1F5ZA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form i
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLNEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 122
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f5zA00
3O6DA 4AMAA 1GVOA 4UTWC 5CZSA 4LVBA 2ZRYA 2RHGA 1A53A 1F2JA 3NQAA 2V9DA 2CLMA 1M7OA 1L6WA 3GNDA 3KFTA 4LRSA 3PF3A 5FI8A 3SECA 3B03A 4YLWA 1R2SA 2DORA 1OK6A 2YZRA 3P61A 3IIXA 2Y6ZA 2CZDA 3HMJG 3ZWSA 3H54A 3PY2A 1K7EA 5HINA 2Q8LA 3SGUA 2QDGA 4R53A 1BWKA 3S5NA 1JUKA 3RMJA 2QCFA 5CPLA 3CEPA 1KW1A 1ZALA 3C2RA 3RK8A 4N9BA 3LBCA 4FX8A 3W7LA 3UPBA 1ZAIA 3P7YA 1Q6OA 3EX1A 4N9CA 1OX5A 4DEFA 3WK2A 1R30A 2YR1A 3I7SA 3KXQA 4N2YA 2Z6IA 1H7WA 4AXKA 1I45A 4AB4A 4EF8A 1H7XA 2E6FA 1T8XA 3HG4A 3NQEA 2H3BA 3A22A 4WXZA 5L9FA 4LY8A 2QF7A 3R5EA 2Z2UA 3BG5A 3I6RA 1YDOA 2Y62A 2P10A 1Z48A 2V5BA 5D38A 3LCWA 3FKRA 3KVMA 3DXIA 3FS2A 3M1ZA 3DI1A 1I8JA 4OWGA 1K7XA 5BMWA 2BZNA 2ZRXA 3BVJA 3MWAA 3TROA 4EVZA 1DV7A 4Z0JA 1F5ZA 4GBUA 5DXYA 1A5CA 2ABBA 4KFNA 2YFNA 1X1OA 1XCFA 4AWUA 2HTMA 3GK0A 3EXRA 3O06A 3MW7A 2XN1A 3EX2A 2VFIA 2CW6A 1XDLA 3M41A 1WAUA 5LNRA 3B8DA 3CLMA 1QFEA 3AJXA 1XM3A 3MI3A 2ZA1A 4YWIA 1LOSA 4ORIA 1TTPA 2FB2A 3NAVA 2NXHA 3T40A 3LOTA 3IVSA 3KRUA 1W5NA 1SSGA 3GB6A 3SGZA 2I1OA 2G96A 4KWVA 1T0OA 4X22A 1FWSA 5D30A 8TIMA 4K6AA 4N9DA 1LOLA 4U4MA 3BLFA 1JVNA 1Q45A 1SR9A 3UNDA 2E5CA 1P5BA 3C2EA 3JS3A 4R7JA 3VCRA 4A22A 4HN4A 3UWWA 1KM2A 4LS1A 5A5WA 4X2RA 5G4WA 1XI3A 2NX1A 3TFXA 2C18A 1UUMA 5K9DA 1PHQA 2R91A 4ZVJA 4LWWA 3P62A 1F74A 3QPZA 5DN1A 4FXSA 3GKFA 3A5FA 2JGQA 2YW4A 1VLIA 3W1LA 1EP3A 3ATZA 4JGDA 4HNTA 1NSJA 3FEMA 3W7CA 1KBJA 1Q6QA 3W76A 2UV8G 1TRDA 4LTSA 3GIYA 4CCEA 4NNAA 2FPTA 2PRLA 1GYNA 3HPSA 4Z1CA 3NQCA 2Z0IA 4DPQA 4X3ZA 1RQEA 1OX4B 3A5VA 2VFHA 3NNTA 5D05A 2OX1A 2YFOA 3LI1A 3N2XA 5HUPA 1NF0A 1M7PA 2CLKA 2A7RA 4XQ6A 1RVGA 2X16A 3HGSA 5AOUA 1YADA 4NZJA 3F03K 4O12A 1N55A 1TRIA 3ABOA 3W6YA 2DZSA 3GAYA 4WJEA 2ZZ3A 4XUGA 3A9IA 3ZS4A 3CPRA 2O7QA 3SI9A 4YXGA 4IX2A 3E12A 1O5XA 2E1DA 1C9DA 1QNVA 2JK2A 5DCDA 4TMCA 4GUJA 3BG9A 3A24A 2V2CA 1TO3A 3IGUA 3C8FA 2GQAA 2YW3A 5KMYA 4K7YA 3EEGA 5HR6A 4NJHA 4JY9A 2WJZA 1S3HA 1FBAA 5IBXC 3C61A 1PIIA 5CKSA 3G18A 1JCJA 5LNVA 3W88A 1YXCA 3G1YA 3P81A 2P0OA 3G24A 1SFJA 3IEBA 4AVFA 1KM4A 1LRNA 3V1PA 4O14A 3K30A 2QR6A 1R47A 1AW1A 5CPMA 3STFA 2C15A 1IXPA 2E77A 2WSYA 1WYIA 4QNEA 3UZ5A 5KZMA 4BK9A 3W7IA 3QMRA 2E68A 2Y61A 3TNOA 1NEYA 1K8XA 1P4CA 1H51A 1QO2A 2J88A 4JTUA 3HB9A 1PCWA 4CQ9A 2VFDA 2CLEA 4HNUA 3BLIA 2Y88A 2NUWA 2W0UA 3DAQA 1OX6A 2Y7GA 4A3UA 1H1ZA 4OU1A 4PC8A 3NQVA 2GVGA 1P0NA 1G4PA 3P67A 4JNMA 2QCGA 2E09A 1JRBA 1OF8A 2CLIA 3TE9A 1MSSA 4X9SA 5E93A 1U5JA 2RDTA 4GUHA 1KLZA 4LC8A 3I68A 1P0KA 5C5YA 3O8AA 5AHEA 3KRZA 4JTEA 5AYYA 5IM51 4O1CA 1AG1O 1G4SA 2ZRVA 4L4LA 4O57A 4UTIA 1FWNA 3EKLA 1EWEA 1W54A 1OF6A 1I2NA 5D33A 1TQJA 3W75A 2G97A 4WQ6A 4E0CA 2FFCA 4JYFA 3IV3A 3UXAA 3T7VA 4A21A 3NL5A 2A6LA 5AHNA 2GJLA 3E02A 5CZ0A 3MBFA 1KFEA 4D2JA 5EMUA 1IGSA 3G0XA 4ICNA 1W37A 1YTKA 4UMAA 4AHOA 4QITA 3IVTA 1EIXA 4JTLA 4O19A 1DQXA 4LT9A 3GDTA 3C3NA 2G95A 4JTFA 3W7PA 5I3FA 3L21A 1W3NA 4Z1AA 3PUDA 1L2UA 4I7WA 4OT7A 4K38A 1TPC1 2NXIA 4AHQA 1FWRA 4H4IA 4O4WA 3E96A 4NQ1A 3DFOA 1PE1A 3KVLA 2VENA 3W7HA 1OK4A 2QUUA 1UBSA 3TJXA 3RLVA 1H50A 3O16A 4FO4A 2WQPA 4C1LA 2EHHA 4NT0A 1ZAHA 3O63A 4YL2A 5A8GA 3S1XA 3W1QA 5EL1A 4LUJA 3MYPA 3LB0A 3W73A 2PE4A 4IMFA 4NU7A 3EXSA 1ZNNA 4MVAA 5HULA 3B0VC 4XZ9A 5FF0A 2A6NA 3MI6A 1EP2A 3F4NA 3EWYA 4QJ1A 2Y70A 2Q3OA 2ZDRA 1FUYA 3F4WA 1XFBA 3NPUA 2Y7FA 4O17A 1JULA 1S5TA 4BR1A 2ZTJA 4B5NA 4LOCA 3QMTA 4Y96A 2C19A 5DLCA 5G2IA 3LCHA 1LTDA 4DO6A 4O0ZA 3TC7A 3S0CA 3EB2A 4DO4A 3W7OA 4CQ8A 2QCCA 1ZY9A 4IPIA 2GPTA 3VE7A 5K4XA 5CG7A 3R13A 4N6FA 1FCQA 2X1UA 3YPIA 4XKYA 4RX0A 1K8ZA 1A5BA 1HO4A 1GVFA 3IIZA 4Y90A 1GJPA 1W5MA 4M5PA 2TPSA 1PCKA 2LLEA 1VH7A 1TPFA 5TIMA 3QC3A 2XN0A 5HQEA 3L0NA 2YYUA 1LORA 2VKZG 4MKNA 3IVUA 3PB0A 4UFIA 3QJAA 4FXRA 1TPWA 3QZEA 3TKFA 1CW2A 1SFLA 4WY0F 3TAOA 1ICPA 4WD0A 4DXVA 1Z41A 4MY8A 2TRSA 4QM1A 4R33A 1C8VA 2ATMA 1GVSA 4RKAA 2DJLA 3DI0A 5FEWA 3HG5A 1EUAA 3ATYA 4LU0A 1LBMA 2H6RA 3MJYA 3NQMA 3LV5A 1VRDA 4UFKA 1TYGA 1LDCA 5MHBA 1DORA 5TQLA 3TMQA 4AF0A 5FF3A 5BNKA 4O54A 2BTMA 3WJSA 2H90A 1F73A 4O1AA 1OFEA 3SY5A 2VEKA 1EPXA 3UXDA 3E49A 1MO0A 3PBYA 4EOUA 1UUOA 5D2TA 3UZJA 4TO8A 3MHUA 2NUYA 3JR2A 5DY2A 1DL3A 5D32A 1WBJA 3N73A 4IOTA 2R14A 2ZRWA 3TH6A 1B9BA 2FQIA 2RH9A 2BXVA 3PSWA 3DU0A 2WNZA 5LSMA 1RR2A 1WDWA 4RZ6A 4RJEA 1QOPA 2E5BA 1G4TA 3FFSA 3HIJA 1VYPX 2PURA 4GXMA 2ZZ1A 4M6QA 3IRDA 3CM4A 2V0TA 3W2MA 1I2OA 2DZWA 4GUFA 1WXJA 3H53A 3B0UX 3S5OA 1QDSA 4HT3A 4XTDA 2OJPA 5D09A 4WY0A 3GKAA 2YSWA 4JEQA 4M19A 4MPQA 1SW7A 1UB3A 4FF7A 3TC6A 4ZQMA 1GQNA 4OHQA 4FNSA 1DJQA 4IXHA 1SO3A 3DGRA 4HSOA 2FJKA 3O1NA 5LNUA 4A2RA 3QM3A 3M5YA 4FNPA 2R94A 2I14A 3LHYA 1SSDA 4ALDA 1SUXA 4NJGA 1OVDA 4UR8A 2BX7A 3W1TA 1WBHA 2AAMA 2C3ZA 1I2QA 4MIMA 2E6AA 2FB3A 5FEZA 2GOUA 3MUXA 4UR7A 1UASA 3FYOA 1RQHA 5D03A 3CIWA 1TPH1 2WNQA 2JBMA 4FIRA 3THQA 4PODA 3P5ZA 3BARA 