4JFUA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
438
structure length
438
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-L-fucosidase
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
total genus 163
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jfuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jfuA01
1JF5A 2VUYA 1GJWA 2AAAA 3GXTA 3WDHA 1TZ7A 1M01A 1JZ7A 2XVPA 3MUY1 2C0HA 1EHNA 3A47A 3THCA 2ZXBA 4KGLA 3WH5A 2VVSA 3WNNA 4WKHA 1XSKA 1Q6EA 1GOWA 1ZBKA 2DSKA 3B8SA 2D20A 2X09A 2D1ZA 2NSXA 3MV01 2V3FA 2WK2A 2VRKA 4IISA 1FP9A 5M3WA 4NZFA 2EXOA 3SCNA 1M03A 2QF8A 3MANA 1S46A 3W26A 1TQWA 2OYMA 2Y5EA 3DYMA 7A3HA 3AQUA 1C8XA 1IV8A 2ZUNA 3AZRA 3WQ6A 4AD3A 3NJ3A 3N13A 1DHKA 3PN8A 5IHRA 3EJUA 1GOOA 1J0KA 4AWEA 5IXEA 4TVUA 4EK7A 3AZTA 7CGTA 3VIJA 2F7OA 1ZBWA 1O7AA 1JNEA 2V3EA 2XTKA 3T0AA 1FH9A 1UQZA 2J7HA 1KGXA 2W91A 1H09A 1JI1A 2ZWYA 2ZUMA 1BYBA 2B31A 1E43A 2OW6A 4MNJA 1EO5A 1PIGA 3AMCA 1QVBA 1R7AA 4EE9A 6TAAA 1H5VA 3ZT7A 1UYQA 3UG3A 2XSBA 4FNRA 2UY5A 1G1YA 3QR3A 1WKYA 3MMDA 4TOQA 4S3KA 1LWJA 2DSVA 2VRQA 2CPUA 4C7GA 1ITXA 4P8VA 3BMVA 1TVNA 2V5CA 1QX1A 1GCYA 3ARZA 4JCLA 2WC3A 5DT5A 2EAEA 1B9ZA 3A3HA 3VPLA 1UWUA 2ZX5A 4U33A 1LL4A 3VVGA 5FOOA 3WELA 1OD8A 2BY0A 1US3A 2YA0A 1X6NA 4D6FA 4M24A 2VX7A 5E6YA 1C93A 3TONA 4W8BA 1E5NA 4UZSA 3AISA 1VBUA 3WN6A 1UG6A 3AIQA 3W6MA 2FH6A 1HL9A 2BS9A 2JALA 1V3JA 1B2YA 1H1NA 3VINA 3WFLA 3WD2A 5A6BA 4ZXLA 3TTOA 4AD0A 1KGUA 1UH2A 1HJWA 4MTVA 3WQ5A 4LYRA 3VO0A 1W9DM 1GQJA 4CVUA 3CZKA 1HKKA 4PSPA 2JEQA 2GVYA 4HZ8A 1Y7VA 3BSHA 1R86A 2WCSA 2MANA 4AMCA 2VR5A 1W9BM 2A3BA 4AIOA 4EKJA 1T0OA 1R7OA 2V3GA 1QPKA 1BF2A 2XN1A 4GO9A 3WIJA 1IZKA 1MW0A 4IPNB 5A2AA 3GNRA 1BG4A 2YDSA 1QI5A 2XIIA 3WQ4A 1GJUA 2CIPA 2F61A 5GPRA 1QHOA 1W9XA 5ABFB 3APGA 1Q4NX 3PTQA 4JZ5A 2FDMA 5E09A 3ARTA 3CO4A 3GXMA 1UUQA 4JKMA 3S2CA 1QHPA 3I3EA 4J3UA 1ODZA 4P7OA 4MB4A 3VIPA 2DDXA 3D52A 3CUGA 2YA2A 1XCWA 1CBGA 1BFNA 3WL1A 4PTXA 2WWDA 3L4WA 3TTQA 1GOMA 1CZ1A 1W3JA 4QFUA 4AZIA 1MQQA 2X2YA 4TVCA 4JL2A 1QNRA 1FH7A 3THDA 1E73M 1XCXA 3VDHA 1HL8A 3D50A 4NRSA 1EIBA 4UCFA 4U5IA 1UQYA 1EH9A 1K9TA 4PMRA 1J11A 2OSWA 1E4NA 1R85A 5AC4A 2XFFA 2OWWA 1NOFA 3WH9A 1EOMA 3AS2A 4MPKA 3EMCA 2CBUA 3BUIA 4GZIA 4BCEA 3II1A 3EDJA 2EEXA 4CD4A 2ZUVA 4GZJA 1XD1A 2VC9A 5IHSA 2DPEA 4F9JA 1L8NA 1Q6GA 3BGAA 2WHLA 4J27A 2EPOA 4AEEA 3CMJA 5CQ1A 5A6KA 3L4ZA 3TP4A 1E6SM 4AZBA 2WBGA 1U30A 3PBGA 4NXSA 1UZ4A 1JYWA 1KCLA 3KZSA 4QAWA 1NWRA 5BXRA 1OD0A 4XB3A 1GHSA 1BHGA 1N82A 1VFUA 5A6AA 4W7VA 3UEQA 2J47A 2VX4A 4F9DA 4OOZA 1FH8A 5E70A 4GI6A 4MAVA 3ARWA 3ZSTA 4CN1A 3BVXA 2A3EA 1XC6A 2XGBA 2ZX7A 3A6OA 3GBEA 2GFTA 3UG5A 1QW8A 1DWGM 2DSZA 1MXDA 1OSEA 3N18A 4BQ5A 4F66A 1H4PA 3UESA 4W89A 3GH4A 3VU2A 1TR1A 1G0CA 4PRWA 2FHCA 5CPSA 3VMPA 4JFUA 1UA3A 1I75A 4BS0A 1V3IA 3LRKA 3AXHA 2VO5A 4HA1A 3WEOA 2JIWA 4KMQA 1Z32X 1E6NA 5KZ6A 1C3FA 1CPUA 2WHMA 3SIMA 1CXFA 2EQDA 4MB1A 4KGJA 4AIUA 3OLIA 3TTYA 5A6SA 4D72A 2ZICA 4W8AA 5I6SA 4X0VA 1HIZA 2WMJA 3VIOA 1ESWA 1RP9A 4M1RA 1TQVA 4NX0A 1PX3A 4LX4A 4W5ZA 3AYSA 1FP8A 4WKFA 1JD7A 3WQ8A 2WVSA 2W63A 1R8LA 3VD5A 3OGSA 1CNVA 2VOTA 4D6EA 1UHVA 3IAQA 4UQCA 2E9BA 4WSKA 1W3HA 1QI2A 3IJ7A 2QMKA 3O9NA 4JFVA 3ARXA 3CH9A 5CLTA 1BYAA 4D6GA 4Z2IA 3OZPA 1B1YA 2X2JA 5M5DA 1HJQA 2JE8A 1MWOA 5ABGA 2QMJA 4GQQA 4MJ2A 2WYSA 2V3DA 3VD7A 2XFYA 3L2LA 4Z2KA 1NWTA 2J7DA 4IPLA 3WNOA 4ML4A 1WPCA 1E0VA 3GDBA 5IFTA 3AIWA 3GM8A 1PAMA 2GJRA 1HJUA 1UKQA 3WEZA 5HPOA 2DQXA 4CU7A 3SEPA 2XPKA 4AD4A 3DX4A 5EB8A 4AW7A 4E8CA 4QDMA 4AY1A 1BAGA 1C91A 3SUSA 2VVNA 1ZU8A 1OB0A 1MQRA 1CGWA 1CECA 4BQ3A 2WC7A 3UERA 4CUCA 4CN6A 2Q8XA 1HN1A 3LRLA 3I3BA 3HZ3A 3FHAA 1BGGA 1OM0A 4PMZA 3WQWA 2VCBA 1BG9A 1B0IA 2J8GA 3W29A 3UG4A 3N15A 2DGAA 3W81A 3BUPA 4H8HA 2XYLA 1PEZA 3AI0A 3VD4A 3EDEA 4PMQA 2F7RA 1KTBA 1SZNA 1V0NA 2GDUA 1QWNA 3G6LA 3VSUA 5E1QA 4AMXA 1JZ4A 3BAKA 3DYOA 3ARSA 1EDGA 5AYBA 4DWSB 1C90A 2VCCA 4UQEA 5I5RA 2VURA 4BZYA 9CGTA 4M81A 1HJXA 2FHBA 3W37A 2UY3A 3EJSA 3CPUA 2GK1A 5DF0A 2Y8VA 4UOJA 1CXLA 5D9OA 3SCUA 4JFTA 4NZJA 2PBOA 5GNYA 5HDRA 2ZUSA 1EO7A 4HOWA 3WF2A 2YLAA 3DDGA 2WSKA 1FHDA 2G41A 4PUEA 4J3XA 1UWIA 3WDPP 4WK9A 2YKKA 1E4LA 4AD5A 4C7FA 4H8UA 1IT0A 5CZKA 5C71A 2OW7A 2PBGA 4RE4A 5EFFA 1NP0A 4D6DA 2PWGA 3TV8A 3L4VA 3B9AA 2J75A 3MKKA 2EPMX 3CIVA 4LYQA 1E4MM 3W24A 1FA2A 4LGXA 1J01A 3VX0A 2CNCA 3VUPA 5A1AA 3GXPA 4TVDA 5LA1A 2F1AA 3L4XA 2HISA 5BROA 1X1NA 4HA3A 5A8MA 2WLYA 4AZCA 4B9YA 1NARA 1OCQA 3F4VA 3AIUA 5E0CA 2VMFA 2WMKA 3U7BA 2WLZA 2J7FA 4KRUA 5A8QA 1U33A 1B3VA 1SR0A 1VENA 1UR1A 3CHFA 3LRMA 3WY1A 5ABHA 4UTFA 3AHYA 1V0LA 5DO8A 3A21A 2RGLA 2VTFA 2GJPA 3EJTA 5DFAA 3WMBA 1GOIA 1AQ0A 2E0PA 4DO4A 3LPGA 1ZS2A 2W66A 1QNSA 2WSPA 4UFJA 4FLRA 3MSGA 3MV11 2XM1A 3WUEA 3BAYA 2FGZA 1CGUA 4KWUA 2CHNA 3CZSA 1NH6A 3CUHA 3OLDA 1J0HA 5HPCA 1BGAA 1J0IA 3S6TA 4ACZA 3ZOAA 1CGXA 3WY4A 5LA2A 1EDQA 4PMDA 2A3AA 5CPQA 4M80A 3SUVA 8A3HA 3O6AA 2WZEA 1XYFA 2DT3A 2CYGA 3IAPA 4UQ9A 1C8YA 3K4DA 2YFOA 3DHPA 1DTUA 3POCA 4D6JA 1TUXA 3F5KA 4WKAA 2BY1A 3PZUA 4N42A 3SCRA 4UOQA 2WANA 3CC1A 