3BURA

Crystal structure of delta(4)-3-ketosteroid 5-beta-reductase in complex with nadp and testosterone. resolution: 1.62 a.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
total genus 115
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2008-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3burA00
2QXWA 3S3GA 4XO7A 4GA8A 3GHUA 4EXBA 5AZ1A 3UZWA 4PUUA 2WZTA 4LAUA 2IPFA 4XK2A 1X96A 4JTAA 1A80A 3UG8A 2PDFA 1AH0A 2PDBA 3Q65A 4MHBA 1IEIA 2ACQA 3EB4A 1AZ1A 4JTCA 4DZ5A 2PDXA 4GACA 3R7MA 2HE5A 4LAZA 3UYIA 1Z3NA 1ZGDA 3UZYA 1ZUAX 4JTDA 1RALA 3G5EA 5HNUA 4XZHA 1YNPA 1Z8AA 3H7RA 4HBKA 4JQ1A 4PRTA 2BGSA 2DV0A 3G1RA 4YVXA 1XGDA 3R58A 4JIIX 4L1XA 3CV6A 3LZ3A 2F38A 1S1PA 3ONCA 1FRBA 5KETA 5M2FX 3RX2A 1X98A 1X97A 4XZMX 1MZRA 2ALRA 2IS7A 3FX4A 3LEPA 2PDUA 3BCJA 2VDGA 3MB9A 4QX4A 5HA7A 4YVVA 3H4GA 4JQAA 3LNMA 1Z9AA 2FZ9A 2PDGA 1S2CA 1ADSA 2PEVA 2PDHA 3QKZA 1T41A 1AH3A 4JQ4A 4H8NA 3LENA 4YS1A 2WZMA 3V36A 3LQGA 4IJRA 4PMJA 3O0KA 2HVNA 2IQDA 4YU1A 4XVDA 3R8HA 4PUWA 1RY0A 2DUZA 5LIYX 4FZIA 3O3RA 2PDCA 3RX3A 3CV7A 2INEA 3UZZA 4AUBA 1HQTA 4LBRA 3GUGA 1QWKA 3V35A 1YE4A 3R6IA 4LB3A 3EB3A 3Q67A 4XZLX 2PD5A 3UZXA 1S2AA 2PDLA 1PWLA 1S1RA 4FAMA 2ACSA 4LB4A 4JIRA 2P5NA 4ICCX 4Q3MA 4XVEA 1M9HA 3V0SA 2FZBA 2F2KA 1AH4A 4GABA 3D3FA 3CAQA 4GIEA 4GQGA 1C9WA 2PDKA 3LD5A 4HMNA 4XAPA 1VBJA 3WBWA 1PWMA 3WCZA 3WBXA 1HW6A 4JIHA 1XJBA 2PD9A 4WDXA 1VP5A 4QBXA 2DUXA 2PDPA 4H7CA 4QR6A 4XZNX 4EXAA 3B3DA 3MC5A 3N2TA 4PR4A 3R94A 3CMFA 2HV5A 1PYFA 1YNQA 2ISFA 2HDJA 2PF8A 1EF3A 4WGHA 3GHTA 2PZNA 3UGRA 4XZIA 3RX4A 5HNTA 3ONBA 4LBSA 3GHSA 1IHIA 3CAVA 1EL3A 2BP1A 3UWEA 1YE6A 4DBWA 1JEZA 1LWIA 3P2VA 2PDIA 4JQ3A 2FGBA 3LUTA 2C91A 3M64A 4GQ0A 5AZ0A 5DANA 1MRQA 3V0UA 4IJCA 2NVCA 3CASA 4G5DA 1ZQ5A 4ASTA 1MI3A 1US0A 3WBYA 4F40A 1T40A 4DBUA 3F7JA 4WDUA 2IKGA 4I5XA 2A79A 3LQLA 4PRRA 3LZ5A 3COTA 5JH2A 4WRHA 1LQAA 2R24A 3H7UA 4JTRA 3BUVA 3M0IA 1PZ0A 4NKCA 3EAUA 2PDMA 3NTYA 2INZA 4ZFCA 2IPJA 2IQ0A 5LIXX 1OG6A 1Q13A 3N6QA 1ZSXA 2IPWA 3LBOA 2J8TA 4L1WA 1AFSA 1XF0A 2IKHA 2AGTA 4FALA 4XO6A 3ERPA 2ACRA 2FZ8A 1EXBA 3C3UA 3VXGA 2NVDA 4RPQA 2HEJA 1QRQA 2IPGA 2PDJA 3FJNA 4Q7BA 1PZ1A 4WEVX 4WDTA 3T42A 2I17A 4DBSA 2IKJA 3UFYA 3WG6A 5LIKX 3M4HA 3BV7A 4R9OA 1R38A 3DOPA 2FVLA 1K8CA 1UR3M 2PDQA 5LIUX 3DN5A 2PDNA 4JQ2A 1AZ2A 2HVOA 3KRBA 3LN3A 2CLPA 3V0TA 4WDWA 3U2CA 2ACUA 4OTKA 2IKIA 3BURA 1EKOA 4GCAA 2PDYA 2PDWA 4JTQA 5JH1A 3R43A 2R9RA 3UP8A 4QXIA 4FA3A 4IGSA 5LIWX 2PFHA 5C7HA 1Q5MA 1GVEA 1Z89A 3GHRA 2HE8A 2I16A 3R8GA 2FZDA 1SM9A 1RY8A 4YVPA 2BGQA 1J96A
chains in the Genus database with same CATH superfamily
4PFHA 1LYXA 3CMJA 3II1A 3A6OA 3N4FA 4LF1A 3S1GA 3O16A 5CCZA 4HB7A 5A8QA 1I2PA 1J18A 1ISXA 4J1OA 5BOFA 1W9PA 3GC2A 3UZWA 1ICQA 3BMWA 5HXMA 3IPWA 1ECQA 1T96A 1W6TA 2V0TA 3W81A 5KTLA 2VX4A 1HGYA 2R82A 1S38A 3T1GA 3EWZA 4ZQOA 4MAZA 5SWUA 4AVNA 3KTXA 5HAOA 2YIHA 2XZ7A 3FVMA 5CPLA 4PCFA 2O92A 3R7MA 4W8AA 1Z3NA 2DDXA 3NQAA 2VGBA 4RL3A 4UFKA 1M7PA 1Y65A 4GI4A 1E4NA 2AL1A 4QE4A 1G0CA 3IK4A 3G8EA 3QEZA 3HG3A 1ZS2A 3BAJA 1SYTA 4J3ZA 2FTPA 3IJ7A 4YPJA 1U1JA 2V68A 3C4UA 3LK6A 1XWYA 3ZYZA 3L5MA 1BRLB 2G3FA 4B5TA 4KFNA 2JK2A 1ICPA 2VHLA 4J28A 3AQUA 3GYEA 4IQEA 2AQWA 4HPXA 3GTHA 4J3TA 3OODA 3WIJA 4MNLA 3GBEA 3FJ6A 5J04A 3DYOA 3N4EA 3ZWSA 3DBPA 4AZCA 5D37A 5TAOA 1J0JA 3UERA 2PWEA 1PB0A 1UKSA 2OQHA 2YL9A 1IYXA 3PB0A 2A7PA 4O50A 1K7EA 1SR9A 4W4QA 4L4PA 1XH1A 4XD3A 3M44A 3B8DA 1OFPA 2P3EA 4UOQA 5D05A 5DMYA 2Q6ZA 4GZ7A 1R3QA 4XVDA 4DNMA 5EU9A 2DPEA 4Z2HA 2I9EA 2WANA 5IRPA 5C55A 1E6NA 3PUEA 4EVZA 4U3AA 4MKNA 5HNRA 2YL5A 1NFGA 3TXZA 3AAMA 3S1XA 1KM1A 1WB0A 4NF7A 3GXMA 4CN1A 2DVTA 1S1RA 1CX9A 3L65A 3TWAA 1KKRA 3UCQA 4LW7A 2JIWA 4CNNA 5BROA 4KWSA 3I3DA 1Z48A 3LHWA 1TJRA 1GVRA 1F74A 2FZBA 3CUJA 3BGJA 2Y24A 1K70A 3PNUA 4Q33A 4B5XA 1V6XA 2Q3RA 1EH9A 3TJ4A 3F4NA 1M7OA 3LGGA 1DJXA 4FXFA 3H6OA 4GY1A 3V16A 1I75A 5F1UA 3RR1A 1SJDA 3E5PA 5C0QA 1YDYA 1PEZA 2EEXA 1N55A 4MB3A 3E2VA 1LBFA 3VOCA 4CQDA 4LBUA 1XLLA 3CAWA 4L4LA 5FEWA 1DQXA 4ECLA 3N34A 4XISA 1RLCL 1LWJA 4RXGA 2ATMA 3GUWA 3LXCA 5A6BD 3ANUA 2ZADA 1HKJA 3DDMA 2VUNA 1U5HA 1EQPA 2WMIB 2W62A 4GPNA 3SSJA 4E2OA 4H9MA 4P7QA 3GAYA 3VM5A 2BWGA 4URIA 2EKGA 1W3LA 1TYGA 1T5AA 3K8LA 4ZOAA 5I0DA 2O9OA 2RFGA 2Y5EA 2FH8A 3VMPA 1KR1A 3RG6A 4ZB2A 1O4UA 2ZXQA 4O53A 3C0LA 1KWGA 4TU1A 1LL7A 4ZENA 1Z32X 4GYPC 3WBYA 4OBTA 1XLIA 3UNTA 4GX8A 2D23A 2PGRA 1JR1A 3CUHA 1I1WA 1QOQA 4GQRA 2D3NA 4FLQA 3A12A 3DENA 1JXKA 3NEHA 5RUBA 1HFBA 4UBPC 1QPQA 3BUVA 1OX4A 1C3FA 1Z41A 1D7KA 1QNQA 5CPMA 2INZA 3H2EA 4QLJA 5HWJA 3UF9A 1RQEA 1ZSXA 1H2JA 1KA9F 2PLKA 4Z0JA 2WO5A 3ZT6A 1W9BM 2EHHA 4JKMA 2I5IA 2VFHA 5A8MA 4CNOA 3FAXA 3VC5A 2NQLA 1AQHA 2WW5A 4CEXC 5HJXA 2V81A 3AALA 2JGQA 3GG0A 1PZ3A 1V4YA 3SRFA 3MZNA 5D8WA 1OG0A 2FIQA 1TZZA 3HBLA 1XLJA 5FF7A 3KL3A 1KM4A 3VAVA 1WAWA 4FP1A 1LL6A 1X1OA 2XIMA 4C6DA 4S3BA 3GC5A 3EWWA 4HSOA 1MNSA 3EOOA 2ZKMX 1JYWA 4RK8A 5CAKA 4OOUA 1OINA 4DJFC 2X7VA 3QGAC 1UP0A 1K8ZA 1H63A 3VFCA 4YYFA 1WP6A 2BBFA 4DPQA 1WQ5A 4Q7IA 5LNWA 2GQAA 1VYPX 5D04C 3T4WA 