1B1YA

Sevenfold mutant of barley beta-amylase
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
500
structure length
500
Chain Sequence
b'MKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKDFLDAGVIVDIEVGLGPAGELRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDAGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKIAGVHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQPPDAMSAPEELVQQVLSAGWREGLNVSCENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYVNFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKIQPFPFQEHTDLPVGPTGGMGGQAEGPTCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (BETA-AMYLASE)
molecule tags Hydrolase
source organism Hordeum vulgare
publication title The crystal structure of the sevenfold mutant of barley beta-amylase with increased thermostability at 2.5 A resolution.
pubmed doi rcsb
total genus 164
structure length 500
sequence length 500
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b1yA00
2WM0A 1KQZA 3F5LA 1CLXA 2YL6A 1C7TA 3OLEA 5A6MA 2WMIA 2YA2A 3ARQA 2WZEA 1ZJAA 3QHOA 4AISA 4Q22A 5A94A 1U30A 1KR1A 3QGVA 4AXNA 1V0KA 4PTXA 4B9ZA 1GOIA 2FH6A 1VBUA 3WMBA 4GZEA 1XH0A 3DYPA 1B1YA 3THCA 1UKQA 3LPPA 4AY1A 3W29A 3EDFA 3AIRA 2X05A 3ZT5A 3WH8A 1PIFA 4QCFA 1FH8A 3ARYA 1QBBA 2V3GA 2ZXDA 3SIMA 1JL8A 4W5UA 1ECEA 2X0YA 3AOFA 1P6WA 1CGUA 1EDQA 2ZXQA 3BCDA 1KXQA 2Z1KA 3QHNA 2VX5A 4QDMA 1ZJBA 4M1RA 3L4ZA 3HMCA 4FLSA 3MUY1 4AD5A 1PZ2A 2CPUA 4NZCA 2VI0A 5C70A 2YL9A 3RDKA 1PEZA 3ALFA 1C3FA 4BS0A 1JAEA 2OSXA 1D2KA 2QMKA 3PHAA 1W9XA 4AMCA 1W1VA 3HJEA 4OUEA 2OYMA 3VGGA 5A6BA 1Q4NX 2YA1A 2EPLX 5KZ6A 3NYDA 4F66A 3WEZA 1DHKA 1WDPA 3AHTA 2E9BA 1WO2A 1CIUA 5LA0A 4E2OA 4D6FA 3QR3A 1E0WA 3FHQA 2WC3A 4CN1A 4D6JA 1CLVA 1KBKA 3AMKA 4F8XA 1QNSA 1MW1A 5I23A 1KQYA 2NT1A 4XUYA 3WUBA 4PYSA 2RGLA 2XHYA 4GO9A 4QAWA 2ZX9A 4ATLA 3MSDA 4MB4A 3SCOA 2E3ZA 1E4LA 2J7CA 4A3HA 4FLRA 2CBIA 2DT0A 1EHAA 1NP0A 1WZMA 3T2OA 3EBVA 1W2VA 3TP4A 1FHLA 2EPKX 3WEMA 1E56A 4AZ7A 2E40A 5HPOA 2W4XA 2GK1B 3AHYA 1IZKA 1Q6EA 2JEQA 3KL5A 1UKTA 3PZQA 3CGTA 3GBDA 5LA2A 5D9NA 2WCGA 3U5UA 4FLOA 1QHOA 4HPGA 1I75A 1BVZA 3WH6A 2BXYA 3ARPA 4UOZA 1F4AA 2CBJA 1BTCA 1CGYA 1H49A 4MTVA 1BAGA 5A8PA 3DHPA 5EFDA 3G6LA 4N0RA 3ZR6A 1W9BM 1KXVA 5A6JA 3RJXA 4ZE4A 4BQ5A 1GVIA 2BY3A 1WPCA 4Y7EA 1X6NA 3SUWA 4D1JA 2WC4A 1B3WA 1AQHA 1HJSA 4TXEA 5D9PA 2WK2A 5HDRA 4PCSA 2CBVA 1PAMA 1C92A 4UFJA 2VO5A 1W32A 4UNIA 1JZ2A 1V3JA 1WE5A 3F5KA 1UWUA 1X1NA 4CVUA 2J25A 3SCQA 1W3KA 4L4PA 1HJXA 2YLAA 3VD4A 3WBEA 1B90A 4QLLA 1V6WA 1NOWA 3FNDA 4EK7A 1UG6A 1LQ0A 1UYQA 4FLQA 4JIEA 3NSMA 5A6KA 3EDDA 3WQ8A 3AHZA 1UD8A 2XWEA 1Q6FA 1E3ZA 3N17A 2OWWA 4PMXA 4R5EA 2EPMX 4S3KA 1UUQA 3CBWA 4LGXA 2VQUA 1TG7A 4B3KA 4GI8A 5BYWA 4F9JA 3GXIA 1C8QA 5HNNA 3OGSA 4W89A 2WW5A 3TTSA 2BS9A 4JHZA 4EKJA 2TAAA 5CPTA 1UZ1A 1XH1A 1LJYA 2XVPA 2J7DA 4H41A 4JL1A 1HJUA 1KXHA 2PB1A 1TR1A 3IJ8A 3NIYA 1OM0A 4Z2LA 2J47A 1BG4A 3CTTA 1D7FA 4JKKA 3SCTA 3WN6A 4EAMA 1G94A 4HU0A 4AC1X 5I3DA 1E9LA 3A4WA 4HPHA 1GOQA 4YHGA 7CGTA 3WUEA 1UA7A 5HXMA 4DWSB 1H09A 4U2ZA 3RPMA 3T0AA 1XYZA 3M46A 1CGTA 3SCWA 4Z2KA 1QW8A 1VB9A 1CZ1A 2F2HA 2VCBA 3CUJA 5KEZA 3VX0A 4KH2A 1LG1A 4GINA 5A8MA 3WNKA 1QW9A 1M7XA 4UZSA 3T09A 5EFFA 4PCTA 2D2OA 3F4VA 5ECUA 1E6SM 2J7HA 1QVBA 4JFVA 4OIFA 4RE2A 3WBAA 1MYRA 1MQQA 1GQJA 5DT7A 1V02A 2EBNA 4OKDA 3EYPA 1MW3A 3K4AA 3WD3A 1JZ4A 2VRQA 2EQDA 1CXEA 1HKJA 4RE4A 4S3JA 2BHZA 5ABEA 1VFMA 4HTYA 2WMJA 3BAJA 4ZENA 3L4VA 3TONA 3BMWA 3OGVA 1E70M 1XH2A 1QHPA 1GOMA 4ML4A 3HU7A 3RM4A 4FF5A 1JYXA 2G3NA 4U2YA 4GO8A 1CXHA 1UR8A 1V02E 1JNEA 2VZTA 4PMDA 3SUTA 4OBRA 4B15A 3UETA 1H1NA 3E1F1 1S46A 3AQUA 4HMEA 1PX4A 3IAQA 5IHSA 4BF7A 4CD8A 1XYFA 4Z2HA 3UERA 2BVTA 4AIEA 1W1YA 2J4GA 2PI6A 1EHNA 4PUDA 2WLZA 3SUUA 4JCMA 2BY0A 1JAKA 2B31A 4YN5A 1FOBA 3CLWA 5CGMA 1C7SA 1V08A 5JBFA 3IANA 1YQ2A 2XM2A 4D6DA 1JYVA 1J0KA 3B9EA 5GQBA 4B3LA 1MW2A 4TUFA 1UR4A 3AIWA 5E0FA 5FIPA 2EXOA 1ZBWA 4GZJA 3THDA 5CSYA 4PMOA 4HMDA 3PTKA 1TVNA 1OCQA 1HVQA 4U3AA 2XVKA 4XB3A 5HPCA 3RIKA 1LWHA 3L4YA 2J79A 2X8RA 4W88A 1HJVA 3RMEA 5CLWA 1E72M 2D0GA 3WUFA 2J78A 4AD4A 4AZGA 5I24A 3OLDA 1SFSA 2VURA 1ODZA 5A2CA 3B8SA 3GYCA 1W1PA 4UQBA 1J11A 2UY3A 2DSWA 3KZSA 2WZHA 1HL8A 2X1IA 4DUWA 3AICA 2AAAA 3KEHA 5ABGA 3N04A 1M01A 2BHYA 4H8VA 3ZT6A 4P8UA 5FKYA 1E5NA 1UOKA 2DDXA 5I79A 4CCCA 1KGWA 1GOOA 2GK1A 1UHVA 3GH7A 3BLKA 2C7FA 2VCAA 4BA0A 1V03A 1W1TA 1VIWA 1OD8A 5TD4A 1UR9A 1W9VA 3RILA 4AD2A 3WNLA 1B30A 2WVVA 1EQPA 2XIBA 1XSJA 3PZOA 2ZUNA 3GNOA 4D6CA 1MQPA 4Z2IA 3NJ3A 1HIZA 1RD6A 2O9TA 4IUGA 3PZMA 1ITXA 4C7DA 3IAPA 3MV11 3NSXA 1UR1A 3DYMA 1VFFA 1E6XM 2XFRA 1XD0A 2XTKA 4J3XA 8CGTA 5IDIA 7TAAA 4M24A 4H7VA 1MXGA 1EH9A 3SCNA 1CDGA 5AC4A 4H04A 4W85A 1NQ6A 1CGVA 5BXPA 1ISXA 4KRTA 5A6BD 2D23A 3EDJA 2XJ7A 2ESCA 1CBGA 3AIEA 2V5DA 4UFMA 3VD7A 1VENA 3W6LA 3WNOA 5HOSA 1UR2A 1GUVA 4E4PA 2UY2A 4HOXA 2GJXA 4PTMA 1V3IA 3WDQA 1A47A 4JZ5A 2Y4SA 2WKLA 2PF0A 1J01A 3I3BA 4D6HA 2W92A 4P7OA 3ARVA 3QOKA 2YDSA 3HN3A 1KB3A 3BH4A 3SCSA 1L0PA 4P7NA 1HF6A 3UG3A 4AD0A 4CD6A 1DWFM 4ACZB 1E73M 1US3A 1EGZA 3OGRA 2WHMA 4UQDA 4ZE5A 1E6NA 2WHJA 4XV0A 2YA0A 2FGZA 4JL2A 1UD6A 