1B1YA

Sevenfold mutant of barley beta-amylase
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
500
structure length
500
Chain Sequence
MKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKDFLDAGVIVDIEVGLGPAGELRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDAGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKIAGVHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQPPDAMSAPEELVQQVLSAGWREGLNVSCENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYVNFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKIQPFPFQEHTDLPVGPTGGMGGQAEGPTCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the sevenfold mutant of barley beta-amylase with increased thermostability at 2.5 A resolution.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords PROTEIN (BETA-AMYLASE)
total genus 164
structure length 500
sequence length 500
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b1yA00
1JDCA 2JALA 3TP4A 1GQKA 1CIUA 2TAAA 3B9EA 1KFWA 1MW1A 1LL6A 3AMLA 3GM8A 2D2OA 1V6UA 5DT7A 4A3YA 4ZXOA 1GVYA 3WDPP 2GJRA 3II1A 2XWEA 2X8RA 4GKLA 5A69A 1FP8A 4TUFA 1HT6A 1E6PA 2A3CA 2C7FA 1E5JA 4M81A 4B15A 1H4PA 2ZUUA 7TAAA 3PTKA 1IZJA 1CDGA 1QNPA 2NW0A 1LF1A 4RE3A 4H8HA 4ZXLA 4ZEPA 1W9XA 3GNRA 3O9NA 2WHLA 1J12A 4HPHA 2ZWZA 3OIHA 2CBVA 2GUYA 1JZ4A 1EXPA 4AEEA 1JG9A 1HP4A 2UY5A 4DWSA 2D0FA 4JFUA 1V08A 1WDRA 1E0WA 1GQLA 2WMFA 2ZWYA 3L4YA 4DUVA 3AMCA 1VIWA 3BAXA 2CCRA 2WK2A 1UQZA 2WW5A 4Q7NA 3SCQA 4JZ5A 1W9VA 1WCGA 1UKOA 1V02A 2AOSA 2V3EA 4JL2A 1US2A 3M6DA 4HP5A 1BPLB 3AROA 5IDIA 2BY1A 1EDGA 2D23A 3HN3A 2XM1A 1CTNA 2J8GA 4MB1A 3DHUA 1B2YA 2J62A 4N0RA 1C93A 4GPNA 4FMVA 4WK9A 4AD3A 5A6AA 4QLLA 6TAAA 2Y2WA 4AYSA 5CPTA 3BMWA 3W37A 3QHMA 4C7GA 2Z1SA 1K9DA 4FF5A 2DT1A 1UA7A 1TA3A 3ARXA 2YDSA 1QVBA 5A94A 1JF6A 3RIKA 2WC7A 4DM2A 1GPFA 1QI4A 2G8ZA 2DH3A 1V3HA 2XIIA 1BG4A 2JEPA 5CZKA 3WQ6A 1V3JA 1BYBA 3MSGA 3AIRA 3MUIA 1HL9A 1VJZA 3QOMA 4P7NA 3W26A 3ZJKA 2BVTA 4J28A 4UOJA 2BFGA 2DSWA 2BHZA 3VPLA 2W5FA 1JD7A 2W67A 4KH2A 3GXIA 3DECA 1WKYA 4D6HA 1XRVA 2BS9A 4W87A 1QI3A 2PI6A 3AYSA 1LWJA 2J75A 5CSYA 2W92A 3NCOA 4XX6A 3TOPA 1KCKA 2BHUA 4XV0A 1VFUA 5AY7A 4AZ5A 3FHQA 4UFJA 3WKZA 4GQRA 5I5RA 1BLIA 4GI6A 4JFVA 4XZWA 3ARYA 3BLPX 1OWQA 5HXMA 2Y5EA 1IV8A 1PBGA 3FW6A 3HU7A 1H3GA 4UOZA 2ZXQA 4J7RA 2ZXAA 1KGUA 2G41A 2FHBA 1E4IA 4Y7EA 1XSJA 4HOZA 2GK1B 2ZX8A 4ACZB 2IXVA 1UH4A 3BAYA 4FLSA 4NRSA 3VIKA 1G1YA 2ZXBA 3MMUA 1TE1A 4AD0A 1D7FA 1R8LA 1J01A 1VFFA 3WF2A 2BY3A 1PZ3A 1ZL1A 5ECUA 2XG9A 1UR8A 1VB9A 3IJ9A 2EPOA 3EDEA 3WD1A 3PHAA 3GH7A 1CXKA 3AIVA 4UFKA 1HJSA 1J0ZA 1MQQA 1OD8A 3WDQA 5CGTA 2WZHA 1XYZA 4KRUA 5FL1A 4JHOA 1EO5A 3LPPA 3W53A 1R86A 1FHLA 4QCFA 2OLHA 1UG6A 3BAKA 4UFLA 3SCUA 3T2OA 4BQ2A 1GOQA 1W91A 1A3HA 1H11A 2D3NA 4CN1A 2J7CA 2YBUA 4OOZA 3CUFA 2JFEX 1TG7A 2V3GA 1W3LA 1UKPA 2WZEA 5JIPA 4ZE4A 1BAGA 2E4TA 4UFIA 1CWYA 4WIWA 5BXTA 1CGVA 2D0HA 2GJXA 5ABEA 4Z2JA 3EBVA 2ZUVA 3VD7A 3CZGA 2A3AA 1G01A 4WSKA 4M8UA 4HA4A 4YHGA 2J7GA 1GVIA 1HXJA 4AD4A 2J47A 1TFVA 3A4AA 2VNCA 4D6CA 2HISA 3ARTA 2HVMA 4P7OA 2E9MA 4TVDA 2CERA 5LA0A 4TTGA 1LL7A 1E3XA 3WH6A 1WAWA 1O7AA 4H8VA 3KL0A 1NH6A 2VZVA 3GXDA 3GXFA 1C7TA 4J3TA 3O6AA 1E73M 1J0HA 4MNKA 1XHGA 1OBAA 3NSXA 1W1VA 2WSPA 4MAVA 3BC9A 1XCWA 1MW0A 3AMGA 2BXZA 3LPOA 1JNEA 4AC1X 1XSIA 3BSGA 1DWFM 3TTSA 4WF7A 5AC5A 5A8OA 1E4LA 4MJ4A 1NWRA 1W3KA 2VL4A 4H04A 5A8QA 3BMVA 3AXIA 4UOQA 1P6WA 3T08A 5I24A 1XYFA 2YLLA 3SCPA 3L4WA 3VILA 4E8DA 1J11A 3ZQ9A 3CH9A 2JIEA 5HOSA 3FAWA 1JZ6A 5FL0A 1E40A 2XGIA 4HOWA 4BQ4A 3SUWA 4U5IA 2VOTA 2VUYA 2EPNA 3AFBA 4JFWA 3AYRA 5BXPA 5DF0A 2G3IA 4LYQA 1E71M 2G3MA 4WKAA 2B31A 2WLYA 2QF8A 2CIPA 4J3UA 1QHPA 2G3JA 4CD5A 1K9EA 1BSIA 3SCTA 4PEEA 4MNMA 4QLJA 2EQDA 4F66A 4W5ZA 1UYQA 3EMZA 2OYMA 1RD6A 1V3IA 3AXHA 3CUJA 2J77A 1R7AA 1ZJBA 1UUQA 1FH7A 2RGMA 1FFRA 1UWTA 4P7LA 2GSJA 4LXFA 5A8NA 2W62A 1J18A 1V6WA 1QOXA 2J25A 2DT2A 4LYRA 1FA2A 1BF2A 4HU8A 3FHAA 4PCSA 3WN6A 4JHZA 5CQ1A 3WNMA 1U33A 2WWCA 1C92A 3PTMA 1Q6CA 3AIWA 1M04A 8A3HA 4PUDA 2XVLA 4JAWA 1E1FA 2EBNA 1KB3A 1LL4A 1EH9A 2WHJA 5M03A 2VMFA 2XFRA 2E8ZA 4V28A 1ISXA 1UWRA 5BWFA 1B3WA 4UQDA 2WLZA 4Z2HA 1E43A 2FH6A 1KR1A 1SMDA 2YIHA 3K4AA 3OLEA 4A4AA 4CU8A 1BTCA 2J74A 2WVTA 2CHOA 4HMEA 1EHNA 1W2VA 5AYBA 3VX0A 3VIFA 3HJEA 3QHNA 4PMUA 4W86A 2PWHA 2A3EA 3UG3A 3WMBA 4HZ6A 3WBEA 1EIBA 5C70A 3GH5A 1E56A 5HNNA 1K9FA 1JYXA 3ZR6A 4N42A 4UQCA 3MV11 7A3HA 2AAAA 3B9DA 1B1YA 2BVYA 3MMDA 3RM4A 4R27A 1CLXA 1HIZA 4AD5A 3AS1A 1QI5A 2DIEA 4J3WA 5IFPA 3I3EA 1W1PA 2FH8A 4DWSB 2D24A 2X1IA 4CN4A 4DUWA 1WO2A 2OSYA 1N82A 2WCGA 3VIJA 2CBJA 1GORA 2F2HA 2QV4A 3RILA 1M53A 2Y8KA 4U3AA 4CU7A 1IZKA 2XYLA 4P7QA 2YJQA 3MUAA 4MB3A 1WP6A 1BG9A 1XH1A 1B90A 1LG2A 1NOFA 4BQ5A 1W9DM 4D1JA 3PZNA 1R87A 3OGSA 3S2CA 1JXKA 1WZMA 1UR0A 2ZE0A 1FFQA 1XD1A 3W4RA 5A2CA 5ABFA 1JD9A 3RM8A 4JL1A 1C7SA 4HZ8A 7CGTA 1XH0A 3S6TA 4AZGA 1BYCA 3J7HA 3CO4A 4CUCA 1GJWA 1AQHA 1JDAA 5CJ5A 5A95A 2XHYA 3QHOA 4YN5A 2QPUA 1RP8A 2VCCA 1X6NA 3WNOA 3SURA 1VENA 1AVAA 4WJXA 1H0GA 1AQMA 4KRTA 1QHZA 1RP9A 1KWGA 1JAEA 1W9PA 1VFOA 1JYWA 1DTUA 3OLGA 4GO9A 3WMSA 4FLQA 4GZEA 3ARZA 3SUUA 1ODUA 3SCNA 1JYVA 