1S2VA

Crystal structure of phosphoenolpyruvate mutase complexed with mg(ii)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
289
structure length
282
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphoenolpyruvate phosphomutase
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
total genus 107
structure length 282
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2vA00
4FXFA 1OQFA 3GR4A 3E0WA 1U5VA 3FA4A 3OYXA 3EZ4A 3QLLA 4IQEA 4B2DA 3HQNA 1IGWA 4YNGA 2VGGA 2R82A 1Z6KA 3ME3A 4QG9A 1SGJA 4LSBA 1F3WA 1U5HA 3GQYA 4MF4A 1M1BA 1KC7A 3FA3A 3KTXA 4B5WA 4B5XA 3SRDA 1F3XA 1MUMA 1VBGA 2VGFA 3EOEA 2BG5A 1E0TA 2DIKA 3M0JA 2WQDA 1ZJHA 3HQOA 1PYMA 1GGOA 3HQPA 3LG3A 3QV9A 3E5BA 2ZE3A 3BJFA 4TV5A 4B5UA 4HYWA 1F61A 5JVLA 3R4IA 1ZLPA 1S2TA 1A5UA 3PP7A 4MG4A 1JDEA 1O68A 3QTGA 2X0SA 4ROQA 2L5HA 4L80A 3B8IA 1PKYA 2G50A 2HJPA 1OY0A 3SRKA 3PUGA 4B5SA 3OYZA 4IQDA 4B5VA 1DXEA 1E0UA 3U2ZA 1A49A 4L7ZA 4QGCA 4L9ZA 3IS4A 4B5TA 4B2DD 4KCTA 3EOLA 3T0TA 3E0VA 2HWGA 1T5AA 1AQFA 2VWTA 5TAOA 1A3WA 2XZ9A 3MA8A 2DUAA 3P0XA 4KCWA 3EOOA 3QV6A 2VGIA 3N25A 3LYEA 3T05A 1DQUA 3QV8A 3OQ8A 3SRFA 2OLSA 1IZCA 2V5JA 1UJQA 1O5QA 2KX9A 4KS0A 4IMAA 1PKNA 4HYVA 4DRSA 1M3UA 3GG8A 3VAVA 2QIWA 3I4EA 4FXJA 2HROA 4KCUA 3QZ6A 4G1NA 1S2VA 2XDFA 1S2UA 4KRZA 4QG6A 1XG3A 4WJ8A 2XZ7A 4RPPA 1XG4A 3G2GA 1O66A 1PKMA 3T07A 1F8MA 3QQWA 4JPGA 1DXFA 3SRHA 4YJ5A 1VBHA 1A3XA 4QG8A 2VWSA 2E28A 3BJTA 4TV6A 4L9YA 4IP7A 2V5KA 1KBLA 2VGBA 1F8IA 3KHDA 1PKLA 1S2WA 1DIKA 3H6OA 3M0KA 2HRWA 3QV7A 4KCVA
chains in the Genus database with same CATH superfamily
3GR4A 2XGIA 3R12A 1IGSA 4L4MA 1FUYA 3AWOA 1ZPTA 1F3WA 3GY1A 1OGSA 2W6RA 3NQ7A 4MZ1A 4AVFA 3EGJA 4REQB 1M5WA 4KFNA 3H7RA 1JGIA 2ZZ1A 4AMCA 4TX8A 3M0JA 3LGGA 2O7QA 4LJ3A 1PAMA 3VFCA 3W75A 3GXIA 3LI1A 2HE5A 3WUEA 1EJVC 2FVKA 1EX1A 5FSEC 1BG4A 5FEXA 4Z1YA 1E4MM 1VEMA 1UC4A 1X98A 1EJXC 4E4UA 1PX4A 3KBVA 2QPSA 1T5AA 3OA5A 2V2HA 3ZT6A 4HVXA 5FEZA 4JBRA 4RW5A 3USBA 3OVRA 2YA0A 4DLFA 1R2SA 3LCLA 3Q45A 3CYVA 4C6QA 3B0UX 3W6YA 2HSAA 3MB9A 5EU9A 3FEQA 4QCFA 1I2OA 4BKNA 1CNVA 3O06A 1W5PA 4KCUA 4JOMA 5B7YA 3W4RA 2VYOA 1KXQA 5HULA 1F4HA 3KL5A 1NARA 3S1GA 5GJMA 1QW8A 1B30A 2BVWA 1OB0A 1KWGA 3BGJA 1PL9A 1KBJA 1KBLA 3NQEA 4PTWA 2X30A 4XD4A 3OO2A 5L9FA 3WKZA 4X2RA 3WQWA 5C2GA 4MJ2A 2C13A 2DIJA 4DZAA 3SUSA 2PDPA 4ZB2A 3OG3A 1I6NA 5T9BG 3DFPA 4B90A 3U2EA 1IR1A 1OM0A 3TX9A 1KM4A 3TN3A 4H8VA 3INPA 4A3YA 4WOZA 1GVOA 1V3HA 3GYEA 3L5MA 4A29A 3L68A 4HYWA 1PVNA 5A6SA 2FB2A 3WQEA 4JTTA 4GI8A 5FACA 2FLIA 4FLOA 4F0MA 4AZBA 2VCBA 1B3WA 2BGNE 1Q66A 3MP5A 3CUHA 3T2OA 5D8ZA 3IJ7A 4OOZA 1I2PA 2DUAA 2DW6A 1YE6A 2F9RA 3VIMA 5M03A 1LUCA 2NXHA 3UQNA 4HNOA 4C6DA 1WV2A 4UXDA 1CXFA 1FHUA 4QISA 5CPTA 1YW1A 2O92A 2QVNA 3EXTA 3AI0A 3G22A 4PBEA 2Y24A 3UXLA 2AQWA 4ICMA 4OUEA 3LQLA 1TJ0A 5A6MA 1JDDA 4YWSA 3LPFA 1CWYA 4UOQA 1Q7QA 4QX4A 1DWAM 2TPSA 3SCTA 2FDMA 3GK0A 5A94A 3AS0A 3V75A 2XWDA 1Z41A 5CSYA 3GHSA 4YTUA 4GRSA 5IOBA 4JEQA 1JNDA 3B8WA 1KTNA 5I3FA 1FCQA 1OFQA 2E5DA 1GOIA 3QXBA 1GYLA 1SPQA 5GVJA 2OWXA 3E5BA 2GVLA 4DZ5A 1UR0A 4A3UA 3WX7A 3LM3A 3BAYA 3OHMB 2E6AA 3EYPA 2WZEA 2PSNA 4DX3A 3CPRA 1SW7A 2ZZ3A 3SDOA 1VRDA 2YFNA 5E0CA 1W56A 1CXKA 1E6NA 5D9PA 1XUUA 3DI0A 3T0TA 5KINA 1VRXA 4A3QA 3V0UA 2CLOA 4GFIA 3QV6A 4JTEA 1WX0A 3B3DA 4GH1A 4GBUA 1O5RA 1UR1A 2ZCGA 3WLIA 1EKOA 4AD5A 4ZQNA 1UWQA 4TX6A 2HNHA 1ICPA 1OABA 4M29A 1VCVA 3UZZA 1CLXA 5AHFA 3KLKA 1VPYA 5CCZA 2I9UA 2ZWZA 3PPGA 3MV01 3B0VC 1OFPA 4UMBA 2J62A 1GZJA 3WMLA 3P3BA 3PANA 4W7WA 1G6CA 2VEMA 5DY2A 1MXSA 3VKAA 1BVZA 3VXGA 1KXVA 2HEJA 2OEJA 5JXQA 4MF4A 5BU6A 2YA1A 1DEDA 5HMDA 3UXKA 3BDKA 1E4NA 4E8DA 3VD4A 4B5UA 3RM9A 4UCGA 2AQOA 3R0DA 1YDVA 4Y7EA 1TG7A 1EJSC 3E0FA 4ONVA 2X7VA 2HTMA 1VR6A 4ALDA 4PMQA 3OODA 3KRSA 5B80A 2VX6A 4JN6A 1Z32X 4B5VA 1TPWA 2Z1WA 3STFA 2E6YA 3VC5A 1RA0A 3FAXA 4MUZA 4S39A 3CQIA 3VFLA 1X38A 5BW6A 5FESA 9XIMA 2FYMA 3PN8A 4GO8A 3DHPA 2WVVB 1SSDA 4N42A 4QTGA 3EWBX 1W9UA 3GVVA 4Q8VA 1G4SA 4C1NA 3DG7A 2EG7A 4M7TA 3THQA 4DRSA 4YTSA 1G94A 2CETA 3MUY1 1C91A 4AY1A 2XJ7A 4YCOA 1JULA 4AD2A 1LZOA 1I75A 3KVMA 5C0QA 1EEPA 3CGTA 3WFLA 4XO6A 4CNOA 4F0KA 4J40A 3B9OA 1M68A 1QHOA 1SM9A 5GJPA 2ON3A 3T40A 3QF0A 3T0CA 2GWGA 3KX6A 3KHDA 1VFLA 4DO5A 1ISXA 3MMUA 4YU1A 3PZQA 4KCVA 4MNKA 3VX0A 2Z4GA 1VHCA 2J8FA 3CV6A 5DXXA 3W25A 1K9TA 3T09A 2Z0IA 1D3GA 5LIYX 1UWSA 3IIVA 3ME3A 1W9VA 3CQ0A 2HS6A 3B0PA 4IFRA 3WF4A 1A50A 1RUSA 4ICNA 1CLKA 4CU7A 3QTPA 4HA3A 1OHLA 2PDMA 3T6CA 4LANA 4PBGA 3MKVA 2J13A 1V3IA 4AHPA 1K9FA 3M0YA 5HOSA 3LY0A 4YCPA 3GS6A 1E1CA 2G41A 1PS9A 1YIXA 1XQKA 1YHTA 2GVYA 5IHSA 3O3RA 2BHUA 3UCDA 4JNMA 3MUIA 1TPH1 1JCNA 4H19A 3EPMA 5D33A 3GUWA 2NUWA 1JUEA 4U31A 3K8LA 3UWYA 2VC6A 1WZAA 3EMZA 5CC7A 1XHGA 3FCPA 4MJMA 4NY2A 3M0ZA 2E77A 4U3CA 4WGXA 2JEPA 3V35A 1CDGA 1Y65A 5A5WA 3JRKA 3QGKC 3B05A 3U2CA 3W7PA 4H9XA 2QPXA 1TV8A 3Q37A 4NZ5A 3NL2A 1HJWA 3UXIA 3PULA 2V67A 3ELFA 4XSMA 1OZMA 2VHLA 4LAOA 1XIDA 1CPUA 1TYGA 3OIHA 1Z6KA 2NVDA 3N2XA 4MWAB 1BVNP 3IJ9A 2YL9A 3KTXA 4OWGA 1AFSA 1LWJA 1H49A 3OBKA 1TCDA 2G3NA 5D02A 