1S2VA

Crystal structure of phosphoenolpyruvate mutase complexed with mg(ii)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
289
structure length
282
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoenolpyruvate phosphomutase
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
total genus 107
structure length 282
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2vA00
3QQWA 1IZCA 3LG3A 4B5VA 1A49A 3M0JA 4TV6A 4L9ZA 2L5HA 3E0VA 4B5TA 2DIKA 3GR4A 4YJ5A 1XG3A 1F3XA 3OYXA 1ZLPA 2VWSA 1E0TA 5TAOA 3QV6A 3QZ6A 2WQDA 1S2WA 2VGBA 3GQYA 1M1BA 3QV9A 2V5KA 3U2ZA 2XZ9A 4KS0A 3N25A 1T5AA 4L80A 1KBLA 4QG9A 1A5UA 3E5BA 3EZ4A 4QGCA 4B2DD 1VBHA 1PKNA 1PYMA 4HYWA 1SGJA 4B5XA 1XG4A 3GG8A 3R4IA 1S2UA 4MG4A 3KHDA 1JDEA 2VGGA 3OQ8A 4JPGA 1M3UA 4WJ8A 1U5VA 2XZ7A 1Z6KA 4IQEA 4RPPA 1O5QA 3HQNA 3QV8A 1S2TA 3PUGA 3EOLA 2HROA 4FXFA 4HYVA 3ME3A 4KCVA 4QG8A 3SRKA 3SRFA 3LYEA 1O66A 3EOOA 1AQFA 1DQUA 4L7ZA 2ZE3A 1PKLA 3FA4A 3HQOA 1IGWA 3I4EA 2QIWA 3H6OA 1DXEA 3M0KA 4ROQA 2HJPA 3QTGA 3QV7A 2X0SA 1F3WA 4YNGA 2R82A 2G50A 5JVLA 4KCWA 2BG5A 3T07A 2XDFA 3OYZA 2VWTA 4DRSA 4G1NA 3EOEA 4L9YA 4B2DA 1PKYA 4KCUA 1U5HA 4TV5A 3T05A 4QG6A 1KC7A 2KX9A 1GGOA 4KCTA 4B5UA 4IP7A 1E0UA 4LSBA 3B8IA 4FXJA 3FA3A 3E0WA 3QLLA 4B5WA 2OLSA 3G2GA 4KRZA 3SRHA 3T0TA 4MF4A 1A3WA 1DXFA 1O68A 1VBGA 2V5JA 2DUAA 1MUMA 2HRWA 1OY0A 3BJFA 4IQDA 1F61A 1OQFA 1F8IA 1DIKA 1UJQA 1S2VA 1PKMA 3VAVA 4B5SA 3P0XA 3HQPA 1F8MA 3BJTA 2VGFA 2VGIA 3MA8A 3SRDA 2E28A 1ZJHA 3KTXA 3IS4A 2HWGA 4IMAA 3PP7A 1A3XA
chains in the Genus database with same CATH superfamily
3UJFA 4MLJA 1B0IA 3QY7A 3W00A 3GKFA 1H5VA 2X1RA 3BXWA 3UZ5A 2E1DA 4C7GA 2VP8A 2AOSA 4JIQA 4JX4A 2VT0A 4X2RA 3CJPA 2WMKA 1ESWA 2F7FA 2PDMA 2PP1A 2O0TA 3H22A 3GYCA 4AIBA 2QJJA 2Y7DA 3VUSA 4XKMA 2INEA 2EG6A 4HYVA 4TUFA 4N9BA 2XIOA 1YPXA 3PG9A 1OGGA 1EEXA 3STEA 2R14A 2OQLA 4S3KA 3LU2A 1XYBA 1QCWA 2V2HA 3SJNA 2GJXA 1RZMA 1LL7A 3OVQA 4TTUA 3W7NA 3ARRA 3SUVA 3GTXA 1QPOA 4H9TA 1REQA 4RLIA 1E9IA 4HZ7A 4GQGA 5T26A 3W74A 1E55A 2V3DA 5EB8A 3MDWA 1SM9A 4IGHA 5HINA 4UBPC 3VDCA 3L0NA 4LGXA 3BAIA 5EPDA 1V79A 4L6DA 1YXCA 3S5YA 2J27A 3CQJA 4Q8NA 2E1WA 3MKVA 2E40A 1EDQA 2BTMA 4URIA 2C1IA 1GTHA 2WZTA 5EA9A 4CCCA 4WSJA 1W8GA 4E4UA 2Q02A 3C2RA 2G4FA 4TQTA 5A8MA 3LGEA 4ZO6A 3M5ZA 4I6VA 1QI5A 5AVHA 1QNRA 3W02A 3N2OA 1FWFC 1RVKA 3PZIA 2YXXA 4Q7NA 4I7WA 4Q4RA 1A0CA 3KBNA 5J8LA 4W5ZA 1ELSA 1UOZA 2YOCA 5G2WA 2F61A 3DHDA 4KESA 4LYRA 9RUBA 5K9CA 4DZAA 1ZPTA 1BXCA 3EXRA 3DU0A 3MU7A 3ONBA 1ZGDA 2EPHA 5CSYA 4AZ5A 2O4QA 5E5CA 4CQAA 3WBYA 3SN1A 3VD4A 4H9UA 2NT1A 1EIBA 3NSNA 4DPQA 2Y62A 4L1GA 4GY0A 2X0SA 2HVNA 2YPIA 4KCWA 3USZA 3MP4A 4EANA 2YXGA 3FFSA 1KM6A 5CKSA 3S5NA 2EEXA 1NFBA 3FKRA 1P0BA 3EWZA 3URBA 3FHQA 1UUQA 5C2GA 5LHFA 3EA2A 2B7PA 3N3MA 4DBSA 3M7SA 3R5EA 1XLHA 3UWZA 1H50A 1G1YA 3R11A 4AW7A 1IR1A 3GNNA 1JYWA 3KUMA 3KLKA 4AZCA 2E28A 4XD6A 2WBKA 3WH6A 1RJQA 2CESA 2V5LA 3GBDA 3RRXA 1J0JA 4AZBA 3UA4A 3ZR5A 3E74A 3TOYA 2G5WA 1A4MA 3NO5A 1SQ7A 1ZJBA 2RDTA 3EGJA 4AIOA 1EUAA 2ABAA 3IIXA 1XP3A 3L66A 4GLEA 5F1UA 2OOFA 3BV7A 2SFPA 4GFIA 1UJPA 2HPMA 2G37A 1YNYA 1P4CA 4QHRA 4NSBA 2PP0A 1JRCA 3O9NA 1RV8A 2ACQA 3TR2A 1FX6A 1QK0A 2WQPA 3GHRA 3H2NA 4GIEA 2H8ZA 4M29A 1YW1A 4BA0A 4D6IA 3VCCA 1DYSA 3AMKA 4S38A 3CV6A 3WYZA 4JD4A 4AHPA 3N4AA 2DZAA 1XLCA 1W5PA 2O7SA 1FRBA 1KRAC 3M43A 4K38A 3T4WA 3BQ5A 1E6PA 2Q8ZA 3GWQA 4O0ZA 3LLFA 2ZUWA 3K5XA 2VVSA 4PB3A 4UWMA 3BCDA 1MFVA 2CEQA 4N6EA 1GHSA 2V3FA 4PC8A 4X61A 3RM8A 5BROA 1FHVA 4FO4A 4S3CA 2OEKA 1KM4A 1F8IA 1UC4A 3LRKA 1OHLA 1RK6A 4HB7A 3DEQA 1ZQ5A 4WLCA 1CXHA 5E9AA 1DJIA 5JIPA 3V1PA 3EB3A 4HMCA 4R5EA 3W1MA 3UPBA 4LVAA 1BYDA 4LXFA 4UZSA 3TUUA 3KRZA 1JCNA 3N25A 1BWVA 1JF5A 2AAMA 2PDXA 2PE4A 3PAJA 1ONEA 2P3ZA 5IFPA 2E4TA 2CKSA 1AW1A 4NT0A 3V0UA 1W3JA 4CNUA 3NUKA 2PU0A 4D6EA 3PSWA 3TTSA 2XINA 5XIAA 4OIFA 4YU1A 4C6BA 3ZXWA 1NDWA 1PZ0A 2A0NA 2VRQA 4A3RA 3VABA 4F2UA 1XC4A 5REQA 1T7LA 1Q8JA 1M9HA 2FTWA 2CU0A 3NOEA 1KFLA 2Z6JA 2J13A 1J8VA 3IVSA 4Z2HA 4QEEA 3GFXA 4NZFA 3CYJA 3I6RA 1ZNNA 2NV2A 3HZ3A 3TQVA 1DBTA 2GUUA 2OSWA 1O94A 3QR3A 3ARVA 4Z2KA 2FHCA 3RM9A 2EF9A 1M04A 5FA5A 1J96A 2PTYA 2OLSA 3W73A 4YTQA 1I6NA 1IEXA 5AYIA 4NNAA 4IH3A 1Q8AA 2OTDA 4BF5A 3BSGA 1V02E 4GQRA 1E71M 2YR1A 4C6FA 1IEQA 3R12A 4UB9A 4DO6A 3OIXA 1HKKA 3TZNA 2Y4SA 4A3YA 3IVUA 1TZZA 4MLRA 4D6JA 3PWIA 4KWVA 1OX5A 5KZMA 2D1ZA 1OYCA 1EGZA 5LHEA 3QV6A 4BR1A 2C16A 1DL3A 2ALDA 2FLIA 1M7JA 1XIMA 4LUIA 1L2UA 1A5UA 4B2DD 1W0MA 4HN4A 2J8TA 4NF7A 3ICJA 4GIAA 3UXIA 4WUIA 1NH6A 3DKLA 5BCAA 1OBAA 2NQZA 2CLOA 2EPMX 2GGIA 4JTTA 4UFJA 3WLNA 2VKZG 5HJLA 1EXBA 1V3MA 2WSQA 2X1IA 2XIJA 4ONVA 3L21A 2R1PA 5BOFA 1EKOA 3CL8A 3UJSA 4MWAC 2BXZA 1H41A 3NPWA 4AD0A 3EOEA 3RNDA 4B2DA 1HJSA 4RDVA 2C14A 1DOSA 3TXVA 3SGZA 3C0SA 4PMZA 1GGOA 2OZ3A 2BB0A 3WF2A 3TSDA 1TWDA 3AUJA 1H7WA 2RJHA 3VTRA 4AH7A 4O16A 2HE5A 3SCTA 1E1FA 1O7AA 7REQB 3MUXA 1B30A 5IBXA 4UQCA 3LB0A 1BQCA 4MB4A 3PTKA 4ADSA 1E9LA 3BARA 3V0SA 2Q71A 3O7UA 4RE4A 3MBFA 4E3VA 3WJSA 1JFXA 5AC7A 1AQMA 3VUPA 2OJPA 4RE3A 3E9AA 4MJZA 4O4WA 1UMLA 