4JFUA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
total genus 163
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jfuA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jfuA01
2VOTA 1E5NA 2W62A 4JFUA 1UKQA 5F7UA 2PWGA 4QLJA 3TTOA 2ZUVA 2OWCA 3BUPA 1KCKA 3MMDA 2YFOA 4AEEA 1GQLA 1JYNA 4GIAA 1LWJA 5BYWA 1J11A 5GNXA 5CLTA 1C91A 2EABA 3SCUA 3WMSA 2O9TA 1W9VA 2WLZA 3ARPA 3WELA 1MW2A 2Y8KA 4W7VA 3VPLA 1OGSA 3LRLA 1GOWA 1GOKA 3FNDA 3EDKA 4MB5A 1V3IA 3MSGA 2F7PA 3T08A 2QF8A 5ABFA 4P8VA 2WMFA 1XD1A 2YFNA 1KCLA 3BSGA 1VFOA 5JUVA 3AHTA 4AY1A 1QVBA 5CXPA 1KTBA 1UWTA 5I0DA 2CEQA 3OA5A 1EHNA 2J79A 4TUFA 4CD5A 3B9EA 3VIHA 2WHLA 3THDA 3BUIA 4MNKA 4BQ5A 4FLQA 1ZU8A 1XYZA 6CGTA 4TTGA 3AIEA 1RPKA 3SCQA 1OINA 2ZWYA 1HKMA 3WNNA 3VGBA 2XPKA 3ARYA 1M01A 3IJ8A 1R87A 1KQZA 4D6DA 1DWGM 3VUPA 4JKMA 4NZFA 4UQEA 4MNLA 4C7DA 5CJ5A 1GQIA 3DDGA 3WF0A 1FOBA 1CXLA 3EBVA 1SZNA 2WBKA 3K4AA 3MV11 3W26A 1XH2A 1CGWA 5I2UA 1BVZA 1JDDA 3SCRA 5A6BD 1JXKA 4PMZA 1HT6A 4W8BA 5CPSA 4JFVA 3WNLA 1E70M 4EK7A 2WWDA 2WK2A 2IXUA 3CO4A 2QPUA 1Q6CA 4AZ5A 1QI2A 3F5JA 3KEHA 1UKOA 3POHA 4GXPA 2VNCA 4W88A 2EPKX 4JHZA 3A22A 4AYSA 1ISXA 1R7OA 1BGGA 2DDXA 4UQAA 2D0FA 3AYSA 4MAZA 4J3XA 1PIFA 4D6CA 2PF0A 2DGAA 5ABGA 4H8HA 3IJ7A 3MUY1 3OG2A 2BVTA 4AZHA 1S46A 1V02A 4GKLA 2WKLA 5A6MA 2YBUA 4W93A 1K9EA 4XZWA 3HG3A 1B2YA 4HU8A 4EE9A 3H55A 3WL1A 3CBWA 1CGYA 3EJQA 3K1DA 5BXTA 1US3A 3NCOA 1TQWA 4UOJA 1E71M 1PBGA 4WKAA 5A8NA 3SCPA 3WF2A 2ZUUA 2CKRA 3CHFA 2UY2A 2JIEA 1UHVA 2XJ7A 3PZTA 3AS2A 1UQYA 2PI6A 4PYSA 2JF7A 3CHEA 1GVYA 1P6WA 4PRWA 4LX4A 3N13A 1ZBWA 5M03A 1PZ2A 3II1A 2WBGA 3A4WA 4P7LA 3CHCA 3KZSA 1FFRA 5GNZA 4D6IA 1JF5A 1ESWA 1B3YA 3N12A 5A69A 3AMGA 1UH4A 1EQPA 4BF7A 4PTMA 3FN9A 3WH9A 4J3VA 3CUIA 4CCEA 3OLIA 3WQ8A 3BAJA 2V5DA 4H8VA 1GONA 3AHVA 4CD6A 3DC0A 1ODUA 4CU6A 3THCA 5A3HA 1PJ9A 1GORA 1O6IA 3J7HA 3EDJA 1UKSA 4U3AA 4GPNA 3FY1A 3AS1A 3AOFA 3AZSA 3GZAA 1JG9A 1ITXA 4CD4A 3WQ6A 1KFWA 1C8XA 3BAXA 1W3HA 4JAWA 4GO9A 5HXMA 5JBDA 3GBDA 2EJ1A 2W91A 2XG9A 4U2YA 2WB5A 1WB0A 5A6SA 1FFQA 2J75A 3FAXA 2WZHA 5AYBA 2G8ZA 1ZBVA 4HA3A 1B1YA 2F1AA 3D52A 2QPSA 2XWDA 4CVUA 5I23A 4PMUA 4AWEA 2J62A 1JAKA 3UR7A 5FIPA 3WY3A 5IDIA 1R34A 3O9NA 4JL1A 4N42A 4OBRA 2BV9A 2HVMA 4AZ7A 2DT1A 4J3TA 2XVLA 1HWWA 3DX4A 1ISZA 1QNSA 4Q7NA 1AQHA 2OYLA 5EBAA 1E6NA 1CIUA 2VRJA 4UQCA 2YL6A 2WVVA 4J7RA 3L4XA 4JFSA 1KB3A 1DP0A 3BXWA 4M82A 2VURA 4DO6A 3OB8A 2DIJA 1E0XA 4UFKA 2YOCA 4ZFMA 3WBEA 3WUBA 1LQ0A 2D0GA 3AXXA 3MUZ1 1L8NA 1TVPA 1B31A 4K68A 3AFBA 4V28A 1CDGA 4UOZA 3QGVA 4MDPA 4AD0A 4ACZB 1E6XM 2WHMA 2CERA 1CEOA 5M3WA 1EO5A 4F9JA 2DSZA 2WZEA 4W89A 1GNXA 2AOSA 3GH5A 2BY0A 3BCFA 1GVIA 3M6DA 3VINA 4W5UA 1V02E 3A4XA 1EQCA 3B8SA 1JAEA 2O9PA 4YPJA 2FHBA 3VSUA 3EDEA 4LPCA 3N1AA 2EPLX 4JZ5A 1I75A 3DX0A 4QLKA 1BF2A 3QHOA 2GJXA 2XM2A 5DMYA 5IHRA 5BCAA 5D9MA 3CZSA 1B30A 1BSIA 1WE5A 4JCLA 1J18A 2WCAA 2FGLA 4B16A 1LL6A 4U33A 3BLBA 1GQKA 4P7OA 1SMAA 4JFTA 4NRSA 4X0VA 3WQ4A 3MANA 1PEZA 4TOQA 4DM1A 4ZEPA 2ZXBA 1G9HA 4ATWA 5JBFA 1NP2A 2ZE0A 1QWNA 3KWXA 3WNKA 1XRVA 4KMQA 2ZWZA 1H49A 4DO4A 1NH6A 2X1IA 2GDVA 3LX9A 2XSAA 1TVNA 5GQBA 3FXYA 1J12A 2W5FA 2W92A 2XIBA 1G5AA 1I1WA 2YL8A 3BUDA 1MW0A 2FYVA 1J0ZA 3DX3A 5D9PA 3RIKA 2EPMX 3S5YA 3KL5A 3KLKA 1BFNA 3VNYA 4AZCB 5CQ1A 3AIWA 3FHQA 3BAWA 1CBGA 4FNUA 3NSXA 3UG3A 4B3LA 4W84A 1KWKA 2BXZA 2WCSA 3N17A 1E6SM 3FHAA 2ZX7A 3S6TA 1UA7A 3ECQA 4W85A 1ZL1A 1CLXA 4D1IA 4CN4A 4JIEA 2YBTA 2OW7A 1CGVA 3ZO9A 4W86A 3LPPA 4NZJA 4P8WA 4ZE4A 3VOCA 3EJRA 1MXGA 1CPUA 1GOQA 1VF8A 1WDQA 1UR0A 2RGMA 3W6LA 3GYCA 3OGVA 4E8CA 1EDGA 2MANA 3SEPA 2WZIA 2WYSA 1FA2A 2CXGA 2OYKA 1V0KA 3VX1A 2O9OA 4C7GA 4Z2HA 3WDRA 1UKPA 3CZKA 3PTQA 2RGLA 4JHOA 1QX1A 4HZ8A 1C3FA 4QAWA 1V6XA 4ATLA 1UWQA 1U33A 3EDFA 2D2OA 5A1AA 2FE0A 3O6AA 2VX6A 1B3WA 1W1PA 3M46A 3WUGA 3L4UA 1ISYA 2WHJA 4XZBA 3ARZA 2DIEA 1VB9A 1BYBA 1TZ7A 3CV5A 1V6UA 1E73M 4XX6A 3QR3A 5E0FA 1LF1A 3M07A 3WH6A 1E5JA 2PC8A 3E1F1 4IUGA 1VFUA 4WKHA 2PBOA 1M53A 2CBVA 4KWUA 2J7GA 1D7FA 2J8GA 2XWEA 1RH9A 2NW0A 1W3KA 3DYPA 1TA3B 1BPLB 5D8ZA 4JFWA 2VZOA 2CPUA 3L2LA 3OZPA 5A6LA 4UFIA 3T2OA 3VGEA 1EIBA 3MS8A 2G4FA 4YHGA 5IHSA 1OD0A 3WD4A 2EEXA 3T0DA 4PMOA 4BQ3A 4FNTA 2XIIA 2VCAA 4J3UA 4WJXA 3HG4A 2DSUA 5FCZA 4TVCA 1W32A 3GBEA 2V3DA 5I24A 3RILA 2PWEA 1UZ4A 1H09A 1JI2A 5IXEA 5DFAA 2BHYA 2VVSA 4M29A 2F7RA 2JFEX 3UERA 3VMNA 3BUQA 3WDQA 3EMQA 2DSKA 1UWRA 2E4TA 4LXFA 3GNRA 4LQ1A 1XD0A 1JNEA 1HP5A 1H3GA 2JIWA 2X8RA 1HKKA 3MU7A 3PZQA 1VRXA 1W1YA 3BLPX 3TP4A 2ALWA 4FNQA 5E9AA 1E4IA 2J7FA 5AC4A 2JF6A 4IISA 4Q22A 2XVPA 2GK1B 3SUVA 1UH2A 3NDYA 4CGTA 1QPKA 2J25A 1J0KA 1V0NA 1IV8A 1BTCA 4OZOA 3A4AA 1E56A 3PZUA 1NWUA 3EMZA 3EJSA 1BQCA 3U7VA 1K6AA 1HTYA 1NOFA 2J74A 5A6BA 2J7HA 1EGZA 3VGDA 4FLRA 5IFPA 1E4NA 3ARSA 4QCEA 4CVWA 4J27A 2ZICA 4M81A 3VDHA 1WPCA 1WNOA 3K4DA 2UY4A 3WH7A 2VR4A 2QV4A 3ZR5A 3CTTA 4UQDA 3W0KA 1SYTA 3OLDA 2A3HA 2EXOA 2ZUTA 1OBAA 2VVNA 2O9RA 2CNCA 3AROA 4BQ2A 2WHKA 4CCDA 2AMGA 4AD5A 4Z2GA 1WAWA 3ARTA 4XUYA 4ACYA 1HIZA 1W2PA 5BWFA 1JD9A 1BGAA 1WDRA 