4C6FA

Crystal structure of the dihydroorotase domain of human cad bound to substrate at ph 6.5
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
364
structure length
363
Chain Sequence
KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROOROTASE
publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 119
structure length 363
sequence length 364
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6fA00
3MVTA 3NQBA 1UIOA 4C60A 4DI9A 4CNTA 3GUWA 2Y1HA 2YB1A 4QSFA 1V77A 4LALA 3A3WA 4R88A 4KEUA 1V7AA 3E74A 3MPGA 3R0DA 4CQCA 2ICSA 1YBQB 2BB0A 4H9XA 1FWAC 1NDYA 4ZSUA 3OOQA 2Z28A 3TN6A 4C5YA 1YRRA 1FWEC 3MVIA 4R85A 3O7UA 4C6KA 1XRFA 3CAKA 3OVGA 4GK8A 2PGRA 2UZ9A 1UBPC 4CNUA 1FWHC 1XRTA 2GOKA 4ERIA 4QRNA 3KM8A 4GBDA 4F0SA 5HMFA 3MKVA 1EJUC 4LCQA 3HM7A 4EPBC 4QTGA 2E25A 4H9VA 4IG2B 4DLFA 4LAKA 3T81A 1BF6A 1KRBC 4DZIA 1I0DA 4GX8A 3F2BA 4IGNA 2Z00A 4M51A 4H01A 1GKRA 2KAUC 2QT3A 3MJMA 1EJXC 2AMXA 4LCRA 4AQLA 1A5OC 3S2MA 2FVMA 2HPMA 2Z7GA 4L6DA 4CEXC 5FSEC 4H9YA 1VFLA 2EG7A 1FWIC 4BY3A 4WHBA 4G7EB 4DZHA 3LGDA 3A3XA 4IFRA 1UIPA 1GKQA 4GY0A 3E38A 4C6OA 2DVUA 1FKWA 3K2GA 4C6EA 2FFIA 3PBMA 4BKNA 4EPKA 3OQEA 3BE7A 2QVNA 2Z27A 4INFA 3LSBA 3PANA 3WYZA 1KRAC 3QGKC 2Z4GA 4V1YA 1ZZMA 3IJ6A 1O5RA 2R1NA 4GZ7A 4H00A 3S2JA 3PNZA 1NFGA 4RDYA 4MUPA 3TN5A 3E3HA 3UF9A 1R9YA 4KEZA 1RJRA 3URAA 3GTIA 4IFOA 1JGMA 1KCXA 2D2JA 4LFYA 1FWGC 4P5UA 1I0BA 4CQBA 4WVXA 3TN3A 2DVTA 4GXWA 3URQA 2OOFA 2AQVA 5AKQA 4C6FA 1RK6A 3SFWA 1V4YA 3NURA 2BGNE 1ONXA 2FTYA 2HPIA 1YBQA 3S4TA 2DVXA 2WJEA 2UBPC 3C86A 1DPMA 4KERA 1FWCC 1NDVA 3SO7A 1EJSC 2VUNA 3G77A 4C6JA 4PE8A 2OB3A 3WMLA 3QGAC 4IG2A 3LGGA 1S3TC 1A5NC 1RA0A 4J35A 3LSCA 1QXLA 2EG8A 4E3TA 4G2DA 1EF2A 2Q09A 4I6VA 1QW7A 1PO9A 4KESA 3PAOA 1IE7C 1ITUA 4LAMA 1RJQA 4C65A 4C6BA 3E0LA 3RYSA 3AU6A 3A4JA 4DNMA 3QY6A 2AQOA 1EJRC 2RAGA 4UBPC 4B92A 4GYFA 4CQDA 2P50A 4DIAA 1A4LA 2PLMA 4CNSA 4I6KA 3K5XA 1POJA 3V7PA 1V79A 3GG7A 4RE0A 4DI8A 1W1IE 3ORWA 4WGXA 3FDKA 3AUOA 3MDUA 4ERGA 1J6PA 3AU2A 5HMDA 4DO7A 4C6CA 2WM1A 2W9MA 2ADAA 2QPXA 2VHLA 1A5MC 2E1WA 3DC8A 4RZBA 4DLMA 2PUZA 2O4QA 3E0FA 3T1GA 3MDWA 2CZVA 3IV8A 5CH9A 3HTWA 4QROA 3LY0A 5HMEA 3URNA 2Z2BA 1WXYA 1RAKA 3ISIX 1PTAA 3TNBA 4H9ZA 4B3ZA 1FKXA 1FWBC 1RJPA 3NEHA 3RHGA 4HK7A 2VC5A 1ITQA 3IARA 3UPMA 4LANA 4IQJA 2HNHA 2Z25A 2FTWA 4KETA 4EPDC 3E2VA 3IACA 3ITCA 4LEFA 1FWJC 3OODA 1J5SA 4V1XA 2I5GA 1YMYA 4GY1A 3FEQA 2ANUA 4GC3A 1PB0A 4J2MA 3F4DA 4C6DA 4Z42C 4IGMA 3UR2A 2ZC1A 2PGFA 1PSCA 5E5CA 4NG3A 4ERAA 3T8LA 3UBPC 4LH8A 1P6CA 2A3LA 3EGJA 1EJTC 4R7WA 2P53A 3DCPA 4C6LA 3O0FA 1ADDA 4DYKA 2VC7A 4GOAA 3GU1A 4QS5A 3GTFA 3ICJA 4AC7C 4NI8A 3F2DA 4XAYA 4CEUC 4XAFA 1RA5A 3GTHA 1A4MA 4GX9A 1WXZA 1P6BA 2R1LA 3GU2A 4PBEA 4H9MA 2YB4A 1J79A 1NDWA 2HBVA 2OODA 4HK5A 5FSDC 3F4CA 2HQAA 4XD5A 3GIPA 3N2CA 4YIWA 5LXXA 4LAOA 2OGJA 1R9ZA 4XAZA 2R1PA 1E9YB 4IFKB 1UMLA 4QS6A 2YZ5A 2FVKA 1KRCC 3URBA 5A6TC 3MSRA 1KRMA 3UR5A 4XAGA 4L9XA 3GRIA 2IMRA 3TN4A 4BJHA 1GKPA 3CS2A 4C6PA 2GWNA 2R1KA 4C6MA 3K4WA 4C6QA 1YIXA 2Z29A 2WJDA 4G7EA 2Q01A 3QY7A 1R9XA 4F0LA 1P1MA 4J5NA 1YNYA 2EG6A 2Z2AA 1NDZA 1ONWA 3LU2A 3B0XA 4TQTA 3EWCA 1M65A 4PBFA 4RDZA 4C5ZA 1K70A 4PCNA 4C6IA 2VR2A 3LA4A 3IRSA 4GY7A 1A5LC 4B90A 1O12A 2F6KA 3LS9A 4B91A 2YXOA 3RN6A 3WZ0E 4KQNA 4ZSTA 4HJWA 4KEVA 4EP8C 3GU9A 3D6NA 2GWGA 2I9UA 3B40A 4PCPA 4F0RA 4HA0A 2OQLA 4UB9A 4EPEC 4ICMA 4HK6A 2D2HA 2GSEA 4RDVA 4H9TA 1K1DA 3LNPA 2Z26A 2XIOA 3GTXA 4KIRA 1J6OA 3GIQA 1A5KC 2O4MA 1M7JA 3EWDA 4NP7A 3OU8A 1EZ2A 3DUGA 3ID7A 1EJWC 4C6NA 2R1MA 3S2LA 1XGEA 4JOMA 4H9UA 1XWYA 4OFCA 4D8LA 1EJVC 3JZEA 3QY8A 1V51A 2G3FA 3IPWA 4KF1A 4XD3A 2WJFA 4IH3A 3MTWA 3IGHX 1M68A 1EYWA 4XD6A 1E9ZB 3F2CA 3B0YA 1RK5A 2QS8A 3FDGA 4RDWA 4LCSA 2PAJA 3OJGA 5G4HC 4IFKA 3RCMA 1POKA 3PNUA 3CJPA 3S2NA 2D2GA 1K6WA 2HBXA 4XD4A 1FWFC 1FWDC 4IF2A 1HZYA 2VM8A 3HPAA 2GZXA 2Z24A
chains in the Genus database with same CATH superfamily
3UD6A 5HA7A 1GONA 3RLUA 3MKKA 1OB0A 4CNTA 3M7WA 4NZJA 2CETA 2PDFA 3KBMA 3D3FA 5G1TA 2QF7A 5A2CA 3XIMA 4LBUA 4B16A 3SZ8A 2C16A 3G22A 2PDMA 3MVIA 3W2LA 3S5ZA 2POTA 5GJNA 3QSRA 4F0SA 4W9TA 4AF0B 1UHVA 4AWSA 3MBDA 1P0DA 4XAPA 3ZMRA 3MKCA 3OLEA 3U48A 2HROA 4N9BA 2AAAA 5LNRA 2G5WA 2CKRA 4BQ5A 1FHDA 1W6TA 3GZ3A 4UNLA 1AZ1A 1JNDA 4KMQA 4REQA 3WQCA 4NJIA 4DPPA 3PTMA 3VMOA 2E8YA 2PU0A 4Z0JA 4BY3A 2AL2B 3ARSA 2IUZA 3M0ZA 2VZTA 1JNEA 5JIWA 2UWFA 1XIEA 3KVKA 2CLIA 1KFBA 5TIMA 3TA9A 3PUDA 3F1QA 3WUBA 3V3WA 2Z27A 3T40A 4AZCA 3ARTA 4RXFA 4ZO8A 1OY0A 1GORA 3MYPA 4HPHA 4A29A 1IXQA 2R1NA 2BGQA 3ZR6A 2VVNA 4H00A 3SDOA 3IEBA 5M03A 2QDEA 2XVNA 3ARQA 3LENA 4AZGA 5LA1A 4QITA 4R7OA 2WZTA 2PP0A 2H8ZA 1R0MA 4HHPA 4Z1AA 5CCZA 1L0PA 2XVGA 3MMUA 4K7VA 1OC7A 4IZGA 3N3MA 3VNJA 1OM0A 3H2CA 1KBJA 1YBQA 1DXEA 2ZE0A 9RUBA 2UBPC 1LQ0A 1RPKA 4JL1A 2BHZA 4WOQA 5TQLA 3NJ3A 4MZYA 3LQGA 3M47A 4WJEA 1UOZA 1PBGA 1AK5A 1S3TC 2CLEA 1U22A 1O5QA 4TX9A 1HL2A 3LCHA 1PO9A 4EWJA 3TX9A 1SGJA 3TKFA 2RGLA 6REQB 1CIUA 2GSJA 2C1GA 4C65A 3E0LA 3KP1A 1UA3A 3OYXA 5EMMA 3MUXA 4KCVA 2Y61A 3C3NA 2VCAA 3V7PA 3WY1A 4MJMA 3EKGA 2V5BA 