4JFUA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-L-fucosidase
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
total genus 163
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jfuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jfuA01
4MADA 3WF1A 3FW6A 2F8QA 2ZXAA 3JUGA 1VBUA 2CKSA 4CN4A 4DM2A 1H3GA 2J77A 2W63A 4D6IA 3T2OA 2WAGA 3W29A 4W8LA 4QCEA 1PX4A 4TVUA 4AW7A 1U33A 1R33A 2WVUA 4OUEA 4F66A 1CZ1A 4PUEA 1UWIA 1E3XA 3LPGA 1WB0A 3GDBA 4QAWA 4DUWA 3GH7A 2O92A 3SCRA 1E55A 1PZ2A 4NSBA 4Z2GA 4JHOA 1JYNA 2D0FA 1UYQA 3VX1A 1JAKA 5D8WA 3CZLA 1C92A 2V38A 2CERA 3UR7A 1XC6A 2J78A 4DWSA 3FHQA 1HF6A 3WF3A 2EAEA 3MMWA 1V3KA 4GXPA 3NSXA 4JHZA 4QCFA 4HA3A 3NIYA 1JZ4A 1XGZA 1PBGA 2DSWA 1WCGA 1HIZA 5EFFA 3MSDA 2VQUA 1B30A 3N1AA 2XN1A 1LF1A 4CD4A 3WENA 3BXWA 4U31A 3AICA 3BAIA 1V0MA 1JD9A 3OGRA 1IZJA 5BXTA 1B3VA 3A23A 1QHOA 1E5NA 3BAXA 2ZOXA 1CGTA 3RPMA 5GPRA 3F5KA 4DWSC 4FLRA 2W91A 3MV01 4AMWA 3W27A 3RJXA 5A8NA 2YOCA 4W5UA 1XHGA 3N18A 3CLWA 4BA0A 1UR2A 1B3YA 4W89A 2HISA 1QNPA 4AXNA 3AXIA 3MUAA 2A3BA 4GI8A 3L4TA 1KXTA 4PMRA 1H4PA 4JCLA 5DO8A 1E6RA 3A5VA 3WH8A 1LQ0A 5E1QA 4U2ZA 1A3HA 4HZ8A 4HA4A 1FP8A 4L4OA 1J0YA 5HNNA 3RM4A 2J7BA 1JYVA 1CXEA 3BH4A 1UA3A 1HKIA 3VX0A 3F4VA 4BS0A 4JFSA 2FHFA 5BWFA 5JIPA 1E6SM 3AMLA 2D1ZA 3H54A 1W9UA 4OZOA 1JIBA 3VOCA 1UD8A 3VM7A 3N12A 4CD7A 2WWDA 3ZJ8A 3L4UA 2YBTA 3AOFA 1B3ZA 1OT2A 4D6GA 1XV8A 4HZ7A 3WL1A 1OINA 3A4XA 5GQBA 3LPPA 1CENA 3BUDA 1I1XA 5E0FA 4FNPA 1VF8A 3CMGA 2XTKA 4A3HA 3N15A 3OLEA 3CV5A 2VVNA 1AMYA 3APGA 2F2HA 1W3LA 5A6BA 2W66A 3AHXA 4MDOA 4W85A 3PHAA 5EBAA 1VFUA 2J8FA 3OA5A 4H41A 4PMXA 4PTMA 3RJYA 2XFRA 1HP5A 1E1FA 3K8LA 2GJXB 3IAPA 1I75A 3WQ8A 3MMUA 3GXMA 1CGUA 3VIPA 3AXHA 1V3MA 1HXKA 4AD0A 3VIKA 4DM1A 3ZSSA 3ZR6A 2X8RA 3OGVA 2QPSA 4WKHA 2RGMA 5CLTA 4FK9A 3VGDA 4M80A 1OGSA 1TQWA 3BUBA 1G1YA 3VIFA 1ISWA 1HL8A 1QWNA 4W8BA 1E0VA 1Q6EA 3D3AA 5D9NA 2J79A 1QNQA 2D24A 4FNUA 2OWCA 2J7FA 1H0GA 1GCYA 4HPHA 1B0IA 5E70A 2CESA 2XHYA 3EDEA 3VINA 3IGUA 1QNOA 4C7GA 1HP4A 1UA7A 4HOXA 1ESWA 2F61A 4M56A 2GUYA 1CXKA 1QW9A 3WBEA 2WSKA 3GNPA 4HTYA 3MU7A 4A4AA 1IV8A 1W3JA 3WMCA 3ARUA 4LPCA 1UKOA 3VPLA 1BHGA 4FLQA 2CCRA 4X9YA 3O9NA 4P7QA 1W1VA 1MQPA 3ZJKA 2BY1A 1G5AA 5BYWA 2GK1A 4V27A 1TQTA 2FH8A 1OM0A 3DX0A 4H8VA 1PAMA 2XN0A 1NOUA 1HVXA 4H8HA 4PMZA 1WKYA 3OZPA 1QI5A 4UFIA 1JDAA 1Q4NX 4U3CA 5F7UA 1TR1A 4RE3A 1VJSA 3GXTA 1R85A 2ZUSA 3N17A 5BXPA 1PX8A 2WHJA 8CGTA 4XUYA 4NX0A 3PTKA 1GW1A 3GBDA 4JFVA 2G4FA 3A47A 3TTSA 3UG3A 4MB5A 3WD0A 1TQVA 2E40A 1GZJA 2W61A 1O7AA 1D3CA 4ACZB 1AQHA 1VEOA 1GQIA 2VURA 2A3AA 1ODZA 3HG5A 2UY3A 1R8LA 4MJ2A 2F1BA 3PTQA 4Q7NA 3AMKA 3VNYA 3T0AA 4UQDA 1O6IA 1LLOA 1JZ7A 1MW0A 4FNRA 2WBKA 1V6VA 1NQ6A 3WDRA 1W9PA 4NXSA 1Z32X 2NT0A 5KEZA 3UESA 2VZSA 3PBGA 2IXVA 3D51A 3ARTA 1BVZA 4LYQA 3VD9A 4CD8A 3ZO9A 3B8SA 2WSPA 4TTGA 4ATWA 3ALFA 5A69A 4JFUA 1W3KA 2A3CA 5LA2A 5BROA 3AS2A 4YHGA 1KR0A 1UR0A 1BGGA 3DHPA 4UR9A 3U7VA 5FKYA 4MTVA 3AMGA 4OBRA 1FHDA 1WP6A 1W9VA 4BF7A 2WCSA 3VM5A 3ECQA 1V0NA 4J28A 3QR3A 5JBDA 4MB4A 2AOSA 5A6MA 1ZL1A 3L2MA 5IDIA 3WMBA 5CGMA 2BHYA 3NJ3A 4PCSA 4NZCA 3GM8A 1XH2A 3VGHA 3WD3A 2D0HA 2YLAA 2CPUA 4QLLA 1C93A 4HOWA 2J7HA 4GIAA 2X0HA 2VZOA 4FNSA 1Y7VA 2ZE0A 3HG2A 2OLHA 1J0KA 3WH5A 3VIJA 1JG9A 3W26A 3HZ3A 9CGTA 3GTNA 2PI6A 1QI4A 2GFTA 5GNZA 2F18A 3WNNA 2WHLA 3E1F1 1UKSA 3THDA 4CN1A 4QLJA 1JZ2A 2BY2A 3ZT5A 4GO9A 1GNXA 2FHCA 1HTYA 3EDFA 1Q6GA 1BQCA 2VJXA 1U2YA 3HU7A 1G0CA 4JIEA 2DSUA 2EACA 3TV8A 4K68A 5BCAA 2JE8A 5AY7A 1SYTA 4KRTA 4Z2HA 3ZT7A 1CGWA 3O6AA 3WH9A 2ZICA 1UR9A 1GOIA 1SMAA 4GZEA 5ECUA 1DWGM 3VSVA 1HXJA 4EAMA 3VIHA 2ESCA 2G3MA 3AZSA 2BHZA 1H5VA 4PTVA 4AD2A 1ECEA 2JEQA 3CPUA 3K1DA 1E3ZA 3WEMA 2DIEA 5C70A 2EADA 3KWXA 3WF0A 5ABHA 3LPOA 2WMFA 4BZYA 3NYDA 3AS0A 1CBGA 1M04A 6CGTA 4CD5A 3EJRA 1BSIA 1EO5A 3BSGA 1XCWA 1BTCA 3WD2A 4FNQA 4PMVA 2DGAA 5AC5A 4H2CA 2XIBA 4M81A 1UWTA 2WLZA 1JI1A 4GPNA 2V5DA 4QLKA 4J3VA 1V3HA 1KTCA 1VIWA 2X2YA 3LXAA 3L4ZA 4J3SA 3ARSA 1L8NA 1Q6DA 3LXBA 3TOPA 1EOKA 1UWSA 1VEPA 2VCBA 3MKKA 1G94A 4AD5A 3ZJ6A 5JBEA 5CXPA 2PBGA 4GINA 3K8MA 1M03A 4MJ4A 3EJSA 3VGGA 2GDUA 1CGVA 2VR5A 1EDTA 4C7DA 4LYRA 2EPOA 3AZTA 3WKZA 3ARYA 3ZMRA 1JZ8A 3BCFA 2VQTA 4FF5A 2O9RA 4OIFA 4ML4A 1VFOA 3RM9A 4XZWA 4AZBA 4PCTA 4DUXA 2YFOA 5A8PA 1UKPA 4W86A 4QFUA 1BPLB 5DT5A 3CHDA 3T0DA 4D6EA 4CGTA 5I78A 5DT7A 2WBGA 5E9AA 2DEPA 3AIQA 3OLDA 1W9BM 3LRMA 2PWHA 3RDKA 1HNYA 2Y5EA 2X1IA 3MUIA 1QI3A 1QBBA 2W92A 1X1NA 1HJWA 2D3LA 4EANA 4IPNB 3VMOA 1V6XA 4LGXA 4CN6A 3CZJA 4CKQA 1DWHM 3CIVA 1E43A 3MV11 3IK2A 3BGAA 1DTUA 4BQ2A 3EJTA 1WDQA 1WDSA 4KWUA 3NDYA 4HP5A 4XZBA 3WN6A 2JF6A 1B90A 3VGBA 5D9PA 3NCOA 1FFQA 3CUHA 3WQ6A 1EOMA 4AEFA 2DQXA 1H2JA 3MS8A 1WZKA 4J7RA 2X09A 3L4WA 3AZRA 3LMYA 3ARZA 4Z2KA 2WMGA 1RP8A 2WVSA 4P7LA 1QI2A 5A8OA 1SMDA 1E5JA 1J0JA 1V6WA 2AMGA 1ZBCA 1F4HA 2YL6A 2BS9A 1K9TA 4AD1A 3RMEA 1UASA 4AZ7A 1EXPA 4LX4A 5FOOA 1J10A 1ZJAA 3A6OA 4HU8A 3W0KA 1OBAA 1E6QM 4HPGA 3WDJA 4AZIA 1T0OA 4PUDA 1TCMA 2Y2WA 1W2PA 3AHZA 4AZ6A 4S3JA 2Y4SA 4GI6A 2BV9A 