1S2VA

Crystal structure of phosphoenolpyruvate mutase complexed with mg(ii)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
289
structure length
282
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
molecule keywords Phosphoenolpyruvate phosphomutase
total genus 107
structure length 282
sequence length 289
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2vA00
4IQDA 1F8MA 3P0XA 1U5VA 1DXFA 2HRWA 3KHDA 1AQFA 3GQYA 3OQ8A 1F8IA 4LSBA 4HYVA 4KCTA 3E0WA 3H6OA 1DQUA 2G50A 4KS0A 4KRZA 1E0UA 4MF4A 4MG4A 3T05A 1SGJA 4YJ5A 4B2DA 4B5XA 3QV6A 1IGWA 4IMAA 3FA4A 4L80A 1F3XA 3ME3A 2X0SA 2ZE3A 1O66A 2VWTA 3MA8A 1S2WA 1ZLPA 4QG9A 4B5SA 2HJPA 3PP7A 3LG3A 2OLSA 3OYZA 3SRHA 3E5BA 1M3UA 3I4EA 4KCVA 1ZJHA 2BG5A 2XZ7A 3QV8A 3N25A 1A3WA 1DXEA 3OYXA 1T5AA 4YNGA 3SRFA 4B5UA 1S2VA 4B5VA 3EOEA 3M0KA 1Z6KA 4TV6A 3EOOA 3QQWA 1U5HA 1PKLA 2WQDA 3R4IA 3G2GA 3B8IA 2VWSA 3QV7A 5TAOA 3BJFA 1A49A 2DIKA 1O5QA 2KX9A 3EZ4A 5JVLA 3QV9A 1PKNA 3BJTA 2V5JA 2V5KA 3T0TA 2XDFA 2XZ9A 3FA3A 4RPPA 1F3WA 2QIWA 4KCUA 3HQPA 1M1BA 4B5TA 1A5UA 3GG8A 3M0JA 3GR4A 4FXFA 1XG3A 4L7ZA 1PKYA 4HYWA 2HWGA 3T07A 4QG8A 4ROQA 1IZCA 1O68A 1XG4A 2VGIA 1VBGA 4JPGA 1PKMA 3HQNA 3PUGA 1KBLA 1UJQA 4QG6A 2DUAA 4DRSA 3E0VA 1S2UA 2VGBA 2VGGA 3LYEA 3VAVA 1DIKA 3EOLA 2VGFA 3KTXA 1A3XA 4IP7A 1KC7A 4G1NA 2E28A 1VBHA 3QZ6A 4KCWA 1E0TA 1S2TA 1OY0A 4B2DD 3IS4A 4L9YA 1JDEA 1MUMA 3QLLA 3QTGA 2R82A 3HQOA 4FXJA 4QGCA 4TV5A 4L9ZA 1GGOA 1OQFA 1PYMA 3SRKA 2HROA 1F61A 2L5HA 4B5WA 4WJ8A 3U2ZA 4IQEA 3SRDA
chains in the Genus database with same CATH superfamily
3BZJA 2DPEA 1ZJIA 1H5VA 2NSXA 1IXPA 4MUZA 3MT1A 3W1RA 3I4KA 4WRHA 1FP8A 2CBUA 3RK8A 2J7DA 3IPWA 4RXFA 2J7BA 1B90A 3AZSA 3C2VA 2G3JA 3AIRA 2PLMA 4HCDA 2XIIA 2CLEA 3IANA 3PAOA 2HNEA 3L4WA 2PURA 2ZX5A 1E4NA 1XV8A 3GIQA 3LQLA 4UXDA 3DCPA 2VCCA 4HTBA 5JH1A 4JDYA 3RILA 3AIWA 2VX4A 3W75A 3WKZA 1UBSA 3SECA 1RPXA 2PUZA 3MUXA 5G1YA 4K7YA 6ALDA 2DW6A 4XO6A 3RX2A 2QCMA 3AYVA 5L9FA 1LZOA 1HP4A 3CAWA 5H1WA 3H2FA 3NQAA 4A21A 2R8WA 3GY1A 4WZHA 2AL2B 2FZ8A 3GW0A 3W29A 3TZFA 1OIMA 1VR6A 1OVDA 4EXBA 3MP4A 2DP3A 5AYYA 1A5SA 3TLQA 2R6OA 5GJMA 2PDPA 2D0HA 5HATA 3ZR5A 5JH2A 2DUAA 2E77A 5LNWA 3CTTA 1W1B1 1BWVA 1Q66A 3RNDA 1XIJA 1TQJA 4WGXA 2FH6A 3Q37A 1NEYA 4M24A 3RPTA 1N8WA 4FXJA 2GJPA 3WK0A 4QGCA 5G4WA 3JVAA 3OODA 3UR7A 1TPH1 1EJSC 2G95A 4D8LA 1OX5A 4JTKA 1RLCL 4JD4A 4JN6A 1FHLA 4PBGA 2VVSA 2EBNA 1B3OA 2JFEX 2JGYA 2YCLA 2J66A 1BAGA 4ZSTA 1K1DA 2E8ZA 2FYMA 3KOYA 1CECA 3C2RA 1NQKA 3L67A 1PS9A 1ZBVA 2QNEA 3SQLA 3S1UA 4HPXA 1ZS2A 2E25A 1TV8A 2IXVA 2WPGA 1HJXA 1V3KA 4AHQA 1KM0A 3QV8A 4ZOAA 2OKOA 1YLVA 1DJWA 3WZ0E 5M3WA 1R6WA 4V1XA 4AUBA 1A53A 4MKSA 3W76A 5J04A 3VIGA 4IMFA 4YCOA 3L21A 3ARSA 4RLIA 1VLIA 3EZ4A 4D9PA 2HS8A 3B0XA 1H60A 2GGIA 3QGKC 4TOQA 3EX4A 1SZEA 5JUVA 3K8LA 1DJGA 5CC5A 4ASTA 3STFA 4PEEA 1PYFA 1V02E 5D9NA 3OVPA 3NDOA 1R9YA 3CMGA 3WF0A 1AW2A 4AD5A 4PUNA 4LUIA 5EBAA 4H9VA 4KFPA 3EWCA 3UR8A 4IP5A 1V6XA 1F73A 2YCLB 4BF7A 1UP0A 2I16A 3WQ8A 5JXQA 3BCFA 4B5NA 4G8TA 4PMJA 4P8XA 3TMQA 2JEQA 3UZJA 2QS8A 3A4AA 1ADDA 4UTIA 3OVRA 4O1EA 1LBFA 5BU9A 4XISA 2Q02A 4UWMA 3C8FA 1NARA 3RMJA 2DV0A 2Q71A 2YXOA 3KBNA 1YNQA 2DIEA 4BJHA 3BH4A 2XSBA 1N8FA 1O66A 3L4ZA 1C3FA 4AX6A 4NUWA 4JKMA 4PMXA 3MANA 5DRCA 4JHMA 2PDJA 4DXKA 4GRSA 2PC4A 2QDEA 5GNZA 1KKRA 4A3RA 3UT0A 1XYFA 4PUMA 3R0KA 1A5NC 1VD6A 3S1GA 3QQWA 1FWBC 3URAA 4XIAA 1HKIA 3A23A 4L56A 3QVQA 4LYKA 4NZ1A 5I3JA 3W4RA 2GGEA 1SJCA 2ZXDA 5I0DA 2GGGA 2GOUA 3I10A 2OJPA 5I3HA 1A5KC 1OFQA 4K68A 4OUIA 4O8AA 4NX5A 4LANA 1AH3A 1NFPA 4DF0A 3TAOA 1NM9A 4REQB 1O4UA 1T99A 1C7SA 2G8ZA 4MNKA 5F4SA 1XLFA 3QTGA 1SR9A 3L65A 3DEQA 1RXOB 3EMQA 4Z0SA 1E0WA 4DPPA 1A50A 4AW7A 3V16A 3WQDA 4P2VA 3UD6A 4QAIA 2YBVA 5HNTA 2O55A 4CCDA 1E0VA 3DX5A 2BFGA 4DI9A 3N6HA 2YA1A 1F4AA 4C5ZA 1UOKA 3GNPA 2XH7A 4QDMA 3FA4A 4O50A 1TRIA 3SUVA 2GWNA 2CCRA 3MV11 2PWGA 3WH9A 5CAKA 2NUYA 4QIUA 4F8XA 1DJQA 1A5LC 1G67A 2VXNA 1OM0A 3TN3A 3B97A 2O9OA 4O15A 5EMUA 1KWGA 3KLLA 1JPDX 2GK1A 1SM9A 1H7PA 1UR3M 4IGMA 2FPTA 4N0RA 1S2VA 3PFRA 1OZMA 2Z28A 4LFYA 4JEJA 1K6WA 3GXIA 1CCWB 4C6IA 5BNKA 1YDVA 1XH2A 3W1TA 3WLKX 1HZYA 4L4MA 2H6RA 2WANA 3H4WA 3MY9A 5CBBA 2R1NA 1E40A 1FWWA 3QW4B 4MZYA 2MANA 3H26A 5IRPA 2BY3A 1R30A 1MXDA 3N9KA 2V8ZA 3ANVA 4E4PA 3AI0A 2C1HA 3TTOA 4KERA 5ABHA 3VD3A 4LAKA 3MSGA 1PJ9A 5JMUA 4W5UA 1KM4A 4PMNA 1AJZA 3GM8A 2WO5A 3PB0A 1B30A 3BQ5A 4V27A 3S6DA 4F0HA 1HKMA 1NELA 2XFWA 1XLEA 1AH4A 4HMDA 2L5HA 3G1RA 2WMJA 1ZQ5A 4NRRA 4Z17A 3E2VA 3STGA 3AFBA 3BMWA 2VC9A 3EMZA 1JULA 1AQFA 2X41A 1X6UA 1E73M 4LW7A 3ITGA 1OBAA 3WMSA 5HNRA 1V08A 3VIJA 4HHMA 3BC9A 3CZJA 2ON3A 1X1OA 1AD4A 4Z2LA 2IPWA 2C0HA 2G0WA 1IEIA 3CYVA 2D2GA 3PJWA 2ZVRA 3TC6A 4HGXA 2I9EA 4RNHA 4AYGA 1XFCA 3BG5A 3ABOA 4R33A 2R1LA 1I2OA 1H2JA 4FNTA 4AWSA 1RSCA 2ISWA 3AS1A 3MVIA 3RX4A 1OB0A 2RGMA 2ZBTA 3PZOA 3IUIA 4K38A 3ABSA 3N2MA 1WNOA 3HQPA 3AXXA 4MPKA 3EKZA 3GG0A 3PN8A 3OZPA 3I6TA 3UYIA 3TCSA 3UFYA 1PKMA 1W0MA 1F9CA 3WH6A 4Y9OA 4DWDA 3WNOA 3CL8A 1CBGA 2PWDA 2BXVA 4G7EA 4GH3A 3VD4A 1DQWA 3K5XA 3P82A 