5BU6A 4RDVA 1ZJBA 2BXZA 4X0VA 4B91A 3C8NA 2C13A 2NQ9A 3M0MA 3L5AA 3AXMA 4ZQPA 5KINA 3UXDA 3F5KA 3W70A 4DZHA 1QUMA 4O17A 3THQA 5I09A 4KIEA 3I4KA 2DT2A 2UV8G 2R1NA 1Z89A 3UD6A 4OV9A 3L2MA 1VPQA 3MO7A 1ZBKA 3AC0A 2XINA 3PJWA 3TTOA 3T07A 4UZSA 1CBGA 4N2YA 4UTUA 1O12A 4UTWA 1Q6RA 1A5UA 1BF2A 3IGHX 3TW6A 2FH6A 4QEEA 4ZQNA 1TRIA 4RXFA 4XK2A 2E1DA 4UTJA 3DFTA 3WF3A 1DBTA 4FHAA 5GNYA 3KLKA 4BQ2A 2WVVB 3XINA 4UMAA 1VGAA 4ZTXA 3C2FA 4EWND 3AS1A 5H91A 4GUIA 4O1DA 4OV4A 1KBLA 1OFBA 4UFIA 1XFCA 4BQ5A 1NIUA 3CV2A 3W25A 2YBUA 2A7NA 1DJYA 4PTVA 3STEA 2PGFA 4PRTA 1JCNA 2JKAA 2RDUA 5K7JA 2DP3A 3PZQA 4HK6A 1TA3A 4PBGA 1A3XA 3THCA 4A3HA 1OYBA 4MJ4A 4Z17A 4ZB5A 4K1GA 1XYZA 4K68A 3EKLA 1P7TB 3MJYA 1J10A 3WDQA 1SZEA 3ZS4A 5TF0A 4UTTA 2NUYA 4RDZA 4YIWA 3RX2A 1XD1A 3UETA 3HTWA 1TQJA 1PBGA 4Z2LA 3BCJA 2DZVA 2HROA 4YVVA 1AL8A 2FZ9A 1GOWA 1ZB5A 2XSBA 3A22A 3W2LA 4Y96A 3SCRA 3QKEA 2X2YA 2YBVA 2WNZA 1QO5A 2PU1A 1GKPA 2VEMA 2VMFA 2VZVA 2YZ5A 3LQGA 4EP8C 2F2HA 1TB3A 4Z2GA 2Z25A 4YXGA 1G1YA 4UTFA 1FH7A 4EPDC 3MA8A 1UB3A 4N9DA 2HVNA 1SJCA 2F84A 2EAWA 3WY1A 1ISWA 4H19A 3RX3A 2GVJA 4PC8A 4NRSA 4OUEA 1HQTA 2CBJA 3VZZA 1KRCC 3HF3A 1OX4B 4PYSA 3U3HA 3ZM8A 4K1WA 1Y7VA 3N4AA 4RKAA 1HKVA 4P8VA 7REQA 1I2OA 2QAFA 3WH6A 1GG0A 4IXHA 1K7FA 5FJOA 3B9OA 3GR8A 3ARZA 2P5NA 5LKYA 3NSNA 1DWIM 1JD7A 4E0CA 3NPXA 3QHOA 1PS9A 3C2YA 5CGTA 1HJXA 1LDCA 4C5ZA 3PVFA 3D3AA 1YDNA 3WQVA 4HVXA 2VENA 3M16A 3FN9A 1AH4A 1UWRA 1QHPA 4DO4A 1LRNA 3FIGA 1BVNP 1OC5A 2VWSA 3SUUA 1GJUA 2OSWA 5D33A 4XAPA 1DQWA 3B0UX 1K6WA 4IL0A 3PJUA 3DCPA 1PWMA 1CXFA 4GIYA 3WBXA 1YTEA 3BG3A 3IS4A 5XIAA 4JDBA 2OGJA 2V5JA 3FK4A 4LVGA 4A8IA 3VVGA 3N2TA 3NURA 4PCNA 1G4SA 3FOKA 5HPOA 2HDJA 5M17A 3G1DA 5DF0A 3ARXA 2B7PA 4WGHA 3MANA 2NXGA 1UQYA 2Y8KA 1UWQA 1UR0A 5DCEA 2Y2WA 1AJZA 7ENLA 4LUSB 4QHRA 3V4BA 4L5ZA 3TJLA 1LF1A 1IHIA 4LY8A 1YW1A 1EL3A 5F7UA 1OC6A 2WJZA 2Y85A 2J8GA 4PUDA 3PZUA 4JYFA 3PPFA 5CG7A 3P2VA 3M5XA 5K4ZA 5MKGB 6A3HA 4AZIA 2Y5SA 4PUKA 3WKZA 2XH7A 2CLFA 3LCFA 3M5YA 1VYSX 2NUXA 4UNIA 2VEKA 3BAWA 4H6QA 5TD4A 3SN0A 1DL3A 3WMCA 2BNJA 1V3JA 4CD8A 1R86A 3B8VA 2ZVIA 2PRMA 4ASTA 1RQBA 4D6FA 4BHYA 3LM7A 1JJKA 4PTXA 5T9CE 5BOEA 3IANA 4GOAA 1HP5A 1HJWA 4XIMA 1GHSA 3GIQA 2HTMA 2CLHA 1E0XA 4ADSA 4JR5A 1CTNA 1AQMA 1KTBA 3IJIA 4ZFCA 1GZJA 4K8GA 2IQ0A 4QDPA 3KBWA 1R5YA 1MNZA 1XF0A 3LDVA 3GXFA 3L4XA 2FZ8A 4XD6A 1J0HA 3VXGA 2DT3A 4X60A 3UU0A 2DSZA 4BCEA 5EGRA 3WDJA 1O7AA 4DO6A 1UROA 1B3WA 3W7EA 4F0RA 1PVNA 4D8ZA 3S5OA 1NP2A 1GGOA 4R53A 1DJHA 3AIUA 4F2BA 2YDAA 2W79A 3AS0A 3AMLA 5I3KA 4GK8A 2VL4A 4LYQA 1ISYA 1W54A 3REQA 4OHQA 4Q8PA 5HWMA 5D9NA 1FX6A 4PMVA 2OKTA 3EB2A 4JQ2A 3WD3A 4K7VA 1XLAA 4S2CA 1UJQA 5A6KA 3GR4A 4QJ1A 1EX5A 1J9YA 4NVTA 4O1AA 4H7ZA 4F3HA 2A4AA 1GOMA 3UEQA 4AQLA 5AECA 3WJXA 3GO2A 2HZGA 3PPGA 4ZOBA 2YBTA 1G9HA 4GQQA 4I9TA 4FA3A 4J4KA 1LQ2A 4ZO6A 2DVUA 2VCCA 2DVXA 3L4YA 1NM9A 2A3HA 4O54A 3BCDA 1XPYA 1BXCA 1G6CA 4D1IA 4A22A 4G56A 3W27A 2GQ3A 2G50A 3BLOA 1IEXA 3M5ZA 3I68A 3NNTA 1F3XA 4KWUA 4XO7A 2WMGA 2DIKA 2YL8A 5G5IA 3U0HA 4EIVA 4BJHA 4NG3A 1X6LA 3K8MA 5HMEA 2F61A 4TX9A 1CXIA 5LNSA 3N12A 4NJJA 1H7PA 4DO5A 1KFLA 2YA0A 4KPLA 4PUMA 1X6NA 3DG6A 3IJQA 3LCGA 4BA0A 1OD8A 2I57A 2E9MA 5K4XA 4LAZA 4LYKA 4UWMA 4DZAA 2BTMA 3WQ8A 1J5TA 2Q3OA 1R3RA 1VIZA 2AL2B 3CM4A 1ZCOA 2O0TA 2ZRVA 3TROA 3H7RA 3ZXWA 4WOQA 4ZZ9A 1JF6A 5H8PA 1NF0A 4XTIA 3CUZA 3D46A 3TJIA 4H00A 4QAWA 2WPBA 3DHPA 3UCDA 3K8KA 1XGDA 3WELA 1R3VA 1UD3A 3CV6A 1JZ4A 5I2UA 1XDJA 4JYEA 3S0CA 3RYSA 4KFOA 5I6SA 3EMCA 3K30A 4RLIA 3KOXA 4ORMA 2YB4A 1BYCA 4JKLA 2QCFA 3RRAA 4O16A 3QV8A 3SRHA 5DXYA 1QK2A 1LRQA 1UR4A 2OB3A 4I7VA 3TEVA 3ITYA 4DO7A 3ABZA 3CIVA 3TV8A 2Y6ZA 1ZBCA 3W26A 2XN2A 4HMDA 3KVJA 3B03A 4QLKA 1IEWA 2IUZA 2ZRYA 1F9CA 2YZRA 1OVDA 3CB3A 4LUYA 4XBJA 1IGWA 3AZRA 3KVLA 2UY2A 5GPRA 5I02A 1XP3A 4IJRA 3NL6A 4HPJA 1G4EA 1IT0A 3WLKX 3GNRA 1PTGA 2D20A 1CXHA 1LOLA 4GFIA 4JBRA 2KZHA 2J75A 4AY7A 2WAGA 2AMXA 3ITXA 1KLZA 3N13A 1GPWA 1KBBA 2W66A 4FNTA 1QNVA 5FAJA 2PF0A 4LUJA 1IWPA 4DPPA 1H7XA 5FJJA 3PUDA 2F6UA 4Z1DA 2XIBA 3WJZA 5U4NA 4LUTA 4MG4A 1BLIA 3DC8A 1TIMA 3URAA 3R0KA 4O1FA 3URNA 2BG5A 3L2LA 4ILSA 4MIMA 3GVQA 3KHJA 4CD6A 1R46A 4JOMA 1ODUA 2RDTA 3RLHA 3QGKC 5C9XA 5IM51 5I07A 1UKTA 3EMQA 4RR4A 3HB9A 3EKGA 3AIBA 1VH7A 3FSTA 2P76A 1XYFA 3TA9A 3KE0A 4JIHA 3SRDA 1LORA 2PD9A 1VP5A 1C8VA 4XZNX 2XPKA 3B3DA 4DVOA 1TJ2A 3LGEA 4TQTA 3B9EA 3I65A 1YNQA 1PHWA 1EUNA 5E9AA 4U4MA 3LS9A 1DKWA 1I2NA 3SGGA 7TIMA 1DHKA 3I10A 4MTVA 3EXRA 5CZSA 1L2QA 3OPSA 3S2NA 1XBYA 3RMEA 2A7RA 2NWRA 3SCWA 4CNTA 1N8FA 4U2ZA 1H61A 2DJLA 3GHSA 4QITA 3CAVA 4PCPA 4OFCA 2QUVA 3KP0A 1C92A 4DUVA 1O1HA 4IMCA 3HJZA 2O4QA 2UZ9A 2ZE3A 3FSUA 2TPSA 3INPA 2G97A 2J7EA 2GJPA 3HQPA 1BKSA 3EWBX 3U2ZA 1TELA 1LLOA 3N6JA 1XINA 2Y61A 2XH0A 4A29A 3UWZA 2A21A 1ISZA 3WQ4A 2REQB 3MY9A 5M5DA 2NWSA 1L6YA 2Q01A 1CB2A 4F40A 3EEZA 5D9PA 2RH9A 1M41A 4DHGA 3UWVA 2G96A 1L6FA 4GVFA 4B4FA 8XIMA 5IHRA 3COTA 1LQAA 2R24A 1V8EA 1VHCA 5E0FA 1IR2A 4MAVA 2W67A 3E0IA 4NKCA 4Z1AA 2OZ0A 3K2GA 1WV2A 3BAIA 3H24A 2C6QA 1E1FA 3W00A 