1F5ZA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form i
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
molecule keywords N-ACETYLNEURAMINATE LYASE
total genus 122
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f5zA00
1XKYA 2YW4A 4K7YA 4MY9A 3EKZA 4JR5A 1RQBA 2JKEA 4GE8A 2GUUA 1Q3NA 4GXMA 5I3HA 2DJXA 3DFTA 2O7QA 4GUHA 1KW1A 1SSDA 3ZS4A 3G0SA 1M5WA 2LLEA 5EA9A 1C9DA 4A29A 3ABQA 1Q6RA 4WY0B 5FI8A 2PRMA 3EX3A 2YPIA 5F4WA 1F5ZA 5LNVA 4PL2A 3ABSA 1OJXA 2FJKA 4Z1AA 3W2JA 3OVPA 1JUBA 1ZAJA 2HMCA 4MVAA 1F6KA 3P60A 2ZYFA 1V7YA 1LBFA 4JEQA 4UTTA 4LS2A 3NQ7A 5LNUA 2ZRVA 1K7XA 3IV3A 2J9ZA 3E0IA 4MYXA 1PIIA 1LRNA 5FF3A 4Y96A 3TFCA 1XI3A 1MEHA 4DO6A 4UTTC 1L9WA 1QOPA 1J5TA 3QQ0A 5HULA 1F76A 4JDYA 4R7JA 2X2GA 2ABAA 3NXFA 1W5PA 4U28A 1G7UA 2DZSA 2E77A 1HO4A 3DFSA 2FIQA 1KFBA 2DP3A 4RZ6A 2EPHA 3KVMA 2ZA2A 3GAYA 1SFJA 4LUIA 1NEYA 3PUDA 4Y90A 3BV4A 1W3IA 3W74A 3IGXA 3H54A 3S9YA 1TTIA 2V2CA 3SIZA 1W56A 2C1HA 3R8RA 1E51A 1OYCA 4L4LA 4HNNA 1KM4A 4OGZA 4UFIA 5DN1A 3NPWA 2H3DA 4JIPA 1P0KA 2QDGA 3RLVA 1ADOA 1KFKA 4LVDA 1TTPA 3L5LA 1Y0EA 4UTMA 3U6WA 4BFAA 3CWNA 1Q6QA 5G2IA 1VLIA 4MY8A 3ZFHA 3R13A 5SWUA 4O1CA 2ZFAA 4JXCA 3LCWA 4TMCA 5D37A 3KRSA 8TIMA 1SW0A 4E38A 3MO7A 3UPWA 3P8IA 4JTKA 4O19A 4CQ8A 3O63A 2Y7DA 3LHTA 4FX6M 1F73A 3LXBA 2Y85A 3TROA 1FDJA 3C2OA 4EIVA 2WNNA 6TIMA 1QPOA 4HT3A 5TBOA 1AW2A 2F84A 4UR8A 1EWEA 3NQAA 4M6VA 2W79A 3TK7A 5AC8A 3W6YA 3LHUA 3S5NA 2DU2A 4FX8A 3GKFA 2Y88A 1N55A 3CPRA 2DZWA 1MEIA 2ATSA 1VS1A 4IUOA 3WK1A 4Q32A 3F4NA 4QM1A 3LOTA 3M5XA 3DFOA 4FIQA 3M5ZA 2CLLA 3FIGA 4JX5A 1M7PA 3MHFA 4QISA 1TV5A 1G6CA 4ZQNA 1W3TA 2JKPA 3G24A 4X2RA 2PRHA 3C2VA 3ELFA 1XUUA 3FYPA 1VJIA 3IVUA 3LCHA 2ZZ3A 1B4EA 4UTWC 1X6UA 4UC5A 4O8RA 2YDAA 1T8XA 5CZSA 2Z6IA 3EWYA 5HWJA 1H7PA 3LBCA 1ZAHA 3EX2A 3PSVA 3CWOX 1JCNA 4NU7A 1FWRA 3C61A 1YTEA 1X1ZA 2WO5A 4CCCA 5HR6A 2OCZA 3S5ZA 2ZRWA 2ZZ1A 2P1FA 3OVRA 4UTKA 4HHPA 1IIGA 4JNMA 2ZZ4A 3C4UA 3UWVA 2VFIA 3GXTA 3UWQA 3TJLA 1ICPA 3TH6A 1QNVA 4MIMA 3W7QA 4FNUA 3CEUA 4MZ8A 2P10A 3W7RA 2CZDA 4LUJA 5G4WA 3TFXA 4B5NA 1TJRA 3QFEA 5LNSA 3W87A 3AJXA 3M7WA 3W7MA 5AB3A 1THFD 3A5VA 4Y6GA 3TAOA 2QUVA 3HG3A 4TU1A 3IGSA 4LS1A 1WBHA 3SGZA 3PC0A 4I7VA 3FYOA 4JGDA 5F2GA 3TQ0A 3A23A 3S6DA 1Q45A 3G1SA 4UTWA 4RLIA 7TIMA 3NVTA 4LVFA 3TSBA 3M5YA 4GUIA 4NZJA 5D04C 3TC7A 4K6AA 4S2CA 2FPYA 1EPXA 1YDOA 1R47A 1XBXA 1DQWA 3NL3A 4XWUA 4MJZA 4K38A 3W1XA 2HSAA 2J6XA 2ZA3A 2G97A 1QMLA 3C0JA 2NV1A 4LV4A 1W8SA 3QW4B 4O17A 3FJ6A 4N6EA 4UTHA 2XN0A 1I2NA 3W84A 2Z0IA 1XC4A 3NQMA 1RR2A 5CZJA 1C8VA 5U4NA 5AYXA 1TPDA 3RK8A 4A2RA 2X1TA 3UPBA 3NPVA 1K7EA 2OMAA 1LORA 4N9BA 4O18A 5K7JA 2J9YA 4NVTA 1DV7A 3HF3A 5E1QA 3S1UA 1I2PA 4WY0F 4ML9A 3DI0A 2VELA 4NJIA 5EPDA 2Z2UA 1TREA 4RJEA 1G7VA 3IIXA 3U8GA 3B04A 2A2IA 3C56A 1PHWA 1AW5A 3G3MA 5FF7A 3ZR4A 4RR4A 4EOUA 4FIRA 2J24A 3R89A 3MP4A 2B4GA 1LCOA 3EWXA 2A21A 3SY5A 2QCCA 3QMSA 4R34A 4RCXA 5E93A 4A22A 4O0ZA 4UTJA 1RVGA 3KRUA 1YTKA 3R5EA 4WOQA 3W1TA 4X3ZA 1XCFA 2JGYA 3S42A 4Z1BA 1SPQA 2JGQA 3P5ZA 5BNKA 3WFAA 1KTCA 4LT9A 2NUWA 1Q6OA 1SFLA 4BI7A 2ZBTA 1JUEA 4ICNA 1OX4B 2X1SA 3G0XA 4FNSA 3M47A 2NXGA 1MEWA 4YMZA 4AWTA 1PE1A 2C0AA 4H3DA 1VHCA 3C2RA 3TC6A 3W72A 3S0CA 1ZALA 4H6KA 5D30A 5LKYA 4A2SA 3W7LA 1YDNA 3THAA 1TV7A 1SU5A 2CLHA 4OE7A 4IMFA 1IGSA 3LBMA 3TXVA 1H1ZA 1LYXA 3S1WA 2VEKA 3HPSA 1W0MA 3W73A 4WY0A 3RU6A 3IIZA 1VR6A 1AMKA 4WOZA 5D38A 2CWNA 5AHNA 5D05A 1LP6A 2WSQA 4UUIA 3LCIA 3IGUA 4JTJA 4QQ3A 2Y7FA 3BGJA 3HG2A 5F4XA 5K9XA 2YCEA 1GEQA 2RFGA 3BGGA 4DO5A 4AVFA 4DQWA 4XKYB 1PV8A 3VE7A 3DKLA 2CLFA 3EXRA 3NQ6A 3LHZA 2E09A 2E6AA 2VC6A 4OU1A 3M0ZA 1R2TA 4LV9A 4XUGA 2J27A 3KX6A 1UCWA 4MOZA 1ZENA 2Z1BA 3ANYA 3W2UA 3KXQA 5MHBA 4Z0SA 4WXZA 2OZ0A 3DFNA 3QSTA 4NQ1A 3O16A 4UFJA 4JX4A 3GIYA 5U7SA 3N34A 3PUOA 4YCPA 4WXYA 1YPFA 3PF3A 3IIPA 4MUZA 1NFBA 3TQKA 3EX6A 1KTNA 5C55A 3W83A 1YDVA 3W88A 1O5XA 1FX6A 2ZZ7A 3CHVA 4HPXA 4AXKA 4LS0A 3NG3A 5I3JA 1P1XA 4MZYA 1JQVA 3DI1A 1H63A 5K9CA 2ZCGA 4YXGA 3OHIA 4ZL1A 2ZDRA 1H1YA 3CB8A 4AHQA 1F6PA 1LRQA 1DJNA 2PCQA 3NGJA 4ZMGA 4UFLA 1KV8A 4N02A 4DO4A 2QUTA 4FNRA 2Q3RA 2YSWA 1FCVA 1JCJA 2QKFA 3H55A 1K02A 1P4CA 1ME9A 3F03K 1VHNA 4KFOA 2ZZ6A 3E96A 5K3VA 3VE9A 3LRKA 2R94A 1X8FA 4GUGA 4UFKA 4JTHA 1O5KA 3GNDA 3W75A 3WK3A 4ZQOA 3WJZA 1OK4A 5HR7A 4DPQA 3TAKA 2YGYA 2C15A 5HINA 4M19A 5A5WA 4GNJA 3GVGA 3K30A 4J9JA 3R2GA 2X1UA 3QJAA 1OYBA 3M16A 1H60A 1PL9A 5LSMA 1ME7A 1K7FA 5KZEA 3FEMA 1TCDA 3CQ0A 4WD0A 3P84A 4NZFA 3QYQA 4Z1DA 2ISSA 5C2XA 3W7KA 2BZNA 1VZWA 1K03A 5AHMA 1AW1A 3MYPA 3UD6A 4K39A 4FF7A 2HTMA 3G1XA 2XFWA 1KV5A 1ONRA 1SQ7A 5FEZA 1RPXA 1U83A 2B7PA 1FY6A 2IQTA 1OABA 1R2RA 5ABTA 2UV8G 3PS7A 5G4EA 4O1AA 1LLWA 4IXHA 2VFGA 4XZ9A 1AL8A 2TMDA 3E49A 1B57A 1S5VA 2O7SA 3O05A 3PVFA 1FCBA 3GDMA 3ATYA 2EKCA 1FCUA 4RXFA 4UNLA 2FPVA 4UIOA 1GVSA 3PM6A 3QSRA 1DJQA 3PSWA 4MJMA 4MLJA 3E02A 1WV2A 4GRSA 4DF2A 2ZZ5A 1KTBA 1O4UA 5G1YA 5BRBA 4O0KA 1OFAA 1WOBA 3SFKA 4PFMA 4YL2A 1A50A 2WJZA 5HQEA 4O1DA 5H91A 1HTIA 3PULA 4DBDA 4QJ1A 2VOMA 3CLMA 4NNCA 3WJYA 3MWAA 