1B1YA

Sevenfold mutant of barley beta-amylase
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
500
structure length
500
Chain Sequence
MKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKDFLDAGVIVDIEVGLGPAGELRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDAGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKIAGVHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQPPDAMSAPEELVQQVLSAGWREGLNVSCENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYVNFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKIQPFPFQEHTDLPVGPTGGMGGQAEGPTCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PROTEIN (BETA-AMYLASE)
publication title The crystal structure of the sevenfold mutant of barley beta-amylase with increased thermostability at 2.5 A resolution.
pubmed doi rcsb
source organism Hordeum vulgare
total genus 164
structure length 500
sequence length 500
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 1998-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1b1yA00
2QMKA 1EA9C 1UD2A 2D3NA 5I78A 1UWQA 2UY2A 5EFFA 3RJYA 5EMYA 1Y7VA 4CCDA 2YL8A 3L2MA 4PSPA 4OOUA 4C7GA 2DT3A 2XFFA 1XH1A 1UR8A 1DWIM 4C7DA 2AAAA 4F9JA 3BLPX 5IHRA 4LYRA 4B3LA 2O9TA 3PTKA 1KQZA 4U33A 1GOKA 3ARVA 1UD6A 3CHEA 1J0KA 3UR7A 1G9HA 1EIBA 4HP5A 1NWTA 3F5JA 5HXMA 4PMVA 4FMVA 2WKLA 3VNZA 4Y7EA 1DHKA 2YL9A 3ARTA 1B9ZA 3OLGA 3OZPA 5E6ZA 3CZJA 1HKIA 4QFUA 1AMYA 3W81A 2OWXA 4PMNA 4L4PA 4PMQA 2GJXA 2WWDA 2VR5A 4W85A 3ARYA 3W25A 1XYZA 4MNMA 1E0XA 5ABFA 4JIEA 2CESA 2Y5EA 2RGLA 1QI3A 3VD5A 3ZJ7A 4CD8A 4B16A 3SCNA 3AYSA 1WP6A 4TVCA 3VDBA 2W91A 2YA1A 3WY1A 3AZSA 4N0RA 3MV11 4J3XA 4OIFA 4TVUA 4ATWA 2E8YA 1VFFA 3GNOA 1CGTA 2WZEA 2J75A 1UKTA 3WD4A 2Y8KA 4JZ5A 4M56A 1QHPA 3WMBA 1ISZA 2ZE0A 2WMIB 3VMOA 3WNLA 3VIMA 1GVYA 2G8ZA 5E0CA 3NDZA 5HPCA 5FL1A 1UG6A 3QR3A 2EPMX 4UQAA 2VVSA 1UR0A 1LQ0A 1E0WA 4RL3A 3RM4A 3AXIA 1EO5A 5FKYA 1SMAA 1GHSA 2VR4A 3BH4A 2G3NA 1I1XA 3W26A 3RJXA 4WKHA 1OD8A 1ISVA 5D9MA 4JFWA 1BVNP 3ZJ6A 1Q6EA 9CGTA 1AQ0A 4AIUA 4RE4A 1JZ4A 2AOSA 5CPSA 5EFDA 3K4DA 1CXFA 1HVQA 1XC6A 1HIZA 3GH5A 1LWHA 2BHYA 2WLZA 1V3JA 5AYIA 5D9NA 4OJYA 5M17A 1E55A 2BY0A 4MB5A 1G1YA 3NYDA 2CIPA 2ZX5A 3QHMA 4W5UA 3CMGA 4J3WA 1UA7A 4AZCB 4IPLA 1IZJA 1NM9A 3B9EA 5CG0A 2ZIDA 4GQQA 1XCXA 1HJQA 4ACZA 1PIFA 4CD7A 4JKMA 2WB5A 3QOMA 3LPPA 1V6XA 1NP2A 1KQYA 1NOUA 2FDMA 3SUWA 4H8UA 1EDQA 1M7XA 1SFSA 4MDOA 1DWFM 3OLDA 2UY5A 3ZSSA 2DPEA 2WVTA 2J62A 4E8DA 5AC5A 1QI4A 4J7RA 1HVXA 3SUTA 2XWDA 1B1YA 3LPGA 2GVYA 4A3HA 5BXSA 4U2ZA 3W82A 1VAHA 1DWHM 5DEZA 4BQ2A 3W37A 3VGFA 2AMGA 1OIMA 2OWWA 2YOCA 4WIWA 3WEZA 1XRVA 3UG5A 1MXGA 4HZ6A 3K8MA 4WF7A 5A94A 2XSAA 3W4RA 4KGLA 5E6YA 2D0FA 3WUGA 1KBBA 4PMZA 2G3IA 4UFJA 1HKJA 5FCZA 3T2PA 4OBSA 4J3UA 1UUQA 2BXYA 3G6MA 1JZ2A 1OINA 4TTUA 4JCLA 3WFZA 3ARPA 1W1TA 2JF6A 1V3IA 4WJXA 2G4FA 3FN9A 4MNJA 4WLCA 1W91A 4YHGA 1EXPA 2WMGA 2J79A 3T09A 3MSGA 1E6QM 3UG3A 3CPUA 2ZUTA 3K8KA 3ARSA 2J8GA 4QLKA 1UQZA 2UY4A 2EO7A 1V0NA 2ZWZA 4X0NA 2NSXA 2ZX8A 2CXGA 1JYWA 1QNQA 1KBKA 1XSJA 1G5AA 5KZ6A 2VOTA 3WNOA 3BXWA 5A8PA 5A6JA 5CLTA 1CXIA 1BYCA 2ZWYA 1WZAA 3ARXA 4NRSA 2BV9A 3VD7A 4AD4A 3K4AA 5DF0A 2VRJA 3BSHA 1QVBA 4E8CA 1B90A 3WELA 4NF7A 3CBWA 3VMPA 1W1VA 1ISXA 3O6AA 1TUXA 2WW5A 2PWDA 1D3CA 3WL1A 2BY3A 1UR2A 4CD6A 3CGTA 2GSJA 2DSUA 3NSXA 3U7VA 2D2OA 3GXIA 3KL5A 4R27A 4F79A 1GUVA 2IXVA 3BLKA 2EPOA 1MW1A 2JE8A 2FHCA 3SEPA 3OGVA 3CZLA 1RPKA 1WAWA 1BGGA 2ZUSA 2UY3A 4KMQA 1KWKA 4PMUA 1UD4A 4LYQA 5A6SA 2GDVA 2WBGA 3OBAA 3TTYA 4AD2A 1VFUA 2PWHA 1KR0A 3ZM8A 1ZBKA 4KWUA 2E40A 3MMWA 1MW2A 1GOQA 5BWFA 4D1IA 3NSMA 2ZUNA 5D8ZA 3ZOAA 3OZOA 2GK1A 1KB3A 1CXHA 2WMHA 2ZUUA 1V0KA 3PZGA 4D6FA 3PZQA 1WCGA 5ECUA 2DIEA 3ZT6A 2DSVA 5HPOA 2CYGA 1UH2A 3W24A 3T0BA 4M1RA 4DUXA 1TG7A 3VIKA 2GDUA 3AMLA 4CN6A 5CGTA 5LA0A 3TP4A 1D2KA 4HU8A 1B31A 1H3GA 1UHVA 1PX8A 4X0VA 4Z2HA 4UOJA 3WUFA 3TTQA 1BF2A 1J01A 1OSEA 4EK7A 1C8YA 1E9LA 4TTGA 3AIVA 3WF0A 5A2CA 1XH2A 2ZUWA 1WZLA 3SUUA 4W88A 3K8LA 3BAIA 5DT7A 1ISYA 3T0AA 1DP0A 3EYPA 3WSUA 4PCTA 4JFSA 4TX8A 2O9OA 4DWSD 2XYLA 2JEPA 2VVNA 3THCA 3POCA 1VIWA 1WB0A 1JZ8A 1N82A 2E9MA 1CLVA 1JGIA 3OA5A 4U5IA 3VM5A 4CD4A 1ESWA 3I3EA 1JNEA 5FD0A 3IK2A 4AMCA 2CETA 1QI5A 1BG4A 3VVGA 4WKAA 2QV4A 3PZTA 1FH7A 4BF7A 2JALA 1JXJA 1TA3A 3BAJA 5I6SA 1CEOA 1M01A 1W9VA 1SMDA 4W93A 4AZ7A 1UWIA 4CU8A 3KL3A 1CNVA 4LGXA 2FHBA 3TONA 5HNNA 4AZ5A 5A8QA 3EDFA 2YKKA 1KXTA 1CIUA 3VD3A 3ZSTA 1B3XA 1JI2A 1H5VA 2ZXAA 5CXPA 1PBGA 2E3ZA 4JHOA 1OB0A 1VFOA 1J10A 4W89A 4PBGA 3L4VA 1W9XA 3AIWA 4H7VA 3SCPA 2CBUA 3WH7A 2W67A 2VNCA 1QOXA 1E0VA 2A3BA 3MSDA 4H8VA 1SYTA 3A3HA 3F5KA 3PZNA 4P8VA 1E4IA 2PI6A 1JZ6A 1BGAA 3WDRA 5GNYA 3GYCA 1E3XA 3MUZ1 2G3JA 1NP0A 1W32A 5A6BD 7A3HA 3PZIA 1VF8A 1X1NA 1HXJA 4UQ9A 1NWRA 4PUEA 3W6LA 4GI8A 1G94A 3S2CA 4NI3A 2VZOA 1JL8A 2V3GA 3APGA 4AZBA 1HT6A 2F61A 1GQKA 1VEPA 4E2OA 3GNPA 1HJXA 2BVDA 4FF5A 1BPLB 4J3TA 2CNCA 4D72A 1OM0A 4A4AA 4IPNB 3I3DA 2VJXA 1M53A 1JDCA 1ZU8A 4TXEA 5I2UA 4M29A 4UNIA 3VGHA 1JAKA 1FFQA 4PTMA 3ZT5A 2X09A 1XD0A 4J27A 3PZVA 4ZEPA 1MWOA 5A6BA 1QI0A 3WQVA 1NOFA 4DWSC 2J7GA 1CENA 1Z32X 3VX0A 5F7UA 4DUVA 3AHXA 1XH0A 3LPOA 4QAWA 