1F5ZA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form i
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
293
structure length
293
Chain Sequence
b'MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLNEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 122
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f5zA00
2WSYA 2E6FA 3GKAA 3S0CA 3BV4A 3EWWA 2H3DA 4AEOA 4TU1A 3ZS4A 2C1HA 3NPVA 3GX9A 2VFIA 1MO0A 1SW7A 1TTIA 3W7PA 3UNDA 4DEFA 4NNCA 4WY0B 1R47A 3EWZA 3FEMA 3BPWA 3NQ6A 4WXZA 3TSMA 2A85A 1RQBA 3O05A 3Q94A 5G5IA 3WK3A 3NQDA 1H5YA 2WV8A 3LCLA 1GVQA 1GWJA 3BG5A 4JY8A 1X1OA 1V7YA 1VH7A 1TV8A 1SZEA 5HWMA 3W7GA 2C19A 5K9XA 2ZZ6A 3QW4B 3WJZA 4UFHA 3LXAA 3L9CA 3UY8A 1YADA 4ADUA 3C56A 5MHBA 3G22A 5CKSA 2CLEA 5LHEA 3KOFA 2V81A 5KITA 2H6RA 4TR9A 3NDOA 3ZWTA 4EWND 3IGXA 4UFMA 3THQA 1ZJIA 3H53A 3M41A 4HT3A 2JK2A 1EX5A 3PBWA 5K9CA 1XC4A 3LERA 4O1DA 3FFSA 4FXRA 2Y88A 3TE9A 3LTSA 4K39A 5AHNA 3WJSA 1PHQA 3W7EA 5G4EA 1I2QA 2EGZA 1FQ0A 3TQVA 4WD0A 1XBXA 3PSVA 5G2WA 3NPUA 4UTHA 2WPBA 5AOUA 4JY9A 2B4GA 1YLVA 3P8JA 4OV4A 1AL7A 1I2RA 1TJPA 3SJ3A 3GDLA 3W85A 3BGJA 4N9BA 2W79A 1TREA 4MPQA 1WOAA 5FEZA 3HGOA 3TUUA 4DO4A 4AAJA 4R34A 1HL2A 4LVAA 4UTWA 3HMJG 2CLMA 1SU5A 1F73A 5CG7A 4JNMA 2ZZ2A 3A21A 4PEKA 3S8HA 2R14A 3TK7A 3OEXA 3RFAA 3IVSA 3L0GA 1VYRA 4NUWA 5LHFA 3FYPA 3HGSA 2EAWA 5C2XA 1KM1A 4UFLA 2CZ5A 3N2XA 4A3UA 3O07A 3LHYA 4K6AA 5G2HA 3NQGA 1LOSA 1ADOA 2J24A 3GYEA 3KVMA 3LI0A 4HNUA 3NQVA 1VCVA 1OK4A 3TC6A 3W7QA 4O11A 2J9YA 2ZA1A 1KFLA 4KKXA 1SO4A 1JCNA 5E1QA 1SSDA 1UB3A 1XXXA 4OHQA 4BWLC 2F84A 3IIXA 1TPDA 3TSDA 1FWRA 1W5MA 1L6WA 3O6YX 5BMWA 5E93A 2XFWA 2Y7DA 3CM4A 1WBHA 3BVJA 3T55A 4LVBA 5H2ZA 4JTGA 4OU1A 3UZJA 3DKLA 2QAFA 3S1XA 5D09A 2A7PA 1FXPA 5C54A 4JTFA 3PB0A 1W8SA 3RF9A 5ABTA 4JX4A 3TQ0A 1K7XA 1K02A 3G1YA 3GZ3A 4FIRA 1KM6A 3C61A 3DI1A 2QR6A 2YPIA 1LRNA 3FJ6A 4O8RA 1TPFA 4ICNA 1C29A 3LHVA 4QQ3A 4AHPA 2E6AA 4DF0A 3W7MA 1TPC1 2P10A 1JCLA 3SFKA 5F2MA 3NA8A 2QF7A 2A1YA 5LKYA 3EXRA 1THFD 4UNLA 5DY2A 1ZAJA 1VR6A 3FKRA 1SR9A 1HUVA 1ZENA 4WOQA 3W70A 1LRQA 1O94A 4YCPA 2ISVA 3SIZA 1K3UA 1TPWA 3ABOA 3I7SA 1KLYA 2YGYA 3FLUA 1FXQA 3NPWA 3W72A 4JDBA 3L21A 3P5ZA 1QCWA 3GNNA 4NZJA 5C5YA 3IIZA 1NEYA 1LYXA 5J5RA 4DPPA 2FTPA 3DHFA 4GNJA 4WOZA 4X22A 5LNSA 4PH6A 2HS6A 3LGEA 3IVUA 1AW5A 4HNTA 3TIMA 4IXHA 4O15A 4ZQPA 2Z6JA 2NXHA 3LCIA 3STFA 1GVSA 5K7JA 3IIPA 1UBSA 5KMYA 3AJXA 1H62A 2ZZ1A 2X2GA 1GG1A 1IF2A 1KLZA 2B7PA 4AHQA 4OGZA 2X1SA 4O14A 3NAVA 4XTDA 1ZAHA 1OFPA 1KM2A 4JN6A 1SW0A 3C2EA 3W7KA 1KA9F 2ZTJA 2WNNA 3TV8A 2H8XA 1YTEA 3GLCA 1KTBA 3TXVA 1AW1A 4OQVA 3TXZA 1EB3A 1TV5A 5CZSA 4PL2A 3G1VA 4CQ9A 2BXVA 5AHEA 5AC7A 1G6CA 5LSMA 3N3MA 1DKWA 4TO8A 4AF0A 5KZDA 1S5WA 3QEZA 1SZNA 2G95A 3G0SA 1AMKA 3W7OA 3UXDA 3E12A 4UR8A 5TIMA 1WOBA 5G1TA 3TW7A 1TYGA 2I14A 2JGQA 1G67A 1PL9A 4P61A 2PRMA 3VCRA 3HQ1A 4JX6A 5HNRA 4JX5A 3CIWA 2CLOA 3LX9A 4HNVA 3L66A 5K2ZA 1YTDA 3UWWA 4PC8A 4CQ8A 1OFBA 4Y6GA 2H8ZA 1I8JA 3S9YA 4JS3A 3MJYA 1HO4A 4K7YA 3S1UA 4FNQA 4ONVA 3RLVA 5HR6A 1DBTA 3EWXA 1EWDA 4LRSA 4MZYA 4YL2A 1LROA 2YFNA 2CLFA 2V5LA 1WDWA 4RV8A 1F5ZA 3UD6A 4BF9A 1SZGA 3R13A 4UFJA 2YX0A 3ABSA 1K8XA 1DV7A 1Q45A 3MHUA 3GK0A 4Q4KA 4UR7A 3QSTA 4JXCA 1KM0A 1FCQA 4ADSA 2CZDA 2C16A 3SSJA 5AHFA 2QCCA 2BLEA 3IRDA 4KFOA 2Y89A 4U28A 1EA0A 2FB3A 3TDFA 3SGZA 3DAQA 1OFDA 1H1ZA 4N6FA 4GUGA 3W7NA 1DQXA 1U83A 3VFLA 1TO3A 6ALDA 5FEWA 1BEUA 1MEWA 3QF0A 4MYXA 1VQTA 3WJXA 4JIQA 5LNUA 4FNPA 1QWGA 1V5XA 2NLIA 4LOCA 5EY5A 4ORIA 3M1ZA 1OF6A 5G1YA 2GUUA 4E0CA 2DJXA 2ATMA 1D9EA 1YPFA 2ZZ5A 1GEQA 4FNSA 3NGJA 3S1VA 4K8HA 3N9RA 4A29A 1F74A 2YDAA 3PB2A 3A5VA 3IGSA 3LI1A 1RVGA 1F7BA 3W2LA 2QCEA 1ICQA 1RV8A 2HSAA 5C55A 4ZL1A 2YR1A 4I7UA 2G5WA 4Q33A 3W2NA 5U4NA 3TKFA 1KFBA 4Y8FA 3PULA 5FI8A 1YPIA 4O53A 4LY8A 2WNQA 3UZ5A 4XKYB 3S1WA 3NVTA 1JCYA 4MFDA 1X8FA 3TMLA 3NXFA 4UNKA 2RFGA 3CEPA 4DBDA 2FDSA 4IPIA 1VLWA 2HMCA 5K4ZA 3N2MA 3QM3A 3NEVA 1OX4B 4AWTA 2VFFA 1KFKA 3G1DA 1LP6A 4UXDA 2RDTA 2WNZA 3SGUA 3MO7A 4ZMGA 3O6CA 1H60A 4GRSA 5HWJA 3KVJA 1UASA 1W5OA 3MYPA 3ABQA 3TSBA 2VFDA 3LHTA 2WO5A 3L65A 4AMAA 4JEQA 2VEIA 1XKYA 4Z1DA 3A23A 3C0JA 3EEGA 2WQPA 3C4UA 2C3ZA 4UTMA 3PG8A 3M5XA 2W0UA 3TC7A 2B7NA 3TU9A 4ZQRA 4ADTA 8TIMA 1GQNA 1KM3A 1JCXA 3L5AA 1G4EA 4N4PA 4MY1A 4FNRA 5J5DA 2V5BA 4XZ9A 3NQFA 1D3HA 3NZRA 1W3NA 1HTIA 3R89A 1Z41A 4A2RA 2QCDA 1OX4A 2G96A 1L6YA 2B7OA 1LRTA 3G18A 3NQ7A 5AFDA 1SPQA 4XTIA 1R2TA 1K8YA 3EXTA 2NX3A 1OX5A 2UV8G 1XBYA 4RX0A 3QPYA 5AC6A 3GAKA 3G24A 2Z1BA 2XN0A 2Z0IA 4NNBA 3EXSA 4L4LA 4K38A 1GYNA 2DZUA 5EYWA 3UYCA 3TJXA 5KZEA 1WV2A 4I7VA 1W31A 2J88A 2CLLA 2HTMA 4M19A 3R12A 1FCBA 4Z1BA 4LT9A 3GXPA 4H3DA 2R91A 4M6QA 1HFBA 2Y85A 3HOJA 4O18A 1IXQA 5D05A 2DZXA 1GJPA 2I9EA 3UPWA 1FDYA 3FYOA 1Q6LA 1P0KA 3HG4A 4OWGA 4JTJA 4MJZA 3FKKA 4HHPA 5D2VA 2E6YA 2NXGA 1GVRA 2B0MA 1QAPA 1XCFA 3P80A 4UMAA 3CU2A 3MW7A 4GUHA 3KRUA 3IV3A 3LXBA 4EVZA 1TPUA 3U2OA 1WYIA 3LHWA 3WK2A 1S5TA 3DFQA 3HBLA 3W7IA 2A4AA 2PURA 1K03A 4A22A 3WFAA 1VC4A 3EX3A 3W7HA 1G4TA 3CEUA 3KRSA 2HS8A 4BR1A 1I4NA 