2NWRA 3A9IA 4DXVA 5C5YA 4LRSA 4ADTA 3LTPA 3O6YX 5AC6A 3P7YA 3NL2A 2A85A 1GVOA 5DCDA 4AHPA 3LM7A 2G5WA 4JTGA 5D09A 2E1DA 1T96A 3NQ8A 3NPXA 4QIUA 3FKKA 4AEOA 2QDHA 3TMQA 2Y61A 3GX9A 4RX0A 1KBIA 2H3BA 3W2LA 3AO0A 1YYAA 3CU2A 1H7XA 3UWZA 4M6PA 2QCNA 2Y89A 1VRDA 5TQLA 4IGHA 3MHUA 1FUYA 3LX9A 1Z48A 1TQJA 2KZHA 3G8RA 4GWEA 2RDWA 2C13A 2E5CA 3O6DA 1D3GA 1TMHA 2V5BA 4JTEA 2BSLA 3EXTA 2YW3A 1D9EA 4XTIA 4O4WA 5FESA 3BK0A 3EWWA 1J2WA 3QPZA 4KFPA 5CPOA 2V8ZA 2VFDA 4MFDA 3MYOA 3LRLA 2HS6A 4P61A 3C52A 4LVAA 3TSMA 1QO2A 3NPUA 1MZHA 2AAMA 2A7RA 4O1BA 2F7FA 2QAFA 1JQXA 4C1KA 4GUJA 4NXSA 2C6QA 1XBYA 3EKLA 4O10A 2G95A 3TXZA 3NQ2A 3QEZA 4OHQA 1OFPA 3W7PA 3TU9A 2EGZA 4OQVA 3PBYA 3UZ5A 1GG1A 3KVJA 4FNTA 3W9ZA 1L6WA 2NXIA 4ORMA 1KM6A 2WNZA 1I2OA 2Y7EA 2XN1A 1IXPA 4O14A 3B0VC 1VC4A 1B4KA 3C6CA 2VXNA 1X1OA 2CW6A 4N9DA 1YXDA 1EP2A 5CSRA 1L6SA 1LTDA 4R33A 3STFA 2CLOA 3KVLA 3ATZA 1KM5A 3F4WA 5D2WA 3T40A 3PBVA 3BLEA 2TYSA 1M6JA 2CLKA 1OG0A 1FDYA 1A5AA 1MXSA 5CSSA 2Y7GA 3M1ZA 5J5DA 2EAWA 3LTYA 2H6RA 4MY1A 1KFEA 3LV6A 3N9SA 4GJ1A 3LCFA 1JCMP 3LRMA 1TPWA 1VQTA 2YFNA 1ZAIA 2YX0A 1A5BA 2B7NA 2NZLA 2CZEA 2WKJA 3GYEA 4MYAA 3GDKA 5F2IA 1RQEA 1QOQA 4N2YA 4P2VA 2Q8ZA 1K8YA 2QJIA 2R91A 2NLIA 5CKSA 4O15A 2V9DA 3NQDA 3S5YA 4Q4KA 5L6UA 1O95A 3L68A 3DH7A 1H50A 4TR9A 3I7QA 3G1FA 4HPJA 1EEPA 4JY9A 5AYYA 4I7UA 3HGRA 1ZJIA 3MI3A 3G1HA 4HSNA 5F1VA 1W5OA 4IMDA 4C1LA 3FS2A 1FWTA 4JX6A 5F4SA 1CI1A 3DZ1A 4TO8A 5LGZA 4MZ1A 4FEZA 2YXGA 1FQ0A 2PC4A 3Q94A 3LHVA 4IXXA 3N73A 1OF6A 2DORA 2CLIA 1JJKA 3LLFA 2WQPA 3G3DA 4S1FA 2Y6ZA 2E6YA 3IIOA 3A22A 3QQ1A 1GVFA 1T99A 4HNUA 4YLWA 5DXYA 3NR0A 2C16A 3IVSA 1PCWA 3UZJA 3QMTA 3W07A 3GR7A 3VKJA 1JR1A 3W7CA 3NM1A 1LRTA 4JTUA 3TV8A 3LI1A 4WX2A 3W70A 3LHYA 3S8HA 4XKYA 5D2VA 3LI0A 4O12A 3W23A 5DCBA 3USBA 4EF9A 1SUXA 1QDSA 3G1AA 2A1YA 3LTSA 3LV5A 3SR7A 4WZHA 1TTJA 2VEPA 3S5OA 2E6DA 1W5NA 3PWAA 1RQHA 3W7HA 4DF0A 5G1TA 3TW6A 2PRLA 3KOFA 4YWIA 5FF2A 4LC6A 1W3NA 3W1RA 3HBLA 2AQWA 4IMEA 1WDWA 2CU0A 4ZQRA 4D2JA 4QAIA 3NOEA 3B8DA 1IXOA 3W76A 2GVGA 3Q37A 5HJLA 1V5XA 5D33A 3KRZA 3T4CA 1TQXA 2X16A 4JYEA 3NQGA 2FFCA 3NL5A 1KM0A 3V75A 3D0CA 3QF0A 4R53A 3P61A 5FEPA 3WK0A 3Q2DA 1R2SA 3STEA 1GWJA 1VCFA 4I7WA 5G5IA 1IIHA 2GJNA 1UBSA 4IPJA 5KTLA 3O8AA 3N3MA 3GR8A 2GPTA 1H7RA 1WYIA 4LC8A 4UR7A 3LCGA 1OF8A 4O11A 5DLCA 1KM2A 4ALDA 5D32A 3L0GA 4M7TA 2VFFA 2A4AA 3NQVA 3M6YA 3HJZA 4NJJA 5LNWA 3G1YA 1EP3A 2B7OA 4AAJA 2RHGA 3TA6A 3B4UA 4PL1A 4N9CA 3B06A 3RF9A 3L0KA 2NV2A 3TMLA 4K8EA 1A5CA 1QR7A 2G96A 1DORA 2CFFA 3W7NA 4AWUA 3BW3A 3GDRA 3NDOA 5F1UA 1JRCA 2VEIA 3W1AA 3RLUA 4E0CA 2E5DA 1ME8A 3O15A 3W7EA 4TIMA 4N4PA 3MJYA 1BKSA 2RDTA 3ABOA 3PB0A 1TPUA 2HS8A 1KM1A 3DFQA 4FNPA 4CCDA 3T7VA 3B0PA 2RKXA 3G0UA 3EWUA 3BLIA 4O54A 1ALDA 2J9XA 1ZCOA 5AHIA 3WJWA 3MBFA 3N14A 1U5JA 3SJ3A 4BWLA 5FEXA 1OX5A 2EHHA 4UMAA 5DY2A 2NX3A 2ZRZA 5D03A 3UWUA 3O06A 5AFDA 4EWND 1S5TA 5AOUA 3S1XA 2BXVA 3LERA 1EUAA 4JTFA 3L65A 4HNVA 2A6LA 2GQAA 4YCOA 3BW4A 2C3ZA 1QWGA 3MHGA 1GQNA 4IX0A 2QCDB 2A6NA 1L6YA 1T0OA 4LU0A 5BOOA 3QH2A 3W7JA 4UTLA 2A0NA 2B7QA 5H2ZA 4O53A 4BI5A 5DBTA 3G18A 3TE9A 1NF7A 2CLMA 2PURA 1Z42A 1UJPA 2FPTA 5I3FA 4UMCA 3RFAA 2R8WA 3DENA 3MP3A 1BTMA 3PY2A 4NNAA 1QPNA 1O94A 3KFTA 4ZQCA 4M6QA 3OIXA 5CPMA 1N7KA 2FB2A 5FEWA 1KM3A 1EIXA 4O28A 5K4ZA 5AHLA 3NL6A 1WX0A 5BMXA 2X1RA 3INPA 3N2MA 5IBXA 2E5BA 1HFBA 3I65A 3W2NA 1R46A 4HKPA 4PC8A 1XUZA 4JD4A 3W86A 4Z1CA 1G4EA 2DJLA 1ML1A 1HO1A 3VI2A 3DBPA 2ABBA 3A21A 3PUEA 1R30A 3CTLA 1YPIA 4A3UA 1YTDA 1FWSA 1AL7A 1GPWA 4JDBA 4MLRA 4UCGA 5IM51 3R12A 1QFEA 4PCFA 2NX1A 3LDVA 2GVJA 4AWSA 2V0TA 1MSSA 4PEKA 4G1KA 1OYAA 3NZ1A 5AHEA 1XBZA 5K2ZA 3PB2A 5CG7A 3QM3A 5AHFA 4TX9A 5G2HA 3W1PA 4POCA 1SR9A 1RV8A 1SZGA 2YYTA 4JYFA 1S3HA 3HGSA 2EF9A 5BW6A 1Z41A 2NWSA 4OT7A 3TKFA 5DY3A 3P62A 3I6RA 2WPBA 4JTSA 5AC7A 1SO3A 1TPB1 4QITA 4BI6A 3TW7A 1ZY9A 4Y9AA 4O4VA 3W1NA 1QAPA 3CM4A 1GOXA 1PS9A 4CQAA 3B0UX 1NSJA 1VYSX 2PE4A 1SO5A 5AYZA 1IXNA 1XDLA 3IRDA 3IVTA 4ADSA 2V82A 1XM3A 3DXIA 1EP1A 1YXYA 3FA5A 3T44A 1OFBA 3UY8A 3HGOA 4K37A 3UYCA 4NJKA 1UASA 4CLMA 3GDTA 1ICQA 2QCHA 4PH6A 4M5PA 2QCLA 3ZWTA 1JULA 3JRKA 3W2KA 5EBUA 4ADUA 3EX1A 4NT0A 5EL1A 5F2MA 4Z08A 2Q3OA 3HPXA 4FHAA 2Y62A 4S2BA 1LZOA 2B0MA 3LGEA 4IWWA 2QCGA 3DU0A 1EUNA 1OX4A 1HG3A 2ZRYA 1FWNA 1SO6A 3NQEA 4KFNA 4JICA 3M9YA 1LROA 5KINA 2BX7A 2QCMA 5HUOA 2V30A 3NA8A 2JKAA 4KWWA 4E2DA 2VENA 5LHEA 3N19B 4CNOA 1ZNNA 3OG3A 2H8ZA 4HN4A 1FXQA 3NQFA 4TMBA 1I45A 1N8FA 1TIMA 3NQCA 4LOCA 4KWVA 1VCVA 4GUFA 4K8HA 5CPNA 1TPH1 2OT1A 4MKNA 3A5FA 3BPWA 1TSIA 2I9EA 3BW2A 1SZNA 1GG0A 1VCGA 5KMYA 1JCYA 4IMCA 4UNKA 2YYUA 4RZ4A 4Q33A 3PBUA 1H5YA 3E9AA 4OV9A 4CNNA 1KFJA 3CC1A 4E2BA 3VFLA 5EY5A 3TUUA 3P82A 5LNRA 2VFEA 5EKYA 4RKAA 3V1PA 1PVNA 1OX6A 2R14A 3UXAA 1F74A 1H7NA 5I3KA 1QO5A 1DQXA 3BARA 1F05A 3VNDA 4AHOA 2NX9A 3BLFA 3QZEA 4FO4A 5D2TA 4FNQA 3HO8A 5D2YA 5E0KA 1F2JA 2GQ9A 4DPPA 3H53A 1W5QA 5AN7A 4DEFA 3PG9A 3I7RA 3P5YA 4I9AA 2FTPA 3L66A 1RZMA 2QUUA 3OVQA 2ZTJA 4JY8A 5A8GA 2FQIA 3QMRA 3BG3A 4LRTA 3GLCA 1IXQA 1H7WA 