1FHLA 1GONA 3CUFA 5D9OA 5ABFB 4MAZA 1QBBA 4FK9A 1W1PA 5CPTA 2XGBA 2IUZA 2VRKA 4HA3A 3VO0A 3N17A 2YL5A 1HNYA 1JDDA 1B2YA 1JDAA 2XVGA 2W4XA 2EPNA 3WL0A 2QHAA 2WXDM 1GNXA 1J0JA 5E9AA 7TAAA 2WVVB 4CVUA 5I77A 1X6NA 4F66A 3N1AA 3VILA 2B31A 4QDMA 1ISWA 3N9KA 1WDQA 1EOKA 3GBEA 5I0DA 3WQ8A 3M6DA 1CWYA 1JF6A 2J47A 1GCYA 5A6KA 2MANA 1VJSA 3MU7A 4UFMA 1W3KA 1W9DM 4LPCA 2D20A 4J28A 4HOZA 3CIVA 2CCRA 3VIJA 4CD5A 1JIBA 1W2PA 2XFRA 2VUYA 2VZSA 3VNYA 4PMDA 5D4YA 3ZJ8A 3AHVA 4EKJA 3HU7A 1PJ9A 1GJUA 3IAQA 4AY1A 4UZSA 2VCAA 4GQRA 1R7AA 4D6CA 4JKKA 1O7AA 2FH6A 3WMSA 5I3DA 1YHTA 1J0HA 3AROA 3OG2A 4FLQA 2BS9A 4HOXA 3FHAA 1EQCA 1JF5A 4JHZA 1CTNA 2J7FA 2WCGA 1UWTA 2WK2A 1V02E 4J3SA 3POHA 2WMFA 4MNLA 1HKKA 2CERA 1ECEA 1DWJM 1W3LA 4AD3A 1CYGA 1VEMA 5JBFA 4ZXLA 2W66A 2D1ZA 1J0IA 3MANA 4ACZB 3F5LA 3CZ8A 3RMEA 4GO8A 5CJ5A 1NARA 2CHNA 3IJ7A 1FH8A 1KGXA 2VX4A 1E40A 1JYNA 4PN2A 2EBNA 2V5DA 4QP0A 4AD5A 1HF6A 2A3HA 4XX6A 3WNNA 1LL4A 1UQYA 5A2AA 1XD1A 3AIEA 3WQ4A 3N12A 4P7NA 2DSKA 4MAVA 1UOKA 4HMDA 1EDGA 2OYLA 3BCFA 1V08A 1B30A 2BVTA 2DQXA 1Q6DA 2V3DA 3WDIA 5LYRA 3WF4A 3AOFA 1GPFA 3SCVA 1VB9A 2WVSA 2EEXA 1LF1A 2VCCA 1HJSA 1CPUA 3OGSA 1WZMA 1PX4A 4W8BA 4AZ6A 4X9YA 3ARQA 3DC0A 5JUVA 5D8WA 2XUCA 5I23A 1S46A 3WIJA 2J4GA 5CPQA 4AYSA 2PB1A 4YPJA 1PEZA 1TVPA 3L4TA 1KCLA 4P7QA 5M5DA 1UZ1A 3W29A 4D6EA 4IISA 4AD1A 3A4WA 3QHNA 4NSBA 1UWSA 3GDBA 4PMOA 2PBOA 3RCNA 1TE1A 2PF0A 5CGMA 1JZ7A 5A69A 3WEOA 1GQLA 4AIEA 2WHJA 1ZB5A 4GZEA 2WAGA 2QPUA 1JD9A 5GPRA 4B9YA 2E4TA 1UZ4A 2EJ1A 4LXFA 8A3HA 1OT2A 1WNOA 1E6PA 2PWFA 3GM8A 4M8UA 5HOSA 1KGWA 2CBJA 1IZKA 3UCQA 2BY1A 3MS8A 1C7TA 2J7CA 1H2JA 4F9DA 1LG1A 3F4VA 3ZIZA 4B3KA 1I1WA 1W3HA 2VO5A 4PTVA 4UFHA 3ZT7A 5A95A 7CGTA 3L4UA 5CSUA 1OGSA 3ZQ9A 3WF2A 3CZKA 3IJ8A 4P8UA 5IXEA 3PZUA 2YA0A 4XB3A 3VIIA 4B9ZA 2WLYA 2FH8A 3AS1A 5A3HA 4AW7A 1EDTA 4JL1A 3ZR6A 1CGUA 2VTFA 1F4HA 5LA1A 2HISA 5C71A 4XZWA 3W0KA 3BAKA 1KXHA 2Y4SA 4GINA 2V3FA 4AEEA 4N42A 2DH3A 3WBAA 5DO8A 4LQ1A 1JI1A 4KRTA 5BROA 2J78A 3MMUA 2DT1A 3N13A 2XWEA 1HKMA 3ZR5A 1MVYA 1NWSA 1QBAA 3AYRA 5HBFA 5AC4A 1RD6A 4HPHA 3PN8A 3VIOA 1AQMA 5E70A 3BAWA 2JIEA 1V6VA 1E1FA 1VJZA 1UD5A 1CBGA 3BGAA 2WC7A 1UKSA 3EMCA 4HMCA 1XSKA 3A4XA 4MJ2A 4PMRA 3E1F1 5A2BA 4LYPA 2C0HA 4HTYA 1UD3A 1NH6A 2DT0A 3AMDA 2W61A 1H11A 1U33A 8CGTA 1R7OA 1E70M 1UWRA 3VUPA 1VFMA 1PZ2A 1Q6CA 3L4XA 4UOQA 5I79A 4ZENA 2WMKA 3VGDA 3ZO9A 3VM7A 2BXZA 4GXPA 3CMJA 4AWEA 2WHMA 4WKFA 3VINA 3WNKA 1JFHA 1UH3A 5AYBA 4AIOA 2J8FA 1E5NA 2Z1KA 3O9NA 1BVZA 2VC9A 2O9PA 4W7WA 2ZX9A 4U2YA 4ZXOA 4XV0A 2YJQA 3WH8A 4H04A 3NUKA 3CLWA 1RP8A 1HJWA 4GKLA 5IFPA 1C92A 4PCSA 3KE0A 1KXQA 3N18A 4XUYA 5JBEA 2DH2A 3ARZA 4TUFA 4S3KA 3RDKA 5E0FA 3CZEA 1UYQA 1L8NA 4Z2LA 4S3JA 4CN1A 1GHRA 2BHZA 3FAWA 3AMKA 2WCSA 1BG9A 1MQPA 3ARUA 1ZBVA 3SCSA 3WH6A 5ABGA 3PZ9A 4V2XA 3AS3A 2CKRA 1ZS2A 2D22A 3AZTA 1G0CA 4UFLA 3EDJA 3WDHA 3AIUA 1TA3B 2QMJA 1CECA 2CEQA 3DECA 3CTTA 2OYKA 4AZHA 2WANA 4GIAA 4D6IA 5FIPA 1V3LA 2Q8XA 5EB8A 5BXPA 1E43A 4JFTA 5I5RA 2V5CA 2XIIA 3AXHA 4MTVA 4HZ7A 2VCBA 3AIRA 3TTSA 3SCWA 1QNPA 1BLIA 1CZ1A 1W3JA 5IDIA 3W6MA 2WZHA 3GBDA 1M04A 4DWSB 1PIGA 3MUIA 1H09A 4EANA 1H0IA 3THDA 1BQCA 2D3LA 1OT1A 3L4YA 6CGTA 2QF8A 2UWFA 5M03A 5A6AA 1LWJA 3ARRA 4HMEA 1ZL1A 1X6LA 1YQ2A 2J7HA 4L4OA 2QPSA 3A4AA 4F8XA 4AEFA 4B15A 1K9TA 3GNRA 3VIPA 2VL4A 2DT2A 4AD0A 2ZXDA 1J11A 2NT1A 1EOMA 2YBUA 3WQ5A 4OBRA 3CHFA 4MB1A 2V38A 1EGZA 4P8WA 2NW0A 2WVUA 2V3EA 3ZMRA 4W8LA 1DEDA 4UQCA 1E4MM 1R8LA 4TOQA 3SUVA 5ABEA 1D7FA 1I75A 1U30A 4BS0A 1PAMA 1FH9A 2X2YA 2WYSA 4ATLA 1P6WA 2YBTA 1MQQA 1TR1A 4PEEA 1KGUA 1OGGA 4D6HA 4UOZA 3VU2A 1HP5A 1E72M 4YN5A 2WZIA 2XIBA 4UCFA 2VX7A 4AZIA 1ZBWA 2PWEA 2EQDA 4UQEA 1HL9A 2JF7A 2J77A 2GUYA 4YHEA 2FHFA 1FA2A 3SCQA 2W92A 1H49A 1C8XA 1F4AA 1K6AA 4U31A 1BHGA 1GOWA 3LPFA 3NJ3A 2IXUA 1UR9A 3SCTA 5IFTA 1US2A 1KFWA 3K46A 3NDYA 4FLOA 2XPKA 3DYMA 1LLOA 1R87A 2WCAA 3RILA 3PHAA 3WH5A 2GFTA 4UTFA 3N04A 3KEHA 2YLAA 4HA4A 5JBDA 4HOWA 2YA2A 1BSIA 1CXKA 3B9AA 2ZUVA 3VX1A 3RM9A 3WD0A 1MFVA 1OIFA 3G6LA 1V0MA 3GXFA 1W9PA 3S6TA 4AISA 3UESA 1JFXA 1E3ZA 2WWCA 3AFBA 1CGWA 1KXVA 3TTOA 4KRUA 2GJXB 5A1AA 1GVIA 1BYDA 1ZJBA 1OWQA 2YDRA 2WHKA 3WEMA 2OWCA 4D6JA 2WC4A 3CUGA 3ALGA 4RE3A 1XV8A 4IM4A 1R85A 1H0GA 2BVYA 2Y24A 2VZVA 3BAXA 1QW9A 3TOPA 2DSZA 4JFVA 3DYPA 1FP8A 1LL6A 1UKQA 4D6GA 3AIBA 1JZ5A 1AQHA 3T2QA 3M7SA 3FW6A 1HJVA 3WF3A 2YDSA 3B8SA 4QCEA 4D71A 4BQ3A 1HX0A 2A3EA 4DM1A 4HPGA 3BSGA 3HJEA 3QGVA 3VMNA 2O92A 1H41A 5AY7A 1R86A 1B3YA 1XCWA 4GZJA 1GJWA 2ZX7A 1M03A 3FHQA 1U2YA 2XG9A 4BCEA 2G3MA 4H8HA 1O6IA 4ZE4A 4JCMA 4GZIA 1GW1A 2A3AA 3W28A 1FOBA 4M80A 4OOZA 1JXKA 4W7UA 3CUJA 2E8ZA 4BA0A 1QW8A 4P8XA 2FGLA 4MPKA 1H4PA 2D0GA 4EE9A 5C70A 1VRXA 1BAGA 3VIFA 4CUCA 1WDPA 3N15A 1V3KA 1C3FA 1BYBA 1QPKA 5I24A 4PSRA 3NSNA 5FOOA 4AZGA 1J18A 3DHUA 3AMCA 5BRPA 4V28A 3N11A 4PUDA 2WVVA 1MYRA 3U5YA 1OGBA 1NWUA 2OSYA 3WFLA 5GNZA 5CQ1A 1VBRA 3T2OA 2CBIA 1C90A 3PBGA 3FNDA 3VGEA 5BYWA 3KWXA 4CGTA 3T08A 2HVMA 1J9YA 4PMYA 1C8QA 4XZBA 1WDSA 3SCUA 1HL8A 3GXMA 3AS0A 2XGIA 2OLHA 4UZUA 1LL7A 4RE2A 3EMZA 1US3A 2DEPA 4Q22A 5E09A 4BZYA 1KR1A 4R5EA 2X1IA 2C8NA 4WK9A 1E71M 1Q4NX 4UQBA 