3MW7A

Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-ump(produced from 5-fluoro-6-amino-ump)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
259
Chain Sequence
APKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
publication title Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-UMP(produced from 5-fluoro-6-amino-UMP)
rcsb
source organism Homo sapiens
total genus 87
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mw7A00
1XBYA 3VFLA 1OYAA 4JEQA 3W85A 4FIQA 2QUUA 5DCBA 1OX5A 2GQ9A 1ML1A 3LCLA 3U6WA 1D3HA 3FS2A 3KRSA 4M6QA 4UFKA 3BLEA 1NEYA 3KRUA 3H55A 4K7YA 3OIXA 1JCMP 4MUZA 2V2CA 1OF8A 3UWWA 3T40A 1QOQA 1VCFA 1JCNA 3DZ1A 3M5XA 1YYAA 1J2WA 1W31A 3EEGA 3S6DA 5KMYA 3BG5A 3GLCA 4K8HA 1OFPA 3GNNA 3A21A 4AMAA 4NU7A 3T55A 1GYLA 1A5BA 4N9DA 3VI2A 4TR9A 1Z42A 3B4UA 1WOAA 1IIHA 1O94A 1LLWA 4AXKA 2Z1BA 3C2EA 4PA8A 4ADTA 1JCYA 3E9AA 3C2VA 2D73A 3BPWA 5LNWA 3S8HA 1F76A 3H54A 2CZEA 3QF0A 5AHLA 4WJEA 4JTEA 1L9WA 3B0VC 2A21A 3TC7A 4AF0B 5DY3A 3R5EA 1F74A 2YZRA 5FF3A 3TCEA 3IIPA 3W2MA 4OE7A 1XCFA 3PBVA 2H3BA 1C9DA 1LLZA 4NNBA 2ZA3A 4GWEA 5KSWA 3PBUA 4N6EA 3UWYA 3O6YX 5C6MA 1W1ZA 3LLFA 4JYFA 3M44A 2WSYA 3LHTA 3MBFA 1JVNA 1TV5A 4QAIA 5AOUA 3OG3A 4NNCA 3QC3A 3C52A 3TQVA 4O17A 4DF1A 1O5XA 1JUBA 3LCXA 4X3ZA 1TSIA 3EKZA 2Y70A 5D38A 4FNQA 1VLWA 1OFAA 2X1RA 1PCKA 2J9ZA 3QYQA 3GXTA 3Q94A 1XFBA 3TJXA 1TMHA 1JUKA 3MHUA 2WOQA 2A4AA 3MBDA 3N2XA 2VXNA 3NVTA 3PG8A 1XXXA 1JULA 4LNYA 5DXYA 3NQEA 4W9TA 3GIYA 3NQ2A 4O4VA 4LV9A 1VGAA 4M7SA 1KM6A 1ICSA 1S5TA 4IX2A 3NOEA 3PAJA 2VC6A 2GUUA 3M47A 3P5YA 3GB6A 3DXIA 2E5DA 2E09A 1Z48A 1J5TA 1OX4A 4A21A 1SZGA 3PUEA 1JCJA 3NQAA 4RKAA 5FESA 4AHPA 1XDMA 1TPEA 5G2IA 3TX9A 3O1NA 1Q3NA 1TRDA 1SUXA 4AEOA 2GQ8A 1X1OA 1FDZA 2OT1A 2TMDA 2JKPA 2ZRXA 3E12A 3I65A 3BW2A 4BI5A 3QPYA 4FB7A 3N9RA 1M5WA 2YPIA 4YMZA 3WJYA 3PB0A 4O0ZA 5AHIA 1LM1A 2V2HA 3DI1A 1W5NA 1H7PA 3BW4A 4E2DA 4NJHA 1QFEA 3NL3A 3LX9A 3PBYA 3VKJA 3HGOA 3IIZA 3ABOA 1YPFA 3MI3A 2B7PA 1A5AA 4P61A 5DXXA 1R2TA 1VR6A 1XBZA 4ZQPA 5EL1A 4AHOA 1H5YA 2QDGA 3TE9A 3QQ0A 1KV5A 1C8VA 2QJIA 3BO9A 1DKWA 3M5YA 3OBKA 4Z0JA 8TIMA 2YFOA 3PS7A 3W7KA 3IIVA 1K3UA 1H1YA 1EUNA 4RXGA 1WYIA 4O15A 3WJXA 1ME7A 3U2OA 1RR2A 1GVQA 4WZHA 1P5BA 2ZCGA 3DU0A 1F5ZA 4XWUA 3BLIA 1FWSA 1G7VA 1YDNA 1I2NA 3FYOA 4Y8FA 1FCVA 2ISWA 2BX7A 2J88A 2DJXA 1OFDA 1FUYA 2YW4A 4UUIA 3O06A 2ZZ6A 4FX8A 5F2GA 3R13A 3I68A 1TQXA 4UFIA 2Y89A 2DP3A 1ZAJA 3M5ZA 3NAVA 2GVLA 3OVQA 3DHDA 3EXSA 4K39A 1H7WA 3THAA 3TAOA 1ZJIA 3NEVA 2BWGA 1SZEA 3KXQA 3QSRA 4PEKA 2I9EA 1TRIA 2CFFA 4UTHA 3LHYA 1H7RA 3HOJA 1G67A 1GPWA 2GOUA 4JDYA 3NXFA 4A2SA 1FY6A 3MMTA 3PR2A 2HTMA 3F1QA 3P5ZA 4A3UA 3G1VA 4HIBA 2C13A 3DHFA 3W2UA 1GT8A 3EXTA 3PG9A 1ICPA 1V5XA 5MHBA 2V5LA 3LXCA 1YDVA 2PC4A 4XKYA 3A5VA 2F7FA 4HNTA 1OFOA 3LERA 4UFJA 1ONRA 4HPXA 5F1UA 1VJIA 3ABSA 1BTMA 5EA9A 3KOFA 3Q58A 1CI1A 5CKSA 3ZWTA 4BI6A 1NVMA 2LLEA 1LBFA 1TIMA 3CB8A 2QAFA 1P1XA 4JYDA 3E0IA 3LCIA 4OV9A 3W1NA 5FF7A 4MY1A 3HG5A 4FEZA 4UNLA 3P74A 4DQWA 3N34A 3PUDA 4UXDA 1TPWA 5C2XA 3TFCA 1B3OA 3DFPA 4Z1DA 3KVKA 1GQNA 2TPSA 4ZQRA 1C29A 4NVTA 3DFSA 2Z0IA 1XL9A 1RV8A 3VE9A 4QNEA 3IVSA 2VOMA 3W7JA 3S1WA 2DZSA 3WJWA 1LRQA 5IBXA 5SWUA 5FF4A 4ALDA 3S1UA 2YYTA 4N2YA 3D0CA 1CX9A 6TIMA 1D9EA 1M7PA 2DU2A 1DL3A 4FNTA 1IXOA 1WX0A 1QMLA 3P80A 1ZAIA 3G1YA 2E6FA 4HKPA 5IBXC 1VS1A 3CT7A 3W88A 2ZZ3A 3ZFHA 4GUGA 1I2PA 2YGYA 4UCGA 4RV8A 1DJQA 4LY8A 1OFEA 4O52A 4LWWA 5CPLA 2JGQA 3W23A 1BEUA 1SFJA 3HPSA 3W84A 5EKYA 3M16A 5J5DA 4KWWA 1O4UA 4JTLA 4M6PA 1KTCA 3PF3A 4O11A 3EWUA 5D2XA 3OVPA 2B7NA 2CLLA 2P0OA 5G4WA 2WSRA 1ZHAA 3G1SA 3MYOA 3LI0A 2XN1A 5AHEA 3A24A 4O53A 2NXHA 3P60A 1PE1A 2W0UA 4L4LA 3W2JA 2G5WA 2J6XA 3M41A 4K38A 3VE7A 1OJXA 1JRCA 1BKSA 4I7WA 4IOTA 1IGSA 3B06A 1G7UA 3B04A 2VEPA 4JNMA 2BLEA 2A2IA 4Q32A 3JS3A 3USBA 2NXGA 4O54A 1X8FA 2GPTA 1K7EA 3E96A 1LTDA 2PE4A 3QMSA 3LTPA 5G1YA 4LOCA 3W07A 3ATYA 4LVGA 4EF8A 4KWVA 4LC8A 5HWJA 1OYCA 3R8RA 4ZVJA 4HNUA 3L65A 1FWNA 3JRKA 3UNDA 4NQ1A 4O1BA 4GFSA 2QUVA 3V1PA 2FPVA 1DOSA 1XDLA 3C8FA 1FCUA 1JQVA 1QO2A 1HFBA 3SFKA 4KFNA 2NX1A 2RDUA 5G2WA 1ALDA 2XFWA 5C5YA 4JTKA 2ISVA 5DY2A 2VEKA 1MSSA 5BW6A 4ZQCA 3NGJA 3TH6A 1DBTA 3WK0A 3S5NA 3W2NA 1KTNA 2P1FA 1MEHA 1KFLA 1P0NA 3QW4B 4N4PA 2Y85A 3L67A 2G96A 2VEIA 4FXSA 3STFA 1AW2A 2PURA 5U4NA 5HWNA 4LS2A 3TAKA 3SI9A 1G4SA 3UPWA 1XUUA 2FQIA 4UNKA 2AGKA 1GJPA 1TTIA 3GYEA 3P7YA 5LHEA 3EB2A 3M1ZA 4LRTA 4G1KA 5LNUA 1KV8A 1TJRA 1Q6LA 1S3HA 1W5OA 1AK5A 4HPJA 4OGZA 2R14A 3QH2A 1TPH1 5K9DA 1OFBA 3MP4A 4IMGA 5D2VA 3QJAA 2Y6ZA 3KVJA 1R2RA 4HN4A 1NF0A 3FIGA 1XC4A 2QKFA 1PHQA 1UUOA 1YLVA 3W7IA 4JX5A 2Q8LA 3KRZA 1EX5A 3LRMA 4IWWA 3MP3A 3W1UA 1G69A 4JTUA 4LS1A 5HR7A 4EWND 2H8ZA 1XBVA 1LOQA 5LGXA 1RQHA 2BZNA 1TPUA 1FDJA 2FPYA 4WD0A 2VFDA 3GR7A 2YFNA 5LNVA 2A7PA 4CCDA 4WXZA 2C16A 3GDKA 4ML9A 5I3GA 1ICQA 1Q6QA 3LHZA 3W9ZA 1DQWA 2ZTJA 1K8ZA 3GAYA 2ZTKA 5BNKA 3LRKA 4PCFA 3ANYA 1QPRA 1D3GA 3TQKA 3EWZA 1LBMA 4JTTA 2RFGA 3E49A 1KW1A 3TFXA 2UV8G 1H1ZA 1G4TA 3LI1A 3G8RA 3P62A 1VCGA 2FPTA 5F2LA 2OZ0A 4IPJA 1XI3A 4XQ6A 1VLIA 