3LLFA

Crystal structure of the mutant s127p of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
217
Chain Sequence
b'DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMPHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 78
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3llfA00
3FKRA 4FNSA 1YDOA 1OYCA 3W1PA 3S42A 4UIOA 1M6JA 4LVBA 5K4XA 1OF6A 4TX9A 2J6XA 1O5XA 2ATSA 1F73A 3PG9A 2ZCGA 3W7GA 1WBHA 5DBTA 2Y70A 4Z1CA 3TSBA 4JTEA 4OQVA 3AJXA 5F2LA 5KSWA 2AQWA 3EWUA 2DZVA 2Y88A 3QJAA 1H7RA 2X30A 4A22A 4AB4A 3HBLA 1DBTA 3NOEA 2KZHA 3N34A 2YCEA 3QW4B 4QNWA 5C6MA 3O15A 1VCVA 3M6YA 3NZRA 3BPWA 1XC4A 3L0GA 5J5DA 2VEMA 3W70A 3M5XA 2P1FA 1W5QA 5T26A 3MI6A 1HL2A 4MFDA 2QJHA 5AHFA 5EA9A 5CPOA 1VHCA 5ABTA 3UWYA 4AHPA 4UTWA 5D03A 5H2ZA 5K2ZA 1H7PA 2QAPA 1JCMP 1F5ZA 1D3GA 8TIMA 1DHPA 3T78A 4IMDA 2FJKA 4O18A 2RDTA 3BV4A 3NYZA 3OA3A 2CLMA 1OFPA 2QCEA 1LBMA 4AF0B 2A4AA 4ZZ9A 1F05A 2Y61A 3BLIA 1IGSA 3EKZA 3TXZA 2FPTA 5H91A 5CZTA 4O14A 1LRTA 2XN0A 1H63A 2I1OA 4NVTA 2YX0A 5A8GA 3K30A 3S6DA 1J2WA 3G1DA 3GXNA 1H60A 3L5AA 4M7TA 3SGUA 1GZGA 3TMQA 1RR2A 1MZHA 1LBFA 4S2BA 4POCA 3QZEA 3RLUA 3TSDA 3CT7A 5LHFA 1H51A 1ZAHA 4UUIA 1IXPA 3FIGA 4ZMGA 2JGQA 2ZA3A 3N73A 4DBEA 1I2PA 3T7VA 3KOFA 4HT3A 3LRLA 3UQNA 2VKZG 3U6WA 4IOTA 1ZJIA 3TIMA 4UTKA 3W87A 3P84A 5AHEA 4HKPA 2BXVA 2DORA 3STGA 6ALDA 2TYSA 4EVZA 3BK0A 4GJ1A 3RLVA 3QRHA 4DEFA 2B4GA 2OT1A 4GUJA 4WY0B 4QISA 1KTCA 1WV2A 4IWWA 3CPRA 2W79A 3EWZA 1SUXA 1SZEA 2QCDA 4FXSA 4TIMA 4WY0A 2Z0IA 4JIQA 1ML1A 3MW7A 4RZ5A 4FNPA 1XUZA 4PODA 1LLWA 3E49A 1IIHA 3W7MA 3LBMA 5LNVA 3CIWA 3KAOA 5HR6A 1VQTA 3M1ZA 1R2RA 3NG3A 2Q3RA 3BO9A 4PC8A 1W5NA 2RH9A 3UD6A 3TFXA 3TE9A 3R5EA 4AAJA 5TBOA 1WXJA 3USBA 5FF2A 1VR6A 3A5VA 4MFEA 2Y85A 2ZYFA 2G96A 4K39A 4XKYA 3MJYA 3DU0A 4DF2A 3MP4A 4FX8A 4RR4A 3SJ3A 5SWUA 2A21A 4BI5A 2QR6A 3IIOA 4O4VA 4EOUA 3GZ3A 3GXPA 1OX6A 3IIVA 2Z2UA 3DI1A 4JD4A 2ISSA 3UY8A 5AN7A 4GUGA 2FB2A 1JCNA 1JRCA 3NQ2A 3IVTA 2ZBTA 5D30A 2H8XA 1SZGA 4YCOA 1KV5A 2VEKA 1FWTA 3NL6A 5D04C 3NQGA 2ZRXA 1QNVA 1AW1A 3ABSA 4KWVA 3HGJA 4O53A 4FNTA 2YXGA 4UTMA 2ZRUA 3LHTA 3N14A 1K02A 4MZ1A 3DHDA 3TUUA 1TQXA 3NM1A 5F1UA 1O5KA 3FLUA 3N3MA 5DBUA 1HG3A 3T55A 5I3IA 1TRDA 4LT9A 4DF1A 2QUUA 1X6UA 4JICA 1UJPA 4NJIA 3QM3A 3PB0A 2A7NA 4WJEA 2ATMA 3Q94A 4UTJA 5AYYA 3TW6A 2V9DA 3NNTA 3W7RA 2Y63A 4YXGA 2ZTJA 3W1TA 3SR7A 3CIXA 2YR1A 1B4EA 2ZDRA 2VFFA 1GG0A 1I2QA 1AMKA 1TV7A 2RHGA 2B7QA 3BW4A 5D05A 2PURA 1SO6A 4N4QA 3WFAA 1WAUA 1OX4A 2HS8A 4LS0A 5CZ0A 5AYZA 3S5ZA 1D3HA 3EX3A 4EF8A 1XI3A 3WJZA 1OK6A 1TPEA 2FB3A 3E0IA 3FYPA 3TR2A 4QITA 3NQ8A 3DAQA 3LI0A 2JKAA 4LOCA 4ORMA 3CEPA 4FHAA 1LOQA 1NFBA 1FCUA 4M6QA 1DQWA 3GLCA 3C2EA 3SFKA 1EPXA 1FWRA 4JNMA 1V5XA 1T99A 4EIVA 1KFLA 1L6WA 3OG3A 1FDZA 5I3GA 3LHZA 1DL3A 4ALDA 1W54A 1LRQA 1W3NA 2GPTA 4GBUA 5FI8A 2C19A 3GYEA 2J27A 1GG1A 1KFJA 3Q37A 3W72A 4HPXA 3EB2A 2EGZA 3BW2A 3ABQA 2B7PA 1YXDA 1HO1A 3PSVA 3L66A 3KVLA 1QR7A 2BSLA 1OYBA 2DU2A 2C0AA 3O1NA 3WK3A 3YPIA 1A5BA 4ADUA 5KMYA 1F76A 4M7SA 5C54A 3DENA 1OFDA 1NEYA 3E12A 3TJLA 5HWJA 4XTIA 3MHFA 2ZZ2A 4IXXA 3NQVA 1XDLA 1A50A 1SO5A 4Z0JA 2C18A 5F4SA 2WNQA 6TIMA 1KM6A 2QCCA 4BF9A 1VJIA 3LI1A 1OFQA 2RDWA 4A21A 3QH2A 1VH7A 1I4NA 4S1FA 1K3UA 1MEHA 1K03A 2YZRA 4H6KA 1ADOA 4MZYA 2GVLA 3THQA 5G5IA 4XBSA 3UWZA 4K8HA 2V2HA 4UFMA 5DELA 1ZY9A 5EKYA 1ZALA 1XBVA 5KITA 2YDAA 1X8FA 1PVNA 4Y8FA 4TMCA 1G69A 5U7SA 2WNNA 4E2DA 1JCXA 5LGXA 3I7SA 4LW7A 3S5YA 3W1LA 1R2TA 1GOXA 3NQFA 2DZXA 5CZJA 2H6RA 3OIXA 3VCRA 1C8VA 5L6UA 5MHBA 1F6PA 7TIMA 4JTLA 4BR1A 3A5FA 2NUYA 3PAJA 2X1RA 2DP3A 5CPLA 1XBYA 1FWSA 4NU7A 3IRDA 1K7XA 1B57A 3B03A 2VELA 5G2HA 2ZZ7A 1Q6RA 3IVUA 1Q45A 4K8EA 1FCBA 2EHHA 4IMCA 4UMAA 5F4WA 3W22A 3GX9A 2W0UA 5AHMA 3M7WA 3TSMA 5BMXA 4LY8A 3P81A 5I3JA 4E38A 2GVJA 1H1YA 4WD0A 1TTPA 3QSTA 5A5WA 1OHLA 3OVRA 2Y7FA 4UMBA 1U5JA 1W31A 4JTIA 4N9EA 2X16A 3CTLA 2ISWA 4NXKA 4TO8A 2E6YA 4N9DA 4MPQA 3LTYA 1ONRA 3T4CA 1Q6LA 1F7BA 1HFBA 3P7YA 2X1SA 4EWND 1TPFA 4O1CA 4XQ6A 5D2YA 4N9CA 1FX6A 3DZ1A 2VFDA 4K36A 3P5YA 4A3UA 4EF9A 4Z1BA 1A5SA 1FDYA 4AMAA 3V75A 1M7PA 1YDVA 5D2XA 5F2MA 4PL1A 3W07A 4AHOA 1GVQA 1KM3A 4C1LA 2PCQA 2VC6A 5HWNA 3W71A 4JN6A 3LHVA 4WXYA 2AGKA 4FEZA 3UPWA 1KM2A 5LNSA 3LB0A 4HSNA 4Y96A 4JDBA 2J9YA 3QFEA 1XM3A 4A2RA 1W3TA 4AWSA 4AH7A 4NJGA 5DN1A 1R47A 1FXPA 3F4WA 4LV4A 1MSSA 1XCFA 1ZAJA 3GAYA 3O07A 3M5VA 3HB9A 1SU5A 1RZMA 1UASA 3QEZA 4GFSA 5FESA 3HPXA 4IMEA 1FWWA 1ME9A 1PE1A 3GKFA 3LXBA 4WOQA 4M5PA 3QQ1A 4JY8A 3PS7A 3PULA 1KTNA 3GDTA 3W7QA 3LCGA 5AHLA 2Y7GA 3PWAA 3WJWA 5I3FA 3N19B 3NDOA 3VI2A 4O1AA 1W5MA 1UBSA 4UC5A 1SW0A 2DZWA 1FQ0A 4AWUA 5D38A 3LHYA 3W1QA 4RZ4A 3MWAA 1AL8A 1TPB1 4RXGA 3W7KA 4RV8A 4PTNA 3CLMA 1VLIA 5FF0A 1ZCOA 3PBYA 5LKYA 4IPIA 3DGRA 3W7JA 4HNNA 2ZFAA 2VFEA 4KFNA 3EX4A 3FFSA 2VEIA 3ATYA 4O10A 3TJXA 2OCZA 3LXCA 4BK9A 2ZRWA 3W2JA 3CM4A 2H90A 4IGHA 3W2LA 2PE4A 4KWWA 2GUUA 5F2IA 5CPMA 2VOMA 1H7OA 4FIRA 3IGXA 5F2GA 3HPZA 3L65A 4UTWC 2CZ5A 1BEUA 4Z1DA 1KLZA 3G1YA 2E6FA 5BMWA 3INPA 3RNDA 3MYPA 4MLRA 2QCFA 3W2NA 4N6EA 3FJ6A 