1F5ZA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form i
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N-ACETYLNEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 122
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f5zA00
1QMLA 1ZFJA 3UXDA 3W2MA 3P60A 3QRHA 3C4UA 1A5BA 1M7OA 4YWIA 2WPBA 1YPFA 1H7OA 1XI3A 3TMQA 1F6PA 3ATZA 3NQAA 4M6QA 3L2IA 1K3UA 1DKWA 3NPWA 5L9FA 2C14A 3TCEA 1C9DA 3O6DA 2FTPA 1OFEA 4UTWA 4HNNA 4POCA 3KHJA 3LI1A 2R94A 3E12A 3MP3A 4FNUA 2W79A 4DPPA 3M5VA 3DXIA 5K4ZA 3LI0A 4JTSA 4MLRA 3BLIA 3LB0A 1TO3A 2A7NA 3CQ0A 1WX0A 2QCHA 3LRMA 4CQ8A 5G1YA 1HO4A 1U83A 1W5QA 4PEKA 4LS2A 5HWJA 4EWND 4O4WA 3HJZA 5FI8A 2RKXA 4UNLA 4O1CA 4RXFA 4ADUA 1FX6A 1KTNA 3B4UA 5FEXA 2ZA2A 2ZA1A 4EIVA 3F4NA 4MUZA 1GZGA 4FNRA 2NUYA 3FJLA 4QISA 1VHCA 3P74A 1X1ZA 3EB2A 5K4XA 1SU5A 4UC5A 2G96A 2EPHA 3PSWA 3HPXA 5G5IA 3YPIA 3LTPA 2ZA3A 4HN4A 5I3GA 2NXIA 2VEIA 4HPXA 1F73A 1LBLA 3UWZA 2GJNA 4JN6A 1TV7A 3H54A 3W1NA 3GKAA 2J9XA 3M0ZA 3S1VA 4RCXA 2JKAA 3GKFA 5CZTA 3UWQA 1XUUA 3LV5A 1QWGA 1KM4A 3EX4A 3I65A 3MWAA 1H60A 1BEUA 5EL1A 1M5WA 4WY0B 1KM1A 2CLOA 3E96A 1OABA 1NSJA 1MXSA 4FF7A 1G4EA 4HKPA 1ZAIA 3W88A 3IVTA 4O10A 3W84A 5CPMA 3GAYA 2JBMA 2DZUA 4UTJA 4AF0B 5G4EA 1H63A 3NPVA 4JTKA 3A23A 5AHIA 3RF9A 4XBKA 4O52A 3TW7A 2DZWA 3W7MA 4NX0A 3F03K 4IQLA 1RQBA 4LVDA 1GJPA 2E5BA 3TSMA 1Z42A 3GIYA 3W76A 3E02A 3SIZA 3LTSA 4ZQCA 2ZZ6A 1D9EA 1XBVA 1DVJA 3EEGA 3G1FA 4WOZA 2NXHA 1F7BA 1NAL1 3RNDA 2A5HA 1LYXA 2V2HA 3Q94A 4UMCA 5AYXA 3G0XA 4Q32A 5KITA 1P5BA 4R33A 4L4LA 1JCJA 2H90A 4DO5A 5AHMA 2QCDA 4G1KA 3W73A 3C61A 3L0GA 1SO3A 1FWSA 1JVNA 3I6RA 3P8JA 3PWAA 1G7UA 2R8WA 3NZ1A 3EXTA 2ABAA 4PC8A 4CCEA 5D38A 2A6NA 4O1AA 2CFFA 1CX9A 2BXVA 5CPLA 4OV9A 1I45A 4A22A 3JRKA 4NJHA 3TDFA 2YCEA 3QQ0A 3PF3A 2QCGA 2LLEA 5HJLA 3M43A 1T0OA 3A5FA 1TREA 5KMYA 1LTDA 2EAWA 4RZ5A 1KFLA 3C3NA 4IXHA 3U8GA 3LCFA 5AHNA 1RZMA 4UTUA 3W7OA 2RFGA 3NPUA 4E0CA 3PBYA 3DFPA 1A5SA 1Q45A 3DFSA 4GWEA 1M6JA 4UTHA 3N2XA 1RQHA 1IGSA 3W9ZA 5D02A 4ZQRA 3NM3A 3DKJA 2V2DA 3NQ7A 4KWVA 4GFSA 1D3GA 1G4TA 1TPEA 1OFQA 3W7DA 3M47A 3W74A 3WJYA 1K7FA 2FFCA 3IVSA 3S1UA 4LVFA 2VEKA 2Y70A 4CLMA 3W7KA 2UV8G 1PL9A 1MSSA 5J5DA 3BARA 4MYAA 2GQ8A 1AK5A 3N9RA 2TMDA 3G1HA 3OA3A 1I8JA 4Y8FA 4RLIA 3W85A 4MVAA 1WBHA 4CCCA 4UMBA 4IPJA 3TROA 1PE1A 2ZRXA 3TFXA 4FNSA 4Z1AA 4AAJA 3SECA 3G3MA 3LRKA 2A2IA 1W0MA 5F4WA 2C1HA 1JUKA 5LSMA 1LORA 2XN1A 3G22A 4RJEA 5FF4A 4GUGA 1OG0A 2WSYA 5KZMA 5LGZA 1IIGA 3ZWSA 4MY9A 4LVBA 4ALDA 3NL3A 3BG5A 3LGEA 3BW2A 1DQXA 1SW3A 2NXGA 3V1PA 4RR4A 1JCYA 2B4GA 3UPWA 4FEZA 3CEUA 3LCGA 4O57A 1KV5A 1OYCA 1FWRA 3KFTA 2HTMA 4P2VA 3ZFHA 2QAFA 1VZWA 4KKXA 3W1RA 3B05A 4YL2A 2OX1A 4K6AA 3KXQA 4UNKA 3RU6A 3OHIA 4XBSA 3PBWA 1DOSA 2AQWA 1FXPA 1SZEA 4WXZA 1VYSX 3HPSA 1SR9A 2X1UA 1MEHA 2CZEA 1WAUA 3SW6A 1LM1A 4MJMA 3A21A 5DXXA 4W9TA 4JTFA 1H7WA 1VCGA 4O15A 4OE7A 3GAKA 2ZZ5A 1YXDA 2E09A 1O4UA 1X1OA 3B0PA 1GG1A 2HMCA 5LNVA 5I3JA 3MYPA 1F2JA 2X1RA 3N19B 3QC3A 5C5YA 4QJ1A 3TAOA 1G69A 2QUUA 4M19A 4PFMA 4NNAA 2ZZ1A 2I14A 1RR2A 1C8VA 5IBXA 4AB4A 5EBUA 3LERA 3EKZA 4K37A 2DORA 4I7WA 4N2YA 4O50A 4QNEA 4DPQA 2QUTA 4LWWA 2E6AA 4JTEA 2C13A 2ZBTA 3CHVA 3PBVA 3AJXA 5IBXC 2HS6A 3TR2A 5EA9A 1LLWA 2E6DA 3UZ5A 3W2LA 4U28A 3W2NA 4JD4A 2QAPA 3HGJA 3MO7A 1JUEA 1HG3A 5CZ0A 3EWXA 3GK0A 4A2SA 2CLHA 3KAOA 1JQVA 1THFD 3EXRA 2DZVA 1K8ZA 3QYQA 4DEFA 4O54A 3VFLA 3BG9A 1O60A 1ZALA 3L21A 1OX4A 3TSDA 4X2RA 5K9DA 1OF6A 1JRBA 4QNWA 5FF7A 3S5OA 3O16A 4ORMA 4O1BA 1S5TA 2YDAA 4BI5A 4UCGA 3R12A 4YLWA 1QPNA 4RZ4A 3TE9A 3NPXA 4I9AA 1SFLA 1GOXA 2B7PA 3F1QA 2V0TA 2YW3A 3DI1A 3HBLA 3S0CA 4IMEA 3DGRA 2YZRA 3UZJA 1K03A 4JTTA 5FESA 5FEWA 2CZ5A 3GR7A 5DN1A 3LTYA 3USBA 3OVQA 3UWVA 2DZXA 4GRSA 4Y9AA 3NA8A 5CSSA 5FF0A 4LW7A 2ALDA 4ZMGA 1W5PA 1H7NA 4Z1BA 3NL2A 5LHFA 1AL7A 3P67A 1DJNA 3TU9A 5C2XA 1JCNA 2X30A 4JY9A 4UTIA 2BZNA 1C29A 4NQ1A 4JX6A 2XN0A 3TNOA 1PS9A 4IX0A 5K2ZA 3ANYA 3HB9A 1G7VA 1QDSA 5K9XA 2ZRZA 2H8ZA 1EUNA 1MEIA 1ME9A 2H8XA 2WOQA 3W7PA 3CWOX 3P81A 3FA5A 5CKSA 5AYZA 2ZZ2A 3TMLA 4GUJA 3Q37A 1SZNA 3LCIA 1LBMA 1JCMP 3NR0A 4OHQA 1OYAA 1H7PA 3CIXA 3RLUA 4M7TA 3DFOA 1QR7A 1VS1A 1Q6QA 1EX5A 2VXNA 5HQEA 3HGRA 1QPOA 2Y62A 2GPTA 4LRSA 4UR7A 2HS8A 2QCDB 3W7CA 3KRSA 2DJLA 3B0UX 3L5MA 2QJGA 2E5CA 2GQAA 3MJYA 4O13A 2X1TA 3DENA 3I7QA 3B0VC 5A5WA 2DZTA 4OQVA 3NNTA 3MHGA 2QJIA 4MZYA 2OMAA 1UBSA 3L0NA 4FHAA 4HHPA 5D2YA 4IWWA 3T7VA 3LHWA 3GR8A 4JIQA 1OYBA 2BSLA 5AHLA 1S5WA 2R14A 1FDJA 3HGOA 3PB0A 4WZHA 1WDWA 4LU0A 5E93A 3W2KA 5BW6A 4S1FA 3LV6A 3T40A 5AYYA 5H91A 5K3VA 2EHHA 1H1YA 2DZSA 4LOCA 3QMSA 2FPYA 1K7XA 3O6CA 3D0CA 3UWUA 4AXKA 3BLFA 4PH6A 1RQEA 5AC8A 3W7JA 2Z1BA 1JCLA 4XZ9A 1P0KA 1B57A 3L5AA 1LZOA 3QMTA 1FCBA 4N4QA 1TCDA 3ATYA 4HIBA 3W7RA 2X2GA 1OFDA 4JYFA 3M44A 1K7EA 5CGQA 3KX6A 3W1AA 3IIVA 1QPRA 3DI0A 4JICA 2VFIA 2GUUA 3W71A 2ISWA 2PC4A 1GVRA 3C2RA 3TK7A 1OHLA 3GXPA 4MPQA 4HPJA 3ZS4A 3HOJA 3HF3A 3GYEA 5HNRA 2CLMA 4UTWC 2AGKA 4DQWA 3DU0A 4NZFA 3W1LA 3TQKA 4MZ8A 2NLIA 4O14A 2BWGA 3MYOA 3R2GA 3GDLA 4CCDA 1FXQA 1ME7A 