4C6FA

Crystal structure of the dihydroorotase domain of human cad bound to substrate at ph 6.5
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
364
structure length
363
Chain Sequence
KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DIHYDROOROTASE
publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
total genus 119
structure length 363
sequence length 364
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6fA00
4QROA 2QT3A 1M7JA 1P6BA 2EG6A 2Z2BA 1EJXC 1EJTC 2WM1A 3KM8A 1O5RA 4C6CA 3RHGA 1RK5A 2Z7GA 3GG7A 3DCPA 4LCRA 2D2JA 4INFA 1KRAC 3PNZA 3IACA 3QY8A 1RAKA 3B40A 4PCNA 5E5CA 1R9XA 2Z28A 4XD6A 4C6MA 3RN6A 4PCPA 2Z24A 3UR5A 1FWEC 3DUGA 4IFKB 2PUZA 2P53A 4LCSA 3MSRA 1NDYA 1EF2A 2Q01A 1RA0A 4CQBA 1A5OC 1V77A 1YNYA 3F2CA 3EWCA 3WYZA 1A5NC 3LU2A 3PANA 1I0DA 4IFKA 4H9VA 1J6PA 4IGMA 2WJDA 4DLMA 4H9UA 2HPIA 3OODA 3GU2A 1GKQA 1UIOA 1UMLA 3FEQA 4L9XA 2O4MA 2VUNA 3URQA 4JOMA 1A4MA 2R1MA 3OQEA 1E9ZB 1VFLA 1A5KC 1GKRA 1S3TC 3GUWA 4IH3A 3LGDA 4AQLA 3LSCA 3MVTA 1EJRC 3A3WA 1KCXA 1V7AA 1NDVA 4B3ZA 4GY0A 1EZ2A 2DVUA 4G2DA 3TN6A 4B90A 1ITQA 4ICMA 4KEUA 3IV8A 1EJUC 4BKNA 2D2GA 2FTWA 4BY3A 3FDGA 3HTWA 4GBDA 3GIQA 4H9ZA 4LAMA 3EGJA 4RE0A 4E3TA 3E3HA 3MDWA 2HBVA 3E38A 2G3FA 1RK6A 2HQAA 1YRRA 2EG8A 4H9TA 2I5GA 4GK8A 1FWAC 3URBA 4DLFA 4CEXC 2Z29A 3GTHA 4G7EB 1O12A 2AQOA 4GY7A 4R85A 4WGXA 3ISIX 1FWGC 3QY7A 4IG2A 3O0FA 1QXLA 3NURA 4LCQA 1UIPA 4DI9A 3QY6A 3IPWA 4AC7C 3OOQA 1XRFA 4R7WA 3HM7A 4G7EA 4IGNA 2QS8A 3FDKA 1R9ZA 4GY1A 1XWYA 3JZEA 4J5NA 4TQTA 2FFIA 1KRMA 3TN4A 4KEVA 2IMRA 2FVKA 3ITCA 2E1WA 3LSBA 3QGKC 4V1XA 4OFCA 2PAJA 4XAZA 3IARA 3T1GA 1IE7C 4LAKA 1FWIC 3GU9A 4ZSTA 4CQCA 3IGHX 4XAGA 1YBQB 4CEUC 4CQDA 2PLMA 1FWDC 3QGAC 4LALA 4CNSA 2YB1A 4QSFA 1J5SA 4PBFA 1E9YB 3ICJA 1EJVC 1YBQA 1FKXA 4IF2A 2GWNA 4KQNA 1PTAA 4M51A 3SFWA 2KAUC 2R1PA 2Z2AA 4ERGA 4GX9A 3LNPA 3TN3A 3ORWA 3MKVA 3LS9A 4HK7A 4HA0A 2DVXA 4QRNA 5CH9A 1FWHC 1DPMA 1V79A 1WXYA 1ADDA 1W1IE 2E25A 4IQJA 2HNHA 2Y1HA 5HMEA 5LXXA 3F4CA 4WHBA 4LH8A 3OVGA 2OODA 1FWFC 4C60A 2BGNE 4H9XA 4QS5A 2D2HA 4R88A 3E2VA 2GWGA 3O7UA 4KETA 3E0FA 3AU6A 3CS2A 3B0XA 2QPXA 4GC3A 4KEZA 2F6KA 2CZVA 4EP8C 2VM8A 2UZ9A 4NG3A 1V4YA 4QS6A 3N2CA 3OU8A 4EPBC 4CNUA 4EPDC 4YIWA 2R1NA 3ID7A 1POKA 3MPGA 1BF6A 4C6DA 4RDZA 4DZHA 1HZYA 1NDWA 4H9YA 1P1MA 2YXOA 3UPMA 4KF1A 3S2LA 1I0BA 4GX8A 3PBMA 3RCMA 1EJSC 1PB0A 2PGFA 4H00A 1UBPC 4LAOA 3MVIA 4B91A 1RA5A 4HK6A 4L6DA 3S4TA 4GZ7A 4RZBA 2Q09A 2OOFA 2WJFA 3TN5A 4HJWA 4ERAA 2ICSA 1M65A 3EWDA 1YMYA 3WMLA 1RJPA 3CAKA 1ZZMA 4PBEA 2PGRA 4CNTA 2Z4GA 2FVMA 2OB3A 1K6WA 2P50A 1K70A 3S2JA 5AKQA 2YB4A 2HBXA 2QVNA 4XAYA 1JGMA 2DVTA 4EPKA 4Z42C 2VR2A 1M68A 3K4WA 4DNMA 4J2MA 2VC5A 2I9UA 3PNUA 3F4DA 3PAOA 4XD5A 1XGEA 4XD4A 3TNBA 2HPMA 3UF9A 4C6QA 4C6OA 4IFRA 1J6OA 3V7PA 1GKPA 2VHLA 4PE8A 4I6VA 3NQBA 4LEFA 3MDUA 4H01A 4D8LA 2O4QA 2ADAA 3T81A 4DI8A 2AQVA 3C86A 3K5XA 4DIAA 4LANA 4LFYA 4DYKA 4EPEC 4C6BA 3MTWA 1EJWC 1FKWA 3BE7A 3E0LA 4H9MA 5A6TC 4F0LA 3LA4A 3GTXA 1P6CA 4C6FA 1FWCC 4F0SA 4XAFA 1PSCA 4XD3A 4C6LA 3R0DA 3UBPC 3URAA 3IJ6A 5HMFA 3F2BA 4C65A 2OGJA 5G4HC 1K1DA 1FWJC 5HMDA 1A5MC 2A3LA 3GTFA 3S2MA 3DC8A 1EYWA 1QW7A 2FTYA 2ZC1A 4MUPA 2XIOA 3OJGA 4GXWA 3T8LA 4QTGA 1YIXA 1ONWA 1KRBC 4C6PA 4UBPC 4C6EA 4RDVA 3A3XA 4V1YA 2UBPC 3NEHA 4DO7A 1XRTA 4KESA 4NP7A 1J79A 4C6NA 1R9YA 2GOKA 5FSEC 4RDWA 4RDYA 2R1LA 3LGGA 3GTIA 4GOAA 4KERA 4C5ZA 2EG7A 4C6JA 3LY0A 4C5YA 1KRCC 2BB0A 1ONXA 1ITUA 3AU2A 3URNA 1NDZA 4C6KA 3RYSA 3K2GA 5FSDC 4UB9A 3A4JA 2GSEA 3E74A 4DZIA 4B92A 3F2DA 4IG2B 3G77A 4F0RA 2Z27A 3CJPA 1WXZA 1RJRA 3GRIA 4C6IA 1A4LA 1RJQA 1PO9A 1FWBC 3WZ0E 3S2NA 3D6NA 4HK5A 4WVXA 4J35A 3HPAA 2AMXA 2W9MA 2WJEA 3GU1A 2GZXA 4ZSUA 4ERIA 2YZ5A 2Z25A 2R1KA 2VC7A 4I6KA 4BJHA 1NFGA 3MJMA 3SO7A 4NI8A 1A5LC 2OQLA 4IFOA 3IRSA 3GIPA 4P5UA 3UR2A 2Z00A 3AUOA 2ANUA 3B0YA 2Z26A 1POJA 4GYFA 1V51A 4KIRA 2RAGA
chains in the Genus database with same CATH superfamily
1SU5A 2ACRA 1W3KA 2W79A 1X6NA 2Z1SA 1XJBA 2VD8A 3M5XA 3UZXA 2YPIA 4C6CA 2W92A 3KE0A 2CLHA 1KGUA 2J88A 3S42A 3TXVA 1R9XA 2WBGA 3H7VA 4C6MA 4UR9A 3VD9A 3VUSA 2O9RA 2PUZA 3I10A 2J62A 3HO8A 3VE7A 3T55A 1XQLA 3AQUA 1W9PA 2VFGA 3N9KA 4JR5A 1EIBA 1F07A 3IK4A 3PAJA 4HVXA 2XJ7A 2QIIA 4H9UA 1JDEA 3SGUA 4H41A 4JKMA 3EBVA 2E1DA 3VM5A 4K7YA 3LGDA 3KZSA 1UASA 1WZKA 2OG9A 6TIMA 2HV5A 4NZ3A 3DFOA 3C3UA 3KBWA 3FA3A 5EGRA 3A22A 1EZ2A 2DVUA 4GGBA 6A3HA 2C0AA 4B90A 3OEXA 1MDLA 4G56A 4RXFA 4XZBA 1WBJA 4PMRA 4YTQA 4L4OA 1GOXA 3BANA 3G1HA 4M24A 3K30A 4LV4A 3ZR6A 3E38A 1UWIA 3EOLA 4XZIA 4JFWA 4GJJA 3C4UA 4EF8A 2EG8A 1ESWA 4XZHA 3H2MA 2PD9A 1YYAA 1L2UA 5D30A 1D8WA 2FVLA 4RL3A 1ZGDA 3VZZA 3ANYA 3G1AA 3GG8A 2VRQA 3W84A 2EGZA 2QMJA 3IPWA 2P1FA 3H2OA 3TTQA 3VDBA 1Q5MA 3UZ5A 4IGNA 2I17A 1YXDA 5IOBA 3SI9A 4MSSA 3K8KA 5FCZA 4GXMA 1EBGA 3K46A 3AROA 3UCDA 3EWUA 1ZUAX 1SJAA 1BAGA 1E6RA 4DUWA 4QSFA 4URIA 4F4RA 3C56A 1P1XA 3PZQA 1W8GA 2JIEA 3L23A 1PCKA 5LGZA 3B4YA 5A8MA 2B7PA 3V5FA 1UKSA 7PTDA 2VZVA 2PURA 2Y0FA 4KQNA 3TU9A 2Q3OA 2J7EA 1N8IA 1UKOA 4LS2A 4L64A 3E12A 1GONA 1ZTVA 3LM7A 2J7GA 2IXUA 