3BURA

Crystal structure of delta(4)-3-ketosteroid 5-beta-reductase in complex with nadp and testosterone. resolution: 1.62 a.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2008-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3burA00
2DUXA 4JIHA 1M9HA 4H8NA 3EAUA 3CV7A 4LAZA 4YS1A 4IGSA 2PDPA 4PUUA 2HVOA 1MI3A 1YNQA 4GA8A 2HVNA 4XZLX 4YU1A 2FZ8A 2WZMA 3Q67A 4R9OA 4WRHA 3LN3A 3LQLA 4PR4A 2PD9A 1S2AA 3UWEA 2PDIA 2FVLA 1S1PA 3S3GA 3FJNA 4XVDA 1IEIA 3UZXA 1RY0A 1MRQA 3R8GA 1ZUAX 4FALA 4GQ0A 1QWKA 1ZGDA 3LENA 3V35A 3N2TA 2I16A 5AZ1A 4Q7BA 3CASA 3G1RA 3CV6A 4YVPA 3G5EA 5HNTA 3V0SA 4JTDA 4JQ4A 4L1XA 2NVDA 3WBWA 5M2FX 4WDXA 2PDUA 3WBXA 2DV0A 4DZ5A 3ERPA 3V0UA 5LIWX 1PZ0A 1PYFA 2ACQA 2PDFA 3RX2A 2DUZA 2PDHA 5AZ0A 5JH1A 3LBOA 3F7JA 3V0TA 2PDCA 1SM9A 4FA3A 1K8CA 1US0A 1MZRA 2HE5A 1EKOA 3UZWA 1X98A 2PEVA 4EXAA 1Z9AA 4XZHA 3O3RA 5LIXX 4XVEA 2IKHA 4IJCA 3LQGA 3WG6A 1YNPA 2INEA 4YVVA 1XF0A 3M0IA 2HE8A 1X97A 4I5XA 1EL3A 4GACA 3T42A 1XJBA 2F38A 3LEPA 2PDQA 3GHRA 1PWLA 3DN5A 5LIKX 2PDMA 2BP1A 4Q3MA 2IS7A 1S1RA 2PDGA 2BGQA 2PD5A 3BCJA 3H7RA 4DBWA 4XZIA 3R43A 3R6IA 2CLPA 2IKGA 1RALA 1AZ2A 4QBXA 2HDJA 2IPWA 3UZYA 1PWMA 3ONCA 3LUTA 3LNMA 1LQAA 1X96A 1FRBA 2PF8A 4WDTA 5HA7A 2WZTA 3WBYA 5KETA 3LZ3A 4GIEA 2INZA 2P5NA 1AH0A 1AH3A 3Q65A 4QXIA 4GQGA 1AH4A 2J8TA 3CAQA 2PDNA 3VXGA 3BV7A 5JH2A 4PRRA 1ZQ5A 2FZ9A 3MB9A 3LZ5A 2R9RA 3UFYA 3GUGA 4LAUA 3C3UA 2HV5A 1ADSA 1ZSXA 3V36A 1VP5A 2AGTA 2FGBA 4F40A 1XGDA 4GCAA 4JTRA 3P2VA 4MHBA 3FX4A 5DANA 1C9WA 4WDUA 3WCZA 3ONBA 3KRBA 1QRQA 1J96A 1S2CA 4DBSA 1LWIA 1HQTA 2PDJA 2BGSA 1Z89A 1JEZA 3R94A 4G5DA 4JQAA 1A80A 4IJRA 3CMFA 3CAVA 4LBSA 4LBRA 2PDLA 3EB3A 3RX4A 4JQ2A 2NVCA 5LIYX 1HW6A 3H4GA 4DBUA 4H7CA 1R38A 1AZ1A 2PDXA 2ACSA 3U2CA 1VBJA 3UGRA 4WGHA 4PRTA 1UR3M 4FAMA 3UP8A 1GVEA 4RPQA 2ACUA 2ISFA 4LB3A 1IHIA 4XZMX 1PZ1A 2IPGA 4LB4A 5C7HA 3M64A 3QKZA 2IKJA 3M4HA 3UG8A 1RY8A 5HNUA 3DOPA 2ALRA 3R58A 4JTCA 4PUWA 3GHSA 3D3FA 1EF3A 4JIIX 2IPJA 4PMJA 4JTAA 4XAPA 5LIUX 1Q13A 1AFSA 4QX4A 1Z3NA 3BURA 2C91A 4NKCA 2I17A 3B3DA 2PZNA 2PDYA 3EB4A 1OG6A 4WDWA 2PDBA 4HBKA 4OTKA 1YE4A 4ICCX 3MC5A 2F2KA 3R7MA 4L1WA 4YVXA 1YE6A 3RX3A 4XZNX 2IKIA 1T41A 4AUBA 3UYIA 4QR6A 2ACRA 4GABA 1Q5MA 1T40A 4WEVX 4JIRA 3BUVA 2PDWA 4ASTA 2IQDA 2R24A 2IQ0A 3N6QA 3O0KA 3GHTA 3NTYA 4XK2A 2FZBA 4ZFCA 4JTQA 3LD5A 4XO7A 2HEJA 3R8HA 2PFHA 2PDKA 4XO6A 3H7UA 1Z8AA 2QXWA 3UZZA 3GHUA 4HMNA 2IPFA 2VDGA 3COTA 4FZIA 4EXBA 4JQ3A 2FZDA 1EXBA 2A79A 4JQ1A
chains in the Genus database with same CATH superfamily
1MEWA 3QGVA 3W26A 2XH7A 3BMVA 1XBVA 5C9XA 2ICSA 1TZ9A 2REQB 3L2LA 4NAEB 4Q4OA 1MI3A 3KS6A 5C0QA 5I79A 5DLCA 1WDDA 3W70A 3GH4A 1OG0A 1UWSA 1EO5A 1DPMA 5JBDA 2OTDA 3DFQA 3E0LA 3CEUA 2GQAA 3CQJA 5B80A 3EOEA 4HPJA 2FTPA 2WK2A 2FPYA 1QPQA 2GSHA 1GOOA 4HTBA 2CLFA 1YIXA 3KHDA 3BLOA 3DFPA 1AQMA 1IV8A 3ICJA 4EOUA 5TD4A 2YDRA 4FIQA 4I9AA 2OX4A 1TWWA 1QOPA 4FP1A 3VKKA 3FJLA 2ZUUA 3HZ3A 2UY3A 3E12A 1ICPA 4NSBA 3ARRA 3WK1A 1LLWA 4RNJA 4RR4A 3T07A 5AYZA 1EP2A 2ISVA 2PTYA 3K30A 3P0WA 3MZ2A 3NVDA 3KBWA 3G3DA 4Q7IA 2AGKA 1XD1A 2A4AA 3NSNA 1RJPA 2WSQA 4ZO7A 1NH6A 3ANYA 2VC7A 2VZUA 3WQVA 2PWDA 5CPNA 2W5FA 1GW1A 3LBOA 2TYSA 3NR0A 4DWSC 3DYPA 2Z1XA 2B4GA 3EOOA 2J13A 2G96A 4KS0A 4CEXC 1X98A 4HNTA 1NVMA 4I90A 2PEVA 4EXAA 1V0LA 3FKRA 3TROA 2JFEX 3VNMA 4ZXOA 4AIUA 2D2HA 1PIGA 3O63A 1W9DM 3XIMA 4AWUA 1XF0A 1ELSA 3MDWA 1JAEA 4OOZA 4Z1DA 1O1HA 1V6YA 4AHPA 2HK0A 3AUOA 3L5AA 3KL3A 4UC5A 1T8XA 4LRSA 1PL9A 4PFHA 1OF8A 3OIHA 1UP3A 3OODA 4GZIA 2YW3A 1K8YA 3S2NA 2GQ9A 3VIJA 2PDMA 2WKJA 3A13A 4B90A 2PDGA 1EJXC 3EBVA 1KTCA 1L8PA 3C52A 2H6RA 4P5UA 3TA6A 4AY7A 3EX4A 5D9MA 4KEVA 2QCFA 3NO1A 1TQXA 3ANUA 2CLPA 4QBXA 3YPIA 4DAIA 1TPVA 2KX9A 1XC6A 4UTWA 3UZJA 1NEYA 3KFTA 5DT7A 4IH3A 2V3GA 1XIIA 1E55A 1J0ZA 1X96A 1E71M 3H24A 2WC7A 4POCA 4ADTA 4BFAA 1DBTA 4Q8QA 3WK2A 1A5KC 4ZOEA 5DF0A 2PS2A 3WL1A 4YLWA 4WIWA 3AYSA 3RILA 2P5NA 3WUBA 4HMDA 4IMCA 3RN6A 3WBAA 2WZHA 1YKWA 2DZVA 3S5YA 5CPLA 3VDAA 3RLUA 2J8TA 4Y8FA 2P8CA 3BG3A 4Q4SA 4MDOA 5DFAA 2DP3A 4YJ5A 2XM1A 5DT5A 4O1BA 4S3EA 1JCYA 2FZ9A 1CLVA 2I5QA 4C6IA 1F7BA 1W31A 2RKXA 3G1YA 3UNTA 1K7EA 4X9SA 4K1WA 1K02A 1VJIA 3QPYA 4K39A 4GFSA 4D71A 3VI2A 1D8WA 3EMZA 5TQLA 1B3WA 4ZMGA 1W1IE 3G1FA 3BJTA 5U4NA 3GNPA 5A95A 3R94A 4CVUA 3H21A 4FF5A 3WH6A 1J9YA 4PSPA 1EWDA 2PDLA 3GVGA 1LOQA 2QDDA 4P8VA 3S4TA 2PMQA 5G4WA 3RX4A 5LIYX 3ZT7A 3S5NA 4N7QA 5CG7A 3EWWA 3EWYA 4RZ5A 5D03A 4ZQNA 2AQVA 3PK7A 3CAWA 3KDOA 2ZWZA 4OZOA 2JKAA 2PLJA 4DUOA 4PUNA 2XVNA 1PZ1A 1I0DA 3OGSA 3W75A 5C7HA 1XI3A 3T0DA 5EMKA 3G22A 4NASA 2OJPA 4KETA 1C90A 1ODZA 5K4ZA 4Q8PA 1S2WA 3DOPA 2ALRA 3SRFA 5CAKA 4QM1A 3NPVA 3DDMA 4O18A 1EF3A 3M5ZA 2J27A 1ODUA 4N42A 3C86A 4UFHA 1ZBWA 2GJNA 5A6BD 3O06A 1XBXA 3HPXA 3P8JA 4MJ4A 5AHLA 1UD6A 2ZXQA 4DELA 3VCCA 3MBDA 1HL8A 3MVIA 3AU6A 1H1YA 5EU9A 1QPKA 2PC8A 3NQAA 2V68A 4ZB5A 4HNUA 1IF2A 4MTVA 5TNVA 1VKFA 1K03A 3WLMA 3UXLA 4FLRA 3R7MA 1NDVA 2VCBA 1KO0A 1PKYA 3H6OA 3S6TA 2XIOA 3F4NA 3TK7A 5HBFA 2X09A 4H8UA 2V30A 1VF8A 1TVLA 4HNOA 