1LG1A 5I5RA 1BG4A 4EK7A 4JCMA 1UWQA 5DFAA 2JIWA 1WZLA 4PSRA 2Y8KA 3L4VA 2PWFA 2XM1A 4W88A 4H7VA 1XRVA 3WNOA 1V3IA 3S5YA 2WMIA 3PZTA 4WJXA 4AC1X 3G6MA 3POHA 3M46A 1NP2A 3AHYA 4QDMA 2EABA 7TAAA 5D9OA 3ALGA 1MW3A 4D6DA 3F5LA 4U3AA 3U5YA 1NARA 4RE2A 3IJ7A 2XGIA 2WCGA 2BVTA 2DH3A 1PPIA 4TOQA 3W6LA 2BXZA 2WVVA 2ZX8A 3QHNA 4HZ6A 2WK2A 3L2LA 5CSUA 1IT0A 2ZUNA 1GORA 1E70M 1J9YA 1E6ZA 4NF7A 1C8XA 4DO6A 5E09A 2XSBA 4WKFA 4AYGA 1V0KA 5LA1A 5HPOA 3FN9A 2QMJA 3EJUA 3OBAA 1HT6A 1JDDA 4MPKA 2PBOA 2XFFA 3BUPA 5IXEA 4PMYA 1CWYA 3GYCA 4RE4A 1UQYA 1UQZA 4GZIA 2VX4A 5A6SA 2YKKA 3WH7A 2JALA 2VRJA 2JF7A 1KQYA 3AIBA 3KEHA 1KGWA 3BUQA 2DSZA 3PTMA 5I3DA 3AIUA 1W3HA 4MB1A 4UQBA 1KQZA 4TVCA 1PIGA 1W9DM 1JDCA 2YFNA 1PEZA 4TVDA 4UQCA 3EDJA 3N11A 2TAAA 3EBVA 1V3JA 3BAWA 4WK9A 3CZEA 2VUYA 5ABFA 2XFYA 1BF2A 1HJUA 2Y24A 4CCEA 1CXLA 3AMCA 2FGZA 1BG9A 1TQSA 2WWCA 2J4GA 2WZHA 5CSYA 4DWSD 4IM4A 4W5ZA 4NXKA 1BAGA 1W1YA 2YJQA 3CH9A 4GI9A 4JFWA 1BYBA 5M03A 1UR8A 3K8KA 3ZIZA 4GQQA 2ZUUA 2ZXBA 1V0LA 2FHBA 2J47A 1FA2A 3PN8A 1CYGA 4JFTA 5FL0A 4H04A 2QPUA 2DSVA 3VIGA 4AD4A 3LRLA 2XPKA 5A6KA 1B31A 5AYIA 5JIWA 1E1EA 3ARWA 3IJ9A 3WUEA 1HX0A 1EIBA 5BXSA 3TA9A 3BVXA 2FYVA 1XD1A 3VMNA 2CIPA 5FL1A 1ITXA 2V3FA 1BYCA 5ABEA 1KWGA 2CBJA 4WSKA 1NWUA 2YA0A 2ZX6A 1U30A 2X0YA 3TTYA 3AFBA 4DWSB 1FH9A 5BRPA 3W4RA 1WNOA 2X05A 2VZTA 5EFDA 2XIIA 2DSKA 4GO8A 3DECA 5A2AA 2WNWA 4PMQA 1WPCA 1OT1A 1SZNA 1CTNA 1GQKA 4MNKA 1E15A 1HVQA 3SIMA 4ZXOA 1NH6A 4ATDA 2W62A 2WC3A 4W7UA 2XVNA 2BNJA 4M82A 3SUTA 1R47A 3CTTA 2VRQA 2WYSA 4MNMA 4JKLA 3DX1A 3N04A 1D7FA 4TX6A 1C8YA 3MUZ1 2OW7A 1MYRA 3VIMA 2OW6A 1EHNA 4ZXLA 3CZNA 1NWRA 3VD5A 1TUXA 4AZGA 4R27A 3ARPA 2BY3A 1VBRA 3FAXA 3WNMA 3ZSTA 4PMOA 2W67A 3WIJA 4E8DA 4LXFA 3PZGA 4P7OA 4CCCA 5C71A 1QBAA 2WMKA 2BVYA 6TAAA 2XG9A 4U5IA 3BAJA 4FLOA 1B3XA 3CUFA 3GH4A 5A6BD 3W53A 2OYMA 1C7SA 2V3EA 1I1WA 2CBVA 1C7TA 3OZOA 4AZ5A 3EDDA 2F7OA 1JYWA 1K6AA 2PWGA 4E4PA 1QW8A 5JBFA 4ZEPA 4M29A 3UERA 4PTXA 1UH2A 3WUGA 4UOZA 3A22A 1BGAA 1KTBA 2A3HA 2BVDA 4HMCA 5A6AA 2WKLA 4Q22A 3T09A 2PC8A 1JGIA 1H41A 3MUY1 3D50A 2G3NA 1OWQA 3LXCA 2GDVA 3AHTA 3WQWA 2E4TA 1P6WA 2ZUMA 1HJSA 1JFHA 4D6CA 4V28A 4AISA 4MAVA 3FHAA 4N0RA 2EO7A 2DT0A 4HOZA 5EMYA 2VZUA 4D6FA 3TTOA 1E9LA 1PX3A 3SCWA 1VFFA 4UOJA 3T2QA 4TUFA 5A8MA 5M5DA 1A47A 3WDQA 2VX7A 1JL8A 3DDGA 4CCDA 2VX6A 5DF0A 4D72A 1UR1A 1JI2A 2PWDA 2CETA 1E4LA 4UQ9A 2QHAA 1E40A 2J62A 1CNVA 4AIEA 4U5KA 1E6PA 3VGFA 1E72M 3AIEA 3D4YA 1JXJA 3W37A 2WMJA 4CD6A 4XX6A 3WY2A 3WELA 4FLSA 1MW2A 1JF5A 3U5UA 1W32A 4CU6A 3HG3A 4BQ3A 2UY5A 4NRSA 4YN5A 3EMZA 1DWFM 4OOUA 3B9EA 1EDGA 1VJZA 4M8UA 1B1YA 1VRXA 5GNYA 3SUSA 3VUPA 2FGLA 6A3HA 3ARVA 2IXUA 5E6YA 4GZJA 3DYMA 3FNDA 4UQAA 3M07A 3MI6A 4L4PA 3A24A 5GNXA 3DYPA 3WD4A 1GOKA 2BHUA 4AIOA 2G3JA 3GXNA 5A1AA 3KLLA 1GJWA 1PIFA 2GK1B 3F5JA 2XUCA 3WF4A 3BVWA 3SUWA 2CHNA 2WB5A 1E71M 1TQUA 1MXGA 2UY2A 1UD5A 2ZXQA 1VB9A 1WDRA 3I3DA 1W1TA 1NWSA 3ZR5A 1E6NA 5A94A 2NW0A 3DC0A 2NSXA 3KLKA 1KGUA 2DIJA 4KRUA 1J0HA 1US3A 3GBEA 4UFJA 3VGEA 4AY1A 1DHKA 2G8ZA 2WKGA 1CPUA 1EH9A 3VU2A 1JAEA 1EO7A 4P7NA 3GXPA 1J18A 3WQ5A 4BQ4A 2CITA 3CBWA 1NM9A 5KZ6A 3NUKA 4LQ1A 1J01A 4ZFMA 3GNRA 2E3ZA 3VDHA 1KBBA 3CMJA 2WPGA 2V5CA 4D71A 2OYKA 2V3GA 3RO8A 3OGSA 1E0WA 4PYSA 3BCDA 1KXVA 3ZM8A 3II1A 5AC4A 1UUQA 1X6LA 5A6LA 1H1NA 1E4MM 1TA3A 1RP9A 3L4XA 1EA9C 4PSPA 4CU8A 2UY4A 1M01A 3A3HA 2XVPA 3MO4A 1CGYA 1UOKA 3WY4A 4E2OA 3KL0A 3PZ9A 1QVBA 3VKKA 1WZAA 3OLIA 3QGVA 2Q8XA 4OJYA 1UKTA 3EJQA 3WDHA 1TZ7A 1CLVA 3WF2A 2F1AA 3T0BA 3NSNA 2WHKA 3ZQ9A 3SCPA 4JL2A 4TX8A 5A6JA 1MVYA 5CGTA 3BLPX 4W87A 5A3HA 4D6JA 4IISA 4C7FA 4AMCA 4S3KA 3BC9A 1FFRA 1J0IA 4M1RA 4X0NA 4F9JA 1TE1A 1BYDA 4UFKA 1F4AA 1XYZA 3SCVA 3AXXA 4MB3A 1IZKA 1FOBA 1LG2A 1V6UA 5LYRA 3K46A 5I24A 3A4WA 4P7RA 3J7HA 3VVGA 1H11A 4UCFA 4D1IA 4NI3A 1JNDA 2CEQA 3FAWA 4WIWA 3DX2A 3GXFA 2X2HA 2IUZA 4KGJA 2X2JA 2W4XA 1FP9A 1E6XM 3N13A 4P8UA 2X2IA 1DWJM 4JKMA 4YHEA 2YDQA 1TMQA 1V3LA 3RM8A 5A95A 3VO0A 1OB0A 3A4AA 3MANA 1KGXA 1C91A 3TONA 2VVSA 2DT1A 3CO4A 3W38A 3T2PA 3UG5A 3D52A 4AZHA 4PBGA 1NP0A 1EQPA 3PZOA 3BUIA 2QF8A 4ATLA 1OSEA 1RH9A 2WC7A 1DWIM 4UOQA 3WNKA 3ARXA 1EQCA 3ARQA 1HWWA 3WUFA 1ZS2A 2ZX9A 5IFPA 2E9LA 4IUGA 3VDCA 2J7GA 1V03A 2WZEA 3IJ8A 5IHRA 1CXHA 1NWTA 1MW1A 4V2XA 2YDRA 1KXHA 5I0DA 3BAYA 2OYLA 1HJXA 2BXYA 3LPFA 3WEZA 1M7XA 4QP0A 1C3FA 2GJPA 3PZUA 3WNLA 3CZSA 3LRKA 1VEMA 2WW5A 4ZE4A 2XGBA 2J25A 3W28A 1WE5A 1AQMA 3HMCA 7CGTA 3BMWA 2GJRA 2VNCA 1GONA 3QHMA 4B15A 3WSUA 3N9KA 2XYLA 1R46A 3FY1A 2E8ZA 3EMCA 3TP4A 4MNLA 2E8YA 5I6SA 1H0IA 3WFZA 3QOKA 3VD7A 2JIEA 4BCEA 1CECA 4D6HA 1VENA 2YIHA 1B3WA 4WF7A 1CXIA 1NOWA 3PZIA 3EDKA 3BMVA 1KCKA 2OWXA 5HPCA 4U33A 5A2BA 3BVUA 3S5ZA 3CZ8A 1E56A 2OSWA 3SURA 3VSTA 3AROA 3OLGA 4XV0A 1GPFA 3VDAA 3AYSA 2Z1SA 5CPSA 3AJ7A 4DO4A 1KR1A 1JZ6A 3AIRA 2EXOA 3CHFA 1ISZA 1UZ4A 1AVAA 1UH4A 1QWUA 2WMHA 5HBFA 1KBKA 1GHRA 4AEEA 2GVYA 5CPTA 1LWHA 1MQQA 3AIWA 4W93A 4JAWA 1HN1A 4TTUA 4F8XA 5D4YA 4B3LA 1MFVA 2WANA 1GOQA 2IGTA 2ALWA 5CPQA 3SCOA 1ZJBA 1W2VA 2ZUTA 4E8CA 