3CMGA 1HJWA 1B9ZA 3LXBA 3ZT5A 3VKKA 4M1RA 3U5UA 4J3WA 3UETA 1C7SA 4JKKA 3SCNA 3ZOAA 4PMQA 4DUVA 4WF7A 2V3GA 1A47A 3LXAA 5A6AA 3G6MA 1ZJAA 3APGA 2YL9A 1HJSA 1O7AA 2XVGA 1QNPA 2ZX5A 5E09A 4KRTA 1TR1A 2DPEA 5C8BB 4DUXA 1CECA 4P8UA 3RCNA 4FNRA 3GH7A 1CNVA 5KZ6A 1MFUA 4HMEA 5HPCA 2GUYA 1WZLA 1VJZA 1W9XA 2F8QA 3CUHA 4IM4A 2EADA 4CN1A 1QI4A 2J4GA 3SUTA 2XFFA 4Z2KA 3WF1A 4KH2A 1H41A 4P7QA 3CGTA 2E9BA 3UESA 3HMCA 3K46A 4AISA 1GPFA 1XHGA 5AC5A 2BY2A 2VRKA 3VM7A 3VIPA 1UD3A 4JCMA 4CD7A 4UFHA 3ARRA 4NSBA 2X09A 1WZAA 2QMKA 1XYFA 2EBNA 2VL4A 2W63A 1AQ0A 3AHYA 2Y24A 2F1BA 1WKYA 2XN2A 2XHYA 3EJUA 1T0OA 3AYRA 3W29A 3D50A 1MW3A 4OIFA 1NWSA 4OKDA 4NX0A 2BVDA 2W67A 1QI3A 1PX3A 1SMDA 1IZJA 2ZUNA 1G94A 3PZ9A 2J7CA 1GQJA 1QHZA 4NF7A 3CLWA 1G1YA 1OGBA 1E15A 4MB1A 1J9YA 3WD2A 1CXHA 3VD5A 1TQTA 4FMVA 1GHRA 1E0WA 2WMGA 2E0PA 3AIRA 1KGWA 2WWCA 4EAMA 2VX7A 4TXEA 4F66A 1YQ2A 4GZJA 7CGTA 3MV01 5TD4A 1CGTA 1JYWA 4PMXA 1W9UA 2GFTA 2BXYA 5BROA 3VX0A 4WLCA 3VILA 2CETA 1J0HA 2OSWA 2CESA 1WP6A 1FP8A 4QP0A 3KLLA 4ZENA 5DF0A 1XSIA 3OIHA 1OCQA 4PTXA 1I1XA 3PZVA 1TQVA 2DSVA 2VCCA 1JL8A 3DDFA 4MJ2A 2Z1SA 4AZIA 1HX0A 4DWSB 1ITCA 4TX6A 1UD8A 1W3LA 3CZGA 1EOKA 1HJVA 3AMDA 1EH9A 1TMQA 4AW7A 1Q6FA 4U2ZA 3GXIA 3VIOA 3VIJA 3AIQA 4HOXA 2WANA 1DTUA 1H4PA 1CTNA 2J7EA 2BVYA 2BHZA 3EJPA 5E1QA 4U3CA 2Z1KA 4TVUA 4A4AA 3FAWA 3GH4A 1DWJM 1XSKA 3H54A 2WLYA 4D6GA 3ZT6A 2F7QA 1HVQA 1V6WA 1RP9A 2G3MA 1HP4A 1SFSA 2ZXAA 1G0CA 1QHPA 2IGTA 1QI0A 4PMDA 4AZBA 1KXVA 1E1FA 4UZUA 4FNSA 4L4OA 4ZXOA 1Q6GA 1CZ1A 3RM4A 1C92A 3GXTA 2WSPA 2XN1A 1H5VA 3D4ZA 3WH8A 1B90A 1C7TA 2VQUA 2X2JA 2A3BA 1OWQA 3ZJ6A 1HXJA 4J3SA 3VIKA 4LYPA 2A3AA 1VBRA 4PN2A 3L4YA 1EO7A 1QW8A 2YKKA 2V38A 2CBJA 2BFGA 1E3ZA 1PIGA 4MAVA 1IT0A 3IANA 1CXFA 2VZTA 1ZB5A 2PWHA 5CG0A 2D20A 4UFJA 3WF3A 1DWFM 1NWTA 2CBIA 2CHOA 3WNMA 1E1EA 1Q6DA 1HL9A 3ZJ8A 3LRKA 1R8LA 4M56A 3KL0A 2XVNA 1JXJA 1HVXA 4R5EA 3NYDA 3AJ7A 1O7DC 1TA3A 5I5RA 2WVVB 8A3HA 2ZX9A 1V03A 3W81A 1OM0A 3WEZA 1XGZA 1TUXA 4EKJA 4PSPA 2JE8A 4W8LA 2EAEA 3HJEA 1H11A 3D5HA 3L2MA 1BLIA 3VGHA 3WQVA 2BS9A 3CHDA 3VD3A 1QWUA 1QOXA 2CKSA 5ECUA 1FH8A 3VD4A 3DX2A 3WDIA 4UTFA 2WM0A 2DQXA 2D0HA 2JALA 3TTQA 1CYGA 3N11A 2X2HA 2WXDM 1AVAA 3IGUA 3KL3A 9CGTA 4PMRA 3K8KA 2YA2A 2CITA 4NRRA 3A23A 5D8WA 3GM8A 1V3HA 3MMUA 3WIJA 5BXPA 2E8ZA 3VIFA 2AAAA 4FF5A 1F4AA 4HOZA 3A5VA 1C8YA 2WNWA 3BAIA 5BRQA 1VBUA 2WW5A 2G3NA 1CWYA 3CPUA 2XM1A 3PN8A 3TTSA 1E6PA 4P7NA 1FH7A 3WFLA 2VR5A 5AYIA 4F9DA 5DT5A 3DX1A 5HPOA 4PMYA 2DH2A 1MXDA 1HKJA 5E6YA 4AMWA 5HBFA 1JD7A 1WZKA 4HA4A 5A6JA 2GJRA 3AMKA 2WCGA 1LL7A 2WC3A 3DYMA 1UZ1A 4MB4A 1B3ZA 4A3HA 2YIHA 4MPKA 6TAAA 3NDZA 4AIEA 4E2OA 1OSEA 4KGLA 1FHLA 3K8MA 5D9NA 4PSRA 3WD3A 4HP5A 3HZ3A 1ISWA 4UOQA 5A8QA 4AD4A 2VRQA 4UR9A 3ZMRA 1V0MA 1D2KA 2F61A 1VFFA 2GJPA 8CGTA 5JBEA 1JI1A 4A3YA 2EQDA 2YDSA 1AMYA 1JNDA 3SUWA 5BRPA 3CH9A 3VD9A 2QMJA 3T0AA 1MYRA 3LPGA 1UR8A 2NT1A 1BVNP 2OW6A 2ZX8A 3VSTA 2WMJA 5E0CA 1V3MA 4UZSA 1OGGA 4Z2IA 2XN0A 3CUFA 4AEFA 4HMDA 1R33A 3VMPA 2NT0A 2WMIB 4RE3A 2X2IA 3A6OA 2E8YA 3ARQA 1B0IA 3AICA 1E6RA 3OGSA 2QLYA 4OOZA 1LL4A 2E9MA 3WY2A 2FH8A 5HOSA 1FHDA 4GI6A 4GZIA 4H7VA 1V6VA 1JFHA 4CU8A 3KE0A 3OGRA 1PZ3A 3EMCA 2W66A 3WN6A 1PX4A 1XCXA 2ZUWA 4PUDA 5CLWA 2X0YA 1CXEA 1D3CA 1E43A 2V3FA 1KBBA 1N82A 3ARWA 1VEPA 3ALFA 4AD3A 1UQZA 3N15A 4JKLA 3WFZA 3DYOA 2Q8XA 1BAGA 4GINA 1E6QM 5E6ZA 3ZQ9A 2J47A 1VEMA 1RD6A 2ZUSA 3L4TA 4MNJA 1JZ5A 4GI9A 4DWSA 2E9LA 1E9LA 3VO0A 4HTYA 1H2JA 4D71A 3CZJA 4QFUA 1TQUA 3WD1A 5IFTA 4WSKA 2YJQA 3MUAA 4C7FA 5EB8A 3AISA 5ABHA 3RM9A 4AD1A 1XCWA 2UY5A 5DT7A 3SCTA 4H41A 2DEPA 4URIA 3BUBA 3ZT7A 2ZIDA 1GUVA 5E70A 1NOWA 2ZUMA 5HNNA 2X0HA 3GTNA 3VDCA 2F18A 3MMWA 3TTYA 3B9AA 1HXKA 1WZMA 5M17A 1FP9A 4WIWA 5A2BA 2ZXDA 3SCOA 3DHUA 3LPOA 3PBGA 2Y2WA 4BS0A 4MTVA 3GXFA 2EPNA 1E40A 3WY4A 4AMXA 1HJXA 1YHTA 1TQSA 5CGMA 1QBBA 1Y7VA 1KBKA 2VO5A 1V6YA 3JUGA 2F7OA 3AMLA 5I77A 1E4MM 1PS3A 1J01A 3QOMA 1C8QA 4AZCA 5A6KA 5DEZA 3GDBA 1R7AA 3EDDA 3CUGA 4PCSA 3BH4A 2G3JA 2D23A 1J0YA 1E4LA 1UWIA 1JZ3A 4OGZA 2DH3A 1CXIA 4LGXA 2D1ZA 4NXSA 2XVKA 3LRMA 4NZCA 1KXQA 1HJQA 1OT1A 4CD8A 1B3XA 1E55A 3CMJA 1GZJA 5I3DA 1NWRA 2UWFA 3MUIA 3VMOA 4GZEA 1JDAA 3I3EA 1V3KA 1UR2A 1KQYA 2WVTA 4W5ZA 1W9PA 4GQRA 2C0HA 4RE4A 3WDPP 3RM8A 4Z2JA 4ZXLA 3IAPA 3SCWA 3IAQA 2NSXA 2X05A 2BHUA 3HU7A 1E3XA 1DWHM 4Z2LA 2J77A 1TCMA 1BYDA 4KRUA 1LWHA 4UCFA 2B31A 3AS0A 2VZUA 4YN5A 1KXHA 1SR0A 3WDHA 4CUCA 1UD6A 1XH1A 3PZNA 5I78A 1XH0A 1K9TA 1UD2A 1QNRA 3T09A 3POCA 4B15A 3AZRA 3A3HA 1A3HA 1JZ2A 2DT3A 2BNJA 1ODZA 1R85A 3F5LA 1JZ8A 2ESCA 1DWIM 1WDSA 2VCBA 2OSXA 2V3EA 4MADA 3SURA 1NARA 3TA9A 3SUUA 4M8UA 1WDPA 2W61A 4GO8A 4ACZA 4AXNA 3PZIA 1GW1A 1QI5A 4KGJA 2C7FA 4D6JA 1V3JA 2WPGA 1UKTA 5GNYA 3AIUA 2FDMA 2CBUA 3UG4A 1TG7A 4P8XA 1K9FA 1VAHA 1UD5A 3LPFA 1E6ZA 3NSMA 4F8XA 1V3LA 5I79A 1W9BM 1JDCA 5FOOA 5A8MA 1W1TA 3ZSTA 5JIPA 4CU7A 2WVUA 3ZR6A 4TTUA 4GQQA 1H0IA 5BXRA 3AHXA 3VDBA 3ZJ7A 1Q6EA 2OWXA 1VFMA 4X0NA 1NOUA 1BHGA 3WMCA 4W7WA 5LA2A 4LYRA 4DUWA 3ZSSA 1QHOA 1EHAA 1HNYA 