1UKQA 4Z2LA 1GW1A 1G5AA 2YA2A 5CLWA 2EJ1A 3CHEA 3RJYA 2DIJA 4PCTA 3SIMA 1C3FA 3SCWA 1ZBKA 4P7RA 2CETA 3NDZA 2NT0A 3WNLA 3AOFA 4BCEA 3WNKA 4CVUA 4B16A 1UWQA 2E9BA 1XV8A 3POHA 1DEDA 4PSPA 2ZXDA 1J0JA 1V03A 3ZT6A 1GOOA 1ISZA 4PMVA 1E6NA 3HMCA 2GJPA 3ZM8A 3L4TA 1GUVA 4GZJA 4CD6A 1VEMA 4P8UA 1H0IA 1NOWA 4PMYA 1I75A 2AMGA 3ARSA 2DT0A 2PB1A 1JF5A 1W3HA 3K1DA 3PZMA 5EFFA 1OIFA 3WQ8A 4BZYA 4TTUA 3BAIA 3A47A 4JCMA 4KGJA 3MSDA 2YA0A 3M7SA 5IXEA 5A6LA 2X09A 2XPKA 1WZAA 4U31A 5JUVA 3KE0A 1QBBA 2WKLA 3GNPA 5IHSA 3AS2A 3CZLA 1JFXA 1NWUA 1V0MA 3A6OA 3WNNA 1CXFA 5C71A 1JXJA 1KXQA 1UR2A 4M29A 3F5JA 4GO8A 2GVYA 1J0IA 1HJQA 2O9PA 5EFDA 1KQZA 3SUSA 2VTFA 2NSXA 1ISWA 3K8LA 2FHCA 3WH7A 1ISVA 1MVYA 5TD4A 3WD3A 1UD4A 3IAQA 4X0VA 1UQYA 1BFNA 3VNYA 3VTRA 3OB8A 3LPFA 2EPMX 1PX3A 1UH2A 5A8PA 1C8QA 1W1TA 3CGTA 4EKJA 4DUXA 2GDVA 3RMEA 2ZX5A 4QLKA 3WY1A 3WEMA 4LQ1A 5JIWA 1JZ3A 2VCAA 5D9MA 3PZQA 1CXIA 1W1YA 1ZS2A 1E9LA 3CZKA 3SEPA 2Z1KA 1GNXA 1VJSA 3A4XA 2OYKA 1X1NA 2VZUA 4OBRA 5FCZA 3OGRA 3WUGA 4TXEA 1EOKA 5AC4A 3DYPA 1MXGA 4WKHA 5CPSA 1CECA 2ZIDA 3PZUA 3WF0A 2CBIA 4J3VA 1ITCA 4HU0A 1H09A 1HVQA 4H7VA 4H41A 3OGVA 3F5LA 1PEZA 2JE8A 3NSMA 1PX8A 3CUHA 1RPKA 3W27A 3VGFA 5BXSA 1BVZA 1MQRA 3UESA 1B0IA 1E4MM 1EA9C 3VGEA 3L4UA 2VX4A 1JL8A 4NI3A 3L2MA 1GOWA 4QDMA 2J78A 1CBGA 2W63A 2J7BA 3T09A 1WDQA 5JBFA 1MFVA 2ZUMA 1EDQA 1PIGA 4U2ZA 1HKMA 1GQIA 4D6IA 2DGAA 5HPOA 1KCLA 4W93A 5BXRA 1JGIA 2O92A 3AZSA 2WXDM 3VU2A 4ATLA 4DM1A 1DWHM 1OINA 3DHPA 5DEZA 3UR8A 2WMHA 1WDPA 1B3XA 4CCDA 1SMAA 1E15A 2XVKA 4D6FA 1KQYA 2WKGA 2WMGA 1CXLA 2YL6A 1BGGA 4M24A 2G4FA 5D9OA 4AW7A 1KXVA 3G6MA 3BXWA 2DH2A 3D5HA 1W9UA 4AZHA 3THDA 2MANA 4W85A 2OSWA 3WNPA 5A6BD 2XUCA 3F5KA 2F61A 1UOKA 2QPSA 4A3HA 8CGTA 2YA1A 4CGTA 1QNQA 1E6SM 9CGTA 3WIJA 2DQXA 2PWGA 3TA9A 4PSRA 4CVWA 3M07A 1CGTA 2J79A 2DDXA 1WZKA 1GHSA 4XZBA 3W6MA 4AIOA 2ZOXA 3U57A 5D9NA 2PWDA 4W7UA 3EMQA 4JFTA 1KXHA 1BQCA 4UQAA 4P8XA 3G6LA 3WQWA 1VFMA 1WB0A 1UH3A 3WUEA 3AZRA 1OM0A 4C7FA 3RPMA 3WDJA 2BV9A 2W61A 2WWDA 4GQQA 3F4VA 2WMKA 1KGWA 3UCQA 2ZX6A 2QHAA 2VRKA 1QI0A 5BRPA 1UD5A 2OWWA 3ZT5A 1W2PA 5I0DA 2WAGA 2UY3A 5BRQA 1TVPA 2ZUNA 3WF1A 3WH8A 2V38A 3THCA 4QCEA 3EYPA 1OD0A 5A8MA 4MNLA 1JIBA 3PZOA 1MW3A 5E70A 3RM9A 2FHFA 4MJ2A 4LGXA 3O2LA 3WFZA 1F4HA 1HN1A 1GQJA 3IJ8A 4HA3A 1J0YA 1HX0A 5KEZA 3ZOAA 4GXPA 1D3CA 1ITXA 5A6SA 3CPUA 1CGYA 2VZSA 5D9PA 3PN8A 3I3DA 5A1AA 3AQUA 2W4XA 1JZ8A 1US3A 4P8WA 3WDIA 4B3LA 5CXPA 3VIPA 1E72M 3MKKA 4AIUA 4AZ7A 1JZ5A 3EDDA 3WEOA 1YHTA 3VMNA 4TX6A 3AS0A 1FH9A 4CU6A 4M80A 4UZUA 1H49A 3VIHA 2WMIA 2ZUTA 3L4XA 3VDCA 3UG5A 3POCA 3PTQA 4EK7A 4WLCA 4MDOA 1JNDA 1EQPA 3GTNA 3CHCA 1ZU8A 5CSUA 3VGDA 3VIGA 5A6MA 5A2AA 2CXGA 1NQ6A 4M82A 4CCCA 3VMPA 1ODZA 2E8YA 2CKSA 1VEOA 1QW9A 5I79A 3MUZ1 5I23A 1V3LA 1VF8A 4MAZA 3AI0A 4LYPA 1CNVA 1NWTA 3GDBA 3OZPA 2WPGA 3WF4A 4B9ZA 4PMNA 2PBGA 1QHOA 1V0KA 1OT1A 2ESCA 2WYSA 4HTYA 5GNXA 3WQ5A 1XC6A 3RDKA 1DWAM 3WDHA 4W88A 5DT5A 4F79A 1E1EA 3MUY1 3WELA 1DWIM 3K8KA 4U5KA 5BROA 4W8LA 1H1NA 1R85A 5HPCA 1BYDA 2BNJA 1U30A 4OKDA 2YDQA 2X05A 4PMRA 3VX1A 3VNZA 2UY2A 3MANA 3FNDA 2CHNA 4PUEA 3L4ZA 3WEZA 2VCBA 4W89A 4ZENA 1OB0A 2XFYA 4OZOA 1M01A 4K68A 4LX4A 1CGXA 4W8BA 4F9JA 1LJYA 1TMQA 3NYDA 2D22A 3L4VA 3MO4A 4E2OA 1ESWA 4HMDA 2XM2A 4AZCB 3MS8A 1ZBCA 3N12A 5M17A 1UKSA 3VD5A 3UG4A 1AQ0A 3SUVA 2GFTA 3UETA 1FH8A 3WL1A 3NUKA 1WNOA 1Q6EA 1E70M 1JI1A 3ARUA 2GK1A 1C8XA 2XFFA 2VURA 3TTQA 1TR1A 1FHDA 4L4OA 2VX7A 3ZSSA 3LPGA 4PTVA 1S46A 4PMDA 2YKKA 1SR0A 5ABHA 5DMYA 4FLOA 1OCQA 4V2XA 4CCEA 1VAHA 2BY0A 3WMCA 4D6GA 3ZJ6A 1ISYA 2BXYA 1SYTA 1OGSA 3ZT7A 4GI9A 1Q6FA 3T0DA 4BQ3A 4C7DA 1JDDA 2WVSA 4D71A 4BA0A 4Z2GA 1B3YA 3NSNA 4UZSA 4H8UA 2E9LA 1JAKA 2V3DA 3PZGA 3VO0A 2D1ZA 1HL8A 4AEFA 3W29A 1Q6DA 5I2UA 1J9YA 3WL0A 4DWSC 5GNZA 2J4GA 1KGXA 2IUZA 3W6LA 4J3SA 2O9TA 2C0HA 1E3ZA 3WDRA 1UR4A 3OBAA 4PMZA 1V0NA 1Z32X 4AISA 1MW2A 1ZBWA 1AMYA 2GJXB 4KGLA 2O9RA 2J7EA 1TA3B 1UR9A 4JKLA 4JCLA 4PN2A 3VUPA 4ML4A 3VIIA 1J0KA 3MU7A 3PZ9A 2JF6A 4XB3A 2DEPA 1PZ2A 3W25A 2A3HA 2VZOA 1CZ1A 2X2YA 1EHAA 1GOKA 3AMKA 2PC8A 1ZBVA 4QP0A 3EDFA 2WCSA 2WSKA 4W5UA 1H2JA 2EEXA 2XVPA 1B3VA 3T0BA 1Q4NX 2WANA 1GZJA 1VBRA 4CD8A 3BAWA 3VD4A 4XUYA 1QNOA 5FIPA 4UCFA 4YHEA 5A6BA 3M46A 4FLRA 4JIEA 2OWXA 2RGLA 2VT0A 1VRXA 1MQPA 4AZIA 1CYGA 3L2LA 4W7WA 3AIBA 4TVUA 3ALGA 3NIYA 3BCFA 5FKYA 2VQUA 1G0CA 1UWSA 1VBUA 2DSKA 3AXXA 5DO8A 3ZMRA 4B9YA 3GXMA 1O6IA 2JEQA 4OOUA 1E6ZA 4Z2IA 4U33A 2VI0A 1WDSA 4B3KA 3WBAA 2Q8XA 2VX6A 2WC3A 3VGGA 3RO8A 3TTOA 1V3KA 3VDAA 6A3HA 4MB4A 1DWJM 2WVVA 5CPQA 3CTTA 1EQCA 2A3BA 5EB8A 3B9AA 4NZCA 3EDKA 4F9DA 2YL5A 4ACZA 2YL9A 3A4WA 3CMGA 3WQ4A 3W28A 3U5YA 4AY1A 3ZIZA 4GINA 2E40A 3BLKA 1GHRA 4IISA 3N9KA 3VM5A 4E8CA 5F7UA 3T0AA 1CXHA 3UERA 1NP0A 1GCYA 1K9TA 1NOUA 5FD0A 1HVXA 1PX4A 2D20A 3KWXA 1E6QM 1BHGA 2VRJA 3IK2A 1E5NA 3SCRA 3W82A 3ZR5A 4CN6A 1VEPA 1C91A 3GH4A 4EAMA 1CPUA 1YQ2A 1TCMA 4KMQA 3ZJ8A 2D0GA 1Y7VA 2QLYA 4IUGA 2WM0A 4GI8A 2E0PA 5E9AA 1I1WA 3BSHA 2VZTA 4PTWA 5DFAA 1MXDA 3WQVA 1TVNA 3VDHA 4ATWA 3WF3A 2YLAA 1J10A 3VDBA 2JF7A 3AZTA 4W7VA 3U7BA 2EXOA 3PZIA 5BCAA 4UFMA 2VRQA 4UQBA 3K46A 2BHYA 2OWCA 2DT3A 