4C6FA

Crystal structure of the dihydroorotase domain of human cad bound to substrate at ph 6.5
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
364
structure length
363
Chain Sequence
b'KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROOROTASE
publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 119
structure length 363
sequence length 364
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6fA00
1XRTA 3E2VA 2YB4A 1ADDA 1ONXA 3UBPC 1A5NC 2GOKA 2EG6A 3F4CA 4LEFA 3EWCA 4CQBA 1YBQB 2GWGA 2I9UA 4C6IA 4LH8A 4DNMA 1POKA 3GRIA 1FWDC 4GX8A 3CJPA 4DZHA 3CS2A 4C65A 2WJFA 2KAUC 4INFA 4J35A 3WYZA 3QGKC 4NI8A 2OQLA 4GX9A 4H9MA 1XGEA 4C6KA 1R9ZA 1V51A 1XRFA 3GU1A 3RCMA 1GKPA 2FFIA 2VUNA 1E9ZB 4C6NA 2YB1A 2AQVA 2FTYA 1J5SA 3E74A 4C6PA 3JZEA 4H9XA 4GY7A 4NG3A 5FSEC 1WXYA 3OODA 2Z27A 2VC5A 2HQAA 4QTGA 2VHLA 3TN6A 2R1LA 2Z2BA 4HA0A 4IFOA 4P5UA 5A6TC 4NP7A 2Y1HA 1EJSC 2ZC1A 2P50A 4GK8A 4J5NA 1YIXA 1E9YB 4RDZA 1A4MA 3TN3A 3URQA 1PO9A 4ICMA 4DLFA 3PANA 4L6DA 3V7PA 3O0FA 1PSCA 4RDYA 4RDWA 3LGGA 4C5ZA 1KRBC 1R9YA 1EJTC 1NDVA 3UF9A 1FWIC 3F2CA 1YBQA 4RDVA 3A3XA 1FKWA 1PB0A 4GBDA 3R0DA 4WVXA 4F0LA 2E25A 3SFWA 2Z00A 2YXOA 1UBPC 2FVMA 2Z25A 4XD6A 3LA4A 2OGJA 3HTWA 3O7UA 4LCSA 2GZXA 2GWNA 4LFYA 3MPGA 4DI9A 3GIQA 4KERA 1EJUC 4UB9A 3GIPA 3UPMA 4WHBA 4GC3A 3DC8A 4QSFA 3MJMA 3LGDA 1RJRA 4F0SA 4J2MA 3K4WA 1IE7C 1EZ2A 2RAGA 1PTAA 2AQOA 3MVTA 4C6LA 4HJWA 1JGMA 3LU2A 4GY0A 3TNBA 4DLMA 1QXLA 2E1WA 1QW7A 2Z24A 4RE0A 2O4QA 4WGXA 1FKXA 1BF6A 4H00A 1ITUA 2I5GA 2DVXA 1RK5A 3GTFA 4G7EA 1FWHC 3B0XA 3F2DA 4C6QA 2QVNA 2HNHA 3OU8A 4EPEC 4C6MA 3IRSA 1RK6A 2PGRA 3AU2A 2ICSA 4LCQA 1EJXC 4LANA 4R7WA 1A4LA 3TN5A 4DYKA 3G77A 3OJGA 4M51A 1NDWA 1K70A 2PLMA 1O5RA 3E3HA 2Q01A 2A3LA 3T8LA 3MDUA 1YNYA 3F2BA 3S4TA 4PCPA 3DUGA 1KRAC 4H9VA 4F0RA 1YRRA 4H9UA 4PE8A 4HK6A 1EF2A 1NDYA 1XWYA 3S2LA 4QS5A 4CNSA 1KCXA 4KESA 2QS8A 3EGJA 3IGHX 4I6VA 1FWFC 3A4JA 4PCNA 4XAGA 2GSEA 3BE7A 4IGMA 3IV8A 2Z7GA 4BKNA 2VC7A 3MDWA 2OB3A 3RHGA 3MSRA 3ISIX 2R1KA 4EP8C 3EWDA 3OVGA 4KQNA 4KEUA 3TN4A 4IF2A 1R9XA 3D6NA 3NURA 4GY1A 4B91A 2Z29A 4IFRA 3RYSA 3GTHA 2D2JA 1RJQA 4E3TA 4R88A 3S2MA 3OQEA 3MTWA 1POJA 2CZVA 1FWCC 5HMDA 3HPAA 3MKVA 4I6KA 1ONWA 4AQLA 4PBFA 1ITQA 3PNZA 3C86A 1I0BA 2EG8A 2EG7A 2QT3A 3HM7A 2PUZA 2XIOA 4KF1A 4C6CA 1ZZMA 4KIRA 1UIPA 3PNUA 4L9XA 2WJEA 1UIOA 4D8LA 3ITCA 3UR2A 4BJHA 1P6BA 2AMXA 4DIAA 4XD4A 4H9YA 1RA0A 1J6OA 1A5KC 3AU6A 4OFCA 4EPKA 1EJRC 4C6EA 1A5MC 4XD5A 4IG2B 3WMLA 2DVUA 3E0FA 4LAMA 2FTWA 4CNUA 4LCRA 4EPDC 4HK5A 1V7AA 3IARA 3IPWA 4IQJA 3QY8A 1KRMA 4C6OA 1DPMA 1NDZA 4B90A 4H9ZA 1M65A 3FDKA 1FWBC 1VFLA 4GYFA 1J6PA 2HPIA 1FWAC 2R1NA 2Q09A 3F4DA 3NEHA 2YZ5A 3QY6A 5FSDC 3ORWA 3AUOA 3URAA 3OOQA 4BY3A 3URNA 2HPMA 4YIWA 1V77A 4IFKB 2R1PA 3T81A 1FWJC 2OODA 1K1DA 4KETA 4IGNA 4C6DA 3RN6A 2WJDA 3LSCA 4HK7A 5HMFA 1V79A 4LAKA 3LS9A 3GTIA 1WXZA 2HBXA 2BB0A 3FEQA 2UZ9A 3GG7A 3LY0A 2FVKA 1RA5A 3N2CA 3NQBA 4ZSUA 1P1MA 1HZYA 2Z28A 2Z26A 2PAJA 1GKRA 3B40A 4V1XA 2Z4GA 4UBPC 5CH9A 3QGAC 4G2DA 3GU9A 3WZ0E 4XAZA 4IG2A 3T1GA 4ERIA 4IH3A 4C6JA 4AC7C 3KM8A 4ERGA 3A3WA 4XAFA 4H01A 3LNPA 1YMYA 3UR5A 2IMRA 3PAOA 1KRCC 4C5YA 2P53A 1K6WA 3K5XA 1J79A 4GZ7A 2QPXA 2UBPC 1GKQA 3MVIA 4G7EB 2OOFA 4XAYA 3ICJA 1EYWA 5E5CA 2BGNE 2ANUA 4RZBA 4ZSTA 5HMEA 3S2NA 2Z2AA 4DZIA 2F6KA 4B92A 1RJPA 3E0LA 3B0YA 5G4HC 3DCPA 4QRNA 4H9TA 4EPBC 5AKQA 4IFKA 2D2GA 1M68A 4JOMA 4KEZA 4V1YA 1O12A 2VR2A 3IACA 4QS6A 4C6BA 1RAKA 3FDGA 3IJ6A 3GU2A 1EJVC 1UMLA 4CEUC 3E38A 2PGFA 4CQDA 4DI8A 4CNTA 2G3FA 1V4YA 4B3ZA 2DVTA 3S2JA 2WM1A 4LAOA 3QY7A 4ERAA 4CQCA 4KEVA 3K2GA 1FWGC 3ID7A 4GXWA 1M7JA 3LSBA 4LALA 4C6FA 4Z42C 1EJWC 2ADAA 3SO7A 4R85A 5LXXA 3URBA 1A5LC 2VM8A 4CEXC 4PBEA 3GUWA 3GTXA 2R1MA 2W9MA 4TQTA 1W1IE 4GOAA 1A5OC 1NFGA 4QROA 4XD3A 1FWEC 3CAKA 2O4MA 1S3TC 3PBMA 4MUPA 1P6CA 4C60A 2D2HA 4DO7A 2HBVA 1I0DA
chains in the Genus database with same CATH superfamily
4A4AA 2VDIA 4LEFA 4MB1A 1BTCA 5SWUA 1SW0A 2YA0A 1POKA 1RQEA 3W22A 2AGTA 3N15A 2QV4A 2QCLA 1F07A 3P8IA 1GEHA 1KCLA 4URIA 1FRBA 1GPWA 1KCKA 3MANA 5EBUA 1TJ0A 1GVRA 2W91A 1EQPA 2XUCA 1KGXA 2CHNA 4HQVA 4QJ4B 1XGEA 4JX4A 4IJRA 4PMYA 1CDGA 1OC5A 3C0JA 1HJXA 3UY8A 3T09A 1MRQA 5CSYA 2KX9A 3U2CA 5D8WA 4W4QA 3VU2A 2WC7A 4J1OA 1ME8A 2CLHA 4RNFA 4D71A 1CB2A 3QSRA 3RK8A 3FXYA 3H2EA 4PMNA 4S23A 2D0HA 1OM0A 3CT2A 2LLEA 4J5NA 4O1DA 1AODA 4B4HA 2WPBA 3WUEA 2I57A 3N2XA 1VZWA 3R13A 3IEBA 3W71A 3WK1A 1OIFA 4B15A 3WQ5A 1DIEA 1TELA 2IQDA 4Q8VA 4RV8A 4FOUA 3VNIA 7CGTA 3QYQA 2OGJA 5FJRA 4Y2WA 1Q2RA 1LBLA 2I5QA 3Q65A 3HTWA 5HWMA 1RPXA 1XH1A 1QI4A 1VFUA 1MYRA 3C6CA 1M3UA 1M6JA 4TR9A 1F8MA 3GC2A 1JZ3A 1U2YA 3LUTA 2ALRA 5FEPA 4CVWA 3NOYA 4GYPA 4J3VA 4RX0A 3G2GA 4UTLA 4AX7A 1E51A 2PURA 4I7VA 3TUUA 4PULA 3LB0A 3F5KA 3G1SA 3UWEA 4UQCA 1E6PA 3POHA 2QVNA 1PKNA 3WKZA 3SQSA 4V2XA 2VFFA 5EKYA 1DJHA 1OF6A 3T4CA 4RE4A 1I1XA 3CV2A 3N2BA 4QJ5B 3NPVA 4AWSA 4G7FA 4XZBA 3W2JA 2QULA 4GI4A 2Y70A 1WX0A 5C2GA 1BPLB 3W9ZA 3CU2A 7REQA 1NFPA 2V5DA 4OE7A 3CPRA 3BMXA 4OUEA 3WD3A 4GUGA 1S2CA 4PSPA 1KRAC 4F0KA 3EZ4A 1GHRA 