2VX5A 3VD7A 3WSUA 4CCCA 1NM9A 3HN3A 1BG9A 4FLSA 5A2AA 1KR1A 3BMVA 3S5ZA 1ZJBA 4H8UA 1WO2A 4UQ9A 1GCYA 2GK1A 3NUKA 1ECEA 2CCRA 3VM5A 3ARVA 4AD2A 3OLEA 3A47A 2VX4A 3ARXA 3RPMA 2DSWA 2WC7A 2V5CA 2D3NA 4HMCA 3MSDA 3QHNA 3B9DA 4QDMA 2YA1A 4FK9A 4HPGA 4DO5A 3BVWA 5M5DA 1MQPA 2WKGA 3WNPA 4XB3A 3SUSA 3ALGA 1UWUA 1DEDA 1R46A 4OOUA 3WUFA 4D6HA 4BZYA 3AZTA 4V2XA 3GXDA 1HF6A 4E8DA 5EFDA 3QOKA 2E3ZA 3GXPA 1R47A 4AMCA 1KR0A 4D1JA 3HG5A 2DT0A 1HL8A 2IXVA 4X9YA 4DWSD 3GNPA 2Y4SA 2WSKA 5JIWA 3PTKA 1PPIA 2W4XA 3W28A 1LG2A 3G6LA 2E40A 4DWSC 2PWDA 3T0BA 3BSHA 2YDRA 3CZLA 2O92A 4HPHA 4B9ZA 4MNMA 3OLGA 4NXKA 3W6MA 4XV0A 3VIMA 3WEMA 4PTWA 1CENA 1BG4A 4UFLA 1KWGA 3PTMA 1DHKA 3AIVA 1C90A 3WBAA 4D6EA 5LA0A 4BA0A 1UR1A 4BCEA 2EO7A 1XV8A 1OD8A 1VENA 3PZMA 2OYMA 3GXNA 3M7SA 1UUQA 3L4ZA 3AXIA 1E72M 3SCVA 3BAYA 3VIGA 3WNOA 1M03A 2VZVA 3A24A 3MI6A 1EXPA 2C8NA 2WMHA 1JGIA 2BY3A 1CGXA 3WUEA 2YLLA 4YHEA 2GSJA 4L4PA 3CUJA 5A8OA 1UYQA 3BVVA 2OSYA 3H53A 4AZ6A 1MFVA 3VVGA 3W82A 4FLOA 2VTFA 2CYGA 3AI0A 3W4RA 4NI3A 3AS3A 3OBAA 1VIWA 3BVTA 2EPOA 4PMNA 4CN6A 2Y5EA 4JL2A 5CGTA 3CZEA 2GVYA 3WQ5A 2FHFA 3VTRA 1EDTA 2GJXB 1FH9A 1X1NA 1KTCA 4R27A 2J7DA 2XSBA 4WK9A 4ATDA 3BC9A 2JEPA 1GJUA 1F4HA 4TX8A 3CC1A 3UR8A 3WL0A 1L0PA 5D9OA 3L4WA 3EJTA 1GHSA 4PUEA 3ZM8A 1B3VA 2XYLA 2D22A 2UY3A 2DT2A 4U5KA 4PBGA 2VT0A 2CIPA 3MKKA 1OIMA 5A8PA 4N0RA 3RJXA 3N04A 1KGXA 1J0JA 3AQUA 4E4PA 1X6NA 4MJ4A 1JZ6A 3A21A 3EYPA 4OBSA 2FH6A 3CZNA 3K8LA 4QLLA 4V27A 2FGZA 4UFMA 1GOMA 4MB3A 2OWWA 1MW1A 3VDAA 5ABEA 4J28A 1MQRA 3WDJA 2D24A 4HZ6A 4PEEA 4HZ7A 1UR9A 4UQBA 3W37A 2WMIA 5CPQA 2GDUA 2XTKA 4W8AA 3VGFA 3TV8A 2XFRA 4GI8A 1M04A 1U2YA 4W7UA 5AY7A 3GNOA 2VUYA 4EANA 4S3JA 3BGAA 1NP0A 1UG6A 4PCTA 1EA9C 2J8FA 1HN1A 2VZSA 3UCQA 3PZOA 5FL1A 2YA0A 5KEZA 1W91A 3AXHA 1UA3A 2YLAA 1K9DA 2VJXA 5BXSA 1JFXA 4D72A 7TAAA 3I3BA 3U5YA 4AIOA 4U5IA 3BVXA 5EFFA 3SIMA 3N18A 5EMYA 5I6SA 1V0LA 2OLHA 3WKZA 1QBAA 1Q4NX 1JZ4A 3QHMA 3OZOA 1OIFA 4IPLA 4PMVA 1QW9A 1ZS2A 1W9DM 2D3LA 2XGBA 1MQQA 2CHNA 1UD4A 2VI0A 3BLKA 2PBGA 1V08A 3N9KA 2J7BA 1NQ6A 1CLVA 3IJ9A 5LA1A 1KXTA 1HKIA 1US2A 2D73A 1BYAA 1JYVA 4RE2A 1HJUA 3ZJKA 3RMEA 1H0GA 3VSVA 5ABFB 1DWAM 4F79A 1MVYA 3U57A 1U30A 1H1NA 1JYXA 1W2VA 5CPTA 4B9YA 1OT2A 5FKYA 3U7BA 5LYRA 3CIVA 2PB1A 2A3EA 3ARUA 3DHPA 4ZE5A 1RP8A 1LJYA 4HU0A 1UASA 1KGUA 5A2CA 1ISVA 2WC4A 3MO4A 3UG5A 2YL5A 3WF4A 4IPNB 2BY1A 4DM2A 3GXMA 3TOPA 3WQWA 3W53A 1R75A 3I3DA 3O2LA 7A3HA 2Y8VA 1CXKA 2IUZA 1IZKA 2ZX6A 1UH3A 2PWFA 3VU2A 3TONA 1C93A 2HISA 3NSNA 3WEOA 4H04A 1TE1A 2VMFA 4AYGA 4Y7EA 3WMBA 1UR4A 5HDRA 3PZGA 3VGGA 1W1VA 1CGUA 3UEQA 1UWSA 3HG2A 1ZBKA 1VJSA 5CSYA 3WH5A 4CKQA 6A3HA 3F5KA 3FW6A 3AHZA 2G3IA 1JIBA 5CZKA 1VEOA 5CSUA 4OUEA 4WSJA 3L4VA 2FHCA 1EOMA 4D6FA 1OB0A 2JEQA 2G41A 4UNIA 1GOIA 1LLOA 5FL0A 1R86A 1GOOA 1EDQA 4MDOA 3WENA 2VC9A 1WCGA 4QCFA 3NJ3A 1M7XA 4B3KA 2WAGA 5A95A 3BMWA 1UOKA 2X2YA 5GPRA 3RO8A 4HOWA 3W38A 3S2CA 2A3CA 3T2QA 1JF6A 5D4YA 3LXCA 2XUCA 3W25A 1TFVA 3AIBA 3D3AA 1BYCA 3LMYA 1JZ7A 5C71A 2TAAA 3CZ8A 3D51A 5C70A 2WVSA 4AC1X 1GJWA 1X6LA 3RDKA 4AZGA 1J10A 4PTVA 1Z32X 2ZXQA 4TVDA 3NIYA 4S3KA 3F4VA 4AIUA 4M24A 2WMKA 3ZIZA 3VNZA 2ZOXA 3IK2A 1W3JA 2VQTA 3W24A 1XSJA 3BVUA 5FD0A 3VIIA 4U31A 1PX8A 3SCSA 3W27A 1G01A 2EACA 1AQMA 3BAKA 2F2HA 1MWOA 3WY1A 1PAMA 5DO8A 4RL3A 1XC6A 4H2CA 3PHAA 4OJYA 1QNQA 3BCDA 2J78A 2QHAA 3WD0A 2YDQA 3T2PA 4LYQA 2XGIA 2XFYA 3AMCA 1J0IA 4HA1A 4P7RA 5A94A 4W87A 1E0VA 3RJYA 4FNPA 4ML4A 4M80A 1LG1A 1QNOA 3DECA 4WKFA 1ZBCA 3D4YA 4BQ4A
chains in the Genus database with same CATH superfamily
5ECGA 1M68A 3DG6A 2YSTA 3T3PE 3VUSA 4XG1A 4A6YA 5EOTB 4HKZB 2WBJA 3V0JA 1ILUA 2DYPA 1E5NA 2W62A 2K4AA 3D69B 4LSQH 3QSTA 1U8HA 4WW2C 3DWTA 4PY7A 5EBMB 2ZUVA 3BZDA 2OWCA 3TTOA 1KCKA 3MMDA 5CEWA 1QVOB 4BE5A 5E5RB 1S2WA 5F2MA 2YFOA 3AQZA 5AOIA 3U2OA 5AZ0A 2BOLA 2B4CC 4GSRA 3JYBA 1PZDA 4GMSH 4AENB 5IHUH 5E8EA 5HY9B 2EUWA 5AOZA 5BYWA 1OAXH 3GUTB 1DQJA 1U92A 3BIBX 3QUMB 2OQJA 1J11A 4M6AA 1C8VA 1VBHA 2UXTA 2QTVA 1OHLA 1NBQA 1CT5A 4UTMA 2A38A 2UV3A 5INCB 1C91A 2EABA 3SCUA 2O9TA 4F2TA 4EQ2A 1D5MB 2WLZA 4LRIC 5IW1B 3I9PA 3UGRA 3WELA 4MY1A 1DQLH 1MW2A 2YR1A 3WIHH 1GOWA 2DZSA 2ZUXA 4FQQA 5IV2A 3FNDA 1SY6H 2DIKA 1HHHA 2X4NB 1J8RA 3DO3A 3MSGA 2ZWLT 4JO1L 4GSDL 4GRMA 4E2BA 3IGKA 3AFLA 3ZE2F 3H7UA 3TO4B 5C7VA 1I9RL 4YSUA 2H1LM 1I8KA 2F5AH 1MI5B 3P61A 3KXFB 1KM6A 4LF2A 5CKAA 4LUSB 1IC1A 2D7MA 3O3AB 2ZCKH 3U6WA 3TO4C 5C55A 4MXQC 3BI9X 1VFOA 3ROOA 3GS0A 5DLLA 5E9DB 3A4FA 3KJ6H 3B9KB 5D8JL 3VFSB 1PU0A 1QVBA 1A6ZB 1KTBA 2JI3A 4Z3HA 4YS4A 1UWTA 5D6DC 2Q3RA 5C2BH 2NNXA 3P9WB 1A6TB 4ILDA 1OY3B 3G8EA 3MP3A 4WJ5B 5HMDA 3HC0B 3BUIA 1QFOA 2ISFA 5BUGA 1EFXD 4A6GA 2M2DA 4X6EA 4IBQA 5E8NB 4OKVA 4L8BB 1ZU8A 1AW5A 4ZNCD 1RVGA 3AIEA 1HKFA 4MLIA 3G1VA 1S7RB 5AZ1A 3W87A 4RCAA 2EE2A 2X10A 2ZWYA 4YO0B 1G6RL 2YB4A 5FW8A 1TZHB 3X12A 1AD0B 4N6QA 1AXTH 4PJFB 3VGBA 3ARYA 1UZ8B 1M01A 4B9JA 3FEQA 1DQUA 3VKCA 2FTWA 3DGGB 1O9WA 3ARGB 4L9LA 4P5MA 3MA7B 4OCNC 4TUOB 1I8IA 2BX5A 3JVGC 3QDGB 4JRXD 4IQEA 1UIPA 1GAFH 