1J01A

Crystal structure of the xylanase cex with xylobiose-derived inhibitor isofagomine lactam
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New, Simple, High-Affinity Glycosidase Inhibitor: Analysis of Binding through X-ray Crystallography, Mutagenesis, and Kinetic Analysis
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords beta-1,4-xylanase
total genus 126
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1j01A00
5KEZA 1RP8A 1BPLB 3GBEA 3RILA 1JZ7A 4YN5A 3GM8A 1FH7A 1HVXA 4GINA 5CLWA 4HZ6A 3FHQA 3K8MA 1VJZA 3CUFA 1W9DM 3GDBA 2J7EA 2J7BA 1MWOA 4KRTA 2WMIB 3NIYA 3KWXA 1VFUA 3VINA 1GJWA 2VVNA 4NRRA 4OOUA 1KWGA 3VM7A 4P8XA 3WQVA 2X2YA 3ZMRA 3CBWA 1OGSA 4R5EA 2WSPA 3AYRA 4PSPA 3ZT6A 2Z1KA 1YHTA 4DWSA 2NT1A 2ZUMA 4QCEA 4OBSA 5DMYA 1B3XA 3BSHA 4MDPA 1VFOA 9CGTA 2V3GA 4FMVA 2WC7A 2VQUA 1UD2A 1PPIA 4W84A 1LWHA 4TX8A 1J11A 1OM0A 4ATLA 4LYQA 1TVNA 3W24A 3KL0A 2VJXA 2E0PA 1JIBA 2QPUA 3POHA 3WQ5A 4AC1X 4HA1A 5D4YA 2IUZA 3AQUA 2VX4A 1UR8A 3W27A 1PX4A 1GCYA 4S3JA 1NM9A 3VO0A 2D24A 1AMYA 4J3TA 1KFWA 1QI2A 4PMZA 1OT1A 3GH4A 4H8VA 1D2KA 3VILA 1UQYA 1E0VA 4CVWA 1AQ0A 1MW3A 4DM2A 1GW1A 4LXFA 2J62A 1F4AA 2WLZA 4JL2A 4JFSA 3SUWA 2VI0A 2XIIA 3ARQA 1SMDA 3M46A 2D2OA 3WBEA 4E4PA 1XD0A 4MNMA 1U33A 1KBKA 5IFPA 2WHLA 4IISA 1TR1A 4M56A 3THDA 3UG3A 3VMOA 2NSXA 2OWXA 3PZ9A 1R87A 1NWSA 3WEOA 2A3HA 5I2UA 3WD0A 3RJXA 1NH6A 5I5RA 1H41A 3QHOA 4EKJA 2BS9A 2BFGA 3PZQA 3K4DA 4AD5A 1UWUA 4UOJA 3ZT7A 1BTCA 2EPMX 2CCRA 1GNXA 5AC4A 1WDSA 3W82A 3U5UA 1W2PA 3WEMA 2WVTA 3SCPA 4PCTA 4HA3A 5CQ1A 4QCFA 3G6LA 3T0BA 2W5FA 3WSUA 2G8ZA 1OIFA 2YBTA 1NWUA 4AZ6A 4C7FA 5A8MA 2ZUWA 1UD6A 4DWSD 3U5YA 4TTGA 4M24A 3WH9A 3BXWA 1E9LA 4J3XA 4BCEA 4V27A 1SR0A 4CN4A 3L4YA 4F9JA 1K9TA 3RIKA 1K6AA 3O2LA 2F8QA 2YL6A 3VMPA 1CGVA 1HP5A 3AZRA 1V3JA 2VCCA 1WNOA 4IPLA 3PZVA 1BGAA 3TTYA 5CJ5A 2VO5A 2QV4A 2E3ZA 3MUIA 3TONA 2EPOA 3VGGA 1MVYA 4AIEA 3UETA 5LA0A 4DWSB 1J0HA 1KQYA 3VD4A 1UR4A 2VR4A 1GONA 1H4PA 4PMVA 2J7CA 2VRKA 1UWSA 1QHOA 2DGAA 2OLHA 2BNJA 1WKYA 4LYRA 1FH9A 3PZTA 1MXGA 