1F5ZA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form i
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
molecule keywords N-ACETYLNEURAMINATE LYASE
total genus 122
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f5zA00
2H8ZA 3IRDA 3W7EA 1JUBA 1TTIA 2G95A 5HR7A 2FB2A 3USBA 3C2OA 3W87A 1DVJA 1QOPA 4XKYA 5EPDA 3S1VA 3PBUA 1O94A 4IOTA 1OX4B 3M5XA 4DEFA 1I2QA 1ZFJA 5MHBA 4LU0A 3PR2A 1RR2A 2PRMA 3P7YA 3CHVA 5DCEA 2FIQA 3HGJA 2C3ZA 2G5WA 2C6QA 1R2TA 3S9YA 2QDGA 1G4SA 4FX7A 3TSMA 1VZWA 1GPWA 3O6YX 3T55A 3D0CA 1G4PA 4RXGA 3SJ3A 4GUHA 1V5XA 4MFEA 2YDAA 1D3GA 4IX2A 1SR9A 4R53A 4GE8A 4S2CA 2OMAA 3Q2DA 3RNDA 2A1YA 5CKSA 1J5TA 5H91A 2DZSA 4AHOA 1Z48A 3TH6A 3BW3A 3B0VC 3ANYA 4WUIA 1H1YA 3NPWA 1BEUA 2DZTA 4TIMA 3KAOA 1GT8A 1WA3A 1BWLA 1GTHA 1N55A 4FNSA 4FX6M 1EA0A 3N9SA 3E0IA 5LNSA 1QR7A 2GVLA 2QJHA 4UTWA 3W7DA 1KFJA 1UASA 1FWWA 5FF4A 3RLVA 1PVNA 3LCFA 1FCVA 2Y7DA 1JQXA 3NQ8A 4UTLA 4K39A 1AL7A 3P61A 3LTYA 1DJNA 2QCLA 1Q6RA 3GAKA 5CSSA 4FNTA 3WJZA 5C54A 4JN6A 2BTMA 4H6KA 1VHCA 2ISWA 4AWSA 3ZWSA 3W1NA 2C14A 4MUZA 4MZ8A 1QPOA 3T7VA 4DXVA 4QISA 3NQ6A 4O1DA 1TPH1 3F4WA 3MHGA 2LLEA 3PF3A 2VFDA 2OZ0A 2VOMA 3NR0A 1JCNA 3CU2A 4IGHA 2C18A 3PM6A 5HR6A 1ZJIA 1QWGA 4CCDA 3S5OA 3HQ1A 4FO4A 4JYFA 4O52A 1GVRA 4NX5A 4WD0A 5HJLA 1EWDA 4JTSA 4AWUA 5CPLA 2CLFA 1H51A 1A50A 1TV5A 3WK2A 2ZZ1A 1VCGA 3SR7A 1F05A 2Z6IA 2A6NA 4RLIA 5LNVA 1JUEA 2C19A 2AAMA 4HKPA 2J88A 1F73A 3NEVA 3S42A 3TX9A 2QAFA 3W1QA 2GVJA 3W86A 4UTMA 3G1SA 1H7OA 3ATYA 2JKPA 4K7VA 3B8DA 4BWLC 2GOUA 3PBWA 1FDZA 1EUNA 2QDHA 1L2UA 2O7QA 1KM2A 3ATZA 3EXRA 3GR7A 3PC0A 4EIVA 3A5FA 1T8XA 4FXSA 3CEUA 3QC3A 4AMAA 2YCEA 4OE7A 4OU1A 4UTIA 4LY8A 3A24A 5G2HA 3VKJA 5CZ0A 1GQNA 5LZLA 5KTLA 4JTTA 1QPQA 2Y63A 5K9DA 4Y96A 2NWSA 2A85A 2WSQA 1MZHA 1WQ5A 1OVDA 5HWJA 3WJSA 5AHFA 1H7WA 1SQ7A 4TMCA 3W2LA 3QYQA 1VCVA 1OYCA 1VR6A 2NWRA 3TXVA 4H4IA 1PS9A 4HNVA 3STGA 3STEA 1QPRA 3DFTA 1QDSA 1ME7A 4UTTC 4AEOA 5BNKA 4LVBA 4AHPA 4NJHA 4CNPA 1TJPA 5HUPA 3PB0A 5C55A 4NXKA 2TYSA 1M7OA 1LOSA 1DOSA 3LB0A 3ABRA 3WK3A 2VC6A 1SSGA 3E12A 4JICA 4C1LA 1J4EA 1RQBA 4NJIA 2FJKA 1JRBA 5D32A 1K3UA 3FIGA 3CLMA 3W07A 4I7UA 4JTFA 3W7MA 1G7UA 3C4UA 3I7SA 1M6JA 1MEHA 2V81A 3MHFA 5LHFA 3IVTA 3LHYA 4UTHA 3BG3A 3HPSA 2E5CA 3W7IA 5HWNA 3TMLA 4UTJA 3U8GA 1B4KA 1R47A 1XDLA 3W2NA 2A7RA 4S2BA 3C61A 3VNDA 3HG4A 1A53A 5AN7A 2NXHA 1ZHAA 4ZQNA 1X1ZA 1XI3A 2ZTJA 1H63A 3EKLA 3KRUA 3SIZA 5KITA 2Y7FA 4PTNA 4JDYA 2RH9A 4XBKA 4QJ1A 5E93A 3HOJA 1SFLA 1WBJA 1GVSA 3WFAA 3DFSA 4UMAA 5F2MA 3STCA 1XUUA 3MP5A 4JTUA 4U4MA 3WK1A 2I9EA 1UUOA 4RX0A 3QMTA 4M19A 3M5YA 2V9DA 1LOQA 2C15A 3C3NA 2WV8A 3O07A 3A5VA 4AVFA 4O54A 1VYPX 2NUWA 1S5TA 4M6VA 3EX1A 3C2FA 4Y9AA 5FEZA 4DPPA 3HO8A 3LCWA 2G97A 3W1TA 1S5VA 1GYNA 2X1RA 3LI0A 3CC1A 4LS2A 5I3JA 3M47A 3DENA 1TMHA 1WXJA 4P61A 2ISSA 3GDMA 4JTLA 1K7XA 4CLMA 4GJ1A 3W83A 5HNRA 3W7LA 4O0KA 3OIXA 2XFWA 4YCOA 4MYXA 1Q6LA 4WY0B 3O8AA 2A4AA 3W1UA 3PUDA 2QCCA 4IX0A 5IBXC 2GPTA 5D05A 3CQ0A 1EB3A 4FNPA 3BG5A 1GVFA 1TV8A 1ZAIA 1E51A 3U6WA 3BLFA 3FA5A 2Y7GA 2V8ZA 1PHWA 1ZENA 1OFRA 3DHFA 2GUUA 3S8HA 5G5IA 2X16A 4K6AA 2WQPA 3HPZA 3HGRA 3TW6A 5CPMA 1QNVA 4BI7A 3V1PA 1T99A 5K7JA 2X1SA 1F5ZA 1XL9A 1W3NA 2JK2A 3FFSA 3IIVA 2J9YA 2Y61A 3C2VA 1W8SA 3PSWA 4FNQA 2ABAA 5HULA 1EX5A 1Y0EA 5K3VA 4A2RA 1X6UA 3RU6A 3EKZA 3Q37A 4KKXA 4Y90A 4GUFA 4YXGA 3TFCA 5LNUA 3M5VA 3BV4A 4O15A 1KM0A 1I4NA 1O5KA 4X22A 4UFKA 3DFQA 4O53A 1F6KA 4NNAA 3DKJA 4BR1A 4M5PA 1H5YA 1JQVA 3YPIA 4N4PA 3EX3A 4HPJA 5J5RA 2BWGA 1KFLA 3ABSA 5ABTA 3EWZA 5L6UA 1QO5A 1G67A 1SO3A 2AQWA 1NVMA 2QUVA 3LCLA 1W5MA 4LS1A 1NFBA 4NNCA 3IIZA 1OFPA 1LRTA 1W3TA 5LKYA 2YFOA 2ZZ7A 3NG3A 4TO8A 4AHQA 5DXXA 3W7NA 4Z08A 2X1UA 3BVJA 1XC4A 3W84A 1AMKA 1NAL1 5CZSA 3KRSA 4MIMA 4FIRA 5F2IA 4ML9A 1KFEA 2YGYA 4WY0F 3GX9A 3T4CA 2D73A 3LBMA 3M9YA 5D04C 4Y6GA 3FKRA 3CT7A 3QM3A 1VYRA 3O15A 4NXSA 3NM3A 4O1CA 5HINA 4UC5A 1EWEA 3P5YA 2EF9A 3H53A 2CU0A 5DY2A 2PCQA 4UXDA 4XZ9A 4G1KA 3GDRA 3W2UA 3GYEA 3LERA 1VGAA 2Y62A 2A2IA 3E49A 1CI1A 4DBDA 3LLFA 6TIMA 3K30A 4LUJA 3C8FA 1EEPA 1V7YA 3TAKA 3QH2A 4ZVJA 3KVJA 3PSVA 1R30A 5G2WA 2E68A 2E1DA 1JCMP 3GDTA 2ZZ5A 3QSRA 2RDTA 3EWYA 4N9CA 3L0KA 5EYWA 3MYPA 3BGGA 3N34A 3TA6A 5BMWA 4FB7A 5T26A 4BK9A 4KFPA 1GVOA 1I2RA 3W7KA 2NZLA 5FF3A 4ZQCA 4GUJA 1FWRA 2C1HA 5K2ZA 3IVUA 3NQCA 4JIQA 3G0XA 1JULA 4JX5A 3UY8A 2R8WA 1MSSA 2VFGA 4N9DA 4JTIA 1R2RA 1OFEA 2RFGA 3EXSA 6ALDA 4EF9A 1OJXA 4WXZA 4LVGA 4O57A 3L5MA 4Q33A 4FEZA 1PV8A 3W72A 1FWSA 3IGSA 5CPNA 1QOQA 1DQWA 1YTKA 1C29A 1GOXA 1GZGA 1W56A 2QKFA 3LHWA 1GJPA 2Y88A 1WOAA 1LBFA 1YDVA 3W70A 2V82A 3MJYA 1QFEA 3MWAA 2QCNA 4O0ZA 2Y70A 2Q3OA 2ZTKA 4AWTA 3NL6A 4CNOA 1LLZA 4LVDA 1OFBA 2QCHA 1X8FA 1SZNA 3G3DA 4QQ3A 3NPUA 4BFAA 4MYAA 4O12A 3IEBA 1TPWA 1RQHA 3EWUA 3LDVA 1W54A 3TU9A 2PRHA 3GLCA 3LV5A 2YSWA 1SZGA 1ZCOA 1H61A 3C2RA 3R12A 1LORA 3LBCA 5HWMA 5K9CA 3W7PA 1VH7A 5BW6A 1AW1A 5TQLA 2WO5A 3BLEA 4NZJA 1YXYA 2I14A 1QAPA 1XXXA 2BX7A 2YX0A 3PG9A 2Y89A 4YLWA 1YTDA 3TCEA 1GG1A 1VHNA 3L5LA 4ALDA 1KTCA 1FCBA 5LGXA 