3LLFA

Crystal structure of the mutant s127p of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
217
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMPHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 78
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3llfA00
3BARA 4JTEA 4X2RA 4O8RA 5D32A 3TSDA 4QITA 1SSGA 2A85A 3B0VC 5I3KA 5LNSA 3TC6A 4JS3A 3UWZA 3BW3A 4X3ZA 3N73A 3PSWA 2ABBA 3LCGA 1U83A 3LM7A 1Q6RA 1PE1A 3ABQA 5F2MA 4R34A 3M0ZA 3NM3A 3ELFA 5KTLA 4BF9A 4HSNA 1TPVA 4HNNA 1GQNA 2ZZ3A 5DY2A 1ZAHA 3OVQA 2NZLA 3NQGA 3LERA 2Q8LA 5IM51 4M6VA 3CWOX 2C16A 2VFHA 3TA6A 1OX4B 1PVNA 4JYFA 5LNWA 1G4TA 2ISSA 3W7RA 1EP1A 4UNKA 3ABRA 3W71A 4EWND 4ZZ9A 1LP6A 3I7RA 2QCEA 4UTJA 3GR7A 2J27A 3B0UX 4WD0A 4UTWC 3P5ZA 4R53A 1KBIA 4HN4A 1FWSA 1IIGA 3T4CA 4NZJA 3S1WA 1XDLA 2A2IA 1C9DA 1KM3A 3R2GA 1W56A 3NR0A 5K7JA 2C0AA 2QCCA 3HPSA 4MUZA 2DU2A 5I3FA 5LNVA 3L5LA 2ATMA 4ZQPA 3TIMA 5BW6A 1ML1A 3BLIA 4CNNA 5I3JA 5AHMA 1HG3A 5I3HA 1L9WA 1DJNA 4UTIA 2AQWA 3BPWA 2X1RA 3UY7A 1GOXA 3E9AA 3LBCA 3S5NA 3NOEA 2VC6A 2C19A 1ICQA 1PV8A 3PS7A 1SPQA 4EIVA 4DPPA 2CLLA 1UASA 3O16A 2FB3A 5FEZA 5D2WA 2V5LA 2V2DA 3W6YA 5AHEA 2NLIA 4GUGA 1SZFA 3W2KA 5CPLA 4UR7A 5IBXA 1OFEA 2A7NA 5HNRA 1OFAA 1K7EA 1THFD 4HSOA 4HNUA 3RNDA 5KSWA 4C1KA 4DELA 3T78A 2ZRUA 3QYQA 5AFDA 3LV6A 3QRHA 4NVTA 3NQ6A 1VPXA 5BNKA 4Y6GA 3W85A 4B5NA 3S5OA 4IXHA 4ZQCA 4O4VA 2EKCA 1OG0A 4HHPA 4LVBA 1Z42A 1GVOA 1VYPX 1XBYA 2OJPA 3C6CA 1ZALA 4UFKA 4OU1A 4XBKA 1ADOA 1FBAA 3AO0A 1K8ZA 3P8IA 5MHBA 1WX0A 4FX6M 4NJJA 4BK9A 2GVLA 2P0OA 3GIYA 4FX8A 2QKFA 3NA8A 3OA3A 4FHAA 3IGXA 2JKEA 3ABSA 1GZGA 3OVPA 3G0XA 1BTMA 1WV2A 1L2UA 1YXDA 3N9SA 3L0NA 3LB0A 5EYWA 1L6WA 2CLEA 2HSAA 2RDWA 3NNTA 1JRCA 1X8FA 2FDSA 1DVJA 1OYCA 3MJYA 4LS0A 4XWUA 1K7FA 3QM3A 3QSTA 4KFOA 3PBUA 5G2IA 1Q3NA 3C2OA 2Y88A 1UB3A 5C5YA 5CZJA 3WJZA 1OK4A 2QDGA 3EB2A 3W7NA 1LLWA 2AGKA 2BLEA 3W74A 3MUXA 4LRSA 3MP4A 3MYPA 1GG0A 1GPWA 2TYSA 1G7UA 4PCFA 1PHWA 3S5YA 2NWRA 3M5ZA 5D2XA 2NX3A 1YXYA 3I68A 5DCEA 1PHQA 1ZCOA 3M43A 4UMAA 1JJKA 4O17A 3GZ3A 4OWGA 1MXSA 1DQXA 2G95A 4HPXA 4RJEA 1IXNA 1LYXA 1P0KA 4LWWA 3ATZA 3I6RA 1SZEA 3PBYA 2F7FA 2VELA 1WOAA 6ALDA 2VFEA 3STEA 4Z1DA 1JQVA 4RXGA 3M41A 1FWNA 3I65A 3R8RA 3JR2A 4IX0A 4LS1A 3O6DA 5A8GA 3M5VA 4FNSA 2VEKA 3EXTA 1LCOA 3Q94A 3NPVA 2PRHA 1XUZA 2O7SA 2X30A 4JTGA 2FTPA 3TW6A 3MWAA 2Y7EA 4BI5A 1SSDA 1Y0EA 5CG7A 5D2VA 2Y89A 1R30A 1WBJA 3CT7A 1GJPA 3GDTA 1TPC1 4IGHA 1KLZA 1UCWA 4MFDA 2YSWA 2EPHA 4NU7A 5G1YA 4WXYA 3W87A 5H91A 3ABOA 3N34A 4FXSA 1QNVA 4UMBA 4ADTA 3LCIA 1AK5A 1TPWA 2NXIA 4OV9A 4ZQOA 3QQ0A 1D9EA 3B4UA 1TPEA 3KHJA 1I45A 3PM6A 4DBDA 1TQJA 2GVGA 1W5QA 3LHVA 3L21A 2ZA2A 1FDYA 4NJGA 4NX0A 4JNMA 1FWWA 5K2ZA 4HPJA 3L0GA 1SW3A 2QCMA 2Y7GA 3HQ1A 3W07A 1BEUA 4FNTA 1FX6A 2Z1BA 1JVNA 2WNQA 4EOUA 2YX0A 1ZFJA 1SO5A 2X16A 4K7YA 4IPIA 3GDLA 3O6CA 4UR8A 3NQDA 1X6UA 3SZ8A 3W72A 2XN1A 5C54A 2R8WA 1Z48A 3TV8A 3C2EA 1TYGA 3F03K 4K39A 4IMGA 1SFJA 3EX3A 1ZAJA 3QMSA 2WJZA 1EB3A 3EX4A 4NJKA 4LC8A 5DELA 4POCA 1VHNA 3H54A 3W7OA 4TMCA 4P61A 1EIXA 1ME7A 2C13A 1LORA 4NXSA 5EPDA 2WV8A 1RD5A 3VCRA 4N2YA 1Z44A 3BK0A 3GAYA 1Z41A 3P80A 4UCGA 4KFPA 3M5XA 3OEXA 1R46A 3HIJA 3NQ7A 3SGZA 4OBTA 1F5ZA 3A9IA 1PL9A 1VQTA 1ALDA 2FQIA 2GOUA 4K8EA 4DQWA 3ATYA 2CLHA 4NT0A 4O1CA 4U28A 4DEFA 3DHFA 1ZNNA 5FEXA 2NXHA 4WY0F 3G18A 1XM3A 4X22A 2YFOA 3S1XA 2ZZ2A 3IEBA 1BKSA 4Y9AA 4CQ9A 4RX0A 1H51A 4GXMA 4S2BA 4OHQA 7TIMA 3LI0A 4O54A 2FIQA 2J6XA 1T8XA 3UPBA 4GUFA 3CU2A 5IBXC 2H90A 2B7OA 3NQFA 1TJRA 5D2TA 1HUVA 4O0KA 3NQAA 3PUEA 2VEMA 3INPA 5AN7A 2QCNA 3W2JA 1H1ZA 4DO4A 1H5YA 2A6NA 1FCQA 1Q6OA 3NL5A 3PG8A 3NL2A 3PVFA 5TQLA 3NQEA 5I3GA 5J5DA 2XN2A 3DGRA 3SSJA 1EWEA 1GWJA 2G97A 1H62A 2CZDA 2YYUA 1M6JA 2Z2UA 4Q4KA 4YL2A 3WJXA 4N02A 1LBFA 3GLCA 1VCGA 2C1HA 4JTUA 4ALDA 3QC3A 1MZHA 1GTHA 4ADUA 4M7SA 2D73A 4JTIA 1QOPA 4AWUA 3TQ0A 2VENA 2E6FA 3IGUA 3GXNA 2EF9A 3UYCA 3W2UA 2FJKA 1GVRA 1A50A 1S3HA 1WXJA 1S5TA 4M5PA 3LV5A 1H7XA 2HS8A 1K02A 2VFGA 4N4PA 3S5ZA 4EVZA 3FJLA 3G1VA 1QO2A 4LV9A 1VYSX 1RR2A 2DP3A 4O53A 3W84A 3ZWTA 5D33A 2Z0IA 5DCDA 1Q6LA 1SO6A 3HOJA 4XBSA 3GNNA 1TRDA 1TIMA 3DFPA 3VE7A 3NG3A 3BLEA 1GYNA 3LOTA 2B0MA 3BVJA 5HUOA 4QAIA 2I1OA 4WX2A 5U4NA 2J88A 4CQ8A 2NWSA 1WDWA 2DZUA 4IQLA 3MBFA 4MZ8A 1TV8A 1SUXA 4UTWA 1W5MA 5D38A 4HNVA 3MP3A 3QF0A 1I2PA 3NQCA 2Y61A 3HMJG 4LT9A 4K36A 5U7SA 3WJWA 2G96A 4AVFA 3MW7A 3HG5A 2GQ8A 3U2OA 1H1YA 3W1TA 1EX5A 3L65A 4AH7A 4JYEA 4FX7A 3DI0A 3SW6A 5HJLA 2XN0A 1DKWA 5CPOA 3TUUA 4TX9A 3HJZA 4PEKA 2QDHA 2VEPA 3B0PA 3LRLA 1OYBA 3G0UA 4M6QA 3OHIA 4O15A 5CPNA 5LKYA 4S2CA 3GAKA 1W1ZA 4E0CA 4UTTA 3BLFA 3Q2DA 1W5PA 4KWVA 4AMAA 5FI8A 1KLYA 2EHHA 3DHDA 1LTDA 3B03A 3QPYA 3P61A 1IF2A 3P82A 2C14A 5D2YA 3PB2A 2V2CA 5BMWA 3W1XA 3F4NA 5CGQA 3VKJA 1YLVA 1VH7A 1F7BA 3MI3A 1JCMP 3C2VA 3VE9A 3EX1A 3LI1A 1M5WA 2J9ZA 2TMDA 2X1UA 3PC0A 3KAOA 1SZGA 3PF3A 1W54A 3G3DA 4CCCA 4Y8FA 4M6PA 2HS6A 1TJPA 4DO5A 4GNJA 2NV1A 4N9BA 2VOMA 4UFMA 2X1SA 5EL1A 1TRIA 4WY0A 2UV8G 4JY8A 2GPTA 4H6KA 1VS1A 1EUAA 1F76A 3TNOA 3ZR4A 3QQ1A 4MY8A 