3AROA 3DECA 2PC4A 1V08A 2VC9A 4HIBA 3C2YA 2WJFA 3LG3A 3PZQA 1UWTA 5FIPA 4ZQOA 2A3LA 1ISXA 5DMLA 3I6RA 3O0KA 3PBGA 4AXNA 5KEZA 4D6CA 2DIKA 4JTQA 1OFOA 2JKEA 2VELA 2YBUA 1PS9A 1LM1A 3LERA 1WV2A 2OQYA 1W2VA 1HNYA 1DJQA 1O5XA 5CSSA 1W9XA 4PMYA 1YLVA 2NQZA 1WNOA 4UR9A 1ZAHA 1A0DA 3M47A 2CLEA 3S6OA 3LHYA 4I9TA 4O13A 1C8YA 2WW5A 2J8GA 2YXXA 3CEPA 1QI2A 3HN3A 3UCDA 3DGRA 3VDCA 4GNJA 1RK5A 2DZBA 2DUXA 1BWLA 2DT0A 4TVDA 1UP2A 4ZZ9A 2XYLA 1NWSA 1DIDA 3LBMA 1OVDA 3PZGA 4BEUA 2CEQA 4OECA 2J25A 3L4YA 1SW3A 1A4MA 3K46A 3EKLA 1K4HA 4XB3A 1LLZA 1MQQA 2PDIA 4HMCA 3VX1A 3S9YA 1MXSA 1B31A 1L6GA 4NRSA 3TW9A 3MWAA 1UYQA 4U5KA 1PCWA 3PWGA 3UQNA 4E2DA 4O1AA 3E1F1 3CUZA 3ARTA 4GQ0A 1FWDC 2X1TA 4B9YA 2Y8UA 5F1VA 2PRMA 4XBSA 4JTKA 4MYXA 3N2MA 1ME9A 3JZEA 3P5YA 2EPKX 4Z17A 2J6XA 3QY6A 3PN8A 1HO1A 5C71A 1EJTC 2VHLA 2VRJA 1R2TA 1E0TA 1IT7A 3KBVA 3WDRA 2Z7KA 3SURA 4DM2A 1E1FA 4LTSA 4EKJA 1XYFA 3SAZA 4TR9A 4R85A 3RLGA 4GO9A 2E9BA 1WYIA 2HPIA 2PDHA 2TRSA 5AZ0A 1W6TA 1A53A 3MSGA 3F2CA 5FEZA 1QHZA 1XBYA 2R1MA 2J9XA 3E38A 7ENLA 1UB3A 4J40A 2DJLA 1C91A 1TVNA 3LHVA 1MUCA 2RAGA 1JCNA 3DKJA 5I78A 3EDKA 2POTA 3W02A 4AWSA 4RZBA 4O52A 4QEHA 4I7WA 4LCSA 4D6GA 3EWCA 4MZ1A 5BRQA 1EP3A 3M07A 4LEQA 5GVJA 3B97A 4ORIA 3U6WA 2H8ZA 4IPNB 4LNYA 3ZJ7A 4XAZA 3KBSA 4GX9A 2IS7A 1JGMA 1D3GA 5AFDA 4LFYA 4KIEA 3SUUA 4PTNA 4LH8A 3SGZA 5HATA 1THFD 4W88A 4M24A 2VEMA 2QDHA 2LLEA 3N6JA 3R1ZA 3UWVA 3V7PA 1TMHA 1TPEA 2GJXB 4FNRA 1HUVA 3F2DA 1NIUA 4L80A 1G67A 1R8LA 4AZCB 2XISA 1OIMA 2VI0A 3NZ1A 1PWMA 1M7OA 1T7LA 3WLOA 2CZFA 2OZ3A 1SPQA 3BAWA 4GJIA 1DTNA 1I2PA 3ES7A 1V0NA 4AAJA 1VJZA 3LK6A 3NJ3A 1HKVA 3Q94A 3GDKA 3AXXA 2R1PA 1OY0A 4HPGA 1CZ1A 4JCMA 3BLIA 3LY0A 3UG4A 4P7QA 5BXTA 3H12A 3FKKA 2PDNA 3GS6A 3CTTA 3WK3A 3CU2A 2D22A 1YMYA 4KPLA 1XICA 4H04A 4U3AA 5IBXA 1LL6A 3CUHA 1E1CA 2WVTA 3AWNA 3GM8A 1GOKA 3VOJA 4B3KA 3QLDA 2UWFA 5MKGA 3MV11 3W37A 4DUWA 1LZOA 1L9WA 3AXMA 4F40A 3V1PA 4X9YA 1CENA 3GYCA 1U33A 3BLDA 1W3LA 3ZJ8A 1QUMA 1C9WA 2DW6A 4BI6A 3ONBA 2V5JA 3TQKA 1PXGA 1VHNA 4S3BA 2FJKA 3N3TA 5G5IA 1FXPA 4DJFC 3ZQ9A 4HTYA 5GJPA 1BD0A 4GYFA 1Y5XA 1VD6A 3RPMA 1NQKA 4ZB0A 2C1IA 4KWSA 3CAKA 3ZWSA 3GUWA 4RV3A 4CNOA 1K1DA 2BODX 1J0HA 3VMOA 4J7RA 3W07A 5MHBA 4P7LA 3QR0A 1O1ZA 1SUXA 3UG8A 3QSTA 5AHNA 4RE0A 3ZR6A 1UASA 1HF6A 3UR2A 3OEXA 3WLHA 1ZP4A 1VZWA 3L2MA 3CUJA 6XIAA 4US6A 2V0TA 2PWHA 1H4PA 2X42A 1EPXA 3GIPA 4BF5A 1OT1A 3WH5A 3IACA 4XIMA 3U0HA 3MP4A 1GJPA 1LG2A 1LL7A 1FWJC 3ITYA 3UJEA 1KR0A 3DG6A 4NJKA 3ZFHA 4BA0A 4DPPA 3W7IA 1G01A 3GXDA 3LXBA 2BX7A 2QR6A 2E0PA 4MYAA 3LRLA 2ZX6A 1R9ZA 2XFWA 3EA2A 4AQLA 1VENA 3RR1A 1ZU8A 3NQVA 3WH9A 4AD3A 1FWSA 3P7YA 1U2YA 4NZFA 1UWRA 3S1GA 3BUVA 4IF2A 1UC5A 3VGEA 3OYZA 1QPOA 3GD6A 2C14A 1EBHA 2OX1A 2FGZA 3NTYA 4XK2A 4GJ1A 2FZBA 2D0GA 4RDZA 3TQ0A 1QU4A 3W28A 5C70A 4EF9A 3WMBA 5LA2A 3KVLA 3PNUA 3VK5A 4W4QA 4XO6A 4LVGA 2OYLA 1SJBA 3C2EA 3PJXA 3FK4A 3R25A 3TAOA 1F74A 1J0YA 3P14A 3RRAA 4WJEA 4EXBA 1VBHA 3CHEA 1FWGC 4IZGA 1Z42A 2QYGA 2SFPA 2YLLA 5FJRA 5HR7A 1OGBA 2VFDA 1TV3A 4PMRA 4L4MA 3AMDA 2CZ5A 1PV8A 2X2YA 4MZYA 1EEXA 3MSRA 1KB3A 4R9OA 1IWPA 4C90A 3KVKA 5CEWA 1H0IA 5T8GA 3PBMA 4GY0A 2Y63A 1Q6GA 3AISA 1S5VA 3U2EA 2FJUB 4JFSA 3W53A 3WJSA 2Z1SA 3W00A 1JAKA 3PBUA 1K9TA 1W1B1 1M7PA 2JF6A 3IV8A 3PULA 6A3HA 1AJZA 1BYBA 2HNHA 1W1TA 1PPIA 2NUYA 1PDZA 2WKLA 5BOFA 9CGTA 4W89A 3A5FA 1M04A 1OGGA 3U4AA 3CM4A 5AZ1A 4ZOBA 2VR2A 1AMKA 5KZMA 3IANA 3KCOA 3G1RA 2VGGA 1DV7A 3UETA 4E4FA 5HNTA 1GNXA 4LUSB 3BAKA 3L0KA 1VEOA 1AQ0A 1OSEA 3WBXA 3GKFA 5LZLA 3VIGA 1CCWB 2CWNA 1JQXA 1RJQA 5CJNA 2W6RA 1L6SA 2YDAA 1VR6A 3W7JA 4BQ5A 4DWDA 2H3BA 4NU7A 1A4LA 5JH1A 2ZRXA 4AZGA 3IJIA 3BZGA 3F4VA 3T4WA 1FH9A 2ZTJA 3VFLA 5DMMA 3HF3A 3S83A 4QSFA 2ZA2A 1N8IA 1B3XA 1M7XA 3U5YA 3GR7A 5EL1A 3S5ZA 3GRIA 2IKHA 4IJCA 5LHEA 1X1OA 4UQEA 1S46A 1FH8A 4YVVA 4UTIA 3BJFA 2ZE3A 2VVSA 3ALFA 4O1CA 1GZ1A 4KH2A 1XBZA 3BOLA 1BXBA 5D37A 2PWFA 1JZ3A 1QI5A 2EO7A 2W67A 4C6PA 4CEUC 3M5VA 1I0BA 4REQA 3DCPA 4BHYA 5FAGA 1JL8A 3AHVA 2VFEA 4FLQA 4TX8A 2J24A 1FHVA 4EP8C 4RPPA 1W9BM 3OOQA 2QCDA 3PPCA 1AVAA 3BCDA 4Q8MA 3TWBA 2ZKMX 1Q6QA 2GUUA 2OZ0A 1FFRA 2AQOA 1FHDA 2EG6A 4B5UA 2E25A 3R5EA 1O5KA 3BPWA 3QQ0A 3UY7A 3M5YA 2XSAA 1MMFA 5JIPA 5G4EA 4XD5A 2J77A 2ZC8A 4QLKA 4IJBA 1GTHA 5HPCA 3BSGA 1G1YA 1AH3A 4H9XA 4C5ZA 1PVNA 4XKYB 3TNBA 1SO6A 3U4FA 1N8FA 2G0WA 3NWRA 4OWGA 3NPWA 5JH2A 4GJJA 3ITXA 2FKPA 4ZQRA 4PRRA 5DCEA 2VCCA 2R9RA 2OQLA 3VIFA 3SBFA 2XHYA 3HQ1A 3QZEA 3MO4A 3UA4A 1R46A 3GXTA 3BICA 3HPZA 1XGDA 4C6KA 5FESA 3SFWA 1XLGA 1WAWA 2D69A 3TR2A 1YTDA 2VURA 4GXPA 4WY0F 1Q6CA 2JKPA 1YPXA 4P7OA 1T6MA 1OFEA 3GH7A 4LBUA 3GNNA 2DZXA 4G5DA 5U7SA 4LBSA 1VRDA 3E6EA 4Z0SA 3EDDA 1YTKA 2O7SA 3HM7A 4QP0A 3DEQA 4ALDA 1P48A 1IT0A 2Q01A 1QJWA 1EJRC 4HPNA 3LCWA 1KXTA 1HW6A 3EWXA 4KRUA 2ZA1A 1BG9A 3TLQA 5CGTA 1Q7ZA 2A3AA 3T4CA 1EJUC 4Q22A 1VBJA 3UD6A 5CGMA 4I6VA 4UNIA 1XLDA 1JCTA 3BANA 5CZKA 1IGSA 1XL9A 1W1YA 4C6JA 2J74A 2OEMA 3TCSA 4JOMA 1AUSL 3C0QA 1TTPA 4MB1A 4MB4A 3CZLA 1XFCA 4F66A 4UOZA 3N29A 1US2A 1DQWA 1ZLPA 4JTCA 