1V7YA 1GQLA 4YVPA 2XM1A 1W1IE 3VDCA 3UP8A 2J77A 1YX1A 1QI5A 2QLYA 2G96A 4UMBA 1MEIA 2VHLA 2VX5A 3BO9A 3PJXA 4IQDA 3WQFA 4B2DA 4BQ2A 3WQDA 1E6RA 6XIAA 2CWNA 1Q63A 1GPWA 4LUIA 2ZRXA 3FJNA 4L4OA 2OZ3A 1XFCA 4B3KA 1QRQA 5TF0A 5A6LA 2E5BA 3IARA 4ADTA 3LBCA 2RKXA 3N04A 4E8DA 2VMFA 5FOOA 2QCDB 1R3SA 4GZIA 3BW3A 5C0QA 3E2VA 3M0XA 3KOFA 4NKCA 3AJ7A 3H8AA 3IACA 1ISZA 4HCDA 3ITCA 1FWJC 3CPUA 4V1XA 4O4WA 4DWSC 2D3NA 2DZSA 2A1YA 4UTFA 3R43A 3HF3A 1E9IA 5JUVA 1WZLA 2WMHA 4HA1A 5DCDA 3LRLA 4IGMA 3L4VA 2PGFA 5LZLA 4A4AA 1UASA 2QEZA 3W73A 5DCBA 1KM2A 4WF7A 1VFHA 1AG1O 1TVNA 5FD0A 4JFWA 3UJSA 1GW1A 3LLFA 4CCZA 3SN1A 3CL6A 1IEXA 5IM51 1J01A 3GU1A 1G7UA 4Q6XA 4AC7C 4FS9A 1PIIA 4GUIA 3LCWA 5CPSA 4JHOA 1IGSA 1A4MA 1FCBA 2YB4A 2X1TA 3FYPA 1EUNA 1LG2A 2WC7A 3VKDA 1FWTA 3B0UX 3ALFA 4XAZA 1KBKA 2YXXA 3UXLA 2B81A 4PEEA 4FHAA 3RFAA 4MPKA 4P8VA 1AJZA 1DIOA 4DJEA 3W88A 3E96A 1PYFA 2E7FA 1TZZA 3GNOA 3UNDA 4UQBA 2FGLA 1AQFA 3TQVA 4O10A 4G1KA 3BARA 4P2VA 4J5NA 4LF1A 3LU2A 3P62A 4X9YA 3KTCA 3GQYA 5CZSA 4DEFA 2WZIA 2XN0A 4IPIA 4DO5A 3UQNA 4KRUA 5I3IA 3E49A 2C91A 5IXEA 1NWRA 4NAEA 1A5LC 5HJYA 1K8CA 3T09A 4GGHA 3AMGA 4OIFA 4J2PA 2BVTA 2GJXB 3TK7A 3RCNA 3VD7A 2JQXA 4Q8UA 2Z26A 5ABFB 4X2PA 1YYAA 4FOJA 1J6OA 5REQB 5DX7A 4LNYA 1H62A 5BMWA 3R11A 2Q6ZA 1Q6QA 3GK0A 3DG3A 1RR2A 3S2LA 4MYXA 2GDQA 3GXIA 3W9ZA 2BHYA 4B3LA 2O56A 3NSMA 3DFYA 5AYZA 2QW5A 4HSNA 3O6CA 4ZXLA 3SCQA 4PRTA 4HCHA 1MEHA 3R79A 2PDIA 4RPQA 3SQMA 4A6GA 3JU2A 4M5PA 5G2WA 4L6HA 4JIPA 5BRBA 3VX0A 2WMKA 2QCCA 4NX5A 4IGSA 1L8PA 2GPTA 2F84A 3ZT7A 3S0CA 3OZMA 4A2RA 1VYPX 1PYMA 2JEQA 1QNVA 1CXIA 1I2RA 1V77A 3K1DA 1KKRA 3MV01 3HN3A 4OECA 3SCOA 4GI9A 1CYGA 1IXOA 4R53A 5A69A 3MYOA 3AMCA 3WBWA 1HF6A 2WYSA 2YZRA 2VEKA 4GRSA 4FLQA 4DYJA 1IT0A 1N8WA 2QIIA 1C7TA 4US6A 1KTNA 4XBSA 4UR9A 1XRTA 2PRHA 4NILA 3W1NA 1TWSA 1YNQA 3KW3A 1H5YA 3SIZA 3G8RA 1CGVA 4LYQA 3W82A 5MKGA 5E0KA 4JQ1A 1BF6A 4JTEA 1KRBC 4HIBA 3R8RA 1MEWA 3VE9A 3VDBA 3HGOA 1VQTA 3MUAA 1C3FA 1V6WA 2YDSA 3GDRA 1A5OC 4JTLA 3R10A 2D22A 5I3GA 3CTTA 3W22A 1VENA 1ZP4A 4JBRA 2WZHA 3CQ0A 1GNXA 3GR8A 1WYIA 5CGQA 1FKWA 2PB1A 3USZA 1Q2RA 1RVKA 1UD8A 4BKNA 1FCVA 4EPKA 5KZMA 3LEPA 3L4XA 3II1A 3CUGA 3NQGA 1V6UA 4YVVA 3A5FA 3NGFA 1B3XA 3A4WA 1YDYA 1LROA 2J8GA 2NVDA 4JYEA 2DZPA 3UF9A 5E1QA 3E3HA 4QDWA 3TYUA 3KAOA 3MBFA 1PKNA 3QQ0A 4HGXA 3MMWA 2G4JA 5K9XA 3TN3A 5I07A 3EB3A 3AS1A 1XINA 3M07A 2EPLX 3I7SA 1TKKA 1OG6A 4MB5A 1JCLA 1E3XA 3W6MA 4ECLA 1ELSA 5CLWA 3S4TA 2R82A 3W6LA 1TPVA 4S3KA 4GUHA 2VFDA 3KLKA 5AHIA 4J40A 1S2WA 3IGUA 4IPNB 5HAOA 1S39A 3R6IA 4WDWA 1KQZA 3LGGA 2X1RA 3RMEA 1TPWA 1RA0A 2OO6A 1SW3A 2C0AA 5EMKA 1ZTVA 3Q58A 3GX9A 1MDLA 3MCMA 5I24A 3GYEA 4W93A 5FF2A 2FZNA 4PB4A 4HZ7A 2YCLB 3W1RA 4O50A 3TOYA 2E67A 4UBPC 4GLEA 5G4EA 4UOZA 1IQ8A 1LT8A 3O3RA 4L56A 1X38A 1TJPA 1EP2A 4HB7A 3WLHA 1XBXA 3VM7A 5C2CA 5F7UA 3WLRA 4AYGA 1VFFA 5HWMA 4GJ1A 4K7YA 4PYSA 4DJEC 3CH9A 3V5FA 2P8CA 4UFIA 3NVDA 1IIGA 1XD1A 3L4WA 1K7EA 3IV8A 1FH8A 3V18A 3WSUA 3SCNA 3EOEA 2QGYA 2F6XA 3C0LA 4A2SA 5FJUA 4L1XA 4H9ZA 3SN0A 4MUZA 5LA2A 3CZLA 2YXGA 3KZPA 2VC5A 3N12A 4EVZA 1OIFA 3XINA 2ZUMA 4C1NA 1DBTA 3V35A 1I4NA 1OK4A 4KWVA 4HOZA 1MUCA 3N6HA 4OV4A 1LTDA 2V9DA 1NF7A 1QPQA 4ERAA 3T42A 3RCYA 3V1PA 4HD5A 1V0MA 4NZ3A 1NIUA 4R7WA 3TTSA 1VB9A 1YDOA 3LM3A 4GOAA 2P0IA 3CBWA 1TPDA 4NI8A 4JL2A 1EP3A 3H6OA 5JQ9A 4PTXA 4PRWA 3ARVA 1L9WA 3WUGA 1V02A 1WXZA 1J79A 1TJRA 4YL2A 5AYYA 4E3VA 3FYOA 2J7GA 1LM1A 2BODX 4ZB0A 2PA6A 1L6WA 4HYRA 1MDRA 4MWAB 2GUBA 1QT1A 2NT0A 2WMFA 2OG9A 4BCEA 4C6PA 1QPRA 3IIZA 1S2UA 1JCNA 1LG1A 5RUBA 4DBEA 3EKZA 1W9PA 4JEQA 1IHIA 1JFXA 3UZJA 2DP3A 2OPJA 3CWOX 1W3KA 5F2LA 3VIHA 3W28A 3WF0A 1W9XA 8XIMA 3VD4A 2XIIA 4ROPA 4C6IA 4HZMA 4JY9A 3WDJA 3RRXA 1AJ0A 4IOTA 3U9IA 4DJFA 1K9TA 4KCTA 3UXDA 4GNJA 1RALA 4G56A 1Q6GA 4A8NA 1H0IA 3D6NA 1K8YA 3KOZA 1UKOA 2ZX5A 3L2IA 3FN9A 2C13A 3H12A 4RZ5A 4UB9A 4NVTA 4DELA 3REQB 1CXKA 3GB6A 4RDVA 2Q8LA 4MKNA 2J7FA 2XIOA 2FDMA 3GTXA 4GH1A 5LA0A 2QDDA 3ZIZA 3AYSA 4ATWA 1E1CB 1V08A 1XX1A 1CX9A 2WSYA 3K8KA 1GVYA 4JOMA 2G95A 1I9CB 2PDBA 4JTFA 3G1SA 4JCLA 4PUNA 1GUVA 4ICNA 4KF1A 3K1GA 4QJ4B 3MTWA 4S3BA 2NWSA 5HNRA 1XUZA 1RBAA 3SUTA 3ZJKA 1TG7A 1BRLA 3A9IA 3B03A 2PAJA 4LTSA 1KO0A 2VO5A 2J75A 1Y65A 1LWJA 1X96A 5KITA 3OLDA 5HUPA 2Z0IA 3IUHA 2NQZA 2ZKMX 2PCEA 5M2FX 3SCTA 3MVTA 2A3CA 4B5VA 1UB3A 4MFDA 4MZ1A 3MT1A 2J7DA 3GR4A 4R88A 5A6MA 3FFSA 2QJIA 4NZCA 3MPGA 3HV9A 1WV2A 2PFHA 4QM1A 1KWKA 3RLVA 1SZNA 5I7GA 4LUYA 1NM9A 2BY1A 1XHGA 1ZJIA 3AXHA 3P84A 4H9VA 5A6BA 4AY7A 3W01A 2VZUA 1EWDA 5A2BA 4KWOA 3TYBA 2HVNA 1DIKA 3QKZA 4RK8A 3CUIA 1V3KA 4H01A 4PEKA 3VOHA 3RU6A 5AHNA 2V30A 1Y0EA 2VD8A 4O16A 4AD4A 1KR0A 3Q2DA 5D37A 1OK6A 1PZ3A 1EOMA 4S3DA 4H9YA 5IOBA 5D09A 5K7JA 1WDDA 4O28A 4UOJA 1L6YA 1E6PA 3MZNA 4JKKA 1QTWA 1HJQA 4FIQA 4J7RA 4IIFA 4GY0A 1SUXA 1RSCA 2X42A 2DVUA 4BI5A 2D0FA 2X1IA 4M6UA 1KBIA 1WA3A 4Q8WA 4JNZA 1IZJA 2PTXA 1KRAC 3PWGA 2V2CA 1X1ZA 2D24A 4JTJA 1QAPA 1WDWA 5D8WA 1YPIA 1XLIA 4TVDA 2RDUA 3TYCA 1XISA 3S46A 2Z6JA 4P5UA 1AW5A 2G3MA 4XKYB 1JZ6A 1WKYA 1A5BA 2RGMA 2W6RA 1TTPA 