3LLFA

Crystal structure of the mutant s127p of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
217
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMPHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 78
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3llfA00
2V0TA 2TMDA 4ADSA 4O4WA 1B57A 2V81A 3KX6A 4Z0JA 2Q3RA 1H7RA 2ZRVA 4GUFA 1G7UA 4IMDA 4K8HA 1H7XA 4JX4A 1TPUA 1QR7A 1GVQA 4B5NA 1R2TA 4O53A 3GZ3A 1YTDA 3TV8A 3RMJA 2I14A 5AHFA 3IGXA 3MBFA 3ZWTA 1NF0A 3LHTA 5DCEA 1DVJA 1I2OA 1SSGA 2GVJA 3ABOA 4O1AA 1JCLA 3T7VA 5J5RA 3UXDA 3JR2A 3I7QA 4UTIA 4O19A 4N2YA 2PE4A 3ZR4A 3C2OA 5FF2A 3IVSA 4MKNA 3C56A 1Q6OA 4N4QA 1AK5A 4RV8A 5CZJA 1WAUA 3NQ8A 2J9XA 1YPIA 1FY6A 1ZENA 4ORMA 4AWSA 3N9RA 2NX3A 4DEFA 4ZZ9A 3OA3A 1QO2A 2A7PA 4O50A 4Y6GA 1PV8A 1YTEA 2ABBA 3IIZA 2HSAA 4XKYB 1LROA 2F7FA 1JCXA 1ZAIA 3G1SA 1KTCA 2ZRXA 3N9SA 3BGGA 3WK3A 4KWVA 1W5PA 5HWJA 3TSDA 4FIRA 2ZCGA 3WK0A 3MWAA 2C15A 2Y7DA 2C18A 2DZVA 4O57A 1DV7A 5BW6A 4WJEA 3PBWA 5FEZA 4PH6A 5FI8A 2GQAA 3EX4A 3GIYA 3TQVA 4P61A 4Y90A 3W1PA 1ME9A 5I3FA 1OFBA 5C2XA 3CQ0A 1KLYA 1PL9A 4WQ6A 4MVAA 4H4IA 1DHPA 3IIXA 1G67A 4LTSA 3L21A 5F4XA 1GWJA 3P8JA 1OJXA 4NNAA 1GG1A 3QPYA 3TQKA 3GLCA 4QSHA 5C6MA 3DU0A 3I7SA 5D05A 2V9DA 3BO9A 3L0KA 2JKAA 4GRSA 3MBDA 4UUIA 3M44A 4FNSA 1FCQA 3W7EA 1U83A 5F2IA 2QDGA 3HQ1A 4MY1A 1B9BA 2C14A 3O05A 4IJBA 2YR1A 3GX9A 3W2LA 3UYCA 3IGSA 4JY8A 1TIMA 4CCDA 4UTLA 3TFXA 3DHDA 3HF3A 4LVAA 3KRUA 4MIMA 1N55A 1AW5A 4R7JA 1XXXA 3A24A 3W3OA 2C6QA 3E02A 4PFMA 3QF0A 2P10A 4JYDA 1I2PA 3R8RA 3FIGA 1SFJA 2QCNA 5I3JA 2ZZ4A 4QQ3A 1JUKA 2BZNA 3W75A 5LNVA 2A0NA 5A5WA 3NXFA 1V7YA 1VS1A 3UQNA 4AF0A 3DBPA 3N34A 3L5AA 4RR4A 1GPWA 2G95A 3KOFA 4UMBA 1GTHA 5G5IA 2UV8G 4KWWA 3JRKA 2R91A 2CWNA 4LRTA 1TPC1 3AJXA 4JDYA 4IXXA 3C6CA 3ATZA 1ICPA 3NO5A 4BR1A 2Y70A 3B0UX 2GQ8A 2I1OA 3S1UA 5D2TA 4LS0A 3CHVA 3W87A 3QH2A 1JQXA 4JDBA 2ZYFA 4POCA 2R8WA 4BWLC 3OG3A 3HPXA 1ONRA 3NYZA 2NUWA 3VI2A 1FDJA 4QIUA 3TJXA 3OBKA 3E9AA 1XI3A 4XTIA 1V5XA 3LI0A 5AC7A 4S1FA 4X2RA 2QKFA 5F1UA 3HGRA 4M5PA 2DZTA 1X6UA 3CTLA 4LV9A 4XBKA 2E6AA 1LCOA 4ICNA 2Y7FA 2ABAA 1A5CA 5BRBA 4ZMGA 1PCKA 3JS3A 3UZ5A 1TMHA 4FX7A 3TMQA 3E12A 2DZUA 2GVLA 3Q2DA 3QQ1A 4UNLA 2FB3A 5C55A 5K4ZA 3HGOA 2DP3A 1DBTA 3G1YA 3S1VA 3GAYA 1BEUA 3DHFA 1VRDA 4Q32A 1O5XA 2WJZA 4RLIA 3L68A 4R33A 1YPFA 4HNTA 1ICSA 1VCFA 1M7PA 3PG8A 3UWQA 6TIMA 4AF0B 3M43A 2YW3A 3MP5A 3IV3A 1NVMA 4CQ9A 1TPDA 4FB7A 3QC3A 4YXGA 3EKLA 1B4KA 1ALDA 4NJIA 1Y0EA 3MI6A 4PC8A 1W31A 4WY0F 3T4CA 2V5LA 4OGZA 2C1HA 2NWSA 2WNQA 3DKJA 1FCUA 2ATMA 3L5MA 5E93A 3GAKA 3W23A 3YPIA 3QW3A 2CZFA 1D3HA 3W88A 4QJ1A 1F6KA 3B05A 4I7UA 4M7SA 3PBYA 3EKZA 4CCCA 3L9CA 3DAQA 1K8ZA 5CG7A 1UASA 2P0OA 3LTYA 2OT0A 1W3TA 1KM3A 4FNQA 1FWNA 1GOXA 2AAMA 1W1ZA 2JGYA 3DH7A 1A50A 4IX2A 1L6WA 1MO0A 3HMJG 3NDOA 4WY0A 2J9YA 4O28A 3LHUA 3PVFA 3CU2A 1GEQA 1EX5A 3NL5A 3LDVA 3TCEA 5FF7A 5D37A 4WXYA 1JR1A 2YZRA 4N9BA 4ORIA 1J4EA 2HS6A 4L4LA 1CX9A 2C3ZA 3A21A 2NUXA 5AC6A 1F2JA 4JTGA 4Q4KA 5J5DA 3IEBA 4O18A 5F2MA 1X7FA 5DXXA 2QAPA 4UTJA 1H1YA 1KM2A 3PS7A 3FA5A 1TRDA 5CGQA 5CZSA 1ZNNA 3GKFA 1SO3A 1TJPA 4KFOA 4MY9A 4NVTA 2Y7EA 3QSRA 3KVKA 1FWTA 3EWWA 3TSBA 6ALDA 3CM4A 3N2MA 1ZAHA 1YTKA 4RJEA 2CZ5A 3Q58A 5DLCA 4E38A 3N14A 3NOEA 3K30A 3PM6A 3U2OA 2Y85A 3G22A 3I65A 1SZGA 4K7YA 3TW6A 5D33A 1LRNA 3IGUA 3CIWA 4CLMA 3B0VC 1EUNA 1S3HA 2P1FA 2QAFA 3TAKA 2B7QA 4DO4A 4EIVA 4FNPA 1BKSA 1D3GA 2ZZ3A 3W7GA 3S5NA 1I8JA 1YYAA 3QPZA 1KTNA 1Z44A 3UWUA 1DJQA 3INPA 2NXHA 1BTMA 1VQTA 3STGA 4O0KA 5EYWA 4JIPA 1VHNA 1VLWA 2QF7A 3ZS4A 1TV8A 3O07A 3FJ6A 4A22A 4JTFA 3QEZA 4M19A 3HPSA 3W7NA 3W76A 2Y89A 1VYSX 3TUUA 4RZ5A 2BLEA 1AL8A 1O4UA 1KW1A 3OIXA 4A3UA 3T40A 3BW4A 3PSWA 3SZ8A 4IPJA 1UB3A 3RNDA 3W22A 3PB0A 5E0KA 3UNDA 4JY9A 4MLJA 1NSJA 5DY3A 4Z0SA 2OJPA 4FHAA 3HPZA 3SIZA 3PR2A 5D2XA 3RLUA 2Y88A 4HSOA 1JUEA 3SFKA 4WOZA 1ZALA 5G2HA 1OX6A 1OK4A 4DELA 2RKXA 2VXNA 3TROA 1F6PA 1EEPA 3DKLA 4OV9A 1Z41A 2J24A 4XQ6A 3VKJA 4LC8A 5FF0A 1JRCA 3VFLA 4HNVA 3A9IA 3CB8A 1LBLA 3B04A 4UTHA 3HGSA 4RXFA 2VFHA 1A53A 2QUVA 3W7JA 1W37A 1I2RA 3RU6A 3E0IA 1H60A 3M5VA 3T78A 1G4PA 1HTIA 2A85A 3UD6A 1GT8A 5DCBA 2FB2A 3DFOA 5HMSA 2X1UA 1TB3A 5CZTA 4Y9AA 1QOQA 4U28A 4ZQPA 3W72A 1RVGA 1K7EA 3NQAA 4O11A 2J88A 2E6YA 4UTWA 3UPWA 1ZFJA 2HS8A 1GVFA 1QO5A 1YXDA 3O15A 1WX0A 3GKAA 2VFIA 4LY8A 3NQ6A 3W71A 5K4XA 1YXCA 1JVNA 1SW7A 1ME7A 3G1XA 4RXGA 1HUVA 3CWNA 1FQ0A 4O1CA 2GJLA 3ELFA 2ZDRA 2C19A 4GE8A 2X1TA 3W7CA 5AHIA 1K8XA 3W7RA 5LGXA 1Q6LA 3P84A 1VYPX 4U4MA 1X1OA 3G1AA 1H50A 2FDSA 4UFIA 3EWXA 1L9WA 3LXCA 2A7RA 1FCVA 3FLUA 2CU0A 5BOOA 4M6QA 3MHUA 4LVFA 4PA8A 4XTDA 2ZFAA 3IIPA 3W74A 5EKYA 1MSSA 1H1ZA 2WO5A 3TIMA 2PC4A 3O8AA 3G3DA 3IVTA 4PTNA 3W7IA 3W85A 4TMCA 3P74A 4FNTA 4LC6A 3G1HA 4O0ZA 2YGYA 1KV5A 3S5ZA 5DBUA 1PS9A 1JCNA 3W7KA 1G4EA 1VGAA 2E1DA 4XUGA 3HBLA 3GK0A 3W1QA 3MP4A 4K37A 1UUMA 1KTBA 3LCIA 2B0MA 3SY5A 4JNMA 3M0ZA 2PRLA 4EF9A 4O12A 3IRDA 1FDYA 2W79A 1WBHA 3F4NA 4E2DA 2ZA3A 3C2VA 4GWEA 4IMFA 4AHQA 1KFKA 3UWZA 3FKKA 3T44A 2H8ZA 4WD0A 2V82A 3GR8A 