA 1C7SA 4W8LA 1UOZA 3ZQ9A 3THAA 4UQEA 2EKGA 4I5UA 3KCOA 1XFBA 4JQ3A 3EDKA 1OWQA 2PCEA 4Y90A 2FFIA 3BGJA 2ZDSA 3GVGA 3F03K 4RE0A 1C8YA 4A8LA 1GORA 1WNOA 5HUOA 2QEZA 4S3AA 2FLIA 2WOQA 3W85A 1ITCA 4A2RA 4TX9A 1GJWA 1Q6RA 2QR6A 4JZ5A 3R94A 4M24A 2DJLA 4Z2LA 5F4WA 1XLCA 3KBVA 1TZ9A 2IPWA 5CJNA 1NELA 4RX0A 4CNTA 4GG9A 4NYYA 5CPNA 1HJSA 2GVJA 3UEQA 2RUSA 4AW7A 1S2WA 4ORIA 4NZ1A 2RJHA 1OFEA 2CZDA 1JAEA 2G37A 3WQWA 3W70A 1GOIA 3BAIA 3KP1A 1XIMA 4A8RA 4C1NA 3FA4A 4L5ZA 1UMLA 4LUTA 1C93A 5DFAA 3LBCA 1TTJA 2PRMA 4TOQA 1ZJAA 8CGTA 2A5HA 5FSDC 3E12A 2NUYA 1GEHA 1IT0A 2DSVA 3LLXA 1RCOB 4HK7A 4IMCA 4CN1A 1FA2A 2GUBA 1CX9A 4JYDA 3TJXA 1NDVA 3P80A 1TR1A 1LRQA 2FMOA 1EDTA 3BLEA 1M41A 3W6LA 2OX1A 2OEJA 1NF7A 2W91A 3UVIA 1JULA 2WNWA 2CZEA 4TR9A 2ZXAA 5CPLA 1HNYA 4Y8EA 2DIKA 1TV4A 4H8VA 2R94A 3GD6A 4PULA 4DWSA 3HG4A 2XM2A 1R9ZA 3PTQA 3MBDA 4JTUA 4FLSA 1L6GA 5G1YA 1R3WA 2DUZA 3IIXA 3U5UA 3GDKA 3OGVA 1TRDA 3GH4A 1JRBA 3DBNA 4DBEA 1OBAA 2OO0A 4GZEA 4W5ZA 2C6QA 1WPCA 2OXNA 1A80A 4LS2A 3ISIX 3GC5A 1OD0A 4DXXA 3EBVA 1L8PA 2ABAA 2VL4A 1K7FA 2YCIX 4JY8A 4EAMA 2ZUTA 3BCFA 3O8AA 1PVNA 2QZRA 4PUDA 1OC5A 1JF5A 4WIWA 1UPMB 1XYFA 3MTWA 4ZTXA 4HCLA 4CD4A 4M6UA 1O1ZA 1JGIA 2H3BA 3UJSA 5IBXC 2KZHA 5I79A 5REQA 4CVWA 3PR2A 2Z4GA 2R1LA 1ZAJA 1J93A 3H23A 4LJ3A 1XR2A 2G3JA 2TPSA 4GX9A 1UR3M 2G41A 2XHYA 4NU7A 5HPCA 2PGRA 3I3EA 3KM8A 3BURA 2EPMX 2JFEX 1PBGA 3MHGA 5GJNA 1KRBC 3IGHX 1AD1A 2GJLA 1Q6GA 2PDXA 1G4EA 1LQ0A 1JPHA 2HPIA 3WO8A 7ENLA 2R1PA 3BGAA 1O5QA 2P1FA 1DWHM 4Z17A 2FH6A 4GY1A 4V1YA 4XAYA 5EY5A 1OINA 4E3VA 2WM0A 1X1ZA 3MJYA 5MF5A 3H55A 4MJ4A 5HANA 1BLIA 3VNJA 2CWNA 5A8PA 2PDNA 3ID7A 4GKTA 2CEQA 3V0TA 4YVPA 1LT8A 