1A3LH 1V93A 1XG3A 3TVAA 1N0LA 5CJ5A 4IRJC 3H7BA 3WF0A 5CSBA 1GSMA 1NFDB 1YNKH 1CXLA 3JWDC 1NGZA 5TE7L 2FX9L 3FQXB 4LNRB 3NGFA 4HUMB 5G5IA 5BUPA 1F58L 2V81A 2Q0ZX 3PWPD 3QIUD 1TJHL 1X9RA 3MV11 3PG2A 4TLSA 1R9FA 1BXBA 4N25A 5E56A 1Y5VA 3TC7A 4FJYA 3BQUB 5J1TC 3QZOA 1CCZA 1N4XH 4EK7A 4X6CF 4C57C 3S36X 2NLJA 5CGBA 3H70A 3L3OA 3BISA 4YLWA 1P1XA 2OK0L 2XZCL 2G37A 3T0TA 4OGYL 3F7PC 4AZ5A 3F5JA 3KEHA 1CDBA 2A6JA 2FL5B 4Y1SA 4AUYA 5IHWA 3WTWA 2WSRA 1I7UB 4LNVA 5HGBB 3FSVA 3POHA 5TE7H 2PURA 4GXPA 1GG0A 1GPOL 2EPKX 3H4FA 4AMAA 4KRLB 1M4KA 2IWKA 3A22A 3LMJL 1JRCA 5GGVH 1TKWA 4QDPA 4XAFA 5D04C 5B80A 3GRIA 4HWEH 3QZWG 3CWNA 4IM8A 4MAUL 4BQ8A 2CIIB 4GRWB 3KXFA 1ICPA 4E9VA 2D0FA 2JK5B 2XH4A 5I3JA 1T89A 1WA0X 1YEHL 2EC9U 3D0VA 2MNRA 3FQNA 5HMSA 1O6TA 5E1GA 4DT2A 3ML9A 3BSZA 3CBKB 1KJMA 2OLDA 1SFJA 1UJPA 2R15A 2DGAA 3C2AH 5JOFA 2KHAA 1JP5A 4L0ZA 3MUY1 3QDJE 4NZRH 2A5UA 3G6JB 4AZHA 2JCWA 4JFYA 5IKCA 4BV1A 2CLRA 4K9EL 3T6VA 1RURL 2NV2A 2WKLA 3MRKB 5TBOA 3E2RA 3MV8B 5MHBA 4LE8A 4WY0F 1PCKA 1EEYA 1GPWA 3PDGA 1HXYA 4MJ5A 5I1KH 5JHDB 4EE9A 3QNZB 5C0BB 1S4IA 5JNYB 3RL1A 1L6GA 3QUZB 4Y1AD 3SDAB 1ZTMA 3QCTL 1YNQA 3S4SG 4H9ZA 4Q9RL 3D33A 1TQWA 1GPOH 3QO1A 4UOJA 5EEZA 5GGTL 4X8CA 4RGMB 5DT1H 5FM4A 4M3JA 4XVUC 4PRHE 3QFWA 4NN6B 3NEEA 4XMZA 3CSYA 3QJZA 3BPNB 2YBVA 4O8AA 3EYSL 5A8NA 4DJDA 2F74B 4RGNC 1O60A 3JVAA 3R1ZA 4OGAD 3WF2A 1CN4A 4M48H 4S2BA 4G6JH 4HH9B 3ORWA 2XJ7A 3S34L 4JO4H 5E5MB 3S46A 5EZLA 2MUCA 1FDJA 3SE3A 2JF7A 1GVYA 1Q6QA 3PP3K 3PXHA 3BD4A 1ORSB 4PV8B 3GK8L 4YGVA 4F8NA 4LX4A 3H8NA 4MJHA 3HB3D 4P2OC 4NQDB 3EXTA 3QIBB 4ZUVA 2WBGA 3UL4A 3A4WA 4NPJA 3BGGA 4H2HA 4DELA 1F97A 1FFRA 3SRHA 1JF5A 2GSGA 1OSZB 5HHQA 1VZIA 3N0PB 3U7AA 5A69A 1UH4A 2B39A 3INPA 4I0KA 4AV4A 4PTMA 3MLZH 3HFML 4J12A 1EVUA 4Q3MA 1KPUB 4PBXA 5D2TA 4PW4A 2PO6B 3OB0H 4LCWE 1I6NA 5SWUA 3WG6A 2WZPA 4F92B 1AQDA 2PDYA 5MHSD 1TVHB 4DYKA 2V5DA 1KT2A 3RY5A 4XVTH 3WFCL 3JWOL 2ZF8A 1WAEA 2XKNA 3DC0A 4CU6A 3VU1A 1FZMB 1YAIA 2WP3T 3F7YB 3OJVC 4LVOC 3S5LA 2W8CA 5BOJA 5ETUB 3R0DA 5D1QA 3I68A 4E41B 3DBXA 4ELKA 1DXIA 4TR9A 1JNNL 4TVPL 4ZFZB 5FB8A 1VACB 4RXFA 1L5GB 1MWAH 4S1SL 3SGJA 4JR9H 5IW6A 2WLLB 4L4VB 1IEAB 3AS1A 4D3CL 1N8ZB 4UNVA 2YQ3A 1M05B 3SO3C 4JFDD 3PAUA 3QDHA 4PJHF 4Q7BA 2FNBA 3BHBB 1EZ2A 3OP2A 2ICEB 3L0GA 1A5NC 2ZFAA 1L9MA 3ME3A 3RLHA 4I3RH 4ICCX 4X9GA 1Q13A 1W3HA 1XLFA 2FJSA 4HETA 3MFFB 1G69A 4ZR8A 1KBWA 4Y5VB 5LDUA 4TSCH 3BO9A 4NOFA 1KTDB 2W91A 2YXVA 3Q44A 1ZD6A 1XKJA 2FD6H 5C54A 3RE0A 3S4SA 3NQFA 3UWUA 3II3A 4KMTL 1HZHH 5AG8A 1WB0A 3TLQA 3CIAA 2E5CA 1D6VL 2PC4A 3L45A 4KCTA 2J75A 5E2UL 3CLEL 3I2CL 1MMFA 1TV8A 1ZVHA 3TEWA 2NY5H 1LDPH 1TYRA 5CBAA 3MXWH 4MWFB 1VR6A 1AHKA 3NPSB 4DGYH 3C3UA 4BQBA 1JZJA 4L1WA 4TVPH 5DHVB 4PMUA 3CFKA 4G42B 1M6OA 5FIPA 2JQZA 3PAVA 3BIKA 1EZVX 1WT5C 3FT2B 5HGAB 5CF3A 3WY3A 1QR1B 4I9JA 3UJRA 5HD8D 5IDIA 4G6KL 1AXSB 1NQBA 1R34A 4N2KA 4EIVA 5A2LH 2N7AA 1KLGA 4ZW3A 4Z7WB 4AGNA 1J5CA 5EU5A 1BYPA 5DHXB 2GAZA 4OF8A 1BZDA 1S5IL 5FYLH 5FPIA 2XVLA 2QUVA 4WDIA 1GZPB 3IYLW 2GJNA 2P45B 3DENA 3V1HA 4RV8A 2XA3A 4HQQH 3VWKB 5IMMB 1X1OA 1IEBB 4O4YL 3MGTB 4PGDA 4WO0A 4GJ1A 3ZIMA 3UJEA 5KVGE 3IMTA 2B16A 2CPCA 1MCOH 4NNXB 3R43A 4K7PL 1EJUC 3BX7C 3ZDZB 3QQWA 3TZVB 3SSJA 1GIGH 1G7JA 2H3XC 2XRAL 4HKXA 4GEJA 4AEIH 3QQXA 2F54A 5B1CA 1E6NA 2YL6A 2YW4A 3G22A 3DSNA 1U8HB 5EBMA 3N1FC 4JFSA 2R7EA 4KXAA 1DP0A 3WCYA 3RFZA 2E7CA 4MMXB 3NNTA 4MCMA 1E9OA 1E5UI 4JVPA 4DF0A 1QSFA 4XNDA 2HRLA 1NGQH 2D0GA 2XIMA 4CADA 4GUGA 4WXYA 2DKSA 1IM3A 3O4OB 3AXXA 2WGXA 1L8NA 1TVPA 2AI0L 2Y1VA 4IQJA 2CZFA 3BSZH 4V28A 1Q0YH 2Q76B 4JFDE 2XTJC 3D30A 4CA4A 5JVLA 3MO1A 1HILA 3MLXH 5E2VH 4DZHA 4O1FA 3PK7A 1AXTL 4AD0A 3PGCA 1JCMP 3GFYA 1RI8A 3HPAA 4KXZI 2AV7B 1NC2D 3EB3A 1KV7A 3ABZA 4YHLL 1CEOA 2E6QA 3BICA 1BQ5A 3UTZA 2O61B 3GH5A 3CWGA 2BY0A 2K9UA 1GVIA 2APXA 1EJFA 3M6DA 4J1UA 3JV4A 4L3EA 4GK8A 4O0ZA 3QDJD 4IX0A 3EYQC 1GW6A 1HFUA 4A37A 3A4XA 2O9PA 3KP1A 4TLUA 1D5ZB 2G5UA 2FHBA 4H26B 4OLEA 4YDNA 5FWQA 1J1OL 4LPCA 4LH8A 2ADYA 4XBJA 5D9SA 3UC2A 2EPLX 3VE9A 3DERA 3IGHX 3VUAA 1I75A 2EKSA 1P4IL 2DQGH 5EU7E 5EYWA 4IMFA 3F6IA 2XM2A 5F7AA 1M05A 3TM6A 1KO0A 4X0KB 3SIKA 7PAZA 3ZMNA 4LHUA 1HZLA 4MSWA 3N19B 5IHRA 5LCVL 4Z77A 4NZTH 1GGTA 2QPEB 3LKSA 2BSTB 3DA0A 5C0GB 3QORB 5AYXA 2XFGB 4JFFD 2OAAA 4J35A 2EUXA 1GC1C 1OP9A 4NT6A 1Q6OA 2J6VA 4JFFA 4JKPL 3MAWA 4LHQB 1LL6A 4QWWC 5KZCD 3ILQC 3BLBA 4P2YA 1KT2B 1GQKA 1LTDA 4P7OA 4JFQA 3NIDE 2UZ9A 3PZQA 3WQ4A 1CIDA 4JTKA 4QT5B 1FTXA 3U3HA 4Y4HA 5T33L 4GJTB 1S9WA 2C3WA 3QRFM 1XIFA 1XYMA 3Q67A 4TOQA 4DM1A 1HINL 2DMHA 2FX7L 2YSSB 4KY2A 4JRYD 1M71A 4ATWA 3K5XA 3ZW3A 1XZWA 3LEXA 5CU9A 4N87A 5BZWA 3UXFA 1HCYA 1XB6A 4H13C 3HQPA 3WNKA 4MX7B 5DZ9A 4Q74A 2WOQA 1K4HA 4UM9D 1VBGA 2ZWZA 1NH6A 3H6AA 3OC8A 2VLJB 4UTTC 4KAQH 5SWSD 2X1IA 2CJUH 3JTTA 2IQAA 3R0UA 2GDVA 4WO4B 4A3RA 1XAKA 3EB2A 4IGBB 1TVNA 2I9TA 4YDMA 4WKXA 3L12A 3RF9A 4BWTA 3ZXWA 2QJJA 4NHUA 3NJJA 5K9QI 3DURB 4C47A 2DD8H 2TMDA 5D05A 2REQA 2XIBA 4KXBA 4AG4H 1XR9B 4OFCA 5JTWA 2LVCA 1RLDA 2IOMA 1YE4A 