1CEOA 3T2PA 5CGMA 2YDRA 1KXTA 2WBGA 3FY1A 2DPEA 4UQEA 1B9ZA 2FDMA 4EANA 1CGUA 2Y4SA 1TUXA 2DSZA 3AHZA 2VR4A 2XJ7A 3RCNA 1E55A 4OIFA 1M03A 1HJWA 4WKFA 3GBDA 1B30A 5E09A 1UZ1A 1XCXA 3SCVA 4QAWA 3ARQA 3ZSTA 1MYRA 3LMYA 1OT2A 1B3ZA 5GNYA 1CXEA 3DC0A 3VIOA 3VIMA 4J27A 1LQ0A 1XH2A 3EDJA 3JUGA 3ARVA 3MMWA 2VO5A 3MV01 4AZBA 1V6YA 1EGZA 2WZIA 3CIVA 1NARA 2PBOA 2EPKX 1E6XM 1G9HA 1BYAA 2CKRA 1E0XA 1HJXA 1NP2A 4PMOA 1BVNP 3B8SA 1E0VA 4CD4A 5LA1A 3SCSA 1PJ9A 1W32A 2CITA 2XTKA 2FGLA 3AHYA 4AD2A 3AHTA 1KBBA 3KEHA 5D8ZA 3T2QA 2OSXA 3ALFA 4OUEA 3VD3A 1ECEA 3VM7A 2VQTA 5I3DA 1R7OA 2XWDA 1LLOA 2J7DA 2CESA 5FOOA 1LWHA 4QFUA 1C90A 3AHVA 4IM4A 5LYRA 2V3FA 3BH4A 4D6DA 1PAMA 4PTXA 1G94A 4ACYA 3WD2A 5ABGA 1ZJAA 3QOKA 3CHDA 5JBEA 1V3MA 3U7VA 3GZAA 3WH5A 5JBDA 4ATDA 1TZ7A 2FGZA 2Y24A 3BCDA 4URIA 2CBUA 4JFSA 3A3HA 5A2BA 5CG0A 3CZJA 2X0YA 1OSEA 3ARRA 1HJUA 4M56A 2WC4A 1UD3A 3AJ7A 2WMIB 3ZJ7A 3VGBA 3N13A 5E0FA 3AICA 4Z2KA 1JZ7A 5EMYA 3VMOA 4TVCA 1BGAA 1F4AA 1CGWA 4UR9A 4X0NA 5CLTA 4GIAA 4NSBA 3APGA 3VD9A 1NM9A 2Y8VA 2VVSA 1QI2A 4J3XA 4PMXA 4MDPA 1ZB5A 6CGTA 1GJUA 4AMCA 2EO7A 3CLWA 3FXYA 4MTVA 2WBKA 3FN9A 4W84A 2WB5A 1XSKA 1GONA 1WPCA 4UQ9A 5E6YA 3W38A 4DWSD 1QPKA 4R5EA 4OJYA 1UKTA 2JIWA 3W0KA 1QNRA 3WSUA 4IPNB 2ZICA 4U3CA 1UD6A 5C8BB 1UA3A 2D3LA 4JKMA 1JI2A 3BGAA 1QBAA 3UR7A 3KL3A 1L0PA 1WZLA 4IPLA 3WFLA 4KWUA 1MWOA 1QNSA 4S3JA 3WUBA 1A47A 4L4PA 1V02E 3AHXA 3OLDA 1I1XA 2PWEA 1D2KA 2YOCA 4MPKA 1UR1A 3WENA 1H41A 1CLVA 4ZE5A 4MB5A 1UD2A 3BAJA 1W9BM 1UHVA 2F8QA 4NF7A 4RE2A 1K6AA 2XSBA 2VVNA 3QR3A 1FOBA 4HZ7A 3PZTA 3AS3A 3AMDA 4MADA 4P8VA 3VKKA 3GYCA 4RE4A 5D4YA 3AIUA 4AZCA 3WH9A 5EBAA 4D1IA 3OG2A 1KR0A 3CZEA 3CHFA 2QMJA 1KWKA 3K4DA 1UWIA 4HA1A 1V6XA 4PBGA 2CEQA 1JYNA 2W91A 2WCAA 1X6LA 2UWFA 1E6RA 3ARWA 2WHMA 3TTYA 4D6JA 1JZ2A 2WNWA 3OA5A 5M3WA 2WVUA 2ZX7A 1HNYA 2YL8A 1V6VA 3WD0A 1EO7A 3N18A 3AIEA 3NDYA 4NRRA 1HKJA 2E3ZA 3K8MA 1Q6GA 2PF0A 5M5DA 4ZFMA 1DWGM 2CYGA 1W3JA 2VR5A 4V27A 5ABFB 2BY2A 1UZ4A 2ZX9A 3N15A 1OIMA 1H5VA 1KBKA 1NWSA 5LA2A 3W24A 5KZ6A 2O9OA 3I3BA 4AXNA 4HMCA 3CUGA 1RH9A 3IJ7A 3N1AA 5I77A 1WE5A 4UFHA 3KL5A 3CUIA 2XGBA 3KZSA 3SCOA 4GZIA 5BYWA 5A6JA 2X0HA 1HJVA 3ECQA 3W81A 2NT1A 4LPCA 4F8XA 1JFHA 1XD0A 1UD8A 4MNJA 2XSAA 4TX8A 3VINA 5IHRA 4EE9A 2VC9A 3NJ3A 3E1F1 3U5UA 4E4PA 3ZO9A 1OGGA 3IANA 3IAPA 4WSJA 1UWUA 4RL3A 5D8WA 1OGBA 1B31A 5E6ZA 2XIBA 4AD1A 3GNOA 4PMQA 3DYOA 4H2CA 3VVGA 2W66A 4CKQA 2EPLX 3N17A 1DP0A 4PTMA 2J7HA 3GBEA 3D3AA 3OLIA 1L8NA 5I6SA 4JKKA 4S3KA 1GOMA 2DSVA 3N04A 2V5DA 1PIFA 4UNIA 5E0CA 4YPJA 1C8YA 3UEQA 1XGZA 5I78A 1EOMA 2QMKA 1FP9A 2YBTA 3CMJA 3EMCA 3ARPA 4AIEA 2WMJA 2BVDA 3CZ8A 4HOXA 5HDRA 3DYMA 4W8AA 2PWFA 1HKIA 2G3NA 2ZUSA 2DSUA 3AIQA 2CNCA 2IXUA 1LG1A 2V5CA 2C8NA 4TOQA 1HKKA 5HBFA 3PZVA 4D6EA 2XVGA 4FK9A 4PRWA 3VGHA 3OZOA 4UTFA 1M7XA 1U2YA 1HF6A 4X9YA 1DHKA 2UY4A 2CPUA 3N11A 2VX5A 1GOIA 1IT0A 1PPIA 4AWEA 4BS0A 3CBWA 1HP5A 4D72A 2OYLA 2WVVB 5GQBA 1V0LA 3WD4A 5IFTA 4CD7A 4PYSA 2VJXA 1SFSA 3PBGA 5A3HA 3WUFA 1EDTA 4BF7A 2GDUA 4U2YA 3FAXA 4HPGA 2J7FA 4OBSA 3TONA 2ZUWA 1E4NA 2J8FA 4Q22A 5AYIA 1CENA 1MFUA 4AZ6A 3VOCA 2WHKA 3AISA 3SUTA 1QW8A 2XVNA 3RJXA 5GPRA 5A6KA 4M1RA 3QGVA
chains in the Genus database with same CATH superfamily
2GPTA 1TYGA 3TP4A 3IGHX 3S9ZA 1FWFC 3DGBA 1EP2A 4FXSA 3KP0A 2Y5JA 1UUMA 4ZXOA 3GXPA 1VQTA 4Y96A 3U6WA 4F40A 1Y8BA 4UIOA 3T7VA 3AXMA 1E6PA 3N25A 2A3CA 1OX6A 2C7FA 2QZRA 4B15A 2NSOA 1ZALA 2ZUUA 1QNPA 4C1NA 1X7IA 4RE3A 4JXCA 4H8HA 1HGYA 4ZXLA 3CEPA 3O9NA 4X22A 1J12A 3EOUA 2ZWZA 1QOQA 3QZ6A 4TR9A 2CBVA 1KNWA 1EXPA 1JG9A 3PPGA 1HP4A 2UY5A 4S39A 3SFKA 4JFUA 2IPGA 2OPJA 1WDRA 2WMFA 3TLLA 4I6VA 4DUVA 3AMCA 1VIWA 2DZAA 2P3ZA 1UQZA 2WW5A 3QM3A 5M2FX 1FCVA 2AOSA 1HZYA 3BICA 3E38A 1BPLB 3AROA 2V68A 4FNPA 1YDVA 4AIBA 3DKJA 2BLEA 3HN3A 2XM1A 3G0UA 3N3MA 3V18A 4DJEC 1B2YA 4N0RA 6REQA 2A21A 2C1GA 4QDPA 3GR7A 5FEXA 4ZO9A 4WK9A 5IDZA 2GDQA 4IIBA 5CPTA 4C7GA 5A8GA 2Z1SA 1K9DA 1LUCA 2YDSA 4HIBA 3RIKA 4DM2A 1GPFA 1QI4A 2OGJA 3W1XA 4K7VA 4OHQA 1V3HA 4KERA 1BG4A 4R34A 2PWVA 1OQFA 1B54A 3MSGA 3AIRA 1TRIA 2DUXA 1HL9A 2AL1A 2XZ9A 3QOMA 2RJHA 2H9AA 1W1B1 2BHZA 4RNIA 2W67A 3BMXA 4ALDA 2PI6A 1LWJA 3TQ0A 5CSYA 4DIAA 3TOPA 2BHUA 4XV0A 5CG7A 3BZJA 4AZ5A 3WKZA 2PUZA 1TX0A 3UXDA 2W0UA 1ADOA 4INFA 4WJ8A 4ZBCA 4ASTA 2Y5EA 4QG9A 2YZRA 3HU7A 3DGRA 2FHBA 4IICA 4DI8A 4HOZA 3HPFA 5IOBA 4NX0A 2IQ0A 4M6QA 1ITUA 4FLSA 3S0CA 3CQIA 1IIGA 1J01A 2R14A 1XIIA 2FDSA 4UCGA 2EPOA 1YADA 3P8JA 2ZRUA 2FPYA 3UGVA 4HZMA 1J0ZA 4IL0A 3PJWA 2NV9A 3T78A 1OCJA 2IS7A 2QXWA 3Q45A 1PYFA 4FOUA 4KRUA 3ABOA 4BI5A 4C60A 4JHOA 4O0QA 1EO5A 4XKMA 3GFYA 1F8MA 2AGTA 5U4NA 1Q63A 3TN3A 5DY3A 4QCFA 3LTPA 1UG6A 3BAKA 4UFLA 2DV0A 3T2OA 1FBAA 3VCCA 3KZPA 2YBUA 3CPRA 1V7AA 4JPGA 3SQLA 2H90A 3MI3A 1ADDA 1CWYA 3W88A 1DE5A 3GR8A 4Z2JA 3VD7A 4WRHA 3CZGA 5I02A 1OK6A 1OG6A 3PF3A 1TWZA 4JQ2A 1EEXA 1FWHC 4NAFB 4YHGA 2P10A 3BQ6A 1GVIA 3D46A 1V8EA 4EXAA 2VNCA 3VZYA 3NAVA 2E9MA 2CERA 1SFLA 4HK6A 3FJLA 1LL7A 3GU9A 1E3XA 1YNQA 1JCNA 4WY0B 3GXDA 1HO4A 5LHFA 1C7TA 3V75A 3GAKA 2E5BA 4MJZA 3H2CA 1K1DA 4IG2B 3BLFA 4KWVA 4K3ZA 3THQA 4LEFA 2R9RA 4MAVA 4JY8A 