3BURA

Crystal structure of delta(4)-3-ketosteroid 5-beta-reductase in complex with nadp and testosterone. resolution: 1.62 a.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2008-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3burA00
1RALA 5LIXX 3G1RA 4HBKA 1X96A 1GVEA 3GHRA 3CV7A 3LZ3A 2HVOA 1VP5A 1XF0A 4F40A 4L1WA 3FX4A 3G5EA 4YVXA 4QBXA 3CAVA 1HW6A 4ICCX 2A79A 3LZ5A 4IJRA 3F7JA 3P2VA 2PDFA 4H7CA 1S2AA 2INZA 2ACRA 5LIKX 3U2CA 3GHTA 3V36A 1OG6A 2PDLA 4FZIA 3R7MA 2IPWA 3UG8A 4XZLX 2NVCA 4PMJA 2VDGA 4R9OA 2DV0A 4JIRA 4L1XA 1AH0A 4XZHA 3WG6A 3EAUA 4DZ5A 4XZMX 2IPJA 4PR4A 5KETA 1PYFA 1PZ1A 3ONCA 1PWLA 3R58A 4JQ1A 5C7HA 2WZTA 1Z8AA 4PUWA 4LB3A 3RX4A 4QX4A 2FVLA 3H4GA 2PDQA 5AZ0A 3QKZA 2PF8A 1US0A 4GQGA 2DUXA 1EL3A 1K8CA 3KRBA 3BURA 2BP1A 1ADSA 3RX2A 5LIWX 4Q7BA 2P5NA 2FZDA 4GA8A 5JH2A 4ASTA 2FZ8A 3UGRA 1ZGDA 4I5XA 3Q67A 2PFHA 4PRRA 3LUTA 3WCZA 4XK2A 3DOPA 1EXBA 2PDWA 2ISFA 3MB9A 1Z3NA 3FJNA 4IGSA 4WDWA 2PD5A 3V0TA 3WBWA 5JH1A 2ACQA 2PDIA 2PZNA 1AH4A 4XO6A 2PD9A 3GUGA 3LN3A 4JQAA 4XVEA 3LEPA 4QXIA 1IEIA 4YU1A 1A80A 4HMNA 1LWIA 3LQGA 2F2KA 4WDTA 4XAPA 1SM9A 2PDKA 3R94A 2IQDA 2PDGA 1R38A 2FZBA 2I17A 3LQLA 4GQ0A 1S1PA 2PDUA 1YE4A 2F38A 1AH3A 1JEZA 1MZRA 5HA7A 3R6IA 1MRQA 4JIIX 2PDPA 1ZQ5A 4GABA 3DN5A 4PUUA 3H7UA 4LBSA 4XO7A 2BGQA 1VBJA 1Z9AA 1MI3A 3UZZA 4WDXA 2HDJA 1PWMA 3BCJA 1LQAA 3LBOA 4GACA 1Q13A 4AUBA 5DANA 4JTQA 4G5DA 4OTKA 3WBXA 4GIEA 4XZNX 2CLPA 2IQ0A 1FRBA 4JTDA 3UZWA 2IPGA 2PEVA 1J96A 2FZ9A 1S1RA 3RX3A 3UZXA 2IKGA 2R24A 2C91A 1C9WA 2ACUA 1YE6A 3CMFA 2IPFA 3UP8A 3UYIA 1T41A 2NVDA 3UFYA 4NKCA 5LIUX 5HNTA 3GHUA 3N6QA 1RY0A 4DBSA 4LBRA 2HV5A 2HEJA 4YS1A 2IKJA 1Z89A 4JIHA 3VXGA 1Q5MA 3LENA 4EXAA 4WGHA 3S3GA 4XZIA 4RPQA 1T40A 5M2FX 1X98A 3V0SA 2I16A 3EB3A 1ZSXA 1S2CA 1UR3M 4H8NA 3H7RA 3B3DA 4JQ2A 1M9HA 2PDCA 3R43A 4EXBA 3D3FA 1AFSA 3BUVA 2ALRA 2PDHA 3GHSA 1HQTA 3N2TA 4YVPA 2IKIA 4LAUA 2BGSA 3ERPA 1AZ2A 3ONBA 3MC5A 3CASA 3V0UA 4FAMA 4Q3MA 1PZ0A 1IHIA 4FALA 1RY8A 2J8TA 4JTCA 3WBYA 2PDNA 5HNUA 4FA3A 1AZ1A 3V35A 3T42A 4WEVX 2PDXA 4GCAA 2FGBA 1QWKA 3COTA 4YVVA 3CAQA 2PDYA 3EB4A 3M64A 3R8GA 3UZYA 4PRTA 3UWEA 1YNQA 2IS7A 2DUZA 2QXWA 4WDUA 2INEA 2WZMA 3Q65A 3C3UA 1XGDA 5AZ1A 4DBWA 4LB4A 3LD5A 2R9RA 1X97A 2IKHA 3M4HA 1XJBA 2PDBA 4JTAA 4JQ4A 2HE8A 2HVNA 4JQ3A 1EF3A 4WRHA 2ACSA 4IJCA 1YNPA 2PDJA 3LNMA 3M0IA 2HE5A 1EKOA 3NTYA 2AGTA 3O0KA 4XVDA 3BV7A 3O3RA 3CV6A 3R8HA 1QRQA 4LAZA 4QR6A 2PDMA 4MHBA 4ZFCA 1ZUAX 4JTRA 5LIYX 4DBUA
chains in the Genus database with same CATH superfamily
1H7XA 1YTDA 3GTXA 1OFOA 5CPMA 3G5EA 4IIBA 1LZOA 2TRSA 1PEZA 4ERGA 5DX7A 4BWLC 3MCNA 1P6WA 3GU1A 3LZ5A 1KFJA 1ZP4A 1KFCA 4JXCA 2XHYA 5CZKA 1S39A 4OIFA 3E2SA 1XD1A 3UG4A 1WCGA 3PJUA 4L6OA 1HJXA 2R91A 3R7MA 4H8HA 3TLLA 2VCAA 1H5VA 4RNFA 5JBFA 4B4FA 1H7NA 5D8ZA 2CU0A 1D7FA 3M5VA 2Z25A 3TQ0A 3DEQA 2QCLA 1FBAA 4C7DA 3CUFA 4K36A 3CUZA 4GISA 3KL5A 4XD4A 2HK1A 1Z8AA 5CJMA 2OKOA 2XYLA 1JIBA 4Y2WA 2B4GA 4J5NA 3KTSA 3T78A 2QS8A 2EJ1A 3KVKA 1G7UA 1V6UA 1EHAA 3LCGA 1P48A 3MSDA 1F5ZA 3QKZA 2CZVA 1S5VA 3ABXA 2VGGA 2JE8A 1EL3A 3GTHA 1EGZA 2FHCA 3OP2A 4H8UA 1CB7B 1EJRC 1W3KA 4O12A 3ARWA 5A69A 2BHUA 4ZEPA 3L0KA 3QV6A 1XBYA 2OPJA 5G4EA 2YYUA 5EFFA 4QS5A 3KEHA 2VFEA 2NUYA 3HV9A 3M0HA 4BI7A 4PZVA 4WDWA 3CV2A 1QJWA 3PTMA 3GDKA 3DYPA 1DE6A 3MTWA 4OOZA 4XVEA 1J93A 4RJEA 3MMWA 4I8DA 3DAQA 5D38A 3JW7A 4JTEA 4HCLA 1W5MA 3OA5A 4LAKA 3LYEA 1RCQA 4GNKB 1R3QA 1XQLA 3VIJA 3E02A 1CLVA 4HOZA 1OSEA 1HKKA 5DCEA 5D2WA 4QS6A 3W7MA 4GKTA 1MRQA 2WLYA 5FEXA 1PDZA 3GXDA 3KBJA 3V16A 3DN5A 3PTQA 1GQNA 1E15A 5C9UA 3IV8A 2HROA 1QI5A 2ZQ0A 3VE7A 1YW1A 2QPSA 5IRPA 3VTRA 4RW5A 1BFNA 3LI1A 1TZ9A 2OYLA 3WQPA 1W1A1 2NV2A 3PFRA 3O7UA 5I23A 4UZUA 4JICA 1VH7A 4PL2A 1N8WA 1TPWA 3A47A 3H6OA 3UWZA 3N12A 3C0LA 3U2EA 3E2VA 1AQFA 3RJXA 2WBKA 5SWUA 4EPDC 4EPEC 2J9XA 1TWWA 3HF3A 3OVGA 1DWAM 2ZUWA 3BQ5A 5CAHA 5D02A 1TB3A 3PZGA 3W2JA 3W01A 2X30A 4EVZA 5DT5A 4C6CA 3H53A 3K46A 2VM8A 4H9YA 2J77A 3SQSA 4HTBA 1XBXA 4HU8A 5CH9A 1ESWA 2FGZA 2YFOA 2Q3RA 2C1HA 3VAVA 4DJFD 1BKHA 1ALDA 4YS1A 5DRCA 2PC8A 1S2UA 3WLKX 4MY8A 1PS9A 3VKBA 2GUBA 2C18A 3G1FA 4WGHA 4XZIA 4W88A 3G1AA 4KIEA 4LS0A 5AOUA 2EJAA 2KX9A 3QGKC 5FL0A 2V2HA 1U5JA 2BNJA 3V1HA 6XIAA 2A3HA 3H7RA 5BXTA 3P8IA 5F4SA 4B3ZA 3R43A 1GVSA 1WE5A 4Q8MA 2YLAA 1LLOA 2ZX8A 5K4XA 1EOMA 2E77A 1OFRA 3SURA 4JTJA 4MY1A 1F74A 3ES7A 3UY8A 3U7BA 3P14A 2WK2A 5T9BG 1Q6OA 3CIWA 4JX4A 5AYZA 5CPTA 3KHDA 5L6UA 1W9UA 2ZFAA 4QTGA 2P53A 4UQEA 1ODUA 2R1LA 3EPNA 1LQ2A 1TV3A 4GX9A 3G22A 3IIOA 4FA3A 1L9WA 3W1MA 2G3IA 2JF6A 3DZ1A 2VEMA 1LG1A 3BAIA 2PDXA 3NGFA 4FXFA 1FH8A 4IP4A 4PCFA 2BHZA 4C6FA 3ZWTA 2QCHA 2JIWA 2WVSA 3W1LA 1F8IA 4ZTYA 1DQWA 3C2YA 5A6AA 5GJMA 3PBMA 5K7JA 4TMCA 1FKWA 3WK2A 4OE7A 2QPUA 1JF5A 2ZZ2A 4JNZA 2QF8A 4A8IA 3HO8A 1OYBA 4IHCA 3AZTA 4LOCA 1LLWA 3CAKA 1L6GA 2GVGA 1AG1O 4CEXC 3NO5A 3VKJA 4JN8A 3W88A 7ENLA 5FJRA 4O52A 3BAYA 5JVLA 2W91A 1RUSA 4PA8A 4Q8PA 1OINA 1N82A 1PB0A 4UTWC 1AL8A 4WIWA 1VCGA 1FCBA 3ARZA 4UMCA 4UTTA 3A3HA 1DTUA 2BFGA 1V79A 4IFRA 