4V1YA 5M17A 1ONEA 2H3BA 1E9ZB 1XINA 4C1NA 4U5KA 2E67A 2VEGA 2ZXBA 2WSRA 4JTJA 1K7EA 2XJ7A 3JS3A 4H8UA 4GBDA 4ZA0A 1E5NA 5XINA 4D8ZA 1UD6A 1F5ZA 4GQRA 4NJKA 5D04C 1IEQA 4NYYA 1TWWA 1KM1A 3BAYA 1FWHC 2OZTA 4Q8UA 1RALA 3RX3A 2V9DA 2X0SA 3BXWA 5CPMA 3O06A 3N17A 5KZEA 2PD5A 3VNDA 3CH9A 1LRNA 5LIUX 3HF3A 1QK0A 2Y62A 3FV9A 2GZXA 4GYJA 5CBJA 2VQUA 3Q94A 4LY4A 1J0KA 4CNPA 1Y5VA 3M9YA 3VYLA 3O15A 3BURA 4HMNA 1QPNA 3W1LA 3E3HA 3GFXA 5GVJA 3KDNA 2HE5A 4Q8NA 3ABXA 3ZOAA 2ZZ4A 3DHFA 5LNRA 1ESWA 3GDBA 1XYCA 4NAFA 1BGAA 4J27A 3O1NA 4K6AA 1UZHA 3ZVIA 3GUWA 3C52A 1W9BM 1YYAA 4XAZA 2J6VA 2HBXA 1B1YA 3OO2A 5HNUA 4P7OA 4K37A 4JTDA 2C71A 1VFOA 3M47A 2VC5A 3R25A 2BMBA 2QW5A 3HPZA 4QQUA 2O7QA 3CMJA 4AEFA 1K4GA 1R46A 4JGDA 4JTGA 3UCDA 3PC0A 3OLIA 5U7SA 4IJBA 1MMFA 4Y9MA 3UGRA 6REQA 1DP0A 5AZ1A 1JNEA 4D6IA 5BWFA 1GOQA 3RUBL 4AZIA 3H2MA 4P8UA 2B31A 1QOQA 3MUZ1 3B0UX 2QCNA 2E4TA 3U57A 2ODOA 1KCLA 3GW3A 2BV9A 3APGA 1JNDA 1RHCA 5LGZA 1O94A 3UWEA 7TAAA 2JKPA 1U2YA 4KEMA 1GOWA 1PV8A 4Q8MA 2ZX7A 2BS9A 4Z42C 4H9ZA 3ARYA 4B3LA 1GJUA 1L8NA 3QKEA 1FWCC 5CC3A 2EPNA 3ITXA 3DFOA 3HMCA 3W1NA 3ZLHA 1D3GA 5A8QA 4GVIA 5FL1A 1FWJC 2B7PA 4BKNA 1KR0A 5ECUA 4Z2KA 3PY2A 3WQVA 2FTYA 4BK9A 4X63A 3NM3A 2JIEA 3WELA 3EEGA 5DT7A 2ZRYA 4OHQA 1VIZA 1TG7A 3LXBA 3GXTA 1ITUA 2I17A 4NG3A 5AYIA 1E70M 4NKCA 2DZTA 2X1RA 4RE2A 1JI1A 1AK5A 4PMRA 3AJXA 3G1AA 1OCJA 3O05A 2J13A 1XKYA 1K8YA 1UHVA 2PLJA 2C0AA 5CSUA 5CG7A 1H7RA 2KAUC 2Z1WA 4JZ5A 3RRXA 1CGXA 3AS3A 1BXBA 1XBYA 2DVXA 3DI1A 1GKPA 3KWXA 1W5PA 2D1ZA 1TELA 1C8VA 2ESCA 3GG7A 3W2MA 4NZCA 3U6WA 4EANA 1PX3A 3R0UA 1UD4A 1P4CA 2HV5A 2CYGA 4N9BA 3AMGA 1E56A 1EF3A 1KXVA 1D7KA 4BI6A 1RLDA 3BLKA 5I3KA 1JQVA 2WC7A 5T9BG 2D2JA 5HQMA 3EPMA 2JKEA 4HA0A 4GY1A 4AWEA 5HQEA 4QISA 1RJPA 4XZMX 3PVFA 4YTSA 4NXSA 3KRBA 1GK8A 1UKPA 1GYNA 1EKOA 2CKSA 2DY3A 3IRDA 3URNA 1PCKA 2J24A 5JBDA 2WSYA 2IKIA 2PWEA 1VFMA 1TZZA 4BA0A 3IVUA 2AOSA 4XAPA 1AW5A 3BUVA 5IXEA 4Z08A 1SO4A 1OQFA 2ATSA 1XLKA 1HVXA 3OEXA 5LA1A 3VC5A 3SADA 4WSHA 4YTRA 1MYRA 1DJNA 1G4PA 3TXVA 3T44A 3VX0A 4JN7A 1J6PA 3A3HA 1KCZA 5I79A 2GQ9A 2CZDA 2X16A 3KBWA 1V6WA 4RDZA 4RV3A 1TWIA 1QT1A 3F4DA 3SCTA 2X7VA 2Y7EA 2QUNA 3IACA 2X1SA 5CCZA 2OLSA 1UPPA 1W9UA 1RCQA 1EL3A 2YLAA 4EKJA 3QY6A 1IR1A 3B8SA 1JCYA 3ENLA 3N25A 3ISIX 3BMVA 1XBXA 5B80A 4Q33A 2TYSA 3GXFA 2XM1A 3GNNA 6ENLA 1KFWA 2GGHA 3UYCA 5HULA 1T8XA 4O1AA 1OFPA 1TJ0A 1UWUA 4O57A 5C70A 2DORA 3NEVA 4S3BA 3G18A 4IFRA 1NF0A 4MJZA 5CEWA 2ZRVA 4CNNA 3WEOA 1PHQA 1UD3A 2BY0A 2OU4A 4ZOBA 5ABGA 3NR0A 4YVVA 4IPLA 1DTNA 2HVOA 5IBXC 2NXHA 1SO6A 1UKQA 3DKJA 3OZYA 3U2OA 1M68A 3REQB 1CXKA 2OYLA 4Q7BA 3NXFA 1E1EA 3WQWA 1WDWA 2DZBA 3AYRA 3WBWA 2XVPA 4MADA 1IT7A 2HS6A 4JFVA 1E0TA 1EXBA 4DM2A 4O52A 4OFCA 3KP0A 2XH0A 3WH8A 4IXXA 4NT0A 2PP3A 1JI2A 4PL2A 1TUFA 4WIWA 1CPUA 2ZZ1A 3AXIA 3URQA 2FZ9A 3LXCA 3MZNA 4KWVA 5BCAA 4QAWA 4OBRA 3R10A 4TMBA 3PS7A 3WENA 3CGTA 5K4ZA 4TVDA 1F05A 4XSMA 3U5YA 3VNJA 3WFZA 4L4PA 3RRAA 3PUDA 3ZVHA 2ASHA 2WJFA 1J5TA 4I90A 1V02A 4DAIA 3ITCA 1ZJBA 2EHHA 1QHPA 1EC7A 3GIPA 3DC8A 2F6UA 4D1IA 1YBQA 4N9EA 1Z32X 2FJUB 1YNPA 3GG8A 5I3FA 4ZQRA 4HMEA 1WXJA 1BVNP 3DC0A 4E38A 1RD6A 1TPFA 3PUGA 2C14A 4GI4A 1LG1A 1P0BA 4LAMA 2P8CA 1TJRA 2QAPA 4D6CA 3WQ6A 2X1TA 3T09A 1JDEA 4TV5A 1P0NA 3W7GA 1FY6A 4PN2A 1MQPA 1JCXA 4XO7A 3A5VA 1TUXA 3IJ8A 4MKVA 3UERA 1U5VA 4D6FA 2P3ZA 3CXOA 2NV9A 3GQYA 3CUGA 2DSUA 4KT2A 3N11A 4YYFA 6PTDA 3CWNA 1PDYA 1X7IA 4H7ZA 4LV9A 3NZGA 4RE3A 3GYEA 3NL6A 2V5LA 1T41A 2EPLX 2WMFA 1NAL1 3PZGA 2ZA3A 3I68A 1W17A 2C19A 4HK6A 4JQ3A 2VC7A 4RZ6A 3TK7A 2Z2AA 3UGVA 1O6IA 3OA5A 3UZXA 4IFKA 2Q6ZA 3H55A 2QCHA 4ZB5A 3QMRA 5E0KA 1OT1A 1JF6A 1GPFA 2Y5JA 2V38A 2ISVA 3H12A 4AD1A 4CVUA 4UFLA 4UMAA 3F4WA 4MNMA 1FCVA 5HMEA 2C18A 1H7XA 4NSBA 3EA1A 3QPEA 1PHWA 1UPMB 2EKGA 3WD2A 3N6JA 1REQA 3MHUA 5C2CA 4MB1A 5AFDA 1AJ0A 3OU8A 1Q6LA 3NDZA 3PNUA 3L0KA 4LGXA 5MF5A 5GNYA 4KW2A 5EMYA 1R3TA 5HNNA 2J7CA 1KXHA 4H9XA 3NQ6A 5D8WA 4C6QA 3UXDA 3G1HA 1QATA 2ALRA 4A2RA 5G2HA 2Z1BA 3PJTA 3VFCA 1NTHA 1GOMA 4IWWA 4JIRA 2HEJA 4LWWA 1TIWA 2CWXA 4C6NA 2OTDA 5CQ1A 3KBJA 2F84A 4H6RA 4M8UA 4B2DA 3FW6A 1F3XA 3QJAA 3FEQA 3LV6A 1B3WA 4Q4KA 5HWJA 5A6SA 1TE1A 2WCGA 1JCTA 3THUA 3CPUA 5A6JA 4CNUA 2DZWA 3O63A 1W5QA 3FN9A 3BLIA 3ZWTA 1XLJA 4XD3A 2CXGA 2VZSA 4FXRA 1VYPX 3NQVA 1HGWA 3G5EA 1OYCA 4DJFC 1E6RA 4I9AA 4DWSB 3PZVA 2GWGA 1PEZA 3BJTA 4N42A 3T0TA 1JPMA 4MNJA 3UZ5A 3GB6A 1YMYA 4BEUA 4CN4A 1PL9A 3GNRA 1RBOB 4A4AA 2QJNA 4XZBA 3JRKA 4AZBA 4J3ZA 2WHMA 1MEIA 1GKQA 2ZXQA 3W25A 1M41A 4WEVX 1JDAA 2BP1A 4LVFA 4JCLA 1IT0A 6XIAA 3VKCA 3BSGA 3PSVA 3W26A 3BVJA 5LA0A 2QAFA 1P0KA 4V28A 2Z1XA 3LM7A 1R7AA 2A7RA 3ORWA 3TAKA 2EQDA 1FH8A 2PRHA 3DGBA 3LN3A 3DFSA 1W5OA 4XB3A 3EWZA 3GC4A 4AWTA 1S2AA 1UCWA 1Q2SA 4KWUA 4CUCA 4JTEA 4KCTA 3ZJ7A 3CZ8A 3TV8A 1JR1A 4PFHA 4XVEA 3EMCA 3U2EA 2WSKA 5E9XA 3GYCA 4G7FA 3DYPA 2EG6A 3C0QA 2YXGA 2CLIA 4FLRA 1XRSA 4HBKA 2DQWA 1EQPA 4HT3A 3L0NA 3VNKA 3QSTA 4LB3A 2F2HA 3DGRA 1GJPA 4ZQPA 5EYWA 1LQ2A 2GQAA 4TX9A 2NLYA 1NOUA 3TMLA 1MW3A 2QPSA 2QCDB 3F7JA 3RLVA 3PZMA 3KBSA 