3WJYA 4S2BA 1X6UA 3S1UA 1EP1A 3LHTA 3AO0A 5F4WA 4UFLA 4W9TA 3OVPA 4N02A 2OT1A 2CFFA 2V8ZA 2ZRUA 1MEHA 2ZZ5A 4JXCA 3W7NA 3B0PA 2ZZ4A 2AQWA 3THAA 3FOKA 3BGJA 5EKYA 1KTCA 2ABAA 3ABSA 2J24A 4OE7A 1QPQA 3L0KA 5KZEA 1OYAA 1VHNA 1O95A 1PL9A 3NVTA 3TUUA 3S5ZA 4UTWA 1FY6A 2RKXA 3O6YX 4U28A 2Y63A 3NYZA 2B7PA 5T26A 3W71A 4QIUA 3U2OA 1JR1A 1JJKA 3Q58A 4E2BA 1S5VA 1GYLA 3KOFA 1FWWA 3P82A 4XTIA 2FDSA 1FCUA 3BV4A 3M9YA 5I3GA 1LCOA 2GJNA 1QOQA 4XBSA 1GG0A 4IXXA 3KVKA 4K39A 3W2LA 2VC6A 3L5LA 4CLMA 1TPB1 1LLZA 1TB3A 2XN2A 2QJIA 3L5MA 2ATSA 3SR7A 4ADSA 3N14A 3HGRA 4FIQA 3EWBX 4CNPA 4XWUA 2ZYFA 1OFRA 3W2JA 3GYEA 4MFEA 2FLIA 2VFGA 4WOZA 3RFAA 3W2NA 1D3HA 5D2YA 2EPHA 1T99A 2TYSA 3PB2A 3G0UA 1XC4A 2VFEA 1KM1A 3WK3A 1VJIA 2PCQA 1X1ZA 1THFD 3STGA 4ONVA 5J5RA 2ZA2A 3PS7A 2QCMA 2V30A 3NQ8A 4CQAA 2AGKA 5K7JA 5FEXA 3TXVA 5G2HA 1BKSA 3MBDA 3G3MA 2ZZ2A 3IIPA 3G1SA 1J2WA 1QR7A 1LYXA 3CIXA 1K8YA 3C2OA 3TMLA 2QCEA 1I2RA 3CEUA 3W2UA 3BG3A 4AHPA 1J5TA 1Y0EA 3P84A 3LV6A 3W1PA 3DFPA 1AK5A 3LGEA 2ZZ6A 4JTSA 4N4QA 3PBWA 4BI6A 2NV1A 4OQVA 3LRKA 4N9EA 4KFOA 3UWVA 4FB7A 4DPPA 2OCZA 3V75A 1TTIA 2HS8A 4LV9A 1W3IA 4QSHA 2V5LA 1SW3A 4JTIA 3G1HA 3M5XA 4NX0A 1PV8A 1B4EA 3W85A 2KZHA 1OYBA 2EGZA 3MO7A 3NA8A 3QH2A 1ZCOA 2J9ZA 3CT7A 1FXPA 4NNBA 4TU1A 3W1XA 4HNVA 3BLEA 1EX5A 4DELA 4O11A 1XBXA 5F2MA 2ISSA 3HJZA 2FPYA 3KRSA 5AB3A 5LZLA 4KWWA 3HOJA 2B7QA 2FIQA 2GVJA 4UCGA 1FWTA 5FF4A 3DHFA 5F1UA 1RD5A 2QDHA 4DQWA 5D37A 1C29A 4BWLA 1ME8A 1YTEA 3CU2A 2C6QA 3HBLA 1XKYA 3CQ0A 1W5PA 3EX6A 1QMLA 3TSMA 1TJRA 4IX0A 4ZQPA 3U8GA 5KSWA 1SZGA 4UIOA 1ML1A 2IQTA 1M6JA 2QJHA 1X7FA 4HPXA 3TQ0A 5AHIA 5EY5A 1TQXA 3I65A 2J6XA 3G1AA 3W1UA 1TJPA 4FNUA 4MZ8A 2QAFA 3W2KA 1N8FA 5K9XA 4M7SA 4O1BA 4JICA 4LC6A 4QQ3A 5I3JA 3LTPA 3RU6A 1JQVA 2VELA 2DZVA 3LRMA 3WFAA 3JRKA 4JTKA 1KTNA 4O1DA 2WKJA 3LCXA 1Q6RA 4Q4KA 3W1NA 3GR7A 3DFQA 2HSAA 1VC4A 3LHUA 3GDMA 3I7QA 4ZQOA 2PRMA 1ONRA 5H2ZA 1JCLA 4Z08A 2O7SA 3N19B 3D0CA 3ELFA 4XKYB 1XL9A 3MP5A 1B3OA 1ICSA 1EUNA 5LKYA 1JRCA 2C16A 3S1VA 4CCCA 3ZWTA 1O5KA 3EWWA 4LVDA 4UMCA 1IIHA 2GQ9A 3S5YA 2I9EA 4K37A 4UTTA 1JQXA 3N9RA 3M0ZA 2ISVA 5EBUA 4BI7A 3TDFA 3ABRA 4O16A 3QSRA 1XXXA 4EWND 4UC5A 5CGQA 3QEZA 2B4GA 4Y8FA 1O4UA 1LROA 4NJJA 2CZEA 3BW4A 1W3TA 4NUWA 2H8XA 2A7PA 3NXFA 3NQ6A 2GQ8A 2A0NA 4ZQCA 1ZFJA 3HPXA 1B4KA 4ZQNA 2A4AA 3W7MA 1F6KA 4QNWA 3TSDA 3T78A 4I9AA 1KBIA 5AHLA 1QCWA 2JKPA 3MMTA 1O60A 1TMHA 2YDAA 5HWMA 4PTNA 3TV8A 5KITA 3TIMA 2JKEA 5C55A 3O07A 3QQ1A 3LCLA 3S1WA 3QMSA 4HNNA 5U4NA 1GZGA 4JTJA 4AF0B 4NJIA 4GWEA 3VI2A 2PC4A 4UTJA 1YPIA 5FEPA 4JX5A 3T44A 3W23A 3TU9A 4EIVA 1GOXA 4BF9A 3IIVA 5D02A 3LXBA 4JYDA 1TREA 2ZFAA 1N7KA 3G1DA 1FQ0A 3MHGA 5DBTA 5K9CA 1DJNA 3STEA 2A1YA 1G4EA 2WPBA 1OG0A 5EYWA 1KV8A 3W86A 4FX7A 1KTBA 3LX9A 2GUUA 3EWUA 5G1YA 1B57A 2P1FA 3UWQA 3M44A 2Z1BA 1HFBA 4H6KA 2V81A 2TMDA 2BLEA 3Q2DA 2X1RA 2F84A 4UTKA 1QPRA 4AAJA 1YYAA 1FXQA 3GX9A 3DHDA 3UY7A 1QPNA 1LBFA 1KM0A 4HPJA 1F7BA 4PH6A 3RF9A 3LI0A 3TQKA 3NQFA 4JX6A 5DCEA 5LNWA 2J9XA 4WY0B 2A21A 3BW3A 1YPFA 2Y7EA 4MY9A 4MJZA 4FNQA 5AHFA 3LTYA 3FKKA 1XUZA 2VXNA 4N6EA 1YDVA 3C2FA 1WOAA 4UFMA 4JTGA 2QUVA 1HG3A 5J5DA 2ZCGA 5LGXA 3PC0A 1JCYA 1PVNA 4UFHA 1GG1A 5GVJA 3OEXA 3PUEA 3G8EA 1GVQA 4I7UA 1AMKA 4K7VA 3QQ0A 4PL2A 5ABTA 4O4VA 1G7UA 3S42A 2YGYA 2VEPA 5HWJA 1DKWA 1W8SA 4IMEA 4HIBA 1WQ5A 3EWXA 1L6SA 2A7NA 3G1XA 4PA8A 3OIXA 3P8JA 1YTDA 4RXGA 4A29A 5CSRA 2R8WA 4MFDA 3UWZA 1ME9A 4LVGA 3C2VA 3NL3A 1L6YA 3PWAA 3W74A 1QPOA 4M6PA 1JCXA 5DCBA 3TR2A 4O52A 3VFLA 1XBVA 4TMBA 1S5WA 3SIZA 3EKZA 3VE9A 2ISWA 1DHPA 2YX0A 3PM6A 1OFOA 3C4UA 4M7TA 1ZJIA 2QCNA 1JCMP 2ZBTA 1KFJA 5G5IA 3OHIA 5K4ZA 1W0MA 2DP3A 2NLIA 4WX2A 3LCFA 2WSQA 3FJ6A 4LRTA 3W1MA 1H5YA 4UFJA 1O94A 3OA3A 3BPWA 5LHFA 2Y89A 2JKAA 3GVGA 4I7VA 3N2MA 3NQGA 1KM3A 1E51A 3VNDA 2E6DA 4JTTA 3T55A 3GXPA 1NFBA 1ZENA 3IGSA 2WSRA 2G5WA 2NX3A 2EF9A 2VOMA 3KX6A 4KKXA 1W56A 3C6CA 1OFAA 3B4UA 3W7RA 1TTJA 2W6RA 2EAWA 3GXTA 3S9YA 4NZFA 2NWSA 1GWJA 3M43A 1TTQA 1AL7A 3OVRA 3HO8A 2ZA3A 3WK1A 5AFDA 1ALDA 1I2PA 4O28A 1TV8A 3R8RA 5CPOA 2HS6A 1F05A 4HSNA 1J4EA 3DBPA 1QAPA 1W31A 5HMSA 1QWGA 2VFFA 2WV8A 3I7RA 1WA3A 3UWYA 3PBUA 3R2GA 3QRHA 5AC6A 2WOQA 4JR5A 1DBTA 2V2DA 5HNRA 4BI5A 1Z44A 2A2IA 4WXYA 3GZ3A 1NF7A 4JY8A 3C0JA 2QCDB 3Q94A 4IJBA 4NVTA 2CLOA 4TIMA 4UNLA 3SFKA 4KFPA 3C56A 2J9YA 4L4MA 5BOOA 2ZZ7A 3RLUA 1GPWA 3NQDA 3B06A 1U83A 3W7QA 1KFCA 3L9CA 3NQ7A 4LNYA 5F2GA 1TPEA 4NNCA 3O05A 1GT8A 1EB3A 3LCGA 5SWUA 4O8RA 1MEWA 3NDOA 4ML9A 2QAPA 5G1TA 1UJPA 4GC4A 1ZHAA 1KA9F 2QCLA 1LRQA 2PRHA 4OV9A 1K02A 1LOQA 1GVRA 5H91A 3UYCA 1AW5A 3QYQA 2C14A 5F1VA 4E2DA 2DZTA 1IXNA 2Q3RA 3G1FA 3CHVA 5CPNA 4RCXA 1G69A 2E5DA 3PSVA 3W1AA 1OHLA 3NPVA 1AL8A 1VZWA 3NG3A 3HGJA 2C1HA 3USBA 4R34A 4DF1A 2DZUA 3NM3A 1VR6A 1SZFA 1WV2A 4O0KA 5LGZA 4UMBA 1P1XA 3E9AA 2QUTA 1VGAA 3IIOA 1YDNA 1H60A 3QPYA 2OMAA 4C1KA 3PULA 4Y9AA 3M6YA 4ZMGA 4PL1A 4IWWA 4DO5A 2VEMA 2CWNA 2QEZA 4GNJA 3PAJA 1GTEA 1R2RA 4MLRA 2NZLA 3LERA 1IXOA 1M5WA 4MY1A 3BO9A 2RFGA 3M47A 4IPJA 4FNTA 4JTHA 3BW2A 4OBTA 4K36A 1H7RA 