3HB9A 3S2LA 3CZKA 1S38A 3IVSA 4PEEA 1XDLA 3ZSTA 3R2GA 3ZOAA 3A4JA 3P80A 1C9DA 2DZAA 5A6LA 3IV8A 4BKNA 2DZSA 3LCLA 1WDSA 1JDEA 3NQEA 4LBSA 3ERPA 2TYSA 3VZXA 4MGGA 2Z29A 4MWAE 1XH0A 1M04A 4ICCX 3KOYA 3GTHA 2BY1A 5H91A 1X8CA 4PRRA 1GQKA 2WV8A 1EOMA 1VFMA 2CZVA 4RZ6A 1JYNA 4L61A 1UR0A 3V75A 2NQHA 5H6HA 3YPIA 5A5WA 3TC7A 1SZRA 1N2VA 3TR2A 2VXNA 2L5HA 3QHOA 3FYOA 1C7SA 4B3KA 1GVYA 4FEZA 4DPPA 4RUBA 1GQIA 3H23A 2OMAA 1LUCA 4RK8A 1TO3A 5AFDA 4KWUA 5HJXA 1RHCA 3I10A 5HJLA 3CYVA 5E09A 3ME3A 3LHVA 3WLNA 3WQ6A 3EWWA 2HEJA 1G67A 3FFSA 4U10A 1TFVA 3TCSA 5HWNA 4W84A 1CXFA 4IL2A 4DZ5A 3UG8A 2XSAA 2C6QA 4R34A 4DXKA 3DOPA 4NZ4A 3FJ6A 4NZ3A 4A8NA 1HKMA 4IQJA 3GDKA 1NDZA 2FPTA 1J0KA 3RUBL 3TWBA 1Z48A 3B9OA 3M44A 1XBZA 2YZ5A 3VD3A 2YBTA 1K8CA 1VBHA 1XICA 4EIVA 2BVWA 3HQ1A 4YIWA 2NXGA 3SY1A 1GVOA 4O4WA 2D73A 1IT8A 3GB6A 4AZ7A 3EOOA 1Y5VA 2OLAA 5GVJA 4JEJA 4DJEC 3FNDA 1XYAA 3WJSA 4OKDA 4GUHA 1JPKA 2FVKA 4ENLA 4KW2A 3BV4A 3RILA 3QLLA 1VEPA 1A0EA 2PAJA 2G50A 4LYKA 1SO4A 1P7TB 1W6TA 2PCEA 4QJ3B 1CEOA 3S6TA 3ABOA 3MA8A 5FESA 3UCDA 1S5NA 3VIFA 4QBXA 1IGSA 1HUVA 2ZZ2A 4IPLA 3EB4A 2ISWA 2O56A 2WSRA 3GXTA 1XW8A 3VXGA 2IKGA 1ZFJA 3S46A 1SO5A 1RH9A 1X8FA 1TG7A 2WVTA 5M2FX 3DCPA 3AWOA 4L1GA 4ZEPA 3CH0A 1H0GA 2C0HA 3MZ2A 3BLIA 1MXDA 2NVAA 4M8UA 3H53A 1F3WA 2DZWA 4CQDA 1LBMA 1EWDA 5CPNA 3SCPA 4EANA 3F5LA 3UG5A 2PBGA 4LALA 3D3AA 4KFPA 3DI1A 3L4ZA 5LXXA 1F74A 4O0ZA 1UROA 3K46A 2OEMA 1D3CA 2PGWA 3FA4A 2ZOXA 1EFZA 4FX7A 4JBRA 1SJDA 1GTHA 1TTIA 1NELA 4H19A 3KE0A 3V36A 3TW9A 3VIOA 3WUGA 4GE8A 1ZY9A 4Q3MA 3G1FA 1R3SA 4MPKA 3VM7A 1JCJA 2HVOA 3QFEA 4FOJA 3VZYA 1OGGA 1U83A 3CIXA 4X2PA 1IXNA 2RDWA 4E8DA 4JTJA 1ZBCA 2X1TA 1MVYA 4GVIA 3GRIA 4TU1A 2EXOA 3O0KA 1KM3A 3GFZA 4HPXA 1IEWA 1XJBA 1R3YA 3EDKA 2JGYA 1AL7A 4YU1A 3KX6A 1WZLA 1HW6A 2ACRA 5E6ZA 3OIHA 1W5OA 4H8VA 5I24A 4ES4A 1VS1A 2R6OA 3THUA 4Q8MA 4C6NA 4Q4MA 2YB1A 2FTYA 1HJUA 4W88A 3VKAA 3H8AA 5KINA 1XBVA 3M5VA 4UQEA 2YCKX 4PMQA 3AYVA 1PPIA 3LM3A 1YADA 2GQAA 1QOXA 4IT1A 2E0PA 3O16A 5I23A 4L1WA 1US3A 3AHVA 3VAVA 1E9YB 2RGLA 3APGA 4MWAA 1QRQA 5E0CA 2TPSA 5AC5A 3IVUA 3MV11 3ZR6A 2ZVIA 4B9ZA 1WA3A 1C91A 1IXPA 3AMDA 3M41A 3M5XA 1V6TA 5IDZA 4GVHA 4GBDA 5C9UA 2A6NA 2NW0A 3A3HA 2UV8G 2YXOA 4PA8A 3KXQA 4M7SA 3COTA 1U5HA 3L5MA 2XINA 3KFTA 3H2AA 3B8WA 3M0ZA 3QW4B 4YWIA 3TA9A 3W7EA 5DY2A 3CUJA 3UPMA 3AMLA 4CLMA 4M80A 5EB8A 3RX2A 5T26A 1Q45A 3RX3A 2W62A 4ONVA 4HMNA 4PBGA 1UOZA 2WKLA 3BLDA 1Q66A 4O1CA 1EP3A 4GZEA 4AZCA 3G5EA 1ELSA 1Z41A 2ZZ7A 2GJXB 1G01A 3O6YX 1QR7A 4C1NB 2WHLA 2H90A 4ALDA 4DYKA 1U1HA 1AD1A 4JTHA 4WEVX 5IDIA 5MKGA 1VPYA 2D24A 2X40A 4L56A 3EDFA 3UWZA 3CPGA 2CHRA 1S46A 2PWHA 3NQ6A 2KZHA 3KWXA 5IHSA 4PE8A 3MO4A 2I7GA 1S5MA 3NVDA 1FDYA 1Z69A 4FPSA 4PUJA 3BMWA 3BPWA 3GBEA 4HSOA 3TYUA 5LZLA 1TWWA 2YCLA 2WSYA 2DZVA 2PDXA 1TWDA 2ZWZA 2ZRWA 3RHGA 2CWNA 4TUFA 1XLKA 2AQWA 2EKCA 2JGQA 3VMNA 3MQTA 4B91A 1PKYA 3QTGA 3WSUA 3MCMA 2OVLA 1B1YA 3WJYA 4NY2A 2Q8ZA 2VQTA 3BANA 3BXWA 4ASTA 1F73A 3UG4A 1YXCA 1ITQA 3LTPA 2VC6A 3PNZA 3CB8A 2FIQA 4FALA 5ABFA 1CXLA 3R4IA 3B9EA 1ZZMA 1UP3A 4ZFCA 1XYFA 2QJHA 3DFYA 1V6XA 4AEEA 1VLIA 1YDOA 3ZXWA 1NU5A 1P6BA 4IQLA 1JRBA 1V3JA 2ZC8A 3M5YA 1FHLA 1PXGA 3M5ZA 4Z2IA 4LC6A 4I90A 2V2CA 4BQ3A 3WDQA 1PX4A 4JCMA 2MUCA 2DVUA 1KM5A 1GUVA 1UUQA 3NQ7A 1J0ZA 2YZRA 3ZJKA 2YL8A 3MBFA 4A6GA 4BI5A 3DGRA 5J04A 1EP2A 4HNTA 1UC4A 5L6UA 4EF9A 1IIHA 3FA5A 2NUXA 1WPCA 5DLCA 1QO2A 3L4UA 3BC9A 4BR1A 4WD0A 1QAPA 2CKRA 3BGGA 3VUSA 3QGVA 1XSIA 2EJAA 5XINA 3TYCA 1AJZA 4RKAA 3LRKA 3W1QA 1A53A 2E9LA 3F4NA 4R33A 3GHSA 3OYZA 2FQIA 1EGVA 3I7SA 2HBXA 3OVRA 4JYDA 5LIXX 2C79A 2FH8A 1WE5A 5AYBA 2VEIA 1IV8A 2IXVA 1D8CA 2Z4GA 1E15A 1EL3A 2HMCA 3FJLA 4F4RA 4EAYA 4XZHA 1HIZA 1XR2A 3W28A 3FAWA 3LNPA 4XZNX 1FVPA 3B4UA 1M01A 1GOOA 2P53A 3VABA 5F4XA 2DU2A 2YA1A 3U0HA 1TPDA 3CMGA 3ICJA 3RU6A 4P61A 2BGNE 4PTNA 2WZHA 3NGJA 1R6WA 3B0YA 3ELFA 1MUWA 2OLSA 5AKQA 3FAXA 1UKPA 1WYIA 3KDNA 2JE8A 4MVAA 2QCGA 1Q6LA 1UMLA 1QNSA 1UR2A 3SCWA 4J2PA 4LAUA 2J7HA 2G4JA 4UQDA 4QG8A 5A6JA 2GJNA 4YS1A 4GI8A 1QWGA 1E0VA 1SGJA 4D1JA 3PY2A 4KWSA 1H4PA 2FPYA 4PC8A 4M7TA 4FNPA 2X41A 3ZWSA 4OOUA 3Q94A 4LPCA 2C7FA 5HK4A 4TMBA 1S3TC 3OA5A 4PN2A 1JZ5A 3QW3A 1XM3A 3ITTA 5J5RA 1JFHA 3CL8A 4MOZA 4WXYA 1ONEA 2BOEX 1WXJA 3K8LA 1XDJA 3H2OA 4UTTA 4GD0A 2ISFA 2O9PA 3JVAA 1V0MA 2ZXBA 1XRFA 2WWCA 3LG3A 2FMNA 4M19A 4XBSA 1RQBA 1OX6A 4MF4A 4XVDA 3CQ0A 4RZ5A 4AXNA 2HISA 1BWVA 2AGKA 5CLWA 3VPLA 2ZXDA 2VFDA 4LF2A 4Z08A 1TZZA 4BA0A 4Q8NA 5DELA 1PZ2A 4GHRA 3MT1A 4DY1A 2PLKA 3BL3A 3OBEA 4H2CA 4YTRA 1MXSA 3G6MA 1X1NA 4HNLA 2J8FA 4K36A 1ZCCA 3R0KA 4WUIA 3DIPA 1XFBA 4JTGA 3QPEA 4IQEA 4RDYA 4WDWA 1Q6OA 4N0RA 3B8DA 3M6YA 5CJNA 1FKWA 4GIEA 1PB0A 4M3PA 3ALGA 1XD0A 2VGGA 4F0LA 2V5LA 1K4HA 1R0MA 2F7FA 2WKGA 4JFTA 4L4MA 1E1CA 1W1YA 1AJ2A 1AMKA 4YL2A 3MPGA 3TW7A 3PPHA 5H1WA 3T40A 4G5DA 1AQMA 5CKSA 5JBEA 1KA9F 2VX5A 3RX4A 4QAWA 4K37A 4ECLA 3VGBA 4KKXA 1QXLA 4WOQA 1GYMA 3CWOX 1AW2A 5LGZA 5D9NA 3GTFA 3T55A 2OYLA 1FWHC 5I2UA 3NQ2A 4YCPA 4BQ5A 1E1EA 4X2RA 4JNYA 4BWLC 1BAGA 1VBUA 1YTEA 4ZXLA 2OSWA 3N2TA 4B5WA 