3CPRA 4LRSA 3W75A 3UY8A 1P0KA 4CQAA 2C0AA 3DBPA 4FHAA 1HTIA 4AF0A 1T96A 2GVGA 3G1HA 1TREA 4M5PA 3S1VA 3AJXA 1QWGA 2Z6IA 4LW7A 1A53A 1PV8A 5G1TA 1AW1A 2PCQA 4S2CA 3HF3A 3LOTA 3M7WA 2OJPA 1ZY9A 2GJLA 2CLIA 2VFGA 4IJBA 2AQWA 3W7MA 3CWNA 3PSWA 1MZHA 4ZQMA 1SW0A 1KTBA 4N4QA 2H8XA 2Z6JA 3NPVA 3TV8A 1OF6A 4POCA 3NO5A 1THFD 4WXYA 3GXPA 3DENA 3G1XA 3BLFA 3WK1A 5K4ZA 3TUUA 3QM3A 4QQ3A 4J9JA 4OBTA 4MFDA 4IGHA 1T99A 4GBUA 3CWOX 2QCGA 4LVAA 2CLMA 1HG3A 5FEZA 1LROA 1EA0A 4BF9A 3FLUA 1AMKA 2CZFA 2CW6A 4RZ4A 4JGDA 4DBEA 2NLIA 2C15A 1PVNA 1ZNNA 2FIQA 4K36A 1IIGA 4PL2A 5HQEA 4ZMGA 1LORA 3O07A 1EP2A 1EEPA 2QUTA 4AWTA 3GXNA 1SO5A 4GUFA 1WDWA 4UFHA 3UWUA 4KFOA 1SZFA 4GUHA 4YWIA 4I7UA 2YYUA 3F03K 1G6CA 1I2OA 2FLIA 2PRLA 3PULA 4NJKA 4Y90A 3B0PA 2DJLA 1W5QA 4PC8A 1SO3A 5AC6A 3F4NA 2RKXA 4WY0F 1SO6A 1UUMA 3GDLA 3S9YA 3C6CA 1BWLA 3TU9A 3FKKA 3PY2A 1OG0A 1B57A 3G1FA 2OT0A 2NUXA 1IXPA 3O63A 2WO5A 3P8IA 2QEZA 3MI2A 4QSHA 4C1KA 5CPNA 5AYYA 1WQ5A 3M43A 3W6YA 3LBCA 2EKCA 3MI6A 3IGXA 3FA5A 2X30A 3W70A 4EVZA 4S2BA 1VYRA 4CNOA 1R46A 4MYXA 3W7OA 2V30A 2GVJA 1VQTA 3P81A 2J9XA 1GVOA 1QAPA 4UR8A 5EPDA 2DZPA 3BARA 4ADSA 2QF7A 3HJZA 4JTSA 4RJEA 1QDSA 2QCLA 3QZEA 2CWNA 2EAWA 4FNPA 5I3HA 3IEBA 1KFBA 2NWRA 2DZWA 2C6QA 3W1RA 4JXCA 4RK8A 3BG3A 1B9BA 4XUGA 1GTHA 4E38A 3TSBA 4I9AA 1NAL1 1NSJA 3M9YA 4HSOA 1YXYA 4JTGA 1H7NA 2TYSA 2ZFAA 4A29A 1L6YA 2Y7EA 2ZQ0A 3B0UX 5BMXA 1DV7A 3NPUA 4GXMA 4LUJA 1A5CA 3B03A 5CSRA 1VC4A 4ICNA 5F4WA 3HPZA 3RK8A 1ZENA 2G97A 2OMAA 4IQLA 3W7DA 2QCDB 4NUWA 2X2GA 3GZ3A 1K7XA 3GKAA 3LDVA 5F4SA 3LV5A 5I3KA 1W5PA 3BK0A 3UXDA 4RXFA 5A5WA 4DELA 2EGZA 3W3OA 3C56A 1IXNA 4CLMA 4JTHA 3T78A 4GJ1A 4B5NA 3KX6A 1U83A 4ADUA 1EWEA 4PFMA 3IRDA 3BGGA 2CU0A 1FDYA 2NV2A 4K8EA 3LB0A 4TMCA 1UJPA 4KFPA 5CGQA 4RZ6A 1X6UA 5FF0A 4RZ5A 2QJHA 3DKLA 3KVMA 3PB2A 4FF7A 4UTIA 4BFAA 3W86A 3A23A 3G3MA 1B4EA 3KVLA 3OVRA 2NWSA 3NL2A 1S5VA 5L6UA 3QMRA 4JTJA 3S5OA 4UMBA 4JY8A 3WJSA 2ZZ5A 3I6RA 3EX3A 3SGZA 4UIOA 3NQMA 1FBAA 3JR2A 5D32A 4UTKA 5BMWA 6ALDA 4O0KA 3M0ZA 1VHNA 2WV8A 4JIQA 4WOQA 4HT3A 7TIMA 1VRDA 3GDRA 2HS8A 4P2VA 1EPXA 1LRNA 1GYNA 4WOZA 2ISSA 2YXGA 5KITA 4MLRA 3LCFA 3QFEA 3TIMA 4UTJA 4U4MA 3T44A 3W7HA 4AWSA 3C2OA 3NDOA 2VFEA 1KFCA 2NZLA 2Y7DA 1A50A 4Z1CA 4O18A 4YCPA 5F4XA 4TO8A 2B4GA 1SW3A 3HGSA 2G95A 4JX6A 4MLJA 1LDCA 5D2TA 3RMJA 3W7LA 4AVFA 5CPMA 4U28A 3G8EA 2QJGA 1KLYA 2VFHA 2Y63A 1RPXA 2W6RA 5A8GA 4CNPA 3GK0A 3P61A 5E93A 4Y9AA 1RVGA 4OQVA 3NQ8A 3KHJA 2Y7GA 1DJNA 3HGRA 3EWBX 1HO4A 4MPQA 1FXQA 3KFTA 3W7CA 3ZWSA 1F7BA 2JK2A 3I7SA 3PC0A 5E1QA 2A7RA 3E02A 1TTPA 3NQGA 4D2JA 4LT9A 2ZYFA 1PS9A 1SO4A 1MO0A 1LZOA 3UYCA 1KLZA 3EX6A 1TTQA 2JKEA 1W3IA 3W7GA 1I4NA 1SSGA 3L9CA 3W7NA 1YXDA 2XN0A 3TXVA 1F6KA 3C0JA 1ME8A 4LU0A 5FI8A 1AW5A 4KKXA 1TQJA 5EMUA 4UTWA 5HWMA 4FIRA 5K3VA 4MKNA 2VFFA 4WUIA 3W73A 4DBDA 3TJLA 4X22A 2E6AA 3W1LA 3W22A 3TA6A 2R91A 3GNDA 1RD5A 5HINA 1BWKA 1W56A 3LCGA 3SIZA 4BR1A 4AWUA 1YTDA 4UTWC 1PCWA 3HPXA 5LSMA 3DKJA 1VYPX 4OV4A 2YSWA 1EB3A 1JCLA 3G0XA 1K02A 5KTLA 3PM6A 4NX0A 1ZALA 2E5CA 1F05A 4LVBA 1Q6OA 2ZZ2A 4Y6GA 5EYWA 3WFAA 4IX0A 3GVGA 3OEXA 2A6NA 4LVFA 1KBIA 4MFEA 3FKRA 2NUYA 1I2RA 3NQDA 1S5WA 1PHWA 2B0MA 3TMLA 2H90A 3RF9A 1KFJA 1SU5A 2Q3OA 1W37A 4YXGA 5TBOA 3UWQA 3ATZA 2I1OA 3QPZA 3ABQA 4FNUA 2QR6A 1H7XA 2YW3A 3G3DA 4H4IA 3T7VA 4OU1A 4R53A 4UFLA 2NX3A 1L6WA 5FEWA 1JRBA 4C1LA 4H3DA 4DPPA 1K8YA 4YCOA 2CLFA 1WOBA 5D37A 2ZRVA 1V7YA 2CLHA 3C2FA 1A5SA 2V81A 3NZRA 3Q2DA 3QMTA 4X2RA 2JKAA 3TNOA 3BW3A 3GX9A 1H7OA 4QITA 2QDHA 4NZFA 3DAQA 5TIMA 1XUZA 2E5BA 4DF0A 4UMCA 2J9YA 1LBLA 3W7QA 2ZBTA 5CZ0A 3IGSA 1TCDA 3R12A 4NJIA 1P4CA 4RX0A 2ZZ1A 5AC7A 3S5YA 3L0NA 1F2JA 1VZWA 1JQXA 1O95A 1WBHA 1I2QA 4JTFA 5LHFA 3S42A 3R89A 4JX4A 4AAJA 4TX9A 1TPVA 1E51A 3NQ6A 3MUXA 3NQFA 1EP1A 1R47A 2X1UA 3TSDA 3EX4A 2FB3A 4CQ9A 4O28A 2X1TA 4E0CA 3NA8A 4R34A 4M7TA 1AL7A 3L5LA 1JCXA 3S0CA 1MXSA 2Y61A 3OA3A 1LCOA 2C3ZA 5DN1A 3ELFA 3W1TA 3DI0A 4Y96A 1TV8A 3CC1A 5CG7A 1T8XA 2GJNA 1W8SA 3SJ3A 4Q33A 1G4PA 1IF2A 4FX6M 4MJMA 2Y88A 4TMBA 4AHQA 1UASA 1JR1A 1SR9A 4JYEA 3B8DA 3W1MA 2BXVA 4JS3A 2FJKA 2QCNA 3IIOA 2V8ZA 4WY0B 4JICA 2ZRWA 3LHWA 4DPQA 1ZFJA 3UZJA 1KFKA 2ATSA 4GUJA 5I3FA 1Y0EA 2NX9A 5I3JA 4L4MA 2E77A 1U5JA 3L2IA 1OFRA 1YXCA 5CZTA 5U7SA 5J5RA 2WSQA 2A7NA 2QCMA 2VFIA 3SR7A 2Q3RA 1DQXA 1VHCA 2A6LA 3GKFA 5AC8A 3P8JA 5DELA 2FDSA 4O1DA 4FNSA 4GE8A 1GEQA 4K37A 5D30A 4GC4A 4Z1BA 4I7VA 3GAKA 5CSSA 1L6SA 3GDTA 4ORMA 2V2DA 2A5HA 5DBUA 5F2MA 3A22A 1KFEA 4LS0A 4UC5A 4NZJA 4N6FA 1AL8A 2RDWA 2CZDA 2PRMA 1YTKA 2ZDRA 3W72A 5K7JA 2I14A 3EWXA 5D2YA 3KAOA 3LV6A 4M19A 5HNRA 3M6YA 1T0OA 1UB3A 2WNNA 3EWWA 3N9SA 3QSTA 5AHNA 3TSMA 3ABRA 3I7RA 1LP6A 5D09A 3LXBA 2CLKA 5FEXA 4DEFA 2ZA1A 3IVTA 1XBXA 3BGJA 2VEMA 4BI7A 3TDFA 1J4EA 4LUIA 3T4CA 1EIXA 4CCCA 3INPA 3HMJG 5BOOA 5K9CA 4O57A 3BVJA 3CIXA 3SY5A 2A1YA 3LCWA 5K4XA 4Z08A 2E68A 3G24A 3W74A 1X1ZA 5E0KA 3DFNA 3QQ1A 1EWDA 5AHMA 2V9DA 3UY7A 1L2UA 3PVFA 1I8JA 2YR1A 4N9BA 4O10A 3N14A 2RHGA 4NJJA 1KBJA 1H51A 1LRTA 1GVRA 3BG9A 5L9FA 4O19A 1O60A 2OX1A 4TU1A 1IXQA 5AYZA 4GRSA 