4W7UA 3N19B 5F4WA 3AIUA 1C92A 4Z0JA 3P93A 4AVOA 2NUXA 1MFUA 1YDOA 2BOEX 3WBEA 1DWFM 5A2AA 5JH2A 4Q22A 3EDJA 1NFPA 3RPTA 4Y7EA 5CZJA 2WMIB 4QX4A 4B3KA 3LOTA 4GI4A 5F2MA 3OU8A 3VIOA 5C70A 1VJSA 4RNIA 1E70M 3R6IA 4HQVA 4JQ1A 2REQA 3PJTA 4MYXA 5LGZA 3B0PA 3P74A 3S46A 3DFHA 4QISA 3PZGA 3WDQA 1SFJA 4W8BA 3GTFA 3EWCA 4JTJA 4OU1A 2PWEA 4EVZA 1W5MA 5HDRA 4XZ9A 3ZVIA 3CT7A 1LRNA 4PBFA 5TQLA 2Y8KA 1OD0A 3TNOA 3S2LA 3P14A 2DY3A 2Y5JA 3IGSA 4ZODA 2NUWA 2OLAA 3NQVA 4NAFB 3TEVA 3TTQA 3W2LA 3CM4A 3GC5A 1KQYA 5GJPA 1VAHA 5HK4A 5C6MA 2HNEA 4A8NA 1ITCA 4H9ZA 3UXKA 3AZSA 2Y7GA 1KBLA 3QVQA 3ENLA 1ME7A 4QCFA 1C8XA 3HG4A 1EQPA 1JD7A 3OVPA 2DZTA 2QR6A 4C5YA 3USBA 1V6UA 3URAA 2QUNA 2FIQA 2WMFA 2FGZA 2F6UA 1VC4A 4RXGA 3H2OA 4ZSUA 4WVXA 3E2RA 4RX0A 3OODA 5EMYA 1GYNA 3A12A 2VL4A 5M03A 5BMXA 5TF0A 4JTHA 4MHBA 2Z1SA 3L67A 3QHMA 1EC7A 1RAKA 1UD5A 1GQIA 1NDVA 4S3GA 2FMOA 3T05A 3H70A 1E4NA 3NDYA 2P8CA 4TTGA 2BGNE 3CK5A 4US6A 3SCSA 3RCYA 2DSWA 2J77A 5FJUA 1A3HA 1X1OA 1OQFA 3VOJA 1HJQA 4Q8UA 2NXIA 2Y0FA 1UZHA 9XIMA 1UR9A 1V0LA 4AD3A 4MUPA 1XDMA 3ITGA 1IT7A 1CT5A 4IUGA 3ARZA 1FVPA 2OO0A 1FWTA 5FEZA 1BHGA 1V51A 2DP3A 2VMFA 5C54A 1D9EA 4KEUA 3LEPA 1EA9C 1VJIA 4B9ZA 3G8EA 2WZHA 3QV9A 4GVIA 3DI1A 2Z0IA 4UNIA 4ZB0A 2VDGA 3GG8A 5FI8A 2JKPA 4JY9A 3TMQA 3W7RA 3O15A 2V3GA 4KFPA 2VZSA 5FCZA 3RCNA 1M41A 3AJ7A 2BY1A 3OHMB 2BFGA 1M01A 2WWCA 1CIUA 4FOKA 1LLOA 2QT3A 1C8QA 3TDFA 1HG3A 4UXDA 4H8VA 4Z1BA 3VOCA 3P80A 2XGBA 1JG9A 3R89A 4ERAA 2Y8VA 4AXKA 5LYRA 4G7EA 3GNXA 1D3HA 3G1XA 3ATZA 3PBMA 3G0UA 3W1PA 1LBFA 1WXYA 2PWDA 4KCUA 3P8IA 5C5YA 1PWLA 3WBWA 3SB0A 6ENLA 2G3MA 2ZQ0A 2IPWA 1FHUA 2XVLA 3QLLA 5G4HC 4DZIA 4IICA 4KERA 3IWPA 3OP2A 4O1AA 4REQA 2D22A 2DUAA 2G96A 1VKFA 5D2VA 5MF5A 1P0EA 4XZMX 1GW1A 5CPMA 4RZBA 1K7EA 2OZ0A 1ZBWA 3QXBA 1K6AA 1M65A 3PSVA 4HHPA 1W8SA 3R94A 4LC8A 1NAL1 2JQXA 1E51A 2OO6A 2TPSA 4UFHA 4WSHA 4JKKA 4GKTA 3SM0A 3S8HA 2G97A 4ZBCA 3TWAA 1GZGA 1W3KA 3QM3A 2QJMA 1FWAC 2PC4A 4ZB2A 3NQ8A 1SR9A 3RDKA 5JMUA 3P7YA 4LJ3A 2YZRA 3OEXA 3HURA 2Y85A 4BK9A 4GJ1A 3TLLA 2QV5A 5C9WA 1JDDA 3WQDA 5CC6A 4EAMA 2GQ9A 5HPCA 3SZ8A 1UZ1A 2QCLA 4C65A 4CU8A 3KWXA 3E38A 2FZ8A 1FWDC 1VZWA 3QLDA 1PX4A 4J35A 3V35A 3VZYA 3TC6A 3BO9A 3QRHA 3W7LA 1TCMA 2G50A 3R8GA 2VUNA 3NGJA 2VWTA 3PC0A 4XBSA 2OT0A 2X1SA 1MMFA 1B3YA 3OTRA 2OYMA 1LQ2A 1E1CB 3BZJA 3N18A 1LF1A 1VENA 2PLKA 1FHLA 1IGSA 3B97A 1PZ2A 1PEZA 1KTCA 2Y61A 2XPKA 1LLZA 3FY1A 1DJXA 1U1JA 3AIVA 3W7OA 1ONXA 3PY2A 4KWUA 3HMJG 3GHSA 3W75A 4IJCA 4P7QA 1F76A 1HO1A 2PF0A 1LYXA 4H9YA 1HGWA 1GJPA 2ACRA 1JI2A 4W87A 2GFTA 3AC0A 2YX0A 2OR2A 2PTDA 2A3EA 2O92A 3EMQA 5H2ZA 4IP5A 1JZ7A 1ZENA 3IIZA 4U2YA 3QQ1A 5A2CA 4P7OA 2Y5EA 1GEQA 3EYPA 3GDLA 1RALA 3EBVA 1E1CA 2AKMA 6XIMA 3PK7A 4FB7A 2D2JA 3VNKA 2QPUA 1V03A 2BVYA 5CJMA 3YPIA 3A9BA 2VQUA 1CLXA 1JI1A 1Q4NX 4IL2A 4RZ4A 8A3HA 3HQOA 4TMCA 3NQBA 1DV7A 1JCJA 4GY1A 3GHTA 1VLIA 2ZRUA 4PN2A 1IXOA 1TMQA 2ZUNA 4L1WA 2ZWYA 4CCEA 1M03A 4B91A 4UMAA 4DO4A 3MKKA 3UPMA 3PBGA 1L6YA 1CX9A 3QHOA 4DB7A 3UA3A 3CZKA 3D0CA 3KP1A 4B92A 3DHUA 2W79A 1ISWA 1RQHA 1PIGA 3FGCA 1HJUA 4WDWA 4H7ZA 2ZRZA 1Z8AA 2GZXA 3URNA 2E09A 3HM7A 4GUHA 1GQLA 4DXKA 3M44A 2Z2BA 1UD6A 4IPIA 3LY0A 1ZLPA 1J18A 1E0TA 2XIQA 4JTKA 3UZXA 3GXTA 5CCZA 3WMSA 4IIDA 3CQ0A 2CZDA 4HMNA 1R9ZA 1MEHA 1JDEA 1NELA 5LNUA 2P10A 1NARA 4ATWA 3LV6A 3I3BA 4XWUA 4ZMGA 4I9MA 1V6WA 1UZDA 4WZHA 1Z32X 3GNOA 3W07A 1A5SA 1J0KA 2IXVA 1ZS2A 3FJLA 4Q8TA 4AEOA 4CKQA 1EYEA 2Y63A 4QNEA 4QBXA 3B8SA 2P3EA 3JS3A 3EPOA 4AXNA 3A47A 4AEFA 3ZT6A 1PBGA 1UP0A 1MXDA 3NWRA 3EMZA 4JTSA 1C90A 1M7OA 5FL1A 2DT2A 1E1EA 1A3WA 1YHTA 4AZ6A 3CMGA 1GPWA 4H19A 3SRDA 4HNOA 4KGLA 1GVFA 3NL2A 3KTSA 3P8JA 5A6TC 1UPPA 1W1ZA 4D6GA 3LNPA 2YDSA 2DIJA 4MWAB 4MPKA 2OCZA 4HK6A 4Y96A 3LPOA 1D7FA 1LG2A 3BZGA 3NNTA 1EP1A 4H2CA 2CZVA 1EWDA 3DHFA 1QPRA 3CZGA 2YBUA 3GC2A 3H7RA 4GPNA 2WNNA 3W87A 1SW0A 3K30A 3BAKA 1Z6KA 3B9EA 4HNTA 3HQNA 2CHOA 4HZ8A 1XICA 3LYEA 4LB3A 1U83A 4O0KA 1DQUA 2BDQA 1K70A 4XAGA 2ON3A 4F3HA 3P6LA 3IIOA 3UWYA 4QM1A 4PRWA 4JX6A 1K8YA 4O1FA 1AD4A 2GVLA 3KOWA 4MPQA 4I90A 3PR2A 2JKEA 4AYGA 2Z1WA 2C6QA 1ONRA 2YLLA 4M5PA 2W9MA 1KCLA 3W38A 2WJFA 1TPEA 4RK8A 3L4VA 5ECUA 5SWUA 4F4RA 2J7DA 4NRSA 3WKZA 3MO4A 1O68A 1PAMA 3SUTA 3WCZA 1JUKA 5EFFA 3G18A 4RW3A 1SU5A 4I5XA 4PB4A 1ZALA 3UVAA 2J75A 3IJIA 4FI4A 1M7XA 2A85A 3HGJA 3U4FA 1RHCA 4UUIA 4RXFA 5LXXA 2P8BA 1GVYA 3VD5A 3OVGA 4B3LA 2QJNA 2QCHA 5HWJA 1FFRA 3LLXA 4QJ5B 1YIXA 2WHJA 3KCLA 4R7OA 4GQ0A 1J2WA 1X6NA 3MW7A 2OSYA 1F6KA 4HNUA 2ZXDA 1FH9A 2OXNA 3GTHA 3WN6A 2O9PA 2YGYA 1H7NA 4E2VA 3QV8A 3KBWA 1SO5A 1PTAA 4HPXA 4NZ3A 3CB8A 3S2JA 3ABZA 3ZYZA 5C2CA 5DCBA 2FVMA 4ROQA 4O1EA 1TV3A 3WLMA 2W67A 3MYOA 2E9BA 1HL2A 4E6MA 4QNWA 3LHVA 3WFAA 3AWNA 5A6SA 1O5KA 5KZEA 4O19A 4TOQA 1GOMA 1JDFA 1OFRA 1P0NA 4JTRA 3W25A 1JNEA 4QJ1A 2VD9A 4Q8QA 3W2MA 3FA3A 4AVNA 1DTUA 2XISA 3U2CA 3SCWA 2WHLA 1G4EA 1SJAA 4HNVA 4PCSA 1TPFA 5FOOA 4QRNA 1IIHA 2YL6A 5CG0A 2XM1A 3WG6A 3ZMRA 1JVNA 3ZOAA 1JDAA 2H6RA 2GQ8A 3AQUA 1QNOA 4Y8FA 3QPEA 2ZIDA 2PB1A 2AAAA 4CD6A 4R27A 2BMBA 1TX2A 4ZO8A 