2FB3A 2TSYA 3GK0A 4X22A 4ONVA 3NO5A 4N6FA 3JR2A 1MO0A 2QCFA 1GZGA 2AGKA 3M5VA 3TDFA 1FBAA 3O07A 2I1OA 3HMJG 2ZA1A 3LCLA 4MPQA 4ZZ9A 3L67A 3G22A 2WNQA 3S1VA 2QJGA 3BG9A 3TJXA 3CT7A 5KZDA 4OV4A 4FXSA 4L4MA 2TPSA 1DBTA 4JTLA 3OEXA 4BR1A 2BLEA 4O50A 2DZXA 3TR2A 1X7FA 3UQNA 3TCEA 4AMAA 1SW7A 2V81A 1K8ZA 4M7SA 4EVZA 1DVJA 3KHJA 4O57A 4Z0JA 5T26A 2QEZA 2OJPA 1AG1O 3EXSA 4JS3A 1LOQA 3GKAA 2QAPA 1G67A 5D02A 1QCWA 3CEPA 3P74A 1GYNA 5EYWA 4IJBA 4IMGA 1WAUA 4UTIA 1TPC1 1YADA 3G8EA 2BTMA 5G2WA 5HMSA 1K8XA 3UNDA 3L2IA 4K36A 4ZQPA 3G1VA 1OFRA 3TNOA 3GDLA 1P5BA 3BO9A 1DL3A 4ZQMA 3L5MA 3GNNA 3UWWA 2H90A 5L9FA 1G4TA 2C18A 1OFOA 1ZFJA 2J88A 1JCLA 5C54A 3W1MA 1OFDA 2CZ5A 1TTQA 3DFPA 3BVJA 3C2FA 4PODA 5TIMA 3LHWA 3EEGA 2ZZ2A 4PTNA 1SW3A 3MMTA 3GXPA 3SGUA 3EB2A 1JCXA 2A5HA 3THQA 3FKRA 5HUPA 1TYGA 1KA9F 2VKZG 2I14A 1ICSA 2D73A 2RDUA 2CZFA 1JRBA 1AK5A 3SZ8A 4OBTA 1KLZA 1ZHAA 4JN6A 1TPFA 3DKJA 5CZ0A 1DHPA 4GC4A 1UB3A 3W7IA 5F2LA 1K3UA 1YXCA 5DELA 1TB3A 4NJHA 3NZRA 4AF0B 4EF8A 2CLEA 2Y63A 3EX4A 4FXRA 2QJHA 3FFSA 3TIMA 1QPQA 3W1QA 3FLUA 4JTTA 4O13A 3PAJA 2QCDA 4LWWA 6ALDA 4GBUA 4BWLC 4W9TA 2NUXA 5CGQA 3GZ3A 1OVDA 3TQVA 3CIWA 4FB7A 2XN2A 1WXJA 1W1ZA 1W37A 2YR1A 5HWNA 3P8JA 2ALDA 1SO4A 2RH9A 4CCEA 3NYZA 1QPRA 1NAL1 1KFCA 4MFEA 3C3NA 3L0NA 5HNRA 3STCA 3L21A 4QNEA 3UWYA 2QCEA 3RMJA 2JK2A 4WUIA 3YPIA 2A7NA 4UFHA 3HGJA 3B05A 4RK8A 3SSJA 3W2MA 1G4SA 4CNPA 3SW6A 3HIJA 3LCXA 1C29A 1LOSA 3DHDA 3PR2A 2QF7A 1TPEA 2YFOA 1S5WA 2Z6JA 1B3OA 5FF0A 2E6FA 3MBDA 1EX5A 5BMWA 2V2HA 3EWBX 1W54A 1D3HA 3T78A 4O52A 1A5SA 1OFEA 4H4IA 3I68A 3MI6A 2E68A 3Q58A 3ABRA 3N9RA 1JUKA 4NJGA 2H8XA 3LXAA 2VFHA 2DZPA 1FDZA 1J4EA 1XL9A 2OT0A 4DELA 4RV8A 1O60A 3OBKA 1WA3A 3MUXA 3VCRA 3B03A 3WJXA 2V2DA 1I2RA 4LY8A 1L2UA 3P81A 5IBXC 3W7GA 1BWKA 4IQLA 2ISVA 1TPVA 4WQ6A 2GJLA 2GVLA 4XBSA 3E12A 3C8FA 3L5AA 1TJPA 1GYLA 3GB6A 3QC3A 4UMBA 3STGA 4HIBA 1VYPX 3NM3A 4ZVJA 1JVNA 1B9BA 4FX7A 3GXNA 3FOKA 1GVQA 5I3GA 2GOUA 1GTEA 5J5RA 1SSGA 4JYDA 2A7PA 1WOAA 2P0OA 1I8JA 2JBMA 5CPLA 1G69A 3G1DA 2DZTA 4XBKA 1PCKA 1EWDA 3W1LA 3O6CA 1DOSA 1LM1A 3JS3A 2VEMA 4K7VA 5GVJA 2ISWA 3UXDA 4X9SA 5FF4A 1LLZA 3HB9A 1NVMA 2C19A 2ATMA 2X30A 4CQ9A 4LVBA 3W22A 1RD5A 1LDCA 4NX5A 1XFBA 4RXGA 3LXCA 4XQ6A 2W0UA 3HG4A 1G4PA 1VH7A 2WSYA 4PA8A 3MI2A 4LTSA 4UXDA 2FLIA 4IX2A 5LHFA 4NUWA 4XTDA 5D2XA 2FDSA 4KKXA 2ZRUA 1H61A 2YZRA 3SECA 2BWGA 2W6RA 4LNYA 4A21A 2DZVA 1FXPA 1OHLA 3NAVA 1H7OA 4AF0A 1VLWA 3F1QA 1GVRA 1GT8A 2ZRXA 1NF0A 3RNDA 1WBJA 3T55A 3PG8A 5DXXA 2OX1A 4NNBA 1YLVA 4ORIA 1EB3A 4LVGA 3WJSA 4Y8FA 3N2XA 2NXHA 3C2EA 3P80A 1I2QA 3KVKA 3UY7A 3WK2A 3HOJA 2V5LA 3NNTA 4BK9A 4DF1A 1CW2A 1UUMA 1Z44A 1KBJA 4OWGA 1EA0A 1LOLA 2WSRA 4BF9A 3QRHA 2ZQ0A 3LB0A 3HQ1A 1OK6A 4O16A 1HUVA 1F7BA 3DHFA 4DBEA 1I4NA 2TRSA 1BWLA 4RZ5A 4QNWA 4LW7A 1W5MA 3MP5A 1KLYA 3M43A 5KSWA 3L9CA 4AH7A 4QSHA 3HPZA 3HG5A 1P0NA 2WV8A 1SZEA 3DGRA 3MW7A 1SZFA 1Q6LA 5K4XA 5KZMA 2C14A 1LBLA 2DZUA 3P67A 4UTUA 3M41A 5LGXA 5DCEA 1H51A 3LLDA 3DAQA 1FCQA 1IF2A 3M44A 1A53A 1TRIA 2NUYA 2Y70A 3FJLA 4NX0A 3W71A 1TV8A 1XXXA 3BG5A 3EWZA 2QR6A 1BEUA 3PBWA 4IOTA 5C6MA 5LZLA 1GJPA 1UUOA 5K9DA 2Q8LA 4N9EA 2WOQA 1LBMA 3QW3A 1PHQA 3W3OA 3CIXA 5EMUA 2GQ8A 4GFSA 1VGAA 1VPXA 1WQ5A 3W7OA 1XBVA 4JTIA 3GAKA 4WJEA 1XDMA 4U4MA 5I3IA 1CX9A 1HL2A 1M7OA 4N4QA 3U2OA 4HSOA 1GTHA 4JIQA 1TO3A 3TX9A 4IPIA 3QPYA 4HNTA 2ZTKA 3SI9A 5HWMA 3A24A 1OFQA 3KAOA 3TSDA 4UFMA 1FWWA 3W7DA 5CZTA 3O1NA 1DKWA 1W31A 4AB4A 3IIVA 1TRDA 3IEBA 5KITA 1H62A 3OA3A 3ZWSA 3NEVA 1VYRA 4NXKA 5DBUA 3I7SA 3W1UA 3W85A 1KFLA
chains in the Genus database with same CATH superfamily
3N4EA 2WVVA 4W86A 5ABHA 2BFGA 2JF6A 3EKZA 4GI9A 3M0VA 1VAHA 4GE8A 1VIWA 2GUUA 5I3HA 4LYPA 2DJXA 1HGWA 4IQEA 2ZWZA 1UD6A 4IH3A 2WVUA 4LB3A 2LLEA 3A4AA 2Z4GA 3ABQA 3WO8A 2C7FA 2PLJA 2CNCA 5FI8A 2VM8A 5AC4A 2YPIA 5ABFA 2ZX5A 4NZ1A 1QK0A 1JUBA 1LUCA 1VP5A 5CPQA 1DWHM 2YCIX 1UP3A 1VRXA 3B8IA 3P60A 4HMEA 1V7YA 1Z6KA 1UD4A 2VCBA 1PIIA 4FLSA 1R3VA 1XI3A 4DO6A 1DJYA 2BNJA 2G37A 5HOSA 4JIHA 3S47A 1ZJHA 2GK1B 1L9WA 1J5TA 2W67A 4QAWA 2X2GA 3NXFA 1W5PA 4E2VA 4AX6A 3GS6A 2PWDA 2ZA2A 3DUGA 3GAYA 1NEYA 5LYRA 3WY1A 1TVPA 3H54A 2J25A 2WNWA 1MQRA 1OYCA 4EXBA 1KM4A 1Y5XA 5CAKA 3SCTA 2FMOA 4JIPA 4NKCA 1P0KA 2QDGA 3RLVA 1ADOA 1Y5WA 1KFKA 4LVDA 4D6FA 1QI0A 4UTMA 4BFAA 1VLIA 3HPAA 3AAMA 3R13A 1RLCL 2A3EA 2WZTA 1SW0A 1YBQA 4I3GA 3P8IA 3UPWA 1V3IA 4O19A 1RVKA 4Z2HA 3Q4DA 2HE5A 6XIAA 3LXBA 5FOOA 2Y85A 4PUNA 2AGTA 2NLYA 4HT3A 4XG1A 2V68A 2WZMA 1Z7AA 3NQAA 4LB4A 4M6VA 2P0IA 1PKMA 1A3HA 1XRFA 4CCZA 2Y88A 3GNRA 2GQ3A 4KGLA 4Q22A 1UH3A 4QS6A 1MEIA 4LUSA 3OB8A 4YHEA 3WK1A 4Q32A 3WL1A 3WDIA 1YNQA 1P48A 3O3RA 1CWYA 4JX5A 1FWHC 4QLKA 4ZQNA 3K4WA 3E5PA 2JKPA 3G24A 3KBVA 1V08A 4JQ4A 1I0BA 3QR1A 1XUUA 1B4EA 1VIZA 4GQRA 3PPFA 2YDAA 3ITTA 1XINA 1T8XA 5CZSA 2WMIA 3FXGA 1K8CA 3ZVHA 3LBCA 1ZAHA 3CWOX 3FSTA 2CITA 3BZJA 2BVYA 1Q7QA 4NU7A 1FWRA 1D7KA 4F66A 4YTQA 1FFRA 1A49A 2Y8UA 2PLKA 3GG7A 1BVZA 3ARXA 2OCZA 4QJ4B 2ZZ1A 4FF5A 4H2CA 4H9MA 2O92A 4UTKA 3M0HA 4HHPA 2XVLA 3UETA 