2PWHA 4GISA 1QRQA 3SCQA 4JNZA 4MB1A 4H4IA 4JFSA 3WJYA 3KL3A 5KZEA 3EWDA 2E9LA 4NAFB 4AEFA 2P3EA 5HA7A 4LYRA 3LCHA 1TCMA 4ZOBA 5D9NA 5DEZA 1HL8A 2VFEA 2VQTA 2WMFA 3HN3A 2WJZA 3FAWA 1H0IA 1F74A 2BY2A 4Z1AA 1UKOA 2YLAA 3R89A 2QHAA 4PUMA 2D0FA 3JR2A 3NA8A 1EPXA 4C6KA 3LMZA 3VIJA 4PCNA 1ELSA 1GVFA 1WYIA 3LYEA 3PHAA 5C9XA 3TROA 5A6BA 2VC5A 4AD4A 2NSOA 5CZTA 1QATA 3WQ4A 1E0VA 1W17A 3RFAA 1HJUA 2H9AB 3P14A 2WKGA 2E68A 3HGSA 4HU3A 3W28A 2HPIA 3EDJA 5MKGA 1I60A 2XTKA 3GH4A 1VYPX 4IFOA 3BARA 4UTJA 1YLVA 2EAWA 4PTXA 1V3KA 4ATDA 1AQHA 2F84A 2J9YA 3RG6A 1RBAA 2G37A 4GG9A 3UNDA 3UR2A 1JYNA 1KKOA 3VNZA 1FWDC 4UTFA 2PCQA 1A5NC 1QAPA 4QDMA 2NQZA 3VOHA 1N8WA 4HTYA 4B9YA 4DWDA 3L7RA 3QPZA 5E09A 3LZ3A 3SCSA 1AZ2A 4MY8A 3CHVA 4MWAE 3W7JA 1W1YA 4IJBA 3T4WA 1PYMA 4PUUA 5E0FA 1ENUA 4KFOA 2OELA 1UKSA 2Y8KA 4G6CA 2XIOA 1Q6LA 1BVWA 4BF9A 4M19A 3VPLA 2CLIA 2Q02A 3AIWA 2ZA1A 1S46A 2DVTA 3TA9A 3RPMA 3KP0A 1LRQA 2ZOXA 3ZS4A 1ECEA 1OYBA 3BW2A 3BW3A 3RR4A 4D1JA 3RCNA 4CCCA 5FL0A 4WQ6A 4AYGA 3CXOA 4EXQA 2P0IA 3MP3A 1U33A 3E2QA 3DC0A 3ZZ1A 2DZWA 1NH6A 1KM2A 3MMTA 3FSTA 3IJQA 2QCFA 3DCPA 4TOQA 1J0KA 1OJXA 1FHVA 2WSQA 3WQ5A 1H0GA 3GVQA 4YTRA 2QAPA 3WD4A 1YTKA 5BNKA 5E6YA 4D72A 2RDXA 4KRZA 3S6TA 5I78A 3AIUA 3T07A 4PUJA 4B16A 3FX4A 1VBRA 3HF3A 1T99A 2VCAA 4DJFC 5D2WA 3ICJA 3CEPA 4JY8A 3GC2A 3F5LA 4FOKA 2FTWA 1TE6A 4DJDC 1H1NA 5LHFA 2NZLA 1JCJA 4IIDA 3WLOA 3S5SA 3MCNA 5HJYA 3SIMA 1VYRA 2IKJA 1PSCA 3A9BA 3GR7A 1Q45A 2WO5A 3A3HA 1J79A 4HA4A 3NQCA 4C91A 1UB3A 5JVLA 1V6VA 3BG9A 1O6IA 3KCJA 1GVEA 4PC8A 4BI5A 4PMUA 1UZHA 4GO9A 2O4MA 3OZMA 4NJKA 3OGRA 1K8YA 2OLHA 5MHBA 5AN7A 5D32A 4YVXA 2NUYA 4ML9A 1A53A 3O2LA 4R88A 1LG1A 1JG9A 4HBKA 4GINA 4QJ1A 3CLWA 3NQ2A 3VABA 3AXIA 3NG3A 1C8XA 2P8BA 1Q85A 3OQ8A 4FNRA 5KZDA 5F1VA 3QMTA 4UC5A 3C2RA 3ANYA 3EOSA 3I3BA 1NWTA 4FAMA 4MAZA 1DYSA 4WJ8A 1ZBKA 1JYWA 4UQBA 3BAIA 3V1PA 4WXYA 3B4YA 2V5BA 1BWVA 4MKNA 4MY1A 1KR0A 1JZ3A 4IUOA 1CT5A 1CGXA 1Q6EA 2XSAA 3VNJA 4D71A 3QFEA 2NQJA 2CLEA 2Q8XA 2R82A 4MNJA 1REQB 4V33A 3HGRA 1M1BA 5FJOA 4B3KA 3MU7A 1VFTA 4E2OA 1CI1A 4BA0A 1G69A 1IV8A 6ENLA 2HISA 1EP2A 4E5TA 2IKIA 2OPJA 3MTWA 3BJFA 5K2ZA 4QQ3A 3PBGA 3DENA 3HU7A 4H6QA 2EEXA 1W5QA 4QLKA 3DFHA 1UASA 3LHZA 4MZYA 1RPKA 5KZMA 4AX7A 3P6LA 1IIHA 3VOFA 1ZP4A 3AO0A 2JGYA 4FHAA 4KQNA 4XTDA 4LF1A 5EBAA 4Z2LA 3NQMA 4W88A 3LUTA 3ABQA 2A3CA 2CLFA 4O18A 3RRXA 2DH2A 3H2EA 3E0VA 1J12A 7REQA 3AZSA 1GEHA 5G1MA 1YYAA 3EB4A 1IE7C 3MA8A 3WBWA 4MWAC 4DO6A 3STCA 5FF0A 4WSHA 3C61A 3DGRA 3WD0A 1SJAA 2PZ0A 1X1ZA 4MJZA 2IQ0A 1AODA 4FNTA 4EX4A 2UBPC 3LOTA 5IRPA 1WAWA 3WDPP 2Z1KA 2POZA 2ZWYA 3ITOA 2OQHA 4NU7A 3LQGA 1A80A 1RJRA 3QYSA 2X7WA 1EOMA 2BX7A 4A6GA 5JBFA 3MI6A 3GNNA 3UGRA 3LENA 2OTDA 4NAEA 2PGEA 3TLQA 1SMAA 2HNEA 3CAWA 2W63A 5BOOA 2DQWA 3W24A 2IMRA 1J6OA 3WH8A 1YTEA 1R9ZA 4JTJA 3G1XA 4O10A 4IICA 2PGFA 4RE3A 4XZMX 2QUMA 4A05A 3KAOA 4DYEA 3MSYA 4D9PA 4UFJA 5E70A 2DV0A 4TIMA 4JGDA 4AXNA 2XFRA 4L7ZA 3PJTA 1US3A 3GXTA 2V0TA 4J3ZA 2J66A 5I3IA 1VJSA 1EYWA 4GMEA 5A6TC 1HJQA 3RM4A 2V2CA 3UWVA 3HTWA 4ACZA 5KSWA 2PB1A 2I5GA 2VX4A 2XH4A 4UTHA 1ZAJA 3VNIA 4N9EA 3KDOA 4IMGA 1TZ7A 2WHKA 1UP2A 4RW3A 2REQB 3RMJA 2IW0A 3BAWA 1OSEA 1V6WA 4UB9A 3VU2A 2P10A 3VO0A 3BUVA 1MDRA 2WKJA 1R8LA 2FZNA 3ZOAA 4PFHA 1AMKA 2EF9A 1QOPA 4IHCA 4UUIA 3DBNA 1CXIA 2BODX 4UBPC 3HPZA 2BXZA 4PE8A 3KBJA 3IGHX 1XLJA 1LG2A 1GWJA 4EK7A 2Z2BA 4IQEA 4CQAA 3NZPA 2UY2A 4C6LA 1J4EA 2G3IA 2BHYA 4KEMA 4RLIA 4QNWA 2Q3RA 4HA1A 1JNEA 4JTCA 3RIKA 3ALFA 4X2PA 1AJ0A 4GZJA 2CWNA 2MUCA 3W87A 1YDYA 3NOEA 1J5TA 1M7OA 5FAGA 3UESA 1X1NA 2ZX8A 3HQ1A 3M5VA 4XBKA 1XLLA 1D7FA 3T7VA 4AY8A 3AWNA 2VRJA 1VFFA 4IIFA 1IXOA 3MSGA 4B2DD 2YIHA 2I9EA 3NNTA 1FP9A 3H54A 4RNJA 4K68A 4Y96A 1CYGA 2DT2A 4UQAA 3SI9A 1KM6A 1K9DA 1W3KA 2XM1A 7ENLA 4NSBA 3CHEA 1FWGC 1MMFA 3FYPA 3PZIA 1ISWA 4AWEA 1PIIA 3TXZA 1OCNA 3PJUA 5G4HC 2PDQA 2X1UA 3W2UA 3RLHA 4RZ4A 3G18A 4UR9A 1Q4WA 3W1PA 3GFZA 4O28A 3WNNA 4ZZ9A 5DT7A 3TC7A 3QV7A 2AL1A 5D2YA 1DHKA 4ZXOA 1EC9A 1V3MA 3SN0A 1DTUA 2NLIA 3PSWA 3GM8A 2ZRUA 1QWKA 4BS0A 3ANUA 3QLDA 4D1IA 5I02A 4AXKA 1Q6DA 4Q8PA 5EGRA 3EDFA 3CL7A 2WCAA 4JTQA 4LWWA 3TA6A 1W3NA 1Q3NA 3W7RA 4AU0A 2CLKA 4GX9A 1JR1A 1KFCA 3OIXA 1VEOA 2BMBA 1Y7VA 3TTSA 3G6MA 1BYBA 3OA3A 3W7DA 2Y89A 4CD5A 3BMWA 2E09A 3MBDA 2DVUA 3A24A 4DXKA 2XWEA 5CSRA 3ZJ8A 1J0JA 1GOKA 3WIJA 3A22A 1RLDA 1F4AA 3NQBA 2Y5SA 4BF5A 4UQDA 2NQ9A 1JPDX 1RY0A 2AL2B 3BTNA 1DKWA 3KOWA 1LYXA 3THDA 4Q8TA 5CSSA 3A13A 1XIMA 1TV3A 3TCSA 4F0SA 4HB7A 3WH7A 1BD0A 2QF7A 3CHFA 4PMNA 3CU2A 4GKLA 4Y8EA 1RLCL 2EPOA 1NTHA 4GVGA 4PCFA 1EXBA 1I2NA 1Z42A 4HPXA 1FH7A 5FJTA 2ZUMA 2HK0A 1JZ2A 3LMYA 4W8BA 2XSBA 4GZ7A 4XAPA 4FS9A 3WQPA 2OSXA 4Q6JA 3UG3A 3RAOA 5A6LA 2Z1XA 4HZ8A 3BVJA 1E6SM 3SM0A 1QOQA 2JKEA 1R38A 1E43A 3NYZA 4C1LA 3I68A 2FH6A 3M9YA 3MUZ1 1TR1A 5TBOA 3WNKA 2C6QA 3WL0A 5AC6A 2Y8UA 3E9AA 2EG6A 5A2BA 1NP0A 3C52A 4L1GA 1MW0A 3A4XA 5TD4A 3I6TA 5IFTA 1DV7A 2VOMA 1JDAA 1XC4A 3N18A 3DKJA 5EYWA 1ZHAA 3P82A 3UCQA 3PAJA 1TKKA 1SFSA 2VJXA 1U1UA 3H24A 1S1PA 2V68A 4PEEA 4KCTA 1A5BA 3OZOA 1Q7MA 4B9ZA 