1S2VA

Crystal structure of phosphoenolpyruvate mutase complexed with mg(ii)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
289
structure length
282
Chain Sequence
b'VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoenolpyruvate phosphomutase
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
total genus 107
structure length 282
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2vA00
3GR4A 2VWSA 4TV5A 4IMAA 1A49A 4G1NA 4DRSA 3P0XA 3ME3A 1PYMA 3HQNA 4FXFA 1IZCA 1OQFA 4IQEA 4B2DA 2XZ7A 3SRFA 1AQFA 2V5KA 4B5SA 3E0WA 1KC7A 3FA3A 3OYZA 3SRHA 3R4IA 1A3WA 1UJQA 3KHDA 1F8IA 1KBLA 4YJ5A 1F61A 1PKYA 4IQDA 3H6OA 2XZ9A 3EZ4A 3HQPA 4TV6A 4ROQA 4HYVA 3MA8A 1DIKA 4QGCA 3QQWA 3PUGA 1ZLPA 3SRKA 3QTGA 4KCWA 1M1BA 3FA4A 2R82A 4B5TA 1O5QA 2VGGA 1U5HA 1A5UA 3M0KA 1Z6KA 2KX9A 2BG5A 1S2TA 3GG8A 4QG8A 1DQUA 4MF4A 1E0TA 1PKMA 4KRZA 4L9YA 1F8MA 2QIWA 1F3WA 1PKNA 4QG6A 3QV7A 4HYWA 1VBGA 1F3XA 3E5BA 4RPPA 4B5XA 3KTXA 1A3XA 1VBHA 4FXJA 3QV9A 1S2UA 1O66A 2V5JA 4IP7A 2HJPA 4YNGA 4L80A 4JPGA 1S2WA 3OYXA 1DXEA 3I4EA 2L5HA 3BJFA 2G50A 4MG4A 4KCTA 5TAOA 1XG4A 3EOLA 3M0JA 4B2DD 3E0VA 1E0UA 2VWTA 1GGOA 3PP7A 2VGBA 3OQ8A 1PKLA 1T5AA 4KS0A 5JVLA 3BJTA 2HROA 1SGJA 3IS4A 3SRDA 3T07A 3EOOA 1JDEA 1S2VA 2ZE3A 1OY0A 4B5UA 1XG3A 2HRWA 1ZJHA 2WQDA 1O68A 2XDFA 3LYEA 3QV6A 4KCVA 3T0TA 1DXFA 3HQOA 1U5VA 2VGFA 2E28A 3GQYA 2DUAA 3U2ZA 1MUMA 2HWGA 4LSBA 3T05A 4B5WA 3VAVA 3N25A 2VGIA 1IGWA 3QV8A 3G2GA 2OLSA 4L7ZA 3QZ6A 2X0SA 1M3UA 3LG3A 4KCUA 4WJ8A 4QG9A 4B5VA 2DIKA 3B8IA 4L9ZA 3EOEA 3QLLA
chains in the Genus database with same CATH superfamily
3CZ8A 3MI6A 3LGGA 1OWQA 3A9BA 4F48A 1TELA 3WLPA 3DENA 4HNCA 5MKGA 3U9IA 4BQ3A 1KC7A 3DFTA 4ONVA 4HMDA 3GFXA 1K9FA 1G7UA 3AHYA 1JCTA 1TJRA 3F1QA 3UG4A 4QCEA 2R1LA 4TVUA 1H50A 3EGJA 3O9NA 1K77A 3CQKA 3PPGA 1ZAHA 3MCOA 3BW4A 3AISA 3M5ZA 3P8IA 1NFBA 4CNTA 1S5NA 4Q4MA 2R82A 3SI9A 2OO6A 4XZLX 3A3XA 1FOBA 4LU0A 4UQAA 4JQ3A 2BS9A 1FH9A 1E0TA 1CGXA 4MHBA 2QHAA 3HTWA 1PDYA 1VBRA 3BURA 3W2LA 4GNVA 2FDMA 4QJ4B 4DYJA 4Y9AA 3G0SA 3QZAA 4IISA 3LLDA 3QKZA 2DJXA 3WH6A 3VDCA 3KWSA 3CB8A 4RDZA 1Q66A 2ZCGA 3FHAA 2WCAA 1ONRA 4NSBA 1YEYA 5DFAA 4GYPA 3ABRA 2ZZ3A 1FH7A 5FL0A 5HMDA 5I3GA 3JVAA 3POCA 5FEZA 1UPPA 3H2EA 4PCFA 1S5TA 4DF2A 2VKZG 3WMBA 4DAIA 4K6AA 2BVTA 4DBDA 2UWFA 4FNQA 1UP0A 3FSTA 1MUMA 2F61A 4PMUA 4LSBA 3O3RA 3GH5A 1UZ4A 1ADDA 3UY8A 4K38A 2ZZ6A 2C79A 1PO9A 3D5HA 4L5ZA 1H1YA 4AZIA 4CUCA 1GVQA 4MUPA 3MMWA 4B90A 3VE9A 4WJXA 3TC3A 4ZB0A 4DYKA 3VK5A 1JUBA 1IXOA 2ZFAA 3E0WA 3CV7A 1A5OC 3MI3A 1G1YA 1UQZA 1BTCA 1L8NA 4X3ZA 1OFQA 1M01A 3SRKA 1QOXA 5AHFA 1O6IA 3DYPA 4IMGA 2BVWA 4HU4A 4D6EA 1NDZA 1VLIA 3OGSA 3HZ3A 4LBUA 3WNPA 3E0LA 3ARQA 4YL2A 4FALA 1SQ7A 1IEWA 1RSCA 1ZL1A 2JF7A 4FLRA 4EOUA 3B06A 3WLQA 4L56A 5KZDA 4CD5A 4CQ8A 3L67A 2Y4SA 2OEJA 1W1PA 1WOAA 4O8RA 3L21A 4L80A 2REQA 2W62A 5F4XA 1S2WA 3R10A 3DFPA 4HNNA 4LUSA 3CPRA 1X39A 3RPTA 3RCNA 1ONXA 1CCWB 3KL5A 4J1OA 2VGBA 4O8AA 4F4RA 1OGGA 1R6WA 2XIBA 3WH7A 2E9BA 5TBOA 5A6LA 3UXKA 3UW6A 4UWMA 3RAOA 3VNLA 1HKIA 3VDGA 1RBAA 5E09A 5A6BA 4K1WA 2PCEA 1LRQA 3GXFA 3VVGA 4W93A 3TONA 5FF2A 3TAOA 4A35A 4HIBA 1JIBA 1W1A1 3U5UA 4KMQA 5BXPA 3DFQA 5FJOA 3VXGA 5HANA 3ITGA 3KS5A 3DBPA 4P7LA 4HNVA 3OLDA 5F2MA 3DUGA 3GDRA 4G7FA 1K7EA 3ITCA 1SUXA 1AVAA 3KBNA 3BG3A 3DX5A 1XLGA 4EKJA 1OD0A 5C8BB 3TNOA 3B8SA 3KBJA 4FB7A 2Q8LA 1D7KA 4TMCA 2QXWA 1EEXA 2ISDA 1OYBA 3TTQA 4DJDC 1E0VA 1OZQA 4XG1A 1D3HA 1B3WA 4R88A 4MADA 4LVDA 1W3HA 2D22A 2VL4A 4XTIA 4YYCA 4XZBA 4Y6GA 3L7RA 2C0HA 3WELA 3FJLA 2FVKA 5B7YA 3R8HA 2GLKA 2P8BA 2WMHA 3TMLA 1NAL1 1U5JA 3WX7A 2PDJA 1XGZA 4MYXA 3VYLA 3LPOA 4RPQA 4KCTA 3LHUA 4WUIA 2PDHA 5C70A 3TYCA 2HROA 4ZZ9A 5I78A 4GG9A 3OOQA 3H55A 4DJEA 5DRIA 3GG7A 1V6WA 3AMLA 5FSDC 2FB3A 1L9WA 3RGTA 5FAJA 1TVPA 4PL2A 1CDGA 2PD5A 2W5FA 3AIWA 1I0BA 1CYGA 3SAZA 2FFCA 3EDFA 2CESA 1SR0A 3MB9A 2C1GA 4UTKA 1JDDA 2AKZA 1G6CA 3L4VA 3QMTA 1OFDA 3KBVA 3HO8A 5AY7A 4CQCA 3WN6A 1K8YA 2Z6JA 3C86A 1TUFA 2J75A 1A5NC 3ZS4A 1R7AA 3O2LA 4KFPA 3RR1A 3GHUA 3WMCA 3THAA 2R8WA 3VM7A 1OIMA 3IAPA 4HYRA 4KGJA 2OSYA 1KRCC 1TR1A 3A3WA 1UWUA 1T8XA 5LHEA 3I6EA 4UR8A 3QQ0A 3SY8A 2J7BA 1IV8A 1BGGA 1DWIM 3R0UA 2CZ5A 3OO2A 1R87A 3M0ZA 2OO0A 1ZRQA 3WDIA 3NQ6A 6TIMA 3WSUA 1VBHA 2ZADA 3LUTA 2WSRA 4MJMA 4AWEA 2NSOA 1O4UA 2VOMA 4LVAA 3W02A 3VIPA 3F5JA 2I56A 1HN1A 2DUZA 1TZZA 3RDKA 1YIXA 3IV8A 2R1NA 3TZFA 4J2PA 4JQ1A 2GL5A 2YOCA 4R7WA 5M03A 4JIHA 1GPWA 1AZ2A 4FNSA 4OQVA 2HWGA 3I10A 3Q2DA 3SM0A 1G69A 4PMZA 2ZE0A 1EJWC 3O05A 1DWFM 2VMFA 3PC0A 3SCSA 3ANYA 3GK0A 4RXGA 4N4PA 3EAUA 3O63A 3K4AA 3P2VA 1O1HA 2GDVA 1DJYA 3LXAA 3E5PA 4HSOA 5G2WA 1Z89A 3SRFA 1U1UA 1VZWA 3S6TA 4LUTA 3MV01 2FJKA 3LENA 3GVGA 4IIEA 4O10A 1M6JA 2R9RA 1TJ0A 2XG9A 1M65A 3B3DA 2QYGA 4PTDA 3NL5A 3S6OA 4JAWA 1DJXA 4IL2A 4J3XA 2PRHA 3PPFA 3OGRA 3EWDA 3CUIA 3BPWA 3UPMA 1WDPA 4S3JA 3NPVA 3M43A 3BAJA 2NV9A 1OX5A 1XLIA 1JAEA 3GW0A 4HHPA 3U4AA 1WYIA 2ZDSA 1TFVA 2EG8A 3BK0A 2L5HA 3BICA 4NP7A 1B31A 1RY8A 4C7GA 4IIHA 5CC6A 1XLMA 3ZJKA 3AFBA 2OT1A 3CUJA 1S5MA 2WCGA 2R1PA 3NL2A 4FIQA 