3FW6A 3IGXA 4UMCA 1OFDA 1EYEA 1UR1A 2DZTA 4UFIA 3GAKA 4N6FA 2V5KA 2Q01A 2FJKA 3Q2DA 2C14A 3VNDA 4O18A 1R2SA 1F4HA 3UD6A 3KS6A 4K7YA 4M1RA 4F0RA 4LS2A 1NDYA 3A13A 3KAOA 2PZ0A 3GW3A 4IMCA 3D46A 4RV3A 1YTKA 3WY1A 3GNPA 1CECA 4JZ5A 2OB3A 1YX1A 3UQNA 2OU4A 1UBSA 4KEUA 2WM0A 4PCSA 4IF2A 3R94A 3TN4A 4D6JA 3B8UA 3R0UA 5CZTA 4Q7BA 2FLIA 5E70A 1WZKA 1LOLA 3R89A 2GYIA 1VLWA 3TIMA 4AD2A 3AJXA 1TV4A 3MTWA 3PG8A 1HFBA 3EOLA 1PDYA 2ZX5A 2PF8A 2WMKA 5DMNA 9XIMA 4LW7A 3CZGA 3H7VA 4QQUA 3VIJA 4E38A 4GA8A 4JQ4A 3BLOA 5IHRA 1F6KA 1I0BA 3HFYA 1O7AA 4UR7A 2XSXA 3N19B 1S1PA 3TFXA 2Z6IA 1FH8A 4LY4A 1DQXA 4Z2LA 4NASA 2CBUA 1JUEA 1PHWA 1Z44A 3SCOA 3LBMA 4IJCA 3A21A 3L23A 3OP2A 4IQDA 1EX5A 3DEQA 2CYGA 2ZCGA 4ORIA 5J5DA 4W86A 3LBCA 3VNKA 1ZAJA 1EJRC 1H2JA 2HVMA 5G1YA 2V68A 3OVQA 5LNRA 3T6CA 1SQ7A 1TYGA 3I6TA 3UU0A 3KVJA 5I03A 1O5XA 2OG9A 2PDGA 1QPKA 1YE4A 2V9DA 4CNOA 3T4WA 3OBKA 3TQKA 3F5JA 4LV4A 4Z1DA 1TR1A 5FSDC 3IUHA 4FAMA 4MY8A 4AVFA 3OOQA 3CXOA 3GXMA 4J9JA 2Y8KA 4W93A 1H5YA 3NFUA 3EOUA 4Y9NA 3ITYA 3EPNA 2C1HA 4AVNA 3S5ZA 4A21A 4PMVA 4ROQA 4IMAA 3PZTA 3PUEA 2VEPA 4HNUA 2BVYA 3WF2A 5ABEA 3NIYA 4LS0A 2OZ3A 4JHMA 1KXHA 1MFVA 2HWGA 4AFYA 4UBPC 4DJEA 3CQIA 3IJ8A 5CZJA 3THQA 3T1GA 4YCOA 1H3GA 4C6JA 2QXWA 3RU8X 4W5ZA 3KEHA 4LB4A 1XS2A 1UD2A 2PS2A 4S2CA 2FZBA 1J79A 4O4VA 5CZKA 3VIKA 2NLYA 5HMEA 3WLMA 4EE9A 1V0LA 4S38A 3KOFA 1GT8A 3GY1A 5AN7A 2R14A 2VFEA 4RW5A 1FWSA 1XLJA 3TJXA 4C6BA 3FDGA 3GU2A 3W7GA 3NL3A 4GG9A 1W3LA 1XBXA 3ID7A 4K7VA 4GVFA 3IRDA 1HKWA 3O3RA 3QMRA 1GORA 1TMHA 2PRLA 1MW3A 2QUNA 3S3GA 3VKJA 3VOIA 1WUFA 2CLKA 1YKWA 3VDGA 4AIBA 1EA9C 4HOZA 3FOKA 1NFGA 4E6MA 5MF5A 4RLIA 1QI5A 2RH9A 3WO8A 1QI3A 2JEQA 3HIJA 1UZHA 1Q6QA 4BI6A 3E2VA 1XIDA 2V30A 2PTDA 4LXFA 6REQB 3DG6A 4JQ2A 1L6SA 3W74A 1QTWA 2GWGA 1PIIA 3UZJA 4ZFMA 4N2YA 1VEMA 2J8TA 5HANA 2CWXA 1K9TA 1QPOA 1ZS2A 1AW1A 5EMKA 1UPPA 2ZA1A 4INFA 4UQBA 3CQJA 4QLLA 1T0OA 3VD7A 3QGKC 1DTNA 3JR2A 4KS0A 4QE5A 1ME7A 1KFKA 3WD1A 2YFOA 4DBSA 3GE7A 5D2XA 3R1ZA 1A5CA 1SW7A 4OJYA 2YPIA 2VEKA 3BG9A 3BH4A 5E0FA 4GY7A 3W6MA 3OODA 4HU8A 1QFEA 4DO6A 2OEKA 2J9XA 1TPB1 3WFAA 4JHZA 3VDCA 2YJQA 2ZC1A 3LCHA 4GK8A 1EDTA 1YPFA 2DJXA 5D4YA 3KTCA 4WF7A 4B4FA 3E0VA 4NZFA 5JU6A 4UUIA 5GPRA 4C5ZA 1OT2A 3GNXA 2XM1A 1BQGA 1UP0A 1ZBWA 4XIMA 3TFCA 3KBWA 3KHDA 2ZUTA 3OG2A 4WVXA 4LT9A 6PTDA 4XV0A 2E25A 3DAQA 3G1XA 1OABA 1OADA 1S5WA 2FZ9A 3IV3A 9RUBA 1E0WA 4LFYA 1VF8A 1A5BA 5FL1A 3VX0A 2PD5A 3HJEA 4XB3A 4AHOA 4XZMX 4TX8A 4TMCA 3UR7A 3DU0A 3A12A 1IE7C 3K4WA 1Y5XA 4ZB5A 2XN0A 1VBJA 1E55A 1H41A 4HHPA 3GFYA 3GH5A 1QDSA 2NSOA 3OHMB 1H5VA 5HWJA 2QGHA 2ISVA 1O94A 9CGTA 4O8AA 2E28A 2I5IA 1OYCA 5E0KA 1X7FA 4LANA 2Y89A 3U8GA 4Q8PA 1Z32X 5LKYA 2VRKA 4PMDA 3STPA 3SB0A 4XKMA 3JU2A 3IJ7A 1F5ZA 3SGGA 4QFUA 2J4GA 4H41A 5AYXA 1E6QM 1O5QA 4C91A 3N73A 3QQ1A 5BW6A 2JIEA 1DQUA 2F84A 5JVLA 3DUGA 3AUJA 1IZJA 4UTKA 3NDYA 4MJMA 3P61A 1UKSA 2X30A 4L7ZA 1EPVA 3DG7A 1XISA 4LRTA 2H9AA 3QSTA 1RVKA 4ZBCA 1OY0A 4K8HA 4S3AA 5FEZA 2BS9A 2XH4A 2EF9A 1OFOA 1KBIA 3D6NA 1VD6A 1RCOB 1VJZA 3AZSA 2W63A 5HAOA 3BZGA 1GG0A 1VPQA 3CV6A 7TAAA 5CGQA 2DJLA 3FSTA 4US5A 4MFEA 2WXDM 3PZMA 2O7SA 5CPSA 2OSYA 4J3ZA 4LAZA 5CSSA 3W7MA 1MQPA 3GS6A 1CTNA 3QFWA 3RR1A 3MCOA 4ROPA 2XVPA 3SN0A 3UJSA 4RCXA 3W1UA 3L66A 1HL9A 1HKVA 4GCXA 4WZHA 3UXLA 4ZGYA 1J11A 2XIOA 2RHGA 4MMWA 5LIWX 5FAGA 4JXCA 2FZMA 3DECA 1VAHA 1UA3A 4REQA 1R3VA 4IMEA 3WMBA 3AAMA 5BOFA 3VOFA 4AF0B 3AIEA 4H9YA 4N7QA 5GNZA 2PWDA 3A4AA 3CMJA 2ZTJA 2YDQA 1D9EA 5D9MA 3WQPA 2J66A 3FA3A 3DZ1A 4FR1A 2GGEA 9XIAA 3HMJG 3TLLA 5A94A 2YBVA 3QBUA 4XTIA 4K1GA 4QR6A 1R38A 1XC4A 1E3ZA 4IICA 3B0PA 3A24A 3W38A 1L0PA 3THDA 4J4KA 1XCXA 1KD0A 1K1DA 1HP5A 3R79A 2A4AA 1KBBA 1IYXA 4LEQA 2V81A 3QQ0A 5CQ1A 3GVRA 1B3ZA 1MNZA 1SJBA 1KM1A 3BZJA 1H51A 3GG7A 5RUBA 2BY2A 3W83A 4ZODA 1AUSL 2ZTKA 3UT0A 1UJPA 1SM9A 2XDFA 3BW2A 4HPHA 1KNWA 2Z1WA 4GJJA 3U7VA 4Q8QA 4XAZA 3VDBA 2CBJA 3PTMA 2WK2A 1OFAA 2BMBA 4UTMA 3VDAA 1KQYA 3GO2A 2Q3OA 4MYXA 4FNSA 4WR3A 5AYIA 3WLKX 3P60A 4NJIA 4R7JA 2Z7KA 5F2LA 2Y5EA 3DKLA 3OGRA 1P6WA 1GOKA 1M68A 2GGIA 5D05A 1MUMA 2VEMA 1CZ1A 4EXBA 3HA1A 2Y2WA 2VNCA 3EWYA 3QR1A 4TX9A 2BWGA 2WM1A 4KRZA 4JIPA 1I1WA 3MMWA 4MTVA 2UY3A 2JKAA 2CLFA 3QJAA 1TMLA 1UZDA 3B06A 4DEFA 3STFA 3K4AA 1E6ZA 1GEQA 1PBGA 2VX4A 3CAWA 3H6OA 3QLDA 4CN4A 3RMJA 3LPOA 1P0EA 4JPGA 4AZ5A 1GVSA 2E7FA 4FF5A 3AXKA 5HNUA 1W3HA 3DYOA 3T0AA 5BYWA 4PMOA 2GDUA 1Q7ZA 1XYZA 3WQFA 2PTZA 4DF2A 1S39A 3M1ZA 1VYRA 2WYSA 3B8TA 2INZA 4G6CA 1FWDC 1UWUA 3B05A 3MUIA 5DMMA 1E9IA 3CJPA 3KLKA 4GKLA 4DZHA 1RR2A 2IPGA 1OX4B 1JI1A 4DVOA 1C7TA 3SCRA 4ADUA 1BEUA 1MWOA 5AC7A 4QISA 4OTKA 3MCNA 4D6DA 2NV2A 1K77A 4H7CA 3WDRA 1ISYA 4D6CA 4EX4A 4UR9A 3DH7A 3PULA 3LZ3A 3TE9A 4C7DA 1UW9A 1UD6A 1HO4A 5GJMA 3M46A 1NARA 3HQPA 1JFXA 3BW4A 2WZEA 3ATZA 3NG3A 2ZDSA 4QLKA 4LUTB 3GXDA 3E5BA 3PANA 2YCEA 3N29A 4JN8A 1EDQA 1LRTA 1UKOA 4D6IA 4YTSA 3NYZA 3VINA 4MZ1A 3WLJA 1I2OA 1E5NA 3TONA 1RXOB 2BHUA 2QUMA 4NL1A 3E12A 1IGWA 3U57A 4I5UA 5G2HA 2RDUA 1LLZA 2Z00A 3PJTA 3WLTA 3DFQA 1VEOA 2ZVRA 1TZ7A 4DPQA 1SFTA 2ZUWA 2PP1A 3C3NA 