1B1YA

Sevenfold mutant of barley beta-amylase
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
500
structure length
500
Chain Sequence
b'MKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKDFLDAGVIVDIEVGLGPAGELRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDAGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKIAGVHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQPPDAMSAPEELVQQVLSAGWREGLNVSCENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYVNFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKIQPFPFQEHTDLPVGPTGGMGGQAEGPTCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (BETA-AMYLASE)
publication title The crystal structure of the sevenfold mutant of barley beta-amylase with increased thermostability at 2.5 A resolution.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 164
structure length 500
sequence length 500
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b1yA00
3EDEA 2YL9A 1ZBVA 3KL3A 3VGDA 4HMEA 2E8ZA 4BQ4A 5JIWA 4ACZA 5JUVA 1MVYA 1J0ZA 4GPNA 3AIEA 2EPNA 1JZ8A 1UD3A 2DT0A 2DSVA 2E4TA 5E6YA 4CD6A 1EGZA 1Q6GA 2WMKA 4P8VA 3WH6A 1WZAA 2D1ZA 4GZEA 3ZIZA 4JFVA 1BQCA 1C91A 2G4FA 2UWFA 5DFAA 1Q6FA 3AICA 5D8ZA 1CDGA 2ZX8A 1E56A 4GINA 4L4OA 3CUHA 3W25A 3UCQA 1JL8A 2DH3A 2JF7A 3GXDA 3B8SA 1FH7A 2OSWA 1A3HA 3AIUA 2VVSA 1Q6CA 2X0HA 1W9XA 4OOZA 3BSHA 1C8XA 2DT2A 5CPTA 3W37A 3SCTA 3QR3A 1E6SM 4PMZA 3AIQA 3W27A 3VUPA 5A6BA 4UQBA 3CZLA 5ECUA 3PZTA 2Z1SA 1JF5A 1G0CA 2C8NA 3W4RA 2GSJA 1J11A 4PMDA 1PIFA 5A6LA 3A47A 2VURA 1LJYA 4KGLA 3PZIA 3K8KA 3VM5A 2DH2A 1K9EA 2D0HA 3AHVA 4Z2HA 1W3LA 1W9UA 4PCTA 2BVDA 4JAWA 1DWGM 1WNOA 2WVTA 1Q6EA 2CIPA 3VIPA 2F8QA 2VC9A 3W81A 4ZXLA 4D6DA 1E6ZA 1BAGA 2ZE0A 3MANA 5CPSA 1CXLA 1PEZA 4TXEA 1XD1A 3AMKA 4AZBA 1UR2A 3WSUA 1AQMA 2XYLA 4B9YA 4UQAA 2WKLA 5GPRA 3BLPX 2YJQA 1E1EA 1MW0A 1MQRA 2WXDM 2XGBA 4PRWA 4CU6A 1KBBA 5DO8A 3SCQA 4MAZA 3II1A 1EHAA 2ZWZA 4OKDA 1V0NA 2GVYA 2WZIA 2GJXB 2PB1A 3IAQA 1ISXA 4AD4A 3AS3A 4C7FA 5GNYA 3DC0A 3ALGA 5HPOA 1E0VA 3AXXA 4CCDA 3WBAA 1E72M 3BCFA 2ZUWA 5DT7A 3ZSTA 3EDJA 4GKLA 4U31A 2VZVA 1W3KA 4F9DA 4TX8A 2V3FA 3AIVA 2BFGA 5CLWA 2OSYA 3MUIA 4CN4A 4MDOA 1G5AA 2C7FA 2FH8A 2BHZA 3ARTA 1W1YA 3F4VA 1GHSA 3NCOA 3WKZA 1KGUA 4AIEA 1ZJAA 1W91A 1J10A 4ZFMA 1GUVA 3AMGA 1QVBA 2CETA 2V5CA 1ISYA 2VMFA 3NSXA 2Y24A 3ZSSA 4CUCA 3KL0A 4ZEPA 4IISA 1O6IA 2E8YA 5C70A 2WNWA 3CUGA 2E3ZA 5I23A 1O7AA 2GFTA 1GOMA 3CZGA 2VTFA 4AZCB 4D72A 2YLAA 2J7GA 3OGSA 3L4ZA 3PTQA 1F4HA 1Q4NX 2J7EA 1UUQA 1H09A 2CHOA 3G6LA 4M8UA 3W53A 5A6BD 4JZ5A 1UQYA 2WMIA 2ZOXA 5DMYA 4Y7EA 4RL3A 1YQ2A 4LX4A 5A8OA 1G9HA 3ZO9A 3RIKA 2QPUA 4YN5A 4HTYA 3FXYA 3U7BA 4YHEA 4Z2GA 4PMUA 5EFDA 2ZUTA 4AZIA 1HF6A 2BHYA 1NM9A 2ZUSA 2E9MA 1CXIA 2QMKA 4JKMA 2YA2A 4DM1A 1GW1A 3BMWA 1CYGA 1J18A 4RE4A 3N18A 2YDRA 1WB0A 2YA0A 4PEEA 1DWHM 1GPFA 1I75A 4E8DA 1UH2A 2EJ1A 1DWIM 4ML4A 5CQ1A 5AYBA 1GOOA 4YHGA 3MO4A 5A2AA 1ZS2A 1OD8A 1WP6A 1KXHA 1UZ4A 4URIA 4JCMA 1WDSA 2JIEA 3N12A 2EBNA 4X0NA 3ZJKA 2WC7A 3WH8A 1HP4A 3ARWA 4PTVA 5A8PA 4QCFA 1QW8A 3CLWA 3PZVA 1OIFA 4XUYA 4UFKA 3WUBA 2W61A 3W82A 1C90A 1OBAA 1KXQA 1EOMA 1UHVA 1B90A 2E9BA 4MNMA 3N11A 4UZUA 1EXPA 1ECEA 5BRPA 3WH5A 1V08A 2G41A 4W85A 3ARXA 3MSDA 1EOKA 3CH9A 4X9YA 1QI3A 1WDRA 4KRTA 3RMEA 1XSKA 3ZMRA 1E6XM 5C71A 3AYSA 1FP8A 2EQDA 3FNDA 4M1RA 5A6AA 4DWSD 3AXIA 4AWEA 1W9VA 3MKKA 2XIBA 3QHMA 3AHZA 2ZXDA 4DUVA 1JNDA 1FA2A 2X05A 5A8NA 1XHGA 2WANA 4NRRA 3WQ6A 4PMXA 3WEZA 1KGXA 2TAAA 1V0MA 1H1NA 1SMDA 2PC8A 4WKHA 5A6KA 1B30A 3VU2A 2WBKA 1V03A 1XYZA 2J7FA 5I77A 4J3XA 2WLZA 1HVXA 2PWFA 2VRJA 2QV4A 2RGLA 3LMYA 2PWHA 3GYCA 1QI4A 1HT6A 3NDYA 2UY3A 1DTUA 1J0KA 2W92A 2VNCA 4KGJA 4KH2A 4V2XA 3WQ5A 1B9ZA 4UCFA 2WYSA 4F9JA 5E09A 1X6LA 5D8WA 1CGTA 2VCCA 5A95A 1LG1A 4OJYA 4ZE4A 3LPFA 2C0HA 3RJXA 2CKSA 4GO9A 4QLKA 3N04A 5A6MA 1CLVA 3CHDA 4JL2A 1G1YA 4AISA 3AMDA 5HBFA 4PN2A 4JHOA 1DWAM 3ZT7A 3FAXA 3K1DA 3WH9A 4CU7A 4CVUA 5AC5A 4N42A 3IJ7A 1QBAA 1WZKA 4F79A 4UTFA 2YDSA 1W3JA 3UG4A 3PTMA 4DUWA 1ODZA 3NUKA 4JKLA 5IHRA 1J12A 9CGTA 3W6LA 3OLDA 5D4YA 1UWUA 1E3XA 3ARSA 4WKFA 1IT0A 1ISVA 1KR0A 2WBGA 2WW5A 4UOZA 1VFFA 3NDZA 5CSUA 1U33A 4PMQA 3THCA 3ZJ6A 3HJEA 1OM0A 2WK2A 1WE5A 1BVNP 1OT2A 1OD0A 4S3KA 1B0IA 2X8RA 4EE9A 2ZICA 4AEFA 5D9NA 4B15A 4DWSC 3VD7A 3NSMA 2Y2WA 3VPLA 2VCAA 4W89A 2XVNA 2V3EA 4MNKA 2Y5EA 4X0VA 3GH5A 4U2YA 1XC6A 4LGXA 3VGBA 1V6XA 2Y4SA 1EDTA 1MFVA 3JUGA 3VMPA 2WHKA 2VT0A 2J47A 2XWDA 1TCMA 3WL1A 1GJUA 1HJSA 1E3ZA 5GQBA 2DSKA 1HL8A 1K9FA 1ODUA 1CNVA 2OSXA 1SFSA 5CJ5A 4MADA 2WSKA 3WIJA 3WH7A 1H2JA 3CGTA 5I3DA 1CWYA 1KCKA 3ARZA 4W7UA 5F7UA 1VFUA 1LL7A 2VX6A 1R7OA 4AZCA 5CGMA 4XZWA 4E2OA 1LL4A 1LG2A 4CVWA 5LA0A 1C7SA 3RPMA 4P8XA 4UZSA 4WF7A 1UQZA 4CD5A 1FP9A 4H7VA 1RH9A 3EBVA 2W66A 1BSIA 2WPGA 4F8XA 3CO4A 5AYIA 2XWEA 3WMCA 3K8LA 2UY4A 1BPLB 4CCEA 3KZSA 1MW2A 1CGVA 2Y8KA 1ZL1A 3UG5A 3GM8A 4OIFA 4UOJA 1HJXA 3THDA 5JBEA 1JYXA 3CPUA 2HVMA 2MANA 1E55A 3WEOA 3CUJA 4MNJA 5E6ZA 2XVKA 3WFZA 2QLYA 4A4AA 3WNMA 3PHAA 3FAWA 3N9KA 4GXPA 4J27A 2XSAA 1DEDA 1GORA 1NWSA 4JKKA 3AZTA 2ZUUA 2ZIDA 4W7WA 2PF0A 3L4UA 3VD3A 1KCLA 5GNZA 3IJ8A 1B3WA 1VJZA 1BYBA 