4JFUA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 163
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jfuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jfuA01
2DIJA 3KLKA 1MXGA 3DECA 5A2BA 4EAMA 3W28A 1NH6A 1ZBWA 4BCEA 2J4GA 4JCMA 1Q6GA 4D71A 4HOXA 1JZ3A 1LL6A 5D8ZA 4W8AA 3CUHA 5GNXA 3LPFA 2DQXA 2YL9A 2WZEA 4FNUA 2JIEA 4QLJA 3THDA 1BVNP 3BGAA 4KRTA 2CBJA 2J8FA 3VMPA 2D3NA 1J9YA 1TMQA 1BLIA 1E6XM 3ZO9A 2CIPA 2VO5A 3RJXA 1R46A 4FLRA 1NP0A 1JYNA 1ITXA 5I6SA 3WEOA 4Z2IA 2XHYA 3TONA 3UCQA 1HKKA 1W9VA 1TQVA 3BAYA 4F8XA 1CEOA 3LXCA 4H8VA 4K68A 1UD3A 1E6SM 1L0PA 2G4FA 3T0BA 3AMLA 3J7HA 2E8ZA 3A6OA 5FOOA 1XYFA 1W1YA 3B9DA 1CXHA 2IUZA 1FOBA 5BXTA 1MQQA 2G3MA 1W1TA 1VFOA 2VC9A 5M5DA 3DDGA 1UKPA 5DF0A 2CEQA 3VPLA 3VTRA 3TTYA 1NARA 3WNPA 3A4AA 1UR8A 5AYBA 2BY0A 3RO8A 3ZQ9A 4D6JA 1MW0A 2G3NA 4JFTA 4MNLA 1FP9A 4AD0A 4UFKA 1B0IA 1CXEA 3CO4A 1V3IA 1PZ3A 2Q8XA 2V3EA 1JD9A 4CVUA 2WKLA 4UFLA 1V3HA 2XPKA 1CWYA 3SUTA 3VGEA 1JZ7A 4Y7EA 2DT0A 4P7NA 1HN1A 1I75A 1K9FA 2ZUVA 4UFIA 1ZU8A 3IJ7A 3T08A 3CZSA 2OWWA 5BXRA 2OWCA 2J75A 1H4PA 3OGVA 5CPTA 4TX8A 1W3HA 5GNZA 3DC0A 4WSJA 3VGDA 3MU7A 4AIUA 2RGLA 1XSJA 1EOKA 1LWJA 1HIZA 2EPOA 3KZSA 4Z2GA 2FDMA 5IHRA 2EABA 2WHKA 3OZPA 1KR0A 2WC7A 3VIGA 1DHKA 1QOXA 3PHAA 3OLGA 1ESWA 3VX1A 2OWXA 3WF3A 1JL8A 1GQKA 2ALWA 2XN0A 3WFZA 3CMGA 3LPGA 1E3ZA 4P7LA 4BA0A 1VEMA 3RJYA 2DSUA 4JL1A 5E70A 1BYCA 4FMVA 3VKKA 3N9KA 1HJUA 2W91A 3WBEA 4AYSA 2A3HA 2W62A 3FN9A 2XFRA 3W53A 1CXKA 4AIOA 3TP4A 1HL9A 4MB5A 1UYQA 4HA4A 3UESA 2BHUA 1TQUA 3FW6A 2DH3A 4EE9A 1QNOA 2DSZA 4KMQA 1K9TA 1C91A 4MDPA 1E0VA 1DWJM 4QCEA 3UR7A 4PUEA 5HOSA 4J3SA 4PMQA 3G6MA 4H8UA 3NSNA 1GOIA 1KCKA 1R47A 3WIJA 2ZIDA 4D6HA 5I2UA 2BY3A 2ZUUA 3W29A 1ISXA 1TQSA 5KZ6A 4AZGA 4UZUA 4AZ7A 3PN8A 4UR9A 4YN5A 1UH3A 3RM4A 3SCTA 1PPIA 3EJTA 1R7AA 2AMGA 4MNMA 1QX1A 4CGTA 3KL0A 1HKIA 3AXXA 3ZJ6A 1E4NA 1OBAA 2Y8VA 1KBKA 1BYBA 4D6EA 3ZMRA 2D23A 2YIHA 1JNEA 4M80A 3F5LA 1XCXA 5AYIA 1C8QA 3HG2A 5EB8A 3N12A 1U30A 1UKQA 2X1IA 2ESCA 4ZXOA 2WWCA 5A8QA 1AQHA 1CXIA 3FHQA 3DYOA 4W7VA 1R75A 1R86A 1E9LA 5C8BB 5HBFA 4XZBA 4BQ3A 4X0NA 2WW5A 3AS3A 3GXNA 1DTUA 3POCA 2WWDA 1VEPA 2XYLA 1H0GA 5I3DA 4AC1X 3BVXA 1V6WA 4S3JA 2VVNA 3D51A 4P8UA 3MANA 5C71A 1EGZA 2PWGA 3VMOA 3I3EA 2FHBA 1RD6A 4V28A 1E5NA 1E6NA 1NM9A 3HU7A 2WZHA 3QGVA 3VMNA 2W61A 1EDTA 2JFEX 3ARUA 2BY1A 3WY4A 2BXZA 4W7WA 3WH6A 1RP8A 1JZ8A 1WZLA 2VRKA 1OB0A 3WEMA 4W8BA 1E6RA 3LPPA 1UQYA 3AXIA 2D73A 3HN3A 3VGFA 3HZ3A 3TTOA 3W0KA 3MUY1 3K4DA 1CGYA 1UA7A 1OD0A 2W66A 1HJSA 1OWQA 5A1AA 5CQ1A 3ARTA 4HP5A 3VO0A 5KEZA 3VSVA 1KQYA 5A8OA 5IHSA 3SCQA 3QR3A 1WZKA 1E55A 1K6AA 3WQ8A 4NZCA 5IXEA 4IPNB 1HXJA 1CGVA 4GXPA 3SCRA 3MUAA 3D52A 3AISA 1V3KA 4W8LA 3HG3A 1W91A 2VJXA 3WMSA 3EJSA 4U3CA 2CBIA 4QLKA 3LRLA 2J77A 3AIQA 2J7EA 1HF6A 4PMDA 4GQQA 4LPCA 2YOCA 3GTNA 4ML4A 1W2PA 3QOMA 3WQVA 3EJPA 3UEQA 4LX4A 3ZT7A 4DUXA 3CZKA 4AEEA 2JE8A 4FLQA 2AOSA 1PEZA 2W92A 1V3MA 2FYVA 1KBBA 3PZQA 4HZ6A 3GXMA 3B9EA 1I1WA 1SZNA 1M01A 1DWAM 2NSXA 3IAQA 1WPCA 2Y5EA 4HZ7A 4IUGA 1BYAA 4UCFA 3W81A 3EDDA 2WMIA 4AZHA 3KE0A 3OLEA 2EADA 3W82A 1L8NA 1GNXA 3WH9A 3POHA 2DSKA 8A3HA 3OB8A 4OJYA 3CZJA 4UQCA 3MSGA 3CV5A 4P7RA 3WSUA 1V08A 1LG2A 1GPFA 1DWGM 3FY1A 3GXIA 1W3KA 2QHAA 1VFMA 3ARVA 3D3AA 5IFTA 1OM0A 1V6UA 1GW1A 2DH2A 1A3HA 1SMAA 2WLYA 1WAWA 3DYPA 1JZ4A 1CYGA 1C8XA 4RL3A 1JZ5A 4D6GA 1TA3A 4HOWA 1ISVA 4OZOA 1J0YA 1GHRA 3EDFA 1BPLB 3G6LA 1HP4A 1UWQA 2BHZA 1YQ2A 1VRXA 1LLOA 2W5FA 1B3WA 4H04A 2CNCA 2DGAA 1EHNA 1Z32X 1UWTA 2GK1A 1E6PA 4D1JA 3D4ZA 2WMIB 4AY1A 1V3LA 4QLLA 5E0CA 3SCPA 5IDIA 2XVKA 4JIEA 3QHNA 4PBGA 1PX4A 2VRQA 1XYZA 3RM8A 1BYDA 4CD4A 3E1F1 3GDBA 3WELA 3AROA 3AICA 5I78A 3CZLA 4CD6A 1OINA 3KWXA 1RH9A 3A21A 1TVNA 5CPSA 2XM1A 3VU2A 2J7HA 1CNVA 4AZ5A 2ZOXA 4FNTA 2XTKA 4FNRA 1P6WA 3CZEA 1H0IA 1CLVA 4Q7NA 2WM0A 3MKKA 5AC4A 2JIWA 1CGXA 3CZ8A 5ECUA 3GXPA 1E0XA 1KCLA 1LQ0A 2YL5A 3WN6A 1FHLA 2VL4A 4FNQA 4B15A 1CBGA 2GK1B 3ECQA 4B9ZA 2QLYA 3AHYA 3VIOA 4R27A 4MPKA 5C70A 5ABEA 2GVYA 4W87A 2WAGA 3ARWA 4A3HA 2OSWA 2J7DA 2D24A 2WPGA 3W27A 3RCNA 2F2HA 1TQWA 3NSXA 3FAXA 1DP0A 3WUFA 1QW8A 3OLIA 3AS1A 2D20A 4JHOA 4UQ9A 3VX0A 3AQUA 1R33A 3CGTA 5BCAA 5A8NA 3L4ZA 4PYSA 1BHGA 3AIBA 5D9NA 2VURA 3PZVA 1E56A 1V0MA 3KL5A 1QWUA 1E1EA 3SCSA 5LA0A 1KWKA 3BLBA 1NQ6A 4LXFA 1GQIA 1M03A 2V38A 4XB3A 2ZUNA 3QHMA 2WVSA 4ATWA 3VGHA 2OSXA 2X0HA 1KB3A 2WLZA 4ZE4A 3EDEA 5GQBA 5A2CA 1E4MM 4GIAA 4AD1A 2YDRA 3CBWA 1GOWA 3BAWA 3AIVA 3RILA 4IPLA 1J01A 2GUYA 1NOFA 4MJ4A 5FD0A 2PC8A 4XX6A 1EXPA 3ZOAA 3SURA 3DYMA 1QI4A 3PTMA 1OGSA 4JL2A 2PB1A 3DDFA 3GH7A 2QPUA 3BH4A 1E5JA 4FLSA 2X05A 2WVVA 3GXDA 3QHOA 1ZJBA 2G41A 2YA1A 2G3JA 3AXHA 1E3XA 3BMVA 4PCSA 1XSIA 1FH7A 5HXMA 1LJYA 1J12A 3CUGA 1ODUA 2E9BA 4XUYA 1B3ZA 3KL3A 4B16A 1AVAA 5CZKA 3A22A 4MDOA 2OYLA 3BCFA 3WF1A 3O6AA 4DWSD 4PMZA 4PMNA 1E1FA 1V02A 2XSBA 4OKDA 3W6LA 4EKJA 9CGTA 4YHEA 1T0OA 1EDQA 3UG4A 4ACYA 2BV9A 4GZJA 3WH8A 3WDJA 2BXYA 4CD5A 4L4OA 5A2AA 4HOZA 1VFUA 1UD2A 1BGAA 1TE1A 4NXKA 1BFNA 4U5KA 4E4PA 2WMFA 3VDHA 