1TZ7A 2QYGA 3DHFA 1K9FA 3TUUA 3AHXA 3CNYA 5CBIA 3KHJA 5SWUA 3VC5A 2DV0A 4FK9A 1HFBA 3P3BA 4AVOA 1BWVA 2XH0A 3BCDA 1EB3A 4D6IA 3PJTA 4MFEA 2PODA 5F2IA 3C56A 3GW0A 4EXAA 3L68A 3KEHA 1PJ9A 2PD9A 2AOSA 4AHPA 3THQA 3UU0A 4XZMX 4UTMA 2ZICA 4DIAA 4R7JA 2XSBA 1VFSA 1MVYA 3RF9A 2F2KA 2J78A 2ZA1A 3EX4A 1AODA 2DORA 4ACZA 5E9AA 4W86A 1LJYA 3OQ8A 1ZHAA 2X41A 1AFSA 4DO7A 3SY1A 3H4GA 2QPXA 1TE1A 1W9VA 3VPLA 2ZZ5A 1TO3A 5EU9A 3VA8A 3KL3A 4CD6A 4E4UA 3E0FA 4PL2A 3W1AA 1EHNA 1ZENA 1G0CA 4QAIA 1SW7A 3S2CA 4QROA 4B5WA 3EZ4A 1GG1A 3LERA 5CGMA 4I8DA 4GVIA 3WLTA 3DHUA 2FHFA 1XC4A 1U30A 1MZHA 1W3IA 1RZMA 4S39A 4JTSA 4PFMA 4LANA 1JYVA 1TQJA 1ZALA 2Z6IA 2OZ0A 4FX7A 3SECA 3PZNA 3IIOA 3N18A 3NQAA 1GW9A 2WANA 4DUXA 4DJFC 2VEPA 3H2AA 4F2BA 1TMQA 1W5NA 1FWSA 3U7VA 2NV1A 2XPKA 4ZOBA 4ZCWA 3KBWA 2BXYA 2J6XA 1G6CA 3PN8A 1UP0A 2Y62A 2C19A 2ZRWA 4CU6A 2ACQA 2WCGA 3NQMA 4Y8EA 4LH8A 3I7RA 3PR2A 3WELA 3WQ4A 5EY5A 2X1UA 3VZXA 2ZIDA 2WZMA 1EJTC 4M29A 3DCPA 3PPHA 3UETA 3NZRA 4E0CA 2XFYA 1BVZA 4NZFA 3BW2A 1IR2A 4XB3A 1D7FA 1CZ1A 4D1IA 1P5BA 2Z7KA 3ARXA 2R1LA 1GK8A 3RM9A 5T26A 2OODA 3APGA 2ZZ4A 3AO0A 3AIEA 5H1WA 3WL0A 5D2VA 2QJNA 2FTPA 4LAOA 3HPSA 4RXGA 1GQNA 3CMGA 3NL3A 3SQSA 1ADSA 1A47A 2ZADA 3URBA 3FVDA 4MJ2A 1R2TA 1QHOA 2VRJA 1U33A 2P3EA 3EEZA 2TSYA 3VIMA 4BJHA 3B9NA 4ZOAA 5JH1A 1DKWA 3LV5A 4JN6A 4DQWA 4DNHA 2E40A 2IKHA 2DQXA 1R9XA 1HO1A 2EG6A 3PTDA 4YN5A 1NDZA 2CLPA 4XZNX 3W84A 1VBUA 1M65A 3R0UA 3OBEA 4MWAD 1L6GA 1Y7VA 1J0HA 3UJRA 1RY8A 3EA1A 4MNMA 1D7KA 1G1YA 1R6WA 3I6EA 4CD7A 2POZA 4X61A 3O0KA 3VABA 2FB2A 3LS9A 5LIKX 2BFGA 4RZ4A 5BXTA 2E9BA 1WBJA 3GU9A 3I65A 3MUZ1 3R4IA 4I7VA 1DTUA 4TTUA 5E9XA 4QCEA 4DVOA 3QW4B 4GUGA 3CEUA 1Q45A 5H6HA 1DQUA 1U1UA 2YCIX 1DP0A 3N11A 2EXOA 4JIHA 5ECVA 3KTXA 3DECA 3W29A 3FKKA 3BG3A 1JCYA 1LLZA 3TR2A 2P10A 2P3ZA 5D30A 3SFKA 2A2IA 4GYPA 3QY8A 3F5JA 2OVLA 2W27A 5CQ1A 4LT9A 1E9ZB 4U2ZA 3LHYA 2NW0A 5FIPA 3LCLA 4IFKA 1WP6A 2YLAA 3PJWA 4UQ9A 2VR5A 1ZBVA 4CVWA 4YXGA 4FI4A 4ZB5A 1O1HA 3E1F1 2OR2A 1I8JA 5MF5A 3N9RA 5I3HA 2WQPA 4MNKA 3PUOA 3UY7A 3D5HA 1KKOA 4CCDA 4Q6JA 1RCQA 4WEVX 3CL7A 3NTYA 2XGBA 3CASA 3WDQA 2YDAA 1PTGA 1ZBCA 3CZEA 1EKOA 2QCGA 1TPH1 1A49A 4C5YA 4DF2A 2P76A 4LXFA 2ZCGA 3CAKA 4OVXA 3NXFA 2F9RA 4ERIA 1CGTA 2E25A 1PHQA 2PBOA 1F61A 2WK2A 1S3HA 3SBFA 4M51A 4GIAA 5HQLA 3FEMA 1FCUA 2JKAA 4MJ4A 1BYBA 2JEPA 3RIKA 3CT2A 2PTZA 3WLIA 4CEXC 1E1EA 1NWTA 3NDYA 1W31A 1VFLA 4L7ZA 1QOPA 1FWIC 3ZR5A 4JKMA 4GACA 2H9AB 3M7SA 3V75A 4C6OA 3PSVA 3K2GA 2QHAA 4Y7EA 3W07A 1A50A 2OQHA 3H2MA 3WYZA 3TC3A 3VKJA 3Q67A 1HO4A 3S1VA 1ZZMA 1GJPA 2VCCA 1UD4A 2I16A 5KSWA 5E70A 3PF3A 2WHLA 1UH2A 3MB9A 5JIPA 3PC0A 1VEMA 1JGMA 1GVQA 4JZ5A 1LOQA 1SJBA 1NWSA 3P0XA 2BOFX 4QE4A 3T4WA 3APYA 4H1ZA 3ZVIA 4HZ6A 5E09A 4FXRA 1RK6A 5XIMA 3SFWA 1DL3A 4GXMA 3RX2A 4RKAA 3GM8A 1Q4WA 4TMBA 4LUSB 3GFYA 4TXEA 4FR6A 2ABAA 8A3HA 2A85A 3O15A 4BQ3A 4O1BA 3AHTA 3BOLA 3A4AA 3K8LA 3WMLA 1CXHA 1YNPA 4M0XA 2Q3OA 2P0OA 3CU2A 4FOUA 4AZ5A 4HNOA 3CAQA 3AMLA 3C0JA 1EF2A 4ZOCA 3FJLA 3VK5A 4QISA 1P4CA 3OG2A 1LP6A 4WJ8A 4DBWA 4KFNA 1RHCA 2WCAA 4CQDA 4EF9A 4O19A 1M04A 4ZEPA 1A5AA 9XIMA 1LL7A 4Z2HA 4R5EA 3RR4A 3BJSA 2YA2A 4WGXA 3MDUA 1TTIA 1NF0A 2I57A 3SW6A 3O6YX 4I7WA 1LL4A 3VDAA 1H09A 3KXQA 4JYDA 4PTNA 4PUJA 1KM5A 5CJNA 4IUGA 1QNQA 2E5DA 2CZVA 1H4PA 3N13A 4WSKA 5AC7A 1ZCCA 1BWKA 3TOPA 1R3TA 2BS9A 4GQ0A 3TNBA 3NGJA 1E73M 4IM4A 1FWBC 4HSHA 3BLKA 4RE2A 4R9OA 1Z8AA 3OHMB 2HNHA 3FNDA 1AL7A 4X0VA 4J9JA 2IXUA 3AYRA 1EWEA 3TH6A 1YMYA 3ATYA 3DFTA 3ALGA 1E6XM 2GGJA 2OT0A 3USBA 1PSCA 2CIPA 2ZRVA 1VRXA 4NJHA 4RNIA 2CLLA 1BYAA 2FPTA 1KTCA 2A3HA 1F3XA 2A3LA 2HS6A 4JTRA 4AXNA 4TOQA 4C6LA 1XYAA 4C7FA 2YOCA 4LB4A 3QV9A 4RUBA 1RQHA 2QF8A 3N34A 1R3VA 4F0KA 4WKAA 3TWAA 4MNJA 2QCMA 4NY2A 2ZXBA 3LHZA 3QSTA 4W8BA 4PBEA 3RJXA 2FMOA 4M6VA 1UMLA 1XKYA 4QS6A 4Z0SA 3W0KA 3M6DA 3UFYA 4L9XA 5B7YA 1KC7A 1GPFA 4RJEA 5BZAA 4PUWA 1Q6CA 1KBBA 1UCWA 1PKYA 3K4WA 4XSLA 4C6QA 1AH0A 2XWDA 1J96A 1XSKA 3RJYA 2Z2AA 2ATMA 2XIMA 3AFBA 5GJPA 2O9PA 3GDBA 1JL8A 1Z42A 4IICA 4KFOA 1HKJA 1K70A 1HJSA 4HPJA 1OZMA 2J9ZA 4P8UA 2D0GA 1WKEA 1FBAA 5G1MA 5HXMA 3WD1A 4B5XA 3HJZA 2A0NA 4AH7A 3FJ6A 1K7XA 1VFUA 5LNUA 2HVOA 1XLKA 2PS2A 4JTCA 3WENA 4PCPA 3OGRA 3PVFA 2OQLA 4QXIA 4ZFCA 1ME7A 4J3WA 4ROQA 4J3VA 3M0IA 1K1DA 4S2BA 3BQ5A 3Q37A 1U1JA 1Z9AA 3HG4A 4NP7A 3BSMA 2BX7A 5BW6A 4I8YA 4IMAA 4UFKA 1E4MM 1RCOB 2BV9A 3O63A 3W2MA 3R2GA 4D8LA 3KUMA 3LPOA 3WJXA 4RNFA 3MC5A 4K36A 3SY8A 3MO7A 1F8MA 4FNRA 4LCSA 3FOKA 2YR1A 2VDIA 5CPNA 3VFCA 3SM0A 3R12A 2ALDA 3DFNA 3LV6A 1DXFA 5DMMA 1XIJA 2PDKA 4WDUA 4W8AA 3KDOA 4UXDA 3N4EA 3VAVA 1WBHA 1HZYA 5AY7A 1DVJA 3SRFA 3BICA 4CKQA 1JQXA 1XLGA 5I78A 4ADUA 1W37A 3ITYA 1BD0A 4PTWA 1FWNA 1UIOA 1W5QA 1ISWA 4NI3A 3QKEA 2DUXA 2ZUTA 1CGWA 5B80A 2BWGA 3NM3A 3BH4A 3BVJA 4K68A 4Z1DA 3THUA 3NG3A 3SB0A 1TUXA 5HJXA 1Z3NA 3IK4A 5GNXA 3WD4A 4L6OA 1R2SA 3SRKA 3TCEA 3VDHA 1HUVA 1CLVA 2CZFA 1J2BA 1ISXA 3W2JA 4AIUA 4PRRA 3B3DA 2OYMA 4QEHA 3B8SA 4LU0A 4Y9NA 1EA0A 3EX2A 1F5ZA 1T6MA 1CB2A 1GOIA 4MKVA 2J7BA 3WQPA 2G3JA 1ZFJA 4ZVJA 1B9BA 4AC1X 3CUHA 2BASA 