3BURA

Crystal structure of delta(4)-3-ketosteroid 5-beta-reductase in complex with nadp and testosterone. resolution: 1.62 a.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
325
structure length
325
Chain Sequence
b'DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2008-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3burA00
4XZNX 1YE4A 4LBRA 1RY8A 1FRBA 3BV7A 5JH2A 4ICCX 2PFHA 1EXBA 4Q3MA 4DZ5A 2PDNA 1EF3A 2IKIA 5LIKX 2PDGA 3R94A 3V36A 3R43A 4LB3A 2PDMA 3UZXA 4JQ2A 4EXAA 2HVNA 1GVEA 3LZ5A 4GQ0A 3C3UA 4PUUA 3LBOA 3GHTA 1QWKA 2PDJA 4GACA 4LBSA 3O0KA 2PF8A 4JTCA 2HVOA 3M4HA 4H7CA 4XO7A 4XVEA 2PDBA 3KRBA 4DBUA 3U2CA 3ONCA 3MB9A 4JTQA 2BGQA 1AFSA 3LUTA 3Q65A 2FZ8A 1S2CA 2PDCA 3BCJA 4JQ4A 1T40A 1S1PA 4XAPA 2IKJA 4GA8A 3R58A 3WG6A 1IEIA 1S2AA 4FALA 3CAVA 2HE5A 2BGSA 1LQAA 2INEA 4ASTA 3RX4A 2IQ0A 4JTRA 3F7JA 3GHRA 1YE6A 4PR4A 1R38A 4QXIA 1RALA 4LB4A 1YNQA 3ONBA 1S1RA 4PRTA 1K8CA 2R24A 2FZBA 5JH1A 3WBXA 4ZFCA 2IPGA 5KETA 3LEPA 2C91A 2J8TA 2INZA 3UFYA 2DUXA 3MC5A 1Z9AA 3UZWA 4OTKA 2PEVA 4QX4A 3N2TA 1EKOA 4I5XA 3WCZA 2PD9A 3DN5A 2HV5A 3EAUA 2ISFA 3CASA 4R9OA 5C7HA 3V0SA 5M2FX 2PDXA 2PDFA 4FZIA 4WEVX 5AZ1A 1RY0A 3ERPA 3UWEA 1Q13A 2ACSA 1OG6A 3GHUA 2DUZA 3V0TA 3LZ3A 1PWMA 3BUVA 1ADSA 2PZNA 1ZUAX 2IPFA 3G1RA 4JQ1A 5LIUX 1A80A 3GUGA 4F40A 2ALRA 4IGSA 1HW6A 2PDUA 4XZIA 3NTYA 1AZ1A 1Z8AA 2IPJA 4GIEA 2I16A 4PUWA 4EXBA 3D3FA 4DBWA 4HBKA 3CV6A 4WRHA 3QKZA 4DBSA 2A79A 1QRQA 4IJCA 1YNPA 2PDPA 1XGDA 4XK2A 2CLPA 1J96A 3BURA 4IJRA 5LIXX 2PDLA 3O3RA 3GHSA 2F2KA 2FGBA 3LENA 1X97A 3LQGA 2IKGA 4XZLX 4JIIX 3UGRA 5HA7A 3B3DA 1PZ0A 1Z89A 4JIHA 2FVLA 3RX2A 1X96A 1X98A 2PD5A 4MHBA 4JTAA 4WDTA 4YU1A 4FAMA 3P2VA 2PDYA 1C9WA 3R8GA 1M9HA 3EB4A 1LWIA 1PYFA 3VXGA 2IS7A 3CMFA 3H4GA 3Q67A 2ACQA 3FX4A 3LN3A 2BP1A 3LD5A 2P5NA 4GQGA 2IQDA 1UR3M 3RX3A 2IKHA 3LNMA 1MRQA 4JTDA 4XVDA 2PDQA 1IHIA 4QBXA 3COTA 5LIWX 4WDXA 4XO6A 3G5EA 3WBWA 4XZHA 2DV0A 4HMNA 4LAUA 4YS1A 2QXWA 4FA3A 1AH3A 1AZ2A 1PWLA 2I17A 4JIRA 3UZYA 3N6QA 3UZZA 2R9RA 4GABA 3WBYA 4GCAA 3CAQA 4LAZA 4XZMX 2AGTA 3R7MA 2F38A 3LQLA 3R8HA 1AH0A 1EL3A 4YVXA 1PZ1A 1ZGDA 2NVCA 2PDWA 1XJBA 2FZ9A 3DOPA 2HDJA 2HEJA 1VP5A 1HQTA 4NKCA 5DANA 2WZTA 3FJNA 4JQAA 4WDWA 4YVPA 3R6IA 3UP8A 3V35A 2WZMA 1MI3A 4G5DA 5AZ0A 2PDKA 1ZSXA 1VBJA 1AH4A 3M0IA 4YVVA 4QR6A 1US0A 4Q7BA 2PDIA 4WGHA 2VDGA 4L1XA 1ZQ5A 1XF0A 4PRRA 1Q5MA 3T42A 5HNUA 1JEZA 3H7UA 4L1WA 3CV7A 2FZDA 3EB3A 4H8NA 2PDHA 4PMJA 4AUBA 2ACRA 3S3GA 3UYIA 2ACUA 3V0UA 1Z3NA 5HNTA 4JQ3A 2NVDA 5LIYX 1SM9A 2IPWA 4WDUA 1T41A 3UG8A 4RPQA 3M64A 1MZRA 2HE8A 3H7RA
chains in the Genus database with same CATH superfamily
3SM0A 1EC8A 1SU5A 1WX0A 2QDDA 2I5GA 5G2WA 1B4KA 1KCZA 3UA3A 3TU9A 3K8KA 4DZ5A 2PDNA 3T09A 2YFNA 3I68A 1VYPX 3KVMA 1JUBA 5LIKX 4BF9A 2B0MA 3GR7A 4A05A 1XCXA 3WUGA 1EB3A 3VX1A 3WF0A 3A9BA 2O55A 3K2GA 1U30A 3QN3A 2ZA1A 1I8JA 2PS2A 2XFYA 1XYZA 3S5NA 3T08A 4HNUA 3LX9A 3A3HA 3LBOA 3OU8A 4ZQRA 4L4LA 1WZLA 3O0KA 1NOUA 2E6FA 1JNDA 1TMLA 2JK2A 1J18A 3L5MA 4OGZA 2GDUA 1WNOA 1UW9A 5DY3A 1UD5A 2V5DA 4H6RA 5A6KA 4MM1A 4HOXA 2C7FA 2WZIA 3ENLA 1SQ7A 5AVHA 3KRZA 1EHNA 2EPNA 5E0KA 3U2ZA 4TQTA 1WP6A 1V6TA 4CD7A 3AIVA 2P88A 4O28A 1DORA 4QG8A 4MYXA 1OX4B 1SSGA 1UD8A 1DJWA 5C2GA 5I02A 5CKSA 2OWCA 7CGTA 2GQ9A 2V30A 4I5UA 2AKMA 1YE6A 4J3SA 4Y6GA 4GIRA 2PLCA 2AOSA 3TC7A 2QVNA 1LOQA 1S1RA 2EG6A 2XFWA 2GWNA 3VUPA 4D2JA 1W3HA 1LLWA 1PCKA 1L6FA 3OVPA 2NWSA 4HPJA 3EOSA 4AH7A 4IQLA 2OSWA 3SCTA 1R6WA 2C0HA 4ICNA 5CZTA 5HK4A 1GOQA 1KA9F 1K7FA 3QGVA 5HATA 2CLEA 3S9YA 2GQ8A 3OZYA 4J3WA 5BYWA 1LUCB 4IF2A 1V6YA 4H3DA 4H4IA 3QBUA 3H21A 2O9RA 2ZA2A 3IANA 2PTZA 1GYMA 3ITGA 4WSHA 1VRDA 3VKKA 3ABOA 1OFPA 4ZOAA 1KXHA 2QCEA 1Y5VA 3TQ0A 4OBRA 3ZXWA 2VEKA 1AJ2A 3IIPA 2FTPA 4F0KA 1E0UA 3OVGA 4AXNA 1DWFM 1LM1A 3BQ6A 3QW3A 2ISWA 4W89A 5D04C 2CW6A 4FEZA 4PULA 3VM5A 4A35A 4UQ9A 3T0DA 5I3KA 3DFPA 1DIDA 1E0TA 1XIGA 1MRAA 3EPOA 2F9RA 4IP5A 2X05A 4FLSA 3IARA 4R7WA 2YDAA 2CZDA 3AFBA 4Y9AA 4CLMA 1R3QA 3KXQA 1FWSA 1Q2SA 1GHRA 3BGAA 2FGLA 4O10A 1R0MA 4ZBCA 2CESA 4E2DA 3VX0A 1W3NA 2QJGA 4WY0F 3CPRA 4XK2A 3W1QA 3EKLA 3AMKA 2PA6A 2OEJA 1XFCA 2C1GA 3V1HA 4HQVA 4R34A 3PTMA 1ZJAA 3NSMA 3RCYA 2BXVA 3R89A 3GZAA 5LIXX 3TYCA 1GVIA 1LLZA 4GNJA 3NZGA 4LU0A 1W2PA 2DU2A 1YLVA 3ZVIA 2G41A 4IGNA 3ITLA 1GPWA 1H63A 4LY8A 2GUYA 3LTSA 3N9KA 3BWWA 3FJLA 4JIHA 1D3HA 3GC2A 2R1PA 3VKAA 3UCDA 3TEVA 3T0TA 4NSBA 1S5NA 1O1HA 3TX9A 2WC3A 1E6NA 5I07A 4ORMA 4LVFA 5E09A 4MFEA 3T8LA 1JULA 1EGMA 5CSUA 1K8ZA 2VDIA 4ILSA 2ACQA 3NQAA 4QROA 3NQMA 4WJEA 3S1UA 6REQB 1PL9A 4J40A 4Z2LA 3BSGA 1VLWA 3WF4A 4DJEC 6ENLA 3W84A 4QQ3A 4LVDA 5IBXA 5A2CA 3GU1A 1XRVA 1YQ2A 2ISDA 5BMXA 3TH6A 1W1IE 2OGYA 3GDTA 1A5AA 4YS1A 1Q3NA 1JFHA 2J6XA 2WK2A 4C7DA 1PSCA 4FX6M 1TPWA 3NXFA 5BXPA 3KCOA 4FLRA 3WQVA 3RLGA 1YNYA 3W1NA 3ZS4A 4AD2A 2QJMA 4LEQA 4A3HA 3QGAC 3RILA 3VOJA 2Z0IA 1IT0A 1GZJA 2G3IA 1TO3A 1E43A 1T8QA 3OHMB 3A47A 3TR9A 1DHKA 1KKOA 3LCGA 3CUZA 2YOCA 3VGFA 2XVNA 3MUZ1 4Q8TA 2BVTA 4XQ6A 5DCDA 1C8VA 1UR0A 3AHTA 1SZGA 3L21A 4OZOA 3ITTA 3QR3A 5EA9A 