3Q37A 4WQ6A 3PWAA 3W1QA 1KM2A 3GDMA 2TSYA 1HO1A 5C54A 3OHIA 3DFTA 4S1FA 1OABA 3RLVA 1FWRA 3TR2A 4MZ8A 1K03A 1OYBA 4MYAA 4QJ1A 3F4WA 1TO3A 1WXJA 5ABTA 2A0NA 2Y62A 3LRLA 4YL2A 1N55A 4ONVA 3O05A 1W0MA 3QEZA 2VKZG 4MJZA 3DH7A 4E2BA 5I3IA 2IQTA 1XKYA 4HSNA 5AN7A 3IVUA 4O16A 4O4WA 3TKFA 4UTTA 2Y7FA 5D2WA 1QPOA 3NPXA 1QOPA 1W3TA 1OX4B 5DLCA 1KM1A 1W54A 5EY5A 4JY9A 1FCBA 3H53A 2TRSA 5LKYA 1QNVA 1UBSA 2EF9A 4O13A 2WNQA 4AB4A 4UTTC 2Z2UA 3NQ7A 5D05A 4K7VA 4EOUA 1CW2A 4NJGA 1EUAA 3NNTA 5DCDA 1Q6RA 2DZVA 3A9IA 5DBTA 1TB3A 1H62A 5HUPA 5LZLA 5LNRA 3UPBA 2H3DA 2KZHA 3LHVA 4O14A 1F73A 3NZ1A 1FXPA 1GWJA 1VH7A 3LHUA 3NM1A 2HS6A 4IPIA 1YADA 4XTIA 2FTPA 1G4EA 2XN2A 4A2RA 1KA9F 2B7OA 2PRHA 4NT0A 4PL1A 4PH6A 5AB3A 1QPQA 3CIWA 5H91A 2HSAA 1SZNA 3L21A 3LM7A 5T26A 4JTIA 1TPFA 3HGJA 1FWWA 1OFQA 2QCHA 3UWVA 3NQVA 2NV1A 5D03A 2ABBA 5AYXA 3VNDA 3W76A 3AO0A 1X7FA 4QM1A 1RQEA 2QCDA 4QIUA 4OT7A 5HJLA 3PSVA 4R7JA 3MYPA 4PTNA 1QR7A 2E1DA 3SW6A 4NNAA 4MY8A 3MJYA 4O1CA 5AFDA 4PODA 1RQBA 3UZ5A 3NL5A 1LOSA 5GVJA 3IV3A 1K7FA 1KM5A 3O15A 4HHPA 4FX7A 4MZYA 4IMEA 4IMDA 3W7EA 1SFLA 1VCVA 3HBLA 1GTEA 4JD4A 1WBJA 3DGRA 5D04C 4XBSA 4MIMA 3G0UA 1HL2A 3GR8A 4XTDA 4UTLA 3EWYA 1TPC1 3IGUA 4LV4A 3SSJA 3QRHA 3HIJA 4ZL1A 4MVAA 3NPWA 1FCQA 1KM4A 3W7PA 3C61A 2QCEA 3HQ1A 1N8FA 2ZZ4A 3LCHA 1AG1O 5LGZA 2A85A 5KINA 1GVFA 1SPQA 4IXXA 2WKJA 4FXRA 1OHLA 2JBMA 4O12A 3NQCA 4JDBA 2YCEA 3P67A 4CQ8A 1H50A 3STCA 4N02A 2X1SA 5CPOA 2ZRUA 3C2RA 4XBKA 2J24A 5FF2A 1ZCOA 4CCEA 1H60A 3A5FA 3N73A 1Q45A 1GG1A 3QW3A 1VPXA 2B7QA 4XKYB 2R94A 4Q4KA 1SQ7A 1QCWA 3O8AA 3WK3A 4YLWA 1WV2A 4UTUA 1H63A 5D02A 1TPB1 3V75A 3UWZA 5AHFA 4MZ1A 4QNWA 4EIVA 3S5ZA 3G0SA 3EXRA 1OX6A 2EPHA 3TW6A 1QO5A 2C19A 4R33A 2V5BA 3G18A 1R2SA 2W79A 4IMFA 2DZXA 3G1DA 3WJZA 3N19B 5G2HA 1N7KA 3VCRA 2ZRZA 2O7QA 1GOXA 3CQ0A 5KZEA 4N9CA 4IUOA 1RZMA 4HNVA 4MY9A 3W2KA 4UTMA 2JGYA 2CZ5A 2H6RA 4RCXA 5EBUA 2NUWA 4CNNA 3HG4A 4DF2A 1WAUA 2C1HA 3W1XA 1GG0A 1LOLA 1TYGA 3LGEA 5H2ZA 3IIXA 1FWTA 4IMCA 2YDAA 3W71A 2GQAA 3N3MA 2WNZA 5TQLA 2HMCA 4LC6A 2C18A 3O6DA 4LTSA 3DFOA 1JUEA 5FEPA 1FQ0A 1MEWA 1SW7A 3I7QA 1DVJA 3L5MA 4JIPA 4X9SA 3HO8A 4FO4A 5HULA 5F2IA 1HUVA 3MWAA 2ALDA 3K30A 5BRBA 3PBWA 2EHHA 2ZA2A 1JJKA 4GUIA 1NFBA 3SGUA 4M6VA 5G4EA 4UR7A 1PL9A 3FJ6A 3L0GA 1OK4A 1GZGA 1KM3A 1DHPA 1I45A 3WK2A 2YX0A 2DORA 3SECA 2VELA 4O8RA 4DO4A 3CU2A 2F84A 1Z44A 2QCFA 3HB9A 3L66A 4Z0SA 1SSDA 2R8WA 3NR0A 3TROA 5CZSA 4HNNA 4FNRA 3L0KA 5KZDA 3LXAA 5IM51 4ZQNA 2NXIA 1UCWA 2DZUA 3CTLA 3W87A 3UQNA 2VENA 3TW7A 4O1AA 2DZTA 4A22A 3O6CA 4RLIA 3BV4A 1GVSA 2RH9A 3NL6A 3G1AA 1O5KA 1Z41A 2ABAA 3HG2A 1M7OA 1FX6A 3STEA 3TXZA 4AH7A 3ZS4A 4OHQA 3LLDA 1ZAHA 1YDOA 3HG3A 3CHVA 2ATMA 4NXSA 4XZ9A 3TQ0A 3O16A 1MEIA 3UXAA 5K2ZA 1ADOA 3YPIA 4N9EA 1W3NA 4OWGA 3FFSA 3P84A 2QAPA 3G22A 1YTEA 2CLOA 5LNSA 1F6PA 1VYSX 3PUOA 1NF7A 4Z1AA 3TMQA 3CLMA 3FEMA 3NM3A 3EX2A 1M6JA 3TK7A 3W2LA 4DO6A 2QCCA 3L5AA 1ME9A 3MO7A 3NYZA 3W1AA 2ZZ7A 1TPDA 1QPNA 2O7SA 2FFCA 3MW7A 1LYXA 3RLUA 1WA3A 3R2GA 4JN6A 1OK6A 2P10A 2E6DA 3W83A 3C3NA 2RDTA 3FYPA 4ORIA 4WX2A 4ZZ9A 4BWLA 1KM0A 1YPIA 4MOZA 2X16A 2V0TA 3S1XA 3STGA 5HUOA 3RU6A 4QISA 4TIMA 3U8GA 2V82A 1K8XA 3ZR4A 1R30A 2FB2A 1TJPA 3N2MA 1PIIA 5DCEA 4LVDA 4H6KA 3L68A 4BK9A 3FOKA 3TC6A 5D33A 5G5IA 1EP3A 4BWLC 1DORA 4NXKA 2C14A 2WQPA 3LBMA 3NG3A 5F1VA 4K6AA 1TTJA 3CEPA 3CEUA 3THQA 3C4UA 1OVDA 3UD6A 2BTMA 2CLEA 5CZJA 2WPBA 1H61A 2BSLA 4DO5A 4EF9A 5C55A 4JR5A 4ZQOA 2WJZA 3DFQA 3M5VA 4IXHA 3B05A 5KZMA 2AAMA 3W1PA 3EX1A 5HMSA 1B4KA 2Q8ZA 3MHFA 4NX5A 3LTSA 5K9XA 3RFAA 3LTYA 2OCZA 4GNJA 3SZ8A 3W7RA 5HR6A 3MHGA 4WY0A 4UMAA 2J27A 2E6YA 1TV7A 1XM3A 3P82A 4UFMA 3RNDA 1W5MA 3CM4A 2ZRYA 3FJLA 4DXVA 3MP5A 4RR4A 4O50A 3EKLA
chains in the Genus database with same CATH superfamily
3VFLA 1CEOA 2J4GA 1KGUA 2GQ9A 4MB3A 1ENUA 3U6WA 3JU2A 3FS2A 4F2BA 4C6DA 4UFKA 2JQXA 4XB3A 3DG3A 4MUZA 1D2KA 2V2CA 4Q8QA 3T40A 3PZMA 3VZYA 1JCNA 3M5XA 3SRKA 1J2WA 3CMJA 1JZ3A 1RJRA 2OSWA 1EF3A 3A21A 4AMAA 1GYLA 2VTFA 4OZOA 3FHAA 3PJTA 1W3KA 2GVYA 4EWJA 3IUDA 1IR2A 1SJAA 2ZICA 1XYBA 1Q7ZA 4B5XA 3WNPA 3C2VA 2D73A 5LNWA 4GOAA 3NCOA 3WQPA 3AWOA 2A21A 1YX1A 3TC7A 4AF0B 3J7HA 3OO2A 4ZB2A 1A49A 3TCEA 4S3DA 1QI0A 3W6MA 5I06A 3PBVA 1C9DA 1NU5A 4GVFA 1CGUA 1CGWA 4JYFA 3B8TA 3M44A 1B1YA 4QAIA 4MM1A 1TV4A 3OG3A 2J75A 4NNCA 3R58A 4O17A 1VEOA 4I8YA 2VGBA 1JD7A 3LCXA 4X3ZA 5D38A 5A8PA 3AUOA 3Q94A 3W25A 4MSSA 4KIEA 4RE3A 2CHRA 4L5ZA 4JHOA 1JUKA 1J79A 2VXNA 3PG8A 3QR0A 1O68A 1KRMA 4AYSA 2GLKA 1VEMA 2E9BA 3L4ZA 1B90A 3SY8A 4JKKA 4LV9A 4D71A 3MO4A 4M7SA 1SFTA 6A3HA 1KM6A 1ICSA 5CC6A 4IX2A 3NOEA 4J3UA 4D72A 3CIVA 4XO6A 4YPJA 2YA0A 4QE5A 2GUUA 1D3CA 3P5YA 2E09A 1Z48A 4I90A 2H9AB 3WF4A 4A21A 2E67A 3PUEA 3SRDA 4TTUA 4ZCWA 4E2OA 4F2UA 3NQAA 4H19A 3OYZA 3WMLA 2ZUSA 4I3GA 3GHUA 1TRDA 3ME3A 1SUXA 5A2BA 1LWIA 4AEOA 4RW5A 4RDZA 2GQ8A 3ZSTA 1Q2SA 3F4VA 1MNZA 1EC8A 1FDZA 5FSEC 1NELA 3V36A 4QAWA 3GNOA 1M5WA 3V7PA 4WEVX 4YMZA 4BA0A 5AHIA 2VCBA 3DI1A 5C71A 3ANVA 1BLIA 3WO8A 3WQOA 4NJHA 4U3AA 3NL3A 1R7OA 2BP1A 2W9MA 3U2CA 3FX4A 1B2YA 4HOZA 