2J75A 1FHLA 5FD0A 1XH0A 3HG4A 2VZVA 2CBUA 2GJXA 2DH2A 1WZMA 1XD0A 2CYGA 5CJ5A 1JZ3A 2OWWA 4J3TA 1VFMA 3UETA 1V02A 4M24A 4J27A 1EHAA 4UFHA 3AS1A 4UZUA 4B9YA 2ZUWA 1J11A 4CU7A 3CUIA 3WFLA 2EJ1A 2JFEX 1FH7A 5LA0A 3POCA 5EB8A 1PJ9A 2CBIA 4FMVA 2QLYA 2EBNA 3NDZA 2AAAA 2YDSA 4PTWA 2B31A 1UWUA 2CHOA 5AYBA 2D22A 2XM2A 4ZE5A 3VIOA 2G41A 5D9MA 1GVIA 1ITCA 3LX9A 4PMUA 3WD1A 1OGBA 4W84A 1E4IA 1B9ZA 1QX1A 5HXMA 4WLCA 3OIHA 4UNIA 1GOOA 2QMKA 1OD8A 3VNZA 1R75A 4CUCA 2QV4A 4F79A 3SCSA 3H55A 4FNTA 2XVGA 2WMIB 4J3WA 4DO5A 3W25A 2VT0A 1RD6A 3QOMA 3CZGA 1XSKA 3RCNA 2VTFA 3IANA 2WHMA 1ZBVA 4Z2JA 3AISA 2E9MA 3A21A 3B9DA 1V08A 2YA2A 1R34A 2WVVB 3H53A 1LL6A 5HDRA 2D3NA 1DP0A 1LL7A 1BYAA 3KE0A 3CHEA 1DWAM 4HMEA 4ACZA 1MWOA 1UZ1A 3ZT6A 3WH6A 1GHSA 2VO5A 1E73M 5E6ZA 1PZ3A 3SCQA 4LYPA 4UTFA 2MANA 3CUGA 1KB3A 3WY1A 1US2A 1QHPA 2PB1A 2D2OA 1Q6CA 2Z1KA 2VX5A 2VC9A 1CEOA 5IHSA 1QI0A 5CG0A 3WNPA 1YQ2A 2EPKX 1G9HA 3EYPA 3W24A 2CKRA 3G6LA 1E4NA 4YPJA 1UHVA 2D73A 3AIVA 1ZU8A 2YA1A 1K9EA 5DMYA 2OSYA 2EQDA 1L0PA 2VI0A 3I3BA 3KL5A 2XSAA 1UWRA 1LL4A 2C7FA 1BLIA 4W7VA 2DDXA 1X6NA 4BQ5A 5ABFB 1ISXA 3ZOAA 1OD0A 4P8WA 1JZ5A 5FCZA 3B9AA 3AQUA 3GNOA 1TVNA 1W91A 4J3XA 4PMDA 3TTQA 3GH5A 2FDMA 3U7BA 1JFXA 2WVTA 3MMDA 5I77A 2ZWYA 3O2LA 4KMQA 5FIPA 2DT3A 1QOXA 1O7DC 1EDQA 3DDFA 4HA1A 4EKJA 2ZXDA 4NZFA 1HJQA 4UZSA 4F9DA 3SUUA 2Y8VA 3PZNA 2E9BA 3BVTA 2XWDA 4PN2A 4AZCA 2RGLA 1H49A 2EEXA 1UD4A 3WDIA 3SCNA 4AD3A 2ZX5A 1OCQA 1M53A 2VCAA 3PZQA 3T08A 2D0GA 5A2CA 3CHCA 2G3IA 3HJEA 3ZJ7A 1H09A 2VRKA 1UKQA 3M6DA 4GKLA 4UQEA 4JZ5A 2O9OA 1NOFA 3S2CA 3SUVA 1CGXA 4B16A 2D20A 3I3EA 3AHVA 3VSUA 1GJUA 1SFSA 4PEEA 1DEDA 4OKDA 3DYOA 3VILA 5M17A 2E0PA 3WMSA 3NSMA 3D4ZA 5M3WA 1AQ0A 1WO2A 1HKKA 4JKKA 5A8QA 2BY0A 3WDPP 1ODUA 1GOWA 1LWJA 1XSJA 4KGLA 2J7DA 1KXQA 1EGZA 4PMNA 3ARRA 1TFVA 1GOMA 2W5FA 2C8NA 2UWFA 1JYXA 1TVPA 4P8XA 4N42A 4HU0A 4TXEA 2YL5A 4CVWA 2A3EA 3RILA 1GQJA 1V02E 4B3KA 1LJYA 1ZBKA 3RIKA 1B2YA 4ZENA 1E0XA 3CGTA 2WZIA 2XN2A 1JNEA 1W9XA 4X0VA 3D5HA 4MDPA 3VD4A 3UR8A 2V3DA 3QHOA 1KCLA 4AIUA 4NZJA 3K4AA 3CZKA 3AI0A 3UEQA 4UFLA 3AYRA 3GXDA 1K9FA 1KFWA 1GQLA 3S6TA 3FXYA 1QNSA 2FH6A 2WCAA 5CLWA 4WKAA 4XB3A 4AMXA 4A3YA 1HL9A 1R87A 3CC1A 3AMDA 4AZCB 4OBSA 2DT2A 1N82A 2PF0A 3WEOA 2WM0A 4PRWA 4H8UA 1HJVA 3WBAA 7A3HA 1V6YA 4U2YA 1XYFA 3WY3A 1GUVA 1XCXA 2D23A 1R7OA 4ACYA 1YHTA 1C90A 5HOSA 3UCQA 3WUBA 4OGZA 8A3HA 3K4DA 4Z2IA 4IPLA 1GVYA 2CXGA 3EJPA 1WDPA 2ZWZA 1UH3A 4GQRA 2YL9A 1UR4A 1QPKA 2NT1A 2F7RA 2J7CA 1J0ZA 2O9PA 3DHUA 3PZMA 4DUVA 1VAHA 1JXKA 2HVMA 1HKMA 1BFNA 2J74A 4HMDA 1RPKA 3SEPA 3HN3A 3BLKA 1CLXA 1R7AA 4P8VA 3M7SA 2VR4A 3KL3A 2XWEA 5I79A 3CUJA 1ZB5A 3U57A 1UD2A 1MQRA 4Y7EA 3THCA 2EPMX 3VIIA 1K9DA 4D1JA 5ABGA 4WSJA 2C0HA 5BRQA 2VMFA 1W1PA 1HKJA 2GSJA 5TD4A 3DX4A 4MAZA 2XJ7A 1SR0A 4JL1A 1OIMA 1XSIA 5I23A 2ZX7A 3WL0A 3VD3A 1XH1A 5I2UA 3BAKA 4Z2LA 2EPNA 3PZVA 1R86A 2VL4A 1J12A 1KWKA 3WQ4A 1BVNP 3WQVA 1G01A 3BVVA 2YBUA 1UD3A 4AWEA 5D8ZA 4W7WA 1Q6FA 4J3UA 4R5EA 4UFMA 2J8GA 3KZSA 1CDGA 4URIA 3VMPA 4B9ZA 2CNCA 5DEZA 5JUVA 3OG2A 4NRRA 5IFTA 3W6MA 2ZUVA 2PWEA 1ISYA 4W8AA 1ZBWA 4OOZA 3L4YA 5BXRA 2ZIDA 2JEPA 1OGGA 4CVUA 3W82A 2WC4A 3BSHA 3IAQA 3VTRA 2XVLA 2VOTA 3VDBA 4AYSA 2BFGA 1WAWA 4RL3A 2DPEA 3MSGA 3SCUA 1UD6A 2F7QA 2YLLA 3SCTA 1TG7A 1JD7A 2VCCA 1OIFA 1MXDA 2WLYA 1D2KA 3DX3A 1JF6A 1MFUA 2XVKA 1QHZA 1PS3A 1QNRA 5E0CA 3EMQA 4KH2A 3GXIA 2FE0A 2J7EA 3AS3A 1S46A 3UG4A 2YL8A 2OSXA 1C8QA 2WXDM 1TA3B 5C8BB 2F7PA 4EE9A 3BLBA 1UG6A 1ISVA 3GZAA 4MNJA 5CQ1A 1CXFA 5CZKA 3OB8A 1CIUA 1FH8A 3W81A 2EPLX 2O9TA
chains in the Genus database with same CATH superfamily
3VZYA 5H8DA 4XZLX 4WFGD 3MVIA 5JLZB 1K70A 5HYJA 3VXSD 1VACA 1YXYA 3SY1A 1FIEA 4BI5A 3T71A 4QJ5B 1PTZA 4HVBA 1RI8A 1TDQA 3DI1A 3T2OA 1AZRA 3UBHA 1MO0A 2EIKB 5IT2L 1XQKA 5LHEA 1TPC1 4QI3A 5JPMC 1E55A 3TFKD 4C58B 1CBVL 4HUXB 4EI0A 1JYNA 3O6FB 1BVWA 1XBXA 3HFML 3IF1B 3VXSB 3FT2A 1YXDA 1D2PA 3PNWA 4GPVA 4NRYB 2KH2B 3QHFL 4LSUH 4ATTA 3AICA 2BP1A 2X4PB 5CZSA 4XCEB 5EZJA 3QXAB 2J3SA 4EP8C 5F9DC 1QHOA 1PG7L 4IGBD 2LFEA 3SDCD 2ISWA 4H40A 4BZ2A 1OG6A 1B3YA 1J88A 3Q3GB 1QBLL 3EZ4A 1P1ZA 5L8LB 1M7UA 1ZRUA 4WGXA 2CZVA 5F1VA 4DKDC 4LRIA 1KENH 4BS0A 1SR9A 4Z7OF 3H54A 3MOBL 3TS8A 3G1DA 4GI4A 2H1LM 1JGLH 4IGBB 3FQNB 3SDCB 2YBTA 3C2EA 1X5XA 4HJEA 1LO5B 4PVBA 4CNPA 1JJUA 4J4PD 2GWGA 1U8MA 3V10A 3TWYA 5F93C 1FQ9C 3BUDA 3HQ1A 5ADPH 5GRUL 2WXLA 3MLUL 3DX6A 3CV5A 1T7XA 2OR9L 4YSRA 3NFNB 1MWAL 3VB8A 3OR6B 3WG6A 3ECVA 4LS2A 4Y8DC 4H41A 4O1AA 2GI7A 1BLNB 2ADIA 2C14A 2FNWA 4Z5RB 4LCWE 4JS3A 4NPYA 2OZ4H 4Z7VB 1CGUA 1NLBL 3GBLA 3Q45A 3MCLL 1HXKA 1BEYH 3MRKB 5IB1B 1D5ZA 3AREC 3QNXB 1XGQB 3BUBA 4C5YA 2HLFD 1HL8A 1F41A 1KBWA 4DPAX 4UTHA 2EH8L 4HPHA 1R3VA 3UPRA 3APDA 3HM7A 2DV6A 3GIYA 4PRTA 3H7BA 4MCNA 4C7GA 1F1DA 3D0VA 4Y1TA 2UXVA 2Y7QB 3FS2A 3WMCA 1RJYB 4AITA 3VPLA 3GJFA 5J6GA 1RURL 2IBZX 4GBXD 3KXFA 1MJUH 5EBWB 5IHZA 4GQ9H 4NM8H 4FE9A 5IB2A 3ABMB 1JGMA 1VJSA 3OJVC 3KDOA 5FB8A 2LQRA 3S5LG 3PP4H 4NN7B 3S34L 4OLUL 4YN3A 4XBEH 3S5SA 1N12A 4FP8H 4GBXB 2YC1B 