3LCHA 1TO3A 1JDCA 3OLGA 3FJ6A 4DRSA 3UZ5A 5BRBA 4KEUA 2ZRVA 2GGHA 3H22A 3SQSA 3B0UX 1MVYA 1QO2A 4BQ3A 4DQWA 4U2ZA 3CBWA 3T44A 3MYPA 3QKEA 5LHFA 1V3LA 3AS3A 3S8HA 4GVGA 3S5SA 2HBVA 3CIWA 3FA4A 3JVAA 1FOBA 3FS2A 4B2DD 3H55A 4HNCA 2E9MA 4N9CA 3TTEA 3W7RA 4C6DA 4DXVA 3G6LA 3R0UA 1JNDA 5ENLA 3R12A 1PKLA 2PBOA 2X7WA 4GKTA 2HXUA 2FZMA 3EEGA 5HWMA 3AIVA 2QW5A 1U83A 1P7TB 1P6BA 3QY7A 1IR1A 3S1VA 4ASTA 5FACA 5TIMA 1YW1A 3AZTA 3WD2A 4MWAA 1WOAA 1GW9A 2WMFA 1GWJA 2YA1A 4HU3A 4J3VA 1K6WA 4JFUA 2JGYA 5H6HA 3ABXA 4AD5A 3HG2A 5K9DA 4GCXA 3QHOA 1UQYA 2A7RA 1CBGA 3GAKA 3CZKA 3JS3A 3PZMA 4AC1X 1R87A 2ZUNA 4S3JA 4KW2A 1HKJA 2A79A 4N9DA 2J75A 3QBUA 4IIHA 2YCEA 2XVLA 1KLZA 2GZXA 4GBUA 4HU0A 3KTXA 3T6CA 5HDRA 1B9BA 4LAZA 3D5HA 2NLIA 1JFHA 3IIVA 2YIHA 3W6MA 4GA8A 1JF5A 5IOBA 2J6VA 3M0XA 4J3SA 3W83A 1ITUA 3UWEA 4LUJA 1SW0A 3S3GA 1AODA 4XBJA 4O14A 1GVSA 3IEBA 3LHZA 3RFAA 3KM8A 3OPSA 4QITA 2QCLA 2RDTA 2O56A 1ZALA 3KVJA 4QHRA 1H41A 3V35A 5CXPA 1XSKA 5FJJA 4S3FA 2YFNA 4FXFA 1XLCA 4QEEA 3PUDA 4F9JA 3CQKA 4IGHA 3VIKA 2XGZA 4ACZB 3V0SA 4I7VA 5T91A 3L68A 3C2RA 3VOCA 2NVAA 2PU0A 4PGLA 3KS5A 1TIMA 1BSLA 3S2JA 1GQIA 4CQ9A 3B4YA 3VU2A 4QCFA 3W4RA 1R86A 1TRDA 1DOSA 3FY1A 2NQLA 3BO9A 1OZMA 2WOQA 4PYSA 5DRIA 2Q8XA 4FOKA 3IUDA 3LSCA 3PWAA 1UA7A 1FKWA 4L4PA 2AL2B 3TYBA 4HZ8A 4XZHA 1VLIA 3PSWA 5IDIA 4P61A 2EKGA 4O8RA 3D0CA 1FKXA 4PEKA 3ANVA 1B4EA 3CUXA 3KP0A 3V18A 4D6IA 1N55A 3ENLA 1NDWA 1A0EA 1MQRA 7TAAA 4DUXA 2O9OA 3G0XA 2J7GA 3TC6A 1G4EA 4D6FA 4DPQA 3W1TA 2NW0A 1SZNA 1OYBA 3BC9A 3GG8A 4IQEA 1M5WA 3WUEA 2NQJA 2RGMA 4S1FA 1YNYA 4XKYA 6TAAA 1H63A 4PMOA 3A23A 4PMQA 3BCJA 4H3DA 4XWUA 4K6AA 3HIJA 1OFPA 2QDEA 1OEPA 5A5WA 3SGGA 1EUNA 4H6KA 3V1HA 1KM3A 5FD0A 4O0QA 4LAOA 5D2TA 4NI8A 3DXIA 1WOBA 2OELA 3UZYA 3HGRA 1SMDA 3EDJA 1VRXA 1ZJBA 1LRNA 4RXGA 1Q8JA 1BLIA 3GYEA 4H8HA 5HA7A 4E0CA 2WCGA 4M0XA 2H8XA 5AC5A 4IFKB 4E5TA 4GIEA 4CNSA 4UTKA 2X8RA 4FB7A 1KA9F 2GK1A 3GE7A 4S2CA 2VMFA 1CEOA 4NRRA 4UMCA 4K7VA 2XM2A 3LXAA 4HVXA 1HGWA 4HP5A 5IRPA 3LDVA 1OX4A 4QJ1A 3EOSA 3LI0A 1X1NA 4E4PA 2TMDA 3QOMA 1MSSA 3FN9A 1LWHA 3GAYA 4AWTA 1WZMA 3QZ6A 4IGNA 4IQLA 2NXIA 1BG4A 4XSMA 1OGSA 2PWGA 2V5DA 1KFKA 2AGTA 2XIQA 5GQBA 2R14A 5CSYA 4LVBA 1EF2A 1TZZA 4V27A 3KWSA 3NZRA 4Z2HA 1ZHAA 3NYDA 1IXOA 2CHOA 3LYEA 3DFSA 5E93A 1BTCA 3F4CA 4DZAA 3RHGA 1YBQB 3TAKA 5ECVA 1WP6A 3CMFA 3NQBA 1R7OA 4DJDC 2BSLA 1XUUA 3P67A 1UPPA 1IIGA 4GUHA 3EB3A 1F3EA 4LCQA 3L5LA 3STGA 4F0KA 3THQA 1CGTA 4M3PA 1K7FA 2CCRA 3MMWA 1B54A 1TJPA 3UGRA 3AALA 1K9FA 4X2PA 3W2NA 4S23A 3UCCA 3GXNA 5H8MA 4XZMX 4BWLC 4N6FA 1XLAA 5D2VA 8RUCA 1EC7A 1XCXA 4PCFA 4DLFA 1M65A 3KRZA 5L9FA 1V02A 3IPWA 3GG7A 1V7YA 2WWCA 2XN0A 3GHSA 4JX5A 1A0CA 4UTFA 2AKMA 4B3LA 3T0BA 4YXGA 4ICNA 1ZENA 2E5DA 1FCUA 2Z00A 1HKIA 2C91A 1PO9A 4NKCA 1CIUA 2WLYA 3B3DA 2AKZA 4N9EA 1O66A 3KDNA 3RIKA 1R2RA 2ALDA 2PDBA 2V69A 4V1XA 5HQLA 1OX5A 2F2KA 2PB1A 2QT3A 2A3HA 2PTWA 4YTUA 3TSDA 1TELA 2HQAA 3CT2A 5C2GA 3RJXA 3A4JA 2PTXA 1KBJA 3LBCA 4Z2JA 1H7RA 9RUBA 3T2QA 5C5YA 3T0CA 1PX4A 1J18A 3WH8A 1RPKA 3KP1A 2YL8A 4UZSA 5I6SA 4MJZA 4JL1A 4NAFB 4FR1A 1MW0A 2GL5A 1SVDA 3L4WA 3A64A 1TWSA 2F84A 4H9ZA 5I23A 5DY3A 2XWEA 1F07A 1OADA 5A94A 4WSJA 8CGTA 3TUUA 4R9XA 1JXJA 1UW9A 4X3ZA 4DIAA 2C15A 3UW6A 4H19A 4C1NB 1RBOB 1EO7A 2W91A 4JIQA 3LSBA 2EGZA 2B0MA 4UUIA 4J27A 3AZRA 1CLKA 4UTLA 1HP5A 2HVNA 2WZMA 3GNDA 3OBKA 3AQUA 2GJRA 3EOUA 1GQLA 1SJCA 3PTQA 4QFUA 4HJFA 1V8EA 3PJWA 3OW1A 3ORWA 4JDBA 3VNZA 4AZHA 1C8XA 5EMYA 4NJHA 1LBFA 3AHTA 4O17A 1LWJA 4YHEA 3LOTA 2OWCA 3Q4DA 1N2VA 4X61A 1KFWA 2DZPA 3LPFA 3CHDA 4U3CA 1B0IA 2J7FA 3DI0A 1UUQA 3Q37A 4RE4A 4AIBA 2DV0A 4JCLA 4W7UA 3UVIA 4B5NA 1TIWA 4IG2B 4H6RA 2OKOA 3WJWA 1X39A 1FWNA 3W84A 1HJVA 2ZICA 1S2TA 4XAFA 1R7AA 4CNUA 1IIHA 3MUY1 2PDCA 3VKDA 2D24A 2CZVA 2OEJA 5JQ9A 1A5SA 2ISSA 3KW3A 2B7QA 3WDJA 4NP7A 1AD4A 4JR5A 3AS2A 2G4FA 5HWJA 5A6TC 2GLKA 4ROQA 4IPIA 2VFGA 1RR2A 2J78A 1IE7C 1JDAA 3DGBA 5AECA 3LM3A 3I6EA 4S3KA 3THUA 1TV8A 2WQDA 3RF9A 3HG4A 1OFRA 2RHGA 3CL6A 4Z2GA 1CGYA 1YPIA 4ATDA 3ARUA 1EHAA 3LLDA 1KXQA 2J9YA 1T5AA 3MJMA 4AD2A 1C92A 3M44A 4KIRA 4W86A 2Z28A 1AD1A 1GORA 4HHHA 4RLIA 4TIMA 6REQA 5E5CA 1J2WA 1E9YB 3T08A 3EKZA 1EX5A 2WMJA 3ECQA 2ZUTA 4RE2A 5LSMA 3M16A 1A47A 4QNEA 3ONCA 5F4SA 5I06A 1FCQA 1PTDA 3LUTA 4A35A 4BS0A 4U10A 3WD3A 1X6LA 1ZAIA 2WVSA 4PN2A 1JFXA 3G77A 4WDTA 2WWDA 1K6AA 4X22A 1X6NA 5CZSA 1RCQA 4EWND 2Y4SA 2QUTA 4QLLA 3AI0A 1V4YA 5B7ZA 2VVNA 2A3BA 3WIJA 4PUMA 1UKPA 1Y7VA 4G6CA 4JTHA 3TX9A 3O2LA 7XIMA 1DIOA 3OGRA 1UUMA 3PZTA 5C9ZA 1YRRA 1TA3A 5TAOA 4AW7A 2W27A 1XHGA 2A1YA 1XCFA 4J35A 3O6YX 1BYDA 2H9AB 5ABHA 3C8FA 3QMRA 3B9AA 3W82A 1DWFM 3E3HA 1E40A 1U30A 3WCZA 3PUOA 5EFDA 2VFIA 4LC6A 2NLYA 2ZA3A 4FEZA 4CU6A 1BKHA 3HFYA 4IIGA 2BGSA 2D23A 3THAA 4RXFA 5I03A 5I24A 3MKKA 3HG5A 2CBUA 4OOUA 1MW1A 4H7VA 3WD0A 1PTGA 4WLCA 2VGBA 3L0NA 4QGCA 1V6TA 2Z6JA 3M0ZA 4C1KA 4FXJA 4FK9A 2IW0A 5LNRA 3W71A 3VGDA 4A8NA 3OB8A 3CLMA 4DBUA 1AZ1A 4DZHA 4O8AA 4PODA 2W62A 3FA5A 3IRDA 5H91A 4PH6A 3N13A 4UOJA 3VD3A 3GX9A 5CLWA 4W9TA 4ZTXA 