1UA3A 4EANA 2F61A 3SUSA 2BS9A 1VEOA 3L2MA 4IM4A 1J10A 2GJPA 2WVVB 1CIUA 5A94A 1HWWA 4D6DA 1FFQA 2WBGA 3MMUA 3THCA 1CDGA 2J25A 3DX4A 1CTNA 1EQPA 2Y4SA 3VGBA 3PZOA 1X6LA 4MNJA 1GQLA 4HA1A 1KFWA 3GBEA 2XIIA 3WH5A 3VIPA 3IANA 1AMYA 3CUIA 3CHFA 3S5YA 1C90A 4PMUA 3WF4A 1V6VA 3ZR6A 3CHEA 4NI3A 1E4LA 1UH4A 2F1BA 1CZ1A 2VVSA 4KWUA 1QNSA 3AFBA 3BVVA 3BSGA 1MQRA 5JUVA 3VNYA 3VD5A 2CETA 4J3WA 1VJZA 3ZJ8A 3SIMA 1QHPA 2VNCA 3WUGA 4Q22A 3LXAA 3WDHA 3H53A 2C7FA 5FL0A 3VD3A 2CESA 1HT6A 4OUEA 3VGGA 2YJQA 3WNNA 2WCSA 5A8MA 2VMFA 1LL7A 1GUVA 1ZBKA 3SUWA 1KTCA 3OG2A 4WKAA 3GNPA 3WKZA 1DWFM 2HVMA 3DX3A 1KXVA 3BAKA 4HMDA 5CSYA 5I5RA 1H49A 1QNPA 3AHXA 3AHVA 2F8QA 3VDBA 5I77A 5CPQA 5JBDA 4NRRA 1GOQA 2Y2WA 3GM8A 3U5YA 4RE4A 5LA1A 3CHDA 2O9RA 3WNKA 3MUZ1 1JDCA 1G1YA 1C7SA 3K1DA 3A3HA 2YLLA 2PBOA 1NWTA 2AAAA 1QI0A 3U7VA 5CG0A 5D9MA 2ZUMA 4DWSA 1ZS2A 1JF6A 4NXSA 5A6LA 2V3FA 4F66A 4PEEA 1R34A 5I24A 3EJQA 1PZ2A 1C92A 1GJWA 1B9ZA 2WHLA 4GZEA 2E8YA 3ARQA 1BVZA 3BSHA 3S5ZA 3PZMA 3TTQA 5I0DA 4P8XA 2CXGA 4FNPA 2WXDM 3VD4A 4MTVA 3GZAA 2DDXA 3WL1A 4M24A 4EK7A 3VDAA 1E6QM 3AIRA 2ZX5A 4TVDA 3HMCA 1AQ0A 1N82A 1JF5A 3F5JA 4J3TA 4FK9A 4RE3A 1MW3A 2PWFA 2WNWA 1LWHA 3IAPA 3K8MA 2GFTA 3CUFA 4WJXA 1B30A 3WDPP 3JUGA 1Q4NX 1H5VA 3SCNA 2NW0A 4M29A 1HKJA 3ARPA 1HVXA 4W84A 3W26A 2VX5A 2C0HA 1UHVA 1VBUA 2D2OA 1X6NA 2EPNA 2IXUA 3EJUA 1O7AA 3A4XA 4DWSB 2JEQA 2XWEA 2XVGA 1W1VA 2D0GA 1W9UA 4AMCA 7TAAA 2TAAA 1PX8A 1XV8A 3ZR5A 2X09A 5HPCA 1TR1A 3VINA 2ZX7A 5A8PA 1HJWA 4MAVA 3D5HA 1DWHM 3EDJA 2V5CA 4GKLA 4CN1A 4AD5A 4BQ4A 3D50A 4CVWA 5CJ5A 3RMEA 1S46A 1EIBA 4J28A 3MV01 1TG7A 3L4VA 2J62A 3SUVA 4F9JA 1K9EA 4AMWA 1WP6A 1GQJA 5DT5A 3PZTA 1EO7A 3GH4A 4OOZA 4YHGA 2DT2A 4Z2JA 3L4XA 1W9PA 3WMBA 1X1NA 4JAWA 4D72A 2CBUA 3L4TA 5LYRA 5D4YA 1LL4A 3DX2A 5EBAA 3W37A 4CU6A 1QI3A 4QDMA 2OW6A 2NT1A 2VZUA 3H55A 5HNNA 3AOFA 2VX4A 2VCBA 2J74A 4ZEPA 4JKKA 4DO4A 3EMZA 4GO9A 4WF7A 4J7RA 2XG9A 2WB5A 3CIVA 3N1AA 4E8CA 1TZ7A 4UOQA 1UKOA 3K4AA 4YPJA 2V5DA 1JXKA 3BXWA 4AD3A 1HX0A 3ARSA 1DEDA 4DO6A 1HXKA 1UG6A 2BVYA 2GDUA 1KR1A 4WK9A 3WL0A 2YBTA 1WO2A 2VR5A 1BQCA 1E71M 2VQUA 4RE2A 1PIFA 4MADA 3WQ6A 3AMGA 5CLWA 1GOMA 3WY2A 2EAEA 5DFAA 3A5VA 1GCYA 3ALFA 1RPKA 1C8YA 1A47A 1B2YA 5AY7A 1W9XA 1E73M 1XH2A 4NZFA 4W85A 2X2IA 1FH9A 1CLXA 1IV8A 1PJ9A 4JFUA 1V6YA 1JDAA 2YL6A 1UUQA 4OBSA 1WDSA 1OT1A 1UH2A 4LYQA 4A4AA 4UQBA 4UFMA 5D8WA 2YFOA 1UWSA 1SFSA 2GDVA 2VOTA 4L4PA 1B3VA 1G0CA 3BLKA 4U2ZA 1G5AA 3BVTA 1J0HA 1UR2A 6CGTA 3AHTA 4NZJA 2W67A 3AZRA 3HJEA 1UWIA 3BCDA 7A3HA 1OSEA 4OBRA 4MJ2A 6TAAA 1M53A 1GONA 2WSPA 3HG5A 4P8VA 1B90A 1BG9A 3QOKA 3OIHA 1NOWA 2UY3A 2YL8A 1Q6FA 2EEXA 2GJXA 3PZGA 2C8NA 1W3LA 4CUCA 4E2OA 1HP5A 1WDPA 2WKGA 2W63A 4PMVA 2ZUWA 4HU0A 3WD3A 2EBNA 4UTFA 4PSPA 1VBRA 1V0NA 1W9DM 1PIGA 4GINA 3VSTA 2D0HA 2YA0A 2DSWA 5BROA 1QPKA 4U5IA 4V2XA 1JFHA 3DX0A 1GORA 1UD5A 2WVTA 3BUBA 5TD4A 3K8LA 1FA2A 2VI0A 4ZE5A 2PWHA 1JAKA 4AIEA 3GXTA 1UKSA 2X2YA 5E09A 3EYPA 4DUWA 4JFWA 4C7FA 1BGGA 2HISA 3PZNA 1BSIA 1LG1A 1OIFA 2A3BA 3MI6A 2WMKA 4X9YA 3SCWA 2WANA 4N0RA 3WUBA 1C93A 4CCDA 3LPOA 2VZTA 2FH6A 3BAIA 4U2YA 4X0VA 1XGZA 3TA9A 1EA9C 1XRVA 3D4YA 4AXNA 4WKHA 4MB4A 2F7PA 1IT0A 2JEPA 3BUQA 4XZWA 3UG5A 2GJXB 1ITCA 3WY1A 2ZUTA 1GOKA 4CD7A 1W3JA 3BLPX 3RIKA 1MW2A 1RP9A 1SMDA 2XJ7A 3VILA 1D3CA 1QWNA 2XN1A 3LMYA 1K9DA 1VB9A 1XD0A 1TA3B 2DIEA 4AMXA 5CGMA 5FL1A 4XV0A 4UQDA 3GNOA 4ATLA 1G9HA 2D3LA 3W4RA 3NDZA 2ZX9A 5ABGA 2DSVA 4AEFA 2J7GA 4TTUA 3T09A 1WE5A 1G01A 4W86A 2F7QA 1E15A 4QCFA 3WH7A 3IK2A 3N17A 3WD2A 4CCEA 3WD0A 3S6TA 4PTWA 3O9NA 4A3YA 4W93A 1JZ2A 5CXPA 2BY2A 3MV11 2B31A 4AW7A 3A4WA 3B8SA 3KEHA 4V27A 3AIWA 2UY4A 2DEPA 5A3HA 4ZENA 3AHZA 1UASA 4U33A 1ZBCA 2XGBA 4NSBA 2XVLA 1HJXA 3EBVA 3NJ3A 3KLLA 4JFVA 4UNIA 1UQZA 1JYWA 3BVUA 4PMRA 3W6MA 3ALGA 3WD4A 4Z2HA 3GXFA 1BAGA 1B3YA 2E3ZA 3MS8A 1G94A 1E40A 4C7DA 3K46A 4DM2A 3AIUA 1V03A 2XM2A 3LRKA 1NWUA 3T0AA 2FGZA 3PTQA 3NSMA 4M56A 4GZIA 3WFLA 2D22A 3VNZA 5M17A 1XD1A 4H8HA 2CBVA 5ABFA 5A95A 1ECEA 4OOUA 1CGTA 3SUUA 4E8DA 4URIA 3WNMA 4D1IA 3FAWA 5BYWA 1Q6DA 2YLAA 3N13A 3W24A 5AC5A 1UR9A 5A6MA 1R87A 1CENA 3O2LA 2PWDA 2YKKA 4IISA 1GOOA 5CSUA 3T2PA 1UWRA 5GPRA 1MXDA 2J8GA 1HJQA 2CCRA 4F79A 1UR1A 1OT2A 1IZJA 2BHYA 1SYTA 3VSUA 3MUIA 3WENA 1UR4A 4PCTA 2GJRA 2VTFA 3EMCA 4PMOA 4CN4A 1WKYA 3VD7A 4OIFA 1O6IA 1C7TA 2DT3A 1VIWA 1CPUA 1AQMA 1J0KA 2VT0A 2WCAA 1E4IA 3LX9A 1LF1A 1TFVA 5E9AA 3VIIA 1US2A 1TVPA 3M46A 4KGJA 1SR0A 2WSKA 5A6JA 3A24A 1ISWA 2XGIA 3ZT6A 1VAHA 5ABFB 1FP8A 3OGSA 4WIWA 1J18A 3VUPA 3LRMA 3W25A 3ZIZA 4B3KA 1NP2A 1JI2A 1OGBA 3W38A 2ZX8A 4LYRA 2J7CA 3AZSA 1UOKA 1JFXA 3T0DA 4NX0A 2W4XA 3ARRA 4W5UA 1Y7VA 1QBAA 2A3EA 1UR0A 2QF8A 2WHMA 3AJ7A 1I1XA 2EO7A 4W88A 4CU7A 5HPOA 1JIBA 3EMQA 3IJ8A 3WUEA 3GYCA 2EPLX 5FCZA 4DWSC 2Z1SA 3DX1A 3I3DA 3N11A 3U5UA 3H54A 3TOPA 2JF6A 1BF2A 5EFDA 2EPMX 4FF5A 1J0ZA 3AI0A 1KGWA 4BS0A 2XN2A 1QI2A 1W9BM 2VCAA 1E6ZA 4ATDA 1VENA 4QFUA 2JALA 3PBGA 4J27A 2ZUSA 2PWEA 2VRJA 4PMXA 4QAWA 1JI1A 1CGUA 1R8LA 2XSAA 1R7OA 3OBAA 4LQ1A 1JD7A 