3W70A 3IRDA 3KVLA 3L9CA 1GTEA 2QUVA 1QMLA 1O5KA 2VKZG 4JR5A 4JTSA 3UZ5A 3NM1A 2CU0A 4EF9A 3CHVA 3CM4A 4CLMA 5EMUA 1TV5A 3LRMA 4JY9A 1BWKA 4UFJA 1FCVA 1JRBA 4WOQA 4YWIA 4L4LA 1W5OA 1W3IA 3TAKA 1O95A 3OG3A 1O60A 2C18A 4M19A 3U8GA 4GUJA 2DJLA 2QR6A 2VFIA 3EWXA 3CIXA 5DXYA 1KM4A 4O28A 1OX4A 1R47A 5AHFA 2X2GA 5SWUA 3W7CA 3NGJA 3TMLA 2YCEA 4WZHA 1V7YA 5BMXA 1TTIA 2V5BA 4GWEA 1AW5A 1H61A 3W75A 1JCYA 4ML9A 3RLUA 3IIVA 3S42A 1FWRA 1B57A 3UD6A 1I2QA 1F6KA 2ZRWA 4LVGA 4AWTA 2AAMA 3GDRA 4R7JA 5E0KA 3LCLA 2CLFA 1R2TA 4OV4A 2GQ9A 4XTDA 2QAFA 2TRSA 1X7FA 3LX9A 4O0ZA 1JQXA 3V75A 4AXKA 3F4WA 4AEOA 1A5SA 1EWDA 1K3UA 4IMDA 1KTNA 3HPZA 3QFEA 1KV8A 3FA5A 5DLCA 4JDYA 2DZTA 2Y6ZA 3SJ3A 4U4MA 3NQMA 4DF0A 1MEHA 2YDAA 2ZTJA 4D2JA 4WUIA 3QMRA 3W1RA 1QWGA 4O10A 4UTLA 1VYRA 5L6UA 3B05A 3UWYA 5F4WA 4P2VA 2YYTA 3GX9A 2DZWA 1FUYA 2G5WA 4IMFA 1N55A 2B7NA 3HGOA 3PUOA 1VZWA 4JX5A 3M9YA 1FDJA 3LHUA 1HO1A 3BG9A 1MO0A 2ZFAA 5HINA 1H7RA 1QOQA 3NYZA 2Y7FA 5HQEA 1NVMA 1UUMA 3GXTA 4X9SA 3TSMA 3FYPA 3N2XA 2GJLA 4PTNA 3P62A 3B04A 1JUEA 1WBHA 2OT1A 3E12A 2A21A 3DZ1A 5F2IA 4LW7A 3UPWA 5D02A 3HF3A 3S0CA 3EXSA 3W1LA 3FEMA 3LRKA 3QW4B 1LOLA 3EWYA 4XZ9A 5HWMA 1TSIA 2WNNA 3QZEA 2ZA3A 3L67A 1VCFA 1KFKA 3W1PA 4RZ5A 3HG4A 1TPH1 5AHNA 1LBMA 1LBLA 4PFMA 3KX6A 3O1NA 3CTLA 1S5VA 3LHWA 4ZMGA 4DF1A 1KFCA 3P74A 4O13A 4MJMA 4DO6A 2E1DA 2J24A 3M6YA 1P0NA 3C56A 1TMHA 4GC4A 4GE8A 1T0OA 4RK8A 3SIZA 4TMBA 2CZ5A 1LRQA 3DH7A 3YPIA 1AMKA 3DFQA 2RHGA 3W76A 1YYAA 1F05A 2C15A 3NZRA 3TJLA 1F74A 3G1SA 2OCZA 2WPBA 1SQ7A 3IIXA 4E2BA 2H3DA 3H53A 3QW3A 4JTLA 1YTKA 2E6YA 2NV2A 5F4SA 1CX9A 3MP5A 2VEIA 1QAPA 3ZS4A 1TO3A 2EGZA 4NNAA 3E96A 2WNZA 2QCGA 1W8SA 4I7VA 4JIPA 4EF8A 4NXKA 3V1PA 4I9AA 2YW4A 4TIMA 4A2RA 2FFCA 4QNEA 5GVJA 3T7VA 5K3VA 3ZWSA 4MJZA 3UNDA 3SY5A 1XC4A 1RQBA 3L0KA 2BZNA 1EP3A 5K4ZA 3NVTA 4DBEA 3P67A 2F84A 4G1KA 3W1NA 2WKJA 4JXCA 3VI2A 1P4CA 3W23A 3DFSA 2QCFA 1CI1A 4LUIA 2CFFA 2JKAA 1MSSA 4AHOA 2W6RA 2C6QA 5AC7A 2R14A 1UBSA 3UZJA 3EWUA 4MVAA 4R33A 2B4GA 4LNYA 3A5VA 4RCXA 2NUYA 1N7KA 3C52A 4QQ3A 2A4AA 3FYOA 3TFXA 3M44A 4E2DA 1WOBA 1PCKA 2Y70A 3MHUA 1TPDA 3PBWA 1LOQA 2E6AA 2BX7A 5CSSA 3W7QA 5CZSA 1LROA 5FF2A 1I2RA 3DKJA 3CWNA 3PSVA 3PULA 3TMQA 1H63A 2PRMA 2A7RA 4IUOA 3BG3A 4KKXA 1MEWA 3G1YA 4AWSA 3MBDA 2ABAA 5CKSA 2YW3A 2ISVA 1KM0A 3UY8A 4TU1A 5AC8A 3WFAA 3UWWA 3W88A 3PAJA 3CIWA 1UUOA 4MYXA 1J2WA 1TB3A 4NZFA 3BV4A 3SGUA 3RFAA 3MYOA 3LXCA 1IXQA 1EPXA 4RR4A 2ZRYA 4J9JA 4MIMA 1ICPA 3FS2A 1TPFA 3TE9A 1E51A 3EWBX 3IVSA 3W83A 4UTTC 4QNWA 5G4EA 1TQXA 2GVJA 4FNPA 1XKYA 3GR8A 3UXDA 3KRZA 4LS2A 3LCHA 2H3BA 2KZHA 2YXGA 2ZDRA 4PODA 2RKXA 4CCEA 2FPTA 3CQ0A 4QIUA 4DXVA 2ZRVA 4JX6A 2V2HA 5AYZA 1R2RA 5HMSA 4QISA 1W3NA 3G3MA 1EEPA 3C2FA 3RMJA 1EUNA 1G7VA 1OFBA 2WSQA 2JKPA 3EXRA 3HO8A 1LZOA 5G2HA 1WYIA 1RVGA 4MZ1A 4XTIA 3IV3A 4GJ1A 4GFSA 1M7PA 1CW2A 3THQA 1W31A 3KRUA 4UC5A 1L6YA 3P81A 3TU9A 3BW4A 5A5WA 3WK2A 3P7YA 1H50A 1ICSA 3W1AA 2W79A 4I7UA 5K9XA 3B06A 1LRTA 5K4XA 2I14A 2QEZA 3W9ZA 4Z1BA 2DZSA 3L66A 3TXZA 3W2MA 2ZCGA 3N9RA 1SZNA 3NDOA 2VFDA 2GUUA 3ANYA 1K8YA 4K37A 2CLOA 2W0UA 1H60A 4AAJA 4JICA 1OX5A 3NL6A 3O06A 1W5NA 2VFFA 4NNCA 1Q45A 3TXVA 4N9CA 1JCXA 4MZYA 4O50A 4Q33A 1B4KA 1LM1A 3PBVA 1G4EA 4JEQA 1V5XA 1QPQA 4JD4A 3TQKA 4S1FA 3O07A 3EKZA 2Y7DA 2HMCA 2ZA1A 2V9DA 3NO5A 4O52A 1VJIA 3HBLA 3EEGA 3M5YA 4UFHA 5D05A 1TTQA 3IIPA 4UFIA 5D37A 4WJEA 3TH6A 3BGJA 2TPSA 2V81A 1GYLA 1OFQA 4IWWA 2J9YA 1VLIA 3A21A 4NQ1A 1EP2A 3EX2A 4O12A 4RLIA 3HG2A 4UUIA 3I7SA 4UMCA 4AHPA 4NNBA 5DXXA 1SFLA 4MKNA 2V8ZA 3M16A 4MFEA 4NJHA 3E49A 2RDUA 4JDBA 3IVUA 3TW7A 4N6FA 3MMTA 3C8FA 4PL1A 4FNRA 3S6DA 1XFBA 3B8DA 1Q6QA 1OFDA 4CNPA 5BOOA 5K9DA 4FEZA 5KZDA 1ME8A 6TIMA 1VHCA 4C1LA 1KFJA 1H7OA 3TFCA 3LLFA 2E09A 4H3DA 3C4UA 3W7EA 1MEIA 5E1QA 3NZ1A 4UTMA 4O16A 2ZRZA 4FNQA 4IJBA 1YXCA 3M7WA 3LHYA 4FB7A 2ZTKA 3IIZA 5TBOA 3KVJA 1QR7A 4KFNA 5DY3A 3KVKA 2Y62A 3HB9A 3F1QA 3A5FA 4MPQA 1LDCA 2A6LA 2BTMA 4K6AA 1N8FA 5C55A 1OX6A 4O57A 3W7LA 1LOSA 5HR6A 1VRDA 2H6RA 1H7WA 3RU6A 2PC4A 1I8JA 3W73A 2YFNA 4UTUA 4ORMA 5F4XA 5FESA 5ABTA 3N3MA 5EBUA 3LGEA 3S1UA 5H2ZA 3GDMA 3KXQA 3UXAA 3C61A 1JCNA 2GQAA 2OZ0A 4Z0JA 3A23A 2RH9A 1OFOA 4YLWA 2WOQA 5DCBA 1SO3A 3MI6A 3W7KA 3QJAA 3EWZA 3JRKA 5LSMA 3GB6A 4TO8A 3W7DA 2YZRA 3LXAA 2ZQ0A 3TDFA 2V82A 2VXNA 3VNDA 4HT3A 3FFSA 3QPZA 3WK3A 5D30A 1OABA 5CPMA 3FLUA 5TIMA 5FEWA 4OE7A 5HWNA 4NX5A 3ZFHA 2LLEA 5J5RA 3DENA 1YPIA 3GDKA 3HG3A 1RPXA 3NQVA 1XL9A 4LU0A 3LTPA 2R94A 3DFNA 1X1OA 4QJ1A 2DJXA 3UWVA 4AF0B 5LGXA 4ZQRA 1FCUA 2NUWA 1XBXA 3N14A 2C3ZA 2OMAA 2P10A 1TTPA 4AHQA 4O11A 3JS3A 1VLWA 3BGGA 5LHEA 2B7QA 3PR2A 4CQAA 1A53A 2WQPA 4FO4A 2A5HA 4K8HA 4YMZA 2YR1A 1M7OA 2ZZ4A 1O5XA 5EA9A 4UTKA 3W22A 3LTSA 3MI2A 2Y63A 1HO4A 2E5DA 5FEPA 5T26A 2RFGA 1C29A 1ZJIA 1XCFA 2PCQA 4WOZA 1NF7A 3I7QA 4MLJA 1NAL1 3A24A 2ISWA 3TCEA 2CZFA 1IGSA 4OGZA 4WY0B 3G1XA 2QCDB 4QSHA 3NPUA 3P84A 2PRLA 4ZVJA 1FDZA 1FWTA 2CLMA 1T96A 1KM2A 1NSJA 1I2NA 3L5AA 2FB2A 1LRNA 2CZEA 1FXPA 2FPYA 2QCHA 1DHPA 3G22A 1WAUA 1SW7A 4XUGA 1QFEA 1K03A 