4GYKA 1AMYA 2OEMA 4O53A 1OF6A 1OX4A 1GOWA 3UWUA 3PY2A 3VCNA 3NQ2A 4E4FA 1LBFA 1LYXA 5AC4A 1N8FA 3R94A 1GTHA 3HGRA 3O06A 1SR9A 4FLSA 1XYLA 3RM4A 3UCCA 1HL8A 1P1XA 2XVKA 1UYQA 4HYVA 1HKKA 1GOMA 1TA3B 4MUPA 4PA8A 3W7IA 4ACYA 5HNNA 4I5RA 1SJAA 4QGCA 2IKIA 3QHOA 4AMCA 3S8HA 1CCWB 4LVGA 3A6OA 3CO4A 1S5VA 3W23A 1QVBA 4H7CA 3SJNA 1B2YA 3W1MA 1JFHA 2MUCA 2ZA3A 3QGVA 1ODZA 4XVEA 3BSHA 4PMDA 3HV8A 1JZ3A 1XFBA 1EXPA 1YQ2A 2ONEA 4BEQA 3HBLA 2V5DA 2XH2A 4OOUA 1WZKA 1JDCA 3G77A 5LIWX 1DE5A 2OB3A 4ENLA 1TV8A 3HQ1A 1BPLB 2A3BA 3D3AA 1PX3A 5AFDA 2R24A 1QXLA 5BOFA 3PG9A 3ONBA 1NOFA 1E1FA 2PP1A 5DRCA 2EEXA 2E5CA 5B7ZA 2XJ7A 2PWEA 1FDJA 4D6GA 1V6VA 3STFA 4DNMA 5FF0A 3AZTA 1CXFA 3HA1A 3C2EA 2QV5A 3CV7A 1V79A 1H63A 3T2PA 1GVFA 1E0TA 3W86A 5A1AA 5HQEA 4US5D 4DXXA 2OLHA 3ENLA 4XBKA 4HSOA 2FIQA 2IS7A 2A79A 5I06A 1A0EA 3BMVA 2D1ZA 3ARWA 3DAQA 3T1GA 3STCA 1MQRA 1EBHA 3HURA 2E9LA 2VFHA 4O12A 1DWHM 3LY0A 4XUGA 2OX1A 2XZ9A 3G1XA 3WNLA 3T08A 4GVHA 3OVPA 4HK7A 2DH3A 2YDQA 4WJXA 1XH0A 3WF2A 2DPEA 1GYLA 4L9ZA 1Y5VA 3BMWA 1BXNA 3OTRA 4XX6A 3B05A 3OODA 3R13A 2I5GA 2W5FA 3GNDA 2NLYA 2PWHA 3R8GA 3S42A 4J2MA 3VOGA 4AEEA 3SURA 5HJLA 2EO7A 4JN7A 4CNPA 7REQA 1P6CA 2PTWA 1M1BA 3I4EA 1EPVA 1A3HA 1YE4A 3QHMA 3O0FA 1PKLA 3L7RA 4JFSA 2ESCA 3BMXA 1FXQA 3RG6A 3BGGA 2E09A 1KXVA 3LB0A 4AD3A 5CAKA 4N9CA 5U7SA 1R87A 2REQB 3LPGA 3DERA 3KZSA 2WZEA 5DMYA 2XH4A 2VC6A 3WQEA 3U5YA 1CPUA 5ENLA 2WQDA 1XCXA 1W3NA 3EAUA 2JFEX 4AD0A 4OZOA 7CGTA 4AY8A 3VDGA 1TCDA 3IJLA 3GIYA 4J3SA 3EPOA 5K3VA 5DANA 1VLIA 4G9PA 2PDWA 3VD3A 1EQPA 4LS2A 4NSBA 3C2VA 1FP8A 4H6QA 3W4RA 3S5NA 2G50A 3CUJA 4JYFA 5M3WA 1E0UA 4B9ZA 3W85A 3EWCA 2OKTA 5CXPA 1QI2A 5D02A 1FWWA 2I5IA 1DJQA 2PCQA 3W7KA 5D8ZA 2BOEX 2PF8A 1TJ0A 3WK1A 1IEVA 4UOQA 4NRSA 2YXOA 1JR1A 3GS6A 3CT7A 3E2SA 4H19A 4RR4A 4EAMA 3B4UA 1ITCA 1P0EA 3N2OA 2GWGA 3E2RA 2GJLA 4JQ2A 4EPEC 4ICMA 3KTSA 1W0MA 1EEPA 1XD0A 2B7NA 3E12A 3QPYA 3IIVA 1QO2A 1JZ4A 3WJSA 5I03A 1R30A 5HR6A 3GNRA 5AZ1A 4Q3MA 2Q8ZA 1KM3A 1UPMB 1SZGA 2VEFA 4U2YA 3NUKA 3OU8A 3GR7A 4AZBA 3QTPA 2FKPA 3NDZA 3C6CA 2V69A 1XIHA 4ZE5A 2BLEA 3VNKA 1CB7B 1EC8A 1P7TA 1CXLA 4NNCA 3UZ5A 1GQKA 1O66A 4LV4A 2ZXAA 1HKVA 4RDWA 2TYSA 3G1RA 1DJZA 4HN8A 5C9WA 3NEVA 2ZZ7A 1SPQA 2J74A 3VNLA 1G7VA 3M9YA 5BWAA 2VXNA 4IUOA 3V5OA 4O0QA 2GK1A 2PLKA 1GVOA 3NNTA 4K2SA 3QRHA 3AJXA 3LBOA 1TPFA 2PF0A 3MZ2A 2UV8G 3UG3A 2RH9A 2WJZA 4HN4A 1REQA 1O5KA 1VFTA 1YPFA 2EJAA 3B0VC 1ECEA 3BANA 2O0TA 5JU6A 1KA9F 4X63A 3OVGA 1XBZA 5BRQA 3W1PA 4QRNA 3TNOA 4XTDA 4LCQA 3BV7A 1JPKA 5FJTA 3W27A 1P48A 3P60A 3RX3A 4AWEA 1CLKA 3N9SA 3T8QA 3PTQA 2J9XA 3G24A 4Z2JA 1C8YA 1HQTA 2J8FA 1TTQA 1R8LA 3BJFA 3NPXA 5CPTA 4GYJA 2WVVB 2IKJA 1U83A 2Y85A 3EWBX 1XPGA 2DZWA 3LCIA 4WKFA 1R3WA 3IJDA 5XINA 2Z7GA 3VIJA 2P5NA 5FKYA 4QG9A 3DG6A 5D2WA 3VIOA 4PMXA 2JKEA 2VNCA 4DYEA 4BR1A 2H3DA 3E38A 3NQCA 2OZTA 5LIXX 3VIGA 3T0AA 5H91A 3EXRA 3WL1A 3LI0A 2HXUA 4HZ8A 3S2JA 2OEKA 3PNZA 2CHOA 1NELA 3LPPA 1X6NA 2W67A 3BC9A 3E0VA 1XLMA 3SGUA 4S3FA 5CPMA 1OG0A 1GYNA 2BY0A 3LGEA 5BXSA 3WLNA 3VUPA 3C2FA 2G37A 3WDPP 3KOXA 1UWSA 3HGJA 1GTEA 1LRNA 3SCSA 2X05A 2DSWA 4D6JA 1H60A 4S3JA 4R27A 2XUCA 2VR4A 2VZOA 4DJDA 4PE8A 4U5KA 5T9BG 5PTDA 1A5NC 1HGYA 1T99A 3QYSA 5HNTA 1CTNA 4ZQCA 2GL5A 1QW7A 1XYFA 2IKGA 4FMVA 4AEFA 4GINA 4W85A 3TJ4A 3RYSA 2WW5A 4JDBA 3QY6A 3MUCA 2W66A 3F4VA 3R8HA 4R33A 3ZT5A 3W7QA 2J62A 3E02A 3GG7A 3W3OA 3NZGA 1E15A 3QZ6A 3GG1A 2NUXA 2E3ZA 3T78A 5CLTA 3KOWA 1OCNA 3MMDA 3ANUA 4UMAA 8CGTA 1IZCA 1XLHA 3CUZA 2ZX7A 4RZBA 1RBOB 5D03A 2PWVA 1SR0A 4U5IA 1YADA 1E1CA 1JDEA 1C91A 2A7NA 5CH9A 3OO2A 4H6EA 1UBSA 4NNAA 3IGXA 1UR0A 1RAKA 1PTAA 4S3EA 1GVSA 2F38A 1UWAA 1C9WA 2I17A 2OLSA 4AB4A 3MHGA 1V3IA 4PTVA 2RFGA 1UR1A 4CVUA 4MF4A 2QQ6A 1O5XA 3JUGA 1JUBA 3C4UA 4DWSB 4NL1A 4XBJA 3NVTA 3W7DA 1V6TA 4E8CA 4Y9AA 4XSMA 3QFWA 4UFMA 3G1AA 4O1CA 2BY3A 2CCRA 3PM6A 4BZYA 2X16A 5ECUA 3LLDA 3G3MA 2FLIA 4CD8A 3QBUA 2GOUA 1PDYA 1OQFA 2PU1A 2OSWA 4WY0B 4O1EA 5HWNA 4PMZA 3ARPA 4Q8TA 4QS5A 3BAWA 3GTFA 3ICJA 3COTA 2RHGA 4D6CA 1FHVA 4UFJA 1K03A 2VX6A 2PGWA 1U2YA 4AZ6A 3P67A 3UWZA 3AXIA 3RPMA 3T7VA 2NSOA 3NZPA 3H23A 2BVWA 3P5ZA 4MOZA 3EDKA 2FGBA 1CXEA 1JCMP 3LZ3A 1DORA 1CWYA 2DZBA 2FGZA 2FZDA 3AISA 3WEMA 1R38A 1F3TA 4Q4RA 4PUMA 2DZUA 3Q65A 5FJRA 2QCNA 3S3GA 2WJDA 4LVBA 3V36A 1P1MA 3OB8A 2INZA 1DWAM 1ONWA 3LHTA 4QE5A 3CIWA 4E2OA 3IJ9A 3HPXA 3UG4A 2VX7A 1MRQA 1NJJA 2VDHA 2VEIA 4EKJA 1X97A 4GQBA 1JYXA 3LA4A 4D9PA 4ZO6A 1NWUA 2PMQA 2F6KA 3CZKA 1SYTA 4HJWA 3GKAA 1L6SA 2CBVA 1NQKA 4FX8A 3N15A 2VCBA 3TROA 3J7HA 4LY4A 3UERA 1S1RA 3LNPA 3NQEA 3TU9A 1E43A 4REQB 4HNVA 1VEPA 4EOUA 1VBGA 2O4MA 3I3BA 3L0GA 4W89A 3RLGA 2DDXA 4UQDA 3KWSA 3ZLGA 3BJTA 1QASA 1XQKA 5CSYA 2R1MA 4PR4A 3OZOA 4FNSA 2AGKA 4DRSA 3JZEA 1YXDA 3VMNA 1UD3A 3IPWA 4L4LA 1ZGDA 4GWEA 2QPUA 3AHVA 4Z2GA 4UR8A 4HNLA 4AZCB 3NWRA 2V5CA 3EX6A 3FDGA 1KM1A 3LPFA 4ZGYA 5CC3A 4W84A 2QJMA 4LSBA 3H7VA 3WDHA 1W91A 4KWWA 5T91A 1BWLA 2BVDA 2WSKA 3L0KA 1XLEA 1B4EA 3FV9A 3ZOAA 1UD2A 4PSRA 1WX0A 4LVAA 2L5HA 3I7QA 3TXZA 1AUSL 5LNVA 3O16A 3TTOA 3SUUA 3U2CA 2G8ZA 4KEUA 2ZDSA 