2NV2A 1YDNA 3FYPA 4HNTA 3N2XA 3F4NA 1OHLA 2CZFA 4N6FA 3PUEA 3W23A 1X7FA 3CIWA 1XKYA 3P62A 3HJZA 3S5NA 4CCEA 3HG2A 3W6YA 5AHEA 3B06A 4A22A 2DORA 3I68A 5FEPA 3LGEA 1FCQA 2VFFA 1OABA 3F03K 4N4QA 4GWEA 4LW7A 2YYUA 2J9ZA 1L9WA 1CX9A 5D38A 2YYTA 4JX6A 3RF9A 2R14A 1SW0A 4C1KA 3P67A 3NM1A 1D3HA 3IIOA 4IPJA 4MKNA 3G3MA 2ZA3A 4A29A 4K8HA 4AXKA 1IIGA 4PC8A 2PC4A 5DN1A 1FDYA 4HT3A 5LHEA 2YW3A 4QNWA 4ZQMA 5EMUA 3TQVA 5C6MA 3M5ZA 3W2MA 3GNDA 5AYYA 1EP1A 1PE1A 4K7YA 5L9FA 2TRSA 3L68A 2E6YA 5AHLA 3W7OA 4A2SA 2QR6A 3I7QA 4Z0SA 5FEWA 5KINA 4Z1DA 4N9EA 5HUOA 1KBIA 1ME8A 4UFMA 3G24A 4MJZA 3G1XA 1SFJA 1G6CA 1XCFA 1N8FA 4MLRA 3BG9A 1GVQA 4DPQA 1NSJA 1MEIA 1MEWA 4UR8A 4NZFA 1TTPA 4LVFA 4YL2A 4O1BA 4JTGA 4ZZ9A 1G7VA 2X1TA 2GQ8A 2E6FA 3EWWA 1R2SA 1JCLA 1LRQA 2BXVA 1FCUA 3CPRA 3HMJG 3I7RA 3P84A 3TMQA 3P5ZA 1A5SA 3TIMA 1G69A 3NZRA 3W7JA 2RDWA 1U83A 1H7NA 4MLJA 2FTPA 3S1UA 3M6YA 2CLKA 3M0ZA 1OX6A 1LBLA 5CSRA 2FDSA 3B0PA 1DKWA 2Z6JA 5U7SA 3P8JA 5CZTA 4GUIA 3ZS4A 2VEPA 4NJGA 4RXFA 4XBSA 5F4SA 1LROA 2R94A 1KTBA 1RVGA 2V5LA 1S5WA 3W7HA 3WK0A 3G1FA 1C8VA 3M16A 3L65A 1W31A 5HMSA 3IIPA 1TPFA 4WJEA 1F76A 3NQFA 1YYAA 3FS2A 4UFJA 2VEKA 2ZRYA 3UWYA 4POCA 2PRLA 5H2ZA 2BSLA 4IJBA 3P80A 1B4EA 1P5BA 4FX8A 2ZZ4A 3G0UA 4Z1AA 4UTTA 3R89A 4S1FA 3PAJA 3PULA 1I2PA 2F84A 4PH6A 2ABBA 3GXTA 2GVGA 5EBUA 5D02A 3SSJA 2ISVA 5FF2A 1I2NA 3NAVA 1BWKA 3SGUA 4ZMGA 3QQ1A 1TIMA 3THQA 1Z41A 3C0JA 4Z1CA 3LI1A 1IXQA 1F2JA 2XN2A 1XDMA 1JCYA 1K02A 3UNDA 3UZJA 1GG0A 1SUXA 5F1UA 1H1ZA 4O19A 1B3OA 3R13A 1WOBA 4NJJA 1PCWA 1JUKA 3B04A 3SECA 4PL2A 2B4GA 2NXGA 2ZRXA 5G1YA 1EPXA 3R5EA 4QM1A 1I2OA 3O06A 2WSRA 4BWLA 2E6DA 2VFEA 3WJYA 4R33A 3BLIA 3BW2A 3UPWA 4NU7A 1SSDA 2Q8ZA 3GXNA 1JR1A 3IV3A 3NZ1A 3CB8A 5DELA 5G4EA 1YDOA 2ALDA 4CCCA 1OFQA 4X9SA 5D2WA 2EHHA 3CWOX 2QUTA 1C9DA 2V2CA 4MZ1A 5C5YA 3UY7A 3QZEA 2X2GA 1HFBA 5F1VA 3QRHA 2Y7EA 4LNYA 3M43A 2XN1A 5DCDA 1EP3A 1K7EA 3L2IA 1KV8A 2H6RA 5I3IA 3W1LA 4NVTA 1W5NA 2QUUA 4RZ4A 3GIYA 3E02A 1FWNA 8TIMA 5D33A 3W2KA 4DBEA 2ZBTA 2NX9A 1FX6A 2EPHA 3LTSA 2ZA1A 1LP6A 4QAIA 2CW6A 4MY9A 1LM1A 4YCPA 4X3ZA 3FLUA 3NVTA 2V5BA 1IXPA 1WDWA 3W7CA 1AK5A 3HBLA 1NF7A 4R34A 3QPYA 2VENA 2I1OA 4LVAA 3OVQA 4LV9A 1IGSA 4DF1A 3C6CA 1TB3A 3G18A 2TMDA 1XBYA 3RFAA 3PB2A 4AF0B 2FB3A 1MXSA 3MO7A 4RJEA 3HG3A 4NX0A 3M44A 5FF0A 4JD4A 2FPTA 2B7QA 3FJ6A 4JX4A 3T78A 2QCEA 4QIUA 3STFA 4Z0JA 1KTNA 3DI1A 2E09A 1J2WA 2Y85A 1YADA 3NL2A 3VCRA 1O4UA 3GR8A 1W37A 1Q3NA 1TRDA 4AB4A 3TFXA 1ONRA 5K4XA 3GB6A 4KWWA 1FXQA 2YZRA 3O6CA 4K8EA 2R91A 1K03A 1KM3A 4GC4A 3HG5A 2NV1A 4CQAA 1XUZA 3L9CA 1EP2A 1OX5A 2DJXA 1ZNNA 1PL9A 1H7RA 2ZRZA 1EIXA 1GYLA 1DHPA 3P74A 3DI0A 5A5WA 3TAOA 5GVJA 4IXXA 1A5CA 3PG8A 1NF0A 1TPUA 4LC6A 4NT0A 2HS6A 3LLDA 3PBYA 3N19B 3UWZA 4RZ6A 3P8IA 1Q45A 2WSYA 1AG1O 5IBXA 3BK0A 3ZR4A 3DU0A 1N7KA 5FEXA 1RPXA 4PFMA 2G96A 2Q8LA 3G8RA 2ZCGA 5I3GA 1VRDA 1TCDA 3GK0A 3GKFA 1JRCA 3QSTA 3FOKA 2BZNA 4M6QA 3A21A 3M41A 5DBUA 5AC8A 3DBPA 3INPA 3KOFA 2QJIA 4UIOA 1TV7A 1ALDA 1SO6A 2QF7A 4OQVA 2UV8G 3CEPA 4NJKA 4WX2A 2NXIA 2QCMA 1ICQA 2B7PA 2HS8A 5TIMA 4MVAA 1YPIA 4QSHA 1LLWA 1IF2A 2CLHA 4ZQPA 5G1TA 1XBZA 2E5DA 3TSDA 1GTEA 1TJRA 1LYXA 3ABOA 1KFKA 4LRSA 2RHGA 4XQ6A 5F4XA 2YW4A 3S1WA 1H50A 4CQ8A 2WKJA 2CLMA 3NYZA 1BKSA 1YPFA 4KFOA 1UJPA 4OWGA 3QPZA 2WNZA 3R2GA 2QCDA 4ZQOA 1JCJA 3N9RA 3KX6A 4IQLA 3NQ7A 4JNMA 5EA9A 3O1NA 3EX4A 2IQTA 4FIQA 3W22A 5FESA 1FWTA 2ATSA 1W5QA 4WOZA 2EGZA 3EWXA 4J9JA 2WNNA 1OYAA 2NUYA 3KVKA 3I6RA 4P2VA 3VE9A 4IPIA 2ZZ2A 1WAUA 1W5OA 3DH7A 3G0SA 4UNKA 4JYEA 4LUIA 2FPYA 4HSNA 4OGZA 4KFNA 3DAQA 5AFDA 1SZEA 4EWND 4K36A 3LXBA 1KFBA 2A5HA 5D2TA 2CLEA 1YLVA 3P81A 4JGDA 5D2YA 1TYGA 4GFSA 1UB3A 3SW6A 5DBTA 3LCXA 3TKFA 3P82A 4LV4A 4FF7A 4WOQA 2PE4A 3OA3A 1QMLA 4JDBA 2H3DA 2HTMA 3L21A 3ABQA 4BI6A 3EX2A 3GVGA 2ZQ0A 3KVMA 3TK7A 4NUWA 3TV8A 3EEGA 3DKLA 1ML1A 4NQ1A 2A21A 1SPQA 1LBMA 4LC8A 1HTIA 5KMYA 1DL3A 3QJAA 3LOTA 1OFDA 3NQ2A 3O05A 3DZ1A 1YXCA 3FEMA 4JXCA 5TBOA 3MW7A 3TDFA 2H90A 2HMCA 4O8RA 3N2MA 1SO4A 1OF8A 1I8JA 3GNNA 2YPIA 3G1DA 3ELFA 5KZEA 5EKYA 1SO5A 2CZDA 3UD6A 4M7TA 3TW7A 4Q32A 1TPVA 2CFFA 1P0KA 5E0KA 3TQ0A 3QFEA 5SWUA 3LTPA 1VYSX 1ICPA 2A7PA 2Z2UA 3KVLA 3LV6A 1HUVA 3MI6A 1VPXA 4I7WA 1M7PA 1FXPA 2QCGA 4LS0A 2CZEA 3Q94A 2C16A 2OT1A 3PUOA 3HF3A 2Y6ZA 4O14A 4B5NA 4JTHA 2DP3A 5CZJA 3QQ0A 4O50A 3G1VA 2ZA2A 3HB9A 4IMDA 1YTEA 1TPDA 4O16A 1LOLA 2W0UA 1UUMA 4LRTA 2DZWA 5D09A 4EVZA 4M7SA 3BPWA 3PVFA 3W73A 2DZPA 1TSIA 5G2IA 2CLOA 3LX9A 3GDKA 2OT0A 3THAA 3TJLA 1IXNA 4K37A 4Y8FA 1DV7A 1XBXA 4DQWA 1WBHA 4KWVA 4UNLA 4HNNA 3MBFA 5AC7A 3W1AA 3FJLA 3LXAA 5FI8A 5BOOA 1RQEA 3V75A 3F1QA 4UCGA 3NQVA 5D03A 3W7QA 3LCGA 3W3OA 2P0OA 3MUXA 1AL8A 4XTIA 3PBVA 4FNUA 2KZHA 4BF9A 1B57A 3LCHA 2AGKA 2TSYA 4HNUA 5AYZA 4HPXA 4LT9A 4RZ5A 5I3HA 2OJPA 3VE7A 1W3IA 1OX4A 1RZMA 3DFOA 3DXIA 4O10A 2A7NA 3NQDA 3TC7A 4JTEA 1SU5A 1TPEA 2Z1BA 3WJXA 4RK8A 3TR2A 3UZ5A 3P60A 3KFTA 3LHUA 2VEMA 1F7BA 4M6PA 3H55A 2CZ5A 1UCWA 1TRIA 1AW2A 2ZRWA 4IMCA 4OV9A 4UMBA 2DJLA 3W76A 2YXGA 2RKXA 3FYOA 3QEZA 4Z1BA 4LOCA 4IMGA 