1F5ZA 1R86A 4A8LA 4OBRA 2QR6A 4LVBA 3LMYA 2AQOA 2QUMA 2WQDA 4IJRA 1SJCA 1UD6A 5H8MA 4X9SA 4GQQA 4N2YA 4DBWA 3RUBL 3LCGA 5HWNA 1QOPA 3MANA 1XV8A 1D9EA 4O50A 4XZWA 5EB8A 1C91A 1V02A 1U30A 3CZLA 2VZOA 3PZQA 4JR5A 3AIQA 4JHOA 1J6PA 4I6KA 1JDAA 2BVYA 4HK7A 3VDAA 1CW2A 2QS8A 4PUJA 3KDNA 4D8ZA 1E3ZA 3WLKX 2OT0A 1EF3A 4JTFA 2CU0A 2FVLA 4GO9A 4JL2A 3LMZA 4H7CA 5AB3A 1JJKA 5A69A 3WF0A 1XC4A 2JIEA 1KM0A 2P3EA 2IKJA 5KSWA 2F6KA 4HA1A 1W5QA 1XCXA 3VINA 1CECA 3O15A 5PTDA 2POTA 5D9OA 4HD5A 3DYOA 4I7WA 4YTQA 2J66A 1REQA 5M5DA 3C2RA 2VQTA 4ZO7A 2Z1WA 4ADUA 1US3A 4V28A 3L2LA 4PUUA 2F6UA 4X61A 4ERGA 3KRUA 3KX6A 3ITLA 4CEXC 3GFZA 4HK5A 1E0WA 1R5YA 3AI0A 1PX3A 1UW9A 3ATZA 5LSMA 3E0FA 2WZTA 4D6CA 3R8RA 1IXPA 3UQNA 4KH2A 3V0SA 5CLTA 5HNNA 4WY0B 3VUPA 3W7HA 4PB5A 4ADSA 1OF6A 5BRBA 4TTUA 2AL1A 1FUYA 5T26A 8XIMA 1BFNA 4DZAA 3DU0A 3R43A 4WDXA 3HG5A 4I5RA 2A79A 3VIKA 3VGGA 4L64A 3BTNA 2DFAA 1MO0A 1EUAA 3TSDA 4FF5A 3H4XA 1ZY9A 5HXMA 3GVRA 2QAPA 4GUIA 2WAGA 2IPFA 4PC8A 4HGXA 3W6YA 3AUJA 4NAEB 3EDDA 3ZZ1A 3DKJA 1C90A 1GYNA 3U2EA 4LPCA 4JTTA 4LH8A 4I90A 4RJEA 2QJMA 3GYEA 4JQ4A 4QNEA 3R12A 3P6LA 1BYAA 4O18A 5HWMA 4U4MA 2WHLA 1YKWA 2CFFA 4S2BA 4RE2A 4WHBA 4KETA 4LS1A 4Y8EA 1UUQA 3EWZA 4BI6A 5BWAA 4DY1A 1XP3A 2GJXA 3ZWTA 3V0TA 4EPEC 4N4QA 2F6XA 3CT2A 3WH5A 2W66A 1XC6A 5CGTA 1Q4WA 4PBFA 5F2IA 1WZLA 4E8CA 1ZAIA 5CAKA 5D9PA 1S39A 3SQLA 1R2TA 1EC8A 3H22A 1EH9A 4PL1A 4DBSA 4O14A 3KP0A 1JI1A 3EA2A 3OVGA 4DIAA 3WQ6A 4YXGA 4M5PA 3UWEA 1XLKA 3GS6A 1M68A 4DXXA 2V5KA 3TH6A 1BVZA 3BSGA 8TIMA 3N9SA 7A3HA 1JD7A 1WO2A 4KT2A 3VNKA 3LPPA 1HT6A 3DI0A 5BROA 4F0MA 2EPMX 2JK2A 3BANA 2BTMA 4GINA 3L4YA 4EE9A 2UZ9A 1W2VA 2A6NA 4DF1A 2QCGA 4JN7A 1ODUA 2LLEA 4ZQMA 3W9ZA 1JQVA 1HVQA 2JF6A 4ZEPA 4O17A 4OVXA 3BXWA 1W3IA 3OBAA 2JEQA 1Q13A 1JQXA 4HNTA 2QDGA 4M7SA 2O9OA 3D47A 3D3FA 3O6CA 5GJPA 1JCJA 1E1EA 1T5AA 4WZHA 1KXVA 1JZ6A 3N2OA 3W24A 3T44A 4JDYA 3SW6A 2Y62A 1XG3A 3CQHA 3EX2A 3VNJA 1OINA 2X8RA 3PHAA 1RBLA 3Q37A 4UTTC 4BY3A 3KCOA 4O4VA 4QLJA 1Q5MA 4MFEA 1QAPA 3NO3A 3C61A 1G4SA 3OLGA 4JNMA 4GY7A 2Z1XA 3PSWA 3MQTA 3MZNA 1EJSC 4NILA 3MCMA 1DOSA 2R6OA 3UD6A 1TPWA 3H70A 5LA2A 1OABA 5KZEA 3UETA 1PSCA 1XJBA 5A95A 2QW5A 4GLEA 2H8ZA 2FYMA 2ZDRA 1H7OA 3DESA 4H00A 4TQTA 3VMOA 1O7AA 3UZZA 3CZKA 1YX1A 4GWEA 3W73A 3S9YA 3CWNA 2ISVA 5XIAA 4DI9A 4J2MA 1QWKA 4BF5A 4MNLA 4OIFA 2PWHA 1M04A 4E38A 4QHRA 3USZA 3N9RA 3FDGA 1DYSA 4A2RA 3BOXA 3WNLA 3NQ2A 3PFMA 1KCLA 3QYQA 1PWMA 3EPMA 1IR2A 1TPB1 1F3WA 1KQYA 1LUCB 2WM0A 4HSHA 3T55A 1AFSA 3CQ0A 1YDYA 3LQGA 4AX7A 1QVBA 3IIXA 1TREA 2WJFA 1A5BA 1A4MA 2C6QA 4XBJA 1AW5A 4E5TA 2ALDA 1NP2A 1YPFA 1AW2A 2Q8XA 5LIXX 4PODA 4LXFA 2QDDA 1QK0A 1RBOB 5G1YA 2X1SA 3T9PA 1B30A 5MKGB 3KEHA 4A2SA 4OECA 5A5WA 4FOUA 4QJ5B 4ICCX 4TX9A 4KWWA 2XGIA 1H0IA 1MQPA 3ZFHA 3ITVA 1Q8AA 3M44A 1DHPA 2GK1A 2DDXA 5D38A 2XIMA 4GKTA 2PD9A 3SURA 1F8IA 2PWVA 2X0HA 3THCA 1PKYA 2VEMA 4U5KA 3CM4A 2PI6A 3BUVA 2NT0A 2QJGA 5JBFA 1OK4A 5IDIA 1EJRC 3GG0A 1AD1A 4DXKA 3C2VA 2E6YA 4N0RA 6XIAA 4HZ6A 3ZMRA 4NNAA 4QM1A 4C1LA 1A5KC 3FXGA 4H7ZA 3NPXA 3SO7A 1OT1A 2OZTA 3H21A 3L66A 3LNPA 2Q09A 2DT3A 2GGJA 3LGEA 3WLJA 3TTYA 5E93A 4FIRA 4J3SA 1ADSA 4AC7C 4XVDA 4YCOA 3R2GA 5C2CA 2PRLA 4WCJA 1UKPA 2V5DA 4QR6A 2WJEA 1P43A 5DF0A 2ZUWA 3RCMA 2PC8A 3GBDA 4Q3MA 5CH9A 3TIMA 4RW5A 1TA3A 3FNDA 1GPFA 2YKKA 5CGMA 2XJ7A 3WQVA 4B5WA 3VI2A 5CKSA 1K03A 3VOJA 1XDMA 1UKOA 3V1HA 1YQ2A 3MWAA 4NHVA 1IZKA 3B8TA 4E6MA 2OR2A 2VR2A 2ZZ2A 3MHUA 5H2ZA 1POJA 2F84A 2W4XA 4GYFA 4ZB2A 3GW3A 2UBPC 1LOQA 4N02A 3GFYA 3PZVA 1E1CA 2FGBA 3RLGA 2I1OA 4MYAA 4CNUA 1L6WA 1QOQA 1NWRA 5BMXA 2ESCA 2TODA 4QDWA 1VJSA 4DNMA 5BXTA 1MRAA 4B5TA 1XYAA 4FX8A 3LS9A 5DQPA 4B3ZA 4AUBA 4AZGA 3E49A 1NFGA 4EK7A 4D8LA 2HSAA 3E3HA 2NUYA 1XICA 3W2NA 1DVJA 4CN4A 1CEOA 1ZS2A 2OQHA 6TAAA 2D2HA 5AVNA 1V0KA 1H3GA 2HNHA 1I2RA 3CAVA 1J0HA 3G18A 3LCIA 4PB4A 3ZM8A 1LT7A 1CGUA 1XSIA 1GTEA 3RJXA 4M56A 2ISSA 2ABAA 4J5NA 4QBXA 3WUGA 4F2TA 1XIGA 5FCZA 3HQOA 2QUNA 2XISA 3M0LA 3LM3A 3TP4A 2A7NA 1X1ZA 4H9UA 3T0BA 3CPUA 3WEMA 5IBXA 3GR7A 4GQ0A 3NZGA 4HOZA 4WLCA 3TYAA 2WZMA 3KHJA 4DPQA 4NG3A 2R1KA 2FVMA 2V30A 2IQ0A 3MVIA 4B16A 1W2PA 2ZZ4A 3MUZ1 3R25A 3DFNA 1C29A 4UFJA 3POHA 3S2MA 3QMRA 3ZOAA 5IM51 1CX9A 1QNVA 3UXIA 5CPTA 3RR4A 2A2IA 4U31A 3WBAA 3R1ZA 1F6YA 3TX9A 3W71A 2YL6A 3W76A 2VX5A 3GR8A 3QH2A 4HA4A 4ICMA 3CZEA 5M3WA 3R94A 2XSAA 3CMGA 2WZEA 4PTVA 3S1GA 4HZ7A 2XM2A 5FIPA 3GRIA 3EEZA 3REQB 1HKMA 1H7WA 5AHIA 2C13A 3RO8A 2ZZ7A 4MB5A 4UMCA 5DXXA 4YS1A 4N42A 3KCLA 5FI8A 2JE8A 1KFLA 1ZU8A 3ONBA 1BQCA 4IIBA 1JRBA 2EEXA 1FP9A 4AEFA 3OPSA 3C6CA 2G4FA 3STEA 2NLYA 3S1WA 4ZO8A 3N18A 4J3WA 1QI5A 1VR6A 1W9DM 3MUXA 1DORA 3G24A 3FX4A 3U6WA 4IT1A 3W70A 5LXXA 4AQLA 1YBQB 4OHQA 3MYOA 3KZPA 4GNJA 1ADOA 1HG3A 4CKQA 1E0XA 1ME7A 4RDVA 1RJQA 4ACZB 2VDHA 4H6QA 1AA1B 3CPGA 4DO6A 2H90A 3W1NA 2HV5A 1UD2A 3ABZA 1WDDA 4X0NA 3EWWA 2Y88A 2QIIA 1SZFA 1F4AA 5LNRA 1FWFC 1TSIA 4P8VA 1LBFA 1PDZA 3L5AA 1KD0A 2OOFA 4GI4A 3UZ5A 1Q65A 1TMLA 1TQJA 3STGA 3VKCA 1WZAA 3GVVA 2HZGA 1J9YA 3G8EA 4JX4A 1KGUA 1TJ1A 3S1VA 1TPC1 1V3LA 