2QT3A 3IIXA 1FY6A 3IJ8A 4LUSA 3HO8A 3FXGA 2WPGA 1BYCA 1RLCL 4M8UA 4AVNA 4JYFA 2QIWA 4WOQA 3S5SA 5L6UA 1BWVA 2PDHA 4DF0A 4C6KA 3WQCA 3N19B 2ACRA 3MMWA 2J75A 2DH2A 3S3GA 5CC3A 1O94A 4M6QA 5CZJA 1VFFA 3QGKC 4IG2B 2ZC1A 1W3JA 1EWDA 1WE5A 1DXFA 2HNHA 3KOWA 4XZNX 2NXHA 5D8ZA 1XLJA 1XG4A 3C2FA 2TAAA 3QM3A 1RH9A 4RZBA 4PYSA 4ZFMA 1XRFA 2YB4A 4K6AA 4Q8MA 5FEXA 5A6AA 1UZ1A 3RRXA 2NQ5A 4C1KA 2JKEA 3R0UA 4LXFA 5E6YA 2P76A 4BQ4A 2VP8A 3LXBA 4BJHA 1QI4A 3W7QA 2W91A 5LYRA 3VILA 1G4EA 4Z2KA 1GVOA 1CB2A 2V69A 1OVDA 1MXGA 4RJEA 4RXFA 1E3ZA 1SFLA 5A6TC 1C9DA 2GK1A 3W9ZA 4U5KA 4TU1A 4UR7A 2J79A 2Q8LA 2X7VA 3H55A 1OF6A 3P7YA 3HPAA 4E2VA 2WC4A 2OYLA 3W1PA 4A3QA 3L2MA 4W93A 1J11A 3PBUA 1A5BA 4W8LA 3LCLA 4AEFA 4UMCA 4IH3A 1VAHA 1PVNA 3W7NA 1OIFA 3II1A 1W5MA 2NX1A 2BGSA 3HQNA 3C2VA 3GUWA 1TVNA 4U33A 2ZUNA 3N3MA 4QXIA 3CL8A 4LB4A 3TTYA 3PANA 4BCEA 3PG8A 1OABA 3N25A 4N9DA 4MLRA 4YHEA 3H2AA 1K8CA 4LPCA 1XD1A 1SGJA 4KIRA 3WF2A 3FS2A 3RJYA 1L6WA 3CTTA 1EJUC 2WCAA 5AC7A 1EA0A 1ML1A 3R10A 1V93A 3GDBA 1EC7A 3C2EA 1HKVA 1OT1A 4WLCA 2FPVA 2XUCA 3HG2A 2CKSA 2XM2A 3WCZA 3DBPA 1XRSA 3MUXA 1EJWC 1KV8A 1JYNA 1W5PA 4IJBA 2IUZA 4R9OA 1R9YA 1TJPA 3WH9A 5HQLA 3USZA 3Q4DA 2NUWA 1TFVA 2D24A 4NJHA 4HPNA 3LTPA 4JTIA 1CGYA 1N8WA 2DZXA 4YNGA 3WLNA 4JS3A 3V75A 4D8ZA 4JY8A 3BDKA 1YMYA 2GUBA 4M19A 3GY1A 3VVGA 1PBGA 1JF5A 5LSMA 3TXVA 5EFDA 4Y90A 4RLIA 3IVTA 4EP8C 4FNTA 2YXGA 5HWNA 2ZICA 5E9AA 1GEQA 2DSWA 3WZ0E 1UWAA 3D3FA 2ZZ5A 1W31A 4PB3A 4LCQA 4HBKA 3CV6A 4L4PA 4WR3A 1FH8A 2A79A 3QLLA 3W24A 3QFEA 3SCUA 3D47A 5FF0A 1E71M 1FCQA 3GNOA 5AHIA 3W53A 2DT2A 4OIFA 4O0ZA 2YCLB 4UFIA 1I2QA 3WLIA 5A94A 3PAOA 4IHCA 4WKFA 2D2GA 3JW7A 3QMTA 5D9MA 3WK0A 1WQ5A 3E3HA 3NGJA 4W84A 1KCXA 5HDRA 2ZFAA 3BLKA 3E02A 3N17A 4I7UA 3LQGA 1BXNA 3L9CA 2A6LA 4Z0JA 3M6YA 2VNCA 4FNPA 1X96A 5AYYA 4MF4A 1S3HA 3NYDA 1F8IA 2J7HA 3UESA 1GKQA 1TVLA 2WCSA 5G1MA 5LHEA 4OE7A 3KHJA 4M1BA 2V5CA 3F4CA 4TTUA 4L64A 2DGAA 3AICA 3HV9A 2NQLA 3RIKA 3GC4A 2WPBA 3IUIA 2VWSA 1ZL1A 1TV5A 3UXAA 2VRKA 1NAL1 3EX1A 1SJBA 4IM4A 1F3TA 3I3EA 1V3IA 3MS8A 4H19A 2VX4A 3OVRA 1JDFA 3EWCA 3B0UX 2Y5EA 1W3TA 4FP1A 4GX8A 1IF2A 3THQA 9XIMA 2E9LA 2V2CA 1TSIA 1DXEA 1GCYA 1A3WA 4O50A 1OYCA 4E2BA 3T6CA 1TKKA 4LFYA 1X1NA 2E9MA 3CAQA 2DFAA 1UR8A 4X2PA 4CU8A 3V7PA 4AIOA 1E6QM 4G6CA 3LQLA 1Q7MA 3CUFA 4JR5A 4D6CA 4UIOA 2EPOA 3P5ZA 2PF0A 1GZ1A 4D1IA 4YCOA 1NU5A 4I5RA 1Q45A 2YZ5A 3LLDA 1KGUA 4KF1A 1NWTA 3UG4A 3M0IA 4YVVA 4E3VA 3LK6A 5FF4A 2HZGA 1XG3A 4JFSA 3C0JA 1VPXA 4HKPA 1LORA 2AQWA 5B80A 1U5JA 4P5UA 3LCHA 2YJQA 3CC1A 2YDQA 3ARYA 3GFYA 3GTFA 3SQSA 2OKTA 3THUA 2DJXA 4JNMA 4ZB2A 5XIMA 3BE7A 5LA2A 5CAKA 3TNBA 4B4HA 4B5VA 1REQA 1EOKA 1XLIA 4Q8QA 1ZJIA 4NZ3A 4LUSB 2QF7A 5FCZA 3LM3A 2CNCA 2XM1A 4AYGA 3SFWA 3H7RA 1VGAA 2GJLA 1GG0A 3W71A 4ADTA 3DFNA 3T2QA 4LUYA 1QR7A 1IZCA 2CKRA 3BV7A 4M3PA 5JH2A 2EPMX 4OKDA 5U4NA 3C86A 1EZWA 3DYMA 1WDWA 1ONWA 1EXBA 1L6YA 3MI2A 4YL2A 1KTCA 3ZVHA 3WQOA 1LF1A 2VO5A 3VOCA 5BOEA 4RR4A 3C2RA 4MJZA 4KWSA 3RXZA 4LCSA 4RDVA 3WH6A 3A23A 2A7RA 4LSBA 3W1AA 5U7SA 1OWQA 1LBFA 1UB3A 3KX6A 2P3ZA 1F4HA 3MUIA 3AUOA 5E0FA 4CNOA 1SZEA 1PS9A 4OFCA 1CNVA 3GFXA 5FACA 3QLDA 2PDJA 4GACA 3WLHA 1V08A 2YIHA 2JEQA 1W3IA 4KW2A 1UUQA 2Y8UA 3DGBA 3E74A 3HN3A 3ZIZA 1I2RA 3NQEA 3P93A 5FA5A 3CLMA 4IXXA 1KTBA 1ZRQA 3PWAA 1POJA 2BGQA 2VEFA 3LSBA 2GK1B 4MVAA 4GLEA 1OX5A 4TX9A 3WL0A 4M56A 5FJRA 3VD3A 1CXEA 1R2TA 1T40A 3FJ6A 3RLUA 1XIHA 1A5KC 2E1WA 2DSUA 1GJWA 1XBVA 1S2AA 1Z7AA 1UUOA 3WQ8A 1QO5A 2INEA 3G0UA 4UOJA 1JGIA 2Z25A 2Z4GA 5E93A 4QJ1A 4ZOEA 1UP3A 1TIMA 3G3DA 1OFBA 3EOLA 4DPPA 3U4AA 4US5A 3WK3A 5A8NA 3BARA 1IXOA 3MQTA 3PR2A 4H9UA 4U28A 4TIMA 2HNEA 4R27A 1AL7A 3SCPA 5JH1A 5ABHA 1B3ZA 4EWND 3SQMA 1XH1A 2DT1A 1BGAA 1EEPA 1OHLA 4H9MA 1HF6A 4R53A 2YLLA 3EX3A 1DIKA 4AB4A 2G5WA 2WANA 3MPGA 3MHFA 4BI7A 3WUBA 1WKDA 1QO2A 2E25A 3G1DA 3MUCA 1EKOA 3CQKA 5K9CA 5CAHA 1MEWA 2HV5A 4QS5A 2VGGA 3CASA 2OVLA 1MUMA 5EKYA 1KB3A 4X9YA 3AXHA 1XGEA 3BLEA 4P8WA 1XLGA 4XD6A 3S9IA 3F5JA 4E2OA 2V3DA 5DBTA 3ERPA 3GVQA 3M0MA 3BXWA 3W7GA 3TNOA 1WDRA 3MANA 1HJSA 3LDVA 4M80A 4RNJA 4DUWA 1MFVA 3VNJA 3DX5A 4LYPA 3BUVA 1ADSA 1DTNA 2XN1A 4XV0A 4QE5A 3G1RA 3VAVA 1C3FA 3IGUA 3H2CA 1CZ1A 5D37A 1B30A 1BXCA 2ALRA 3WMCA 4KESA 4KWWA 3PN8A 3DZ1A 2Q71A 1XCWA 1RSCA 5I79A 3O05A 1KBJA 1KRAC 2BZNA 1GKPA 1JZ3A 1UP2A 1F7BA 2VQTA 3V5CA 3IPWA 3UY7A 4UTFA 3NQGA 4FB7A 3IEBA 1G01A 2E09A 2HWGA 1U2YA 1XI3A 2E68A 3E2VA 5RUBA 1M7XA 2ISSA 4CU7A 4C6MA 4A3YA 5C9RA 1QDSA 5GQBA 1YPIA 4KEUA 4IX0A 3VTRA 2J66A 3VMPA 1OCJA 4JTGA 1S5TA 1J0JA 2PDLA 4AZBA 4PEKA 1FOBA 4DI9A 1XLFA 2VX5A 3LHYA 1V3HA 3MDUA 4O57A 2FZMA 3UR8A 2B81A 4NIRA 5BRBA 2G4FA 2PRLA 3A5VA 4HPGA 3WELA 3HZ3A 1KFEA 2GVYA 4Z2JA 3EPNA 1JCYA 4K7VA 4DJEA 1FXPA 1BQGA 1XGZA 3WEMA 1PYFA 2XPKA 3AIWA 1VYRA 3BJFA 2Y6ZA 3H12A 4FX8A 3ZR5A 2Q02A 4Q4RA 3W2MA 3KOXA 1VJZA 1VZWA 5B7YA 3STCA 1O95A 2CLHA 3DFTA 4H7VA 3LD5A 1TPVA 3SRHA 1E0XA 4O52A 3PFRA 3ALFA 4N42A 4BKNA 1O5RA 3W25A 1I0BA 5C9XA 3IV8A 1IHIA 4MB1A 3MVTA 4D72A 5JMUA 1HGWA 1WXYA 3H2MA 1OFRA 4P8UA 4W86A 