1UOWA 5AFAA 4Z76A 3ZLQC 1LMKA 4J12A 1W9PA 5DHXB 3R8RA 1DLHA 3HZYB 4TOYH 1FIGH 2EDBA 3D2TA 4EX4A 3A6CL 4JFUA 3AG2B 3CYJA 5DJAA 3I6LD 3OODA 3HS0B 2FTAA 4M19A 4BY3A 2DJUA 2CJSA 4P5RA 3NG3A 2I9LB 4OKVA 1IQDA 4BF7A 3KJ6L 4GRWB 2P47B 1EANA 3EJZC 2WCSA 2PR4L 3ECQA 1V0NA 1EL3A 4MB4A 3GW0A 2L3BA 3L2MA 3NBNA 2R0ZH 1TZHA 3UAJC 1A5BA 4FALA 4WTZG 3LZ5A 4XMTA 1S9VB 2D0HA 3WMLA 2PS2A 2OP4H 4JVPA 2NLIA 3GGWA 1TR7A 1SOKA 2DMBA 4FNSA 3TN6A 3BEWB 3LEYL 1JG9A 3C5JA 4RMRA 1IIKA 5J8OA 2PI6A 1QI4A 4NKDB 2GFTA 3WHXA 2CO6A 4UT9L 5BOZG 4LHJB 4J8RA 1XF0A 5DGQA 3C0LA 4ZMTA 1HTYA 1HIML 2Y3NA 4L4VE 3NPVA 1LL1A 5CZXD 4FXKC 3ULSB 3QWNA 4UQ2B 3KWUA 4LLDA 4GFTB 4MNHA 4JANA 1DWGM 4GVHA 4FFYH 1QKZH 4NBZB 3AZSA 3QXBA 1QO3B 1O12A 5D5MB 3LB6C 1QPOA 3KRZA 4XHJD 1H5BB 3ZTDC 1ONEA 4KH9A 5L0QB 4HISA 5B3NA 1NFKA 1C9WA 4K7PX 3S8HA 2D2GA 1Z9NA 3LNEA 2LT9A 5KSVB 1Z5HA 2IPUK 3F6IA 8TIMA 1NDYA 4OGYL 2FL5A 5JBEA 4ODHH 3TW6A 5FYLE 5MEQB 1E4JA 4OIFA 1WBZA 3OW1A 5IFAH 5A8PA 1UKPA 3GSNL 4O14A 1AFVL 4YBLC 5ICUA 3CQKA 3QC0A 4CGTA 5CFHA 1MSPA 3OLDA 2R2EA 1JXDA 4KRLB 3GTXA 2WAQA 3FO1A 1HKFA 4FNLL 4IPNB 3LIZL 1FZOB 3MRHB 5HQEA 2EVGA 4X60A 1XVSA 4XAGA 3MA9L 2K6ZA 4XZBA 3QDGA 1EOMA 3DI2B 3MS8A 5DC2A 2OMYA 2AQ3A 2VDKL 3LMYA 4LUTB 1QI2A 5A8OA 3JXAA 4KNUA 2FIKA 4ADUA 3NRQA 3BTNA 3QT2A 4DF9A 5B39B 3SHSA 3OTTA 5HGDA 1IEAA 4JFXB 5DANA 2EKJA 5I5RA 3VFLA 2EDFA 1BG4A 5DFAA 4BFGA 3N34A 1PCWA 3G6MA 3IDXH 3DRQB 5I19H 4JMXA 3W87A 3LKNB 4TLTA 4W9EC 4CJ0A 3MQTA 3JUZA 4HPOL 2ZA3A 1KN2H 3VNMA 2CNYA 2WWMC 2AS5M 1T96A 3G77A 3U6WA 2NW2B 5DQJA 5F6HI 4Z7NE 3GMMB 4GOSA 4HEME 5HYJD 4IMKC 4Z23A 1PAZA 3E9UA 2I17A 1P1XA 1MFMA 3R2GA 4P5TC 3RVUD 4KITB 5IOKA 2KERA 3E2HC 2K3TA 1P0DA 4NENA 4JKPH 1V3JA 5FAGA 2QKIC 4ZQNA 1IFRA 3RPBA 2BRQA 3URBA 2FGWL 2XV0A 5CWSA 2ALRA 5E9DA 4AKPA 5HYJB 1VACB 1FFNA 2GTWA 2YK1H 1BYBA 5KSAA 2Y2YA 3RTLA 1F4XH 2MNWA 2ZXBA 4LHUG 3Q6GH 2W9EH 3MV7E 1LWRA 4QXGL 4JFTA 4YSSA 2NX9A 1HHGA 1MHCB 3BQ5A 3BPLC 2XXFA 4G9PA 3CXDH 4X6FA 3NOEA 3L2IA 4AGLA 4I1RA 3LH2L 3CSBA 3FT2B 4U1NA 3PNWB 3NZSA 1OC7A 3NSJA 3GUTA 2XX0A 4P2RA 2DSKA 4UYQA 4C57C 3JZUA 1QEWA 1WAAF 2XVNA 5EZJB 4UTLA 1AI1H 3CQQA 4KKBD 3NDYE 1PIIA 3QPYA 3IAGC 2BB0A 4LQFL 4DJMA 5HYSG 1P1ZB 2O26U 2DTMH 1OD7A 1WF5A 4YHYC 4Y5XA 1IE5A 2L04A 1HCYA 2CLZA 1MHEA 3Q8AA 6PTDA 4DXXA 3GR8A 1G9EA 1WS8A 1S7RA 3BFQG 3R13A 3VG0H 3H26A 1Q5MA 1F3DH 4GUGA 2G0WA 1ESOA 1U8MB 3LLXA 4H7CA 3BARA 1A4BA 4HXAH 4JGDA 1DVFA 3F03K 1LP9F 3DX6B 4MAVA 1TJ0A 3KRUA 1DQTA 2GC4C 4KDWA 4I3GA 2NY5C 1OHLA 2IOMA 2EICA 2R1KA 1EPVA 2C9UA 2CWXA 2Y5TA 1N5YL 5IVXF 2ADIB 4HK6A 3TN3A 4G6ML 4LRNH 1OGAA 2IANA 4U5KA 4MJHA 3VGFA 2DZWA 2NV2A 1F58L 3KXFD 4MM1A 2AEPL 1VHNA 3CMOL 1CK0H 4Y5YC 5I6XB 2ZAGA 3UPRB 2AKZA 4JQAA 3VOHA 3NH7H 2J9YA 1R6VA 1X5ZA 3H7BB 3HBGA 3ARVA 2AP2A 3D0VB 3UGUA 4EDWL 2VSKB 1KKRA 1KV8A 1KDIA 3A24A 2AABH 1GKOA 3GJFB 5J6GB 3GK8L 4KQ4H 3GXNA 3CIQA 3KXFB 1VZHA 2XUCA 2EG7A 5IHZB 1MXGA 3CVBA 4KXBA 1J1XL 4GRLC 5C9ZA 2H26A 3SO7A 5IB2B 5HVWA 4YDNA 1SVDA 3LJ3A 3N6QA 3EF4A 1KGUA 1PCXA 5FB8B 2ZOTA 3AY2A 2G8ZA 3MMTA 1EKOA 4BBWA 4Y9NA 4P3DB 1EH9A 1R0MA 3II2A 4X4ME 3DC8A 4LQ1A 4A2LA 2EHHA 3NA9H 1KBBA 3CMJA 4Z76B 3HI6H 3ES7A 5HI3C 3QEQA 4AWUA 4ECLA 4XNDA 3KPOA 1RP9A 2YARA 4XPBL 1LOLA 5AVVB 2CSPA 4TNWK 3A3HA 1DLHB 1ZJIA 5KOVC 4XX1G 1LDPH 2O4QA 1QVBA 3VKKA 1E8YA 3IJ6A 2FFIA 3QG7L 3W1UA 1GAFL 5DJAB 2NQJA 3T6QC 3WF2A 4PJAA 2F1AA 1XI3A 1KXVC 4N3UA 3SCPA 2PCQA 5GHWL 4OKVB 3W2KA 4D6JA 2AJYH 1S6NA 1IQDB 3CASA 3CAVA 1J0IA 3W2LA 1ZA6A 1KLUB 3QIBC 3DOHA 4F9JA 5MENE 2BVEA 2QPDB 4N8UA 1BG1A 3SCVA 4UM9A 4MB3A 3SZ6A 2VSCA 4RW5A 2AKMA 5I24A 2I5GA 4D1IA 4J1OA 2H9AA 3VG9C 3GGWB 2G5WA 5TF1H 3VFGL 4A6YH 3C5JB 4ZZFA 2YZ5A 4WY7H 3WHXB 2JKSA 2DT1A 3F64A 2CO6B 4ANWA 4UTWC 3LH9A 1JCVA 1YNPA 2GI0A 1MUMA 4ATLA 2VR8A 2R15A 2FTPA 3WNKA 1Q72H 4LLDB 3T9WA 4MNHB 5IHRA 4JANB 5FFGA 2XWJA 4LLYA 4PW9A 3S2NA 3M86A 3C52A 1C3FA 2GJPA 4CKVX 1KFAH 5SWZE 5E95B 5DN1A 1HUVA 2WSRA 3ME3A 4KRNA 3EMCA 4G11A 4XP1L 2PLKA 3BDYH 4P49A 2FL5B 5KZDA 3NZ8A 1TTBA 4QG6A 1UEYA 3OA3A 5HPCA 1YNQA 1QCWA 5T5NG 4HCGA 1IT9L 1EBAA 4FXSA 1WBZB 4ZMQA 2VXQH 1ETZA 3NIDB 3AYSA 5AG9A 1NCUA 5PAZA 1QWUA 3GSOA 4FYQA 4MXWL 4J3ZA 4LGRB 5CPTA 2R2EB 3OMNB 4W93A 4F8XA 1A5LC 3FO1B 2J1WA 3O2WL 1KZYA 3QUKB 2ZCLH 3ITLA 2CBUA 4QNPE 1XD0A 5C0BA 3K6DA 3V0IA 1VFMA 5DI8A 5MP6H 1UJPA 2WP3T 1K4GA 1FH7A 4K7FA 4S1SL 2OMYB 5EB8A 1PJ9A 2CBIA 1NELA 4AZ8A 3TK7A 3SYAA 1R3YA 2WQXA 4PTWA 2FIKB 5LXVA 1UWUA 4O1BA 4WW1B 2QHRH 4DQAA 1E6JL 1SJDA 3LX9A 1DBMH 3GNML 4ZTOL 1G4RA 3ZXAC 5HGDB 2OZTA 2JV6A 3NPWA 3KS6A 3TNMA 3WJWA 1A4MA 4MAUH 4HK3J 2DM4A 4J3WA 2FEEL 3CZGA 2VTFA 4Q0XH 3LZRA 3QPQD 5DK3A 5CEZD 3K71A 4R7WA 1FGVH 1R34A 1FN4A 1CB4A 1MLCA 1MAML 2GY7B 2HFFA 2X1UA 3DETD 3IKCB 5DQJB 1OANA 1SFJA 1HEJC 2V2XA 2NCEA 3ZLHA 4Z1BA 4L2YA 3V6BR 1EX0A 2ARJA 1TEGA 4WFGE 1US2A 4KDTA 5IQ7H 3VXSE 4XNQA 3GFZA 2RA1A 4TLUA 2XISA 5KSAD 4QLRA 3S42A 2CKRA 4TTDD 1K9EA 3U36A 4QRNA 4NENB 3T4AA 5EU7E 3KD4A 2YRZA 4MUPA 4BQ6A 2VE6A 3ESNA 2IQ9L 4PB0H 3M0XA 5FUZL 4IRJC 1HH6A 5AZ1A 3LIUA 4EI5C 