1QBBA 2Z4GA 4IJCA 2QDHA 3CIWA 1KV8A 1G4PA 4P61A 3N19B 2OZ3A 1YXYA 1IGSA 2J25A 4UQCA 3B9AA 2PWFA 3IANA 3RMJA 4CD4A 2BP1A 1GHSA 1UMYA 3LRLA 4PYSA 3E2VA 4EXBA 1BVNP 3MUIA 6REQB 3UZWA 3CLMA 4O1BA 4LT9A 3VKDA 3L0GA 1KM5A 3PK7A 4LCSA 3CBWA 3VFLA 2G41A 2FZ9A 3H4WA 4QTGA 2PZ0A 3L23A 1XDLA 1OC5A 3UF9A 4X0VA 4LUTB 3ZWSA 4OT7A 3U2CA 5L9FA 3EDEA 4L9ZA 2BOFX 1U33A 3LHZA 4JTRA 2C91A 3F4CA 4GRSA 5D05A 3WD4A 3HFYA 1LTDA 2PUZA 5IDZA 3LPGA 4ILSA 4KRUA 3GU1A 3OBKA 5JXQA 3PZIA 4R33A 1V6YA 3IGSA 2WMKA 1C8QA 4X2PA 1X96A 2X42A 5I02A 2OPJA 4DQWA 3L68A 5DBTA 3B05A 3DH7A 2Y70A 4JCLA 3I68A 2FZDA 2W61A 4C6EA 2QCCA 2OCZA 1PEZA 5HBFA 3KVKA 2CXEA 3GC4A 3L9CA 4R85A 4IX0A 4YWSA 2E9LA 4XO6A 3U4FA 4JTLA 4I9MA 1DPMA 3TW7A 2ABBA 3ZVHA 3Q67A 2VZTA 4F3HA 1UD5A 1Z44A 1Q2SA 2BBFA 3UG3A 3ELFA 2OMAA 4TOQA 5I3JA 2Y8UA 3M16A 3WD0A 4RNIA 2DW6A 2PTZA 4GX9A 4W8BA 3WJSA 4JYDA 3W7GA 2X1IA 4O1CA 3CTLA 4ATWA 5LIKX 1EQCA 3WL1A 1E51A 3M47A 2OLSA 2F8QA 1EWEA 1HL2A 4B5VA 3HM7A 1P48A 1G94A 2C1IA 4S3AA 2ZVIA 1LOLA 4IFKB 3SUWA 2X7VA 3W53A 3VOFA 4Q8TA 1I4NA 2X1TA 2CHNA 2FMOA 5D32A 1R3QA 1YTDA 1K7XA 2E3ZA 5E1QA 1DWAM 1R30A 1EDQA 2P10A 4NJKA 2BXVA 3LK6A 3WKZA 5K2ZA 1YMYA 1NDWA 1W9PA 3IUDA 2V2DA 2CKRA 1SJDA 1XYLA 3AYSA 1B4EA 2AOSA 4UTFA 1TV5A 5DMMA 4JYFA 4UOJA 2RH9A 2CYGA 4LOCA 1QCWA 1EGZA 2YDRA 4QRNA 3BGJA 3BCJA 2J77A 3CIVA 3APYA 3NEVA 3JZUA 2O7QA 3THQA 1H5YA 2WANA 4BZYA 5A6JA 7CGTA 4XWUA 4JCMA 4DNHA 5CSYA 3GXMA 3LCHA 1EJVC 2CIPA 2GYIA 3E96A 3WQ5A 8RUCA 4ICNA 3NSMA 2Y85A 3GVQA 4X60A 3CT7A 4E3TA 4YTTA 2CZVA 4RZ5A 3CQIA 2OZ0A 2YL9A 1KWGA 1LL6A 3N25A 2VX4A 1DIOA 3DOPA 4J3ZA 2WWCA 3GKAA 4MWAD 3B8DA 1ZBWA 1IWBA 3UGRA 4Q7BA 6ENLA 1E40A 1J96A 4H83A 3LEPA 4D6HA 3A5VA 3LTYA 1U2YA 1X38A 2QVNA 2PDPA 2Z1SA 2WMIB 3EWXA 1BF2A 1Y7VA 4GVHA 1Q7ZA 4PZVA 3R79A 3LERA 1PIFA 3DGRA 1Q4NX 2YBUA 3G22A 4PRWA 2ZXDA 4XZNX 5A6TC 4MB4A 3AIBA 3EDJA 2F38A 3GO2A 2XYLA 5DMLA 2D2GA 3DG7A 3TQ0A 3EMCA 3H7RA 4GXMA 4WXYA 2VT0A 2TRSA 3AAMA 2GJXB 4ZVJA 4A8NA 2X16A 3L2IA 3G8RA 3CK5A 4H6RA 1OEPA 2ZA1A 4QSFA 3WUFA 3Q94A 4UFIA 1OX4A 4NZJA 1JFHA 2ZZ1A 5JMUA 3VPLA 2WYSA 1GVIA 1V3MA 2DVXA 3W2JA 3ORWA 1J11A 1VFSA 4Q8WA 4F0HA 5M2FX 1VEMA 3SGUA 1YNYA 3RK8A 2GUUA 4PRRA 5C9UA 3B4YA 4F66A 3CHCA 4OZOA 3DKLA 2V63A 4IG2A 3LHVA 1A5AA 4WDTA 2ON3A 3F5LA 1E9LA 3MJYA 1VJZA 3T81A 1W5OA 1WV2A 1ZJBA 2DIKA 5EPDA 4JTAA 3LD5A 3SN0A 1RY0A 1OFRA 3P0XA 4G7EA 4TX8A 1V7YA 3WDRA 1C93A 4B5SA 4WDWA 4H9YA 4BI7A 1YPXA 1LG1A 1LRNA 3WMLA 4PCTA 1ZPTA 5AVHA 1LOSA 1SFLA 4I5UA 5AECA 1E5NA 3MP4A 3O6AA 4KWOA 3W88A 5AHLA 3OJGA 5AHMA 1GWJA 1TO3A 1G0CA 2HVNA 4POCA 1PKMA 4JKKA 5JBEA 1PX8A 3N9KA 1JDCA 2VEFA 4D71A 2ALRA 4LVGA 3WK1A 1KXHA 4LC8A 3E5BA 4RE4A 2DPEA 1UR1A 4H8UA 2Y5JA 4AWTA 2Y63A 4Z1CA 3EX3A 3RIKA 3QHOA 1ISYA 1UD4A 1XBVA 4YHGA 3QTPA 1NH6A 3VNIA 3PZ9A 1Q2RA 3FA5A 1H7RA 1HGWA 5FESA 3IS4A 3QM3A 2Z2AA 3ID7A 2XFRA 4M6UA 4HPJA 4RCXA 4AXKA 4ZCWA 3EKLA 1SSGA 1DQWA 1I75A 3BMWA 1J8VA 4O52A 1YW1A 1BG9A 4PBGA 3RILA 3HU7A 1Q3NA 3AJ7A 4JXCA 2I14A 4D9PA 3QZ6A 4OWGA 3T09A 3UR5A 4TO8A 3V16A 4DJFD 1VQTA 1XQKA 3E02A 1CNVA 3TMQA 4G6CA 3W26A 1PJ9A 5A2CA 4BQ5A 3IIPA 3IAQA 2HTMA 3IVSA 4H9TA 4F2BA 1WUEA 2XN2A 4UCGA 3BC9A 4XIAA 1E71M 4AY1A 5DX7A 1JUKA 4J3VA 3TU9A 1HJVA 2I5GA 1RJRA 4YU1A 3AHVA 3O06A 3AXHA 2P53A 5HATA 4H41A 2Y7GA 1WPCA 4DWSC 3HF3A 5HK4A 4GISA 3AUOA 4V27A 3P0WA 3T40A 2QIWA 3UG5A 2ASHA 4JTJA 3M0VA 2PAJA 2VTFA 6A3HA 3EMZA 5DO8A 1BF6A 2PWEA 4IIGA 1F07A 5LNUA 3TDFA 3VCRA 4JTIA 3PANA 4ES4A 2QV4A 1YADA 2NWRA 3H2CA 3ABXA 2PGRA 4GC4A 3B8WA 1BGAA 2VCCA 3DBNA 3OQ8A 3MMDA 4W88A 1M7JA 4Q8PA 2ACRA 1UYQA 3GUGA 4WIWA 2XGZA 3BGGA 4Q32A 5HR6A 1JD9A 1JXJA 1IT7A 4A05A 3BMXA 3PTMA 1EOKA 3CLWA 1YTEA 3S42A 3SR7A 2EG6A 2GVYA 1L8PA 1NTHA 1PX4A 2E1DA 3VD4A 3QLLA 3DC8A 4REQA 4XIMA 2WSYA 1HJUA 1B3YA 1CXIA 1XGEA 4KIRA 3LI0A 1LG2A 3SGZA 3T8QA 3NXFA 1OFBA 4KW2A 3IRSA 2YYUA 1OYCA 3GTHA 3VKJA 4WSJA 2J8TA 4OTKA 4QS5A 4AX6A 2OXNA 3TQKA 3O0FA 4A3RA 4JD4A 1TZ7A 4EPKA 1KM1A 5I07A 2BGQA 1K3UA 5EA9A 4EP8C 1AL7A 3UY7A 4ML4A 4IP5A 1S38A 2G96A 1B2YA 4CQBA 2D24A 3TOYA 1G4EA 4IXHA 1VYSX 3V75A 2WVSA 2VUNA 3P3BA 5TD4A 3NEHA 1XIHA 1OJXA 3P81A 1UOKA 1MW0A 3GUWA 4GOAA 3KVLA 3WUBA 2VR4A 5DXYA 5CAHA 1J0KA 1TPVA 3QSRA 2DY3A 2AMXA 3P67A 4B91A 4H9ZA 2OYMA 4PUNA 1Q6FA 3UWVA 2GQ9A 4B5UA 4ORMA 5BCAA 5LA1A 1YXCA 4ZMGA 3VZYA 1XH2A 4LYRA 4NXKA 4RUBA 4QITA 7REQB 1Q63A 2Y2WA 5D09A 1NY1A 2NV1A 1Y5VA 3B0XA 4W5ZA 1ICQA 1PIIA 3VA8A 3I7RA 4D6GA 3G1AA 1VCGA 3VGDA 5FEPA 3HQNA 3VE7A 3HB9A 3WD2A 3KRSA 4NJIA 4IIDA 3SDOA 3PBUA 3DC0A 1ELSA 5E6ZA 3T08A 4S3EA 5C9XA 5I2UA 3GSMA 3G1HA 4OUIA 3QQWA 3QGAC 2SFPA 2Q01A 1UWRA 1RP8A 1OZMA 4IHCA 3VGEA 2NW0A 1KQZA 3BQ5A 4DUXA 3RU8X 1QW7A 2QCNA 5GNYA 3OTRA 3NQCA 1VF8A 2D1ZA 1UKTA 4LFYA 1BKSA 4Z2IA 3BWWA 3LXBA 4HPHA 3QSTA 2Y7EA 2RKXA 2D0FA 4RLIA 3ECQA 1PBGA 4O0KA 4KWSA 2OEMA 2HK0A 1P6CA 2VI0A 1MW1A 5GNZA 2YDAA 8A3HA 5AFDA 1NOUA 4BI5A 4RXFA 3UCDA 2I9EA 1MW2A 2Z00A 3MI2A 5KZMA 2OWCA 1XINA 4LCRA 1WKEA 1XHGA 1RQHA 3T2OA 4O1AA 4GZIA 1JPMA 1JPDX 2PF8A 1EA9C 1YDNA 3JZEA 3KOFA 4GI6A 1FH8A 1HJXA 2E6FA 3IARA 