4QG8A 3S4TA 4H6EA 3LPOA 4IMEA 4LU0A 2V0TA 3TR2A 3W2KA 2VGGA 3CEUA 3LYEA 3K8MA 1MQRA 3AISA 2VFIA 1UR1A 4ACZA 2BB0A 1YXCA 2Y24A 3VUSA 3IS4A 4L9YA 1BTMA 3H4XA 3FSTA 1B9ZA 3D3AA 3G77A 4J40A 5FIPA 2FMNA 1TYGA 2GVGA 2ABBA 4LNYA 2QPUA 5CGTA 4PMDA 1LQAA 5EU9A 3PZ9A 3EDJA 2QGYA 4JR5A 2W79A 4KIEA 2HPMA 4TO8A 4MG4A 4Z0JA 5AYBA 5D02A 1K9EA 2O9RA 1OFOA 3LRKA 1S5TA 4K36A 4GYPC 1J4EA 3AZRA 3SEPA 1E6QM 1J2WA 3W7PA 3T1GA 3WLLA 1U1HA 1BQCA 1XQLA 1R9ZA 4FNSA 1ENUA 3O07A 4N4QA 3SRFA 3GK0A 2XTKA 3QGVA 2GLKA 4KGLA 3W37A 3B9OA 4ACYA 3TFXA 1BGGA 4FHAA 3SY8A 1HFBA 4HHPA 2BVYA 3MJMA 3R8HA 4DEFA 5AECA 2V3FA 5DBUA 4HNCA 5D9OA 3GR8A 4AAJA 4EIVA 3EX3A 4ICCX 3W73A 2YA0A 3D5HA 1SSGA 5D2TA 5K3VA 3EOLA 3LV5A 1P0DA 1UUOA 1CNVA 3DZ1A 5BZAA 3KL5A 1TTPA 1SYTA 1E43A 1Z3NA 2GJXA 4O11A 1ZCOA 1ISWA 3M0ZA 3H2CA 2NX1A 4OOUA 1W9PA 2C79A 5C2GA 2QIIA 3GFZA 3IGXA 1DXFA 1RQHA 5AHIA 3W81A 5HJXA 4I9TA 2IUZA 3LCGA 3KE0A 2B7OA 4C7DA 2PTWA 3BJSA 1UUQA 2XH2A 4GUGA 1XIIA 1CXHA 4BZYA 4BHYA 3ME3A 1XIDA 4QQ3A 3W2UA 1M7PA 5AHEA 2CWNA 3PP7A 5FAJA 3GBDA 5EMMA 2H8ZA 2VX6A 3KUMA 4DUWA 5A3HA 4BFAA 3PZTA 1VF8A 2D2OA 2NX9A 2OVLA 1I2RA 2ALDA 4Z2JA 4B5UA 1QNSA 4Q7IA 2ZOXA 1W1A1 4UFMA 1EPVA 1GYLA 3GE7A 4JTTA 4L4LA 3MMWA 2AGTA 3FA5A 3W72A 3B8WA 3ARXA 4P61A 1W1YA 5BU6A 3W1UA 2XWEA 4ZXLA 5LIXX 1T7LA 3UWVA 4FIQA 3CC1A 2BTMA 3FLUA 5CPOA 4FEZA 3WLRA 3IUHA 4I6VA 4IUGA 3S5ZA 4CD8A 4DJED 3VM7A 3TYZA 1VFHA 2HPIA 1XRVA 1OK4A 1EIXA 3NL3A 3TIMA 4HNUA 1W1VA 3LCLA 1XD1A 1DJZA 4AIEA 3KTXA 2VNCA 4MWAA 3HV8A 4RNFA 3A4WA 3V1HA 2WNWA 2IQTA 1SMAA 3OBEA 3SIZA 2OYMA 1FBAA 4HIBA 1NIUA 3F5LA 2BWGA 4X9SA 5KZMA 4XIMA 1KM6A 4S23A 3NVTA 3T2QA 2YW3A 4PMZA 1UH4A 4PB5A 2QYGA 1UA3A 3VZXA 3ZO9A 4LCQA 2ISFA 4HSNA 3AO0A 1I2PA 3BICA 4B5SA 1HKKA 2HSAA 3AQUA 3BZGA 2V6AA 2UZ9A 2JF7A 3VNMA 2Q8XA 4UOQA 4B16A 1RV8A 4WKAA 3SCNA 1BRLB 3S5NA 3UF9A 1E71M 5A8MA 3SGZA 4J3VA 3TH6A 4GGBA 3AWOA 3S0CA 4G6CA 4UTWC 3UJ2A 3ID7A 3W7JA 5FF0A 3T2PA 4XKYA 2G3FA 2PDYA 2RDUA 1UWAA 3LPGA 4W8BA 3IARA 2AQVA 5K7JA 3BTNA 4HPHA 2GJNA 4JIHA 1B3VA 1AUSL 4B3ZA 1EIBA 1PTAA 4FF5A 2CLPA 3EB4A 5D9MA 5LA2A 1HJVA 4S3EA 4B4HA 4NRSA 2PTYA 5A8GA 2UY5A 2J4GA 5FF3A 3M5YA 1GORA 1IWPA 3OLEA 4Q4SA 1PYMA 2QV5A 1CX9A 1AQMA 1PXGA 4DYJA 1YW1A 1Q63A 4QXIA 3POHA 4G5DA 3GTFA 3CUFA 1G01A 3ZS4A 1I0BA 1MVYA 1R3RA 1TB3A 4H7CA 4YWSA 2CZEA 3WLNA 3PBVA 2WC3A 4O14A 3KL3A 4LS1A 1ZBKA 1MO0A 5C9WA 3CH0A 4HU0A 5F2IA 4DUOA 1M01A 5HK4A 4US5D 2P0IA 2RUSA 3SFKA 5IDZA 3MUY1 3TP4A 3M5XA 4HB7A 2P10A 3NQMA 5IM51 4M51A 4LYPA 4PUKA 4FI4A 4LUYA 2V3EA 1B2YA 4HNVA 3U7VA 4MAVA 3RJXA 2JE8A 2PZNA 4GWEA 3H54A 4N6EA 1OCBA 1H41A 3BAJA 1EGVA 2ZA1A 3TEVA 4R53A 2YX0A 3MC5A 1KA9F 4YVXA 3OLDA 3V4BA 1OG0A 2NV2A 1XSIA 3S2LA 4D6GA 1UJPA 1OFBA 1JF5A 4MAZA 3HMJG 4WOQA 3F4CA 4WXYA 4PMOA 3R8GA 2NWSA 3CHFA 4GJ1A 4MKNA 2OX4A 1VP5A 2B7QA 4FO4A 5DELA 1R3SA 3DG7A 3DDMA 5A95A 1KTBA 1OEPA 2JBMA 4F79A 1R8LA 1DWIM 1I4NA 9XIAA 1H09A 1R2SA 4LF2A 1C93A 1VRDA 2VFEA 1DIDA 3WSUA 4HU3A 4QR6A 1UIOA 3MYOA 4F0LA 3ICJA 1IGWA 1QPOA 4PUWA 3RR4A 1NF7A 2QCEA 3GKFA 1K4HA 4K8HA 4CD4A 3B9NA 4JYDA 2UWFA 5A5WA 5C5YA 3NNTA 5AZ0A 4KWSA 2W0UA 1Q13A 3KCJA 4MM1A 1YIXA 4L6DA 2VQTA 5DO8A 4I7WA 3UG8A 3P93A 2QV4A 1FWIC 2VWSA 3BJFA 2A3EA 2YFNA 4OV9A 3UBPC 3TQVA 1VEOA 3T4WA 3U48A 3CO8A 2A3BA 1FTXA 1RA0A 1SZNA 3CV1A 3N9RA 3P3BA 1O1HA 2D20A 3ES8A 1EP2A 1YPIA 1A3HA 2NVAA 3IIOA 4IX2A 2ZUMA 4NQ1A 4HN8A 3WLPA 3E38A 4I5XA 5BW6A 2VFHA 2QCLA 2R14A 3PPHA 5HDRA 2FKPA 1RZMA 5F4WA 3KCOA 1TTQA 2PDKA 4HKPA 4XZLX 3QY8A 1K3UA 2JF6A 5BXTA 5FEPA 3RO6A 2VTFA 3B9EA 1OZQA 3EDDA 3KW3A 3LMYA 5D37A 4EXQA 3T8LA 4C6FA 2H90A 4JHZA 4O4VA 1NFGA 3S42A 1FQ0A 1NVMA 3CUIA 3U4FA 4E8CA 1K7FA 1M53A 2ZZ5A 5JIPA 5FJPA 4FNRA 4AD0A 1FKWA 3RHGA 4R5EA 3BARA 3PBGA 1MRAA 3OGSA 4HZMA 2OSXA 2EG8A 2H3DA 3W7OA 1H7OA 5C9UA 3HQ1A 3STEA 4DJDA 1B4EA 3IJ6A 5I6SA 2NWRA 3QV9A 2A3LA 4WKHA 8CGTA 5DN1A 3VIKA 1R87A 2F8QA 5FJIA 3ZYZA 4FOUA 5A6KA 2ZVIA 1UMLA 3C3UA 1WQ5A 1XLMA 4IPJA 1LRQA 3IVSA 3QYSA 2XIMA 1KO0A 5FOOA 3CV6A 2NT0A 3CZGA 4IIHA 1S39A 3VA8A 1E1FA 2VRKA 2IPGA 3I7QA 4DJEC 2DFAA 4AD3A 5HPCA 3AIUA 4EAYA 2PRMA 1EZWA 4JTHA 3LENA 3NIYA 3LBOA 3M64A 2VYOA 1CGYA 3NWRA 1X39A 3R1ZA 4BQ5A 2OCZA 3G1VA 3EA2A 2CLKA 3S47A 3MUAA 2YZ5A 3A21A 1Y5WA 2DZXA 4AC7C 1VCFA 4QS6A 5AYXA 3VNIA 1A5AA 4XTIA 1I2NA 3CQHA 4QFUA 4LC6A 5E09A 3S1XA 1VPYA 2Y5SA 1H63A 1SFJA 1JZ3A 4W85A 2CFFA 1XI3A 3W85A 1KR1A 1S2WA 4DNMA 3M41A 3GAKA 4E2OA 8XIMA 3P81A 3C56A 3L7RA 1GQIA 3UZYA 1KFEA 2VX7A 3S83A 5C2XA 2TRSA 2GSHA 3WQCA 4ADSA 2Z2UA 1LORA 1QHOA 5A94A 5M03A 4X22A 1NP0A 3KX6A 3MO7A 5DCBA 5JQ9A 1ML1A 1W9VA 4U2ZA 5JIWA 4UTFA 3VCCA 5AVHA 4HPGA 1KV8A 3TXZA 4NL1A 1SJAA 3N4EA 5A6BA 1B3ZA 3P8JA 3TCEA 2VZVA 1KLZA 1MEHA 1QWGA 1DJHA 3KS5A 4R27A 1R2TA 1F3WA 1LJYA 1WE5A 4B5TA 3WD3A 1G6CA 1EWDA 1DHKA 2YPIA 3GIYA 4US6A 2XM2A 1IZCA 3GXMA 2W92A 4MJ2A 3CIXA 3OHMB 4PULA 2GJLA 1X98A 3CNYA 1H7WA 4C6LA 1LWHA 3IJQA 1JEZA 1R3WA 2Z00A 2PGFA 3MDUA 1CGUA 4NI8A 4C6BA 2VOMA 3M46A 4MJ4A 3G8EA 1Q7QA 3TLLA 4EVZA 3FOKA 4PUJA 3WH5A 4LV4A 4BF9A 4WQ6A 4DUXA 3EKGA 5AB3A 2VUYA 4L5ZA 