1F5ZA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form i
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
293
structure length
293
Chain Sequence
b'MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLNEURAMINATE LYASE
molecule tags Lyase
source organism Haemophilus influenzae
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
total genus 122
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f5zA00
3W86A 1O60A 3G0XA 3TU9A 2I1OA 3EX2A 3LI1A 3W2UA 2TYSA 3W3OA 4BI6A 4E2BA 2J27A 4Z0JA 3THAA 3S8HA 6TIMA 1LM1A 3W1TA 3W7RA 3IRDA 4JR5A 2OX1A 2YFOA 1SO5A 4NNAA 1FWWA 1GOXA 1G4EA 4UFJA 2ZQ0A 2ZZ6A 4IX2A 4FB7A 2E6YA 3HMJG 1ZCOA 2Y7FA 2GVGA 3T78A 4HNVA 2E5BA 1I2OA 1P0NA 4H6KA 5E0KA 4MY1A 3P8JA 1W5QA 1PS9A 1HG3A 1O5KA 3NR0A 4MFDA 1Z44A 5AYZA 4XWUA 3TXVA 4R53A 2VC6A 3EWYA 3EWUA 3G22A 3QW4B 4PC8A 4IMCA 1M7OA 3RF9A 3NQEA 1LBLA 1LOLA 3KRSA 4CQAA 4IPIA 3HG3A 1VLWA 4NUWA 4ADUA 2KZHA 2J9ZA 3IVUA 3PAJA 4L4LA 5FF0A 2QCFA 4N6EA 3MYPA 4S2BA 1LBFA 4JTUA 2DZTA 1RR2A 2CZFA 3P74A 5AHMA 2W79A 5D2VA 4EVZA 3BLEA 3HPXA 3BLIA 3C6CA 4K7YA 1RD5A 1K7XA 4BFAA 3MHFA 5G4WA 4FO4A 2VFFA 3L2IA 1S3HA 2ZZ3A 1SSDA 3GNNA 3P82A 2Z0IA 4MJZA 3NG3A 4AHOA 3C56A 3QZEA 1B4KA 4JY8A 1GQNA 5CPMA 5DXYA 2CLOA 4NJGA 4N6FA 3W84A 2VELA 4XZ9A 4ZMGA 2WNNA 5K9DA 5AC8A 3TSBA 2JKPA 1KTCA 1OX4A 2CZDA 3WK3A 1RQHA 5IM51 3QYQA 4ZQMA 1TPB1 2FPTA 3NQ6A 1R2RA 4QSHA 1VQTA 3W7LA 1A53A 1MEHA 2DU2A 2NXIA 2R94A 1EX5A 3MI2A 1NF7A 3B0VC 2XFWA 3OG3A 1YTKA 2JGYA 2E6AA 3N34A 1LBMA 4GUIA 4QQ3A 4QNEA 4E0CA 4ML9A 2ISWA 2W0UA 4EOUA 3SY5A 5FI8A 3HQ1A 1ZJIA 3IVSA 4LUJA 3U6WA 3DH7A 3CTLA 5G2IA 2YXGA 1KFEA 1SSGA 3GZ3A 3HBLA 4HNUA 3STCA 3HG5A 5BRBA 3CLMA 3M5XA 3DZ1A 4UFIA 1H63A 1Z42A 1BWKA 3O8AA 5K9CA 3KVKA 4I7VA 4OWGA 1F2JA 1SZFA 4FHAA 5I3GA 3DFTA 3HGJA 1OX6A 1DORA 3IIXA 3W87A 1LDCA 3LERA 2H8ZA 3CT7A 3TK7A 1IXQA 1NSJA 1G67A 4KFOA 3W75A 4UTIA 3GR8A 4AWSA 1IGSA 2ZYFA 1GG0A 1RZMA 4FNUA 1TTIA 3C2FA 2WPBA 4I7UA 4WY0F 1SUXA 3LLFA 2ZTJA 4O17A 4DPQA 5EL1A 5F2IA 2X1RA 1PHQA 4A21A 1KBJA 1LRNA 3GKAA 2R14A 1THFD 4CCEA 2RFGA 4TMBA 1M5WA 4X3ZA 4M5PA 2EAWA 4RLIA 3QPYA 3R89A 2E6DA 2JKAA 3BG9A 1AL7A 3N9RA 3WK0A 3UWVA 5T26A 3L21A 4RCXA 3M44A 1YLVA 2C18A 3O6CA 4UTWC 3QQ0A 3DXIA 3DKJA 5FF4A 2E09A 1FCBA 4UTUA 1X1ZA 4JYDA 3LXCA 4IMEA 3VE9A 3W7CA 1J2WA 5BOOA 3B4UA 4XKYB 4LV9A 2C3ZA 2GVLA 3BLFA 1P5BA 1ME7A 4FNTA 4ZQNA 1W5NA 4JTHA 1SW7A 2HTMA 2J6XA 4Z1DA 5CGQA 2PRHA 3NQMA 3PF3A 4RR4A 5KZMA 2FLIA 4AAJA 1F7BA 4XUGA 3I68A 4ZL1A 5K3VA 1F6PA 2YCEA 5D2TA 2DORA 1VHCA 3ANYA 1UCWA 2A21A 4IWWA 3LCWA 1KLYA 3NQ7A 1Q6OA 3L5AA 5FF7A 1VHNA 4WZHA 2C15A 3G1XA 2YYTA 1I2PA 1OK4A 2A4AA 3G24A 3UXDA 4CQ9A 1OYBA 3EEGA 1KLZA 3IGXA 4E38A 1T96A 3AO0A 1AMKA 3G3MA 2GPTA 4POCA 2WO5A 3PVFA 3N2MA 4O4WA 4AEOA 3H55A 4MZ8A 2V5LA 1SPQA 1EP1A 2HMCA 3R2GA 3L65A 4S1FA 2V9DA 4RZ5A 2QCGA 1ZFJA 4X22A 1TPVA 3PY2A 4BI5A 2WJZA 3QRHA 2RH9A 3L5LA 1O5XA 1KFLA 4K8EA 3UWZA 4CNPA 4IMDA 1SW0A 3HIJA 2P1FA 3SW6A 4FNRA 3SECA 3IIVA 2ZRVA 3MP3A 3MJYA 4GUJA 1TIMA 5LZLA 1VH7A 5HWMA 1S5TA 5EPDA 3O63A 1PL9A 3W71A 3WJZA 4LS0A 1GTHA 1XKYA 3Q37A 2Q8ZA 3SZ8A 2PE4A 4N9CA 1WBJA 5DELA 5AFDA 2Q8LA 1G4PA 3N19B 5CKSA 2RKXA 4LS1A 4MY8A 3LOTA 4GC4A 3CWNA 2QUVA 2GUUA 3PG8A 2TSYA 1VCGA 3W7NA 1QR7A 3KRUA 2NXHA 2VEKA 4RZ4A 4MIMA 1DKWA 1JUEA 2BSLA 4OE7A 3PBWA 3NDOA 5D04C 5F1VA 1OHLA 3NL2A 2EF9A 2QCNA 4O18A 1OFEA 3THQA 1E51A 3W7QA 4UIOA 3G0SA 2QCLA 3W7JA 3WJYA 1IXOA 5DN1A 3C2RA 5H2ZA 5H91A 4U4MA 3RU6A 3NM3A 2J88A 1PHWA 4AB4A 2A2IA 4EWND 4BWLA 2YDAA 3I7RA 4M6VA 2CLEA 3D0CA 3UD6A 2H6RA 3LHZA 4BK9A 1KM4A 4ICNA 5D03A 3FLUA 2CZEA 5CSRA 5A8GA 1JQVA 4FEZA 2FQIA 1LLZA 4DO4A 4UFKA 1K3UA 4O16A 5FEZA 1BKSA 3TC6A 3GVGA 4UMBA 3UYCA 4B5NA 2PCQA 3UPWA 3LTPA 1GJPA 4UCGA 3TW6A 3MO7A 1VCVA 3M43A 3ZWSA 4EF8A 2A1YA 3ZR4A 1DBTA 3EX3A 4JTLA 3W23A 3INPA 3H54A 3G1DA 1ZALA 3GKFA 3LXAA 1K7FA 4N9BA 4R34A 4HT3A 4CQ8A 1AW1A 3G8EA 3F1QA 3G1YA 3C2OA 3OEXA 1AL8A 3QPZA 2CLHA 1QO5A 3LCFA 2FTPA 5LSMA 1I2NA 2VFEA 1LRQA 3VNDA 4C1KA 3NZRA 1D3GA 1R46A 3HGRA 1U83A 4FF7A 1MEWA 3B8DA 5AB3A 2QUUA 3DKLA 3VCRA 4UFHA 3L68A 4O4VA 2FB3A 2V2CA 4PL2A 2ZBTA 1FXPA 1A5AA 5F2MA 2QCHA 2BTMA 3UQNA 3TAKA 2TMDA 3BPWA 1SFLA 3IEBA 2WOQA 3M47A 5F4WA 3W7DA 3LHUA 1X7FA 5G1YA 4ZQRA 3BARA 1WDWA 3S5OA 1G6CA 1L9WA 3DFSA 4KWVA 4UTTC 2GJLA 1ZHAA 1JCJA 1EPXA 3LDVA 3LXBA 1YXCA 3R5EA 2XN1A 4GRSA 3CIWA 4U28A 2BLEA 4DBDA 4O57A 1C9DA 5D33A 3TMQA 3LM7A 2ZRXA 4WD0A 3MBDA 4DO5A 3A24A 3W9ZA 3QMSA 3OIXA 3ATZA 2B0MA 4KFPA 2I14A 3S0CA 4XTDA 1W37A 2EHHA 4MY9A 4WJEA 2QAPA 3WJXA 1EUNA 3HG4A 1KM1A 1XBYA 4WOQA 2G96A 2QKFA 5F1UA 1Z41A 1KA9F 1PIIA 5EY5A 3W85A 5G1TA 5KINA 4GWEA 4AH7A 2QF7A 1IXPA 2WV8A 3HJZA 3BK0A 1FCUA 2AGKA 3W7EA 1KM3A 1OF6A 4AF0A 4XBSA 2ZZ5A 4JEQA 2IQTA 3IIOA 3T7VA 5DBTA 4MJMA 1JJKA 2QCEA 4N9EA 4OQVA 3TMLA 2O7SA 1GT8A 5D38A 2VOMA 3OVPA 3B05A 3OA3A 3O6YX 3NGJA 1GTEA 5TBOA 1SR9A 4UTWA 1FDZA 1H61A 2RDWA 3KXQA 5AHNA 4X2RA 2W6RA 3TROA 5D32A 1W3IA 1FWSA 3W7KA 4UTJA 5HWNA 4HKPA 3QEZA 1FY6A 4NQ1A 4O0ZA 2R8WA 3FEMA 3CB8A 1LYXA 4R7JA 4PFMA 1IF2A 3KX6A 3TSMA 5C54A 