3NPUA 5I3HA 5BNKA 3JS3A 4MKNA 1IF2A 2Y89A 1AL7A 3L0NA 2WKJA 2NX9A 4AHQA 1A5AA 1HO4A 3W1UA 4JXCA 3HJZA 4LUIA 1KFEA 4WQ6A 2ZZ5A 2ABBA 1W3IA 1QPNA 2VFHA 1SO4A 1DV7A 1LROA 1F6KA 2FDSA 1OFEA 2PRLA 4FNQA 3W85A 3ZWTA 3LERA 1W0MA 4AXKA 4S2CA 3HQ1A 4TMBA 1TJPA 4HSOA 4DXVA 1SO3A 2NZLA 1MXSA 2V30A 1K8YA 2WNZA 3IGSA 5CPNA 1DJNA 2ZRZA 1RQBA 2TPSA 3DFSA 2NV1A 1EUAA 2FTPA 3CQ0A 5G4EA 2OZ0A 4RZ6A 3TAKA 3OEXA 3PVFA 4TU1A 5LNRA 4FXRA 1S3HA 1TRIA 3EEGA 1DJQA 5K9CA 5K3VA 3LTPA 3G8EA 4N4PA 2CLLA 3EWXA 3FYOA 5FEPA 4AF0A 3L0KA 3MHGA 1M7OA 3S5OA 4O28A 2GJNA 3W7DA 2NUXA 4RXFA 3WJYA 1YTKA 3B05A 4X3ZA 5AHIA 3EX1A 1GQNA 1YPFA 3G18A 3S1WA 2R91A 1LYXA 1LDCA 2ALDA 1W1ZA 3QQ0A 5DLCA 4GUHA 2B7OA 2EPHA 3KVJA 5E1QA 3NL3A 3BVJA 3DKJA 5D09A 1VGAA 4UMCA 4AEOA 3NPWA 5E0KA 3NQAA 4UR7A 1FCVA 3FEMA 4C1KA 2PRMA 4O50A 4MYXA 4ZQRA 2R14A 3G0XA 2DJXA 3C6CA 5DCBA 3TH6A 2WJZA 4AVFA 3RFAA 3PM6A 4ZQMA 2Y62A 5GVJA 1QAPA 3DH7A 1RV8A 3GDRA 1HUVA 2VEPA 2E5CA 4MIMA 2V0TA 4JTTA 3SSJA 1DOSA 1R46A 3LCHA 1TPUA 2IQTA 3NQCA 3RU6A 1VZWA 3MHUA 1KA9F 1GTEA 1TB3A 3ABOA 3QPZA 1YDNA 4G1KA 3OHIA 3RMJA 2ZTKA 3BG9A 1LOLA 1RVGA 2QDGA 3CHVA 1WA3A 3TAOA 2CLKA 2QCGA 3EKLA 4DBDA 1KBIA 2C15A 3SGZA 2WO5A 3OVQA 3W7HA 3GKAA 2ZZ3A 3A23A 3NQMA 4IMFA 4ML9A 3P8IA 2J24A 3GDMA 2JGYA 3KFTA 5AOUA 1OVDA 1EUNA 1ZHAA 4QNEA 4O0KA 5BW6A 2QDHA 3B0UX 2YYTA 4NT0A 4FNUA 3KRZA 1NF0A 4XWUA 4DF0A 3LLFA 1P1XA 5TIMA 3FOKA 2VFIA 2OT0A 4R53A 3P80A 1R30A 3M5YA 3NVTA 1GTHA 2A6LA 3N2XA 1OK4A 2Z6IA 1KM0A 3SI9A 4Q4KA 3LCXA 3P5ZA 4OE7A 4O57A 1TPH1 1ZFJA 1OFRA 5IBXA 3QPYA 3W1AA 5G1YA 3QMSA 5EPDA 5DY2A 3PUEA 5LHEA 3L68A 2E09A 1VCFA 2ZZ6A 3M43A 5HJLA 3BARA 3E02A 4I7WA 2WSYA 2V5LA 4ADSA 2H3BA 1EWDA 1RD5A 1YLVA 3G3DA 3LBCA 3O6CA 3TC7A 2CZEA 4OV4A 1CX9A 1V7YA 2I9EA 3WJSA 3NGJA 4YL2A 4YLWA 1BKSA 1L9WA 3UWUA 2PC4A 4O54A 1WX0A 4HIBA 1TTJA 4BFAA 1YXCA 4DO5A 4FNRA 2V5BA 3M44A 4M6VA 4CQAA 4YMZA 1H7XA 5HINA 2AAMA 3LGEA 4I7UA 4MVAA 1JUEA 3DHFA 1PCWA 4YWIA 1QOPA 4UR8A 1IIGA 3GAKA 3MBFA 1CI1A 1GVOA 4MOZA 2GQAA 1QPQA 4IQLA 2DZPA 4JTHA 4FX6M 3C2FA 3BG5A 1K7EA 3PF3A 3W7IA 2CLFA 3ANYA 4RX0A 2WSRA 4UTIA 2H3DA 4PFMA 5G2IA 1QO5A 3FKKA 3C56A 5DCDA 1Z48A 4RK8A 1PS9A 3M0ZA 4CNOA 3S0CA 2DZTA 1FXQA 4JX4A 3SZ8A 5G2WA 3IVSA 3LDVA 3B0VC 4IPJA 4MZ8A 4Z0SA 1JVNA 2E6DA 3W86A 2NUWA 1C9DA 2A85A 3QSRA 2YW3A 5AHNA 4HHPA 1OF8A 1MEWA 2J9XA 3PY2A 2CW6A 3UWQA 1IXQA 3B8DA 5FF7A 4PL2A 3LHUA 2HS6A 5K4ZA 3MUXA 3B04A 5KINA 2FQIA 4O17A 5L9FA 4FF7A 3C4UA 4MY1A 4P2VA 1GEQA 4K7VA 4L4MA 4OWGA 3R8RA 3A22A 1S5VA 1ICSA 3NO5A 1QCWA 1TPVA 4QSHA 2DZUA 1DQXA 3QYQA 3N2MA 4A2SA 3ZFHA 1VYPX 4NZJA 3HGSA 3E9AA 3W7CA 3GDLA 3CU2A 3NR0A 3BLFA 3LXAA 3W7NA 3TROA 5C55A 1WYIA 2CFFA 1W5OA 1EA0A 4W9TA 2HTMA 1FWNA 3NZ1A 5AB3A 4KKXA 1CW2A 3GK0A 3GB6A 4RLIA 4U4MA 5KZDA 4XTDA 3S8HA 1LOSA 3EWWA 3W6YA 4LV9A 2QUTA 3VNDA 3A24A 1QO2A 3TQKA 3VFLA 3PR2A 4E2BA 2YPIA 3BG3A 4FO4A 2FIQA 3P82A 4UFHA 4K6AA 1N8FA 1LTDA 2C13A 3NQ7A 1QDSA 3TQVA 4JDYA 5EL1A 2RKXA 1I2OA 3IGUA 3G3MA 4UTHA 3HG4A 4UTTA 2CU0A 1FBAA 5LNWA 3EXRA 4BWLC 1SR9A 4LVGA 1KTBA 3ATZA 3W1XA 1W56A 2Z6JA 5EMUA 4MLJA 1VC4A 4MUZA 1OX5A 3ZWSA 3T40A 2Y6ZA 3L2IA 5BRBA 1SFJA 1QPOA 4ZQNA 2A7RA 3PUDA 3S1XA 4UTLA 2A6NA 3G1FA 3O05A 1LP6A 4TR9A 3ZR4A 4I9AA 1NAL1 3GNDA 3UXDA 3UY7A 4WZHA 2H8ZA 1JUBA 2QCHA 3I7QA 3M47A 1J5TA 5HNRA 4XBKA 1WQ5A 3QMTA 1BWLA 1QWGA 4NQ1A 3LCIA 1JJKA 3OBKA 3DFTA 4NJHA 3F1QA 2OJPA 4O1DA 1K7FA 4UNLA 1TPWA 4R33A 1I8JA 3L9CA 2TSYA 3UXAA 1LRNA 4NX0A 5CGQA 1HTIA 4NXSA 3UNDA 2B7NA 1BWKA 3DXIA 1ICPA 3NQDA 4R34A 2Y7EA 2A1YA 1AK5A 1VRDA 3KHJA 4X2RA 3R12A 1GVFA 4Y9AA 4UFIA 1VYRA 1S5WA 4Y90A 3MI2A 2WQPA 2CLIA 5EBUA 2ZA1A 3W9ZA 2W6RA 4OBTA 5J5RA 3W23A 1YXYA 1F74A 3DFOA 1UB3A 3NPVA 2ZRVA 4JR5A 2XN1A 1GYNA 4WY0F 1TJRA 1H7WA 3PBWA 3DBPA 2NV2A 4UNKA 3T44A 3TQ0A 4YCPA 4AWTA 4NJJA 2JKPA 3P62A 4JYEA 1QFEA 3W88A 1VCGA 3LCWA 1NVMA 1SZNA 3EX6A 2WPBA 3N9RA 3G1VA 4O13A 5BOOA 4LU0A 2VXNA 1TTQA 4CNNA 2CLHA 1SW3A 4JX5A 1VYSX 3PG8A 2TRSA 3M9YA 1I2NA 1X7FA 4NJKA 2X1UA 1R2SA 3UZJA 1SPQA 3E96A 4DO6A 3MP5A 1GWJA 1FDJA 5LZLA 1LLZA 3QC3A 1TMHA 2C6QA 1E51A 3I6RA 3DFQA 2O7QA 4LS2A 4Y6GA 2Q8LA 2GQ8A 3C2VA 3P60A 1TYGA 1T8XA 4K7YA 1H7NA 4ICNA 4FIQA 1LZOA 4O52A 4CQ9A 4GUIA 4JTGA 4CCDA 2G95A 5D2VA 3W2KA 5TQLA 1A5CA 4NZFA 3HG2A 4ZQOA 1EP1A 4MJMA 3DFPA 4ZVJA 4OHQA 3HGRA 3HMJG 3LOTA 1XKYA 1JR1A 2EKCA 3LV6A 3WJXA 3PBVA 1KFBA 1WOBA 1GVSA 2CLEA 4NX5A 4O15A 3STEA 3N9SA 4JX6A 4GNJA 5AC8A 2VFGA 3B0PA 4CNPA 1O4UA 4U28A 2A5HA 5LSMA 3F4NA 1XXXA 2DJLA 2UV8G 1TCDA 3KVMA 3HF3A 3FS2A 2B0MA 2R94A 1TSIA 5CSRA 2YW4A 2GOUA 4DPQA 1O94A 1SW7A 4IXHA 3M41A 3MP3A 2BWGA 1YTDA 3PB2A 3EWYA 4LNYA 2QCNA 2A0NA 2OMAA 2BZNA 1XBXA 3O6YX 1H50A 1G4PA 1G4SA 4RKAA 3W75A 3W7OA 1H1ZA 2QAFA 1S5TA 1XFBA 4H4IA 4K38A 1GT8A 1P0NA 2ZZ4A 4N2YA 1BTMA 2LLEA 2FLIA 1KM5A 2ISVA 3CB8A 2E77A 1KW1A 4ZQPA 2RDUA 3LTSA 1EP2A 3P8JA 1ZNNA 3O63A 2QJIA 1N55A 5D2TA 4GWEA 3UYCA 3I7RA 3M5ZA 4FB7A 3I68A 4JTUA 2C16A 4DO4A 3LV5A 2E5BA 1P4CA 3OVPA 1WDWA 2Z1BA 3NA8A 2C3ZA 1H62A 2ZA2A 3TC6A 1UUOA 5D32A 3FA5A 3LCLA 1XL9A 2YYUA 