1LRTA 1U33A 4PRWA 2C6QA 5ENLA 3WD2A 3J7HA 5H1WA 4GABA 3W2UA 2WSYA 1MEHA 1B2YA 1IZKA 1EUAA 1DJZA 4FNUA 3UJRA 2XIIA 3AXMA 4R3UA 3C4UA 4YTTA 4D9PA 3PG9A 4Q4SA 2TPSA 4NG3A 2WVVA 1XJBA 3TTSA 5A6BD 4KT2A 4H2HA 1VP5A 1PKNA 2G3MA 3HIJA 2A5HA 1VFOA 4ZEPA 4GK8A 3R6IA 3V35A 1V3MA 3W4RA 5CGTA 3KM8A 4Y8FA 1VBJA 1AH4A 5HNRA 4DZIA 1N82A 3OGRA 4PTNA 2F6XA 4JFUA 3TJIA 1BVZA 1FQ0A 3E38A 3OYZA 1ZQ5A 2XYLA 3GB6A 2E6AA 2OZ0A 3CUXA 2V81A 3P8IA 3GDLA 4RW5A 5LKYA 1MO0A 5A8GA 4YXGA 2WQDA 4AXKA 1SW3A 4ZO8A 4XD4A 1RK5A 4BS0A 1GPFA 2ZRYA 3AYRA 4JIEA 2TSYA 3BZGA 2DSKA 1Z3NA 1ZPTA 5HNTA 4JQ3A 4AAJA 3OA5A 3I6TA 5K9XA 1OSEA 4L6OA 4AVFA 3HBLA 1SJAA 2EG7A 1Q63A 2E9BA 4MPKA 6XIMA 4K8HA 1REQB 3PPHA 1VJSA 3MMUA 3AS1A 3QW4B 4WF7A 4O12A 3IJQA 3OG3A 3UXDA 5CLTA 4MAZA 1BKHA 1CPUA 1KW1A 2QCDA 5A5WA 1HP5A 1Q65A 2DIJA 3PVFA 4X22A 1FVPA 4Z1CA 5G1TA 1TV4A 3SCRA 1FWNA 2XH2A 3R43A 4LB3A 4C60A 2XDFA 3RNDA 1VRXA 1YDOA 5EMKA 1JD7A 2QMKA 3IIVA 1ISYA 3W07A 3LZ5A 4DWSC 3ZO9A 3SUVA 2CETA 3P67A 1BTMA 2C19A 2WXDM 2EKGA 3LLFA 4HVXA 4JTCA 1TTJA 3I65A 1LWHA 2D2OA 4W7UA 3W83A 2AGKA 5JBFA 1UROA 3S4TA 2GUUA 4DBUA 3L4WA 2QCNA 4OU1A 4AHOA 2C16A 3UWWA 3P8JA 4RE2A 3U6WA 2AQOA 5I3GA 3Q65A 3T4WA 5CXPA 1UQZA 3W7RA 3JUGA 1S1PA 3EDKA 1RD6A 2IKJA 2FTYA 3F4WA 1YKWA 3HJZA 1K8YA 1DHPA 2VT0A 4HTBA 1LQAA 2L5HA 1T7LA 2V3EA 4U3CA 4XSMA 1AW1A 4IPPA 4IMCA 4NXSA 1WXZA 3L12A 1V3JA 3L2LA 2ATMA 1C93A 2OEKA 3EXTA 2WC7A 3K8MA 2EBNA 1OQFA 3W7DA 5C9ZA 5A8PA 4RDZA 3ZJ6A 4P7NA 2BHUA 3UFYA 2DUXA 3BOXA 4UQBA 5LGZA 5AC4A 4H8UA 3A4XA 1G4PA 4GZ7A 1QNRA 4GI4A 2VD9A 3R0DA 4YN5A 3I7QA 1WBJA 1UR4A 3C0SA 3CH0A 4O4WA 3VNIA 4N4QA 4ZXLA 2QCLA 2QJHA 3LHWA 3E0WA 1KXVA 3HURA 4MYAA 1OADA 1XC6A 3ZLHA 3ABSA 3AS2A 4QJ3B 1EYWA 2WVTA 1A3XA 4CN1A 3LZ3A 3SY1A 3IJLA 2FH6A 1JXKA 4DUVA 1PUDA 4FIRA 2JALA 3MSDA 3VO0A 1KFLA 1W1TA 3BLPX 3W22A 4OECA 2YZRA 2HQAA 2PDUA 3W23A 2OB3A 3FFSA 4XZIA 1H7XA 5A6MA 2NV2A 3L4XA 5C7VA 2V0TA 1W9BM 4LTSA 2HXTA 4OVXA 3DERA 6CGTA 1IWPA 3DFSA 4PMNA 3GG7A 3RFAA 3RLHA 4LF2A 5J5RA 4KBXA 1AMYA 5D38A 1ECQA 3GU2A 1PYMA 2REQB 3AJ7A 3SSJA 3S9ZA 3OIHA 2PDPA 1E4LA 3WD1A 3ZJKA 4YCPA 3VPLA 1H5YA 3VYLA 1JNEA 2IMRA 3CU2A 1JQXA 3RM9A 2R82A 3OIXA 4PCSA 3JVAA 3A24A 2C14A 3MVIA 1ZY9A 3N04A 2UY2A 4AY7A 4DI8A 1PZ2A 3UPWA 1PKYA 2V68A 3WFLA 2X1RA 3PJUA 3QH2A 2E6YA 3UGRA 3CO8A 1G9HA 3CLWA 2FDMA 3G8RA 4CGTA 2RUSA 1JDCA 3CH9A 4ZQOA 4QNEA 5ECUA 3TSMA 3HM7A 4J2PA 3RX2A 3CBWA 3E2QA 4N7QA 5REQA 3V3WA 2AMXA 4E8GA 4IXHA 1WUFA 6PTDA 2WMFA 4AWUA 3TC3A 2W66A 3NM3A 3EPMA 4IT1A 3VD4A 3GDRA 3FX4A 2JQXA 2Z28A 2DUAA 2FIQA 3EDEA 1Z69A 3G1SA 3R8RA 1SO5A 1Q6QA 3R79A 2I5IA 2OX4A 4GQGA 4WY0A 5DRIA 3G0SA 1Q4NX 4UTMA 4PFHA 2Y1HA 3C8FA 3LNMA 1FWCC 1GTEA 5K2ZA 4IFKB 4O19A 2QDEA 2E1DA 3NQDA 1XSKA 3FDGA 3WEZA 3BC9A 2QXWA 1XLKA 2A3BA 2P0IA 2PZ0A 2Z1VA 2ZADA 3KLLA 5DRCA 1L9WA 4FNRA 4RDWA 3CZ8A 5FF7A 2FFIA 4HCLA 3FEQA 1AQFA 1F3WA 2F38A 4D71A 1TPC1 1G67A 3FDKA 2VEIA 2WVUA 3INPA 1UWRA 2IQTA 2FZ9A 3W38A 2XTKA 3GNRA 4MY1A 2HJPA 1W54A 1UD4A 1XXXA 2QQ6A 4FXFA 3OJGA 3KWXA 3HB9A 4QSHA 2HBVA 2CU0A 4ML4A 2PU1A 2BDQA 2WVVB 4PTXA 1CTNA 4B92A 1HO4A 1YADA 2J7GA 3KL3A 2PDIA 2WNNA 4H9ZA 3JR2A 1OFDA 1K8XA 4AEOA 1RR2A 4KH2A 4P7QA 2ADAA 3UBPC 3IJIA 1ISVA 3URNA 2VYOA 3ITXA 5CZKA 2WO5A 1D9EA 2ZZ7A 2OZ8A 4JTLA 3WFZA 4CCCA 1HXJA 2QHAA 3WQDA 1RXOB 4H8NA 1OCQA 3N14A 3WJXA 2QUUA 3CQIA 2RGLA 1OF8A 2DW6A 3UYIA 2NVDA 4MWAC 1SM9A 1P0EA 3A4AA 3DAQA 1U1HA 2UY3A 1BAGA 3Q2DA 3M64A 4EKJA 1TRDA 2HE8A 1R5YA 1FWBC 2XGZA 1JYVA 2PRMA 4HD5A 3HG5A 1LYXA 4NJGA 2GGIA 5CSRA 2QUMA 3IS4A 1ONEA 1C8YA 4AQLA 5TF0A 3U3HA 1CIUA 4H6QA 1H0IA 3N15A 3UNDA 3WLMA 4Q4KA 4AD3A 3L5LA 4BY3A 1HTIA 1GWJA 3PB0A 2PC8A 1JRBA 4AC1X 2QCDB 1EBHA 2YBTA 1TELA 2VENA 1LZOA 3STGA 3G2GA 3FCPA 4WKAA 1JZ6A 3P0XA 2EPLX 7A3HA 2YA1A 4DHGA 1DXIA 4NF7A 4JCMA 1I6NA 2BY1A 2VMFA 3UY8A 4FIQA 3LOTA 2A3CA 4O8AA 5LXXA 3NCOA 4PUKA 4L4OA 3TFXA 4AU0A 3ZOAA 5E70A 4QLKA 4LS1A 3DGRA 5FJIA 2NUYA 4I8YA 2QGHA 3B9OA 3LHUA 3B9AA 3O16A 5AECA 1M41A 4LC8A 3AMCA 5CJNA 3GTHA 3CPUA 4F2UA 1NQ6A 4BA0A 1P5BA 4C1NA 3OQEA 2A3HA 3EBVA 4HU3A 3ABZA 2O7QA 4JTRA 1WZAA 4DZAA 4LBUA 1FWDC 1T5AA 1G4SA 1OJXA 1L2QA 4PB5A 3VUSA 2XISA 1UH3A 4PRTA 5LNRA 4W7VA 1QJWA 1P6CA 4B16A 4DAIA 1FCUA 2FLIA 2QULA 3NO1A 4HZMA 4QG6A 3PF3A 5G4HC 1AMKA 3AIEA 1XLDA 3QY7A 4PTMA 2OQYA 4GY7A 3HPSA 2OKOA 3PSWA 1MUWA 2J24A 1QTWA 5TAOA 2H90A 5DT5A 4J9JA 4A3UA 3RK8A 5DMYA 3IIOA 4ZO9A 4C6BA 3GXIA 4W8AA 2E8ZA 3O07A 3C61A 3HA1A 5EYWA 2WMHA 3W7CA 2VL4A 4HJWA 3S6DA 1I45A 1UBSA 3CXOA 3EXSA 4O0KA 1IIGA 3WD4A 5EGRA 3DYPA 1OG6A 4C6LA 1ME8A 5GJPA 1IYXA 1JCXA 1BWKA 2PZNA 1QNVA 1OX6A 1ZUAX 3H53A 4PMXA 3MP4A 3MUY1 3N2MA 3ORWA 4M1RA 2F61A 2VR5A 4QP0A 3NTYA 1LROA 3OOQA 4NAEA 2W5FA 4OQVA 1TE1A 1JYWA 2OG9A 4DZHA 4CD6A 4YYFA 4Y2WA 2NT1A 2YCKX 2ZVRA 3UJFA 2X1SA 4RNHA 3MHUA 4ZQCA 3CZJA 2ZRUA 1UASA 2CLPA 2H6RA 2MANA 4MZ1A 1GKRA 1VC4A 1HL2A 2O4MA 3QV6A 1S2WA 1LWJA 1VIWA 4Z1BA 3AU6A 3B4UA 3PY2A 3VIMA 1H09A 2Z6IA 2BBFA 3BV4A 1W91A 2OGJA 3AIUA 3B0VC 3GYEA 3WY1A 1US2A 1XRTA 2VCAA 4XAYA 1WXJA 1OC6A 3F2DA 2YA2A 3AYSA 1AQMA 