2NXGA 4HN8A 2OEKA 4PCSA 3W7QA 4LB4A 4WJ8A 4CD4A 1XDJA 3WBEA 3GNOA 1H7PA 3W2KA 1P0DA 4JDYA 1J11A 4XAGA 4WXYA 1E4LA 1ME8A 1UH3A 2X16A 2BLEA 1TTJA 1FWTA 4PE8A 3MHUA 2E8ZA 3BAJA 1WZLA 1RH9A 2QCMA 3G24A 1AJ0A 1QCWA 2Z1KA 4MSSA 3TNOA 2DT3A 1FTXA 1HL2A 1I2OA 3NA8A 3CZGA 2B81A 2Y7EA 3MUCA 3L4TA 4TVCA 2BVWA 3WUFA 1DJHA 4O54A 4CQAA 3B8DA 1MQPA 3QV7A 4YVXA 4M1BA 2QVNA 3PS7A 3QPZA 4XZNX 2Z24A 1EOKA 1W1VA 3SDOA 4L4OA 3TN4A 1AA1B 4KFOA 3M9YA 2AMGA 4GH3A 1X38A 4GUGA 2P1FA 1AW1A 2E3ZA 3DBPA 1R9YA 3N6QA 3LPOA 2DGAA 1CDGA 1Q45A 3GHTA 2BV9A 3V75A 4GRSA 1SZFA 3IGHX 3QRHA 3RGTA 2CBVA 1YTEA 4AHOA 1UHVA 4AD1A 1FP9A 1XWYA 4H6QA 3ARYA 4EACA 3MUAA 2QGHA 3STPA 1E6PA 2C19A 2FZDA 2I9EA 3EWDA 1UWQA 4JIHA 1M9HA 3M6YA 1Y5WA 4FNPA 3HO8A 1QK0A 3U5UA 1JZ4A 1EJ7L 1NM9A 3OG3A 2MNRA 4PTVA 1EC8A 1L0PA 1EH9A 2XVKA 2A7PA 3GWQA 5HULA 1CGVA 2G41A 3PR2A 3K1GA 3IAPA 2XH4A 4PTMA 2FB2A 1KW1A 2PZ0A 4QQUA 3TJ4A 4UFKA 1HZYA 3NL5A 3IS4A 2CESA 4OBTA 3R8GA 1OF6A 3ARZA 2NT1A 2XZ7A 3FLUA 4O0ZA 4ROPA 1QVBA 1ADOA 4Y7EA 3F2BA 4P7RA 1DWGM 3TYAA 2C71A 1JDFA 1FHUA 3ZLGA 2I16A 2BOGX 2ZRZA 1O12A 3NEVA 3IJLA 1IZJA 1PKMA 1SO4A 4IMDA 1TPFA 1EZ2A 2JEPA 3WDQA 2HMCA 5M17A 5M2FX 4W84A 4NZ3A 2ISDA 3N12A 1B3YA 4JTTA 2BOFX 1C93A 4H9TA 4WUIA 1OD0A 2YXGA 3AYVA 3BGAA 5C8BB 4EWJA 2ACQA 2GWGA 3H26A 4W8BA 2XJ7A 3TYEA 4C6MA 4UR8A 5F4XA 2EXOA 2QDGA 3LGEA 3W29A 1MZRA 4DXKA 2DUAA 2V6AA 2OVLA 3CHCA 3UU0A 2ZZ2A 3EWZA 4UQ9A 4US5A 3O3RA 2JGQA 4XVEA 2GPTA 4BEQA 3MQTA 4LUTA 3URNA 3DG3A 3VO0A 1SYTA 2QIIA 1J01A 4WY0B 3QZAA 2WMIA 2QAFA 1G9HA 1JXKA 5A8PA 5EYWA 3APYA 4ZB2A 3H2AA 2WO5A 2WVVA 4KCVA 3WNPA 4LCRA 5BW6A 3ITCA 4Z1CA 2VZOA 1NWUA 4H8VA 2UY2A 1KTNA 1FWRA 4XZ9A 2FHFA 4YCOA 4DBWA 3CHFA 3BLKA 3R43A 3VD5A 4MKVA 4G7EB 3ZVHB 1TPDA 4I8DA 1W5OA 3WF4A 2FLIA 3PY2A 3KBNA 3ABOA 1KCLA 4FLOA 1Q6DA 2GOUA 4KCWA 1OT2A 4IQDA 4M29A 4M6PA 3AXHA 3S9ZA 2OU4A 4J1OA 1E6NA 2Q3RA 1JZ8A 1LUCB 5LA1A 1KM1A 3VD4A 1XYLA 3ZS4A 2Y0FA 1K9EA 1CGUA 2J7BA 3OTRA 3POHA 1HXJA 2YR1A 1KD0A 3BV7A 3C2FA 3LPGA 2PRHA 3UPWA 1PHQA 1TVPA 1KFBA 1ZQ5A 1B30A 3TA9A 1E3ZA 5F2MA 2GGGA 3CGTA 4ZL1A 2WJEA 4HB7A 2Y7FA 3GTXA 3W6LA 1VP5A 4ORMA 5D30A 2EKCA 4AF0B 3H4WA 3AIEA 4ML9A 4WOZA 4IMFA 3N73A 4U4MA 5FKYA 4UQCA 5F1UA 5AC8A 5C9RA 3TYCA 1KWKA 1AK5A 2Q6ZA 2OZTA 3CMJA 5M5DA 1WDRA 5A6MA 4I6KA 1TUXA 1SQ7A 3KZPA 4C7FA 1H5VA 1OD8A 5I09A 1BWKA 2BVDA 1V6VA 3PBVA 3EGJA 1ZRQA 1FWFC 1FFQA 2CPUA 1OK6A 5A8QA 2W66A 4C1LA 3IJ7A 3I3BA 3EKGA 3Q58A 2OWWA 3ZM8A 4JX4A 1KRBC 1Q65A 2NWSA 4D1JA 3KEHA 3ISIX 4IXXA 3W1LA 3EPOA 4LS1A 4GFIA 1V3IA 3VZZA 2Q02A 4NNAA 1BPLB 2W61A 3EA3A 1OB0A 3LTSA 3MV01 3BLEA 1PUDA 4IIDA 5D4YA 1R2SA 2Z4GA 3U9IA 1Q6OA 3A3WA 1NWTA 2ZQ0A 3K4AA 3LMZA 4JIIX 4V28A 1H60A 4PMJA 1XFBA 1FWWA 4UFMA 1H5YA 4RUBA 3MSYA 1B57A 5LIUX 4C91A 2NQ5A 3IVUA 4IP7A 3WQGA 3P60A 4FO4A 4KGJA 4NZ4A 4U5IA 1JCLA 3PM6A 5GJMA 4L9XA 3M0KA 4K38A 3SCWA 3CV2A 4M6VA 4CCZA 2I17A 2C8NA 1V03A 4BKNA 4LC8A 3DHDA 5E0KA 5I77A 4E2VA 3TJIA 3ALGA 3PB0A 1CT5A 3WH7A 3J7HA 2OT1A 2FH8A 3WLNA 1MNSA 3GZ3A 4LALA 1QNSA 2YYUA 3HFTA 4B5SA 1KBLA 2V5LA 4AVOA 4Q8UA 4AMAA 4JTEA 2PDWA 4MY1A 4G1KA 2A3CA 1OWQA 2HS6A 3BLPX 3DFYA 3T7VA 3QV8A 1N82A 1KWGA 3FJ4A 3PG8A 4U33A 1LJYA 2GDVA 2C6QA 4NYYA 2BGNE 3VNDA 3WLTA 3BW3A 1W37A 2ZX5A 1NY1A 3SZ8A 3FCPA 3HMJG 4MM1A 3TKFA 1H09A 2CERA 3BJSA 3U2OA 3AXKA 3EX1A 5DBUA 5FF7A 2Y5EA 1O5QA 1K77A 3P3BA 2CIPA 1KNWA 3LI1A 4NZ1A 1XYZA 4IPJA 3RCYA 2VC5A 3L7RA 1HVXA 2G3NA 1F6PA 3DHPA 2E8YA 1BTMA 4WRHA 3WQEA 2CW6A 2BASA 4HA0A 4Z2KA 3RITA 5TBOA 3QMTA 2C7FA 4Q4PA 2YCKX 2B7PA 1GONA 2WJDA 1W3JA 6TIMA 3FJNA 3O05A 4TXEA 2GSEA 1TCDA 4YYFA 4MOZA 2AAMA 1FWEC 1NP2A 3ABSA 4NZCA 1LT8A 3SN4A 1GK8A 2CLKA 2PUZA 3LHUA 3N2TA 2DZSA 3QEZA 1IZCA 3CQ0A 3QFWA 2CWXA 5FJTA 4HCDA 1V6WA 4YVPA 3A22A 3LCXA 4XZWA 2PF0A 5I3KA 3NO5A 4UFJA 4BQ2A 4WDXA 1EYEA 1F6YA 4KCUA 3VGFA 4JFWA 1ISYA 3TJLA 3A4XA 2J9ZA 3TYZA 1R6WA 3QYQA 1PDYA 1TQJA 3CB8A 4J5NA 1XSJA 2DUZA 3VD7A 1FY6A 1A5LC 1VBGA 2E7FA 4GISA 1VEMA 2X1RA 3SN0A 4EVZA 3P93A 4WX2A 4CU7A 3NQMA 1XV8A 3MPGA 1W8GA 1WUFA 1KR1A 2XWDA 4DVOA 2YX0A 3N25A 3OLIA 5TF0A 4O57A 5I00A 4G7EA 3T55A 4PL1A 3N18A 2CLIA 1UR9A 3A24A 3DU0A 3AXIA 2Y7GA 1TJ2A 4C6FA 1HKKA 2TAAA 1BF6A 3B05A 4AIOA 1TJRA 3FGCB 4XTIA 4LV9A 3CYVA 3NQ7A 2J7HA 1LBLA 1XJBA 3BGJA 1IXQA 1I60A 1XR2A 2BP1A 1DTUA 1CW2A 4GI6A 4LF1A 2DSZA 4WGXA 2D1ZA 1UQZA 1J79A 3TP4A 4N02A 3EX3A 1RALA 1E0XA 4IWWA 3WQDA 2BBFA 4F2UA 3QW3A 3OZMA 3N34A 4GWEA 3OA5A 3S2MA 2BOEX 3BCFA 1JZ6A 4MWAD 2I7GA 4GOAA 3LGDA 3VVGA 1J0JA 4J28A 1Z44A 1FRBA 4CD8A 1FWCC 5AC7A 1MEHA 2UY4A 4Q4MA 3EMCA 1QBBA 4CCCA 2OGJA 1RA0A 1RXOB 1TWIA 1QAPA 5DX7A 3NQ8A 2VFHA 4LAMA 4ZQCA 1DXIA 4HA1A 3GVQA 2CZDA 3VC6A 1SJDA 1E9IA 1M3UA 1V3JA 3WF2A 1TZ7A 4FX7A 3ITLA 1E5JA 5H2ZA 3N2OA 2GVEA 2NSXA 3BL3A 3GUGA 4Q8WA 3B8SA 2HCVA 1TV7A 3UA3A 3B03A 1KGUA 2Z27A 2WBKA 2BWGA 4DHGA 1MXGA 1A50A 4GGBA 3O0FA 1DJZA 2HZGA 1EC9A 4G8TA 1XCWA 1BQCA 1W5QA 4B4FA 5HOSA 2ZUMA 2H3DA 2X0HA 1JEZA 2H90A 1HJXA 1TB3A 4GVHA 8TIMA 1XH2A 2UZ9A 3M41A 5E0CA 1XLHA 2J47A 1GVIA 1RCOB 3UXKA 4AZIA 4EAYA 