1G7UA 4MY9A 5AFDA 4UFJA 3DFNA 4CLMA 3A9IA 2DZSA 2O7SA 1O60A 5G4WA 2XFWA 4HNTA 3U2OA 3LHWA 1GPWA 5FEXA 3JRKA 3KXQA 3F03K 4OV9A 1FCQA 4GUFA 1EWEA 1TIMA 5F1VA 5U4NA 2CWNA 3MMTA 2GQ9A 2PRHA 2F84A 4WOZA 1RQHA 3G22A 1FY6A 1H61A 3QW3A 3G1HA 2F7FA 3ABRA 2NWRA 5DXXA 1OYAA 1PV8A 3R89A 1KLYA 5AC6A 1AW5A 1LBLA 1UCWA 1YPIA 1G67A 4JY9A 4LVDA 1SQ7A 3S5NA 3IIPA 3P74A 1PHWA 1XUUA 1W5PA 2NLIA 4N9BA 1JULA 5CKSA 3RK8A 4WX2A 5HULA 2A7PA 1WOAA 1LCOA 2QCDB 4UFKA 5AC7A 5CZSA 2HSAA 3C61A 3P67A 1RQEA 3IIXA 1TTIA 2CLOA 3CWOX 3W7PA 4LUJA 1ALDA 1W37A 5C2XA 3W83A 4DQWA 3NQEA 1G7VA 1SSDA 2G97A 2V2CA 3KRUA 2Y7DA 5HQEA 3HPSA 3R2GA 5IBXC 2Q3OA 1JCLA 3FJLA 2OX1A 3BGJA 2EAWA 1EB3A 4XZ9A 3DKLA 4WUIA 4XKYB 5KZEA 1PCKA 2QUVA 3SW6A 2TMDA 3THAA 1MO0A 2R8WA 3W1RA 2YFOA 3S9YA 1ME8A 1VPXA 1T0OA 4KFOA 2C14A 5DY3A 4BI7A 4UCGA 5FF4A 2FPYA 3W1NA 2E68A 4HNVA 4N6FA 4O11A 3L5LA 1U83A 3VKJA 3G0UA 5LGZA 2RFGA 1Z44A 4PH6A 1PHQA 2NWSA 1THFD 1SFLA 2ZZ1A 4LRTA 2E5DA 3SECA 3MYOA 3UZ5A 1VS1A 5D33A 2QEZA 1B3OA 3GDKA 4GC4A 3W2UA 3HGOA 3H53A 5D02A 5EY5A 1F2JA 3LLDA 2A2IA 2ZRYA 4JYFA 4FX7A 4BI6A 4I7VA 3NM3A 4HPJA 3TV8A 3C52A 4HNUA 4B5NA 4K37A 3NL2A 1T96A 4NUWA 5KZMA 4ADTA 4LS1A 4M19A 1Q3NA 2NXHA 4PEKA 3LRKA 2YFNA 3JR2A 3G0SA 1TV8A 1KM4A 4PCFA 2WV8A 1B4KA 3C3NA 2JK2A 1AW2A 2BTMA 4JTJA 4Z08A 5E93A 4UFLA 3TX9A 4LC8A 2HMCA 1X1ZA 1W8SA 3ELFA 4LVAA 4MJZA 4QIUA 1LM1A 2E1DA 3ZS4A 3HOJA 2X1TA 5C5YA 5CSSA 4JS3A 1YADA 4GXMA 1OJXA 3GVGA 4Q32A 3STFA 1TO3A 4Z1AA 3EXSA 2D73A 3MBDA 2QCMA 1XBZA 4CCEA 1G4EA 3L67A 3Q2DA 3NEVA 1OX4B 3MI3A 3V1PA 1JCYA 5KTLA 4LRSA 3PBUA 2ZQ0A 1TV5A 3AO0A 1G6CA 3HG5A 1EEPA 5G1TA 4ZL1A 4CCCA 3TCEA 3R13A 5D37A 3H54A 3HO8A 5K7JA 1KBJA 1ZAIA 2NX3A 2X2GA 3UWVA 3GR7A 3CEUA 4GE8A 4O12A 1L2UA 3CC1A 3W1MA 1JQVA 1DKWA 1QOQA 3PC0A 4QQ3A 4M6PA 3QMRA 1G4TA 1H5YA 3SY5A 2WSQA 4IUOA 4L4LA 3UPBA 1DVJA 1I45A 3IIZA 3BLEA 1KM1A 4OGZA 1OG0A 1KV8A 1NSJA 1AG1O 1IXNA 2GVGA 5DCEA 3NXFA 3O6DA 2CZDA 3HG3A 4HN4A 2QJGA 3B4UA 4X9SA 3W74A 3IV3A 4P61A 2V82A 1DORA 4Q33A 3G24A 2NX1A 2YSWA 4UTTC 2J9ZA 2FPVA 1RPXA 1ICQA 3RF9A 3EWBX 3G8RA 4O0ZA 4RCXA 3O8AA 1OFAA 5EYWA 5HMSA 3TDFA 2WOQA 5HUPA 2NXIA 3GNNA 3KRSA 3TK7A 1PL9A 1OABA 3GR8A 1TREA 3WK0A 4A29A 3MO7A 1KFKA 3VE7A 4OT7A 5HR7A 4JTFA 1EP3A 3TXVA 1GJPA 1ZENA 1K8ZA 1WBJA 3L5MA 1OFBA 4R7JA 5F4XA 1OFOA 3LX9A 3TNOA 4LWWA 2BX7A 3WK2A 4GRSA 3C0JA 4JIPA 1SSGA 3NL5A 4KFPA 3TMLA 1PIIA 4OU1A 4O16A 5HUOA 1VLWA 2JKEA 5CG7A 1TQJA 1UUMA 5HWMA 1X1OA 4O4WA 4JYDA 3Q58A 1TPC1 2CZFA 1I2RA 1Z41A 3LCFA 3VE9A 3QF0A 2FFCA 3S1UA 1QPRA 1D9EA 4O1BA 4NNCA 1P5BA 2I14A 3NQ6A 4N02A 3TA6A 4NNBA 3C2OA 1K8XA 1N7KA 5FF3A 4ORIA 3B06A 3I65A 3GXTA 4IX2A 2QKFA 3P61A 2C1HA 4CQ8A 3LRMA 3KVKA 3W73A 1M5WA 3L21A 3W76A 4X22A 4JGDA 1C29A 3TKFA 4MYAA 3G1SA 2YGYA 1NF7A 3NPXA 1Z42A 4BWLA 2EF9A 3UWWA 3O06A 1IXOA 1JUKA 1EIXA 4IJBA 5AYXA 2JBMA 3D0CA 2GJLA 1KFCA 1B9BA 1P0KA 3NAVA 3IEBA 4UTUA 4E0CA 2G5WA 4QJ1A 2QF7A 1YTEA 1MEIA 4MY8A 1JCJA 5FEWA 1VHNA 4JTSA 1EX5A 1TPDA 2P0OA 1SZFA 2ABAA 3TU9A 4JEQA 3W7LA 3TW7A 3W3OA 4LTSA 3A21A 1GVRA 1O95A 3S1VA 5FEZA 3EXTA 4LC6A 3LM7A 4UXDA 3G1AA 1J4EA 4WXZA 4O8RA 3O16A 4PA8A 3G1XA 3TFCA 4QM1A 1L6YA 1Y0EA 3BGGA 3PUOA 4JTKA 5LNUA 4J9JA 3WK1A 2V2DA 5IM51 3W84A 3EX2A 1LORA 4XUGA 4RJEA 3DI0A 2V81A 4D2JA 1Q6QA 2VENA 4DELA 3HIJA 1ME7A 1QMLA 4H3DA 1GYLA 4LVFA 2BLEA 3PSWA 4ZQCA 5D2WA 5K9XA 3GIYA 3M16A 1A53A 4NNAA 3SIZA 2QCLA 3C2RA 2NXGA 4DPPA 1XDMA 1JQXA 3H55A 1FUYA 2V8ZA 3BW3A 4IMGA 2E6AA 3W2MA 2Q8ZA 1Q6OA 2J88A 3CWNA 3W7EA 4IX0A 3U8GA 1YYAA 3STCA 4QAIA 5K9DA 3C8FA 1JRBA 3KX6A 5I3KA 5DXYA 1L6SA 2XN2A 4ONVA 4O19A 2P10A
chains in the Genus database with same CATH superfamily
3FKRA 1Q6CA 1HF6A 2AQOA 3S42A 3WLSA 4LVBA 3LBOA 5K4XA 1ONEA 4U5IA 1OF6A 5FSEC 3W24A 2J6XA 3E0FA 1O5XA 1YNYA 5I2UA 1GUVA 3B9AA 3KDNA 1NDYA 3ZJ6A 4BHYA 1P7TA 4OQVA 1UKQA 3V16A 1VBHA 2DT0A 4YTRA 2AQWA 6TAAA 3EWUA 2DZVA 3QJAA 2X30A 3LPGA 4AB4A 3KLLA 3BDKA 1DBTA 1G0CA 1GOQA 1PPIA 2KZHA 3N34A 4G1NA 3QW4B 4QNWA 3GW3A 1WE5A 1OGSA 3L0GA 5J5DA 2VEMA 3SUTA 3RCMA 1W5QA 1S2WA 5T26A 4R9OA 2XH2A 4QE5A 5HMEA 5EA9A 3VIMA 5ABTA 3THCA 1H7PA 3UZXA 1F5ZA 2YKKA 3VIIA 1E4IA 3CQIA 4FOJA 3ZO9A 4GLEA 2RDTA 2VDIA 7XIMA 4UQAA 2CLMA 1QPKA 1OFPA 4NP7A 2A4AA 1F05A 2VZUA 2Y61A 4IP7A 1UC5A 4XAFA 5TD4A 4KRTA 1GNXA 2XN0A 1W8GA 1HP4A 2I1OA 2IS7A 4NVTA 2YX0A 4WJ8A 3KOXA 3UCDA 1Q6EA 1J6PA 3WEMA 3ID7A 3TZNA 3TMQA 1N2VA 4PB3A 2ZUWA 3ITOA 4H7VA 1RUSA 4POCA 1K4HA 3NZQA 2XGZA 1F6YA 3CT7A 2E28A 3V5CA 3AMLA 1IXPA 3K8LA 3TOYA 2ZA3A 3N73A 4DBEA 1BSIA 4W88A 4HSHA 2VKZG 1YPXA 1PX4A 1PKLA 2ISDA 3LSBA 4ZSTA 3Q65A 3AMGA 1JG9A 1PB0A 1DQUA 1UQZA 4UTKA 3P84A 4D8LA 2DORA 1DE6A 3STGA 6ALDA 3G2GA 1S38A 3PZGA 4XX6A 2CYGA 4FXJA 4DEFA 2OT1A 4GUJA 4HU4A 3CPRA 1E6QM 1EC7A 3WYZA 2MANA 1JI2A 2PS2A 1DTUA 3MT1A 2QCDA 3A4WA 1KRMA 4LCRA 3MWCA 4W5UA 4WCJA 8RUCA 5HA7A 4FNPA 1RLCL 3KLKA 1Z6KA 3IACA 4CQDA 3LBMA 5LNVA 3CIWA 4URIA 5JH1A 1I9CB 4Q7NA 3TYDA 3GZAA 1HKKA 3BO9A 4PC8A 5I3DA 1W5NA 3UD6A 3TFXA 3SCUA 1ELSA 3A5VA 3S4TA 2Y85A 3D5HA 4K39A 5EFFA 3MJYA 4H01A 1MUMA 