3NOEA 5D2XA 4Y6GA 3MYOA 4CNOA 1V7YA 3BGGA 2FTPA 4GUGA 5F2LA 5AC8A 1TIMA 1Q3NA 3W87A 3ZR4A 4LW7A 3HQ1A 4WZHA 4CCDA 3WJWA 1ADOA 2CZ5A 1AW2A 1VHCA 2WO5A 3LHWA 4K8EA 2E6YA 1CX9A 1LM1A 3DH7A 1LP6A 2H8ZA 5DXXA 1T96A 1OFPA 2GVLA 3TAKA 3W84A 4RV8A 4BWLC 4ZL1A 3NPWA 3W7GA 4OGZA 1YXYA 3BK0A 1WX0A 5EA9A 3HG2A 1BTMA 3MP4A 3W07A 2B7OA 3DKJA 1QO5A 1DQWA 5D2WA 3OG3A 1Z42A 1HL2A 4S1FA 4QISA 2X1TA 2QCDA 3DENA 3TFCA 1YLVA 1X8FA 3N9SA 4P61A 1OJXA 2J27A 3R12A 5C6MA 1FX6A 4GUIA 3GDRA 3RNDA 5I3IA 2D73A 4ZQRA 1EWDA 3N3MA 4LVAA 5BRBA 1SO4A 2QKFA 4P2VA 2DJXA 3SZ8A 3TK7A 3W7KA 4JS3A 4MZ1A 1JUBA 5FESA 2YYTA 3L68A 1SZNA 4GFSA 1SPQA 3G22A 2HMCA 3GDKA 3C52A 4PCFA 1L9WA 3Q37A 4MYXA 4O10A 3LCIA 3G3DA 3ANYA 4NXSA 4UXDA 1TPUA 3FJLA 3P74A 5BMXA 4JYEA 1CI1A 4RZ5A 4AH7A 4DBEA 2V82A 4UTTC 3L65A 1UCWA 4FX6M 5I3HA 4PFMA 3KHJA 3QSTA 6ALDA 4IMDA 4LS0A 2VEIA 4RXFA 2X30A 2C13A 3W1RA 2ZQ0A 1VCFA 3DZ1A 5LNSA 1G6CA 3G1VA 1IIGA 2WNNA 2Z6JA 3PUOA 5BW6A 4IMGA 1H7NA 4ORMA 2B7NA 3QF0A 5HJLA 1RPXA 3NEVA 3DFNA 2EKCA 3DFSA 4Z1BA 3CB8A 4LS2A 4Q33A 3HPZA 4JDYA 5C2XA 2B0MA 1SW0A 1W1ZA 5D04C 1H7PA 3TW6A 1A50A 1LZOA 5AYXA 2YCEA 3M5ZA 1V5XA 4A2SA 4IQLA 1D3GA 2TSYA 3W72A 2DU2A 4JDBA 1ME7A 4RK8A 3A21A 2YPIA 3MI2A 3FA5A 1OFDA 2RDWA 4AWTA 3T4CA 1WOBA 5CSSA 1W5QA 3GLCA 4RLIA 5E1QA 1VQTA 1VPXA 1VS1A 2XFWA 5EPDA 1KLYA 3P60A 3W7DA 1R2TA 3GAKA 5K2ZA 3NGJA 1KFKA 4ADTA 3N34A 7TIMA 5FF2A 3LXCA 4E38A 4MLJA 1LRTA 4O13A 1ZAJA 4IMCA 4MOZA 4RZ4A 3EX4A 1XBYA 1GTHA 3UQNA 4G1KA 5TBOA 4AWSA 3B05A 5G4EA 2BSLA 4O50A 2BWGA 3L67A 3SSJA 3GDLA 5IBXA 5L6UA 1PS9A 4ZZ9A 5KINA 4O18A 3INPA 3A23A 4QAIA 1ICQA 4YCOA 4POCA 4AEOA 1SU5A 4JIPA 6TIMA 1KM6A 1VYRA 3PBVA 2NXGA 1FDZA 3HF3A 1OFQA 1H62A 1HTIA 3QW3A 2Q8ZA 4FEZA 5I3KA 2Y85A 3QW4B 2A5HA 4GRSA 4S2CA 1OX4A 3SJ3A 5AN7A 1DVJA 3LRLA 3FIGA 1RQBA 4J9JA 2ALDA 4GE8A 2RDUA 3NZRA 3P80A 3WJZA 3UY8A 4NJKA 1H63A 1OABA 3L5AA 3DFTA 3FLUA 5AC7A 4M6VA 3TSBA 1NAL1 3UD6A 5HWNA 4OV4A 4UTUA 3PR2A 1BWLA 1MEIA 3UWUA 3G8RA 1PHWA 3W83A 1KV5A 1IF2A 4IUOA 4NXKA 3TJLA 3SW6A 4DF0A 5U7SA 4UTHA 5F4XA 3IGXA 3TQVA 4FNRA 1SO6A 1FCVA 1FDJA 5CZTA 1VYSX 2Y7DA 2OZ0A 3NQ2A 3NL2A 1A5SA 4WUIA 3KVJA 2H3DA 3LHVA 5AYZA 1W5OA 1OYCA 4N4PA 2OT0A 3P5YA 3S8HA 1G7VA 1DOSA 3NO5A 4UUIA 3TA6A 2CLFA 3CC1A 1H7OA 1EEPA 2DZXA 1MXSA 4UTMA 1VLWA 1R46A 2CU0A 4XBKA 1KFBA 2DZPA 1VCGA 4LUIA 4YCPA 1Q6LA 3FYPA 2NX9A 4YMZA 3EWZA 3LLDA 1XBZA 3GR8A 3OVQA 1RV8A 4JN6A 3S6DA 3W22A 4TX9A 2W79A 1TV7A 1SQ7A 3O15A 4UNKA 1NVMA 1H61A 1XUUA 3W7JA 4EF9A 5CZJA 3EX3A 4HKPA 5LHEA 5DY3A 2FPVA 1K3UA 1H1YA 4FHAA 4JX4A 3NR0A 5K3VA 1SZEA 3VKJA 3HG3A 3MP3A 3QFEA 3L66A 4HHPA 2A85A 2ZTKA 1RZMA 3PVFA 3TXZA 3MHFA 3F1QA 3W9ZA 4DBDA 3NL6A 3CTLA 4WOQA 2CZFA 3PG8A 2NWRA 3M5VA 4LV4A 5C54A 3W70A 1OFBA 4GJ1A 2CLLA 5E0KA 1LLWA 3ZFHA 3LDVA 1TPVA 3W7EA 1TSIA 3H55A 3GXNA 3TCEA 3B04A 4CNNA 5HR7A 1TCDA 1I4NA 1HUVA 3P8IA 4MZYA 4DF2A 3L2IA 4NX5A 1F6PA 4H3DA 4MYAA 4Q32A 4RR4A 1EA0A 3DKLA 3ABQA 4IGHA 1IXQA 5DELA 1JUEA 2NV2A 3WJXA 3R89A 3LLFA 4BFAA 3LHZA 1KM5A 3EXTA 1G67A 1TPDA 3CWOX 3WK0A 5G2WA 3NPXA 4ADUA 3CWNA 1K03A 3GNNA 5KZDA 3U6WA 3HGOA 2JGYA 2QCHA 5F4SA 3LBMA 2X1SA 3LXAA 1XDMA 5D2VA 3UPWA 3TW7A 1TV5A 2F7FA 1SO5A 3STCA 3W3OA 3E0IA 1FCBA 5DBUA 1LBLA 3TX9A 2X2GA 2ZRZA 3L0GA 3NZ1A 2NUXA 3NM1A 3LTSA 4MJMA 2YXGA 4Z0SA 3G0SA 4MUZA 4PEKA 5F2IA 3KAOA 4JIQA 5AHMA 1FDYA 5HUOA 5FF7A 4O15A 1JCNA 1YXDA 3OBKA 4LVFA 1HO1A 3O6CA 4JD4A 4K8HA 3PG9A 1VCVA 5KTLA 3M7WA 1D9EA 1A5AA 1MZHA 2V2HA 3LM7A 3M16A 1BEUA 2QJGA 1F76A 1K7FA 2CLHA 4UTLA 4Z1DA 2C0AA 4O53A 4TR9A 1KFLA 1GEQA
chains in the Genus database with same CATH superfamily
3O6DA 1CGXA 3BDKA 2DIEA 3W0KA 2DVTA 2RHGA 2ZRYA 2D2HA 3ARRA 4ROQA 3KFTA 1M7OA 1L6WA 3P0XA 3GE7A 1KGWA 1R2SA 1TJ0A 1MXGA 2DORA 3P61A 2Y6ZA 2G3FA 4W7UA 4A8LA 2JFEX 3W28A 3WLHA 2Q8LA 1NDVA 1MDRA 4ACYA 1JUKA 1E5JA 1E6ZA 2QCFA 5CPLA 2O4MA 4H83A 3AU2A 4P5UA 4M81A 4D8ZA 2W62A 1Q6OA 2ZXQA 3WK2A 1XD0A 3KXQA 1SJBA 4AXKA 4U5KA 4AB4A 1H7XA 1T8XA 3IJ6A 1A5NC 1XG3A 4ERAA 1CTNA 1LWJA 4F4RA 3SGGA 5EMKA 4LY8A 5L9FA 3R5EA 2Z2UA 2BXZA 3EYPA 2Y5JA 1Z48A 1POJA 1ZBWA 2EPNA 3FKRA 4QCFA 3ARZA 1QATA 3DXIA 2ZC8A 3AXKA 3FS2A 6ENLA 1R87A 3M1ZA 5BMWA 1A5UA 4CVWA 4EVZA 3P93A 1DV7A 2J7BA 1F5ZA 1PDYA 3OIHA 1T6MA 1A5CA 1YW1A 3RPMA 2ABBA 2YFNA 4L1WA 4WDUA 3FHQA 3GK0A 1HZYA 2YBVA 1YBQB 1DWJM 3CAQA 2VFIA 1E1FA 4RDZA 1UC4A 3M41A 1WAUA 3B8DA 1E3XA 4GCXA 3CJPA 4ERGA 3R0DA 1GORA 3RITA 3MI3A 4YWIA 2R1PA 3NAVA 4B3ZA 3LOTA 3IVSA 1TWZA 4UZUA 5BROA 1SSGA 3GB6A 3SGZA 4KWVA 4X22A 1ZJAA 2EBNA 1FHUA 3WQPA 1XIMA 5JBDA 4K6AA 4N9DA 1XRSA 1SR9A 1P5BA 4C6NA 3OZOA 3VCRA 4HN4A 3PTQA 3R8HA 4X2RA 1XI3A 3SUUA 1E43A 1UUMA 3WLIA 1UW9A 1PHQA 1V6VA 4ZVJA 4LWWA 1JPMA 5DN1A 5TF0A 2JGQA 1VLIA 1EP3A 3ATZA 2PGWA 3W7CA 3WLPA 3W76A 4FLOA 1MZRA 1VPYA 1XIJA 2BDQA 4NNAA 2O9TA 4L9ZA 3NQCA 1WDPA 4DPQA 2X7WA 1J0ZA 2VFHA 3N2XA 3LI1A 2A7RA 2PDYA 1ODZA 4XQ6A 1RVGA 3BH4A 1EC9A 2X16A 3APGA 3HGSA 5AOUA 3GY1A 5D9PA 1LT7A 1BHGA 4NZ4A 2X0SA 1TRIA 4GFIA 4XD6A 3A9IA 3CPRA 1HNYA 4S3GA 1O5XA 1LJYA 4TMCA 3RR4A 4IGMA 