2CFFA 1RZMA 3G8RA 2GVJA 1OFOA 3PBUA 1FDZA 2ZA3A 4E2BA 3Q37A 1LTDA 1ME8A 4FX7A 5CPOA 2Y61A 1VS1A 4I7WA 3INPA 1IXPA 3GDMA 2FLIA 3G3MA 4IMFA 2XN2A 3NM1A 3O06A 4LRTA 1OHLA 4JTTA 3S5NA 4PFMA 3W7CA 4QIUA 3ATYA 3UPBA 3MYOA 1KBJA 1IXNA 5HWNA 2E5BA 4RZ4A 1KTNA 4IMDA 3VE9A 3QZEA 2PCQA 2ZZ4A 3HPSA 4J9JA 4GBUA 2EF9A 3S6DA 1W0MA 4A2SA 1W37A 4NJJA 1OYCA 2CLIA 3I6RA 2CW6A 4Z0SA 4W9TA 5AYXA 3DHDA 4AXKA 3W1AA 5FEXA 4FX6M 1H7XA 3B05A 3TAKA 1LOQA 5F1UA 1FBAA 4MY9A 4RXGA 1DJNA 1JR1A 1ZALA 1X7FA 2FB2A 3RNDA 2OT1A 4O50A 1Q3NA 4IGHA 1OFRA 1VCFA 4B5NA 1PE1A 3LRMA 2H3BA 5CPLA 5HMSA 5F4XA 3NOEA 1ZHAA 3W87A 1W3IA 4BK9A 4NXKA 1EP1A 3H55A 1OX6A 4LV4A 4UTTC 3HF3A 4ML9A 4E2DA 1ME9A 1HO1A 3IIVA 2ZRXA 4S2BA 4O17A 3CIXA 4UTWC 2QJHA 4QNWA 5D2WA 2LLEA 2ZA2A 2VKZG 3CC1A 1W54A 1G69A 5HINA 4N9EA 2QCGA 2QUVA 2V2HA 4IUOA 4CCCA 1JVNA 3PUOA 4JTHA 2DZVA 4RXFA 2PRLA 2GPTA 2ZTKA 1OABA 4XWUA 4O13A 3ZR4A 5DBTA 1DVJA 3QC3A 3DGRA 1TPH1 5LNWA 5D04C 4LVGA 5CZJA 2A7NA 5HQEA 5CGQA 2I1OA 3WK1A 2ISSA 3M6YA 1QPRA 4PCFA 4NX0A 1GPWA 3MI6A 3STCA 2YYUA 4IWWA 4GE8A 1EUNA 2GVGA 3KVKA 1ICSA 4NVTA 4FIQA 2EPHA 5D37A 2E1DA 3PF3A 3G0XA 3MHFA 3UQNA 1LZOA 1QPNA 2CZFA 4YXGA 3NQ2A 5IBXA 3W76A 3EKZA 2WSQA 2WSRA 4FEZA 4O4WA 4WJEA 3W2KA 4JTSA 1VJIA 4OBTA 5LGZA 1OFEA 3O1NA 3G8EA 1TV7A 3M7WA 4NT0A 4O28A 2RDWA 4JTKA 4M6VA 3B03A 1Q6QA 3NG3A 3HG2A 2A6LA 4UUIA 1QPOA 3BLEA 5FF7A 1SO6A 1XDLA 3VI2A 4X9SA 5BRBA 1VLIA 2ZDRA 4RZ6A 2QUUA 4N9CA 4DBEA 3LV5A 2C15A 2DZTA 4UIOA 2BSLA 1AG1O 3ELFA 1JQXA 4MLJA 4HSNA 5F2GA 3BW4A 2CLHA 2OJPA 1C8VA 4N4QA 1FWSA 5HULA 5D38A 2FPVA 3A9IA 1E51A 3E49A 3G1XA 4Z1CA 1LLZA 3TJLA 2VXNA 4CLMA 1EP3A 1O4UA 3OVPA 5E0KA 3M0ZA 4UFIA 1H61A 4GUFA 3TH6A 2NWRA 5KSWA 5DCDA 2Y63A 5DXYA 1O5XA 4OT7A 3HJZA 3USBA 3C2OA 2V82A 3W7DA 1W3TA 4AF0B 3NZ1A 1SO3A 4OV9A 4YLWA 5I3IA 4JTLA 1GZGA 2QUTA 4OE7A 2Z6IA 1ICPA 4YMZA 3UWZA 1K7FA 2J9ZA 1JUKA 3SY5A 2NX1A 5EBUA 3NO5A 5F1VA 1FUYA 4MY8A 1QPQA 5AB3A 3Q2DA 3G1FA 5D33A 1H51A 4LV9A 1ZFJA 3BLIA 3O6DA 3ZFHA 4AHOA 1MSSA 3C2FA 3MUXA 1DOSA 3C3NA 4MIMA 3T40A 1CX9A 5DLCA 3JR2A 3NL5A 4MJMA 4NJGA 5U7SA 5D32A 2OT0A 3VKJA 2VC6A 4M6PA 3FJLA 1KV8A 3ANYA 4HSOA 4M7TA 4NZFA 5HUOA 5DY3A 3BG9A 1O95A 2EHHA 3NM3A 3W23A 3GNDA 4ZQNA 1MZHA 3HIJA 4N02A 4YWIA 4FNUA 4FX8A 1Z44A 1K8ZA 4UCGA 3YPIA 3F4WA 3BK0A 4N2YA 4O54A 3QFEA 3NL3A 3CT7A 1IGSA 1A5AA 2BTMA 4DF1A 3PAJA 4ZVJA 1DHPA 3G3DA 1DORA 2O7SA 4JYEA 2E6DA 3P5YA 1KM5A 4UTIA 1YTKA 4LS1A 3BARA 3CQ0A 1QOPA 2WJZA 1TJRA 1L2UA 1UCWA 3B8DA 4JTUA 4O0KA 1GOXA 4O16A 1FX6A 3LB0A 3WJYA 5A8GA 3LM7A 1PIIA 2C18A 2ZFAA 4ORMA 4KWVA 1OF8A 2YCEA 4KWWA 3B06A 3PM6A 3D0CA 1YDOA 1H7OA 4PL1A 4R33A 4FNTA 3R8RA 2V9DA 4QM1A 5EL1A 4QITA 1TQXA 4JTIA 3KRZA 3BG3A 3NQAA 3W84A 4PA8A 3B04A 4UTJA 1GVOA 5LNRA 1F2JA 4DPQA 3L2IA 3GR7A 3W6YA 2X1TA 4NQ1A 2NUXA 3Q58A 1XFBA 1FCVA 4HNNA 1ME7A 2FPYA 3GDRA 3PS7A 4X2RA 5DN1A 2NZLA 4IMCA 5EMUA 2J27A 3THAA 3WK0A 1QFEA 3E02A 1R46A 3T78A 4ZQMA 1XBZA 4HN4A 3PUDA 2C13A 4RR4A 4MFEA 2BZNA 3RU6A 1VYPX 1Q6OA 1WQ5A 3O16A 5C6MA 4FXSA 4IX0A 1NF7A 2OMAA 4M5PA 4O52A 5FESA 4WQ6A 1NVMA 5A5WA 4GXMA 1XUUA 3HO8A 3DFPA 3HB9A 3GIYA 3U6WA 4Y90A 1RQEA 4LUIA 1F6PA 1G7UA 1AK5A 2QAPA 3M44A 1PV8A 2GOUA 3DFSA 4WZHA 2VEKA 1ML1A 3W07A 2E77A 3PBYA 4MVAA 2QCNA 1A5BA 3IIOA 4Z08A 4HIBA 3LCGA 4C1KA 5KTLA 1KTCA 5DCBA 4JYDA 3C6CA 4TX9A 1GT8A 4AH7A 1AW2A 1P4CA 2W6RA 3I7RA 2VELA 2ZBTA 4FO4A 4BI5A 3LCFA 4UTKA 4IQLA 1LBLA 4FHAA 2G97A 3M9YA 1KFJA 1LOLA 1TRIA 2QCDB 3STEA 3HG3A 2TSYA 1L6SA 1H7WA 1LORA 4IJBA 1T8XA 4YCOA 3LLDA 3SW6A 3A5FA 4ZQCA 1TTQA 1FDJA 2Q8LA 3MP3A 3NQ8A 3C8FA 4QJ1A 4D2JA 5AYZA 3DXIA 3W7RA 3TR2A 1NFBA 3DH7A 3C2RA 4H6KA 3NNTA 2DZPA 2F7FA 3E0IA 1O5KA 2TMDA 1WX0A 3E9AA 1H7NA 1P1XA 4LNYA 1JUBA 2Y7EA 3SECA 4Z1AA 3W9ZA 5SWUA 3HPXA 4EOUA 3WJWA 2NX9A 1X1ZA 1ZY9A 3UY7A 3KHJA 1B4EA 3M5YA 3NR0A 3MBFA 2IQTA 2QCFA 3MI2A 1RPXA 2ZQ0A 4WUIA 4UMCA 2V2CA 1X6UA 2TPSA 1OYAA 3GVGA 4JR5A 3OVRA 2Q8ZA 4WX2A 2QDGA 3CWOX 2QKFA 5F4SA 4O10A 1A53A 3IEBA 2ZRUA 2C6QA 3LHZA 3L67A 4XUGA 3P84A 4CNOA 4RK8A 5CPMA 3GXNA 5BNKA 1W5QA 3L0NA 4LTSA 4EF8A 4CQAA 2QJGA 1S3HA 3CLMA 2BX7A 3F03K 3P60A 4UMBA 6TIMA 1EIXA 1SFLA 2JBMA 1TCDA 5DELA 3UWVA 4IPJA 3EB2A 5D30A 4O4VA 5FEPA 3HPZA 3W2MA 2NWSA 3W1XA 2A21A 4N6EA 2XN1A 3BW3A 1BKSA 2RDUA 1B4KA 2ZRWA 2GVLA 2Y62A 5DXXA 4R53A 3RMJA 3QRHA 3B0VC 1F6KA 2JKEA 4CNNA 3M5ZA 3MWAA 4NU7A 1UUOA 4POCA 3JS3A 2ATSA 2FIQA 1VHCA 2P0OA 2ISWA 3DKJA 1Z48A 4LUJA 5EKYA 3CTLA 3P61A 4HKPA 3UXAA 4EIVA 3O63A 4DO5A 3QH2A 1QR7A 3QMRA 5I3KA 1SO5A 4U4MA 3EKLA 3TFXA 1S5VA 1XL9A 2O7QA 4WXYA 1ONRA 5CSRA 3EX6A 2Y70A 3GXTA 3LV6A 4NX5A 4RCXA 4NNAA 2V8ZA 2X16A 5K3VA 2ABBA 4AVFA 3CWNA 3P7YA 2VFGA 1KBIA 3R5EA 1LBMA 1JJKA 2R8WA 3GAYA 2NUWA 4PTNA 1TPVA 2QCLA 4LC6A 4QNEA 4RJEA 3ATZA 3N19B 5I3HA 4LC8A 2FFCA 5HUPA 1BWLA 4IMGA 4MOZA 4NJIA 2A2IA 3MI3A 1QO2A 1J2WA 3W1TA 1OJXA 1VRDA 3TROA 3S5ZA 2A0NA 1YDNA 2GJNA 2JKAA 3JRKA 4H4IA 4LVFA 1D3GA 1TPB1 1ZNNA 4WY0A 3W71A 3PBVA 3VE7A 3W1UA 4CNPA 3QQ0A 1CI1A 1Y0EA 1J5TA 1LLWA 3A22A 3HG5A 3DU0A 2AQWA 4FF7A 3LTPA 4DQWA 3CPRA 3W86A 3LCXA 2V30A 