4TX6A 4U3CA 1P6WA 5JBDA 3VGGA 4BQ2A 1D3CA 3FHQA 1WCGA 5DEZA 1HKIA 4BS0A 4IUGA 4PUDA 3T0DA 3OZOA 2CYGA 4OBRA 3AS2A 1UKOA 2B31A 1YHTA 4W8AA 1ZB5A 2D22A 3QOMA 5HXMA 3BGAA 1WDQA 2ZX6A 3EMCA 4UFMA 1G01A 1E0WA 4LYPA 1KXTA 2A3EA 4M82A 3ALFA 3PZMA 4HMCA 3WBEA 3WQWA 4KWUA 4LPCA 4GO8A 2JEQA 2BHUA 1CGYA 6TAAA 1I1XA 4N0RA 5D9MA 4CD8A 3UERA 1K9DA 1V3HA 5IXEA 5IFPA 3BAKA 4EK7A 1UWRA 1VEMA 1JYNA 2J7BA 3BH4A 1ESWA 2EXOA 4GIAA 4TVUA 1V0KA 3WUEA 2XPKA 1E6NA 3D3AA 4RE3A 1HKJA 3VNZA 3WF1A 4HU8A 4LXFA 1TG7A 3LPPA 4GZIA 1HJVA 5BROA 4P7QA 2X2YA 3RDKA 1SYTA 2DPEA 2A3CA 2VX7A 3GBEA 4XX6A 3WDQA 1OIMA 4J7RA 5CLTA 3QGVA 1UA3A 4GI8A 2D20A 2GDUA 3MUY1 1PZ3A 1WAWA 3EDKA 4CU8A 3DHUA 4J28A 4U2ZA 1OSEA 4AMCA 5A6JA 4C7GA 2QF8A 1J0JA 1HN1A 1VAHA 3OBAA 3ARUA 5AC4A 2OYLA 2CESA 4LYQA 5E0CA 1H49A 4BCEA 4AEEA 2V5DA 4AD1A 4KMQA 3EMQA 3SIMA 1MYRA 1KQZA 1OINA 4D6JA 2Q8XA 3VOCA 4AD5A 1QNQA 2WAGA 3GNPA 2XVPA 3BAJA 3M46A 3VX0A 3OA5A 5HDRA 1UG6A 3DYPA 3BSGA 2FHCA 4UFJA 1HL9A 5E9AA 4B3KA 2EO7A 3WD4A 2XG9A 1IZJA 4H8UA 1EDQA 2EEXA 2BVYA 1GQKA 5ABFB 1J0IA 2W62A 2OWWA 5E0FA 4B16A 7A3HA 3HU7A 3WF4A 1L8NA 1TUXA 4GZJA 3WNLA 3WDRA 1E9LA 4P7LA 1PX4A 4MNLA 2GK1A 2A3AA 3OG2A 1UR0A 1TFVA 3ZJ8A 4S3JA 5M03A 4M29A 1TE1A 4XZBA 3VIIA 2O9OA 1EH9A 3WF0A 1CZ1A 1QW9A 3NIYA 3WQ8A 3L2MA 5BCAA 3POHA 2CBIA 4R5EA 1UWTA 2JALA 2CBUA 4ZENA 4H2CA 2WVVA 1C8QA 4DWSA 4FK9A 1BG4A 4OUEA 4PMYA 3CHFA 1NOWA 2VX5A 4UQEA 5EFFA 3B9DA 1PIGA 3RM4A 3N15A 1JD9A 3SCOA 4BQ3A 4D6FA 3BAWA 3O9NA 3AIBA 1SR0A 2DQXA 1E4MM 3UEQA 1HXJA 5I2UA 2AAAA 1N82A 1MXDA 3VIGA 3VINA 3GH7A 1UWQA 4JFTA 1TMQA 1UA7A 5HPCA 4D6EA 1W2PA 1CXHA 3DECA 2IUZA 1GQJA 3AJ7A 2X09A 3IANA 4BQ5A 4W84A 4ATLA 4QAWA 1H4PA 1MXGA 4PMOA 4D71A 4LYRA 4HZ6A 5CG0A 1H41A 1VBRA 2NT0A 5JBFA 4AY1A 4HZ7A 4FLQA 1EIBA 2A3HA 1I1WA 1CEOA 2WKGA 4UFIA 1Q6DA 5M5DA 3ECQA 1E6RA 1PAMA 3GZAA 4UFHA 4AYSA 4B9ZA 2NW0A 3GBDA 3VIFA 3EDDA 2XGIA 1UH3A 4PTMA 1GNXA 4BF7A 4JHZA 2WVUA 4J3SA 2XVGA 5ABEA 1H5VA 1QNOA 4R27A 4PYSA 3CUIA 2G3IA 4AZHA 4D6HA 5E70A 4NI3A 1GQLA 1E71M 4PMRA 3SUWA 2FDMA 2CBVA 1C8YA 2BXZA 4EANA 1V6YA 3VD4A 1DWJM 2FGZA 2YL5A 3T0AA 2CCRA 5EMYA 1NWUA 2OWXA 3GDBA 4W8BA 1J0YA 1GVIA 1GVYA 1TZ7A 3MMDA 5LA1A 1JIBA 1M04A 3AROA 3AHTA 1CXKA 1R87A 3PTKA 3PZUA 1NH6A 1CTNA 3AIWA 1PX8A 4W86A 1NWRA 3RILA 2W5FA 1BYCA 1JG9A 1TVPA 4D6IA 1JI1A 1W32A 3WDIA 4WK9A 2VJXA 4BZYA 2J74A 3S6TA 3UESA 1F4AA 1D2KA 2QMJA 3ZOAA 4XV0A 1U30A 2XFYA 3MUAA 5FD0A 3SCPA 2BXYA 4QFUA 4H04A 3PN8A 1VENA 2XSBA 1R86A 1E43A 1LF1A 3KWXA 2YBUA 3T2OA 1NOFA 4CN1A 4CD7A 4Z2IA 1UYQA 3WD1A 2EPLX 5I24A 1OGBA 1E4IA 2DIJA 3F5KA 1HJQA 3W29A 2CKRA 1R85A 1QI5A 3WNPA 5BYWA 5I79A 5FCZA 4TTGA 3SURA 2J8GA 2EPOA 1QOXA 1UR4A 4RE2A 1HIZA 3MV01 5FKYA 5BWFA 2WWDA 1BGGA 3CZJA 5KEZA 1BYAA 3OB8A 4P7OA 2DSZA 1XH2A 5JIPA 2GJPA 1DWFM 4U33A 3RCNA 2YLLA 3TTQA 3K46A 1PX3A 1B3ZA 2E40A 4HU0A 1QI0A 2BVTA 3VILA 1XSIA 4W93A 3BC9A 5ABHA 5A8QA 3I3DA 4TVCA 3TONA 2J77A 2YBTA 1C93A 2X1IA 4XB3A 1UWSA 4D1IA 1JDCA 3RO8A 2DT1A 3WD2A 3ARVA 4QDMA 2PI6A 2UY5A 3VMOA 1H0IA 2VUYA 3GTNA 4HA3A 4UQDA 4MB3A 2WMHA 1KWGA 3AQUA 4HA4A 2BS9A 5ABFA 2GJXA 2ZUVA 3L4XA 1EO7A 3AS1A 2WWCA 5CGTA 1B2YA 4ATWA 4DUXA 3DHPA 3WL0A 4B3LA 2RGMA 1V6VA 1FOBA 2JIWA 4UQ9A 1GCYA 3CTTA 3PZ9A 3AYRA 4PTXA 3TOPA 3W38A 4W87A 3BAIA 1B3VA 2J8FA 2CPUA 3KE0A 4A3YA 1OGSA 3CBWA 4HZ8A 5BRQA 1JF6A 2YDQA 1JI2A 1L0PA 1FHLA 4Q22A 2DIEA 1R7AA 1W1VA 3CMGA 1KXVA 1UZ1A 4H8HA 2V3GA 4H8VA 4V28A 4OZOA 3VMNA 4IPNB 3M6DA 4AW7A 2CITA 5HNNA 3VGEA 4JCLA 3SCUA 2FGLA 3WD3A 1XYFA 3B9EA 5DF0A 4CCCA 1SMAA 3WENA 1UKTA 2XIIA 5IDIA 1BTCA 2WHJA 3W0KA 1M53A 4UOQA 2WVSA 3RM9A 3W24A 3TTSA 3GXIA 3AHXA 3WF3A 2J75A 2OYMA 5DT5A 2ZXQA 1V3IA 4Z2JA 3WDJA 2HISA 1FHDA 4A3HA 5A69A 4JFWA 1UD8A 3L4WA 3N13A 2XFFA 2D23A 4UR9A 4HP5A 1UWIA 1NARA 1RD6A 1Y7VA 2YIHA 3SCRA 2F61A 2YA1A 3AZSA 3K4AA 3QHNA 2VZSA 1WPCA 2WCSA 3AMLA 1V3LA 4QP0A 1PPIA 5CXPA 4HPHA 3SUVA 3PZQA 1AMYA 4NRSA 1KQYA 1HVQA 5IHSA 1V3JA 1B3XA 2BY3A 1GOIA 1QPKA 5CSYA 2W4XA 3ARQA 3DYOA 1RP9A 3TP4A 4Z2KA 1FH8A 1JFXA 3T2QA 2CNCA 3GXMA 1AQ0A 2UY2A 2FHBA 2J7DA 1WZMA 3RJYA 1K6AA 8CGTA 4HMDA 2PWEA 1E6PA 4FMVA 2VR4A 3NYDA 5CZKA 3VGHA 4PMVA 4D1JA 5C8BB 2CBJA 3PBGA 2GDVA 2VZTA 3LPOA 3UR7A 4ZE5A 3SCWA 3OZPA 3UG3A 3SUSA 5FOOA 3BAYA 3L4TA 1ITCA 1CPUA 4UQCA 3VD9A 4H41A 3SUUA 2GJRA 4AZGA 1LL6A 1V02E 5A3HA 1JAKA 4J3TA 4MB5A 1JDAA 2X0YA 4WSJA 2J78A 3CZEA 5BXPA 3CZ8A 1ISWA 2G8ZA 4EAMA 3UETA 4WLCA 5M3WA 4QLLA 4E4PA 1BLIA 4F66A 1QNSA 2AMGA 1R8LA 1W9BM 1E1FA 2JEPA 4PMNA 3BCDA 4AZ6A 4AC1X 1UD5A 2QHAA 5A2CA 1M7XA 2VL4A 5EBAA 4OBSA 1XH1A 3U5UA 1CENA 4D6CA 3TA9A 1XV8A 2WC3A 2J7HA 4M56A 4TOQA 3VDBA 3U5YA 3BMVA 1NP2A 2V38A 3SCNA 5GNXA 3VKKA 3AS0A 1EA9C 5A1AA 3T0BA 1QI2A 1E4NA 2O92A 4PSPA 1US2A 4NSBA 1UKPA 1JFHA 3VIHA 1MW1A 3MU7A 1WZLA 3E1F1 4FLRA 3M07A 3WMSA 4U5KA 1H11A 4MAVA 1E70M 3MMWA 2WB5A 1Z32X 3MV11 1V02A 1JD7A 2ZUMA 1ZBKA 2EPMX 2VCBA 3MUZ1 4DM2A 1JXJA 2ZX9A 4PTWA 1ITXA 2YL8A 3OGVA 5FIPA 1JZ2A 5A2BA 1GHRA 1HP5A 3FN9A 3WNNA 1OT1A 1HJUA 1G94A 2WCGA 1OCQA 2WMGA 2XM2A 4Z2LA 8A3HA 3ARPA 1E5NA 1C3FA 3VGFA 1JAEA 3OGRA 3QOKA 2NSXA 3VDCA 4HOZA 3SUTA 4FLSA 1HKMA 1HNYA 1PZ2A 4JIEA 1B3YA 