2GJPA 1TVNA 3WD3A 4V27A 3L2LA 4EAMA 2XM2A 4MJ4A 2VI0A 3WF1A 4U3AA 4AC1X 3EDKA 1JAEA 3BMWA 3U57A 2WMIA 2D23A 3ECQA 2EXOA 4W84A 2JIWA 4UQDA 4CVWA 3MMDA 3KZSA 3VD4A 1PPIA 3CHCA 1ITCA 1WDRA 5CZKA 3FAXA 1MW0A 4Z2JA 1OCQA 1L0PA 3PZMA 4OZOA 1E15A 2YIHA 5A8OA 3EDEA 1HJUA 4C7FA 4JFUA 3UETA 1C7SA 3L4ZA 4Z2KA 2E9BA 1V03A 3L4WA 2D24A 4KH2A 4GI9A 4DM2A 1JG9A 3ALFA 1ZBCA 4H41A 2DIJA 6TAAA 4PYSA 1K9DA 2J7DA 5DFAA 3SCOA 1K9FA 3AI0A 6A3HA 4BQ5A 1CGVA 2WNWA 1J0YA 3D5HA 1QNRA 3VGGA 2A3CA 1J0ZA 4NZCA 5A8NA 1TCMA 3WNPA 3ZJKA 2G41A 2ZOXA 1FFRA 3AHZA 4GPNA 1LG2A 3A6OA 1RH9A 2DDXA 1DWGM 1VBUA 3OLIA 3OIHA 3WH9A 1Q6FA 3JUGA 1CGYA 3A47A 4CKQA 4U5KA 5KEZA 1OD0A 3SCRA 3MUAA 3VD9A 4W86A 1BFNA 3BC9A 4AZCA 3SUSA 2BFGA 3VTRA 4GI6A 1E6ZA 2VRQA 5GQBA 3HMCA 1UKOA 2VURA 2WSPA 4W7VA 4P7LA 3AICA 1QI2A 4PMXA 1TFVA 3WBEA 1UD8A 5A8MA 4Q7NA 2XM1A 5IHSA 5GNXA 3RO8A 1DTUA 2F2HA 1G01A 3WQ6A 3NCOA 2WHLA 3AQUA 4JKLA 1E4LA 4M82A 1V02A 1E73M 3VDCA 3VDAA 2X8RA 2JEQA 2CITA 2PC8A 1CXLA 3BAYA 1QNOA 2O9RA 3AIQA 2ZICA 4BQ4A 2VZTA 3VIGA 4LX4A 3EDDA 4FLRA 1XGZA 1ZJAA 1UA3A 1AVAA 2J74A 1J12A 4UR9A 1XSIA 1FP9A 4CCCA 3AZRA 4ZE5A 2OSXA 3WUBA 1B3VA 1EQPA 2XVNA 4FLSA 2GK1B 2NT0A 3PZOA 1OBAA 3IAPA 3WENA 2C7FA 5EBAA 3M07A 3AISA 1HP4A 1GZJA 4QLLA 2X05A 3U7BA 3PTQA 2WSKA 4GO9A 3GTNA 1MXDA 1V3MA 3W38A 3K1DA 4MDPA 2W62A 3VOCA 4CN4A 3OGRA 4OUEA 1QHOA 2VMFA 2CBVA 2WMJA 2PBGA 2PWGA 5M3WA 2J25A 2XSBA 5A6MA 4TVDA 3B9DA 2WC3A 1PX3A 1GOOA 3CZGA 2WPGA 1E6RA 1KCKA 2VT0A 1DWAM 1CDGA 1UR1A 3GZAA 1MW3A 2DGAA 1IT0A 3MUY1 4A3YA 3RPMA 5BRQA 2E0PA 1VENA 1WZKA 1E6SM 1JD7A 1UWUA 2CHOA 4H2CA 1BTCA 3WMCA 2X0YA 3BCDA 1GQJA 2CKSA 4ZFMA 3VPLA 1MQRA 5DMYA 2E9LA 1KWGA 1GQIA 1W1YA 2RGMA 4PRWA 3II1A 1K9EA 1A47A 3MKKA 1WE5A 1SR0A 3FY1A 3AJ7A 1JZ3A 3WKZA 1CLXA 4IUGA 1IV8A 1B3ZA 2XJ7A 5CSYA 4D1JA 1MFUA 3UERA 3EMQA 3CUHA 2J7BA 5D9PA 2XVPA 3PTMA 4W5ZA 3ARWA 1NQ6A 4MNKA 4P7OA 4CU6A 3MO4A 2BY2A 3W27A 2WM0A 1GOIA 3VGBA 4E4PA 3RIKA 4ML4A 1E6NA 1CGXA 4WSJA 1E1EA 1UKPA 3EBVA 2XVLA 3CUIA 4URIA 1EH9A 3M46A 1ITXA 1JYVA 2XHYA 1H1NA 2ZXQA 3UG4A 2VX5A 4W8AA 3U5UA 1B0IA 1W9BM 2OYMA 2WKGA 4P7RA 3OB8A 3UEQA 1JYXA 1ODUA 2ZXBA 2CPUA 3IANA 2EPKX 5JIPA 4HU0A 3WDJA 2VZUA 3MV01 1ODZA 3IJ9A 5ABHA 2FGZA 1XYFA 2F8QA 1V0LA 4HZ8A 3SURA 4M81A 3DYOA 2YLLA 1V6YA 1V6UA 1WPCA 2QLYA 4WSKA 4TX6A 3WD1A 1UH4A 2VX6A 1TMQA 3AXXA 3CH9A 4M24A 1V6WA 3VKKA 3WUEA 3J7HA 3RM8A 4ACYA 3AS2A 1E6XM 2YL6A 2DSWA 2TAAA 5C8BB 3DHPA 2GJRA 3UR8A 1C93A 3WN6A 5BXTA 1BYAA 4J3VA 4HA1A 4PTXA 2J7EA 3GH4A 3QOKA 2VQTA 3QHOA 3LMYA 2WBKA 2ZX6A 2OSWA 4ATDA 4CU7A 2YDQA 3HN3A 2BHUA 3VIHA 3CHDA 4U3CA 4UFKA 3W53A 4DWSA 1A3HA 5CLWA 5FL0A 1EO7A 1E56A 2W63A 1XHGA 4PTWA 4D6DA 4MB3A 1E5JA 1VEOA 2XTKA 1B3WA 3T0DA 1C91A 2XVKA 4OKDA 1Q6GA 2JFEX 1W9UA 3FXYA 5DT5A 1QNSA 1NOWA 2EPLX 3WDPP 1GOMA 1GORA 5BCAA 2BNJA 3TA9A 1TZ7A 3OLEA 1JNDA 3AHYA 4K68A 2W5FA 1QHZA 2Z1SA 5A6LA 2Y8VA 2D0HA 3AHTA 3AMGA 3D3AA 3I3BA 2ESCA 4UFIA 2Y2WA 3VDHA 5TD4A 3WD2A 1HN1A 1E4NA 3WQWA 2ZUMA 1WKYA 3GXDA 4KGJA 1CXEA 4DUWA 3NIYA 1PZ3A 1RP9A 4Z2GA 3CO4A 1WO2A 4AXNA 4CCEA 1LJYA 4W87A 3BMVA 1FHDA 4Z2IA 4JL2A 4MB4A 5LA2A 2XFYA 3WNMA 4QLJA 3O2LA 3WDQA 3GH7A 1W2VA 1EHNA 1EHAA 2X0HA 4MADA 1UR4A 4NRRA 4QCFA 5HDRA 3SIMA 1V3HA 3KL0A 4JAWA 5BXRA 2VQUA 5JIWA
chains in the Genus database with same CATH superfamily
3N2TA 1I8JA 2QMKA 2PWUA 5I78A 2UY2A 3RJYA 4P2VA 1Y7VA 4HNOA 3TJ4A 4CCDA 3L2MA 4PSPA 2Q3RA 2EG7A 3T44A 3PR2A 3DERA 3MVIA 5FAJA 4LUTA 3BLPX 5IHRA 4LYRA 1SZFA 3VA8A 1KQZA 4U33A 4ZQCA 1TCDA 1A80A 4M6QA 1W31A 5BOOA 4HP5A 3KTXA 2GUBA 3VNZA 1Y5XA 3LS9A 4O13A 1B9ZA 1MSSA 3OZPA 4U10A 1TYGA 2P8BA 1AMYA 1XYBA 3W2LA 1QMLA 2OWXA 4PMNA 1XLDA 3UCCA 2V0TA 3GVGA 1HGWA 1E0XA 4OE7A 3BICA 4JIEA 1VPQA 1ADOA 1MDLA 1X39A 1QI3A 4YTRA 1BD0A 3C3UA 3VDBA 4O52A 4N0RA 3OW1A 4DJEA 5D09A 3A24A 4A3UA 3C0JA 3UZJA 4WY0A 4J3XA 3ABXA 3CEUA 3UNTA 3D6NA 2VOMA 1SZGA 2Y8KA 4M56A 3VIMA 1J79A 3NDZA 5HPCA 5AHEA 4N9BA 2VVSA 5FJIA 1LQ0A 4RL3A 3RX3A 1XIFA 1JQVA 2FPTA 5E0KA 5HWNA 3UD6A 4G7EA 4DPQA 4ZQNA 1PKYA 5G2WA 2EPHA 3FKKA 4AY8A 2FKPA 4C5YA 2G3NA 3W26A 1R3QA 3RJXA 2PLJA 4A2SA 3PVFA 3W2MA 3R43A 1RY0A 4NZJA 1ONRA 4IFRA 4AIUA 4GNJA 1N8WA 2HJPA 1F5ZA 2QCDA 3HPAA 3G1RA 3A3XA 1IWPA 4J9JA 5AYIA 4OJYA 1KKOA 3QH2A 1UB3A 5FF3A 1XPGA 4AQLA 1Y65A 4UCGA 3GAYA 2CIPA 4NJKA 1J5TA 4W5UA 2MUCA 1UA7A 1EWDA 1XIDA 4PEKA 3W1UA 2ZIDA 5TIMA 2Z29A 1PIFA 1SM9A 4EPKA 4CD7A 2GSHA 3F7JA 4S3DA 3QOMA 4A2RA 4H8UA 3V1HA 1M7XA 1SFSA 3LCWA 4X3ZA 1UZHA 3P62A 5LHFA 1OK6A 1UBSA 3H2FA 1TPC1 1J2WA 1FWWA 2E5BA 2J62A 1QI4A 1ZAIA 1J2BA 3D46A 4QSFA 5T26A 4N7QA 4ROQA 3SUTA 2GVYA 3EOEA 4ZO6A 3KVKA 1ADDA 5DEZA 2IPFA 3W37A 3C61A 1FUYA 2VHLA 2AMGA 4HZMA 4WIWA 4J40A 2YB4A 3UG5A 1P7TB 3GU2A 3Q65A 2DZTA 3K8MA 3QMTA 2XSAA 4B5UA 5BU6A 4PMZA 4AVOA 5FCZA 1QT1A 4GMEA 2G3FA 4O10A 3G6MA 2VD8A 4DBWA 1LT8A 1I0BA 3DENA 4L64A 4DN1A 1V3IA 1F6PA 3TE9A 3EWCA 3MSGA 3CPUA 3V16A 2J8GA 2VDHA 4QLKA 5LHEA 1PIIA 4KWSA 3OP2A 1LM1A 2UY4A 2EO7A 2ANUA 4X0NA 2Y5SA 3BDKA 1QNQA 1XSJA 4ADSA 1G5AA 4FNPA 4PTNA 5KZ6A 2VOTA 3WNOA 3GTHA 3BK0A 1FCUA 3ARXA 4AD4A 5DF0A 3WELA 2R1NA 1D8WA 1T5AA 4IH3A 1JULA 1W1VA 3AC0A 4AX6A 3DN5A 1NY1A 