3SI9A 5I3FA 4HYVA 1GVSA 5EMMA 4F2TA 4C90A 1F07A 3VC5A 4XAFA 4F48A 3PZUA 3R8GA 4OV9A 2RJHA 4NILA 4LQ1A 3EX6A 4N9CA 1LLOA 1E6PA 5HNNA 3IJ7A 4IIFA 2ISVA 3E1F1 4HMCA 1SPQA 2NVAA 1EBGA 1GTHA 3H2EA 2EEXA 3EKZA 3TDFA 1UQYA 1MDLA 5HXMA 2H9AA 4C6EA 2CERA 5K7JA 3VDBA 3C52A 3AMGA 2VWTA 4N02A 3WLLA 2Q8XA 4NT0A 1S5WA 2WSPA 1AH3A 4IPJA 4MKNA 1TB3A 3WYZA 1CXIA 1W5NA 2ZKMX 3NQBA 1SJDA 1Q7ZA 1FWFC 1DOSA 5AYBA 3M5ZA 4ZQMA 2PP1A 3A9IA 4EPEC 1GJUA 1MSSA 3GTIA 4YMZA 2DZPA 2NVCA 5E6ZA 2OJPA 4AZIA 1GVFA 3FVMA 3URBA 1HQTA 4WIWA 1V6XA 3MP3A 3NR0A 4YVPA 2OLAA 5C9WA 5TNVA 3BMVA 4GC4A 1RQHA 4UFLA 3TCEA 1BWLA 3W02A 5F4WA 4NY2A 4L1XA 1XLEA 1Q2RA 4KCTA 4JGDA 2OZ3A 4PRRA 3TVAA 3T42A 3UVIA 3B9NA 3OG2A 3EB3A 5AHEA 4GXWA 4BWLC 2C71A 1TQXA 1TZ9A 2J47A 4GE8A 2QYGA 4UUIA 3ZWTA 3MMTA 1ZBKA 2Z00A 1K7EA 1Z6KA 1XKYA 3W1TA 3PZMA 2B7QA 4QDPA 3URQA 2EO7A 4KS0A 4MTVA 4O1EA 1JYXA 3MCNA 5E5CA 1FKWA 3LHVA 1C92A 3QC0A 4JAWA 4NP7A 3M0KA 2YL9A 3SO7A 4DWSA 3MW7A 2IXVA 5CC5A 2QDHA 4NZJA 3VKJA 4ES4A 3ES7A 2J9YA 3TN4A 3SUWA 2G4JA 1FHLA 4NI8A 2EJAA 4XUGA 4AF0A 3FOKA 3F2CA 3AHXA 2PDMA 3ABQA 1W9DM 4EXAA 2DIKA 1WAUA 2OCZA 5FEPA 3EX4A 3KP0A 1AL8A 1OZMA 3TLLA 2HBXA 3LPPA 4LBSA 2QCFA 2O9TA 3LGGA 4UXDA 1MNSA 5JUVA 4OJYA 3POCA 4UMAA 4CQAA 3JZUA 4X0NA 3LLXA 2WMKA 5ABFA 4JCLA 3BAIA 1LP6A 1T0OA 1XICA 5AYZA 4AW7A 3S1WA 2MUCA 3LUTA 3E9AA 2PWEA 3PZOA 2PDCA 1IV8A 5I6SA 3PUOA 2E0PA 3LERA 3D3AA 1OYAA 3BH4A 3W73A 3R58A 1JCJA 3SAZA 3RU8X 1H7NA 4JYEA 2OU4A 3BSHA 3WJZA 3RX4A 2NV9A 3FSTA 1ZCCA 3U5YA 4JL2A 1TIWA 3HGJA 3W7LA 3ARTA 3SRKA 2QUVA 3F4NA 7REQA 3Q45A 4C1NB 1BSLA 3PZGA 5C8BB 3K8LA 1W1B1 4NRRA 1HFBA 1ZP3A 1JI1A 4H04A 1X1ZA 3OZPA 1WDDA 2INZA 5HPCA 1MW3A 3ARQA 3V5FA 4H8HA 1AA1B 1Z9AA 3B0YA 1EUNA 5DX7A 3FA4A 1AVAA 4IP7A 4GQBA 1PIGA 1ITQA 2WZEA 3UWQA 1NY1A 4MFDA 5LA0A 1FWGC 1RJQA 4GG9A 3EAUA 3TSDA 1DWAM 3TWAA 1PKMA 4JKMA 2PDFA 3QSRA 3GU9A 1PX8A 4DRSA 1O5XA 4I9AA 2HRWA 3KE0A 4JX6A 3UWEA 3CL6A 3HU7A 2HPMA 1C91A 4WUIA 3D46A 2W4XA 5D05A 4ADSA 1OFOA 4MWAE 4ZMGA 3FN9A 4DAFA 4GZJA 1DKWA 1V3KA 4IMGA 4DYJA 1J93A 3HG4A 1W9VA 2RHGA 1CEOA 4UTIA 5EMJA 5DELA 3HJEA 4FXJA 2P53A 1CXLA 5AVNA 3VINA 4I9JA 3WFAA 4XBSA 4DJFD 3ISIX 5F1VA 4MNLA 4UFMA 1TA3A 3FYPA 1I1XA 4U10A 2GL5A 3EMQA 7ODCA 4PCPA 3DC0A 4LWWA 3KBNA 4CCZA 1VCFA 1B1YA 5CPOA 3DH7A 2ZDSA 1UG6A 1A5OC 3R25A 4J7RA 4IICA 3G1FA 1XIMA 1US3A 1B3YA 2I9UA 3UXLA 1QOXA 3NPUA 3O3RA 1O66A 3LRMA 1WZKA 4CEXC 3TYEA 3VNZA 1XISA 1SZFA 5TBOA 2Z2BA 4ZTYA 2PP0A 1Z89A 4XKYB 5CG0A 1D2KA 3PBYA 2OODA 2GVEA 5DY2A 2FPYA 4KFPA 2VFFA 4FPSA 4P2VA 1OM0A 3EB4A 2VFDA 3EB2A 5LNWA 1JIBA 1ZCOA 4US6A 4NZ4A 2IS7A 3SEPA 4UZUA 4REQA 3MKCA 5IDZA 3LN3A 4EAYA 2BP1A 3PBGA 3BCFA 1YHTA 1X1OA 3NVTA 3KTCA 5I06A 4S38A 4B2DA 3BICA 3QPZA 4XZHA 3M16A 3RRAA 3IVSA 1E0VA 3EEGA 3CT2A 4MDOA 5KEZA 4CQ8A 4OBTA 3WLJA 2H9AB 4TVCA 3EA1A 5FJTA 1H61A 2XZ7A 5I5RA 4GCAA 2QNEA 2RGMA 1C7SA 2XIQA 2VFGA 3LXCA 2ZZ3A 3NZRA 4B5XA 1D8WA 3TV8A 2HEJA 2NQHA 3CUIA 3FJNA 3IVUA 4C6CA 4YWIA 1UWIA 2Q3OA 3AROA 1QPNA 1E6ZA 1HJXA 3DCPA 5CSYA 5AZ0A 3RU6A 1WKEA 4AHPA 3MKKA 4EXQA 1TTIA 3CT7A 3EDDA 3E0FA 3KBSA 4GYKA 1WA3A 1GOIA 2GGHA 4IWWA 4UOZA 5D2TA 1PKLA 4MWAA 1V6UA 1SO6A 3LY0A 4K7YA 2Y7DA 4GBUA 3AZRA 1I1WA 1C8XA 3MA8A 2RKXA 1LQ0A 1BYAA 1J01A 1VEMA 1KTNA 1T41A 8RUCA 3VIPA 1YE4A 4LBRA 2V5KA 2I14A 3B06A 4LAMA 4K8EA 2V5LA 4NVTA 4KCVA 3TWBA 2OEMA 3CYVA 3OLGA 1SFJA 1RJRA 1PXGA 4UCGA 1FWAC 3AIBA 2QV4A 2OT1A 3U57A 1FWHC 2R94A 5BWAA 3W7MA 1QMLA 3R94A 4PMUA 1XKJA 3AZSA 2E4TA 4R33A 4BK9A 2JGQA 1UHVA 4I6VA 4DWSB 4QE4A 3S6OA 4Y7EA 2V5BA 4KCWA 4GQ0A 2QS8A 5F1UA 4W4QA 1RUSA 1UIOA 2YLAA 4AF0B 2Y85A 1VPQA 3GRIA 3A6OA 4KETA 1AK5A 1OEPA 1YXDA 5EMLA 2OMAA 4IQJA 2EGZA 3P74A 3OQ8A 1PTAA 4FHAA 1CB7B 4GZEA 4J2MA 1JF6A 4TMBA 3MTWA 3FAWA 1FWIC 3TW9A 3D5HA 2CITA 2FB2A 3WQPA 1ICSA 2BMBA 4GPNA 1OCBA 2BVYA 2O7SA 3UQNA 2PBOA 3IRDA 2YXXA 4G7EA 5ABFB 4TO8A 1YRRA 3MBFA 3TSBA 4DLFA 3A12A 3GXMA 4X0VA 5HAOA 1DJXA 1A50A 1G6CA 3W6MA 2J7FA 1TMHA 3QZEA 4ZCWA 5I7GA 3QQWA 4KQNA 4K39A 4DYKA 2Y7FA 3QF0A 1JUKA 3ATYA 3V16A 2WKLA 2IPGA 5JIPA 1V3LA 3FHAA 2Q8ZA 4YTRA 2VRQA 1UD3A 3LPFA 4GI9A 3PPFA 4QAIA 5DT7A 3LBCA 4I90A 5HPOA 3QV9A 1X6LA 4OWGA 2NW0A 1OIMA 2J7CA 1OZQA 3KDOA 3GVVA 1RPKA 1TCMA 3GO2A 5DLCA 4OTKA 4LC6A 1WOAA 5A69A 2AAAA 3GTXA 4PFMA 1E1EA 3B8VA 3UNTA 3B40A 2GYIA 1DVJA 5T8GA 2IW0A 3G6LA 1UA3A 1IEWA 4DELA 2ONEA 4I9MA 4PBEA 4AZ5A 1XP3A 5AZ1A 1EPVA 1I4NA 1KGWA 4GYJA 3EKGA 4ZQNA 3N9RA 1IR1A 2C1HA 1JGMA 4DJDD 3DFQA 4PMYA 3AXXA 3C0QA 5EFFA 2FVMA 3VI2A 1HKWA 2VGIA 1TRIA 1GEHA 5M3WA 4GVHA 3AI0A 3EXRA 3PTDA 3W37A 3SZ8A 3EMZA 4QSFA 2VGFA 4ZTXA 2ON3A 4HNVA 1MW2A 1QOPA 1V6WA 3KBWA 4LAKA 5CGQA 1BG4A 4J3UA 1V0MA 4KGLA 3OHIA 4PUWA 1Q6EA 4EXBA 5D09A 2NQ9A 3NXLA 1HN1A 4DBWA 2BY0A 3HOJA 4A4AA 4KRZA 3W1UA 2C79A 1FFRA 1CLKA 2PLKA 4O1BA 2HTMA 3C8NA 3QJAA 1S2UA 3FHQA 3FVDA 1MEIA 3WQ4A 1TA3B 4M24A 4JIQA 1KKRA 1KM6A 1KM1A 3H7VA 3NL3A 4B5SA 4LV9A 3S83A 2QCGA 1LL4A 4E38A 1E40A 3LG3A 2F2KA 4UR9A 3USBA 4CUCA 1ISZA 3CUGA 4IOTA 4JEJA 4IG2A 3SRDA 4J4KA 4UTHA 3STEA 4YLWA 3SRFA 3R5EA 3GQYA 