1OF8A 4IPJA 1BWLA 2JK2A 3W7PA 3A22A 1QPNA 3TKFA 2E6DA 1B3OA 5AB3A 4YXGA 1VR6A 3G24A 2Q8ZA 1GVFA 1DL3A 4I7WA 2E68A 3N2MA 1KBJA 2CWNA 2QF7A 3NPWA 3S9YA 4LV4A 2QCDA 1ONRA 4E38A 4LC6A 1YDNA 1GEQA 4O19A 4XKYA 2YPIA 4ICNA 3W7IA 3L5MA 4UXDA 4O14A 3OBKA 3K30A 1FCBA 1EA0A 3FIGA 3G1HA 4N9EA 3O05A 5EY5A 4GBUA 4HNTA 4JTHA 5DBUA 3DI1A 4GRSA 3FKRA 1TV7A 3O8AA 4ONVA 4JX4A 3WK0A 5FF4A 3IVTA 3C0JA 3PB0A 1YTDA 1KFLA 1G4PA 1FXQA 1G69A 2NXGA 4RXFA 3NL3A 3R12A 5HWJA 1KTCA 1OFPA 1OF6A 2Q3RA 3OIXA 5FF3A 4M7TA 1JULA 2QUUA 1IXOA 3DFOA 2PURA 4LVFA 4OQVA 5CSRA 2EAWA 3DXIA 1KFBA 4MY9A 1G67A 2Z6IA 3CPRA 3FOKA 3FJ6A 1K7XA 1DQWA 2ATSA 2QAPA 4Q32A 3LCFA 3MO7A 1JUKA 1O4UA 1PIIA 1VC4A 1XDMA 1PS9A 3SFKA 1NFBA 4ZQNA 2QJIA 2X1TA 4MLRA 2GJNA 3T44A 5D09A 4NUWA 5C6MA 1A5AA 3TSBA 5DN1A 1GT8A 3DU0A 4BI6A 5G2WA 5LGZA 3Q37A 3TJXA 3QMTA 2QJHA 1DBTA 2CLKA 1W0MA 1T99A 3LHTA 1U5JA 1P1XA 1KFEA 4MYAA 3NPXA 5HULA 1OYAA 1ZAIA 5G4WA 1KA9F 2CLIA 3HGJA 4RV8A 1DORA 1R2SA 2ZZ6A 1B9BA 4A21A 2ZBTA 3STCA 3UWQA 4O1DA 1FQ0A 1OFRA 2H8ZA 1TCDA 1F73A 4UTHA 1UJPA 3LHZA 2QJGA 2ZZ5A 1L6SA 1FY6A 3EWWA 4ADSA 2Z6JA 2QCLA 4BWLA 5KITA 1RQEA 2WSYA 3NQ2A 5AHLA 3TAOA 2NUXA 1SW0A 2TSYA 2FPVA 5F2LA 3TQVA 5D03A 1TTJA 4Y90A 3HGSA 3R13A 1ZHAA 3W2LA 4L4MA 2QUTA 2O7QA 1K8XA 1XXXA 3T55A 4ORIA 3Q58A 3NXFA 4QM1A 3C2RA 1RZMA 1DV7A 3GNDA 5FF7A 4IOTA 1JR1A 4CNOA 5I3IA 3O15A 1DOSA 3G1DA 1AW1A 3MHGA 2DORA 3WJYA 1JCJA 4WXZA 5AHIA 1QCWA 3M1ZA 1SU5A 4IX2A 5F1UA 2WSRA 4PH6A 3R89A 1J5TA 3OVRA 4YCOA 1G6CA 4AB4A 1RQHA 2I9EA 1GVQA 4UNLA 1HL2A 4DPQA 4CCDA 3DKLA 1KTBA 2BXVA 4HIBA 4LTSA 2ZRXA 3HPXA 4IMEA 4FF7A 3G1AA 3IGSA 1LLZA 3GK0A 4UFLA 3P60A 3GYEA 2A7PA 1H7PA 3CEUA 2JBMA 1ME9A 4MY1A 3M47A 3W7GA 3W3OA 3KRSA 2E5BA 3W1UA 1B4EA 3R5EA 1KV5A 5G1TA 1AW2A 1JCLA 2PE4A 2HTMA 4RKAA 1C8VA 1KM6A 4DF2A 3H55A 1P5BA 3BG5A 4W9TA 3LCWA 4H4IA 1OK6A 4JTTA 2FLIA 4KWWA 5KZMA 2ZYFA 1NEYA 1D3HA 3G8RA 3QH2A 5LNUA 1TPB1 5F2GA 5LZLA 3GXPA 1I2OA 1SR9A 2A0NA 5HUPA 4XQ6A 4A3UA 1VGAA 4FXRA 4FNUA 3LCXA 4JTFA 4Y96A 1QPRA 4Z08A 4JIQA 3PWAA 4PC8A 3LTYA 2E77A 4JTJA 2V0TA 3SECA 4LVAA 3LLDA 3N19B 4A29A 3C3NA 3LDVA 3TC7A 2BWGA 3NQ8A 1DJQA 3STFA 3LBMA 1OVDA 4N6EA 5CZ0A 4TR9A 1VCVA 2E5CA 1W37A 3CEPA 3TK7A 5L9FA 3UQNA 3CC1A 1O94A 3W1MA 4WQ6A 1HTIA 2V30A 5LHFA 1AL7A 4JN6A 3O63A 1XBZA 5CZTA 1HFBA 1KM5A 2RDTA 3U6WA 3BW2A 4BWLC 2CW6A 3SR7A 1XBVA 1KM1A 3LXBA 1GVSA 4BR1A 2NX9A 2JGQA 1JUBA 3KOFA 3UWUA 4OT7A 8TIMA 3RF9A 4K38A 3E02A 2Y85A 3W7HA 4PL2A 4IXXA 5KMYA 1QO5A 4NJIA 3RK8A 2R91A 3W86A 3G8EA 3MHFA 2Q3OA 5EKYA 3W7MA 1S5WA 3G1FA 3WK1A 2B7PA 4MOZA 3KVMA 3G0SA 4O18A 1F6PA 3DAQA 3W2NA 2H8XA 5KINA 1H7NA 1TREA 2OX1A 3L2IA 2DZXA 2J9XA 1OJXA 4HKPA 4RZ4A 1W3TA 1A5BA 4LOCA 3CLMA 1D3GA 3WJSA 3IIOA 1YDOA 4IMCA 4RZ6A 1J4EA 3NAVA 4LUJA 1RV8A 4ZQMA 1IXPA 3KFTA 1AG1O 3EX6A 4FIQA 4O4WA 5K9CA 2YGYA 5D04C 1WA3A 5AC6A 2OT0A 4UIOA 1ZY9A 4AF0A 3O6YX 3USBA 1KW1A 1QDSA 3FKKA 3PUDA 4N9DA 2WO5A 3DFTA 1YPFA 5G5IA 3HGRA 3L68A 4LRTA 3QSRA 5BRBA 4Z1CA 4BFAA 3AJXA 3S8HA 3GVGA 1G4SA 3QEZA 4O1AA 3BO9A 4XKYB 2ALDA 3D0CA 4GUIA 3GKAA 2A1YA 1YDVA 3W1QA 4O1BA 3STGA 4BI7A 4ZL1A 3P8JA 1OHLA 3EKLA 3TX9A 3VFLA 4Z1AA 1XUUA 2DZVA 2ZZ7A 2DZPA 1IIHA 1WQ5A 2IQTA 3W7JA 5C2XA 4YCPA 1YADA 1GG1A 4JGDA 4LVDA 3SI9A 2P1FA 5AYXA 2NX1A 3E0IA 4LY8A 5FF0A 2BSLA 3GKFA 1YTEA 3PG9A 3DBPA 5F1VA 3NEVA 3CB8A 3TR2A 5E93A 5HR7A 5AYYA 1AL8A 3PY2A 3S1VA 1SO4A 2JGYA 1X1ZA 5DBTA 1QPOA 2ZZ1A 4A22A 1XI3A 4PA8A 4GUHA 3THAA 1I4NA 4FIRA 4K7VA 4A2SA 3P5YA 3TROA 5LNRA 1NF0A 4Z0SA 5AOUA 1ZENA 4N4QA 5KZEA 2XFWA 1F2JA 1A5CA 3RLVA 3T40A 4JTKA 1PCWA 4JYDA 1TPUA
chains in the Genus database with same CATH superfamily
4JEJA 3FV9A 4X2RA 3TSDA 4HMEA 4QITA 7A3HA 1W9PA 4Z1YA 1XLKA 4DUWA 3UWZA 1LWIA 4X3ZA 3PSWA 4MWAE 5H8UA 1QNQA 5GQBA 1PE1A 5H8PA 5F2MA 3CUZA 2J7GA 3NM3A 1US2A 9RUBA 1D8CA 1CBGA 1TPVA 3WFZA 3CUIA 4JHOA 5BXSA 3PTKA 1V0LA 2GVEA 2VFHA 2XIBA 1PVNA 3KWXA 4UOJA 1D7FA 1O5QA 3VGGA 1JYVA 4WEVX 2FZMA 3UXLA 3W7RA 1UOZA 3ABRA 4EWND 2X2YA 2PDYA 3WQEA 3DERA 2FKPA 2WLZA 2OZ8A 4NP7A 3P5ZA 4GZ7A 1FWSA 2P5NA 1TE6A 4EWJA 2FTWA 2GGEA 4A8LA 4IQEA 1UC4A 2C0AA 4H7ZA 4J3VA 4MUZA 5I3FA 5IOBA 3MJMA 4W85A 5I3HA 1DJNA 1CTNA 2AQWA 3BPWA 4ZXOA 5BXPA 3CAQA 2VRKA 3E9AA 3U3HA 3I4EA 3LBCA 5E9XA 1FOBA 3S2LA 1E4LA 1DJGA 1NWUA 4DPPA 3WF2A 5D2WA 2HRWA 1A5KC 4JTAA 4N7QA 2OSWA 3W2KA 4ZO6A 4S3FA 2VC7A 3DBNA 4UR7A 5I5RA 1OFEA 2XWEA 5AC4A 3OQEA 4HSOA 4ZB2A 4DELA 5ABFA 2YCLB 3NQ6A 1VPXA 5BNKA 1E70M 1JGIA 2YXXA 1Q8JA 3WNMA 4IXHA 4ZQCA 3IRSA 2OELA 1KBLA 2ZXAA 1X6LA 4IPLA 4HA3A 1GVOA 3VILA 4E8CA 1ZALA 5MKGB 3T2QA 4HYWA 4J27A 3VOFA 1J93A 4EACA 2GVLA 3GIYA 4FX8A 2O9OA 2PF8A 1TUXA 1CB7B 2JKEA 1R87A 2PDQA 3T8LA 1BTMA 4JIEA 4MKVA 4AY7A 4NHVA 4HNCA 5EYWA 5AY7A 2RDWA 2FDSA 1PDYA 3VC5A 3AWOA 3SCNA 4XWUA 1LUCB 3LMYA 2PWEA 3PBUA 3OG2A 4B15A 3C2OA 1QI0A 2Z1SA 4AZ7A 1T6MA 1OK4A 2QDGA 1BTCA 1JGMA 4LRSA 3MP4A 3MYPA 2VEGA 2EG7A 1GPWA 2TYSA 2XHYA 3S5YA 3VGFA 5A3HA 4UR9A 5D2XA 4QLKA 4NG3A 3HURA 3M43A 4UMAA 1JJKA 1VFSA 3ISIX 3C0QA 3GZ3A 5H1WA 4HPXA 4LUYA 2D0HA 1LYXA 