2W63A 3U57A 5IFTA 1QHZA 2WC4A 3ZR6A 5FL0A 1WKYA 5LYRA 4PUEA 3VM7A 2WCAA 3EMZA 2J25A 6CGTA 1UKQA 4L4PA 3W26A 3VX1A 3GNOA 2Z1KA 1GONA 2AOSA 3WY1A 4AXNA 3HMCA 3WUGA 3PZOA 3APGA 3TTOA 2PBGA 5BXRA 3FHAA 3VO0A 1DP0A 2D0FA 4AZ7A 1K9TA 1OGGA 3A4XA 2XTKA 3WDPP 3WD0A 1CGUA 5LA2A 3ZT5A 1ZBCA 3WNOA 4UFLA 1OWQA 3AZRA 3CMJA 1BHGA 1JGIA 2XUCA 1VIWA 1IZKA 1U2YA 4W5UA 1AQHA 1LWHA 3J7HA 1XCWA 2IXUA 1V6UA 1CXEA 4GI6A 4MJ4A 1ISZA 3FY1A 2DT3A 1ZBWA 1TA3B 2VI0A 2VZUA 2VVNA 2CEQA 2XM1A 1QBBA 1W3HA 3WUFA 1E6QM 3GNRA 1JZ3A 3SCSA 2O9RA 1E0XA 2GUYA 3TTYA 1VJSA 2XVLA 1H0GA 3F5LA 3SEPA 4AIOA 1GOKA 3WDHA 4EKJA 2E9LA 4P8WA 3EDFA 7TAAA 4AZ5A 4P7RA 5HOSA 3SCVA 3CUFA 1XRVA 2WHLA 3I3EA 1VBUA 4ZXOA 1M03A 3ZQ9A 2WZEA 2E0PA 1BFNA 2VOTA 4Q7NA 4QLJA 3CZKA 3IAPA 4W88A 4TUFA 4M81A 1W1TA 1EQPA 2YKKA 1FFQA 1W2VA 3W28A 1B31A 4U3AA 2O9PA 3IJ9A 2Y8VA 3VNYA 4TVDA 5D9OA 3OIHA 1B1YA 1W9PA 4CN6A 2V3DA 2VQUA 5D9PA 5FL1A 2WZHA 1VF8A 2DSWA 2D0GA 3QHOA 2CXGA 1EDGA 3BAXA 2ZXAA 3WN6A 3M7SA 4YPJA 3VIKA 1W1PA 1OB0A 2G3MA 3OLIA 2J62A 3ZM8A 1KGWA 3DYMA 4M24A 4JL1A 3POCA 3ARYA 1HX0A 1X1NA 4ACZB 3FW6A 4K68A 3D5HA 1KFWA 1TR1A 1E4LA 2O9TA 1CIUA 1PBGA 4NZCA 4KRUA 2VRQA 3L4VA 3VVGA 1XGZA 2D24A 2G3JA 1XD0A 2NT1A 4D6GA 1UD6A 3EYPA 4WIWA 2XJ7A 2OLHA 1H3GA 3K8MA 2VO5A 4WSKA 2OYKA 4C7DA 1HKKA 2BY0A 2WM0A 2PWDA 3PZGA 1CGXA 4JFUA 1EHNA 1GZJA 2CHNA 3S2CA 3G6MA 4IM4A 3CIVA 1KR1A 1V3KA 4PBGA 2A3BA 4P7NA 3CHEA 3O6AA 3AISA 1CECA 5CPQA 2BV9A 2WMFA 3ZT6A 1EO5A 1GJWA 4W8LA 1QHOA 2JF6A 4IPLA 4MJ2A 3WF2A 2ESCA 3WEMA 1JZ6A 1XCXA 3A6OA 1BGAA 2XHYA 3UR8A 2VX4A 4WJXA 1GOWA 5ABGA 1J0HA 5A6SA 1LWJA 2FH6A 2WLYA 1S46A 3OLEA 4JFSA 5BXSA 4OOUA 2QPSA 2F2HA 1XH0A 1KB3A 1VEPA 3N1AA 4BA0A 1UKSA 1NWTA 4AIUA 4AD0A 1D7FA 3RM8A 1UH4A 1V6WA 1BG9A 3A3HA 4MTVA 2ZUNA 1MQPA 4HPGA 3IK2A 2WSPA 2WHMA 1AVAA 3A4WA 1VEOA 4GQRA 2J4GA 1PJ9A 4WKAA 4QCEA 3NJ3A 3I3BA 2YL6A 1VRXA 1WDPA 5BXTA 3VIJA 2YOCA 4AD3A 5I5RA 4LQ1A 4J3VA 1IV8A 3WELA 4P8UA 3ARRA 1QNPA 4GQQA 2WMJA 4MDPA 1WO2A 1DHKA 1J9YA 1US3A 3GXFA 1GOQA 1UD4A 2XFRA 3AHYA 5A8MA 1UR9A 1NOUA 1VFMA 1MWOA 3K4DA 2CERA 1JYWA 3VIMA 2BNJA 2DSUA 2ZWYA 2ZX7A 1BVZA 1VFOA 4M80A 1EQCA 2ZXBA 4GI9A 3AMCA 2D3NA 4UNIA 4FLOA 3N17A 2JFEX 3MS8A 3F5JA 1UOKA 1UR1A 2GK1B 3WNKA 5A94A 1E15A 1GQIA 1E73M 1XSJA 1MFUA 4PSRA 3WFLA 1CBGA 3MMUA 3BXWA 3W6MA 3CHCA 3KL5A 2VZOA 2JE8A 1HJWA 2WVVB 3U7VA 4MB1A 4CGTA 1JDDA 1CGWA 6A3HA 5I78A 4DWSB 3AOFA 1LQ0A 1JNEA 3WQ4A 4NF7A 5AY7A 1CXFA 2OWCA 3OLGA 1JZ7A 1UD2A 1UR8A 1FFRA 2D2OA 4FF5A 1CLXA 3GH4A 4J3UA 3ZR5A 1E5JA 3HN3A 4HA1A 4W5ZA 1W9DM 1J01A 1RPKA 2EPKX 2VQTA 2D3LA 1VB9A 4J3WA 1NQ6A 4HOXA 2J7CA 1V3MA 3NSNA 3T08A 1KWKA 4TTUA 2W91A 2FHFA 1M01A 1JZ4A 1NP0A 5I0DA 5M17A 3AFBA 3AI0A 3WMBA 1BYDA 2DGAA 1TA3A 2DDXA 3MSGA 2WMIB 4MPKA 1LLOA 4AD2A 2G3NA 3AXHA 2VRKA 3AIRA 1MW3A 2DEPA 3ZJ7A 3VDHA 3VTRA 1MQQA 3WQVA 2PWGA 4U5IA 1RP8A 4CKQA 2J79A 4PCSA 1QNRA 4CD4A 5EB8A 4HOWA 1C7TA 3O2LA 2VR5A 1ZJBA 2BY1A 1V0LA 1E40A 4W7VA 7CGTA 3T2PA 1JYVA 3VIOA 2W67A 1BF2A 3L4YA 1X6NA 4V27A 1QHPA 4MB4A 1TVNA 2BY2A 3VDAA 3T09A 1KBKA 3PZNA 3LPGA 4E8CA 1A47A 2PBOA 5TD4A 3B9AA 3A4AA 3L2LA 1JXKA 2ZX5A 4ACYA 3VD5A 3KEHA 1FH9A 4ATDA 3BLKA 1JZ5A 2IXVA 1ZU8A 5KZ6A 1C92A 5I6SA
chains in the Genus database with same CATH superfamily
1XRSA 2VGFA 2FB2A 1XYCA 5BZAA 4BQ4A 5MHBA 5LNUA 5JUVA 1OZQA 3AIEA 2I9EA 5K2ZA 2EPNA 2W27A 2XN1A 2Z2BA 3H2MA 2FFCA 1Q6GA 2WMKA 3R10A 1WZAA 3WLOA 4GZEA 4IWWA 3EWUA 2PDWA 2WJFA 1WDWA 1Q6FA 1F3EA 2BG5A 3W73A 1CDGA 4WJEA 2J9ZA 4GMEA 1X8FA 2A2IA 1POJA 3W25A 3B0VC 2DH3A 5KTLA 5U4NA 1F2JA 5JH2A 3HF3A 3L65A 3S8HA 2C14A 4E8GA 2VVSA 1B5TA 1O94A 3TYDA 3HPFA 3UPBA 2XIQA 4LUSA 3QR3A 1E6SM 5DCBA 3W27A 3GR4A 3QBUA 4Z0JA 3VOHA 4UQBA 2Z1SA 2C8NA 1G0CA 3NZPA 4PMDA 5TAOA 3TXVA 3PVFA 3K8KA 3C0SA 1K9EA 1K7FA 3YPIA 2IPJA 2ZZ2A 1AZ1A 3C2RA 1SZNA 4REQB 2OGJA 4B5XA 2CIPA 3GXPA 2F8QA 3MI3A 3MHFA 2R1MA 1BAGA 2IPFA 2ZE0A 3ABQA 3GVRA 3PUDA 4R7OA 3A5FA 2P3ZA 3ANVA 4B9YA 2WKLA 3AUJA 4A35A 3C3UA 4K8EA 1E1EA 4AF0A 4GVIA 2TRSA 1IEXA 2ALDA 1EHAA 4A2SA 2VR2A 1NIUA 2GJXB 4AXKA 5HNTA 1PKLA 1NFGA 3ALGA 3AXXA 2QYGA 2E28A 5B80A 3BCFA 3SJ3A 1E9ZB 5HWJA 4H6KA 4HYWA 2VZVA 2W79A 3IK4A 2GOKA 3AIVA 4MDOA 3ZWSA 1XLCA 2FH8A 2BHZA 3OOQA 4NVTA 3DU0A 1W1YA 1P1XA 1GVFA 5FF3A 1KW1A 4F0MA 1F07A 2VMFA 1ISYA 4FO4A 2Y24A 4B2DD 3TJLA 2EKCA 1E9IA 2E8YA 3EWBX 1R3WA 2Y7GA 1L6YA 1A53A 1MNSA 4D72A 3VCNA 3PTQA 1F4HA 1XS2A 3M7WA 1Q4NX 1H09A 1YXCA 4JEQA 1J5SA 4PUJA 1C9DA 4HYRA 1OK4A 3KHJA 3E0IA 3CXOA 4RL3A 2PGRA 4LX4A 3ID7A 5F2IA 3WLMA 3EKLA 2ZA3A 2QPUA 4HTYA 3FXYA 3U7BA 1HF6A 1POKA 4HCHA 1NM9A 2ZUSA 2QMKA 4KRZA 3IJLA 5EYWA 2YA2A 1ZAIA 3NOEA 1JJKA 1XLHA 3N18A 3V1HA 4XD6A 1DWHM 3UU0A 5HQEA 2QCMA 1UH2A 4JR5A 2EJ1A 1DWIM 5CQ1A 3H2CA 3BV7A 4GBDA 2PLCA 2GPTA 3LLFA 3C0QA 5CPLA 4B5SA 1OD8A 1WP6A 1UZ4A 4PB4A 4URIA 1YNQA 2JIEA 3N12A 1A0CA 5A8PA 1AG1O 3CLWA 4UFKA 4GCXA 3CO8A 4CCZA 4GFIA 2DUAA 4MNMA 4GRSA 5DMNA 2P53A 1WBHA 4G5DA 5AOUA 1EXPA 4PRTA 3S5SA 2E1WA 3VXGA 1CLKA 4WXYA 2GWNA 1XW8A 1WDRA 2NZLA 1UBPC 4KKXA 3QN3A 5C71A 3FNDA 4M1RA 2PLJA 4XBKA 2NV1A 4DWSD 2R1PA 4AWEA 1W9VA 4I3GA 3V35A 3QTGA 3EEGA 4DUVA 3MSYA 1WOBA 4NRRA 