4HOZA 4AIUA 4JFUA 1ZU8A 1N82A 2PWDA 1R87A 4GIAA 1JDAA 1J18A 1PX3A 4UCFA 3BAWA 3WUGA 2VOTA 3A4AA 2CHNA 3ECQA 1B31A 3ARXA 1G5AA 2QMJA 1E6RA 1KXTA 3KWXA 2VCCA 2UY5A 1UD5A 4EANA 1CTNA 3AYRA 3CHEA 2JALA 4GZIA 1NM9A 1OGSA 2D3NA 3U5YA 4W7VA 4BZYA 2DIEA 3VKKA 1CPUA 4LX4A 3LMYA 3TTYA 2YOCA 2WVSA 3PZGA 1E40A 3MUAA 1JYWA 1KWGA 1NOUA 1BG9A 1TZ7A 2J8GA 5D8WA 4ATDA 1CXKA 4PMUA 3TA9A 3ARZA 3W38A 1EQCA 1UWRA 1JXKA 1E5JA 2CYGA 3NUKA 1WNOA 1B0IA 2Z1SA 1R7AA 4CVWA 2EPNA 1FHDA 4KWUA 2WCSA 3ZMRA 2WAGA 1BLIA 1CXIA 4E8CA 2ZUSA 3II1A 2W63A 4TVUA 3OIHA 4H8HA 3VIIA 1BSIA 1UR0A 3VU2A 1M53A 4CKQA 2GFTA 1ZB5A 4ACZA 1PBGA 1J9YA 1OWQA 2DT1A 3IJ9A 3VVGA 3N1AA 1J0HA 3RM9A 1QI2A 5BXSA 2WMKA 5C71A 2MANA 3TOPA 1DP0A 4PBGA 2GJXB 4UOJA 1O6IA 1XV8A 3WF1A 2QV4A 1QI4A 4MADA 3AMLA 3VINA 2O9PA 3PZNA 1DWJM 5ABHA 5M5DA 4W7WA 2GJRA 2ZX8A 4HU8A 1JZ6A 1E1EA 4V28A 2NSXA 5IHRA 3EDKA 2X2YA 3WD4A 3N11A 4WSKA 4DUXA 3A47A 2GDVA 1Q6CA 3WEOA 4UTFA 2CITA 4UQ9A 5E6ZA 4WLCA 4YHEA 3AZTA 5DF0A 1C91A 1JI1A 2WMGA 3O9NA 1R8LA 4PEEA 2Q8XA 2CEQA 4JKLA 1KR0A 2XVLA 1HP4A 4W8LA 1JD7A 3MMWA 1V0LA 1Z32X 3WNPA 4QCEA 5IFPA 1H41A 3VGHA 1DEDA 3VIFA 2VZVA 3W28A 3GXMA 4CD5A 3L4TA 4MB1A 4DWSA 5E70A 1PPIA 2FHBA 3BMVA 3VIOA 3S2CA 1FFQA 4WKAA 3FAXA 1FH7A 3M07A 4GQQA 2W66A 1ZBVA 3VDHA 2WB5A 2PBGA 1H2JA 8A3HA 1BYBA 1XHGA 3ZO9A 3CZKA 3L2LA 1HJWA 4AIOA 6TAAA 3MS8A 4PMNA 3WQ4A 4F79A 1D3CA 2PWEA 1JZ5A 2WMHA 3ZSSA 2BVYA 2G3IA 2HISA 1JZ3A 1KCLA 3GDBA 3U7VA 4AZIA 3WQWA 2WPGA 2CHOA 2VVNA 1TFVA 1OB0A 3WD0A 5I6SA 5A2BA 2WHLA 2XSBA 3AS3A 3U57A 1MVYA 3LPOA 3N15A 4LYPA 2FGLA 3M7SA 3K4DA 2ZXBA 4KMQA 1CYGA 4BQ4A 3VD9A 1GJWA 2VNCA 4UFHA 1M03A 2J7FA 3ZOAA 2XIIA 4C7FA 1W9PA 1BGAA 4MJ2A 2CERA 3K8KA 3K46A 3POHA 3WSUA 4L4OA 2WHKA 3WDJA 3GH5A 4CCDA 4IPLA 1JYNA 4HA1A 2D24A 3T0BA 5D9MA 3WMCA 1E3XA 3VUPA 4F9DA 5M03A 5JIPA 1V6XA 3GZAA 3CIVA 2F61A 1K9DA 1QOXA 5A6AA 1CGXA 4CU8A 2W67A 2EO7A 1UKSA 1EO7A 1CWYA 1JXJA 4MDPA 5JIWA 4TX6A 2ZUVA 4Z2GA 3VMNA 4AW7A 3OB8A 2WLYA 4KGJA 4AYSA 2WBGA 3AIQA 3B9DA 2Y5EA 3T08A 3W24A 1AVAA 2WYSA 3WQ5A 3WF3A 1QNOA 4PTVA 7A3HA 2DH2A 4LQ1A 3BXWA 2ZX6A 3UESA 3ZT7A 1RPKA 3G6MA 3CZJA 1BQCA 1QNRA 3VOCA 4BCEA 3CO4A 5BRQA 2J8FA 3VGBA 3GXFA 4M80A 2XPKA 4E8DA 2V38A 5AY7A 1GQKA 4HP5A 4W8AA 1J0YA 3MV01 2ZWZA 1E55A 3L4UA 3O2LA 3ZIZA 1MW0A 2VTFA 3VO0A 3T2PA 2A3CA 9CGTA 3GH4A 1V3MA 2DSVA 4J3UA 5E0CA 4AZBA 5CG0A 2CNCA 2W5FA 1QI0A 1HT6A 3CH9A 4D6IA 4PN2A 3D3AA 4GI9A 2Y2WA 2ZUMA 2BNJA 4WF7A 3WKZA 6CGTA 5FD0A 3T0DA 1H5VA 5CPSA 4AZCB 3VIKA 4OBSA 1RH9A 1K6AA 4D6GA 3I3EA 3L4XA 2XFFA 1VEOA 4A3YA 3KL0A 1V6UA 1NWSA 1OINA 3ARRA 2A3EA 4EE9A 3WQVA 3GBEA 1E4NA 6A3HA 1E1FA 1UD4A 5CLTA 1UD3A 4D6EA 4P7RA 2J62A 5I0DA 1ISVA 1MXDA 2D0FA 4WJXA 3A4XA 1ODUA 4FK9A 5E09A 3W0KA 4U3CA 5DO8A 2J75A 3AHXA 2FDMA 1J12A 1WZKA 2J7EA 3EMZA 2E9LA 2XVNA 2QLYA 1WDSA 1KFWA 4IM4A 3DC0A 4KRUA 4IPNB 1V0MA 2DQXA 3AS1A 1UQYA 1FP8A 1LL7A 4X0NA 3FXYA 1QNPA 3U7BA 1BHGA 1XGZA 3POCA 1UWTA 3VMOA 4AWEA 1B3YA 1XRVA 2CIPA 2Y24A 2DT2A 3W4RA 4MNKA 1VJSA 2IXVA 1K9TA 3AMCA 3VGEA 5DFAA 4FMVA 1U2YA 4UQCA 3SCRA 2OSWA 4GXPA 2YDRA 3VM7A 2DSKA 2PC8A 1CXFA 2O9OA 1EOKA 1E43A 2JIWA 3GXDA 3LPGA 2G41A 1KGXA 1VEMA 1MFUA 1C90A 3W82A 4JFTA 1QNQA 1OGGA 4X0VA 3BAYA 4P7QA 3SCUA 1NOFA 3OZOA 2ZOXA 4N42A 1WCGA 4B16A 3AS0A 3N9KA 3PN8A 4RE3A 3ZQ9A 2VRKA 1BYDA 4P8WA 3CHDA 1JI2A 3WNMA 2XGBA 3W81A 2CCRA 5CZKA 5GNZA 3OLIA 1VFOA 5ABFA 2QF8A 2WMIB 3DYOA 5A8QA 1BVNP 4J28A 1WZLA 3K1DA 3W25A 1FH9A 1H3GA 3VNYA 4MB5A 5BWFA 1OGBA 3J7HA 1IV8A 1PJ9A 4V27A 5DMYA 3QHMA 4ZFMA 4CD4A 3M6DA 1AQMA 3DECA 4HA3A 3CUGA 4JKMA 2NW0A 1B9ZA 2JF6A 5DT5A 2OYKA 3AZSA 4Z2JA 4TOQA 2BV9A 2V3DA 2UWFA 4QP0A 1TVPA 1Y7VA 4PSRA 3VILA 4UOQA 1JDCA 1K9FA 1NH6A 2QPUA 3VIGA 3VDAA 3UG4A 4ZEPA 5JBEA 3QOMA 1H0GA 3BC9A 5BCAA 1GOKA 2XVGA 1GCYA 1BYCA 2WKGA 2VR5A 3WDRA 1HL9A 3AFBA 3AI0A 3UR8A 1YHTA 2CETA 4J7RA 1VRXA 1HN1A 2EJ1A 2V3FA 2VX7A 1L8NA 1DWHM 4X9YA 2DSZA 3FW6A 5EB8A 4DUVA 2C8NA 1EIBA 3RCNA 3WMSA 4TVDA 3CHCA 1E0VA 3MMUA 1TCMA 3ZJ6A 1EDGA 1I1XA 1UH4A 2XYLA 1C93A 2WZIA 2YLLA 4CUCA 1NWRA 1IZJA 1JFHA 2ZICA 3PBGA 3AZRA 1UA3A 4MJ4A 1I1WA 2D22A 4NF7A 2YL8A 1JZ7A 1OD0A 1SMDA 5CGTA 1UKOA 2ZUWA 1BYAA 4UR9A 3ZJ7A 1GONA 1W9UA 1JFXA 1LLOA 4PRWA 4QLKA 2W62A 1KGUA 2GSJA 3RO8A 2GVYA 1GQIA 3PZTA 1DWGM 2QHAA 4JHOA 4AD3A 1UZ4A 2WVUA 4MPKA 5FOOA 2XFYA 4WSJA 4U5KA 4DM1A 2OWCA 3EMQA 2V3EA 3CHFA 3AROA 1E4IA 3TTOA 3A3HA 2A3HA 4OZOA 2WSKA 2DSUA 1V0NA 3WENA 4W5ZA 5A95A 3SEPA 4GI6A 2VZUA 2CBUA 1TUXA 4NRSA 1B3ZA 2WVVB 4A4AA 2HVMA 1J0JA 2BFGA 1ITCA 1HXJA 1B3VA 2VZOA 3CMJA 3MSGA 5CSUA 1QHZA 2WWCA 1JZ8A 2OSYA 2FH8A 2DT3A 5A1AA 1TA3A 1QPKA 1CXLA 1ISYA 1IT0A 2Y8VA 1OSEA 4CGTA 4MNJA 4PSPA 1OIFA 1DWAM 1A3HA 2G3MA 1OT2A 4D71A 5A2AA 3VIHA 1CENA 2GDUA 1Q6DA 2GJPA 4LYRA 5JUVA 3SCPA 2BY1A 1ZBCA 2YL5A 4OOUA 3GNRA 1MFVA 1WDQA 4V2XA 5IXEA 1VFUA 1U33A 3NDZA 1EO5A 5EMYA 4LXFA 1HJQA 1GHRA 4NI3A 1V6VA 3AS2A 3RJYA 1XCWA 2BXZA 1WZAA 4NRRA 3WDIA 1DTUA 2XUCA 4HZ7A 3UG5A 2YBUA 2FHCA 1UWIA 3S6TA 2QPSA 3CUHA 3FHAA 3F5JA 2ZE0A 1E71M 2VUYA 3WDPP 3ZM8A 3DHUA 3WH9A 3BLPX 1RP9A 4MB3A 3ZR5A 4JCLA 4UZUA 3SUSA 2JFEX 3WY1A 4AZ5A 2WMFA 2CESA 1W3JA 1JD9A 1XSKA 3BSHA 