4LUJA 5AYXA 1FDZA 3M0JA 1P6WA 3DEQA 3NO5A 4LOCA 2ZUWA 2IXVA 1WXYA 3SJ3A 1XLFA 1HKWA 4IQJA 3I4KA 1TPB1 4D6EA 1EOMA 1WUFA 4JQ2A 2B31A 4IPLA 1X39A 4XO7A 2WWCA 4BCEA 5BCAA 3LHZA 4DNHA 4EP8C 4FX7A 1JF5A 3WDHA 2PA6A 4UFHA 5HWJA 3FS2A 2GDUA 4FA3A 1CB2A 1F3WA 4LBRA 1MNZA 3C5QA 3S6TA 3MMTA 3WLNA 1EC9A 1VR6A 3IVTA 3GD6A 4AY8A 3NVTA 5CAKA 3AHVA 2O55A 4IX2A 3R1ZA 1BXNA 4NAFB 4O10A 3HGOA 5ABFB 2XGIA 4DRSA 1G1YA 4S3KA 2DQWA 1OHLA 2GDVA 3FYPA 3IRDA 1Z9AA 4ERAA 3KTXA 1JYWA 5KZDA 3L2IA 3TV8A 1EEXA 2I7GA 4X3ZA 4FALA 4Q4KA 2G95A 2XVKA 2EJAA 3LBOA 8XIAA 4M1BA 4Z42C 4ORIA 4DNMA 1W1VA 3M41A 1ZCCA 4XD5A 3GY1A 3OLDA 3VNIA 2JGQA 5CZ0A 2R91A 3WN6A 2RDUA 3IWPA 4GZEA 4I6VA 4EIVA 1H7NA 3PBUA 4AYSA 3ZLFA 4XVEA 4D8LA 1AZ1A 3VX0A 3VIJA 1TVNA 3WNOA 4NAEA 2GVGA 1R5YA 4GNVA 4GH1A 5FF7A 4HCLA 1AW1A 1YXCA 1QBBA 3W7JA 2DY3A 4N02A 2GYIA 4Q4PA 3QR3A 3UWEA 2ZUTA 3D47A 2UV8G 4A3HA 3CXOA 4JY8A 3T0TA 3GLCA 4N0RA 4HU0A 3WLJA 3UESA 2QW5A 2QLYA 4FS9A 2WHJA 3SCWA 4DBSA 4NQ1A 4O11A 3CHFA 1TPH1 1U5JA 1KRBC 4RZ6A 3GXPA 4RDVA 4BQ5A 5EL1A 3CM4A 4HHHA 1XIJA 1LQAA 1YE6A 3NEHA 3KOFA 1J2BA 1XI3A 4PEEA 4NP7A 3TJ4A 1KLYA 5CSSA 1VJSA 2ZUSA 3SQSA 4CVUA 4PSRA 3VCCA 5CBIA 3F5KA 3WQVA 4JNMA 4TVUA 1X7FA 2NX1A 2P8CA 2HVOA 3SB0A 4NZ1A 3NSMA 2PZ0A 1JZ3A 1PXGA 4FR6A 1NH6A 1UR4A 3H55A 2W61A 1XC6A 4B92A 5FOOA 5EMLA 3WFLA 3B8IA 3B05A 4NIRA 4QQ3A 3COTA 3TSBA 3B9OA 4K8GA 1JR1A 3IIXA 1FH8A 2ZUMA 1QHOA 5F2GA 3PUDA 3WX7A 2W9MA 1XYZA 3GC5A 4ZSUA 2A0NA 2YCLB 1QK2A 5D9NA 1Q6FA 1E9LA 3ZJKA 1FVPA 3AMCA 4Q7NA 1TFVA 3AISA 3VDHA 1TJ1A 2Z00A 4F66A 3KCJA 5CG0A 4IIGA 1POJA 4IIEA 2OO0A 3GW0A 5AVNA 5I24A 3GSMA 4Q4SA 2FIQA 5A6SA 4AWUA 1MW0A 2YDRA 5H1WA 1S5TA 1TPVA 1L8NA 1XBZA 3WF4A 4UTKA 2DT1A 4LY8A 4UTJA 1RK5A 4DUOA 4KFOA 1FOBA 4F40A 2DIJA 3B0UX 2YCJA 3MA8A 1JDDA 1QVBA 4WR3A 4X61A 4W86A 3F03K 3HGRA 2EQDA 1EGZA 4WSJA 2CU0A 3C2VA 1EF2A 1DP0A 3CTLA 1IEWA 2YIHA 4C1LA 1YNYA 5JH1A 1UPMB 3E1F1 1OIMA 3KUMA 5XIAA 1KB3A 3ITLA 3W25A 1F4AA 2C3ZA 3W6YA 2PDUA 5KZEA 1RH9A 1UD3A 3DHUA 4HNUA 4RZ4A 3GU2A 4B5WA 1SZRA 3PG9A 2CZFA 3O6CA 5DMNA 2V5JA 1VF8A 3WNPA 4ZE4A 3WUGA 9RUBA 4BQ3A 2XZ9A 1A5KC 2HJPA 4H7VA 3WK3A 5EB8A 1K8ZA 3GK0A 2A4AA 5CZJA 3RLUA 3QQ1A 3UWUA 4GY0A 3ERPA 4Q8UA 1ITQA 4ZOCA 1W32A 3O6DA 2Z1VA 2WNWA 4GG9A 3DHFA 3ZT5A 3CZGA 4WKFA 3CUZA 3OBAA 2VEFA 3ABRA 4OBRA 3ITGA 1TMLA 3GW3A 3CMJA 3W82A 2QDEA 1YRRA 2A3BA 5DX7A 1Q6OA 3N6QA 4P8WA 4OTKA 2P0IA 3VNJA 4OQVA 1CDGA 4S38A 2YCEA 1QOXA 4J3UA 2Q3RA 4MYAA 1MW2A 1W5MA 2CC0A 3KVKA 3DECA 4R3UA 1ECEA 1UJPA 4MJ4A 1GZJA 5C2XA 2O92A 2VL4A 2E1WA 4J1OA 4O0QA 4RX0A 3FCPA 4GO9A 1GVEA 4DJFC 1EH9A 3FXGA 1XCFA 2GOUA 4ICCX 3EPMA 1YTDA 4IX0A 3CZJA 2PLMA 1UR3M 4CNSA 1J5SA 1E70M 3QMTA 2B7OA 3RO6A 4ES4A 4JKLA 1M41A 4KWWA 2DJXA 2UY3A 3PZMA 3MKVA 4PB3A 1EUAA 4GABA 5TAOA 1ML1A 1TIWA 4HA0A 3PUGA 1VB9A 4B16A 1SYTA 3UPBA 1VPQA 1S2AA 4MFEA 2G3NA 3WO8A 5BWFA 1S38A 4MWAB 1KLZA 3OVGA 1XG3A 2AAMA 2D2HA 3E2VA 3LGEA 3PZOA 3U7VA 3FFSA 1V4YA 3EMZA 1JZ5A 4CUCA 2QAFA 3VIGA 1R46A 1B0IA 4PEKA 1Q85A 2H6RA 4KCVA 1POKA 4WQ6A 4M6QA 2WV8A 4CCCA 3E2SA 1TWWA 1SO5A 1C92A 4RDZA 2X8RA 4RNJA 3MP4A 1D7FA 4D6HA 1BVNP 2OSXA 4JIIX 5A2BA 3S2LA 3BAJA 4NZFA 3S5ZA 1UR1A 1UZ4A 1O94A 4B91A 4L6DA 4ZEPA 4CN1A 1MDRA 3UA3A 1U5VA 3ZXWA 1KTNA 2PDYA 1GNXA 1KBBA 1M6JA 2BFGA 3EXRA 4I7WA 4DELA 1QO2A 4J40A 3WQWA 2VCBA 4US5A 1E4IA 5HJYA 2FPYA 4IOTA 3VKCA 1K6WA 3GUGA 2P50A 1WA3A 5AKQA 1HGYA 4POCA 3H2AA 4Z1CA 2OLSA 1AZ2A 3SRFA 1R3SA 3MZ2A 1RLDA 2XH7A 3EWBX 1FBAA 1ZJBA 4W93A 2CKRA 4AFYA 1DVJA 4QJ3B 4XD4A 2X16A 1ZAHA 3UF9A 1OFQA 1EP2A 3G2GA 2C91A 3V7PA 3GM8A 2EF9A 3EOUA 3W29A 5LYRA 5M03A 3P61A 2NSOA 2B7QA 3KOZA 3BAKA 1WCGA 4ZMGA 3WDQA 1H0GA 3N34A 2DZXA 2J9XA 1PTDA 3U57A 1TQXA 4GVHA 4H8NA 1FY6A 1UZ1A 1WAUA 4PZVA 2EPHA 1WYIA 3ELFA 4KH2A 4HCHA 4YMZA 5DQPA 1XQKA 1E3ZA 4MWAE 1JQVA 3L21A 1MUWA 1OSEA 3T0CA 4K39A 1D9EA 4Q33A 3WD4A 3MMUA 2POTA 2VEPA 3UYIA 3GTFA 2TODA 3F7JA 2ZC1A 2OYMA 5K4ZA 1H41A 5F7UA 2YBTA 2BS9A 1KO0A 3BSGA 1HUVA 4DXKA 4V1YA 2QCGA 2OYKA 2O0TA 1N82A 1GQNA 3EB4A 3W2UA 2ZRUA 2AL2A 2QV4A 3RRXA 4UQCA 3M64A 3HPXA 2INFA 1IT8A 1W2PA 1GVYA 1TUFA 1WKFA 1M7OA 4R33A 4DZIA 4RCXA 3XISA 3QFEA 4WLCA 1RZMA 4P8UA 4MG4A 2WMFA 1XM3A 3CB3A 1V0NA 4NXKA 2MANA 1KC7A 1PHWA 4JTEA 3WLRA 2A7PA 2BP1A 4WJ8A 2EJ1A 2ISDA 3W28A 1KBIA 1NFGA 1XXXA 4PL1A 3SO7A 5GNYA 5DT7A 4N9BA 1JYNA 2YZRA 3DG3A 4PODA 2WSRA 2CZDA 3GDLA 3T05A 3NDYA 3P3BA 3FKRA 3VIIA 2Z2BA 2YXXA 1EJTC 3LCHA 3RHGA 2ABBA 1MNSA 4INFA 3QY8A 5HR7A 1A50A 2ALRA 5EMUA 3RR4A 2V69A 1QW8A 4HTBA 2X1TA 4FZIA 3M44A 4LWWA 4J3TA 2RKXA 2DP3A 1UUMA 3BLIA 4OGZA 4PRRA 1Y5VA 3FEQA 3WLHA 2V3DA 1UH2A 3GO2A 2R1MA 4IH3A 3UNTA 4AZ7A 1TUXA 4ECLA 1EB3A 1W5QA 3W2KA 3CTTA 1FH7A 3TLQA 2C6QA 2YYTA 3NQEA 4O1BA 1BLIA 2DQXA 1XIGA 3HTWA 2V5BA 1VCFA 3II1A 4QLJA 1TB3A 1N7KA 4PTVA 1C29A 3AO0A 1FQ0A 3AXXA 3P74A 4JDYA 3ZIZA 1DTNA 3ATYA 5DY3A 1HO4A 2FZMA 4OJYA 3U48A 1Z48A 1ZP4A 3C8FA 1CGYA 1QXLA 1S46A 3TTEA 2CW6A 5REQB 4EKJA 2BDQA 1YDYA 4JTAA 2ZZ6A 3CV7A 4WDWA 4TQTA 1F3XA 3LSBA 3KWXA 4W85A 5GPRA 4W8AA 4UNIA 2EPMX 1UR2A 3LENA 2VGIA 2VDIA 3OG3A 4HNLA 4MLRA 