3E38A 3ELFA 3G1VA 1KD0A 2O7QA 4CQ8A 3A21A 5E1QA 3ARUA 2WM1A 4JFSA 2VVNA 2ZYFA 4S1FA 5C9ZA 1LZOA 5HQEA 1UP2A 2GDQA 2FHBA 3LTYA 4MB4A 3EPMA 3TQKA 1O5QA 3IWPA 4G2DA 5EY5A 1RJRA 1GVQA 1FWCC 2Z1BA 1R2SA 2J8FA 4AZ7A 1FKWA 3VZXA 3VPLA 4TO8A 4JN7A 4CGTA 3ARTA 2IKJA 3TFXA 3T08A 5T9BG 1NOUA 2QUUA 1YXCA 3VNMA 2VR5A 2QV5A 1Q6GA 5D32A 2QCCA 3AHYA 3BAXA 2QPSA 3C8FA 3TFCA 3IJLA 3BL3A 3N2CA 4MDPA 4AMCA 2YX0A 1IXNA 2ZZ1A 1GCYA 3KAOA 1PL9A 1OYAA 4CD5A 3NUKA 1C90A 4LOCA 2Z0IA 4B5WA 3MUIA 5AYXA 5HMFA 3UA3A 4UFLA 1B5TA 4PL2A 4ZXLA 1WKYA 3RPTA 2PWDA 4J5NA 3BURA 4UQBA 5CC5A 3TYEA 2CEQA 2KX9A 2VNCA 2E6YA 3S46A 4Y9OA 2DUAA 3CWOX 1L0PA 3H4WA 3P8JA 4W88A 3I3BA 1NDZA 1FBAA 5FAGA 4W8BA 1OM0A 1XYCA 5KZDA 1EJSC 4I8YA 4GI8A 5FL0A 5HR7A 4LS2A 3GU1A 5JVLA 1KM2A 2GGEA 1ME7A 1UH2A 7TAAA 1Z69A 3NPUA 3WDIA 1ME8A 2ISDA 1IF2A 1FWRA 4HZ8A 4FIRA 1C93A 2VFGA 1YLVA 3AZSA 2QVHA 3KLLA 3TAKA 3WN6A 1DIEA 1JFXA 3IUIA 2YLLA 1IEIA 2FQIA 4GKLA 1Z42A 3VNDA 4PMQA 4DAFA 4YYCA 2OZ8A 2PDXA 3NJ3A 1KQYA 1UHVA 2XM2A 2Y7FA 1YHTA 2VFDA 4JTDA 3KDOA 2WK2A 1H7NA 1DWHM 1R47A 3CYJA 2ZZ3A 4X22A 4NAEA 2FYMA 3A4JA 3RM4A 4LAMA 1YTDA 3TW9A 1AW1A 4GHRA 1BGGA 4JIIX 3BZGA 3R58A 4LPCA 2OWXA 1Q8JA 2GJXA 4V27A 1IZCA 1EPVA 3HURA 5LNRA 4AYGA 1FRBA 2DJXA 4C6BA 1Q4WA 3IAQA 4RZ4A 1X98A 2QT3A 4NZCA 1S5VA 4KWOA 2F6KA 2BLEA 3KCJA 4IIDA 2V3GA 3L0NA 3N15A 2GUUA 4X61A 1AQFA 3W72A 3R4IA 2DZXA 4S38A 3RK8A 1S2WA 3FFSA 1J6OA 3VIOA 3PG8A 5D02A 3NWRA 2QGYA 4OKDA 2BSLA 3GDMA 4JQ4A 5KEZA 1W5QA 1TSIA 1TIWA 4ROPA 4Q4QA 3LCWA 1QWGA 3ABRA 1DE5A 1HX0A 3GWQA 3BV4A 4XKYA 4PUWA 4IT1A 1IIHA 1WZMA 3ABXA 4MSSA 4D6GA 4O15A 3E2SA 4HTBA 3KW3A 3VKCA 3EB3A 1U2YA 4NZ3A 3QM3A 3OYZA 3QHNA 1BRLA 3PWAA 4IG2A 2D73A 1T6MA 2ON3A 3H2OA 4LB4A 2FZMA 1FKXA 3GZAA 4A3QA 1HJSA 2BHZA 5DO8A 4D6DA 4JXCA 4W87A 3ATZA 5EFFA 5BXTA 3OW1A 1R7OA 3OLDA 1C9WA 1WUEA 3DH7A 2QCEA 4C6QA 1YMYA 4LQ1A 5T91A 1GW9A 3LV6A 3PBYA 2XSXA 3WL1A 2FMOA 3EWCA 3BW3A 2G0WA 1VBJA 4PB3A 5ABEA 1XBXA 3R11A 1GQKA 3MI6A 5EPDA 3JVAA 2YDSA 5FI8A 1AODA 3NM3A 1XJBA 3W74A 3T0DA 3PF3A 1CB7B 5E93A 2B4GA 5GVJA 3H8AA 2WHLA 4IMGA 4F9DA 2QUMA 2ZWZA 3W7OA 2FVKA 1M3UA 4UTLA 1EF3A 3H70A 2PZNA 3UY7A 2Z1WA 4K39A 1UWSA 5HNTA 3VGEA 3NGJA 3K5XA 1W2VA 3LB0A 4DBWA 2VELA 1XBVA 4AIOA 4LRSA 4DM1A 1NU5A 1MFVA 4GIAA 1UASA 3LUTA 5D9MA 1WXJA 3WK3A 1XX1A 1W1ZA 4O1CA 5T26A 2QYGA 1EWDA 6ALDA 1UD2A 3AU6A 5BRQA 3QVQA 4J9JA 3S6TA 1JDDA 3P8IA 4DBUA 3E0LA 5I06A 3WLSA 3RNDA 1O5RA 2NW0A 3LGDA 4DUXA 4C1LA 3SECA 2A79A 5H1WA 5JIPA 4A8RA 4QG9A 1D7FA 1M65A 3T0TA 1JPIA 1X7FA 4O10A 1O68A 3PANA 2DSVA 3HGRA 2V5DA 4BEUA 4O0KA 4KRZA 3AO0A 3ANYA 1ITQA 2EG7A 2ISWA 4V33A 1WPCA 2CZDA 1RCQA 4DF0A 3PTQA 5FF0A 5CZTA 4IPNB 1E0WA 2CXGA 3AXXA 3GNOA 1MVYA 5A6JA 2IPGA 3WQPA 2NT1A 4TX8A 3ZJ8A 4LV9A 4B5SA 5D8ZA 2OWCA 2FPTA 4GXPA 1F05A 2JQXA 3BLDA 4QRNA 1TWDA 1B3ZA 1P0NA 4FNQA 2NX1A 2VGFA 3TMQA 2OZTA 3KS5A 3F2DA 1QASA 3VINA 4DJEA 2PS2A 3OVPA 9XIMA 5KZ6A 3PZNA 1QR7A 1V02A 1UR3M 1KBIA 3OP2A 4ATDA 2OEJA 5A2CA 1WDPA 4HCLA 3GXTA 5IDIA 2Q8XA 3EZ4A 1B1YA 3HFTA 4O0ZA 5EL1A 4N02A 1G7VA 2JGYA 3OVGA 4LUTB 1FCQA 3C0SA 5A8PA 1LM1A 1V3KA 5AHEA 3IUDA 2HPIA 3LI0A 4Q22A 2E1WA 4G7FA 4US6A 3C2EA 4JTQA 1LTDA 3BWWA 1XBZA 4HA3A 4QS6A 4QXIA 3IVTA 3U4AA 4JNYA 2G3MA 3AJXA 3ZT7A 1JZ7A 1P0DA 2QJIA 1Q5MA 2QCDA 1EYEA 4M1RA 3SQMA 3EDKA 1HVQA 5FJTA 2OU4A 1NSJA 1TCMA 4ERAA 4EX4A 3U5UA 2OYKA 1FHDA 4JTGA 3LOTA 1GEQA 4UNKA 4NU7A 3QOKA 1E0VA 2Z28A 2QS8A 3QLDA 3OQEA 3ITOA 1RD6A 4ML9A 5AZ1A 2EKCA 4BF7A 4LAUA 4JKKA 4DIAA 1PTAA 3HQ1A 4JTAA 2TAAA 1HO4A 2OSXA 1B31A 3QZEA 3V7PA 1QOXA 2C3ZA 2X2GA 3N19B 1S46A 4XAGA 1W8SA 2W63A 1OWQA 2XSAA 1KGUA 3EEGA 3G1XA 1KCXA 3F2CA 2H90A 2BHYA 3RPDA 3EXTA 4AZ5A 4D8LA 1LOQA 2DEPA 3KXQA 3C2OA 1E1CB 1LRTA 3CU2A 1P48A 2BGSA 2GSJA 4BI6A 5GNZA 3CWHA 3NO3A 4QCEA 4YVXA 3UYCA 1MW2A 4BI7A 1VLWA 2FB3A 4JGDA 4KIRA 5AOUA 1QATA 1QPNA 4UOJA 1ZAJA 3ARVA 3VDBA 4FXJA 3O6DA 1UR8A 4MM1A 3T55A 1KXQA 5K9DA 3LLDA 3G0SA 4Q8WA 4P8WA 3LU2A 4D9PA 2H9AB 1X97A 1IXOA 2H9AA 3MCOA 4KESA 1M04A 4PMOA 5BMXA 1OGBA 1CPUA 3WZ0E 1GKQA 1M01A 4N42A 1E72M 2X41A 1NFPA 2VEIA 3WMBA 5AYBA 1ZY9A 2PBGA 5G1MA 5HINA 2Z7KA 2O9RA 2DT0A 4LX4A 1GOIA 2H3BA 2PEVA 4GLEA 1XIJA 5I3JA 4HU3A 2BY0A 1ZJHA 2OKOA 3L5LA 1RVGA 1I1XA 3GTIA 4PBFA 3LSBA 5DY2A 3MMTA 1HNYA 4EPBC 1QCWA 2OT1A 4RUBA 2ZDSA 5K9CA 2G41A 7A3HA 2C0AA 2JIEA 1SUXA 1W9VA 4YU1A 3CQIA 3TVAA 1QPKA 3ARYA 2VQTA 3SZ8A 1OCNA 2EJAA 1LCOA 2GFTA 3OA5A 4KGJA 4MF4A 3Q94A 1F6PA 3ITLA 3VDHA 3MVIA 1OX6A 2VEFA 2I5QA 3W7PA 3TXVA 3TCSA 3W7MA 4AY8A 4S3EA 3THDA 4C1NB 3M46A 2OEMA 5A1AA 1GHRA 1F6YA 4LAKA 3BW4A 3SN1A 3NSXA 3R79A 1EJ7L 3S83A 2WC4A 1TV8A 1HJUA 4GABA 3CWNA 1W2PA 3F1QA 3ABOA 2GVGA 2QHAA 2AAMA 1KFKA 1WUFA 5G4EA 3H7VA 4LCQA 4M19A 1V6VA 4JEJA 3QQ0A 3DAQA 4MNMA 3A23A 4AWUA 3KOWA 4RV3A 2XDFA 3N14A 1K9DA 1DIOA 3OLIA 3QC3A 2Y8VA 3WCZA 4UXDA 1RQHA 5C9RA 4QBXA 3P93A 1JL8A 2YCIX 3EKZA 4H7CA 3OO2A 5AKQA 3DGRA 1SSGA 5TQLA 2X1TA 4IHCA 3C3NA 1V08A 5DQPA 1OT2A 4P7NA 4NAFB 1AW2A 2HV5A 3B9NA 4ENLA 3APYA 3GM8A 2ISFA 3HQOA 3PULA 1EIXA 2EPMX 1A53A 4FK9A 1A5KC 