3LHUA 2TRSA 3LRLA 4S1FA 2DP3A 3PVFA 3DFOA 2QJIA 4M7SA 3C2VA 3MHGA 1TRDA 3PUEA 3KXQA 4KFNA 1VCGA 1MEIA 5F2IA 4TMBA 4UTTA 1FCUA 1W5PA 1QOQA 1H1YA 3TX9A 5FF0A 3DZ1A 1UJPA 1C9DA 1WAUA 4X3ZA 3G1SA 5G2IA 1FWNA 3PG9A 1PCKA 1R2SA 1YXCA 2AAMA 1CW2A 2C14A 1H50A 4HPJA 3DFNA 4BFAA 1OVDA 1LBFA 2CWNA 5L6UA 3LRKA 1W1ZA 3V1PA 1HG3A 3C52A 4JGDA 3W1RA 1QDSA 4BWLA 2TYSA 3H54A 1F05A 2CLKA 1T99A 5KINA 1MXSA 3TQKA 1FWTA 2VEMA 3BW2A 3RLUA 3MP5A 3TW6A 5HJLA 4GUJA 1FWWA 2H90A 4AWSA 3G0UA 1KW1A 4K36A 3TCEA 5I3FA 1TSIA 3GDKA 3EX2A 1PVNA 3M5VA 2GQ8A 2VFHA 2P1FA 3W7LA 1B9BA 1TTPA 3PY2A 1KM4A 2Q3RA 5BW6A 1VPXA 2Y7GA 3KVLA 3UWUA 1O60A 4LS2A 2OX1A 1XM3A 1I2OA 1TIMA 4JICA 4MKNA 2ZRVA 1P0NA 2YW4A 2YW3A 2ZZ3A 5D03A 3EX1A 1YXDA 4Y96A 2QEZA 2YSWA 3DBPA 5HR7A 5D2TA 3FA5A 4RZ5A 3G1HA 4MZ1A 4S2CA 1WXJA 3W83A 2QDHA 5FF2A 4GJ1A 3GDTA 4MLRA 2DZSA 2OCZA 5IBXC 4UTUA 3BGGA 5TQLA 3KFTA 1JQVA 3M16A 3T7VA 5EPDA 2Y7FA 5DBUA 2E09A 1GTHA 2GQ9A 4IXXA 3N73A 2RH9A 5CPNA 4IX2A 3BLFA 2ABAA 2RKXA 2V0TA 3LCHA 1OFAA 1JRCA 2YZRA 3O8AA 2J6XA 3AO0A 5K9DA 3P8IA 2JKPA 3LBMA 4MYAA 1ALDA 3LLFA 1TPEA 1YDVA 5CZ0A 5DCEA 4CCEA 1OFQA 3KX6A 5CZTA 3TAOA 3W1QA 1Q6RA 1JCMP 4O0ZA 1OG0A 5AHMA 3W75A 3W1NA 3W1PA 1NF0A 4O57A 4E38A 3T4CA 1IXOA 2ZYFA 3MBDA 2NUYA 2ALDA 4NJKA 4XBSA 1EEPA 1TQJA 3UWQA 3O15A 2NV1A 2Q3OA 3TA6A 4JYFA 1TB3A 1N8FA 2YYTA 4LU0A 4CCDA 5F2LA 4GC4A 2VOMA 5AHLA 4WY0F 5LGXA 4AWUA 2DORA 1WBJA 2DU2A 3NL2A 1G4SA 5AYYA 3L68A 3GB6A 4QISA 1LCOA 3OVQA 1LM1A 1AL8A 1VGAA 1GG0A 4QAIA 3I68A 4NJHA 3BO9A 1A5SA 5CSSA 4K7VA 4DO6A 4R7JA 4IMEA 2A7RA 4GUIA 4LS0A 1N7KA 1M7PA 1FY6A 1RD5A 3QMSA 2RHGA 2E5CA 3NQEA 1NSJA 1YYAA 4DXVA 4GFSA 1QNVA 4O19A 4HPXA 5LZLA 1DJQA 3P81A 1MEHA 3V75A 4QSHA 3S5YA 1VZWA 4KFPA 3W2JA 4MUZA 3CB8A 3LTYA 1N55A 1R30A 4ZZ9A 4RLIA 1UUMA 1GTEA 5TBOA 4TMCA 2BWGA 3W1MA 2X30A 3SI9A 1VHNA 4K8EA 1XUZA 1SQ7A 2VFEA 3SZ8A 5LNVA 1A50A 2ZRYA 3W73A 3CHVA 3I7QA 3LBCA 2C0AA 2JGYA 1F76A 3W1LA 3QSRA 1L9WA 4XQ6A 2A5HA 3GKFA 3W22A 3VNDA 5AC8A 3S5OA 2WKJA 1M6JA 1M7OA 3EWBX 4LW7A 1TTJA 1EUAA 2R94A 2YXGA 1A5CA 2A6NA 1R2RA 1IIHA 1I2NA 3DI0A 1PHWA 4FB7A 5T26A 1GYLA 2EKCA 3KAOA 3PC0A 1G4PA 1W56A 4O12A 4C1LA 4UTLA 1I2PA 2PE4A 3IGUA 1GVFA 3QW3A 4L4MA 2Y6ZA 4BI6A 3UWYA 3EWYA 1J4EA 1VYSX 1JRBA 1K7EA 3NYZA 2Z2UA 3ZWSA 3B0PA 3LDVA 4IOTA 2E68A 3DENA 3IVTA 4I9AA 2YFOA 1XI3A 3FIGA 3PWAA 3NPXA 4LWWA 5G4WA 3FOKA 3PR2A 3LOTA 4ZQOA 4O1CA 3NL6A 3TFCA 1TMHA 3F1QA 4RKAA 1SUXA 2VENA 1H7RA 3QMTA 5H91A 3QJAA 4UFKA 3ABRA 4JDYA 3N9SA 1T96A 3FS2A 3L0KA 2CU0A 4JD4A 1M5WA 2X1UA 4K37A 2ZZ7A 3OHIA 3G1AA 5IM51 1RR2A 2OZ0A 4A21A 3M47A 5D2YA 3W3OA 4Q32A 5FF4A 5D2XA 3N34A 2V2DA 3HGRA 2NXIA 2E5DA 4UC5A 1KFEA 2FQIA 3W88A 3QQ1A 4N9DA 3QPZA 3EWUA 1PS9A 3L5LA 1W5NA 1EWEA 4P2VA 3B0UX 1BWKA 3F4NA 7TIMA 2QCHA 1KFCA 4DF2A 1RQHA 1QO5A 1T0OA 2VEPA 3NQMA 3U8GA 1YXYA 3MP4A 3NQCA 3OA3A 3OBKA 5GVJA 2ZCGA 1Z42A 3OIXA 2NV2A 4G1KA 4JIPA 4TIMA 1G7VA 3P74A 1OYBA 5BMXA 1SW3A 1IIGA 3STGA 2AGKA 4ALDA 1H7PA 3S42A 1JCJA 1DL3A 5AN7A 1SZFA 3LCWA 3LXCA 2DZWA 3EX4A 2QCMA 1SSGA 5D02A 2DJLA 2KZHA 1WA3A 3P82A 4JTEA 4O1BA 3TMQA 1P5BA 1XDMA 5L9FA 1B57A 3OG3A 5FF3A 4XKYA 4Y9AA 3B4UA 2ZRZA 5EA9A 1ZCOA 4MZ8A 3R2GA 3MMTA 1XBVA 1JULA 1U5JA 4O1AA 2J9XA 2PC4A 1JUEA 4NXSA 1KV5A 5I3JA 1EP2A 3W2UA 2GQAA 4DELA 4BI7A 3HGJA 3M43A 2PRHA 1BTMA 4GWEA 2FJKA 1LDCA 3K30A 3N14A 2GJLA 1QMLA 1OK6A 2WOQA 5KZMA 1SFJA 3W74A 4Z0JA 3I65A 1EPXA 3DFTA 1DQWA 3P62A 1NAL1 1B3OA 3L5MA 4EF9A 1I45A 5F4WA 4PODA 5AHIA 3P67A 2D73A 4LVDA 4AB4A 3W7JA 5K4XA 3GR8A 2B7QA 2X1RA 1H63A 4XBKA 5I3GA 3E96A 3A24A 1ZAIA 2FPTA 3RK8A 1PCWA 3TNOA 3PSWA 2CZEA 5BOOA 3T44A 3SR7A 3QYQA
chains in the Genus database with same CATH superfamily
2WSYA 3LM3A 5DT5A 3GKAA 3S0CA 1ZQ5A 3EWWA 2H3DA 1EC7A 4UZSA 1KWGA 4TU1A 3TVAA 4CGTA 1J12A 3NPVA 5E0FA 3SCPA 2VFIA 1MO0A 3V5OA 3W7PA 4HA3A 2WVVA 4DEFA 1NDZA 2GK1A 4XZWA 3BPWA 3TSMA 2A85A 3O05A 3QV9A 4KT2A 3Q94A 3AU6A 5G5IA 1E55A 2NQHA 2OO6A 4AZBA 4JFWA 1J5SA 1W2PA 5LIXX 1SZEA 5HWMA 4C6OA 2ZZ6A 3MT1A 2HDJA 5MHBA 4AWEA 2CLEA 5LHEA 5MF5A 3VX0A 5KITA 2AQVA 2H6RA 4ERIA 1ZGDA 4HGXA 4YTTA 3WZ0E 4AVNA 3THQA 2Q02A 3ZVHA 3M41A 3WLOA 5EMLA 4V33A 1HQTA 4FXRA 2Y88A 3TE9A 1MNZA 2D3NA 4AYGA 3WJSA 3RN6A 5G4EA 1I2QA 4ZE4A 2EGZA 3WLMA 4PN2A 4UTFA 4W7UA 1OC5A 3GFZA 3NPUA 3VGFA 5AOUA 5I6SA 4ES4A 1TJPA 3W85A 1HGYA 2ZADA 4AXNA 1S5NA 1WOAA 3TUUA 4DO4A 3F5JA 4KCVA 3QGVA 4LUYA 4UTWA 1VFSA 3ABZA 4AZ5A 4WDXA 3S8HA 1S1RA 4DWSB 1K1DA 4NUWA 5LHFA 2EAWA 5CQ1A 2X05A 4LUTA 1XLJA 1UIOA 3CV7A 3VGEA 3KUMA 5CZKA 4ZENA 1ADOA 2J24A 3Q65A 3LI0A 4HNUA 5AZ0A 3UBPC 3NQVA 3BQ5A 1IZJA 4U5KA 3BJFA 3W7QA 4IIEA 3NURA 1FFQA 4E8GA 3H70A 1SYTA 1LJYA 1K9EA 4DNMA 3EMCA 1JCNA 1SSDA 1UB3A 1XXXA 3SURA 2E3ZA 2DIEA 4RDVA 5GNYA 5E93A 3CM4A 1J01A 2YBTA 3BVJA 4DN1A 3OQ8A 5ABFA 1M7JA 2GVYA 2OLAA 3WFZA 3UZJA 2DW6A 2WMIB 4QLKA 5A94A 2D3LA 1Q8JA 4JTFA 3O9NA 3RLHA 4BEQA 1NELA 4CD4A 4OUEA 4OJYA 1K7XA 1GW9A 3GZ3A 4FIRA 4E8DA 3C61A 2FGZA 3RX4A 3BE7A 1TPFA 3WH6A 3LHVA 4QQ3A 4AHPA 2E6AA 3W7MA 1PUDA 3RPDA 4ATLA 1PDYA 3PJUA 5LKYA 3MS8A 