1F6KA 1AW1A 3CB8A 1W3TA 5D30A 2H6RA 3H53A 3OG3A 3CU2A 3CEPA 5F2MA 4ZZ9A 1XBZA 3INPA 3LHYA 2E68A 4K8HA 2ZRYA 3LLDA 2GVLA 2YSWA 5D2TA 1N7KA 1F5ZA 1EEPA 2C18A 3A9IA 3PG9A 2ZZ3A 3UNDA 2F84A 3W1QA 3W7EA 1LRQA 4DXVA 4Z1CA 4E2DA 3P82A 1EWDA 3IEBA 3TA6A 2XFWA 5HWNA 1D3HA 4PCFA 1DORA 5AC6A 4FB7A 4CQAA 3TX9A 5LNUA 3O63A 1VC4A 1ICPA 1QAPA 4IJBA 4DF2A 3PBUA 2C15A 3ABRA 1CW2A 4N6FA 4Z0SA 2H3BA 2C19A 1V5XA 3I68A 1OFPA 3B03A 5D05A 1GG0A 4NJGA 4UIOA 4Y90A 3NZRA 8TIMA 1L6WA 4NZJA 3OVPA 5FF2A 1FCUA 1PCWA 4NNCA 2CLLA 3O1NA 3W75A 4ZQPA 4BWLA 5HINA 1YTKA 1LCOA 4CQ9A 4I7VA 2V2CA 4NNBA 5EYWA 1SPQA 2QCCA 2BX7A 1G6CA 5CPOA 1H51A 1ONRA 3CM4A 2OT0A 4WUIA 3PUDA 3PS7A 4LC6A 4YCPA 1VYPX 1TPWA 4BWLC 5CZJA 5T26A 3PG8A 4K36A 3PVFA 4FNPA 4A21A 3G1AA 4MY8A 1OX4B 1QO2A 3QPYA 3MI6A 4RV8A 1MEWA 1XDMA 4KFNA 3KVKA 3FFSA 1DQWA 3IIZA 4OBTA 3W87A 1YDNA 3P7YA 2B7QA 2E6FA 1HL2A 4LUJA 3AO0A 3PUEA 2VFFA 2QCLA 1ZAHA 3B06A 5DBUA 1ADOA 2YPIA 4NUWA 3HIJA 2DZPA 2YGYA 3KRUA 1PCKA 3STFA 3LCWA 1QO5A 3WJSA 5BOOA 3G3DA 2W0UA 4O11A 4YMZA 1VGAA 4AMAA 3SY5A 3LX9A 1KW1A 1YXYA 2RDUA 2A21A 3W83A 4JNMA 3PR2A 1VHNA 1XUZA 5FF3A 3UWYA 3LHZA 1XM3A 3TV8A 2PRLA 1O5KA 2ISSA 2A85A 3P80A 3STGA 1TPC1 3W86A 5F2GA 3TC7A 1OFRA 1WV2A 2TRSA 1UUOA 1G4SA 2WV8A 3T78A 3L5LA 3MP5A 3W22A 3LBCA 5TBOA 4UFKA 1JJKA 4BK9A 2R91A 4LNYA 5CG7A 4LVGA 3SJ3A 5BRBA 1UCWA 2Y7FA 4ORIA 4O1DA 3FYOA 2H3DA 2NX3A 4GBUA 1B9BA 2JKEA 3G1XA 1IXNA 1HO1A 3EWUA 2CWNA 2PRMA 1RPXA 1WXJA 3BGJA 1LLZA 3HPZA 1GYNA 1T96A 4Q4KA 2GJLA 3NO5A 4GJ1A 2EKCA 1RV8A 2DJXA 1KLYA 4DF0A 3QZEA 3EWBX 3QQ1A 2V81A 3NQCA 1TPH1 3TAKA 1TJRA 3CWNA 2HSAA 4NXSA 4H6KA 1JCXA 1B4EA 1XC4A 4JXCA 4ONVA 5AB3A 3W2UA 2WNQA 4JTGA 1B4KA 1GWJA 4P61A 5LNRA 4Z0JA 4NJKA 4BI6A 3UWWA 3N3MA 2FQIA 1ZJIA 3GXTA 4HSNA 2ZRWA 4WXYA 2WSRA 4NXKA 1BTMA 2JK2A 3W7IA 1EUAA 4XWUA 1QOPA 2E6YA 1TRDA 4MLJA 5I3KA 3M5YA 3SGUA 3O8AA 4JX4A 4GNJA 4DF1A 4MJZA 3W7GA 3HG2A 3C56A 3VE7A 1SQ7A 3P62A 1O94A 1I2RA 3LCHA 2TYSA 4K7VA 5EKYA 2Y7GA 3TUUA 3NOEA 5CZSA 4O8RA 1A5AA 2FB3A 3G24A 4MIMA 4KFPA 1F05A 4AWTA 3WK3A 4LC8A 1LBFA 3DZ1A 3R89A 1TTJA 4LV9A 4BR1A 3G1YA 3M41A 3NQEA 3VNDA 1HUVA 1IIHA 2E1DA 1XBXA 4IPIA 3SGZA 3WJWA 2J9YA 1KBIA 2O7QA 4Y6GA 2YYTA 1H50A 1O95A 4X22A 3LBMA 3FLUA 4RXGA 2A4AA 4XKYA 1W3IA 3THQA 3UY8A 5C54A 3THAA 2BTMA 1A53A 1VLWA 2WO5A 1DV7A 4S2CA 3PSVA 3P8IA 4JGDA 2NUWA 4NT0A 2X16A 2YFOA 3S5ZA 3FJ6A 4IUOA 4GE8A 1SFJA 1GTEA 4M6PA 2Z6JA 1KTCA 5DY2A 1VH7A 1Y0EA 3LXAA 1I2NA 3STCA 2PE4A 3TQ0A 3UD6A 1TB3A 2P0OA 4LT9A 4UTMA 3JR2A 3FYPA 4S2BA 4UFHA 3M7WA 3PAJA 1OFBA 5D09A 2NZLA 3C2EA 1W54A 2VELA 3UY7A 1KM5A 1TPVA 3HG5A 1H1ZA 2I9EA 3KVJA 2ATMA 3LHVA 3OIXA 1SO6A 4UTTA 3QW3A 4U4MA 5D37A 5D32A 1TPDA 4FIRA 3S5NA 4JX5A 5D04C 1X6UA 3SZ8A 1TMHA 1TTIA 2ABBA 3FKRA 1AG1O 2VFEA 5KINA 4LTSA 4JY8A 1P1XA 4MY1A 3JS3A 4M5PA 1A50A 1VCVA 1AL8A 3OVRA 2YW4A 1XKYA 5HR6A 4QQ3A 1BKSA 3IIOA 3DHDA 3IIXA 3SI9A 3EX1A 1VR6A 4JYEA 4BF9A 1WA3A 3KOFA 2VFGA 4MFEA 1YYAA 1TTQA 2Y7EA 4UR8A 4IOTA 2ZFAA 2Z6IA 1FDYA 1W5NA 1DJQA 1SZFA 1YTDA 3W72A 2DP3A 4AWSA 3A22A 2Y63A 2CU0A 5AHFA 4B5NA 5BMXA 1LDCA 3LHUA 2FIQA 1WBJA 4O28A 3S5YA 2ZCGA 1J5TA 1K8XA 2VOMA 2I1OA 3VI2A 3TKFA 3W7LA 1T8XA 3NL5A 3W1PA 3CIWA 2DU2A 1RD5A 2ZYFA 5AHEA 1LRTA 3LCXA 3L68A 1WOAA 1JULA 1TV5A 2G5WA 3L0KA 4ADSA 2NWRA 4EF8A 3UXAA 2C16A 4QITA 5GVJA 1TJPA 1ZAJA 3B8DA 4PTNA 2PURA 3GDKA 4IMDA 3RLVA 4IMFA 3DAQA 3PY2A 2YXGA 1OVDA 3MP4A 3NL6A 3IGXA 2V5BA 3C8FA 1XDLA 1UUMA 1DHPA 1FWNA 2CLIA 1SW0A 4O16A 1ZENA 1YDVA 3S9YA 4MFDA 3W1TA 3W3OA 3L9CA 4UTKA 2CLEA 3WK1A 4JDYA 2QUVA 5U4NA 3BPWA 3M16A 5CPNA 1NEYA 5I3IA 4FX6M 2NX1A 1DBTA 2VKZG 1LOLA 2VFDA 3QMRA 3MI3A 2RDTA 3ABOA 1OK4A 1R46A 3MI2A 4A29A 4YXGA 2WNNA 1FCQA 1QNVA 1QPQA 2FDSA 3QW4B 2E5DA 3B04A 4O53A 1OF8A 2OCZA 4JTUA 4WJEA 1KFEA 2QCEA 3NM1A 1WQ5A 4DELA 2GQ9A 1JQXA 1ZNNA 3GNDA 2Y61A 3S6DA 2V9DA 4OT7A 2G95A 3E0IA 4ML9A 1KM2A 3HG3A 3TJLA 5A8GA 4UFMA 2Y89A 5LNWA 3QFEA 2CLFA 2PRHA 3GB6A 4PL1A 4O0KA 2NUXA 2YR1A 3SR7A 1MO0A 5FEZA 3GX9A 1R2TA 2IQTA 4TO8A 5MHBA 3DFNA 1T99A 3O05A 4NJJA 1GVQA 5F4XA 2KZHA 1TQXA 3O07A 4UFLA 1W5MA 3QH2A 4O18A 5KSWA 1YDOA 1WYIA 5E1QA 2FLIA 1ZHAA 4RKAA 3DHFA 4Q33A 3M6YA 4XTIA 1LOSA 2Q8LA 2D73A 2PCQA 3R8RA 1LROA 5CSRA 5HR7A 1KFJA 5E0KA 5G2WA 3C2FA 4HNTA 1XCFA 2NWSA 4N02A 4R34A 1EIXA 1KV8A 3S1XA 1GPWA 1U5JA 3L65A 4YCOA 2Q3OA 1O5XA 2Y85A 5BNKA 3LRLA 3TJXA 3Q2DA 5HMSA 3FS2A 4OU1A 5G2HA 3KRZA 3LXBA 1Z41A 1AMKA 2C6QA 4MZ1A 1Q6OA 3ELFA 4Y96A 1Q3NA 3STEA 1EB3A 2C0AA 1UJPA 5J5RA 3QEZA 1K02A 2RDWA 3CT7A 1P4CA 4BFAA 3W23A 2VC6A 1TPB1 3N9SA 3H55A 3PM6A 3BLEA 1QOQA 2ZRVA 1H7XA 1I2QA 1G67A 1V7YA 1FY6A 3LHTA 1VCFA 4PODA 1JRCA 2WJZA 4XKYB 1ICSA 3W7NA 2ZDRA 3WK0A 4E38A 3O06A 5TIMA 3GDRA 4A2RA 3IVUA 2A7RA 4H3DA 4IX2A 3IGUA 1KBJA 2QDGA 3M5XA 3NG3A 1OX6A 6TIMA 6ALDA 1J4EA 5TQLA 5DY3A 3G1VA 1EA0A 1XXXA 1LP6A 2Q8ZA 3P5ZA 4UMAA 3KVLA 4AWUA 4WX2A 2A6LA 5LKYA 1KM3A 1W31A 1N55A 3BGGA 3NYZA 1YXCA 1AW2A 1Q6LA 3HO8A 2OZ0A 5K7JA 4WY0F 4FX8A 2BLEA 1PHQA 2JGYA 4M7SA 5FEPA 4UTLA 1H7RA 5DXYA 1F76A 5G1TA 4TIMA 2QCFA 4AHQA 