3PWAA 1K03A 3NQGA 5G5IA 1MXSA 5CPOA 3ABQA 3W1NA 2E77A 1IIHA 2ATMA 3N3MA 3TA6A 2QCMA 2A6NA 3P5YA 3M16A 1GVOA 3STEA 3LCXA 4O50A 5AOUA 2NX3A 3I7QA 1TPWA 1JVNA 1M6JA 3LTSA 3QH2A 1UUMA 5AHLA 4JIQA 1XI3A 3E49A 3G8RA 4O10A 3CC1A 3W1UA 5D2XA 3UY7A 5DCDA 1TPC1 4NZFA 2WSQA 4PODA 5FEXA 2GQ9A 2E1DA 1L6WA 4MLJA 4N4PA 3RFAA 3TQKA 2NV2A 4JYFA 2QDGA 3PS7A 3FS2A 4LVDA 1RV8A 4IGHA 3W7MA 1EIXA 3P61A 2ZRWA 1LROA 5G4EA 4JGDA 1AW2A 1KM6A 2BX7A 4JX6A 3HGOA 2DZSA 3IIPA 4K36A 2FB2A 1H7XA 3SIZA 3WK1A 3Q58A 2UV8G 3W1QA 2YX0A 3LV6A 1TTJA 3DI1A 1PE1A 3GDKA 4O1BA 1LP6A 3G18A 4JTIA 3MHUA 2OCZA 4DQWA 3ABRA 3I65A 1TO3A 1SO3A 5TQLA 3TCEA 4TMCA 3IGUA 1OFDA 1WXJA 4ZQCA 1LLWA 2ABBA 5CZ0A 1NFBA 1T0OA 1GYLA 3GB6A 4GE8A 8TIMA 3W7PA 1NVMA 4O54A 2YYUA 1OVDA 3MHGA 1KFJA 2QJIA 3Q94A 4YLWA 3O05A 1SO6A 4KWWA 5KZDA 3L0GA 4LVFA 4UXDA 3W1PA 3O06A 4JTGA 3IVTA 4Y6GA 1U5JA 4UMCA 4A3UA 3ELFA 3NL3A 4UR7A 1TTPA 1O94A 1R2SA 1TQJA 3NYZA 3EXRA 1XDLA 4O28A 3TJXA 2BWGA 5IBXA 4TO8A 3FYOA 4I9AA 3EWWA 3P5ZA 3C52A 3MMTA 1KM2A 2YSWA 3U2OA 1YADA 4WY0B 1KW1A 4BWLC 2A7RA 1W5PA 1FX6A 3QSTA 5E93A 3SR7A 5I3FA 5FF3A 3TH6A 3NVTA 1TPFA 2AAMA 3NO5A 2ABAA 3PUDA 4IPJA 3C61A 1TPUA 3M0ZA 2E5DA 4CCDA 3NM1A 2G97A 4PH6A 1TPDA 1SQ7A 4FIRA 4HSNA 1XUZA 3S1VA 3GDTA 4OT7A 1ZY9A 2P10A 2RDTA 1N7KA 3PB0A 3SGUA 1I45A 3G1AA 3VKJA 3DENA 4PL1A 3CEPA 2CLFA 2DP3A 2CWNA 3M5YA 4XQ6A 4LTSA 1SZEA 1WX0A 3C2EA 4N9DA 4ORIA 1VR6A 1W31A 4XBKA 1RQEA 1ME9A 4L4MA 2FJKA 2FPVA 3DBPA 4YCOA 1H62A 2YW4A 1FWTA 4IMFA 1VYPX 3GYEA 4ONVA 5KTLA 4PCFA 3T44A 1WV2A 4ZQPA 5AYXA 1LCOA 2BZNA 3PULA 5LNUA 1H7OA 2BXVA 1YYAA 3NQCA 3QW3A 3PC0A 2YW3A 4MKNA 1OYAA 3JRKA 3LB0A 2CLKA 1B57A 1QPRA 3LBCA 3LLDA 3PSVA 1KTBA 1HO4A 3CPRA 3H53A 4ORMA 1GPWA 2VFHA 3EWZA 4DF0A 2CFFA 5DY3A 3UPBA 2WQPA 1CI1A 1G7VA 3OHIA 4QNWA 2A7NA 4RKAA 3EKZA 4MLRA 3B04A 3W73A 1LORA 2OT1A 2B7OA 4HNNA 3PG9A 2E68A 4A22A 3L66A 3TDFA 2OT0A 3LCLA 5HR7A 1TPH1 1K8XA 4JNMA 1YXDA 4P2VA 3L0KA 3NQ8A 1TPEA 4H3DA 4WY0A 1Q6LA 4W9TA 3UWWA 3MUXA 1QAPA 2VKZG 4RX0A 4BR1A 3OVQA 1JRCA 1QFEA 1ADOA 4IOTA 1MO0A 3WK2A 4IJBA 3BO9A 3MP4A 4UR8A 3W1XA 3T4CA 4O1AA 1P0KA 2JKEA 2J24A 3GXPA 4M7SA 2X30A 2VXNA 3KHJA 3BVJA 4Y90A 5K7JA 4JX5A 1I2RA 1NF0A 1OX4B 1VLIA 3HOJA 4GUFA 3TFCA 1OABA 3TW7A 1OFQA 1QPOA 2YFNA 3NA8A 4N4QA 3WJWA 1KM0A 1F05A 2V30A 3SI9A 4OV9A 3NPVA 1JULA 2ATSA 1KFCA 2RDUA 1VJIA 1F5ZA 4EIVA 2E6FA 2O7QA 3DGRA 1WAUA 3NQFA 3RLVA 3FFSA 3C8FA 2F84A 4WUIA 1UASA 1UUOA 3P62A 1H7RA 4RXGA 1MEIA 2CZ5A 1SU5A 2DZUA 2DZPA 3LX9A 3E0IA 3SJ3A 4MZYA 2X1SA 4NJKA 1TJPA 5C6MA 4RK8A 3UWUA 5AC6A 1Q6RA 3GAYA 1X6UA 3NQAA 2C14A 1J5TA 4O14A 4ZVJA 1TJRA 3W2MA 4CNNA 3TV8A 4UTKA 1AG1O 4NJHA 1GEQA 3S5YA 1TYGA 4NXSA 2R91A 1P1XA 2FFCA 5EKYA 1H7WA 3CHVA 3MYOA 1TRIA 1TMHA 4YCPA 1YTDA 3NNTA 4YL2A 2DJLA 4LC8A 4M6QA 3DHFA 4GJ1A 1XL9A 4JN6A 1P4CA 5D05A 3W1LA 1XXXA 4DBEA 4M6PA 2NZLA 1W3NA 3LV5A 4HIBA 4MYXA 3L0NA 3W6YA 4GUHA 5D02A 2Z2UA 3NPWA 4RJEA 1DOSA 3E9AA 2V8ZA 3ABOA 4BI7A 4LC6A 4AF0B 1YDNA 4XTIA 2HS8A 2ISVA 5AC7A 2YGYA 4JX4A 3UZ5A 4NZJA 3EX1A 3FJLA 4NT0A 1LRTA 3QF0A 2V5BA 3W07A 4LNYA 4HHPA 4O19A 2ZDRA 5HUOA 4UTHA 4D2JA 4WXZA 2XN0A 2QJGA 3NOEA 3F4WA 4NVTA 5HUPA 1QMLA 3TQ0A 1DJNA 4O13A 3QMTA 2Y7GA 4XKYA 3CM4A 4UFLA 3GX9A 1X1OA 3I7SA 4NNBA 5DCBA 3V1PA 1G69A 4FIQA 5EYWA 4NNCA 4NX0A 3GNDA 1D3HA 3B06A 4DEFA 5LNWA 1MZHA 4QJ1A 5MHBA 4UNKA 5K2ZA 1YXYA 1TB3A 5CG7A 2QCDA 4ZQOA 4ALDA 3W2LA 5FEWA 1GWJA 2Y7EA 1SZNA 3VE7A 4GUGA 2EPHA 3GDLA 4M7TA 1A5BA 3P81A 4AHPA 4K37A 5AHEA 4HPJA 2VENA 2WKJA 2NWSA 3ZS4A 4LOCA 3LCHA 1N8FA 3M41A 5DBUA 5FESA 2AQWA 2NV1A 3UWQA 1OYCA 2H8XA 3TAOA 2B7PA 5K4XA 1VYSX 4Q32A 3S1WA 3LCGA 1OFPA 3F03K 3LGEA 3IGSA 2GQ8A 4O1DA 3DU0A 5IBXC 1F73A 3FA5A 2V82A 5EMUA 1OFRA 1WYIA 5F2LA 4CLMA 3M6YA 1DL3A 4OU1A 2I9EA 4GXMA 3I6RA 7TIMA 3UWYA 4DO6A 4NJJA 3W7OA 1W56A 3K30A 4OGZA 1QPNA 1TV5A 5HNRA 5A5WA 1QOQA 2Z6IA 1VS1A 1O95A 1JCYA 2QCDB 2ZCGA 3TSDA 5BMXA 1I8JA 4IUOA 3KFTA 4O8RA 3LHVA 4Z1CA 2DZVA 2C0AA 4NX5A 1KV5A 4FXRA 2Z6JA 2NUYA 3O16A 1OX5A 1AW5A 1G7UA 2QAFA 1K7EA 3OVRA 2NLIA 2Y85A 1R47A 2Y70A 1FDJA 1L6SA 3TUUA 4CCCA 1T8XA 3R13A 4HSOA 3S42A 2VFDA 2GOUA 2V81A 5LNSA 3NQ2A 2ZA3A 3DFPA 3P8IA 5CZSA 2V0TA 1H5YA 3W7IA 3O6DA 5L9FA 3TE9A 4ZZ9A 4FNSA 3UNDA 4LUIA 4WOZA 4I7WA 2CU0A 2D73A 3RNDA 5HWJA 4JTTA 5LHFA 1FCVA 4C1LA 3P67A 3KOFA 3W72A 1GVFA 3B03A 2QEZA 1EP3A 4O0KA 4UTLA 3R12A 1Y0EA 2F7FA 4PEKA 3W1MA 5AHFA 4JTEA 5AYYA 4NXKA 4FNPA 3W22A 5D09A 1K8YA 4Z0SA 3GR7A 4KKXA 3L5MA 1ML1A 3M7WA 3HO8A 4IXHA 1L6YA 1WA3A 3ABSA 1B9BA 4QITA 5TIMA 3CIXA 2ALDA 3TC7A 2DZXA 3G1VA 4FX8A 3UY8A 1TV8A 5KITA 1H50A 4A2SA 3DHDA 3TX9A 2NUXA 1A5SA 1JCMP 3EB2A 5DY2A 5G2HA 4Z1AA 4LU0A 1UBSA 3QSRA 4YMZA 3TXZA 5KZEA 1XM3A 1JCXA 3EKLA 1EUAA 2FDSA 1FDYA 3A21A 4UNLA 3P80A 3C2VA 1W0MA 2OZ0A 1FWRA 1TREA 4UTMA 2VFIA 2CW6A 3NAVA 1TQXA 3NL5A 1V7YA 2WNQA 1CW2A 1FUYA 3LCIA 4G1KA 5U4NA 4GFSA 3W70A 3FKRA 1XFBA 4O15A 4NJIA 3FOKA 2VEMA 3TKFA 1QOPA 3TNOA 4FNQA 2QJHA 4Z08A 3STFA 4HNTA 3QQ1A 4A2RA 2C1HA 1W1ZA 1W54A 4JTJA 3STGA 1N55A 3BGGA 3GDMA 5EBUA 5D37A 1SZGA 2VFGA 1KM5A 1YPFA 3O07A 