3BC9A 1S3HA 3AMGA 2HNEA 5LIXX 3V36A 1DOSA 4AC1X 4I5XA 1DXIA 2GVJA 3V1PA 1E4LA 3EWXA 4CEXC 5CGQA 3BMVA 2YCLA 2ZCGA 4IFRA 4MM1A 4JIPA 3T08A 1QWGA 3R5EA 1XYFA 2YLLA 1IEQA 3SCPA 3L4WA 3VILA 1XX1A 1RPXA 5HOSA 3FAWA 5FL0A 4HOWA 4O18A 2D2HA 2PDXA 2VUYA 4JFWA 3P2VA 4XTDA 1XQKA 2CLFA 4HNOA 2CLOA 4JTLA 2G3IA 3WCZA 3GIPA 4IUOA 3O05A 3W23A 1MNSA 4BHYA 2G3JA 4CD5A 1K9EA 4L80A 1YDYA 2YXOA 4RZBA 1Z44A 4Q8MA 3AXHA 1UWTA 1FFRA 4GX8A 5DBUA 8XIMA 2BG5A 3A12A 4ERGA 4ZB5A 3QW3A 2QUUA 5A8NA 1J18A 3MVTA 1AW2A 1IE7C 1QOXA 1GKQA 4ZVJA 2QDEA 4I9TA 1DJZA 1DBTA 3RGTA 1C92A 1G6CA 1H7OA 1E1FA 3TYUA 2EBNA 1KB3A 1LL4A 2Q8LA 3UVAA 1EH9A 3L5MA 2XFRA 4Z1BA 1Q13A 4V28A 3OPSA 1TUFA 5BWFA 2ACUA 3PY2A 2WLZA 4GE8A 4Z2HA 1RHCA 4CQ8A 4CU8A 1BTCA 2J74A 2JBMA 4EAYA 2WVTA 1JJKA 2FZ9A 4GXWA 1DKWA 4Q8TA 3VX0A 3LM3A 3QHNA 4PMUA 4W86A 4O1BA 4JTKA 3ZFHA 3WBEA 2OJPA 3DHFA 3GH5A 2NUXA 1M7OA 4PTNA 3H7UA 3ZR6A 2DZUA 4ML9A 1BWVA 2VWTA 2AAAA 1B1YA 1W5OA 3DFNA 1CLXA 3RXZA 1T0OA 4UR8A 1DYSA 4R9OA 1HIZA 4C6IA 1QI5A 4JQAA 2DIEA 4J3WA 4RDVA 3I3EA 1LORA 4DWSB 2X1IA 1WO2A 2CC0A 2FZBA 5KSWA 1IXPA 2F2HA 3O16A 2PDGA 4FEZA 3E49A 2GVLA 2QAPA 3LUTA 1XINA 1SVDA 2XIMA 2XYLA 2G97A 2YJQA 4MB3A 1WP6A 1B90A 2PWUA 3PZNA 1R87A 1K77A 1QJWA 3TLQA 4NI8A 2ZE0A 3WBXA 1FFQA 5D05A 3W4RA 4S38A 4JL1A 1C7SA 5LIKX 3BW3A 4ENLA 1A53A 4Y90A 7CGTA 1XH0A 2NV2A 1J5SA 3FXGA 2ZKMX 4JY9A 6ALDA 1GJWA 4W4QA 1AQHA 2NLYA 2QCCA 5CJ5A 1TQJA 3W75A 2ZTJA 4NG3A 4YN5A 1F5ZA 1RP8A 3QLLA 3WNOA 4IGNA 5JXQA 1ZZMA 3HG5A 3M0JA 3HURA 1TWDA 4JTQA 1X96A 1AQMA 1VHNA 3B0XA 3MBFA 1JAEA 1N8FA 1VFOA 3WMSA 2O4QA 5LGXA 1NVMA 3PB2A 3UU0A 4L1GA 1DIOA 3UBPC 3SUUA 1NAL1 1ODUA 1LRNA 1TSIA 3H8AA 3SCNA 5BOEA 3OVRA 5CLWA 4HSOA 1C9WA 5KINA 2VM8A 4UR7A 1C3FA 4H9UA 3SCWA 4P7RA 3AOFA 1Q45A 4CVUA 5FSDC 4B16A 2E9BA 1XV8A 4JTIA 2PDYA 4I6KA 2ZRWA 4QITA 1LBMA 1U1UA 4JTDA 3EEGA 5DXXA 4O0ZA 4CD6A 3U8GA 1VEMA 4GYFA 1H0IA 3V1HA 1XXXA 3K1DA 3H4GA 3WQ8A 4MKVA 3N4AA 1A3XA 3BAIA 3A47A 3RRAA 4JCMA 3FYOA 1LRTA 4KGJA 3MSDA 1LT8A 2G37A 4DBWA 1FWAC 4YWSA 3QY8A 3KE0A 3C2YA 2Y7DA 3PPCA 1V0MA 4GYPA 5AZ1A 3B9NA 4I8DA 4ZFCA 5DBTA 3LV5A 4GO8A 3PSVA 2ATSA 6XIAA 1U5VA 2VTFA 1ISWA 3CL7A 4BF5A 4C91A 4MWAE 3WD3A 3K1GA 3UJEA 4YU1A 3OB8A 4QS5A 1PX3A 1UH2A 3QMRA 5A8PA 1FWBC 4IMEA 3S1UA 3RMEA 2ZX5A 3UY7A 4GYPC 4EIVA 4LQ1A 5JH2A 5JIWA 1JZ3A 3URAA 1GTEA 2QVNA 1CXIA 1FKWA 3DN5A 3B06A 3LHWA 1E9LA 4MIMA 1GJPA 4U4MA 1O66A 1RY8A 2Z1KA 5FCZA 2V5JA 3KX6A 1KO0A 3RR4A 5K3VA 1EOKA 5CPSA 5JU6A 2I16A 3WF0A 2CBIA 1THFD 3V16A 1H09A 3M0XA 1HVQA 4H41A 3GW0A 1PEZA 2TRSA 2D2GA 2ZYFA 1XWYA 3VGFA 4D8AA 1MQRA 1PL9A 1JCMP 1EA9C 4HK5A 3L4UA 3VOIA 2PDLA 1CB2A 4NI3A 1GOWA 3MDUA 4HCHA 1CBGA 2ONEA 2W63A 3W2UA 1JUEA 2WZTA 3GXTA 5HPOA 4M19A 5BXRA 3RPDA 3AZSA 1WXJA 3DI0A 1DWHM 4H9VA 1C29A 1NELA 1WDPA 3FA3A 1KFCA 3W7QA 1E15A 4JIRA 4ZB0A 4D6FA 4J4KA 1CXLA 5I07A 3TR2A 1OC7A 3A9BA 4AW7A 3ES8A 3W87A 1RXOB 3T55A 4W85A 3W1TA 2B4GA 3F5KA 2J8TA 1UOKA 2QPSA 3TTEA 4CGTA 1GYMA 2DQXA 4PSRA 5LIYX 2E77A 4JR5A 3W6MA 4AIOA 2PRLA 1FCQA 1OZQA 5I3IA 3USZA 2HV5A 1YPXA 1TPB1 3FCPA 5LNVA 1DJWA 1UH3A 3AZRA 4IIHA 4C7FA 1OHLA 4L61A 2HZGA 2OQYA 3F4VA 2WMKA 3UCQA 3NL5A 2Y5SA 2VHLA 1UD5A 4Q8QA 2C3ZA 5BRQA 4O0KA 1XBYA 2V38A 3CYJA 4HHHA 1OD0A 2OELA 1JIBA 2WKJA 3RM9A 4LGXA 1XP3A 3O2LA 4Q8PA 4QDWA 4JTRA 1F4HA 5G2WA 3B4UA 3QGKC 2G50A 5LNWA 4KFPA 3RFAA 1FQ0A 2X7VA 1ZSXA 4GXPA 3N6HA 3KS5A 3BLEA 5A1AA 4MG4A 3AQUA 5D32A 1F3TA 1JZ8A 1US3A 5ABTA 5CZJA 2POZA 4B3LA 1M6JA 2E6AA 1JZ5A 2E1DA 3I10A 4O52A 4G6CA 3VMNA 4M7SA 1GKPA 4F2BA 4CU6A 4YCPA 2R1MA 3MHUA 4UZUA 4MMWA 1H7RA 4Y6GA 3EA3A 4IIFA 3BURA 4UTJA 3POCA 1XIGA 2MUCA 4WLCA 1VYSX 2Z1VA 3BJFA 3GTNA 3VGDA 3F2DA 4IPIA 4YTRA 1NQ6A 4O11A 4YTQA 3DERA 1ODZA 5ENLA 4LF2A 3EX2A 1CNVA 1NWTA 4US5D 3OZPA 4LVGA 4B9ZA 4PR4A 4PMNA 3VNMA 1QHOA 4IMDA 1V0KA 4D2JA 4WDWA 1GOXA 4HTYA 2V69A 1XC6A 3R6IA 3FJ4A 4IH3A 1KRAC 3A9IA 1UCWA 1FHVA 3ELFA 3LOTA 4W88A 2AGKA 4WDUA 1XFBA 3GHRA 4U5KA 4O14A 1R85A 1XLKA 1BYDA 1GK8A 1FWWA 4X3ZA 1NIUA 3LENA 1GG0A 5GJNA 2OZ3A 4M6UA 3FNDA 3VA8A 1EP3A 2CHNA 4DELA 2YB1A 1WXYA 4OZOA 3PK7A 3UWYA 4W8BA 1MUCA 1LJYA 3NYDA 4XVEA 2D22A 5KETA 2FGBA 2CW6A 3EWZA 3MS8A 3N12A 5M17A 4RE0A 3UG4A 4PODA 2GFTA 1FH8A 3MC5A 1E70M 4IOTA 3ARUA 3V0UA 2CLMA 3GC5A 2ACSA 2ISSA 4OE7A 3PNUA 4PFMA 4E2VA 2PAJA 4LRTA 1AD1A 1GYNA 4JYEA 3ZSSA 3LPGA 4PTVA 3JS3A 1SFTA 5ABHA 3GG0A 2XIJA 3TROA 3TE9A 1Q6RA 3DEQA 3EWYA 3UGRA 1KC7A 4ZOCA 4I7VA 1OGSA 3ZT7A 3DCPA 1XBZA 1Q6FA 4BQ3A 4D71A 4BA0A 3NSNA 2OOFA 4DF1A 4IQEA 1JAKA 4JTHA 2GQ9A 3VO0A 3ZLFA 5C55A 4AEFA 4TMBA 4CQAA 3GTIA 4KESA 1JQXA 2ZC1A 4AVFA 4DWSC 3QR0A 4ZQOA 4HHPA 1KGXA 4DJDA 1OYBA 3A64A 3VABA 1EPVA 4IIGA 1OC5A 3G8RA 4PA8A 2Z1WA 3DBNA 1G7UA 5G4HC 1Z89A 3WDRA 1UR4A 5EY5A 3P67A 2GJXB 4GQBA 1O94A 4GUGA 3L21A 1TA3B 1UR9A 1PO9A 3W71A 4AU0A 4PN2A 4YWIA 1J0KA 3MU7A 3P93A 3OHMB 2PTZA 2PGFA 1PZ2A 2VC6A 3W25A 2VZOA 2X2YA 2CZFA 2V81A 4IP4A 3N34A 4E3VA 3AMKA 4EF8A 1I6NA 3UCCA 1E0UA 1L8PA 5KMYA 2WSKA 2XVPA 3IVUA 1B3VA 3OIXA 1TREA 3ZS4A 3EX4A 3BAWA 4ZTXA 4GK8A 3PWGA 4YHEA 3M46A 2I7GA 4O17A 1SGJA 1RK6A 4PBEA 1XI3A 1MQPA 1PV8A 4AZIA 1OCNA 1MEIA 2NLIA 3NIYA 1EBHA 