1B1YA

Sevenfold mutant of barley beta-amylase
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
500
structure length
500
Chain Sequence
MKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKDFLDAGVIVDIEVGLGPAGELRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDAGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKIAGVHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQPPDAMSAPEELVQQVLSAGWREGLNVSCENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYVNFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKIQPFPFQEHTDLPVGPTGGMGGQAEGPTCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (BETA-AMYLASE)
publication title The crystal structure of the sevenfold mutant of barley beta-amylase with increased thermostability at 2.5 A resolution.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 164
structure length 500
sequence length 500
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b1yA00
2J7DA 2WANA 1HP4A 2V3EA 1B30A 2WK2A 1LG1A 3GXMA 3RM9A 3UG3A 4XV0A 1RP9A 3L4WA 2WM0A 1TZ7A 1PX8A 1JDDA 3DC0A 1W9UA 2J7HA 3ZJ7A 1DWAM 1JL8A 4GI9A 1KXTA 1KBBA 3MUZ1 1F4HA 3ALGA 1UD6A 4AW7A 1UA7A 4PMXA 3W37A 1JF6A 4CD7A 4W88A 1WDQA 3L4UA 3CUGA 1CXKA 4AZ5A 2AMGA 3VU2A 1H09A 1UR0A 2ZUMA 1UZ1A 1E73M 3WDQA 3THCA 5A6JA 3AFBA 4OKDA 3THDA 4HU8A 4UOZA 1IV8A 1JFXA 1PX3A 2VVSA 1IZKA 1D3CA 3LPFA 3VIOA 1E0WA 4FLSA 1R7AA 4FF5A 4RE2A 1B90A 4W7WA 1I1WA 1OGSA 3VVGA 5DMYA 4F9JA 3ZR5A 2WKLA 1EA9C 5CZKA 4FLOA 2MANA 2E8ZA 2OWWA 3WNNA 3BAWA 1UG6A 4J7RA 3ZJ8A 4GZIA 4C7DA 2D0FA 3NIYA 4MB1A 3UG4A 3A6OA 1X1NA 1LL4A 1NM9A 3EMQA 1EQPA 4U2YA 2V5DA 4WF7A 4CN4A 4JKKA 3OZOA 3UR8A 5CSUA 1UWIA 2J4GA 1UWRA 3VIMA 5A6AA 1G0CA 1JNEA 1ESWA 4NSBA 5CSYA 1TR1A 1I1XA 4J3VA 5CPQA 4PMRA 2IUZA 4F79A 3II1A 3AIBA 3M7SA 1CXLA 3MKKA 2VUYA 1V0MA 4AYSA 4LQ1A 1ITCA 5BCAA 4L4PA 4W87A 4B3LA 1L0PA 1EHAA 1MW0A 3AMCA 2EPOA 4D1IA 1CDGA 1PEZA 5DT5A 1J10A 2JF6A 3S6TA 3WNOA 1QNQA 1V6WA 4JAWA 4PCTA 1E6QM 3W25A 2VZUA 3VM7A 1W3JA 3QOKA 1E4MM 3CO4A 2BY2A 3W24A 1WP6A 3OLIA 3VIIA 1H5VA 3LPGA 4LXFA 4HA3A 1AMYA 1QBBA 3W28A 3ZSTA 3AHXA 3GXIA 5AC4A 1ISWA 1YHTA 3IJ7A 1QI0A 1UQZA 4UZSA 3SURA 1VEOA 3PZNA 4D71A 1EDQA 2EO7A 4IM4A 2G4FA 4UNIA 3DYMA 4CKQA 2BFGA 2OWCA 4LYRA 2CHNA 2A3HA 4AD0A 4OOZA 1AQ0A 1J0KA 2UY2A 1EQCA 3W0KA 1B2YA 5IFTA 1WNOA 3N13A 5CJ5A 1X6NA 2WVSA 4W85A 3BAXA 2AAAA 1W2PA 1W1PA 1JZ7A 1UKPA 1BGAA 3N11A 3OGSA 2OLHA 1EOKA 3OB8A 1ZS2A 2GDVA 5M5DA 1OT1A 1J18A 1JGIA 4JL1A 1UKQA 1WPCA 1K9DA 5CPSA 3VIPA 1H4PA 1M7XA 3EDKA 1D7FA 4YN5A 5HDRA 3AOFA 4M24A 2JIEA 1U30A 2GJXA 3IANA 3KL3A 3F5KA 1ITXA 5D8WA 3VPLA 4J3UA 1GZJA 2XGBA 3WNMA 4B16A 2VX6A 4PBGA 2C8NA 2A3CA 1NWSA 3VD5A 3WH7A 3W26A 1WZKA 3ZMRA 4X0NA 1RH9A 2VQUA 2XIBA 2FGLA 1JZ2A 2GDUA 1E1EA 5DF0A 5E0CA 1DTUA 4TOQA 3SUTA 1WKYA 1HJWA 1QNOA 1J11A 5CQ1A 2CEQA 4ACZA 3WH5A 4ZE4A 1E6RA 1OM0A 3EBVA 3ZM8A 1W3KA 2QMKA 3BCDA 2FHFA 2VURA 1NWRA 2EBNA 4WKAA 5ABEA 2UY4A 1NWUA 1OD0A 5I5RA 4AEEA 3WD3A 1K9FA 2EPLX 1HNYA 4EANA 1BPLB 4MAVA 3APGA 3M6DA 2Z1SA 4A4AA 1KCLA 3BSHA 3T0DA 2XIIA 2UY5A 4UQCA 1G1YA 3N15A 4DM2A 2YDRA 4W8BA 1UKTA 3NDZA 4PTMA 4UR9A 5E9AA 4PCSA 5AC5A 2E4TA 4HPGA 3WIJA 4OBRA 1GW1A 2VOTA 4C7GA 1U2YA 1UHVA 4UFKA 1JD7A 1M01A 3K1DA 4ZEPA 3M07A 5JBDA 3WF2A 3NJ3A 1UWSA 4Y7EA 3FHQA 3MU7A 3FAWA 2EQDA 4UQEA 3RILA 1QI2A 2XM1A 3AIVA 4H41A 1JNDA 2VZSA 1R85A 1RPKA 2VZTA 1SFSA 4BQ4A 1CWYA 3TP4A 1CIUA 3CHEA 2GFTA 1LF1A 4FLQA 2WBGA 5I77A 4BQ5A 3AMGA 2D3LA 2DSWA 2YL6A 4QCFA 4LPCA 4GKLA 3IJ9A 2W61A 5CXPA 1TCMA 3WBAA 1JI2A 4PSRA 1XD1A 2WMGA 4TVCA 3CLWA 4XZWA 3L4XA 5CG0A 3ZO9A 4BA0A 2OSWA 3VMOA 1HL8A 1PIFA 2EPMX 1H1NA 2CBUA 3BMWA 1AQMA 1ZBCA 2G41A 2XSAA 1UKSA 3FNDA 2QV4A 1JYNA 1OIMA 4D72A 3WEZA 8A3HA 1WZMA 3VINA 3UERA 1JAKA 3T2OA 1GOMA 2CBVA 5JBFA 2CERA 2E9BA 5BXRA 1CLVA 3GH7A 3MSDA 4W89A 3PZIA 2V38A 5A69A 4CCDA 2XVGA 3VDBA 3F5LA 1DWFM 1ISXA 4XX6A 2G8ZA 3ZQ9A 4JL2A 1E43A 1K9EA 1A47A 3J7HA 1CZ1A 5JUVA 3VIJA 2X0YA 1CEOA 3KZSA 3UCQA 2ZXBA 3RIKA 3T0BA 4ZFMA 1OT2A 1C93A 3I3DA 4U31A 1F4AA 3HU7A 3RO8A 4V28A 4MADA 1JDAA 1H11A 2WPGA 1QPKA 5EFFA 1QVBA 3UR7A 3N17A 1CLXA 3FXYA 1UH3A 2W5FA 2E8YA 1BHGA 1GUVA 5M03A 3TTYA 2CKSA 2DSVA 1BYBA 3T2QA 4GQQA 3S2CA 2WMJA 3CPUA 1TFVA 3NSXA 1V0KA 3WFLA 4PTVA 3VTRA 4DWSB 1KR0A 4CD6A 2WHJA 4CD4A 3OLGA 1VBRA 4ZE5A 3O9NA 4PMDA 1VFFA 1BYCA 4PSPA 3AXIA 4W86A 3E1F1 1TUXA 4OUEA 4W8LA 5I23A 3TONA 1OIFA 3T2PA 1W9XA 4B15A 2WCAA 1CECA 2JEQA 4KH2A 1ISZA 2BY0A 1TG7A 1BG9A 2WKGA 3GNOA 1KB3A 3GXFA 4RL3A 2HISA 3FY1A 2BHUA 3BH4A 1R86A 4CVWA 1HKIA 1XHGA 2VL4A 1UWTA 3ZR6A 1EOMA 5HPOA 1MQRA 3QHMA 4AZGA 4UFIA 1CXEA 4CN6A 1VFUA 2D0GA 2J74A 2Q8XA 3L2MA 4KRTA 3A47A 3SUSA 6TAAA 1G01A 5D9NA 2WVTA 4AEFA 5A8NA 1R7OA 5DO8A 4GXPA 2JIWA 2GK1A 3VD7A 3PZ9A 4HZ7A 1JZ5A 4H8HA 4JKMA 1GOOA 4AZBA 2VCAA 4AZCB 1RP8A 3WNPA 5IHRA 4JFVA 2PWEA 1UH4A 1UKOA 1V08A 1ZJBA 3PZTA 1W9VA 1QBAA 4KGJA 1C3FA 1B3XA 1GQLA 2WBKA 1G9HA 2VI0A 4J28A 2OYKA 2G3IA 3KWXA 4AZHA 1J0JA 1EO7A 2DQXA 2WC7A 2D23A 4KRUA 2WSKA 5AYBA 2DGAA 4M8UA 4GQRA 3AIEA 3IAQA 4RE4A 3SCOA 5BXTA 3MUY1 3F4VA 3UEQA 3WDHA 1ODZA 5BYWA 2J75A 2VRJA 3AQUA 1QI4A 4GPNA 4A3HA 5FD0A 3WEOA 2BHZA 4HTYA 