4X9SA 1DYSA 1H1NA 1V51A 2C1IA 1N8IA 4PUUA 1GVRA 1V03A 2WLZA 2VRJA 3LHUA 4ICNA 2ZTJA 3PM6A 5F2GA 2QV4A 3LMYA 4KGJA 4V2XA 1B9ZA 4F9JA 1OFAA 1X6LA 3O06A 1CGTA 1M7PA 3P7YA 2ADAA 3LPFA 3S5ZA 2PU0A 2QCCA 4JL2A 1GOXA 3N9SA 4DJFC 3PPFA 4JHOA 1EFZA 1DWAM 2QW5A 3ZT7A 1G7UA 1KFEA 3K1DA 2QCDA 4N42A 3IJ7A 1QBAA 3KOXA 4UTFA 1XYMA 2OQYA 2YDSA 2PTYA 3CQJA 4F0RA 1Q2RA 9CGTA 2EG7A 2FDSA 3OLDA 1TPUA 3FJLA 3NL3A 2PDPA 2W0UA 2ZC8A 2GVGA 4ZR8A 1ISVA 2J8TA 2WBGA 4AVFA 4DBWA 3EWWA 1FCVA 1U33A 2QJMA 3ZJ6A 3HJEA 2HRWA 4U4MA 1BVNP 1OD0A 2ZZ6A 2ZICA 3VD7A 3P82A 1JDEA 2VCAA 4IXXA 4W89A 2BASA 5FF2A 1N8FA 3U9IA 2PCEA 4X0VA 3CQ0A 3H26A 3ZVHB 1V6XA 2I9UA 3SB0A 2WHKA 2J47A 4TX9A 1WOAA 1TCMA 3WL1A 3BLEA 1FWWA 1S5WA 1WKEA 4UMBA 3CUXA 1NSJA 3EX3A 2NLIA 5KSWA 2WM1A 5K9CA 3PJTA 5CJ5A 4E2VA 2WSKA 1Y65A 3CWOX 3OVQA 3QKZA 1NEYA 2KAUC 4JYFA 1VFUA 1LL7A 3VC6A 4GYKA 4XZWA 1A80A 4WVXA 2RKXA 4OUIA 4MKVA 1UQZA 4GJIA 2W66A 4M6UA 3G1YA 5C6MA 2R82A 1WKFA 3LN3A 3OHIA 2H8ZA 1XGDA 2V2HA 3BJTA 2UY4A 1BPLB 4CCEA 3B0UX 4ZB5A 1ZJIA 1DJWA 1CGVA 1YDNA 4B4HA 1D8WA 1JYXA 3GM8A 3CPUA 1E55A 3WEOA 3HQ1A 2XINA 4KCVA 3BDKA 3IUIA 4MNJA 3VI2A 5FSDC 1OC6A 4IJCA 2QLYA 1AODA 2Z25A 1A49A 4LS1A 5SWUA 4J27A 3ABXA 3ZLGA 2XSAA 3L0KA 1DEDA 1VPXA 3NGFA 1ZFJA 4NP7A 1GJPA 2OFJA 3V5CA 3L4UA 4BEQA 2VC5A 5CZTA 4C6CA 1US0A 2GVJA 3SGZA 1O66A 1BYBA 1P6WA 5JBDA 2C1GA 3W07A 3PJWA 5DEZA 1LBLA 4US6A 4BS0A 1RBLA 2CYGA 1IIHA 3C2OA 3QH2A 4F48A 2Z1BA 1YHTA 3STCA 5HXMA 1E1CA 3CL8A 4Z1CA 4HSHA 1G01A 1J4EA 3BWWA 1KXTA 3NA8A 4ICMA 5E93A 4HMCA 3WBEA 3EWCA 3NPVA 2CLIA 4JNYA 1EL3A 4GO8A 4DO7A 3B05A 4JQ1A 4Q8TA 1AW1A 4CD8A 3UERA 4XIMA 5IFPA 5KZMA 4GZ7A 2EPHA 2DW6A 4QITA 4XAPA 1UWRA 1YPFA 1JYNA 3OW1A 3BH4A 1PUDA 1A3XA 5DN1A 2XPKA 1HKJA 5T91A 2BP1A 3KS5A 4DIAA 3VNZA 3WF1A 5C9RA 3CIXA 1AH3A 2GDQA 4LXFA 3LPPA 3VA8A 5BROA 4GUFA 5EKYA 1R9ZA 3HV8A 4JIQA 2D20A 1WAWA 2I5GA 3LRMA 5HJYA 4JQ2A 3NDOA 4NAEA 1OSEA 2A6LA 1UJPA 5A6JA 3M0ZA 3WBYA 1VAHA 5F2MA 1OF8A 1GKPA 4G7EA 3SM0A 4JTTA 3TCEA 1EF2A 4GY1A 1PS9A 3PG8A 4S3CA 2AQWA 3ONCA 4BKNA 2V5DA 4AD1A 2DZBA 5LNSA 2YX0A 2MNRA 3QXBA 5CZJA 2Q8XA 1OG0A 2REQB 1ZLPA 3I7SA 1JCNA 2BOGX 3W76A 3W75A 3OA5A 5HDRA 4AH7A 2FHCA 1HL9A 4K7VA 1NF0A 3MUCA 3TDFA 1I45A 1EDQA 1GQKA 1JRCA 2W62A 2NQLA 4Q4OA 2BGSA 4B16A 3EPNA 3HU7A 3WF4A 4JEJA 3HTWA 2RJHA 3SADA 1TYGA 4H9MA 1OC5A 4P7LA 3HM7A 5T9CE 1TFVA 3O3RA 3TN6A 3OVGA 5M03A 1TE1A 1VGAA 2O9OA 1EH9A 1CZ1A 1FWGC 5BCAA 3KCJA 4C6LA 2JALA 3GG7A 3VOIA 2OLSA 3S5NA 1EX1A 3NQEA 4KEZA 2I57A 4UQEA 4M51A 3KRBA 2ACQA 5EFFA 2GOUA 3MJMA 1XUUA 3C61A 1PIGA 3SCOA 4EXAA 3F03K 4UMCA 3MKCA 1LOSA 5LIXX 3F4DA 3QMSA 4ZTYA 3UZYA 3BAWA 3AALA 3O9NA 4JDBA 1BWVA 3AIBA 3G8RA 2BOFX 3NR0A 5ECVA 4GI4A 5I2UA 1LT8A 1M3UA 1MXDA 3VINA 3QZEA 3A23A 1TMQA 1W2PA 2VD9A 4FX6M 2IUZA 1GQJA 2G3FA 3IANA 4BQ5A 2XN0A 3B0PA 4WDXA 2ISVA 2UZ9A 1H4PA 4L1XA 3NQ2A 3OZMA 2OGYA 5CG0A 1J5TA 3SECA 2NT0A 5D38A 3TQPA 4AY1A 5MF5A 5HK4A 4HZ7A 3G8EA 4FLQA 3R11A 1I1WA 4UFIA 1E6RA 4AYSA 2NW0A 2XGIA 4JIPA 4HSNA 1JCXA 1B57A 3TQVA 2Z1XA 4PYSA 3T7VA 4MFDA 4DJDC 2GL5A 2G3IA 5D37A 3TMLA 4DELA 1FXPA 1GQLA 1Z7AA 1E71M 4HN4A 4KS0A 4AX6A 3B04A 3KBSA 2YL5A 3NWRA 3SSJA 1KTCA 3H6OA 3W85A 1J0YA 1TZ7A 2PPGA 3MMDA 5LA1A 1FWEC 4MVAA 1M04A 5L6UA 3WBWA 5CBJA 1SZFA 3F4NA 1OFPA 4MZYA 2NSOA 4O8RA 1NH6A 6REQA 1P48A 1CTNA 4W86A 1XBXA 3S1UA 2IPGA 1TPDA 3CH0A 2PLMA 4H9XA 1W32A 2BVWA 1ZALA 4BZYA 3O0KA 2R1NA 1N8WA 3UWYA 3H70A 3S6TA 1VZWA 4R33A 1ZGDA 4LS2A 1D2KA 3QC0A 2E68A 3M6YA 1W8GA 3SCPA 1TPC1 4QFUA 4WY0A 4PBEA 5AHLA 1ZQ5A 2J9YA 1KKRA 2YZRA 3T2OA 4Z2IA 1UYQA 3KRSA 3GHUA 2EPLX 2OX1A 4LUSB 1YEYA 1VPYA 4MZ8A 2I5QA 3P80A 2CKRA 1R85A 5BYWA 4NT0A 3PF3A 4DY1A 3FKRA 4TTGA 2PA6A 1EGVA 3SURA 5K4XA 2VDGA 2J8GA 4YIWA 2ZZ7A 3DI0A 2EPOA 3WJZA 2PRHA 1PWMA 1XLDA 1EUAA 2CLLA 4TR9A 1XYLA 2PDFA 3A64A 2Y7DA 4YMZA 3CZJA 4BR1A 3QRHA 2VEMA 1W8SA 5JIPA 5HQMA 2YLLA 3GVGA 3TTQA 4HU0A 3E96A 4LCQA 4W93A 1GG0A 1OY0A 5A8QA 3I3DA 2Z1VA 2YBTA 3FSTA 2X1IA 5REQA 2Z2AA 3GDRA 1R3QA 1JDCA 1YDYA 4XO7A 3WD2A 1QO5A 2A7NA 1ML1A 2PDKA 1QW7A 2DW7A 2VUYA 3DDMA 3LB0A 1IXQA 4HA3A 4UQDA 4MB3A 2WMHA 5TIMA 3AQUA 2BS9A 4YVPA 3L4XA 3AS1A 4NJGA 1JCLA 2FPVA 5D03A 1ZCCA 1V6VA 3QW4B 2JIWA 2YCIX 3GIYA 4E2BA 2INFA 1GCYA 3E2SA 3TOPA 3W38A 1TE6A 1D9EA 1KNWA 1VFLA 4HK5A 4JIHA 2X7VA 3HPZA 4A3YA 4HZ8A 2ZE3A 2QEZA 2BGNE 3ISIX 1JI2A 3A4JA 1L0PA 1ICQA 1FHLA 1XLGA 2DZUA 2NQ5A 3CV2A 4H8VA 4I7UA 2WNZA 4OZOA 5AYXA 1A5SA 3VGEA 1KRBC 2FKPA 4O1FA 2OCZA 3KOZA 4ZODA 3NOYA 4ICCX 5I3GA 1LROA 3MHGA 5IDIA 3TN4A 2WHJA 1UBSA 1X38A 1A5UA 3IGHX 3RM9A 3W24A 2QAFA 3DAQA 3QEZA 4TO8A 1Q85A 4UTKA 4DEFA 3L4WA 4XQ6A 3M41A 2YIHA 1U5HA 2F61A 4DJEC 3AMLA 2WCSA 3BOLA 3GNNA 4P61A 3ITCA 3W1MA 3PZQA 1AMYA 1W1ZA 1LRTA 9RUBA 1HVQA 5LXEA 1V3JA 1YW1A 4WOZA 2W4XA 2ZCGA 4NAFA 3T81A 1PTGA 2R24A 3NQGA 2Y89A 3GXMA 4S2BA 3W7NA 3ZS4A 5HQLA 1WZMA 3KVKA 3RJYA 2G5WA 4DZIA 3DHFA 2VDHA 4FMVA 3KBMA 3VGHA 4D1JA 3MVIA 3W01A 2VZTA 3OQEA 1U83A 2VC6A 3SUSA 5FOOA 3L4TA 1ITCA 2PDJA 3UD6A 4UQCA 3A9IA 4H41A 4AZGA 2ODOA 2FMNA 4HNLA 3QSTA 4CQCA 4XD4A 4Q6JA 3VNIA 1JDAA 5C5YA 2J78A 3CZEA 5BXPA 3M0MA 3UETA 3LK6A 4QRNA 3UWQA 3ONBA 3QV6A 1BLIA 