1SR9A 3QZEA 4UFJA 3DFNA 3MJYA 1T96A 2E77A 2PCQA 3NQGA 3GXNA 1TO3A 1XM3A 4UMAA 2TYSA 1OX5A 4MJZA 1LOQA 4MLRA 3LRLA 5KINA 3LTSA 1YXYA 3BARA 3N3MA 3NL6A 1IXQA 1TPVA 2JBMA 4MFDA 4S2CA 3LCFA 1KLZA 4FO4A 5CKSA 4JTUA 3NQEA 5CPOA 2C13A 4HKPA 4O10A 3QRHA 3LGEA 1X1ZA 2NZLA 4WXZA 4I9AA 4O14A 3HJZA 3MMTA 3PAJA 3V1PA 5I3KA 4DO6A 2XN0A 1IF2A 2Q3OA 3U6WA 1OX4B 1Q45A 2ISVA 2Y7GA 3TXVA 1OFOA 3NZ1A 4A2RA 3IIOA 2B7PA 2DU2A 3S6DA 3M5YA 2LLEA 5EPDA 3TW7A 1LOSA 3G1VA 1QFEA 3LHYA 1H5YA 3MP3A 5D09A 1TTPA 5HUPA 5LNRA 3EX1A 2ISWA 2E09A 4OE7A 1SZEA 3HOJA 4WUIA 4IMEA 4ZVJA 2Y61A 2B7OA 1OYBA 3MUXA 5A8GA 3QW4B 1G4SA 2WV8A 2VEIA 5HWNA 4NXKA 3B0PA 3DI0A 3PBVA 3W1LA 3G3MA 1MEIA 2FPTA 1PIIA 1LRQA 2VFDA 4UTTA 4LU0A 1B4EA 2FFCA 2VEKA 1MZHA 3RF9A 1OFEA 5AHNA 3N73A 3BG5A 1RQHA 5BMWA 1F74A 5KITA 4O15A 5KZMA 2CLKA 3TKFA 1SO4A 4G1KA 4UTKA 5SWUA 4OWGA 3TH6A 3P60A 1JQVA 2B7NA 2ZRZA 4JD4A 3DFQA 1T0OA 4K6AA 2ZZ5A 1J5TA 2GVGA 1HO1A 4AAJA 5DELA 4TMBA 2QCCA 1SUXA 3P62A 3THAA 2FQIA 2E5CA 4OHQA 3P8IA 4Z1DA 3BVJA 3NQFA 3W1RA 3EWYA 4NZJA 3TMLA 2X1RA 1H7OA 4LV4A 4GUHA 1X8FA 3NQCA 3OVQA 3H53A 2ZZ2A 1EPXA 1HG3A 3NM1A 5TBOA 3WFAA 5LNWA 4DPQA 1JULA 5K2ZA 2BXVA 2WNNA 2ZRYA 1VC4A 2EAWA 2YXGA 2GQ9A 4OQVA 2VELA 1G6CA 5FEPA 3TA6A 5HR6A 3P7YA 3TX9A 1XBZA 2ZRWA 5BNKA 5HINA 5HULA 3L67A 3GDLA 3RFAA 3KRZA 4GUJA 3RK8A 1IIHA 5K7JA 4IUOA 1PHQA 3F4WA 4HT3A 5D04C 3DI1A 3W7DA 4I7WA 1DQXA 1KFCA 4FNUA 3QMRA 1TPH1 2QCDA 1ML1A 4N02A 1QPRA 3I68A 1NAL1 4FX6M 3P61A 3FOKA 2XFWA 5T26A 4RKAA 4MUZA 4Z1AA 1AMKA 2QEZA 4O17A 2RHGA 3KXQA 4QISA 3G0SA 2FTPA 4AWTA 3WJXA 1NF7A 4LVBA 2Y62A 1Q3NA 4JR5A 1GVRA 4UTTC 3QM3A 5AYZA 4K36A 5K9XA 3GXTA 3MI2A 5AHEA 4UNKA 5C54A 2V30A 3I6RA 3M5XA 3M7WA 4DXVA 3LCGA 4M7TA 5DBTA 3GR7A 2VFFA 3IVUA 1LYXA 3WJYA 4JEQA 2QR6A 4K38A 5CPMA 3P80A 2CZDA 4YLWA 4ADTA 5TIMA 4JTJA 5AYXA 1VCVA 1QOPA 1F73A 3BG9A 2VFEA 3L0NA 2B4GA 3L66A 5U4NA 1O60A 5CSSA 4QAIA 5DCDA 7TIMA 3VCRA 1LDCA 2WPBA 4BFAA 1R46A 4RZ4A 3TNOA 4UR7A 2EKCA 3O1NA 2G5WA 2QCLA 4Z1BA 2BX7A 5G4EA 1Q6RA 2QCMA 3S9YA 4UFMA 1TPWA 3STFA 3DFPA 3C0JA 5G4WA 4LUIA 1TPB1 4MOZA 3KVJA 2QCDB 2A2IA 4NJKA 1WXJA 3PULA 3W2NA 1QPNA 3W7HA 3QFEA 3L65A 5F4SA 4UFHA 2CLOA 3L0GA 1I2QA 3PB2A 3KRSA 4S2BA 2A4AA 2Q8LA 1TQJA 2V2HA 4A2SA 5FEWA 3D0CA 4XBSA 4GFSA 2V2CA 1K3UA 1I4NA 3PSVA 3CWOX 4UR8A 4JTLA 3TQ0A 5FESA 1FWRA 2QDHA 3F1QA 4LS1A 1TTIA 3W1UA 3C2EA 4AMAA 1JCMP 3EWUA 4YWIA 2RDWA 1TCDA 3W6YA 3S0CA 4AHOA 3BLEA 1G7VA 1ZJIA 2BTMA 2DORA 4AH7A 1W0MA 3GVGA 1EWDA 3P81A 4YMZA 2A6LA 5TQLA 1E51A 1SSDA 2CFFA 2Z6JA 4HPJA 3W2MA 1IXNA 1WV2A 1VH7A 3GDTA 1W8SA 2TSYA 5AN7A 2YPIA 3UWWA 2W6RA 1AL7A 5F4WA 2CLEA 3EEGA 3PG9A 1BWKA 5F1VA 3OEXA 3O06A 1O94A 4GNJA 4LW7A 4HNUA 1OFAA 4O8RA 3W2JA 1Z42A 5DY2A 3LLFA 4GC4A 2H8XA 3HG4A 2XN2A 5G2WA 2AQWA 5AHMA 3BLIA 1VLIA 5LNUA 3UWYA 2OCZA 3W86A 4UXDA 1EP2A 1OHLA 2J9ZA 2WSQA 1LM1A 3ABRA 5K9DA 4UTMA 4TO8A 3C61A 4IWWA 1PE1A 3W7MA 5K9CA 1G4TA 1U5JA 3A23A 5K3VA 4Y8FA 4YL2A 4BI6A 3NZRA 3N19B 2WSYA 1IXPA 2OX1A 2XN1A 1CI1A 1GTEA 2QJGA 4RCXA 5D2YA 5KTLA 2GUUA 1N7KA 2NV2A 1R47A 1I45A 1K7XA 1SZNA 2VC6A 1OF8A 3W73A 2NV1A 1N8FA 4NJJA 4DF0A 4O16A 3UZJA 2NXIA 3HB9A 5G1TA 1P0NA 5MHBA 3W7QA 3NVTA 3BK0A 5AC8A 1EWEA 2G97A 3B8DA 3EWBX 3W7PA 2CLHA 5D2WA 1RQEA 1GJPA 2DZPA 4XWUA 2O7QA 1XUZA 3LRMA 1VZWA 1BWLA 2ATSA 3MHGA 3W1NA 3P67A 3I7RA 1GYNA 3HG2A 3LV6A 4TX9A 3PUOA 4EF8A 1KFEA 4TR9A 1H7NA 3LM7A 2PRMA 4IMGA 1VPXA 1J2WA 1T8XA 1FX6A 1S5VA 1LBFA 3PC0A 4A29A 1RD5A 3G0UA 2YFOA 3NEVA 1R2SA 3MO7A 5L9FA 2F84A 1SQ7A 5LHEA 3P5YA 5LKYA 3TXZA 2QJHA 3DGRA 3FFSA 3H55A 3ZWSA 5I3IA 3G1DA 2E6FA 5EL1A 4GUGA 1L2UA 1KFJA 2YDAA 3LBCA 1UBSA 3QQ0A 4AXKA 3SJ3A 2X1SA 4HSNA 2E5DA 3Q37A 4DO5A 4UIOA 5CSRA 1XDMA 2GPTA 2QCHA 1THFD 2Z2UA 1IXOA 3NQ2A 2C0AA 5LNSA 3EX6A 2H3BA 2R94A 3NNTA 3T55A 1O5KA 4FNRA 4N4PA 4CQ8A 4LS2A 4DF1A 3OVPA 3NAVA 3UXAA 1OYAA 2WSRA 3CT7A 1R30A 3G18A 4N6FA 4OU1A 2QCGA 4FX8A 5EY5A 2GJNA 5H2ZA 4MJMA 4ADUA 1YLVA 2RH9A 3W1AA 4AB4A 2WNZA 3L2IA 3FS2A 3CLMA 2RDUA 4NXSA 2VEPA 4NX0A 3M9YA 3E96A 3C3NA 4ZQCA 1SZFA 4GBUA 1IGSA 2RFGA 1OG0A 1TV5A 4IMCA 1OX4A 3LERA 5EMUA 1KM6A 1TPEA 1SW0A 5U7SA 1AW2A 2ISSA 1LZOA 5LHFA 5D32A 3NPVA 4AHPA 4MYXA 3P5ZA 4N9DA 1MEHA 4N6EA 4H6KA 1AW1A 1DQWA 3STEA 1VJIA 3NA8A 1WA3A 2O7SA 5G1YA 4E2BA 2C16A 1OK6A 4FF7A 1KM1A 5AHLA 2HTMA 4NZFA 4JX6A 1QNVA 1LTDA 3LB0A 4JTKA 1ICQA 1KBIA 3LHVA 4NNCA 1R2RA 3W83A 2TRSA 2CLLA 4AWUA 3G8RA 1XKYA 1MXSA 4K39A 1ZY9A 4IQLA 1LOLA 3A22A 3W84A 4MZYA 1FXPA 1SPQA 4WZHA 4UTWC 1FWWA 4EWND 2EPHA 2DZWA 3CEUA 2H3DA 4X3ZA 5D2VA 4CQAA 2FLIA 3HG5A 1QDSA 4JXCA 1FDZA 2DZSA 3TR2A 2ZTJA 5LGZA 3C2FA 3WJWA 3G1FA 1OVDA 2JKEA 1LBMA 3QYQA 1VR6A 3NQ7A 4ML9A 2BWGA 4PCFA 3W2KA 1KBJA 4AVFA 4TIMA 2R14A 1EP1A 2YSWA 1JRBA 3W70A 1P0KA 3NQDA 3BV4A 3LOTA 1DOSA 1C9DA 5IM51 3ABSA 3DFSA 4JIQA 4DQWA 3LHZA 3KHJA 3LXBA 2Q8ZA 4Z08A 2JKPA 5KSWA 3WK2A 1C29A 3TFCA 3M5ZA 1H7WA 1TYGA 3W7LA 4BWLA 4JTTA 3QMSA 4UCGA 3HGJA 1P5BA 3DFTA 2VEMA 4LT9A 2VKZG 4NQ1A 2ZQ0A 4NJGA 1S5TA 1XL9A 3HO8A 1ADOA 3MYOA 3AO0A 3KVLA 4ONVA 1DJNA 4QNWA 4E0CA 3LTPA 