4Y9AA 4GY0A 4JN8A 3DHDA 2Z29A 3CXOA 3A9BA 4DF1A 2Y88A 2EO7A 2PUZA 4PMXA 1ZU8A 2V2CA 4BF5A 4AHOA 1GNXA 3B8SA 2WWCA 4JQ3A 4FOKA 2J66A 1LBLA 3AMDA 4JS3A 3UXIA 1VS1A 4GQ0A 1R2RA 5AZ0A 4K8HA 2HWGA 5C6MA 3BLIA 2I7GA 2V30A 5DMLA 3ARQA 1HJVA 1E0TA 1XUUA 3OBAA 1VCGA 3WNLA 1XIFA 3QTGA 1DJQA 3PBUA 1US0A 1ZCCA 1HVXA 1PDZA 1F3WA 3U9IA 5FA5A 4JY9A 2CHRA 3WD2A 2AKZA 2E77A 2JF6A 5FSEC 4MLJA 3C2RA 1GYLA 1U30A 4ZSTA 3N2BA 1XQLA 1SO3A 3LQLA 2EXOA 3GNNA 3LZ5A 5EMYA 4E38A 4HOWA 2HXUA 2EPOA 1KRBC 3T05A 1KXTA 4K3ZA 2PDMA 1VBRA 3VOFA 4RZBA 5LIXX 3VIJA 1OCJA 2X09A 4GNJA 3VNIA 4H8VA 5EFDA 3KOFA 4M3PA 4UR9A 2WBGA 1EDTA 3MKVA 2ZVRA 3KL0A 4JCLA 3GNXA 1W17A 3E2RA 4RPPA 3VD3A 3MO4A 1UA3A 1EO5A 4Z1CA 3WQDA 4LAOA 3ECQA 3WLLA 3ZWTA 2WC3A 2WPGA 4UMCA 3MHGA 2PBOA 2A2IA 2NLIA 1IQ8A 1E51A 4B2DD 4Z2IA 5K2ZA 1K8CA 3T81A 1C29A 1WXYA 2QGHA 3VDAA 4LVFA 3QSRA 1TMLA 5DY3A 4Q6XA 2X7WA 5DBUA 1A0DA 2ZRWA 1GOQA 5A69A 4DWSB 4PMUA 1FWHC 4M81A 4XAYA 3N17A 2E9BA 2YLAA 1UR1A 3L4UA 3P0XA 3WL0A 1PZ2A 1C8XA 2WBKA 1NDWA 3W1PA 4TIMA 2ONEA 1XIHA 3BJSA 1G7UA 1TV5A 1SW7A 1GZ1A 4JTJA 1XYMA 1CLKA 3J7HA 1ONXA 1GVEA 3GHRA 4NRRA 1EP3A 4DXKA 2A3AA 1A5LC 4E4PA 3K4DA 4CNUA 1X1NA 3BOFA 3QFEA 4WHBA 3KRZA 3VKJA 1RY8A 2AMGA 3RCYA 1CDGA 5EMMA 3EX3A 3URQA 1NWTA 3UXAA 1B3XA 5IFTA 3VNYA 2XZ9A 3TSBA 3CHVA 5BRPA 2XM1A 3HMCA 3SUTA 3SFWA 3NQBA 4GIRA 4O28A 4O13A 1CWYA 1A80A 2WLZA 2BDQA 2MNRA 3SCPA 2MUCA 1EZWA 4FF7A 4KEMA 3HZ3A 3WDPP 5BNKA 1L6WA 5HBFA 2ZDRA 3N2MA 4GACA 6XIAA 3UYIA 4Z42C 3I4EA 4H6EA 2D69A 5ABTA 4OIFA 1UP3A 4HHMA 4JQ1A 4WIWA 3IGUA 1RA5A 4X2PA 5EBAA 4QJ4B 3LNPA 3G1RA 1EQCA 3T0CA 5HULA 3V3WA 2VFIA 3HV8A 3H2MA 2HBVA 1RP9A 1UZ1A 2YYTA 4WCJA 3UWWA 3Q45A 5A94A 1E56A 4W9TA 3CQHA 2V3EA 3ONCA 4G9PA 5KETA 3TQ0A 3CZEA 2OYMA 3IIXA 1U1HA 3UZJA 4L6DA 4QDWA 1XG4A 5LZLA 2PLMA 3PZ9A 2R1KA 1XM3A 2WZHA 2BGNE 3W0KA 1DYSA 1F8IA 1E5NA 3VILA 1Z9AA 3TYCA 4AD2A 2Z24A 3AUOA 3NQCA 4GC4A 4IPIA 3LPFA 2ZX5A 2FTYA 5AC5A 3G2GA 4D2JA 1BFNA 1RBLA 1GT8A 1XDLA 3N9RA 2IQDA 3GG8A 3USZA 3EX2A 4K36A 1J79A 2VJXA 3KBMA 3W75A 1E71M 1FWTA 1XKJA 4E6MA 5A95A 3RLVA 1VFMA 2P1FA 3VKAA 2OGYA 3AXIA 2Y8UA 1Y8BA 4U31A 2J6XA 3GUGA 3SCUA 2XG9A 4AG0A 1HL2A 4ZBCA 4WJ8A 2CLLA 3ARPA 4Z1BA 5T8GA 4ES4A 3NOEA 3LYEA 2ZXBA 2YXOA 7CGTA 4Q3MA 4C5YA 3TMLA 2F2KA 4WSJA 1DVJA 1V02E 4GQGA 2RAGA 4LUSA 4J3XA 5K9XA 1H60A 3NXLA 3ZOAA 1KFEA 1FQ0A 2YL6A 4GNVA 1EYWA 2FPVA 1JQXA 4MWAD 2B7NA 4JL2A 1RK5A 3DECA 4YJ5A 2CLIA 3APTA 5CLWA 4IIBA 2PTZA 2ANUA 4ORIA 2GK1B 4OBRA 4BS0A 3NVDA 1SMDA 4JFVA 2ZUNA 1G69A 3KCLA 1V3IA 1HUVA 1JNDA 3BXWA 1E43A 4YN5A 1H4PA 2ZUUA 4NNCA 4GUGA 2V5BA 1JQVA 4IMDA 4UC5A 3H2CA 4REQA 1W9XA 1H49A 4O14A 4QEHA 3AIRA 2JE8A 4LCRA 4OOZA 3WQCA 4QTGA 1YE6A 2DSWA 1QW8A 4JTFA 1PCKA 3WLMA 1TWWA 4DYJA 4JHZA 4E8DA 2JEPA 3U7BA 3GNDA 4FO4A 1DWAM 3K13A 3U5YA 3CASA 3VKDA 4UTMA 4AVFA 1CIUA 1MI3A 4NZ5A 1VJSA 3N29A 1A3HA 3TTYA 1J6PA 3HPAA 2OPJA 3LRLA 1W9DM 3NEVA 1W5NA 5AYYA 4XKYB 4F2TA 5CJNA 1JRBA 1RBOB 3CEUA 4I5XA 5GNXA 5JMUA 4S3AA 1SQ7A 1JUKA 1ZRQA 3W02A 1NAL1 1XLBA 4W7WA 3MMDA 3NTYA 1I9CB 3V5OA 1MMFA 2V63A 1Q13A 4EACA 3H26A 4ERGA 2PGEA 3BQ6A 3OLEA 3SGZA 2CXEA 3GH7A 1LL4A 5CG0A 5EBUA 5D38A 4E8CA 5F4SA 3VABA 4XV0A 1I2QA 3DFYA 1ALDA 1MDLA 1WZLA 4LC8A 4TMCA 1REQB 1Q2SA 3LM3A 4EAYA 2ZTJA 1VFTA 4PMRA 3F03K 1DPMA 1Y5XA 4QSHA 4O1BA 3VDGA 1J4EA 2CNCA 3PFMA 3PZVA 1R30A 4C6MA 2PWHA 4PH6A 5CPOA 3EMZA 1QT1A 2FJUB 4UMBA 1BYAA 4ACZA 5HK4A 3M1ZA 3KRUA 4JZ5A 3OVRA 1G94A 3O0FA 4NASA 3FV9A 3LN3A 4PMNA 2YCLB 1RXOB 2PE4A 2PZ0A 3BAKA 4TOQA 2BFGA 1P1XA 3M0JA 3WJWA 1DIKA 3MTWA 2E3ZA 4GCAA 3VNLA 3LCHA 4JN6A 4Z1YA 4FMVA 1P0KA 3HIJA 2PDWA 2J7CA 3AWNA 3HPZA 1LT7A 2R9RA 4O12A 4IOTA 5MHBA 3BW2A 3P84A 4GI6A 3EWXA 1B57A 3D0CA 4W8LA 2FZDA 4NSBA 5AFDA 4IX0A 5DELA 3CLWA 1YPIA 1LBMA 2G3IA 4JTSA 3DFQA 2HVMA 2NV1A 3CTTA 3OB8A 1P43A 4EXBA 4WF7A 4HYRA 4JIQA 1EGMA 1MW3A 2HS8A 3VOJA 1H7WA 1Q7MA 3S5ZA 3WLHA 4IMAA 1AH0A 4H9VA 1B9BA 1KKOA 5IDZA 3Q65A 4MHBA 4WXYA 3EOSA 3M41A 1AD4A 2YCLA 2FVMA 2XFRA 1IWAA 1A5BA 1ZP3A 1N2VA 3NQGA 2FJKA 3UT0A 4HJWA 3W7LA 1WKFA 2ODOA 1TZ7A 1EC8A 4WKAA 3W71A 1ZUAX 1JAKA 1K8YA 4EANA 5LYRA 3CH0A 3G24A 3CO8A 1IE7C 3MUCA 2C1IA 1YEYA 4CCCA 1U22A 2GVYA 5FJUA 1YBQA 4ONVA 3LHVA 3U2EA 3O15A 4RCXA 1T8XA 1EX1A 1J01A 3W4RA 3VNJA 5CGQA 4E3VA 9XIAA 1YXYA 2DZAA 3N1AA 4IGHA 4OE7A 3LHZA 1LJYA 2QDDA 2CU0A 3NYZA 3S9YA 3C86A 1R3WA 1W5PA 5H6HA 2GDVA 2VGIA 3WO8A 1W1VA 1QPRA 2YJQA 1ZBVA 1EP1A 1UJPA 3GU9A 3GVVA 1IV8A 1YNYA 2QMJA 2C16A 3DZ1A 1E1CA 2PLJA 1L6SA 1L6GA 3UR5A 9CGTA 3KHDA 3T40A 1EBHA 4LCSA 3QV6A 4Q8UA 1V3HA 4DWSC 3EOLA 1JCYA 3OOQA 1OZMA 4LEQA 3UVAA 2D3LA 1DHPA 3M6DA 1UPMB 4KT2A 1XH0A 1X39A 4U5IA 3V18A 3FGCB 3VMOA 4M56A 2YOCA 1OABA 3UG3A 3KX6A 5IBXA 5KSWA 3PG9A 3O3RA 3UJ2A 3OIXA 1ICSA 2X0SA 1YDVA 3Q58A 2GOKA 4ADTA 2LLEA 3CNYA 3M9YA 3A3XA 2NXIA 3U2OA 3BJFA 2G95A 1MQQA 1T99A 1ITCA 4KEZA 5KZEA 2J79A 1QI5A 3MHUA 2J7HA 1SFTA 2WB5A 3VC6A 4XBKA 4ICCX 5DRIA 1F76A 5CEWA 3R0UA 2FTWA 2FDSA 4S39A 1YPFA 2PMQA 3ITCA 1CXEA 3D6NA 3HGJA 1TV7A 3OGSA 3WK0A 1FWEC 3TP4A 1WA3A 4J35A 3OYXA 