2WCGA 3WH6A 4D1JA 1E9LA 1M53A 2WB5A 2G3MA 5LA1A 3AICA 4GI8A 2YDQA 1XSJA 4WKFA 1K9TA 1V0NA 2F8QA 5BXSA 1Q6EA 2YKKA 5EFDA 5A1AA 1E3XA 3K8KA 5D9MA 2CHOA 2W67A 1LWJA 3CUIA 1GCYA 3WD2A 1J9YA 3DYOA 4XZBA 1LL7A 2OWXA 2B31A 2DSKA 2WZHA 1LG2A 3WQ5A 1TE1A 4GINA 7TAAA 3DYPA 4DM1A 3WSUA 1W9BM 1UD8A 1TVPA 3K8LA 3MV11 4P8XA 1DP0A 2IXVA 2DEPA 4JIEA 2NW0A 1J0YA 3UG5A 1UD3A 4M80A 1H0IA 3AS2A 1X6LA 2J8FA 1ECEA 4MNJA 2XJ7A 1US2A 2IXUA 1PJ9A 2V5CA 5FCZA 1EO5A 1H49A 1HP5A 1QOXA 1DWGM 1Z32X 5BRPA 1E4IA 4LGXA 4HU0A 3SCNA 2XYLA 2PWGA 4NRSA 2OSXA 5DEZA 1FP9A 1CGVA 3N1AA 4P8VA 2XVKA 2J7BA 4QLJA 1UR4A 5C8BB 3BAYA 3VIHA 3W82A 1PX4A 1XRVA 3GNPA 1MYRA 5HBFA 4IPLA 2ZE0A 4M82A 3W53A 1CYGA 1E71M 1E6PA 4D6DA 3TA9A 3WMCA 3BAKA 1VENA 2VR5A 1KXQA 2ZWZA 7CGTA 3POCA 4Z2KA 3K4DA 4P7OA 2BVTA 3AIUA 2G3NA 2YLAA 4AIOA 4B9ZA 2O9PA 2PBOA 3W4RA 2E0PA 3TOPA 1HKJA 2CETA 4GI6A 2VX5A 4KMQA 2C0HA 3AROA 4P7NA 4ML4A 3U7VA 1JZ4A 1OGGA 3WUFA 3A4AA 1Q4NX 1VEPA 1EHNA 3GXDA 2XFYA 4CD5A 1W32A 1HT6A 3BLPX 1BSIA 2VZVA 2WYSA 2QHAA 2VZOA 1C7TA 1E4NA 2YBTA 4GO8A 1XYFA 5A3HA 4U3AA 1E6SM 1M04A 2XFFA 1C8QA 1GHSA 3AS0A 4PMNA 1L8NA 3GH4A 2WXDM 3POHA 1TA3B 3VX0A 2X8RA 2WCSA 3BAIA 1E0XA 2D2OA 4J27A 2NSXA 5JBEA 1CGTA 1KBKA 2BNJA 4TTGA 2WC4A 1KGWA 4P7RA 2DSUA 3B9AA 1BVZA 1OWQA 1O6IA 3ARYA 2DT2A 2UY3A 1HN1A 1VJZA 3ARUA 1A3HA 5FOOA 4UQAA 4UQBA 4EKJA 3WQ6A 3SCUA 5A8QA 3BLKA 1QI3A 2WVUA 1LWHA 1VJSA 3OGRA 2DT3A 1ODUA 4BS0A 3ARSA 2DIJA 2J77A 4PMUA 4LYPA 5IDIA 1V3IA 3WDJA 3OIHA 1B3WA 1XCXA 3RCNA 1ISVA 1OSEA 2ZUSA 2PI6A 1GOWA 1WDPA 1OB0A 2RGLA 1XH0A 1FH8A 4OIFA 3AIWA 3NCOA 1U33A 1VFMA 4CCCA 4HA4A 1PZ2A 2QLYA 2W63A 1MW2A 4QLKA 4WSJA 4HMDA 3U7BA 4R27A 5C70A 1ZBKA 2WAGA 2ZWYA 4OBSA 1O7AA 1FFRA 1XV8A 3AXHA 3FAXA 3GNRA 1H0GA 2BV9A 2PF0A 3TTSA 3ALFA 2J7CA 1EGZA 1JI1A 1G5AA 1V3JA 2E3ZA 3CZEA 4JKLA 1FHDA 3GBEA 4QCEA 4Z2JA 1GORA 3N12A 1FA2A 4AD3A 2DH2A 1V02E 5D9PA 2JEPA 1OGBA 3SUUA 3FHAA 2ZXDA 1UR8A 1V6UA 3NSMA 1C92A 2ZXAA 3GYCA 3KL5A 3PZGA 4PYSA 4AD1A 6CGTA 2Y8VA 4TX6A 2CIPA 3PBGA 3WDIA 4MJ2A 1R8LA 2J7EA 2JFEX 5JIPA 4MB4A 2GJRA 2XVNA 3CBWA 4QFUA 4PUEA 4K68A 1N82A 1KGXA 4NRRA 2EJ1A 5FIPA 4AXNA 1GVYA 1WDSA 4NZCA 1V3HA 2C7FA 1SR0A 1QNSA 4U5IA 3VD4A 3GZAA 1ISYA 3ZOAA 3NUKA 4PTWA 4KWUA 2EEXA 2PWHA 1VB9A 1V6YA 4D6CA 1B0IA 3PN8A 5GNXA 2WMKA 2X09A 4JFWA 5I6SA 2E9LA 5E0FA 3MMWA 1MW3A 4J3WA 5A2AA 2J79A 1MWOA 1UR2A 3RJXA 3JUGA 1FP8A 2V3GA 1JYXA 1BGGA 4UQDA 3VKKA 2CCRA 3AI0A 1AQHA 1CXFA 1GJWA 3GM8A 1HJVA 2WVVB 1HF6A 4GZJA 3BXWA 5LA0A 5BWFA 1UQYA 2BY1A 3WBEA 1JDCA 3L4TA 4UFHA 1S46A 2YBUA 1C8YA 5EMYA 1OINA 2ZX9A 1QW9A 3WEMA 4IUGA 1E70M 2WW5A 2ZX5A 1CXHA 2BHYA 2ZUWA 2QPUA 2X0HA 5DT7A 4FK9A 5ABFB 4TTUA 1UD4A 2GSJA 3KEHA 3AHZA 5CLTA 1RD6A 4JFTA 1CGUA 2QF8A 3D3AA 3OA5A 4ACYA 1V02A 3VNZA 1V0LA 3A3HA 1MQPA 1PZ3A 2DIEA 3K46A 1E5NA 1MW1A 3ARPA 4H8UA 1W1YA 2TAAA 3MMDA 4TVDA 1KR1A 3SUVA 2WMIA 3EMZA 2XWDA 1CXIA 5A8PA 5DFAA 3VGFA 4M1RA 5HPCA 4URIA 4ATDA 2YIHA 1D2KA 5BRQA 2Y5EA 4D6HA 3EDDA 3OLEA 3B8SA 4MPKA 4Q7NA 3AZTA 4W7UA 1NP0A 3IJ8A 3BMVA 3T09A 1JF5A 3GBDA 2VRQA 4FMVA 4Z2HA 1ZL1A 4PMYA 1UOKA 3AMLA 1PIGA 1W3LA 1FFQA 4GZEA 4D6FA 3CGTA 1JXJA 5BROA 3GDBA 2O92A 5LA2A 3VOCA 2J62A 4S3KA 3VDAA 2J25A 1XSKA 4HZ6A 5GNYA 3MS8A 5A94A 3O2LA 2VRKA 3ZJKA 2W62A 2FHCA 1E3ZA 4MDOA 3CZJA 1MFVA 1DWIM 1HJSA 1GHRA 3WL0A 2OSYA 1GOIA 4F9DA 5A6LA 1JZ3A 1EDGA 4W93A 2WHMA 3OG2A 3AHTA 2XFRA 3KL0A 2Y24A 4DWSD 5E6YA 3AZRA 4Z2LA 1GNXA 1XCWA 1EH9A 3EDJA 4MNMA 5A6BD 4MNLA 3VGGA 3VDHA 1HJUA 3EMCA 1E6NA 2XVLA 2DT1A 3RJYA 3VM5A 3SEPA 4AIUA 1ZBWA 2UWFA 1HVQA 1UYQA 3HMCA 4PMQA 4DWSA 3K8MA 4E8CA 3CHDA 2ZOXA 1V3LA 1QHZA 3AHYA 1HX0A 2O9OA 2YLLA 4WLCA 2A3BA 2CBJA 1OD8A 5A6BA 1PBGA 2J7GA 2W91A 1IZJA 1TVNA 2VCCA 3UESA 3WQWA 2WSPA 4HMEA 4QLLA 2CKRA 1W1TA 1ZJAA 1QHPA 4W5UA 5HNNA 1BG4A 1DEDA 2WMFA 1WZLA 5I2UA 2BVDA 3AMKA 3BC9A 2YOCA 5LYRA 2ZX6A 5I3DA 1VBUA 4M29A 3DHPA 4F8XA 5KZ6A 3OBAA 3OZPA 1HL9A 3WNKA 2WHKA 1MQQA 1VIWA 4Q22A 4AZ6A 2VO5A 3GH5A 2BY3A 4DUWA 4PMZA 4QP0A 3RM4A 2ZICA 3VD3A 3WD0A 4WK9A 1FOBA 2A3EA 4M81A 1Q6GA 3ZIZA 4CGTA 3WH9A 2AOSA 2VJXA 1XH2A 1JG9A 5IFPA 5A6KA 1Q6FA 3WFZA 2YL5A 1V6XA 1JYWA 2WWCA 4MNKA 4AZCA 1H2JA 1XYZA 3L4ZA 2PBGA 3NDYA 1IT0A 2XWEA 5TD4A 4MB5A 2J8GA 2D1ZA 3U5UA 2G3JA 2D22A 1NQ6A 3VIGA 2F61A 2VQTA 3WY1A 1BFNA 3T08A 5A95A 4EAMA 1E40A 1B1YA 1UWQA 2ZUNA 1OCQA 1UUQA 2V3DA 4CU6A 3SIMA 1LL6A 1JD9A 4J3TA 2EPNA 4C7FA 4J3XA 5IHSA 4IPNB 4LX4A 1NH6A 4JZ5A 4JCMA 3UETA 3RM8A 3U57A 1Q6CA 3VNYA 5HOSA 2FH8A 4PUDA 5FL0A 1JIBA 2PB1A 3WL1A 3AMDA 1VF8A 4AIEA 4MTVA 3FN9A 5D8ZA 3MSGA 1BQCA 2BVYA 1KGUA 2WWDA 1HXJA 3WD1A 1EIBA 2XHYA 4HA1A 3WUBA 3AXXA 3WELA 1WO2A 4A3YA 3ARVA 1XC6A 3RMEA 8CGTA 3N04A 4WKHA 3EYPA 2DPEA 2E40A 3ARWA 4AISA 2WC3A 4BF7A 3PHAA 4U2ZA 3VGDA 4ATLA 1SMAA 4UTFA 3SCWA 1FH7A 1J01A 2CBIA 2XSBA 2ESCA 1J0IA 5A2BA 5FL1A 4HOXA 2VT0A 1V03A 2FH6A 2XM2A 9CGTA 2VVNA 1E56A 1FH9A 3CZLA 1UA3A 1KFWA 3ZSSA 1DWJM 1JZ6A 3CH9A 1JYVA 1CNVA 2GJPA 1YQ2A 2XPKA 3VGEA 5GNZA 1E5JA 4V27A 2V3FA 4AC1X 1W1VA 3VUPA 2NT0A 4UOJA 2Y8KA 1UR9A 2ZX7A 4EE9A 1XH1A 1KQZA 3IAPA 5ABHA 2J47A 4ZXOA 3VIKA 1J0ZA 4HZ8A 1E15A 2D3NA 2DSZA 3W27A 4MAZA 3ZT5A 4CUCA 