3LLFA

Crystal structure of the mutant s127p of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
217
Chain Sequence
DVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMPHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 78
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3llfA00
3KVLA 1TV5A 5BOOA 5AC8A 1OFDA 1OFPA 2QCMA 3ABRA 5AHMA 5AFDA 1TCDA 4Y96A 1IXOA 4RXFA 1OYBA 4IXHA 1NF0A 2HTMA 4E2DA 5EMUA 3NQDA 1ZCOA 4O8RA 1R47A 5KTLA 1H1ZA 3FA5A 1ICSA 3A5FA 3NPUA 1NEYA 3P67A 3QJAA 5G1TA 4QM1A 3FJ6A 3B0UX 3L65A 1F5ZA 4ICNA 2NUWA 1XC4A 3O07A 3C6CA 1ZJIA 1I2NA 1PVNA 3MMTA 1K8ZA 3M41A 5D2TA 2NUYA 2DU2A 4LU0A 1HUVA 4UFJA 3LRKA 4UXDA 1ONRA 3VNDA 2A6LA 4C1LA 2NX9A 3W23A 3R12A 2E1DA 1NVMA 3F4WA 1FQ0A 1VHNA 3LCFA 4A2RA 5KZMA 2RH9A 3MP5A 3GXTA 4WY0B 1TJPA 2CLOA 1SUXA 3MI2A 1SSGA 3QRHA 4ZL1A 3QSRA 3W7EA 4A3UA 1IXPA 4N6EA 5G2WA 4WQ6A 1PE1A 3NQVA 3NNTA 4RXGA 3S0CA 1ZY9A 2GUUA 1PCWA 1ZHAA 2YDAA 4UMAA 3OA3A 4LVGA 1NF7A 1JUKA 5D2WA 3VE9A 1VS1A 3M47A 2JKPA 2RDWA 2P0OA 5CSRA 1DBTA 4H6KA 3B8DA 4LOCA 4B5NA 1B57A 4WOZA 4O1CA 2PRMA 3LV5A 3NL6A 3DFQA 5LGZA 3B4UA 1DORA 3GDLA 3OG3A 4WXZA 3IEBA 3L5LA 4LS0A 3E12A 3M5VA 3L21A 3UZJA 1WX0A 4Y6GA 4O19A 5HMSA 1WAUA 2GOUA 4NZJA 3HGSA 4MY1A 1KM2A 1P5BA 3HF3A 4HSNA 2C14A 3TXZA 1OJXA 3BG5A 5F4XA 4E2BA 3W6YA 3W1LA 5G4WA 1TPDA 2V5LA 4JXCA 4M6QA 3AJXA 3C0JA 3HMJG 5DLCA 3IIXA 2CLKA 5EPDA 3W1AA 1A5SA 3STFA 3HOJA 3P5ZA 4AB4A 5G4EA 2Q3OA 2Z1BA 3W2NA 5F2LA 1MSSA 1B4KA 1GVRA 1OX5A 4LV4A 3EXRA 1RR2A 1TV8A 1P0NA 3CEPA 3QC3A 4MYXA 1IIGA 4FNQA 3B03A 3HG5A 4IX2A 1Z41A 4JY8A 1KV8A 4CCEA 3T40A 3UYCA 5J5DA 4JY9A 3B0VC 3QSTA 3LXBA 1TPB1 1XCFA 3O6DA 4GUJA 3TX9A 1CX9A 3NQCA 1AW2A 3M5YA 5K9XA 4GBUA 2A2IA 1W31A 2ALDA 1Q3NA 3W7KA 4N6FA 1HG3A 4R33A 1BWKA 1B3OA 1PHWA 1JR1A 4IMCA 3DH7A 5TQLA 1AW1A 3BLFA 3EEGA 4FX8A 3UWVA 4MFDA 1PS9A 3NQ8A 3GNDA 3UWWA 1YXDA 1XI3A 4IMFA 2QJIA 4OWGA 3EX3A 5HQEA 1KFLA 3DKLA 3DXIA 2OX1A 4FNRA 3QMRA 2OZ0A 4AWSA 2DORA 1K8XA 4KFOA 3W83A 3MYPA 4TR9A 1GZGA 5DBUA 4JTKA 3DFSA 4DBDA 1Z48A 3R13A 5IM51 2P1FA 2RKXA 3Q58A 4L4LA 5AHFA 5KINA 1DJQA 1V5XA 1X8FA 3KOFA 4KFPA 4O4VA 4E0CA 4NT0A 4QSHA 1LZOA 2Z0IA 4P2VA 3EXSA 3CHVA 4FXSA 4O1DA 3BLEA 5BRBA 3SI9A 3M6YA 3TUUA 2X1UA 3G18A 5CZ0A 5AYYA 2Y89A 4UTHA 3CLMA 4IUOA 4GUIA 3P8JA 4M7TA 1TV7A 3BW4A 3EWZA 4LTSA 1FX6A 2A6NA 4AMAA 1MEWA 4A21A 4L4MA 5F1UA 2ATSA 1TRDA 5LNUA 3P62A 4AWTA 4ORIA 5D02A 3FYPA 2A0NA 4DBEA 1UASA 4AHQA 2FDSA 2YR1A 2RHGA 2OMAA 2ZZ5A 1M7PA 4Q32A 4DQWA 1DOSA 4LW7A 4R7JA 3TSBA 1QR7A 3LHVA 3EX2A 4JR5A 1AMKA 3MHGA 3W2UA 2J9ZA 2E5BA 3KRZA 3W1RA 3CTLA 1S5WA 3G0SA 3QW4B 1AL8A 2YGYA 3KHJA 4LVAA 3RF9A 2QCFA 2H3BA 4ADTA 8TIMA 4M7SA 3ATYA 3HG4A 1ME8A 4R53A 4KWVA 3P60A 4MY9A 4O57A 1P0KA 1GEQA 4CCDA 1DJNA 1G4TA 2CLHA 2G5WA 1EPXA 2VEPA 4O14A 3UNDA 1W0MA 5LSMA 4ZMGA 2X1RA 1FDZA 3R89A 5HUPA 2QCDA 2A4AA 1XBZA 3LOTA 4JNMA 3KFTA 2ISSA 4JTIA 3MUXA 3TROA 3MW7A 2QJGA 3PY2A 5EY5A 2OT0A 4MZ1A 1SFJA 4MVAA 1K7FA 1A5BA 3EWBX 4N02A 3WK2A 1F7BA 1FWRA 4A22A 3TR2A 3TQ0A 4GRSA 4XQ6A 1ME9A 1XKYA 3VE7A 2EPHA 5I3IA 5AYZA 2R91A 4HPXA 2QJHA 1TYGA 2YX0A 2YZRA 4ZQMA 2ABAA 1YLVA 1LBMA 3DHFA 4JICA 3TQVA 2FPTA 2ZA1A 3C3NA 3NQMA 5E1QA 4MZYA 1QPQA 1F6PA 5FEPA 2GQAA 3SW6A 2Y6ZA 4JYDA 3PG9A 4A29A 2DZSA 4Y9AA 4XKYB 5K4ZA 1H7PA 2V81A 1RQEA 3NXFA 1RV8A 4TX9A 4DELA 4RR4A 3P80A 4LT9A 1OFQA 1EP2A 1VLIA 3GLCA 3BV4A 1K7XA 4AAJA 4MZ8A 1XL9A 2V0TA 4IMDA 1ADOA 2VFFA 4O54A 1KLYA 4HT3A 2ZTKA 1VLWA 3C56A 2ZZ6A 5A8GA 4LUIA 4GJ1A 2C18A 4XBSA 1JQVA 3W7NA 1ZAIA 3CC1A 1RQBA 4WD0A 4XUGA 4TO8A 3NQAA 1DVJA 1A5CA 1EB3A 3DKJA 4UTIA 2VKZG 5LHEA 3M5ZA 3BW3A 2TMDA 1D9EA 2A7RA 1H63A 3FKRA 4AEOA 1JCXA 1H50A 4Z1BA 3IGSA 1LLWA 3N19B 3A24A 1KFKA 2J9YA 1IXQA 1C8VA 4KFNA 1U83A 2E6YA 2XN2A 4H4IA 4CCCA 2C16A 3OIXA 2DJXA 3EWYA 4PCFA 4IX0A 4ONVA 3ABQA 4MY8A 3GZ3A 2Y7GA 1MXSA 1TRIA 1XUZA 4JDBA 3RU6A 1CI1A 4FEZA 3FYOA 4K7VA 1O5XA 2BX7A 1F05A 2B7PA 4ZQRA 3L0GA 1SO5A 4BF9A 1W56A 3HPXA 4PA8A 5G2HA 3RFAA 3N14A 1CW2A 3CIXA 1W3TA 3QMTA 4OV4A 3UQNA 4JX4A 5F4SA 1QPOA 3S1WA 2C15A 2CZ5A 3W72A 4IMEA 1G7UA 3HPZA 4FIQA 2DZVA 2R14A 1W1ZA 3PSVA 3SY5A 4O10A 3DAQA 3DENA 1GOXA 3O15A 1SZFA 2Y70A 4PFMA 5DN1A 4DPPA 1W3IA 1SU5A 4MOZA 3TMQA 1HL2A 1D3GA 5I3FA 1ALDA 3QH2A 5CZTA 1RPXA 3LI0A 3LBCA 2QDGA 3MI6A 5DCDA 2ZBTA 4CLMA 4LNYA 1TPVA 5C54A 1KTCA 4LY8A 2NWSA 3M9YA 3W76A 4OGZA 3W7IA 3KX6A 3WK0A 3LCHA 3LM7A 4MJZA 1DQXA 3O6YX 2ABBA 3TFXA 3O06A 3L9CA 3GX9A 4UTWC 1W5OA 1EX5A 5LZLA 1J2WA 1XUUA 3W2MA 5CGQA 3EKLA 1PHQA 1FDYA 3PS7A 3CIWA 2GQ9A 5AYXA 3GVGA 3IVTA 3L67A 2W6RA 4HNTA 3LXAA 1TREA 3HGJA 3LCGA 3N2MA 1H7XA 2FJKA 3VFLA 2A7PA 3IIOA 4ZVJA 4Z1DA 4MIMA 3R5EA 3G1SA 3GR8A 3W1MA 1H60A 1X6UA 1LRNA 2FPVA 2F84A 5BW6A 2A7NA 5G5IA 2Y62A 5EL1A 3S1UA 2V30A 1LROA 3W7LA 5C5YA 3ELFA 2Y88A 1OF6A 3KRSA 1BWLA 4E38A 5KZDA 4H3DA 2NX3A 4FHAA 3TAOA 5L6UA 1WBJA 1OX4B 4DO6A 1FY6A 1VCVA 3HGRA 4GXMA 3G8RA 1W54A 4UR8A 1TMHA 3PUOA 1JCLA 4GUHA 2DZTA 5FEXA 4UFIA 2FQIA 1NFBA 2PE4A 3L66A 5F1VA 2YSWA 2V82A 3Q37A 5IBXA 1P1XA 3CT7A 3WFAA 4BR1A 5CPNA 1V7YA 1SW0A 4NVTA 