3HQ1A 5DCEA 4Z1DA 4JTIA 4WOQA 3BV4A 4AHPA 1FUYA 4RK8A 2YYUA 4NU7A 3BVJA 1PHWA 1W37A 1VRDA 3DKLA 3NEVA 3CTLA 2B7NA 3R5EA 1KA9F 4O19A 2A0NA 2C3ZA 3N34A 3W1XA 4NJIA 3NVTA 4LVAA 3LCLA 1S5VA 5ABTA 2ATSA 1EWEA 1YLVA 2O7SA 1E51A 3I7RA 4EVZA 3W07A 1BWKA 3LM7A 1MZHA 3UYCA 3VCRA 4JTJA 5LZLA 5BMWA 3MBDA 4JTHA 3NQVA 4KFOA 3FEMA 1EPXA 1IXPA 1VYRA 3BO9A 4IMCA 1XFBA 3GDMA 3GVGA 5SWUA 5DCBA 2P10A 1FWWA 1GEQA 2Y7DA 2QKFA 2B7OA 3LDVA 4DBEA 1CI1A 2FPVA 5DELA 1TYGA 2EGZA 1QCWA 3MHUA 4WD0A 5G2IA 5AOUA 1FBAA 3V75A 3OEXA 2NX9A 4FXSA 3BW4A 4IXXA 3WK2A 1Q6RA 1EP1A 3FKKA 5DCDA 1P0NA 1SO4A 3Q58A 4ZQNA 4LRTA 3G0SA 1PVNA 4ZL1A 4MKNA 1GVSA 2QEZA 3T44A 5F4SA 3MHFA 1KM6A 4JS3A 2QCMA 2J88A 1I2PA 4TX9A 4FO4A 4FIQA 3UPBA 3MUXA 1OX5A 4ADTA 3DFTA 3O15A 2RH9A 5F1VA 4GUHA 1S3HA 4K7YA 2AAMA 3MMTA 1TPUA 1JUBA 4TMCA 4M6VA 2Q3RA 5AC7A 1TSIA 2ZRUA 2OT1A 1PV8A 3P84A 4AEOA 3TIMA 1AW5A 1PIIA 4O4VA 3C52A 4O0ZA 4CNNA 1LRNA 1FCVA 3HMJG 4RZ6A 3PULA 1TQJA 1H5YA 1IF2A 4KWWA 3W6YA 1ZY9A 5EMUA 4N9CA 1B3OA 3G8EA 1Z44A 4O12A 5HUOA 1BWLA 2EF9A 3L67A 3W70A 2Z0IA 4H4IA 1NF0A 4K38A 2J9ZA 2YFNA 2GOUA 4UUIA 5HULA 5D2VA 2NV1A 1R2RA 3LLFA 4WQ6A 4ZQMA 3ZR4A 4UFJA 1W3NA 2VFHA 4Z08A 1OFOA 2Z2UA 4IMGA 4XUGA 5LHEA 2X1SA 4LS1A 2ZTJA 4QM1A 4TMBA 4HT3A 3NQGA 1J2WA 1N8FA 3QSRA 1TV8A 1TIMA 3G0UA 3NQ2A 3G1SA 4JYDA 1ML1A 3PUOA 1GQNA 4ICNA 1K8YA 3UQNA 4BI7A 2GVJA 2FB2A 4DBDA 1ME8A 3U6WA 1Z48A 4N9EA 4HSOA 3U2OA 2FPTA 5I3FA 1NFBA 1GT8A 4JR5A 4ZQOA 1L6SA 3TFCA 3O6YX 2JKPA 3A5VA 4FXRA 1OK6A 5D33A 3GXNA 2CLKA 5K9CA 1IXOA 2XN2A 3HG4A 3N73A 3KVMA 3DH7A 1VJIA 4LS0A 2VEMA 2FJKA 2VEPA 1W5OA 2CZFA 5EPDA 2ZZ7A 3LOTA 3CC1A 3BG3A 2A7PA 4GUIA 3S8HA 1ICQA 4AHOA 4N9DA 3BW3A 3NQMA 3A24A 1GYLA 4LY8A 1L9WA 3IIPA 4QIUA 3N14A 1KFBA 3ZWTA 2J6XA 1GVFA 3R13A 2QDHA 3RFAA 3T55A 1SO5A 5KZEA 1UASA 1LOQA 3VKJA 1FQ0A 5U7SA 4QSHA 2NV2A 1HTIA 1NVMA 1TTPA 4WY0A 1YTEA 1XL9A 5H2ZA 3RMJA 1L6YA 5DLCA 4MYXA 2CW6A 2RHGA 4XQ6A 2V8ZA 3NGJA 4K8EA 1FWTA 3K30A 3G1DA 1EP2A 3TH6A 4O17A 2A1YA 4NVTA 4N9BA 4OV4A 2J24A 1L2UA 4AF0A 4EOUA 4L4MA 2WKJA 3ABSA 3W1UA 1W8SA 1NF7A 2V5LA 4E2BA 3WFAA 3RK8A 3ABQA 1KTBA 4PA8A 1KLZA 4UFIA 3C0JA 4GC4A 3NAVA 2QF7A 3IRDA 3FOKA 3CLMA 1XBYA 4UTTC 4R53A 1WOBA 3BK0A 5AN7A 5KTLA 2TSYA 2ZZ4A 4JEQA 1H61A 1R30A 2P1FA 2WSQA 2V30A 4FNQA 3S1WA 5LGXA 3GZ3A 3M9YA 3PB2A 5EY5A 3C6CA 4UXDA 3TSBA 4LUIA 3EXSA 3VE9A 3HGSA 2V82A 1I4NA 5IM51 3NQ6A 1OFAA 4OGZA 1DL3A 1TPFA 4TU1A 4JIPA 1VPXA 1R2SA 2J27A 4K39A 3P61A 3QM3A 1ZCOA 4I7UA 5D2XA 3W1MA 4GUFA 3SSJA 4J9JA 1SSDA 4OWGA 3I7SA 3NDOA 4HNUA 3EWZA 3W7QA 3LXCA 1GTHA 1VLIA 3GLCA 1ALDA 3NQFA 1W56A 2Y88A 2GVGA 2E77A 1HFBA 1VQTA 3N2MA 5C55A 5LNSA 4JTLA 4MOZA 4CNOA 1OJXA 1I2OA 3L66A 4X3ZA 3SFKA 2YX0A 4FNTA 5F2IA 4TR9A 1KFCA 4N4PA 1M7PA 3MBFA 3NXFA 4DO4A 4PL2A 3WJXA 3M1ZA 3W7HA 3P5YA 1SUXA 3NQDA 3GNNA 1RVGA 1SSGA 2QR6A 3OBKA 4A3UA 1F74A 4EF9A 5AFDA 2WQPA 3M5ZA 2Y6ZA 3PC0A 1IXQA 3DBPA 4C1KA 3FIGA 1X8FA 4X9SA 1H62A 2W6RA 4LV4A 2ZQ0A 2B0MA 1A5CA 5C6MA 3EKLA 3T4CA 1QFEA 3TC6A 1SW7A 1GVOA 3EX2A 4N6EA 5D2WA 3IV3A 3EWYA 1W1ZA 1TRIA 5DBTA 3C2VA 3MW7A 2TPSA 3EWWA 4JDBA 5G4WA 4CNPA 1YADA 4IGHA 3S42A 3NQ8A 1UB3A 5HUPA 1EP3A 2WNZA 2ZTKA 3GDTA 3TW6A 4FX7A 2OJPA 3EX3A 3CPRA 4NX5A 5KZDA 4D2JA 2JGQA 3QPZA 3TXZA 1KFKA 3W2JA 3E9AA 2F7FA 2ISVA 5L6UA 3DFQA 3G8RA 1SZGA 3TQVA 7TIMA 2QCNA 5I3HA 3G18A 2CZDA 4GXMA 5D03A 4RX0A 3F4WA 4QAIA 4ZVJA 5HWMA 3QF0A 4C1LA 5F2LA 1JR1A 3WJZA 1FDZA 3IGSA 1R47A 4XTDA 1X7FA 1YPIA 2QJHA 3EX6A 4AVFA 5F1UA 4AH7A 3E49A 3QJAA 2G97A 3C2OA 4DO6A 4R7JA 3TXVA 1G4PA 1KM0A 2VENA 3QSTA 4HNVA
chains in the Genus database with same CATH superfamily
4ECLA 3KL0A 2DIJA 2X40A 4WR3A 1O5QA 1S2TA 3C4UA 4YWIA 4JFVA 5C9WA 1H7OA 3QC0A 4XVEA 3VDHA 3ATZA 3L2IA 2CYGA 2PLJA 1VP5A 5A8OA 2VC9A 2C79A 3K1DA 3T42A 1CGTA 3MSYA 3O6DA 3U0HA 2FTPA 1OFEA 3A13A 3B8SA 3KHJA 1YRRA 2D3NA 3T81A 1S2UA 4DPPA 3UG4A 3TW9A 3CS2A 3UCQA 4JTSA 1GKQA 4NG3A 3TZNA 2QCHA 3LRMA 1U83A 4LS2A 3FJNA 4XD5A 5FJPA 1FX6A 2ZA2A 2ZA1A 2NUYA 1NOUA 4QISA 2YL6A 1X1ZA 5K4XA 4XSLA 1V0KA 5G5IA 2D3LA 3LTPA 2VEIA 3PPFA 4UQBA 1Q6DA 3QBUA 1B30A 1IEIA 5EMMA 3M0ZA 1BGGA 4HD5A 5I2UA 3WH6A 3UBPC 1QWGA 4OOUA 3PWGA 3EX4A 3GUWA 3I65A 1Q85A 5DMLA 2IUZA 1OINA 1D2KA 3E96A 1IEXA 3RR4A 4DB7A 3NQBA 1JPDX 1WKYA 2RGMA 4AIBA 1MXSA 2DT2A 4MWAE 3W88A 3CNYA 2X1IA 4D6IA 5FJUA 1UKPA 3V4BA 3WH9A 4H01A 3OZMA 1NWSA 1Y5XA 1EHNA 2EEXA 3RF9A 6REQB 3U7BA 4IFOA 5CG0A 1EA9C 1V02E 3APYA 3WF3A 4AX6A 2PGEA 3SIZA 1WDDA 4YTSA 4ZQCA 3UA3A 2ZZ6A 1PYFA 1ZP4A 4W7WA 3H21A 4V2XA 4ZGYA 3EEGA 2O55A 1E0XA 1NAL1 4PCNA 2QQ6A 5FSDC 3CLWA 5AYXA 3GU2A 3W82A 4C6PA 3N2CA 4WF7A 1O5RA 2HE8A 1WO2A 4FLQA 1FWSA 1JVNA 2V5CA 2PDQA 2PMQA 3P8JA 1DTUA 2EBNA 3EXTA 5CPTA 4L7ZA 4PYSA 4HU0A 3T1GA 2GQ3A 3POCA 2WB5A 1UWQA 5CPLA 3UG3A 1ITUA 4OV9A 4WSJA 1A5MC 1SMAA 4LUSA 4NJHA 2WZMA 2QCGA 2LLEA 1FKXA 1PX8A 1T0OA 3UPMA 3MVIA 4MHBA 2VNCA 4HBKA 4KGLA 2EAWA 4RZ5A 3S2NA 3ARUA 3H2AA 2QIWA 4QE5A 1F4HA 4IXHA 3TJIA 4GQQA 3W7OA 3LZ3A 3DFPA 1RH9A 1A5SA 5JH2A 3W9ZA 2HEJA 4IHCA 4ZQRA 3UJFA 4LF1A 2R9RA 1MFUA 