2HVMA 4CU8A 3CHCA 3CZGA 1WCGA 4NF7A 3PZUA 2VMFA 4KGLA 4HOZA 4QDMA 3PTKA 1MFUA 1E55A 5GPRA 3W81A 2A3AA 5M17A 5CGMA 4N0RA 3WKZA 1QI5A 1UZ4A 4CCEA 3CHFA 3VDCA 3GTNA 4NI3A 1JFHA 3TTOA 3DHUA 3ARTA 3CZKA 3PZVA 1VFOA 2XG9A 1H41A 2X1IA 1B3VA 2ZXQA 4OJYA 4AY1A 5C71A 1OBAA 2W92A 3ZJ6A 4AD2A 3QHOA 1M03A 5E70A 4QAWA 7A3HA 4ZENA 1PAMA 2YL9A 4R5EA 2FHBA 3W38A 2WZEA 2Z1KA 2Y2WA 3VD9A 2JF7A 1E6ZA 1US3A 3VMPA 3SCVA 2VCBA 4PTXA 2X05A 4D6GA 3PZQA 3VIFA 1SYTA 2DT0A 2FDMA 1CPUA 2WZIA 2VNCA 3WMSA 3DECA 1VRXA 4P7QA 1NOUA 3QR3A 3WF4A 4E2OA 1H3GA 4U3CA 2GVYA 4J3SA 2WNWA 5I0DA 1UD5A 1TA3A 4X0VA 3SCPA 2GJXB 2YA1A 3PTQA 1MXDA 3VX1A 3WNLA 4CN1A 2ZUTA 4TVUA 4UQ9A 1G94A 5GQBA 1UR1A 1QW8A 4HP5A 3WMBA 4BZYA 1ZU8A 2CNCA 1VAHA 1HJXA 5A2CA 1GONA 3MMUA 1C90A 4XUYA 5E09A 3SCSA 4UFJA 2F2HA 4JFUA 2YL8A 2JALA 5I79A 1GVIA 1CGYA 4H04A 4ACZB 4UCFA 2DH3A 5HXMA 2ZUVA 1W2VA 3EDEA 4LYQA 3QOMA 1R87A 4CD8A 1GQKA 4BCEA 4MDPA 2BS9A 2Y4SA 1BYDA 4D6IA 1KWGA 2VX4A 1P6WA 4BQ2A 4H8VA 3G6LA 5CPTA 2JE8A 3A4XA 1BVNP 1E6XM 5A8OA 5EB8A 3CMGA 3CUHA 4D6EA 1C91A 1W9PA 1CTNA 1HKKA 4H2CA 2CXGA 4YHEA 1BTCA 1TMQA 3HN3A 1GOKA 2PC8A 1QNPA 1NP2A 2WLYA 4OZOA 4X9YA 4CVUA 1UWUA 1E72M 4E4PA 4Z2GA 1Q6DA 3N9KA 5IXEA 2J7FA 5M3WA 4W5ZA 1SMDA 4DUXA 2D24A 3O6AA 4TX8A 4HPHA 1MVYA 4UOQA 3VGBA 4AZ7A 1AVAA 4AD5A 1KQYA 3BSGA 1BAGA 3SCRA 3WQVA 3WN6A 3I3EA 1W91A 4YHGA 2YDSA 3SCTA 3WF1A 3ARZA 4JHZA 3CTTA 3AS1A 2W4XA 3PTMA 4WIWA 1XSIA 3CZ8A 3SCQA 2BXYA 3AYRA 3L4YA 3RDKA 4MB3A 2QPSA 4JCLA 1JXKA 4W84A 1J12A 1V6VA 3HJEA 1BF2A 1UH2A 3KE0A 1WE5A 3AIQA 1WB0A 4WSKA 3L2LA 1E0VA 2O9RA 2WMHA 1C8XA 1EXPA 4W7VA 5JIWA 4DWSC 2J78A 4GIAA 1GPFA 4IISA 3T0AA 3VMNA 2E9MA 4RE3A 2WMIB 1Y7VA 2BXZA 1KWKA 5F7UA 3B9EA 3FW6A 3CIVA 3ZT7A 1BLIA 3PZMA 3PZOA 4PMOA 3RPMA 1CGWA 2WVVA 5A8MA 2CPUA 2EPKX 5AY7A 3WF3A 4FLRA 5A6MA 1B3ZA 4F66A 4AZIA 5A6SA 3VO0A 4UZUA 3QHNA 5D4YA 5ABFA 3A4WA 4L4OA 3WD4A 4OOUA 4AWEA 2CITA 3WDRA 5BXPA 2VR4A 3EDFA 4S3JA 1KXHA 2XUCA 1WZAA 3WUEA 3MANA 3M46A 3W6MA 2ZIDA 2PWFA 3TTQA 4PN2A 3ARXA 4HOWA 2PWDA 4UFMA 3NSNA 4TUFA 2QMJA 3AJ7A 5I24A 3OGVA 3WDPP 2YJQA 4U5KA 3IK2A 2XGIA 1XD0A 4P7LA 1WDRA 2VC9A 3QGVA 3VILA 4TXEA 1DWHM 4D6JA 1GQJA 5CLWA 1QNRA 3AISA 2CESA 2GUYA 1FHLA 3WF0A 1UD2A 3L4VA 1JAEA 1ZB5A 1GOQA 1J0HA 2DDXA 3WH8A 1VEMA 1MXGA 3D5HA 3LPOA 4MJ4A 3VGHA 4GO9A 1B3YA 3MUAA 1V3MA 3ZT6A 2WHLA 2OYMA 3MUIA 1XGZA 3AHVA 1CENA 4YPJA 2VX7A 3WENA 3LPPA 1KXVA 1E4LA 1GJUA 1ZBVA 4P8WA 1NARA 3B9DA 4P8UA 4BQ3A 2CYGA 3MO4A 1LLOA 3AS3A 1HKMA 1CGXA 1QHOA 4WJXA 2VTFA 1LJYA 4M56A 4DUVA 5AYIA 4UFLA 3SUWA 4EK7A 1W3HA 4PEEA 5EBAA 1HIZA 1K6AA 3K4AA 3ARRA 1GQIA 4V2XA 3WUGA 4E8DA 5I78A 2GK1B 3W29A 1PPIA 1HVXA 4HMCA 3CUFA 5KEZA 1NWTA 3AYSA 1V3KA 2ZUUA 4PMVA 2W66A 4B3KA 2D0HA 1C7SA 2EXOA 2XVPA 4AD4A 3F5JA 3LMYA 4U33A 5ECUA 4ZXLA 3NYDA 3BAJA 3ECQA 1BYAA 4W8AA 5D9OA 1EDTA 3CUJA 4Z2IA 2WLZA 3WQ4A 1B31A 1NOFA 5ABGA 1WAWA 3BCFA 4AMCA 3AIRA 5E6ZA 1B9ZA 4H7VA 3ARQA 2NT1A 4PRWA 3CMJA 3AZSA 3OLDA 1CBGA 1W9DM 2XTKA 1DHKA 3WQ8A 2O9TA 2ZX8A 5FKYA 1I75A 1JZ8A 6A3HA 4XB3A 1E1FA 2FGZA 4JFSA 1HJQA 2OYLA 2RGMA 4CU7A 3W6LA 3G6MA 3N18A 2YA2A 1LQ0A 1NOWA 3U5YA 5CGTA 4JHOA 1KCKA 4N42A 4ATWA 3I3BA 2YA0A 4B9YA 3MV01 2X2YA 2D20A 3BGAA
chains in the Genus database with same CATH superfamily
2J7DA 2WANA 3VAVA 3K30A 2YFOA 4B5WA 3FV9A 3EB3A 1ZGDA 4JTTA 4XV0A 3QMTA 1GVSA 3L4WA 4B5VA 1TE6A 5LNVA 4ENLA 3BL3A 4M19A 1DWAM 2PLKA 2QCMA 3ALGA 4EF8A 4P5UA 3RU6A 3U8GA 4L64A 3CUGA 1I2QA 3MT1A 3WLIA 5J5RA 3VU2A 1UR0A 2WNZA 1UZ1A 4NYYA 2R82A 3CQIA 2CXEA 3P8IA 3MI3A 1RR2A 2L5HA 1JFXA 1PX3A 1IZKA 1ECQA 2PDIA 4RZBA 4FALA 1SO4A 1B90A 3O8AA 5DMYA 3ZR5A 3IGHX 4FLOA 3A21A 2WO5A 3GQYA 3E0WA 4FS9A 4XQ6A 2OWWA 3BLDA 1UG6A 4J7RA 4TIMA 1ITQA 1GQNA 1XFCA 1WA3A 1M7PA 2W6RA 2PE4A 3A6OA 1ENUA 4HYWA 1V7AA 1LL4A 1NM9A 3G0SA 5PTDA 1S5WA 4WF7A 1EP3A 3S47A 3BLIA 4YJ5A 2J4GA 3JU2A 1UWRA 1EP1A 4QG9A 3VIMA 4UMCA 2VFGA 4LUIA 1XLCA 1I1XA 4UMAA 2IUZA 3TC7A 3MKKA 2VUYA 2QUNA 4Y8EA 1W5PA 1KBLA 3C8FA 3B4YA 1OHLA 4O0KA 3HURA 4L4PA 4EVZA 4F0RA 3AMCA 4D1IA 4E8GA 3BV7A 1PEZA 5DT5A 1J10A 2JF6A 3WNOA 4JAWA 1DPMA 2VZUA 1E4MM 3DI0A 2E1WA 3LCIA 3W24A 1WP6A 5CC3A 2DZVA 1J8VA 4LXFA 1N2VA 4HNTA 1QBBA 3HZ3A 3ZSTA 1M5WA 3L7RA 4DJDC 1XBYA 2EG7A 2XGZA 5LNRA 5CKSA 3QSTA 2XIOA 3SURA 4AAJA 3CASA 1SZNA 1OG6A 2PCEA 4IUOA 1V79A 2QUMA 4GJIA 2HV5A 2OWCA 4O28A 4LYRA 2FPYA 3ICJA 2I9EA 1KLYA 4AVNA 4GUHA 5AYXA 2CLEA 4EACA 1FCVA 2WVSA 4LAZA 2QCDB 3PUDA 1W1PA 3PFRA 4PFHA 1FKXA 3WG6A 4C6BA 1UKPA 1BGAA 1TZ9A 2B7QA 1EBGA 3OGSA 4C60A 2CFFA 2GDVA 5HWJA 5KTLA 4KWSA 5D33A 1YTDA 1K9DA 2ZZ2A 4B2DD 1D7FA 4YN5A 4Q7IA 3URNA 4LEQA 3HGSA 3IANA 3F5KA 3KS6A 5D8WA 3B03A 3GDRA 3HGJA 2A3CA 4JTCA 1DJNA 2Q09A 3VD5A 1IQ8A 5LSMA 4X0NA 3IJDA 2VQUA 4J2PA 2FGLA 4H3DA 1JUBA 1OC6A 1E1EA 1RVKA 2H90A 3LY0A 2PDCA 4RDZA 2GUUA 3E0FA 3SUTA 3WLOA 1WKYA 3TQ0A 1J11A 2QJNA 1EFZA 2CEQA 4ACZA 3SY1A 2F6UA 3PFMA 3G1RA 3GO2A 4NZ1A 3EBVA 2OJPA 2PLJA 2QMKA 2B0MA 1P1MA 2VURA 1NWRA 3GZ3A 5KZMA 3W84A 1GEHA 5I3HA 1OD0A 5I5RA 3QF0A 3ATZA 2AL2A 2R1MA 2P53A 3H2CA 3VE9A 4IF2A 3WLRA 3P0XA 2TRSA 4O17A 2NWSA 3GTIA 1BPLB 2NLIA 2XSXA 4ROQA 3M6DA 1P0NA 3GDKA 4M3PA 