3GR7A 1G6CA 1E1FA 1DXEA 3BCDA 2NUYA 3M47A 3Q2DA 1UD5A 4MWAC 5A2CA 1TPVA 3M0LA 5EBAA 3S1VA 2DVTA 4Q4QA 3S2JA 1DXIA 3UJRA 2J7HA 3KZPA 4NYUA 1NP2A 4ZA0A 3AS0A 1TSIA 5A1AA 4MKSA 1HGYA 1QI2A 1E4NA 3TUUA 1XIGA 1QAPA 4DBSA 4NSBA 3IRDA 3VIHA 3SZ8A 4CQ9A 3GY1A 1WZLA 4RPPA 4QSHA 1FHVA 2YW3A 1RPXA 4CNOA 1ZBKA 3QPEA 4PB3A 4LBUA 1J93A 4PTWA 2QCDB 3PPHA 1ITXA 2YL8A 1IWBA 3OGVA 4EPDC 2AQOA 1JZ2A 5A2BA 2WJDA 4Z1YA 1SW7A 1HP5A 3WNNA 1OT1A 2E6YA 1HJUA 1G94A 1EB3A 2O7SA 1OCQA 1HW6A 2ABAA 2YYTA 3ARPA 3VGFA 3OGRA 3H55A 3STPA 4G56A 1JPIA 3BV4A 4L9ZA 4HOZA 3SUTA 4FLSA 3HPAA 2GGHA 3W1XA 4DXXA 3N25A 4ZOCA 4JTIA 2Q8LA 1BKHA 2PCQA 2AMXA 5IFTA 1SPQA 5LYRA 4C6IA 4M7TA 4WDWA 2WCAA 3DH7A 4JIIX 2VDIA 4JQ4A 4DZAA 2J25A 1J2WA 4ZTXA 3N4FA 2HNEA 4GA8A 1V5XA 3WY1A 3O8AA 4FXSA 4AXNA 3RPDA 3E38A 2PBGA 5BXRA 1V7AA 3FHAA 3VO0A 1DP0A 1OVDA 3LHVA 4AZ7A 3QLLA 5AB3A 2XTKA 1KRCC 3WDPP 3WD0A 3G1SA 3GXTA 4BEUA 1ZBCA 3WNOA 2XH7A 1EP3A 3CMJA 1ZNNA 3WLRA 5C0QA 4YTSA 3A12A 1AQHA 3KAOA 1JCYA 3LHZA 1EJSC 4LSBA 1Q5MA 2POZA 3IV8A 1R9YA 5D30A 1QBBA 1W3HA 4ZFCA 2GJLA 3URAA 4N9EA 3G5EA 3HG4A 1E0XA 2XVLA 1M65A 1GOKA 2ZVIA 3EDFA 3RCMA 2Z7GA 4AZ5A 2X1SA 1W37A 1X97A 3SCVA 1XRVA 1VBUA 3FYYA 4G8TA 4GBUA 3UZJA 3ZQ9A 2OU4A 1UW9A 3IJIA 3K13A 4UTUA 3DOPA 4QLJA 3CZKA 4W88A 4JTUA 2R8WA 3W3OA 1FFQA 1W2VA 1T8XA 3QJAA 3W28A 4U3AA 3H2OA 2E67A 3IJ9A 3UXDA 2Y8VA 3VNYA 4MLJA 3Q4DA 2FZMA 3OIHA 1B1YA 1W9PA 3GKFA 4RPQA 4CN6A 5B7YA 5D9PA 3XIMA 1VF8A 2D0GA 1MEHA 3QHOA 3EOUA 5GJPA 3BZGA 3S9IA 3Q67A 1OB0A 4A22A 4GVGA 5BU6A 4M24A 4JL1A 3ITXA 3POCA 2CLMA 3ARYA 2C15A 3KWSA 1HX0A 1UP0A 4K68A 3BLFA 3D5HA 1KFWA 2O9TA 1PBGA 5H6HA 2VRQA 1I9CB 2D24A 2G3JA 3BVJA 4IH3A 4XWUA 3FSUA 2ALRA 2YCJA 4IMFA 1H3GA 3ANUA 4D8AA 4WSKA 3L7RA 4FR1A 3S5OA 2BY0A 2WM0A 2PWDA 3PZGA 1E9YB 3V5FA 1CGXA 3GDLA 2CLFA 3T8LA 3R12A 4AHPA 3LCWA 4EIVA 4JFUA 1EHNA 1T96A 4FPSA 2BODX 4JD4A 1V3KA 3V16A 4GISA 4JNMA 2A3BA 2IKJA 2O7QA 4P7NA 4DO5A 1MUMA 3ITVA 3IRSA 5CPQA 2GUUA 4NUWA 5KMYA 3C2EA 1KM0A 3IIVA 3VUSA 1JR1A 1QHOA 4IPLA 2ESCA 1JZ6A 2J24A 3A6OA 1NDWA 1YNPA 4A8IA 2XHYA 3UR8A 3PBWA 1R9XA 4WJXA 5ABGA 1QWKA 2KX9A 1M9HA 3OLEA 1O5XA 2HS6A 4GKTA 4XTIA 5LIWX 2PTWA 4PB5A 1M1BA 3V18A 3WLQA 3CMFA 5I00A 2FPTA 2XH2A 2QJIA 2GQ3A 1QMLA 3PFRA 3ZZ1A 3A3HA 4MTVA 3GG1A 4GGBA 1RSCA 1VS1A 2J4GA 1PJ9A 4P5UA 4WKAA 2PDLA 1M41A 3I3BA 1VRXA 2DZWA 4AD3A 4BI5A 4S38A 1OFRA 3CUZA 3T55A 1RVGA 1PCKA 3GXFA 4UNKA 1K4GA 4YTUA 1UD4A 2XFRA 1F9CA 5A5WA 1X96A 4WGXA 1EEXA 2HBXA 3M5XA 1O5KA 5LHEA 1VFOA 3G77A 4GI9A 5D05A 3U0HA 4LV9A 3W1RA 2ISFA 3GVVA 3NQ8A 2XU2A 1XLBA 3VZXA 1GQIA 1E73M 1Q7QA 3QZ6A 4EXQA 3UT0A 1IHIA 3N4AA 3UXIA 3WFLA 5EY5A 3BXWA 4GNJA 3CHCA 3TN3A 5K4ZA 2B7PA 3GG0A 2NXHA 1CGWA 3IGSA 3AOFA 4KBXA 1YE6A 3RX4A 2VD8A 3EA3A 5AY7A 1FXQA 1UD2A 1FFRA 2D2OA 3NL2A 1CLXA 3GH4A 3MB9A 1S2WA 1A0DA 1KD0A 3PNZA 4HA1A 4W5ZA 3B03A 3BJFA 4IJRA 1P0BA 1VB9A 1K8CA 1NQ6A 4J3WA 3UNTA 4HOXA 2J7CA 1V3MA 1UUMA 1KWKA 1RV8A 4RNFA 1JZ4A 1NP0A 3AFBA 2YYUA 2PUZA 4IPIA 3WQFA 2VFFA 2DDXA 5KZDA 3MSGA 4Y2WA 3JZEA 3S6DA 3L12A 1LLOA 3AXHA 3S42A 4FOKA 2DEPA 4H19A 4NX5A 4CQAA 1LYXA 1QUMA 1RP8A 1PB0A 4GJJA 4CD4A 1IWPA 1SO3A 4OGZA 4L4MA 1TTQA 3OODA 4RW5A 4PCNA 3O2LA 4UTLA 1RBAA 1ZJBA 5EMUA 5TNVA 5HNUA 1FWNA 3LMZA 4W7VA 1LLZA 4M1BA 3VIOA 2W67A 2ZTKA 4ZQRA 1QHPA 1K03A 2PE4A 3VDAA 4EWND 4ZB2A 1UJQA 1A47A 4ZSUA 4J1OA 3L2LA 1TIWA 2QULA 4WX2A 6ENLA 2NXGA 1SW3A 1FH9A 1P7TA 2Y88A 2ACRA 4I7WA 2IXVA 2A1YA 2QDDA 1EF3A 5I6SA 4W9TA 3UYIA 3VGDA 2YL9A 1ZBVA 2E8ZA 4AY7A 5JIWA 3EAUA 6REQB 4ACZA 2RDTA 4I5RA 1J0ZA 1XLKA 4Y96A 1SSGA 1ZCOA 3OA3A 4WDTA 1JZ8A 4UTTA 1UD3A 4BHYA 3NPXA 2DT0A 2E5BA 2DSVA 1IQ8A 3RX3A 4PZVA 5LGZA 4BI7A 4PCPA 4HNNA 4Z08A 1SJBA 3A3WA 3NXLA 4JN6A 5PTDA 1XC4A 3NNTA 5A6TC 4TIMA 1BQCA 4MY1A 2BZNA 5DFAA 2PDGA 3RNDA 1R6WA 4L4OA 1JL8A 3SSZA 4B2DA 2YR1A 4HBKA 4Q4RA 3B8SA 1DIDA 1FH7A 3TXZA 3BGGA 4GC3A 1BXCA 3W7LA 4S39A 1R2RA 4OOZA 3W7MA 1J79A 3HQNA 1C8XA 2DT2A 1D8CA 1DJNA 3L5AA 3O05A 1S39A 5H91A 5D02A 3LCXA 5ECUA 1IXNA 3W4RA 2GSJA 1J11A 2JKPA 1REQA 1Y5VA 3VM5A 1XL9A 5AHEA 2Z00A 4AVNA 4CNUA 3AHVA 4LYKA 1UOZA 4GUGA 2BVDA 1WNOA 2BDQA 2FVKA 2WVTA 2Z29A 1PTAA 5AC8A 3F4CA 1GW9A 4JTJA 3WQPA 4BJHA 3V0SA 1E6ZA 4HK7A 1PEZA 1MUWA 1RD5A 3WLNA 4TXEA 1UR2A 1S2VA 3TSDA 2XYLA 3CJPA 3G1FA 4HMNA 4UQAA 5GPRA 1OJXA 1MQRA 2WXDM 3BW4A 4PRWA 3RAOA 2ONEA 1OCNA 3TJIA 5DO8A 2ZWZA 1XISA 4OKDA 3SRKA 1MRAA 2PB1A 3IAQA 1ISXA 3WLPA 3AS3A 5GNYA 5HPOA 4I9JA 4KWWA 1E0VA 2HDJA 1E72M 1OADA 5LHFA 1MNZA 3CT2A 4R85A 3BL3A 5DT7A 1FWTA 4GKLA 4U31A 1TPWA 1W3KA 4FSAA 4TX8A 2BFGA 2OSYA 5LZLA 1QT1A 2E5CA 1G5AA 3ARTA 4J2PA 3BTNA 4YVVA 1KGUA 3PNUA 4AIEA 2FTPA 4K38A 1V77A 2TSYA 1K77A 3R0UA 4UTWA 3DN5A 5DQPA 2X2GA 3E2RA 4CUCA 3I6RA 2P50A 4IISA 2VWSA 3KVJA 1W1B1 1JVNA 4CQBA 5C70A 3ABOA 3CUGA 4J40A 4ES4A 1L6FA 1O7AA 3TLLA 1GOMA 4XBJA 3CZGA 3WZ0E 4CNSA 1TELA 4AZCB 3MWCA 2GYIA 2ZADA 1GZGA 1SO4A 1PWLA 3BCJA 5MKGB 1UUQA 1OCBA 3G6LA 4M8UA 3V5OA 4RV3A 2Q3RA 2ZOXA 5DMYA 4Y7EA 3SGUA 2H8XA 3MVTA 2B7QA 3RIKA 3DFQA 4ZCWA 1ZJHA 1XFBA 1MMFA 1TB3A 2ZUTA 4X63A 4AZIA 2BHYA 4N6FA 5CJMA 2V5JA 2E9MA 3DG3A 1GW1A 1CYGA 1J18A 1THFD 1EEPA 4O12A 2YA0A 