4O28A 2DZUA 2Z0IA 2A6LA 2J24A 3ZWTA 2QCDB 3HGOA 1D9EA 4WQ6A 2E5BA 1B9BA 1TQJA 3S1XA 4O17A 2QEZA 4IXHA 4XUGA 3RLUA 1QO2A 3S5ZA 4DF0A 4ORIA 3NO5A 4ADUA 3E96A 1JCXA 3TNOA 4UFHA 3PWAA 4A21A 3G8EA 4YWIA 4OBTA 4Q4KA 1A5AA 4PODA 2VKZG 1L6YA 2B7NA 1XM3A 4N02A 3LCIA 2XN0A 3NQMA 3I65A 5AC6A 3NNTA 1KFCA 1FDJA 1W5PA 1DBTA 1ME9A 3NXFA 4LTSA 3GXPA 4N9BA 3B4UA 1NEYA 2VFIA 4PA8A 3CM4A 4RKAA 3MP3A 3L0GA 3HGSA 2ZYFA 5EL1A 1A5BA 1QPNA 4RR4A 3IGUA 3NQEA 1KLZA 3N3MA 2DZXA 4O4WA 2VXNA 3FKKA 4GUGA 4ORMA 1G4EA 2W79A 3OG3A 3W1XA 5DLCA 3OVPA 4GNJA 1O5XA 3O16A 4ZL1A 5F2GA 4K38A 2F7FA 2QAPA 3W1PA 3G1YA 3W7RA 2VEIA 4E38A 2OCZA 5KZDA 1KBJA 3MI3A 4CQ9A 4HHPA 3KHJA 1FQ0A 1W0MA 4JR5A 1LZOA 3SZ8A 4DF2A 4BI5A 5CG7A 3W88A 3NOEA 5F2LA 1L6SA 3NQGA 4JIPA 4L4MA 1L6WA 3QMRA 3EXTA 3G1HA 2BLEA 4UTKA 5AHNA 3QW4B 2WOQA 2H3BA 3GZ3A 3OHIA 5DXYA 2NX1A 4JY8A 3IGXA 3NDOA 1VLWA 3RMJA 3Q58A 1FY6A 3CTLA 1EUAA 3OEXA 1K8XA 3DFPA 1K8YA 3MMTA 3MHUA 3LHZA 2O7SA 1OYBA 3ZFHA 1GWJA 4EOUA 3UQNA 5A8GA 3EB2A 3GAYA 5LGZA 3S0CA 2WNQA 4UMCA 5AB3A 5BRBA 3S6DA 4JYDA 1LCOA 1O95A 4DO6A 1KW1A 1OF6A 1Z44A 4XTDA 5FF7A 1KM1A 2V30A 4ADSA 5AHIA 3S5YA 2QJGA 2P1FA 3W71A 1RV8A 2V2DA 4X2RA 3H54A 4W9TA 1S3HA 3E9AA 4MFDA 3UWQA 2EKCA 4JEQA 3CWNA 2ZZ6A 1SZFA 4PEKA 5I3KA 1THFD 1XFBA 3KRZA 1TO3A 4HIBA 3A9IA 2FQIA 2FPVA 4RV8A 4TX9A 1F74A 2X30A 1H62A 1VCFA 4JTKA 1M5WA 1VQTA 2E77A 3BW4A 3NQAA 3NPXA 1OFAA 3G1AA 3VFLA 4FXRA 1LTDA 4IWWA 3LRLA 3TUUA 3W1MA 4DELA 2WJZA 2YR1A 5KSWA 4OT7A 3UWWA 3LRKA 2FFCA 1JVNA 1VC4A 2JGQA 1OFOA 4WZHA 3MYOA 3LXCA 3L5AA 1VS1A 1Q6QA 2V0TA 5LNWA 4HN4A 2CWNA 2QCFA 2GQ9A 3T40A 4EF8A 1TTJA 1K7FA 4GBUA 5C2XA 1Q6OA 5K9XA 7TIMA 5IM51 3GDLA 1VLIA 2WPBA 4E2BA 5DCBA 3KXQA 4XWUA 2ZFAA 3AJXA 3QMSA 3SY5A 3NL5A 2B0MA 1PHQA 5U4NA 5I3FA 3W74A 1TREA 4O1AA 1WYIA 5CGQA 5F4WA 3TE9A 2A0NA 3G22A 5D30A 4R7JA 2FLIA 2C0AA 5J5DA 2DZVA 1WX0A 1OK6A 2VFHA 3LM7A 4ZQRA 4JTJA 4DO5A 1F6PA 2C13A 4MOZA 1ICSA 5AHMA 4MY1A 1Z42A 1ZALA 3WJWA 2J6XA 5G4WA 5BMXA 1YXDA 4O13A 3N14A 3UYCA 1OG0A 2EAWA 3UXDA 1K8ZA 5AYXA 3R8RA 1UBSA 1ADOA 4DO4A 5HQEA 3JS3A 3W75A 3TSBA 4I7VA 4IMEA 1HO1A 4UR7A 2H8XA 3C2EA 3DGRA 3HIJA 3JRKA 4AF0A 4LWWA 4E0CA 1P4CA 4U28A 2Q3RA 4WY0A 1TTQA 1KM6A 4CNNA 4D2JA 3W2JA 1GEQA 4WXYA 3PS7A 4UTWC 2GQAA 4N6EA 3SI9A 3W85A 1KM4A 2ZZ3A 4E2DA 4QITA 1DJQA 3BARA 1X1OA 1KM5A 2CLLA 3EX6A 1H7XA 3AO0A 3C52A 5EY5A 2JKEA 4N2YA 3A23A 3TXZA 1ZAJA 5K4ZA 2GJLA 5E1QA 1P0NA 4MY8A 3W1RA 4UTUA 3IVSA 2RDUA 1WV2A 3EWBX 1FUYA 3NGJA 2W6RA 3C56A 2J9XA 1XBVA 3L0NA 3HPXA 3NPVA 2J27A 3M1ZA 2JGYA 1I45A 1FBAA 2V2HA 4IMFA 2TPSA 3O63A 2ZRUA 3MBDA 2NLIA 4YMZA 3QF0A 4MZYA 1W1ZA 3BO9A 4O11A 3MI2A 1HG3A 5CPOA 4IUOA 1LDCA 4AH7A 1RD5A 2JBMA 5D2XA 3L66A 1U5JA 2ZDRA 3SFKA 4FHAA 4I9AA 4QNEA 3OVRA 3W9ZA 1CW2A 1HO4A 4UUIA 1T96A 2NX3A 1OK4A 3JR2A 1BTMA 4TR9A 1IIHA 4HSOA 4PL1A 3UWVA 3GKAA 3UPBA 3OBKA 4UFIA 2YFNA 3M7WA 4ICNA 2ATMA 2JKAA 4O4VA 2E6AA 3B03A 1JJKA 3TROA 4FNRA 4ADTA 3LHTA 3DHDA 3CIXA 3B0UX 1IXOA 3NA8A 3DFNA 4JS3A 2NUXA 2ZRVA 2VELA 1H7PA 3TC6A 3VI2A 1AW5A 1MO0A 4RCXA 3RK8A 1H60A 4MPQA 1SW7A 3IIXA 4L4LA 4ONVA 3SGZA 3QW3A 3A22A 4PCFA 2CLIA 3B05A 1PIIA 4TMBA 5D37A 5AOUA 3T44A 2DU2A 1TPC1 4A3UA 1QCWA 4UFLA 1LRNA 1TQXA 2HSAA 1KLYA 4O18A 1DQXA 1SW3A 4XKYB 5KZMA 3N73A 4AAJA 1KA9F 2OX1A 1VJIA 3W7GA 1G4TA 3TJXA 5DY3A 1O60A 4MJMA 1R46A 1ZAHA 5D2VA 3MP4A 2GJNA 1DORA 3UWUA 1TPB1 4GRSA 1HL2A 4H3DA 3LRMA 3PY2A 3NL3A 1PCKA 2P10A 3UXAA 3L67A 2PURA 4GXMA 4TU1A 3TQKA 3U2OA 3BGJA 3LHVA 4OHQA 1P1XA 5LSMA 2B7OA 1ZY9A 4JY9A 3O6DA 1KV5A 1T0OA 5LNRA 4NNBA 4OV4A
chains in the Genus database with same CATH superfamily
2WMFA 1UHVA 1XYAA 4EP8C 1JUBA 4PULA 2G95A 1MZRA 2FB2A 2V38A 3USBA 3C2OA 3W87A 4PUDA 1QOPA 4XKYA 1O94A 4REQB 5FKYA 2GGIA 1QK2A 7TAAA 3VX1A 1I2QA 4PUKA 5BOFA 1M9HA 1Q66A 1EJRC 1Q7ZA 3M0KA 4D1JA 2OGJA 1R2TA 4FX7A 4KEMA 3TSMA 1T40A 1GPWA 4C90A 3D0CA 5I77A 4FLOA 3SJ3A 4AD3A 1V5XA 3GC4A 4YTTA 4MFEA 2EPMX 1N2VA 4NL1A 3G6MA 1D3GA 1FA2A 2VO5A 3I4EA 4Z2LA 1KR1A 2GWNA 1QBAA 2OMAA 1XLMA 3W27A 3VC5A 5CKSA 5H91A 3SN4A 3F5LA 4AHOA 2R82A 4WUIA 4YWSA 1BEUA 4GHRA 2ZX6A 3DC8A 1WA3A 1N55A 1Q13A 1HJSA 4UTWA 1UASA 1FWWA 3RLVA 2Z1KA 1PVNA 3LCFA 4UTLA 4US5A 1AL7A 3FYYA 3KBJA 2HVOA 4FNTA 3WJZA 4JN6A 3FGCA 3LPGA 2W92A 1WDRA 4CEUC 1LUCA 2OO6A 4HN8A 1QPOA 3WQVA 4RUBA 1PTGA 3P0XA 3SGGA 1TV3A 1ISXA 1G9HA 2VOMA 2OELA 2KX9A 2C18A 2VNCA 3A3HA 1XH2A 3BICA 3F5JA 4YTRA 1XYFA 4WD0A 5HJLA 2OYLA 3G2GA 2NVAA 3C86A 3ZJ6A 1NFGA 4W8AA 3WK2A 1YX1A 5LNVA 3W29A 2Z25A 2C19A 1G01A 3FJNA 3E5PA 2OU4A 4PUEA 1A4MA 3W1QA 3W86A 3GD6A 4UTMA 1KXQA 2GDQA 4QFUA 1VFOA 2ZUVA 4K7VA 2GOUA 1JPMA 4B15A 2O7QA 1KM2A 3ATZA 3PC0A 4EIVA 3A5FA 4IPPA 1DEDA 4FXSA 3CEUA 3NXLA 4OU1A 3SEPA 2FGLA 2YDRA 5KTLA 2YA1A 4JTTA 2GOKA 2P8BA 2Y63A 2EG8A 4W86A 1OVDA 4DWSB 1BVZA 4D6GA 1SQ7A 3W2LA 2E8YA 1OYCA 3TXVA 4X61A 1QDSA 4W87A 1WNOA 4Q4OA 4OZOA 3ZIZA 1I9CB 4GI8A 4H83A 4HNOA 3GNRA 1LWIA 4NJHA 4CNPA 2Y5EA 3VMPA 4MF4A 3FSTA 4V33A 1DOSA 3GHUA 2VC6A 3E12A 4HU0A 2VD9A 3EEZA 3SB0A 3UU0A 3TC3A 1J4EA 2INEA 1PB0A 4NJIA 