5BWFA 2EXOA 3I3BA 2MANA 4AZIA 5E0FA 3BUPA 3ARXA 3EDKA 2VUYA 3GBDA 1OD8A 2J47A 4UFJA 2FHCA 3WMCA 2XVNA 2FH8A 4H7VA 4TX6A 2XFYA 3A47A 1ZL1A 3IGUA 1EH9A 1QBBA 1OCQA 3GH5A 2UY5A 3PTKA 3AYSA 2F7OA 1PAMA 4BZYA 1KXTA 1EHAA 3UR8A 1WZAA 1D2KA 3AZTA 3SCOA 5DO8A 4AYGA 3CHCA 3NYDA 2VZOA 2ZXDA 3A23A 1V0KA 2O9PA 3L4WA 2BVTA 2E0PA 1W1PA 3VIJA 2J78A 2J79A 2GSJA 2DPEA 1J0JA 2E9LA 4DM1A 4LYPA 3AIEA 5GNYA 1E43A 3M07A 1QNQA 3VOCA 3ZSTA 2PI6A 4AZBA 1QHOA 1QW9A 4TVCA 1EDGA 4CCCA 2XFFA 4HPHA 3MMDA 1KTBA 1GJUA 4AD4A 2Y24A 3CZNA 3APGA 3WDQA 4U31A 1PBGA 2EQDA 4WKFA 4HMEA 1IZKA 7CGTA 4ZFMA 1NWSA 2ZWYA 4GI9A 4J3UA 1NOUA 4PRWA 3DHUA 4UZSA 3OGRA 5JIPA 1H41A 3NUKA 2PBGA 1MWOA 1DWIM 3ZJ7A 3SEPA 3OLDA 4W7UA 1J11A 2ZXQA 1CXLA 8CGTA 2QMJA 1XC6A 3K8KA 3TV8A 4HZ8A 3WQWA 3WNOA 1UD4A 4JKLA 2WYSA 4BQ5A 4ZXLA 3ARYA 4KH2A 3L4YA 4B3LA 2E9MA 1MVYA 2X0YA 1GVYA 4M1RA 1ISZA 1HL8A 1KWGA 2WVUA 2D0FA 3UG3A 5DMYA 1XCWA 1VJSA 1XSKA 3WQ5A 1HKMA 4CD8A 1JZ6A 2CITA 1OIMA 3AS2A 3EJRA 3VM5A 1KXHA 4OGZA 1B1YA 4HU8A 3CPUA 2JF7A 4WLCA 2QV4A 3N18A 4HTYA 4UOJA 1MFVA 4JCLA 1V6XA 2YFNA 4NF7A 4C7GA 1W32A 1E70M 2V3GA 4GI8A 1BG4A 4D6FA 1UZ4A 5EMYA 1M04A 2WMGA 2WC4A 1WB0A 2V3DA 2RGMA 4UQEA 4TOQA 5A6AA 1JYXA 2CYGA 4U3AA 5HDRA 3ZSSA 3VM7A 2XUCA 4LGXA 2DT1A 4WSKA 2A3AA 2ZE0A 1ZBVA 2UY2A 3T2QA 4J3XA 1H1NA 1JAEA 5A6KA 1ZJAA 4CN6A 3U7BA 2WHJA 5JBFA 1FH8A 2QPSA 2ZICA 1CECA 1V3JA 1E0WA 2IXVA 4DUVA 5ABHA 3TTSA 5CLTA 3S2CA 2OYMA 2OSYA 4GPNA 6A3HA 2X2HA 5M3WA 3ZJKA 1U2YA 2YDSA 4FLOA 1HVQA 3CLWA 4CKQA 1QVBA 4R5EA 4PUDA 2X8RA 4PTMA 5JBEA 1HTYA 4Z2KA 3PZIA 4JFSA 2XWDA 3II1A 1PX3A 4GQRA 2YBUA 4F9DA 5M03A 3UERA 5A69A 3VD9A 4KRUA 1OGGA 3MSDA 3WNLA 1GHSA 3AYRA 3NDYA 4M8UA 4PTXA 4UFHA 2Z1KA 5I79A 5BRPA 2O9TA 3WEZA 4GI6A 3VIHA 4UQAA 1JNDA 5FKYA 1WNOA 3RPMA 2ZWZA 2IGTA 2BVDA 4AISA 3CZGA 3AS0A 3DHPA 1TQTA 1NWRA 4JHZA 2A3CA 1J0IA 1WDRA 4D6IA 1CXFA 1B31A 4KGLA 3RM9A 2OLHA 1F4HA 5D9PA 1BTCA 4FNSA 2YDQA 3LXBA 3NCOA 5IFPA 2WZIA 2ZXBA 3WQ4A 2F18A 3AMCA 4H2CA 2CKRA 3IJ9A 2CHNA 2CERA 3MMWA 2WMHA 5DT7A 1EQCA 4DO5A 4CU8A 5F7UA 1E72M 4D6CA 1HJVA 1EOMA 3WDRA 4QP0A 2VX7A 1KQZA 4AD2A 4Z2LA 2EACA 1GVIA 2QMKA 1MQPA 1GZJA 2J7BA 3F5KA 3CTTA 4H41A 4JKMA 3OA5A 4HMCA 1U33A 3M7SA 1US3A 4MAZA 3ARZA 1R85A 3T2OA 3PZUA 3WF0A 3BMWA 2OYKA 3ZM8A 2G3IA 2VQTA 1O7DC 3WF2A 2D1ZA 2NT0A 4W5ZA 5A6BD 3WY3A 1EO5A 3CUJA 3NIYA 1FHDA 3VDCA 4BQ2A 4TVUA 5E1QA 2CPUA 1MFUA 4M82A 4P7QA 2CHOA 1XHGA 1WCGA 2F1AA 1XH1A 2BNJA 3BUIA 2YA2A 3VIMA 1H09A 1ODZA 1VFFA 3MO4A 4ACZA 3GNRA 1W2VA 2J7FA 5E6YA 4HA3A 4JZ5A 3VIKA 3BAJA 3BC9A 4TXEA 3L4UA 3M6DA 4P7OA 2VCCA 4N42A 4BF7A 2FE0A 3RDKA 1QHZA 2UWFA 4AZ6A 2G8ZA 1TCMA 5E6ZA 4TUFA 3VIFA 1YHTA 2ZX6A 5EFFA 1D7FA 2WMJA 1KGXA 3AMDA 2XVPA 4M81A 2EJ1A 3UETA 2WK2A 3VVGA 1B3XA 3CC1A 5CGTA 1MW1A 3ZT5A 3AMKA 2F7RA 3BAXA 1CGWA 1JGIA 1PS3A 3OZOA 3HG4A 1V0LA 1KGUA 4PTVA 1H3GA 2XIBA 3FHAA 5JIWA 2FHFA 1JG9A 3N15A 5A6SA 1ZB5A 2X2JA 1QNRA 2PF0A 3WD1A 2Y8KA 1UKTA 1FFRA 2E40A 4PN2A 3WDIA 1WZMA 1H11A 4AZCA 1C3FA 2O92A 4ACZB 2CKSA 5D9OA 3WBAA 3F4VA 5FIPA 1H2JA 4NRSA 3U57A 2VX6A 4TTGA 1V02E 2E4TA 2OW7A 1TUXA 2VZSA 3L2LA 3BUDA 4MB3A 4W89A 3SCUA 1ISYA 1WDQA 3CH9A 1UWUA 1JYVA 2WBKA 2WCGA 4PSRA 5BRQA 3PZ9A 4GO8A 2WC3A 1JXJA 4PMYA 1JDDA 1Q6CA 2BFGA 4J3VA 3SCVA 2EPKX 4AWEA 3B9AA 5LA2A 4S3KA 4UOZA 1M7XA 1F4AA 1UZ1A 2VR4A 1XH0A 2VZVA 1QI5A 4HPGA 3BVWA 1Q6EA 3FNDA 3FXYA 1MYRA 1UD8A 3CMJA 2O9OA 4MB1A 5I23A 1HNYA 5DEZA 4P8WA 1KXQA 5A6BA 1VF8A 4MNKA 5BXSA 4B9YA 2ZXAA 2FGLA 1UD6A 4AZCB 5BXPA 3N04A
chains in the Genus database with same CATH superfamily
3TO4C 1EL3A 5D70L 1LL6A 4O28A 2Z25A 1UACH 1ME9A 4FZ8L 4L3AA 3SW6A 3VMPA 3V35A 1KYAA 3UMNA 1J9YA 1TMQA 3U0HA 2BTMA 2BSED 4X6DF 4P5UA 1HESA 4NQDA 2Y0SA 2HG0A 2P80D 3CXDH 2JKSA 2FB3A 2ISWA 3TW7A 3IVSA 1FC1A 2XG4A 4AW4A 5IBXA 5FCUH 5IM7A 1X6UA 5AW3B 2ISVA 3HZMA 3L7FA 4OH2A 5CPMA 4LLMA 3FFOA 2FUTA 3ZQ9A 3DXAE 4AX6A 3O6FC 1SYSA 2I9UA 3CO4A 3QR1A 3ZQXA 2Q8XA 4ICCX 2E59A 1NIAA 4DZAA 2Z4GA 4XNMA 1EGVA 5BS0D 3T4YA 3VXNA 1YEIL 5JPNA 3V7PA 2OWWA 1ZAGA 4RWYL 1N64L 4UIMA 3UXIA 2NYZA 3TWCH 3OGVA 3I9GH 1W3HA 3SPCA 1FKXA 3OHXB 2HV5A 4QG9A 1Z7AA 1RK0A 4AG0A 5HY9A 3HUJA 2ZRXA 4LCIL 4XN1A 1BWLA 3ZGHA 3U9UB 4OIIH 4NYYA 3PHAA 1GOXA 2OWXA 3GR4A 1ZSDB 3DUUB 4RR4A 3LPGA 4JN2B 1E3ZA 1QRKA 3RJYA 2LFEA 3NVDA 1I31A 5IFJA 2VLMD 4KHTH 4HEME 1IKFL 3IIVA 4FZEL 1S7WB 2H6PA 1CXKA 3O2DL 5KYXB 2VDMH 4IRZA 43CAB 4MFEA 3FXGA 4M00A 1PWLA 4KX8A 5E5UB 4J12A 1T21B 1RV6X 1M1XB 5HJ3A 4ZJ9A 2W0KA 3NVTA 2D7PA 5HOSA 4XXCA 3A5FA 5EHFA 1KCKA 4POUB 5IBTH 2PP7A 5KSAC 3GQYA 4YN5A 1YX1A 5I8OL 3VI4A 2APXA 4PGEB 4OFCA 2EXTA 1E2VA 4J39A 2YXFA 3HMXH 4PJ9D 3RNQB 4QS5A 1KBKA 1H15B 4JHUA 3HJZA 3MZGB 1ZWIB 1EO8L 1JCXA 3W11C 1BQUA 3NRQA 3N12A 1I4FB 1Z3NA 2Q71A 5EZJB 1T7XA 1INEH 1BXBA 2AXGB 4GLRH 4OT1H 2IGLA 4JNXA 3ZZLA 2H41A 3GMOB 3SQLA 4W4OC 2JKAA 1U83A 1P48A 5DXXA 5JXEC 3INPA 1ROCA 3ZDXE 3SDAA 1BVOA 5J6GA 1E42A 1E5NA 3QGVA 3A4JA 1ZCOA 3WSQL 1S3HA 4G9PA 4QHUB 1T6BX 2NY4D 4NLAA 5BPPA 4LL4A 5T3ZD 4ABVA 4QIUA 3G5XB 3RBGA 2E9JA 2XLLA 