3FS2A 3N11A 5BRQA 1B4EA 5HOSA 1HTIA 4MDOA 3UA3A 1ICQA 4KERA 3S5SA 1LLOA 1S2AA 4PEKA 1R7AA 3XINA 1AH3A 4GC3A 3VDHA 1YPXA 2J6VA 1EBHA 2XZ9A 4J3XA 2E1WA 3TXZA 3N6QA 3UWYA 1A3WA 3U4FA 1ITUA 3EB3A 3VO0A 3KRUA 1ONRA 1TV8A 4RPQA 3CZEA 1H60A 4LSBA 3VZZA 2OQHA 2HNHA 2PDWA 3IRSA 4E8CA 3N04A 5A6BD 1VFTA 1TQJA 5LA2A 3K1GA 4PODA 5AHFA 4M6UA 2F6XA 3I65A 4QDPA 4DBDA 4AD3A 4YTTA 1YLVA 3T44A 4LQ1A 3PK7A 3UZWA 4M6PA 5B7ZA 4JCLA 4BWLA 3S4TA 4GFSA 3C2EA 4F2BA 1J5TA 4LTSA 3EX3A 3BSHA 3LMYA 4IXHA 4UTIA 3KVKA 3VMOA 4H9UA 3OLDA 1XLAA 4BF5A 1B3WA 2VR5A 1EF3A 1R47A 1CENA 1VQTA 2QS8A 1US0A 3WNLA 3BE7A 2QCFA 2DSUA 3TK7A 1OG6A 3K1DA 2PCQA 2B7OA 1J96A 4HPJA 4EP8C 3EWDA 5J8LA 2O7QA 3NTYA 5T9CE 4M29A 5AHEA 2NVCA 4GY1A 3LHZA 1E6RA 4YPJA 3STCA 2CW6A 4M24A 3AIQA 1YNQA 2Y62A 4FX6M 3WLHA 2V2DA 3Q4DA 3SECA 3FIGA 1IR2A 3WEZA 3W1TA 4FMVA 2ZYFA 4KGLA 2EG7A 4UZUA 4XIAA 3E9AA 5EYWA 1VFSA 1A49A 3VK5A 4UR8A 1L8NA 5A8PA 3L0NA 3IJIA 1JDCA 1K8YA 2J9YA 3VNLA 3UR2A 1AZ2A 2WVVB 5I09A 1NF0A 2DORA 3QVQA 2HXTA 3R11A 4Q7NA 1MW1A 4ZE5A 3Q67A 4ML4A 4BQ4A 4PRTA 4Z0SA 1W3TA 3G22A 2VDHA 3TLQA 5HATA 1KRMA 1W9BM 4B90A 4B5SA 1FWBC 1VFLA 4UOZA 3RPDA 1SZFA 4PMZA 1Q7QA 4YJ5A 4CD5A 1ODUA 3U48A 1JPDX 3CIWA 3JRKA 1HVQA 4UFJA 5LIUX 1LORA 3KVLA 3ORWA 1W5QA 4HSHA 3EKGA 3WF3A 3CHEA 4LYRA 3EA3A 4YWSA 2NT0A 3FV9A 4C6DA 3DN5A 3W27A 4DF1A 3B9AA 1BXNA 4AH7A 5AHMA 3WLRA 3LS9A 3RCNA 4D6EA 2GL5A 2QKFA 2Z28A 1GQNA 4PB4A 1ADOA 2X1UA 1US2A 5CH9A 5HINA 1Q8AA 2E8YA 4A8IA 3W37A 1NOUA 4DAFA 4H4IA 4DNHA 1JCTA 4OBSA 3NPUA 2GJXA 1F9CA 3RDKA 3SRKA 3PAOA 3B0VC 5PTDA 4HHMA 5JIWA 1XIBA 2VVSA 5BOOA 3CUGA 1HKIA 1TWSA 4O1BA 1JZ2A 2OOFA 2AAMA 3UJEA 1AQFA 2QQ6A 5ABTA 4NYYA 1RZMA 3WNKA 4WDUA 2J7DA 2CBVA 3O8AA 4JOMA 3W7LA 2NWSA 4KEZA 1RLDA 4RNHA 2W4XA 3OGSA 3T0DA 3M6DA 3IJ6A 3SZ8A 1OIMA 1G4SA 4X3ZA 2REQA 1TPC1 2QR6A 4JTLA 3NSNA 1U1JA 3RLHA 4BQ2A 3GVWA 1C90A 3W6LA 3WL0A 3LSBA 2GVYA 2QNEA 4LC8A 3QQWA 3EEGA 2PLCA 4UIOA 1NTHA 3WIJA 5IFPA 2ZWYA 2CETA 3JS3A 2DH2A 3MO7A 5LNVA 2IXUA 4O8RA 2BOFX 2DUZA 3LRLA 4DO5A 1RP9A 3DDMA 4JGDA 5FEXA 5C54A 3VD9A 3WLQA 1W91A 3KBVA 4S2BA 3MZNA 2QCMA 4UNLA 3WG6A 5KZEA 1Q6FA 1SU5A 5IBXC 3P5ZA 3UXDA 1DORA 3TYZA 3UBPC 1CGYA 3O15A 3GXIA 5CC6A 3EWCA 3VI2A 1WOAA 4LH8A 1GNXA 1SPQA 1G4TA 4MJZA 1S5TA 4GX8A 3P6LA 4I9AA 4ZL1A 4N9CA 3NZRA 2GQ8A 4DJFD 1TE6A 2WJFA 3TQPA 3BVJA 4O13A 2QAFA 3WNOA 3ABQA 4NI8A 4GX9A 1AL8A 1F3XA 5ENLA 1Z9AA 7ENLA 1UWQA 1VPXA 3RCMA 4UQAA 1RPKA 2V5CA 3DFSA 3LXCA 3I4EA 1WZAA 1H62A 1ZPTA 3SY8A 3IAQA 3PBVA 3LTYA 3JZEA 3NO5A 1XLIA 3LI0A 3QMTA 2BGQA 4NU7A 4QEHA 4RXGA 2VHLA 3HPFA 4MJ4A 2R1LA 1DWGM 2F38A 2PDFA 3TQVA 5EL1A 2OOGA 3OQ8A 3PHAA 4WK9A 3V5FA 5A2BA 1A4MA 1RV8A 3GNRA 3IJDA 4B5NA 2DP3A 4JX6A 1A5AA 1L2QA 4IIEA 1A3XA 3U5YA 3A64A 3GQYA 5HQLA 3F2CA 3HZ3A 5KZ6A 3UJFA 4DUXA 2WMIA 2Y6ZA 4D2JA 5LSMA 3V4BA 4F3HA 4OVXA 4L4LA 2DUXA 4GUFA 4WHBA 3MJMA 2BSLA 2PDPA 5JMUA 1PEZA 1ZBVA 4H6RA 1T40A 5H8UA 3UEQA 4GY0A 3IUDA 1CXIA 4DO4A 5CCZA 3GZ3A 3PTKA 4LUIA 2PF0A 5BU6A 3SCVA 4D8ZA 1ZRQA 3I3EA 1OBAA 4C6QA 3H2FA 4C6MA 3HG4A 3PTQA 3PZNA 3OJGA 4GYJA 2OWWA 1NDWA 1J2BA 1KFEA 3VFCA 4BZYA 1ALDA 3P81A 4WGHA 3QOMA 4LRSA 2ABAA 3LCWA 1ZJBA 6CGTA 5AYYA 2GQ3A 1BSLA 4FR6A 4PMJA 1XF0A 4OZOA 3KBJA 4HK6A 1DTUA 4QS5A 3C5QA 1W9DM 1E1FA 1XD1A 4KCWA 1XYMA 4DUVA 4W8LA 2A3CA 3MSRA 4H8HA 3Q37A 4QEEA 4XZ9A 1EB3A 3A6OA 3UJ2A 5HMSA 4GO9A 3FGCA 5C55A 3WNNA 2R94A 1X39A 1XX1A 1XIEA 1JIBA 3U2ZA 2Y5SA 2XU2A 1BHGA 1OC6A 4HVXA 4EKJA 3AIRA 5LNUA 3HQOA 5BWAA 1E72M 1KFBA 2E3ZA 5K2ZA 3BTNA 4AAJA 4L9XA 4ZOEA 3NL2A 5CLTA 1D2KA 3UESA 3E49A 4UTUA 4GBUA 5EFFA 3HGSA 3LPPA 3AXXA 3ZJ6A 1BTMA 3E0WA 1GWJA 1NWRA 4DYEA 3CBWA 4KH2A 1OB0A 1J6OA 3PUGA 3GXPA 4NJHA 1JNEA 2FGLA 1OVDA 4MADA 2DIEA 1FHDA 1P43A 1BQCA 3PWGA 3C52A 4W87A 4Y9AA 2QPUA 2QPSA 1ZCOA 4ZCWA 2EPKX 1XLCA 3VE7A 3AHTA 5F2IA 5D02A 1HJQA 1CNVA 1W3KA 4L65A 1ZJAA 4NIRA 4M56A 2QUTA 3ZYZA 3AMGA 1I2PA 3SI9A 4BF9A 4GFIA 2QZRA 3P3BA 1DEDA 4Y8FA 4HNOA 3ITVA 1IEIA 3VX1A 3NQAA 1TTPA 3UYIA 4PFMA 3CUXA 4ZTXA 3NM1A 4HU3A 3RPMA 1XP3A 3WUBA 1V6VA 2PDMA 5LIYX 1WNOA 4GPNA 5D8ZA 1BXCA 4I5RA 4MB4A 1Q3NA 1KGWA 2BB0A 2CLLA 3AIVA 3NQBA 1TZ9A 4W5UA 1J2WA 3QN3A 1DL3A 3PS7A 3C8NA 2WNZA 3PFMA 3GHUA 3QGAC 4G2DA 3MHUA 4OBRA 4UWMA 3FHQA 2D69A 1JF5A 3R8HA 1X6UA 5BXRA 3ITOA 4AYGA 1F6PA 5B80A 1Q6DA 3T0TA 1REQB 2C19A 3DXIA 1F4AA 3HN3A 4JKMA 1EYWA 5E5CA 3P5YA 1V3HA 5C7VA 3RG6A 3KLLA 4B92A 1XIJA 4YN5A 1WKFA 5G4HC 2VZVA 4QRNA 1ZU8A 4UXDA 3RXZA 1K03A 5DQPA 4V1YA 2A6LA 1F3EA 4KEMA 3KBNA 1EJVC 1IEQA 3VD4A 1OJXA 4RPPA 2HDJA 3KWSA 4B3ZA 1TB3A 5DN1A 4JTRA 2W0UA 1VCGA 3AXIA 3REQB 1JCLA 4KEVA 1GOMA 3PG9A 3PSWA 4ZO9A 4C6FA 3EBVA 4R85A 3EDEA 4HU0A 3OG3A 3EPOA 1P4CA 3ITLA 3AFBA 2O55A 5EMMA 3GHRA 1K7XA 3B04A 2CESA 4ZQMA 1X7IA 4CU7A 3GKFA 2FFCA 3UCQA 4ZO7A 2VI0A 3ES8A 3R7MA 2DSWA 2Y4SA 3GG0A 4IMFA 4NNCA 4DBEA 1K8ZA 3M0VA 1QO5A 1XBYA 2Y7DA 4GXPA 4C60A 3KOWA 4DXXA 2Z1XA 3DYMA 3C4UA 2WB5A 4HOXA 2YB4A 1GVIA 2QDGA 1ONXA 3F4CA 5TD4A 3GYEA 1W8GA 3SIZA 4C6IA 4J3WA 4LUSB 3WQ8A 4B16A 2FHFA 3AROA 3HG3A 2E5BA 2PU1A 1FCVA 4XQ6A 3NQCA 2WNNA 4LNYA 3OPSA 2CXEA 