1UWSA 3ZMRA 3GIYA 2PZ0A 1Q8JA 4WVXA 5B7ZA 1Z6KA 4DLMA 1TQXA 4MY9A 4U33A 1GVFA 3N14A 3WBYA 3TZFA 1WDSA 4F0RA 4QIUA 4B3KA 1FTXA 1TV3A 2WC3A 3VGGA 2JK2A 1F6KA 2JGYA 3TTOA 3SRFA 4NZ1A 1A5NC 4P61A 3VDAA 2ZVIA 5CPQA 1SZGA 3CTTA 1EQCA 3EKGA 3BV7A 3EDKA 3QMSA 1UP2A 1TPEA 1YE6A 2OEKA 2YL9A 3KDOA 2GUUA 3CMGA 3RMJA 3W28A 3U5YA 4NKCA 4K39A 1Q6OA 4GINA 3UZXA 3VM5A 2ON3A 4C6CA 5F7UA 3WQGA 3EX3A 2Q8ZA 3UERA 1US0A 1NP0A 1FXQA 2P1FA 5HNTA 5HAOA 4MZ8A 1XYAA 4G56A 1WUFA 1XLEA 4H2HA 1HTIA 4GY7A 4DXXA 2D20A 3WK1A 4TX9A 1BHGA 3EGJA 3SCRA 2IKIA 3W82A 4CNOA 3ZR5A 4CN6A 4LVFA 3GH4A 4KMQA 1UBSA 2C71A 2D0GA 2OMAA 1TTPA 3RNDA 3TW7A 1PUDA 4GI8A 3ITXA 5CPNA 1UP3A 3H2FA 5DQPA 1XLIA 3WQVA 2QGHA 1TVNA 4PB4A 3S2MA 3VDHA 1SQ7A 1LTDA 3TCSA 1OK4A 1RVGA 4AWUA 3LQLA 2JF7A 4B5NA 1PB0A 3OVGA 3U7BA 4HCDA 1IXNA 1OYAA 3W2MA 4UQBA 2YFNA 1K8CA 2OWCA 1TX2A 1ZGDA 4Z08A 2Z0IA 3S5NA 2GUBA 2HDJA 2DPEA 4UQEA 3T0CA 2FDMA 2TPSA 5KITA 3BV4A 3AHZA 4M51A 3L2IA 1KTNA 3OEXA 4OIFA 4DY1A 2VP8A 1HJWA 3T4CA 4CLMA 2QGYA 1TTQA 3LA4A 1IYXA 5E09A 4F4RA 1XCXA 4JIQA 2EHHA 3W1LA 3ZSTA 3VDGA 3VIOA 1ZAJA 4LANA 3SN4A 2P76A 4S3AA 3E5PA 1Z69A 2FB3A 2VO5A 4AZBA 1V6YA 3BGGA 2WZIA 4KWOA 4EP8C 2CZDA 2Q6ZA 5E0KA 1BYAA 4H01A 3QC3A 2PEVA 4UNLA 2PLJA 4UMCA 1PJ9A 3FA5A 1AD4A 3MP4A 2FGLA 3UWWA 2Z24A 3AHTA 1KA9F 3KEHA 5D8ZA 1Q7MA 1YXDA 4O57A 3FLUA 3VD3A 4JEQA 1YNYA 2XWDA 2J7DA 2INFA 1VBGA 4IX2A 1ZQ5A 1C90A 4DRSA 1YTEA 3BOFA 4NYUA 4ZR8A 4O15A 3ABSA 3LXBA 3WD2A 4LBUA 3MSYA 3SGGA 2PLKA 1AL8A 3WH5A 1HFBA 3EX6A 1TWWA 4OV9A 2Y24A 1VPXA 5K9CA 5A2BA 5CG0A 4UTWA 4MLRA 4S3FA 3TNBA 5AN7A 5AOUA 2YCKX 5TF0A 3IUHA 2L5HA 1HJUA 4YVPA 1R9ZA 1K03A 3VGBA 3CO8A 4PC8A 4Z2KA 3VMOA 1CGWA 4X0NA 3RHGA 5CLTA 4GIAA 3VD9A 3PULA 3DFTA 1PHWA 4GYJA 4ZTYA 2ZE3A 1U5JA 5D37A 5HJXA 3SY5A 5FSEC 2GGHA 4MTVA 4EXQA 1B4EA 1ECQA 3KVLA 4W84A 3VNKA 1XSKA 3H12A 4IJRA 3UJSA 4X9SA 1QPKA 1UKTA 1QT1A 2QPXA 4IPNB 1UA3A 2V5BA 3BGAA 3S9YA 1QBAA 1XRTA 5LXEA 3KL3A 1DJNA 3HOJA 4ICNA 4KEUA 1V02E 2PD5A 3AHXA 4H00A 3OLDA 1I1XA 2YOCA 4MPKA 2NQ5A 1Z7AA 1VPYA 5G4WA 3UPBA 1UD2A 4H9ZA 4S3GA 2F8QA 4HYVA 3NWRA 2XSBA 2VVNA 3QR3A 2J13A 4WUIA 4LC8A 4HZ7A 2BOFX 3MCMA 3QV8A 4P8VA 3AMDA 4GXMA 2E5CA 2X1RA 5AVHA 3E5BA 3AIUA 1AUSL 2V67A 4D1IA 3CMFA 1VGAA 5LNSA 2ACRA 3PS7A 4HA1A 4HK7A 1V6XA 3TQPA 3ANVA 1E6RA 3TTYA 5M3WA 2PDKA 1BEUA 3UCDA 1EJRC 1EO7A 1RALA 2FB2A 3K8MA 3G1YA 5M5DA 2CYGA 4N9EA 1W3JA 3PFMA 2VR5A 1M3UA 4UXDA 1TZZA 1OIMA 2VFDA 3P14A 1H5VA 2ZFAA 1ZUAX 1NWSA 5LA2A 4J40A 5HATA 3W24A 5KZ6A 1S2TA 2ABBA 2BB0A 4AXNA 4E5TA 3AO0A 3CUIA 5IM51 5BYWA 1FRBA 4LS2A 3OO2A 4NZFA 2XSAA 1XF0A 4TX8A 2XIOA 4JQ3A 1VH7A 4NZJA 2VC9A 1JRCA 3NJ3A 3WJYA 1CCWB 1SSDA 3FEQA 2FTYA 3WMLA 1E9YB 3OVQA 2R1KA 1NJJA 4Z42C 1K6WA 5E6ZA 3R0DA 4WCJA 1LQAA 1TR9A 3GNOA 4PMQA 3DYOA 3VVGA 4BI6A 1DP0A 1UPMB 4PTMA 1XYLA 2J7HA 1YPFA 4AHOA 5I6SA 3V5CA 4QISA 3N2XA 1WV2A 3WQDA 1N8IA 3H23A 4UNIA 5E0CA 4YPJA 1C8YA 3EB2A 2F2KA 1ZLPA 1EOMA 1FP9A 4I9AA 3EMCA 2NUWA 1SR9A 1WOBA 4AIEA 3RG6A 5AC6A 2BVDA 5HDRA 4Z1YA 2ZUSA 1IR2A 3AIQA 2QAFA 4GYKA 2IXUA 2TYSA 3TEVA 2VFHA 3C52A 1PXGA 3ITVA 4D6EA 1EA0A 4FK9A 3W7DA 3DFOA 4R88A 4Y8FA 3TR9A 3C4UA 4NXKA 1U2YA 1K7XA 4X9YA 1DHKA 1S5MA 1GOIA 1IT0A 3GRIA 3CBWA 3NZRA 1W3NA 4RNHA 1LBFA 5AHEA 5GQBA 3WD4A 5CCZA 3W7OA 4I5UA 3LYEA 1SFSA 5E93A 1EDTA 1Q2RA 4BF7A 4WJEA 1TZ9A 4KEZA 4AHPA 4HYRA 3P84A 5AHMA 4B91A 1DTNA 1OJXA 2Y70A 3LRKA 4LU0A 2ZUWA 4FP1A 1VBHA 2TMDA 4AZ6A 3CH0A 3AISA 3SUTA 3UXKA 1R38A 3F7JA 3P3BA 1JPIA 3BLIA 2J9ZA 1ICPA 4HGXA 3SN0A 2PMQA 4N7QA 2PDFA 5EU9A 3APTA 4GHRA 3C3NA 2RDUA 3B9EA 1KFWA 1MW1A 3IIPA 5DT7A 3UP8A 4LAKA 5MKGA 1W6TA 1QXLA 4E0CA 2PTXA 3SRKA 1GVYA 4PUWA 4NASA 2O4MA 3N2BA 2GJRA 2XWEA 2X8RA 2G3FA 2QV5A 3TX9A 3CM4A 3ABRA 4LNCA 5HMSA 3M5YA 5HMEA 2AMXA 1E5JA 1DL3A 3GS6A 3VE9A 2FZDA 1IZJA 2NW0A 4FR6A 3OZMA 4OECA 2WHLA 4H6KA 1JZ4A 2GUYA 4IQJA 4GI4A 2D0FA 5JMUA 3DBPA 1VFTA 1V08A 3W1PA 3VOFA 3G5EA 3SCQA 1GYLA 1W9VA 2WJFA 1UKOA 1RJPA 1V02A 2Z1BA 3M6DA 4HP5A 3O6DA 4GJIA 4NJKA 3U4FA 2BY1A 3S1GA 2D23A 4Y9OA 1CTNA 4MB1A 7TIMA 3DHUA 3KVMA 5LIWX 3NZGA 1O12A 3OYZA 1C93A 3KOXA 1Q6LA 1LQ2A 3V0SA 1L9WA 4HPJA 2PU1A 1PCKA 1W3IA 3VKAA 4FF5A 2ZDSA 1TA3A 4KFNA 5A94A 3GVVA 3URBA 2A4AA 2O0TA 1AH0A 4JEJA 3DC8A 4DLFA 2DH3A 4Q4QA 3TYCA 4RXGA 1UROA 2JEPA 4DF0A 3T8QA 1XLAA 3CT7A 1EZWA 1VJZA 1WYIA 3B97A 3W26A 1F74A 2BVTA 3ZLGA 3UZ5A 4GVGA 5T9CE 4H9MA 3VPLA 1LLWA 5DMMA 1WKYA 4D6HA 1KV8A 5KZEA 2J75A 3HPXA 4PRRA 3IRSA 3BO9A 3SIZA 1KCKA 5AY7A 3FHQA 2I5GA 4GQRA 1S5NA 4KEVA 4B4HA 4GI6A 4JFVA 2RFGA 3OODA 4CQBA 3ARYA 4KCTA 1OWQA 5HXMA 1J96A 1AA1B 3FW6A 4H6RA 2PDJA 4UOZA 2ZXQA 4X60A 1H60A 1EGMA 2G41A 4N4QA 3VFCA 2EG8A 2ZX8A 3IS4A 2IXVA 3BAYA 4LUSA 2X41A 4DO4A 2X7WA 1G1YA 4IMAA 2Y89A 2FLIA 1D7FA 3WLOA 3WF2A 5FAGA 3CUXA 1ZL1A 2QCNA 1SFJA 3IIXA 1K8XA 4IIDA 5I3KA 2YGYA 3PHAA 3AIVA 1HJSA 4LCQA 3PSWA 2R6OA 2X1TA 4PB5A 1OD8A 4H6EA 2OKTA 4E4FA 2IKJA 5H6HA 1EB3A 3U2EA 1N55A 2Z25A 3BE7A 1XYZA 4HBKA 3IIZA 3UWUA 3D0CA 4IT1A 5EKYA 4NQ1A 3B0UX 2XZ7A 5F2GA 2X30A 4HJFA 2P50A 3SCUA 4DF2A 3LDVA 1H11A 2D3NA 2JFEX 1TG7A 2V3GA 1VIZA 1VS1A 1UKPA 4L5ZA 4ZE4A 1F61A 3TXZA 2E4TA 4UFIA 1CGVA 2D0HA 2GJXA 