5JOFA 3V6ZB 3HZ3A 2B3RA 1OD0A 2A7RA 4HGKC 3GSXB 4WU5A 4EBQL 3VSVA 3RUGF 4E5XA 4MAYB 2IKGA 3EX6A 2C1OA 3AXKA 4NZCA 4YHMH 4XX1E 4QROA 2QHRH 2J8UE 1W15A 1ZP4A 3I9IA 3ZW3A 1AQKH 4Y16C 1YXDA 1AY1L 3SGDI 4QLKA 4UQ2B 4FP8H 2J3SA 4LUJA 2E7MA 1T2QH 1JXFA 3ISIX 4DUXA 3VOJA 1P84K 3I9AA 2Y23A 1DLHB 4Z3TA 2GSHA 4HZ6A 4L5FE 1MUWA 2G5BB 3TZVD 1HHHB 2PR4L 3IGHX 4YXKL 4IUGA 2EVFA 3PV6A 1MHCA 2X1QA 3U79A 5DUJA 1YDYA 5T8GA 4X5LA 3ME3A 3ABOA 2FQIA 4XBKA 43C9B 4UB0H 3FO9A 2RDXA 4K7FB 4RGOL 1D7CA 3FY1A 1N5YL 4Y0GA 3G8EA 3C5JB 3WK1A 3K30A 2K6ZA 3SODB 1QKZL 1T0NA 2DY2A 3H3KA 1NF0A 1G9NL 5IKCB 5DRZA 4RFEB 1W8NA 1JDFA 2Z92A 1SU5A 2J4WH 2XXCB 4KDVA 1FYTD 1WA1X 1YMHB 3FO1A 3EWXA 5F0JB 2R69H 3SCPA 5JO5B 4JDTL 2P10A 1XUZA 1BEYH 3RM8A 1BYDA 3BH9A 2NY2C 3E1F1 1TKWB 3MUGA 3GDBA 4K7PY 5JHLH 5DX7A 3GGWA 4M43L 3CH0A 4NZUH 1KMGA 5BZDA 1OXYA 5KBMA 2ZOXA 2EKCA 2P0IA 4LSTL 5AC4A 4B9CA 2BOLA 3DAQA 1T1ZA 1RK7A 3EYUH 2V8ZA 4FNQA 4JY4A 3MJGX 1NFBA 5AHNA 2GVYA 3QR2A 5G5DA 4LDEB 3PPFA 5IMOB 1LE9A 3NSXA 1DP0A 4UIKL 1FG2A 1GYLA 2BSSA 3IB4A 4M6NL 2PP8A 4KNUA 4HWBL 2ZSWA 3HC3H 1SM3L 4JX5A 1OCOB 1BAFH 1X5JA 4B5XA 3SCSA 3QI9A 4CC0A 1I8MA 5DS8B 3C2OA 1UB5A 2YPVL 1PCSA 2AEQL 4YVNA 1KB3A 3S9DB 3LCXA 1WT5C 3FSUA 4GIAA 3CVHA 2YMXL 1A5UA 2GITA 3RILA 3LDVA 3VK5A 5J5EA 1J01A 3IXAB 4QRUA 2ZZ3A 3D25B 2ZKWA 3GG8A 5DBUA 4XX6A 2BIQA 4GRSA 4XO3A 2INEA 3SURA 5K9OA 5DWPA 2CRMA 5DHVB 2R1YB 2R2EA 3WG6A 3AXHA 4KXDA 2ZJSH 2DOCA 1GGUA 5ID1B 2D7TL 5CZKA 5BJTB 1EJOH 1XLAA 4PUBH 3TYDA 4G9FD 4YE0A 2XH7A 1ZA3A 2Z1PA 3CT7A 1EDQA 3FFDB 5LQBH 1KJ2L 2OMVA 3SR7A 2R29L 3CVCA 4W9EC 4H8WL 4QEHA 2F61A 2WZPA 2AFNA 4L4TB 4ZFQA 5C9JA 2F58L 3O2WL 3BG5A 4WW2A 4ISVA 4Y19B 1MIMH 1CTNA 5EU7E 1LQAA 4KRPD 4RFNB 1AGDA 2NUXA 2NPLX 4WZ9A 5JOEA 2H6UA 5IEKA 1UTDA 4BDVA 3TYGH 3O0FA 5EKYA 3FT3A 3TH6A 4LP8A 3GHPA 4XOCA 3PC0A 5JZ7C 2PXYD 1NBCA 5GJTL 2VMFA 4HK5A 4NQCA 2R1PA 2ID5A 3F58L 5BOPA 5HATA 3BLLA 1ZLSL 1UYWL 5DZ9A 2P53A 3HG1A 4GUGA 4ZO9A 1PF3A 3AHVA 2F8QA 2R94A 5B39A 2Y2WA 1JGUH 3NDOA 3QUZA 1BAWA 5IVXB 5JW3L 1G1YA 2CR6A 4FA6A 4KW2A 3DKLA 2CCLA 3X2QB 1ZS2A 3LKOB 1KNWA 1ADDA 1R34A 3EJQA 3FSWA 4MSWB 1B0GA 1BVZA 3WIHH 3QAZC 4CVXB 1CZ8L 3QDJE 2Y0FA 4WWKC 1AQ0A 3JTBA 4LVEA 1VFSA 3SIKA 2Y1HA 3PHQA 1D5IH 2X1XR 1Q4NX 1HVXA 2VFIA 3SQRA 2XZCL 1X6NA 3S6OA 2PUZA 2XVGA 2VKXA 4Q8BA 1A2YA 3O11B 4Z7NE 3AQDA 3LM3A 2X6AA 3H0TA 3A4DA 4MAVA 3KM1A 5F2IA 1HZLA 3USBA 1I9CB 1QSED 3ISRA 1NCDH 5CEYA 1KTLB 1S46A 3GDMA 1R2SA 1BCIA 4QOKB 3VI2A 2INFA 2YGVA 4EAEA 2BZCA 4MS6A 4C58B 3SGKC 1K9EA 1O5KA 4FL4B 4KJWD 4LLQB 4UAHA 2XI9A 3GX9A 4Y2NA 1G6RA 2YD9A 1J4EA 2J72A 2Q01A 1T80A 4UDTB 4E9XA 4KX9A 3CB3A 2DUAA 4P23D 1JV2A 2XA3A 1F5ZA 4L5FL 5BU6A 3IUHA 4PB5A 3LCGA 1JTTA 4PGLA 1TUFA 1CB4A 5AVUB 4ZEPA 2XWCA 4DZBB 4DAGL 3PQYB 3L08A 4J7RA 1AKJD 3UF9A 3L9EA 3ARED 2DQUH 4LY4A 4QAIA 2HKAA 4UOQA 4GQGA 1NMBH 1VRSA 2FNWA 4GSXA 2QIIA 4M6ML 2XY2A 5H35B 2R9HD 4JFDE 3HRZA 1BMWA 4KVNH 4L6DA 3WN5C 5C2UB 1I8AA 1GOMA 3A5VA 3ZK0A 3CBRA 3CM4A 2V8MA 1W9XA 1XH2A 2J9XA 5I3HA 2VYOA 2A1WH 4AIZB 1XVSA 4EP8C 3U30B 3W86A 1QEXA 1RUPH 2G0WA 4XAKD 1EJFA 3AHTA 5C0NC 1V05A 5IMMA 2PDBA 4HTBA 3HG5A 5F4SA 4HCGA 5GGRA 4Q58C 1TPUA 3KRUA 1S7UB 4C6PA 4NIKB 3RVWC 1TFPA 1HP5A 1E2ZA 4PMVA 2VDNL 4HU0A 3GMMA 2HMIC 1TJGL 3E80A 3HFFA 3H23A 4OLVH 3DURB 5BW7C 1TJMA 2VDHA 1SXCA 3GMLB 1M71A 5E09A 1WAAA 5J9PB 4QY8B 2JQAA 5EO1A 1SJHA 1RULH 4Q7DA 5J04A 3GY1A 1MCIA 1AXSA 3BAIA 4FQIH 4GIYA 2ITEA 4WAFA 3ZKNC 3IRDA 4KJPC 2H6OA 5CP3H 1LEGB 4ODSH 2PA6A 3PL6D 3QXDB 4JAMA 5T3XE 3VXGA 5B1CA 4LBEB 3LI0A 4G5ZH 4N26A 2CUHA 4NQDE 3LMYA 3BG3A 5GRZA 2DPKA 3VXSB 4XVSH 1NFIB 1LNUA 3IDXL 1CQYA 1V5JA 2F8IA 3UAJA 4QXGL 4ORIA 3IDIB 4F15C 3W1RA 1A5FL 5DBTA 4Q52A 4Q56A 3ZTCC 1MY5A 3TO4D 2CLZB 5E2TL 5FYJH 1KB5H 4FXKA 4O2EB 2ITDA 3VWJA 4J40A 3DKHA 1A14H 3S5LG 4EPSA 4XWGH 3UJSA 2TPSA 2AEOA 2BS8A 3EYQC 1BKHA 2BINA 5HJYA 1MHEA 4XMLH 3ENLA 3DVIA 3QVQA 5XIAA 5G2IA 3NK3A 4BWLC 4HLZH 2VISB 4E8DA 5HMFA 5T1DH 4D1IA 3AXMA 1M05A 3O3AA 3MYJB 5CUSL 3D39B 1MLBA 3O6FD 3NWRA 1QA9A 3O2LA 3D85D 3V9EA 5CKAA 2OCZA 2FQGA 2C9QA 1DOSA 3WENA 1K4HA 3AB0B 4F1SA 4Z17A 1I0DA 5HJXA 5F7KC 1O6IA 2VT0A 3V6OA 2YXXA 3HAEG 4LT9A 2DDQL 5AW1B 4AH7A 1YN6B 3A24A 3MREA 4A2DA 5HINA 5ABFB 2VLKE 1G7UA 1UGNA 3GKZA 5F71A 1AOZA 3P82A 5EFIB 2YD6A 2ONEA 2UXVA 1Y7VA 1NELA 4WW1B 5FO8A 1I1XA 3GZPA 4FPSA 4JFED 3KRSA 5A8GA 3N11A 4QISA 3G1XA 3QPEA 4GEIA 3VI4E 3OZ9H 5HWNA 1QI2A 5F9JB 3T6XA 2WM1A 4XNXH 4FFZH 5F9AC 5D1XE 3QIUA 5I76B 1C9SA 3UWVA 3OXRA 4Q9RH 4A6YL 4ZFFA 4N86A 2XSAA 3OBAA 1R7OA 5CJOH 4P3CL 1WBYB 3EDKA 3UBXB 3WMCA 2NY5H 4RBPK 1XIFA 2DZAA 4K38A 1I2RA 5KSAD 4UT9H 4MNQB 4PHXA 3OD3A 1U8CA 3CHCA 1VFBB 4LLDA 3UY7A 2G96A 1XL9A 4OLWH 3TO2A 5B7EA 1UOVA 4Q8OA 3CD4A 3W11D 3PHSA 3QK0A 4WHTB 2OGYA 2QVNA 4TVCA 5ANME 1TPXB 2F5AL 1OP3K 1NOAA 4KRZA 4HN8A 4MMZC 4C56B 1UXSA 1NEZA 2TSBA 4NYLB 2AL1A 4WGWB 1WFNA 5JXED 4NNPH 4HKBA 5CNHA 2DM4A 2NX3A 3PWJB 3WQWA 1GKOA 2FATH 4ZXLA 4KH2A 3VABA 3L4YA 4RV3A 3FB8A 4MD0B 1TB3A 3QCUH 4C54A 4HJUA 3GBMH 5DMYA 3EOSA 4MXWL 