4A4AA 5K2ZA 4C90A 1FKWA 3EAUA 1Q6LA 2QEZA 1EWDA 1H50A 2YDRA 4W8BA 1RLDA 1UKTA 4PTMA 5TBOA 4MLJA 1GT8A 4JPGA 5AC5A 2CLOA 3ABZA 3WIJA 2DZPA 2VOTA 4W9TA 3GAKA 4C7GA 5FF0A 1UHVA 1YYAA 5JBDA 4L7ZA 3WF2A 3MU7A 1MSSA 4UQEA 2R24A 1RPKA 4E4FA 2J6XA 5GJPA 3BOLA 1LF1A 1C29A 2DZWA 1OFDA 4BQ5A 4ZODA 4N4PA 4D8LA 3BVJA 1W1A1 3NR0A 2YL6A 4QCFA 4Q8WA 4GKLA 4AF0A 1U1JA 1UUOA 3KBVA 3BE7A 3T0CA 4QNEA 4GCAA 3GHUA 4WOZA 4XZWA 4AWUA 1OCNA 5CC5A 3G24A 4FEZA 3V5OA 2Z6IA 4BA0A 1XIMA 3WQCA 3N2CA 1HL8A 1PIFA 2C14A 3TYCA 3KBNA 2CBUA 3BMWA 1ZBCA 2G41A 1UKSA 3KS5A 4KKXA 4GFSA 5JH2A 1LRQA 3V5CA 2PWVA 3BG3A 3UERA 1JAKA 1FWFC 2O55A 4GBDA 2E9BA 1QPRA 5BXRA 4BJHA 4R88A 4CCZA 4HIBA 3UXAA 4XX6A 2W27A 4K1GA 3WK3A 4Z1YA 5JUVA 3V35A 3DIPA 3UGRA 5D2XA 3MI6A 3G2GA 1NF7A 3QJAA 3HU7A 3RO8A 1S2WA 4V28A 4MWAB 3GR4A 3IIZA 4YYFA 2WPGA 1QPKA 1W1ZA 5EFFA 1YPFA 1QVBA 3OHMB 2QCGA 1UH3A 2KZHA 3R10A 1PTGA 3SGUA 2EPHA 2BZNA 2CKSA 3TJLA 5B7YA 3CPUA 3VTRA 1KR0A 4CD4A 4DPQA 3PSVA 1VBRA 4O0ZA 4ZE5A 2PGRA 3UZJA 1VFFA 3QTPA 3UBPC 1BKSA 2Z7GA 4W86A 3FA3A 4FF7A 3DN5A 3E1F1 1YW1A 3QPEA 3FXGA 2YZRA 3W2NA 3TONA 4BEQA 2QGHA 1OIFA 3T2PA 3KVLA 4LOCA 4RZ4A 5F4WA 4B15A 1G7VA 3WO8A 1TPVA 3TE9A 1BG9A 1S2UA 3ELFA 3BLOA 1MDLA 3QC0A 3GXFA 4FX7A 4K6AA 3M5VA 5DLCA 2C13A 3MCNA 4S3FA 1UWTA 3NTYA 1XR2A 4DYKA 1RAKA 4QGCA 1YTKA 3QHMA 3KVKA 2Z0IA 1XYAA 2PRMA 3HBLA 5CPLA 4CN6A 2J74A 1DL3A 4LUSA 3A47A 4LW7A 5A8NA 4H19A 4GXPA 2ZVRA 2NUXA 4MZYA 5HNTA 3PZ9A 3IRDA 4JKMA 4PB3A 4AZCB 3JR2A 3SBFA 4ZSUA 4F0SA 2O4QA 3U2OA 3N73A 5IHRA 1XIFA 4AVFA 1CW2A 2WSRA 1ZJBA 5LNUA 4TV5A 1W9VA 3GAYA 1GQLA 3KWXA 4EOUA 2XH7A 1J0JA 2PZNA 5HMEA 3TDFA 4M8UA 1S5NA 5CAHA 4EXAA 4RNJA 3P60A 3WK1A 3SCOA 4GOAA 1RSCA 3F4VA 5BYWA 2VRJA 3B06A 4IWWA 3B8WA 5EGRA 4LF1A 4L65A 1W3NA 3N6QA 5CZJA 4H7CA 1BWVA 2BHZA 2OVLA 2PDNA 3WH6A 3BV4A 4D1JA 3PWGA 3STGA 4WKFA 3A24A 4KF1A 4WRHA 3HOJA 2F8QA 5BXSA 2YKKA 3F4CA 4HU4A 2PTYA 2W67A 3CUIA 4HPNA 4XZIA 3DYOA 2BOGX 4CQBA 1LL7A 4E6MA 4JTRA 3IIXA 2HVOA 4O52A 2AL1A 3OVRA 3OIXA 2B31A 2DSKA 2WZHA 1LG2A 1GOXA 1EC9A 4GH1A 4P8XA 5F2IA 3FYYA 4XK2A 1DP0A 3K13A 1EZ2A 3TROA 1UBPC 1UZHA 2X41A 3REQA 5CCZA 3V4BA 2J8FA 9XIMA 4MNJA 4A21A 3NA8A 4YXGA 4QDWA 2V5CA 1IXNA 1EO5A 1R3RA 3CJPA 4AC7C 3PBMA 3UXLA 4LGXA 3Q58A 4NRSA 2OSXA 5DEZA 4GX8A 4PUJA 4QLJA 1UR4A 1JDEA 1VJIA 3R13A 3KHJA 3IJQA 1A5OC 1MYRA 3LGDA 4IPLA 4H6RA 1CYGA 3BLEA 2O56A 1CB7B 4N9EA 4D6DA 3GVGA 2VR2A 1NSJA 2OPJA 1G4PA 2PCQA 2VR5A 3NQDA 1GYNA 4HD5A 5H8PA 2A1YA 4AIOA 4H9YA 4B9ZA 1E0TA 4O18A 3HA1A 3O07A 2O9PA 2P88A 3W4RA 3TOPA 4Q8NA 2NV1A 1KKRA 3KOWA 3AROA 1Y5WA 3IUIA 4ML4A 1OGGA 1V7YA 3F4NA 4GIEA 3IGSA 4LNYA 1OEPA 2BOFX 3GXDA 4NJKA 2XFYA 4NG3A 3GXNA 2E25A 3W83A 2J8TA 2NQHA 2RJGA 1JULA 3C2RA 4G1KA 3CLMA 1VBGA 4UTHA 2XFFA 1GHSA 2IS7A 3E5PA 5LGXA 4LVAA 4PMNA 3GH4A 3SIZA 4I90A 2WXDM 1HG3A 2QF7A 3POHA 3VX0A 5CZTA 2NQZA 2D2OA 4QRNA 3G1FA 2W0UA 3HG2A 3DZ1A 1H5YA 1ZUAX 1J79A 3WBXA 1YBQA 3ARUA 1A3HA 4UQAA 4UQBA 2P1FA 5E1QA 3O63A 1JPKA 4FNRA 3NPXA 1XIHA 2WVUA 1VJSA 3OGRA 2IQ0A 3VCNA 4C6KA 2PAJA 4BS0A 2J77A 3W22A 4R9XA 9RUBA 1B3WA 3R0UA 3WCZA 3W76A 1XX1A 1GOWA 4NY2A 3RCMA 2RGLA 1XH0A 1FH8A 3AIWA 3NCOA 1U33A 4U10A 2E5DA 5AHEA 2W9MA 3EXRA 5CZSA 1FRBA 4PUWA 3LM3A 1RY0A 1W6TA 2ZWYA 4OBSA 5GJMA 3GNRA 1OCJA 3BWWA 2J9ZA 4O12A 2VWSA 4MKNA 2GGJA 4PCPA 2ZADA 3TWBA 1ZPTA 4XO6A 5EKYA 3B9NA 3NL2A 2P5NA 2CLLA 3C0QA 2DFAA 3E2SA 3FHAA 2J27A 2ZXDA 1UR8A 1F9CA 1V6UA 3NSMA 2Z1BA 3EPMA 2YXXA 2XZ7A 4O8AA 3GYCA 4AD1A 3G0XA 2Y8VA 1FWJC 4GUGA 1AJZA 1A5KC 4WOQA 4YTRA 4PUEA 4NRRA 2V5BA 3IPWA 5FIPA 4AXNA 3VNDA 3SRFA 4NZCA 1V3HA 4KEVA 1MNSA 1UIOA 4IGMA 4U5IA 2UV8G 3S5SA 3H53A 3H2OA 2CZFA 2X7VA 3VZZA 2BP1A 3QQ0A 1ZY9A 4IQEA 3EB4A 4HYVA 4JNMA 1Q7QA 3F4DA 3W1LA 3DFYA 4D6CA 1LBFA 2A79A 3GC5A 2X09A 4JFWA 5I6SA 1MEWA 4J3WA 5A2AA 4C91A 5D02A 2PU1A 1UR2A 1KFEA 3B0XA 3MCMA 1FP8A 2CWXA 1BGGA 1GTHA 4MY9A 2V6AA 2VGFA 4NJHA 1GVQA 3GM8A 1SVDA 1HF6A 1GKPA 4NAEB 4ZSTA 5DANA 3PS7A 1JDCA 3UJEA 3PB2A 1OINA 1QW9A 3WEMA 3CT2A 3LLFA 4IUGA 4YU1A 3L9CA 5FF3A 1OFOA 1X1OA 1CXHA 3CYVA 2F6KA 2QPUA 8XIMA 4FK9A 1J96A 1UD4A 3LZ5A 5CLTA 3W75A 4JFTA 1EXBA 1V02A 3VNZA 3A3HA 2NV9A 4ASTA 3V7PA 1CB2A 1ZCOA 3LHYA 2ZDSA 3ARPA 1J6PA 3MQTA 4R9OA 5A8PA 4RJEA 2NQLA 5BOEA 2PD5A 4Q4SA 2I14A 3APTA 1V6TA 2VOMA 4ATDA 1PKNA 1XJBA 1XLGA 2QJHA 2Y5EA 4D6HA 5AN7A 1NTHA 3E0LA 3EDDA 3ZVHA 3IJ8A 3S8HA 3T09A 3GC2A 1IXQA 2VRQA 1JCYA 4AWSA 1UOKA 2Y5SA 1I4NA 4GZEA 2XIQA 2FPTA 1RCOB 4D6FA 3NQ2A 5BROA 4MOZA 5HNRA 5C2CA 5LA2A 3VDAA 4O1CA 1EJSC 5IM51 3HQ1A 1WKEA 2VEKA 3AO0A 3Q2DA 3O2LA 3LNPA 3ZJKA 1ALDA 1OK6A 2C1IA 2W62A 3CZJA 2B7PA 3B97A 3GTHA 1HJSA 5CBIA 3WL0A 3EX1A 3V0SA 2DUZA 1AFSA 1TRIA 2KAUC 1JZ3A 4W93A 3SQMA 4NXKA 3RO6A 5FI8A 5AB3A 1MNZA 3EA3A 1W31A 3AHTA 4X63A 5HINA 2X16A 3S9YA 2Y24A 1YDOA 4DWSD 4GXMA 1XCWA 4HB7A 2FQIA 5HJLA 4DBUA 2H8XA 1F3TA 1TV2A 3PBVA 2XVLA 3RJYA 4MKVA 4WXYA 3AUJA 3UD6A 1UYQA 2PMQA 1JRCA 3CHDA 1UPMB 2ZRYA 4NX5A 2C3ZA 3IIOA 2O9OA 2YLLA 1O60A 3OOQA 2A3BA 2CBJA 1IZJA 2VCCA 3UESA 4X2PA 2Z2BA 2WSPA 3DFHA 3R11A 1UASA 1W1TA 1AL8A 1DEDA 2WQPA 2WMFA 4B4HA 1H7PA 1WUEA 2O7SA 4AX6A 1HGWA 1T7LA 6REQB 4M29A 4J40A 2HTMA 