4DF2A 4FX8A 3SDOA 2PF0A 4RR4A 2E8ZA 3ZJKA 4AD1A 2YBUA 4NYYA 4O4VA 4UCFA 3IIVA 2Z2UA 4IIFA 3DI1A 1KQYA 4DJFA 1UH4A 4GUGA 1JCNA 1X98A 1JRCA 4U3AA 2ZBTA 1UP2A 4LYKA 2EJAA 1KV5A 2VDHA 2WMJA 3NL6A 2PTZA 2ZRXA 5CAKA 1AW1A 3ABSA 2WKLA 3WF1A 3QN3A 4KWVA 1E6ZA 2WCGA 5BWFA 4MZ1A 1WP6A 4I3GA 3TUUA 3VD3A 2XG9A 4L61A 4NY2A 1OZQA 3R58A 5DBUA 1V3LA 4PMQA 3T55A 1XLIA 4KCVA 4LT9A 3FGCA 1DWGM 1X6UA 1QBAA 3NCOA 6XIAA 1UJPA 5A6KA 2Q6ZA 3OYXA 3RJYA 3MVTA 2FHCA 3QM3A 1CGVA 2PF8A 2IMRA 3DFHA 5LIYX 4KWSA 2E1WA 7CGTA 4WJEA 3N3TA 2J77A 2V5JA 3TW6A 1WZAA 2V9DA 4YXGA 2PWVA 4IMAA 3H2MA 1I2QA 4WGXA 2RHGA 1TV7A 2PURA 1NP0A 3BUVA 2QGHA 2A3LA 2PDNA 2GVEA 3DG3A 3WFAA 3V36A 3GTFA 1OX4A 4PB4A 5CZ0A 4LS0A 1I75A 1D3HA 3AI0A 2E67A 1TE6A 2NQHA 2V5CA 4IG2A 4CN1A 3ARVA 4PTWA 1R87A 1WDQA 2X0HA 3UG3A 1TPEA 3E0IA 4MNLA 3ZR5A 2V5KA 2GLKA 2GUYA 4AIEA 1XYAA 3MMWA 1XIBA 2IKGA 3T05A 3CEPA 4FHAA 1NFBA 3STPA 4H8VA 1A3XA 3R8HA 4JNMA 1XH2A 3A47A 1L6WA 1XV8A 1Q66A 3LHZA 3EOEA 4ALDA 1GOWA 3K2GA 1LRQA 5CG0A 2ZWYA 3GYEA 2YCJA 2WSPA 2YLAA 4BCEA 4HGXA 2XVGA 5CEWA 4TXEA 3L66A 3KVLA 2BSLA 3O1NA 1A5BA 4ADUA 1X97A 2DY3A 1OFDA 1NEYA 3E12A 3KBVA 3SN4A 3ZLFA 3DYPA 2QIIA 5HWJA 3MHFA 3AXKA 1BSLA 5XIMA 3VGDA 4DO7A 2QCCA 4BF9A 4RW5A 1VJIA 4AD0A 1UWQA 1F8IA 2RDWA 4MUPA 5C2CA 1XHGA 2J7HA 3DGBA 5G5IA 2Z24A 4UFMA 4WRHA 3GTIA 5DELA 1ZY9A 1VP5A 2Y8UA 1PVNA 1G69A 2WNNA 1QNOA 4GABA 4LW7A 3ARPA 1TKKA 4DM2A 3EZ4A 1C8VA 4LQ1A 7TIMA 1OT2A 2WKGA 1UMYA 3CO4A 3CPUA 1SM9A 2J7GA 3B03A 3QR1A 5G2HA 4AY8A 2A3CA 3GX9A 5AHMA 2PODA 4LY8A 2ON3A 2GVJA 1H1YA 1Q6FA 1B2YA 1OHLA 5CBJA 2G3IA 4UMBA 1PKMA 1NOWA 2D3LA 3CTLA 4LUSB 2OVLA 2D0GA 3VMPA 2OFJA 4N9DA 4B5TA 1ONRA 3SUSA 1Q65A 3N4FA 3OQ8A 1HFBA 1J5SA 1T8QA 3P7YA 2A3EA 1TPFA 3IUIA 3KS5A 2J78A 4XQ6A 3W27A 7A3HA 4N9CA 4IUGA 3VD7A 1A5UA 4IPLA 1FX6A 3DZ1A 4Z42C 1CB7B 2NT1A 1A3WA 2PTDA 4AMAA 4PN2A 5F2MA 4BS0A 1GVQA 1KM3A 3WLPA 4DNHA 4AW7A 4WXYA 1TA3A 3T0BA 1KM2A 4ECLA 1HJUA 4H9ZA 2NQJA 4Y96A 4JDBA 4UQCA 1E0XA 4IFRA 1A5NC 1ENUA 1XM3A 2WVTA 1W3TA 4AWSA 2OWCA 4AH7A 5DN1A 1DWIM 4NRRA 4LV4A 1MSSA 2OQLA 2PLJA 1XCFA 4B3LA 4UQ9A 4G2DA 2G4JA 4W84A 1UASA 5FJPA 2QIWA 2VR4A 1FWWA 3E0VA 1ME9A 4IMEA 3WBEA 4DLMA 4M5PA 3APGA 5HAOA 2WHMA 1KTNA 2HXUA 3GDTA 3M7SA 1UD8A 5AHLA 5I3FA 2GDVA 3VI2A 4LAUA 1XIJA 2DZWA 3WF3A 3N4AA 1KWKA 1RY0A 1LWIA 1CGYA 1XCXA 2I5QA 3LHYA 2AL2A 3AIRA 3WX7A 3W1QA 4D6IA 4RZ4A 1FP8A 3HFYA 3K5XA 3BOXA 2NVDA 1Y5VA 1TPB1 2Y24A 4RXGA 4MG4A 1VLIA 1ZCOA 2XM2A 1HP5A 4YVVA 3S2CA 3DGRA 4HNNA 2VFEA 3FFSA 5CJ5A 3TJXA 2HPIA 3LZ3A 3CM4A 2PE4A 3OVGA 5F2IA 3RR4A 4GG9A 3WSUA 4FIRA 2FTYA 1UIOA 1YE6A 1WB0A 1AQ0A 1WO2A 2E7FA 4Z1DA 2JF7A 3B97A 4KMQA 3INPA 3RNDA 3MYPA 5H8PA 4XVDA 3GU9A 3B8UA 4KF1A 4JKKA 4FR6A 2BHUA 1TUXA 1IF2A 4PUDA 1A0DA 2NX9A 4ZE5A 4CU8A 3W1UA 4XKMA 1W3IA 4E8CA 2BHZA 1LROA 4O1EA 3HV8A 3VTRA 2FDSA 4LY4A 1V79A 2VWTA 1SZRA 3T0AA 2J74A 4S2CA 3HQ1A 4HSOA 1JZ4A 4OUEA 2NZLA 4Q4MA 2EKGA 1MXSA 2V30A 1K8YA 3TJ4A 2TPSA 3AJ7A 3S1GA 5HXMA 3OTRA 3E2RA 3TAKA 4TU1A 1SFTA 4LX4A 4U3CA 3LTPA 1S2AA 5JIPA 1KR0A 3FYOA 4J3TA 5FEPA 3SQSA 4XZIA 2W27A 1M7OA 1VKFA 3S5OA 3W4RA 3AAMA 3B05A 3Q4DA 1OSEA 3EX1A 6REQA 1YPFA 3LPFA 4P8WA 4B15A 1HJXA 4XZHA 5DLCA 4GUHA 3WQFA 4Q8TA 5HNTA 3NL3A 3EDDA 2V38A 4LCSA 5D09A 4MNMA 3VUSA 2BHYA 3NPWA 2VX6A 1M01A 3AHXA 4O50A 3AHYA 1UR9A 3G0XA 6XIMA 2DJXA 3C6CA 3VIKA 2PTYA 2X0YA 3TYBA 4AZCA 3N2TA 5E70A 2Y62A 3PJWA 1E1CA 2REQA 3GDRA 3VD5A 5HPCA 2ZE0A 2V0TA 3SSJA 1XYLA 1KRBC 2CHRA 4AZHA 1H3GA 1YBQA 3NQCA 4L1GA 2R1PA 3T6CA 1VZWA 1MUWA 3W25A 5DANA 3QPZA 4YPJA 1YDNA 3AS3A 3ONCA 1IT0A 4LJ3A 4MB1A 4H7ZA 3B8TA 4L9YA 1W32A 2E8YA 2YXOA 1J0HA 1KBIA 4DBDA 1PYMA 2C15A 3HTWA 2XVLA 4IMFA 3V0SA 3JW7A 3P8IA 3GBDA 1LJYA 4LB3A 3H6OA 2A3HA 5AOUA 2DT2A 1MW3A 1UKTA 3MTWA 1GVIA 2YYTA 3CV7A 4XWUA 3H2AA 3NUKA 5LIXX 2WVVA 4DF0A 3VUPA 1P1XA 3DUGA 3FOKA 2E9BA 2OT0A 4R53A 1R30A 1HGYA 3N2XA 2CBIA 3SI9A 2KX9A 2GGIA 1TR1A 1QNRA 1SJCA 2VR5A 1IT8A 4OOZA 1TPH1 1WKEA 5IBXA 2XIOA 1GONA 2OQYA 4QAWA 3QMSA 1K9FA 3ZYZA 3PUEA 3L68A 4PEEA 2E09A 4ZA0A 1ZJHA 1E40A 3BARA 1IEQA 3MU7A 2V67A 3U4AA 3Q67A 2CZEA 4YYFA 3EA3A 4NAEB 1BLIA 1PWMA 2I9EA 4YL2A 4YLWA 5FJIA 5JMUA 4ACZA 1W6TA 3MKKA 5LIWX 3QHOA 1WX0A 4R7OA 4DO5A 4FNRA 2V5BA 4CQAA 4YMZA 3UJSA 1OGGA 4IP4A 1J0IA 1B31A 5CLWA 1UQYA 1QOPA 1W1IE 3GAKA 3JUGA 2PWHA 3MBFA 1CI1A 1ZRQA 4KCUA 4KGLA 2DZPA 3QHMA 4FX6M 3ISIX 4JTHA 4AYSA 4L9ZA 1EJRC 3BG5A 1K7EA 3ANYA 2OR2A 2RGMA 2WSRA 4UTIA 2H3DA 3FKKA 5DCDA 2JE8A 5I5RA 1FXQA 1JAEA 3HPAA 4U33A 2WB5A 3PWGA 1JVNA 1R9XA 1P48A 1LUCB 3W86A 2R6OA 5AHNA 1VEMA 2HVMA 2DIKA 1DXIA 1MEWA 3PY2A 2CW6A 3UWQA 2ZXAA 1IXQA 1MWOA 4PL2A 1PEZA 3LHUA 1JDFA 5K4ZA 3D47A 4XZBA 1D8CA 5L9FA 5MKGB 1OIFA 4K7VA 4L4MA 3MMUA 3RM4A 1ICSA 3O0FA 3A4XA 2C71A 2XM1A 2JIWA 3AMKA 1XRSA 1VYPX 4NZJA 2V3GA 4FLOA 4P5UA 3TYAA 1A4MA 3TROA 1WYIA 2CFFA 4QJ3B 3WH8A 4HU0A 2FMOA 5JBEA 2O9PA 3BLDA 4D1JA 1JPKA 3WN6A 2P8CA 3GB6A 3DERA 4WSJA 5KZDA 3WY1A 1P0DA 4JQ3A 3EWWA 4RPQA 1QO2A 1XP3A 2FIQA 1J0JA 4K1WA 2FHBA 3P82A 2VVSA 1V6WA 1N8FA 1LTDA 2QDEA 4S3BA 5I77A 