3BP7A 1MEIA 1XSKA 4TL5A 4ZMZA 2I07B 3SBWA 5IF0A 3FYEB 1YPZF 3M0HA 3M5ZA 4Y5YA 4HU8A 1FLRH 4A22A 4RSYA 5DJ0B 1OM9A 3IEBA 4HG4J 3O6LL 4L29B 2IC2A 3Q6GH 1S7QB 1GZPB 2PPCA 5A2FA 4FG6C 1M04A 4K6AA 3UGXA 2C1PA 5FF3A 1EEZA 3F8UB 1LBMA 3PGDA 4XZLX 5J4MA 1NKRA 4Y16D 1THAA 4MOZA 5D7IF 4ZTOL 4B7IA 2FGWH 1XYCA 5IROC 4YN3A 4HU3A 2G0LA 1AS7A 3N2BA 4OJFH 1H1NA 1E27A 1ZIAA 5F1VA 4JFXB 1E0WA 3VKBA 4BSVA 4HWEH 1ZAHA 2ZAGA 5JHAA 1NWOA 4Q8PA 3S46A 4EN2A 3NCJH 3PZIA 3URQA 2GYSA 3WQGA 2DQGH 3R1GH 3T0WA 3EEZA 4G7QB 2BFVL 4GRLA 4IMDA 4BRJA 3DG7A 5DEFB 2E5EA 1F2JA 3WLKX 1NAML 2EG6A 1A6VL 2NY0B 3RWJA 4MQTB 4HWZA 1VZGA 1MRFH 4BFEA 2X38A 3O2DA 2YPLB 3QEGL 3MJ7A 3VU1A 4ILSA 4YFEA 2YDQA 3SCMB 4U3SB 4Y9EA 4W9CC 4DKFL 2C9SA 4AXKA 4P49A 2HKHH 5DUML 3ARBC 3MMWA 4ZPVB 3IJYB 3BKJL 5F3HA 1EQCA 1E9IA 4WHBA 5I9QC 4PJXA 1W1A1 3QS3A 5LBSL 5DANA 2FBOJ 5HHNB 1U33A 4NKDA 3TW9A 3NXFA 3MPGA 4KQ0A 3T2OA 2W9DL 1MVUB 5FDWB 1OF2A 1A5OC 1VZWA 5INCA 2Q20A 4AJWA 1IM3A 2NY2D 3O4LE 4L0YA 4IMLA 1WCGA 1A4MA 2IGFL 4IHBA 4LFHG 4WTXA 3HPFA 2Z8RA 4N9EA 2KKQA 2QFPA 3L65A 2AV1A 4P7OA 4S1FA 4BF7A 4L9LA 2FE0A 4AJ0A 4PBFA 3N9GL 3VE0A 3DIVA 4ETQA 1UP3A 2WK2A 4FQXC 5D1QA 1VBHA 3TN4A 4HZAA 2K1MA 2V30A 1HFUA 2VM3A 2ABBA 3TFXA 3F6JA 3L3OC 5AW0B 4LBRA 1DJXA 5DRWA 3V18A 3U0PA 2HDJA 5KMYA 4OV4A 2VERA 4LEQA 3C5XA 3KH3A 1Q9WB 3F4VA 1BRLA 1UROA 2E4TA 4OGYL 3TSMA 3IFLH 1HE8A 4PGDA 3IRSA 2VXTH 4RH4A 1Y1DA 4HBQA 2HFTA 4JDVB 3FCTB 2WC3A 5C9KA 1JXJA 4PMYA 1M3IA 5GGTH 3UO1H 4O11A 2JJVA 3CPGA 4MJIA 2VR4A 3UBFA 1TPC1 3FNDA 3PG2A 1KSRA 2H1XA 4WCYH 1KXQA 3KPSD 5A6BA 2YGNA 3RWHA 5L2KD 1VF8A 3HPLA 1YNTF 1S5IH 1IR1A 3GPEA 1U3JA 4IJ3C 4O1FA 5CGBA 3KOYA 3KYOB 3HA0A 1MXGA 2B1AL 3W28A 3KVQA 2BP0B 1QUPA 1Q6GA 4LL1A 4W8AA 4WKXA 5JLZA 3FLUA 3E96A 1S1PA 1N19A 3MHUA 2CLFA 1N9PA 4PUUA 5AVRB 2VO5A 1R46A 2EZ0C 4QRQB 1LJMA 5HBBA 3E3QE 1K3UA 5I28A 4C6MA 4GMTH 1L0PA 3OKMA 2Y06L 1HAWA 2JLLA 3B9DA 5D4QA 3QXAB 2ITCB 2G3MA 4XO5A 3ARDC 5DF0A 5I00A 5HYSB 3GC4A 2CPCA 4F7PA 1H3PL 3CVBA 4LVFA 4D6JA 3D3VD 1MW0A 2G3NA 3KH4A 4AD0A 1B0IA 3KLAA 1XF5A 2WKLA 1V3HA 2XPKA 1ND0A 5JZ7D 3MBDA 4HJTA 4JFFA 3MW7A 2D2GA 3PAVA 2ZUVA 3T08A 3E0GA 3FBKA 4NM8L 1ZGLP 3VTMA 4UB9A 5CBEB 2DQTH 1CR9L 3J07A 1J9SA 2FZ8A 3H7BB 4YLCA 2P52A 2VEGA 1FZKB 4WSJA 3VGDA 32C2A 3VGAC 1VKXA 1HIZA 5L4FA 1YY8A 4R4BA 2QVHA 2H2PC 3B7SA 3NGBB 3I6KA 1J5IA 3WBWA 1A3ZA 4DKTA 4RAHA 3S48A 3M0VA 1GT8A 4C6QA 5F70A 4H0LC 3STZB 4RLIA 3TBWA 3IMBA 3DX7B 5CSRA 3F4DA 3V1HA 1N8ZA 1IC7L 4WWKD 3H3BC 2Z7WA 5J1TC 4HWBA 2R7EB 3S4SA 1HFBA 3NL6A 2VMEA 5F2FA 5CILH 2WKOF 5AVTB 1AQDA 3DXAA 1EJWC 2AQRA 4JDZB 1ZCRA 2YPVA 3O3EB 5C9WA 4PTTB 4A2HA 2M26A 4FQQA 4Y5XC 1DWJM 1E9OA 3T07A 5AVVB 2K78A 2DZPA 2BLFA 2XYCA 3N85H 2CU9A 3PN8A 1KA9F 2AJXL 1MNUH 3VFUB 1XB8A 5TF1L 5K39A 1QFWL 3FBQA 3EJTA 4N3TA 4BHUI 3Q3GB 5LN4A 4M5YH 4AM0A 4AYFB 5TQ0H 4D6EA 1XCXA 4W9ZA 2FMNA 2VDIA 2OEKA 3BJFA 3JUZA 4HKXA 2Y62A 2DQIL 1U95B 1V6TA 3MB9A 1J9TA 4Y9OA 3N43B 3GXNA 1KJ2A 3F83A 4HPYL 4PRDB 1H1ZA 2A9DA 2R29A 5AAPA 4AMKH 2W88A 3D51A 5EUOB 5B4MC 5LCVH 1RD6A 3OP2A 3LNGA 4HJSA 4X6CF 1ZKAA 1CFTA 1A9EB 3H8NA 1I7RB 2BXZA 2W38A 2AJ3A 3B7TA 1UZ8A 1QYGL 2UVEA 4OM1L 4UNUA 4Z1DA 4JM0A 5KBNC 3L67A 2O7SA 3P9MA 3EBGA 1CGYA 4U0RB 2V4LA 1YHPA 1WGVA 4IOIA 4KNQA 1UWEH 3VB9A 4DVBA 1I8LC 4NO3B 1D5MB 2HPMA 1XQKA 1U8KA 4MHHG 4FN0A 3WCZA 5EZLA 1OB1A 2R8SL 4PY7A 4F7EA 1LOQA 5C0ND 3N4EA 3G5ZB 1C1EL 1W91A 4OCYH 2MSPA 2YGYA 4F7TA 5ILTH 3SYAA 1V7ML 3RYSA 1GXEA 2R82A 5D8JL 3VXUD 2J7EA 5DJAB 2Y7EA 3DNKA 5HAOA 1QPRA 3ABKB 4WO4B 4MBOA 4OQVA 1N67A 3RVWD 2YPKA 2H3NA 3CH1A 5DZJA 1Q0XH 4NVTA 4NUJB 1WITA 3Q8EA 1JHLH 4OFVA 3IXTB 1QO2A 4DNMA 2AOSA 3T8XB 4XPAH 2HMID 3HQNA 2W92A 3F7LA 5HYQB 3RU8H 1I1WA 1FJ1B 2RA1A 3S3SA 4I18B 5ABTA 4H40A 1PKLA 1X5HA 4N2IA 3MCYA 3TV3L 5E8DL 3QGAC 1LO3L 1YDOA 1NPJA 4OJYA 2J6EH 3FOLA 3ZKND 2R8WA 2QDVA 1ICQA 1MH5B 4KJPD 1GGTA 3B5TA 2NLJA 1SEBB 5I2IB 2X16A 1CYGA 3GNML 3SDCA 3VW3L 2EJAA 4TUOB 1ONWA 3MKGA 1EJUC 2J8UA 4JG0H 1HQTA 3M9YA 4ZOCA 4A1RA 3V5FA 1Z32X 5AW9B 4ZFZA 4JRXB 1GGIL 4ZUUB 4DZIA 2D7NA 4TMPA 4RUBA 4G7VL 3BKYL 3X1EA 1KLUA 1BEUA 4XP5H 2VFEA 2HWZH 2OXGA 1BQKA 3KPRA 1FXQA 1KC5H 4TNVK 3AROA 4Q9CA 2ZXWB 3KWXA 3A21A 3FQ2A 3BEWA 1CNVA 4AZ5A 5GRVL 3WHE1 4XKMA 2CDEA 3EYQD 4NHUB 3CIQA 2JIWA 5BQDA 2AERT 1EFZA 3V6OE 4RLDA 1CBGA 5A2LH 1DL7L 4MJJA 1CFSB 1YEKH 3KUMA 3UGRA 1YNYA 5BRZD 5BMFL 4P99A 5F97E 3U4BL 2BNQD 1AYRA 1B57A 5JUEH 2UUDH 1H0DA 2FJHA 3L1GA 1REIA 2IFFL 3S36L 3VQMA 3TBTA 4WZHA 5HNRA 5CSZB 1L6FA 3B0VC 2EIZA 4H7ZA 3ROLA 5A2CA 3AIVA 4GIEA 5DK2A 3C8KA 4WFGE 5GISL 5DCEA 3IGLA 3PDOB 4KKPA 3W74A 2UBPC 4GO6B 3HS8A 5EMLA 1NKGA 3QHOA 3LSBA 2L7EA 2YA1A 5T5NF 1U0QA 1KPRA 5EF2A 1LJYA 4JKPL 5DDHB 5D04C 1ODUA 1A0QH 1F11B 5D2NB 2VFFA 5CPOA 1F76A 4FADA 3KNBA 4FGMA 4G6KL 1K02A 4PJCB 1E5ZA 2MOGA 3HB3C 2Z0UA 4LSUL 5K4ZA 1MJ7H 1DZ0A 5TQLA 3CUXA 2MUCA 5DQPA 3X1FA 3PGFL 1UA3A 4EANA 5DRXB 4ZK8A 1RURH 1TE6A 1J8VA 1ZSXA 1VZHA 5B38A 2QSCL 1IUZA 4YNYA 2ZD0A 2WBGA 2HLEB 3KRBA 2F7FA 5HHOE 4LF3B 5AVXB 4AQ8C 2YK1L 4JZOB 4JFZL 3FO2B 