1YW1A 4RUBA 3KBMA 3B3DA 2QF8A 1QWGA 4ALDA 4O11A 2VDHA 4WHBA 3WL1A 4UTJA 8CGTA 3HQOA 3FV9A 3W86A 3TROA 3V4BA 4UFHA 2V63A 3U2OA 4JKKA 1H11A 4QDMA 1BLIA 1W8GA 4C6JA 1E5NA 1A0DA 3BG3A 4G9PA 3LHTA 3VIHA 3E12A 3O15A 2BNJA 5AHMA 4YTQA 1AG1O 2Z26A 3HGRA 1UD6A 5F2LA 2Y62A 1GNXA 1E56A 4FMVA 5G2IA 5ECVA 4REQB 4JFTA 5LZLA 2PDQA 3M1ZA 5C9UA 4JD4A 1F6YA 2VVSA 4D6HA 3WLTA 3NEVA 1XYCA 2NWRA 3GIPA 1EJRC 4JX4A 3OLEA 2BGNE 3RYSA 2Z2UA 2ZTKA 1DWGM 1G7UA 4LANA 1M6JA 2VX7A 3KFTA 4DVOA 1IQ8A 3SIZA 4LS2A 1P43A 1G94A 3UF9A 4O54A 4S3FA 3LHZA 4HU0A 4LAZA 2VUNA 4GVGA 3GW3A 5AYXA 1Q66A 4WXZA 3W7IA 3VIFA 3RLVA 1K70A 2XSXA 3TTOA 1W6TA 3CUHA 3KVKA 4NKCA 3MWAA 2E67A 3WUEA 1YTEA 2VZOA 1WYIA 2F6UA 3M0HA 5TD4A 3H2FA 2BB0A 3UGVA 4Q33A 1H2JA 1UOZA 3LMYA 1SMDA 2WBKA 4BWLA 3EWBX 3B0PA 3H6OA 4PSPA 4EPDC 4IGHA 4AD1A 3GXTA 1R9ZA 4AG0A 5D9OA 1Q6FA 4PUMA 4L1WA 3KW3A 3V1PA 3KTSA 1UKTA 2QJNA 5AKQA 4MWAB 2D2HA 3ANYA 1K6WA 2HK0A 3HG3A 2WHKA 2X1IA 1OBAA 3G1AA 1MQPA 2VEGA 1EXPA 1E1CA 1MZRA 3QYQA 2XVLA 4J28A 1EFZA 2ESCA 5HWJA 1RY8A 5C2XA 2CZFA 4ERIA 1BRLA 3SCWA 1SVDA 3WQFA 2XVKA 2YYTA 2NLIA 3O63A 4O8RA 3CMJA 5FL1A 4A3RA 1ISXA 1J6PA 1UMLA 3UW6A 2OLSA 4QGCA 4NZ5A 3CNYA 3PC0A 1RCOB 2J74A 2VKZG 5I77A 1R3SA 3G24A 2X09A 4LRSA 5A8OA 4CNUA 1XDJA 3W88A 3DENA 1GYLA 1JZ8A 5D2VA 4EIVA 2VURA 4PUUA 1XBZA 1IT8A 2WKGA 1FUYA 2X2YA 1MYRA 2PLJA 3ARPA 2NXGA 2QGYA 3VKDA 1UOKA 4B9YA 1E6SM 4QFUA 1R9XA 3NWRA 4NUWA 2PDBA 4WQ6A 3U2CA 3QRHA 1CW2A 1TJ2A 2P50A 3HQ1A 1M7OA 2VC5A 4YYCA 1RV8A 4BI5A 3K13A 1F2JA 2ZUVA 2HVMA 5XINA 2YCLA 2OZTA 5D33A 4IIHA 3FY1A 4JOMA 5TIMA 3WK2A 1ZAIA 1UZ4A 1DWHM 1LTDA 3IGSA 1HJWA 2W0UA 2VZTA 4O17A 1A0CA 3BPWA 5CH9A 3GIQA 3NO5A 5M17A 3GYCA 1XDMA 4G7EB 2BS9A 1KM2A 2E3ZA 4WSKA 1AQHA 4JHMA 3WX7A 3W2KA 2NX9A 3LPGA 4AZ7A 2Z2AA 4TX6A 5I78A 2VZUA 1F8MA 1XHGA 3QOKA 3P82A 3ZFHA 4C6NA 2CXEA 2PE4A 2A4AA 3CHEA 4MLJA 5CEWA 2BHZA 1A5SA 4MNMA 5D32A 3BLIA 1ZB5A 4GVFA 2BY2A 5ABEA 4LUIA 1A3HA 1JCLA 1DJIA 1J6OA 1KO0A 3BQ5A 2PLMA 4PUDA 1TUFA 2VTFA 1CGWA 2XZ9A 1F74A 1NELA 1FDYA 3BLDA 2D69A 1P4CA 5A3HA 1YPXA 3U48A 3N2TA 4I5XA 3W26A 3MMDA 1EIXA 3WLPA 4F8XA 2PD9A 4AVOA 5LXEA 4ICMA 2CC0A 4TOQA 3DHPA 4S3EA 5C7HA 3ZWSA 5FF3A 2XFRA 2B7PA 4INFA 4WEVX 1R3WA 1RY0A 4Q7IA 2OYKA 4Y96A 3NAVA 1RZMA 3WNMA 1B4EA 4ROQA 3AMLA 2VFHA 1VJIA 5D2XA 3MZNA 3SGZA 1QNQA 5CJ5A 3BW4A 4DXXA 1UJPA 3UZJA 3ITYA 3MO7A 4J1OA 3ZSTA 5BU9A 2GSHA 5M1TA 1HO1A 1H1YA 2CHOA 2E28A 1TJ0A 4S3KA 3NO3A 4PSRA 3W7JA 3CAKA 5FEZA 4HK6A 3OLDA 1HKIA 2BSLA 2YCJA 1UC5A 3NGFA 4BQ2A 1LQ2A 1RP8A 3TK7A 2FGZA 4CEUC 1DJHA 5HUOA 1GOWA 2J25A 1YTKA 3U8GA 3WLOA 1OC5A 4IJCA 3CO4A 4I6KA 3W0KA 1QASA 2FVKA 5H8UA 4ZA0A 1LDCA 1OY0A 4WKHA 4Z08A 1QHZA 5H2ZA 1LCOA 3BMXA 5K9DA 1M7PA 4MY8A 1KM4A 1NP2A 1G69A 4XZLX 4GISA 2OFJA 3WK1A 2YFOA 4N6EA 1DJGA 5BROA 4B91A 5HJXA 3QOMA 1W5QA 5J8LA 2GJRA 2O9OA 1X98A 2WM0A 2QMJA 4O14A 4FK9A 4JTAA 4Z1DA 1M1BA 4O4VA 3C2OA 1MXSA 1XYMA 3HFYA 4A8NA 5I2UA 1GG1A 2DQWA 2J27A 2QLYA 5D02A 1K7XA 5I3JA 4IIDA 3DC8A 3LBMA 5GNYA 1P1XA 1DJNA 4GKLA 2J4GA 3VFLA 3RJXA 3NURA 4UFKA 1JCMP 4JTKA 5IFPA 3SIMA 1JAEA 3L2IA 4JHOA 3PTQA 2VEPA 4CD5A 3IK4A 1PE1A 4W7WA 3VK5A 3OW1A 4BQ5A 4Y9OA 2WJZA 2QZRA 1P48A 4MB4A 5DXXA 1I2NA 3G5EA 3W85A 3W70A 1E51A 1LBMA 1GUVA 1PWLA 3NQVA 5KZMA 5KZEA 4UBPC 5K3VA 1N8FA 3LSCA 4L6HA 4H9TA 4UQDA 4B90A 4C6QA 2WJDA 1K4HA 3N2XA 4PCNA 3IGHX 4WJXA 3N1AA 3C56A 3Q94A 1AH0A 1V79A 2VR2A 4UCFA 5JVLA 3R2GA 5DANA 4DUOA 2A6NA 4Q4MA 3A3XA 1B90A 3TA6A 4TV6A 2BXZA 1VFMA 4S3JA 1V02E 3DHUA 3DKJA 1US0A 4IMEA 5BU6A 4HZ8A 3F4VA 4HOZA 4Z0SA 3M6DA 2OTDA 4GO9A 3GZ3A 4C6OA 1WZMA 3WDJA 1DJQA 1MQRA 4DO5A 5KZ6A 3ZT7A 1I0DA 2BOGX 3RUBL 4XZWA 3W3OA 3EOEA 2OQHA 1RD5A 1EP2A 1YTDA 2J77A 3PZQA 1KWGA 1FCBA 2W3ZA 5CC7A 4A21A 4HOWA 2H3BA 4RDYA 1LL7A 2MNRA 1IZJA 1EGVA 3NPXA 4JZ5A 1GW1A 3TN6A 2GJXB 4DBDA 1ZALA 2Y4SA 1TTQA 3CQ0A 2PODA 3DHDA 3M07A 1JPHA 4PEEA 4B5UA 3ZZ1A 2X0HA 3WENA 2IKIA 1E1CB 1W9XA 4IL2A 4UNKA 1TV7A 1EQPA 1GORA 4PZVA 4QCEA 1IT7A 1TREA 1BRLB 3GC5A 3AJXA 4DQWA 1UWSA 1ODUA 4GJIA 4KEZA 4NXKA 1MMFA 4XTIA 1TG7A 1FWRA 4HU4A 4YPJA 1XPGA 3OYXA 4ZO6A 3UT0A 3LYEA 4HNTA 1QXLA 1VBRA 3UR7A 3ZR6A 3PB2A 5JBDA 1CWYA 4F79A 4YWSA 4XO7A 1X7FA 4H41A 4UQAA 3AS3A 2PSNA 4JTQA 3ZR4A 4R85A 1NVMA 8A3HA 3A13A 3KVJA 4O1FA 4BR1A 1N8IA 3QY6A 1DE6A 1MUCA 3FSUA 4DLMA 1RA0A 3KVLA 3SJNA 3WNOA 1ZHAA 2CLOA 3G1VA 1UA7A 4EF9A 2E5DA 2J88A 1L0PA 2IQ0A 1HKKA 1P7TA 1W56A 2GGGA 5I3DA 2PB1A 1IGSA 3FA3A 2XIOA 2Z27A 4W88A 1HVQA 5PTDA 2NQJA 1F6KA 3TFCA 5HQEA 3K30A 4ATWA 4QTGA 3ALGA 3A4JA 3ABXA 2FZBA 4IIBA 1ZJBA 2FHCA 5KETA 4IPIA 1P1MA 2D2JA 4KERA 3TW6A 1SZRA 3LEPA 1LBLA 1A53A 1KCKA 2ZDRA 3OTRA 3VZXA 1DL3A 3Q37A 1ZAJA 2WV8A 3PTKA 1VFLA 1ONXA 2QPXA 3AQUA 5IM51 1V02A 1XS2A 4GXMA 2JF6A 2CYGA 4MZ8A 1DP0A 3U7BA 1UJQA 5FAGA 1V7YA 3E0IA 2BX7A 1PIIA 1P0DA 1KQYA 2J13A 3FLUA 4Q8WA 1UBPC 4NJKA 1KRBC 1XIIA 2YYUA 4ZB5A 4GY1A 2J6VA 1A5MC 1JJKA 4UTKA 3UCCA 3KL0A 4ATLA 2CXGA 1QI0A 4ZXOA 1LJYA 5LIUX 1W9PA 3VIOA 4D6JA 4IGSA 3BO9A 2W92A 3QHNA 4EK7A 1YXCA 3CL7A 3EGJA 1TPB1 4NAFB 4NNAA 2IPJA 2ZX8A 2JEPA 3IAPA 