4ML9A 3DX5A 4J3ZA 1TUXA 3O6AA 4DIAA 1YX1A 2CLFA 2WW5A 2PWDA 1D3CA 1SW3A 3PG8A 2BY3A 1UR2A 2JKAA 1TPVA 2GSJA 5HNUA 3GXIA 3C52A 3PTDA 4HK7A 1TPEA 4IWWA 4EPBC 3R0DA 3BLKA 4MVAA 2JE8A 1XLCA 4QG8A 1ZAHA 1WOAA 5HQLA 1BGGA 1S5MA 2UY3A 3N2CA 1KWKA 1P4CA 2HS6A 3EWZA 4LYQA 5A6SA 2WBGA 3TTYA 4C6JA 4AFYA 3BURA 3GXNA 1W5PA 3S9IA 3RF9A 4KCWA 3QM3A 1QK0A 3MMWA 1MW2A 4QAIA 1FWGC 1G7UA 5BWFA 2ZUNA 3LLFA 4ZOBA 3PNZA 4EWND 3KVJA 1DIEA 4S38A 2NWRA 4DNHA 3KFTA 4D6FA 3PZQA 2P10A 3ZT6A 2DSVA 5HPOA 1R47A 1XP3A 2PDPA 1ZCOA 5JH1A 2GDUA 3AMLA 4H9UA 1SZEA 3LHVA 1TB3A 1B31A 1PVNA 5HULA 4QSHA 4C6PA 2Q8LA 5REQA 1AL7A 3BLLA 3TTQA 1OSEA 3WF0A 1M9HA 2HROA 5A2CA 5D2YA 3C2FA 2P76A 1Q6RA 3P60A 4PCTA 4HBKA 3V4BA 1W3NA 2HPIA 4YTUA 2IKHA 8TIMA 3POCA 1VIWA 1WB0A 2DW6A 2EJAA 1U1UA 4U5IA 1QATA 2QAFA 1ESWA 2ZRUA 5I3FA 1T8XA 1DQXA 4IOTA 4AMCA 1QI5A 4KEZA 3VVGA 2QV4A 3PZTA 4WDTA 5FEPA 2JALA 3N25A 1AW2A 2AGKA 3SADA 1DXIA 2FMNA 2GQAA 4FHAA 4LUYA 2PDNA 1PHQA 1DE5A 4V15A 3VC6A 1W9VA 4W93A 4CU8A 4DBEA 1AZ2A 1XS2A 4LGXA 3W2UA 3ABOA 2PP0A 3TONA 1UPPA 2JKEA 2HQAA 1ZY9A 2DP3A 1CIUA 3VD3A 1A5MC 4CEUC 1I2QA 2WNNA 1JI2A 4HNCA 2Y0FA 4IPIA 2GWNA 4W89A 3HPSA 1YNQA 4FX8A 5DMMA 3N19B 1DJYA 3SCPA 4ENLA 2W67A 4IQEA 4L5ZA 1E0VA 3PM6A 4QM1A 4LANA 3MSDA 4H8VA 3F5KA 1SJCA 1JZ6A 3F03K 1U83A 3ABRA 3LU2A 3GYCA 4HU3A 3IUHA 4RKAA 3M43A 2QUMA 3PSVA 2L5HA 1FDYA 1VF8A 1HXJA 1XI3A 4HVXA 1OX5A 1VYRA 1MUMA 3QTPA 4FXRA 3HG3A 2OPJA 4R9OA 3WK2A 4F0LA 3KBVA 3SJ3A 5AOUA 3S6OA 2W3ZA 4GVGA 2V3GA 5DRCA 4GCXA 1UROA 1VEPA 1W1ZA 4DYEA 4WUIA 4BK9A 3B4YA 2P50A 1LTDA 1UZDA 5TBOA 1TWDA 3ZZ1A 4QJ3B 1M53A 5I2UA 5DMLA 5AHIA 1Q6QA 1JAKA 3CK5A 4GJ1A 1KCXA 1SW7A 3MTWA 4FZIA 4J27A 3PZVA 1MWOA 1LQAA 4ZGYA 4O1AA 1QI0A 2QCFA 1CENA 1Z32X 4DXXA 2HBVA 2OZ3A 3TN5A 3BTNA 2NUXA 1YTKA 1P43A 3R13A 4KRZA 3WO8A 5ABFB 2DZVA 1YE4A 2CLOA 2XGBA 4HA3A 4E3TA 2WSQA 1HNYA 1R2SA 1XG4A 2XVGA 4LBSA 3WL0A 2QHAA 4DJED 4RNJA 4XD5A 5TQLA 2JK2A 4JY8A 2O7QA 1L8PA 2QUVA 2WVVB 3ANVA 4V33A 3TZFA 5DCEA 3CT2A 3W02A 1AJ2A 3LY0A 2C1IA 3NZPA 4EAYA 4IXHA 1XINA 4FX6M 3C2EA 3N3MA 1EUAA 2RKXA 4RXGA 1ITQA 5IBXA 2D20A 3MZNA 5EMKA 3R79A 4XZMX 3CIVA 3EWBX 4RZ6A 1L6WA 3GHTA 1FX6A 4NZ4A 3NL6A 5D4YA 3ZJ8A 1WOBA 1QAPA 5LNWA 3CL6A 3QZEA 3HU7A 4R7JA 2OZ8A 1PJ9A 2Z2BA 1GJUA 4PC8A 1THFD 4AY1A 3FA4A 3UPMA 4GQRA 3TOYA 3IPWA 3TLQA 4QG9A 4F0SA 1UP0A 3DHDA 1O7AA 3O3RA 1VZWA 4NG3A 5KITA 1VFSA 3UA4A 1YHTA 2PRLA 3L68A 3TQKA 4GUJA 4DZAA 1EQCA 4Z1DA 2R9RA 4ZSUA 1UASA 4IQJA 1CTNA 4J3SA 1RCOB 3ZVIA 7PTDA 2XH2A 3WQCA 4AD3A 1SO5A 3P6LA 3ITVA 2WQPA 5JBFA 3P2VA 2W66A 4HHHA 4ACZB 4Z42C 3NURA 3MPGA 1Z42A 2V8ZA 3BJSA 1MEWA 4JNYA 1TPH1 3WFAA 4O1DA 2VX4A 3KX6A 4H6EA 4AD5A 6REQA 3UWQA 3AYVA 1MO0A 3EWYA 3PANA 1XD1A 1M65A 3UZYA 4LB3A 1R9XA 3GTFA 3EX3A 2PTXA 4K8GA 2VFIA 3RFAA 4C6KA 4ES4A 3M0HA 2BASA 1EDGA 4DJEC 3TSDA 3S5YA 2GUUA 1B30A 3H2CA 1HFBA 1H61A 3WF4A 3AOFA 4LV4A 1VB9A 2PCEA 3A13A 5CBJA 3NVDA 1HJSA 1VBJA 1CPUA 4RLIA 4YWSA 3OGSA 3H22A 4X9YA 3ARQA 4AX7A 3HZ3A 3THQA 3GIYA 4UR7A 1S46A 5XIMA 2PB1A 4NX0A 3FKRA 2GSEA 4HNLA 1PEZA 4CQ8A 3HQPA 3UFYA 4IISA 3VUSA 3QHNA 5K4XA 2FVLA 4DJDA 1B5TA 2A3LA 1GQLA 4GKTA 4DYKA 2ZZ3A 3B0PA 1XIEA 4B9YA 4FXJA 1I2PA 4Q7BA 1WNOA 3GM8A 2V82A 4UC5A 1DJWA 3NQBA 1ICPA 1C7TA 1H2JA 4F9DA 5KZDA 3S2JA 1OFEA 4PTVA 2O56A 3PFRA 4UUIA 1YKWA 3M0XA 2ACSA 3G1DA 3WF2A 3SSJA 2H3DA 1IIHA 2OOFA 5PTDA 2TMDA 5IXEA 3PZUA 2EHHA 5AC8A 3BLDA 1DIDA 4I5UA 3C2VA 2C14A 2NXGA 4AHQA 3IVTA 4B9ZA 2R1MA 4Z0JA 1FY6A 4AW7A 1KRAC 1EC7A 4JL1A 4A8IA 2BB0A 2ABAA 3WG6A 2VTFA 3W72A 3TVAA 3SRFA 5EGRA 3W0KA 3DGBA 5D03A 1K7XA 4AEEA 3WBAA 4KRTA 3MMUA 3N13A 3R58A 3DHFA 3EPMA 3ZR5A 1MVYA 1NWSA 1QBAA 1RD6A 1AQMA 2EF9A 2HMCA 1AK5A 2XIJA 5DANA 2ZZ7A 3BG9A 1FHUA 1UD5A 3BGAA 3GLCA 2WC7A 4QJ1A 4TV6A 1LT7A 1Z89A 2B81A 5DXXA 1D3GA 4HTYA 4AVNA 2ZZ4A 3U3HA 4Q4QA 1E70M 3IIOA 3A22A 2WV8A 4RZBA 3VM7A 2BXZA 2JBMA 3GXPA 3VINA 1CT5A 3GVWA 3PUGA 1Y5WA 1F9CA 4Z1AA 3O9NA 1K8ZA 4W7WA 4U2YA 3W1MA 2ALRA 4N02A 1S5NA 3WH8A 4H04A 4PRRA 2YCLA 1PKMA 1TPWA 4GCAA 4IG2B 3N18A 3JZUA 5JBEA 3WJZA 3BOXA 4O0ZA 3H26A 3QLDA 4WEVX 2ATMA 3CZEA 4ZB5A 4Z1CA 3BW4A 1ZLPA 4CQ9A 2BHZA 2WCSA 3SCSA 4KCUA 3PZ9A 2GVLA 2CKRA 2ZA3A 2Z1XA 3IIXA 2QMJA 2CEQA 2QYGA 2G97A 7REQA 4GIAA 5FIPA 3W7HA 1PB0A 3KOZA 5EB8A 3QRHA 3JR2A 3MVTA 3SCWA 1QNPA 2AMXA 2JQXA 3KCJA 2WZHA 2DVXA 5F4WA 1H09A 4FO4A 1EEXA 3WJXA 3WBYA 1GYMA 2D3LA 2H8ZA 4J35A 3L4YA 2UWFA 1KC7A 3QSRA 4L65A 3EWXA 3EXTA 5KZMA 1M68A 5HJYA 3SN1A 5FF4A 1X6LA 1R2RA 2QPSA 3A4AA 4IX0A 1HTIA 2J8TA 1K9TA 5EPDA 4XAZA 3G1XA 1YDVA 2DT2A 3SQMA 3LYEA 2PDMA 1J6OA 1P0EA 5AHFA 2NT1A 3W73A 3CHFA 3H7UA 2PUZA 3FGCA 3VABA 2BP1A 3JVAA 3NPWA 2YBVA 5DRIA 1E4MM 1TJ2A 1D7FA 3MBFA 2VC5A 2X2YA 3RX2A 2PPGA 1MQQA 1XQLA 2QT3A 3QN3A 3MQTA 3CH0A 4FSAA 1FCBA 4RUBA 1C29A 4YN5A 4HYRA 5LNUA 3GXTA 2EQDA 3NQGA 4MWAB 4UQEA 2JF7A 2J77A 2FHFA 5T9BG 4MKSA 1C8XA 3QR1A 4U31A 1BHGA 3LPFA 2H9AA 4IMFA 2IXUA 1UR9A 4MFEA 3EOUA 4A21A 2YCEA 5BZAA 5GJMA 3SN0A 3ZFHA 5EU9A 1R87A 1DXEA 3PHAA 3S6DA 3WH5A 4IMEA 2WKJA 1TPFA 3NNTA 3BWWA 4HA4A 4OQVA 4OV4A 4A8LA 4B5SA 3C2YA 3B9AA 1Q66A 1SZNA 4O4VA 2NQ9A 1NAL1 3PK7A 5HMEA 3W84A 3WQPA 1MFVA 3P74A 3G6LA 