2FJKA 1JRBA 5D32A 5EBAA 3CLMA 4EAMA 4JTFA 4RPPA 3PZ9A 3KBWA 3TYBA 3P14A 2R6OA 1O68A 2PF8A 2V5CA 3WQ4A 1PDZA 1ECQA 4JIIX 3I7SA 5JVLA 2V81A 1YKWA 3AWOA 2NQZA 3HPSA 4LB4A 1DIEA 4BA0A 2Y8UA 1LT8A 3W7IA 5HWNA 4NAFB 3OPSA 3TMLA 3U8GA 3R58A 1B4KA 4HCHA 3VVGA 2A7RA 3H22A 4S2BA 2OQLA 2Z2BA 1Z3NA 1ZHAA 3AMKA 4PB3A 1H63A 3IWPA 3EKLA 1JD9A 3PHAA 2Y7FA 4QLKA 2OYMA 1LLOA 1MRAA 2RH9A 4JDYA 3SUWA 1SZRA 2P3EA 1SFLA 3REQA 3KP0A 1DXEA 3WFAA 2J8GA 3STCA 3WK1A 4RX0A 1C91A 1GJWA 2X2YA 4O54A 4M6VA 1US2A 2ZC1A 2ODOA 7XIMA 3ECQA 1PX4A 3N11A 3W1TA 4M3PA 3LI0A 4JL1A 3OGVA 5I3JA 3W00A 1GKQA 5GNYA 5G1MA 3M47A 3W37A 3DENA 3LPFA 1WXJA 1B5TA 4IG2A 3VU2A 4L64A 5ENLA 4CLMA 4GJ1A 2GUYA 5JXQA 4PMOA 3W7LA 1R0MA 3BAJA 1U1JA 1BPLB 1Q6LA 3O8AA 3GNOA 3MUY1 3VD9A 1BSIA 2WLZA 3CQ0A 1U5HA 1GVFA 3BMVA 1TV8A 1KWGA 3CK5A 1R7AA 4JCLA 1T8QA 1E1CB 2CIPA 1TX2A 3VUSA 1ZBVA 5JIPA 5T9BG 4ASTA 3MO4A 2Y7GA 4L4OA 1OFRA 3QLLA 1UC4A 2X16A 5I79A 1UR3M 3CQKA 4JQ4A 2VRQA 4AZ7A 3H2MA 3V1PA 1XLIA 4I5XA 1ZP4A 4A8NA 3QGKC 3M0YA 1J9YA 3BAKA 4GX8A 4DJFA 1ZS2A 2WQDA 1EX5A 1WZLA 1Y0EA 4C7FA 1Q6GA 2Z1WA 3RU6A 4YXGA 3WLKX 3TFCA 5LNUA 4O15A 4O8AA 2OWXA 2GGGA 5PTDA 4UBPC 5JMUA 1KRBC 1YBQA 1O1ZA 4RE4A 4BR1A 4N4PA 2QJJA 5AECA 1Z9AA 4JKLA 4HPJA 3GFXA 1KGXA 1HJVA 2EG6A 3ARTA 4FI4A 3ABSA 4QLJA 1QO5A 1G67A 3VPLA 1NVMA 2FHCA 5ECUA 4JHZA 2E9MA 1W5MA 3UP8A 3TTSA 4H1ZA 3BL3A 3HTWA 4GYFA 1OFPA 7CGTA 1W3TA 5LKYA 1DP0A 1BAGA 3LZ5A 4AHQA 5DXXA 5HBFA 3A12A 3W7NA 4CGTA 2YBTA 3BVJA 3W84A 3G77A 1WKEA 1WDSA 2IPWA 2ZVIA 1KFEA 3PPFA 2YGYA 1KO0A 5A1AA 4NAEA 3MDUA 4Q8PA 3AROA 2QPSA 2OX4A 2VR4A 2VEFA 5D04C 1NARA 4JTRA 3O15A 4KWUA 5C2GA 4UC5A 5GPRA 1C8XA 4S23A 1R86A 1MMFA 1TJ1A 4LCRA 3KOYA 3AS1A 2D23A 4G1KA 1HIZA 3W2UA 1E9IA 1VGAA 3SIMA 3GIPA 1TMLA 4HHMA 2C8NA 2A2IA 2PWGA 4MNKA 4C6LA 3E49A 3R4IA 6TIMA 3V36A 1C9WA 4HPGA 4OUEA 2QW5A 1CXLA 3TAKA 4F48A 3PSVA 2E68A 2E1DA 3GDTA 4H7ZA 3QSRA 4LAKA 1YHTA 3BGGA 1P43A 2DGAA 2V69A 4H6EA 5BMWA 4FB7A 5T26A 4KFPA 1GVOA 3OU8A 2AAAA 1M65A 4ZQCA 3TW9A 2DUXA 2C1HA 3AHXA 4JIQA 1XCXA 4N9DA 1TZ7A 4JTIA 2RFGA 3LD5A 1SJDA 1OJXA 3CAKA 1KCXA 3R11A 5BCAA 1PTAA 2RAGA 2VM8A 2PD9A 1FWSA 4ERAA 1N82A 1YTKA 1GOXA 2QKFA 1IGWA 3LHWA 1WOAA 5CEWA 2VGFA 1QFEA 1D2KA 4DUXA 1HKKA 5A2AA 2E7FA 3FSUA 2MUCA 4LVDA 1OFBA 3QOKA 1X8FA 1XC6A 5DANA 4BFAA 4S3GA 1TPWA 4Q7BA 4C6IA 1W54A 4YVXA 4XD5A 3GLCA 2FZMA 5C0QA 1H61A 3ALGA 3TNBA 2DV0A 3MU7A 1U1UA 2ZX7A 1FWIC 9XIAA 1JDEA 1JZ8A 1VH7A 4R9XA 1JFHA 5A6BA 4XZWA 3D46A 4GACA 3THCA 1YXYA 3GHSA 4LF1A 3MZNA 2YX0A 2Y89A 3TCEA 4GC3A 1GG1A 5H8MA 3L5LA 4KEUA 1FCBA 2OSWA 4HNTA 2EJAA 3N2XA 5AC4A 3ZR6A 1OHLA 4F0MA 4DXKA 1X7FA 1QI5A 3CIWA 3P62A 3HJZA 3HG2A 3UGRA 3C0SA 1KFWA 1P7TB 5AC5A 1YNYA 1NOWA 3WYZA 2DORA 5JBEA 3JZUA 4N4QA 2CESA 4LW7A 2J9ZA 3UXIA 2YYTA 4REQA 4JX6A 3RF9A 1SW0A 1W1A1 3WH9A 4B4FA 2G8ZA 2V68A 5EFDA 1XIFA 4PC8A 4C6BA 1BVWA 3GH4A 3RGTA 5LHEA 4ZQMA 1ODUA 3BZJA 5EMUA 1OWQA 3W2MA 5AYYA 3VGEA 4KCTA 1EP1A 5LA1A 1HKMA 4MNLA 4A2SA 4D72A 3CHDA 4H6RA 4WKFA 4N9EA 1LJYA 3I6TA 2R1NA 4UFMA 2J78A 1OIFA 1SFJA 1G6CA 4FPSA 5DFAA 1NY1A 3LNPA 4WF7A 2NQHA 7ENLA 1GQKA 1CIUA 3H2AA 3MC5A 4NRRA 3PJWA 4MUPA 2X1TA 2GQ8A 1R2SA 3TR9A 3CPRA 4IM4A 3HMJG 5DMNA 1UKOA 1BFNA 5CSUA 3HM7A 4YNGA 2RDWA 3WEOA 1H7NA 2VDGA 3MKCA 2VZSA 3C0QA 3S1UA 5CJNA 3M0ZA 3HN3A 1OX6A 4MADA 2FDSA 4ROPA 1DKWA 3GG0A 2XZ7A 2Z6JA 5HMEA 5BZAA 3ZS4A 2VEPA 4LB3A 4RXFA 1NWTA 5I23A 4X63A 4IFOA 1JDFA 1J5SA 2V5LA 1S5WA 3VD7A 3WK0A 1J2BA 2XFFA 3N29A 2WMJA 4AX6A 3LPPA 3S4TA 1TPFA 4WJEA 3S2LA 2ZX5A 3NQFA 1UZ4A 3HA1A 4GD0A 4Q8TA 5JU6A 3A64A 3P80A 1J18A 4G7FA 2ZZ4A 1XRVA 1OT1A 3VCNA 4PH6A 1V0LA 4QE1A 3SSJA 1XRTA 2ISVA 3B8TA 2OKOA 4ZENA 3SGUA 1H49A 1Q6CA 3THQA 1Z41A 3KTCA 3LI1A 1IXQA 1JPHA 2XN2A 1XD1A 3WD4A 3UNDA 2HV5A 3M0IA 1JZ4A 3TLQA 1GG0A 1H1ZA 1B3OA 1XPYA 4NYUA 1B31A 4IJRA 1PCWA 4LY4A 3WEZA 2ISDA 3SECA 4PL2A 5AYBA 5G1YA 1DXIA 2CETA 3S2MA 2ZUSA 1IZJA 2E6DA 2ZVRA 3SFWA 3LN3A 2OWWA 4EK7A 3WDQA 1EGVA 4LQ1A 3GH5A 3M0MA 1A5MC 3CB8A 2NQ9A 5DELA 3II1A 3QGAC 1DJZA 3DERA 4E5TA 4Q4RA 2ISFA 2VGBA 2V2CA 2VWSA 3M0XA 1ONXA 2E25A 3GNPA 3UY7A 5A8MA 2DSKA 5F1VA 2R9RA 4WJ8A 1M1BA 5DCDA 3W82A 1KV8A 3MUAA 1XLFA 2HROA 4V28A 1W5NA 4S3AA 3MKKA 3E02A 1EFZA 2WVUA 4PN2A 4DVOA 2CZVA 1TMQA 1BYAA 3GR4A 2VEGA 2EPHA 3OB8A 4G56A 2ZA1A 2BXYA 4L65A 2CW6A 4QAIA 4P8WA 5HATA 2FYMA 2V5BA 1IXPA 1P0BA 3W7CA 3O3RA 3JVAA 3A6OA 1UKTA 4AZGA 3WUGA 2CBJA 4UB9A 2EKGA 2I1OA 2W66A 1FKWA 3OVQA 4LV9A 2WPGA 3TWAA 5I5RA 1VFMA 1X7IA 1UH2A 4JFTA 3F4DA 2XM2A 1BF2A 5FSEC 2F2KA 4Z2IA 4NX0A 4QDMA 5FF0A 1PXGA 2J62A 4JX4A 4R7OA 4P8VA 1E6XM 2VYOA 2E09A 2W67A 1O4UA 2EG7A 2DT0A 3GR8A 3KBSA 1TWWA 3O0KA 1R3YA 1C8YA 2V5DA 3TFXA 1ONRA 1P1MA 3GB6A 2H9AB 1W17A 2HE8A 1TZ9A 4JIRA 1XUZA 4GXPA 4I8YA 1OX5A 1ZNNA 1H11A 1H7RA 1CECA 1GYLA 2OB3A 3TAOA 2E3ZA 2OTDA 5E9AA 2J6VA 3VZYA 1NF0A 1TPUA 2OZTA 4MKSA 3LLDA 3UWZA 3P8IA 3RCNA 2WSYA 2XM1A 1R9XA 5D9NA 1DWFM 3ARXA 1DQUA 2YIHA 3G8RA 1OQFA 2ZCGA 2DH2A 1VRDA 3U2EA 3ITCA 2VRKA 4MHBA 3GKFA 2A3BA 2CYGA 3QSTA 4QS5A 3FOKA 2BZNA 2IKHA 3A21A 