3N29A 4MADA 3M44A 1K77A 1FWJC 5MKGA 2QW5A 1XD0A 1EX1A 2Y2WA 3W29A 7TIMA 3R4IA 4K68A 3I3DA 4NJJA 1VS1A 1R86A 1IXNA 3MT1A 3SUSA 4KRTA 1J79A 1XWYA 4S3CA 1P0BA 2Z7GA 4F9JA 1J5TA 2YW4A 3G1XA 1WB0A 4NNCA 3CB3A 4DM2A 2DJLA 4HZ7A 2VC6A 5HINA 4QJ5B 6A3HA 4UB9A 3GW0A 2B31A 4RE0A 4JIIX 4M82A 1A0EA 1XUZA 4GI8A 4GIYA 3NDOA 4P7LA 2GPTA 3GVWA 2CLIA 1BHGA 4WDTA 4YU1A 1VH7A 3L67A 3APGA 2DEPA 5HJLA 3S2LA 2AL2A 3BW3A 3MZ2A 3WNPA 5MHBA 3N18A 4AFYA 1UPPA 2VOMA 3IACA 1E9IA 1BF6A 3G1HA 1AD1A 4C5ZA 5FEWA 3WLRA 1P6WA 3PPCA 2ICSA 3RX3A 1B3VA 2ZX5A 4JTDA 3UD6A 3DFHA 2Q01A 2BLEA 2G50A 3OLIA 1R8LA 4CCDA 4WDXA 3VNMA 4EVZA 4LVBA 3NM1A 2RJGA 4RW3A 4JIRA 3BSMA 1XW8A 4PN2A 1TZ7A 1X6NA 3T44A 1GGOA 2GVJA 3DDMA 3OBAA 2DIEA 1ME9A 1NF0A 1NFGA 3RPMA 4GWEA 1IEXA 4HYWA 1KLYA 4C7FA 2QCHA 4AYSA 1FDJA 1DTUA 3GBEA 4ACYA 3W01A 2W63A 2JIWA 1I60A 4RCXA 3AIRA 1IWBA 4GQRA 1XYBA 1PZ3A 4D6GA 4LALA 3WNLA 3UP8A 2A0NA 1BXBA 3FGCA 5IHSA 1YDYA 1PCWA 1TPDA 2YDSA 2J9ZA 1FP9A 3S2JA 4JTFA 4JY9A 1ZBWA 3HMCA 4WX2A 1QPRA 3K5XA 3ITVA 4ATDA 4G2DA 4GD0A 4HA3A 4W87A 2DZUA 2ZUUA 4NQ1A 4BEUA 4Z2IA 3THCA 1ZBCA 3MY9A 4TUFA 3NQCA 4FI4A 4GUHA 1NDWA 1RVKA 3P62A 2FQIA 3VCRA 3PHAA 1W5OA 4PMJA 3JU2A 1KXQA 4KKXA 5JXQA 3UZ5A 2QAPA 2AKZA 2TMDA 2QPSA 2PCQA 3NG3A 3F2BA 3H22A 4PBFA 2XIJA 3PAJA 4AD0A 2NV1A 4B5NA 4HTYA 4L7ZA 4QE1A 4E6MA 2X7WA 3ELFA 1HGYA 1FRBA 4Q4PA 3ZYZA 4ICCX 1UR9A 1XM3A 1DV7A 2FMNA 3BG5A 5LNSA 3PPGA 4DM1A 3D6NA 3WO8A 4PUNA 2GSJA 2QPUA 3WQGA 2QDGA 3S8HA 3LXAA 3LS9A 3QHMA 4JQ2A 2HVNA 3V18A 5IXEA 1TZZA 4EE9A 4R7JA 3VKCA 3H2NA 4Q6XA 1U83A 3C3UA 4IMAA 3K4WA 3P3BA 1K02A 1OK4A 4ML9A 3GG0A 4HU8A 1X8CA 3JRKA 4LH8A 3S6TA 3SQLA 1Z44A 3P61A 1M7JA 3XISA 4CNPA 3E2SA 4OV4A 2C1IA 3PZ9A 1XFBA 2REQA 2Z1BA 4I8DA 2XU2A 4F66A 3M7WA 3W2NA 1J0ZA 4OOZA 2YCEA 1VB9A 1TWWA 4GJ1A 3NQ7A 3CIWA 4PBGA 4XAPA 2X41A 1Q7QA 1VF8A 3FW6A 1HP4A 3WG6A 2NLYA 3CAVA 2HE5A 5EMUA 2W79A 3L5AA 1XBXA 4PR4A 2GDVA 2PGFA 3B9DA 2YL8A 1YNQA 2O4QA 3L4TA 4M81A 1NOWA 4YTSA 1VPYA 4F0HA 1B54A 3UJ2A 3CZKA 3L0GA 4BF5A 1H3GA 5KSWA 5FJUA 3LPOA 3CWOX 3A4WA 1ZU8A 3OGSA 4GUJA 1P7TB 1BVWA 3RGTA 2G3FA 2ZZ4A 2RDXA 3W82A 4D6FA 3VIKA 3W75A 2X0YA 4LRTA 1CGUA 3RAOA 3DKLA 5GNXA 4UQEA 1KV5A 2XWEA 4L5ZA 4NX0A 4YHGA 4LS0A 4A6GA 3AXKA 5HJYA 3UZWA 3O6CA 3L0NA 3SCOA 1PPIA 3NZ1A 1AD4A 3T4CA 1AW5A 4QX4A 3TCSA 1KFJA 3JS3A 3AU2A 3NFUA 4V33A 1VFSA 4IFKA 1J0HA 3BCDA 1J2BA 1GQIA 4GY0A 3PFMA 3TP4A 4CU6A 3N2BA 3MI6A 4KGJA 1D3CA 4GKTA 2PGEA 4Z2HA 3NL5A 3K4DA 1ALDA 3WH5A 1GQKA 1A5LC 3FIGA 2DUZA 3UJEA 3VDHA 3E5PA 3OPSA 4V28A 3UCQA 1GOKA 4PC8A 1XDLA 3CWNA 4UTTC 2ZVIA 4QEEA 1B0IA 4CVUA 3PUEA 1KM5A 1HL9A 2FYMA 4DWDA 1KBKA 3CHVA 2W62A 3DHFA 3RCNA 3NQ6A 3PJTA 5E9XA 3GK0A 3QKEA 3WLQA 1EX5A 3M0YA 4H1ZA 5HMDA 4F0LA 2WHLA 2SFPA 5HR6A 1R7AA 4HNOA 1KRMA 2JKPA 3GX9A 2HROA 2GSEA 5AC6A 3EYPA 1KM3A 4WVXA 1QRQA 1SR0A 2CZVA 4L61A 2OYMA 4MKSA 3SUTA 3KAOA 2RDWA 1XINA 3PZNA 1ZJHA 5DCBA 2YKKA 5MKGB 4P61A 1E9ZB 1XLCA 4MIMA 2CHRA 1XL9A 2W61A 1S5VA 4D8AA 3ZLFA 3BAJA 1ONRA 2FGBA 3UYCA 2ZXBA 4HGXA 3PBMA 1W3KA 4CQCA 4D1JA 2XIMA 2IKGA 4Q8PA 3W7PA 5FESA 3RCMA 3ZJ7A 1EC9A 2O9PA 5H6HA 1VFTA 1X6UA 3GH4A 3GG8A 4AIUA 5FOOA 2FVLA 3O6AA 2VZVA 3GXPA 1C9WA 3VD7A 3ZT6A 1NM9A 3IJ9A 4US5D 3VXGA 3WBAA 2Y8KA 4XD3A 1YEYA 3AC0A 3GR4A 4F2BA 4ZE4A 4S39A 1D7KA 4AMAA 4R9XA 2IQDA 5FF2A 3UR5A 3OA3A 2AL2B 3SCSA 4RKAA 1MRQA 1JAKA 3KP1A 4O1AA 3S47A 1FHVA 3NL6A 1L8NA 3R13A 4QHRA 1BD0A 4UC5A 4S1FA 1KFCA 3OP2A 3WBWA 4L1GA 1X38A 3L4ZA 3AIQA 4HMNA 3L23A 3LRLA 1NQKA 3M41A 3TQKA 4OT7A 4S3DA 2F7FA 2BVDA 3BG9A 1M68A 5BXSA 3VOHA 1WKYA 2FB3A 1E5JA 2X1UA 1SYTA 1LG2A 4PGLA 1KD0A 1EJ7L 3R7MA 5HOSA 1QUMA 1QPOA 1YBQA 4A8IA 4C5YA 3GTNA 4Q32A 4IFRA 1POKA 4L9XA 1B57A 1O5QA 2ASHA 4PUJA 3CB8A 2DW7A 2I57A 1V7AA 4HSHA 1E15A 5AFDA 1TWSA 3FXYA 4V1YA 2GJPA 4XZBA 2EJ1A 2Q09A 4QG9A 2P3EA 1F4AA 4XD5A 1UH2A 1KGXA 2DZWA 4H7ZA 4WGHA 3BLLA 3FGCB 1GQJA 2ZZ1A 3B04A 2ALDA 5HNUA 3T81A 5FKYA 1C7TA 2WMGA 2JFEX 4C6FA 3B03A 1CGXA 1SMAA 4X2RA 2OOGA 4DB7A 3CQHA 2H8ZA 4DN1A 1KLZA 5I09A 3W87A 5C0QA 1BF2A 2ZQ0A 3EA2A 3VCNA 2NSOA 3S1VA 4TV5A 2VEMA 1C90A 3UERA 2Y89A 2QEZA 4LUJA 3RM4A 1ZBVA 1JZ4A 1PJ9A 4GYPC 3QHOA 3SBFA 4M29A 3I4EA 3S2CA 2JBMA 2ZX6A 1C29A 3WJSA 1VBHA 3EDJA 2BWGA 2D22A 1QBBA 3N73A 3N34A 4FXSA 4AX6A 2CBJA 1XLHA 3S5ZA 3V36A 3L7RA 2Y70A 4MSSA 3MDWA 1GOMA 1V77A 5F4XA 4DJED 3CYJA 3M0ZA 3M43A 2A21A 5A1AA 2W67A 4JNYA 2ZBTA 3VZYA 4WJ8A 3TJLA 4H2CA 3DFOA 3RM8A 5AYIA 4AEEA 4UTWC 4XAGA 1R47A 2H8XA 1CT5A 3MYPA 4ZOBA 3VABA 3NQ2A 1EOMA 3HMJG 3KS5A 3MJMA 2QCMA 2ZRWA 5DCEA 1UWQA 4FF7A 2V82A 4H7CA 2BG5A 6TIMA 3WQEA 2J8GA 4C1LA 4I7WA 3GH7A 4Q8VA 2QIIA 3KCJA 4LEFA 3CZGA 4B3ZA 4NL1A 1S2CA 4A8RA 1XH0A 1SFTA 3QSTA 1EDQA 3WMBA 3VM7A 3XINA 1JPMA 4GQQA 3T1GA 1R3RA 2B4GA 4OBSA 4Q8UA 4H9XA 5BW6A 1XV8A 4F4RA 1IEIA 3RO6A 4BQ3A 4KWVA 4FF5A 4CKQA 2Y5SA 1WCGA 4LNCA 3PZIA 2YXOA 1J12A 1J8VA 3SUUA 3AO0A 2ZXDA 4XSLA 2PWHA 3W1XA 1TYGA 4S3BA 4LYKA 4JL1A 2VVNA 3EA3A 4M6UA 1CXHA 2XH4A 1A5NC 1KFWA 2XIBA 3RMJA 3MHGA 2X42A 1N55A 2ZE3A 2Y7EA 1VENA 1VCGA 3A64A 3MP5A 3KLKA 6XIAA 3UVAA 