1C3FA 3CH0A 2X1IA 4D6HA 4DO7A 2VEKA 3ZT5A 1V51A 2A3AA 1QDSA 4Z2HA 4IXHA 4OUIA 2ZZ7A 3BV4A 3H2CA 4DWSA 3WF3A 1XD0A 2QIWA 3BWWA 5I2UA 3KVJA 4JTIA 4G56A 1CW2A 1H5VA 1TPEA 2B7NA 1GTEA 3CTLA 1V08A 3K4AA 3U5UA 4GK8A 2CWXA 1XG4A 1IQ8A 5DRCA 5GQBA 1QO2A 1THFD 5M2FX 1LLOA 3BSGA 1DQXA 2QYGA 4J7RA 4MDPA 5CZSA 3S42A 3NPUA 1CTNA 4QR6A 2PI6A 3GDRA 4KF1A 5E0KA 3B8TA 4QDPA 3T08A 3QVQA 2VKZG 2ALRA 3BZGA 1PZ0A 3T0DA 5J8LA 4L1XA 4LSBA 3SGGA 3GQYA 3E2SA 3QR0A 2YCKX 3NDZA 3WD1A 5JIPA 1IEWA 5HUOA 3ATZA 3HPXA 1XIHA 4O13A 2E5BA 1KRAC 1OT2A 2PU1A 1V02E 4AIUA 1O1ZA 2WC4A 1R2RA 3UFYA 1EDTA 2JALA 1HP5A 4HZ7A 1JDEA 4MNMA 2FZ9A 1HFBA 3H4GA 3WMCA 1M04A 1UD8A 1KGUA 3TQ0A 3V1HA 4NI8A 5BXPA 2NXIA 4R9OA 1XLIA 3QR3A 3S2JA 3IACA 1BGAA 1BYDA 3NL6A 1ALDA 4PGLA 1VS1A 3VE7A 3SRFA 4UTLA 4CU6A 1P1XA 3DG3A 2C14A 5LIUX 4NZJA 3P81A 2YL6A 1EWEA 1LL6A 4LB3A 4M8UA 2QVHA 3WK2A 1YNQA 5E5CA 3K8KA 2Y4SA 3AIQA 3TWBA 1WNOA 4NX0A 3WL1A 1K6WA 3OTRA 2Q3OA 3RN6A 1C7TA 1PIFA 2V5KA 7A3HA 1Q7ZA 3WK3A 3KS5A 1EHNA 2GJNA 1W2PA 3MI2A 3KM8A 2HXTA 1O95A 2NWRA 3NQAA 2WK2A 5G2WA 3FDKA 3V3WA 4XBSA 2XH2A 3QKEA 3EBVA 2DZAA 2O9TA 3IJLA 2ZE0A 4IIHA 4LS2A 3I6EA 3AMDA 3N6QA 4NRSA 4A22A 4F3HA 4AC7C 2A2IA 1XSJA 3ABZA 4LAUA 1R3SA 3PJXA 4ZTXA 1FOBA 4A3RA 1R30A 4QIUA 4D2JA 4F2TA 2VFFA 1TWDA 4HK5A 3H7VA 3U2ZA 1V3JA 2WHMA 5I00A 3C0SA 3BCDA 3GDKA 1S3HA 5CG7A 3ALGA 5FF4A 3COTA 4QE5A 4LOCA 3GH7A 3G24A 3PZMA 1ME7A 3G0SA 1W8SA 3PNUA 4Q4QA 4MB3A 4DELA 2F7FA 2OQYA 1J2BA 3LU2A 1BWLA 1XPGA 1E9IA 1SJBA 3A3WA 2DSVA 5H2ZA 1TPUA 4IFKB 4ILSA 1N7KA 3UGVA 3FYOA 3GRIA 4GIEA 1GUVA 4WZHA 4I5UA 1WDDA 2E7FA 1V02A 2HPMA 2ISFA 1UKQA 1EJWC 1QNPA 1HKWA 4ERAA 1Q8AA 4HU0A 4GLEA 4LNCA 3CB8A 1EEXA 1POKA 1YE4A 4HSOA 5J5DA 2DEPA 2VGFA 3MQTA 3QHOA 4Z2KA 3DAQA 1BGGA 5I07A 2RH9A 1FHLA 1H62A 2AQVA 3RCMA 1KD0A 5EA9A 3EDKA 3L4WA 2GVJA 3CT2A 3I3EA 1DWFM 2G4FA 2CIPA 3M0IA 2D1ZA 4K7YA 3BSMA 1UQYA 1GOOA 1T96A 4EKJA 3VGBA 3C2OA 3FJNA 3S5OA 2YYUA 3IGUA 1XLAA 4GI4A 3MVTA 4NRRA 3QRHA 1XP3A 5IDIA 4HHPA 2X05A 3PZUA 2YR1A 4NX5A 2G96A 3LTPA 2GDVA 4QSFA 1LQ2A 3O7UA 2ACSA 3BG3A 4IMAA 1RCXB 5F1UA 5G1TA 2CZ5A 2J47A 1TV7A 2XFWA 2OX1A 2CYGA 4JTHA 3W85A 4F2UA 4AVOA 3EEGA 5CPQA 1KQZA 2VEIA 1RCOB 3FVDA 4JKLA 3AXXA 1DXFA 1ZZMA 2VZUA 2OOFA 5FA5A 4NUWA 1H7OA 3BAKA 1E4IA 4INFA 5CJ5A 1XSIA 2DUZA 3M0KA 5F4SA 4HPGA 3DXIA 5DANA 4HHLA 5FJUA 1JQXA 3E74A 1P6WA 1EPVA 3VVGA 4YVPA 1I4NA 5D38A 5HBFA 4CNNA 3GVGA 2XHYA 3BURA 5A8PA 4PUNA 3TNOA 3D47A 3RMEA 4L6OA 4GY0A 3PUDA 2QQ6A 5HQLA 3F1QA 2ZDSA 5HWNA 4S3BA 1FDJA 1MW1A 3VX1A 3A4AA 2J79A 3UR8A 5DN1A 2DJLA 1B3XA 1V6TA 3B8IA 1VFOA 1GKRA 3NYDA 3WJXA 1E0UA 1IWAA 2Q71A 2J25A 4OV4A 1FRBA 4KESA 3DG6A 4JN7A 2GSJA 2UY3A 5CZKA 3UEQA 1US2A 3AC0A 1ZCOA 3GIQA 1I45A 2OYKA 1TUFA 4J3VA 3CMGA 4ZFMA 3LSBA 3KUMA 2HK1A 1WKDA 4C5ZA 1O5QA 4Y9OA 4GUHA 1XYLA 3O16A 3C2YA 3I4EA 4YWIA 1R9YA 2R94A 2HXUA 1W3HA 3V0SA 3NZGA 2XDFA 3MUXA 2Y2WA 1KBKA 3O05A 4UTKA 4GIYA 4BI6A 3VGDA 4JTFA 5HJLA 4RKAA 2BBFA 4X9YA 5C9RA 4NZ4A 4U5IA 1SFTA 2EPKX 3WCZA 2IXUA 3M0LA 3NO5A 4M3PA 2X8RA 4NZFA 2CBIA 4PL1A 4GGHA 4TMCA 5FEPA 4OHQA 3VMNA 5CEWA 1HJVA 4HNTA 4KEVA 3W1UA 4ZL1A 5A6AA 4UNKA 3K4WA 4I5RA 2F8QA 1FHDA 2ZICA 3SRKA 4NNCA 1VFSA 3TUUA 4M24A 2QCHA 2TODA 4AISA 1DE6A 1WDQA 3AS1A 2Y5JA 1LBLA 5D9MA 2VVSA 4Q4SA 3ZSSA 5HWJA 3GTHA 1AUSL 2QR6A 1V6YA 2GSEA 3K13A 1QTWA 3E0IA 3FSUA 3OOQA 5D03A 4ML4A 2R1KA 4H41A 1O12A 2CCRA 2RKXA 4ATWA 1FWRA 2PWFA 3MO4A 3UVIA 1JF5A 1SJCA 2CC0A 4LCQA 4B92A 3W26A 4MOZA 4AAJA 1GVRA 3KRZA 5H6HA 4CQDA 1OK6A 2FVMA 1PHWA 2V30A 5LA2A 5K9CA 1KBBA 3T81A 1R5YA 4IP7A 3CPGA 3WLMA 1EBHA 1ZU8A 4NASA 1UD6A 2EKGA 1UWUA 3P5ZA 3A47A 3EZ4A 3M07A 4LU0A 1RPXA 2ESCA 2FZDA 1KBIA 5I06A 1RA5A 1H60A 4PTMA 5D30A 4B5WA 1TPC1 2OKTA 3W37A 2ACRA 1BTCA 4DXXA 2Y61A 1UR4A 2B4GA 4AWSA 1GQKA 3TKFA 2PRMA 3N9KA 3LV6A 3ZWSA 4W7UA 2B0MA 3NR0A 3TU9A 3CHDA 2O7SA 1Z69A 3V5OA 5F7UA 1SMDA 4MVAA 4C5YA 2YXXA 1H41A 2GGGA 3SCPA 4A35A 1XBVA 1DXEA 4GQGA 3QW4B 5U7SA 2GK1A 2ONEA 4NJJA 4W8LA 5DMLA 2YLLA 2DUXA 2ZUSA 4LXFA 4FR6A 1QWGA 3RX2A 3CIXA 4K8GA 1A3WA 5B7ZA 4L65A 3AHVA 5HPCA 4HJFA 1TA3B 1G4PA 2H3DA 1LOLA 4Z0JA 2Q01A 1RK5A 3G1VA 1HP4A 4ZBCA 2XGBA 2XINA 1OFDA 3FYYA 3NXLA 2QUTA 2J74A 4HSHA 4O15A 1AW1A 3NSXA 3UVAA 4E0CA 5K4XA 2J7GA 5I03A 1GK8A 1E55A 1KA9F 3NQVA 4LVAA 4PULA 3PZGA 1TIWA 1YBQB 2B7PA 1CGVA 1TPDA 2A6LA 3AYRA 3P0WA 3IEBA 4YPJA 4IQJA 1GG0A 2D73A 2ZUWA 3WUFA 5FOOA 3BH4A 3TYDA 1RALA 5AZ0A 1B3OA 4BQ5A 3ARXA 5LNWA 5REQA 1EZWA 1PV8A 2G95A 5A3HA 1RD5A 2I5QA 4P2VA 2EHHA 2HS8A 2UY5A 3CC1A 4S3DA 1K7EA 1Y8BA 2VZSA 3NFUA 2W61A 3EOUA 4DLMA 4GIRA 1X8FA 3AXHA 3TQPA 3BOFA 5C7HA 1ZL1A 3GO2A 4LQ1A 3GHUA 4PEKA 4LYKA 2OODA 1WDWA 3N29A 3HPFA 3QR1A 2DSKA 3LPOA 4XKYB 4V1XA 1OADA 3LZ5A 3QKZA 2YDRA 2W79A 5DO8A 3CL8A 2WMIB 1EO5A 4GYPA 1HTIA 1LBFA 3W29A 1T41A 2VZVA 2YCLB 3EWYA 3N2CA 2C19A 2O9RA 2DDXA 5LNVA 4XWUA 4C6EA 3HG2A 1Q2RA 2FFIA 3O0KA 2INEA 1IWPA 3DHDA 3W2LA 4G8TA 2F6KA 3O6AA 4H8UA 4JFWA 4DPPA 1VCGA 4PCSA 5A1AA 2NT0A 4F66A 5I7GA 2PUZA 4PTDA 5D4YA 3U0HA 1W1B1 2GSHA 5F2GA 1J6PA 1NDYA 2XM2A 5I79A 4Y6GA 