2DH3A 1R86A 1UH3A 3NSNA 5FCZA 4TTUA 4K68A 3CUIA 3PZ9A 1H11A 2XM1A 3AMGA 1H4PA 3VD3A 1UH2A 1Q6GA 1GPFA 1UKPA 2PWHA 4OOZA 1R7OA 4UQEA 4GKLA 5ABFB 2YIHA 3OLGA 4LYQA 1W91A 4CD7A 2ZX7A 4H2CA 4B9YA 1W2PA 2WXDM 1B3XA 3FY1A 3ALGA 4CU7A 3ARUA 1O7AA 3UCQA 1NWUA 4QFUA 3SCVA 1LF1A 5BRPA 2E0PA 5C8BB 3FN9A 1ISWA 4WKFA 1XCXA 2GUYA 1VAHA 2VMFA 1E15A 2RGMA 1FA2A 5AYBA 3VD5A 4DWSD 4WK9A 3NCOA 1W9DM 3VIPA 3RM8A 5A8OA 1NWTA 1EOMA 3MUIA 1JIBA 1K9EA 1CEOA 2JIEA 2PWGA 4MDOA 4Q7NA 2YKKA 5LYRA 1CECA 2D20A 2F8QA 5E6YA 3IK2A 5M17A 2PBOA 2UY4A 3WL1A 3BSGA 3K8MA 3W6MA 1JF6A 1V3KA 2JE8A 2WNWA 5D9OA 5CQ1A 5BXTA 5A6SA 4GPNA 1LG2A 4J3VA 1JG9A 1WB0A 5FL0A 4M29A 3WL0A 1WAWA 3AHVA 4CU6A 3AIBA 3BGAA 5DEZA 2D1ZA 2ZWYA 3ZJ8A 1VEPA 3VM5A 1X6LA 1C8XA 1E6QM 4IISA 2OYLA 1KCKA 3APGA 5EBAA 1BPLB 1EXPA 3PTQA 3UR7A 3OZPA 4UQAA 1US2A 2W91A 1C8YA 1VF8A 3AYSA 4J3TA 4LPCA 3MUZ1 5AYIA 1JF5A 4ATWA 2ZXAA 1TE1A 4R27A 2WCAA 1HX0A 3NDYA 1UQZA 3A6OA 4J3WA 2ZX5A 5HBFA 1JDDA 4JFSA 3WH5A 1ZBKA 1WKYA 1FP9A 3BAXA 4AZCA 1GNXA 4KGLA 1J0ZA 5A8NA 3CZGA 4AEFA 2VL4A 4TVCA 1WDRA 1UWSA 3PZVA 4AEEA 2D0HA 3WH7A 1GORA 3GNPA 3ARTA 2J7BA 3AJ7A 2IXUA 4TTGA 5CPQA 3WNNA 1LL6A 2V5CA 1JNDA 5A69A 2EPOA 2WVTA 2A3BA 4J27A 3WDHA 1R85A 2JEPA 4BQ2A 5A6LA 1WP6A 3O6AA 3IJ7A 1CGWA 2VQTA 3VGDA 4AZ6A 3N18A 3EMCA 2XSAA 2DPEA 1PX8A 2J7GA 1ISZA 3KL3A 5CJ5A 1G01A 2VZSA 3W37A 3OA5A 4XZWA 5M3WA 3BCFA 1UD2A 1W3HA 2IUZA 5GNXA 3ZSTA 3N12A 3UEQA 3CZLA 1MWOA 3TTQA 3WF0A 2WSPA 4CN6A 4DM2A 2YJQA 3JUGA 4W8BA 2ZUUA 3EDEA 2E8ZA 1GOWA 2E4TA 1VJZA 3WD1A 3PZIA 3VDCA 1OT1A 3VTRA 3VPLA 4C7GA 4MNLA 4U31A 1LWJA 2O9RA 3WELA 1GZJA 1GHSA 3L4WA 1PIGA 4OJYA 1LL4A 1PZ3A 5FL1A 2W61A 2WC7A 1GJUA 3ZJKA 4PMVA 5IFTA 4J3SA 1BFNA 1G0CA 3BAKA 2VJXA 1BF2A 2E8YA 3WQ6A 5A3HA 4UFKA 4QLJA 1E6PA 1UWQA 1VBRA 2D3LA 1HP5A 1HKMA 3AISA 4DWSC 1HKIA 4W84A 1AMYA 1MQRA 1QI5A 3MO4A 4BQ3A 4CCEA 4MNMA 3D5HA 4U33A 2OLHA 2EEXA 4JFWA 4YPJA 2VRJA 3AXXA 2A3AA 2PWFA 1RP8A 5D8ZA 4JAWA 3CUFA 1TA3B 4NSBA 3SUVA 1B2YA 2BVDA 4PTWA 4UFLA 5I5RA 2X09A 3L2MA 3ARWA 1SR0A 1V3HA 2VC9A 1ZL1A 1JGIA 3B9AA 2CKSA 2J77A 3CZEA 1V6YA 4XZBA 3VNZA 3WIJA 3WF4A 3N13A 3W26A 5E9AA 4HZ8A 2E9MA 4URIA 4W86A 4MAZA 4M82A 1AQ0A 3WF2A 3GM8A 5LA1A 4P7LA 4HZ6A 4MAVA 4D1IA 1KBBA 4PUEA 4PMRA 4HMCA 1XC6A 2JF7A 4W7UA 1NARA 4UFIA 5F7UA 5I2UA 3AXIA 2X0HA 4ZXLA 1TMQA 2AOSA 2VVSA 5BXRA 3WD2A 4P8VA 4M56A 1GVYA 3WFLA 2WANA 1GQLA 4WKHA 1SYTA 3W53A 2J74A 2CXGA 1QI3A 3SURA 1J0IA 1HVXA 1J10A 2WBKA 2VX6A 3OG2A 4PMYA 1M04A 4H8UA 2XG9A 2NT0A 3T2QA 1ESWA 3PTMA 1EDTA 5D4YA 2DIJA 5I78A 3LPFA 5CXPA 4ZXOA 3OBAA 4RL3A 4HOWA 1QBAA 2OWXA 3BAIA 3MANA 3MKKA 1XSIA 4P8XA 3AXHA 1G1YA 3VDBA 2ZUTA 2CKRA 2G4FA 2G8ZA 3VX1A 1W3LA 2YDQA 2BY2A 1E0XA 3I3DA 5GPRA 1V3LA 3WFZA 1G9HA 2WWDA 3AMDA 1HKKA 3PZUA 2XWDA 1F4HA 4W87A 4AD1A 3AIUA 4M81A 1XD1A 1HNYA 3MMDA 4PMZA 3K8LA 3VIJA 4W93A 2VX4A 4PMQA 1EA9C 1H0IA 2YBTA 4WIWA 3CPUA 2Y8KA 1OBAA 1DWIM 5BROA 2O92A 2DEPA 5I77A 4XX6A 3VIMA 2AMGA 2C0HA 2XGIA 4HA4A 3AIVA 3W27A 1KWKA 4GQRA 1E4MM 1GW1A 3FAWA 4D72A 3ARSA 2BHUA 3CMGA 4TX8A 5JBDA 2FHFA 4AZHA 3KE0A 4M8UA 1BGGA 4CN4A 5AC5A 1CNVA 2G3JA 2VR4A 4ACYA 1NP2A 1FFRA 2DGAA 3GTNA 3CZ8A 3VGFA 4U5IA 1OIMA 5GNYA 3MU7A 2VT0A 2ZIDA 1SMAA 1ZS2A 1E6ZA 3VMPA
chains in the Genus database with same CATH superfamily
1KKOA 4N9EA 1CLXA 3JR2A 3ITOA 3OLEA 1O66A 4PGLA 4Q22A 2OGJA 4AXNA 1UP2A 1ZTVA 3ANYA 3TX9A 3M44A 3NQEA 3MWAA 3WMBA 3PANA 3W7GA 1TTJA 3W3OA 3UF9A 1UKQA 2ZZ5A 4Q6XA 3WLOA 1PKLA 2DVUA 4DZIA 1BTMA 4QCFA 3ARYA 1R0MA 1QBBA 1K02A 3B8UA 3AOFA 1EP2A 3LMZA 1EDQA 4RKAA 1J6PA 3G1FA 3BCDA 1XYMA 1XIGA 3B9NA 3CL6A 4M1RA 3DFQA 2OLSA 4YTTA 5D32A 3FJ6A 1PZ2A 3N25A 4O17A 1PEZA 2FTWA 3USZA 3ALFA 3W2JA 1C3FA 4BS0A 1A5UA 2B7NA 3GDTA 1D2KA 3WCZA 3PHAA 4YL2A 4OECA 1QJWA 1TPB1 1W9XA 2YB4A 3CXOA 4AMCA 1W1VA 4H6KA 2OYMA 3VGGA 3QZAA 3DGRA 2YA1A 2DQWA 2C16A 3NYDA 4F66A 3B04A 3REQA 1F6YA 4HK6A 3UBPC 1I0BA 2Y7EA 1I0DA 3AHTA 2E9BA 2H6RA 3P8IA 2TODA 4HNLA 4D6FA 1E0WA 1K4HA 4D6JA 3WJYA 4JTUA 2NT1A 4PYSA 1ONXA 2XHYA 4QAWA 2QULA 1GPWA 4DF0A 3MCOA 4MPQA 5FA5A 4N02A 1Z41A 4RPQA 3MYPA 3V35A 2CBIA 2OEJA 2DT0A 3RX2A 1EHAA 1NP0A 3CIWA 4WGHA 1SO4A 4S38A 1T8QA 3SN4A 3TP4A 3MI2A 4ZQMA 4F4RA 2MUCA 2X41A 4AZ7A 2V5KA 3O8AA 4HHLA 1WOAA 1UKTA 3F4CA 5HA7A 3ES7A 3WLIA 1RXOB 1VZWA 3U5UA 5CC6A 3CYVA 4B5SA 3RGTA 3VNMA 1I75A 1BVZA 2PLMA 3WH6A 2PDLA 4XZLX 4UOZA 1H49A 4MTVA 4ZOAA 2OXNA 5A8PA 1FCUA 1H62A 2WZTA 2OO6A 4N0RA 1TZ9A 4QSFA 2FZ8A 2HXUA 4A8RA 1X6NA 3N2BA 3AWOA 3W7RA 1H50A 1PAMA 4IMAA 1C92A 2YZRA 2RAGA 1EZ2A 1W32A 5AHEA 1X1NA 4TQTA 4CVUA 2J25A 1BXCA 2YLAA 1PHWA 3WBEA 4L6DA 4O8RA 3FNDA 4YNGA 1SW3A 1LQ0A 1UYQA 1DJXA 5F2MA 4FLQA 1X98A 3NQDA 4DUOA 3VZYA 3T8QA 1P4CA 2D2HA 2HV5A 3QLLA 4A8NA 1FWFC 4Y9PA 5BU9A 1TV8A 4R5EA 3UWUA 2DIKA 4HT3A 1KO0A 4JTIA 2PWVA 3LUTA 4BY3A 4A05A 1ZP4A 4F9JA 1C8QA 5HNNA 2EF9A 1A50A 3QC3A 1HJUA 1RHCA 3L66A 2ASHA 3IJ8A 3KP1A 2CLHA 3NIYA 4DY1A 2J47A 2YYTA 4WRHA 3WN6A 2YYUA 2G4JA 3GC2A 3TFXA 4HU0A 3QQ0A 1E9LA 2POTA 3UU0A 1QWGA 1X1ZA 1NVMA 3FVDA 4K1WA 4PFHA 1EUNA 3KDNA 2NV1A 3T0AA 3EA1A 1DOSA 1ONWA 1H7XA 3IWPA 3UWEA 1H63A 2F2HA 2VCBA 4Q32A 4PUUA 3AC0A 4GINA 4MF4A 