1EZSA 4NI3A 5EOTB 4S38A 1K7EA 2E1DA 5IQLA 3EZ4A 3URNA 5AAWA 3G9AB 5GRJH 1FE8H 4HA0A 1KPVB 3I7RA 3BVVA 1VHPA 1XXFC 4ELDA 1SLUA 3TXZA 4X9GA 3WUGA 2ERJC 1Q0YH 3DK2A 1N12A 1OO2A 4JTIA 3C6SA 4ONFL 4WFEE 3I10A 5I5RA 4E6MA 1ES0A 4LSQL 1VFTA 5F1IB 1FNEB 3IU3A 4KZDL 2FEJA 4I1NB 1POJA 1GZQA 4XWOC 5IESH 3CHDA 2O9RA 3NJLA 1OX5A 3MLZL 1DBBH 3GHBH 2Y5SA 5JXQA 2ZUMA 2ASHA 2XTJC 5FJJA 4JPQA 1TQCB 3DOSB 4PBXA 3IDJA 3FUHA 1GGCL 3MJMA 3UC2A 5DJZB 4RDBA 2RTTA 3HMCA 1WICA 3O63A 1M9WA 5DCCA 2BM3A 1BIHA 3COOA 1LWHA 1B6UA 1D5ZB 4N2GA 4FG6D 3N44B 3V16A 2V2XA 2A3LA 2OO0A 3DG3A 4W84A 5G2NA 5AVHA 4L05A 2PGRA 3M17B 1Q13A 2C0HA 2D2CC 1S7RA 4WV1B 3LTYA 5IROD 5C1MB 5C0BB 2Q3OA 2H0PA 1TV5A 1NY1A 1OQFA 5EWIL 3ZXAC 2ZOOA 4YXGA 1HDMB 1F58H 4CVWA 3LQGA 3SGZA 4LNVA 3V4PB 3GUFA 4OLZH 4HIJB 4GJ1A 1VLWA 3W07A 4NKIL 4PJXE 4N0YL 3L4XA 1NGXB 3VCLA 1NUGA 2MNRA 2CBUA 4UUJB 2VKZG 3ISYA 3CEPA 3W37A 1NU5A 4DGWC 1NUNB 2Q3RA 5DC9B 4R7LA 1A6TA 3OQEA 4YR6B 4CMHC 3A6BH 4A6YA 3C8DA 3WNIA 3ZTEA 3T77B 2OI9B 2IJ0C 1IBHA 5GGVL 3BESR 5FYJD 3ARBD 4JFYA 5I1DB 3CDGA 3QULA 4OZ4A 1MY7A 3MTWA 4YC2B 3BQ5A 2GDUA 5I26A 3SO3B 3IPFA 3GMRA 4YTQA 4H8PA 4NRZA 4ZUWB 1OADA 2NMSA 3EW3B 4HJGB 3KYKH 2I69A 5ESQA 1FFNA 1EHLH 4QRTB 4PR5A 5K2ZA 4QXWA 1KLFB 2RQ8A 1OT1A 4A4AA 1GOHA 3RGVC 1Z9OA 1W3TA 3CNKA 3I65A 1JVOA 1CL7I 4MUPA 3W7LA 2BX7A 2EYSA 1B90A 4OM0L 5C09D 1F4YH 3OIHA 2NCMA 3QR0A 3QJXA 3T65B 2GJXA 1SFJA 1R5VB 2XRAL 4FQXD 3UPAA 1A80A 5E6IA 5KYWA 3TA3C 4H13C 3UR5A 4XPFL 1SUXA 3B34A 1DKWA 4HJJL 3IUDA 4GX8A 4IIHA 4Y4FB 4MJIE 3BTNA 4XVJH 5DC0A 5DMIH 4G80B 4P5MA 4ZE5A 1UKSA 2X2YA 3RKPA 2CO6A 5GS1B 4C55A 1LG1A 2H26B 3F7VB 4PG9B 4HHMA 2XWXA 3ITXA 5C6TL 3L9RB 3HE7A 3BE1L 4JFDA 4WJG3 3H2NA 5CGQA 5MERA 2Q9OA 4GH7B 4PJ8A 4U6YA 4G59C 1ITCA 3BWUC 2CJSA 4D3CL 1QWNA 5ERWB 5DS1A 1P1MA 3ZE0B 4C47A 2QIWA 2HKFH 3LQLA 1F4XH 1T3FA 1NVMA 2I17A 3MLWL 1IGMH 2ZX9A 1JPTL 2EE3A 4YBHA 1GJIA 3KVLA 2P5WE 4Z5RA 2DAVA 3W2DH 3U6RA 2B31A 2X1RA 4ORGB 1B5TA 1ZBCA 3NH7L 3EBVA 3FUEA 3VRIA 1UADC 3KLLA 1HEZA 3BVUA 3KPTA 4FYRA 5CEXA 3G5VA 2E6YA 4Z2HA 2EZ0D 1NAMA 1CLOH 1F1DA 4JFFE 1G94A 3AIUA 1RK1B 3FQNB 3SDXE 4GFSA 1ORSA 1GRWA 5F1UA 3ARDD 4GUCA 4KWSA 2CLHA 3PJTA 4LUTA 3W9EA 4J4PA 5HYIA 1X38A 1R87A 3T0EE 5LBSA 5MEOA 4PGBA 3O0KA 3T2PA 2VUKA 2G3ZA 3BD3A 3WE6A 3D47A 2UY7B 4ZTPL 2WD0A 4LEOA 5L6YL 1MCCA 3F2CA 5GGQH 3RDTC 2JKIS 3MRGB 3U46B 2VFGA 3TFBA 4OIFA 3KVMA 4K9EL 1WCBB 2WXLA 3D2UD 2MCAA 3H4WA 4Z77B 4XNZC 4PJIB 1A5MC 4KQ4L 3V4UH 2H0FA 4S0HA 3F04A 3MRJA 3EXLA 3VUPA 4BJLA 2NX5E 1NL0H 1OGBA 2H2PD 3KOZA 4JO4H 2APVA 1XLFA 3C2FA 1N70A 4G8GB 1Q8AA 3CSYA 1G6VK 1IM9A 3W1MA 1F3DJ 5GSVA 2Q02A 1I2NA 1MFEL 4NUGH 1QBAA 1YMME 3IPWA 1LMIA 2XZQH 5MI0B 1F73A 5DC4B 4M1CC 3AI0A 4BS0A 3EPMA 1SO4A 2D9CA 3MRBB 3FT4A 1E4XH 4J27A 3UBHA 1N8OE 4XCEA 1JD7A 5IG7B 5F7EH 3WU1A 3ARXA 1SGKA 2Y7DA 3R5EA 4H7VA 3DN5A 3TLQA 3IGUA 1EZWA 1ML1A 1IAIH 3WMQA 4EXAA 2HVBA 5E1AA 3FONB 2J5LC 4ZSOB 1AP2B 2J78A 2GBAA 3HGJA 4MDIA 2OR8A 4ES4A 3FCGA 1P7QB 3EX2A 2VLKA 5FLVA 3HM7A 2EXSA 2GUOA 3QY7A 4KS0A 6XIAA 3OHIA 2ADFH 3HI5L 4YWGH 2HYMA 4PJAA 4CNIA 3N3MA 5JORB 4MNHA 1CDYA 1VCVA 1ZVSB 4Q32A 4HXAH 4RJEA 5EN2A 4G6AC 1ETA1 2E7LC 1TYGA 5L2JA 4X2PA 4KH9A 5B4MD 4Z7VA 4YGAB 4JO2L 5AAMC 1N8WA 2FJKA 4O2FB 1I1FB 5KVMC 2ACRA 1SDDB 5IEHA 5KUKA 2WYSA 5D1XA 2X0YA 1U8OB 3LZQA 1GVYA 4GSUA 3MACL 4NKMB 3ANYA 3MHFA 1QNIA 4PJDB 4NBXB 1EXHA 2YQ3A 3LCYA 3MV9E 2CUAA 1E70M 1A1OA 4G5AA 4R7NB 2NSQA 1JGLL 1BD2D 4GB9A 3E9AA 5I3FA 1FWNA 4EVZA 3NGFA 4IBQA 5DHYB 3DV6A 3ZMEA 3DFOA 2H3KA 2XSXA 1ZBVA 2GQ3A 1NDZA 3U7BA 3C5SA 5ANMA 3CHPA 2X2HA 5GGSY 5JOPD 1QVBA 3F5WB 5KSBF 1A6AA 3K2KA 4N8VA 1ZLEA 2ISFA 3WNLA 1GHSA 4M8UA 3TVMA 1L7IL 2W81C 1K2DB 1MREH 1RIVH 2PWUA 1KJ3H 5KANG 2R56H 4DW2H 3AS0A 2P5NA 4M5TA 5MKGB 4NRYB 1RUQH 1QASA 4D6IA 2B5IC 5ETUA 1B31A 1VRDA 5D9PA 1F4HA 3KPRE 1BTCA 4UT7H 2IANB 3L3GA 2WMHA 4ABUA 1FVEB 1DFXA 4KERA 3HE6B 5DI8A 2G37A 3O16A 5MP6L 4XAGA 3RU6A 1H7OA 3A3XA 2QMKA 4DK5A 4NPYA 5FJTA 4FHBD 3APDA 1I8IA 5K9JH 3H4FA 4NZ3A 1PNDA 3BQUB 6PCYA 2BP3A 3PZUA 4J2XA 1ZXKA 3WO8A 3ZM8A 1GYNA 4IRSB 4FG2A 4BGLA 1P1ZB 3KDMB 3NIYA 2XWZA 3L0NA 4P7QA 3ECVA 3IJHA 3MWCA 4WHDA 4X6BA 1MJ8L 2BNJA 4UILL 4E0CA 3PFQA 5CHNA 5U7SA 2ZC1A 3S47A 1Z2KA 4HA3A 4EOUA 5CIPB 2VCCA 1XR9B 4YHZH 3G5YB 1XLIA 2H8PB 3QZNA 3HC4L 3L68A 1F18A 4GKOA 1BZEA 2VSDA 4K71C 1RXLA 2AQQA 3IJQA 5J1AB 3OZOA 3KW3A 3IU4H 3BICA 3LZNA 4XAZA 3TQKA 3C0LA 1BVKB 3HZKB 4AXWA 3SPVB 3K6SB 4XXWA 1UPPA 4E42B 2TRSA 4AZCA 1BFOA 3GHSA 3JV0A 4I6VA 1DFBH 4JTAA 4BR1A 2J66A 2QZRA 4M02A 1YCSA 1DJNA 3CQIA 5AW5B 1N6QH 3BQVA 4HUMB 2CG9X 1UWUA 2OMYB 4EZMA 3G1DA 3QSKB 1SVZA 2C7UB 3MQIA 4AQEB 5AKTA 5DHXB 1OX4B 4XN8A 2JIXB 1UFGA 5E8EB 3J2PA 1ZHNB 3O4LA 3C0QA 5I1EL 3ZZ1A 1JGVL 3QIWA 2PCPB 5F4WA 2IDTA 1NDMB 2HTLC 4KVCL 2ZXAA 4L8SA 4XBPA 2MTPA 4RZCB 1ZBWA 3HB3D 2VDKL 4PJ6A 2B0MA 1DEEB 3R79A 3BGAA 7REQA 4WHYH 5FV1L 2VYRE 3LK6A 3CSFA 1JZJA 3FQUA 4N0FA 4PS4H 2X6VA 4LY8A 4UMCA 4Y89A 5GJPA 5XIMA 1UCTA 4JFQA 2EUZA 4IDJL 3QLDA 1TVBB 3A6OA 5DA4A 1W1YA 1MCWM 3MRQA 