2PDXA 3GFYA 1EHAA 3Q4DA 3VK5A 1VP5A 1KCLA 3N3MA 3PF3A 4GIAA 4RXFA 2I7GA 4PMRA 4FALA 3M44A 3G5EA 3R11A 3FGCB 4P7QA 3H2MA 1PJ9A 4RCXA 2FTPA 1MFUA 3IVSA 4DF2A 1WXYA 4PMVA 5T8GA 3AS2A 1UBSA 4GJIA 1FWBC 2HVNA 4QHRA 3CTTA 4ROPA 1OX4B 3PR2A 4IGMA 3C56A 3VNDA 4UZSA 2VGIA 4GNKB 4O1BA 3PWAA 1TZ9A 1NWUA 2YXGA 4NT0A 4M82A 5EFFA 1TVPA 1JZ5A 4O12A 2QAFA 1ISVA 1J96A 2PWGA 5CLWA 3M7SA 1ZENA 2ISWA 4FLQA 1XM3A 1UOZA 2D2GA 3BOLA 2XFFA 1JEZA 5C71A 2Z6JA 1QT1A 3GE7A 4XZ9A 1BQGA 1NELA 2R91A 3NWRA 3BLEA 4V27A 4S3JA 4WY0B 4IG2B 3A64A 5F2MA 1IT7A 4MZ8A 2FHCA 1RJPA 1NFBA 2QCNA 3CQKA 4WRHA 8TIMA 4M51A 4ZO6A 3NOYA 1EGZA 1DJNA 4L56A 3EX2A 3W01A 1XWYA 4L4OA 2QJMA 3A9IA 1AMYA 5C2CA 2A21A 4AG0A 3T44A 4ZO8A 3OG2A 3R8RA 3UETA 4HPJA 4AFYA 1ADSA 3TTEA 4TXEA 1MQRA 4Q4RA 5D2VA 3S3GA 1XYMA 3EWWA 2CXEA 4C6IA 2GGHA 4E8CA 1EDGA 1V77A 2OGYA 1CBGA 3AHZA 1NSJA 1ZB5A 4Y9AA 5IHRA 1A47A 1F6KA 2FFCA 1DJIA 5DRIA 4UQEA 4KWVA 3UJSA 2VRQA 3W7LA 1P0DA 4FI4A 5AY7A 5BCAA 2EO7A 4Y9NA 5DCEA 1DVJA 1LRNA 1TE1A 3CH9A 5JUVA 3W38A 3GG7A 2X42A 1KRMA 1TJ1A 5FEWA 3BAXA 4JX5A 1QPNA 4HNCA 5HQEA 5LIKX 3AHXA 2TAAA 2D20A 3QC3A 4RNHA 3H70A 1YKWA 1VBJA 5DXYA 4ERIA 4Q8NA 5ABEA 4FSAA 2AAAA 4M1RA 4L6HA 3CZEA 4H9TA 2WNZA 3PK7A 4P8WA 2PGWA 3BW4A 4AHQA 3LBMA 4JTRA 1ADOA 4AZ5A 4LV9A 1TTJA 1L8NA 1S1RA 3HFYA 1C7SA 2YA2A 4AHOA 5AKQA 1PIGA 3S1UA 1WZKA 1Z89A 4S3GA 2PF8A 1F7BA 4Y9PA 4LNYA 3H23A 4G7EA 2PS2A 3WD2A 2F61A 3AIRA 1PUDA 1U1JA 5GNYA 4O57A 2ZC8A 1U2YA 3EWCA 3L0KA 1WO2A 4FNSA 5GNXA 9RUBA 3KWXA 2QXWA 7CGTA 3L5AA 2A5HA 4UOJA 3L21A 2POTA 4P61A 4I5XA 3P60A 4E8GA 4JXCA 4NNBA 1VAHA 4FXJA 3WLPA 4N0RA 1BFNA 1VPXA 1QI3A 3YPIA 3G2GA 1EUAA 1KV8A 3ES8A 1ZFJA 3TCEA 4P7LA 3CZJA 5JBEA 2PTXA 3LCGA 4FX8A 1I1XA 4DNHA 1A5SA 3O15A 3GYCA 1K9EA 1H7XA 4HU4A 4YNGA 4LC8A 4ORIA 4FEZA 2J8TA 3TJ4A 4ZSTA 3WK0A 3P8IA 4K39A 3OBEA 1R3TA 3S1VA 2XVLA 2GPTA 4H8NA 1CGYA 2CZVA 4E2BA 1JD9A 3QV9A 1S39A 4Q4MA 3ZJ7A 1KFBA 1NQKA 3TYAA 3F5KA 2QV4A 2OZ0A 3RILA 1WKYA 2J8GA 4R53A 2BXVA 3H8AA 1E56A 4S3KA 1Q4NX 3BXWA 4PCPA 1KNWA 2PDJA 5A69A 4WX2A 5FJRA 3DUGA 3CAVA 4XVEA 2VL4A 5FKYA 3MV11 4MDOA 1VFUA 1K7XA 1XINA 5C6MA 1AVAA 5FJPA 4EPBC 3NAVA 4BQ2A 1I0BA 3SAZA 3ARZA 2CBUA 3AJ7A 1S2UA 1E6XM 3UZXA 1WBJA 4LYQA 2INFA 5A8GA 1DIEA 4C6PA 5CSUA 1PX3A 4AVNA 1I1WA 4LUTA 4AX6A 3HPAA 4AIEA 3TSBA 3A4WA 4J28A 3BLLA 2OCZA 3KZSA 1YRRA 1SO6A 2QS8A 3VMOA 1QPKA 4OBRA 3Q65A 1H7RA 2I16A 2XN0A 1ONWA 3NVTA 2OXNA 2YW3A 5AFDA 2GOKA 2B7QA 1IHIA 4UQ9A 3SSZA 1CGTA 2HE8A 3RXZA 1KTBA 2QGYA 4V28A 3LB0A 3UWWA 3R4IA 2V5LA 4O1DA 1C8YA 3LEPA 1RD6A 1KWKA 5DT5A 4Z2JA 2E5CA 3VD3A 5ECUA 3AQUA 3I10A 2D22A 4ASTA 1MI3A 4Z1DA 3VGGA 1K02A 3HA1A 4LCSA 3UWZA 3SR7A 2EJAA 3NQGA 1JI1A 1UH2A 2VR2A 2W3ZA 1G4EA 3N04A 4P8XA 1NDVA 2IUZA 1GVYA 2CXGA 3UY7A 1HUVA 4JQ4A 4W7VA 1YXYA 2ZVRA 1TJRA 4RX0A 2AGTA 3WK1A 3HPSA 3II1A 2Y7DA 1GVSA 6REQA 3BMXA 3KXQA 3CAQA 3BC9A 1UYQA 4HJWA 1A4MA 1VH7A 2H6RA 1R87A 4MB4A 3URQA 3LCIA 3TMLA 3PM6A 5A8MA 2PDWA 4CNTA 4EF9A 3G1AA 1UZ4A 2JFEX 4P5UA 3IJIA 2Q8LA 4S3AA 4CKQA 3PZNA 1ME8A 4NP7A 1PTDA 3KRBA 1XIIA 4H9UA 3SEPA 1MUMA 3S1WA 2PDUA 5M3WA 3UPBA 2RDWA 1OF8A 2CEQA 4D6EA 4DHGA 5BRPA 3VMPA 2Z24A 2J88A 1PE1A 3CQJA 3UCCA 1ZLPA 4H1ZA 2GL5A 4AD3A 1KLZA 2G50A 3HBLA 5HXMA 4BF7A 2YFOA 3KFTA 4IQDA 1OF6A 4HD5A 4XD3A 4XUGA 2OB3A 1H63A 1VYSX 2GUUA 2R1MA 4UMCA 3AXKA 4A4AA 1OCJA 2VCCA 1XS2A 3RO6A 1Y0EA 2ZZ4A 3TH6A 1MW3A 1LUCB 3KBSA 1X6NA 3GBDA 4K2SA 1BKSA 4RE4A 5EBUA 4XUYA 4NYYA 1K4HA 1PKNA 4IJRA 8A3HA 3VAVA 2P76A 3TR9A 4PCTA 3VILA 3SO7A 1CECA 3IJDA 3SY8A 3W88A 1D7KA 4NIRA 1W9BM 2JF6A 3UR5A 3JUGA 1E4LA 2RJGA 5GPRA 1NWRA 3ONCA 1C8QA 2WJFA 4JS3A 3VZZA 3E0WA 2H8XA 3KRUA 2VUYA 5HMSA 4F48A 4KWSA 1ZJBA 4RDYA 3IGSA 3M1ZA 2NQHA 1U5HA 3CUFA 3QGAC 3NGFA 1YTDA 3UG8A 1GW1A 3S1XA 1EA9C 5C5YA 1M53A 5C9UA 4EVZA 1LJYA 1JPHA 4LVFA 3VUSA 3R94A 3DZ1A 3VINA 3PP7A 4S3CA 4DAIA 3P74A 1WZLA 5CZ0A 1LT7A 4ZSUA 3R6IA 1SSGA 3M0XA 3P7YA 1UW9A 1V3LA 4IMEA 1IEVA 4JX6A 1D8WA 2WVSA 1U22A 2VUNA 4QQUA 3RUBL 3TXVA 4DBUA 3QFWA 3GXPA 4GUJA 1RK6A 3TW7A 8XIMA 1MZRA 2YDQA 4WVXA 3AS3A 2ACUA 1ONEA 4MPQA 3DESA 3IIOA 2DW7A 3WDHA 1UPPA 3EA3A 1KM3A 1XKYA 1GVIA 3MY9A 2W5FA 2OEKA 4R5EA 3GNXA 1K3UA 1QASA 5K7JA 4ZA0A 2EBNA 3CV7A 3D46A 1CENA 1SFLA 4US5D 2DZTA 9XIAA 1ICSA 1PKMA 3RR1A 3U6WA 4ADUA 4AZIA 2I5IA 1TMLA 2OLAA 5DFAA 3W3OA 3LHTA 4WK9A 3C0LA 3LXBA 2XVKA 5DBUA 4GQBA 3G1RA 1XLMA 1B1YA 5CGMA 2DZPA 3LGDA 4ZOCA 4Q4PA 3HQNA 1V0LA 4Y2WA 2Z7KA 1MVYA 4EWJA 5DLCA 1WBHA 5ABFA 3O9NA 4MPKA 5DCDA 3CPUA 1C93A 4OFCA 1G5AA 1EP3A 4GXWA 2NLYA 3PTQA 3TEVA 2A4AA 1F07A 1AQMA 3S6OA 3WEOA 3DFQA 1RV8A 3HZ3A 3B8VA 4IL2A 4PMJA 1J01A 2OT0A 4FX7A 1ZRQA 4RUBA 5LXEA 2V6AA 5G2HA 3F4NA 5D2XA 4O54A 3WSUA 1GKQA 3H21A 2CLHA 1YQ2A 2QKFA 4AWUA 2CHOA 3PBYA 1NDWA 5IBXA 1UOKA 1OBAA 4O11A 1DJWA 4RXGA 4HNLA 2OJPA 4HOWA 4MFEA 5BU9A 1M7JA 2WW5A 4OOUA 2X0HA 3LI0A 1XSKA 5H1WA 1PCKA 4G1KA 2UWFA 2EPNA 4C1NB 1ZS2A 4GA8A 1M3UA 1R85A 1N2VA 3THAA 4O1AA 1UCWA 2RDTA 3LS9A 3R58A 1M7PA 1RZMA 3D3AA 3T8QA 2VZTA 1XH2A 4PMYA 4NNAA 4LUYA 3VKKA 4HZMA 1Q6QA 1MSSA 3UZWA 4O53A 2HV5A 3AZRA 