1RD6A 3B9EA 1JZ7A 4AVNA 3AXIA 3C4UA 1UG6A 5MF5A 1NU5A 3LNPA 3GWQA 4MZ8A 1BXBA 3QN3A 1ISYA 3W7RA 1PWMA 4LUJA 2X09A 2X1IA 4D6IA 4ZOEA 3QFEA 5LNSA 1EJWC 3ES7A 3AJXA 3M7WA 2X0HA 5AB3A 1THFD 2NQ5A 4HP5A 3BSMA 3WELA 1OC5A 2C8NA 3QOMA 3HG3A 4TU1A 4HJWA 3T6CA 3ITCA 4LS1A 3AOFA 4I7VA 4J35A 1UKPA 3FN9A 1Q45A 3G1SA 7ODCA 3NVTA 1JGMA 3LPOA 3AUOA 3M5YA 5E0CA 4S2CA 2ZE3A 5M03A 1E73M 1R47A 4MJZA 3S2LA 1SZRA 4J2PA 3VO0A 3WX7A 1WZMA 2ZA3A 2J6XA 5HXMA 1TZZA 3AYTA 4CVWA 3DFYA 3JW7A 3R58A 2FKPA 1W8SA 2XIQA 4H04A 1ADDA 1B54A 3W84A 1XC4A 1RR2A 1C8VA 3TTOA 1TPDA 3RK8A 2X1TA 1V0KA 3UPBA 3GO2A 5CJNA 2WC4A 4NASA 4LH8A 5K7JA 2EG8A 4YN5A 4NVTA 3BAJA 4P8WA 5GJPA 4H9ZA 2XIBA 4WY0F 3AXHA 1J10A 2Z28A 3D5HA 2Z2UA 1JD7A 1QXLA 1EGZA 1AW5A 3G3MA 5FF7A 4FIRA 3R89A 3EWXA 4B3ZA 3BQ5A 3H4WA 5CZKA 3KW3A 2QCCA 1X96A 2FZMA 2OEKA 3MJMA 1RVGA 1YTKA 3RJXA 2JGYA 1DIOA 3S42A 1JPHA 1RAKA 1XISA 4LT9A 4ZOCA 1OX4B 2X1SA 3G0XA 4NL1A 4FNSA 1G94A 4U33A 1E9YB 2C0AA 4O8AA 3S0CA 1RCXB 2V3GA 2WVVB 1O66A 3W7LA 2ZIDA 4H9TA 1TV7A 2IS7A 4IMFA 4H6RA 3LBMA 1XS2A 3GFZA 4IHCA 4A4AA 4DZIA 3DIPA 3W73A 3SSZA 1FA2A 4WY0A 1VFMA 3RU6A 3VNIA 3WDJA 3BSGA 3GD6A 5D38A 1GOQA 2FGZA 1R87A 2WSQA 4UUIA 2CC0A 4QQ3A 2Y7FA 3H23A 5K9XA 4DBWA 1UR3M 2IKIA 2RFGA 3BGAA 4PUEA 3HPFA 4XKYB 3EXRA 1E1CB 4IIFA 3M0ZA 1R2TA 3LNMA 2PWHA 1JNEA 4LV9A 2OWXA 3VD3A 3CIVA 1ZENA 4AU0A 4PMRA 1B3VA 5MHBA 3GVRA 4Z0SA 3VFCA 4WXZA 1R7OA 2OZ0A 3VUSA 2FFIA 3N04A 1P0EA 3QSTA 3PUGA 4NQ1A 4JX4A 4N7QA 3JZEA 5LIKX 3N34A 1C7TA 1TR1A 3PUOA 4WXYA 4YCPA 3PF3A 2FDMA 1CXKA 2X05A 4BJHA 3EX6A 2I7GA 3I3EA 3W83A 3H21A 1F3XA 1O5XA 2ZZ7A 4V1YA 5CQ1A 3WNKA 4LS0A 5M5DA 3NG3A 4WF7A 4DUVA 3AHYA 4G1NA 2ZCGA 3WQDA 2YLLA 4YXGA 2ZDRA 1H1YA 4O1FA 1HX0A 4C6CA 2OGYA 2PA6A 3CQHA 3E0FA 1LRQA 1J0HA 3REQB 2OZ8A 4GCAA 3NGJA 1ADSA 1KV8A 4N02A 4FNRA 4FP1A 5H8MA 1FCVA 5HBFA 2ZVIA 3VNKA 1JCJA 3H55A 4PUMA 3UVIA 3E96A 3E2SA 3LRKA 1NOUA 4GUGA 4JTHA 1O5KA 4JHMA 2CETA 3W75A 2ZKMX 3MO4A 4H00A 8XIMA 3WJZA 1N8WA 1QJWA 5I24A 3TAKA 2X41A 5A5WA 3GVGA 3K30A 4J9JA 4Z17A 1K7FA 3FEMA 4FLOA 4Y9PA 1DP0A 1UWRA 4NZFA 1VJZA 4GPNA 1EBHA 3MYPA 3UD6A 2BHZA 3IJLA 2PAJA 4L80A 2VDHA 4D8AA 5FEZA 1RPXA 1S2UA 3H7VA 1XIEA 2B7PA 4Q8WA 4GXWA 4GD0A 2IW0A 1PWLA 1DXEA 5G4EA 1LLWA 1Q8JA 4KEZA 1B57A 2VT0A 3ERPA 1FWJC 3NWRA 3ATYA 1FWCC 2J62A 4RXFA 1GVSA 3BXWA 1H49A 1XLAA 3PSWA 4QTGA 2VHLA 4E3VA 3QR3A 2EBNA 3S9ZA 1KTBA 5G1YA 2XIJA 3TN6A 4CU8A 4O0KA 1OFAA 1AJ0A 4PFMA 5HQEA 3EDFA 3VILA 4QJ1A 3CLMA 3MWAA 4LRSA 4ADTA 3BAIA 3P7YA 1U1HA 1GKRA 2A85A 1GVOA 4CVUA 2Z24A 2PBOA 4LXFA 1WP6A 1B5TA 2PD9A 4UOZA 3WBYA 4ASTA 4QIUA 2VZSA 4AEOA 1JEZA 2Y61A 4IJCA 1KBIA 3W2LA 2OSWA 3UWZA 4UQEA 1MXGA 1VRDA 5TQLA 4I8DA 1BXCA 1Z48A 4GYKA 3AWOA 4PCPA 2KZHA 3G8RA 3LG3A 3HQPA 3O6DA 1TMHA 4IGSA 3EXTA 2HISA 4UB9A 4XTIA 4O4WA 2QJMA 1V6YA 3BK0A 1TE1A 5J8LA 3QPZA 4KFPA 2WW5A 1J5SA 3AS2A 3LRLA 2HS6A 3C52A 4LVAA 3VIKA 5GNYA 3WEOA 1XBYA 4EP8C 3TXZA 3QEZA 3DYMA 1RCOB 4OQVA 3AXKA 3IUHA 2XSAA 3W9ZA 1W91A 1QI4A 1L6WA 2NXIA 1TE6A 4AY1A 4PSRA 2PTYA 2YDQA 3S2NA 2WKGA 1B4KA 3L7RA 3C6CA 3T0AA 3PBMA 2DW6A 4ATWA 3DHUA 4MM1A 3SCQA 5HNUA 3W6MA 3PNUA 4NRRA 2XVGA 3ARQA 3ATZA 5D2WA 3T40A 5FSEC 1Q7MA 3SCWA 2CLKA 1OG0A 2VGFA 1UR9A 5I7GA 1Z3NA 4J3XA 4MDOA 1JG9A 2Y7GA 2PP0A 3N11A 1ZCCA 1SGJA 4GJ1A 2PU1A 4C7DA 1BYCA 1ECQA 3LSBA 1W9XA 4ZXOA 1ZAIA 2BB0A 4L6OA 1DPMA 1RK5A 2B7NA 4C91A 1YEYA 1C8YA 4N2YA 3EDEA 3RLHA 1VFFA 5CSYA 3KRBA 1MXDA 3MCMA 4AZGA 2NLIA 4GY1A 5CKSA 2CKSA 1Y7VA 2V63A 3UXLA 5L6UA 1KCKA 3CZEA 1EEPA 3KEHA 4W89A 4F2TA 3MI3A 4B9ZA 2V5JA 4JKKA 1XLCA 1FHLA 3PN8A 1E72M 4E4UA 2QUMA 3PWGA 4IFKB 4GGBA 3DZ1A 5LGZA 4MZ1A 2I9UA 2YXGA 1FQ0A 4G56A 2VR2A 3Q94A 3LHVA 2DORA 2CLIA 4GVFA 3LLFA 4I8YA 2UY5A 3KOXA 4V15A 1GK8A 4X0VA 3IANA 4HZ6A 5HNTA 3OVGA 3IIOA 5JIWA 3GXFA 1AQMA 3DCPA 3W6LA 4YLWA 3UZJA 4AC1X 1JR1A 2W91A 2WVTA 1VPQA 4S3BA 4JTUA 2OO0A 3LI1A 2BY2A 1RSCA 3QY6A 4L56A 3KWXA 3W23A 3USBA 1CT5A 3SR7A 1W2VA 2ASHA 4DLFA 4KF1A 2VEPA 4HMDA 4KPLA 2E6DA 1X1NA 3TW6A 2PDUA 3CNYA 3HV8A 1R9XA 3WD3A 3WCZA 4YWIA 1KC7A 3EEZA 3W00A 2HNHA 4BZYA 2XHYA 3MB9A 3N18A 3BAKA 4NRSA 3HBLA 1Z9AA 1EQPA 5AECA 4X2PA 1WDWA 4M24A 4GY0A 2P8CA 4QAIA 3NOEA 3B8DA 1IXOA 4H9UA 3GXMA 5I06A 1XYAA 2GVGA 3N17A 4XX6A 4X60A 5D33A 5BRPA 4JYEA 3NQGA 1MVYA 3NL5A 2D69A 1YHTA 5FEPA 3TC3A 2WMKA 4YVXA 3BMVA 3Q2DA 1WXYA 3ECQA 3IS4A 1DE6A 2YBTA 1UBSA 5C9WA 3N3MA 2GPTA 5D9PA 2P53A 3EA2A 4LC8A 4UR7A 1OF8A 5DT5A 2X0SA 5DLCA 2IKHA 1UZ1A 4EXAA 1KD0A 5DANA 3G1YA 3SEPA 5E09A 2FZBA 2QZRA 5XINA 2ESCA 4AW7A 1MWOA 2YLAA 3VMPA 3TMLA 4K8EA 2C91A 1K4HA 2JE8A 1DORA 3BAYA 3VZXA 3PZUA 1ZQ5A 1BGGA 3W1AA 3RLUA 3KZSA 4FPSA 1UA3A 2E5DA 5ECVA 1EBGA 1CLVA 3W7EA 1QATA 3MJYA 2YCJA 3OU8A 3PB0A 2HS8A 5HK4A 5C9XA 3RRAA 3KWSA 2VC9A 5A8NA 3MT1A 3BLIA 3V35A 2J9XA 1ZCOA 1U5JA 2WZEA 1GUVA 1E0WA 4UMAA 4XAFA 2WHLA 4XO6A 3I6EA 2PP1A 2XH4A 3UWUA 3N12A 3E0VA 4GJJA 1KXQA 3LERA 2WJEA 3FGCB 3L65A 2DGAA 3BW4A 2WC3A 4X9YA 4LSBA 3WL0A 1GQNA 1CGXA 4IX0A 2QCDB 5BROA 4UTLA 5FJTA 3ARZA 3AHZA 4M56A 4OTKA 4E3TA 5DBTA 1NF7A 2CLMA 