3P82A 2WCSA 3N13A 1PL9A 4I7VA 4DWSB 3B9NA 3NZPA 3VIFA 3BARA 3PY2A 1XLJA 4LYQA 3GXPA 1GOKA 4EANA 4JL1A 4K8EA 1LP6A 1KM4A 1OFEA 2BY2A 3QQ1A 3WG6A 3F03K 4TV6A 2Z2UA 4PMQA 2QVHA 1EIBA 1OFOA 2ZRWA 3K2GA 1UPMB 3FA4A 3H54A 1WOBA 2EQDA 4ZFMA 3HA1A 2WM1A 3P84A 1BEUA 4Z08A 4BJHA 1FQ0A 2A4AA 2V68A 4Q7IA 1JZ4A 2YBTA 4L6HA 4GFIA 2GOKA 3TSMA 3JU2A 4HPNA 4O0ZA 3BAYA 5DMNA 2UY4A 3UPWA 1NJJA 3CZJA 4DPPA 1XBZA 1JZ8A 2CWNA 5FACA 4AY7A 2J9XA 2PWGA 2FPVA 3LCFA 4HBKA 2GWGA 4MZYA 4XKYA 3J7HA 4PMRA 1KLYA 4ASTA 4S3CA 1XIMA 1EX1A 4R53A 1J5SA 4RZ4A 3W87A 2V5CA 1XH1A 4H7VA 3ARZA 1CTNA 2XH0A 1TX2A 3OZPA 2J7DA 4HT3A 3GH7A 5REQB 1YRRA 1VYRA 1A49A 2XUCA 1RXOB 1FWNA 2PDBA 5A2BA 1E9IA 1M5WA 2AQWA 3TUUA 3BSMA 2XIIA 1TPUA 3MSDA 4MKSA 4FNUA 1DV7A 5EFFA 1IQ8A 1AMKA 3BSHA 1GQJA 1HJSA 4F0KA 4QGCA 4N9EA 2QUUA 1QHZA 2NQLA 4B3LA 3B03A 4GGHA 3B4UA 3C8FA 4QISA 4NRRA 1ICPA 3VKKA 2AGKA 4AH7A 4QQ3A 1M7OA 3OIHA 3MDUA 3DXIA 3WK2A 2QJNA 3BG9A 1FFQA 1PYFA 4IP7A 3KOYA 4LAMA 4M7TA 3FK4A 2X1RA 4KEZA 2XVPA 5CZKA 2Z1BA 3N4FA 2F9RA 3CIXA 4UR9A 4R9OA 3MKKA 1UMLA 2IS7A 4AMCA 4JFUA 3Q4DA 1XLAA 1S3TC 4YTUA 4JTUA 2DSKA 1W5MA 1QO2A 3KVJA 1H11A 2Z7GA 2O92A 4Z0SA 4Q6JA 3PTKA 5ABFB 3H24A 3D3AA 4KGLA 4RDYA 3UNDA 2E7FA 2D69A 2XIQA 1KR1A 3PZOA 1PS9A 3IK2A 1YLVA 1UJPA 1XLCA 3ZQ9A 2QT3A 3E2RA 4UTWC 1MNSA 4A3YA 1LLWA 1FA2A 2OKTA 3SRHA 3TWBA 2ONEA 2WO5A 2ZX6A 1GOMA 1J12A 4HCLA 4TU1A 1DXIA 5HPCA 4AD1A 1B5TA 4HVXA 3H6OA 5IHSA 4MDOA 3GY1A 3CYVA 5LIYX 2WJZA 3UJEA 1GORA 1CT5A 4GI9A 3K4DA 5K4XA 4XD6A 2Y89A 4JKMA 5I09A 1EP3A 2O9RA 4TIMA 2QCDA 4RE3A 4IPNB 4IM4A 2OELA 3W2UA 4UFMA 3XIMA 4AD4A 3OZOA 4E2VA 3QGVA 1XD0A 1W37A 3MO4A 3CS2A 3OBEA 1V02E 4XAZA 1LWIA 4C65A 1QBAA 4I3GA 1VIZA 1LZOA 1JPHA 3GIQA 4HN8A 5C6MA 1A4LA 4H9XA 1Q6DA 1LQ2A 4GBDA 3SY5A 1RH9A 4GACA 2NXGA 2XU2A 1I9CB 1WDRA 2DZAA 3OEXA 5HDRA 1PB0A 4NX5A 1O1ZA 3V35A 4JTSA 1V08A 3H23A 1QATA 4S38A 3W7IA 1EUNA 1IT8A 1XLEA 1RA0A 3TJLA 3QPEA 4BWLC 4FMVA 4QS6A 4GGBA 1CGTA 1E9YB 3W00A 3N73A 1CPUA 3WLTA 3IJ7A 1IXNA 5EFDA 3TYUA 1AH3A 4G8TA 3UZXA 3LSCA 4UBPC 4NUWA 4ZQNA 3IJDA 5A8QA 4FEZA 1P0DA 3PJUA 5FJTA 2YGYA 1UJQA 2TMDA 4D1JA 3CWHA 2B0MA 5I03A 1XSJA 3M64A 5ECVA 1HJQA 3JRKA 5HUPA 3N11A 3L4UA 3KVMA 3QFEA 1TTQA 3NGJA 3QJAA 1VFTA 4GQGA 1EBHA 4NAFA 1B0IA 3MP3A 4LUIA 4NI3A 4LJ3A 3ARTA 4PTXA 1QPKA 2X2GA 1DQUA 1EHAA 1AMYA 3LU2A 2Z27A 4L4MA 4OFCA 5CZ0A 3SN1A 1E6QM 1OGBA 1G01A 1QW8A 3RITA 3E9AA 2YCLB 1ZFJA 3H7VA 4DLMA 4EIVA 3G1XA 4HJFA 3SUTA 2HE8A 5IFTA 1HKKA 1AW1A 4G2DA 1RVKA 2YSWA 4FSAA 1XR2A 1BWLA 1VD6A 5MF5A 1MEIA 4V1YA 2PP0A 5CC3A 1X1OA 1I2QA 3AMKA 3II1A 2OQYA 4B4HA 1GKRA 3LLXA 1ZQ5A 5CJNA 1XS2A 3P74A 3GXDA 2HEJA 4QAWA 1PZ2A 2PC4A 2CZFA 4UOQA 3A3HA 4GIAA 3XISA 3QW4B 3GHSA 3AU6A 1U1JA 4AAJA 1OC7A 1IT0A 1Z8AA 4AD0A 5DCEA 1P0BA 2V8ZA 3AOFA 4MWAA 1E5JA 1TYGA 1UH3A 1XIEA 1XD1A 4IGHA 4WRHA 2W67A 1KTBA 3MUCA 1A3HA 1XLDA 2HXTA 2OJPA 4IMFA 5C5YA 1AL8A 3GDLA 3ARRA 4FI4A 3NTYA 2TPSA 4RNFA 4DO7A 5AC8A 2O4QA 4K37A 2PE4A 3O6YX 3U3HA 3CTTA 2ZXAA 1GONA 3B0UX 1A0EA 9CGTA 4QG8A 4FLQA 1BQGA 1F8MA 2E68A 5D2WA 1NELA 2A3HA 3IVUA 3UXLA 2XVKA 1WAWA 3VM5A 3S2CA 1ISXA 1OCQA 4LC6A 3MC5A 1N55A 1PZ0A 1Z69A 2A21A 4UMBA 1XYFA 1J5TA 3PBVA 3R8GA 2GQAA 4PMOA 4LEFA 4QNWA 3W86A 1YDOA 2GFTA 3WLSA 1EC9A 1ZJAA 1FKXA 4LY8A 4PUDA 5AHNA 4IMCA 3F2CA 1US0A 4O12A 2WNNA 2VVNA 2PEVA 2RFGA 2FJUB 3W1MA 4C5YA 2HDJA 1RPKA 2OKOA 1L6SA 3UESA 1P6WA 3ZJ6A 1NDYA 3ERPA 1GOOA 4ZB5A 3G2GA 3T0CA 1UR8A 2CHRA 4GX8A 4MJ4A 2E77A 4NJJA 3QYSA 1BAGA 1QTWA 2J9YA 5FEWA 3ZIZA 5ABEA 1GZ1A 1UKQA 1JYXA 2E6DA 4NJHA 4DO5A 4AYGA 4MNMA 1HXJA 2XZ7A 1EPVA 4V33A 3A5FA 2PP3A 3APTA 1US2A 2QLYA 2XH7A 1RJPA 2ZYFA 4ZOBA 3CV6A 2Z28A 3W7RA 4A3HA 2Y8VA 2WMJA 4JNYA 1RLCL 4DF0A 2HPMA 2VFHA 1O5KA 1AUSL 1BSIA 3KW3A 4R3UA 4ZOCA 1AK5A 3BLOA 3QW3A 4KRZA 3PZMA 3C2OA 2ZX8A 4J4KA 1QNOA 3W83A 4LBRA 3W07A 4H9MA 1V51A 3OZYA 2VQUA 5BYWA 3SCVA 4QIUA 4JBRA 2PSNA 4Q4SA 1V0LA 3TYEA 2C19A 2I16A 2QJHA 4CNNA 3EOOA 1UG6A 2DSWA 5AOUA 3ZVIA 1KTNA 4BHYA 4AY8A 2ACQA 3ZXWA 1E1FA 2CHOA 4JFTA 2YL5A 1ENUA 2E40A 4ZXLA 1BPLB 3HG4A 3NQVA 5FF7A 3B0PA 4F79A 2QCLA 3TW9A 2EPOA 4GFSA 2WC4A 3S4TA 3B8IA 2CNCA 3FJ6A 4EF8A 1WKDA 3F2BA 4FP1A 2V5BA 2VZUA 4WF7A 1JZ7A 4PEKA 3VUSA 2PDLA 1LQAA 3M4HA 3GWQA 3JS3A 3KM8A 1GJPA 3EZ4A 3NDOA 4W9TA 2QULA 1XLLA 2ADAA 5CBBA 3GBEA 2Z26A 5I3HA 1B4KA 2BLEA 4DX3A 3B04A 2XH4A 1VBUA 5L6UA 2VGGA 3NDZA 3WLNA 3T0DA 3FAXA 4AXNA 1KO0A 3T4WA 1GZGA 2DH2A 3PM6A 4Q8QA 2CLIA 3A64A 2E8YA 2BASA 2GSJA 4A3QA 2OVLA 3RF9A 4GH3A 4O1FA 2HJPA 1GYLA 1QR7A 4AHQA 2EAWA 5A8NA 1QFEA 1W1IE 3XINA 2QF7A 3N4AA 3GZ3A 2PU1A 2FHFA 4GQRA 3P14A 3GD6A 5HPOA 4J9JA 3SRDA 3FDKA 1GVEA 2C7FA 3OG2A 2WNWA 3PB2A 5KMYA 4DN1A 4AZ5A 5LNWA 3I3DA 4RW3A 1XH0A 1ZGDA 3ARWA 5A2AA 3NA8A 5LXEA 3C52A 3SIMA 3UR8A 3IUIA 3E2QA 3WFAA 4RL3A 4ZSTA 3LRMA 3K30A 1BXCA 4MMWA 4O4WA 3NQAA 4C60A 1H1NA 4W84A 4D2JA 4ZTXA 4R7JA 3R4IA 2BVDA 4FLOA 1K6WA 2Z0IA 1CZ1A 2QCHA 5CCZA 1FCQA 4AIUA 4GABA 3H2AA 3S5ZA 3W27A 4ZQOA 4RZ6A 4LB4A 3S0CA 3GC5A 3W7CA 3W84A 4FHAA 1J0JA 2AL2A 1GVOA 3SCNA 3VABA 3DN5A 3EOUA 4UFKA 1Q7QA 4LUYA 