3IFLH 1LO2H 1VC4A 1QWGA 2GTWB 3L6FA 5KSAB 4P2RD 3GUFA 3ZZLA 4F9DA 4HZLA 4FI8A 3L1FA 2E9BA 4NX5A 1HHGB 4PUUA 5AW7B 4K2SA 4X6FB 3TAOA 3VI4F 4Q4QA 4DKEH 1W1IE 3Q01A 5J06A 2R4RL 1IBGL 3SGJA 5IF0A 1U3NA 4YQXH 4R85A 4QLWA 4ZO8A 3GUTB 4MF4A 4BEIA 4P2RB 3OAZH 1ODUA 3GMLA 3JWOH 3KM1A 3NCJL 4PJHA 1ZHBA 3W73A 1TX2A 2JKTM 2BMKA 2BSSA 1NU5A 1QEWB 1LHZA 1QA9A 3ARRA 4K5PA 3QC3A 4ACTA 4AEHL 1D5IH 5DZLA 2CGRL 3CX2A 3S4TA 3VRJA 4Z7VE 4A21A 1E2VA 5J3HD 2KQMA 3W7CA 2DMGA 4LT7A 2WJ5A 3D5HA 5F0JB 4Y5XB 4YUEL 3N4EA 2CLZB 1MHEB 1H1ZA 2V0TA 2DQJL 3GD6A 2F8VA 2Y7OA 4U1SA 1S7RB 4NI8A 4H01A 1QNSA 1U6AH 3K7UA 2WCAA 2ICWA 1OGAD 2IAND 4WEUD 4RXFA 2E56A 1N82A 4HAGA 3K6SA 3OVUB 3LCIA 1R7OA 4ACYA 3GMPA 5F7EH 5K93A 4GSUA 2Y5TB 3T44A 5JMRA 2OX4A 1OGAB 2IANB 1I45A 1XH3A 3PHSA 3QLDA 4EN3C 1RUKH 1NKGA 1XBRA 2EXWD 5CAYB 3CUJA 3QULB 2Z28A 1GVEA 1SJEA 2FX8L 1X5KA 3BGFB 3GYRA 2ZF8A 3B4YA 1IIGA 4JQVA 1VBGA 2CHRA 2YKLH 1R86A 2VN7A 1KWKA 4M1BA 1CICA 2C3WA 3PIQA 3BVVA 4M48L 4URTB 1ORSA 1WEJH 4GRWE 3NQAA 2QGYA 4JDEA 3QEQD 2FO4A 1PDKA 3N40P 4JOMA 4W8AA 4UINL 3QK0A 2H26B 3R43A 3T9PA 1UBSA 3VTRA 2XVLA 3NJHA 4JO8A 3B3BA 5IHHA 3I6LE 4DAFA 2H1XA 3LQAH 1NEZA 2DQWA 3GJEA 1GGIH 3BP5B 4IP5A 3B0XA 1IAOB 2PPCA 1SVCP 3QEQB 2QV2A 4PYGA 4UM9D 1T2JA 3UVIA 1DVTA 3KPOB 1PKYA 3T0XA 3IACA 4RZ4A 1EXHA 5FFLA 5DS2A 1M41A 1MDAA 1QFWI 1A7NL 3FBKA 4O1CA 4YHNA 1WQVT 1AH3A 3FPXA 5D5ME 3WF1A 4PJAB 3S9IA 3JUGA 2E7LC 1GZHC 5DUPH 1VBUA 4HC1L 4L5FE 5D32A 3ERPA 1BKSA 5EU9A 2DKUA 4XMUA 5T26A 1ZA6B 4K3EL 1U1UA 2H2SD 4UM9B 1Q0YH 2VDOL 1EPFA 4POUB 4DP1X 2IKIA 4FL4B 4BFNA 2H9AB 4MLJA 1MREH 5JQIB 3TQPA 1HJCA 2C9SA 1I2PA 3UJIL 5CSSA 5AYTA 2V38A 1RVKA 4Z6AT 1XC6A 2BFVL 3B06A 3CWOX 2P45B 3H7UA 1D8WA 4WO0A 2DSWA 2EECA 3UOAB 1RXLA 2GJZA 2XN1A 2A5HA 3OZMA 1W56A 3V4UH 5IUCA 3NM1A 3B4NA 1IC4L 3TW7A 4G9DA 3F5KA 4FLRA 4EIBA 1ZKAA 2XWJB 2BDNH 3O45B 4LLYB 2BNRA 5A8NA 1UMLA 5EMUA 2EILB 2C0AA 1QNPA 2BSEA 4GI8A 3TWAA 1O5PA 3VRLF 1H4PA 4JY9A 2QQKH 1QPPA 1HHHA 5CEXA 5HNNA 5AEAA 1QAPA 3D0AA 3NZ8B 1AHWC 4PJGF 1S78D 4CD7A 1NBVL 3ITOA 1I3GL 5C0BD 1B4TA 5HP5A 1ETZB 4J3OG 3IXTA 2D4DA 1AOHA 2ZWKA 2GW5A 1OINA 4G80A 5HDBF 5FF7A 5DUMH 4OM0L 1T89A 5AAMC 3I4EA 3GSOB 3N15A 4DN4L 2P5EA 5KBMA 1VFUA 2YPLA 1A14L 4HKXA 2IO5A 3RJYA 1CFSA 2XFRA 4LPWA 1QLFA 5C0BB 1UP0A 5DI8B 4C6CA 4M7JL 4JHUA 1JRHH 3JUYA 2V82A 2NRDA 3HC4H 1R2TA 3PWVA 4K7FB 4M80A 2HLEB 1CQKA 1PVHA 4LNCA 1Z3NA 3C09B 4HGWA 4G8GA 1M9SA 4XPAH 2Y1HA 4Q97A 3GHEH 4RFOL 4ODVL 3SGKA 1P5BA 1A6WH 4ACPA 1VCVA 2E25A 2F61A 2GUYA 7XIMA 2OO6A 4QRSA 1S5MA 3CLEH 3TNMB 2Q8LA 1FBIL 3VXPA 1YEKL 2GK1A 2XN0A 4RX0A 5HYJE 5C2GA 1YJDC 3G0XA 5KVDH 3U3HA 3K71B 1FN4B 2X16A 3N9SA 1MLCB 4F2MA 2HFFB 4F57L 4F80A 3DI0A 4WRLA 4PJ9C 5FX3A 1QZ1A 5FJPA 2V2XB 4F8PA 4EI6A 2ARJB 2XBTA 3M44A 3UZ5A 5FYLL 4KUZH 1NQ6A 4XNQB 1K5NB 3PBGA 1A5KC 3TZVC 1GHFH 3VD9A 2GWNA 5FYJD 5A2KH 5F2LA 1EEYA 4JNZA 4Y8AA 3U36B 1W3KA 3T4AB 4MKMA 3IJEA 4EVNA 2VE6B 3RIFF 3H2WA 1TLKA 5LIKX 3M1CA 1KELL 2Q3ZA 4N5ED 3H2NA 1HH6B 5IBUG 3LI0A 3UZWA 2IVFC 4JFQA 2Y89A 1E4WH 4JO3L 5EL1A 3WMBA 5BMFH 5FUCE 5E1GA 4UMGA 3WFBL 2BIMA 1RSFA 4HZLB 3KPTA 2VZOA 3WLMA 3WH5A 3W23A 2J20A 2PW2A 1Q1JL 3NTYA 3B9KA 4KY1L 3WNNA 1UKSA 1KF9B 4JQ1A 2BY2A 2C34A 4AQZA 4M93C 4F9LC 1LQBC 2IPFA 4K68A 2ICWI 2JQAA 5IF0B 4KRTA 1CGWA 3FRPG 1J7VR 3GMLB 2G3MA 1AD4A 4PJHB 2FQFA 4RLIA 2BMKB 3GFUA 1P1MA 2BSSB 1QA9B 4DI8A 6PAZA 4HG4J 3CV6A 5HGBA 4PMVA 1XGUA 3O2DL 4RPQA 4LKXA 1YNKL 4XMLL 4UIKL 3VRJB 3LTVA 4HQQL 1UWSA 1CFQA 2XZCL 4GQGA 1NUGA 3ZTNH 1UEMA 1U3JA 1OYAA 2N7BA 4ZB0A 4PCTA 1DQDL 3LD8B 1KRAC 2ZZ2A 4U1SB 3W7MA 1VPXA 3XISA 3MXWH 2P80A 5AZEH 3UYRL 2EDHA 3GO1H 2OLSA 5KS9F 2ICWB 4AF0A 3ECWA 1W9BM 1HNYA 1CBJA 2W0KA 4GAJL 1JGVH 3NZ1A 4CNTA 1L6WA 5C0QA 1HJWA 3B5TA 3KXFE 2E5DA 3S5LA 3K6SB 3RLGA 1E43A 4M7ZB 3IK2A 2ZRYA 5IBLC 1I9RL 2ZWNA 3GMPB 5EO1A 1SF3A 3MJ7A 4LY8A 3MV7D 1OOAA 1TPXC 3IV3A 3CUHA 5FHAH 3V9FA 1F6KA 1RUPH 1H2JA 3N85L 1CICD 1M7PA 4YIQB 1VKFA 4X9SA 5EOCL 5AUMA 1AJ7H 1CDIA 1QRNA 2R1LA 3LNFA 1XH3B 2G2NA 1ZPUA 4GG9A 2V2DA 1UASA 4PQXA 2VEGA 4LX4A 1SJEB 1OBAA 1WFNA 1Q63A 1T7LA 4I2XA 5KMYA 1J9TA 3FT3A 1NEYA 3MV7B 3EFFA 5DEJA 3ZWSA 3OJ2C 2O7QA 5C2UB 4OV9A 3PZTA 4PE8A 1CICB 5H37H 5C0CA 1PKMA 3PIQB 4WTZA 2V30A 1ORSB 3IJ7A 4RDQG 3N25A 2W6RA 4JDEB 5KW9H 2DORA 5CC7A 3S9DB 1S5WA 2FO4B 3QHNA 4N1EA 3A64A 2HT3C 5EOCJ 4FQHA 3BRDA 1EYWA 1H60A 3L5JA 5LA1A 1BZ8A 4AL8C 5EC2A 4BJHA 4U1JA 5KJRL 3BLEA 5TDPA 1HESA 1F8TH 5CBIA 1KCBA 3DWTA 2DWDB 2Y2TA 3GJEB 3OF6A 4RMSA 5I3DA 4I4WA 5IQLA 4LDEB 3AM8C 2J88A 1JDCA 1PEZA 1AL8A 4RSYA 1KM5A 2HE5A 2R1WA 1RZ7L 3CSGA 1T2QL 4NNYA 4KVCH 4YHNB 2FUQA 4UTIA 1LZOA 4KAQL 3ARFC 3PUDA 5DQDL 1ZGLM 1PZ0A 3EO9L 4FQIH 1WS7A 1P7TA 4L7ZA 5J1TC 4P3WA 1W1YA 4O13A 2ZOOA 2WXOA 3P30L 2P7TA 3DA0A 3K30A 3CQFA 5AW0B 4YTSA 4YZFE 3H2EA 4RMUA 1I3RA 2Q76A 1M1SA 2A7NA 5AYIA 4XMPL 4B5WA 2VXQA 1EIBA 1HKLH 2APXA 2FQEA 2BNRD 3QEZA 2NY4D 4L8DA 2KPNA 3NIDE 1MCJA 2BSED 3EGDB 2UX7A 2VZTA 3EFDL 4O02H 3QUXA 4YTTA 1AQ8A 2PCYA 1KN4L 2GJZB 1SZNA 3T4WA 1FDYA 4WFED 3S35L 4G9DB 1EDHA 