3TYBA 3TW7A 1VPYA 4IMEA 4UZSA 5EFFA 2D2OA 5ECUA 1E6SM 2J7HA 2WSQA 4XISA 2DUAA 4K6AA 5FJRA 4JFVA 3D6NA 4OIFA 3N9SA 2HVOA 3EYPA 2YCJA 1F3TA 3K4AA 1JZ4A 3UPWA 1Z9AA 2E25A 4DXVA 1JCLA 1GZGA 1JCNA 3SY5A 1VFMA 5I7GA 1BSLA 2EG6A 1TMLA 3LXBA 5K4XA 3JW7A 2BVWA 5HULA 4ZENA 3TONA 3BMWA 4HHMA 3HFTA 2VGFA 3OGVA 1JCJA 2SFPA 3P2VA 4FF5A 3OVPA 4L56A 4GO8A 1V02E 1JNEA 4WCJA 3IIZA 4B15A 2O55A 1S46A 4P2VA 4X9SA 3IAQA 4CD8A 4NP7A 1XYFA 3TR2A 4BJHA 2ZFAA 4EXBA 1W1YA 3CU2A 4F0HA 4IPJA 1EEPA 2BY0A 4AQLA 1BQGA 1OFQA 5LNRA 5CGMA 5IBXA 2FPVA 2HK1A 5AVHA 1BRLA 1Q2RA 4D6DA 3LI1A 5LNSA 3W1MA 3B8IA 4QAIA 3EAUA 1UR4A 3AIWA 1F6PA 1ZBWA 1R6WA 3DHDA 2JBMA 5MKGB 5FF4A 1QDSA 1Q4WA 2CZDA 3TJXA 4XB3A 1LWHA 3Q2DA 2PS2A 3N4EA 4KW2A 2A6LA 8TIMA 2FPYA 5EY5A 2J88A 2VFFA 4YS1A 5I24A 3M0XA 4C60A 3A24A 3SRHA 3NQ2A 1FXQA 5A2CA 3B8SA 3GYCA 3I4EA 3S2MA 5HQLA 3MZ2A 3M0ZA 1VLWA 5REQA 1DJIA 1E51A 1HL8A 2X1IA 1IF2A 1O60A 3N04A 4KQNA 4IIDA 2BHYA 4KESA 4H8VA 4LVGA 2QUMA 2QCDB 4OVXA 2DUZA 4DJFC 3W7IA 2XH7A 1GOOA 1H1YA 2MNRA 2YGYA 3S5YA 2C7FA 1TJ2A 3E2RA 4BA0A 3PB0A 2ZA2A 4PEKA 4KS0A 1OFOA 4M51A 3FYPA 1I2QA 1K7XA 2Y62A 1AQFA 3FA4A 3W07A 2FZ9A 4XG1A 2O9TA 3HPAA 3PZMA 1A4LA 3UXKA 4C7DA 3NSXA 2PDCA 4S3GA 3DYMA 3E2SA 1E6XM 4IMCA 4FHAA 2XTKA 4J3XA 1M7PA 3VFCA 3QKZA 3PPHA 1HFBA 3QSTA 1RA5A 3CB3A 3K13A 3M0JA 3WQEA 2DU2A 1FCBA 3HMJG 4WEVX 4QG9A 1CDGA 4LAKA 3DN5A 4H04A 3PTDA 4W85A 1NQ6A 4V33A 1CGVA 4ZQPA 4DHGA 3NQCA 4JQ1A 1FKWA 2AMXA 1IQ8A 2D23A 5LHFA 3FYYA 3AIEA 1T6MA 3U2OA 3CYJA 5HOSA 4PUJA 4E4PA 3LERA 4ZO7A 4B5VA 2INEA 3KCOA 3QMSA 4LBSA 1ITQA 2WKLA 3KOFA 4O19A 2W92A 2XISA 3RLGA 1F7BA 2YDSA 3UJEA 3W6YA 1L0PA 3M1ZA 1HF6A 1Z69A 3E2VA 4S3BA 3O15A 4AD0A 1DWFM 5CAKA 4ACZB 1US3A 3ZVHA 2XH0A 2YA0A 4HOZA 4EPEC 4AIUA 4O4VA 4WQ6A 1N82A 3P6LA 3N2MA 1H60A 1T99A 1LLZA 1AL8A 2E6YA 1EYWA 3BAWA 3WUGA 2TPSA 4GACA 5KTLA 1VHNA 1WUFA 3ECQA 1B31A 5TQLA 3ARXA 3W1QA 1G5AA 2CU0A 3UR2A 4ZFCA 3CHEA 2JALA 5L9FA 1TRDA 4LY8A 2D3NA 3U5YA 4W7VA 1F2JA 3A5VA 2WVSA 4YTQA 4A6GA 3MUAA 4ZZ9A 1IYXA 2NXIA 3HG4A 1AJ2A 1HUVA 1NOUA 4ATDA 1CXKA 3GU9A 2V9DA 1UWRA 1JXKA 2V82A 3P61A 3TJLA 2CYGA 3NUKA 3CQ0A 3UW6A 1O5RA 4PZVA 1WNOA 5HQEA 1B0IA 4GOAA 4H9VA 2EPNA 1FHDA 1LBMA 2E6AA 2WCSA 4E8CA 1BLIA 2W63A 1O4UA 4L6OA 4C6EA 3VIIA 7REQA 1UR0A 4AMAA 3ZLHA 1ZB5A 5HATA 4XZNX 1OWQA 4M5PA 4DJDC 3GFYA 4PBGA 2P0OA 4UOJA 2QV4A 4QS5A 1JDEA 1UWAA 4J4KA 3QF0A 2GQAA 1X8FA 4FA3A 4DO6A 3UWYA 4CQBA 1EX5A 1WV2A 3A47A 3RHGA 3BLFA 2CITA 4UQ9A 3O6DA 2V69A 3L65A 1KFCA 4U4MA 5DF0A 3SR7A 3GG1A 3O9NA 2C19A 1R8LA 4PEEA 1Q5MA 3BQ6A 1JPDX 2VC7A 4JKLA 3CMFA 2VHLA 1JD7A 4HJWA 1UUMA 3FV9A 3VGHA 2ZTJA 2A6NA 5AN7A 1REQA 2DZTA 3E12A 1LOQA 3P14A 3GXMA 5C0QA 5I02A 1C29A 5E70A 3L12A 1NF0A 5HWNA 3U2EA 1VP5A 2R8WA 2PURA 1JPKA 3FFSA 1FH7A 1S3HA 3M07A 4GQQA 2IPFA 2W66A 1ZBVA 1XDLA 2PBGA 1O94A 1TV7A 1LRNA 1XHGA 3ZO9A 3KS6A 4S23A 1HJWA 4AIOA 3CO8A 1LBLA 3WQ4A 2O4QA 2WMHA 3ZSSA 2BVYA 2V2DA 3PULA 2VVNA 2PE4A 4Y9OA 3AS3A 3G5EA 3NZQA 3U57A 3N15A 1FY6A 4GXWA 2FGLA 1M03A 4C7FA 2XIIA 3FEQA 1W9PA 3G1XA 5TAOA 3POHA 4I6VA 3WSUA 3MP5A 1QAPA 4QG6A 3GH5A 3PUGA 3IEBA 4HA1A 2REQA 2D24A 1ME9A 2B7PA 2Z2AA 3T0CA 1OF6A 3VUPA 2ISDA 1V6XA 3FLUA 4KWWA 3CIVA 4L9XA 9RUBA 1K9DA 1R5YA 4CU8A 4DXXA 2W67A 1EWEA 1CWYA 1JXJA 4G9PA 4TX6A 4Z1AA 2WLYA 1YE6A 3T05A 3B9DA 2NV9A 1VKFA 3PG9A 3WQ5A 1V7AA 3LD5A 3E49A 4FIQA 1TZZA 4LQ1A 3W71A 3UESA 3ZT7A 2UV8G 1KM3A 1RPKA 3G6MA 3RXZA 4HMNA 4YYFA 3EWXA 3TTEA 5D09A 1RY8A 5DBUA 1GQKA 3MV01 3ZIZA 3NTYA 1NFPA 1MW0A 4NJIA 9CGTA 1V3MA 5E0CA 4AZBA 4BEQA 1F73A 1HT6A 3CH9A 4ONVA 4GI9A 1W3NA 2HDJA 2E67A 2ALDA 4JICA 3THQA 4WF7A 3ISIX 1LT8A 4C90A 4FOUA 1H5VA 4OBSA 4G5DA 1XLDA 1VEOA 1JCTA 1XYBA 2Q71A 2A3EA 2Y85A 4R9OA 3T4WA 2YXXA 1XCFA 3TSMA 2L5HA 5CLTA 4D6EA 1PS9A 1ZPTA 1IR1A 3N9RA 2J62A 4A2SA 1MXDA 2D0FA 4KERA 3QV6A 1LQAA 2YCLA 1IGWA 2ZRZA 3U2CA 1GVSA 5DO8A 6XIMA 2PDMA 1YIXA 2J7EA 3EMZA 4S2CA 2QLYA 5CC7A 1EFZA 3C61A 4IM4A 4Q7IA 4UTTC 3AS1A 1I2PA 1UQYA 1J5TA 3IIOA 4LOCA 3FXYA 1QNPA 1WAUA 3POCA 3TZFA 2XDFA 5I3GA 4NILA 1CI1A 2CIPA 3W4RA 4MNKA 2BOGX 1AODA 2GWNA 1K9TA 3NQ8A 4FMVA 4XZHA 4UQCA 4GYPC 4ZOEA 3SCRA 4GXPA 2PC8A 1CXFA 2QF7A 1E43A 3LA4A 3GXDA 4JY9A 1C90A 1QNQA 2A7PA 3SCUA 1NOFA 3EKGA 3MHFA 3OZOA 3P60A 2BSLA 4MKVA 4N42A 1WCGA 4B16A 3AS0A 2R1PA 3N9KA 4RE3A 4ZO6A 4YCOA 1A5BA 1JI2A 3PVFA 1SPQA 2XGBA 5T9BG 4C1NB 5CZKA 3DYOA 4RK8A 4WXZA 3EA3A 1BVNP 4N9CA 3K1DA 1FH9A 1H3GA 4O18A 2ZDRA 3J7HA 2C13A 2A79A 4O52A 3QHMA 3M47A 4F0LA 1AQMA 1H7OA 4AIBA 3DECA 4HA3A 3CUGA 2TSYA 1JCMP 4O8AA 2ABBA 4NXKA 2JF6A 4Z1YA 5H6HA 4TOQA 1PO9A 1Y7VA 4ZBCA 2EHHA 3GB6A 3VZXA 4ZQCA 1XFBA 5F2LA 3TQVA 1GOKA 1GCYA 4ASTA 1MO0A 1HL9A 1VFHA 3Q94A 4C6JA 3H2EA 5CPNA 4KEVA 4ZQOA 4OV4A 3N3TA 3I10A 2EJ1A 1OABA 1DWHM 3KBJA 4NIRA 4GNKB 2DSZA 2HZGA 5K7JA 4DUVA 5EMJA 2C8NA 4JIQA 1T41A 2OKOA 3WMSA 1PE1A 1E0VA 1S5TA 4AVOA 1UH4A 1C93A 3NGJA 1SVDA 4CUCA 3PBGA 3GZ3A 2BOEX 2OKTA 1GTEA 3UNTA 4NZ5A 3PJXA 1TJRA 1JZ7A 1PDYA 5EMKA 3LX9A 4AWSA 1O12A 3NVTA 2G3FA 4UR9A 3DKJA 3B8WA 3IGSA 4AAJA 4REQA 4C1KA 1DJYA 1HG3A 1LLOA 4PRWA 4AC7C 3QXBA 2GSJA 3S47A 4GXMA 1NIUA 4NJKA 1UMYA 4IF2A 1UZ4A 1MUWA 1TX0A 2V3EA 