4PUEA 4EE9A 1WDPA 2R1PA 4JYDA 3U7VA 1MRAA 3WH9A 3OPSA 3TZNA 3TJIA 1GQLA 1VBGA 4GQ0A 1EF2A 4C90A 2C71A 3VM5A 3WH5A 3LHVA 3PG9A 1O4UA 4O17A 2QUNA 3HJZA 1TMHA 5EL1A 5HR7A 3RPTA 1E1CB 4N6FA 1NFPA 3KTSA 4DPQA 1JL8A 1H1YA 1LOQA 3F4CA 2WNWA 3GBEA 2B81A 3GZ3A 4GJ1A 5T9CE 3WH6A 1W3JA 4JY9A 5A6JA 3AISA 4G2DA 2VURA 3MJYA 1RQBA 3T2PA 2ZVIA 2PFHA 1UUQA 3BLPX 1HKIA 3B4UA 4RE2A 2OT1A 1PBGA 1XBXA 4RK8A 4OKDA 3WMBA 3TAKA 1Q6CA 2YBVA 3MJMA 3F7JA 2E9MA 2ATSA 2QJNA 3OZPA 4K37A 1S2CA 3F2DA 1T6MA 3U2OA 3BL3A 2D2JA 1VENA 4GI6A 5EMJA 1EWDA 1B0IA 3ARQA 1OG0A 2BS9A 2WANA 5J5RA 7ODCA 1C9WA 5EMYA 1QW7A 2EGZA 3BE7A 3DERA 1GT8A 1XX1A 4YN5A 3LA4A 1QFEA 4G9PA 1XCFA 3VOIA 2Y6ZA 1UMLA 1JD7A 4MJ4A 3URNA 3FA5A 3MCMA 2ISDA 2GQAA 4C65A 1UC5A 1GGOA 4HPHA 2ZTKA 3AAMA 4ORMA 1NAL1 2JBMA 3M7WA 4WJEA 1A0CA 2ALDA 1OCQA 1W5MA 3GTXA 1XLCA 1XDJA 5BWFA 4R85A 1CGUA 4MG4A 1X6LA 3E2RA 4HIBA 3C4UA 1ADDA 3GAKA 3PVFA 2QUUA 3REQA 5IFPA 1GCYA 4QGCA 4H01A 2I56A 3LNMA 4JIIX 3PUEA 2YBUA 4CQ8A 1LL7A 3MCOA 3Q94A 4NF7A 3R8GA 1XGZA 4RPQA 3AIEA 2OSWA 4TQTA 4J3UA 5H8UA 1NM9A 5FIPA 3B9AA 4BWLA 3U48A 3ARSA 2Z25A 4ZQOA 5MKGB 1TTIA 4E3VA 3LBCA 5G5IA 4B15A 2VI0A 1WZMA 1UP3A 3DU0A 3O1NA 4X60A 1DIKA 1VLIA 1QU4A 1FDYA 1N55A 3VNKA 5I23A 3N2BA 3W1AA 1LLZA 4L5ZA 4UNLA 4C6MA 4W87A 5AYIA 4K36A 4DWSD 3HO8A 4D6DA 3GC5A 5CH9A 3ZWTA 1JF6A 5F4WA 3W9ZA 2HVOA 2ZE3A 3B04A 1R46A 3W83A 1FA2A 1KCXA 2XGZA 3NTYA 3WQ8A 3VD5A 5C2XA 1LORA 4GYKA 2XN2A 3L0GA 3F4VA 4GC4A 5EMKA 4PBFA 4UTWA 1OINA 1H51A 4ZQPA 1YXDA 2C1GA 1KXHA 3G1DA 4IGHA 1EJTC 3CWOX 2C0HA 3UD6A 2YDAA 4IP5A 3L9CA 3VGFA 2Z00A 2VFHA 4JL1A 3NURA 3WQGA 3TFCA 4KWOA 4H6KA 1VF8A 3AICA 4ZCWA 3T05A 3WQOA 2J9XA 1QHZA 3WNLA 5HUPA 3L4VA 1SYTA 3VGEA 3NQDA 1R9XA 6PTDA 2J7DA 1VLWA 1XH1A 2QJHA 2PEVA 1MQQA 1S3TC 1MXGA 3TFXA 2ZX7A 1IYXA 1HW6A 3PS7A 1S2VA 3MSDA 1UA3A 2BLEA 1K6AA 1FWFC 1E73M 5BZAA 4Q4KA 2G4JA 4ZGYA 3W7MA 1J11A 1DJQA 3G1FA 4ZTYA 3STEA 1DIOA 2PC4A 5IDZA 2V3GA 2XH7A 3MDUA 1O60A 3ZXWA 1V93A 3LRLA 3GDTA 3URAA 3W22A 4Z2IA 3H55A 3OLEA 5CPOA 4QG9A 2C0AA 2ZADA 3KBWA 4ZVJA 2BZNA 4GACA 3GUGA 3FFSA 3UWQA 4IOTA 3PWGA 3EX3A 3SUWA 2VC7A 1JUKA 3W82A 3UNTA 5LZLA 5AYZA 2PLKA 1P0BA 4WUIA 2Y1HA 4QJ5B 4A2SA 4MY9A 3BLOA 2YBTA 3NQ8A 4GY1A 3A4JA 4CN4A 4FPSA 5AHMA 3CEUA 4NZCA 1KFWA 1R3QA 2J75A 5D37A 2XPKA 4WHBA 3UY8A 3PB2A 4US6A 2R1LA 3WLTA 2X0YA 1BRLA 3WDJA 3QZEA 5CC6A 3QOMA 5FF2A 3TTQA 2NV1A 3HGJA 5AVNA 1FQ0A 3R1ZA 3AMKA 4FNQA 3DFYA 4YHEA 2AKMA 1EZ2A 3ARWA 1KRBC 4FF5A 3HJEA 4Z17A 4C60A 3VIKA 2OO6A 1W91A 4BQ3A 2Q6ZA 4JFVA 2VX7A 3W74A 3STPA 1IT0A 1L0PA 4KKXA 2IPGA 2WBGA 4L4LA 4KMQA 3GXMA 1IR2A 2PLJA 3ZLHA 3AXMA 1R2TA 1MEIA 3TLLA 3IGXA 1W3IA 2BFGA 4DBSA 3LPGA 4I9MA 1DTNA 1W9PA 3CMFA 4IGSA 4R3UA 1F6YA 3VIPA 1WOAA 1RAKA 1G4TA 1AQ0A 1TTQA 2I17A 2JKPA 1G7UA 2HVMA 1UR9A 4Q32A 4U5KA 2BOEX 1W3LA 5BOFA 1R3YA 2NXGA 3MKKA 4AF0A 4V1YA 3KLLA 4XZWA 7REQB 4C6CA 2OR2A 3P8JA 4IIEA 1G7VA 4GXMA 4AWTA 1KM1A 4UTTA 1EC7A 1V7YA 4EOUA 2WZIA 1H1ZA 1BYAA 3ES7A 2BTMA 3KDNA 2EQDA 1DIDA 4HYVA 3BLFA 3KOXA 2DVXA 5XIAA 1VIWA 4F2BA 3UERA 4ZMGA 5CPMA 3TDFA 2A3HA 4LF2A 1TJ2A 2PWVA 1DWHM 2AAMA 1JI2A 4H6EA 1TQJA 2VTFA 3HV8A 5DX7A 2R6OA 1TFVA 1BPLB 3HB9A 1VHNA 2HMCA 4XD5A 3GKFA 4Z1CA 1U5VA 4NAEB 4L9XA 3HOJA 2XFYA 1CIUA 4WXZA 4QLJA 3VCNA 1ZALA 3R5EA 3GNOA 1F6PA 1SZNA 4GZIA 2JKAA 3OP2A 4GY7A 3W53A 2PDNA 3L66A 4DIAA 1L2UA 1RCQA 4XVDA 1M01A 4Q6XA 4CQBA 1YDOA 3S9ZA 3BAJA 3M6DA 1JQVA 3AMGA 3VKJA 2XG9A 1XCWA 3CYJA 1PZ1A 2J7CA 2FDSA 1RJQA 3V4BA 1EQPA 5HANA 3WEZA 4UR8A 3HURA 2QUVA 2WXDM 1D8CA 4ACZB 2JF7A 3POHA 5G2IA 2CESA 1P0NA 4O19A 1DQUA 1J8VA 2OLSA 2V5JA 4D8AA 3WMSA 1DQWA 1EBGA 3IANA 1JAEA 3C86A 2V38A 2WOQA 5D05A 3PY2A 4IH3A 1UHVA 1HZYA 4AQLA 2F6UA 2OWCA 3WFZA 1W9DM 4PZVA 4GKTA 4KETA 3LGEA 2PE4A 3MZNA 1ZCCA 1FCBA 3DGBA 4OU1A 4CGTA 2ZXAA 1EO7A 1O94A 3DIPA 2V82A 1QJWA 1G67A 4URIA 2PDGA 3IRSA 3E1F1 1L6SA 2A7NA 5F4XA 4DJFD 3S47A 3EOEA 4N7QA 3S5NA 3U4FA 3LLXA 1FKXA 1FWJC 1UG6A 3ARTA 2ZX9A 4MGGA 4Q7BA 4DUWA 4DJDD 1QK2A 3IAPA 3O6DA 2TYSA 2DZBA 4JCLA 3BLKA 2WC3A 1KCZA 4L80A 4GZEA 3UPWA 2W9MA 4HKPA 2NUXA 5A8NA 2XIBA 4DXVA 2Y5EA 4GCAA 1V7AA 4IP4A 3VNMA 2PODA 3AU2A 1HKJA 1H7WA 3WLNA 3ABSA 3LHUA 4ZB5A 4FXSA 1AQFA 3GX9A 3WQCA 4JIEA 2ZRVA 1XGEA 2PDKA 4ACYA 3K30A 1OFAA 3CHCA 3W1NA 5KETA 4LTSA 4GYJA 3VOCA 2E4TA 1MW2A 1S5VA 3IIXA 3VTRA 3GU9A 4LFYA 2KZHA 4LYPA 1GYNA 3CIWA 5K9DA 1FKWA 4DVOA 3FHQA 3QSTA 4MKSA 5U4NA 3U57A 2HDJA 4O8RA 4CEXC 4EANA 4CNUA 2GVGA 2JIWA 2TMDA 3CWHA 2J7HA 2P3ZA 3IWPA 1GQJA 4U10A 1MXDA 5E9AA 1NU5A 4AZHA 1TWIA 3CZ8A 1AZ1A 1U30A 4F9DA 4K3ZA 3W7NA 3WLKX 1DE5A 3FA3A 4PRWA 2DZSA 4BJHA 3D3FA 3EWZA 2IPWA 4E4PA 1F05A 5DMYA 1HNYA 1QI0A 1Q63A 3MP4A 4DZHA 1XRFA 3H2OA 1XXXA 1AH4A 1PTAA 2HQAA 1CCWB 4PMDA 4LW7A 4UFIA 4S38A 2X0SA 4LCRA 3GB6A 1QPRA 4HMNA 3W1RA 2V8ZA 1UPMB 1HG3A 1S5WA 2QCEA 3LSCA 4GVIA 3A21A 5I3KA 1UZ1A 1GKPA 4AYSA 3SECA 3NVDA 4H83A 3HGOA 2YSWA 2XZ9A 5HPOA 3DYPA 4F0RA 4H9MA 2ZA2A 3ITTA 3TP4A 4J4KA 5JH2A 2GOUA 2Y0FA 4C6NA 4DQWA 2XVPA 5CC3A 4LUSA 3DC8A 4QITA 1XC6A 4KFPA 1HGWA 4JN8A 1VEPA 3I6RA 1J0YA 1O66A 