5IOPA 5IM7A 1PLGL 1J48A 2RIKA 4DJDC 3K1KC 2A9NL 2VDNL 2BNRB 2AK1L 1TUXA 2NY4B 5GGQH 4MG4A 4B0MM 3QDGE 3W5MA 5CN2A 4LXFA 1NAMA 1WFTA 3SQBA 2HRHA 3BD3A 2JJSC 3C75A 1U8IA 3TT1H 3W83A 3C5ZA 1HHHB 2ZCKL 1TTPA 5FF3A 1T4KA 2P5ED 5CEXB 3W53A 2OYMA 2YPLD 1PKQA 2H2PC 2I9TA 4HYTB 3D1MC 2Y8UA 4E4PA 2JGQA 5ITBH 3IGXA 4OJFH 1NGXA 5D09A 1QD0A 2A3HA 1XGRA 1LORA 3ZZSA 3IXTB 1PD0A 2W60A 3MLRL 3T09A 3SRHA 4G80B 2XFGB 4J5VA 2NOYA 2P5EB 1J1OH 4G8GD 3SGEH 4DW2L 4PLJC 4NN5B 4Y19A 4NHCL 2YPLB 5B1JC 4HKXB 2F2KA 4L4MA 1A47A 1CFSB 1VS1A 3NA4A 1E4LA 4F2EA 3VFTA 1CDCA 3NRFA 4JGMA 4GAFB 2D7NA 2BC4A 1HOCA 3W37A 2WMJA 1NM4A 1A4CA 2FX7L 3PWVB 3TO4A 4BUGA 1NF7A 1JF5A 1DR9A 4QHMA 4HGWB 4G8GB 4FI6A 4M6NH 5CEZE 3M45A 2Z92A 2ON3A 4H9YA 2FZ8A 4MFDA 4XD3A 4QRSB 1T7VA 4U49A 3N5AA 3JW7A 2B4GA 1SMOA 3VXPB 4LHUA 2GK1B 3WF4A 4RZ5A 2ROYA 4MTMA 5E9DE 4HJWA 2UY2A 1UD5A 2WJDA 1E8XA 1NWSA 3S46A 3DTXA 2PETA 4JDBA 4F2MB 3CBJB 1I7RA 5FYJU 4HCRA 1B57A 1N6QL 4TSBL 3V55A 2HEJA 2WKGA 4NUGH 3Q43A 4R4FH 1FCQA 1EO7A 4P2OA 3WQ5A 4KCTA 3ZVIA 3KZPA 5AC8A 1GEQA 1KFJA 3NQ8A 4IMDA 2PDBA 1XBVA 4EAYA 2FVKA 3V4PH 2ZC8A 3LUTA 4LASH 3PZ9A 1KLYA 4P2CG 3L0KA 4P2RE 5D2LF 1EEYB 4R3SA 3NSYA 3IJEB 4KJQD 2WUCL 4EVNB 3CPRA 3S3CB 3IARA 5HYSA 2XTJD 3B9KD 5F1NA 4NOBA 3BC9A 3MZGB 3WJYA 3MYJB 4IU3B 4KZDL 4XWGH 1ZAJA 4JFQB 2GJNA 1IZKA 3IS1X 1CB7B 1XIDA 3W2DH 1CF1A 4ZOAA 1T8QA 3GXFA 1TYGA 3IFNL 1E6XM 4F58H 4PW3A 3UO8B 3ZKNC 2LTQC 1GL4B 3MBDA 1MAKA 4ZMWA 2PW2B 3SOTA 2XTJB 3B9KB 3CO4A 3NJMA 2YXWA 4NZ1A 4FN0A 3QZLA 2QF8A 3S47A 2WC7A 4LP5A 4Y9CA 3FYEB 4HIJA 1V03A 4O1EA 2C1OA 1TJIH 1NGYA 3AO0A 4KTEL 3P6LA 5D7SH 3LRKA 1XR2A 5U4NA 4P9HL 5GGTL 5HGBB 3FU5A 2P80D 1XGUB 4U0QB 5BJTA 4LKXB 3WSUA 1KZQA 3BJTA 1ZIBA 1WJ3A 3QJSB 1T03L 1OGAE 2IANE 2AV1A 2G3FA 4PMEA 1CFQB 2E6PA 2Y1ZA 1NIFA 2EDLA 4UNKA 4L64A 3HB3D 3N9RA 3X3FL 4N2CA 1S38A 1WUNT 1FL5A 4E9RA 3GDTA 3TJHC 4HWZA 1WDAA 1QRND 4AF0B 1NAKL 1P4IL 4H88H 3W0WA 1G0XA 3GSVA 3R06A 1ZJBA 3S5LB 4LSBA 5EF0A 1SLUA 4JK0D 3FMGL 3HB3B 5EO1B 3MJ7B 4PJFA 4ZX6A 2ZUWA 4LANA 3T0EC 2Z6JA 3MDJA 3HMWL 5C0CD 2R2HA 5AUMB 4I0CC 3UG8A 1QRNB 2XY2A 2EBNA 3UFYA 5LGZA 2WJZA 2HVKA 4FG2A 4K7VA 2OMWA 3L95A 3QEQE 3A9IA 3QEGL 4P04A 4WLCA 5LWYH 4I2XB 1JCTA 3FT3B 1TRDA 4N85A 3EFFB 2F8OA 2OKMA 3ICJA 1IGCH 1VZIA 4B9PA 4XNZC 1NWPA 4PJAE 1MUCA 2F68X 2ZCZA 3H3KA 5C0CB 4KXDA 2C15A 3CJPA 3OF6D 2J9ZA 2J71A 5EZIL 3G3LA 5J7CC 1ITBB 3SE9H 2NYKA 4GQZA 4K8RH 1BIHA 1WH0A 1LL7A 2CO3A 2OPCA 2ASHA 3RKDD 4RA3A 5DO2D 4F27A 3BPNB 4U1JB 5GZOA 5TDPB 1ZD6A 2ANUA 1A7QH 5E8NA 3RLHA 4GYKA 1FZJB 2HTLC 4G70B 4I4WB 2VC9A 3NQ7A 5FO9A 4YLCA 1SUHA 1UBPC 1CLOL 3EYPA 3PWNA 1ZLWK 4YPJA 1LM1A 2R1WB 2A1WL 5C7XH 4HJUA 3U0WL 3LS5H 1W8NA 4NNYB 1ZENA 1AACA 1S2CA 1TVNA 3PDDA 3LSCA 4HG4K 3QW4B 1P7TB 3WUWG 1S9WB 4NZRH 4BI6A 3IK4A 1EDQA 4HA1A 3QUXD 2Y1AA 4FQ2H 2P7TB 2Z4TA 3UCRA 4EIUA 3HN5A 1MIEL 2Q76B 3FU0A 1OCQA 1JUKA 3CFIC 4JPWL 2VXVH 4L1TA 35C8L 3M6DA 5D6CA 1V7MH 3L3IA 4NBYB 3VSUA 4L8DB 4L8SA 4OKDA 3HGOA 4ZODA 1A5UA 3QUXB 3FQUA 2XZ7A 3C5ZD 3ZDWA 1EWEA 1UWXH 2Y3AA 3HC0B 1XSJA 3NOYA 4WIQA 1EGZA 1SJBA 3PUCA 4YS4A 4DZ8A 5BNKA 1UG9A 3GC5A 3KWWA 1XO8A 3AJXA 5IOPB 4L6DA 1P6AB 3D33A 5IM7B 3A67H 3TGXA 1OO2A 4PIRF 4HU4A 5C0BE 3UBXG 4TQ8A 4OGQC 2X7LA 4HPJA 1A53A 1NAMB 1JNEA 3SQBB 3CQHA 2FPYA 1U8IB 4XPTL 3C5ZB 1N70A 1VPQA 4MDPA 1T4KB 1LRNA 2Z7KA 5DY2A 4Y19D 1PKQB 2I9TB 4DGVL 5JIIA 4NQ1A 4FAMA 3CN0A 5J56B 3P60A 3GXDA 4H8WL 1AL7A 4AWTA 2FATL 1NGXB 3IGFA 1Q2SA 4F8NA 2X3CA 1PZBA 1NFDF 1XGRB 2W60B 1P6CA 3SDXF 3VOIA 1JMZA 3LOWA 1V6YA 1NCDH 2VUOA 3WY3A 4JUTA 4ZMXA 1N64H 3P4OA 3NG5A 1FNAA 1Q0XH 4F3FA 4Y19B 4Y9EA 3WUBA 4L8BA 3K4DA 1QZNA 1FGNL 5F9WB 3NNTA 1U41A 1X5AA 2ZWZA 5A5WA 4DWDA 4L5FL 1I8IB 1OARL 2QQLL 4E6MA 3KVLA 4PJ8A 5JHLH 1RPKA 1OFQA 2AEOA 4IOFD 1CLZH 2BC4B 1HOCB 3T07A 3E2RA 1OM3H 4GYJA 5BRQA 3WHE0 4QHMB 2GSHA 2X0WA 5D4HA 4MAZA 2DUZA 5T1MA 2EF9A 4MD4B 3GBNL 2Z92B 3U4BL 3VD3A 4L8CB 3BAKA 1NFAA 1J12A 4WTXA 1M65A 1BVNP 1G01A 2WYHA 4P2OD 4RGND 5A6IA 4R5EA 1TO4A 2WXHA 2LHAA 2WQWA 1FLRL 2YZ1A 5LGXA 2Z8VC 1HHJA 1D7DA 5IFTA 2XU9A 1ISYA 1RZFL 3L4YA 5I8OH 1J5IA 2WLKA 2A74C 1BQUA 5GISH 3DTXB 5FYJE 4ALAH 1I7RB 1AZBA 4BM7A 2UY7A 3IDJA 1L7IL 3KZ8A 4PJ7F 4P2OB 3OHIA 4RGNB 3RWFA 4PV8A 3EJYC 4AJYV 1TV7A 3SODB 3EPNA 5EB9A 1YEYA 5MEPA 2G5RA 3LERA 3QRGH 2NQHA 1OCNA 3P82A 5CQ1A 2BIOA 3B4UA 2Z27A 4CQ9A 4XVUC 4POCA 2F6AA 1I3UA 3K3QA 2EPLX 4PJHE 4R3SB 4IOIA 4UTTC 2E4FA 5HYSB 5F1NB 3MU3A 2AZUA 2QUMA 4WWKA 1OEPA 1AOZA 5DRNA 2X6BA 1LBFA 4QCEA 1MHPH 3CH8A 3MYOA 2K45A 5DZOA 1QWKA 4NJ9L 2O92A 2NY2C 4NILA 3G5ZA 3JS3A 3GUWA 3P0YL 4U7KA 1IFHL 3FTZA 1IKNC 4N2MA 2QDDA 5ENWA 2VLKA 4DWSA 3U1SH 2NR6A 5I15H 4A2EA 4WDUA 5BV7C 4XO4A 2Z25A 3A23A 3F7RA 3GRBA 4ODSL 4HIJB 2DICA 2ZJSL 4F0SA 3EYSL 1T5WA 3RYSA 2C1OB 1NGYB 4D0DA 1TJPA 1L9PA 1XPYA 1U5JA 4Y2OA 3QS2A 1I9IL 3X11B 3UR2A 5SWSA 3TYGL 3WXWH 2CBTA 5FM8A 5DA4A 1O75A 3KP1A 3SDYL 1ELSA 3FNKA 1GTEA 4B96A 1A6AA 5BWFA 2D1ZA 4TRPL 5GRZA 3KBJA 4NKIL 1MNUH 5F1IA 5G55A 1UROA 4FQJL 1CFNA 3SCMC 5IHWA 2YGYA 1FL5B 2Q6ZA 3HMXA 5E0FA 