5DT7A 4UMCA 3RFAA 2G4FA 4M1RA 5BU9A 3VXGA 3EBVA 1TV4A 4NNAA 1O94A 3EKGA 3P0XA 3AWNA 1EGVA 1N7KA 1VBRA 4CEUC 2XFFA 3N2MA 1ZSXA 3FY1A 1AJZA 1R46A 4HKPA 2CLPA 1UH2A 3JZUA 3W86A 1AJ2A 5A3HA 1NH6A 3Q67A 4K8GA 3LA4A 5E6YA 1ELSA 4NHVA 3KDNA 1YPIA 2FHFA 1FWSA 1GPWA 4JDBA 4CN4A 4KS0A 4MLRA 5IM51 3VIJA 1KNWA 3WENA 3L4TA 1Q65A 3FYYA 2NX1A 3LDVA 4AWSA 2YB1A 2OGJA 4PEKA 1XBZA 3PB2A 4US5D 4TUFA 5AHFA 1SR9A 3UERA 1S3HA 3WLIA 1CTNA 4GY7A 5EFFA 4GQ0A 2W3ZA 1Z41A 3S1GA 3EA1A 2OYLA 3TKFA 4OBRA 5DY3A 2WPBA 5AC7A 3UJSA 3I3DA 4D9PA 1M3UA 1FKWA 3KBJA 3KL3A 3W1NA 3CM4A 1GOXA 1CEOA 3B0UX 2PGRA 1NSJA 1MRQA 4OJYA 1W1YA 4FR1A 4DWDA 5AYZA 1XDLA 2FH8A 4IQJA 5AVHA 4ADSA 2V82A 4U31A 3T44A 8XIAA 3P3BA 5CLWA 3HGOA 3TW9A 4K37A 1UASA 4WKFA 4CLMA 1ITCA 1JULA 2BGNE 4Q4QA 4ADUA 5A2BA 5F2MA 1HVXA 1DYSA 1IT7A 4QEEA 2W4XA 2Y62A 3H2CA 2B0MA 2QQ6A 3VMNA 3M6DA 5REQA 3OJGA 4MNKA 1FWNA 4NG3A 1CXLA 4KFNA 4GZIA 3WDHA 2D2JA 1TV3A 4UTFA 3NSNA 3BH4A 4PCNA 2DY3A 4L65A 1O68A 4CNOA 4AWEA 3NQFA 4KEUA 4KWVA 3ARYA 1IT8A 4K8HA 5CPNA 2QS8A 3SRFA 1TSIA 2X0YA 3BW2A 5KMYA 1JCYA 4EAYA 1RBOB 2YYUA 4RZ4A 3PBUA 2Y5SA 3CC1A 7REQB 3WQEA 4ZSUA 4G7EB 5LNRA 2INFA 4QDPA 3BCDA 1XGZA 3UXAA 2O4QA 1F74A 4GZEA 2DQXA 4P8UA 3B8UA 4AHOA 2NX9A 3CT2A 4KH2A 3BLFA 3EGJA 4FO4A 5D2YA 1KBBA 1W5QA 4G7FA 2XVNA 4GIEA 3I7RA 3P5YA 3T4WA 5D9OA 4I9AA 2FTPA 4XZBA 1WB0A 3OVQA 2ZTJA 4WVXA 5A8GA 5I23A 4IQDA 4LRTA 4XZWA 4PMVA 2A3CA 4ONVA 4YYCA 2VZUA 2PGWA 4C7FA 5GNXA 1K9EA 3ANVA 3O07A 3W27A 1PTDA 4MPQA 3G22A 3AROA 3W02A 4V2XA 3SB0A 4YS1A 3ME3A 4FXSA 2TPSA 1ZBVA 4LNCA 4YWSA 1FHVA 4G9PA 4MMWA 4D1IA 3WMBA 2QPUA 1KKOA 2DZXA 4A6GA 2ZX9A 4AMAA 4C6MA 2EPKX 3KL5A 4EVZA 1TJ2A 4ECLA 2QLYA 3EXSA 2DFAA 3LLXA 5B80A 1LOQA 2WMJA 4ZE4A 4KWOA 1RUSA 3VYLA 3LPFA 2WCAA 4IMGA 1WAUA 4UTIA 3CGTA 4C6PA 3VDCA 2BTMA 1ENUA 3RGTA 4K36A 2VZTA 3H2FA 1OFRA 4QFUA 2JIEA 1NP0A 3N9KA 3WIJA 4U3AA 1G4TA 1OFOA 1ZFJA 2J88A 2ZX7A 2DW7A 3DFPA 3BVJA 1F4AA 4PODA 4Q6XA 4EXQA 3EEGA 5EB8A 3K8KA 2WLYA 3VOHA 3EB2A 3DYPA 2NQJA 5C9RA 2I56A 3AS3A 2VRQA 3GC2A 4DO7A 1GZJA 3W53A 2D73A 5IDZA 1ONEA 3KDOA 1JRBA 1AK5A 4LUTB 3SZ8A 3V16A 5HMFA 2GVYA 3RO8A 1TWDA 2HEJA 3SGGA 2HDJA 3DKJA 1EJ7L 1E4NA 4S3DA 5DELA 4AF0B 1H3GA 2TAAA 3GHUA 4NYYA 4IFRA 4XD5A 3WMCA 1T41A 2QJHA 5CBIA 1QPQA 4PRRA 3AZRA 3LBOA 2QCDA 4LWWA 4W9TA 5CGQA 3TQVA 4GI4A 2G4JA 5IXEA 3E0WA 1NWUA 5HWNA 1KWGA 3DEQA 2ALDA 2RH9A 6CGTA 1QPRA 2XH7A 4F2BA 1W9VA 3M0LA 4NZ5A 3STCA 1AQ0A 2OWWA 3C86A 1IZJA 3RMJA 2JK2A 3YPIA 2GOKA 2A7NA 3HGJA 4R27A 4YU1A 5LIUX 3W2MA 4B9YA 1LQ2A 3LCXA 1TX0A 2D0FA 3PR2A 2QF7A 2YFOA 3IWPA 3EMQA 1XF0A 4S3EA 2VGIA 3MBDA 2I57A 1CGYA 4H4IA 1TZ7A 2H8XA 2H9AB 3LPPA 1R38A 2J79A 2OT0A 3ALGA 4RV8A 1O60A 4LAMA 3VCRA 4LY8A 1IEQA 3BUVA 1UYQA 3U57A 1KGXA 1TPVA 3C8FA 3DG7A 4RNHA 4F8XA 1PTAA 3STGA 1M04A 1B9BA 3WLHA 1JDCA 1I8JA 1UA7A 4ACYA 6TAAA 3G1DA 4XBKA 1EWDA 4JTDA 1DIKA 2PDQA 3CZLA 1ZTVA 2BOEX 4HZ8A 3UXDA 2NV9A 3UR7A 3OA5A 5FF4A 1BTCA 3RIKA 2C19A 4TTUA 1I75A 5F7UA 3T0DA 2V3FA 2W0UA 3VKDA 3L2MA 4PA8A 2WSYA 5BYWA 4H01A 3BDKA 1A47A 4ILSA 2Z1SA 5AY7A 2FLIA 2E25A 7XIMA 2BMBA 1FWBC 2PDHA 2BHYA 2YZRA 3SECA 1J0ZA 4WSKA 3VAVA 4LNYA 3H2OA 4K2SA 4F0LA 3H2NA 1OHLA 2GGJA 4JTAA 1H7OA 5BOFA 4CU7A 3BCFA 3RG6A 2O55A 3EPNA 3XIMA 3PG8A 4IGNA 4Z1YA 2OX1A 4JPGA 3N2XA 1E15A 3HOJA 4KCUA 4Q7BA 3GC5A 1SJAA 3ARUA 1Z44A 1S1PA 3B9OA 1G9HA 3TOPA 2XSXA 3IJDA 3QRHA 1IE7C 2YZ5A 5EMJA 1UD5A 4O16A 2Z7KA 1HUVA 3COTA 1F7BA 3DHFA 4LAUA 4DBEA 1I4NA 4L4OA 3H7RA 1CCWB 4FOKA 2A3AA 2ODOA 1W5MA 3W01A 3URNA 3VABA 3L9CA 1DJGA 3E5BA 1SZEA 3DGRA 2UY3A 1HKKA 1Q6LA 2C14A 1ZS2A 3R6IA 1Q2SA 1E4MM 3DAQA 1FCQA 1M65A 3NXLA 1A53A 1TRIA 2NUYA 2Y70A 3FJLA 4NX0A 4WIWA 1TV8A 1NM9A 4DZAA 3EWZA 4CGTA 5B7YA 1XCXA 4BQ4A 1HW6A 2PWUA 2Q6ZA 5C6MA 4Q8VA 1RY8A 4ICCX 3W38A 4Q8TA 1GJPA 1UUOA 4KCWA 4GH3A 4IZGA 3W3OA 3CIXA 5EMUA 3GBDA 1UWTA 3B8VA 1VGAA 1SFTA 1VPXA 2GWNA 1XDMA 4U4MA 5CC6A 3AIVA 3T0TA 3S3GA 4MSSA 4N4QA 2ZUSA 4YTUA 3MZNA 4GNKB 4JIQA 1TO3A 1VFUA 3QPYA 1EDGA 2ZTKA 5CC5A 1P7TB 3OGSA 2CBIA 4UFMA 1QW9A 1FWWA 4E4FA 2VR5A 1Z89A 3UW6A 3SADA 5JXQA 1EXBA 4TQTA 1YE6A 3QR0A 3TWAA 4PSPA 2ACRA 3PFRA 1GOWA 3IJ8A 3SUTA 1KFLA 1UKTA 3WLRA 3ZO9A 1MI3A 1E6ZA 1XKYA 4MY9A 3GHSA 4FAMA 1J0IA 1RQBA 4ENLA 1KWKA 2EJAA 1Q3NA 2IMRA 2VWTA 3R94A 2O7QA 4DJDC 2XJ7A 3WBXA 3ARRA 1M5WA 2GYIA 1C9DA 3UGVA 3KS6A 2VL4A 4HBKA 3WQVA 1YIXA 1E9LA 2BGSA 4ZB5A 2ZYFA 5C8BB 5KZ6A 4LS2A 3NQ7A 3O2LA 3E0IA 4MYXA 1NWRA 2CERA 1AODA 3VDHA 5CBJA 3UVAA 1VBGA 3F2CA 4NAEB 4GISA 3UA3A 4TTGA 1QVBA 4XIAA 1H0GA 1XLDA 5GPRA 4IJRA 4R7JA 1TX2A 4J40A 3P0WA 1G7UA 3T8QA 3RPTA 3A3HA 2JFEX 3DFSA 4HYWA 2UBPC 4QR6A 2J7GA 4RE3A 1W9BM 1SFJA 3EMCA 4LUIA 1S5MA 1A5UA 3PUDA 4B92A 4PYSA 3G6MA 3K8LA 2Z2AA 1E6NA 2HK1A 3VIFA 1ISXA 1TTIA 3M0MA 3M0YA 3OZPA 4QCEA 1W56A 4QG8A 2C1HA 3V1HA 4L4LA 5LXEA 2AKMA 4FK9A 1C3FA 1RALA 3KHDA 1GONA 4XISA 3HFYA 3TYBA 1TTPA 2AQOA 3L5LA 3U6WA 2DVTA 1Q6QA 5G2IA 2ZUNA 4H2HA 4DYKA 1GJWA 5SWUA 2BY0A 3LCWA 5D37A 3KRSA 4E38A 4QROA 4JTKA 2FZNA 1ZBCA 1J6OA 2NQZA 2J7DA 4PMOA 1IR2A 4BQ2A 1DJZA 