1D8CA 3OVQA 5C54A 1LG2A 2FTYA 4ZFCA 4B16A 4JD4A 4Y8FA 1GQJA 4P7RA 1G1YA 3GNXA 1CT5A 2PMQA 3CV7A 3POCA 1N8FA 2CNCA 4K1WA 3WFLA 3QY6A 3R79A 2V6AA 5EA9A 1A0CA 4YWIA 1IT0A 1TTIA 1L6FA 3W7OA 2ZVIA 4Q4QA 3KM8A 3CO4A 1I60A 3GC5A 4LUJA 3S9ZA 1BF2A 3T2PA 3KCJA 3NURA 3QW4B 1DXEA 3VNZA 3F2BA 1KO0A 3TN6A 3NQFA 1XR2A 2WC7A 3H26A 5I3JA 1BWVA 2CBJA 4KERA 2AQVA 3WD0A 1U5VA 4C6MA 1EP2A 3W1UA 3DX5A 3GH5A 4S3CA 1CGWA 3MS8A 4LUTA 1MEIA 2X1SA 4MG4A 4G7EA 1EF2A 1VC4A 4TVCA 3S83A 4JTFA 4J3UA 1A5AA 3ISIX 4JHZA 4MOZA 4N7QA 3GVRA 3TC7A 2OO6A 3I3DA 3AU6A 3ZVHA 3A12A 3AS1A 1UH4A 4KETA 5AC5A 4GNVA 1M7PA 1AW1A 3L4XA 3T1GA 1NY1A 4LFYA 3LM3A 1O5RA 1VRDA 1XIMA 1SFLA 3G1DA 3WF1A 4US5A 4REQA 3MT1A 4MUZA 3BWWA 3EXTA 3FV9A 3LCWA 5H91A 1CWYA 3I6EA 1H2JA 4S3BA 3Q67A 4D6EA 2J27A 1HG3A 2RDWA 4FOUA 1EXBA 3LXCA 1EJVC 3FKRA 3W7EA 1REQB 4AWSA 2V9DA 4UQ9A 4C5ZA 4IGSA 1O60A 3W73A 2WNZA 5JH1A 3N9SA 3FXYA 1S5MA 4PYSA 5AHLA 1JZ4A 4IGNA 3TYAA 2BLEA 2QGYA 4YLWA 3TTOA 5AC8A 2JKEA 1OWQA 2BXYA 4HU0A 1EIBA 4NYYA 3WENA 1HXJA 4QJ1A 3OG3A 4K8HA 2UY4A 1BG9A 5CC5A 4O13A 3C2RA 2WMFA 2I5QA 4PTWA 1SGJA 2FHFA 3OBKA 3QH2A 1JUBA 3S5SA 2ZRXA 2GVYA 4I90A 4RDWA 3TZFA 1WV2A 4EPKA 3UR8A 4US5D 4IMCA 1BSLA 2PWHA 3UERA 9XIMA 3MO4A 2CZ5A 3TN4A 4YTTA 1S3HA 2Y24A 1GTHA 5ABGA 3HGJA 1UCWA 1UC5A 3IARA 4QQ3A 2P88A 4O53A 5ENLA 3BARA 3GQYA 2DT1A 1DYSA 3LMZA 3VMOA 1BSIA 4G5DA 3VZXA 2J7EA 1HKWA 3GU2A 5IDZA 4EANA 3KOYA 1FRBA 4A35A 2PEVA 3GXPA 4BA0A 5CJ5A 4LS2A 1CLXA 2ZX7A 1J96A 3F2CA 4UMBA 3GTFA 4Q8TA 3VIPA 2QJGA 4IT1A 4H9XA 4P7QA 2VFGA 3HZ3A 3W02A 2VC7A 5A2AA 1BXBA 5AHMA 1R3VA 3BG5A 1ZHAA 1US2A 1H7WA 4O14A 1QATA 3I3BA 1T41A 1F2JA 2Q09A 2NVDA 1KR1A 3H2CA 5LIUX 5F4XA 4XAFA 1VIZA 1FUYA 2BOGX 1GW1A 3OU8A 3VNDA 1PKLA 4HZ6A 2X41A 4LBRA 4YYFA 3S42A 2J7HA 4RZ5A 1W5PA 4HNLA 4TV5A 1RJPA 3CZEA 4IFKA 5AB3A 2FIQA 4GQQA 1GG0A 3RPDA 2J7BA 1ITCA 5BZAA 1RAKA 3EDDA 1TCDA 1XRVA 4JTKA 1I8JA 1JI1A 4Y9OA 5HDRA 4AD0A 4L5ZA 3RMEA 4CCEA 1UA7A 1GK8A 4ZQRA 3T4WA 3GVWA 1UR1A 4HA4A 5I5RA 1TR9A 4RZ4A 5C2CA 3HTWA 2CHRA 1YXCA 1HQTA 3EWWA 3N2TA 5D9MA 3RLUA 4UC5A 4XIAA 5D9OA 4AB4A 3CB8A 2GGGA 3IRDA 5A1AA 1W31A 1ZTVA 1JI2A 5GPRA 1TE6A 3BLDA 3Q58A 1UQZA 1XQKA 5C5YA 4YN5A 1JCNA 3G6LA 2QQ6A 3L7RA 4QEHA 1B3YA 2Z7KA 3W7HA 1C3FA 3QMTA 3Q94A 3AYRA 1Z41A 1XINA 5FJUA 2ZUMA 2PGWA 1X1OA 4KS0A 3VGBA 4LUTB 4V1YA 2I9EA 1TX2A 3LPFA 3COTA 3GW0A 2W62A 1F76A 3UZYA 4HIBA 4PRTA 1XL9A 2OZ0A 3GYEA 4PRWA 2BZNA 4JKMA 1R3RA 4WQ6A 1YX1A 1M1BA 5AHFA 1GVRA 1FWDC 1KA9F 3RM8A 3N6JA 5H8MA 4LY4A 3CQKA 4FS9A 1TV2A 4C6QA 3OHMB 2VT0A 2F61A 2P50A 1HIZA 4GJ1A 1VB9A 1RK6A 1FVPA 4GC4A 3ITGA 1RLCL 4IMEA 4B9ZA 2E28A 3UQNA 2Z4GA 4GPNA 3BV4A 1XH1A 3W7KA 3PG8A 1Q7MA 3TZNA 4ZODA 3K8MA 3KOXA 3DXIA 2PCQA 2XIBA 4CU7A 1WKFA 1QHPA 1F3XA 2JBMA 4O4WA 2PZ0A 1U1UA 4Z0SA 4TMBA 1T8QA 4GQBA 1HL9A 3GXFA 3ZJKA 3QTPA 5LSMA 4C90A 2VL4A 3P60A 3RYSA 5LIYX 3KX6A 4Z2LA 4A05A 3WDIA 2HBXA 4KCWA 3L2LA 4GJIA 4W89A 1RP8A 4F40A 3KL3A 4YVXA 3W6MA 1HW6A 2CKRA 3TV8A 5DBTA 3RFAA 3KUMA 2A79A 3PAOA 3JVAA 5HMDA 2E6DA 3E74A 2X0YA 2J62A 2OGYA 4PL1A 4KEVA 2NXGA 2BOEX 2H3BA 3NVTA 2E5BA 4Q22A 2PDLA 5BYWA 5C2GA 3DFOA 4PTDA 2V3EA 7A3HA 1H4PA 2VP8A 4K68A 1GYNA 4Q6JA 1FWCC 2V5KA 4JX6A 1YPXA 4H6EA 2ZDRA 1V6VA 4XZMX 3MWAA 3PPGA 4BK9A 4N4QA 3VD3A 1AUSL 4IQLA 3AIUA 3OGVA 4DJFC 2Q02A 1KRAC 1DWHM 4LB3A 5FSDC 2Y70A 4W8BA 1ZRQA 3RX4A 1VYPX 2VYOA 3THUA 1ZJBA 4GH1A 1WUEA 4H19A 5HQEA 4E8GA 3DECA 4UTMA 3A3WA 1D8WA 2E6FA 2GSJA 1H63A 2FTWA 2XGBA 3O6DA 3S2LA 4J9JA 3EEGA 1TPDA 3AIQA 2O9TA 1YTEA 1SW7A 2A7PA 4WUIA 4TU1A 3GW3A 5HWJA 3DH7A 1JYVA 4UFKA 1LF1A 4H01A 1B1YA 4IFKB 4Q33A 2WCGA 1P5BA 3R25A 3S9YA 4XISA 3UXLA 3FJNA 2PD5A 4ZB0A 3PTKA 5JMUA 1E0TA 4Q8VA 2ZBTA 4MKVA 3CHCA 5E9AA 1LOSA 1W17A 5E0CA 1FDZA 1KFKA 4Q4SA 3NL2A 3PC0A 1XPGA 4HOWA 3C4UA 3N1AA 4CQCA 3URQA 3MYPA 2Y7GA 2F38A 2R1PA 3JS3A 4W85A 4WR3A 2GYIA 4E38A 3RPMA 4PUEA 3K1GA 4ENLA 3M46A 4UB9A 4B5NA 4WKAA 3JRKA 1B30A 3W72A 4JTLA 2PDPA 1QW9A 3F2DA 3GXTA 4XKYA 4ZOBA 2NV9A 3TKFA 1OFAA 4Z0JA 3ZVIA 7ODCA 3VIFA 2EKCA 2I1OA 1OB0A 2VGIA 1K77A 3NQ8A 4MZ1A 1VJZA 1TYGA 5AKQA 1ZCOA 2ZZ4A 5FD0A 3VOJA 3MHGA 4BJHA 4FNTA 4TIMA 1FHLA 4GIEA 1RBLA 1Y65A 3SI9A 1UUQA 3L23A 2QVNA 3M9YA 6XIMA 2ZUVA 3CK5A 3BQ6A 3VGEA 3WQFA 3WDRA 4AIBA 4D1JA 3F5LA 3LSBA 3R0UA 3II1A 1UR8A 3KBMA 4XUYA 3OEXA 3HPAA 4CQ8A 4O8RA 1KRMA 2G3MA 2PTWA 1O7AA 3VUSA 4LTSA 1V77A 1GKPA 5CBJA 1TZZA 2EPMX 3ZO9A 5FCZA 1OEPA 1PHWA 4ZTXA 1UR0A 1VFSA 5GNXA 3QLDA 1PBGA 2ALDA 2C16A 2Q8XA 4RDYA 5FJJA 4L4MA 1SR9A 1QDSA 3ZLFA 3A4AA 4RUBA 4ZO6A 2G4JA 2A3AA 1E1FA 2RUSA 3NJ3A 1DJHA 5I3FA 1WQ5A 1CIUA 2BB0A 1VEOA 3EXRA 3TJXA 4UXDA 3MWCA 1S5WA 3D3FA 2P1FA 2ZWZA 4IMGA 2FB3A 3WYZA 2ZC8A 4P7NA 1P1XA 1JZ5A 3OTRA 1N55A 3W76A 4AZCA 1CGYA 1A5NC 4Q3MA 1PZ0A 2VFHA 3A4XA 1OD0A 1CW2A 2WB5A 4J35A 3G77A 3BICA 4O57A 4DZAA 3NQ7A 3HJZA 3UCDA 4DQWA 4AVNA 4CQ9A 1OHLA 1PDYA 4Q8UA 4CD7A 1J12A 4AIOA 1YPIA 3BLLA 3WQ5A 4MAVA 1Q45A 4J3TA 3DFNA 3PUGA 3R8GA 3OIHA 1W1TA 3WH8A 1F05A 3SRDA 2O7SA 1TMQA 1XDLA 1YEYA 2DDXA 2QZRA 1BKSA 4J27A 3LV5A 3NOEA 3EWZA 4C6BA 