2PB1A 4B91A 1OGGA 2EG7A 1CIUA 1SM9A 2RGMA 2YCIX 5HBFA 1QU4A 3KZPA 4QAWA 1O94A 2I57A 5E0CA 3OGSA 2ISVA 4I9MA 1K3UA 1TPWA 4MNLA 3SAZA 4YCPA 3QFWA 1KLYA 1FXQA 2HVNA 1VFMA 2NQZA 3W72A 5FSDC 3P5ZA 3IIZA 3T08A 3ES7A 3L4YA 3EOUA 1BSLA 4UOQA 4DPPA 2FTPA 3DHFA 4FXJA 5CH9A 7ENLA 4PCSA 1JGIA 2ZUTA 2G3IA 3LGEA 1PKMA 4HNTA 1EH9A 2NXHA 3LCIA 1GVSA 2OGJA 3AIUA 3IIPA 5A8OA 3IJ6A 1MQRA 4ZXOA 4EK7A 1S2WA 4HNCA 1DWJM 2X1SA 1UR4A 1ZAHA 1FOBA 1E3XA 1OFPA 3H2EA 3S47A 3ARYA 4PCTA 3HMCA 3LENA 2QPUA 4FOKA 3MANA 3FW6A 1CGVA 1UD2A 3TXZA 2BXVA 2X2YA 4LX4A 3DG6A 4DZIA 4WVXA 1G5AA 4TO8A 4AF0A 4PMRA 4H19A 5KZDA 2DSUA 3K8KA 2G95A 5FJUA 3UF9A 4UR8A 1RK6A 4S3JA 2PGWA 4L7ZA 3KBWA 1PL9A 4ZB2A 2PRMA 2VX7A 5CC5A 1NM9A 3PPCA 2OWCA 1BLIA 2UY5A 3VC5A 3WLPA 4GNKB 3L66A 4PC8A 1TWIA 4JOMA 1P0EA 2EPLX 1I8JA 4JS3A 3SY8A 3DIPA 4ONVA 3RLVA 1EWDA 2VVSA 2XIJA 4I9TA 5TF0A 5AKQA 3IJ7A 1ODUA 3DYPA 4L9YA 1F5ZA 3UD6A 3OLIA 3APGA 3I6EA 4UFJA 1DV7A 2BB0A 3GK0A 1EKOA 1V0KA 1VBGA 1Q4NX 1PTGA 1UWUA 1P7TA 1A0EA 4IG2A 2HRWA 3RU8X 3OODA 4HTYA 1EA0A 3TDFA 5M03A 4IIDA 4QP0A 3W7NA 1DQXA 2CETA 5FEWA 1BEUA 1R3YA 1MEWA 4MYXA 3WJXA 4JIQA 1W32A 1F9CA 5EY5A 2CITA 2AKZA 1OF6A 3RR4A 1XLBA 4E0CA 1DJYA 3ID7A 1C7TA 2ZZ5A 1GEQA 1QI5A 1J96A 3PBGA 2QPXA 1J0HA 3IGSA 4L65A 2PDUA 1F7BA 4DJFC 2QCEA 1JAKA 5C55A 4DLMA 2C0HA 4Q33A 4HK6A 4DBWA 3DERA 5FL1A 2VD9A 4O53A 3K13A 1ZBWA 2WNQA 1A3XA 3UZ5A 1TZ7A 4C6PA 1S3TC 2O4MA 1JCYA 4MFDA 3P6LA 1XIEA 1XR2A 2ALRA 2RFGA 1ZB5A 3CEPA 1W9XA 1KRCC 5IFPA 3AOFA 5HPOA 1AQ0A 2OXNA 4Z42C 1KFKA 1LP6A 2O9RA 2Y4SA 2RDTA 2WK2A 4Q8NA 3CZLA 4JZ5A 3UZWA 3F4DA 3KVJA 4C6FA 1PEZA 1W5OA 5JIWA 4GVGA 4HK5A 1AA1B 1SVDA 3K1GA 4KW2A 1WUFA 3EEGA 3CXOA 3LS9A 5JUVA 3STPA 1MI3A 5A2CA 2B7NA 2GGEA 2VI0A 4QXIA 4ADTA 3IJ8A 1GQNA 5J5DA 1FKXA 3II1A 5DRCA 1JFXA 3NZRA 4AZGA 1GQJA 1OX4A 2NVDA 1XIBA 1L6YA 4GVHA 3SUVA 3NQ7A 1SPQA 5A8PA 1R2TA 3EXTA 3O7UA 2IUZA 2NX3A 3R6IA 1OX5A 2UV8G 4XZNX 1RALA 1AUSL 1WUEA 4AIBA 1US3A 3QPEA 4MWAB 4NNBA 3N04A 2X7VA 4K38A 5EYWA 3G6LA 3PNUA 3NO1A 5KZEA 4I7VA 3WLQA 5A6AA 2CLLA 2HTMA 3CV1A 1QVBA 4Z1BA 2XPKA 5A8QA 1OEPA 1BYDA 1IXQA 1M01A 2E25A 3HG4A 2NQLA 4MJZA 3EZ4A 2WNWA 2B0MA 1B5TA 2J7HA 1QAPA 2G8ZA 3P80A 3CU2A 4GI6A 3APYA 1W1A1 1JZ7A 5BRQA 3K8LA 5MKGA 1T40A 1VFOA 2DSKA 4MJ2A 3WK2A 1S5TA 1NOFA 5D4YA 2A4AA 1UP3A 4M3PA 1VFTA 3TYUA 1RXOB 4NAFB 4IFKB 2HISA 1TJ2A 1M03A 3EX3A 3W7HA 1JXKA 1EC9A 1I4NA 1RZMA 3G8RA 2CWXA 4DZ5A 3PBUA 3SRKA 3KCOA 1LTDA 4F66A 2GJPA 4FX7A 5FJOA 3UW6A 4WEVX 5CPOA 1IGWA 3INPA 2FLIA 1HKKA 4IMFA 2XN2A 3O06A 4LRTA 3AHVA 3CL8A 2PODA 3A3XA 1LWJA 2QQ6A 3MYOA 3NXLA 4K3ZA 2PCQA 4HA4A 1DHKA 2VTFA 2PDGA 3KL0A 5IFTA 5B7ZA 3S6DA 1W37A 4PBEA 4PZVA 2ZC1A 1ITCA 4IT1A 4AD0A 3E74A 4PUWA 1XISA 2I56A 5AYXA 4AXKA 4FX6M 4C6KA 4UQDA 1LOQA 2VGIA 1FBAA 3CAQA 4JL2A 2FVMA 1FFRA 3TONA 1TIWA 2X1IA 3LSBA 1NU5A 1KRBC 1XFCA 1KQYA 2RJGA 1X7FA 4H2CA 4G56A 1EC8A 2VC5A 5FSEC 2OB3A 3MQTA 1VCFA 2WC4A 1DJWA 4BK9A 1S2AA 3FSTA 4LANA 3E0WA 4E2DA 1F3XA 1HKMA 6REQB 1JYVA 2PDXA 1HO1A 3WH7A 4CN4A 1UWSA 3FY1A 3GXMA 3CIXA 2D0HA 2ZA2A 2VKZG 1DIDA 4AYSA 1G69A 5HINA 3T9PA 2ZX9A 3FXGA 4JTHA 2DZVA 3TWAA 3CUGA 4DBSA 3PZIA 1HP4A 1XIFA 1DVJA 3QC3A 2GGIA 4IGNA 5LNWA 4EPBC 1XYZA 2A7NA 2XIMA 3WK1A 1GPWA 3MI6A 3STCA 2Z25A 5KETA 5T8GA 3LNPA 4I5XA 4IIFA 1ICSA 3CJPA 1R9ZA 1XIGA 4NVTA 4FIQA 1CB7B 4V28A 3MHFA 1WCGA 3UQNA 3KP1A 3NQ2A 4IGSA 7REQB 1POJA 1YMYA 4FEZA 1XJBA 4JTSA 1TV7A 3ARSA 4O28A 4DWSC 2RDWA 4YTQA 2D1ZA 1OZMA 4JTKA 1Q6QA 3HG2A 1QPOA 1XDLA 3VI2A 2JALA 5BRBA 2C15A 3ZLFA 1TMLA 4UIOA 2BSLA 1AG1O 3T42A 2WKGA 5HULA 4C6NA 3TJLA 1O1HA 1GVYA 4B3ZA 3N6HA 3WUGA 1O4UA 3FCPA 1TZZA 4JNZA 3TN6A 3VKKA 1I60A 4RNFA 1XIJA 1GKPA 3C2OA 3QLDA 2V63A 2HWGA 5BZAA 2XM1A 3OZOA 1E0XA 1EHNA 1U2YA 1XLKA 4YWSA 1UKQA 5GNXA 1ADSA 1LQAA 3NO5A 5F1VA 1HKVA 2VWTA 4DAFA 3Q2DA 3P3BA 1CBGA 5D33A 1ZFJA 4Z2JA 3R25A 1MSSA 1OT2A 3MUXA 2XIQA 4MSSA 4W4QA 4GINA 3VKCA 3T40A 4I5RA 4H8UA 3JR2A 3NL5A 4MJMA 1V6YA 5D32A 5BRPA 4IJCA 4M6PA 5LIUX 4HSOA 1IZCA 4QHRA 2EHHA 2Y24A 4BS0A 3GNDA 1MZHA 1K8ZA 3GU2A 4F9DA 3BK0A 5BXTA 2D2JA 3CT7A 3FX4A 1XP3A 1IGSA 1HJSA 4QG9A 2HQAA 4HA1A 2WBKA 1KBBA 4WKHA 5C71A 2XYLA 1DORA 1PPIA 4V27A 1H11A 1KM5A 2OEKA 1YTKA 1B1YA 4AZCB 2VGFA 4O0KA 1UA3A 1GOXA 2WMKA 4JHZA 4IP7A 3PM6A 3GM8A 2RDXA 1MW2A 1A5NC 1H7OA 4GACA 2DVXA 1OIMA 1X96A 2XFFA 3F2DA 3HV8A 3OPSA 2A3LA 5EL1A 3QY6A 5C9UA 2FDMA 3KRZA 3W84A 1OY0A 5LNRA 3CAVA 4Q8VA 1F2JA 4DPQA 1REQB 2XU2A 1JGMA 1RCQA 1FCVA 1XFBA 8XIAA 3GDRA 2X42A 1CZ1A 5DN1A 5EMUA 2OWXA 3THAA 2VGBA 1H0GA 1R46A 4P7NA 1XBZA 1TMQA 3PUDA 4K2SA 2IW0A 2C13A 4S23A 2WM0A 3AUJA 5HAOA 1VYPX 1Q6OA 1X97A 3O16A 3VXGA 4KRZA 4M5PA 4O52A 1NVMA 3SSZA 2WHJA 3AS0A 3DFPA 4US5D 3GIYA 3U2EA 1RQEA 1G7UA 2QAPA 4GYPA 3DFSA 4LGXA 2E77A 3VGGA 4J3ZA 3KP0A 3FHAA 1GEHA 3UEQA 4DYKA 3CV2A 3LSCA 1A5BA 4DVOA 4JYDA 3C6CA 3H2NA 4TX9A 4FP1A 1AW2A 5I5RA 2PLMA 1H09A 3S46A 2YOCA 1AFSA 1TRIA 1L6SA 1F3TA 1T8XA 3OYZA 3SW6A 3A5FA 3GNRA 2W91A 5M1TA 2Q8LA 5HNTA 4QJ1A 2CHNA 4XX6A 4EAYA 1V3HA 1ZLPA 4CVUA 1WDRA 4NI8A 4PMDA 3W82A 1NFBA 4F0RA 4H6KA 