3NR0A 2VOMA 3V75A 4FO4A 4O28A 2KZHA 4MLJA 2YYUA 2G97A 2ZRVA 2FB3A 3ZWTA 4O1AA 5D04C 4WY0A 2CZDA 2CFFA 4JTEA 3W2LA 3W7DA 1S5TA 1VGAA 2CLFA 2ZFAA 4FNTA 1EIXA 1SO4A 3LCWA 1L6YA 2NWRA 1WXJA 3GIYA 1G7VA 1TPH1 1OFBA 2WOQA 1QMLA 3B06A 3CPRA 1YDOA 2Y7DA 4UR7A 2QKFA 3H54A 2DZWA 1I45A 3AO0A 2QDHA 5I3JA 1GG0A 1LOQA 4XTDA 3P61A 2FIQA 3KXQA 4BWLA 1VRDA 1GVOA 1Z42A 3LHZA 4IJBA 1LP6A 4FNPA 3PULA 5CZJA 1KBJA 1XM3A 1UUOA 3W1XA 4QITA 4ML9A 1TPWA 5FEZA 3RK8A 4BK9A 1VPXA 4N9DA 1EWEA 4GWEA 3G1YA 3NPWA 4LRTA 3LB0A 4M19A 3NQGA 4LWWA 1ICQA 1P4CA 4JYEA 1OG0A 4Q4KA 5D2XA 5D2YA 3WJXA 3NAVA 4I7VA 2FPYA 3SIZA 4KKXA 1SW7A 3WJSA 1BEUA 3QZEA 3G3DA 3TE9A 3L0NA 2CZEA 2CLEA 1TIMA 5AOUA 1YPIA 3NQ2A 1VCGA 3IVUA 3UD6A 3O05A 2I9EA 3F1QA 4UTJA 4DEFA 1G4SA 2H8XA 1QO5A 1SW3A 4AF0B 2VFDA 4PEKA 2QAFA 4LRSA 4XWUA 3E02A 1H61A 3USBA 3W07A 1N8FA 2XN0A 4DO4A 2C1HA 3FLUA 2C13A 3TNOA 2O7SA 2ZTJA 1YTKA 4MLRA 4ZQNA 1EWDA 1TTQA 1SO6A 1KTNA 2Y7EA 3NGJA 1DHPA 1KBIA 1TO3A 4PL2A 3UPBA 5TBOA 3DU0A 1X1ZA 3CU2A 2D73A 3IV3A 4OU1A 4YXGA 1L6WA 2J9XA 3TSDA 1XBVA 1H7OA 3A5VA 3M0ZA 3LBMA 3TDFA 3N3MA 3N73A 5DXXA 1KV5A 5KITA 1VQTA 1G4PA 4M5PA 1H51A 1OFOA 1LOSA 4S1FA 1GTHA 2WNNA 1THFD 2QCEA 3TCEA 5C55A 3LV6A 2B7NA 1YTDA 2Z6IA 5HUOA 1Q6RA 5H2ZA 4IGHA 3OVPA 2WNQA 4K8HA 4YMZA 1N55A 3MWAA 3C52A 3MBDA 3FJLA 1KTBA 2ISWA 4NXKA 3UY8A 1OFRA 4JIQA 2GQ8A 3PAJA 4FNUA 4M6VA 1T96A 2X30A 4MUZA 2X16A 3W7JA 3OBKA 1FDJA 1SZGA 1K3UA 5CPOA 3DI0A 3QYQA 2GVGA 1KFCA 4UTTA 4MYAA 3OVRA 4UIOA 4X22A 1XXXA 2I14A 4K36A 4JTLA 4PH6A 3O63A 4WZHA 4J9JA 1VZWA 3E96A 3NL5A 4UMCA 3S8HA 1BKSA 1OABA 4GNJA 3W74A 1UJPA 1XBYA 3NQ6A 3NL3A 3G22A 3PF3A 2FB2A 3G1VA 1TTJA 4MFEA 4NZFA 3QPZA 2Z2UA 2E6DA 2E6AA 1R30A 2E5DA 1IF2A 2NZLA 3FKKA 3UXAA 3NEVA 1KFJA 1VJIA 4EF8A 3V1PA 1XDLA 3JS3A 5FI8A 1TQJA 1VR6A 2FFCA 3PR2A 3W71A 2H8ZA 2TYSA 3W7GA 1G4EA 1I2QA 3NQFA 3W85A 1VYRA 1SZEA 3W1PA 3PB0A 1JJKA 4UTKA 4ZQPA 4JX6A 2V2DA 3TK7A 3G1AA 3W7CA 4HNVA 3L0KA 3P5YA 4K37A 1AW5A 4G1KA 1ME7A 3ZFHA 5LNVA 2V2HA 5LNWA 2ZZ4A 2QEZA 2ATMA 1ZNNA 3PB2A 1M5WA 4NU7A 3K30A 4PC8A 1G67A 1JVNA 4YWIA 3NYZA 3LHUA 5D05A 2Z6JA 3SSJA 3GAKA 2EGZA 3P81A 1L6SA 3W22A 1DKWA 1F73A 4NJHA 1K7EA 3TSMA 1FXPA 3TXVA 1WOBA 3DHDA 1X1OA 1JCYA 4PODA 4QISA 5KZEA 5TIMA 3VI2A 1I4NA 5D2VA 2NXHA 4I7UA 4X3ZA 4DXVA 1EUAA 4CNNA 4AVFA 3S1XA 2CLLA 2VEIA 1SR9A 3I7QA 2YFOA 4FNSA 3STGA 1FCBA 4N4QA 1S5VA 4O13A 4DO5A 5LNRA 3G3MA 5CG7A 5C2XA 2VFHA 5D09A 1DQWA 3NDOA 2B0MA 5FF7A 4XKYA 1H7WA 2DP3A 4TMCA 1ZAHA 2CZFA 4NUWA 3TQKA 5HINA 4NX5A 3ZR4A 4PTNA 2QUTA 1UB3A 2O7QA 2J6XA 3MO7A 5D37A 3G0UA 5I3HA 1O5KA 2BTMA 1KA9F 3BGJA 1EP3A 3C61A 1Q6OA 2QCHA 1GVFA 3W1UA 3N2XA 4K7YA 1KM1A 1FXQA 3M5XA 2GPTA 4WX2A 4NJGA 3TMLA 4Z1CA 1Z44A 3B0PA 3IIZA 3A21A 4O11A 1WDWA 2B7QA 2IQTA 4UTMA 2ZRUA 5FF4A 5EKYA 4U4MA 3W7HA 4S2BA 4JTFA 2VFGA 2QR6A 3PUDA 4HNNA 1IGSA 4QNEA 1KLZA 3R8RA 3FFSA 2QCCA 4RJEA 3NZRA 4OQVA 1YADA 1FWTA 3BARA 1YDNA 1TQXA 2F7FA 4KWWA 2VELA 4O52A 5BMWA 1N7KA 1ZFJA 4UNLA 3W2KA 3MHFA 3Q94A 3HO8A 3CEUA 4EF9A 2PCQA 3L5AA 3STEA 5I3GA 3S9YA 2ZRZA 3T55A 3WJYA 1YTEA 1AL7A 2P10A 2QUVA 1B4EA 1MEIA 2VFIA 4UFMA 4W9TA 3OEXA 3I68A 4BFAA 1MZHA 3IGXA 3P84A 3LI1A 4DPQA 3W73A 3THQA 3GYEA 1W5PA 5KSWA 1W37A 4IQLA 4AXKA 4P61A 3LCLA 5FF0A 3CWNA 4POCA 4JTUA 4XZ9A 1H7NA 2QCNA 2E68A 4I7WA 3QQ1A 2Q8ZA 4UCGA 4YCOA 4GUGA 2VXNA 3NO5A 4GE8A 4D2JA 1O4UA 1OHLA 2I1OA 5HWNA 1Q45A 5EA9A 3WK1A 3I65A 4QJ1A 3I6RA 1ML1A 1R46A 4N9EA 3OHIA 4JGDA 1I2PA 3WJZA 4JS3A 2C6QA 3BVJA 1H62A 3ZS4A 4EWND 2EF9A 5CKSA 2NUXA 2PC4A 3GDKA 3PUEA 1QOPA 3FS2A 2B7OA 5KMYA 5K9CA 3LTPA 3UWYA 1T0OA 2WNZA 3STCA 5GVJA 1FCVA 3W3OA 3QQ0A 5AHNA 1PIIA 3QW3A 3A23A 3C2OA 2VENA 1TTIA 1OK6A 5FF2A 4WY0F 3SGUA 3IVSA 3B04A 3ANYA 1YDVA 3O8AA 5L9FA 3RNDA 1GVQA 5DCEA 5J5RA 3A22A 1GT8A 3UWZA 4UTUA 1K02A 2OT1A 3LXCA 2GJNA 2QUUA 1R2TA 1OVDA 2CLIA 3HG3A 2AAMA 4UNKA 3INPA 3MBFA 2HMCA 3TW6A 1JRCA 3GDTA 4LV9A 1AG1O 3TW7A 3MP4A 3MP3A 1LRQA 5ABTA 4GC4A 3E0IA 2CW6A 1J5TA 2QAPA 4NQ1A 4ADSA 2E09A 3NM1A 1Q6LA 1JCNA 1MEHA 4TMBA 2X1SA 1PL9A 2A21A 5CPLA 1G69A 2R94A 3EWXA 2ZYFA 5U4NA 1GYNA 4U28A 4IOTA 3LCXA 2GJLA 3ABOA 3DZ1A 5DY3A 2WSRA 3M44A 1YXYA 1KM0A 5HWJA 3T7VA 3CB8A 1JRBA 3TAKA 2JGYA 3MHUA 2XFWA 1RZMA 2YFNA 3W86A 5DCBA 2TSYA 1XFBA 1JQXA 1UBSA 3BPWA 3IGUA 4IMGA 4BI6A 4HNUA 5FEWA 4JTSA 3SGZA 2VC6A 3GK0A 2HS8A 2ZDRA 2H3DA 1WQ5A 3W7MA 2VEMA 1QO2A 1NAL1 3G24A 4RLIA 2GVLA 3KAOA 2C19A 2ZZ7A 3NVTA 3EX1A 3GXNA 2DZUA 3GB6A 1AK5A 2RDUA 5AB3A 3EKZA 3BK0A 3W2JA 4QNWA 4UFLA 3DFPA 1RVGA 3RLUA 4HHPA 2BWGA 4WOQA 4M6PA 3LTYA 3HIJA 4N9CA 2A5HA 1VHCA 1O95A 1FWNA 3E49A 2YPIA 3H53A 1WBHA 1LOLA 4JTHA 3CWOX 3DBPA 3N9RA 4JTGA 1KM4A 4NNBA 4RZ5A 3BW2A 1HO4A 3G8EA 3C2FA 1FCQA 1TSIA 3EX6A 4WJEA 2GVJA 1W5NA 4FF7A 3QMSA 1VH7A 4FXRA 2V9DA 2ZZ3A 2DZXA 2CU0A 2EHHA 3ZWSA 3W7QA 5IBXC 3IRDA 4IPJA 4ORMA 5LKYA 3OVQA 2A1YA 2E77A 1OF8A 1X7FA 1ZAJA 5BMXA 1TPC1 5AN7A 5G2IA 2A85A 5CPMA 4NNCA 3C2RA 4K38A 1SZNA 1WA3A 1GWJA 2E6FA 1QPRA 2X1TA 1G6CA 5F4WA 4UFHA 3LTSA 4IPIA 4LVBA 2WSQA 3G1DA 3L2IA 2Y63A 2NV1A 1GPWA 4AF0A 4DF1A 3QF0A 