4GFSA 4FK9A 1TRDA 3LDVA 3TVAA 5LSMA 1XLBA 2BB0A 3WG6A 4XSLA 1MEWA 5FI8A 4YLWA 1CGWA 2R9RA 1Y5XA 4ICCX 1X96A 4K8EA 3WEMA 4A3HA 2QCDA 3KOFA 4US5A 2VMFA 2WHJA 5EKYA 4JL2A 3CB3A 1P7TB 1BG9A 2HCVA 3S9IA 2VOTA 4DM2A 1E51A 2ZUNA 3GDMA 3UR7A 3L4ZA 5CLTA 5TIMA 3I7RA 4GWEA 1HVQA 2F6XA 2Z29A 2PP3A 2HZGA 1TV2A 1M65A 2ZFAA 1FTXA 3VDHA 2C7FA 3CK5A 4CCEA 3SIZA 2BY0A 2PTYA 5AB3A 1TWWA 3VIOA 3VZYA 1E71M 2DU2A 4KWUA 4MKVA 4IJCA 4IMFA 1B3YA 2QLYA 4EF8A 1JYXA 5BWAA 4MNLA 1GQIA 1BHGA 2YZRA 5AYXA 2FPYA 3VDCA 4QSHA 1YXCA 3MHGA 3GG1A 2QMJA 4DWSB 3VD7A 5HATA 1G9HA 4N9BA 4ZOEA 3MBFA 1QI5A 2ZRZA 1JZ7A 1EH9A 3MWCA 1VBHA 4PB5A 4MB5A 1NF7A 1XYFA 3B8DA 2ADAA 3RITA 2QEZA 3AMCA 3N13A 3OYXA 1VZWA 1FX6A 1A5LC 3VE9A 3CJPA 3MYOA 3WJZA 2WMJA 2VVNA 3UYCA 1TTPA 4I8DA 3URBA 1KC7A 2DY3A 3PJWA 3CLMA 4JZ5A 2X2YA 4JHOA 3EPOA 2ZQ0A 3TSMA 3MVIA 5ABTA 5TQLA 3S5ZA 1I8JA 2E0PA 5H8MA 1JFHA 2VXNA 1XBYA 1EJUC 1S2TA 3CIVA 1YPXA 1ONXA 1JIBA 4ZE5A 3LXAA 2IPJA 3T78A 3NDOA 3W76A 3QPYA 1SJDA 1OK4A 2RGLA 2VENA 4GOAA 3MMDA 4I7UA 4CCZA 5MF5A 5LYRA 3LX9A 2PP0A 3L65A 5AC5A 3WD3A 3N25A 3CUJA 3PFRA 4BHYA 3QM3A 4WSJA 2E40A 4JYEA 2ZDRA 1MRQA 4PSRA 2G97A 3HG3A 1HGYA 1VFMA 2YJQA 1Q6FA 2RGMA 3RJXA 3S2MA 1WXZA 3SQMA 5EY5A 3VIIA 3EB2A 2FGZA 1KQYA 2DORA 1XRSA 2ZXBA 4QEEA 3GSMA 3M46A 5E9XA 3SN4A 1L8PA 3BJTA 3NPXA 3WDIA 2FZBA 4OBSA 3S83A 4H7VA 1IEIA 6TAAA 2CHRA 1Q5MA 4P7RA 1WDSA 5CJMA 4EP8C 1TV5A 3H26A 4AZGA 3GNDA 1GORA 3CO8A 3SUVA 1CX9A 1KO0A 1JYVA 1SZFA 4JCMA 1UD4A 1C29A 4XAGA 1AL7A 1S5TA 2DJXA 4R34A 1DORA 1UZDA 4D6IA 1FWSA 1JZ4A 1SR9A 4LAKA 4FOUA 1OY0A 3WBYA 1Z48A 4HOZA 3B9NA 5HQMA 1EJRC 4NI3A 1SQ7A 4XAFA 4ENLA 1K4GA 1HIZA 4HYRA 5JH1A 4IZGA 1E6RA 4YTTA 1ONRA 2D2OA 1E1EA 3AROA 3EAUA 3ZQ9A 1PZ2A 1SR0A 4BI7A 3NSNA 3KZPA 1AL8A 1K77A 1UIPA 3MHFA 5HAOA 2EPLX 2X41A 2AOSA 3KHJA 2KX9A 4WDWA 2BDQA 3AHYA 1V6XA 3EXRA 2UV8G 1JGMA 3QC0A 1J0IA 4LBSA 3TOYA 1ML1A 3I7SA 4ES4A 4EPKA 1XRTA 5AC8A 2Y7GA 1XF0A 2WSKA 3UJEA 3K46A 4HOXA 1X6UA 1P7TA 3B9EA 1ZSXA 4N2YA 3ZJKA 1XIEA 5K3VA 3BCJA 5HJXA 1DP0A 4R7OA 4ADSA 2CW6A 2PAJA 4QFUA 3ZVHA 3BMVA 2GJXA 4XQ6A 1JJKA 3TAOA 3W1QA 1TRIA 1VBUA 4PODA 4GABA 3KW3A 3OW1A 4IMCA 3MDWA 4O52A 2NVAA 4H04A 4GE8A 3O0FA 1QBAA 5BOEA 5D8WA 1OWQA 4RV3A 3R43A 3FXYA 3LTYA 5AECA 4H9YA 4UFKA 3N6HA 3IJ6A 3Q2DA 3ZR4A 5KEZA 1ISYA 1J2WA 1GOMA 2Z26A 5EFDA 3VZXA 3G8RA 3NEVA 4ZO9A 3L2LA 4UR7A 2WPBA 1AW2A 3TYUA 3KE0A 2YW4A 2Y85A 1TX0A 3UZYA 2QT3A 5ABGA 4MYAA 3AFBA 1TVLA 2WNQA 2YDSA 4JYFA 2W62A 1DJGA 3TQVA 1UD2A 1E6PA 3LCFA 4HHHA 1O5KA 4FIRA 3CT7A 4CQCA 4DBEA 5C9WA 1Q65A 1WB0A 1XRVA 4ZENA 3TYZA 3E0LA 3NL5A 3SUUA 1XFBA 5BRQA 4DZIA 1OD0A 3UG4A 3TR2A 3SRHA 3HG4A 4XZBA 1LM1A 2VWSA 5HDRA 4Q8WA 4L9YA 4CU8A 4J5NA 3ENLA 3H6OA 2PURA 5EMLA 1AD1A 3QLLA 3LLDA 3L4TA 3SADA 1Q6GA 1GEQA 1WKFA 4O1EA 1V0MA 1H11A 3MS8A 3RX4A 3B03A 3CO4A 3L5LA 1FY6A 4REQA 2BGQA 3GD6A 4DWSC 1X1OA 1P0KA 3SB0A 2ZUTA 3KBMA 4R9XA 1CXLA 2D0GA 1QNRA 3FIGA 3H2FA 3WO8A 2CZDA 3E96A 3N6JA 3E2VA 5I3HA 2AMGA 1NWSA 2WKLA 5E6ZA 4TVCA 4LRTA 5BRBA 4ZQCA 1BEUA 4L9ZA 5M1TA 2E67A 4ECLA 3OEXA 5I3JA 1DJZA 4NILA 4IX2A 1JXKA 2FIQA 3N11A 2BSLA 3SCRA 4RZBA 3PNZA 3EXSA 5CBIA 3OLDA 2YGYA 4WEVX 2OO0A 4H2CA 2FKPA 5IXEA 5E1QA 2NSXA 3W07A 3W1TA 5BMWA 2H8ZA 5J04A 6TIMA 1P4CA 3QJAA 1FP8A 1FWIC 1PDZA 4H9VA 1IXNA 2O4QA 4F0HA 2PTZA 3P67A 2EJ1A 3WQDA 1MDLA 1ESWA 4TVUA 4DN1A 4DBDA 1DJXA 2OYMA 3M64A 2YZ5A 2VDIA 1QNVA 1ZTVA 5H91A 2QJIA 3B40A 3GDLA 1V03A 4D6CA 3GXFA 1HJXA 3V0TA 2IKHA 3M0VA 4M6UA 4FP1A 2PD5A 3RHGA 3G0UA 1K8ZA 1NY1A 3DDMA 4GPNA 1E5JA 3E6EA 4O0QA 2I1OA 3T2QA 4TV5A 4C7DA 1P6BA 5LIXX 4OBTA 3V16A 2E1DA 1O1HA 3RGTA 1A4LA 3P2VA 2A0NA 2GZXA 1K7FA 1NQ6A 3F03K 3MUAA 1AW5A 1QNQA 4IL0A 1J9YA 3SFWA 5A6KA 6ALDA 1TMQA 2F38A 3LPPA 1TWZA 3W7EA 3LBOA 2NX3A 4HK7A 4RNFA 1SW0A 3MI3A 3UZJA 2J77A 1B54A 1LF1A 4RDVA 1YPFA 1C8VA 3R25A 2OFJA 1V5XA 4NHVA 3MHUA 1NOWA 5CAKA 3OLGA 4RE0A 4XG1A 1X39A 2WM1A 3KVLA 3W1MA 1EFZA 1NIUA 2IKGA 4JPGA 2TSYA 2PDBA 3K4DA 1LBMA 2PLCA 1KRCC 5HMEA 4LEFA 1VJIA 1P5BA 2ZUUA 4LS1A 1R6WA 1TSIA 4WCJA 4LX4A 2ISVA 4GVHA 1UUOA 1IGWA 3LHWA 1IT8A 1MYRA 3N3TA 4D8ZA 2YCJA 1PYFA 1MQPA 4NYUA 2EKCA 2O55A 2P5NA 3EX1A 1FBAA 1XLGA 3RX3A 2Z1BA 2XUCA 3SCUA 4DJED 1TIMA 1CXEA 3FEMA 1VPQA 2FMOA 3P5YA 2V3FA 3TK7A 4P7NA 3BGAA 5BYWA 4JTLA 3HM7A 2DH3A 1FDZA 1IXQA 2A3LA 4GNVA 4M0XA 1XW8A 1O68A 4TX9A 4N02A 1EIXA 2GK1B 3TN5A 5LNUA 1JCYA 1L6YA 4F40A 3T0AA 3WLLA 1QW9A 2C91A 1RH9A 4GVFA 2CKRA 3U3HA 3U7BA 4BFAA 4H00A 2C79A 3IVUA 4J3XA 4A8IA 4PL2A 3N4AA 1XQLA 2ZX6A 4LVBA 3E49A 5G4WA 4YMZA 3N9SA 2ZRYA 4P8VA 1HL2A 5C9ZA 2QJJA 1T8QA 4XX6A 3C2EA 5IM51 4L61A 5H8PA 7PTDA 3DX5A 3BSHA 3K1DA 2ZTJA 5KTLA 2OGJA 3NUKA 3OLIA 3T42A 3U9IA 5C7VA 4N9CA 3EA1A 1OQFA 4O1CA 2G5WA 3ZFHA 1JXJA 4GHRA 1KV5A 2F2KA 2P88A 5M17A 4TMBA 1BKHA 4OIFA 3GTIA 1F3XA 5REQB 1PWLA 5DCBA 1AH0A 1VC4A 4UCFA 3HQOA 1O5XA 4UTUA 3TQKA 2J78A 3H53A 4HSNA 2XVNA 4AB4A 3C5QA 4WY0F 1UWIA 2E8YA 1X97A 1XLEA 4HMDA 5KITA 2L5HA 5F2IA 2WBKA 2QDDA 4NL1A 2PWUA 5CGQA 2W91A 1QI2A 1SVDA 2RJHA 2WZMA 3ONBA 3ZO9A 1H4PA 3GH5A 4DJFA 2RHGA 2X16A 4RDWA 1T0OA 