4DQWA 2J13A 3OBEA 3LYEA 1ONEA 5AYBA 3CPRA 4Q7IA 4NX0A 2R1KA 4JTKA 4OHQA 1ZS2A 1OK6A 1KXHA 4DJFD 4C1NA 3PS7A 3HQPA 1A5CA 3ZJKA 3WH8A 1HP4A 1LQAA 4PTVA 2V30A 2E09A 1UB3A 4XUYA 5EMLA 2W61A 1AJ0A 2XIOA 1UHVA 3VFLA 1PZ0A 2WNQA 1BD0A 1TZ9A 3WH5A 1V08A 2G41A 4W85A 4RXGA 3JVAA 4KRTA 4BWLC 5G4EA 1Q4WA 4FNPA 3ZMRA 1BWLA 3EOSA 1V6TA 2AL1A 4M6VA 1KRAC 2EQDA 3AU2A 1EC7A 3AXIA 3QHMA 4HHLA 3GTIA 5M1TA 3H21A 3MO7A 1FA2A 2X05A 5A8NA 4ALDA 3SO7A 1FCUA 1RCQA 3C4UA 2VM8A 1KGXA 1V0MA 1SMDA 4MZ1A 2J66A 3OTRA 1SR9A 4WKHA 5A6KA 3U4AA 5KZEA 3VU2A 2WBKA 1HGWA 1XYZA 4J4KA 2A79A 3TA6A 4J3XA 3SRFA 1HVXA 2PWFA 1K4HA 1TRIA 3R8RA 2ISWA 2RGLA 5HWNA 3LV5A 5C7VA 1DTUA 2W92A 2VNCA 2X1TA 2WYSA 4FXRA 5E09A 1EA0A 4LEFA 2VCCA 4OJYA 2Y8UA 2X40A 2IKIA 4NZJA 3SN1A 3DGBA 1PYMA 3N04A 3PFMA 5A6MA 1CLVA 1RA5A 1FTXA 2Z7KA 3N4EA 3AMDA 4MOZA 4PN2A 5HBFA 3WH9A 3CEPA 3W70A 3LTYA 1GQNA 4F40A 5GJNA 1TJPA 4REQA 4DUWA 1ODZA 4HHHA 4FS9A 3N2BA 5D4YA 4XO6A 1J2BA 4WKFA 1Q7MA 1RY8A 1Z42A 2G0WA 2WW5A 3G0UA 4B5UA 3THCA 2YCLB 1WE5A 1Q13A 2V67A 3LBMA 2X8RA 4EE9A 2PSNA 4AEFA 4B15A 4QNWA 2V5LA 2Y2WA 4O1CA 3IGUA 3GSMA 2XVNA 3NQAA 4KERA 1Y5XA 1XC6A 3VGBA 4ONVA 3JUGA 3VMPA 5FEWA 1LOQA 4C60A 8XIAA 1QPRA 2PDHA 1S5NA 3CQIA 4PTDA 2PC4A 4LF1A 2INEA 1Z69A 1XPYA 2D73A 5FJRA 4RZBA 1CNVA 2OSXA 4H9ZA 2X42A 1QATA 3WH7A 3GLCA 3CGTA 3KTXA 4Q4PA 3ES8A 3SRDA 1KCKA 1FDYA 4M6PA 4YLWA 4LUJA 3KBWA 1ME7A 2VENA 1GVEA 2VX6A 3NQVA 2PAJA 1Z44A 4ZL1A 1LL4A 5LA0A 4CVWA 1C7SA 1HTIA 1OYCA 1SFLA 3RPMA 4UZSA 3SN4A 3O6CA 1G4TA 4OFCA 3SAZA 1BSIA 2HVOA 3P81A 4F8XA 3SY1A 4LC6A 3GB6A 4D8LA 4C6BA 1EJ7L 2I17A 4OQVA 3KM8A 3K8LA 1AFSA 4H6QA 3NQFA 1UC5A 3GU1A 1MW2A 3HB9A 2Y5JA 3L9CA 5JBEA 1ZL1A 3UG5A 2HVMA 4A05A 3CUJA 1LQ2A 3L2IA 4DAIA 5A8GA 1Z6KA 4FAMA 3W7QA 5HWMA 4I5XA 3PHAA 4F0SA 3PG9A 3RU6A 3GD6A 4JKKA 1TWZA 3S2NA 1KRMA 3LCFA 5GNZA 1GT8A 1P0NA 1SUXA 1QWGA 4Z1BA 4C6FA 5H2ZA 5LIUX 3VGGA 1D3CA 3FHQA 3T40A 1R3SA 3T0DA 3OZOA 2D22A 2X41A 3BGAA 1W0MA 3KVMA 4A8NA 2ZX6A 3GW3A 4IIHA 2A3EA 4ADTA 4BI6A 1EP2A 3PZMA 1RUSA 4DNHA 5FAGA 1WYIA 1UP3A 3N2OA 1CW2A 1RJQA 1A3WA 5EA9A 4JDYA 2JEQA 4LAZA 2FIQA 3S9ZA 1F8MA 2PDNA 3CB8A 1VCGA 1VP5A 4IIEA 1IT7A 3QQ0A 2NVDA 4IMEA 1VEMA 4TVUA 3WUEA 4RE3A 3KRZA 1RCOB 3T6CA 4JTQA 4NQ1A 4GZIA 1HJVA 2DFAA 1F6PA 3QTPA 2VX7A 1VQTA 1F6KA 2BTMA 4J7RA 5CLTA 4E2DA 1UA3A 2OELA 3TCSA 1MRQA 4DF2A 4ERIA 3MUY1 4HZMA 1UASA 2OT0A 4M0XA 4CU8A 4Q8MA 4MWAB 2VP8A 4GUIA 4J28A 1IXPA 2F6KA 1ZRQA 1X7FA 4AMCA 2QF8A 4O0KA 1K7EA 3ITTA 4Y8EA 4HCDA 1Y8BA 5HJLA 2CESA 2OYLA 5KETA 3TOYA 1DJYA 1H49A 1YTEA 5LXXA 4BCEA 4AEEA 3C8FA 4KMQA 5J5DA 4QBXA 3EMQA 4XAFA 3TSMA 1U1HA 4D6JA 5I7GA 4AD5A 1QK0A 3RRAA 1XLIA 5BOOA 3GNPA 3T0CA 2XVPA 4OV9A 4B5NA 1XDMA 1KBIA 1UG6A 3DYPA 3BSGA 1ITUA 3BURA 5E9AA 2EO7A 4IP4A 1IZJA 4H8UA 2I5IA 1AUSL 5DANA 2FZ9A 3NVDA 3BQ6A 2TMDA 4D9PA 3TC3A 3RU8X 1SZEA 1RQEA 3WNLA 2MUCA 1XLAA 1W1A1 4R9OA 1E9LA 2G97A 3MWAA 1XBYA 3VC5A 5DRCA 1UR0A 4S3JA 4ZO6A 4QTGA 5J5RA 2B0MA 3VKCA 3VIIA 3WF0A 3NIYA 3WQ8A 3L2MA 3BGJA 3POHA 2CBUA 4ZENA 2PGFA 4RR4A 3H2AA 4Y9NA 3ZVHA 5FJTA 4E5TA 3ZFHA 3GFZA 4PMYA 2VX5A 3TW7A 1BEUA 4HNCA 1K7XA 5I07A 3B9DA 3RM4A 4DBDA 3N15A 1NFPA 3T0TA 4BQ3A 4D6FA 1VR6A 4OWGA 1DHPA 4LTSA 3CNYA 1N55A 2DQXA 4GYPC 1GVSA 2NV9A 3UEQA 4IPPA 4DAFA 1HXJA 2VFHA 3P74A 2Z27A 3L67A 4JFTA 1UA7A 5HPCA 1H7RA 3DECA 3AJ7A 2QDHA 4O52A 4KPLA 4W84A 3E0WA 3VZYA 1Q3NA 1DVJA 4ORMA 4X2RA 4QAWA 2E7FA 4PMOA 4LYRA 2CWXA 4OE7A 4XBSA 4NNAA 1TVLA 3JR2A 2A3HA 2WKGA 1Q6DA 1PDZA 3ECQA 3W1AA 4JPGA 2H9AB 4H9UA 4QE1A 4IP5A 4UIOA 3VKJA 3UG8A 3DZ1A 4BF7A 4JHZA 1W3IA 4LCSA 4O1EA 1H5VA 1YMYA 1QNOA 4R27A 3F2CA 4AZHA 4UB9A 1MZRA 4XD5A 1H63A 2H90A 2XFWA 3KVLA 3GU2A 3L0GA 2FGZA 5EMYA 3KBNA 3W6YA 2P8CA 4KEUA 3BLIA 3HURA 1YLVA 1TPB1 1KTNA 3NTYA 4YWIA 3AROA 1Q6OA 4A8LA 1EX5A 2PWVA 3TWAA 2HCVA 4QJ3B 5CJNA 1BYCA 2CU0A 3HGJA 5D2XA 3B0XA 3HQOA 3W7JA 4ROPA 4D6IA 4UTIA 3PC0A 3FDKA 3DFSA 1X6UA 4GWEA 2J74A 4ML9A 1LZOA 3UA3A 1A5OC 2ZRZA 2ZVRA 3PB2A 3S2MA 3E5PA 1OX6A 1UWAA 2E6AA 3MDWA 3B9NA 3VNMA 3W23A 1OF6A 1C29A 2BXYA 4LRSA 1R86A 3KWXA 3CV6A 3L23A 3T9PA 2YBUA 3UZZA 4I5UA 3LHYA 5CC6A 1XF0A 2OPJA 4MSSA 4CD7A 3BZJA 1XBVA 3WD1A 4F0KA 4C5ZA 3TTEA 3C5QA 1E51A 4DLMA 1X8CA 1KA9F 2OOFA 4ZBCA 1JRBA 3VNJA 2GQAA 3F5KA 3W29A 2QCEA 4PBFA 2G96A 4IFOA 2PP0A 3LGGA 4GNVA 2YDAA 6PTDA 9XIAA 3FA5A 2P8BA 4XKMA 4IIBA 1VHNA 1HKVA 3K30A 4RE2A 1FRBA 4PL2A 1HIZA 3LHWA 5FKYA 2G50A 1WDDA 1FWDC 2WSQA 3IJQA 1ZENA 4O11A 1BYAA 3R4IA 3LEPA 4FF7A 4LB4A 3K46A 1PX3A 4PULA 3VILA 1XSIA 4GIYA 2QUVA 3EWZA 4XG1A 4J2MA 2J77A 3LV6A 1UWSA 2VEGA 1VD6A 2REQA 3RO8A 4KEVA 3KOYA 2ASHA 3A3XA 2UY5A 4LEQA 4G1NA 1KM5A 4QISA 2FZNA 4IL0A 2D2JA 1LBMA 2FZBA 3OHMB 3L21A 3MKVA 1EO7A 4X2PA 2WWCA 5CGTA 1B2YA 1SJAA 4F2UA 4DUXA 2E6FA 3RGTA 2P3EA 1IEVA 1XICA 4WOQA 3PZ9A 5AKQA 1F6YA 3KCOA 1R2SA 4W87A 2PGEA 2YFNA 4FOUA 3G1AA 5AHFA 3SGGA 5CBIA 3K4WA 3CBWA 5BW6A 1JF6A 2J88A 4OBTA 3C52A 1B9BA 4H8HA 3SIZA 3EPMA 3VMNA 1AW2A 2CITA 5HNNA 4UR8A 4AWTA 1JPKA 2GQ9A 3MCOA 1XYFA 2Z6IA 1SMAA 2FQIA 2X7WA 2XIIA 4MWAD 1QRQA 3TTSA 3GXIA 1P0EA 2NX9A 3VNDA 3PUOA 4RV8A 2NUXA 2J75A 2ZXQA 2ATMA 1V3IA 4DF1A 4E38A 1TIMA 3PTDA 4A8RA 