2V68A 2XYLA 2PMQA 3WCZA 1F3EA 2DGAA 1HNYA 1RPKA 3G3MA 2EAWA 2VFFA 4GUIA 4W86A 5FF7A 3CIWA 4GZJA 4A2SA 2ZZ3A 5KETA 2EJ1A 5AHMA 4XUYA 3WFLA 4Y8EA 2BHZA 3ZJKA 1IEWA 5LIKX 2ZCGA 3ABZA 1YADA 4Q4MA 4PMUA 3KOFA 2PTXA 3LCWA 3W1XA 5I23A 2W6RA 4XAFA 1NU5A 3LS9A 1QBAA 2CLMA 2Y5EA 5IDIA 1NDYA 2WLYA 4DO4A 3DESA 2V5JA 2WWDA 2ZE0A 1U1UA 2QDHA 3W1AA 5DLCA 3ZM8A 3PG8A 3TSDA 1F74A 1JZ7A 1RP8A 3SCQA 3EYPA 1OX4B 3B4UA 5EBUA 3QMSA 2A79A 1D3HA 4NYUA 3VGFA 3GC2A 2CLHA 3DBNA 5CZKA 1VFFA 2R1KA 4LPCA 5M2FX 1GEQA 4PCSA 1UWQA 1VENA 2ZUUA 3PF3A 2VVNA 5CPQA 1CXLA 3TC7A 4QLKA 3SUTA 1QO2A 2C91A 2HROA 1KLYA 1UP3A 1VFLA 2FJKA 4P7LA 1MDRA 3CT7A 4NZ4A 4PGLA 3A64A 3NZPA 4YPJA 3FJNA 4AISA 1EB3A 3JZEA 1GZ1A 2R1MA 4CCEA 1KRBC 4UZUA 1KRCC 3KVJA 1W54A 1K8CA 4B9ZA 1JVNA 2W61A 1W3JA 1FCBA 4XZ9A 3PTQA 4Z1CA 3HG2A 3VKKA 4PMVA 4MB3A 4DNHA 2X40A 1DVJA 3CUHA 3SGGA 2DW7A 4MWAE 3C86A 2FB2A 3NQDA 1G7UA 2GDQA 5LSMA 2BLEA 4GO9A 1TWSA 3TWAA 4Y7EA 1JYWA 3PUEA 1DXIA 1EJ7L 4AMAA 2OO6A 5FACA 5CJ5A 4LB4A 1E4LA 2PP1A 1QR7A 2ZX6A 3CL6A 1JZ5A 1YE4A 3VU2A 4IMGA 1PVNA 2QF8A 4MDPA 2NZLA 3NUKA 1LLWA 2D3LA 3QH2A 2PA6A 3QZEA 4X9YA 3FNDA 2TAAA 3QHNA 1K70A 3B8UA 5LGXA 2VGFA 3D6NA 3GUGA 1XIGA 4PH6A 4R85A 1B4KA 2XFFA 3BAXA 3WEZA 5C54A 3HJEA 2VFGA 4M6UA 4Q8TA 2V82A 1OCQA 1WZKA 2DJLA 3S1VA 1ZTVA 2VUNA 3WLIA 4H41A 3ZQ9A 1W9DM 2F7FA 2HVMA 4EPBC 4HCLA 4HSHA 4HA1A 4OBSA 4AXNA 4YIWA 3P7YA 3BGJA 1BXCA 1UWRA 1XR2A 4PTXA 1L6YA 1JGIA 1YHTA 2A85A 3PZIA 1ODZA 3BG3A 2MNRA 1C92A 4A3YA 3CAVA 3NSNA 1OC7A 4LYQA 4P7QA 3E5BA 2J9XA 1UWIA 3TN4A 2ZQ0A 4HU8A 4G2DA 3VO0A 3FDKA 5AY7A 4INFA 1UW9A 1XP3A 2PF8A 2DU2A 2DZAA 4DWSC 3RM8A 3VK5A 4AIUA 4MGGA 3Q58A 3E02A 2TODA 3VOIA 1E55A 3WLMA 1FWAC 4BY3A 1WCGA 1WBJA 3EKLA 1CLKA 4GBUA 1EUNA 3MW7A 4I7UA 3KP1A 5E70A 2A1YA 1EJVC 1VZWA 1HP5A 3S5YA 4KQNA 4M82A 1U1JA 2F6KA 2FZNA 1IHIA 3S46A 1XLGA 1Q8AA 3C2FA 2QCCA 3NPXA 1C7TA 3HQNA 2ATMA 5DY2A 4H2CA 1GWJA 5G5IA 1GVOA 1VHCA 2WJDA 1XRTA 4PCFA 3BK0A 1V6TA 1J6OA 3H7VA 3IAPA 5HQLA 3P14A 5FJJA 2W66A 3R12A 1J0YA 4TVCA 4O1BA 4GIAA 4A3QA 1FWRA 1VAHA 3MVTA 1T40A 3GWQA 1WZAA 5I03A 5ABFB 3UR5A 2A3HA 3P5YA 3WBEA 1WP6A 1LBLA 2FPYA 1WO2A 1GVQA 2IPFA 3WY1A 3WNMA 2PU0A 4IPNB 3QOMA 1Q5MA 2VURA 1E1CB 4W88A 4YVPA 4Q4RA 4Q7NA 3CZEA 5E0FA 3PJUA 5A6LA 4A05A 2C1IA 3R7MA 5E1QA 3PSWA 1BFNA 2OOGA 1EBGA 1Z6KA 4MSSA 2PAJA 1Y65A 4HVXA 3CV7A 3TYUA 4JY9A 2I57A 1O7AA 3GG1A 5REQB 3WQ5A 1QW9A 3VVGA 3CHEA 4E2BA 2WCSA 4GX8A 1TKKA 1XPYA 1NFBA 3G6MA 4ADUA 3QM3A 2J88A 4JFTA 3AMKA 2E9LA 4GFSA 2FTWA 1OC6A 3M0YA 2QQ6A 4CQDA 1HJSA 4A22A 1G94A 3NCOA 5GNXA 2RFGA 2J8TA 1XLBA 1BEUA 1UD8A 4RPQA 3QF0A 1HO4A 5CLTA 4ZQNA 3KTCA 3VTRA 4F2UA 4C60A 3UG4A 4YWIA 3DFNA 1PWLA 2A4AA 2OMAA 3E1F1 3HU7A 2HMCA 3CV2A 3P0XA 5DF0A 2PBGA 1W1TA 1XBVA 2FHCA 1QWKA 4E2VA 3W70A 5HR6A 3STCA 1CGVA 3TW9A 4LBSA 4ZGYA 1S2CA 1VH7A 1I8JA 3GSMA 1XFBA 1UZ1A 4D6HA 3T08A 2NV1A 2YDSA 1W3NA 5CH9A 4GQQA 1IV8A 1RUSA 1BYBA 4N6FA 1VC4A 1HJWA 1NP2A 2ZICA 4TU1A 4ZFMA 1KFCA 3MCNA 2NXGA 3EXRA 3QHMA 4E3TA 1Z7AA 4BS0A 1LP6A 4LVGA 1WB0A 2WKLA 1TIMA 3W83A 4WXZA 3P6LA 4XBSA 1V93A 1UUMA 2WM0A 3B03A 4QROA 4LBRA 4XSLA 5TNVA 2YB1A 4PUEA 2KX9A 4ILSA 1FOBA 4YXGA 1QFEA 3EX1A 1IXOA 5RUBA 1XLAA 5CZ0A 1UMYA 1ZUAX 3F4VA 2B0MA 4FP1A 1QPRA 1I9CB 2XH4A 4AZHA 4RZ4A 3U5UA 3KZPA 5DXYA 4HA3A 1VBGA 2VX5A 3L4XA 3FYPA 3C2OA 3B9DA 2Z2BA 1TMQA 2WMGA 3QQ1A 4IQLA 1OY0A 5D38A 4H01A 2R1PA 4BI5A 4IZGA 3T0DA 1I6NA 1B9BA 1OIFA 4PEKA 2E09A 4W4QA 4GJJA 4GQGA 1XW8A 4US5A 3WL0A 4QDWA 2YXXA 2IS7A 4JQ2A 4HNTA 2JGQA 3T0AA 3N4AA 1XGZA 1P7TA 3BSMA 4OQVA 1N82A 3TN5A 3R0DA 3G0SA 1KCXA 3COTA 4AIBA 3WF3A 5E6ZA 1EP1A 4P8VA 1PAMA 1F6PA 3YPIA 1IYXA 4WVXA 1N8IA 2FZDA 4I9JA 3CK5A 1KXQA 3P74A 1BXNA 3PZNA 3LCXA 4FA3A 5DMYA 2AL2A 2PGWA 4Q4OA 4B92A 4AVFA 2IPJA 2XIQA 1FRBA 4IFKB 5EFFA 3B0YA 5H8MA 1E51A 1BLIA 4I6KA 3GAYA 5AC8A 1VBJA 4I7VA 5JBFA 3UU0A 3SJNA 3AXMA 1V0KA 2XSAA 2CBIA 5FEXA 3TOYA 4H8NA 2PDWA 3HIJA 1JCJA 2PWHA 1MW0A 5BROA 4M5PA 3VOJA 2DDXA 3WQPA 3LTYA 4CU6A 4IXHA 4UTTA 3TSMA 4S3CA 1J5SA 3M44A 1GOKA 4MFEA 1W91A 4U33A 1EOMA 4Q6JA 4EPEC 4ICMA 4NZFA 4KCWA 4RKAA 3SCPA 3LM3A 4C6PA 2ZUTA 1KQZA 4M3PA 3QC0A 4JNMA 2D0GA 3AUJA 1PDZA 3W7KA 1Q7MA 3TYBA 3FVMA 3R8RA 2A7NA 3U8GA 1FWSA 3NAVA 4L65A 1JUKA 2HRWA 5I24A 1XLHA 4UMCA 3LBCA 1ZAJA 3PHAA 3ALFA 4YJ5A 4FX7A 4HCHA 3W7DA 2Q09A 4AMCA 4RNIA 4ZOCA 1HKWA 3N34A 2XINA 3W7LA 2ICSA 5FL0A 1JUBA 4GXMA 4KMQA 3V7PA 3JZUA 1FWNA 1KBBA 2RHGA 4C7GA 4JTAA 4WUIA 1TO3A 2GVEA 1EP3A 3RPDA 3GU2A 1OD8A 5HUPA 1JJKA 3L2LA 3MJYA 4D71A 3ZLGA 4LBUA 1DWHM 1ZAIA 1QI2A 4NZ3A 4H1ZA 3G2GA 2ADAA 1TA3B 4G1KA 3VZYA 1S3TC 4GG9A 2GJXB 5CPTA 1FXQA 2AAMA 3M7SA 4JTRA 4A3UA 3DYMA 2H8XA 2O7SA 2OT1A 2QIWA 3W7HA 4HNLA 3FYYA 1H50A 3HPFA 2ZUVA 1UH2A 2QJGA 4G56A 4RX0A 3TA6A 4EWJA 3E96A 3FGCA 3P62A 1IWAA 1XIHA 4GZ7A 3FXYA 3BLOA 2QLYA 4I9MA 4KRTA 3VOGA 4R7OA 1A0CA 4CGTA 2NVCA 4IQDA 3BCJA 3C4UA 1ADSA 3A13A 3W0KA 2VO5A 1EC8A 1RBLA 1ISVA 4UTTC 1DIOA 5CPSA 4D8AA 4FS9A 3VKBA 1TX0A 3WQFA 3MB9A 2ZTKA 4W8LA 3TTEA 1K8XA 3DG6A 3N3MA 1V79A 1CI1A 1PWMA 2HTMA 2VL4A 4OZOA 1M7XA 1Q65A 