4EIVA 1YNPA 6TIMA 4PEEA 4GMEA 2RAGA 1DTNA 1SR0A 5AC8A 4N0RA 4FX8A 3GKFA 3BV7A 3OTRA 1UZDA 3F5LA 3ZSTA 2DZWA 3B8SA 2ATSA 2PDGA 5LIXX 4UNIA 2XFYA 3GH7A 3DFOA 3B9NA 1LT8A 4RPPA 4FMVA 3FIGA 1M7PA 3MHFA 4KT2A 4S39A 3RCMA 1G6CA 4JCLA 4X2RA 3VC5A 5CSUA 1WZLA 3FX4A 3ELFA 3FA4A 2WZHA 5JVLA 4FS9A 1VJIA 3LCHA 3SY8A 4UTWC 2GSEA 4V33A 2ZE0A 5AVNA 3H8AA 2ZUTA 4PUJA 1CGUA 1H7PA 1R9YA 3C5QA 1PXGA 3EX2A 3PSVA 1JPMA 1RJRA 1X6LA 4Y2WA 1PSCA 3R10A 1BFNA 1B0IA 1OIFA 2YL5A 1N8IA 2ZRWA 3VK5A 3DDMA 2ZWYA 1FH7A 3URAA 3AQUA 2ZZ4A 1NDVA 3TLQA 2VFIA 3GXTA 4C6IA 3RN6A 2QV5A 1ICPA 3TH6A 1QNVA 4HOZA 3W7QA 2ALRA 5A8PA 1XDJA 3TFXA 3PZVA 3MPGA 4G8TA 3H7UA 4B5NA 1TJRA 5CXPA 4WKHA 1DXIA 2IPJA 3A5VA 1XLIA 1J8VA 3KTXA 4GNVA 3D47A 1WZKA 1WBHA 4H9VA 3PC0A 2QYGA 3S6DA 4IFOA 1D8WA 1GQJA 5I5RA 7TIMA 1OGGA 4ES4A 3TSBA 1RH9A 4GIRA 4S3JA 5D04C 4TV5A 4K6AA 4ZXLA 4S3CA 2FPYA 1JFHA 5FA5A 2WKLA 1K77A 4GC3A 3Q45A 5CH9A 4QJ5B 4NAFA 1QMLA 1NTHA 4MG4A 4O17A 4I9TA 3FJ6A 4UTHA 1SJDA 1PKNA 2VVSA 4B3KA 2QJJA 2Z0IA 1SFSA 3SRHA 5A2CA 5AYXA 3CWHA 2VTFA 4OOZA 1K7EA 1LORA 4Q8UA 4N9BA 4O18A 1EF3A 4S3KA 3WLPA 3WF1A 2OEMA 4W4QA 3HF3A 1QPKA 1PYMA 4X63A 4PUDA 1E3ZA 2HQAA 4ML9A 2GUYA 4F4RA 2ZVRA 1GW9A 5EPDA 2VURA 4AYGA 4MTVA 2A2IA 2ZXBA 3C56A 3U4FA 1MDRA 2J24A 1F8MA 2DIJA 2B4GA 1LCOA 2OO6A 4W87A 2A21A 3SY5A 3QMSA 3KBSA 4A22A 1JZ2A 3PZQA 3W1TA 1XCFA 4HA4A 4Z1BA 1XIIA 3P5ZA 4FLQA 5BNKA 1JPKA 1KTCA 2IPGA 1Q6OA 1ZB5A 1SFLA 4KIRA 1JUEA 5G4HC 2W62A 3UG8A 2VJXA 3BOFA 3M47A 4AWTA 1MEWA 4DUOA 4H3DA 1BQCA 1VHCA 3DYOA 3TC6A 2XVPA 1ZALA 3C8NA 1XIBA 2GGGA 1P0BA 1S2VA 4A2SA 3W81A 4ZSTA 4FXJA 1SU5A 4ZO6A 5I07A 5BXRA 4IP7A 1KQZA 3TXVA 1H1ZA 3URBA 5M17A 3LZ5A 3S1WA 1H0IA 1PDZA 3GH5A 4J27A 1AMKA 1B3WA 5AHNA 3MVTA 1A0CA 5HJYA 4LCSA 1WPCA 5F4XA 3G77A 1OD8A 4G7EA 4HZ7A 1GEQA 5RUBA 4DQWA 5TF0A 1PV8A 4PB3A 3RX4A 4UR9A 4GOAA 3LHZA 2E6AA 2VC6A 3NJ3A 1XV8A 2OR2A 3KX6A 1UCWA 2BXZA 3CS2A 2PDMA 5CPSA 3C3UA 1IGWA 4UOJA 3VX0A 3KXQA 3A6OA 2F9RA 2ACQA 5MKGA 3O16A 3IAPA 4PMUA 5U7SA 3CLWA 3U9IA 5I3DA 3AXXA 3IIPA 4MUZA 1NFBA 3TQKA 1M03A 5A6JA 3U2ZA 3CUGA 1KTNA 3GR4A 4ACZA 1XRSA 2ZUMA 3RU8X 3CHVA 3EB3A 4DB7A 5I3JA 2OELA 1JQVA 4MWAE 5JH2A 2G8ZA 5K9CA 4C5YA 4M0XA 3OHIA 1EJVC 4AHQA 1G5AA 4PB5A 5BZAA 2HWGA 1LG1A 2GJXA 2UZ9A 1R5YA 1SMDA 2DV0A 4CD7A 4AZBA 3VU2A 1K02A 1P4CA 1GVEA 4H83A 2ZZ6A 3VNZA 1M41A 4DWSA 3OYZA 4AC7C 2VDGA 3GNDA 1POJA 4Y9MA 5BWAA 5CC7A 2ZX8A 2HPIA 5EMLA 2L5HA 5HR7A 4ZO8A 1OY0A 2C15A 2YGYA 5HDRA 5HINA 3WD0A 4F0RA 4M19A 2ZXAA 3CTTA 3S2JA 5FSDC 1SMAA 1U2YA 3R2GA 2X1UA 3QJAA 1OYBA 2OLSA 1H60A 1PL9A 4LCRA 3MMUA 1ME7A 5KZEA 1G0CA 1TCDA 3SN0A 3P84A 3QYQA 3ZR6A 1OZQA 4DYEA 1AW1A 3MUAA 4DJDD 3EDKA 4K39A 2HTMA 4QHRA 4IIDA 1ONRA 1UWQA 1U83A 4HN8A 4OIFA 3KBNA 1FY6A 2F61A 3GFYA 5ABTA 3MWCA 2BASA 2UWFA 4O1AA 1S39A 4MJ4A 2CZVA 1S5VA 3GM8A 2O7SA 3PVFA 4BA0A 4ZCWA 4ZR8A 2EKCA 4H1ZA 1P0DA 3AU6A 4UIOA 1Q66A 3NOYA 4MJMA 3WNPA 3EOLA 4J3UA 4GRSA 1V77A 4PTWA 1WOBA 4HK5A 3SFKA 1EZWA 3QZ6A 3AMGA 4TXEA 5H91A 3PULA 4W5ZA 2VOMA 3A9IA 3FAXA 3N2BA 5G1MA 3F7JA 2V6AA 5CEWA 5BXPA 2HZGA 1R3SA 5TD4A 1F6YA 3FDGA 1T96A 3NPXA 3TMQA 4IP4A 4AZCA 3GX9A 4IFKA 4RX0A 2G3IA 3AO0A 4TOQA 3ZVIA 1XD0A 3RR4A 4UQCA 2Y89A 4IGHA 2PDJA 3LX9A 4ZB0A 3GBEA 3AU2A 4GWEA 1D3GA 2WPGA 3OYXA 4AEFA 1Q4NX 4IISA 2V5KA 2YW3A 1D9EA 1MDLA 2OSYA 3EWWA 4DWSB 1ONXA 1UW9A 1HJWA 2VFDA 2J7BA 3MYOA 1QO2A 3MS8A 2YBVA 3S9IA 2DIKA 2DSUA 4C1KA 3OOQA 4O10A 3SY1A 4PZVA 2G95A 2QULA 2VUYA 3NQ2A 4OHQA 1XLLA 1OFPA 4GABA 4CD6A 3W7PA 3SCOA 1UD3A 4REQA 1GVYA 5ENLA 1C9WA 3PBYA 1KO0A 1OGBA 2PWEA 4A8IA 1V6UA 2XN1A 4O14A 4AIEA 1VC4A 3T09A 2BY3A 1X1OA 1KRBC 4MGGA 1EP2A 5CSRA 1LTDA 2E8YA 4W7VA 3STFA 3KVLA 3F4WA 4US5A 1XIGA 3OZMA 2F6KA 1FDYA 3DHPA 1CENA 3M1ZA 2EAWA 1HVQA 2H6RA 4GJIA 3U0HA 4MY1A 4L4PA 4V28A 3TA9A 3GU9A 3LRMA 4MWAD 2YX0A 3PJTA 3ZM8A 3IPWA 1A5BA 2CZEA 4QG9A 1JYVA 1FP8A 4HSHA 3HM7A 1WO2A 2Q8ZA 3S2CA 4AZ5A 2V9DA 2J8TA 1O95A 3L68A 4TR9A 1PZ1A 3BCJA 3I7QA 4HPJA 1BG9A 4JFSA 1ZJIA 5F1VA 1W5OA 4C1LA 3UPMA 2R24A 3FS2A 1FWTA 5BWFA 1JAKA 5F4SA 3VM5A 1TUFA 5XIAA 2PC4A 3CAVA 4IXXA 3N73A 1OF6A 5A8MA 1JJKA 3FVMA 2V38A 4Z2LA 1V02A 3G3DA 1Y65A 3VOJA 1UR1A 4S1FA 4C6OA 1B3YA 2E6YA 4B5SA 3A22A 3QQ1A 3MKVA 3FA3A 3PPCA 1T99A 1XYMA 4HNUA 2J74A 3IVSA 3Q65A 3UZZA 2VX6A 2PPGA 3U5YA 4KERA 2VWSA 1TV2A 1LRTA 3BJFA 1P6BA 2XVKA 3DBNA 4WX2A 2RGMA 3W70A 3LHYA 3KCLA 4CNUA 4XKYA 3LI0A 2XYLA 3SO7A 1BSIA 1QDSA 1HT6A 3PJXA 4E8DA 3VC6A 4K1GA 4GZ7A 1VJSA 1RQHA 3EOSA 4HPGA 4Q8MA 1NQ6A 4FOJA 1WXZA 2PZNA 3POCA 2PRLA 3OLIA 2VC7A 3KOFA 4H19A 3UJ2A 2J8GA 4LC6A 1W3NA 4ICMA 4IMEA 1LWHA 3NURA 4P7NA 3UYIA 3N13A 4CUCA 2PDWA 4N42A 3Q37A 3MVIA 2QPSA 4Q7IA 3KRZA 4MJ2A 2CHOA 2YL9A 4C5ZA 1UKSA 4M8UA 6A3HA 4Z2IA 1NQKA 3VKCA 1TWIA 3CUHA 1H09A 4I7WA 1W3HA 3MUZ1 2DIEA 2VX7A 1EKOA 3PAOA 2DT2A 4IPJA 1YMYA 4AD4A 1DHKA 1WYIA 4TX8A 5C71A 3PJUA 4OZOA 4XK2A 1KM2A 4IL2A 1A80A 4HGXA 2OKOA 3M6YA 2O9OA 4PMNA 2YXXA 3ES8A 4NJJA 5LNWA 4LYRA 3GG0A 4DJEA 1S2TA 4N9CA 3B06A 2NV2A 1A5MC 1W3LA 4EPKA 1A5CA 2ZX6A 2VQTA 2IUZA 2G96A 4MAZA 