3ZR4A 3C0QA 1B57A 3NQ7A 3BQ6A 1CCWB 3OQEA 4FNQA 4P7LA 2XWEA 4GIYA 1V8EA 4ZVJA 1IIGA 1PIFA 3W6YA 3H4GA 4K1WA 6PTDA 4GZ7A 4DUOA 3G1YA 4KWOA 3W24A 4CCZA 2Y2WA 1XXXA 4GXPA 2R6OA 4PMQA 1CXLA 3M64A 3TLQA 1DJYA 1JPIA 3TW9A 3FKKA 5FF4A 2WNZA 3QTGA 4CUCA 3L2IA 4F8XA 3T07A 3DH7A 2EXOA 3HPXA 2F38A 2PRMA 1PE1A 1GKQA 2P0IA 2ZADA 4EIVA 1K8XA 5IOBA 1QATA 4H6KA 3DZ1A 3ERPA 2KAUC 2PGFA 2GL5A 1TUXA 1WAUA 3RLVA 5AHMA 3DOPA 3AISA 1XV8A 3MT1A 4CD5A 1E4LA 2QUUA 3GXFA 4GUFA 3U5UA 1EUNA 4NNBA 4WJXA 1YE6A 5LNWA 1XRVA 3DFYA 1P48A 1TPDA 5C9ZA 1VFFA 2Z29A 1O60A 4IG2B 4GCXA 4WRHA 1TYGA 1ISXA 3VKJA 3P0WA 2ANUA 1UUMA 1DTNA 5ABEA 1OCJA 2QCDB 4H8HA 1ZJAA 3CT2A 1P7TB 1UD3A 2NV1A 3TC7A 5EMUA 1IR2A 3AFBA 3N1AA 2Y88A 2OZ8A 3VGFA 3CBWA 3DC0A 4GJJA 3KDNA 4A8LA 4RPPA 4XO6A 4EACA 7TIMA 4FXFA 2F8QA 1FDJA 8CGTA 2E3ZA 3C0JA 4QQUA 5T91A 1WBJA 3SDOA 1DWHM 4FALA 1R38A 3V36A 4XZWA 4M8UA 3W85A 1K3UA 3GDKA 1P1XA 2DW7A 3UF9A 4D6CA 5M1TA 4PTXA 1QASA 1C8VA 1UZ4A 1KC7A 2XTKA 1C7SA 3VD7A 3L4ZA 6A3HA 3K46A 1OEPA 1FXQA 4LNYA 1MSSA 4Q4QA 1B5TA 5KSWA 2HRWA 1XINA 4QLKA 1NSJA 1UA3A 5D4YA 1Q2SA 3UEQA 4U5IA 3BG5A 2BBFA 1A3XA 1CENA 1TTPA 1AVAA 1WA3A 5F1VA 3VOHA 1Y65A 2PDBA 3M0HA 3ABSA 4NAEA 1LG1A 1LBMA 1GG0A 1ISVA 3MMDA 1QWKA 2VWSA 1AW2A 3STFA 3KS6A 4TO8A 4GA8A 3ZR6A 4C7DA 4QDPA 4XZHA 4LX4A 2NQ9A 3BAXA 3R43A 4FLSA 3SQMA 4QGCA 1BGGA 3NZRA 1TWIA 1G5AA 2ABBA 2J7HA 2ZRXA 3MDUA 3W82A 2V5DA 3ANUA 4GYPC 1NFGA 4JTCA 2ZXQA 3O6AA 4JTEA 4MMWA 4X0VA 3TAOA 3WLIA 1JPKA 1WX0A 1RY8A 1DQXA 3PNUA 5ABFA 1K8CA 2I14A 3FYYA 2DZBA 4XV0A 1Q2RA 3PM6A 1NOFA 4DBEA 2V5CA 3O2LA 2ZICA 5BXRA 4PUMA 3C8FA 2BX7A 5CGQA 3ZT7A 4N0RA 1B3WA 4M1BA 1XLGA 3WL1A 3C52A 2EBNA 2ODOA 3KFTA 1VQTA 1R46A 1EJVC 2BXVA 3F4WA 3GH7A 4JEQA 5G4EA 1LL4A 4K8GA 1KM5A 4B16A 2PWHA 2WVUA 1EQCA 2DUXA 1F9CA 1GOQA 2BHYA 3TNBA 1L6GA 4DBUA 3WEOA 2A4AA 1LOLA 2D24A 3KX6A 3VC5A 2CHNA 4PB5A 1NVMA 1B4KA 3OLGA 2DPEA 2DQWA 3BMXA 1VLWA 2XVKA 3HG2A 5HBFA 2WHKA 3IJLA 1UR4A 2X42A 1VYRA 1ZFJA 2XN0A 2ZRWA 4ZQRA 4DJFC 2G3JA 3D3AA 5KTLA 1WPCA 1XUUA 4XAPA 5CAKA 1KM1A 3EOLA 4S3JA 4NZ5A 1X1ZA 3TE9A 2E6YA 4RDYA 2Q6ZA 1US0A 4NNCA 1W91A 4AWSA 1I0DA 1FHDA 5I3GA 3LTYA 5DMNA 5A6KA 1XL9A 5AYBA 1JUBA 3MKCA 4HKPA 3VM5A 3G6LA 2ZTKA 1WOBA 2EKGA 1GZJA 3CAWA 1R3SA 1OFEA 3F03K 4Y9MA 2PBOA 4JTQA 3TCEA 1X6LA 4DHGA 4HK5A 1UP3A 3ZJ8A 1JXJA 4ZTYA 1RPXA 1JCMP 3HA1A 3RJYA 1D8CA 3GAYA 3WQWA 5BYWA 3T0DA 1A49A 1QWGA 4XUGA 4HNLA 4Q6JA 3L2MA 3SUWA 2QAPA 2NSXA 1XS2A 4RUBA 2J7FA 2I5QA 2VQTA 3L23A 3DBNA 2X7WA 4MB3A 1QRQA 2OQYA 3GIQA 4GK8A 4C91A 2I57A 2VEMA 1KBKA 1XH2A 3NQGA 3BSHA 2IQTA 1M3UA 4LOCA 4I5UA 5ABGA 5D9NA 4C90A 1K4HA 1WDWA 1L9WA 4JR5A 4EF9A 2A21A 5H1WA 4AF0A 4L7ZA 4PUDA 1X38A 2VXNA 2ZDRA 4GINA 4GX8A 2PGRA 1EP3A 4CNTA 2Y70A 3PAOA 3Q4DA 4J3UA 1UWSA 4DELA 1ZUAX 3M9YA 2NW0A 1KV5A 1RLCL 1A5MC 3ABXA 1JCYA 5IFTA 3BURA 3MO7A 5J5DA 1GOXA 1XFCA 3MI3A 1OC5A 2Z1XA 4AC1X 1E56A 3O05A 3L4XA 5I3JA 3LDVA 6XIAA 3STPA 4JQ2A 2GSEA 3SCRA 1JF6A 3IARA 1GOWA 4ZSTA 1GJUA 1GVSA 3W28A 2ZX6A 3M0YA 5HQEA 4AZ7A 1XIBA 5A8GA 3HGOA 2WPBA 1B90A 5KITA 4UFMA 1XBVA 1W3HA 3O06A 5AC8A 4EWND 4FLOA 4BQ5A 2YCLB 3FYPA 4PUEA 3OGVA 3CWHA 3C2FA 1YRRA 2WLYA 2XYLA 1ZCOA 3G0SA 3ARPA 3ALGA 3LCWA 5D05A 2DEPA 3NL3A 3OA3A 3FJNA 3L9CA 3MJMA 3WJZA 3E49A 3K4WA 4DEFA 2WOQA 4YN5A 2QAFA 3E96A 3N2XA 4FIQA 1J12A 4UOZA 4U31A 3GM8A 1OFQA 2PRHA 4WY0B 1PTGA 2PDJA 2V63A 2WVSA 4L65A 1A5LC 2BHZA 1S2AA 2QCNA 3POHA 4PTVA 4EWJA 4OT7A 3S2MA 1IGWA 4WEVX 1UHVA 2H8XA 3AAMA 1JXKA 2YCLA 3LHUA 4A22A 4ATDA 1RH9A 1J01A 3TSMA 4YLWA 4Q4PA 2ISDA 1I2NA 1GVOA 4HSOA 3W22A 1I4NA 1G7VA 4DBDA 1XCFA 2V3EA 2YBVA 4IPNB 2B4GA 3NO3A 3V5OA 1QOQA 3DYPA 1E43A 1Z42A 3CXOA 2PDHA 4JNMA 4DJDC 2BY0A 1RXOB 1E40A 1ICPA 3U2OA 2WV8A 3MWCA 1Q6QA 3DFSA 2VTFA 1IE7C 3KE0A 5JUVA 3W01A 4C1LA 3KVLA 4GNKB 5G1TA 1SZRA 4CVWA 3HU7A 1FWEC 2ZC1A 4EPBC 1PO9A 4N4QA 4O53A 3UY8A 4I6KA 2O7QA 3FDGA 1W1IE 1W3IA 2PCQA 3WBAA 2H9AA 3IJ9A 1KCZA 4G5DA 3T8QA 4E8CA 5C71A 1VFTA 2E0PA 3VKKA 4PUNA 1OG0A 3TZFA 2H90A 4OGZA 4PZVA 4S3DA 5A94A 1D3GA 4H6RA 2CKRA 4W93A 1W37A 3XINA 3GH5A 4BI7A 4Q8PA 2YSWA 2W6RA 2UZ9A 1UR2A 3B0YA 3WH9A 4M6QA 3W2NA 1IXPA 2DZPA 5I3DA 5E09A 3EWYA 3W23A 3MS8A 4YIWA 3UD6A 1H49A 1QDSA 1D3CA 3RU8X 4R3UA 5PTDA 4MWAE 4P61A 5HR6A 3IUDA 1YTEA 1XCXA 1ZAJA 4FPSA 3R0UA 4CNOA 4IIBA 4OOZA 3ZWSA 4C6CA 2AL2B 3FNDA 1EJXC 3MUIA 2DVUA 1DJHA 4JTFA 3T2OA 3PZMA 5JXQA 3PPCA 3DUGA 1VRDA 4B3ZA 1NWSA 4MSSA 2UY5A 2D0GA 1HW6A 4BEUA 3BW4A 3CUIA 4DO5A 4GUGA 4HU8A 3FSUA 4H00A 4Q8VA 4JIPA 3N9RA 4DUWA 3E5PA 1MZRA 1FKXA 2POZA 1PHQA 1KB3A 3N13A 4YS1A 3L5LA 1HP4A 2MANA 4S3FA 1HN1A 2OSXA 3ATYA 3I65A 2I56A 3NM1A 1Q5MA 3KL5A 3G22A 4MFDA 1RVGA 1TVNA 1A5OC 3DERA 5A6AA 2C79A 3IEBA 4JN8A 5K3VA 1JD9A 5CZTA 3QQ0A 3WD4A 4K7YA 1K02A 2CXGA 1TMHA 1EOMA 1S1RA 1DVJA 1BKSA 2QJGA 1DPMA 1JPHA 2XSBA 1H5YA 3M5YA 3T2PA 3N04A 5E1QA 1GUVA 1C9WA 1P5BA 3PBVA 4PMXA 1B2YA 1UD2A 4FX7A 3NSMA 1YE4A 2RUSA 3HGRA 1AUSL 1MW2A 2PLCA 4XZLX 2JBMA 2CZEA 3MJYA 1GYLA 2PFHA 2J7CA 3CV1A 4MAVA 4B5NA 4ZOEA 3NQCA 4ZB5A 1TVLA 2CIPA 3IGXA 1AZ2A 1V3LA 1T99A 1PWMA 3AXHA 