2ZX5A 1O66A 4JFWA 1HKWA 2CBUA 2WVVB 2HCVA 2PDMA 4HNUA 4UXDA 1UROA 3HV9A 2W79A 1RCXB 4HHLA 3NOYA 4HU0A 4FXRA 2ZE3A 5K7JA 2F7FA 4FX7A 2BSLA 2WSKA 5JH1A 1EXBA 5HR7A 4Y7EA 3AWNA 4CNOA 2G97A 3H4GA 1L0PA 3HIJA 4K8HA 4LVFA 3T6CA 4LUJA 3OG3A 1A0CA 3G5EA 1P7TA 4H01A 2OEKA 5D04C 5LHFA 1NU5A 3OU8A 3G77A 1E6NA 1ODZA 1SZRA 4CEUC 1ZSXA 1H09A 3TLLA 1X8FA 2NVDA 3WDHA 1B90A 1W3KA 3Q65A 3KBMA 2A3LA 5FJRA 1LLZA 3VILA 5C9WA 2Y5EA 5GVJA 1J2WA 3AO0A 5EMLA 3M46A 4IH3A 2WBKA 2EGZA 2QCFA 2AKMA 1OK6A 3AHTA 3V1PA 1SFJA 3VIGA 4DUVA 3CHFA 5BMWA 3FJ4A 3MKVA 1TJPA 3JR2A 1KA9F 1W56A 4CN1A 1GKPA 3NVTA 3EWUA 4CLMA 4YN5A 1FHLA 3M0MA 4C6MA 5ABGA 1LL4A 4OU1A 1RVGA 1L6GA 4WXZA 2KAUC 1POKA 3NZRA 2RDUA 1TV2A 3VOIA 3KFTA 1TPFA 3ENLA 3H12A 4WR3A 1C8VA 2G50A 4DUWA 4NYYA 3BDKA 4UNIA 2PLCA 1RUSA 1L6FA 2HBVA 2OLHA 3GDTA 2WWDA 3AALA 4GYKA 3BLKA 2V67A 1HF6A 4ECLA 2YDSA 2E09A 5FSEC 2DQWA 1BRLB 1GNXA 2VEPA 4N6EA 3GNNA 1RPXA 2ZUSA 4GJJA 4UQEA 3AZRA 4AEEA 5CBJA 2BWGA 5FF4A 1G5AA 1VCVA 2GDUA 4OBSA 3FS2A 4PUMA 3PVFA 5D9NA 3VIIA 5EU9A 3NZQA 4LF2A 1HNYA 4GMEA 4KERA 1HX0A 4UQ9A 1M53A 4BK9A 3WJXA 2VX6A 4L4PA 4RKAA 3KOWA 1UB3A 9RUBA 4QEEA 2WNQA 4YTRA 2VCAA 4LRSA 1KM2A 2HS6A 3NCOA 1TPH1 3CMJA 3RXZA 3PPHA 3DHDA 3N1AA 3QBUA 2PBOA 4HA0A 7ODCA 4GY1A 1O94A 1J4EA 4RV3A 4UTLA 3FV9A 2PB1A 3RFAA 1SO4A 3AJXA 3S9IA 3AZSA 4LAKA 4PCPA 4KEMA 1JEZA 4M29A 4M80A 3DIPA 3N3MA 3WQPA 1ECEA 2V5JA 4I8DA 5FJJA 4XAYA 3FKKA 3K5XA 2ZX9A 1PKLA 1KFJA 3T78A 3AIUA 5G1TA 5T8GA 3MP5A 3E74A 3MBFA 4RV8A 2ZUUA 5ABTA 3DDMA 4QXIA 1FTXA 2YCKX 3KWXA 2XN0A 1EQPA 1GVRA 5TNVA 1TJ2A 1P0EA 5F1VA 3BLFA 1PTGA 1XCFA 2CC0A 2HK1A 4YIWA 2GJLA 4GCXA 2PGFA 5BU9A 2ZC1A 1XXXA 4O1EA 3GR4A 4TV5A 3ZT6A 2NLIA 3C2FA 2Z29A 4CNPA 3GH4A 1KBJA 3RPDA 4DHGA 3UZYA 5A6SA 1FHVA 3N17A 4DO4A 1BYDA 3HQPA 2H9AB 1KRAC 3TZNA 4H6EA 1TWWA 1T0OA 5U7SA 3W1AA 3GLCA 4JFVA 3EWBX 4C6PA 2D0GA 3BH4A 4XSMA 3WH8A 1JNEA 1S2UA 5BXRA 1XSKA 1D8WA 5HAOA 2VD8A 2XIOA 1V8EA 1E72M 3TR2A 1FWDC 1FVPA 1E73M 2PDXA 3T07A 2YA2A 3W22A 4LY4A 3RPMA 2C18A 3STCA 3EB3A 1NARA 4F40A 4EPBC 3WY1A 5HMSA 2J7GA 1EP2A 4E2BA 2HBXA 3FEMA 2PU0A 4UFHA 3OIXA 1JXKA 5LNSA 2DUXA 3ISIX 3SUUA 3IJ8A 2V3EA 3C3NA 2VD9A 2Z6IA 2DW7A 1I45A 1NQ6A 3H2NA 4MLJA 1VB9A 3EDKA 4KESA 1WNOA 1I1XA 4LS0A 3NQMA 5AZ0A 4PA8A 1UOZA 4O11A 3O8AA 3PF3A 1UA7A 2HE5A 3LXCA 3ZSTA 4L4LA 1S1PA 3VC6A 1FWJC 1HIZA 1ZP4A 4AVOA 4WSHA 4GK8A 1HW6A 1J79A 4WGHA 1TPDA 2UY3A 1K4HA 3SADA 4ZGYA 3AMCA 3MA8A 1L2UA 5I06A 4UZUA 2UV8G 3BCDA 4MAZA 2G3IA 3FGCB 3S1UA 1AH0A 1RD6A 3OP2A 1OX6A 4IPPA 3UWQA 4PR4A 1QO5A 2EF9A 3EKGA 1GT8A 4WEVX 1A5SA 1F3XA 4H2HA 1XUZA 1CLKA 3CGTA 3IGXA 2GUYA 1HTIA 1RR2A 1DXEA 1PXGA 2J8GA 3ABQA 3W81A 1H7PA 4GYJA 3UBPC 1KXTA 1N82A 4IPJA 3THDA 2J88A 4MY1A 1NVMA 3ANUA 2FTPA 3MW7A 3KDOA 1S2VA 1UD3A 4MM1A 3QV6A 3NQBA 1P0KA 3CL8A 1FFRA 3W1XA 4W87A 1W9XA 1K1DA 4C6JA 3MPGA 3VAVA 3ZR5A 3W6LA 1DTNA 4WD0A 3LI1A 1Z42A 4E2DA 2WMFA 2ZQ0A 2I5IA 4HMNA 4FXFA 3MTWA 1X97A 5I23A 2ZUNA 5LGZA 4J35A 3EB2A 2PS2A 5AN7A 1ESWA 3LHYA 3WYZA 5FJUA 3VU2A 2OODA 4DJFC 2BOEX 1EOMA 2PLKA 3SCOA 4HZ8A 1GTHA 1HVXA 2XVLA 1PAMA 4W85A 1ZP3A 1WBHA 2OGYA 4JTCA 4NNCA 3EA3A 5K9DA 1XBYA 4R5EA 1CB7B 2PDQA 3N04A 2X05A 3SUSA 2FZ8A 2J7FA 1W31A 3TA6A 3BVJA 4DM1A 1TWDA 3WBWA 1FWAC 4S39A 4QLLA 4P7RA 9XIMA 4FOJA 2NV2A 3U8GA 3NYZA 3HFTA 2W91A 2AAAA 2AGTA 3INPA 3WZ0E 3CYJA 1XG4A 3EOLA 5G4EA 1UZDA 1W9VA 3W1UA 5EYWA 2BV9A 2RAGA 5I3KA 1N8WA 1S5VA 4Z42C 5BU6A 4Y9PA 1E6PA 4HJWA 1R47A 3EMQA 4WJEA 2J74A 1J0IA 4ATDA 4UFLA 2Y7FA 3WDQA 3AXXA 3NDYA 3V5OA 4NQ1A 1BWVA 3N6HA 1UD8A 1QI0A 1MYRA 4V1XA 3LDVA 1V77A 3STPA 1ITCA 3EXRA 5C9ZA 1R8LA 1I1WA 3TC6A 1PHWA 1QNQA 3LV6A 3NGFA 1W0MA 4O13A 4JIIX 3W7DA 3AMDA 2J9ZA 3RYSA 4BCEA 3QHMA 3W7QA 2J13A 1W1TA 1DL3A 4B15A 4QE1A 1RQEA 1FCUA 3NO5A 1XLFA 2V0TA 3CUZA 4GBUA 4IGSA 5IFPA 2INFA 4LYKA 2PTXA 3CB3A 2I17A 5IOBA 3GG8A 4UNLA 5CPSA 3EX1A 5C7VA 5FF0A 4GYPC 3MZ2A 1FWIC 1BXNA 4NI8A 4UTIA 3BJSA 3CV1A 3S5OA 4Y2WA 2RJGA 1SYTA 3QV9A 1C9WA 1K02A 1R3VA 2VEIA 4DJDA 3MVTA 1YDVA 3AS2A 3PNUA 2YDQA 4L6OA 3MO7A 4KBXA 4TVDA 1GKQA 1OCJA 1CWYA 4LTSA 3G3DA 1O12A 1BVWA 1V6TA 4S1FA 1O68A 5BW6A 4PEEA 3NQEA 1TR9A 1EA0A 1JYNA 4RR4A 4DZ5A 3QPZA 2I5QA 2ACSA 2QMKA 5H91A 4NNBA 3AICA 4Q6XA 4PTNA 1V3JA 1TV3A 3P80A 5AYIA 3MU7A 3I65A 3TN3A 2BHYA 3UERA 3VIHA 3C4UA 3BL3A 3SN4A 2DGAA 2X7WA 4FNTA 3NOEA 3GAYA 2VO5A 3AZTA 4XV0A 3AQUA 4NASA 1KNWA 4GIYA 1XLBA 2QQ6A 4X63A 2YZRA 1UR4A 4E2OA 1V03A 1S2CA 1K8XA 3A13A 2G3FA 3VNZA 4QJ3B 3MYPA 1FWGC 3SBFA 4QDPA 3GB6A 1FDJA 3TKFA 2TAAA 1RCQA 4WY0A 1BSLA 3FYPA 2DH3A 1JFXA 3EXSA 3K8MA 1W5NA 4PUWA 4J40A 2ZXBA 4C1NB 4S3FA 1W1ZA 2ZA3A 2IQTA 4FXJA 1A3XA 3CAKA 2CBVA 3LOTA 1IEQA 4HHHA 1QU4A 1HJWA 2XVNA 1R46A 4AD3A 5I3FA 3G1VA 1MZHA 4AC1X 3TCSA 3DHUA 2DP3A 2JGYA 3WF4A 4KFOA 3LYEA 4MUZA 5A8PA 1WKYA 1JYVA 3SY1A 3S5YA 3PSVA 3W2KA 5G4WA 1K70A 2HPIA 4EVZA 5CC7A 1UKSA 4KFNA 3FIGA 1VPYA 4PTMA 3PZGA 3AU2A 2FZNA 4GY0A 4C6CA 4Q7NA 1ZCCA 3DGBA 5LYRA 1JRCA 3CXOA 3R13A 3FA3A 2WV8A 1AD4A 5F1UA 2OSXA 2FPYA 3HPZA 4ALDA 4MZ1A 4EPDC 3RMEA 4B4FA 1MW3A 4ROQA 4MB1A 2CBJA 