2CFFA 3W7NA 4AWUA 5FJRA 3PNZA 1KGUA 3NDOA 4DWSC 2WMFA 2YA0A 2PDNA 4N4PA 2GK1A 3VIHA 1TPUA 1DJXA 4KWSA 1EJUC 2CXEA 2F2HA 1CB2A 3BLLA 2QF8A 3T7VA 1VEOA 2GSHA 2PZ0A 1E6QM 1FVPA 2VD9A 3B0PA 3EWUA 2XGBA 4O54A 3BTNA 3SJ3A 4GKLA 5BOEA 4BWLA 5DY2A 2DVUA 2F8QA 2NX3A 5D03A 3DG3A 1EO7A 2PEVA 4IM4A 5FL1A 2INEA 1EOMA 3T42A 4C6BA 3TTSA 3LN3A 3RX3A 3DFHA 1JZ3A 3MHGA 5HPCA 1L6YA 4LU0A 5BOOA 4WGXA 1OCQA 1YE4A 5A69A 4WDXA 2PF8A 3R0UA 3S6TA 3TE9A 3B97A 2PURA 1W1VA 1J0YA 4AEEA 4DYJA 3DENA 1BTMA 1QPNA 1R86A 4M6QA 2FB2A 4O28A 3W24A 3NL6A 4MWAA 1KBLA 1EQCA 3J7HA 1E9IA 5C9ZA 2E5BA 3W2NA 4DI9A 5IFPA 4HA1A 3BMXA 4Z1CA 1TKKA 1SYTA 4XV0A 2DJLA 4IP5A 2ABBA 1WUEA 4GFIA 4HU0A 4S3GA 2OQLA 2EJ1A 2PB1A 1YTDA 3MDUA 4UCGA 3ORWA 3PTQA 3RCNA 4MB1A 4PTXA 3WN6A 3T1GA 1MSSA 3PZOA 4R7OA 3UCDA 1EA9C 4W88A 1SZGA 4JYFA 3I6TA 3VVGA 3HGSA 4JTCA 3F2DA 1MFUA 3DERA 4L64A 3ZXWA 2GGHA 4A8LA 3CO8A 1VF8A 2ZUUA 1VBJA 3P62A 3TW7A 1EX1A 4JL2A 4EANA 1CXEA 4JTQA 1PS9A 4CQAA 3CMJA 2PBGA 3MY9A 4C6KA 1VYSX 7ENLA 2O9RA 1WKYA 1SO5A 2WMHA 1IXNA 1LWJA 4FALA 2ZICA 4MB3A 1X38A 2ZDSA 1W17A 2XIIA 2GUBA 3UY8A 4UWMA 4CN6A 4Z2KA 2QCLA 3ZLFA 5EBUA 4W93A 3SUWA 3GNOA 2Q3OA 2P3ZA 4PGLA 3UR8A 4F9JA 3TLLA 4S2BA 1V6VA 3HZ3A 1EUNA 4OVXA 3E38A 2ZRYA 4C6JA 3K1GA 4WDUA 3NQEA 1WZAA 4JFTA 5HJXA 3M9YA 5KINA 4MNMA 1AZ2A 2B31A 2QT3A 3NA8A 3LGDA 2QIIA 4E2DA 3MTWA 3SJNA 3MMWA 3OG3A 2I17A 3BJTA 1N8FA 5TAOA 3SUUA 1TIMA 4F0MA 3U48A 4HNOA 2WANA 4GUFA 4IPNB 1SM9A 1VFHA 5H6HA 4A3HA 4B4HA 3BPWA 1SZNA 1VCGA 1U5HA 1J18A 4R85A 4I6KA 3WMSA 2BODX 4RE4A 3W82A 3E9AA 2HJPA 1YW1A 1PIGA 1EPVA 2QUNA 2WBKA 3NDZA 3P82A 4JEJA 2EEXA 2VFEA 5EKYA 4KW2A 1OX6A 1H5VA 1FHDA 1REQB 2FZ9A 4PE8A 1DQXA 3T08A 3QVQA 5T91A 3VNDA 3VZZA 3WSUA 2YA1A 4HCLA 3HO8A 5E0KA 4DPPA 4I5XA 1PJ9A 4XKMA 4DEFA 3PG9A 4JQAA 5FJPA 3WLJA 3B8TA 1ZZMA 4DJFD 1RZMA 1LL7A 2GJRA 4GBDA 3O0FA 4JY8A 4KESA 1JI2A 1M9HA 2FQIA 3HA1A 3GLCA 3E3HA 1VFTA 2QW5A 5B7ZA 1H41A 5I09A 4X22A 1AH4A 3NO5A 3CUFA 4N6FA 1MO0A 4MKVA 4LCQA 2AGKA 2E9BA 1WKDA 3N4AA 3TDFA 1FBAA 2I1OA 4PBGA 2AAAA 2CESA 1S2AA 4W84A 3S1VA 2QJGA 1DIEA 5ECUA 3HTWA 3VDGA 4OV4A 2WJFA 3OEXA 1VB9A 3VIMA 3DOPA 3UJEA 3S83A 4HNCA 2DUXA 2CBJA 1J0KA 3TCEA 3WFZA 1SW7A 1K8ZA 1DVJA 4Z0JA 3M46A 1UKQA 4CD4A 2YKKA 2XUCA 2E9MA 2PDFA 2YCLA 4HA0A 3ZSSA 4XZHA 1QCWA 3CEPA 3D6NA 5JUVA 1V6XA 5D4YA 4IJBA 1W6TA 3TYDA 1YADA 3G8EA 2WZIA 1K8XA 4LJ3A 4ZQPA 3G1VA 3PZTA 3V5CA 1P5BA 3L5MA 3CUXA 2J6VA 3AS0A 2Y4SA 3RX2A 2WSPA 1Q6DA 3TVAA 5C54A 1OFDA 5H8UA 1B3XA 5A6KA 4CQCA 7TAAA 5H8PA 2PDXA 1FFQA 3URQA 3KCJA 1F9CA 2ZZ2A 4PTNA 4GH1A 1WDPA 4XZNX 3SGUA 1J96A 1T7LA 3RITA 1TYGA 2VKZG 2I14A 5GQBA 4AIBA 4QG6A 2DH2A 4RNJA 2OLAA 1XLEA 3SUSA 1TMQA 3UT0A 1KLZA 1M68A 1TJ0A 4EE9A 1R3QA 3MSDA 2BVDA 5CC3A 2YJQA 2WHJA 1A5LC 3USZA 1OSEA 1TB3A 4U2ZA 4HTYA 3LEPA 4FXRA 5CJMA 1JF5A 3FLUA 4JTTA 4O13A 3PAJA 6ALDA 1BPLB 4GBUA 4GYPA 4KWUA 3H2AA 1DTUA 2GJXB 1OVDA 3GZ3A 3H70A 3CIWA 1PIFA 2W63A 3L4YA 3SFWA 4BQ3A 1W1ZA 1W37A 4HYVA 3K1DA 4IIBA 3OLEA 4CCEA 2CEQA 5I2UA 4WGHA 5A6TC 5HNRA 4QNEA 1VFLA 3PWIA 3QTGA 3CBWA 1AUSL 3QPEA 3AIRA 3WDQA 3B05A 4CNPA 1IWPA 2V67A 3GVWA 3U7VA 2Z6JA 1B3OA 2E6FA 4MB5A 4A8NA 2CCRA 2V2HA 1HJUA 3BC9A 1W54A 1D3HA 3T78A 4O52A 1A5SA 1OFEA 3A47A 3ABRA 1R85A 4NJGA 3LXAA 2VFHA 2OKTA 2DZPA 1FDZA 4DELA 2FVKA 3F4VA 1XCWA 1U22A 3MUXA 1TMLA 2A3BA 3P81A 2G3FA 3QHOA 3KLLA 2GJLA 1EJTC 4XBSA 3E12A 3QC3A 4UMBA 4M29A 3R25A 3NM3A 1JVNA 5E6ZA 4FX7A 3FOKA 1GVQA 2GOUA 1GTEA 5J5RA 1WOAA 3EDDA 1PCKA 1FWFC 1E1FA 3O6CA 4XO7A 5FIPA 1ODZA 3OW1A 1DQUA 2ISWA 3N25A 4FLRA 4LPCA 3HB9A 1A0EA 2ATMA 4CQ9A 4LVBA 3PPGA 3WUFA 4FZIA 1XFBA 4NX5A 4RXGA 4QXIA 1K70A 1V3JA 4INFA 3HG4A 1VH7A 4H8NA 2OTDA 1HXJA 2D24A 2DUZA 1I1XA 4IX2A 3RO6A 2P50A 5E9AA 4KKXA 1JGIA 1H61A 1VENA 2QV4A 8CGTA 3H2EA 3NAVA 3O0KA 2XIMA 1VLWA 1X98A 1RJQA 1GVRA 1GT8A 4ZOBA 1GHSA 3AFBA 1E3XA 1WBJA 3N4FA 5DXXA 4GVIA 3TZFA 4NNBA 3AXMA 1A3WA 1MMFA 2DUAA 2NXHA 3FHQA 1CNVA 3KOZA 1EDQA 4C6LA 1UUMA 2DPEA 1EA0A 4LAOA 3LB0A 2NSOA 4Q4RA 4ZENA 3MC5A 4GYFA 1KRCC 1E9ZB 3I4KA 4RZ5A 4QNWA 4LW7A 3AZSA 2P3EA 1K9TA 4AH7A 3O9NA 4QSHA 3HPZA 3HG5A 1P0NA 4B5TA 3KOWA 4E8GA 2V5CA 5EFDA 4L1WA 3NSXA 4W8AA 1SZFA 5KZMA 4PRTA 1LBLA 2XDFA 1H51A 3LLDA 5I02A 2J13A 1VD6A 1XXXA 1PX4A 3BG5A 2QR6A 4NZ4A 3ZIZA 4HHMA 4IOTA 1XYCA 2ZXDA 1PB0A 1DWJM 1TR9A 5DRIA 3V5FA 2AOSA 3OP2A 1BRLA 2DVXA 1YRRA 3QW3A 1BVWA 1G01A 2VI0A 2QHAA 3W7OA 4HK7A 3IK4A 3VOFA 2WM0A 2PDIA 5PTDA 2PDPA 2YXOA 3WLTA 4H7ZA 5GNZA 2J77A 1JCTA 4PCTA 4Q8PA 3W28A 4HNTA 3SI9A 5ABEA 3CYVA 1RBLA 1EYWA 3A24A 3KAOA 3TSDA 2G50A 2CWXA 3F5KA 1DKWA 1E43A 5EBAA 4AB4A 2INZA 4J5NA 1E5JA 1ISVA 3IEBA 1M01A 5D9MA 1V6WA 1NWSA 3ZWSA 1R0MA 3NEVA 1CLXA 4UBPC 4LUYA 4NXKA 3I7SA 3SCSA 3W1UA 2HBVA 5A95A 1JD9A 5AYIA 4KCTA 2YW4A 4TVDA 4JR5A 2JKEA 3TZNA 4C6DA 4GXMA 4JIRA 4J3WA 4GUHA 4YTTA 1KW1A 1SSDA 1WDDA 3WUGA 3G0SA 4GI8A 5EA9A 2A3LA 3AZTA 5I77A 1VKFA 4WY0B 3SCVA 3IJ6A 1EHNA 4HNLA 1W1A1 2PRMA 3EX3A 4RZBA 1F5ZA 2PI6A 4HPHA 1DWFM 4PL2A 1LF1A 1OJXA 4Z1AA 3W2JA 3OVPA 1ZAJA 4NYUA 4ATLA 4MVAA 3GH4A 1F6KA 2AMGA 