5F2MA 4XBKA 2NLIA 1KM6A 1W5MA 1LORA 1RD5A 3NOEA 3EWWA 3W7RA 4ZQCA 1O60A 1OFAA 3TU9A 1Q6QA 3O16A 1KM5A 2HSAA 3Q2DA 1NSJA 1H1YA 1DL3A 3NA8A 4EIVA 3IIVA 1SSDA 3S6DA 2JKAA 1M7OA 2QCGA 5E93A 3S5OA 1YXCA 3W87A 5HR7A 4BWLC 3TV8A 3THAA 4MJMA 1QCWA 5K4XA 5K9DA 1ZALA 2OCZA 4RX0A 4CQ8A 3A9IA 4O16A 4LS2A 2H6RA 2YCEA 4RKAA 4EOUA 2BSLA 5SWUA 4Z1AA 1W5QA 3SECA 4JDYA 2B4GA 3S5YA 3L68A 3TC7A 3LHWA 4OT7A 5H91A 3PC0A 3VCRA 4NXSA 1W8SA 3CM4A 2BXVA 1FUYA 2RDTA 1TJRA 2J24A 4MPQA 1GYLA 3F03K 4QIUA 6ALDA 1TB3A 5EYWA 3IIPA 5FF3A 1JUEA 3P82A 2VEKA 2X2GA 2E5CA 2WO5A 3F4NA 2DZPA 1HFBA 4O15A 4UMBA 2NXGA 3C8FA 3JR2A 5D32A 5DY2A 3C2VA 1SQ7A 3TA6A 2CLMA 3KVKA 2QCLA 2ISVA 3W9ZA 4UFKA 3EX4A 3DGRA 3LLFA 5D33A 3JRKA 4N4PA 3WK3A 4ADUA 2JKEA 4O17A 4GUFA 4PL1A 3E9AA 3TKFA 2WQPA 1XDMA 5DELA 2Q8LA 4YLWA 1F74A 3DFTA 2ZCGA 1A53A 1UUMA 3PVFA 4K39A 1JUBA 2TRSA 3HB9A 3M43A 4GFSA 2JK2A 2YYTA 5K7JA 4RCXA 1VYSX 3LHTA 1F76A 1Y0EA 4TU1A 3HJZA 3HPSA 2J27A 4MKNA 3P7YA 4LC8A 4OHQA 1QAPA 5K3VA 1H7RA 3N9SA 4LVFA 4QQ3A 1B9BA 1OYCA 1R2RA 2JBMA 1LLZA 2YW3A 3QM3A 3ATZA 3KRUA 3T78A 3BG3A 2XN1A 5HWMA 1GQNA 3GKFA 2RFGA 2ZQ0A 2BZNA 1T8XA 2G95A 1TTPA 1I8JA 5EBUA 1EEPA 3UWQA 3LLDA 1GG1A 3QFEA 3PSWA 4TIMA 1LBFA 5K2ZA 3PBVA 4FIRA 1DV7A 1KFBA 5MHBA 2HS6A 3HG2A 3LDVA 1YYAA 3QPYA 5C6MA 4K6AA 4DF2A 3UZ5A 3UY7A 3TJLA 3PWAA 3WJWA 3PBWA 5AHIA 5HR6A 2PRLA 3R2GA 3LRLA 3H55A 4UTTC 3FIGA 3T4CA 2ZA2A 1LCOA 2ZA3A 4O4WA 2Y61A 3FEMA 2DJLA 4RV8A 4JYFA 4R34A 5F2IA 4ZZ9A 3I7RA 4NX0A 3TFCA 2G96A 4NJIA 2QCDB 3W70A 4LUJA 4YL2A 5I3KA 4JEQA 3TC6A 4FX6M 3NQ7A 3BG9A 1VCFA 3UXDA 3KVMA 5DXYA 3LCIA 3DFNA 3P8IA 1KFEA 1WOAA 4Z08A 3BLIA 1C9DA 1W3NA 3U6WA 5FESA 5U7SA 4C1KA 2WKJA 2WPBA 3M7WA 3PBUA 2J88A 4O18A 4CNOA 4JN6A 4O1BA 3LHYA 3GKAA 2JGQA 1OX6A 1WYIA 1TPFA 2NV2A 3MYOA 4XTIA 1L9WA 1OYAA 4CQAA 1E51A 4YCPA 5BNKA 2BLEA 3LERA 4OBTA 4Z0SA 1ZENA 1QOQA 5HULA 3TJXA 3U2OA 1LRTA 1SPQA 4HSOA 3MJYA 4JTTA 1LYXA 2EKCA 3W1NA 2ZZ1A 1QPNA 4LS1A 1LBLA 1YPFA 3FOKA 5DBTA 3W1QA 1A5AA 4JIPA 1R2SA 4JD4A 3PG8A 1UCWA 2C0AA 1OFEA 4Z0JA 4IXXA 1KM3A 3RLVA 1IIHA 1RQHA 3NPXA 4HKPA 1EA0A 3GXPA 3GAYA 2AGKA 3D0CA 4RZ6A 1JCJA 1HTIA 3GR7A 2FLIA 3NL2A 3NQEA 3S42A 2W79A 3KVJA 4I9AA 4RK8A 2ZRXA 2V2CA 1SO3A 3G1FA 3W84A 1A50A 4UTLA 1KW1A 4CQ9A 4LC6A 3CQ0A 1H5YA 2R8WA 1FWSA 3B05A 5D03A 4OE7A 3NZ1A 1S3HA 3HBLA 4JTJA 2C3ZA 3GDRA 5D38A 1O94A 4CNPA 7TIMA 4BI7A 4S2CA 1PCKA 3VKJA 4Y8FA 4RZ4A 1EP1A 5LNSA 1GJPA 1EUNA 3TH6A 5D30A 1QFEA 4X9SA 4O12A 3C4UA 1MO0A 1D3HA 4N2YA 3ABSA 2TPSA 2ZZ2A 1SFLA 4WUIA 3L5MA 1T99A 3BO9A 3EB2A 1OK4A 1TPEA 3S1VA 2W0UA 1PV8A 3O1NA 3GDMA 4FX7A 1JULA 4UTWA 1QNVA 3G0XA 1FBAA 1JCMP 3YPIA 1QWGA 4AHOA 1LDCA 5LGXA 3BGGA 1K03A 2OJPA 4JX5A 2ZRYA 5T26A 3N34A 1U5JA 4UC5A 1QDSA 4HPJA 5E0KA 3SZ8A 1FWWA 3W7PA 3PBYA 1WV2A 1ICPA 5G1YA 2ZRWA 4UUIA 2UV8G 4A2SA 4AH7A 4EVZA 1BTMA 2Y7FA 1C29A 3LX9A 4LVDA 3SJ3A 4K8EA 3T44A 2YW4A 2AQWA 3W88A 4O50A 4HN4A 1HO1A 1L2UA 3SFKA 3GNNA 2V5BA 1VYPX 5AC6A 1F2JA 2QF7A 4NJJA 4O53A 3DI1A 2NXIA 5AHLA 5CZSA 4HIBA 5HJLA 2Q3RA 4O0KA 2PURA 3C2EA 3TIMA 3NM3A 1LM1A 3W1TA 4N9BA 2FTPA 2Y85A 3M16A 5AC7A 4NJKA 1XBXA 2NX1A 3EXTA 4AHPA 4QAIA 2PRHA 5CSSA 3PM6A 3S5ZA 3HQ1A 3O6CA 4AWUA 2YXGA 5F2GA 3W7OA 3MI3A 1FCUA 2LLEA 3QEZA 1M6JA 3UWUA 4BI5A 1IXNA 4Y90A 4X2RA 1J4EA 4IWWA 2CWNA 3NPVA 4O0ZA 1TPUA 3LGEA 5AHEA 3W75A 3U8GA 4Q33A 3M1ZA 2WJZA 3LRMA 1I2OA 4FB7A 1I2RA 2H90A 1VC4A 5A5WA 3EWUA 2EAWA 4ZQOA 6TIMA 1OX4A 1K8YA 3NG3A 3UPWA 4DF0A 2WV8A 5LHFA 3S5NA 1LTDA 3G1XA 3SR7A 4WXYA 3P74A 3I7SA 4ALDA 3G1HA 1F6KA 2WSYA 1GVSA 5HNRA 4OV9A 3HGOA 4NNAA 1GTEA 2VFEA 3DFOA 2V8ZA 3RMJA
chains in the Genus database with same CATH superfamily
1XGEA 5BOOA 4ZXLA 1AQMA 1J6OA 3U3HA 4ROPA 4CUCA 1NF0A 5F7UA 5CC7A 3WO8A 4PZVA 1R47A 5KTLA 1UYQA 1H1ZA 1IE7C 4ATDA 3NPUA 3FJ6A 4EACA 3B0UX 2IXUA 4MHBA 2WANA 1F5ZA 4ICNA 2NUWA 5I07A 1XC4A 3HPAA 3O07A 3C6CA 1I2NA 1PVNA 4PN2A 4C1NB 1K8ZA 4PSRA 3PFMA 4JTCA 4H7VA 4L1XA 1ONRA 1W91A 2NX9A 3D46A 2O9TA 4KW2A 1FQ0A 4A2RA 1OGSA 3MP5A 4WY0B 3O9NA 1TJPA 3MI2A 3QRHA 2I16A 5A6AA 3QSRA 3W7EA 1IXPA 2ZUTA 3NQVA 4H9ZA 3NNTA 1NFPA 3H21A 3H7VA 2GUUA 4LALA 3RPDA 1ZHAA 1NF7A 4AD3A 1P7TB 5C8BB 3VIOA 2OVLA 5CSRA 3B8DA 3UVIA 1MYRA 1V6TA 3WUEA 4O1CA 4CQCA 2PRMA 2DUAA 4NG3A 1M1BA 1H49A 4JL1A 4M1BA 2AL1A 2G50A 4FI4A 3DFQA 4RDVA 2VUNA 1MRAA 3FYYA 5HAOA 4AD0A 1K8CA 2ZE0A 4WXZA 3WDPP 2VYOA 3M0HA 4WKHA 3E38A 2Z25A 3UZJA 1B3YA 1XYAA 3TJ4A 2V5CA 1WX0A 1YRRA 4Y6GA 3VINA 6XIAA 1WAUA 2GOUA 2VGBA 3GFYA 3LMYA 4ZO7A 1BXNA 4HSNA 2C14A 1PJ9A 3S1GA 1SYTA 3W1LA 3UA4A 4OKDA 3L4VA 1AODA 1S1PA 3WNMA 4EE9A 3L4ZA 3HMJG 3FA4A 5DLCA 3CV1A 3KP1A 5EBAA 2AOSA 1E4NA 2JIWA 3ZR6A 5CSYA 3BCFA 2VVNA 3P5ZA 4D8ZA 2WVTA 3S9ZA 4AEFA 1GVRA 1RVKA 4HU8A 1OCBA 4ILSA 1B0IA 5E0FA 5IFTA 4HA0A 3S46A 4IX2A 1Z41A 1TELA 5I79A 1KV8A 3B0VC 1C90A 3QSTA 1TPB1 5H6HA 3O6DA 1CX9A 4Q6JA 2A2IA 3TNBA 1Q3NA 1FKXA 3W7KA 3U2EA 1HG3A 4R33A 1JR1A 3RX2A 3V1HA 4ZOBA 4IGNA 1UKOA 3ZT5A 1WAWA 3EEGA 2GJXB 4FX8A 4R7WA 1GW1A 4MFDA 3RM8A 2IKHA 1V7AA 3UWWA 3CUXA 1XI3A 4IMFA 2OOFA 1GONA 2D69A 