4B9YA 3A24A 2V2CA 4GVIA 1B3WA 2GQAA 2YW3A 4ZOEA 2IXUA 5A2AA 4K7YA 5HR6A 5DRCA 5EFDA 5IBXC 3C61A 3M0HA 4E8DA 1JCJA 3ARVA 3KL3A 4AVFA 2VD8A 1LRNA 3VOCA 2YA1A 4JFUA 5JQ9A 3WBWA 1YBQA 3STFA 2C15A 2AKMA 1IXPA 2WSYA 3IV8A 4QNEA 1DJWA 4BKNA 1GVIA 5CEWA 5EMJA 3W7IA 1IYXA 1BVZA 4IJRA 4XD3A 1NEYA 5HMFA 4A4AA 1QT1A 1SM9A 2VFDA 3U7VA 4PCNA 2Y88A 2NUWA 3CUHA 2W0UA 3ES7A 1HJWA 4XAZA 3UWEA 2J6VA 3NQVA 1M68A 3P2VA 3P6LA 1G4PA 1HJXA 3L4YA 1SMDA 3AJ7A 1FH8A 1OF8A 2CLIA 1G94A 3TYUA 4GUHA 1R8LA 2YL9A 3VIGA 2DSZA 2ZX9A 1P0KA 4Z2IA 5C5YA 4DXXA 4PMDA 2OGYA 3CHDA 5AYYA 5IM51 3ZXWA 3MCNA 4R9XA 4O57A 3WDPP 1FWNA 4LB3A 3F4DA 3HA1A 1UWRA 3W75A 4PUJA 2FFCA 3VIFA 3IV3A 3T7VA 1IV8A 2A6LA 5A3HA 4QJ5B 1XLBA 3AI0A 1HJUA 4E4UA 1V0NA 4AHOA 3SO7A 3IVTA 3QGKC 4C6MA 4O19A 4LT9A 3GDTA 2VL4A 4JTFA 3W7PA 3L21A 1NIUA 3PUDA 2XIJA 1JZ8A 1AQFA 4Q3MA 3LU2A 4K38A 5I2UA 4R9OA 4AHQA 3Q4DA 1KCZA 3H2EA 3W4RA 1SR0A 3KVLA 3ARQA 3QY7A 2QUUA 4C6OA 3AXIA 2X09A 1UZ4A 3RLVA 4HNLA 2VURA 2VR4A 2WQPA 3MSDA 3S1XA 1ZAHA 5A95A 1PIGA 5EL1A 2V63A 4HA0A 4IMFA 4NU7A 1DIKA 1WZKA 1PZ3A 5HULA 1DYSA 2YL8A 3B0VC 4O8AA 4HU3A 5FF0A 2WM0A 2A6NA 3MI6A 1PZ1A 3EWYA 1FUYA 2P8BA 1XFBA 1EF2A 3QHOA 4IM4A 4EX4A 3WELA 1K9FA 2ZTJA 4B5NA 5AVNA 3QGAC 4DO6A 1XHGA 5HNUA 5E6YA 3VKDA 1U33A 3TC7A 1J0YA 1JZ4A 5FJOA 3EB2A 3MSGA 4MADA 4ZOBA 5JBEA 2D2GA 2GPTA 2Y5SA 1OIMA 3VE7A 5K4XA 1FCQA 2X1UA 1KR0A 2PTDA 2XZ9A 2HPIA 3WLQA 2XHYA 4AYSA 3N15A 1VBUA 1MXDA 1K8ZA 1Q4NX 2I5QA 1GVFA 1MFVA 4WDXA 2TPSA 5GJNA 2LLEA 1P7TB 3NTYA 4Y2WA 2XN0A 3PZVA 4MKSA 3E0VA 3QV8A 3L0NA 2E25A 4AZ7A 2XIQA 4BCEA 1J10A 3AXHA 3NZGA 3VABA 4JTAA 2DQWA 3NIYA 5IRPA 2CIPA 4WY0F 5G4HC 2CCRA 4DXVA 4V27A 4MY8A 2TRSA 5BWAA 2BY2A 1GQIA 1T40A 2ATMA 1XP3A 4LU0A 1UG6A 2VYOA 3CB3A 4HHHA 3NGFA 1DORA 3T0TA 4AF0A 1XICA 3EOUA 4FXJA 1DJZA 1JAKA 2H90A 3B97A 3SY5A 3WBAA 1EPXA 4O1EA 2FVMA 4V28A 1MO0A 3KHDA 3UZJA 3MHUA 3JR2A 4TTUA 1XYMA 3MC5A 4B5TA 3M46A 1EXBA 3TH6A 2RH9A 3OYZA 1FWJC 3PSWA 3DU0A 2WNZA 1WDWA 1QOPA 2E5BA 3FFSA 3VOHA 4X9YA 2G3MA 3IRDA 2WMGA 4CN4A 3AMCA 1I2OA 2DZWA 2XM2A 3LM3A 3W37A 1UR2A 1YX1A 2VDGA 5D09A 3IRSA 4DIAA 2NLYA 3MS8A 4MPQA 5AC5A 1Q85A 3HMCA 4GINA 1GQNA 4OHQA 1UD2A 4GQGA 1TMLA 2VZTA 7TAAA 5LNUA 2C71A 4M8UA 1F9CA 2PDCA 1YMYA 2I14A 4D9PA 3EPMA 4ALDA 3KCLA 2FJUB 5HXMA 2OGJA 2BX7A 3WD2A 5D8ZA 3VIPA 2G41A 2CHOA 4W8AA 2C3ZA 1I2QA 1W1IE 2NT0A 1RBLA 3GG0A 2GOUA 4IPPA 2OLSA 4UR7A 4O0QA 1TWDA 1RQHA 5A6TC 3USZA 2WNQA 4FIRA 4F0KA 3BARA 4G2DA 1X6UA 1P7TA 1EP1A 1EO7A 3LHTA 1Y5XA 1VAHA 3OVPA 2OT1A 2CFFA 1EHNA 2ZRUA 1B0IA 2V38A 1MEHA 4GOAA 1UA7A 4JXCA 1QW8A 1FA2A 5EKYA 3Q65A 1RP9A 2ACQA 1V6XA 1KTCA 2JEQA 2GJRA 3ABSA 1CWYA 2J24A 3QC0A 3GFZA 1E0VA 1VHNA 3NVTA 4S39A 3C0QA 1H49A 1FP8A 4YTRA 2Y63A 4H01A 3I6EA 5T26A 3W71A 4QIUA 3U2OA 1JJKA 2I5GA 2WSKA 3UNTA 1YNYA 2I16A 3TTYA 4WKHA 1FWWA 8RUCA 2YBTA 3BV7A 3M9YA 1QI4A 3K8KA 1LCOA 3UJEA 1TG7A 1BSIA 3WDRA 5BXPA 1QOXA 5A6SA 3L5LA 4MDPA 1DE6A 1LLZA 2XN2A 2ATSA 3WQEA 3WLRA 3HGRA 3WQ4A 3EWBX 4CNPA 3WLLA 4XWUA 2ZYFA 2WQDA 4MFEA 2PTWA 4KF1A 3W27A 4FOUA 1NDYA 3THCA 1T99A 2TYSA 3PB2A 4AD5A 4CD5A 1DTNA 4QDWA 4KEVA 3S2CA 2PCQA 4TV5A 1X1ZA 1THFD 1IR2A 3S5SA 5KEZA 2WC4A 3PS7A 1UKSA 1UMYA 4K3ZA 1HJVA 5JH2A 4RPPA 3S2JA 2WZTA 4EPKA 2G8ZA 5FEXA 2XVKA 3MMDA 3R94A 3GHUA 2PP1A 2QJMA 4PUUA 3G1SA 1A5OC 4ZB0A 5GJMA 3LSCA 3C2OA 2QCEA 1I2RA 3AU6A 3CEUA 2J7EA 4AHPA 1J5TA 1EPVA 1AK5A 3LGEA 4N4QA 4GISA 4ZEPA 3ZYZA 1BKHA 1YNQA 1MI3A 3LLXA 4QDMA 4MG4A 3UR2A 2NQZA 2PLKA 4F2TA 1W3IA 3AMDA 4NX0A 3P0WA 1PV8A 1B4EA 2PTXA 3PK7A 3W85A 2WKGA 3MO7A 1C90A 2J9ZA 1FXPA 1E0WA 1ONXA 4P7LA 3MKVA 2WJDA 1EX5A 4RUBA 2ASHA 4O11A 4XD5A 1ZCCA 3HJZA 5AB3A 3TZFA 3FAWA 3HOJA 2OSXA 2FIQA 5FF4A 3EZ4A 1RD5A 2WCSA 3N04A 2QDHA 4DQWA 3CU2A 2ALRA 3ITYA 3ZLHA 1CXKA 4KWOA 1JYWA 4WJ8A 4HGXA 3U8GA 5KSWA 4MWAB 1LG1A 5CLWA 3WUFA 2QJHA 1X7FA 5AHIA 5EY5A 2OWWA 1TQXA 3SCPA 4JKMA 1XR2A 2ZUTA 4EAYA 1DWHM 3FK4A 4O1BA 4I6KA 3A4WA 3EWDA 3OTRA 3IJ7A 4ZB2A 1DIDA 1UD8A 1JQVA 3WH5A 3AFBA 4O1DA 4Q4KA 1Q6RA 4HK6A 3TWAA 4B9ZA 3HQNA 4ZQOA 2PRMA 1PTGA 2AL2B 2DH3A 1JCLA 1J8VA 3D0CA 1CIUA 3DCPA 3IJ9A 4XKYB 3MP5A 4HN8A 5LKYA 1JRCA 3ZJ7A 4K37A 3TJIA 3SBFA 4EE9A 4GQQA 4BI7A 4I8YA 1S38A 1FKWA 1US3A 4EWND 4HCHA 1J93A 5CGQA 4MF4A 4Y8FA 3XISA 2HRWA 4E8CA 1WCGA 3VDHA 2A0NA 1ZFJA 5D8WA 3D47A 4N7QA 1W32A 1QCWA 2JKPA 4OFCA 5HWMA 3DOPA 4S3EA 2CXEA 1D7FA 1BRLB 5AECA 2JKEA 4TXEA 4C60A 4HNNA 3VFCA 2ZC1A 3B0YA 3ZT7A 2Z27A 3V5CA 3TOPA 1UKOA 3KEHA 3SRKA 4GWEA 1TVLA 3PZ9A 1YPIA 2OB3A 4ACZB 4DNMA 4UZSA 2Z25A 3PZMA 3QZAA 4CD4A 4S23A 1GOXA 1HGYA 5D02A 3G6MA 1EZWA 5H8UA 1CGTA 3POCA 4IGSA 1S1PA 2WM1A 4CUCA 4BQ2A 3SFWA 3N13A 3BL3A 1DJNA 4PBFA 2HK1A 1G4EA 3STEA 1OG0A 4FX7A 2J66A 1YRRA 2ZUNA 3LX9A 4LEQA 2FZNA 2ZE0A 1NFPA 4XKMA 3VIOA 3NO1A 2X1RA 1KRMA 5CC5A 1ONWA 2YB4A 4PUKA 1FXQA 3GX9A 1QPNA 4U2YA 1AZ2A 1VKFA 4PH6A 4MWAA 4P7QA 3VD9A 3TQKA 2VP8A 5LNWA 3N2OA 1ITQA 3WBYA 4IIEA 1CLXA 1YPFA 5I7GA 2W61A 4WHBA 2VX7A 2Y7EA 4MY9A 3VX1A 1XYCA 3ISIX 4M29A 3K5XA 2VXNA 4AY7A 4N6EA 1YDVA 1KKOA 4UFMA 3APYA 3GVVA 