3KEHA 3KL0A 5ECUA 1TQTA 1V03A 5CG0A 2E8YA 4FNTA 4M8UA 3U5UA 1JFHA 5M03A 4Z2LA 1EDTA 3N04A 5ABEA 3HG3A 4S3JA 1BQCA 5A2CA 1MW1A 1UWRA 3ARVA 5CJ5A 3SCTA 4D6HA 1UKSA 3DX1A 1E1EA 3U5YA 1KR0A 5FKYA 1LLOA 2FHFA 1KBBA 3CZEA 4HMEA 2WPGA 3DX0A 3DX3A 3PTKA 4MAZA 2D23A 3G6MA 1H3GA 4H41A 1GQIA 4NZCA 5FL1A 3T0DA 1JZ2A 1JF6A 4WF7A 3CZGA 2ZUUA 1SYTA 4JAWA 3VGBA 1XHGA 1ISVA 3AROA 3WDQA 4J3SA 4GXPA 5EFDA 1GQKA 1CGTA 4AXNA 3WD0A 4AYGA 2YBUA 1JXKA 2VL4A 3WSUA 2GDVA 3MMWA 4CCCA 1TA3B 4EAMA 1UR4A 1V0MA 1D3CA 1KR1A 1BLIA 3FW6A 3QHOA 4PBGA 5A94A 2BVDA 4F8XA 1GORA 4DWSA 1JGIA 3NDYA 3HG2A 1H41A 3JUGA 2WW5A 2PI6A 4WJXA 3RJXA 2Z1KA 3MUIA 2YLLA 3POHA 5DMYA 1OINA 1CXKA 1J0JA 2YBTA 4F79A 1W32A 3MMUA 1XSIA 2J62A 3MI6A 3OLEA 3VNYA 4GO8A 1ISWA 3HG5A 2VX5A 3WH6A 4QLKA 4J7RA 1GUVA 4PCTA 1ZBVA 2W67A 3M07A 4J3TA 4Z2GA 5C8BB 4UFLA 1TE1A 1BYDA 2WHJA 2VZOA 1J9YA 3J7HA 1MVYA 3S5ZA 4GKLA 3H54A 3KWXA 1KTCA 4B3KA 3RMEA 4J3WA 3O2LA 2ZE0A 2OYKA 1KB3A 1CYGA 1J18A 5A8OA 4E4PA 2EJ1A 1BPLB 4YN5A 2WMFA 1HWWA 4A4AA 3K8MA 3HG4A 1E71M 3BLPX 1E6XM 2YL8A 3RJYA 4P7LA 3VDBA 3RO8A 1QW9A 2DH3A 1C92A 3LXBA 3QOMA 2VT0A 3BUBA 3S5YA 1VJSA 5EMYA 2BHUA 2VNCA 1XGZA 3KLKA 3FXYA 1E0WA 4W88A 5IFPA 3T2QA 2CERA 2HVMA 1WZKA 5CSYA 4MJ4A 2O9OA 3NDZA 3WNLA 1OBAA 2VZSA 1SFSA 2Z1SA 1UH3A 2FGLA 1KCKA 4AZGA 4FNSA 2GK1B 3W53A 1B3ZA 1X6LA 1SMAA 2D0HA 1DWFM 1KWKA 1HP5A 1W3KA 1R87A 2QPUA 1LQ0A 4AZ6A 4AIEA 2YL9A 5CLWA 1H0GA 3EDKA 3W28A 2J7BA 3I3DA 3T08A 4JHOA 1OWQA 3PZVA 5KEZA 1TFVA 3N17A 3N11A 1PX8A 2WM0A 2BY2A 2IUZA 2NT0A 2WVTA 3OG2A 3A22A 2AMGA 1MYRA 3L4UA 2E4TA 2C8NA 4D1JA 1QOXA 3K4AA 1HKMA 3RM8A 2FH8A 4HMDA 4AYSA 3WD4A 5CXPA 2YL6A 1JZ5A 1CLXA 4Q7NA 4GQRA 1EGZA 2RGMA 1FFQA 4AEFA 3BH4A 1W3LA 2FE0A 4P8UA 4AZCB 5GNXA 3SUWA 3SURA 1CGVA 2X0HA 5C70A 1HP4A 1JZ3A 3EJRA 1V6UA 1F4AA 5IDIA 1H49A 3VIKA 1JXJA 3AXIA 2O9PA 3IANA 1TQUA 4A3YA 3ALFA 4TUFA 4NF7A 1C7SA 4WIWA 5D8WA 4P8XA 3VD3A 2IGTA 1V3KA 2EO7A 5A95A 1LF1A 2DSUA 2PWEA 4X0NA 3SUUA 1UKOA 1B3YA 1LG1A 2F18A 4HOXA 4U2YA 1PBGA 4YHGA 1EXPA 1ZJAA 4H7VA 3CUJA 1UD3A 1ECEA 1XH2A 4MB5A 4CD5A 2V5DA 4PMXA 3PZQA 1VJZA 1UZ1A 1H2JA 1QNQA 2CCRA 2WKLA 3D5HA 5D9NA 3BAWA 1WDSA 3LPPA 3VIHA 3GZAA 4PTVA 4M82A 2GJXA 4W7UA 5GNZA 4ACZB 3U57A 4W8LA 2IXUA 5D9PA 1NOUA 1QHZA 1JIBA 2OLHA 3GH5A 3VSTA 2VZTA 3ZO9A 2VX6A 3WDRA 1TA3A 4CD6A 1WO2A 2BY3A 3CHDA 4R5EA 3OGVA 2D0GA 2WCGA 5FCZA 1ZJBA 3BAXA 3MU7A 3ALGA 3A24A 4PYSA 2XWDA 3NSNA 2PC8A 3HMCA 5A6JA 1KFWA 1M53A 1H11A 1DEDA 4L4PA 3PZNA 1AQMA 2EPNA 3VKKA 1R47A 1VFFA 3EMQA 1W2VA 5I77A 4AISA 3BLKA 1JDCA 4B9ZA 4FNQA 1DWHM 3H53A 3VMNA 4OIFA 5D9MA 2PB1A 3NSXA 2V38A 1JFXA 4GI9A 1XH1A 2WAGA 3BVVA 2XHYA 3AFBA 1JD9A 3PZMA 1HF6A 3PZIA 3GTNA 1HVXA 3CUIA 5FIPA 3TTSA 2BHZA 2TAAA 3L2MA 4ATDA 1OIMA 3QGVA 4OGZA 4HA4A 2EBNA 4RE2A 2W61A 1DWJM 3KE0A 1O6IA 1CGYA 4OKDA 3VM7A 2G3JA 4ZENA 3W6LA 4MNMA 1A3HA 2CBVA 2VRJA 1TMQA 2ZX8A 1BYCA 4CGTA 1KWGA 2YDQA 5I3DA 3BVTA 2EPLX 1SMDA 2X0YA 6A3HA 2X8RA 3D4ZA 3VILA 2AOSA 1HJSA 1B3WA 4NRRA 2ZX9A 4QLJA 1W1TA 2BHYA 4UOZA 1W91A 2J78A 4QP0A 3ZJ8A 2Y24A 3WY3A 1GQLA 1QI4A 3GXDA 5BRPA 4GPNA 1CXEA 2JF6A 3EDDA 4HOZA 2EPKX 3AICA 4JIEA 1KQYA 1VBRA 4OOUA 5HBFA 4V27A 3A5VA 3LXCA 3ZR6A 4U3AA 3D3AA 1W1YA 4CU6A 2WB5A 4FF5A 2CETA 2WZHA 4D71A 3T2PA 4HTYA 2EADA 4JCMA 4D6CA 1VFMA 2OWXA 1Q6CA 3EMZA 4FK9A 2F8QA 3IJ8A 3CHCA 3FN9A 3OB8A 3DHUA 2DEPA 2W62A 3GBDA 1WCGA 1JAEA 3K8LA 2WMHA 1JG9A 4UQAA 3KL3A 1NWUA 2CXGA 3NYDA 1WP6A 1GVIA 3ZT6A 2WC4A 1W1VA 1BSIA 4YPJA 3BVWA 1WZMA 3AZSA 1V02E 2D3LA 1WB0A 1HKIA 1UR9A 5TD4A 1GVYA 2XIBA 4P7RA 2XWEA 1XYZA 3AMKA 1UD8A 3LXAA 3AS1A 1JI2A 2D2OA 4ZXOA 1JL8A 4CCDA 1QI3A 1WDPA 1J0ZA 3WEMA 2ZOXA 3LPOA 4H04A 3DDFA 2ALWA 5I2UA 1HTYA 1WDQA 3VGHA 1E6QM 1P6WA 4FLOA 1GZJA 2J77A 3SCPA 1E0XA 5D8ZA 3MO4A 1LG2A 3M7SA 3DC0A 3VD9A 1W2PA 2ESCA 4TTUA 3F5LA 3AMLA 2O9TA 4AD1A 3M6DA 4BF7A 4W84A 3B9DA 3ZQ9A 2QLYA 2EACA 1U2YA 1ODUA 5E9AA 4E8DA 1JZ8A 4C7DA 4UZUA 2O92A 5GQBA 4UQDA 1MFUA 2G4FA 3BAIA 1RP8A 4ZEPA 3BLBA 5M17A 2A3CA 1K9FA 3QHNA 1UR0A 3ZM8A 1KQZA 1V3LA 2BV9A 3DYPA 2WVUA 3BUDA 2OYLA 3LMYA 2E8ZA 4UFIA 1ZBCA 4PUDA 1W1PA 4MADA 4DO5A 1UKTA 5AY7A 3EBVA 4W7WA 5AYIA 2UY2A 3EJPA 1ISYA 1GOKA 2ZXAA 4UFKA 4CCEA 3WUFA 2X2IA 1VRXA 3E1F1 3AS3A 1LL7A 2VQTA 1KXVA 3WUGA 1B30A 1EHAA 2XJ7A 4JHZA 1CENA 3FAWA 3UR7A 2YA1A 1RH9A 4PMNA 1E5JA 4XV0A 2GUYA 3GXIA 1WZLA 1OIFA 4H2CA 2DT1A 3BCDA 2CESA 2WCAA 5JBFA 1V6WA 3H55A 1B90A 2DH2A 4DM2A 3BXWA 3WDIA 2W92A 3NUKA 8CGTA 3AYRA 3W27A 4OBSA 1XH0A 1CIUA 1FFRA 1K9DA 2WWCA 4OJYA 5LA0A 1OGBA 3WUBA 3ZJ7A 4DUWA 3QOKA 1HX0A 1WDRA 1NM9A 3FHQA 2DIEA 3NIYA 5I24A 3OA5A 3UR8A 4CN4A 1G01A 1PZ2A 4X9YA 3CHEA 2GSJA 1VEOA 2W5FA 5JIWA 1XV8A 1PPIA 4TX6A 3ARYA 4AZ7A 3FY1A 2GJXB 4FNPA 2D24A 4HMCA 1W9UA 3AMDA 1TG7A 4ZFMA 4L4OA 3WMCA 2WKGA 4V2XA 2O9RA 1HNYA 2XN2A 2BXYA 4OUEA 3TOPA 2F2HA 3BCFA 5A6MA 1E55A 4CKQA 3AIRA 4PMYA 4W86A 4CU8A 4JKKA 5JUVA 3ARRA 3SUTA 1CLVA 4ATLA 5CPTA 1XSJA 3UCQA 2ZWZA 1CTNA 5BXSA 3SCSA 4BA0A 5JIPA 5BXTA 1AQHA 3VGEA 4TX8A 1US2A 4CD7A 1JYNA 4GI8A 5BCAA 3N1AA 3BMWA 1FHLA 4J3VA 3WNKA 1UD2A 2WBKA 