4WZHA 3CHFA 1K7EA 3BOFA 1S38A 1GZ1A 3WJSA 2A3HA 3TJ4A 2VC6A 1X7FA 3WENA 1D8WA 2XN0A 3SEPA 1SO3A 2VZUA 1QR7A 3GNDA 2GVLA 2WVVB 1WXYA 4X2PA 3TOYA 4TX9A 1HXJA 5LNWA 3WBXA 3CT7A 3CMJA 5CSUA 3CTLA 3QR0A 1JZ8A 1AW5A 2OSYA 4ZTXA 3IGXA 1OX6A 3W1LA 3P5YA 3SM0A 4Q8QA 1ISYA 1IT0A 2Y8VA 1KLZA 4D71A 2YCKX 2GDUA 2GJPA 4J1OA 3TQKA 4WY0B 4LEQA 4Q8UA 2A7NA 4PUWA 4OOUA 1MFVA 2GSEA 1RCOB 3NDZA 5EMYA 1IXOA 4O4WA 1GHRA 1V6VA 5KMYA 1ZSXA 1XCWA 4RV3A 3N2TA 1WZAA 4NRRA 4KCVA 2Z6JA 4HZ7A 2ONEA 3M5XA 3LM3A 4PBEA 2H9AA 1JR1A 2FHCA 3S6TA 3MP3A 3JS3A 3F5JA 1E71M 3ZM8A 5I3KA 3W1UA 1EIXA 3S5NA 4UZUA 4JYEA 3BUVA 3TH6A 5C6MA 1XSKA 3GXPA 3MZNA 4ERAA 4B5WA 3ZFHA 1R86A 1UH3A 3AU6A 3ID7A 3NPUA 4UBPC 3PZ9A 4GX8A 5DCEA 1H4PA 3P93A 2DZPA 3TV8A 2WSYA 1GPFA 1UKPA 3BG5A 3N34A 1H5YA 4UQEA 4G1KA 2YIHA 1W5QA 3BLOA 3F4DA 3KDOA 4LYQA 3USBA 4CD7A 4H9XA 3FA5A 2DW6A 3GTXA 1O7AA 1ELSA 3IJ6A 2E77A 5FEPA 1ZJHA 4S3EA 1UC5A 3FN9A 4JTHA 3PWGA 1J2BA 1EL3A 2OQYA 3LN3A 2A85A 5MF5A 2XIJA 3NCOA 2G97A 2A21A 1RZMA 3MUIA 1JIBA 1K9EA 4N9DA 5LYRA 4UTWA 5KINA 2QCGA 4Q8NA 1JDFA 4N6EA 2YW4A 3W1NA 2Z1BA 4GJJA 1JF6A 1G7UA 2O4MA 2WNWA 5D9OA 3HGRA 4TMBA 4GPNA 3ABOA 3LGGA 1LG2A 4MUPA 1ZAJA 1S2AA 2P0IA 3VE9A 3TW6A 3AIBA 2W6RA 3NO1A 3JVAA 2V63A 3WQGA 2ZWYA 3ZJ8A 1E6QM 4KIEA 1KCKA 5I3HA 1UB3A 4GIRA 4HGXA 3VE7A 2DZVA 1GW9A 3PTQA 3R8RA 1OK6A 1US2A 3FCPA 1C8YA 3W7CA 1LBFA 3AYSA 3BZGA 2XINA 5FJOA 1T5AA 4GY7A 1P0KA 1Q63A 2TMDA 1TE1A 2RHGA 3ME3A 4R27A 2QJHA 3PPGA 3NDYA 1UQZA 3KBSA 5HBFA 1JDDA 3GNNA 1TR9A 1ZBKA 3M7WA 3URQA 2CLIA 3GFXA 5JQ9A 3VKDA 2V67A 1FP9A 5HMSA 1JRBA 2P53A 3TAKA 1J0ZA 3VCCA 4H9UA 2VL4A 3EWUA 3HQOA 5C54A 1F8MA 4HPNA 1GORA 3KTXA 4GUGA 1BF6A 1S2UA 4EXAA 3AJ7A 1HGWA 1OY0A 4NZFA 4TTGA 5HJYA 1F8IA 1MNSA 4I5RA 4MUZA 1VS1A 4Y96A 2EG7A 2EPOA 1VQTA 1T8XA 2A3BA 4HN8A 3ZS4A 3WDHA 4BQ2A 1SSGA 3VGDA 5B80A 2PTZA 1U1JA 1DQWA 1ISZA 3CC1A 3UA4A 4Q8VA 2VZSA 3W37A 3PNZA 1R3WA 3PM6A 1U83A 4XZWA 1FDJA 3BWWA 3RFAA 1W3HA 2IUZA 2ZC8A 3GDMA 5GNXA 2RJHA 1MWOA 3WF0A 1S5VA 1UIOA 3KP0A 3NWRA 3HA1A 3V5CA 4XBJA 3M41A 3LTSA 4PCPA 3EDEA 2E8ZA 2E4TA 3Q37A 1VJZA 1GVEA 1RALA 4I5UA 5FF7A 3VTRA 4A35A 4F48A 1KM0A 2GVEA 4MNLA 2HK0A 5IRPA 2CLEA 1XBZA 1KM1A 3WELA 2HSAA 1TPWA 5JXQA 2F6XA 4OJYA 5FJUA 1VR6A 1BWLA 2W61A 3VYLA 1GJUA 2OOFA 2CLKA 3N19B 1KM6A 4IUOA 3W1TA 4J3SA 3LK6A 1BF2A 3PFMA 3WQ6A 5A3HA 1UWQA 1VBRA 2D3LA 2V8ZA 3KBNA 3S3GA 1HP5A 4IPIA 2VFDA 3AWNA 1HKMA 1MUMA 1HKIA 3IVUA 2QIIA 1A5AA 1QI5A 4MNMA 2EKCA 3D5HA 4PUNA 2OLHA 4JFWA 1RP8A 4JAWA 2NWRA 2CZFA 2WV8A 2O56A 3UZJA 3B0VC 1X38A 4DJDA 2W27A 3QGAC 2X09A 1TPH1 1KLYA 4XZIA 1X97A 3WYZA 3B9AA 4NI8A 1MZHA 1RA0A 2NVAA 3UJFA 3WIJA 2E9MA 4HN4A 2POZA 3TK7A 3WFAA 2PDKA 3EX6A 1IEXA 1N55A 1Y5WA 2G5WA 1LRTA 4HZ6A 4MAVA 5HMEA 3P81A 5HMFA 4UFIA 1RSCA 1EGVA 4JIHA 3AXIA 3N4AA 2PTDA 2X0HA 2AL2A 4KT2A 1TMQA 4P8VA 3LI0A 4GYJA 3VKAA 2WANA 4LUIA 4RDYA 4WKHA 4GKTA 2QJJA 1W5NA 1C9WA 1YDYA 4L64A 4KWVA 3SURA 1KBIA 3EOEA 5BU6A 3TC6A 1HVXA 4KKXA 2VX6A 3OG2A 1CB7B 4C91A 3T2QA 3HPSA 5D30A 2YCEA 3UYCA 3LPFA 4RDZA 4ZXOA 1PSCA 4HOWA 2Q8ZA 3BAIA 1XSIA 3VC5A 3VDBA 2ZUTA 2CKRA 3EWDA 3V16A 4TV6A 1ZHAA 4C6LA 5D37A 3KOXA 4FNPA 1BXBA 3P7YA 4RW5A 3I3DA 3RX4A 3BGJA 1A5NC 2HWGA 3WK0A 4ZVJA 1G9HA 2PRMA 3GTHA 1VRDA 3U4AA 1HKKA 1CX9A 2QDGA 4W87A 4FXJA 2P76A 1XD1A 3NEHA 1DIKA 1HNYA 3S5SA 4PMZA 3GAYA 3XISA 5J5DA 1H0IA 2Y5JA 1K03A 3IUHA 4Q33A 4WIWA 3CPUA 3S5OA 1Y5VA 2Y8KA 2O92A 3KBVA 2QCHA 1Y0EA 5I77A 3WLNA 3VIMA 3UY7A 3DG7A 4NASA 3EZ4A 4X61A 1S2TA 1KWKA 4GQRA 1IR2A 3OODA 3FAWA 4D72A 2CXEA 2OVLA 3LHUA 5JBDA 1WDDA 4JOMA 4JTDA 1LZOA 4OV9A 4CEXC 2AGKA 2IW0A 1CNVA 1H7NA 3IARA 1FFRA 3VGFA 1ICSA 1OIMA 2ZE3A 3CL7A 3MU7A 2VT0A 1GVQA 4OU1A 1FWAC 2Z7KA 2YFNA 1ZS2A 4DB7A 1KQZA 3F5LA 2YL6A 5D2VA 2WMIA 2YA2A 2PTXA 4YTRA 1Q45A 4AISA 4LW7A 4A22A 3WQOA 4PTXA 1W1ZA 4MWAA 1KTCA 1XH0A 3NVDA 3THCA 5H8MA 3LPPA 1NSJA 4AY1A 3SW6A 1B4KA 3AIRA 1O5QA 4JX4A 1H1ZA 1PIFA 1FH8A 3BJSA 4W5UA 1ECEA 3IRDA 5FSEC 1JEZA 2VM8A 5J8LA 1J6OA 2Q3RA 1CGUA 2CLMA 1YNPA 1KXQA 2VX5A 4QDMA 1DHPA 1TX2A 1LOLA 3G18A 3MUY1 3W75A 1LROA 4NZCA 3WLPA 3RDKA 5EMLA 2A2IA 2OSXA 1WBHA 4EP8C 2VEFA 3A9BA 3HJEA 3HG3A 3E0VA 2EPLX 3FX4A 1DHKA 3R79A 4MZ8A 4LS2A 4RDWA 3KUMA 4CN1A 3A3XA 4LBRA 3AMKA 4F8XA 1MW1A 4Q4KA 5AB3A 4XIMA 4XUYA 3WUBA 1IT7A 4DQWA 3TU9A 1SZFA 4LAZA 2J66A 3GAKA 1PTAA 4GO9A 5E5CA 2ZX9A 4ATLA 3MSDA 2P3EA 4RNFA 4WJEA 3SCOA 2E3ZA 1E4LA 4J9JA 3DDMA 5XIMA 3VFLA 4A3HA 4EF8A 1X1OA 3GX9A 1ZFJA 3IVTA 4GVHA 2ACQA 2NUWA 1WXJA 2HRWA 2I16A 2QQ6A 1FHLA 2Z00A 4Z0SA 3W2KA 3BLLA 4GYFA 3A23A 3EB3A 2V5JA 3LHTA 3NZ1A 2AQOA 2FQIA 2RJGA 3WJWA 3TIMA 3VUSA 2JGYA 4EF9A 3KZPA 3KLLA 4GG9A 1NY1A 4UR8A 3HB9A 3GR8A 3IGUA 5CC3A 3NYZA 4G1NA 3VKCA 1BAGA 1X6UA 3PY2A 5C9XA 2P1FA 5EFDA 1W9BM 1DVJA 1SR9A 1KXVA 5A6JA 4IICA 3RJXA 4BQ5A 2OGYA 1WPCA 3H2OA 4D1JA 4TXEA 3L0GA 4PCSA 1GTHA 1SM9A 4JBRA 1VIZA 1V3JA 1WE5A 2J27A 6PTDA 3F5KA 1UZHA 1W3KA 4PL1A 3VD4A 4DAIA 2ZA1A 1B90A 3BANA 4K38A 1V6WA 2V30A 2Y88A 3G1HA 4EK7A 3DFPA 5G4EA 3NSMA 2H8ZA 4LYKA 5A6KA 3WQ8A 3G77A 2FKPA 4WDUA 3N17A 4LAMA 5RUBA 1MEIA 3CBWA 3OZMA 4LGXA 3UA3A 4QEEA 1RJRA 1NFBA 4S1FA 4GI8A 5BYWA 5H8UA 1ZAIA 2G95A 