2ZXQA 4DJDA 4GX8A 3WMLA 5IDZA 2V3FA 3C0SA 2ZZ4A 1PIGA 3H2FA 4Z1AA 3NZRA 2BOGX 3NPVA 3VIKA 4CEXC 1QNQA 2Z1KA 2ZOXA 2XWEA 4ASTA 3R7MA 4RW5A 4P8WA 4HU3A 2JGQA 3NXLA 3W7CA 3QR1A 1GOMA 1XBVA 4O12A 3IK2A 2JIWA 2Q01A 3O6CA 1KFJA 4NX5A 4RV3A 3WK3A 4JL1A 1P48A 1PL9A 3V1PA 1ZAIA 4NT0A 3ZOAA 3OTRA 4DUVA 4W87A 1A5LC 1XUUA 1XD1A 2OT1A 2Y7EA 3DIPA 3RLGA 2OT0A 1H1YA 2ALRA 3G1YA 3QTGA 4Y7EA 2REQB 3TTQA 2ZRUA 3EMCA 3OZMA 5F2IA 2W61A 5CPOA 1QUMA 1W1ZA 3CQJA 5DANA 1HN1A 1WZAA 2WMGA 4MYXA 4XQ6A 1R3YA 1LBFA 3MHFA 5D02A 3LERA 4LCQA 3TLLA 2E9BA 4LVAA 3WLNA 1FWNA 5EFDA 1I0BA 2ACRA 4K3ZA 1RJPA 3UBPC 3G1HA 3TCSA 2BZNA 4IX2A 2JEQA 3E9AA 5LA0A 1XLKA 4FMVA 9XIAA 3EX4A 4HA4A 1S2TA 1XLFA 1JZ7A 1PX3A 1E6PA 3CH0A 3KBNA 2WJDA 5CZJA 4ERAA 1RPKA 3IAQA 2Z29A 5G1MA 4LVFA 1QWGA 3PWIA 1H5VA 3AXHA 4LF1A 4RE4A 2GDQA 3A4WA 4AXNA 1TUXA 4HNOA 1SO4A 4Q32A 4GVHA 5XIAA 3OGSA 4L4OA 4W7UA 3Q2DA 1Q8JA 4U5KA 3ZFHA 5EL1A 4HNNA 1F4AA 3VZXA 3G6MA 3TSDA 3MZ2A 4D8AA 1WDRA 3V16A 4HZ8A 1DBTA 3H4XA 3H53A 4H7ZA 1NP0A 1W8SA 1KM6A 3VDBA 3B9AA 3JW7A 2W79A 2VYOA 1QR7A 2WB5A 1AH3A 1BTCA 1W5OA 4CVUA 3R8HA 4Z1DA 1OJXA 3GXMA 4AMAA 3GRIA 3NVDA 1TZZA 1A3WA 1F74A 3PPCA 4A05A 3W73A 1H3GA 1SW0A 1V7AA 2WSQA 4ZB5A 2G50A 3HGJA 4DM2A 4US6A 4S23A 1H7OA 4TX8A 2VWSA 3AMCA 3MP5A 2F2HA 1YDVA 2ODOA 1QPOA 2HK1A 4A35A 2X16A 4XISA 3BG9A 2WVVB 4J3TA 3M0VA 2NQJA 1VS1A 4BQ2A 1LL6A 3WX7A 3EWUA 2OOFA 2PA6A 3H2NA 2EEXA 3CHFA 3PP7A 3AHZA 4B4HA 5FCZA 1AW2A 4IIEA 4GXPA 3ZSSA 3SGUA 4LUSA 3S6OA 1I75A 4Y9OA 4AEOA 4I7VA 2VWTA 5C55A 3N12A 5K9XA 5E0KA 3ZVHB 4YYFA 3N2CA 3S0CA 1YDYA 3XISA 1SMDA 5AYXA 2ZA1A 2O9TA 1RVKA 1O7AA 5D30A 1JL8A 4E6MA 1CXKA 4F40A 1MW3A 4M56A 1G69A 