1H51A 4AZCB 3DCPA 1WP6A 2Z1VA 1KBKA 2DIEA 2A1YA 3LHWA 3DZ1A 2YBVA 3AS1A 3TQPA 4BKNA 3W7KA 5ABHA 1B3OA 5GPRA 3UFYA 2ZX7A 2J78A 1DJQA 5D2XA 4DJEC 3KE0A 1HGYA 2NVAA 2FGLA 1X8CA 5H6HA 1AQHA 4PFMA 3ABSA 3S1XA 3M0JA 2WC3A 2IKIA 1CBGA 3PJXA 4IPLA 1W9UA 3ALFA 4QLKA 5CSUA 2HNEA 4JIQA 1UC5A 3BAWA 1EF2A 1BLIA 3U2ZA 2DQXA 5A6KA 2BY3A 3OVQA 1GW9A 3O6DA 5GJNA 3RX2A 4HK6A 4GD0A 3SECA 3MJMA 3U5YA 4J28A 1EGVA 3W38A 4FPSA 2P88A 4R7OA 4HKPA 4P7QA 3O1NA 2ZICA 1EYEA 1H1ZA 2A0NA 1JCYA 4JTEA 4NU7A 4R34A 5HJLA 4BF9A 4HNLA 4QJ1A 2RGMA 2J4GA 1GJUA 2DT2A 2V5LA 1HO4A 3WFZA 4RNHA 3PPCA 4IF2A 1D3CA 1FDZA 4LB3A 3LCLA 3D6NA 3SQMA 1XFBA 1WB0A 1HFBA 2PDKA 1DWGM 4P8WA 3W7EA 4KCWA 4X22A 5FJIA 4NF7A 3EX4A 9XIAA 1UR2A 3ZJ8A 2KX9A 4GZ7A 3F7JA 4L9YA 1ONWA 4QG6A 1H7NA 4GE8A 3ZLHA 3W4RA 1W6TA 4EX4A 5A8OA 3GHTA 1E4NA 5BZAA 1HKVA 4FR6A 4JIEA 4D6JA 2QJIA 3LY0A 3I4EA 3WCZA 5D4YA 1JCNA 2YW4A 2GGIA 1TTIA 1F2JA 2HQAA 2P0IA 3NUKA 3B0VC 1MXGA 3ARYA 1SGJA 2WSQA 4H8NA 4XO7A 4K36A 2DIJA 3RLVA 4GA8A 4IQLA 2CZDA 3K1GA 4B9YA 3W1TA 4XTDA 4JIPA 3VD3A 5DCBA 4S3DA 4U10A 1L2QA 1IEIA 5HMEA 5A8GA 4LANA 3COTA 4CVUA 3M5YA 1AJZA 3BOLA 1KFBA 2P76A 3EPOA 4S23A 2BNJA 4HTYA 4C90A 3W1PA 2REQB 4B2DA 3CMFA 2I57A 4LUSB 3TJXA 1V3IA 1A3WA 3GXTA 2DSZA 2GGGA 1F61A 1KGXA 1QJWA 2OX1A 4UUIA 4ZXOA 4CU8A 1A0DA 3ZSSA 2V9DA 3LRKA 4M6QA 1FWWA 3LBCA 4O1DA 4UC5A 5D33A 5HOSA 1EJTC 1EKOA 1QI4A 2XFYA 4IMDA 4IL0A 4M82A 3H2OA 1XFCA 4GQBA 2OX4A 2IQDA 4CU6A 3ARXA 4H19A 4F8XA 4OE7A 2VELA 3TVAA 2BXYA 4NYUA 4YTSA 3PULA 4E0CA 2C8NA 1EX5A 4QP0A 1T96A 2FIQA 1V79A 5I79A 4AU0A 3GTIA 2E1WA 3RRXA 4C1KA 2QZRA 2OG9A 3URQA 2OGJA 4Z2KA 1WE5A 1VEOA 3NIYA 3NG3A 5CEWA 1WDQA 4IMAA 4J3UA 3EOSA 1X7IA 3FOKA 1OGSA 2VFEA 3AXMA 4C7FA 5CPQA 3GM8A 1NOFA 1PTDA 1Y0EA 1XW8A 2JKEA 4Z1AA 1H5VA 1YNPA 3HGRA 1KFWA 1E4MM 5GNXA 5LIUX 3LCXA 4HA3A 1B3VA 3QLDA 3V5FA 3WDPP 2XTKA 3NO1A 1I8JA 1ECQA 3GHRA 5FA5A 5K4ZA 1J18A 3M0KA 4M3PA 1VFUA 1R3SA 4PCSA 1PV8A 5LKYA 4QAIA 1R0MA 3KRBA 3LV5A 3A22A 3FXYA 4NZ3A 2QV5A 1SJBA 3PAJA 4E8DA 1ZBCA 3ARSA 5ENLA 3GTFA 1MZRA 1S46A 4JICA 1MVYA 2XIJA 2YLAA 1ZTVA 4DEFA 2VENA 4CD6A 2PTYA 4ZBCA 3WD1A 5JVLA 2QNEA 1VFMA 3AYTA 1VGAA 3AS3A 3WD3A 2FLIA 3BE7A 4WX2A 1UBSA 4M1RA 3RNDA 2QGYA 5C2GA 2A3BA 4IFOA 4YCPA 1IZJA 1JG9A 2EJ1A 4XISA 1O60A 2FH6A 3JUGA 3OA5A 3OLIA 3T05A 3L5LA 1VCFA 2F2KA 3WLIA 2ZVRA 4WKAA 4MOZA 1OCBA 2UY5A 2E25A 2BGSA 1EZWA 1MFVA 3LLFA 3QC3A 4R27A 1GHRA 4UTTA 1I60A 3UU0A 4MVAA 3LM7A 2VDIA 3VNMA 1ME8A 3BAKA 1Y5XA 2Z2BA 3VD5A 1AQFA 5JIWA 3UWZA 1EDGA 1XX1A 4M0XA 4XD4A 3STFA 1NWTA 1J2BA 3RRAA 3OYZA 3CUHA 4MSSA 2JGQA 2XM1A 3S2NA 4Q4RA 2WNZA 3PS7A 2C14A 3MUY1 2P1FA 3GU2A 2VC7A 5M1TA 4C6LA 1ZLPA 4C6FA 1OB0A 3EKZA 1IEXA 5FL1A 4XQ6A 3VMPA 4DWSD 2HXUA 3B9DA 4GHRA 3TSBA 1EO5A 1XCWA 2R91A 4Q4PA 1KV5A 4JEJA 1A47A 3W75A 1KFCA 1OVDA 4JPGA 2XWDA 5C9RA 2BB0A 3CUGA 3W85A 1MXSA 5FJPA 2YW3A 3GX9A 4W89A 3W7NA 3G3MA 2VURA 1BTMA 2YXGA 2AMGA 2OU4A 3EYPA 1V6UA 1SW0A 3PZUA 3TOPA 1JVNA 3DECA 3VOHA 3PBGA 1U5VA 2E28A 4AIBA 3LZ5A 5FAGA 5K9CA 1K7FA 4H4IA 2ZA2A 1PCKA 4ZE4A 3CAWA 1EIXA 3LCWA 4MPKA 3HV8A 3CHEA 3REQA 3CU2A 3F4VA 4KEVA 3WLRA 1LDCA 4KF1A 1W1B1 3O0KA 3ABOA 1OQFA 2GSEA 1K8ZA 1TV4A 4PMVA 1J93A 2IXUA 3KHDA 4M51A 5D9MA 4K1GA 1SFTA 2DEPA 2WSPA 5DT7A 3SQSA 2FZBA 2PDWA 3ITTA 3H8AA 2G37A 5EMJA 2B4GA 4G1KA 4MFDA 4RDWA 2RHGA 4MIMA 3VIOA 1JF6A 3PUGA 3KBSA 3PWGA 3B0YA 3SFKA 4BQ4A 1GYMA 5MHBA 3CHVA 1E55A 1YBQA 4N9BA 3THUA 2EO7A 3TAKA 1F3EA 2KZHA 3WO8A 4AIOA 4D1IA 1QHOA 4EWND 4A8RA 4LX4A 1YYAA 1EHNA 1TCDA 1WAUA 4ACZA 4H6KA 5E6YA 2IXVA 5CZJA 3VX1A 1XISA 2RDXA 5GQBA 1K9EA 2PODA 4CCZA 2IMRA 3HPSA 4AF0A 2ZOXA 3CO8A 1NIUA 1F74A 3CC1A 5J5DA 4MY8A 1VYPX 2VXNA 4F0LA 3PTQA 1TIMA 2X40A 3AXKA 3MT1A 3PFRA 1XKJA 1NFPA 2B7NA 4KWVA 4LGXA 1VENA 3KL3A 1KR0A 4HSNA 4BFAA 1Q8JA 2PDCA 3KOZA 4CN6A 1UP2A 1Q6QA 2YB4A 1X7FA 3LBMA 1REQB 2PGEA 5H8UA 4J27A 1FCVA 3MKCA 1MRQA 1P6BA 4M24A 3AWOA 4HZMA 3P7YA 3DG3A 1CIUA 4XAPA 2X30A 4UQBA 4U5IA 4AHOA 2BODX 6REQA 3LX9A 4I7UA 3C0JA 3IWPA 4AMAA 3IK4A 1WA3A 1V6VA 4HU3A 3VDHA 4H9VA 1V5XA 1ME9A 4U2YA 2BXZA 2V38A 2GDQA 2FMNA 3C2YA 3M0HA 4DM2A 1UH2A 1DTUA 2RUSA 3VOGA 4MNJA 1E3XA 1LT8A 5F2LA 2H6RA 5C2XA 1UHVA 3WQDA 2O4MA 3HPAA 3UGVA 4L9XA 3BJTA 4MWAE 1WBJA 4O15A 3NURA 1TQXA 3VFCA 3BO9A 1HKJA 2V2CA 2EKGA 3PJTA 5TF0A 1F7BA 3AHXA 4IJBA 3UA4A 3EXTA 1WKFA 1D3GA 3CUFA 1GZJA 2POZA 3MUAA 4D6FA 1JCXA 2A3AA 1RD5A 5F7UA 4HP5A 5E5CA 3TXZA 4OOZA 3NYDA 1VFLA 2NX3A 3UJ2A 4E4PA 5FF3A 2JEPA 4Q8MA 4B5NA 1S5WA 2FHBA 4JTQA 2RDWA 4N6FA 4UTJA 5HJYA 4C6OA 2NVCA 5CG7A 3GDKA 2HS8A 4O0QA 4WDUA 5CG0A 2DT0A 3IJIA 5LIWX 1P4CA 1A80A 3PJWA 4WGXA 4Q22A 1DIEA 3NSXA 3HGJA 1DE5A 3WQ4A 1G7VA 4M8UA 4LNYA 2V3GA 3ITXA 3UWWA 3L0KA 3IEBA 2CLMA 4EXAA 3N14A 4IFKA 2NUXA 4IXXA 1W1YA 3QGKC 5FKYA 2YA0A 3OVRA 5F4SA 3BV4A 2FQIA 4YYFA 4DELA 4CCDA 3N3TA 3FN9A 4F0RA 3GZAA 3C0LA 3G1DA 2I9UA 2CITA 1I2NA 1C8XA 1ZENA 2OWXA 3A4XA 5A94A 3ARPA 2YFNA 2QJJA 3M41A 2VNCA 3LGDA 1NOWA 1DXFA 3F4DA 3OHMB 1TVNA 2W27A 1Z9AA 1R38A 2BHUA 1LORA 1XIDA 4QSHA 5J5RA 3IUHA 3WF1A 4MB3A 1DBTA 3UVIA 2PA6A 2PGWA 