1P0KA 4ZB5A 3ATZA 3I6RA 1EJWC 1EOKA 2F7FA 4OUEA 1P0BA 1Z6KA 2A3CA 2HCVA 3U2EA 4RXGA 1UZ1A 3I65A 1EO5A 2CIPA 3M5VA 1P7TA 3OLEA 1ZL1A 5JH2A 1LCOA 1UKTA 3Q94A 1XUZA 4DO7A 4DXXA 2GZXA 3SCTA 4DY1A 2Y89A 1R30A 1V3LA 2G3JA 3SCOA 2YZ5A 2OWCA 1EC8A 2MNRA 3SEPA 2WZIA 3ES8A 4WXYA 1WCGA 4R7OA 3LCIA 4QAWA 1AK5A 2BOFX 3FSUA 4ILSA 3V0TA 1TPWA 2PTWA 3B4UA 1ISZA 4DBDA 2ZA2A 3M64A 1FWWA 1QW7A 2DV0A 1SW3A 3HQ1A 2Y7GA 5I0DA 1FX6A 1ISVA 2BVTA 2OQHA 3BMWA 1O6IA 1EH9A 2YX0A 1IT0A 4K7YA 3NDZA 3QGVA 3NEHA 3MUCA 2D24A 3R0KA 3WEMA 5C54A 5G4HC 2WZHA 2BBFA 1Z48A 1BWVA 4FPSA 3O2LA 3GXIA 2O92A 3PPHA 3BAKA 3NO1A 1M68A 3QOKA 1BSLA 4H2CA 3W7OA 3BLKA 3BJSA 1F8MA 1EIXA 2PODA 1ME7A 1X97A 3SN0A 4NASA 5HDRA 1Z44A 3WNKA 1B0IA 4H01A 4UCGA 3M5XA 1R46A 3HIJA 4OBTA 1F5ZA 1PL9A 3F5LA 1GW1A 3FVDA 4DQWA 8RUCA 2P8BA 3ATYA 2E0PA 4NT0A 2W3ZA 4U28A 3T07A 4Z2LA 3NO3A 4IFKB 3SBFA 3G18A 1J5SA 3ARUA 1FH8A 4ZXLA 2YFOA 4BQ2A 4M1BA 2RGMA 3IEBA 1V0KA 3R4IA 1EGZA 1H51A 4Y8EA 1ZS2A 2YCKX 1PO9A 2FIQA 4FSAA 2J6XA 3CU2A 3NWRA 2H90A 2B7OA 4DZAA 3UG4A 1H1NA 3UYIA 3INPA 3C0LA 3E0FA 2A6NA 3PG8A 3CTTA 5TQLA 5I3GA 1H09A 3DGRA 1FH7A 1EWEA 1PKMA 1GWJA 1H62A 1YX1A 4GZIA 4JIIX 3WJXA 3RPMA 4GOAA 1UD4A 2HROA 4ALDA 5GNZA 4ADUA 4M7SA 1A0CA 3LGGA 4AWUA 3IGUA 1W3JA 2PDHA 2EF9A 2HNEA 2IKIA 4GK8A 4YTTA 5CG0A 1WXJA 2HS8A 1BYDA 2VFGA 1DWJM 4N4PA 2F2HA 1M65A 2VZSA 1NP2A 1O68A 4H8HA 3G1VA 3WLHA 2DP3A 1B3YA 3W84A 1QI3A 5JBDA 2Z0IA 3H2OA 3WQ4A 2AQOA 2WBKA 2F9RA 3DFPA 3VE7A 1E1CA 1WDQA 4DBWA 3V0SA 5HUOA 3N15A 3DC8A 4WX2A 5U4NA 2DZUA 4IQLA 4JHMA 5TD4A 4MZ8A 1R3QA 4IFKA 3M4HA 2YOCA 1I0BA 4UTWA 1XSKA 2WKLA 5CJNA 1Q8AA 5DF0A 3EPNA 2Y61A 1FWHC 1IT7A 4LBRA 4IPPA 3HMJG 7XIMA 1Q2RA 1OZMA 1MZRA 1X38A 3WJWA 5IRPA 2EJ1A 5GNYA 3GDBA 2VNCA 2YCLA 4B9YA 3WBAA 2OXNA 2G3IA 3R0DA 4V28A 3DI0A 4B16A 5C7VA 3VD4A 2HE8A 2XPKA 5CPOA 1NWRA 3PZ9A 4MNKA 4D6CA 4PEKA 5LIWX 2OX4A 2VEPA 5CPNA 2VDIA 2AMGA 1O5RA 3PN8A 3GAKA 4S3EA 4DUVA 1R3VA 4E0CA 5C9ZA 3Q2DA 1W5PA 2OWXA 3NQBA 4GGHA 1KLYA 2EHHA 1MXDA 1M1BA 4IIGA 3PB2A 5BMWA 2WMJA 2XWDA 1KGWA 2GJXB 1UD6A 3C2VA 3LI1A 4G7FA 1XLFA 4M6UA 1SZGA 3PF3A 1X6NA 4K68A 3IAPA 2FTYA 3CO4A 1L8NA 4CCCA 5BRPA 5D9PA 2ZUWA 2NV1A 3TYEA 3IUDA 4IJCA 4UFMA 4KEMA 4H1ZA 3VGHA 1VBJA 1XG3A 5BU9A 4WY0A 2UV8G 4H6KA 1EUAA 4H7CA 3VMNA 4MY8A 3FAWA 4W89A 1KWGA 3KVLA 4YTQA 1JZ6A 4DZHA 4WCJA 1GQLA 4JNZA 3VOGA 1N8WA 3UZ5A 3V1HA 3DDMA 2WHLA 2VEFA 4GNVA 5EMUA 4WOQA 4L4LA 1V6VA 5XIAA 4UQCA 3OG3A 2YDQA 1F3EA 2WCAA 2GJRA 3U7BA 4GUJA 4JFSA 2YB1A 3EWXA 5DXYA 3S9IA 1KM4A 4LBSA 4O28A 1EGVA 5AHFA 2X2GA 4ZOBA 2XH4A 3PZTA 3W7CA 4CEXC 3TMLA 2YCEA 4GVIA 1V7YA 3ITLA 4QCEA 1NDZA 4ACZB 3W75A 1NDVA 6CGTA 1JCYA 1W8GA 3IIVA 4I90A 2DW7A 1IEXA 1B57A 1HJXA 2XFFA 3TONA 3CT2A 2ZRWA 1WKYA 2AAMA 1R2TA 4XTDA 1JNEA 2QAFA 3QTGA 1A5LC 4PTDA 2TRSA 2WHMA 1US0A 3ICJA 2WM0A 4QJ5B 1V4YA 4V1XA 3EDDA 3BICA 4INFA 4JFWA 3QFEA 2Y0FA 4FA3A 5DLCA 2CITA 4JDYA 1A3XA 3LG3A 2DZTA 2Y6ZA 1JZ3A 1LF1A 1LWHA 4WUIA 3MCOA 4O10A 5L6UA 5FKYA 3T9PA 3UWYA 1BPLB 5F4WA 2YYTA 1FUYA 1GONA 2G5WA 3LU2A 5I2UA 4GQGA 3VCNA 1W2PA 3T0BA 1QNRA 3ES7A 1J11A 2POTA 1DE5A 3QHOA 3NYZA 2XVLA 1NVMA 2CHOA 4OECA 1RH9A 3AYVA 3LMZA 4X9SA 3TSMA 3FYPA 2CEQA 3NTYA 3SCRA 2JF6A 4CN4A 3AIQA 3DZ1A 2PAJA 4LW7A 1YNPA 4PMNA 4IH3A 4AQLA 2Z2AA 3EWYA 2XJ7A 2XIOA 3GTHA 2Y4SA 2GJXA 2WNNA 2Q01A 3W1PA 4D1JA 1VAHA 1LBMA 3WL0A 4AD1A 4ZMGA 1NDYA 1KFCA 3USZA 2E1DA 3PJWA 1HKKA 4GE8A 2PTXA 4RK8A 3SIZA 1LRQA 3DH7A 1ITUA 2RHGA 1FKXA 1F05A 2C15A 3N4EA 4HNLA 3T0AA 2OCZA 5EU9A 5EB8A 3QW3A 2DIJA 4LUSB 3BAYA 2E6YA 2NV2A 3LYEA 5F4SA 4KEZA 1CX9A 4DJDD 3KOWA 3EDKA 3VKCA 3CZLA 3PWGA 1XYAA 2QCGA 3MV01 4HMCA 3BUVA 4WKHA 3ZWSA 4WJ8A 1R7OA 1A80A 5ENLA 5LA2A 3F2CA 3N25A 1VBGA 3DOPA 3KBJA 3P67A 2QW5A 5BCAA 3VI2A 3DFSA 3KOYA 1UR4A 3GNOA 2NLYA 1KQZA 4ZTXA 1HGYA 5AC7A 3ARRA 1W17A 5GJPA 1FHVA 4UOZA 5E09A 3EWUA 4R33A 2B4GA 4P8UA 3LM3A 3V5FA 2NUYA 3C52A 3TFXA 3CHDA 5JIPA 4HHHA 4AYGA 3BZGA 4LBUA 1RJQA 1RVKA 1TPDA 4DJEC 1UOKA 1LOQA 2BX7A 4TTUA 1LQ2A 5CZSA 7REQB 3U5UA 4KWSA 4NI8A 1V51A 3AZSA 1FHDA 3CH9A 1H63A 3GYCA 2WJFA 4KKXA 1JIBA 2ABAA 3UZXA 1E55A 4FMVA 1HF6A 2WNWA 2ISVA 4QSFA 1NOUA 4OVXA 3UY8A 4PR4A 4RE0A 4LUTA 1J01A 5AC8A 3PAJA 3CIWA 3H2NA 4BF7A 4MYXA 4BKNA 2INFA 1J2WA 1MW3A 1TB3A 3S4TA 1HVQA 4NZFA 3BV4A 3ZJKA 3FX4A 3LXCA 1EPXA 4Y9PA 3LZ5A 5D9OA 1PIGA 3EWBX 5C9UA 1JZ4A 2X05A 2W27A 2VX5A 4LS2A 1EQCA 1Q6CA 2P88A 2RKXA 2FPTA 2YBUA 1L2QA 3E38A 1XLAA 2V2HA 2IMRA 3NSXA 1P7TB 5LYRA 3TCSA 4QISA 1W3NA 3G3MA 3C2FA 3K8LA 3WH5A 1EUNA 3R8HA 7PTDA 1XCWA 2AAAA 4L9ZA 6ENLA 4PCTA 2FMOA 1A5UA 4LQ1A 4IFOA 4D8AA 4PTXA 1CW2A 5AYIA 1W31A 1C8QA 5AZ1A 3WK2A 1EA9C 3W1AA 2W79A 4I7UA 5K4XA 3N12A 2DZSA 2D23A 4IISA 3N9RA 1Q7MA 3O0KA 3TOYA 3UZZA 4TTGA 4F2TA 3DYOA 3J7HA 2ZC1A 4NZ1A 2W0UA 4AAJA 1W5NA 4NZ5A 2VFFA 1JCXA 4MZYA 4NY2A 1B4KA 4ML4A 3OYZA 4MG4A 3QY8A 1SJCA 4GY0A 3DHUA 3R7MA 3H2EA 2HMCA 2V9DA 4O52A 3FJNA 3OVGA 5D05A 1UJQA 1TTQA 3IIPA 4PUDA 3RM9A 5D37A 4W8AA 4WJEA 3B8VA 1SFTA 2GJPA 3N4AA 3T81A 4NQ1A 1U5HA 1EP2A 3VNLA 1JZ5A 3OYXA 4RLIA 1Y5XA 3GZAA 