3UWQA 2V2DA 1FHVA 3QC0A 3E3HA 1S5TA 4YCPA 1LWHA 1MEIA 1UUOA 2VTFA 3NYDA 4NZFA 3MBDA 1EJRC 3POCA 2JKPA 1UWAA 3OZPA 4HPNA 3TC6A 1GEHA 2G4FA 3TQPA 4A3YA 4W86A 2OOFA 1EHNA 2WCSA 2J9YA 4GYJA 1EOMA 4BR1A 2Y7GA 1NY1A 2W9MA 2OT0A 4FIQA 3L12A 4ZQCA 1QNSA 5G2HA 3DHUA 3KBSA 2VURA 1UWUA 5FF2A 1WDSA 3MBFA 1V51A 3UWEA 4B5VA 1Q2RA 1OCQA 3KVKA 2HCVA 1LWIA 3V75A 4UQDA 4E3TA 4ALDA 3R12A 2ZXAA 4FS9A 3GYCA 4MUPA 4JFUA 3HFYA 1TE6A 4OT7A 4GZIA 2C8NA 1K02A 3L2IA 1TMQA 5D03A 3E9AA 1GORA 2D0GA 4GUJA 1WZKA 4N0RA 3FXYA 4GVIA 3SUWA 1TPWA 2FZNA 5EMKA 5HANA 1VHNA 3T9PA 3WF2A 1EO7A 1SJBA 4NYUA 4FEZA 3NPVA 3IACA 1B3VA 4ZCWA 3WBAA 4DWSD 1EPXA 5EA9A 3MCNA 4O8AA 1VD6A 5JH2A 5I03A 3M0IA 1RJQA 3MV01 3TCEA 4Y8EA 2ABBA 3FKKA 3LMZA 4AVOA 4FF5A 2IPJA 4AU0A 3R8RA 2DW7A 3N6QA 2JF7A 3CJPA 4ZODA 3VU2A 3QMTA 4NJGA 1MW1A 3UZ5A 4XO6A 1ZTVA 3HPFA 3R1ZA 2QJMA 1KM5A 4Y6GA 4MYAA 4Y7EA 5CJMA 3WLQA 1KV5A 4U28A 3T42A 4L4OA 3BAYA 4MKSA 2C15A 4ZMGA 2I17A 4XB3A 4KH2A 1I45A 1QNPA 5LSMA 3N73A 1ODZA 3M4HA 3TWBA 1DV7A 1E73M 4Z0SA 3VGHA 1LROA 4H4IA 1HKMA 1AG1O 1IIGA 4PEEA 5LIUX 4LRTA 1A5MC 3KRBA 2CLPA 1E55A 1ADDA 3RCMA 3TLLA 3PC0A 3H22A 4IZGA 2YXXA 5HDRA 3T0AA 1TRDA 4HIBA 5IBXC 3CB8A 3EX1A 2W5FA 3O2LA 1VEMA 1EA0A 1OFRA 1S3TC 3UP8A 2HNHA 1J2WA 1KV8A 1VC4A 1VFHA 4DJFA 2FFIA 1KNWA 1FVPA 4A05A 4YVPA 4C6EA 2WMFA 1O66A 1KTCA 1WKDA 3NPWA 1A0CA 2F9RA 1VPYA 2CZ5A 3A5VA 4C6JA 1FOBA 3N04A 4MPQA 2E40A 4H8HA 4C7DA 5CC3A 5DCBA 4PUUA 1BGAA 4D6HA 2YW3A 3P60A 1BVZA 5E5CA 5FF4A 3ABSA 2ZUMA 4UR8A 1D9EA 3JU2A 2G37A 1CECA 1FY6A 5BXSA 3NL2A 1RP8A 7PTDA 4BWLA 3S6DA 1WAUA 1ONRA 4HCHA 3BG5A 2ACQA 3LBCA 3EB4A 3GVWA 3T2OA 2V3FA 3NDYA 3P5ZA 3GFYA 4S2BA 2FHCA 3P0WA 5DXXA 4NXSA 4BEQA 3ZSSA 4TTUA 1YNPA 3RILA 1NJJA 1HP4A 1X7IA 2HK0A 3AYRA 4JYDA 3W2NA 2J77A 3S8HA 5GJPA 3ZO9A 2J9ZA 3M0ZA 4YNGA 5AN7A 1TO3A 2PRLA 3PFRA 4KCTA 1JZ3A 3W23A 3SQSA 3WLPA 3W2KA 3HOJA 1MZRA 1QNOA 1PKLA 4MWAB 3LEPA 1MFUA 4WLCA 2BZNA 1CLXA 3MI3A 2VC5A 1UC5A 2J62A 4FLSA 4QX4A 5GJNA 1PHQA 5EMJA 3TR9A 1ONWA 3DI1A 3SEPA 3W1AA 1W37A 3SR7A 1XYBA 4F0KA 1XLEA 4JX4A 2L5HA 4NYYA 3OZOA 5K3VA 5FEZA 3ZLGA 4AC1X 3STCA 1UOKA 2QCLA 4ICNA 1QI2A 4D6EA 1ITXA 4JEQA 4C6PA 2BODX 3VIKA 2GJRA 3R5EA 2DUZA 3I6EA 4PSPA 1ECEA 1VFUA 2V8ZA 5F1VA 4HOXA 2NZLA 3GDRA 2CWNA 1OCBA 3CZ8A 1EGVA 1QWKA 3G18A 5L9FA 1FH8A 3R6IA 3RM8A 3Q67A 3T8QA 2YCKX 1GK8A 2E6AA 1EB3A 4FAMA 6TAAA 1G4PA 4QG6A 2DZSA 2Z2BA 3PP7A 3OGVA 2Y7EA 3HG5A 5AC7A 5F2IA 2WNQA 3SIMA 2PGWA 1RH9A 2AL2A 3DYMA 2PC8A 1XRTA 1WDDA 3BGAA 3CQ0A 1LLZA 3GKAA 1MWOA 4QQ3A 1JPHA 4N9CA 3IAPA 4GIEA 1A5NC 4XSMA 3LRMA 2RDWA 1OIFA 4AFYA 2DZPA 5D30A 1YBQB 5CSRA 4GWEA 1AJ0A 2VD8A 2B7QA 1ZENA 2WSKA 4UFMA 4YLWA 3LI1A 3W2UA 1ESWA 2VVSA 2CYGA 1V6UA 4GC3A 2DUXA 1S2TA 5I3DA 3M6YA 1MEHA 4Q4KA 1WDWA 1ENUA 2NUWA 3KWXA 4IX2A 4O52A 4PUNA 1ITUA 3MMWA 2ADAA 1QJWA 4O4WA 2WKJA 3O6AA 4AEOA 2O56A 1X38A 3GHTA 1A5SA 4M7TA 4MNKA 1K7XA 3ONBA 1JNEA 1FDJA 1M1BA 4YHGA 1QI0A 3G77A 4PA8A 1VBHA 4DNHA 3M0LA 4KWWA 4I9AA 3CUFA 3GTFA 2J7DA 2WXDM 3RFAA 1ZJAA 4IQLA 4LTSA 3S2CA 4O18A 1TPEA 4GY7A 3NDZA 3QH2A 3WNMA 2ZZ6A 2QW5A 4IGMA 2B7OA 2NVCA 4P8XA 3VE9A 1KRAC 3UR7A 3U4FA 3U48A 1VFSA 3NFUA 1EDGA 1MSSA 4HYWA 1F5ZA 3TZNA 4FNPA 1DOSA 2BASA 1DP0A 1HF6A 1B9ZA 5M1TA 5REQA 3D47A 4C7FA 4PRRA 3CAKA 4GCXA 4WRHA 2UY3A 4JTRA 4DELA 1DWFM 1RCOB 4L9YA 2D2GA 3UVIA 3QYSA 5CBJA 2J74A 3GVRA 1C8QA 1AVAA 1G67A 1AJ2A 4GUHA 1VFLA 2V5KA 4R3UA 2AGTA 2XIOA 4CN6A 2ACRA 1A47A 3DFPA 4FI4A 1B0IA 3QQWA 3ZR6A 1G4TA 2NVAA 3GTXA 4A2SA 3AROA 1VEOA 3QPYA 2X40A 1TWSA 4DBSA 1F7BA 3UFYA 1Q6EA 3STFA 2A5HA 3PZOA 3G1HA 4Y2WA 3OBKA 5E9XA 1FDZA 1IR1A 1UWIA 4CEUC 1PUDA 5B80A 1HTIA 2R1LA 5A6TC 1P4CA 4K8EA 1BQGA 4WDWA 1O95A 1RD5A 2VEGA 2IKIA 1V0NA 4DXVA 3SRKA 4RNJA 2D22A 2PDYA 3LLFA 4PMDA 3ZJ7A 2ZRZA 4NX0A 2VP8A 1Q8AA 3URBA 3TSMA 1FFRA 4C6CA 1M03A 1O5XA 2H3DA 5LIWX 4GISA 3OTRA 4CUCA 2G5WA 4GJIA 3IK2A 2YDQA 2CBVA 4IWWA 3GH5A 4IL2A 1RJPA 4UB9A 1EIBA 3W1NA 3W7HA 3WNOA 5C9WA 2VUYA 3QBUA 3WYZA 1RA0A 3FS2A 4M24A 3WK1A 3TYAA 4KF1A 3C6CA 2WHJA 4L9XA 3NQFA 1T7LA 1AUSL 2REQA 1W5OA 4QCFA 1DJNA 4LVDA 2XH4A 2WJFA 1X96A 1U5VA 3AIVA 3MU7A 5J5RA 4P7RA 2PDFA 3SFKA 4QISA 4AX6A 3PZTA 3CQKA 4UCGA 4DZ5A 2D0HA 2E67A 1MXDA 4U2YA 1S2UA 2VI0A 4DYKA 3WDRA 2CBUA 1LLWA 3NZRA 2BS9A 2J7GA 2AGKA 3SW6A 1JGIA 4Z2KA 1A5CA 5ABFB 2DV0A 1RUSA 4LALA 4LYPA 1GQNA 2B0MA 3PZIA 2Y7DA 3DHFA 4GXWA 3SCNA 4TMBA 3L0GA 4W84A 4CD7A 1BTCA 1QFEA 3BLFA 2X05A 1WNOA 2BVTA 3DKLA 1GPFA 3E2QA 3FYYA 3W1QA 1Q45A 4TTGA 5I7GA 2ZA3A 3NSMA 4GUFA 3B0PA 2VDGA 3W38A 3RU6A 2P53A 2XFYA 3H4GA 4H9ZA 1K3UA 3Q37A 4HN8A 8XIAA 3Q4DA 4YHEA 3TA6A 4ZE4A 1ML1A 3PUGA 4RW5A 2PDHA 4LWWA 1ONEA 2CLMA 4YS1A 1CI1A 3V36A 4WUIA 1UIOA 1Q6QA 5CBIA 3SN4A 1D8CA 3IIZA 3K4WA 1WBHA 1KO0A 3W88A 1HL8A 1IXQA 3WMLA 4AHPA 3H12A 2WCAA 5BMWA 3EDFA 2QJHA 2CZEA 4RV8A 4C65A 4AD5A 1KW1A 5JQ9A 1UUQA 4Q4MA 2AOSA 2QF8A 1FP9A 4J40A 4AH7A 1UR9A 3V35A 1RSCA 4N9BA 3TC7A 3WENA 2DZBA 4L9ZA 1AMKA 3EWUA 1Q85A 2ZX8A 1U83A 3NQ2A 3NQMA 1PWLA 4E4FA 3VOIA 1I0BA 3PPHA 2UWFA 3QY7A 3FHAA 3SM0A 4MJMA 1E3XA 3DFSA 1W1PA 