4JYEA 3QFEA 1WOBA 2ZZ1A 1NEYA 3NZ1A 4MUZA 1VZWA 2EKCA 4ADTA 1A50A 4NU7A 1F76A 3PBYA 4LVGA 4IX0A 1G4SA 3UZJA 1ZENA 3EWXA 5BNKA 1XUUA 5I3KA 3GAKA 4UFMA 2NWRA 4MOZA 4Y9AA 1LZOA 3MI6A 3L9CA 1F6KA 4H4IA 3DAQA 3MP5A 3VI2A 4JTFA 1WBHA 1BTMA 2P0OA 1GVRA 3BG5A 2ZRUA 3JR2A 1VCFA 1RPXA 2XN2A 4OHQA 2NX1A 3W88A 4DPPA 1ME8A 3WFAA 1OG0A 3NPUA 3W2NA 3LHWA 3FYPA 1KTNA 2ZFAA 3B0PA 1EA0A 3CU2A 1VGAA 4JXCA 3Q2DA 2WNZA 5F4SA 1CX9A 5FEPA 4DF2A 3KVJA 2YZRA 3G1SA 5K4ZA 1EB3A 3A5FA 3LRKA 2PRMA 2JK2A 3M9YA 1UB3A 2CLMA 2X2GA 3C3NA 3FIGA 5LKYA 3KRZA 3T40A 4HPXA 1DVJA 3L67A 1QPQA 5FF2A 1FQ0A 3JS3A 1G4TA 3S1UA 3KVMA 4LY8A 5CZTA 1YDVA 1DQWA 1OK6A 1PCKA 1I2QA 2A0NA 4K6AA 3BV4A 5LNVA 1QWGA 6ALDA 1PCWA 3A9IA 2FPYA 4HN4A 4LRTA 3V75A 4JTKA 3VFLA 3GDRA 2WSYA 4A29A 1MSSA 4J9JA 2DZWA 1XCFA 1SFJA 1S5WA 3MI3A 3P60A 4TU1A 1WQ5A 2H90A 4UTTA 5J5RA 1OFBA 2JGQA 3F4NA 3IIZA 1OFAA 3GIYA 1W3TA 3A22A 1HTIA 3G3DA 3MBFA 1TCDA 2A5HA 2PC4A 3S6DA 3UXAA 2X16A 1K02A 3MW7A 4MVAA 3BGJA 1VC4A 4YXGA 1PV8A 1XBXA 1Q3NA 3T55A 3EXTA 2ZTKA 3GLCA 3NEVA 3PSWA 1ZAIA 3KVLA 3GXTA 3DI0A 3KAOA 2GJNA 1GG1A 4LV4A 5I3HA 4PA8A 3N14A 4QM1A 5HR6A 3MWAA 5CPNA 1H1YA 3W7HA 3ZWTA 3RMJA 5D2YA 1Q6QA 2Y89A 4EF9A 5BW6A 3LRMA 1OFOA 1BWLA 1ZAHA 3M5VA 4JY9A 1W5OA 5DLCA 3M5ZA 3PBVA 1FCQA 3W1RA 3SGZA 3SSJA 4JDBA 2PRLA 3HPZA 2ZA2A 2ZZ7A 1YPIA 2C13A 5BMWA 1DJQA 4OV4A 3P7YA 4M19A 4GBUA 2RHGA 5ABTA 2Y7DA 3A5VA 3HG2A 3O1NA 2VEIA 2Z1BA 3TIMA 3BG3A 4QAIA 1T99A 4JD4A 4K7VA 1H7PA 4K8HA 4JTSA 3RK8A 1B3OA 1KV8A 3S5NA 1OJXA 1QO2A 4AWUA 3TFXA 4IQLA 2QR6A 5HINA 3PB2A 3AJXA 1FBAA 1KFKA 1EWDA 2WSRA 3P84A 3C4UA 5D2WA 5KSWA 1ICSA 1TSIA 1EP2A 2H3DA 3GK0A 5DXXA 4LT9A 4O11A 4LW7A 4AVFA 4DXVA 1S5VA 3FKKA 4S2CA 5CZJA 4FX7A 4Y8FA 3TR2A 1M7PA 2OJPA 3W74A 4JS3A 1DQXA 1HO1A 4WX2A 3W2KA 1L2UA 4TIMA 3LBMA 1SW3A 2G95A 1FWNA 4MFEA 2Y62A 1SO4A 3E02A 3HB9A 4LVBA 5I3JA 4TR9A 2Y63A 1O4UA 1ICQA 1RVGA 2C19A 3PUEA 1K8ZA 4LS2A 4O53A 3LRLA 1PVNA 3EX6A 2ZRZA 4IMGA 4X9SA 1J4EA 4JICA 4OBTA 3N73A 4O52A 5J5DA 3WJSA 3PR2A 2NUWA 1GVQA 1W8SA 3EXSA 5LGXA 3DFOA 4DELA 1YTEA 3QM3A 2E5CA 2Q3RA 1VYRA 1JRBA 1QDSA 2VEPA 4AHQA 5D30A 1QCWA 1Z48A 3LTYA 1HL2A 3BW2A 5L6UA 2OMAA 1KBIA 2QCCA 4K38A 5CPLA 3EWBX 2ZRYA 4AWTA 4LWWA 5C55A 3N9SA 5HJLA 4QIUA 1LTDA 1Q45A 2J9YA 3B0UX 1H7NA 4BF9A 4MPQA 3NQVA 3S1XA 3USBA 1XBVA 2V2DA 1TRDA 4CNOA 5C5YA 2ISSA 5I3IA 1JCLA 3IV3A 5SWUA 3ZFHA 1JQXA 1V5XA 1F74A 3NXFA 4IXXA 4R33A 3C0JA 2HSAA 1GZGA 2TPSA 2C16A 3QMRA 5LGZA 5C2XA 2PURA 5EA9A 1D9EA 4RZ6A 3W2JA 1EWEA 1VPXA 3PM6A 3PBUA 1HFBA 4PTNA 2DJXA 3R8RA 1DV7A 3NQDA 1ONRA 4K39A 5F4XA 3DFQA 5G2WA 3S5ZA 2C6QA 1ZAJA 1WOAA 3DFNA 1LOSA 2NX9A 3TQVA 2JBMA 4MYAA 3S9YA 2ZA1A 3TJLA 1HUVA 3W7GA 3G0UA 3W1AA 1A5CA 4N2YA 3U8GA 1NAL1 3W83A 3EX4A 4O1CA 2LLEA 2A85A 2Y88A 1X8FA 4RV8A 1TTQA 1UJPA 5HQEA 4AXKA 3LI0A 1XC4A 4P61A 3QJAA 3YPIA 1XDMA 1FXQA 5LNRA 3GXNA 5DCEA 1H60A 2YPIA 2QUTA 2TRSA 3PUOA 2CLIA 4ADSA 1I4NA 1BEUA 2Y61A 4WXYA 1GVSA 2H3BA 2A6LA 1R2TA 3E96A 5F2GA 3LHTA 2CLLA 4Z1BA 5HULA 2X1UA 4LVAA 3G1FA 4WQ6A 1TV7A 3W76A 3OBKA 3A23A 3NL6A 3ATYA 3RLUA 1XBZA 3SFKA 1YDOA 2X1TA 5KMYA 4FX6M 2Q3OA 1R30A 1KFBA 1RQBA 4O12A 2ZZ2A 5GVJA 2J9XA 5CSSA 1C29A 2B7NA 3CWOX 4JIPA 4LRSA 2Y6ZA 1OF8A 1DHPA 4YWIA 5E1QA 3N2XA 4N02A 3G1HA 1VRDA 3CQ0A 3LHYA 3HPSA 4UUIA 1LOQA 4MZ1A 4TX9A 1IIGA 2ZZ4A 3HF3A 3O15A 2EGZA 4AMAA 1AK5A 5K9XA 1JUKA 3CEUA 1EEPA 4FXSA 4QISA 4DF1A 1H51A 3NPXA 1ALDA 2NXGA 2B4GA 4Q4KA 3BW3A 1JR1A 1ZNNA 4GNJA 2FIQA 1C8VA 4RXFA 2V2HA 3HGSA 2A7PA 2GQAA 3QC3A 1QNVA 4UC5A 3FJ6A 4E2DA 1JUBA 3M1ZA 2GVJA 3E12A 5AN7A 2QDHA 4JDYA 5HMSA 2HS6A 1ICPA 1GYNA 1W5MA 2B7QA 1JCNA 1IXNA 5LHEA 3BW4A 2G5WA 4UMAA 1H1ZA 4Y96A 5AHIA 4Q33A 1B4EA 4KFNA 5U7SA 2YR1A
chains in the Genus database with same CATH superfamily
3W86A 2CXEA 4I3GA 2OYMA 1VBHA 4BI6A 4HVXA 3WBYA 3THAA 3S8HA 6TIMA 2D0GA 1LM1A 3W1TA 3H70A 3W7RA 4QBXA 3WH8A 4AD4A 1EFZA 2OX1A 4NNAA 3ZM8A 1FWWA 1GOXA 1G4EA 3DOPA 4CD8A 3GBDA 3VTRA 3WLLA 3DG3A 2BXZA 1R85A 5FAJA 2Y7FA 1KBKA 2E5BA 4PUWA 4BF7A 5CSYA 4YVVA 1Q5MA 1W5QA 4JOMA 1WUFA 1QK2A 3PZIA 4IGSA 1IZKA 3VIGA 1RK6A 1Z44A 3PZOA 4XWUA 2CBUA 2D2OA 3ZOAA 2VC6A 3G22A 3LPGA 2XYLA 3QTPA 3BDKA 5E70A 4CQAA 4IPIA 3UR8A 4NUWA 3TP4A 4CCZA 4J3SA 3OYZA 5FF0A 4IISA 4N6EA 4DAFA 2J74A 3MANA 3W4RA 2CZFA 4R7WA 3P74A 1G1YA 5D2VA 2DT3A 2VDIA 3HPXA 4IJCA 1Z69A 1K7XA 3GC5A 5G4WA 2E8ZA 3P82A 1EJVC 5AYIA 2ACUA 1T8QA 1EGMA 4JY8A 1GQNA 3K8LA 1MXDA 1W2PA 2O9TA 3VCNA 1SR0A 1Y7VA 3WK3A 2X7VA 5IM51 3N2CA 4ZQMA 3WDQA 4PR4A 4PTWA 5LXXA 3RLHA 3DERA 1LT7A 1A53A 1GQJA 2EKGA 3MI2A 1NF7A 3VGDA 2JGYA 4PRRA 2BNJA 3FYYA 2XVNA 4HGXA 4H6QA 4QNEA 4PZVA 2ISWA 2W0UA 2OO0A 1C93A 5IHRA 3U6WA 2YXGA 1KFEA 1MQRA 3HBLA 4JIEA 4QE4A 3HG5A 5BRBA 3M5XA 1H63A 4XD4A 4JZ5A 3RGTA 1V0MA 4I7VA 3GXMA 3DN5A 1FH9A 1F2JA 1SZFA 5FD0A 4FHAA 5I3GA 3IIXA 2XGZA 1LDCA 1V6UA 3CT7A 1IXQA 1XGDA 3M0IA 4QE1A 5RUBA 2CITA 4IP5A 2BOGX 2OR2A 3GR8A 2VD8A 2YKKA 4PTMA 2ZYFA 3E0FA 1V0NA 1GQLA 4IL2A 1NWTA 1M9HA 3VDCA 1SUXA 2BFGA 3LLFA 2ZTJA 1TG7A 4S3KA 3NSXA 3S9ZA 1LRNA 3PZMA 4M5PA 2NQ9A 2PDKA 4ZXOA 