4EKJA 5CPTA 1XH1A 1LJYA 4H41A 4JL1A 3H4WA 2FJKA 1SUXA 3CTTA 3W7QA 1T0OA 2FVLA 2E5DA 4AC1X 5I3DA 4HPHA 1YRRA 4I7WA 3P0WA 3WUEA 1W1IE 1UA7A 3R0UA 1PCKA 3GTFA 4U2ZA 5FF3A 2Z4GA 3RPMA 3UT0A 3M46A 5CH9A 4MLJA 3UWVA 1QATA 2E5BA 1CGTA 4DX3A 4XVEA 1O5KA 1QW8A 1CZ1A 1IXNA 3CUJA 1I60A 4KH2A 1E9IA 3U4FA 5A8MA 3N2XA 4O57A 1CCWB 1KW1A 3F2DA 4K36A 3FK4A 3F4VA 4ROQA 4AX6A 3NA8A 3O7UA 3WBAA 4K7VA 1MQQA 3P74A 1RLCL 1MW3A 1R3SA 2OU4A 1ME8A 4DWDA 4QXIA 3S2NA 4BR1A 3B9OA 3IS4A 5K9CA 1NF7A 1L6YA 3H7UA 3BAJA 4XO7A 3LRMA 4TMCA 3L9CA 1FUYA 1R3QA 1V93A 1QHPA 2OTDA 1K8XA 4ML4A 3HU7A 4I6KA 4KF1A 5A5WA 4YIWA 1JYXA 4WSHA 4IT1A 1XIHA 4H6RA 2DZWA 3LG3A 4O11A 1SU5A 1B5TA 3LRLA 3AQUA 5IHSA 1T96A 4XBKA 3UERA 3V0TA 4D8AA 4AIEA 2G0WA 3SUUA 4JCMA 3PAOA 4KEUA 3GHSA 4ZB2A 1JAKA 2B31A 4YN5A 3RLVA 1M68A 1ITUA 4MWAC 4H6EA 1V08A 1PZ0A 2ZTKA 3IANA 3EWWA 4MFDA 1LM1A 2VUNA 4G7EB 4RNHA 4WVXA 1G4PA 4DBSA 4JN7A 3MTWA 1SO6A 2EXOA 4GZJA 3SB0A 3THDA 5CSYA 4DLFA 1KC7A 3TCEA 3PTKA 3WLLA 1HVQA 5HPCA 1XWYA 3RIKA 1PWMA 1HZYA 3FGCB 4W88A 1HJVA 5CLWA 3I6RA 5ABTA 5G4WA 3GR7A 4NAFB 2FZBA 2X7VA 4IPPA 3OJGA 3OLDA 5J5RA 1PXGA 2UY3A 4JIPA 3QZEA 4L5ZA 2WZHA 3OHIA 3CV1A 3AICA 3H4GA 4PBFA 3KEHA 4ZSTA 4X63A 5FF2A 1DXFA 5DN1A 3MDWA 4YU1A 1AFSA 2NQHA 3D47A 1AH3A 2GK1A 4D8ZA 2J8TA 5CEWA 4J40A 4RZ5A 3GXTA 1V03A 1W1TA 1VIWA 3CPRA 1OD8A 5TD4A 3W76A 4L4LA 1W9VA 1K77A 5AFDA 2XIBA 1XSJA 4D6CA 4IZGA 5LKYA 3H7VA 2V68A 1I2OA 4IUGA 1Z48A 2PP0A 3OVGA 2NVDA 3IAPA 2QDEA 3UZWA 1IE7C 3P82A 3KHJA 1XYAA 1OFAA 2XFRA 4CLMA 4GQ0A 1XD0A 2HVNA 1SFTA 3L5AA 3DIPA 7TAAA 1DE6A 3C52A 1P48A 1EH9A 3S42A 3B05A 5E1QA 1E0UA 4FOKA 5BXPA 4C6NA 3SSJA 4Y9AA 5A6BD 4UNKA 2NX9A 2XJ7A 1OX4A 2GUUA 3T1GA 2D2JA 4J3ZA 3VD7A 2GQ9A 2NV2A 3MW7A 2H90A 2UY2A 3P5ZA 2GJXA 4PTMA 3IIVA 3G3DA 3SRDA 1A47A 2Y4SA 2PF0A 1J01A 4FP1A 3W72A 2O7SA 3HN3A 3BH4A 2NSOA 4P7NA 3UG3A 3V4BA 4XD4A 1E73M 1EGZA 1CT5A 1UOZA 3OGRA 1W54A 4UQDA 2WHJA 4XV0A 2PZ0A 4LAUA 2FGZA 4LUSB 1M6JA 1ZU8A 3GHTA 4JYFA 3BQ5A 1W1B1 5I06A 1OCJA 1J18A 1PX3A 4UCFA 1TPUA 3V1HA 2OODA 4RUBA 3A4AA 2BB0A 3W22A 1E6RA 3KWXA 2VCCA 4WXYA 3UG8A 2UY5A 4HQVA 3SIZA 1CTNA 4C6IA 4WD0A 3AYRA 3KTSA 4GH1A 1NM9A 4HNVA 1IWPA 1OGSA 2GDQA 4BZYA 3GIQA 1LTDA 5G1YA 1CPUA 3ABRA 2R82A 5I03A 1ZCCA 1OHLA 3T0TA 4LCRA 1OZMA 5C2CA 1PYFA 1YPFA 4Y2WA 4I90A 2XN2A 3ARZA 3M0VA 4JNMA 1E5JA 1IZCA 4KWUA 2BZNA 4FNSA 1N7KA 4RR4A 1KKRA 2ZUSA 3II1A 1P6BA 3QZ6A 4TVUA 3YPIA 1S39A 3VU2A 4CKQA 2GFTA 1TKKA 5LGZA 3BJTA 2Z25A 3CH0A 3N1AA 1QI2A 3EOUA 3UVAA 2WMKA 5DMNA 1EJXC 1OQFA 3QV7A 1RUSA 3UCCA 2MANA 3GRIA 4C6KA 1OYBA 2FDSA 4NNCA 2WJFA 3EPOA 2NX1A 2WKJA 4IXXA 3G8EA 1QI4A 3RLHA 4WOQA 2O9PA 2OT1A 5ABHA 3T07A 4HU4A 1BWKA 1VCGA 4R88A 1ONEA 2ZX8A 1JZ6A 1EP3A 1E1EA 4Z0JA 2NSXA 3EDKA 2X2YA 5GVJA 4DUXA 5D33A 1E1CB 2GDVA 3NZPA 4H9MA 3WMLA 1TPFA 1Q6CA 3ZWSA 4WLCA 4YHEA 4HNCA 4E2DA 4FF7A 1LT7A 1JI1A 3QMRA 1XQKA 5CZTA 4FNTA 2E28A 4R34A 2CEQA 3DCPA 3LHWA 1SFLA 1LYXA 4W8LA 3WNPA 1OADA 4L1GA 3KW3A 2CLFA 5IFPA 1H41A 2ZVIA 3H70A 2UZ9A 2JQXA 3B06A 1JQVA 3KOZA 1XDJA 5LIUX 3TAOA 3TXZA 4JEJA 3OEXA 1OC6A 3BMVA 3LCFA 4HK5A 1U5HA 3RITA 4I9JA 5G1TA 3TDFA 3S1UA 4YTSA 5G4HC 1H2JA 3CZKA 3L2LA 3SECA 1K4GA 1RK6A 3R4IA 4M6UA 3GDBA 2YX0A 1PVNA 3MCMA 2I1OA 3WLKX 3K5XA 2JGQA 3WQWA 2CHOA 1I8JA 3STFA 1GVOA 1XIEA 1OB0A 5I6SA 3NZRA 2WHLA 5A2BA 1RQBA 3M7SA 3K4DA 3VD9A 1GJWA 3W1XA 3BG3A 3ZOAA 3O05A 3C5QA 1BGAA 2WQDA 2WM1A 3WDJA 1JYNA 4YJ5A 1TPC1 3OU8A 4B2DA 3BL3A 3N2OA 1XLMA 1PCWA 4F9DA 1EP1A 3O07A 4EPKA 4TIMA 3D3FA 3GZAA 4HPJA 1S2VA 2F61A 5A6AA 2CLPA 4XZMX 1CGXA 3VA8A 4MZ1A 1TYGA 2ZUVA 3VMNA 1S1RA 3SZ8A 3TYEA 3L67A 2I57A 1P7TB 4LF2A 4DZAA 2WBGA 3AIQA 4BF5A 1NFGA 1AVAA 4HHPA 4TU1A 3FDKA 2WNZA 3KVJA 1W37A 3VKBA 4O14A 2PDQA 2BMBA 2CFFA 2CZVA 2OEKA 4PTVA 7A3HA 1FBAA 4K2SA 1GKRA 5G5IA 1FWRA 2HNHA 1NEYA 1EUAA 4FNRA 3CO4A 5BRQA 3VGBA 1WX0A 3GXFA 2V38A 3GVGA 4IIHA 3S8HA 3UP8A 4HP5A 2XIOA 4J2MA 1J0YA 1P0DA 4GUHA 1DIDA 2VTFA 3VO0A 3HURA 4J3UA 3GH4A 3BG9A 1SW7A 3M0LA 2VKZG 1QI0A 3NQ6A 3RPTA 4YXGA 3C2OA 4QROA 3D3AA 1SZNA 1L6SA 1TELA 1TRIA 4IGNA 5DRIA 3CWHA 5FD0A 3T0DA 5CPSA 2PUZA 5T91A 3I3EA 5FEXA 4A3YA 3KL0A 1V6UA 3DFTA 1OINA 4KETA 4LJ3A 4EE9A 1JUEA 3WQVA 3GBEA 1E4NA 3HGSA 2V0TA 4D2JA 1FX6A 5CBJA 1Y8BA 4P7RA 2QDDA 4G2DA 3NQFA 2R94A 1LCOA 3A4XA 4FK9A 1VYPX 2J9YA 2DZAA 1LUCA 1WZKA 3PSVA 3INPA 1XP3A 2E9LA 2XVNA 3LXAA 1E9ZB 1TTPA 1L8PA 1ZRQA 3EOOA 3R89A 4KRUA 3SQMA 4XD3A 2A4AA 4CNPA 1JCYA 3GW0A 3CS2A 3S1WA 1LL7A 4X0NA 1JGMA 3U7BA 1XGZA 3VMOA 4AWEA 1B3YA 1XRVA 3OYXA 1VH7A 2F2KA 3A21A 5HK4A 3UJRA 2DT2A 1VJSA 3CAVA 2OZ3A 3VNIA 5CSSA 1I2RA 3WLJA 1M1BA 3EXTA 1LOSA 4ZQNA 4MMWA 3VM7A 4YMZA 2ZKMX 2AQWA 1EOKA 4HSOA 2X1TA 2ANUA 3KVLA 1EPXA 1VEMA 3MSYA 3DFSA 3BAYA 4P7QA 4B2DD 1GT8A 5DMLA 2EJAA 5DANA 2NQJA 3DG3A 2PRLA 4IP5A 1MI3A 2VRKA 1BYDA 4FX7A 4F2BA 5TBOA 4TO8A 1DQXA 2OZTA 3W81A 4Y9NA 4GC4A 1F3WA 1DQUA 5GNZA 2FJUB 3OLIA 5ABFA 1BD0A 4DNHA 2ICSA 1N8WA 1WZLA 1FDZA 3U8GA 4MB5A 2CC0A 3WZ0E 4E5TA 4ZFMA 3QBUA 3M5VA 4H00A 1OFBA 4JKMA 4ES4A 3U9IA 4US5D 1HW6A 1QCWA 5F1UA 1US0A 1VCFA 3H54A 1TWSA 3H22A 4Z2JA 4JTEA 4QP0A 1TVPA 4IQJA 4UOQA 2QPUA 4LALA 3WK1A 2A1YA 3H4XA 4IJBA 