1UH4A 3ECQA 3IK2A 1R46A 2BVYA 1G5AA 3L4YA 3VGGA 2J74A 4HZ7A 3VIGA 3K46A 2WVVA 5HXMA 3UETA 4PSRA 1K9EA 4DUXA 1M7XA 1E70M 2E40A 3SCWA 3HJEA 4UFHA 3EDFA 1V3HA 3CZLA 1E40A 3ZIZA 3VGDA 1M04A 5FD0A 3NSMA 4B15A 2E3ZA 4U3CA 3WBAA 4AC1X 2J4GA 4JKLA 4UNIA 2BXZA 4W85A 3VTRA 4M56A 1CEOA 2DT2A 1VIWA 4XZBA 3WENA 1BTCA 1WNOA 4AZHA 1CDGA 1J10A 1E9LA 1MFVA 2DT0A 3B9EA 5CGMA 3RPMA 1NWSA 5AC5A 2J7GA 1IZJA 3VM5A 3WFZA 3AXXA 3WD1A 4BQ4A 1RPKA 3WY2A 3IGUA 2XVGA 1E15A 1NP2A 4WSJA 4YHEA 4FLSA 2WMIA 5A2BA 3PZTA 4V28A 1RD6A 1E6RA 3WMSA 2JF7A 4ZE5A 3ARQA 2JEPA 2UY4A 3ARUA 4B16A 1DWIM 3TA9A 4PTMA 2ZUTA 2F7QA 3K1DA 3WDJA 6CGTA 2Y4SA 3AIEA 3LX9A 1ITCA 3T09A 3WNMA 1TQSA 2ZXDA 2E9LA 1I1WA 4JFSA 5BYWA 3L4TA 3ZSSA 1JYVA 1JZ6A 3ZT5A 3WD3A 1ZB5A 3SCOA 1D7FA 2WZIA 5A69A 3N12A 3FAXA 1G9HA 1WE5A 2VZVA 3OGRA 1B3XA 1QWUA 4XUYA 4UR9A 2J79A 1GNXA 4HU0A 1BVZA 3D51A 2D73A 5BRQA 4URIA 2CKRA 1GHRA 4D1IA 3SCVA 2YDRA 1PJ9A 1UWTA 1VEMA 3HU7A 3GXNA 4P8WA 2CBIA 1AMYA 1UOKA 1LWHA 1GPFA 2XG9A 3VOCA 2G3NA 5A8NA 3GYCA 2CITA 1L0PA 5FL0A 4R27A 1MW2A 2G8ZA 1VFOA 1CXHA 1DP0A 2VR4A 1HJVA 1E3XA 2CEQA 4EANA 4J28A 4RL3A 3WKZA 1KXTA 3RCNA 2J7EA 3VIFA 2XM2A 4PTWA 2J25A 3AHZA 3RIKA 4GZEA 1V08A 1KGWA 3BUQA 4CD8A 3BAJA 3CZ8A 4Z2HA 1Q6DA 3W25A 3QHMA 1XD0A 2D3NA 4PEEA 3HN3A 4PMVA 1VF8A 1MXGA 3WF1A 5A6LA 4OZOA 1QNPA 1FOBA 3AHXA 4OBRA 5I23A 1UR2A 1NQ6A 4P7QA 4FNUA 3CZJA 4HZ6A 3VSVA 3RILA 2EABA 3U7VA 1V3MA 1AVAA 1EA9C 2JIEA 3W0KA 5JBEA 3RM9A 3ZJKA 4MB3A 1OGSA 1V6YA 2QHAA 1CXIA 3A4AA 4MNLA 4GINA 2BNJA 4CVWA 3OZOA 1OT2A 2OSXA 1UD6A 1Q6FA 3W38A 4P7NA 3WNPA 1PZ3A 4NI3A 3VDCA 1YQ2A 2D22A 5E6ZA 2DSWA 3M46A 2Y8KA 3CTTA 4XX6A 5LYRA 3OIHA 4LPCA 1E1FA 1VAHA 2XVNA 1MW3A 1UKPA 1E4IA 4MDPA 1HVQA 2YJQA 1E72M 3GNPA 1QBAA 3OLGA 3IJ9A 4MDOA 1TCMA 3A23A 4QCFA 2X05A 2OSYA 2ZUWA 3A4XA 3OBAA 5E0FA 1UWQA 4NSBA 2G3MA 3AS0A 1I1XA 4QLLA 4U2ZA 2YFNA 4RE3A 4AMWA 2CHOA 2XGIA 4U31A 1ISXA 1E3ZA 3W82A 3K8KA 5HNNA 1JDAA 3AOFA 3LPFA 1D2KA 1PX4A 3AHTA 4TXEA 4HP5A 2ZX6A 3T0BA 3AIBA 1QBBA 4FLQA 4A3HA 1UA7A 1C7TA 4LYPA 4U5KA 4ZE4A 3AMGA 1V02A 4MNKA 2J8FA 3VDAA 2F1BA 2UWFA 5JBDA 3MUZ1 3PZGA 4KRTA 1UD4A 3AIVA 1R75A 4Y7EA 4IUGA 4E2OA 1JYXA 5ABFA 2VZUA 4LQ1A 3AJ7A 4ATWA 5A3HA 1CWYA 1E6PA 4K68A 1YHTA 4PCSA 1O7DC 4LXFA 4PN2A 3WH8A 3BSGA 1OT1A 2PF0A 2WNWA 2X2HA 3GXFA 4PMUA 1VEPA 1MQPA 4DWSC 2YIHA 3DECA 3VX1A 3RDKA 2PWHA 1J12A 3BC9A 4UFMA 3T2OA 3EJQA 2PWFA 4W87A 3NCOA 4ACYA 3PTMA 3SCQA 1BVNP 4M29A 2FYVA 3CZNA 1V6VA 5HOSA 3VNZA 4B3LA 4Z2JA 1QNOA 1JDDA 1EOKA 2F7PA 1HKJA 3VIMA 1E6ZA 4BQ2A 1EQCA 4H8VA 4HPGA 2A3HA 4NXKA 2XN0A 1HXKA 2YL5A 2XUCA 1VB9A 1OGGA 3WBEA 3KLLA 2ZIDA 3GNOA 1LL6A 1PS3A 4GIAA 2VJXA 1GONA 2IXVA 2W4XA 3WF3A 1UASA 4WLCA 2WVVB 1QI0A 4JL1A 1DWAM 2QV4A 4DM1A 5I79A 2WHKA 4DO6A 3ZR5A 1K6AA 4KH2A 5D4YA 3CUFA 2VI0A 3BVUA 2G3IA 3EYPA 2VQUA 3D4YA 1NOWA 1R34A 2XVLA 1HXJA 2PWDA 1A47A 1GW1A 3MSDA 5EBAA 4FMVA 1EQPA 2NW0A 4TTGA 3A4WA 4AZ5A 1TVPA 2BVTA 2D0FA 3W4RA 4XZWA 3FNDA 1JAKA 1G94A 4N0RA 3CV5A 3ARPA 1B31A 1W9VA 4PMOA 2OWCA 3MS8A 3AHVA 1E56A 1WZAA 3ZMRA 1J0YA 3CBWA 3VGFA 5I0DA 3WQVA 1UWSA 5BXPA 2JFEX 3DX2A 3GH7A 1KBKA 1H0IA 1UD5A 1C8QA 1HT6A 1GOQA 4W93A 1V0KA 2XFRA 3PZ9A 5CSUA 4HPHA 3N9KA 2XSAA 4Q22A 5DT7A 2WMIB 2BFGA 2CKSA 5A6BD 2J7CA 4DWSD 2X1IA 5F7UA 1PIFA 1R33A 3WL0A 3ZJ6A 2ZXQA 2XVKA 1WAWA 4QCEA 1KXQA 1V6XA 4IM4A 2VCAA 3CLWA 1ISZA 1W9PA 3PZOA 3MUAA 7TAAA 2WMGA 1KXHA 1XRVA 2C7FA 3VMOA 3CMGA 3WH7A 4DUVA 1LJYA 5DEZA 1JNDA 3VIIA 2WXDM 2CBJA 2Y2WA 1F4HA 4UQBA 3F5JA 4AD2A 5I78A 5BWFA 5A8PA 4JFWA 4D6IA 2NT1A 3KL5A 2QPSA 3CGTA 1ZL1A 1UR8A 3RM4A 2YOCA 3PHAA 3WF4A 4W5UA 4HU8A 3WF0A 2DIJA 5CGTA 2E9MA
chains in the Genus database with same CATH superfamily
2OR7A 3WTXA 2EYSB 2G5UA 5AKQA 3GR7A 4EI6A 4U1LB 5AW7B 2ZXBA 2I60H 3ZDWA 3HN5A 3QUXB 4NT6B 3MV01 3LV3B 3MKVA 1WGOA 1GT8A 4QHLA 3VFTA 5IFHH 2ZSVA 5F1OB 2BNQB 3SGUA 4HX1A 3BP6A 2H6PB 4JDTL 4MNQD 3VYPA 5HHPA 4P57B 2JGYA 4H13C 1KXQE 4ZTOH 2OW6A 4P5KA 2AABH 3ULUE 1F42A 3WJMB 2HH0H 2UVEA 4P59L 2X0WA 3CX5J 3QR3A 4HH9B 5F6IB 4Y88A 5T3XE 3PFMA 4IIQA 3HG1E 1V05A 3BMVA 4HXBH 2O4MA 1W3NA 4H9XA 4ANWA 1D5BB 5FOOA 3SQLA 3KHQA 2R56L 2VD9A 4ES4A 5IW1A 3QBUA 1MHEB 3ARGC 5D2NC 2YHGA 3DETD 1MH5A 4FZEL 5J8LA 3BWSA 3PXJA 2QQKL 1QO5A 4QE4A 5L0QC 1E4XL 1BZ8A 1HKKA 1J05A 4G6AC 2FDBP 4FXGB 3DURB 3ZL2A 5E6IA 1NEZA 3APTA 1MUJA 3LEXB 1SR9A 4Y8DC 4GQ0A 2XIIA 3KM1A 1FVDB 3LN4B 5JHLL 4WW2C 2BFVH 1W9XA 4PJBA 2X4RB 5AAPA 2HT4D 4MB4A 4R7OA 3RU8X 5I19L 4Q8UA 1KTRL 2WWDA 3MRQA 4PG9B 1CZ1A 4DJDA 2D31B 5IMOB 4Y9CA 1MQQA 4A6YH 3AADB 2F5AL 2JJTA 1E5ZA 1HL8A 4UCFA 1IEBB 1FNHA 4OE7A 1RAKA 4QGCA 4MPKA 3FL7A 4JRYA 1LP6A 4GQBA 4BCEA 4PJEE 1MUCA 4WW1A 1Z3GL 2FJGB 5ACZB 2R59A 3TAKA 3IDXH 2GTWA 3U79A 2BIIA 3BJLA 3VWJC 1IC1A 1SFDA 3ZDYB 1XF3A 1JYWA 1I3UA 4FOJA 2Z0BA 3H2CA 3CZFB 2Y1AA 2X9XA 4PBWD 2ED8A 5A6AA 2VX4A 1FH8A 5FYKE 2PGWA 4HKPA 3KYAA 2WN3A 1UG9A 3TCLB 3FFCA 3NO3A 1QSEB 3ZU8A 4N2AA 5IEHA 3QDGE 3GH4A 3PJWA 4DP6X 4F37K 5E24E 2WXOA 3VMPA 2EUZA 4M6NL 3AXHA 5FLVA 4JPSA 1GKRA 3G5ZB 1T0MA 4PRRA 1NMCC 4D72A 1ZT1A 3RRAA 