5M2FX 2ZX5A 1HZYA 1F3TA 4FF7A 4ES4A 1VFHA 3M0IA 4XSLA 3UCDA 4DZ5A 4PYSA 3K4AA 3WD1A 1QOPA 1RK5A 3BAWA 4B5TA 4R53A 3KWSA 4NZCA 4O18A 1W1YA 2J25A 5EYWA 4PUKA 4A2RA 3AI0A 1DE5A 4K7VA 4OVXA 1S5WA 3ARWA 3SFKA 2J9ZA 1I8JA 2VX4A 2BWGA 1XG4A 3SSZA 2YLAA 1H1YA 1S39A 2NLIA 4BQ4A 3OG3A 3P60A 4M24A 4GG9A 2A79A 4ORMA 3ARQA 3EOOA 2WYSA 2WM0A 4DX3A 4KEVA 4M7SA 3W6MA 4Y8EA 5C9RA 2BVDA 3GNRA 1AODA 2F84A 4DJEC 3VI2A 4NP7A 4B4FA 4CU6A 1US2A 3D47A 2X40A 4S2BA 1HL8A 5HQLA 5E0KA 1OC7A 4MY8A 4HTBA 3V1HA 4A3QA 2YCJA 3C6CA 4W86A 4J28A 5I3IA 4IP7A 1YKWA 3WQCA 1WZLA 3PULA 1XLJA 1H63A 2PDKA 1QBBA 3WUBA 4Q4KA 1EJWC 1UJQA 3QTPA 3QC0A 1GYMA 3P0XA 3MCNA 1V0KA 4AY1A 3TFCA 3RPMA 1KR0A 2IW0A 3GAKA 1BD0A 3SUSA 3PP7A 1EYWA 1FDYA 2QMJA 3QF0A 2R91A 2PAJA 1NP2A 4MNJA 3UQNA 1LRTA 4XG1A 2NWSA 5DT7A 3OZOA 5EU9A 3ITYA 3U2ZA 3SCOA 2VZTA 3VIFA 1G0CA 3RCMA 2LLEA 1LRQA 1TQJA 3WNPA 2TSYA 1W2PA 1T40A 3OIHA 4RDWA 4GYPA 1VJZA 3H53A 2Z28A 3APYA 3FLUA 4U28A 3VPLA 3QH2A 4X2PA 4O11A 1GTEA 2NXHA 2BLEA 1ADSA 4BZYA 2ZZ1A 3EPNA 1Q6RA 3I4EA 5EGRA 1CXEA 1N2VA 3VIKA 3CZ8A 1Z41A 3CHCA 3QKEA 3OBAA 2GQAA 3NFUA 1J5TA 4B15A 3KOXA 5DLCA 3MZNA 1KWKA 1T6MA 2WVVB 1TO3A 2H3BA 4BWLC 2BSLA 3ZLFA 3MY9A 3CAQA 3B0VC 3LV5A 1L6WA 4FP1A 4DJFD 1FOBA 2VI0A 4NUWA 1QOXA 3R8HA 1EO7A 5IHRA 1QHOA 3A5FA 4Q6XA 3CEUA 2ACSA 5IXEA 4AWTA 4GJIA 5AN7A 3O0FA 3UJEA 2B31A 3EXSA 3VOGA 4HOXA 2WC4A 4WCJA 3WH5A 2C0HA 4FNSA 2OYLA 3KOZA 1BG4A 1DXIA 1F07A 1PVNA 1CGUA 3MSRA 2WLZA 2CLPA 5KETA 5C0QA 2RDWA 4DJFA 2X41A 4C7FA 3L7RA 5M3WA 4GY7A 4IFKB 3WDHA 1VR6A 2ONEA 4QR6A 2ATSA 4XISA 3W1LA 1NQ6A 5LA0A 5DMLA 1PTDA 1V5XA 3F5KA 1UR8A 3BLLA 2YA2A 3PZTA 1Y5XA 1IEIA 4IP4A 1KBJA 3GO2A 5I3FA 3C61A 1XBZA 2V2CA 2QDHA 1J10A 1FH7A 6REQA 1RBAA 3QGKC 3SCQA 1TWZA 4TV5A 2QDGA 3CUXA 4W9TA 4HCDA 1GNXA 2D0HA 1H2JA 3EX4A 4FXJA 2A5HA 2Z6IA 1A47A 1N55A 3GVQA 1TRDA 3TONA 3STCA 2FJKA 2WJZA 4OJYA 4J3VA 4UTIA 2Y24A 1E6NA 1MRQA 4OECA 3CAKA 2POTA 2VEFA 4TX8A 1U1HA 3BLOA 3K1GA 2RJGA 3E1F1 3RF9A 4IX2A 1XG3A 1NDZA 5D9PA 5DELA 1I1WA 5D2XA 2QMKA 4M3PA 3WD3A 4K6AA 4NXSA 1XIDA 5CC3A 2YYUA 4CN1A 2P0OA 3URQA 4MG4A 1IV8A 2PD5A 4GABA 4ZFCA 4HA3A 1K8ZA 3N4FA 1A50A 5CBBA 3PANA 2RGLA 1US3A 1BGAA 2E6FA 3B0UX 1B3XA 5EFDA 3SCPA 2I17A 1BSLA 3I7QA 4PCNA 5CPSA 3LQGA 2INZA 4YVXA 4RW5A 1N8IA 3A6OA 5A8NA 4Z2GA 4ZXLA 4PEEA 3BTNA 4X60A 4DXXA 2XSXA 4CNPA 4ML9A 1TJ2A 2ZWZA 2I7GA 5B7ZA 3AZTA 3H21A 4DVOA 2VO5A 3NQMA 2A3HA 3DIPA 3PPHA 4BQ2A 3GK0A 5K7JA 1EF3A 1YPFA 1UD4A 1KM3A 3QW4B 4G7FA 1PSCA 5HMSA 1E3XA 3VIPA 5HANA 3A24A 1EJSC 3SSJA 2VC5A 4QAIA 2VNCA 5LIYX 3EPMA 3NL6A 4UTWA 5FSDC 1AA1B 1CXIA 3N2CA 3N2TA 4HCHA 4RDZA 1U33A 2DQXA 5D33A 4DZHA 1Q6CA 4QIUA 2VVNA 1T8QA 4LBRA 4CLMA 4WX2A 2WSKA 1RUSA 1PXGA 2XH4A 1DIOA 1WBHA 2ALRA 1KXVA 1MW1A 1R3WA 4Q8WA 3LXCA 5CQ1A 3VOIA 2JF7A 4MNKA 3SQLA 2WKGA 3JRKA 2GDUA 3UJ2A 3I68A 4XD5A 3HJEA 3SO7A 2YXOA 3HG3A 2ZRYA 3SADA 4XKYB 1OX4B 2GVYA 4J3XA 2HROA 2OB3A 3N29A 4S3EA 3T81A 1E5NA 1IXQA 2HISA 1YPIA 1IWPA 2Z7GA 4DJDD 3BH4A 4PBEA 1JCXA 4JDYA 4RNFA 2CPUA 4NYYA 3DBPA 4UTHA 3AWOA 2VFDA 4H4IA 4X22A 2Y89A 4GZJA 1CB7B 4PTDA 1QK2A 3BGGA 4MDOA 2IS7A 2XFWA 1GKRA 4XTIA 4V33A 4AUBA 1LQAA 3OLDA 1AMKA 2A2IA 5K9DA 5BOOA 3VZXA 1YBQB 1ALDA 3DFNA 1FWBC 2WANA 4ADUA 3JW7A 2E25A 4GI9A 3FV9A 2ADAA 2FHFA 4P8UA 3MBDA 4HZMA 4LCRA 3KRSA 3LS9A 4X9YA 1ZP4A 4DJDA 2BVTA 3TVAA 3EXTA 1XLFA 1Z89A 4R9OA 1XWYA 4PMOA 2QKFA 4L9ZA 2C13A 2NXGA 1QI4A 3QBUA 2VDHA 3W76A 4FOJA 3TXZA 3VKDA 1O5RA 2FZMA 3GQYA 1WKFA 4C1NB 5D8ZA 5T9CE 1XW8A 4LF1A 4HMDA 3UG4A 4LCQA 3WK0A 4MKSA 3UZZA 5MKGA 1RJRA 5GPRA 3W53A 1QPQA 5LSMA 1MRAA 3CH9A 1OVDA 1TA3A 4W7WA 1GOOA 2D69A 3G1SA 4M80A 4MADA 3FOKA 2OWXA 4UR8A 1P6CA 3VA8A 3W7HA 4CD4A 4O28A 2E5BA 1PKLA 4LYQA 1PDYA 2VM8A 3W37A 5EMKA 4GD0A 2J47A 2HSAA 5CJNA 1HFBA 4PUUA 3S42A 2JGQA 3PVFA 4GNJA 4O8RA 3UGRA 4W8AA 4Y2WA 5E0FA 5D8WA 3K4DA 3HOJA 3R2GA 2GUBA 3C3NA 4PMVA 5A6MA 4N9EA 2MUCA 2OZTA 2GJXB 1BG9A 3H7VA 1R85A 2CFFA 3SW6A 1REQB 3LXAA 3OZYA 5CSRA 4GGBA 1HT6A 1DIKA 2FYMA 1Z44A 1E15A 1BEUA 3DDMA 5CEWA 2E77A 4C6NA 1VEOA 2Z2UA 2NQHA 2B7NA 4ZQPA 3PJXA 4LAKA 3MB9A 1S2WA 1K1DA 1L8PA 4JN6A 1W5OA 2IQ0A 5GJMA 5JBDA 3Q58A 1XYMA 3PTDA 4LS1A 4FNRA 3R10A 4BI5A 3W4RA 2OODA 2YFOA 5I0DA 2D2GA 2QVHA 1A80A 5TD4A 1KD0A 3SGGA 1W2VA 2QEZA 3CL7A 4HZ6A 3W1QA 5AOUA 4BQ3A 3W7JA 1U22A 4FX6M 1JUEA 3CO4A 4LALA 2W92A 1A5KC 1TELA 3EOSA 1F74A 3PFRA 1HO4A 1MI3A 1BF2A 3V7PA 4O50A 3BLFA 5C7VA 3VNMA 2C1HA 4GRSA 4KRZA 1WAWA 1V6XA 1RQBA 2ISVA 5B7YA 3KP0A 1SZEA 3WD0A 1TJ1A 1AD1A 1GPFA 1BTCA 4GBUA 2GVEA 1GVEA 3PTMA 4JFUA 4MZ1A 5ECVA 3O6DA 3A21A 3QR1A 3IRDA 3Q45A 5EMMA 3W1RA 3KRBA 1PZ1A 4M0XA 1S3HA 4AZCB 3CLMA 4NJKA 3W7EA 4WDXA 4V1YA 5CAHA 4DJED 2PGEA 2JGYA 3JZEA 1C7TA 2Q09A 3CUGA 3MSDA 4A8IA 2D3LA 3E5BA 3LD5A 4LEQA 3TQPA 1SSGA 1RSCA 5I02A 4WIWA 4MKNA 5AC5A 5I24A 3DI0A 3W27A 4ZOCA 4DWDA 5A1AA 3AU6A 1ENUA 1UD8A 3GDRA 4LAZA 1R30A 2Z1KA 4O57A 1EO5A 1GQNA 1EH9A 1E0WA 1Q45A 1O1ZA 1WDQA 1PX3A 4DJEA 1QHPA 5HQMA 3BCJA 3LBCA 4QXIA 1B3VA 3GVVA 5AHIA 2X1UA 5HA7A 4DUXA 4NXKA 1EIXA 4FLQA 1H11A 2V38A 3CZLA 2PDLA 