1CGXA 1DJIA 3H22A 4NNBA 3HQOA 3MMDA 2V8ZA 3M16A 1J9YA 2QJJA 1WZLA 2RDUA 3VIIA 1F61A 4QQUA 4N6FA 4PUEA 1XFBA 3B8DA 2Y8VA 2OYKA 2YKKA 5BOOA 5KZDA 1Z69A 6TIMA 4C1LA 3WSUA 1LWJA 2X40A 1HN1A 3TFCA 4H3DA 2DUXA 1MEIA 2J6VA 2HJPA 4TVUA 1W3HA 3POHA 4FB7A 1K9DA 4HTYA 2OLSA 5A2AA 4URIA 4KFNA 4AIOA 2D1ZA 1V03A 4Q4PA 5DY3A 3VDBA 1NELA 2HNHA 3CAVA 2BTMA 4D72A 3FAXA 2FH8A 3LUTA 4MAZA 5IDZA 3SM0A 2CHRA 5HR6A 1W32A 4PCNA 4R9OA 1SFSA 4B90A 1GVIA 3ZO9A 3W73A 4UTUA 4ORMA 5ABTA 3N3MA 5H2ZA 2WPGA 2ZUSA 4PUNA 3I10A 3C61A 1ZJAA 3WLNA 5A6SA 4I5XA 1TKKA 4JN8A 3A23A 5GJNA 4O1FA 4GXWA 5DCBA 1SO3A 1D7KA 3MI6A 2J79A 3EWZA 3WLOA 5HJYA 2VX6A 1I9CB 3Q4DA 2VXNA 1J12A 3WF4A 1PB0A 2V38A 3REQB 3FFSA 5D30A 2B31A 3N2CA 1LJYA 4OE7A 2F8QA 3UR7A 5J5RA 3GDKA 1RPXA 4Q4SA 3V5OA 3LTPA 2R94A 4Q3MA 1TE1A 3H4GA 4GYPC 1J0HA 2DJXA 3UWVA 4AF0B 1VIWA 1XBXA 2Z1KA 8XIAA 3JS3A 1VLWA 3MKKA 3M07A 2VQUA 5IFPA 1YQ2A 7REQA 2XTKA 1A53A 2A5HA 2IW0A 1RCXB 4FO4A 3MUIA 1O5XA 4J3SA 4E8GA 4IIBA 1SJAA 3LTSA 5FJJA 3BURA 1VFUA 5FEPA 2UBPC 2NT0A 5AVHA 2AKZA 1C29A 1TV2A 4XAFA 3CLWA 1BG9A 1BGAA 1IGSA 4H41A 1KXQA 3G1XA 3GNXA 5HATA 3F4DA 1FDZA 1T96A 2W66A 1XPYA 2Y1HA 4HCLA 2ALRA 3QBUA 2CZEA 3IK2A 2FPYA 3G22A 1I1WA 4Z2HA 5CGMA 1SW7A 4XUGA 3K8MA 4KQNA 4IPJA 5I00A 1BWLA 4ES4A 3W7PA 3A22A 4MMWA 1B3OA 1DJZA 3E0LA 1VR6A 4FK9A 4DM2A 1UMLA 1AFSA 4KH2A 3IV8A 1TV3A 3NPWA 5AYBA 4DAFA 3S9YA 1ONRA 4LC6A 1YDNA 6XIMA 3OBKA 1E9LA 1PAMA 4HZ7A 4AWEA 4GBUA 2XZ7A 4HNTA 3DI1A 3WK0A 4JX4A 1SMAA 3H4WA 2QGHA 4FI4A 4ENLA 4NYUA 1UG6A 2HE5A 4NYYA 1W1IE 3NL3A 5HNUA 2BY1A 5HWJA 5F7UA 1KTCA 1JDEA 3C2YA 2Q3RA 4F9JA 1VEPA 1RK6A 2WWDA 2QUUA 2XYLA 3VUPA 3DFOA 3CQHA 3QC0A 3EOEA 4OQVA 3T0CA 1V0NA 2EAWA 3DXIA 5FOOA 4GMEA 4I6KA 3N6HA 3S83A 3CPRA 1FWCC 3FJ6A 4P8VA 4Q32A 3MO7A 1O4UA 1CGTA 1RBOB 2DIKA 1A49A 1PS9A 2C91A 3VKKA 1EJRC 4ZQNA 4DJFC 1UIOA 1KXHA 2X1TA 4MLRA 2GJNA 1POJA 5FACA 1QNPA 1GT8A 2A3AA 1CEOA 2P50A 3MCMA 1IWAA 1GEHA 4M3PA 3PPCA 3TJXA 4GI6A 5GPRA 4I9JA 1W1TA 2CLKA 1D2KA 3DGBA 5A6TC 4RDYA 1OYAA 1VPQA 1ZAIA 1KA9F 3BANA 5C2CA 1WAWA 1WUEA 3WLPA 4A21A 3UWQA 1EKOA 3SSZA 3FW6A 2QQ6A 1UJPA 3K1GA 2WHKA 1XYFA 1XLEA 4J40A 3GHRA 5KITA 3KOZA 4C5YA 2WSYA 1NOFA 1OEPA 2NUXA 3WH6A 2TSYA 4R3UA 3PTMA 1JYNA 1I60A 1FHLA 3KWSA 2DEPA 4LANA 5JXQA 1ZHAA 3PWIA 3TYCA 3K2GA 2YBTA 4GO9A 3QFWA 3Q58A 4QM1A 3MVTA 3V18A 1DV7A 5FF7A 4AEEA 4NILA 3GU2A 4CNOA 3W37A 1EJUC 3ZMRA 3NSMA 2DORA 4WLCA 4WXZA 5AHIA 2PLCA 3UFYA 1BXBA 4UWMA 3R89A 5CBBA 2DSKA 4C6PA 4YCOA 4HHMA 1G6CA 3RG6A 4CQBA 3KTCA 3WELA 1RQHA 1GVQA 1LT8A 4UNLA 2PWDA 3AYTA 2GVYA 1B31A 3E2RA 1ZTVA 4RE4A 2Y5SA 4FF7A 5FAJA 3QLLA 3MSRA 2W92A 2GLKA 1WKFA 3IANA 4PUKA 4LYPA 2OZTA 3KS5A 1GOMA 2E5BA 5E6YA 3KBWA 1SM9A 4H6EA 5I06A 1AW2A 2PE4A 4DF2A 5M1TA 3AICA 2XGBA 1OK6A 3PAOA 2DGAA 3KS6A 3VX1A 3EPOA 4AC1X 4ZO7A 4RV3A 3QH2A 1OGSA 5FCZA 1JNDA 5LNUA 1TPB1 4WDWA 3AIVA 3VPLA 2PSNA 3ZLGA 1SR9A 2A0NA 1S2AA 1UW9A 4Y96A 1QPRA 4HYVA 3LTYA 3SUSA 4JTJA 4L61A 5D4YA 2XFYA 4MADA 3NQ8A 4KBXA 1DJQA 4WJXA 4J28A 4WDTA 1FWBC 2XVPA 3LBMA 1OVDA 1OZQA 4RE3A 2PDPA 3N6QA 4TR9A 1MQQA 3BLPX 1VCVA 2E5CA 5AVNA 1JZ7A 4GIAA 3EKGA 4NI3A 3BGAA 1HTIA 1AL7A 1KCXA 4HPGA 3O63A 1XBZA 1HFBA 4ZOAA 1KM5A 1PTGA 3EA1A 3BW2A 1VBUA 3IUHA 4XKMA 3LXBA 1GVSA 4J3UA 1ZB5A 4BR1A 4LB3A 4W5UA 4RPPA 8TIMA 3UWUA 2OTDA 1SVDA 3DECA 4AY8A 2Y85A 2BDQA 2PWHA 5JQ9A 1QO5A 3ITGA 2R91A 3ITOA 4KRUA 2Q3OA 3LSBA 1E6PA 4F40A 1E0WA 4P7NA 4MOZA 2JALA 3PZMA 2RAGA 3KVMA 5IDIA 3G0SA 4O18A 1XG4A 1F6PA 3W24A 3VK5A 1ZP4A 3GXFA 4FP1A 3VDAA 1H7NA 3VMPA 2VR5A 3AOFA 1TREA 2ZICA 4HKPA 1NY1A 4TUFA 4L4PA 4JQ2A 1JL8A 2BASA 3UESA 4DJDC 3JUGA 3HU7A 2VGBA 2XH2A 2YGYA 2ZXBA 4IICA 3L2LA 1WA3A 2FHBA 3MZ2A 5A8OA 4GG9A 3O6YX 3USBA 2EKGA 3FKKA 5E0FA 2BGNE 2WO5A 2PU1A 4YHGA 3MMWA 1B3ZA 1XH2A 3S5SA 1REQA 4GYJA 5BRBA 1KRAC 3R79A 3GVGA 1G4SA 3QEZA 3BO9A 4XVEA 2J25A 3BAWA 2A1YA 5EMKA 1FFQA 1UR1A 3VFCA 2GGJA 4QS6A 4EE9A 3KE0A 3STGA 4DYKA 4G9PA 3P8JA 3CQJA 4TXEA 2OO6A 9XIAA 1EL3A 2DZVA 5C2XA 1G1YA 2ZUVA 1JDCA 3HFTA 2PDLA 1YADA 4TV6A 3TTOA 4LY8A 4ACYA 1UP2A 3CQIA 3MB9A 3UCCA 4PB5A 3NEVA 3ZT6A 3CB8A 1E4MM 1K6AA 3R43A 3TR2A 4YYFA 2CYGA 2GSEA 4J5NA 5AYYA 5AZ0A 3PY2A 4US5A 5DBTA 1QPOA 4PA8A 3F4CA 3ARZA 3GNPA 4A2SA 1NF0A 4Z0SA 5KZEA 2XFWA 1A5CA 3RU8X 4JTKA 2J7HA 1PCWA 4JYDA 4LCQA 3GFYA 4UZSA 4JTEA 4JN7A 4O8RA 5D32A 4H8UA 1IEVA 1ZGDA 3B0VC 1WDDA 5I3KA 5LNSA 4JS3A 3BW3A 3N73A 4YVVA 2Z1XA 5DEZA 2ABBA 1VEOA 4PMOA 2O9TA 3ABQA 4R34A 3M0ZA 3ELFA 4GABA 1EDQA 2HEJA 4HSNA 4HNNA 3A47A 2BXYA 3OVQA 3NQGA 1RA5A 2C16A 3TA6A 1SGJA 5LNWA 3DESA 4NAFA 3MS8A 3GVWA 3VM7A 1EP1A 2VGFA 4UNKA 6TAAA 1QJWA 3I7RA 4L80A 3B0UX 3K13A 3SUVA 4KETA 2QULA 3AAMA 4HN4A 4NZJA 4AVOA 5HK4A 3MKCA 5B7ZA 1RLDA 2A2IA 1WDRA 4C5ZA 2PTDA 3GW3A 5K7JA 4EAMA 3LLXA 3K46A 2PA6A 3RDKA 3ID7A 2ATMA 5AKQA 2PFHA 3WNOA 1Q13A 1Q4WA 4CNNA 5AHMA 1HG3A 1GGOA 1DE6A 1QUMA 3KZPA 2HXUA 4XD4A 1REQB 3NOEA 2D69A 1ICQA 1PV8A 1W1PA 2VR4A 2GOKA 3EMZA 2Z25A 1UASA 3O16A 4I9TA 1RJRA 3TJ4A 2V5LA 1UROA 3W6YA 4QGCA 1SZFA 4BY3A 2DH2A 2A7NA 4JIRA 1CGVA 1OFAA 1K7EA 3EBVA 