2DZPA 5A8MA 5F4WA 4JQ3A 2GK1B 5GJPA 1GJUA 1QNSA 1VFLA 3EEZA 2ATMA 3UXAA 1Q8AA 1UWIA 2PBOA 3VFLA 4OOUA 5FSEC 3I10A 2PB1A 1Q6CA 3LXBA 2AAAA 1IWBA 3KS5A 5IM51 4WXZA 1FX6A 5AHNA 3RHGA 5ABEA 2FMOA 3DENA 4MHBA 6TIMA 3EB2A 1WDQA 4DJEA 3HBLA 1EBGA 1JCJA 3U7VA 3PY2A 4NAEB 2CETA 3W1QA 1EUNA 4LQ1A 1PXGA 3B8WA 1EZ2A 5FJPA 1KC7A 4ZXLA 1NFBA 1W1ZA 2XIJA 4GUIA 2WMGA 4ICCX 5DMYA 4PFMA 4DJDA 4XSLA 5HINA 4W93A 3WNPA 5LXEA 1S2AA 4WKHA 1C90A 1SO5A 2W27A 2IPWA 1E70M 1YBQA 2WZEA 5J5DA 1JDCA 4AMAA 8RUCA 2JQXA 4NI8A 1VBHA 2PTZA 1UH2A 3SUUA 2VC9A 3D47A 3NZPA 4XZHA 4BR1A 4DZ5A 4A8NA 5D2XA 2D22A 5DY2A 1W91A 1OJXA 4HKPA 4CQBA 1K6WA 2QAPA 4PH6A 4TO8A 3UYCA 2NQ5A 4JCMA 1JPDX 1IE7C 1F61A 1RHCA 4PUNA 3WF3A 3NZQA 4XQ6A 4A4AA 1YNYA 1PE1A 3TDFA 3BGGA 2FPYA 2NWRA 1EUAA 1QAPA 3VCNA 4J3ZA 4ATDA 3O1NA 4CNSA 5G5IA 1KGXA 1W3LA 4LAMA 4L6HA 3HQ1A 4I6KA 1LTDA 2BY2A 3EKLA 2OSYA 3SCVA 1PZ3A 4IICA 4H7ZA 4DHGA 3LGDA 3BOXA 1ZGDA 4CVWA 3KRUA 3HV8A 3WLQA 4QLJA 3C2OA 4Q4KA 1KM6A 4Z1BA 1GOWA 2IXVA 2DEPA 4CN1A 2A3LA 3B8TA 2PP1A 4PCPA 4AW7A 2QHAA 3WUGA 1OYCA 2VR5A 1TPH1 2Z28A 4DX3A 3GUWA 3W7LA 3TQPA 1CXHA 4DEFA 2VX5A 5FJOA 1W2VA 1J2WA 1A80A 3ZT6A 2YX0A 5CLWA 2IQDA 2J4GA 4NXSA 3GX9A 3DBNA 3B9NA 3IGSA 1XPYA 2PDUA 3TFCA 2DT2A 4OV9A 4HK7A 1RSCA 3B40A 3T8LA 3PUEA 4PMZA 1I9CB 2GQ3A 4HSOA 4HHPA 2Z1KA 4XZ9A 3GAYA 3LTPA 5I3DA 1M65A 2ZX6A 3H7UA 4RZBA 1QPRA 3WQOA 4UFJA 2Z2BA 1X6LA 2QF7A 1A5UA 1F73A 1XW8A 3UZZA 3WLSA 2QLYA 3BCJA 3EZ4A 4H6RA 2DSUA 4FP1A 1UOZA 1A5MC 1XLCA 3L4WA 2WO5A 4JTQA 1CNVA 1HJQA 4O1DA 3GG7A 3N11A 4OTKA 4F0LA 4JTTA 1E4MM 1R2RA 3VOGA 1TCMA 5K2ZA 4GIYA 1OGBA 2Y2WA 1XLHA 3QR1A 3M6DA 2FZ9A 2DUAA 1JXJA 1G6CA 3LDVA 3BC9A 4F66A 1QW7A 1JXKA 4N0RA 3S6OA 2W66A 1UWUA 4LYKA 4L9XA 3THDA 4PBFA 3B8VA 1CEOA 3W7DA 3WDJA 3UYIA 6REQA 5CEWA 1GVYA 1BVNP 2PWDA 4NZCA 4HU4A 4X0NA 1ZBWA 4UFHA 1Y5XA 4ZQNA 5A95A 1XYBA 4DBSA 3L9CA 3GG8A 4KW2A 3T08A 3KRZA 2YA0A 4GVHA 2DSVA 1R9XA 4TTUA 3WLPA 2YXOA 3B9DA 4AZGA 3RR4A 3CLMA 4S1FA 4TVUA 1UR9A 3O07A 4GY1A 1TA3B 4A8LA 3SCUA 4EKJA 1RR2A 1ZSXA 3EB3A 3UEQA 2CBVA 3H24A 3QW3A 1GHRA 5HQMA 4JL2A 1QXLA 1UR3M 1DV7A 2QDHA 4U33A 1RZMA 4YCOA 2GJXA 3KRSA 3VKDA 4IPPA 1QASA 2BV9A 1EC9A 1DBTA 2HS6A 3NQAA 4PSRA 3PNUA 1QPKA 4NX5A 4HNNA 4YVPA 4XV0A 1G7VA 1MDRA 1TVPA 4YCPA 3S2CA 1KLZA 3CTTA 3TYZA 3PZMA 2XINA 1E0XA 3N15A 3DGBA 4M6VA 4IPIA 1KV8A 1YBQB 2J8TA 1OVDA 3IVTA 4J3WA 2REQB 2E0PA 1GONA 1XLLA 4CCDA 1JVNA 2D69A 2BBFA 2PP0A 3CO8A 1EGVA 4JY8A 2DZBA 1JRCA 3WD2A 3TOYA 2NT0A 1I75A 4YVVA 4UR9A 2VHLA 4HOXA 3N29A 1YDNA 1PTGA 3FAWA 4ONVA 5I00A 1W9XA 3Q65A 5BMWA 1YDYA 3NL5A 4Q4OA 2E25A 4JHOA 3NSXA 1EF3A 3TVAA 1YYAA 1UQYA 3WLHA 3KVJA 3EOEA 2X1UA 2H3DA 3IV3A 2OWWA 4GQRA 3UWQA 1XRFA 2WSQA 4X9YA 1XSJA 4KKXA 3W38A 1IEXA 1BXCA 1JDFA 3EWXA 3LTSA 1QRQA 4LAZA 4R7WA 1W8SA 4IG2B 4MNLA 4ZA0A 1DHKA 2WPBA 1VPXA 1MEHA 2XVKA 1KQZA 3T4CA 5CPOA 4PMYA 3DFHA 3K4AA 1SVDA 2YL9A 5HWMA 1XBVA 1JNEA 1XYMA 3F03K 3CAVA 1W37A 1V02E 4MB1A 3NAVA 4XWUA 3GM8A 1QNOA 3MMTA 3AZRA 1VFMA 1ZLPA 3QV8A 3ID7A 1E55A 3KBNA 3SN0A 4QE4A 3GR4A 3W9ZA 3QYQA 3TROA 3IAPA 4F79A 4G8TA 2NVCA 2XFWA 3S5NA 5HK4A 1HP5A 5D33A 5M3WA 4RLIA 3WLRA 3DFQA 4DXXA 1NDVA 5M17A 3S2MA 4AU0A 2AL1A 1I0DA 2FVMA 2DP3A 5ECUA 4DZHA 4C65A 5DXYA 1A4LA 3QZAA 4LAOA 3FLUA 3DHDA 1OF8A 1GG1A 3BL3A 4FPSA 4PUWA 4DN1A 4FX6M 1J18A 2E9BA 4AWTA 1V7AA 4CNTA 4RKAA 3U2ZA 4KWSA 2FZNA 1W56A 4YIWA 1VRXA 2R94A 4ICNA 3IK2A 2OSXA 4O1BA 3VD7A 4WJEA 2QIIA 1XIEA 1J0KA 3HQNA 1R3WA 1J10A 4FNUA 4I8YA 4NJKA 3WH5A 3SRFA 2BS9A 4Q4MA 4Q7BA 1B4KA 2ZTJA 5C6MA 2P5NA 2VZSA 5CGMA 5EMMA 4I5XA 2WANA 4GI6A 4JIQA 1V3MA 1E6SM 3NDOA 1ISZA 3TCSA 1FWWA 5FEPA 3SEPA 4XZWA 2C8NA 4ZO8A 4B5SA 4LEQA 4GYPC 3TW9A 3MB9A 3S6DA 1LOQA 4LT9A 4C6IA 1WA3A 1DEDA 1UYQA 3H2EA 3MZ2A 4DBDA 1F7BA 4W87A 4K8GA 1JZ7A 1GJWA 1TV5A 3URBA 5PTDA 4XD3A 1C8XA 1MQRA 3APYA 3M16A 5IFTA 2F2KA 4WDTA 3LMYA 2ASHA 3M5ZA 3KBVA 3TU9A 2VCBA 3TQVA 3N34A 1R38A 4LRSA 3IJLA 3BLFA 3E12A 1YE4A 3BLKA 3M0KA 2NXHA 2FFIA 5J5RA 1XLKA 1XGZA 1R85A 1OZMA 1FHDA 2XU2A 2GGIA 1MNZA 1Q4NX 4LBSA 2WPGA 2ZX9A 1BD0A 4N9DA 1Y7VA 2BODX 4A22A 3LV6A 4MY9A 3SM0A 1IEVA 3CZGA 3NIYA 2NQZA 3NDYA 3ITLA 1XIDA 2VRKA 5CSRA 2Y7EA 4C6OA 1CECA 1LBLA 1UWTA 4PMRA 5I3KA 4KMQA 2ZICA 3VNJA 1U83A 3IVSA 5DELA 5LKYA 3ZR4A 4GUHA 5DFAA 1JYNA 1GCYA 5TBOA 3RR1A 4EWND 3MKVA 4JTDA 1KXTA 3UZWA 4D72A 4U2ZA 2ZOXA 3VNMA 3FY1A 2GUYA 4FR1A 5AC7A 3EWCA 5U7SA 2AL2A 4XX6A 2PBGA 3DHUA 3VX1A 4GUFA 3VIMA 1NWTA 2V30A 1GW9A 2OCZA 2QJIA 3MPGA 3IJ9A 2GJLA 4AXNA 2OEKA 3VZZA 1RVKA 4AISA 4N9CA 2CBIA 1H41A 3WLTA 2C14A 5KEZA 2ZTKA 4OWGA 3CPRA 2HEJA 3WL1A 1Z89A 4Y8EA 2VOTA 3G3DA 3B9OA 4R9XA 4QQUA 1RPXA 5DT7A 4AIEA 1EYWA 3VC5A 4QEEA 5I78A 2QW5A 2I16A 2JEQA 3LHYA 5C9WA 3M0ZA 4O1CA 2WSPA 1NDYA 3Q4DA 4P7OA 4U3CA 3WNOA 3UW6A 2WW5A 4DO7A 1L8NA 3SY8A 4EXBA 2WQPA 1TSIA 3NDZA 2BSLA 1ADOA 3BSMA 1NWUA 4JFWA 4PB4A 2BGSA 2VGBA 4IIGA 3C86A 4H2HA 4ATWA 1E3XA 1W1YA 1C7TA 5LA2A 4IQDA 4B3LA 1JUEA 2YCIX 1T7LA 4LNCA 3LHUA 3D0CA 3AXMA 2JIEA 5AYXA 4LJ3A 3CHDA 4HNTA 2WVVB 4UFMA 4DY1A 3DDMA 1XYFA 2DW6A 