3B3IB 4FI7A 4BYHA 2VC9A 4ANKA 4N6RA 4L37B 3RWCA 5LNRA 3PNWA 4B50A 5DJCB 2J27A 3HVDA 3UJRA 1CICA 1F97A 2ZP8A 3NIDB 1QP1A 3IJ7A 4P9HH 2XQBL 2V2DA 1MQKL 1JK8B 1YNLL 3S6CA 2Z1VA 2DZUA 4QHPA 3QUYA 4I9TA 3CH8A 3MU7A 4XWOD 2F6UA 2GTWA 4JRYB 4NQVB 1P5VB 2EPOA 1ZCCA 3PABA 3MOQA 4JYDA 5IHRA 4MD4B 3RPIB 3EKGA 1F3RB 2DQJH 2ZVRA 4H8QA 2XTJD 3VRLF 3IDUA 3SPJA 2ALWA 1EZLA 2VEKA 2IS7A 4S0SD 3UPBA 1NIEA 4BA0A 1BWVA 3MUHL 5ICYB 3RPDA 2HQAA 1VCGA 3KWUA 1W5QA 1IFHH 1BD0A 2DBJA 2XFRA 3W53A 5DVNA 2DV0A 1BVNT 3QV8A 5SWZB 1HL4A 1V93A 4WNQA 3S3CB 4ZAKA 4H2AA 1ZT1A 4PW4A 2F54E 3WLSA 4F92B 4ADIA 3WIJA 2XIJA 4JPKL 3DHDA 4HD5A 1QCWA 1WUFA 3A13A 2R0LL 5KSUB 1IGTA 4NQEB 4MNMA 5L8KB 4H88L 2NQDA 1UJ3A 3EZ8A 4X4KA 3INUL 3N14A 3F2LA 3DVNB 5KSVB 4B2DA 3BEVA 3F2BA 4BQ3A 1NFDF 4X0NA 1A4KA 4IIGA 1RZKL 3EGDA 1UXWA 1XCQB 1A02N 5MEPB 4KZEH 2W80C 2VD8A 1JHKL 5J5DA 1OW0A 2A38A 4ZZKA 3BL3A 1MDAA 4GJJA 1LTXA 1ILSA 4L6OA 1MCFA 4EF9A 2D73A 1KZYA 1HSBA 1PW3A 1TZIB 4RGNE 1TZ8A 1HJSA 2YRZA 3TF7C 3UNDA 1SOSA 2AMXA 1MJUH 2OS7A 2D31B 1C9DA 2CO4A 1IB5A 3IM1A 2A9BA 3OR7A 5I8KL 5EPDA 3OC5A 3LU2A 3RGVD 2MQ0A 4I9WD 3O8XA 4FIQA 3RPBA 5I02A 2CBIA 1FGVL 4DJFA 3GUTA 1A5KC 5EO0A 2IAMC 1HF6A 4PMDA 3UWQA 5F0LB 3JVAA 1HHIB 4S2BA 4FXJA 3P54A 2Y85A 4E9TA 3VTAA 4LX4A 3ZT7A 1YUHA 3FQRB 4AGPA 4AEEA 3TA3D 1DUZA 1BDYA 3S7GA 2V6AA 3JWOH 3HN5A 4J1UB 4PH6A 1M01A 5C7HA 1J2BA 1HILB 1N8IA 4UCFA 2GJ6D 4XCFH 2CDGB 2W0PA 4OU3A 3WH9A 3V4VB 1E0TA 2ON3A 3CV5A 5I1KL 4ANXA 4GBUA 5CWSB 3N40F 2HVKA 1U8HA 3GBNH 5TE6L 1MEXH 3GWJA 4DCQB 3U1SH 1E5BA 1OPGH 1P0DA 1K03A 4M03A 2O5YH 3NM3A 3S96A 2NQ9A 2WUCH 4FTVA 1XF2A 1HP4A 1UEMA 2NOYA 4QHLA 1GY1A 5GSRA 1HQRA 4WVRA 2GK1A 1LM1A 1E6PA 3ETBF 5IHBA 4BUHA 1V3LA 2Y88A 5EPMA 5IDIA 3QDGB 3TMLA 3VI3F 3BKML 1P5UA 1XYZA 2EIEA 2X88A 5T1KB 3QG6B 4L3ED 3Q2LA 4L3FA 3LQZA 1OSZB 4JFPB 1DUYB 5D7SL 2Y25A 1OINA 2IBBA 1U58A 1XT5A 3CC5A 4AV0A 4DYEA 5IHUH 2YXWA 2J7HA 3BIKA 4I7ZC 3UJFA 4JFOA 1R2TA 4N1CA 1E0XA 2KZ1B 3SRFA 1FORH 3TJPA 1L7TL 5CZ0A 4JYFA 3P40A 2R1WB 4ZW3A 4PJEF 3UTTE 2PCQA 5FFGA 2F2HA 5TFSH 4ZXBC 3FAXA 3VX0A 3DGRA 3T81A 4I5BA 3OKEB 1BVLA 1B6DA 5D96C 1JNLL 1U8NB 4O13A 1Y5XA 1YECH 4S2CA 3D08A 3BLBA 5I1GH 4UYPA 3RDTD 3WJXA 2X0HA 1QSFD 4ZMNA 4XKYB 5MEND 5JMOC 1GOWA 3BAWA 5DTFA 1SHWA 2H9AA 2X6CA 2JBMA 1T5WA 1NOFA 4PRAA 3NCYP 4Z95L 4H6QA 1XLLA 1CO1A 1HZKA 3R8BB 4B92A 3PGCA 4DT2A 4K9JA 2VDLB 4GAYB 1BQHA 4K2SA 4DGVH 2FJFB 2E75C 2Q6ZA 1MDTA 2CKBB 2E9BA 1W5PA 3CL8A 2AK4B 1C8PA 4MDOA 3BCFA 4BZ2L 2OMNA 4JHAH 1OYBA 4X4YB 4PUKA 3IFOB 5GJSL 2E7BA 4HJ0C 3T8LA 1AO7D 4J2PA 1UD2A 1BGAA 4M51A 4UTBL 1BFNA 1LEIB 2FIKA 5FOBB 3H12A 1MZZA 3QA3B 3TQVA 5JHBA 2OP4L 3CBKB 3SUSA 1BBDL 4L4VD 5L9DL 5T3XH 4NERA 1IFGA 4HSAC 4GRWH 2GJPA 4K8RH 4PJAE 5I3IA 1W5MA 2XQYG 5IB2A 1YRRA 3ZVIA 2ZOLB 1BFVH 4IEFB 4NQXA 4J3ZA 2FZBA 3HPZA 3UBXG 4WY7L 3TAOA 3ZR6A 1U2CA 3VFPA 1S2VA 4Z7VE 1MCSA 4RRPA 4YIQA 2VVSA 2FEEI 3NFNA 2A9AA 3VD5A 3BQ6A 1GS7A 2OEJA 1SFHA 3HURA 1JK9B 3PHOB 4Y4KC 5A8MA 1KTRL 1Z3GL 1I4NA 3QAQA 1TETL 3GNPA 1OAXH 4N2NA 2NUTB 1PYFA 3D9AL 4G6AD 3UVIA 4I90A 1L6GA 1Q9OB 1FWRA 3MUZ1 4AIXA 4BFBD 3WQOA 3LSOB 5E03A 4FIRA 3DRTA 3N4AA 2PBOA 2C5DC 2D8KA 1IEXA 1EXGA 1H7WA 4DWSA 3P0VH 4WGHA 1TOXA 1V7AA 5HDQH 2OL3L 4ZDHB 3BSHA 1FV1A 1EJVC 4ZX5A 4BWWA 3QJSB 4WCJA 3G18A 4XP1H 3GZAA 3WL1A 1ZA6A 4NC1E 4U1IA 3MYOA 2WGXA 5IOPB 5KG9B 1N82A 5HHOA 2HS8A 5GS3A 5E9DE 3WFEH 2FX7H 5I19H 2GFTA 2CWXA 1CFNA 4IRZH 2QQNL 4LCWD 3CVIL 4WKZA 1AR1C 1W9UA 4MZ3A 2BK8A 4FLHA 4DJMA 1QPXA 3IIXA 3D5HA 3C6CA 4AD5A 3E6EA 3MMEB 3APCA 4YHNA 4RXFA 2MKWA 2C9AA 3UYCA 3QFDA 2O6EA 4GEJA 2V5KA 1X4XA 1E4WL 1FZMA 3KS6A 4Z08A 2F84A 1BXUA 1N6VA 1YJDH 4OQTL 5EMMA 2NT1A 4DN3H 3EBAA 3H55A 2BZNA 4X99A 4RMQA 1JR1A 2R1XB 3C2YA 2XWJB 4O02B 3QQDA 4XB7A 2FPYA 4ZA0A 4ICNA 3ET9F 5AW7B 1BW8A 2RFXB 5C0GB 5HGHA 3KOWA 1ZS8A 3LOWA 2FTAA 1E5UI 1KY6A 1NANH 1KR1A 1XC4A 5CCJA 1A9BB 3C75A 3EA2A 2BIPA 3WQ6A 3WY2A 5TH2A 2GC4C 3P0YL 5EGRA 4ACPA 1BFTA 1CDUA 4JGUA 4K07A 5EEUA 1RZJL 4FG4A 2VOTA 3F12A 2GDVA 3S0CA 3GEFA 2P45B 4MA1B 2APTA 1I9EA 1YEGL 7A3HA 4OBRA 2WZ0A 5IMKA 1LGVA 4J9JA 4G43A 4PVMA 3G3MA 3MBFA 2WOQA 4GBXC 4CVZB 4F2MB 5ISZA 2W63A 1L9MA 2RAMA 4YLBA 3UTPD 1V0NA 1PIGA 2D0HA 3MLTA 1QPKA 3B7YA 4DEFA 3BUBA 3SZ6A 5TD4A 1PIIA 1OE2A 4I7WA 3E6FA 4XAYA 1ID2A 2WMKA 1ICTA 3WUBA 1X1OA 5J6SA 3BDYH 5D2LE 2V81A 1L0QA 2QPEB 2RDUA 3X3FL 3ELQA 1DVZA 4PYHA 2NVCA 4Y5VC 1FFPA 2IKIA 5F96L 4CD7A 4IOSD 2SEBA 1G67A 1IQWH 4G56A 3FT0A 1A6UL 4XV0A 4OCWH 3D6NA 1ZANH 3CUZA 2DD8H 5FA4B 4UXDA 3WG7B 4HU4A 3GSVA 1EUAA 2HTLD 4MMWA 3RL2A 4A3YA 1I8KA 3MXVH 2I9LB 3QIBB 4V27A 3O45A 2QELA 4MGXA 3AIWA 4MKVA 5D71L 4YHIA 2QULA 3I6EA 3OAZH 3NJ3A 1UQZA 3C08H 2CSPA 3VCNA 4PVBA 3IGXA 4L1TA 1QEWB 1XRFA 2ZXGA 5KYUA 3U1PA 3OPSA 2WNXA 4Z1PA 2XM2A 1IEAB 3PTQA 2PKDA 2QCHA 2NY5C 3DOHA 4URIA 5AUMA 4LAUA 4AZ8A 4H2HA 1CENA 3NQCA 1P4BH 3LEYH 2MHAA 5HYSG 5BUPA 1UR1A 4FRWA 1OT2A 3UTQA 3HOJA 4FQJH 3RX3A 3GJFA 3MUIA 3S2AA 3BUVA 3RWEB 3N91A 2BZDA 2PU0A 4Z7UE 2DJ4A 5FOJA 4MA7H 1XF4A 3WJJA 1C7TA 3DI0A 1QLRB 