4JFUA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
total genus 163
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jfuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jfuA01
4CN4A 3PZ9A 3D4YA 1VB9A 3CZJA 4B9YA 1ZBVA 1UKSA 1B30A 4H8VA 5CPTA 1SMAA 2YKKA 2WNWA 3VGBA 1V03A 4HOZA 4QLLA 1IZKA 4CU8A 1JZ2A 3ARUA 1J11A 1NP0A 1ISVA 4ZXOA 4W87A 3WMSA 3AMCA 4W5UA 1E70M 3CZNA 4GPNA 3BAWA 4TVCA 4GQRA 1PBGA 3OG2A 3HG2A 3SCOA 2OYLA 3PZIA 1UD3A 3LPOA 3KZSA 2WPGA 1I1XA 2VZTA 4WJXA 3MMDA 4OGZA 5TD4A 1TA3A 3WNNA 3UETA 4UNIA 4GI6A 3B9EA 2UY3A 3POHA 3HN3A 3RIKA 4ML4A 1K9FA 3WY2A 2CETA 4YPJA 1JYWA 1UH4A 1ESWA 1K9EA 1HJXA 1GORA 1B31A 4EE9A 1B9ZA 4DO4A 4NZJA 1HP4A 2PWFA 3TV8A 2F18A 5DEZA 5D8ZA 1S46A 4ACYA 1UH2A 1CIUA 1D7FA 1BHGA 3S2CA 4KRTA 4IPNB 1RPKA 3AS1A 1HN1A 3AXXA 1BQCA 4WKHA 1GVYA 2OW7A 1ZJBA 1UD8A 2OWWA 3BUQA 1XCXA 4JIEA 4B16A 3WMBA 4PMVA 1KXQA 3WNPA 5A94A 3LMYA 3WNMA 2JIEA 3K8MA 3WNKA 3W38A 3L4WA 3FNDA 1WZLA 1OB0A 1HNYA 3BUBA 2PBOA 1H2JA 2J7GA 2V5CA 5A69A 2JEPA 1XGZA 3WF1A 3O6AA 3CZKA 3T2PA 3W6MA 2J7EA 2Y24A 4W89A 2XVPA 1OWQA 3BVVA 1X1NA 2WMGA 3CC1A 2VUYA 2WSPA 4BQ4A 4D6JA 5CSUA 1V0NA 1V3MA 4UTFA 1AMYA 4PTVA 3W0KA 1ZB5A 2XGBA 2XPKA 3W24A 3BLKA 3KL3A 1MWOA 1U30A 4P8WA 1CGWA 2VOTA 4HMDA 4H8UA 4P7RA 1HJUA 3ALGA 2WANA 1W1TA 3VMOA 4U2ZA 2W4XA 3APGA 3UESA 1N82A 1V6VA 3AHZA 3L4ZA 1JGIA 2O9TA 5IHRA 3VMNA 2WBGA 2BNJA 1R46A 3VPLA 4PSRA 4D71A 1J0YA 3DX2A 4PMUA 5CQ1A 4AD1A 2WHJA 2C8NA 4W7WA 4AIOA 3GH5A 3T2QA 3GZAA 1UD2A 3VKKA 2OYKA 3SCQA 3AIWA 2VVSA 3MMUA 5CXPA 2W91A 4EAMA 4ZE5A 2J62A 3T09A 1H41A 4W85A 4F9JA 2ZX5A 4AZ5A 4HMCA 3WUGA 1LJYA 3W6LA 3EJSA 7TAAA 4BA0A 4JCLA 3WQ6A 3FHAA 3OLIA 5BYWA 3ARTA 2XVKA 3CUHA 1IZJA 1E55A 1NH6A 4YN5A 2BHYA 3ZM8A 3IANA 5LA2A 3AHXA 5HXMA 3IJ7A 1KTCA 3BSHA 1EQPA 4PSPA 4OBSA 4LX4A 3F4VA 1DEDA 4JAWA 5AC4A 4PMRA 1UWTA 3RJYA 3WQ4A 5CLTA 1UOKA 2WMIA 1CLXA 3PZOA 5JBEA 4JFVA 3AIVA 3AIRA 2OW6A 2GVYA 4XUYA 1QOXA 2FE0A 1CBGA 2F1AA 3UG5A 1GVIA 3AS0A 1G9HA 2XHYA 2VL4A 5D9PA 4FNSA 1R7OA 4QP0A 3ZSSA 4HZ7A 2WW5A 1JYNA 2WB5A 7CGTA 4DWSA 2ZX6A 5JIWA 4AZCA 5LYRA 1UD4A 1E6RA 1W3LA 3MO4A 5E6YA 3VU2A 1C90A 2NW0A 3CZSA 1Q6FA 6CGTA 3OGVA 3WD2A 4TUFA 2NT0A 3GM8A 4HOWA 3MUIA 2X05A 1B1YA 3JUGA 4ATLA 2BY2A 1PJ9A 1E5JA 2D0FA 1EIBA 1LG2A 2V3DA 3TA9A 1GONA 4HTYA 2FDMA 2ZOXA 1C7SA 2VURA 4GO9A 3MU7A 3EJTA 1M04A 1CGUA 4N0RA 4NX0A 1MYRA 4J3VA 1C93A 4V28A 3BC9A 2E3ZA 4KH2A 5M03A 3CUFA 2ZUTA 4RE3A 1B90A 2X2HA 2CHNA 1VAHA 1CWYA 1TR1A 3GH7A 4X0NA 5F7UA 2A3AA 3NIYA 5ABFA 3GXTA 4UOZA 2X8RA 4MAZA 3ZOAA 2G41A 4TVDA 1E73M 2J8FA 5D8WA 5FL1A 4CVWA 1TQUA 1FOBA 2EPNA 1ITXA 4C7FA 5JIPA 1DHKA 3N15A 1AQHA 4QLKA 3BVUA 2WMJA 4CD7A 3NSNA 2D23A 4MB4A 4D1JA 8A3HA 5JBDA 3RILA 3K4DA 3TTSA 2QMJA 4DO6A 1E6SM 3OLEA 1EDTA 1WDRA 2BHUA 4CGTA 3PZTA 5I78A 3WD3A 1G0CA 1V0LA 2FH8A 2ZUWA 3CBWA 1B3XA 2F7OA 2CPUA 1UA3A 1TQSA 3NDZA 2YLLA 1WAWA 3VD3A 3WY1A 1GOWA 1V02A 4ACZA 1EOMA 1M7XA 3TP4A 3AROA 4P7NA 3MSDA 3AJ7A 5HPCA 1HP5A 1OT2A 5DFAA 4WLCA 3MV11 2CEQA 4NXKA 3WD4A 3AS2A 1E15A 5A6BA 1QBAA 4AEEA 2VQUA 3HU7A 3NYDA 5ABEA 1UZ1A 2EBNA 1GQIA 2WMIB 5JBFA 1JI1A 4D72A 1JXKA 4D6FA 4P7OA 2BVTA 3RPMA 5D9OA 3WH5A 1VJZA 1HJWA 3WFLA 5BCAA 8CGTA 3S6TA 4M82A 2NT1A 4W8AA 2VTFA 4HA1A 2XVLA 5E6ZA 1QBBA 3VOCA 1UKPA 3BAKA 4CKQA 1VFOA 3BH4A 1L8NA 2CERA 4W7VA 2VRKA 3AHYA 1CTNA 2YJQA 3DDFA 3ZJ7A 2VZSA 3AHVA 2YIHA 2XFFA 4XX6A 4MB1A 4UQBA 2VCCA 4UFIA 4PMOA 1E40A 4MB3A 4ATDA 4GKLA 1ZS2A 2DSUA 3ZJ6A 4NRRA 1HVXA 4P8VA 4HPHA 4B3LA 1CYGA 1OIFA 4CD5A 4E8CA 5A8MA 1V0MA 5E9AA 1B2YA 1BYCA 1E3ZA 2QLYA 2WKLA 2YLAA 1E1EA 3PBGA 4J3TA 3CH9A 1PIFA 3ZT6A 1O7DC 2X09A 1QHPA 2B31A 4KGLA 4HZ6A 1EO5A 3U7VA 1X6NA 3FY1A 3MUY1 2XG9A 2WK2A 4QLJA 1ODZA 3T08A 2VVNA 3H53A 1B0IA 1M53A 4TX8A 4FLRA 1JF6A 1LWJA 3SCRA 1V3LA 3CZGA 1UQZA 2D0HA 5I79A 3DX3A 1NWTA 1UR4A 3DYOA 3WDJA 4CN6A 3MUZ1 3CTTA 5HDRA 5E09A 1TFVA 3A21A 5AYIA 1UR2A 3M07A 4W93A 1OM0A 1BG4A 1VRXA 1WP6A 2WM0A 4EANA 2VMFA 5A6BD 3GH4A 2VR4A 4XZBA 2WWCA 3UG3A 5ECUA 3RJXA 3WEOA 3VM7A 1C3FA 2AOSA 1MXGA 2EQDA 2VT0A 3L4TA 1JYXA 4EK7A 4U2YA 1G94A 3W4RA 4PTXA 3BUPA 1TVNA 1WDPA 3THDA 3WF4A 3CUIA 1JFXA 3I3EA 4UCFA 1UR0A 3CUJA 1U2YA 1CXEA 1Q6CA 4CVUA 1L0PA 3WEZA 3UEQA 2D0GA 4H41A 2W62A 1FFRA 3AI0A 1NARA 4U3AA 1R34A 2NSXA 4BCEA 4CCCA 2J78A 4BQ5A 2J7HA 4FLOA 1E4IA 2Y2WA 3QOKA 4FK9A 1F4AA 1BF2A 2JIWA 1DWGM 1LQ0A 1E3XA 3EDKA 3WDRA 3BXWA 3EDFA 3U7BA 1DWAM 1R7AA 3N17A 1NQ6A 1SYTA 3WDHA 2D22A 3LXCA 4V27A 1J01A 4AZBA 3UR7A 2VX7A 1WE5A 1NOFA 2BY3A 4LPCA 1GQJA 3VINA 2CBIA 1W2VA 3L4UA 4GIAA 1UH3A 4FLQA 1OCQA 4OOZA 1KR1A 1QI3A 3CGTA 2VI0A 3AICA 3EYPA 1QVBA 3AYRA 3MSGA 4AZCB 3WDQA 4W84A 3HZ3A 3DECA 2XM1A 4KMQA 3L4YA 1KGWA 5A6AA 4HZ8A 2PBGA 1IT0A 3GBEA 2ZUVA 4UFHA 5CJ5A 5BROA 1V3IA 4GI9A 3AXIA 2XTKA 1O7AA 1W3JA 3WH9A 1EDGA 2UY2A 3KE0A 3WELA 2WCGA 4J3UA 3B9AA 1V02E 1WO2A 2F8QA 4H2CA 2XVNA 3CMJA 3WFZA 3F5JA 2WVVA 1I75A 3WN6A 2FYVA 1KQYA 4X0VA 2HVMA 3WQ8A 3AOFA 1SR0A 4AEFA 4Z2GA 1QHOA 1HF6A 3OBAA 2ZE0A 2E8ZA 3WY3A 4QFUA 1R8LA 4WF7A 2G3NA 2C7FA 2GK1B 1KBKA 4B3KA 