3ZLHA 3R89A 3G77A 2FGLA 4PUEA 3IWPA 4C6CA 4G7EA 1HX0A 3L21A 4RCXA 1NWSA 3WLRA 1HGYA 1YLVA 3EBVA 3QQ0A 3DXIA 3DKJA 5FF4A 3C0SA 1MW1A 2E09A 1A3HA 1X1ZA 3NVDA 1POKA 2Q6ZA 3W7CA 5BOOA 1OZMA 3B4UA 1UHVA 1P5BA 4FNTA 4H1ZA 5IFPA 2WJFA 3UG5A 4RDVA 1UWSA 4H6RA 2HVMA 2XISA 3PF3A 3H21A 3O7UA 4CUCA 2ZXDA 1F7BA 3WX7A 1DXFA 4IT1A 3I68A 1E9ZB 3VD5A 1BSIA 1CLXA 3ANYA 2DVUA 1CGWA 1YBQB 4ZA0A 1RJPA 4AXNA 1RH9A 3G1XA 1HJSA 2GDVA 4LB3A 1KLZA 4E38A 4TVCA 1AMKA 5A1AA 3IK2A 4QEHA 3N2MA 4O4WA 4MZ8A 1Z9AA 4AMCA 2DIJA 2HMCA 4PUJA 3R2GA 2QVNA 1HIZA 4BF5A 2OYLA 3AYVA 4L65A 4RZ5A 2DSVA 1ZFJA 2I5IA 3WDIA 3BZJA 1TPVA 4LH8A 2RH9A 3ABXA 3WL0A 3F2CA 4K8EA 3VFCA 3UWZA 3OLEA 4ICCX 3LYEA 1PKLA 4IPPA 5CEWA 2TODA 5HWMA 1S5TA 2NLYA 4H6EA 3O63A 1G01A 5FJTA 2WMHA 3E3HA 1GTHA 1KFWA 1XKYA 2G37A 1T41A 2Q8ZA 1GNXA 3IAQA 4GHRA 4KS0A 4LYQA 3N19B 5CKSA 4MY8A 3L12A 2IPJA 4PUKA 4FF5A 1NOWA 4GC4A 2GSJA 2QJJA 3BAJA 1WUEA 5JMUA 2GUUA 3C0LA 3VD4A 2OVLA 3F5LA 1J0ZA 1LQ2A 2J7FA 3FXYA 3EOSA 2VEKA 3VGFA 3WCZA 9XIMA 4OE7A 5CH9A 5F1VA 5BU9A 1OHLA 3NL2A 1H41A 2EF9A 5G1MA 1ECEA 4MWAE 1S2AA 3THQA 3G0SA 1IXOA 5DN1A 3C2RA 5H2ZA 4AZBA 3RU6A 3NM3A 5M3WA 3MU7A 4GIYA 4U2ZA 1KM4A 1FWIC 1IEXA 3TN5A 4TUFA 2CZEA 2RGMA 2VTFA 5AVHA 5A8GA 4DO4A 2RGLA 3FJNA 3KL5A 4UFKA 4JTCA 4O16A 4F4RA 4GCAA 4UMBA 3UYCA 3ALFA 1BYCA 3ANUA 3UETA 3OBAA 1VCVA 2H9AB 2F2HA 2A1YA 1R9YA 1DBTA 4JTLA 3VDGA 6PTDA 3B9NA 3GU1A 1A3WA 4R34A 1NARA 1O66A 3F1QA 3ARYA 2HK1A 4Y9NA 5C0QA 3QPZA 2CLHA 1OT2A 1V7AA 5E0CA 4ZOBA 5I5RA 3ZT5A 2VFEA 2G3FA 2EQDA 1R7OA 3PPFA 3PNUA 1D3GA 1DPMA 4FF7A 4UOZA 1MEWA 3B8DA 2BY3A 3UF9A 1SFTA 3DFYA 2QUUA 3WLPA 4C6LA 2CZVA 1VEPA 4O4VA 4MSSA 2FB3A 2ZBTA 2QJMA 3RM9A 3AMKA 5AVNA 4KH2A 4G7EB 3UQNA 3TAKA 3TZNA 3QHMA 3IEBA 2WOQA 5F4WA 3W7DA 3LHUA 3EA3A 2A3AA 3S5OA 1L9WA 3SCTA 3AWNA 3SBFA 3GTNA 2D24A 2VP8A 4HA0A 3I6EA 3MSGA 4PUNA 3EDJA 4WD0A 3MBDA 4IM4A 3ARRA 1DE5A 4DI9A 2OLSA 3H2FA 1OIFA 4GY0A 3MC5A 2EHHA 3GVVA 3CXOA 3BXWA 1KM1A 4WOQA 1KXHA 1ODUA 2QKFA 5AKQA 4C5YA 2XIQA 1O5RA 4Z2GA 4AH7A 4BS0A 2WV8A 4C1NB 1FCUA 3W7EA 3SCNA 2PAJA 1KRAC 4MJMA 1XLBA 2WPGA 3TMLA 1T5AA 2ESCA 1CXFA 4RE3A 1VENA 4PMJA 2J7HA 4YTUA 4W8AA 3NYDA 1A49A 2VVSA 2V6AA 4EWJA 4DBWA 2PLCA 1Q85A 4X2RA 3WQOA 2ZX9A 2J7CA 3UR2A 3WF1A 1V3KA 1FVPA 4QTGA 3HA1A 2J7BA 4A8RA 4AG0A 4NQ1A 4PFMA 4IFKB 1W9VA 3B97A 3PWAA 4JTRA 1K03A 2D2GA 3NQGA 1HT6A 3ABQA 1K6WA 4U5KA 5EMMA 3UJRA 1J96A 3N3MA 2OQYA 2QCMA 5A69A 3HV9A 2P88A 4GQBA 2DSUA 2DZAA 4DBUA 5A6MA 3PWIA 4FPSA 1TPWA 3ARUA 1JVNA 3QH2A 2AAAA 4H00A 3CC1A 4TX6A 2AMGA 4NZFA 4PODA 3BJSA 2GQ9A 2E1DA 1L6WA 4S3DA 1DJXA 4XZNX 2FGBA 2R9RA 4JYFA 5BXSA 4LVDA 1RV8A 5I09A 4LGXA 5G4EA 1AW2A 2BX7A 4JX6A 3BL3A 1BWVA 2VR2A 2OQLA 3Q58A 1YNQA 2YX0A 3W1QA 2CEQA 3M0XA 4O1BA 3G18A 4RV3A 4DWDA 4JTIA 3MHUA 4PCPA 4WK9A 1HJXA 1OB0A 1TV4A 3ZT7A 1LLWA 5I24A 3GB6A 4QCEA 1IR1A 8TIMA 3GFYA 2YYUA 4E4PA 3PHAA 1G94A 3P6LA 4GGBA 3LNPA 1E0UA 1SO6A 3O06A 4JTGA 4Y6GA 1Q4WA 4HCLA 3NOYA 3OP2A 1QOXA 3RO6A 4IL0A 4UR7A 1H49A 3SCRA 1R2SA 1PXGA 4HU0A 1Q2RA 1YIXA 4O28A 4EAYA 1GW9A 3VDHA 1O6IA 3WH5A 3FYOA 4XZIA 3EWWA 3B8UA 3HQNA 3C52A 1KM2A 1B0IA 4WY0B 1KW1A 2QT3A 2A7RA 5CPQA 4NYYA 3QSTA 4LAKA 5E93A 1AJ2A 3MJMA 3TH6A 5LYRA 2WB5A 3DYOA 3POCA 4CCDA 1QVBA 3EYPA 1CPUA 3QY7A 4JTDA 1LL4A 1SQ7A 5GNYA 1VFUA 3G1AA 4NI3A 3CEPA 1HVQA 1I6NA 1XIMA 3O6AA 2FVLA 1GK8A 1SZEA 2CHNA 1WX0A 3TOPA 4GZEA 5KETA 3U57A 3TTQA 1W31A 1R3YA 1UP0A 4F2TA 3UWEA 4W86A 2WVSA 3RPMA 3SJNA 2W91A 3GYEA 1P7TB 2DPEA 3T44A 4ZQPA 2V3GA 3Q67A 1LCOA 2YCLB 2J77A 3PULA 3H4XA 2BXVA 1K4GA 3SEPA 4LBSA 1P43A 4WLCA 1R3VA 1D3CA 2DFAA 3LBCA 3GO2A 1E0VA 2DSZA 4ATDA 4MF4A 3PSVA 3ALGA 1EGVA 1XP3A 1BTCA 1OSEA 4DF0A 1KR1A 5DY3A 3UPBA 1E56A 3IGHX 3FVDA 2WQPA 3DBNA 3R1ZA 3OHIA 4B5SA 3T2OA 3QY8A 3B04A 1LORA 1XSKA 2W66A 5FSDC 1PJ9A 3ICJA 3GNOA 2E68A 2DW6A 4A22A 1KB3A 5A95A 3ZYZA 2QMKA 3WLNA 4GOAA 3L0KA 4V28A 1ZQ5A 1UR0A 3AIBA 2X09A 3TN6A 2NW0A 4IZGA 3E2VA 1JRCA 4Q4RA 3BO9A 4W88A 1PWLA 2J24A 3VOCA 2X30A 3PZTA 3BVJA 5XIMA 2P5NA 4FS9A 3KE0A 4H8UA 4LJ3A 2PP3A 3LQGA 3KL3A 1NY1A 4DI8A 3HOJA 1VLIA 3TNBA 1J0IA 1TCMA 4G1NA 3WUBA 3TW7A 2YBUA 4W93A 4GACA 1KM0A 1GGOA 2V30A 3WYZA 3GW3A 3WQEA 3NPVA 4PGLA 1JULA 2X7WA 2PDUA 4YYCA 5D9MA 1KFCA 2RDUA 1VJIA 1W3LA 4EIVA 2E6FA 4AD3A 3RLVA 1JZ7A 4MTVA 4V1XA 4YTQA 2DZUA 4H04A 3LX9A 3E0IA 2V5JA 3SJ3A 4NJKA 2YCIX 5C6MA 5AC6A 3GAYA 2C14A 1J5TA 1UR9A 3N18A 3ITGA 3W2MA 1AG1O 4NJHA 4QS6A 3RCNA 3MCNA 4NXSA 3ZJ6A 5HDRA 2R1LA 4K8GA 4CD6A 1PUDA 2R91A 2GQ3A 3UR5A 1ZPTA 4DXKA 3WLIA 3CHVA 1XDJA 4NL1A 1J0KA 1TRIA 3R0UA 1RVKA 1YTDA 4QRNA 4YL2A 1QHPA 1U5HA 4GCXA 4OBSA 1SJDA 3C3UA 2GL5A 1MW0A 1S2UA 3LV5A 4LBRA 3L0NA 5D02A 1DOSA 3VYLA 4BI7A 1XRSA 1MZRA 2YGYA 1NDYA 3EX1A 3AWOA 5JXQA 1PDZA 1SJAA 3H7RA 2V5BA 5DMYA 3B8IA 2ZDRA 4MB1A 1V3LA 4DVOA 1HKIA 3L4XA 2XN0A 3MWCA 3VD9A 3LK6A 2UWFA 5HUPA 4ICMA 3WNNA 4XKYA 3BMWA 5DCBA 2VVNA 3K4DA 2X05A 4YWSA 3V1PA 1G69A 3CUHA 4NNCA 1A0DA 1W1IE 4LXFA 2PP0A 4QJ1A 2PZ0A 1OD8A 4LB4A 4GO8A 1C91A 1GEHA 4J3ZA 4GYFA 1BHGA 2AMXA 3W2LA 5FEWA 3VE7A 1YRRA 3VILA 5BOFA 2CXGA 4M1BA 