2Z1SA 4OGZA 2YGYA 1GZJA 3HURA 3BAJA 4C1KA 2GLKA 2A7NA 2CU0A 3C3UA 1MDRA 1K9FA 4NG3A 1OZQA 2VGIA 1F7BA 5KZMA 2Z27A 1PDZA 4PMUA 1EH9A 4AMCA 2GDQA 3ARXA 3TN6A 3M0HA 2PWVA 1ZQ5A 1CXHA 3SGZA 4AD4A 3KRZA 2BY0A 2BGSA 2QLYA 2PDBA 4KCUA 4QCFA 2VEGA 4IIDA 5I0DA 2PFHA 4ZO6A 1MQRA 3TW6A 4RDWA 3CGTA 3G18A 1EJTC 5CPLA 1ZAIA 4RDVA 1R87A 1D7FA 4DB7A 4S3EA 3UGVA 5HULA 2RKXA 3VOGA 1Q4WA 2DT0A 3SFWA 3NGFA 7REQB 3PBYA 1OK6A 3S8HA 3DFPA 2MNRA 2XG9A 1N55A 1F2JA 1XIGA 2P0OA 1WDQA 2C91A 4UB9A 5HNNA 2XIIA 3QMSA 5C9XA 1AQ0A 3D3FA 2AQOA 1JAEA 4Q33A 2XFWA 1ZP4A 4RE0A 1EC9A 4X63A 5D38A 3RR4A 5FF2A 4NXKA 3HBLA 3GG8A 4NNBA 3L4YA 2DFAA 2DVXA 4IJBA 4FLOA 5DEZA 5CEWA 3SRHA 5C2XA 2BY3A 3NZGA 3SCSA 2ZA2A 1FWNA 2DT3A 3EA2A 2E8ZA 1XDMA 3CO8A 1BGAA 1BWLA 3SCNA 3W2UA 1FFRA 4MKVA 4FF7A 5BOEA 2RGMA 1Z42A 1M7PA 2A3HA 1JRCA 1GONA 1CLVA 2YOCA 3LM7A 3PZQA 1U22A 1VP5A 1XG3A 2X2YA 1E6SM 2W92A 3MUZ1 4IGMA 1QW9A 1M9HA 3CHVA 1B2YA 4PMRA 2VC7A 2D0FA 1RY0A 2OTDA 1HN1A 3SBFA 3SN4A 4Q8OA 4ZENA 1OQFA 5F1UA 2CLEA 2ZZ4A 1CYGA 6REQA 1W8SA 2DDXA 4U31A 4I9JA 4OV9A 2OEJA 3WH7A 3UGRA 4WLCA 3OYXA 4GWEA 1ONWA 2VD9A 4AY7A 4HYVA 1JPMA 2EPNA 1VH7A 3DBPA 3NO1A 4UZSA 4MNJA 3NDOA 3RGTA 3TOPA 3W87A 4FHAA 1F76A 5T91A 1F05A 3NAVA 4Z1YA 4YVXA 4GZIA 3OLEA 4PTMA 3S42A 3TX9A 1O66A 1B9BA 3SQLA 3EA1A 4O1AA 2WQPA 1SMDA 4KRTA 4JFWA 1C8XA 3NQ8A 2FTWA 3VKBA 3DERA 5FACA 1TJPA 2V3GA 1NM9A 3UERA 4H9ZA 1M65A 3FDKA 4PUDA 3F4DA 3MWCA 3CNYA 1HX0A 2F8QA 3ZVHA 1G94A 3ARTA 3M0XA 3MV01 4LVAA 1TMQA 2E40A 1RVGA 3T81A 2RJGA 5HR7A 4QM1A 1UWSA 3S5OA 3USZA 4AD1A 2WJDA 1W3NA 1P0NA 3PN8A 3LSCA 1NWSA 1DHPA 1C8VA 3KRSA 1HXJA 3CASA 4E4PA 4JQ3A 1WXZA 1Y65A 3WQDA 1WV2A 3JW7A 5DBTA 3WN6A 3B03A 3W82A 2XJ7A 4XTDA 2ZUMA 4GIYA 3SADA 1V3IA 2Z26A 2FMOA 4D6GA 3VC6A 1BKHA 1M7XA 1B57A 5GQBA 3PWIA 4DZAA 1TR9A 1SYTA 4EXAA 3N9SA 5D09A 3V35A 2YL5A 3PB0A 3ECQA 1LWIA 1IWPA 1YMYA 1QT1A 1E6XM 1V6YA 4LUJA 3UW6A 4GZ7A 3O07A 4G7EB 4JTSA 3R5EA 3NQMA 4RZBA 1Q2SA 1KV8A 1R86A 1AD4A 3W2NA 3QYSA 2FGBA 4DZIA 1L6YA 1RJPA 2ZRZA 3GZAA 5TF0A 3W7RA 4K39A 1ZJIA 2O92A 2X7WA 1K4GA 1BRLA 3W02A 2QJNA 1JDFA 1EXPA 1RY8A 4GQ0A 3AOFA 3M64A 5L9FA 4E8GA 4DI8A 5BMXA 2E1DA 2ODOA 2GVJA 1AW5A 4EF8A 4JS3A 3BAIA 5HQEA 4Z42C 2DT1A 3SO7A 1FCUA 3QC0A 4N4QA 2VDGA 3JUGA 1R3TA 2FGZA 1DJNA 4TXEA 4CNNA 3U9IA 3LV6A 3N4AA 1W1PA 3GTXA 1R30A 4Q4RA 1TX2A 4E2BA 1T5AA 4OIFA 3W73A 3TC3A 3M07A 1I75A 1FWEC 1CPUA 3V5CA 5A8OA 1OFEA 3PBMA 1B90A 3S1VA 4JTEA 2D2HA 2RJHA 4MWAB 5CGMA 1WKDA 2G3JA 4F40A 3K8KA 4LYQA 3WCZA 1W3JA 3DC0A 3V16A 1TV5A 4M1BA 3UJRA 4Q4SA 5FJUA 3C2RA 3F4VA 1KFCA 2PTYA 3QR3A 3CS2A 4JL2A 4DBUA 4MYAA 4O50A 2HNEA 1SO3A 3ITXA 3INPA 2JKEA 4XZWA 4YLWA 3VIHA 3WYZA 4LUYA 5AECA 1XIFA 5IBXA 3V1HA 1FCBA 3LN3A 4HA1A 3WDHA 2QCHA 3ZT6A 1JCYA 3HO8A 5ECVA 1CBGA 2D1ZA 2FFIA 4AU0A 4N6EA 1EBGA 2NQLA 1YTDA 2PEVA 3UWQA 2QV5A 4F9DA 3RO8A 5F2GA 4P5UA 3V0TA 2Y1HA 4KCTA 1PIFA 4AZCB 4IIBA 4J3SA 4L4PA 7TIMA 4F2UA 2O9TA 4PUMA 3OGVA 1SZNA 1ECQA 3NQDA 2YYUA 1Q7MA 4XVEA 3LPGA 1KM6A 2FZDA 1XCWA 4AUBA 4OU1A 5MKGB 1ECEA 3PF3A 3GWQA 2FVMA 2WMFA 2XPKA 3LGEA 5IOBA 2VVNA 5G2WA 1PCWA 2C1GA 4LCSA 2YSWA 5I3HA 2E68A 4DWSD 4OBTA 3XIMA 4NAEA 3BK0A 4Z1CA 4LF1A 1RCXB 3WLPA 1JL8A 3S1UA 1UZ4A 4Q4KA 1G9HA 2RAGA 2YCLB 3TH6A 4QGCA 3ZLFA 1Y7VA 4PTWA 3CUIA 3FVMA 3ENLA 3ZZ1A 3FEMA 2ATMA 1SR0A 4EPEC 1RK6A 5JH2A 1B5TA 1A4LA 3W01A 1UH4A 4G1KA 2ON3A 3DHUA 2Y88A 1TRDA 2P8BA 1AQHA 1UYQA 3ONBA 4KFOA 4NAFA 1FHUA 1TPWA 1I2QA 4DUWA 2EBNA 1NP2A 5E1QA 1GOWA 5H2ZA 3S5NA 4P7RA 1XWYA 3VTRA 2ACUA 2BV9A 3TSDA 4R53A 4I8DA 1LF1A 2G8ZA 2YX0A 3OZMA 4PCNA 4O14A 4V15A 2P0IA 3CHDA 3WELA 1F3TA 1G7VA 2C3ZA 2GGJA 1EOKA 2PGEA 3O6AA 3PPCA 3MHFA 2D23A 3L4TA 2DZXA 4MB5A 4M6QA 3BOLA 3IANA 1RQHA 5BROA 1R7OA 3MU7A 1IZCA 2PDKA 4MDPA 5LXEA 2DGAA 1JUKA 1W2VA 1NWUA 2J7CA 4UCFA 3UNDA 1RUSA 3G1HA 4PBFA 3PZVA 3LTSA 2ESCA 5D37A 2J24A 1QI0A 3W2KA 3KBMA 2FHCA 3H22A 3ZLGA 4MM1A 3UVIA 2CZDA 3DHFA 3SQMA 1GW9A 4W9TA 2PRHA 4M0XA 1QK0A 1U5JA 2ZX6A 4JNZA 2EGZA 4BJHA 5DMYA 3I6EA 1JZ8A 5DFAA 1LWHA 2QGYA 2PA6A 3SUWA 1HL8A 1S5VA 3SSZA 2G96A 4CCZA 3AICA 3GH7A 3GNDA 3OTRA 4X0NA 4A35A 5A3HA 5CC5A 4LUTA 1BYCA 3ONCA 4EPDC 4GUIA 2GPTA 2BXVA 5I02A 3ZMRA 1M1BA 4NUWA 4CU8A 5DT7A 1J6PA 1L6GA 2YKKA 2GOUA 2TAAA 3NPWA 1KTCA 5C70A 2FH6A 4S3CA 1A5UA 1HKKA 1V03A 2WQDA 3DFTA 4H83A 1X38A 3AIWA 3BCDA 1QUMA 4GVGA 3N2MA 3WFZA 4OUIA 4KETA 3ZQ9A 4IGNA 4MHBA 4PTDA 2CLOA 1MXGA 2O9RA 3FCPA 2PODA 3GHTA 3UA4A 1FDJA 3TROA 1IEXA 5CPOA 5C7HA 3ZS4A 1PV8A 3VOHA 4GKTA 2WJZA 1UR8A 4O57A 4B5VA 3HPZA 5BMWA 4OECA 4NVTA 1C9WA 1JPIA 2OPJA 3MJYA 1PJ9A 3GM8A 3HGJA 3KDOA 4XAPA 3EX1A 2OKOA 5REQB 1BKSA 4XWUA 2BNJA 1PUDA 5AVHA 2Y7GA 4KT2A 3UR5A 2IMRA 4GI9A 8RUCA 1EA0A 1KRCC 1WCGA 3K5XA 3LYEA 1OGSA 1UWIA 2PI6A 4H6KA 1TIWA 3CC1A 5A2AA 5AC6A 4DWSB 3MC5A 4PTXA 4PRWA 2F2KA 2J7BA 2BVTA 4NZJA 3MMUA 1VCVA 2QDDA 5FJJA 1LROA 1XLMA 1M7JA 1K6AA 1EJWC 1YPIA 1JJKA 3IK2A 1CB7B 1A0CA 3WUFA 2GVLA 2VM8A 1QW8A 4X60A 2A0NA 4WY0A 1PX3A 1UH3A 1XIHA 4ZZ9A 1TV3A 1XL9A 2ATSA 4IHCA 3JZUA 2G3MA 2WVUA 1Q63A 3S47A 4JTIA 1VYPX 4GRSA 4DJED 2GJRA 2ACQA 4ZE4A 1KC7A 