4AYGA 3VMPA 1OD0A 3K8KA 2GDVA 4GZEA 3CUGA 2QPUA 4RE4A 3BSGA 3I3DA 3VX0A 4AZGA 4C7DA 4IUGA 1WPCA 5CGTA 3ZQ9A 3HG4A 4B15A 3WUBA 5BRPA 2BVDA 2JE8A 1W9UA 5I23A 1RH9A 2O92A 2E9MA 1HJVA 1EDQA 2V3GA 1CXHA 3VIOA 1RP8A 2V38A 3AZSA 3A3HA 5A8OA 1E4NA 2DT2A 5IXEA 2FGZA 3N1AA 1EHAA 1PZ3A 5A8NA 1KTBA 4ZFMA 1JG9A 1NWUA 2O9PA 2D73A 3W53A 3SCWA 1HVQA 3N9KA 3T0BA 4QDMA 3KLKA 3FAWA 5E1QA 3F5LA 5D9NA 2DH2A 3II1A 4NI3A 2WBKA 4D6GA 1V3HA 4DO5A 1P6WA 1MW2A 2OLHA 3VTRA 5DMYA 1R47A 1TQWA 3EMZA 1V6XA 3GNRA 3KEHA 1W9DM 4AYSA 4LYRA 1ISWA 1E6ZA 4PBGA 1ZJAA 4MDPA 3FW6A 3OA5A 3WL0A 1WDQA 2CKSA 1US2A 4MJ4A 5GNXA 1VFFA 3ALFA 3D52A 3VD5A 2VRQA 4CCDA 4PMQA 2Z1SA 9CGTA 2O9RA 3SCUA 4HA3A 3WY4A 1E56A 1GNXA 1VIWA 1FFQA 1CNVA 3W37A 3WF3A 4JHOA 1GQLA 1C7TA 1UWSA 1GOKA 2VX4A 5D4YA 4OKDA 3PZNA 1J0ZA 2EO7A 1JDAA 1XSIA 3WIJA 1TCMA 3OZPA 3K1DA 2IXUA 1QPKA 2Z1KA 6TAAA 1JXJA 4DUVA 1RP9A 3BVXA 1DWFM 2ESCA 1E72M 1V08A 1UA7A 1Q6DA 1UZ4A 4ZENA 1DP0A 4GZIA 2F2HA 4E4PA 1WZAA 4HMEA 3IJ8A 1BGAA 1QNSA 2W66A 3CHCA 1GW1A 3QHOA 1G5AA 3T0AA 4UFJA 4AMWA 3ARYA 2XIBA 1V6WA 1EHNA 2BXYA 3IAPA 2J7FA 4IPLA 2F7PA 3VGFA 3GNOA 3VIFA 3UCQA 4LGXA 4JKLA 3AMLA 5ABGA 2ZUSA 1ISZA 3TTQA 1DWJM 3EDDA 5A8QA 1XSKA 1HKIA 1J18A 2E9BA 4MNKA 1ITCA 2FGLA 1CENA 2JF7A 2VO5A 3PZVA 2A3HA 2PWHA 4AMCA 4AZ7A 1SZNA 3A22A 1HKJA 1OBAA 1UHVA 4NRSA 3WENA 3W82A 4S3JA 4L4OA 1BG9A 3W29A 3PHAA 5A6SA 1KCKA 4GZJA 2W67A 1M03A 3AS3A 2XIIA 3M46A 4TXEA 1EGZA 2ZUMA 5FOOA 3LRLA 1UWUA 4JFUA 1V0KA 1UR8A 1HKKA 1UASA 3HMCA 3OZOA 2YFNA 2EJ1A 4OOUA 3PZQA 4M24A 1Q4NX 1EOKA 1VBUA 2V3EA 1R86A 4WIWA 1PX4A 4DUWA 3THCA 4OZOA 5IDIA 3MV01 3BAYA 4Z2IA 1MW1A 3A5VA 5EFDA 5I6SA 2G3IA 4D6EA 1W2PA 4MNMA 1R33A 2J47A 1A47A 4J27A 2CCRA 3W28A 5FD0A 2WMKA 3CLWA 2DSWA 1J12A 3D4ZA 1UWIA 2WC4A 5ABHA 2VR5A 3UG4A 3AIEA 1BTCA 1WZKA 1ZBCA 2VZVA 1XSJA 2Y4SA 1JDDA 2JEQA 1KXHA 1VENA 1KB3A 3O2LA 4GXPA 1V3JA 2FH6A 1H3GA 3A23A 3WL1A 1GOMA 4UZSA 4CCEA 1JZ8A 3OLDA 1QI0A 3N18A 4FNRA 1TUXA 4A3HA 1MW3A 3AHTA 4HP5A 4UQAA 3NUKA 3VVGA 5BWFA 1W9VA 2YBUA 4XB3A 2Q8XA 2YL8A 4YHGA 5CSYA 4GQQA 1H1NA 3N12A 4JFSA 1LL4A 3SUUA 4J7RA 3AMKA 5HNNA 2WCSA 1XD0A 2DH3A 1JD9A 3VIKA 5A1AA 2PB1A 1NOUA 5M17A 5AC5A 3GYCA 3TTOA 2EADA 2PWDA 5C70A 3VSUA 2D2OA 3VGHA 1XH2A 1FH9A 2EABA 2J7CA 2EXOA 4UOJA 1Q6GA 3KL0A 2DIJA 1C92A 3OLGA 4CD8A 3L2MA 2CESA 2WMHA 3MUAA 2ZUNA 5A2BA 4Q7NA 2HISA 2BV9A 3LRMA 3AMGA 1MVYA 4MTVA 4CD4A 3VIHA 2CBUA 1WCGA 4A3YA 1JNEA 1HL8A 3GXDA 5GPRA 1H0IA 2WVSA 2CYGA 3MKKA 4W88A 2XUCA 5CGMA 3QHNA 1VEMA 5FIPA 1HTYA 2D20A 1B3VA 2WSKA 4N42A 2F7RA 3L4XA 1W9PA 3SUVA 5LA1A 5EMYA 3MS8A 3WD0A 3OGSA 2VCBA 3NSXA 2OSXA 4AW7A 2TAAA 4JL1A 3BGAA 3SCSA 5I24A 4GO8A 4U33A 2CKRA 3POCA 2XM2A 4AMXA 2PWGA 4FMVA 2DIEA 1JZ3A 1E6QM 1MXDA 4GI8A 2DGAA 3AIQA 2BVYA 1JFHA 4BQ3A 2CBVA 2J7DA 4J28A 3MANA 1KWKA 1PX8A 3F5KA 5M3WA 1VFUA 4B9ZA 4K68A 4MAVA 4AXNA 3ARZA 3LPPA 3SUSA 4HU8A 3VSTA 1JAEA 1ZBWA 3CHEA 2CNCA 1UR1A 1J0JA 3WMCA 3ZJ8A 4J3SA 1US3A 4JL2A 3AIUA 4Z2KA 1E5NA 5EB8A 4D6IA 2GJXA 5I3DA 2VX5A 3QR3A 5CZKA 1BAGA 3U5UA 3CZLA 1C8XA 1AQ0A 4OUEA 1QW9A 4HOXA 4LXFA 4PMXA 4J3WA 4CU6A 1CGTA 3ZMRA 2BFGA 2XFRA 3ZT7A 2J74A 2IUZA 4MADA 5BXTA 1PEZA 2PC8A 4FNUA 2XN2A 2BY1A 4AY1A 1QNRA 2DT3A 4U5KA 1J10A 1LWHA 3ARRA 3NCOA 3LX9A 1VJSA 3RM4A 4FNPA 4NF7A 2J7BA 2VRJA 3BCFA 2ZX9A 1GOQA 2WVVB 3PTKA 4E8DA 4XV0A 4A4AA 1CGVA 3OGRA 1MQPA 3AZTA 1ISYA 3SCPA 1KWGA 4NZFA 1UR9A 1VFMA 3WNLA 1E4MM 2VZUA 1K9TA 2VCAA 2J77A 1XD1A 1HWWA 1V3KA 3CZEA 2GJXB 2GK1A 1QI4A 3WUEA 2VZOA 3OB8A 3HG5A 3PTMA 1TMQA 1JI2A 2AMGA 4M29A 2O9OA 3D5HA 3TONA 2WHMA 3N11A 5A6LA 5KEZA 1JZ5A 3A24A 3D3AA 3T0DA 2D1ZA 3U5YA 2IXVA 4PMDA 4W86A 4UQCA 2WLZA 4AZ6A 1G01A 3SUWA 3VIJA 4D6CA 5CG0A 1JIBA 5A2CA 1T0OA 3GXFA 1CGXA 4LQ1A 1E71M 1BGGA 4HPGA 5E0CA 2XYLA 1E6NA 5IHSA 3LRKA 1JZ6A 3MI6A 3VIMA 4UR9A 1UKTA 3BAJA 4PMNA 1E0WA 5I5RA 3VDHA 4TTUA 1GOIA 3WF0A 3KL5A 4CU7A 2GUYA 1GQKA 3DX1A 1QNOA 5A3HA 1JZ4A 2F61A 1J0IA 1R85A 3WDPP 1PX3A 3ZR5A 1V6UA 4Q22A 2WLYA 1EXPA 4MDOA 4L4PA 2MANA 3SCTA 3VILA 3WKZA 3ZO9A 3AMDA 3S5YA 3TTYA 2BS9A 1OIMA 4M81A 1SFSA 3D51A 3H55A 5BRQA 1CXLA 4QCEA 3RCNA 4OJYA 4MJ2A 1W9XA 1NWSA 1WKYA 4LYPA 2QHAA 4AD3A 2XWEA 3K8LA 1KR0A 3ARXA 4LYQA 2BY0A 2IGTA 2E4TA 1XC6A 3VM5A 4PCTA 2YDSA 3M6DA 1VF8A 4KWUA 3BLBA 1GCYA 3ECQA 2DT0A 4PRWA 1BVNP 2FHCA 1MQRA 3HJEA 2ZX7A 1MW0A 3VIGA 2QMKA 5A6KA 1C91A 4PTMA 3L4VA 2RGLA 3W26A 1JD7A 3VD7A 2WXDM 2ZWYA 1M01A 3EDEA 1EQCA 1BYBA 2X2YA 3CV5A 5BXSA 1UG6A 1BVZA 2YOCA 1W32A 3K46A 4WSKA 3FN9A 3ARWA 2YL9A 3BVTA 1TG7A 1TZ7A 4P8UA 5AYBA 3W25A 1HXKA 3SIMA 1CDGA 2QV4A 2E9LA 4JHZA 4IISA 1CXKA 2WYSA 3VGEA 3DC0A 4W8BA 1KQZA 1LG1A 1B3WA 3IGUA 4P8XA 2GJPA 4PUEA 1JNDA 1E0VA 5HBFA 1QNPA 3WNOA 3ZR6A 4ATWA 1UKOA 2G4FA 1HL9A 1Z32X 2PI6A 3DDGA 3N04A 3BVWA 3I3BA 4PCSA 2ZICA 1W1PA 4AZHA 5GNZA 2WVUA 1IV8A 3GBDA 3A4WA 3VD4A 2C0HA 3EMQA 4ZEPA 3GXMA 4NXSA 1WNOA 3O9NA 2Y8KA 4PUDA 2E8YA 4AIUA 1Y7VA 1FP8A 2DSZA 4AD5A 4JKMA 4RE2A 1CLVA 4JKKA 4M80A 4M56A 4BF7A 2W63A 5I0DA 2PWEA 4UFMA 4AZIA 3SCNA 4UFKA 4W5ZA 3VIIA 4PN2A 4HA4A 1TQTA 