1M7PA 1WDPA 1VBJA 2JEPA 4UIOA 4MF4A 1VBGA 5I09A 1VCFA 4HSNA 5D2YA 3B8DA 2YDRA 4LUSA 3SFWA 5AC6A 1IZKA 4P2VA 4DF2A 3LG3A 1H62A 3DYMA 3BG3A 3M41A 2L5HA 5BOEA 1XRTA 3UXDA 4EXAA 1LWJA 5G1YA 3EEGA 2ZUSA 2OGYA 4U2ZA 4MKVA 3NM3A 1UKPA 2OQHA 4E2DA 3O3RA 4GE8A 4CQBA 1VPYA 4JNYA 4H2HA 4IHCA 2FGBA 2BOGX 1U1UA 2J66A 4HHHA 3CS2A 1UH3A 1SW7A 4ZO9A 5M17A 1ZHAA 3A5VA 4H7CA 1EZ2A 2ZUUA 2R1LA 3CLWA 3BGAA 3EKLA 1K9EA 3GY1A 5DRIA 3KEHA 3OHIA 3VO0A 4LBSA 1G4TA 1AJ2A 4TVUA 3HGSA 4JQAA 4EP8C 3WUFA 4FNTA 4AG0A 2E6AA 2E5DA 3KCOA 1OT1A 4S3AA 1NQKA 1KM2A 3EWWA 5REQB 4FZIA 1TPVA 4L4PA 3BLPX 2PDQA 4HBKA 1EBGA 2VELA 4KKXA 1U5JA 4YWIA 2NX3A 5KZ6A 1NWUA 4PEKA 4WGHA 4A29A 1UROA 4BWLA 3W1AA 1I60A 1LROA 4L6OA 4J1OA 2DGAA 3W2JA 3NYZA 3WZ0E 1V7YA 3ISIX 2V67A 3WNLA 1X98A 1GQJA 4JAWA 3GXMA 2UWFA 2Z27A 1MW3A 4Z1AA 3WFZA 1K9TA 3RX4A 2RKXA 2WVTA 1NIUA 3LUTA 5DCDA 2C91A 4PMUA 2WZEA 2D3NA 2FB2A 1WB0A 1T41A 3P5ZA 1H0IA 2IKJA 5FESA 5LIKX 2PWFA 3BDKA 2Q8XA 4O13A 4JPGA 3KOYA 4WOQA 1FXPA 4Q8OA 1XIFA 1UKTA 3S9YA 1MWOA 5DF0A 1J0IA 2OYKA 1CXFA 4YHEA 3HPSA 4W89A 1CDGA 1HP5A 3MP5A 4ZR8A 3NZ1A 3RO8A 2A7RA 4N02A 5CJ5A 4IX0A 4YVPA 3HPZA 4OUIA 5I06A 1VHNA 1NTHA 4AHOA 4MGGA 3VDBA 4PSPA 3JVAA 2QYGA 4LNCA 1QI2A 5FKYA 1LUCA 1N8WA 3U48A 3OPSA 3M0ZA 3B9AA 1ZBVA 5HR7A 4LSBA 3A13A 2ZZ3A 3L4UA 1RBLA 4ECLA 5GJNA 1TWWA 2OEMA 4Z1YA 3KOFA 1VPQA 1RCOB 5E9XA 4BF7A 1YTKA 5U4NA 4AZHA 4EK7A 1R6WA 2HMCA 2CBIA 2HXUA 3W81A 1Z69A 3L12A 2QCFA 1CEOA 5JU6A 1OWQA 2BVWA 7PTDA 1WKDA 3XISA 3UR2A 1XJBA 1A5BA 1VD6A 1R86A 2ESCA 3C2VA 4LUTB 4D71A 3TU9A 3DYOA 1VRXA 2P50A 4NRRA 1Q6GA 2QQ6A 2C1GA 4LYPA 5EMJA 2FGLA 3SRFA 2YL5A 3IIVA 1R3VA 2IPFA 5HUOA 2HVMA 3T42A 5A3HA 2CZFA 2QF8A 2FZNA 3QN3A 2AQOA 3B03A 3WO8A 4M56A 2A6LA 4HGXA 1N8FA 2P1FA 4XBKA 4AISA 4F2TA 4E2BA 3S1XA 2DVXA 1Q3NA 5LA1A 2GGEA 3S1VA 1QJWA 1WZKA 3F4CA 2I5GA 2EJ1A 3CO8A 1H1NA 4H9XA 4KFOA 2CBJA 3E3HA 5DY3A 2WJDA 1I1XA 4LUTA 2REQB 3GXIA 4YYFA 2R24A 3R0KA 4HOZA 4F2BA 3GXNA 4KF1A 4NZJA 3ZIZA 3KW3A 3MA8A 3W7QA 1MW0A 3G3DA 3RLUA 3DAQA 4S2CA 2Z24A 2C3ZA 4TIMA 4UFLA 4Y9AA 4L6HA 2NVCA 5DXXA 4RCXA 2WC3A 4I5RA 4S39A 1J6PA 1I75A 2C18A 3DHPA 3W9ZA 3SCNA 2ZA3A 2F2HA 3ZSTA 1TPUA 2AMXA 2OPJA 1YX1A 2QJIA 4F0MA 3W7IA 3BOXA 4B5XA 3AIRA 3O6CA 1XLDA 3U7BA 2YDAA 1S2UA 3GNPA 3T08A 3C2YA 2ZXBA 1UASA 4W85A 1I45A 2QCEA 5HJXA 2JEQA 3GLCA 5EMLA 1QVBA 2WNQA 2OKTA 3I6EA 3QR0A 2WK2A 2ZE3A 3JUGA 5GQBA 4GVGA 5CPOA 3ES7A 3K1DA 1XD0A 1MVYA 3IJ7A 2IKHA 3VMPA 3S6TA 5DBTA 4OZOA 3N2MA 4KT2A 3TYAA 3N6JA 3UFYA 2DT0A 4AU0A 3VGDA 4GC4A 1FP9A 2WSRA 1MXGA 3FYOA 5JBEA 2YBTA 4HSHA 3G1DA 4UFIA 3WJXA 1F6PA 1Q6EA 1XYAA 4HK7A 1SVDA 3UWUA 3TA9A 1KV8A 4RKAA 1DWJM 3KXQA 4ZL1A 5LXEA 3ARSA 2ZVRA 3HPAA 1AW5A 3TN6A 3D6NA 4GVFA 4HHMA 3NURA 3BJTA 4OQVA 4Y6GA 4GMEA 3BE7A 2IXUA 1EGMA 4ZTXA 4O14A 1EBHA 4YYCA 1XM3A 3S1WA 1V02A 1IQ8A 3UG8A 3SY5A 3ZVHA 4DM2A 4GI8A 1BKHA 4ZQMA 3PS7A 1R7AA 4UTKA 4M1RA 3G1RA 1BRLA 4QEHA 1HNYA 3FEMA 3QY8A 3KVKA 2RGMA 4JDBA 2Y5SA 2RAGA 4W4QA 5DMMA 1R2TA 4OE7A 1U30A 3QJAA 4HTYA 4GXWA 2VGGA 4PL2A 5DO8A 1DP0A 3UCQA 1EPXA 3MCMA 1BYBA 3FAXA 5BRQA 2P5NA 2J62A 1AFSA 1OG6A 3L4YA 3VFCA 1WOAA 3E0LA 1RPKA 5DCEA 4QDWA 1TPB1 3LBOA 3WNKA 1MEIA 2EHHA 3SUUA 1E9YB 1JAEA 3A3WA 4C6MA 2E7FA 1V3HA 4WSKA 2JFEX 3SJ3A 4PTWA 2O9RA 1F3WA 1CGVA 3TQKA 4ZEPA 4DRSA 3ORWA 5LZLA 3WQ5A 3V5FA 2FFIA 3W7KA 5IM51 2JALA 4BI6A 2HEJA 1EC9A 4XQ6A 3PHAA 1XIGA 3GVGA 4QS6A 1NWRA 4G7EB 4AX7A 5F4SA 1XLAA 3IJQA 1K6WA 2QPXA 2ZZ6A 3GXDA 3B04A 3AS3A 4HA1A 2DH2A 3QGVA 1VGAA 2ISWA 4FX8A 4PGLA 1UPMB 5HWMA 3DKJA 5FF2A 1TQXA 2XN2A 5JQ9A 5AKQA 4ORIA 2G4JA 3NPVA 4FR1A 4REQB 1I0BA 1V4YA 3N6QA 3VNLA 1FY6A 2PEVA 3G1VA 3GU1A 2Q3OA 1WUEA 5AHFA 3WD2A 1XKYA 1NP0A 2F2KA 1F5ZA 4WXYA 3WNNA 3O0KA 4NL1A 1QO2A 5AC4A 1JZ6A 1WZMA 3NXFA 3VGHA 4F40A 2QV4A 1BYAA 3TTOA 3DECA 2CITA 4WGXA 1VCVA 3OO2A 2X05A 2QUMA 3H54A 3R25A 4UTMA 4J40A 4DI9A 1ZL1A 3HG5A 3G24A 2ZVIA 2J8GA 3GE7A 2O9OA 4IMEA 3NZGA 2HDJA 3TYUA 3QMSA 2GGHA 4JTGA 2OGJA 1KGXA 3M0VA 1NY1A 2RHGA 4V15A 4J3SA 3TMLA 3VK5A 2NVAA 3PPGA 4LRTA 3NA8A 4JX5A 1GW9A 1ZCCA 3LPPA 1XPGA 1WKYA 1Y5VA 1G7UA 1ONWA 2ZBTA 1CGXA 4X0NA 3BJFA 4UR7A 4EE9A 1OX6A 3DN5A 4AIUA 1K7FA 4MJ2A 4WHBA 4IPJA 4CN6A 2WJEA 1J5SA 5FJTA 1O5XA 3EDKA 3IS4A 3R13A 2WMHA 1R7OA 2DSVA 3AIEA 3PFMA 3NVDA 1IT0A 3LBMA 1AK5A 4F0RA 4PFMA 4EPEC 2VEKA 2XN1A 2ZFAA 3G77A 1UQYA 5LNSA 3UWQA 2ZDSA 2OX1A 1UP2A 2AQVA 1V3KA 3ZQ9A 2BOFX 1TTIA 3AUOA 3WLHA 2DJXA 4AY7A 4GQQA 3NQAA 4OUEA 3KLLA 4CU7A 1EC8A 3N4EA 5CZSA 2CHRA 4MYAA 2PBGA 2BY3A 3Q2DA 1EOKA 2BZNA 2GGJA 3WK2A 1TPC1 5E6ZA 1WO2A 5ABHA 4D6FA 3LA4A 1W9DM 2QGYA 1Q6LA 3KBMA 3W72A 1E6SM 3KL3A 2EPOA 2DSUA 1V93A 1XISA 2NV9A 4ZA0A 3W84A 4LH8A 4NZ1A 1SSDA 4M51A 3VE9A 4IGNA 3AOFA 4NG3A 5K4ZA 3T40A 3TTYA 3AO0A 3O1NA 1Q63A 7TAAA 2CLMA 3L4WA 4J3TA 4HNNA 2PWGA 2PPGA 2J9YA 1X7IA 4DAFA 2CBVA 2VFHA 1CB2A 3IV8A 1TTQA 3GFYA 1QI3A 3ZJ6A 4NKCA 2VJXA 2GSHA 5J5RA 1VB9A 4Z2JA 1Z48A 2YL9A 3U4AA 4ACZA 1B3ZA 3UGVA 3KAOA 1TR1A 4U3CA 3RITA 1EDGA 4B5VA 3GZAA 3UWWA 1QUMA 4AMCA 1UR0A 3QOMA 4HOWA 3D46A 4LY8A 3APGA 2RDUA 3QZ6A 4HNCA 3FGCB 