1G4TA 3STPA 2VI0A 1QI4A 1RHCA 2BY2A 1E15A 3H24A 4GZEA 3F4CA 3PP7A 3EB3A 1KD0A 1UR9A 2UV8G 3BARA 4MYAA 4R9OA 1EJVC 4GGHA 4Y8FA 3CHCA 2ZUWA 2J62A 4AZ5A 4EXQA 4UMBA 1PE1A 4OECA 1KCZA 3SECA 2X0YA 1XWYA 5LA2A 1EYEA 1LORA 4GY0A 1OG0A 3DUGA 3OLGA 2WSYA 1ZBCA 2GJXA 3TTOA 4MY9A 4E4FA 3VD3A 1ECQA 1Q2RA 4H9VA 3V1PA 2NXGA 3UPWA 4FEZA 3CEUA 3CGTA 4O57A 1FWRA 3MUIA 3KFTA 4P2VA 4KKXA 3KDOA 4AYSA 1EJ7L 3B05A 1TVNA 2OX1A 3KXQA 3PBWA 3B9OA 4WSHA 1VYSX 3MANA 2OO0A 2CZEA 2ZIDA 1QU4A 5D8WA 3M0JA 3A21A 5DXXA 4OE7A 2ZZ5A 2DT1A 2J8FA 2I57A 3NIYA 4LB3A 1GG1A 3GYCA 1NARA 4UZUA 3QC3A 2HISA 2QUUA 4PFMA 2ZZ1A 2I14A 3V3WA 1RR2A 1C8VA 2IPWA 3LERA 3EKZA 3IWPA 2DORA 2GGEA 4I7WA 4BQ5A 4QNEA 4CN4A 3UWEA 2E6AA 3BDKA 2WVVB 1U1HA 2DPEA 5IBXC 2E6DA 3DFHA 1TA3A 4LB4A 3B9EA 2OEKA 3IARA 4YJ5A 4BQ3A 1GW1A 1W1TA 5CZ0A 4A2SA 5DT7A 1JQVA 3EXRA 3O6AA 1JL8A 1K8ZA 1ZTVA 4O54A 2BODX 1E9LA 3L21A 4S38A 4X2RA 1I1WA 5K9DA 2ON3A 1X6NA 3NO1A 3WFLA 2FYMA 5JBDA 2VVSA 3TYZA 4ORMA 3CB3A 3AQUA 2VX6A 1QPNA 3GXIA 4J3TA 1UQYA 1R6WA 3HBLA 3NJ3A 1UD2A 4P8WA 2G3IA 5FESA 3V5FA 5B7ZA 4PMQA 2CZ5A 4LAUA 2QPXA 5DN1A 3C8NA 3WLQA 2DW6A 4CCZA 1B3WA 3QVQA 3OVQA 4QCFA 4QJ3B 1Q8JA 5CSSA 2EG7A 2OGJA 1JEZA 1H7NA 4PTWA 3NL2A 2HROA 3P67A 3WMSA 1XDJA 2INZA 4NQ1A 2XN0A 1PS9A 4JFSA 3W01A 4C7DA 1DWHM 4ZXOA 2PDLA 2H8ZA 2R1KA 2XINA 4M0XA 1ME9A 4C6FA 3GTXA 2ZC8A 4GUJA 1SZNA 3GIPA 2OZTA 3UU0A 2BVTA 3CH0A 3M6DA 1GOWA 1QPOA 5BU6A 2Y62A 1XV8A 3W7CA 3KRSA 3WNNA 2Z4GA 2CLPA 1E0VA 4HPNA 4Y9MA 3BOXA 1Q6FA 4HYRA 3TYBA 2GQAA 3MJYA 4GKLA 2VWTA 5MF5A 1RCQA 3BMWA 4C65A 1YDYA 3B0VC 1IZCA 1NFGA 4UOQA 2HRWA 1FWJC 4CQBA 3GHSA 2Z2AA 2VL4A 4M51A 2R82A 1PJ9A 1ENUA 3F7JA 3WDRA 3KHDA 2YOCA 5D2YA 3AIUA 1ISWA 4LU0A 3W2KA 5A69A 4GZ7A 2XSXA 2OYKA 2Z00A 4PUKA 4JNZA 3T40A 5H91A 3DHUA 2DV0A 1BG9A 2EHHA 4W86A 2DZSA 2CBUA 4LOCA 2FPYA 3MA8A 1EO7A 4L80A 3UWUA 4LUTA 4AXKA 1RQEA 3KWSA 5AC8A 5C9RA 3BLKA 3URAA 1B57A 4JIEA 2PU1A 4F0KA 1TCDA 5C9XA 4GYFA 4KWOA 1OFDA 1SYTA 3XINA 4JYFA 3SN0A 4LCQA 3M44A 3ZIZA 3KX6A 4JZ5A 3DI0A 3C5QA 4B15A 2XVNA 4H7VA 2W27A 3RGTA 4I9TA 3C2RA 3GXPA 4MPQA 4HPJA 3KCOA 4P8VA 5HNRA 1UR0A 3M0IA 4R5EA 4PMXA 4DQWA 3DU0A 4NZFA 3GH5A 3W1LA 4GFIA 3MC5A 2EG6A 2NLIA 3TYDA 5A8NA 2BWGA 4DWSC 1EQPA 5B80A 5F2MA 3H53A 3OG3A 4DZAA 1R9YA 4XZLX 3RX4A 3LHYA 2ZRYA 4G9PA 2GVLA 1P48A 5D2TA 1BWVA 1N7KA 3SDOA 1F5ZA 4PCSA 4O8AA 2ZZ3A 3UNDA 1LRQA 2DSVA 1GKRA 4Z1CA 4IIBA 3TA6A 1XIBA 1P0BA 3MUAA 1M7XA 3GFZA 1RP9A 5HBFA 1E70M 4AMCA 1QAPA 3VNKA 3AXXA 2C15A 3ABRA 3A6OA 2GJPA 3GXMA 1V5XA 1RJPA 4GISA 1GG0A 1Z89A 2BS9A 3II1A 4I8DA 3EDEA 1QUMA 1ODUA 4NNCA 1ZB5A 5HINA 1LCOA 4GABA 3IRSA 4L4PA 1G6CA 5CPOA 3ZM8A 2OB3A 3PUDA 5CSYA 5EBAA 5A8MA 4LC6A 4S3EA 4DYEA 1VYPX 1TPWA 4BWLC 1ZP3A 1IZKA 1QO2A 3ZJ6A 3MI6A 4RV8A 3FJ4A 2OKTA 4B2DD 1UUQA 3VGHA 1XDMA 3FFSA 3TYEA 1RUSA 1H49A 3FNDA 3P7YA 1VENA 1YKWA 4GVGA 2C1IA 2BXYA 1XH0A 5A95A 1PZ2A 4CUCA 3PUEA 2VFFA 2E9BA 3PTDA 2RGLA 2ACUA 5I02A 3HIJA 2DZPA 1PCKA 4BCEA 3B4YA 3IPWA 3G3DA 2W0UA 3T0BA 1UKSA 4AMAA 3VDCA 1JNEA 1ZBWA 1KW1A 2HVOA 2A21A 3PFRA 5REQB 3W83A 5GNYA 4JNMA 3PR2A 1VHNA 4UNIA 2HJPA 3LHZA 3TV8A 2ISSA 4XX6A 1UQZA 3GNPA 3SUVA 1RP8A 1WV2A 2TRSA 4UQDA 1UUOA 1G4SA 2WV8A 3W22A 3MP5A 3LBCA 4UFKA 3ABXA 4IGMA 2HE5A 2H3DA 4EK7A 1E6ZA 4GBUA 1B9BA 2JKEA 2HBVA 3G1XA 3GHUA 1HO1A 5GJMA 4PMVA 1X6LA 2PRMA 8CGTA 4GQRA 3NTYA 1LLZA 1T96A 2VD8A 1AQHA 2EKCA 3FHQA 1JFHA 3EWBX 1XYBA 1TPH1 4Q4RA 1B2YA 1TJRA 2HSAA 5TAOA 3GD6A 1B4EA 4ONVA 5AB3A 1MDRA 1RD6A 1O12A 2FMNA 1GWJA 1OT2A 4TVDA 4BS0A 4IZGA 5CJMA 4HK6A 4H8HA 4WGHA 3GHRA 2J7HA 1QOPA 2Y5EA 3M5YA 4CU6A 4GNJA 4PTXA 2BY3A 1AH0A 5BOEA 4XISA 3P93A 2E4TA 3LCHA 3PZUA 3CUIA 2VDIA 4PMRA 3G24A 4MIMA 1E72M 1C9WA 3VZYA 1TTJA 4BR1A 3G1YA 3VNDA 1IIHA 3WJWA 2PDGA 2O7QA 1YX1A 2I16A 3OODA 2Z24A 4KEVA 3WLJA 1E6RA 1C7TA 2A4AA 4XKYA 4Y9NA 4C6NA 5C54A 3THAA 2BV9A 5TD4A 1QHOA 2CERA 4JBRA 1DV7A 3V36A 4NT0A 3VOJA 4AD5A 4CNSA 5CPQA 1WZMA 3GU9A 4DM2A 4HA3A 1E0TA 3UESA 1NU5A 3QOMA 5M5DA 3D5HA 3R43A 1ECEA 1SFJA 4M6PA 3CAVA 1VBGA 1KTCA 4RNHA 1FWHC 4J3UA 3N6JA 3ARTA 4ML4A 3A4WA 1I2NA 4GX8A 4Q4SA 3UD6A 1FH8A 2AAAA 1TB3A 2Z2BA 2P0OA 3EYPA 3VK5A 3TN6A 1X1NA 2E9MA 3PAJA 1R9XA 2CBVA 1KM5A 3HG5A 4H6QA 3KVJA 2ATMA 3LPGA 3CZLA 2HVNA 1DJZA 1TPDA 1DWAM 1VEPA 4FIRA 2J25A 4JX5A 1X6UA 1AJZA 3M0YA 5I00A 1UJQA 1AL8A 3P3BA 2YW4A 1HP4A 1HKMA 2AL2A 4XAPA 3PNUA 3DHDA 4US6A 2DDXA 3MQTA 4JYEA 5A8PA 1XGDA 4BF9A 2FTWA 2VFGA 4HB7A 1FKWA 1YYAA 4ATDA 5BRQA 2BDQA 2ZFAA 4B2DA 1DJQA 1RBAA 1SJDA 1SZFA 2DP3A 3EOEA 4RPPA 3A22A 4KF1A 2CU0A 5AHFA 1IZJA 4O28A 2I1OA 3TKFA 3NL5A 5AHEA 2D2HA 4AVNA 2CZVA 1LRTA 5RUBA 1KCXA 2OU4A 3UXAA 2C16A 3KTSA 2PURA 3RLVA 3AIQA 1UR3M 3NL6A 3KUMA 2V5BA 3C8FA 4GJIA 3KLKA 1I60A 5JBFA 3DEQA 1QI0A 5U4NA 3M16A 1NEYA 1UH3A 5D4YA 1IT8A 3AS3A 2PDWA 2NLYA 2XIIA 4F66A 3CHFA 4EACA 3ZLHA 4YXGA 4REQB 2ZOXA 3WF0A 3UYIA 1QNVA 1OB0A 1QPQA 1KC7A 4O53A 1EXPA 4EXAA 2OCZA 4FLOA 3F2CA 1KFEA 2QCEA 2GQ9A 1BPLB 1ZNNA 3GNDA 3VA8A 4BA0A 1YNYA 2PLMA 2Y61A 2PWUA 3SGGA 4OT7A 4CN6A 4ML9A 4H04A 3HG3A 1WUFA 2Y89A 