1A3LL 5D7SH 9PCYA 2Q71A 5XIMA 2FEEI 2R2EA 4MIMA 2Z6JA 4V2BA 1AODA 5DS8B 1J0ZA 4NZ8A 2PDQA 1OFRA 4ODXB 3DX3A 3K0YA 3MODL 5D7SL 4YHYB 3JS3A 4BZ1H 3GQFA 1HESA 2VIRB 3KLKA 3PWNB 4B5SA 4Z7QB 1BFNA 1S9KC 4F7PB 2X0VA 4GX9A 1M7UA 3S5OA 3TCSA 1S39A 5CQ1A 5ITBH 2NY2D 3FHQA 3BAWA 1B3IA 5AEAA 2E9JA 4PVNA 4IBSA 4A2HA 3UG3A 2YBGA 4JO1H 5I6LA 3AY4A 2J43A 1XLBA 1KWKA 2BXZA 1N59A 4JHAH 1OP5H 5JNYA 3BJFA 1B0GB 2YPLB 4Z7VE 1FHNA 1PTDA 1F2XK 4ZVJA 2CU9A 2JBMA 2JKIS 5E2JA 3BW9B 3D4GA 2F2KA 1Z3GH 1RHFA 3SE8L 4UTAL 5JW4M 2YPKB 4EKXA 1NF7A 3ABXA 3NQCA 3VI2A 1NMCB 5DCBA 5JHMA 4HCRA 4EDXB 2YBTA 3FTUA 2I9LA 1CGVA 3MZGB 4DXKA 4Q4KA 4L3AA 1AAJA 2E6PA 2BVOA 2Q8LA 1X5AA 4FL4C 4MJIE 1MHHB 4MJJA 5CIPH 3VOCA 1GOQA 3VD1A 2A6DA 4MGGA 5IJBC 1HHJB 4X8JB 1RY0A 3TE9A 2EEBA 3D8MA 1HK6A 4BHYA 2DPKA 4A7GF 4F8TA 1W16A 1KCZA 3UPWA 2RGMA 4WDWA 5FEWA 5AB9A 3FO1A 4G6JL 5CP3H 4QRRA 3HOGA 3OGVA 5DRXA 3FUIA 1NAL1 1W1B1 1E3FA 2PP3A 2WYSA 4U3SB 1FA2A 3EOTL 3SGKC 2VZ3A 1N67A 4MCZA 5D1ZC 5C0IB 4WRLA 2OYKA 5E6IB 1IAIM 2RTTA 3Q1SL 4FXKC 1YEDB 1R9YA 4POCA 3RA7L 1A02N 4HUUA 5F9AC 2YARA 4F2MB 3SKMB 4HU4A 2OMWA 4JRXE 2D31A 5TNVA 4RNRB 3BPWA 1SJHA 3BH8A 1XTLA 5C0CE 2AK1L 1X5LA 4AZUA 1AH3A 3PTQA 3PS7A 2RGLA 5J8OA 3M7WA 3MRCA 4FO4A 3G1XA 4AXWB 1GYNA 4APQC 1AZCA 3V0DA 2K0RA 1V6XA 3ABRA 3ZDXF 3SE8H 3BDKA 3PWUA 4N4PA 3FUFA 4CILA 4JKNA 4IUOA 1YY9C 4G8GB 1R5WB 3O4OC 4RVBA 4CDHA 4EBQL 5A1AA 1IGFH 2VC2L 3OTRA 3JVFC 4AGQA 2WZAA 4P0DA 5IG7B 2Y62A 4M6VA 3MRIB 1HEJC 2PAJA 4XSLA 1ISYA 4XC3L 4WY0B 1LE9B 1GVOA 5EL1A 4DLFA 3ARZA 2CBPA 2DIEA 4D8PB 2WSDA 3T1FA 3C8HA 4NQVB 3KPRA 1V6UA 2AW2A 1U8QB 1H9VA 5DRNB 5HGHA 3OKEB 3NZRA 3UGEA 4XX6A 3IJHB 3DX8B 1LF1A 2UYLA 3M07A 3Q8CA 5CG7A 2OMVB 3LHTA 1NIAA 1I7TB 3AG2B 3LN4B 1A5KC 3VFNA 1VFTA 2Z0BA 1VFUA 1P0BA 1W0WB 1R0MA 4HBKA 2YXMA 3NCEB 1K2DB 4K1GA 3N6JA 3W7GA 4KWUA 4N0FB 3ABKB 5EEVA 3JTTB 3VYPA 2J7GA 1RXLA 1OAKH 2XWEA 1XCQA 2WLJA 4Y4FA 3BIAX 3BEVB 2B1OA 3SE6A 1T4KA 4N5EC 3ZQXA 4CGUB 1RH9A 2RB8A 6FABH 4U1HB 3KDMB 2VSCA 1W3KA 1WD8A 3DYPA 1TA3B 1XDMA 1X5YA 2XQBL 4GRLC 5I66B 4HS6A 3LKNA 1NF0A 2BVUA 2BWGA 4K37A 2RA1A 1M7DB 7ODCA 5DEGB 4B6ZA 2VZOA 1K8CA 4NJAH 1OSZA 4UWQB 5JIIA 1F90L 3HG1B 3L1GA 4H9UA 5J5DA 2OMZB 4O10A 3II2A 2XTSA 4NUPA 3ZBMA 1KPRB 4NC1C 4QT5A 3FN3A 4Y16C 4CC1A 1P48A 3TF4A 3O3AA 4I6VA 3SADA 1QBML 4PMOA 3D6NA 4JN6A 1INQA 4FQCL 4RSYA 3RX4A 4PBDA 1QSVA 1K7EA 2VCAA 4J3UA 2WJFA 3QMSA 5DHMC 1IVLA 4D9LL 2Z1WA 3BPLC 5D2LA 3V9CA 3GIQA 1VFAA 4FABL 1GYUA 2X4NA 4LSUH 3WLTA 2V3DA 1X44A 3D1MC 5GRJH 2ZSWB 5E1AA 4JTQA 4D8PA 3O11A 2PWEA 3GS7A 1H09A 1FP5A 4M4RA 5DFAA 4DZBA 4ZX6A 4U6YA 1NANI 2RJMA 1B9BA 3GY1A 3TCLA 4RDQG 5GRJL 3UERA 4DEPB 3NO1A 3CPLA 3BUQA 3P0VH 4W4NA 2BSED 3AY2A 4NJIA 1LRQA 1KB5A 2BNQD 2OMVA 2DSKA 1A7QL 2E4TA 2H32A 3PWVB 3MY9A 3GNRA 2I9UA 5I7GA 4GUPA 4LQ1A 1IU1A 5DRNA 5DJ0A 3U0TA 2Z25A 3WN5C 4G70B 1GL4B 1NBYB 2WO3B 4QAMB 1EYWA 2K7QA 1FIGL 1SXSA 2ZWSA 5BRZE 1ET7A 4RX4D 2JIWA 1OLLA 2W88A 1V27A 5C2GA 4R26L 3MU7A 4AL8H 3JWNH 3UWWA 2VHLA 5HDBE 5C07B 4TULH 3SKJL 2G2RB 3NFNB 3AB0C 3FFDB 1BVLB 1XIBA 1QUNA 2BNRB 4Z7WA 1PW3A 2CRZA 4JFHD 4DP4X 2XCMC 1PL3A 4MA3B 1EGJL 2EDWA 3E1ZA 3NGBC 1UUMA 2CLPA 1JSYA 2NX5A 4F93B 2J7FA 2YZ8A 4W9GC 3C8DA 4B27A 4RIRA 3F7RA 4FRWA 6REQB 2XWBB 4N26A 3WAKA 3SUVA 3OR6A 3D85B 1UH2A 2RUSA 5DRCA 3VOHA 4UQ2A 2KUTA 3P3BA 1M2VB 4LB8A 6PAZA 1ETJA 5DEFB 1CTMA 3EKZA 3W23A 4XZNX 1UWXK 1IV8A 1BTCA 3W3OA 5EZJB 2VM4A 4NQCA 4LSBA 3STEA 2PF8A 4R83A 4NKOA 1XXXA 4QSFA 3FUMA 3K80A 4PJIA 4GW5B 1T41A 3EMZA 2BVOB 4AB4A 2A0LC 3O07A 1U8NA 2JQMA 4Y5VC 2VDGA 4R4ND 3B3IA 5BZXA 1BQCA 3IACA 2DQFB 2PTWA 5AWNH 4LEOA 1V8EA 2AJYL 2J74A 5ESAA 1BX2B 4WNSA 4OE7A 3QPXL 1ASOA 1BJ8A 1ZXQA 2IG2L 3P3UA 4FLRA 4D9QE 3R0KA 5IFPA 2CD0A 1S9YB 1FAIL 4I0PB 2EP6A 4J27A 4M81A 4XBKA 3VDHA 1AO7A 3FT9A 1ZNNA 4C60A 1C12B 1WPCA 2JTYA 3K4DA 3KXQA 4TNEA 2JGYA 4EUPH 2Y9RT 4LCWD 2UY4A 2DKUA 3K5SA 1W72B 5BOPA 2C9VA 3V0HA 2QV4A 1X4YA 4EDWH 3B2DC 1JPHA 4XZLX 3ZR5A 5FOJA 3U9WA 4YDIH 2EDBA 4ELDA 3IE4A 4IRZH 4MBOA 3W0KA 2GC4C 3RWGB 2C18A 4XAGA 1AHWC 3CH1A 2EXOA 2H26B 5FUZH 3V4VA 2VVNA 1F3WA 3W75A 3MBEB 2VR6A 2YXXA 2IVFC 3RWCB 3AROA 5J06A 3H7LA 2PYEB 4UAOB 4WUKL 3TFBA 1NIDA 2EUVA 1JXFA 3ESUF 1UATA 2DAVA 3QFDB 1IO4C 2IW0A 1BOGB 2HTLD 2RFXA 2X53A 3NCXA 4ONOA 5F96L 4K5MA 5FF6A 2JCCA 3ASOB 2ZQ0A 4Q4IA 3K6NA 3VH8G 1TPB1 2XG4A 3VXSB 2OR2A 2VM9A 4PUBL 1QAWA 1YEJH 3WK0A 1OCZB 4WAFA 2X1UA 1JD9A 3MV9E 2EDRA 5F7EH 5LO7A 1BGAA 1WDRA 3T8MA 5T26A 1HJWA 2G95A 1FH5H 1AJ2A 1RZ8A 3GMPA 3RVWD 4UT6H 2EXSA 3SDDD 2MTAA 4DOHE 3ZT5A 5HVWA 3VKKA 5H8PA 4QRTB 3KGUA 2XJKA 1QKZL 1KYDA 1RZJH 4LL1A 4O2FA 1NFAA 2XDHA 3ZOAA 4YFLF 4F7MA 3TN0B 4PMQA 2V3GA 1A47A 2F8IA 3MRMB 2Q6ZA 5A6AA 2OLSA 3G6MA 1ZJAA 4LASL 4WO4A 1YUKB 4DHLA 4G9FA 2ZD0A 1A14L 3WFBL 3ULUC 4LOEA 2E7DA 3MRHB 1PYFA 1LTXA 3BRDA 2OOFA 2QCEA 4W4QA 5E09A 4KRTA 3GIZH 2VD9A 2CUMA 1IGCH 2XXGA 4O58L 1U4FA 2DPEA 2Z31D 2XLLA 1AKJA 3G04B 4ANKA 2DQWA 2IPWA 2Y36L 3O0LA 3VFRA 1CECA 3M0YA 3LENA 1PE1A 1WS8A 2EKJA 3U4KA 1NBYA 4IEFA 1K8IB 4IDJH 4K3DH 