3SEPA 1F61A 1QNQA 3E0IA 3IV8A 3E3HA 3L4VA 1WX0A 4LNYA 3SECA 1E70M 4IL2A 2YA2A 3HPXA 1SJBA 3W9ZA 1JYXA 2NX9A 1XYBA 4C7DA 2BGSA 2XIBA 1X6UA 1EA9C 4MTVA 3VOHA 3OVRA 5BWAA 2QDGA 5E09A 3WMCA 1OBAA 3UGVA 1XX1A 3WO8A 4Q6JA 4RK8A 4AZ7A 3N1AA 1OSEA 1MWOA 4PUKA 3K5XA 4EAMA 2ACUA 1XC6A 1S3HA 3T0TA 1IEWA 2OR2A 1CCWB 5GPRA 3GXIA 1EIXA 4IM4A 5DELA 3UWVA 2J6VA 1DTUA 3LY0A 5FEPA 3W2MA 4YVXA 1V02E 2NWSA 2WC3A 1RJQA 4HQVA 3GXFA 3GC2A 4IPLA 4JQ3A 2JKEA 3AIEA 3JS3A 1Q8AA 3VMPA 2FIQA 2ISWA 1R87A 2A3EA 5EKYA 3P61A 4Q7NA 1K4HA 4EIVA 3VGBA 3AZTA 1VD6A 4QE5A 3O63A 3WQPA 5I3KA 6XIMA 3TFXA 4WXYA 5CSRA 3BLPX 2Y70A 3IK2A 3VTRA 5K3VA 1CYGA 4Q8OA 3P7YA 5JQ9A 3WH9A 3WLSA 2NUWA 4PGLA 4MWAC 4LC6A 4QNEA 5E9AA 4WRHA 4MNKA 1NP0A 3N19B 3BAXA 5I3HA 4LC8A 1HIZA 1SZRA 2FFCA 1W9VA 4IIHA 3NDZA 3H4WA 4IMGA 1K8CA 4MDOA 1LG2A 3TJIA 1QO2A 1CT5A 1OJXA 2PA6A 3AIWA 1VRDA 1V51A 2OO0A 3CHCA 2NT0A 3AAMA 2YJQA 4H4IA 4LAKA 1D3GA 3PBVA 5HK4A 1D2KA 1Y0EA 3BJTA 3PNZA 3DU0A 2AQWA 4DQWA 3LHUA 1FH7A 4ICCX 2DP3A 1X39A 3BL3A 4HOXA 2VUNA 3MHGA 3CMFA 4HOZA 5F2IA 1VCGA 1FCUA 2ZX6A 1WAUA 3VIKA 5G2IA 1FWNA 2OYKA 5I24A 1EO7A 3GHSA 1ISXA 4IH3A 3SFWA 4HPJA 3K1DA 3DFNA 4W5UA 4BFAA 3VDAA 1OVDA 3MC5A 5L6UA 3LRKA 5HNNA 1QNOA 3V1PA 1BYCA 1XCWA 3WIJA 2EEXA 1QDSA 2TYSA 3PPGA 3H54A 1F05A 1EDGA 3WLRA 2OSWA 5KINA 2DFAA 3CZEA 3TQKA 2QJJA 3RLGA 2J74A 4GX8A 3E5BA 4GKLA 3MP5A 5HJLA 1E1CA 1S2CA 4HN8A 3H21A 4D6FA 3PZUA 4G9PA 1E9YB 3NSMA 3WQWA 4FLOA 2WMJA 1GPFA 3OTRA 4NZ1A 4XD3A 4PTWA 1PVNA 3M5VA 1Y5VA 4L4OA 4H8HA 4L61A 3NO3A 1H49A 2QIIA 1B9BA 1JZ2A 3WF2A 1CLVA 3QXBA 4D8LA 3IJLA 3T05A 1E40A 4Z1YA 4MWAD 1TIMA 4JICA 4MKNA 1P0NA 2YW3A 3BCFA 2DT3A 5D03A 1YXDA 3IRSA 4IF2A 2NVCA 2PDWA 5BYWA 4MZ1A 1A3HA 2QDHA 1E15A 2FYMA 4Y7EA 3B9OA 4GJ1A 1TX2A 2OCZA 4HCHA 3RO8A 3N18A 3KOZA 4GY7A 3M16A 3KM8A 3T7VA 2D2GA 3H7UA 3PAOA 5EPDA 2E09A 2GQ9A 4IXXA 4C5ZA 2RH9A 2W61A 2BNJA 4IX2A 4W88A 4F3HA 1XIHA 3HA1A 2YZRA 2J6XA 3VZZA 3O3RA 1U1UA 4EPKA 1YDVA 4AW7A 1OCJA 1OFQA 3KX6A 4A3HA 3ITOA 3GVVA 1JCMP 3A4XA 3KLLA 4HPGA 5AHMA 1CLKA 3KBMA 4E38A 1NDVA 3MBDA 4DZAA 1SJDA 4WLCA 3S5SA 1LL7A 4RPQA 3UZZA 3O15A 4J7RA 1BRLA 3AHYA 2WHMA 2E9LA 5I02A 2VOMA 4AFYA 2PBOA 3WNPA 1UBPC 4H2HA 3OVQA 4LYPA 2PU1A 1GG0A 3I68A 1A5SA 3BV7A 2ZDSA 4IMEA 1EF2A 1X38A 2MNRA 4GUIA 2PDNA 1M7PA 1FY6A 1HVXA 1RD5A 3W29A 3BSHA 3WLKX 1H1NA 3EWDA 1MQPA 4W7WA 1Z7AA 3EOOA 3EMQA 5LZLA 3V75A 2FVLA 1VZWA 4TVCA 1UC4A 3LTYA 3BAJA 4RW5A 1GTEA 1Y65A 3QKZA 4MDPA 3WD0A 3ZVIA 5GJNA 4XO6A 4R85A 2F8QA 3W4RA 1CXIA 4K8EA 5LNVA 3BH4A 2YCJA 3C3UA 4UBPC 3LBCA 1FWEC 2JGYA 4HHHA 4KS0A 3WBWA 2A5HA 3IUIA 3VFCA 1D8CA 1HKJA 1TTJA 1EUAA 3P2VA 3KWSA 1A5CA 3ITVA 1KR1A 3KBJA 1UKSA 4CD8A 1IIHA 1P1MA 3MTWA 1GYLA 3ANVA 1XLCA 2PE4A 3IGUA 1GVFA 3A4AA 3QW3A 3WNOA 1ESWA 1VYSX 2PLCA 1H0IA 1W3LA 1PIFA 3B0PA 3CL7A 1N82A 4OZOA 2CXEA 2E68A 2G4JA 3DENA 3T8QA 4NIRA 5A6SA 3MB9A 4DJFA 3M0JA 3L12A 3VMNA 3VINA 1XPYA 1HNYA 4UFKA 1E1FA 3N9SA 1BQGA 1WO2A 3L0KA 2CU0A 4JD4A 1RD6A 1VPQA 3RM8A 3VZXA 3MVTA 2VDGA 1RR2A 3EA1A 4KMQA 5D2YA 2ACSA 3A13A 5F7UA 1UH2A 3QZAA 1GQLA 4D6GA 4PRTA 1KGUA 4RPPA 3ECQA 2ZUWA 1CXLA 1W5NA 4P2VA 1BWKA 3F4NA 1KFCA 4LYQA 4QDPA 5D9MA 1YXYA 3MP4A 2ZCGA 4HHMA 1Z42A 2NV2A 4JIPA 4TIMA 2FZNA 3FDGA 3WLTA 4PBGA 2BY3A 5C0QA 1V8EA 1ZP4A 5BMXA 1SW3A 6ENLA 3RMEA 5GJPA 3QGKC 2P88A 1V02A 1SZFA 3LXCA 1LQ0A 5FJPA 1HW6A 3A64A 2KZHA 5CLWA 3P82A 4O1BA 1P5BA 4LEQA 4XKYA 4Y9AA 3N29A 5EA9A 4Q7BA 3R2GA 2O9PA 1DWHM 1Q85A 3PZ9A 2PC4A 4YPJA 3AROA 1EP2A 2BHYA 2YXOA 4HYRA 5DQPA 3AUOA 1I6NA 2X7WA 1U33A 2FJKA 1LDCA 2WJFA 2WZIA 3TEVA 4WHBA 4WKAA 2GJLA 1QMLA 4BF5A 4Z0JA 3WH8A 1EPXA 4KPLA 3P62A 3BSMA 1B3OA 4EF9A 1I45A 4PODA 5EMMA 3P67A 4XBJA 3V36A 2B7QA 4XBKA 4ZO8A 3E96A 1VJZA 3SN1A 4XZBA 2FPTA 4PMYA 3TNOA 1PWMA 4HJWA 3NZPA 4GYKA 2WM1A 5FKYA 1JXJA 3UERA 3SR7A 3EPOA 1SMAA 2R6OA 3BV4A 2D22A 4AEOA 4K68A 3ZS4A 1BQCA 4GQRA 2J79A 4ECLA 1QPKA 1RVKA 4XAZA 3UNDA 1MW3A 4XIMA 3UU0A 4B2DA 4WY0B 3RRAA 3FEMA 3FN9A 2QYGA 1RQBA 3EDJA 5H6HA 1O6IA 3AJ7A 1Q2RA 2J78A 3VM7A 4JY8A 2AAAA 1VH7A 4L6OA 2YZ5A 1JZ6A 2C1IA 4J2MA 5K9XA 3WJZA 1KCKA 2J7GA 1YADA 4ADUA 3AMDA 3EOEA 4QR6A 4I3GA 5CCZA 4L80A 3G22A 3NDYA 4GOAA 5CKSA 1MMFA 3KOFA 1TR9A 2V81A 4TR9A 1IHIA 1UYQA 1WKDA 1TE1A 3H53A 2JK2A 4IUGA 1UOZA 3LGGA 2J8FA 4O1DA 3DOPA 1SR0A 2OELA 1F3EA 5AHNA 1PHQA 2TAAA 1IT7A 4DJEA 4E6MA 4LALA 4CN6A 4Z2KA 5G2WA 4IQJA 4KEMA 1VFUA 2WPBA 3EPNA 3VIJA 2ZUSA 4OV4A 2OG9A 1AL7A 1I2RA 2VX4A 3VOFA 3WD1A 3GDLA 2WC7A 4MB1A 3VNKA 5FEZA 3VIPA 3EEZA 4PFHA 1MW0A 4FALA 2KX9A 4R34A 1UG6A 1JAEA 3AYSA 1R7OA 1GOIA 1T41A 4GO9A 3EDKA 1SU5A 2ZZ2A 3A21A 3GRIA 4HVXA 5EBAA 3OEXA 3RFAA 3IVSA 1I1WA 3L0GA 4KESA 1R9YA 2XM2A 3KW3A 1AJZA 1KM1A 4UFLA 3N2XA 3K2GA 5G2HA 4LBUA 1LOSA 4QQUA 1K9DA 1XPGA 1OM0A 3GYEA 4JKMA 3VUSA 2X0SA 2VO5A 1VCVA 4EP8C 3CZGA 2XVGA 2J9YA 5C2GA 2Z1WA 2ZA1A 1KFLA 5E1QA 2F84A 4CKQA 4S3DA 4ML4A 1L6WA 2XFWA 3CIVA 3JW7A 4XG1A 1WDQA 2NW0A 1I9CB 3VNJA 4DWSA 5H2ZA 4JTGA 3W6MA 3DKLA 3FGCB 1QWKA 3JUGA 1ELSA 5IOBA 4J40A 2QNEA 4Y2WA 3VO0A 4HJFA 3WDRA 2OSXA 1WDSA 2BXYA 3M46A 