3TZFA 1K7XA 3OBAA 3OVQA 2QNEA 1IHIA 1XM3A 3KRZA 3A3XA 4CQ9A 4AZ6A 4F0KA 1F6KA 3MYOA 2E68A 2YCEA 4QP0A 2PTWA 2QV5A 1NQKA 2P8CA 4EXBA 6XIMA 3WD0A 4DLFA 3TW7A 3OBKA 2Z2UA 3JVAA 4CGTA 3WH9A 1XDMA 2VJXA 3MVIA 1XH2A 2QIWA 3OZYA 1VH7A 1Q6FA 1EX1A 3W1NA 1V6XA 2GJLA 3BLFA 4FNTA 2IPGA 4REQA 3TFCA 2WWCA 1H2JA 3PSWA 2GUBA 4DF2A 4FPSA 3ONCA 3VNMA 1FQ0A 2PUZA 4IXHA 2PBGA 5DQPA 1IT0A 4DN1A 1W56A 8XIAA 5BU9A 1VYSX 2R94A 1NQ6A 1BKHA 3T40A 3TN5A 3KBSA 1OYBA 3RFAA 4EAMA 3CPGA 4US5A 4HCHA 4HSOA 4L80A 2Q8ZA 3UZXA 1OY0A 3SIMA 4ADTA 1X39A 4KWOA 5L9FA 4HHMA 1YE4A 1T0OA 5IHSA 3R58A 4IPNB 3RM8A 4Z1CA 1O95A 2J6VA 4X60A 3VNYA 4DI8A 1I60A 2I17A 1FWAC 4XD3A 1EF3A 2Q3RA 3EA2A 5DBUA 4KFPA 3IGXA 4JIQA 3RK8A 3TSDA 3HJZA 2VXNA 3WUBA 4HZMA 3GIQA 1HGYA 5TF0A 3NVDA 3WELA 3EWYA 3TZNA 1GZ1A 2GQ8A 1EJXC 4KS0A 2DPEA 1LOLA 1F6YA 5D38A 1T5AA 4C1LA 1OG0A 4ZQRA 3W1AA 3R0DA 3CK5A 3W88A 1SMAA 1RY8A 4HHLA 5EMKA 3D46A 1O1ZA 1J0IA 5A2BA 1HTIA 2CC0A 3KRUA 1TTIA 2VT0A 1TQJA 4GY7A 1HUVA 1EC7A 2C0AA 2WOQA 3MDUA 3CZLA 2G96A 1JYVA 1E9YB 1YQ2A 5GNZA 4H9MA 4V27A 4AC1X 2IKGA 1W1VA 3UJRA 3PG8A 2FIQA 4H8NA 4UOJA 4ERIA 1AZ1A 4XZ9A 1PHWA 2J47A 2WJZA 3VIKA 1MO0A 2DSZA 7ODCA 4MAZA 4CUCA 5ABTA 2X1SA 1XYMA 1V93A 3PTKA 1KM5A 3TJ4A 5CGMA 4UMBA 4N0RA 4V1XA 5A6TC 4LS0A 4UWMA 2BB0A 5AYYA 5B7ZA 3TTOA 4B5UA 4LS2A 3CZKA 3PZVA 1WKFA 4LF2A 2ZXQA 1XUUA 3F2DA 4OU1A 2WJDA 2GVLA 2PZ0A 4HMNA 3ZJ6A 4RDYA 1PUDA 2Z25A 4LC8A 3OU8A 1PAMA 4GX9A 2YL9A 5MHBA 3N2MA 3VD9A 4AY8A 2VCBA 4LBSA 2DT0A 3FK4A 1AZ2A 3TAKA 3WMSA 3DECA 3ABQA 4P7QA 2AGTA 3EPNA 2GVJA 4E2OA 4FR6A 3DBPA 2WKJA 2YA1A 3PTQA 1MXDA 2Z1WA 1JRBA 3WNLA 2VFIA 4ZR8A 2ZUTA 4GIRA 5GQBA 3H24A 4FA3A 5F4XA 1F61A 1GVFA 3LCLA 2XIMA 5EBUA 1VS1A 2Y8UA 3BGGA 3KUMA 4XUYA 2F2HA 2YL8A 2JALA 1GVIA 4YVXA 4ACZB 2DH3A 3CEUA 2VD9A 1TV3A 2B4GA 4B90A 1K03A 2ISSA 3UR5A 4BCEA 1GVEA 2BS9A 3V36A 3UY8A 3NGFA 3GK0A 3EWZA 3T55A 3KBJA 4AXKA 2PP0A 4H01A 3CTLA 1P6WA 4R7OA 1A0DA 1F3WA 3IEBA 5CPTA 4DJDD 1EUNA 1CTNA 2CXGA 4YHEA 4GG9A 4GVIA 1GOKA 1XFBA 2PC8A 2VDHA 1S38A 3UWEA 1EYWA 2WLYA 4X9YA 4CVUA 1UWUA 1YPXA 3N9KA 3GYEA 4M7SA 3W2MA 2J7FA 5M3WA 2X30A 1EEXA 2QZRA 1AODA 3C2YA 3BZGA 4TX8A 4UOQA 4F3HA 3PJUA 3W07A 2FPVA 4O13A 1JDFA 6XIAA 4AD5A 3MA8A 4TX9A 2ZTKA 2ZRUA 3SFKA 5FJJA 4L9XA 1X6UA 5TIMA 4YHGA 1B57A 3C4UA 1VQTA 5K9DA 4B5SA 3CTTA 4LSBA 5H2ZA 4MIMA 3AYRA 3L4YA 1W1IE 1E0UA 5FAGA 3RDKA 4GQBA 2QPSA 1RHCA 4H9VA 1JXKA 4RNHA 1J12A 4QTGA 1H61A 3WJZA 4E0CA 4X61A 1V6VA 3HJEA 4GWEA 4BK9A 5BWAA 1PTAA 4GVHA 3WQEA 3H22A 2C16A 4HVXA 1FWIC 4XBJA 4O50A 3V5FA 3L2LA 5LXXA 3PAOA 4W7VA 3CAKA 4IISA 1IWBA 1DJIA 2WMIB 2BXZA 3AJXA 5F7UA 3B9EA 2OOGA 3PZMA 3E5BA 4L9ZA 1Z48A 3LENA 3PZOA 3RPMA 3W7LA 5E5CA 2PLMA 3WF3A 1Q65A 4XBSA 4IFOA 3GVVA 3RMJA 3M0XA 3O6YX 4XD5A 3RR1A 1B3ZA 3NO3A 2I5QA 4UTWA 5C9WA 1SSDA 3DG6A 1JUEA 5D4YA 3RLVA 5ABFA 1O5KA 3QY7A 5G4EA 1QXLA 2VR4A 3EDFA 4DX3A 3EXTA 3NZRA 4LC6A 4GC3A 4QS6A 3WUEA 3MANA 3M46A 4JTFA 1EGMA 3ARXA 2HBXA 1DQWA 4S3GA 4GUJA 1Z9AA 4HJWA 3OYXA 3AJ7A 4DYJA 4U5KA 1EB3A 3CO8A 1DWHM 2EJAA 5CLWA 1QNRA 3WLHA 3N4EA 2CESA 3AAMA 5JVLA 1Q2SA 2Q02A 2Q71A 5HUPA 1NF0A 3WH8A 2DDXA 1S3HA 2VFDA 1HKWA 3HPSA 4GO9A 4L6DA 1V3MA 4Z08A 3TR2A 4ERAA 1XGZA 4DJEC 3KDNA 2YW3A 3N2TA 3LPPA 4K8HA 2DZXA 5AYZA 1ZBVA 4P8WA 1NARA 4J3ZA 2JBMA 4LVGA 3JW7A 4IX2A 2ISWA 1D3HA 1LJYA 4X3ZA 4UFLA 1W3HA 5EBAA 1OABA 3KTXA 4GISA 1K6AA 1S5TA 3K4AA 3GXPA 1GQIA 3WUGA 2E28A 5I06A 1I8JA 4XZMX 2GWNA 1HVXA 2REQA 4R7JA 2OB3A 5HNUA 1A4LA 3MWAA 4RKAA 3T8LA 4AD4A 9XIAA 4WDXA 1KFLA 1BYAA 1Q7ZA 1RQBA 5KZEA 4W8AA 3CUJA 3WQ4A 2C18A 4MJMA 3NQVA 1O94A 5HJXA 1W37A 3T8QA 4UTJA 3BCFA 4AMCA 3RXZA 4JTSA 3B8TA 4FIQA 2PDGA 3FEQA 4AFYA 1L6YA 3MYPA 3CMJA 2PSNA 1CBGA 3M0IA 1W9DM 1DHKA 7PTDA 5LNSA 3S2JA 5T8GA 1FHVA 3BANA 2FGZA 5HAOA 4HK5A 3UJSA 2RDUA 4CU7A 5C7HA 5G5IA 3W6LA 1L8PA 1P48A 1LQ0A 3QYSA 3W7DA 5CGTA 4HNVA 1KCKA 3OG3A 2YA0A 4OBTA 4G7EB 2ATSA 4YIWA 4IJRA 2PLCA 4DJEA 4JTKA 5HQEA 2X2YA 4PRRA 4K2SA 2D20A 2V3EA 1VFLA 2FJUB 2D2GA 1XL9A 1LG1A 3GXMA 3WJSA 4GNJA 4XTIA 2PDBA 3UG3A 1RP9A 1WAUA 2WM0A 3LCWA 4BKNA 1TZ7A 1DIKA 1A3XA 2WZMA 2J7HA 4GMEA 4IJCA 2YGYA 1M65A 1JL8A 4GI9A 3REQB 1KBBA 3MUZ1 4XISA 4WGXA 2HVNA 4PMXA 3UA4A 3W37A 1JF6A 1WDQA 4YWIA 4GGHA 3QPYA 1OCBA 3BURA 3EX2A 5C7VA 4GUIA 3NPWA 3WDQA 2PODA 3THCA 5J8LA 2YFNA 3TC6A 4OKDA 3THDA 4IGSA 4UOZA 4XSLA 1V77A 3LPFA 1E0WA 3LUTA 4FLSA 5BZAA 3W7MA 4F9JA 5CZKA 2ACQA 1LTDA 3EOOA 3H2EA 4J35A 4ALDA 4GZIA 3HQOA 2QJJA 2BLEA 3K2GA 3NEVA 2VEMA 3TAOA 4Q4PA 3SW6A 1X1NA 4ICNA 1WDDA 4K38A 2V5DA 4FOKA 3GU9A 4CN4A 1HL2A 4JKKA 1QRQA 3DU0A 3OZOA 1M41A 4B92A 1UWIA 1R3VA 5A6AA 2RJHA 4WQ6A 4NT0A 4LY8A 3VXGA 4CNUA 4IMGA 3M7SA 4ZTYA 4KFNA 4NP7A 1WV2A 1F3EA 4LQ1A 2OEJA 1L0PA 1FHUA 3DG3A 1D8CA 4KT2A 3SO7A 3VKJA 3S6TA 1QNQA 4PCTA 3OQ8A 1E6QM 3VM7A 3QOKA 3G5EA 1K8ZA 1XICA 1VGAA 2A21A 5I03A 3OLIA 5LHFA 1AMYA 3M43A 4FAMA 3E38A 1A5CA 1EKOA 3GXIA 3V16A 4Y9MA 1YHTA 3IJ7A 4JNZA 1FDYA 2ALRA 1QWGA 4UB9A 4QDPA 3L21A 2G4FA 4MZ1A 3RNDA 3NXLA 2CHNA 3ERPA 1AQ0A 5IFTA 3HM7A 3GNNA 2PTDA 1X6NA 2DZTA 1U1UA 4JGDA 3USBA 3PTDA 2KX9A 1SFTA 1W2PA 3EPOA 1JCLA 1JZ7A 1VPYA 4DHGA 3RHGA 1WBJA 1H51A 1J18A 