1YBQB 4MGGA 1DJGA 3GNXA 3IJQA 4PMVA 4Q4KA 5M17A 5LYRA 5FEPA 3U8GA 2UZ9A 4YLWA 4HYWA 1H7NA 3HM7A 4A3HA 3BCJA 2UY4A 4IJRA 1H49A 3UJFA 1GJWA 2HTMA 5A6AA 3UWWA 1QUMA 1ZP3A 2OKOA 2QT3A 3VGEA 5JBDA 4LCRA 3LXCA 2JIEA 2PWGA 4D2JA 1KLZA 1OYAA 4XO7A 4OJYA 4V27A 2CEQA 3L12A 4HVXA 3OW1A 3B9AA 4C7DA 4WZHA 3VOJA 4Y9MA 3GE7A 2QAPA 5T9CE 1M9HA 1ZJAA 4J28A 3AIQA 3MHUA 2QXWA 1DHPA 2DZAA 4MKSA 3I10A 4JQ4A 3PS7A 1CT5A 1R3YA 3EA3A 1OFRA 4PSPA 1B5TA 2FHBA 3TN5A 3TSDA 1E5NA 1TWIA 5AHEA 3QR0A 1EC7A 2Y5SA 1AJ2A 4Z1BA 4DXKA 5DT7A 5TAOA 1Q6DA 1PIGA 3QOKA 3OBAA 3H4XA 2YLLA 3L2LA 1SFJA 4RV3A 3UVIA 4H8HA 4H6KA 3WX7A 3QZAA 1JZ7A 3TIMA 5H8UA 2X7WA 3A12A 3DFSA 5EMUA 2WNNA 1OX6A 1DPMA 1UP3A 3NOEA 4G5DA 5A5WA 3IRDA 4NJGA 4ZO9A 3VD5A 3IWPA 4O8AA 1H2JA 2VI0A 3QGAC 5A95A 3AYTA 3HU7A 4KS0A 4HPNA 4IG2A 1M5WA 1E56A 1JAEA 1EO7A 1YDNA 4I3GA 3LSCA 1K8ZA 1F6YA 4W7VA 3AI0A 4M6PA 4W87A 1Z6KA 2WVTA 4Q22A 3U6WA 3OLIA 3RX4A 4YTTA 3SCUA 4GJIA 4B92A 4TX6A 2P50A 1L8NA 3ITOA 1UJQA 4MAZA 2XZ7A 2NQLA 2IPJA 1W8GA 1IT7A 3MI6A 3L21A 5HMDA 1O6IA 1VS1A 1O95A 3W87A 4IMEA 4YTSA 2A3AA 3AIRA 2HVMA 4ATLA 3R58A 3KL5A 1I1WA 1VPXA 3NXLA 3U4FA 1AW2A 4LYKA 3I4KA 4G8TA 1TFVA 3M16A 1WXYA 4OBRA 4A3QA 2TMDA 2PC8A 4ZQRA 2G3NA 3VTRA 5KZEA 4I9AA 2RDXA 4ILSA 4JQ3A 2ZUNA 4GQQA 1I2QA 2GQ9A 4AD5A 3N29A 3PZTA 4J1OA 4NAEB 3OIHA 4OV9A 1G67A 2XIJA 1Q8JA 1PZ2A 2VDGA 3R5EA 4NQ1A 1RD6A 3FEQA 1TCMA 5EB8A 2WVSA 3F4DA 4TR9A 2XG9A 3PBGA 3UR2A 4CN4A 3SRDA 5TBOA 4AHQA 2BOGX 3GFXA 5EL1A 3N4AA 1ICSA 2NXHA 1YPXA 4DWSD 2J8TA 2XHYA 2DIEA 4O0KA 3MMTA 4AFYA 4O8RA 4D8AA 2B4GA 4HHLA 2OEJA 3GTHA 4GX9A 1OCBA 1P6BA 3GU2A 2ZZ6A 5G2HA 4ZXOA 3T44A 1IV8A 3OGSA 3BAIA 2BNJA 8RUCA 3UT0A 1D8CA 4NJJA 4HOWA 1KRCC 1BYCA 1WDRA 3WNKA 2UY5A 3O8AA 1UMYA 3TYDA 4U4MA 1FX6A 1K3UA 4IP7A 3T0BA 2Y8UA 1F3EA 3VILA 1TQXA 9CGTA 1SMAA 4GIRA 4ZFMA 3OPSA 3I3DA 1XRVA 2XTKA 2VENA 2ZUUA 4XZHA 3TZNA 3IIPA 5H2ZA 3TYEA 1N82A 4AMAA 4N2YA 4DUWA 1OFPA 4QNWA 1XI3A 4N4PA 4YJ5A 2VQUA 5MKGB 2ODOA 3RN6A 3TAKA 1EO5A 3HMJG 2F7FA 3O05A 1XJBA 4B5TA 4CNNA 4IHCA 2WLZA 4F0RA 3UYCA 4W5ZA 1MI3A 4GIEA 5K9CA 4LS0A 3FA5A 4K8EA 1SZRA 1A5KC 3QOMA 4GKLA 1OGSA 5A3HA 3HOJA 4MB4A 1XGEA 1HNYA 4UNKA 3UZYA 4H9UA 2OU4A 3KVLA 1W3JA 3W7OA 4UTTA 2PRLA 2XDFA 3ZXWA 3PPFA 2E1DA 2G41A 5BNKA 1TV5A 3DZ1A 2E6YA 2WWCA 3KVMA 5GJMA 3N14A 2DZTA 2I56A 1QR7A 3CHCA 4QDPA 3WLSA 4MIMA 3AXMA 3WNMA 2QKFA 5M5DA 2VFFA 1VC4A 3B8DA 1M41A 1MRAA 3UR5A 2Z24A 2C1HA 1DWJM 4C60A 2GSHA 2ZX8A 1MXDA 3A3WA 1ITXA 3W7RA 2WO5A 3WK3A 3SSJA 2MANA 1V7AA 1FHLA 3EWXA 1CBGA 2BB0A 1RUSA 2CXGA 1FWAC 4S3AA 3RXZA 4QCFA 3QVQA 5LIUX 1QW9A 5CG0A 1KB3A 1XIGA 2E6DA 4PUKA 3RRAA 3G1FA 4CLMA 3WG6A 2J25A 4F40A 3ZVHA 3AUJA 2Y8VA 1UC4A 2AMXA 4WIWA 1BGGA 1B54A 4Y90A 5D9MA 4MVAA 4CU8A 2XYLA 1D3HA 4J3TA 2HDJA 4S3CA 1MQPA 2XSAA 1NOUA 2J9YA 3LGDA 4QX4A 4IFRA 4F9DA 2OXNA 1UIPA 4HJFA 1CENA 3P80A 1JRBA 1VP5A 1JCXA 1K9DA 1OD8A 2C1IA 1IYXA 3ZM8A 1ZL1A 3BTNA 4IMFA 4ATDA 3PPGA 1IT8A 3PZGA 3LTYA 4IFOA 2GVJA 1NQ6A 1V6XA 3TA6A 4YS1A 5K2ZA 4FB7A 1OX5A 5HULA 7ENLA 3NYDA 4C1NB 4B2DD 4N9DA 2CLHA 3SRHA 3URQA 2EPKX 3W7EA 1W2PA 4C6FA 1M01A 3U4AA 3CQIA 1W1TA 4LV9A 4NAFA 1UWTA 2Z1XA 2HPIA 4RW3A 1GHSA 2WJEA 1THFD 3EKLA 5AC6A 1VBJA 1GOKA 4GO9A 4V33A 1BG9A 2H6RA 5JVLA 1JAKA 3B9DA 3H21A 1CNVA 3BG9A 1NARA 1XIIA 4M24A 4QLLA 5CC5A 3GW3A 3TP4A 5CZ0A 5TD4A 1IE7C 3S1UA 1RJQA 3VNMA 2DFAA 1TR9A 3THDA 3IV3A 4MY9A 5CKSA 3VKBA 1HP5A 3CC1A 4PH6A 2A4AA 1UPPA 1JCTA 3WD2A 1A4LA 4BF7A 1J0IA 1EGZA 5J5RA 1E4IA 2V38A 3AIUA 4FAMA 3G0XA 2FPYA 1J18A 3MW7A 3CTLA 3L4YA 2EJ1A 1VCGA 2CBIA 4BHYA 2E1WA 2VOTA 1A5SA 3O07A 4TO8A 1BTMA 1UWIA 1A0CA 2YFOA 2FJKA 2BBFA 5ABTA 4MADA 3HTWA 4XWUA 4L61A 3BLDA 4RPPA 1FRBA 2GVEA 3T2QA 5HMEA 2IQ0A 4WDTA 4F8XA 1ME8A 5CAHA 3NEHA 4LVDA 4DJED 5EMJA 3WK0A 1D3CA 4F66A 2WMIA 2CLFA 3SEPA 1J5SA 4O1DA 3ZR4A 2WNQA 3NSXA 4UUIA 3M41A 3WH5A 1ISVA 4C6DA 4JNMA 3T6CA 4Z42C 2HV5A 4NG3A 3WDRA 3F5LA 3UZXA 4AX7A 2ISDA 2P53A 2W79A 4Y9OA 3U7BA 3IS4A 1V8EA 5LIYX 1H1NA 3HQOA 4AIBA 4DZAA 2QULA 4UTTC 3M0VA 2DUZA 1FH9A 1Z32X 3T0CA 5JBFA 4H9MA 4HK5A 1K4GA 2CZDA 5FSDC 3WMSA 1AA1B 3WH7A 4JHMA 1BRLB 1TIWA 2OFJA 3ZS4A 4GA8A 4ADSA 1MSSA 3LQLA 3O6DA 2FVKA 3NL2A 2VQTA 2VELA 1KRMA 1LLWA 2WNWA 3GXTA 3DYOA 5IBXA 2WBKA 1C92A 2ZYFA 4C91A 2CBUA 4TUFA 2IMRA 4YTUA 1GKPA 3B9OA 1HJWA 2R1KA 4ZOEA 2V67A 2VJXA 4C6MA 4LQ1A 4GJJA 4LVFA 1BSIA 2SFPA 3FY1A 4LPCA 1YNYA 4PB3A 1HKWA 1B3VA 4MAVA 1U1HA 2OO0A 2FZBA 2Z1BA 2VFGA 3TQPA 1UR2A 3WLLA 3W70A 2W62A 1S2TA 3FJ4A 1WB0A 3B8VA 2F61A 3TQKA 2GQAA 3ZJ6A 2V3EA 2V6AA 4GY7A 4B90A 3QYQA 1OGGA 2CERA 3L4UA 3LMZA 3PJUA 1A5UA 3PFRA 7PTDA 4WR3A 3QMRA 2C15A 1VPYA 1RLCL 3BGAA 3ARUA 1OCQA 1UOKA 4YU1A 4UQEA 4TTGA 1QPKA 4MLRA 4Q8PA 4DM2A 1TR1A 2ZZ3A 3GIQA 3W74A 3VGHA 4KCWA 3W7MA 4LS1A 5C54A 2FVLA 4V15A 1TRIA 1OVDA 3ZJ7A 3DYPA 4DF1A 3NOYA 3UWYA 3EOUA 1E3ZA 3AS0A 4EACA 4WOZA 1HXJA 1KCZA 4OFCA 1DV7A 5D9PA 4FA3A 2W92A 2GVLA 4WK9A 1VD6A 1M68A 2VZSA 2AAMA 2Y88A 1OBAA 5D2YA 1TMLA 3F2CA 2V81A 3LOTA 1W5PA 4FLOA 2LLEA 4GABA 3A23A 4IL0A 3OJGA 3RCMA 5KZDA 3TLQA 4XG1A 1Q85A 5FJJA 2OX4A 2WLYA 4X22A 4YYCA 