2OODA 2QUMA 5CKSA 3ATYA 4PUMA 4JIIX 2A3AA 2A0NA 5MF5A 4PTDA 3C5QA 1K70A 1GZGA 3OBKA 2W3ZA 2POTA 1RQEA 3EB4A 2FJKA 2J7GA 1HXJA 2XH4A 3ES7A 4AD4A 2J47A 3EB3A 2Z2UA 1UOZA 3TKFA 2OLAA 4AXKA 4LOCA 4LC6A 4P7OA 1L6SA 2PFHA 4B3ZA 4TTGA 4JDYA 1RD5A 3PUEA 3WH6A 3GVRA 1O7AA 3MJYA 5FJJA 1NH6A 2ALRA 2VZVA 4WHBA 6REQB 5J04A 1E73M 1OBAA 3NSXA 2OCZA 2WSPA 3IJ6A 1EGVA 1LUCB 2E25A 1H1ZA 2WNZA 1TPC1 2EGZA 1CB7B 3C2FA 2BXZA 1M7JA 1SO4A 2YPIA 4FOJA 3UA4A 3BSGA 4WF7A 4HKPA 1D9EA 3IGXA 5HUOA 1Q7QA 1Y5XA 1W3KA 4UOQA 1IXOA 4AWTA 4N9CA 3W00A 3H55A 3SADA 1J11A 4WY0A 5T9BG 3ZQ9A 4GX9A 3STGA 4J35A 6TIMA 3EA2A 1E40A 3UG8A 3W72A 4BQ4A 4UMAA 1FKXA 2EAWA 2A7RA 1WQ5A 2VEMA 5HWNA 3TU9A 1E0TA 1BRLA 4QNWA 5BXPA 3TK7A 2FVLA 1KM2A 2B31A 3H21A 2CIPA 3PAJA 4XKYB 1R9XA 4BF9A 1BSIA 1X6UA 3IACA 3R43A 4PEEA 1UYQA 3EMZA 3PPHA 1TIMA 4US6A 1R7AA 2QCFA 1FH7A 4P7LA 3GFZA 4GUJA 4DZ5A 4LXFA 1KM4A 3GYEA 2W62A 1V6WA 1XR2A 2J25A 2QCDA 4G7EB 4LYRA 4HU8A 3REQA 3FHAA 1I2QA 4RKAA 2P0OA 4OBTA 3PBMA 3PTMA 1XLLA 3DENA 1M04A 1DJYA 4PUDA 1L6GA 1RCXB 2H3DA 4AHQA 2WHJA 3JR2A 2VMFA 3AXKA 3N6JA 3THUA 2Y7EA 1UWRA 1B3WA 4BKNA 4GABA 1MUWA 2HPMA 1KR1A 1SMDA 1ZTVA 3MUXA 4JNMA 5BNKA 4G7FA 3ITLA 3LHTA 2CHOA 3S5OA 3N4EA 4HMEA 1XDJA 1WOAA 2YB4A 3PG8A 4NY2A 1FWTA 3VIFA 2YBVA 1PIIA 3WMBA 3NO5A 4HZ6A 2XINA 5C70A 4ZA0A 4ZO7A 1E56A 3T05A 3RLGA 3P60A 3B05A 1K9FA 1JYXA 3LHYA 1KFLA 1EC7A 3RAOA 1ADSA 4MLJA 4NHVA 4C5ZA 5HQLA 3QSTA 5IFPA 4GMEA 1KLZA 3TW9A 1W1PA 4DUWA 4K7YA 1ITQA 1FWJC 4JTTA 3FGCA 3U0HA 1I2NA 4E2BA 3NQEA 4IGSA 1GORA 2GWNA 2QV4A 3Q2DA 3RILA 1M53A 4DO6A 4AG0A 2NX3A 4CU7A 4M0XA 1IZKA 1ZAHA 4K6AA 4HTBA 4O4VA 1BG9A 1XH1A 4WXYA 3K13A 1LG2A 4BQ5A 4Q3MA 3F4NA 1JXKA 3GSMA 1H1YA 3ZXWA 3UJRA 3RM8A 4HZ8A 2QCMA 3PWIA 3S83A 1EWDA 3GG7A 1BYCA 5FJPA 3G2GA 3V7PA 3J7HA 3EWCA 3CO4A 4Q8NA 3VZXA 3W83A 5AHIA 1R3YA 4FS9A 4MY8A 1A5AA 2QEZA 2QPUA 3W01A 2VCCA 1X6NA 3W2KA 1VENA 3DUGA 3QXBA 1AVAA 2EG6A 3TIMA 3A23A 1TPFA 4WJXA 3QW4B 4HN8A 3CK5A 5BOOA 5HUPA 4KRTA 2P8BA 1W9PA 1FCUA 1DTUA 3AYTA 1FXPA 3KBVA 3M5ZA 3TCEA 5AHLA 1G5AA 3QF0A 4JX6A 3KBWA 4PCTA 3LCGA 3GXNA 3NDZA 2NT0A 4LB4A 4YTSA 3PJUA 3SFWA 3LXCA 4LALA 2ZXDA 3HFTA 4MWAB 3ZT6A 3RRXA 1E6NA 3E96A 3HMCA 2HQAA 3AWNA 3ZM8A 1XKJA 2DJXA 2D73A 4GZJA 3W7PA 5C9WA 3M16A 4PMYA 4GY0A 2AMGA 3QPEA 2PODA 2PB1A 1JF5A 1W3HA 1JPHA 3U3HA 3PZMA 5EFFA 1RAKA 1EWEA 2VFFA 4ZSTA 1YXCA 4XG1A 1RQHA 2WSRA 2YA0A 3ID7A 3C8NA 3CV7A 2P53A 2X09A 4H7ZA 2PE4A 4HHMA 1LRQA 5GVJA 2PDPA 5FI8A 4GVFA 4LSBA 5H1WA 5C71A 1JXJA 4O50A 3F5JA 3WX7A 4K1GA 1MNZA 4UTLA 1J0IA 1HJQA 2O9PA 4GIRA 2V2CA 1KQZA 1NF7A 2NSXA 4Z17A 3GTHA 2FHCA 1ISVA 5TD4A 3EEZA 3IAQA 1F73A 3B8UA 3UVIA 4L65A 1IEIA 3VTRA 2EPMX 1C8QA 3R2GA 4EKJA 4DUXA 4MYAA 1VYRA 3WEMA 3M7WA 5LHEA 1LROA 1MDLA 3PZQA 3PBYA 5CBIA 5AHFA 1XLMA 1OFQA 3B04A 3FGCB 4UBPC 3A4XA 5C5YA 5XIMA 2OYKA 2VZUA 4OBRA 3OGRA 4MJMA 5MKGB 4TXEA 1UB3A 3BCJA 3HGJA 1MXGA 1IHIA 1CECA 3HQOA 2WPBA 1RLCL 4J3VA 3GDKA 1DQUA 2BOEX 2H8XA 2CFFA 3NSMA 3JZUA 1RPKA 4Q8OA 1ZFJA 2OZ0A 2VDHA 4GG9A 1LYXA 1OF6A 1W56A 1EXBA 3L2MA 4QDMA 4M3PA 1TCDA 1DVJA 2P3EA 2DW6A 2J7BA 3T09A 3CL8A 1A5MC 3NEVA 4I8YA 1MFVA 4IX0A 1EDQA 1PIGA 1QW7A 4KBXA 2VOMA 1HKMA 1GQIA 4F2UA 4NUWA 3G22A 4D6IA 1KCLA 5EMMA 1JCYA 3VU2A 3UD6A 2AL2A 4BWLA 1QCWA 2ZRZA 4US5A 2FJUB 1B3XA 1F3XA 3PUGA 4XBJA 1KQYA 1YTDA 2WKGA 1P0DA 2ZZ6A 4RXFA 1KXVA 3BXWA 1JPKA 4M6VA 4O28A 3RX4A 2VDGA 3QJAA 2MANA 3THDA 3AAMA 3WNPA 4YS1A 3TJLA 3G0SA 2DP3A 3EPMA 3LCWA 3MA8A 2EF9A 2ACQA 1E6SM 1ME7A 4IP5A 4E4UA 3H70A 2PWGA 5AC7A 1W8GA 3VNJA 4C65A 2J79A 4MWAA 3WBWA 4XZBA 3NEHA 4RK8A 2AAMA 2FMOA 1SW0A 3IJIA 3U57A 4ZO6A 2PWDA 5D9NA 3WLRA 3SJNA 3BLDA 1V77A 3E9AA 1R3RA 4MZ1A 5JQ9A 1DPMA 1WB0A 3R89A 4R9XA 5D33A 1O5QA 3C86A 3PBUA 3RPMA 1ZPTA 2WWDA 2ZX6A 3CWOX 2VRKA 2GJNA 3LCXA 4IHCA 3GVWA 4GQGA 3R7MA 4V33A 2OOGA 5I0DA 3NL3A 2YZ5A 1DQXA 5CC6A 2C15A 1EKOA 3UPMA 1I45A 1IGSA 4MNLA 3I7QA 2DUAA 3C61A 1FX6A 2PRHA 5I3GA 4WY0F 1KKOA 3G1VA 1QK0A 3TSBA 1GQJA 4HA3A 5C9RA 4ZGYA 1Q85A 4DJFD 1AL7A 4MFDA 4DBEA 1ITXA 3TFCA 5A6SA 1FWSA 5HMDA 1WUEA 3I3DA 1TPVA 3B8WA 3VKJA 5FEWA 4DJDC 4DJDD 1E72M 3MKKA 4AZ7A 4GGHA 1KKRA 3EDDA 5DY2A 1D8WA 4UTHA 4TX6A 4C6QA 1FH9A 2I5QA 3TUUA 2HS8A 4LAZA 2ZUTA 3L4XA 4FPSA 1HL2A 3UG5A 1TPH1 4MDOA 1JNDA 1QO2A 4LBSA 1ZU8A 3VIGA 5A6MA 5A2AA 4IMGA 3ONCA 2KX9A 3L0GA 3WLSA 2NVCA 1V3LA 4MAZA 3GDBA 3EWWA 1Q3NA 2DIKA 1MEHA 2PBGA 4GNJA 5IRPA 2ESCA 3AYVA 1DIKA 2WYSA 3SB0A 5GNXA 3UZYA 3W7MA 3TXVA 1NF0A 3NDOA 4JQ1A 3MUY1 1DWIM 2E6YA 2Z2BA 3K8KA 1XRSA 4A3RA 5A5WA 2NX1A 2GQ3A 3P0WA 5HPCA 2R82A 3A24A 3FSTA 4LS1A 4OKDA 2X05A 1AJZA 3MZ2A 1QR7A 3S2JA 1HQTA 2OO6A 3VNZA 2UY2A 2OX1A 4RZ5A 1W5NA 1J2WA 2VCBA 2NQJA 5HA7A 4ORIA 4K68A 4LX4A 1PSCA 5D04C 3FSUA 4S2BA 2J66A 1TMQA 3KHDA 5F1UA 4O16A 3L4VA 1RBAA 1ZBCA 5D09A 3Q94A 3UETA 3B8TA 3NUKA 1WNOA 3W1RA 3BLLA 5I7GA 3S4TA 2GK1A 2H8ZA 3MHFA 3IIOA 2XFFA 1CX9A 2XDFA 1FHDA 1FHUA 4KT2A 1XYMA 3TW6A 2VEKA 1S46A 4XAGA 9RUBA 3EKLA 4PMDA 2OXNA 2NV1A 1SR0A 3AUOA 2GGEA 1OCQA 3FJNA 3BGJA 3H2NA 4XZLX 4V1XA 3HGOA 3RLHA 5CJMA 1O95A 4HNVA 3UNDA 4REQB 4QQUA 3T0DA 4Z2GA 4RJEA 2PDUA 1S5VA 3VNIA 1KRBC 2HTMA 4Q8UA 1J9YA 2QW5A 