4U31A 2OB3A 1YPFA 3JVAA 2PF8A 4C6MA 3ITXA 1XBZA 5EL1A 4AHOA 3UJRA 1H5YA 4CN1A 3S2MA 1VFUA 3RR1A 3RPDA 3BO9A 1UWIA 1DKWA 1E1FA 1R3SA 8TIMA 2R1MA 3W7KA 3IIVA 4D6IA 2YDRA 3WEOA 9XIAA 1WXZA 1W8GA 1WYIA 2Y5JA 4B4FA 1ME7A 1US2A 4WZHA 1P5BA 2WKGA 1EJTC 4NI8A 4XWUA 2OG9A 1I2NA 4GPNA 3UF9A 1FUYA 1W1B1 1Z69A 2WLZA 2PWDA 5F2GA 3I68A 4UFIA 3VPLA 1S3TC 1ADDA 1ZAJA 2ON3A 3W81A 1VPYA 3EXSA 3PPFA 3WLQA 3TAOA 4QTGA 1P0EA 1SZEA 2NSXA 1XSKA 3LHYA 1H7RA 4UBPC 3KWXA 3AALA 4TV5A 4F2TA 1FY6A 3PR2A 1GZJA 2HTMA 3P5ZA 4Y2WA 3GH4A 1MQQA 2CBUA 5BXPA 3W2UA 1GT8A 3EXTA 2OFJA 4WKFA 1Q5MA 2ACRA 1JZ7A 2WB5A 3ARRA 3TWBA 2PC4A 3A5VA 4DAFA 3VNLA 1OFOA 3WYZA 1ONRA 1EO7A 4HMDA 2EXOA 2PBOA 3ABSA 1OCQA 3Q58A 3MCNA 4BI6A 5DX7A 3K8MA 1VKFA 2LLEA 1TIMA 1AQ0A 4AD0A 2QV5A 1A4LA 2PDGA 1EKOA 1E43A 1RUSA 1X6LA 3QV9A 2GUBA 3ARXA 2VDHA 3P74A 3PUDA 1B3OA 1O6IA 1HP4A 3KVKA 3TW9A 2F2KA 3MUAA 3THUA 3QBUA 5AZ0A 1UC4A 1QHPA 1RV8A 3TONA 4WRHA 5REQA 4G5DA 4KQNA 4QSFA 3IVSA 2VOMA 3W7JA 1LRQA 5FF4A 1XIBA 2CHNA 1YEYA 5I0DA 4TQTA 2J7HA 2YYTA 4HYWA 1CX9A 3SSZA 3KOYA 4S3KA 1HGWA 1KXHA 3TEVA 1V3IA 1D9EA 3BOFA 4FNTA 4AY1A 3AIUA 2QPSA 2SFPA 1JNDA 1RJPA 4HKPA 5IBXC 3W88A 3ZFHA 1DJYA 2CIPA 2D3NA 1A5MC 2YGYA 4RV8A 4HCDA 5MKGA 4IL0A 5M03A 4O52A 2X05A 1QVBA 3HPSA 1SFJA 3W84A 4RL3A 5EKYA 1XR2A 5CCZA 4GI8A 1MUMA 1P0DA 4MAVA 4WCJA 5HBFA 3PF3A 4EACA 5AZ1A 2B7NA 2I16A 2WSRA 3MYOA 1E56A 4GA8A 3UXKA 4KEVA 1VFMA 3LI0A 1EBHA 3A24A 2NXHA 3P60A 5GJPA 2W0UA 1FFRA 2J6XA 1S2AA 3M41A 4J2PA 4IOTA 4PCNA 1IGSA 2V5DA 1XYAA 4C6PA 3FJNA 4HZ7A 5JUVA 3D3FA 2IW0A 2YBVA 1K7EA 4ZODA 4ZB0A 3E96A 2VX4A 1LTDA 2DQWA 1K4HA 5G1YA 4ZFCA 5I3DA 1B3WA 4KEUA 2X7WA 4REQB 1CGTA 4YIWA 1WO2A 3GUWA 4X61A 2ZUNA 1OYCA 4HNUA 3OLIA 4OECA 4DI9A 3MWCA 4JEJA 2YL8A 3F2DA 4GFSA 4MHBA 4AZIA 2QUVA 3LZ5A 3V1PA 1XDLA 3K8LA 4D8ZA 1FCUA 1BHGA 1CECA 3F7JA 4G56A 3KOWA 2RDUA 5G2WA 1KBLA 4GFIA 5C5YA 3ITCA 2VEGA 3NGJA 3QV6A 3GTFA 3WK0A 2WCAA 1XIEA 1GJWA 1P0NA 1K77A 3CMGA 3KRBA 3WQFA 3NTYA 1AW2A 1GORA 4PTDA 1YKWA 4LS2A 1RA5A 4C91A 1FHVA 1V03A 4WSJA 1TTIA 3R10A 4J1OA 3QPEA 3EB2A 4LRTA 2POTA 5LNUA 1BVZA 1W5OA 3RMEA 2BNJA 4HPJA 4F3HA 5FJIA 4M1RA 1GGOA 3WQWA 2ISFA 2G3MA 1XC4A 2QKFA 1UUOA 2O9RA 4JX5A 3KRZA 3KBSA 4XBJA 1G69A 4BHYA 3M0MA 3BZGA 4OTKA 2PWFA 4UQAA 1MUWA 1UQZA 3SCUA 1TJ0A 3SGGA 1XCWA 1SMDA 4AVOA 2A7PA 2CKRA 5LNVA 4MJ4A 2GSJA 2VOTA 4WXZA 2Z2BA 3GDKA 1MVYA 1ICQA 1Q6QA 4PMUA 2WPGA 3KZPA 1PZ3A 1MQRA 3LRKA 3HMCA 4PCFA 3ARUA 4H2HA 3TQKA 1J96A 2BFGA 2WHJA 3KTSA 1A5OC 2RFGA 3TFXA 4F40A 3FV9A 2V3FA 5M2FX 1HNYA 3BC9A 1DWIM 4GI4A 3P62A 2WZMA 3B9DA 4IPJA 1AZ1A 3LMZA 2MUCA 5I23A 1JYXA 2W91A 4GZEA 4W87A 2Z00A 4AF0A 1FWFC 1LF1A 3FK4A 3S1VA 1TREA 3AJXA 2Z6IA 1MZRA 5G1TA 1E9ZB 1AW1A 3HF3A 3TJIA 4IPNB 4L65A 5DT7A 9RUBA 1D7KA 2VFGA 2AQWA 3W7MA 1JXJA 3CWNA 3PSWA 2BHZA 3GM8A 4DUWA 2H8XA 3NPVA 4Q8MA 3AXMA 4JQ1A 3NYDA 1THFD 3GXPA 3G1XA 2XWDA 3T07A 1VFTA 5K4ZA 1E72M 2BOEX 3QM3A 4LJ3A 2Z1SA 4OBTA 1T99A 4GBUA 4EPDC 2E7FA 3AYSA 4LVAA 2CLMA 1EA0A 4BF9A 2DW7A 1TVPA 2CW6A 4RZ4A 1TIWA 3AU2A 5EFDA 1LORA 1LLOA 2GJRA 3MDUA 3GXNA 4U3CA 1WDWA 4UFHA 3UWUA 3GZAA 2OVLA 1XIHA 1G6CA 2ZC8A 2D0FA 2E28A 1UR4A 3B0PA 1ZUAX 1M01A 3TLLA 1XLFA 4WY0F 3UEQA 3GDLA 4AZ5A 2H9AA 3G5EA 3SM0A 3FKKA 3PY2A 2Q6ZA 2PTYA 3VD7A 2D2HA 1B57A 4J3XA 4ATWA 2NUXA 5JH2A 3P8IA 4ZTXA 4QSHA 1W32A 1UZHA 4C1KA 3CT2A 2QIIA 1CXKA 3M43A 1CNVA 2C1GA 3GW3A 1ITXA 1VYRA 1QW8A 3D5HA 2GVJA 2WHKA 1VQTA 3P81A 4JTRA 1QAPA 1XJBA 1V79A 2QDDA 4I5UA 2ZUMA 3RJYA 2WVUA 3ZO9A 2QCLA 1YBQB 3NJ3A 1C8QA 3LD5A 2J7CA 3VNKA 2C6QA 1E0XA 4WGHA 4W7UA 3T0DA 4I9TA 1GTHA 4E38A 5M1TA 4JIHA 1YXYA 3G77A 1H7NA 3N13A 4A29A 1L6YA 4AD5A 1O12A 1QHOA 3VGEA 5C8BB 2BGNE 2G50A 5HXMA 5BMXA 3NPUA 4GXMA 1A5CA 4DVOA 1PDYA 1XYCA 3A4AA 4QLKA 2D69A 1ZENA 5KZ6A 2G97A 2OMAA 2FVLA 4GJJA 2XUCA 1VEPA 1K7XA 1PZ1A 3GKAA 3LV5A 1V02A 2FZDA 2PTDA 4JNZA 3W3OA 2BY2A 1S46A 3R0UA 3PPGA 4G1NA 1GVYA 4Q7BA 5I07A 5HMFA 1E1CB 1U83A 2BOGX 1GJUA 4C6IA 1K9TA 4M24A 4CN4A 3IRDA 1GOOA 2HBXA 4US5A 1UR1A 4L6DA 5FCZA 4C6JA 4TMCA 3E3HA 1RD6A 3AC0A 5AY7A 4KESA 2IQ0A 3DKLA 3PB2A 4FF7A 3CO4A 1RJQA 3C2YA 3OVRA 2PBGA 1HJUA 3A4XA 4UMBA 3WQ8A 1Q8JA 1QASA 3WH9A 2WBGA 3JR2A 1EGMA 1EDGA 3AHZA 4O0KA 3M0ZA 1VHNA 4PB4A 4JIQA 4WOQA 5FSDC 4HT3A 2RDXA 7TIMA 1TX0A 1VRDA 4GGBA 4LAOA 1V6YA 1UQYA 1BD0A 4WOZA 3TYBA 1X96A 5KITA 3KOXA 1QK2A 4TVUA 5CSUA 1AQHA 1TMLA 4U4MA 3AXHA 1KWKA 3W7HA 3APGA 4Z1YA 3C2OA 3K1DA 2VFEA 1KFCA 3I3EA 2NZLA 3VX0A 4MWAE 1V0NA 2GZXA 2Y7DA 1A50A 1BVNP 1ZU8A 4Z1CA 1XPYA 4O18A 5EFFA 3VKAA 1O5RA 4JOMA 2G95A 3RMJA 3W7LA 2BODX 3EOSA 2OWWA 1BFNA 3BMXA 2QJGA 2Y63A 3VCCA 3WDQA 3MV01 1EO5A 2YDQA 4PB5A 3FA4A 3VNZA 2WJFA 4TXEA 3S6TA 3WH8A 2OGJA 4MPQA 1FXQA 3EPNA 1HKMA 1UWUA 5XIMA 1Z6KA 5BWFA 2A7RA 2AGTA 1F6YA 3EDDA 2CETA 1PS9A 2ZKMX 4HYVA 4GIYA 3KZSA 4C7DA 1J12A 1LZOA 1MW0A 4PMRA 2V5KA 3EX6A 1E6RA 1UD5A 1W3IA 1I4NA 1ZP3A 2A3EA 3DOPA 3CZ8A 3TXVA 3OB8A 3C0JA 5EMUA 5JBDA 1J0JA 3W73A 4DBDA 1X98A 4X22A 1V3MA 3TJLA 1ISZA 1XIDA 3Q67A 3W1LA 3W22A 3TA6A 5HOSA 1SMAA 3GNDA 3I3BA 4F9DA 1W56A 3LCGA 1EL3A 4Y9PA 2YCLB 