1DXIA 4NKCA 1POJA 2WHLA 3PTDA 3WYZA 1H5YA 3SFKA 4DJDA 1ITUA 4HHMA 3GKAA 1E3XA 3NPVA 2J24A 3TYEA 3TWAA 3W86A 2WVVA 3EEZA 4AC1X 1K70A 1Y5WA 2YYTA 3O07A 1X7IA 4GC3A 5RUBA 3VKCA 2GLKA 4QP0A 1ZQ5A 3QH2A 1FWNA 1SO3A 4RZ5A 4H7CA 5LA1A 2XIJA 3M4HA 2XZ7A 1BWKA 1XJBA 2G0WA 4NXKA 2OMAA 4X63A 1F8MA 1OFBA 2XSXA 4W84A 3W02A 3IV3A 1HT6A 1XICA 2HRWA 1ITCA 1XIBA 3T0BA 3R0KA 1FWCC 4J2MA 4CVUA 4PSPA 4L64A 5LA0A 1SGJA 3IVTA 2BWGA 2QJGA 3RJYA 4LPCA 3TIMA 4M80A 1IEQA 2J6VA 4B91A 3R79A 2Q8ZA 4XO7A 2ZBTA 4O0KA 1S5MA 2EG8A 2WQDA 4D6JA 4BY3A 2ICSA 2Z28A 1XFCA 1SFJA 1JPIA 5JBDA 1A5UA 4NZ1A 3G3MA 1HL9A 1ECQA 1HKVA 1ITXA 3WBEA 3OYZA 4EACA 4KGJA 3FJ4A 4TO8A 1KFEA 1GZGA 4AIBA 3W70A 3GTNA 5CBJA 2WQPA 4DYJA 4J1OA 3RPDA 2QCLA 1Z44A 1PO9A 1OEPA 3EWUA 1UD5A 2JE8A 3C3NA 1EOKA 3RRAA 6XIAA 1XYAA 4ZFCA 5DMMA 3SCVA 4X61A 3GZAA 5D9OA 5CGTA 1B9ZA 4WOQA 6A3HA 1E0WA 2HROA 4ZQMA 4K1WA 3QSRA 4JIPA 3QZ6A 2PZNA 5DMNA 5KZ6A 2OQLA 4QG6A 2VEGA 3UA4A 3UZ5A 1QR7A 3TONA 4Z42C 4ZR8A 1XPYA 2C1IA 3VM7A 3EPNA 2V69A 2PDCA 1ZGDA 3THUA 2X40A 3RNDA 2O9PA 1F8IA 4LY4A 1HKMA 2UZ9A 4XV0A 3WN6A 3EDEA 4IUGA 1KTCA 4QJ4B 4UFLA 3MKCA 4MWAA 5AYBA 4GUIA 1L2QA 2ABAA 3QHMA 3HMCA 3V5FA 1TVNA 2E1WA 3JVAA 5DQPA 2WLZA 4JDBA 4NAFA 4LC6A 3LN3A 1RVKA 3APTA 5AC4A 2PF0A 2FTYA 3LV5A 5A95A 5HNTA 2WNNA 3MO7A 5T26A 1ZP3A 1P0EA 3MSRA 1RP9A 3MW7A 3GIPA 4I7VA 3H4XA 5EMUA 4DYKA 4LGXA 1QHPA 5CBBA 1M6JA 2ISSA 1JCXA 1HO4A 4NZ3A 1UA7A 4OJYA 1BXCA 1OFEA 3PTKA 3GNRA 4PTNA 1IZCA 1WAUA 4MADA 2FJUB 2OKOA 4LH8A 3W73A 3C8NA 1ODUA 3CBWA 3M0HA 4HN8A 4WJXA 2HBXA 2E25A 2H9AA 4Q8OA 4ZXLA 7XIMA 3NQ6A 4GCXA 4XISA 2DFAA 2GJLA 4IX0A 1QXLA 2E28A 4O16A 1UR8A 2FZMA 2Z6IA 2QDGA 2WWDA 4FXFA 3LCXA 1ZUAX 3GHRA 3VD9A 4BCEA 3N73A 2TRSA 4M6QA 1JDFA 3OB8A 3W7GA 4BR1A 4HK6A 3WF2A 4ATLA 1B2YA 4PTVA 4BZYA 2PDYA 1WXJA 3MT1A 3DOPA 3PUOA 4UOZA 2BV9A 3IJ8A 3HQPA 3K5XA 4Q7NA 2PA6A 3TC6A 5HNNA 3B06A 3ARUA 1W1VA 1JPMA 4W9TA 1F3TA 4HPNA 1BSLA 1LCOA 1EYEA 3QTGA 2EPMX 4G5DA 4G7EB 1PTGA 1E9YB 4Z08A 4GH3A 5I77A 4XZHA 4EXAA 4LAZA 1E9ZB 1W54A 4JTGA 1BTMA 4B4HA 2FHFA 2Z27A 2ZRWA 3E5PA 2NVCA 4CD7A 1AG1O 5CKSA 2ZYFA 3ECQA 3W71A 1AJ2A 3BICA 2WVUA 3H12A 1PEZA 3U8GA 3WLRA 2DGAA 3VDAA 1ZJIA 3GAYA 1GQNA 1UJQA 2OEMA 2PDFA 2D2HA 3GG0A 1UWTA 1CB2A 2R14A 3NM3A 4JR5A 3K8MA 3N4EA 4L6DA 4NJIA 2V3DA 4LVDA 2CERA 1VFHA 3I7QA 3RDKA 1LROA 4RR4A 5I6SA 2BVTA 2XIIA 4FOJA 3N19B 4I3GA 1FH8A 4XZIA 3TV8A 2CU0A 1WE5A 3N2OA 3C2FA 1FFQA 4R7WA 4FO4A 3PBVA 3U4AA 1GPFA 3FK4A 1WUFA 4U33A 4OTKA 4GYPC 3SGZA 4MLRA 4Y8FA 1A3HA 4E6MA 5FL1A 4ADTA 2Y88A 3TSDA 1UKPA 1QOXA 2XISA 4FB7A 3KVKA 3T9PA 1B31A 3N1AA 1TPB1 1C9DA 3GC4A 3NL3A 1XGDA 4ROQA 4Q33A 4PMOA 4R33A 1H50A 2XU2A 3NO3A 1OC6A 3W1LA 2C16A 2LLEA 2XIMA 3FKKA 4Q22A 3PTMA 1TPVA 2VM8A 4IQLA 2DPEA 2WV8A 3ITCA 3UA3A 3MWAA 2CLMA 3A3XA 4FZIA 4PB3A 2PWDA 3EWXA 4WDTA 3A12A 1UMYA 2DZUA 3ZYZA 4XIMA 3WLSA 4JD4A 5BXRA 1I9CB 2ZXDA 1P6CA 4KWWA 1V8EA 3T8LA 3K1GA 3NGJA 5M5DA 4KH2A 3WFAA 1HQTA 3W2MA 3E38A 4IIGA 1M9HA 2VFGA 5LIWX 2FH8A 3SGUA 5I5RA 1IZJA 4BQ4A 4RL3A 4LUTB 4TV6A 3W6LA 1QK0A 2PGRA 4DAFA 1W37A 3BK0A 5G1YA 1BSIA 3UW6A 3EX4A 3ZSTA 2OX4A 1G0CA 2CBJA 4HMCA 4CN1A 4QBXA 4PRRA 2X1RA 2W0UA 1PPIA 1REQA 4CD6A 1R7OA 4F79A 3IV8A 3O8AA 5XINA 1VKFA 3AYSA 4FA3A 3P61A 2WJEA 1I2RA 1JPKA 4MM1A 5CXPA 1CZ1A 2DP3A 2ZUVA 3P93A 1AH3A 4I9TA 2VEFA 1B4EA 5XIMA 1FVPA 2C8NA 4WSKA 3MC5A 1EL3A 1LWIA 2QDHA 3EB3A 5AHNA 4MHBA 2FPTA 4GXPA 3QOKA 4Q4OA 4XD6A 1OYCA 5I24A 3R2GA 2X2GA 5GJNA 3OVQA 3QY6A 4KEZA 3WJWA 4UZUA 3WQ6A 4RV8A 1JRBA 2PPGA 1OFRA 2BOGX 4QEHA 1PB0A 4XB3A 4HMEA 1OX5A 2C15A 4M6VA 5HNRA 4L4PA 4JFUA 4WKFA 2XN1A 1FH9A 5DELA 8XIAA 2ZRXA 4ZOAA 2Z1SA 3ZJ6A 3GW0A 3OQEA 2V63A 2NV9A 1W1PA 1KR1A 2Y8VA 2FZ8A 4IIBA 3R0UA 3H2NA 1B57A 1N8FA 2VR5A 2GDQA 6REQB 1E1FA 1SU5A 3WENA 2NV2A 2VD8A 4HNNA 5AHEA 3DHFA 2ZX5A 2PDHA 5TNVA 4JTDA 3LCWA 1UP0A 1FWTA 2JK2A 2ZA3A 1M03A 1K8XA 1C92A 4N9DA 1F3EA 4EAMA 3B9DA 1WOBA 4CN6A 4QS6A 4YVVA 4TR9A 3HMJG 1E6ZA 2RFGA 1E40A 2PP1A 4GNJA 2V9DA 3V5CA 1F76A 3WLHA 1X7FA 4ERGA 2ZIDA 3GWQA 5TF0A 3HFTA 4H3DA 2J4GA 4H8HA 8CGTA 3DEQA 4UMAA 1D3CA 5D09A 4QAIA 2E3ZA 1UQZA 4J3SA 2ASHA 4LALA 2Z2UA 3VDGA 3B0XA 1BYCA 3DYOA 3RU6A 3DFNA 3BLIA 3QGVA 3LM7A 4FF7A 2QCCA 1XDMA 4EWND 3R10A 4JIRA 4XKMA 3AALA 3LK6A 4FXRA 3BCFA 2VEPA 1XYCA 1BF6A 1JCLA 4IF2A 5TAOA 4IISA 4EAYA 3EOOA 3RM8A 4NG3A 4B4FA 4MLJA 2VQUA 5LNRA 2ZXQA 1Z3NA 1FXQA 1UH4A 1FCUA 1YNPA 1KXTA 4J3TA 3WQVA 2NT1A 4AZCB 4IPNB 3I4KA 3N2TA 3N14A 1OT1A 1EA0A 1EDQA 2REQA 3PC0A 4C7GA 4CUCA 4LUIA 1J0ZA 1V0NA 3FS2A 1PZ3A 3WDQA 1GOWA 4B3ZA 5C8BB 4UTIA 1PCWA 3AHTA 4O50A 4GBDA 1XIGA 2Z1VA 1A3XA 2QF8A 4HP5A 3GXDA 2DIEA 3ZLFA 2WPGA 4KPLA 2YX0A 4MTVA 1UUMA 3ABXA 1NP2A 4FNPA 1X8CA 2O0TA 4DUXA 1TPFA 1NVMA 2D24A 1W6TA 4DI8A 1RXOB 3WQFA 4MSSA 3SQSA 3SRDA 4O14A 2V2DA 3VGHA 4PUDA 4AZ7A 3OVPA 4ZO7A 5K4ZA 3FW6A 2Y7EA 1YEYA 3C2VA 4ZQRA 2B31A 2GGIA 3WF0A 1O7AA 3SURA 1KFKA 1DPMA 3GLCA 5JMUA 3NPWA 4I7WA 1TWSA 3GDBA 2YKKA 4LEQA 3NO1A 4HT3A 2PC8A 3ZT7A 2FJKA 3TW6A 1A5OC 2IPFA 4FR1A 3ZMRA 1GVQA 2YXOA 3CUGA 4PB4A 3H4WA 2PRHA 2ACQA 3M5YA 