1M5WA 4PL2A 3W9ZA 4ZQNA 4NT0A 3EX3A 3P82A 1K7FA 3A5FA 3BGJA 3MW7A 3NM3A 3UY7A 1KA9F 3UWVA 2DJLA 4LUJA 2EHHA 2ZTKA 5D30A 2J27A 1K8YA 2A1YA 1QPQA 4CNOA 4C1LA 1VYRA 3DENA 2ALDA 1H62A 2E5BA 4HN4A 3TK7A 1XBXA 3G0XA 4JX5A 1KFBA 2NX9A 3C4UA 1RZMA 4RK8A 4IGHA 2IQTA 4D2JA 4A21A 4LNYA 1QWGA 1GVOA 2VENA 3EXRA 4IOTA 4Q33A 5FEXA 1SW3A 3M41A 1PHWA 3H54A 5AOUA 5HUOA 1RPXA 3NPWA 3VE7A 2A21A 3W7OA 3NQVA 4K8EA 2H6RA 3UPBA 4L4MA 1FXQA 1XUUA 2YYTA 2TPSA 3Q94A 2X30A 4LOCA 1EA0A 3TE9A 1DKWA 1JJKA 4QNEA 1OFRA 4W9TA 3SGUA 4BF9A 2YYUA 4N9EA 5D02A 5F2GA 1O95A 5I3HA 1QPOA 4UFLA 2E68A 1A5BA 3SI9A 2CZEA 3MHFA 2H90A 3C8FA 1XCFA 1F05A 4UMCA 3QSTA 5LSMA 1OFQA 3FKRA 3ATYA 1GZGA 3BG3A 4YCOA 4NJHA 1OFPA 4DBDA 4X9SA 3SGZA 4GJ1A 1JCJA 2ZRUA 3EXSA 3STCA 3W1MA 3LI1A 4N9CA 3VE9A 4CNPA 3GB6A 1IIGA 3LCXA 3PUDA 1GYLA 5AB3A 1S5WA 3O63A 5BMXA 3N2XA 5DN1A 1YADA 3CEPA 3M47A 1QCWA 4RX0A 4QITA 1DL3A 3O6CA 4MZ8A 4BI7A 3LBMA 2Z6IA 2VOMA 3OVRA 1HL2A 1GVSA 3LX9A 4JTHA 4BK9A 3TU9A 1SO6A 2Y6ZA 1GQNA 2OMAA 1UCWA 2NX1A 1H7PA 5G2IA 2OZ0A 1LORA 4LWWA 4NUWA 3B03A 4C1KA 4X22A 1EUAA 1NEYA 2JGQA 4JICA 3KAOA 1JUBA 1FCBA 3GDKA 4OV4A 3TC6A 3WJZA 1F7BA 2ZA2A 3DXIA 5KZEA 3LCWA 4MPQA 3NG3A 3HG3A 1EP3A 3EX2A 4QM1A 1TJRA 1SO5A 4JYEA 4DF2A 2ZA1A 4JGDA 3GNDA 4UTUA 4MY8A 4Z1CA 4JS3A 4FIQA 3THQA 3S1XA 3NL3A 1H63A 3KFTA 3G24A 3LHWA 4KKXA 4ZQOA 5D03A 1VHCA 5H91A 3PY2A 2EF9A 4IX0A 4M6VA 3BW3A 2PURA 1P1XA 2ZZ6A 5ABTA 4FXRA 2QUTA 4LVDA 2OT1A 2NLIA 1QAPA 3S5OA 3S5YA 3V75A 4FXSA 3R12A 2X2GA 3SSJA 2A6NA 4H3DA 3GDMA 1OYCA 2D73A 3PBUA 5DXYA 1H61A 4R34A 3R2GA 1VCGA 1UUOA 2NWRA 4WX2A 2CW6A 3S8HA 3C52A 2YFNA 2QCEA 1WOAA 1LLZA 2FPVA 3QJAA 1RQBA 1W56A 2ZZ7A 3LLDA 4YCPA 2CLIA 2J6XA 4PODA 2G96A 3W1XA 3RLVA 1NFBA 1F76A 1DORA 3KVMA 3W2UA 4MYAA 1PVNA 1KFLA 1TQXA 3WK1A 8TIMA 1TREA 1XFBA 4UC5A 1K02A 3FJLA 5CZ0A 1KM4A 3S42A 2KZHA 4GUIA 4KFNA 2HMCA 4O1BA 4Y96A 1LRTA 3LCLA 1ME8A 2E6DA 4KFPA 4TU1A 1W54A 3TSMA 5FF4A 2WQPA 1L6SA 1ZHAA 5HNRA 1EB3A 2W0UA 3BW2A 1W5QA 2AGKA 3BLFA 4EOUA 3GNNA 1W5OA 4HHPA 4WOQA 1RV8A 5AFDA 3NPXA 3O6DA 3DZ1A 5GVJA 1T99A 1FUYA 3CIXA 4GXMA 1A5AA 2ZBTA 3U8GA 3A5VA 4LVGA 1TTQA 4K7VA 3M1ZA 3WJSA 3M6YA 5CPNA 3C2RA 3R5EA 1M7OA 1LP6A 3EWZA 3CC1A 3CPRA 4O4VA 3TC7A 2PRHA 5FF3A 5EBUA 1L6YA 3PWAA 4J9JA 4BI5A 2Z0IA 3ANYA 4O13A 2DJXA 1WOBA 5AYYA 3TJLA 4WY0B 1OFDA 4HIBA 3ZFHA 3NGJA 5KZDA 2YX0A 2CLFA 4M6PA 3OHIA 4NU7A 4DBEA 4O1DA 3NQMA 1KM5A 1RR2A 3BPWA 1F5ZA 1WBJA 1TTJA 2QJIA 1TRIA 3NL2A 4DPPA 3EB2A 2YCEA 1W5NA 5IBXA 1WYIA 1FWSA 3LV5A 3NR0A 3W1TA 3LCHA 4JN6A 4NNBA 2QUUA 1G69A 4IPIA 1QMLA 3EXTA 3F03K 4MFEA 2V5BA 1YDOA 3L5LA 4PL1A 1TV7A 2WOQA 4O52A 5CPLA 1YDVA 1B3OA 5HWMA 1Z48A 5F2LA 2BSLA 1TPFA 3HIJA 2GOUA 1CW2A 2X16A 1SU5A 5L6UA 4HPXA 3E49A 2FIQA 1A5SA 3GDRA 3O6YX 2A7NA 1W5MA 4ZQRA 5HQEA 1M6JA 3QMTA 4I7VA 4JYFA 5LZLA 3S1WA 5C5YA 3M16A 3TAOA 4OBTA 1H51A 3GYEA 2V8ZA 3LRKA 1W3NA 2Z1BA 1W3IA 1ZCOA 2WKJA 1WQ5A 4IXHA 4RZ6A 1MEWA 3SR7A 1EIXA 2FJKA 1I2NA 4HNNA 1AG1O 1JCYA 1TSIA 2RDTA 4LRSA 3O16A 2ZZ1A 4JTEA 3R13A 3LXAA 3FYPA 4JTSA 4PEKA 1XDLA 5I3GA 5D38A 3VNDA 3NPUA 2FPYA 4ZL1A 5KMYA 2YW4A 2DZXA 1SFLA 3R89A 1FBAA 3FYOA 4P2VA 3SECA 1Q6QA 1YDNA 2Y63A 1LLWA 3B4UA 3MI3A 4CCEA 1ZAJA 3IIVA 2I9EA 4FEZA 1OABA 1WDWA 4MZ1A 3W07A 1KM0A 3SW6A 3FEMA 5HR7A 2CLMA 3B06A 3USBA 3TDFA 2NXGA 4UFKA 1OF6A 4R53A 1PCWA 1UJPA 4EVZA 1HO4A 1GG0A 3MYPA 1XBYA 4JTIA 1KV8A 1HFBA 4CNNA 3G8EA 2A5HA 1D9EA 1K03A 2VFGA 2NUYA 5EA9A 1XC4A 3PF3A 5HJLA 3GXPA 3UY8A 1XBVA 4ZQMA 2JK2A 5IBXC 3ABQA 2V2DA 2EGZA 4XKYA 1P4CA 5E1QA 3PUEA 4ALDA 4NX5A 4OT7A 2QCFA 4XZ9A 1C8VA 4O54A 4AEOA
chains in the Genus database with same CATH superfamily
2V0TA 2TMDA 1J6OA 1B57A 3KX6A 2Q3RA 2VZTA 1UZDA 2ZRVA 4IMDA 4YTUA 2PF8A 1H7XA 3EAUA 4CN1A 4LJ3A 1JZ3A 3BCJA 2WCSA 2HK1A 1GVQA 5LA1A 1H2JA 3B8IA 3OOQA 1IT7A 4O53A 3GZ3A 3DYPA 2HJPA 2I14A 3MBFA 4GC3A 3LHTA 3DYMA 1RY8A 3N11A 2VX7A 1DVJA 1YBQB 2GVJA 3BTNA 1U30A 4IIHA 3CUZA 5FL0A 4UTIA 3AS3A 2PE4A 1EO7A 3ZR4A 2QJJA 2VYOA 3QC0A 3IVSA 1OT1A 3C56A 3M0MA 3QV9A 1AK5A 4HK6A 1BKHA 4WKHA 4D6JA 3VNIA 2O92A 1ZENA 1MUCA 1SZRA 2NX3A 2OVLA 1LQAA 4Q4SA 3VCCA 3OA3A 1QO2A 2D3NA 5RUBA 1YTEA 4GKTA 5CC5A 3KS5A 1VFUA 1JCXA 3WNKA 5PTDA 1PDZA 1W5PA 3WMLA 3B3DA 2ZCGA 3I10A 4E5TA 4GH3A 2MANA 4QQUA 4GFIA 3VZXA 4O57A 2PWGA 1QW8A 4RW3A 1H09A 5FI8A 2NQJA 1B3XA 1US2A 3VMPA 4Y90A 5I3FA 1F6YA 2C71A 3T08A 4H4IA 2WQDA 5A2BA 2INZA 3F5KA 3IIXA 4C7GA 3FK4A 3FVDA 4DLMA 4NNAA 1GG1A 3T8LA 4QSHA 1J93A 3I7SA 2W4XA 5D05A 1B3YA 2V9DA 3BO9A 5A6TC 3SRFA 3ZO9A 3CB3A 3VABA 3MBDA 4UUIA 3M44A 3AI0A 1IWPA 3FHAA 4IICA 3W7EA 3SO7A 3KL5A 5F2IA 4UOJA 4MY1A 4IJBA 4Q4PA 3TEVA 2YR1A 3IGSA 1NOFA 1A5NC 4JY8A 1CXIA 1KGUA 4DAFA 5CXPA 3TFXA 3B97A 3HF3A 2ZUVA 4R5EA 4MIMA 3UPMA 1XDJA 1UQZA 3W3OA 4MTVA 3E02A 2PA6A 1I2PA 4US5A 9XIAA 1SFJA 3LLXA 3SUWA 2Y5SA 3A3HA 2EKGA 1JUKA 5KETA 3GS6A 2BZNA 5XIAA 4GLEA 3M6DA 3NXFA 1WPCA 1FA2A 1VS1A 3UQNA 4RR4A 3AS2A 2GVEA 2R24A 2UV8G 4IT1A 2R91A 1V0KA 4LRTA 3AJXA 2ICSA 4IXXA 3WUFA 3II1A 4BR1A 2Y70A 1Z69A 4GVHA 1CECA 4HD5A 5D2TA 1AJ0A 