4H8HA 4GBDA 4AISA 1TKKA 5AHEA 4HPJA 2VENA 4AIOA 1L6FA 2PWVA 3V0UA 3WNPA 4EXQA 3M41A 5FESA 4P8XA 2VZSA 3W02A 4K2SA 5K4XA 3KS6A 3LGEA 2GQ8A 3GTHA 1HKJA 4QG6A 3FA5A 2W92A 5EMUA 6XIAA 1OFRA 1WYIA 5F2LA 3B3DA 1AD1A 2XWEA 3H6OA 3DG7A 3SQSA 4NJJA 3W7OA 1ZUAX 3WNKA 3K30A 2A3CA 4OGZA 5A5WA 2JIEA 1EQCA 5JBEA 1M3UA 3LHVA 4Z1CA 4GJJA 4W7VA 2C0AA 1KV5A 1EJSC 1Y5XA 1K7EA 1I0DA 3OVRA 4NF7A 4AVNA 2NLIA 1R47A 1DWFM 3CMGA 3RN6A 1RY0A 2V81A 5LNSA 1IV8A 3O6DA 3NUKA 4FNSA 4L4OA 2O55A 1RLCL 4DUWA 4AIUA 1US3A 5A8MA 5HWJA 4JTTA 3URNA 1E72M 4GINA 3FGCB 3P67A 3KDOA 3W72A 1UR8A 4C6DA 5LIXX 1EP3A 2GUYA 3R12A 2HPIA 2P0IA 2IW0A 3M6DA 3WLJA 4FNPA 3W22A 4LAOA 1K8YA 2JEQA 3N04A 3W81A 3F4CA 3HO8A 2D69A 1WA3A 3FCPA 1OZQA 3N25A 3BUVA 2J8FA 3IJIA 4K3ZA 2DZXA 3OLGA 4DM2A 5ABHA 4FX8A 3CQKA 1TV8A 1TV3A 3DHDA 2NUXA 4XD6A 1AJZA 2NQHA 4H7VA 1N82A 5DY2A 3QTGA 4Y2WA 5G2HA 4Z1AA 3TXZA 3QV8A 2UY5A 1JCXA 4QDPA 2FDSA 2ZUSA 4KW2A 1I9CB 1FDYA 2WLZA 2VRQA 1K8CA 5C7VA 3QC0A 3THCA 1ADDA 5U4NA 1UYQA 5IDIA 4GFSA 2F6KA 3EAUA 1SM9A 5DRIA 1XH1A 2D2HA 1QOPA 4XO6A 2GWNA 2V68A 1VFOA 3RDKA 2QJHA 4RDZA 4AIEA 3KTXA 1A5KC 1NDZA 3K46A 2C1HA 4A3QA 4BA0A 4JFVA 5A6BA 2CC0A 2GDUA 2P8BA 2PDNA 1YPFA 2F9RA 3O07A 3M0MA 1WOBA 4L6DA 4XBJA 4MUZA 1VZWA 4R5EA 2VDGA 2EKCA 4QDWA 4ADTA 4O1FA 3PBYA 1OBAA 4Q22A 1HGWA 3BAWA 4P7OA 2UY3A 3ZR5A 4P8VA 2IXVA 1XIEA 4MOZA 2QF8A 1HP4A 3MI6A 5LIYX 3AS1A 1F6KA 2NSXA 2CESA 4HZ8A 4JTFA 1BTMA 1E5JA 1GJUA 3E0WA 4AY1A 1RPXA 3U48A 1QNPA 1IQ8A 1JDDA 2XN2A 3RX4A 1W1VA 3LZ3A 4DPPA 3DX5A 5C9WA 3LHWA 4H8NA 3FYPA 1ZBKA 5BXRA 2Q8XA 3U2ZA 1VGAA 3NCOA 3Q2DA 3CO8A 5F4SA 7ENLA 1CX9A 2W62A 3KVJA 3WELA 1AQ0A 1KGXA 3G1SA 1HN1A 4I5UA 1EJXC 4F66A 1XX1A 3FIGA 1U5VA 4B4FA 4Z17A 1HP5A 3DGBA 1XLMA 3L67A 4H9TA 4F2BA 1TR9A 1CGVA 1H0IA 3S1UA 4V15A 5CZTA 4Q4SA 1OK6A 4CN1A 4LUTA 4AD2A 2R1NA 3M64A 3SRFA 3WMCA 3LZ5A 4JTKA 5D9NA 2IXUA 1PX3A 2YCJA 2ZICA 4DWSC 5A8OA 3WD4A 2VCCA 3AHYA 2DZWA 1SFJA 3APGA 3N13A 1DWAM 3GS6A 1UZ4A 3F4NA 2VX7A 1QNSA 1HJWA 4IQDA 3A22A 1ISWA 4H01A 3MBFA 4AEEA 2PC4A 3S6DA 4ZSTA 1VC4A 3AHXA 3T55A 3EXTA 3T2QA 4YN5A 4IGNA 3PJTA 4P5UA 3R8HA 3RAOA 3TN4A 4Q7NA 3BURA 1GG1A 3BJFA 3OZYA 3EA1A 3MWAA 2EPKX 4XIAA 3F5KA 3E5PA 2QQ6A 5FJUA 1BYDA 4FLQA 5CZKA 4WSJA 4PUDA 4BQ5A 4WKHA 1UKOA 4JY9A 5DLCA 3AROA 1UR3M 3BOFA 2PRLA 3HPZA 4AZCB 2QZRA 1PZ1A 4C6KA 1YPIA 3GHUA 1YNPA 5BMWA 1L0PA 3TQPA 4M19A 1EHNA 2WK2A 1WZKA 1JL8A 2VEIA 2OZTA 1CB7B 3O1NA 1DWHM 4AZ7A 1RA0A 2GJXA 1E71M 2AOSA 2OYKA 4M51A 1KV8A 1GOOA 3S5NA 4LUSA 1OJXA 1Q13A 1QO2A 1UD4A 2QHAA 5HINA 1OT1A 2XH7A 3P84A 7REQA 3AIEA 1MNZA 5CQ1A 3GK0A 3PPHA 4FX7A 3QY6A 4LBUA 2OJPA 4JS3A 1IE7C 1NIUA 1HO1A 3W2KA 2G95A 2V3EA 1OGGA 1AZ1A 4A8IA 2C71A 1EBGA 3AIVA 3QHNA 4GO9A 1ICQA 1RVGA 3JUGA 3PUEA 4C6MA 1K8ZA 3LRLA 4WDXA 5CC6A 3N73A 4P7QA 1W8SA 4W7UA 1UMLA 2E5CA 2VMFA 3WBWA 1BXNA 1EC8A 2Q3RA 5FAGA 2EG6A 1ECQA 2VEPA 3IS4A 5JBFA 3D5HA 1UP3A 1Z48A 4KF1A 3BW2A 2CYGA 2O92A 2QYGA 2BGQA 5ENLA 4KPLA 3AIUA 1MFVA 4K38A 2JEPA 5CPLA 2FHCA 4LWWA 2BVYA 3PP7A 4QIUA 2PPGA 4CNUA 1Q45A 4UB9A 4BF9A 3NQVA 3S1XA 3LA4A 3USBA 1M53A 3IV3A 1ITXA 5ECUA 4B90A 5C9XA 2YXXA 2XFRA 1OWQA 5LGZA 5C2XA 2WC7A 1P0DA 5BU6A 4RZ6A 3PM6A 1BGGA 4N7QA 1X6NA 3T2PA 4K39A 3N4AA 4OVXA 3VVGA 4FMVA 3FGCA 2PMQA 3U9IA 1A3XA 2AL2A 3FJ4A 3F4VA 1LOSA 5I00A 2WZHA 2AL1A 3LY0A 1LJYA 3QQWA 1HUVA 1RAKA 2DW7A 4PE8A 5T9BG 3W7GA 4RNJA 2QULA 3L4UA 1A5CA 3U8GA 4IQJA 2A85A 4RV8A 1BSLA 1VFHA 1S2TA 4K1GA 4M6UA 1XDMA 3ZT6A 2YPIA 4P8WA 2YL6A 5MKGA 1I4NA 2HBVA 1UKTA 4L5ZA 2A6LA 1JEZA 5C9ZA 2WVVA 1XH0A 3WFZA 2PODA 3W53A 1FWAC 2YIHA 1VP5A 1RALA 3TYZA 1Y8BA 4NP7A 4Q4OA 5M2FX 2AGTA 2DDXA 3CO4A 3QHOA 5A6AA 1YDOA 1CECA 4H7ZA 3WUGA 4URIA 3OLDA 4D1JA 3QKZA 4MNLA 2ZZ2A 5CSSA 1KBLA 4JIPA 2Y6ZA 2I17A 2F38A 5HA7A 5J04A 1IWAA 3HPSA 5M03A 2HBXA 2PWHA 4XG1A 2EGZA 3O3RA 1G0CA 4AZHA 1JUKA 3PBMA 4FXSA 2ZADA 1N8IA 3Q65A 5F7UA 1ALDA 2NXGA 2B4GA 4OUIA 4HA4A 4LCSA 1ZNNA 4IP4A 4DZHA 1E9IA 2FIQA 1XYMA 4RXFA 4HMDA 1WAWA 3R8GA 1XYAA 1RBLA 2REQA 3GH7A 5HNTA 2XVPA 3E12A 4QXIA 4JDYA 5HMSA 2HS6A 5JUVA 3MVTA 1W5MA 3GXFA 5XIAA 4UMAA 1V93A 3AAMA 4Q33A 3G0XA 1BXCA 1UKQA 2BGSA 3EX2A 3W2UA 3W3OA 2J27A 4QJ5B 4WSKA 1UA7A 3BSMA 2X8RA 2YFOA 1E4MM 1LT8A 2X40A 2J79A 1D8WA 3SN0A 2QDEA 3SUTA 2DIKA 4LYKA 4A4AA 1F4HA 2EO7A 3HMJG 3DYPA 1QNOA 3OOQA 4PMOA 3E0LA 3T0TA 3NO1A 1KXVA 1V3IA 3CZKA 3UJFA 2INEA 1POJA 5HMFA 2VCBA 2Z7GA 1UQYA 2FHFA 2Z1SA 3TXVA 4R53A 1ELSA 1C92A 3EWYA 1U1JA 4PC8A 4IMCA 1M7OA 3RF9A 3SY1A 1S5NA 2ZXBA 3UNTA 2G41A 1LOLA 4P7RA 3KRSA 4DWSD 1A5MC 4DNHA 2GSHA 1FFQA 3HFTA 3WIJA 4ADUA 5KZ6A 3H2OA 1S38A 3IVUA 3GG0A 2FZNA 4B5WA 4JTUA 1MW2A 5AHMA 5ABEA 4MWAD 3G6LA 4IQEA 3B8WA 1UMYA 3EB4A 3BLEA 3BLIA 4K7YA 5H8PA 5GNXA 5JIPA 3L2IA 3KZSA 2ZZ3A 3BCFA 3GNNA 4LEQA 4MJZA 1DXIA 3NG3A 2EBNA 4JCMA 4IJRA 3VA8A 3OTRA 2C1IA 3DUGA 4NJGA 4N6FA 4GVHA 4ZMGA 4XZ9A 3AALA 4KCVA 5FOOA 1J12A 4DHGA 5AC8A 4RE0A 1KCXA 4IIBA 4Z2LA 1XICA 3WLQA 1R3QA 3GSMA 4XB3A 1BVZA 1V6TA 3QYQA 3EDFA 4ZE4A 3WLMA 3H2CA 3SCOA 1R2RA 4AC1X 4MHBA 3K2GA 1MEHA 1XYLA 5CPTA 2XFWA 1A4MA 3VIJA 1PZ3A 1LBMA 3CZ8A 