1AIZA 2D2CC 1CDCA 3VFWB 1HH6B 4WI8A 4XSMA 5D38A 4ZFZB 5AW0B 2A77H 3TS8A 3DX5A 1KJVB 4WI4A 4GQ9H 5IWLA 3ARXA 2FX8H 1BYAA 2XKSA 1IT9H 4WI7A 4NOBA 1GW9A 7TIMA 4OECA 2JE8A 1UURA 4JFHE 1XGUA 2V3DA 4JFXB 4RMUA 2DRUA 3Q5OA 1G7QB 3FSZA 2F8OA 3WNOA 4M48H 2HQAA 3KW7A 3AYTA 5KVDE 3EF4A 2VH5L 3QI9C 2C4XA 3OD3A 3SKJH 4NN5B 4ODXB 3Q43A 4I3RH 1KCXA 3ULUD 2HTKD 2W0KA 4F2UA 1XXXA 5CEYA 3D0AA 4LSUL 3SDOA 3QT2A 5T3XD 4ZTPL 4Y1SA 3MTWA 2WC7A 4F92B 2DMGA 4QR7A 3HZ3A 5CU5A 2CSPA 1LP9A 1OAUL 4AH2A 1JPST 3BX7C 1FZKA 5JPMA 1MHHA 5DWUH 1RKRA 3DHMA 3EDEA 2VXVL 2Z29A 4P0DA 5A16A 3FUKA 5HAOA 1RVKA 4S1QL 2WLIB 4PY8I 3T3ME 3FU7A 3OKMA 4O1BA 4FQQA 3P3UA 4NENA 4UTBL 3RVVC 2BSSB 1D6EA 4ORZC 4IP4A 4LLQA 3FTXA 3HN8A 3C8FA 3LKQA 3RTQD 3ZE0E 5TF1H 2CLZA 4HZLA 1HKWA 4OCMC 4NS0A 4I18A 2OZNA 2G41A 1CD0A 2HROA 3WDPP 3A13A 3B56A 3PV6B 4WK9A 4NY2A 1TZGH 4AD5A 3AY2A 5FEXA 4PWFA 5CZKA 1N0XH 4Z0XB 5EEZA 4PD4J 3BOVA 4LOEA 2NWRA 4LGXA 2CNCA 4BFGA 4IKIA 4XZ9A 4Y8EA 4TV5A 1X1NA 3ZE2E 3UZVB 1M2OA 4PFHA 4HCDA 4M7ZC 3F7QA 4GSUA 1P1ZA 3GUWA 2I57A 3RLHA 5I6XC 4U1KA 2E6DA 4Z42C 1A5LC 4KKBD 2GJPA 3O6FA 1IIHA 2FX7H 1QNSA 5FO9A 2WSPA 5JHMA 4EPKA 2PDIA 4ODVH 5FYKD 3KH4A 5HMSA 5LBSA 1ILSA 2XU9A 4GW4A 4LAJH 4XO5A 3W00A 3S6TA 5SV3A 2G5WA 5L7XL 1EYEA 3QV9A 3QDGD 4S2CA 3IAPA 4M93C 3K4DA 1DYSA 4PV1C 3F2LA 2CZDA 2WANA 4W9JC 4DGVL 3O3RA 4X6CB 1OW0C 3FYIB 4FNTA 4PREB 2R0WL 4K3JH 3TIEA 2QVNA 2X7LA 1NLDL 2C15A 3OAYH 5FGRA 1R1CA 3L3IB 3BGFB 5CD3B 5TJWK 5DZAA 2IKGA 4N9OB 5AYQA 5CCHE 2H9GB 2NX5D 4DSYA 1RULH 5EB9A 3QQDA 3P74A 1L2UA 5MERB 4HK7A 2X4OB 3WUZA 1X39A 1EX1A 5C0AA 1JCMP 4FG6C 2EDHA 1SYTA 1ISVA 3AROA 3WDQA 2R4RH 2ROYA 3URNA 1HEZA 1RPUA 4JFHD 1D2PA 2VGLM 3RPKA 3IXAA 4UB0H 4YDVA 1IBDA 1N68A 1S8DA 4F8XA 4EMZA 1JNLL 2ZA3A 4WVXA 4Y2WA 3GSUA 4O18A 2G75B 1B57A 4LVAA 2G2RB 5IJCC 2A0LD 1AD4A 2FEJA 4X83A 1XLAA 2ATPB 1F58L 4RMRA 1TV5A 3BAEH 3DJSA 4GW5B 1IAIM 1C9SA 3P0WA 4MJ5A 3PWPB 4GNJA 2XYBA 3BD4A 3B0YA 1XYCA 3RA7H 2WMFA 3DKHA 1ICQA 3A9IA 4MHBA 1FC1A 4YE4L 5I30L 2DH3A 2IQAA 3N43B 2H1PL 3LVEA 3FSUA 2XN9B 1L9NA 3EXJA 4NN7C 1AZRA 1SVDA 1KCRL 3OQEA 3NDZA 4FFWD 3B04A 4LRSA 2V0AA 3TR2A 1FG9C 1PLCA 2GK1B 3LH9A 2D0HA 2FVMA 1DWFM 4UTMA 1PCSA 2ZSWB 4X4XA 1VESA 3C2SA 4AQ1A 3PRZA 2VXQH 3QPQC 4GJIA 2APSA 9XIAA 3OG2A 2A73A 5KZDA 5KBPA 3RZCA 4XNMB 3NCWA 1NL0L 4GRLA 5JW3H 3ANVA 1E5CA 3LGDA 2X4QB 1G7HA 5KVEL 2J72A 3MGOA 1KO0A 1MCKA 1M05A 4FXSA 3V18A 5DI8A 4MYAA 4IP5A 1OTUD 3IDIB 1W3LA 5E8OB 5GNXA 3QO1A 3U9IA 5L9FA 1ANUA 3O45A 4HUUB 1YUHB 2OMYA 5T1DH 2FZDA 3ZO0A 4FQIL 5DRXA 1DQKA 2WYIA 2EO7A 4W70A 4X0NA 3ZDXE 1YX1A 2GJ6A 4PFMA 4R7JA 3S34H 3UL4A 3QWOB 3NIGE 1KM5A 3OG3A 3C8KB 5HHME 4PTVA 2EECA 5KYWA 1CU4H 1QHZA 2X6CA 3VSTA 1A6PA 1YQVH 3ZO9A 2PCPB 3LQZA 1ZAIA 5JW4N 4GH7B 5FCZA 5IBUG 1FIGL 2CLPA 3BP4B 1RY7B 4CMHC 1KFWA 2QJIA 4GT7A 1AD0A 4L9DA 1EEQA 2EG6A 3HGJA 3GWQA 2WO5A 2QQNH 1GEHA 3RLGA 4UINH 4FFZH 5BO1L 4ZOEA 3FPYA 3VXMB 5G4NA 3RL2B 4O0QA 1W3IA 1DLFL 4GI9A 2WAGA 1OGAD 4G80B 4KETA 5BS0E 5JO5A 3FUNA 4ZMQA 1ZVYA 3UBGA 2TAAA 3GMPA 3GD1C 4HS6A 5D7JC 2VQ1B 4HA4A 4H26A 4I5XA 3D0LB 2ZUQC 4UQ3A 3RVXD 4Z0SA 2P8MA 4RV3A 2M2DA 4LKCB 4JANA 4CVXA 4O15A 3VE0A 2EGZA 6FABH 3PHQB 4IGSA 5TK4A 4IL0A 3AO0A 3S1UA 4EN3D 4ZFFB 3G1FA 1W17A 3FOMB 3OW1A 3ML8A 4UOZA 2MTAA 2Y24A 3GXDA 2PLKA 4MWAC 4XK2A 2HRHA 1TNNA 4DXVA 5D8JL 3B8DA 4K5MA 1TJHH 1OAQL 2WZPA 2WB5A 5FM5O 3TAOA 2NZ9C 2BP5M 3ARDB 2PP9A 4HK5A 5DYOA 1XGTA 3K8LA 2YQ3A 1JG9A 1BKHA 3DTDA 2Z4GA 1WP6A 2GVGA 2MPAL 1UUMA 2ZYRA 4WJG3 3THMH 1WA3A 3GC4A 4L56A 3RWCA 2E25A 1R5IB 1CD1B 2DEYX 2RFXB 3M88A 3PJSB 4OKVA 3N4AA 3BE7A 1HTYA 3VGHA 4ADTA 1E6QM 1RK1A 1W0WA 3Q8EA 1NBCA 2AQOA 2OEJA 1Q9OA 5D8ZA 3WE6A 4IQHA 4C58B 2P45B 2YWYA 3RG6A 3F5LA 2O9TA 4GIRA 4BF7A 3NPUA 2FIKB 3ESUF 2FEDD 4PWGA 3LCIA 3QZWG 5K9QG 1OPOA 1V5JA 4R7DA 4LYKA 4MHHI 2P5WB 3NQVA 2NY6C 3HMWH 1RP8A 2NY1D 4GJTB 2X9YA 2Z31C 4HKXB 4Z7QF 5AYTA 4CAGA 1W1PA 4BEQA 5CZ0A 4JHWL 1YEWA 2C7UA 3ASNB 1ISYA 4Z7VE 5GRVL 2DUXA 5HDWA 5C2BL 1BXXA 2WWOA 4AY8A 3MJ7B 2XJ7A 3K71A 1GGBL 3GXIA 3ZQXA 1WZLA 3N1GC 3VFSB 4J1OA 3O6LL 4LSPH 4M4PA 4AI7A 1NFDF 1GYCA 2CRZA 1JJKA 2WWCA 3DMMA 4AG4H 1HCFX 3I4EA 3ZJ7A 2IAMB 4K55A 5BZDB 2FD6H 2ZCKH 1UT9A 5B1KA 5KYUB 3FHQA 5I24A 4Y16D 3GMOB 2Y6SD 4FQHA 5EULV 3S5NA 3PUUA 4KUZH 1N64H 4A7QA 1WXZA 5H6HA 3L3KA 4CSPA 1IAII 2WKOF 3RHWK 1TG7A 3UJIL 2AQQA 2WKGA 2AV1B 3T2NH 2ZZ5A 4UT9A 3HUJE 2WNQA 3OWRA 4KWSA 1IAKA 4CKQA 4H88H 3VFUA 3TFKD 5I8OH 3SUTA 4P2QE 4ATLA 4GXUN 1MFMA 4AF0A 2RD0A 5EU6D 5C0CA 4ZMGA 4M7LL 3EBHA 4TX8A 4KQNA 4PJFF 4WV1B 2WBKA 4GUQA 3IK2A 1P84K 2HMIC 4QR6A 4F4RA 1EJUC 2GY7B 2V2XA 5BS0D 3HPAA 1FGVH 3W2NA 3S6CA 1KJ2B 1G69A 1X5HA 3FGCB 4HJ1A 4JE4B 2QKSA 1BQKA 2I16A 4C6FA 4O02H 1FV1B 2QZ5A 2J6XA 5FD0A 4AC1X 2J4GA 3Q8BA 3VTRA 2PYFA 3N9SA 3QULA 1VFBA 5I5MA 3LB6D 5HDOA 4RA3A 4ZRGA 2OX1A 3T2LA 4LSBA 1NWSA 4EIVA 1MJJB 2J7GA 3LHTA 4OVUA 4YHZH 3P9MA 3CFDB 4PLKD 3ARQA 5FSDC 4DZ5A 1JRHL 1K4GA 2QCDA 4NI6A 4XMPH 4O4YL 1DSFL 3K1DA 3UC2A 1P0EA 3HRZA 3T09A 1ZCRA 5E8DH 1T5WB 4HGXA 1JYVA 3GSOA 1ZLPA 4MQXC 2DYRB 5I3HA 