1W1TA 3E2RA 3CV2A 2GK1A 4RE4A 2V3DA 2NSOA 1MW0A 1YPXA 3UG5A 1E43A 1SM9A 4QHRA 3TYZA 3W6LA 4WF7A 4GBDA 3JZUA 3OIHA 1XI3A 4XTIA 1V5XA 3LI0A 2NLYA 4INFA 5F1UA 3HGRA 4DYKA 1X6UA 1QBBA 1XWYA 4FX7A 1ONXA 5JMUA 3E12A 2GVLA 3NVDA 5C55A 2FB3A 2UY5A 5K4ZA 3HGOA 3G1YA 3WH9A 1ADSA 3BWWA 3WZ0E 5TD4A 3DHFA 4GCXA 1VRDA 4Q32A 2ZUWA 2WJZA 4I5XA 4CCZA 4RLIA 4GVIA 3LSBA 3TLLA 5MKGA 2OQLA 5A69A 3VKDA 2YW3A 1K1DA 1TPDA 4FB7A 3QC3A 1XF0A 2HBXA 3EWDA 4YXGA 4GI4A 3COTA 2OOGA 3EKLA 5CPQA 4HJFA 5EMKA 4OGZA 4XSLA 3GXDA 1ZS2A 1OADA 3CUGA 3QW3A 5A2CA 2CZFA 4RL3A 1F6KA 1S2UA 3I6TA 4UZSA 3ABXA 3ITXA 4H04A 3PPHA 5CG7A 1V51A 1XIHA 2OSYA 1MRQA 2Z27A 4DAIA 3H2CA 5EFFA 1KM3A 1RVKA 1QOXA 4EXBA 1W1ZA 1KR0A 1A50A 1L6WA 3QYSA 4R7OA 1DWGM 3BLDA 3NDOA 4WY0A 4O28A 4ZB0A 1TVPA 1EX5A 2D2JA 4XAYA 4W8BA 3LDVA 1Q6GA 5FF7A 4WXYA 2XIOA 1G94A 3WH5A 3AAMA 2YZRA 1JI2A 5A8PA 4N9BA 4E4PA 1J4EA 1QNRA 1TV2A 1F2JA 1Z6KA 4MWAC 2YCIX 3DHUA 1Q63A 1SVDA 2IPWA 3H24A 1SO3A 4IIGA 3TYDA 3CTTA 4X2PA 1UZ1A 4GIRA 1J0JA 3S3GA 3RXZA 1TWZA 3K30A 2AKZA 1SZGA 5EMJA 3TW6A 2ACRA 2AAAA 5I23A 2Z29A 3TTEA 2P1FA 3BJSA 2ISFA 4FNPA 1BKSA 1QHPA 1HIZA 4US6A 3DOPA 3QR0A 1DJQA 1BXCA 3INPA 1BTMA 3U9IA 2OGJA 1JD7A 5EYWA 4JIPA 1VHNA 1KWGA 2RAGA 5I09A 1TV8A 5LXEA 3VIFA 3FJ6A 3T2OA 5FAGA 1VYSX 5A6BD 7PTDA 4C6IA 1AL8A 1O4UA 3OPSA 4HU3A 1XLJA 1ZBCA 4AZHA 1UB3A 3GD6A 3WLKX 2GGGA 2PDQA 4DHGA 2OZTA 1W1B1 2CETA 1XLEA 5D2XA 3RLUA 2Y88A 2DH2A 1JUEA 5M2FX 1EXBA 2CHRA 2I5GA 2BG5A 3NOYA 3PZUA 4REQA 1W3JA 2VXNA 1F6PA 1EEPA 4G2DA 4OV9A 1Z41A 2J24A 1JZ7A 3Q65A 5FF0A 3FSTA 4HJWA 2J75A 1OSEA 5FA5A 1DWJM 4KWOA 1HL9A 3WLJA 1FWJC 3HM7A 2EO7A 3B04A 4UTHA 3HGSA 3WNNA 1K6AA 1PKYA 1FRBA 1MWOA 1I2RA 4I5UA 4QLLA 4WHBA 3TW9A 4IQDA 4S3JA 2Q71A 5HMSA 1D8WA 3SAZA 1CGXA 1A3XA 4ZE4A 1UMYA 3NQAA 2J88A 3UPWA 4A3YA 1GOMA 1RBAA 1GVFA 4NAEB 1SMAA 1EC9A 4W86A 3GKAA 2VFIA 4F2BA 2HROA 5K4XA 1YXCA 1JVNA 3G1XA 1HUVA 1HKIA 5C71A 1FQ0A 2GJLA 4NZ1A 4PFHA 2ZDRA 3N25A 4Q7BA 3ZR6A 4GE8A 5LGXA 1X1OA 1H50A 2FDSA 4LCQA 4PZVA 1L9WA 3DEQA 6CGTA 3LXCA 3FLUA 2CU0A 5BOOA 4Q4OA 3XINA 3MHUA 1V3LA 3MDWA 4GGBA 3GQYA 1EJWC 2PC4A 3O8AA 5A6AA 3ARWA 4TMCA 1N2VA 3P74A 2ZVIA 2XINA 4LC6A 2BVTA 2VEFA 4H8HA 3ZSTA 1HL8A 1CDGA 1G4EA 3LPOA 2E1DA 3NURA 4XUGA 3HBLA 2PDKA 3OBEA 2G37A 1UUMA 4RZBA 1TMLA 1KTBA 3LD5A 3SY5A 3UGVA 2PWEA 3AXMA 1SMDA 1FDYA 3F4NA 4C91A 2POZA 1TWWA 4GQ0A 1DYSA 3I4KA 5IFTA 5CC6A 3GDBA 3V35A 5I02A 3NQGA 1WKFA 1TO3A 1ZPTA 1F8IA 1OX5A 3MA8A 3T9PA 2XVNA 2OWCA 4LAMA 5D9PA 4AEFA 5LXXA 4NAFB 3OLEA 4YU1A 3AHVA 3LCFA 4FO4A 2PZ0A 5EGRA 2OEKA 4E4UA 1F9CA 4PUUA 1V8EA 1ESWA 3B9NA 1RLCL 4M24A 3LK6A 2Y8KA 1WCGA 1E72M 1JYWA 3HJZA 2VVNA 5DX7A 1KRBC 2GL5A 1OWQA 1IF2A 4OKDA 2Q3OA 3U6WA 1OX4B 1FOBA 1Q45A 1A47A 1PX8A 2Y7GA 4TV6A 4HA1A 2B7PA 3WO8A 1D7FA 1LOSA 2YL5A 2ZUNA 3MP3A 2PTZA 3EX1A 1L2QA 3H2FA 3U57A 4OE7A 3UERA 4WGXA 4KEVA 3AZTA 4IMEA 3CBWA 4ZVJA 3BAKA 2Y61A 4HBKA 3MUXA 5A8GA 1JPKA 1HT6A 2J66A 4A8RA 4W5ZA 2ZXDA 4JNZA 3WDQA 2WHMA 2FPTA 1E9LA 4EAMA 2VP8A 2VFDA 3UETA 3EDDA 3O2LA 5BMWA 5JIWA 1TUXA 3GW0A 4GZEA 4Q8QA 5SWUA 3P60A 4HGXA 3B9DA 4RNIA 4MB4A 4TMBA 4B3LA 3AU6A 3SRHA 1A0EA 2PDFA 3CAWA 2E5CA 2E28A 4Z1DA 3AXHA 3BVJA 4QLJA 4EACA 3BE7A 1MUWA 4GUHA 2WMFA 3D6NA 3CAVA 2Z7KA 2ACQA 4LY4A 1EPXA 1R3QA 2IPJA 4DPQA 1JULA 1Q13A 1OGGA 2EAWA 2XH2A 5DEZA 2P8BA 1PUDA 1G6CA 2EXOA 2D3LA 4Q8OA 3L67A 3KRZA 6A3HA 3WL1A 4WKFA 3BXWA 3OB8A 3WD4A 1PKNA 4UOZA 4RNFA 3HJEA 3UJRA 1T8QA 4D6IA 1CB7B 4QG6A 2YCJA 1DQXA 1TIWA 1TPH1 2QCDA 3EKGA 1QPRA 4R9OA 7CGTA 2GSEA 3L4VA 2XFWA 1MDRA 3CH0A 3VILA 2QEZA 3M46A 2RHGA 3KXQA 4JIHA 2FTPA 1J79A 2Y62A 3N2BA 3LS9A 4UTTC 3QM3A 5AYZA 3GXTA 3MI2A 4RDWA 4G8TA 3M5XA 4OOZA 4J2MA 5G4HC 5DBTA 3VNLA 5FSDC 3GR7A 3IVUA 3F2BA 2RJHA 2QR6A 4P8UA 5CPMA 3P80A 4YLWA 2XWDA 5TIMA 1ZRQA 1VCVA 1QOPA 1F73A 1QWKA 3TOYA 1T40A 3GWQA 1IYXA 5DCDA 1O6IA 3SN4A 2HXUA 3VCRA 2WPBA 1MW2A 3MMUA 5HJYA 4DJEA 2EKCA 3KS6A 5ABFA 4Z1BA 1Q6RA 2QCMA 2XVGA 4UFMA 3ZR5A 1ODZA 4AIBA 4LUIA 2R1MA 5GJNA 1ITUA 1LL6A 1XH2A 4NJKA 1WXJA 2OWWA 3QFEA 1JAEA 2WKGA 3DIPA 3S5SA 2BOGX 4JKMA 2A4AA 1ZQ5A 3KW3A 4NI8A 4A2SA 4DJFA 4W85A 1SJCA 1RA0A 3D0CA 4L61A 4IGSA 3GNRA 4PR4A 2DV0A 1L6GA 3WLIA 1RLDA 1K3UA 3CWOX 3H7RA 4XZBA 2QDHA 3C2EA 1V3KA 4YWIA 1FWIC 3KHDA 3S0CA 2WLYA 3KBNA 4QTGA 5JBFA 4ZODA 1ZJIA 3EZ4A 4LCSA 1W0MA 1W6TA 4WDUA 4PRRA 3VOFA 3AUOA 4YMZA 2A6LA 4IIEA 1UUQA 3EA3A 1H3GA 2GUYA 3CXOA 3W2MA 1VH7A 4WSKA 1TELA 4IP7A 3PN8A 1E1FA 6REQB 2CLEA 1TJ1A 3AXKA 4WKAA 1WDRA 3VOJA 4CD7A 1XIFA 3PG9A 3OEXA 3ARZA 4DB7A 4NY2A 4YTRA 4AZBA 4ZXLA 3W2JA 1DE6A 3WBEA 5DY2A 3LLFA 4C6LA 2H8XA 1U1HA 2AQWA 1RJPA 3UWYA 1GOOA 1XHGA 2J9ZA 4PTXA 2BASA 3KL3A 1RY0A 3C61A 4Q8MA 4RW5A 3ZJKA 1G4TA 4L9XA 4IGNA 1AQ0A 3WBYA 4GYFA 2HNEA 1KCXA 2OX1A 5JIPA 1QXLA 1GTEA 4DWSA 3LEPA 4C6KA 2NV2A 1R47A 1I45A 1K7XA 3AALA 3MJMA 4JCMA 1A5UA 2P53A 1SZNA 1Q6CA 2Y2WA 3ITLA 4AC1X 3UZJA 4J28A 5MHBA 3NVTA 2WMHA 1EWEA 3APTA 4P7QA 4B5UA 1ADDA 3VM7A 5I06A 5KEZA 1GJPA 2DZPA 4TTUA 4XWUA 2O7QA 3SUTA 2GSHA 1Q65A 3T2PA 3SCTA 2DIKA 2VCCA 4KEZA 3HFTA 1H7NA 