2QCMA 1VB9A 5CLTA 3L21A 5EB8A 2QVNA 3B9DA 4HU8A 3HA1A 5HATA 3JW7A 3EBVA 5D2TA 3RLGA 4DN1A 3WBWA 3UW6A 3P61A 1K1DA 4MUZA 3ZQ9A 2GK1A 4MFEA 2OFJA 4S3KA 4Y9MA 1PKMA 1PIIA 4XX6A 4ZTYA 5G4WA 3WDHA 4P61A 3OJGA 1ZAHA 1SJAA 2VRQA 4UQ9A 2ICSA 1XCXA 3MWCA 1HT6A 1XKYA 3RX4A 1TR9A 4M8UA 3JZEA 4IIEA 2POTA 2IQTA 3R13A 3WUFA 4Q8VA 4AEFA 2HK1A 4HMCA 1VPXA 4LSBA 2HNEA 4Z08A 3AWOA 3ARRA 2A3EA 3N9KA 8CGTA 4EWJA 2DH3A 2VZSA 4IF2A 2FGBA 3VIHA 1JZ5A 4KS0A 1JFHA 1OFQA 4JTTA 3AHXA 2DQXA 1MYRA 3O63A 4FPSA 1AA1B 4L80A 4IP4A 4XSLA 4MFDA 5FOOA 1J0YA 4LS1A 1TUXA 5LXXA 3TU9A 1DORA 1VCFA 3E12A 3UJRA 5ABGA 3MDWA 2GVEA 1XIGA 1DJZA 2BY2A 3OZYA 3ALGA 2VD9A 3S1UA 4QJ5B 3QGVA 2XVLA 4QQUA 4FLOA 3VUPA 3F4CA 4LANA 2GJLA 3LBMA 5FKYA 2CHNA 2GLKA 4PULA 1CGUA 4JIPA 2V3DA 2GJNA 2ISSA 4QE5A 4UIOA 3WSUA 2Y5JA 3P74A 4NI3A 3M43A 2WVVA 1W3KA 3ES8A 2DY3A 5IOBA 4RZ6A 2NQJA 4F2UA 1W5MA 7ODCA 4RPQA 1UD8A 1QRQA 1EF2A 3B8WA 1WOBA 1VJZA 4NXKA 4RDWA 3B0YA 4GE8A 1PZ1A 4WDTA 3S9ZA 1XSJA 3L68A 3W1MA 1SR0A 1XI3A 3QLLA 1KFJA 3QMSA 2WMKA 1V6TA 1CLVA 1KGXA 2E8YA 2V69A 3VM7A 1V7YA 3H2FA 1QAPA 2GQ9A 2WZIA 5CC6A 1P0EA 2QPUA 2R6OA 2GPTA 1UBPC 5PTDA 4CU7A 4Q8MA 3AZTA 1THFD 4IMFA 2ZBTA 1XYLA 4MWAA 1ZLPA 1F3EA 4EXQA 4QDMA 3UJFA 2QDEA 3S5NA 3S5SA 3A4XA 2Z2AA 1J93A 1JG9A 2D2HA 3UWUA 3PNZA 1JI2A 3WQ6A 1OJXA 4R85A 3PAOA 4IGSA 2ZZ5A 3GXDA 3FA5A 4JIEA 4MJZA 3UWYA 3TQVA 1GJPA 1QW9A 2OODA 1TV3A 4C6NA 3H53A 2HE8A 4ZFMA 3PSVA 3QZAA 4WR3A 1JZ6A 4HU4A 1OK6A 4US5A 1KLYA 2ZC8A 5HJYA 3T4CA 2PODA 3W7GA 5CC7A 3FDKA 3U6WA 4O4VA 4WXZA 1YADA 4GA8A 4GBDA 1TREA 3GHUA 3GG1A 2BY1A 4B9YA 2YKKA 2V38A 1DQUA 3HG2A 3V1HA 3MSGA 2UBPC 3LXBA 1XGEA 3PBGA 3RM9A 5CBBA 4HNLA 4UR7A 1KFWA 1JCXA 2O9TA 4ZGYA 3QV7A 2A6LA 2ZFAA 4X0NA 2OEKA 4M29A 4OGZA 3VNKA 2F8QA 1ELSA 3TIMA 3TTSA 5D9OA 4BK9A 1D2KA 2H8ZA 1X8CA 2VDIA 4AB4A 3B0XA 2YFOA 2PTXA 4XZWA 1XLMA 2FFCA 4DB7A 4O0QA 2PWGA 2VX5A 4PUEA 3N25A 3DYPA 1FWDC 3N2OA 3CS2A 5HPCA 5BRBA 2V5LA 3KCOA 3G3DA 4CQBA 2HMCA 4L1XA 3STGA 2W3ZA 1G01A 4MOZA 1S1PA 4POCA 4NNAA 5M2FX 4X63A 4XZMX 4GBUA 5B7ZA 4JTUA 5AHMA 1ZPTA 2VOTA 3S1WA 1CYGA 4D72A 3QXBA 4S3JA 1AL7A 5BWFA 3KBJA 3Q2DA 2HXTA 2PDGA 1US2A 4FX8A 5FJIA 3ZT5A 5CXPA 2WNNA 2OLAA 3CPUA 1QHOA 4A8NA 4L6OA 3SB0A 1AH3A 3ZLHA 3PPCA 2AAAA 3GFXA 5I5RA 2WKGA 1W1YA 3NGFA 5AB3A 5E09A 2ATSA 2ZRXA 4RNFA 5GQBA 1M5WA 3W37A 3BJTA 4NJKA 3N3MA 4CCEA 1LG1A 2Z6JA 4C91A 1JVNA 1XIBA 5AC8A 1JYXA 5LIYX 3AMCA 3ISIX 3U8GA 5F4XA 2F7FA 3EPNA 2PDCA 4I6KA 4ZO9A 2O7SA 1RLDA 3NQ6A 2G3JA 4RDYA 3TZFA 1OFOA 4HA1A 1BSIA 3EGJA 5DEZA 3IV8A 2J47A 2EG6A 2J7BA 1VF8A 3WLRA 4MKVA 4YTRA 4WSKA 5FL1A 1E40A 3K1GA 4QROA 1JCLA 3A3HA 5REQB 2BVDA 4S23A 4GKTA 3T78A 1X8FA 3I6TA 3PHAA 2Z1XA 4DI9A 1FWNA 2AQOA 4HQVA 2X1SA 3ZMRA 1FWSA 1F4HA 4XTDA 3UA4A 2D24A 4R88A 4UQCA 3D3FA 1KC7A 1BG4A 4RX0A 2BVWA 4DQWA 2RHGA 4H1ZA 2PDKA 3KBVA 3W86A 2ALDA 2Y0FA 2P3ZA 3NR0A 1GG1A 1S3HA 3KTSA 4BQ3A 2CITA 1AW5A 4B90A 2EPLX 4JFWA 3A5FA 4PTDA 1C91A 5CZ0A 4E2BA 4GH1A 2E5BA 1O5KA 2EJ1A 4IIHA 1J2BA 4JHMA 2YR1A 1Q7QA 4OVXA 4ML4A 2VZTA 2YB1A 1JUBA 5KITA 4XAFA 2OLHA 4D6CA 3ARSA 3W83A 1JCJA 4PR4A 2CBIA 1PYFA 2E5CA 1TG7A 3USBA 4DY1A 4MMWA 3VGGA 3PS7A 1PO9A 4QSFA 3AHVA 4I9JA 3QJAA 3M7SA 4NZ1A 4HJFA 2Z6IA 3GS6A 1BYBA 4H01A 1A5OC 5DT5A 3VZYA 5CZKA 3GBDA 3VKBA 4DJEC 2NQHA 4PODA 2J24A 4UTTC 1V79A 3W6YA 4FOJA 3RRXA 3T2QA 3S42A 1QVBA 3V0UA 1FWWA 1VJIA 3B8TA 2XIIA 4G5DA 3B0VC 4HNVA 1UUMA 3LLXA 1UOZA 2ZE0A 4R27A 3AI0A 5BU9A 2C7FA 1B2YA 1J8VA 1YPXA 4K6AA 1C8YA 3UY8A 3WEZA 4P5UA 1G5AA 2GGGA 4JPGA 4GRSA 3MWAA 5C5YA 4XD4A 3BK0A 1GVIA 2RKXA 1FUYA 3HN3A 4WD0A 3PY2A 4PEKA 3A24A 1AFSA 4JHOA 2DZTA 4JTEA 2PA6A 2GUBA 2XWEA 1NOFA 3M0XA 4J3SA 3FEMA 1GVYA 3BLLA 1DXIA 2BOFX 4KGLA 3UPWA 4PTMA 3W85A 4PFMA 4GGHA 2XGZA 3RO6A 3H2NA 3DG3A 3SY1A 2JKEA 1CNVA 3T8LA 3WG6A 4NL1A 5FEPA 4NAFA 4GI9A 3D5HA 3BGGA 2CETA 3GB6A 1R38A 3W7DA 4MZYA 1TMHA 2VR4A 1S39A 1K77A 3ORWA 3K46A 2CKSA 1P6CA 1K6AA 1Q6DA 1H1NA 1V7AA 1KWKA 1NVMA 1JF5A 4WK9A 4N7QA 3THAA 2ZQ0A 3I7QA 3UNDA 4AIEA 2VRJA 5E6ZA 4V1YA 1JZ2A 4I90A 1XC4A 1SZFA 4H9XA 4QNEA 4ACYA 1GW1A 3L4TA 5MF5A 4MGGA 3PZMA 2PFHA 3GTNA 4DRSA 5C2CA 2EGZA 4DJDD 1V93A 3A47A 1GOXA 2YCEA 4Y90A 4A8LA 2GJXB 3H4XA 5LNUA 2CHOA 3H2AA 2YSWA 3EX4A 4JL1A 2NQ5A 5A6LA 4RNHA 3GXNA 1GYMA 3S3GA 1L2UA 5CH9A 2X1IA 1GZGA 4AWSA 4RE2A 5BWAA 5C9UA 2R91A 3C5QA 1EP2A 2WC7A 3MI2A 3N18A 1V0LA 1J0ZA 3TE9A 2CIPA 2J9XA 1XIDA 4GJJA 4PZVA 2JFEX 5H2ZA 4C1KA 5I3FA 4QLLA 2TODA 3PZGA 2WVSA 3L7RA 1XLGA 2DQWA 1KXVA 2E25A 2PTYA 4M6UA 1SO5A 1W1TA 1AZ1A 3ZLFA 3AIWA 3WFLA 4LYRA 5D09A 5LNVA 2P8BA 2P0OA 3A64A 3BG9A 3WLTA 3ZJ6A 4DI8A 2VX6A 4UUIA 3VFLA 1H51A 3TDFA 2V9DA 4CN4A 3UXLA 2QAPA 1EDQA 3FYOA 2UY5A 4DF2A 4INFA 5I3IA 1EHAA 4XZBA 1WDQA 4G1KA 5EYWA 4R5EA 3CHDA 3LZ3A 4BKNA 1IWBA 1H50A 4B16A 2G8ZA 2VC9A 3F4WA 4AZHA 3LSCA 1ZALA 1HG3A 4AD1A 3MSDA 4IIGA 2PDUA 3NL5A 3IV3A 4PUJA 3VO0A 4WQ6A 4LU0A 2GWGA 4HOZA 1T8QA 3RCNA 5ECVA 3WUEA 3AHTA 2XN1A 3FA3A 3MS8A 1OBAA 2VZOA 2PWFA 4C6LA 1AD1A 4CNPA 3LMYA 3QKZA 4IP5A 1Q6OA 3PBMA 4AF0B 3QR1A 3LTPA 1YIXA 3P6LA 1EC9A 4NQ1A 