3NQ7A 4GIAA 3WQOA 4F79A 3HG4A 1EF3A 4E2OA 5HK4A 3T2QA 3PN8A 4MLJA 4MUZA 3NURA 1KXTA 4ZO6A 1UC4A 4J2PA 1G1YA 2A7RA 4G6CA 2PI6A 4QR6A 4OTKA 5FJOA 2A6NA 3G1FA 1ISXA 3RX4A 1AH4A 2CWXA 4WKHA 2DSUA 4LBSA 3UY7A 2G8ZA 3PZUA 1JUBA 2QCHA 1J5TA 4DZIA 1QW7A 1WQ5A 1M04A 1QWGA 4NQ1A 4PBEA 3VM7A 1JJKA 3F1QA 2OJPA 4UNLA 1TPWA 4R33A 3CL6A 3I4KA 3UXAA 2BOEX 5CGQA 1HTIA 2WHKA 3PJTA 2B7NA 2BGQA 1BWKA 3DXIA 1Q8AA 1K6WA 2A1YA 3LYEA 4X2RA 1VRXA 2PDYA 4Y9AA 1CLKA 1UUQA 1H1NA 2FKPA 1CYGA 4KEMA 4W7VA 3W9ZA 2O55A 1TIWA 2INFA 1XIHA 3W23A 1CGTA 3UJFA 1DJXA 5J04A 3TCSA 2ZRVA 4JR5A 2XN1A 1GYNA 4K68A 4UNKA 3OU8A 4PUJA 3ZMRA 3RITA 3NDYA 4PCNA 1SZNA 4US5A 3AHVA 4MAVA 4O13A 3CUFA 2VXNA 3A9BA 2TRSA 2BVDA 2X1UA 3BICA 4QJ4B 4DYEA 1CBGA 3QC3A 1V4YA 2BNJA 2SFPA 1E51A 1HZYA 3I6RA 3KOYA 1NOFA 4LS2A 3T1GA 1JXJA 3C2VA 2GWNA 1E1EA 2Z7GA 4K7YA 5AC5A 4FIQA 4O52A 3SEPA 2GWGA 4DBWA 2W3ZA 4NZFA 3FNDA 5HDRA 4XO6A 3BLLA 2EKCA 3QOKA 5C9XA 3TTQA 3SIMA 1DP0A 3KBNA 2CLEA 1OQFA 4GNJA 4EKJA 3OLEA 2VFGA 3DC8A 4XB3A 4U28A 5JBFA 3KZSA 2XIBA 5LSMA 1XXXA 2DJLA 1TCDA 3KVMA 1FHDA 2VRKA 2R94A 5T8GA 1XRTA 4BY3A 4I5XA 3HQNA 4REQA 1IR2A 2PEVA 2BWGA 1EDTA 2QV5A 3S46A 1XW8A 3CPGA 1ZJAA 4L7ZA 2QCNA 2A0NA 3V5OA 5AYIA 1H50A 2VTFA 1F3XA 1US3A 4D6GA 1DIKA 3EWCA 1GT8A 2ZVIA 4W89A 3ZVHA 4F4RA 4HPHA 4GA8A 2E77A 4ZQPA 3LTSA 3O63A 5D2TA 2O4MA 3UYCA 3I7RA 4D6HA 4FB7A 1OEPA 4DO4A 4GYFA 1WDSA 3WLHA 3MCOA 3OVPA 3SB0A 1MNZA 2HRWA 4K1GA 4R3UA 1EA9C 4S3DA 3OZOA 4QTGA 1CGXA 1HT6A 1XINA 1BWVA 4MMWA 3OHMB 3ZLGA 4MY9A 4IL2A 3F4VA 4HPGA 5G4WA 1O60A 3WNNA 2PDLA 4L1WA 4DJFD 5EMYA 2ACSA 4FZIA 4GUFA 5BXPA 4Q4QA 5U4NA 1IGWA 2CWNA 5IDZA 2R9RA 4NL1A 1JD7A 3IUDA 3TYZA 2F84A 1OADA 1HKVA 1RQHA 1FY6A 3G22A 3QW3A 3G1HA 3KCOA 2F7FA 2NWRA 1ODUA 5I6SA 1XWYA 2WMGA 1S1RA 4PMZA 1R3VA 2CKRA 1Y7VA 1XIFA 1D7KA 1RAKA 2GJPA 1PHWA 4GI9A 4N9BA 3F2BA 4EX4A 4PUMA 1ZSXA 4MB3A 1SMDA 2OU4A 1KGWA 4UTFA 5AYBA 2HSAA 1NJJA 3AS1A 2ZUVA 3B0YA 1MXDA 3MSYA 4HN8A 3IIXA 3M0YA 3QHNA 2P88A 1F61A 4Y2WA 3MDUA 1OCQA 2XVKA 3SRDA 4DQWA 3NQEA 2I5IA 2V2CA 1Q63A 2Y7DA 5HQEA 4AD2A 2ZADA 3WELA 2OX1A 3DKLA 4WUIA 4YIWA 4MDPA 5AY7A 2EPNA 1VBJA 2R8WA 2XPKA 1TZ9A 1ME8A 4MTVA 4RDWA 4X60A 4KFOA 2GJRA 4MF4A 1VPQA 3G5EA 4XO7A 1BFNA 3S47A 2IUZA 4S3AA 4UCGA 4GACA 1XPGA 1ZCCA 2E68A 4N6FA 3VKJA 2RFGA 3DBNA 1Z44A 1THFD 2HCVA 4TV5A 3UZ5A 5D33A 4KWOA 3GDKA 1V3JA 3H53A 4UOZA 1F2JA 1BRLB 3MC5A 1A5MC 5GJNA 2XTKA 3LN3A 4IZGA 3ONBA 5HJXA 1XD0A 4DBSA 4XD6A 4B5NA 3NL2A 4NUWA 3GWQA 4ADTA 2NXHA 1DJHA 2YFNA 3JR2A 1KM4A 3P6LA 2WV8A 4C7FA 3VYLA 4QS6A 4Z08A 3RX3A 4M1BA 2WNWA 3TX9A 5EMKA 3RRXA 4PFHA 3ELFA 4V33A 4QIUA 1TWZA 3ZS4A 5C5YA 1RLDA 1YADA 3QQWA 2HISA 4GXMA 4UB9A 3GVGA 2D2OA 1E9LA 1J0ZA 4ERGA 1ECEA 1TUFA 1FHUA 3KP0A 4HMNA 3EXSA 3MBDA 3NSNA 2JIEA 5A8PA 5HPOA 1BQGA 4CN4A 2HPMA 2PB1A 1EEPA 5G1TA 4ZL1A 5D37A 3H54A 1YKWA 5K7JA 1EYEA 2X2GA 3WUGA 2GK1A 2VZVA 3LMYA 1A0EA 3GR7A 4Q4PA 1R3RA 3W1MA 1UIPA 1QOQA 3PC0A 1B3VA 3BOFA 4M6PA 1H5YA 3SY5A 4L4LA 3RLHA 3UPBA 4NIRA 4P8VA 1UR1A 3VC5A 5FJRA 3CV6A 3NIYA 1TR9A 3U5YA 2CZDA 3SUVA 1Z32X 3CTTA 3EB3A 4F0KA 4X9SA 3KOWA 4JTCA 2BG5A 3E5PA 4Q33A 4EPEC 3WMSA 4QLJA 2QJMA 2NX1A 4BA0A 2FPVA 4D72A 2YJQA 3G8RA 3O8AA 1OFAA 5EYWA 3TK7A 5HUPA 5F7UA 4D6DA 3DDMA 2PP0A 4A29A 3BAKA 3MO7A 2VC5A 4YHGA 3TXVA 1W2VA 3BOLA 1GJPA 2CXEA 1IV8A 1V0MA 1OFBA 3MB9A 5FAGA 5D8WA 3TOPA 7REQA 4LWWA 2BX7A 5HQMA 3UZWA 2CHOA 1D3CA 2Q71A 5H1WA 1V3IA 2Y4SA 4JIPA 3GC5A 4UZUA 4OU1A 5HBFA 2D2JA 2O92A 3UR5A 1PX3A 2X2YA 4FLQA 4RPPA 3Q58A 1I2RA 5T91A 4HPNA 3H23A 4PSPA 1G9HA 1D9EA 1XRVA 4JOMA 3MV11 1BTCA 1GKQA 4HYVA 1X7IA 2IKJA 3C2OA 1ZBWA 1K8XA 3ZQ9A 1N7KA 2X8RA 1UKPA 3TR9A 2QKFA 4ML4A 3LRMA 3UESA 3VAVA 3NDZA 2ZICA 3L21A 3N25A 1UW9A 3W76A 4X22A 3G1SA 4B9ZA 2PDXA 4CUCA 1K70A 1XQLA 1I0DA 3FDKA 2EF9A 3H7VA 3O06A 1EIXA 4B16A 4IJBA 2JBMA 4BQ4A 1KFCA 1HJWA 3IEBA 4E0CA 4QJ1A 2QF7A 1YTEA 1QI2A 3SCNA 4B5WA 4LGXA 1JZ8A 1VHNA 3PHAA 3EDEA 3O7UA 1JGMA 3CAVA 3W3OA 3A21A 1PZ3A 3S1VA 1B90A 5FEZA 1Q2RA 1S2VA 1Q4NX 3TJIA 2PDCA 2NQLA 1VFMA 1X96A 4O8RA 4PA8A 3G1XA 1LT7A 1Y0EA 4Q8WA 9CGTA 3WO8A 4J9JA 4F2UA 3WK1A 2V2DA 3LA4A 3W84A 3EX2A 2X41A 1LORA 4TOQA 1E6NA 4D2JA 3KUMA 1ME7A 1VEPA 1LT8A 3PSWA 4FOUA 1QI5A 3M16A 1T40A 2VEGA 4NNAA 3VINA 3C2RA 2NXGA 2J79A 1JQXA 2V8ZA 4ICCX 2E6AA 1DJIA 1VJZA 1Q6OA 1AZ1A 3RU8X 5K9DA 5I3KA 2XN2A 4ONVA 4O19A 2P10A 4MWAD 4BEQA 3R94A 1M6JA 1WUEA 3CZJA 4JFSA 3RCYA 1WAWA 4LEFA 5C0QA 1VEOA 1JI1A 5C2GA 3PG9A 5DMYA 5A6TC 2OLSA 4PR4A 5DBTA 2Y70A 2DVTA 1BF2A 4JTEA 4NZ3A 5F2LA 3WMBA 3CMGA 2AGTA 1H7RA 4A22A 3COTA 3HBLA 3NO1A 3MUIA 2VEFA 4NILA 3TYUA 5C6MA 4DJDA 4G7FA 1VCVA 1XLCA 1L8PA 1QW9A 3BPWA 2E4TA 2VOTA 3CUXA 3KTSA 3K8KA 3VMNA 1DWAM 4MFDA 2QJHA 5AHFA 1VHCA 5BOFA 2J47A 4F0HA 3UWYA 1OCBA 4IHCA 3BAWA 3BLPX 2QAPA 2JQXA 1JCMP 5CC5A 5J8LA 4DVOA 2WXDM 1ZGDA 3BV4A 3OA3A 1XLLA 5EGRA 1B54A 1E55A 2QCEA 4AF0B 4ZZ9A 1IZCA 4HBKA 1X6NA 3QC0A 4IFKA 2FPTA 2DEPA 5H91A 4DUXA 5AVNA 3BGAA 3VNJA 1H63A 1ZBVA 1N8WA 3S6DA 1UMLA 3G1DA 2V69A 2YCKX 2IXUA 3N2BA 3L5AA 4M7TA 3SGUA 4EP8C 1YW1A 1RR2A 