4JKLA 4XIMA 4O0KA 3EOLA 2ZA3A 3UCCA 5E9XA 2FYMA 2QNEA 4GCAA 3B8IA 4JIEA 1QHOA 2FGBA 4IPJA 3AHTA 4NZJA 2IW0A 2QMKA 1MWOA 2FPVA 5CSYA 1AD1A 3NGJA 2D73A 2Y88A 3KTCA 4NJGA 2VEIA 4PTMA 2Y5EA 2INEA 2WZMA 4WLCA 4CN4A 2IKHA 4QAWA 4HGXA 2TYSA 3B8DA 4MFEA 2CEQA 4IMAA 1JJKA 4R7OA 3VGHA 4NT0A 1SR0A 5DCBA 2ZRYA 5I3GA 2PDJA 3LNMA 3KFTA 2C71A 2V81A 5I0DA 1GGOA 4BHYA 5BMXA 4C6NA 3QMRA 4BI5A 5LXXA 3C0JA 1VPYA 1OX5A 4WCJA 1EPVA 4AX6A 1ME9A 5CGQA 5REQB 2PE4A 3OQ8A 2FKPA 1OYAA 5DRIA 4BWLA 2YA2A 2E8YA 3KZSA 2ZCGA 4KFPA 3SZ8A 5EMLA 1O66A 4R53A 3MUXA 1Z32X 3UJFA 4G2DA 4FXJA 2ICSA 3CUHA 4HBKA 4Z1DA 4F2BA 3GDRA 3IJIA 4L1WA 2E5DA 2PWGA 4QBXA 3W25A 5G1MA 1LOLA 1WOBA 3IJ6A 4S3KA 1ITQA 4RL3A 4JEJA 4G56A 2EF9A 2RHGA 2EQDA 3KVLA 3S5ZA 2HWGA 2PWVA 4U5IA 1UH3A 4W4QA 4UFIA 3RM4A 2JALA 3HU7A 1X6NA 1W9BM 2VUYA 4MM1A 3AO0A 4H6KA 1XIHA 2INFA 1OG6A 3H23A 4FZIA 1WB0A 1UWSA 4XZLX 1IGWA 5KMYA 1Z6KA 4P5UA 2DVTA 1YQ2A 3CNYA 1N7KA 5DLCA 3H8AA 2QV5A 1V3KA 4NIRA 3B03A 2OELA 3W2LA 2WWCA 1KM3A 1PYFA 3LCIA 3ONCA 3HGSA 3NOYA 2CXGA 2ZE0A 2WZTA 4G6CA 5IHSA 2OT1A 4U2YA 1VCVA 2W5FA 3W6LA 4GY7A 2XG9A 1FWNA 2EBNA 4BF9A 4JOMA 4QE1A 2OQHA 3ARQA 4GK8A 2GJRA 3ITVA 4KEUA 3LLDA 4O15A 3HN3A 3E0WA 3I65A 3MCOA 3KBWA 4PEKA 1J6OA 2PI6A 3PPCA 4M6QA 5TAOA 3AIRA 4KEMA 4MIMA 4GA8A 1GYLA 2ZKMX 3CAWA 1FWHC 3AXXA 4MMWA 3NM3A 3BAKA 4LGXA 5AYYA 3W7PA 1ZNNA 4QHRA 1EBHA 5CG0A 2WMIA 1JAKA 1X1ZA 4N02A 1P0DA 2ACQA 3TIMA 1ME7A 3VDGA 1XIBA 4ZQMA 3MP5A 5FEWA 4JQAA 5I3IA 3KOWA 2GQ9A 4ORIA 5HNNA 3GXMA 3GDLA 4U4MA 3JR2A 3CGTA 4UTTC 3CZJA 4PUKA 3SSJA 3AMLA 3KZPA 2PDGA 3QLLA 5I07A 2CYGA 1S1PA 4KGLA 1XLMA 3RU6A 2QV4A 2J6XA 4LC6A 1S2WA 4MB5A 4BY3A 3BTNA 3FGCA 4HNOA 4JIIX 4QSHA 1H7OA 3OZMA 3UVIA 1JRBA 4F8XA 4GG9A 4PUUA 1J2BA 4HA3A 1DVJA 3VNKA 1HKVA 2YA1A 5G4HC 1QVBA 3CHFA 1SJAA 1TPC1 3NCOA 2NUXA 4LVGA 2J79A 4LV4A 2GVJA 4MLRA 3UJ2A 3QQ1A 4B4HA 4AC7C 2Q6ZA 3B9AA 3U0HA 3V1PA 5D2TA 3GDBA 4KCUA 1CTNA 1KTNA 2XPKA 1NAL1 4PODA 4WY0B 3NQGA 4L4PA 1HKIA 1KCLA 5AYIA 3TK7A 3ABOA 3AHYA 3HJEA 4X63A 1S1RA 2FJKA 5G1YA 2OJPA 1ICQA 2ACUA 2CITA 2WSKA 3NXLA 5KITA 4QRNA 3A24A 5E0FA 3CL6A 4O11A 4B5XA 1NF0A 3MA8A 2RJGA 1DJNA 1NQ6A 4LUYA 4B5VA 1JZ8A 3W37A 1DJIA 3VIKA 1M7XA 2YDRA 9CGTA 4H00A 3A6OA 5ABFA 3ES8A 4NZ4A 3N6QA 1JFHA 5HXMA 3WQ6A 4LXFA 2A85A 3CQ0A 4A21A 3U57A 2DIEA 1UD4A 3BGAA 2WMJA 2Z29A 1POJA 3ARUA 5LHFA 1JDAA 3ZJ8A 1XIIA 4EXAA 3GR7A 1A0EA 1UIOA 2R1NA 4C6JA 5B7ZA 3APGA 3ENLA 4QE5A 3CV1A 3W86A 4NI3A 3PN8A 3PAJA 3KE0A 2NT1A 1QPQA 4Y7EA 4PGLA 2W6RA 3QHMA 4S38A 2IQTA 4KRTA 1DORA 1O1ZA 1HJSA 3BW2A 1HUVA 1SZNA 1WBHA 1XFCA 1AFSA 4GE8A 2W92A 1AW2A 1FWSA 2YL6A 3WIJA 4R34A 1VJIA 5CPLA 5JU6A 1Q6EA 4ZXOA 4FAMA 3W7JA 4YMZA 3SGGA 1LROA 2F6UA 3G1SA 3H12A 4H9MA 3SQMA 2DIJA 3L5MA 2DVXA 1FOBA 1LT8A 3FS2A 1LYXA 1LLZA 2WSYA 1TPB1 1QHZA 3WK3A 4FLSA 2PDNA 2QR6A 3W7QA 5TF0A 1AZ1A 3E5BA 1TUFA 4CNNA 3T42A 1BYAA 4CLMA 4MNKA 3B0YA 4HN8A 2FH6A 1R30A 1E9YB 5LHEA 1GTEA 4BQ5A 3O05A 3VA8A 1OCQA 4MJ4A 2QUNA 4FIQA 3I4EA 4DWSA 2ZRWA 2WKLA 3RPTA 2ISSA 4GO8A 4IUOA 5HQLA 2V8ZA 3B97A 1IEQA 3FCPA 2VD9A 1JUKA 3S46A 2HS8A 3VU2A 5M5DA 5AZ1A 3M0JA 3DC0A 3EA3A 1OCJA 4UTWA 5GNZA 1E5JA 2HE8A 2PA6A 3TQKA 5BOOA 3P0WA 1UOKA 1JAEA 4LNYA 1LDCA 3GNRA 2X1RA 4J2PA 1CGXA 3AXHA 2J6VA 1CX9A 1IEWA 2UWFA 4JPGA 3STPA 1BWLA 5CZ0A 4LUSB 1P43A 2EXOA 3EX1A 3TOPA 4Z2JA 2R1KA 4NVTA 3POHA 1QW8A 1PV8A 2D24A 1O68A 1OC6A 1E43A 1LRQA 1VAHA 2PODA 3PJXA 3SRKA 1IIGA 2G50A 1X38A 3HQPA 4GI4A 1JNDA 1LRNA 3KXQA 4K1GA 4IL2A 3W2KA 3PULA 1Q4WA 2RKXA 3RLVA 2NZLA 3G18A 2I5GA 1GVEA 3LZ3A 2R8WA 3NR0A 4AWUA 1WZMA 1Y0EA 3UR2A 1M7OA 3FIGA 3HGOA 1A5CA 1VEMA 4A3RA 4M82A 5LNWA 1E1CA 1VFOA 4ZVJA 2ADAA 4ZE4A 2Z7GA 4U31A 3EDJA 1MYRA 2VR4A 3FN9A 3D6NA 1K7FA 4LX4A 3WQVA 3VIOA 2E1DA 3B0UX 1VD6A 3GHTA 3OODA 1GVOA 4WOZA 3CT2A 1X8FA 4PMJA 1WDDA 1R86A 3PZIA 3HPSA 3PS7A 4TV6A 1TFVA 3NM1A 3PF3A 4Y6GA 2KZHA 2YDAA 4I9TA 2AGKA 2XFYA 4NNCA 3STGA 3K4WA 3BOLA 4ZR8A 3N2MA 2R6OA 4HN4A 1LQ0A 1R46A 1BYBA 1Q6RA 1OX4B 4MDPA 1W3HA 4JTUA 3FEMA 3CC1A 1W1IE 3P84A 2Y61A 2BX7A 1PIFA 2W63A 1FCVA 1ISVA 3WO8A 4LYQA 2W4XA 1O94A 1XC4A 2Z24A 3IRSA 1ADSA 3NSNA 4ATLA 5ABFB 2PUZA 3GKAA 2HPIA 1LBFA 1NDZA 4LEFA 3T2OA 2OEJA 4PRRA 1P0BA 4CEUC 3PHAA 4NZ1A 1UUOA 1XCFA 3TWAA 3P7YA 1PYMA 1H7PA 4ACZB 1Q2SA 2PD9A 1FHUA 1B57A 2J75A 3T44A 3V5CA 4DF1A 4DWDA 4DB7A 6ALDA 1XYZA 2PDKA 4L80A 1V8EA 5MF5A 3S9IA 3L4VA 2ZC1A 1R6WA 2VFIA 2HISA 2VQTA 2YW3A 1OD8A 1F4HA 4V15A 1NVMA 1KXHA 3TTEA 4NZFA 4D6FA 1IV8A 4AEOA 1ZQ5A 3AWOA 2VKZG 2XTKA 4MWAC 1HZYA 3FYOA 1BRLB 1GZJA 4XO7A 2BGQA 1DP0A 1BQGA 2YOCA 3A4JA 1G4TA 1QWGA 3R8RA 3QC3A 2X7VA 1Q13A 1RQEA 3GBEA 4XD5A 1G94A 1ONEA 3SAZA 2E5CA 2HXUA 2WZHA 4ROPA 1VPQA 1WNOA 2GSEA 4RCXA 1XV8A 4XZNX 9XIAA 2FB2A 1R3TA 1R7OA 2NVAA 1JULA 1W0MA 1QBAA 3GD6A 4JR5A 4CNPA 4TX9A 4QSFA 2NXIA 1J9YA 3RX3A 3LCHA 5C2XA 1EB3A 2IKGA 3OPSA 4FF5A 4Y9MA 4ZENA 3TX9A 3QHOA 3GFZA 5L9FA 3GY1A 1EP1A 3AS0A 2Z2AA 1XX1A 3O63A 4EE9A 5TQLA 2FTPA 3MDUA 3MI6A 2VZUA 2Y1HA 4O28A 3MP4A 3BLPX 4D8AA 2Z6IA 1G0CA 2ZE3A 5GNYA 4YXGA 3DERA 3HG2A 1CB2A 