4CGTA 3LXBA 1HVXA 1JZ7A 2IKJA 4NZ5A 1PIGA 1E73M 5CC7A 5ABGA 2KAUC 1B3YA 4A3QA 1UR4A 1GPFA 5C6MA 1A3HA 3BAYA 5FA5A 1XKYA 2RDTA 4US6A 4XUGA 3E5PA 2ZUNA 2H8ZA 4IWWA 2BHYA 1J5SA 2NX9A 3RRXA 4ZQRA 2VC5A 5I5RA 3NXLA 4PUKA 2HQAA 4PUEA 2OYKA 1W5MA 3W6YA 4BI7A 3ARPA 4TV6A 1JR1A 1JNDA 3LOTA 4N9EA 4W7WA 3K30A 1UJQA 2C1IA 3VMPA 1FY6A 1XIMA 1RCQA 1WP6A 3IVTA 4JHOA 4F0HA 4KRUA 4AWUA 5JH1A 2E77A 4XSMA 4HNCA 4MNMA 1YBQA 4ZO8A 3L65A 3LCXA 3GDTA 1JCNA 1TJRA 2XVNA 3O1NA 1BG4A 1UBPC 1XLGA 1OF8A 4Z2GA 1JQVA 1KQZA 4E0CA 1R2RA 3K4DA 5H8MA 5M03A 4H2HA 1KTBA 3U4AA 4ILSA 4J7RA 4HIBA 1CIUA 3PWAA 4Z2HA 1H7WA 2B81A 1EZ2A 1HQTA 3L0KA 1YEYA 1EUAA 5I6SA 3LU2A 2ZICA 1XGDA 2F61A 4F48A 2E5CA 5ECUA 3LCIA 1BF6A 1WAWA 4GNVA 3PUDA 4GI6A 2J78A 1H1YA 2BOGX 2ZRUA 3DG3A 5FF4A 3P84A 3IJQA 3WQCA 1ZL1A 1R8LA 3AHZA 4MJ2A 3PJXA 4S3DA 3C0LA 5AC8A 4S1FA 1K3UA 4IISA 3T78A 1O5RA 3EMZA 1NH6A 1DQWA 2D3LA 1G6CA 3M7SA 4UQ9A 4M81A 1YNYA 4PMXA 3UWVA 2YCJA 1OD8A 4A3RA 1YRRA 3NZPA 4HYWA 4P8WA 1LT8A 4YNGA 2XH0A 3EPMA 5A6BA 2X2GA 3G1AA 1DYSA 3B8SA 3CZJA 1HNYA 3RLGA 1E71M 1JI2A 3CO4A 3HMCA 1KM0A 5EFDA 4AW7A 3ARRA 1FBAA 2BTMA 3CH9A 3IK4A 2Q8LA 4IFRA 3SR7A 2OX1A 2D2JA 1P0KA 3AWNA 4EXQA 4E2DA 2R82A 1HJSA 3FK4A 1FOBA 4XSLA 3UZ5A 2VQUA 4N4PA 3G8EA 5AHNA 4E4FA 2QF7A 4RNJA 2B7QA 2G41A 2ZIDA 2PTWA 2QT3A 3A47A 1W9PA 1FDZA 3WBWA 3TP4A 1CGVA 2IQ0A 1QBAA 3FKRA 3R6IA 3KZPA 1KO0A 5I7GA 4ML9A 5HBFA 3BOXA 3Q58A 4JEQA 1AMYA 1BYBA 1TPH1 1Q4NX 5AZ1A 2FDMA 1K9DA 4OFCA 3S83A 3WMLA 4LAMA 4KFNA 3WEMA 5F2MA 4C6OA 3DHDA 4BS0A 2PMQA 1O60A 1UMYA 2VP8A 3RNDA 3TMQA 1EDGA 1OFQA 1W56A 4BY3A 2HPMA 3TSBA 4ZR8A 3H4GA 3BLPX 1TPVA 1FFQA 4A8RA 4US5D 1LLWA 5G5IA 3W23A 2ZZ5A 1S1RA 3WX7A 4U3CA 3GTIA 1SVDA 2EPHA 2QIWA 3TWAA 3T2OA 2PDNA 3ARSA 1TIMA 1MZRA 2X16A 1SZGA 3TU9A 1IIGA 2ZFAA 4AWEA 4JTUA 1ZLPA 5GNYA 8A3HA 2VGFA 3WZ0E 5F7UA 4IG2A 4J40A 4IH3A 3WJWA 2G37A 1QPRA 2AKMA 3AYSA 1PWMA 3M0LA 4IP4A 4TTUA 2HJPA 1HF6A 3W7JA 3U6WA 1NSJA 1DHKA 5I3DA 3CLMA 1FQ0A 3K13A 2D3NA 2A3AA 2QHAA 4NX5A 3RFAA 2F6KA 2HRWA 1PYMA 2JEPA 2X1RA 2BODX 3GX9A 4Q8WA 4K3ZA 1GYNA 2I16A 1YXYA 1PHQA 1RAKA 1NIUA 4AD5A 4MLJA 2BVDA 2PGFA 4UOJA 1XCFA 3NDZA 5TAOA 3BGAA 1T99A 3HPXA 2VL4A 4GXWA 4B3LA 2E4TA 1ISZA 3SURA 5T9BG 3S6DA 1WOBA 1EIBA 1WKYA 3GUWA 4MG4A 4FX8A 2W9MA 4KGJA 1W1IE 2VTFA 2XGBA 1V08A 2P1FA 3BO9A 8XIMA 1E0XA 2WVSA 3OBAA 3ZR5A 4HMCA 1P6CA 4F2TA 3S9ZA 4O15A 1XRTA 4H8NA 4L9YA 5GJPA 2VENA 3PPFA 5EBAA 3IJ9A 2NSXA 2A1YA 3BICA 1GHSA 4HCHA 1UOKA 2R8WA 4GXMA 4CQBA 4O19A 4IXXA 1E4IA 1DJWA 4R5EA 3AS0A 4L80A 1NY1A 3AO0A 4C1LA 4J35A 2W61A 2W79A 2E6YA 4H9MA 3BQ6A 2AKZA 4L4OA 1R9ZA 1EIXA 1VBRA 3ATYA 5D32A 3VKCA 1CX9A 3QXBA 1IHIA 4XK2A 5K9XA 2WNQA 3UFYA 3MMDA 1MEHA 3ZJ7A 3P62A 4MFDA 2PWEA 3H55A 4RW3A 4IIFA 5ABHA 2H3DA 1QOPA 3KS5A 2PSNA 4AHQA 3A23A 3QKEA 3AIBA 4R9XA 3PC0A 1HKJA 1P48A 3U3HA 4OT7A 4L6DA 3V7PA 4K8EA 1W3IA 4UFLA 1QNQA 5HJYA 3GR4A 1CGUA 2J7EA 1NDVA 5CBJA 1H11A 4MAVA 2CIPA 4O53A 4A2RA 3MHGA 3WDIA 2QCNA 2E09A 3R0DA 4DELA 4NHVA 3UPBA 3TTSA 3AS1A 2E6AA 4XD6A 3VVGA 3W29A 3UCCA 1GJPA 2FZNA 2GWNA 2V3FA 4DI9A 3GIQA 4FK9A 1EJUC 3L0GA 1E4NA 3W26A 3MWAA 2CPUA 3QKZA 4I7WA 1WDPA 3FSUA 1K7FA 1JGMA 3TNBA 4JIRA 3KHJA 1UKTA 1L2UA 4WGXA 2OX4A 4PCTA 3A4XA 2P5NA 3BQ5A 1ICSA 3GNNA 1QU4A 1W1B1 1JUBA 2FB3A 3BJTA 5DXXA 4BCEA 2HTMA 2QUUA 4CKQA 3SDOA 3D0CA 1KR1A 2GUUA 2A3BA 1LP6A 1IWAA 1K70A 4EOUA 5I3GA 1JYXA 1DXFA 1CXKA 2BG5A 3GNOA 2A3LA 4FLSA 4AY8A 4B5UA 5A69A 4GUJA 3AS2A 3REQA 3QRHA 5D33A 1JCXA 2Y7EA 2DSVA 4I3GA 1LQAA 4PCPA 3FVDA 3G1VA 4REQB 3IIXA 2D0GA 3R58A 3ARVA 2VURA 4MZYA 3CQKA 2J79A 4AISA 1V6UA 4GNJA 3IGHX 4XAGA 4GISA 4HN8A 3EXTA 4MKSA 4U4MA 3GBDA 1XYBA 1SSGA 5FCZA 1OX5A 2EO7A 3K8MA 2VO5A 4NRSA 7XIMA 4IL0A 1Z89A 3GR8A 4D1IA 1U1UA 3PZUA 5JUVA 4E3TA 2GFTA 1Q85A 3S2MA 4LUSA 4Q22A 4D72A 1FWCC 3TYDA 4Y90A 4AQLA 4XUYA 2FPVA 5LGXA 3NJ3A 3M7WA 3G0SA 5K3VA 3G0XA 1JYVA 3W2LA 1FWRA 3N6JA 2A3EA 4UTFA 2OCZA 3AXHA 5F4SA 3OLIA 2NUYA 3BJFA 4U28A 1I2NA 2XIMA 1VR6A 3UETA 4HB7A 1D8WA 3ZVIA 2AMXA 3SRDA 1NOFA 3L9CA 4DIAA 2G0WA 4UOQA 4FIRA 5FL0A 1V0NA 3MYPA 5K9CA 4JICA 4JFSA 4ORMA 2Q6ZA 4GQGA 1A5MC 2IKIA 4ACZA 2P3EA 1E70M 1B4KA 4HK5A 5HNTA 1F8IA 1L8PA 3U2OA 1TA3A 3BW3A 2WOQA 3VIGA 2P76A 2POTA 3GVGA 4L5ZA 4JR5A 2HPIA 3M43A 1UA7A 3URAA 1BF2A 3G3MA 3URNA 4OV4A 1E4LA 2VT0A 1UQYA 2NZLA 4ZQPA 1ENUA 2P3ZA 4LNCA 3HGRA 4Z0JA 4O10A 1H1ZA 1TCMA 4O28A 4MLRA 4GH3A 3L12A 3ARYA 3VNJA 3OZPA 4WSKA 3W4RA 4I9MA 3A4WA 4B9YA 1GCYA 4EWJA 2XGIA 5HR6A 1E0UA 1C92A 1LT7A 2VFGA 1PE1A 4TOQA 3N2OA 2DPEA 2QCDB 4ZVJA 4AC7C 3S1GA 4YYCA 1L9WA 2QJJA 4NZ1A 2WHKA 3IIZA 4DJDD 4C5YA 3EOSA 1OHLA 1B9ZA 2QVHA 3LI1A 1XLDA 3S2NA 2P88A 2X42A 4DF0A 2D20A 1W1A1 3CLWA 5LHFA 4YTUA 1ISXA 3BMVA 1EGZA 1GZ1A 4IFKA 7ODCA 1DV7A 4U2YA 2IPJA 5HA7A 4JN7A 1I45A 2Q02A 1FP9A 3LV5A 4KCVA 1MI3A 2F9RA 4WKHA 4ZOCA 2WNWA 3TMLA 2NV1A 2G3FA 4CNTA 4B5XA 4O12A 1T7LA 3G1RA 3CV7A 4CQCA 2Z0IA 3GAYA 3CAVA 1DWHM 3GD6A 4QDMA 5JBDA 3HJZA 4FSAA 4QG9A 4NJJA 2XM2A 1A5LC 4CEXC 1VHNA 1DIKA 5GJNA 4TQTA 4A3YA 1NWTA 2AOSA 3ANYA 4YHEA 3UWUA 1OWQA 3TCEA 2XFRA 5DCDA 5AYZA 3M0JA 