1WV2A 4WK9A 4JHZA 2W9MA 4ZBCA 4U10A 4LAZA 2PODA 5CSUA 4BZYA 2ACQA 3G1FA 3B4YA 1G5AA 5JXQA 1I60A 5E0FA 1GZ1A 3VE9A 3CAKA 4JFSA 4XBJA 3M5YA 2NW0A 1XJBA 4TMBA 3DHUA 1UWQA 3W2UA 1N8IA 4QG6A 5DT5A 2ISWA 3W81A 1VBJA 4H8NA 4HZMA 4DUXA 5AC5A 2J74A 1Y65A 5JQ9A 3BLIA 3GVRA 1H0GA 4LF2A 1VB9A 2Y62A 3WNOA 2HK0A 3IEBA 4KQNA 3N11A 3LSBA 4Z0SA 1O5XA 1LWIA 3WLTA 3SRDA 2NLIA 3W38A 3AS2A 3P3BA 3R5EA 1B30A 2WQPA 5L9FA 3T42A 5TNVA 3W1AA 4KH2A 4ZXLA 2AKZA 5E70A 3I68A 1TB3A 2ZRYA 3GY1A 3NSMA 4NI3A 1VHCA 2WSRA 3M0YA 2WSKA 2PI6A 3VKDA 3KXQA 1VJIA 2VC9A 1UA7A 2W5FA 1PEZA 4YXGA 2ZE0A 2PP3A 2YDRA 4WGHA 3SCSA 3ZXWA 3TFCA 4FR6A 2QDDA 4BR1A 3R0UA 3P6LA 5DMMA 1XS2A 1O1HA 1UOKA 3S5NA 1JZ6A 3RG6A 3GIYA 3TWBA 1EDQA 3WUBA 3URBA 2J77A 3G22A 3CZJA 3V18A 3GE7A 4JPGA 3MUCA 3M5VA 3RU8X 1ZAHA 2Q3RA 4ZFCA 5D9OA 4DUOA 5I00A 3EAUA 3O16A 3LYEA 4DAIA 3UZXA 2E6YA 4XD3A 2GVLA 3GXIA 3W76A 3M6DA 2Z00A 4O11A 2IQDA 4ERGA 1A5KC 2DH2A 4AZBA 5D9MA 4FHAA 4A29A 4NRSA 5A8OA 4ZODA 1HIZA 3RX3A 5LA1A 4I7WA 5CJMA 3U3HA 3NDOA 3OLIA 2VGIA 3UP8A 1VHNA 2VXNA 4IQEA 3UPBA 5JU6A 2PDPA 4QE4A 1FFRA 2ZKMX 3WUFA 3A47A 5SWUA 1M7PA 3VOIA 1RBLA 3I7RA 3B8SA 1GONA 4N6EA 2YB4A 3DFSA 2E4TA 2DSWA 4M3PA 4HIBA 3L21A 4C6FA 3R8GA 1UWSA 1XSIA 2FKPA 3E96A 2P8BA 4AAJA 3THQA 3IARA 3M0MA 1REQB 2EJAA 3NQ8A 4PTWA 3LNPA 3QMTA 1AZ1A 1I1WA 2X1TA 3WFLA 1QO2A 2BS9A 4H6KA 4MNJA 1OG0A 1U5HA 4N2YA 4OBTA 3W1MA 4PCTA 3EXSA 3UNTA 2ZRVA 4UTHA 3A9IA 3R0DA 3ZZ1A 2MUCA 1I8JA 4AG0A 1X8CA 4PMRA 1K8ZA 3FXYA 3KHDA 4ROPA 1EZ2A 5HA7A 2PZ0A 3ZSTA 1XYAA 3VXGA 1I0DA 4HP5A 1WXZA 3CEPA 1JEZA 4NJIA 4QS5A 4U31A 4AZ5A 2CLEA 3PWGA 4C6PA 1Q6LA 3GG0A 2HXTA 1KFWA 4X0VA 2F84A 2YZ5A 1W1IE 5E09A 3M44A 