4AWUA 1YTDA 3N2CA 5D9OA 2TODA 1PCWA 4DNMA 1VYPX 1XKJA 2ZWZA 1IR1A 3R0DA 2INZA 3DYMA 1S5MA 4C6QA 2E5CA 1F05A 3GWQA 1JZ8A 4YS1A 4Y6GA 5RUBA 1XLEA 4LVFA 4JQ3A 5XINA 1UR2A 4GQGA 2NUYA 1I2RA 3E74A 3SQSA 2B0MA 1E0WA 3RF9A 4DUVA 1W37A 2IPJA 1B3ZA 2D3LA 2QR6A 3G3DA 2QYGA 4REQA 3T7VA 1XP3A 2EJAA 4MB1A 2NX3A 1L6WA 5E09A 4AEFA 1NY1A 3VA8A 5D4YA 3TTOA 1R86A 5D37A 4L1WA 4FSAA 4GHRA 1A5SA 2V81A 2ZUUA 3TNOA 5ABGA 5IXEA 1H3GA 4QITA 2FVKA 2E5BA 1SZRA 2NLYA 4QFUA 2PDFA 1XSJA 3W7QA 2PD5A 3IGSA 4IQJA 3R12A 1DWJM 2INFA 4NJIA 3ZR5A 4AWEA 2YBUA 2ZZ1A 1IEXA 2MNRA 4MNMA 3MTWA 2XFYA 4KIRA 2FZNA 3FEQA 3F2CA 4WDUA 3NQ6A 4DJFA 4C6EA 3E38A 2X1UA 4YVVA 4EANA 2FB3A 4CQ9A 4D6GA 1SGJA 3VDCA 1EX1A 2PA6A 1MXSA 1KBKA 2Y61A 3PP7A 1AMYA 2C3ZA 5DN1A 3NZQA 2YIHA 3GE7A 5HDRA 3CC1A 3WX7A 3XISA 1ZBKA 2GJNA 4Q4OA 1W8SA 1HJVA 3VM5A 1V4YA 4EXBA 2PWVA 4TMBA 4AHQA 3H2OA 1MXGA 4LNCA 5IOBA 1UASA 3H4XA 1TJ1A 3B8DA 1EA9C 4B2DD 4JS3A 4M51A 2QCNA 2BHUA 1I0BA 4JICA 1JYNA 4GUJA 1Y0EA 1Q6EA 4L4MA 4H8HA 2E77A 4IQEA 5U7SA 2Q8XA 2QCMA 1KC7A 1MXDA 2OLAA 1TZ9A 1VHCA 3GKFA 2NV9A 2IKIA 3BICA 3AICA 4O1DA 4YU1A 3H4GA 4HOWA 3GAKA 5CSSA 5CBBA 3URQA 5IDIA 3GG0A 3RCYA 5F2MA 4HP5A 3EA1A 2WANA 4NZJA 1KO0A 1KQZA 2J6VA 1A5LC 4GC3A 1YTKA 3W72A 2I14A 3WG6A 4M19A 4F9JA 1OC6A 3M6YA 1T0OA 1UW9A 1AQFA 4KERA 3A12A 5AYBA 4K3ZA 2WAGA 3I7RA 1LP6A 3P3BA 5D09A 3S5SA 3WLJA 3LXBA 2CLKA 1UKSA 4N42A 5CAKA 3GXDA 4DEFA 2ZA1A 4OJYA 3IVTA 3FSUA 5C9RA 5D8ZA 1J4EA 2D2JA 4XG1A 3EWDA 3RPTA 5DO8A 2DH2A 3LCWA 4E5TA 5K4XA 1CBGA 2E68A 3G24A 2WVTA 3W74A 2ADAA 1BXNA 3E2QA 1FP9A 2QV4A 1XCXA 1I1WA 3PVFA 4PSPA 1XRVA 3IAQA 1EHAA 2O4QA 3N14A 4NJJA 4B3LA 2RGMA 5A8OA 1XDJA 1G94A 2YCIX 2OX1A 4MMWA 4TU1A 1IXQA 5AYZA 1F9CA 4GRSA 2XJ7A 1F4HA 1L2QA 3W1QA 2QZRA 2C1IA 2DPEA 4ICCX 4LF1A 1ESWA 1HO1A 4GZIA 3PTDA 1OABA 3RLVA 2ZX8A 1KR1A 1DJWA 3TR2A 5CBJA 2FH6A 4QS5A 1WXJA 4IIHA 3VIHA 3O05A 4EPKA 3BV7A 4QBXA 5I3IA 1V6VA 2OWXA 2FMOA 3QY7A 4HSNA 3LUTA 1KXQA 2EO7A 4XAYA 4Z2HA 4UTTA 1QPOA 1UR9A 1K9DA 1J6PA 2FDMA 4ES4A 3GHTA 1A3HA 1B31A 3FVMA 1CIUA 3H53A 1IZKA 3W00A 5LKYA 1UBSA 4O13A 2WNQA 1E6NA 3PZ9A 1Q8AA 2PLKA 1JGMA 4K7VA 1CW2A 3CNYA 1GOIA 1SYTA 4NJGA 1EUAA 1XLDA 2DZVA 3N4AA 2QHAA 2FTWA 3WQEA 1UWTA 1YBQA 5LZLA 5GQBA 5LNRA 4UWMA 4LGXA 3THCA 2GK1B 1XF0A 2WC7A 1FXPA 4GJIA 3P6LA 2P76A 4JAWA 1O1HA 3KWSA 4J40A 4IPIA 1YADA 3IJ9A 4A2RA 2B7OA 2PRHA 3N18A 4PL1A 3TTSA 1AQMA 5AB3A 4LB3A 4IT1A 5H91A 4TUFA 3L21A 3LM7A 3VD9A 5T26A 2QUNA 4JTIA 3N17A 1TPFA 4OOUA 1OFQA 1WE5A 1K9EA 1GOQA 3WQ4A 2ABBA 4QM1A 2WC4A 4OT7A 2VRJA 3K4AA 2GJPA 1A3WA 2E1DA 3WDRA 1GVEA 3SW6A 5H8MA 3B8WA 3C86A 4JFVA 3UZ5A 4Q8WA 1LOSA 4ZR8A 1NARA 1FWBC 3IV3A 4F8XA 4YWSA 1KM5A 1QW7A 4C6FA 3SEPA 1E1CA 4IFOA 1WBJA 1GQIA 2BGSA 3U4AA 5JBFA 4UTLA 4HMEA 3ZT6A 3IGUA 3U48A 3QRHA 3S1GA 1FP8A 3S83A 3WD3A 4ZL1A 3NPWA 1KM4A 2QCEA 3P0WA 1F61A 2ISDA 1F4AA 1PKYA 4X63A 2A85A 4R3UA 4IXXA 1Q6CA 1Q6GA 2XSXA 2DZBA 4MPKA 2ZRUA 4XBKA 3SCWA 4CCEA 1H60A 2HPMA 5DF0A 1QCWA 3O8AA 3WK3A 4DJED 5D02A 3V75A 5DEZA 3AHTA 4XD5A 3EXRA 4AEEA 1HXJA 3OOQA 3TW6A 3ZJ6A 2GJXB 1K8CA 4ATLA 3L7RA 2DZXA 2FGBA 1JYVA 3WJZA 3N19B 3QZ6A 5G2HA 4OOZA 3VCRA 3OW1A 3W02A 2O7QA 1GOXA 2EBNA 1MDRA 4OBRA 3IJDA 3CZEA 3PZGA 5LA0A 3M0LA 2H6RA 4L61A 1ZSXA 5EBUA 2NUWA 1NOUA 2C1HA 4GG9A 3W1XA 1A0CA 1XRSA 1LOLA 4WIWA 1FWTA 3W71A 1ZJHA 1B0IA 5TQLA 2HMCA 2C18A 2F8QA 1CXHA 5HQMA 1JAKA 4LX4A 3VIKA 4QS6A 3KTCA 3MWAA 2ALDA 3K30A 4CGTA 3L4XA 1JI2A 4GACA 3PBWA 4IIBA 1MUCA 1NFBA 3SGUA 4M6VA 1EJVC 1C8XA 4UR7A 4C65A 3AYVA 4OUIA 1E9YB 1GZGA 3CU2A 2F84A 2QCFA 3R25A 1SSDA 2R8WA 1VPQA 1EQCA 1B3VA 1FWJC 4HZ6A 1M7JA 2YCLA 1QOXA 1P48A 4HNNA 3WNKA 3EKGA 2Z27A 5DMMA 1UCWA 1JFHA 1VFLA 1PWMA 1GVSA 2AMXA 3TP4A 4TV6A 1V3LA 4ZO9A 3M7SA 1Z41A 2ABAA 1M7OA 4AH7A 1QNRA 4JFWA 3ZS4A 4OHQA 1BPLB 3HG3A 4QX4A 3CHVA 4XZ9A 1JF6A 3OYXA 1JIBA 4AIEA 1ADOA 4ZO6A 4FLSA 5I7GA 4CVWA 1YTEA 4LCQA 5LNSA 5KETA 2V67A 1NF7A 4HN8A 1H0IA 1EGZA 3VNJA 3W2LA 3L5AA 1J18A 4GIRA 1QPNA 1FWHC 2ZDSA 2O7SA 1IT8A 1LYXA 3NDZA 3RLUA 1MW1A 1JYWA 2HROA 4JN6A 3V18A 2E6DA 4JNYA 3C3NA 3V5FA 2O0TA 4NRSA 3AFBA 4C5YA 1YPIA 2X16A 3REQB 4Q8OA 2G3FA 4TIMA 1FH7A 4RNIA 6CGTA 4MWAC 2JF6A 3FOKA 3TC6A 4Q4PA 1OD0A 3W53A 5G5IA 1E15A 2ACQA 4BWLC 5A6TC 3KDOA 4HMCA 1UUQA 3LBMA 3OGRA 5F1VA 4JL2A 5LA1A 3UR5A 4MUPA 3C4UA 3GFYA 1UROA 1R9ZA 3UD6A 3DYOA 3H26A 1ZGDA 1Y65A 3ZLFA 3CUZA 3N11A 3DEQA 3SCTA 3DFQA 3M5VA 1KGWA 3ARQA 2P5NA 2XG9A 4WF7A 3KP0A 2JIEA 5HMSA 3CJPA 3BSMA 4RE4A 1W1VA 1ELSA 3VM7A 1CB2A 4ZXLA 3RFAA 2OCZA 3UJEA 3W7RA 4H9TA 4GZJA 3H24A 4UMAA 1TV7A 1UG6A 3PPCA 3CM4A 3B9OA 3FJLA 4DXVA 4O50A 1XBYA 3U3HA 1TMQA 4FIQA 1WXYA 3AYRA 3RYSA 3MQTA 1AZ2A 1ML1A 3LCLA 3WFLA 4A8IA 4BEUA 2DFAA 4YN5A 2XM2A 1Q2RA 2Z24A 3P14A 4I9JA 4Y9MA 1GKQA 5EMJA 4W89A 4C6BA 2PLJA 1YYAA 1W31A 3UA3A 3S6DA 3VDHA 4BQ3A 1E6SM 3BG5A 4AC7C 4K8HA 2I17A 1QNOA 5DMYA 1IWBA 3ORWA 1A5BA 4C6LA 2PGWA 3DYPA 2JF7A 3B4UA 1WOAA 1O94A 1EZ2A 4AXKA 1SFSA 1WDPA 3MZNA 3CL7A 3E9AA 5CC3A 1SM9A 1UZDA 3PFRA 4JCLA 1F76A 3ZLGA 2CZEA 5AHLA 3SUSA 5ABEA 1I60A 3B0VC 4YTQA 3WLHA 3R5EA 1F74A 4F4RA 