4HMNA 2ABBA 1FDYA 5E6YA 4D71A 4LALA 1TWWA 5LXEA 3UCDA 1Q7ZA 3NDOA 3PB0A 2R14A 3MS8A 1FQ0A 3R0DA 5CSSA 3TFCA 2QUTA 4P7RA 4ZTYA 2BP1A 1O1ZA 4Q8OA 1RQBA 1XH2A 3R25A 4CNUA 3KM8A 5HMFA 2NX9A 1EJUC 1LUCA 2AKMA 3GVGA 1MZRA 4QEEA 5C70A 2Y7GA 7TAAA 5F2GA 3PZIA 4KGJA 1X98A 1ZCOA 3P5YA 4OKDA 4Y9PA 5EBUA 4Q8QA 3C5QA 1K02A 3UA3A 1GKRA 4W4QA 2WKLA 3DI1A 3L65A 2CBJA 2ZC8A 1F74A 3VGFA 4KH2A 5FSEC 1DJHA 1C90A 3EXTA 4A3RA 5TNVA 4ACZB 3T55A 4AZIA 1TV4A 3R89A 1QW8A 1R3QA 4WHBA 4G7EB 1KXQA 4N9EA 1C29A 1LBLA 1K7FA 1VPQA 1OFEA 4XISA 2CNCA 4PCTA 1Q2SA 4S23A 3MY9A 2FFIA 1N55A 2O7SA 4NZ4A 3IJ8A 1XBYA 4INFA 1EX5A 3PANA 4W5UA 3VMPA 3BQ6A 3WQGA 4DPQA 2Z4GA 4KIEA 2YCKX 1PVNA 1EDGA 3AMDA 2AQWA 4Z2LA 1B90A 4LY8A 4RDYA 5F4SA 5FF3A 2CESA 1R9YA 1M6JA 3URAA 1LRTA 3DI0A 3C2YA 3D47A 3IANA 3B04A 3EWZA 1A5CA 3B9EA 2ZWYA 2DIKA 3KS5A 1HJVA 2RJGA 3QQ1A 3ZWTA 4N6EA 4BFAA 5LKYA 3LCFA 1B57A 1NDVA 3M0MA 3CV6A 2XIQA 3CUFA 2VUNA 1OEPA 4DXVA 3ARRA 2FPVA 5JXQA 4J35A 3TW6A 3DFHA 2Q09A 1RXOB 5CZKA 2ZZ1A 3PAOA 1Q6LA 1KFLA 2CHRA 2OZ8A 3VYLA 3SY5A 1J0ZA 5DCEA 3QEZA 4JFTA 3M43A 1DJWA 4GBUA 3APTA 4CNSA 3W1TA 2VVSA 4I6KA 3H2NA 3VKCA 1W9DM 3BSGA 2J7CA 4GZEA 1UR4A 4RE0A 3N6JA 3UPWA 2A21A 1VHCA 1PKMA 4H83A 4HA4A 4KFPA 3R7MA 1MO0A 3AU2A 4PMJA 5IBXC 3GWQA 4EF8A 3ITGA 3T0DA 1SJCA 4KCUA 5E6ZA 2CW6A 2BMBA 5I77A 2R8WA 3CYVA 2INFA 3GSMA 4U31A 4DBSA 4F2UA 2DUAA 4JFVA 2DZVA 4WXZA 1F07A 1TTJA 4P8WA 5J04A 3RHGA 2D69A 3BOFA 3UPMA 1SFSA 4H8UA 1G5AA 2MNRA 5C7VA 2VWSA 1S2VA 4FX6M 1NTHA 4HU0A 3H7UA 3FHAA 3EOLA 1J0KA 3GH4A 4ALDA 4C1KA 3G1YA 2NUWA 4HHMA 1DTNA 4PN2A 2ANUA 4U3AA 1SMDA 4A8RA 2CXEA 7A3HA 5A94A 3NZQA 1QK0A 5E0CA 2FB3A 2Y24A 1JDDA 4U3CA 3MP4A 1WZMA 4Z2KA 4OHQA 3UBPC 1FDZA 1PPIA 4H8NA 1SSGA 3ZFHA 4OQVA 4GQRA 4DJFD 5D2XA 4L65A 1L2UA 3MSGA 2CFFA 4QSHA 3CV1A 3W25A 5HOSA 1D8WA 1XIMA 4GVGA 4XAYA 4A22A 4TV5A 2J6VA 3UESA 1IXNA 3SIMA 1ISYA 3GIPA 5IHRA 2C0HA 4L64A 2OGJA 1EL3A 4I7UA 1RPXA 4IFKB 4FOKA 4FNPA 1JUEA 4MNLA 3ECQA 4CD4A 2X2GA 3M5XA 2NV9A 1KFKA 3FK4A 1KM0A 1IR1A 1YXYA 4KEMA 2PPGA 3UXKA 4K8GA 2BZNA 1XG3A 2YBVA 4GISA 3BAKA 5JBEA 2Z29A 4IX0A 5G2IA 4F0LA 4O52A 2EBNA 1H0GA 5K4ZA 4TVCA 3WO8A 4GMEA 4TQTA 1G4PA 4PBFA 4RDZA 3OEXA 1J0JA 5BROA 1AH4A 1TMHA 4A21A 1R47A 3C61A 2VR2A 4JTTA 4QLKA 4OTKA 3PG8A 3IRSA 5D38A 2OQYA 3GG8A 2GFTA 3UCQA 3EEGA 3VFLA 1HJUA 3EBVA 4KEVA 3B06A 5EKYA 3DBPA 3G0SA 1B4KA 2Z1KA 1XCFA 3VI2A 4AW7A 1BVWA 1FOBA 3S9YA 3WLOA 1G9HA 1ZAIA 1FCQA 1XYZA 2GJNA 1VFOA 1HP4A 1OZQA 3Q45A 4IQLA 4J3XA 5CPOA 2ACRA 3DUGA 5A6BD 2NT1A 3C3UA 4H2CA 1M7OA 4WDXA 4C6NA 1LQAA 4HU8A 2PWDA 1KD0A 3TDFA 3G6MA 5C7HA 3VNDA 1C93A 5DBTA 1XXXA 3WH9A 2QCHA 4O1FA 2CZ5A 1CLXA 1PS9A 5I2UA 5DT5A 2Y5EA 1EEXA 4ZTXA 2AL1A 4ZQNA 2X0YA 1R5YA 4S3GA 1K6WA 1TYGA 5EFFA 4XD4A 1LOSA 1XBVA 4LRTA 3NL6A 3K30A 3D0CA 2C18A 3CEPA 1K6AA 3TONA 1W1YA 2JK2A 4QSFA 1T96A 1EQCA 3E74A 3DC0A 4JTUA 1XG4A 1NDYA 5A6KA 3FGCA 1FWEC 1NFPA 2PGRA 1FWHC 4GBDA 3SR7A 2V3FA 4MWAE 1ZNNA 3L9CA 3DFQA 2V2HA 3WMBA 2DT1A 4WRHA 3FHQA 1RP8A 1GEHA 1XLCA 2GGEA 1I0DA 1N7KA 2IXVA 3U2EA 3LUTA 2YGYA 1ICQA 3CWNA 3WFZA 1F4AA 2YSWA 3TSBA 3ZWSA 1L2QA 5DXXA 4GUJA 3T0TA 1X6UA 1MFUA 3LD5A 4ML9A 3JS3A 1UZ1A 4IMDA 4LAZA 4FR1A 4DZHA 2XH7A 3VIIA 2CU0A 3RK8A 3TVAA 4Z2IA 4AVFA 2IQTA 1PTDA 2P8BA 3UR7A 4ZENA 4Q4QA 3BE7A 4AYSA 2QAFA 2YL5A 3PK7A 4E6MA 3K8MA 4FF7A 1E0WA 1O60A 2X0HA 2YW4A 1V0LA 5A8PA 1ICPA 1QHZA 4FLRA 1J10A 1PDZA 4EAYA 1KCXA 1BSLA 3CWHA 2NX3A 2DSUA 2ACUA 4NIRA 2J13A 4IT1A 4CQBA 4M6QA 2PDQA 3DH7A 2O9TA 2OOFA 2XGZA 4MYAA 2AQVA 2VURA 2IPWA 1Q13A 1T7LA 3WF4A 2YA1A 5EMLA 2A6LA 2HJPA 4S38A 1ZSXA 2VGBA 4RE3A 3WBEA 2RJHA 1XIFA 1W3TA 1KFCA 4PB5A 1O7AA 2ZWZA 3IAQA 3NPUA 1XYBA 1E51A 2CWXA 2EG8A 3OP2A 2J88A 2Y70A 5L6UA 6CGTA 3TR9A 2Y89A 3CAWA 3S1WA 1EJRC 3CGTA 3A9BA 5CJ5A 1K8XA 5IRPA 1SO3A 2EKCA 2TPSA 4J3UA 3M5VA 3DFPA 5I6SA 1XLDA 3CHEA 3FDKA 3WLPA 2W9MA 3U57A 1TJ1A 3HQPA 1JF6A 2PUZA 3TYAA 4H04A 3G0UA 1PZ0A 1MW0A 2ZZ2A 2V63A 1W8SA 4GNVA 1PAMA 3FA4A 5I3JA 1NEYA 4IIHA 2H90A 3HB9A 1JZ2A 1YHTA 2PDUA 3QLLA 1ZJHA 1GZGA 1B3YA 3N1AA 3N17A 3O2LA 3UGRA 2WBGA 3NO3A 4X3ZA 4MY8A 1FVPA 5T8GA 2IPFA 3W1QA 2C79A 4DBUA 2HZGA 1LQ2A 4HNCA 2TAAA 5AHMA 2DT2A 1J12A 2WMGA 5KZ6A 4UZUA 3SCRA 5AB3A 3BLOA 3WJZA 3WEZA 3THAA 4DO6A 4F48A 4Q4SA 4P7OA 3IK2A 3MWAA 1Z48A 1XCWA 3OVRA 4JHZA 4R9XA 3RITA 1KGUA 5KINA 1Z41A 4Q8NA 4IIDA 3AHYA 3NFUA 2PD5A 5ABGA 2EGZA 5FEWA 3CQKA 3TC7A 1ADDA 1BHGA 3MI2A 1H41A 4IJCA 4JDYA 5DQPA 4M7SA 2FH8A 3IIXA 3CHDA 4HU3A 1QI3A 3RU8X 2ZE3A 5ABHA 3CZJA 3N2CA 3UWQA 3TZFA 3UYIA 1E9YB 2XU2A 3N9KA 4PUDA 3LDVA 3SCPA 3L66A 3MSRA 2BTMA 4QG6A 4XAGA 4QFUA 4ZBCA 1J9YA 2B31A 1W56A 5FF4A 4AWTA 3P61A 3CS2A 3VOFA 1Q7MA 2FZ9A 1F73A 4NUWA 2PURA 4K1WA 4O18A 1C8QA 2PDCA 3S5YA 5BWFA 1SJDA 4KWSA 4MLJA 3VIFA 3ABQA 3W38A 1ESWA 3NIYA 4MSSA 4PMYA 2HCVA 3CYJA 3NQ7A 3CUXA 2PGEA 3N73A 4WGHA 4UTUA 1XYMA 7XIMA 1EBGA 2R6OA 2ASHA 1ONEA 3KRSA 4IJBA 2I9EA 1PCWA 1RBLA 2C7FA 3WZ0E 3L2MA 5A8NA 4ZSTA 1NOWA 4EP8C 3FYYA 2HXTA 1V5XA 3IGSA 1VBHA 4HA0A 5AYXA 3AAMA 1KTBA 2D2HA 5HINA 3OZYA 5DLCA 4H9TA 1SZFA 4XQ6A 3G1DA 3HPFA 1VJSA 4AUBA 