3C61A 2DYPB 2FR4A 2JELL 2J79A 1DBJH 4HU0A 1T6VN 4IF2A 2Y7QB 5TTRA 1BQHA 1GHRA 4P8WA 3P4OA 1NGQH 5H35A 4MY1A 2Z92B 4MJZA 2TMDA 3GYCA 2Q76B 7PCYA 3MWAA 2HX9A 4DN1A 2EXYD 1I4FB 2NY4C 1WSST 4PJ7A 3DZ1A 4WY0A 2PE4A 3D6NA 3WKZA 4ZNCD 3WJLC 4IMKC 4D2JA 4YQXH 4JAMA 5CJ8A 2AGJH 1AO7E 4CD8A 4JFFB 4YHLL 2BP8B 3BMXA 3UR2A 5FCSH 3BUVA 3URBA 4PMVA 2BBFA 2WBJB 3D48R 2GBUA 1QNPA 5DFTA 1TPFA 4OBRA 3LIZL 5E2UH 5IVXB 5D4IA 3QDJD 3CN2A 5DYFA 1JPDX 3DESA 1QRNE 2QHAA 4CVWA 4L4VA 3UTSB 2NY2B 4PRBA 4QHKJ 3EA2A 3CTTA 2YAPA 4GSDL 2A2QT 1E72M 2HRGA 2PTTB 3E3QE 3QB7C 1LVEA 4AGLA 2G3MA 3IKCA 4DPBX 5HYSA 5TDOA 1I1XA 4RE3A 3GSNA 5KOVC 4XVEA 3JQOB 43CAA 3LEYL 3ZX1A 4ZE4A 3QFJD 2UWFA 2YC1A 1GS7A 1BX2B 1UD4A 3NJIA 5DQPA 3SAZA 1E6PA 4KK5C 3H2MA 4A7SA 3WH8A 4P2QD 4I8YA 1DVUA 4HT1H 4IKLA 4RNFA 5I16B 1L6PA 3DECA 2OLAA 3GU9A 2PWHA 4JO4L 4X80L 1T83A 5TE7H 4H25B 1DBAH 3UABA 1IO4C 2C3VB 4F2MB 1JTPA 3TTEA 1KBGH 3DHJA 1MFAH 3SQRA 3C3NA 1GHFL 2OLDA 3MNZB 3KLLA 4TUKL 1PSCA 3C2AL 2F54E 2IXVA 1HSBB 3NCFB 3GAKA 1K6AA 3DFTA 4WTXA 2VI0A 4ZDHB 1JULA 2HVOA 1WAAE 4RETB 1DBMH 4OCWH 3LKNB 4U1JA 5EBAA 4PCNA 3UPAA 1XKJA 4YL4A 5FDWA 4XP1L 4WDUA 5JQHC 4JTCA 1GGCH 2XWXA 4HYTB 5TGBA 4OZIE 5TIMA 5GGRB 4ZBCA 1DVQA 5I0DA 1CYWA 2PYEE 3PL6D 2XFRA 4HPHA 3MCLL 2O61A 3NFSH 1G4RA 2VXSL 2J7CA 1S38A 2VDKH 4NJ9L 3UW6A 3RZWA 2OX5A 4N8VB 1GZ1A 3HPSA 2B59A 1EX0A 3IXTA 4OCXL 4R2GD 5KZMA 3TZVB 1N4XL 4M1DH 2Z0IA 1HKVA 4YSRA 3OHXA 4NPYA 1ZANH 3B05A 4WUUB 5AYYA 4NRXB 2BGSA 3FO9A 4OJFL 3L9CA 3GSRB 4L8SA 5TQ2L 5BNXD 5TDPB 2JCCA 2XVPA 4CNSA 1KPUA 5DS2A 3QH2A 5DVKA 4WENB 1ZBKA 2NSXA 5CR1A 3Q7JA 2NYYD 2QF8A 5EPMB 3TNNA 5IHRA 1AO7D 1OK0A 4AWEA 3ZYIA 4MMXA 3G5XB 2V3EA 3RDTA 4KH9A 3QEUB 4US6A 1Q9KA 3QEGH 3C86A 1JOIA 3ANYA 2QPEB 1IM3D 1E43A 1DL3A 1LE9B 1FWCC 2AEWA 5AOMA 2AXFA 2GJLA 4KHXL 3Q6GL 2OMXB 1G1YA 3UEZA 2V5CA 3INUH 1FFPA 1GCYA 1NBZA 3OPZL 4PGZA 1NEYA 3LS9A 5I76B 4I88A 1LL4A 5CP7B 3B4NA 1X6NA 2YA0A 2BMBA 5C97A 2L4OA 5AUMB 4ZD3L 1MWAL 1T22B 4ZXLA 2JLPA 4GW1B 2VERA 1AY1L 4MTVA 4MAUL 4WW2F 2D9CA 3BSHA 2WCSA 4QRAA 5A2IH 2E76C 1DANT 4I7ZC 1T0OA 1TSIA 3H0TA 3D2UA 4GO9A 4YDIL 5I74C 2XWBB 1P4BH 1DIDA 4Q3MA 4QG8A 2DVUA 3E0VA 4XNAA 1S2TA 1N5AB 3WUWB 3ZKMC 3MNWA 5GPRA 2OL3H 3EOAB 5ABFB 3PTQA 3CN1A 3PXHA 4OQ1A 1BGXL 1ODZA 2CXKA 3IN2A 3SBFA 4NQCE 2X1RA 3RIAF 5E03A 3MV9B 4UNUA 4QIUA 2VDNH 4OFCA 3BJTA 1G7JA 3JV4B 2GUUA 2VDQL 2WTOA 5JA8B 1E73M 4TV6A 4ONOA 2B20A 2A6NA 3UJSA 2XLLA 4HF5H 2YR3A 3NPXA 2WXQA 4R97B 2F54D 1D7DA 5AYUH 3DIFA 2EEXA 1SVZA 3L6FB 3E2QA 4XXCA 3TP4A 3BLOA 1NOAA 2F74A 3W3BA 4QAWA 3MXVL 1EGMA 4WO4C 3X11B 3LLFA 2G5RA 4XODA 3DO3A 1MG2C 4OOZA 1FF5A 1ADOA 4MPQA 1XG3A 3UYCA 4RDYA 4E0RA 2RDTA 2ZX7A 3BESR 4F58H 2PYED 4HJEA 1JTTA 3ROLB 4URKA 2K9FB 5F96L 3N1MC 2M83A 1AACA 5ANMA 1IC5H 3URAA 4G8AC 5C9XA 2XT1B 4HYVA 1SYVA 3U2IA 1NWPA 3GS7A 1Q1JL 2Z26A 3QG7H 5DHMC 4GRWE 4N2EA 5HJXA 4YL2A 1YTDA 4X0VA 5B39A 3IS4A 4OT7A 3LEVH 4DN4H 3HO8A 4NX0A 2HPIA 1WBZA 5J6GB 4H1LG 3SGGA 2W07A 4OH2A 4EI6B 4D6EA 3GI9L 5FV2A 4JD4A 4C4KO 1Q2RA 3GMNA 5J8OA 3O9NA 2AK4D 1NDZA 4X2PA 1LL1A 4DX3A 4PRTA 3H2EA 2O5ZL 4QHLB 5CZVL 5M5DA 3VFTB 1OX6A 2ZSVB 4ZB0A 1M3UA 3QGKC 4IRSC 4HIJA 4F8NA 4MCMA 4HX1B 2LTQC 3FB5A 5LUMA 3TROA 3ESOA 4HC1L 3IDGA 3BP6B 1N2RA 3LY6A 3IJEA 5HHPB 1BIIA 3R4IA 4ERIA 3NQ6A 4GUCA 4P5KB 4ECNA 1EJVC 3BYTA 3BPLB 4OWGA 2EDRA 2FBJH 3IRPX 3ABRA 1IHIA 4IIQB 5E08L 3MOAL 3IPWA 4DCQA 4WXYA 3LTSA 3VG0H 2J8GA 2Q6ZA 3UG4A 3M7FB 2FIQA 3SGZA 4LAKA 2Y6ZA 3AY4A 4LEQA 5EY5A 2PDQA 3VKCA 1MH5B 3H8AA 5D32A 3FYYA 4OLYH 4IIGA 3ARSA 1QOPA 3C2YA 2KT6A 3Q06A 1URIA 2E9GA 2E4FA 1O94A 1G6RB 9CGTA 1J05B 1ONRA 1DQLL 2VN7A 5E6IB 1NEZB 3G5VA 1A7BA 1MUJB 4N4PA 3SHSA 8XIAA 1ZA3A 5DMGD 3H2WA 4HOWA 2YZ8A 1H61A 5I6MA 3EX2A 2YKKA 4LARL 4PJBB 1J5TA 3B0UX 2HRPH 2J1ZA 2DFAA 4W4NA 1JFQH 4YPGA 3HNVL 2ZRXA 2R6OA 3MRQB 4NZ8A 2P88A 4HH8A 3VQLA 5I1CL 1P0SE 1XB8A 1GYNA 5A1AA 4HCRL 5HDLA 4NC1C 1F13A 5GZOD 4JRYB 4YWSA 3TT1L 3LCHA 2NX3A 2R0ZH 2Q10A 3MLYL 2ZP9A 1FWFC 4JY9A 1VHNA 2JQZA 2GTWB 3PB2A 5K5YA 3UTOA 3E2VA 5AVZB 1XF3B 2OQHA 3SQOL 3I10A 2W66A 3GPSA 1BEYL 3TVAA 5I8KL 1PD0A 3RWEA 3CZSA 4DKFL 3GMLA 1J0HA 3OVGA 5F0LB 1BGAA 4UILH 1MUMA 3CB8A 4Y2DD 3FFCB 3T6QC 2NXZB 2P26A 2CYGA 2JIXA 4KZEH 3BL3A 3UWQA 4A05A 5IEHB 4WKAA 4F2BA 2V2CA 3UXAA 4AMAA 1FYTE 4N22A 5E8PA 1RIUL 2OJPA 3ISIX 1ADQA 2H5UA 2R83A 4U1IA 1NDGA 2VXUH 1T0MB 3Q8AA 4HJGA 3LG3A 1ZT1B 1E1EA 1BD2A 1VCVA 1M57B 5H2BA 3CZEA 4PJ5E 2WPGA 3OEXA 1PCWA 5CO1A 1RZFL 5FL1A 2B7OA 2WSRA 4V15A 4C8XA 4DP5X 1LQAA 4UM8A 4JEJA 4AXNA 1JXKA 5JIIA 2D7NA 3MMWA 3SGKA 3BKCH 4URTB 1XGUB 4NQDA 1SPQA 4YHOL 5I0YA 1MJUL 5E99L 4DWSA 3G8RA 5I26A 2BOFX 4E2BA 4C6PA 1PG7H 4JTRA 4QRRB 5DD5L 1OINA 2RH0A 2QADB 1EA0A 2YLHA 1E4WH 4GO8A 1WS7A 5ALBH 2QUUA 4HIBA 5CEYB 1LZOA 4DAGL 3LN3A 3MBDA 4P4RA 4S10A 2BZCA 1ZT7A 1BYDA 4GKLA 4KKQA 3KWXA 1LP9B 1YPZA 3K4ZA 4AH2B 1KB3A 5FHBL 1WD9A 1FZKB 2YSTA 5JPMB 1MHHB 1AHWC 2INZA 3SDAA 1H9DA 4NUQA 1E6XM 3EPNA 5A16B 3PNZA 2WB7A 4AKQA 2I9TA 2XYCA 5DGQA 3UZQA 3NH7H 1I2QA 4BSVA 5IFPA 3K3QA 4ZMZA 2NV1A 2Z7ZA 2HVMA 