1V0MA 3LK6A 5T8GA 3S6TA 4AISA 3P80A 1E3ZA 3FLUA 1UP3A 2WWCA 5E93A 5HANA 2Y5JA 3I7SA 4PODA 3S9YA 5EBUA 1BYDA 4HU4A 1OWQA 2IPGA 2OWCA 4D6JA 2WC4A 4IM4A 3CAQA 5I3HA 3BUVA 3QLLA 3BAXA 3DFTA 4FNQA 4HK6A 1FP8A 2NLIA 4PUWA 1AQHA 3T2QA 3FW6A 2HXUA 4M6UA 4ZL1A 4QCEA 3W7PA 2A3EA 4UTTA 3HJEA 3VMNA 3V5OA 2H3BA 1H41A 1SJDA 1RK6A 3QF0A 4I9JA 1B3YA 3B9NA 2BTMA 2XG9A 1W1A1 1YRRA 1S3TC 4JEQA 4RJEA 1O6IA 3N2XA 3CUZA 4DQWA 5D30A 3VOJA 3NO3A 4LU0A 1EJRC 1K6WA 5AB3A 4P8XA 4QITA 1W56A 4MPKA 4FNTA 3NEVA 3IVSA 1XISA 4GUGA 4DX3A 3N14A 3UJ2A 4M0XA 4YS1A 3IIZA 1OQFA 1XDJA 3S1XA 1QPKA 3VNDA 1TRIA 3TUUA 3DOPA 3W2NA 4JHMA 4U4MA 4KEUA 4V28A 3MUCA 4IJBA 1NDVA 2WVVA 1MYRA 1X7FA 1DV7A 3U5YA 4Y2WA 2OSYA 3WFLA 2I9UA 2PLKA 2W27A 5GNZA 3GIQA 4RPQA 3LCXA 2AKZA 3SIZA 4HTBA 1XWYA 3T2OA 1L6YA 2IQ0A 4N4QA 4O53A 3PBGA 1DIOA 3VGEA 1BKSA 1A5BA 4DLFA 4RE0A 2Y7GA 3UGVA 2DZWA 3BW3A 1C8QA 1E0TA 4WSHA 2X30A 4O12A 3CQKA 3AS0A 2NQLA 5C6MA 1KRCC 3EMZA 1W6TA 2NUWA 4H4IA 2DEPA 4OECA 3NPUA 4R5EA 3LV5A 2X1IA 2AQOA 2DVTA 1QU4A 4XZHA 3GFXA 3GG8A 2QR6A 2XM2A 4JTCA 2VI0A 2R91A 1Q7ZA 4AVFA 4S39A 1FCQA 3TV8A 3ECQA 4UQDA 5HMDA 2CLMA 3MMDA 3GDLA 1FWJC 1WDRA 1T7LA 1MW0A 3UZ5A 3ZVHB 1ZZMA 2ZFAA 1HJUA 4C7FA 4GFIA 4XWUA 4RPPA 5AC6A 4Z2KA 1GVEA 4XKYA 5U7SA 5I3IA 1KV5A 2Y7FA 4RZ5A 1V03A 4IP7A 1S3HA 2QULA 3TW6A 1OC6A 3MP5A 1A49A 5DFAA 3ZLGA 4R85A 3CT7A 1VGAA 1K4HA 3O6CA 3AI0A 3LCLA 1PKLA 4BQ5A 2V81A 1CGVA 3GKAA 3CAWA 4PULA 5JMUA 3W85A 1DBTA 3FJLA 3DFSA 1R5YA 2C16A 1TCMA 4JIIX 1JRCA 2G41A 1FFRA 3QY6A 4H00A 1KKRA 4GPNA 4HJFA 3A6OA 4NY2A 3UXAA 1RD5A 2DDXA 1VBUA 3OLIA 3WH9A 3JUGA 1JRBA 2CWXA 3A47A 3H55A 4CKQA 4DI8A 1L9WA 4AZCA 2TYSA 1JDFA 4XD6A 1E6ZA 5GQBA 3L21A 1UKOA 3FVMA 3GR4A 4GYFA 2DQWA 4W7VA 3AICA 1XX1A 3SAZA 3F2CA 4ZTYA 4QQUA 3I7QA 2HDJA 3OEXA 3HG5A 1M1BA 2ZYFA 3W88A 5I06A 3T4CA 2FYMA 4JTQA 4JKLA 3BV4A 3PJUA 3LHZA 3N9RA 5AC7A 4O19A 4HPXA 1KFLA 4MKNA 2FLIA 4LVFA 3MWCA 3I7RA 1EJUC 4LX4A 4K3ZA 1JGMA 3KAOA 2OGYA 1Y8BA 4M6VA 4HNUA 3A12A 1Q8AA 2TSYA 3HB9A 1ZJAA 3O16A 4REQB 4WGXA 4UR9A 3AZRA 2OSXA 1B3VA 2XVNA 3WMLA 3NDOA 3TCSA 3CL7A 3MT1A 1REQB 2QJIA 3PZOA 2X05A 2QJGA 5AHNA 4IP5A 3IJDA 1MXDA 3W38A 4X22A 4QDWA 1A0DA 4GIRA 5DCBA 3TNBA 1EUNA 1N8FA 1PWLA 4HPJA 4NP7A 5FJPA 1DHPA 1Q85A 3LTSA 3P3BA 3JZEA 2O7SA 4C6NA 2ZVIA 1BRLA 2E0PA 4RR4A 4RDYA 3QPZA 2PWVA 4RNIA 2OEJA 1E6SM 3QJAA 3CWNA 4H2CA 2CLEA 2C18A 5H91A 2CZFA 4JTDA 1ZENA 4DF2A 3MP3A 1WE5A 4UTIA 1J93A 3HA1A 3AJ7A 4BHYA 4JBRA 3O0FA 3GTXA 4JTAA 4C6LA 1JDEA 3SO7A 1WQ5A 4OTKA 1VFHA 3CQJA 4AIBA 2Y63A 4I7VA 3ARWA 1P1XA 2BZNA 3W27A 4PCFA 2WM0A 3T07A 1GOIA 4HGXA 1E6NA 4L6HA 3N9SA 1E1EA 3W1QA 2VUNA 2XVLA 3CUIA 3LG3A 4URIA 1EH9A 5AYXA 2Z7GA 1TPDA 3W3OA 3U5UA 1YBQA 3OB8A 3GKFA 4XIAA 4HU0A 2VZUA 3MV01 4IG2A 5ABHA 3MKVA 3NO1A 1LBMA 4UMCA 3TIMA 3NFUA 2OKOA 4NNAA 1Q65A 3UNDA 2YLLA 1V6YA 5FESA 3W01A 3NM1A 2XU2A 3M5VA 4WSKA 4FOJA 3LHTA 4BWLC 4CLMA 1LP6A 3SFWA 3AXXA 1X6UA 3UGRA 4GYPA 1EF3A 1E6XM 2YL6A 2DSWA 2TAAA 1Z41A 4IL0A 3DHPA 2GJRA 5IM51 5CPNA 1C93A 3WN6A 3TC3A 4J3VA 1LLZA 1I60A 4HA1A 4E4UA 4PTXA 3QV7A 3ERPA 3CEPA 3QHOA 4GH3A 2OSWA 1UUMA 5HNRA 3VIHA 3CHDA 3HGRA 5HMFA 1A3HA 5FL0A 4D6DA 1VPXA 3T0DA 1FXQA 4OKDA 1ML1A 2ATSA 1TELA 2OOGA 4TX9A 4LFYA 2EPLX 3BW2A 4WDUA 1GOMA 1IWBA 5H8UA 5BCAA 2BNJA 4E4FA 1TZ7A 3OLEA 1JNDA 3AHYA 4LCRA 4K68A 1SO3A 2W5FA 5E5CA 3HV8A 4H8NA 1M7PA 3L7RA 4J2MA 1HN1A 3O6DA 2VC6A 3E2SA 4C6MA 1UJPA 3WLPA 2ZRXA 3H54A 3SM0A 3E0VA 4CCEA 1LJYA 4FNUA 2Y62A 1PTDA 2E6DA 1EJVC 4ZBCA 5LA2A 4MJZA 1KA9F 1FDJA 3W22A 3LZ3A 1W2VA 1EHAA 3P0WA 3CPGA 4DJFA 4JTJA 1EA9C 2D3NA 1UWQA 3W74A 1BWKA 3VNIA 2YL8A 3IV3A 4KWVA 3DUGA 3TC7A 1XH1A 3UY7A 5G1TA 4C7DA 1DWIM 1XLHA 1RZMA 4C6FA 2CW6A 2J27A 3V18A 4OBTA 3W1RA 3PTKA 4B3LA 1TO3A 3OU8A 4LUSB 3W7QA 2X41A 3L5LA 1PZ1A 1GKQA 4ADTA 3UR7A 3FVDA 4L80A 4CCZA 2PDIA 1DL3A 2WKLA 2HNHA 1DHKA 4FR6A 3YPIA 1D3HA 3W81A 3NEHA 3PJWA 2X42A 3WLMA 2WWDA 2VR5A 4W85A 1ZJHA 3GW0A 2PZNA 3NOEA 1EGVA 4K37A 1XYZA 1O5XA 4MNMA 2CESA 3QW3A 4QNEA 3H2MA 3ZJ7A 3AYSA 4UNKA 4A3QA 3SSZA 3WY1A 2YA1A 1QDSA 2HVOA 1NFBA 1Q7MA 3LV6A 1A5AA 4NX5A 4WXZA 3EAUA 3UT0A 1EA0A 2E8YA 3TYBA 3HGOA 1CGTA 2WZEA 4YLWA 3WD4A 3AUOA 1KV8A 1ZSXA 2QV5A 4GWEA 1UG6A 1K77A 3PB0A 2CFFA 3BCJA 2Z7KA 2A5HA 1UR0A 1E0WA 2YZ5A 1HKWA 5AVNA 4GVIA 3FYYA 3WLIA 4NU7A 1GHSA 1WBJA 4WDWA 1A50A 1RA5A 4ZQMA 1LDCA 4LVBA 3KHDA 1R2TA 4R7WA 1I1XA 4DAIA 5F1UA 1L2QA 2Q02A 5FEZA 4M51A 1OD8A 3KRBA 3IUDA 4JFWA 1BVNP 3ZJ6A 2AAMA 5K9DA 1QJWA 1AQ0A 1JCLA 2HZGA 1XIIA 1TJPA 3E2QA 5CPSA 1SO4A 1HVQA 1XC6A 1OYBA 3GH5A 2BHYA 3H8AA 2WLZA 1M41A 3AXMA 1VYSX 2QNEA 3VOIA 2ZX5A 4AF0B 4J3WA 5E9XA 3ENLA 4D8LA 1IZJA 1NM9A 5CG0A 1CCWB 4ZMGA 4GQQA 2GJNA 1HJQA 3TYEA 3V1PA 1KQYA 2FDMA 4LBUA 2QCNA 3KM8A 2GZXA 3LZ5A 5CJMA 2UY5A 3PJTA 2RDXA 4O1BA 2DPEA 3ABZA 3WLLA 5GJNA 2E5CA 3IV8A 5H1WA 1DJNA 3M4HA 4YCOA 2PRMA 1HVXA 3KRSA 2GDQA 1B1YA 3QY8A 3N4FA 1LRQA 4BQ2A 1P0KA 2F38A 2PURA 2OWWA 3W1PA 4YIWA 3U2EA 4N9EA 5E6YA 3WUGA 1F74A 1YNPA 4MHBA 4XVDA 4LYKA 5H6HA 4J3UA 1UUQA 1RY8A 1MDRA 4TTUA 4MYXA 1TPUA 4J5NA 4WLCA 5ECVA 3G18A 3PAJA 3RMJA 3UG3A 1B57A 1ZJIA 3ARSA 1EYWA 4HIBA 1E1CB 1P0DA 4BI7A 4QRNA 2HK0A 2NSXA 1ZP4A 