1UKQA 1WPCA 4XSMA 3STEA 2A6LA 2OMAA 1XIIA 4NI8A 1U83A 2NUYA 1M7XA 4LUTA 2WJFA 1IEQA 2Y7EA 1UP3A 1VPQA 4DF1A 2JIEA 3G1YA 2GJXA 3CNYA 2HJPA 5D2YA 4EIVA 3VPLA 1GZJA 2XGBA 4B16A 4HYRA 1ZFJA 2EG6A 3M4HA 3W26A 4GUFA 3QW3A 4B2DA 2XIBA 1JZ2A 3DFOA 4Y90A 1RV8A 1WOAA 2VKZG 4FX6M 4ZOCA 3W02A 1QNOA 1LWIA 4I3GA 4CNSA 3E2VA 4ZOEA 2VGIA 4ZE4A 1E6RA 5FF4A 1OM0A 3VI2A 1JUKA 3SFWA 2UY4A 1NWUA 4XIAA 4QS5A 1BTMA 2EPLX 3SY5A 1SR9A 2EGZA 2ZRWA 4P2VA 1K4HA 3GHSA 1TWIA 2V63A 3SADA 3BSHA 4C6IA 2XIIA 4RXGA 4UTIA 1G1YA 4J5NA 1YKWA 5C9RA 3NDZA 3HPFA 2A7NA 4PCSA 3BMXA 3IACA 3SB0A 2FZMA 1XPYA 2FTWA 3MHFA 4UFKA 1M01A 4I5UA 5FEXA 4JR5A 3TLQA 4DO4A 3TWAA 1EJRC 2EQDA 3FAWA 4H41A 1JNDA 1R85A 3ANVA 1KO0A 1CWYA 2D2JA 1PCKA 1FCBA 4A22A 3W7KA 5FEZA 1PVNA 1XLBA 1XG4A 3H4XA 4FLQA 2AKZA 5I77A 2PDJA 1Z69A 2D3LA 2DSWA 3ORWA 6ALDA 2IQTA 4LPCA 1WUFA 3CC1A 1XLFA 2QW5A 2HNHA 1XD1A 3O05A 3ZO9A 1VPXA 1KRCC 5XIMA 3H2AA 2EPMX 1H1NA 3KWSA 4OECA 1YMYA 4L1GA 4E2DA 3MI2A 2VYOA 3ONBA 2OCZA 5EU9A 4BEUA 2GJNA 8A3HA 4OV4A 3PULA 4RLIA 1GOMA 1R2RA 5DXXA 1D9EA 3QVQA 4QQUA 2CERA 4XO7A 1CLVA 5H8MA 1POKA 4W89A 2NSOA 2V38A 3P5ZA 3UWUA 2XVGA 1QUMA 3G77A 3UWZA 1ISXA 1QPNA 3N2OA 4RPQA 4JL2A 1E43A 1K9EA 1A47A 3MZ2A 3VIJA 2GWGA 2X0YA 3UCQA 3RIKA 2UBPC 1X8FA 3OEXA 1OT2A 2ATMA 3I3DA 2I1OA 4U31A 1F4AA 3MKCA 1JDAA 2GGHA 4XKYB 3P82A 2QT3A 2QVNA 4ZQPA 4ZFCA 3FXYA 2E8YA 5M03A 1ICQA 4GQQA 4IIHA 3EWBX 3WFLA 1DQXA 2DZSA 4DBSA 4EPKA 2V5KA 2QJGA 2GLKA 4CD6A 2OEKA 4DO6A 1X7FA 3W2LA 2H3BA 1OJXA 3AXIA 2XIJA 4JTLA 3CV6A 4ECLA 4W8LA 3AWOA 1W9XA 3IARA 1VCGA 1B3OA 3B8VA 1JR1A 4DZAA 5EY5A 1KM0A 4GK8A 2BY0A 3NNTA 1TG7A 3N3TA 3GW0A 1KB3A 2ANUA 3HO8A 2BHUA 3MWCA 1R86A 4WX2A 1XHGA 2HCVA 3PWAA 1EOMA 3E0VA 5C6MA 1MQRA 4AZGA 3LHTA 1CXEA 4YCPA 1VFUA 2D0GA 2VC6A 5D09A 2NUWA 1R3QA 2INFA 1QOPA 6TAAA 5D9NA 4Q4MA 1OFRA 2WVTA 4H9UA 4Z1BA 2F84A 1J2WA 2R14A 5HATA 4KEMA 1Q85A 2VFHA 1GOOA 2VCAA 1RP8A 4XVDA 1R9XA 5CSSA 4IP7A 3W7PA 3SJNA 4LCSA 3GD6A 1UKOA 1V08A 3UPMA 4KGJA 1C3FA 3W1MA 1R5YA 4AZHA 2OYKA 3T78A 3T7VA 2DQXA 2WC7A 1XDJA 4KRUA 2WSKA 3BDKA 5AYBA 2DGAA 4HNLA 5C2GA 1FVPA 3BCJA 3LTSA 1SW3A 2BGNE 4RE4A 3UEQA 3WDHA 3O15A 4QG8A 5LIYX 3R8GA 2J75A 2FZBA 4WSHA 4ZL1A 4BI6A 1QI4A 3LCFA 2ZFAA 3IS4A 3NZ1A 1DJWA 1A5UA 1KNWA 3CIXA 3DKJA 3GKFA 4HTYA 2WCGA 2QUTA 1G7UA 5FF7A 2G3MA 4Y9OA 3T4CA 1Z7AA 1FWBC 1AUSL 1K9TA 1V0NA 5I3FA 1Q6EA 5A1AA 4QJ3B 2ZVIA 3DOPA 2CHOA 4NASA 1LWJA 1TWDA 3WYZA 3WD2A 4XZBA 1T40A 2DP3A 2BX7A 1DJQA 2OWXA 5D03A 4TV6A 4LT9A 7TAAA 3P5YA 1A50A 2BGQA 4QEHA 3WSUA 1UD8A 1QPQA 1E9ZB 3K8LA 3EKGA 1IR2A 1IR1A 2DY3A 3MP4A 2DEPA 3UG5A 1UD3A 1BD0A 3VKAA 4L4LA 1R9YA 1EIXA 1PJ9A 4LAOA 4DO7A 1H49A 3UGVA 3TSBA 5BRPA 3LLXA 4HU0A 2VM8A 2XYLA 1VRDA 3GG7A 3PANA 4CNNA 3B0PA 1P7TA 1FP9A 4Q8TA 4FNQA 1DV7A 1SJBA 4KBXA 3BAYA 3VIHA 1PX4A 1XRVA 2G3FA 3KCOA 4ZO6A 3W53A 1E71M 3NL5A 3KZPA 3BAKA 4DI9A 2X42A 1HQTA 1KXQA 2ZWZA 3FJNA 2XH0A 2Z1XA 4ML9A 3M1ZA 4Z2KA 1S2TA 3WLPA 5CSRA 4HKPA 2Z1VA 2BVTA 4KIRA 1T99A 2FFCA 3UG8A 2PBOA 2V67A 2CETA 1R3WA 4GI6A 2VX5A 5G2IA 2BASA 3VZYA 4AB4A 2C0HA 1GVOA 4XWUA 2JKEA 4MUPA 1EHNA 2OQHA 4IZGA 1P0EA 4YLWA 1TJPA 3PJWA 1XIEA 3BLPX 1M3UA 4S3CA 2WYSA 3PPGA 2QHAA 4HBKA 2Z6JA 1Y8BA 3G3DA 4M6PA 1FY6A 4RZ6A 3VC5A 3LXCA 1E6SM 2XN2A 1EL3A 1Z8AA 4IHCA 4IL0A 3FX4A 1J93A 3ITOA 3LRKA 3S5NA 2X8RA 1XYBA 3ABXA 4A8IA 2VELA 3RPDA 1UMLA 3VC6A 4NU7A 2P50A 4Q4RA 1BVZA 3GU1A 3MZNA 1VJZA 5FOOA 4JEJA 2PC4A 5A8QA 3BLKA 1KTCA 2JK2A 1QI3A 4Q4OA 1CLKA 1LWHA 3FOKA 2X0SA 1ODUA 3SGZA 4RZ5A 3ARSA 2DIJA 4LYPA 3NL6A 5EMLA 3Q4DA 1VIZA 1DVJA 4GVFA 1XC4A 4AMAA 2BBFA 3OIHA 2VC5A 1XCXA 1M7JA 2ZE3A 3PBYA 4JX6A 2ZUSA 4IMDA 3P2VA 4F0LA 1F8MA 2QJIA 3RRAA 3IVUA 3UPBA 5CG7A 4HA4A 1MW2A 3E9AA 4WSJA 4KEZA 4R27A 5C70A 3FYOA 4E2VA 1VR6A 1ZBKA 1ZP4A 2ZA3A 2WAGA 7REQA 1GKRA 1O7AA 3AXHA 5LGZA 2HDJA 2BV9A 2PF0A 4FZIA 1X96A 3ALFA 3C61A 1UJQA 1EGZA 1G5AA 1V3JA 3CZEA 4JKLA 5DCBA 4QSFA 1CX9A 3GBEA 4QCEA 4Z2JA 1GORA 2DV0A 4AD3A 4AQLA 1XIBA 2TMDA 1RA0A 1SQ7A 3GY1A 5BNKA 5D9PA 5EMUA 3TYAA 1TPDA 4FXSA 1UZDA 2JEPA 3LGEA 3CXOA 3QGAC 5DCEA 4O1FA 4C6CA 1C92A 2ZXAA 1UUMA 6CGTA 4TX6A 2CIPA 3WDIA 4FO4A 1POJA 3T6CA 3QTGA 2XVNA 4JN6A 1O5QA 3CBWA 3BK0A 1XQLA 2BODX 1N82A 1KGXA 2EJ1A 1JPHA 2FZ8A 3TSMA 1WDSA 2P8BA 2C7FA 1QNSA 3QM3A 3ZFHA 3CS2A 1ISYA 3GR7A 3HQNA 3ZOAA 2YXGA 5C9ZA 2EEXA 2PWHA 3ITVA 2OT0A 1R2SA 1XG3A 4JYDA 4GACA 3HQPA 2WMKA 2E9LA 5E0FA 2RDTA 1MWOA 1PKMA 3JUGA 1Y5VA 3UF9A 1CCWB 2CCRA 1AQHA 3M16A 5F1UA 2IKIA 4OGZA 4OWGA 1GJWA 2FB3A 5I3JA 2OU4A 3BXWA 4FXJA 2BY1A 1VLWA 1FWRA 4NL1A 3VKDA 3MMTA 1B54A 4O0QA 5F4SA 2WW5A 3W1RA 2PDQA 1DTNA 2NXHA 3QPZA 5ABFB 4TTUA 3W72A 4PFMA 2QF8A 3OA5A 4ACYA 1H7RA 1MQPA 3LNMA 4YTQA 2ZZ4A 2DIEA 3K46A 4AY7A 1MW1A 2ISVA 1L9WA 3E49A 2A5HA 3MCOA 1Q45A 1KR1A 4EAYA 3GUGA 4HTBA 3R7MA 3DESA 3I4KA 3N2BA 4F0MA 2IPWA 1XF0A 4URIA 4S39A 1AQFA 3G3MA 1D2KA 3FLUA 5BRQA 3M5ZA 3BLLA 1PCWA 2X1TA 3B8SA 4UC5A 3AZTA 1JF5A 3GBDA 1ZL1A 3B0VC 2AQOA 4A8LA 1B4EA 1JXJA 5FESA 2A0NA 1U5VA 3GDBA 2R1LA 2J62A 1TRDA 4IT1A 1XSKA 4JTJA 3XINA 4BF5A 2A85A 4PTDA 1FXPA 2VRKA 1W5NA 4MDOA 2VHLA 4DZIA 4DJFC 3THAA 3O6DA 1DWIM 1GHRA 3TV8A 3ZXWA 2OSYA 4F9DA 1QCWA 