2RAGA 4U3AA 1HJWA 4L65A 1J0ZA 3TYEA 1CI1A 3DBPA 5HPCA 4L4OA 4B15A 3C3NA 3EMZA 1H1YA 2P0OA 3N17A 4PTNA 3NFUA 1NELA 1OIMA 1PZ2A 1TPEA 4C6KA 1OBAA 1M41A 4ML4A 1RXOB 6A3HA 4JS3A 5F1VA 4LYPA 1DPMA 1VF8A 3HPXA 2E6YA 3FAXA 3MV01 4JQ2A 3RCYA 1M9HA 4Z08A 4UCFA 1VFFA 3RCNA 1AJ2A 3UGVA 2PDHA 1OGGA 4EAYA 2HBVA 1E1CB 2RGLA 5EMKA 3S0CA 1AA1B 3AYVA 1I2OA 2VVNA 1OC7A 3KBSA 3CYJA 4GLEA 1KR0A 1HTIA 4CUCA 4J4KA 3G24A 3NQDA 1R3SA 3C2EA 3QZEA 1D2KA 3TTSA 2HXTA 2BMBA 4MZYA 3BDKA 3N6HA 2OSWA 4PBGA 1J6PA 3PWGA 1H09A 5E0KA 4JTIA 1A4MA 3UWUA 4WEVX 2XM1A 4E4UA 4GXPA 5EMYA 2Z1VA 2V3DA 5C9XA 2HNHA 1TV4A 1NH6A 3L21A 5E1QA 2DW7A 1G4EA 3ITOA 1YNQA 1KM4A 1MZHA 3UA3A 5D9NA 4DBWA 1CXFA 1FP9A 4LU0A 4AVFA 1PSCA 4OUIA 1XISA 2F6KA 4JTAA 4JQ4A 1ZS2A 4C5YA 1SSGA 2POZA 3GNNA 1W9VA 3SIMA 2J78A 5D03A 2DT3A 3MDWA 3N25A 3R1ZA 5F1UA 5LYRA 4D8LA 1Q65A 3C61A 5CPSA 2HVMA 3LERA 1YKWA 3EMQA 3G1YA 3QRHA 4F2UA 3BV7A 1F9CA 1FCUA 1W5OA 2D3LA 4OBSA 3OBAA 2CESA 2A0NA 3W7RA 4S3AA 1WDWA 1HO4A 5BRPA 1RV8A 3IVUA 3KDOA 2OOGA 2VQUA 3WMSA 4GBDA 3C2VA 2YCJA 3CIXA 4FXSA 5LIXX 3LM7A 3G0UA 3GHRA 1VP5A 1E6NA 1HJVA 2WSRA 6CGTA 3BJSA 4IIHA 4HSHA 2YJQA 4XG1A 3EYPA 2E1WA 1IIHA 1OCBA 2PGFA 2FGLA 5K9CA 3MUZ1 2QYGA 1RBAA 2OWXA 2UY3A 2PDFA 4PUMA 3NQCA 1NWSA 4W5ZA 3WLLA 3GRIA 3GC4A 1FWRA 3OHIA 3V36A 3GU9A 1V08A 3BAJA 2XSBA 4H2CA 2W3ZA 5MKGA 1BGAA 1BWKA 3I7RA 4DJFA 2VWSA 3QHNA 3MBDA 2XIOA 4GVIA 4UOZA 4A3UA 2PU0A 1H1ZA 4JL1A 1PX4A 3CBWA 3BE7A 2DPEA 3U2OA 3FHQA 4JX5A 2G3JA 4FF7A 2R82A 3VNYA 2JFEX 1A0DA 3AIVA 3R12A 5AC6A 2X09A 3UG5A 3TTQA 4K8EA 1DXFA 2ISWA 2FZMA 5B80A 4EAMA 7CGTA 4ZL1A 4J2MA 3GFYA 3OZYA 1UMYA 3U6WA 3TSBA 4GQGA 2DUXA 2FJUB 3G6MA 5E93A 4D6GA 4DUOA 1K8CA 5T8GA 1SMDA 2B81A 2LLEA 4D9PA 1O1HA 3ZOAA 4ADTA 3C0QA 3K2GA 2XGIA 5LIWX 3DC8A 5EPDA 1ECEA 2PSNA 4R88A 2F2HA 2MNRA 3VILA 3UNTA 3PTDA 4FK9A 4DM1A 3WCZA 3LHVA 1KNWA 1TQXA 1MFVA 1UWAA 3CB3A 2YPIA 1GZ1A 4HPGA 1K6AA 4TR9A 3MHUA 1OF6A 3TYUA 1PVNA 1REQA 2VZOA 2HZGA 1VR6A 1AH4A 1WPCA 3LS9A 1BYCA 1E9ZB 3V5FA 5EU9A 3AIWA 2VX7A 5D32A 3NQVA 1HX0A 1LWIA 3G3MA 3QPYA 3MYOA 2ZUUA 1VFTA 2BXVA 3SCPA 1KCZA 2MUCA 1WP6A 3ARSA 5HATA 2FZBA 3LU2A 1KWGA 2ZDSA 4GQ0A 4CNUA 1THFD 4OVXA 1K9DA 2A5HA 4FX7A 3U9IA 3GH4A 1YXYA 8XIAA 3M0XA 4A2RA 2XSXA 2YLLA 3BMVA 4OT7A 3L4ZA 5CPNA 1EWDA 3DUGA 1QMLA 4DJDC 1UWQA 3ALFA 1E56A 2CXEA 1A5SA 2HCVA 1UKOA 1PWMA 5BXSA 1LQAA 1QI4A 1ZU8A 2QCGA 4M29A 2NX9A 3L4YA 4L61A 3ZS4A 1W54A 2ZIDA 4M0XA 4LW7A 1B4EA 1G4SA 2H8ZA 1ZCCA 1EP3A 2E3ZA 3LBCA 2Z1BA 3P80A 3VNLA 1JDEA 1D7KA 2V3FA 4NF7A 4RNIA 3LRLA 3WELA 3MMDA 1EIXA 4RDZA 1J11A 3UXIA 4YTSA 3FHAA 1G67A 3M44A 3T7VA 3ABZA 4M56A 5C9RA 1VENA 2OVLA 2PTYA 3WQCA 3AZSA 1POKA 3JU2A 3L2MA 4IGMA 2QJHA 1H61A 2DH2A 3CU2A 4PUDA 3J7HA 3D3AA 1V02A 4ORMA 3N04A 4GYKA 2ZUSA 2C79A 2OZ8A 2YBTA 3RGTA 2XIMA 3DIPA 5EFDA 3I7QA 5AY7A 2D0HA 1RVGA 3OQEA 4R3UA 2ZWYA 1KBIA 3KWSA 2DZAA 1Q6FA 3BZGA 3DG7A 5CGTA 1X7FA 2WVUA 3ECQA 1UA3A 3VGFA 4S2BA 3SECA 2J9YA 5CZJA 4AX7A 3FSUA 3RUBL 3LRMA 3RAOA 1B3XA 1IXOA 5IXEA 3CWOX 1K9TA 1ZBCA 2WHMA 2PDCA 3ATZA 2WNNA 1EX1A 3CQJA 1XXXA 3F4VA 2AOSA 5DMNA 4UQDA 3WJZA 1MNSA 1F6PA 1LM1A 4L1GA 1SZFA 4LAUA 3ERPA 1XLEA 5BWAA 1QNQA 3QR3A 1E73M 4R33A 2A7NA 4OZOA 2BWGA 4MYXA 3RIKA 2PLCA 3WNLA 1EYEA 5MKGB 2PGEA 1BGGA 2O4QA 3H7VA 4ADSA 3B0PA 3MJMA 4CD6A 3O6AA 1SW3A 4MWAE 3WD4A 3MCMA 2NSXA 5A6LA 5I79A 1QTWA 3E0IA 3A64A 3BSHA 2NQ9A 2Z1SA 3M64A 1NWRA 4FNPA 3SSZA 2ZXAA 1TMLA 3NQ2A 2IS7A 2QXWA 3OO2A 4D8ZA 3UPBA 2BY1A 4J1OA 2G4FA 1DWJM 3F5KA 2YCLB 3FJ4A 4NRRA 4NXKA 2D0GA 2XN1A 2PDBA 4IJCA 4PB5A 3WD1A 1R5YA 1TREA 4C1NA 1E71M 4TX8A 4ZB2A 3BSGA 7PTDA 1EDGA 2TODA 3NTYA 1TE1A 2D23A 4A2SA 3UNDA 1UD6A 4OGZA 5G4WA 4L4LA 4QAIA 3A23A 3MUIA 1XC6A 3H22A 3N9KA 1XI3A 4PULA 1CPUA 1R3YA 5ECVA 4FMVA 4AZIA 4JBRA 3WDHA 2X16A 5HMEA 3S5YA 2BOFX 4ZZ9A 4DF2A 1AJZA 5LA1A 3AJXA 2V38A 3W24A 2JKAA 2R1MA 4YHEA 3NZGA 3IK4A 1TELA 3SADA 4HJFA 1W32A 2GGEA 2E40A 3PPHA 4IJRA 5DQPA 4D1IA 1B3VA 1YIXA 4MJ2A 4AY7A 1CCWB 1BXNA 1UKSA 3ARRA 1A5BA 2DH3A 3SO7A 4B2DD 3GC2A 2W61A 3IUIA 4CQAA 1I2PA 3FEQA 5DO8A 3BO9A 3WSUA 1J0YA 3ANYA 3SCQA 3AFBA 3THAA 1ZAIA 4ROQA 4HYWA 2Z27A 3RN6A 1HF6A 2FFCA 5CQ1A 3W53A 2IPJA 3H54A 4PR4A 2TPSA 3KP1A 1PZ1A 5FJTA 3CUXA 1PWLA 4B91A 4K39A 2F9RA 2PGRA 2C13A 1YXDA 1WO2A 4H83A 4P8VA 2X0SA 4IQJA 1OX6A 3VABA 3O15A 3UF9A 2CERA 2D2OA 3MSRA 3WK0A 3QM3A 2WZIA 1F3EA 3QV7A 2PWFA 4TXEA 2C6QA 3HOJA 4QG9A 3W1RA 1P7TB 3ANVA 1C8YA 3VMNA 4LCRA 1XLFA 2Y8UA 4JY9A 3ZR5A 4J3VA 3MMUA 5M03A 3KDNA 2O7QA 1TVLA 1UW9A 1JZ6A 1UBSA 2Q8LA 3WUFA 5JIWA 4MNJA 1YMYA 4QLKA 2L5HA 1DJZA 2P10A 4LV9A 3GUGA 3RMJA 4DXVA 4Q8OA 4YU1A 1IZCA 3OYZA 3NWRA 4GIRA 4QJ3B 4HMNA 4JNYA 1VBGA 3PVFA 1H0IA 2XH7A 2Y7FA 4OHQA 1ICPA 4LVDA 1YADA 1I2NA 2OR2A 4DYEA 4H1ZA 1F4AA 3ATYA 4DRSA 2Y63A 2GDQA 5D2VA 3MW7A 4IQEA 1GEHA 5IFPA 3A9BA 5HA7A 3UESA 2Q01A 4NYUA 4Z1AA 2B7NA 2DGAA 3MVTA 4BEUA 1XG3A 2O9OA 3C8FA 3TC3A 3HPZA 5A6SA 2QCCA 1A5LC 5K3VA 3FVDA 1OFBA 4UTUA 3VOFA 4TX6A 2Y85A 2WXDM 4X9SA 3AU2A 4EXQA 3T40A 3S47A 1QI2A 2ZUNA 4U10A 2NLIA 3MHFA 1QOPA 1KRCC 3WLIA 