2OX1A 1QK0A 1ZJBA 2HQAA 2DORA 1K8XA 4XX6A 1KCKA 3MYPA 3WQ6A 4QDWA 3FVMA 3GM8A 1UR4A 2P1FA 4XZHA 4IF2A 1TA3B 1XIJA 3WLRA 1V5XA 3VGEA 5HQMA 5FJIA 4JL2A 4E0CA 1LZOA 2Z0IA 1VPYA 1E73M 4O1FA 2W63A 4MWAD 1W2VA 2D2GA 2FJUB 3WD4A 1UA7A 4GUIA 4M7TA 2R6OA 5HMFA 5JMUA 1S2WA 1XIBA 1EJRC 4G9PA 1KR0A 3CHDA 1ODZA 1JL8A 3ZLFA 2DFAA 2A0NA 4DBEA 4LCQA 2RHGA 4M29A 2RGMA 3NEHA 1UUQA 3CLWA 2QJMA 4GA8A 3ZJ8A 2DT3A 4Q32A 3U2CA 3ARQA 4JR5A 4AXNA 3TN5A 4Z2LA 2PI6A 3W1RA 3CTLA 1L8PA 5A6JA 3F5LA 3UR5A 2G3FA 2QCFA 4M7SA 3UGRA 1R86A 1GEQA 2EPNA 1MDLA 3GS6A 1EPXA 2VEPA 4O14A 5CGMA 2NSXA 1FDZA 4E3VA 2DT0A 5HUPA 2XSAA 2XGZA 1U1UA 2A4AA 1MW0A 4ZO6A 4H8VA 3LOTA 4JNMA 2OYMA 3KFTA 2ISSA 2VUYA 4PYSA 4JTIA 1V0KA 3PK7A 4QBXA 1BSIA 2QJGA 1H0GA 3QXBA 4I9JA 2CYGA 1UBPC 4Z1YA 1K7FA 3MO4A 3L4WA 4KRTA 3TR2A 3TQ0A 2EEXA 4GRSA 2D0GA 1V93A 1PKNA 5AYZA 4HPXA 1X7IA 1TYGA 3T0DA 3RPTA 4JICA 4D6EA 2Z4GA 4QTGA 3GFXA 1CGXA 1S5NA 3C0SA 4GINA 3AHTA 4GO8A 2ZWZA 2Y6ZA 4JYDA 4JHOA 4Q4RA 2PA6A 4V2XA 4NAEB 1H7PA 1RQEA 3NXFA 3I3BA 4LT9A 1OFQA 4HA3A 4DB7A 3VOFA 4WDWA 1PKMA 2GOKA 1XL9A 4L64A 4O54A 1E6NA 1GCYA 1VLWA 2ZZ6A 4KPLA 1LL4A 2PTYA 3OLIA 2HWGA 4GJ1A 3BANA 3EOSA 1ZAIA 3CC1A 1XGDA 4TO8A 3HV8A 3NQAA 1DVJA 1EB3A 4UTIA 3AZRA 4KH2A 3F4DA 1YMYA 3M07A 3B9AA 4PBEA 1W9UA 3SADA 3IGSA 2O0TA 1LLWA 3DX5A 3DESA 5ECVA 4W88A 2Z00A 3GH5A 5A6LA 1U83A 1JGMA 3EMCA 1RLCL 4H4IA 3KTXA 2J7BA 5IHSA 4M1RA 1SMAA 3EWYA 2Z29A 4TX8A 3OU8A 4IG2B 4JDBA 4R7OA 4K7VA 1F05A 4DUWA 2HROA 3DC8A 4B91A 5EMMA 4BF9A 1H11A 4LSBA 1XLEA 5AYIA 4PA8A 5G2HA 2QV4A 3N14A 3CUZA 1W3TA 4MJ2A 3QMTA 1YNYA 1D8WA 1IEXA 1TFVA 3FV9A 4YTTA 2CZ5A 4FIQA 4QR6A 2DZVA 2R14A 1JNEA 4WRHA 2AL2A 5D9OA 2XFFA 3R43A 2HXUA 5FJPA 3T07A 3MS8A 1SU5A 2BB0A 2BHYA 3MTWA 3TMQA 1HX0A 4LYQA 1HL2A 3B40A 1D3GA 5LA1A 3EA2A 5CZTA 2CPUA 3LBCA 4D1JA 4TX6A 1S1RA 4CLMA 2O56A 3WD2A 1TPVA 4H7CA 5DMYA 4LY8A 3VKCA 1FH9A 3KX6A 3WK0A 4Q7BA 5EFFA 3N2TA 3O6YX 3FK4A 4GG9A 3WNOA 2IKJA 3L9CA 3GX9A 1CBGA 4UTWC 4NSBA 1EX5A 1J2WA 1XUUA 4GACA 4S3GA 2VZUA 3N4FA 1XC6A 4LEFA 3W2MA 4XBJA 5CGQA 4DYKA 3EKLA 3U57A 4NL1A 2E1WA 1PHQA 3H7RA 3CIWA 5AYXA 2YJQA 3H2NA 3L67A 2W6RA 3HGJA 2W91A 3TZNA 4H6QA 3ZZ1A 3IIOA 4XD6A 4L80A 4DZHA 1ZBWA 1QI2A 3BAXA 4HTYA 2FPVA 4Y9PA 5BW6A 2A7NA 5G5IA 5EL1A 1PZ2A 2V30A 3W7LA 5C5YA 3S2LA 4IHCA 4DLFA 1OF6A 3KRSA 2EPKX 3VDBA 4H3DA 4C7FA 3TAOA 1Y7VA 7REQA 1OX4B 1DJGA 3WMCA 1VCVA 4DAFA 1PX4A 1J10A 6TAAA 4IIBA 1O1ZA 4UR8A 1D7KA 4Q8WA 4WGHA 3P0XA 3PUOA 1JCLA 3AICA 2BY1A 2PE4A 3L66A 2V82A 3Q37A 2OQHA 4S39A 3R4IA 3CT7A 4CD7A 3S5SA 4BR1A 2HK1A 1OB0A 3R58A 1PYFA 2RJGA 5DF0A 2VOMA 4O28A 2XIIA 2G97A 2FB3A 3ZWTA 4FXFA 5D04C 1JDDA 3W2LA 3WH6A 1VGAA 3AS0A 2XINA 2IS7A 4IQJA 4FNTA 1SO4A 2DT2A 3LCWA 3GIYA 1CXFA 3C0LA 2WOQA 3LZ3A 1VBUA 1ZTVA 3B06A 3BMWA 1XQKA 2YBTA 2I5QA 4R27A 1I45A 1EXPA 3AYRA 2QDHA 5I3JA 3VDHA 4XTDA 3WBEA 2FIQA 1REQB 3LGGA 5IXEA 1A49A 4BWLA 1VRDA 2DH2A 1LP6A 3MMDA 4GI6A 3T2OA 3MVTA 3T08A 3L12A 5CZJA 2NQZA 4JCMA 1KBJA 1XM3A 2O4QA 4F0SA 3MPGA 3RU8X 1EWEA 3LB0A 4CVWA 2D3LA 1YBQB 1KR1A 3NQGA 2WVVA 1OG0A 3NO1A 8RUCA 4E4FA 1SW7A 1ODUA 3S9IA 4GI8A 3SCRA 4QHRA 5FAGA 4XO6A 1VBRA 2CLEA 2CZEA 1EOMA 1V6UA 1TIMA 3UERA 1YPIA 5A1AA 3O05A 2I9EA 4UTJA 3A3WA 1ITUA 3ZO9A 1SW3A 3PAOA 4B3KA 1W1PA 2EG6A 1OC5A 5CBJA 4JFWA 3E02A 4QEEA 3H2FA 3FLUA 2C13A 3TNOA 2ZUWA 2P3EA 1PAMA 1XKJA 1W9XA 4HNOA 3VNIA 3COTA 3F2DA 1TTQA 1H09A 1KTNA 1JAKA 3TTQA 4PL2A 4J28A 3DU0A 1UWAA 3CU2A 3NXLA 2D73A 3UF9A 1LWIA 2J9XA 1US3A 2PDMA 5DXXA 4HMEA 4ZR8A 4M5PA 1XWYA 4S1FA 2PMQA 1GTHA 2WNNA 1R3SA 2CKSA 1W9DM 2PWHA 4LANA 4IGHA 1GOQA 5A2AA 3RJYA 2I56A 4G2DA 2Y5EA 2WNQA 4K8HA 1QJWA 1HKKA 1N55A 4QSFA 3MBDA 2ISWA 2VZOA 4OOZA 2Z27A 1K70A 4NIRA 4Q8QA 1OFRA 5FJUA 2GQ8A 4FNUA 4IIEA 3W7JA 1E4MM 1FDJA 4HYRA 3WFZA 1KRAC 1SZGA 5CPOA 1AJ0A 1R85A 2EG7A 5HBFA 3PUGA 3CPUA 3VILA 3W28A 1YE4A 5CJNA 1HKMA 4X22A 4GYFA 1XXXA 3M6DA 2CEQA 1DQUA 3GVVA 2R82A 4J9JA 4UMCA 3R8HA 1UJPA 3NQ6A 3G22A 2NV9A 2CC0A 1VKFA 5T9BG 1W3KA 2QVNA 1B1YA 1GNXA 4HYVA 4TTGA 4A6GA 2J74A 3BGAA 4BQ2A 4MNJA 2VQUA 3NEVA 1T8QA 1EX1A 1TQJA 3W71A 2TYSA 2V69A 3W7GA 1G4EA 1VYRA 2AMXA 2BY3A 3GXFA 3WMBA 2OWWA 4J5NA 4K37A 1RXOB 3EOUA 4G1KA 1ME7A 5LNWA 3V0SA 2ATMA 1ZNNA 1M5WA 1FOBA 3DC0A 4XAYA 4IJRA 1JVNA 3EMQA 1E5JA 1GVEA 8A3HA 1WCGA 3LHUA 4A8NA 1W1YA 2VURA 2Z6JA 2EGZA 1L6SA 3W22A 3ZLGA 1K7EA 2EBNA 1JCYA 2VX6A 4QISA 5KZEA 3TA9A 3VI2A 4C90A 5D2VA 4H6EA 3NYDA 4F66A 2CLLA 3UCDA 2VRKA 2DY3A 1S5VA 4I8DA 2UY5A 1P0DA 1Q2RA 4DO5A 3G3MA 1Y5VA 5FF7A 3I3DA 1H7WA 1W9BM 2VC9A 2CZFA 4WVXA 4NUWA 1OC6A 1E4IA 4QS5A 2J25A 4UOJA 1UROA 3ZIZA 2O9OA 1E70M 5D37A 2WCGA 3A4XA 3G0UA 1XLKA 4GIYA 1BVZA 3BGJA 1TIWA 3GTNA 1ZCCA 4K2SA 1V51A 4H00A 1OEPA 3N2XA 2E40A 4WX2A 1QNQA 3B0PA 1ZBVA 3MVIA 2PWFA 2Z24A 2B7QA 2OU4A 3G6LA 4AUBA 4Q4QA 6ENLA 3SUSA 3VMOA 4S2BA 4PMYA 3H2MA 5DEZA 5T8GA 2VFGA 2QR6A 4PGLA 3VOCA 1IGSA 2A3CA 3KDOA 1PDYA 2F7FA 1JZ6A 3PZGA 2VELA 4FALA 4HJWA 3W2KA 1U2YA 3Q65A 4BEQA 4DO7A 2ZRZA 4JN8A 2HBXA 3T55A 1YTEA 1AL7A 3BH4A 2QUVA 1AH3A 1B4EA 4ACZB 4F79A 3P84A 2VX4A 