4JFWA 1UD8A 3N13A 3FCPA 3SN0A 1DJXA 1UWIA 4YTRA 1W5NA 2ZFAA 1IEQA 2P88A 3QHNA 4MY9A 4QDWA 5CXPA 3SUVA 1A4LA 3NPUA 4HK6A 1S1RA 1WA3A 4JY9A 1FWJC 4XTDA 1GOIA 3VCRA 1VHCA 1E0TA 1RP9A 3TP4A 3W71A 1JFXA 4V33A 3T2QA 1G4EA 2CNCA 1AQ0A 3FVMA 4C91A 1K6AA 1D3GA 2PWEA 3DENA 3FA3A 2V81A 2VR4A 4WD0A 3NYDA 4PMVA 2VKZG 2GDVA 1L8PA 3UR7A 3DGRA 1PTDA 2YCKX 2PZNA 3SCWA 3SRHA 2VFEA 1KFCA 1FWBC 1JUBA 2ACUA 4F4RA 1Z8AA 2PURA 3VD9A 2QJHA 1V02E 4D8ZA 5A3HA 1JAKA 3U2OA 3ITYA 3WQOA 3IIOA 2HPIA 4UR7A 2X0YA 4GNKB 4R7JA 4C90A 4DYJA 1F3WA 4WLCA 3BG5A 5M3WA 7REQB 4GH3A 4QLLA 1LWIA 4NZ3A 4E4PA 1DPMA 3U6WA 1QNSA 1A5MC 2CZEA 4NZ5A 1W9BM 3O63A 4AZ6A 7ENLA 3GIPA 5EMJA 4WHBA 3MDUA 4LNYA 4OBSA 4LUTB 2WZTA 1VJIA 4G1KA 2KZHA 3U5YA 4EWJA 2V38A 1EA9C 3V36A 5E9XA 3IWPA 3T0BA 2G95A 1RJRA 4QJ1A 1US2A 4ZSTA 1UMYA 3E1F1 1SFTA 4A29A 4MAVA 2WB5A 3NG3A 2C19A 1S2UA 2EPMX 3MUZ1 3TQ0A 3W7PA 2YB4A 2Y5SA 3SDOA 2IQTA 3HOJA 4HHMA 2ON3A 4JX6A 5ABTA 2XM2A 1DL3A 2R14A 1E5NA 4DXVA 1AW5A 2NSXA 4R7WA 1TTPA 4M19A 1HKMA 1XKYA 4FALA 1XIHA 5DCDA 3IJDA 1PKYA 1PCWA 1IE7C 4H1ZA 3GC5A 1AJ2A 4PMJA 2LLEA 2W63A 5IBXA 4B90A 1RY0A 3U57A 1BVWA 2DVUA 1X39A 1M68A 3UXAA 4L4PA 5H8PA 1GTEA 3GNOA 2AOSA 4WSHA 4MUPA 3T42A 2DJLA 2X30A 4NJHA 3APGA 3TTOA 3WUGA 1OCJA 3QSRA 4DHGA 4G7FA 3A4XA 4IIDA 3W87A 5LA2A 2D2GA 1OWQA 3W2KA 1JGIA 3CB3A 2ZQ0A 4W5UA 1XCWA 2IXUA 1DJZA 3UPMA 2EAWA 1CXEA 3K2GA 4GI6A 4HQVA 3MCMA 3PULA 1LP6A 1YTKA 2CEQA 2XM1A 3LGDA 1OX4B 4G9PA 4AIOA 4EKJA 2E9LA 1HO4A 4P7RA 3BW2A 4ZXOA 4H2HA 4J3ZA 1DE6A 1M03A 2WZEA 1BFNA 3ES7A 3N34A 3RN6A 2VOTA 3T78A 4DN1A 1I6NA 2A6NA 4GUJA 4N02A 3IAPA 4TUFA 4M81A 1Z41A 4KCUA 1QASA 4ZVJA 2YKKA 3VFCA 4IZGA 5FEXA 4TVDA 4F0LA 1GK8A 1A5LC 1QPQA 4LF2A 1A50A 3W9ZA 5JU6A 1HKWA 1O5RA 2FGBA 3QM3A 2EJAA 5CGQA 4FIRA 1ME8A 3BAXA 2ABBA 3NQBA 2ZXAA 3WN6A 2VELA 2DP3A 4GFSA 2J62A 3ZM8A 3DYMA 2F6XA 3NZQA 2BBFA 2OMAA 3FW6A 1XQKA 2G37A 1S5TA 1TR1A 3USBA 4KRUA 1NFBA 2DJXA 3S5YA 1O12A 1LUCB 1XD0A 1UUOA 4D6GA 3N2TA 1UD6A 4IG2B 1W5PA 4WIWA 2POTA 2Z0IA 3UWUA 2OLHA 2V8ZA 3O16A 3W1UA 4MYXA 3E6EA 3W2UA 1TX2A 2Z2UA 3MA8A 1O68A 1GZJA 2V69A 1GG1A 2CHNA 3S2CA 3G6MA 3CIVA 1KR1A 4UTJA 2ATSA 3EWYA 2J6VA 3AISA 1CECA 3WK2A 1K8YA 5LGXA 3KTSA 1TO3A 2IKHA 2Y62A 4NIRA 1EO5A 1GJWA 5C54A 2JF6A 3HGOA 1XCXA 3NZGA 1XPGA 3LUTA 3W7KA 1BGAA 4Q8OA 5AVNA 5EMKA 1J0HA 3REQB 2WLYA 2Y1HA 4OOUA 3H7UA 2F2HA 1KB3A 4PC8A 1XGEA 1NWTA 2Q71A 1UH4A 4V1YA 8TIMA 1V6WA 1KV5A 3C0JA 2ZUNA 3QY8A 3WLIA 1MQPA 4HPGA 3IK2A 3R8HA 2WHMA 3GRIA 4IGMA 1AVAA 3GIQA 3W86A 3KX6A 4ZQMA 1TPEA 4RJEA 4ZOEA 1FX6A 3QGAC 4UUIA 4QCEA 4S3GA 2ACSA 3OU8A 3L66A 2YL6A 3WJYA 5BXTA 3VIJA 3DFHA 4BY3A 2YSWA 3DCPA 3ARRA 4GQQA 2WMJA 4MDPA 2R1LA 3G2GA 1GOQA 2QPXA 5D2YA 2YBVA 1MWOA 4GYJA 2BNJA 2DSUA 2ZWYA 2ZX7A 3G24A 1DOSA 4M80A 3CT7A 2ZXBA 2BSLA 3N3MA 4FLOA 3R89A 1L9WA 2ZZ4A 2JFEX 2P76A 3MS8A 3LCHA 1UR1A 5A94A 2JKAA 3GXNA 4C1LA 1MFUA 5KITA 3OIXA 3MMUA 4LBRA 4YVXA 4IQEA 2VZOA 4GK8A 3U7VA 3W7OA 2TODA 3ITLA 5I78A 1LQ0A 2JGQA 3MI6A 3W7HA 4NF7A 1FVPA 2WO5A 2SFPA 1S2AA 3LG3A 4XZHA 4OVXA 2VUNA 3TR9A 3ZR5A 1FWHC 2B7OA 3HN3A 1RPKA 3CQHA 4XVEA 4H3DA 3ZVIA 1VRDA 3T08A 4JTAA 3EZ4A 4OECA 2OZTA 2FHFA 3S1WA 5I0DA 1Q8AA 4PFHA 4AWSA 3AI0A 3KP1A 3UF9A 4FXFA 2WMIB 5C2GA 5T9BG 4DZHA 3TC6A 2VRKA 4NI8A 3UJEA 1F7BA 2QGYA 3VTRA 1P0DA 3AYTA 3BQ5A 3T07A 4PCSA 1QNRA 2HE5A 3PUEA 5EB8A 3D0CA 4RXFA 5FA5A 4O17A 3AWOA 1P1MA 3IACA 2VR5A 2QCGA 2WQPA 3LXAA 1V0LA 4ROQA 4LCRA 3EOLA 1FY6A 1A5BA 2O0TA 3R0DA 1BF2A 1JULA 3L4YA 3KOWA 4V27A 5C9UA 4MB4A 2V82A 5AC7A 3GYEA 3LPGA 1RQHA 5TD4A 3VDGA 3B9AA 3A4AA 2CXEA 4NILA 3TAOA 2ZX5A 1T40A 4RDVA 3KEHA 4ATDA 1JZ5A 1TREA 4ENLA 4F2TA 3H7VA 3EDEA 4HMEA 4NXSA 3D6NA 1MVYA 4GPNA 1IR1A 4QX4A 3DUGA 2CZ5A 3GK0A 2NX3A 1EKOA 1XYAA 3N14A 4HNOA 3BE7A 4NJKA 5E6YA 3TJ4A 1XLEA 4CD6A 1EGZA 3WH6A 5K7JA 4NY2A 4LS0A 2D1ZA 3E2QA 3ZIZA 4JFVA 4LBSA 4XZ9A 1AL7A 1C91A 2G4FA 2UWFA 1RK5A 7TIMA 3AICA 1GPWA 5D8ZA 3PANA 1E56A 3LHTA 2ISSA 3CUHA 3EB4A 4DI9A 4HU4A 2JF7A 3SI9A 3GXDA 2OSWA 2GJNA 4K8GA 9XIMA 1A3HA 2XGZA 3AIUA 1Q6CA 3PWIA 4ZQOA 2ZZ3A 1W9XA 3BSHA 4GVFA 2PU1A 1Q6LA 5CPTA 3W37A 1WUEA 3EB2A 3AIQA 4IT1A 1Q2SA 3BO9A 5I03A 1M7OA 5I3HA 2WOQA 1JF5A 2H3BA 4L9XA 5A6LA 4O1DA 1O1ZA 3H4WA 5CEWA 3H2NA 3WX7A 1LJYA 1H50A 1GWJA 4Z2HA 1W9UA 3V0TA 1AMKA 3P60A 4JAWA 4LUIA 3URNA 1Q6EA 3Q37A 3W22A 3VIPA 3MUXA 4GQBA 3E12A 2OO0A 3I6EA 3W81A 4AVOA 1EJXC 4D6DA 2OEMA 4QG9A 3MT1A 1TJ0A 1CXLA 4V1XA 1XD1A 3AMKA 3N2CA 4AZBA 3GDTA 3WSUA 3MYOA 1WBJA 3GTXA 2YJQA 3KLKA 3NQMA 1MW0A 1XJBA 2V68A 2AGTA 4QEEA 2Q6ZA 2AL2B 4DJFA 1U5VA 3AO0A 4QAIA 1LLWA 1V0NA 2GVYA 5I02A 2VGIA 4AD4A 4Q8UA 4JN8A 5K9XA 4L6DA 1DBTA 4CCDA 3WBAA 3LENA 5G4WA 1S2CA 3UA4A 2ZUWA 3RUBL 5RUBA 4NHVA 3DG6A 1VH7A 2HZGA 3CL7A 2BB0A 3EXRA 3MUIA 4O54A 4CN4A 3BG9A 1PHQA 2IS7A 1R3VA 2C7FA 4E0CA 4N4QA 1GHSA 3DFNA 4RE0A 3N29A 1J10A 2OODA 2G4JA 4X22A 3UZXA 3AMGA 1QVBA 2CETA 2V5CA 3RO6A 5IM51 3CPGA 3NSXA 3JZUA 4L64A 3RITA 3G3DA 3ZSSA 3OQ8A 3GHRA 5BNKA 5I3FA 5M2FX 1O6IA 3KUMA 3LZ5A 3MSRA 1PKNA 1S5VA 3UP8A 2WNWA 1EWDA 2E3ZA 1EIXA 4JN7A 3DBNA 2VTFA 2PMQA 2J7GA 5HJXA 3L4ZA 1O95A 1YTDA 1JUEA 1I60A 1OG6A 1AH0A 2OTDA 4UC5A 1TX0A 