5EMJA 4HNUA 3RNDA 1UZHA 5KSWA 1OCBA 3MC5A 2ZRUA 3QYQA 1QU4A 3QRHA 2FGZA 1BKHA 9CGTA 2WC4A 1UR2A 4Y6GA 1C7TA 2J78A 4B5NA 1OG0A 4E2OA 5IFTA 2BS9A 3QV8A 3PPGA 1B2YA 1VYPX 4UFKA 2GFTA 1P0EA 4E3VA 4XBKA 3I3DA 1FBAA 3N2BA 3AO0A 4IIFA 3HZ3A 3ABXA 1D8WA 3C3UA 4WKFA 1WX0A 4FX6M 4BK9A 4GFIA 4UQDA 3A9BA 2HQAA 3IGXA 6REQB 3OVPA 3AIRA 3IJ6A 3RX3A 1L2UA 1YXDA 4GVFA 3L0NA 2HSAA 1E72M 3AZRA 2A3BA 1Q6GA 2VL4A 2WVVA 4LS0A 1K7FA 1J6OA 3QSTA 2XVKA 3R94A 4F8XA 1V6UA 2GSHA 1GUVA 2Y88A 5MF5A 3CH0A 1T8QA 3MTWA 3QY6A 1E1FA 4H83A 1S5MA 5C5YA 3QN3A 3VDCA 1LLWA 1UBPC 4AZ5A 2Q71A 1C9WA 4PCFA 1UPMB 1LL7A 1AA1B 1RSCA 1VFHA 4J1OA 2NX3A 2EEXA 3W0KA 1PHQA 1ZCOA 3M0JA 4HVXA 3U4AA 1MXSA 3AMLA 1DQXA 4LYRA 4RJEA 3CIVA 1UD5A 5DX7A 2B81A 1SZEA 3PBYA 3AYRA 3T42A 4XAPA 1VBHA 4Z1DA 1KQYA 2OEMA 1A47A 3AFBA 5CLTA 1FWNA 2E7FA 2PDBA 1R9YA 4IX0A 1JPIA 1XV8A 2PBGA 2DIEA 2VEKA 1CT5A 2X30A 3TW6A 2XH7A 3ZR5A 1OM0A 1OC7A 2Y24A 5D2VA 2QNEA 1WBJA 4F0KA 5IHSA 1OD8A 1TPC1 4S23A 4EAYA 4MFDA 2BHYA 3MA8A 2OPJA 5H91A 3TYBA 3R10A 4FXSA 1QNVA 4GX9A 4F79A 3DCPA 4IL0A 1KR1A 4DX3A 3CPUA 2WLYA 5IHRA 1TPEA 3KHJA 3PM6A 4AMCA 4ZE4A 3WQPA 2GVGA 4L7ZA 1BLIA 1FDYA 1NFGA 2NQ5A 4QLJA 2V67A 3UCDA 4NJGA 1RLCL 1ITXA 4GYPA 3QKEA 4HPJA 2NV9A 3EA3A 3W07A 4AIBA 2Z1BA 2XIJA 4XBJA 4IFRA 2E67A 2AMXA 1ZFJA 3HJEA 2X16A 4IPIA 3GDLA 3O6CA 5CCZA 3NQDA 3SZ8A 5A69A 3RYSA 2XN1A 1DEDA 1XLIA 2R8WA 4W5ZA 3TV8A 3C2EA 1TYGA 2DFAA 4IMGA 3EX3A 3SCQA 3DFHA 2D3LA 4V1YA 1EB3A 3EX4A 3AHVA 5DELA 4POCA 3H54A 1RUSA 3RILA 4P61A 2PUZA 6REQA 2C13A 3H7UA 1E1CB 3BK0A 3RJXA 1QT1A 5EMYA 4IHCA 2Z1VA 3NQ7A 3SGZA 3LN3A 1TZ7A 1VQTA 1ALDA 2GOUA 2XUCA 3A9IA 3Q67A 2CLHA 4O1CA 1YMYA 4LPCA 4RZBA 1E5NA 2Z4GA 4L64A 4X22A 3TWAA 2F61A 3IJ8A 3S1XA 4NZ3A 4RNHA 1BKSA 4CQ9A 4RX0A 4GXMA 3PZOA 3ARPA 1L6GA 4XZLX 1KRMA 1XLLA 4HB7A 2E25A 1HT6A 4GUFA 2CXGA 5IBXC 4IT1A 5D2TA 2QPXA 4GX8A 4MPKA 3EWDA 3ARXA 3NQAA 2ZX7A 1XSJA 1C8XA 5REQB 2QCNA 3SRKA 1H1ZA 3RM8A 1H5YA 1W2VA 3H2CA 1FCQA 1Q6OA 1JYXA 1PXGA 5HMDA 3GC4A 3NQEA 1VEMA 3R11A 3F5KA 2CZDA 4JOMA 4B5UA 4YL2A 4IP7A 3GLCA 1VCGA 2REQA 2C1HA 4LAOA 1FWGC 4WR3A 4D6EA 3QC3A 4K1WA 1GTHA 2VVNA 2D73A 4MHBA 3W27A 4AEFA 1AQMA 1HZYA 2E6FA 2VENA 4F2UA 3UYCA 3W2UA 1S3HA 4M5PA 1S5TA 4PULA 1EZWA 3LV5A 4FOKA 3S5ZA 4ATLA 3ONBA 2Z00A 3GC2A 2QVNA 3U57A 4DUOA 3FJLA 1ISXA 2V63A 1DWFM 3RXZA 3GIPA 1Q6LA 1TMLA 3HOJA 4NIRA 5XINA 4MB3A 2DVTA 4XSMA 2WZTA 3QHNA 3BVJA 2J88A 1PKNA 4J4KA 2PLJA 1TA3B 3MBFA 4QS5A 4PMRA 1T40A 1KRCC 1SUXA 1BG4A 2BVYA 2DZBA 2CBJA 4Q8QA 2DT1A 2INZA 3W81A 1OCJA 1ITQA 1XIMA 5U7SA 4K36A 3URNA 4ZTYA 3HG5A 3U2OA 4P7QA 3W1TA 1ESWA 1EX5A 3L65A 3A4WA 2INEA 4FX7A 3EZ4A 5HJLA 2XN0A 1DKWA 4C6FA 1D3CA 2XISA 3TUUA 1V3HA 1U5VA 4JCMA 3LRLA 3G0UA 4M6QA 3OHIA 3WUEA 4OFCA 5LKYA 4S2CA 4EKJA 2X1IA 1W1ZA 1A5OC 2SFPA 3THUA 3CL8A 1XC6A 3DHDA 1MDLA 1IF2A 3P82A 5CEWA 4UNIA 1EYEA 2V2CA 5CGQA 4PMJA 5HMEA 2A3EA 1UZDA 3E2VA 3EX1A 3PC0A 1W54A 2WBGA 2POZA 1TJPA 1B3XA 3WD1A 2VOMA 2J75A 4TQTA 3WLMA 2ANUA 1Y5WA 5EL1A 2XDFA 1B30A 1Q6EA 1NOWA 3CBWA 4HP5A 1VS1A 3WBYA 2OGYA 3AMDA 1OIMA 5FJOA 1PZ2A 3A4JA 4V33A 3RHGA 3D5HA 2PDKA 3KP1A 2QUMA 4JR5A 2CU0A 4EF9A 4JY9A 1BWKA 1FCVA 2YCIX 1W5OA 1O95A 1O60A 4XUYA 3GR4A 3CZJA 4IPNB 3SRHA 2DJLA 3CYVA 1HL9A 3WLQA 4W87A 1TTIA 1AW5A 4H9VA 4Q6XA 1FWRA 3L4XA 1F6KA 1S46A 4LVGA 4AWTA 4R7JA 5E0KA 3ZJ6A 1YIXA 2J77A 2CLFA 3IUIA 3ABZA 4NZCA 2QLYA 2BG5A 2BOEX 2CNCA 4GH3A 1XIEA 1V6XA 4O0ZA 3NZGA 3UW6A 1JQXA 3B8IA 3UJSA 3LZ3A 3TN3A 4AEOA 1HJQA 1A5SA 1K3UA 1KTNA 3HPZA 5E5CA 4PUJA 1UPPA 4CGTA 1G5AA 1DIDA 1MI3A 2GYIA 1QWGA 1VYRA 3M6DA 4P2VA 1F3TA 3B9NA 4GIYA 3PUOA 1OC6A 3ZYZA 2PDMA 3M9YA 1HO1A 3BG9A 4FAMA 2ZFAA 3AQUA 3VIFA 1VPYA 1QK0A 4NAFB 3SIMA 2IQDA 3UJFA 3BOFA 4B91A 3AS0A 3B04A 4HU0A 2ACQA 1WBHA 1XGDA 2OT1A 2WHJA 2A21A 4JBRA 2ZXDA 1HIZA 3ZSSA 3UPWA 3HF3A 2VP8A 3S0CA 3FEMA 3LRKA 4XZ9A 3QZEA 1VCFA 1KFKA 4RZ5A 4U3AA 4H19A 1TPH1 2J4GA 4PMVA 3T8QA 3EDJA 1EDTA 1LBLA 4PFMA 2D2HA 3KLKA 2RDXA 4DWSD 1S5VA 2R82A 3CHFA 3P74A 5I09A 4V2XA 3M6YA 1HW6A 3P0WA 1IZCA 3ANUA 2CZ5A 3YPIA 2QV4A 3DFQA 1YYAA 1J6PA 2O56A 3PNUA 3RX4A 4K3ZA 3S6TA 3B97A 3IIXA 4E2BA 5A2CA 1Q7ZA 3KBVA 3H70A 2OFJA 3IARA 2ZX9A 2ZE3A 2Q09A 3TTSA 3MP5A 1UWQA 2WZEA 1JDFA 2EGZA 4NNAA 3E96A 1W8SA 4BHYA 3DFYA 2PI6A 4TIMA 3WNNA 4A2RA 2FFCA 2PWUA 4QNEA 3B3DA 4QTGA 5K3VA 4MJZA 1M01A 1V6YA 1XC4A 2JE8A 3SURA 3OBAA 4ATDA 1QOXA 1ITCA 1WNOA 3QGAC 3HV9A 3D6NA 4GACA 4L65A 1S2VA 4JXCA 4FR6A 3LPOA 2G4FA 4H8NA 1EF3A 4LUIA 1EBGA 1V6WA 2W6RA 3NCOA 3T2OA 1XLHA 3WH7A 4LNYA 3AXIA 3UXKA 5M5DA 4QQ3A 3FYOA 5CH9A 4C6QA 3M44A 4E2DA 1WOBA 1PCKA 2G8ZA 3FJ4A 3WQ5A 3MHUA 4I8YA 3I3BA 1OT2A 1W3LA 2E6AA 4D6FA 1JPKA 4YTSA 2DVUA 2CKSA 5FF2A 4QDPA 3DKJA 3CWNA 4QP0A 4XAGA 2A7RA 4IUOA 4XSLA 3SCSA 2PCEA 3KUMA 1MEWA 1A4LA 3UU0A 4HHLA 4REQB 1KM0A 3GTNA 4CEUC 3WLLA 3WFAA 2XIMA 1CGWA 4ICMA 1J10A 4U5KA 2ZX5A 3SGUA 4YVPA 5FJUA 3BAJA 4BF5A 4RR4A 1QHPA 3WDQA 1TPFA 4B3ZA 3IVSA 4QNWA 2WMGA 3ENLA 1TQXA 1XKYA 3EDFA 1H2JA 2FMNA 3TW9A 2QF8A 3WH9A 1EGMA 4QIUA 4DXVA 1XIBA 2VOTA 5T91A 2DQWA 1OIFA 5I23A 