1S1PA 2ANUA 3NEHA 4TXEA 1J96A 2GDUA 2HCVA 5MKGA 2CC0A 3EA3A 1QASA 2OWXA 4MY9A 4LAOA 3RM9A 3IJLA 1U5HA 2VEIA 2REQB 4AD4A 3KEHA 3SY1A 1RK6A 4UUIA 1XIFA 1WDPA 4IM4A 2C8NA 3M0JA 4GH1A 4L7ZA 3C3NA 5IFPA 1C8XA 4HYWA 1LRTA 1LROA 3UJEA 3U9IA 2E5DA 4HJWA 2J25A 3CB3A 4O16A 1Q4NX 3UQNA 2BSLA 2OXNA 3EX2A 3N19B 3N2CA 4M7SA 4F3HA 4XD4A 4QSHA 3KVMA 4YHEA 5F1VA 3AC0A 3AMLA 3RGTA 1QW8A 4LEQA 4K1GA 3GZ3A 4J3XA 4A8IA 3LUTA 3IJ9A 3AIQA 3KHDA 2C13A 2INEA 2PB1A 3PM6A 2X09A 3VDBA 4PUUA 3E0WA 1S46A 3TZNA 1XYBA 3GRIA 4IMCA 1UR2A 3QR3A 1TQXA 2BDQA 4HHHA 1DWAM 4Z2GA 1G1YA 1U33A 2ZUNA 1E5JA 4LC8A 1R5YA 4LCSA 3BLFA 1ALDA 4LF1A 4WHBA 4CN1A 4QSFA 3WDPP 2Y7FA 4DHGA 1GVSA 2V3GA 3NPVA 1IEVA 1SW7A 1BWLA 1M7OA 1PKLA 2GOKA 2R94A 3FAXA 3W07A 4RXGA 1OSEA 4CNSA 3UW6A 1P5BA 4XK2A 1W32A 4FLOA 2FQIA 4XVDA 3PBYA 1J18A 4JFSA 3CT2A 1VJIA 4C91A 3WLJA 8RUCA 4AEOA 1L0PA 3BANA 4LXFA 1MEWA 1XPGA 2PTZA 1FA2A 2XIOA 5FSEC 1EZ2A 1OCNA 1QVBA 4KH2A 3HN3A 3R89A 2J9ZA 2VR4A 1A3XA 3EPOA 4KRUA 1H7NA 1LBMA 3EBVA 2WMIB 1EJTC 3VIHA 5I07A 3GDMA 1YXDA 4CQ9A 3GR7A 3WD1A 4FSAA 4PSPA 2ACRA 5CAHA 1XSJA 1S5VA 3OB8A 1EJXC 3HG4A 4N4PA 1K9DA 2FB3A 2PPGA 3ZFHA 1PIFA 2DH3A 2I9UA 5LXEA 4FF7A 5C6MA 4GKLA 4GCAA 3R11A 4CD7A 3MPGA 5TIMA 1DWGM 4E5TA 4EF8A 3LGDA 4E3VA 2W67A 4BF5A 4PC8A 1XDLA 4O17A 3W88A 1PCWA 3GX9A 2FMOA 1IXQA 1WUEA 3RPMA 1B3XA 2PDBA 4AZCB 1PPIA 4OV4A 1L6WA 2WQPA 4ZO9A 3MMTA 2QMKA 3UVAA 1RR2A 4GKTA 1XQKA 4JX4A 5TAOA 7TIMA 1EDTA 3RLHA 3R6IA 4LUJA 1GT8A 4S3JA 3B8TA 3W02A 2EPMX 2WK2A 4DVOA 3F1QA 3VIPA 5FESA 1L9WA 3SBFA 2J74A 2NQ5A 1BYAA 2E6DA 5T26A 3KTSA 1PZ2A 4PBEA 4XZWA 4O13A 1MZRA 4CVWA 1PZ3A 3PPCA 4C6KA 2WZMA 1W3IA 3E49A 5FJRA 3W01A 3H2NA 2QKFA 3WUBA 1SJBA 4V15A 1MUWA 2PODA 3L23A 4UCFA 2EO7A 3C8NA 4YCPA 1QRQA 2POTA 4MVAA 1LWIA 1K7XA 1GHSA 4KWOA 1Z44A 3PBUA 3EOUA 1K03A 4U3CA 5AKQA 3ARWA 4E0CA 3FSUA 2E1WA 4QG9A 3CU2A 1F07A 4QJ4B 3DFTA 3CO4A 4PMYA 4CEXC 1BYCA 2CLFA 3N6QA 1DWFM 5CC7A 3LCFA 4TX6A 1TREA 4F48A 1PO9A 1AQ0A 2WZEA 1EEXA 2WMHA 2PFHA 2OLHA 2E9MA 3MI6A 1J93A 2YL5A 1V6VA 2A6NA 2VEFA 5AC5A 2WSPA 1FDYA 3USZA 2G96A 1GW1A 4JS3A 1PX8A 1HL9A 2NVDA 9CGTA 4J9JA 2IW0A 1A4MA 4W7WA 1Q6QA 1YPXA 3GC5A 2OG9A 4CU7A 2EPHA 4UTHA 1EPXA 5IHSA 2YDAA 2ZFAA 2TMDA 4DO6A 1J0IA 2TSYA 3OTRA 4XD6A 1GOIA 3BAWA 1ADOA 4CNTA 3SUSA 3SCRA 3EXTA 3W1PA 4ONVA 2AKZA 2BVTA 1XICA 2UY2A 4Z1AA 4G7EB 1DQXA 3PNZA 4UTLA 4QLJA 4S1FA 3BW4A 4IGHA 3KBMA 1TVPA 4DBEA 2Z6JA 4ZTYA 3GH4A 1VFTA 3WMCA 4QJ3B 4UTMA 3VD9A 1UR9A 1LTDA 3RITA 3CL7A 4C6EA 1GHRA 7ODCA 1IWBA 3NXLA 5I2UA 1IQ8A 2ZC1A 2YJQA 4JFWA 3S2MA 2J79A 2A3AA 4GOAA 4ORMA 5BRPA 3ITOA 2G97A 1DYSA 5DX7A 2F6XA 3NGFA 3NA8A 4ZCWA 4N02A 3IK4A 4UOZA 2PDCA 2WOQA 3GU9A 3LBMA 3L5LA 2PU1A 4RV8A 1T0OA 3PJXA 1M03A 3WYZA 1J2BA 1AZ1A 1VYSX 2C3ZA 4RZ5A 1VKFA 2EKCA 2CZFA 1M6JA 4DUVA 4NASA 3EDFA 4R34A 3VX1A 3N73A 1LOQA 2PRLA 2J47A 1GVEA 2FHBA 3B06A 4BCEA 1JIBA 3QR0A 2NT1A 4L6HA 5D8ZA 3BGGA 3MS8A 4GUFA 2Z25A 3VAVA 1V03A 3NZRA 5I3GA 2YCEA 3W2LA 1VBHA 1UROA 4DQWA 3N29A 4ZVJA 5KSWA 2CZVA 2I5GA 4Q6XA 2V5DA 2OSYA 2GUUA 1RY0A 4AY8A 3GDLA 3A9IA 2W62A 5EY5A 4ZODA 4F66A 3GTIA 2VD8A 1TV7A 2QMJA 1R86A 3UP8A 5CPNA 4MF4A 3UY7A 4O53A 1JUEA 5C71A 1O5XA 1XYLA 4FALA 4FZIA 1AL7A 3SN1A 3SW6A 2YW4A 1GQLA 4DBWA 2OQHA 3VGEA 3M4HA 2QCFA 3A3XA 1JD7A 3H53A 2CHNA 2FPVA 4HNOA 4GI6A 3GHSA 4UIOA 3HA1A 6TAAA 3C0LA 1F2JA 1TPWA 3MU7A 1VBUA 3GTNA 5GQBA 3SFWA 4UQAA 4U31A 3HM7A 4NJHA 3LHYA 1US2A 1ONRA 4LUSA 4UQBA 1V3JA 4ZZ9A 2YSWA 1TMHA 5GPRA 4IHCA 4RPPA 4KCUA 4MLJA 1WOAA 3ONCA 4LVBA 4M29A 2P76A 3E0LA 3MMUA 2ZDRA 3H24A 1K6AA 4XWUA 2GSJA 2I5IA 2BVDA 3CUXA 4DWSD 3O7UA 1XDMA 1KGUA 1T8QA 1IXNA 2R82A 4JFUA 4TTGA 1M04A 2FLIA 2GGJA 4DELA 4DN1A 3W28A 3DUGA 3VE7A 3TX9A 1JZ8A 1WDDA 3NO5A 4XKMA 1W1IE 3GVVA 4PUDA 1EBHA 4C6DA 3QPYA 4AZ6A 2VEKA 1V0LA 1TMLA 3KFTA 3NOEA 3XIMA 4BEQA 4PB3A 1LCOA 3D46A 1AVAA 5F2MA 1AG1O 3RLUA 1E1CA 3UWQA 2O0TA 4XZNX 1W31A 1R0MA 4GHRA 3WG6A 3NPUA 4Z1BA 5I3IA 1ZL1A 3GXDA 1FHVA 1J11A 2V67A 3CIVA 3IJ7A 4O18A 3LPFA 1VLWA 3LNPA 1QJWA 4ML4A 4H19A 3ZIZA 1H0GA 2NXIA 3QRHA 1UZDA 4H9TA 3GS6A 2EGZA 1XH0A 4GVGA 4LRSA 5J5RA 3BWWA 5AVNA 3NQ8A 5I3DA 2VGIA 3VZZA 1AH0A 1CB2A 2ZWYA 1HGYA 3H21A 3T0CA 3CHVA 2OQLA 3GVRA 1QDSA 2ZRXA 1YPFA 2ZZ6A 3UWWA 4DBUA 4JKLA 1MSSA 3QLDA 5AC6A 1NJJA 4GY7A 2VENA 4WGHA 3LGEA 1GQKA 3GZAA 1GG1A 3BL3A 4IIDA 2PWFA 3SQSA 2DIJA 4UFHA 4JY8A 4CNOA 4E8DA 3W7NA 3R94A 2UY4A 1J0ZA 4JIEA 5C9ZA 4WF7A 3UVIA 5CZTA 1V51A 3VI2A 3H6OA 1WDRA 3A4XA 5KZ6A 2FZBA 2J7HA 3LA4A 4GI8A 4E8GA 3G1XA 1LL4A 2OT0A 4HOZA 3JW7A 4MWAB 1L2UA 4C7FA 4UBPC 2G3MA 3OHIA 3SSJA 4MPQA 3S6OA 1ZJHA 2H9AB 2J75A 1P6CA 2YL9A 2X1UA 4GQ0A 2J7EA 3PG9A 3W1QA 2WVUA 1YDOA 1JXKA 2CIPA 1UG6A 1Y5XA 4AYSA 3VILA 3EDKA 3L12A 1J8VA 4GACA 4JYEA 3UWUA 9RUBA 4F4RA 2X0YA 1SFLA 3VIIA 2PGRA 2XG9A 4XG1A 1MFVA 1JAEA 3WDQA 1ZBCA 4KESA 3NQBA 3U2CA 4BQ3A 3OIXA 3UG3A 4GNKB 3WK2A 2QGHA 1TV4A 4LCRA 1KFJA 1UJQA 2UBPC 1KRMA 1VGAA 1QOPA 1EEPA 3DXIA 2J7GA 1W2VA 2J62A 3M43A 4FB7A 2D3NA 4W89A 1SFTA 1VPXA 4O0KA 3SRDA 2BX7A 2WHKA 3WUGA 3O6CA 2JK2A 1DBTA 3DFPA 5E5CA 2X0HA 