2HMCA 1EJXC 1J10A 3UWVA 4UNIA 3IJDA 1NJJA 5CPTA 3B05A 2KZHA 1E55A 4HN8A 4ERAA 3QPYA 2J7EA 3C3NA 3KOYA 1WDSA 4QRNA 1FXQA 4GUFA 4V1XA 2GFTA 3V0SA 1ZAHA 2OLHA 4CQBA 1ENUA 4O18A 2WNQA 4ZGYA 2DZSA 5CLWA 4IPLA 3QTPA 5G4WA 5IDIA 3LA4A 3WQ6A 2DZAA 3L4YA 3FJ4A 4MGGA 2NX3A 4JQ1A 3QY8A 1DE5A 1TMQA 1R2SA 4ZZ9A 1Z32X 3KOZA 1TX2A 4C91A 3BGJA 1S2VA 3MCOA 3PM6A 1K9EA 1Z8AA 5T91A 4H6KA 4UOQA 1YPFA 2GGEA 1GOOA 4GO8A 3PZVA 3LGDA 2VR4A 5H8PA 2I1OA 1PAMA 1PB0A 3WQWA 1NDVA 4PE8A 1Q6CA 1YNPA 1G0CA 4DBEA 3EWZA 1Z41A 3NNTA 1FA2A 3LB0A 4WCJA 1MW1A 5G2HA 2ZIDA 2UBPC 1K9DA 4E4FA 3W1LA 4JTSA 3SSZA 3UU0A 1R3VA 1J0YA 1EJVC 2R1LA 1IGWA 2A1YA 3NDZA 4QEHA 1X97A 2KAUC 3TA9A 4EAMA 4TMCA 2DQXA 4QS6A 3BANA 4FOJA 4XBJA 2GOUA 1JDAA 1Q6OA 1SW0A 3W7OA 4MHBA 4PTWA 3M5XA 1M3UA 1O12A 1P6BA 3WLKX 3S46A 1AW2A 3B8DA 3H4GA 1CX9A 3TOYA 3U7VA 1SJCA 4X60A 3ZT5A 4LY4A 4JTUA 2ZRXA 4D6DA 1FTXA 1UR3M 4HNNA 5B7ZA 4MOZA 3HPZA 5DO8A 4GNVA 4EACA 5H91A 3A5FA 1PHQA 2XSAA 2DZVA 4UR8A 4N2YA 2Z6JA 3A3WA 1NFBA 3AYVA 2I17A 4UZSA 3IV3A 3SY5A 3PJWA 3TYUA 3B8WA 2R9RA 3W74A 1XIDA 1QFEA 3VNDA 3WBYA 3GXNA 2BY3A 2A2IA 3DFYA 2CLMA 3PJXA 3WBEA 3ZQ9A 1I2OA 1W1A1 3FKKA 1EL3A 4MJ2A 1JUEA 1R30A 4PMRA 2WZTA 4RX0A 1JFXA 4JQAA 6TAAA 2WMIA 5CC6A 3NIYA 5LNVA 1YBQB 3H4XA 3D0CA 4HCHA 4QLLA 5A6JA 4GIAA 1ISWA 1JPDX 3UETA 2FDSA 3QR0A 2XFFA 3E2RA 3CK5A 3GD6A 3PP7A 4MJMA 4X63A 3S0CA 1TPEA 3VNLA 3JZEA 3GM8A 3PNZA 4CNSA 1QNPA 4QLJA 5D9NA 2XGBA 4TX8A 4XBKA 3QQ0A 1LRQA 1SR9A 5E1QA 1H51A 1XPYA 1QNOA 3VDCA 3VOIA 1A4MA 4FR6A 4WDUA 4BZYA 4AY1A 4E4PA 3FA5A 3QXBA 3CIXA 2X1TA 4XIMA 2O56A 2PTWA 3F1QA 1VFHA 3H8AA 1QHOA 3DG3A 3P60A 1VEPA 1CENA 1TWZA 3UXIA 3G77A 2QKFA 1F3XA 3EWDA 4QNWA 1JZ5A 4DNHA 1FWTA 2DPEA 1BG9A 3HPXA 1OFQA 4GHRA 2I56A 1JZ2A 1YIXA 3NZPA 3SCNA 1AJZA 4FLOA 4U5IA 3MWCA 4F3HA 2WAGA 4E5TA 4YIWA 2GVGA 3NVDA 1F05A 5G4EA 1V8EA 3GDMA 9XIAA 1JVNA 4Y8EA 3NQ8A 2WB5A 2H3DA 2WSKA 1QK0A 4JDYA 1YXYA 1HKJA 1W1VA 3VOGA 2Z1SA 2GOKA 3M4HA 1PHWA 4HA0A 4IP4A 3B9EA 4Q6JA 3ONCA 3STFA 1GVYA 2WOQA 5H8MA 1H7OA 5HULA 4W85A 2EXOA 3P0WA 4CD8A 4Q4OA 3TQPA 4MZYA 2FZ8A 3MV01 1VFUA 4P8XA 3WH8A 4RE3A 1I9CB 2G37A 3U4FA 4QISA 4D8LA 2V3FA 4DXKA 4FALA 4D6IA 4KWOA 1E6RA 5FJOA 2CLFA 3MU7A 4ASTA 1WAWA 4NZCA 1H49A 4B3LA 3EMCA 3GHRA 3GNPA 3VNKA 1Z42A 1CXFA 3OB8A 4NNBA 1QU4A 2ZWZA 5A95A 4CQ9A 5AB3A 1JQVA 2V2DA 1HL8A 4JFVA 4XKYA 4RZ4A 3GNNA 1R3TA 4GZIA 5JBEA 4F0RA 2E8YA 4GINA 5ABTA 4X9SA 3PZTA 4HHLA 3DIPA 1S38A 5CBIA 3BK0A 2Q6ZA 1DYSA 1DWJM 1UPMB 2GGJA 3ARSA 2C91A 3OEXA 1D7FA 4O13A 4FLQA 1IXQA 3T2OA 2VX6A 1H50A 4CQDA 3N4FA 4J35A 2E5BA 3NJ3A 4CVWA 1K4GA 3KS6A 3NA8A 3NL2A 3CM4A 2D20A 2ISFA 4JTHA 4GI6A 5EU9A 3LM7A 3U9IA 4HNCA 2V8ZA 3OVQA 2NSXA 3BLFA 1KFBA 3G22A 4UTTA 1L2UA 3NEHA 4EOUA 1UCWA 3IGXA 5HANA 2V5JA 1DQXA 2Z24A 1UZHA 5HUPA 5A6BA 3G1YA 3VIGA 1Q13A 2FJUB 1W1PA 2ACSA 3GHUA 5HR7A 3B8UA 3ZJ8A 1E4IA 2X30A 1XSIA 3UPMA 3O9NA 4GYFA 4B9ZA 2BTMA 3N13A 4F40A 3NZQA 1XUUA 3IUHA 1W17A 1RCQA 1TQJA 2G8ZA 2AMGA 1EYEA 1UWTA 4IZGA 4G7FA 3ARVA 5KMYA 4GJJA 1IEQA 1K1DA 1W3LA 4K1GA 3M5VA 1JXJA 2C8NA 4H9VA 3ES8A 3TZNA 3T8QA 2O92A 2OSYA 2F8QA 5A6LA 2HPIA 4WRHA 2PPGA 2A3EA 1F9CA 3NOYA 2YR1A 5I00A 2UY5A 3AOFA 2X8RA 1UKPA 4HIBA 1NF7A 1YX1A 4RE4A 5JIWA 3T55A 3GR8A 1MZHA 1PX3A 3N6HA 1A4LA 1SFSA 3GHSA 4GC3A 3W6YA 1H7WA 1Q4WA 4WXYA 1AJ0A 1AUSL 3TJ4A 5KINA 5CZSA 1I2PA 3B8SA 5EMYA 3L66A 3O7UA 4ZE5A 3NDYA 2CIPA 4J3TA 4RZ6A 3WDPP 4KMQA 3C5QA 3L68A 4FAMA 3ZM8A 3STPA 4HK5A 1M9HA 3BOLA 2HCVA 1W0MA 4FO4A 3RR1A 4HMEA 4WZHA 4K1WA 4LCRA 3CMFA 1KNWA 3T40A 2VRJA 5FAJA 5TQLA 4NASA 3N4EA 3T05A 3BAWA 1Q6DA 4HHHA 5BZAA 4L9ZA 2RFGA 1TWDA 3VIJA 2IKHA 3GE7A 3SN0A 3ABRA 1LT8A 2DT3A 3PWIA 4E8DA 1XLBA 1GQNA 4QBXA 4WOZA 3TE9A 3SADA 1BYBA 7PTDA 1LOSA 3SURA 4S2BA 4XO6A 1ICPA 1Q85A 3WJYA 3PBVA 3N2OA 1MVYA 3LTYA 1XSJA 5EBUA 4IQDA 2I5QA 1UKSA 3Q58A 1O4UA 4MJ4A 4R7OA 1J9YA 2XVGA 2XVPA 4PH6A 2ZRZA 3RMEA 4O53A 3P81A 3TQVA 3NSXA 1QK2A 1QPKA 2V3GA 1T99A 1KWKA 1XH2A 2OELA 1B5TA 3WQ5A 1J5SA 3EX2A 3WDHA 4Y9PA 1MW0A 2P1FA 4WDWA 5LA1A 1ECEA 2GJNA 1MI3A 4HK7A 3T2PA 3LMZA 3E96A 3QV8A 2F6KA 1R2RA 3T78A 3GKAA 4QQUA 4HP5A 4IX2A 3BAYA 4IIGA 2RAGA 5DBUA 5FI8A 3HV8A 4Q7BA 5F4SA 1DPMA 5CBJA 2WMIB 2EAWA 1HKMA 5A2BA 1O6IA 4ZENA 4XX6A 2CBIA 3WF3A 4OOUA 2D1ZA 3CV7A 1EF2A 3OODA 4PCTA 1GYNA 4HB7A 4GYPA 1QBAA 1CDGA 3VE9A 3L65A 2GVLA 2WKJA 4CNNA 1TPUA 3EWUA 3KBVA 2IPWA 3S42A 2Y61A 1FH9A 5DQPA 4D6EA 5A8QA 1MDRA 2W6RA 3SGGA 2J7DA 1JPIA 1XR2A 4YJ5A 4EWJA 3BOFA 3IRSA 5GVJA 4DXVA 3B8IA 3IIZA 2QCCA 4QCFA 5HBFA 2FPTA 3WDIA 4IUGA 1EP1A 4W5UA 1IEVA 4P7RA 4TVDA 4UTWA 1EZ2A 3AZTA 2CCRA 3NSNA 3GNDA 1R7OA 4C7GA 5FJPA 4C6IA 2Z1WA 3GLCA 3NYZA 3T9PA 5IOBA 2V6AA 5E0CA 1TTPA 1OINA 1SUXA 2DZTA 1RVGA 2FHBA 3N12A 2ATSA 4Y9NA 3MJYA 4QIUA 1VBUA 2OO6A 1CCWB 4E8CA 1E3XA 3CHCA 3APYA 1W37A 2HVOA 2WJFA 2OR2A 1QVBA 3O6YX 4JBRA 4DJFC 1M5WA 3MB9A 3PNUA 4QM1A 2OX1A 3PWGA 3OBKA 4ZSUA 3ZLGA 2WCGA 2Y7GA 3ECQA 4AZGA 4ZVJA 5BRPA 2XWDA 1JR1A 1H41A 4JQ4A 5I3IA 2X40A 4GFIA 1QT1A 1D8CA 4W9TA 1BFNA 2B7NA 1JI2A 3QTGA 2E40A 3EWYA 1WV2A 4S3AA 5DN1A 5CPLA 