1SFLA 4DI9A 3LQLA 4YNGA 4MYAA 4L61A 1L6YA 4HQVA 2ZFAA 3M0JA 4WKHA 1BRLB 2QJHA 1ZCCA 3VOFA 1S1PA 1F3TA 5CZ0A 4J3ZA 2X0SA 3CUJA 5C70A 4YWIA 4NVTA 4H9ZA 4NYUA 2VFIA 3B0YA 4MDOA 4DQWA 4J3XA 4IX0A 7XIMA 8XIMA 2Y24A 3NR0A 3WJWA 1LWJA 3NFUA 4JNZA 2OYLA 3B03A 4GH3A 2CBJA 1E6SM 2XGBA 3VIGA 4YYCA 3LGGA 3PFRA 1CZ1A 4QLKA 4H83A 1YXDA 2VP8A 3ZLFA 2YBUA 1W1YA 2QVHA 4HCHA 4R3UA 5HNNA 1BD0A 4FX8A 5AHFA 1KM5A 1E4NA 3TJ4A 3UVAA 3MCNA 3KCLA 1R5YA 4WDWA 4KWSA 1P6CA 2CHRA 2EPKX 1G1YA 2DV0A 2Q09A 3UA4A 4QDPA 1GOQA 1YKWA 5DY2A 1B54A 3UG4A 4QGCA 4RNFA 3K1GA 5L6UA 1QPQA 2L5HA 2Z1XA 3ZT6A 3PBYA 2EG6A 3L4VA 2O0TA 3CZLA 1IZCA 1JZ8A 1AJ2A 1YTDA 2O55A 2QV5A 2BVWA 2I16A 3W7GA 3WBWA 2X30A 5CGMA 1K6AA 1V0LA 3APTA 3E74A 3UXAA 2YFNA 3A9BA 1V0KA 1CGYA 1Q63A 4UUIA 2DVUA 1YX1A 4PE8A 4ZQMA 1IGWA 2FPTA 1HUVA 2ZX8A 4C6BA 1XSKA 1CW2A 1SU5A 2B31A 1GZGA 1IV8A 1IR2A 5CJ5A 5JH1A 5DXYA 3WQVA 5GNXA 1I2RA 3QW4B 4GE8A 2BGSA 4CD8A 3T0DA 2XGIA 3AIVA 1UD5A 1DOSA 2V2HA 2A3BA 2DZAA 1AG1O 3LENA 5BXPA 1QBBA 1SR9A 3A4JA 3IRDA 1D3GA 4J3UA 3T08A 1JI1A 3EB2A 1TSIA 1WA3A 2YA2A 3WH9A 1NP2A 2WK2A 5HNTA 3PPFA 4R7WA 4UFKA 1EOMA 4FO4A 2QPSA 2VC6A 2PUZA 1V4YA 5HK4A 4YTQA 2TYSA 1EO5A 2DORA 2GWGA 3LBMA 2GSJA 4KMQA 3WEMA 1E1CA 4C6OA 1F3XA 2YL6A 3VKAA 1EUAA 2ABBA 4D6HA 1DJZA 5CPTA 2YYTA 3C0QA 2CLLA 3AJXA 1R87A 1SPQA 3NURA 3V5FA 4J4KA 4MSSA 2FH8A 3WJZA 2BY0A 2VC7A 4L4LA 1FWBC 2QMKA 3FS2A 1GKQA 2Y7GA 4QG9A 5CGTA 2WNQA 4HHHA 3W01A 2A3CA 2PU0A 4JTLA 4GA8A 2PDCA 2E3ZA 2VR2A 4E38A 4DBWA 1DP0A 3CL6A 3V5OA 3DYOA 4AEEA 4X60A 4KFNA 2DDXA 3B05A 4E2VA 3EDFA 1SJAA 3MY9A 2WSPA 1JI2A 1XYLA 1ZBWA 3GR4A 4QXIA 3ANUA 2VZSA 1S5TA 3WCZA 4CN6A 4WD0A 3W53A 4PTNA 4BJHA 