4PMYA 5FCZA 4U3CA 3A6OA 3WQWA 1JAKA 1FP9A 4X9YA 3IJ9A 1AQMA 5DF0A 2ZXBA 3ZT5A 3WH7A 2YFOA 1MQQA 3BUDA 1F4HA 3GDBA 3TOPA 3VUPA 3ZJKA 3VX1A 1J0HA 1ISXA 3DYMA 1HT6A 2ZXQA 3PZMA 5C8BB 1KFWA 3KLLA 2Y8VA 3WBEA 5E70A 1E1FA 3GNPA 1WZMA 5A6JA 1XRVA 1CPUA 3ARVA 3PZGA 5A8PA 3B8SA 4PTWA 4F9DA 3NSMA 5BXRA 3K4AA 3VD9A 3AQUA 3BAXA 1E4LA 3VGGA 1FH8A 1FHDA 3CZ8A 5I2UA 4R27A 4KRUA 5D9MA 1R87A 1E0XA 4UQEA 3GTNA 2GFTA 1DWIM 4AWEA 3B9DA 1K9DA 2J75A 5FKYA 3PN8A 4DM2A 1OT1A 1OSEA 1HJSA 1J0KA 2GDUA 2E0PA 1KXTA 1U33A 1LL7A 5E0FA 1R75A 3VSVA 5FL0A 1W1VA 2ZIDA 4M8UA 2JALA 3H54A 1TQVA 3CO4A 3SEPA 3CHFA 3VDCA 3SCVA 3BLPX 2QF8A 1KGXA 3VNZA 3LPFA 4IM4A 2OWCA 3RM8A 2PF0A 3AYSA 4BS0A 4Y7EA 3EDJA 1G1YA 2WVTA 5IFTA 3RDKA 1W3HA 1NWRA 2WC7A 3HG3A 3PZUA 4S3KA 2Y5EA 2D24A 2CHOA 1B3YA 2ZXAA 3WBAA 2QPSA 3BCDA 3VDBA 1C8YA 2VX6A 1O6IA 4JFWA 1CGYA 1H49A 2J25A 3BUIA 1MFVA 1QI5A 4CN1A 3N13A 2OSYA 1ODUA 1JZ7A 5CPQA 3QGVA 1CZ1A 1CXFA 3ARPA 1KCLA 4Z2LA 1HKMA 1GHSA 2J8GA 5LA0A 1FHLA 1XCWA 5GQBA 1BLIA 3L2LA 2A3BA 1W91A 4MB5A 1UD6A 1UWQA 4NZCA 2G3JA 3EBVA 2CBJA 2RGMA 1PPIA 2V3FA 4JCMA 1W3KA 2DDXA 4D1IA 1ECEA 5A2AA 2EACA 3CIVA 1WDSA 1UUQA 2F1BA 3ARQA 3LXAA 1CXIA 1OD8A 5DT7A 4WSJA 4TOQA 4ZE4A 2WZIA 2X2JA 2X2IA 2WC3A 2YDQA 1ZBKA 4F66A 2WHKA 4F8XA 2G8ZA 3WUFA 3AIBA 1DTUA 2YL5A 1VEOA 3S5ZA 2A3EA 4PEEA 1B3ZA 1PAMA 1E9LA 2EPOA 2D3LA 5EFFA 3FAXA 2D3NA 5CLWA 4AD4A 4UOQA 2YBTA 4R5EA 3NJ3A 1QI2A 2OSWA 4OBRA 1OGSA 2ZX8A 2XFYA 1JYVA 3GXIA 1JDCA 2FHBA 4FLSA 1JF5A 4ACZB 2F7QA 3RO8A 3D50A 3PTQA 1QWNA 3FXYA 1QW8A 5AY7A 3IK2A 3RMEA 2E40A 1XH0A 3CMGA 3VDAA 1UKQA 2EPLX 1EO7A 2W5FA 4MNLA 2EPKX 5M5DA 1GJUA 4TTGA 2YA0A 1LF1A 4D6DA 3WEMA 4E2OA 1VBRA 4DWSD 2X0YA 4M1RA 3GXPA 2WAGA 4FNQA 1QWUA 5KZ6A 4W7UA 2DT1A 2JF6A 4DM1A 1UYQA 1BYAA 3AFBA 4AD0A 3BMVA 3EJPA 3G6MA 4U31A 5C71A 2VNCA 2JFEX 1GZJA 2YDRA 4U5IA 2X1IA 1PS3A 2OYMA 1NOWA 1YQ2A 1PZ2A 3J7HA 1XH1A 3ZSTA 1XYFA 2BHZA 3WD1A 1ZL1A 5EBAA 3BAIA 3W81A 4Z2JA 2W61A 3WH8A 2XSAA 2XVGA 3CPUA 3WQVA 3UR8A 5BXPA 1RD6A 4PYSA 1E43A 3VIPA 4BQ2A 5JUVA 5A6MA 2BXZA 4XZWA 4P7LA 3WF2A 3AZRA 3MMWA 1QX1A 1NP2A 1ZU8A 3ZIZA 1OGGA 1CEOA 4D6HA 3G6LA 4RL3A 1XYZA 2AAAA 2DEPA 3NDYA 1WB0A 4WKAA 4H04A 2WZEA 4ZXLA 4AC1X 2V5DA 1SMDA 1I1WA 2XN1A 2EEXA 1FH7A 3DHPA 4TVUA 4H8HA 2WHLA 2VQTA 3LPGA 5HPOA 2EPMX 2XN0A 4J3XA 2UY4A 4V2XA 6A3HA 2J79A 2YA1A 1Q6EA 3EMCA 1X6LA 4URIA 4W8LA 1W9BM 1QHZA 1GHRA 1H09A 2WZHA 1BPLB 1TVPA 1YHTA 2WCAA 4UQ9A 1JL8A 4HU0A 2X0HA 4UFLA 3DX0A 1HX0A 1GPFA 3WDIA 3BMWA 1KGUA 1TA3B 5CPSA 1KXVA 1PIGA 3VNYA 3DHUA 2ZXDA 5HOSA 3OIHA 4OIFA 5DO8A 4TX6A 5IFPA 4BZYA 3EJRA 1J9YA 2WWDA 2FHFA 1D3CA 4QAWA 2VC9A 1BYDA 4DUXA 2UY5A 1NM9A 4AIEA 1GJWA 3EJUA 5I77A 4PMZA 4JFTA 2CITA 1E6XM 5DT5A 1KBBA 4KGJA 3U57A 4GINA 4DWSB 3KWXA 3UERA 1AVAA 1A3HA 1H11A 4MPKA 4P7QA 2UWFA 5A95A 4F79A 1BFNA 1UQYA 4Z2HA 2WMFA 2DQXA 2EAEA 2CXGA 2ALWA 4UZUA 3T2OA 1W1YA 3LXBA 2XSBA 3ARSA 2GSJA 4UQDA 4DWSC 2A3CA 3FHQA 3E1F1 7A3HA 3WH6A 2G3MA 2ZWZA 4NSBA 4WKFA 2XJ7A 4H7VA 1GUVA 5GNYA 4MNJA 1E6PA 3A47A 3W27A 3A4AA 4FNTA 1LL6A 2DPEA 2J4GA 3GXNA 1LLOA 2DSKA 2ZUUA 3AXHA 3WSUA 2VJXA 3DX4A 1XHGA 2XWDA 1UD5A 1QNQA 4C7GA 3QHMA 3RM9A 3DYPA 1V6YA 3WQ5A 4AD2A 1DWHM 1EA9C 1VEPA 3CHDA 1H0GA 4QCFA 4WK9A 4AISA 2XGIA 1MFUA 4EKJA 5ABFB 2YA2A 1BSIA 1H5VA 1CECA 1EH9A 1XV8A 1HIZA 1GOOA 1FA2A 2DSVA 3VGDA 1UWRA 4CUCA 4JZ5A 1OGBA 1OINA 2GJRA 1C8QA 1TE1A 3AISA 1D2KA 3A4XA 4CD6A 2CIPA 3EJQA 2OWXA 3SUTA 2W92A 3M7SA 2YL6A 1HXJA 2WKGA 3VO0A 1HJQA 1K6AA 3IAQA 4YHEA 3SURA 4FF5A 1H4PA 3QOMA
chains in the Genus database with same CATH superfamily
3RVVD 1FL5A 2Z00A 4CN4A 4NENA 2ZAHA 4S2BA 1SPDA 2Q6WA 1T7YA 5E4IA 1PKYA 1NCBL 2AK4D 3TBVB 2NX9A 3E0VA 1FY6A 4X9IA 4KETA 2AGJH 3EYOA 3MV8A 3LNHA 5AZEH 3RQ3A 4PGBA 2G2RB 3H21A 4H8VA 1EEYB 3PY9A 3KLQA 3LOTA 3ERPA 1Q5MA 2P47B 1XGQB 4O12A 3LGDA 3TBTB 1PZ1A 1CE1L 2I56A 3QDJA 2WNQA 4BWLA 2YPLE 2GSMB 4JM2A 1RFDL 4PP1C 1QLRA 4U1SB 4LLQB 4UM9B 1ISVA 1TPVA 4W87A 3ALPA 4TVPL 4JZNA 1YNYA 2PXYB 5E2WH 4XWGH 4G7YL 3K5XA 1CLOH 1XRTA 2EH8L 2VFEA 1M7OA 4GPNA 12E8L 3BAWA 3MUGA 4G1MA 1A4BA 4TVCA 3ABKB 3BUTA 2YPKB 2UXFA 3HTWA 1AXTL 2YGVA 3B2VL 4PVLA 3KWWA 1PBGA 3PP7A 4PMFA 3KRSA 3W2UA 1ITBB 2A4ZA 4K8RH 1ENUA 2IIJA 5FJOA 1I1XA 2WXPA 4JKNA 3FKRA 3MU3A 3TCXA 4LWWA 1HHJA 3QUZB 2D9CA 5FYLL 4DIAA 1VESA 1FKXA 4JG1L 4P3CH 4NHCH 1KBPA 1EJFA 2HMCA 3UETA 4UNIA 1W3IA 3FH5A 2ZQ0A 3B9EA 4LLWA 4JG9A 5CC6A 2R1WA 5BV7L 3AXMA 3TCLB 1AGCA 4KESA 4HZAA 4YFEA 3OVGA 4YPJA 3W7CA 3QQ4A 1MI5E 4HJ0C 1HJXA 5FHBH 3KDMA 3JWOC 2EE6A 4NZJA 4Q8TA 1U8MB 4UMBA 5EU6D 2ADAA 3RIAK 1KCRH 1TV8A 1CFNA 2DW6A 3TV8A 3WS6A 3UXIA 3BE7A 3QZWA 4HJ1A 3FQNB 5F8QC 3B8YA 5D8ZA 3IJYA 4EN3D 3ZX1A 2NY2C 3NIGF 1CIUA 1D7FA 3CCHA 3IDMB 1HO4A 1U1JA 3UF9A 4XVTL 4IPNB 4TQ8A 2UXVA 4NUMA 3PV6B 3HPAA 4M48L 4LSTH 3RWIA 2X4PA 2GJNA 3DAQA 5IB2B 1JZGA 4JQIA 5DRXB 3MLVL 4WI0A 1GVYA 3KG5A 5DT1L 5JPNB 1ZJBA 2DLFH 4JIEA 4RMBA 4BEUA 4LDCA 4JY5H 5AW9B 4F93B 1KXQA 4HPOH 1TV4A 2NCEA 1XUZA 3ZVHB 2VD8A 1PZUB 5CU9A 1R3IH 3TW9A 5BV7B 3LMYA 1F58L 5A16A 1CURA 2WQAA 