3TA6A 2KX9A 3NNTA 2GPTA 5BNKA 5HJXA 5JIPA 4I3GA 1DWJM 3OIXA 2GJNA 1VFUA 5A3HA 1YBQA 1FKXA 1T96A 3PWAA 4U3CA 5A8QA 2HS8A 2PTXA 3UETA 2Z2AA 3AZRA 4HPJA 3S1XA 5JUVA 5FJPA 3G1XA 5C0QA 2OELA 3W7RA 1DORA 2QGHA 1EP1A 1OZQA 3ABZA 4AHOA 1KGXA 5HMEA 1HJXA 2CHRA 3NDZA 4M6UA 4WHBA 3VZYA 4AD4A 4KRTA 5BW6A 3H4GA 4AEOA 4MY8A 3PS7A 3I65A 2ZZ5A 3L4UA 1UHVA 4OWGA 3AU6A 2X1RA 3LERA 4GIYA 4W5UA 2YR1A 4O16A 3SRDA 3M0YA 3R94A 1MFVA 3NYDA 3PJUA 3PULA 2PB1A 2FFCA 2AOSA 4ZTXA 2DT3A 2CESA 3S5NA 3UWWA 3APTA 4NNBA 1JPMA 1B31A 2DZUA 2O9PA 4JHMA 4UOJA 1PB0A 4UMAA 1YKWA 1FRBA 2OEJA 3EPNA 3QTGA 1GOOA 4OBTA 1U1HA 2D22A 1ZBCA 3NFUA 1E40A 4QJ4B 5GJMA 4K6AA 4GI9A 4ZOBA 1TPUA 4PBEA 3OLEA 4ENLA 1CGUA 4V27A 4K38A 3SQMA 4AW7A 1F4HA 1FHUA 1JFHA 2VVNA 4J3SA 4HGXA 5EMYA 1JDCA 1V3HA 3FOKA 3R2GA 4J2MA 2I9UA 3VU2A 1DJZA 3APYA 1UD2A 3MW7A 2HPMA 2A5HA 2Q6ZA 4IMCA 4O18A 4IGHA 3T44A 1FHLA 3P93A 2F8QA 3V18A 2YL9A 1U83A 3NQBA 3R4IA 5G2IA 1A5BA 2O4QA 3UPWA 3W87A 3QPZA 2I1OA 3TYAA 3VIFA 4BR1A 2V3EA 1B3ZA 1XH2A 2VCAA 1GQIA 4XBSA 4MDOA 3CHEA 1OX5A 4DBDA 5FF0A 1KGWA 1A53A 2PTYA 7ODCA 2OGJA 3SCNA 3HQOA 1KV5A 4CQAA 2JKPA 5I0DA 4X60A 3W2JA 3PUOA 4ML4A 3OJGA 4GXWA 8A3HA 4AIOA 4B5XA 4UBPC 2ZE0A 1KBKA 4Q8WA 4JQ3A 2WMJA 1H7WA 2H9AA 1RBLA 2UBPC 3G3MA 3KDOA 4KKXA 1LL7A 2A6NA 4NU7A 1XDLA 1O1ZA 4TIMA 3G1VA 3TQVA 1W2VA 1F61A 2EG7A 2CNCA 2X05A 3RCYA 1NP0A 1LJYA 1UUQA 3VVGA 3VFLA 1E0VA 4UNKA 3CASA 1L6SA 5H91A 2WB5A 1E43A 4DWSC 3XINA 3BV7A 1TWSA 4FX8A 4PMXA 3Q2DA 2Z1KA 3AMLA 3R13A 1C9WA 4E6MA 1PO9A 4Y8EA 3RX4A 4FIRA 3AICA 2PI6A 3USZA 3W7CA 5G2WA 2OLAA 1S1PA 2P3ZA 1PJ9A 4NI8A 3PTQA 4FLOA 1W5NA 3QJAA 1GVFA 1KM6A 2OU4A 3UT0A 2ZUNA 3M46A 2Z26A 1V51A 4KIRA 4O54A 1Q2RA 3H2CA 3UA4A 4KS0A 3U5UA 2V6AA 3IJ7A 1JZ7A 1FWNA 1AK5A 1W6TA 5DMYA 4MIMA 3H4XA 3DCPA 3H54A 3QBUA 2Y88A 3PNZA 1UQYA 3B40A 1CXLA 1CEOA 1JCYA 3BGGA 2WNQA 4QP0A 3PY2A 1FWEC 4N42A 1FFQA 1UWRA 2IPGA 3CNYA 1NDYA 3LPGA 1EDQA 3NAVA 4AIEA 4Z2KA 1AQ0A 4IIHA 1TYGA 1O95A 4AD5A 1OYAA 5EKYA 4RXGA 3WLQA 4YHEA 3CQJA 2WJDA 3F4NA 4QCFA 3DG6A 3VOCA 2VFDA 1UIOA 1Q6EA 2OOGA 1HTIA 3QR1A 4JOMA 1GKRA 1V08A 3WEOA 4ATLA 3IAPA 3SN1A 3H6OA 1XFBA 2WZIA 3MUXA 3MY9A 4NZ5A 4IMAA 3NWRA 2DGAA 3KTSA 3IANA 1NOFA 1DTUA 4GQ0A 5KSWA 2XTKA 4WOQA 1R3VA 3CWOX 1B4EA 1HXJA 5KZMA 3C0LA 1XW8A 2D2GA 1BF2A 3EGJA 4FLSA 1CXFA 3WBYA 5K9XA 5BMXA 3EB2A 2G5WA 1CXEA 1AA1B 3LTSA 2DV0A 4GK8A 3TSDA 5MHBA 5HXMA 4R85A 2VEIA 2W67A 1E4LA 4ZODA 1WB0A 1O5KA 4LCQA 3I68A 4FNSA 2WVTA 5CSRA 3WLPA 4B5UA 3XIMA 3OLGA 4Q4OA 2PWHA 4PRWA 3W7PA 3OW1A 4TXEA 6ENLA 4YYFA 1FWIC 3M9YA 3O05A 1DJIA 1YX1A 1RQBA 4OV4A 2ZOXA 3TAKA 1LOSA 2FJKA 3DFQA 4QIUA 2VDGA 3ICJA 1EJVC 1IEXA 4GZJA 4O15A 1YPFA 2QYGA 3N4EA 1DL3A 1LL6A 5EMJA 2EKGA 2YCKX 3UJFA 4Z2LA 1AVAA 3HIJA 4RPQA 1RCOB 1RXOB 3U3HA 3FY1A 3T4WA 3WQ5A 3LD5A 4JIQA 3CMFA 4XQ6A 3T4CA 1FWHC 3BAIA 4ACZB 1E51A 1EJ7L 3W2MA 2WC4A 2QMKA 3W00A 5J5DA 3BSMA 3R0KA 2C19A 1BWKA 5CG7A 4UC5A 1C8VA 4C60A 3VGEA 3KS6A 4R88A 3WQEA 5C2CA 2GWGA 2PTZA 1XPYA 4HA1A 3GG0A 3TZNA 3KBMA 2XIJA 1TCDA 3BUVA 3NQ6A 4QM1A 1XIIA 2PCQA 2WK2A 3TEVA 5CKSA 1E0WA 3FSUA 1VEPA 3DC0A 4LTSA 4Z2HA 4BHYA 2Q8XA 1Y5XA 1K9DA 1DWFM 3HJEA 1ENUA 1PX8A 1U5HA 2VQTA 1GWJA 1EJSC 3PB0A 4H00A 1RD6A 1GVSA 3C8NA 4I9TA 4LAOA 4MB5A 3MVIA 5CC3A 4HPHA 3SADA 1YW1A 4G9PA 2CITA 4PUEA 4AY1A 1K03A 5K3VA 1ZPTA 4JTHA 4UQ9A 3NQ7A 3UNDA 2Y6ZA 3VNZA 1ZJHA 3EYPA 1T6MA 2Z4GA 1S2CA 3UXAA 3QLDA 3REQA 3S2JA 3T2PA 4LEQA 3LQGA 1EYEA 1TTIA 1U1JA 4ROQA 2DVTA 1WDRA 4Q8QA 5DLCA 2OEMA 3ATZA 3PNUA 4DXXA 3WFAA 1E73M 5AYBA 3LBMA 3RPTA 2XM2A 1LROA 4O8RA 2X40A 3V36A 4AISA 2P0OA 1KCLA 2FJUB 7REQA 3VMPA 3N2OA 4ZFMA 1XRVA 3LLFA 5AHNA 2ZIDA 3BJTA 4PB4A 1UA7A 1ZCOA 1FFRA 4ZL1A 3HJZA 4B9ZA 3V3WA 1B4KA 4US5D 3M0XA 4HB7A 3KOYA 2VT0A 2AKZA 6REQB 3LTYA 2EPKX 1GEHA 4UCFA 4WDTA 1XBXA 4LUTB 2E6FA 4PN2A 2Y89A 2A3LA 1EGMA 4FR1A 1W9XA 1WV2A 3LQLA 2FTYA 1W91A 2YA0A 4IJCA 4A29A 4JTLA 3AXHA 3M5VA 2F84A 1B3VA 4RR4A 2XIIA 4MOZA 1DJQA 2ZRZA 3S1WA 3LK6A 1Q6LA 3K8LA 1GG1A 1BXBA 4EXAA 3GG1A 1Z3NA 1I2PA 3RK8A 3QV6A 4Q32A 4XAPA 2GUYA 3GHSA 2IUZA 3KX6A 2BB0A 1ITUA 3C0QA 2PWGA 2VEGA 3UG4A 1V0LA 1ZQ5A 3GH5A 1ALDA 3FYOA 1UJQA 4H8UA 2YL5A 4ZFCA 3WL1A 4A8RA 1OINA 4Y2WA 3Q67A 1A4LA 1B90A 3QVQA 3TWBA 3PZVA 3QGVA 1A0DA 2E6DA 3VOHA 3WQPA 3MUZ1 3T2QA 3UW6A 2QQ6A 1QU4A 4HA3A 1C7SA 4W89A 1ZBKA 3MI3A 3PPGA 1VBGA 1XCXA 2E6AA 9CGTA 2CCRA 1AH0A 1ISVA 2XZ7A 2C7FA 1TTJA 5BROA 3N04A 2YW4A 4PMVA 2PTDA 2PDJA 5AC8A 5HWMA 3EDEA 3BCDA 2BG5A 3DKJA 3LCWA 3CH0A 1I1XA 2WM1A 2QULA 1TE6A 3KM8A 4GNKB 4GHRA 4W5ZA 4UOZA 3BOFA 2AQWA 2ZZ7A 2O56A 3GNNA 1UKPA 1I8JA 3DAQA 4LVBA 4XD6A 3VOJA 4S3DA 3DGRA 4Q7BA 5D02A 2R94A 1E5NA 5T26A 3PZIA 1I2QA 2FGZA 3PZNA 4MJZA 4A3QA 1M01A 5A2CA 1WDSA 1EDGA 1PUDA 4IHCA 3SRHA 5F2IA 3H8AA 3RCNA 1H62A 1ITXA 2VC6A 4QDPA 1BVZA 3SDOA 3P0WA 1OF6A 4BI5A 5FA5A 1TPEA 1RBAA 2ISWA 5D2TA 1VIZA 2JQXA 1ONRA 3RX3A 3M0KA 3TC7A 1NF0A 3B9AA 2ZADA 1XV8A 1L8PA 4FXSA 2B81A 4UQEA 4IIFA 3QPEA 4ZVJA 3FSTA 1ZSXA 5KITA 4ZO6A 3N6HA 4O0ZA 1R87A 1HO1A 3M0IA 4XZ9A 3QYQA 5LIWX 4MVAA 1HKKA 1AQHA 1D3HA 1LM1A 3NL2A 1RK6A 3WUFA 