3PZTA 1R3WA 4MZ8A 3N15A 4QG9A 1TV7A 4UB9A 2J8FA 4FS9A 1UIPA 4C91A 5DELA 3H2FA 1TWIA 2O56A 3RLUA 1WZMA 5DCDA 1LWHA 1Z32X 4KKXA 3RM8A 4ZQPA 3VNDA 2CW6A 5I00A 2PDUA 3W1QA 4JZ5A 1NSJA 4S3BA 5EL1A 4AZ6A 4IMEA 2QAFA 1N8IA 5D2TA 4ZR8A 3C0SA 5C7HA 7ENLA 4HPGA 2OB3A 2R14A 3DEQA 1W32A 1V93A 4PUEA 2FGZA 2DJLA 2WB5A 3T8LA 4N7QA 1H60A 3W28A 4CU7A 3F4WA 3RCYA 3GG1A 5I24A 3URNA 3SSJA 4ZQCA 2NT1A 2E9MA 3NQ7A 1OG0A 1K4GA 1GVSA 1L6YA 2WMIA 3PG8A 3DFYA 4OV9A 3MSYA 2WVTA 4DZIA 2BHZA 1XIBA 5IBXC 2NZLA 1TWSA 4BEQA 3CL6A 5BOEA 4PB3A 3AIEA 3CL7A 4KCVA 4L1XA 2Y7DA 1Q6CA 2XVGA 4DYEA 4EACA 1EBGA 3GYCA 2V2HA 2BX7A 1V4YA 5HUOA 4MKVA 4GZEA 1DJGA 1Z41A 3W25A 3VCCA 4P7NA 3QFWA 1WDSA 1PWLA 1BYBA 8CGTA 4P5UA 4YVVA 5EMYA 4DAFA 2GVJA 3EOEA 4GJIA 3S47A 4CD8A 1TZ9A 1XYMA 4CVWA 1OG6A 1SMAA 4LQ1A 4Y9NA 3W82A 1OF8A 2W0UA 2QPUA 4QFUA 2E8ZA 4UR7A 3RO6A 4JN6A 2C15A 3OB8A 1KBLA 3ICJA 3E38A 4U3AA 1CXKA 4Z17A 3UXDA 2DZTA 3APGA 1UR9A 3A23A 3P93A 2Y24A 3N4EA 1O5QA 3HPFA 5KTLA 1Z6KA 3ES8A 4DWDA 1S2TA 1SSDA 2NX1A 3WQFA 1ZJIA 4GXPA 2UY2A 5DT5A 4GKLA 4XAGA 2VHLA 1VBGA 2HMCA 3GDMA 4ZFCA 1VH7A 3PR2A 3TFCA 1JAKA 3OZMA 1YE6A 2GK1B 3ITOA 1Q85A 3S83A 4DUOA 3TQVA 4K68A 3SJNA 1RA5A 1JNDA 2ZZ5A 3R0KA 2X09A 1VS1A 5M17A 1IXQA 1JDEA 1K6AA 2ZRYA 4QQUA 1UWTA 2VX7A 2XDFA 5G5IA 2DT1A 2JBMA 1A5LC 1OD8A 2VC5A 2VFGA 3VTRA 1ZB5A 3MDWA 3SB0A 4V15A 5E0FA 1KFEA 1X6NA 4H1ZA 1GUVA 2GUBA 1EZ2A 1SM9A 4ZODA 1D7FA 3HMJG 1DEDA 4D8AA 1S2AA 1KTCA 4IQJA 5FEXA 4UMAA 2V6AA 1U22A 4Q4OA 3GNPA 4Y96A 4WOZA 3WF3A 3U2OA 1GCYA 4OBTA 1DWHM 4KRTA 3W2MA 4ZL1A 4YLWA 5KITA 4FR1A 3BCFA 3LTPA 1OBAA 1NP0A 4GC3A 4C6QA 1M7XA 2XFFA 2CERA 4XZIA 3FJNA 3QTGA 1ZALA 3IGUA 1TA3B 4YMZA 4F0SA 1OIFA 2J27A 1QMLA 1TV8A 2GPTA 5I6SA 1RV8A 3NJ3A 1P1MA 2IKGA 1J6OA 3VKBA 4NY2A 4GNKB 3JW7A 2IW0A 4YNGA 2Y0FA 3HQ1A 2WJDA 1MUCA 4AB4A 1N8FA 4ATLA 5E9XA 5AYZA 4HPXA 3M7SA 2ZBTA 5E0CA 1E1CB 3N6JA 2OYKA 4I9AA 3AIRA 2EBNA 4JIRA 1Z3NA 3MSGA 4PMYA 1XYCA 1EPXA 2CEQA 1HL9A 2DUAA 3B40A 1A50A 2WKLA 3BW3A 5TIMA 2DVTA 2YFOA 1JYWA 4NJGA 4GIEA 3UCCA 1B1YA 2NXHA 2CKSA 2G3NA 5J04A 3WQWA 2H8XA 4C6KA 3NM1A 1D2KA 1FWHC 1T6MA 2GJNA 1WDWA 4JTKA 1IEVA 4ROPA 4Z2LA 2J47A 4QX4A 2EHHA 3L12A 1UIOA 4MNKA 5DLCA 4NL1A 3LA4A 3VMNA 1JF5A 1PHQA 1AQMA 3BLPX 4QE5A 3ZT7A 4NZFA 2FPTA 3G0UA 1TRIA 3TLQA 2WHJA 1U5HA 3W01A 1BD0A 1HL8A 2GVGA 1XPGA 4MF4A 5K3VA 4YHEA 5HNUA 3QF0A 4K7YA 3R11A 1QWGA 1FWEC 1TCMA 5HINA 1NF7A 4CNSA 1PE1A 3SFWA 4MDPA 2PRMA 4CQ9A 1SZGA 5D37A 4V2XA 3RM9A 1UQYA 2WHMA 4JKLA 1XGDA 3IGHX 1SR9A 2MANA 3NQFA 1ICSA 2I7GA 5KETA 4Z1YA 3KBWA 4XVEA 1FWRA 1RALA 3OODA 2OOGA 2VM8A 3BZGA 2R94A 4M6VA 1FY6A 3UJSA 2G5WA 1IGWA 3WBEA 4FNPA 3WQOA 2IKHA 5A1AA 4U3CA 4IGNA 2YCIX 4ZSUA 4GVGA 1DJWA 2ZRUA 1MSSA 1WCGA 2ZTKA 3I3BA 1GJWA 4JFSA 3U7VA 3UJRA 1DJIA 4WKFA 3TYDA 5CJ5A 4ENLA 4J3TA 1UASA 2PLMA 1SFSA 5U4NA 2E4TA 2FH8A 4KEUA 3T4CA 3L5MA 4UZSA 4OKDA 1QNPA 2BY1A 3TR9A 1WXYA 3WLHA 4S3GA 4QROA 3UG8A 5JU6A 1W5PA 4BR1A 2WPGA 5CLWA 5CQ1A 2E6AA 1X6UA 1SO6A 4LW7A 2PLJA 3U0HA 1E9ZB 3P5YA 3CZGA 7REQA 4ZENA 4H8VA 2OQLA 4URIA 2QCMA 3GXNA 1K8CA 2XPKA 5H1WA 3TN6A 4G9PA 2PTWA 1V0NA 4QEHA 1VPXA 7XIMA 4AD5A 3QC0A 4HHMA 4TMBA 2DSVA 3E0VA 1MEWA 5JQ9A 4W7VA 1ONEA 4BA0A 3R89A 1H62A 5KEZA 3R7MA 1XWYA 3NXLA 4DBUA 4KQNA 2INZA 1B9ZA 3S2LA 2EPLX 2CETA 3NFUA 1UZ1A 4JOMA 2ODOA 4MAVA 3HBLA 4LEQA 3ZLGA 1LF1A 5CSSA 1XBXA 4CQDA 4K3ZA 3NZ1A 5JIPA 5A6MA 2X0SA 3N2TA 5SWUA 4GIRA 1FRBA 4XAFA 3SCQA 2Y6ZA 3BG5A 4GXWA 2ZRZA 1QPQA 2V3DA 1XYZA 3L65A 4TTGA 3L4XA 5I0DA 1T40A 5XIMA 3OA3A 2VR5A 1ITQA 1GQLA 3HJZA 3IVTA 3R6IA 3PN8A 1W8SA 5LA0A 3PB0A 4M1BA 4GVIA 5D2YA 3WNKA 4D6IA 1GVFA 1FXQA 3PAOA 4F9DA 1ISVA 3TW6A 4ZQRA 1F6KA 2HVOA 4P8XA 2DZXA 2H3BA 3BLDA 2YJQA 4A8IA 3UJFA 5LNVA 4Y9OA 3VGHA 3EEGA 2BFGA 4LYPA 2PDNA 1JCMP 3AROA 3NPWA 4H8HA 4DWSA 2QCEA 2DORA 1FKWA 1V7AA 2VYOA 2H3DA 3ZJ7A 5DN1A 1UA3A 4L65A 4WQ6A 1Y5WA 1PZ3A 2VUYA 2QPSA 3TA9A 3DHFA 1FWCC 3GNRA 1J0ZA 5CGQA 3VZZA 2B7QA 2EG7A 3WL0A 4C5ZA 1U83A 5B80A 2DSUA 5T9BG 3RN6A 2OFJA 5AYXA 1QPOA 5C55A 5AYYA 4AYSA 3WEZA 3ZYZA 4O54A 4LWWA 3AS0A 3B97A 4KPLA 4JQ2A 5DY3A 2E5DA 4X2RA 3USBA 2VP8A 3UWUA 1UWIA 3FLUA 1IR1A 1F05A 3BAIA 3ME3A 1VHNA 3ZVHB 4Z2GA 2DZSA 4BS0A 1XL9A 5E9AA 4MY9A 1ZBKA 3TYBA 2NQHA 3F4NA 3QPYA 2RDTA 3QEZA 1QI2A 3QR0A 2ZUVA 2J62A 3D0CA 4RX0A 3T2PA 1BXBA 1PTAA 1MQRA 3BLLA 4WVXA 6XIMA 2A7PA 4MJ2A 4GUFA 4XB3A 3RM4A 2C0AA 3U57A 4O57A 4AF0B 5C54A 2P3ZA 3EPNA 1KLZA 1VFFA 2YXXA 1JUEA 5REQA 3QHNA 1E6RA 3WLLA 3OYXA 3NQGA 5FOOA 5BNKA 1H41A 5F4WA 3SCUA 2X41A 4TUFA 1UR0A 1EFZA 3OLEA 4US5D 3GIPA 2IPJA 2D20A 1MFUA 1CENA 1KXQA 1EL3A 4PSPA 1VEPA 2YCEA 3P5ZA 2VGFA 3W1LA 1GOQA 3A4JA 5G1MA 4ML9A 4BEUA 2EJAA 4LCQA 1GVYA 3K8KA 1W9BM 1ML1A 3LG3A 4Z1BA 1KKRA 3K13A 4Z2HA 1B54A 1JR1A 4WKHA 2J6VA 3W7JA 2JIWA 2VRJA 1PYMA 1I2OA 5C71A 4O16A 1HO1A 1YTKA 2RGLA 3S5NA 4LRTA 3LHTA 4JNZA 1AH4A 4AHPA 3C0QA 5E70A 3RJYA 3NWRA 1JGMA 1EJUC 2V3FA 1H61A 3LBOA 3QN3A 3FEQA 2HISA 2G95A 2PTDA 5B7ZA 2ZUTA 5I3IA 1OCNA 1ZHAA 3UT0A 3BMVA 3W7PA 3DFSA 1MUWA 4UTUA 3KLLA 5ABFA 3QY7A 3M07A 3GDBA 1R7OA 1NF0A 3TJ4A 4QCFA 