1X7SA 4KFZC 2NNFA 1SO3A 2ED8A 2YD4A 4RIRA 4YHZH 5FA4B 2ITEA 3F7YA 3K8MA 1TITA 4I9WD 4BUQA 4OZIA 3LGGA 2YAPA 4UBPC 3DVGA 2BSBA 2MIZA 1HNYA 1INDL 2PBOA 5T1KD 1A6WL 5B3JF 4ZYKA 4G8GE 3VOGA 1H2JA 2ESVD 2QCDB 3NJFA 3UYPA 1RIVL 5FYJL 3EYFA 4RAVA 2V5CA 3LS5L 3ZYOA 4KITB 4ZCWA 1EJ6A 1XGZA 4U28A 3WF1A 5EU5A 3CZKA 4J6RL 1AZBA 4W9KC 3UYOD 2E4FA 2PR4L 3W6MA 5E8NB 4W9CC 3P93A 2EVHA 4R7WA 3BVVA 3W7IA 2VSDA 3B9KB 3CVDA 4HUVB 1VFHA 2VUYA 4EWND 1TTFA 4EACA 2KLSA 2WSPA 1YPZB 4O53A 1X9RA 4D9QD 1V0NA 4Z3HA 2BGQA 3GMLB 3LKSA 1AMYA 4PTVA 1EFXB 4E42B 2VFHA 3S9YA 1V5JA 3DMMD 2P48B 1V8EA 4DK6A 3NIGE 4LPYA 2X9YA 1W3TA 3ILPB 2QDWA 2XGBA 1ZT7A 4R0LC 3VUAA 1ZTXH 1AGBB 1A7RL 2DPKA 3KL3A 3H7RA 3VABA 3OG6B 3EGXB 5E2VL 5E8OB 3BQ6A 3E5BA 4P8WA 1AMXA 2IEPA 4HMDA 3D2UD 1KLUA 1QP1A 4H8UA 3TVMB 2FVNA 3VXTA 2PDPA 2CDEA 3X1EA 2AW2A 3OM3B 1FWWA 2UBPC 3CN1A 4GAAA 5A3ID 3H22A 2P42B 3D0VB 2GIMA 4JFZL 4U6YA 1DLFH 4BUHA 1MFAH 4JFHE 4H01A 3RLHA 3BPLC 7ENLA 3FQRA 5JOPD 5EYWA 1J87A 2HP4A 5DD6A 3PANA 1S1PA 4DLMA 1NDTA 2O9TA 2W94A 5IHRA 4HAGA 4Q7DA 1GVRA 3GO2A 3OKNB 3EO9L 1LE5A 2BNJA 2WSYA 2B1HH 2PLTA 4PSRA 1WFMA 1RJZB 4N6RB 4K38A 3W0WA 1YW1A 4GJ1A 1YADA 1E5AA 2X1UA 5KVDE 1BLNB 5HHXH 2WHJA 3B40A 1JWMB 1KNOB 1F6AB 2UZYB 4P4RB 1OGTA 3MJ9A 1U83A 1IU1A 3GH5A 2XWJA 2BSED 3OPSA 4FQJH 5CMAA 5IHZA 3PY2A 4WV1B 1K02A 3EGJA 2XV0A 1H5BA 3RVUD 2VVSA 5AOJA 3QIUC 1FF5A 4GVIA 1P4LB 3QZNA 3SJ3A 3ABOA 3IGFA 2GY5A 5GJSL 3NQ8A 5DRNA 2J62A 4UU9B 2F53B 4PVBA 4ZE5A 4FFTA 4JJ5A 1QLEB 4L3ED 4U1KB 2R39A 1JCVA 5TE4H 2F6XA 2CBPA 2PMZA 1K4CA 3RWGA 3GG1A 4GY4A 1PKQA 3OZLA 4KXCA 3WJXA 4AX7A 3URAA 4U6XB 3UPBA 3EJSA 3VWKD 2IALB 7TAAA 3WIAA 2FZDA 1R3SA 2WIMA 2FO4B 1WFOA 3ECBA 4N1CA 4NKOB 4ODTH 3V5KA 1Z3RA 3VFPB 3NBNA 2H3KA 1FHVA 1H1YA 2VUOA 3EH1A 1CDJA 1QLRB 2WD0A 1Y18B 5DZOA 4TTDC 2DWXA 2XVKA 1J6OA 4XCYA 1IZJA 4L3CA 4W6XB 3WLBA 4GS7B 3S5LB 3CUHA 3ITOA 1LDPL 3AUOA 4YN5A 2EH7L 2BHYA 2BWQA 2DMGA 2F5AL 4RGNB 3S3BB 5G2HA 3KWTA 3BAEH 1VLXA 2C3ZA 1SQ2N 1LTXA 3AHXA 5LA2A 3DXAA 3LDVA 4DXVA 5FUCE 3ABZA 3ZN6A 5LCVA 3EXTA 2QZQA 3I7SA 4KROC 3PJTA 2H8PA 5DUBB 1BIIB 1SF5A 5ESAA 3O6DA 3WQ4A 4B90A 3WFHB 1AZVA 2I9UA 4JPKH 1ET8A 2DEXX 3UAEA 3RB5A 2DQEL 8RUCA 5HHMD 5JBEA 3PJSA 3KCJA 3R4IA 3AIRA 3V0UA 4FFYH 3MNVB 3I6RA 3GMPA 2A9ML 1CBGA 1DQLH 3EYVB 3RX4A 2F1AA 3PFUA 3QPZA 3REWA 4HX1B 3S2MA 1GVIA 3AS0A 1G9HA 1QFEA 3RBSA 3SODB 3KTSA 1OOWA 3WFCL 3S2NA 3IIPA 1J93A 1LWIA 3KRUA 4L4LA 4QT5A 2PNDA 3VD2A 4DKEH 5T1LD 4HZ7A 4NM8H 4LU5H 4P2VA 1Y5VA 4AL8L 2ZYSA 4RNRB 4PUNA 1XGTB 3FQNA 4IHCA 4R4FH 2FGWL 4WSHA 3MGAA 1QSEB 5CZ0A 1UWEH 3V0SA 4YJ5A 2ZX6A 3EG9B 1A5UA 3ULUE 3DGBA 3GO1H 4B9GA 3WKYA 2BBFA 1EXHA 1RUKH 2YXFA 5EO1A 5EO0B 2FLBT 4F2MA 3TROA 4AZCA 1HGYA 1FC1A 1KN4H 2X4NB 1ZDQA 3GBNL 5HGDA 3VU2A 1Q6RA 1W3LA 2A4AA 3DKLA 3CZSA 1Q6FA 1F00I 2VDOH 4UTJA 4LUSA 5DHVB 4C56A 3HR5A 3WD2A 2KX9A 2NT0A 3EJJX 3GM8A 2CIKA 3MI3A 3T6WA 5HR7A 3IEBA 3QUZC 1O6SB 5CJXA 1D2PA 4MVBD 3AY4C 3P0YL 2X05A 4JYEA 2K8MA 3MBDA 5H8PA 3QQ3B 4WAFA 3TYGH 1N10A 4U1LB 5EU7C 4R3UA 1E5JA 1TFPA 4MHBA 1EIBA 2R4SH 2VN4A 2W9MA 3O15A 3TA9A 2C9AA 4NIRA 1T21B 2H0FA 1BQGA 2O5XL 2ZOXA 1C7SA 4BV1A 3H3PL 3C08H 5AHLA 3MU7A 1DQQA 4WI7A 1M04A 5XIAA 4MA8L 3A5FA 1YJDH 2EAWA 4PJIA 3WTTA 3LS9A 4RX0A 2FGWH 1UZHA 3CDCA 3TH2T 4V28A 1WBYB 4HIXL 1M3JA 1QWKA 3R11A 5HNRA 3OAUH 4XO8A 3WL9B 2E3ZA 1F74A 3GO1L 3AU1B 4H9TA 4XD5A 4J8RB 3CUFA 5TDPA 2ZUTA 1INEH 2Z1XA 3HEIB 4RE3A 1RZ7L 2X2HA 3ZWTA 3NFPB 4GBXD 1GSMA 3LCFA 5AC4A 3C60D 3IBEA 5E2JA 1CWYA 1MRQA 1LD9B 2CZ5A 3PG8A 1RURH 4MWAC 2PU0A 2QLVB 1KPVA 2VDOL 1PNCA 5F7UA 5HYIA 5BOOA 2VLLA 4KVNH 5GIRB 4NZTH 1OTUC 1JPGA 4UOZA 2HKFL 1P0KA 2AQVA 4ONGH 1G69A 4ELME 2G41A 1E73M 3ZTDC 4TVDA 3GDMA 1KY7A 4FFYA 2Z25A 1OGAA 2BZCA 1JK8A 4HQQL 3U9UB 3X14B 3J8F7 5IT2H 5D8WA 3NQCA 4QRPB 2EYRA 4HSOA 1A3LH 4G8GB 4DQWA 3KPLA 5DK2A 1T20B 2HTKC 5G4WA 5ADPL 1K4DA 3HRPA 2D2CC 1EXGA 3RNQB 5DEFA 1FOBA 3SGUA 3MV7A 1KPUA 3VCNA 1ITXA 5I6OA 5DD6B 4R53A 4FR6A 3UWEA 1M1SA 1BX2A 3QK0A 2XG5A 2FIRT 1AQHA 4NYUA 1PU0A 4Z95L 3U36B 3H9SE 4LCCB 5EPMB 2P5NA 2X42A 3QFJE 5ENWA 5JOPE 4O54A 5AW6B 1FDZA 2VM9A 4R2GD 5DMLA 1O68A 3EOOA 4H44C 1UVQB 1MHCA 1Z5LA 3KHQA 5A3IC 2EDYA 2GUOA 5JU6A 4IBQA 2NYKA 2OMBA 4NB7A 4WO0A 4LIQL 4XNQB 1WUFA 5LXGL 3MW7A 4PRBA 4UQ3B 5JXAH 5DQJA 2PDYA 2RAMA 1DEEA 3QI9D 3TXZA 1E6SM 5JR1H 3OLEA 1EDTA 3G1SA 3CX2A 3CDZA 1RR2A 3F58L 2C1PB 1MG3C 4NN5C 2Q5BA 4I5XA 4WQ6A 3GSXB 5FUOL 4K5PA 1TU2B 3CBWA 2YSSA 5K5YA 3VNIA 2CLVA 4ZNEA 4X5QA 1XH3A 5BPPA 4DLFA 1A4JA 2OMVA 5F89B 1G0XA 1MH5B 2G50A 4ONFH 3WY1A 2W60B 4LHUB 4BH8A 1QPPA 1FKWA 1M7XA 4HTBA 1F86A 4A37A 3V6FA 2EIMB 4U3SA 2VITA 2Q8AL 2ZCLL 5HYFA 1JPMA 3G0SA 3MSDA 1OT2A 3S37L 3P1VA 1VGKB 4N6EA 1DQXA 5HPCA 4XXCC 1F8TL 1I4FA 5DFAA 4MMZC 2CUAA 4LCRA 2CEQA 1A3RL 4NO2A 4HCHA 3AS2A 2F1EA 1A3ZA 4X6BB 1E15A 2GBVA 3DUHA 3ECUA 3ZR4A 1RALA 4X9HA 5I8EA 2ZD0A 1WYJA 5MEPA 1RUQH 3RU8H 2EE2A 3OTTA 5F1IA 1G6RA 3HMXL 4AEEA 3H9ZA 2IQAA 3KMDA 2H90A 3B8WA 4JB9L 4L4MA 2V2TA 1OD7A 3MBED 3L3KB 4FF9A 1W5PA 1CU4H 4TPRL 1VQTA 