3U0HA 3T78A 2Y7GA 4UR7A 1Y8BA 1E0UA 4A8LA 1FWTA 1AD1A 2Y89A 4W87A 3Q65A 3W7MA 4H9UA 3WK3A 1LLOA 3LG3A 1UWTA 3SRHA 4QS5A 1LOSA 4Z2HA 4JYFA 3QXBA 2OODA 3TYAA 1W3LA 5A6AA 1Q6DA 1QUMA 1FUYA 4LVAA 4H3DA 4QEEA 4B5VA 3P60A 3KLKA 4A3HA 1ZY9A 4GY0A 3A9BA 4W8AA 4LOCA 4NY2A 3R4IA 5I78A 3EWUA 2FFCA 4EOUA 5LIYX 3ERPA 5DRIA 3GDTA 5C0QA 4YTQA 4ZENA 4NI3A 1VCGA 4S2BA 4M6VA 3KM8A 1JFXA 1BSLA 4OUEA 2R91A 4GE8A 5TF0A 1W5NA 3MKKA 2ZUWA 1SZGA 3V5OA 3WFAA 4PTNA 3PWAA 2YA2A 1AMKA 3FKRA 1MXGA 3USBA 1QNRA 5E0CA 3WF2A 4XBJA 3E0VA 2C1GA 3CB8A 4JTUA 2Z0IA 3TJIA 4MZ1A 5A8NA 4ROPA 4UTUA 4DJEA 4JCMA 2NSOA 4PL1A 1P1XA 2DVTA 2ZXAA 3U2ZA 4PBFA 3H22A 4DO7A 4PRWA 1F8MA 1GQNA 4CU8A 1KM5A 1GOOA 1P1MA 2CBVA 1A5CA 4M19A 1RAKA 3DENA 3DAQA 1HO1A 4JEQA 2ZZ7A 1WDQA 1XD0A 3TW6A 3OG3A 1V3HA 2X2YA 2WMKA 4W84A 3WJXA 3M0IA 1SZRA 1Q6CA 3HGSA 2J8FA 4UOJA 1NWTA 4JDBA 2BGQA 2YCKX 6XIMA 4DLFA 4JXCA 3P61A 4U28A 4JIPA 3V0TA 4GGHA 1HVQA 2Y6ZA 4BQ4A 3E2RA 3M1ZA 1G69A 2KZHA 1LT7A 1HL2A 1D7FA 4PTMA 5F7UA 2AQOA 4UR9A 3R43A 4FXFA 3VABA 1D2KA 3LLXA 1RK5A 5KITA 4BI7A 1W8SA 1KCKA 3EWXA 1W1ZA 1I1XA 1E9YB 3L68A 2CERA 1TSIA 2ABAA 5DMLA 4MLRA 2J6XA 1KQYA 3BLPX 2HE8A 2VP8A 5HXMA 1XLLA 1TZ9A 4HYRA 2I5QA 3MHFA 3RYSA 3RF9A 4PMQA 2BOGX 2XVNA 1KKOA 2OWWA 4FAMA 1QI3A 3L4TA 3WD0A 1QXLA 2O4QA 3FY1A 2V2HA 3QGAC 4GCXA 1GZJA 1RA5A 4JL1A 5DFAA 4HPNA 1OF8A 3EWDA 2DVUA 3UWZA 2Y0FA 3FYOA 3JUGA 3MUCA 1X97A 3NYDA 2D69A 2R24A 4ENLA 1YTKA 5H2ZA 1N2VA 1L6GA 3ARZA 2D2HA 4UQCA 3DHDA 2NQJA 4C5YA 1HW6A 1JAKA 4J3WA 3LMZA 4RW5A 3URBA 2GUYA 3TE9A 1E6SM 3MI2A 4TV6A 2PC8A 2ZRWA 4IPPA 1TFVA 4HZ8A 1RH9A 4TUFA 5DEZA 4CN6A 5HAOA 2QJMA 3N12A 4H4IA 2JKAA 1LDCA 5DANA 1FDZA 1NQ6A 3FKKA 5BOEA 1YTDA 2XDFA 3RR1A 5MKGB 5CXPA 3VNZA 2OZ3A 3IJDA 1A5UA 3VCRA 1QMLA 3DI0A 1VBRA 2DEPA 2GSEA 3ZJ6A 3K4WA 2R9RA 1AW1A 4R88A 3UJRA 1LM1A 4K8EA 3H7UA 3DOPA 3WJYA 3FAWA 2I1OA 5J5DA 3POCA 2X7WA 1KW1A 2JIWA 3FJ6A 4GIYA 2O56A 4DBSA 1FHDA 3R5EA 5XIMA 3SQMA 4J7RA 4HQVA 2YL8A 2X05A 1JFHA 2P53A 2WM1A 3NQGA 1WZMA 1A4LA 3VC6A 2G50A 2E8YA 5HMFA 4O10A 1UBPC 2J77A 2QDDA 3OVGA 4AY1A 3G24A 1CW2A 1F76A 1FXPA 1ZP4A 5HANA 5XIAA 2QULA 3E0FA 1JL8A 4PCNA 2Y4SA 3VFLA 2YZRA 3PWIA 2XN0A 5AN7A 1H62A 4F0SA 3LSCA 4LUSB 1V3LA 3K4AA 3TFCA 4MYAA 1ONWA 2WC4A 3LSBA 4GQBA 2Z4GA 1O5QA 3MBDA 5FF2A 1XYAA 5GJNA 4LS2A 2G3IA 2EF9A 1LF1A 1OFDA 4WLCA 4V2XA 4HPJA 3W6YA 1XRFA 3RCNA 1HIZA 1WKFA 4D6EA 3N13A 3GTXA 4UR8A 3C5QA 3AJ7A 3MKCA 4ECLA 3AHXA 5F4XA 2DT2A 3VDGA 5KTLA 3FXGA 1SO5A 4S39A 4KIRA 1POJA 3GVWA 1ZAHA 3V5CA 1TR1A 3HOJA 2Q8LA 3C6CA 3VDCA 3PUOA 5DCEA 3GVQA 4IMDA 5A6BD 1RD5A 2D24A 1XCFA 3ITYA 1F8IA 4Y2WA 1H49A 3LQGA 4OWGA 3I65A 1BF2A 3GLCA 2W27A 3ZT6A 1Q8JA 2GDVA 4L80A 3THCA 4F2BA 4EXAA 1A80A 4LY8A 1QPKA 4KFOA 1P6BA 5PTDA 4H2HA 4D2JA 1XYZA 2CW6A 1ECEA 3EEZA 3FHQA 2G5WA 2OR2A 3WH7A 2AGKA 3G8RA 1E6NA 4AQLA 5AYZA 2WZIA 4DZ5A 3E2QA 1JG9A 2E7FA 4OJYA 1XX1A 4HJFA 4XD5A 3WK1A 4M81A 3ITLA 2XSXA 1YBQB 4MY8A 4BQ2A 3BSHA 1UR4A 4YN5A 4RCXA 3VCNA 5CSRA 5LXXA 3DFQA 1QNOA 4MMWA 1CB7B 3M0VA 3LTSA 1VRXA 4S3DA 4CQAA 2DSKA 4S2CA 1KM3A 4EWND 2LLEA 4MIMA 1ZGDA 1RY8A 4UQEA 2OEJA 2QDGA 2VGBA 3S3GA 1V0MA 4BR1A 3F5KA 2GVLA 5D9PA 3R58A 4WDTA 1UQZA 2OGYA 2PDGA 2V2CA 3HG3A 4HK5A 4RK8A 3UCQA 3S9ZA 3AMCA 2EPOA 2QCGA 1LQ0A 3PBWA 4AVNA 1G0CA 1C8QA 2Y88A 4NP7A 5ABFA 3UA3A 1KGXA 1VPQA 1XF0A 1QOXA 1I0DA 1XC4A 2Z1KA 4KRZA 3SI9A 4PE8A 1WAWA 1N55A 3WF1A 1J0HA 3DKLA 3MO4A 4NNCA 1D8CA 2F61A 2WAGA 3SCSA 4ZEPA 3U3HA 1R3YA 3E0IA 1GQJA 4M1BA 4L6OA 1FWFC 3OZMA 1V4YA 2DZPA 4ATDA 4ERAA 1YXYA 5CZSA 3UESA 3HPSA 4DF2A 4IX0A 3EWYA 3SCWA 2D22A 3QYQA 5CZJA 2DSZA 4P5UA 4OOZA 3N2OA 1I60A 4GISA 2I56A 4JKKA 1C9DA 1JCNA 4IGNA 4IIBA 3VOFA 4S3KA 4PA8A 1TTJA 3O0KA 4WY0B 2QVNA 1UR0A 2AQWA 3CBWA 4Y90A 2FDMA 3CJPA 3EAUA 4AXKA 1KBLA 4O1DA 3OBKA 3QN3A 2VZOA 1TCDA 3TYCA 2HQAA 3RCMA 3QZ6A 4M6PA 3NQFA 2EJAA 5C9XA 4KFNA 3LY0A 4L1GA 3WBAA 4PSRA 3WD4A 3QLLA 3FDGA 4R7JA 2XUCA 3OGVA 3AU6A 3JR2A 2VZUA 4N7QA 2CESA 5K2ZA 1ISZA 3OJGA 3GHRA 2XGBA 4A29A 2NQ9A 3AHZA 1J10A 3PAJA 1UB3A 1UKSA 1XUZA 1EHAA 3HB9A 3IVTA 5KEZA 3MTWA 1ICPA 3VD7A 2OGJA 1GEHA 3MP3A 1JYNA 2J8GA 4FOJA 1JXJA 4JX6A 4TQTA 1W3KA 3CZLA 4XAYA 2Y61A 2WPBA 3GKAA 3WUFA 2QJJA 3AS0A 3A22A 3OQEA 2REQA 2YFOA 1JD9A 2ZX9A 5D30A 1E72M 3S2CA 4ZO8A 2ACUA 1WOBA 4DJFA 1MRQA 2B81A 2IQDA 3M0KA 4W7UA 2A3CA 2IKHA 3B8IA 3D3FA 3V18A 2QUTA 1PKNA 1QTWA 2VRJA 3WNLA 3MSDA 1FDJA 2PSNA 5C9RA 2NQHA 3CWHA 2GVJA 3O8AA 4NX0A 3PZUA 3ALGA 4XKYB 1HJQA 3IV8A 3A4JA 1QK2A 1H61A 3VMNA 4AFYA 1KNWA 3ZVHB 4H83A 2WW5A 4IUOA 3BE7A 1JPKA 5HR7A 4Q8OA 3VINA 3OZOA 1OX4A 1FFRA 1MXSA 2XVKA 8A3HA 3AIVA 4S38A 3MV01 3NG3A 1GUVA 7XIMA 1E15A 1S2TA 3E9AA 3NOYA 5LNUA 2VZTA 4EAMA 3SM0A 1X96A 4PTVA 4QNEA 3L5MA 1OGBA 1SQ7A 2P8BA 3MDWA 4C65A 1NWSA 3WJZA 3SN0A 2RGLA 5T91A 2ZIDA 3SDOA 4MWAD 2DSVA 3QQ0A 3W87A 4O54A 3VMOA 1QAPA 5BOFA 3NSMA 1OHLA 3RG6A 2ZE3A 3K13A 4KBXA 4RR4A 2OZ0A 3F2DA 3GNOA 4DF1A 3IJIA 1W3TA 3LI0A 1HG3A 4TTUA 1FCQA 5I5RA 1JZ2A 4NILA 1UD5A 4LTSA 1AQHA 3P84A 1TPC1 2PLKA 3IAQA 4YLWA 3SCOA 2WVSA 1QI0A 2W5FA 3R2GA 3APYA 4HU4A 