3LM7A 4O0QA 1T8XA 2BXZA 4LBRA 1LBFA 3OTRA 4I3GA 4JN8A 3VIKA 1W1YA 1GGOA 1YW1A 2YFOA 3S2MA 7REQB 2F84A 4JZ5A 1XYBA 2C7FA 3VIMA 3B4YA 3GY1A 5LKYA 3EDFA 4IJRA 3R7MA 3BOXA 2XZ7A 3CK5A 5EU9A 2E6FA 4GUGA 4ECLA 3SJ3A 1E3XA 2OSWA 3SCWA 5HMDA 1IXOA 3C3UA 3CV6A 3E5BA 3PBMA 4Q8VA 3CV7A 1OC6A 3BAIA 1QW7A 2BHUA 4HNCA 4MNMA 4CQ8A 4LS2A 4DF1A 2DVXA 2WAGA 2WSRA 3IK2A 3NAVA 1R30A 1L6FA 4N6FA 4OU1A 4CQCA 2QPXA 2X09A 1QUMA 2XSAA 1EQCA 4LAKA 4ADUA 4OBSA 1EJRC 3GXMA 4GBUA 2RFGA 4LUTA 5DMNA 4IMCA 4JN7A 3TNBA 5EMUA 1V3HA 2XFYA 1VFFA 3STPA 3AU2A 3VAVA 3WH6A 4ACZA 4N9DA 5CQ1A 4H6KA 1M01A 3NA8A 1WA3A 2O7SA 4E2BA 3NQBA 2C16A 1KM1A 2BY0A 1VFOA 4Q4MA 1A5LC 3RX4A 3UCCA 2CLLA 2O55A 1XKYA 1ZY9A 1LOLA 4MZYA 1FXPA 1M1BA 2J74A 2P5NA 2WMIA 3HMCA 4LGXA 3W0KA 4EWND 3OZOA 2DZWA 3UNTA 1S2TA 2FMOA 5D2VA 4KRUA 2VC5A 2ZUMA 3MMWA 3HG5A 2E40A 3TR2A 4P7OA 4AZGA 1Z89A 3ALFA 2NQ5A 3C2FA 5B7ZA 3RU8X 1LBMA 1VR6A 5HMFA 4F40A 3LM3A 1BYCA 4TIMA 1TWSA 1NQKA 2WM0A 2YSWA 2YL8A 3LNPA 4A35A 4AY8A 3BV4A 2BHZA 2CESA 3L4ZA 1DOSA 1GHRA 4HA0A 4Z42C 3CMFA 1DTNA 1L8NA 3DFSA 4JIQA 1HKVA 2Q8ZA 4AD0A 2JKPA 5KSWA 1GYMA 4QG9A 1C29A 1W3HA 1TYGA 5ECVA 3SY8A 3HGJA 1B30A 3EEZA 1R3SA 4LT9A 2VKZG 4NJGA 1HVXA 2XWEA 3AO0A 4PMZA 4ONVA 1DJNA 4E0CA 1KQZA 4HU0A 3VMOA 2IPGA 2CYGA 4NIRA 4CU6A 3BGJA 3DFYA 3UXIA 3SY1A 3TTOA 3MW7A 3UY7A 1KA9F 2FZNA 2DJLA 5D30A 1MVYA 4R85A 1EHAA 4YTSA 4HN4A 1UKOA 4JX5A 1T5AA 2BDQA 1DJYA 1F8MA 3NZPA 2IQTA 4TUFA 4D2JA 2VENA 3EXRA 5FEXA 3H54A 3VOHA 1UQYA 5XINA 5HUOA 3VD3A 2HK0A 3QLDA 2A21A 4L4MA 3EDEA 1HKWA 3DESA 2YYTA 4R9XA 5M17A 3TE9A 3B8UA 1UH2A 2R6OA 4W9TA 3SGUA 4BF9A 4ZR8A 7ENLA 4JIEA 5F2GA 1KB3A 5I3HA 3P3BA 4UFLA 3UF9A 1A5BA 2CZEA 2H90A 3PPGA 2ISDA 1F05A 4WJ8A 4PYSA 2DIEA 3QSTA 1OFQA 4A8IA 3L2MA 4UQCA 4NJHA 1OFPA 1R5YA 3QHOA 2EEXA 3C8NA 2ZRUA 4IG2B 3EXSA 4PUMA 3CNYA 3LI1A 3MVTA 3N2CA 3CYJA 1QTWA 4CNPA 3CAKA 1FWCC 5AB3A 5FCZA 3O63A 5BMXA 3LSCA 3OQEA 3EOLA 5I77A 4QITA 1DL3A 2WJDA 3O6CA 1FTXA 1IEWA 4GIEA 4LALA 1HL2A 3AUJA 3CUHA 4JTHA 4BK9A 4C1NB 4KGLA 1UCWA 1OINA 3PZGA 1LORA 4LWWA 3HPAA 1ZJBA 2JGQA 3OZMA 3ZVHB 3QOKA 4J4KA 3GO2A 1FCBA 2VO5A 4OV4A 3NG3A 2PTDA 4L5ZA 1XLHA 4FALA 1V03A 1IEIA 3BAJA 4FF5A 4UTUA 3CV1A 3W25A 3LQGA 3NL3A 1JPIA 5D03A 1DXFA 1TE6A 5H91A 2EF9A 4ERGA 1AD4A 1NWTA 3VK5A 1P1XA 4A8NA 3L4UA 4S3BA 2QUTA 3AIEA 3S2LA 3AISA 1QAPA 1T7LA 2HXTA 4ZB2A 9CGTA 3V75A 1BYAA 4ZXOA 2A6NA 2BY2A 8RUCA 5DXYA 4MWAB 1VCGA 2NWRA 4KERA 4WX2A 4PB3A 3S8HA 3OQ8A 1POKA 3GTFA 4WDTA 2QCEA 2QLYA 3CUJA 3KBSA 3TYBA 1TZ7A 3E3HA 2CBJA 1XIJA 1UPPA 3S47A 3VDCA 1EKOA 4FZIA 1XPGA 3SRDA 3QR3A 3KDNA 3VNJA 4G1NA 3W1XA 2PU1A 3RLVA 1DORA 3SADA 3WK1A 2OELA 3A6OA 4QJ4B 4HTBA 1Y5WA 1UWUA 2GZXA 2J6VA 1LRTA 2CHOA 1E0WA 3W00A 1ME8A 4QS6A 4F0RA 4MADA 4H9VA 4TU1A 4IF2A 1W54A 2V3FA 3TSMA 1MXGA 3AS1A 1L6SA 2VD9A 5HNRA 1EB3A 4J3ZA 3BW2A 1W5QA 3SN0A 3HV8A 3GNNA 3E74A 1TG7A 3NPXA 3GNXA 4ZO7A 3DZ1A 4HMEA 2G8ZA 4L4OA 4DJDA 3MSDA 3A5VA 5IDIA 4LVGA 1TTQA 4KBXA 1TWIA 3BOLA 4DJEC 5CPNA 1M7OA 3EWZA 3CC1A 1HJVA 3TC7A 2BMBA 5FF3A 5LIXX 1L6YA 3PWAA 1WKDA 4J9JA 4L6HA 1EO5A 4BI5A 4WCJA 4HIBA 3ZFHA 2JIEA 1QNPA 4J40A 4CEXC 2WHLA 4M6PA 2OEMA 3OHIA 4OOUA 4NU7A 3NQMA 4Z2IA 4J7RA 1F5ZA 3ITYA 1NY1A 3NL2A 3O0KA 4DJFC 1O68A 1GW9A 1HJWA 2UWFA 1J9YA 3W1TA 4BHYA 4E3TA 5MF5A 1QMLA 3OU8A 4MFEA 3WFLA 1UG6A 2DGAA 2WOQA 1Q6FA 1YDVA 3UZYA 5HWMA 4CD8A 2WLZA 1IEVA 2PC8A 4B5TA 3UXKA 3UCDA 4HPXA 2CBUA 2FIQA 2PDCA 4H7VA 3GDRA 3O6YX 1EOKA 1DJHA 3CZ8A 3O7UA 2QYGA 1W5MA 1WZAA 5HQEA 1M6JA 3BAXA 2IS7A 1XH0A 2FJUB 3LRKA 1UR3M 3WUGA 1DJZA 2Q8XA 3M0KA 5FIPA 4FLOA 1WQ5A 4Q7NA 1XCXA 1QK2A 2IPFA 3B9EA 2FJKA 4U2ZA 3W4RA 1EJTC 1AG1O 1BD0A 1DWFM 4C6JA 3O16A 2ZZ1A 2NQ9A 3WMSA 1OC5A 1QATA 3CL6A 3R13A 3NIYA 3MO4A 4JTSA 2HVOA 4AY1A 3EGJA 5D38A 5AZ0A 3MUZ1 1JDFA 2J7DA 4H9XA 4AWEA 5DRCA 5C7VA 4GH1A 3ONCA 2YW4A 2DZXA 3WLTA 1PXGA 5JU6A 2Z1XA 3RLHA 3FYOA 4P2VA 2NT0A 3SECA 4WK9A 1LLWA 5B80A 4DWDA 3IIVA 1WDWA 4XISA 3W07A 4JFSA 3TDFA 4EK7A 3TR9A 5IHSA 4OFCA 2EG7A 3GIPA 2YOCA 3BUVA 4GY0A 1GG0A 1IGWA 4DWSC 1UD5A 2A5HA 1DWHM 4HPNA 1FWAC 4C6BA 4XKYA 3PUEA 4OT7A 2QCFA 1C8VA 3KBWA 1S3TC 2QUMA 4O4WA 2V81A 4G7EB 3OODA 5BU6A 3VDBA 4O1FA 3FW6A 3A3WA 3MUY1 1G7UA 4IFKA 1CENA 3RYSA 4JX4A 4TQTA 2IUZA 2VRQA 4NRRA 3EDKA 4QE4A 3IGXA 4A3HA 1TJ2A 1KGWA 4L6OA 1NF0A 2PWDA 5DCEA 3UJ2A 4NF7A 4XK2A 2WNWA 4KCVA 5M03A 1H1NA 2OO0A 3K4DA 1LUCB 3Q4DA 5FF2A 2QT3A 3U2CA 1RSCA 4MKNA 1IZCA 2P8CA 4NZCA 4N4QA 5CZJA 3O6AA 2CPUA 4JHZA 1WAUA 2X8RA 3ZT5A 4ORMA 1REQB 4C6CA 2GJXB 3QGVA 4LAUA 2XDFA 4PMQA 3NYDA 4DIAA 2VGIA 3PZIA 3ARSA 4Y6GA 2WPGA 3R0DA 3ME3A 1W9BM 4F0KA 3IIZA 2SFPA 1LROA 3NEHA 1JNDA 3BCDA 2IKIA 3PTQA 1ZAIA 5DFAA 2ZRXA 3WUBA 4W87A 3N9SA 1XLBA 3R94A 4YWSA 3TSDA 3VGDA 3R25A 1KCLA 3WK0A 2J7BA 2C15A 4QJ3B 3WG6A 2GLKA 6TAAA 1EGMA 4GMEA 4YTTA 4PH6A 3TTSA 2GQAA 3EX4A 1ZTVA 2PDNA 3GIYA 3TQVA 1ME9A 2Z4GA 3BLLA 3WDHA 3EPMA 1DHPA 5EBAA 1GWJA 1OJXA 3QPYA 3TQKA 3GLCA 3IUIA 3GG1A 4U2YA 4GY1A 4FNSA 4LEFA 3ARPA 1FCQA 3PTDA 3DG7A 2AGTA 4WDXA 2QDGA 3O05A 5DQPA 8XIMA 3GX9A 2D2HA 2OB3A 3RCNA 1TIMA 