2GJPA 3W7GA 2H90A 3W2NA 3L0GA 5HBFA 7REQB 1IZKA 4Z17A 4A29A 4D6DA 4PTXA 5HJYA 1S3TC 1TPUA 3N19B 5F2IA 2HQAA 2PWEA 2WMHA 1NEYA 3LG3A 3ABQA 1SO6A 4PTVA 2DZVA 4W9TA 3W3OA 3CMFA 4GWEA 3A9IA 5E5CA 3NZ1A 3I6RA 1KBBA 2E68A 1CZ1A 1OIFA 2RJHA 4W7VA 1M3UA 1TUXA 3T0BA 4C1NB 3F1QA 2VENA 1B54A 2O0TA 3IJQA 3G1XA 2FHBA 2YR1A 3GWQA 2IKJA 3MI3A 4N9BA 3KWXA 3BH4A 3VXGA 1XKYA 2QMJA 4V27A 4RPQA 4AZ5A 3VKCA 3HB9A 1GOKA 4RXFA 2YL8A 4FNSA 3DESA 2H8XA 3K30A 3M0YA 2GWNA 3MANA 3LSCA 1J0IA 1JCLA 3JZEA 4RK8A 5BROA 1DKWA 1JYWA 5C8BB 4C7GA 1OZQA 2DSZA 3D46A 3QFWA 4DO4A 3U4AA 4AHPA 5E70A 2IKIA 5IDIA 1HVQA 1AZ2A 1ZP3A 3WY1A 5A6KA 2YBUA 5G2IA 2B0MA 4K37A 5FF4A 1FHVA 3WJXA 3GXNA 2XIQA 2YB1A 1U5HA 4JTSA 2V5JA 4MADA 3LCXA 2OWCA 2DQWA 4BQ3A 1V3HA 4NP7A 1EJWC 1P0EA 4RR4A 3BPWA 2V5DA 2OLHA 3DYMA 4G7FA 1XLAA 5E6YA 1UKQA 5C70A 4KGJA 3CS2A 1B0IA 1XCWA 1WAUA 1V7YA 1R9ZA 3LGEA 4IXHA 3L2IA 3SR7A 1W1VA 3WFAA 3U4FA 5BW6A 3SJ3A 2QUUA 4E3VA 1A3WA 1ZENA 4EOUA 3C3UA 2XWDA 5DMMA 5D09A 3T9PA 4I7VA 3LD5A 3P74A 1RCXB 4GD0A 3GNDA 1LL4A 2GJNA 2HVNA 4LRTA 2OTDA 1PKYA 1TIMA 2WKGA 2GK1A 2XVNA 5MHBA 4HSNA 4RE0A 1YNPA 1NM9A 5HJLA 2V5CA 3VDAA 1KKOA 3CHEA 1EKOA 4AG0A 1CGUA 3DFPA 3K13A 5CSUA 2OT0A 2VCCA 2H9AB 1BYDA 3Q37A 2VDHA 2QDDA 2VEGA 4KF1A 1Z7AA 1SSDA 1DWIM 1FH7A 1W9DM 5H2ZA 4WF7A 4IM4A 3BCFA 3CUGA 1XWYA 4DBUA 2WCAA 3RM9A 4UR8A 2RFGA 2J9ZA 4NAEA 3CTLA 2HVOA 1XF0A 1ODZA 1UJQA 3O2LA 4AF0B 3AHVA 3W7NA 2HRWA 4MTVA 1XH2A 4F0RA 4LY8A 4UQBA 3ALGA 4R27A 4KH2A 2OEMA 3AS3A 1V6YA 1KLYA 1CGVA 3AMDA 2UZ9A 1LWHA 4UCGA 3EMCA 1W3JA 4E5TA 4CU6A 6ENLA 3R89A 5A6BA 2C7FA 3E0VA 4AWEA 3W1XA 2E8ZA 5GVJA 3W2MA 3GNOA 1GJPA 1Q6GA 4HPNA 3ARYA 5T9CE 3E6EA 3EPMA 3IACA 2ZRVA 5JUVA 2QJMA 3S2JA 5KETA 4GGHA 3MUY1 3DYOA 3SCTA 4YYCA 2YCKX 3UU0A 1K8ZA 3UWYA 4NX0A 2FVLA 3OB8A 3P8JA 1J0HA 1US0A 4PEEA 1AD4A 4FOJA 4GYPA 2W79A 4QLLA 3KRBA 4K6AA 1TPFA 3SRHA 4JFSA 1RJQA 2BP1A 2OG9A 5IBXA 2NX3A 4ASTA 4JTHA 3UGRA 5BWFA 5E09A 3AC0A 4AD2A 2EEXA 2YZRA 3H2OA 1SZEA 2ZZ6A 1ONXA 3HA1A 1NF7A 1DL3A 2WM0A 5C71A 2OZ3A 4A3HA 5A6BD 1XD0A 4QCFA 3I4KA 4WSKA 4XBJA 1XFBA 5AVNA 1ENUA 1FXPA 3T0TA 2PDIA 3CWNA 2XVPA 3PBYA 1QNVA 4D6JA 4XO6A 4HCDA 3REQA 5I02A 3UWWA 1HGYA 4YNGA 3LHTA 3T0CA 3P62A 3EDKA 1OK4A 2D2JA 5CXPA 1K4GA 3UG3A 3JZUA 1WOAA 4H8VA 1PCKA 3IS4A 1J01A 2NQJA 4NU7A 3I7SA 1RA0A 3RO8A 1K9FA 5D37A 3BK0A 4P2VA 4E2BA 1LUCA 1ONWA 3O0FA 4DLFA 3GH7A 4ECLA 2CWXA 3T81A 3N4FA 3ZXWA 1N8IA 1MW2A 2I56A 2QCEA 3GVQA 3IWPA 2PRLA 1Z9AA 3PB0A 5FJIA 4C1LA 5DXXA 4WDXA 4O1AA 3TSDA 3MKCA 2P3ZA 3FA5A 2ISVA 1E72M 4CVUA 4Q4PA 3CYVA 4JGDA 3R4IA 2A21A 1E3ZA 1V6XA 1GZGA 2ZXQA 2W67A 5EKYA 2QCFA 2FVKA 3TMLA 1W5NA 4JIPA 3A13A 4JEQA 1GQIA 4GNJA 4DO5A 2J74A 4CCZA 1C7SA 3UZXA 3EX6A 3TNBA 3TE9A 3WQEA 4E4FA 1H49A 4QM1A 4H9VA 3WH7A 1Z48A 1G4PA 4X61A 4B5WA 3GVGA 2D3NA 3P3BA 5LZLA 1TKKA 4F9DA 3TXZA 1ECQA 4PN2A 2Y6ZA 4PB3A 2VFFA 4AYSA 4QCEA 1QU4A 1S5TA 3T0DA 1E9LA 3WQ4A 1OABA 4ZSTA 3DU0A 1Q8JA 1VHCA 2ESCA 3ITTA 3UXDA 2WJFA 3W87A 4B5TA 3W00A 1YHTA 1FWAC 3PZQA 4AD3A 4GO9A 1CBGA 1Q6DA 1UZ4A 3GVVA 3CPGA 4GVGA 3MKKA 3B04A 1OFPA 4M80A 3KVMA 2OLSA 1TA3A 4M81A 1RLDA 4CU8A 1JDDA 4H8NA 3SCOA 2VC5A 3UJEA 3NQ6A 4NAFB 2OOFA 3M43A 4RXGA 1JCMP 3WUEA 1LT7A 2GL5A 3W75A 2X1IA 2CKSA 1LCOA 2W9MA 4E4PA 2OFJA 3M5XA 2XFRA 3MV11 3GNPA 1U30A 4C6LA 3HMCA 1RY8A 3PG9A 2Y4SA 4JTCA 5LNUA 3LA4A 4DXKA 5DBUA 3WBYA 2CBUA 5B7YA 1GVQA 4UTLA 4YTUA 2TMDA 4C6DA 1BVWA 1GOXA 2WQDA 2REQA 2FDMA 1DWGM 3CH9A 3HG4A 4XSMA 2Y8KA 2ZRUA 1FDYA 2WJZA 3TJ4A 1VHNA 3N4AA 3WEMA 4JFVA 5AECA 3ZMRA 2G0WA 3D5HA 3T2QA 2UBPC 3RRXA 3RO6A 4ILSA 1H62A 2PRMA 3BMWA 1XGDA 3C56A 4NNAA 1ME8A 3AQUA 3EWDA 3VGDA 3G1VA 3EA1A 1R47A 3LCFA 1ADDA 2WV8A 5G2WA 4AVOA 4EACA 2O55A 1JPKA 4Y9PA 5A5WA 4IPLA 3QMSA 1SO4A 5EMUA 4NNBA 4L56A 1DTNA 5U4NA 1SQ7A 4ES4A 4GRSA 1R7AA 4D6HA 3O0KA 1TR1A 2QDEA 3O9NA 1HJUA 1DJYA 3FSTA 4WXYA 1ICSA 3G2GA 1E6QM 3FJLA 1DOSA 1Y5WA 3ANUA 5FF3A 1ZUAX 1V0KA 3REQB 2OU4A 4ZO9A 4CD5A 2WMKA 8CGTA 1ISYA 3PB2A 1FFQA 4IG2A 4NRSA 3BCDA 3UT0A 3GR8A 4I7WA 3ITCA 1AMYA 4Q7NA 4X2PA 1J4EA 1TWZA 4NY2A 4UQAA 1S2TA 4DUWA 5AN7A 1DWFM 4HK5A 4P61A 2EPHA 3S4TA 2PC4A 5XINA 5I24A 4N6EA 4N9EA 2Y8VA 1LBMA 4XTIA 3N14A 1WZKA 4RPPA 4DIAA 4C6PA 1LUCB 2QIWA 1DXIA 4AFYA 2ACRA 5G1TA 3WF0A 3G0SA 3CWHA 6PTDA 3W4RA 2Y62A 4Z1YA 2QAFA 1VEPA 3TYCA 4HPXA 1JZ2A 2V67A 5LNVA 4L1XA 2MANA 2BXZA 3HPFA 1WDRA 1XG4A 1FWGC 3CUJA 5LNRA 1J8VA 1A3XA 2OO0A 1D3GA 2KAUC 5JXQA 4IX0A 1V93A 3FVMA 1OT2A 3WNMA 1OCNA 1ZBKA 1RK5A 5HR7A 1XYCA 1V3LA 1E6XM 4Y90A 2CLEA 4RV8A 5EY5A 4DO6A 3F5JA 3B4YA 3GZ3A 1R8LA 2PF8A 1KXVA 4MKSA 1KW1A 4DWSC 4LPCA 4J3SA 1A47A 3KCLA 3C2FA 4GBUA 3TJLA 3BURA 2PRHA 1UR4A 3M7SA 1QFEA 3H2NA 1T0OA 1EZWA 1O5QA 2FZDA 5JH2A 3VKAA 1C29A 2BDQA 1U33A 4GGBA 3LHZA 3F4CA 1JZ3A 3IUHA 4AAJA 3PM6A 2ISFA 1J79A 1Z3NA 1FXQA 2QCNA 1US3A 3SGZA 1CYGA 2O9PA 2X2GA 2GWGA 1DE5A 3QFEA 3VUPA 3ZM8A 5BRBA 3GS6A 4QXIA 1W3NA 2PP3A 4GUJA 4M6PA 2UY2A 4JN7A 3MZNA 2DORA 4NUWA 1SM9A 3LY0A 4O18A 4L6DA 2G95A 3N13A 1DJGA 2Z2UA 5BU9A 4UOJA 4NJIA 3TNOA 1QR7A 3HQOA 1V0NA 1V6WA 