2ZX8A 4R3UA 1EP1A 4N6EA 3H2OA 4ASTA 3BXWA 5A6JA 5CLTA 4KW2A 1FWBC 1FWAC 3K4AA 3G3DA 4KEMA 3KLLA 3ITLA 3VMPA 2PD9A 2ZQ0A 3QEZA 1ISXA 4OV9A 3LMZA 2INZA 3ZLHA 2G95A 1GVOA 3U7VA 4B90A 4XK2A 3L5AA 4F79A 1GUVA 1W1B1 1ME8A 1K8XA 3G2GA 2EPOA 1MW1A 3UA3A 3TZNA 3CZLA 1RPKA 1XLMA 1WAWA 4BI6A 1TR9A 5C5YA 4K7VA 3KBJA 1UIOA 4PMUA 1XLBA 2ACRA 3RN6A 5C55A 4BEQA 1H7XA 4Q8OA 2X1TA 2QVNA 3AU6A 2Z1BA 1KR0A 4JYDA 2EG6A 4REQA 1GOQA 2CZ5A 4WGHA 3NSMA 1JUBA 1SW0A 4BKNA 2Z1WA 3GR7A 1F3WA 3ZOAA 4O17A 1Y5VA 3SRHA 3ITYA 3PZGA 1L6FA 5ECUA 1UH2A 3T0BA 3M64A 4C60A 2J9YA 1TG7A 3VIKA 1JPMA 4CN6A 1O12A 4H1ZA 3IUIA 3TP4A 4HU8A 3LEPA 1F6YA 1TZZA 3BOFA 3U48A 4XKMA 3VZXA 4C1LA 4DAFA 2PCQA 1LBFA 2PDJA 4QXIA 4UOJA 3WUFA 3RLGA 1J01A 3BMXA 3RPTA 4QE1A 1XH2A 2ZUWA 1WZLA 1OFBA 1EBGA 1FKXA 3K8LA 3BAIA 1WDDA 3CQIA 3LUTA 1ISYA 3WSUA 4JFSA 1J96A 2C6QA 3D3FA 3SZ8A 2XYLA 3CWOX 3OJGA 1JZ8A 4O16A 2E9MA 1CLVA 1JGIA 2G0WA 3EKGA 3LI1A 3NM3A 3TK7A 4HYWA 2OEKA 3I3EA 1JNEA 2PE4A 4GBDA 3IK2A 4EXAA 3LM3A 1FH7A 3QMSA 4BF7A 1EL3A 1JXJA 1TA3A 1YE6A 5I6SA 1CEOA 5C7HA 1KBIA 4H9VA 4Q7IA 4O15A 3S5OA 1Q8JA 1QWGA 2XISA 3ATYA 5CPMA 1CNVA 5AN7A 2FHBA 5HNNA 1HUVA 1AD1A 4S3AA 4L6OA 1G7VA 2C91A 2FQIA 1H5VA 3BLIA 3VK5A 1QO5A 2V30A 1VFOA 1J10A 4HN8A 3EWDA 2D69A 3L4VA 4CNTA 4H7VA 1GT8A 3FJ6A 1GJPA 2UBPC 5T91A 1QOXA 2A3BA 4JEJA 1IXQA 2R1KA 2REQB 1BGAA 1EC8A 4NJJA 2CLIA 1QPQA 1G4EA 3MUZ1 4I8DA 2G3JA 5A6BD 4DJFD 1X1NA 4MOZA 3WLRA 4PFHA 3ORWA 4GI8A 3KOFA 1G94A 3S2CA 4F40A 4NI3A 3PF3A 2VZOA 2IPWA 4AZBA 1ZTVA 4LUTB 1YDNA 3WLQA 4XD4A 2BVDA 4FF5A 1BPLB 4J3TA 1XPYA 2ACQA 3NZRA 2CNCA 1FWTA 4WOQA 5BWAA 1N7KA 4A4AA 1GTHA 3HTWA 2VJXA 3H70A 4YYFA 4TXEA 2OXNA 1TQXA 3EPNA 2PFHA 4M29A 1VBHA 4KETA 4OU1A 3W1NA 3VX0A 4DUVA 4CQBA 5FA5A 1K02A 1XH0A 1KM3A 2DJXA 3HFYA 5D9OA 5J5RA 1WKDA 2PEVA 1EF2A 1QBBA 4FK9A 1TTPA 2VRKA 3PWGA 4E6MA 1JDDA 1B2YA 4P5UA 2OQHA 2JGQA 2EPNA 3NPVA 1LROA 2FIQA 2WXDM 1GNXA 3HG4A 2PODA 3GNNA 4C6OA 4GNKB 1RR2A 1X6NA 2PDLA 1S2WA 2B31A 1EOKA 5I0DA 5CSSA 1GYNA 5A6TC 1VJSA 3T78A 4UFMA 1W3KA 5K4ZA 1GVQA 4LPCA 4W9TA 5D2XA 5EL1A 2F2KA 4OFCA 4B5VA 3HM7A 2CCRA 4I5XA 2VXNA 3VIJA 4I7WA 1W2PA 1XM3A 3NQMA 1XIHA 2XFRA 4AEOA 1RBAA 5K7JA 2VZSA 3OG3A 3VNYA 5LNSA 1ICQA 4XTDA 4EKJA 5MKGA 2YCKX 3IAQA 4MWAC 4UZSA 2VCAA 1R7AA 4D6CA 3WLTA 4RDWA 2OZTA 4FLQA 2E68A 3FHAA 2IKJA 2PRHA 3VNLA 4JHZA 2QCDB 2WCGA 1UWTA 3F1QA 4KKXA 5G4EA 3Q2DA 3NL5A 2WMFA 2DUZA 1CYGA 1D7KA 1F6KA 2QUNA 2D1ZA 4WY0F 2PDBA 2ASHA 3T8LA 5CJ5A 3P67A 1KGXA 1LORA 3Q37A 3NZGA 2EBNA 3E49A 5JH2A 1AW5A 2A3HA 4OGZA 1CI1A 4XX6A 3WNNA 3LERA 3TSMA 3NQ6A 1UQYA 5A2AA 4YNGA 1M6JA 1UIPA 5U4NA 3AIEA 1GG1A 5CBIA 4GY7A 1KD0A 3GHUA 3N4AA 3S8HA 4FB7A 4QBXA 4MAVA 1LQ2A 1G69A 2CLLA 2BVWA 3GU1A 1UMYA 3M1ZA 3BCFA 3C6CA 2V3DA 3GC2A 1KTCA 3WDIA 4JICA 4DHGA 2WVSA 2VCCA 1LF1A 2H6RA 4CNNA 4QISA 4W8BA 4QJ5B 3LCFA 3NZ1A 2XUCA 2NLYA 3WIJA 4AYSA 4MZYA 5F4SA 4QROA 4P7QA 3L4TA 1KCLA 4J4KA 1UZ1A 3ZXWA 2GQ3A 1UPMB 4NSBA 3E5BA 1O4UA 4PMOA 1TE1A 3VC5A 1K4GA 4GX9A 3N73A 4NAFA 2F7FA 2FPVA 2WHJA 2GVJA 4GZEA 2I5IA 4LF2A 5DBUA 1TWSA 5HA7A 5FSDC 3GQYA 1UZ4A 2EJ1A 2WNZA 4JTGA 3RLHA 5LZLA 5AFDA 4CEXC 1E6PA 3I65A 5XIAA 4DLMA 2CBJA 1IZKA 1IT8A 3UCQA 4CNSA 3MS8A 5LNRA 3KBSA 4AU0A 1LG1A 2EGZA 1I1WA 3DKJA 4DRSA 2IKIA 3EWUA 1W3HA 1BVWA 5A95A 3ZLFA 7CGTA 2ZCGA 2PP1A 3DZ1A 3CZKA 4XISA 4L9ZA 5DXYA 2NQHA 4BJHA 4D8AA 3S0CA 2ACUA 4BF5A 4WRHA 5F2GA 2WLYA 3AS1A 3NL2A 5FJJA 3QQ0A 3ZR6A 4UTMA 3DFYA 3N6HA 2DU2A 3WCZA 2C1HA 1KXHA 1XICA 4GINA 3BLFA 2V3FA 5CKSA 2GWGA 1JR1A 2DH3A 5DO8A 4LQ1A 2J78A 3G1SA 4UBPC 4DBSA 4L4MA 3CIWA 3PN8A 2YXGA 5E70A 2BOEX 4PL1A 4LRTA 1AQFA 3FEQA 3DG3A 1VJZA 5I09A 3MW7A 3A4XA 4CNPA 4WD0A 3KLKA 1M7OA 4MJ2A 4ZFCA 3E1F1 3U2CA 5GJPA 2VC7A 1NH6A 2DT0A 4KIEA 4O4WA 8CGTA 1VP5A 3RLVA 1EJSC 1PZ2A 4FIRA 1XGEA 3AALA 4XSMA 5I79A 3HQ1A 4GXPA 1TSIA 3CMJA 4I6VA 1NIUA 4HMNA 1PHWA 3HOJA 4WKFA 2VENA 3CAKA 3WNKA 1C9DA 4GQ0A 5REQB 1H62A 4Q8MA 5K9XA 1E0UA 4C5ZA 1E5NA 2Z1KA 2VC9A 3GG1A 4AY7A 1VCGA 2ZX9A 5CZJA 1TMHA 4XV0A 3RAOA 3CLWA 1RP8A 3WJYA 1N55A 3G5EA 5IFPA 1C92A 2YFOA 3K4WA 4XUYA 4AWTA 1SJAA 2WO5A 1V8EA 1BF6A 1UC4A 3ARZA 3S1UA 3E0FA 1RQHA 3HPFA 5E0FA 2Y61A 4S3JA 2PDXA 3AMKA 3T4WA 1BG9A 1MQPA 3ARUA 1ZBVA 2YSWA 2FZ8A 1I6NA 3MJMA 2D22A 3AZTA 3EDJA 3RXZA 2GJLA 1OFDA 5DBTA 4ORIA 4FALA 3CTTA 4S3CA 1OHLA 3DG7A 4D6IA 3W7EA 5BMWA 1V3LA 1MEIA 2OELA 2Q8XA 4GBUA 1W5MA 1E43A 1XRTA 2AL1A 3GYEA 1LWIA 4FNRA 5LIKX 1RVKA 4HZ7A 1EPXA 3UWUA 1PYMA 3OODA 1W3JA 1KW1A 3SRKA 3W6MA 2B7OA 3GDTA 2NVCA 4DWSB 1PIGA 1H0IA 4NJHA 3THDA 3RRXA 2EAWA 2GQ9A 6CGTA 4ZR8A 4JQ3A 3GDRA 2WZTA 4K6AA 2VFFA 3UJEA 5A6AA 1RVGA 1KFJA 1AG1O 4E2BA 5L9FA 4HHPA 1YQ2A 4AEFA 4B15A 3GK0A 3L66A 3TROA 5KETA 2ZKMX 3NVTA 2VL4A 1W1IE 2FZBA 1K7EA 3HG2A 4GVHA 4UIOA 2BGNE 4K36A 3F4CA 1ZAJA 3B05A 3TJXA 3WQ5A 3LLXA 4YJ5A 1EGZA 3U4AA 3GHSA 3MC5A 2FJUB 2V63A 3ES8A 4JTSA 4Y9OA 2V3EA 2FGBA 4UQCA 4JQ2A 4WVXA 1XDMA 3LHYA 2PS2A 4BS0A 2OZ0A 2WYSA 1P6WA 3KUMA 2QS8A 4AAJA 1HP5A 2UZ9A 3GG7A 5K3VA 5LNVA 4UCFA 1NDZA 3KRZA 4AZIA 1WUEA 3A9IA 3APYA 4M5PA 1FA2A 2ISFA 3SCQA 2BLEA 3QKZA 1GOWA 1POJA 2VGIA 3R1ZA 5IFTA 1UUOA 4G2DA 1VHNA 4H3DA 4MUZA 5HINA 2ON3A 3RILA 