1DXEA 3IIPA 4GX9A 2H3BA 2ZA3A 4B5WA 3CS2A 3VGGA 5KSWA 4N6EA 4V28A 3UWYA 3O6YX 5T91A 1M03A 3LHTA 1JVNA 4RE0A 4PCSA 3QC3A 1X38A 4XISA 4DYJA 1ONEA 4DF1A 1O5XA 3APYA 1LG2A 1CXEA 1JUBA 3EDJA 3EKZA 4GNKB 2Y70A 1XLAA 1LWHA 3W24A 1PCKA 1TMHA 1X1NA 4IISA 3WF3A 2FVMA 3MHUA 2WOQA 4PUJA 3MBDA 3N6QA 3DGBA 1QW9A 4LNYA 4DAIA 1RCOB 5DXYA 3NQEA 2W3ZA 2E3ZA 3NQ2A 1HF6A 4F66A 4O4VA 1VGAA 4E4UA 1S5TA 1HN1A 4RNFA 4P7LA 3ZZ1A 3H21A 3LSBA 2HZGA 3M47A 1UH3A 1ISXA 2Y5SA 4WDXA 1IWAA 1A80A 2XVLA 2OODA 4P8WA 4H00A 3WQGA 1RXOB 4XIMA 4D6JA 4AHPA 4D6EA 3CBWA 1XDMA 3ZOAA 3TX9A 5J8LA 1GK8A 1XH2A 4PRWA 3EMZA 3N4FA 4BS0A 1KCKA 2JKPA 3E12A 1VFSA 3I65A 1V93A 3LZ3A 2YPIA 4Q22A 4W5ZA 2RJHA 3WJYA 2GK1A 2OZ8A 2QPXA 1YPXA 4ZOBA 2A79A 3LX9A 3PBYA 3HGOA 1AJ2A 1VD6A 3ABOA 1E3XA 2PU0A 3MI3A 2B7PA 4P61A 1R2TA 2FZMA 3GNRA 4ZQPA 1OSEA 4ZOEA 1G1YA 3QQ0A 2QJIA 4H6EA 2ACSA 4RPPA 3RXZA 4NL1A 4ZBCA 2QJMA 3OBKA 5DQPA 2ESCA 3PS7A 4PUEA 4V27A 3GH5A 2VR2A 1EUNA 3M0IA 5I6SA 3SO7A 2WMJA 1TFVA 1WKEA 2ZCGA 3DU0A 4GH3A 1FWSA 3PWGA 2XDFA 1VBHA 2ISWA 2J88A 2I5GA 1OFDA 2YW4A 4UUIA 2Z26A 7REQB 2ZZ6A 4WSKA 1EC7A 3R13A 2Q71A 4EXAA 2ZXBA 3UG5A 4RE2A 3M5ZA 1EJWC 4GYPC 3DHDA 3V3WA 4M29A 2CPUA 3AIWA 1BVWA 3WQ5A 3KXQA 3BLOA 4QLLA 1TRIA 3RO6A 5CJNA 4WJ8A 1QK0A 3PZIA 2GOUA 2ZE0A 2D0HA 3VUPA 5EMYA 3G1VA 2O55A 4KETA 2W63A 4HIBA 2C13A 1I9CB 3TYCA 1TWWA 3PG9A 1TV2A 3A13A 1NWTA 2V5LA 5A6KA 4BQ2A 3QC0A 3EMCA 4HNTA 5EU9A 3LERA 4UFJA 2DIEA 1JNEA 2WJEA 1BSLA 5F1UA 1NFGA 3PAOA 4AIOA 1UR8A 2PTWA 1GW9A 4CD5A 2GJXA 1CI1A 2W92A 4KRUA 1BRLB 2I5QA 4ZE5A 3RCNA 4GGHA 1E6XM 4JHMA 1ZRQA 4F0MA 4HA0A 4N7QA 3W1NA 5G4HC 1UKQA 4FEZA 4DQWA 3N34A 3NO1A 3TFCA 3FNDA 4L9XA 4IG2A 1WKYA 1GQNA 1VBUA 3GG7A 2TPSA 2R9RA 1C29A 2Z0IA 2QPUA 4MKSA 1JDCA 2VO5A 1ZQ5A 3VE9A 4QNEA 3U2EA 1UP0A 3UWEA 2BY3A 2F6UA 2ZUWA 3WJWA 5IBXA 5SWUA 2EG8A 4ALDA 5T8GA 3N2OA 1XLKA 1UA3A 3D0CA 1V51A 1RA0A 1Z7AA 2C71A 3MUIA 1M7PA 1IXOA 1WX0A 2CWXA 4HPNA 3CT7A 3OIHA 2ZZ3A 3UVIA 4GUGA 2FZBA 3R8GA 2PF0A 3W6LA 3I4KA 1OFEA 3M64A 3W82A 2JGQA 3W23A 3M16A 1ITUA 4KWWA 1TE1A 1O4UA 4JTLA 3TOYA 3HN3A 1K6AA 1MW3A 1UWRA 3CUIA 2CLLA 3DERA 4J3WA 1ZHAA 2WK2A 3BH4A 2XN1A 3S6OA 3BAXA 3E6EA 1J5SA 4AU0A 1BTCA 4K38A 1TELA 3VIJA 2WMIB 5HATA 2P50A 1I75A 4AZCB 3RILA 3B04A 2BLEA 3A4JA 2NXGA 4CN6A 3GC2A 2GPTA 2GGIA 1Q63A 4E4PA 1Y5XA 2PE4A 1QXLA 4LOCA 3XINA 3B8UA 1ADSA 3HZ3A 1E4LA 3RDKA 2O9PA 5LIYX 3KTXA 1VIZA 3R8RA 4ZVJA 3LNPA 3NXLA 2BOFX 2HVOA 4NQ1A 3WLIA 6REQB 3VNIA 1DOSA 4YYFA 5LIKX 1JQVA 3ZXWA 3ARVA 3SFKA 3H8AA 2XFWA 3TCSA 5BYWA 2ISVA 4H9UA 4IZGA 1PUDA 5JU6A 4ZQCA 3VOGA 4DJDC 3OZYA 2VD9A 3WQVA 1YMYA 4DIAA 4JTQA 1CLXA 2EPOA 4G2DA 4N4PA 1KFLA 2JALA 4MTVA 4FXSA 4Z2IA 4W85A 3TYAA 2PURA 5A69A 1SJBA 3TAKA 3UPWA 4LANA 1XUUA 3QHNA 4UNKA 1GJPA 1OB0A 2UY5A 2OKOA 3R79A 4H8UA 3P0XA 1S3HA 3CHFA 2R14A 2PDIA 4IMGA 1DEDA 4FS9A 4GY0A 3M46A 4LUTB 1RBOB 3HV8A 4J3TA 3KE0A 4HN4A 4MF4A 5D9NA 1PHQA 2G3JA 4IWWA 3VKKA 4XVDA 1ZS2A 1R3WA 3TYDA 4YTRA 1D8WA 5HR7A 4TTGA 3F4CA 2H8ZA 4EWND 1XBVA 1LOQA 2A3BA 3UXIA 1R3VA 1TPUA 2FPYA 2I56A 3B0YA 2PDCA 4EK7A 4WD0A 1MFVA 3CQHA 1E55A 2YFNA 1C7SA 2C16A 3K46A 4EP8C 3PJUA 4IHCA 1DQWA 1ONWA 3KW3A 2ZTKA 2R1PA 5BNKA 2EG7A 3KS6A 1QPRA 2GFTA 2OLSA 5PTDA 1LBMA 2XFFA 3LI1A 2L5HA 4KRZA 4LYRA 5CLTA 2FPTA 4X60A 5I77A 4L56A 5F2LA 2OZ0A 1UZ1A 3FJ4A 1W9VA 1XI3A 4XQ6A 1QBBA 3W75A 1IEWA 4HJFA 3UY8A 3IK2A 4LEQA 3KLKA 2C0AA 1PB0A 4FHAA 1DPMA 5I79A 1HTIA 3OVGA 1X39A 4AW7A 3W01A 4M5PA 3NGFA 3FAXA 1A53A 1PV8A 4HQVA 4S2CA 4WK9A 3WNOA 1PTGA 1RPKA 3UPMA 3SCNA 2GJLA 5GJMA 3ZMRA 2CLIA 3O0FA 3WDHA 1MZHA 2PEVA 4UQ9A 4N4QA 4ZE4A 4WXYA 1HW6A 3UR2A 3BLFA 4QQ3A 1QU4A 4KW2A 4IGHA 4MFDA 1BF6A 5A6LA 2CITA 4GYKA 4DBEA 3ZT5A 1QUMA 1QI4A 1PVNA 2C15A 2IKHA 4K36A 4US5D 3QV7A 4ZMGA 3O07A 4XD6A 2NQHA 1EP2A 1EEPA 4GVGA 4AWTA 1SO5A 2IMRA 2JEPA 3W26A 4PB3A 4KFOA 3B97A 1SZFA 1GKRA 3HQNA 4I7UA 4AIUA 3MVIA 2YYUA 3FY1A 2FLIA 3PULA 3WNNA 3VDAA 4NJKA 1CLVA 4Y90A 4ENLA 1UIPA 2DJLA 1T41A 1SO3A 1DTUA 3IGHX 5AC6A 5CGMA 2RKXA 1EQPA 3EDEA 1MQPA 1UUMA 4C6KA 3TU9A 3OPSA 2HRWA 4B2DA 3MI2A 4GZ7A 2Y8UA 2GSHA 4NZ4A 3TTYA 3MI6A 3UZYA 3VD3A 3IGXA 3FA5A 2J8FA 4CNOA 1R46A 2O9TA 3W7OA 2XVKA 1MMFA 2G41A 4R7OA 1GVOA 3KCLA 2YCJA 2DZPA 2VX7A 1PEZA 2I9UA 4ICMA 1H09A 1UKTA 1QDSA 4X9YA 5I3HA 4HA1A 3IEBA 3PTQA 4V15A 2DZWA 5HNTA 3A64A 1M9HA 1DJIA 3I6EA 3GU2A 1VJZA 4I9AA 2J7FA 4HSOA 1PZ2A 1F3XA 3B8SA 2Y7EA 2JFEX 4IICA 2CEQA 3HU7A 3OLDA 2ZQ0A 2XIJA 4IL2A 4LUJA 2PSNA 4FAMA 3KP1A 3H23A 4ICNA 5F4WA 3R1ZA 4MKVA 3SQLA 4PMVA 1VIWA 4WJXA 4IQLA 4MNLA 2X7VA 4Z42C 2CYGA 4Q4MA 1TVNA 1KRBC 3LDVA 5M5DA 1C9WA 5F4SA 9XIMA 5I3KA 1IHIA 3L23A 3UXDA 5A5WA 4DELA 2EGZA 7REQA 4Y9NA 4QE4A 4JTHA 3IS4A 4I5XA 2WMKA 2ONEA 4B5NA 4C7FA 2EJ1A 2AL2B 4ZGYA 4NHVA 1EWEA 4PFMA 3BGGA 4K8EA 2OXNA 1UJPA 4JIIX 5FF0A 4AQLA 4RZ5A 3RM4A 2QJHA 3PNZA 3IJ8A 3KCJA 3LQLA 3M0KA 3W86A 2EPNA 3A23A 3G3MA 1E71M 1TVLA 3KVLA 3EDFA 5F7UA 2OO6A 4Y9OA 5JIWA 1S5VA 3QMRA 1XHGA 3I6RA 3GTIA 2NQZA 2WQDA 1GNXA 1OZQA 1FBAA 4R9XA 1UBPC 5BMWA 5A6JA 3GXMA 6ALDA 3MV11 3BAYA 3NO3A 4HPGA 3FXYA 2Y2WA 4B5VA 4YVXA 