1FL6A 5G55A 3ZE0B 3F1QA 3QV9A 4P8UA 2Z6IA 4C6IA 1P9MC 4JPIA 2DTMH 1MDLA 4QISA 3BPOB 2O5XH 3GSNB 3GH7A 2ARJQ 2JKEA 3U0WL 3WG7B 2Z8SA 1IXPA 2GUYA 5DVNA 1Z42A 3TA4D 3NMEA 4H25B 4Y1AA 1Q1JL 1HHGB 3L95A 1VJZA 1DQJB 1U92B 1W9XA 3O7UA 1FZOA 2DZEA 5I73B 3FQ4A 1F8TH 3FO2B 2EEFA 2VC2B 3KYKL 4LIQH 3IFPA 1ZT7B 4XP9L 4KKQA 1H62A 2EADA 1CF8L 2HT3C 3TIDA 3LS9A 4CN1A 5TJWK 1AIZA 3W1MA 2CJUL 2C9QA 3DHDA 2R8SH 3L5WB 2J4GA 3SYCA 3JWNE 3MGAA 3OKNB 4JZNB 2QDWA 4L5FL 1Q0XH 5GS2D 2ED9A 2ACSA 2X42A 4HUKB 1OB1A 1PZAA 2A9DA 1SSDA 4G3YH 4WHTA 4WJKB 4MDIB 1OW0A 3RUGE 3VGAC 1NMAH 2E9BA 5FC9A 1L6FA 3UESA 3K46A 3B03A 1FCGA 3T3ME 1GPFA 4AISA 5HBBA 1JBJA 5AC5A 3QUHA 1MEXL 5HJ3A 3LUTA 2VRKA 3ARDC 4PAZA 3VM7A 5BV7B 1TU2A 4OI8A 4JCMA 1W3TA 3IJDA 4WFGD 1PY4A 1X7SA 2G30A 3LAFA 3ARRA 4OLUH 3ES7A 3I6RA 4UFHA 4AHOA 4X6CA 1T1XB 3IDNB 1AD1A 1XYFA 2GSEA 4MMXA 1SM3L 2VL4A 1QSEE 3EOBB 3SBRA 2W63A 1ETZB 5EO9A 4F33B 2Y24A 1AOHA 4G8TA 4WDTA 1FWNA 2NZ1A 2XN2A 4RAUA 1UUOA 4TOYH 2VFDA 3OEXA 4NZTL 3K71A 3K6DA 3C12A 5IRPA 3BOFA 1WBYA 4XP9H 5EWIL 4JYFA 5BMWA 2VXQA 3P3SA 4IS6A 2ATKB 4OJFL 2I5GA 1W6WA 3UR2A 3W29A 2WHVA 4NO0A 3CDGB 5JH2A 1E2VA 4ZB2A 4CRPA 4GT7A 1DE4B 1QG3A 4OKDA 2CDFB 3C86A 2W67A 5CJQL 3SE9H 1QI3A 4L8SC 1SMDA 4IJTA 2FBJL 3EBHA 4G6CA 1E0UA 1IZJA 4X9HA 2ZUNA 3AM8A 3DVIA 2J7CA 1A49A 1WFMA 1GQJA 4WWKC 3W0WA 2B4CL 2J8HA 4V1DE 3NA8A 3CLWA 4AXKA 4L1TA 4NF7A 1DV7A 1RZMA 3BYTA 3FOLA 4R0LC 1OGBA 3IUIA 3BKCH 3I9GL 3WEBA 3DFOA 2IF7A 4JZJA 4AEOA 5KW9L 4G7EA 4V1YA 3MWAA 4ACTA 1ZANH 3UY8A 1ZRQA 3QWOA 1GHRA 4PR4A 3GJFK 1DFXA 5K9CA 2K4WA 3QXAB 1SGKA 1IAMA 2CZ5A 3ARBD 4ZQKA 2INEA 2VEGA 4J40A 2D7TH 3AIRA 1CT8A 1A14H 1YAZA 3LH2H 4AVIA 4YZFF 4UINL 3DV6B 3PWGA 4TXEA 1OE2A 3SQRA 1D5IL 2QIWA 1JERA 2Q7YA 4F66A 5T3XE 4GZJA 7CGTA 2WZMA 4MRCA 5B38G 3MW7A 1TYEB 4NAEB 3UY7A 2MPVA 2XWCA 2B20A 5TD4A 2BP0A 4EZMA 1W6TA 2GFTA 3BKML 1PLAA 5F1NA 4HS8L 3REWB 3WK1A 1DBBL 1ZUAX 1CURA 5FJPA 2EXYD 4GJIA 3IPWA 3D39E 1A9BA 2HKAA 3D0LA 3CNKA 5L0QB 4F40A 4BSWA 2CESA 3PSWA 1FL5A 2GEEA 2HLFD 2V5RA 3DI3B 4X5XA 1S5HB 5AKRA 5A40E 1R17A 2YZ5A 1BM7A 3UTQA 3OKDA 1YHPA 2VGFA 5K4ZA 4Z0SA 4OTXH 2G9KA 5AYTA 4HBCH 4MNQD 2EE6A 4N90D 3IGAA 5IOBA 3UX9B 3BV4A 3GTIA 3WZ0E 2Y07L 2R69H 1TQVA 1DLHA 1P5UA 2P7TB 1HWGB 1JL8A 3DDFA 4BQ6A 1P4CA 2DSVA 3LKSB 3KBSA 3SN0A 3DBXB 1EV2E 4ZTOL 1KTLB 3WUWG 1OC5A 3LA4A 2FMOA 1HX0A 1R3YA 4LHUB 4LSUL 1KIQA 4HJSA 2E76C 3PBVA 2ZOUA 2IANB 3HE6D 4RISH 5IOKA 1UD8A 1BQHA 3CZGA 4M02A 2MEJB 1HJVA 1EH9A 2PGFA 3T81A 1TMQA 1ADQL 4R7NA 2AGTA 4U2ZA 3SDCB 3C0QA 1ERNA 4BZ2L 4LRTA 5H91A 1S7TB 4MAYD 4LCQA 1JPEA 3N2BA 4KDTA 3O11B 5JXAL 2VWTA 3I9IA 3MOBL 2HRGA 3EXLA 3V0WL 5G2HA 1H3WM 1DTUA 3MV9A 1CTNA 3HC0A 1J9RA 2J7EA 4S3FA 1M1XB 2B15A 3EJPA 4TSBH 1US0A 1F90H 2FATH 4NRXA 4QDWA 5K9JH 3U2CA 3EOTH 2Z1KA 3HUJE 1FLRH 4TVUA 4W6XB 1RD5A 3LD5A 3DX6A 15C8H 5AAMC 3QUXD 2OXNA 4XBGB 3J2PA 5EA0H 5EU9A 5C6MA 4U10A 3B8IA 2IQAB 3C87A 4WTWA 1L7IH 4U7MA 4BHUI 4BSWB 3MYPA 1QQDA 2F7QA 4HGWB 3MGOB 2B1HL 3U2SA 4WK2B 1GGCL 1TUFA 1I8KB 3F4WA 4MWAA 2EDEA 3S6OA 4NDMB 2VR8A 2Z8WC 1HP4A 2NZIA 1SFSA 3QGAC 5HA7A 1QHPA 4QTIH 4ZUSB 4HK5A 1LLAA 5BZWB 1WA1X 2PDXA 1U8LB 2BP0B 4RDWA 1MSPA 3QRGH 1KXVA 3RYSA 4UZUA 1F1AA 3NPZB 3SKJH 4LOFA 4NP9A 5J5EA 2EPHA 3B8UA 3LBOA 4A63A 4E5TA 3FFSA 1LCOA 3RWIA 4KBPA 2PTDA 3KBNA 3RM4A 4PV8A 3QDJA 5F21B 5I0YA 5SWQB 4AQLA 2WSPA 2XN1A 3R13A 4KEVA 1J9QA 1DQQA 4XWOC 4AQ8C 1BTMA 2C79A 2IWGA 2VQUA 5EN3A 1WYJA 1QYGL 2BWQA 3GGWA 4TSBL 4L6DA 1SPDA 5REQB 1XLDA 3MGTA 4LSPH 3OX8B 4Y1AE 4J3SA 3V6OA 2UWEA 4AGPA 4HIJB 5FF0A 3VIKA 5TQ0L 4Y8FA 4PJGB 1QW7A 2R2BA 2MCMA 1CDJA 3NA4A 5I73C 3RX9A 4PJHB 2JJSC 1UG9A 4ADGA 2OX5B 5HYFA 2AV1B 1KFLA 4M6ML 4QOKE 3HPFA 3C6EA 4GUHA 2WIIB 3M45A 4HHAB 3JBG7 4FNLH 4GGBA 5HSFA 4JJ5B 1I9IH 3CDGA 5G1MA 5HDLA 4D9LH 2GUOB 4MBRA 3EXSA 2JKXA 3CHQA 3TBWB 1AZ1A 1J1XL 1JPDX 1PIGA 2W9EH 4FEMA 3VXME 2PXYD 3ECWA 4Y16D 4UTJA 2NXYD 1IAIH 3PF3A 3URQA 2BRQA 5JPMA 4UFJA 4MCZB 1Z5LB 5C0IA 4OV9A 4AQAA 1D9KC 4K8RC 4FEZA 3EGXB 4HX1A 3SBWC 2PPFA 4XTIA 5TAOA 2WBXA 1LOSA 1VCAA 1DQMH 1DWFM 1I85A 4LLYA 1P5VA 2X70A 4RRPG 4AVJA 5I1EH 1I1FB 3EX2A 1G1CA 4Y2WA 1JNJA 1BSLA 1OVDA 1IBGH 4NQEB 1UA6H 3AO0A 2XA8H 4EDWL 5I6XC 1YADA 4JKPH 1MZYA 2ABAA 4GABA 3ZLHA 1HVXA 3K6FA 4C55A 1SVDA 3L5IA 3FVMA 4M6MH 5MI0C 1V54B 1O7DC 3AJ7A 4XPTL 3ULUE 5AW0B 1TO3A 1WXZA 3FFCB 2A0NA 3MACH 3I50H 1PZCA 2OL3L 3L5WA 1CYWA 4U6HB 1MRDH 2I69A 5C2XA 1EVTC 4QE4A 1SDDA 5JW4R 5K39B 1S9XA 3V5HA 4OLXL 2GJ6A 4FHBD 1ZZMA 3P8JA 4X7SH 4GIEA 3W2JA 2HE8A 5FEPA 2GLKA 5FO9A 1E65A 3C2VA 4FFTA 4HJJH 4H83A 5B3JF 4AU0A 2DM4A 3BQUA 4H1LG 5D1QE 5JU6A 3QS2A 2V2XA 3BL3A 1G6CA 1VGKB 2WQXA 4AM0Q 3UBXA 3QG6A 3C9NA 1CI1A 4PW3A 5DHVH 7REQA 2CO1A 1D7DA 4A2EA 3TJEL 4O1CA 2EICA 2XWJA 3ULVE 2BS9A 3CHDA 3QXVA 2BGSA 4GRWH 4MQSB 2A9MH 1QOXA 3S96A 2CKSA 2VRAA 2VDRH 4O54A 2EDYA 3EBGA 2VELA 3E0GA 5I1EL 4KKAD 3UZYA 4NCC2 1WKFA 1EUAA 4IIBA 4UTFA 1TJRA 3NG5A 1BAFH 4KJYB 3WUWB 4Q4MA 3LXUX 2WCPA 4XP4H 5GS0L 2D0HA 1RA5A 2JALA 4ORGB 4IRJB 1TF4A 1U3HA 1KFAL 5E2VL 4HYVA 