1ZLPA 4CCDA 3BLOA 3DHDA 4LVAA 1N55A 2BP1A 2FYMA 3ARVA 3GZAA 1AW5A 4R7JA 1AFSA 4TVCA 4PFMA 4GNVA 2FH8A 2P10A 3H70A 3QTGA 2PDYA 1V6VA 3R8RA 3FIGA 1VENA 2QCNA 1EBGA 2AL2A 5I3JA 1Q7QA 2ZZ4A 5FOOA 5HOSA 1OIMA 5LNVA 2WC3A 3IJ6A 5CZKA 1V7YA 2A3EA 1RPKA 3N34A 1EC8A 3KOFA 3WYZA 2QDEA 3OLIA 3W82A 4KWWA 3LUTA 1ICPA 2HEJA 2GQ8A 2CKSA 1X7IA 3VOCA 3VMNA 3IV8A 3KBMA 3CHVA 3F5LA 2ZYFA 1KQYA 3HPXA 1LLOA 1ONRA 2QMKA 4N7QA 2NUWA 3VI2A 1M68A 1RJQA 4QIUA 1C93A 2VL4A 4ZBCA 3E9AA 1KGXA 3KTXA 2QKFA 2DZTA 3CIVA 5BRBA 3UZ5A 2QXWA 5HNTA 4UNLA 4PMXA 2V5DA 1DBTA 3IANA 1WUFA 1BEUA 2I17A 1CIUA 1JF5A 2XIQA 5CLTA 2PDPA 2I7GA 2HZGA 4H6RA 1YPFA 2DH3A 1Q2SA 4HNTA 1VCFA 4IIFA 2XM2A 3V36A 3PG8A 3UWQA 1YHTA 3BGAA 3W81A 3SQLA 5A6BA 5D9OA 1HN1A 2F9RA 1B4KA 4MB1A 3FNDA 1ALDA 1XH1A 2FZMA 2YBUA 3T4CA 2C1HA 1S46A 1FCUA 1LWHA 3DKJA 3ONBA 2CNCA 3GTIA 3GAKA 3W23A 2O0TA 4U3CA 3DG6A 3C86A 4M7SA 3EKZA 4CCCA 1UH3A 3UXLA 5I2UA 1Q5MA 3LTYA 2ZX5A 1KCKA 2OT0A 3IUHA 3WQWA 3E0FA 3E6EA 1ZU8A 1BGGA 4IHCA 2FMNA 2V3EA 1GOXA 1E6QM 4OUEA 2Z25A 2DSZA 4IX2A 4FP1A 1MO0A 4IIDA 3HMJG 2IKHA 1CXHA 2OZ8A 3GVQA 3LHUA 4PEEA 1GEQA 2OYKA 2ASHA 2E1WA 1AQFA 2OLSA 4DZAA 4B5VA 2J8GA 4ORIA 5MKGB 4KIRA 2VGBA 4L4LA 1CX9A 1MDLA 3A21A 2NUXA 1ZGDA 4TV5A 3URAA 1E15A 4Q4KA 4MMWA 4UTJA 4IH3A 1W1VA 3ARUA 3SQMA 1XRSA 3GKFA 4KFOA 1TJPA 4MY9A 1YNYA 2UBPC 3PJTA 2GWNA 1QI2A 4TOQA 3TSBA 4JTQA 6ALDA 3CM4A 3Q58A 4DVOA 4A6GA 3N14A 2Y85A 3VOGA 4FMVA 4H9UA 4GYKA 1LRNA 3IGUA 3CIWA 2E8ZA 3B0VC 4U5KA 2B7QA 4A3RA 1D3GA 3N29A 4ATWA 1C3FA 3QPZA 1TV3A 1LG1A 3VDAA 1Z44A 3WBAA 3QHNA 4W8LA 4D6CA 4JL1A 3G77A 1JYVA 4Q3MA 3GHRA 1GW1A 2BOEX 2QF7A 3H6OA 3TN5A 4AZIA 4A22A 5CLWA 2QULA 3HPSA 1V3JA 3W76A 1EJVC 2Y89A 1V02E 4HB7A 2OWXA 4RZ5A 2J7FA 2J7HA 3OIXA 4G5DA 2O56A 2JIWA 3SZ8A 3W22A 1TV4A 3CUFA 3PB0A 3UNDA 4JY9A 3R0KA 1XD1A 1YEYA 3RO8A 4FHAA 4XUYA 3W01A 3OLDA 5G2HA 4DELA 1OC7A 2OX4A 4WGHA 4AD1A 3U5UA 4BQ4A 4LC8A 4D6DA 2QDDA 1CPUA 5GNXA 3K1DA 3QVQA 5FAJA 2WVVA 5A94A 4W88A 1JG9A 2VFHA 3A4JA 2QUVA 4I6VA 4XB3A 1W37A 5D4YA 1H49A 3WLPA 3T78A 3R79A 1HTIA 4LNCA 5A6SA 5AY7A 2JQXA 3ITCA 3I3EA 2C0HA 5CZTA 4U28A 4ZQPA 1FP8A 5A2AA 2Q01A 3W72A 1RVGA 2PDHA 3S9ZA 4O11A 3NZQA 4DJDC 3MCMA 2HS8A 4XD4A 3O15A 1PTDA 4QLKA 3QKEA 1WX0A 4B2DD 5I3DA 5C2GA 1SW7A 4GVGA 2PWFA 4RXGA 1W2VA 3USZA 3WLNA 4XZMX 2J7GA 3CHFA 1UHVA 2VR2A 1VYPX 4KF1A 3N6QA 5CG0A 3OG2A 2OO6A 4AZCB 3IARA 3RILA 4C5YA 4ZOAA 2ZFAA 3IIPA 3W74A 3GG8A 5EKYA 2DSVA 3M7SA 1V3IA 3V0SA 3IVTA 3W85A 3AQUA 5C9ZA 1TJ0A 1TVLA 4TVUA 3G1HA 1KV5A 1PS9A 3SJNA 4JQ4A 3W7KA 1RCOB 5AKQA 1VGAA 3VX0A 3GK0A 4UTFA 5T91A 2VX6A 4O12A 1VKFA 5DMMA 3UCQA 3U2ZA 3A13A 1OY0A 4DY1A 4H9MA 3MDUA 4IMFA 4AHQA 2WHKA 2H8ZA 1J10A 4GABA 1YQ2A 3C0SA 4HZMA 2VRKA 3K1GA 3L4YA 2C91A 4JTDA 1JD9A 3DFNA 1I9CB 2BVWA 1F4AA 5JUVA 2PCQA 3ITTA 3MU7A 3GXNA 1XM3A 4HN8A 4UMAA 4X0NA 4MJZA 3LRLA 5KINA 2PWHA 3LTSA 4CKQA 1YXYA 1XR2A 1NWSA 3QTPA 3UZXA 2G3NA 2PF0A 4Z2JA 4MFDA 1XIGA 1UWRA 2DIJA 5CKSA 4TTGA 3NQEA 1B3ZA 1NOWA 3EB3A 5CPOA 4HKPA 4ZO8A 1J11A 2NZLA 1JZ4A 4I9AA 5HPCA 3V1PA 2F38A 2HPMA 4YNGA 3S2CA 4MB5A 4DO6A 3CO4A 4ZE5A 2ISVA 2J25A 3NJ3A 1AQHA 1OIFA 3IPWA 1Y8BA 4MG4A 3IIOA 1Q7ZA 3M0XA 3LHYA 4QCFA 5D09A 4LUSA 3RPTA 3ZXWA 1SZEA 3HOJA 1XX1A 3LZ5A 2B7OA 1OYBA 2ZVRA 3QW4B 1PO9A 1G4SA 2V63A 3RR1A 5HWNA 3B0PA 3DI0A 5A95A 1D7KA 3TZNA 4ACYA 3OA5A 4Q8NA 1XYZA 1E1CA 1LRQA 4LU0A 1B4EA 2FFCA 4QEHA 3PAOA 1MZHA 1OFEA 2Z1VA 4J3UA 2FH6A 4D6EA 3FYYA 2DPEA 3N18A 2VC9A 4DXKA 3TKFA 1SO4A 3FX4A 4G1KA 1XLAA 1BF6A 3KCOA 4UTKA 2RGLA 3ANVA 3DFQA 1C7TA 4K6AA 2ZZ5A 1J5TA 4AAJA 3QXBA 1SUXA 3EDJA 2GDUA 3P62A 1LF1A 3THAA 1Q2RA 4OHQA 1AQMA 3NSMA 2DUAA 3NQFA 3EWYA 5HNNA 2GGJA 1V0LA 3UGRA 3NQCA 4PTMA 4PULA 2J78A 3NM1A 5TBOA 4EPEC 2OTDA 3ITOA 5K2ZA 2WNNA 3VGHA 2CITA 2R82A 1B31A 1R3WA 2GQ9A 4OQVA 4HMNA 1OBAA 5FEPA 3TX9A 1XBZA 2NW0A 3CJPA 3MUCA 5J8LA 3GDLA 1LWIA 5K7JA 1UKQA 1MQRA 3F4WA 2J62A 3B0XA 3W7DA 5E6ZA 4FNUA 2XFFA 3F4DA 2WWCA 3PNUA 1NAL1 4AYSA 4IL0A 3VGBA 3FOKA 2BODX 3M64A 4GO8A 3VKAA 4O17A 4HYVA 3G0SA 4LVBA 2ODOA 4JR5A 1GVRA 3EWCA 2P3ZA 4C65A 2VEGA 4B9ZA 1DJGA 3M7WA 4DUXA 3CS2A 2ZKMX 2WZHA 3BICA 4S3FA 1QNQA 3BG9A 4S3GA 2OODA 3BH4A 2JFEX 3L0NA 2B4GA 4PB4A 1UKTA 1CGYA 3CO8A 5E0CA 5U4NA 1O60A 5CSSA 5CC7A 2PLJA 4GJJA 3UJEA 3W24A 7TIMA 1LDCA 4BFAA 1R46A 3E2VA 1K4GA 3TNOA 1D3CA 4S3CA 1ISZA 1EYWA 3STFA 2ZUUA 2WMJA 5CC3A 1TPB1 1KFWA 4MOZA 2QCDB 2A2IA 3N4EA 4KWUA 3PULA 1QPNA 2XU2A 3L65A 5F4SA 2GDQA 4UFHA 5A6JA 3L0GA 2PLMA 1I2QA 3MKKA 2XSBA 5CBJA 4LXFA 4S2BA 1I0BA 1TQJA 2WWDA 3VIHA 2FHCA 3VNMA 4RDZA 1PZ3A 1I4NA 4AIOA 1FWRA 3SB0A 4LS1A 3GHSA 4AUBA 1TCDA 1K4HA 2V5KA 1A49A 1W3KA 2DORA 4ZOCA 4WIWA 2D0HA 4PCTA 3HU7A 1DJXA 3SCRA 1UWSA 4HPJA 4B91A 5A8MA 4RDVA 3NGFA 2VCBA 4HOZA 3HPFA 1RALA 2PBOA 3T2QA 2TSYA 4FK9A 5AN7A 2YPIA 1HP4A 2W6RA 1KD0A 4AFYA 1E4IA 5F4WA 1JZ8A 3GG0A 3MQTA 3LBOA 1BWKA 1CYGA 1O94A 1GOWA 4LH8A 1LJYA 2DQWA 4I5RA 1HZYA 8A3HA 1ISXA 1BSIA 3HG4A 3GU1A 3MV11 3IJDA 5C9WA 1UC5A 5LNUA 1WZMA 2OCZA 3W86A 1EP2A 3ARYA 1OHLA 1LM1A 1UH4A 2C1IA 5HNUA 4UTMA 3AMCA 