4LT9A 1OFEA 3P6LA 1S3TC 2VM8A 4U31A 3IAQA 1R38A 1NEYA 2ZTJA 6ALDA 1IE7C 3ONBA 1W9UA 1BGGA 1VCVA 4LVGA 4A2SA 2WYSA 2R24A 4K38A 2C13A 3QR1A 2Z1KA 4AMCA 2YW3A 4CN6A 3FYYA 5D9PA 3VA8A 2WVSA 1Y8BA 2ZXAA 3TMLA 3MC5A 2WHJA 4FX7A 3VKBA 1VKFA 3E5BA 3H70A 4JTEA 2XG9A 3M0XA 5DXYA 5LHFA 1D3GA 5HWMA 1JD9A 5L9FA 3KL5A 4M6VA 3FKRA 2HS8A 2YPIA 3TTQA 3ZVHB 5M2FX 1R3YA 3QV7A 3AUJA 3GXDA 4BF7A 1VBGA 4DO6A 1NARA 1ELSA 1F76A 3LNPA 3GBDA 3N2CA 3O1NA 5FJJA 1KQZA 3QYSA 4DWSD 1PWMA 2DH3A 2HK1A 4LNYA 3DUGA 3HPFA 9RUBA 3CMGA 1V5XA 1XLAA 2WLZA 3THDA 3LCFA 1H4PA 3IK2A 3CZEA 2E5CA 3BTNA 3F5LA 2G96A 2YL6A 2UZ9A 2J7BA 3GFZA 1TE6A 4JYDA 3G6MA 1E6XM 3VGHA 2HXUA 3TMQA 3P5YA 4EANA 1EO7A 3BAKA 2Y8VA 4ENLA 5BCAA 3G18A 4CN4A 4RZ5A 2OSXA 2CPUA 1AQ0A 1MXDA 1N2VA 3V5OA 1E72M 2E6DA 1XC4A 1NSJA 2WSRA 3W1MA 3I7RA 4NU7A 1ZLPA 1NTHA 2PWVA 4FXRA 3CEPA 2WZHA 1HT6A 4NZ1A 3LENA 3M0LA 1ESWA 1OK6A 2PP3A 4X3ZA 1ADDA 4DO4A 1FFQA 3FK4A 1HIZA 4EPBC 3L4VA 1BEUA 1PZ0A 4M5PA 1TVPA 1XIFA 1OD0A 2CFFA 3W1RA 4F0SA 5C55A 2VFEA 2VCBA 4AZCA 4DF1A 2VZSA 2A85A 1UUMA 2POTA 4LF1A 2KX9A 4HHPA 2G3JA 1W1ZA 4KFNA 3SY8A 1P0KA 2C15A 4AC7C 4S23A 1EEXA 1CLXA 2P5NA 3SB0A 4AWEA 2A3AA 1HJVA 2V67A 3H2OA 4XVDA 1E4NA 3A22A 4Z42C 3TXZA 5ABGA 2OXNA 1K9FA 1SZNA 3KEHA 4M7TA 4B15A 4U3AA 4PTDA 4LAUA 1VIZA 4WK9A 4FA3A 4IMDA 1FP8A 1AODA 3N6QA 4I9TA 3UZZA 1HNYA 1QW9A 3G0XA 4B4FA 1TV8A 1U5VA 2DVXA 4URIA 3WLSA 4GNKB 4NRSA 4U2ZA 4DNMA 3WMLA 4DY1A 2DY3A 1HJQA 3CHFA 1G4TA 3DI1A 4YVXA 1GVQA 4M51A 2CLKA 5DMNA 4MMWA 2HDJA 4UMBA 3LV6A 4K37A 1T6MA 1J0KA 1WBHA 1ODZA 5EPDA 5F2MA 3WD3A 3QZ6A 4WGXA 1OGBA 4CD4A 1ZP4A 3NUKA 5D03A 3BJTA 4W8BA 3WF1A 2PAJA 4XUYA 2BASA 2D0GA 1M65A 2I9EA 3RDKA 1GZGA 3KZSA 1U1JA 4OHQA 3E49A 4FNQA 1XF0A 4UTUA 3GS6A 3O06A 1ITCA 4KCUA 3B0XA 4BI6A 2CHNA 5FSDC 4GUGA 4WD0A 4MB3A 1KBLA 3M7SA 3LRKA 4JICA 5BMWA 5EY5A 2ACUA 4HN4A 3W72A 4JTJA 3UG8A 3VU2A 1QATA 4RPQA 2R8WA 2C18A 1C8QA 2YSWA 4AZ6A 2VELA 1JG9A 3WUFA 1UMYA 4MAVA 1JDEA 1K03A 3ARRA 2PFHA 1EHAA 3CEUA 4Q4QA 1EF3A 4E4UA 3MSRA 2JKAA 1OD8A 4M7SA 4V2XA 4O16A 1JCTA 3NPWA 2HISA 1WDQA 3H54A 3UZXA 3GWQA 4DJDC 5A8MA 2XINA 3SJ3A 4MY9A 1GVEA 1RHCA 2PMQA 1LT7A 4HT3A 5D2WA 1B9ZA 1FWWA 5GNZA 4OUIA 2PWUA 1B3OA 1FKXA 2FFCA 3WD0A 1VR6A 3DG6A 3W28A 5DMLA 2DVUA 3EEZA 3M47A 4JX5A 5LGXA 1NWUA 3UEQA 4KEMA 2NXIA 4FSAA 5GPRA 2ZXQA 4XVEA 3TJXA 4B2DD 2JE8A 1P0NA 1B9BA 3LGEA 3OBEA 5F2IA 2FMOA 3TAKA 5IHRA 3BCJA 1ITUA 2FTWA 3AYTA 3MSYA 2ZWYA 1F5ZA 3SECA 4O1CA 1X39A 3KRSA 3TYBA 2XH0A 3DU0A 2FHFA 3KHDA 1H7RA 1OCNA 4RK8A 3VMNA 5DEZA 4ACZA 2ABBA 3NQFA 1DQUA 1A5UA 2BV9A 1X8FA 2WHMA 3MKVA 2Z1XA 5I23A 1MNZA 1HVXA 1XYLA 2AQVA 2QVHA 3S1XA 3W7KA 3N11A 2PGRA 3HQPA 4MWAD 4L56A 4YTUA 5CZ0A 4UQCA 3M46A 4I7VA 4GVIA 2FH8A 3RPTA 1NWRA 3ID7A 3MCMA 1S5MA 1SO4A 1RK6A 3LCIA 4ZL1A 3DN5A 2YBUA 5K4ZA 2VOTA 5CCZA 2J62A 3BW2A 1Y5XA 4BHYA 5CJMA 4FNSA 4FZIA 1UWUA 5BWFA 1KRCC 9CGTA 4AZHA 3DECA 4JN7A 2ZUWA 4HCDA 3BGGA 2CBUA 4GMEA 1QI2A 2WJEA 3S5OA 2C3ZA 3B8TA 1KC7A 3V0TA 1QI5A 1NDZA 3T07A 3WDRA 4DF2A 1Q6LA 2B7OA 3I4KA 4Y9MA 5I3HA 1ZENA 1WDPA 4PL2A 3VD5A 3GUGA 1MQQA 5AHLA 3QVQA 3UWZA 1HW6A 3H24A 4HYRA 2ZX7A 2TYSA 1FCVA 2PWGA 3GVRA 3HGOA 3W6LA 3LCWA 2ZCGA 1V0NA 1A49A 2J8FA 4DUXA 3DG7A 3TW7A 4UFJA 5BOOA 1H5VA 4J5NA 3M0JA 1OFAA 3PULA 4JNZA 1V0KA 4N0RA 4DBSA 2HSAA 1PV8A 3SN1A 2NT0A 3G8EA 5C54A 1XGDA 3EOUA 2ZUMA 2DZBA 1LL6A 4TTGA 1BYDA 4ECLA 3FNDA 3VGEA 2D3NA 4X61A 3PSVA 1DIOA 4PMQA 3VMOA 3ZSSA 4NYUA 5D4YA 3B97A 1XQKA 3UG5A 1H1NA 4UNLA 3P84A 5FIPA 3AMDA 2PCEA 1UH4A 1ZTVA 2CWXA 1XYFA 2ZUTA 5HA7A 2WLYA 2BODX 3SCVA 1F61A 4HNLA 1TCDA 2OT0A 2PD5A 2QUTA 1SW7A 1VQTA 2GJXA 3P2VA 3WN6A 2GQ3A 1FBAA 2PDYA 1UP0A 1O1ZA 2V9DA 1DQWA 3C2YA 2RDTA 2G3NA 1TWIA 2PTYA 2YGYA 2EHHA 4IGMA 4K8GA 4PL1A 4A8LA 4AZCB 2WM1A 3CPGA 5EL1A 2VQUA 2W9MA 1Y0EA 2PRHA 5BXRA 1E9LA 1VLIA 4NX5A 4GXPA 1XIBA 3H4WA 3KCLA 2BOEX 4K3ZA 1RA5A 3KBJA 4IPNB 4E3TA 3OZMA 3G3MA 3COTA 3W00A 3FEMA 4DO7A 4EF8A 1WKFA 4PMOA 4LUTA 2V2HA 4C6DA 1W2VA 4Q8OA 1Q6GA 4ADUA 2R6OA 4LYRA 3ARUA 1R87A 4GGHA 4AY8A 4NI3A 4TVUA 3AS0A 3ANVA 3E6EA 2ZC8A 3PS7A 4LGXA 5CBBA 2UV8G 5EB8A 5MF5A 1E9YB 4BEQA 1CECA 2ZA3A 1TR9A 3AWNA 1ZGDA 2VXNA 2PDWA 4PB4A 4WSJA 2CZ5A 1CXKA 4TR9A 1B3WA 3TUUA 2F2HA 1UKQA 4GX9A 3RF9A 4Q22A 4IUOA 1ZFJA 2PI6A 2PDKA 1ZSXA 4O15A 4XISA 4KEVA 2GLKA 4G8TA 2VC7A 3WNKA 1EP3A 4N9BA 3T7VA 2ZZ6A 4DPQA 8TIMA 1EO5A 5DF0A 4U4MA 1GW9A 1NOFA 2WSQA 4GH1A 5AC5A 2D3LA 2QUNA 3K46A 3KWSA 3DXIA 1Q5MA 5D30A 2VJXA 1JEZA 2W27A 7ENLA 3I7SA 3VD9A 4JN8A 4F9DA 4PODA 2FZDA 2TODA 1JPKA 3TYDA 4AUBA 1GOXA 3SFKA 1U22A 3K1GA 1WO2A 3ARZA 3ITOA 1VEOA 2XN2A 2CWNA 3L0KA 2GQAA 3CV2A 5LIYX 1RBLA 4V15A 3TN3A 3KUMA 1W8SA 4JHZA 4ZSTA 3K4AA 2YCIX 4MPQA 3C6CA 4A22A 1QNSA 1ZS2A 1JCNA 4DIAA 2YB1A 3RPDA 4C65A 1GVRA 3WIJA 2I7GA 1EJTC 1TJRA 3F5KA 5REQB 4V27A 4PMVA 3VGGA 4XAZA 1Q6RA 1E70M 5A6SA 4O1DA 3U0HA 4I3GA 3VIIA 3EWXA 2PDGA 2X0SA 1VHNA 4RV3A 4DEFA 4QAWA 1Y65A 1Y5WA 3KOFA 3GAYA 4J3ZA 4WY0B 1HJUA 4LV4A 1DBTA 1KFKA 3UPBA 2OPJA 4XWUA 3EWWA 4DJFA 3F4DA 1M01A 1BPLB 3N6JA 1QWKA 3TAOA 4E0CA 4IMFA 1B31A 4LVA