1SFDA 3DFNA 3RLGA 1E6JL 4S1QL 1KA9F 4LYKA 2IADB 1A6VL 4P7OA 3ILQC 3NM1A 4K3EL 2H0JA 2ALRA 5D5MA 2K9UA 3QLLA 2WP3T 3NIGB 2ZOTA 2M1KA 4MD0A 1BXAA 4OV6F 4Q2ZB 1TPFA 1VJZA 4S38A 2EC9U 2FB4L 5FECB 5I6XC 3FSUA 2NT1A 4HUXA 3MYZA 2ZP9A 3GY1A 2K3TA 2ISVA 1WVZA 2C1GA 5KUMA 4KRPC 2A1WL 4CSTA 1H8OA 1J4EA 2FJUB 3I6KB 1QSFD 3FU7B 4N9EA 3SPVA 3WG7B 5I7GA 3EJYD 4WW1B 4J1UB 1UKPA 4NUJA 4YLCA 2AXFB 2W9DH 3RTQC 3L7FA 1BW8A 1ZHKA 1J1PH 4AIBA 2B59B 2VRKA 3ZU8A 2GSHA 2GEEA 2ZUQB 15C8L 2W79A 4RMQA 2KBGA 1IYXA 2OEJA 3RNKA 3ZJ7A 3RPDA 4PGDB 2YIHA 2WQUA 4X5PA 1L5GB 2VW4A 3K4WA 5B38B 4MB1A 1WBZA 5IVOA 3APDA 4UQBA 4Y9BA 4F2MB 3INPA 3BT2L 12E8H 1X5XA 1EWHA 1E40A 4MB3A 1H5BC 1HOEA 1MNNA 1AH1A 1UFGA 5GJMA 3ZJ6A 1FVCA 1MFDL 2WUCL 4S23A 4ERSH 3HR5B 3ARFC 1WBJA 3W01A 1QNIA 4AY8A 5D2VA 1GH7A 3TT3H 2WMPB 3F2LA 1J5DA 1L9MA 3G1HA 3LKQA 1IQDA 3T65A 4YDNA 4IH3A 4B3LA 3N6YA 4P23D 4UILH 1I3RB 1GVFA 1THFD 1KY6A 4DZ8B 1MOEA 3VXPB 4X7SL 1PTAA 4P3DB 4IBTA 1A02N 1PIFA 2ZSVA 4BEQA 4LCCC 3ZL4L 1O7DC 2X1QA 2JKNA 3BP6B 4FQHA 4JPWH 5EU6A 4NQDA 3F64A 1BDYA 4DK3A 3QG6B 2C4FU 4QR7A 3MC5A 1FNGA 1A9VA 3QE5A 3G9VA 3ULAB 2MNUA 1X6NA 4HJIA 4YWIA 3KJ6H 1CGSL 1QFWM 1ZIAA 5EHFA 4PJIB 3SDAA 3FDKA 4E6MA 3QZMA 1Z9SB 3G6JA 1UZ8B 3HB3C 3PBMA 1QSFA 3E3QC 1PG7X 1DTNA 4NRXB 4IXXA 1B54A 1YIXA 4PRRA 1B0IA 4TX8A 4YDLC 5F3HA 3T2LA 1M7DB 4C83A 1QEWA 2HSAA 2Q7YA 1TT6A 3MRMB 2XZQL 4WJ5B 4X98A 2BSTB 1V3LA 1E4XI 5KVMC 2XIDA 2C7UB 5KYYA 2BGSA 3GGWA 3P8JA 4LSTL 4OU1A 5C2CA 5IOBA 3QWRA 1JPHA 2P0OA 4OV9A 2V5SA 3CG8A 1GPOH 3WDJA 2DMHA 3F00A 4K8RC 1AJ7L 3KPQA 4UDUB 3KP0A 3M0VA 4PL1A 1DJIA 2ADFH 3A21A 3TC6A 4OZ4B 1ZCCA 4G1KA 3H4HA 3M07A 1UM5L 4HG4J 3TMQA 4JN2A 5DI8A 3A6CH 1YYLL 3GHSA 4ILSA 1XTLA 4W93A 4Z7UA 5F9WC 1VRXA 2D7PA 1YMMD 3FT4A 2OXGB 2C9SA 2E1WA 3UTPE 3WMLA 4MD4A 2BSRB 3QJSB 1XW8A 4A29A 1NKRA 3RLUA 3L3JA 1PV8A 3BPNC 5GZNC 3VM7A 5CMAB 1WH0A 3PABB 4PV1C 3GG7A 3E2HC 3SO3B 4DT2A 3L4TA 1JYXA 2YD8A 4U2YA 4EK7A 2Q10A 3P0XA 1UTDA 1G7PB 3V4PL 2I5GA 4P5KA 3HG1B 1LO0H 1T6MA 3S35H 1YKWA 3FVMA 4YVUA 2WLIB 3THDA 1Q6OA 4OGYH 3CUIA 5HNTA 3A3WA 1JGLL 2P53A 4IOFD 3BJFA 4LSPH 1RJCA 1T04B 1FL3A 4LSVH 3SBWC 2CLZA 3QRGL 3NMEA 4JO2H 4OD2A 5IIEB 5DD1L 4YEFA 3WEZA 5JIQA 3U4AA 3MFFB 4JN1L 4LBEA 4XO5A 5FV1L 5HAOA 5G1TA 4JFYB 1S7VA 1DEEB 4X8JB 4ADGA 2FK9A 3WTSA 4GW4B 4Z9KB 1W80A 3FUKA 3O3RA 4Z7NF 5F2FA 3OKKB 2WYZA 2Q8AH 3DIPA 3S6CA 3V5HA 2VJ8A 3I6LE 2Z2BA 1KM6A 1OAXL 1YN6B 3DTXB 5HYQB 5KBLA 1T80A 2QPEB 5D2NE 4A21A 4WHYH 2DF3A 2A0LD 4P4KB 4ZRGA 4NAJA 4WK2B 1X1OA 2JIWA 3OKEA 2HJPA 3UYRL 2KZWA 1M05B 3C8NA 2UZXB 4IGSA 4RDBA 3V95A 2E9GA 3WDRA 3BXWA 3FCTB 3EDFA 5ESAB 3U7BA 2XBZA 1TYJA 2QJGA 3HBPA 4ANVA 3N17A 1NQ6A 1SYTA 2GPTA 3K1GA 3HS0A 3OWRA 1OP4A 4D0DA 4KCTA 4AZBA 3KP1A 3UR7A 3TEWA 3H85A 4HBCL 3FSAA 4GKZA 4GQZA 4DJFC 4POZC 4UTBH 2CWXA 2K0RA 4CQ8A 2IKJA 4G80A 4LPCA 4OW6A 1GQJA 1ZUAX 1W2VA 3L4UA 3T3PB 4N85A 3NOIA 3TYFA 3K5RA 2A6KB 3MV8E 4GIAA 3UXDA 1PFOA 1NOAA 3QXDA 1KC5H 1VFAA 3PL6C 2VW7A 4LEFA 3QS3A 4FLQA 4HT3A 2NW2B 3LZFH 3TN0A 2M26A 3RPIA 2P5PA 3KAOA 3VW3H 2VE6B 4P07A 1OWWA 3AJXA 1DFBL 1A4KB 2HDJA 2VI0A 5DMKA 3CE1A 3UYIA 5DO2C 3NP3A 1CT8B 5IW1A 3AICA 3T8XA 4JYFA 3QBUA 5IFHH 4BWLC 4KOCA 4XHJD 1JVOA 1G7IA 1L9TA 4R84A 1IM9B 3AYRA 1H8LA 3EJZC 4P59L 2PCQA 2Y7QA 4NZTL 2J8UE 5ISZD 3M7OA 4UM9D 1AH4A 1TO3A 1Q9KB 2WYTA 3OZKA 4KT2A 3C4UA 4HN8A 4UYPA 4RZ4A 2X1PA 3P9LB 3UFIA 1RZMA 3S9ZA 1KGWA 1CBJA 4P2OC 5KINA 4TUKH 4NN7B 4JBRA 3VNKA 1IT0A 3GBEA 2ZUVA 2AV1A 2Q86A 3LSOA 1NBYA 3OB0H 4LB8A 3ZFHA 2VEGA 4BZ2L 3AXIA 3QIWD 3UZVA 4WIQA 1W3JA 4N86A 5G4MA 3RNKB 2VEKA 3HF3A 1HCZA 3ABRA 3MNWA 1P7BA 2FATH 1EDGA 4CBPA 2ORBH 3WELA 2WCGA 3QZEA 1KACB 4XXWC 1NLBH 4B9IA 1CG9B 5GS0D 3NA8A 3QIWC 2HS8A 1REQA 2GITA 4KTEH 1T41A 3STBA 5KYWB 1MCFA 3IWVA 5D7JC 2F8QA 2P88A 3R43A 2ZKWA 3G6DH 4GUHA 3WAJA 5IVXB 5KOVC 4DGVH 4PGCA 1I75A 4Y9GA 2G96A 2Y3AA 1SY6L 4QRUB 1TX2A 1JNNL 1SEQH 4P57B 2ZWNA 4S1RL 4EDWH 2NXYD 4PJIE 4WWKB 5BXFB 3KJ6L 3ZIMA 5FB8B 4G8EA 4CW1A 2EPHA 4JG5A 3LHZA 2EDHA 1PHQA 1SR0A 2REQA 4LF2A 2Y6SD 4PGLA 3ZKSD 3L7RA 1MIEL 1Q1JL 3H7LA 3Q44A 3IJLA 3O05A 3FSWA 1V54B 3GDCA 4LU0A 4QFUA 3C0QA 2EZ0D 1Y0LA 9XIAA 5FAJA 2V17H 4UNLA 4QXVA 2J2ZB 1NFAA 5GS1C 3G24A 3D2TA 1OSPL 4QSHA 2GBAA 2ILLA 4HZMA 1HQTA 4F9PA 2O55A 4MA7H 4PBVC 1BYOA 3GPSA 3L3DB 5DJYB 3ROOA 4JTLA 3SDAC 4MWFB 4OD3L 3PYCA 2HPIA 2UZ9A 1UB6A 4MJ6A 3WCZA 3BSGA 3Q8AA 3L6FA 3IDUA 3QUXD 3BN3B 3MOAH 4NWTL 3QUYC 3VX0A 3A6CL 5C8JB 5C9KA 2OAAA 1C5DA 2Q7NA 1N6QL 5T3XD 3ZQ9A 2QEZA 1P9MA 3HG4A 3E0IA 1RUKL 1NFDE 2Y7FA 1SF3A 4PJFB 2FIQA 2G60H 5BRPA 3O8AA 1IEAB 4AFYA 2BVDA 1YMHB 1Z3GL 4BRVA 1W9UA 1KBWA 4RA3A 4XOBA 2A6LA 3H8AA 2VHLA 1HJVA 2IOMA 1T7ZA 3H9SB 1ZTXE 2P49B 1I8LC 3DOIA 2A74A 3EZJB 4HALA 3SYCA 4HC1A 1YEJL 3OSKA 5C0FA 2FZBA 3B9NA 3BPOC 1W1IE 2V3GA 3RJQB 5CIPB 1WKEA 3IVTA 3KM1A 3PHQA 4U6TA 4MQTB 3LNIA 4PWEA 1SJCA 3AZSA 5DC0A 3UZXA 1TCRA 4PIRF 3ZHLA 2IQDA 2ESVE 1HHGA 2BSRA 3MLSL 4XAKE 2FGZA 3G2GA 1UUOA 1X98A 1EHAA 2FJHB 4W70A 4YTRA 1KTBA 2RH0A 4YTQA 1ZV5A 3UBXB 1JG9A 1NWUA 2C34A 