3FU7B 4BBWA 3OKMB 2BX7A 4FQQB 4NENB 4KWOA 1D6EB 5CSBA 3IBOA 4LLQB 5JMRA 5MEND 1B3ZA 2KPWA 3LKQB 2CRMA 5IVOA 2CLZB 3N9GL 1XR8A 4HZLB 5BMFH 1YW1A 4LVNC 4I18B 1H0GA 2PO6A 1OWQA 2EXWC 3TKFA 4M4RB 1FWJC 1OCBA 1E4XI 2VLJA 4OQTA 3UY8A 1MRAA 1JZ5A 1EHLL 2F9BT 1PF3A 4JM2D 3CFCH 5D09A 3L7FA 1DQIA 3PWNA 3STFA 1SY6H 1P1ZB 5AC8A 3VGAB 4XBKA 1F3TA 1TJPA 1SJDA 2F8IA 1VFHA 5CJMA 2DMKA 3NQMA 1TPUA 4U1KB 3IMTA 3P4MA 2C1GA 3O6FB 3QXVA 3S36H 4OD1L 2KH2B 3LYEA 4WY7H 3T4CA 4IJ3B 1PBGA 5TQLA 1EXPA 4H7VA 3MHFA 4R5TA 3PPGA 5LG6A 3BPCA 4AGPA 2G37A 3V4PH 5D9NA 4FTVA 3ES7A 4XO6A 3QXUA 1WQ5A 5C7XH 2OP4H 1FYTD 4ML9A 4ZUSA 1U4EA 3V0WH 4XVSL 3A3XA 3TIEB 4TQPA 2X7LB 5FAAA 1EC8A 3K72A 3W7QA 3M5XA 4B90A 4FQLH 3GRWH 5K2ZA 3WBDA 2RQEA 3AFBA 4HJ0C 3QQDB 3EX3A 1F1GA 2BHZA 3L2MA 5C9ZA 5C0AB 1OY3B 1UZGA 1HEZB 4TLUA 3O6CA 3WTYA 1AXSA 4CGTA 5I3DA 2HEJA 3S83A 2EPLX 5L4JA 1S8DB 2K1MA 2R4SH 1ZLWH 1QFWH 2KZKA 4XNXL 3GSUB 3TGXA 4NRRA 5I00A 1DDTA 5LXGH 3ZJ8A 2BVOA 5IQ7H 3TH2T 2GVEA 4WTZA 4GPNA 4O1FA 5HJLA 3UJEA 2EPKX 4RW5A 4MLJA 1VBRA 3VRLE 4N68A 3DSFH 3D3AA 5I1JL 2FGWH 3H2QA 3HFFA 4D6CA 1T7LA 1PJWA 4YDKH 2F8QA 3CHCA 3LA4A 3WLWC 2WMPA 1L8PA 3KL3A 3NYDA 4DIXA 4L4LA 2VLME 2PABA 2WC4A 5JPNA 2N4IA 1BSIA 3NGJA 3G18A 3AZSA 4HB7A 5J9PA 5DO2C 4U1GB 2W9MA 2IDUA 4UM9B 4ZNEA 4DPRA 2GPTA 1OGTA 2BASA 4ZXOA 1T1WA 2IQAB 4CCDA 3IJHA 2C3HA 3B43A 3VXUD 3D69A 1P7BA 4ZFQA 3BG9A 2QSVA 3SCPA 3N2MA 4JO3H 3SODB 2ARWA 4GMTL 5C6TL 1ME9A 3T0CA 5FHAL 3G9VA 2PCFA 4X4XB 4Y96A 1T04A 2WYTA 1JZ8A 4AQ1B 2O92A 4XBJA 5C0RH 1CICA 2A3CA 4KJWD 4AL8H 2BV9A 2A73B 1DJZA 3RZCB 2OYLA 1MXSA 4GRLB 4OFIA 2AITA 4CCEA 3COOA 1G7HB 4PTUA 3GINA 2G3XA 3MGOB 3BFWA 1OE2A 1M05B 3ELFA 3ARED 4JHZA 5DI8B 4AC7C 1EEZA 2A21A 4GXVL 1X38A 2AZUA 3QO1B 3HV9A 4LVHB 1Z6JT 3O45B 3NUKA 5GS0C 1NAKH 4FXFA 2PDHA 4PTNA 4O4VA 2EEDA 3W71A 3K0YA 2QIWA 5CKGA 5D6CA 5DRXB 2DZPA 2HVNA 1EJXC 2X16A 3QYQA 1HX0A 2GJ6B 1XT5A 3CSGA 1U1JA 2FUTA 1K1DA 3KJ6H 1NGZB 1LRTA 1JXGA 3STCA 4JHVA 3ARYA 2AQVA 2VW7A 5KYWB 1HS6A 1IKFL 5E94A 2VWEC 3FUDA 3AMDA 2Q7NA 4ZFMA 4L4OA 5LCVA 2Y62A 2E1DA 3LQZB 4GY1A 4M7KL 2HCZX 1Y0EA 3HPXA 1LMIA 1J88A 2MHAB 1HHJA 3DRQA 4FXGC 2Y72A 1AD0B 1KZYA 4J9JA 2QDDA 4JREC 2EYRA 1JYNA 3IJDA 3F5WA 3Q44A 5A3ID 2DQTH 2OR8A 4JEQA 4GYBA 1ONQA 3GLZA 3QZBA 5KAQG 3C08H 1J5SA 1PZ0A 4GZ7A 3MW7A 5GJNA 4FI6A 4EKXA 5JO5B 4PSRA 4PBDA 3SCWA 3D85D 2E75C 2PDXA 5SX5H 3GMPB 4HS6B 4FQJH 5HGDA 4H26B 1YRRA 1TJRA 1RD5A 1YA5A 4UQ3B 2P8MB 4MA8L 4E8GA 1MELA 4JANB 4CVXB 2DT2A 5SWZE 5FCUH 3VE0B 3M0ZA 2KI6A 4Z7NE 4PJGF 3WENA 3PR2A 1O95A 3B06A 3TW6A 1E9LA 1JCLA 3BI9X 3EZ8A 2AANA 5AFDA 3B7YA 1I8LA 3WY2A 4WSJA 3N14A 4YH6A 1PY0A 4U3SA 3KW8A 3UTTA 4EI5D 3WMSA 5EBWA 3ARBA 4B16A 3MV8D 3VCRA 1RZPA 4WGWB 1J9SA 3K6SA 1B2WH 4HFUL 4EUPA 1TQSA 1N59A 3E2HC 2VLMD 2V7HA 2J5LC 5DYOB 3KP0A 1GYMA 1XGTB 5A7BA 4KK9D 1KN4L 3TYFA 3U48A 3MJGX 5JHBA 5I0XA 4WFHD 4WHBA 3DJ9A 3RWCB 1B5TA 4XAKE 2KHAA 2R15A 4OKVB 4XMLL 2Y0FA 1WICA 1RK1B 3SKUD 1W0WB 3REVA 1Q9OB 1CXHA 1FGNH 3WE6B 1CFVL 2OMZB 4WR3A 1J5OH 1QR4A 2XDHA 4CDGC 3T3PE 3CZ8A 2PCQA 1MCRA 4R7DB 4WNQA 5GRZA 3QHMA 2B77A 2XH4A 4QROA 1VF8A 4QGYA 2CE6A 5F1VA 1J1OH 1UR2A 2PR9A 3MJ9H 1NANI 4BY3A 1E4KC 1VD6A 3NZ8B 4DQWA 2C7UB 4Y5YC 1V3MA 1ZHKA 2FECL 4RGNC 2QT3A 4KCVA 1OT2A 3P9WB 1M7OA 1TPH1 4HCHA 1IBGL 3K71B 4H8PA 4DP7X 1MJ7L 1P6FA 1YDVA 1U2HA 4NNPL 5C0ND 2F19L 3QORA 4Z9KB 4YMZA 4AL8C 2BG5A 3U6WA 3FB8A 3LQMA 5E5CA 3DMMB 2WIIA 1PLGL 2NR6A 2WQVA 5HPMA 3LHUA 1J8KA 4XWOC 4AMWA 3P80A 5CJOL 4I9WE 4FQHB 1MZYA 3U30C 2VHLA 1OTTC 4MNKA 2J8FA 5BQ7A 3QKEA 5D2LE 2IOIA 3JBG7 3HG1D 1R75A 3JWOL 4DXXA 1AFSA 3WK3A 3FN3A 4PCSA 3LIUA 5AG8A 4JY4B 4FQ2H 1IAKB 3SPGA 3PDDA 5J04A 4Y9OA 3VFUB 1R3QA 2OU4A 4HFWA 4H20H 4UFMA 4G6ML 1T8QA 1KFCA 3PTMA 4AF0B 3V1HA 5C0CB 1CLOH 5IIEA 3FUEA 3CZNA 4FJZA 2VMCA 3EOLA 3FUFA 4XVDA 3VIMA 1EQCA 5ECVA 3UTPE 5HJBA 4D9PA 5JR1L 1JF1A 2WYHA 1HZKA 2V2XB 3P30H 2JKSA 1NGPL 4F0HA 4FX8A 4KXDA 4XO9A 4KH2A 4GYPC 5FYKU 5FESA 1XGRA 3QPXH 1KENH 3M1ZA 1RZKH 3I6RA 2IPFA 2NW0A 2DWXA 3A4WA 1IXOA 3LNGA 2BVTA 3SOBL 2PYFB 4K23L 1W9VA 4L4JA 1FL3A 5HR6A 3MS8A 1G0DA 1VFBB 3VRJA 2H45A 1WH0A 2N7SA 1A22B 4KVNH 3FUMA 2R69H 1SGJA 3F1QA 2P9RA 4TLTA 4LT7A 1W0VB 3BPNB 3R2GA 1JERA 3MFFA 2QSCH 1G7PA 4F48A 5DT7A 4U6VL 1KEMH 3S47A 3WL0A 4KUCF 3PANA 3VTTA 2QCDB 4JDBA 5DMLA 2DQCL 3M9YA 3PZOA 1PKLA 5HWMA 5IJVA 4NFBA 1A6WL 1PCXA 3GSOB 2XWCA 3NA9H 4WTQA 3H1ZA 5I2IB 2XV3A 1MG3C 5CGTA 3HHRB 3SDDC 5DLML 4XOBA 3F7PC 5SWSA 4XAKD 5H8PA 2Z34A 1CR9H 1HE8A 1BQHB 4KPHH 3MC5A 2DTML 3P4OB 1T4WA 5H35B 2OI9C 1B4LA 3P69A 3S9ZA 4V11A 1F07A 3E8UH 1TQWA 3PBVA 3U4AA 3C5SA 3DBSA 4KIEA 4B9GA 3W1NA 4PJ7B 2O5XH 5F1IA 4WY0B 5K4ZA 5KG9A 1Y65A 1GOOA 4YFLI 2EZ0C 1TWIA 3TQKA 3URQA 4JTIA 2WQXA 5AOIA 3MGTA 4JAMB 5AFAA 1ZBWA 2Z91A 2J7HA 1TDQA 1Z2KA 3FU8A 4PJAF 4A1RA 4PB9H 4MNJA 4UBPC 3SGJA 4ZZFA 1R7AA 5CAYB 5KSAC 1ZHLA 4FNRA 1Q72L 3SPJA 4ALAH 1B3JA 3GIQA 4S3KA 3TYCA 3MYJA 3RCMA 4NJJA 3MRBA 2ZZ6A 1RZIA 2VFFA 4JIQA 4L4VB 3B7RL 2XOTA 1UWUA 4PRBB 3HC4H 4YNYA 4Q6YA 3Q6FA 1ZLDA 2P3EA 5H4ZA 1P7TA 4FL4B 