1XLJA 4M82A 3FEQA 3TSDA 5LHFA 1XG3A 1ZAHA 3UEQA 4LUTA 4QE1A 4AZ6A 2V3FA 4ZMGA 2JGQA 1W3LA 2R24A 3T7VA 1VIZA 5DFAA 3LRLA 3UQNA 3U6WA 3VGHA 4CVWA 3W87A 3MS8A 1L8NA 1P6CA 2HWGA 5DRIA 2BXVA 2CHNA 1XYMA 3ENLA 2YDQA 3VNYA 4GJ1A 2YDRA 2BASA 2XH7A 3F4CA 2ZUUA 4WSHA 1OM0A 2X40A 1EJXC 1KTCA 2W79A 3NZGA 5DX7A 1SUXA 1IZJA 4EAMA 1SZEA 1JNEA 1EF2A 3CO8A 4TIMA 3TN6A 4WY0A 3GYCA 3ZT5A 1X1NA 4RZ5A 3WQPA 4PODA 3E49A 1IIHA 4H8NA 1R2RA 3LNMA 3TE9A 3R5EA 4AAJA 5TBOA 1WXJA 3USBA 1VR6A 4XKYA 3IK2A 2EPLX 1U5VA 4WDTA 4GQBA 3MP4A 2BGSA 2PGFA 3IIOA 4EOUA 1WDPA 4F2TA 1OX6A 3CB3A 1V6TA 2ISSA 3WBYA 2OSWA 3IVTA 5G4HC 3RIKA 5D30A 4OOUA 2VHLA 3K4DA 1EXPA 3QZ6A 1QNVA 1TG7A 1YEYA 3R43A 3HGJA 1O7AA 4QDPA 2YXGA 4GVFA 4UTMA 2XVNA 3LHTA 1QWKA 1QVBA 3FA3A 2VWSA 3NM1A 1O5KA 2FFIA 3FLUA 3N3MA 1EXBA 3GHUA 1TRDA 3MSDA 3M07A 4JFTA 4JEJA 1W1TA 4WKFA 1W1YA 2CEQA 1KBBA 4IM4A 3TWAA 5C9WA 3HU7A 5I00A 4UZSA 1RHCA 2GYIA 4BZYA 3BAJA 2ATMA 1SR0A 1GOKA 5AYYA 3RAOA 1UA7A 4H8UA 2Y63A 3V0UA 2ZTJA 1O1HA 5A6BD 3W1TA 3SR7A 1HQTA 3FHAA 2VFFA 2DSKA 2XGBA 2B7QA 2C1GA 3BW4A 5AC4A 3PJXA 1YNPA 4N4QA 2GZXA 2TAAA 4MJ4A 5B7YA 2WC4A 4ERIA 2AMXA 1VIWA 3NXLA 4JQ4A 4LAZA 3PZMA 1OK6A 3KDOA 1MXGA 3CZEA 4QS5A 1ZZMA 4OVXA 4QITA 3DAQA 2WMHA 5DMNA 1ITXA 3SCSA 4J3XA 3RILA 2JKAA 2ZDSA 3BMVA 3ALGA 4H7CA 2WBGA 4H41A 3UWEA 1FCUA 3F5KA 3N2CA 4M6QA 1DQWA 3C2EA 4WDXA 3DC0A 4CU6A 1T99A 4EIVA 1XJBA 5LIKX 5I3GA 3TN4A 1DL3A 3S3GA 3FYYA 4KERA 4V27A 2GPTA 3FX4A 1UWAA 5FI8A 2C19A 1KFJA 3Q37A 3W72A 3XISA 4GYPC 4U31A 1KWGA 3EB2A 1A3HA 3BV7A 3DYMA 4UNIA 5CC7A 5HQLA 1IQ8A 1HIZA 1LF1A 1YXDA 3PSVA 1LG1A 1UWTA 3WK3A 3JVAA 3YPIA 1F76A 4M7SA 3VGBA 1EJUC 1UOKA 2YL6A 2ZZ2A 3OPSA 4Z0JA 3SCRA 3ZR6A 2NQ9A 2QPXA 2AOSA 4KIRA 3IJ6A 1M03A 3QH2A 1VH7A 4Y7EA 4S1FA 4ENLA 2D23A 3CV1A 4PMJA 4MZYA 3THQA 2V2HA 2EXOA 3KL5A 1EO5A 4FA3A 1X8FA 1V7AA 5GNYA 1NOUA 4TMCA 5M3WA 2C8NA 4E2DA 1JCXA 3I7SA 1AH0A 3S5YA 3ZSSA 4NI8A 4LANA 3N4EA 1GOXA 2DZXA 5CZJA 3OIXA 2W91A 5DF0A 3VCRA 5L6UA 3PAJA 3T2OA 4WVXA 3VKKA 3UU0A 5CPLA 4GFIA 4NU7A 3IRDA 1UH2A 1K7XA 3S2MA 5I09A 4K8EA 2YCLA 5F4WA 4UMAA 2W0UA 5M17A 2ZC8A 5BMXA 3TSMA 3CQJA 1TTPA 3SFWA 1TV3A 4A8IA 1ZP4A 1PUDA 4YVXA 1L6FA 1U5JA 4JTIA 2X16A 1AJ2A 2PSNA 2C79A 2ISWA 4NXKA 4TO8A 5LA0A 4AZIA 3TYEA 2QVNA 2FHFA 3LTYA 1Q6LA 1F7BA 4EWND 2Z00A 4ZR8A 1GZ1A 1TA3B 4K36A 1JZ7A 1UJQA 4EF9A 1A5SA 2RAGA 1XGZA 3W07A 5D2XA 4HCLA 2WCAA 2PCQA 2VC6A 4QLKA 2D22A 5HWNA 4JN6A 4FEZA 1FVPA 3UPWA 5LNSA 1EOKA 2FZMA 4EPDC 2O9OA 3EEZA 3TONA 3R25A 3QFEA 3H2NA 3RDKA 3UERA 3F4WA 4QQUA 3N15A 3FJNA 1ZTVA 3GAYA 2G37A 2EO7A 3GG0A 1SU5A 1RZMA 5FESA 3PTQA 1JGIA 4ILSA 4Q3MA 3GKFA 4WOQA 4OBRA 2DZBA 3QQ1A 3CIVA 4JY8A 3PS7A 1KGXA 4Y9MA 3PWAA 3WJWA 4PTDA 2DUAA 4LAKA 4AUBA 4C6BA 4O1AA 1KNWA 2OEKA 3GXDA 1WNOA 2X09A 4P7RA 3MWAA 1ZBKA 3IJ8A 4JIHA 3CMJA 4IH3A 3SRFA 4PTNA 3CLMA 4Y9OA 5G1MA 3IUHA 1RBOB 4WDWA 2ZFAA 4KFNA 4DBUA 2VEIA 3WH9A 3GU2A 2H90A 3SADA 2INZA 5CPMA 2VOMA 4Z2LA 1H7OA 2R82A 5F2GA 1CXKA 3G1YA 4C7GA 1OG6A 4B92A 4LYQA 3FJ6A 3EA2A 3JS3A 4ZCWA 2Y89A 5CSUA 3OG2A 1XIDA 1A5AA 1HL8A 4JXCA 2GUBA 4LUIA 1GVYA 1QRQA 3W6LA 4HHLA 2ZZ5A 4U5KA 1QPNA 4OJYA 3UF9A 3FAXA 1DV7A 3APYA 1T6MA 2VGBA 3KTXA 5I07A 2WJDA 1JYXA 3RCNA 2J25A 3LERA 1EJ7L 4Y9PA 3WD4A 2DPEA 3AXXA 4M56A 5KZ6A 3WQCA 1SO3A 3UYIA 3W29A 4S39A 5CPNA 4AFYA 3DFSA 3CZKA 2FTPA 3WLJA 3OEXA 4Z2GA 1S3HA 1TRIA 1FWGC 5A2CA 5K9CA 3G8EA 1KQZA 5CQ1A 2CLLA 3WQEA 3MHGA 2OYLA 4O28A 1CXHA 2GJNA 3TVAA 1JDEA 2NUXA 4RXFA 2YB1A 4GVIA 3WJYA 4OBSA 3GIQA 1YTKA 1SMAA 4X3ZA 3VIFA 2DUZA 2OZ8A 4DLFA 4GI4A 1GQNA 3G18A 7ENLA 2R91A 1LYXA 1GW1A 2ALDA 1W1ZA 1MVYA 3UXLA 1Y5WA 2B7OA 1XF0A 3M0IA 3TN5A 3W6MA 3DKJA 1VGAA 1SJAA 1WZLA 4B5UA 4AEOA 3GHRA 5E0KA 3NQAA 4UR7A 3E2SA 1MMFA 4GD0A 4RE0A 4AU0A 2PRMA 4MYXA 4XV0A 1F3TA 1FOBA 4XBJA 2Z29A 3EAUA 8XIAA 2I17A 2CITA 1YBQB 3IJIA 4AVFA 3RFAA 9RUBA 3PM6A 2EEXA 3DH7A 4Q8PA 1AVAA 1RV8A 1HUVA 4W8BA 2PTXA 4GI8A 5M5DA 2HNEA 4JTTA 1R46A 3LCHA 4YN5A 3C8NA 3R0DA 1TPUA 2IQTA 4M81A 1TVNA 3MHUA 1GTEA 2QPSA 4A6GA 2PP3A 4CU7A 1RVGA 1UPMB 2QDGA 2WMFA 3CHVA 1WA3A 2CLKA 3LQGA 4J35A 3EKLA 3VCCA 1GCYA 2W62A 4YTTA 3T2PA 1QI4A 1UWRA 4B5XA 2ZZ3A 4I5UA 3NQMA 4E3TA 4ML9A 4WR3A 2J24A 1POJA 4S23A 3KWSA 1QOXA 3DESA 3GDMA 5FJTA 3IRSA 3BMWA 2PUZA 1ZHAA 4C6PA 4QNEA 4JCMA 4O0KA 2J8FA 5BW6A 4XAGA 3B0UX 4MADA 1WDRA 4NT0A 4FNUA 3KRZA 3WDQA 1NF0A 4H9MA 3LLFA 4HMCA 1C92A 2VFIA 1P43A 2QZRA 1CWYA 5HANA 1NDVA 1QUMA 2J6VA 1QK0A 2A6LA 3WQWA 1OK4A 2Z6IA 1KM0A 1EFZA 3DX5A 1OCNA 2ACUA 4O57A 3CGTA 1ZFJA 2O9RA 4DJED 4TVDA 4L4PA 3QPYA 3W1AA 5EPDA 2POTA 2ZZ6A 3I4EA 3VNIA 4I7WA 2PU1A 4LNCA 4JN7A 2V5LA 4ADSA 2H3BA 4DWSB 4AG0A 3QLLA 4CNUA 3LBCA 3TC7A 2G3FA 3PPGA 4GHRA 3T09A 1BKSA 4C90A 4O54A 1DXFA 3QXBA 4BFAA 3M44A 4M6VA 5C9RA 2JALA 4H9YA 3N17A 3DHFA 2WHLA 2E40A 4UR8A 1GVOA 1T7LA 3TWBA 4AQLA 3LENA 1EJVC 2FGZA 4TTUA 2Z4GA 5JUVA 3PF3A 2CLFA 1AQMA 3TLQA 5G2IA 4PFMA 3VNLA 3MA8A 3C56A 4JTRA 4NZ4A 4KETA 1KCXA 2OB3A 2VR2A 1CLVA 3SZ8A 3LDVA 3B0VC 4Z0SA 1FWBC 3CZLA 3PWIA 4E8GA 2XH0A 3R1ZA 4QEEA 2NQZA 3U4FA 1IEWA 2FQIA 2PWFA 