2WZHA 1GHRA 2ZA2A 1C8QA 3L0NA 1K4GA 2PP3A 4DLFA 3TH6A 2A3AA 3UCCA 1N8FA 4HU3A 3N2TA 1O12A 1FWTA 4PMDA 5RUBA 3NURA 3WMCA 4RE3A 1BVWA 4QR6A 3Q37A 3OA3A 2NWSA 2RUSA 3TN4A 4O57A 2E6YA 5AYYA 2FVKA 4JQAA 1J0KA 2SFPA 4YTRA 1P0EA 3NQCA 2B0MA 3NL5A 1B57A 5IFPA 4YVPA 1KXVA 6XIMA 2D23A 3ARYA 2OSWA 4ZB0A 1F5ZA 1JCTA 3TYBA 3W7KA 3BMXA 1VQTA 4GFSA 2QGYA 2GWNA 3N11A 1ZRQA 4XWUA 4NJHA 1WDWA 4GX9A 4RNFA 3ORWA 1AQFA 4NL1A 5F4XA 3MKKA 4GUFA 3TYEA 5D33A 2FYMA 2DDXA 4NASA 4WDUA 2Z2UA 3V35A 3OGVA 2JF6A 3RGTA 1CLKA 1FXQA 2I9EA 1R47A 3I7SA 1OFRA 3QV9A 5IHSA 5FL0A 4NZ4A 3FVMA 2BGNE 3WQFA 4H9XA 3EXTA 4MB1A 2Z7KA 5LNVA 3CO4A 3N2CA 3NQFA 4NNAA 1R2TA 3ECQA 4QHRA 1F6KA 5CC7A 4JD4A 1JF6A 4EAYA 3CC1A 1YADA 5HQLA 1PTGA 4O14A 2XHYA 5ABEA 3CAQA 4O52A 1S2TA 2BY0A 5FACA 3VI2A 4JNZA 2V82A 3JS3A 2A85A 3NDOA 1NEYA 1Q6RA 3HPSA 3VKDA 3UPMA 4D6IA 1I0BA 1VEMA 3PSWA 4GX8A 3ARZA 3AXMA 1B54A 3D46A 1RP8A 1QNVA 3TCSA 4EACA 4H7CA 1XX1A 4C90A 3R43A 2WJFA 2CPUA 1THFD 1ADSA 1TX0A 2WSPA 1E0UA 3AYRA 4AXKA 3NQGA 4LF1A 2ISFA 2Z6IA 1C91A 2X0YA 1FP8A 3RJXA 1K6AA 4JBRA 5BOEA 1GJPA 3BAWA 3QKZA 1NQKA 3I6EA 3LNMA 4RNIA 3PBYA 1PKLA 1SO4A 3MKCA 4MMWA 1F6PA 2NUYA 1LZOA 3CAVA 2I16A 4C6QA 1JDFA 4NAEB 1NF7A 3U5YA 4DB7A 3IJ8A 4PL2A 1B3YA 4H6RA 1AH3A 4JPGA 4X22A 1M7XA 1W1ZA 4RV8A 4CCDA 4XBJA 4JAWA 1OQFA 3W3OA 4EPEC 1A49A 3AIVA 5IRPA 1G5AA 2J13A 3KCOA 3GHRA 3ZR4A 5GJNA 4XG1A 4S3FA 6XIAA 1CXKA 4H4IA 3URAA 3IJ6A 4Z0JA 4GIEA 4B9YA 3N2MA 4PTXA 2XVLA 1ZB5A 3S2MA 2XGZA 2C71A 4Q8VA 4LX4A 1SO3A 4CD8A 1VFTA 4QTGA 1VBHA 4LU0A 2WZTA 5BZAA 2B7NA 3S9YA 1L6WA 3UJ2A 2DIKA 4ZQOA 1K77A 1Z7AA 2YSWA 1D3GA 4ADTA 4HU8A 3UWQA 4RZ5A 2QZRA 3WBWA 1M7PA 3IIVA 1L6FA 3H21A 1BRLA 4AMAA 1HIZA 4FHAA 1SZFA 2Y61A 1CBGA 2PDNA 4PGLA 5C9WA 1ME9A 1G7UA 1ZY9A 3GTIA 1Z41A 2GFTA 4Q8PA 4KWSA 4HZ7A 3MHUA 3CUGA 4AIUA 3UG3A 3GR7A 2ZX8A 1HKMA 3STGA 2Z27A 3KOWA 1DYSA 1MRAA 3WZ0E 3CWNA 3UZZA 4BA0A 4K37A 3GU1A 4HOXA 1SM9A 5AHFA 3ZJ7A 3W7QA 5KTLA 1NFBA 1ZJIA 4J3ZA 1RPKA 4CU8A 3GC4A 4LV9A 5I2UA 1UKTA 5TF0A 1H3GA 1IXNA 1OGGA 2AGTA 5A95A 5A2AA 4U2ZA 3TMQA 1O5RA 3JVAA 2XWDA 5I6SA 2OGYA 5C9UA 4FEZA 4RPPA 2QCLA 4D1IA 3UY8A 1KTBA 3DHDA 4QDWA 5I06A 4LCSA 3RLGA 1EC8A 3IUHA 3ZZ1A 2FGLA 1X1ZA 2VOTA 3RNDA 3H26A 2PDBA 2Y63A 4GVFA 1A0CA 4UCGA 5CZKA 2ZVRA 4AEFA 1X8FA 3MP3A 2YX0A 4D1JA 3S1UA 2A3EA 4C7GA 4NT0A 4U31A 2XFYA 3CL8A 4PMQA 4XSMA 4LUSA 1Y7VA 3SY5A 1ME7A 1SVDA 1G94A 4AQLA 1DE5A 3MWCA 3WNNA 1QBAA 3DBNA 3QLLA 4DQWA 4IPIA 1WP6A 3MSDA 3KHDA 3W1AA 3FHQA 4G2DA 3WLOA 5B7YA 3M4HA 4F48A 2FTWA 4Y6GA 1NY1A 3CQKA 2ZICA 1I2RA 3V75A 3GDBA 2FMNA 5A6MA 2Z6JA 1GQLA 1JI2A 4A3YA 1WO2A 3N18A 1E6QM 4IISA 2VVSA 5G1YA 4H9TA 1SZEA 3N2BA 1FWAC 5FJOA 1A5UA 1JQXA 5C9RA 4WGXA 5DRIA 3NXLA 8TIMA 2WCGA 3KVMA 4HP5A 1EWDA 4LVGA 1PZ0A 4R5EA 5I3KA 1V0MA 1K9TA 4WRHA 4KGJA 2OZ3A 2VCCA 2X2YA 3BL3A 1PPIA 1TIMA 2V0TA 4P8VA 5LKYA 3C0SA 4Q4MA 3QN3A 1TZ9A 4GUIA 4IUOA 3IARA 2V2DA 4N9EA 3GU9A 4UTUA 1DWAM 1W9BM 1CGTA 1P0BA 4LC6A 1IHIA 3ABOA 2OKTA 2WVSA 3VIPA 3L67A 1Q6QA 3C0JA 3S5SA 1J01A 1CECA 2VGGA 3BCJA 4GQGA 4KMQA 3I4EA 1NAL1 4Y9AA 4A8LA 1E4NA 2VRJA 3TLLA 1VCGA 4O0KA 3LS9A 2ZXBA 1BYAA 4YCOA 3AWNA 2YKKA 3GHUA 3TMLA 4DYEA 1E56A 1TV8A 4N9DA 1JJKA 3I3BA 3GBDA 4MY9A 2E25A 2QXWA 3QHMA 2VELA 2VEMA 2Y1HA 2ZRYA 2YBUA 3VFCA 4A2RA 3HMJG 1V6WA 2Y2WA 3MHGA 3M7SA 1LUCB 3LUTA 3BOXA 3VNKA 1EF3A 4FOKA 3DKLA 2HSAA 2UZ9A 2E9MA 1QI0A 4AB4A 3LEPA 1PAMA 3T6CA 2EAWA 2BODX 4LPCA 4JX6A 1LBFA 1T40A 3VINA 2WXDM 3E96A 1PKYA 4C6DA 1UUOA 1NDWA 2Q71A 4B5VA 4DBEA 3GDTA 3R8RA 4GH3A 3PTKA 1L2QA 1PZ3A 4U3AA 1JAKA 3QOMA 4LBUA 2BXVA 4QE4A 2FMOA 3SSZA 1V03A 4MKNA 2D0HA 2Y5SA 1AMKA 2XFWA 3BW4A 3DU0A 3VGDA 4MHBA 3SZ8A 3H2NA 4HSOA 2JKAA 3HMCA 2ZX6A 2VX6A 2CLLA 1REQA 1RJPA 2DSKA 5DO8A 5HPOA 5MKGA 3G22A 3IV3A 2XH2A 3TTYA 5FIPA 5AHIA 1EBHA 4RE2A 2WZMA 2IW0A 2HBXA 4GQQA 2QVNA 2ZZ4A 2PDWA 3WNLA 4S1FA 3TAOA 3PUEA 2AMGA 4AZ5A 3PR2A 3W27A 2WQDA 4IFRA 3DYOA 5HK4A 4PE8A 4JTSA 3CHDA 1JFXA 3OGRA 5SWUA 1TA3A 5U4NA 2P5NA 3VIKA 3W1XA 4JTJA 4F79A 3C86A 3VPLA 5I77A 2DW7A 5DCBA 1EJWC 3KRBA 3QZ6A 1GJWA 3BGJA 2J8FA 4N7QA 4PMNA 4RLIA 2XSAA 3GTXA 1CI1A 4R7JA 4PB5A 1WE5A 3N13A 4XAFA 1PSCA 6CGTA 3F4VA 3PB2A 3UBPC 3TW7A 2Y8KA 2CBJA 5CPMA 1GT8A 3T7VA 5E70A 1Q6CA 4MYXA 3THDA 3MYOA 1TZZA 3NL3A 1IT0A 3BW3A 3N2XA 1X6UA 2C1GA 3S83A 2AL2B 3NXFA 4IGSA 4MFDA 3NJ3A 7ENLA 5K2ZA 3WQ8A 4BF7A 3GWQA 4LQ1A 4QG6A 1OCJA 3MJYA 1UOKA 4NYUA 4A35A 3EA2A 5FSEC 3ALGA 1HVQA 1EOKA 2ZXQA 3GAKA 2QCNA 1K8YA 4QQUA 5I7GA 1JPKA 4U10A 1XLMA 2D20A 3RYSA 2YLAA 3A12A 1DKWA 2V38A 4AWEA 2Y4SA 3W02A 3G77A 4K8HA 3B03A 3VKBA 4L4PA 1H1YA 4EX4A 1AH4A 1HJQA 3W2LA 3EDDA 3W7LA 1WZAA 2WYSA 1MRQA 1VHNA 2JIWA 4H04A 3W7NA 2VOMA 5LIKX 4EWJA 1TE1A 2I56A 3ARUA 2FB2A 1UR9A 2BY1A 4NJIA 3RIKA 1OFDA 1MVYA 4KWUA 2DSWA 4OUIA 3UR2A 3AUOA 2Z1BA 1AD4A 3LCFA 3JUGA 5LNWA 3BV4A 4HNCA 2H8XA 5AECA 1E1CA 3HN3A 1Z6KA 1ITCA 4Q3MA 1AJ2A 2PU1A 4P2VA 1XDMA 2E4TA 2D2JA 1PX3A 3T9PA 5C9XA 4HYVA 4Y9OA 4H3DA 4TX9A 1S5VA 2J79A 5AZ1A 3TYCA 4UFJA 3BH4A 2GJPA 3HBLA 4WSHA 4D6CA 1SFJA 3BICA 4MF4A 3L4XA 4H9VA 4XKYA 1C93A 3GH4A 3ZFHA 2FZBA 3NVDA 