4AU0A 3BLOA 1G7VA 4E4FA 1OFBA 3OQ8A 1FWDC 1ZBVA 2DW6A 1ENUA 1CCWB 1LZOA 5G2HA 4JQ4A 4OKDA 3CUHA 1RVGA 1XF0A 1DTUA 4XTIA 3IV3A 1KFWA 4GFSA 4M29A 3VUSA 5M3WA 3B40A 2W62A 1L6YA 4DN1A 3TU9A 1NDWA 3ZZ1A 4FZIA 3TVAA 1LRTA 2OODA 2IKHA 1JDAA 4Z1BA 4W84A 3WY1A 2X7VA 1YHTA 2ZCGA 3MU7A 4W4QA 3KZSA 1CYGA 1R3WA 3SUTA 2VFDA 1GNXA 1ADDA 1K8YA 3APGA 2CLOA 3RLGA 1VJZA 5A6AA 1Q45A 4GY1A 4L1GA 1LM1A 1G4EA 3AXMA 3PBGA 1UKOA 1VBRA 4RNIA 1ZRQA 3CV1A 5D8WA 3MSGA 4RL3A 3NO5A 1VJIA 3UT0A 1A0EA 2ON3A 3GHTA 3TH6A 3BGJA 4PTVA 2V81A 1IEWA 4XO7A 1GYLA 1OFQA 2J9YA 4XAYA 5FL0A 3EX2A 3WDRA 1QATA 4UUIA 4AG0A 4E2VA 3VNJA 4UMCA 4AHPA 1SFLA 4HMNA 1DWAM 4NJHA 4PUMA 3E49A 3EB4A 3VTRA 3ZT5A 3WMLA 3IVUA 1T7LA 3TW7A 3VIMA 1P43A 3HPFA 3MMTA 4PB4A 3MUZ1 2QHAA 2ZUUA 1U2YA 1IEIA 4S39A 1Q5MA 5K9DA 3D46A 1ME8A 1X98A 3W28A 3W7EA 4MNMA 5E1QA 4UTMA 4FNQA 4IJBA 1FRBA 3LGDA 4MAVA 4QRNA 3IJ7A 4QE1A 1XRFA 1DXIA 2ZTKA 1QR7A 1XLJA 3M0YA 3AIBA 1QNOA 1WP6A 3KVKA 3HB9A 4M1RA 4LCSA 3F1QA 5A8QA 1AVAA 1LDCA 4K6AA 2J62A 1FHUA 1N8FA 3GIQA 1YPXA 2O4MA 3WD2A 3GUGA 4PEEA 1BYBA 4R85A 4RW3A 5CC3A 5REQA 1WXYA 2YFNA 4U2YA 3AMKA 2BXZA 3LA4A 5FESA 4QLLA 2IUZA 1TA3A 2Y8UA 5EBUA 3LGEA 1JXJA 3GDMA 1XQLA 4PMUA 1JCNA 2FHFA 2OG9A 3DN5A 4BZYA 1OFOA 2WOQA 4BQ5A 1CENA 2OR2A 4HZ6A 8XIMA 3GO2A 2CCRA 4OOZA 1GJWA 2PDGA 3CMJA 3W7DA 1PX4A 5CGTA 4Q8UA 3TDFA 2V82A 1H4PA 2O9RA 3WK3A 3ALGA 3E0WA 5CPMA 3WQGA 2I5GA 5JBFA 2CXEA 1TCMA 2CBUA 3DENA 3EMCA 3AC0A 3HMCA 4HK5A 4XIAA 5HXMA 2PBOA 1GK8A 1E0TA 4JL1A 3N17A 4X60A 5CXPA 5CSYA 4MUPA 4R9XA 4ZQRA 1TTPA 1AUSL 2CHNA 4WKAA 3SFWA 3IS4A 3GS6A 5LHEA 1OB0A 2WQPA 2YR1A 1M7OA 4AYSA 1BD0A 3ONCA 4GXPA 2PGFA 3CAWA 2W63A 4GKLA 4GY7A 3VGDA 1H49A 4U33A 1OT1A 2XINA 5T26A 3GY1A 4IQDA 1IGWA 1Q7QA 3VNYA 2CBIA 1NF7A 1UH2A 1RY0A 4U2ZA 1NAL1 3A24A 2ISWA 4DAIA 3GC5A 1TIWA 3WD0A 4GA8A 4L5ZA 4QSHA 3NPUA 1EJTC 2PRLA 2AOSA 3AALA 2CLMA 3APTA 2PD5A 1KM2A 3FYYA 1EJSC 1I2NA 3JVAA 3L5AA 2D22A 3CPGA 3OLGA 3TTEA 1FXPA 2QCHA 4E6MA 1WAUA 5LA0A 1QPNA 4YU1A 5A6KA 2E6DA 1Z8AA 5AB3A 4YXGA 1J0IA 1F4HA 2J7BA 3G24A 4MM1A 4I7WA 3UVAA 2D20A 2GQ3A 2QF7A 4HSHA 4PB3A 5M17A 3UJRA 2QCDA 4ZCWA 3VM5A 1O1HA 3RO8A 1NQKA 4O19A 3P0XA 5TF0A 4ICNA 3W7IA 3XISA 4OIFA 4KWUA 4UXDA 3GVVA 1FCBA 1EA0A 3FIGA 3VDGA 4PSRA 3O05A 4HBKA 5DBUA 4GRSA 3FKRA 3O8AA 2GK1B 1UZ4A 1PEZA 5FF4A 2PDUA 1MNSA 4NRRA 2QMKA 3WUGA 1UP3A 4P5UA 1CZ1A 1YEYA 3CUFA 3R12A 1OFPA 2PS2A 4WHBA 3GU1A 3ORWA 1JULA 1MXGA 2YL9A 2WVVB 1TUFA 3DX5A 5A6BA 2E9BA 4LVFA 5CSRA 3M0XA 4HOZA 3N1AA 1KFBA 3QLDA 4TX6A 2ZC8A 4E4UA 3UGRA 4ZODA 1DQWA 2ATSA 4AZ6A 3FXYA 3ZOAA 1IR1A 1VC4A 1XDMA 3HQPA 3SCWA 4R88A 1XQKA 1KB3A 2QJIA 4LEFA 4Q8MA 1XR2A 2DH3A 3DUGA 3T44A 1CXHA 1O66A 5D09A 1YE6A 5C6MA 4BI6A 5G2WA 1W1B1 1V02A 3LPFA 3SO7A 1QW9A 1UA7A 5LGZA 2QJHA 3CB3A 2OYLA 4BQ3A 3GM8A 2NSXA 1NIUA 3LHTA 1U5JA 4CQDA 1OBAA 2PTZA 1KFEA 3GBDA 4C6OA 2VD9A 2VC9A 4RV8A 3STCA 5BROA 1BYCA 1BXNA 1W3KA 5LXXA 1F73A 4UTHA 1FP9A 1H41A 3WLTA 2WMHA 2QJGA 4CVWA 3NGFA 4D1IA 4HPHA 1FY6A 3QR1A 3EWWA 1JPHA 4ROQA 3G2GA 2QCLA 2DQXA 3ARWA 3NQ2A 4JHZA 4ERIA 3TAOA 3ITCA 1Q85A 1SW0A 2DT2A 3CYJA 5A95A 2CETA 1W9XA 4Y90A 2NQJA 4ZB0A 2NVCA 3W2LA 4M81A 2QUTA 1XXXA 3T55A 4ORIA 1GZJA 1N2VA 3NXFA 3C2RA 5I24A 3O15A 3JZEA 3WQFA 4EK7A 3G1DA 3TA9A 5I7GA 1F3XA 2O0TA 4YYCA 3U2ZA 1CNVA 1QCWA 3M1ZA 5BOEA 4UCFA 2X0HA 3EOSA 3O7UA 4PH6A 2Z2BA 1R5YA 4AB4A 1M04A 2TAAA 2ZUTA 1GPFA 2EO7A 4DPQA 5ABHA 5I07A 3OB8A 3FHQA 2ISDA 3M46A 2BXVA 1GKQA 4LTSA 2ZRXA 5A6JA 2X7WA 2VD8A 4YVXA 4WK9A 3G1AA 1G01A 3P60A 3GYEA 1H7PA 2PDIA 4XX6A 2OLHA 2VRJA 3KLLA 4PZVA 3M47A 3W3OA 1KV5A 4ZR8A 3UETA 1C8VA 1VJSA 2WJDA 1E15A 4JKLA 1P5BA 1C92A 2QDEA 4W9TA 2O4QA 2FLIA 3NVDA 4KWWA 5KZMA 2ZYFA 1NEYA 3C86A 4DWSA 4RDZA 4GVHA 4LF1A 5F2GA 3GXPA 1M3UA 1EYWA 1WO2A 5HUPA 2G3MA 2WSKA 4FXRA 3WF1A 3LCXA 4JTFA 4QDMA 2ZE0A 3ZR6A 2OSYA 3PWAA 5CC7A 4F0MA 3LD5A 2E77A 3KCLA 2V0TA 3LLDA 1CXIA 3N19B 4A29A 4MTVA 3C3NA 3LDVA 3TC7A 2IKJA 4H9ZA 4LFYA 1OGBA 4LGXA 5HAOA 3SQMA 2J8TA 3S6OA 4Q7IA 3A12A 4LX4A 3CEPA 3AISA 1HKIA 1O94A 3W1MA 4WQ6A 2V30A 1M7XA 1DXFA 1OCQA 4KCUA 4AY1A 4MB5A 2CW6A 2IXVA 3MY9A 3SR7A 1XBVA 1QNSA 4L6DA 1UQZA 3W25A 1PTDA 2JGQA 2C71A 1TVNA 3ITYA 1HJWA 3E02A 3S3GA 1E0VA 3W7HA 4PL2A 5JH1A 1P6CA 4NJIA 4XV0A 5J04A 1EXBA 4K1GA 4QG8A 5EKYA 4A35A 4REQA 3WK1A 2B7PA 3HFYA 4GI9A 1EHNA 2E1WA 4LJ3A 1EC7A 3W2NA 4UOQA 4BS0A 5KINA 3VC6A 1CGYA 2DZXA 2J9XA 2FZNA 3TOPA 4RZ4A 1A5BA 4XISA 3ERPA 3TZNA 1D3GA 1YDOA 4QEEA 4YTRA 3N9KA 1J4EA 4X9YA 3NAVA 4ZQMA 4YPJA 3EX6A 5XIMA 1OY0A 3QGKC 4Z42C 5D04C 5AC6A 2P3EA 4UIOA 2REQB 1RXOB 4WRHA 2J74A 1R8LA 3W6MA 4AF0A 3F7JA 5FJTA 2FVKA 4JZ5A 4JTRA 3PUDA 4N9DA 3DFTA 1YPFA 2VHLA 3NDYA 3TN4A 1XISA 3FNDA 3QSRA 5DMNA 4BFAA 3L2MA 3S8HA 4O1AA 2XVNA 1E40A 1JCTA 3WLRA 4A8RA 4Y9NA 3W1QA 3L7RA 3VDHA 3T0DA 3H2MA 2VYOA 4EXBA 4BI7A 2PDCA 3W02A 1OHLA 4B3LA 2CBVA 5AC5A 3GE7A 3KP0A 3MDWA 2ZZ7A 1JXKA 4DWDA 2WC3A 1IIHA 2IQTA 3TYUA 1P1MA 1OCNA 4IG2B 4FLRA 2NX1A 3E0IA 4LYKA 5A6MA 3GKFA 4OTKA 3KTXA 1YTEA 1E4NA 2I16A 5AECA 5E93A 5CLWA 4JAWA 3STPA 3RR4A 3M0MA 