5IOBA 3CVHH 1P7KB 4BCYA 3AACA 3FB7A 4D9QE 4TMBA 2P5WA 3OYZA 1RIUH 1MCPH 3BKCL 3SQBA 3ABSA 1PZCA 1DBMH 3W25A 1WDAA 3OF6D 2EEDA 1EBHA 5HP5A 3K6NA 4XMPH 5EG6C 1W80A 2F74A 3QORA 1HSAA 1YNKL 1AD4A 4PJGB 5LAPA 4W88A 3JZ7A 2V17H 3I3DA 5CC7A 4J4KA 1FIEA 1MKFA 3GNXA 4A04A 1OTSC 3E8UL 3SDXA 3FA3A 1Q38A 2ADAA 3FCUB 3O7UA 4JPSA 2ESVD 3O15A 5BWFA 2C91A 1AC6A 3C9NB 3PBWA 2WQXA 4LVHC 5E0QA 3BP6B 3T0EA 2KAUC 1JWUB 4TX6A 2VW6A 1QBBA 1IGCH 4JTKA 3SQSA 2DLFH 5C0DB 4URKA 4L1LA 1PKNA 5C0CE 2AJSL 2FO8A 3TNBA 2NR6A 4E41B 3BCJA 4PYGA 1W1PA 4L0ZA 4LVOC 2EDJA 2NX5A 3ZSTA 2ORBH 4FOKA 4N3UA 3QFWA 3IFPB 5EMUA 4Z6AT 2EDDA 5TE7H 1PBGA 4APXA 5K4XA 1NMCC 1YMMA 5BV7H 3SECA 2ZXEB 1FHUA 2H90A 4J3UA 3U83A 2CGRL 1JP5A 3WKPA 4NHVA 3QEQA 3SEPA 4WTZG 2ICEC 2PP0A 4IL2A 3SYQA 3TNNB 2BASA 1OCWH 4WEMB 2GOUA 2GTQA 4RNRA 3WNOA 5I6PA 4JKLA 1XGUB 1J5TA 3B2UC 3K71B 4NO5A 3VFOA 3SDYH 4DP9X 3HEIB 1JNNL 3DGDA 3AWEA 2CH8A 5DLMH 4PRIB 2Q7YB 1JCMP 2JF7A 3R8QA 5FF7A 3N18A 4HGWA 4AF0A 5B22A 3U25A 2DTML 3MN8A 4LCCB 3Q05A 4LESA 4XC3H 1UZ4A 2O72A 4MWAC 5CAYB 1Q90A 2XZ7A 5E6SB 3F7RA 4GUFA 2PDGA 5HDRA 2XUCA 4PRNA 1P7BA 4XVTH 4O0QA 1HOCA 4U7SA 4U05A 1G7PB 4FR1A 1RFDL 4O57A 2IAMD 1CK0H 1M7DB 2QPSA 2ZNXA 4DUVA 1E4XI 4LSVL 4XSMA 4H8NA 5A3IC 5HVFB 1FSKB 3Q94A 2YZ5A 2RHGA 4Z0XB 5C08A 2XWDA 5JQHC 3TBSB 1UMLA 4ZFCA 4FTVE 4PJBF 2A5UA 4E9VA 3H42H 3AYRA 1T04B 4C5ZA 5SX5K 5I79A 4G6ML 2MQGA 1ZLWH 3SQOL 1G6RH 5FKYA 4JM2B 3GC3A 1E6OL 2VXVL 5E2WL 2GBVA 3HNSL 4AISA 1PD1A 4FXTA 4A39A 3DHPA 3OAYK 2VDGA 3RFAA 3IARA 4XXDA 5K9QI 2ADGA 3NPWA 3ZE2F 3UG8A 2OMBA 5D7JC 3AMCA 4U28A 2CERA 3NJGA 2WHVA 3MV9A 4DUOA 3ISWA 4FQ1L 2VXQH 2XNAB 3TYFA 5GZNA 1RAKA 4D6CA 3UJIL 4KXCA 4AVKA 3NPSC 3NESA 3CFBA 1OHZA 3QGKC 1KELL 4AYBA 4M61A 1YYML 1RPUA 3KPLA 3R8GA 4JZJA 3QN3A 1AK5A 3LEVH 4NNBA 5HDBE 4WENB 3RLHA 1P7HL 4NNAA 1UM6L 2R27A 4K7PX 1FIGH 2JJUA 2DEYX 4K8EA 2J1WA 2ODIA 4R53A 4HYTB 3BW9B 2JKRM 3BUIA 3GAKA 1BX2B 5AEAA 4GLRI 2GQ8A 4MXVE 4ACZA 4K7YA 4E9LA 4XGZA 2C3ZA 1UUSA 1ZT4B 3FIGA 2B3IA 3O6KL 5B8CA 4K4KA 4MJ5A 3UA3A 1MUMA 4AZ6A 2G8ZA 1IT9L 2EC8A 5E6ZA 5K7JA 2A4EA 3QI9C 3UXKA 3UCRA 4QXTB 4CW1A 4OCSH 3WUZA 4LLYB 3LG3A 3AMKA 4ZPTA 4PQXA 2RD0A 3NJHA 4GC4A 1VH7A 4Z78A 4GXMA 1KGUA 5IB1A 2PCFA 3DROB 2GSIB 1EA0A 2FHFA 3MWAA 3RR4A 1FFRA 3IBEA 2GUUA 1NIDA 4WY0B 5CCGE 4NKOB 4L6HA 5L4JA 4TVPE 1N4XH 2CUMA 1KYOK 1OE1A 5FYJU 3X1GA 3W1AA 1JV5B 2HPTA 5ESAA 4P4KA 3UTSD 3EH4B 3DTDA 4F0HA 1IIGA 5LXGH 2OA9A 3KZ8A 2Y6TE 1RVKA 1M7XA 1XH0A 4WDIB 1CU4L 3LHUA 3WD5H 5K9KB 3MYZA 4RDWA 5D7KD 1HNYA 4APQB 4AH2B 4OAWA 3V7AE 2DWTA 3NN8B 2FGLA 1TV3A 4HJ0D 4GUPB 4LE8A 3RZCA 1DSWA 2DW5A 4Y8EA 4P2YA 5I1JH 3CUHA 5GNXA 4TQIA 2WBXA 3GC5A 4HDIB 4M6UA 2XZ9A 2D3NA 4X61A 5IVZA 4FLRA 1DBJH 2QUUA 3DGBA 2VDOB 4Z2IA 1J05A 3GRWL 3D3FA 3GIVA 4G1MA 2OKOA 2OT1A 5F1NA 4JLRA 1E6SM 2DKSA 2E28A 4ZQKB 3L3IA 2H47C 3B04A 2XN9B 3OXSB 4KK8C 3GO1L 3ABMB 4GAAA 3TR9A 2YAMA 3O6YX 3PNUA 4UV4H 5HHQB 4S3FA 5BV7C 1XWVA 2X41A 3A0OA 3EEGA 3QUZC 4PWJA 2BSDA 3MLSH 3CCHB 1M57B 5AYUH 4TOYH 4G6CA 4Y4KD 1HN1A 1XTLA 2Y1ZA 5AVQB 4TNGA 1V54B 4XO9A 1M7JA 4NN6B 1H7PA 5LNVA 1RQEA 4JVPA 2CR3A 4IFOA 4L8DB 4X4XA 3W7GA 3RWGB 2WMPA 2EABA 3QJTB 3CHXA 4QRSA 2UX7A 4PW9A 4D8PA 2CJUH 4KBPA 3CN2A 3H7LA 1SN0A 1S9XB 2XN0A 1KM2A 3QQWA 2OZ8A 1XPYA 4OD3L 3VKDA 4JL1A 1E5YA 2BDNH 3NTCH 2W91A 4XNQA 4NNCA 3UZ5A 4JD4A 2WQPA 3CWHA 1HXMA 4H9XA 2VC5A 3C6LA 3W1TA 4GVFA 2G2NA 4H6EA 2GQHA 2DH3A 4AWSA 5CBAB 3RA7L 5LBVA 4ZMLA 5LN8A 2R2BA 4KMQA 4DP6X 3UR7A 2TRYA 1AR1D 4N1HB 5AKRA 3FUDA 3UOAB 4H8UA 5J06A 3ARGB 1LK3H 4UZUA 3E74A 3B2VL 1YEYA 2VRAA 4U4IA 4CEUC 1GK8A 4L9XA 3M47A 4WDWA 1YQVL 5LIUX 2FECI 4YXHH 1DVUA 4M80A 2Z31C 2J6VA 4YHYB 1CE6B 3S2LA 4BZ2A 1CDJA 4MYPA 2F0CA 4HEPG 2WWCA 3E1ZA 5TK2A 4UTAL 3EYSL 3LLDA 4WGVB 1G7HA 4XZBA 4M62H 1WHOA 3CZUB 3KGTA 4GZ7A 3HRZC 5CKGA 5I17A 1TIMA 1U92A 4FXGA 5D70H 3BISA 4UTBA 4S3JA 1E8XA 3OKDB 3EYFB 4FZ8H 1EGZA 2I5YL 4G8IB 3VXOB 2W61A 4BELD 4G70B 35C8H 1IL1A 3BWZA 4Q97A 1WWBX 3V52L 6XIMA 4Z3HA 2BCKA 1G7QB 3GZQA 5AKQA 4HOMA 2F54A 4QRBA 1JULA 3S3BB 4KCUA 2KL6A 3GSMA 1XRTA 2C9UA 3TFKC 5ISZE 4DGIL 2VLJB 4LVNB 1GPOL 3WQ8A 2IW0A 4IPNB 4MMXC 3LD5A 3ESUF 4IGBB 1F61A 3LVTA 1DVJA 2ZSVA 4AHPA 2H5UA 3C5ZC 1YEIH 4E2BA 4GVGA 1WXYA 4RWYH 1N64H 3NMEA 3V9FA 2CIIB 4MCNA 2B2XL 4GBXD 4UTWA 3VFRB 1IKNA 4M9OA 1U91A 1W0YT 3CZKA 4G83A 2JE8A 2PMZA 5I30L 1PEZA 1JTPA 2MIZA 4PVNA 5G4OA 2ICES 5F9OL 2K6YA 1XDJA 3B9EA 3G6JE 4IQJA 2YCIX 2OL3A 1DWAM 5KVFE 1IEQA 4X50A 1GOGA 1EJ7L 4KDWA 4IS6A 3W82A 5PTDA 1GNXA 3LNFA 1UB6A 2P8PB 4UQCA 4AEOA 5JW4Q 2UZPA 4FZEH 1ZP3A 1LG2A 4E3TA 3Q7JA 1DWGM 2B4CL 2BIOA 2OTUA 2Y7QA 2Q8BL 4R8WL 4TVPL 1JZ4A 4HPNA 4WJ5A 1SDAB 4RL3A 5H8MA 3K2MC 2OR7A 2V6HA 4XNYL 3DSNA 4HFWA 2VDPB 4MYXA 1TJHL 3D12B 4PS7A 1V10A 3LGGA 3DO7A 4Z7WE 1MG3C 3SE3A 4QLLA 5I8OH 3MCG1 1ASQA 4E2DA 1FNGB 4IGHA 1SHSA 2HMCA 4M1DL 2XXGA 4ERGA 2V2WA 1EO8H 4H9TA 4U4MA 1IGYA 5LGZA 4HUXB 3CZLA 1XUUA 5FDYA 2WN3A 3BYTA 4DZ5A 3ZRSA 3SDDA 4OQTA 4PE8A 1KFJA 1T0PB 4UTLA 1H0IA 5D93B 5G55A 3CZ8A 3BGMB 3Q9PA 1XGPA 2ADIB