1SZGA 1TTAA 3W53A 1BZ9B 1HVQA 3N9KA 4EXAA 4HVXA 5E6RB 3QZWB 4ML9A 5EO9B 2X4SA 1H7NA 4O14A 2VELA 4RDWA 5EKYA 1ASQA 1X5GA 3O3DB 4I1PA 1KEGL 3FTSA 2PCPB 5TH2B 5I0WA 2A1WH 1NUDA 2WBKA 4P05A 3VXSB 4XP4L 4B3EA 2ICEC 3IBOA 4QHUB 5E5UB 1OF0A 1MRCL 4O0ZA 1NGXA 2R83A 2HPMA 5KSBB 1Z3GH 1LHZA 1U4EA 3VXRE 2FX8L 2Q3OA 5IK3A 1GT8A 5LQBH 5F1VA 1CYXA 3CUPB 1J8HE 1FZKB 2CAKA 1DJWA 1XZ0A 1ZZMA 5H8UA 3FO2A 3T8LA 5B38G 3GSWA 3TO4D 3VD0A 3DX5A 2P5WD 3O6FD 1INEL 2PDJA 4HBKA 1CDYA 1PZSA 4AVJA 5TQ2L 2VP8A 3GNRA 1UB5A 4LYRA 5T3XE 1ISWA 4J3OH 2CM6A 1N0XH 5IT2L 5ADOH 4MDPA 1I8UA 1IGIL 4HNNA 3H9HA 4H83A 3DFTA 1WA0X 2UY7A 5CBAA 5C0GA 3VKBA 5IDZA 2NUYA 3K6DA 5DDHA 1US2A 5DSCA 2QELA 4Z0JA 2UVEA 4MJ4A 1SJVA 1UACL 5E4EB 1VFFA 1GYNA 4O0KA 5GNXA 2MQ3A 4ZBJA 1ZSXA 3HMJG 1KYAA 4L5FE 5I1IL 4KO6A 5FK9B 4A7VA 3EZ4A 4KS0A 4DFHA 2QUNA 3VOIA 5T1MA 2VRQA 5HJDA 4CCDA 2FTWA 3INUL 2WO3B 2XG4A 4PMQA 3MMEB 1J05A 1V7NH 2QVTA 2WAHA 3W9DB 4TULH 4KRLB 5D5MB 4AC4A 1T2QL 1VS1A 3KVDD 4H1LG 2PDHA 1KPRA 3WY4A 1ZHAA 3STFA 4G2DA 1NCCH 4PLJD 3WBDA 2OYPA 5KANI 4GY1A 3OF6D 3C3UA 2UV3A 2H4EA 3HW7A 4S1SL 1FNLA 4TNFA 2LR4A 5CKSA 1VIWA 4QLRA 1FFQA 1MFCH 4G42A 2DMKA 5E6IA 3RX5A 1CNVA 1GHFL 2ZYHA 3WF3A 3WCYA 2VWSA 4JHOA 3T0CA 2HXTA 3VXQB 4LB4A 1U8CA 1ZHKB 1RVGA 1IC1A 2O5YL 3QV7A 5CP7B 2EDOA 4A6GA 2VX4A 2DLTA 3LRSA 4EOUA 1JDAA 4O51A 4P9HH 1T83A 1TCMA 3VXTB 3NN8B 2HG0A 4FS0A 4LIQH 3BZ4B 4R97C 5D04C 3PIQA 4EP8C 4GEJA 2BSSA 4DUVA 1DWFM 4E9WA 1W8NA 1CVRA 2ESCA 3O1NA 3NJNA 4KKRA 5DJ0A 5TQ0H 5I17B 2ATPB 1AO7E 1E72M 3OMNB 2P45B 2WZ5A 3IJEA 1RK0A 3LCHA 3DXAE 2XYCA 1Q6DA 4XVEA 4M62L 5DJ2B 4UWMA 3IFOB 1XM3A 1A6WH 1DP0A 4ISVB 4U1GB 4GZIA 4ZENA 3EPOA 1AGEB 2PPAA 4UDTA 3MUHL 1XIWC 2DTSA 3TA4D 1JTOA 2WOBA 4JAMA 3MODH 1IEWA 2XINA 1WS7A 4KW2A 1FVDB 1NCIA 1Q8JA 3R8RA 5AYQA 2JKAA 5C6MA 1SGJA 2R69H 2LV4A 4JPGA 3MNMA 1TEYA 3ARFB 1FGVH 4TVPD 3TL5A 4UFJA 3QPQC 4OM0H 4K39A 3ARYA 4PG2C 1BZQK 3QZPA 4LSSH 4OLVH 1LBFA 4JY6B 3BGFC 4G9DA 3FB5A 8PAZA 1EHNA 1V6WA 1VKXA 1S3KL 3RY6A 5AYUH 5F97E 3TESA 1ZLEA 3W29A 4OLXL 5SWZB 4PJGA 5D9SB 4ZX5A 3B34A 2GJJA 2RFXB 3UABA 3VFWB 4AQ1A 1I1YA 1XIJA 2J7FA 3P30H 1UC5A 1VACA 3S3CB 1P4LA 2CKBL 2A2IA 1A7RH 3L3HB 3EA3A 3AMLA 2A7BA 3E9AA 4WUUE 5ABGA 1JQXA 5JHBA 1DVFC 1UA6L 3DX8A 1P84J 4H20L 5EULV 1K4CB 3RWGB 3CNKA 4Z23A 5A8QA 4H9UA 1VLIA 5TFSL 2E9BA 3CSGA 3JT0A 5I1LA 3RDTA 1H3UA 5CEZH 4YVNA 4FOUA 2IALA 4HCLA 3UTPD 6REQA 4QWWD 3QH2A 5J13C 3M7WA 4KO7A 1T2JA 5D1QB 4ZMAT 2QZ5A 3PJNA 2I85A 4QRQB 4NN6C 4YZFE 4ANWA 5J6HB 4RDVA 4AMCA 3F2DA 4ZSOA 3A22A 2CK0H 1HKJA 4QXTA 4KK5C 4CNIB 1UHVA 4U6VH 5KVEL 1OBAA 3WENA 2IQTA 4PUUA 3W7DA 1FGVL 3VCLA 3B7YA 1BMZA 3WKPA 1BVWA 5HGGS 4JLRA 4YTUA 3PWVB 1AY1H 1B5TA 4UUJA 1XCTA 3W1RA 3H3PH 5FCUL 4PP2A 5I1CL 3D3VB 2GJ6B 3UH8A 5EFIB 2OMZA 3AS3A 1M03A 1SM3H 2DKMA 3MCOA 1W8EA 2BP1A 4N28A 1F3EA 1P5VA 4L0PB 1OY3B 2NMSA 3S6DA 5KN5B 3G6DL 4HCDA 2DEYX 3WD5H 2Y06L 5AVWB 5H94A 3KBJA 1AJZA 1UR8A 4HBQA 5K3VA 1FVEB 25C8L 3CVCA 1KM3A 2EO1A 3CVBA 2EJ1A 1CL7H 1EJTC 2J8TA 3JUZA 4K5LA 2VYOA 1CS6A 4TNEA 4Y5XC 3CWOX 1WYIA 3W1MA 3FO1A 2UYLA 4PG9A 4XZNX 4RFEA 1EOKA 1XRSA 4N2CA 2VFGA 4BI6A 2XQBL 3LQZB 3IDJA 3UJIL 2V3EA 3CDGB 4DIXA 5HI4D 5D70L 2JJUA 4LPVA 1VPXA 3B8VA 4GYFA 2VC2L 4FHJA 3APMA 2A4CA 4DUWA 2OZ3A 3N4FA 2D4FA 3C8KA 5LQBL 3N19B 3LCWA 2VH5H 3KBPA 3QEZA 5EMUA 3BAYA 4ZW3A 1AACA 2BVEA 3A5VA 4OZGB 4Z7VF 4Z2IA 4M19A 1GW9A 1U3HC 3N41F 2I5QA 1Q2SA 4MA7L 1IC4L 1MCEA 4MYWB 3HHMA 4GT0A 4EVNB 1D6EB 5C55A 4P4KA 2GVGA 1D5BB 3EOBA 1W2PA 4YBHA 4N2FA 1QPXA 1R33A 1H3PH 2NTSP 4MNQD 4Y1AB 4YC2B 1OM3L 4BFIB 4F8QA 3ZDYF 4GXFA 1GZGA 1A47A 4ODHL 3SDCB 3W28A 3SCMC 2YBRB 4E0RB 3BEVB 4WZ9A 3HCVA 4LW7A 4MJMA 3SO7A 3TO4C 1D6VL 3G77A 2HT4C 2WC4A 3VFMB 3DURA 4WTQA 2NQCA 3DI3B 4UTWA 4LRTA 5IG7A 1T8XA 3FTWA 5AWNH 1P4IL 1UBSA 1JDDA 4CA4A 2JEQA 2JLLA 2PO6D 3M0MA 3CIQA 3IJSA 1KB3A 1PMYA 4GXPA 3LN9A 1IM9D 1P7KA 3VI3A 3KPRB 3WK3A 1E30A 2Q87A 3EEZA 2NSOA 1H3GA 2C3GA 3A23A 1T21A 3E0WA 3WL1A 3VDGA 4DP4X 1SVDA 1JZ8A 3L3OC 3OLDA 4PG2A 2ZBTA 3O0RH 3IIVA 3N18A 1T5WA 2DJMA 1TVHB 3IDNA 1R3YA 5F96L 5IUSA 3MRDB 3EGSA 2G4GA 3NIFE 2FB3A 1MW3A 2CIIA 5D7IF 1XFCA 3AHTA 4A3HA 3NUKA 3DCPA 3CVIL 3P80A 3JXAA 5DYOB 4N90D 3T6ZA 1P7HL 1U1HA 5F6IB 1V27A 3BLIA 2CLFA 1F4WH 1BFOA 1RIHH 5I0YA 3L12A 5K4ZA 4OUOA 1I0DA 2QBWA 5EUOA 4Z18A 1ES0A 4GQQA 4KDTC 1H1NA 3DROA 1R3TA 3TBYA 2ZKXA 5C3LD 1EC8A 4ZW6A 3SPIA 1S9YB 3V4PH 4C55A 3ZYZA 1LL4A 4HFUL 1KJ3H 3SUUA 1X1ZA 2HRGA 4J7RA 5TGBA 2OMAA 1WXJA 3USZA 2QUMA 1DDHB 2IDFA 1ZRQA 3OHMB 3B8IA 1PTZA 1WA2X 4IU2B 2CDFB 4JY8A 4N5ED 2O1AA 5J3HC 4AEIL 2E68A 2AJSL 1KLFB 1A2YB 1Z2KA 4XNYH 4HULB 2CKBA 1R30A 4IJRA 1FLTX 4KI5D 4L37B 2EHHA 2EYRB 1AP2B 2PB1A 1WS8A 3WQPA 4H1LH 4L1SA 4UI2A 2Q3RA 3IIOA 3FOKA 4WO4C 3BQVA 2BX7A 2YPKA 4GS7C 4F24A 3TTOA 2EADA 4GLEA 3HNVH 2GGGA 3L48A 3VSUA 2CO6A 2B77A 3GXUB 1XH2A 5KYWA 1MFNA 1AZUA 3LJ3A 3MV9A 2R4SL 1S2UA 3GSOB 3M8OL 4UOJA 1SY6A 1IC5H 1UGKA 3PREA 5FR3A 3LQAH 4ISVA 4IOIA 3S1XA 1XF4A 4HXBH 2C5DC 4CD8A 1F1AA 3GSRA 3L2MA 2W3ZA 4D3CL 3GRWH 1NC4A 2YLKA 