4QBXA 3B97A 3GE7A 2QVHA 3PPFA 4JKKA 5LHEA 2OTDA 4U4MA 1XCWA 4FX6M 5BXRA 4ZR8A 2PDMA 3EZ4A 3I6TA 3FJ4A 1EC7A 1XLLA 1P0DA 3B0PA 5HANA 3NL6A 2WCSA 5HA7A 2J77A 2PDKA 1C8YA 1HNYA 2J8TA 1N8WA 4K36A 4E0CA 4PTMA 1KQZA 3EDFA 1VGAA 1X1OA 2IKGA 4AF0A 3KS5A 4W8LA 4Z2JA 3EMCA 4G6CA 4MZYA 1CGVA 4AHPA 3AMDA 4JTIA 2I5GA 4U28A 4AZCA 4JYFA 3URBA 2Z29A 3AIRA 3GTHA 5MF5A 2QUVA 3RM4A 4D6DA 4Q4QA 1XSJA 1HL9A 3QY6A 2XVNA 4PMUA 5FJRA 3HM7A 4BFAA 2AAAA 1VKFA 2QAPA 5CPOA 1IZKA 4UWMA 1W1TA 1KRMA 2FTPA 3R8HA 3QGKC 3UJSA 1VFMA 1U33A 2PAJA 3VNLA 5FJIA 1G4TA 1HVXA 1W0MA 4AZHA 1VZWA 1WKEA 4FOUA 1YBQB 1TRDA 3AHXA 3WF0A 3VIOA 4JTDA 3KRUA 3FYYA 3H24A 4O4VA 4LYRA 1W3IA 3LOTA 1SW0A 3HZ3A 1VYRA 2PCEA 1LDCA 5CQ1A 2J75A 4QITA 4OHQA 3IJLA 3A5FA 1O7AA 3W76A 3T40A 3LNPA 4M81A 4GI4A 3UGRA 1JUEA 4HK7A 3DHPA 3L66A 4PC8A 2DVXA 3VTRA 3MMWA 4M6PA 2O7SA 4TR9A 2C15A 2X2GA 4DF2A 4M8UA 3F4CA 2NV1A 2TPSA 3W23A 2WSKA 1MMFA 2OODA 5G2HA 3N3TA 1BGGA 2GLKA 4WIWA 3IGSA 4KETA 3E0FA 4L6OA 1MWOA 3B0XA 3V1HA 4JQ4A 2INZA 2BWGA 4DJFA 5BXTA 3G0UA 1XINA 5KEZA 5JVLA 3MC5A 3QSTA 4RW3A 1DJWA 5LIUX 1WX0A 3ID7A 1J18A 3MPGA 1V3IA 2FGBA 3HGSA 3MV01 3PM6A 3N73A 2EKCA 3QMRA 1VCVA 4NRSA 3R5EA 3LXAA 2WLZA 3NYZA 3EX4A 4GNJA 4N2YA 2OX1A 3KBSA 5BWAA 2XIMA 4JTGA 4Z08A 4WKAA 2ZCGA 1XLJA 3QTPA 4NILA 4LVDA 3CAKA 5HNTA 2PRMA 3ZOAA 3WQ6A 1XYMA 7TIMA 2ZFAA 1IZCA 1VHCA 4GI6A 4L4LA 1WOBA 1TQJA 4REQA 4ILSA 4P7QA 4NY2A 4DO5A 3WSUA 1NELA 5DBTA 2VC5A 1HP5A 2HEJA 4YJ5A 2FQIA 5EMMA 3THUA 2IQ0A 3B4UA 1OFEA 2VHLA 4Y9NA 5G4EA 5K4XA 1AFSA 4NRRA 5I3JA 2Y7GA 3P82A 1H1ZA 2XIBA 3W07A 1RUSA 1KM0A 1KA9F 1OB0A 2PBOA 5D2YA 2CZEA 4WF7A 1BGAA 1GOMA 2DFAA 2PMQA 3A4WA 4JEQA 3PTDA 5HR6A 3WCZA 3MTWA 3RRAA 2VYOA 5FI8A 4I8YA 3LZ5A 3E0LA 1V6TA 3LPPA 2PLJA 3TIMA 4YXGA 1B30A 3WY1A 2DZAA 4NSBA 4QE5A 3PN8A 3UJEA 3K1DA 3CEPA 2H9AB 3DGBA 5M17A 1QFEA 2PDCA 2ZXDA 4QAIA 4MNJA 2OVLA 1NARA 3IIPA 3UXKA 4CKQA 4IMFA 1KW1A 1V3MA 1R6WA 1JEZA 1EX5A 3ZR5A 4XVDA 4C6NA 2E77A 4PR4A 2I5QA 4ATDA 4RDYA 2R1LA 4N9CA 2RDXA 4GOAA 3LY0A 5AC4A 5K9CA 2D3LA 4GKTA 2J25A 3BCFA 4GA8A 1XGZA 2A21A 4JIRA 4JX4A 4IG2B 3FK4A 1PWMA 4PMYA 8XIMA 1UA3A 3B8TA 3DFYA 5CC5A 4C6IA 3BSHA 5CAHA 1UROA 4WSKA 4GCAA 1OGBA 3HPAA 1V02E 2Z25A 2UY5A 2R1KA 9XIMA 2GJRA 1PYFA 4D6FA 4PUJA 1A47A 1KM3A 2BOFX 3TTOA 4A6GA 4P5UA 3LRLA 4LVFA 3WF2A 1GCYA 3T42A 3QW3A 2X09A 4PUNA 4E2DA 4I8DA 2O9TA 1P6BA 2YGYA 3TOPA 3VKJA 3DZ1A 1SPQA 4LCRA 1EZWA 4DN1A 1ECQA 3IACA 3VCRA 1BYDA 1RALA 4I9JA 2VEKA 1C90A 2IPWA 4DZ5A 3AMGA 4UTTC 1BWVA 1NSJA 1QWGA 4WY0F 4OOZA 3HQNA 1JPHA 1TREA 1I1WA 4YCPA 1EPXA 3KP1A 4LUYA 1SUXA 1L6GA 6PTDA 3TCEA 3H22A 2IKJA 1VBJA 3M6DA 4W7VA 4PTDA 1IEQA 2WSQA 3E0VA 1UMLA 3CUFA 4I90A 3SN4A 3KW3A 4XBKA 1JZ2A 2EXOA 2O4MA 7TAAA 3URQA 3AS1A 2Y7DA 2WHMA 4ONVA 2WLYA 1E9ZB 1J8VA 1H60A 3N4AA 2ZKMX 3QMSA 3EEZA 1V7AA 3KXQA 2ZBTA 1TVPA 5TD4A 1PX4A 1CGWA 4PUWA 4UOQA 3KBVA 3BQ5A 3ARSA 3IJIA 1TV3A 5DFAA 2PS2A 2FHBA 1GVRA 1OF8A 3CB8A 2NVDA 4QNWA 3WK2A 3WNMA 2G4JA 1ISXA 2ZTKA 1MQRA 5ECVA 1J0JA 3P81A 5DELA 4GY7A 1V3KA 4UMCA 2X42A 4DI9A 4JYEA 1YDOA 1XRFA 1BWLA 5DMLA 2GQ3A 4JX5A 3P5ZA 2J74A 3VD7A 4J5NA 1U2YA 3OIHA 3LPOA 4KEVA 1FUYA 3I7RA 2G41A 1MXDA 4IXXA 4IL2A 1JRCA 1ZNNA 1A3XA 4PCTA 3M7WA 4CQCA 3GXIA 1Z89A 3GYEA 3QQ0A 2VP8A 3H12A 1FWDC 3DI0A 4FI4A 4PA8A 3VX1A 1TWZA 2CLOA 2YA1A 5JXQA 3CUJA 1XR2A 4FNQA 3CH9A 2WJZA 1VYPX 4FF5A 3TN3A 4H2CA 1KR1A 3TYZA 4GE8A 2NW0A 2FHCA 4LAZA 1TO3A 1OVDA 1Z42A 1LL4A 1Y5WA 3HU7A 3PZ9A 1OCQA 1W5PA 5C54A 4NJJA 2I5IA 4GQBA 2E28A 5FEXA 5AN7A 3WH6A 3IGUA 3NPXA 4S3AA 3SJNA 1AL7A 3CS2A 2YXGA 3ZT7A 4K1WA 1SFSA 2VUYA 3HFYA 3G0XA 3H7UA 3JW7A 3EWYA 4YTUA 1PDYA 2GVYA 1G4SA 4TMBA 1JD7A 5I23A 1J93A 3UXDA 3SCUA 4JFVA 1BYBA 2BBFA 5DXXA 3TYDA 3RFAA 2CERA 4NUWA 4DJEC 1GTEA 4M1RA 3CLWA 1V6VA 1PZ2A 4FP1A 4I5RA 3E0IA 3HG3A 4HJWA 3QM3A 2VX4A 3EWDA 1MUMA 3REQB 4HNVA 1JNDA 1F05A 3JZUA 4A3RA 4JIEA 4F2BA 3PPCA 5JBFA 4YTTA 1WDQA 1IYXA 1R3TA 2WMGA 4QSHA 3ZLHA 3QF0A 3WELA 3SIMA 3EKGA 3G8EA 1XS2A 5E09A 2GK1A 7REQB 1E55A 4DJDC 4A4AA 2NV9A 4H01A 1JZ4A 5BRQA 4IPPA 4NYYA 2BY2A 3UD6A 4GVGA 3TQKA 3ZVHA 3QRHA 4GCXA 4FMVA 3SSJA 3K5XA 2ZUUA 3ITYA 5DF0A 4DYKA 4GQRA 3GNDA 3GXDA 2OMAA 3L0KA 2V5CA 1FKWA 4I5XA 3GR4A 4AXNA 1LORA 1V7YA 4OUEA 2NQLA 4LNYA 1FP9A 3AMKA 4K68A 3TROA 3BURA 1YLVA 1FWJC 3UFYA 3OYZA 3P0XA 4GVIA 4D6GA 4RK8A 4JTQA 4CU6A 2NQ9A 1ONWA 3O06A 2Q8LA 1DEDA 3KL5A 4X2PA 3BG5A 4ADUA 3KRSA 1FTXA 3MCNA 2VTFA 1EO7A 1H50A 4PH6A 1XRTA 3RG6A 3LHTA 1J79A 3KAOA 2J9ZA 1GOWA 1R9YA 4BF9A 3ALFA 3FA5A 4C7FA 2DH2A 4YN5A 1CW2A 1MZRA 4LAUA 2DORA 3O15A 2PODA 4D6JA 1WOAA 1ZAJA 1XBYA 2CEQA 1QNOA 3H4WA 2W0UA 4L1GA 1BEUA 3HA1A 3W6LA 3FXYA 4AAJA 1K9EA 4KBXA 1QUMA 1MEWA 4HT3A 1ZHAA 1QNSA 1W9VA 3WUEA 1H2JA 2XINA 3EX3A 5CJNA 2H3BA 4Z1DA 1R86A 2R9RA 1P48A 2RDTA 4GPNA 1DJGA 3P2VA 1SFLA 2V5KA 3CPRA 3A4XA 2X0HA 4Q4RA 2V2CA 4LRSA 4U33A 4JN6A 1KRAC 5FESA 4Z17A 5E6YA 4YVVA 4PCPA 2Z24A 2CETA 3C3NA 2Y8UA 4DWSA 2WVUA 1LCOA 3W4RA 3HURA 2V9DA 1KFLA 3CPUA 3L12A 3WYZA 1LP6A 3BK0A 4RE4A 2BLEA 1SW7A 1UMYA 1KM4A 4QXIA 2OQYA 5AZ0A 4PSPA 4BK9A 1I2OA 2RJHA 1A3HA 1A4MA 