3S1VA 3SADA 4P7LA 1XI3A 1XYCA 3THAA 4K7VA 1XYMA 4OBSA 1E9YB 3D47A 3P5YA 3TROA 2GGHA 4GQ0A 5LNRA 4PMDA 5AOUA 1F2JA 3LNPA 3RLVA 1LL6A 2QDDA 4N42A 4PBFA 3S2MA 1BFNA 1PZ3A 1SJBA 1XD0A 1NARA 3LK6A 5EFDA 1XHGA 1SMDA 2HPMA 3TC6A 3CHCA 1OGGA 4XZIA 4ZSUA 1U83A 5HOSA 3LM7A 1V8EA 4Q8OA 3ZLFA 2A79A 1LG2A 1KBBA 3T4WA 1S5NA 4EANA 4NAEB 4BF9A 2DDXA 3UG8A 1GQNA 5DY2A 4QE5A 5A2BA 2NZLA 3LERA 4M6VA 3CWOX 1OWQA 4EP8C 4JYFA 5KZ6A 3U4FA 1G4TA 5JMUA 1LQ0A 2Q6ZA 1LP6A 3H21A 3BH4A 4UTJA 3GR7A 1AZ2A 4Q4QA 4ZO9A 2VCCA 3MDUA 4GHRA 5DQPA 2GSJA 2P76A 3QR3A 2Y5JA 4PYSA 1V3KA 3UWEA 3S1WA 1KBKA 1XDLA 3OLIA 4MB4A 3MSDA 1C9DA 1KM3A 1UD2A 3R2GA 3NR0A 2EPLX 1FVPA 2DU2A 3K8KA 1P6BA 4ROPA 2YXOA 4M56A 3L5LA 3B8TA 4UBPC 4ZQPA 3BLIA 5I3JA 2VR2A 4RW5A 3TZFA 3E74A 2GDUA 4UTIA 2HPIA 3U7VA 1MRQA 1RY8A 1GOXA 3RX2A 3S5NA 5D9MA 4XIMA 2C19A 3PS7A 4KRZA 1SPQA 3PZGA 4EIVA 3EOLA 3CMGA 5FEZA 3VOIA 2V2DA 2C1IA 3F4VA 4C6LA 5HQMA 5CPLA 1HP4A 3VO0A 4D6JA 2OYMA 1E71M 5FAGA 3COTA 3UNTA 3G6MA 3GNRA 3GVQA 4FLQA 5HNRA 2HZGA 4PFHA 3E2QA 2BP1A 3UR8A 4NVTA 3PJUA 1TFVA 2BGSA 4HN8A 4O4VA 4GQRA 2EKCA 3EGJA 4HHPA 4I5UA 4LVBA 1Z42A 3OTRA 2OQLA 1XBYA 2OJPA 3C6CA 2PDJA 3VOJA 3B8UA 3UA4A 4OU1A 4DJED 1K8ZA 3P8IA 2VRQA 4F0SA 5FIPA 3VIKA 5MHBA 1MVYA 4NJJA 1W9VA 2P0OA 4HK7A 3C8NA 2NQZA 1CXLA 3NA8A 3OA3A 3QZAA 1KGUA 4D9PA 3G0XA 1IHIA 1B9ZA 4F66A 3SRFA 3N9SA 3LB0A 2CLEA 2BY0A 3GUWA 2VWTA 2Y8KA 4BEUA 1DVJA 5LIYX 3NXLA 3MJYA 1UWIA 3T05A 4KFOA 1ONXA 2W91A 3WLKX 5G2IA 1GOWA 1Y5VA 2ZVRA 5CZJA 3WJZA 3BL3A 1E5JA 3W7NA 1WB0A 2BLEA 3QKZA 3W74A 3UF9A 1NQ6A 1GG0A 4H9XA 1ZU8A 1G7UA 2YLLA 3M5ZA 4HK6A 1UH4A 2EPKX 1YXYA 3I68A 4OOUA 5DCEA 2Z1WA 1F8IA 3UR2A 1UQYA 2G95A 4PMXA 4OUIA 1NU5A 1IXNA 4LWWA 3VNMA 3B8WA 5DRCA 2PMQA 1PYMA 2E3ZA 4KS0A 4TV5A 1OINA 1WOAA 6ALDA 2VFEA 3STEA 1H5VA 2D3NA 1HJUA 3DYPA 3L4VA 5FJRA 4H7VA 3O6DA 1PBGA 4FNSA 4JPGA 4DNHA 2J7DA 4JTGA 3WBEA 2FTPA 3CZGA 1NJJA 1Y0EA 5DRIA 2VZOA 5EMMA 3CT7A 4M51A 3WQCA 4J2PA 1VKFA 2Z29A 4B5VA 4IGHA 4J3WA 1T5AA 1EX1A 1S38A 3RITA 2YSWA 2WMFA 3BCJA 4LEQA 4NU7A 1YW1A 1BYAA 3W87A 4DJFD 3PZUA 2C8NA 3N34A 4BJHA 3GH4A 3I4KA 4UMBA 4ZEPA 3SQLA 5DT7A 1D9EA 1I45A 2GDVA 1TQJA 4Q8TA 4GNKB 4DM1A 3LHVA 5JVLA 4Q7NA 4Z2KA 1EOMA 2QCMA 3L0GA 1JD7A 5BU6A 1BEUA 3P14A 1GQJA 3WQWA 1JVNA 2WNQA 4EOUA 3TN6A 4KGJA 1SO5A 4NAEA 1US3A 3H7RA 1X6UA 5DANA 1XIHA 3CASA 1EJVC 5HNTA 3P2VA 3F03K 4GO8A 2IKGA 1ZAJA 3QMSA 1JDDA 4NJKA 4LC8A 4W7UA 4MSSA 4TMCA 3OGRA 1E3XA 4ERGA 1WDSA 5EPDA 4Q4MA 1J0JA 2G50A 4HYRA 2CLPA 1XYZA 3P80A 1F6YA 3OEXA 2R6OA 1UD3A 4F2BA 2NQLA 4LAZA 3ZQ9A 1B3VA 4XZHA 2FQIA 1EC9A 3VAVA 2HXTA 2Q02A 4L4OA 3DHFA 2RGLA 1ZNNA 4H9TA 2NXHA 3BC9A 3TTYA 4L9YA 3VIOA 2ZZ2A 3P3BA 4IGSA 4Y9AA 3WDHA 4S2BA 3RRAA 1C3FA 1V0MA 4OHQA 2W67A 4O54A 3U9IA 2JQXA 5FL1A 1T8XA 3UPBA 1VFFA 3KOXA 5HANA 3NQFA 1TJRA 3OPSA 3W29A 1HUVA 4XD3A 3PUEA 2VEMA 3O9NA 5AN7A 2E4TA 3KTSA 5J5DA 4QEHA 5BWAA 3GQYA 2JEQA 2FH6A 2WMKA 3KL3A 3JW7A 2YYUA 2RJHA 3CV2A 4Q4KA 1BGGA 4N02A 1LBFA 3THCA 2R9RA 4JTIA 4GI4A 3N2OA 4DWSB 3GXNA 2D2GA 4RNFA 3WDIA 5A6BD 4EX4A 2FJKA 3GHUA 1HGWA 1PJ9A 4W93A 2F6UA 5LIUX 1QO2A 4LV9A 1VYSX 3CO8A 4O53A 2OOFA 4HTBA 4QG6A 5D33A 1RP8A 1LUCA 1S2CA 5DCDA 3SJNA 3EEZA 4C6JA 2OGJA 3RR1A 4R5EA 1TRDA 3NFUA 3ECQA 1AH0A 1GYNA 3LOTA 5G1MA 2WC7A 1O7AA 2YDRA 3UBPC 1WDWA 3PTDA 2OLAA 1TV8A 4PMYA 2DT3A 3GRIA 3R8GA 1W5MA 5D38A 2V68A 1P48A 2VM8A 3MP3A 4Y2WA 4I8DA 3K4WA 4AISA 3NQCA 3VZXA 3W4RA 3PBMA 4LT9A 2G96A 4AVFA 3MW7A 1H1YA 5E0CA 2PGWA 4XVDA 3KDOA 2X41A 2WMIA 1ECEA 1XH0A 1HQTA 1GOQA 4J3XA 1R85A 4KCWA 4TX9A 2NT1A 2QDHA 4O15A 4FOJA 5KEZA 3WIJA 4KWVA 1KCZA 4A4AA 3VIHA 1LTDA 3B03A 1VFMA 3P61A 3QPYA 5DMMA 3TN5A 5D2YA 2C14A 3BSGA 2NSOA 3IPWA 3VKJA 3W38A 1RAKA 1FWAC 1YLVA 1DXEA 1VH7A 3AUOA 3MI3A 1JZ8A 2J9ZA 1C91A 1NFPA 1EFZA 1PYFA 3G3DA 4JQ3A 4Y8FA 4M6PA 3PJTA 3AIUA 4GNJA 4N9BA 2QT3A 1K6WA 2X1SA 1TRIA 1ZLPA 3MT1A 1JFXA 1M53A 2VC5A 1ISYA 4U31A 3JU2A 1UHVA 5I03A 1F76A 3TNOA 3ZR4A 3C0SA 3IRDA 4PCSA 1XLCA 1JPDX 1GTEA 2QUVA 4ECLA 3BXWA 1QMLA 2VKZG 4I6VA 3CM4A 4CLMA 3LRMA 2V6AA 4YWIA 4UFJA 1JRBA 1WKEA 1GVYA 4YN5A 3RM4A 4IF2A 1TWIA 1W3IA 4YHEA 3TAKA 2XM2A 2P8CA 4M0XA 4PTMA 3L4ZA 1KKOA 1EBHA 4M19A 3U8GA 1AJZA 3GTXA 4V27A 1PKYA 4B3KA 2QR6A 1WXZA 2H9AA 2G41A 2VX4A 1DJXA 1Z32X 1QBBA 3B4YA 1H0GA 3NGJA 4WZHA 4QBXA 4GWEA 4ML9A 2JIEA 3RLUA 2F2KA 3UD6A 1I2QA 1MMFA 4DYEA 3GDRA 2BB0A 4GJIA 4OV4A 1C90A 2PDNA 3SN1A 3IGHX 4H00A 4P8XA 3LX9A 4NSBA 4DVOA 1BF6A 5BRQA 2JFEX 2IPWA 4AXKA 3F4WA 4JTDA 1QHZA 2NQHA 1JG9A 3FEQA 4DBSA 3V5CA 4HGXA 1BXCA 4C6BA 3SJ3A 4U4MA 4DF0A 2YDAA 1F9CA 3QMRA 3W1RA 4UTLA 3B05A 1JFHA 1AZ1A 1XLMA 3GX9A 1TWSA 4IMFA 1CXKA 3HGOA 4JX5A 3L4UA 1FDJA 3LHUA 3N6JA 4JKKA 3PP7A 3KEHA 4ZGYA 1H7RA 4RDVA 5I79A 3NURA 1J0YA 3N2XA 1ONWA 4HU4A 1JUEA 4I9MA 2X09A 4M80A 4IM4A 4DXKA 2G3FA 3CUJA 2QIIA 2FFIA 4JQ1A 3RIKA 3F2BA 1CXEA 3W1LA 4GYFA 4AD0A 3QW4B 1LOLA 5HWMA 3PZIA 1TSIA 5CAHA 2DSUA 3CMFA 3L67A 2V5KA 3HG4A 4YS1A 1XICA 5AHNA 2QVHA 3T0TA 3O1NA 4LNCA 4DF1A 4MJMA 4GIRA 4JTQA 3C56A 1XGEA 1Y8BA 1LG1A 4GC4A 1T0OA 3CNYA 5HMFA