1E9IA 4HWZB 1RIVL 2ZTJA 1FRGL 4JNXA 4TQEL 3KPSA 5KBDA 3GSVB 7PCYA 3R06B 4PTMA 3RPDA 1HP5A 2YD9A 5C3TA 4BZ2L 4FEIA 4ZW7A 3NCEB 4PJFB 4AD0A 3ZSSA 4XXWA 3O4OB 4PS4H 3ME0A 2QPSA 3SOBH 3NCCB 3R0MA 3FCPA 1TZZA 2R2HB 3WTXA 1IAIL 2NV9A 4GIEA 5ES4B 1DBTA 1QRQA 4IIBA 3IPFA 2HVKB 3O41A 4RWHA 2OMWB 3L95B 5E6IC 4M6PA 5GSRA 3H9YA 4XOAA 2KLRA 4HTYA 5AVRB 3ARUA 1W54A 3DO3A 4XN9A 3G9VA 4QDGA 3NSDA 3RURA 5GZOD 3UC2A 4CNUA 3LAFA 4KNTA 1QI5A 4IIQA 2E47A 2J55A 3GQFA 3RFZA 4NP4L 3EX6A 4KX9A 1ADWA 1EFQA 5JIDA 4NJKA 1LWIA 3SYPA 3NPSB 1D3CA 3PS7A 2WKJA 2VURA 2B9AA 1Q8MA 2QF7A 4RAHA 4LVDA 4NM4H 2PDXA 4FQXC 3TEVA 5E8NB 3PUUA 3FH5A 3IGHX 4Q32A 4NPYB 3N44F 2JBMA 5FO9B 3ZE2F 5DJ0A 4X42A 1L6ZA 3PWNB 3MJMA 4D9PA 1WXZA 2B0SH 4KJWD 4NQCA 1D5ZB 1RD5A 4EPSA 3D05A 1UR0A 2EPHA 4NAFA 2PPDA 3VSQA 2VDHA 5CO1A 3P14A 4X6CA 2BNRE 1KNOA 5CFAA 5JBDA 3NXFA 5IDIA 5HJ3A 4E8GA 2AAMA 5JMOC 4UAOB 2VLRA 4MJMA 4URKA 2MOGA 2X3AA 3D08A 2B7QA 3QKEA 3OU8A 1CI1A 1OW0C 2E27H 2J1XA 4IRZA 4KKRA 2B3IA 4WFEE 2DJMA 2F18A 3D3FA 5D6CB 3L3IB 3J8F7 2P1FA 1OY3B 4L8SB 4FERA 3PBWA 3TV8A 4Z2HA 5CGYC 2B3RA 2ZA2A 4XNMA 1VHPA 2FJGA 1B6UA 3FQUB 1HXJA 2ESCA 2BHZA 2P5EE 4IBQA 2J24A 5CC6A 2O5YH 1FWAC 1E3ZA 2YPLE 3HPLA 3RLSA 4DZ8B 3KWWB 2D4FA 3BSGA 1EO5A 2FB3A 2ORBH 4H2CA 4B9IA 4D8OA 1R0AH 2XI9A 2DIKA 2X7LB 1CE1H 3ORWA 1DVJA 1TJRA 3EJSA 2W07A 4I3RL 1MCIA 5ECGA 1QR1A 4QTHA 5LBGA 1KULA 3DDMA 4G8GE 2UZIH 3KNBA 3MLYH 1R9FA 1IE4A 2L4OA 2AXFA 3X3GL 5HINA 1TZHB 4RA0C 2X4TA 3FXIC 3V0VA 4PJ8D 3S8GB 4ANXA 2Y5EA 2ZCHL 1VPOH 2P5WA 5FJOA 4QSFA 2D3LA 1TO5A 4JZNA 5F7FA 4PMFA 2AJ3A 2QV5A 4DFIA 1OTUC 1FXPA 4BF9A 4J8RB 1GTFA 1T99A 4EPDC 3P4OB 1U8PA 2CLFA 1WDSA 4OD1H 4F3FB 4LLMA 3QXTA 3IRCA 2JMRA 5K7JA 4L8BB 4O54A 1C29A 1K7XA 4AEFA 4F2ME 1F11A 1WZKA 4J6RH 4LAQH 5I1HL 1I31A 4IH3A 3NM3A 4PJ8B 2C9AA 1HH9A 3CAQA 5FCSH 5HHVL 2C9QA 1F4HA 2H0JA 3NJNA 4F33A 3ET9F 4HU8A 3RFAA 5D71L 4HPGA 5TPWH 4Y9BA 1TTAA 1GIGH 4AZ6A 1UUMA 4BWUA 1LG1A 1B2WH 5T1MB 4GVFA 3T81A 4K23L 2X1PA 2ZPKL 5KBKA 1BMZA 3LVTA 5FHBH 2DQUH 1ZHKA 3U7WH 3JZYA 3VUSA 3B2VH 3NIFE 2NY1C 3QDGD 4KZEL 2NXYD 2WVVA 1HHJB 2YWYA 2WK2A 3W9ZA 4MMZA 4PRNA 4G3YH 1JZJA 4WKFA 4Q3MA 3FL7A 4N5UA 2LU3A 3US1A 2ZZ3A 2UY7B 4RV3A 5C9XA 3IDJB 3BT2H 1NKOA 5IW6A 3E1ZA 1SBBA 3FRPA 2XTJE 3RWFB 4PV8B 4WWKD 2HWZH 2YFNA 3QDGB 2NXYB 2WLIA 5MEPB 1UJ3A 4OLYH 1DQJA 3N11A 4IFKA 1XIJA 3LNGA 15C8H 3A4FA 5DT1H 4E5XA 3ZQWA 4Q8WA 4IOIB 2WSDA 4MAYC 3WLJA 2VLKD 2NZLA 1IEAB 2VGBA 4DWSD 3ISRA 2PTDA 2NR6D 2G2PA 2Y88A 3EWCA 1XGYL 4WWKB 5DRNB 2GUUA 4EXKA 5LAPA 1RXOB 3DXIA 3DIPA 4RESB 1X9QA 3O81A 3H9SA 1B9KA 3HBQA 1KMGA 2WQPA 3G5ZB 2ZZUT 3KG5A 2X4SA 4QGYA 1HYSD 4O28A 1HS6A 4G6JL 4JN7A 3QNFA 4Y2DA 3U9WA 5ENWB 2VLKB 1GGBH 3GVWA 4DWSB 4EXBA 4HX1A 5SWSD 2KX9A 5INDA 4Z0SA 4C4BA 5CEZL 4XZUA 4MNKA 2VR9A 3VXTA 5E9DD 4IMGA 2YD8A 3SUTA 3CTTA 3RLVA 2EXTA 1D7FA 1T5WB 5B3JF 5D1XC 4ABQA 1KY7A 5HTSA 5IBTH 4GNVA 2YXOA 2FGBA 3ARPA 4DX3A 4GG6A 3NEOA 4Y2OB 4QIUA 2CK2A 2WMKA 3I4KA 2ADFH 5SWSB 2L5HA 3CVCA 1PV8A 1S2TA 1QRNE 5CWSB 2GYSA 2FD6L 2Z00A 3U9UA 4WNQA 1M3IA 3MO7A 5E9DB 2CBVA 1A6AB 3EDDA 3H42L 3G6JA 5I3JA 3V35A 1FFNB 5F1IB 2F5BL 3F4DA 3LI1A 2BWDA 2Q9OA 1A3XA 4I2XE 1CFNB 1G9MH 2BVDA 4OZHA 3H85A 3A4JA 1LD9A 3FO9A 1PGRB 1JFHA 5C0CE 1YRKA 5LBVA 4JRLA 5GGVH 2D03H 1BV8A 4QWWC 3T2QA 3MRBA 4U1NB 5HJGA 1S5VA 4CCDA 4FZ8H 2PWDA 4JO4L 4D9LH 4U1GC 1S7TA 4HKZA 1GZQA 3MFFA 1M5WA 3ME0B 3DIFA 4XX6A 2OZ4A 5DRZA 3PAOA 1A3ZA 2DLHA 4JYEA 5H91A 4NRSA 1THCA 3TBVA 1D9KC 2DMKA 5AN7A 5SX5H 4AH7A 5GSRB 1DVFD 5BOFA 2WJEA 1JCYA 4OY9A 4RRPG 1EGJH 5DCDA 1XFBA 3QH3A 3KLLA 3F5JA 2NYZA 2YR1A 4AGPA 1EFZA 3MJYA 4HIIA 4IIQB 4MY8A 1FX6A 1IGFL 3ZR5A 2IMNA 5LNSA 3RFZB 3DC0A 3G22A 1JPIA 1R3IH 1QFUH 4NQCD 3CB3A 4GJIA 3NQ2A 4KK9D 1CFBA 1DVFB 2JKLA 1ILSA 4AC2A 5KTLA 3UTPD 4XR8C 2Y1YA 2MCMA 3LBMA 1OAZL 1Z69A 1J01A 4N0UA 1X44A 3T05A 4PYSA 1H1NA 4HIXH 7ENLA 1ZVSA 2VLRD 4BZ1H 5DJ0B 1X38A 4ZUVA 3ONCA 3SGEI 3HJZA 1E8WA 4NQCB 3WDHA 4J3OD 2ZWLT 3B2UD 1MJ8L 3GEWB 4NAFB 3TH4T 4AVHA 1WDWA 2YD6A 1KM4A 4M1RA 1YEFL 4X6CB 1A3WA 1KNOB 4H44C 3U8GA 4ZPVA 1A0DA 4H9UA 5HJ3B 1JXFA 4K2UH 5J12B 1LG2A 2VLRB 3MCOA 3J7HA 5CUSL 4UCFA 5EMJA 1AS6A 5H37G 4KGJA 1UC4A 4W4QA 2W9DL 4UV7L 3QQWA 4DPCX 1PKQE 3O8XC 2PRHA 2VVSA 4YE4H 1SGKA 2YAFA 4DERA 2BRRH 3D52A 1XG3A 3M0YA 2DZVA 6XIAA 3A6BH 2ZX9A 2DZTA 2VMCA 4XNMB 1L6SA 2FJGB 3DZ1A 1YNLH 1OAQH 4QGTA 3KH3A 3VJ6A 4NBXB 4Y19E 1HWHB 4YPGA 4FFYA 3HPLB 2YQGA 3N19B 2O1AA 4QKXB 1EDYA 3UAFA 1OP4A 2RUSA 1ID2A 1WE5A 3MI2A 5C3IA 5D7JA 3D3VA 3MCMA 4JDTH 4OW6A 2P5WD 1OHQA 4PTTA 2J8UA 2V4LA 1XBYA 2W07B 1QR1B 4QTHB 3ES6A 3FA4A 1KSRA 3TEWA 3SQMA 1DBKL 3KNBB 2AXFB 5CPSA 5FK9A 1A1MA 1KR1A 3ENLA 3CZFA 1G1OA 3QJRB 4TVPD 2X4TB 3KCLA 3EBHA 2RD0A 12E8H 2P5WB 3BUYA 4JAWA 5D6DC 5AWNH 3UTQA 1QFWL 4IGNA 3HC3L 4KOCA 3CQJA 3TASA 3BQ6A 2AJ3B 2Q7YA 2BW5A 2GJXA 1WZMA 3LSOA 1U8PB 2XWCA 4C65A 4LLMB 4LOCA 2EVFA 1NIDA 3BYYA 1ONQA 3IMTA 3T65A 2DWEA 1SFTA 3OXRA 4EXPX 2Q01A 1F11B 2UX6A 1IEVA 1FHNA 1HH9B 2BVWA 3MACL 4RGNE 4K8HA 1YQVL 4F33B 2AFNA 3WD1A 4W84A 2PPEA 2H3KA 