4GMEA 3W53A 1FCQA 4JHOA 3M47A 3NZGA 3TA9A 3PP7A 4E8DA 4V15A 4O4WA 1HG3A 1FX6A 3SRKA 1IQ8A 2RH9A 3QSRA 3W7GA 1ZALA 4O19A 4FSAA 4JNYA 3GKFA 3RXZA 3FDGA 1KNWA 1SR9A 4E3TA 2JEQA 2PWUA 2CLKA 1GJUA 1QASA 5D09A 1V93A 3VOIA 1E6NA 3D5HA 4AVFA 3W7EA 1FWGC 2B4GA 5ABGA 4C1KA 2L5HA 3CYJA 4JS3A 3C2YA 2QJJA 4R9OA 1A3WA 4KCWA 3KRZA 1XC4A 1EQCA 3AI0A 2XG9A 3OLIA 3U4FA 3H70A 2WSYA 3CUXA 2G97A 3G24A 1YDVA 4IT1A 4YPJA 4H2HA 3WK0A 4MWAC 4PMJA 4ZSTA 3LHYA 5K9DA 3IJQA 4GYPC 4JTTA 3UVAA 4UTWA 1UC4A 3MUCA 2YB1A 5C5YA 1RPXA 2YDQA 4XX6A 1AQMA 3OTRA 5I3FA 1GYLA 1I60A 4FNTA 4XKMA 1LWHA 3I3DA 4GYKA 3N9SA 4CQ9A 1JUBA 3S6OA 1VC4A 1P0NA 1IWPA 2VMFA 2RJGA 3L0GA 3PJWA 1M5WA 1VBUA 3AHTA 2WPBA 1YTKA 4XK2A 3IJ9A 1HQTA 1OBAA 4FXJA 3BLEA 4Y7EA 4Q8OA 2NV2A 4AX7A 5A8PA 1UR0A 3GKAA 4D2JA 5H8MA 1SZGA 3A9IA 1ZU8A 3POHA 1GPFA 1XHGA 2BV9A 3O8AA 2E9BA 3OU8A 1FH9A 3KOXA 3U9IA 1J4EA 4HPGA 2R1NA 5LSMA 5EFFA 2WQPA 1OYCA 2J47A 3DFHA 1GORA 3P67A 3L2MA 1BTCA 1FWWA 5D32A 2WCAA 5KINA 3RF9A 3BLFA 1UYQA 3LHWA 2A7RA 3S0CA 4Q6JA 5T9BG 2OKOA 3LG3A 1X6LA 1E15A 5CPLA 1UBPC 2WKJA 4IIBA 4QAWA 4MPKA 1J12A 3I3EA 5HDRA 3V0UA 5CGTA 2WC3A 3AAMA 1JZ6A 2HNEA 1IZJA 2JKEA 3VXGA 4QJ1A 5LHFA 4FO4A 4X9SA 3W7HA 4DJFD 3OZOA 2OB3A 4PMZA 1JGMA 2QEZA 3HFTA 4PUDA 3CT7A 4DM2A 3ANVA 3OVPA 4AVOA 2ABAA 3PBGA 3B8VA 1NOUA 1UKQA 3U6WA 2ZRWA 2F6UA 3TNBA 4BF5A 5D9MA 4R27A 1WXJA 3SCQA 1SJCA 3GZ3A 3CIVA 3WBXA 1XFCA 1XLEA 3G3DA 1UWSA 2XDFA 3T0DA 4QLKA 1OX4A 4O1DA 1H5YA 4LFYA 3EOSA 4JEJA 4IWWA 3LHUA 2Y24A 3OZYA 1UH4A 4AD0A 4A2SA 4F0SA 2CBVA 1Q6GA 3CQ0A 1HP4A 4G1NA 1OWQA 4JICA 1NJJA 3ITVA 4US6A 3F2BA 2ZXAA 4CD7A 4KW2A 3VMOA 3HPZA 1K1DA 3W24A 3OHMB 3R0UA 9XIAA 1QW7A 3KCLA 3CGTA 1W8SA 4H1ZA 5I00A 1EFZA 3SAZA 1AW5A 3GNOA 1JYXA 5EPDA 2ZA3A 2NXIA 3W81A 5HQEA 4N6EA 1Z44A 2UY2A 4DZAA 4WDXA 2C0HA 1NU5A 5FAJA 1IGWA 3W1UA 1QPKA 1UH3A 1M1BA 3TKFA 1GGOA 2CBIA 2FPTA 2W4XA 3OZPA 4ZGYA 5A94A 4C6JA 2PBGA 2CWNA 4DBWA 1XGDA 4B3LA 3NA8A 2FKPA 3K2GA 3S8HA 2DUZA 3W1NA 3UWYA 3MI2A 4DUVA 1VJIA 1J96A 1I45A 2VZOA 3M6YA 1NM9A 3M5YA 2YW3A 1KBJA 1WQ5A 1RJQA 4TU1A 4HK5A 3GBEA 2GZXA 4P8XA 5IBXA 4H8HA 2ONEA 1SSDA 3ANUA 3TWAA 1E4MM 3MZNA 3LN3A 3IIZA 1O5QA 3AIQA 3NIYA 4IFOA 1RCQA 1L6YA 1UWAA 3N9RA 4TVDA 1BPLB 3P84A 3Q58A 4E38A 4CNPA 5B7ZA 3V5CA 5AC7A 2O7QA 3CO8A 4W87A 3O9NA 5DN1A 1W1YA 5LA0A 3NQDA 4UTHA 3KHJA 3WD2A 3ZQ9A 1EJXC 3L4WA 4WXYA 1RCXB 4FK9A 5HOSA 1UZHA 2R6OA 3AYVA 4GACA 4QLLA 4GBUA 4OT7A 1RP9A 3BAXA 3FHAA 3QEZA 2JALA 4NJGA 3OHIA 3ZO9A 3SW6A 3M0HA 2GJLA 3M43A 1O5XA 1US0A 3CQHA 1KCKA 4QDMA 4AZIA 1I0DA 4IFKA 2NZLA 4ZBCA 3PBWA 4IQLA 2G8ZA 4LUSB 1MYRA 3W83A 1RY8A 3BGAA 2CLMA 4LUTA 3A13A 3OODA 1DWGM 3BZGA 3DG7A 2OLHA 4LBSA 3ENLA 4JIPA 1M03A 3GUWA 1I2NA 3LSCA 4FPSA 2ESCA 5AC6A 8RUCA 5E0FA 3P62A 1KTCA 1ICPA 2YBVA 2GJXA 1NDVA 1QAPA 4FOJA 4KWOA 4EANA 1IIGA 1KFBA 4G1KA 4UQAA 3LV5A 2VZTA 3CZLA 4ICMA 4KEUA 3NSXA 2D0GA 3PWIA 2YL8A 2ACQA 4TUFA 2YLLA 1PL9A 3E3HA 3G1DA 3U2OA 1G7VA 5AVHA 1UG6A 1E5JA 3UZJA 3P14A 4Z2GA 3NPUA 1DQXA 1H63A 4W9TA 1JAEA 3QQWA 1YPIA 1XLAA 4LW7A 1BXCA 2QKFA 4DPPA 4J9JA 4IICA 1CZ1A 4WJEA 2CXEA 4UZSA 4QG9A 1LWIA 2VFEA 3FDKA 4K8EA 3C2RA 3JZEA 4C1NA 4L1XA 3SIZA 4PMOA 3B8WA 3VGFA 4A8NA 5HQMA 4XAZA 1F8MA 1SSGA 4UTLA 3QKEA 4HHMA 3S1GA 4AUBA 4CQDA 3PBVA 4HZ8A 3QGAC 1CWYA 3WJSA 2DW6A 4NX0A 4FLQA 3ZT6A 4M51A 1ZBVA 1G9HA 1H11A 4ERGA 4PTNA 5CBJA 1RVGA 5I3HA 3RLHA 4FXRA 3TJLA 2TRSA 5E93A 3FIGA 4M80A 2Z1XA 2NVCA 1KFWA 2HNHA 4S23A 5D05A 1OCNA 3SQLA 2FLIA 3TC3A 4B2DA 1BSIA 1ZENA 3F1QA 5HINA 3O7UA 1K9FA 1OT1A 1KWGA 4KT2A 4LUIA 3FAXA 3TFCA 3AS3A 1DHKA 2BVWA 3AZTA 3B3DA 3B04A 2E0PA 2QUUA 3ARQA 1QOQA 1QWKA 3G1SA 1EQPA 3M16A 5J5RA 2OPJA 3WH7A 1LWJA 1E3XA 2F2KA 3L2LA 3UXLA 3VM7A 4HIBA 4HN4A 4DAFA 5M5DA 4YYCA 3ITOA 1GK8A 3E2RA 4JTFA 2QJGA 1T41A 1REQB 3GC2A 5MKGB 1JXKA 2NWRA 2VC9A 1P7TA 3SCPA 3TN5A 1JNEA 2ICSA 1M65A 2WMIA 3W7MA 1Q4WA 4O1FA 3OGSA 2BX7A 1W3HA 4JGDA 3R7MA 2V3FA 2PGRA 5D9OA 1KM1A 4NVTA 4XTIA 1U1UA 1S1RA 2GVJA 1P43A 3USBA 2Y62A 2VFHA 4EPKA 1M68A 2GUBA 2JBMA 4F2UA 4HD5A 2PRLA 5D4YA 5CJMA 1DHPA 1TA3B 3VILA 3QXBA 5EA9A 4CNOA 2GQAA 1E0TA 3N15A 1UD6A 4KEMA 3RDKA 3IUIA 4HYWA 4MM1A 1QHPA 2ISVA 3EDJA 1E1FA 3GVGA 3MBFA 1X38A 4AD3A 1FCUA 4DI8A 1X8CA 4E5TA 4U5KA 1JXJA 2PDLA 4YU1A 3OP2A 4LYQA 4C6BA 4ZA0A 1CXHA 3L65A 1QATA 1P6CA 4C6FA 5F2LA 3THCA 3A64A 3WH5A 1FWRA 2BSLA 4NX5A 2C13A 3NM3A 1JUKA 4CD6A 5J8LA 5TIMA 4NI3A 5ECUA 3VD4A 2IQDA 3OZMA 1PIFA 2X30A 5KZ6A 3G1YA 4C6PA 1S3HA 4A22A 1QCWA 4C6EA 3H23A 4PRTA 4UZUA 1IWAA 3NO3A 4HJFA 3A9BA 2PFHA 1J11A 3W37A 1A0EA 4M29A 3BMVA 3C2EA 5DRCA 4KFNA 1QNRA 3R12A 1TV2A 1FXPA 4H83A 5D2VA 1RBOB 1FCVA 1HKVA 3G18A 3I6RA 4UTWC 3MQTA 2O9OA 4C5YA 1HKIA 3TTSA 3R89A 3AU2A 3UVIA 5ABTA 1MXGA 1Q7MA 2G3MA 3OQ8A 1JD9A 4ORMA 4IMGA 5CC6A 1UWTA 4J3WA 3TW9A 4PTWA 1VPYA 3UP8A 1UBSA 3L5AA 3VO0A 4AG0A 4N6FA 4QEEA 3W1TA 3S2NA 4KFPA 5D8WA 3VD5A 2Y70A 4E8CA 1Q45A 4QEHA 2H3DA 2W27A 1XLBA 4ERIA 3DESA 2ZRXA 3TC6A 4XSLA 4AH7A 1KXTA 3B06A 2WNZA 3SGGA 1E1CB 1KWKA 3TONA 3HF3A 5BU6A 2NT1A 3Q4DA 3B0YA 3WDPP 5E9AA 3WQOA 3PJTA 3RX2A 4JY9A 4L9ZA 1PBGA 4L65A 