1EZWA 3LGGA 1I75A 3UBPC 1BFNA 3URAA 3FVDA 1MW2A 3WLSA 2VEKA 1FXQA 1OQFA 5I3JA 4B9ZA 3VKAA 5RUBA 2PDXA 2WNQA 1H11A 3DAQA 4MB5A 4GXMA 1KRMA 3A4WA 1RLDA 3UPBA 1GJWA 4MPKA 2VUNA 3IGSA 1S2UA 1IHIA 3B9EA 1D8CA 4UWMA 2QLYA 1AQHA 3UESA 4RKAA 1E6XM 5HXMA 1JRBA 3RLVA 3QKZA 1F6KA 4MY9A 3RMEA 2Y1HA 3W38A 3F5LA 1Y5VA 5D32A 4GY7A 4PC8A 3VKJA 1P5BA 1HKMA 3P81A 4Q32A 4Y9OA 2V38A 2IXUA 1SW7A 3BV4A 2KZHA 3L4UA 4MB3A 1JGIA 3E5BA 3W2UA 1KFLA 3NSXA 5T26A 3DI1A 1JZ7A 2XVPA 4HZMA 4MWAE 3EMQA 2HPMA 2E4TA 3RR4A 1F8MA 3PUEA 2XUCA 4MFDA 5AHIA 4IX2A 2PSNA 3L66A 5GNXA 2FTYA 4M80A 5G2IA 3GFZA 5LNWA 3S1UA 1L6YA 3E96A 3AS0A 3FHAA 1D3CA 2ZE0A 4QE4A 3ATZA 3TIMA 2XIBA 2IXVA 1W91A 4AUBA 3OHMB 1VCVA 3B40A 4E3TA 4NZJA 2IQDA 2E5BA 2NQHA 2QVHA 3LMYA 2P3EA 4KEMA 3N15A 1WDPA 2QHAA 2RFGA 1GOQA 2O4MA 2XPKA 3IRSA 4LEFA 3OU8A 3VM7A 5BCAA 4AH7A 1JPHA 4J2PA 4GE8A 3GIYA 4OQVA 1EYWA 4ZBCA 1XIFA 1KFJA 1DP0A 2QXWA 3GHUA 3T0AA 1X8FA 3TOYA 4Y9AA 1PEZA 3COTA 3FSTA 5D02A 4GINA 1VYRA 4D9PA 1JPIA 1QHOA 2W79A 1G4SA 2X1UA 5HUOA 1BHGA 3UVAA 3NPUA 3W81A 2JIEA 4D1IA 4HK5A 2P53A 2FZ8A 5DMNA 5L6UA 2OO6A 2YOCA 5I3HA 4ZE4A 4JKKA 4IFRA 5FI8A 1E0VA 2E9LA 3UZXA 2DH3A 4NF7A 4GQBA 1MRQA 3WMLA 1P0EA 1LP6A 3CT7A 1BWVA 4XUGA 1JUBA 1W17A 3RK8A 2GJLA 1VYPX 3GNXA 4Q7BA 5H8PA 2V8ZA 3NQCA 1TREA 1WCGA 5HMDA 1KRCC 1C7SA 3C2VA 3VZXA 3L2IA 2XDFA 1Z6KA 3MCNA 2CLMA 4NIRA 4JTDA 4JQ4A 2NVDA 3WBWA 2Y8KA 1JNEA 3WLQA 2VZSA 3V0UA 4L5ZA 3G1HA 3WKZA 3E49A 1KGXA 1V3KA 2PURA 3RG6A 5BOOA 3LS9A 4XD6A 4MNLA 4CU8A 1R30A 3KOFA 2OLHA 2Y62A 1PHWA 2WLZA 1NF0A 4P7NA 4IOTA 5C9UA 4GYKA 1ISWA 1H49A 1UCWA 1W56A 1NF7A 2YB4A 1K8CA 5C9WA 4MVAA 2YCLA 6ALDA 4EPKA 3UY8A 3B9OA 1KBIA 2BY1A 4X0NA 2BVTA 4AB4A 4XISA 3W1PA 3PSVA 4J9JA 4DJFA 1I4NA 1F4HA 2WSYA 3VZYA 3HPSA 1BRLB 2HE8A 5FJIA 2ZX9A 1X97A 1WXYA 3WO8A 5AYBA 3RXZA 3K4WA 4L56A 4XX6A 4TMBA 3LM7A 4JFVA 2VD8A 4HZ7A 4FIRA 1RQHA 3OGVA 3GTFA 4AXKA 2PE4A 2VX7A 1QMLA 1MZHA 4JNZA 4YIWA 2YCIX 1XINA 4EX4A 1JDDA 3PFRA 3NQ6A 5CAHA 4PMVA 2FIQA 3B8UA 4KBXA 3LA4A 2I9UA 4B5WA 1B90A 3FHQA 1IEQA 2RDUA 3WD1A 3PZ9A 4GXWA 2F2HA 3P74A 5KSWA 2OYKA 3IGUA 2ISWA 5I3DA 4YCPA 3BARA 3W25A 3C6CA 5E70A 3FV9A 5BU9A 2OGYA 4UQDA 1W54A 5REQA 2QJGA 5F2IA 2BTMA 3LZ3A 2NX3A 1TRIA 3I6TA 1JYVA 5CQ1A 1BEUA 1OHLA 2EPNA 4GBDA 5FF2A 4IHCA 5D2WA 2WHLA 3H2EA 3CK5A 1XLKA 4GQGA 1FDYA 5GPRA 4JY9A 4RW5A 4HSNA 1FH7A 1YEYA 3IK2A 2AQWA 1OX6A 1QR7A 1XLFA 3W9ZA 4JBRA 2VT0A 3K1DA 3VOFA 3I65A 2O7QA 3C3UA 3MBFA 1ADSA 4DO7A 2RH9A 1RCXB 4AZ6A 4NJGA 3P5ZA 2ON3A 1UD2A 3I7SA 1GEQA 1QNPA 4GCAA 3NYZA 5CG0A 3FX4A 5AYYA 2PBGA 2PPGA 1RD5A 2REQA 4HN4A 4NAEA 1EGZA 3SW6A 5JBEA 3RRXA 3ARQA 1EGMA 1J8VA 3TLLA 3BWWA 1Z89A 1JD7A 1T99A 2ZZ7A 4IJRA 4LBRA 3I4KA 3DFOA 1V02E 3VNIA 4G2DA 1X6UA 3WFAA 4DWSB 3GU1A 4LJ3A 3B0VC 3QHMA 4MUPA 4OFCA 5D9PA 1F3XA 4HMEA 2DIJA 4FX8A 1R38A 5HMFA 4M7TA 2O4QA 4LYQA 1Q85A 1UR3M 3CZJA 4PRTA 4UR7A 1ZNNA 1CNVA 3VTRA 3UP8A 4RPQA 1IYXA 5XINA 4O1FA 2PWVA 1C29A 1MDRA 2NZLA 1E0UA 4GI9A 1EIXA 1D3HA 1GOMA 2GOKA 1RQEA 3N4FA 3W1MA 1XXXA 5FJPA 1LCOA 2YZRA 1UWUA 4DO6A 4J3TA 2QF8A 3R58A 3D3FA 1O4UA 1XH0A 4KWOA 4ZR8A 5CBIA 4K3ZA 1TKKA 1PE1A 4JTSA 1UKSA 4BF7A 1UIPA 1SZEA 1UZDA 3HPAA 1Q4WA 3FW6A 3PUGA 4H41A 1QI4A 1GYNA 3TFCA 4WDWA 3PB2A 4KESA 4DM1A 3ID7A 4EPDC 2OT0A 1TPH1 2A0NA 5CKSA 2VX6A 1RJRA 3IIPA 1JYWA 2FDSA 4CCDA 2HNEA 1PTAA 1TV2A 2JQXA 4W8AA 2YBVA 1V51A 3AHXA 3UYIA 1RBLA 4M81A 4A3UA 3QLLA 4GNVA 1U22A 1CI1A 2I5IA 1V93A 1JJKA 1XYCA 1DORA 3VIMA 1MFVA 2Q09A 2IQ0A 2YDSA 6XIMA 1POJA 1X7IA 4XZBA 1P43A 3B9DA 1XUZA 3H4XA 3LD5A 4RNIA 1WXZA 3B04A 2EQDA 4XO7A 1POKA 1C7TA 3T40A 4N0RA 3WNLA 2OOFA 2PDKA 3B8TA 2QJIA 3D47A 1KFEA 5DMYA 1FWIC 5FJOA 2I1OA 1VIWA 5C54A 4JTUA 4AU0A 3JU2A 3HOJA 3NAVA 3XISA 4DI8A 2VDGA 1HG3A 3BW4A 1VYSX 2X05A 2VJXA 1ZP3A 1UD4A 3ZVIA 5D8WA 2C0AA 4TTUA 4UMAA 4L6DA 4PTWA 1QK2A 3TZFA 3P84A 1CLXA 3GG0A 7REQB 2PD9A 1QI3A 1VCGA 2FVLA 5HJXA 3VGHA 4M82A 3T9PA 1XIGA 2QV5A 3RM9A 1ZB5A 3G1XA 1Q6FA 1WPCA 4Y8EA 3WFZA 4KFNA 3S2LA 3GFYA 5CPMA 4LVFA 3QW4B 1GUVA 3AU2A 2VFFA 3LENA 1EQPA 2KAUC 3UG3A 1V3MA 3UT0A 1BXNA 2F6XA 4P8XA 3CV6A 5BWFA 4NYUA 3G5EA 1S3TC 1VFFA 4L1XA 5I02A 1J0IA 3EB2A 5T9BG 1G0CA 1R47A 1S38A 1KM2A 2PDUA 4DUVA 3HTWA 3ERPA 3WSUA 2VM8A 4HD5A 4D8AA 1QHPA 1BRLA 3V5FA 4A3HA 2ZZ1A 3WQFA 3A4AA 1MW3A 4CLMA 5HNRA 4PBEA 1LTDA 4K7YA 3EA1A 2VZTA 3O15A 2EAWA 4UBPC 1JPKA 4IISA 4C60A 4L1GA 2PTZA 1FQ0A 3O1NA 3SRKA 5EBUA 3UR5A 1DXEA 3ZWTA 3KCJA 3WFLA 3CWNA 2HSAA 2ZVIA 1F3WA 4YTQA 2EPHA 1YNPA 3PPFA 1EBGA 3ITGA 2DZAA 2VGIA 2ZCGA 1OBAA 2XVGA 2W3ZA 1EFZA 3DN5A 2DSVA 3UJ2A 3VOHA 3DFHA 4CD5A 2DVTA 1XISA 3CJPA 1H7NA 2QF7A 1S1RA 2PWEA 3TDFA 3W7DA 2IQTA 4AEOA 1W2PA 3S9IA 3H53A 3R0DA 4EIVA 4GZJA 1V77A 3L9CA 3OG2A 4BQ4A 3GR8A 2NX1A 4LRTA 2GQ8A 1VFHA 2VWSA 4TX9A 3FXGA 3WQOA 2A6NA 1TTQA 1R3TA 2ZXDA 4E8CA 4AYSA 4KF1A 3W3OA 1NAL1 2WZTA 2QUNA 1M41A 3EX2A 5D2XA 3WBYA 4QSHA 2E28A 2ZBTA 4I9JA 3C8NA 5D04C 1AQFA 5PTDA 2OKTA 4AZ5A 1KRAC 5HQMA 4DF2A 4O10A 2WNNA 5CPTA 1UKQA 3N9RA 2PGEA 3TCEA 1ITQA 3TQPA 3PBWA 2G3FA 3RLHA 1PKNA 1PIFA 3O7UA 