2WMJA 4KRZA 4RCXA 4GKTA 2J24A 2V0TA 5AVNA 3ABOA 1OX4B 4XIAA 1JDFA 1SFTA 3STEA 1JCJA 3EPNA 2WJFA 3WH8A 2WNZA 2CHNA 2JGYA 1QNSA 4IH3A 3FAXA 6ALDA 1F7BA 1UKPA 3GKFA 4UMCA 2OLAA 2CPUA 1RK5A 1E6SM 2PWFA 3V1HA 5G4HC 4FNQA 5C2XA 2D2GA 2BY2A 3IJIA 4A3YA 4Z08A 5KEZA 3MWCA 2ZRZA 4GFIA 2WOQA 1PV8A 2E8ZA 2GGHA 3GD6A 1UUMA 3WH6A 3HPAA 3H26A 4PMRA 3WNNA 1FWRA 2Y1HA 3FKRA 4PBGA 4O0ZA 4AZ7A 1MNSA 5BXRA 3L5AA 1WKFA 1QPOA 2O55A 1JYNA 3K4DA 1SO6A 1IEIA 3MCOA 1GOOA 2ICSA 3AALA 4Z1YA 1S5NA 2R91A 2JF6A 4UWMA 3AZRA 3W1UA 1UJPA 3AS3A 3BWWA 4PULA 3O7UA 3BGJA 1ZU8A 4O15A 3MHFA 3HG3A 3KWXA 3GVQA 1GGOA 3W7GA 1GEQA 1O94A 3L67A 1ZJBA 4XKMA 5FL0A 2Z00A 1TREA 3G1HA 3HJEA 5FL1A 3POHA 2VOMA 2Z1WA 1EIBA 4AIEA 4AZHA 3VGGA 1AQMA 1DIEA 4QP0A 1PXGA 4AIOA 1UWQA 1XH1A 3LM7A 1DHKA 1WAUA 2WKJA 4X9SA 3U5UA 4UFHA 4UQCA 2GQ3A 1P0BA 3SADA 3V4BA 4FEZA 2X40A 5D05A 1DWIM 5CSRA 3P2VA 4P8XA 3H24A 4FXJA 1EDTA 5BU9A 4LOCA 4NZ5A 3M46A 3MANA 1F6KA 3T07A 4Q4OA 1JYWA 3CB8A 3IUIA 3CHFA 3GZAA 1FWGC 4PC8A 5KETA 2PDGA 1T5AA 1B0IA 3VCRA 3BPWA 1VRDA 5C2GA 3CHVA 1ZAJA 4GHRA 3W26A 2BGNE 1ONXA 3ARYA 4E38A 4YTQA 3GDKA 3Q4DA 5A8QA 3LK6A 3WIJA 1VF8A 1BF2A 3H7RA 4ML4A 1KWGA 4M7TA 1B3WA 2O7QA 7REQB 3GAYA 5DEZA 4AF0A 3U2OA 1VGAA 3B8WA 5GNYA 3UA4A 4Q7NA 1WO2A 4RW5A 3OHIA 1SVDA 3RNDA 1CW2A 4HPGA 3AS2A 2J7EA 3UWVA 3TE9A 1DE6A 3LTSA 5FACA 4UZSA 3AU6A 1S5WA 2A5HA 1KFEA 2WSQA 4QR6A 2RAGA 1XLBA 4CU7A 2PEVA 2PLMA 1J93A 1EA9C 4GFSA 4L4MA 2AL2A 4MJZA 1PUDA 3B8TA 2YKKA 4LEQA 4X0NA 4D72A 1NAL1 2FJUB 2V8ZA 2YBUA 5EMYA 4DBDA 4IXHA 2PDJA 1KM6A 2GUYA 3DXIA 4Q8VA 2XGIA 2KX9A 4M8UA 4TU1A 2ZUWA 3LI1A 4W7WA 2C71A 3S6TA 1RJPA 1OABA 2DZXA 4PFHA 1BTCA 3W71A 1JGIA 5DMLA 2HISA 4JIIX 3SUVA 5BXPA 1PB0A 4I5UA 3PB2A 1ZQ5A 3C2RA 4DUOA 3CLMA 4CCEA 2VYOA 4JTHA 1PEZA 2E77A 1OSEA 2Y4SA 4AWUA 3W7NA 1EJ7L 4IISA 4QQ3A 2GGGA 3DEQA 2X7VA 3HG5A 1YEYA 3OIXA 4P61A 3S9ZA 4O4VA 8XIAA 4M1RA 2WAGA 6REQA 3P8IA 2E6FA 4ORMA 1P7TB 1PWMA 3WJWA 3F4CA 1UH3A 3FXYA 2ON3A 4YIWA 3QXBA 1NP0A 3GY1A 4PMNA 3BLLA 2WPBA 1H50A 1W3LA 4L9YA 3KS6A 3M0KA 5GPRA 5L9FA 1BXBA 2NVCA 2VZVA 4GVFA 4KGLA 4XV0A 1Y5WA 1MWOA 1BKHA 4OU1A 2GK1B 1UP2A 4AX6A 3BZJA 1EP1A 4LYRA 3BLFA 4QJ1A 3P93A 2X1SA 1W17A 1LWHA 1REQB 4ONVA 3L23A 2Q8XA 2TRSA 4BA0A 3STPA 5C9XA 5I00A 3GG0A 3RMJA 3VUSA 2QCDA 5GNZA 2ZRYA 1GCYA 3AXKA 3FVMA 4EE9A 3GXPA 2W4XA 1FTXA 3N3TA 4LUTB 4KQNA 3HMCA 2ISSA 5GVJA 4G6CA 4QQUA 4S2CA 3GC4A 1OT1A 3W72A 1W5OA 4AHOA 5CGTA 1PX4A 1IWAA 4XVDA 4CNOA 4OUEA 1W32A 1VFMA 2FYMA 2V5JA 4UTWA 5FJPA 2JKPA 1EX1A 5I23A 1SO5A 3CM4A 3O6AA 4Q4MA 1EJVC 1OFQA 3BG5A 2PZNA 3ZT6A 1XV8A 3H55A 1KCKA 3TTYA 1PIFA 3PTKA 2CC0A 2FZMA 2QS8A 4WSJA 1MFVA 2YYUA 1EC9A 2GDVA 3CJPA 1UH4A 4H6RA 3S2NA 4M3PA 2NWRA 5BYWA 2J27A 1NP2A 1AL8A 2J79A 3WN6A 2GQ8A 3A22A 1D2KA 3NQBA 4DI9A 3NSNA 3PULA 3AIBA 2YB1A 3A47A 5HATA 4CD5A 4HQVA 4UCGA 1Q6OA 1QBBA 2QDHA 2XISA 1TVPA 2QUMA 3UW6A 4ZSUA 4CUCA 4KBXA 4FZIA 3EOSA 3IUDA 4OBSA 3GDMA 4L4PA 2GOKA 5E0FA 5HMSA 5EYWA 1WUFA 3BDKA 4DLFA 3MUY1 1J4EA 1IGWA 2GJXA 3TW7A 2O9OA 4IGNA 3K13A 1WE5A 4QJ3B 4UIOA 3WJYA 1LT7A 5ABFA 4AQLA 1ADOA 3SQLA 2ISFA 2EAWA 5REQA 2HPMA 1EXBA 2GYIA 3PPCA 5I79A 2XFWA 5CPLA 3VOCA 2EPNA 4F0HA 1MNZA 1AD1A 2VRKA 1JULA 4H7ZA 1JVNA 2ACSA 3EA2A 4RLIA 5A2AA 1EYEA 1P43A 1V03A 3ITLA 3ABXA 3QMSA 4FP1A 4LRSA 5IFTA 3E5BA 3ABSA 4V28A 3LBMA 4IP4A 3QW3A 4LF2A 3BV4A 1JD7A 3HO8A 4ZL1A 3PWAA 4DY1A 4GZ7A 1GHRA 5E93A 4Y2WA 3NAVA 1VLWA 1MMFA 3MCNA 3GTIA 4JTQA 1TVLA 1R3RA 5FEZA 1EZWA 2YIHA 3S6DA 4B5SA 1TE6A 3A13A 3EX3A 5AHFA 2D2JA 3B4YA 3C0QA 2FFCA 1DYSA 2Y0FA 1OIMA 3KP0A 4WVXA 3H2EA 3EWUA 5AKQA 5AC8A 4IL2A 3T05A 3LLXA 3GYCA 3U2ZA 2ALRA 1NVMA 1I6NA 2BGSA 2BG5A 3OA3A 2F2HA 3OZPA 3PZ9A 1IXPA 1AQHA 1OFOA 3TQ0A 4GO8A 3W6YA 1Q3NA 1S46A 4TIMA 1XLFA 3ERPA 4WUIA 4IIGA 1CECA 1ZB5A 4UTJA 3NQ8A 1V0KA 3GAKA 1YXCA 4E4PA 4G2DA 2GVGA 3NL5A 4WX2A 4ZA0A 3W02A 1FXPA 3JRKA 3D46A 1HW6A 3VKAA 1S38A 4YNGA 3OBKA 1JPIA 2AQOA 4NU7A 4M81A 2JBMA 2FDSA 1V3MA 4UCFA 3FSTA 4MTVA 4QAWA 5C8BB 1HX0A 2FZ8A 1BFNA 1ZY9A 2VGGA 1W2VA 4NX0A 4DF0A 3HGSA 2VT0A 4GUFA 2ZRUA 3WCZA 1FUYA 4DLMA 2QJJA 4O57A 1Q7QA 5CZJA 2PTDA 5CJMA 2J66A 4J4KA 5EA9A 2EKGA 4GE8A 1XS2A 1X8CA 1Q6FA 1TPB1 5LGZA 3KOYA 1OINA 4HMDA 2QDGA 2Z2BA 3ISIX 4HTBA 4GH3A 1WDQA 1TX2A 3RDKA 2XWEA 4MHBA 2Z1SA 3WLMA 2C14A 4FNTA 3LZ5A 1KXHA 4HHHA 1E4NA 3UEQA 1DEDA 2AGTA 5IHSA 2DJXA 2XVPA 3JR2A 2Z25A 4N7QA 3YPIA 1UR3M 2FTWA 4JX4A 2J4GA 1BQCA 2GGIA 1G4SA 1J11A 3E6EA 3KBNA 2GVYA 3CH0A 4P7QA 3HPZA 3W2UA 1WDSA 4TV6A 1XW8A 1LRQA 2ZC1A 2CKSA 1XSJA 1H7OA 3VGBA 3C8FA 2WCSA 3CB3A 4ZZ9A 4UTLA 4DYKA 3LCGA 1ZPTA 3CIXA 1LZOA 1LCOA 4UTWC 4BF9A 4OE7A 1H5VA 3GC2A 2Q71A 1VJIA 1NY1A 4XAFA 4G7FA 4WD0A 2YCLA 2H3BA 3KBSA 1DJIA 1ZBKA 2HBVA 3DOPA 5HR7A 1KQYA 2OWCA 4GC4A 2I7GA 3C0SA 4F2TA 3ZO9A 1GQIA 1R9ZA 3P82A 4HKPA 2YZ5A 3RM8A 2NSXA 1OT2A 5CG7A 5A6TC 4HMEA 3TXVA 4H7VA 1DWFM 3M64A 5D4YA 3GRIA 2AKZA 4GGBA 3TN4A 2GWNA 4XZIA 2OTDA 3BLPX 4N4QA 3W2KA 1YIXA 3LHUA 1N2VA 4NRRA 2O9RA 3AQUA 6ENLA 2C8NA 2PDLA 4G7EA 3DKLA 3EMZA 4M82A 1QCWA 4I5XA 3QN3A 1JPHA 1F4HA 1S2AA 4ZE4A 3ATZA 3WUEA 5G1YA 1XDLA 