5AC8A 2QXWA 3INPA 4B16A 3KOFA 4GI6A 3SCNA 3FXGA 4UIOA 1PBGA 3FNDA 3N4AA 1ALDA 4OQVA 1OBAA 4WX2A 3NDZA 3ANVA 1ICQA 5TIMA 5H8UA 1LLWA 2E5DA 2Y2WA 1F3EA 4MWAD 3AUOA 3QV9A 2WSKA 2RHGA 2Z00A 2WZIA 4GVGA 2NQJA 5E09A 2UY5A 4AIBA 3WH5A 1BKSA 3R2GA 2F8QA 2XTKA 2QCDA 4GFIA 3KX6A 5TD4A 1N8IA 2B81A 2IQTA 4H9VA 5CC6A 5LYRA 1E0XA 2O9PA 2PSNA 1J0ZA 1OYAA 2WNNA 4P2VA 1HQTA 1GJUA 2IKGA 2OLHA 3G0SA 1V93A 3V1HA 3SY8A 1AH4A 4HSNA 4AIUA 4LYPA 2Z4GA 4H7CA 1A3WA 4KFNA 3DAQA 4PSPA 4D6EA 3LXBA 1EZ2A 2ACQA 4OJYA 1VD6A 1TYGA 2ANUA 4Z17A 4FXFA 5LXXA 3HPAA 1DWIM 1FTXA 1FWAC 4LBUA 3XISA 4PB5A 2H3DA 4NZ4A 3CUGA 3QHMA 4ZOCA 3FJ4A 3OQEA 2BG5A 1R3TA 1DIKA 3EEGA 4NQ1A 2A21A 1W32A 2IPFA 4A35A 4Q7NA 3GU2A 1DIDA 5BRQA 1HTIA 2QZRA 4IQEA 1W9BM 5XINA 1V0KA 3FEMA 5TBOA 3LA4A 2J79A 4RPQA 2H90A 4AEEA 4O8RA 2QT3A 1I8JA 3GG8A 3XIMA 1JGMA 5KZEA 7REQA 1SO5A 1IZCA 2QJNA 3PJTA 4UR9A 5BU9A 4M7TA 3NZPA 4JTAA 1NH6A 1TPVA 3TQ0A 3BMWA 1DJXA 1UUQA 5A6LA 3KL5A 3WNKA 4MDPA 2Z2UA 3UZZA 1V77A 3OODA 1XG3A 2Y4SA 1HUVA 3EPMA 3R10A 3QV8A 1M7PA 2FVKA 2QCGA 2XYLA 4IIHA 2OVLA 4LS0A 2PDJA 6XIAA 1D3CA 3HF3A 4B5NA 3E2SA 5JQ9A 5CZJA 3ME3A 4O50A 2VJXA 4MWAC 1Z69A 2J75A 4HOXA 4IMDA 4MWAB 1TPDA 1LT7A 4LRTA 1KBLA 4DJEA 4EVZA 3BPWA 3W73A 4FP1A 2XIBA 1TSIA 2OLSA 2OT0A 3EA3A 3TJLA 5EU9A 1IXNA 4HTYA 4HNNA 2OOGA 1B9ZA 1L6FA 4ZXLA 3ANUA 5CAKA 1RQEA 3F1QA 4CQBA 3FGCB 3W7QA 4WKHA 1TWIA 4XTIA 2VRJA 1LUCB 4FNUA 4BF9A 1B3VA 3IS4A 2TSYA 4HNUA 5AYZA 4HPXA 3VE7A 2VCCA 3S6OA 4Q8VA 4O10A 3NQDA 3WBAA 1GOMA 2JF7A 3WJXA 2WHJA 3GFYA 4YIWA 3WELA 3KFTA 1F7BA 1JAKA 1K70A 1JXJA 2CZ5A 1GKRA 1UCWA 3AIBA 1TRIA 1AW2A 4WK9A 3MDWA 4BQ5A 4UMBA 1XX1A 1UZHA 3W76A 3FYOA 4KEZA 1QTWA 3QEZA 2DVUA 3EYPA 4GJJA 1FOBA 1IYXA 3ZWTA 2QCDB 3HGOA 5LIYX 1XRSA 3BQ6A 2CLPA 4IXHA 4XUGA 1QO2A 4A3HA 5HANA 4L1XA 1VP5A 3E96A 1JCXA 1OGGA 1RA0A 2OO0A 1QUMA 1BG4A 4XG1A 4PSRA 4PODA 1CENA 2TODA 2VKZG 1L6YA 4N02A 3LCIA 3AWNA 2AGTA 3WMSA 5AVNA 1HN1A 3BH4A 1FDJA 1W5PA 4XV0A 4LTSA 1O7AA 4N9BA 1Q65A 3SM0A 1NEYA 2VFIA 5I0DA 2HE5A 3L0GA 2WB5A 4R27A 3AHZA 4DLFA 4HK7A 2Y5SA 3S9ZA 4PCSA 4RR4A 3HQOA 2FH8A 3WY1A 2G41A 3N3MA 5IDIA 1FHLA 2DW7A 4IGMA 5JUVA 2W79A 3T0TA 3CB3A 5BXRA 3SUUA 1AMYA 5F2GA 3ZYZA 2F7FA 4AX7A 1CTNA 3T6CA 3G1YA 3H2NA 1VIZA 1MW3A 4AD2A 5KZDA 1CCWB 1R5YA 1NDWA 2PGRA 4B2DD 5HQLA 2WJDA 1W0MA 4PMVA 4ZO8A 3RDKA 3NOEA 4MJ4A 4PMQA 3VOFA 2XH0A 4JFVA 2ZDSA 3PPHA 3G1HA 4UTKA 2NX1A 3FHQA 4JY8A 4C6EA 4ATWA 1RCQA 2Z7GA 1M03A 3LHZA 1RBAA 1SGJA 3BXWA 3S0CA 1WDDA 3CT2A 3S6DA 1M04A 1V3LA 1Z44A 5FF7A 4WDTA 4ZR8A 2V30A 3AYVA 4NHVA 1XLGA 2YL5A 1NDVA 1RV8A 4X2RA 3NUKA 1S3HA 3FVDA 3ZT5A 4Y8EA 2XJ7A 3UWQA 4GQ0A 3EOSA 2ZZ6A 3GXIA 1THFD 1XLKA 1XH0A 3UXKA 3A9IA 3ENLA 4RV8A 4TX9A 2PCEA 4L7ZA 1W1IE 2X30A 1VCFA 1DXFA 1W1PA 1M5WA 3BW4A 2O55A 3NQAA 3NPXA 3G1AA 5C9UA 3IAQA 2ZADA 4IWWA 3E0FA 1I75A 2WJZA 1YE6A 1UKPA 2OQHA 3QY8A 2OQYA 1ZU8A 3D5HA 3PZTA 3TYZA 1AJ0A 1KRMA 2FGBA 3LXCA 4EKJA 3Q65A 1PX8A 1F6YA 2V0TA 1VFTA 1CEOA 3WQ5A 3GSMA 4HA3A 2DZBA 1AH0A 2I5QA 4UOQA 1TTJA 1X1NA 5C2XA 5K9XA 7TIMA 4QX4A 4E2BA 5A8PA 3KXQA 4XWUA 4F79A 1XHGA 2B0MA 1V7AA 3CS2A 3CH0A 4Q6XA 4J3WA 3AAMA 5CGQA 3B8SA 4HU4A 3G22A 4R7JA 2HXTA 5J5DA 2DZVA 1RAKA 1F6PA 1UD5A 1E4NA 3GTFA 5AHMA 3GC2A 3DG7A 1ZALA 3MCOA 4J3TA 1S2WA 1EX1A 2BOFX 5GJNA 1LL7A 1V3HA 3UXDA 1U5VA 2PZNA 6REQA 4D8LA 4ACYA 1ADOA 5HQEA 1NWRA 1TKKA 3JS3A 3TSBA 1ENUA 3W75A 4H04A 5IFPA 3DBNA 4AFYA 3RM4A 3VZZA 4H7VA 2H8XA 1XIGA 3JRKA 2VX5A 4E0CA 1XLBA 4GZIA 4IJCA 2ZUTA 2OGYA 4D6HA 1TTQA 1MUWA 2Y5JA 4D2JA 4DJDA 3W2JA 3PS7A 4N6EA 3SI9A 1BXCA 2HBXA 3MV01 4IG2B 2F6UA 2WCAA 3CTTA 2VGIA 1R3WA 1X1OA 1KM5A 3WEMA 3TXZA 2E4TA 1ZAJA 5E1QA 4HMEA 2G37A 4WGXA 2VUNA 2W6RA 3C56A 4PCNA 2J9XA 4CKQA 1RD6A 3CL8A 1FBAA 2ZRUA 3WBYA 3N15A 1HKWA 2DUZA 3CASA 3NSXA 4M6UA 2XIJA 5D2XA 2BNJA 1UR0A 3L66A 4IL2A 1AZ2A 4QNEA 1CW2A 1HO4A 4L1WA 3SCUA 1IIHA 5A69A 4LAZA 4UFIA 1E6SM 4Q4MA 4XIMA 4B3KA 3MT1A 4XD3A 1V6TA 4O4VA 4UQCA 2XIQA 2ZUMA 1K9DA 3LHTA 4S3FA 4U3AA 3DFNA 3EBVA 2NUXA 4JHOA 2ZRVA 5BROA 3PZIA 3THUA 4BJHA 3ZSTA 1H7PA 3TC6A 3VI2A 4RCXA 3E1F1 3RK8A 5CJ5A 1DJYA 1SW7A 1W91A 4ONVA 4F3HA 3SGZA 3M64A 1EO7A 3B05A 1J0IA 3SQLA 2XVLA 5AOUA 3LS9A 1QCWA 1ISZA 4S3KA 2Q6ZA 5C2CA 1SW3A 1RLDA 2OX1A 3WN6A 3W7GA 4L9ZA 1NIUA 4H9ZA 4RNIA 4JZ5A 3PZOA 5DY3A 4MMWA 4S3EA 1BLIA 5IDZA 4AD1A 5FJPA 1QNSA 1OINA 3ZXWA 1NP0A 3NL3A 3TCSA 1JI1A 4DB7A 5DMYA 5LSMA 2B7OA 1R3RA 3N04A 4PR4A 1UWRA 1JPKA 4XZMX 2H8ZA 3WDHA 5HR7A 3KWSA 3SCRA 3S1VA 4Q8QA 1OX4B 3M0JA 4DEFA 3AS0A 4LU0A 1RR2A 2PRMA 3P7YA 3CHVA 3T8QA 1GVYA 1V03A 3HGJA 2AKMA 1VFLA 3E3HA 3S9YA 4BY3A 1UYQA 2QDGA 1VZWA 4QBXA 1A49A 1TUXA 4C6KA 1PKMA 4HB7A 3U0HA 3L7RA 3S47A 4QDPA 2YDAA 4IX2A 4YTQA 1TELA 5CSYA 3BE7A 1R3SA 3Q2DA 3ARYA 3RNDA 1C7TA 1Q8JA 4Z2HA 3MUZ1 3L23A 2D69A 1JD7A 3ANYA 5RUBA 2JQXA 1GT8A 4FNSA 2QV4A 4DN1A 3E0IA 1QR7A 2RGLA 2QJHA 2ACRA 3W7DA 1KFJA 1IEQA 1FCVA 1JQXA 3NQ8A 5I3DA 3NO3A 4K39A 4IF2A 1Q6RA 5CSSA 2BTMA 4H6KA 2ISWA 4JNYA 3ZWSA 3IJDA 1YQ2A 5DRCA 3NWRA 4JKKA 3NQ6A 4O1DA 1TPH1 1B3ZA 8A3HA 1BTCA 4EAYA 3PF3A 