3VIJA 4RNJA 4JTGA 3R5EA 2G0WA 1OFPA 1UUOA 2WBGA 1DJZA 3A21A 4NVTA 3F5KA 2WC7A 1FWBC 2EPKX 3GTNA 2GGHA 5AYBA 1GOXA 1N2VA 4ZTYA 1RQBA 1R3TA 2TYSA 3WQCA 1W91A 4W8AA 3U48A 4XD3A 3TNBA 3SCWA 5DEZA 1IHIA 3UPBA 3SSZA 1ITUA 4M19A 3DHPA 3GQYA 1EYWA 2ZXQA 3VGFA 1TWZA 1P0NA 5CPMA 2DZPA 2J79A 2O55A 4JDBA 5AC5A 2J7CA 4GJ1A 3W23A 5F2GA 3VOCA 3W6MA 2Z25A 2AQVA 4DB7A 3SCTA 1CXEA 4I8YA 1SO5A 4S2CA 1F4HA 1TMHA 2FZMA 2ANUA 3M5XA 1BYCA 2ZIDA 4DJDD 3ARUA 3ZT5A 3C3UA 4UNKA 1JPKA 1OX4B 1X6LA 3BOFA 3R0DA 1EB3A 3IJLA 2WKGA 3WUEA 1HZYA 2XFWA 3IIVA 4UOZA 1TTJA 1JZ3A 3W74A 5CPLA 1T8QA 1PKNA 1FDYA 4IG2B 5IHRA 1I0DA 4C7DA 1UBPC 2A3EA 3KAOA 3L4TA 3AIVA 1PZ1A 4FXSA 4G7EB 3PZNA 1EXPA 3Q58A 3PNZA 3IACA 2DU2A 2XH2A 5CPOA 2VZVA 5D2VA 1BG4A 4ERAA 4JQAA 2CXGA 4MLRA 3TTOA 4JTHA 3MHGA 3M6DA 1JDFA 4R9XA 3TN4A 1SU5A 3HG3A 2VEGA 2QEZA 3T1GA 4K8GA 1Y65A 1LYXA 5EBAA 1VPQA 1WUFA 3WMSA 1MNZA 3KZSA 1ZNNA 3TV8A 1QUMA 1W8GA 2NUWA 2P50A 3G1YA 3V5CA 1UUMA 4W7WA 5G2HA 1QK2A 4Q4QA 3OGVA 4Q8VA 2C16A 1WQ5A 1JPIA 4PE8A 2YCLA 4MTVA 2GWNA 3TTSA 1KFKA 3VD9A 3W3OA 3ONCA 3AXIA 2PWDA 3B9EA 5HA7A 4PULA 1N7KA 2YB1A 1JZ5A 2XZ9A 1U1HA 4TX6A 3TYZA 3WBXA 3FVMA 1EC7A 2D73A 4HOWA 1IWAA 3WFLA 4ZO9A 5I7GA 4P2VA 3W37A 2BG5A 1EEPA 3M7WA 1OYAA 1C9DA 4Y9MA 1FWTA 1DIDA 3ZR6A 3N12A 5CPNA 3SZ8A 1ZUAX 4I5XA 3OW1A 2D2JA 1GOWA 3HJEA 1Q6RA 3BV7A 4IGMA 1HUVA 3P62A 4GUJA 1H63A 3A6OA 3WJWA 2YR1A 1R2SA 3M6YA 3KOXA 1E56A 4PFHA 2B7OA 2WK2A 2Y1HA 4XKMA 1JULA 1AODA 3BLIA 3NQDA 3RHGA 3L4WA 1F76A 3NL6A 1UC4A 1GEQA 2PWUA 4XUGA 2OTDA 1FHDA 4DI8A 2QKFA 5EBUA 3FCPA 1WXZA 3S3GA 4IICA 4UTHA 3EX6A 2C3ZA 1BWKA 2PP1A 4L1GA 1TB3A 2F2HA 3DYMA 4EXQA 5HJXA 4EAYA 1NDVA 3PBMA 3IIZA 3ATYA 1A53A 1UP3A 4P7OA 4UCFA 1FXPA 3UVAA 1DIKA 1XDJA 1KW1A 2GVEA 4UTWA 3WEOA 5A8MA 1MQQA 3W29A 1SPQA 3I7SA 3A24A 3MMTA 3OHIA 2XINA 1W54A 1YXDA 3D46A 5EKYA 2FDSA 5CJMA 1J01A 1KCKA 3RG6A 3FYOA 1ISZA 4ZO6A 1H2JA 3T0AA 1XI3A 3GU9A 5CZSA 1Q6LA 3C56A 2J7HA 3KTXA 3WH9A 1FHUA 4REQB 2O9PA 1LROA 2QUTA 3SEPA 4NRSA 1H4PA 2Y8KA 1JI2A 2NSXA 3P60A 3VKAA 4OUEA 4PN2A 3QR3A 2OSWA 5AC7A 3L4ZA 1KRBC 1ZJHA 2YZ5A 4DVOA 4S3KA 3VNYA 1CXFA 3KTCA 5E0KA 3WQ8A 4HU8A 1O5XA 3O7UA 1BHGA 4RE0A 1CGWA 2A3CA 1UH4A 3OVPA 2O9TA 4AISA 4I9JA 1RZMA 1MMFA 1TE6A 4CCCA 3NR0A 2DZBA 4U2ZA 1XUUA 2PFHA 4LF1A 5KZ6A 2CLFA 1OC6A 3BQ6A 1ZZMA 2PBGA 2FKPA 3LSBA 1YPIA 4IQEA 3HGOA 2BZNA 1EP1A 2PMQA 3MMUA 3TROA 1G4TA 2NQZA 4BWLA 2XGBA 2CLLA 3S2JA 5KINA 2IPWA 4K7VA 3TE9A 1T41A 4YJ5A 3L0NA 1F9CA 2ZC8A 1KKOA 3GXIA 5HULA 2JKAA 3N2XA 3EA1A 4ZE5A 1IF2A 2Q6ZA 1GOIA 2HVMA 2ZUMA 4B92A 3VD7A 4AEOA 4IPIA 4NT0A 1CXHA 1E70M 4U33A 7TAAA 1VFOA 4W8LA 5HNTA 2YL8A 4Y90A 1R3YA 4JY9A 4B2DD 4PMJA 4Z0JA 2VWTA 1KWKA 1TX0A 2NQ5A 4L6DA 4LNCA 2GJPA 2YXOA 4FF7A 1T99A 1Q6GA 6CGTA 3K46A 1A5CA 4C6DA 3LNMA 5HQLA 1RK6A 1E15A 4FK9A 5D8WA 4MGGA 1NM9A 2QMJA 4IOTA 4DLFA 3URBA 5BXSA 1MI3A 5DY2A 3QV8A 3URAA 7TIMA 2ZWYA 1NWSA 3U7BA 4WK9A 3S46A 3HGSA 1VRDA 3CJPA 1C92A 2J24A 5AZ1A 2B81A 4O53A 3AYVA 2WQPA 1V0MA 2DZVA 3SGGA 3QOMA 4G1NA 2WW5A 3WIJA 3FSUA 1RCOB 4BF7A 1Y8BA 2MNRA 4NZ5A 1VKFA 3KTSA 2WMGA 5C0QA 1GEHA 4WOQA 4FX6M 3ALGA 3G1SA 3W7MA 1R9YA 2PF0A 1A5MC 3CAQA 5HMFA 3UEQA 4AG0A 3DI1A 3FW6A 2E0PA 4LV4A 3FFSA 3M0XA 4IWWA 4GO8A 2VFIA 3PG9A 4AWSA 4MKNA 1K9TA 1JL8A 2W92A 4Q8NA 2GJRA 4J7RA 4OV4A 5BWFA 3AYRA 5CBIA 1P1XA 2BMBA 3VZXA 2V82A 1UR3M 5AC6A 3TXVA 2W6RA 3G6LA 2WZHA 3DFHA 4XD5A 1DKWA 1E6ZA 3MHFA 4IFRA 1AQ0A 4GPNA 1PUDA 5DRCA 4DZHA 3LZ3A 1FWSA 1F73A 4N9CA 1M03A 1Q7MA 1I6NA 3CQJA 2WHKA 1XIIA 1TIWA 5HWJA 4ADTA 5CZTA 4I6VA 4E3VA 2ISWA 1XRSA 4CD7A 4FOKA 2Q02A 1G67A 3TTEA 3VCNA 3ES7A 1KM3A 2WOQA 2XN1A 5CXPA 3WBYA 4GI8A 1QHPA 3IIOA 1DP0A 2EXOA 3N34A 2WVVA 3MCNA 7PTDA 4JN8A 4M6PA 4OGZA 3CWOX 3E12A 3VX0A 4PCNA 1P5BA 1AJ0A 1V3KA 4KIEA 3P61A 2QGHA 1XRTA 4IQDA 5EMMA 4NXSA 1LWJA 1LBLA 4LALA 5AHEA 4PUKA 4B9ZA 4C6BA 1OFAA 1QPNA 2ISFA 1PVNA 3MV11 4XKYB 3TC7A 2YLLA 4XBKA 1MWOA 3QKEA 3GIYA 3VDBA 1SJAA 5G2IA 3T2QA 4GH1A 3UP8A 3KLKA 4YPJA 4RPPA 2V69A 3LQLA 3IRDA 1GQNA 3V7PA 2PPGA 3E0IA 3G1RA 5A6BD 3M0YA 4JEQA 3KP1A 3LB0A 3SCRA 1QXLA 3CASA 3UR2A 3RU6A 2GSHA 1WZKA 3WLMA 4E4UA 2VRKA 4KWUA 2VC9A 4N9DA 1O5RA 3WNOA 3F2DA 3OQEA 2VFFA 4ZA0A 2W9MA 3VIMA 1EO7A 5I77A 4F2UA 2O0TA 2W3ZA 1S1RA 1O95A 4O28A 1UWSA 3I4KA 2QF8A 4AZ7A 4ORIA 3WK0A 4MWAC 1YNQA 5LGXA 1H7XA 4L7ZA 4KCUA 4WJ8A 3TFXA 3NPUA 1W1VA 3GE7A 4C6IA 4H04A 2QDEA 1VRXA 1ZBVA 1QASA 4W5UA 1JZ2A 3CEUA 3HG2A 4IUOA 3TEVA 4QDMA 4W86A 1J10A 1VIWA 3CV2A 2YYTA 6PTDA 2JQXA 1BRLA 1AJ2A 1WX0A 1DE6A 3PTDA 1XIJA 2Q3OA 1GG0A 2DV0A 1UWAA 4W4QA 4GZJA 2Z7KA 3WJYA 1R9ZA 3AMGA 2ICSA 5HQEA 4F9JA 1ISWA 2Z24A 2PURA 2V81A 2CCRA 1TMQA 3NVDA 4DJED 4US6A 3A4WA 4JTDA 4IX2A 3V4BA 1CGVA 4IIFA 1PPIA 3VGBA 3BJFA 5TAOA 3CEPA 1RAKA 1GGOA 3IJQA 3SJ3A 1F3TA 3M5VA 4HMEA 2BY0A 4BQ2A 2OYLA 2X0YA 1KBIA 3ZLFA 2ZWZA 2GZXA 4IZGA 4Y8FA 1YE4A 4G56A 2OWWA 3PBWA 4E8GA 2MUCA 4Z1DA 1E43A 2CBIA 4XSLA 4W7UA 3IPWA 1W3JA 2YCJA 2DZWA 3W0KA 4YVXA 3SIZA 1B3ZA 5D30A 2VZSA 2QCDB 4Z2JA 1YHTA 3VC5A 2EKCA 1M9HA 1IIGA 1LL7A 2WPBA 4AD2A 1CI1A 1C7TA 2DZUA 1QNRA 3EBVA