4W7WA 3TLLA 3EGJA 1AH3A 4XD3A 4P2VA 1C90A 4H1ZA 3R8RA 3A22A 1S5VA 1FWAC 3IANA 1NH6A 3MJMA 1UG6A 3IGHX 1E15A 1BAGA 3AIUA 1DQXA 1BYDA 2VP8A 4A2SA 3IJ7A 3B0XA 1PIFA 3ZFHA 4GX8A 3T81A 3NR0A 3BLFA 3W7NA 1W5OA 4X63A 4QE4A 1NARA 3ORWA 3VXGA 4DAFA 4UQBA 3NZ1A 2XZ9A 3N6HA 4U4MA 4XTDA 3S8HA 4GY1A 4CCZA 3W6YA 1KCZA 3K4WA 3VNDA 4FS9A 3A24A 3PBGA 5I0DA 3RO6A 1VFSA 4A8LA 4E2BA 2YPIA 3BG3A 4FO4A 4OIFA 1NQ6A 3TTOA 2GJXB 4QHRA 1IWAA 2C13A 5CPSA 1X39A 4MSSA 4JDYA 3WL1A 5EL1A 3IGUA 3G3MA 1W1VA 5AZ1A 3I10A 1BG4A 3EXRA 4BWLC 5LNWA 1VBUA 5EMUA 4C1NB 1R86A 1VC4A 4JBRA 3CUJA 3ZWSA 1Z9AA 4RE3A 3VIGA 3V18A 1Q6DA 4LCQA 1FH8A 5ABGA 3CL7A 1S2TA 3ZR4A 4MWAE 3QY7A 4WEVX 4A3HA 3I7QA 1E73M 3M47A 3Q45A 2D2GA 3U5UA 2WZMA 3SN0A 4GNVA 4LAMA 3MKCA 3RYSA 3L9CA 4B4HA 2TSYA 2EPMX 2P50A 4PCTA 4A4AA 4NXSA 2OQHA 4C60A 3UFYA 2Y7EA 1AK5A 4GK8A 1GVFA 5GQBA 3BAYA 4UFIA 4LUSA 1I60A 2ZA1A 4OBTA 2I9UA 1F74A 1PO9A 1V03A 3OBAA 5A8NA 2J8TA 3CK5A 3RMEA 4Q6JA 3AZRA 1TJRA 3PBWA 1T41A 3DBPA 2YLLA 1UD6A 3T44A 4YCPA 4NASA 1ODZA 3P62A 3PBMA 4IJCA 4JYEA 4JIRA 2RGLA 1VCGA 3LCWA 3UR8A 2GL5A 3EX6A 5CSYA 3VOGA 4KRZA 3FN9A 4GKLA 2Z26A 1IEVA 3G1VA 1MI3A 5BOOA 3KW3A 4AMCA 1H11A 4PMDA 4CNNA 1SW3A 4JX5A 1VYSX 1AODA 4Q4SA 1GOMA 4J3UA 3WH7A 3RRAA 5M2FX 3E96A 4Z2KA 1QTWA 2C0HA 3MP5A 3EOSA 4HZ7A 2QT3A 5D9PA 3K13A 4PUWA 3UR2A 4RUBA 3DFQA 2DQWA 1RALA 2CBUA 1TYGA 4EWJA 1PBGA 1T8XA 3CBWA 4HP5A 3O6AA 1LZOA 3DFYA 4CQ9A 4J28A 4GUIA 3OQEA 4AC7C 2PFHA 5D2VA 3W2KA 5TQLA 3KBJA 1DWJM 3S5SA 3HG2A 1EP1A 5FJUA 3EYPA 1JR1A 3WCZA 2ZX8A 2Z2BA 4ERAA 1GVSA 2V5DA 3OZYA 3WL0A 1PYFA 1XLHA 2VMFA 1ISYA 3B0PA 3GTHA 1M1BA 2A5HA 5I23A 1VBGA 3A3WA 4J40A 4PE8A 2PGEA 1ISWA 2VL4A 8XIMA 2YW4A 3UT0A 1G01A 4DPQA 3MP3A 1XPYA 3PB2A 2O56A 3ZT6A 1JF5A 1G4PA 4RKAA 3W7OA 1H1ZA 1S5TA 4LYRA 2IQ0A 2OGYA 1PDZA 3EMQA 2GGGA 1FHVA 4OUIA 3BL3A 1H4PA 3ARTA 1BTMA 3W26A 3EMZA 2J13A 2FLIA 1KM5A 2HJPA 2ISVA 3P8JA 1TZ7A 3WDJA 3H2CA 3M5ZA 1HJQA 3I68A 3WEOA 2C16A 3VCNA 1QI3A 2XUCA 4LUYA 4WKAA 3HURA 3LV5A 3QYSA 4PMVA 1H62A 4FOKA 4YTUA 1XLBA 4ZB5A 3WD2A 3ZT7A 1BXNA 4F0RA 3FA5A 6CGTA 1N82A 1W2PA 1ZJBA 2PLMA 1CXFA 4BQ5A 2PWDA 1ZUAX 4CLMA 3VOIA 3GY1A 4JIIX 4NRSA 5DMLA 1J9YA 4N42A 2PZ0A 4D8AA 2ZXBA 2P76A 1TIMA 5F1VA 2YCIX 4GCXA 3CUZA 2GQ9A 2PRHA 4IT1A 3ZM8A 1H61A 1JPIA 3ABRA 5DXXA 1OYAA 4XIMA 4JQAA 1KXVA 1KLYA 3GC2A 1EOMA 4HHHA 4HOXA 4CN6A 5JIWA 1NIUA 1G67A 4DWSD 3AIBA 2WLZA 1XUUA 1W5PA 3WIJA 3IJQA 5BXTA 1LL6A 3CHDA 1UZ4A 2P3EA 3VMOA 3BJFA 1XCWA 2W92A 3G77A 3FCPA 2V6AA 3C61A 3VIHA 3R8GA 2QS8A 3P67A 1VFTA 3RPDA 1TTIA 2CIPA 3CWOX 3GNXA 3W7PA 1V77A 5BWAA 1ALDA 1L6GA 3GHTA 3SY8A 1G7VA 3AICA 2F2HA 3W81A 3GTNA 3HPSA 3R2GA 4AD5A 3CH0A 1JCLA 4E4PA 2EAWA 5KZEA 3SW6A 3T8LA 3W1RA 5FD0A 2PBOA 4DXKA 3PZQA 1E0WA 1HGWA 2C14A 4BI7A 4O11A 3G0UA 4I9JA 1SFLA 3D46A 2QEZA 2YA1A 4GC4A 3GVVA 1BVWA 3HGOA 1PTGA 4L4OA 5D02A 1IEIA 2XH4A 3N11A 4JYFA 4FX7A 3GW0A 3OGVA 2WZIA 3C52A 4KS0A 3LUTA 4DWDA 1V3HA 3FSUA 5DO8A 1ZPTA 4PEKA 1TV8A 4XAPA 2OLHA 2BTMA 4UFLA 4PSRA 4LVAA 2HE8A 3XIMA 4NAEA 1ZL1A 1R38A 3N2OA 1LM1A 3HOJA 3PANA 4W7UA 1QW8A 4JS3A 1W91A 4GO9A 4PRWA 4CD6A 1V3MA 5CC3A 1TO3A 1CLXA 3W0KA 1OB0A 4Z1AA 3ANVA 2D73A 3B8VA 1BYBA 2KAUC 4CCEA 4D6FA 3NEVA 3LEPA 2ZVRA 3MCMA 3V1PA 1DJZA 4LRSA 3OLDA 3GQYA 4D8ZA 1TV5A 1HL9A 4QRNA 1ZP3A 3O2LA 4DYKA 1ZAIA 1TE1A 2E9MA 4RDZA 2NX3A 3VA8A 1VB9A 3AHTA 4W5ZA 4GZIA 3QV9A 3CEUA 4DJEC 1L2UA 1R3TA 3V5FA 1JQVA 3GVWA 2ZX9A 3WLNA 4OECA 4P8UA 2H9AB 2D24A 4IUOA 1EBGA 1LUCA 1I45A 3QY6A 4J1OA 1WXZA 3IIZA 3OZMA 5A2BA 1OG0A 1NSJA 2GVGA 4TVUA 2OLAA 3O6DA 2ACRA 3N6QA 3VKDA 1JEZA 4HN4A 1J79A 1XD1A 2QJGA 2XHYA 3VIJA 4E2VA 1DORA 2GOKA 3WD0A 3G24A 4UTTC 3GXMA 4NAFB 1FH7A 2ZUMA 4MB4A 3V0TA 5FKYA 1ICQA 1X6LA 4O0ZA 2CERA 2FMNA 4R88A 2XJ7A 4GZJA 3TDFA 2VNCA 3GR4A 2NXIA 3GNNA 4WIWA 1OABA 1XG4A 2ZWZA 3WK0A 3BAXA 1REQB 3E6EA 5KEZA 3GC4A 1EP3A 3L4UA 1ZENA 2ZOXA 3RPTA 1K8ZA 1WBJA 3CQHA 1K6AA 5F4XA 3VOCA 7TAAA 3IS4A 1OFOA 1OCJA 3WK2A 1PAMA 3QV8A 4GYPA 3C0JA 1BXBA 1L0PA 3MVIA 3UETA 2IKHA 1QK2A 1E0UA 3B3DA 3EPOA 5HUOA 4IIGA 1DIEA 1BYCA 5CG7A 5HWMA 5BU6A 1X1OA 4O4WA 4RDVA 3BJTA 2CZFA 1Z41A 3LCFA 3QF0A 4ZBCA 2FFCA 4LBRA 4J3SA 4PUKA 1QPRA 1U5HA 1J0KA 2WM1A 2Z2AA 1P5BA 3UBPC 2ICSA 5I78A 4S3EA 2PCEA 3CHFA 4NNBA 2YZ5A 1KCKA 1KR1A 3B06A 3I65A 4RE2A 3OGSA 3KE0A 4UWMA 2Z1SA 3P61A 2C1HA 4CQ8A 3E3HA 2QHAA 3W73A 1FFQA 1M5WA 3SRHA 2G0WA 3PNZA 5C71A 4S3KA 4CNSA 2DQXA 2YGYA 4QCEA 1U2YA 2Y8KA 3IWPA 1NF7A 1GQJA 4NHVA 1E56A 2NSOA 4IL0A 3PJUA 1IXOA 2WJEA 1CEOA 4XK2A 3NAVA 3N9KA 1E9ZB 4PBFA 4MY8A 1MEIA 2NQ5A 5FEWA 1EX5A 1TPDA 1BKHA 4W4QA 3W7LA 3VVGA 3TW7A 3C2YA 1GVRA 1E6RA 1O95A 5DT5A 3EXTA 5IRPA 3LM7A 3G1AA 2G3MA 3HFTA 4WXZA 4GIYA 4PRRA 4WK9A 4QM1A 1L6YA 3BGGA 5A8QA 3PUOA 4AIUA 5LNUA 3GVQA 3WQVA 2O9TA 4CD8A 5A94A 1R7OA 2FVMA 3A64A 3T08A 1C91A 2QXWA 5M03A 4HQVA 3FJ4A 4QDWA 3MSGA 2VENA 4DELA 2IQDA 3HIJA 5HNNA 4H3DA 4UOQA 9XIMA 5K9XA 2B31A 3ZIZA 3SIZA 4DPPA 4X9YA 4IMGA 3R79A 4KCTA 3M0HA 3CWNA 5IHRA 4TQTA 4QAIA 3AHZA 3C8FA 3AFBA 1RBLA 3KX6A 4GXWA 1L6SA 4E5TA 3FSTA 1RP9A 5A6AA 