3W71A 1UW9A 1W3LA 3MP5A 5T9CE 3GG7A 3EB3A 1RAKA 3LHVA 1CPUA 3CBWA 3N25A 3S46A 3W1PA 3QR0A 1W54A 2Z28A 1VLWA 2NUXA 2A6LA 3UZYA 2PDQA 2P53A 3EWWA 1MSSA 4EWND 1LRQA 4HQVA 3TUUA 2R24A 4XKYB 5D2WA 4UFKA 4UTIA 2OXNA 1QPOA 3PANA 4QFUA 1JDAA 3BLPX 4JL1A 3OBKA 3TFXA 1AJZA 3FEMA 1OD8A 3W7OA 2VWTA 4RNHA 1B2YA 4L9XA 4W7WA 3SUVA 5EBAA 2PE4A 3GB6A 3DENA 4A8IA 2ALDA 3RITA 2QUNA 3E5BA 4DPQA 1EJRC 2A7NA 3QYSA 1KCXA 3C2OA 3S9ZA 2ZWZA 4AF0B 3W9ZA 4S39A 4LJ3A 3EX6A 5FJUA 2YOCA 1M9HA 2G50A 3N1AA 4N4QA 1YTEA 2CBUA 3L5LA 4BY3A 4ML9A 2RHGA 4AZCB 1BQGA 4DWSD 1VFHA 1GZ1A 4PUKA 5CBBA 2HQAA 1JIBA 5G1TA 5JH2A 2G3JA 1TRIA 1XISA 2EPNA 1A80A 2ZZ1A 3SCSA 4FB7A 3R11A 5DMMA 1DV7A 1OIFA 2PP0A 3NCOA 5I3IA 1G01A 1Z69A 1V0KA 4R7WA 3QC0A 4L4MA 4G7EA 2E9LA 1XWYA 4HPXA 4HBKA 1VENA 3F5JA 2FHFA 4YWIA 4J2PA 4O50A 3FVDA 2BGQA 3T1GA 4LAKA 1TPDA 4I7UA 4CNNA 5ENLA 5LA2A 3TJIA 2Y7EA 1Y0EA 2GGHA 2WVVB 4LALA 4Y90A 4IP5A 4PBGA 5HUPA 4PCSA 2D0FA 3MCMA 3FJNA 6TAAA 1SFTA 3BVJA 5B80A 3SFWA 1AMYA 5HNNA 1SJBA 4ZOEA 1J9YA 2NLYA 3W73A 1G6CA 3THQA 3VMNA 3P60A 3B8UA 2XN0A 3NM1A 2WANA 2BOEX 1UR8A 1ADDA 3T78A 3MT1A 4JHZA 1QTWA 1KKOA 1UQZA 3ZSTA 4S3BA 1DJHA 4W4QA 1ZLPA 3W1LA 3LX9A 3KDNA 3RMJA 1DJNA 4Y9PA 4LT9A 1X97A 4OBSA 1VD6A 1CENA 1T7LA 4GC3A 1BFNA 3P8JA 4KEZA 5U7SA 3SUUA 2HXUA 3LV6A 2VR5A 1WNOA 5T91A 4HA4A 3NQVA 5IBXC 3JRKA 4XIMA 4Z1AA 4I5UA 5JU6A 3GXFA 2BOGX 3Q94A 2NXGA 3PZUA 1K7XA 4H9YA 2Q8ZA 3T2OA 1PE1A 2C1IA 4MKSA 3BLDA 5IDIA 3UR7A 3NEVA 3RCMA 4BQ2A 1QI3A 3GAYA 3WJYA 4HPNA 3DFNA 2DPEA 1NIUA 2QDGA 3P5YA 4RZBA 3VZXA 1AG1O 1YMYA 3LDVA 1OEPA 1H51A 4CLMA 2QJMA 5I3GA 3EXSA 4REQB 1UOZA 5HPCA 1XSKA 2ACSA 5A8OA 1S2UA 3WF3A 1KV8A 4CCZA 3TVAA 5LNSA 1G0CA 4QX4A 1I6NA 3PG8A 5EU9A 1R3QA 3CV1A 3CL7A 4KCTA 1DIEA 1WDDA 2XFRA 3HG5A 1U30A 4YHGA 3ZS4A 4S3CA 3VGGA 1XICA 3F4DA 1GVQA 1C9DA 1R7AA 5CSUA 3ZJ6A 1GVOA 1UP2A 1HFBA 4ZENA 3MDUA 4ZO7A 3G8RA 3N12A 4UFIA 3T81A 4K2SA 1OGSA 4JFUA 3U7BA 4TX6A 3GFXA 5KETA 5CEWA 3OYXA 1UD5A 3LPFA 3BE7A 1AD1A 3O6AA 5FF4A 4HZ6A 3MYPA 2VURA 4DO4A 2GSHA 1HGWA 5A6KA 3LLDA 3G1FA 4HZMA 3TQPA 1VFOA 3SCRA 4E2OA 1HL2A 3AYSA 1EYWA 3BAYA 3GTNA 4WD0A 3RILA 2A2IA 1OCBA 1OK4A 1LUCA 1LOQA 4XZNX 1ZS2A 1KR0A 2KZHA 4RKAA 3LCGA 2YYUA 1TWDA 3AOFA 5C7HA 3L4ZA 3GYCA 3W70A 3FV9A 2XSXA 5AHLA 5HWNA 2BMBA 4RDWA 4ZB5A 4AU0A 3W26A 5E0KA 2CLPA 3NZPA 4CN4A 1ONEA 4DVOA 3VIHA 1LRTA 3URNA 2PF8A 1NDZA 1GYMA 4IIDA 4C6KA 3LRMA 5FSDC 1PDZA 2GSEA 1OT2A 2W62A 1CXIA 2G3IA 5CZSA 1SMDA 3GRIA 3IGXA 2GUUA 2QCDA 5I5RA 2QCCA 4F0MA 1ISYA 5CSYA 2HVNA 2AMXA 4G8TA 1EEPA 1QOPA 1S5MA 3WBEA 3W72A 2VC7A 4I6KA 2POZA 4AZBA 4IP7A 3LCXA 3VDCA 1IT7A 4JIHA 8CGTA 1H1NA 1IV8A 2WHLA 3GIPA 2FDSA 1OADA 1DWIM 3V16A 3WQCA 2Y85A 1QW9A 2RAGA 4FNUA 1UZDA 2OX4A 2Y7FA 4OZOA 4TTGA 2PWDA 4EXBA 1R7OA 4EVZA 1IWBA 4QJ5B 5BU9A 3AS2A 1KXHA 3TDFA 2QJHA 5E5CA 5D38A 4N4PA 2QDDA 4OV9A 2F38A 2HROA 5FEPA 1IXPA 2PLKA 2CLEA 1GOQA 1E72M 1UC5A 1RA0A 4OECA 5F1UA 3GVWA 1LRNA 2ZC8A 4IUGA 2GGIA 4P7RA 3WQ4A 3KBNA 3BLKA 3LM3A 3UR8A 2E67A 4Y8FA 1V8EA 2OJPA 2AL1A 2FH8A 3CK5A 4JFSA 1XRSA 2HPIA 3NPWA 1Q2SA 1BKHA 3RMEA 4Q8MA 5DT5A 2HE5A 3C52A 3O0KA 4HMEA 4S2CA 4R7OA 1VFLA 3K4DA 5LA1A 3ZWTA 3C6CA 1V3LA 4ZO9A 4UQDA 4B4FA 4B3ZA 2IS7A 1AODA 2VENA 1KFCA 1KKRA 3UERA 1XLCA 2PLCA 5A6BA 3ZLGA 4FNPA 1Q7QA 2W91A 4H6KA 1F73A 1WKYA 3GFZA 5A8GA 3CU2A 2J24A 3WQDA 2REQA 3TQ0A 2XYLA 4MPQA 3O6YX 5A5WA 4V2XA 3DOPA 3WJXA 3UG5A 2J27A 3KL3A 3GVQA 3O0FA 3B9EA 3LCIA 2J4GA 2AGKA 3VE9A 1LLOA 3WH9A 4BZYA 1UB3A 3OG2A 1NFPA 1YE4A 1HJVA 3FW6A 4YWSA 4GY1A 5G1MA 3N4FA 1W1PA 4HMCA 4ICNA 3S3GA 1QRQA 3RPMA 3U2ZA 1VP5A 1S39A 5FF3A 2OQHA 4K1GA 1OX6A 2WC7A 1GQKA 5M2FX 4PBFA 3FGCA 1H7PA 4EOUA 5CXPA 1LBMA 4IPNB 5BOFA 3RLVA 4UFLA 2DJLA 2HK1A 3NUKA 3BDKA 1K7EA 3V0SA 2XIQA 4B3KA 4O53A 4WJXA 3S5YA 3BW2A 2X41A 1I75A 4GINA 3CZEA 2C18A 5CH9A 1DPMA 1XP3A 5HJLA 1W1IE 4XO6A 3DYMA 4DY1A 1R3RA 2P76A 1E6ZA 2JF7A 2NQZA 1KFKA 4P7LA 1TWIA 3GX9A 4MLJA 1TTPA 2HVMA 1FWFC 1P5BA 2ZX5A 3NZQA 2QPXA 1E6PA 1ZFJA 3AC0A 2F7FA 1PCWA 1P4CA 1ME8A 4IP4A 5HNRA 5EYWA 4MZ8A 4ASTA 3VD3A 5JMUA 1VIWA 1QMLA 1BF6A 4QE1A 1JCLA 1RV8A 5FJTA 2P10A 4DZHA 4CD4A 4H8VA 2D24A 3N29A 2ACUA 3RM8A 2QCEA 2A3HA 3KP0A 1QNQA 1VFSA 5BXSA 4H6QA 2OEKA 1GQJA 2YFNA 4GZ7A 4YTSA 3A23A 4WY0A 1DJXA 5BRBA 4PFHA 4AEEA 2ZTJA 1EHAA 1V6XA 2VZUA 4JN7A 1XBVA 1H49A 4DEFA 3VCNA 4B2DD 4NZJA 5D8ZA 2DT2A 1F6YA 3APGA 1NWUA 2C14A 2H8ZA 5FAGA 4CNTA 4LB3A 1EA0A 2AKMA 1HW6A 5H8UA 3DH7A 5I02A 1LT7A 2YJQA 2DZVA 2GK1B 3FKKA 3K4WA 3TNOA 4IJRA 3CHCA 3DIPA 1XGEA 4IQEA 3H2FA 3BZJA 1VYSX 2NQHA 5A1AA 4J3VA 3A47A 4OOUA 3ZVHB 4EAMA 1T8XA 3V5OA 4XB3A 3GDKA 1IIHA 1F9CA 1LYXA 4EK7A 1GVIA 4A21A 2JK2A 3HOJA 3SCVA 3AUJA 4DIAA 4LANA 3OA5A 4K3ZA 1LG2A 1Z32X 2Y5EA 3TW6A 3SY1A 4H9MA 5A6TC 4IQDA 1XYAA 1IEIA 2HRWA 3AJXA 4FNRA 3OB8A 2ODOA 4XD3A 1R0MA 4C6LA 4Y9MA 2DH3A 2PDGA 2VRKA 3SUTA 4C65A 4I7VA 2JEPA 1GEQA 4RW5A 1A5MC 4TVCA 4XUYA 3AIUA 1QPQA 5BXPA 1QO5A 2G0WA 4Y96A 1W56A 3MS8A 3T8LA 3BMWA 4ZOAA 1Q7ZA 4E4FA 5HNUA 4HN8A 4GWEA 5A6AA 2EPOA 1MQPA 4R34A 4Z1YA 3G6MA 2HTMA 2DSVA 5C55A 4X0VA 1O66A 2BXYA 1XSIA 1FA2A 4HTYA 