4DO6A 2GFTA 3PY2A 3KEHA 2YLAA 3G8RA 2YA2A 5H2ZA 3TN3A 1IR2A 3LCIA 3WJWA 1WX0A 4GX8A 3EOOA 4DO5A 4MLJA 2VR2A 2VWSA 1TPB1 2E25A 4H2HA 1BXCA 2PDYA 1JCTA 4FXSA 3TAKA 2PDGA 1E9YB 3AFBA 3NWRA 1CGWA 2Q09A 4H6RA 3LNMA 2GJXB 3KW3A 1VJIA 3A23A 5A1AA 1GVIA 2F6KA 2CLKA 2OMAA 1ZJBA 2YDRA 1JCXA 4W4QA 4JTEA 3KDNA 3OIXA 3WEMA 2E1WA 2OLSA 5KMYA 4LUIA 3FYOA 4RE3A 1R85A 2BVYA 3OO2A 5I02A 1QW9A 3TOPA 4JFVA 2RJHA 4JGDA 1TIMA 4IQDA 1JZ5A 3CV2A 2KX9A 4X61A 1YLVA 2YDSA 1RA0A 1EJXC 4D71A 4BQ3A 2E6YA 2JGYA 4MIMA 4HPGA 5FEXA 3BSGA 3QGVA 3DG6A 4LAOA 2ZADA 4K1WA 2DZUA 1VRDA 3EX6A 1F7BA 3MDUA 2INFA 5JQ9A 4GZJA 1GJWA 1M03A 1U2YA 1EXBA 2BOGX 5LIXX 4H8HA 3STEA 4ZE4A 2VGBA 4I8YA 2PTDA 2V5JA 4M80A 3BARA 1JXKA 1VBGA 5F2IA 1ITUA 3CUJA 4XIMA 3UR5A 4GQBA 4BA0A 1QW8A 1ALDA 1OYCA 4L7ZA 4B5NA 1YIXA 2A6NA 3Q94A 1X8FA 3PAOA 1AUSL 3ATZA 1VRXA 1BAGA 1S38A 6REQB 3AWNA 1IQ8A 1C3FA 1BYBA 4E8GA 1KM4A 5I24A 2E5DA 4UTWA 3ONCA 5FOOA 4AZGA 1J18A 1HL2A 1XRFA 3PULA 5BRPA 3DESA 3N11A 4PUDA 2YXXA 3HBLA 4XTIA 4KERA 1OGBA 5J04A 5RUBA 1US0A 3DEQA 3GVRA 8XIAA 2CBIA 9RUBA 3WQEA 3B06A 4B5TA 3LI0A 4LH8A 2ZZ1A 3FNDA 4H9TA 4IMGA 4CGTA 4RV3A 4MYAA 4PMYA 1WDSA 5MF5A 4NZ1A 4QGCA 3UZXA 3A3WA 3GXMA 2XGIA 3QV9A 2PGWA 3SB0A 1J8VA 4BZYA 2Y85A 3DXIA 4GJIA 1OC7A 3VFCA 1O1ZA 1Q4NX 1TVNA 3UYIA 3MYPA 1W54A 5HATA 4GUFA 1WXYA 4B2DA 1FDZA 3L2LA 4LS2A 3OYZA 3ABQA 2QEZA 5G1MA 4H9MA 1KBJA 3GR8A 4MJ4A 2Z0IA 3CTLA 4U3AA 3O06A 3U57A 2WMIA 1A0CA 1EP2A 2D23A 4W84A 2JIWA 3OHIA 4CVWA 4M19A 2VEIA 1OCQA 3PZMA 1E15A 3EDEA 4Q8QA 4GG9A 3ABSA 1C7SA 2W9MA 4R53A 1U22A 1RBLA 2E9BA 3LBCA 3CM4A 4DM2A 2DFAA 1JG9A 3N6JA 3E96A 2ZRVA 2DIJA 1K9DA 3M0ZA 1PL9A 2Q3OA 3SCOA 4WOZA 5F2MA 1KRBC 1GTEA 4GYJA 3N2BA 3RU6A 1J0YA 4Q8PA 4NZCA 2PSNA 5A8NA 4C90A 1RQBA 3I68A 1AFSA 3CPRA 1YXYA 3C8NA 2ZRZA 4BFAA 1QTWA 3E0IA 3UVAA 1RH9A 1MUWA 3VFLA 3OIHA 1CGYA 2FZDA 3SCRA 1F8IA 3VD9A 4W86A 2W79A 1KM6A 3F4NA 2WSPA 4P61A 4XBSA 1PSCA 4PMXA 3TW9A 1UD8A 1TJRA 4Q7NA 5IHSA 3OA3A 4C6DA 3RO8A 1DTUA 2RDTA 5G5IA 1G01A 2QQ6A 2HTMA 1FWNA 4M82A 3LDVA 3P82A 3VDAA 3M5ZA 2JEQA 4B5XA 4JDYA 4XO7A 1NVMA 1QNOA 2ZICA 2VZTA 3VIGA 4CQAA 2QCMA 4HQVA 3EKLA 1SO6A 2YCLB 3EB4A 1FP9A 1R3RA 5HQEA 3PP7A 2GK1B 5LGXA 3C2OA 1OBAA 2V2HA 3WENA 2C7FA 5EBAA 3AISA 4QLLA 3PTQA 2CXEA 3O6YX 1FWEC 4ZZ9A 2P3EA 3T9PA 3OGRA 4EWJA 1QHOA 4EIVA 2PBGA 2PWGA 5M3WA 2J25A 2XSBA 3PG9A 2PDUA 1GOOA 3CZGA 1E6RA 2VT0A 7REQB 1Z8AA 3G1YA 1S39A 3W7NA 3LHUA 2PMQA 1MW3A 3CAVA 2DGAA 4ZOCA 1VENA 3OVQA 4C6IA 2XH4A 1UWUA 4O1FA 4QX4A 5BRBA 2PU1A 2X0YA 3BCDA 2CKSA 1KWGA 1GQIA 1W1YA 1A47A 1Q5MA 1IXOA 5SWUA 1IGWA 2OG9A 3LRKA 9XIAA 3BV7A 1U5JA 5JU6A 1IV8A 2XJ7A 1BEUA 5CSYA 3QR0A 1MFUA 1XBYA 3EMQA 2J7BA 3IIVA 3B8DA 3NYZA 4UMBA 2XVPA 3S83A 2BY2A 2RDWA 4F0KA 3RIKA 4LVGA 1OX4A 3MHGA 5I3GA 1ENUA 1UKPA 5CH9A 1X96A 1PTAA 4MY9A 5TF0A 1OCNA 3V0SA 1ITXA 4QJ4B 1JYVA 2YW4A 1IYXA 3FGCB 2PTYA 1P5BA 2WKGA 4QNWA 5J8LA 4IFKA 3UEQA 1V77A 1DIKA 3E3HA 3IANA 4J2PA 4IMAA 3WDJA 3NGJA 1ODZA 5FJTA 3WLJA 2FGZA 2PDWA 1NDYA 2F8QA 3TQVA 5C9ZA 3GO2A 3N4EA 1O95A 3SURA 2QGYA 4M81A 1LOSA 4XAFA 3U6WA 3IRSA 1X97A 3LENA 1V6UA 2QLYA 4WJEA 3DFNA 4AMAA 1UH4A 2H9AB 4YXGA 1YDOA 1ONXA 1TE6A 1TMQA 3WUEA 3J7HA 3N2OA 3T05A 3C8FA 2VELA 3GS6A 4ERIA 5C8BB 1K8YA 2XIOA 4UTUA 4JIRA 1OYAA 4A8NA 3L9CA 2WBKA 5K2ZA 1SSDA 2XN0A 5CC7A 4U3CA 1KCZA 4DWSA 4O1CA 4Z1YA 1E56A 4WCJA 1ZUAX 1XHGA 3A21A 2NWSA 2XTKA 4FA3A 5C2GA 1C91A 1CB2A 2FB3A 3EEGA 1Q6GA 2JFEX 4FF7A 2YW3A 5G4WA 1W9UA 1P48A 2PD5A 5DT5A 1QNSA 4XSLA 1NOWA 3QFEA 1LYXA 2NV9A 1GORA 3CUXA 3I6RA 1TV8A 1UP2A 2OX1A 1XIJA 2E77A 2FFIA 5D38A 2I14A 2Z1SA 2V9DA 2HXTA 4ERGA 5C9WA 3I3BA 2ESCA 3CLMA 2PP3A 5TD4A 2J88A 4DBUA 1TX0A 3G0XA 2E09A 4QEHA 2ZUMA 4UTJA 1CXEA 5BW6A 3V7PA 1KLYA 1I2NA 4Z2GA 3LTPA 3HMJG 1TJ0A 4JL2A 4I9TA 4MB4A 3WNMA 4PGLA 5DCDA 1EHNA 1TV3A 3LM7A 3VE7A 2X0HA 4MADA 3SIMA 2YXOA 1U5HA 3S47A 3KBMA 3GE7A 1D9EA 1EJTC 3NQCA 2VQUA 1Z7AA 4NIRA 2ZZ2A 2J13A 1UD2A 5EFFA 2FJKA 4C7GA 4WJ8A 2Y1HA 1AJ0A 2FTYA 2XFFA 1TTIA 1XRSA 1F76A 1IGSA 4KQNA 2AAAA 4XQ6A 3TTEA 4F9JA 2O9TA 1JPHA 1PDYA 3KRUA 4L1XA 4QHRA 3CHEA 1J0KA 1QFEA 1G9HA 3NXLA 3W7LA 1EIBA 1NWTA 3UY8A 2XSXA 4G1KA 4FMVA 2GGIA 4Y7EA 3ARTA 3OLGA 3CZJA 1HKIA 4QFUA 4NYUA 1A5KC 1S2CA 4L4PA 2GJXA 3ARYA 5DX7A 4ILSA 3W25A 1K3UA 3WBWA 3H12A 4HNVA 1QWKA 3AXKA 3L0GA 1FCVA 2Y5EA 2RGLA 3VD5A 3SCNA 3SY8A 1WP6A 4TVCA 3ANYA 3GX9A 3AZSA 2ZZ5A 4JQ1A 1ME9A 4ONVA 1KM5A 4TVUA 4UXDA 4B2DD 4CNOA 1EB3A 1GVSA 5EMUA 2J75A 2ZE0A 4WZHA 3WNLA 1GVYA 2FB2A 2LLEA 2G8ZA 2V69A 5E0CA 2Z27A 3QR3A 2EPMX 4UQAA 1RPXA 4LWWA 4GHRA 3LTYA 1TREA 4LEQA 3AXIA 1EO5A 4AWUA 5FKYA 2R8WA 1SMAA 4XKYB 3UVIA 2VR4A 1KM0A 2Y89A 2DW7A 4RX0A 5T9CE 2YYUA 1K70A 4WKHA 4LUJA 4F3HA 3P93A 5D9MA 3TYZA 3KBWA 4PZVA 3DCPA 2C0AA 2AOSA 3VCNA 4NXSA 2OT0A 2ONEA 3UWEA 1CXFA 4GOAA 1FWCC 4F0MA 1HIZA 4LNCA 3CB8A 5EYWA 1V3JA 4CQCA 3CO8A 5D9NA 1GZGA 1E55A 2BY0A 3HPXA 3NYDA 1U1HA 3B97A 4S3FA 4AZCB 3RITA 2V67A 1XBXA 4HD5A 1XCXA 1F05A 3USBA 3THUA 2WB5A 1V6XA 1NP2A 2PF8A 1FWHC 2CWNA 4RNHA 1DJXA 3W71A 1DWFM 3OLDA 4K1GA 3ZSSA 2EG8A 2WVTA 1H50A 1WKFA 2NVAA 3DIPA 3TN4A 4E8DA 5AC5A 3TXZA 2YX0A 3UZZA 2XWDA 3LPGA 2PA6A 3VKAA 5BXSA 1EPVA 