2X1XR 2WJ7A 1BBDL 2QMKA 1EZVY 4MPQA 5C9KA 4NJJA 3C5QA 5IBUB 4FNTA 2XVGA 2X1SA 4N2IA 2FVMA 3C60C 3QOMA 2AMUA 1XSKA 3B0YA 1ZHKB 5B7ZA 4A37A 5HYQA 3PJWA 5I6MA 3MHUA 1FWXA 1NIEA 2A1YA 2WVVB 2G97A 3V0EA 3DRTA 4XN1A 1ZE3C 3LOTA 2VWTA 4BQCA 4MMZB 4N2KA 1UZ1A 5I3IA 4V33A 2WUBL 1EEPA 4A39A 4XD5A 3WH6A 3TPKA 5C92A 3ZE0B 2XQBH 3HV8A 1J8KA 4HNLA 3BRFA 3CUGA 2QSCL 4ISVA 3WY1A 5IW6B 5IHUH 4XOCA 3FRPB 2BM3A 2PDFA 4PJDA 4B3EA 2AXGA 2MJWA 5FA5A 3T2LA 2WLIB 3VD2A 1UJ3B 4OQ1A 2CK0H 3TYBA 1DQJB 1L0PA 3W1PA 3H9SD 1VADA 5C07A 4IFKB 4K3HA 3TA4D 4AZ8B 2XZZA 4YSAA 4P8WA 3JWDL 4E5XB 4M7TA 4Y2DD 4KMQA 4LP4A 2DT3A 3FOMA 1CR9L 1MCNA 5B7MA 4BE6A 5CLXA 4TULL 5DRXA 3PZNA 1IC5H 2QVFB 3STBA 3H9SB 3GPSA 1NQKA 1UQSA 3ZLFA 3CHCA 3VQ1C 4K6AA 3EZ8A 1N7MH 1T41A 4Y2DB 2PW1A 1ZT1A 1CTOA 4PB9L 4GIRA 4V15A 4HX1B 3OD3A 4L1LA 3DVFA 4XZUB 1L6YA 2AJVH 1RMFL 3VXTB 1H6UA 2RCSL 4TYUA 5TE7H 3W0WE 1YDPA 3UO1L 1A5FL 1RUQH 4HU0A 5JPNC 1C5BH 3BK0A 3C2RA 5BWAA 2TRSA 3ZO0A 4GG6B 4PJFE 1TO3A 2R0KL 3JTTA 3WLHA 2H3DA 1O5XA 4XX1E 3U9UB 4AM0A 2BBFA 3QUZC 3WLTA 4CCZA 4WNQB 3WS6C 1KCLA 3ZTEA 2QGHA 3G6JB 3FJTA 3AI0A 3UEQA 2W0UA 4UILL 4E36A 3L6FB 3T1FA 2OL3H 1KFWA 2Q0ZX 3RI5K 3S6TA 5K9JH 2B5IC 1VFSA 3FA5A 3HAEH 4OZHB 4HJ0C 5CKAA 1IWPA 1R3SA 4Y96A 1LD9B 2E46A 3FO9B 3RX3A 1BWWA 4HB7A 1HJVA 1XYFA 3MHZA 1J6PA 5DVMA 2D23A 4F24A 3GWJA 1CW2A 2E86A 4A2MA 1NC2A 3FUKA 3MRBB 4DGUA 3EJPA 2O0TA 5FOBA 4YWSA 1X5LA 4APQA 2XIQA 3ELQA 1S7TB 4D3CL 4HKZB 1ZHBB 4B41A 1GZQB 3ROLA 5F97E 3BLKA 3MFFB 4HBCH 4A2DA 3DIFB 5KYYA 5AVQB 5AVWB 4AY8A 1HAUA 2CUAA 3MBXH 5DRZB 4JX4A 2XZAL 3U30B 3VIIA 2TSAA 2QHLA 3TBVB 1MCBA 1T1XA 2XJ7A 1G0YR 3ZYIA 3ZZ1A 4X80L 3M5ZA 2PYFA 3WUWA 3WQVA 1PD1A 3ZTCC 2DVUA 1Y6NR 3B8TA 4AWEA 4W7WA 3QH3B 1IGWA 4KV5F 2J8GA 3WAKA 4B9ZA 4IBTA 2Q7NA 4G8FA 1SEQL 3FJNA 3W6MA 4HIIB 1BKHA 3RVWC 4BH8A 1INEL 3HRPA 3P0VL 1LUCA 2ZP9A 4HSQA 5AFDA 3A12A 4N4QA 5KINA 1JD7A 1QHZA 4N0UB 4G5ZH 4I13B 1QNRA 3NK3A 1F4YL 3L5MA 3NP3A 3PGCA 3UJRA 2UVEA 3NJVA 1ZVSB 4XBGA 1KNWA 5I16A 3WJLC 1GYMA 1XQ4A 4ZUVB 3PB0A 4ONFL 2ID5A 3UZEC 4CLMA 2DI7A 2EIEA 4DM2A 5AKQA 4DGIH 1MCPL 2PURA 1T83A 1KTNA 2BP5M 4KERA 5F7AA 3EWBX 4F8QA 4AW7A 4ZPVB 2WVUA 5EA0L 2A9CA 3GDBA 3KOXA 4BCYA 1WBHA 4LBSA 4FABL 1WZ1L 2E59A 4JHOA 3NJGA 1C92A 1PDKB 1JR1A 2G60L 3RBGA 1JSYA 1LLWA 5D7JD 3D3VD 1JZ4A 1NMCB 3U83A 4A6YA 1WCGA 2IDCA 3B8WA 5LQBL 5AVYB 1HNFA 1V0MA 5JA9A 5DMNA 2EIDA 4M0XA 1E5NA 4LAMA 3ZZQA 1NEZB 3E5PA 4EAEA 5LNDA 2A9MH 5I5IA 3L5XH 4OJEH 3CN3A 1XHGA 2ZXWB 4JO5A 4JRWA 5D7JB 3D3VB 2NXZD 4Y9MA 5T33L 3APTA 1A3HA 1J0YA 1BXXA 4UUJA 5IQNA 1POJA 3VX0A 2HQAA 5L6YL 2J8UB 3BAEH 3RGTA 3E6HA 1AS7A 4GX8A 3ES6B 5LN8A 4QRPA 2QZRA 1Q38A 1B3ZA 3BLLA 3UXFA 5C2CA 4X9HA 5FK9B 4IQEA 1A1MB 1RZPA 1JBJA 5GQBA 4ORGA 2NXZB 4AJ0A 1MCOL 3HNTH 3BUYB 4OFKA 3PG9A 3UTQB 3U7YH 3H4WA 3S36H 1WFIA 2Q7YB 5LDUA 1GK8A 3ZKMD 2GJXB 4HIPA 2X89A 3LSOB 3RJOA 5DS8A 1ONQB 1CDYA 3T65B 2DWEB 3QXDA 3U2SA 3OXRB 5GJMA 1TFPA 1PYWA 3HOGA 1LQAA 4Y4HA 4Q8TA 2G5BA 4YDMA 2FZNA 3NO1A 4DJEA 4A7GA 1S7UA 4M6QA 4WHCA 2BVOA 4JY5H 4OAWA 4R0LC 3U4FA 1DXEA 4G6AD 1LO0L 5F3HA 4R2GD 3LV5A 5GZNC 4RUBA 2EKCA 1W1VA 2J6VA 4GO6B 2E9GA 5C2BH 3HB9A 5B3SB 5HYQB 3CU7A 3QG6A 1T5KA 1R85A 3N17A 5MI0B 3PTKA 3DRTB 4MB5A 5C07D 1XSOA 1TQVA 5E8EA 2XETA 3NCYP 4R2GB 1SHXA 2UY3A 4C47A 3AU6A 3AMKA 3T0AA 3TT3L 2QS8A 5JQ6L 4ISVB 25C8H 2VLKE 4B2DA 2EYSA 2PPGA 4NIYE 5KEZA 1QLFB 3D51A 4FHJA 4PJDB 1GW0A 1QTPA 2AXGB 4ATWA 1NGZA 5LA2A 5HI4D 2CPCA 5FGCB 3SBWC 1VADB 5C07B 3ELFA 3P11H 6ALDA 1Z9PA 1RIUH 4ESKA 4H0HB 5JYMA 3QO1A 2IWEA 2L8AA 2HLAA 4HSNA 1IXQA 3VB9A 3FOMB 2QLVB 1SHSA 3MKVA 3OAYK 5HMSA 3UJTH 2EDTA 5SWSE 2CPUA 1PL9A 4JJ5A 3PG2A 5DRXB 2MHAA 2Y36L 3HG2A 2OLHA 1L9SA 5JR1H 2ICEC 1QACA 3FC8A 3W26A 2MH4A 1UQSB 3RUGA 4WQ6A 1VDGA 4ABUA 2UWEF 5AOMA 3THDA 4YXKH 2PW1B 4FQCL 1ZT1B 3HU7A 4CMHC 4JIEA 3FCUB 5LGHH 1UURA 1HZKA 4K37A 4NUPA 3LCXA 2ZICA 1SMAA 3JT2A 1XLCA 1H3WM 4LMQI 4BK8A 4IXHA 2R1XA 2FYYA 4M6OH 5FWRA 3MI3A 4EI6B 5I18H 5DURD 1S5TA 3EXRA 3CQ0A 4GS7B 2QVIA 3RWEA 4YHMH 1X7QA 4G7EA 1ULVA 3OZ9H 1Z44A 5D33A 4J3SA 1GYCA 3LXBA 1EOKA 4GUPA 3TCXA 5HVFB 4TMPA 3JTTB 4KWVA 2O93L 1QR4A 3NIFB 1TB3A 1TT6A 1NC2D 4S2CA 3X12A 4F37K 2BSLA 4W86A 3L7FA 5DURB 4D6EA 4APQD 3T1FB 2K78A 2VM3A 4UOW0 4XBMA 5CM1A 3F3HA 2OBGA 3B0UX 1I4FA 2VXNA 2YHGA 5GJTH 3CFQA 3FYPA 3CN2A 1JV5A 1V6XA 5FJTA 3DUUA 4HSOA 1YMYA 2WNKA 3PWAA 3B43A 4KWUA 2PUZA 1NC2B 4XPHH 2F58H 1MFBL 1FFQA 3NCOA 2CJTA 5FOBB 3WIHH 2KT6A 4APQB 4J7RA 1XXDC 5EIIG 2CZ5A 3ROLB 2AMGA 3BV4A 3P67A 5KYYB 1YPZF 5FOOA 1DYSA 1EHXA 2VC7A 5HGGS 5ICXA 4JY8A 1ND0A 1ERNA 2R1YA 5D1ZC 1T1XB 9RUBA 4JCMA 1WZLA 3IRSA 1F2XK 2PWFA 4NQCE 4H7VA 3TN0A 2PYFB 3WUWB 3KYAA 4KHXH 5EMMA 2EABA 3UBXI 3S2AA 3UTPE 3F5LA 4HD5A 3MOQA 3LMJL 1WWBX 4X6CE 4G8FB 3L21A 3WJZA 4OGXH 3L2LA 2C79A 4JPIA 3GLZA 4DO6A 4BH8B 4O0ZA 2VLRE 1LUCB 3UWEA 2GBAA 2CJUL 4YTQA 1SBSL 1NMBH 4IIHA 5KZEA 1N67A 4F15B 1BQLL 5DD0L 3RX5A 4KVNH 2CHZA 1TCDA 4OFIA 3AIBA 2C9RA 2QJNA 2XDFA 1CIDA 3DG6A 2I32A 1KQZA 4CSZA 4YTUA 3QZPA 1BQKA 5CG7A 3PGCB 5G1MA 2WBJC