4EKJA 4IGMA 1LBFA 4JEQA 1OBAA 3E2RA 5M2FX 5LNUA 2ZRVA 2J9ZA 4LQ1A 3UR5A 1Q13A 3AHXA 2IPWA 1LRNA 5FF3A 2I16A 3TFCA 2BXYA 1MEHA 2W66A 3M64A 3AC0A 3ZVHB 1R3RA 1A3XA 4UTTC 1QOPA 1CGTA 1XYFA 4JDYA 2ISDA 1Z69A 2C79A 4WHBA 3SIMA 3WQ5A 2E77A 1OC7A 1HO4A 3FEQA 2GDVA 3CQJA 5A6LA 1BYAA 2BV9A 2DP3A 4RZ6A 3BOXA 1O7AA 3IACA 3BV4A 3W74A 1UC4A 3U7BA 2AMXA 3FGCA 3AIBA 1WCGA 1E51A 2P5NA 3ARPA 3G1RA 4GO9A 4HNNA 4OGZA 3P2VA 4L5ZA 4S23A 5T9BG 3K5XA 5DN1A 4GGHA 3RPMA 3VNMA 2H3DA 1FH9A 3OODA 3UZXA 3CWNA 1GOMA 4QDMA 4MY8A 3ZFHA 4O1CA 4TMCA 8TIMA 2NT0A 3CHEA 4IIEA 4J2MA 1S46A 4YIWA 4CQ8A 3O63A 2VCAA 4PUUA 3LPGA 1XIHA 2Y7DA 4ZO7A 3UWEA 3OBAA 4IIGA 1F73A 2XINA 3NZQA 3C2OA 3GYCA 1DWIM 3SAZA 5TBOA 1W1IE 3WH8A 2F84A 4UR8A 4S3AA 1EWEA 1XR2A 3BJSA 1QI5A 2MNRA 3FK4A 1OZMA 3ITLA 3S5NA 1TA3B 2GGEA 1AZ1A 1N55A 4MHBA 1VS1A 2VEFA 4IUOA 3IK2A 3LMYA 3SQSA 3IUDA 1J9YA 3OGRA 4QM1A 3M5XA 4FIQA 4LFYA 1WUFA 3M5ZA 1T40A 2CLLA 2I5QA 3A3WA 4AZHA 3HMCA 1TV5A 4QISA 1AFSA 3GTXA 2VX5A 5JH1A 1JDFA 3UZYA 3T81A 3GUGA 3MDWA 3T9PA 2FTWA 2ZZ3A 1Q7ZA 3IJIA 2YCKX 1LWIA 1X6UA 3B4YA 3H12A 2VDIA 1IQ8A 1BD0A 3TR9A 2Z6IA 4JQ2A 3EWYA 3TWBA 4RNFA 2PUZA 3P14A 4HVXA 1V7AA 2OWCA 4U3CA 1JCNA 2WWDA 2RJGA 2QGHA 5TNVA 1QRQA 4OKDA 1YTEA 1E5NA 1HP4A 1X1ZA 4CCCA 3CASA 3LQLA 2P1FA 2IKGA 5FAJA 3BICA 5FACA 4JTRA 2UY2A 3TTQA 2VGBA 3KBMA 3QV8A 3UWQA 4ROQA 4MIMA 4KBXA 3PTKA 1H1NA 3AMLA 1HJQA 2CZDA 4BQ5A 3UF9A 5G4WA 4RNIA 3CZKA 1W3KA 2VZVA 3MSRA 2OYMA 1EC8A 2PCEA 4Y6GA 3MV01 2BG5A 1V79A 2QUVA 4GI6A 4R7WA 2W92A 3AALA 1A4LA 3SGZA 3FYOA 3DECA 5F2GA 3TQ0A 5LA2A 2D1ZA 1YBQB 3VTRA 4RLIA 2PD5A 4LVFA 2VCCA 1PYFA 4EPEC 2OPJA 3UG5A 4GUIA 5CCZA 5HQMA 3TC7A 4PTMA 2FZ8A 1UP0A 1YDOA 1XBXA 3PZIA 3NL3A 3GE7A 4K38A 2HSAA 3FW6A 3QV7A 2G97A 2ON3A 2NV1A 1E1CA 2OOGA 2GLKA 1BYDA 4LV4A 5EMYA 3WG6A 4Q8NA 2HCVA 3OQEA 4DZ5A 2XTKA 3WDRA 3NZGA 5HMEA 3A13A 1QI3A 4R5EA 4F3HA 3NQMA 5HATA 3LQGA 2XIOA 2OMAA 4DNHA 3H2MA 3KUMA 3XINA 3OHMB 4E8CA 2FJUB 1MQPA 2J9YA 4B5XA 4HHHA 5E1QA 3S1UA 4D8LA 3OG2A 3RILA 4NF7A 3GW0A 1TREA 3VOCA 4RJEA 4LEQA 1E6SM 3U8GA 4ERGA 4FXFA 1YX1A 3CAKA 4D6JA 1RP9A 3ZR4A 1B9ZA 4RR4A 1XP3A 2AL2B 3N2OA 3RRXA 1HKWA 4Q8OA 4R34A 4O1EA 4O0ZA 4UTJA 4IL0A 3KRUA 3R5EA 3UBPC 5I79A 2RJHA 3TP4A 1SPQA 3VGHA 1O12A 5A6BD 3TOYA 3VKAA 4M3PA 4NILA 4ZA0A 1QUMA 2ZBTA 1OC6A 4BCEA 4AD0A 3RLGA 4ICNA 4A05A 2DSVA 1XIMA 4DXKA 2Z1KA 2RGLA 3B0XA 1PE1A 3WNLA 1CXIA 4JQ1A 5C7HA 3WQ6A 3C2RA 3QC0A 3V3WA 3U3HA 1Z8AA 1YDNA 2GWGA 4M80A 3THAA 1GHRA 3LENA 4CEXC 4L1GA 2YCLB 3W29A 3WD1A 1LYXA 2R82A 2VEKA 4D1JA 2D3NA 1JIBA 2FVLA 5IHSA 1MUWA 1W0MA 3S2MA 3GU1A 4RW3A 1C7SA 1EIBA 3N29A 4PN2A 4HU4A 1CGVA 2F2KA 5D05A 1LP6A 1V51A 3LCIA 4PMXA 1NDZA 3IGUA 3HG2A 3ENLA 2YCEA 3BWWA 1J01A 4H9XA 4JIIX 4AVFA 1E6PA 1V0LA 1HJSA 3VDAA 2D2HA 3U2EA 3ITYA 3DKLA 2C1GA 1EYEA 2E09A 2NVAA 3NVDA 4OU1A 3CK5A 4XUGA 2J27A 3WQFA 3B9DA 4GIYA 4MOZA 2Z1BA 4IG2B 3W2UA 2X7VA 4XSMA 1HKIA 3SCRA 3L4VA 2YIHA 4UFJA 3WH7A 3ZLHA 1RP8A 3MZ2A 1YPFA 2A3HA 3OPSA 1HN1A 5C55A 3AUJA 3VD7A 3GW3A 3W88A 1V02E 4KEVA 1FX6A 4YNGA 3QHNA 4HPXA 5C2CA 4AXKA 4DM2A 1ISZA 2Z00A 1XYBA 4B90A 3MSGA 3WNNA 2WVSA 3JUGA 3CB8A 1OEPA 3I3BA 1XJBA 1F6PA 2NVCA 1CGWA 1ZJBA 3MV11 2YBUA 4DO4A 1DIDA 2XG9A 4FI4A 4H7VA 1V3KA 2YSWA 3UZWA 2YL8A 4LF1A 3F03K 4KFOA 2I5GA 3LD5A 3EWCA 5K3VA 4GINA 2V69A 3VIGA 3OBEA 1QHZA 4UFKA 2GSJA 3GXIA 4L6HA 1GORA 1EL3A 2PGEA 1UR0A 1B2YA 4ZQOA 2IXVA 4LY4A 4P8VA 4DPQA 4HK6A 4GNJA 4W5UA 1LUCB 3WF4A 3IAQA 5LSMA 5DMNA 4PTDA 5DRCA 1GOKA 2R1NA 3CQ0A 1PX8A 4Z1DA 1JL8A 4JFWA 2ISSA 3U2CA 2BZNA 3MUCA 5AHMA 4J3ZA 2QVHA 1JI1A 4FF7A 5EMKA 4DJED 1XHGA 1KV5A 4JCMA 1SQ7A 3MUY1 4ERIA 3THDA 4NI8A 2IQTA 4I9MA 2I5IA 1OABA 2UV8G 4WDTA 3UJFA 2AL1A 3PS7A 4RDZA 3F2BA 4DXXA 1DJIA 3S5SA 4IXHA 2FVMA 1NWTA 1QHPA 1JAEA 1AL8A 3E49A 3O05A 3DGBA 4E2OA 1FCBA 3GDMA 1J0JA 5T8GA 2X2YA 1FCUA 3PFMA 4UNLA 2FPVA 3V36A 1L6GA 1DJQA 4QP0A 3APTA 3H6OA 3LMZA 4MLJA 2AQVA 3E02A 4ATDA 3ZMRA 1MW1A 2ZZ5A 3B0YA 4DF2A 3KLKA 5BRBA 4YL2A 2WJZA 2PSNA 4TV6A 1A4MA 5I6SA 4DBDA 3IV8A 1TCMA 4DXVA 3WF0A 4PMQA 5AC6A 1L6FA 3NL2A 3GSMA 1Q6FA 5DCDA 3LM7A 3T8LA 4JTGA 1IT0A 1HP5A 2E1DA 3NQ8A 1RA5A 3FKKA 2QDHA 5EGRA 5LIYX 2Y8KA 3XISA 4HPNA 2H3BA 1YYAA 2ZOXA 3CU2A 4M6PA 4IT1A 2QCNA 4XD3A 4P5UA 2RDWA 2C13A 2E5CA 2V5BA 4GYJA 4JTEA 2JF7A 2BSLA 5T9CE 3GVQA 1NARA 5FESA 4TVUA 1IWBA 1J2WA 5CPOA 2Q09A 3VA8A 3TSMA 3NPUA 1MZHA 8RUCA 2A7RA 4O1BA 2F7FA 2QIWA 2QAFA 1JQXA 4GUJA 2TODA 4NXSA 3UCCA 3HURA 1Y8BA 4RE2A 1ZGDA 3TU9A 2EGZA 2P8BA 3ZT6A 4F9DA 4JOMA 3L4UA 5FJJA 3UZ5A 1GG1A 4F2UA 4FNTA 1FWAC 1R7AA 3ZOAA 1IXPA 3B0VC 1E1EA 3GRIA 1UC5A 2VXNA 1GYMA 1YXDA 2IXUA 3SN1A 3KM8A 1L6SA 3LYEA 4XIMA 1S3TC 2WBGA 1IEXA 4AQLA 5C7VA 2PLMA 2CLOA 1POKA 1CYGA 3WQCA 3PBVA 2TYSA 1M6JA 4DAFA 4FR6A 4OUIA 1UPMB 1MXSA 1U33A 1NJJA 3WBAA 4CN1A 1KFEA 3LV6A 1BF6A 3N9SA 1BF2A 1GZ1A 1TPWA 2YFNA 4C6NA 2EKGA 2AL2A 1VEMA 2NZLA 4GZJA 2WKJA 3GYEA 2Y5JA 5F2IA 3N2TA 3VINA 1RQEA 1QOQA 3KOYA 1D7FA 1K8YA 2ACSA 4XAGA 2R91A 3GFXA 4O15A 1O5RA 4ROPA 3I10A 3KBWA 4FA3A 1R9ZA 4B5WA 1B31A 1KBKA 3VZYA