4TO8A 2REQB 3SSZA 4Y8FA 4NAEA 1GK8A 3CMJA 1JZ2A 3L23A 1CI1A 3MVIA 1PTAA 2QJGA 4RCXA 3QY7A 5D2YA 1P7TA 1XQKA 1HNYA 2Y8UA 3CLWA 2WCAA 3PTKA 3AIRA 5E6YA 2VC6A 1OF8A 3W73A 2NV1A 4DF0A 4LYQA 3WQCA 1IR2A 3IJ8A 2YDSA 4XD6A 1BXNA 1PZ2A 3HB9A 3S46A 3WEOA 3W7QA 3EPOA 2OZ3A 3BK0A 1W1A1 3B8DA 1CLVA 1Y65A 2CLHA 2X2YA 3LRMA 2ATSA 3MHGA 4G7FA 3RM9A 3W1NA 3CMGA 2NQZA 3LV6A 3PUOA 4LSBA 9XIMA 4EF8A 4TR9A 2GDVA 2PRMA 2YA1A 2J7CA 1FX6A 3EYPA 4QDWA 3AOFA 3AMDA 4XZNX 4YYCA 4ATDA 3PC0A 2FZDA 1F3XA 3CGTA 3NEVA 1MW1A 2HBVA 5L9FA 1UD6A 2XH4A 1UD2A 1KRMA 1UZ4A 3IK4A 2VRJA 4CD4A 2QJHA 2ALRA 3DGRA 3LMYA 3FFSA 3RG6A 3VTRA 4DWSB 1AMYA 3G1DA 2D2GA 2CHNA 4BCEA 1IT8A 1ZSXA 1H11A 1CXLA 3AHZA 2YDAA 3VC5A 3RX3A 3AMLA 3Q37A 1WDDA 2QCHA 1QHZA 2Z2UA 3E2SA 5LNSA 3EX6A 2H3BA 2YL9A 3ZMRA 4NAFA 3N6HA 3OVPA 1OYAA 3WKZA 1NIUA 1VFTA 5EY5A 1X38A 5H2ZA 4JNYA 3CL7A 3PNZA 2PDWA 1GKRA 4AB4A 3L2IA 3FS2A 3CLMA 2AMXA 1PAMA 2VEPA 3M9YA 1A5MC 4AX7A 1SZFA 3H2AA 3WLMA 1IGSA 1OG0A 1TV5A 1WDQA 1CB2A 1OX4A 2V38A 3LERA 1NFGA 4A3QA 4GHRA 2PTYA 4HHHA 3V3WA 1DQWA 3STEA 4PRTA 1VJIA 3TTYA 1M9HA 1WO2A 4HQVA 2BV9A 4FF7A 5AHLA 5M3WA 3BOFA 1LTDA 2Y4SA 2E9BA 4XAZA 4WSHA 2HDJA 3BAWA 1PKLA 1SGJA 2ZDSA 4AWUA 2TRSA 4P7RA 1K9DA 1IEQA 1PZ1A 4K39A 4IQLA 3AHXA 4NYYA 2EPHA 4G56A 2PMQA 1LWJA 3EMQA 3CEUA 4X3ZA 1P6CA 2FLIA 1I1XA 3D5HA 1QDSA 3QBUA 2ZTJA 5LGZA 3OBAA 4DUWA 1LG2A 4IM4A 3G1FA 2BGQA 3GNOA 1QNSA 4GJIA 4UZUA 4GQRA 1XLMA 2BWGA 3W2KA 4AVFA 3BV7A 1LQ0A 2R14A 2ZC1A 1P0KA 2UZ9A 4ILSA 3LOTA 3AIQA 4AZ5A 4JL2A 3RAOA 3BJTA 1OB0A 3R8HA 3KHJA 3BAYA 5FACA 4ACZB 4MF4A 2YDRA 2WVSA 3M5ZA 3BSMA 3GG7A 4IPNB 1ZZMA 4BWLA 1XYMA 3GHTA 1P5BA 4Q22A 3UVAA 4NQ1A 1QT1A 1XSKA 2ZQ0A 3MYOA 3WNMA 4ASTA 4H9TA 3KVLA 2BNJA 3VX1A 1EXPA 3PZ9A 1M5WA 3ITGA 2IXVA 3W9ZA 4KRZA 3VZYA 4LFYA 3M4HA 1K7FA 3BZJA 3CH9A 4GA8A 1GQJA 3NM3A 3GM8A 4GQBA 3UWVA 4LUJA 4GQGA 4BF7A 5G1MA 2X0YA 3PANA 1K8YA 2A1YA 1NDVA 4AU0A 2B31A 4DM1A 1E4NA 2ALDA 4CVUA 4XX6A 1QRQA 3TK7A 1NFPA 1XYFA 3C4UA 1UROA 4HTYA 3GHUA 4IGHA 1WAWA 2HQAA 4YHGA 4A21A 4LNYA 1QWGA 1GVOA 5C7HA 4B4FA 5GQBA 3AC0A 2BBFA 1RPXA 1XYCA 1ZBWA 4AEEA 4X63A 3NQVA 2QW5A 3UPBA 1XUUA 4MHBA 4UCFA 3R6IA 3TN3A 1DKWA 1JJKA 1OFRA 1O95A 1QPOA 1MMFA 2GYIA 4AZ7A 1B54A 3RGTA 2D0GA 3MHFA 4KW2A 4M51A 1XCFA 3SUSA 4UMCA 5LSMA 3FKRA 3GXFA 2F6XA 2AQVA 3B8TA 2XIBA 4DBDA 1K77A 4S3KA 3SGZA 4ZFCA 1JCJA 3M0HA 1RP9A 4Y9NA 2JEPA 3STCA 1A3WA 4Q8PA 3LCXA 4IPPA 3WMBA 2Z1SA 2UY2A 3GU2A 3M47A 4MZ8A 3DUGA 5HDRA 3GVVA 1TR9A 2W9MA 1U1JA 3R11A 4OVXA 2Z6IA 4Q4RA 3CQIA 1GVSA 3LX9A 1SO6A 3GUWA 2OMAA 4OJYA 2EJAA 5I24A 5G2IA 2OZ0A 2ZXBA 3B03A 4C1KA 3AMGA 3HN3A 4JICA 3WQEA 1JEZA 2YBVA 3WJZA 2ZA2A 3EA2A 1R87A 5KZEA 3LCWA 1XV8A 4LQ1A 4HCLA 1VIZA 3HG3A 4Q8UA 4MPKA 2WK2A 2ZE0A 3MY9A 5HAOA 4ES4A 4GACA 2YLAA 1SO5A 2BOFX 3XIMA 3VGFA 4DF2A 2ZA1A 1M03A 3GNDA 4KS0A 3R43A 4Z1CA 1JFHA 4FIQA 1HGWA 4QFUA 3PZOA 3S1XA 1H63A 3KFTA 3G24A 2IMRA 2DT0A 3PY2A 4IX0A 4M6VA 4J3WA 2PURA 8XIAA 3VGGA 4PTWA 4B5WA 1EF2A 5FKYA 1KO0A 1E6ZA 1X98A 2E7FA 4LB3A 1VB9A 3UR2A 2VC7A 3U7VA 1JF6A 3KOYA 3MSGA 3R12A 2Y1HA 4ICMA 2D73A 3PBUA 1H61A 1DIOA 1NM9A 2DUZA 1FFRA 3ZLFA 4EPDC 3C52A 2Z26A 3DC8A 3E1F1 4ZOEA 2FTYA 3VNKA 3O0FA 4BQ2A 3UFYA 3QJAA 3LLDA 3G5EA 3DYOA 3TLQA 4PODA 1F76A 1W3LA 1OT2A 3WF4A 1EX1A 5BWFA 2E25A 1PVNA 1DWAM 5TAOA 1BFNA 2XGZA 4R7WA 8TIMA 1E40A 1G0CA 1TREA 2VZUA 3O3RA 1K02A 4PBGA 4KQNA 3S42A 1VFSA 1R8LA 4GUIA 4KFNA 1I0DA 2HMCA 3LCLA 1E0VA 1W9PA 2GGEA 3VKBA 2GVYA 4GYPA 4QX4A 4OBRA 3BLFA 2QJMA 2RUSA 2V6AA 2RDXA 4EOUA 1AZ2A 2VNCA 4QXIA 2VTFA 4WOQA 1RV8A 1QI5A 1T99A 1X96A 1A5AA 1GJUA 4NASA 2ZBTA 3U8GA 1OQFA 3D3AA 3M6YA 3K4WA 1D8CA 1LP6A 4O4VA 2G3FA 3ANYA 4O13A 2DJXA 5AYYA 2GQ3A 2YA0A 2INFA 5KZDA 4FAMA 2CLFA 2ESCA 3BSGA 4O1DA 1KM5A 3BPWA 2YCLA 4PTDA 1WBJA 3A47A 3IS4A 4EE9A 2QJIA 1TRIA 2P88A 4DPPA 2YCEA 5IBXA 1WYIA 1AUSL 3T81A 2O4QA 1B5TA 2QGYA 5BXSA 4JN6A 4HA4A 2WVTA 3EXTA 1W9XA 4N0RA 1XGZA 2GJPA 1O5RA 4F0SA 3GE7A 5REQB 2GOUA 1CW2A 2X16A 1SU5A 2F2HA 5L6UA 3VA8A 1J18A 2ACSA 2A7NA 2GOKA 3MMDA 4E6MA 1AZ1A 3AYRA 1J0ZA 3S1WA 4AXNA 1CTNA 3ICJA 2V8ZA 2Z1BA 2DW7A 1ZCOA 4CGTA 1MEWA 1I2NA 1JCYA 1TSIA 5C8BB 2PDJA 1OG6A 4L1GA 2Z2BA 3DC0A 2FGZA 1XDLA 5I3GA 3OW1A 2PB1A 3VNDA 3ZQ9A 4QJ5B 3PJWA 4JHMA 4ZL1A 4LF1A 1ZBVA 1XRTA 1FBAA 2Y5EA 2Y63A 1NOUA 4NP7A 3MI3A 4RV3A 4C6EA 4CCEA 3F2CA 3LNMA 4PRWA 3WD1A 3SW6A 2CLMA 3B06A 1FWHC 5BZAA 3TN6A 3W38A 2YDQA 2VGFA 3MYPA 3LG3A 4JTIA 1BWVA 1HFBA 3R0UA 1TZZA 5E0FA 2VFGA 3CL8A 3KOZA 1J01A 3RHGA 1U33A 2VI0A 1MW3A 2JK2A 3ABQA 2V2DA 1WP6A 7TAAA 1W32A 1UOZA 2EPLX 2POTA 4XZ9A 1RP8A 4O54A 4QP0A 5JXQA 3GU9A 1HX0A 4ADSA 4Z0JA 3FN9A 1RK6A 1EOMA 3FDGA 1TPUA 2XIIA 1JFXA 1QR7A 3CAQA 3U4AA 4YHEA 2X40A 1YTDA 3TV8A 3RMJA 3E5PA 1PYFA 4PMYA 2PBGA 2FHFA 3SCPA 4LBSA 1I2OA 4O1AA 4F66A 1JCLA 3T7VA 2ZX6A 5J5RA 3I7QA 2PP1A 4O19A 4IPLA 3EOSA 1O5QA 3KCJA 4U10A 2IW0A 1JCTA 3UZZA 4ROQA 4AWSA 4R27A 3N9RA 3THCA 4DEFA 1HVQA 4ZZ9A 4O50A 2HE8A 1LT7A 4ZO6A 3LYEA 4XKYB 2F7FA 2DT2A 5CAKA 5AYIA 4HK5A 3G1SA 5CBIA 3S6OA 3VZZA 3BGGA 3WK3A 2JE8A 1QI4A 4Q6XA 