4XIAA 3QOMA 1Q7QA 3BC9A 3NQBA 5BNKA 1M65A 2XVGA 1BYCA 2WKGA 4HYVA 4N7QA 2H3BA 3GIYA 1G67A 1RJQA 3IK4A 2HJPA 4DF1A 5AC6A 3KM8A 3UXLA 5DELA 4OHQA 4B5NA 1YW1A 2BGQA 4J7RA 1HO1A 1J8VA 1FVPA 1VRXA 1HN1A 2V3FA 4X9YA 4C6MA 5FJIA 1H7PA 2ODOA 1UASA 3H21A 3CHCA 3MMUA 1TCMA 1EDGA 3T40A 2XYLA 4M1BA 2J24A 3FYOA 2FIQA 1YX1A 3R7MA 2QEZA 1IEVA 2R6OA 1LORA 4NF7A 2NZLA 4AEOA 2VENA 4PUMA 1SMDA 1TWWA 1XXXA 2KAUC 3R2GA 3TEVA 1BYAA 3ZJ7A 3F4WA 1VYSX 1DPMA 1A5CA 5HQMA 2W62A 2ZRYA 3M0KA 5DRCA 2AL2B 1GQIA 3PZTA 4IP4A 1C9DA 1XDMA 2WVUA 2RDWA 3MMTA 4Q4OA 4WSJA 4U5KA 4JTJA 3EMQA 4H01A 4WX2A 4GJIA 2NXGA 1Z42A 3A3HA 2ACUA 4NZ3A 3PPCA 1EJWC 4RW3A 5A95A 4RE0A 3NAVA 2Z1XA 1TUXA 4B5XA 3TA6A 4NRSA 3CAKA 2PP1A 4I9TA 2FVKA 4GYPA 1VHCA 2QT3A 2RUSA 4QG8A 2BFGA 4JQ4A 1ITCA 4ALDA 2WWCA 1R2TA 5JH2A 5A1AA 3BARA 3TN3A 1TA3A 4QS6A 4LNCA 3ZWTA 3GUWA 4AVFA 2C1GA 1OSEA 4EOUA 1OFRA 5AHLA 4J2PA 2QCLA 1DWAM 1A3HA 5A2AA 1W17A 4R7JA 4MWAE 2NXHA 1T40A 1Q6DA 4UTUA 4PMJA 1ZBCA 5FESA 3TYZA 3GNRA 3FXGA 2Z1VA 3ES8A 3ITYA 1U33A 1EO5A 1U5VA 3F4NA 3UVIA 4NI3A 3PC0A 4HYWA 4MKSA 3WDIA 4IMGA 4GD0A 2C0AA 2OQHA 2QPSA 3CUHA 3RX3A 2ZZ2A 5CPLA 2EPHA 3WH9A 3BLPX 3TWBA 4GMEA 3MA8A 4XKYA 4AZ5A 3I6TA 3RU6A 1W3JA 1JD9A 3L21A 3ITVA 1UPMB 4LH8A 2DH3A 4ROPA 2C15A 3R0KA 4JIRA 3CAWA 2WO5A 1K8ZA 5AC7A 3AMGA 4US5A 3G1YA 3LLFA 1GWJA 4EACA 4GKLA 3OLGA 4IG2B 3MUXA 4XSMA 1W91A 5TIMA 4C6OA 2ZX7A 3NR0A 3RU8X 1B3XA 1TSIA 3MC5A 3ZYZA 3S1VA 1LRQA 4FR6A 4J35A 3UCQA 1F5ZA 5AYZA 1CW2A 4CEUC 2E0PA 3GVQA 1ISWA 4WKFA 3B97A 2I7GA 4QDPA 2HTMA 2GUYA 4AWTA 1VAHA 2VMFA 4O0QA 4DJED 3GD6A 3V3WA 3GSMA 4O1EA 4GRSA 4WK9A 1W9DM 2YW3A 3PJTA 4ECLA 3B0UX 5AZ0A 2G96A 3V1PA 5A8OA 1EOMA 2JIEA 4Q7NA 4Q8MA 1OFPA 2CWXA 1CECA 2HPIA 3TN4A 3PAJA 3WLSA 3TYAA 2F8QA 1M5WA 5E6YA 1Q8AA 3IK2A 3WX7A 2PBOA 2XFWA 3E96A 3LDVA 3W6MA 1V77A 4NZ1A 5CQ1A 5M2FX 1TIWA 1XI3A 4HCLA 5A6SA 1DJQA 4J3VA 1MEWA 3UYIA 2DZBA 5FL0A 7ODCA 3WL0A 4M7TA 3AHVA 4QJ4B 3EEGA 4CU6A 3MI6A 3BGAA 1UBSA 1S2WA 3GWQA 4M6VA 3JZEA 1C8XA 4IISA 3D46A 1XM3A 3S6OA 3SFWA 1N8FA 1EXPA 4X2RA 3OZPA 4UQAA 2Z26A 2H8XA 3B0XA 3GHUA 4LPCA 1VBGA 3DFNA 5AYIA 1XICA 2OT0A 4Q3MA 4GIYA 4UTLA 4JFSA 3AUJA 1P6CA 3C86A 3UWWA 3QM3A 5CZSA 1GNXA 3PBWA 2YR1A 3MVIA 5CC5A 4XKMA 4UWMA 2V2HA 2WJEA 1WDRA 1UWSA 2D0HA 4DYEA 1I4NA 3HZ3A 3WNNA 3CQHA 4QIUA 2P10A 3S1XA 4EPBC 4XAFA 4MLRA 5A69A 2R1NA 2WVTA 1FQ0A 1R85A 2JEPA 3FA3A 2I5QA 3W70A 4E0CA 4UIOA 3IJ7A 4EPDC 4NZJA 3SQSA 3N18A 3EMCA 2DPEA 2J7GA 2QR6A 6REQA 2R1KA 3A9IA 1G01A 3HFYA 3OA5A 3CNYA 4QHRA 5C9UA 3BCFA 1UD2A 1P7TA 1XX1A 3SBFA 3ZSTA 3MHUA 4JNYA 3UEQA 3DH7A 3TTQA 4NJJA 1YNQA 2VFEA 4ADSA 3JUGA 2H3DA 4ENLA 4W8BA 8XIMA 2VC5A 4LAOA 2GPTA 2VFHA 2PAJA 1GOWA 3T78A 4G8TA 1NTHA 1DV7A 3WD1A 3PZIA 3VDCA 1SJAA 3B0YA 1OT1A 4KWOA 4JS3A 1FWJC 1ZCOA 4HHHA 3OTRA 3GY1A 4WY0F 3DBPA 1LWJA 2B7QA 2VEKA 3GNXA 3GG0A 4UXDA 1WBJA 3L4WA 3WQDA 4AFYA 2YB1A 2GYIA 5FACA 3NQGA 2GVGA 1YEYA 4PMVA 3V5FA 4PA8A 1BFNA 1G0CA 3BAKA 2VJXA 2E8YA 3HV8A 4UFKA 4WY0A 2QS8A 1E6PA 3G0XA 4K39A 1NJJA 3W9ZA 4DWSC 2QZRA 4NL1A 4W84A 1NDZA 4B90A 4U33A 3UNDA 4YPJA 2VRJA 2A3AA 5D2XA 5D8ZA 3CUFA 5C9RA 1TA3B 4I3GA 3KBWA 4RJEA 2XGZA 2BVDA 2DVTA 4Q4MA 5A6TC 5AYYA 5I5RA 1MUCA 3ARWA 3O1NA 4MJMA 3SSZA 1W8SA 1QWKA 3O63A 1V3HA 1JGIA 3U48A 3C56A 2P8BA 2CKSA 4XZBA 2HQAA 5E9AA 4URIA 4W86A 1XLIA 4XWUA 1AQ0A 3UZXA 3DFHA 1KV8A 2F38A 5BMXA 3H2MA 5CJNA 4JPGA 5F7UA 2FYMA 1YTEA 3DBNA 5DXYA 3Q67A 4XSLA 3QQWA 2ZQ0A 3WD2A 1E1CA 4M56A 4I9AA 2AKZA 3HV9A 1SYTA 4KCWA 1VBHA 4NQ1A 1SJBA 1QI3A 4XUGA 4FO4A 4AB4A 2VGGA 3WJXA 1J10A 2FTYA 1A3WA 3G1AA 1RBAA 1PWLA 4PMYA 1ICQA 4HZMA 2XG9A 3DFYA 3UQNA 4ERGA 1IEIA 3OO2A 3PTMA 2GJLA 5I78A 3DZ1A 1Z6KA 3CLMA 3PK7A 5CXPA 3OA3A 2OWXA 3MANA 1WKFA 1F3EA 1N2VA 2G4FA 2G8ZA 4JYDA 1RD5A 2J9ZA 4C5ZA 2BY2A 4PB5A 5GPRA 2CW6A 3UCDA 3WFZA 3I7QA 2Q8LA 3M9YA 3MI3A 4LSBA 3DHFA 2PA6A 2XWDA 3PZUA 2R9RA 2VR2A 1HKVA 4PFMA 4H4IA 3PNUA 1LWIA 1XBVA 2C1HA 3K8LA 4GIEA 4W93A 2VX4A 1EA9C 1VPXA 5BROA 1AA1B 5IDZA 1OVDA 1ADSA 2DEPA 1KRAC 1UP3A 2P5NA 4GBDA 2C0HA 3C2YA 3KCJA 3B8DA 3TZNA 3OVQA 2VD9A 3CT2A 1TV3A 5BOOA 2FHFA 1JVNA 3KE0A 4M8UA 3W7PA 4DJFD 4B3ZA 5AC5A 3O0FA 2VR4A 4ACYA 3TMLA 2DGAA 4CQCA 5EA9A 4U5IA 5GNYA 4A3UA 2FMNA 3I7RA 2ZIDA 4LS0A 2FLIA 4RZ6A 2WM0A 1B9BA 2PDWA 3W2LA 1XRTA 4R3UA 3QHOA 1JRCA 1R2RA 1VC4A 1KR1A 1V5XA 3QGVA 1V0KA 2NQLA 4F0KA 4CCZA 3MO7A 3UD6A 2BP1A 3RYSA 1SJDA 4DLMA 5EL1A 1HTIA 3EX3A 4GZEA 4YYCA 3DYPA 1B1YA 1LDCA 2GGIA 1KFJA 3GVRA 5LGXA 4KRZA 1WKEA 3C0QA 3T8LA 1YKWA 3P80A 2V3GA 4XAPA 2X0YA 2IPJA 1P6WA 1OG6A 2QAFA 3W85A 4EWND 3LBMA 1R46A 3HMCA 1QFEA 4L9ZA 3GYEA 4FLSA 2DORA 4AD5A 1J4EA 2CPUA 2VI0A 1OX4B 4HB7A 2YL9A 3LY0A 4GUFA 1UUOA 4IH3A 4IFRA 4GNVA 1W3TA 1JAEA 2WNQA 5L6UA 3H2AA 3O6YX 1M7JA 2IS7A 1YBQA 4US6A 2XN1A 5A6BA 4M3PA 1Q4NX 5LXXA 2VEGA 1AD1A 3WEZA 1F05A 1A4MA 4Y90A 3JRKA 1WDPA 1TVLA 3M64A 1CIUA 5LA0A 4E2OA 4B92A 2CHRA 2HMCA 3VCRA 1CLVA 4G56A 4CNNA 1Q7MA 4PL2A 1EX1A 1GG0A 1GG1A 4LBUA 3F03K 2HS8A 2RGLA 4C6BA 4MB4A 1WQ5A 3GVWA 3LTYA 4RNJA 1IWBA 1TUFA 4QITA 2J7CA 3ABXA 1O95A 5C5YA 4YVPA 3QEZA 5F2GA 3HOJA 3IGHX 1WZMA 4MM1A 4GY0A 3EBVA 2EPKX 3APYA 1E56A 5HPOA 2IKGA 2GK1B 3DERA 1TJPA 