3ABOA 4L80A 2NQJA 1WQ5A 2HV5A 1QU4A 3UNTA 3WEZA 3VDGA 1ZRQA 1U5VA 3AMDA 3U2EA 2PCEA 1TR9A 3E0IA 5I77A 4WR3A 4KBXA 2ZUTA 4B9YA 1KCKA 3A22A 3TYBA 4UCGA 1BWLA 3LGGA 4AQLA 2PDYA 3MHUA 3NQDA 3PUOA 4XD3A 1AL8A 2VD8A 3BV4A 2UV8G 3BUVA 1ICSA 3W7PA 1MNSA 4YNGA 5A2BA 2YCIX 3FN9A 4GNVA 1ZP3A 1UUOA 2PDGA 3KBSA 1C29A 2BNJA 1JAKA 2VOTA 4Z2IA 1Q65A 3BICA 3E2SA 2TAAA 1OINA 3WLQA 2NT0A 3IAQA 4HD5A 1BFNA 1LL6A 3LX9A 2PDIA 3JZUA 1R87A 3RX3A 4M6PA 4GZEA 1OZMA 4LW7A 3L68A 4L64A 3M7WA 4E2OA 2CLEA 4A8RA 3FW6A 1RP9A 1KR1A 3LPGA 2JF6A 2EJAA 4GX9A 1CTNA 5CSSA 2PWVA 2I9UA 1HVXA 3NPUA 5G2IA 2OFJA 1NOWA 3MMUA 3LMYA 1M53A 4ZOBA 1CW2A 4UTJA 3S1GA 4MDPA 3H2EA 3KDOA 3LK6A 3Q67A 3HIJA 3P82A 3PF3A 4H1ZA 4ASTA 3AHXA 1YEYA 1FP8A 3H2FA 3PZVA 3UERA 1MQRA 3AROA 5LNVA 5I7GA 2EG8A 4PRRA 4C6JA 3B9DA 2FDSA 1KXQA 3S83A 1P0DA 3L0GA 4GGHA 1J0ZA 1GK8A 2ZX7A 3ECQA 1WV2A 3NQ6A 4OV4A 1XGDA 5BW6A 3WLRA 3CZJA 3AMGA 5C8BB 2VZUA 5E6YA 1J11A 3G6MA 3T1GA 1TV7A 3CUHA 5JVLA 3LLDA 2FMNA 1YYAA 3ZZ1A 4L1XA 1GOIA 3I7SA 3CAVA 2GLKA 3M6YA 2OT1A 4DYJA 4C6QA 1SUXA 4PUJA 5FJIA 3C5QA 4AVFA 4C6PA 2YFNA 2J79A 4RZ5A 3AXXA 1EHNA 4NILA 3VMNA 1Q7MA 3W2KA 3WDJA 1ODUA 3KCJA 4F66A 1RD5A 5FEXA 3ZS4A 2WNWA 4J9JA 3H2MA 3B9NA 2Z4GA 3K2GA 5DT5A 1JJKA 1OCBA 3TQ0A 1OGSA 3IVTA 1FCQA 1K9DA 3EAUA 3HBLA 2A3CA 1QW9A 3QGAC 4JIRA 2O9TA 4R7WA 2A6NA 2Z26A 1VCGA 4JL2A 1B3OA 2XZ9A 4Q4MA 1TV4A 2YA0A 3TN5A 1R0MA 3IJ8A 3O07A 1NJJA 1AZ1A 3V4BA 3WF3A 1GEHA 3QEZA 3S0CA 5LGXA 3VINA 2G95A 3W71A 4IUOA 3F2BA 1ZTVA 2QDEA 3GX9A 2C0AA 3B8UA 1YDYA 4K3ZA 5LIUX 1ISZA 1DEDA 1OFOA 5AYXA 1NM9A 2AMGA 3CYVA 4I9JA 1N7KA 4YL2A 1B54A 3NL5A 2FQIA 1OYAA 1BXNA 4XTDA 1LT7A 2V2DA 1R9YA 3GYEA 2FH8A 1PPIA 1F7BA 3TJIA 3VDHA 4P7NA 1YXDA 3H2CA 1HJWA 5DN1A 4C1KA 3QYQA 1KO0A 1VP5A 1TIMA 3RGTA 3VCNA 2CWXA 1TE1A 3TYZA 4ATLA 4NU7A 1AJZA 4V2XA 3C0LA 3H4WA 3W29A 3AIBA 3AS2A 1EEPA 4U5KA 4LAUA 1V6TA 3NQ2A 2R8WA 2HXTA 3VNJA 3A64A 1XQKA 3RMEA 2CC0A 1CNVA 2PP3A 3RXZA 1GQKA 3UJRA 1AL7A 3WL0A 1OF8A 2XH2A 5TAOA 3GNDA 2NSOA 3CV2A 1QR7A 4OBSA 3QW3A 2DFAA 1E0XA 4JFSA 5GVJA 3FIGA 2PUZA 4JTLA 3T0AA 4AWUA 1Q6FA 3OQ8A 3THDA 5B80A 1QXLA 2YCKX 5K9XA 1QNSA 2X1TA 2NZLA 1POJA 1SJBA 2V30A 4LBUA 4H04A 1OCQA 1MNZA 5FEPA 5FACA 4ZGYA 4DLMA 2PDPA 3CMJA 1H60A 5D32A 1P6BA 4BS0A 4LCSA 3OYZA 1SFSA 1TMLA 1S5TA 1KFWA 1JQVA 4GIRA 1F4HA 3IACA 4GZIA 4IIEA 1B31A 1ITQA 1Y8BA 3AXIA 1QO5A 1FQ0A 5F2GA 2QUTA 3CQHA 1XLMA 4X63A 1S5MA 2AKZA 1XSJA 3NOYA 2Y7EA 2ZRVA 4H8UA 1QPKA 2V5JA 4GO8A 1LLWA 2VFEA 3VKAA 2GJLA 1HJXA 1DWIM 2FDMA 4XVEA 1GKPA 3E12A 3TA6A 2YB4A 4Z08A 4R9XA 1AH3A 3RAOA 6TAAA 2ZZ7A 1V0NA 5HATA 5HMDA 4UTLA 3PTQA 4MNMA 4G6CA 1XRSA 4MTVA 1W5QA 3R0DA 3S9ZA 3L4TA 1EGVA 2JKAA 3TC3A 3MHFA 4QITA 4IIGA 2V8ZA 4MOZA 4JTUA 2XJ7A 2FJUB 3M4HA 2PS2A 3RIKA 5HMEA 1FTXA 1SPQA 1UH2A 1E4MM 4D6HA 1VIZA 5IHSA 3ARTA 3BOFA 4YCPA 3LMZA 4N9CA 5J04A 3HV8A 3NQFA 4R33A 4MY1A 3WLTA 3ZJ7A 2WZIA 3RK8A 4R7JA 3BAJA 3F1QA 5FF0A 1ZBCA 3E2VA 3VDAA 4LTSA 1KQZA 4G1NA 2HS6A 4PH6A 4XZIA 4YVVA 3G1FA 2YL8A 4GH3A 4LUYA 4NI8A 5FF3A 3WY1A 2YKKA 3G2GA 4IM4A 4H41A 3CIVA 3RR4A 1ML1A 3LSBA 3CUJA 1ZBKA 1H61A 2YCEA 2TODA 4Y9PA 4B4HA 3HB9A 3BPWA 3GUGA 3M5XA 4UTUA 1UOKA 3UR7A 3HTWA 1P43A 2IKIA 3M0LA 2QXWA 1E6RA 5DEZA 1OK6A 1F3EA 3OYXA 1G9HA 1XLLA 3TN3A 3K8KA 1EX5A 5I2UA 3C3UA 3FXYA 4IL0A 1W1PA 3U57A 1ZB5A 2DU2A 3QMRA 2WPGA 4NAEB 1J79A 3SQSA 2CERA 3LCIA 1CPUA 1DIDA 4I3GA 1XUZA 4EAYA 2VC7A 2ASHA 1LOSA 1XIHA 2OKOA 2C71A 2NQ5A 1XYFA 1LP6A 4IQLA 4PL1A 3BW3A 1XSIA 4H7VA 2ACUA 5F4XA 4ERIA 1NWTA 2XIBA 1OSEA 3S2CA 3DC8A 1ME8A 3M0KA 3ABRA 1HF6A 5AFDA 3M07A 4O1CA 1KKRA 2R82A 3WENA 2B81A 1IF2A 3NCOA 2DSZA 5FJRA 1R3YA 1FWCC 5ABFB 3H24A 3M0XA 1JCTA 3SGUA 4EF8A 2V81A 1CXKA 4N4PA 2VX5A 3R1ZA 1F2JA 4AIEA 2PURA 4C6OA 3G0XA 1EJTC 4ERGA 4GHRA 3SRHA 4JZ5A 3T0TA 5C55A 4XIAA 2A7NA 3GKAA 3T6CA 3CEPA 3ITXA 1UC5A 1NDYA 2VX7A 1RA0A 1C91A 1EPVA 1F73A 4FSAA 4WJEA 2FVLA 4QAWA 1RCXB 3RMJA 2OEJA 3E02A 3E0VA 1K77A 1HVQA 2EG7A 1VYPX 1G6CA 1KFKA 5HNNA 5GNYA 4YPJA 3S5OA 1LQ0A 3IK4A 1PX8A 1Q7ZA 2V5KA 2ISSA 1OK4A 1S5NA 2GDQA 1BSIA 4UC5A 4D6DA 4FS9A 4YWSA 3C8NA 1YADA 1EWEA 4LV9A 1G94A 1W17A 1S2TA 4DNMA 2WC7A 2J4GA 3LCLA 3TKFA 2PLJA 3AYVA 2PC8A 1EL3A 5HPOA 3T8LA 2YYTA 2GGGA 3I3EA 4C60A 3B8TA 1SYTA 4IGSA 1J6OA 2GJPA 2R94A 3MWAA 4A3UA 2WXDM 3DG3A 3UR5A 3O63A 1JULA 2FFCA 3KHJA 4LEFA 1W9BM 3SBFA 1GWJA 2WHMA 3RU6A 7REQA 1UCWA 4EXBA 3N11A 1OYBA 1E73M 2GVJA 4TVDA 4CD7A 4JQ4A 2Z2AA 1H4PA 4O54A 4Y90A 2YZ5A 4L4LA 8XIAA 5AVNA 4IQDA 4DPPA 3HN3A 1S2VA 4JL1A 1XIJA 3PZUA 3VAVA 1HUVA 4PULA 2ZX8A 1CWYA 4JY8A 4D2JA 3POCA 5ENLA 3M1ZA 2HWGA 4KRTA 2FVKA 1NF0A 4BFAA 1I9CB 1O4UA 1XHGA 2WCGA 3H4XA 2GQ3A 2C19A 5AB3A 4TV6A 3GDBA 4QE4A 2HBVA 4QSHA 3L5MA 2UY3A 2E8YA 4PRTA 3N9SA 4A6GA 2FPYA 4BKNA 3WK3A 3UXLA 3S6DA 2Y7FA 1EA0A 3NJ3A 4FNPA 1WCGA 2QNEA 4ZZ9A 1MZHA 3UYIA 5AHLA 1ECEA 3WSUA 2VEPA 3KVMA 3AICA 4JYDA 2WMIA 3NR0A 2XVGA 1XBYA 1G4SA 3VIGA 4JEJA 1T96A 3TN4A 4UQAA 3WDIA 1QNQA 3SCVA 4HIBA 5IDZA 1ITUA 1JZ8A 2XM2A 1POKA 3TCSA 1S5VA 2VUYA 3VFLA 1YLVA 4LANA 3W83A 5CBIA 2BY2A 1ADDA 2VYOA 2OVLA 