4EPEC 4EVZA 1AQ0A 1S3HA 4RE2A 3WLHA 4S3CA 1JG9A 3SCVA 2PDUA 1UHVA 3T8LA 4DJFD 4AWEA 5AYIA 1W54A 2PURA 5GQBA 2DZPA 4AZCA 3L68A 6TAAA 1VCFA 1WYIA 3VMNA 3P5YA 2HQAA 2PTXA 4B5SA 4DZAA 5HUPA 4XAGA 4MY1A 5KSWA 5A6BD 5BNKA 3K1DA 3LM7A 4IP5A 4C7FA 3CQ0A 1D7FA 2DZTA 3OG2A 3SCUA 1X6UA 3G3DA 1LLOA 5DBTA 4Z2HA 4EF8A 7A3HA 1V08A 1H50A 4AY7A 4KFOA 4O14A 4H6RA 3TSMA 1T8QA 2QJMA 3SFWA 3WBAA 1AMYA 3N34A 5AZ1A 4NILA 5T91A 4AD3A 4E0CA 3MUZ1 3GZ3A 1TV5A 3BZGA 1TIMA 5BU9A 1KXVA 1PV8A 2BY3A 1VEOA 3HQPA 3UGVA 1SZEA 4N9BA 3W84A 3FGCB 2PDQA 1TPB1 1E6NA 4HPHA 3N2OA 3S9IA 5BU6A 4H00A 3MU7A 4ROQA 4CCEA 3T0CA 4CNSA 2RHGA 3UR7A 3ABSA 4WHBA 1I2NA 2OKTA 5ENLA 3QYSA 1E1FA 1Q66A 2E5CA 5K4XA 3DECA 1MUMA 2WAGA 3VOGA 1XLAA 1MZHA 4FF7A 1T41A 4AD0A 2ZZ2A 2H6RA 4ATLA 4XX6A 4Z2KA 1B4EA 3ZLHA 2G3FA 3KVJA 1PKMA 1UKSA 2JF6A 4MKVA 4V28A 3CZKA 5HWMA 2NX9A 3I6RA 2OLHA 4AIUA 2HWGA 2HBVA 2XIMA 1UASA 3CAVA 4BWLA 4AC7C 3TV8A 3MUAA 1QWKA 3UWUA 4CNUA 4D6FA 4CU8A 3ALFA 1FUYA 2ZVIA 2PP1A 3M1ZA 1IZJA 3CGTA 3GKFA 1FCVA 3H4GA 5A6BA 3C2VA 4POCA 3UYCA 4F0LA 3VGDA 4S3JA 3OODA 4TMCA 2C0HA 4LVBA 4M6PA 5T26A 1L6WA 4Q8WA 3P0WA 3AC0A 3MQTA 4UFHA 4H9MA 4DYJA 3THDA 1Z9AA 5D4YA 3OZYA 2J7GA 2Y8VA 3GBDA 4C6DA 1FWAC 3G0SA 1PTAA 6PTDA 2CW6A 3KVLA 2VGGA 4HNVA 1LCOA 4WSKA 3OPSA 4JTKA 4QDWA 2V5JA 1DJIA 4LW7A 1VFUA 2DIEA 5A2CA 3WLSA 3VE7A 1F05A 2NXGA 5CSSA 2ZX9A 1KLZA 3UJFA 4RJEA 1RZMA 5GVJA 1RA5A 2NQHA 4S39A 2NLYA 3PZIA 1D9EA 4QNEA 2XVLA 2HZGA 1H1NA 4BY3A 5TIMA 4UMCA 4OFCA 4UCFA 4HCDA 4ZL1A 3AALA 3CMFA 3DX5A 3EOEA 1JIBA 3B97A 1MI3A 3IWPA 1EYWA 5AKQA 5FF2A 4R34A 3H70A 4NJKA 3NQEA 1MXSA 1WZKA 4JIRA 4DJDD 3DKJA 1PHQA 4H2HA 2C14A 3I10A 1OX6A 2WHKA 3W00A 