2X0HA 4AISA 3NAVA 4EKJA 4OUIA 2OOGA 4J2MA 4UTKA 3V5FA 1XCWA 3TTEA 3R8HA 1X1ZA 1E6SM 3W53A 4XWUA 4FZIA 1Q63A 4C6FA 4AZBA 2INEA 3FYPA 2VFEA 5I78A 2YW4A 5F2GA 4LBRA 4R33A 3ZVIA 5M03A 1PDYA 3S2JA 1YE4A 1R8LA 4O1EA 1UMLA 5A6SA 1KM6A 4YCOA 4GO8A 1FWIC 3K4AA 2ACSA 2GSHA 1E6QM 1B30A 4LVAA 2W0UA 1JDAA 4L1GA 3BSGA 1EJWC 2NQZA 1KM0A 1EJXC 1M9HA 4J2PA 3FNDA 4H9YA 1NQKA 3WUGA 1W8GA 1ZAIA 4S3DA 4WZHA 4PB5A 3WQFA 4MPKA 3LCXA 1HJQA 4HZ7A 4JNZA 4GFSA 3MQTA 3S2MA 3LERA 1N82A 1P1MA 2NV2A 3ITTA 2NLYA 1N7KA 3W6MA 2DSKA 2XIJA 3P62A 3QY6A 4KW2A 4FSAA 3KVMA 1WKEA 2JALA 4EXAA 3IVUA 1HN1A 4FX6M 1PCWA 3S4TA 3UQNA 5CSUA 3VGBA 1XD0A 1CW2A 4KRUA 1IT7A 4C6OA 3BSMA 1EZ2A 4HHLA 3BO9A 3LXAA 3WNNA 1Z6KA 4XZIA 3CK5A 1EJUC 1IT8A 3W73A 2OO0A 2EG8A 4LBSA 5FEXA 2W92A 2PPGA 2QLYA 4HPGA 4NZ4A 3SUSA 3VGFA 1US3A 1E1EA 4HN4A 3NDOA 4AX7A 3B4YA 4WOZA 2W91A 1JPMA 3N3TA 4HZMA 5FESA 3WX7A 4A6GA 3RGTA 8TIMA 4R7OA 1MRQA 1FA2A 3N2XA 1O1ZA 2EPHA 2WMHA 1FXPA 3RDKA 1GUVA 3WH9A 3BVJA 3SCTA 3GU2A 2R94A 4UQEA 3DUGA 3IGSA 2Z27A 1Z7AA 3CO4A 3S1VA 2IKGA 5JBFA 1Q4NX 2OMAA 1MQPA 3QR0A 1XW8A 3QV9A 1XSKA 2OQLA 4S3GA 1FWAC 2ABAA 4YTUA 2YA2A 4CQCA 4GD0A 5AHNA 2V5CA 3TAOA 3NM1A 5E0CA 4Q32A 3L9CA 5A6BA 1PKYA 3APGA 2OELA 2J8TA 1BVWA 3BE7A 1RCXB 3TK7A 3RITA 1NFBA 5EKYA 3W1RA 6REQA 2AKMA 2VCAA 3QW4B 2X8RA 2HPMA 1IZKA 2Q8ZA 3BLEA 4K38A 3QZ6A 4NJIA 3QOMA 4IUGA 1E5JA 2J4GA 4AY1A 4ADUA 1E6RA 3QW3A 1UG6A 4WEVX 3FY1A 2C71A 5AHIA 4NT0A 1UD6A 5LIKX 4U5KA 1BHGA 5TIMA 2A1YA 1J0IA 6ENLA 3ALFA 4PRWA 1XUZA 3RMJA 3CL7A 8A3HA 1R2TA 4GZJA 1S5NA 1GVFA 3O07A 3OBEA 3MUXA 2VEPA 3WNKA 3L4VA 3DBNA 4XUGA 5F2MA 3B05A 4AW7A 5IFPA 1AZ2A 2CC0A 4REQB 3G3MA 4M80A 1RAKA 4A3UA 4QGCA 1VR6A 4X2RA 3C0QA 3AMKA 3OIHA 4R7WA 4YTSA 1ZZMA 2OWWA 3BMXA 5G4HC 4D8AA 4WSHA 2C0HA 2OVLA 2E8ZA 4NX5A 3R43A 4I3GA 3DI0A 1JD9A 1FWJC 4M7SA 1OC7A 5CSSA 3TUUA 3EA1A 3VA8A 3KS6A 3WK2A 3R8GA 4HHHA 2XFFA 3SO7A 2V2HA 3R25A 4QFUA 1JDFA 1WBJA 1S5MA 4MZ1A 1YXDA 5EMUA 4S3CA 1DWJM 4Q8OA 1AMYA 2A3LA 4V28A 3DX5A 3W1LA 3VD5A 5JBEA 2ZRUA 1F4AA 4FNRA 5XIMA 1WOAA 4KMQA 1QTWA 5HNNA 1W1A1 1R3TA 3RXZA 2XFWA 3E96A 4H41A 5LHEA 1P5BA 2VDHA 2BB0A 1WDRA 4UQAA 4JTCA 4ZE5A 2PTDA 1OD0A 4IPLA 2WKLA 4K7YA 2WLYA 3G5EA 4WJXA 2ZA1A 5I23A 4O8RA 1EJTC 1QNRA 4TXEA 3CGTA 6XIMA 4MWAC 4AYSA 2E6FA 4RE0A 5D2XA 2Q8LA 1D3CA 3STPA 3EA2A 1RV8A 4FNSA 4JTLA 1JPDX 5DFAA 2ZC1A 4IFRA 3VIGA 4IICA 1PXGA 2Z1SA 3OLGA 3HMJG 2D2OA 2GYIA 1BWVA 2GZXA 2QULA 5M3WA 1XC6A 1YYAA 1IZJA 3I7SA 2ALRA 2IS7A 3TN3A 3FX4A 1TWZA 3MCMA 2IW0A 1TKKA 3TSDA 3EXSA 2JEQA 4F0MA 3QFWA 5HA7A 4CVUA 3RJXA 5DLCA 1F6KA 4J7RA 2WHKA 1Q6CA 3GAKA 1SVDA 4Q7NA 4WY0F 1BXBA 4H9UA 4HKPA 4JD4A 4PE8A 1VENA 4L65A 1RBAA 2RJGA 4AWEA 2INFA 2X0YA 2CESA 4X3ZA 3TNOA 5EMLA 1Y0EA 2PP0A 2DZWA 2QDGA 2XVNA 3O0KA 3SCSA 4M51A 1R3YA 1IEVA 4IPPA 3SSZA 4TR9A 1W91A 3WQEA 1RY0A 1EEPA 5ABFA 2X1RA 3NL3A 4DUOA 3GDKA 3UZZA 5A5WA 5JXQA 5FSDC 1A5AA 2A85A 4F9JA 4DYEA 2VOMA 5FD0A 1QBBA 3TC3A 4N4PA 3BOLA 2Z26A 4ATWA 4Q4PA 1S2AA 4I5UA 3MV11 2PDLA 4I6VA 1H0GA 3TJXA 3I7RA 3G1FA 2Z2UA 2I14A 3VX1A 4C90A 2WNWA 2QCNA 1V5XA 2QEZA 2TSYA 6CGTA 2J6VA 2WCGA 4A2RA 2C18A 2ZZ4A 3O06A 1HKWA 4GXMA 2WZEA 3SJNA 1MZHA 3LD5A 3EDEA 3MSYA 5G2IA 2PRHA 1DWGM 4YTTA 1OEPA 4H8UA 4C6KA 3UJSA 3ZVHA 4BFAA 1KCLA 1QBAA 2QR6A 2CPUA 5HQLA 5JU6A 3MYOA 3VOHA 2Y89A 4M6PA 4RE3A 5JIWA 2I1OA 1ZHAA 1XLHA 4AC7C 1N8WA 2DU2A 3EX6A 2VC6A 3PUOA 4YWSA 2TMDA 1QPOA 1PE1A 3IARA 3TN6A 4H7VA 4AZCB 3CZKA 1I60A 5AYZA 1OIMA 1UCWA 3LPGA 3UGRA 1PYMA 2X16A 3OHIA 3AYSA 3R2GA 1ZL1A 2HISA 4DAIA 3T2PA 4UOZA 3T0BA 4HTYA 4GYFA 2ESCA 2DIEA 1JEZA 1UZHA 2CWXA 4PL1A 3QN3A 2PDIA 1E6XM 1QHZA 4LT9A 4GINA 2QPXA 3LV5A 4WKHA 1MXSA 3CH9A 4O57A 5AY7A 4KCWA 1OB0A 1QXLA 3MW7A 5BOOA 2OYLA 3WD0A 1H1ZA 1FDYA 1TVLA 1KTNA 1LQ0A 3L66A 2QCDB 4HD5A 4W85A 1O60A 1B54A 1LT8A 1E6PA 3NXFA 1P6WA 4IG2B 3MPGA 1MO0A 2ZCGA 3BCFA 3PAJA 1FWGC 4V15A 1RK6A 2AQVA 3M7WA 2P0IA 1BF6A 3GLCA 3QSTA 3MKKA 4MDOA 1TVNA 2OZ3A 1VZWA 2Z4GA 1XDMA 3GR7A 4HU0A 4YMZA 4DXXA 3O1NA 1VYRA 4I9MA 3WQGA 2ZX9A 1A4LA 4HGXA 4GZEA 3GDLA 1LOSA 4E2VA 3C3UA 2NVDA 3NO5A 2WOQA 3GNPA 4LNCA 2PDJA 4CQAA 3FJNA 4LJ3A 1EC7A 1KGWA 3BSHA 4IH3A 3HG4A 3NOYA 3CT2A 5BYWA 2NX3A 2WMJA 3W7RA 4HNUA 3UPMA 1UBSA 2VX7A 4DLMA 4Q8QA 2P8CA 3KUMA 1MDRA 2YA1A 3CZJA 3R10A 3DOPA 1TTPA 4D6IA 2FVLA 3EA3A 3B04A 3FHQA 2G3NA 1U33A 1JCTA 3BMVA 3WF0A 2FDMA 2WYSA 1ISVA 1UKQA 3V0TA 5C2GA 3E49A 1TPFA 4C1NA 2OXNA 4ZO7A 2XN0A 4ZXOA 1KQZA 1YKWA 5E70A 1QOPA 1ZNNA 2OQYA 1XH2A 3H54A 4TVUA 3W6LA 1SW0A 2I56A 3H21A 3SBFA 3LHYA 5AVNA 1U1UA 1JRCA 1Q3NA 4IMEA 2I16A 4FR6A 3GG7A 1W3HA 1GKRA 3EOEA 1BG9A 1XQKA 4GNKB 3NG3A 2BHUA 1TTIA 4KWVA 2NXHA 4XD5A 3CPGA 2ZUSA 4FX7A 1XPGA 1TJ1A 1GONA 3QTPA 2X42A 1GVSA 1P7TA 1F61A 1DE6A 1OK4A 4GVGA 3MVTA 2CLOA 1UZDA 3C2VA 2QJNA 1CGVA 3F2BA 2OCZA 3E0WA 3F5LA 1OGGA 3UCCA 2C79A 3T09A 2IMRA 3W84A 1M6JA 1E3ZA 1RALA 8RUCA 5HNUA 4Q4SA 1Q65A 2WVTA 2PC4A 1PV8A 4HBKA 1TUFA 4L6HA 4LUIA 4HHPA 1FH9A 4H6RA 1W3TA 4AMAA 3BH4A 4RNIA 5FJRA 3WLIA 4B3ZA 5I3HA 2GL5A 3G22A 5CPSA 3JR2A 2IXVA 4H04A 1TJ0A 3S6OA 2ZWYA 