1C3FA 1RY8A 2ZCGA 5LGXA 3PC0A 1JCYA 1PVNA 3H26A 3OEXA 1GVQA 3EOEA 4JEJA 4PL2A 4O4VA 1G7UA 3E3HA 3ANUA 2AL2A 3S42A 3IACA 3KE0A 2Z00A 3FAXA 2YGYA 5KZ6A 1DKWA 1AA1B 1W8SA 3O0FA 4IZGA 4XZLX 4HIBA 1GVYA 1BAGA 1QHOA 4IIHA 2WCGA 3EDDA 1D7KA 1MW3A 1ME9A 4PMYA 3C2VA 3W74A 1QPOA 3TR2A 3IUDA 1GQJA 4RL3A 1QRQA 1D2KA 2G37A 3VO0A 7REQA 4YNGA 1A5LC 3EKZA 1UZHA 1RK6A 1QW9A 1OFOA 4UOJA 1JZ7A 5G5IA 3EKGA 3LCFA 4LRTA 2DPEA 3GVGA 4DN1A 3N2MA 3NQGA 1KM3A 1BRLA 4JTTA 3N4EA 4QFUA 3E5PA 2BVYA 1DP0A 2HDJA 2D0GA 3MA8A 2G5WA 5TAOA 3UETA 3KX6A 4KKXA 4ACZA 1TTJA 4LNCA 2FHCA 2W6RA 3TW9A 2CBUA 4J5NA 1AL7A 1QNQA 4NYYA 4XSMA 3VVGA 1UPPA 2P53A 4H6EA 5CPOA 1F05A 1QAPA 5LIKX 3LPOA 1R9YA 2J77A 1QWGA 3PZUA 1GZJA 1XIGA 3I7RA 1KCXA 4U33A 3PBUA 3R2GA 4HA3A 4RE4A 3LNMA 2XJ7A 3HJEA 2J25A 4XUYA 3C0JA 2QCDB 2PWHA 3SFKA 3QBUA 1OGGA 4KFPA 4Z2JA 2VGBA 2JF7A 3CUZA 2R24A 2Z2BA 4DJDA 4URIA 1CT5A 3CUGA 1OC5A 2PFHA 4XVEA 1OGBA 4YTSA 3UBPC 3VX0A 3UVAA 1WO2A 4W4QA 3JZEA 1EF3A 2EXOA 3GTXA 5LA2A 5CGTA 1KB3A 3V0TA 5SWUA 4JIEA 4GC4A 1KA9F 3S83A 2QCLA 1LRQA 5H91A 1T8QA 5F1VA 2WWCA 1WAWA 3H12A 2DZTA 3CUJA 1UWTA 1DEDA 4MJ4A 1UR4A 1WZLA 8XIAA 1U22A 1I1WA 3IK4A 2FGBA 2CC0A 4AWEA 4ERIA 2OO6A 3VOFA 3GSMA 5HDRA 2P88A 1P1XA 3E9AA 1VGAA 1H60A 1XJBA 2OKTA 1B90A 4Y9AA 2XVNA 2QVNA 2FVKA 1B1YA 3PAJA 1IXOA 1M5WA 4MY1A 2ZX8A 4CU6A 2J7FA 4IPJA 4H9MA 3BUVA 3IANA 3ZSTA 4OBTA 5D2XA 1UR8A 3V18A 3BQ5A 4CNOA 3GW0A 4GUGA 1RALA 5DT5A 1TIMA 1Z32X 5D9NA 3W87A 2RJHA 4RNHA 4HPNA 2Z1WA 1ADOA 2WO5A 4K8EA 2E6YA 4RDWA 4ENLA 1T96A 1OFPA 1LUCB 3FSUA 4YN5A 2GVLA 4YYFA 4ZE4A 1PKYA 2EQDA 1YXYA 4ZO9A 1JAEA 2HBXA 3WMSA 5D2WA 4DO7A 4AEEA 4LUTA 1Z42A 2VI0A 4S1FA 4PTVA 2QCDA 4RE3A 3UZWA 4Q7BA 1WUFA 1YLVA 3KS6A 3VKAA 2IW0A 3A4JA 4P61A 1FX6A 3T8LA 2B81A 3OBAA 1GONA 4ZOCA 4LVAA 3UU0A 5BRBA 4P2VA 3TK7A 3GH7A 3AHXA 4GBDA 3IPWA 5FESA 1W9XA 3GG1A 3GU2A 1SZNA 1V3HA 3AHTA 2J8GA 5BXSA 3M6DA 4LX4A 3WUBA 3Q37A 3JU2A 4AUBA 1RAKA 2WHLA 2XU2A 4JYEA 1GHRA 4AH7A 2XFRA 1UD3A 3H2MA 2EPKX 1R5YA 2NQLA 5I3HA 3KHJA 3VTRA 1IEWA 4RNIA 3CK5A 2X30A 2C13A 4W5UA 3NUKA 5LNSA 1XSKA 4E8GA 1HT6A 1TVPA 3NCOA 2GSEA 4GJJA 4ORMA 2B7NA 1AJ0A 4I3GA 3QF0A 2PU0A 5HJLA 1RPXA 2DT3A 3L4TA 1A4LA 3IJIA 1JZ6A 3S47A 3SUTA 3E2SA 4AEFA 3HPZA 5REQA 2B0MA 3CPGA 3NZPA 4W93A 1W1ZA 3VOIA 3KRBA 3VNYA 1RY0A 4PTDA 1A50A 1LZOA 1S2AA 5AYXA 1W1A1 3ZM8A 2WHMA 2TSYA 3W72A 2HEJA 4WLCA 2WYSA 3R0UA 4RK8A 3A21A 1KD0A 2XVLA 1V3LA 4H7VA 1OFDA 4FMVA 4AWTA 4HJWA 4RLIA 5E1QA 4L6DA 1VPXA 1VS1A 5EPDA 3P60A 3W7DA 2CLPA 1R2TA 3GAKA 1O5QA 5K2ZA 3NDYA 4ADTA 1C8YA 3FXGA 4ZODA 5FF2A 4J3UA 4MLJA 4WGXA 4IMCA 2J13A 2G4JA 4ATLA 3OHMB 1MQPA 1NDWA 5TBOA 3LYEA 4O50A 3LN3A 1ISVA 4XZWA 2A3LA 3L67A 5IBXA 4Y9PA 1PS9A 5LIYX 5KINA 5GNXA 3INPA 4KGJA 1OC6A 2DDXA 3UG8A 3M0MA 3O3RA 1KM6A 2PDFA 4H9ZA 4CD7A 1IE7C 3PBVA 2NXGA 4PBEA 4ZFCA 1HTIA 3QW3A 5I3KA 7ODCA 4GRSA 1JI1A 1TX2A 1TZ9A 5CJMA 2RDUA 1X6LA 4D6DA 4PMRA 3P80A 1E4LA 2VCBA 1AFSA 3RO6A 3H8AA 4QAWA 2FHFA 5FJJA 4D6FA 1H63A 3EA1A 1OABA 1V93A 3BMXA 1RHCA 3KTXA 1NAL1 3VMNA 4OV4A 1BVWA 3PR2A 5DANA 1QW7A 3W83A 4X0NA 2C91A 1TWSA 3SW6A 1DJGA 2FH6A 4Q4PA 3AIUA 5U7SA 3DDMA 3CZLA 3N2CA 3TQVA 4WKAA 3HFTA 1FCVA 2YOCA 2Y5EA 5CZTA 2XIMA 3NQ2A 4R27A 3KVJA 3QYSA 2RGMA 1P43A 4IUGA 4C6CA 2GOKA 1W5OA 3P5YA 1DWIM 3LQGA 1BQGA 5JMUA 1C93A 3TA6A 1UKTA 1J5SA 5ECUA 1MXSA 2UZ9A 1VLWA 1OBAA 4XBKA 4DJDD 3LMZA 1KFBA 4LJ3A 1VCGA 4LUIA 5BZAA 1BXNA 1H0IA 1POKA 1ZPTA 2A3EA 1E56A 3OVQA 4B5VA 4M3PA 4MNKA 2EPLX 4JBRA 3CZGA 1TV7A 5HPCA 3PBGA 2E1WA 3WNMA 4YTTA 2OWCA 2ADAA 5HQMA 4HKPA 1UP2A 3LD5A 1I75A 3PPHA 4XISA 1E15A 1F4AA 3HG3A 2A85A 4C6LA 2CZFA 4B2DA 2GWGA 5E0KA 3GDBA 1LLWA 1RJRA 2AAAA 1T7LA 4CNNA 2WVUA 4K68A 4IHCA 4NX5A 1X96A 1F6PA 4MYAA 4Q32A 3W02A 4L4PA 1CXEA 3WJXA 4GQRA 3WK0A 5G2WA 3GNNA 3WYZA 3ARTA 4IH3A 2X1SA 1KRBC 3DC0A 2GGEA 4K1GA 4ICCX 1LBLA 1W91A 4QJ4B 2DQXA 3MMUA 3KAOA 3WF3A 2CNCA 2CWXA 1Q66A 3RR1A 4JKKA 2OU4A 2PF8A 2ZX5A 4LVFA 1HO1A 3BZJA 4KRTA 3TTSA 4K8HA 1VCVA 1MZHA 4GH3A 3LM7A 3FV9A 1N82A 1UOZA 3KOXA 3SB0A 3RMEA 1MUCA 4RE2A 1ODUA 2C0AA 4O53A 3LY0A 4AMAA 4X2PA 1GVOA 1FVPA 4I9JA 3SCVA 5BXRA 1UH3A 1A53A 2YIHA 1F2JA 3F2DA 3NQAA 4LRSA 3SECA 3GNDA 3PF3A 4MMWA 1TELA 3G5EA 2X7VA 3IIXA 3OG2A 2CZDA 2WWDA 2E8YA 2DT0A 3HMJG 3ZWSA 2PZ0A 3BAJA 2PWEA 5HINA 3KP1A 4WDTA 1QNSA 3S1GA 3S5NA 2QHAA 1PKLA 4H04A 3VD3A 4PTWA 4GX9A 4F8XA 4L9YA 4I5XA 1I0BA 3LBCA 4FX8A 3EX1A 3H4GA 1OX5A 3G6LA 3HTWA 1I45A 2E6FA 4NY2A 1REQB 1V3KA 3H7VA 1FFQA 2Z24A 1EOMA 3PPGA 2H3BA 1R7AA 1WKYA 3LEPA 3A22A 1QWKA 4M56A 2V68A 3ITXA 3E1F1 1TWIA 3KVMA 3DI1A 3TN4A 2ZRXA 3BVJA 4Z0JA 2PD9A 5DXYA 4IICA 1RJPA 1XCFA 3A6OA 3T0DA 3TLQA 3MW7A 2XN1A 2E8ZA 4QE4A 4IGNA 1XDLA 4J1OA 3CLMA 5C2CA 2VR5A 1ZJBA 4ORIA 1TTPA 1JD7A 3WQVA 2FB2A 3T40A 4Z2KA 2FKPA 3I3EA 3KRUA 4PN2A 3HZ3A 1KXQA 2I1OA 3Q67A 1WDDA 5D30A 4QEHA 3WD0A 4C91A 8TIMA 1O6IA 1XIBA 1OG6A 4EPBC 5LIXX 4U4MA 4F40A 1HKMA 3C2EA 4R7JA 2J47A 1QBAA 2BOGX 1RA5A 2O56A 5G4WA 1VBJA 3TFXA 3DUGA 3WD3A 2R91A 5A6AA 2VT0A 5DX7A 5I24A 1M7JA 4GCAA 3GKFA 4D6GA 3W1LA 1NSJA 