3NYZA 4LS1A 1MXSA 4BI6A 1PIGA 5A3HA 1HNYA 1LORA 1PO9A 2OLAA 2ATSA 2RDTA 1XDJA 3WMLA 1B9BA 1B3OA 2OB3A 2C0AA 1W2PA 2P8CA 1FFRA 4MAZA 4N42A 1NFGA 1SUXA 4FLOA 1MDLA 2GOUA 2Y5SA 4QP0A 1O5XA 4RE4A 2HDJA 3YPIA 1XP3A 2J88A 4E8DA 4WD0A 5FKYA 4F4RA 4AY8A 1MEWA 1MRAA 1HN1A 3QGVA 5AYBA 2OKTA 2DSWA 1NJJA 1QOXA 5CBBA 2BTMA 2CLPA 3KP0A 2B7QA 4ZQOA 3RXZA 2J8FA 3LOTA 1VFHA 4IZGA 1T5AA 1MW3A 3AMKA 4FI4A 3KL0A 3QBUA 1GPFA 3E0LA 4XB3A 2R24A 5CAKA 2JEPA 2BASA 1K1DA 3ZR6A 4FR6A 4Z2HA 3NPVA 3KLLA 3UP8A 1I2RA 1TMHA 4NKCA 4WKFA 4XUGA 2VOMA 3WX7A 3ZJ7A 3WN6A 1SFSA 2P3EA 3OLEA 3P67A 5LGXA 4HQVA 3LX9A 2J7GA 3B8UA 1ZZMA 2VZTA 3VVGA 1QOQA 1SYTA 4Q6XA 3TW7A 4DUXA 3LENA 5AFDA 1VKFA 3ZSSA 1EQCA 1YPFA 3W27A 2QGHA 4LVFA 3M0LA 3RK8A 2AKMA 4KRZA 4BEQA 3O8AA 5TNVA 4AIUA 4H6QA 2PLKA 3AIEA 3LTYA 4ZSUA 1UKTA 3ME3A 3QVQA 4KPLA 2ZVRA 3TW6A 4CD4A 4JFUA 4I5RA 2E67A 3NL3A 3GHSA 2EPKX 4XZBA 2B7PA 4S3EA 3OZPA 3BXWA 1HVXA 3N18A 1TRDA 4LF1A 1QO5A 3T0AA 3TXVA 4GHRA 1GOMA 3CEUA 4WSHA 1IYXA 3BG3A 5FAJA 3WQGA 2J7DA 4AC1X 4A3YA 3NA8A 4URIA 3E96A 1JPMA 3F4DA 1JGMA 2C1GA 4MPQA 4FX8A 3WEZA 3BAXA 3ABRA 3UCQA 4S3FA 2WVVA 2V2CA 1AJ0A 3DHFA 3U5UA 3WMCA 1P4CA 4HP5A 1K3UA 2BY0A 3EKZA 4F3HA 2C0HA 5HULA 3SW6A 1DJQA 1LRTA 1UR2A 1JF6A 4JN6A 4WOQA 2DJLA 4UBPC 3VIIA 2ON3A 3P0XA 4HZ8A 2SFPA 4ZQPA 3CIVA 2NQLA 3CXOA 1MVYA 1X39A 3L5LA 4GINA 3SFWA 4AY1A 5G2HA 1F3WA 1UD2A 3EX3A 3GIYA 3VCCA 2QJJA 3IGHX 2RDXA 3CL7A 1HO1A 1ZPTA 3AOFA 5K4ZA 1KFBA 4S23A 1UJPA 1OT1A 1C8VA 2WHKA 4INFA 3TWBA 4JFTA 2YKKA 1H11A 1PCWA 4CCCA 4O0QA 2XZ9A 2WYSA 4QG6A 1TWIA 1B3ZA 5CG7A 2AGTA 3IIXA 3QC0A 3LHWA 3CMGA 4XVDA 1BHGA 5FA5A 4JZ5A 4GCXA 2QPXA 3KLKA 3R8HA 5BCAA 3S1VA 3VOCA 3BANA 4FHAA 2PDMA 3KTXA 4KCVA 1Z69A 4OU1A 3XISA 1UD5A 4RE2A 1TJ1A 2YZ5A 4UTKA 4OBRA 5REQA 3BLOA 2HMCA 3PZVA 2J7CA 4NILA 3I3EA 4HZ7A 3VE9A 3QOKA 1EA9C 4L9YA 3QYSA 3OYXA 4WJXA 2VTFA 3UBPC 4P8UA 3GTIA 2GSHA 5KSWA 3P93A 1O12A 3W28A 2CZFA 3R2GA 3W26A 2DJXA 2ZA1A 4UZSA 4ZMGA 2XVLA 4V28A 3TH6A 1M04A 3R13A 4Z1CA 3QQ0A 4ML9A 4AD1A 2PTXA 2EGZA 2XWEA 1I0BA 1SPQA 4WVXA 4TTGA 1GPWA 2DZXA 1IXQA 1UBPC 4JYDA 4G7EB 2A3CA 3UXKA 3EXSA 3GG0A 3SCWA 4C1KA 1M5WA 1KWKA 3V75A 4JQ1A 4DAFA 2BVYA 1O4UA 3ZVHB 2VDIA 3AS2A 3ZIZA 2G37A 3TA6A 1Z42A 4ACYA 2BHYA 3DHPA 4RX0A 2ZUTA 4DBEA 2G5WA 5EB8A 1XLGA 1V03A 4PBEA 4HJWA 4Q4RA 1YLVA 3TC6A 1V5XA 4REQB 5D05A 5D8WA 2WHJA 2IMRA 1K70A 3H55A 4CGTA 2C3ZA 1FWJC 4AZ7A 2QT3A 3U48A 2HPMA 4BZYA 3W82A 1VJSA 4ERIA 4CD8A 2B7OA 2CLIA 3OGRA 3ZSTA 1PX3A 5C0QA 2PFHA 4ERAA 3RF9A 3QF0A 1HKJA 1EPXA 1KGUA 4JYEA 1AQ0A 1EEPA 1TVNA 4I9JA 2AAMA 3GE7A 4S39A 2PZNA 4NSBA 4LBUA 5A6MA 3ELFA 4NHVA 3LN3A 1ZL1A 3APTA 3TAKA 1QK2A 4V2XA 1PTAA 4GIAA 3QY7A 1GOOA 3DFSA 3GIQA 1MFUA 2PLJA 3PZNA 4MWAA 5DCDA 3ARTA 3R94A 3P5ZA 2XJ7A 4S3DA 2I17A 3S1UA 5XIAA 4O0ZA 3CJPA 2VR2A 3IIVA 1U22A 1UP0A 1WZLA 2DU2A 4HHHA 3DG6A 3AYTA 3R6IA 2A1YA 2D2GA 3BG9A 1XIJA 5JBDA 2CLHA 3W81A 3C52A 1XS2A 1CDGA 2POTA 1GKQA 3EOOA 3PPFA 2Z0IA 2TSYA 3P6LA 3LPPA 5CC3A 3INPA 1WZAA 1XDMA 1ONRA 5EYWA 2YL5A 2Z1WA 3THCA 4KCTA 4AUBA 2PAJA 4K7YA 3N9RA 4GZJA 4PFHA 3UPWA 1TJ0A 4DELA 1EX5A 3S2NA 1VS1A 3MP3A 1CXIA 3H2AA 1W8GA 1E0VA 3WDQA 1EDTA 2IPGA 5H1WA 1MW0A 4WY0A 4M1BA 4H9TA 4HYRA 2CPUA 3SFKA 4BQ4A 1E4LA 2DZUA 4MWAD 3A5VA 2CW6A 2VVSA 2IPFA 3VIGA 1A50A 4IMFA 2VC6A 4QDPA 1RJRA 8TIMA 5AC4A 2J47A 5A94A 1NP2A 4L64A 4O1FA 2DY3A 3PBVA 1NFPA 3GHUA 4WSJA 4Z2GA 2F7FA 1X7IA 3DKJA 2HV5A 3GO2A 2I9UA 3E2RA 1SJBA 3T05A 2WAGA 1GQLA 3W7CA 4W7WA 4PMNA 4IX2A 5EGRA 4IUGA 3TN5A 2QEZA 4ZO7A 3FA4A 1F6KA 4C7FA 4HMEA 4FLQA 4WZHA 4CNOA 2YFNA 2F6XA 2BVDA 3H21A 2YCEA 3R0DA 2NW0A 3OBEA 4O16A 4MUPA 5K9DA 2QCMA 3WLMA 1R9YA 1VYSX 2CWNA 3GBDA 1XUUA 1L2UA 4G1KA 3QTGA 4GYJA 2XVGA 1JL8A 3VDHA 3F4WA 4UTHA 2ISDA 1PHQA 3GG1A 3EGJA 4BKNA 2NV1A 1DQUA 3T6CA 3MC5A 1SFJA 1NOFA 2Z00A 3VC6A 5A8PA 3NYDA 3QJAA 3C5QA 1SU5A 4M1RA 3VM5A 1XM3A 3DCPA 1BTMA 4M24A 1RD5A 3A4WA 1H0GA 2I57A 3L65A 3AUOA 2PU1A 4AZBA 3E3HA 4F9JA 4ZBCA 2FMNA 4HTYA 2VEFA 2CLMA 1M53A 4UTFA 1UZ1A 4WX2A 7XIMA 1EWEA 3OLGA 4D6CA 2C19A 3VD4A 3NQBA 1QWKA 2QJNA 3W83A 1KBLA 2PDYA 4XTDA 2V69A 1MXDA 5HMFA 1Z44A 1RQBA 1NOWA 4W7UA 3NQEA 3M1ZA 4WDUA 3PWAA 4LB4A 3VDCA 1F07A 3WBAA 2HK0A 1GQKA 1EOKA 2GGJA 2VD8A 3CZLA 1YDVA 4QITA 4N4PA 3K1DA 4HU3A 2XN2A 1XRTA 3L68A 4QJ5B 1KFEA 1E1EA 3SJNA 4YL2A 3WFZA 3PZOA 4UWMA 5HUOA 2CLLA 4F0KA 7TIMA 4PMXA 1B3WA 3OW1A 1GYMA 2VEKA 3WF4A 2O92A 1FWFC 5T91A 3RITA 2XFFA 3G1HA 1W1B1 2X0HA 3W6YA 2V5LA 3GDMA 4LUSA 4LWWA 3PBWA 2YGYA 3B06A 1E0WA 1KFWA 1QO2A 5C55A 4MB4A 1HP4A 4JTRA 4GXWA 3NXFA 1RALA 3KS6A 4UIOA 2BG5A 4MWAB 3UR7A 1BG4A 3VO0A 5I6SA 5TIMA 3UJRA 3TR9A 4AYGA 4MF4A 3FYPA 1OFQA 2WCSA 4KWOA 6TAAA 4IISA 1AMKA 4E0CA 4E2DA 1P6CA 4YTRA 4GI8A 4RNHA 3W71A 1ISWA 4KQNA 2DT0A 2CFFA 4YJ5A 3WH6A 3EWYA 1K02A 1UG6A 2DV0A 4JIRA 3SY1A 5FESA 1A53A 2DZTA 2WWDA 1E5NA 1MUCA 4IH3A 1AQHA 1NIUA 3OA3A 3PZUA 3UZJA 2OQYA 5RUBA 3B05A 2G97A 4Q32A 5CKSA 4O4VA 3FDGA 4MGGA 1KTBA 1E0UA 3SDOA 5EBAA 2CIPA 2EKGA 2GDUA 1ZFJA 1OX4A 2VX4A 4IWWA 3WK1A 4P8WA 1IR1A 3S1WA 5CLTA 1V0LA 