1N8IA 1EPXA 1LRNA 1IEQA 1GYNA 4AD4A 3CTTA 4UR9A 4DWSC 3QFEA 1IE7C 1P6WA 1BRLA 4JL1A 2PGRA 3CGTA 4BZYA 3NURA 3C0SA 1MFUA 3CHEA 4IQDA 2HPIA 4TO8A 3V1HA 4W5UA 2HEJA 1T6MA 3GVVA 1JG9A 4TVCA 4CCZA 3PZVA 5CPMA 2VL4A 3G8EA 2VFHA 4LUSB 1RPXA 2G4FA 4RNJA 1VFHA 1HKIA 2VDGA 5E93A 1RVGA 2HCVA 1W9PA 2DT0A 3KHJA 2Y7GA 1DJNA 1WZAA 1HO4A 2X2YA 3W7CA 1F7BA 1GQLA 2JK2A 4GCXA 3K2GA 2IS7A 5E1QA 2OLHA 1TTPA 4X2PA 3CHDA 4D2JA 1YQ2A 3MSGA 4CEUC 3ZVHA 4DB7A 3UYCA 1KLZA 2OGYA 1NDYA 4JN8A 3L9CA 1V3JA 5C7HA 1B3YA 1ME8A 4KKXA 1TQJA 1KFWA 2VGIA 4MKNA 4A8NA 4PTMA 2E6AA 4DZIA 1FWGC 5H8PA 1RD5A 2YXXA 3VO0A 2WCSA 3RU8X 3W38A 1HL8A 2VZVA 3ABZA 2OOGA 1VAHA 3D6NA 3SN1A 5MKGB 5C9WA 3LPOA 3DHPA 4OV4A 2YSWA 1EB3A 2R1LA 4ZTYA 2DZAA 3AXXA 3H2CA 3LGGA 4Y8EA 1TG7A 2QGYA 3RX3A 3OGVA 3CH9A 1DXIA 4LVBA 1XGEA 4HU4A 3GO2A 4Q6JA 4AZHA 2Y4SA 1E1EA 3WFAA 2VDIA 4IFKB 2UZ9A 4IX0A 1CENA 2CBIA 3PPHA 1KBIA 4LALA 4AZCA 1ZB5A 3FKRA 1TZ7A 3NQDA 1PHWA 3MC5A 1ZLPA 5TBOA 2XZ7A 3ZR6A 4JKLA 4IFRA 4FNUA 1Q7QA 3OLGA 3LN3A 4WKHA 2DSZA 5CPTA 1XG4A 3AIVA 5FEWA 3F5LA 1K8YA 2AL1A 4YCOA 3QR1A 1XYMA 6PTDA 2NVDA 1WOBA 2ZRVA 3C2FA 5E6YA 6REQA 3IJ6A 1RCQA 3BW3A 4MWAB 1H7OA 5D9MA 2EPMX 3R11A 4LF2A 3WL0A 5CZ0A 1TCDA 1XIJA 2BDQA 2DVUA 3ZIZA 4YTTA 4LBSA 1F2JA 1EDQA 4JTFA 3BSGA 3FN9A 4JX4A 3DC0A 4TX9A 4CNTA 1XYFA 1ODZA 3MUXA 3NQFA 1EP1A 1R47A 3KLLA 3TNBA 2VZTA 3EX4A 4O28A 1S2WA 3BAJA 1F07A 3H6OA 3OGSA 4R34A 4XD3A 1JCXA 3WQCA 4IIFA 4KGJA 3NIYA 3WKZA 2UWFA 3ELFA 3W1TA 3WLTA 1TV8A 4HHMA 4LUTA 3K1GA 5CG7A 1T8XA 4DI8A 3SJ3A 4Q33A 1IF2A 3LNMA 4UQEA 2V3DA 1TWZA 4XSMA 5HPOA 3IK4A 4CNUA 4BF5A 1CT5A 2FJUB 2WBKA 3GDBA 4KS0A 3W1MA 2BXVA 2VC5A 1JF5A 1Z3NA 1XIIA 4WY0B 2ZRWA 3R94A 4DPQA 3VGBA 3LY0A 2ATSA 1QRQA 5FJRA 5I3FA 1U5JA 3L2IA 1ITCA 1ZCCA 1YXCA 4AG0A 2Z25A 2WSQA 1T7LA 4XAFA 1RP8A 3P8JA 1UD2A 1V6TA 2DT1A 4FNSA 4GE8A 4K37A 4GC4A 2PWUA 4Z1BA 1EIBA 1HGYA 5I02A 2V2DA 2HE8A 5IHSA 2YZ5A 2V38A 1TUFA 4NILA 3A22A 4N6FA 4WKAA 1BQGA 3VUSA 4ZO8A 4XZLX 1QNPA 2WNNA 3EWWA 3TSMA 3ABRA 1Q66A 3KL5A 4IMAA 4P7QA 4NYYA 1TJ2A 2YKKA 3VXGA 2Y5EA 4MG4A 4L7ZA 2VEMA 4WVXA 1R3RA 3TDFA 3HQPA 2V3GA 4PBFA 4D6FA 3INPA 4CQBA 5K9CA 3CIXA 3SY5A 2POZA 2A1YA 1HVQA 3QVQA 2FMNA 5A8NA 1F3TA 1X1ZA 4JTAA 3DFNA 3QQ1A 3BOLA 2QXWA 3UY7A 2GDQA 3T0BA 1NWUA 2YR1A 4B9ZA 4N9BA 4O10A 3CYJA 2QULA 1KBJA 4E4FA 1FWCC 1LRTA 1GVRA 1L0PA 4YVPA 1IYXA 1RAKA 2WZEA 4GX8A 1U30A 1J0HA 4WQ6A 1P0BA 3CL8A 3SDOA 1L8PA 1UP3A 3ISIX 5LXEA 3LQGA 1KM2A 3GDMA 2PP3A 3OHIA 4S1FA 2ZX7A 4MZ8A 4OVXA 5CH9A 2EPKX 1OYBA 4QJ1A 3ICJA 4YYCA 4AC1X 3P2VA 2A0NA 3NDYA 4LYKA 1VP5A 1N55A 1W0MA 2IPGA 3DH7A 4M81A 1HJXA 1U5HA 4M3PA 4ACZB 1HIZA 3TKFA 3RITA 4IGMA 5D2WA 3N1AA 1E4IA 1QOPA 2VWTA 1OX4B 1W54A 2R24A 4JY9A 1FCBA 4DN1A 2TRSA 1E6ZA 3CPUA 1QNVA 3WEMA 4JTDA 4AB4A 2Z2UA 3NQ7A 3V35A 4JIEA 3NNTA 5DCDA 1Q6RA 5DBTA 1GVIA 3LMYA 5HUPA 5E5CA 1BGGA 3M0VA 2KZHA 4O14A 1YE6A 4AZ7A 3NZ1A 3UJ2A 1GWJA 2GSEA 3MKVA 1V6XA 2QGHA 1GKPA 3IARA 2HS6A 4HHLA 3H7VA 4XTIA 2XN2A 2VQUA 1CPUA 3O3RA 4HD5A 1PAMA 1QPQA 7ODCA 3T2QA 2QW5A 3VDBA 1R85A 4CD8A 3SRFA 3PJXA 3HGJA 3PNUA 4PTWA 2NV1A 1VBRA 3VNDA 3MMUA 2HVNA 3S2CA 3SURA 4XV0A 1EYEA 1QR7A 4NNAA 4MY8A 5AFDA 3FDKA 1WNOA 1KXTA 3NL5A 4GXWA 5GVJA 1O1ZA 1M65A 3MU7A 4AX7A 3AMLA 4IMEA 4IMDA 3N2TA 2E40A 2PCEA 2AL2A 4JD4A 3LPGA 1LQAA 1OC5A 4H8VA 2WHMA 4EX4A 5D04C 2P88A 4XBSA 1Y5VA 3G0UA 1J2BA 4H9YA 1HL2A 4XTDA 3SSJA 3MT1A 4TX8A 3HIJA 3C61A 2WJDA 3HQ1A 5H6HA 1G5AA 1M04A 5TNVA 3VCNA 3SRHA 3UJFA 4RV3A 4O12A 2CBJA 2XHYA 3DN5A 3P67A 3MMWA 2VX5A 1KCXA 3A3WA 4ERGA 3C2RA 2PB1A 4DUOA 2DVTA 3N73A 4XKYB 1VPXA 2B7QA 3NQBA 4DRSA 8XIAA 2Y24A 4Q4KA 1H63A 1TPB1 4MZ1A 4QNWA 4EIVA 3S5ZA 3G0SA 1WCGA 1OX6A 1Y5WA 1OY0A 2C19A 3VIPA 1LT8A 2PMQA 2W79A 2YXOA 3T2PA 1XLJA 4IMFA 2D1ZA 2PTZA 3G1DA 3BLPX 1WB0A 4LUSA 3QZAA 3EB4A 3GRIA 5KZEA 1Q4WA 3VKBA 1RZMA 1R3TA 2J13A 1F8IA 1EYWA 2CESA 1UZ4A 3H2EA 2IPWA 3N15A 2OQHA 1OC7A 1TYGA 5DFAA 3IIXA 2YDAA 3LEPA 1JCTA 4RDYA 2GQAA 4HCLA 2WNZA 3CAWA 4LC6A 5I5RA 4LTSA 3DFOA 1JUEA 2ZX5A 3FAWA 3CV2A 4AXNA 5EBAA 2FZ8A 1KBBA 3VKCA 4JIPA 3HO8A 4FO4A 4A6GA 2W4XA 3S9IA 4HK7A 4GABA 3S46A 4M6UA 4PMDA 5BRBA 4M8UA 1JJKA 4JFTA 4GUIA 1W9BM 3LYEA 2AOSA 2WNWA 1KM3A 3SECA 4O8RA 1XW8A 4DO4A 4ROQA 3N3TA 2X09A 3NR0A 3BTNA 4FNRA 1XH0A 4ZQNA 4GO9A 4E3TA 3BZJA 2DZUA 1JDEA 3QFWA 1H49A 3QXBA 3TW7A 4J3VA 1A3XA 3BV4A 3CZGA 4QCFA 2DVXA 3NL6A 3T05A 3HG2A 3STEA 1GZ1A 1NP2A 3LLDA 1ZAHA 4IFKA 4WSHA 3O16A 1MEIA 2XISA 3UXAA 5K2ZA 3GYCA 1BF2A 3P84A 4S3FA 2QAPA 3G22A 4HSHA 4A05A 3U0HA 1KKOA 4K1GA 1VYSX 3WUBA 5IRPA 1FHDA 4R5EA 1BWVA 2G0WA 4Z1AA 3SQMA 3AMGA 5I2UA 3E2SA 3DC8A 3NM3A 1M6JA 3TK7A 4Y7EA 4J2MA 3MO7A 4LAKA 4QE1A 6ENLA 3W1AA 2PWEA 2R6OA 4I6KA 5C7VA 4MWAA 1WA3A 2ZXAA 1OK6A 3T42A 4B5TA 3W83A 1DE5A 1I6NA 4WX2A 1NQKA 3S9ZA 1PX8A 4BWLA 4C60A 2X41A 2X42A 4QROA 4S3EA 1YNQA 4Z17A 4PBGA 3U8GA 1K8XA 4ECLA 1R30A 1PKMA 4H7ZA 2XH0A 4LFYA 4U2ZA 4H6KA 2ZUTA 4BK9A 4HK6A 1E6QM 5D33A 4OIFA 1WDSA 3VIGA 2WQPA 2J77A 3G2GA 3RO8A 1XSIA 3NG3A 3M0XA 1A0EA 1TTJA 3CEUA 4L9YA 1PKNA 2PU1A 2OZ3A 2CLEA 2ASHA 4IGNA 5EMKA 2WJZA 4DJFC 