3AMLA 4GIRA 4PTXA 4IQLA 3UJFA 3WBYA 2GGEA 4IPNB 4HK7A 2DZBA 4QG9A 2XPKA 4P61A 3LCLA 1KRCC 3SJNA 3CWNA 3WQWA 4I7WA 4C5ZA 2XVKA 3V0UA 2VXNA 3P2VA 3NO5A 2GYIA 1ZLPA 4D2JA 2WCAA 3VIKA 2I1OA 3ZQ9A 3WK1A 3BAIA 4OTKA 1R46A 1R9ZA 1C7SA 1XIFA 3TTEA 4B9ZA 4JS3A 1XCWA 3WELA 4EWND 3GHTA 2BXZA 2WMGA 3DECA 2AL2B 2PTXA 1X38A 2WHLA 4MGGA 3GSMA 5CPQA 3SRDA 5KMYA 1TCMA 2WNZA 3AXXA 5GVJA 3W3OA 4GZEA 3MJMA 2WZMA 1PIIA 3QW3A 3A23A 4Y9MA 5FF2A 3NDYA 4JNZA 1J0JA 4R85A 3RNDA 4GZIA 1GT8A 5E09A 1GOIA 1HKWA 2OT1A 4LAOA 4OUIA 1KQYA 1EF2A 2ICSA 1JPMA 1FHDA 5CBBA 3GW0A 4Z17A 4L56A 1LL6A 5E70A 2AAMA 4R3UA 5BXTA 3INPA 1AG1O 2PLCA 4BQ5A 2OODA 1DHKA 3AHVA 3MP4A 6REQB 1S2TA 3SDOA 3MP3A 4H1ZA 1RP8A 3E0IA 2Z2BA 4NQ1A 2QAPA 4ADSA 5LIUX 1Q6LA 3LA4A 1MEHA 1PL9A 2OSYA 2A21A 1G69A 3GU9A 3LLXA 2ZYFA 4KCWA 1GYNA 2PDFA 2GJLA 2F6UA 3FJNA 3MY9A 3ONCA 5CLWA 3R79A 4G7FA 3BZGA 4LAMA 7REQB 1XP3A 3W86A 1R3VA 2TSYA 1JQXA 4Q8OA 2I5GA 4HNUA 4JTSA 9CGTA 5JXQA 1BYCA 1NWUA 1TUFA 3GK0A 1WQ5A 3T8QA 2J78A 4C6CA 3G24A 3NIYA 2ZZ7A 4PMRA 4GVHA 3KRBA 1K9FA 3BK0A 1Q6EA 1JF6A 1OT1A 3RLUA 4HHPA 2DSWA 2BWGA 4M6PA 4XB3A 1VHCA 2QV5A 4RDZA 2WYSA 3ARYA 3JW7A 2PBGA 3E49A 3CAVA 4DX3A 4JTHA 3WLQA 5A6BD 2B31A 4RL3A 3SRKA 3UXKA 3T0BA 3BJTA 4R9OA 1R3WA 4WJEA 3PNUA 1W5NA 1ZB5A 2V9DA 4H8NA 3W29A 2ZZ3A 2XM1A 2J7GA 3QQWA 5IDIA 1UC5A 5M17A 1BF2A 3WH5A 3H2AA 3K1DA 2ZX5A 1JPKA 1NOUA 4TVDA 1X7FA 5BMXA 1BYAA 1FHUA 3C2RA 1BSLA 1JGIA 1XRTA 2YL6A 2ZOXA 1WA3A 1GWJA 2PWVA 5F4WA 2PDGA 4UFHA 4IPIA 4LVBA 1L2QA 3RRXA 3G1DA 1GPWA 2VP8A 3TWAA 4XBKA 4Z2GA 5I06A 1D8CA 1KGUA 4LCSA 1KM6A 3E5PA 1TMLA 4ZQCA 2OZ8A 5IFPA 3TU9A 3SN0A 4FXJA 1KM5A 3Q2DA 3AAMA 3NA8A 4EIVA 5G4HC 1OWQA 2JKAA 3QTGA 1V6YA 4DNMA 1PX8A 1YXCA 3FXYA 3W87A 2NLYA 1GOWA 2XIOA 2CERA 4H9UA 4BWLC 3B8TA 4F0KA 1ZALA 4OVXA 2DDXA 4O16A 4EOUA 1EH9A 2BSLA 3BCDA 1TVLA 3LHWA 1MWOA 3CHFA 4P8WA 3CPGA 3KWSA 1F07A 1XYFA 4NXSA 5M03A 1WZAA 1E40A 4A8LA 1DWAM 4WKFA 2W62A 3B9NA 3FAXA 4CQDA 5FF3A 2UZ9A 1JFHA 2VEKA 4IJCA 2GUYA 3BC9A 3F4NA 2YA2A 4UMBA 1JF5A 4B16A 1QWKA 3JR2A 5D32A 5DY2A 3C3UA 2KX9A 1AD4A 2WVUA 3VAVA 4GQGA 4HVXA 3EX4A 2PC8A 5BOFA 4HOWA 5C0QA 2JKEA 4O17A 1M65A 3GXDA 3TKFA 2O92A 3JZUA 1DJXA 3G77A 1GOKA 4YLWA 1HNYA 1JPIA 1GOOA 4IFRA 2ZCGA 2J79A 3PVFA 3ZJ6A 2WSPA 2EJAA 3BLKA 3HB9A 2YYTA 2EG8A 4GPNA 1VYSX 4A3YA 3IWPA 4QRNA 1T41A 2RDXA 3A4WA 4ACYA 1OGGA 1H7RA 3N9SA 2PEVA 2JBMA 2IMRA 2YW3A 3ITLA 2DZAA 2VWTA 2XN1A 1GQNA 1R0MA 2C79A 1QW9A 2RFGA 2BZNA 4DYEA 4PTMA 3UU0A 1I8JA 5AZ0A 2OXNA 2QUMA 4LXFA 3LZ5A 2ON3A 2XU2A 4XSMA 4TIMA 1LBFA 5K2ZA 2FZ8A 1Z6KA 4FIRA 1KFBA 1CECA 3HG2A 4DZIA 2XSXA 1AVAA 3RM4A 5C7VA 3FHQA 3FIGA 3T4CA 5MKGA 1KB3A 1MI3A 1LCOA 2ZA3A 3FEMA 4FR1A 1QK2A 3IRSA 2DJLA 4RV8A 3TFCA 2G96A 1OIMA 4LUJA 4GVIA 4JEQA 2YL9A 1EYWA 2R9RA 1LUCB 3BXWA 3AMDA 2AKMA 3BG9A 5DXYA 1P6WA 3P8IA 4X60A 3SCQA 1QW8A 3BLIA 4GXPA 3AZSA 2FH8A 3UG4A 3K8KA 2NT0A 1VD6A 3BAKA 4DJFD 3CUFA 2WKJA 4GH3A 4C6OA 5CZKA 4MTVA 4O18A 4JN6A 4CNOA 4O1BA 2QDEA 1OX6A 1XG4A 4JIEA 4P8VA 2NV2A 3HZ3A 4XTIA 3GHSA 1E51A 1S2CA 4EAMA 1IZCA 2DH3A 1GOMA 4OBTA 4AZ7A 2X7VA 2ZX6A 2XH0A 4MNKA 1SPQA 1ESWA 1BQGA 5HMDA 1K9EA 1EOKA 5GNXA 4JD4A 3PG8A 5ABGA 4ES4A 4QE5A 1UCWA 3QTPA 1CGUA 3OQEA 3RLVA 1IIHA 1CNVA 1E3XA 4YVPA 2AGKA 4JTRA 1M53A 3WDRA 7TAAA 4MAZA 1HTIA 3OIHA 4PMZA 3WLTA 2GGHA 3NL2A 4S23A 4RK8A 1JIBA 2YXOA 1PTDA 4HZ7A 2XWEA 3W84A 2PDPA 2R8WA 3NZPA 5D03A 4QROA 3NZ1A 3HBLA 3NO3A 3WBAA 1DWJM 3GDRA 3IPWA 1Q8JA 3POCA 4RE2A 4Y8FA 2YCLA 5LNSA 2RAGA 1ADSA 2X8RA 3NZQA 3MT1A 4U5KA 1Q63A 3GG8A 3KL5A 4WJXA 1SFLA 4WUIA 2PDLA 3L5MA 3W6MA 3CO8A 2XVNA 3MCOA 2Z1SA 4MWAB 1PV8A 1UH3A 4FX7A 1JULA 1VFSA 3TP4A 3SSZA 3IJ8A 3RLHA 1E1EA 1QWGA 3MSDA 1XS2A 1NQKA 2WWDA 1WO2A 1UWSA 1EDTA 1FWEC 2PDXA 4HPJA 3DIPA 2OEMA 2ZRWA 4A2SA 3DGBA 3LX9A 5JIPA 4J3SA 3EDJA 4K8EA 1CLVA 4O50A 4MWAC 2V5BA 4CQBA 3R10A 4NJJA 1E9LA 3VNLA 5A8QA 3WX7A 1JZ2A 3UXLA 2BGSA 4O0KA 4B9YA 1HJXA 2FTPA 5AC7A 1S2VA 1XBXA 4F48A 4E3TA 3EXTA 4QAIA 3PM6A 3S5ZA 4ZA0A 3I4KA 1FCUA 2PP1A 1FWIC 2Z7GA 4Y90A 4QE1A 1TPUA 4PBGA 5DO8A 4PUWA 2BVTA 3WZ0E 3LRMA 2H90A 1FFRA 1VC4A 1R3TA 1Q7ZA 1UR8A 5EGRA 1W1TA 3NG3A 3UPWA 4DF0A 4LNCA 5ABFA 3G1XA 1RD6A 3L2MA 3AALA 1GVSA 1GTEA 3DFOA 3F5JA 5JQ9A 5AC8A 3RLGA 2ZVIA 1NOWA 2QCMA 3ABRA 1YKWA 4YS1A 1M01A 5AFDA 4Y96A 1IXOA 2DIJA 4IQEA 4IXHA 1XYBA 1UD3A 1QPKA 3HQOA 1CXIA 4AW7A 2PGFA 3NQDA 5EMUA 1AJZA 1FWDC 1ICSA 1NEYA 2FVKA 1JI2A 3UZXA 3VOJA 3O2LA 1NOFA 3L65A 3I6TA 1ZJIA 3WQ4A 3VX1A 1O5RA 2WZTA 3OO2A 1KGWA 1R7OA 2DU2A 4LU0A 3VNDA 4UXDA 1EGVA 5BCAA 2E1DA 4DZ5A 4MWAE 3F4WA 2PDBA 2QUNA 2CLOA 1SSGA 3CV6A 2BGQA 3NVDA 4ZL1A 2DSVA 4N6EA 5G2WA 1VFUA 1PE1A 2DQXA 4LUTA 1ZY9A 4DWSD 5D2WA 3VE9A 1JUKA 3ORWA 3WN6A 3LNPA 5LA2A 4K3ZA 3PNZA 3VX0A 2P76A 1EJWC 1SGJA 1B57A 2E28A 4NY2A 2NQ5A 4I8YA 5DFAA 4HHLA 3L5LA 4LS0A 3SCTA 4DUVA 3NOYA 4DY1A 3L21A 3VA8A 3LSCA 1R3RA 3A64A 3VNJA 3MUAA 4NZJA 4PBFA 1KM2A 3GY1A 2XSBA 3TXZA 4G56A 4NHVA 5BRQA 3MCNA 5G4WA 2DUXA 1TPDA 2V5LA 1L6FA 3IIXA 2CLKA 5EPDA 1IHIA 3W1AA 1TWWA 1VBGA 2Q3OA 2Z1BA 5F2LA 1MSSA 3WD1A 3BSGA 1OX5A 