2CHOA 3W53A 3TJXA 5A6BD 1JEZA 1H7NA 2ZC1A 3P2VA 5A8OA 1G9HA 1VCVA 3STGA 4XZIA 4JTRA 4PMUA 4QDPA 3N19B 4IMDA 3W00A 5I09A 1LOLA 4DM1A 3BMWA 1KC7A 3GZ3A 4RE4A 1TQJA 3U48A 1GPFA 1I75A 4E8DA 4GX8A 4L1GA 3TFXA 1GOOA 2NVCA 3EX6A 3INPA 1J8VA 2BOEX 2BWGA 1R3TA 5A2AA 4L5ZA 1PXGA 4C6OA 5FI8A 3GTFA 5AHMA 1WDSA 1DQUA 4X0NA 1DIOA 4TQTA 5EPDA 1HFBA 2Z1WA 3AAMA 4XKYB 5D09A 4L4LA 5G1YA 5J8LA 3WUBA 3W82A 3UQNA 1B90A 2E9BA 1GKQA 2PTDA 3NPWA 4X60A 2Q01A 1UR3M 4GHRA 2ZZ5A 3FS2A 3W7IA 4O16A 3ARXA 1EOKA 1H7XA 4GVHA 3CH9A 3N2MA 4X9YA 1QI3A 3E3HA 1E6XM 3CHVA 2A0NA 4V15A 1FP8A 4B5VA 4EOUA 3B8WA 2WSRA 4DWDA 4RNIA 2XIBA 2ZXDA 4LVGA 1JNDA 5JXQA 4PTNA 2HMCA 1XHGA 5DMMA 2TAAA 4N7QA 4QQUA 4S3FA 5JH1A 2QAPA 4F2BA 4GG9A 4IQDA 2C13A 1B30A 2J7FA 3C56A 1T5AA 4Q3MA 1T6MA 2RFGA 5EGRA 2Z26A 3QYQA 4HNVA 4IF2A 1QI4A 1HT6A 3H24A 2UY3A 3NDYA 2UBPC 3UYCA 1KM3A 4KH2A 3WQ5A 4UCFA 4AFYA 1GYNA 3K1GA 3W2LA 5A95A 5HULA 1LG1A 4Z0SA 4N6EA 4LJ3A 4ZE4A 1IZCA 3RJXA 2CKSA 4GO9A 4XISA 1TV5A 1F8IA 4K7YA 4LV4A 5FACA 4CVUA 3M0VA 1IT8A 3W7GA 1C9WA 1WZKA 3O6YX 1W3JA 3NQDA 3PTMA 4TV5A 3NUKA 3WQGA 4YCOA 3W6LA 1UWUA 3TVAA 3OPSA 3DI1A 4HN8A 3M5ZA 3UR2A 1VFFA 3CC1A 5CSUA 4PMQA 5FESA 1OM0A 4HA0A 3LCGA 3U2ZA 4DPPA 2WK2A 3GG8A 4KETA 2V6AA 2FPYA 5D9NA 1NAL1 3NSMA 1TQXA 4LOCA 1PV8A 3PAOA 4PUWA 1W3NA 4MNKA 1JPDX 2Q8ZA 2A21A 4LGXA 1TTJA 1EDTA 2RDUA 4JQAA 3C2YA 1GJUA 3NQ6A 5CBBA 1E3ZA 5GQBA 1R47A 1MO0A 2OQLA 3FKKA 1HL8A 1K9FA 4DBUA 2R9RA 2NQ9A 1AJZA 3LS9A 4FNQA 4U28A 1H2JA 1ONWA 5I3DA 3ARZA 4W7UA 5F7UA 4QJ4B 4E4FA 3W88A 3R6IA 1DTNA 1TMHA 5H8MA 5HANA 4AZCA 3W2JA 1LG2A 1EBHA 4P8XA 4CD5A 1FP9A 1RH9A 5MKGA 3EBVA 4LY8A 1VKFA 2YGYA 4Q6XA 4OT7A 5FEZA 3NO5A 2I56A 3PSVA 3FV9A 3F2DA 2HVNA 3KZSA 4FXJA 4DYKA 4ILSA 4Y9PA 3RCYA 4OIFA 3THDA 1HJXA 1U22A 1QO2A 1IYXA 3W1LA 2X0SA 4GABA 3UWVA 2YW4A 4XD3A 4DLFA 3W74A 4Q4MA 2XVKA 3VZZA 3WFZA 4CEUC 4A4AA 3FAWA 2GWGA 1UZDA 3QMTA 3AZTA 2ZIDA 4W7WA 2PF0A 4XK2A 3FDGA 2WJEA 2ZA2A 4PH6A 1KCLA 3IJ8A 4CEXC 1B3WA 1ECQA 2PDYA 3HG5A 1S5MA 4O1BA 4TX6A 4U3CA 1EJUC 6XIMA 3WCZA 3TROA 2QIIA 5HA7A 5DLCA 4AB4A 2ZKMX 2QVHA 3LSCA 2W6RA 1WCGA 2OVLA 4EPEC 1HKIA 1IWAA 2RDWA 4DJDA 4IUGA 3AS2A 4NL1A 4W8AA 5TQLA 1WDQA 2YXXA 3DEQA 1LBFA 1E0WA 2YB1A 3ALFA 7XIMA 5CAHA 2QUUA 4QGCA 1RXOB 1NVMA 3HG2A 4L6OA 2PDIA 4KWUA 3LCLA 1KFLA 3LY0A 1DJGA 3I68A 1QDSA 2EHHA 1TTIA 1CGYA 1LT7A 6TAAA 1I1XA 3RK8A 5D9MA 3NM3A 2HS8A 3KBVA 4C6KA 4IJBA 5IXEA 2HJPA 5AYYA 3UJ2A 2P0OA 4YTQA 3BAKA 3M0JA 5GJMA 3M0XA 4HPXA 2J7BA 4O53A 3DXIA 5H8UA 3H4GA 3D3AA 3GNXA 1V8EA 2ZRVA 4HU8A 4ADSA 1TG7A 1XLMA 4Z42C 4P7QA 3HMJG 1SYTA 2DPEA 4XX6A 5DCEA 2JK2A 4RK8A 1OIMA 3IS4A 4GI8A 4KFOA 1XG3A 3H7RA 3DHUA 1YBQB 2UV8G 4FR6A 4S3DA 4U2ZA 1BRLB 3GDKA 4WEVX 3OBAA 1VPQA 3ARUA 3ENLA 5CPNA 2XZ9A 3VAVA 1PVNA 3FJ6A 1WX0A 1GVOA 2Q02A 4QHRA 2DU2A 1KQZA 4N2YA 4A3UA 4K1WA 1TPFA 2WAGA 3FOKA 1QU4A 2A4AA 3TYCA 4DF0A 1LCOA 4IP7A 4QM1A 4UFJA 2WNNA 3WD4A 2XG9A 1A5NC 1OYAA 2BVYA 5LNRA 5ABFB 1J0IA 4YJ5A 1H7PA 5E0FA 1PIIA 2DZVA 3ERPA 1GKRA 3SR7A 1TUXA 4GZJA 3RR1A 2YCLA 3WDRA 3KBJA 4NJIA 4RLIA 5FAJA 1GVQA 1IR2A 1VYRA 4PR4A 2GK1A 3OG2A 3ZJ8A 3CTLA 4M29A 4XZBA 1UWTA 2XISA 1XIIA 2GGEA 4H2CA 1MEIA 4HSOA 4CNNA 1GYLA 1NF7A 4FK9A 1BG4A 2C91A 4E4UA 1R2TA 4OUEA 3CHFA 1NOWA 4A2RA 2VFIA 1QOQA 3WQEA 2ZZ1A 3R1ZA 4LVBA 3VNLA 3L5LA 3HIJA 2HXUA 1VLIA 3AJXA 3TC7A 4HJWA 1E4MM 1F76A 3VIGA 1Q8JA 3FJNA 1ZP4A 3GH7A 1UWQA 4H01A 3APTA 2PWUA 3NO3A 4CNTA 1MXGA 4RX0A 2PFHA 3HV9A 1VBRA 3IIZA 2CLKA 3OYXA 4S1FA 3W83A 3LQGA 5GVJA 4X3ZA 2OX4A 5M5DA 4DB7A 1PAMA 4UFHA 4MJMA 3VIFA 3CQKA 5L9FA 3EDDA 5E5CA 4PTMA 2WSYA 3CIWA 4Q4SA 4HT3A 2XVGA 4ZB0A 3LU2A 3H2FA 3FVDA 4NASA 2ZYFA 4KIEA 2Z28A 3CUIA 3OEXA 2QF7A 4PMRA 1QK2A 3SUWA 5DY2A 1C8YA 1WXYA 3EPOA 4NKCA 2BXZA 3QLDA 5CPOA 3JW7A 4B3ZA 1V6YA 3VD4A 1DWJM 2OKTA 4GQGA 3T0AA 8RUCA 2OWXA 5LIKX 3WLJA 2Z4GA 1P6BA 1JIBA 2E6DA 3WK0A 3CEUA 3AHTA 3MC5A 5CZ0A 3S1XA 4DJEA 3VE9A 1CXKA 1R87A 1XX1A 3PZUA 4DVOA 1NDYA 2E77A 4FEZA 4GH1A 3F4WA 1NWRA 2XIJA 2W5FA 1JG9A 1TVPA 4FB7A 3IIPA 1F74A 3CASA 2VJXA 3TZFA 3HGSA 4FZIA 2D2HA 2GGGA 1RJPA 1W54A 4GY0A 4L7ZA 4Q4KA 4IFKB 2RUSA 4FNRA 5D2VA 3ZOAA 2OQHA 1P6CA 2Z24A 4XV0A 1KLZA 2XFYA 3BW3A 4DI8A 5FD0A 3IV3A 3JRKA 3L68A 4S23A 3PN8A 1EUNA 1XDLA 1MUCA 1VENA 1WAUA 1E43A 1LF1A 1Q63A 3DKLA 2DORA 1NOFA 5HMSA 3WQCA 5CC5A 4H9VA 3N6HA 1E4IA 5G4HC 2DIJA 1DE5A 3VYLA 3VCCA 1HJQA 3CWHA 4C5YA 1SQ7A 1QI5A 2L5HA 3WNPA 5I79A 5FCZA 4MFEA 3RXZA 3TAKA 3W1TA 3TFCA 4MWAA 4L61A 1UR4A 1XUZA 1V93A 2C18A 3GUWA 3GVQA 5AECA 1ONXA 1BGGA 4DNMA 3M43A 2DSZA 1XH2A 1EJRC 4HNTA 1DWFM 1IIGA 2OKOA 2E40A 4LAOA 2BVTA 3BC9A 4TVCA 3TONA 3MHUA 3FLUA 1C93A 3N6QA 4D1IA 1Y0EA 2DT1A 3FEQA 1U1UA 3ARVA 4QDMA 2OO6A 3UZ5A 2AQVA 5DBUA 2PI6A 5HMEA 5CCZA 3VMOA 2BX7A 4MLRA 4Q8VA 2XN2A 3N2XA 1KFJA 1KWGA 3SQSA 4RZ4A 2F9RA 2I14A 3LBCA 4RKAA 5FJOA 1JCTA 4ATWA 1FDJA 3P0XA 2IPWA 3GX9A 4GQ0A 2RGMA 4LT9A 4FNSA 4KEMA 1FOBA 1SJDA 2HBVA 2IQ0A 2VEPA 3CTTA 3ELFA 3AYRA 1FWAC 1KFBA 3BAIA 1UC4A 3COTA 5CG7A 2J8FA 4QJ5B 5JMUA 1Q7ZA 1Z48A 3KE0A 4NYYA 1F05A 3RYSA 5BRQA 3UGRA 4Q32A 4DYEA 1ZZMA 3H54A 1VIZA 2OZ8A 2DIEA 3EOEA 1R7AA 3CMGA 1UZ1A 3VKAA 4IPNB 3T8QA 4AW7A 4LC8A