3TSMA 4IGHA 4L6HA 5AHLA 1BYDA 2XIBA 3EWBX 2WPGA 3CZLA 4JKLA 4DAIA 4AZ6A 4BEUA 1R5YA 1I2RA 4S3KA 3ZLHA 2EG6A 2ZRYA 3H4XA 4LS1A 1G1YA 2CC0A 4D6FA 4DNMA 4EACA 3I4KA 3MUY1 3E1F1 1Q6GA 5M1TA 1IXOA 1TE1A 1LRQA 3H26A 3W1LA 1P0BA 1PYFA 2XISA 4Y9OA 1AA1B 3RO6A 1V51A 4N02A 2WZIA 4A8LA 1TCDA 5D9PA 2E67A 1ME9A 4JFUA 4O54A 1O4UA 2AQVA 2VCCA 4O17A 4C6PA 1MFUA 1WXYA 2VX6A 1KM4A 5DCBA 2BZNA 3LLFA 3TAOA 1TKKA 3RIKA 3WBXA 2PC4A 1UWTA 4IFOA 4NP7A 2CFFA 3W7CA 1EPXA 3VGHA 2H6RA 4P8UA 3V18A 5HXMA 1HO1A 2CCRA 4YVVA 1PO9A 1ZSXA 1VBGA 5M17A 2WC3A 3A22A 3VIPA 3C0SA 1D3GA 3VD5A 3TDFA 4JTQA 1TJ2A 3WQEA 5C2CA 1U33A 4ZTYA 4UTJA 4RE3A 3MKKA 3CZ8A 1LRNA 3CTTA 3TZFA 1ZTVA 4POCA 2QEZA 3O7UA 2GZXA 4LBRA 2J25A 3N4FA 4P7OA 5DF0A 1V8EA 1IQ8A 4IPNB 2V5JA 4QP0A 2XN1A 3NSMA 3UP8A 1JXKA 4RJEA 4WDTA 2XVKA 4P7LA 5LIKX 2JK2A 4LGXA 4IIHA 3QC3A 4NI3A 4HYRA 2Z24A 3C8FA 5K4ZA 2WLYA 4K6AA 2ZZ1A 3TEVA 3DENA 4HGXA 3WD2A 1L6WA 2INFA 2DV0A 1RK5A 2XWDA 1MQQA 5A95A 4G7EA 1XKJA 1XG4A 3B0XA 3KRBA 4BHYA 3S9IA 3AU2A 4LCQA 3W7IA 4JYFA 4XBKA 4F8XA 2AL2B 1CCWB 2DIJA 2NVDA 1PCKA 1Q6RA 4Z17A 6A3HA 8TIMA 1DJGA 1GOXA 1LTDA 5MHBA 1EEPA 1J93A 4H9VA 1UR3M 2V0TA 2VOTA 3BAKA 1DWIM 3EXRA 4NF7A 1LM1A 1KCXA 3T8QA 5LNWA 3UY7A 1FWFC 3L67A 3QV9A 4XZLX 3GH4A 3R8RA 1BLIA 4M5PA 1NJJA 2OZ0A 1DWFM 4X22A 6XIMA 4JKKA 1TX0A 4WKFA 4WRHA 2YXGA 3S1XA 3NURA 1P5BA 1GJWA 3QV6A 1VRXA 2HK1A 5I00A 2E9MA 1DWJM 3ZT7A 1XPYA 1G4PA 3OQEA 4WJXA 1XINA 4WSJA 3QOKA 3UR8A 1HJWA 1GTEA 3KW3A 3VKKA 4QNEA 2ZUUA 1C3FA 3MSGA 2ASHA 4FIQA 3NYDA 4B2DD 4QQ3A 3W72A 2UY5A 1CI1A 2EHHA 3C86A 1YNPA 1GZGA 5DX7A 3E2RA 4CD6A 3FN9A 2FDSA 4C6CA 3EX6A 1M53A 4MNLA 1TTQA 1UIOA 1UR9A 5HPCA 7A3HA 4D8LA 3H2NA 4IP7A 5B7YA 3ITCA 4CNPA 2B7NA 1BSIA 4RE2A 2HE5A 2ZXAA 1ISWA 3MSDA 4QJ1A 4V27A 3H2CA 5FF7A 3G3DA 5HNRA 4EPKA 3LMZA 3EX4A 2NV9A 5I78A 3EWUA 3AMKA 5XIAA 1ITXA 4J3TA 1OEPA 4ZQOA 1V7AA 2GQ9A 3UXKA 4WJEA 4YXGA 1IXQA 2GSHA 1V77A 1T6MA 1W2PA 4ATDA 4JY8A 4EK7A 2OODA 4NYUA 1X97A 2PPGA 3P0WA 1SFSA 1A0DA 3I3DA 2REQB 3G1YA 4FS9A 3MS8A 4CQ8A 3UXIA 3OHIA 3LDVA 1ZUAX 2D22A 3KL5A 3TOYA 3W7PA 1ZALA 1CGWA 1P1MA 3EXSA 2QUVA 1XQLA 1P0DA 3EAUA 3TNOA 3VGGA 4JIHA 1BG9A 2NX3A 4Q4QA 4PSRA 3MBDA 1RBLA 1CXEA 2ABBA 2QJIA 3KM8A 4PB5A 3ZWTA 4GMEA 1FTXA 3DX5A 2GUBA 4OQVA 4W89A 3ZM8A 2UBPC 3RLUA 5JXQA 4AHPA 6TIMA 3UZXA 4H9TA 2VKZG 3UG3A 3QHNA 4H3DA 1V3KA 1JPHA 5BXTA 2VR2A 2PB1A 2BDQA 1W9XA 2C13A 5TNVA 3UPWA 1TVNA 5D03A 3CUZA 1WDRA 4F66A 2CLMA 4C7FA 3W00A 1XIIA 2VD8A 1GOIA 3R10A 2ZUSA 2DZUA 4XX6A 1SFJA 1WO2A 2A85A 1HGWA 1R3RA 3N3TA 4U5KA 3T05A 3M47A 2ADAA 3B3DA 1DP0A 1QATA 4LB3A 3N13A 2IUZA 4CD8A 2DY3A 1P7TA 4AYSA 3VIIA 4GOAA 2BXZA 1LYXA 2GDVA 2VEFA 1DJIA 1XLHA 1Y8BA 3N4EA 2E6FA 2VOMA 3S0CA 3BARA 2O4MA 1EXBA 1SJCA 5BRBA 3M0KA 4LV9A 4DO7A 2X0HA 4CCCA 3A9IA 4IOTA 1YE6A 1MEIA 3W3OA 2HE8A 4OWGA 1RLCL 1UPMB 4HCLA 1AK5A 2WSKA 2CNCA 1KKRA 4Z1BA 3LERA 6ENLA 2B0MA 3W7KA 3W24A 3R25A 4MKNA 2Z1BA 3W25A 3MUAA 5CSRA 5BU9A 3P93A 3MP4A 5C5YA 4UC5A 4AEOA 2WMIB 1P1XA 1EC7A 2BX7A 1IF2A 3QPZA 2I14A 3ZJ8A 3THAA 2IPFA 1VYSX 4R3UA 4KWWA 1OYAA 1TSIA 1FWTA 3WH6A 1UB3A 3E74A 2NXIA 4HTBA 3W7NA 1S2WA 4JTCA 3E0IA 4O0KA 4QTGA 1GYLA 4DQWA 3NA8A 3G8RA 2WCAA 3GDLA 3TYBA 1EJSC 2VYOA 3A5FA 4GC4A 3AHYA 1EX1A 4HHLA 3URQA 1FWWA 4ICMA 3SFKA 4ATLA 2DSZA 1PKLA 5TIMA 5BXPA 2RUSA 2OT1A 2X8RA 1VC4A 5CSUA 4CU6A 1Z6KA 1KCZA 2IS7A 1J0HA 3APYA 3EYPA 3V1PA 1DE5A 4G56A 2RDXA 2VX7A 1IWBA 1QNVA 1K02A 3S1WA 1FXPA 5A8NA 1XUUA 1ZP3A 2FZ8A 3VGEA 3QZEA 4PR4A 3AYTA 2NXHA 3P67A 3BSGA 1QHPA 3QZ6A 2Y8UA 3T7VA 1EGMA 1W31A 4J28A 5REQA 3QTPA 1X96A 4JIIX 3DFOA 3MVTA 5FAJA 4YVPA 4PCFA 4GJIA 2WSQA 3FY1A 4HPGA 4MY9A 2I5GA 2R24A 4BK9A 3FGCB 4TX6A 3W86A 3F2DA 2PGRA 1XHGA 5KETA 4DWSA 3MY9A 1E5JA 3ARUA 3A5VA 3G77A 4O1FA 4QG6A 2Q71A 1JD9A 2PLMA 8CGTA 4U3AA 2OFJA 3WL1A 1E6NA 3ITGA 3KCJA 4Y8EA 5DXYA 3T0BA 2IW0A 1V02E 5JQ9A 1H1NA 3CUHA 3STEA 2I1OA 1EJ7L 3B8IA 4RR4A 3NSXA 6ALDA 2CITA 3GIYA 5T8GA 3W85A 3J7HA 2VRJA 1JCMP 1W17A 2Z7GA 1F61A 5BZAA 3M16A 2JQXA 1WDDA 3FLUA 4S39A 2X7VA 3ISIX 3ALFA 2R1KA 5I3FA 3OVGA 1B3VA 2C18A 3AI0A 2VZUA 2G3NA 4JNMA 5CC3A 3H21A 2PWFA 1C29A 1EQCA 4QNWA 2I56A 1MDLA 1XLBA 4PL2A 4XISA 4FOKA 3T0CA 1H7XA 3L2LA 4C1NA 4H8UA 1ZHAA 1POJA 1SUXA 4QITA 3TR9A 3PM6A 1LZOA 5G4EA 3EWZA 2CHOA 2GJPA 2BHZA 4O1EA 2EKGA 2Y24A 1V3LA 3QH2A 4AZIA 2VCAA 4ICNA 3OIXA 1QWKA 2VWSA 2HROA 3CHFA 2G4FA 4PUUA 3AMCA 1W37A 3B97A 1O1ZA 3PNUA 1JAKA 1GK8A 2E9BA 2WLZA 1V7YA 3MP3A 4R7OA 1CLKA 4S3BA 4FXRA 1A5KC 3AU6A 1KXTA 2PZNA 2PDLA 2QCCA 5D30A 1T8XA 1TV2A 1UP2A 2DSKA 4MIMA 4H7ZA 1E0TA 5I77A 2OWCA 4HZ7A 4CNUA 4XKYB 4AX6A 2Z1VA 3N12A 3V5OA 2Y85A 3RM8A 1M5WA 1JDDA 4Z2JA 5JIPA 3L21A 2ACSA 2QDHA 3FYPA 3FKKA 3D5HA 3PBUA 3APTA 3W0KA 1XGZA 4U2ZA 2GSJA 5XIMA 2OO0A 2EEXA 4PGLA 1OINA 2VELA 3NL6A 2XHYA 2O9OA 3BG5A 3SEPA 4HTYA 4V28A 3BV7A 4P7QA 3TVAA 4HK7A 4MPQA 2Q8XA 1AH0A 5C8BB 3KCOA 5DANA 2CZEA 1A50A 4CN6A 2NQ9A 2V38A 4A3UA 4TO8A 2WC4A 4WDXA 2VZOA 3BGJA 5DBUA 3AALA 2JF7A 3L2MA 3HF3A 4K8GA 3C2YA 3B40A 1G0CA 3KVMA 2O0TA 2YW4A 3OLGA 2J62A 4ERIA 4LJ3A 3A3WA 1BVNP 3SCUA 1QJWA 1K6WA 