4FIRA 3SCUA 4IFKB 3FJNA 2DZVA 1XPYA 4IISA 1CXFA 5BW6A 1FHVA 3PBWA 2GGIA 4X60A 5FEZA 3P2VA 1G01A 3WDJA 1OFBA 1XICA 4RPQA 5C2XA 3CQ0A 1RK5A 1PL9A 5BOFA 1G67A 4LTSA 5F4XA 1BGAA 1V0NA 3DU0A 5C6MA 2XFRA 4YYFA 2CEQA 4H83A 1R3TA 1DTUA 4B9YA 4IG2A 2JKAA 4M1RA 1F61A 3LQLA 3LENA 1EJUC 1QI0A 1U83A 4NG3A 3H4WA 2ZXQA 1B9BA 2C14A 1QPKA 5J04A 3W2LA 2X42A 3UYCA 4UTLA 4GO9A 3GC5A 1UR1A 4ERIA 4S39A 4C1NA 2WW5A 2C6QA 1CWYA 4MGGA 4EKJA 3QF0A 4JYDA 4JQ2A 1Q85A 4HOWA 3RIKA 4Y7EA 2GJRA 4IQJA 1T41A 1MNSA 1F3TA 3KTSA 4NRSA 1HP5A 1WUEA 2A0NA 5A5WA 4XAFA 1QI3A 4F8XA 4AF0A 2QMJA 3DBPA 3L5AA 2JF7A 1RBOB 1RXOB 1VD6A 4D1IA 1FWGC 1KXTA 3JRKA 1WKYA 3WLHA 1TPC1 1OZQA 1C90A 2O9TA 1JYNA 3ATZA 2BVYA 3BLPX 4FOJA 3B0UX 3QY8A 2I1OA 1R9XA 3KLKA 1SJDA 3DDMA 3FXYA 3W87A 3QH2A 4JAWA 4MAVA 4G9PA 4POCA 4BWLC 1B3VA 4Z2LA 4QE1A 3EOOA 2W92A 3NYZA 1FDJA 3TJXA 1VBJA 1SR0A 5BROA 4KETA 3OBKA 1Z9AA 2ONEA 4X2RA 3CQKA 1SFTA 1VIWA 4M5PA 4LV9A 4XBKA 4D8LA 3WF1A 1LCOA 4XO7A 1DJIA 1JNEA 2ABAA 1A5CA 4HSHA 4ZMGA 1TMHA 5BYWA 2YCKX 3QQ1A 2DP3A 1FWEC 1Z8AA 3SN1A 3GAYA 2B81A 3L68A 4R33A 1EC7A 2VZOA 3UR7A 1BTCA 2FZBA 1A5OC 1U2YA 2ON3A 3M43A 1NVMA 4CQ9A 1BXBA 1JDEA 4GQQA 1C92A 1M7XA 2ZX7A 2F61A 1Y0EA 3MI6A 4H19A 5CH9A 1W31A 4WY0F 2NWSA 2WNQA 3EMCA 2ATMA 4NILA 4AX6A 5ABEA 1W1PA 3YPIA 3OZYA 5A6KA 3K5XA 1PSCA 2WZEA 4RDYA 1XISA 4HNOA 4LYKA 3PBYA 3MKCA 2WM1A 3V0UA 1K8ZA 1UR8A 5BWAA 3SCQA 1UASA 2KAUC 4E2OA 5GJPA 1W3TA 4J35A 2P0IA 1UA7A 4FNQA 3OYZA 2JGYA 3OHMB 3DH7A 2ZC8A 2J9YA 3PVFA 3CU2A 3VIGA 3NL5A 1DIEA 1JR1A 5EMLA 3PPCA 1KKOA 4V15A 2HS6A 5ENLA 5LIUX 5AC6A 3RCMA 4JTGA 1AH4A 5J5DA 1A4LA 3IEBA 4O18A 5F2MA 1X7FA 5DXXA 2X0HA 2QAPA 1H1YA 3PS7A 1E3ZA 3CWHA 1TRDA 5CGQA 4B2DA 3IAQA 5CZSA 4XZHA 2HVNA 4AY7A 1DQUA 1DHKA 3QSRA 3EWWA 1KNWA 4GYJA 2BGSA 3N2MA 2FFIA 1ZAHA 1YTKA 4RJEA 3ISIX 3WNLA 3DECA 1K9FA 4W89A 3G22A 3I65A 5H8MA 4K7YA 5D33A 2ZE3A 4CLMA 4BEUA 1R7AA 1S3HA 2O9OA 2PTWA 2QAFA 2UY4A 4DO4A 4CNUA 1BG9A 3UR8A 5CPTA 3W7GA 2Z2AA 3WLLA 1I8JA 4WDWA 5AZ1A 1E5JA 3OVGA 4CNSA 2NXHA 1BHGA 4IZGA 1VQTA 4O0KA 4IMAA 3UW6A 6PTDA 2Q09A 3N4FA 2R1KA 4JTFA 4M19A 4Q6JA 1ZL1A 1C9WA 4EXQA 1DIDA 4HMCA 1ISVA 1HW6A 2BLEA 4KCUA 3S2NA 4A3UA 3RX2A 3T40A 3BW4A 4L1WA 1VBHA 4IPJA 2WZMA 4Q8WA 5E0KA 3T0AA 2O9RA 5DY3A 4Z0SA 2OJPA 3K8LA 4B15A 5TNVA 3PR2A 4HSOA 4WOZA 1YE4A 4NKCA 2RKXA 2BFGA 3TROA 1IHIA 3A3XA 3NTYA 3WD3A 4S38A 4XQ6A 4ZO9A 3VKJA 3SCNA 1JRCA 3VFLA 4HNVA 3PFMA 3SGGA 2PWUA 3ARXA 3CQJA 3A9IA 3CB8A 5DMLA 1IEXA 1TX2A 4GX9A 1FHDA 3RU6A 3N3TA 2I16A 3E0IA 3K2GA 3TZFA 1H60A 1V3MA 4GYPC 2A85A 3HURA 1H0IA 1V6YA 3DFOA 4AYGA 3L12A 3VD9A 2X1UA 1A80A 3G1RA 1K7EA 3UU0A 2E6YA 3F4VA 1ODUA 1GOKA 1JDDA 1QO5A 1YXDA 3UG8A 1IZJA 1IR1A 4LY8A 3NQ6A 3W71A 2G4FA 3L4TA 3CWNA 1LUCA 2XTKA 4PCSA 2C19A 3IGHX 4JTCA 1DXIA 3P84A 4ICCX 4CQBA 2QJNA 3EWXA 4UFIA 4CNTA 3W53A 2GJXA 4M6QA 4QROA 4XTDA 2UY3A 1MSSA 4DNMA 4CU7A 3TIMA 1HKMA 1VFMA 2ZIDA 3W6MA 1P6WA 2WVVB 4MWAE 2XVPA 4O0ZA 4UR9A 1UWAA 1XGDA 2VZVA 1GVEA 3GTXA 3JUGA 3S5ZA 3DCPA 3ZLHA 4PMJA 7XIMA 4M0XA 4H41A 1OD0A 4KGJA 4V2XA 1G1YA 3KTCA 4P7LA 4FOUA 4K37A 4LPCA 4AISA 2B0MA 3B9AA 4TX6A 4JNMA 3UR5A 5I00A 2G3MA 7A3HA 1EYEA 2W79A 2ZA3A 3C2VA 4GWEA 4F0HA 2PP3A 4RNJA 1KFKA 3UWZA 2W66A 4LB4A 3T44A 1TFVA 4WD0A 2V82A 1A4MA 1HJQA 2OU4A 3L2LA 1P0DA 4UFJA 1L8PA 2E77A 4PGLA 4O8AA 3LN3A 1MUMA 2W3ZA 2E4TA 1V79A 3SRKA 4JIIX 1LOQA 4MLRA 5FJIA 4B5SA 5FJRA 2CXEA 3N3MA 1IXQA 4X9YA 3ES8A 3ES7A 3TYUA 4S2CA 1KLZA 2KX9A 1UWTA 3F2DA 1J8VA 4D9PA 4DLFA 2FTWA 3WQGA 5HPOA 2C13A 4HK7A 4D6GA 3QV6A 2GFTA 1EIBA 4O14A 1PTGA 3MMTA 3PAJA 5I3KA 3C2YA 4PB5A 4XVEA 1Y7VA 2VD8A 2XN0A 3WLOA 3TXVA 4JBRA 4GXPA 3PZQA 4K1WA 1OFOA 3ZT6A 2LLEA 1E5NA 2FVKA 1QFEA 4J3TA 1E1EA 2ISWA 5CBBA 2E09A 4YVXA 1S2VA 4WUIA 3VGEA 4EAYA 4KEUA 4FA3A 1C8XA 1FWBC 1OCQA 2VHLA 5CGMA 5FJOA 1ITXA 4J3XA 2WV8A 2VEIA 4JQ1A 4K8GA 4AQLA 3V16A 3W1LA 2PCEA 3G3MA 3TA9A 1MEIA 1W9DM 3CT2A 5LIWX 4UTTA 2OLHA 4XD5A 2VEKA 4HP5A 1XKJA 2Z1KA 2HPIA 3N73A 4XV0A 4D1JA 4M81A 1AJZA 5KZMA 2CLKA 2G3IA 4JQAA 4P8VA 5FJPA 4AVOA 4MNKA 4OWGA 1OD8A 4G6CA 1JQVA 2ZRZA 1VEPA 1HJSA 1HO1A 2VMFA 4M3PA 2QCCA 5BRQA 3AFBA 2VX5A 2INEA 2FQIA 3N13A 2J47A 3GRIA 1CGWA 2XIMA 3W1RA 3EA1A 3MZNA 2BS9A 4NZJA 2CKRA 2X1RA 4H2CA 1X8FA 3WEZA 4K1GA 4GNKB 4C6QA 4LUSB 4WEVX 1X6NA 5LNWA 3WFAA 2BXVA 2ZRYA 3K8KA 2YXGA 4FLSA 2P3EA 2E9LA 4PSRA 4AW7A 5HR6A 3P7YA 4XAGA 5HATA 2ZRWA 1UWIA 3ZOAA 1EA9C 4TX8A 1GNXA 1DEDA 5CJ5A 1E1CB 4IUOA 1PHQA 1Q4NX 2CERA 4HT3A 3V5OA 2WCGA 3DI1A 4I7WA 5E09A 3VKCA 3QMRA 1ML1A 1NELA 3I68A 1KC7A 3AJ7A 3H26A 4H7ZA 1BQGA 2WXDM 3WIJA 4RKAA 1S38A 1MQQA 4Z1AA 1AMKA 4L7ZA 1AH0A 2CBVA 2WBGA 1GQKA 3AWNA 4FXFA 1ENUA 1AH3A 3WJXA 1JGMA 3A4AA 4L6DA 4AIEA 3N04A 3H12A 3V4BA 1VJZA 5K9XA 4K36A 3WFZA 5AHEA 4UNKA 3G6LA 5C54A 1I6NA 3DG3A 1GEHA 4OIFA 3UT0A 2VFFA 1LYXA 1J12A 4K38A 3AYTA 1KBLA 2QQ6A 2CWXA 4ADTA 3MT1A 3WDRA 4JTJA 3GYCA 5AYXA 4PUKA 3L66A 4M29A 2PWVA 4QAIA 1XQLA 4H2HA 2PDGA 4RZ4A 4UR7A 2PDXA 4CU8A 3O1NA 4WRHA 1V6WA 4QAWA 2G5WA 2NQLA 1WZLA 3GVRA 2BX7A 2EJ1A 4H01A 5FD0A 3ARQA 2WYSA 3DFPA