3CU2A 2BMBA 1ZJIA 3CL7A 3HQ1A 3BC9A 4JYFA 3W24A 4O52A 1UOKA 4YTSA 1GVRA 3K8KA 4JCMA 4DM2A 1NTHA 5I07A 1BSLA 4HA1A 3R0DA 4AWUA 2DVTA 5CPLA 3K4WA 1HVQA 2ZZ1A 2A3AA 3QR3A 1VCGA 3JZEA 5E0FA 3L2LA 2A6NA 1JUEA 4UNIA 2HEJA 3S42A 2PLMA 2QAFA 3WF4A 5I06A 2JKPA 4BWLC 3GR7A 3EXRA 2DW6A 5LIUX 4U10A 3WNLA 3SN0A 4AMAA 2YCEA 3BLDA 3V0SA 3LSCA 4UTIA 4LY8A 5G2HA 3VKJA 4DAIA 6XIMA 5DO8A 1GQNA 1QPQA 2YL9A 5K9DA 2BGNE 3WD0A 5DX7A 2WSQA 4IQDA 1WQ5A 1XIBA 1H7WA 4XVDA 4EXQA 3UG5A 1VCVA 3WFLA 2QLYA 3CUIA 3ITOA 1ME7A 5BYWA 4GQQA 4LBRA 1QU4A 4QCEA 8XIAA 4LVBA 2VGGA 2EO7A 3EOLA 4MB1A 5J04A 3LB0A 3ABRA 1SSGA 3RM8A 3P2VA 2CKSA 4J4KA 1RQBA 1QXLA 2VCAA 4ACZA 3VNYA 3W07A 3CHFA 1I1WA 3W7MA 1ZZMA 3C4UA 4AYSA 1BYDA 4GVIA 5BXSA 1VENA 3GTIA 3N17A 3GY1A 3DYMA 3IVTA 2D2GA 2PUZA 2YA0A 3WKZA 2XIMA 3VKAA 4UZSA 1QATA 4A8RA 3HG4A 1DE6A 5AN7A 4DYKA 1C7SA 1V4YA 2NXHA 3VIIA 1X1ZA 2ZTJA 1ZPTA 3VKDA 1IV8A 4C6DA 4PTNA 4XBKA 4U3CA 4LBSA 3GTHA 3HOJA 1WBJA 1GVSA 5F2MA 3KCOA 4L61A 1GOOA 3MP5A 4JTUA 1UUOA 3QMTA 1ISVA 2V9DA 3O07A 4AVFA 1YDYA 4RZBA 3RITA 2NUWA 1QBBA 1FFRA 3LCWA 2G97A 3WZ0E 3DN5A 3CAWA 4GNKB 2PDNA 3CUXA 1BYBA 5DT7A 3E0WA 1TMHA 4GX9A 3VGDA 4HMNA 1F8MA 4TUFA 3ZJ8A 2O92A 3DECA 1XKJA 1BKHA 5HNRA 4O0KA 5BWFA 4HK6A 3OIXA 2G4JA 5REQA 4YCOA 4MYXA 4WY0B 1KCLA 3PUDA 2Y1HA 1QT1A 4HZ8A 2QCCA 1UIOA 5IBXC 3QLDA 1XD0A 5A2BA 5D05A 4AYGA 3V16A 4M1BA 1W3JA 4B2DA 3VGGA 2G3NA 2V8ZA 1PHWA 2X40A 1E70M 3DHFA 3Q4DA 4PMNA 3S8HA 1JAEA 3LSBA 2X0HA 3BUVA 3E5BA 2XSBA 3TW6A 1P6BA 1UPPA 1F5ZA 5JH2A 2JK2A 4FNQA 1UC5A 3RJXA 3Q37A 4KKXA 4Y90A 4GUFA 4LPCA 1EIBA 1KM0A 3VK5A 4X0NA 4HHLA 1O5KA 4X22A 4G9PA 1XH1A 1F6KA 2V5KA 4GA8A 4GOAA 3DKJA 4KIRA 2BOEX 1QW9A 1RXOB 2J8TA 3EX3A 1CGTA 3UT0A 5J5RA 1US3A 2REQA 1VRXA 3EWZA 5L6UA 2ZUWA 3T0DA 1PZ1A 5FCZA 1CXKA 2Z27A 3HV9A 3LCLA 3RPTA 2DPEA 1NFBA 1MDLA 3AS2A 4EACA 3RJYA 5H6HA 4TO8A 3VDBA 4U5KA 4Z08A 2X1UA 3DUGA 1R8LA 1XC4A 3AXKA 1KRCC 3SRKA 2DSZA 1NAL1 5CZSA 3XINA 3TYEA 4IGNA 3KRSA 4MIMA 3M0HA 4ML9A 4W88A 2WC3A 3PWIA 4YTUA 3LBMA 4BS0A 4L1GA 2VC5A 3CT7A 1VYRA 3E0VA 4NXSA 4O1CA 1XYBA 4XZBA 3SDOA 2EF9A 3H53A 1DTUA 3WF0A 2BVTA 4UXDA 2ZX8A 4XZ9A 4FAMA 3GDRA 2GJXA 1NU5A 5I24A 1OG6A 3GTNA 1IT8A 1CI1A 3LLFA 1VKFA 3QY7A 2FZBA 4ZVJA 5IXEA 3KVJA 4TOQA 4PZVA 3AOFA 1JCMP 2ZE3A 4HD5A 3RRXA 1G0CA 3LPOA 3N34A 4LANA 4BK9A 1I2RA 2EXOA 1A0EA 2NZLA 4XISA 5FF3A 2J7HA 3NEHA 1JZ6A 1FWRA 5K2ZA 1EHAA 2R8WA 1CDGA 2WZTA 4EF9A 2P53A 1GZ1A 2VT0A 4TX8A 1BF6A 4WXZA 2VX6A 1SVDA 4LVGA 4O57A 3L5MA 5EFFA 3CUHA 1PV8A 3TVAA 3W72A 3VIGA 3DEQA 3IGSA 5REQB 1XLJA 4W84A 5CPNA 1DQWA 4Q8MA 2OOFA 3CHCA 4ZSUA 1W56A 1C3FA 1GJPA 3H4GA 3V0UA 4GYPC 3WBXA 4WKAA 4NY2A 1HGYA 1TUFA 3NL6A 1W1YA 1SZNA 3BLPX 4QQ3A 4O12A 1KBKA 2PRHA 5LA2A 2YSWA 3C2RA 3SURA 1LORA 1WUEA 5HWMA 5K9CA 3KDNA 1XFCA 3EGJA 3T42A 2FVLA 4IP4A 4A8IA 2J25A 3BLEA 1AQHA 1P6WA 1EOMA 3HFTA 1HX0A 4NZJA 4C6FA 2QGHA 3TTOA 1ZJBA 2BX7A 1XYMA 3M0VA 2YXOA 3VIJA 1KTCA 3U7VA 4Y7EA 2YCLA 5LGXA 4HTBA 3KZSA 1TV4A 3PUEA 1K1DA 2OSXA 1XKYA 3S5NA 4CCEA 2VZUA 1OC6A 2HISA 5FEPA 1FCQA 2NVCA 2D3NA 4ZBCA 3TYAA 4EE9A 1OABA 5E6ZA 3UW6A 2YYUA 4C1NB 1CX9A 5D38A 2R14A 4C1KA 3VCCA 1D3HA 4XO7A 2BHYA 4IPJA 2GYIA 1I0BA 2WC4A 2PFHA 4KRUA 2PC4A 3VKCA 3BURA 5DN1A 1XR2A 3DHPA 1IEXA 3MSGA 3TQVA 3GNDA 1JNEA 2HRWA 4K68A 3A47A 4K7YA 4NP7A 3VOHA 4PE8A 1RP8A 2QR6A 1E43A 4PCTA 5E9XA 2J8FA 8XIMA 4Z0SA 5KINA 4Z1DA 5HUOA 2ASHA 1W1TA 1ME8A 4MJZA 3T0AA 3UYIA 3G1XA 1H1NA 1N8FA 3VNLA 2DIJA 3GHRA 1GVQA 2XPKA 1EF3A 2X42A 2NSXA 1J12A 4NZFA 1TTPA 3UVIA 3UR2A 4YL2A 4O1BA 4ZZ9A 3EWWA 1JCLA 2BXVA 3I7RA 2YBUA 3TIMA 1OT2A 1G69A 3WLNA 5KEZA 3ICJA 1BYCA 2CLKA 1UD3A 5CSRA 3R94A 3UETA 2WM0A 4MWAE 1YW1A 2ZXDA 1TR9A 4M56A 4H6QA 4NJGA 4PFHA 3UNTA 4XBSA 1X98A 1LROA 3GFZA 3N4EA 1RVGA 2PDUA 3UR8A 4HOWA 4M29A 3G1FA 3M16A 4X2PA 3L65A 2F9RA 4HMCA 1UD2A 3FS2A 2J7FA 4D6CA 3WLQA 1UOZA 1XWYA 4R88A 3UWYA 4POCA 2GVYA 3C2YA 2BSLA 1P5BA 4LSBA 4AISA 3G0UA 4XIAA 4ML4A 1Y5VA 4S1FA 3PULA 1I2PA 2F84A 1SJCA 3GXTA 1XYCA 5I2UA 5D02A 2Q71A 3N6QA 5A2CA 4ZB0A 3QQ1A 3S9IA 4QEHA 4Z1CA 4LF2A 1F2JA 4QE4A 1K02A 3UZJA 3APYA 1XF0A 4NJJA 4V1YA 1EKOA 2VC9A 1JUKA 3B04A 4GIYA 2POZA 2PDMA 1Q5MA 2NXGA 2IKIA 1EPXA 1SR0A 3F2DA 2WSRA 1D7FA 1KRAC 5AY7A 2VFEA 3WJYA 2PDCA 2PEVA 3VDAA 1HGWA 2L5HA 4FOJA 2G3MA 3BLIA 3S2CA 2E67A 1DHKA 1W9VA 4CD7A 1LG1A 1SSDA 2BFGA 3CYJA 2J7GA 4HZMA 3NZ1A 3URAA 1W1VA 4Q4SA 5CC7A 1EDGA 1RCXB 5D2WA 2EHHA 1YPXA 2QUTA 1C9DA 4MZ1A 5HNNA 5C5YA 3I3BA 5LIKX 3UJFA 4ZSTA 2X2GA 3ARWA 1S5NA 3WDRA 3M43A 2XN1A 3LM3A 2WMKA 2JIEA 1K7EA 3W1LA 2QUUA 3K13A 3KCJA 3KTXA 3VOGA 1PYFA 4J28A 4G7EA 1DTNA 2PI6A 5AKQA 3UEQA 1LP6A 4C6NA 1LM1A 4YCPA 1XLDA 2WMIA 3WDIA 1K77A 1M7XA 1RK6A 4AC7C 5BOEA 2AQOA 2VENA 1GOKA 4LVAA 3GRIA 1BVNP 1IGSA 2XSAA 2PODA 2AOSA 1T41A 1FWJC 3RFAA 2TMDA 1XBYA 4M82A 5ECVA 3TLLA 3MO7A 3F2BA 1W9DM 3HG3A 5C9ZA 2Z7KA 1OCBA 2B7QA 5CH9A 5HQMA 1KTNA 1J2WA 3EDJA 2Y85A 3L12A 3UJ2A 5FJOA 4ZE5A 2FGZA 2OKTA 4TVUA 3UR7A 4DX3A 1CPUA 2IUZA 1YE4A 5FJJA 3H2CA 1VFSA 3LBOA 3VM5A 1MW1A 3KL3A 3AHYA 2R91A 1K03A 1KM3A 