2VJXA 4JX4A 3TQ0A 1K02A 1I0BA 1XKJA 1PXGA 3SUWA 2OPJA 3WQDA 3DI1A 4J35A 2QR6A 3UETA 3VDBA 2OKTA 3GYCA 1C29A 1WP6A 5TAOA 1LL6A 4Q8UA 3WQ8A 4DF0A 3H2FA 4NYYA 4RNIA 1WZLA 5F2MA 1OT1A 1YRRA 4GGHA 5DY2A 1ZAJA 2J75A 1SR9A 1ZENA 3W70A 3DYMA 3P14A 3FEQA 4KF1A 1PZ2A 4AZHA 3E38A 4QS5A 1QCWA 4NZJA 1NEYA 5J5RA 1XYLA 4TXEA 4Q6XA 2VZUA 3T4WA 1ONWA 4GNJA 2PLKA 1RBAA 4X22A 2VX6A 4PH6A 1AODA 4IXHA 1LG1A 1FA2A 4O15A 3VUPA 5K7JA 3STFA 2PCEA 3A4WA 1X6NA 4DUXA 1TELA 3B3DA 2B7PA 4OGZA 4O14A 3NAVA 3WEOA 3W37A 2XIOA 4DAIA 3MWCA 1KA9F 3TV8A 2H8XA 5HDRA 3GLCA 1KTBA 3TXVA 4OQVA 3W26A 4PL2A 2NQ5A 2VQTA 1G6CA 3QQWA 1UJQA 1XQKA 4LCSA 4M82A 3GTIA 5IHSA 3ARTA 1S5WA 4KCWA 4CEXC 5C9WA 4FF5A 1AMKA 3W7OA 4QTGA 2GDVA 3UXDA 3RG6A 1GVEA 1TYGA 4P61A 4F0SA 4FLRA 1WZKA 3GW0A 4JX6A 4LAZA 3S2JA 4JTDA 5HNRA 2BVWA 3GNOA 1PDZA 4HNVA 2YDQA 3M0YA 4W85A 3H7RA 1YTDA 3TTOA 1OFBA 2W92A 3AXIA 1DJXA 3MCOA 2D2HA 3CMJA 3S9YA 4K7YA 4QDMA 3S1UA 3MSDA 1S46A 3TWBA 3EWXA 1LL4A 3E6EA 4UOJA 1UD8A 4YL2A 1XV8A 3Q45A 3DEQA 4DI8A 1SZGA 2FZMA 2W27A 2PTZA 1VIZA 3ABSA 4AG0A 4UR7A 2IPGA 2AQOA 3TZFA 3IRDA 4KFOA 4M80A 3QR3A 4U28A 1OD0A 1H1ZA 4N6FA 4GUGA 3TCSA 2D2OA 3QF0A 3LBOA 2FMNA 4FNPA 4PMUA 3F4CA 4LOCA 3T2PA 3GH5A 5G1YA 4TQTA 2GJRA 3SRHA 2W5FA 3S1VA 1QTWA 3IJ9A 1MNSA 1VRXA 3A5VA 3KOYA 3N11A 2IXUA 3QOMA 4H8VA 3CWHA 3ZQ9A 3PUGA 1PKNA 2G5WA 2VD8A 3SQSA 3AIRA 3PTDA 4ILSA 2DW7A 5DT7A 1V7AA 4L5ZA 4ERAA 1E4LA 1A5OC 1HF6A 2R24A 2IPFA 4Q8TA 4RDZA 3VD4A 4W7VA 1PZ0A 3NVTA 2HJPA 1CEOA 3NXFA 1C8XA 2FDSA 1ISWA 3QM3A 3T6CA 3NEVA 5EMKA 2MANA 1ZRQA 3M0XA 3SGUA 4A3YA 4IFOA 3MYPA 3ABQA 4URIA 3TSBA 3APTA 1GZJA 1XKYA 3SCNA 1K9TA 2YCLB 1EBGA 1XLIA 1UOKA 3MPGA 3LMZA 3PG8A 2JQXA 3ALGA 1UQZA 2Y5EA 4H9UA 4IQEA 3UESA 4ZQRA 4ZSUA 3KEHA 1KM3A 3BC9A 1G4EA 4N4PA 3WELA 4MY1A 4FNRA 4XZ9A 1D3HA 4CQBA 3GDBA 3CAKA 1Z41A 4S3AA 4H9MA 5EMJA 2QCDA 2PP1A 4QLJA 1NOWA 3CUFA 2PDIA 4XTIA 1K8YA 2WZHA 2WVVB 1C3FA 5AC6A 2GK1B 5C70A 3URQA 3WD3A 3EXSA 2DZUA 3LNMA 3UYCA 2ODOA 3OO2A 1YW1A 3QOKA 3L4UA 3FXYA 3QR0A 4P8WA 4PB4A 4QBXA 4QGCA 3IWPA 2GQ3A 1WNOA 3I3DA 3GXPA 4H3DA 3I3EA 4MMWA 1GKRA 5D05A 3FYOA 1PX3A 4UQEA 1Q6LA 1P0KA 3RJXA 4JTJA 3CBWA 3KL5A 3E2RA 4HHPA 5HMEA 2YKKA 2E6YA 3CS2A 4GQGA 1GVRA 1XCFA 2PMQA 3MW7A 1XD0A 3ZVHB 3KE0A 1RLDA 1TWDA 4EVZA 1Q4WA 2FH6A 2PWHA 3NGFA 1WYIA 3LHWA 3N15A 4AISA 3O2LA 4A22A 3FVMA 4DUOA 1KBKA 5KZ6A 3L4TA 4BR1A 3BOFA 2XFRA 1FVPA 3ZLHA 2ZA3A 1YQ2A 4S3KA 3MCNA 4RDYA 1YDYA 1OIFA 1G9HA 2Y61A 1VS1A 3S2LA 3G3MA 4L56A 3S5NA 4P7OA 2ZXAA 3GBEA 4Y8EA 1VFHA 1LLOA 2XVKA 3GG7A 4IMDA 4NZ3A 5D9OA 1NWRA 2VX5A 3HPSA 1QHPA 3BMXA 3UJ2A 2EF9A 3U9IA 4LUTB 1C92A 3AIVA 1GZ1A 4HNLA 1MVYA 3OYXA 4NJJA 4AD3A 2CLIA 1E72M 5BXSA 3I6RA 2WXDM 3TOYA 2CW6A 2IKJA 3OBEA 1A0CA 4UB9A 5FEXA 3AMCA 2GGHA 5F1UA 2VVNA 3VC6A 5AECA 1NWSA 4KEUA 1JR1A 1PSCA 4DXXA 1ZALA 2FB2A 3RNDA 3AI0A 1Q3NA 4IGHA 1OFRA 3D3AA 2H3BA 5ABFB 5HMSA 4BF7A 5AZ1A 4P7LA 3W87A 4HNOA 1XWYA 1W3IA 3ITLA 1EP1A 2OQYA 1OX6A 4LV4A 4UTTC 2VRQA 2PF8A 2YLLA 4DI9A 4GXWA 4D6EA 3OOQA 3HZ3A 1ME9A 2PGFA 2OLSA 1XS2A 4S2BA 3KWXA 1EX1A 4C6JA 4MB3A 3MV01 2LLEA 3PTKA 3NOYA 2E8ZA 2QUVA 3PUOA 4CD7A 2D0FA 3N3TA 1BXNA 4O13A 1UROA 3ZR4A 2Q6ZA 1QI0A 1TPH1 2WKLA 3V3WA 1GQIA 4FK9A 2ISSA 4PCFA 4NX0A 2IKGA 2YYUA 3KCJA 1A5MC 3T2OA 1YHTA 2ACQA 3M7SA 1E6RA 1OCQA 1R5YA 1IEIA 5D37A 4PCNA 4ZFCA 2C1GA 3PF3A 3W02A 1QPNA 2CZFA 2R1MA 1L6GA 3EKZA 2WSRA 3UR2A 4WJEA 1JZ5A 4E5TA 3WLHA 1C7SA 1VJIA 3G8EA 5HOSA 4R9OA 4FXFA 3B03A 3NG3A 3OZYA 3WBEA 3WUFA 2QJNA 3BLEA 3TTQA 1F6YA 4X9SA 1P48A 1VLIA 4N9CA 1GUVA 4ZOAA 4PTVA 4H9ZA 5F2GA 1EQCA 1C8VA 4N4QA 1P6CA 3BOXA 1LLZA 4LJ3A 1EP3A 3OVPA 5E0KA 1W1TA 4J3TA 1H61A 4GUFA 3ITGA 3KOXA 4JKLA 1CGUA 2Y63A 1J0IA 4OT7A 3W81A 3UG4A 4YTUA 3USBA 1TUXA 3C0QA 3W7DA 2VRKA 4L1GA 2R9RA 4AF0B 1SO3A 2R1NA 4JTRA 1XGZA 4Z2IA 4YMZA 1Q6CA 3UWZA 1ZUAX 2J9ZA 3SY5A 1RAKA 1QPQA 4MB4A 5AB3A 1HN1A 1UP2A 4A3QA 3BLIA 3O6DA 3ZFHA 1S5MA 2V3DA 2CBVA 3C2FA 3CUHA 2ZXBA 2OQLA 3GR4A 1W1VA 3C3NA 1CX9A 3FHQA 4QG6A 4KWSA 2WSKA 3VKJA 1W6TA 1M04A 3WEMA 5EFFA 4HU8A 1LWHA 5DY3A 3BG9A 1O95A 4PSPA 1G1YA 1BYAA 1RA5A 2CERA 1Z44A 3ZT5A 2JF7A 2HE8A 2OLHA 3N4EA 4O54A 3NL3A 3THCA 1A5AA 1LT7A 3MUAA 4IG2B 1DHPA 2Z2BA 1MUCA 1OWQA 1VJSA 3WF0A 1E9ZB 3CQ0A 1L6FA 3TZNA 1O5QA 3CH0A 1GK8A 1V3JA 2FMOA 3N9KA 3LB0A 3WJYA 1FTXA 1PIIA 2YCEA 1DE6A 2AGTA 4EWJA 3N2TA 1FH9A 3PBMA 2BY0A 3CQHA 1IV8A 3UZXA 4QITA 1VAHA 2I5QA 3NQAA 2HV5A 3B04A 1R38A 4UTJA 4DJDC 5CPTA 2GSJA 3GR7A 2O55A 4LBSA 2X1TA 4NQ1A 1V3MA 1B54A 1C8QA 2NUXA 4QG8A 3E0LA 4X2RA 4IMCA 1NWUA 2VURA 3SJNA 2J27A 2CEQA 3VVGA 1B0IA 3WK0A 1A0DA 1IYXA 1RLCL 1WQ5A 4YHGA 4JIEA 5C6MA 4H00A 1WE5A 1NF7A 5FESA 3GHTA 4LAMA 3HB9A 3L7RA 3DBNA 1AK5A 3WL0A 2BG5A 1JFHA 1CENA 3RX3A 2VEKA 3URBA 1ML1A 1OCNA 4W86A 4WDUA 2PGEA 3DHUA 3N4FA 1RY0A 2QCNA 2O9OA 3E2VA 4HIBA 2V69A 4C1KA 3BANA 5JXQA 4PTMA 1P4CA 2PI6A 1Q6DA 2W6RA 3MCMA 3UNTA 3B8WA 2DEPA 1LBLA 4UOZA 5C9XA 4H9VA 4FR1A 1DXFA 1UWIA 3GFXA 3ENLA 4K8GA 2VWSA 4EANA 7XIMA 4PUNA 3KDOA 1LORA 2ZIDA 3FJNA 4IJBA 4KGJA 4ZQCA 3HU7A 4I6VA 5D8WA 4M8UA 3RUBL 