4FMKA 1I31A 3L1FA 2ZUNA 5A2BA 3B0PA 4Q7NA 1YEHH 1J5CA 4N0FB 1N6VA 3VXOB 1YEYA 4PB3A 4DO7A 1S5IL 3RKPA 3LRMA 2BV9A 1YZZA 3AMGA 4B4FA 4MTVA 3ULVL 5C6TH 1UM4L 4Z7UE 4M7LL 5L2JA 1AKPA 2CBUA 5G1MA 2VLRA 3GXDA 2X4QA 3UGXA 5AYZA 4XR8C 4A7QA 4PJGF 4EPKA 2D3JA 1GKOA 1PZCA 2AK4A 4JPVL 3S4SA 3QHNA 3VFCA 1HS6A 1VEMA 5IBUG 1UOWA 4AV4A 2QKIB 4YHNA 4ZODA 2DB8A 1Y65A 4NQXA 2F6AA 4TSCH 4HF5H 5I5JA 1UB6B 4MJ6B 1NPUA 2B4CC 2DMCA 1TZIA 3KBNA 4PJHE 3MS8A 4N9CA 3OGSA 2VCBA 1TO5A 2F0CA 4M3JA 2CK0L 4AW7A 5L7XL 5GGVH 1EQWA 5I24A 4GO8A 4MBOA 3IFLH 5D1QC 3VFSB 3T07A 2XM2A 2Y2TA 3W70A 3NQMA 1W0MA 2RH9A 4FMVA 4OFPA 1E6QM 2B7NA 1MXDA 4NPKA 3H9SA 3ZQWA 5KSVB 2DGAA 3AIQA 2HWZL 4NKIH 5EEWA 3H4XA 5I1CH 3H26A 4M0XA 1KIPB 5D7KD 3BDBA 4GY7A 4RW3A 2IWEA 5EMLA 2JJWA 1MDAA 1KWKA 1N8IA 7XIMA 3R0KA 5IB3B 4UT7L 4LRNL 2PRHA 1KBJA 4GKOA 3VCLB 1XX9C 5D7JA 5DT1H 1H3WM 3HVDA 1RCOB 4XZIA 5FOBA 1G0YR 2CE6A 1OHQA 3ARZA 3SUSA 1IBGL 1NDGB 2EXWC 4FQXC 4JFXB 5LAXA 2J88A 4O58H 1AR1B 3W1XA 5HQMA 3SPCA 2HVJA 1FFPB 1O12A 1GKEA 4LF3A 2DWEA 5IMLA 4F91B 2EDTA 3J07A 4YHZL 1IFHL 3N6JA 3S1VA 4JL2A 4UMSA 3GM0A 4J3OG 4Y4HD 3NXLA 3THMH 5F3FA 4H1LA 5AW2B 5H94B 4M6ML 3P30L 4QRNA 1JNHB 4ONHA 3O07A 4MKSA 2JKSA 1FWSA 5EB8A 3FT1A 1SHXA 4LMQE 1O9WA 5EBGA 5FHAH 3N41B 1HE8A 4GSDL 4JFQA 1B3OA 3H9SD 4Y16A 4I7WA 1K6QL 2Z35B 5CZKA 4TNVF 4XBMA 1TMCB 2LW3A 5FKPB 2B5IB 2PTTB 1CI3M 4NQCD 2VDLH 3ZE1E 4HOXA 4LXFA 2PDFA 2CJUH 2V7NA 3GSWB 3KH4A 3L7FB 2XQYA 3QUYA 1H8SA 5D6DA 4LAUA 1RPXA 2XFRA 2HG5B 2OZ8A 1PEZA 1XBZA 4ZAKA 2PC8A 1PY0A 4KEZA 3DOPA 1QRND 3QHFH 2VQ1A 1N19A 5DVLA 1OVDA 1TJIL 3L95B 4BUGA 4XO7A 1I9RL 4YPGA 2MNRA 4FEZA 4HCRH 3LZLA 2NLIA 3MDWA 2AL2B 3HM7A 2V2WB 5J6GB 3ECVA 2DAVA 3QUMB 1NEZG 4LARH 1GOFA 4KU1A 3CXOA 1JWSA 3CFKA 4GJTB 4OQ1A 5IFJB 1XG3A 3NJHA 5DCEA 4DY1A 1FIGH 1L7TH 3UTTB 1EJOL 4YSQA 1WHPA 3O2DH 3ZDZE 1VC4A 2J7BA 2ENSA 1LMIA 5JPMB 4E4UA 5EU4B 2WVVB 4MLSA 5T1DL 4BSJA 3TA3B 1W5QA 3LLFA 3RHWK 1IXOA 2EUZA 3CMFA 4XX1E 2Q20A 4P4RA 3FU8A 1GZ1A 1QMLA 2A83A 3DUSA 3OAYH 3SCPA 4P3DA 1XVSA 3IETA 4NZFA 3PNRB 4PRHA 3E2HB 1VFMA 1WISA 3K6FA 1BF6A 3O9WD 2Y36L 5AKTA 2YAHA 3NFNB 1K9TA 3AG1B 2C3VB 4PJ5A 5DZLA 1S5MA 3LNDA 2VCAA 4H6RA 3KPSA 2J77A 5KZDA 1Q0EA 2BOCB 4HKZA 3OKMA 3RVXC 2WQVA 4OGXL 4PPTA 4A7GA 3PE9A 1NUFA 2YMOA 4AUBA 1Z9SA 3G6JB 2YK1H 2NUTA 2YXVA 2GGIA 3N3EA 2PA6A 4YDMA 5AOLA 3C3NA 4L1DA 4WOZA 3R94A 3DNKA 5SX5K 4KEMA 4I9MA 1I9RH 4B5EA 4M29A 2G3ZA 4XG1A 3NZHH 3D5HA 2ZSWA 1SXZA 1D9KC 3AB0C 3TJ4A 5TPWH 5BJTA 3P84A 4UTLA 2XA8L 2ACQA 2E6QA 3CQPA 3KYOA 5CS7A 4PLOB 4PB9L 1P0SE 5GJSH 4ZNCD 3D3AA 3Q6FA 4OF5A 1R5WB 3QZWG 4GKNB 4XN8A 1M5WA 1PXGA 1F13A 1Y18A 3FCSA 4MJJA 4YHKH 2D1ZA 4KIRA 4LVAA 1ASPA 5AZEL 1RCQA 3M8OH 2WLZA 3SJNA 4AZ6A 3P73B 4PREA 1TWDA 3ARDB 5EU9A 5CG0A 3ZTJG 5A2CA 4YHMH 2J5LC 4NX5A 1KYUA 4TNWF 3ATEA 1LO5A 3GXFA 3GDRA 5EZPA 1Q90A 4WO4D 1CGXA 4FQ2L 1N0XL 4KX9A 4H9MA 1UWFA 4F8OA 1AD9B 3TE9A 1L0QA 3LIZH 1E6NA 1V5XA 1IRAY 2N1TE 4LLUB 4XN1A 5SWZA 5DEGA 2QW5A 4M1CC 3Q4DA 1JZ6A 3EA1A 4GXVH 1U8NA 2VENA 2Y5SA 1NCGA 1OP3K 4IQLA 1AGFA 4V15A 3CPGA 2MFNA 1Y8BA 3A4JA 4GX9A 3CUXA 1TJXA 2P24A 2ZKHL 4ACTA 4ORGA 1FJ1B 2E6DA 1MFMA 1GOIA 2V30A 4TTUA 1E9QA 5IR1A 1PCXA 2AGJL 3HC4L 3WQOA 1IIKA 3ESVF 1DVZA 2B81A 3CQ0A 4UBDD 2O5XH 4TR9A 4PUJA 5C97A 1GQKA 4Q3MA 4G6ML 5E99L 2HVBA 2IAND 4HVBA 1EBGA 4G6JL 3FH7A 3OEXA 5EN2B 1JZ4A 2E7FA 1SFHA 4PLKD 4QT5B 3SHSA 5I75C 5IBLD 4LAKA 2NY2D 3VJ6B 2DJSA 3T8QA 1BOGB 5CGYD 4LL4A 4CGUB 5D2LB 2QCHA 4OZGE 2WINB 3KD4A 4RGOH 3Q58A 1CR9L 5D1QA 2KPNA 2R0KL 2J1WA 2PPCA 4G11A 1TDQA 3QDJB 5DR5L 3W0WE 1XL9A 2FEDD 4K36A 4MKNA 1EXPA 4TQEL 3L3IA 4LNRA 2NQLA 4Q22A 4YAQB 2MANA 1HQRA 2LU4A 2ROXA 5HDOA 3VILA 3TNMA 1F2JA 3UAJD 1D5MA 4FHBD 3AMDA 3P9MB 3RWCA 4WNSA 3ZE0F 3VTAA 3B97A 4MYAA 5HINA 1E9YB 1S9XA 4M81A 4JRWA 1RUML 3H55A 4M7SA 3B0XA 1NAML 4DGYL 3RYSA 1MZYA 2OJZL 1KTLA 4NRYA 4OJYA 5GS1B 1DPMA 4XBJA 3I02B 3ULVD 4EQ2A 4HAKA 4LYPA 5H37G 2OTDA 2BSDA 2ZZ2A 5FW6A 4LYQA 4QR6A 2BY0A 4PCKA 2CRZA 3KBFA 4JG0L 4FQLH 1XC6A 4WEMB 3CQKA 1JF1A 4Q4IA 4JO4H 4JGNA 1K8IA 4A55A 1VF8A 4KWUA 1RAMA 1L2UA 3H42H 2W07A 3BLBA 2ZYFA 2WWOA 4L29A 4DP8X 1GCYA 5BVJB 3LQGA 5FA5A 1J1XH 4EJ1C 1NBQA 3BZ5A 4G71B 3U6XS 1RJYB 2QKIC 1OC5A 3I6TA 1WDDA 3BWAA 4HHMA 4GAYB 4A3RA 5DLMH 4QRPE 3RLVA 3DX6B 2FT8A 1KB5H 1WBXB 4YDIL 1U8MA 3CIWA 2HLEB 2P1YA 4MKMA 3MUUA 3VXGA 1BV8A 3QXDB 3NO3A 4GH1A 4ROPA 4LS2A 1U42A 3UY8A 1P5UC 4P5TA 4FXSA 1SYSA 3EHBC 3ZE1B 5F3BB 5A6KA 2DQJH 2V9TA 3WBWA 4Y1SA 5KSBF 4UTCA 5B21A 3NL3A 1DLHB 3PSVA 2RGLA 5DHEA 1JD7A 4FN0A 4HJWA 4DPQA 1IILE 1ZVNA 5I5IA 3NOEA 3ESPA 1MF2L 4B4HA 3RUGF 3C5ZB 2X4PB 5C0EB 1C8PA 1NAMH 2OMYA 2NPLX 3ABLB 3EDEA 1LBLA 4XE0A 1EQCA 3P7YA 1ADQA 1BYBA 1N8ZB 4X6FB 3CV5A 3SGDH 5C0NC 1BVZA 4MPQA 5AOKA 1K5WA 3AWGA 3L3GA 5AOUA 1TZHA 3ARWA 4XTRC 4J40A 4ZW8A 2OV0A 5D7IE 1TZ7A 2QQKH 1TG7A 3GK0A 1UA6H 4JDEA 5C9XA 4UUIA 5AAMC 1EB3A 4LCWE 2AV1B 3LSOB 2Q86B 3Q94A 5DD0H 1A1MB 3LQAC 5C0ND 5L4JA 3V8OA 3B7UX 5FDWB 1TJ0A 3W25A 4W9EC 3MROB 3IUIA 2OVLA 3UW6A 1A0EA 1CXKA 4IRSA 4OF6A 