1E40A 3GTHA 4Q8UA 2OEKA 3B05A 3QR3A 2VX6A 4HHHA 1B4KA 3MPGA 4AYGA 3LLXA 3E0WA 4NX5A 1G9HA 3OJGA 2XM1A 4GNJA 1Q6FA 1FKWA 3MHGA 1UKOA 3RX2A 1E4NA 4WY0A 1J9YA 5CQ1A 1XM3A 1UR0A 1S2UA 2J7GA 1W5MA 2ZRYA 3NZGA 3DBNA 4BF7A 4RR4A 4H01A 3EKLA 2NW0A 1EJXC 1OYAA 2Z7KA 3BDKA 1W91A 1E4MM 2QUUA 1OX5A 3OU8A 3OZMA 1FWAC 1KNWA 4AD2A 4B3ZA 4M6QA 1NEYA 2XSBA 3KRUA 4PMZA 3H55A 4K7YA 3N29A 1UD4A 1XD1A 3T2OA 3CZLA 4YHGA 1OF8A 3UWWA 3OBEA 2GYIA 2VUNA 3EEGA 5KMYA 2HK0A 1AUSL 2PD9A 3GNNA 3GXFA 1PPIA 3NUKA 4J3SA 1BSIA 4N9DA 1WUEA 1LLWA 1TKKA 1NDZA 3C2EA 3H4WA 3BPWA 2PGEA 2PFHA 4XAGA 3H54A 3QF0A 3FXGA 4BJHA 2PDLA 5FAGA 4QG8A 3UA4A 5DY3A 3BCJA 4H2CA 4HNLA 3W2MA 3L4WA 3OG2A 1SJDA 1LLZA 4NNBA 3PBUA 5C6MA 1W1ZA 3LLFA 4GY1A 4KCVA 3V16A 2WSYA 1S2CA 3R0KA 1OGGA 1RBAA 4UQDA 3SBFA 4IJCA 2QNEA 2X0SA 3C52A 2D22A 1RP9A 1IZCA 3PBMA 5ECUA 3GC4A 4KWUA 2X8RA 1LQ2A 3UVAA 4URIA 4NAEA 3GXTA 4HA3A 3TJXA 3QGAC 3VOJA 1GOMA 5IFPA 1W1PA 3PN8A 1D7FA 4S3JA 3NVTA 4DXXA 5A6BA 1JULA 2Y1HA 4NZ5A 3GIYA 3PTMA 4MGGA 5A2AA 4ACZA 4AY8A 2BASA 2DUZA 2VC6A 3U57A 2BVYA 5EMMA 2OEMA 3UXLA 2YOCA 3DG7A 3F4DA 3GB6A 2E5DA 3UCDA 1KWGA 1J5TA 1OX4A 1JCJA 4W8LA 1M53A 5AKQA 4QQUA 4RKAA 1E0VA 2J25A 1J0ZA 1TPEA 1QT1A 3C0QA 2PDUA 2VVNA 1J10A 1X1OA 3I4EA 2OT1A 3KEHA 4LYQA 2ZRXA 3H2FA 3BW2A 4BI5A 1C8YA 1LWJA 2D23A 2GWNA 1BXBA 3PB0A 3ZQ9A 4O0ZA 1BAGA 3QKZA 3CV7A 4C6CA 1W5NA 1H7PA 3BW4A 4E2DA 3VKJA 4GO8A 1Q4NX 3GTXA 2VUYA 4LY4A 3TN6A 1XISA 2ZVRA 5ABFA 1A5AA 5HNUA 2D0GA 4W7VA 5DXXA 1VR6A 1U1UA 2ZE3A 3TE9A 4AVNA 1DWHM 1KV5A 1C8VA 3M5YA 4DM1A 2W5FA 2YFOA 4H6RA 3ID7A 1H1YA 3U7VA 2Y8VA 4RXGA 2ODOA 3WJXA 4O15A 2QVNA 3U2OA 4NZ3A 1RR2A 3UU0A 3EOEA 1N82A 2WM0A 3BLIA 3E0LA 1EXBA 4GYPA 4GXPA 2F2HA 2BX7A 2DJXA 1ODUA 4FX8A 2VR5A 4AIBA 3QHOA 4PYSA 3GIPA 1MRAA 5D9PA 4HTBA 5T9CE 3NAVA 3DCPA 3OVQA 4ERIA 4K39A 1H7WA 4P7OA 3THAA 3KHDA 2FGZA 3I3DA 2IUZA 1PX3A 2BWGA 4PEKA 3VMPA 2CFFA 1B54A 4UTHA 3RRXA 3HOJA 4C90A 1GPWA 4JDYA 3CQKA 3B8IA 3NXFA 3MMTA 3QYSA 1P1MA 4A3UA 3JUGA 8CGTA 1S2TA 4PTVA 1W1TA 4DWSB 5MHBA 4LUYA 4UQCA 4XKYA 2F7FA 2Y8KA 1DTNA 3AAMA 2BXZA 5C9ZA 2R1KA 2DT3A 4HPXA 4PRRA 1J6OA 3URAA 2GQ3A 3VC6A 4L1GA 2OZTA 2VP8A 1BTMA 5EA9A 3WLKX 4B4HA 2WSKA 3KCOA 5CKSA 2KAUC 3GBDA 3ZWTA 2WWDA 5BZAA 3AS2A 1NVMA 3AOFA 1LBFA 3CB8A 2QAFA 4WLCA 4HZ8A 4C6NA 4JYDA 2PWHA 2VCCA 3LCIA 4OV9A 1OINA 5FF7A 3HG5A 2XPKA 4UXDA 5C2XA 1TPWA 4Q7NA 3DFPA 4Z1DA 3WLRA 1PKLA 2VCAA 3F5JA 3V5CA 1R9XA 2HQAA 1L6FA 4NVTA 3DFSA 3K5XA 3BJSA 2WC3A 1OCNA 2J7BA 5BXSA 2J47A 3S1WA 2DZSA 3KBWA 5FJUA 3ALFA 3VC5A 4RPQA 4PTXA 2WSPA 2XH2A 3RAOA 2Q09A 3E2RA 2DU2A 1DL3A 3VIOA 4D9PA 3GTNA 4E8CA 1VJSA 3UR7A 1QMLA 3P80A 1E73M 1ZAIA 2YA2A 4DZHA 2E6FA 4AMCA 4G7FA 1VS1A 1X6NA 3BURA 4FR6A 1DJQA 4LWWA 5CPLA 3MANA 1HQTA 3L12A 5J5DA 1H41A 4M6PA 8RUCA 3F2BA 1KTCA 4L6OA 3EWUA 5D2XA 4HB7A 3ZLHA 3OVPA 1Y7VA 4WR3A 1V0LA 5C9UA 2GGEA 2AQVA 2P0OA 5G4WA 4PMOA 2WMFA 4R7WA 3D47A 1RY0A 1XLHA 3LPPA 4GI9A 4IF2A 1TUXA 4XAZA 3AIRA 1PE1A 3FVDA 3UT0A 2CERA 3W2JA 1DE6A 4PN2A 2J62A 4QEEA 4Z2GA 4GVIA 4I7WA 4WDWA 4MNKA 4A3QA 1G7UA 3KBMA 1SR0A 1W3HA 2VEPA 4JNMA 5IFTA 3JS3A 2REQB 3FSTA 4O54A 1X8FA 2PZNA 2W66A 3DG6A 5BROA 4J27A 1XH1A 2DSUA 4Q4SA 5FJJA 2YL6A 3W07A 4W93A 3GBEA 4M1BA 2HXUA 2VD8A 3T81A 4LVGA 1V3HA 4LC8A 2XGIA 3K8KA 5LXXA 5HWJA 2RUSA 2BVWA 2GOKA 3AZTA 1A5UA 3JRKA 2BMBA 4DJDA 4O1BA 3WBXA 3ITGA 1VBGA 3EA2A 3C8FA 4L6HA 9CGTA 2OYMA 4NRRA 5M17A 1ISYA 1HFBA 4KFNA 1XRFA 1KR0A 1ALDA 2WZIA 3SN4A 1MRQA 4RNHA 3WLLA 3CZJA 1MSSA 5BW6A 1U5VA 3QLLA 3THDA 4LBUA 5FA5A 3S5NA 4EKJA 1KTNA 2P1FA 1MEHA 3QW4B 3L67A 1CXIA 2G96A 1AJZA 3B40A 4V1XA 4Q6XA 3ITOA 1OIFA 5U4NA 5HWNA 3SI9A 3DFYA 3V5OA 5GJNA 2FQIA 4LSBA 2AGKA 3EOUA 3GYEA 3M0YA 1EF2A 1OM0A 5LHEA 3IV8A 3M1ZA 3WF1A 2O4MA 3GW0A 1UH4A 3E5BA 3APTA 2NQLA 4OGZA 1E0UA 1FOBA 3GIQA 4FLRA 1OFBA 4GKTA 3N9KA 3ALGA 2Y6ZA 3QOMA 1DIKA 3KVJA 1R2RA 1XQLA 1NF0A 3E0FA 4JBRA 4WHBA 3MUZ1 3W7IA 2Q8LA 1JZ6A 3AROA 3LRMA 3MP3A 3CV1A 1R7AA 3CPGA 3W1UA 4LS1A 2XWEA 3W28A 4K2SA 2FHBA 2XZ9A 4EAMA 3WBYA 4XO7A 1ZP4A 1H1NA 4GYFA 3EGJA 2QT3A 2HDJA 3W27A 3WD0A 1JEZA 4ML9A 1NOFA 4QG9A 3GAYA 4QLJA 5HJYA 1CB7B 4DZAA 3WZ0E 1D3GA 1OT2A 3EDKA 3EWZA 3E49A 5E9XA 2IXVA 2UV8G 3SAZA 2X40A 2XVPA 4HU8A 1VCGA 1XPGA 4CU7A 5E0FA 4LRSA 3N2BA 4E2VA 4X0VA 3RR4A 4CQAA 3DBPA 4PZVA 3U7BA 1T96A 3G1HA 1XIGA 4QJ4B 1QWGA 2FHCA 3M7WA 1BGAA 2OR2A 1ZY9A 1SJCA 3LM3A 1H4PA 4IJBA 1F3WA 1GHRA 2Z6JA 5GNZA 3TV8A 1OF6A 1JZ2A 4POCA 4F79A 1PIFA 5B80A 1O5QA 3TUUA 4J9JA 3KBNA 5HPCA 2QCGA 3WSUA 1LROA 1FHLA 3URBA 2Z1XA 1ZNNA 2FIQA 4G9PA 1IIGA 5JXQA 3EAUA 3VAVA 2QUTA 5DMLA 1XWYA 1PSCA 5E6ZA 4GUFA 1FH9A 1EJUC 4QEHA 1I2OA 2PRLA 4I6VA 4HMNA 4L64A 4PC8A 4LCSA 3F4NA 1UA7A 5GPRA 1SO6A 1TE6A 4S39A 3S9YA 1O7AA 3PZOA 3GNXA 3WD2A 2IQDA 1XYLA 3G1FA 3O63A 2WO5A 3ANUA 4CD7A 4J3ZA 5M3WA 1Q6DA 5AYYA 1UPPA 5FL0A 1WQ5A 3OQEA 3W6YA 3LBCA 2UY2A 4N0RA 5B7YA 3LG3A 4PE8A 2V30A 4A35A 1E0TA 2J9XA 4UR8A 3JZUA 5AVHA 2FKPA 5LIXX 4INFA 4JTSA 4RJEA 4FNPA 2YBTA 1KFBA 2CBVA 4XD4A 2NWRA 3T8LA 3WMBA 1P7TB 1D8CA 4JXCA 4RK8A 3BG3A 1B9BA 4XUGA 3TSBA 2V6AA 1J01A 3EB