4GUIA 4ML9A 3WQ6A 4AWEA 4EOUA 2DSWA 4J3WA 5FI8A 2C7FA 2PLKA 3DH7A 1REQB 1CDGA 3CHCA 3CMJA 2PTZA 3GZ3A 3QXBA 3CLMA 4UFIA 3O8AA 1ZBVA 4Z2IA 3GR4A 3K1GA 3KVKA 4OWGA 1M7JA 3OJGA 2VOTA 3DFTA 3IJLA 1DORA 3LERA 2H8ZA 4FOJA 1FKWA 3B9AA 1FA2A 1X6LA 3TK7A 4MNJA 1TUXA 1QW8A 1WXYA 1G67A 1F8MA 1XLAA 4WHBA 1J0YA 4IIEA 5GJNA 4UTIA 1UWTA 1XCXA 1IGSA 3BCJA 3W37A 3L7RA 4AZ6A 1JPIA 1FWFC 2QPUA 4PUUA 3C2FA 4C6QA 4WY0F 4HA3A 3IRSA 1TWSA 3Q45A 5EL1A 2X1RA 4GYPC 5BCAA 2R14A 4GI8A 4TMBA 4TTUA 2EAWA 4RLIA 3RR1A 2DT2A 4DZAA 2E6DA 4NAEA 3EOEA 3FEQA 5T26A 2BODX 1E3XA 1EO5A 1GHRA 2I5GA 3O6CA 5EB8A 4DNMA 5TF0A 3WQCA 2GGGA 4V1YA 1HKVA 1VBGA 4LUTB 2PDMA 3WQVA 3VNLA 3CH9A 1TA3A 4IMEA 5I78A 3AS3A 3OQ8A 4LV9A 3SFWA 2OZ8A 3G1RA 3IPWA 2Z28A 2Z27A 2DZBA 5CGQA 2B81A 4S23A 3BH4A 5ABGA 5K3VA 5D2TA 2OB3A 1VHCA 1PKNA 2A21A 4IWWA 1E1CB 1JYNA 2DUZA 1VHNA 5FJJA 2C15A 2XH2A 4XD5A 3U2EA 1RXOB 1OK4A 2A4AA 4B5XA 4MUPA 1RCOB 1OYBA 3IGXA 1T96A 3G3MA 5DMMA 3WMBA 4GVIA 6ENLA 3PVFA 2J47A 1GOIA 4AEOA 4C6FA 3H55A 2NV9A 5A94A 1EP1A 4S1FA 4UWMA 3CQJA 1GKQA 1L6GA 1Z3NA 3QRHA 1L8PA 2EPOA 2P3ZA 2V63A 3VK5A 3PK7A 4GQRA 4L61A 2ZRVA 1IT8A 1H3GA 3MJYA 2QIWA 2WNWA 5CGMA 4XAYA 5EPDA 3RITA 1ISXA 3WJZA 3ITVA 4LS0A 4KETA 1EXBA 3CZEA 1GONA 2HDJA 1HW6A 3Q37A 3SZ8A 2EXOA 5AZ0A 3V5FA 1WKYA 4L1WA 3LUTA 1IEVA 3EMCA 3BAYA 3QLLA 5H8MA 2EJ1A 2TSYA 1VCGA 5DFAA 1QR7A 1PO9A 4IPNB 1TZ9A 2ZUWA 2BSLA 3PBWA 1Q65A 3RUBL 5D04C 4QS5A 1GKPA 4ACYA 4TVDA 3ZVIA 4Q4QA 4O18A 1OFEA 3W7QA 3T0BA 3E38A 3U5UA 3KCOA 4U4MA 2PBGA 2J88A 4M3PA 2OKTA 3WMSA 4AB4A 5A2BA 1JZ4A 4CQBA 4EWND 3CTTA 4M6VA 2CLEA 3W29A 5AYBA 3UD6A 3LHZA 4ICNA 1UR1A 3IACA 3R25A 3S6OA 1CXIA 4FEZA 1FP9A 5PTDA 1K3UA 3NSMA 2CETA 1WZLA 5FEZA 5FCZA 2VGBA 1BKSA 1BYAA 3TC6A 3GVGA 5HJXA 2E0PA 3UPWA 3LTPA 5ABFA 2PU0A 4MWAA 1W91A 5GQBA 3ZWSA 3GHTA 4EF8A 3W23A 1KCZA 3INPA 3H54A 1AQFA 5HANA 3G1DA 1ZALA 3LXAA 1K7FA 2PI6A 1IZCA 3N1AA 3RRXA 3LU2A 4CQ8A 1I60A 3C2OA 3OEXA 2WKLA 1QO5A 3UCDA 4B2DA 4Q8WA 4L80A 1LRQA 3GC2A 5FKYA 3NZRA 1V02E 3HGRA 4QE5A 1NFPA 1U83A 3KCJA 3ZMRA 2G4FA 2VC5A 1FWJC 5IHSA 3PJWA 2FJUB 5DT7A 3DKLA 1WKFA 3L68A 1ZBWA 3FN9A 4UQEA 1EPVA 2A79A 1FXPA 2CHOA 4W5UA 2JF6A 1HXJA 3MKVA 3HZ3A 3OGRA 1SFLA 4R27A 1QWKA 2POZA 3HPFA 1CLKA 3UA4A 3DFSA 3UCCA 3V36A 3SO7A 1EPXA 3LDVA 1YXCA 3WQDA 3R5EA 2XN1A 3ARWA 1E6XM 4WSHA 4GRSA 4AVOA 4U28A 2F2KA 4DBDA 4DJFA 4XD3A 1V79A 4X63A 3A24A 1OG6A 1W1B1 3QMSA 2PWDA 1LUCB 2VX5A 2I14A 3S0CA 3LPPA 2QAPA 1SFSA 3MA8A 1EUNA 3MPGA 1VF8A 1XBYA 2OG9A 4JQ3A 1KA9F 4REQB 5EY5A 5BXPA 3WH7A 3VOHA 2QF7A 4XZHA 4XIMA 2HRWA 2XIJA 3AYSA 2W67A 3MUCA 1XD0A 3HJZA 3OQEA 2AGKA 2NVCA 4JEQA 1GQIA 3IIOA 5DT5A 5DBTA 3CGTA 1GVIA 4OQVA 4ZB2A 1W9XA 5D38A 3CAWA 4HBKA 1SR9A 2POTA 3ARZA 4LPCA 1PDYA 4HK6A 2RDWA 5AHNA 1O7AA 2W6RA 1BKHA 3TROA 4HSHA 3K1DA 5D32A 1W3IA 1FWSA 2AQOA 4F9DA 4FALA 2RJHA 3GVWA 1MMFA 2C1GA 2PWGA 3I10A 1FTXA 2R8WA 3FEMA 3GVQA 5FL1A 2DUAA 1QI4A 5G5IA 1MXSA 1W1YA 4C65A 1US0A 1VIZA 4O50A 2QUNA 3HN3A 2NX3A 3WDPP 2Z1VA 3I7QA 1GZ1A 1M6JA 3H8AA 1UD8A 5AHLA 3E49A 3R6IA 4O10A 4R7OA 4C6OA 5D2XA 5CBJA 2Z7KA 5FEXA 4MLJA 3RFAA 3TQKA 3HFYA 2NV2A 4DJED 1R0MA 3PS7A 2JE8A 4PMDA 2E9MA 1W17A 3P61A 1HJUA 1LROA 2GK1A 3TLQA 3UZWA 2CKRA 3S9IA 4M80A 3HGOA 4K36A 3OB8A 3WK1A 1CYGA 3VZXA 4I6KA 3EWDA 3DI1A 1PE1A 1B9ZA 3E2RA 7REQB 1LP6A 4Q8TA 4DQWA 7TAAA 3ABRA 3KCLA 2W5FA 3IGUA 1OFDA 1WXJA 3PZNA 5CZ0A 3GQYA 1GYLA 4C6NA 5FACA 3W7PA 4O54A 2QGYA 3O0FA 1KFJA 3SCPA 2PDJA 3VGHA 5E09A 3R4IA 2DVXA 2ANUA 3S4TA 2FFIA 3S47A 1MRAA 4J1OA 1U5JA 4UMCA 1TTPA 3W01A 4V2XA 2YA2A 3GBEA 1ZP3A 4I9AA 3A4WA 5DF0A 5JVLA 4MG4A 3MMTA 1TJ0A 5H1WA 3C0QA 2YSWA 1YADA 2NT0A 4BWLC 3UG4A 2D1ZA 4ZO9A 5FF3A 3AXMA 3NO5A 3PUDA 4IPJA 4JL1A 3F4DA 1TPUA 1JFXA 4MADA 3AHTA 3NM1A 3B8TA 1NFGA 2G97A 2I7GA 1XLEA 1KQYA 4FIRA 4OT7A 5I02A 2RDTA 3OBEA 1I45A 4C6PA 3G6MA 3VKJA 1QU4A 3AMDA 2DP3A 3OW1A 4XQ6A 4HJWA 4N9DA 4ORIA 2FZBA 1VR6A 1GZJA 1XF0A 2FJKA 3APYA 2GJRA 2A3HA 2YW4A 4XAFA 4JAWA 1VYPX 1ZZMA 3AHVA 3IANA 3LGDA 1WV2A 2OEMA 2OLHA 4FR1A 4HOXA 3IARA 4L9XA 1YYAA 3PC0A 3U0HA 2YLLA 4E8DA 3JRKA 2CLKA 3GNPA 1B57A 4LNCA 2E28A 2XU2A 5C7HA 1Q2SA 3CPRA 3CHDA 4J40A 3H53A 4ORMA 2VFHA 3EWZA 4MNKA 4KEMA 3ZSSA 3BGAA 4QNWA 2A7NA 3LNMA 2JQXA 3AIWA 4HZMA 4W8BA 4QG9A 2E67A 1T6MA 3SRKA 3SN1A 4C91A 3VMOA 3L66A 2SFPA 1UBPC 5HOSA 4PCNA 2EPNA 2IQ0A 3UXIA 4JNMA 4GLEA 2YBVA 1KWGA 4P2VA 3VC5A 2YZ5A 4WY0A 1Q6LA 4W9TA 4NYUA 1V6XA 1QAPA 3V18A 3OVQA 1MO0A 3WK2A 3QGVA 3MP4A 3PTMA 4F2UA 1P0KA 5B80A 4CGTA 4M7SA 2Z25A 3AQUA 4W89A 1AQHA 4Y90A 4F8XA 3TFCA 1DQUA 1R6WA 1OFQA 3EKGA 1J18A 3WJWA 3P0XA 1EQPA 4OV9A 2YL5A 1GHSA 3T07A 4GC3A 1RY8A 2J13A 2ATSA 1VAHA 2BB0A 3AZTA 1SZRA 2O7QA 2WAGA 4Q8QA 1UASA 4DYEA 1MEIA 2OELA 2PGFA 2VZUA 1CT5A 4I9JA 3OA5A 4C60A 1E0XA 1TJPA 4RK8A 4FLSA 1BLIA 1JFHA 3UWUA 4OBRA 5CJMA 3N6QA 4CNNA 3TV8A 3S5YA 4IIHA 4JNZA 4Q8NA 1UD2A 4FA3A 3TTEA 1I0BA 3N11A 3ONBA 3KLLA 1TMHA 1VKFA 4X0VA 3S2LA 2X0HA 4LC8A 1XL9A 1P4CA 1YE6A 3W1LA 3V16A 1IEIA 1ZJAA 3ZXWA 1VD6A 4KRUA 4GUHA 1WDSA 1QNQA 2VDHA 1UP2A 4RJEA 3LMZA 4AF0B 1E3ZA 1BG9A 2I57A 