4GB9A 3E9AA 5GJPA 1T22A 5HGDA 3LV5A 2H2PC 1RSCA 3NZGA 4BUHA 3ZDYF 5HDWA 3LS5L 4LLDA 5CPMA 4X2PA 4B5NA 4FLHA 3G6JF 2Q8BH 5EU4A 5A6IA 3QG7H 3C2FA 4PEKA 5D8WA 1P53A 3AT0A 2HPMA 4N9BA 2BOBA 2P28B 4TPRL 5H35A 1BVOA 5BXFB 4F7EB 1P1MA 1WBZB 3KWWB 3OMIB 3BGMA 5BXPA 3VIFA 3O2VL 4CMMB 4JD4A 4FF7A 3DJTA 1ID5I 2PCYA 1IFHH 4IT1A 2BPBA 2MSPA 4J8RB 1XYCA 1J5OH 2GDQA 2NZ9D 3NPXA 4ZBCA 2ZYFA 2LAGB 5D2NC 3N0AA 2PDCA 3MOQA 1NVMA 2WNWA 3APFA 4FGMA 2QKFA 2WW5A 3ANVA 4L4MA 5KYUA 3TWAA 1OCWL 5GS1A 1XIWC 3Q6FA 5HAOA 5I8CB 1F6LL 3KOXA 3M64A 3FZUD 3TTSA 4OSUL 3CQPA 3PXLA 3UVAA 3KYOA 5H6HA 3IJQA 4PRAB 5AYIA 3FPXA 2APSA 1KY7A 1HHHB 3GAYA 2I26N 4G2AA 4M6NL 5MEQB 4FX6M 3T77B 4C4BA 2HTKD 3QJRB 1UZDA 5EOCJ 4QSHA 2NNRA 2CHZA 2GJ6B 4I9XA 4XH2B 5I5JA 1IKFL 5ANMA 4FYTA 5SWZD 5KVMC 3S5SA 5A6JA 1SLUA 2GG1A 3VJ6B 3PL6C 2VDIA 3O3RA 3O6DA 1J8HD 4I5RA 1WYIA 2PP1A 2GVLA 4KESA 4A3HA 2YIHA 5B1AB 2J6EA 3UTTD 4Z1DA 2A74C 3AXLB 4R88A 2DLFH 1G7PB 1WUNT 4HF5H 4K94L 5EOTA 1YY8B 1ZLSL 1DVUA 4CC4A 3PJUA 4E2OA 2DFAA 1TJIL 3WLQA 4M1CD 3Q13A 3SE4C 4ZYKA 3FQRB 1B0WA 5HHPA 3BVNA 3X1NA 3SDAC 5DJCA 1ISWA 1P5VB 2X70B 1O4UA 5A8QA 4AD4A 3B0PA 1TT6A 2Y6SC 3UTSA 3IEAA 5LG6A 1HQRA 2IDSA 1AGCB 1V0MA 4Z7OB 4KK6C 3EFOB 4NUGH 4RFNC 2X6VA 1CI3M 1A5UA 3MACL 3QDME 1NTDA 2ARJA 3AU0A 3ZPDA 3MZTA 2VQ1A 4G9DA 4Y2DC 1GOXA 4P23C 3GNXA 4OUUA 5JBEA 1MFEH 1JI1A 1Z9MA 3F05A 5C6PB 2EQDA 4G9PA 2HN7A 1JGEA 1LEGB 2HYMA 5IVXB 4S3AA 5C0AA 4H1LA 4RZBA 2B3IA 3TBYB 4AYEC 1ZKAA 4BR1A 3DI2B 3D85A 3IN0A 3MU3A 4ODWB 3LCGA 1S7VA 4JFOA 4KITB 2HJFB 3CVHL 4ZMAT 3NL6A 3M1BA 1U3NA 4OECA 2AZUA 4ANXA 4E3TA 5J11B 5EKYA 5A7BA 1FFNB 1BBJB 4LU5L 5HDBF 1OGGA 1LVEA 2W27A 5HGDB 2EE0A 3SQOL 3MBDA 3GYEA 3SGZA 5FYJE 1GVQA 2UZYA 4JM2B 2CLHA 4ZFCA 3KYKH 3VMPA 1IGTA 5DD5L 1ML1A 1VFBB 5A16A 3ARDD 3B9OA 4GXVL 4JM4L 3TCXA 3TAOA 2OQYA 3BCJA 4XO3A 1TV2A 4O1BA 4K94C 2QXWA 3A6OA 1KFAH 3GB7B 3FRPG 1D9KD 4K8RD 1IUZA 1IZCA 1SOSA 4R9OA 1B0IA 3AICA 4FQIH 3CFBA 4OAWA 4X4ME 1E6RA 1T6BX 1BQHB 2QLYA 4DK6A 3OGSA 4L56A 4IOIA 4Q2ZA 1MCWW 3ATYA 5D4IA 3FXGA 3ZYJA 8XIMA 4MA7L 1LL4A 3C2EA 4FKHA 5FM5M 2FH8A 4WRHA 3REVA 4OM0L 1AXSA 2C4FU 4GI6A 4HUWA 1K8IA 4LWWA 5FYKD 4L65A 3DZ1A 4AUUA 1V6VA 1JFHA 1RERA 3RFRA 2APTA 4CU8A 5JW5A 3NCYP 5JQHC 5LZLA 2C3ZA 1N2VA 2IPGA 3N4FA 4WVXA 1DQVA 5EA9A 3EMCA 5DQJA 3VRJB 5K4XA 1FVDA 4ZQMA 5IJKC 4N8VA 2FYMA 1XCXA 1B54A 1TKWB 3MB9A 4PUDA 4XBSA 1SFHA 2X0YA 4JN2B 4NZ3A 2TSAA 1LO4H 4NO2B 4F7MB 1D3CA 1OV8A 2P50A 3DFQA 2V9RA 3CXHJ 3MJ8B 4HIQA 4FQJH 2J9ZA 2C9UA 4OUIA 2R29L 4EN3A 3JUZA 4YEEA 1I1YA 4QKTA 1FRBA 4AD3A 1Q9WA 1FWEC 3DYOA 3IDXL 4QHLB 3B9VA 2IALB 5E0QA 1BAGA 2Y5SA 5IMKA 4YHNA 5D1XA 1J4EA 2YYUA 3PG9A 1EGJH 1T6WA 3ZQ9A 3PWJB 4A2RA 3LN4A 4HNLA 2ZUSA 5FEZA 4XMWA 1JZ5A 3MO7A 3N3MA 1KBIA 2H45A 2E9LA 4FTVB 2DQTL 1RK7A 3OKEA 3GB7A 4O02A 3VO0A 1J5TA 5JYLA 4IHCA 4PH6A 3CZJA 3KCOA 1EC7A 1U8PB 1C16B 2IV8A 2ICWB 1REIA 2IXQA 2J1ZA 4LDEB 4NUJA 4PRIA 5FA3A 3B0XA 1UZ8A 2XIQA 1B3JA 4BDVA 4C5ZA 2W0LA 4F58L 4EIGB 5EEWA 5EB8A 3AISA 4QITA 2VDLB 5IESH 5ABHA 4GW1A 4JEQA 3RM9A 2O55A 1XCWA 2Z92B 3AU1A 4FCHA 1XTMA 4ZT1A 5DLML 1B4EA 3BUBA 3HR5A 2IG2H 3GGWB 4OGAC 2ZIDA 3NFUA 4KIEA 5REQA 4PS4H 3VI3A 2WWMD 4H6EA 4JQ3A 2F18A 4RAUB 4ZO7A 5EU6E 4ELMB 3MMWA 3B9AA 4OZ4B 1O75A 3TTYA 4DQOL 1IGYA 4BY3A 4O28A 2QDVA 4QRRE 3SDDA 3QIBA 4JRYB 1G5GA 4NU7A 1X9LA 4Y89A 4DJFC 1CBVH 3GHEH 5K9KA 2XACC 2ZXDA 3SCOA 3P69A 3SR7A 1QTYT 3LPOA 4YHIA 1EAQA 3Q0HA 2B08A 2Y7QA 3THMH 1ZPUA 2HFFA 2WQWA 4MTVA 2KDGA 1FWRA 4IGHA 5E5MA 4O1DA 3URAA 1EMTH 3IDJA 3WY4A 4LCRA 1OP4A 4YMPA 1U21A 3QJVB 3Q2WA 4ZMYA 5IBLD 2VFIA 1HJXA 2QEJA 3LRHA 5CGMA 4JBRA 5FF2A 3SJVE 2QCDA 3FOLB 1GEQA 4L1GA 1Y7VA 3TEVA 3ELQA 4LNCA 5EO1B 1NL0H 3KBHE 3FFDA 4LBEA 3IWUA 1GTHA 2BDNL 3HPSA 4OZHB 1F05A 2VDHA 3TVMD 3JUGA 5LXGH 1L7IL 5FOBA 1AC0A 2OXGA 4OZIA 2OFJA 1SJAA 2UV8G 3AMLA 5I77A 3RNKB 3C5SB 4K9EH 4HNVA 1USQA 1E4MM 1R3LB 3QQ1A 2IAMD 1IFGA 4X83A 5DVPA 3VFWB 3BUYA 3UWQA 1DBKL 4TSAH 1ZS8B 3EYVB 2ENQA 1DJGA 1NCTA 2PR9A 4G8AC 3GB6A 3QV7A 1F4YH 3RX8A 3U7YH 3ZRCC 4L29B 4DQOH 3E02A 2YKLH 4M9OA 4Q33A 4NZ5A 4XD4A 4PCSA 2GSHA 2G3JA 2BIIA 4KZ0A 2D23A 3EX6A 3RGVB 2H5UA 4WFHD 1TQCB 3R06A 2F5BL 3SBPA 3T3PB 3ULVC 3C0SA 3B7RL 4LSRL 2RFGA 4R7LA 3LD8C 3VH8A 1SBSH 4NBZB 4AQ1A 2BCMA 2OYPA 4YSSA 2ZKMX 2HFGL 1I8UA 3L3IA 4LRIA 2X30A 5HHOB 3HS9A 3VGAB 1IC0A 1ET5A 1I1AA 2YQBA 3SDYL 3UABA 3CMJA 3DGRA 2JB5L 4B5WA 3MLTB 1EK3A 1NWRA 5I30L 2UWFA 1YNYA 1XR9A 4QRBA 5DUPH 1A6AB 5AVQB 2QKIA 5CSSA 3THQA 1OCRB 4QNPE 2NUWA 4XAYA 3HZMB 1KTRL 3EYQD 4RSVA 2IFGA 3SGDI 4NNPL 4XXCC 3T0EE 3KHQA 1W9PA 3UZXA 4B91A 1VYRA 4F3FA 4RE4A 1A8ZA 1JV2A 4OCSL 5ID1A 3E2QA 1WHPA 2XQYA 3KYMA 2VLJA 3XINA 2IADB 2QNEA 4X5PA 5KAQF 4XKMA 3GTHA 1CZ8H 3W7HA 3PV6B 3DRTA 1H5YA 3JZEA 3SCWA 2EE9A 2N0MA 4WEUD 2NSXA 2NLJB 2X1WL 1QPPA 4FQHA 3WKYA 4NYYA 4L1BA 4I9AA 3C8KB 4HWUA 3HU7A 1E3XA 2PXYC 4WUUA 1F56A 4JFFE 4PP2A 4QXUL 3T4AC 4JQ1A 4YDIL 4GUCA 2IAAC 3FCTB 1TCMA 1K2DA 4GW4A 5DJYB 3F58H 4GW1B 4E9TA 2J2ZB 3RGBA 3B8VA 4AIZB 3F7JA 4YL9A 3ERXA 4K2UH 2VZUA 