5AYZA 3DXIA 4JIHA 2WZMA 3DH7A 3C2RA 2F7FA 1O5KA 2TMDA 1H7NA 3GC5A 3VDCA 3VKAA 4Z1AA 1GJWA 3CK5A 4L4PA 4EOUA 1B90A 1VF8A 5LIKX 4A4AA 1X1ZA 3REQA 1MRQA 3N25A 2QCFA 3MBFA 1RUSA 4B92A 4PMZA 4UMCA 3KLKA 1QOXA 3UJSA 1UD3A 5I7GA 1VBUA 3AXKA 4WX2A 5AY7A 4OIFA 4CQCA 3NYDA 1U1JA 5MKGB 4DJDD 2PZ0A 2QV4A 4JAWA 1JD9A 2C6QA 2GSEA 4XUGA 3NUKA 2Y0FA 2OFJA 3HV9A 2UY3A 1W5QA 5ABEA 3HTWA 4GY1A 2HPIA 3HN3A 3L0NA 4JIIX 4E8CA 4EF8A 4CQAA 1PX4A 2QJGA 1KR0A 3CLMA 5JH2A 2WMGA 3R58A 6TIMA 1J18A 4CN1A 5TNVA 3EB2A 1R3VA 3NWRA 1S1PA 3WG6A 1DWIM 3HPZA 3T8LA 3SGGA 2XN1A 1BKSA 4H6QA 3PZGA 5CC3A 2ZRWA 3OU8A 4F8XA 2IKIA 2GVLA 1FWDC 5A6KA 4R53A 1OD8A 1F6KA 1KCXA 3DDMA 4ZOBA 2A3HA 4ZTXA 3MWAA 4JQ2A 1VHCA 1WKYA 1J0KA 3UXIA 3FDKA 1OC6A 1DIKA 3VNYA 1WKEA 1QR7A 2QMJA 1CWYA 1E56A 3D5HA 4NZCA 1B3WA 4D1IA 1ECQA 5I06A 3TOPA 3LYEA 4NX5A 3G2GA 2V8ZA 2X16A 4XZLX 1T8QA 2EG6A 2QF8A 2VFGA 3S6TA 1W3KA 1YE4A 1JJKA 2R8WA 3GAYA 3MMDA 1A49A 1TPVA 1E4IA 3TYBA 3ATZA 2BVYA 4HU3A 5I3DA 4NJIA 2A2IA 3MI3A 5LA1A 4B5XA 3V5CA 4N42A 9CGTA 3TROA 4GI4A 2A0NA 1YDNA 2JKAA 1E6NA 4IL0A 5G1MA 2WMFA 3GG8A 1T5AA 2HVOA 1ZNNA 5A6BD 4KCUA 3L2MA 3RITA 1J5TA 3K46A 3S1GA 1UUQA 4FF7A 4JFTA 3CPRA 1UR3M 3W86A 3LCXA 2V30A 2TRSA 1OGBA 3PVFA 4DUVA 1EXPA 4DHGA 2QJIA 3OBAA 2HBXA 3KXQA 4P8XA 2FGBA 4HMNA 1H1YA 3KL3A 3TX9A 4A3RA 4U3CA 1UJPA 2OGYA 2POZA 3G1SA 4XD5A 1QUMA 1GCYA 2E9BA 5CBBA 2P5NA 2AAMA 1WKFA 3CH9A 2NV9A 5BU6A 4DNHA 1U5VA 1LBFA 1P6BA 3C52A 1R9XA 3MY9A 2WPGA 3EDFA 4K1GA 1V6XA 4B5WA 1T99A 4KEVA 4ZFMA 1MXSA 1J79A 2WZEA 2CXGA 4M29A 3BW2A 2Y8KA 1VB9A 3TW6A 4GLEA 1QNPA 2PU0A 4GUJA 2VRJA 1W1IE 3TA9A 3G0UA 3FAWA 4K36A 4BA0A 3PTMA 1Q5MA 1W9DM 3EX2A 3B97A 3UFYA 2EPOA 3VD7A 2CBJA 2J62A 5J8LA 4A8IA 2Q3RA 1VPXA 4AD4A 3UWUA 1V3LA 2OX4A 4LS2A 1BPLB 2PD5A 1XM3A 4GO8A 3WLLA 2L5HA 2YW4A 4D8AA 3EX1A 3T07A 1DIOA 2QEZA 4LY4A 2YSWA 1BWVA 1RHCA 5D2TA 4ATWA 4RZ5A 1AD4A 2WZTA 3H2OA 5FF2A 3HJEA 4HCLA 5C2CA 2XGZA 1ISYA 2XHYA 3AS3A 3BGGA 5TQLA 4F0MA 3KFTA 1UR8A 4DB7A 2FHFA 1W91A 4JFVA 2GZXA 4AY7A 5CPNA 1BHGA 2A3CA 4PYSA 2RKXA 3OZMA 1EEXA 8CGTA 3LCHA 5M3WA 5HXMA 4GBDA 3O8AA 5HANA 1RK5A 2ZXQA 1V03A 5K9DA 1HKIA 3P8IA 4MYAA 3LLFA 5IXEA 5CZTA 3TAOA 3W1QA 3ES8A 4O0ZA 3W75A 2CPUA 2PBGA 3W1PA 2DDXA 1NF0A 1DE5A 1IXOA 2Q8XA 4H9XA 4ATDA 3GS6A 4HMDA 2NUYA 3OLGA 2XH0A 2Z1VA 2YA1A 4XBSA 1TQJA 3R8GA 1N2VA 2INZA 1N8FA 2GDQA 1PO9A 2YYTA 4LU0A 3VA8A 4CCDA 4GC4A 3POCA 3POHA 5AHLA 1E71M 2J7CA 2DU2A 1XW8A 3L68A 1EGMA 3FYYA 6TAAA 1LCOA 4DXKA 2BXZA 1AL8A 1K70A 2YB4A 5CSSA 4E4PA 4R7JA 2A7RA 4AY1A 1NJJA 3JU2A 3KTCA 2ISDA 3QHNA 5M5DA 4O19A 3XINA 1DEDA 5HJXA 2ZVRA 4D71A 2OZTA 2QHAA 1MEHA 3B40A 1J0YA 3R8HA 1H4PA 4QSHA 4YVVA 3W2JA 4RV3A 1QI2A 1N55A 4YU1A 7CGTA 1R30A 2PDJA 4X0VA 4KRUA 4RLIA 1UUMA 1GW1A 2PAJA 4KCTA 4INFA 4BQ4A 2BWGA 3W1MA 1GONA 3PTQA 4I8YA 5HJYA 1XUZA 1SQ7A 2VFEA 3G1RA 4QFUA 2ZRYA 3W73A 1C93A 2G41A 3EGJA 3I7QA 3ERPA 2C0AA 2ZC8A 3T1GA 4PUDA 4MNJA 4TV6A 4OFCA 3PK7A 1L9WA 1HJWA 3GKFA 3W22A 4B90A 4AQLA 3ZIZA 2WKJA 2W9MA 3HQNA 5LXXA 3EWBX 2VOTA 3U7VA 4ZEPA 2FGLA 2R94A 1EL3A 2YXGA 1A3WA 1E0UA 1R2RA 3NVDA 3CQKA 4N0RA 1I2NA 3GIPA 4ZO9A 4FB7A 4I6KA 5T26A 2EKCA 3KAOA 1G4PA 4O12A 3RILA 4C1LA 1FWFC 4Q7IA 2VZSA 3DFYA 4YTSA 1FP8A 3T0BA 1Q66A 3UWYA 3EWYA 3ARPA 1EQPA 3WDHA 1T7LA 1JRBA 1JI1A 3NYZA 2Z2UA 4XV0A 2VR4A 1YIXA 3PWAA 1JI2A 4QLLA 4ZQOA 4O1CA 4ASTA 1I75A 1KO0A 3NL6A 4RKAA 4NAEB 2I5GA 4FSAA 1ITUA 1R86A 5XINA 3WBYA 1J0JA 2NVAA 1UA7A 5I78A 3MSRA 5A3HA 4H9TA 4JDYA 5I07A 4UQCA 4NZ5A 1R0MA 3FSUA 2GUBA 1EJWC 1IT0A 4QCFA 2YL9A 2VCBA 4A21A 3M47A 3QN3A 4Q32A 3NSXA 5FF4A 4Y9MA 2PTYA 1X7IA 3HGRA 3ME3A 3NTYA 1EJ7L 3WQEA 1VFLA 2E5DA 2FQIA 4QSFA 3GVQA 1OC7A 1E5JA 5XIAA 1ONXA 3QC0A 5FACA 3ISIX 2D23A 4EXAA 4PE8A 5DMNA 4DF2A 4R3UA 3GNPA 4YN5A 3B4YA 1QW8A 2CBIA 3OA3A 3QYSA 4DRSA 4LBRA 1QXLA 1G7VA 3ITTA 4ALDA 4F2BA 1CXEA 1H2JA 3AC0A 6XIAA 3CUIA 3ICJA 3TYCA 1EXBA 2DZWA 2QCMA 1QNRA 4NASA 3VOCA 1WA3A 3UPMA 2J7EA 1XDMA 5L9FA 5IRPA 2DH2A 3OG3A 5FF3A 1ZCCA 1FHUA 3PJWA 4AC7C 2ZRZA 4TX6A 2WWDA 4FAMA 3MMTA 1XBVA 5FAGA 1JULA 4O1AA 2J9XA 1JUEA 5I3JA 2QVNA 3ALFA 4BI7A 3HGJA 4W8AA 4KGLA 3U5UA 2P76A 1TUFA 4GZ7A 2G3NA 4L9XA 3UR5A 5KZMA 2VEGA 3CHFA 1XH2A 1DQWA 1NAL1 1XLDA 4GFIA 3PZOA 4QEEA 5F4WA 3IK4A 4LVDA 4V2XA 4AB4A 1EGVA 4PUEA 1JDDA 4H01A 3RK8A 1XINA 1RP8A 5BOOA 1VEOA 4MADA 3T44A 2BV9A 3CO4A 4MHBA 1KBLA 2E6FA 3AWOA 3F4VA 5CJMA 4LF2A 2DUXA 1EFZA 1SW7A 1TTIA 1TVPA 4NNCA 2O92A 5A6JA 1R47A 3EWZA 2P8CA 3NQ6A 1W9UA 3E0FA 4WXZA 1YNPA 3WK3A 1H5YA 4GZJA 3LCLA 3BG5A 1X1OA 1V7YA 3B0XA 3AYRA 1TV8A 2C19A 3I4KA 4A35A 5AYIA 3E2SA 4ZA0A 3QW4B 4ROPA 4UFHA 3LXAA 3L9CA 3SUTA 3UY8A 5HNUA 1M9HA 3WF4A 4E4FA 5CGMA 4A8RA 4E2OA 2X0YA 4K1WA 3ZWTA 3NDOA 4EWND 2PLJA 2R82A 2F6KA 1CLXA 5M2FX 4J3SA 3B9EA 2QT3A 1EX5A 2Z27A 4Z17A 1JL8A 5K9CA 2IPWA 1ZS2A 4C6LA 3FFSA 1NP2A 3RAOA 3V0SA 2OWWA 3TQVA 5A2BA 2R1LA 4WD0A 3PSVA 1HT6A 2GYIA 1E1CB 4UTHA 5FCZA 3P8JA 3IAPA 5AVNA 3SJ3A 3BGJA 5CSYA 3ZT6A 1VBHA 2QZRA 4YVPA 4MPQA 3GU9A 4ROQA 2G3JA 1NFGA 3OLEA 1DJZA 3VD3A 4J3XA 3HMJG 2CLMA 4JNMA 4G7EA 2R14A 4V1XA 