2X8RA 5EFDA 4YHGA 4NYYA 4U33A 1VZWA 3TCSA 1E6QM 2FH6A 1W9BM 4PCSA 4FF5A 5LGXA 2ZBTA 1TV7A 3N19B 5FEXA 3QJAA 4LC8A 4JX5A 3AIVA 4WXYA 1Q6RA 3R1ZA 3AYVA 1WCGA 4MDPA 4DX3A 3OG3A 4JTAA 4JY8A 3W7CA 4QIUA 4RNHA 1MW1A 5F2MA 4DN1A 2G3IA 3M4HA 3L5MA 3GH7A 3L4ZA 3GDTA 4GIYA 3PZUA 3AIWA 3ARZA 3K46A 2YA0A 4JIRA 4YMZA 3VNYA 1M03A 3F03K 1F3WA 4JX6A 4HPXA 1OD0A 3EWWA 4RX0A 1O4UA 1KLYA 5D04C 3MA8A 5HNUA 3BZGA 1U5JA 1K77A 4UR7A 1E6ZA 1LDCA 4Q8MA 1HVQA 4XD3A 1A53A 2QCLA 3GVVA 4Q33A 4OUIA 4AEOA 1X8FA 1F6PA 1UC5A 2E9MA 3ITTA 1TX0A 3WNOA 3RAOA 1OC6A 1T8XA 3CZGA 3CLWA 1K9EA 1EOKA 1SW0A 2IQDA 3PNUA 2DSVA 2VWTA 2QVHA 4MWAA 1S1PA 2HBXA 2QGHA 4PCFA 5LNSA 1FWFC 1KW1A 2W63A 1GOQA 4AXKA 2YDRA 4LX4A 2VM8A 2V5LA 3TSMA 3V0UA 2OSYA 3AOFA 3DG7A 6XIMA 2CITA 2NQJA 1E72M 2HS8A 3CAVA 5CC7A 4UNIA 3EOOA 3W7PA 5J5DA 1KFJA 1QDSA 1UG6A 3I68A 3THCA 3KVJA 3MP5A 2PZ0A 1DQWA 2DU2A 4QDMA 1Q66A 4R85A 2HWGA 2Y63A 5AZ0A 3TJIA 3M0HA 2WSRA 1US0A 4EPBC 1CEOA 3ONCA 4IG2B 3NQDA 1JZ5A 3TYZA 2QCFA 3EMQA 3EYPA 3M0YA 3VU2A 1AZ2A 3TTEA 1CGYA 3DDMA 5I0DA 3REQA 2KAUC 5F4WA 2D20A 3PSWA 4QLJA 3QC3A 4YVXA 4DJDD 2FVMA 4HOXA 2PDXA 1CGUA 1YTDA 3AWOA 3NO1A 1E71M 1AMKA 3NQFA 1MUMA 2KZHA 3EPMA 2W0UA 1X1OA 1GKQA 4BWLA 1VEOA 2YFNA 2EQDA 4O13A 5FF7A 3OQEA 4NXKA 3DESA 3B8UA 3UJ2A 3CL8A 4BEUA 3PBUA 3E9AA 3QGKC 2PLCA 5HK4A 1O5RA 3SGZA 4FSAA 5C9RA 1I60A 2YCEA 2PDHA 3N2TA 3SUSA 1WAWA 1R85A 3QM3A 3PBVA 1E55A 2INEA 4IWWA 3FLUA 1I0BA 1XDMA 2VP8A 1PZ1A 3CPGA 2XSXA 4HNUA 3QTGA 3XISA 1V4YA 3I3EA 3NURA 3ABRA 2EPHA 1DQXA 5HWJA 1P0NA 3P6LA 1FWCC 5AYBA 2XM2A 3SO7A 9XIAA 1FA2A 3P7YA 5AVHA 3IAPA 1S5TA 2YPIA 4JIEA 1IEWA 2WM0A 4JNYA 3KBVA 5XIAA 2F6UA 4I6VA 4KESA 2Y6ZA 3QHNA 3E5PA 4O11A 3W83A 4JCMA 3CIVA 3DENA 3FW6A 3WKZA 3SN4A 3VC6A 4GYFA 4PTDA 5FCZA 4PODA 1UWRA 3DGBA 4DI8A 1VBRA 4ERGA 1J6PA 1F05A 3GXNA 3HIJA 3RUBL 2WM1A 3VIPA 3JW7A 3G5EA 2GDUA 3PZMA 5EPDA 2DSKA 2YBTA 1WOBA 1XSIA 3EWYA 4B5UA 1T40A 4NASA 3MDWA 2DQWA 2WPGA 4A8IA 3VX1A 4CQ9A 3VNIA 1PL9A 3H4WA 5EGRA 1T8QA 4UTIA 1SZEA 1K4HA 1H51A 4QG8A 1TV2A 3ZSTA 4AAJA 1VCVA 4XKYA 4C90A 3ZLFA 4ZODA 1EFZA 2GUUA 4D6FA 4LNCA 1EUAA 2PP3A 3MO4A 4LBRA 1RLDA 3F7JA 4GY1A 3RILA 3N4FA 3GXMA 3QMTA 1A80A 1RQEA 1OCJA 3TTQA 4L5ZA 4MB3A 1FHUA 1X1NA 1W1B1 4DUVA 1Q5MA 2YL9A 1A3XA 3W1XA 5K9DA 1NU5A 5AC5A 5JMUA 2VKZG 3JZUA 3STGA 2PDPA 4HNTA 1GVIA 4KWUA 2WSPA 4D6DA 3UVAA 3UZZA 1RA5A 4CN6A 5IDZA 4E2DA 1CI1A 1LWIA 4OT7A 5FA5A 3PFMA 3M0LA 3TJXA 1T41A 2R1PA 1F9CA 2DEPA 5G5IA 1UKTA 1C8VA 1OYCA 5FJOA 1W1VA 3LN3A 3KCLA 2ZVIA 3TFXA 2DW7A 4GNKB 4MWAC 1P0KA 5BOEA 1TRDA 3F4NA 3GNNA 5BCAA 3CPRA 1QI0A 4B4HA 4JGDA 3VE7A 5IFPA 2NLIA 3N2MA 1BXCA 4K38A 3GXDA 4K8HA 1FH7A 4Y6GA 2R94A 4IIBA 1XLLA 1UWUA 5HQMA 1UR8A 1QOQA 2UY3A 2ZUVA 3WNPA 4WCJA 1TUFA 4KW2A 4JTGA 3B40A 4DO4A 3GFZA 1UA7A 4HK6A 2DH2A 3ZVHB 1JI2A 4B15A 3RGTA 2WB5A 1G69A 1XC6A 3MSYA 1M7PA 1XLJA 3BL3A 5D9NA 3UJEA 1HKIA 4H41A 5CSUA 3TW9A 3QFEA 4FALA 1R2RA 3VINA 1YW1A 2X0SA 4NT0A 4I9MA 4OBTA 2G0WA 1TSIA 3PWIA 3MQTA 1JG9A 2W3ZA 4JD4A 3WF1A 4BWLC 4S1FA 1M53A 1ZUAX 1B9ZA 1DIDA 2FQIA 4LAUA 4Z1CA 3BUVA 1LLOA 5A6SA 5BOOA 3HQNA 4HTYA 3LRKA 3NPVA 3K4AA 2PTYA 2D0HA 1SO4A 1JZ8A 4GYPC 3LTPA 1WUEA 2Z1VA 3KL0A 3WBYA 4Q4PA 3BOXA 1W3HA 3OYZA 3WQOA 7TIMA 1SQ7A 2WV8A 5F1VA 3I6RA 3A4XA 1HN1A 3C52A 4YTRA 2HK1A 5C6MA 1VYRA 2E6AA 2P88A 4NAFB 3CO8A 4NZ1A 4YHEA 4CQCA 4FPSA 4OGZA 4HU4A 1MUWA 3LG3A 3OOQA 1QHPA 1I75A 1YTKA 1B31A 4C6KA 4GK8A 2YW3A 3MKVA 4HCLA 4GG9A 3ABZA 2DW6A 2TODA 1F2JA 3H22A 3S6OA 3W2NA 4LAKA 2X30A 1OFDA 4BK9A 4DZIA 1E5JA 3UR8A 3F2BA 3CK5A 3ZZ1A 4RNJA 4RZ6A 4H2HA 4JS3A 1XRSA 3T9PA 2VTFA 3ES8A 1NFBA 1VCFA 1B3ZA 3CV2A 1OGBA 1RH9A 3IJ7A 2WKGA 2A3EA 3E0WA 2WC3A 3ZLHA 3P81A 3UY8A 1GZ1A 2ZQ0A 1PHWA 5DRIA 7ODCA 2B7OA 3A3XA 4Y8FA 5A6JA 4NNBA 1ZAHA 2YJQA 5D32A 1ONRA 2H8XA 1JIBA 4JR5A 1TWZA 3GHRA 3PBMA 1MXSA 2BDQA 1CGXA 3A21A 1V3HA 3VNZA 4BI7A 1JI1A 3IJ6A 5HUOA 2PLJA 2QJHA 4JKLA 4XZWA 1NFGA 4O14A 1E4LA 1VYSX 3GC5A 3RO6A 1NSJA 3CXOA 2XFRA 3M5YA 1E0VA 3CZ8A 4LFYA 2DT3A 4A8LA 1G4TA 3LRMA 1J8VA 4BF5A 1BYDA 1H7WA 2DVTA 4GXWA 1R7AA 5DY2A 2WMIB 5H8PA 4QBXA 3SJ3A 4RV8A 2I1OA 5CZTA 1QMLA 3W75A 2P1FA 3AXXA 3UNTA 3SGGA 1Y8BA 3H54A 3E2QA 3GHTA 1V6YA 2DGAA 2JIWA 4LYPA 2JE8A 1C9DA 1GOXA 2OJPA 1RY0A 2GJRA 1EJSC 4O1AA 1TPC1 1WPCA 3V16A 4IPLA 4C7GA 5BMXA 4ZMGA 3KCOA 1DWGM 3T4CA 1HVXA 4LAMA 1FP9A 3LMYA 1TV3A 2OGYA 3A4JA 4W88A 3AHZA 2OT1A 3DU0A 1M7XA 3TWBA 1JPMA 3F5KA 3ZYZA 1GQJA 1POJA 1ML1A 4O54A 2ZX6A 1AQ0A 4EXBA 4EX4A 4B5NA 2YCJA 2E4TA 1PCKA 2QPSA 2XVLA 1Y5XA 1WZAA 4N0RA 3CMFA 2OWWA 2H9AA 3DC8A 1R46A 3G18A 4R3UA 5HANA 2O4QA 4EXQA 4MPQA 4Y96A 3H2FA 4JPGA 3S9IA 1R86A 3T2OA 6TAAA 1XUUA 2WHJA 1OFBA 1PE1A 1H61A 4QNEA 3POCA 3MI3A 3W1LA 4E2BA 1X7IA 1SM9A 3TV8A 4EIVA 3M0JA 3G6LA 4PUUA 1G01A 1ITQA 2XN2A 3DBNA 4V2XA 1LL6A 1GJUA 4IQJA 5AOUA 4ZQMA 2QUNA 3NCOA 3UWEA 4L1GA 3A24A 1I2NA 2XFFA 3VM5A 4LEFA 1J0YA 3GBEA 1BAGA 1E70M 3INPA 4PZVA 4UTKA 1EGMA 5I09A 4LUSA 4DAFA 1EIXA 4P7NA 2ATSA 4GI6A 3NYZA 3ZSSA 3M1ZA 5E5CA 4CGTA 5IDIA 1HJXA 1GVRA 2VUYA 1JF5A 1JDAA 3ME3A 4US5A 1US3A 2AMGA 1X6LA 3GUGA 2QNEA