3QBUA 4B91A 1E6ZA 5KZDA 4IP4A 4QNWA 3U7BA 1TPVA 1WYIA 3OBAA 4JQAA 3KL0A 4Q3MA 4WSKA 3B4YA 2FVMA 2AKMA 1HTIA 1RP9A 3GXNA 3I6EA 5FJOA 1B31A 1GTHA 3ES7A 3N18A 3S2NA 1GNXA 1MWOA 1XDJA 2J9YA 5GJPA 2BOEX 1XM3A 1QBBA 1QCWA 1H51A 1TCMA 2A21A 3BLLA 1THFD 1EA9C 1VQTA 3WJWA 3EOSA 1QI4A 3N9SA 4HOWA 1WUFA 2X30A 5BXRA 1GGOA 7REQB 2W63A 3PWGA 1ZB5A 2XVGA 3RO8A 3CQIA 1VCVA 3EGJA 1O1ZA 3CUJA 4GIRA 4U5IA 1YDYA 3GD6A 1DQUA 4NHVA 1GOXA 1MDLA 1P7TB 4XBKA 1RCOB 3LD5A 4UMBA 1UZ4A 3MBFA 5CC6A 3BG9A 3OOQA 1ZBWA 4R3UA 3FX4A 3VUPA 4C90A 2XGZA 5LIWX 3HPAA 1UC4A 4TMCA 1N7KA 3WF4A 3PB2A 1DXEA 1H1YA 2WMIA 3H2AA 2BBFA 4K8GA 3AUOA 5HMDA 2QVHA 1R85A 1JRCA 2F38A 1WBHA 1CXFA 2BHYA 2XN1A 3PTMA 4LUTA 2IMRA 4OT7A 1BPLB 3M0XA 4F0KA 2XFYA 2CHRA 4NJIA 1ZHAA 3V0UA 1EDQA 3VDHA 1X8CA 4LQ1A 1BHGA 3S8HA 2PWVA 3CPGA 4MOZA 1Z41A 2BXZA 2HWGA 2PWUA 4J35A 3SUWA 3LX9A 4HD5A 1YRRA 2ZRZA 4R7WA 1V7YA 1VS1A 2OYKA 1CTNA 3WLHA 3C0JA 1XS2A 1BQGA 4CQ8A 2J78A 4DPQA 3PR2A 3B8VA 1EX1A 4Q8PA 2Z24A 4F9JA 5IFTA 3TYDA 2W3ZA 1IZJA 3PZQA 1DOSA 1X38A 1ISXA 4KEZA 4POCA 2PDLA 3W00A 3BV4A 2X42A 3N2TA 5C8BB 5EMKA 5K9XA 1I2QA 1S5MA 2A7PA 1BG9A 3GO2A 3G0UA 1FVPA 4I5UA 2UY3A 3T4CA 3HV9A 1B5TA 2VD9A 3CQJA 4GIEA 3P8IA 1LWJA 3M6DA 3NQCA 4OE7A 1XYMA 3AAMA 5FEZA 3WLOA 4HZ6A 3EXSA 4HHLA 5CSSA 3VMPA 1W8GA 1H1ZA 4ZXOA 1XSKA 3H4GA 4WX2A 3H8AA 4I8YA 2E40A 5HWNA 1Z48A 2QPXA 1O68A 5BXPA 2WKGA 1EO5A 1XG4A 1HKJA 3GH7A 3H2OA 5I09A 3KS6A 4DRSA 3T0BA 1JCLA 4G1NA 4GINA 4QM1A 4HP5A 4DZAA 4CLMA 4PB4A 1U83A 1KBKA 4GLEA 2WSQA 8XIAA 4MDOA 2Z26A 4UTJA 3LEPA 5CJNA 1ZZMA 4B5WA 4GD0A 3L2IA 3RU6A 4ZOEA 1OD0A 3OPSA 2DT0A 4LAZA 4HYVA 1V3IA 1A5BA 3LZ5A 3NTYA 5I7GA 1SGJA 5I02A 1ME9A 4MB5A 3WQOA 1G4TA 2GVYA 1ZJAA 2TPSA 1D8WA 4O1FA 2YKKA 2V69A 1KFBA 4IJRA 5A6TC 3NYZA 5H8UA 4A35A 1SZFA 4NAEB 1OG6A 1HX0A 3NQ2A 5EGRA 4MB4A 1L6SA 3XISA 1Q6OA 1PZ0A 3AHVA 1DWJM 1UYQA 4V33A 3W7CA 1R7OA 3E2SA 5K9CA 1ME8A 4JNZA 2IQ0A 4AIOA 1HN1A 4DBDA 3EOEA 4X0NA 1E6XM 1CENA 1LG2A 3VE9A 4NNBA 4S3AA 4WD0A 3OW1A 3FA3A 1R38A 3SR7A 2NUXA 2AMGA 4EF9A 3LHWA 2W4XA 4ZO7A 1GG0A 1RBAA 3LPPA 1XBZA 3LERA 2FHFA 1J0JA 3K2GA 1J01A 2ZUSA 1A5MC 3VNYA 2XIJA 1B54A 3THQA 1OWQA 2FVLA 2OEMA 4IH3A 1XIBA 4J2PA 4UNLA 3PPGA 4UB9A 5DQPA 4EPKA 4OU1A 3HGOA 3AYSA 1SO3A 3O2LA 3MI3A 4UQ9A 3KRZA 2CLOA 4QRNA 3T8QA 3BLDA 2YLLA 3IK2A 1EF2A 1KWKA 3RU8X 5REQA 1XGDA 1X7FA 3BMXA 2GFTA 4WY0F 1SR0A 2PCEA 1TV2A 2GUBA 4PTWA 4WDUA 2Y1HA 4GYFA 3TDFA 1EGMA 2VWTA 4MY1A 5HMSA 4YHGA 4URIA 3LXAA 3SAZA 4MJMA 2Y70A 4ZMGA 2CU0A 1QPQA 3OYXA 2P88A 4PR4A 6TIMA 3NM1A 4QJ1A 1BKSA 3WBXA 5LHEA 3EB2A 4GABA 3NO1A 1YDNA 4CD5A 4ZQMA 1TPEA 1J12A 2WVVB 3UXAA 4FLQA 3AICA 3G1YA 5LNSA 4X61A 2BNJA 4Q32A 1KFLA 1UIPA 5LHFA 2PDXA 3NZ1A 3FJ4A 4UNIA 4L1WA 5EMJA 5AOUA 3ZXWA 4FOKA 3C0SA 3CUZA 4QG6A 1VB9A 3BGAA 3L0GA 2WYSA 3GDKA 4UTKA 3LLFA 3IIPA 3OIHA 3O3RA 5L6UA 3G1FA 3QR1A 2VCAA 4IFOA 2OOFA 1F4HA 1GVIA 3NJ3A 2Z27A 1BG4A 4Q8WA 3EB3A 9XIMA 1DPMA 1OGGA 3VKAA 2Y8KA 3F5JA 3SUUA 3W2JA 4DYEA 1QI5A 4UTWA 4J3UA 1TPDA 2NW0A 4JTSA 3KCLA 4CEUC 1V6UA 1H5YA 3F03K 1AL8A 3AS2A 2VELA 3MCMA 1UASA 4L64A 1DEDA 2Y8UA 2ZZ2A 1AFSA 3QTPA 2DUZA 1TTIA 1BYDA 5U4NA 2YBTA 4OTKA 1NOWA 3A3WA 3EOOA 1DE6A 3CAQA 2VDGA 1TJPA 1MW2A 3W6MA 4ADTA 3WDHA 2W9MA 3WDJA 1Q6RA 3PBMA 3SCUA 3WNKA 1PIIA 2ZTJA 3GR4A 3KOWA 3KOZA 5G4EA 4XZHA 3IGUA 3DHPA 3ZSTA 4ZFCA 3RJYA 1WKYA 1GCYA 4MWAC 3KVKA 2SFPA 3TOPA 4KEUA 1QNVA 4UC5A 1S2UA 2G3NA 1V77A 3BQ6A 4NVTA 4WOZA 2WCAA 3AXHA 4IP7A 3IGHX 4OBTA 2YB4A 2Z7GA 4LVDA 1EOKA 1NSJA 4Q22A 3GDRA 5AC7A 4Y9AA 5B7ZA 3DN5A 4ZSUA 3TQKA 3UEQA 1DHPA 3S1WA 3HBLA 4S3GA 5C7HA 4C6MA 2VDIA 1BF6A 5CKSA 3CASA 4RDYA 2VI0A 1ECQA 4QHRA 4IMAA 3VGBA 5ENLA 4DY1A 2G37A 3CQKA 2ISDA 3W3OA 2ZWZA 7ENLA 5ECVA 1TA3A 4ERIA 1EJWC 3WL1A 3SO7A 4KCVA 1MI3A 1A3WA 1MQQA 4QTGA 4CKQA 1DE5A 1KBIA 4FK9A 1V5XA 1BD0A 3K30A 1OADA 1E9LA 2CZ5A 3KZSA 3W2NA 4O28A 3GHTA 4LAUA 1J79A 2INFA 4LS0A 1EYWA 1PX4A 1YEYA 5HJYA 3CAKA 2VHLA 3S5SA 3L66A 1IIHA 3MZ2A 2E6YA 1A5OC 2PLCA 4FNUA 3FGCB 3RAOA 4RDVA 1E4MM 2D23A 1E0XA 1H11A 1RQBA 1XCWA 3WO8A 3LCIA 1R2RA 4D6JA 4FNPA 1TJ2A 3HG5A 3V36A 4IT1A 1G5AA 1JDCA 3NPWA 4QBXA 5CJMA 4GXPA 4TVUA 3L4VA 1RVKA 2X8RA 4J4KA 1UKTA 4R9XA 5FD0A 1XH1A 2ZA2A 2A5HA 2YCJA 4AF0B 3V1PA 4C6CA 3FFSA 2OLAA 2VJXA 1XLIA 1P43A 1JRBA 2PZ0A 1NWUA 3B40A 3M7WA 2MUCA 3VXGA 4GUHA 4OIFA 1Q6FA 4IL0A 4JX5A 3H7RA 4FIRA 2ACSA 1C90A 1O60A 3NL2A 2HISA 4DB7A 5G2WA 3WLTA 1ONXA 3PK7A 5D2XA 1PTGA 2BZNA 4NAEA 4GYPA 4BWLA 1S38A 3I3EA 4DXVA 1MUCA 3A5FA 3ELFA 1X1ZA 4H8VA 3WLSA 3NVDA 1TPB1 1TV5A 5F2LA 2RJHA 3HGRA 2O9TA 1U5JA 4PZVA 2BY1A 2Q3OA 4DWSA 3NURA 3WJSA 1SJDA 4L9XA 4H9YA 3F2CA 2FZMA 3TJLA 2V63A 4LH8A 3W9ZA 4WR3A 3AWNA 3BLEA 1EQCA 2NQZA 4A8RA 4C6JA 1PB0A 4EX4A 4F2TA 4AZGA 4JHOA 5AHLA 2CITA 4JIQA 3NO3A 2WJEA 3O16A 3HJZA 3IRSA 4ZO6A 4HOXA 4YMZA 1RVGA 4I8DA 5T8GA 1WA3A 3W53A 4EK7A 4S3FA 3TVAA 4JOMA 4ZL1A 2PDNA 3SRKA 3SB0A 1M65A 5FA5A 2DSWA 1VHNA 2G4FA 2HVNA 1JYVA 4P7RA 3ANUA 7CGTA 4KGJA 3KHJA 5LNVA 5K9DA 1W9XA 1XLDA 1C9WA 4C1NB 4Q8QA 2WLZA 4KS0A 4KEVA 3HURA 3L2MA 4LALA 3R13A 2VMFA 1E6PA 4AG0A 