3TK7A 5JIPA 4U33A 3MUIA 1VYRA 1YE6A 3FYPA 3HGSA 1TV2A 2IQDA 3QLLA 2WAGA 2CZ5A 4OECA 4A3UA 1RSCA 5C8BB 3PANA 3C0LA 2VZTA 2C71A 4QE4A 3URNA 2BHUA 3TC6A 4O11A 4MGGA 1XRVA 1S39A 2PDKA 2JFEX 4D6JA 4KKXA 3OW1A 4OHQA 3GFYA 3IIXA 1TPDA 4HZMA 2Y1HA 3TSDA 1FWRA 4X0NA 4ZOCA 5BMWA 1POKA 2Y7DA 5KEZA 4PULA 3T55A 1IEXA 4LVBA 4W84A 4OU1A 2B81A 4J1OA 3ABXA 2O0TA 1KNWA 3D46A 3SB0A 2QAFA 4GK8A 3S1XA 5D09A 3AQUA 2A7PA 5C54A 2OEJA 1MUMA 3P0XA 3PB0A 4WSKA 3CZKA 4OTKA 3USZA 1W8SA 3RF9A 3SM0A 4ZB5A 4Z2GA 1DXEA 1KM6A 1BRLB 3XIMA 3W28A 5T91A 3AYVA 3FJ6A 4O8RA 2W67A 2VYOA 1DPMA 2HPMA 3U57A 1EO5A 3N6JA 5H1WA 3GXDA 3AFBA 2P10A 1JCLA 3SFKA 1XYAA 2DT1A 2A1YA 2QF7A 3WLJA 1THFD 1NQ6A 4O1FA 4S3CA 1VR6A 3FKRA 4D6CA 3GU1A 1PX8A 1HUVA 1YNQA 2EBNA 3BSGA 1XLMA 2GWNA 4JN8A 1BF6A 3VD9A 3I3BA 3WMBA 3M64A 3SIZA 3GD6A 3I7SA 3CYVA 3FLUA 3MKVA 3RX2A 2WCAA 3OA5A 1AVAA 4JDBA 3L21A 4J3UA 1YKWA 3OGRA 4Y9OA 1LYXA 2P50A 1E9LA 1V79A 4WOZA 4YTRA 2XH2A 4ZGYA 5LNSA 4TTUA 1UPMB 2HS6A 4S3GA 3IVUA 1AW5A 1PZ3A 1JG9A 3TIMA 4ZQPA 1BF2A 2Z6JA 4M1BA 3AJXA 5HMDA 3RCYA 1RCOB 2J47A 4LUSA 4AHQA 5GQBA 2AMGA 2J7DA 4XTDA 6PTDA 1UD5A 1KM2A 3BOLA 1SW0A 3C2EA 4A6GA 2ZTJA 2WNNA 3IJQA 3VIOA 3WH5A 1YTEA 1AW1A 3N2CA 2QV5A 3BWWA 1EB3A 1TV5A 5CZSA 3G1VA 4CQ9A 1RPKA 4QDWA 3N3MA 5E5CA 1DKWA 1V3KA 2PWEA 3QEZA 4G5DA 1SZNA 3H4GA 3SCQA 3HM7A 3VIMA 3E12A 1WOBA 5G1TA 2ZOXA 3HQPA 1E6XM 2I14A 2YXXA 4Q4SA 1IE7C 1G67A 2ZXDA 1Q6EA 1K4GA 3DC8A 1FHVA 3CIWA 2CLOA 3HFTA 7PTDA 3UWWA 2PDFA 2H8ZA 3MJYA 5H8MA 1HO4A 2F6XA 1W2VA 4FNQA 2ZUNA 5HR6A 1DBTA 1EOKA 4NP7A 3S2NA 2QW5A 5BWFA 2YFNA 2CLFA 2V5LA 4JTCA 2PWVA 1WDWA 4RV8A 3AMGA 4PTDA 3VNMA 5JMUA 5D9NA 4A8NA 1UZHA 3ITYA 1YPXA 2PF0A 1JPKA 4HYWA 1K8XA 1FP9A 3ANUA 3MHUA 4X63A 3VM5A 1R85A 1V0MA 1B31A 2NQ9A 4C6EA 2C16A 3SSJA 4AEFA 2QCCA 2CCRA 5JBEA 2BLEA 4REQA 4EKJA 2Y89A 2FB3A 3SGZA 2Z1KA 3VIGA 1OFDA 4U3AA 1JPIA 3VFLA 5TD4A 1TO3A 4PB5A 4P7RA 2W62A 4C91A 5LNUA 3N2OA 1QWGA 1V5XA 1ZPTA 4ORIA 3THDA 3V1HA 2GUUA 2E1WA 2DJXA 3M6DA 3NGJA 3WX7A 4K8HA 3N9RA 4A29A 1IQ8A 3PB2A 4ACZA 3LI1A 3GVRA 3W2LA 4GPNA 3AU2A 2YR1A 4I7UA 3W2NA 4AZ6A 1ZSXA 3TKFA 4GYPC 3N2BA 1YPIA 3MKKA 3OZPA 1RH9A 2OOGA 4S3FA 5HQMA 4D9PA 1FWHC 3S9ZA 3EAUA 4IFRA 4GYJA 1NY1A 2GDUA 4XKYB 2PDQA 2JEPA 4NRRA 1X8FA 2AOSA 3T0AA 3TMLA 2EPKX 4UNKA 1PWLA 4B5VA 3A6OA 3TYZA 4IPIA 1VLWA 4QEHA 4XD6A 3QV8A 5K4ZA 3DX5A 3N2MA 1LUCA 3J7HA 2V68A 3G1DA 4HZ8A 4UXDA 2BMBA 4M81A 3O6CA 1UP0A 1H60A 3WYZA 1E6SM 1UASA 4HPNA 2WVUA 2OEMA 1RY8A 1SFTA 2WO5A 2ZE0A 3DESA 4JEQA 2VEIA 1I1XA 3QKEA 3VILA 4JQ1A 2WQPA 4B5UA 1E6ZA 1QJWA 2C3ZA 1TV4A 4UTMA 3M5XA 3BCJA 1M65A 1GGOA 3TC7A 3TU9A 8TIMA 3WUEA 3M0KA 1JCXA 3W25A 3L5AA 3BAIA 4R7WA 3BQ6A 1KRAC 3ARVA 1W3NA 1UKOA 3R89A 4DUWA 4A2RA 1TJ0A 3LPPA 4QRNA 2G96A 4X61A 3F2CA 2B7OA 4TUFA 1O5RA 5AFDA 3SUSA 3QPYA 3QGAC 4HMCA 3O0KA 3GAKA 1K6AA 1HJQA 2Z1BA 2XN0A 3MDUA 3EA2A 2HK0A 3VCNA 4L4LA 3GG1A 1P6WA 1V6TA 1W31A 3C2YA 2XINA 5GJMA 2J88A 2BODX 4D6IA 1FCBA 4LT9A 2OZ8A 4F2TA 4MAZA 3KBNA 3UYIA 1PKYA 2DZXA 1GJPA 3CAWA 5FJRA 3LGDA 3URAA 1VFFA 3OGVA 2FVKA 3FKKA 4NG3A 5D2VA 2NXGA 3ZR6A 4WDWA 2NLYA 5ECVA 3UWEA 3BMVA 4GUHA 4MKVA 3KRUA 2QXWA 3IV3A 3LXBA 2J8GA 3M4HA 3U2OA 3CUXA 3TC3A 1ZL1A 3DFQA 2REQA 3HBLA 4L64A 3THUA 3W7IA 4DY1A 3BURA 2AL2A 3NIYA 4XISA 3SO7A 3WFAA 1VC4A 3N12A 3CEUA 4Q22A 2HS8A 3IUDA 2CFFA 2NT1A 2GVEA 2HEJA 1OFOA 3S3GA 4E2BA 3Q37A 4J3VA 5M17A 3NEHA 4ERGA 5I79A 2E67A 3LG3A 4NSBA 4JTTA 4PFMA 4GIAA 4Z2LA 3ATYA 3H24A 1IXNA 4QROA 3OHMB 1B3ZA 2E5BA 4E3VA 4RZ4A 1KTNA 5I03A 2DIKA 1JEZA 4WIWA 2ZZ4A 2R1PA 4LPCA 4J9JA 3VABA 1IWBA 4J2PA 4GBUA 1M3UA 4H7VA 1W0MA 2VDIA 4A2SA 2ON3A 4R88A 2Y2WA 1OYCA 5E6YA 5AYBA 4EPEC 4W9TA 3VK5A 1XQLA 3DHDA 1H7XA 3B05A 3TAKA 4AU0A 4XK2A 9XIAA 2DUAA 4MY9A 1IEVA 4YNGA 3H23A 1DJNA 5FL0A 2FZ8A 3AXMA 2F9RA 2FZBA 4NHVA 4WSHA 7ODCA 4B5NA 1PE1A 1XH1A 1XICA 3LRMA 4LAUA 3UR8A 4GYFA 3NOEA 1ZHAA 5DMLA 1HKWA 4NXKA 4F0KA 3UJFA 1GOOA 1U1HA 2CHOA 2J7BA 1TG7A 4ML9A 3LK6A 5PTDA 4LCQA 2ADAA 1DIEA 1VP5A 5LA0A 2O9TA 1J9YA 3IIVA 4JCMA 2ZRXA 1UH3A 3ARQA 5DO8A 5IDIA 4HZ7A 4JN7A 3GW3A 3DC0A 5D2WA 1E0TA 3CC1A 1W54A 1OZQA 2WHLA 4N9EA 2QCGA 2V2HA 4M1RA 1XYFA 2G0WA 4HU0A 3GE7A 2I16A 4RXFA 5BU9A 2PRLA 2GPTA 2ZTKA 1BGGA 4ZODA 1OABA 1W8GA 4XWUA 2PPGA 5DBTA 4GH1A 4C6BA 5E70A 3DGRA 1BVZA 4H7CA 4AX7A 4LVGA 5CZJA 2I1OA 1QPRA 2E4TA 2GVGA 4PMXA 2CKRA 3OJGA 4XIAA 4PUJA 3KVKA 2DSVA 1MZRA 1JPHA 4GA8A 4TOQA 2EPHA 2GJXA 4ICMA 2JIWA 4CVWA 5DFAA 3TYAA 1C91A 2WSQA 3GG0A 3WLIA 3W2KA 4D6HA 4KH2A 5AC5A 3O1NA 3M7WA 3PWIA 1V4YA 4M6VA 4C1NA 2A6LA 4UUIA 3A12A 3VIHA 2CYGA 2ZDRA 3AHTA 4RZ6A 2BY1A 3CMGA 4DBEA 1BXCA 2DZTA 2JEQA 3ELFA 1JQXA 1VEMA 4HSNA 5ABGA 2CLHA 2OJPA 1FWSA 2V3GA 3EDDA 3MA8A 4DX3A 3R10A 5D38A 2WW5A 2FPVA 3ZM8A 3E49A 4Z1CA 4IIBA 2XH4A 2BS9A 2PWDA 4R5EA 1EZ2A 3M0ZA 4UFIA 1F3WA 3TH6A 2Z7GA 3OP2A 4B9YA 3IGHX 1V6VA 2EO7A 5DXYA 3AMLA 1X1NA 4WJXA 3HJZA 3IS4A 5JVLA 1B2YA 1GKQA 2V82A 3NZ1A 4CNUA 4WKFA 4YLWA 1GZGA 5G4HC 1XIDA 1HP5A 1KRMA 3H8AA 1K7FA 2OVLA 5EBUA 1FUYA 2Q71A 5IHRA 2ZX7A 1H51A 4LV9A 4PMJA 3K8MA 1XYMA 1AZ2A