4JIHA 4XTIA 3EA2A 3CBWA 2PDWA 4FSAA 2E1WA 7CGTA 3FJLA 1JPMA 4NT0A 1CXEA 5A6TC 2QMJA 2W3ZA 4REQA 2G3MA 4KCUA 4XK2A 3QF0A 1RJRA 3AMGA 3W07A 1SJCA 4HHPA 1XLFA 3A64A 5HUOA 3K5XA 4D2JA 1LUCA 1V6VA 3U7BA 2QJGA 4PTDA 3NOEA 2E9BA 1QMLA 2Z2AA 4OOUA 1DJNA 4O13A 5LA1A 1X1OA 2GJXB 4QLLA 5EYWA 4DBSA 3SRHA 4DWSA 3CASA 1ESWA 3B06A 3D47A 3AHZA 4HYRA 4JTQA 5K2ZA 4ZB0A 1L8NA 2PC8A 4ZTYA 1TE6A 4YHEA 1AMYA 2VGFA 5I2UA 1DJWA 3K8MA 2VI0A 1GWJA 4GUGA 2EPHA 3GY1A 2C91A 3A47A 2NWSA 4D6CA 1E9LA 2BBFA 3LCHA 1EH9A 3TW9A 3TEVA 3DEQA 1AVAA 1J5SA 2H8XA 1RUSA 1FH7A 3WLHA 2B7PA 4MB3A 3RXZA 5D9OA 3ARSA 4Q8PA 2XH0A 4O1DA 3DU0A 2QNEA 4RL3A 5A2AA 4ATWA 4AYGA 4JQ2A 3SIMA 2QDDA 3BOXA 4OU1A 2VJXA 2I9EA 3I6RA 2X0SA 4RNHA 3UWYA 4A35A 2IKHA 1QPNA 3S2CA 1QOQA 2VYOA 3REQA 3KBJA 1JPHA 3BMXA 4C5ZA 3MUIA 2WZMA 2Y8KA 1TWZA 4IUOA 3FY1A 4O8RA 1V0KA 3WQGA 1JDAA 1QPKA 1U1UA 1OX5A 1AW5A 4FP1A 3TUUA 2VR5A 4CCCA 1T8XA 3R13A 2ZA3A 3DFPA 2OKOA 1CB2A 3W7IA 3JZUA 3TE9A 3EOLA 5M5DA 4WOZA 2CU0A 2RAGA 3H24A 1UKSA 1UROA 1B3YA 1FWHC 5IRPA 3L4ZA 1O68A 5LHFA 4KCTA 3N4EA 4C1LA 4ZXLA 3KOFA 1KD0A 2Z1XA 1Q6CA 4UTLA 1TWIA 4TQTA 2F7FA 3CUGA 4XZBA 3GR7A 5AZ1A 3M7WA 4IXHA 3B8VA 1L6YA 1EYWA 3ABSA 1B9BA 1EZ2A 3QGKC 4QITA 3TLLA 5TIMA 1JPDX 2WSKA 1VJSA 1M04A 4KEZA 1O12A 3VIFA 3G1VA 3UY8A 3TX9A 1JDCA 1A5SA 1HZYA 4S3GA 4L6HA 1R3SA 1UBSA 3QSRA 4YMZA 4DN1A 3GHRA 5KZEA 2XFFA 3EKLA 1GORA 1TZ7A 3C2VA 4UTMA 4HHMA 2CW6A 2VEFA 1V7YA 5FA5A 1CW2A 2IPWA 2FDMA 1WO2A 3T8QA 4US6A 4H8VA 1IR2A 5G4HC 1JZ6A 1BRLB 3L23A 3FKRA 2WHKA 3W6LA 1XFBA 1Q6FA 4O15A 1EJ7L 3FOKA 3ZLGA 1MFUA 3TNOA 4CU6A 4FNQA 4L4PA 4H9YA 4X0NA 4Z08A 5HQLA 4HNTA 1UIPA 1P0EA 2BHYA 3C8NA 4D8AA 4JTJA 3GDMA 5EBUA 5D37A 1SZGA 2V69A 4GVGA 2VFGA 3ZIZA 1KM5A 3QFEA 4AD1A 5I77A 1M68A 1NJJA 4LFYA 1F76A 4PB5A 4GX8A 4XKMA 1Y5WA 4YTTA 4E8GA 1ZENA 4YYFA 5BNKA 1R5YA 5I3KA 2OODA 3GAKA 1LZOA 4KRTA 2F6XA 3L9CA 1DIEA 2GZXA 3MP5A 3TOYA 3ZVHA 1R3WA 3VI2A 2P0OA 2FH8A 3T1GA 3JR2A 1V4YA 3IUHA 1UWAA 4DX3A 6REQA 1OG0A 4WVXA 3VC6A 4TV5A 1MQPA 3D46A 1KTNA 2O56A 2ZE3A 4OUEA 4B5UA 4DJDA 1FHVA 3KBWA 4H9XA 2I9UA 1V6YA 1UWQA 3U5YA 3E1F1 2YZRA 2ON3A 4XAGA 5K4ZA 3ISIX 2V67A 2WW5A 1EB3A 4AQLA 8A3HA 2PRMA 3TTOA 2CLMA 4M0XA 3NFUA 2ZWYA 3DFHA 2OTDA 4HPXA 4U5IA 1FHDA 1DVJA 1XLDA 1J6OA 4KT2A 3EB3A 3JS3A 1U30A 2ISDA 4J4KA 1EIBA 4LY8A 3P93A 1YDVA 2BVTA 4D6DA 3GVRA 4JN7A 2YA0A 3UJ2A 4GYPA 5LNVA 1QWGA 1PCWA 3A9IA 4LRTA 2ODOA 3VNJA 2OEKA 4Z1YA 1K9EA 2WSYA 4A29A 3M4HA 4HMNA 1KWKA 4ACZA 3MI3A 3MZNA 4UOQA 3T0DA 4A8LA 4UTTA 2GWGA 5J5RA 3ID7A 4CU7A 3IIZA 1OFAA 3G3DA 4OOZA 1NOUA 1TCDA 2YDQA 1TFVA 3MW7A 4MVAA 1XS2A 4IG2B 1TELA 3TYCA 1Q3NA 2ZTKA 2J7GA 3GLCA 3F7JA 3CV7A 1ZAIA 3KVLA 1A4LA 2GJNA 4LV4A 2ACRA 1Q6EA 4QM1A 2VR4A 1UPPA 3W7HA 3CAQA 4AY8A 2WMIB 3RMJA 2WBGA 1Q6QA 3LPOA 4EF9A 5BW6A 3LRMA 1OFOA 1ZAHA 3UJSA 1W5OA 2D3LA 4NZ5A 3VKKA 2J8TA 3PBVA 3W1RA 3GUGA 4JDBA 4BQ4A 3EWCA 6REQB 3QV6A 2ZA2A 3VZZA 3NGFA 3AC0A 3P7YA 4GBUA 5ABTA 2Y7DA 3A5VA 3HG2A 3TIMA 2Z1BA 4QAIA 4XZLX 2OZ3A 1TX0A 5J8LA 2FZ9A 4JTSA 4MDPA 2HCVA 4H2CA 3RK8A 1RBAA 4JHZA 4W5ZA 4KMQA 3TC3A 3VOFA 1VEOA 3TFXA 4AWUA 4IQLA 3U4AA 1EWDA 2WSRA 3GTFA 4QX4A 1EP2A 5DXXA 4LT9A 1VBUA 1VFSA 4BCEA 4TIMA 3V0TA 1QI2A 1TVLA 3V3WA 1FWNA 3UXLA 4EPKA 2Y62A 2QGHA 3B40A 4QCFA 2Y63A 2C19A 1CXKA 4LS2A 4O53A 4D6JA 2Y5SA 3PZQA 4BQ3A 3SRDA 4PN2A 4JICA 4CD5A 2ZDSA 3T08A 1RSCA 3EXSA 5LGXA 1BRLA 1B3WA 3CLWA 4GY7A 4DELA 5FJRA 1L2QA 1PIGA 2OGYA 1JRBA 3AYTA 4WDTA 5D30A 1QBAA 3WSUA 3VD7A 2DEPA 5L6UA 2EG8A 4MNMA 4AC7C 1KBIA 3ZQ9A 5LIKX 3PFRA 3EWBX 3SCWA 5C55A 5T9CE 4IFKA 3KP0A 4DUOA 1ISYA 1LTDA 2YCKX 2J9YA 4HN8A 4TTGA 3JU2A 2VZOA 2V2DA 1TRDA 5C5YA 3WBAA 5I3IA 1JCLA 3WZ0E 5SWUA 3IJDA 1V5XA 1XC6A 1F3XA 3C0JA 1WZAA 2HSAA 2NQJA 4NZ1A 3QMRA 2GGJA 4K68A 5EA9A 3W2JA 3PBUA 4MAVA 3R8RA 3DFQA 3S5ZA 4PMUA 1UOZA 3MMUA 5B7YA 1WOAA 3FVMA 4C1NA 3AICA 4B9YA 4J7RA 2PP1A 1IYXA 1NAL1 5DX7A 3EX4A 3UGRA 3VD3A 2Y88A 1X8FA 5HQEA 3DHUA 3LI0A 2G8ZA 3KW3A 3N2TA 5DCEA 2QUTA 3PUOA 2ZUTA 4ZO8A 2CLIA 4ADSA 1EX1A 2Y61A 3GU2A 3UYIA 2H3BA 5F2GA 2ZXQA 4W87A 1W1A1 3V1HA 3EGJA 1TV7A 1B3XA 1DJZA 3W76A 3A23A 2WM1A 3ATYA 3RLUA 3BSHA 1R30A 3SAZA 2HISA 3TYBA 4J3VA 4PBEA 3EOOA 4HU4A 1WDPA 1RP8A 4I5XA 2B7NA 1KGWA 1UQZA 1OF8A 4IH3A 1DHPA 4L56A 3BANA 1EGZA 1P7TA 4M29A 4N02A 5AY7A 3AXKA 1BD0A 3A3WA 3F5JA 1ZJHA 1LOQA 4TX9A 3TYAA 2ZZ4A 1KXTA 4JKMA 1RCQA 1AK5A 3GXDA 3CEUA 1EEPA 4RUBA 1XPYA 3LSCA 1BPLB 3BW3A 4E5TA 1FHUA 1Q8JA 4ERAA 3QC3A 4UC5A 3KUMA 3FJ6A 2GVJA 4UR9A 5AN7A 1M01A 2QDHA 4FLRA 1GYNA 2B7QA 2PWFA 2VZTA 4MMWA 4GISA 5A8NA 2AKZA 3BW4A 3L4VA 4G56A 4WDUA 2FZDA 1O60A 3TU9A 1TJ1A 5GNZA 3LI1A 1AA1B 3BLKA 3R94A 2ADAA 1AQMA 3IRDA 3ZJKA 4JIIX 4GXWA 4UZUA 3LPFA 4INFA 2VZVA 4DLFA 3W82A 4NHVA 1JNEA 2ZQ0A 5TD4A 4IX2A 4FB7A 2E6YA 4WJ8A 3GNRA 2B31A 2GVGA 3OHMB 3T78A 1DXEA 3VGBA 2GLKA 4HNVA 3HTWA 5CCZA 4HB7A 1P0NA 1CTNA 1LQ0A 4H6KA 4MKVA 3P8JA 4B91A 2ZIDA 2JFEX 3VIHA 2DIEA 3WLSA 1PS9A 4WDWA 1HG3A 1O5KA 3NR0A 2HJPA 1UIOA 1UR2A 4GIRA 3W26A 1PAMA 5B7ZA 4Q3MA 2PTYA 1Q8AA 1YE4A 3EWUA 3NQEA 2J78A 3B9DA 1YMYA 3HG3A 1VLWA 4F0SA 