5CJMA 1I8JA 3MW7A 1KV5A 5H8UA 2HV5A 4DI9A 2J8FA 5A6LA 1FVPA 2NUXA 3CIXA 1W8SA 3B4UA 2CYGA 3GDBA 4H9VA 1GVRA 2J79A 4IM4A 1DWJM 1FCVA 1E43A 3JZUA 1JCXA 4P8UA 4QDMA 3V16A 5K2ZA 4NT0A 2O9PA 3ZR5A 3VNJA 2DVUA 4DBSA 5FL1A 2D3LA 2PODA 3USBA 3KOYA 5EMUA 2R1LA 1PCKA 3OZPA 4QDPA 3K13A 4PZVA 1FDJA 3SECA 4JQ2A 4GIYA 4GVIA 1KCKA 4MFEA 1GEHA 3AIBA 3DBNA 3W85A 4KQNA 1TV4A 2D0HA 4JYEA 3AYRA 4LSBA 2G3MA 2I57A 4MKNA 1SFJA 1UWAA 3MTWA 3UJSA 2BY0A 3QC0A 4OVXA 3APTA 5A8GA 1XRTA 1KBBA 3CWOX 4O53A 4IIEA 2G5WA 1UA3A 2W92A 1XX1A 1FWAC 1GVOA 1TX0A 1UMLA 4FMVA 3DUGA 4WQ6A 5K3VA 3P61A 5HNUA 5DCDA 4PUWA 1XIMA 3K8KA 1V3HA 1FA2A 2GFTA 3LRKA 2DPEA 4US5D 3L4VA 3TE9A 1YXYA 1H3GA 4NXSA 2V82A 1UZ4A 2VR4A 4QX4A 3BLLA 3CYJA 1CXFA 4UTHA 2NUWA 3FA3A 2PZNA 5AHMA 4JTGA 1OG6A 1J5SA 1DHKA 4FXRA 4JICA 4GQQA 3BOXA 3WQ4A 3QQ1A 1G94A 3CB3A 1LYXA 5AHFA 5BWAA 4FLSA 2IKIA 1UH2A 2Y5JA 1WUEA 3WL0A 4ZCWA 5G1YA 1Q3NA 1EQCA 4TO8A 4AHQA 1HN1A 3A47A 2BFGA 3SCPA 4HQVA 3UEQA 3E0IA 1ML1A 3W7LA 1UR1A 4DYKA 3APGA 3L65A 2ZTKA 3UR7A 4N4QA 1DJXA 4HYVA 4NNCA 2CXGA 1NELA 4UTTC 3BMWA 5DQPA 4AZBA 3DC8A 5KZEA 3ZT5A 4L61A 4JN7A 2G50A 1MRAA 1DWIM 3LTYA 2HEJA 3VILA 3HJEA 1W5PA 2PAJA 4DJED 2J7EA 2BS9A 2GJXA 4PCPA 4AZCA 3DH7A 4FOUA 2D2JA 5JVLA 1UR2A 1XD0A 1F8IA 3ME3A 4FZIA 1YDYA 1F9CA 3EWBX 3N3MA 3N9KA 4YTSA 3PBYA 5EBAA 3TSBA 5CH9A 4AY8A 3O8AA 3IARA 1H61A 1W0MA 4HOWA 1QNOA 2B7NA 1K7XA 2BHZA 2XN1A 3C0JA 1YNQA 3ARPA 4S3GA 1E5NA 1V6XA 3KOWA 4AMCA 3VOIA 4QRNA 3KTCA 4IX0A 4M19A 4Q8TA 3EXRA 5E6YA 3SSJA 1KM6A 4F4RA 1SFLA 1TMQA 2G3JA 5A2BA 2V5KA 1OCBA 3NXFA 1ZUAX 1LRTA 3VD9A 3ITOA 4RJEA 3S6DA 3TZNA 4MNJA 3LPPA 3BAXA 4RW3A 2ODOA 3W01A 3HG3A 1WBJA 1EP1A 3MCOA 4DYEA 1XP3A 2CHRA 2OR2A 4K36A 4N2YA 5SWUA 2Q71A 2VX4A 3HV9A 5I07A 1XLIA 1ENUA 3VIOA 5FL0A 4Y2WA 4ZQPA 2NV2A 3DC0A 1QATA 3GTNA 4TU1A 2ZZ5A 4YN5A 1G4PA 3N4EA 3QM3A 4Y96A 1J6PA 3A3HA 3C0SA 5HMEA 3PP7A 3M0LA 2Z1BA 1V7AA 1L8NA 3M0JA 3QTGA 3WD4A 3SO7A 4Q8OA 4PTDA 2ZVRA 3WJXA 3F7JA 2ASHA 3RM4A 2YBTA 3B06A 3GDTA 3MYOA 4DNHA 1EKOA 1OABA 4MMWA 3AYTA 3G3MA 4MZ8A 2XU2A 4HYWA 3CC1A 3CV1A 4AEFA 3NSMA 2INFA 1Y0EA 3KUMA 3F5KA 3WLLA 4DJDA 4F8XA 1EJWC 1VB9A 3LQGA 4LANA 3AZSA 2INEA 2Y88A 1DWHM 3DG7A 3GU9A 2C18A 5A3HA 2YB1A 1OCNA 4D6JA 1W3KA 4HHPA 1G69A 3THCA 3KBMA 3GVVA 1UR8A 2BXYA 3OVQA 4MJMA 2NWRA 3TFXA 1ONXA 3KL0A 2P50A 3MUIA 1AMYA 1XPGA 3SSZA 1TMLA 4BR1A 3M0MA 4BWLA 1CB2A 2GGIA 5D8ZA 2PGRA 2BY3A 4WSHA 1LOLA 4W5ZA 4RX0A 1ZCOA 4UTMA 4DEFA 1AZ2A 1IXPA 4DWSD 3LX9A 1R5YA 1ISZA 4A8IA 4GKLA 5K9XA 3GDLA 3TJXA 1WDQA 5J04A 3T78A 3MMTA 3UG5A 5K9CA 5IDZA 4GK8A 4QAWA 4F0MA 4B15A 1OYCA 4GC3A 1KXHA 4OV9A 3KOZA 3TW6A 5A6JA 2TSYA 4LV4A 3MUXA 2GGJA 2CU0A 4O4VA 2DSKA 3E02A 3FSUA 4ATLA 4GI4A 5JIWA 2AL1A 1TE6A 3AJ7A 4HA4A 3NM3A 3XINA 1NTHA 4Y9PA 3QSRA 4AG0A 3E74A 3MWCA 4NX5A 3FOKA 1W1PA 1YQ2A 2BY2A 2V5CA 2UY5A 4WHBA 1XLBA 3LCFA 4UFIA 3U48A 3S42A 1KBKA 1ZL1A 4HOXA 3STFA 4IMAA 3E0WA 3G2GA 4B91A 1O68A 3WQPA 1S3HA 2ZYFA 1CYGA 1OCQA 4NJIA 3P2VA 7A3HA 4R34A 4EXQA 2CHNA 3SIZA 4JHZA 5CC7A 3P6LA 2F7FA 4KKXA 3KRBA 2Y2WA 3W6YA 3WQ5A 2F61A 2PLCA 4GC4A 3OP2A 1HQTA 2JE8A 2QNEA 4FNUA 7PTDA 1ONEA 1UZ1A 1MXDA 2QPXA 4ZSUA 3WYZA 2G97A 2J88A 5HINA 1RQBA 1T96A 1KXVA 4XQ6A 2R91A 3N14A 2O0TA 3C0LA 2A21A 5BMXA 3SR7A 3THDA 7TIMA 3U2CA 4GZEA 3LCLA 4WGHA 4W85A 3H2FA 3MUZ1 3H2OA 1KKOA 3HQPA 1HIZA 3ARWA 1XS2A 3VMPA 3R4IA 1CB7B 4LUSA 1OFBA 3C61A 4JYFA 1EHNA 1GHRA 4I3GA 1Q7MA 3NZGA 1M53A 2Z2BA 3R2GA 5E1QA 4HCLA 3VIIA 1YX1A 4L4LA 4PFMA 2J62A 1VFTA 2ZUWA 4AISA 2FMOA 1TJ1A 3W72A 3NZQA 3ITVA 1HX0A 1LQ0A 1GZJA 3GIQA 4UCFA 4N9BA 2XN2A 3PZIA 5KZDA 2W4XA 3CQIA 4XAPA 1IGWA 4O11A 4FSAA 1LBMA 1QT1A 1UBSA 5CZ0A 4JIPA 4TMCA 4DLMA 2W63A 1VPQA 2ONEA 3GXFA 3EB4A 3DERA 5FSEC 4ACYA 1TPWA 3H2CA 1LORA 4OTKA 4QE1A 1ZBCA 3S1XA 1Z69A 3M7SA 3N2BA 4L64A 3QTPA 1G5AA 2PCEA 3PZNA 1DJWA 3ZIZA 3AMKA 3ZJ6A 3SCQA 3ES8A 4ZO8A 1SZGA 4HCHA 1EA0A 4JIRA 4RCXA 3CPGA 4LVDA 5LYRA 3KXQA 4A21A 5J5DA 1P0NA 3SIMA 3BZJA 3M1ZA 3F1QA 1ZY9A 3FYPA 3QHNA 1EB3A 3W86A 1LRQA 3EXSA 4QG9A 1EGVA 1SR9A 1ZBKA 1RZMA 1VHCA 4DF0A 1M68A 1E4IA 1JULA 4A3QA 2VENA 4GQRA 1E1CB 3A3XA 4A2RA 1TJ0A 4J3ZA 4K2SA 2RJHA 5FAJA 2IPFA 5MKGB 4GYPC 1XIHA 4NX0A 2EEXA 4JQ3A 3PAOA 1X1ZA 4H00A 4ML4A 3QPEA 9XIMA 3D6NA 2DT2A 3GFXA 3L12A 3EAUA 2FHCA 1YDOA 4IGSA 1QNQA 4CNNA 2HVOA 4KFPA 2CLLA 1ALDA 3LTPA 4FHAA 3VGBA 2OSYA 2Y89A 6PTDA 3LHWA 3NQFA 2E6AA 4L6HA 4O1EA 3FFSA 4JTLA 1S1PA 1OFDA 5CC6A 2ZRUA 1M6JA 1TCMA 4NY2A 4L6OA 3UGVA 1M03A 3PTKA 1A3WA 5DBTA 3SJNA 3PJTA 4IGMA 4IPPA 4D8ZA 4PRWA 2ZWYA 2Z1WA 2Z29A 1GPFA 2BXVA 1RP9A 3UWZA 2WSPA 2E6DA 3W7KA 3DFTA 5CJ5A 3LU2A 6ENLA 2P0OA 1SMAA 1NFGA 3W1AA 3CNYA 3AWOA 2VO5A 1U1UA 2RDWA 3IVTA 2BHUA 3WF3A 3CLWA 3DYOA 3RNDA 5IFPA 3SJ3A 4S3CA 3FDKA 4C65A 2BVYA 4E38A 1QPNA 2PDFA 3KRUA 1KV8A 1HJUA 5I5RA 1IR2A 3QXBA 3N2XA 3POCA 3KX6A 4PCNA 3TSMA 1FWHC 2BXZA 4PUDA 1I45A 3LCIA 4V33A 3TYUA 3P82A 3WEZA 4M7SA 3S47A 4QS6A 1KM5A 4FA3A 1A5MC 2D20A 4O0KA 3H23A 3VC5A 3CUGA 3T8QA 2PP0A 1KKRA 5DELA 5LIXX 4UB9A 1U1HA 1IEWA 3S5OA 3W7GA 4IPLA 4E6MA 2F6UA 3CL7A 