4Z08A 1CFTA 5AW1B 3IKCB 4B9FA 5TDOB 4BFFA 2JEQA 3PFQA 4J6IA 4A29A 3GSNB 3MUCA 1DVFC 1QBMH 2B2XH 2ZCGA 43CAB 3KDPB 4QY8B 1BQGA 1MW0A 1ICSA 2POZA 4DGUA 3LQAH 1E9PA 2YC1B 3H6JA 5ID1A 1Q4NX 1DUZA 4B5NA 4HU4A 2ZOUA 3VVVA 1YEEH 1ZTXH 4DUOA 1N6QH 3ATZA 3KNBA 3MTRA 4O58L 1A64A 4PMRA 4HWEH 2Z8SA 1EXGA 3KWWA 1JN6A 4ODBD 4G11A 4JJOA 2VC9A 2QPXA 1M65A 5DJDA 1FUYA 3HM7A 4R96A 4WGXA 3WYZA 4TVPE 2EIBA 5BXRA 4JZJC 4UB9A 1XF2A 1Q8JA 1IGSA 4N8PA 3CDYA 5FDWB 3TIDA 5ICUA 4MAVA 2CK0H 1XC6A 5C9JB 5TGBB 4YSDA 5F7FA 3KD4A 2V68A 1DWGM 4LHUG 2DSZA 3BEVA 4Y19E 1X4YA 3TK7A 1L9OA 2QQLL 4PCYA 4HZ1A 2O61B 2G5BA 3HR5A 4NAQA 4OCRH 3VU2A 1RZKC 1UIPA 2UBPC 1I75A 3GVWA 3N91A 2VO5A 3RWHA 1D3HA 2OX5B 1GOXA 4L61A 2BRQA 2B59B 4E2VA 4LOUD 3L5JA 3IXTB 4QXUH 4PJ9C 1QP1A 1BD0A 3A4FA 3F7JA 4JQ3A 3HGOA 3IUHA 3OHXB 2RJGA 3PDGA 4M1RA 5I6PA 3PYCA 5JHLA 3US1A 1DIOA 1KY7A 5KVFE 3FO9B 1FP8A 4L8SB 1B4EA 3DFYA 2JCCB 1ELSA 1KPUB 1KJ2H 4O1AA 2AJ3A 4UQCA 4LAUA 1JRHI 5KW9H 3EFOA 4D6GA 1VCBC 4Z2IA 5CZXC 1HSAA 1BQLL 1TFHA 2UZPA 2HRWA 3TNNB 4KTYA 2R0LL 2ZOKA 4YFDB 2JB5H 2QCEA 2D7PA 4MMXB 5DT1H 1MRQA 4MJIE 5HGBA 4MNGA 4NILA 1Q9KB 4R0LC 1W72L 4GWEA 3ZHKA 5HUPA 1SEQH 2BP0A 4IG2A 5H1WA 4P2OA 2DBLL 5EB8A 2AXFB 2XH0A 3MI3A 4E8CA 1JEZA 4KQ3H 1OB0A 1M1BA 4OD3L 4MS6A 2Q8XA 1BGGA 1YYLL 1FFPB 1HZHH 5LZLA 2Y9RT 3I2CL 4YHPA 1SZNA 3MQTA 3G6LA 4ADUA 2DLFL 5I1KL 5I0WA 1HCVA 4LUJA 3ZTJG 4FP1A 1UGNA 2RJHA 3M0MA 1MQKH 1DUYA 1FORH 3H0TB 5IFAL 4UOJA 1GJPA 3NQAA 3B5GA 3MBEC 4HHMA 3MNWB 1HXYA 4M1CC 5JUEH 4I90A 4CDHA 1YG9A 1KELL 4U7MA 2K9UA 4J4PC 1CD8A 1XPGA 3GC5A 1G7JB 2QW5A 3CMOH 3GDKA 5F4WA 2CNZA 4KJYA 2XFWA 1QZ1A 3W57A 4DP9X 3K13A 4OCYL 3SI9A 2WLYA 2NY0C 1NARA 1OAKH 4Z1PA 3K1GA 1DQDL 4W6XB 3NXFA 5E0CA 3U7BA 1RQ5A 5EIIG 1KW1A 2GDQA 1QATA 5CLZA 3P0XA 3R0MA 1SR0A 4L1DA 1LUCA 3WZ0E 4TVPD 1V0LA 2G50A 1Z66A 1JXFA 2C9RA 2KPNA 2P42B 1D5MA 2F74B 3FB6A 1SMOA 2A83A 2X10A 3QA3A 3H4FA 3RAJL 1I8MA 4F8PA 4NQUA 4APQC 4GUHA 2CZ5A 4DI9A 2DBJA 1QSFA 1TYEB 3UOAB 3U4FA 3CT2A 4E0RB 4Y19D 3B2PA 2J4WH 4UTWA 5DVOA 1XGEA 2EDQA 1YE6A 5I18H 1JJUA 5ANMB 3F5KA 2GWGA 2BY1A 2CC0A 1IBHA 2VLRB 4N42A 5L88H 1UPPA 5ECUA 2H41A 1X5AA 1SYVB 4PLOB 2H32A 5CEZE 2PKDA 4UTBA 4XNYL 4DN3H 4WSGA 4UT6H 1CUOA 3WFDL 5DELA 4HJJL 3GR4A 3AXLA 1TQBC 2V67A 3LDVA 4WKZA 2B7DT 5B39B 1LWIA 2OM5A 1F11A 1WBZB 2HVBA 2CWRA 1KYAA 3HQPA 5HHMD 4Q97A 3WD5L 1LTDA 3S2AA 2VC2B 3GMNB 3VGBA 2C0AA 2IWGA 1V27A 4P5TC 1TA3B 4X4YA 3T0XA 1NDMA 4HIJB 2ZCZA 1NUDA 3TO4C 2ID5A 1H41A 3FB5B 3IDGB 1N2RB 4MFEA 2IANA 2CLOA 1J0JA 3IJEB 1W32A 1OANA 1BIIB 2JVUA 1QSVA 3T04D 2ZKXA 3RX9A 5T5NG 4IFKA 4QHKI 3TPUA 1DORA 1W2KT 3UCRA 1AUSL 5CD5C 1ZP3A 2XTSA 4N2DA 3I9PA 3IEAA 1CQKA 1F2QA 2VLKA 4AE1A 3K8MA 1WEJL 3RO8A 1H3PL 4U1MA 4JICA 1WWWX 1L5GA 4TSCL 5IP4A 3O0FA 5HINA 4OZHA 1J5DA 1VJSA 4PRHA 2WQUA 2NY5H 8PAZA 3B9KA 1F90L 3S6DA 4C90A 5FK9A 3G5VB 4BWLC 3ZDZB 1HK6A 1ZA3B 4NPKA 4HWBA 4WCYH 5CP3H 2DV0A 2VSCA 1KLUB 2PTWA 4IUOA 3WNIA 3PZVA 4JOMA 2WM0A 1O7SA 1PO9A 1TITA 3ISRA 2NT0A 5HHQA 4AQAA 4NO5A 4YPGB 3VFVA 2ASHA 3NL2A 4HMDA 5KTEL 2J73A 3SZ6A 2C71A 1XIIA 4IS6A 2DJSA 4YXHH 3LH2L 3S3DB 4LBSA 3QJSB 2DJUA 3UXKA 4W9GC 4PRPE 4Y4HA 4J3OH 4AXWA 2CLFA 2IBZX 4FZ8H 2R9HC 5M95B 3G1DA 5LKYA 3OBKA 3U36A 2IPKA 5IDIA 4FG4A 2WLHA 1ZLUH 4P8XA 1OALA 4WNSA 1ZJAA 3SB3A 3FQ2A 3RWEB 1QNQA 2CCRA 3GMLB 1QXLA 3GZAA 1AYRA 4JPWL 4M82A 1IKNA 1Q6OA 2IXUA 2D2JA 1NCUA 4N9CA 4QHMB 3MX0A 2JIXB 5DD6A 2DMBA 2PMQA 2WO3B 2CO7A 5CEZD 5IROA 3BDYH 2PC8A 3PPCA 4ZOBA 4DF9A 1NIEA 3L0GA 4US5D 1N8ZA 1PUDA 1K4DA 4R26H 5JYLA 4U1IB 1NDGB 3MLRL 3FRUA 3VMNA 3DG6A 4HJGB 3W7EA 4ORGA 1BD2B 3T6XA 3N6QA 4NP4H 1PVHA 3N1QC 4AJYV 5H2BB 1KBVA 4YHYC 1OCWL 4BI6A 5A2JH 1P4UA 1KEGL 4L1WA 4L6DA 5F9DC 4PS3A 5B8CA 3QXWA 3S9YA 2X53A 5C6WH 4S3EA 1TTQA 1M7PA 3CSYA 3HJ0A 1CDJA 5CJXC 2GHZA 5F7YC 1Q8MA 1KWGA 4NQDB 5CKAA 5D7IA 3NXLA 5GGUA 3H9SE 1GKEA 1THFD 4Y7MA 1VH7A 3GUGA 3F7KA 3UAJA 4UR7A 3HLAA 5HVGB 2FWOA 1KCUL 1DDHA 3FYOA 3PWJA 4LV9A 3C5ZA 4JIEA 3P5ZA 3PS6A 2F58L 3OR7A 2NTFA 2YD5A 4U3AA 1AQKH 3DVNA 2OMBA 2O6EA 5TE6H 4P4RB 3AQZA 4HKBA 5JZ7D 2ZCLL 3A6BH 5HR7A 1YPZB 4D8LA 3W6YA 1WHPA 3VU1A 2EG7A 4G7VL 3EX4A 2VUOA 3NJHA 1XIEA 1H7XA 1D9KA 4F3HA 4XI5C 2E47A 2I9TB 2ZQKA 3CD4A 3RB7A 3UZQB 2ZWKA 2Y5SA 2ZOXA 2MCPL 4BSVB 3RPIA 3IKKA 4M5SA 3QUZC 5FUCE 3NJMA 4NJHA 1NDTA 1W2PA 1YSOA 1KFLA 3ZTNL 5DZJA 1LQBC 3QJVB 4JX4A 2F15A 1L9RA 5ISZB 4P46A 1XR8B 2VL5A 2L0DA 4E8DA 2ADJB 4OB5H 4Z1BA 4C83A 3OJMB 2PO6B 3X3GL 3UXIA 1QJWA 4ZEPA 3W1AA 1Z69A 3GZ3A 4FR6A 3ZHFA 1UR0A 1KQZA 1EJSC 1V3LA 1RLDA 3PP4L 4I3SH 3ULVE 4GAGL 1MNUH 4LIQE 1MFEH 2VLJB 5AYIA 3I68A 4PRPD 4YDMA 2VQTA 3NM3A 4JQ1A 1XL9A 3CAWA 1GVSA 3L7FB 3QXAA 4IZGA 1CFQA 3PWNB 4L37A 2W92A 3S1WA 1A4LA 3IIOA 1K9DA 4YOKA 3T8MA 2E5BA 3HI1A 1GZPA 3LBOA 2Y36H 3P4MB 2ZAIA 1Q85A 4I8DA 2QCNA 4I7UA 1OAXH 3B9NA 4PLNC 3QAZC 4JHAL 3OA5A 2YGOA 4JMXA 1G6RH 1MRDL 3BPCB 3C6LD 3AWNA 1PLAA 1XTMA 1EEUA 4LCWA 3LM7A 4FTVB 1QRND 4KU1A 5FFLA 4HSQA 4V2XA 4R7LA 2XN2A 1OWWA 3TOPA 4AY7A 5TQ0L 1MRCH 3E74A 3GK8H 1YDOA 4PRNB 3IU4L 4R5XA 3B7UX 4Z76B 1XSJA 