3W1PA 3H22A 4GNKB 3UJ2A 4GX9A 4Y8EA 3H26A 4KBXA 4C6DA 1F73A 2ZCGA 3AXHA 3CH9A 1J2BA 3W7GA 3PFMA 1WBHA 1TWSA 1BHGA 3POCA 1C93A 1TJ0A 1YDYA 1EO7A 3TSBA 5KSWA 3AIQA 2PMQA 3NOEA 1PKNA 1A0CA 2YCEA 1DE5A 3WBWA 3O15A 3M6YA 3NGFA 3S9ZA 1XC4A 4G5DA 3A12A 2X7VA 3M5XA 3W70A 4Q8VA 2EG6A 5LXEA 2P1FA 2ACQA 1DJWA 4DUVA 3IAQA 5FOOA 1HL2A 1CXEA 4AHPA 5FAJA 4CQCA 5H2ZA 4I90A 5K2ZA 1TMLA 1D3GA 4C6CA 1M7JA 1W9XA 3IV8A 4L64A 1BYAA 4O18A 3URNA 3NYZA 3V1HA 3DG7A 2FVKA 1AQFA 1R0MA 4M80A 3CUGA 2Q02A 3BCJA 3MO4A 5CC6A 1IGSA 1UR8A 3TXZA 2WK2A 5D9NA 3ZOAA 1EBHA 1H2JA 2G4FA 3AS0A 1RK6A 3K30A 4M8UA 1J2WA 3ZVIA 2WWCA 5A6JA 1H60A 1WZKA 1R3WA 4DN1A 2VURA 3QZEA 4MWAA 1J01A 3UJEA 3RLUA 1JDCA 2PA6A 1BD0A 1I6NA 3NWRA 3NFUA 1H41A 1AD1A 1V0KA 5DQPA 1I2PA 3KOFA 2J7EA 3QPEA 1UD4A 4IOTA 2J75A 1ZJIA 3ABXA 5GPRA 4J7RA 3P0WA 3V4BA 5IFTA 5JXQA 2TYSA 2HBVA 1WKYA 3B9EA 4EVZA 3RLVA 5BCAA 3LK6A 1EDQA 4WY0B 3GG7A 4QISA 1WV2A 3SRKA 4B4FA 4GY0A 1PKYA 1NFGA 3W28A 3KZPA 3H70A 3QY8A 1GPFA 1XFCA 3UVAA 3WQ6A 1ML1A 3WZ0E 1UZ1A 1MUCA 1T5AA 1XUZA 2P0IA 1E4MM 1JF6A 1E5NA 1LLWA 3E1F1 1W9VA 4ZENA 1E0VA 4LEQA 3DN5A 1VQTA 3SCPA 3MY9A 1ZU8A 3M1ZA 3NG3A 4HYWA 2RH9A 1HXJA 4HOWA 1O6IA 1J12A 4GINA 2ZYFA 5C9UA 3DU0A 3U57A 3WKZA 3SJ3A 1K4GA 2PP1A 2QR6A 4DWSC 4C6MA 2VUNA 4JD4A 2BS9A 2QNEA 2XSXA 3A4JA 5AN7A 3WF0A 3ITTA 2OEMA 2H8XA 1SZGA 5M1TA 4FR1A 2HK0A 4X0VA 3L4TA 2VEKA 5D04C 1HKMA 3NQGA 1PDYA 1ESWA 3P0XA 3ICJA 1QNQA 4O53A 3GS6A 3U9IA 1BRLA 3LGGA 2VRJA 1K02A 3POHA 1UHVA 2F38A 3VDAA 5F1UA 3L4WA 3F7JA 1NY1A 4D1IA 1HG3A 5I3IA 2OG9A 1VJSA 4I9MA 4DF1A 4L6OA 2IKIA 1WDDA 4L1XA 4AD4A 1RD6A 4JICA 4DI8A 1EQPA 4NJIA 2Q01A 4AYGA 3PB0A 4DM1A 4K8GA 2A7NA 4B91A 4X0NA 4IP5A 3JU2A 3Q94A 3BWWA 4UTJA 3LMZA 3WF4A 3CIXA 1E0TA 2ZDRA 5FJJA 3NYDA 4IGSA 1GG0A 1CPUA 5D05A 1Q7ZA 4A8RA 3ARQA 3PPCA 4C6KA 3L4YA 1VPYA 3VKBA 2DT3A 2HS8A 3S5ZA 3EX3A 2FZNA 5H6HA 1XI3A 1GQKA 1DIOA 3WJZA 5FA5A 4F8XA 2FB3A 3AWOA 4L65A 3TR2A 3VZXA 3LI0A 4KGJA 3FK4A 3W00A 4DY1A 3TYCA 1XLKA 1EH9A 4DZ5A 3GLCA 1UP0A 1GVEA 3SFKA 1EPXA 4YNGA 4IJRA 1KFLA 3ARZA 3P2VA 1B30A 3SN1A 1W3NA 4BF5A 2I16A 3ECQA 4GBUA 4UQDA 2D0HA 3BW2A 2B7PA 3EDJA 1HO1A 2WZHA 3CHEA 3VGGA 1QR7A 2NVCA 1OYBA 1O1ZA 2ZE3A 3TZFA 3DENA 2XIIA 4Z17A 3TJLA 3HJEA 1XRFA 3LNPA 1K9DA 4U2ZA 3LM3A 3NQVA 1A50A 1SO5A 3RR1A 5F4SA 4AX7A 2OX4A 6TIMA 1KM6A 3T4WA 3F2CA 1W3JA 3LI1A 2E0PA 3PK7A 4A21A 2BVTA 3UPMA 3CV2A 1ZB5A 3KBWA 1I4NA 1K3UA 1MEHA 2DSVA 5TNVA 2YZRA 1NFPA 2WC7A 4H6KA 4WLCA 2BGNE 1ADOA 2WCSA 1XICA 5D8ZA 1XH0A 1P6BA 4K8HA 2Z1XA 1JXKA 2A3BA 4RDYA 2XGIA 5AECA 1ZALA 1XBVA 5KITA 4PMOA 4ZTYA 1U1JA 1R9YA 3UA3A 1FHLA 5A6BA 3AMDA 3ZLHA 1NTHA 1C9WA 3W1LA 3NQFA 2BMBA 2H6RA 2YCLB 3D6NA 2J7FA 4W87A 4JTAA 3IK4A 2NUYA 2X1RA 4HA1A 1XBYA 3WBAA 1YQ2A 1UR2A 2ZZ7A 3IVUA 2Z1WA 4IMCA 2OWXA 1QI0A 3M7WA 3BXWA 4PRTA 5I3JA 3P81A 4E38A 1OWQA 2OEJA 4WD0A 3B4YA 3QSTA 5A1AA 5A5WA 3OVRA 5A6SA 3WLRA 4A05A 3R7MA 4Q8UA 2PD5A 2YOCA 4GC3A 1FKWA 2ZXDA 1XLFA 2F6XA 1RA0A 2Y5JA 4JN8A 4XG1A 4XISA 3T4CA 3W82A 5LXXA 3PZVA 3H2EA 4O1CA 5ABFB 5D2YA 1A4LA 1V0NA 4DXXA 1A5KC 2XSAA 3GRIA 3P5YA 1E71M 3SM0A 1FDYA 4PYSA 1YDVA 4PL1A 1KCLA 2B81A 3W71A 3R0UA 1EJTC 2WZEA 4N7QA 1M3UA 4HSNA 2BY2A 4MPKA 5HMFA 4IIEA 3UG8A 2J9YA 4EXBA 4GBDA 2IW0A 4KWUA 2YA2A 4A2RA 4I6KA 1NP2A 3CAWA 3U2ZA 4G7EB 1A5OC 4O0QA 4U10A 5EU9A 2BBFA 3O07A 2ODOA 3GVRA 3FVMA 3HPXA 3KEHA 4GOAA 5EMJA 2ZX5A 4ZSUA 2AL1A 2OXNA 3PULA 3QGAC 4J27A 4JFUA 3W7QA 3LCGA 3HZ3A 4I6VA 3N19B 3NDOA 2VZSA 4K3ZA 4J3ZA 4UC5A 1Q5MA 1FQ0A 4AWUA 4O8AA 5A6LA 5D38A 3AXIA 2J7BA 1LL7A 4ATDA 3OLGA 3AXMA 1B3YA 1F9CA 3W7JA 3WBXA 2EG8A 3EX4A 3M0VA 3ATYA 1V0LA 1RH9A 4O10A 1OC5A 2OCZA 1K1DA 3LXCA 4BK9A 2ZRWA 3SUWA 3W2LA 1UKOA 3E2QA 3IGXA 4MNKA 3HPZA 4UTWC 3ARXA 1E43A 1KLZA 2PDMA 2E6FA 5BMWA 4GXPA 3RM9A 2VGIA 4F0LA 4N6EA 3MZ2A 3NPUA 5I3HA 4MDOA 5JBDA 4GQGA 3KTCA 3PZ9A 1FWFC 4MKNA 3TP4A 1AL7A 1ADDA 1HO4A 3I3BA 3USZA 1ZQ5A 3HJZA 1M9HA 2ABBA 2HZGA 4KEVA 2VFHA 4QJ5B 4GJJA 3C0LA 3TTEA 4E3VA 1H0IA 1OFEA 2OKOA 3SURA 1ECQA 3ZWTA 4TMBA 1TJPA 4HU8A 4IF2A 4TX8A 1YX1A 2WNZA 3F5JA 5GJMA 3IGSA 1DJNA 4C6IA 5A6MA 2NV1A 1EUAA 4Q8OA 3UJRA 3WMLA 3CQ0A 5G4EA 2OZ0A 3PVFA 1HX0A 3URQA 5LNRA 4FXRA 1JL8A 1MNSA 4HK6A 5K3VA 1EC8A 2FJUB 2CLPA 3RN6A 3S83A 3LU2A 5HATA 4AF0A 1R7AA 1UBPC 3S2NA 4V15A 1UD5A 3L0KA 4GISA 4KIEA 4D71A 3REQB 3CXOA 2Y5EA 3WQGA 4IFOA 5AHIA 3WUEA 1C3FA 3VC6A 3VM5A 4QSFA 1BPLB 2MUCA 1NWUA 4CVUA 2EPHA 4D6EA 1PXGA 3H24A 5E1QA 4NYUA 1TVLA 1FCVA 3FEMA 4FSAA 4M6UA 4ZQRA 2F9RA 3AISA 3LG3A 5REQB 2WJZA 3C5QA 2DVXA 3AZTA 1BGGA 4ZQMA 3CJPA 2VEPA 2VJXA 2E5CA 4DZHA 3DHUA 3QTPA 1JZ5A 3ZZ1A 3UR7A 2WW5A 5E9AA 1KA9F 4O1FA 1Y8BA 3VDCA 1TB3A 2EPOA 3ABOA 4PUEA 4G1KA 3OHIA 3EWDA 1GJWA 3RMJA 2ZTKA 3W01A 3KS6A 1CXLA 3TAOA 2MNRA 3WD3A 3A23A 4ASTA 1TZZA 1RXOB 4V1YA 3ARRA 3KFTA 1EUNA 4DX3A 3BSHA 2VD9A 2VX7A 1FTXA 1MDRA 5TIMA 5E6ZA 3I3EA 4HU3A 2ZUNA 3P80A 4ZOBA 5FL1A 3NVTA 4NZ5A 4M51A 1UZDA 3UGVA 4FF5A 4Q4KA 3LCXA 3P5ZA 5E9XA 2FH6A 1VENA 3OLIA 4LSBA 5G1YA 4XUYA 3NSMA 1HJVA 1TVPA 4PB5A 4JIEA 5HJLA 2FDMA 3E02A 4RW3A 4MM1A 3QLDA