4X9SA 1EDGA 2WHMA 2FMNA 5KINA 1J5SA 3KL0A 5AC7A 1H7NA 3VUSA 3YPIA 3TVAA 3AZRA 3P3BA 3CQ0A 1BRLB 3EDJA 4MNMA 4DQWA 3QR1A 4GQGA 1DXFA 3UXDA 4IICA 5A6BD 3VGGA 2A3LA 3VDHA 1HJUA 4NHVA 2QIIA 2DT1A 4QG6A 4IP4A 3DH7A 4QAIA 1ZBWA 1HVQA 4DWSA 4G6CA 3KLKA 1KM6A 1QHZA 4U28A 3NQCA 1EEPA 1J6OA 1BF6A 3G22A 4NX0A 4K8GA 4LU0A 4O1BA 3WQWA 5DRIA 1XCFA 1KFJA 2CKRA 4N7QA 1Q4WA 3MHUA 5HNNA 2ZA1A 5AHFA 2H9AA 3ITYA 4NVTA 3OPSA 3S3GA 3O0FA 1GYMA 5LYRA 2ZX6A 1ZHAA 3K5XA 1VBUA 4LVDA 1ONXA 3KBWA 2J88A 3NVTA 3SRDA 3PY2A 4NAFA 2IKHA 2WHKA 2WNQA 4BFAA 1VIWA 4Q22A 3EA1A 2JKAA 1AG1O 2Q6ZA 3O06A 1OX4A 3RM4A 4WK9A 1Q6GA 3UYCA 1IIHA 2CLFA 4Y6GA 4EPBC 3LXAA 2AOSA 2E5BA 4DJED 3EWWA 1O12A 1XLHA 2YW4A 3DI1A 4C65A 3IJ6A 4KRZA 5TQLA 1W17A 4F0HA 4LWWA 2IKJA 4DXKA 3ZS4A 3WLKX 2D22A 3TJXA 3LGGA 1SGJA 3R12A 4IQJA 4UTTA 3WQGA 1O5XA 1E40A 1B1YA 1YEYA 2Y7GA 4D2JA 1XLKA 4WY0F 3UJFA 3TN3A 1DXEA 4J3XA 3UZYA 2OODA 3U57A 1JVNA 1LROA 5HOSA 3VNLA 3F03K 5FL0A 1JIBA 2PB1A 3WL1A 1VF8A 2ZRVA 5D8ZA 4PB4A 1K8YA 2OGYA 1R38A 3PF3A 3SI9A 1KGUA 1VBJA 3TK7A 3F1QA 2XHYA 4HA1A 3QW4B 3P8JA 5DMNA 2YX0A 3W74A 1TV5A 1TYGA 4A3YA 1XC6A 3RMEA 8CGTA 3N04A 3EYPA 2GVEA 1B5TA 1DE5A 3GRIA 1SZGA 4AISA 2WC3A 4BF7A 4O53A 3MO7A 5DY3A 2YB1A 1ONEA 2GZXA 4Y9NA 3VGDA 4GHRA 1FH7A 4MPQA 2HRWA 3CQJA 3MJMA 3HPAA 1W8SA 4DYEA 3MJYA 3SRKA 4EWND 2V68A 5FL1A 1DIDA 3UY7A 2HROA 1F5ZA 1VFHA 4IH3A 2WV8A 4QIUA 4Q6XA 1UR3M 3JS3A 4A35A 2NT0A 1LM1A 2Y8KA 5HWNA 3I7RA 3W01A 4EE9A 4PTNA 4MHBA 1E15A 2D3NA 4LVFA 1P0KA 1DIEA 2YCLA 3VE7A 2G5WA 4KFOA 3ZLHA 2GDQA 2POTA 2INEA 3FVDA 3E2RA 3TYEA 2OO6A 3RLUA 3WKZA 1KW1A 4ZMGA 3CHFA 3GTNA 1L2UA 3SQLA 3DHUA 2BGSA 1H41A 2X1IA 3UP8A 5K4ZA 4UNKA 4OJYA 1IWPA 1OBAA 4AD2A 1OVDA 4QAWA 7A3HA 4ZENA 2QCHA 2FHBA 2WZEA 2Y2WA 2JF7A 3IV8A 1E6ZA 1US3A 1OADA 2X05A 4PTXA 4D6GA 3T07A 4AHPA 1SYTA 1S1RA 5JU6A 1P43A 1E1CB 3KAOA 1LP6A 4PZVA 1VRXA 1IEIA 1NOUA 3QR3A 1H3GA 4C1NA 2VC7A 2GVYA 4J3SA 5I0DA 1TA3A 4X0VA 1KTBA 2CLIA 2GJXB 1JJKA 4WDUA 1UWAA 5L6UA 4CN1A 1GPWA 1L6FA 4UQ9A 3OZMA 4BZYA 3MUXA 4TMCA 5FEPA 1OYAA 4N2YA 4LEFA 1HO1A 2NXIA 2FVMA 1ZENA 5A2CA 4JX4A 1C90A 1Q63A 4MKSA 5E09A 3SCSA 4JFUA 3CPRA 3JZEA 5I79A 2VP8A 4H04A 2C15A 1F73A 3VA8A 4DO5A 2ZUVA 1W2VA 1EC8A 3EDEA 3N29A 4BWLC 4MDPA 3LLDA 2Y4SA 3SN0A 2PDUA 1BYDA 4D6IA 3NQEA 1RALA 4HPXA 2VGGA 1G67A 4ROPA 4IIFA 1KWGA 3PK7A 3CEPA 3B8IA 4H8VA 3S1WA 4DBDA 3WJYA 1DHPA 2Q01A 3CWHA 2JE8A 5AHMA 2VENA 3VNKA 5K4XA 1BVNP 4FB7A 5EB8A 3CUHA 4D6EA 1UOZA 1BTCA 3SN4A 5LHEA 1ZRQA 1R6WA 1QNPA 3O1NA 3B9OA 2HWGA 4OZOA 1GEQA 3N14A 5M1TA 5U4NA 1Q6DA 3KRSA 4DJDA 2HS6A 5IXEA 1SO5A 3FFSA 3C3UA 3MBFA 3O6AA 4ICMA 1XRFA 3I7QA 1T6MA 4GD0A 4ONVA 2ODOA 1LT8A 1QDSA 1I2PA 3BSGA 1BAGA 3SZ8A 4QITA 3WQFA 2HQAA 2V69A 3ZLGA 3B8DA 3M0LA 3G1DA 2YDSA 3WF1A 4I6VA 4JHZA 3AS1A 2W4XA 4MWAC 4ILSA 1W8GA 4QEEA 1Q66A 3W1PA 3GU2A 4W84A 1WOBA 2CLMA 1IZCA 4RW3A 3NQ8A 2QCFA 3B0UX 1G4SA 2CZEA 3QY8A 2WMHA 2J78A 4GIAA 4IOTA 1G69A 4RE3A 3BW3A 5H8UA 3CHVA 5CJNA 3FW6A 3NOEA 1AD4A 4V1YA 4Z0SA 2CPUA 2F2KA 2EPKX 4JQ1A 5AY7A 5A6MA 3BG5A 5DMMA 1GYLA 3WLNA 2G37A 3P61A 2HXUA 3TFXA 3RCYA 1IGWA 5A6SA 4IP5A 4F2BA 1YTEA 3A4WA 4YTTA 4L4OA 3TQKA 3WD4A 4H9ZA 4OOUA 2CITA 4YCOA 3WDRA 5BXPA 4LYKA 3DDMA 4RXFA 3UWVA 1MZHA 3TKFA 2XUCA 5KZDA 3CAWA 4G8TA 1WXJA 1WZAA 3W73A 5C54A 3W6MA 3S83A 2PWFA 3KOXA 1OFPA 1Z44A 1QU4A 1EJ7L 1NAL1 4DRSA 1LBLA 2PWDA 1V4YA 3NSNA 4BI5A 3LXBA 3OGVA 4PULA 2YJQA 4Q8PA 2XGIA 2GQ9A 1XD0A 4INFA 2VC9A 4YTSA 2A7PA 3AALA 4TXEA 5AZ1A 3AISA 3BZJA 3EX3A 3WF0A 2C19A 1UD2A 1JAEA 1GOQA 4O10A 3QLLA 4MJ4A 1UC4A 4PL2A 3GNDA 4M6QA 3MUAA 4I8DA 3ZT6A 3MUIA 4C6QA 3THQA 3G8EA 4PODA 1LDCA 2AQWA 4H00A 4K39A 5HMDA 1V8EA 3P67A 1GJUA 1AMKA 4Y9PA 4H9XA 2CYGA 5DN1A 4C6MA 3MO4A 4GZ7A 4HSNA 2VTFA 1OZQA 4DUVA 3SUWA 1I2NA 4EK7A 2G50A 4Z0JA 3NZQA 3OBEA 3W7CA 4PUKA 5CBBA 1PXGA 1K77A 4JQAA 4V2XA 3BARA 3TR9A 1TJ1A 5IBXC 1JCMP 4HMCA 3CUFA 4L6OA 4RV3A 4OUIA 5HJYA 4OTKA 5DELA 1C7SA 3RRXA 3F5JA 4U33A 5ECUA 1XGDA 3EXSA 5H1WA 5SWUA 4N6FA 1EJTC 3NYDA 5REQB 1XKJA 3ECQA 1RCXB 1EDTA 4Q8QA 2WSYA 4IXXA 1NOFA 4XVEA 5HUOA 2E7FA 3AIRA 1YDVA 4S2BA 4H9TA 4PRWA 1DKWA 4QE4A 2XTKA 4G56A 4JTHA 3FSTA 3UZ5A 2HPIA 3L23A 1I75A 3GHRA 1HJQA 4RR4A 5FACA 2ZZ3A 3TCSA 3G6MA 4S1FA 2PF8A 2ZRXA 3U5YA 4N42A 3NYZA 4B9YA 2RDWA 1A0EA 5RUBA 2AQVA 4BHYA 4TTGA 1FXQA 1W0MA 1B30A 2WK2A 3DUGA 1TTQA 5LIXX 3RM9A 4WUIA 1Q3NA 4LUJA 5U7SA 1PX8A 3DC0A 1W9UA 2DZUA 3ZJ7A 3LRLA 1KXTA 1U22A 2XH4A 3PBUA 1F4HA 3HGRA 2B7NA 3DC8A 1UA7A 3DGBA 4CD7A 3PBWA 2QAFA 4AZ5A 2AMGA 1H09A 1TPB1 2ZUMA 1FCQA 1A53A 4XKMA 3LBCA 5A6JA 3S1UA 5T26A 1EX5A 3AFBA 4GNKB 4HU8A 1P7TB 1IV8A 2D69A 1D3CA 2NV2A 2PPGA 3LG3A 2R9RA 4C6OA 4RE2A 5AZ0A 1I1WA 4UTUA 4S3BA 2ZC8A 5EMMA 3WBYA 1KBJA 1E9IA 4LH8A 2MANA 4H6QA 5CAKA 5G2WA 3WNNA 3NQBA 3ZJ8A 3TNBA 1O4UA 2OQLA 4DBWA 4C7DA 5C2XA 3GC4A 3GB6A 3NIYA 4MB1A 3UG4A 5I3KA 2IPJA 4QXIA 4AYGA 3EMQA 4HK7A 4U2YA 3WJWA 4H7ZA 3R43A 3NQ6A 1Q8JA 3RITA 3UR8A 5CSUA 2HE8A 4AWTA 3M7WA 3KTSA 1ESWA 4NSBA 5CSYA 5MKGA 4J3VA 3HV8A 3TOYA 3V18A 2PDWA 4PMRA 3SN1A 4PE8A 3II1A 1K7EA 3L0NA 1VKFA 4GNVA 1GWJA 1V0MA 4AYSA 1ITCA 5BCAA 4W87A 1MW0A 3S5ZA 4B5XA 1SO3A 2EPOA 4LS1A 