5AYYA 3VNYA 4KIRA 4AF0B 2EGZA 4JCLA 5EBAA 3NIYA 4NJIA 2XDFA 5EKYA 1FFQA 3I7RA 3DFOA 2ZX9A 4FXRA 4O17A 4JGDA 3EB4A 1OFAA 1TJ0A 1XDLA 1MYRA 4KEZA 5K4XA 4O0QA 3QOKA 4KETA 3C2OA 1MUMA 4IIHA 1X39A 4NAFA 4MUZA 2DVTA 3IPWA 1XCWA 4LVBA 1W1B1 3KS5A 2RH9A 3N73A 2EAWA 3QQWA 1Q6OA 1Q7QA 3T0CA 4UR9A 2VFGA 3BWWA 4D9PA 1JZ3A 1GVIA 1LT8A 3LHWA 3PBYA 4D8AA 1HKMA 2D23A 3EMCA 4P5UA 4LPCA 1JRBA 1QHZA 4GYFA 4QG9A 3ZO9A 1YDVA 1KRBC 1WXZA 4XIMA 4WKAA 3TK7A 3WH8A 3QZAA 4JS3A 1Q66A 4A4AA 2Y1HA 1C8YA 4LY4A 1RY0A 3EX3A 1K4GA 1LCOA 3NZQA 4QCEA 1TV2A 1JGIA 3M46A 4DF1A 4HP5A 4JTAA 4DWSC 2AQWA 5A6LA 3V0TA 3ALFA 2CLHA 2E67A 3MSGA 3AYTA 1MQQA 3MYPA 3AS1A 4OKDA 3NGFA 1EB3A 5I3HA 3IUIA 5ABTA 4UTWC 3UESA 4INFA 2YA1A 2X09A 2XIIA 1E6QM 4O15A 4LVDA 1I2RA 4ZQOA 2WCAA 4AD4A 1H1ZA 3L65A 1BVWA 5D30A 2QCMA 2PZ0A 4I8YA 3OZPA 1OGBA 4GC3A 1SR0A 1FBAA 3ANYA 4ZCWA 1UWQA 2V9DA 3T0BA 1J2BA 3UNDA 4K1GA 3TJXA 1EF2A 3S2NA 5I00A 3VE7A 4CVUA 3FS2A 4LFYA 3QPYA 1OD8A 4O8AA 3IAPA 2CW6A 3MVIA 4GXMA 1IZCA 2GJNA 3FVMA 4AZIA 1KTNA 1E0VA 2CLFA 2VX6A 4F9JA 1VH7A 3J7HA 3HFTA 3THUA 1PDZA 2VFFA 4H01A 1QPNA 4UQDA 4H3DA 4X3ZA 1DJGA 4IIFA 3UP8A 1TZ7A 1Q85A 3CPUA 4A05A 3O8AA 2XFFA 1E3ZA 3S5ZA 3H2AA 3AHTA 1UWUA 3II1A 4NVTA 1TREA 4FEZA 1W3NA 1QT1A 1PB0A 3NG3A 1CGYA 1EX1A 3B8WA 5FJPA 3SECA 2F6XA 4GUIA 1MEWA 2H9AB 3W3OA 1BAGA 2ZCGA 2G0WA 3SY8A 2Z00A 4GFSA 4K2SA 4C6EA 5A8PA 3MUAA 3H6OA 5A6JA 4KPLA 1W5NA 4NX0A 3B8VA 4ENLA 1R8LA 3DFQA 3WX7A 3CZEA 3RX2A 1ODZA 1WYIA 1RR2A 4D1IA 3SIMA 2IQDA 2GPTA 3LENA 4HCLA 3QYSA 1U2YA 4QSFA 2XH7A 1HKVA 2JIWA 3WQ8A 1BLIA 4J3WA 1HL9A 4RPQA 4EKJA 2Q01A 4RJEA 2NX9A 3PZQA 4DXVA 1EFZA 1MUCA 4M6UA 4XO7A 1EJ7L 5AYZA 1M5WA 1CYGA 5AHEA 3TYDA 4LQ1A 1L2QA 4G1KA 3WF4A 4U3AA 3ZM8A 2WCSA 4WXZA 2VFIA 4QQ3A 5F2IA 2AGTA 1CZ1A 3P84A 2OX4A 3GR4A 3UU0A 1F3XA 4HJFA 2PRLA 5KZDA 1OB0A 4UMCA 3OG2A 2DT3A 4NX5A 1NU5A 5CGMA 5C7HA 3BL3A 1W56A 1O1HA 4PBGA 3R4IA 1UWIA 4UTTC 1SFTA 1R3RA 2DT1A 4YMZA 1JZ4A 5CSUA 4Y9NA 3PB0A 3PG8A 3BMVA 2ZXAA 2J88A 4OBTA 5D03A 4O1DA 2J7GA 2TYSA 4R85A 3O16A 2HCVA 1JYXA 3OOQA 5XIMA 4FA3A 2IUZA 5LA2A 4HJWA 2QIIA 1BTMA 2V69A 3DXIA 3B0XA 1W1VA 4ZQCA 1X7FA 3VNIA 4FXSA 4YTSA 1ADOA 4PODA 3T44A 4FIRA 4G8TA 4S23A 4KWSA 5CZKA 3JR2A 5HXMA 3CUFA 3F5LA 1UG6A 3GR8A 3WUEA 4UOJA 3VOFA 4AC7C 4K36A 2FZ9A 4PCTA 3SN4A 5FL0A 5DY2A 3TWBA 3LPFA 4IISA 2J78A 2VR5A 1H09A 2VRKA 3C86A 1DQWA 2VCAA 1UW9A 3GBEA 4J27A 3H8AA 3TJLA 4O52A 2R9RA 5HAOA 2PSNA 1MDLA 4AMAA 1G69A 2DIKA 4OFCA 1TWSA 1WZAA 3IV3A 5GNXA 1YQ2A 4M6VA 4HPHA 5CGTA 3ES8A 1XGEA 1NOUA 4IFRA 4HPGA 4QJ3B 2GJRA 3EZ4A 1BF6A 1SGJA 4GQBA 3CL6A 2JK2A 4TX6A 4ROPA 4D1JA 3B40A 1HQTA 3NSXA 2O56A 1MXSA 3R8RA 5KEZA 3UYCA 4IMCA 3XIMA 3WDRA 3NEHA 4N42A 1BQGA 3PNZA 1ME9A 1QBAA 4JFTA 3U6WA 1TSIA 2GOKA 2QULA 4AD2A 2CBUA 4XD4A 4MZ8A 2W0UA 3MQTA 3WLJA 5FJOA 5FF7A 2VDIA 2I5IA 3AMCA 4CNNA 1DWAM 1GZ1A 2GVGA 1PKYA 1V7AA 2ZZ4A 1FUYA 1TVPA 4GVHA 3MC5A 3LHTA 1OADA 1DXFA 4LAMA 4US5D 4MIMA 3GSMA 3OLIA 5A8OA 3GHUA 4ZE5A 1D8WA 3HQPA 4QS5A 1ZJHA 4IMAA 2Z1BA 4B90A 2PZNA 3WQGA 1XIEA 2HK1A 2CETA 4L61A 4NASA 1TUFA 3TFXA 1JPDX 1RD6A 3VKBA 1FWIC 1E4IA 2R1KA 2QGHA 3REQB 2IKGA 3CMFA 1AMYA 2X2YA 3R79A 2W61A 3ITOA 4KS0A 2BASA 4LT9A 2QW5A 3UG5A 3V16A 5JH1A 2QPSA 5DX7A 4MJ4A 3I4KA 1B4EA 3VD9A 3GTIA 5DMYA 1XPYA 1W9XA 5IDIA 1HTIA 3UZWA 5BRBA 5H8MA 5A95A 2X0HA 4US5A 2IMRA 3EWUA 4IQEA 4N2YA 1F05A 3VNZA 3OGRA 2FZDA 1H7XA 2BXYA 4MWAD 4CCDA 3V75A 1AQFA 2TRSA 2X7VA 1R3QA 5D2TA 3B4YA 3BMWA 4PA8A 5BRPA 2J8FA 3MV11 4MZYA 3TR9A 1S1PA 1W6TA 1XR2A 4RNJA 1KRMA 3F4DA 4QJ4B 1HX0A 3NDOA 1JL8A 2C7FA 1IT8A 2Z1VA 1PHWA 1IHIA 1W31A 2CYGA 3LSCA 4EX4A 1C93A 3REQA 2F9RA 3V3WA 1L8NA 4CEUC 3B06A 1PJ9A 2CWNA 4XZBA 1DHKA 1DIEA 3RM4A 2A3BA 4MWAA 3GG0A 1V08A 3IGUA 3PJWA 1SO6A 1E6XM 1BVZA 2VGIA 2VGFA 3B4UA 2ATMA 4V1XA 1UIPA 2O4MA 2FTPA 4XSMA 1YNQA 4NJGA 2B7OA 4FF5A 3R7MA 3W1NA 3T2QA 1QW8A 4LS0A 5TIMA 1CGTA 2VENA 4IMFA 4LVFA 2HVOA 3LHYA 4LB4A 1CECA 3VIMA 3FEQA 3KRUA 2W91A 5T8GA 4Z2LA 4YCOA 5BZAA 3UPWA 3H55A 2HK0A 1VFMA 4UQBA 1D2KA 4CNSA 5LKYA 1QNVA 4QDMA 3MP3A 1HGYA 3NEVA 5K2ZA 1WDRA 1OFPA 1PS9A 3GIYA 5I5RA 4YTRA 4CEXC 2A1YA 2DZWA 4RL3A 1DORA 3BAYA 3N12A 3OVRA 3WUGA 3RHGA 1TE6A 2B0MA 3VU2A 2UY2A 4HU0A 3T09A 2ZUMA 4AYSA 4PE8A 2PTWA 4HU3A 4EOUA 3F2DA 4O10A 3BLIA 1JDCA 2DDXA 4LF2A 1OABA 5U7SA 3G8RA 3VGBA 2RDXA 4QG6A 1JPMA 1H3GA 1QFEA 1EJUC 1VFSA 4GISA 2WSPA 1S2CA 4PMDA 1VFOA 2Z7KA 1W54A 4JYEA 6REQB 3RO6A 2FPTA 3N14A 4PTMA 3ITCA 2V68A 4Q3MA 3WJWA 2ZOXA 1JNDA 2VC9A 3DENA 3L5AA 3U5YA 2OG9A 1OT2A 2W62A 1JR1A 1QAPA 3H26A 5CXPA 2J6XA 4XBJA 3HFYA 1DJWA 5EL1A 4GCAA 4H9MA 1VFUA 3NAVA 1VPXA 4YJ5A 3P81A 4JKMA 1LORA 3BVJA 1K03A 2CXEA 3EWDA 1GORA 2YIHA 3SURA 1TFVA 1VBRA 3UETA 1T0OA 2DH3A 3BK0A 1DHPA 2UY4A 2HNHA 2Y8UA 3OZMA 5GNZA 3U9IA 1SMAA 1DWGM 2A3AA 5FAGA 3VZZA 1KKOA 1O5QA 3W26A 3MUZ1 3WMCA 3HQ1A 2ICSA 1FDZA 3IUHA 3N9KA 4BHYA 5E70A 1TJPA 1QMLA 3VYLA 1ICQA 3CPRA 1WDSA 2BGSA 4IPPA 4F0LA 2GSJA 3WJYA 4NYUA 4C5ZA 3AHVA 2B7QA 3WQPA 4JHZA 2VEGA 4KRUA 4S3BA 3BJSA 3NDZA 3ANVA 1THFD 4XUYA 3WLOA 3NXLA 1VEPA 3LI1A 2QF7A 