2J9ZA 4X9YA 3RPTA 3PAJA 2VQUA 3SCUA 1XQKA 1M41A 1PTAA 3MYPA 1E6ZA 4S2BA 2DZTA 1X1NA 2ZUNA 1RR2A 3AXHA 3ITYA 4AX7A 4EVZA 1AFSA 1RD5A 1FWGC 4S38A 2FTWA 3MHFA 2VFFA 1XHGA 1S3HA 1LWJA 1E5NA 3UEQA 3UXKA 4LAMA 5ECVA 3TJ4A 3UFYA 1IGWA 4AHOA 1UG6A 3QZEA 1EDQA 1B4KA 3VXGA 1KRBC 3V5CA 5CPMA 2CLOA 3W84A 2YA1A 2WNNA 3JZEA 3B9OA 5K9DA 3R43A 3TSBA 2JKPA 2JALA 1KTCA 1OX4A 2XSAA 4A6GA 2VL4A 2FYMA 4ZO6A 2PD9A 4DAIA 3NQ6A 4UQ9A 4QSHA 2DU2A 2NXIA 1PZ2A 3B0VC 1MVYA 3OG3A 1YTKA 4J28A 2E6AA 3U3HA 3N34A 4GFIA 1H0GA 1LLOA 1H5VA 3SY5A 4V27A 2HE8A 1LG2A 1EYEA 3IVSA 4LUJA 3CTLA 5G2IA 4JQ1A 1SSGA 4Y7EA 3IK4A 2G3NA 3OIHA 1UKPA 2D3NA 1K9TA 3E74A 1H11A 1O1ZA 2HWGA 1UD3A 4TOQA 2Z2BA 4XSLA 3HGJA 4NSBA 3W87A 3V7PA 4I8YA 2DUXA 1JXKA 1S2WA 1B1YA 4O8AA 1XSIA 2J75A 4J35A 2J66A 1Q7ZA 3MVIA 4AWSA 2Z1WA 1KC7A 3D3AA 2F8QA 1E0TA 1RZMA 4FNUA 4AD5A 3CUXA 3UG8A 1OEPA 4BZYA 1PHQA 4A21A 3WD0A 3WH9A 4PYSA 1THFD 1RD6A 1GW1A 3SM0A 1M5WA 3AUOA 4X3ZA 2IKGA 3B4YA 4TV6A 1HJQA 4JFUA 3QPYA 1J8VA 2JKAA 4AFYA 1US2A 5D8ZA 4XO7A 3WK0A 3UWVA 3S6TA 2C8NA 3M44A 1KBBA 3VX0A 3WF0A 3K8KA 1EO7A 4GZIA 5MKGB 1FCBA 4UTUA 2Y5EA 1XQLA 4JFTA 3VE9A 1XRTA 3ES8A 2C3ZA 1UZHA 3TZFA 1SW7A 2J6XA 4Z1DA 3NQMA 4RR4A 5KZMA 4AAJA 4QQUA 3VNKA 2CERA 3FSTA 4XUGA 3ARXA 1UUQA 4ZL1A 5LA0A 4HQVA 2WXDM 1EJTC 2DORA 1C7TA 2AL2B 3WD1A 1J0HA 2XPKA 2J7EA 5CJ5A 4ZOCA 3NQ7A 4LUYA 3L5AA 2ZX6A 1LWHA 4WZHA 1LG1A 4HTYA 3MSRA 2YYTA 3WL1A 1I2PA 3G24A 1ENUA 1V3JA 3LLXA 3QGAC 2P8CA 3AO0A 2GPTA 2NQ5A 2R1KA 4Q7BA 1ZCCA 2DVTA 2CIPA 3PANA 3I4KA 2DH3A 1SPQA 1Q7QA 2DV0A 3L65A 2FZ8A 4E8CA 1E55A 2V9DA 4X22A 3C5QA 3CAVA 4BI5A 3PJXA 1QBBA 1KFLA 4IMDA 1EZWA 2P1FA 3SW6A 1DIKA 3CUIA 4FNRA 3SECA 2WANA 2ICSA 1MW3A 3BJTA 4GUJA 1TIMA 2GK1B 3P3BA 2FGZA 1RP9A 5DMNA 3VDAA 3WF2A 1PIFA 2WM0A 2INZA 3PZ9A 4N9CA 5DELA 3S83A 3L4TA 5C71A 3PZUA 1DJHA 3CWNA 2PDFA 2QUVA 5BRPA 5CBIA 4J27A 3W7NA 2XTKA 1PB0A 3UW6A 2NXHA 2ACQA 4MIMA 4IHCA 3RX2A 4CVUA 3LGGA 4B15A 4MDOA 1E1CA 1B5TA 3WNOA 4IP7A 3SQMA 2MANA 4RPPA 1E51A 4UIOA 4JEJA 3BOLA 4F40A 4ZTXA 1U1HA 2PDLA 4J3UA 4LF1A 1BF6A 1SMDA 5H91A 4I6VA 1DJYA 4MM1A 2A2IA 4DJDD 3I7RA 3W6MA 2WMFA 1HL9A 1YW1A 3D0CA 4ZOAA 2H6RA 4BK9A 1MUCA 3IJ6A 1NELA 2HROA 2XVKA 5D03A 1TA3B 2PDQA 2NVAA 2BXYA 1LLZA 3DYMA 4GI4A 4C6JA 3WNMA 1TR1A 3WKZA 3V5OA 3AOFA 1GJPA 3TW6A 2FVKA 4FOUA 5HPOA 3M43A 1JXJA 1GQKA 1TJ2A 3E0VA 3E2SA 3ZR4A 1C8YA 1V3MA 4UNIA 5A8QA 3MUZ1 4HT3A 1AW1A 3G8EA 3G1YA 2IKJA 2P53A 1AL8A 3A4XA 3LCFA 1F4AA 5LSMA 4M82A 1V6WA 4PMQA 3CAKA 4C1KA 1P48A 3WQ4A 2Q09A 2BHZA 2D2JA 3O2LA 1K1DA 5AB3A 1HQTA 1QATA 3RPDA 3BAIA 3VCRA 1AUSL 4UFHA 3QBUA 1CIUA 1A5AA 2FKPA 3IJ8A 5F2MA 3UVIA 9XIAA 2QCHA 3NURA 4F9JA 3PZGA 3EOUA 4B3ZA 1R86A 4WEVX 2A3EA 3M47A 5DEZA 1NWUA 3DG6A 1JDEA 1FWCC 4ZQRA 3BARA 4YVPA 5LIUX 3UU0A 3CH0A 1ZHAA 3UZXA 1SJBA 2I56A 4EP8C 2ACSA 4NI8A 4O57A 1DIDA 4CVWA 4GZ7A 5CC3A 3TMQA 1W1TA 3W9ZA 3USZA 4LCRA 4YIWA 3ATZA 2TAAA 4KFPA 1XCWA 4FXJA 4WJEA 1CENA 4GI9A 3HG4A 3H23A 5REQB 1EDGA 4MJ4A 5F1UA 1NM9A 5BXTA 1PIIA 4GWEA 4Q8VA 1IXPA 1GOKA 3BK0A 4ASTA 4UBPC 4XBSA 2XINA 2ZZ5A 3T7VA 1X96A 4Z42C 3BAXA 4N9EA 2EJAA 5EU9A 2O7SA 3FA4A 2AKMA 1GOQA 2J62A 2VOMA 3OVPA 4P8UA 3BICA 3NGJA 4QJ3B 4GVFA 3M0VA 4DLMA 3NSNA 4UTWA 2G50A 3RHGA 2OWCA 4EACA 1J01A 4B3KA 2Y4SA 4ZCWA 3W7KA 5I07A 1OC5A 3VMNA 1MDLA 4ZOEA 1RPKA 1DWIM 3TSMA 4Y8EA 2GUBA 3ZLFA 3IAPA 3W1NA 2E77A 4AZIA 2PSNA 3TA6A 1M65A 3M16A 1GVOA 4PSPA 2XSBA 3LCXA 5CXPA 5AOUA 3B0YA 2OQHA 1JNDA 4US5D 2R82A 3LTSA 1UUMA 1XI3A 1KGUA 3WUEA 5E9AA 3UY7A 1BYBA 3CK5A 2WSQA 4R9OA 3BAKA 4N4PA 1OCQA 4U2YA 2G0WA 3FS2A 3SUUA 1R8LA 2PDIA 1EIXA 2ZRWA 4R88A 3QLDA 3T05A 3VZYA 1KM6A 5GJPA 4KWOA 2FB2A 3SIZA 3PTDA 1OCJA 1TTJA 3LV6A 3VNMA 2CBJA 2WHLA 3W00A 4RNFA 1XFCA 4GQQA 2OCZA 2PDCA 2PUZA 3I65A 2NQLA 3VIKA 1TO3A 1SO3A 2QIIA 5TQLA 3ZO9A 3H2MA 3RM8A 3RG6A 4F79A 1KQZA 1TWWA 1T0OA 1ODZA 4GE8A 1A0CA 1XYCA 1OGSA 3TWAA 2C79A 1E4NA 1OVDA 3MHGA 2REQB 4JHMA 4HHLA 4BEUA 4KEVA 4KWWA 5KZDA 3L0GA 4LVFA 4UXDA 3M0KA 3V0SA 3IVTA 2X41A 1BQCA 3CYJA 4QSFA 2HVOA 1W8GA 3NL3A 3SB0A 4S3FA 4NILA 3NYZA 3N12A 1XDLA 1ITCA 5IBXA 4TO8A 4D1IA 1W9UA 1K4HA 3P5ZA 3KOYA 1BQGA 1ZS2A 1DJIA 3U2OA 5I3FA 3QZ6A 5FSEC 3NVTA 1J11A 5A6BD 2AAMA 2ABAA 4GH3A 4BEQA 2WC3A 2QV5A 3FHQA 3M0ZA 3BMVA 2HEJA 4GNKB 4KESA 3GE7A 3S1VA 3GDTA 2P10A 1N7KA 3PB0A 3SGUA 3WENA 4KWUA 4PL1A 4E6MA 3U4FA 1W9BM 2CLFA 5E6ZA 3EDDA 3C2EA 3GHSA 5KEZA 3EMZA 4GIAA 4XBKA 4L4MA 3CUFA 2FPVA 4YCOA 3O9NA 3QR0A 4IMFA 1JCTA 5KTLA 2OEJA 1X7IA 5AYXA 4PCFA 4AY7A 2BZNA 3WH6A 1H7OA 3U2CA 4Y9MA 4MKNA 1FKXA 4HZ7A 4GI6A 3TTYA 3LB0A 3COTA 1QPRA 3VOJA 1W3JA 2XFYA 3I3BA 1KTBA 1GPWA 1XWYA 2OU4A 4GKTA 3PPGA 5FJOA 1A5OC 1G7VA 2ZUUA 3II1A 2DQXA 4RKAA 4MLRA 4V33A 3W73A 1REQA 2B7OA 4HNNA 1RLDA 4PFHA 2E25A 4HOWA 1E6SM 2IUZA 4S3AA 3TDFA 2OT0A 3NIYA 3LCLA 1K8XA 1ADSA 1YXDA 1TPEA 1PYMA 2BVWA 4HNOA 4YU1A 3UWWA 5BWAA 3MUXA 1IWPA 3QKEA 1SYTA 4BR1A 4YTSA 6XIMA 2IPGA 2E40A 4UR8A 3GXPA 1C8XA 4IFOA 2VXNA 4ZENA 4CEUC 5K7JA 1WDRA 3ITOA 1M03A 6TAAA 2YBTA 1OABA 4HPHA 1QPOA 4N4QA 4X2PA 1XRFA 1F05A 5GPRA 3TJIA 1OCBA 5HATA 3TWBA