2QUUA 4IXXA 2ZZ5A 3S5ZA 1XCWA 1O6IA 4XD4A 2R6OA 3BL3A 3WLKX 3AIUA 1NFGA 2QQ6A 3CIWA 1NFBA 3OEXA 1FWJC 5D9NA 2VOMA 3TA6A 4Z42C 4L6DA 1VBHA 4IPJA 3DHPA 3TYZA 1V3JA 2GQ9A 4L9YA 1XRTA 1EC7A 4Q4QA 2CLOA 1BYAA 1E0TA 1HJQA 4YTSA 3MV01 1WDSA 3DFYA 3VNIA 1FWCC 2VD9A 3LBOA 4JKLA 3TXZA 3AYTA 3N6JA 3SRKA 2ZQ0A 5HINA 1VRDA 4XZMX 4TXEA 1OFAA 2V5DA 1T99A 1ZALA 2AQVA 2ON3A 3KX6A 1EX5A 1SYTA 2QCDA 4OWGA 5EMKA 1JD9A 4ADSA 1EO7A 3EPNA 3TDFA 1NFPA 5G4EA 2VOTA 4J40A 1JFXA 1PO9A 1PSCA 2DQXA 3VOCA 1FBAA 4C1NB 1PXGA 2HVMA 2PE4A 1Y8BA 1DQXA 4FOJA 4ZENA 4W7WA 4GFIA 4AHQA 3PZNA 3C2OA 4J7RA 3SY5A 1ALDA 3AXXA 4IISA 4S3DA 3G8RA 3LCFA 3VNYA 1RK6A 1XRFA 3LEPA 3I6TA 1QCWA 3VK5A 3LPFA 2QF8A 1OADA 3AZSA 4JCLA 3CV7A 1LYXA 3OYXA 4GYFA 3TMLA 3W0KA 3WFZA 4W8BA 4NNBA 3KCJA 3HPSA 5C71A 3LXBA 3CXOA 5A2AA 5C2XA 4A8IA 4YMZA 2UY5A 3H26A 2A1YA 3BCDA 3CUFA 4RUBA 3RM4A 1PIFA 1X7IA 4AZ7A 3HV8A 4NZFA 2EG8A 3RNDA 2E25A 1I9CB 4X0NA 4U33A 4Z0JA 3VCNA 2O9PA 1ITQA 5C6MA 1SZRA 5FF3A 1XDLA 4ONVA 5AVNA 3ECQA 2PDMA 4GIYA 1YHTA 1Y7VA 3TIMA 1TTQA 1REQA 3FYOA 1KWGA 4O18A 4BI5A 1L6SA 5ABFA 2R9RA 4A8NA 3C0LA 1VCGA 3RYSA 4WLCA 1NU5A 4JFVA 2XSAA 2I9UA 3P2VA 4KEMA 4RNHA 1DJXA 3I7QA 3EOUA 3TK7A 3WKZA 1UKOA 7REQA 3UWQA 2GJPA 4GBDA 1ADDA 3U0HA 1EA9C 1PHWA 3CV6A 3RR4A 3QOMA 3F4NA 1ZBKA 2VFEA 3I3DA 3QRHA 3QHOA 4MLRA 3MDUA 2G8ZA 3OHIA 4MVAA 3N29A 5A95A 2VR5A 3KP0A 3IJQA 5I3JA 1EZWA 3N2TA 3UWYA 3W2MA 3NAVA 1OCJA 2C1HA 1RBAA 4UNKA 2XIIA 2HRWA 2X40A 3BOXA 5FACA 1GGOA 4Q8QA 2HTMA 1GTHA 4AHPA 1FDYA 4WX2A 2PSNA 1JNDA 5DCDA 1QAPA 3NQGA 1UQZA 1JCXA 4LYPA 1DJWA 5CC6A 3VDGA 3BVJA 2ZUSA 1QTWA 1ZBVA 1DIEA 4H2CA 3R58A 4PTXA 1XBXA 2NZLA 1YDOA 4GO8A 4ACYA 1M7XA