3AHYA 1Q6EA 1AUSL 1V79A 2JEQA 4CNOA 4BKNA 2INZA 3KL5A 1NDWA 2OPJA 3KBMA 4RPPA 2YBVA 2QCFA 2WCGA 4FLOA 3PJWA 4ML9A 3V5OA 4NHVA 4PODA 4BHYA 2BXYA 4S2BA 1F4AA 1BTCA 1CGYA 2R14A 3QY7A 3R6IA 2I9EA 3DHPA 1P0BA 3G6LA 3HM7A 4ZE4A 1GVIA 2JKPA 3ANVA 4ZL1A 1VGAA 1P43A 4DPQA 1Q2SA 2BY3A 1DIOA 3DAQA 3EXSA 1AQHA 2WK2A 2CBVA 4IX2A 3NPWA 3SY8A 2A7RA 4UFJA 5HWJA 4CNTA 1JZ2A 3R94A 2ZADA 1UWUA 3KVMA 4L4PA 4H9YA 3ZXWA 4NU7A 1UG6A 1AL7A 3CJPA 3EDDA 1UD8A 4QSHA 3IVSA 3WQPA 2OWWA 4PMXA 2G50A 3ITCA 2EPMX 4S3KA 2B0MA 4ZMGA 4H7ZA 5CPOA 1UUQA 4GA8A 1XRSA 3L5LA 3HG2A 2YXGA 4JX6A 2RFGA 2QCNA 1ZY9A 4L6HA 3OGSA 2WW5A 3E0IA 3G8RA 1TTQA 2TAAA 1UZ1A 2XVPA 4JGDA 1KXHA 4QTGA 2PB1A 3ENLA 1OM0A 4Z2LA 4OT7A 1QXLA 1GKQA 4ZSUA 1D7FA 3TN6A 1DJWA 2C3ZA 4JKKA 4NAEA 1EYEA 3SCTA 4H2HA 2RDTA 1AJ0A 4EAMA 1G94A 4NG3A 2R91A 3A4WA 3UGRA 4YHGA 7CGTA 1A0DA 5HXMA 4EIVA 1AD4A 3ICJA 1XYZA 4F40A 5LIYX 1EZWA 4UC5A 3DI0A 4XVDA 3S0CA 4IIBA 3R11A 4B4HA 3PBMA 3SCWA 4AXKA 1PL9A 1EF3A 3EKZA 5KEZA 4X22A 4WOZA 3TNOA 5E9XA 1M7XA 3T09A 4PCTA 3KHDA 1XINA 1NAL1 1YMYA 1MNZA 3BCJA 3QLDA 5E0KA 4RE2A 4PB3A 1UBPC 1OJXA 3N6JA 1GQJA 1K1DA 5DT7A 3FOKA 1V02A 1JPIA 4OKDA 1S5MA 4QNEA 3KRUA 5FJJA 4QX4A 2EQDA 1OC5A 3XIMA 4RE4A 4S3JA 4CNUA 1R2SA 1GOXA 3BO9A 3PSWA 4LCQA 3IV8A 3K1GA 5GJNA 4IP7A 3M5ZA 4JQAA 1E70M 2WOQA 1GOMA 4RCXA 2PLJA 2F6KA 4JEQA 4U2YA 1UR8A 5EKYA 1VCVA 2VZTA 1AH4A 3OP2A 1A5OC 4OBRA 3U0HA 3UETA 1H1NA 1L2UA 2IKHA 1XLEA 5KSWA 4NYYA 1PHQA 4BF7A 2Q3OA 2BVTA 2VDGA 2F7FA 2J4GA 2PI6A 1EHNA 4DZHA 3BTNA 4O53A 3QFWA 1FOBA 1HGYA 3HPXA 4IG2A 3S9IA 1C7SA 3CUZA 5JBFA 1XLJA 1YQ2A 2XM2A 3P3BA 2ZRWA 5BMWA 3EWZA 5HMDA 5GQBA 4K1GA 5BWAA 4L9YA 4HNUA 5C9ZA 5FIPA 2KX9A 4PMOA 5CG7A 3FJLA 5HANA 1TVNA 3OQ8A 3WO8A 3F7JA 5C9WA 3QVQA 4XKYB 1ZALA 3AAMA 4QRNA 3L4YA 2PDIA 2X8RA 3RMEA 1E72M 2D0GA 3B4YA 3F1QA 1XIDA 2V81A 4F2UA 2J78A 3GC5A 4UTMA 4AD4A 2LLEA 4AZGA 4O28A 3VNJA 1ADOA 1SFSA 1W1PA 4UQBA 4JTKA 1QNVA 3EPMA 2DSWA 9XIAA 4DUWA 2AAAA 5C7VA 1T7LA 5ABGA 2GWGA 3SO7A 4IJRA 3BW4A 1M01A 3UXIA 5F4XA 5EGRA 1E5NA 3DU0A 5I79A 4CCCA 1KGWA 4QE4A 3R43A 1UHVA 3GH7A 3VOIA 3BLKA 1XPGA 3LBOA 2OLAA 2VCAA 3MDUA 4ICNA 1VFTA 1YDVA 1HKWA 4AD2A 3WNLA 1SJCA 1B30A 5TNVA 1MRAA 2B7OA 2ZUNA 4MY1A 3APTA 3NJ3A 3O6CA 1RD6A 2Z7GA 5DX7A 3NL3A 3GU1A 4Q4PA 4Z08A 4IQEA 3MV11 3C8NA 1UR1A 3UXAA 1VFFA 1XISA 4DEFA 4MY8A 1G7VA 5IDIA 2D69A 1TB3A 3K30A 2Z0IA 3V75A 1TCDA 1YBQB 4F0RA 1QU4A 4ORMA 4FIRA 4LVFA 2PD5A 1ISXA 4KRTA 4EWJA 5K9XA 1CBGA 3E6EA 3ITGA 2X7WA 4QDWA 1VENA 1UR2A 4FI4A 1XF0A 4NJGA 1D8CA 3E5PA 2QUVA 2NLIA 3AYTA 4GFSA 3WDQA 3UWQA 3M6YA 4D6HA 3QOKA 3DFOA 3H8AA 4I9MA 1KB3A 3SCSA 2QCMA 1QOQA 4HIBA 4QISA 3MBFA 3VKJA 4CD6A 3UWZA 1QMLA 1PIIA 1W1A1 5A8GA 2WHMA 3C0LA 4ZE5A 2JKEA 3SN0A 2A5HA 1SSDA 1K8CA 4MYXA 4Q6JA 1UD6A 2OX1A 4UTJA 4JFUA 2PDBA 4GGHA 5AKQA 4UB9A 4AY8A 1J5SA 3PG8A 1GVRA 2VOTA 2QMJA 3NEVA 1GYLA 1TMHA 5G2IA 4KWSA 4Z1CA 4EANA 2NX3A 2GVJA 3SAZA 4HTBA 1F3XA 4GZIA 3C0JA 1KRBC 1M9HA 4ZB5A 5DLCA 1TWZA 3LMYA 2YOCA 3PZGA 1Q7ZA 3MKVA 4O54A 4DJDD 3RMJA 1E40A 1M41A 4ERIA 4GZ7A 1JYWA 3ATYA 4YVVA 1KWGA 5E93A 2EKGA 2QUTA 4RNIA 1BG9A 4O15A 1TZ7A 2J8GA 5D8WA 4CQ9A 3LZ3A 4PMUA 1B57A 1BRLB 1QO2A 4DXKA 3OPSA 5D2WA 4PR4A 1R7AA 4CVWA 2Y7DA 4IIGA 4XQ6A 4HSNA 3ZMRA 2WAGA 1CXIA 3W7JA 3MQTA 1Z44A 2QCEA 1GYNA 1M53A 1WOBA 4N4PA 1QW7A 3TLQA 3IIPA 4EVZA 1PBGA 4PE8A 1KTNA 1J9YA 4L7ZA 3RM9A 1FWHC 4R85A 5C71A 4IFOA 3NM3A 5K4ZA 3TOPA 1XBYA 3QW3A 4ZTYA 1M3UA 2GJXB 2ISFA 4MFEA 1O6IA 1ALDA 1XV8A 1W6TA 3MKCA 4MADA 3AMLA 4ICMA 3VI2A 3PZNA 5HJLA 1DWJM 3ITTA 4W7WA 3IJLA 2OZ8A 3F2CA 2YFOA 4V28A 4Z1DA 3TC7A 3G22A 4L4MA 1JULA 3KOYA 3WEOA 4UTFA 2OJPA 4H1ZA 4CNSA 1C91A 1ML1A 4WGXA 2WMGA 1XBXA 4GABA 1QASA 2Q8XA 3IPWA 4FAMA 2FFCA 3UJ2A 1V0LA 1Z32X 4JR5A 4UMBA 4QCEA 3C3UA 2Q09A 2HCVA 3QRHA 3HO8A 1AW1A 4UTWC 1DEDA 4Q8WA 3GDKA 2FPTA 1OC7A 1XG3A 2HBXA 3B40A 1SFJA 4KFPA 4CD5A 1UR3M 2PD9A 3TC3A 1PPIA 2GGGA 3AXMA 3S2CA 1FFQA 1Q66A 3CL8A 3A22A 2WB5A 1VPQA 1BYBA 4H7CA 3MS8A 1RBOB 2PWEA 3GO2A 2HISA 4EAYA 1JZ3A 1NU5A 3U7VA 5F4WA 4K3ZA 3T4CA 3S6DA 1ENUA 2FFIA 2PSNA 3WD0A 1EJSC 5D02A 1MVYA 4LYPA 3I4KA 5EBUA 1MDLA 2ZXBA 3QH2A 4KMQA 4BQ4A 2HBVA 1Q65A 2RH9A 4HVXA 4RLIA 2C18A 2CERA 1PUDA 3OZYA 3K46A 1JUBA 2WHKA 4CCDA 3B8TA 3G1RA 4IPLA 3TUUA 3JU2A 3NQ7A 1TWDA 1MEHA 3T0BA 3SADA 3RN6A 4GGBA 1E3XA 5M03A 1Z89A 3BV7A 3FGCA 5JIPA 1GGOA 3IUIA 2PTYA 1KFBA 3RUBL 1QOXA 2ATSA 1A53A 1ZLPA 3OQEA 5HNRA 1UKSA 1MDRA 1FWSA 5JIWA 4Z2GA 3HGJA 4KGJA 4JTSA 2NUXA 5EU9A 2X40A 4A3QA 2Y5EA 3T08A 1UROA 1AMKA 2WYSA 1SQ7A 1XFCA 4O12A 1ZGDA 2CLOA 3WF3A 3BXWA 2GLKA 2E1WA 1XGEA 3GE7A 1CB2A 2J8FA 3DC8A 4FB7A 4M80A 2XPKA 4E8DA 2Z1WA 4W8AA 1RQHA 1EWDA 1VFLA 4ADTA 4IMDA 4FALA 1QT1A 3H23A 3Q45A 1PYMA 5CG0A 5CCZA 3RLUA 2W5FA 5H1WA 2Y89A 2I14A 3D0CA 4QEHA 2ZUMA 2BNJA 3WKZA 3WLRA 6CGTA 3MHGA 3HF3A 5JU6A 3VIKA 4GH3A 1RH9A 4D6GA 3H7RA 5I09A 2XFFA 3CK5A 1NWSA 3ARRA 4F0MA 1E1FA 1EC9A 2PWUA 1FDYA 3CQJA 3IIXA 4OFCA 3I7SA 2J13A 3P84A 1ISVA 3QTGA 4WJXA 5HR7A 5CBIA 4QQ3A 3HQNA 4HNOA 1KRMA 4C6PA 2J75A 2FDMA 1J12A 1JUKA 1CLKA 4QJ1A 3SRFA 2OEMA 1TPVA 1WDSA 4LB3A 1WDWA 4BFAA 3IJQA 1Q3NA 3DC0A 4RXGA 4IPNB 1V0MA 1A5KC 3L23A