1ISXA 3RU8X 4B9YA 5EL1A 3RNDA 2DIKA 3QY8A 3E38A 1X8CA 1BF6A 1XYAA 1MUWA 3RG6A 3LUTA 1UB3A 4NJHA 5FI8A 1UD3A 4HPHA 2VMFA 2VWTA 4MYAA 3AJ7A 1A5KC 2YDQA 3V4BA 4GOAA 1AW5A 2OODA 2ODOA 3V0TA 5H6HA 4IP5A 1R0MA 3O06A 3B4UA 1HGWA 3VNIA 4ACZA 1I1XA 4AMCA 3CL8A 3N4EA 1UZDA 3NO1A 4I9AA 3BAWA 3LQGA 4P7LA 1IXPA 4RV3A 4U5KA 3HG5A 5HAOA 4HNVA 4PMVA 4DNMA 3N2XA 1S2VA 4AXKA 1AK5A 1QPOA 1SFTA 4EF9A 4A6GA 4D2JA 3M0MA 2CHOA 2WOQA 3E9AA 4XKYB 1IGSA 4S3JA 2DFAA 3MVIA 4HA0A 4MJZA 2VURA 2RGMA 1JGIA 1VIWA 4F0SA 1EFZA 1IT8A 2FDSA 1BRLA 1EO5A 2FLIA 5F2MA 3VOIA 2WC4A 1EHNA 3LBOA 4HMDA 4UOQA 3SUWA 1K7EA 4I9MA 3U8GA 4IXXA 2NUWA 4DJED 3IGXA 4KT2A 4H41A 1KM2A 1K9EA 1XSIA 5A8OA 4V33A 1E40A 1TIWA 1GEQA 1KQYA 4JAWA 2UV8G 5H8PA 4X22A 1GVIA 3LPOA 1CXEA 5DY3A 1ZJAA 1NU5A 1QT1A 4LUIA 4DJDD 3WBEA 5BRQA 4K2SA 4JYFA 3P5YA 4GI9A 3UFYA 2JKPA 1GNXA 4H9ZA 1MQQA 3VD9A 2V2DA 4FXRA 1ITUA 4O19A 4GY0A 3IJ7A 4JCLA 3TUUA 1EC7A 3VX0A 4DNHA 5IOBA 3QGAC 3QXBA 3EWBX 3W29A 2XH4A 1L8PA 3LK6A 2YBVA 9RUBA 2RDUA 1FWIC 1UKPA 1FQ0A 4MPKA 2E7FA 3QEZA 2VGFA 2V0TA 5J04A 1TTJA 3NO3A 4IMDA 1DIDA 3L66A 1WBJA 4D6IA 5HR6A 1S2CA 1IQ8A 1CLKA 2OZTA 5KZEA 4MLJA 4RZ6A 3VDBA 5F7UA 1ZAJA 3FXGA 3V3WA 1VLWA 1O5KA 3PSVA 3N3MA 2VI0A 1C92A 2J25A 3BUVA 3WJYA 3VPLA 2Q71A 3IJDA 3WJSA 3W84A 4UMAA 4PC8A 1UHVA 4AZCB 1ITXA 3OGSA 1H3GA 4G9PA 3UVAA 4O8AA 2CC0A 5AHEA 3SUSA 4MDOA 2D20A 1Q6LA 1SZGA 2ZZ1A 2F8QA 1D3CA 4DAIA 1J5TA 3AISA 2YB4A 4EIVA 1OFDA 5HNUA 1PUDA 4IJBA 4R85A 3G0XA 3KCOA 3V35A 1RQHA 1WKYA 4KFNA 3WH9A 4Q8NA 4YHGA 1QUMA 1X6UA 3ZZ1A 1SJDA 3RLGA 5FEZA 1J0JA 5CSSA 3O6YX 3EB4A 1LP6A 3LPGA 5LNSA 4OECA 4LVAA 1T99A 3AMCA 4X2RA 2D2HA 2HTMA 1EH9A 2EG7A 2HNEA 4FLRA 4KWWA 2P76A 3SUVA 2R9RA 1XCXA 3WZ0E 1XJBA 1G69A 1E6RA 3MUCA 1XLJA 4KWVA 4W8LA 2ACSA 3HMJG 4MVAA 2VO5A 5IHRA 3STFA 1AL7A 1XSKA 3HFYA 4G1NA 3V18A 5DMLA 3IANA 4I6VA 3TYBA 3GK0A 3M07A 5BOEA 3WL0A 4CQDA 3PZTA 4IGHA 1OC5A 1NTHA 3BOFA 4F0MA 4PCNA 1I6NA 1TQJA 3E0FA 2E6AA 3CV6A 3O3RA 4NZ3A 3L67A 4JHMA 4QFUA 1XLDA 4QR6A 3IAQA 5HNRA 1DJWA 2VRJA 5FOOA 1WDSA 4UQCA 2YXXA 3VM7A 3GDTA 3PR2A 3PBGA 4GVFA 3S5OA 3U5YA 3GAKA 2E4TA 2EO7A 1L0PA 1VZWA 1KBJA 1PAMA 3C8NA 1JPHA 3DG3A 4B92A 2FQIA 3MU7A 4NL1A 4H7VA 1E51A 1DJXA 1VGAA 3F7JA 3S1XA 4KEZA 3HGRA 3W2UA 5A8GA 4JTGA 3OZOA 3WLNA 1B2YA 4DI9A 4UNKA 2DZWA 1XICA 2PCEA 1V6TA 1XKJA 4MSSA 4X60A 5EMJA 1G5AA 5A2BA 4XBSA 4RDVA 3VK5A 2CLKA 3STCA 4PE8A 3ZLGA 3R58A 3MY9A 2XGZA 2ZADA 4GJJA 2ZZ7A 4ZOCA 4GFIA 1T8XA 3MJYA 4L9ZA 4POCA 1QPNA 1XRSA 2VEPA 1TPVA 2J8GA 1TX0A 4ZGYA 4EK7A 3H4GA 4F0HA 4QIUA 2EPLX 3ITYA 3LBMA 4PMDA 1JQXA 3GZAA 4OUEA 5H8UA 4NZ5A 1F3TA 4TVDA 3KW3A 3AYSA 4AEFA 4W8AA 3EKGA 3TFXA 3RX2A 1GT8A 5AVHA 3QPEA 3GIPA 3H2FA 1Q7ZA 3VINA 3IIPA 1IF2A 1FY6A 1WYIA 1I45A 1KV5A 1FA2A 3W23A 1JR1A 2P0IA 3TYDA 3LNPA 3GYCA 2Z6JA 1A49A 1Y5VA 3AIBA 3UETA 1M6JA 3QSTA 4HPJA 2BY3A 1MW1A 2GLKA 1JCYA 4DM2A 2DZSA 5I77A 4MNMA 4LYRA 3CMJA 2VZVA 1TJPA 4K7VA 3LEPA 1S38A 3PFMA 1MUMA 3T55A 2A4AA 4XD6A 4GH3A 3ZFHA 3DGRA 1XH0A 2OXNA 3RJYA 4IIFA 4M5PA 2XSAA 1IWPA 3Q45A 1K8XA 5D2YA 4HHMA 3W0KA 1Q7QA 3TA9A 4RNJA 1JEZA 3FJ6A 3NPWA 4ZCWA 2G41A 2QULA 3TJIA 3M0VA 3GFXA 1M01A 1XHGA 1CXLA 4J40A 3AICA 4HB7A 3QQWA 1LJYA 2WLZA 4GYFA 1NQKA 1PIIA 2DVUA 1FH9A 1TV7A 1DIOA 4UNIA 4ZFMA 2X42A 1V3JA 3AUJA 1XLIA 4OQVA 4AHOA 1T96A 2GQAA 3AROA 3TR2A 2A7RA 1EJ7L 2V68A 3VKKA 5E6ZA 1W1PA 2A3EA 3VGGA 4HNCA 1JPIA 1MXGA 3PK7A 3WBXA 4X3ZA 3QZ6A 1I1WA 5XIMA 3UPMA 4LVBA 4I7UA 2IQ0A 3RILA 2EHHA 3ARXA 2CZDA 1ML1A 4FOKA 3EOSA 1FTXA 2WBGA 4HHLA 4QDWA 3KOZA 1RD6A 2GFTA 2PPGA 1V0MA 2ZA2A 1TJRA 1TTPA 3DFTA 4ZOEA 1EGMA 1FDJA 1TV8A 1PKMA 3DFYA 6REQB 1K4HA 4UTIA 2VXNA 4KWUA 1L6SA 4GUGA 1ZBVA 1FP8A 3EX4A 3HM7A 1SMAA 3HFTA 3M47A 1KGWA 3SQLA 4B90A 5HNTA 3FKKA 2BVTA 1RCOB 2XH2A 1YTKA 2DQXA 4J28A 4GKLA 3EOUA 4CKQA 3VMPA 3XIMA 4BF5A 2QUVA 2GOKA 2WC3A 3UZ5A 2Z26A 3UD6A 3F4NA 4MFDA 4Y96A 1P1MA 5IBXC 1H60A 4PCTA 1JG9A 3S3GA 2XN0A 3MI2A 1T40A 4TQTA 1DIKA 5GJNA 1X98A 2GJXB 3CQIA 4YTQA 4Z42C 5HUPA 3ZLHA 1U1HA 4IFOA 3NQMA 3KAOA 3URNA 3A5FA 5KZMA 3TONA 1GOQA 4M7TA 4PCSA 5KZDA 3ORWA 3R10A 1WUFA 3LB0A 5A6JA 4TOQA 4HK6A 2WM1A 1IXNA 1FWEC 1VCFA 1VBRA 4Q7IA 2WKJA 3VZYA 4I5UA 5HJXA 3AAMA 4NQ1A 1QI3A 4QISA 1N2VA 5JQ9A 5A8NA 1GKRA 2CCRA 2VFDA 5D4YA 1W5QA 5I09A 3HURA 3MBFA 3N3TA 3IUDA 3AI0A 1BVZA 2IUZA 4BS0A 4UNLA 2Q8ZA 4XAZA 4WK9A 5LA0A 4E8CA 1TO3A 2XISA 4EPBC 4DVOA 1M7JA 3BGJA 5JIPA 1OGSA 2CLOA 4QGCA 2I14A 4BQ2A 1M03A 4NASA 1ZB5A 3CAQA 1CGTA 2ZXBA 3UWEA 2YDSA 5BNKA 3P81A 2EPNA 1K7XA 4PMOA 3N2OA 4JDBA 3W1NA 4LCSA 1W3IA 3PANA 1IZJA 2DUZA 4QJ4B 3C6CA 3CZKA 1WKDA 1T6MA 1X97A 2D0FA 2ZZ3A 2YCLA 3L4TA 1K03A 2OGJA 3OVPA 1CXKA 3OLIA 3EX2A 5HANA 1PKNA 1KKRA 1PL9A 3FA3A 5A2CA 1P6BA 3AHZA 5LGZA 3SIZA 2V5BA 3R5EA 2XH0A 1Q85A 3GLCA 4DI8A 1PPIA 4E2OA 2WJDA 1GVFA 4QNWA 3IEBA 2ZYFA 7TAAA 1H5YA 2A6LA 1P0NA 1EJSC 4QG8A 3QR0A 1VQTA 3O16A 5GQBA 3E49A 4AD5A 3EA2A 2Z1XA 5K9XA 3SCNA 3SUTA 1BLIA 3G1RA 3IJ8A 3VOHA 1X96A 2J24A 3IGUA 1QI0A 3CLWA 3H4WA 3SN1A 2YW4A 3K4DA 1A3HA 2AKZA 4DJEC 1KCXA 5TD4A 4U28A 3FK4A 4M51A