3WQCA 2FZDA 1ZQ5A 3GZAA 4AMCA 1EP2A 1O66A 1EIXA 4IIDA 1DHPA 3P74A 1MVYA 3N6HA 4ECLA 3ISIX 5A5WA 1EHNA 1F3TA 4KQNA 1R9ZA 5GVJA 3V0TA 3AIRA 4C7DA 1A5CA 3RPMA 3UESA 3LG3A 4LC6A 4US6A 1EZWA 1Q85A 3N19B 1TIWA 4E3VA 1AH3A 4LX4A 2WXDM 3BK0A 1RA5A 5A8NA 4PMZA 4WCJA 3SRFA 2Q02A 1H09A 3EDEA 1TCDA 4ATLA 3W01A 1ZUAX 2PLCA 4ZGYA 3M41A 5DBUA 4H2HA 4IHCA 1F4HA 3DYOA 3TZNA 1F3XA 1ADDA 1V02E 1FRBA 1RVKA 4E6MA 3DC0A 2QF7A 4GLEA 1JL8A 2X41A 3OBEA 2HS8A 4XZLX 4MVAA 3WDJA 4QSHA 1Y65A 3RLGA 5DT5A 1IF2A 4ZQPA 4RE2A 1BD0A 4U2ZA 3QV6A 1LYXA 4LRSA 2WVVB 3R79A 1H50A 4CQ8A 4IIFA 2CLMA 4JPGA 5C8BB 2OSYA 4UQAA 4KIEA 5CZKA 2QMKA 5C7VA 3EA2A 1VEMA 1JDAA 2BOGX 2PWEA 1V3MA 4GY7A 4MB3A 1XGZA 4IQLA 3CQJA 3GE7A 3NQ7A 3O1NA 2BV9A 1JZ2A 1T7LA 5FESA 1FWTA 2QHAA 2VQTA 3U4FA 3I3DA 2BY2A 4QDWA 1H4PA 1YIXA 2EGZA 4AZHA 1U22A 5FJUA 1P7TA 3I6RA 3VE9A 3WD2A 4ZFCA 4IPIA 4OVXA 1C93A 3UJRA 4D6FA 3DH7A 5CQ1A 4JYEA 4GG9A 4LUIA 4OGZA 1A0DA 4WSHA 2O9RA 4KT2A 1CGUA 2CLEA 2WCSA 3CV2A 2HZGA 4GFSA 4DWSD 4YVVA 3SW6A 3LCXA 4WIWA 1UMLA 3TKFA 3P82A 3BAWA 3QTGA 3B0YA 1JPIA 4FF7A 1QHPA 3OA3A 4PMRA 4OBRA 2FTYA 1QMLA 4JDBA 4MNMA 4YYCA 5M17A 1Q4NX 3GVGA 5FAJA 2PU0A 3TK7A 4LC8A 3FX4A 3O7UA 3UG8A 5KMYA 3H8AA 1DL3A 3LOTA 1OFDA 3NQ2A 5CPQA 1YXCA 4JXCA 3MW7A 4DZIA 1ZL1A 1OC5A 2F38A 4H9YA 3N2MA 1SO4A 1UZDA 4WEVX 5EKYA 2AL2A 1Y8BA 2CZDA 5EMJA 4ZXOA 2P3ZA 4Q4QA 4Q32A 3MS8A 3RU8X 1D8CA 3QFEA 5SWUA 2OR2A 3LTPA 2E1WA 1ICPA 2XGIA 3LV6A 1E40A 3ZLHA 1VPXA 2C16A 3PUOA 2XGBA 4IUGA 4X60A 2X0YA 3V5OA 3ZOAA 4GIRA 1JXKA 1J01A 1KWKA 3JW7A 4DJFD 1Z89A 1K9FA 1S2VA 3HB9A 4O16A 1S2TA 4Q22A 2DZWA 1UR8A 4M7SA 1FHVA 4WSKA 5G2IA 3LX9A 2PPGA 3IK4A 3WLLA 1XBXA 1E6QM 3PZQA 3CYVA 1WBHA 3IGHX 5AC7A 3ARSA 1S2CA 3WUEA 4QG8A 3V75A 3B40A 3PFRA 3NQVA 5D03A 2WHMA 3NYDA 5LA0A 3TC7A 4JTEA 3VABA 1SU5A 1IHIA 2VEMA 2CHNA 4Z2KA 4ZO7A 1MUCA 1UWAA 4W7UA 2I7GA 3BQ5A 1XPGA 3HFYA 3UZXA 4WSJA 5EMKA 4Z1BA 4LOCA 3MY9A 3GBDA 4HSHA 3CLWA 4O28A 3WSUA 3GS6A 1IEIA 1OZQA 3RLUA 3KLKA 3PTMA 1HL9A 3S5ZA 4DF0A 4FLQA 4UFHA 4ES4A 4PGLA 2YL6A 4OBTA 2OPJA 1A3HA 2ALRA 4Q8WA 3SCSA 2QVNA 3BJSA 2WW5A 3I65A 5AC6A 4I6VA 1A3XA 3ZM8A 3B3DA 1XS2A 2WYSA 3WFZA 2DFAA 3GXDA 2VR5A 1FVPA 3CM4A 4GKLA 3MP3A 5EL1A 3CH9A 1QPNA 3IGUA 3MUIA 2VXNA 3CQHA 5GJPA 3FKKA 5C9RA 4GUGA 3W81A 3W1XA 3OG3A 2ZIDA 3DDMA 5D9MA 4GNJA 1TR1A 1O5XA 3CMGA 3PZGA 1BG9A 2J7CA 5B7YA 2QAPA 3ABXA 2JALA 3OLEA 2YCJA 4E38A 4C5ZA 5HMFA 5A3HA 1GQLA 4KH2A 2BODX 3KHJA 1FQ0A 2PWHA 3SZ8A 4B4HA 1ODZA 5CG7A 1L2QA 3W88A 5F2LA 1L6SA 4Q8OA 3PPGA 4V27A 4JIPA 4L4MA 4AU0A 1VJZA 1R6WA 1POKA 5AHNA 5EGRA 1H0IA 1UR2A 2WOQA 2H3BA 5LXEA 4ZTYA 3BGAA 3DCPA 4HOZA 3CZJA 4A3QA 3NDOA 1FY6A 3CTLA 1Q6FA 5FOOA 3MHUA 3MWCA 3ZMRA 3TYCA 2Z24A 2VI0A 4EOUA 3UQNA 2HWGA 3EB2A 5A8GA 4NZ5A 4LJ3A 3QKZA 3RCYA 4F9JA 3NSNA 1LCOA 3AYTA 4ICMA 1VFUA 2P50A 3S5YA 2QJGA 5ABGA 2QS8A 4RNFA 1O5RA 4H8UA 2PTZA 4MFDA 2EKCA 3MSDA 4J3XA 3CWNA 1SZFA 3AQUA 4PEKA 4PEEA 4F0LA 4S3CA 3GBEA 4HIBA 1XSKA 2FQIA 1TJ0A 5IOBA 1H62A 4JTKA 4F9DA 2E77A 3WH8A 3K8MA 4R7WA 3H7VA 1VPYA 5C70A 4FXRA 3PP7A 1FH9A 4E3TA 3MJMA 1TJ2A 3W1MA 5KSWA 3UWWA 4B91A 1UWIA 1JVNA 3BLLA 4WZHA 1HXJA 3B9OA 1XGDA 2UY4A 1Q6QA 2PTDA 3ITYA 2CWNA 2QCFA 3T40A 4HU8A 4NILA 3WUFA 1ITUA 1EJSC 2ZFAA 1ZLPA 3AJXA 9XIMA 3IPWA 4Y9PA 1M3UA 5U4NA 5I3FA 3W74A 3SRDA 1IWBA 3AC0A 2GWGA 5F4WA 3TE9A 1RH9A 3FXYA 3B8IA 3RCMA 3LYEA 1OK6A 4JTJA 3CBWA 4JFSA 4MOZA 1X97A 3GWQA 1TVLA 4P5UA 1NP2A 3GTXA 3IUHA 3N14A 1ITCA 1OG0A 3BMXA 4UQ9A 1QRQA 1K8ZA 5AYXA 3CJPA 1ONWA 2OWCA 1HO1A 1PUDA 4ZODA 3OG2A 3HIJA 1ZCCA 1P4CA 2DSUA 1AVAA 4GZEA 3DFYA 4L4PA 4U28A 3W6MA 1KM6A 4CNNA 2PDIA 2XDFA 3TONA 4KRTA 3TTYA 1E56A 4E2DA 3H6OA 1XJBA 3C52A 1G1YA 5EY5A 4UCFA 3Q67A 2DZAA 3A23A 3F4VA 2VVNA 3SCPA 4AZIA 1P0NA 3W1RA 4MPKA 3MV11 5ABFB 1XBVA 5CBJA 4E4PA 4XD4A 1UMYA 2PU1A 1I45A 4M81A 1CLKA 3S2JA 2V2HA 2TPSA 1BXBA 3MBDA 4GVHA 2W4XA 1A5NC 3R25A 1W1ZA 3RX4A 1O1HA 2HVMA 1HG3A 5DMMA 4FR1A 3MSYA 1LDCA 2ZUNA 3TTQA 4AH7A 1X39A 1RSCA 1XYZA 1IR1A 2ZDRA 3VDGA 3NFUA 4TQTA 4FHAA 4I9AA 1FHDA 3OVRA 3W9ZA 3AHVA 3DGBA 4FS9A 1MNZA 4UUIA 2NX3A 1RJPA 4TR9A 4PL1A 3UWVA 3GKAA 3UPBA 3KOWA 3OA5A 4YYFA 2D3LA 1BXNA 4H8VA 3T2PA 3AIEA 2ZUUA 1KCKA 3ARPA 3B03A 1CGYA 1CB7B 4ADTA 4NI3A 3DHDA 1IXOA 3T2QA 4JS3A 4KW2A 2VELA 1PPIA 1MO0A 1J11A 1H60A 4JTCA 3WIJA 1EJ7L 1J6OA 1XLEA 3O0FA 3QW3A 3SUTA 1P6CA 1W3HA 1EBHA 4PCFA 4TMBA 3AU6A 2DU2A 3N1AA 3RHGA 1TQXA 4O18A 1DQXA 3TA9A 4XKYB 3N73A 4AAJA 1QASA 4HMDA 3TJXA 4F4RA 2REQB 4TV5A 1EYEA 3TP4A 4MJMA 1ZAHA 5ABFA 2YOCA 3MP4A 4GY0A 4KRZA 1JZ5A 3UWUA 4GRSA 3PAOA 3KZPA 4H3DA 1PCKA 3UXAA 4W5UA 2CEQA 3L67A 3AJ7A 2J47A 1ECEA 3U2OA 4OHQA 3LHVA 4EXAA 1P1XA 4M80A 1FWHC 2YB1A 1MDRA 4JY9A 5LNRA 4OV4A 6TAAA 1GYMA 3GHTA 3W7EA 4D1IA 1TTIA 1VFFA 5AZ1A 4PUNA 3LQLA 3SCWA 4DNMA 4Z42C 4WR3A 4QHRA 2PGEA 3PBUA 3KS5A 4J3ZA 4Q6JA 1Y5WA 3T05A 1ZFJA 1M41A 4KS0A 3VD3A 3IAPA 2G3IA 2R24A 1XW8A 2FIQA 2C3ZA 4W8LA 1W9UA 4CD4A 4XAPA 1V6VA 3O6YX 4GI4A 3TN5A 3GNXA 3FA4A 3R0KA 4GUHA 5A6KA 4GE8A 4S2CA 4ATDA 2D24A 4HPNA 3F5KA 2A1YA 3H70A 4B3LA 1PYMA 4XK2A 