4BDVB 4X7FC 3L7FA 1HJCA 1BM3H 3PP3H 4F7TA 2GEQA 5D7IA 1KXHA 4NRXB 1U2CA 1UXWB 3I75A 5FGCB 1KKRA 3LZ3A 5HUOA 3QJHA 3QFDA 5IEKA 4C6OA 4PHZA 4Y1TA 1A9EB 1H3UA 3PREA 4B95C 5I78A 3E6FA 1UGNA 1MUJB 2VGLM 5T1DL 1E27B 4WI2A 4WY0A 2E7MA 4JPGA 4M6NH 4OM1H 5ABZA 1ROCA 5I6XB 4MAYC 3NQVA 4HU3A 3PWJA 4RMRA 1SW7A 3E2HB 3HC3L 4KKNA 2BSCA 3U4BL 2CLIA 1A3HA 1GH7A 2OJZH 3IJEA 1TO4A 3CN4A 3QI9C 5FYJL 2AJSH 4G9FB 3OG4B 5CCKH 3F5LA 4AGLA 2VH5L 4K8EA 1BD2D 3E74A 1NGWB 4R3SA 2ATPA 2KX9A 6TIMA 5FIEA 4XRCB 3C75A 2V3EA 1BD2A 3FT4B 1VCFA 1CGSL 4IJBA 3SW6A 1UA6L 4XMPL 5TDPA 3T8VA 4KCVA 1UWGH 1RZGA 4FERA 4LUJA 1GK8A 1ME9A 4Q7DA 1NARA 1QRNB 2UVEA 2HBXA 5GZOC 3UTZB 1T7VA 3D0AA 3PWPE 1P4LA 3GJFA 4DN4L 3TA9A 3L3OC 2P46B 3F58L 4ZTEA 5GISL 1ZHBB 4NC1E 2NQJA 4GO8A 3MNDA 4K3EL 3FSZA 5C9JB 1GZQA 3PZIA 4PUKA 3LH8A 5FI8A 4HBQA 4D2NA 2AKRA 4P59L 1M7IB 1F6AA 1VCVA 1V3JA 3BSMA 2AJ3A 3VQMA 4PJXB 1JZEA 2I56A 1QLEL 4WI9A 3T2LA 3BQ6A 4MNGB 5GNYA 1V7MH 4CADB 3BRGC 4XT1C 3HZKA 4DY1A 5IHZA 4OF7A 5GSVA 3WGVB 3GDRA 5E4IA 1K9FA 3QTGA 1HWHB 1VAHA 4J3OC 1UD5A 3LPFA 3EWUA 2E28A 4MA3A 1V7NH 2R0ZL 3QZNA 4XHQA 4FFYA 4XO4A 3KPRD 4K2SA 1ML0A 4OR1A 1D6EB 4S1RH 5HYJB 5BRBA 2CK0L 2WQAA 4LCIH 2XYBA 4XNAA 4AT6B 2V2WA 4ZS7L 3W2DL 3W9EB 3UWEA 2QEZA 1EJWC 4UTHA 2NUTA 1OGAD 2GQAA 3UT0A 3SDCC 1MUJA 3W82A 1A5MC 1I8JA 4DN1A 1X5FA 3ZR6A 4ACPA 4J6RH 2X89A 3WE6B 3CSTA 1KPVA 4MA1B 1KM0A 1XPYA 5EMLA 2CO2A 4PW9A 3QJHB 4F37F 5IEKB 1M7JA 1X97A 4NUGL 4TVPD 3VOFA 5FGRA 2X3CA 1Q6EA 4YLBA 1VFMA 2ZRVA 4L18A 2YHGA 3SBFA 4P3DB 2ORBL 4WU5B 3NZHL 4YHOH 4ZZKA 2ZOTA 4BF7A 4C1NA 1UT2A 3ZE0F 4IHOA 1Q85A 1Y8BA 4LT9A 5E4AA 3A5FA 3UO1H 4DUWA 2KZBA 2NXZB 2BIHA 3ZSSA 2OJ1A 2IPTH 5CEXB 1DBAL 3QUXA 4Z8FL 3CFMA 3VD7A 1JGVH 3CVIH 4OGQC 4JHMA 3WSUA 1REQA 3HN3A 3L6FA 4F15C 1RJQA 1W56A 3PB2A 1NUGA 2P3EA 3LSOB 3LK6A 4HT1L 1WO2A 5D1ZI 4OUUB 1I2RA 3E0WA 4IIGA 5BNXD 1MY5A 1ZHLB 1ECEA 1GZQB 2CCRA 1QZNA 3CN2A 4EXPX 1KN4L 3SE3C 4YXKL 2Y2YA 5L6YL 1DJNA 1LWIA 1AZ2A 4WTZG 4I5BA 1OX4A 4KNSA 2F9BT 4R5XA 4AAJA 2DSWA 5J1AB 5IOPB 2R2HA 3WHXA 2WC7A 3NFNA 4YZFE 5BO0D 1A1MA 2D3NA 1UB5A 1LP9A 2CKBB 4HMCA 4DVRL 3H9YA 2WN3A 3G5ZA 3MFFA 4FK9A 3BW3A 3IETB 3OKMB 4R3SB 4OZIE 3B2XA 3BVWA 4ZXBC 4CQDA 1MQPA 3AWFA 3ZDZF 2N0KA 1LDSA 4XB3A 4D0CB 3CSPA 4Z78A 3SUSA 3DG3A 1DEDA 4C54A 3FONB 4ZFFA 4L3CB 1D5XB 2QSQA 1OARL 3HQOA 3PQYE 3I02B 1EEUA 1CD9B 5DLMH 1ZJHA 1SJCA 3F2LA 2UBPC 5MEPB 4MKVA 1HF6A 5FESA 1OD8A 1YX1A 4E8DA 2EYTB 3QDMD 3HPJB 1TLMA 4GOAA 4R2GB 4AMCA 4GLRI 4QPEA 2Z31B 5B39B 4REQB 1ZCOA 4X9YA 5BJTB 3PB0A 4DWSD 2PCEA 1UADC 5FDYA 5T91A 4J23A 4O19A 4NP4H 5JIWA 4AVHA 1PPIA 2H2SC 3BJLA 3AQXA 2E40A 3O6ML 4APQD 3R7RA 3G6LA 1P4IH 1KCSH 4PWFA 4IW4C 4CNIB 3TJIA 1JK8A 4PA8A 5DN1A 3KW8A 2GITB 2OZNA 3O4LD 2O92A 3TT1H 3GMOB 2HJLB 3IFOA 4MNMA 2NY0C 4I18B 3ETSA 1NKRA 4N2YA 3O4LA 3KPSE 4FB7A 4Z42C 3RVVD 2UXVA 2Q7NA 4ZBJA 3MRCB 4XV0A 3VIMA 2XV3A 1DJWA 3KWSA 1I9CB 2Q8AH 3S1VA 1TEFA 3EFFA 3KGSA 5SX4H 1H19A 1DHKA 1S2EA 3G3DA 2YUWA 1DN2A 1XF3B 3P77B 4JDZB 4IMKC 4Z7UE 5EUOA 1T1WA 4YJ5A 4D6EA 5LA0A 4PJIB 4PREB 3EO0B 5AYZA 4XCEB 1PSKL 3ZK0A 3KDOA 4IKLA 1G6RB 1ZHLA 5EZJA 3VCNA 5T5FA 3TN0A 1O5DT 3QNXB 1XUZA 3M7SA 1U8KB 1KCRH 2EDTA 5E94B 4QCIB 4DKTA 2A4ZA 4JG9A 4O4VA 3SCVA 1GTEA 3WAJA 5J89A 3MJMA 1DSFL 4R5VA 1OF2A 3NL3A 5CC3A 3WNOA 3UXIA 1NCAL 3GMPB 5F7BA 1J5SA 1IEQA 2YMOA 1CD1A 5FJOA 3MI6A 4RBPH 1CJYA 4I77L 1OFOA 2C8NA 3PHQA 1JWSA 4EF3A 1CDYA 1JGIA 1P7BA 3PU7A 2V5JA 1MDAA 4JTGA 4PUUA 2I25N 3RGVA 4PUWA 3FJ6A 4WXZA 1J5HA 4O15A 2P5WA 4G1MA 5JXAH 3N73A 3BOLA 4LFYA 3E6EA 1FNGA 2A3LA 4YHEA 3MREB 2P5WD 2ICWA 2GSJA 1PVHA 4L4PA 5HD8C 3P73B 5EBLB 5G5DB 4HKBB 4DW2L 3JTSB 3HMJG 3H53A 2A6KA 5I1HL 2AEPL 3UP8A 3O3EB 1ECZA 1TTFA 2EIBA 1U0QA 3H0TB 3WI9A 2OXGB 2NDFA 4AEHH 3AI0A 2F9RA 3W4RA 4NI3A 1SJHB 1RJLB 3BH8B 1NFBA 2XH7A 3CFDA 5EO1A 3TH6A 3K4ZA 5D1XE 2AJVL 3S9ZA 5IM7A 3IJYA 3BP4B 4NNYB 1DVZA 1ZMYA 5DDHB 1BGXH 5ANHA 1IGIH 1OX6A 2AMXA 3W1NA 5D33A 4W9KC 4YR6B 1OHZA 4Z7WE 1FE8H 5J11C 3DKJA 4QHKI 3WQ5A 1KIRB 1ACCA 1E4XI 2HFGH 2OXHB 1EDTA 3VTRA 1INQB 1RPQA 4OGXH 2D7OA 2CXEA 1ACYH 4HSAC 3SCMB 4HLZH 3BP6B 4XXWA 2AJXH 4TXVB 1SQ7A 2XSBA 4OCLC 5AVRB 1R6VA 4OZFB 3WK3A 2CR3A 2P5EA 5GZNC 2VYOA 3T0EC 3ZLFA 4WFFE 4XOBA 1M6JA 4GFIA 4XE5B 3HR6A 3SODB 2AJUL 5I1JL 3UJ2A 2XY2A 4XODA 1D5RA 2WWOA 3HG1D 1B4TA 4MKTA 3ABMB 4OD3H 1LE5A 4G3YL 1DBKH 2PDJA 3VABA 3UR8A 5C7ZA 1L0PA 8FABB 5IDZA 3LQMA 4ZX4A 2B3RA 3LNEA 1KULA 1BLNB 4JJ5A 1ZENA 4M3KB 5BOZG 3ZM8A 1FGNL 4NRZA 2OI9C 3F62A 1Q3NA 2CFFA 2DP3A 1MFNA 1IKNA 3P9MB 3BZGA 3GRWL 3KW7A 3N3EA 5ICYB 1BVLA 4IBVA 2HJKB 1M2OA 3JWOC 2WXGA 4PBGA 3CPLB 4NQUA 4AQEB 3BG3A 3RJXA 3XISA 2AXFB 2ZQKA 2FLRT 4JFDB 4FXGA 1X9UA 2PCPA 3W7DA 1BQRA 3K3QA 4HFWB 3UTTB 4JTAA 4QAIA 1XGTA 3L7EB 1KGXA 5CU5A 4LLVA 1KB5L 5DUBA 5K69A 4JANA 4K8RL 5IMOA 1EP1A 4R8WL 5A16B 4D0BB 1X6NA 2F6XA 2OTWB 2QUMA 3EX4A 5DVLA 1IM9B 1PKQE 3V4VL 3GD6A 3NO5A 4F0HA 1USZA 4NWTL 4JE4B 8PAZA 3DMMC 4CNNA 3ZTCC 5T1DH 2E6DA 3DAQA 5HWNA 3BW4A 1RZFH 4UDUB 4YS1A 4UFMA 3EGJA 4PC8A 4QHNA 4X9SA 3O8AA