2PB1A 1KBJA 3WQGA 4D1IA 4HZ6A 5PTDA 1VFLA 1FRBA 4CCEA 2FPTA 2PRLA 4CNSA 1LL7A 3RLHA 2Z0IA 5GNZA 2PDWA 4CD6A 3A5VA 3NNTA 4LAOA 1NF0A 4LY4A 4H9XA 3EA3A 4C7DA 2BFGA 5T9CE 1H09A 4OUEA 4O12A 4PUEA 4OVXA 3W6YA 3ABOA 5TNVA 3GAYA 2ZZ3A 4XUGA 3N25A 4KEUA 3H23A 2VQTA 4IX2A 3E12A 1REQA 3DX5A 2E1DA 4ZXOA 1QNVA 5FJPA 2XH4A 4YPJA 2XSAA 1EBGA 1PIFA 4J7RA 3GIPA 1MRQA 3WDQA 3MUY1 4Q4QA 4JFTA 3D3FA 3QR1A 1ZL1A 1MNSA 4P8WA 4FLSA 5CKSA 3G18A 5LNVA 3SN1A 1YXCA 3P81A 3G24A 1SFJA 5HPOA 1W1B1 3BC9A 3V1PA 1AW1A 2ZVIA 2G3IA 3OQ8A 1B3YA 4EXAA 5FD0A 3AMKA 2PDNA 5HAOA 4GY0A 3KOWA 1QO2A 4HNCA 3HB9A 4E6MA 1CGWA 1M04A 4HNUA 3BAIA 4MSSA 4M0XA 3DAQA 4PZVA 3A12A 1JDFA 1OX6A 2AQVA 2VGFA 3H2NA 2Y7GA 1FHLA 2GVGA 4J28A 1P0NA 4MNMA 3QR0A 4JNMA 2E09A 3L4ZA 3K4AA 1CENA 2WK2A 2CBIA 3TE9A 1MSSA 2F2KA 2RDTA 4GH1A 4LC8A 1ZSXA 1DJXA 3RPTA 4GMEA 3OQEA 2NSXA 5AHEA 3KRZA 4JTEA 4GKTA 4O1CA 3AHYA 1W9UA 2BASA 2WVTA 2QF8A 1G4SA 4L4LA 1R6WA 2GJPA 1R3RA 1XX1A 3MTWA 3GC2A 6CGTA 3CQKA 3N6HA 1XCXA 2CHNA 3FJNA 4E0CA 1V4YA 4AZBA 1EQCA 4DZHA 3RLGA 4ZFMA 4RW3A 4CN6A 3UXAA 4A21A 3NL5A 2VDHA 2GJLA 5CZ0A 3FDGA 3KDNA 3MBFA 5T8GA 4A3RA 5EMUA 7XIMA 1IGSA 4ICNA 4UMAA 3T05A 1DXEA 1V08A 1MW1A 1QK0A 4JTLA 1ZUAX 3T0BA 3C3NA 5I3FA 2X42A 3WZ0E 2YZ5A 4Z1AA 2O9RA 4D6JA 4I7WA 5CBBA 1TPC1 3DFHA 4H4IA 4O4WA 3E96A 4QE5A 3H6OA 3DFOA 4PGLA 3W7HA 2ZUMA 1UBSA 5E70A 5DT7A 4FO4A 4C1LA 4C5YA 3WF1A 3AS0A 4LUJA 1W6TA 3MYPA 3BLLA 3W73A 3KBNA 1UMLA 3ZT5A 3EXSA 1KCKA 4MVAA 3UR8A 4R7WA 1M1BA 2ZKMX 2OFJA 5A6MA 3BLOA 3F4NA 3W6MA 2BHUA 5CJ5A 3AXXA 2ZDRA 2OYLA 1UD5A 1MVYA 1PPIA 2X0YA 4Y9NA 4ZGYA 4LOCA 1XGEA 4Y96A 4RNJA 3M4HA 3RM9A 4O0ZA 1ZZMA 5HATA 4DO4A 2ESCA 3W7OA 4GYFA 3OP2A 3WQWA 2QCCA 1MW0A 5C7HA 4IP7A 3LG3A 3R13A 3GO2A 3KBMA 4ZTYA 3YPIA 1CGVA 1A5BA 1HO4A 1GJPA 4M5PA 2ZXBA 3AIVA 1VH7A 3KCOA 4JHMA 4Q7NA 2Q8XA 5TIMA 3WLNA 5HQEA 4MKNA 2F6KA 5A6KA 3AYRA 3VPLA 3OPSA 2UY5A 2ONEA 4C6EA 1TPWA 2XH7A 4KT2A 3TKFA 2IS7A 1XSIA 3H7UA 3TAOA 1ICPA 1VJSA 1IWBA 3CWHA 3B9EA 1MRAA 1GVSA 1LQ0A 3OBEA 1LBMA 2YL6A 1KGUA 3NQMA 4V1YA 3LV5A 1TYGA 4KCTA 3VGFA 3GU1A 5TQLA 4QP0A 4W8LA 5LYRA 5BNKA 4O54A 3PP7A 3CYJA 3WJSA 4LAZA 3SQLA 1ELSA 1OFEA 2PCEA 3T0AA 1ECQA 3E49A 4JQ4A 5FIPA 1W2VA 2NUYA 3U5UA 2VZOA 3VDBA 3WH8A 4QLKA 2VRKA 1B9BA 5DRIA 3S2LA 1XIDA 2H9AB 2MNRA 3BANA 1Q65A 3TONA 4XIMA 3QHMA 3MUCA 4M6QA 5C70A 2I57A 1EOKA 2O55A 1GQLA 4S3AA 5CZKA 3B0UX 5I06A 2NVAA 4U5IA 4HT3A 3RO8A 4WY0A 1GJWA 4NI8A 4LCQA 1UB3A 3N9KA 4FF7A 3C86A 1ZLPA 4ECLA 3UA4A 4ZQMA 1WDSA 4BY3A 3HU7A 2FGZA 4H9UA 5I07A 3DGRA 3CHEA 1VD6A 3QM3A 3DHPA 2Y8KA 2QMJA 2D0HA 2R94A 1C7SA 4RW5A 2QXWA 3LHYA 1XRFA 4YJ5A 3R1ZA 3V7PA 1NDZA 1UWIA 3K1GA 3W1TA 3GUGA 4HTBA 5HQLA 4MIMA 5CH9A 2E9MA 2BGSA 4QCEA 1AQ0A 1UASA 2CXGA 1TPH1 1M53A 4PODA 1F8MA 1O12A 1QNRA 1XW8A 4L61A 2QYGA 4PCTA 5F4WA 4W9TA 3ITGA 4LXFA 3A4XA 3T8QA 1TJ2A 4OTKA 1QXLA 3FSTA 2B31A 3W7NA 3B0PA 2DSWA 3U4AA 4X60A 3AYTA 3IAPA 3WG6A 3CQHA 3BGJA 5GPRA 2ABAA 4GZJA 4OE7A 4QEEA 2XIIA 1O95A 1Z3NA 3TUUA 3S5ZA 2QUMA 3DYPA 4UTWA 3VNLA 3PAOA 4W86A 4U28A 3NYZA 3WMCA 2GVYA 3L4VA 4E2BA 1S5VA 2RUSA 1GYLA 1A49A 3KOFA 4JTQA 1RCXB 4XTIA 2FDSA 2UY4A 2POTA 5BOFA 3KOZA 3MJMA 5ABFB 4D72A 3NQBA 3KVKA 4D6EA 4K39A 2R1NA 4IP4A 4ASTA 3H2OA 2Y0FA 1R9ZA 1OFRA 4QS6A 3GYEA 3RFAA 2VFGA 3W2NA 2EPHA 4L65A 3ICJA 4JHZA 2H9AA 2VFEA 3HQPA 3WH7A 4JQ3A 1A47A 3RDKA 1WE5A 4JOMA 4ONVA 5J5RA 4CNTA 2ZA2A 1FWFC 3EDKA 2QCMA 4US5A 4DYJA 1A3XA 4WR3A 4M1RA 3UJFA 2Z1SA 3NQ8A 4CQAA 3MBDA 2HQAA 2ZZ2A 2TODA 1G9HA 2PBOA 1LYXA 3TMLA 1JG9A 2X05A 3P84A 1K70A 2ZZ6A 1PUDA 2X40A 3PBWA 4AIBA 3LRKA 4KFOA 3O9NA 4FB7A 1SVDA 3V75A 4LV9A 4XV0A 3OU8A 4QSHA 2O4QA 2PGFA 1BG9A 4JTIA 3G1HA 1NWTA 4H1ZA 3SSZA 3AS3A 1OYBA 5D9MA 3U2EA 3CHFA 6REQA 2JF6A 5E9AA 3VAVA 4PB4A 4QX4A 4PUDA 4DELA 3C0SA 3QKEA 3SUVA 1J2BA 3WQ5A 1KC7A 2FFIA 1W1PA 2UY3A 2E9LA 3JW7A 5D37A 1YTEA 3HBLA 3U57A 1ZB5A 3CQ0A 4H2CA 3PJUA 1F07A 1RVKA 1QMLA 1TJRA 4L1GA 5RUBA 1ML1A 1XQLA 3IS4A 3LGDA 4HPXA 4J3TA 3WDIA 4NAFB 3G1AA 1TJPA 2WZEA 2P3EA 3KM8A 3VOJA 5K9XA 4LPCA 4M7SA 2C79A 3AHZA 4QQ3A 3RU6A 2VELA 3TZNA 1RUSA 3I4KA 1K9EA 4FXFA 3WCZA 3LRMA 1TV3A 2G3JA 5H1WA 3JRKA 5ABFA 3AXMA 4JTKA 4Q22A 4LCSA 4TX8A 1XSJA 1B5TA 1VC4A 3LHUA 4DUOA 3BCJA 4DJFD 3WLKX 1HVXA 4Z08A 1XYLA 3WUEA 2J62A 3ELFA 4E2OA 1LWHA 1D3CA 5JUVA 1EUNA 1Q8AA 2C16A 1DE5A 4IQDA 2I9EA 4PSPA 1JQXA 3N9RA 3GM8A 2J8FA 4HA1A 4KGLA 1J96A 3KBWA 2HXTA 3TDFA 4L1XA 3BSHA 1JIBA 3FA4A 1ZP3A 3QEZA 3ZR5A 1O4UA 2CZEA 1VFOA 3S9IA 3GTFA 3NQ6A 4PSRA 1TVNA 2GZXA 3BLDA 3QV6A 4QNWA 1S5MA 3C5QA 3MMTA 2YDAA 1UR9A 3WIJA 4AIOA 1FWEC 3O07A 3QQ1A 3S1WA 4MB5A 4W5ZA 2PWFA 4EP8C 1YDYA 1UR0A 1NTHA 4JTJA 3DYMA 2I5IA 3N17A 2PC4A 4UTJA 3TU9A 3W23A 1ISXA 1IWAA 2EJAA 4BF9A 3IIVA 4V2XA 1TREA 1TFVA 1IT7A 2ZFAA 3CMJA 3QV7A 3G1DA 3CV2A 5K9CA 4LF1A 2WPBA 1X1NA 5EYWA 3C3UA 3CNYA 1DWAM 3E2QA 2VRQA 3ANVA 2P1FA 3UWQA 4W7VA 4OOUA 1Z8AA 2TMDA 2BLEA 3W82A 3Q2DA 4C6BA 2F84A 9RUBA 4UTKA 4FP1A 1B9ZA 2HROA 3DHDA 4UOZA 4BA0A 1KM0A 4HPJA 1F7BA 2Q09A 2WC3A 4UBPC 1KRAC 3NQFA 3I6TA 4D1JA 4NAFA 3SEPA 4OKDA 