2UY2A 3W75A 1S2UA 1A47A 2V63A 2ANUA 4IM4A 3AJ7A 3F03K 2Z2AA 5FJIA 3SIMA 3IS4A 4DXVA 5CZSA 4DJDC 3UZYA 3O9NA 3VCCA 3RM9A 1ADSA 3SAZA 2VFHA 2WANA 2Y7FA 5I3KA 5M3WA 4DBWA 3OZYA 1IR1A 4JYEA 4GGBA 2I17A 3TJLA 4E3VA 2TMDA 4AVOA 4ZXOA 3UNTA 3DKJA 4LYPA 1QNOA 2J9ZA 1UUOA 3SCQA 1T96A 2CXGA 2ZX9A 2ISSA 3M0MA 3WQ4A 2NT1A 2R9RA 4HP5A 1GVQA 1B31A 2J8GA 1BXBA 5AY7A 4AMAA 3GR7A 2J75A 3ARWA 4MY1A 4XG1A 4HZMA 1I60A 3HOJA 2J7FA 3G6LA 4Y6GA 1A5NC 5GNXA 2OSXA 1CGTA 4WSHA 1BWKA 3S2CA 2I9UA 5I06A 3EMQA 4CVUA 5EPDA 2VRQA 2GGGA 2IKHA 3H2MA 3KOXA 5F4WA 3VA8A 1V02A 2WWDA 4QLJA 3CWNA 4UFKA 1RD6A 1JZ4A 1KLZA 3CPUA 3KP0A 3II1A 3PAJA 1Y5WA 1RBAA 3G1DA 3WLLA 1FHVA 2ZA3A 4WIWA 3T08A 1BFNA 3GDRA 4JTFA 1AFSA 3M0IA 1O5KA 3M4HA 5LA1A 3NPXA 1YQ2A 4GO8A 3CTLA 2QDEA 2RFGA 2VFIA 2ZQ0A 2WZMA 4AXKA 3VCRA 3LCGA 3ANVA 1BD0A 2PBOA 1QHZA 1X1OA 4C7GA 3LGGA 4NXSA 4Y9PA 1TPUA 4W7VA 3B4YA 5DRCA 2W27A 3OW1A 4ZA0A 1LL6A 5DRIA 4NQ1A 3AXMA 1MEWA 1YHTA 4IP5A 1V5XA 5K7JA 3PUOA 3V3WA 2PWGA 5KSWA 1E3XA 1UD8A 1C8QA 2POZA 3QF0A 3MUCA 4MB3A 1TREA 1EEXA 3LPFA 3SUSA 3T07A 4HCDA 2PDQA 3GIPA 3F7JA 3CT7A 1E43A 4GCAA 1TUFA 4QSFA 2ZBTA 5EA9A 1FA2A 4QSHA 3AZTA 3EKZA 4AD0A 1WKEA 4C6LA 4J27A 4N9DA 3WNPA 1QW7A 3BJSA 4BFAA 3C61A 3W1MA 2PDCA 1W0MA 1R85A 2HCVA 2YFNA 4HOWA 3OU8A 2A21A 3W07A 4AIOA 1CWYA 4PZVA 2EQDA 4R7WA 3TN5A 1PZ3A 4IUOA 3EEZA 1VFHA 1M03A 2NQZA 4L6OA 3CIVA 4KIEA 4RZ4A 1O6IA 4TV5A 4F0MA 3MI3A 1KBJA 2EJ1A 5CBIA 3KTSA 2VJXA 1KW1A 3N6HA 1JYWA 4JAWA 3AYRA 2YL9A 1GOQA 1NFBA 3NCOA 3I3BA 4I6VA 3EGJA 5C9WA 4GABA 3NM3A 5U7SA 4QXIA 1EO5A 1VENA 2UWFA 5TBOA 4W85A 2ZZ3A 4DUOA 3HV8A 4IZGA 2Z6JA 4QAIA 1R9XA 3C56A 2PWUA 5EMYA 4WJ8A 2OT0A 1XLLA 4JY9A 1QMLA 4XZIA 4R88A 4AC1X 2WBGA 4HJFA 2GK1B 2R91A 3DBNA 5CXPA 1JZ6A 2JFEX 3PZGA 2V6AA 5DMLA 5HMDA 2YA2A 3ZVHB 4BEQA 1KWKA 2ZZ6A 2A5HA 3OO2A 1SSDA 3DESA 2OZ8A 3QEZA 1K7EA 1C93A 1X6LA 4HA4A 3MYOA 2XH7A 1UH2A 4A05A 1TQXA 4AWTA 4WX2A 3USBA 3ZFHA 4YMZA 2J47A 5EMUA 2FJUB 1I6NA 4M82A 4Y9MA 4EWND 1KV5A 1V6WA 1JULA 4H6EA 1TWIA 2PLJA 2WBKA 1HJVA 3FXGA 4CCEA 2VGBA 3TJIA 4H6QA 2J6XA 4WQ6A 4ATWA 2YDRA 2XH2A 3LHTA 1B3XA 4C6EA 4XD5A 3WJZA 1R2TA 2GVGA 3TTEA 3GXNA 1J01A 4L64A 3IARA 3MI2A 3I6RA 3L4WA 4S3FA 3QY8A 3WLSA 1DPMA 1PWLA 2GJLA 2QIIA 3DFNA 5FOOA 3T42A 4IMGA 2OJPA 2NWRA 2WKJA 3GC5A 4FXSA 3QY6A 3WF4A 1W5PA 1AG1O 3HGOA 3NVTA 3CMFA 1UKQA 1A5SA 1J12A 4N9BA 1CT5A 1FWJC 2WMHA 4LX4A 1BRLB 3GDBA 3P14A 3DHPA 4AG0A 3HG5A 1YDYA 2PU0A 3LY0A 3U7BA 4WY0F 5E93A 1RA5A 3N2CA 5I3IA 4LVGA 4NJGA 4M6VA 3IAPA 4HA3A 1TPEA 3PBGA 3WK2A 4G9PA 4K1WA 3XISA 3KL0A 1GGOA 3OEXA 3LXAA 4UNIA 1U30A 5KMYA 1E4MM 4PFHA 4H01A 3U5UA 4Z2KA 3SY5A 2CZFA 2J7GA 2FYMA 5KITA 8XIAA 1EO7A 1L6FA 4Q8TA 2W6RA 3G24A 1XPGA 4L9ZA 2HS6A 2XVGA 1N7KA 2EPLX 2BP1A 3L5LA 4H7VA 3WDPP 1THFD 5EMJA 3WH8A 1KR0A 3WH9A 4FNTA 1DE6A 1G69A 4QE4A 2ZE3A 4U33A 1XC6A 5EMLA 1JEZA 1QVBA 1QI2A 3MSYA 2DVTA 2CKSA 1UWAA 4LBUA 2FTPA 2ZRVA 2J13A 4QCEA 3SW6A 3S6OA 5AB3A 2ISDA 4PBEA 4E2OA 1UD4A 2R1MA 1I9CB 1XYLA 3C2FA 4GLEA 1J9YA 1VGAA 1LL4A 3AQUA 1JDAA 2X0YA 1I0DA 1NP0A 3WLOA 4PH6A 3TTOA 3LEPA 1OCBA 1KM2A 1LG1A 4FXJA 5G4WA 1JD7A 3MW7A 5G2IA 3WMSA 1OFBA 4DYJA 5HPOA 3KTXA 1PL9A 3ZT5A 4H04A 1WUEA 2PD9A 4MWAD 1R3QA 2OQLA 4W8BA 3PTDA 3CK5A 2QMJA 1W1ZA 4Y96A 2G97A 3RJYA 2ZUVA 3GU1A 4OHQA 5KZDA 3N9RA 4NAEB 5LNSA 1LUCB 2VUNA 3TZNA 3BAXA 1J0JA 3NO3A 5E6YA 3FJ4A 2Y61A 1HL2A 3M0YA 1DXEA 3GK0A 1W1TA 4FO4A 2OYMA 3LHWA 5A6TC 3S9YA 5BXSA 3PJWA 2H3BA 1WDWA 4IX0A 1QNRA 2FKPA 4RDZA 3L7RA 4GACA 1QPQA 1NEYA 2TODA 1JVNA 2B7PA 3W84A 4PTVA 4DM1A 3BOFA 5FI8A 4ZB2A 1X98A 4WXZA 2VZTA 2CBIA 3A3XA 4L1XA 2WMJA 2WO5A 3LK6A 4NAFB 3LQGA 4GH1A 3CWHA 2P10A 3MKCA 2PDHA 4PUNA 5A8MA 1U5VA 3CHCA 3QR0A 3C2VA 2JKPA 3GUGA 5E9XA 3PP7A 3BURA 2HSAA 3CYJA 1QPNA 4AIEA 2YXXA 2WCSA 1NVMA 3DC8A 4F0SA 4J2MA 4KPLA 1LCOA 1TV7A 3VNZA 1WBJA 1S2VA 2QAPA 3EWXA 4CQ9A 4HNVA 1PS9A 4HJWA 2QCDA 1OCJA 1GG1A 1H7OA 4NJKA 3TTYA 4FLRA 4H00A 3B9NA 4X9SA 3HPSA 2J77A 2JIWA 4AB4A 3HQNA 1ZBKA 4KMQA 3PBWA 4MZ8A 3WK3A 2GUYA 4JIQA 2EAWA 1GJUA 2AL1A 3GTNA 1M41A 2ZX7A 1VJIA 1M7OA 3R8GA 4Q4OA 1S2TA 4I8YA 3W1RA 1XV8A 3PVFA 1KBLA 3LX9A 1UD5A 2NQJA 2YIHA 3TAKA 1DXIA 3W53A 1EF2A 3H7UA 4X61A 4CNSA 4HZ8A 3W76A 2QJMA 4RXFA 2GSEA 1TWZA 2BLEA 4IGSA 2XVLA 5D2TA 4NKCA 1MRAA 3ARZA 1KBKA 3WMCA 1OSEA 3W1PA 2WHMA 1AJ0A 4QX4A 1PZ0A 4HT3A 4HSNA 5EGRA 5A8QA 2V2HA 2AAAA 3LHYA 1XUZA 2Y0FA 3WQWA 3BUVA 3TKFA 5HDRA 1HP4A 3N18A 1RSCA 2HK0A 1QNPA 2QJGA 2WZTA 4I6KA 3W88A 5C9RA 3GG1A 2OKTA 3T2PA 4UTWC 1KFWA 2EG8A 1MW0A 3WQOA 1Q13A 1WB0A 2NQ5A 1FP8A 4KWOA 3H24A 4JQAA 2Z2UA 2PC8A 1Z7AA 3RITA 2DZBA 3BDKA 2YR1A 3O6CA 4K68A 3N17A 2DQWA 5CZ0A 5CG7A 3KL3A 3NUKA 1XYCA 1N82A 4PYSA 2BFGA 2A79A 5BWFA 4JDBA 5DO8A 2FVLA 4E4UA 3W81A 1KXVA 4TVUA 2R1NA 2Q09A 4JTTA 1IEVA 1T41A 3GSMA 3PR2A 3AUOA 2DUAA 1JGIA 4KWVA 1E56A 3NXFA 4CQAA 2ZE0A 4RNIA 3RM4A 1O1HA 2X0SA 1VJSA 3THCA 3P0XA 3VNMA 5HMFA 4J3UA 2PP3A 5DY3A 2EPMX 3EB2A 2V67A 4AF0A 1CW2A 1HGYA 4IPPA 1PAMA 3VFLA 1G5AA 1N8IA 1AZ1A 3VM5A 2W67A 1MUCA 4QDWA 3E6EA 3BCJA 1GKRA 4DJFC 4V1XA 4WY0B 2DT2A 1LJYA 2CEQA 2WMGA 2JF6A