1R3QA 1Z48A 3TH6A 3TWBA 3B0VC 3SUSA 3NPWA 3VNJA 3CPGA 4TIMA 3C5QA 3ZZ1A 3N12A 4DHGA 1BWLA 1YMYA 1GTHA 3AXMA 3FAXA 4FX6M 3N9SA 2J66A 2GVLA 4DUWA 3LQGA 3N25A 4M8UA 4CD6A 1ZJHA 5JIWA 3FK4A 1B54A 5FF4A 4U33A 4DJDC 2Y7DA 1GCYA 1VBGA 3P61A 3LTYA 4PTDA 3GAKA 4LNCA 4PRWA 3WLMA 4R9OA 1U1HA 3W1NA 4OOZA 4JQ1A 1UP0A 4MZ8A 4DXVA 3F4WA 3MHGA 1KBBA 3L2MA 3PBMA 2LLEA 1LQAA 1OGBA 4BZYA 3NR0A 4RW3A 4IGHA 4K1GA 5HR6A 1IQ8A 5JBDA 3BOXA 4CCDA 4P7OA 3S5OA 3IJQA 4FO4A 3QOMA 4PBGA 2WAGA 2BP1A 4A4AA 4S38A 4RW5A 2W61A 1EWDA 4JTSA 4US5D 1H51A 1A50A 1IZKA 3GVVA 3SR7A 4OUIA 1NOFA 4RLIA 4YS1A 2O0TA 3NEVA 4QAWA 4AZCA 4L6OA 1H7OA 4U31A 1HVXA 3VFCA 1FDZA 2E8ZA 3F2CA 3QPEA 3QC3A 2O9TA 4OE7A 3WQ8A 1H2JA 1V3JA 3A24A 3KBNA 5LZLA 4Y96A 4CNTA 4W85A 1FWCC 3NTYA 3E38A 5HWJA 3WJSA 4TMCA 3UF9A 2FJUB 3QYQA 5HJYA 3QXBA 3A4WA 4HNVA 3STGA 3STEA 4K3ZA 3I10A 1NFPA 4AEOA 2Q8XA 1TWSA 3W6LA 2FZNA 4MAVA 3AIUA 5BNKA 4LUTB 4AHPA 2ACSA 3ERPA 4AZ6A 1TJPA 5HUPA 3OLDA 4H41A 5C55A 1WZMA 4NXKA 3VIOA 2P8CA 3WK3A 3RYSA 2QIIA 3B8UA 4J2MA 1JYVA 1K3UA 3NJ3A 1KXTA 3T4WA 1QNPA 1G7UA 2FTWA 4MTVA 1XDJA 4QCFA 1CLVA 3VILA 3MHFA 5LHFA 1XLLA 4UTHA 5TF0A 3BG3A 2YXXA 2YA2A 3LMYA 2GVEA 1XDLA 1R47A 5A6JA 1PAMA 2DT2A 4EPDC 2XWEA 4ZQNA 3KRUA 3SIZA 1AQMA 4QEEA 3MVTA 2PDYA 2BXZA 3DFSA 4UMAA 4H9XA 4CU7A 4X9YA 1XUUA 4U4MA 2I9EA 2FHFA 1CXIA 2VL4A 3M5YA 1IWPA 2C15A 2WV8A 1LF1A 3A5VA 2G3FA 4DJED 2W91A 3KCLA 5DEZA 1H41A 3L4VA 3EX1A 3C2FA 5FEZA 3UFYA 3N13A 4TVCA 4KERA 1UIPA 1S38A 1WKDA 1S5VA 2X1RA 1HP4A 4PMJA 4LS2A 1JYWA 5KETA 4RL3A 2Y0FA 5HXMA 4P61A 4C7GA 3BJFA 2GSEA 3CV1A 4IGSA 2QIWA 4JTLA 2P76A 3W83A 1FKXA 2DY3A 2VTFA 2QYGA 2F61A 2A4AA 3W1UA 1Z32X 4BQ2A 4IX0A 4V15A 2GPTA 3EOUA 4GZ7A 1LWHA 2FMNA 1E51A 3U6WA 2O56A 4QXIA 1XIHA 4OKDA 2PP3A 2GUUA 2WQPA 3CGTA 3HPZA 5HNTA 1QNVA 2GJRA 2YCKX 1I0DA 1E5JA 2G0WA 2A3CA 3QC0A 1UP2A 1MW2A 3IIVA 1HF6A 3C2VA 1W8SA 3PSWA 4HU3A 3BLKA 4A2RA 4NZCA 1OD8A 3EKZA 3H24A 1I4NA 3K5XA 3LLXA 2EQDA 1E1EA 1IR2A 5A95A 2IQDA 1NQ6A 2ESCA 4M5PA 3YPIA 2XH4A 2BWGA 3CUZA 1KFLA 5ABTA 2DIKA 1J0KA 2AQWA 4H01A 2ACUA 3MANA 1E5NA 2XZ9A 4LS1A 5XIAA 4FK9A 1WE5A 1PZ3A 2J74A 2VUYA 3ZVHA 1LRTA 2WLYA 1Y7VA 3I4KA 3APGA 4D71A 2ZZ7A 3NG3A 5MF5A 2WMGA 3WMBA 3WL0A 3VAVA 4HYVA 1AMKA 3WMLA 4IP5A 2Y8VA 3SUVA 2XISA 3VX0A 1E4MM 4BKNA 5M2FX 4S3DA 3AMLA 2WVSA 3GX9A 3T4CA 3WH7A 1LQ0A 3M9YA 4Y6GA 3QM3A 2QUNA 3NM3A 5HINA 4FMVA 3P5YA 2CU0A 4RV3A 3IANA 3GYEA 3LERA 4HA0A 2ON3A 1XG4A 2Y62A 4YHEA 2GL5A 4DBDA 1V6WA 3RM9A 2JFEX 3KOXA 3NURA 2YJQA 3M7SA 1V7YA 4IPNB 4AY7A 1R30A 3UBPC 2ZZ5A 4D8AA 2RDTA 4N9CA 2WZEA 3L0KA 1L0PA 2Q09A 5B7ZA 3TA6A 2UWFA 1TFVA 3POCA 3DHUA 2CKRA 3EZ4A 1JF6A 4GUJA 3AZSA 3IVUA 3VOIA 1YNPA 1JULA 4JX5A 4IMAA 5AYIA 1MSSA 1OC7A 1OFEA 3EXSA 5LIXX 4AUBA 4LYRA 4N42A 4PUWA 3IARA 3WDPP 4FEZA 1F07A 3ALFA 4O1EA 3RXZA 4JAWA 1QOQA 3ID7A 2VWTA 1K9TA 2HBVA 5CC3A 4XZIA 1HJWA 5T9CE 4E2OA 2V82A 2QCNA 4O0ZA 3GO2A 3AHTA 3AYRA 3BDKA 4JQ3A 3LZ3A 4J1OA 4CNOA 1QI2A 1VIWA 4CNSA 2A3EA 1S2AA 2H9AA 3MCNA 3EWUA 3QVQA 3LV5A 1SZGA 3ONBA 2YZ5A 3BSMA 4MDOA 1JEZA 1B0IA 2YB4A 1CZ1A 5BW6A 2DUAA 1AW1A 2WO5A 3S46A 3OOQA 1EC7A 5C9WA 4DJFC 1XXXA 1IEWA 3GW0A 1U2YA 4YLWA 3BWWA 4QR6A 2QPUA 1VHNA 4OFCA 4ALDA 1YDNA 3FYPA 4IL0A 2X7WA 1AD4A 3WQEA 4IQJA 3W25A 3W23A 2YBVA 1RY0A 4MM1A 4KGJA 1EJWC 3W6YA 3B06A 4S39A 3G6LA 4A22A 1OM0A 1SM9A 1FWDC 2VZVA 4MAZA 3H7RA 4QE5A 3VUPA 3K4DA 2QMJA 4LUSB 3P67A 3IIOA 4AZ5A 6A3HA 2IPGA 2ZA3A 4A29A 1PTDA 3RR4A 2FZ8A 4AXKA 3EKGA 2UBPC 4ERGA 1LQ2A 4C65A 1FDYA 4HT3A 4QNWA 5C6MA 3ARRA 1J8VA 3L68A 1E1CA 1J79A 3H4WA 3W7OA 2E28A 3I7QA 3KBMA 5FEWA 3NO1A 3CQIA 1XIMA 2ADAA 4QLLA 5CLWA 4ZB2A 8RUCA 4DPQA 1CGWA 3KHDA 1ZGDA 1MEIA 3KTSA 1MEWA 4UR8A 5BXPA 1E71M 2WK2A 4AC1X 3TQPA 3OLIA 3MVIA 2ZKMX 1MW0A 2E6FA 4HJFA 3ONCA 1LRQA 2XWDA 1UKQA 1FCUA 5T91A 1GOQA 3P84A 3TMQA 2VD8A 1WZKA 3NZRA 3W7JA 3WENA 1U83A 4MLJA 5FSDC 3M6YA 2CNCA 1DJHA 3TYUA 3GM8A 5U7SA 2XG9A 1D8WA 4M51A 4MB4A 1T5AA 3E6EA 5F4SA 3EMZA 3RLHA 5I02A 4EPKA 3W7HA 4HYWA 5AVHA 2WCGA 1V0NA 5HMSA 4R5EA 3IIPA 3WLPA 1F76A 3S5SA 1HNYA 1YYAA 2DQXA 3SCOA 1FH8A 2ZRYA 2D0HA 2PRLA 4CD8A 2V63A 5H2ZA 2QQ6A 4IJBA 1E1FA 2PA6A 1QI4A 1XIEA 3R89A 3PAJA 1UA7A 1TA3A 2BY3A 2J77A 1KD0A 4NI8A 2GVGA 5EBUA 1J0YA 4MKVA 5FF2A 3NAVA 1LL6A 4DO7A 3B0XA 3OTRA 3C0JA 2WMHA 5CJMA 1KR0A 3SRHA 1KGUA 5EMLA 3HU7A 1SUXA 1GOWA 3OYZA 2CPUA 3FAWA 4W8BA 4JIEA 3SY1A 3VIMA 2WJEA 2ZRXA 1XCWA 2J7EA 4QM1A 1PO9A 1I2OA 3O06A 4BWLA 4AIOA 1B3YA 4NSBA 3E2QA 3AISA 5D9PA 2PDQA 4R33A 4Q3MA 1DWHM 1E0TA 2Q8ZA 3RUBL 3GDBA 3IV3A 2HJPA 3AXIA 4S3BA 2ALDA 3W26A 1OFQA 3N2CA 4X9SA 4CN1A 3W0KA 1OZMA 4B3ZA 4PUJA 1XGEA 1HFBA 4AW7A 3QRHA 4J3VA 1PWLA 5I00A 4LNYA 4ERIA 2GQ3A 1VBHA 3AZTA 3CV7A 1EP3A 3L2IA 1WKYA 5C71A 2YKKA 6ENLA 2G3JA 2DSVA 1PWMA 1FWNA 3H23A 1ZJAA 2HXUA 1TE1A 5D33A 3U2ZA 2ZBTA 4H9UA 2NX9A 3E2VA 1FX6A 3C3UA 2Z2AA 2HDJA 3AICA 1GHSA 3FLUA 3GH7A 4PUMA 3DOPA 1RLCL 3QZAA 1VEOA 3AIVA 4B9ZA 3DESA 3UJEA 2RUSA 3UA4A 3VC6A 1GVEA 3VTRA 2PTWA 4DF1A 3G18A 1S5MA 3PB2A 1OCNA 2V3DA 1GQJA 1MXSA 4RJEA 2WWDA 4F66A 3AIWA