5FFOA 2WYSA 3V7PA 1R19A 3DC0A 3ZHKA 4B96A 2WBJC 5L0QB 4EDXA 2A6IB 3DRTB 1EWDA 1LG1A 1GYLA 4U05A 1YQVH 2DQTH 2V2WA 4Y8AA 5J6GA 2AL2A 3IGUA 2R6OA 3EWUA 3ARBB 4RCXA 3R0UA 3ESNA 3PWNB 4XZUB 1JNDA 5HBFA 3SRKA 4JE0A 4GIOA 1QNPA 3TJHD 3HGRA 2YUZA 1NGYA 4MYPA 4C6JA 4P46B 1Z32X 4LASL 5B7MA 4E3TA 3P74A 3DDGA 3N04A 4ZS6C 1ONRA 5I8CB 5F7DB 1RULH 4XP4H 4AZHA 4GW5A 1WITA 3H2WA 3BKYH 4X5RA 4JQVC 4XMPH 5FM8A 3TX4A 3MRQB 4ZX3A 4MFEA 3W39B 3BV4A 3SQLA 3QJHA 4OJAA 3EMQA 4ZEPA 1NMCB 2R2HA 4JHUA 1EFXA 5EEYA 1MRAA 1Z9LA 1WNOA 2Y63A 3H23A 3O9NA 5C9WA 3CDZB 4M8QB 3E2SA 1G1OA 3LEPA 3PQYA 1KB5B 4HWUA 5CJOL 4JGJA 1H7PA 1YBQA 3UNTA 2XQBH 2DSZA 4H1ZA 1R4XA 3GI9H 4NKQB 4P4KC 3GS7A 4JVWA 5FLVA 1KDJA 4UWQB 5AC8A 5IHLB 1CCWB 1VFTA 1XYAA 2JXMB 4JKKA 4QJ3B 3BGFB 4EXBA 2W63A 5EU6E 2PO6B 1D3GA 3G1VA 2PWEA 3B03A 4YCPA 4AZIA 4PBWD 4WFHD 4L8SA 1XIMA 6ENLA 2OI9C 3TH3T 3KYKL 4FTVA 4QQUA 4W5ZA 2DQTL 4WW2A 3SGEH 1P6CA 3SGJC 3KBEA 4BRJA 4KO9A 2Z31C 2R0WL 4RGND 1XIWB 5CJQH 2VH5L 5D93C 3SCMB 3Q6FB 5DHMC 4LT9A 1MCCA 5FCZA 3PUGA 2V9UA 3APFA 3A6OA 3OF6A 3FT9A 1I7TA 1U91A 1JAKA 3WQWA 1EAJA 1HOCB 3QDGE 4P61A 1XMWA 1BVLA 3TEVA 4N0CC 4XMVA 2FWSA 2LLNA 4YVXA 1MJ7L 3MP3A 3PP3H 2EYSB 1Z9NA 3WLWD 1BLNA 3JWNG 3VG0H 4NNPL 3NDZE 1DKWA 5LG6A 1Q63A 2VDPH 4Y4KA 4Z0BH 4ELMB 3VUPA 4H0LC 1FRBA 1KRMA 5D33A 3ABQA 3VFTA 5DBTA 3ZJKA 9RUBA 3QYCA 5F7KC 1J0HA 3T9PA 3CC5B 4MSWA 4YK4C 3S48A 3EF4A 3DYMA 4QSFA 4MCYB 1HT6A 1ZSDA 2ZOKB 4BY3A 4NRZB 5J7CC 2VXQA 1U9KA 2ZONA 1AHWB 4Y1AE 5HY9A 4HK0B 2V2XA 5EIQA 3PZMA 1JTPA 4OGXH 3BI9X 1LRNA 3EOLA 2LHAA 3S8HA 4N9OB 4K9EH 4O2CB 2K78A 3WBEA 3VXSA 2OULB 3TO4A 7FABL 5IWLC 1XWVA 1WZMA 4JR5A 3PS6A 1B6UA 1XRVA 4KFNA 3OJDA 4N2OA 3IPEA 4BGLA 4N9DA 3UT0A 2NY0B 2QCEA 1AD0B 4DW2L 5FSEC 1BOGA 4F9DA 5AFDA 1OT4A 1NOLA 3DRQB 3MZTA 3K4AA 3QARA 1BOYA 3QFJB 5IREA 3Q45A 1EFQA 2ZYRA 3BAXA 3QYQA 4R33A 4PJ7E 1FH8A 4LNRB 1GA2A 2GJ6D 2ROYA 2AABH 4J4PD 4A6YL 1QLEH 1ED3A 1KOAA 3BOVA 3EBGA 2N56A 3TBTA 4EI5A 4LRSA 1ETJA 1WBZB 5AVXB 4PODA 5CEWA 4TQPA 1AH0A 4XCCL 4R27A 1PZ5B 4RW5A 4QG9A 1A14L 4YHML 5D9MA 2XIJA 1N6UA 1R87A 1X9LA 1GYCA 3G04B 5DRZA 1R9FA 4OLXH 1OSZA 2X4RA 1XWYA 2GFTA 3QI9B 4KNTA 3N5AA 4IRJC 2AEQH 3U8GA 1YTKA 1EA0A 2H0PA 3FMGL 4ZZKA 3TVMD 1AG1O 1DN2A 3HA1A 2X7WA 2AZUA 2BIHA 2XX0A 4WGKA 2XIOA 3F7VB 1OFPA 2NY4C 1HC1A 2YO3A 3VXMB 1RBOB 5FKYA 3QULA 3RL1B 4JFHD 3PN8A 3D34A 4DZ8A 3D1MC 3ATAA 4HJGA 5GJTL 3P2BA 2E0PA 3BN9C 3OAWA 3PGCA 4H8QA 1UM6L 4PIBA 3T0EE 3ULUC 1XF2A 3ES8A 5E0FA 1R75A 3VSVA 2NY7L 1WG3A 5FL0A 1YVLA 5DFVC 3GS0A 2WTRB 5CBEA 4AQEB 4GUJA 3XINA 5CILH 5F6HI 4HX1A 4JFPB 4G59C 3H54A 3FQ1A 2GIXA 2IF7A 3LZOA 3N85L 4Y16B 4N0UA 3U79A 3SEPA 5DFWH 3ZE1F 1QRNE 4B41A 3RA7L 1XBXA 4G6JH 3CHFA 3HI5L 5HYSG 4JM2D 1LVEA 3IFPA 3VXQA 1C5CH 1U8CB 4JOMA 3VNZA 3QI9C 4G6KH 4IM4A 3BGMA 4MXQD 5EGRA 4K37A 2H26A 2BLFA 3CEPA 2OWCA 3QS2A 1XIGA 1QSEA 2WP3O 2PP9A 2MCAA 4Y7EA 3L5XH 3ERXA 1CFVL 3D4GA 3HAEA 4TQEH 5KYXB 3D85B 4YOKA 3RDKA 4PB9H 4Y5VC 4OWGA 2WC7A 3DO3A 4MA8H 4PZVA 1TVDA 4EZMA 2A74C 5A6TC 2GTZA 1TMHA 4BK9A 3PZUA 3ZTNH 3BVNB 3LHPH 4G3YH 2D24A 4TTDD 5G2WA 3TOYA 3FYEB 1CB2A 4PJ9A 4LS0A 3KPRD 4OY9A 5I1IH 1M1XA 4M6NL 5FUCC 5GJNA 2ZDRA 2A6JB 3X13A 1FI8C 3MLRL 5LGKA 5G4EA 3MJ9L 4KJQD 2ZAIA 4I77H 3MROA 4MAUH 4YIQA 5AZUA 2A83B 3DUSB 3CXHK 5B3NA 5IY5B 3FONB 3P61A 5CKGA 4F9PC 2GAZA 3MJ7B 1C8YA 4CC4C 5TJWK 4A6YA 4NM4L 1O94A 4JFWA 1CGYA 3I7RA 4KRNA 3BUIA 1UM5H 3UVAA 1O5PA 4JG1H 4X6CB 2BOCA 2MWCA 3DGDA 3QDME 4PJGB 5D9SA 4CN1A 4PJCE 3W5MA 2OSYA 4GG8A 4OZIB 1KXTB 5B7FA 4IWWA 2LAAA 4PH6A 2QGYA 4DXXA 2WLIA 1Q0YH 3IT8D 3BGJA 1P4UA 3ANVA 1A4CA 2X5PA 4L5FL 5C09E 2X1RA 3DVIA 2R8WA 1QJWA 3MBEA 5F44A 4XI5D 1BQHB 3UYPB 2WLJA 1CZ1A 3ARPA 4R7DA 1XGRA 1ORSB 1CICA 4MDIA 1FL3B 1HIMH 4GW5B 1R3QA 3H7UA 3AU1A 3CIXA 4PWFA 3TASA 5E5LA 4IP7A 1U8OA 4AWJC 1GHSA 1BM3L 1NBVL 4JQVA 4UM8A 4NLAA 1KT2B 4XO3A 5DS8B 3V52H 1LE9A 3V79C 3IDXL 3TC3A 2R2HB 1U21A 2O5ZH 2V81A 2RACA 1BLIA 3BH8B 2A3BA 3D9AL 3QO1A 5BS0B 1UD6A 1POKA 3UA3A 5ISZA 4RMWA 3ZL2A 2FVMA 5CJQL 4M48H 2VDLL 2AQWA 5JXEC 4P59H 3PRZA 4P04A 2FQGA 1GZQA 3C5ZD 2G3JA 5JXAL 4XNXL 2ZG2A 3EBVA 1MQKL 4LSRH 5DD1H 1MDTA 1SSDA 2RGMA 3DBNA 4BSVA 1PPIA 2V3FA 3CHQA 4A7UA 1W3KA 2OELA 2GQ9A 2AJ3A 3SKMA 1PJWA 5A2AA 4XCFH 5FIEA 3DHDA 5DFTA 3CIVA 1GGIL 3S9DB 4UUJB 1N5AB 4LSSL 3D05A 2EDKA 4BK4A 2EDWA 4XQ6A 2C6QA 4F0RA 2R2EA 1T1YB 4JHAH 4PEKA 1IGYA 1Q0YL 1BBJB 4WSJA 4GD0A 3W02A 2P24B 4ZE4A 2UVFA 2ICEB 4D7PA 3QAZC 1INDH 3E9TA 3DIVA 4XAFA 3QQ4B 1MCJA 1T89A 1J88A 4RFNC 2WHKA 3HPXA 4QY8B 2J72A 1RIVH 5FYJH 1KCZA 2ENJA 3NPWA 1BBDL 4F8XA 2X3BA 2HLAA 5EOCH 5FEPA 3W00A 1PD0A 2E56A 5E9DB 3TZVA 3W0WB 6XIAA 3O7UA 1DTUA 1LGVA 2G4EA 3L08A 1JJKA 2IBZX 2PETA 1K7FA 2O5NA 3VZYA 3CNYA 2NUXA 3L5WA 4HKJA 3EJCA 2EPOA 3MHFA 5EFFA 3TNMB 3V5DB 1J5IA 1L4IA 2LTQB 2GZXA 4PR4A 3SE9L 2NWSA 5IMKA 5M94B 1PWLA 2YBTA 3DI0A 1Z9PA 1QI2A 3EKZA 3MCNA 3NJ3A 5DMGC 4G7RB 4A6YH 2XFYA 3CT2A 3MJ6A 5HQLA 2ATKA 3PWJA 4K2UL 1TB3A 3CM4A 3N40F 1SM9A 2FHBA 3T40A 3UBGA 1GQNA 1OTUD 2XDHA 3HURA 4JO8A 4BH8B 2F7QA