3AWNA 3SRFA 2OLSA 3OZPA 1RR2A 2I57A 5I24A 4FNQA 3B03A 1HJQA 5TNVA 4IP4A 3W02A 5DQPA 3H70A 2V5JA 4IISA 3OZMA 1GZJA 3T40A 3WH9A 5J5DA 4JY9A 3H8AA 1JZ8A 1BGAA 1ONEA 1XCFA 3C5QA 1UIPA 3UJRA 5C9ZA 1AW2A 4M80A 5ABHA 5K9XA 5FJOA 2ALDA 3PWGA 4N6FA 2W92A 3N9KA 1BWKA 1B3OA 4IMCA 1ISYA 3CUJA 5I6SA 4H7ZA 3VZXA 3CZ8A 5B7YA 1AW1A 3UWVA 1PS9A 3NQ8A 3GNDA 2E8YA 1YXDA 3K8MA 4IFKA 3T0TA 4KESA 1FA2A 3EX3A 3MSGA 3SEPA 4B2DD 5HQEA 4AIUA 1ZBCA 3KZSA 2XIQA 3QMRA 4AWSA 3TN4A 4KFOA 4EXBA 4TR9A 2PWDA 4B4FA 4W8LA 4DBDA 4YVVA 3DHPA 3R13A 4UQCA 3OLGA 1AH4A 5KINA 3O3RA 1DJQA 3IV8A 4CN6A 4E2VA 4IH3A 3H4WA 3A12A 4P2VA 2WJFA 3TYDA 4FXSA 3WQGA 3S6OA 1TVNA 2FTYA 5BRBA 3SUTA 5CZ0A 3NURA 3ARXA 3E0VA 3P8JA 4JTAA 4LTSA 3K4WA 3FNDA 1XH1A 4AMAA 1KKOA 5F1UA 2ATSA 1Q4WA 1TRDA 3E3HA 2X40A 5D02A 4EK7A 3FYPA 2GZXA 2FDSA 2YR1A 3SUUA 2OMAA 4GKLA 1HJSA 1XYLA 1DJHA 1TWZA 2FGZA 4DQWA 1IT7A 1DOSA 3BL3A 3R94A 1NTHA 4ZTYA 1QR7A 3EX2A 3APTA 4UR9A 3W2UA 4XO7A 3RDKA 2E5BA 1EC9A 4DJEA 1S5WA 4CNSA 1AL8A 1ENUA 3LM3A 3KHJA 3RITA 3BMXA 4LVAA 4Q8MA 3ATYA 3FN9A 2PU0A 3P60A 4O57A 3AIEA 1HKIA 1JD9A 1RBLA 1ISWA 3KE0A 3SY8A 1M7JA 2ALRA 5LSMA 2X1RA 1TV2A 2GDUA 3R89A 3RX3A 1P6CA 3U4AA 2W5FA 3TN6A 2J77A 1G9HA 3MUXA 3VGGA 1KWGA 3UWEA 4P7OA 5JBEA 2OT0A 3KBVA 3KW3A 4MZ1A 1SFJA 4KEZA 2QHAA 8XIAA 1A5BA 3EWBX 2VQTA 2VC7A 1QBBA 1TZ9A 1BGGA 2EPHA 3CASA 1ZJHA 1XJBA 1CGVA 3CH9A 4H9MA 3GG1A 1LBMA 2UWFA 1O66A 2ZA1A 4XAGA 1J6PA 1QPQA 3U4FA 4GFIA 2GQAA 2J7FA 2D20A 3PG9A 1QI4A 2GSHA 4A29A 2J47A 2DZSA 3QLDA 3M0VA 4Y9AA 1ZSXA 3HFYA 4EKJA 2AQVA 4GKTA 4HPNA 1KO0A 4LY4A 1W6TA 3N2BA 1VFMA 1HQTA 1XIGA 4DELA 2F6XA 4RR4A 2Q09A 5HNNA 2YCKX 4TVCA 4B3ZA 4LF2A 3GLCA 2ESCA 1L6GA 4XZMX 2VFFA 1EFZA 1QHPA 5HNTA 1KLYA 2ZTKA 1P1MA 5AVNA 4LUIA 3T2PA 3W7NA 3EWCA 3TYUA 4INFA 1NM9A 3CYJA 1W1A1 3DKJA 1VIWA 3ARPA 3WLMA 3M5ZA 4TV6A 4IP7A 2TMDA 1D9EA 1OC7A 5CCZA 1H63A 4WLCA 4AEOA 4F0LA 2PD5A 3HU7A 3RPMA 5AKQA 4P8XA 4Q8NA 2VCCA 1C8VA 3N17A 4KFNA 2XGIA 3ITCA 2DEPA 4CCCA 4W5ZA 5BXPA 1MFUA 2DJXA 4D1IA 4PCFA 1BLIA 4IX0A 4ZXOA 4MY8A 3GZ3A 2Y7GA 1XUZA 3RU6A 2CWXA 1RA0A 3CQHA 1FWGC 4FEZA 2I7GA 1O5XA 2BX7A 2YCLB 3B9OA 6XIMA 3HPXA 3RFAA 1NDVA 4OV4A 3UQNA 3NQBA 4JX4A 3LD5A 5F4SA 3ANVA 3S1WA 2C15A 1B5TA 1VF8A 5DT7A 1GORA 2UY3A 3H2EA 1W1ZA 3PSVA 1NIUA 4PCNA 2GGJA 3O15A 4PFMA 4DPPA 3KCLA 1DE5A 3BURA 4ICMA 1JZ3A 1W3IA 2Q71A 2CLPA 5HXMA 4LGXA 3CGTA 3MV01 1DWFM 3CHEA 4AEEA 2ZVRA 1WZKA 3LI0A 5DCDA 1UKTA 2XYLA 2ZADA 5C54A 3TEVA 3M9YA 3CB3A 4AVOA 1ZUAX 3NCOA 2ABBA 1HJVA 3TFXA 2AQOA 3WBWA 1C8YA 3VCNA 5LZLA 3KP0A 2HCVA 2OTDA 1MXGA 1EBHA 4AFYA 3QLLA 3PS7A 3LY0A 3GVGA 3IVTA 3N2MA 4BCEA 2FJKA 5MF5A 3RM9A 3QBUA 4MPKA 1SFSA 4IFOA 3W1MA 1H60A 3ENLA 3OTRA 1X6UA 1LRNA 1R87A 9XIMA 2F84A 2Y62A 3UFYA 2G3MA 3S1UA 3UCQA 1JZ7A 2ZDSA 3IJIA 1LROA 3ELFA 4G7EB 1CWYA 2XVGA 9XIAA 1OIFA 3FX4A 4XG1A 3B3DA 1WBJA 1EYEA 1WZMA 4MMWA 2OSXA 1BFNA 1OGBA 4IL0A 3HGRA 2C1IA 4AZ6A 4AY7A 1W54A 7A3HA 5DMMA 5CPTA 4FOUA 3K13A 1ITXA 4MF4A 1GHSA 1P1XA 4Q4PA 3WNKA 1V7YA 3PFRA 4PUUA 2KZHA 2FVMA 4MLJA 3SCSA 2ZRVA 4WY0A 2CZDA 2CFFA 2V38A 1TE1A 1XRFA 4JTEA 1BG4A 5LIKX 3VDGA 3WLHA 2ZFAA 3WLPA 2SFPA 1ZU8A 1GZ1A 1JZ5A 2A3LA 2NWRA 4AMCA 4JEJA 4ECLA 4L1WA 2FVLA 3LBOA 1PTGA 3D6NA 1BQCA 4UR7A 4K68A 4Y7EA 2JALA 4PCTA 4LUSA 2VD8A 1G01A 1OZQA 4UQ9A 1BG9A 4ICCX 1CPUA 1R6WA 4R5EA 1QT1A 3GFZA 3CWHA 2VCBA 2IUZA 3RCMA 2AGTA 4GQBA 1O68A 1EHAA 5A6SA 3ZT7A 2OEKA 1DJIA 3G1YA 2WK2A 3NFUA 3K2GA 5CAHA 3FEQA 1E0XA 1MW1A 4JYEA 4Q4KA 5D2XA 5D2YA 1QASA 1S38A 3T2QA 2BASA 1E6PA 4MJ4A 2B81A 3WJSA 1BEUA 3TE9A 5CBIA 1J79A 4J3UA 3D3FA 2A3HA 3NQ2A 2X2YA 1VCGA 1D3CA 3TYAA 3H12A 4DEFA 1G4SA 3BOFA 3BOLA 4D6JA 3WLKX 2ANUA 4KWUA 3LN3A 2QAFA 1H61A 5FL0A 2QF8A 3B97A 2C1HA 3GNPA 2ZTJA 4L9XA 2Y7EA 3NGJA 4YJ5A 5D8WA 4WF7A 1DHPA 2Y5JA 1KBIA 1TO3A 2GJXA 4ERGA 1X1ZA 1B30A 4PUEA 4LJ3A 4A05A 2WHKA 3IV3A 5H8MA 4S3FA 3U5UA 2XM2A 4ERAA 2GL5A 4W8BA 4AIBA 3TDFA 4B5UA 4HNLA 3VC6A 2IQDA 3H4GA 1G4PA 1H51A 3L4XA 2BDQA 1HL9A 1LOSA 4XZLX 1THFD 5C55A 1PBGA 4MAVA 2Z6IA 2YA0A 1TA3A 5HUOA 4MM1A 1Q6RA 5LIWX 5H2ZA 2PTDA 3OVPA 3A4AA 1AQHA 4HPGA 1SVDA 4YMZA 4I9MA 4DNHA 4BS0A 3PAJA 4M6VA 1RLDA 1T96A 2X30A 1DXIA 2ZIDA 3P3BA 1K3UA 3VOIA 1WXZA 3WLNA 2V67A 3QYQA 2A3AA 2GVGA 4AZIA 5CJ5A 1X6NA 3OLDA 4EAYA 4RNFA 1V0LA 3XINA 2MNRA 4MKSA 4HZ8A 4H04A 4PH6A 3O63A 1PPIA 4J2PA 5C71A 3E96A 3S8HA 4GNJA 3W74A 2P53A 2PDIA 1TTJA 4NZFA 3QPZA 5DMNA 1Q4NX 2E6DA 4AZGA 1AA1B 2E5DA 4B5TA 1GEHA 1IF2A 3R0UA 3PZVA 2GWNA 3UXAA 4ZB5A 1KFJA 5HK4A 2X0SA 3V1PA 5FI8A 1VR6A 2JEPA 3ZSTA 1I2QA 1FH7A 3QGKC 3W85A 4KIRA 5LYRA 1SZEA 1TJ2A 3W4RA 4UTKA 3TK7A 1UWRA 2V2HA 2ONEA 2GSEA 1UZDA 3ZJKA 4PC8A 2EXOA 3V5FA 1P0EA 4AD5A 5JVLA 3OZYA 5D05A 1PZ0A 1GHRA 3P81A 1RY8A 1T7LA 3WEOA 4M6UA 1F73A 1O5QA 3ZJ7A 3T9PA 1FXPA 4PODA 5TIMA 4YHGA 1I4NA 1KRMA 1Y8BA 2NXHA 1EUAA 1WKFA 2C71A 1EJXC 3S1XA 2VEIA 1SR9A 2BP1A 3I7QA 4FNSA 2O9RA 1AJ2A 4DJEC 3GUGA 4OOUA 2JEQA 3BSMA 3IUHA 5LNRA 4HZ6A 4C6PA 4WIWA 2X09A 3QV9A 5D09A 3U7VA 5I02A 2FFIA 4FLRA 3VD3A 2POZA 3TQKA 3ZR4A 3NWRA 3TC3A 1UB3A 4C5YA 3MO7A 