1XWYA 1KB3A 3B9AA 5BRQA 4KKXA 3TROA 2QEZA 2XFRA 1P48A 5CGQA 1T5AA 3IV3A 1EWEA 4YTTA 3C2YA 3UJFA 1U30A 1NDVA 2QCDA 4GX9A 2YR1A 3W84A 4HA4A 3G22A 1QO5A 3APTA 1A49A 2WNQA 4JICA 5EFDA 2Y63A 1GKRA 1C91A 3QPZA 2XU2A 7A3HA 4M7TA 5HINA 3TONA 4JQ1A 1ITQA 2GL5A 2EG7A 1ISYA 5FSDC 4K3ZA 2OX1A 4W5ZA 4F0MA 1K77A 4WY0A 2XIBA 5C55A 1R9XA 3WBYA 5TQLA 4PODA 4XZIA 1EHNA 2FGBA 1JGMA 4J1OA 3VIMA 5D05A 3NSXA 4Y8FA 2O9PA 1DIKA 2JEPA 3PPFA 2DQXA 2ZKMX 2P0OA 3O6DA 3QZAA 3W22A 4H8HA 4DZHA 4ZB0A 3ARPA 1VFSA 3UNTA 1EJRC 4C1LA 8TIMA 3W6LA 1TZ7A 2VC6A 3ATYA 1HF6A 1KFKA 2PBOA 1OK6A 4DLMA 1DIEA 4LNCA 4GK8A 4O8RA 4RJEA 2JQXA 4Y9NA 4DI8A 1S3HA 1XJBA 1XIEA 3N2XA 3GXPA 4EACA 4UFIA 3I4EA 4Z1DA 1EA0A 1UP2A 4RW3A 2VRQA 4AZ7A 3ZLFA 3UR2A 3UXIA 1Z89A 4IIGA 3T81A 4JNYA 1SMDA 4EPDC 3N04A 4J5NA 4H00A 1KBJA 1KGWA 1V3MA 2WQDA 4MUPA 3T9PA 2VEMA 5BRBA 3REQA 1W37A 2Z6IA 3WLQA 3UWYA 4AEEA 4DXXA 1M7JA 3Q2DA 2GK1B 4UZSA 2P3EA 4MFDA 1Q3NA 3WQEA 2VR5A 1M1BA 1J9YA 3W1MA 3UCCA 3DYOA 2Z1VA 1TPUA 3T07A 5A8PA 2YIHA 3WEMA 4EP8C 1OFEA 4A8NA 4WDWA 2CXEA 4WJEA 1P6WA 1UD2A 3QSRA 1OYAA 4JTFA 3TJ4A 1D3CA 2OWCA 3ZT5A 1OYBA 4UQDA 4QCEA 1ITXA 5AC4A 4AZ5A 2INZA 1AZ2A 4ZB2A 4HTYA 1MUMA 1EFZA 4K2SA 2HXUA 1TVLA 4K39A 1ME7A 5AHNA 4Q4QA 1FKXA 4LX4A 4QE4A 3ZSSA 4NXKA 4M56A 4M1RA 3FJLA 3HTWA 3MQTA 4RE4A 4QDPA 3HPXA 4RNJA 1W56A 2A6LA 3CZKA 3WIJA 2NUWA 1GYMA 3DFYA 3KAOA 3W82A 3THAA 5DT5A 3VIOA 3S9IA 3E12A 1L8PA 1XLCA 1K8ZA 2XN2A 4ZQCA 3MA8A 1C29A 2FGZA 3DFHA 4KF1A 3SCVA 1OJXA 3G3DA 3F4NA 2WV8A 5FKYA 2QZRA 4XQ6A 1SVDA 3S2JA 4YYCA 2WWCA 3VD5A 2WVTA 3BO9A 3N14A 3UG5A 5IHRA 3T2OA 3MUIA 1LOLA 4U3AA 1BVZA 3LHUA 4MNLA 3AIBA 1S5WA 3CPRA 4GXWA 4Z2IA 2Z1SA 4LUTB 1CYGA 3F2BA 3DH7A 4FNQA 5F1UA 3TR9A 3SURA 2DH2A 3WMBA 3RXZA 1OF6A 4XX6A 3ATZA 3AALA 3IGSA 1JZ6A 3TNBA 3AXKA 1F3TA 5E93A 1W2PA 3THDA 3BOFA 4K7VA 4JPGA 3AROA 2DT3A 3PANA 1JQXA 4D1JA 1FWEC 2PS2A 4H04A 4QP0A 1SPQA 4IG2A 3FHAA 1SU5A 4FR6A 4X3ZA 1G9HA 4NAFB 3UPMA 3LDVA 1FH9A 1MZHA 1RJQA 1JDDA 2Y2WA 2QXWA 3EWWA 1CEOA 2ZC8A 3ITVA 1DJIA 4O1CA 4AH7A 1ZENA 1GONA 4RE0A 2IXUA 3O9NA 5A1AA 2OQYA 2PDIA 1TRDA 2CNCA 5DMNA 3UJSA 1R3QA 2WZHA 4OVXA 4DAFA 3M0MA 4LEFA 3TTQA 3VKDA 3LNMA 2YGYA 2WBGA 2IKJA 4HSOA 4PYSA 2RDTA 2PP0A 4PRTA 5A8OA 1QNPA 1WZLA 2YYUA 1E3XA 3GU1A 3AMDA 1XHGA 2B7NA 3RMEA 1EUAA 1U22A 6CGTA 5ABEA 4JIIX 1Q45A 4ATWA 2AL1A 3QW3A 3TKFA 5HPOA 1JDFA 4GJIA 1FCUA 4IGSA 2DZSA 1XC6A 2UV8G 1FWGC 4GC3A 3LHVA 2WNNA 2PI6A 5A2AA 3TQ0A 4U2YA 3IWPA 3FEMA 2CHOA 3CLMA 4XAGA 2X2GA 5TBOA 3QEZA 2GQ3A 2YOCA 4JTQA 2NLIA 4N2YA 2BOFX 4AVOA 4MTVA 4ZTXA 4YU1A 4CCCA 3EDEA 3RM4A 1KRAC 1G4EA 4B2DD 3MHGA 3K46A 3TTYA 4X60A 4ML9A 2E6AA 4FX8A 1GVYA 4U4MA 4GVFA 3W38A 3I6RA 1XXXA 3WDRA 1NOFA 5HUOA 1VFUA 5DCDA 1TJ1A 3QY7A 2Q01A 1G4SA 1OABA 3RN6A 1F6KA 4AD2A 1W5MA 4LRTA 1XGEA 4F0RA 1YX1A 4B90A 1ZLPA 5J8LA 2OZ8A 3BW2A 2HK0A 4REQA 6REQB 4XUGA 1POKA 3MSYA 3K1DA 2J7FA 1I45A 3AYTA 4D6DA 1F7BA 4I3GA 4IIFA 1CIUA 2QUUA 3KDOA 3L4YA 2BASA 5HJLA 4A6GA 2NX3A 1JCMP 6A3HA 4DM1A 5JBEA 2ONEA 3KVLA 3J7HA 1RCXB 1YE6A 2FH8A 1E9IA 1E3ZA 3K8KA 1A47A 1OFRA 1LUCB 2DUXA 5A2BA 4AC1X 1ZFJA 3A12A 3LB0A 2P50A 5H8PA 2V5CA 3UZZA 3P67A 3LGGA 4FR1A 3H23A 1ZU8A 5T9CE 3D0CA 3TQPA 2DT1A 2IKGA 2OKTA 4NNAA 2FFIA 4JTCA 4H7VA 4H6KA 3TWBA 1M9HA 1Y7VA 3N1AA 3CTLA 2CKRA 3FK4A 3P0WA 3ABQA 1P0EA 1SFSA 3ZMRA 5D4YA 1WPCA 3INPA 4AHPA 3WX7A 4GA8A 3M5ZA 3QFWA 5EMLA 3TTSA 4LSBA 4CCZA 2P5NA 3XINA 3GNDA 2BY2A 1L6FA 4R9OA 1UC5A 4AY7A 1EC9A 5I00A 5CLWA 1X8FA 2B4GA 2BG5A 1I75A 2FIQA 1HL8A 2I7GA 3KRSA 3TYEA 4DJFD 4KWWA 3VIFA 1VEMA 1Z42A 3P5ZA 1HT6A 3LU2A 4PFMA 4AF0A 2F9RA 5KMYA 2WVVA 1YTEA 2YYTA 3L9CA 4UCGA 1GPWA 1IEXA 3OGRA 1W1PA 3MP5A 1Z8AA 3GBEA 3ARVA 3CS2A 3AHTA 4GFIA 3ZR6A 3WDIA 2WXDM 4H6QA 4JTLA 3B0VC 2OPJA 5D33A 4B3KA 3UXLA 2DZVA 3KWSA 1CZ1A 2QT3A 3RIKA 5H6HA 1DV7A 1F6YA 1O95A 3CHCA 4QEHA 1JYXA 1TE6A 2VT0A 3HFTA 3TN6A 4ZR8A 2ZDSA 1EXPA 2FGLA 4FXSA 4FX6M 3LRLA 5F2GA 2F2KA 5D03A 4C6OA 4I5RA 1AA1B 1ZSXA 5EKYA 1KTCA 4NJJA 5DMMA 4K1WA 3SZ8A 1FHUA 1V8EA 3IUDA 4IJCA 3W7RA 2WHLA 4ZE4A 2EEXA 5E9AA 2X1IA 2E5CA 4YTUA 2RH9A 2AMXA 2ZADA 1A0EA 1Q6GA 1VYRA 1PBGA 3RDKA 1WDSA 1E4IA 1KXTA 3B0PA 4IICA 4ALDA 4XTDA 1O5RA 3V5FA 3OP2A 1Q6EA 2WBKA 3GVGA 5D2YA 3B05A 4B9YA 5FI8A 4WJXA 5FCZA 4HMCA 4DYKA 1ZP3A 5CGMA 1FWDC 4QE1A 4QLLA 1REQB 3NDYA 1IR2A 2RJGA 2HZGA 1L2QA 1ZPTA 5CBIA 2BGNE 3KXQA 2VKZG 3E5PA 4ORIA 5D2WA 1KM2A 2E3ZA 5JVLA 4JAWA 5BMXA 3GFYA 3OG2A 5G1TA 1US0A 5A69A 4AWUA 1Z69A 3BAIA 3AIEA 1G7VA 3E74A 3N15A 3FVDA 1HKVA 4D72A 3W7IA 4GNVA 3ITTA 3V75A 2Z29A 3W27A 4QX4A 3TNOA 3QKZA 4J28A 4TX8A 4N9DA 4FLSA 7REQA 1HUVA 3OA3A 1H4PA 3L4UA 1WX0A 5MHBA 3ARTA 3EX6A 1TR9A 1F61A 3II1A 3GNXA 2WB5A 3LK6A 5HOSA 5DXXA 4MZ8A 2Y85A 3AZTA 3CQ0A 4YL2A 1VIWA 2PTDA 1B3YA 4ZE5A 1X6LA 3CEPA 3TW7A 1V0NA 3DIPA 3ZJ8A 1Y0EA 2XVLA 2CLLA 2W91A 5AHFA 1HXJA 2O92A 2E1DA 2GJRA 4RZBA 2E5BA 4YNGA 2QJHA 3C2EA 2Z7KA 3W7QA 1GVRA 4WCJA 3QHOA 5SWUA 3I7SA 3W7EA 1UOZA 1PSCA 2PDMA 1XISA 5A6MA 3CLWA 5DY3A 2DZUA 1EO7A 4U10A 1NWRA 4B4FA 3OLGA 1BVWA 3W74A 2FVKA 1BRLA 3G0XA 1CT5A 2HK1A 3IIXA