2OO6A 1VAHA 2XINA 5C9UA 1HQTA 4HT3A 3DC8A 4M6PA 4NZFA 3KBNA 1IF2A 1XRVA 2PDQA 1K1DA 2A7PA 4HZ6A 3W4RA 4KGLA 3RCMA 1NQKA 3GFZA 3C0SA 1GG0A 3T2PA 3B0VC 4OBSA 3TC6A 4OHQA 2OQYA 3ISIX 1OINA 3Q58A 3WFZA 3ARPA 1W1TA 2JF6A 4WJXA 1CB7B 1GWJA 3MMTA 4YHGA 2VEKA 2WMGA 2J79A 3T09A 1XIGA 1UQZA 7ODCA 3OQEA 3O63A 1OADA 2IKGA 2FZMA 1BRLB 4EXBA 3L0NA 4Y9NA 3S1GA 1CXIA 2ABBA 4E2VA 3D47A 1BYCA 3LXCA 1WZAA 4NRSA 1EJ7L 4YTQA 3VD7A 5L6UA 5FACA 3QMRA 4O18A 3AO0A 1G6CA 1B90A 3EWWA 2A2IA 3CBWA 3NGFA 2X7VA 3E2RA 3SJNA 3H4WA 1XUUA 1B54A 5TNVA 3CJPA 3BE7A 1TWWA 4CD6A 5GVJA 3LHWA 3QVQA 3NSXA 1A3XA 5I03A 1PZ0A 3OPSA 2VEMA 2NX3A 4R27A 3KS5A 3H23A 4H01A 3R6IA 1OVDA 1R46A 2D2HA 3O05A 3TMLA 2ZUSA 3U2ZA 1AH3A 4GISA 4YVVA 1HKVA 2BGQA 1UD4A 5M2FX 4DVOA 3KDOA 3W1AA 3RR4A 3HURA 3CU2A 2PWHA 2DVUA 1Z44A 3TFCA 2OTDA 3ZM8A 1ZBKA 3P5ZA 1GKPA 3NZQA 4KWUA 2E6FA 1YBQB 1BWLA 2B4GA 3FDKA 1R9YA 4AH7A 1XR2A 5D8ZA 1OC5A 4GY1A 2GK1A 1KB3A 3FA5A 1CXHA 2WMHA 4HNTA 3W23A 5FF0A 5A5WA 5KINA 4HB7A 1C8VA 2CYGA 3G77A 3W24A 5FJRA 4M1RA 4DUXA 3EEZA 7XIMA 1O60A 2I16A 2VEFA 3T0CA 4BF9A 1UHVA 4X0VA 4Z2HA 5EMLA 4ICMA 1F3XA 1RCQA 2QCCA 1O94A 1BF2A 3QYSA 1IEIA 2YYTA 4MMWA 4O28A 3AIVA 3G22A 3SUUA 4H7ZA 2A0NA 2YB1A 1TV4A 3R0UA 1Q2SA 1H7RA 2IMRA 3MHFA 3EYPA 4TX8A 2F6UA 3C2RA 1OCJA 4DWSD 2JEPA 4KWWA 1XLLA 1N82A 1T96A 3AJXA 3OA5A 4NAEA 3MB9A 3VM5A 3E9AA 4I5RA 4CD4A 3T6CA 5FD0A 3HGJA 2ZC1A 2BDQA 2CETA 2V6AA 1LZOA 1YPFA 1T8QA 3GRIA 1Q13A 1W0MA 3UWZA 4WKAA 4JN8A 2ZA2A 4KCVA 4DI9A 4JIQA 3BAJA 2FMOA 1M01A 4KWOA 2CZDA 3H6OA 1SMDA 4AZ7A 4C91A 2HSAA 3KL3A 4F0RA 2OFJA 3FOKA 2DY3A 5A8QA 2YKKA 3RCYA 4L9YA 2BODX 3ZSTA 1M3UA 1B3XA 1RXOB 1PBGA 3QSTA 2A4AA 4TIMA 3W7JA 1T40A 5HR6A 3B0UX 1OB0A 4XAGA 5D33A 4IQLA 4GGBA 2Z28A 1E9ZB 4C6EA 3QQ1A 1W9XA 3SY1A 2CBUA 3DFPA 3WH7A 4JNZA 2VNCA 1UWAA 3LGGA 3CB3A 3A3HA 4P8VA 3PZNA 2PI6A 3DBNA 3IS4A 3NQ2A 1E3XA 3VZYA 2QIIA 3W1TA 2XH0A 2Y7DA 3R10A 3HIJA 5IOBA 4UQ9A 4L1GA 2PGEA 3VKDA 3W6LA 4XAPA 3O7UA 1KLZA 3TJIA 4FR1A 2NQ5A 5HAOA 4YWIA 4GXMA 3APGA 3TR9A 4E2OA 1HJXA 3K30A 2EKCA 1OM0A 3M0JA 3W6YA 4UMAA 4H9YA 3DKLA 1XQKA 3I3DA 4O1EA 1XLJA 4OWGA 1JDCA 2OJPA 4IIDA 1R38A 4Y8FA 3EZ4A 1JUKA 1XIBA 4PTMA 3ZT5A 1GEHA 2X09A 1VCVA 3NQAA 3TU9A 3WQVA 1NOFA 4DWSC 2Z26A 2J7GA 4JTKA 2VGFA 5CZSA 2FTPA 5F7UA 3E0WA 3AHXA 2PGRA 4NYYA 3LPOA 2G5WA 1GONA 3GVQA 2EKGA 3V36A 5CBBA 5D05A 1W1PA 5CPTA 2IUZA 4D8ZA 2YL5A 2P0IA 1TWZA 1XC4A 2W4XA 3CL8A 3TW7A 2C13A 1J0JA 2P8CA 4JTFA 4RDVA 7TAAA 1KFKA 4CVUA 3VCRA 5I77A 1HO1A 4HSHA 4F66A 4S3GA 1VD6A 3VILA 4QDMA 1ISWA 1WDQA 1U5VA 3WQ8A 3RHGA 6XIMA 1CWYA 3M6DA 2YGYA 5D04C 1GCYA 4QEEA 2O55A 1WUFA 3MU7A 4RV8A 3OHMB 4RZ4A 3QZ6A 3W75A 1MEHA 6TIMA 1XLKA 3NG3A 3STFA 4J28A 4HOZA 4YVPA 1UMLA 4ZO8A 1CW2A 3RLUA 4WXYA 3XIMA 4PMDA 5D2WA 3W9ZA 3LXBA 3AHVA 2OEMA 1XW8A 1F73A 1OK4A 3G1HA 1XLIA 4HNNA 4A8RA 3G0UA 4Y9PA 3WMSA 4DXVA 4C1NA 1J0HA 2V5LA 3S3GA 2BS9A 5CC5A 1G4PA 1JF5A 2J7FA 4X2RA 2WK2A 1V02E 3POHA 1KFCA 4FP1A 4JQ4A 4MNLA 1HKKA 2QXWA 1RALA 1H1YA 5CSRA 1DWJM 1W3LA 2VEPA 2ZDRA 1JEZA 3D0CA 1VEMA 1Z3NA 4DY1A 2ZTJA 3CV7A 4WHBA 3MANA 3F5LA 2I1OA 1S2VA 3RRAA 2ZRYA 2CHNA 1SFJA 3BGJA 2NV1A 3I6TA 2DZXA 4PBFA 1GYLA 4PN2A 4QP0A 4C6BA 1V4YA 2Z1VA 3UG8A 2XH7A 5IBXC 2XZ7A 2POTA 3WQ4A 4DJDD 3SI9A 2NX9A 3IGSA 4MUPA 4P7NA 4FS9A 3FEMA 3ZS4A 4HMDA 4Q8UA 4MZ1A 3RU8X 1V08A 1N8IA 1XL9A 1Q6DA 1V6TA 4Y90A 1GPFA 2HK1A 4Q8TA 3SCVA 2EEXA 5DMNA 2QJHA 3OQ8A 1WZMA 1H51A 3EGJA 4AZ6A 3OVGA 1FBAA 3DC0A 3PUEA 3H4XA 5JUVA 5I23A 1VR6A 1TVPA 2WJDA 3R8RA 4D6EA 3MJYA 4AD1A 3A4WA 2OVLA 2PBOA 3RCNA 1JZ7A 2PF0A 3FYPA 3E0LA 1JCJA 1V5XA 3WEOA 3UJRA 1F2JA 1O5KA 3R0KA 5KSWA 2NQZA 1ZB5A 4LB4A 3REQA 3WLOA 3TH6A 1JD9A 3PPHA 3WK3A 4KS0A 1R3WA 1OT2A 1TQJA 3T42A 3MDWA 2QJNA 4M8UA 1KGWA 3U4FA 3NQ8A 3M5YA 4LT9A 2BY1A 3CC1A 3F4VA 4MG4A 4K2SA 1A4LA 1XXXA 2VO5A 2WJZA 3TMQA 4UFHA 3BL3A 3ZT7A 5D2TA 3DH7A 4AXKA 3EOSA 3L4UA 1OGSA 2OKTA 1F3TA 4E2DA 2XIMA 3VIIA 2H90A 4EF9A 2FH8A 4GGHA 3G1FA 3G24A 3SRDA 3KWSA 4MGGA 5LA1A 1V7YA 2HISA 5C71A 4XZWA 4IPPA 3BAKA 1OJXA 3BGGA 5M1TA 1JI1A 5BROA 4KT2A 2XWEA 4MLRA 4JX6A 4JX5A 1HKMA 2I9EA 4DJDC 1DOSA 2F6XA 2RUSA 5HBFA 5AC4A 4ALDA 2IW0A 3VIOA 1ICSA 4X2PA 3BAWA 2JIEA 4NL1A 1E1FA 1CBGA 4HMCA 4Q6JA 1XSKA 1I2RA 2VFEA 3VNJA 4HHLA 1F61A 3LGEA 4LYPA 2ISDA 2C0HA 2J6VA 1IEWA 3AMDA 1Z6KA 2W61A 1H11A 4QR6A 3VYLA 2FVKA 4DZ5A 1R7OA 1UWRA 3CV6A 3PUOA 3L4XA 4UOQA 3W83A 1H63A 4ZENA 3VGDA 3ZO9A 2NZLA 1SQ7A 2AL2A 3DI0A 3C56A 3IEBA 2WHMA 4C65A 3KCLA 1BXBA 1JFHA 4AIOA 6ALDA 1BVZA 2O9PA 2OB3A 4ZO7A 3CASA 2YJQA 1OY0A 3TYUA 3NUKA 4M1BA 5CPLA 4GKLA 1RQEA 1UJQA 3ANUA 4PCSA 3KE0A 3B03A 1KXQA 3W2JA 1B4KA 2ALDA 1GVRA 2DV0A 1SFTA 1XYLA 7TIMA 1AH0A 4S3KA 3RDKA 2B7NA 1UYQA 3FIGA 4O11A 3H7RA 3LQLA 4DEFA 4GI4A 4CN1A 5FJOA 2QDDA 1GHRA 3FFSA 1NFGA 5ABGA 3IJ6A 2AGTA 1VH7A 4V2XA 3QQWA 3GW3A 1G0CA 4UFLA 1PUDA 1ADSA 1VCFA 5FF7A 3AIUA 3FJNA 1TA3B 1CECA 5EMJA 2FPYA 1OFPA 4AZHA 4N6FA 2WANA 1FHVA 1GZ1A 3MWAA 2A7NA 4AHOA 2VWTA 2ZVRA 4JFTA 2XIIA 4MTVA 3GFYA 3HQNA 2VCBA 3TTSA 3UXLA 1EKOA 1JPIA 5C7VA 1BLIA 1CZ1A 5IDIA 5G4HC 3MUIA 2WOQA 4KESA 3S42A 4EANA 2Y7EA 1BQCA 1OZQA 1JPKA 4WDXA 2BMBA 2QF8A 3QGKC 1ZCCA 3S4TA 1EP3A