2EO7A 2IPFA 1DXEA 1UD8A 3LGGA 4PYSA 3WD0A 1UP0A 4YS1A 3W7IA 1T8QA 4X9YA 3M0MA 1ONXA 3DBPA 2NQ5A 5FD0A 4RV3A 2PRHA 3UJRA 3WLSA 3CEUA 1C3FA 3C61A 4FXFA 1QR7A 3E74A 1XYBA 3QHOA 2VXNA 4U2YA 3MUY1 2X1SA 3EEGA 4ZXLA 3CJPA 1WXZA 4ZQMA 5I09A 4DWDA 3T07A 2GQ9A 3D6NA 3A4AA 4QNEA 1S5NA 3TE9A 3R25A 3NGFA 3V0TA 4ZB2A 3RU8X 5AYZA 3U8GA 1W5OA 3B0VC 4UUIA 3MSGA 4BJHA 5E9XA 2XN2A 2VX7A 4WK9A 1KM5A 4Q8NA 1WAWA 3PFRA 3LI0A 4AMCA 3KWSA 4O17A 2LLEA 1XIFA 3CQIA 3UQNA 4WCJA 1F7BA 3STPA 1V02A 3AIEA 3AIBA 5C71A 1UP3A 4MAZA 5D9PA 1WZMA 3GR8A 3M07A 4L6HA 1TVLA 3STFA 3NG3A 1I9CB 2NX3A 4DWSB 4M0XA 3T8QA 1XL9A 3TR2A 3PVFA 1M3UA 1MEHA 1PV8A 3INPA 1W17A 4CQBA 4PFMA 2HZGA 3AHZA 1R2RA 4YNGA 2PD5A 4NHVA 5ABHA 2EBNA 2FZDA 2RGLA 5LIYX 4WKHA 5GNZA 4E3VA 4IGMA 1LQ0A 4WOZA 3RO8A 3THAA 4NZCA 3VNYA 4ZQPA 3NQ2A 3KTCA 4DF0A 5GNXA 2XN1A 2G4FA 3TP4A 3WUBA 5D2XA 3MVTA 4KWVA 3T09A 3N17A 3BO9A 4JL2A 3WK1A 4O13A 2OWCA 1F8IA 2W3ZA 2C79A 7XIMA 3TN6A 3N19B 3UXIA 5HAOA 1B5TA 1EJUC 3PPHA 4BKNA 1TTQA 1PEZA 2XVGA 4GBDA 3GIQA 2OWXA 3HG4A 3TYUA 1EL3A 4I9AA 3VAVA 4UTTA 1W37A 1J10A 1YHTA 3AWOA 2WZEA 3FA4A 3NQAA 1XYLA 3U0HA 4G7FA 4IG2A 3LMYA 1O68A 3VIMA 5F2MA 1KM2A 3OOQA 1KCZA 4EE9A 4M82A 2QS8A 1GG0A 4MY1A 4UXDA 1H5VA 4X2RA 1PIGA 1PZ1A 3NPVA 3Q65A 3EA3A 2DZBA 3A3HA 1G67A 4JCMA 4KRUA 5D03A 3JR2A 1V5XA 3CL6A 1IE7C 1HF6A 4LNCA 2FB3A 1FHVA 4XAGA 4KCUA 3S2CA 2XISA 1F76A 3CYVA 1J0HA 1SO6A 3LYEA 2FPVA 3N6JA 3O3RA 2YDSA 1RD5A 2CFFA 2PSNA 1PTAA 4PULA 1BYCA 1XLDA 2FZ9A 1V3JA 2PGEA 3G5EA 1F3EA 1H7RA 3H2EA 3SR7A 4JXCA 2CHNA 2F9RA 3QOKA 2J6VA 2DSUA 4QRNA 1BKSA 2XFFA 1US3A 2W66A 4HNNA 4OE7A 3R79A 3VKKA 2HISA 5LXXA 4BQ4A 4LH8A 1X96A 1HN1A 1Q63A 4UTMA 2IKIA 4ALDA 1VJZA 5EY5A 5E1QA 3POCA 4MNMA 2CZVA 2VM8A 4M6VA 4NG3A 2VQUA 1OJXA 2PZNA 2BTMA 2PDIA 2EEXA 4DHGA 1XKJA 4NXSA 2W6RA 5JIWA 4TO8A 1DIDA 2VDHA 3MANA 1HZYA 3LB0A 1IXOA 5TBOA 3ITTA 1B3WA 2P88A 2D1ZA 2GL5A 1AL8A 2PGWA 1KQYA 2QCHA 1XUUA 1XYFA 2WKGA 1JGIA 3S1VA 4HMDA 1RA5A 3S4TA 3OPSA 2CHOA 4E2VA 1NWRA 2OR2A 2EPLX 2Q09A 2NVAA 3BJSA 3NOYA 4NAFA 3FJ6A 5ABFA 1B3XA 1XKYA 3Q45A 4GC4A 3RUBL 2E40A 2R8WA 4F0KA 1L0PA 3NO1A 1K70A 1W9DM 2YB4A 4E2BA 4AHQA 3UGVA 1OABA 1Q4NX 2F6XA 3KZPA 2J7DA 2OT0A 2QDHA 5DCEA 3QV8A 2W63A 4DUXA 1SW3A 2QCMA 4BWLA 4W8BA 1CCWB 1Q3NA 3LLXA 1OX4B 1QNPA 4CQ8A 1UD4A 1YPXA 3S5OA 2V8ZA 1OFOA 3E02A 1JCNA 1Q66A 4IPJA 4HHLA 1VPXA 1ZL1A 1R30A 1BHGA 2PP1A 2Y5JA 1EDTA 4DJEA 2V63A 1VRDA 4GUJA 3WBAA 1VH7A 3SUWA 1S2VA 2GDQA 3U2CA 1BSLA 1Q6DA 3GVVA 3J7HA 4O1CA 5PTDA 3C2FA 5GJPA 4TX8A 2G96A 5HMFA 4AZGA 1MO0A 4GUGA 3IJDA 2BY3A 2E8YA 1GW1A 1GTHA 1DQWA 1ZJAA 2VD9A 2CIPA 3PSVA 3D0CA 3S47A 2E09A 4FIQA 1PIIA 1VRXA 4HHPA 2PC8A 5F1VA 1EA9C 2BZNA 3UWZA 5BYWA 5EFDA 4BEUA 4DJDA 1PHQA 1PYMA 4LXFA 4KESA 5BMWA 3MI6A 4UR8A 5F4WA 4YLWA 3IAQA 2JGYA 1XIHA 1GUVA 4W88A 3W7DA 1XLIA 3CT2A 2DUAA 5T8GA 4KERA 2NLIA 1CYGA 3B8SA 2E3ZA 4H6EA 3ITXA 3DI1A 5CPTA 4V28A 4J4KA 4S3EA 2QJNA 4IL0A 3F2DA 4ATWA 3DXIA 4L9YA 1CIUA 1MXSA 3VDGA 1R2SA 3W86A 1RY0A 1RJRA 1O60A 3LTPA 2ZDSA 3ABXA 4CGTA 1NWTA 3AIWA 4TTUA 1CB7B 1U22A 3L9CA 1B9ZA 2WJEA 2X1IA 1H7OA 3ES7A 3SCOA 3B9DA 2BGSA 1MW3A 2PDFA 3MJMA 4WXZA 1DBTA 1H61A 3DFPA 5LIXX 5D04C 2YCLA 5C70A 2QF8A 2D2OA 4AIBA 3ARTA 2OCZA 4GYFA 5F4SA 5J04A 1RSCA 5EMKA 4JTRA 3GQYA 3L5MA 2QT3A 5CJ5A 2UY4A 5LGXA 3VOGA 4ACYA 3WLIA 4ZO8A 1D3CA 1LOLA 1FDYA 4EXQA 2XH0A 4P7OA 3EA1A 2GSJA 2J66A 1YNQA 4MJ2A 1HX0A 3UG8A 3WIJA 3JU2A 1I4NA 4IFKB 1XYCA 3MSRA 1EO5A 3EMQA 1Q8AA 1A5OC 4DO6A 4FAMA 3QHNA 4HMNA 1TPFA 1DQUA 2PEVA 2NSXA 3F2CA 3CV6A 4MTVA 4JYDA 1SMAA 1LG1A 3OVRA 3F5LA 1J6PA 4NF7A 4DLMA 4AYGA 5CGMA 1GHSA 2TYSA 5E6ZA 2I57A 1V6YA 5AHEA 4Q6XA 2GJXB 2VWSA 4MADA 1S3TC 1DIOA 1EXBA 5FJJA 2ATMA 4RUBA 3MUAA 1C8XA 4MKVA 1TPC1 2VKZG 3NGJA 4HNOA 4LRTA 4GI8A 2GGJA 1CX9A 3E6EA 3O16A 5H6HA 3WH8A 3IV8A 2ZQ0A 3DFTA 3CLMA 2J78A 3S6DA 3WEMA 3VNMA 4H9ZA 2J9YA 2G3FA 3AYTA 1R8LA 4BI7A 1K4HA 5A69A 4NKCA 1JYVA 1HKJA 3KBJA 1H7XA 2AQOA 1CT5A 1A5AA 3ISIX 3QY7A 2WAGA 3HGJA 2OYLA 1HJWA 1A5SA 4C1NB 4Z2IA 2V2HA 5IDZA 5CCZA 1UIPA 4F9JA 5LZLA 1IXQA 3LI1A 5IM51 1R9ZA 3DDMA 3H53A 2FFIA 3RU6A 2JFEX 1YXYA 4V1XA 4O8AA 3VYLA 2GQ8A 4MNKA 2C8NA 1QPRA 1Z8AA 3CMGA 4JFTA 2ISSA 3RR1A 3WLLA 2GVLA 2BHZA 1DXFA 1EXPA 3FX4A 4LY4A 2X0SA 5A6BD 2E5BA 4A05A 2PC4A 1SZNA 1E9YB 5M3WA 3TR9A 2XH4A 3WF1A 1NQ6A 3ARRA 2KAUC 1UWQA 1OK6A 1GYNA 3K4AA 1NP2A 4M19A 2BVTA 2BVYA 2QPSA 1JRBA 2OZ8A 2FDMA 3T08A 4DX3A 3ZM8A 2IQTA 2XSBA 3TX9A 5AOUA 3W1MA 3WDJA 2PU0A 1D2KA 3VDAA 3WG6A 1Q13A 1W9UA 4MWAA 4EPBC 4CNUA 4EPDC 4GYJA 1S2WA 4E4UA 1LF1A 3NR0A 4GYPA 2E8ZA 3BG3A 1ZAIA 2OWWA 2F61A 1OFAA 2HK0A 3ONCA 3A21A 1KBLA 1X7IA 2Z1WA 1WPCA 2Z0IA 5HULA 2WWDA 1MFUA 4MUZA 1P7TB 2PF0A 3PBMA 4LC8A 2PGFA 3GIYA 2WMIB 4HK6A 3MWAA 3EAUA 1VEOA 1JI1A 2TAAA 4JTCA 1W3JA 4DAIA 3WMLA 3ABSA 1A5CA 5FF2A 3IVUA 2NXHA 3QPYA 1TJ2A 1TELA 2PPGA 2V3GA 2INEA 3IK2A 4UIOA 1K8CA 2FVMA 4GO8A 3PJXA 4GD0A 4HCDA 3K8MA 1QDSA 3AFBA 4FLRA 3RPDA 4XAYA 3B9NA 4G5DA 4MNLA 2EHHA 3SM0A 3IEBA 1JCJA 2QIWA 1TCMA 4AC1X 4M7TA 1TKKA 1ZP3A 4XIAA 4CD5A 5L9FA 1XLKA 1TR1A 5DXYA 4L80A 1R38A 3L4VA