5EMLA 4MB1A 5CH9A 1A5OC 1XD0A 4GLEA 2R1LA 2Y8UA 2WMKA 1KA9F 4B15A 3M0JA 3KBWA 1Q6OA 2QCHA 3B8VA 4IZGA 4AD2A 1TV3A 2WZHA 4AX7A 3A21A 4D9PA 2IQTA 1KC7A 3PTKA 2ZRUA 5FF4A 3U2ZA 5FCZA 3GH7A 3W7HA 4AIEA 4JTFA 1WDQA 3VGDA 2GJPA 3PUDA 4QNEA 1WDDA 3M7SA 4PUMA 3R8RA 3FFSA 3FA3A 4RJEA 1Z32X 4FSAA 3GZAA 4KCVA 1YDNA 4PR4A 1TQXA 1A4MA 1R7AA 3BAJA 1WXYA 4H6RA 5CPSA 5IRPA 4UNLA 4DZAA 2CBIA 2OEJA 1E6XM 3MC5A 4Q6XA 1NP2A 1QRQA 5I3GA 1FH8A 1YHTA 3WJYA 4IMAA 1XG3A 3D3AA 2VFIA 1MZHA 4DPQA 2WM1A 4BQ4A 3B0XA 5FIPA 1DXFA 3TONA 1EGMA 1VENA 1WE5A 3Q4DA 1Q5MA 3HMCA 1V3MA 4QP0A 4AXKA 5FF0A 4IL2A 3BE7A 4POCA 2WJDA 4BJHA 2FHBA 1KCZA 1O4UA 1OHLA 5HWNA 5EA9A 1BXBA 3DFHA 5E9AA 3TYBA 3I6RA 3R8GA 3EWDA 1ML1A 4GH1A 1A3WA 3OHIA 4B90A 1CLXA 1I2PA 2FMOA 3WJZA 1KGXA 5TF0A 3BVJA 2YKKA 2EF9A 5CKSA 4IPLA 3WQ8A 2HVOA 1WB0A 2PC4A 5I5RA 1QOPA 4KEMA 3FS2A 1J2BA 4I5UA 3ARTA 3LTPA 1WKDA 1BD0A 1RCOB 3IJQA 1RK5A 1T0OA 1ISZA 4AWEA 1FCVA 4V1YA 2F8QA 3QQ0A 5AHNA 4HMCA 4CEXC 4US5D 1HL8A 2VENA 3Q67A 3N4EA 1TTIA 1OK6A 3SGUA 2WPGA 3DDMA 4W4QA 5L9FA 1C9WA 3DBNA 5DCEA 5J5RA 4C6DA 3UWZA 1NFGA 2Z2AA 3ITYA 1GK8A 2I5IA 3N29A 1W3HA 3OP2A 1R2TA 3QN3A 4UNKA 4OIFA 1UWUA 1AD1A 1J5SA 2AMGA 3Q45A 5JIWA 4CEUC 4LAKA 1FWCC 1E0VA 2CW6A 4JTQA 3NM1A 1JCNA 3B4YA 4TMBA 1E1FA 1J0KA 4QGCA 5CPLA 2IPFA 4EXQA 4Y2WA 3TCSA 4LH8A 3CV7A 1VFFA 4GXWA 1KRBC 4IOTA 3LCXA 2W67A 1CXKA 1XLJA 1V3JA 4HOZA 1UH2A 3IS4A 3M44A 3MDWA 1YXYA 1SJDA 3CB8A 1K9TA 4BQ3A 1JRBA 5DX7A 1RZMA 2YFNA 3IAPA 3HQNA 3T0AA 3CAKA 3BPWA 3IGUA 4BI6A 4DJFC 1O6IA 5JH1A 2WCSA 3TZFA 3WQOA 2QGHA 3V36A 4WSHA 1PKYA 2ZDRA 3VC5A 3T8LA 3LPPA 4UQAA 1QO2A 1GJWA 2C19A 3OPSA 4U33A 3NVTA 2FDMA 1B3XA 2DZUA 2ZC8A 1O7AA 3GB6A 2RDUA 5AB3A 3RILA 4WJ8A 4UFLA 4CVUA 1RVGA 3AC0A 3ES7A 1REQA 4W93A 4WOQA 4ZEPA 3LTYA 3HIJA 2F61A 1A5UA 3KZPA 5GPRA 4I6KA 1LOLA 4AQLA 3TOPA 4NNBA 5BRPA 1QNRA 3G8EA 1KXVA 1TSIA 3EX6A 3TN3A 2GVJA 2P3ZA 1YBQA 3QMSA 1OD8A 1XLCA 1UD6A 2C0HA 2FZNA 4US6A 4J1OA 4IPJA 3W24A 5LKYA 1N8WA 4FZIA 4LUSB 3BQ5A 5ABEA 4C60A 1AMYA 4XD5A 1S46A 2G4JA 3F4VA 5AN7A 5CPMA 2DT1A 2NT1A 1WZLA 3QHOA 2V3DA 2INZA 2J7DA 3H24A 5D9NA 3NGFA 2WSQA 4KWOA 3VGHA 4D8LA 4DF1A 2E0PA 3CZGA 2NLIA 3CHCA 1LORA 3EWWA 3W7RA 4HHMA 1O60A 1Q6QA 3O16A 1H1YA 1DL3A 3IIVA 4KF1A 3S6DA 2ACSA 3PZMA 1M7OA 2QCGA 3S5OA 3P93A 1OBAA 4F4RA 3THAA 4GQ0A 5K9DA 2G3JA 3WKZA 4RX0A 5E6ZA 4CQ8A 2FGBA 4RKAA 4KRZA 5SWUA 4Z1AA 1WDRA 1JXKA 1ECEA 1W8SA 3SO7A 2X0YA 2RDTA 2VR5A 3USZA 3F03K 4QIUA 5EYWA 1DWGM 2EKGA 5BYWA 3W0KA 4QDPA 4O15A 4TQTA 4PMDA 1UG6A 2BY2A 3W9ZA 4UFKA 3QVQA 4N4PA 4ADUA 3U7BA 3E9AA 4LBUA 1OQFA 3W27A 2Q8LA 1I1WA 3BTNA 3SM0A 3N4AA 1F74A 3DFTA 1B90A 4K39A 5BROA 4H9VA 4GIEA 1HJWA 4GFSA 1XGZA 2O9PA 1JEZA 2AKZA 3CL6A 4RCXA 3LHTA 1C8XA 4RE4A 2DSKA 5FOOA 3HJZA 3HPSA 2J27A 4MKNA 4LC8A 1QAPA 3WFLA 4GBDA 3V4BA 2VGIA 3WLOA 4QQ3A 1OYCA 4DUXA 1ZP3A 1MXDA 3KS5A 3A9BA 4PUJA 1Q2SA 3MMUA 4DJDA 1E9YB 4LPCA 3FDGA 2WZEA 4XAZA 2ZQ0A 1T8XA 1Q6FA 3CUHA 4H2CA 3LLDA 3QFEA 1RPKA 3PSWA 4MNMA 2NSOA 3IK2A 5I77A 4PB3A 3WL0A 1W1B1 2CHRA 2GSJA 1DV7A 1TUXA 2ZUNA 3AHYA 2OQYA 1YYAA 3QPYA 1A80A 4NZ3A 4P7QA 3TOYA 4XUYA 3PBWA 2PRLA 1H41A 3LRLA 3H55A 4EX4A 1XLGA 1NDZA 4O4WA 2VEGA 5F2IA 4YTSA 4ZZ9A 3I7RA 1PTAA 4OBRA 1NWSA 1RCQA 4DM1A 4NJIA 4DBWA 2QCDB 4FS9A 1FRBA 1K6WA 4HA4A 1M9HA 2VGGA 5I3KA 5LXXA 4HB7A 2BMBA 4P7RA 4C91A 4C6EA 2CXGA 2HE8A 1UWQA 5J8LA 4ZO8A 1IEVA 4M3PA 1KBKA 1C9DA 4AZCB 1W3NA 1BVWA 4XVEA 4HZMA 3TYEA 3U6WA 1GVIA 5U7SA 2WPBA 2J88A 3QR3A 3ZXWA 1J12A 2JGQA 3SIMA 3V35A 1FWFC 2YOCA 3HN3A 1OYAA 4CQAA 4NKCA 4FLSA 2JIEA 3LQLA 2YB4A 4H9YA 4IIGA 2Y5SA 1QOQA 5IDZA 4HSOA 3P6LA 4JTTA 1LYXA 2EKCA 2G4FA 2ZZ1A 4G6CA 1QXLA 4BEUA 3OGSA 3II1A 1LBLA 2WXDM 4AISA 1BYBA 3MZNA 3MU7A 2PF8A 2D24A 1L8NA 4WDUA 4Z0JA 1CGWA 4IXXA 2Q01A 2ACUA 3NPXA 4HKPA 1EA0A 3GXPA 2PDQA 1TZZA 1J11A 4RZ6A 1E72M 3GR7A 3LG3A 2I17A 2Y0FA 2WJEA 2V2CA 1SO3A 2R24A 4UTLA 3EB4A 5D9PA 3AUJA 4HU4A 1FWSA 4OE7A 1S3HA 4C6QA 3LSBA 5D38A 1GPFA 3IJDA 3VK5A 1O94A 4GYPA 1GJPA 1LT7A 3FW6A 1EUNA 2XWDA 2OZ3A 4ACZA 1RA5A 4XAPA 3C4UA 1MO0A 3KOWA 3B9EA 1IR2A 2O4MA 4Q8UA 3KLKA 3BO9A 3EB2A 2CETA 1HP4A 3O1NA 3LQGA 3PJTA 1DTNA 3WF4A 4B92A 4S3EA 4QEHA 2GUBA 4AHOA 1LDCA 1F8MA 3BGGA 4W8AA 4JX5A 3AWOA 5T26A 3N34A 4UC5A 1QDSA 3QHNA 1JDCA 5E0KA 5GJPA 4A3QA 1XYCA 1C29A 3QY6A 1PIFA 4ZE5A 2OLAA 5M1TA 2YW4A 3W88A 3ARVA 4RUBA 1XLIA 2PTZA 2DQWA 3BLOA 5AC6A 3SQMA 4X9YA 1XRVA 4O53A 2TAAA 4U10A 4ENLA 4A3HA 1RUSA 2J6VA 5KEZA 5AHLA 4HIBA 4JQ1A 3B8WA 2ODOA 2PURA 3C2EA 3W1TA 1V0MA 1LM1A 3ZYZA 5AECA 3M16A 2W61A 4NJKA 4AU0A 3CZLA 1IEIA 3AU6A 4H2HA 1F61A 2CBJA 2WB5A 2PRHA 5CSSA 1S3TC 5F2GA 3W7OA 3A47A 2LLEA 4W7WA 1MUWA 1VB9A 4BI5A 4MB5A 1VPQA 2CWNA 3NPVA 1E1CB 3LGEA 4GJIA 4C6MA 1RBOB 3VIHA 2Y8KA 3U8GA 3OG2A 4Q33A 3DCPA 2WJZA 6REQA 1I2RA 2OX4A 4QCFA 4QJ5B 4UB9A 3EWUA 4QS6A 2DVTA 1OM0A 2FMNA 4O0QA 1FVPA 2QDDA 2VMFA 2WV8A 3S5NA 1LTDA 3P74A 1KBBA 1F6KA 1OZMA 2WSYA 5HNRA 1R5YA 4NNAA 1F3WA 4DBSA 1H3GA 3FXGA 4GYKA 1OFDA 1OFPA 1A5LC 2DIEA 4KEVA 1K4HA 2DV0A 5EU9A 3WYZA 1JFXA 4RXFA 3V18A 4JQ2A 1B3WA 