3K5XA 4JTFA 3L4XA 3U57A 4K37A 4CD6A 3QVQA 4I5XA 2I5GA 2E5CA 4C7GA 3M43A 3BAYA 3T42A 3TTSA 4D8LA 5BXSA 2F38A 1FUYA 3DFNA 2PDQA 3TXZA 3L23A 3NDZA 5LIKX 4Q3MA 5AVNA 2E09A 2F8QA 2QUMA 3ITTA 5MF5A 3EWUA 4RK8A 1U5JA 1VJSA 1MFUA 1T0OA 2PD5A 1WZAA 4XZIA 5GJNA 4AZ7A 1P6CA 2FZNA 3A21A 2C13A 3MT1A 1AW5A 2PP1A 1QWGA 4K8HA 4C6EA 1GKQA 4J3UA 4FOJA 2X1SA 4Z2LA 1P7TA 1UJPA 3ZJKA 1VAHA 2FQIA 3BK0A 2DEPA 4KWWA 3UJRA 4MF4A 1VBUA 3ABQA 1DWAM 4R5EA 4EF8A 1JZ2A 3OQEA 3BTNA 3LV5A 4YMZA 2V2CA 4DO5A 1ZS2A 3VXGA 1W3IA 1CGWA 4D6HA 3Q2DA 4Y6GA 2D3NA 1MWOA 5E09A 2ZFAA 5LA0A 3AS1A 4D6DA 3OJGA 3UFYA 1XIJA 1W5NA 4HSOA 2P0IA 5D33A 1B9ZA 4AFYA 2FGBA 4AVNA 1QXLA 1PBGA 4MHBA 1FCBA 4B5TA 4HZ6A 2CFFA 3PJUA 2XFYA 4RDVA 4JHMA 1JD9A 3P0XA 2BMBA 2OB3A 5I3IA 2VL4A 5HJYA 1E4NA 3AFBA 5XIMA 3QGKC 1ONRA 1WKYA 3BE7A 3TTYA 4H4IA 3SCUA 2CZEA 3MMDA 3GB6A 4IXHA 3TW7A 1E9LA 4H7CA 3BQ6A 4MY8A 3WELA 3PPHA 2NV1A 4JD4A 3CIVA 3E2QA 4FAMA 2PP3A 3RCNA 5HR6A 1AL7A 4O19A 3QGAC 4ACZA 3H2MA 4JYDA 1F76A 2ZXBA 3TEVA 5G2HA 3UWUA 2WNWA 4OKDA 3M64A 2D73A 2B31A 3OQ8A 3WZ0E 1ZJIA 2R1KA 2A6LA 1UKTA 5CBBA 4UTWC 4MDPA 4ERIA 5LGZA 2QULA 4FPSA 4REQB 4IMGA 8A3HA 4XIAA 3KBJA 1R3RA 1XLEA 2YLAA 3LHTA 4C6CA 2OG9A 5LNSA 4DJFD 4JIEA 1E6ZA 1Q13A 3W73A 2PWUA 3GNRA 3KAOA 2QCDB 3GH5A 2AL2A 2HTMA 4IFOA 2DY3A 3IIOA 3F4WA 4GGHA 1RAKA 1XG3A 1JUEA 3DHUA 3M6DA 4ZVJA 1YPFA 4JTIA 1VFOA 1K9DA 1Y65A 3F03K 4Z08A 1J10A 2DIEA 4G56A 2VEIA 1JI1A 3NUKA 3MSDA 5A8OA 4OIFA 4M51A 5HPOA 3DIPA 5BXRA 4UQAA 1DXFA 2OODA 2WC4A 2YZ5A 1ZCCA 3EX6A 1FP8A 4GABA 1Q5MA 5EMMA 8XIMA 3B0YA 4PB4A 3GXMA 3M5XA 3VM5A 2R24A 4HK6A 4PMDA 1C3FA 3L4ZA 4GD0A 4HSHA 3IJ8A 1P6WA 2WMGA 5CZTA 3T0TA 3RAOA 3KLKA 4Z1YA 1O6IA 4X0VA 2ZXAA 4Y9NA 1WX0A 2YL5A 3H7UA 3HB9A 3T09A 1TYGA 1UMYA 2X41A 2GGEA 4W7WA 3HQOA 3IVSA 1OINA 3UZZA 5H1WA 1TFVA 3V3WA 3VDHA 3EXTA 4H83A 4LS2A 4CN4A 1I2QA 4O1DA 2WC3A 5EMLA 2VDIA 1HP4A 1NP0A 1CWYA 1WB0A 3TMLA 2OSWA 5A6KA 1FHLA 2BB0A 4A29A 4IFKA 4Q4KA 4UNKA 4TV6A 4QTGA 4EK7A 2O9TA 3IGXA 4PULA 3TYDA 3TTOA 4PR4A 4JL2A 1M01A 2XH0A 1VH7A 5AY7A 1VGAA 3WJYA 1O60A 2GVGA 2EPLX 5LGXA 1UKOA 4NJJA 4E3VA 3TOPA 4BK9A 1EDTA 4MPQA 3UWYA 3E0VA 2F9RA 1UD8A 3WK0A 2VEPA 1Q8AA 5EPDA 2YL6A 4LX4A 3W0KA 1H2JA 1ZGDA 1JDEA 3AMGA 3OLDA 5E9AA 4F2TA 1QI0A 4I5UA 4TX6A 2VOTA 2X2GA 4IL2A 4AX6A 1IZKA 3SCSA 3U2ZA 4GY1A 1EA9C 2PLKA 3UWWA 1MUMA 1JIBA 3MCMA 1XH1A 5B7YA 1YBQA 2PGWA 1CPUA 3W7MA 1UD3A 1JF6A 4WCJA 1QOQA 4KWVA 3QR1A 2WHJA 1XQKA 3RX2A 4JHOA 3S0CA 3M0HA 1BKSA 1GGOA 3AO0A 3W2MA 2F6KA 3TC3A 1UOZA 3UYCA 1SM9A 4ONVA 4I5RA 1KC7A 2NXHA 3KHJA 4QE5A 4IUOA 2DQXA 3W1QA 1GG0A 4C6OA 2R1NA 3VDBA 3WQWA 4F3HA 1BXCA 4Q6JA 5A8MA 3I3EA 3M0IA 1F3TA 2QUVA 2ATMA 1KQYA 2DSWA 1EL3A 1W9PA 3EZ4A 1A5OC 4B3ZA 2CLOA 2GQ3A 3GHRA 1PWLA 4KCTA 4Y90A 3B0XA 1JZ5A 2YYTA 1XLJA 2Y24A 4MWAB 1YADA 4O4WA 1RVKA 3WNNA 3AIRA 1I1XA 1F2JA 3MANA 4WKHA 3WQ6A 2VP8A 5HAOA 4ERAA 3SUWA 3CO4A 1U5HA 2IKGA 4LY8A 3AICA 1W9UA 1ZFJA 4AVFA 4Q4RA 1PSCA 3NURA 4I8YA 1QPRA 4PMZA 3TMQA 2O9RA 4E8DA 1TTIA 4WOQA 4PUJA 4WZHA 1G7VA 1XRFA 4JNMA 3KRSA 4XV0A 3U7BA 4ZODA 1MUWA 1DEDA 2HROA 3LLXA 3W7OA 1DQXA 2XZ9A 1H50A 3IJQA 5EFFA 2WKGA 3R79A 5BROA 5BXPA 4NAFA 2C16A 1JRCA 2X0YA 2WSKA 2OO0A 4RL3A 1WKFA 5E0FA 1AH4A 4WF7A 5AHEA 3MU7A 5M03A 1WO2A 4ECLA 1QW7A 3H54A 1FWBC 1DVJA 5ABFB 4Y9MA 4DB7A 3MB9A 3AIQA 2DORA 2QAPA 4IP5A 4X60A 3BMXA 1ZBVA 3R0KA 4PCTA 5E9XA 5KTLA 3MO7A 5DN1A 4F79A 3WN6A 3O9NA 1I6NA 2XH2A 1XG4A 1SR0A 1QOXA 4V15A 4C1NA 3SM0A 3LXCA 2GVYA 4LWWA 4M6UA 3OLEA 3GTHA 4YWSA 4FX6M 4G7FA 4XD3A 1QASA 2DT1A 2XIMA 4OHQA 4PB5A 1A80A 1ZTVA 4H7ZA 4L9YA 2G3IA 3CWHA 3RUBL 3RJYA 2VZVA 3AHYA 1A5UA 3PZOA 5IXEA 4PMNA 3SN1A 2QGYA 4U31A 3HQNA 3VE7A 4YNGA 5FF4A 2VQUA 4UOQA 4HNVA 2R82A 5FEPA 4Z1BA 2ACSA 2ZZ6A 3S46A 5FJUA 2C79A 3T1GA 3ABZA 4A2SA 1H1NA 2ZOXA 4DX3A 3GLCA 1TR1A 2ACUA 1J93A 1KGWA 3VIPA 2ESCA 2CETA 2VXNA 4UIOA 2YW4A 1S5TA 4HA3A 1RHCA 4UTUA 1IT8A 4AWEA 3ZSTA 2ZUVA 3SRDA 3URQA 4Q8VA 1XIEA 4XD4A 1WXJA 4IG2A 4Q33A 1NQ6A 2OMAA 3WLPA 4JTAA 3CH0A 1EUAA 4CQDA 4WVXA 3GC4A 1U1JA 3C2OA 2FFIA 3G0UA 4JXCA 1W9VA 4HPHA 4JNYA 2QJHA 1B3OA 3MZNA 3QQWA 2QUUA 2PTDA 2W9MA 4QLJA 2X30A 1LQ2A 1A5AA 2FPTA 5DXYA 5C55A 1IWAA 3UXIA 5IBXC 3IIZA 5DXXA 5GNZA 3F4DA 2DFAA 2ZRWA 3VPLA 1T41A 3NGFA 4O12A 4IICA 3TH6A 3HGJA 1UG6A 4V2XA 3QF0A 1RD6A 2RGLA 3C5QA 1XRSA 1UC4A 1DYSA 4HGXA 2GK1B 4YYCA 4CQCA 4QJ5B 2PA6A 4GVFA 4MAZA 4H2CA 1OX4B 5EA9A 3U3HA 3GO2A 2Q8LA 4HU8A 4CUCA 2OXNA 3O6AA 1Z8AA 1D2KA 4EE9A 4FXSA 3CPRA 3E0FA 3N4AA 2WPGA 4RZ4A 2OOGA 1ESWA 4BF9A 5IHSA 1Z41A 2X1IA 2QMKA 4TOQA 2OZ8A 1JPDX 4PUUA 2VCAA 3CXOA 2YXOA 1JUKA 4XZLX 3E2SA 1KLYA 2WYSA 1BYAA 4CCEA 3A9BA 4LYPA 3W88A 1S2AA 4WJXA 1LOSA 1YDVA 1IEIA 4PEEA 4LPCA 2QKFA 1XDMA 3GSMA 5AKQA 3VKBA 4KWUA 1AG1O 4B4HA 3PFMA 1Q63A 3FEMA 2FPVA 3TN5A 1FDZA 1JYNA 4DBDA 5XIAA 2H9AA 4U2YA 4W87A 3NEHA 3ELFA 2ZC1A 3CASA 4O15A 2GJPA 5HNNA 1P1MA 4WD0A 3G1DA 5I3GA 3K4DA 3QV6A 2UBPC 3BW2A 3NQDA 4LAKA 1MYRA 2VRQA 1W32A 1W3NA 4Z0JA 3QMSA 4O28A 3C4UA 1PYFA 1JQVA 3U8GA 4LOCA 2DW7A 5A69A 1UZHA 3REQB 5HQEA 1ICQA 