3CZGA 3IRSA 5KMYA 5C7VA 1R0MA 4UCFA 3UGVA 1UIPA 1KRMA 3TNBA 1SZNA 2Z1VA 4L61A 1W32A 4S3FA 1M53A 2SFPA 4PB4A 3K1DA 1CEOA 3WJYA 3QYQA 4MY8A 1I6NA 1ADSA 3LRKA 4LS0A 4K2SA 2Y62A 3W07A 2HSAA 1BWLA 3CUGA 5H8MA 4M1BA 2UY4A 2WZMA 3QR3A 4TX6A 1XHGA 4M0XA 3HGOA 3P81A 3T6CA 4EK7A 1XISA 3NCOA 3VYLA 5HJLA 3MDUA 4MZ8A 4CQ9A 1A4MA 2XWDA 4LVBA 4XIAA 1E6ZA 1V3LA 2C14A 4NAEB 5DMMA 3IJ9A 4UNLA 1XLFA 3CV7A 3W7QA 3TH6A 3JRKA 5G2WA 4CU8A 3KWSA 2HJPA 4N4QA 4QM1A 1BAGA 4C6IA 4LB3A 4AIBA 3S9IA 2P88A 4RE4A 4IQDA 4JIRA 1GOKA 1SFSA 3A9IA 3OU8A 4W7UA 3NZQA 4NIRA 4PGLA 1SU5A 5C2XA 1VKFA 4R7JA 1Y5VA 1TZ9A 3HO8A 3W28A 4AD0A 2XVPA 2PCEA 2DIJA 4ATLA 5C70A 1LP6A 2RDXA 4AD4A 4DUWA 4KEUA 3KOYA 4L7ZA 4MY1A 2EPKX 2VCBA 3PJXA 4HNCA 2W61A 3CHCA 4Q8TA 1C9DA 3UPBA 3PB2A 1TPVA 3I6RA 3VUSA 3W7NA 2OX1A 1MXGA 1SW3A 3VCNA 3R0DA 3MYPA 2GQ8A 5DBTA 3ZIZA 3BQ5A 1R6WA 4PTWA 5J5DA 4EAMA 2PDPA 5F2LA 4I7UA 4E5TA 3VE7A 4ROQA 1OHLA 1FCVA 3R94A 4IQJA 3CMFA 1OF8A 3FXGA 4Y9NA 3L4ZA 1S2VA 2WM0A 3AISA 4Q6JA 3MMUA 3VDCA 3GZ3A 3NQVA 1W3IA 1PPIA 3W76A 2PB1A 2V82A 3KBNA 1XR2A 2BP1A 4OZOA 1VBUA 3SDOA 1KXHA 1FTXA 1PIGA 2VC7A 3BDKA 3WQWA 4PTNA 3PWGA 3SCQA 5TBOA 1YTKA 3W7IA 5HR6A 1J12A 5HUOA 6TIMA 4IJCA 3RPMA 2VFFA 2WSYA 4ZOCA 1OFDA 1GTHA 1VRXA 3W22A 3GW0A 3IJ8A 1OZQA 3IJDA 1T40A 3W29A 2CCRA 3CEPA 4HK7A 3F7JA 2QUNA 4B92A 1EFZA 2ZX6A 3PTMA 4MB1A 4EPEC 2ASHA 3PBVA 2PI6A 1OGSA 1KFCA 3G1YA 1NDYA 1UC4A 4AEEA 3WH7A 2TYSA 4BY3A 4YTQA 2I5GA 5AC4A 2IPWA 1DTUA 1SPQA 3KDNA 1VIWA 3OG3A 3GH4A 1ZP4A 4U33A 1JDEA 1RHCA 4V2XA 5H8UA 3HPXA 2HEJA 3S2LA 4AD3A 4ZO8A 1H5VA 2Z00A 5A2AA 2OSYA 5F4WA 4N6EA 1CXLA 2E6DA 1UKPA 3ANVA 1JIBA 3VNZA 4LH8A 3LA4A 3AHZA 2HQAA 3OG2A 5B7YA 3LPOA 3O9NA 2EPNA 3FVDA 3N9SA 1E70M 3NZ1A 4MNJA 3GK0A 3U7VA 3FJLA 3IEBA 4ZA0A 1XV8A 3DN5A 4NILA 3M0HA 1R3SA 1DXEA 1WZAA 1I8JA 3WNPA 1H09A 3PJTA 5BZAA 3AJ7A 4F0LA 1R9YA 1XLCA 1PX4A 4D6JA 4U10A 2GWNA 3EYPA 3WD4A 1W31A 1Y5WA 4KCVA 4MVAA 1EKOA 3N6HA 4EOUA 1NWUA 1GVOA 1XIMA 1FCUA 5CKSA 3A4AA 1QU4A 4P7LA 5DT7A 1NP0A 3B9AA 4U3CA 2PWVA 2WMIA 3KZSA 2I9UA 3G0XA 1H7OA 1Q6FA 3UR8A 1CZ1A 4AAJA 1DXFA 1SM9A 2ZTKA 2XJ7A 1XSIA 1UR2A 3LX9A 3QPEA 1VCVA 2CKRA 3PM6A 1K4HA 4MADA 2FPYA 1F3TA 4MJ2A 2IPFA 5LA1A 3RR4A 1XRSA 3QMRA 1Z44A 4HNTA 4UZUA 1CXKA 3CIXA 4TUFA 4O19A 2GSEA 4RW3A 2ZZ7A 1H41A 2EBNA 1XXXA 3WLOA 4AWTA 4DWDA 1XS2A 1ZJIA 4CCDA 1H11A 4OBSA 1MUMA 3IRDA 3NZGA 3W2JA 1A0EA 3MHFA 1Z8AA 4MY9A 4OQVA 3SUVA 1Q66A 1HO1A 1J11A 6REQB 1E4MM 4W7VA 5J8LA 2W6RA 5D2VA 2FHFA 3DU0A 1R9ZA 3M0KA 1MUWA 1HGWA 3FDGA 3WEOA 1TE1A 3VOGA 3ZR4A 1O94A 4A4AA 4JY8A 3YPIA 3CUIA 5HMSA 2R8WA 4J3WA 1NH6A 3XIMA 3BPWA 1WE5A 2DGAA 3SCOA 5HUPA 2EQDA 2ZXDA 2RUSA 4J27A 4OU1A 1O6IA 3LNMA 1TPC1 5C54A 1CCWB 4P7OA 2R1MA 3OGRA 4PN2A 3A4WA 1S2CA 2OO6A 1NTHA 4ERIA 3TKFA 5G1YA 1KBJA 1T41A 4EF9A 1TFVA 4H8NA 1DIDA 3LENA 2DZUA 3MT1A 1UA7A 3MZ2A 2FGLA 4NI8A 1S5WA 2CLKA 4DJFD 3BTNA 4BF9A 3JS3A 4GO9A 2YXGA 3CMGA 4XBSA 4LGXA 1QDSA 1CT5A 2PTWA 4FR1A 3WQ5A 1FXQA 3BZJA 4EPKA 4HMEA 1YQ2A 2NT0A 3SI9A 1V0MA 1CGXA 3QF0A 1EGZA 4AUBA 3S47A 3NIYA 4H2CA 5A2BA 3EDDA 2O55A 1H1YA 3C52A 2VGGA 1UQZA 3PTDA 2CERA 4B4HA 4W89A 4XZLX 1ZBWA 4V1XA 1P0BA 3B06A 3MKCA 4GVHA 2D2JA 1W3JA 3TOPA 3N11A 4N9EA 4D71A 4KRTA 1VLIA 2P50A 2J7FA 4US5D 1V03A 1KBKA 2ZIDA 4I8DA 2ZUTA 2QCGA 4HP5A 3MJMA 1OADA 1Q6LA 2HS6A 2BVYA 4AXKA 3MP3A 4DX3A 1K8XA 2B31A 2ISVA 3CHEA 4LY4A 3ITVA 2ZOXA 1FWFC 3I3EA 2BOGX 5FACA 3OEXA 4L4MA 3RHGA 3TYBA 4F0SA 1REQA 4DLFA 3CYVA 2QJJA 2WJEA 4WDXA 2B81A 4IFOA 4N6FA 2RGLA 1POKA 4ZR8A 1F2JA 4PCTA 3VIIA 4BZYA 2YYUA 3E5BA 3CPRA 1WXZA 4HSHA 3SY8A 2CW6A 3T7VA 2X1UA 1L8NA 2BX7A 1UZ4A 5I00A 3B8UA 2FKPA 1V0KA 5HOSA 3AXHA 4KBXA 3AU2A 3V5CA 3CZLA 1BPLB 4PSRA 3KRSA 2E4TA 3ZVHB 4WJEA 7XIMA 3CBWA 5I77A 1P6BA 1I0DA 4IXXA 5ENLA 3M64A 3LHUA 3GDBA 2XH2A 5A8GA 1UYQA 2ZZ2A 3KZPA 4HYVA 4CKQA 3PR2A 1ZQ5A 1GQIA 3PTKA 3IUHA 1VRDA 3TX9A 1NF7A 4GJ1A 3MUY1 2FMNA 4M82A 3OQ8A 1TTJA 1GJWA 4B15A 4WDUA 3W9ZA 2VXNA 3E6EA 3B8IA 3CLMA 1H5YA 4GYPA 2E5DA 5DX7A 3T44A 3VCRA 5AC6A 2VO5A 4KCUA 3GX9A 4RJEA 4XG1A 4HNOA 1IXPA 2O4MA 2QDHA 3P14A 1XRFA 2NSXA 2GDUA 2DT1A 2GGHA 2POZA 3OZMA 1SO6A 3QRHA 1RZMA 1M7XA 4F0HA 4B5NA 1SMAA 4AXNA 4CVWA 4PBEA 4GH3A 4JNMA 1XGZA 1NELA 3TYZA 1SGJA 1MW0A 4UTHA 4Q7BA 4JDYA 1UMYA 4QE1A 4PMZA 1B3OA 3LY0A 4X9YA 3WFZA 4W5UA 4WVXA 2HRWA 3ABQA 3BV7A 4R9OA 2WWDA 1TPDA 3W01A 1CGTA 5DN1A 2D0FA 4M6VA 4B3KA 4I7WA 4IGNA 2DORA 3HQNA 4KFPA 5IHSA 1KFBA 1WX0A 1C7SA 1RPXA 1EWEA 3F5JA 3HV9A 2Z7GA 4AF0A 1OSEA 4UFJA 3WD1A 3HGSA 2ACUA 4IFKA 1FCBA 1XRVA 4M6QA 4NZJA 4FB7A 2PP3A 2C1HA 5CPQA 5JH1A 2GUYA 3UXKA 1V3MA 3TN5A 3TN4A 4X9SA 3NQ8A 2CZVA 4HT3A 2EF9A 3MUAA 3MSRA 1BTMA 5I79A 3ITGA 3BLPX 3JZUA 3UESA 4FXSA 1JGMA 2VYOA 3VCCA 3VKKA 3BC9A 3FGCA 1D3GA 1W1IE 5LGXA 2QXWA 1GOOA 4LXFA 1OX5A 3ZFHA 1JI1A 1E0UA 5D4YA 3PBWA 4LFYA 2ZUWA 1F8MA 1RR2A 2XGBA 2NX9A 3M47A 1JUEA 2WV8A 3BICA 1PKNA 1RPKA 2WZTA 3E0VA 4AZGA 3UJEA 3V1PA 4RZ5A 3KOZA 4G7EA 4IIFA 4G7EB 1K4GA 4UTWC 3EOUA 3NO1A 3AS3A 4WGXA 3UG8A 3CV1A 4ZOEA 2PDBA 2XHYA 3VMNA 3W1UA 3DERA 3GQYA 4E8GA 2PU0A