3ZR4A 1V6WA 2H8ZA 3W25A 2Q8LA 2NXGA 3CO4A 2BY2A 1NFGA 3VIIA 1TX2A 4IIGA 1H5VA 1KRAC 1GJPA 4HA3A 3GKAA 1XGEA 3W28A 1DOSA 1YXYA 3VOFA 1X7IA 3AHXA 5A5WA 1ISWA 1UQZA 1TV4A 1LOQA 1VEOA 4D71A 3H4GA 1BWKA 1EDQA 2EO7A 4IM4A 3SR7A 4FR1A 4K36A 2QYGA 3DCPA 4CKQA 2BFGA 4A3RA 1NDZA 1NFPA 3D3FA 4OOZA 3S1VA 1OF6A 2UY2A 1YDYA 4QX4A 3H7UA 5ENLA 2Y88A 2PD9A 3LZ3A 3LYEA 1WNOA 1LQAA 3N13A 2ZZ5A 5CJ5A 3W7OA 1OF8A 2HK0A 3BAXA 4W85A 2AAAA 4PUMA 3CB8A 3S46A 4C6FA 4O14A 2OLHA 1EOKA 1ZS2A 4RE0A 3ITLA 3CWNA 5M5DA 1OT1A 3GX9A 1JGIA 3SAZA 5I3IA 1NDYA 4DEFA 3LQGA 5CPSA 3DHFA 3VIPA 2C1HA 3UT0A 5HK4A 1SPQA 1QASA 4IG2A 1S1PA 5LIWX 3VOIA 3AOFA 3LCGA 1ITXA 1I2RA 4J3UA 4C6PA 2OEMA 2C8NA 2FYMA 3SY8A 3ZMRA 3R2GA 4MGGA 3SSJA 5AHLA 3W87A 5DF0A 3JRKA 3WQPA 3DFSA 3VCRA 1HJWA 1K7FA 4ZQMA 3RPTA 4N9CA 3WH5A 3NM3A 5AOUA 3OHIA 4ZQCA 4NQ1A 1W3KA 3BCDA 3LHUA 4JICA 2EBNA 4L1XA 3UNTA 5ABEA 2PEVA 1PDZA 3CL8A 3WD3A 4AEEA 3KP1A 4OT7A 4JTDA 3TIMA 1XBZA 1HNYA 3N9SA 4MAVA 2Z24A 3FDGA 2Z1SA 1KCLA 3VABA 5FSEC 1XUZA 4G9PA 4MUZA 4UR9A 1XLIA 1TWSA 2E4TA 4OBRA 4IGNA 3UVIA 3T81A 1NJJA 3UWYA 1JD7A 3K1DA 4ZEPA 1JGMA 3NJ3A 3LS9A 2NX1A 1UWSA 4Y7EA 1WKDA 4RNFA 2XM1A 3AIVA 3LSCA 4K7VA 2VZSA 2BMBA 2VZTA 4QJ5B 3B05A 1SFSA 4BQ4A 4A6GA 4JS3A 4E5TA 1TSIA 1X97A 1CIUA 5G1TA 3CHEA 2GFTA 3W7EA 2WBGA 3QV8A 4LTSA 3L12A 1S3TC 3Q67A 2W61A 5CXPA 1TCMA 5IDZA 2WMGA 3MBDA 2E77A 3SSZA 4TVCA 3A9IA 4J4KA 4GYPC 3L4XA 5CG0A 4NAEA 2OSWA 1H1YA 3VMOA 3C2FA 4YVPA 4LRTA 1AQMA 2FB2A 3FNDA 3GDTA 1JYNA 4D72A 4FI4A 3WEZA 4RK8A 4M51A 2CBVA 1TREA 2DVTA 1ADSA 1XRTA 4CCDA 3VDBA 2INZA 1DWFM 1DXIA 2G8ZA 3ZQ9A 3BG9A 4F4RA 3RGTA 1L2QA 3FGCA 2ZXBA 3FCPA 4R34A 3T0BA 1C93A 1DJHA 3PPHA 4Q8OA 4MADA 3LBOA 2X1RA 1H11A 3LV6A 2GGGA 3C2OA 3C5QA 3S6DA 1JCNA 1RQHA 1BHGA 3HG4A 3T2QA 4L1WA 3NSXA 1V0KA 2ZCGA 4PTVA 1P1XA 4DWSB 2WHJA 3QEZA 4JX5A 4UIOA 1OFBA 3RR4A 4GCXA 3O9NA 2YCKX 2LLEA 4C6LA 3UZZA 2H6RA 4PSPA 5FJPA 3RYSA 8TIMA 3E74A 2FZ9A 1TUXA 4OUEA 5FJTA 3ZWTA 3L2IA 1K70A 1CECA 1D7KA 1ISZA 3ZZ1A 1N8WA 3GNOA 3MC5A 4V15A 3T4WA 4QHRA 2HISA 3FY1A 3C86A 3BH4A 3C0SA 3ZR6A 2VL4A 2QAPA 2BG5A 4JQ3A 1KV8A 1FWEC 5HPOA 2V0TA 5HR6A 1YXCA 3C3NA 3L2MA 1OX4B 1OFQA 3SUSA 4YVVA 5DO8A 3TMLA 1F05A 1JCJA 3VOJA 1PDYA 2VEPA 2WJEA 3VD7A 4NZ5A 3E12A 3RAOA 1O68A 2OLAA 2QDHA 4MSSA 4A2RA 3WNPA 3S2NA 1MMFA 4JFVA 1EF2A 4DJFD 2PWEA 1UH4A 1ZAIA 3SRHA 3ITGA 1QBAA 3M47A 5CPOA 1B3XA 4GIYA 4J28A 5FAJA 1EO7A 3QMRA 2D23A 1Y65A 1TQXA 3BPWA 3QR0A 3AIEA 3IAQA 3BJTA 1RBAA 3MUY1 1REQA 1ODZA 4GY1A 2R91A 3HG3A 4GPNA 4A3HA 5FD0A 3U2CA 2PDFA 3WEOA 3ANUA 1OK4A 5J5DA 4Q8MA 1E9LA 3AICA 4GI8A 2YDQA 3I4EA 4HQVA 4O8RA 5EFDA 6TIMA 1EA0A 3K4WA 3MP5A 5CEWA 1E3XA 2XU2A 2GSHA 4A29A 3FIGA 1GCYA 1ML1A 1J9YA 4HCLA 4UR8A 2Z7KA 2DUAA 3BICA 3TW9A 4JN7A 3L68A 1ZQ5A 1RLCL 5HULA 3WQ5A 3GFYA 1TE1A 1RZMA 2BOEX 4DM1A 4ZCWA 1SM9A 1TTJA 5LNWA 2IXVA 1F6PA 1NDWA 3H12A 1CI1A 4OVXA 4M80A 1DJYA 1X6LA 4GA8A 1ECEA 4ZQOA 2XJ7A 3S2LA 1Z89A 2IXUA 1HP5A 1E4IA 1LT7A 4Z42C 1AD1A 4JTUA 4GLEA 2PWGA 2Y85A 3UFYA 3WLQA 4P8VA 2J7BA 4PR4A 5CPMA 1RK5A 2GL5A 3WJXA 1W3IA 1KM1A 3H6OA 3LERA 2E5CA 5C8BB 3W82A 3R1ZA 2VEFA 3GG0A 5HBFA 4M82A 2YCLB 2DORA 3WMCA 5GJNA 1A5SA 1BVWA 2PFHA 5AC6A 3UU0A 4GH3A 3MKVA 3O6CA 1A80A 4P7OA 3PPFA 3ZWSA 3LOTA 3AIUA 5HR7A 2YLAA 3UCDA 3H7RA 5MF5A 2E0PA 3U9IA 5BOFA 2WM1A 4KMQA 3WMLA 3MB9A 1KM3A 4CEXC 3WUFA 3A4AA 5BMXA 1S2CA 2F7FA 4DVOA 1HT6A 4WZHA 4DWDA 3P84A 2YCJA 1BSIA 2VZVA 1FWNA 2VZOA 3I65A 1C7TA 1E4NA 2YBTA 1OZMA 5A3HA 1TPEA 1M04A 1RCQA 3A23A 3DXIA 5EA9A 2PGFA 1JPMA 3AS0A 1L8NA 4C1NB 2QDEA 3E3HA 1TA3B 1VYRA 1IXPA 4MMWA 3DX5A 2R8WA 4J27A 3VNIA 5JBEA 1QFEA 2BNJA 4LY4A 1V51A 2CLHA 1JEZA 2WC4A 4P7RA 3B9AA 3ARYA 2DT2A 2UY3A 1HN1A 5LIUX 2P0IA 1GK8A 4NJGA 4EKJA 2J13A 3MP3A 3FSUA 1B4KA 3TU9A 2DT3A 3QV9A 4PMUA 5D32A 3GHTA 1UP0A 2PDPA 1ISVA 1SZRA 4G1NA 2YR1A 1TUFA 1OB0A 1VC4A 4OIFA 4ZVJA 2QLYA 2W63A 2ICSA 4QLKA 4FNPA 3QXBA 3GIYA 1UBSA 4K8EA 4HMDA 4XIMA 4HHHA 1QT1A 4RDWA 1BQGA 3E2QA 3B04A 3STCA 2PS2A 1VP5A 3A64A 1XV8A 1PO9A 4QNWA 1UROA 3HMJG 1H0GA 1TWZA 3TTSA 4OQVA 1TIWA 4LB3A 1FHDA 2AL2B 1PHQA 3H55A 1ZSXA 3GW3A 3N12A 1TIMA 1FA2A 3LHVA 2DH2A 2HE5A 3N9RA 1IE7C 3SUUA 2ACUA 3N4AA 3BQ5A 5G4WA 3SECA 5EMJA 1ELSA 3KL5A 3PZGA 4GJ1A 4BY3A 2NWRA 2J7EA 3AXMA 1TR9A 4E38A 1TV8A 1L6GA 1XLAA 2HSAA 5CH9A 3QV6A 3EEGA 1GVYA 1M68A 2Y5JA 2PRHA 3W7HA 4YL2A 3O0KA 3P80A 1OX5A 4YYCA 1AH4A 3GZAA 3NUKA 3N3MA 4PTWA 4KWUA 4WDTA 3AUOA 3NURA 2GOUA 3LMZA 1V6YA 3HFYA 4WR3A 1I6NA 1B0IA 3PN8A 1HKVA 3U48A 3N2XA 3NOYA 5ECVA 5FSDC 5M2FX 3M5YA 3QKZA 2ZRZA 3RJXA 4AF0B 4X2RA 1JYXA 4UQDA 1CXFA 1Q6RA 1KRBC 1HJVA 5LA0A 1Q8AA 5BWFA 1UQYA 3WBEA 4UFHA 1S46A 2YBUA 1C8YA 5EMYA 4MWAE 4PMJA 3ABSA 2ZX5A 4Z1AA 2BHYA 2X0HA 4JIIX 3DAQA 1W54A 1Q5MA 4KPLA 2FDSA 3U2EA 2GSJA 3KEHA 3AHZA 4FX8A 5IRPA 2IW0A 1CGUA 1FWHC 3W70A 2C1GA 1I2OA 1V0LA 2J9YA 4NUWA 3LHZA 4NNCA 1TX0A 3E6EA 3CQHA 3XIMA 4LAKA 2TAAA 3B4UA 4M0XA 2I57A 4TVDA 1L6SA 3INPA 2WMIA 1UMYA 1EYEA 1PIIA 4UUIA 3BUVA 3I6RA 4R7WA 4M1RA 4XTDA 1W5OA 2YIHA 2ABAA 4IMCA 1E51A 3OLEA 4MPKA 3GTFA 3EOSA 2FJKA 3VNJA 4J2MA 2I5GA 4FMVA 4Z2HA 7XIMA 3TLLA 5CBJA 3HIJA 3W2UA 1W3LA 1FFQA 2WQDA 1SJDA 2QXWA