2IUZA 1BXNA 2PDQA 4JTAA 2Z00A 1XFCA 2C0HA 3NM3A 2A2IA 3GU2A 4GC4A 1FWNA 3OBAA 4PMZA 1Z32X 4HNCA 1MW2A 1ZENA 4AISA 2O9RA 4PUKA 5F4XA 2PDMA 1XJBA 4IMCA 1O4UA 5TIMA 4CNTA 2VGFA 4GOAA 3GD6A 2TSYA 4JNYA 2JF6A 4XB3A 2DEPA 3PNZA 4WGXA 1IXQA 1EHAA 4OQVA 2PDIA 2PRMA 3MHGA 1G7VA 2PC8A 3R94A 1QPQA 3PUDA 4W5UA 4AX7A 1JR1A 1Q66A 4U28A 3TQKA 2EEXA 2HPIA 1BVWA 2DVTA 2DZVA 2WSYA 2WANA 3NURA 1GZJA 3VD4A 1QNOA 1IWBA 3KRSA 3QTGA 4KS0A 2PDBA 1SJBA 4JIEA 3MO7A 2OWXA 1E51A 1I8JA 4IG2A 1CYGA 2J6VA 3ALGA 4X2PA 4Q4PA 2CLIA 1XPGA 2VQUA 4DN1A 3OOQA 1FDYA 1VBUA 1X38A 4LEQA 1S5WA 4GNKB 1JEZA 1MI3A 4YCOA 3TAOA 3HGSA 1TPUA 4O8AA 2JEQA 1E6ZA 4Z2IA 4P5UA 2ZTKA 3QY6A 3FYPA 4XVDA 1QRQA 2VX6A 1H7NA 2VENA 3ABQA 3TSMA 2DZBA 5J8LA 4ZQNA 5EB8A 3B9AA 4DYEA 2WM1A 1G4SA 3TYEA 3BW4A 3A22A 1QPRA 5BWAA 2BGSA 4MPQA 3BLKA 5I3JA 4IISA 3M0VA 2O56A 1XDLA 1CXHA 1GCYA 2GGGA 1NOUA 1HVXA 3M0HA 3S1XA 4WZHA 2VRJA 2BGNE 4YVXA 5K9XA 1A5LC 1JDEA 3EWUA 4A8RA 1S5TA 1LOQA 1VEPA 1C91A 4GGBA 5CAKA 1CPUA 1O68A 3NL2A 5I06A 2WM0A 5E9AA 3CAVA 3MUCA 1EX1A 3TDFA 3BSHA 1XUZA 5HQEA 4CEUC 3TN6A 1WBJA 4QG6A 3LQGA 3WF3A 2YLAA 3GNNA 3VDBA 3QC0A 3SQSA 2EXOA 3QLDA 4FHAA 4LV4A 4JTFA 3N2OA 2VEIA 1EYEA 3M0KA 4REQA 2DT3A 4CNUA 1CEOA 3LMZA 4ZQPA 3FY1A 3HBLA 5FJUA 2DSZA 2XJ7A 3E2QA 2GSEA 3KM8A 1SO6A 1M03A 2OEMA 1B30A 3KRZA 3UPWA 3B9OA 4L64A 1XGDA 3P0XA 4RPQA 3DC0A 4L6OA 4J27A 4MY1A 5K4XA 4GWEA 4M5PA 3ARVA 4EF9A 3CIVA 3OQEA 3W6YA 1NARA 2PBOA 2CKRA 1F8IA 3H53A 2EJAA 1E0XA 2AQVA 1I2PA 3PBWA 4QJ3B 2OQLA 4PMOA 1NP2A 1BVNP 3SCSA 1T99A 2XTKA 3ONBA 2PPGA 5K4ZA 3C0JA 3V3WA 3T2QA 2AL2B 3ALFA 4HVXA 3HO8A 5FF7A 1LZOA 1NFBA 1XG4A 3GVQA 3R8HA 1R7OA 3TYZA 4ZZ9A 1LLOA 1UASA 3SAZA 5FOOA 1LWHA 4LCSA 2BXVA 1R30A 3RK8A 4KEMA 5LYRA 1R46A 2V3FA 3BH4A 1H7XA 4PTXA 1G94A 4UC5A 4ACYA 1BF6A 4LUTA 1SO3A 4L7ZA 1ZJAA 4QGCA 1ALDA 4G1KA 4ATDA 4IMFA 4XAZA 2CBUA 4JFSA 3O0FA 3LK6A 3LSCA 4UB9A 2QQ6A 3ARRA 4KKXA 5BW6A 1X1ZA 4C6DA 4F0MA 4IQLA 2WMIB 4XWUA 1NSJA 3N13A 1PVNA 3YPIA 3A13A 2QT3A 2IPWA 1GEHA 4UR9A 3UWEA 3AWOA 4NSBA 3APGA 3JRKA 2JKAA 4RW3A 4J3XA 5J5RA 1GJUA 4AMCA 2EO7A 4ADTA 3E3HA 4UTWC 4IPJA 2WB5A 3MVIA 1GONA 1WPCA 1VP5A 4UQ9A 5E6YA 3W74A 2QUTA 2REQA 3W38A 1XPYA 1R47A 2ZZ4A 1VPQA 3W7LA 3H26A 4OJYA 4XTIA 5CPOA 2ZICA 5M1TA 2OKOA 1L6WA 2D3LA 4ZOAA 3G1FA 1W17A 3PB0A 4JTJA 3WFLA 1M68A 4KWUA 1QNSA 3WUBA 1A47A 1LDCA 4L4PA 1RV8A 4AQLA 4K1WA 1EC8A 1P0BA 3OW1A 4MB5A 1J79A 1GKRA 1UHVA 3W9ZA 3GX9A 4GIEA 1FOBA 3M0LA 2BZNA 3NFUA 2Q3RA 3VKKA 4MADA 2ZRXA 3LHUA 3GYCA 5D4YA 1ONWA 1BWLA 3WH9A 2D2JA 3OG2A 3CHFA 2OX4A 5I3FA 1UWIA 1VKFA 4LFYA 3F1QA 1X6LA 4NYYA 2UWFA 5C2XA 3C2OA 3DAQA 2FQIA 2WNWA 4PB3A 5MHBA 4NU7A 4ROPA 1S3TC 1T40A 3T9PA 4NRRA 4A6GA 2E3ZA 3S42A 4ZSUA 4CQ9A 7PTDA 6PTDA 3TC6A 1IEVA 1M41A 4C1NB 3N15A 2ZA1A 2P5NA 1EIXA 1KBKA 4TIMA 2ZA3A 2C13A 2O9OA 3UFYA 2GWGA 4AY8A 3WLJA 4HMCA 3CUGA 1RH9A 4EPBC 1GPWA 1WE5A 5I77A 2OT0A 3KL5A 4J2MA 2HBXA 2XGBA 3W1QA 4GZ7A 3SCOA 1BKHA 1JQVA 1EX5A 1JGMA 5GJPA 3W81A 4HB7A 4LPCA 2SFPA 1XD0A 4F8XA 2Z7KA 3VINA 2F84A 4UNKA 5IHRA 3L68A 1X98A 3E74A 1V79A 3IAPA 2VFIA 4MVAA 5CZTA 4QROA 3HGRA 4RL3A 3LBMA 1JDFA 3PG9A 1B31A 2W66A 2EPLX 1GVEA 2XH2A 3D3AA 1AQFA 3FYYA 2TODA 2X0SA 3DI1A 1GOMA 3LLDA 2DSVA 3N04A 2V5DA 3UEQA 2QMKA 2ATMA 5F2LA 3EXTA 3ARPA 4J9JA 5D2VA 4GLEA 2WMJA 1MRQA 3IV8A 4HOXA 3GLCA 3LCFA 2EG7A 1QNVA 1XYCA 4MYXA 3C8FA 4F0KA 2PWFA 2FYMA 4QSFA 4NZ4A 1TTIA 4LV9A 3K4WA 2V5CA 2XSXA 3PZVA 2XVGA 1SJCA 4NL1A 4PRWA 3VGHA 4JNZA 4DXKA 3CV6A 3RPTA 1KFKA 1JPMA 1X97A 2HCVA 2NVDA 2PTYA 1KLYA 1PPIA 3B0YA 4AWEA 4BS0A 4LAUA 1AFSA 1YMYA 1HP5A 1JULA 4OFCA 4E6MA 1NDWA 3R11A 4QE4A 3T07A 2AQWA 1V0LA 4CD7A 4KWWA 1PDZA 3PBGA 5A3HA 1IQ8A 1MMFA 3VI2A 1KBJA 4L9XA 2NVAA 3LRLA 3QY7A 4ES4A 4WSHA 3O6YX 3MKCA 2HBVA 3FAXA 2O7QA 4RZ4A 2J7FA 4PL1A 3TONA 2OVLA 4Q4OA 1Z8AA 3VKBA 2Z6JA 3VOCA 2WHKA 3VYLA 2XVNA 1P4CA 2QJGA 1DIDA 3LRMA 1JDCA 2JALA 1O1ZA 1GQKA 3BK0A 4C5YA 4NNAA 2GVGA 3AMLA 1V6UA 1QMLA 4A3YA 3MP3A 1OVDA 4KPLA 3HPZA 2J24A 4GKLA 3WLHA 2E28A 1OC6A 2GGJA 3TJIA 3OU8A 4NJIA 4TUFA 1H5YA 1HT6A 2Z7GA 4M81A 2I57A 6ENLA 1ONRA 1S2CA 4KF1A 5PTDA 1DXFA 1CDGA 2OB3A 4EPDC 1LF1A 1AODA 4ZEPA 1W9XA 3GNRA 2J9XA 4QS6A 5EMJA 2J6XA 1UIPA 1R0MA 3SN1A 1OEPA 3KTSA 3KBMA 4AEEA 1CI1A 3FKRA 1I60A 4H1ZA 2GOKA 4MGGA 2DZTA 5A6TC 1DXEA 3S8HA 1JCTA 3Q65A 4KWSA 1VFLA 1EJSC 1E0WA 5LGZA 3MYOA 1VC4A 3BAXA 2HEJA 4K2SA 1AW1A 1UP0A 2ISWA 1TV2A 4JZ5A 3E12A 2ZDRA 1ZHAA 1WCGA 2PDWA 3QV6A 5IDIA 1EDGA 4QEEA 2DVUA 5DMLA 2J62A 4NNCA 4WGHA 5I03A 4AD3A 5A6AA 1D3GA 4AYSA 4GQ0A 3W1UA 3E0WA 1UA7A 4BI7A 1T41A 4DAIA 1YYAA 2FTPA 2Z28A 1QVBA 3BW2A 4LRSA 4XUGA 1OG0A 2YX0A 1RCOB 2G8ZA 1PHQA 3W2JA 2W79A 1RBLA 1YRRA 3SR7A 4ZL1A 5CZKA 3WQ6A 1V3JA 1HGWA 1OABA 2Y8UA 2IQDA 4QBXA 4UOJA 2PLCA 4NZ3A 2W5FA 1JD7A 1KBLA 3DECA 1XRVA 2BS9A 1M1BA 1QI3A 4XX6A 2BMBA 1SW3A 1VFUA 1JCXA 4L1WA 3SW6A 5I5RA 4X2RA 5T8GA 3CXOA 3H2OA 5AYXA 3CT2A 3W7IA 1F6PA 1IV8A 4ROQA 1D3HA 4F0HA 4J7RA 4BFAA 5CC5A 1K02A 2ZXAA 4XK2A 4POCA 4Y7EA 3VOGA 4FSAA 4JHMA 1A5OC 1WBHA 3GNDA 2GK1B 2IW0A 5BU6A 3M4HA 2XGZA 4NRSA 3KHJA 2ZXBA 3MMUA 4DI9A 1TE1A 1R8LA 2WJZA 1VFFA 1K8ZA 2BY3A 4GKTA 1PZ3A 1QAPA 5ECUA 