3XISA 2D0HA 3ITYA 4H7ZA 1KFLA 4FNUA 4I6KA 1W9XA 4GX8A 5LNSA 1E3ZA 1A5MC 4RZ6A 3HV9A 1OVDA 3AIBA 2WSPA 4ZE4A 3XINA 4QDWA 4CQ9A 3VDBA 1XLHA 3W27A 4PA8A 2PMQA 5HWMA 3BLDA 1OD8A 2C18A 2J7EA 3Q58A 2OWWA 4WGHA 4M81A 4JEJA 4MMWA 3IIZA 2IS7A 1RVGA 4K6AA 1A0EA 2ZKMX 1H7PA 5CG0A 1W1IE 2VELA 4FLRA 1MUCA 1PKLA 1S2WA 1GG1A 1XLKA 3NIYA 1UR2A 1L9WA 3ITXA 4JTAA 4Q8MA 4LBUA 1AD4A 1XR2A 1W2VA 3NJ3A 5ABFB 4N4QA 4B5XA 2GVEA 3ARYA 4DEFA 3CZLA 1V0KA 1GOQA 3WY1A 2PRLA 1W1ZA 4B3LA 1GTHA 5A2CA 3S9YA 1EGVA 3SCNA 1OYAA 4E3TA 4QS5A 2DZXA 1XD1A 3XIMA 5FJIA 2NX1A 3HG5A 1B9BA 1W8GA 1XH0A 4KW2A 2DSWA 3LHYA 1HJSA 3NCOA 1Q8JA 1Y5VA 1US0A 4E38A 4O8AA 1EXPA 4B5TA 1KM5A 1ZBWA 4DJEA 2J9ZA 2AL2A 3NM1A 1XLDA 3ARVA 3SY1A 4I6VA 1HN1A 1W1A1 1RY8A 4LAMA 1U5JA 3FVMA 4W93A 1E15A 1MO0A 1J18A 1VIZA 1ZAIA 1MWOA 4IPLA 3GG8A 3IK2A 1SZRA 3UF9A 3RYSA 4I9JA 3LLFA 3L23A 2WZHA 2GGJA 3QQWA 1OIFA 4O0ZA 1UROA 3NSMA 3S6DA 3ABOA 3STGA 1TQXA 2W4XA 4H6RA 3BPWA 4PMXA 3UWUA 3CV1A 3WNOA 2ZZ2A 1Z7AA 4X9SA 5CJNA 3M47A 3V36A 3AYTA 3D6NA 2BOFX 2IQDA 3QPEA 3G3DA 1MUWA 5T91A 2BG5A 1TUXA 1YDNA 4DJEC 3UBPC 3CQHA 4U28A 2W27A 2DT3A 3A23A 4M56A 4QJ3B 2QMKA 4PRTA 3U5YA 2G8ZA 3GW3A 4B5NA 3AJXA 5HR6A 1GHSA 5BXTA 4AZCA 1JZ8A 5FF3A 1N82A 5HMFA 3SY5A 5L6UA 3GVWA 4WLCA 3VI2A 1PDYA 5C70A 3PBWA 1PHQA 4UFMA 1GPWA 1CB7B 4C6JA 2AGKA 4EPEC 1G1YA 1PWMA 4CNSA 3CMJA 1E72M 4IPPA 4JDYA 3RLGA 1UH3A 2GQ3A 4X3ZA 3ARRA 3CZKA 3TYCA 1CLVA 2VX5A 4KRTA 2GUYA 3IUHA 4RPPA 2A7PA 5AYYA 4K7VA 4NVTA 4Z1BA 4IPJA 1E5NA 4AH7A 1OG6A 3C6CA 3W81A 4HGXA 3VYLA 1B5TA 1QPQA 3SN1A 4KRUA 1H09A 3CASA 4A8LA 3QMRA 3CV2A 4E2VA 4JHZA 3C0JA 3W23A 1BXBA 1KGWA 3AOFA 3IARA 3SUTA 3NEHA 2DIKA 2RUSA 1T7LA 3QBUA 3W00A 3ZIZA 4W86A 3USZA 3O6YX 1A5AA 1ZJAA 1R7AA 5AOUA 2NQ5A 2I14A 4GI9A 3TTOA 3E3HA 2W67A 1XYBA 1P43A 2YB4A 2CLLA 3M5ZA 3S8HA 3CUZA 3JZUA 2VZOA 1WKEA 3REQB 3DFOA 1QNOA 2R8WA 1E9LA 4M5PA 4QE1A 1W31A 2QPUA 3FXGA 2D3NA 2HWGA 4UTMA 1OGBA 3S5YA 3S4TA 3W72A 2I57A 4FMVA 2W92A 4WKAA 4KCWA 5LXXA 1SZEA 1B3VA 3G0XA 2WVTA 4LBRA 3ZLGA 3L67A 2VT0A 2WJDA 3DHUA 3AZTA 4JQ3A 3G1YA 1QPOA 3OJGA 4KIRA 1VD6A 2QIIA 3F2BA 5G4EA 2D69A 2WMKA 2GJPA 1WQ5A 3QW3A 4EXBA 3POCA 2GQ8A 1XLFA 2OOGA 3N9RA 7TIMA 4QCEA 2Y7FA 2YPIA 3EX6A 4C6FA 4F9JA 4WDUA 1RHCA 5I09A 1UD3A 2BVYA 4XAYA 3PFMA 2OZ8A 5CC5A 1TR9A 4HZ6A 3NXFA 4A2RA 3W6MA 3RLUA 3L4XA 2AMXA 2ZZ6A 3GFXA 3QEZA 3MPGA 2O56A 3E12A 4M6PA 4IWWA 4LT9A 4P7OA 2BP1A 3G8EA 3P80A 5ECVA 5DY3A 2GYIA 3VOJA 3LG3A 1VB9A 1A5CA 2CHNA 3GU1A 4YHGA 1XIFA 5FCZA 3S46A 5DBTA 1DJHA 3AU6A 3GTFA 1FXPA 4X0NA 1BAGA 3CNYA 1LT8A 1JCMP 4XTIA 4J2PA 4HU8A 3KOYA 2VFIA 3SZ8A 1V6UA 1ITQA 1Q6RA 1YMYA 3IS4A 1ZAHA 3W1XA 3QQ0A 1UKTA 4TU1A 3UJFA 2OU4A 5LGZA 1KCKA 3TZFA 1UIOA 5AVHA 3WLJA 2Y62A 2ZZ5A 2E8ZA 3D0CA 4R27A 2Z7GA 3PBMA 3V18A 1CXHA 2IXVA 3W7HA 1LOSA 2A1YA 3A6OA 2VR4A 3AUJA 1PX8A 4W89A 1RSCA 2PDLA 4N4PA 4G1NA 4IFKA 1DOSA 4PFMA 1DBTA 3HIJA 3FKRA 4QNEA 5HINA 3KCOA 1XYZA 2PBGA 1Z9AA 4TTUA 1XV8A 1UWRA 2VGBA 1RQHA 4S23A 1J0HA 3KP1A 5IBXC 4WD0A 1K03A 2GJRA 5C55A 3FA4A 3PZVA 5EPDA 1D3HA 1XCXA 1EGMA 4OQVA 3OZYA 1RP8A 1TJPA 4FLSA 3BO9A 4A8NA 3G1SA 3OVGA 2X1SA 1KFJA 2KAUC 3MZ2A 2R1NA 2WLYA 2QZRA 3NQFA 1IEXA 3GNPA 3BANA 1DHPA 1JZ6A 4GQRA 3L2IA 5I3GA 5I3DA 4NXSA 1NFGA 2PCEA 4J3WA 2CZEA 1KLYA 4O4WA 1JFXA 4JKKA 2FQIA 4MAVA 3UJRA 1HX0A 5AHIA 1EF3A 5FF7A 1N8IA 5CPSA 1GOXA 2YL5A 2VC9A 2NW0A 1MZHA 2PBOA 3KL0A 4JX4A 3IUIA 3W7KA 4DF0A 2OVLA 2CKSA 1HVXA 3PZ9A 3LTSA 3VIFA 3QV8A 3BQ6A 1S5NA 1EJ7L 4WR3A 2QGHA 1HF6A 1M41A 1BRLB 1BXNA 5D04C 2PU0A 3TN4A 5A2AA 4DO4A 2EXOA 3QQ1A 1OGGA 1ZY9A 1LP6A 1EC8A 5BXSA 3UYIA 3RK8A 1H7NA 3M6YA 2VDGA 1OIMA 1F9CA 1E6QM 3PB0A 4QG8A 3SSJA 3MYPA 2DT0A 3MUCA 4KBXA 2JIEA 2YCEA 4M7SA 1S2AA 5LHEA 3PAOA 4HCDA 5FSDC 1C90A 1YX1A 1W32A 1G01A 2BASA 4LY8A 4ZEPA 4D8LA 3ITLA 3K2GA 4CLMA 1E0TA 1R3VA 2A3BA 3QHNA 1Q13A 2CNCA 1EUNA 3CUXA 1F61A 4W5ZA 3W0KA 3EDDA 5AC7A 1U1HA 1B4KA 2PTDA 1DWGM 2QNEA 4A8RA 3OGSA 4YYCA 3PUGA 4UQCA 2J27A 4AF0B 3FOKA 3KS6A 2XYLA 2E6DA 2WSYA 2C1HA 2CPUA 4POCA 4AEEA 4A21A 2HBVA 4K1GA 3UXAA 1LDCA 4KT2A 3CS2A 1FWHC 4CCDA 3ZR5A 1ODZA 1TELA 3DH7A 4PUWA 3ATYA 3DFSA 5A8QA 1HKKA 2P1FA 2QDEA 3W7CA 2MNRA 1T40A 3O6CA 4W85A 3JS3A 1XIJA 3EMCA 1M7XA 2INZA 3VOGA 2WZTA 2YL8A 4F4RA 1RBLA 4GJJA 1L6FA 2YCIX 4OT7A 3UG5A 4AD1A 1W5NA 3PBUA 2E9BA 3ZR6A 1QCWA 3KOZA 4B2DA 3W2KA 3DBPA 3SJNA 3DECA 3GIYA 1LWHA 3PPHA 1VJZA 4YTQA 3QY8A 3ABRA 1SW3A 4Y9MA 2Y63A 4GUGA 1K8CA 4CEUC 3AYVA 2G3FA 2A85A 5A8OA 4BWLC 4MFDA 3CZGA 4CD4A 1KB3A 2X1TA 1TZZA 3UU0A 1GHRA 1WDRA 3N17A 4OGZA 4XAZA 2BXYA 3P84A 4YXGA 4S3FA 2CZFA 1ZBVA 1WP6A 3R8HA 3C3UA 4JICA 4ZB0A 3NZQA 3RF9A 2CITA 2WMHA 1YADA 3KTCA 1SO5A 2A3EA 4HNVA 3PG8A 4JTKA 4NQ1A 4HCHA 4YIWA 3APYA 3CL6A 5EB8A 2WC7A 2F2HA 1GJPA 4OECA 4C7FA 2R24A 1XL9A 3SW6A 3S2CA 1GJUA 1IWBA 2WM0A 4JHMA 1IF2A 2NWSA 2OZ3A 3D5HA 2VP8A 4IXXA 1LRTA 5JIWA 1A5KC 1FWEC 5CQ1A 1OC5A 4JFTA 1E70M 3ARPA 4UTWC 4MYXA 1TREA 3BV7A 3EKGA 4Q8UA 2YOCA 4AUBA 2UY4A 3WF1A 1XKJA 2FGLA 4JQ1A 1BF2A 3VUPA 2V5CA 2YB1A 2JQXA 2DT1A 2ATMA 3W84A 4FX6M 1I2QA 2XIQA 1GNXA 3DYMA 2A79A