3KVJA 1UA7A 5I07A 1W32A 4B5UA 3B8IA 1UWAA 1A5AA 3UWVA 2HQAA 1ISYA 3NPXA 1T8XA 5BNKA 3CB3A 3MPGA 3QY6A 4DWSB 4GH1A 2XFYA 4ZOAA 3LI0A 2YB1A 3KTXA 1RQEA 4UZUA 2VEIA 4DWSD 4POCA 1RCQA 3LNMA 4L4MA 2NWRA 3LERA 4Q32A 2ZA1A 3AXMA 2XHYA 3LCHA 2C15A 2AGKA 1B9ZA 2PDCA 2WSYA 3UCCA 1JEZA 2HZGA 3TYEA 3S5SA 1AJ0A 3W70A 3M5VA 4HYWA 1DJQA 4DF0A 2GUYA 4DI8A 1FCVA 4TX9A 3ARUA 4WF7A 3GFZA 1OIMA 2WWDA 1WUFA 4V27A 3RYSA 1X8FA 3ME3A 4KCVA 1O66A 1J93A 3BLDA 1Z3NA 3DFTA 2VR4A 4DWSA 1FCUA 3CTTA 2WKJA 5CZ0A 1W3TA 2ZKMX 3TSBA 1JQXA 4XZNX 3S3GA 4BCEA 2ISFA 1TV5A 1JIBA 4F9DA 4ICCX 4J4KA 2XUCA 2BG5A 3QKZA 3A4JA 3UZJA 3PN8A 4U33A 3EA3A 3CHEA 1FWHC 4WD0A 1FWNA 4IT1A 1ZJIA 1A0EA 2WO5A 3ONCA 4UMBA 3W86A 2ZA2A 2ZYFA 1SZFA 3AU2A 1SFLA 4HPJA 4ZENA 3LCXA 3WLLA 1FWJC 4IG2A 2NVDA 5BU6A 5HULA 3C56A 2YW4A 2VURA 4LAOA 2CCRA 4XK2A 1FA2A 3EX1A 2QCDA 4M19A 5AZ0A 1P7TA 1ECQA 3RILA 1TPH1 3OA5A 2Y6ZA 3LN3A 4GACA 3THCA 4DAIA 4JIIX 3CU2A 1L6SA 1SZGA 4MB1A 3V18A 1WKEA 4XAFA 5DQPA 6ALDA 2XFRA 4CD8A 1X97A 5HMFA 3BC9A 1UYQA 4TR9A 3SI9A 2XVNA 1XLKA 1GJWA 1S3TC 5CPQA 1V6VA 2NQLA 3QZEA 4WQ6A 5LIXX 2QUVA 1KXTA 4UOQA 5KMYA 1BPLB 5MKGB 3WMBA 4OBRA 2NLYA 4JN7A 3APTA 2DW6A 3DGBA 1KRCC 4ICMA 5JIWA 2A3LA 2C8NA 3ELFA 4X9SA 3NTYA 5BWAA 4P7RA 4NQ1A 3CTLA 1DXEA 1JFHA 1TA3B 3ZFHA 5C2XA 4E3TA 4G56A 5HJYA 1HKWA 5H8UA 3PWGA 2WB5A 1IWBA 4L9YA 4JHMA 1X6UA 3WDPP 2PDWA 4RE2A 1XKJA 3BCFA 3SN0A 4ZO7A 2V0TA 4ZXOA 3ZLHA 2RFGA 4AB4A 4KH2A 2D2OA 3W1TA 4QE1A 8RUCA 2E68A 4GBDA 2BV9A 1VIWA 4DO7A 3CNYA 3IJ6A 2E6DA 4PMRA 5FIPA 4PCFA 3AHZA 3WH7A 2DZXA 4CGTA 4MNLA 1DE6A 3FHAA 1Q4WA 5BXPA 1QNPA 3CQKA 4JXCA 4MY9A 4JIHA 1JCLA 1HXJA 3LXBA 3P67A 5CC5A 2QCCA 1CGWA 3LRLA 3MUCA 1R9XA 3TROA 3CASA 3Q65A 6TIMA 1TB3A 1PYMA 1KLZA 1O12A 3GS6A 5BMWA 3AHYA 1MO0A 3WLKX 4LS2A 1M68A 2EKCA 4QFUA 4DIAA 4UTTA 4FOUA 2J24A 4IF2A 3WK1A 3UR8A 4FAMA 3VNDA 4DUVA 1GVRA 3QMTA 2QZRA 5DFAA 1YTDA 2WZMA 2DZUA 4JYFA 1YNPA 3FDKA 5TNVA 4ZFMA 2ZTJA 3OJGA 3CHVA 3MV01 1FWGC 3DX5A 3COTA 2DJLA 3WFLA 3LZ3A 3WEMA 4FMVA 3A3HA 1TTJA 1H51A 2BHUA 2V82A 5A8QA 3Q37A 4L56A 2VC6A 5A6BD 2PTXA 2G41A 3OBKA 2GYIA 1GONA 1Z9AA 2P76A 4WOZA 1LWHA 1SMDA 4PMNA 3EB2A 5CPTA 3SIZA 1LWIA 4AWEA 2VHLA 5F7UA 2FTYA 3THAA 1QW7A 5CC7A 4UQ9A 1PUDA 1YDNA 2HTMA 4C6LA 1A5NC 4K37A 3U7VA 1O95A 1C9DA 2DV0A 3GU9A 4QLLA 2D2HA 3CGTA 1V3IA 3M0MA 5F2LA 5A6BA 1EJRC 2F6KA 3RN6A 1UBPC 2VZVA 3WQVA 4GUJA 3FSTA 2OMAA 1H7PA 4DBWA 2PGWA 2FH6A 1Q6DA 2X2GA 3QC3A 3O6YX 3EX6A 4IJBA 2HBXA 1KTBA 1XBXA 3ZT5A 5DANA 4MJMA 1VEMA 1UKOA 1KLYA 2PF8A 3ZLGA 2VZOA 1GG1A 3G5EA 3K13A 1CLVA 4H8NA 1FCBA 4HA0A 1BVNP 2QIWA 1P0KA 1SJDA 2KZHA 4ADTA 1J0YA 3VM7A 3FAWA 4LRSA 3VX1A 4KQNA 5CG7A 4K68A 3IGHX 3VXGA 4CN4A 4GI6A 4ICNA 3ZWTA 1KWGA 3TYCA 2D73A 2OELA 3LCGA 1OFBA 2W5FA 1F61A 4XVDA 4AAJA 4JKLA 1DKWA 4MAZA 1G01A 1X96A 1KCXA 4PFHA 3EKZA 1W3LA 4RNHA 3IRSA 3VILA 2E9MA 3PB2A 2E8ZA 1R2SA 3W7GA 4J3ZA 3MANA 4EPDC 1R3TA 1UKSA 1KFJA 1LBLA 1UKQA 2OOGA 4RE0A 4YXGA 4JNZA 2PD9A 5DBUA 3TP4A 4LUSB 4Z17A 1V6YA 5G5IA 3C4UA 3PZ9A 3GDMA 4NHVA 1TCDA 4QTGA 2EQDA 2E9LA 3H12A 4E5TA 3JU2A 1UB3A 1KFEA 3NO1A 2OLHA 3NVTA 2D20A 2J7BA 5D02A 3UBPC 9XIAA 3GB6A 3AMLA 5AY7A 4P8VA 1KNWA 4WKFA 4CQCA 5E0CA 2JIEA 3SAZA 3A3XA 1VS1A 4Z42C 3MHGA 4I7UA 3SR7A 4ML4A 4GO9A 3E0FA 1R47A 1XFBA 2CLKA 3A4AA 3E6EA 1KGWA 1CBGA 2HJPA 1DJNA 2OU4A 3FX4A 4JICA 1U5HA 4A3HA 1LJYA 4E0CA 2PDFA 4IOTA 1V3JA 4Y9OA 4D8LA 3MMWA 2W4XA 2PDNA 2G3NA 1ZAIA 3E0WA 3TOPA 3FA5A 4CQDA 3W1UA 1XQLA 2X8RA 4KFNA 4DYKA 4IXXA 3SEPA 1CLKA 1AH4A 1WNOA 4BJHA 3GVWA 3S6OA 3N2BA 5LNRA 1A4LA 1OC6A 1XH1A 3INPA 2G3FA 4J2MA 1MUWA 3HV9A 3TV8A 1XYCA 3DG7A 5D9OA 3OBEA 3D5HA 4RZ6A 4CQ9A 1FWRA 1OZQA 3AYSA 2AL1A 2PI6A 4HA4A 3N17A 4WY0A 4DY1A 3N6HA 4RR4A 2I1OA 1W1A1 3PUGA 4FLRA 2PODA 2H3DA 3F4VA 1P6WA 3GTNA 4RV3A 1E5JA 1L0PA 3GIPA 3CWOX 1J4EA 2QDDA 4MM1A 4J7RA 3MCOA 2DSKA 1IYXA 4O4VA 3GR7A 1TPWA 2EO7A 3BG9A 4F0HA 1LZOA 2P53A 2PU1A 1XLIA 1TX0A 3QV7A 4UFKA 1EZWA 3WF0A 2W27A 5D38A 3KBJA 2QJHA 1ZZMA 3L0KA 3VGGA 5FSEC 2Q8LA 1G4PA 3PZOA 6CGTA 1B1YA 4FNUA 1G67A 1RJPA 1PCWA 2EPKX 4XB3A 2HE8A 3BLEA 5G1MA 1F4AA 1IWAA 3GC4A 4ILSA 1LUCB 3WQ4A 4MVAA 2X16A 1XH0A 5EBUA 4A21A 1N82A 2GK1B 4N6FA 3WQOA 2DZSA 4HYRA 4P8XA 8TIMA 4UCFA 4UQEA 3PWAA 2PTZA 7ODCA 3B3DA 3I10A 3STGA 2FHBA 3GZ3A 3WLSA 4F48A 4GWEA 3V5CA 4AHQA 5IRPA 1LTDA 3G1HA 3KZPA 3B05A 4I8DA 5HNUA 3VCRA 4WK9A 3R58A 4GKLA 4YTUA 2FKPA 4QP0A 1JYVA 3LCFA 4KGJA 2VGBA 4NY2A 5AHNA 3WQEA 1M1BA 4QE5A 4LWWA 1VF8A 3TJ4A 4JIEA 5G4WA 4K8EA 3KL0A 4U10A 3DCPA 3AXKA 3GD6A 4LYKA 4OWGA 1PL9A 3P2VA 4FK9A 7ENLA 3LTPA 3A4WA 5I78A 5LIWX 3KZSA 5M5DA 3TW7A 1AG1O 4D8ZA 1GHRA 2GK1A 3DG6A 3CQIA 2YDQA 4W7VA 1QI0A 3VGEA 2J74A 5AECA 5CPNA 3WBXA 1AQHA 4QROA 2V5BA 4OOUA 4PTNA 5CH9A 2XGIA 2BP1A 3I3DA 3G3MA 2AL2A 2XU2A 2W3ZA 3WLPA 3WF1A 4AD1A 3VD3A 3F5JA 1SO4A 3LQLA 1RBOB 3RFAA 4UTFA 1VYSX 2KX9A 5MHBA 1SO3A 4KW2A 1WXJA 3OLEA 3RPDA 4KMQA 2R1NA 5D9MA 2WMJA 1Y5WA 1OFDA 4Z1CA 3HPFA 1PKMA 3PPFA 4Z1DA 4F0KA 2CZ5A 4LVGA 4PUWA 1XX1A 1XD1A 5I6SA 3MI2A 2TMDA 5D2WA 2Q3RA 2XH0A 4S1FA 2PA6A 1H0GA 1MQPA 4N7QA 4GYJA