2DGAA 1CGTA 2HTMA 4ZB2A 1FKWA 1ZCOA 4O8RA 3CQKA 4C6JA 3FA5A 3A5FA 3QJAA 4QM1A 2PFHA 3SCPA 1KQZA 3S2MA 3MMTA 2PDHA 1N8IA 3QC0A 1MQPA 3M41A 2BODX 3T4WA 4UFJA 3LRKA 2DPEA 2A6LA 2ZXQA 8CGTA 4S3DA 3WNPA 1NVMA 3LCFA 1VHNA 2NVDA 5KZMA 3EDFA 3PANA 2YBUA 4AY1A 2WMFA 1SJCA 5HJYA 1Z9AA 4REQB 4WQ6A 4RXGA 1UR9A 3GNRA 4I5RA 4UMAA 3OA3A 1SM9A 1VS1A 2RDWA 2P0OA 1LJYA 1DBTA 4H6KA 1IZKA 5LGZA 3B4UA 1DORA 4MADA 3E2QA 1OG6A 3SCNA 3ABXA 3KUMA 3E12A 4TXEA 2VC5A 1SMDA 4I3GA 1UHVA 3H4XA 1G94A 1Q65A 4O19A 1J93A 5HMSA 3HGSA 4MY1A 1P5BA 1ZL1A 4JHMA 3BG5A 3W6YA 4GYJA 3WSUA 4M6QA 1UJQA 3BLPX 3GVWA 3AJXA 4OBSA 2DSZA 5FSEC 3IARA 3PJWA 1J01A 1NDYA 1A5SA 3STFA 5C9RA 3KL3A 1NELA 5G4EA 3W2NA 5JUVA 1B4KA 1ONXA 2HVNA 3CK5A 1FP9A 1TV8A 2D2JA 3LPGA 3CEPA 3QC3A 4MYXA 3UXIA 4DRSA 4XD3A 3H2CA 3HG5A 4JY8A 4PCSA 5T9CE 2CCRA 4C6LA 3UYCA 2OO6A 4W85A 3GVQA 3S47A 1AQFA 4KGLA 4E5TA 4Z2JA 4DAIA 1W31A 3CV2A 4UZSA 1PHWA 3PWIA 2WMIB 3DH7A 2QJJA 2G0WA 1LQ2A 3GBEA 5TQLA 3BLFA 2ZE3A 2XIJA 1EO7A 4L6OA 1E6RA 3S83A 2HV5A 3L4TA 4NZ1A 4GVFA 1KFLA 1UZHA 1WUFA 3DKLA 3DXIA 4PMVA 2OZ0A 5C9XA 2PTWA 3W83A 1B3ZA 5DBUA 2ISFA 4JTKA 3EOLA 3ZVHB 1Z48A 2RKXA 3Q58A 3KBNA 4L4LA 4HCDA 1X8FA 3KOFA 1MVYA 3VDCA 3JU2A 1JXJA 4NT0A 4QSHA 1ZS2A 1JDAA 3EXSA 3CHVA 1QNOA 1RP9A 4O1DA 3BLEA 3E2RA 4JFVA 3M6YA 3TUUA 3VMNA 1AFSA 5AYYA 1J9YA 3D47A 2Y89A 1QTWA 3CLMA 2H9AA 3ALGA 3WUBA 1TV7A 3BW4A 3EWZA 1NY1A 1FX6A 3FCPA 4IIHA 5A8OA 3EEZA 2EJ1A 3UR8A 3AMGA 1UASA 3MWCA 2VRJA 4H01A 3KTSA 1V02A 3VNYA 4CD4A 4CD8A 1HT6A 4E8DA 2ZZ5A 1JD7A 4C6NA 3NJ3A 1EJ7L 4AZ5A 4R7JA 4PRRA 1EF3A 1I0BA 3LS9A 3TWBA 3MHGA 2J9ZA 3KRZA 2RUSA 3G0SA 1DJWA 1K1DA 1L0PA 1HIZA 1YE6A 4ADTA 8TIMA 3HG4A 1ZQ5A 2CNCA 3BLDA 3D5HA 4GISA 4R53A 4ZFCA 5H1WA 4KWVA 1P0KA 3VM5A 4CCDA 1DJNA 2CLHA 1RY0A 5JU6A 4JTDA 2BNJA 3UNDA 2HBVA 4I6VA 3CYVA 2L5HA 4GCAA 4N42A 1XLDA 1XBZA 2IXVA 1LUCA 4J3ZA 1PIGA 4J7RA 1TMQA 3TROA 1YQ2A 4WSJA 5EY5A 1E56A 4DLMA 1C93A 3WF3A 3GNOA 1E71M 4DJDC 4EPKA 1F7BA 1CLKA 3WH8A 4H83A 1XKYA 4GZJA 4ATWA 2R91A 4J35A 2QJHA 1JG9A 2OWCA 2FTWA 3KDNA 2YZRA 4ZQMA 1YLVA 3DG6A 3TQVA 3C3NA 3NQMA 4P7LA 1V79A 1F6PA 5AVHA 5FEPA 1POJA 4LEQA 1V6XA 3SW6A 2XHYA 3VOGA 7CGTA 2HPMA 3OOQA 2V6AA 5FL1A 4J27A 5CEWA 1EDQA 4XKYB 5K4ZA 5GJNA 2V81A 4S3KA 5A8NA 5PTDA 4MSSA 1FWBC 2YXXA 1QI0A 3DG7A 2WC3A 3P80A 3N18A 1EP2A 2JQXA 3UA3A 1X98A 2VZSA 2J13A 2VX7A 4PUDA 4QCEA 2INFA 3GWQA 1E4LA 1BRLB 1OY0A 1K7XA 3BV4A 4Z42C 3CL8A 1QBAA 4MZ8A 2C91A 3WMSA 1PO9A 2V0TA 3W01A 3PZTA 4NRSA 4NZ4A 1BXCA 3CTTA 4HNCA 4HT3A 4GY7A 2ZX9A 3T42A 1KBLA 5REQA 1Q8AA 1XIDA 3EBVA 3R0DA 3MSRA 1JQVA 4QXIA 1E0WA 4WD0A 4LAZA 1PWMA 1A5CA 3PPCA 3O0FA 3VDAA 4Q4MA 2VKZG 1XDJA 4NAFA 3ZM8A 3SUWA 2A7RA 3WLJA 3FKRA 3GW3A 5GJMA 4Z1BA 3KCJA 3A24A 3QR0A 1KFKA 1I9CB 4MWAA 1IXQA 2XN2A 1V8EA 2ZUMA 3TLQA 3OIXA 3ABQA 3GG0A 1EA9C 1XR2A 3RYSA 1CI1A 2OELA 4AYSA 1HXJA 3CZEA 1XIIA 1F6YA 1UD4A 1PDZA 3L0GA 2XG9A 1SO5A 5HPCA 1W56A 2QULA 1E55A 4PMJA 4LBRA 4IUGA 1DJZA 3I6EA 3WUFA 3HPZA 1KD0A 4HN8A 3SY5A 2QPXA 3DENA 2BBFA 2XUCA 3MB9A 1SZFA 1EO5A 1ELSA 2XFRA 3WF1A 2PCEA 1NP0A 4GYPC 1H2JA 3UZWA 1DIDA 3VIFA 4JFTA 3QH2A 3MI6A 5C7HA 1WUEA 3ABZA 3KCOA 1ZJAA 2HPIA 1CENA 3MKCA 4HU0A 4OGZA 3VGFA 1P0BA 1E15A 1PWLA 4Z2KA 3LM7A 3OZOA 1DQXA 3RX4A 5I3DA 1W5OA 4CD6A 1GQLA 2F38A 2YCIX 1FDYA 2VO5A 3B9DA 4L7ZA 3RJXA 1A4LA 3LXAA 1TREA 4GY0A 3SURA 3BSHA 2OQLA 1UD5A 3WDIA 4J3XA 4Z1DA 5A8MA 3G1SA 3GR8A 2P5NA 3IANA 1A47A 2FZ9A 3BWWA 4NASA 4NYYA 1U22A 3LUTA 1VFHA 2Y88A 1BWLA 2BHZA 4WDTA 4E38A 4WR3A 3W25A 3N04A 3QY8A 4Z2HA 1FY6A 4WEVX 3EA3A 3ZOAA 4GXMA 4YTUA 4C7GA 3U5YA 1TMHA 2GK1A 2E9MA 5FEXA 3MV11 5A69A 5F1VA 2Y24A 4FK9A 1K9DA 2XISA 3OYZA 4XAFA 2QPUA 3WFAA 1UZ1A 5CPNA 1SW0A 4NVTA 4QJ4B 3V75A 4HBKA 4E6MA 3GVRA 2YYUA 4O1AA 2ZX7A 3UJEA 2PPGA 2VI0A 3JUGA 5EFDA 2V3FA 3E0LA 1EIBA 3W7DA 2VHLA 5BWAA 2HZGA 2HK0A 1EIXA 2NQLA 3H7UA 4LF1A 5AYBA 3WLSA 3EMZA 1G7VA 2QLYA 3U0HA 1QMLA 1R38A 3CPRA 1YDOA 1BAGA 2QKFA 3H54A 2DZWA 1QNPA 1BVNP 4Q7IA 1GG0A 2NQHA 1LOQA 1ZGDA 1TR9A 1CEOA 2CBVA 3KXQA 2PDKA 1GVOA 1Z42A 1SZRA 4DHGA 4DUOA 4PE8A 4JIHA 4FNPA 3OHMB 3ME3A 3WQ5A 5XINA 5GNZA 1UUOA 3W1XA 4YYFA 4ML9A 3M0IA 1TPWA 3VMPA 5FEZA 4BK9A 5LIXX 4GWEA 3NPWA 4LYKA 1JCTA 4LWWA 1MDRA 5CJMA 3HURA 5I0DA 3SIZA 4KKXA 3FHAA 3G3DA 1IYXA 3PZQA 4S3JA 1FWAC 2ZUUA 2INEA 5AOUA 3UD6A 1DIEA 3A3HA 3S6TA 4B4HA 3M4HA 3ZMRA 4AF0B 4DXXA 2VFDA 4PEKA 1VJSA 2HXTA 4XWUA 4P5UA 1XIMA 3K5XA 1TWDA 1N8FA 3SQLA 2O7SA 3VUPA 4V27A 1X8CA 1E0UA 1YTKA 4MLRA 4NILA 4ZQNA 1EWDA 1SO6A 1EBGA 4PMNA 3H22A 3REQA 3UPBA 1VJZA 2OGYA 5BXSA 4HPHA 4B5WA 4YXGA 5M2FX 1XFCA 1XLFA 1LWHA 1H7OA 3A5VA 3M0ZA 3DFYA 2OYKA 1KV5A 5KITA 1VQTA 2PDUA 4BA0A 3UG8A 3IJ6A 2GVYA 2A3EA 3CMFA 1CZ1A 2PB1A 3KWXA 1DWIM 3CO4A 3M0MA 3C52A 2GJRA 1KTBA 4NXKA 3UY8A 3RUBL 3THDA 3AIRA 1E3ZA 3ITXA 2X16A 4PB5A 1XCXA 3KLLA 2YLAA 1IV8A 1G0CA 4QQUA 1AH0A 1KFCA 2QMJA 5FJTA 1Q66A 1HN1A 3WD3A 2BVYA 3A3XA 1LT8A 3OVRA 4X63A 4UIOA 5FA5A 4LYRA 2I14A 3PPFA 4K36A 2PDWA 1VZWA 3MUIA 1OABA 1XBYA 2QGYA 3G1VA 2H9AB 4MFEA 1FWJC 2Z2UA 5AY7A 2E6AA 1LL7A 2FHFA 4PMXA