2CDGA 4AIBA 4DFHA 1TV8A 3AWFA 3MUGA 2FWSA 3PHSA 2R24A 1XPYA 3VGEA 3U9WA 2VDPB 4NFDA 3K72B 4IW4C 2XRAL 4EAEA 1NSNL 3N34A 1XBVA 1R46A 1C29A 4KFNA 2FMNA 4P2RE 2WVVA 5J3HC 2PGFA 4GKZB 5K39A 1A1OA 4HUMB 5I5JA 2Z6IA 5HSFA 4Q8QA 3ZIZA 1RQHA 2BSLA 3MP5A 3AUWB 4W85A 3MLVL 3PUCA 4NNAA 3UYOD 3QEQE 4ALDA 1AXSB 1VIWA 5CINH 3W5MA 4OFYD 3JWDL 2ZPKH 3ZDYF 4BQCA 4RXGA 4X60A 4Z23A 3ECVA 3UADA 1NCCL 3MHUA 4YDNA 3NEXA 1RPKA 1NGXA 1RZJH 5EIVA 1DE5A 1KLFB 4LS2A 3G7TA 2ALAA 1S1PA 3TWCL 4NQEE 5H8UA 1A4BA 5ADPL 2X6VA 3TA9A 2ZUTA 2CIIB 2J6WA 4IJTA 2FB4H 4ESKA 3O2DH 4R8WH 4W9CC 3SCOA 5D1QA 5AW4B 4CQDA 4WEBL 2VMEA 5JPNB 3ULSA 5DUJA 4Z0JA 2VR8A 5J9PB 3WLSA 4UR9A 2L04A 1VACA 3SCVA 1T1WB 3IJHB 5LWYH 2XACC 5CIPA 3W07A 2J8UF 2CJSA 3W39A 4WHDA 1LBFA 3EJYD 5EO1A 5CILL 2CLEA 1DP0A 2E1WA 2QUNA 2CEQA 5C07E 4JGDA 3GO1H 3FF7A 2PCFB 1T04B 1UZ6E 3QY8A 1Q6DA 5CC6A 3W25A 4FKEA 3IFLL 2IC2A 3AC0A 1CICB 1MXGA 4KVCL 3K6NA 1ZSDA 1OARL 3APDA 1GVQA 3MVTA 5FKAB 1BAFL 4U28A 3J8F7 5EWIL 3U7VA 4JFYA 2AI0L 1FCVA 4PTUB 1IT7A 1H3XA 2H7WA 2AJYL 1EEZB 3HZKA 3M17A 3VDCA 5HI3D 2XZQL 4LEXH 5HI5C 4G43A 3O11A 1RSFA 4MDPA 1THCA 3A23A 4MSSA 3BKYH 4YVVA 1UYWL 1A7PH 1SBSH 4M5YH 5D6CB 1CZ8L 2EXTA 4QLLA 2CLRA 1HINH 5AECA 1TIMA 2CHOA 3FCGA 2XGIA 4U31A 3PY2A 1O7VA 5DRCA 1TE6A 4NN6C 3QXTA 3RYSA 2X42A 5TAOA 2WQSA 3V95A 2X6MA 2GSHA 4D3CH 4OLZH 3MUZ1 4KRTA 4BI7A 5E94B 3CQFA 1K03A 3E49A 4FXRA 2HV5A 2BHFA 4HSOA 1OT1A 2EDTA 1X5LA 4G70B 4RMSA 1MCPH 1I9IH 2I7GA 1MQPA 5GGSY 3HQOA 3Q01A 2JQAA 4GSQA 2V9RA 3DRQB 4AGNA 4MD0A 5IW1B 3UWEA 1P5UC 3TH4T 3VH8G 4NI8A 4JFPA 4ZS7H 3H6AA 2EYRB 2YO3A 3F5WB 4G8EA 4P2RD 3HAEG 1ONQB 5KSBE 5D71L 3NIFE 4GIAA 4FP8H 1RSYA 3OQ8A 3KLHD 4Q4PA 1O5DT 3TZFA 1Z89A 4ODHL 5HGDB 1RJLA 2O4EA 3LIZA 1XQLA 4HLEA 1NCWH 5FW6A 4TTGA 3QEQD 5DJ8A 4NQCD 4MA3A 3BZEA 4ROPA 3CV5A 3F2CA 3VKDA 2YMXH 2NV9A 3BWZA 3DU0A 2TPSA 5LBSH 5T1JA 3NSYA 4IIHA 1UD5A 4XPGH 2F7IA 5F9AC 1L0QA 1BJ1J 4NQED 2WV8A 3GJFH 2B3RA 4U3SB 3UTTB 5EBWB 3ARBB 1IGJA 1T41A 3K6SB 4WW1B 1MFNA 1KXHA 3IFOA 2QPFA 3F4WA 4EUPB 1N59B 5BWFA 5I3JA 1NAML 3KL5A 4JZNA 5F6HI 3W1MA 5EEYA 2NYZA 4X6CF 3RM4A 3HE6C 4GRMA 3TYFB 3VTAA 5DK2A 3NSDA 5E2WL 2APFA 3JYBA 3LB0A 3W73A 2B1AH 4WDIA 1EAQA 1YEJH 1UM5L 4KGLA 5GRJH 2DSKA 3TT3H 5DCDA 4F7EA 3WLPA 1FP9A 3ZN6A 4ZQRA 3REVB 5C07D 4FABL 4EVZA 2CXEA 1OQFA 4XP9H 3EO9H 3UC0H 3SM0A 1I3GL 4M3KB 3FQUA 2HWZL 4CC1A 3IUIA 1U3HD 1VZHA 4WNQB 5CUSL 4F15B 3R0NA 3THQA 3OB0H 3N5AA 1IM9D 1P69B 1PIGA 2CIKA 3L7EA 3NZ1A 5IW3A 1VFTA 4L5FE 1NCDH 4N2GA 1M7DA 2B5IB 2VM8A 2QV2A 5FFGA 3EOYG 3WMLA 1A66A 1ZHKB 2BW5A 5K9DA 4WXZA 1KV8A 3MKGA 2P5NA 1KB9K 3U0TA 1NIDA 2BY0A 1OFRA 1US3A 4AYID 1IGML 1Y5XA 3AWGA 4KQ0A 2VX7A 1C93A 1HIMH 3QORB 5BW7C 4RKAA 5EEWA 3VI3E 5FOJA 3FB8B 1Q65A 1PKQA 1NF0A 2E7LC 2VKXA 5HPMB 4PSPA 1EBPA 3AB0B 4HZ8A 4MKTA 1PTDA 4E38A 3VNKA 4EKJA 1LOSA 1FLRH 1BF2A 2XN1A 3R19A 4JY6A 3MODL 3N43F 1Z9PA 4JGMA 4JBSA 3WO4B 5BQ7B 4Z3FA 3ABGA 4IBLT 4X7FC 4M6AA 4PODA 3OXSA 2FDMA 3BYYA 3CO4A 1TU2A 1KJMA 2FJFA 5E4EB 1MREL 1S7XA 3TDFA 3NP3A 4E9WA 1USZA 1TEFA 1KCBA 1DCLA 4HFWB 3DROA 4QFUA 5F6HJ 3P8IA 5PCYA 4ECLA 5IIEB 1Z1WA 3H56A 1YJDH 3RJDA 4MJJA 5EEUA 3EOTL 1JMXA 2O6DA 3BUIA 1Q0EA 1JF1B 3WS3A 4FFVD 3TURA 5H94A 1WIPA 3RRQA 3MZTA 4NCC2 1IC7L 3W02A 3T78A 5D6DC 3L4ZA 1UVQA 2HS6A 2NQ3A 3ELQA 4AZBA 4ZUWA 3LRHA 1XGRB 3LCFA 1NWRA 3NJNA 3O9WA 5IVNA 3HJZA 5E70A 1FHNA 1FL3B 4CN1A 2A3EA 3VRJB 2XGBA 3TZNA 4LDCA 4KZDL 3ZGHA 3OKDA 4Q9RL 4CC4A 1OSEA 3TBWA 1UXLA 3B9VA 2QGHA 4MVAA 3OODA 2ZOLA 1G7PB 5E95B 1IILE 1MWAA 2KKQA 4PRWA 4X2RA 5JXED 5HWNA 4TQEL 4PJHE 4QRSA 2WP3O 4KMQA 1CPUA 4G9FE 3SIMA 2OZ0A 5IJVB 2YAHA 3RBSA 4IFRA 2WMJA 4H8WL 4OM0H 4OD2A 2VJ8A 5FO9B 1OIOA 4WKFA 4F1ZA 2B3IA 5SWSB 1SOXA 1NZRA 3P2DA 4GW4B 2QSQA 2E9BA 1W3HA 2DDQH 2VR9A 3Q1SL 2CRYA 5FO2A 3BRDA 1OSYA 4CNUA 4LRNH 3U6XS 2K78A 4LALA 3UD6A 3C5SB 5DBUA 4GLRH 2IDCA 5F1IB 4KRLB 4N26A 5GS1A 1W0YT 5KG9B 2CK2A 3GVVA 4N2NA 4QXGH 2F6UA 3MGTB 3NQGA 1HJUA 2CO1A 3UT0A 4ETQA 2I5GA 4MJ6A 5FFOA 1HQRA 4H19A 5B80A 4PJ5D 2C3GA 1T99A 3SUSA 4L9XA 2WTRA 1ZHLB 1K02A 3V0EA 2Z93A 3LZPA 4GLEA 1EC9A 1A7QL 3MYJB 5DQDH 3MUUA 2X6AA 3MRBB 2J88L 3MLWH 1Q90A 4GEJA 4YSEA 5BZXA 4YNYB 3AI0A 2VDRB 3Q6FB 3MRFA 1RPQA 1JPGA 3IXAB 4YDVB 1P7TB 4N2YA 2KS0A 5D2XA 3L9RA 3QV7A 4C1LA 5C0IA 1CFTB 1UM4H 1GVFA 2MTPA 2WZ5A 2FECI 3CK5A 3EH1A 5DF0A 4X5LA 2Y8VA 2QJMA 3WTVA 5EC1A 2VDIA 2VDHA 2PBOA 2ZUSA 2X1QA 1E9PB 3WJJA 4LOFA 5ID1B 1P6BA 5AVQB 1DUZB 4U1GC 3W1TA 2GTQA 4C7FA 4MJ5B 4IDLA 1GVOA 2PBGA 1NP0A 3TJHD 5C09E 2TSYA 3HCVA 3KNBB 3D1MC 1VBGA 4XNZC 1MIMH 1J01A 3K81A 1DCEA 1ZMYA 2ZTBA 5A8MA 3QDME 4AYFA 2YRZA 3KWWB 3BGJA 1JN6B 1X7IA 4HC1A 2CZEA 2HKHH 2XSKA 2WLZA 4K2UL 3MNVA 3VXRA 1HQTA 2PDUA 5DJDB 2ICWJ 4R96B 4ADSA 3DVIA 5KVGH 4ZBJA 2LVCA 1ZS2A 5DCEA 1NC4D 4UFJA 1XF2B 2A9ML 3MV11 2FGZA 4TNVK 3TIDB 4GJJA 2OQYA 3OLDA 1OP3K 4R9OA 2OODA 5HPCA 3QV8A 5CKSA 1S7VA 3QUXC 5G5IA 5CPQA 4PVLA 2Q8AH 4HSAC 3BEVB 3VI4E 2VDGA 3F85A 5T1KA 3N2JA 4R34A 2G5BB 3HR5B 2ZG3A 1ME7A 3IT8D 2VMJA 1XIWD 5EBGA 3EH2A 1EFQA 5CBAA 2A9BA 3RWHB 4G9FD 3U82B