5LNWA 3QFEA 4RE3A 2YR1A 3PTKA 5DX7A 3GVRA 3GX9A 3VIHA 3AALA 3DN5A 2IQTA 4TOQA 1CXKA 3UW6A 1QWKA 2WJEA 4NJJA 2Z25A 5F4XA 3WCZA 4NI3A 1UP2A 1ADSA 1W5MA 3BQ5A 4PB4A 1YDOA 4RDWA 2VOTA 3AMDA 3H7UA 3UR7A 3GSMA 4FAMA 4H9MA 2VR4A 3FA3A 2PLCA 4NL1A 1XCFA 4N02A 4MTVA 2V3DA 3IJ9A 4IP5A 1LUCB 1DJGA 1J8VA 1I6NA 4DX3A 3QGVA 3KRZA 1GKPA 4YHGA 1Q6OA 1Z8AA 5I23A 3RMEA 1HX0A 1VBHA 3A4XA 1AFSA 3STEA 1PBGA 3WD3A 4G6CA 5I09A 5J5RA 3I3DA 3QEZA 1UYQA 4NAEA 4LJ3A 1JD7A 4FOJA 4H41A 3VMOA 1H11A 2PS2A 4H9XA 1C7SA 3PM6A 4PR4A 3MZ2A 1JRCA 1K77A 1SFSA 3XISA 2ZDRA 4W88A 4LEQA 5TIMA 1QW8A 4A2RA 4MB4A 1RCXB 2GWNA 1KBJA 2VJXA 2IPGA 1Z6KA 3M5XA 3NG3A 4W8LA 3WD4A 4C7FA 1WDPA 5FJIA 1B3XA 4AWUA 1A47A 2RAGA 2CETA 3KP1A 1JCTA 2A6LA 2VDHA 2UWFA 1W31A 3NYZA 1YXCA 3BV7A 4QG8A 1XHGA 3HO8A 2OZ0A 4PRWA 4FX8A 4CU7A 1LL4A 4M7SA 1CGYA 2CNCA 4AHQA 4Z42C 4JKKA 5ABEA 1Q2SA 2NSXA 4HQVA 3VIMA 3AIVA 3A4JA 4NU7A 1LQ0A 1W37A 1FOBA 3NEVA 2B7NA 3MKKA 1EIBA 4O19A 3W1XA 7TAAA 1P6BA 4LVAA 3SUTA 2WC4A 1YLVA 4E4PA 3W6LA 1U5HA 1MZHA 3SIMA 4I6KA 1R0MA 4JTJA 5FL0A 1HJXA 1A3XA 3MBDA 3GS6A 1DPMA 4Q7BA 1ZBKA 1EPXA 1VYRA 2XM1A 3BO9A 3HPFA 1XFBA 3GDMA 3K46A 4Y2WA 1FVPA 2P10A 3VGGA 4F0RA 2B81A 3QV9A 3KM8A 4C6BA 2QKFA 2J77A 4DBEA 2EGZA 4WD0A 3CZKA 2YIHA 3KW3A 3THDA 1XGZA 4TX6A 5DCDA 1B1YA 1BRLB 3URBA 1LG1A 1X97A 2OOFA 2XFYA 2BB0A 1W2PA 3G0SA 2VRQA 2WPGA 2QDDA 1EGMA 1QK0A 1FHDA 1I2PA 3KZPA 1R38A 3E2RA 1RALA 4BF5A 3B97A 4FIQA 3WQPA 4ADTA 3O15A 1C92A 4B5VA 5HATA 2RH9A 4AZ7A 4GUHA 2YA1A 3FXGA 4Q8VA 1XRVA 1S3HA 1JUBA 2Q3RA 3WDIA 5AC7A 1PV8A 4ILSA 4BHYA 2CEQA 3RILA 4AEOA 1QHZA 3D3AA 4NHVA 2VC7A 2G3MA 1GQKA 1LRNA 1XIJA 4V15A 4RZ6A 2VEFA 1H4PA 3W6YA 2MUCA 5EMUA 4RUBA 4N9CA 3G8EA 1UMLA 1NELA 4O12A 1DJWA 3L67A 4H4IA 2PDPA 2ZUSA 4K38A 2QMKA 2A79A 2WK2A 5HULA 2C7FA 1R2RA 5A2BA 3ITLA 4B9YA 4WQ6A 1XYAA 3ZR4A 1W1VA 2VFHA 2IPFA 4IMGA 2X1SA 4FPSA 4LS1A 4XD6A 4WK9A 3VVGA 3CUHA 4S3JA 3VNZA 3ANUA 3H4GA 3QSRA 3G0UA 1GYMA 3F4DA 4OBSA 3UQNA 1SZRA 2J7EA 3TJ4A 1YHTA 3UZXA 4DBDA 2NQ5A 1AVAA 3JU2A 3U6WA 1XGEA 1POKA 1W3KA 4ZQOA 5C7VA 5FIPA 3AIRA 1I9CB 4FXRA 1OK6A 3GXNA 3TTEA 2FZDA 2CLKA 3KRBA 4YIWA 4H6EA 3D6NA 3HG4A 4Z17A 2PDXA 3KVMA 3DH7A 1VJIA 1BXNA 4UCFA 4RW5A 1QW7A 1V77A 2GUYA 3CC1A 5HMEA 1E0WA 3LSBA 4Y7EA 2A7PA 1J10A 1ICQA 3A24A 3BZGA 4DJDC 3W81A 3ZWTA 4AISA 1GVFA 2F61A 2AQOA 2WKLA 4GJJA 9RUBA 2NV2A 4RDYA 5GQBA 1ADDA 4BQ4A 4Q6JA 4AD1A 3I4KA 5I07A 5H2ZA 2FVLA 3H2FA 2X42A 3N9KA 2L5HA 1JXKA 3VIFA 2ZXAA 4DJFD 3VUSA 3W4RA 3VC6A 4XQ6A 1FWTA 1L6GA 4A8RA 1Q65A 2E40A 1EP2A 4MJ2A 1XIMA 4NVTA 3AU2A 1T6MA 2XU2A 2FHCA 2J24A 3CAKA 4KT2A 5I06A 4AF0A 4L4MA 2HBXA 4E3TA 5DRCA 4QG9A 3W1UA 5DT5A 2V5LA 3WFAA 3ABQA 1RLDA 1Z69A 3UJSA 3BK0A 3WQCA 4W5UA 2NQHA 4GPNA 2P1FA 5EY5A 3WMLA 3K4WA 3NZPA 3TEVA 3CK5A 4I8YA 2V82A 1V3LA 1E3XA 3SFWA 1DL3A 4V28A 3AMKA 5AZ1A 4MAZA 1R2SA 3IJQA 4K39A 4ZA0A 3QM3A 1UIOA 2F6UA 1K9EA 3NDOA 3EWZA 2Q01A 2VQTA 3HFTA 3LXCA 1UD5A 2QV4A 2PLKA 1L8NA 3CV6A 4LH8A 4YTUA 3UERA 3UT0A 4V1YA 5C55A 3A3WA 4CNOA 1OJXA 1I2OA 3SFKA 4PB5A 1J0ZA 1YIXA 1MDLA 3N15A 4TR9A 4N4PA 5D9NA 4HHHA 3M1ZA 3W7HA 3GNNA 3CUFA 1NP2A 2QR6A 4LYPA 1F74A 5AFDA 4WRHA 1IXQA 1ZPTA 3DBPA 2UY2A 3FIGA 4UWMA 2XH7A 3VKAA 1QT1A 2V67A 1K4GA 1H62A 2ZQ0A 1UMYA 2B0MA 1A5CA 1EC8A 1QFEA 4HZMA 4Q6XA 4GY1A 5CC7A 4NYUA 5D2WA 1TWIA 3L4WA 4F79A 1W1ZA 3UP8A 3PZNA 5DANA 4CNPA 1YADA 3NQ8A 2Z1WA 3C0SA 3V1HA 7CGTA 3NUKA 1NDYA 2PWVA 3EX3A 1SR0A 4LAZA 3L4YA 5KZDA 2YCLB 4D2JA 3VD9A 4YNGA 4R9XA 3E9AA 3DFQA 1A3WA 3UGRA 4GMEA 3I6EA 3WQOA 5D03A 4RX0A 3GHTA 4W85A 3PFMA 4PUEA 1W1YA 5JVLA 5CEWA 3GXFA 2G50A 3COTA 1FTXA 3CAWA 3E49A 3TXVA 2D2OA 1X98A 1XLEA 1QMLA 1ZFJA 3P60A 4EX4A 2XH4A 4R27A 1JGIA 1AH4A 1WCGA 2OSWA 1MMFA 1DKWA 4R7OA 3NPWA 3T0CA 5L9FA 1LQAA 1C9DA 5BXTA 4MB3A 3WDQA 2PZNA 2GVYA 1RSCA 4ZODA 1UKQA 4HNNA 4OUEA 3ZO9A 4KPLA 9XIMA 4POCA 4ZSTA 2W66A 1RPKA 1E6XM 2R94A 4Z1YA 3LYEA 3DXIA 4L5ZA 5KEZA 4XKMA 1R3TA 3LB0A 1TO3A 3LEPA 3CQ0A 2E28A 3RM9A 1W5QA 2BOEX 2X41A 2WLYA 1HKKA 4C7GA 2RKXA 4UNLA 4O1CA 4UBPC 3ONCA 1KTNA 3LGDA 2YA0A 1CXHA 3GG1A 3M46A 1V4YA 3E38A 3FJLA 2JQXA 1VHCA 2DSZA 3P74A 5XIAA 2BNJA 3CL8A 2VUYA 1E6NA 1OCQA 1MXGA 1Z7AA 2EPHA 5CBJA 3HPXA 1W9VA 2QULA 3YPIA 4HN4A 2NXIA 4HPXA 1F73A 4H8UA 3FAXA 3WNKA 5AYBA 4ZO8A 1TV7A 3AYSA 2FZMA 3OOQA 3MS8A 3MB9A 2QLYA 2ZWZA 1AQMA 4DJFA 3ZT6A 1LF1A 2Q02A 4FMVA 2F6KA 2XTKA 3MWAA 1BEUA 1H60A 4WY0B 3M0HA 4CQCA 3T2QA 4IPLA 1OABA 1NSJA 1SJCA 4PN2A 1RCOB 4FF7A 1G4EA 3WEMA 3B3DA 3W84A 2YL8A 5CPMA 2DZUA 5JUVA 2DSKA 1VFSA 4AWEA 1H63A 3NPVA 2ACQA 1QNPA 3KDNA 1UWSA 4XBKA 1K8CA 3W7MA 4NX0A 1WKDA 3BSGA 1RK5A 1TJ1A 5EB8A 3R8HA 1DTNA 1M1BA 2WZTA 1MUCA 1Z42A 1KRBC 3E02A 3DYMA 3MO4A 4LYKA 2C71A 1D9EA 3LS9A 4TTGA 1XBVA 4TV6A 3G1FA 2NXHA 5AECA 1F7BA 3UXLA 1CLKA 1ESWA 2J66A 3EA1A 4Q32A 2R6OA 3UR8A 4L4LA 3C0LA 4XAFA 3W24A 4U10A 1JCJA 4G1KA 3DOPA 3W73A 4NY2A 3L0GA 4HZ6A 1A5LC 1R7AA 3HQOA 3NZ1A 3N2BA 1GPFA 4DAIA 4LF2A 4DBUA 4AVOA 2WVTA 4O1AA 2BXVA 2YBUA 3HN3A 4A22A 3VOFA 5AC5A 4TV5A 3LSCA 5HJLA 2GSEA 3EOSA 4PUDA 1IE7C 3A5FA 5HNTA 4A8LA 