5C6MA 1SU5A 3L12A 3W7EA 2XG9A 1A5SA 1VB9A 3IJ9A 4Y2WA 4XO6A 1NEYA 1CXKA 4UFKA 4LT9A 3HG4A 5XIAA 4IPPA 5CGTA 3LD5A 2WZHA 3ORWA 4O53A 2QJJA 2UV8G 4WD0A 4AY7A 4A21A 4NZ5A 2X16A 3LPPA 4A8IA 3W53A 4KCVA 3K30A 1FHLA 4JTEA 1GOQA 5D03A 1W91A 5I09A 5K2ZA 5CPMA 3UT0A 3B8VA 4CN1A 3P5YA 1A4LA 4OOZA 1SUXA 1FVPA 3EXSA 2WZEA 5CPLA 1Q65A 4WIWA 2X2GA 4LUYA 5ABEA 2C6QA 3LBOA 4FXFA 3EBVA 2ZUVA 3NGFA 1SZFA 1QPOA 3F2CA 2A79A 4HA4A 3QPZA 4IWWA 1VCGA 3HIJA 4KIRA 2QUVA 1PZ0A 2NXIA 3CPGA 1TFVA 2CU0A 4D6CA 2HISA 3ARTA 1YX1A 4IGHA 2CZVA 3GQYA 1GW9A 5LA0A 2GLKA 3UA3A 4NT0A 2IPFA 4H8VA 4TMCA 4X63A 2DVXA 4J3TA 3O6AA 3M1ZA 1J0HA 3PWAA 4MNKA 4ERIA 1XHGA 1P0KA 1W1VA 3L7RA 2IKHA 3LGEA 1MW0A 4NILA 1H7WA 2VR2A 3LPOA 1JNEA 4KW2A 3G1SA 5CZSA 1QTWA 1NQKA 1XSIA 1DWFM 4XKYA 5H8PA 1VYPX 4HPNA 5A8OA 3HB9A 4MJ4A 3UZJA 5J5DA 1NWRA 4GBDA 3IK4A 4XZ9A 4HPXA 4TV5A 4CNNA 3AXIA 1DJQA 3ICJA 5C7HA 1EF3A 1XQLA 4E8DA 3KTXA 3CAKA 4JICA 1A5KC 2DZWA 2E68A 3TOYA 4QQ3A 2JIEA 5DN1A 3NQ6A 4MFEA 2XGIA 4ONVA 4MKNA 3KOWA 2Q01A 4U5IA 3KCLA 3QFEA 3O3RA 3KCOA 1EJ7L 2EPNA 3N6QA 3LZ5A 4HNNA 5ECVA 4GH3A 5L9FA 5DF0A 3STEA 4LYQA 1E71M 2G3MA 3H2AA 4PULA 2WLYA 3RU8X 2QF8A 5EA9A 1QHPA 2PP0A 1Q2SA 3UQNA 3SCTA 4MNMA 5CC7A 1OFRA 4QLJA 2EQDA 3GNXA 4ZQMA 4ZB2A 1XISA 2CLKA 1MEWA 4PRTA 1RD6A 3AC0A 1AJ2A 3CUJA 1ZJBA 1UUQA 2B7OA 3IGUA 3U9IA 4O1AA 1XIFA 1V93A 2E7FA 2QIIA 1P48A 4ICMA 2H3BA 1A0EA 3QMTA 1FA2A 1BF2A 3G1HA 2JGQA 3WN6A 5CQ1A 3WNMA 1U33A 1IEWA 1Q6CA 3MYPA 3AIWA 4AAJA 7ODCA 1XIHA 8A3HA 1NFGA 2ZRVA 2XVLA 1ZJHA 4GD0A 3H22A 4EACA 1J2BA 4I7UA 2E8ZA 4Z0SA 4DJED 3CS2A 4UQDA 1E43A 2FH6A 3OLEA 3PANA 5G2IA 5E1QA 4AUBA 2OZTA 1KFBA 4JTUA 1W2VA 5AYBA 3MZNA 4JYFA 3T40A 1OX4A 3HJEA 1X39A 1Q7ZA 1EJVC 2PWHA 4O1FA 3UG3A 3ENLA 2HXUA 3NOYA 3M0YA 1UPPA 3WQCA 1V51A 3RO6A 5HNNA 3LV6A 3WQEA 1GVRA 2QUNA 3CIXA 5TAOA 3JZEA 2G5WA 2DQWA 1XLDA 3MMDA 4PL2A 1TO3A 3GB6A 3OYXA 4HHLA 3AS1A 3UR2A 3QV9A 4JTSA 3SGUA 4GC3A 4CN4A 5FJRA 1Z42A 1N82A 1YDOA 2WCGA 3VIJA 2CBJA 4LVDA 3RX3A 4U3AA 4S3BA 2GVEA 2VXNA 1R3SA 1MUMA 3KCJA 4PE8A 1PCWA 1W9DM 4DJFC 1KCXA 2WOQA 3OGSA 4JTGA 3QKEA 2Y85A 1GWJA 1UR0A 4N9BA 5ABFA 1QU4A 4HCLA 4NJHA 3NQMA 1SJDA 3UZWA 4N9DA 1UC5A 1YBQB 3GZ3A 1JDAA 5A95A 1A3WA 2XHYA 3QHOA 2CXEA 9XIAA 4B5SA 2F38A 3K5XA 4YTTA 3SURA 4ZOBA 4MF4A 2ZZ2A 2PTDA 3V35A 1FUYA 4XSLA 1QHZA 3G3MA 3DFPA 3QR1A 4R53A 4GO9A 2ISDA 3W84A 3DDMA 1TV4A 3ARZA 4Z2LA 2YA2A 3QPYA 2EJ1A 4RV3A 3CHEA 4KQNA 1TJRA 1BRLB 3RJYA 2DIJA 4PBFA 3SIMA 1YW1A 1ZBKA 2A6NA 4BCEA 3SZ8A 4N6FA 4HU4A 4H7CA 4V15A 2DY3A 3MB9A 1DEDA 3FIGA 4PSPA 2IMRA 4B2DD 1J0JA 3VE7A 1V03A 5BMWA 1GOOA 3SY1A 1ISZA 3NVTA 3Q58A 2VKZG 4G9PA 1DQWA 5BMXA 2Y0FA 2PCQA 1Q4WA 2RUSA 3L4TA 1A5UA 2Y7GA 4P8UA 1NOWA 3WK2A 3ZVHB 5LZLA 1XW8A 1XDMA 5FF0A 4BZYA 5G1YA 2DJLA 4TTUA 2VELA 3QZAA 2OGYA 2V6AA 5IXEA 3WQPA 3T8LA 2OO0A 5A6LA 2BVWA 3CB8A 3B03A 4PMJA 5JUVA 1P1MA 5HR6A 2BSLA 1WAUA 4IZGA 4DQWA 1EL3A 4A8LA 5IHSA 1UIOA 1JFXA 4AYGA 3GTFA 2YCIX 1GVSA 3WNNA 5DRCA 5B80A 3ANYA 2CWNA 3RITA 1KXQA 1UR2A 3LM7A 4M29A 4FIQA 1SW7A 4PH6A 2GVYA 5EFDA 3KP1A 1OADA 3SUSA 3S1WA 3K8LA 1MVYA 1VCFA 1Z3NA 2YW3A 3HQ1A 3GG8A 4X0VA 1BFNA 2HXTA 2Z6IA 1ME8A 1KM3A 3H4WA 3I7SA 4HU3A 5D9MA 3W7RA 1Z41A 4S3EA 2Z2AA 1ZS2A 3GK0A 1MRAA 3CZKA 4RNJA 1R3QA 4C6OA 1GNXA 1VJSA 1X1NA 1KW1A 2WQPA 5HULA 3LEPA 4IFKB 4EPKA 3T42A 4WKHA 3U2CA 1J6PA 2J9YA 3PZUA 3WLLA 2WZMA 1YLVA 4HU0A 1CLKA 3E2SA 2HJPA 4H7VA 5LNRA 4QSHA 3OGVA 2JE8A 3CUHA 1F3EA 1DJIA 1QPNA 4LBRA 2HE5A 3W27A 5BXSA 4ECLA 3UESA 5AC8A 2MNRA 3VGEA 1E4MM 2VX4A 1JL8A 1XLGA 4AFYA 3HA1A 1GVOA 3PJXA 1WKEA 5JBFA 4WDTA 3LY0A 2ZUMA 4E2DA 2KAUC 1XBVA 1XRFA 2V0TA 4U2ZA 2VFEA 3NVDA 4WR3A 4DJEA 2DGAA 3TN4A 3N19B 2O92A 4ATLA 4DM1A 3W3OA 3DHPA 1TWSA 5DEZA 4TQTA 1ENUA 1PDYA 2QCLA 1IGWA 1SMAA 2XVKA 1X1OA 2WMGA 3BOLA 1BGGA 3S46A 4M24A 2G4FA 3G6MA 3D5HA 3QVQA 2C1HA 5DANA 4DVOA 4XIMA 1KD0A 3M47A 4AZHA 3BUVA 2OSWA 4Q4KA 4H4IA 5A6BD 3PR2A 3LGDA 3QYSA 4Q4MA 8CGTA 1QNQA 3OP2A 1QOPA 3TA9A 1W1IE 1RJRA 3UWQA 3M07A 2DDXA 1GHSA 2HROA 2J88A 4ZQRA 3T44A 3S6DA 3HPSA 3EMQA 3SQMA 1CW2A 5CBBA 3LCIA 1BQCA 3AALA 4UQAA 1S2WA 3FKKA 1F9CA 4CQDA 4IXXA 3WQWA 1VFMA 3N29A 1KV5A 5FJOA 3GVGA 1SZEA 3WDJA 4YJ5A 3D3FA 3N4FA 2BV9A 2WJDA 4FB7A 2ZRYA 4XD3A 3NQ8A 1QI0A 2I56A 3MWCA 3U4AA 5BRPA 2OWWA 4Z1AA 1W2PA 3GAYA 2WAGA 2ZUNA 3WF1A 3WH8A 1ZP4A 2VEGA 3T6CA 4IP7A 4QCEA 5A8MA 3G1AA 3PZOA 1UJQA 3RU6A 1MW3A 1V4YA 5E70A 2FHFA 4MJ2A 3WFZA 3GG1A 3KVKA 1K4GA 1J0YA 3NQFA 1HX0A 5KEZA 3ZOAA 3W1AA 1W31A 4XZMX 1D3CA 3EWDA 2PDCA 4DO7A 5L6UA 3IARA 3UJFA 5LSMA 1CGYA 1AG1O 5HNUA 2VZSA 4XAPA 4GNVA 3TVAA 2PZNA 3S2LA 3WDIA 3VIPA 4AIUA 2YSWA 1YHTA 3TC7A 1XIEA 3CAWA 3ZYZA 4M80A 1H49A 3VIHA 3VDCA 3HFYA 3LHVA 3HG2A 3PTQA 4EK7A 3NGJA 1EQPA 5LIUX 2QULA 3CHCA 5CSUA 2I17A 3PP7A 3QQ1A 2YW4A 3RLVA 3WZ0E 1RLDA 4KFOA 3HV9A 2E8YA 2CKSA 4N2YA 2CLEA 1QW9A 5I79A 1NDYA 1OX4B 1EZ2A 3MUZ1 1VF8A 3AI0A 3WF4A 3RCYA 4DNMA 2X1UA 3LN3A 1DWAM 4TV6A 3WDHA 1SPQA 5GJMA 1EBGA 1E1EA 3MI6A 3ZZ1A 2QKFA 3WELA 4DUOA 4YYCA 5BROA 2FVKA 4I9JA 4C1KA 3KWSA 1B3OA 2HMCA 3IIVA 3FV9A 1ONEA 1Y0EA 4RW5A 5HR7A 1KM6A 4GACA 2B7QA 4PUEA 4NIRA 3WEZA 1OB0A 2XFYA 5F2IA 4F9JA 4JN6A