3E5PA 1V6UA 2P76A 2GSJA 3KVMA 3NL2A 1CXIA 2HBXA 2QZRA 4Q4QA 3SY5A 3VINA 1HKWA 2A3EA 2VX5A 5AVHA 1DJIA 3UXDA 5FF0A 4HJWA 7CGTA 3PTMA 3A5VA 1LT7A 4MNMA 3WQCA 1SFSA 1HGYA 3EDEA 5BRPA 4DYJA 4KERA 1PIIA 3EEZA 3SCOA 3N2CA 1RSCA 2RDXA 1TPUA 3NOEA 1HVQA 1F4AA 5FEWA 4E4UA 2HJPA 2OLAA 4I9MA 4ZGYA 3VMNA 2YL9A 2Z0IA 3TQVA 2NX9A 3INPA 3W87A 3NQEA 3W24A 2X0SA 1UBPC 4HPXA 4AD0A 4MGGA 4GZ7A 3W1RA 2VGFA 2WMKA 3G0SA 3JUGA 1ZJHA 4IMEA 1QW8A 5HK4A 4NQ1A 3ZLHA 1EEPA 1XYAA 1R9XA 2ABBA 3H7RA 3SGUA 4C6BA 2XIJA 3LNPA 1GQKA 3NQ2A 4G1NA 5ABFA 2OPJA 4ILSA 3ZLFA 1MNZA 4PUEA 2RUSA 4FI4A 2V81A 3NL3A 3S1WA 1TWDA 4OV4A 4GNKB 1F05A 4YTRA 5C6MA 4C6NA 2GWNA 4L7ZA 1XPYA 3KCLA 3FAWA 3G8EA 1I1WA 5CBJA 2E6FA 3WMSA 2XSXA 3NZPA 4M8UA 5KETA 4HU4A 1GJUA 4OBSA 3GU2A 4H01A 1JYXA 2CBJA 1AH0A 1CXKA 3MS8A 1IEXA 3Q65A 3WX7A 2PI6A 2R8WA 3CAQA 4IQJA 1LL4A 5BMWA 2ABAA 1ECEA 1E15A 4P2VA 3LZ5A 2WANA 1O94A 3PC0A 2GVJA 1LLOA 1IXNA 4LVAA 3WMCA 1SGJA 1X8CA 3ABRA 3V36A 4LW7A 3N11A 2QQ6A 6CGTA 2XSBA 4JN8A 1CXLA 4PSRA 4RNFA 3WLKX 5DANA 4ZA0A 2ZX8A 2BZNA 2IUZA 1NOWA 2FVKA 1J96A 2VOMA 2PDJA 4JFTA 1ISVA 3TV8A 3OZYA 2Y6ZA 2XIIA 2QPUA 3FDGA 1GQJA 1S5NA 1Q7QA 5AC4A 1E3XA 5KMYA 4Q6XA 2P8BA 2Y8VA 2YSWA 3W1UA 2C1HA 4JY8A 3SCTA 5I7GA 3OZOA 3CHVA 1WDWA 3H2NA 3QN3A 4S2BA 2X7VA 3HGSA 3VGGA 4DZIA 1RPXA 3N1AA 5D2YA 3W22A 4QJ4B 2Y7DA 1R3QA 3W7NA 4LB3A 3IV3A 2EHHA 1L6WA 2IPGA 1UH4A 3A6OA 1L6FA 3GXIA 3ZO9A 1XIBA 5BYWA 2ZZ4A 2FB3A 3VCRA 4A4AA 4W5UA 4ZTYA 1RY8A 1A3XA 3T81A 1B1YA 1EJVC 3SB0A 4MG4A 5BU6A 4QNWA 3KWXA 3W1NA 2ANUA 1ZJAA 3LRMA 3R11A 3FNDA 1P1XA 1W5MA 4DJDD 2WXDM 1M7JA 4ZENA 3ZZ1A 1XSIA 1Z3NA 4HNNA 2JF7A 6REQB 4ZQMA 3NCOA 1B4KA 4Q7NA 1O5RA 2FVMA 3C3NA 4ES4A 3GY1A 3NM1A 4D6EA 2FTWA 3HV8A 4AC7C 4L9ZA 2C0HA 5HUPA 2AMXA 1T8QA 4HBKA 1QNVA 1SSDA 4PBGA 4XKMA 2ZDSA 4WXZA 2DZTA 1OC5A 1Z48A 1CECA 3HMCA 4L1WA 4R53A 3ZSSA 3RX3A 4IIFA 3TWAA 4WY0A 5ECUA 3VUPA 5LXXA 3MP3A 2VRKA 1G4TA 4CQ8A 4GMEA 1T40A 3O6DA 1XLMA 5FA5A 1KCZA 1GVFA 3SY1A 2XFFA 2TODA 4PA8A 1N7KA 3LLFA 3ZOAA 1BSIA 4MJ2A 2D2GA 3VOGA 2VC6A 4Z1AA 4UMBA 3N04A 1SZRA 2FMNA 2VUYA 5D09A 2CKSA 4ZOAA 4B5VA 1WBHA 3CS2A 1K8ZA 3ZVHA 1E6RA 2FYMA 3WNOA 5F2GA 1TA3B 4BCEA 4RZ6A 1VBRA 4OUEA 2J7DA 3CTLA 1G6CA 1J12A 1EXBA 3MHFA 4JQ1A 5G2WA 1H62A 5C7VA 1GYLA 3MHGA 3ARVA 4YS1A 2PDPA 3WY1A 5KINA 1XKJA 4IUGA 3VNKA 1LUCA 5IHRA 5G1MA 2CKRA 4YU1A 4O50A 1NSJA 2ATSA 4A22A 4P8WA 4QDWA 2EJ1A 2XG9A 3G1AA 3TTQA 1XKYA 1GVQA 1R0MA 4RNHA 4IIBA 4XVDA 3GK0A 1VIZA 2C1GA 1EWEA 3KLLA 3REQA 3WNMA 4OBRA 3QY8A 3MKCA 1WAUA 4LYKA 3BOFA 1Q2RA 4WR3A 1XW8A 3VFCA 2ADAA 5G1TA 4HHLA 3ZYZA 2QCHA 4AF0A 2L5HA 3GVRA 2QJJA 3JR2A 3C56A 5ABTA 3GBDA 4XSLA 3UNDA 3VYLA 3OO2A 3JW7A 4V1YA 1EOMA 2WPBA 4ZO6A 3GKAA 2WV8A 5DCBA 4NILA 1VCFA 5LNUA 1JG9A 4R7WA 4RDWA 1OC7A 3RO8A 1VFLA 4UFLA 3GZAA 5J5RA 5BNKA 3QR3A 4MKSA 1P0BA 4ZEPA 3N9SA 3W76A 1BGGA 5CPQA 4Q8NA 1F73A 1RP8A 1BAGA 4JAWA 2QJMA 3UZWA 2Y70A 1HL9A 1ZZMA 4MWAC 4F9DA 3GDMA 3B8WA 4EAMA 4UNLA 5A6BA 5EKYA 2A7NA 1EX1A 2G37A 3W2LA 3R89A 2CXEA 2QV4A 1VC4A 1Q4NX 1GPWA 3FEQA 1OFQA 3PG9A 4GPNA 3AUJA 3NGJA 1E1EA 2HISA 2FGLA 2QS8A 3B8IA 5D9NA 1J6OA 2ZIDA 3FYYA 3UJFA 5DRCA 3F5JA 3OBAA 3QFEA 3UF9A 3AHZA 1ECQA 5M3WA 3BXWA 4GO8A 3IIXA 1E51A 3DX5A 4CN1A 3BH4A 4URIA 3VA8A 1PYMA 1OM0A 4LUIA 4QAIA 1H0GA 3LV6A 1I2NA 2DZUA 4K8EA 4AD4A 3G18A 2HDJA 3FAXA 2FH6A 3TONA 4PMXA 4CVWA 3G1VA 1E73M 1H1ZA 2D2OA 1B3ZA 5A2AA 3LNMA 1LQAA 1K70A 1S5WA 1A3HA 3AMCA 2V3EA 3VUSA 1REQB 1BVWA 1U5VA 4MNKA 4H2HA 4X2RA 4QROA 1XRVA 1UD5A 1W1ZA 3SADA 1TE1A 2QPSA 3KZSA 3ZXWA 3OVGA 5EGRA 4UZUA 3GXPA 2Z6IA 2RJGA 1NDYA 3VNYA 4FNTA 4OT7A 1FBAA 4IT1A 4C6LA 3FVMA 3L5MA 3MI6A 5D38A 5D9OA 3BG5A 1S39A 2WBGA 3N17A 5CPOA 1ZSXA 2QMJA 3PANA 2ZRYA 3G6MA 1A5NC 1XYBA 5AOUA 3AAMA 4ATWA 1CXHA 4LU0A 5HMSA 3T8LA 3I3DA 2PLMA 4H9MA 5FOOA 2GDQA 1A5BA 4LQ1A 3SRHA 1C9DA 1YXCA 3TR9A 4N4PA 2BDQA 3KTSA 3GW0A 4JQAA 4FNSA 4A3RA 3IUIA 2EG8A 3AC0A 3T2OA 1PZ3A 4HKPA 3IJDA 5DY2A 1JI2A 3GW3A 3GG1A 4NVTA 5CSUA 1GHSA 1WQ5A 2WM1A 1WZKA 4S3AA 4TTGA 4GG9A 4C7DA 4UXDA 3H8AA 3CH9A 1IWBA 4ZFMA 2GYIA 4CGTA 3MVTA 3PWIA 4ENLA 2ZUSA 3GTIA 4D72A 1ICSA 2HWGA 2R6OA 1NFBA 4ZO9A 3GR4A 1L2QA 4H1ZA 1VPXA 2J7CA 1Z7AA 5HANA 4LUTB 1NJJA 1OJXA 3H70A 3P62A 2V5BA 4UTJA 2WMIB 1VFSA 3TN6A 5ABGA 2PU1A 3ZR4A 1CGXA 5J8LA 1UJQA 3VKCA 4M56A 2IPJA 1SO3A 4ZXLA 1N8WA 2EG7A 2WVVB 1QO5A 2YGYA 1K4GA 3PVFA 2WSRA 2E68A 3MI2A 2Z7GA 4H9UA 1DE6A 2XFRA 4DO4A 5CZJA 2EJAA 3HBLA 1YHTA 1E6SM 3MKVA 3QC3A 1GTEA 2WHKA 2Y85A 4O16A 3QJAA 4GI8A 3MJYA 3V4BA 1HJWA 1WDSA 4YPJA 3WEOA 2O55A 2OFJA 3TVAA 3FGCA 4XBKA 3UPMA 5GNYA 2OWXA 4U28A 4QR6A 4R7JA 2ACRA 4K8GA 3W1XA 5HJLA 4FS9A 1SJAA 2WZEA 1TSIA 1Q6EA 3OVPA 4NXKA 5AB3A 2YJQA 1DL3A 9XIAA 3AMLA 3NL6A 4UQBA 2QCNA 4HK7A 3IK4A 3IJ9A 2G4JA 4W8LA 4ZFCA 3VAVA 4YTTA 3L21A 2PFHA 2YFOA 3HGOA 1ZPTA 3NVTA 4QS5A 4JPGA 2TPSA 2BHYA 2WNZA 1GOWA 1TPB1 3L0GA 3TC7A 1W3TA 4HMNA 3SI9A 1H7WA 2BNJA 4BJHA 3TU9A 4Z2IA 4H8NA 3CV7A 2NT0A 1OC6A 1VFMA 3NFUA 1TWZA 2VR5A 3B9NA 2OCZA 1ITCA 3GDRA 5FSDC 4RE3A 3K8MA 2VYOA 1DE5A 1TV5A 2R94A 4MLJA 1