3R7MA 4Z1YA 1M65A 3DG7A 1J0IA 3C2FA 4MNJA 1J6PA 1J9YA 3MV01 4MAZA 5J5DA 3AIQA 1H4PA 3HFYA 4DYEA 2GK1B 1Q6EA 1AMKA 2QJNA 1R3WA 1CXHA 1UPMB 3CL6A 1XS2A 1QTWA 4IMEA 5E0FA 1Q2SA 1FTXA 3MUZ1 1DTUA 4FA3A 2E7FA 2A7NA 4PA8A 5CSRA 1TA3B 2R8WA 3R10A 2RGLA 3UCQA 4IIDA 1XINA 5EMLA 3GUWA 3PWAA 1L6YA 1JCXA 4BS0A 4GI4A 5IOBA 4G56A 1XBVA 1VFSA 4HTYA 1S5WA 3VE9A 2Q71A 4F66A 2ISWA 1DHPA 1EJXC 5ABHA 1EH9A 1GW1A 3K46A 2KX9A 3U9IA 4XZIA 1UBPC 1KR1A 2QCNA 1JYXA 3U0HA 4X0VA 2ZBTA 1KFJA 3OHIA 1W0MA 2NLIA 3V5OA 3FJ6A 3OA3A 3MKKA 2PGRA 1UQZA 2PDPA 3O0KA 4I7VA 1E51A 1NFBA 4C1NA 6TAAA 1R3TA 4ZO8A 1BXBA 3PFRA 2J7HA 1XLFA 2Z1VA 4XO7A 2EJ1A 5A6LA 1RD6A 3AZSA 5CAKA 2NWSA 3CYVA 3DC8A 1P6WA 5C7VA 1GGOA 3APTA 4TV6A 4DYKA 1VEPA 1XYBA 5EMMA 3VA8A 2F61A 3VKCA 5AFDA 1ALDA 4O28A 4US6A 2F38A 3V0UA 3R8RA 4CKQA 2HS6A 2IPGA 4AYGA 3ME3A 4MNLA 1CLVA 3RUBL 2QUNA 1F61A 1JDEA 2VFFA 1EA9C 2WV8A 4US5D 3QRHA 3DERA 1OCJA 5A8QA 1AH4A 2WOQA 4JR5A 3II1A 1K8CA 3WMLA 4GYKA 2BHZA 1H41A 2VEGA 4WXYA 1NF7A 3PWIA 4JY8A 4NVTA 1UOKA 4IJBA 1P0DA 7ENLA 4TIMA 4DI9A 1OGSA 1W3HA 3C56A 2J9YA 4L4MA 1US2A 3BOLA 1GPWA 2V3EA 1V3MA 3ABXA 3VD5A 4NI3A 1TE1A 1JDDA 3QPEA 3KBSA 3EA2A 3LCGA 3KZSA 3AUJA 3BCDA 4C6KA 4ML9A 2QAPA 4GHRA 2BVDA 3OZYA 2ZUVA 4OV9A 1K02A 1LOQA 3UYCA 4A8NA 2IKGA 4E2DA 4IQEA 3G1FA 1PZ0A 4PMJA 1JXKA 2GDVA 3IJQA 4KBXA 4L64A 1BYAA 1G69A 4FZIA 1IZKA 2NVDA 1E0UA 4NZCA 3USBA 4DF1A 1W3KA 2DZUA 1YE6A 1B31A 4QLLA 3ITVA 4NKCA 5LIWX 1WPCA 1GNXA 2QNEA 2OMAA 1NM9A 2VWSA 5JXQA 4IWWA 3FNDA 2HZGA 1OWQA 2VEMA 2QEZA 2WMFA 3GFXA 4GNJA 4JZ5A 1R2RA 4MLRA 2Y8VA 3LERA 3N18A 3TP4A 3BO9A 2HE8A 3VUPA 2RFGA 3M47A 2BP1A 1CB2A 4EXBA 1EDQA 3MYOA 1NQKA 4N42A 1J0JA 3BGGA 2FTPA 5CSYA 1U1UA 5AC8A 1ONEA 1V6YA 1Q3NA 5C9XA 3WKZA 4XK2A 5DMMA 2BY0A 1AW2A 5E0CA 4Q8PA 3RCYA 4KESA 2XISA 1QPKA 5HNNA 2H8ZA 5DXXA 4W87A 3BJTA 4KCVA 3TYBA 3PNUA 4GG9A 4BWLC 3NPWA 4BEQA 1S39A 3HG2A 3WUGA 4IMAA 1FHDA 3OVGA 3XINA 3FN9A 2B7OA 1E6PA 2P3ZA 1QO5A 3EOLA 3EMCA 4BF7A 3DG6A 5XIMA 4NAEA 1L2QA 4AVNA 1JZ2A 1XD1A 3HURA 3UZXA 3TYEA 4QLJA 3AC0A 4AZ5A 2W67A 4C7GA 2J27A 4U3AA 5ENLA 1KCLA 4GUIA 2O9PA 3THUA 2YL5A 5I3IA 2D73A 4M1BA 3ZVIA 4ZQRA 1AD4A 4AZHA 1PSCA 1SO4A 3V35A 2QKFA 2ANUA 2YYTA 3KBVA 1W9BM 1O66A 2JE8A 1JPIA 3C52A 4NL1A 7A3HA 4MYXA 3GXMA 4O10A 4F0LA 5LA1A 3G3DA 3H4XA 3FJLA 4GGBA 1CI1A 4RZ5A 1RBAA 4L80A 3HQOA 4J2MA 4UTTC 2Z28A 4PFMA 1WDQA 2VEIA 4R85A 4HSHA 4NRRA 1PTDA 1ADDA 3W1RA 2ZQ0A 3DZ1A 2BGNE 5IDZA 1G6CA 1FH7A 1IIGA 2WNNA 5CC3A 1EX1A 4LYKA 3W38A 2PPGA 2QPXA 3L2LA 3NVDA 2ZX7A 1LF1A 2EKCA 3DFSA 1U1HA 3M0YA 5C2XA 4DZ5A 1XG4A 1BWVA 5D04C 3PFMA 4HCLA 1H7PA 1XYFA 2OXNA 4LEFA 3M5ZA 1BF6A 3BAYA 1D3GA 1E72M 4GQ0A 4HA4A 4WGHA 3VKBA 1E4IA 2CBJA 3GBEA 1GKQA 4Q4RA 4MUPA 4B5UA 5CSSA 2HXUA 1W5QA 4KS0A 2O0TA 2PC8A 2BY3A 1U5VA 3CZKA 1KFKA 3B8TA 1Q13A 4AISA 1AH3A 2PA6A 1E4MM 3EX4A 3UQNA 4G1KA 2QVHA 4AWSA 5G4EA 9XIAA 3VOGA 2J74A 2BWGA 5L6UA 4ZZ9A 3GC5A 3A23A 4QAIA 5AVHA 2AMXA 1BPLB 4H00A 4D8LA 5ABEA 4POCA 4AEOA 1MQRA 1SU5A 2PDGA 4HMNA 4JIPA 6TIMA 2PWDA 1FDZA 4KIEA 1QI2A 1H62A 1G5AA 3TEVA 1QUMA 1GOOA 1X6NA 4GVHA 2OZ3A 3OW1A 5AN7A 1A5KC 2INZA 1DVJA 3LRLA 5IFPA 1KFWA 1PZ2A 3LMYA 3LBOA 3WD4A 1RQBA 3PZIA 4GE8A 4GI6A 1SMAA 4LB4A 4PB3A 2WXDM 2PU1A 4ZO7A 1R3VA 3BZGA 2OEKA 3FLUA 5AC7A 1PDZA 4H9TA 4M6VA 3OLEA 2X0HA 3WF4A 3FCPA 4UTUA 3GBDA 5I77A 3G8RA 5BWFA 3CGTA 2W3ZA 2C1IA 4DLMA 4NZ3A 4Q8VA 4DF0A 1XLIA 1YNPA 4UTHA 4Z17A 3ITLA 1DJYA 1CYGA 2C0HA 3T2OA 3JVAA 1VP5A 3SURA 5A6BD 2Y7DA 4BQ4A 3IAQA 3HN3A 2EG7A 4UCFA 3WLJA 2OT0A 3S8HA 1EEPA 2DZXA 3OLIA 4PRWA 4S3KA 4UNIA 1EL3A 2WLZA 4YCPA 1OCQA 3FYPA 2NX9A 4G7FA 3LA4A 3WDHA 3S2NA 4IFRA 1RCOB 5AC4A 4DZIA 4TX9A 1J11A 1PBGA 3URBA 3O15A 1NVMA 3WEZA 1CPUA 1BYCA 5DY3A 2FPVA 1K3UA 3N12A 4K8GA 4JX4A 1B3VA 1SZEA 2HK0A 2GUBA 4GIEA 4GO8A 3MVIA 4LV4A 1XFCA 4F79A 3M64A 1ZTVA 1UIPA 3ZFHA 2Y4SA 3W7EA 1TSIA 1LG2A 1NH6A 3GXNA 2VDIA 3TCEA 1NFGA 3ARPA 4JIIX 1I4NA 1HUVA 3V3WA 2OLHA 3P8IA 1EJSC 3L2IA 3WNKA 4JQ1A 3WY1A 4JFWA 4R5EA 4PMQA 1IXQA 5DELA 2Y2WA 3LLFA 4HU8A 1TPDA 3CWOX 2REQB 2HV5A 1K03A 1FWAC 5KZDA 3U6WA 2XWDA 3QOKA 4B15A 3HGOA 2JGYA 2QCHA 4CCZA 5F4SA 4HYVA 4GQBA 4IISA 1JFHA 1Q2RA 3UPWA 1UP3A 3O2LA 3AZTA 1EJRC 3OODA 4C6JA 1C91A 3T81A 4M82A 2X2GA 4J3XA 4MJMA 3OLGA 1LQ2A 4YVPA 3I10A 4MUZA 4PEKA 3GIQA 1FDYA 5HUOA 1YXDA 3RCNA 2OQHA 1K6WA 3O6CA 1KKRA 1J18A 1O1ZA 5KTLA 3AAMA 1D9EA 3OJGA 1AUSL 1EDGA 4LCRA 1IT0A 4HU0A 3M16A 2QJGA 1F76A 1IT8A 4DAIA 2VM8A 2CLHA 3VMOA 1W9VA 1V79A 1BF2A 2WCAA 2DV0A 1NQ6A 1I1XA 1KFLA 2MANA 3S3GA 4LVBA 1K4GA 2F6XA 2V9DA 4FLRA 3B03A 3S6OA 1OZQA 1EJVC 1OK6A 1U30A 3HV8A 3WLTA 3OGRA 4ZCWA 4I8DA 1E6XM 1PXGA 3PY2A 3L12A 4D6IA 1K7EA 2QDGA 4R53A 1BWKA 4AIUA 4EXQA 3VNKA 3RMJA 1B54A 3C2RA 3FDKA 4OJYA 3RK8A 1ZBKA 4N9BA 3SCRA 5DFAA 3UPBA 1ZAIA 2QIIA 1Q6GA 3P7YA 4DEFA 6XIMA 3I7SA 4EK7A 4B4HA 2Z6IA 3KOYA 2BODX 4HD5A 1H7WA 1CCWB 2VC7A 2YA0A 2GDUA 4EF8A 4IQJA 3NQEA 3WQFA 4B4FA 1PKMA 4WXZA 5FA5A 3AISA 2QF7A 1AMYA 3VIIA 4G1NA 1RP8A 3BG5A 3I6RA 1YDOA 2P10A 3LCWA 4WRHA 2J7CA 1I8JA 2BZNA 3MWAA 3LS9A 4KIRA 