1LTDA 3OLIA 4TUFA 4HGXA 4NZ3A 1V6TA 2WQDA 1QTWA 1RY8A 4UTUA 3M07A 3L2LA 4AZCA 4PUUA 4G7FA 1TJ0A 4UR9A 1VIWA 1Q45A 3DFSA 3IUIA 7PTDA 4NI8A 4QSFA 1XLLA 5D02A 4XZBA 4PTVA 3NM3A 3DKJA 4GFSA 4M1RA 1LL6A 1D3GA 3JW7A 1Y8BA 3UR2A 4R88A 4LGXA 2FFCA 3IVSA 1ZGDA 5FOOA 3H7RA 1S2VA 3GO2A 2Y70A 3T07A 3QTPA 3AHTA 3G1HA 3L4VA 1I8JA 1UR2A 1I0BA 4RLIA 3IANA 4MVAA 3WF2A 1WBHA 3OJGA 3TROA 2ZRXA 3TFXA 1XLBA 6A3HA 5HMDA 3G3MA 4D6EA 2XN1A 5FF4A 4RJEA 4GUGA 5KZMA 5LGZA 1IIGA 4LVBA 4F0HA 1OCNA 4ALDA 3NL3A 1HJQA 1TUFA 4NAFA 1DQXA 3Q45A 2KAUC 4DO7A 8XIAA 5FJOA 4MF4A 2HTMA 1DQUA 3ZFHA 2QAFA 1REQB 4AC7C 2XSAA 1F6YA 1W2VA 4YL2A 1HP5A 1JZ2A 5E6ZA 2AQWA 1K9TA 3QY8A 1WAUA 3MV01 1B3VA 1E6QM 3H6OA 3MJMA 4W9TA 4O15A 3GAKA 1EZ2A 1O4UA 1OGBA 1X1OA 5GNXA 2PTYA 4IPPA 4L1GA 2WWDA 3DERA 4GKTA 2P53A 4NRSA 5LNVA 1SJBA 4M56A 1UWRA 3N19B 1X39A 3K5XA 4QJ1A 3TAOA 1PSCA 1KGXA 4FP1A 3LENA 4NNAA 7ENLA 3S1GA 3VMNA 4QLJA 2WAGA 3M0XA 2UY5A 3BANA 4N2YA 3QLDA 4O50A 4K68A 2WSKA 3MY9A 2QUTA 3ITTA 4JTEA 4D6JA 2TODA 2WM0A 1BD0A 2HS6A 1L8PA 3TR2A 2FVMA 3W2NA 4B90A 7REQA 2QAPA 4Q8TA 4GGBA 1XKJA 1XF0A 2QJNA 1JI2A 3EDFA 3EWXA 3GK0A 3E3HA 3W0KA 3KAOA 3RPMA 2NVDA 1LWJA 3TYAA 1TFVA 4DEFA 1E4IA 1O60A 2WW5A 1P7TB 4CVUA 3EDJA 3WNPA 1V6YA 4D72A 4W93A 1S5TA 4YTRA 1EF2A 4C6QA 4L4OA 4I9AA 4MNKA 3A47A 3DI1A 3QY7A 3DGRA 3IJIA 1EJRC 2QNEA 3U2CA 3GR7A 3VKCA 1H09A 4C6CA 3USBA 3UWVA 2DZXA 3CAQA 4NILA 4GRSA 4Y9AA 3NA8A 4J27A 2I17A 4LW7A 2WMHA 2ALDA 1CEOA 4WHBA 4KERA 1KCLA 1ONEA 5LHFA 3RJYA 2QMJA 2V5KA 4HA1A 3H2NA 3EMQA 1LT7A 4GCXA 1JCNA 2X30A 4JY9A 5C2XA 2BZNA 4WEVX 3AUOA 2D0HA 1JZ6A 3TNOA 5K2ZA 1QATA 2J47A 1VF8A 3EOUA 3REQB 3AFBA 1UR1A 5K9XA 2QHAA 1P0EA 2DUZA 4H6RA 1JYNA 3B9NA 3FA5A 3GZAA 3FVDA 5CH9A 3NR0A 1H7PA 3CIXA 4HK7A 3RLUA 1JYXA 3U2ZA 5GPRA 2QW5A 3B8VA 3FSTA 4G56A 3HGRA 1BSIA 1DHKA 3DG7A 4UR7A 2O9TA 2QCDB 1EGZA 3D3FA 3ITGA 1E4LA 3L5MA 2OR2A 2E5CA 2OLAA 4J5NA 5FSEC 3ZMRA 3MSRA 5IXEA 2WBKA 4L9ZA 3I7QA 3WLKX 1AQFA 3KZSA 1BVWA 3CUZA 2DZTA 4FK9A 4Q7IA 2OWXA 4OQVA 3MHGA 2QJIA 3BCJA 3FGCB 3K4AA 3L0NA 5XINA 2YA2A 3GR8A 4H8VA 4JIQA 3M0LA 3CASA 1S5WA 2PDNA 1V3MA 3E2VA 3N4FA 3HGOA 4WZHA 1G5AA 1V08A 3PAOA 1H1NA 1UZDA 1LG2A 3V0TA 1BG4A 3W38A 3WNLA 1K7XA 3O6CA 2MNRA 4AIOA 2INEA 3POHA 3EZ4A 4XZ9A 2VCAA 4MWAB 1D8WA 4HJWA 4IGNA 4M1BA 3W7RA 3R11A 4HTBA 5IRPA 4US5D 1VEMA 3LGGA 5CGQA 1TWSA 4M82A 1WDSA 5HAOA 3WBAA 4IG2A 2O56A 4HMDA 1P1MA 1EXBA 3W71A 4KMQA 1LL7A 4X2PA 2JFEX 3ZS4A 4S3AA 3HF3A 3GYEA 3O9NA 4DJEC 4KCVA 2CLMA 4UTWC 3TQKA 3ZYZA 4OBRA 4D71A 2D2JA 3BJFA 1TV2A 3EPMA 6PTDA 3Q65A 3GDLA 1BXBA 1JDCA 1F6KA 3NGFA 1W3TA 2OFJA 2H6RA 3GTNA 5D30A 1V3HA 2FVKA 4LCRA 1VD6A 1A49A 2J7DA 1ZJHA 1XBZA 4K8HA 2CITA 3DBNA 3CIVA 4NSBA 3PG9A 1Y5VA 4DXVA 2WHLA 3P82A 1Q4WA 3UJ2A 1XYLA 1DORA 5AC6A 3KL3A 4CQAA 2I9UA 1VC4A 3SQMA 3WLLA 3VKDA 4IFRA 5IHSA 2Y1HA 3H2OA 4DF2A 3VGDA 2OGYA 4PMUA 2DIKA 1CW2A 4Z0SA 2PTWA 2XVKA 4QTGA 3ZSTA 3B03A 5D05A 4NJGA 3NZRA 3VZZA 3M64A 8TIMA 1OD8A 1FCUA 2WHJA 2CLLA 3CZEA 2DUAA 1YTKA 1DP0A 4NNBA 1JDEA 2A3HA 1SPQA 2QCCA 4JHZA 3CPUA 3ITYA 1UA3A 1H51A 3CM4A 4I5UA 1F4AA 2X09A 4S3DA 4M29A 4LXFA 1EJWC 2P76A 2W61A 3ZVHB 2AL1A 2OWCA 1DE5A 4XIMA 4IJRA 1R5YA 4X60A 4A21A 3WEOA 3S47A 1OX4B 3QPYA 1ZCCA 2OTDA 3OGSA 1MEWA 3SSZA 3B0YA 1DQWA 2XG9A 4OBTA 1KKOA 3R94A 2E6FA 4R7WA 1HL2A 4ZBCA 2BOGX 1KBBA 3BXWA 4L9YA 4LUJA 3AO0A 4MPKA 2FJUB 9XIAA 2QCLA 1ADOA 2YPIA 4NUWA 1QO5A 5BOOA 3RLGA 4G7EA 4P8XA 4A3HA 1EJUC 1VGAA 1Z9AA 4KWUA 4D6HA 4A35A 3WH8A 3D47A 3ICJA 4WDUA 4JTQA 1RAKA 6CGTA 1MNZA 3RRXA 1GEHA 1XUZA 5FF3A 3EMZA 2EPMX 3UWYA 4WJXA 1O5KA 2FGBA 1OFRA 3GTIA 3BWWA 4GZIA 4DYJA 3T78A 3V5CA 1BTCA 4LNYA 1R85A 4LVGA 1GOQA 4PMDA 4XUYA 4PMJA 3FYOA 3VD7A 3R0UA 2AQVA 1ZSXA 1IXNA 4AY7A 3TONA 4LCSA 1RPXA 3BGJA 3HPZA 4Q4KA 4HTYA 4GJ1A 5BXRA 4HYVA 2DH2A 4XZNX 5HPCA 3OO2A 1RV8A 2BASA 2FZ9A 2HDJA 3QQWA 4QDPA 4Y9PA 3AIEA 4G1NA 3WH7A 3TTQA 2ZXBA 3VOCA 1C8XA 1VFUA 4JXCA 3NOYA 4J1OA 3W2UA 2WNQA 4P61A 5LNRA 3H8AA 1V02A 3N3MA 5ENLA 2ICSA 1CGWA 4HSNA 2ZRWA 4WXYA 4H00A 1QHPA 4NXKA 1BTMA 5FCZA 1EUAA 2E6YA 3UXIA 4H9ZA 1TRDA 1E56A 1CXIA 3SGUA 3O8AA 4DF1A 4MJZA 1CXFA 3S2CA 3SUWA 1I2RA 3NEHA 4K7VA 3WN6A 1HVXA 3TUUA 4OZOA 4HYWA 1A5AA 3QHNA 2F38A 2FB3A 4C1NA 2E25A 1JDFA 3TN4A 4D6GA 4LC8A 4US5A 3R89A 4LV9A 3ENLA 2E1DA 1XBXA 3ZR6A 5CLWA 3NSXA 1EYWA 3HQPA 1PO9A 3L2MA 1H50A 4WJ8A 4EANA 4ZEPA 3FLUA 1UKTA 4F2UA 2BMBA 1W3IA 5ECVA 1RBOB 3U7VA 2CBJA 1A53A 1VLWA 3SUSA 3V0UA 4S2CA 2PD9A 1JXJA 2NUWA 3CO8A 1L6FA 4DWSB 1QI2A 4GNKB 1H0IA 4IUOA 1H41A 1GTEA 3S6TA 2ESCA 3QGAC 3TVAA 3AWNA 1NJJA 4BY3A 1XQKA 4WKAA 4L56A 1VH7A 3HMCA 1XSJA 4ACZA 4XZIA 4IIFA 3TQ0A 4O1FA 3VABA 1TVLA 4LT9A 1SMDA 4UTMA 3JR2A 4JFUA 2RDXA 3FYPA 4S2BA 5A94A 5GNZA 5MKGB 2GSJA 5A6MA 1BYBA 1OFBA 5D09A 2NZLA 2WHKA 3FVMA 3RPTA 2VR5A 2Z1SA 3AMLA 3KOYA 3OIXA 1CYGA 2DVTA 4H9TA 3NWRA 5D04C 3WD0A 5DMMA 2G3NA 2CESA 2W4XA 1E6SM 6XIAA 1TMHA 1TTIA 3S5SA 3FKRA 4W87A 3RRAA 3V18A 2GUBA 1IWAA 1XIGA 1Q6EA 1A50A 3WFZA 3IGHX 2Q8XA 2CWXA 1C93A 3OVRA 5HR6A 2XH2A 1G0CA 2Z26A 3IIXA 1TE6A 1IQ8A 