2E0PA 1X1OA 4AWUA 3PPFA 4H8VA 3EXRA 3O06A 5KETA 3EX2A 2D2OA 3EBVA 3UW6A 3U48A 3TR9A 2BB0A 2BOFX 5FJTA 3N29A 5CG0A 3AJXA 2ZA1A 3M07A 4M80A 2DUXA 1R7OA 2IPFA 4I5UA 3AS1A 1W5NA 1ZBCA 2CYGA 2G96A 1T0OA 3FJ4A 1FWSA 2YCJA 1BFNA 3W6LA 3EAUA 3CAWA 1LOLA 1PYMA 2OG9A 3BLFA 2WMIB 2E5CA 1A3WA 3S46A 4A22A 4LUSB 3E5BA 4K2SA 1E73M 3UWWA 4LS1A 5A5WA 4Y7EA 1FWDC 3MU7A 2NX1A 2C18A 5K9DA 1RJQA 5HNTA 4MM1A 4IP5A 3QLDA 2YW4A 4YVXA 2R1MA 1Q6QA 2UV8G 1TRDA 1G1YA 1OZMA 3KLLA 4B92A 3AMLA 4Z1CA 3NSMA 4XBJA 4PR4A 1OCNA 3URNA 4UQAA 1OX4B 5D05A 4N0RA 5HUPA 1EXPA 2OX1A 3MUAA 1HXJA 2PDIA 4PMZA 1M7PA 2CLKA 3GHRA 4FSAA 4PULA 2YLLA 1YADA 4P7OA 2I56A 3F03K 4FF5A 1XISA 4QG9A 1XDJA 4A8RA 4WJEA 3ZJ8A 3SCWA 1IZCA 3SI9A 3FEQA 5HANA 1P6BA 3TYDA 1C9DA 1E9ZB 2JK2A 5DCDA 3AQUA 4AZGA 2OSYA 8CGTA 3PHAA 1KBLA 5B80A 3BICA 2FZMA 3EDJA 4AIEA 1TO3A 5J04A 1QI3A 4HNOA 3D5HA 3BAXA 5DMLA 3N4FA 1XIFA 4JY9A 1RBOB 1N2VA 5BYWA 1S3HA 4HU4A 4AFYA 1R3QA 3WENA 3DECA 5CAHA 2W66A 3W88A 1V6UA 3MDUA 3NO3A 3IEBA 1KM4A 3GW3A 4WSHA 3I3DA 3ITTA 4O14A 2QR6A 3EOSA 3NJ3A 3TLLA 4KPLA 3UZ5A 3MT1A 5KZMA 4BK9A 2XH2A 3QMRA 2VRJA 2Y61A 2OELA 1PX3A 5G1MA 1K8XA 1H51A 4JTUA 4NILA 1PCWA 4CQ9A 1KWGA 2CLEA 3BLIA 3CIVA 3A3HA 2QDEA 4L6HA 3LGGA 1HW6A 2WJEA 1A0CA 3VM7A 1R38A 2BOEX 4TVCA 4OU1A 4GZIA 4PC8A 3UERA 1FWIC 4YIWA 4EPDC 2WMIA 3P67A 2QCGA 1V02A 3VGGA 1JRBA 2AOSA 4OZOA 3SY8A 4TOQA 3R0KA 1KLZA 3GHSA 3M0IA 2HBVA 4LQ1A 3H21A 3O8AA 3QVQA 1AG1O 4IFOA 3RX2A 2FH8A 4UTIA 3WFZA 3N2BA 3PZGA 1BD0A 3EKLA 4RDYA 1EWEA 1DIEA 1OF6A 1I2NA 2W92A 1E5NA 4JFSA 5D33A 4QG6A 3ZO9A 4HZ7A 3QOMA 4WQ6A 1YEYA 4JYFA 3WNNA 2W4XA 5AHNA 5GJPA 2YCLB 5LIUX 4RE0A 3G0XA 3CV6A 1W37A 4QITA 3RX3A 6A3HA 1EIXA 2XFYA 1DQXA 1H2JA 4WKFA 3GVQA 1Z89A 5D9OA 3T08A 1L2UA 2OYKA 4W89A 4U3CA 3URAA 1UP0A 3E6EA 4CNUA 3H2AA 1DHKA 2QS8A 4NQ1A 1PE1A 2VENA 4JIRA 3SRDA 4IL0A 2P5NA 3TJXA 3UF9A 4C90A 4L4OA 4L56A 2EHHA 1XYAA 1F3TA 3O63A 1Y5VA 2IQ0A 1TWWA 3OO2A 4GIRA 3VCNA 3VGEA 4M24A 1ZNNA 3QKZA 5I03A 2QJJA 4GKLA 3EDEA 3EWCA 4QJ1A 1Q7ZA 4AZ6A 3F4WA 3M0XA 3NPUA 5EBAA 2Y7FA 4XZHA 4O17A 1JULA 4UQCA 3BAWA 4D6HA 1R86A 1F3WA 3KS5A 1ZRQA 4AXNA 2C19A 5DLCA 3DESA 5G2IA 3LCHA 1LTDA 1GQKA 4PTXA 1XLHA 1EBHA 2YDSA 2ZUWA 4B5WA 4E2VA 1EO5A 1RSCA 4LAUA 5CG7A 4N6FA 4A3YA 4XKYA 4Y90A 3IIZA 1VEMA 1K4HA 2YDRA 3A64A 2V3GA 5M2FX 3UXKA 3QC3A 3GS6A 3ARXA 3UCDA 2YYUA 3DG3A 2ZWYA 3BOXA 1E4NA 2VKZG 1XRVA 3IVUA 3T09A 2Z4GA 5DMYA 3ZOAA 4UFIA 3RG6A 1Q4WA 1PO9A 3QJAA 4FXRA 4XAPA 3NSXA 1UR1A 3H2FA 3F5KA 5BCAA 2PMQA 1Z41A 1J79A 4CD8A 4R33A 2DJLA 3DI0A 1EUAA 1IEIA 2YCLA 4KCWA 4MHBA 1VRDA 3BSMA 1AH0A 1FWBC 1LDCA 1RH9A 3MCOA 1JYVA 4ZENA 3TMQA 5CBJA 4DRSA 2IPJA 3D6NA 1F73A 4O1AA 2PD5A 4ML4A 5BU6A 3NXLA 3ENLA 4EOUA 3UR7A 3QV9A 4TO8A 5DY2A 1DL3A 1WBJA 4IOTA 2ZRWA 3MB9A 1JF5A 1H3GA 3M0KA 1RA0A 4KMQA 3RRXA 5LSMA 4NG3A 4B3KA 1RR2A 1Z6KA 2ZADA 3ORWA 3UP8A 3HIJA 1VYPX 2PURA 2ZZ1A 2VUNA 2ICSA 2VUYA 3HV9A 1WXJA 3H53A 4GD0A 3UFYA 2YBUA 2WKLA 4FLQA 3W53A 2PDXA 4XTDA 1V51A 5IHRA 5JVLA 2VX5A 1Q7QA 2X2YA 2PS2A 3SM0A 3GKAA 2FTWA 2YSWA 4JEQA 3IJ8A 3FYYA 5E09A 2WVVB 1M7XA 4FNSA 1VEOA 2FVLA 1EQPA 2A3HA 3LK6A 1PEZA 1SO3A 4YHGA 4HSOA 2FJKA 4J27A 3O1NA 3NEHA 1SSDA 4HHLA 3UJSA 1F3EA 1SUXA 4NJGA 1OVDA 1J6OA 4UR8A 3FVMA 3M7SA 3TCSA 1WBHA 4UWMA 3RAOA 2XGIA 2OQLA 3U2ZA 1ITCA 1HKIA 2E6AA 4DX3A 5FEZA 1SJAA 3MUXA 3LZ3A 1GOWA 1V0MA 2IQDA 3CIWA 2W27A 3WJYA 4LYPA 2VVNA 1UH2A 4UFLA 7PTDA 4JIHA 4N02A 5HJXA 1R85A 1S1RA 4DM2A 3AS2A 2ZZ4A 3CH0A 1ADSA 2EPOA 3UR5A 3THAA 2XIBA 2F6UA 2Q6ZA 5AKQA 1QPQA 4XO6A 2NV9A 5KZEA 4QJ3B 5C9WA 2NVCA 1GOKA 1FY6A 2RKXA 3VINA 4NSBA 5DEZA 2B7PA 1GKRA 1Y5WA 2D23A 3L4UA 4Q6JA 1JR1A 2NQJA 3VIHA 4ZSUA 4FS9A 1FCUA 3BV4A 5I3GA 4W85A 4UQBA 1W1VA 2Z1KA 3TN6A 1QOQA 1JZ5A 1JPDX 2BHYA 1ZU8A 3STPA 3W2LA 4Q8WA 5B7ZA 5I23A 3K8LA 4ADSA 4DXKA 3N14A 5C9ZA 1V7AA 3B40A 3W2JA 1KXHA 1EJTC 2FLIA 5D2YA 1JXJA 3AWOA 1W2PA 3WBEA 1XC4A 4B16A 2VZSA 3VCCA 3SUSA 1CGYA 3STGA 4Q6XA 1LLOA 4H8NA 2V69A 2DY3A 2V30A 4A35A 5K7JA 3GQYA 4AD3A 4PUNA 3MV11 1BKSA 3UXIA 5IXEA 2F2HA 2XGBA 3G3MA 8XIMA 3PTDA 1J2WA 1QR7A 2GJXB 2PODA 3CIXA 1K8YA 3UJRA 2WVVA 3EMQA 3BG3A 1CBGA 1Y0EA 3LV6A 4P7RA 3W1PA 4JTSA 2OTDA 1RPKA 4RDVA 5A1AA 4N9EA 3UWVA 1QHPA 4DPPA 4HP5A 2OCZA 1TTIA 3EGJA 1TUFA 4TUFA 2Q01A 2V5LA 1SW3A 3WSUA 3H24A 3M5XA 1UZDA 2KZHA 3S6TA 3QH2A 2PWUA 1LQAA 4GLEA 3CT7A 5CQ1A 4NNBA 3BLEA 3EPOA 1E6RA 1XLKA 3AYSA 1S46A 4L9XA 5F2MA 3KRSA 4HOWA 2PLMA 4KWWA 4PCPA 3DHFA 3E0WA 1GKPA 4BWLA 1GW9A 1W5PA 4WIWA 1YIXA 3EX6A 3TSMA 2DUAA 3B8WA 1ENUA 5I79A 2EG6A 2VO5A 1SZGA 2DW7A 4MWAD 4XB3A 2IQTA 3VC5A 2VX4A 2J6XA 2VHLA 2WPGA 2FZ8A 4FNUA 2V67A 5CXPA 2YLAA 1BYDA 1IEQA 2QAFA 1N8FA 2BNJA 4KW2A 3W2KA 2QIWA 1NWRA 4JICA 4V1XA 5I3JA 3LTPA 3ECQA 3WQOA 3T9PA 3PN8A 2DZVA 4XAGA 3WFAA 3WLOA 3CL7A 1HP5A 2WKJA 2R82A 2P50A 3SADA 1RXOB 3GR7A 3I7QA 4DBWA 5H2ZA 1XQKA 4YU1A 3N19B 1NP2A 4J40A 3FGCB 1VB9A 2D0FA 5JU6A 3DEQA 1B3OA 2PTYA 1ICSA 5AY7A 3ZJ6A 3S1VA 4CCCA 3RILA 1O5KA 2XVGA 4LVDA 1IIHA 3S5YA 1XV8A 2E40A 1TX0A 4UTTA 5JH1A 3PBMA 3M0ZA 1TMQA 3FHAA 5EBUA