2WCSA 1W9DM 4YWSA 1TTQA 1WE5A 1MUMA 5B7YA 2Z6IA 4A3RA 3WUBA 1ZU8A 3DYOA 4LAMA 4JTDA 4F48A 2Y63A 4U3CA 3VGEA 4B5NA 4DLFA 3LHUA 2VZTA 3LBOA 3S5YA 2ZCGA 3WQFA 1J01A 3TCSA 3CIWA 2DU2A 1RD5A 2ZYFA 4FI4A 3RIKA 3L68A 2G5WA 1VBRA 2YB1A 2VGBA 5HA7A 3L0KA 4ADSA 3BUVA 4EF8A 5GVJA 3L4UA 4PTNA 3B8DA 1UWIA 1US0A 3DAQA 3PY2A 2YXGA 1OVDA 5FAJA 3R7MA 1DHPA 1IYXA 2CLIA 1XP3A 3PTMA 4O16A 1ZENA 4MFDA 3W1TA 3UJRA 1JAKA 2CLEA 4AD0A 1CT5A 5I3IA 4F9JA 2IKJA 3KEHA 3MI3A 3ARYA 2RDTA 3WBWA 2EPOA 4IGSA 4L1XA 3ZT5A 3TN5A 4WJEA 4JTUA 3SUUA 2DW7A 5H8UA 3U57A 3LNMA 4L9XA 3S6DA 5LIKX 2WANA 4WDWA 4WIWA 1KM2A 2BOFX 4Z2HA 5GJPA 3T0DA 1ZJBA 3T0AA 4OVXA 3GB6A 4PL1A 1PYMA 4D8LA 1AH3A 3IS4A 1TV4A 3PWIA 3O05A 2KZHA 2X8RA 5CPSA 2A3LA 1CB2A 1H2JA 1YNQA 1PTDA 4AFYA 4FZIA 5KSWA 5E1QA 3CZ8A 3DGBA 4QAWA 1HGWA 4GINA 3DHFA 3M6YA 2ZX8A 1K4HA 2Q8LA 3VIGA 2D73A 2PCQA 2OQHA 1F3TA 3BJSA 2GJRA 2BVYA 5JH1A 5E0KA 2XZ9A 2FGLA 4HNTA 2NWSA 3UCCA 2OQYA 1EIXA 2AMGA 2OXNA 3JUGA 4YCOA 2Q3OA 4M3PA 3ARQA 1OIFA 1PIGA 4JQ1A 3FHAA 3FS2A 1CGXA 5HPOA 3M0KA 2BVDA 3RM8A 2G4FA 1K9FA 3ELFA 2Z27A 1UR4A 4MG4A 4J7RA 3S2LA 1UJPA 2GK1A 3EOLA 1K02A 2P0IA 3KBMA 3MDUA 3C3UA 4F4RA 3IK4A 1XH2A 2C0HA 3H55A 2YBTA 5DFAA 1G67A 1V7YA 4CN1A 5A6AA 3LHTA 1VCFA 2BGQA 4XD3A 4AZHA 2WJZA 2PP3A 3WK0A 3GQYA 2H9AA 3O06A 4IFKA 3GDRA 2OLHA 3PTQA 1VFOA 1M01A 1XRFA 3ARRA 2QDGA 3GNXA 3ONBA 4MSSA 3G1VA 1EA0A 4UQ9A 5C9ZA 1XXXA 4YVVA 4KIRA 2ACSA 2VR2A 1UD6A 4WX2A 2W9MA 2GL5A 1HKVA 3NZQA 5LKYA 2DZBA 1KM3A 1N55A 1NDZA 1TX2A 3BURA 4ZSUA 1EOMA 1UD4A 5FEPA 1X7IA 1PZ0A 2E67A 5G1TA 1OY0A 1OCBA 3AHYA 4RE2A 3OB8A 3BV4A 3ES7A 4A3YA 1BQGA 3MVTA 5HNUA 3WG6A 1X96A 3QHOA 2YYUA 2P8BA 3ALGA 1BF6A 1VRDA 3DKLA 3EWDA 4Z2JA 4JL2A 1E1EA 5LXXA 4GXWA 3R5EA 3N34A 8A3HA 2PP0A 4NJIA 3LCLA 1S5VA 3KBJA 2O7SA 1PKYA 1E51A 4KESA 1WB0A 4LX4A 4N7QA 3DX5A 4RV3A 4FLSA 5LZLA 2O9PA 4JTHA 3QV7A 4GLEA 1LWHA 3WLSA 2VDGA 1TYGA 2DY3A 1KGWA 1FH9A 3OEXA 3BW4A 2XZ7A 3TLQA 1YBQB 3FKKA 3HM7A 4JAWA 3TP4A 2WCAA 4ZQNA 4KGJA 3FA4A 3C2YA 3K1GA 3SY8A 1JAEA 1FWEC 1GVSA 3MHFA 1KM6A 2B31A 1QNSA 1RVKA 4D1JA 1GQLA 2JEQA 4INFA 2OKOA 4URIA 3WENA 4RNIA 5BZAA 1OT1A 1E1CA 4U5KA 4K7YA 2G4JA 1OZMA 2ASHA 1D8CA 4QS6A 3MMTA 1S38A 4EP8C 1IV8A 3QGKC 2ZRUA 1XG4A 2PBOA 2E8YA 3TIMA 1VBUA 5IDZA 4PBGA 4CNNA 1LT8A 4ZFCA 1FCVA 3G2GA 2PGWA 3TWBA 1H5YA 3VOHA 3N1AA 2WC3A 2VZOA 3PPGA 4HMCA 3HTWA 1Z44A 5HUOA 2EF9A 3SCUA 3W70A 3SCNA 2YFNA 2WMIB 2GGGA 4UUIA 4GQ0A 4HJFA 4UFJA 1W3NA 4QP0A 1OFOA 5LHEA 2E8ZA 1O1ZA 1UW9A 3TN3A 4QDMA 3M4HA 1J2WA 4NZ1A 1O68A 1TV8A 1TIMA 3BAJA 2VX4A 2G3FA 3RLHA 2JEPA 4ICNA 1IR2A 1K8YA 1CBGA 5CC5A 3BSHA 4BI7A 4JTCA 1XISA 4DJED 1Z48A 1PEZA 1B5TA 1NFBA 1U1UA 3O6YX 3A5VA 2HNHA 5D33A 1KXVA 4BQ2A 1IXOA 3N73A 2WXDM 3WQDA 1NY1A 4LS0A 2VEPA 1A80A 2ZZ7A 3LOTA 3SY1A 4GUIA 3S8HA 4AHOA 5CCZA 1S5NA 3NQMA 1GYLA 2PCEA 4LY8A 3IIPA 2PFHA 1HQTA 3VFCA 1KFBA 4I6VA 3SCVA 2J6XA 1SFTA 6XIMA 1SO5A 3FAWA 1LOQA 1FQ0A 1XD1A 3V5OA 1TTPA 2VRJA 2VT0A 1F3EA 4Y8EA 4CEUC 3OIHA 2V8ZA 3RAOA 2GDVA 3SCTA 3TH6A 4QX4A 3M0VA 1AJ0A 4EAMA 3WLIA 1L2UA 3WLNA 5E0FA 3OLDA 3O2LA 4PBFA 1A5UA 5CGTA 6REQA 1A0EA 3IRDA 3CLMA 1XBYA 4UTTC 5HANA 4LQ1A 2ZZ4A 3UETA 1H61A 3S1WA 2V30A 3GTFA 4WDXA 3SO7A 3GDBA 3M9YA 3PB2A 4GBDA 4LUIA 3EXSA 3VE9A 3P14A 5IM51 5E9AA 2Z1KA 1S2WA 4JHMA 5AZ0A 2QVHA 1O6IA 5HMFA 4JIPA 1I75A 2PDMA 2J27A 2HWGA 4I7UA 3W1MA 4GUFA 4WSKA 1GOIA 3SN4A 2QJMA 2QDEA 1ALDA 1EJXC 1W56A 2AOSA 2POTA 3T2PA 3MSGA 5DQPA 4JTLA 4MOZA 3VOGA 2OG9A 3RHGA 4MAVA 4FNTA 5F2IA 1TWWA 1KFCA 4JIRA 3ZJ8A 2PTXA 4LBRA 1ZLPA 3NXFA 4DO4A 2GVEA 1WAWA 3O3RA 4PL2A 3WJXA 1SUXA 5T9BG 2BVWA 3A3HA 4AD3A 3OBKA 4AY1A 2WQPA 4Q22A 3B40A 1JPHA 4HNOA 1HKIA 4WGXA 1MUWA 2DFAA 1XYZA 2REQB 3J7HA 3TC6A 1BQCA 4DYKA 1NWRA 2YDQA 3ARWA 5AVNA 5AYIA 4AEEA 4DXXA 1J2BA 3IV3A 1EGVA 3EWYA 4QR6A 5LIXX 5DBTA 3MW7A 2I5IA 1ZS2A 3EWWA 3VIIA 1CTNA 2VZUA 4IGHA 4PMOA 1XS2A 1UB3A 3R6IA 4I9JA 4LNCA 1ZQ5A 3BAYA 1EP3A 3VD4A 3HV9A 2OJPA 4HHMA 3CPRA 3B8IA 1X38A 3QPZA 3W2JA 2ISVA 3QZAA 5L6UA 2WZHA 1S5MA 3PZOA 1SZGA 5I3HA 2CZDA 4GXMA 1A0CA 3LK6A 1EBHA 4A3QA 2X2YA 4Q8OA 4QJ5B 5HWMA 4JIHA 4C1LA 3WJZA 3C0QA 1R47A 4MKVA 1BGAA 1YPIA 4J3VA 2QJHA 4XO6A 4AVFA 2XUCA 5F1UA 1HW6A 1EHAA 4CD4A 5XIMA 4DO6A 4PSRA 2IMRA 1KM0A 5LNSA 3DG3A 4HNVA 3UXDA 3QRHA 5ABHA 2WPBA 1YPFA 1PWMA 4Q8PA 3EA2A 3E5PA 4NKCA 4K3ZA 1F6PA 3NQAA 3WLPA 4G2DA 3Q4DA 3VNIA 1RY0A 3TCEA 1TV3A 5FJTA 2ZVRA 4MADA 4DJEA 5HJXA 1JFXA 4UTWA 4HHLA 4RW3A 4KS0A 1W17A 3V16A 4UQCA 3LI1A 3GW3A 3A9BA 3G5EA 3E12A 3NSNA 2PDBA 4F2BA 3H23A 4FNUA 4GI6A 3M5VA 2ZWYA 1HJUA 2WVVA 3LI0A 3DFYA 4ZXLA 1R3RA 3BLIA 2A7NA 3ARVA 1WX0A 1S1RA 4CQ8A 5LA0A 5G1YA 1HO4A 4PEKA 5HWJA 4EWND 5A6SA 4MDPA 1J11A 5FI8A 1TELA 4ADUA 3QR3A 3B4UA 4YVPA 1FHVA 1ISYA 3WNOA 1XH1A 4ERIA 4B5TA 2PODA 3VINA 3PSWA 2CHOA 4OTKA 2HXTA 3K4DA 4ZE4A 5I3GA 1LBLA 2WZIA 2GJNA 4ASTA 1ZRQA 2ZX7A 2R1NA 3W1NA 3GKAA 5FL1A 2J9XA 1GZJA 2YJQA 4RCXA 2JKAA 3GKFA 3UWQA 3MV11 1WDRA 1XUUA 2D1ZA 1S1PA 3LV5A 2Q6ZA 2J78A 3SQLA 1F9CA 5JBEA 4W4QA 2XGIA 3E6EA 1UHVA 3CZGA 4P7NA 1FHUA 2BFGA 4S3BA 3IJDA 4P7LA 4QHRA 4DJFC 3WO8A 1TCMA 1JYWA 1Q7MA 1MQPA 1V3KA 3IVTA 3LN3A 3EAUA 2JBMA 4UTJA 3BE7A 3VKKA 5G4EA 3PPCA 2V68A 4I90A 3S2MA 4AZBA 3ERPA 1DE6A 4HNCA 3A23A 4FSAA 5EFDA 3TW7A 3RX2A 1RK6A 3AYVA 1RQBA 1UA7A 4LVDA 2E5BA 3TSMA 3W76A 3ZJKA 4XD4A 1M04A 2CHNA 3LM3A 3RCYA 4RDVA 3IAQA 1XR2A 5JQ9A 1VFMA 4KIEA 3RNDA 1LYXA 5BRPA 3Q94A 4C5YA 1P5BA 1Q63A 1HNYA 5LA1A 1CLXA 3S9ZA 2H90A 4DO5A 3PZQA 3C61A 1IEVA 2VQUA 4FXFA 2OEJA 1G7UA 2R8WA 4PUNA 2ABAA 5DF0A 4PC8A 1E6PA 4V27A 5JU6A 5D38A 4PMNA 1I45A 4AD2A 4D9PA 3QQ0A 4MJ4A 3U3HA 4D8AA 1R3YA 2PA6A 3PZGA 3SRHA 2DSUA 3M43A 3U5YA 2X0SA 4ZOEA 1TREA 2E9LA 1KFLA 2FZNA 3VU2A 3GW0A 2QS8A 3DDMA 3C3NA 5H6HA 4K8GA 9CGTA 1U30A 4TVUA 5CZKA 3AMCA 3K8MA 3WZ0E 3M0MA 3E5BA 3RCMA 1B54A 1PTGA 1VKFA 3TOYA 3OQ8A 1QBBA 2SFPA 1M6JA 4UTHA 1RQHA 1MW3A 1E9ZB 4LYQA 3NQ7A 4KWVA 4QJ4B 1TPEA 2A3EA 4HZ7A 3A3XA 4QRNA 1WKFA 1HGYA 1OQFA 4CLMA 1J0HA 3W7KA 5ABFB 1XIIA 1AK5A 3N9RA 3OA3A 3W85A 3LNPA 3MMDA 1ZJAA 1NOWA 4FNSA 3LRKA 1W0MA 2C1HA 2GFTA 3AS0A 3ARPA 3WEZA 4ZOAA 3ZWSA 1NWTA 2AMXA 3P0XA 5I79A 4JQ3A 3BG5A 3LGEA 3BW2A 3W00A 1SW3A 1JCYA 2B4GA 3OYZA 2VO5A 3PJWA 3LCGA 2OX4A 5CBBA 7ODCA 1VZWA 3SCWA 1IHIA 1XLKA 3ORWA 4OKDA 3W1RA 2VM8A 3MZNA 7A3HA 2UY4A 1DOSA 4LYRA 1FXPA 1SZEA 1MQRA 4WXZA 1SR9A 2X1UA 1MEHA 7XIMA 3VTRA 1LM1A 4MJMA 5GJNA 3BAKA 4JTFA 1H7WA 3NDYA 2Q71A 1EPVA 2DEPA 1YXDA 4HU4A 2O4MA 2O0TA 2X1RA 1XRTA 5LIYX 4M19A 4AB4A 1ZZMA 1EKOA 5EBUA 4K37A 4FA3A 3TNBA 4DPQA 1PX4A 2C13A 2ZBTA 1HF6A 4IMAA 3CHVA 2D2GA 3JZEA 1NDVA 3UA4A 5HXMA 5C70A 1UZ1A 2DVUA 4DIAA 5EA9A 1LLWA 2FFIA 1Q66A 4U28A 1KRAC 3HGJA 3MO7A 1RA5A 1JUEA 1HG3A 4GYJA 3SM0A 4HNLA 2PGRA 2QF8A 2CLHA 3E74A 2CC0A 3MMWA 1FP9A 3VFLA 3MTWA 2YXXA 1ZALA 3E0LA 3TSDA 4JNYA 3VIOA 2TAAA 5FF7A 3WL0A 3O16A 1XD0A 3IAPA 4O1BA 2YDAA 4BI5A 4UCGA 4OUIA 2VURA 4XIAA 1CXEA 2V0TA 4J2MA 1HZYA 2YW3A 3S0CA 3BC9A 4HCHA 4IMEA 1UC4A 2YZRA 4LBUA 1K03A 4JTTA 5FEWA 2YCKX 2RJGA 2I5QA 2OVLA 1NP0A 3PHAA 3LTYA 1NQ6A 5FF0A 3BOFA 2WJFA 4JFTA 5REQA 4UQAA 1TR9A 3QR0A 3UG8A 3NDZA 4Z1BA 4ENLA 4C6IA 3ZSSA 1DJNA 4UTIA 2XJ7A 4RNFA 3GVQA 3GBDA 3ANYA 4MKSA 3F5KA 3HB9A 1G7VA 3UVAA 4Q8MA 1QDSA 2DUXA 3HQNA 1UD8A 2ZRZA 3VDGA 1MEIA 2H8XA 3CWOX 3P81A 1FP8A 4MB1A 5CKSA 2ZZ2A 4PULA 3LCIA 1JCMP 1M3UA 4PRRA 1K6AA 4D6DA 3DFOA 3R10A 1EX5A 5HQEA 1NWUA 1Q5MA 4I3GA 3AI0A 2J4GA 2GPTA 4LRSA 4PE8A 1BVZA 2HS8A 1NOFA 3VM7A 2DJLA 1EC7A 5EGRA 2HNEA 1G9HA 2C1GA 5G1MA 2DVXA 2Z29A 1VBJA 2BY0A 4DY1A 3URQA 1BXCA 2X1TA 4EWJA 3DENA 1GJWA 4B91A 5IFPA 4J3ZA 2WMKA 2QT3A 1J12A 4LUSB 1VB9A 3UFYA 4Q4QA 1GVEA 5A2CA 2VEGA 4C6EA 3NNTA 3B8WA 2OMAA 2WMGA 3T7VA 4IWWA 3NVDA 4L65A 4LUYA 3S9IA 2PTDA 1FDJA 2PB1A 4QCEA 1FFQA 3PB0A 4DVOA 4GCAA 3N18A 1WDWA 2HVMA 4GIEA 5E93A 3V35A 5BW6A 3VIPA 1A4LA 4E6MA 2QVNA 4U3AA 2PC8A 5C7HA 1H1YA 3I10A 4QDWA 2ONEA 3QMSA 1WDQA 4HOZA 3CYVA 2XGBA 4GI9A 4PH6A 1U5VA 3W7JA 3EGJA 4PUJA 4ERAA 3W25A 2Z1BA 1JCLA 3GBEA 4XO7A 3L5AA 4B9ZA 3T4WA 5AC4A 3T6CA 1FCBA 4N4QA 4LAOA 3UCDA 4HIBA 2X2GA 1VJSA 4NIRA 4P5UA 3KBSA 1F3XA 2F6XA 2VFIA 3AICA 3BLDA 1B0IA 1YW1A 2GUUA 2VHLA 2ISWA 3U2EA 2PC4A 4F3HA 2Z28A 3USZA 1T8QA 1V6UA 5HK4A 2GJXB 3CUGA 2HPMA 3AS1A 3IACA 1J6OA 1DWIM 2AGKA 1MXDA 3CHEA 3EOOA 2ZE3A 4MZ8A 2BP1A 4GVHA 5E0CA 1J0IA 3EBVA 4J35A 2V38A 1VEOA 3R58A 4UB9A 1ME7A 4HMNA 1AW1A 3CB8A 2VRKA 1TJ2A 4GX9A 4DUWA 1O1HA 1QI3A 4FXJA 3INPA 4J40A 2R1MA 4Z2GA 2E68A 1UC5A 4KRTA 3CQKA 2YSWA 4Q8UA 5D9PA 4GQGA 3A9IA 3W7EA 3BSMA 2F84A 4E5TA 1PZ1A 1UWAA 4E2DA 1EWDA 5I78A 3WQVA 1D3HA 4PCFA 3GH4A 1GHRA 1FH7A 3TX9A 5LNUA 3O63A 4Z2IA 4OFCA 4M81A 4JHOA 2WC7A 3GC2A 2OLSA 1ICPA 1OWQA 3MUZ1 4IJBA 2R1PA 2ZUTA 5CBIA 3RO8A 3VNYA 2INFA 2H3BA 1EX1A 3E0VA 3G1RA 4MGGA 1OM0A 2C8NA 3I68A 4IIHA 4Y90A 3ITXA 3HU7A 4NZJA 3OVPA 3EDKA 5KZ6A 2W91A 1V6VA 5T9CE 1JF6A 3O1NA 1B3ZA 4ZQPA 1TA3B 3K8LA 3BQ6A 1UD3A 3UXKA 4I7VA 4CQ9A 2V2CA 3IUHA 1UR8A 4FOUA 4WKFA 1HN1A 1ONRA 3QHMA 3EPOA 1DXIA 4XVDA 2XIOA 3EKGA 5J04A 4MY8A 4HVXA 4IUGA 1EZWA 4RE0A 1R3QA 4C91A 4KFNA 1QJWA 1O66A 1VFHA 3KVKA 4EPBC 3GG8A 2BGNE 2XWDA 3W87A 3SADA 3WLOA 1TIWA 2B7QA 4IISA 1GGOA 3FSUA 5PTDA 1VRXA 4B3LA 1ZAHA 3E0FA 3P0WA 3PJTA 2WZEA 3KRUA 4XAGA 3LCWA 2VX7A 3WJSA 1FWDC 4O11A 1XLMA 3N13A 2YLLA 4L6DA 3SY5A 1YXYA 3WELA 2RDUA 1Q13A 1CZ1A 4CNTA 1GVIA 1LQ2A 3FDKA 1UH2A 1V0MA 4Q3MA 3LPPA 3P80A 3STGA 3W86A 3VDBA 1VJZA 4REQA 5DEZA 1T7LA 1GW9A 3L5LA 5TBOA 2P3ZA 1JJKA 4PUWA 1A5KC 3AMGA 5D9MA 1DXEA 3SCOA 4E8DA 3SJ3A 5BRBA 5G4HC 2Y7FA 2DSWA 1VAHA 4C60A 4ORIA 1P0DA 3ZLFA 2NX3A 1OZQA 2VYOA 4XG1A 3OA5A 2J7GA 1J93A 1WXJA 3NSMA 2ZKMX 4GA8A 1GYNA 2GJLA 3VD5A 2P5NA 3CUJA 3BLLA 2DJXA 2J13A 1KLYA 1DJXA 4MNLA 4S3FA 3VO0A 4GYPA 2Y4SA 1XLIA 3QV8A 3CWNA 4NXSA 1JCXA 1WUEA 4MWAC 1K70A 3RR1A 1EDQA 4M6UA 4A8IA 2WNWA 4Z0JA 3N4AA 4NJKA 3UWWA 1PTAA 1ZJIA 1A5NC 2FHBA 4JIIX 2EKGA 1US3A 1XQLA 2WMJA 3R1ZA 1IGWA 5A3HA 5C71A 2V3GA 3GRIA 5C9UA 4MLJA 2PDUA 3A12A 3CL7A 1LUCA 3C56A 1XCXA 1SQ7A 2I7GA 2Y2WA 2RUSA 3S83A 2TYSA 2JIEA 3RM4A 2Y7GA 4U5IA 3NOEA 5CZSA 3WQ4A 2WKGA 3BAIA 4LUTB 3KOWA 1EL3A 3WQWA 2XIJA 1F05A 4G5DA 3BLPX 1Y5WA