2VZUA 2VL4A 1B90A 2WYSA 3KL3A 4DWSC 3A4XA 3FAXA 2XVGA 4AWEA 4Z2LA 2CEQA 2YLAA 1QI0A 2VR5A 5D9PA 1Q4NX 3VDAA 1LG2A 1JZ2A 2CETA 2VX6A 1V03A 5BXRA 1CGXA 1B3ZA 3ALFA 3CUHA 1I75A 1EDQA 2W63A 2X8RA 4W8LA 5JBEA 4AD2A 3SCQA 3WUFA 1ISYA 2DSWA 3PN8A 4K68A 1TFVA 1HJSA 3ZSTA 2XIBA 2ZXQA 1EGZA 3I3DA 3GYCA 1HKIA 4UFMA 2XVNA 3WENA 2WXDM 1CIUA 3GXMA 2DSKA 4U3AA 4U5KA 4S3KA 1XSIA 3AS1A 4GI6A 2QPSA 4MB3A 1JYXA 1EIBA 1VBRA 4GIAA 1MQPA 3WD2A 4DUXA 4AIOA 1HKJA 3NJ3A 3KZSA 1FH8A 1Q6EA 1E3ZA 3FY1A 1YQ2A 5IDIA 1JF5A 7A3HA 2J8GA 1ZJAA 3BMVA 1CWYA 1JD7A 3WFLA 3ARVA 3W29A 3VIFA 3CTTA 3MANA 4UZSA 3L4UA 1JNEA 1H2JA 2BY3A 2YKKA 4HTYA 5FOOA 3L4WA 3SCNA 3N9KA 4PMOA 3AIEA 4ML4A 3MS8A 1CPUA 3WFZA 3MMDA 1US2A 3WEZA 3VDBA 1BVNP 3WH7A 3WF4A 4U5IA 3PTKA 2CHOA 2V3EA 2WCAA 1Q6DA 4AZCB 5C70A 4UOZA 4P8VA 3QOMA 1B9ZA 1CTNA 5A2AA 2E8YA 1V3HA 2QLYA 3T2OA 4M1RA 1JDAA 1VF8A 3ZJ6A 4D1IA 1GHSA 5BXSA 1QNPA 2GJXA 2WMGA 4H7VA 4M8UA 5I77A 3VDCA 1XC6A 5BWFA 2ZIDA 1VJSA 2WHKA 3AHVA 4BF7A 4PUEA 2JEQA 1O7AA 2GFTA 3AIVA 1XCXA 3K8LA 3AS3A 1XYFA 2J78A 1UQZA 1EO5A 1HF6A 5DT5A 1W9UA 4D1JA 2GJRA 1ITXA 2WWCA 5A95A 4XB3A 2CIPA 1TUXA 4PTVA 2PWEA 3ARSA 5GPRA 1NARA 1JXKA 1US3A 3SCSA 2EPKX 4JKLA 5A8OA 1QI4A 2YDQA 2D23A 4PMYA 4GO9A 3GNRA 1ISZA 4YPJA 3L4XA 2EO7A 3EDFA 1UR1A 3N18A 2ZUUA 3W38A 3RPMA 2YA1A 7CGTA 3ZOAA 1KGUA 1LL4A 1W9VA 2OSWA 1W3LA 1F4HA 3VPLA 1QNRA 2CXGA 3DYMA 2BHYA 2VOTA 2VZTA 1DTUA 2BVYA 5FCZA 2VQTA 1QNOA 3AXXA 4AMCA 1UKPA 4GZIA 1QBBA 2ZUSA 1UWTA 2EBNA 1BVZA 1FA2A 1UYQA 5I3DA 1MW1A 4D72A 3AROA 3PZOA 3MMUA 3QHMA 2VZVA 2UY4A 1GOMA 2WAGA 1R86A 1EOMA 4J3WA 3A3HA 2VMFA 1OT2A 1JYVA 1A47A 2D20A 3L4TA 5D9MA 1AQHA 2ZX6A 5A6JA 1GPFA 2DT3A 2D0GA 2J47A 4UFIA 1E55A 2ZUTA 2G41A 3KEHA 2ZX7A 3BAIA 4H8UA 1GQJA 2XGIA 2PWFA 2EPNA 5E6ZA 4LX4A 1CECA 1GHRA 1VEMA 3BCDA 5FIPA 2ZX8A 1HJWA 3GXIA 1CDGA 5DF0A 4IUGA 1E6NA 3AMKA 3VGEA 1QBAA 3W4RA 3O9NA 4KGJA 3IANA 2GSJA 2OSXA 4AZHA 1ISXA 1V3LA 2XG9A 3VIHA 1ITCA 5IXEA 1PJ9A 1B3VA 3SUUA 5GNXA 1RPKA 2WM0A 3OG2A 3ARZA 3BCFA 4UQBA 3SUSA 1UG6A 2DSUA 2EXOA 1ZS2A 4AEEA 1GVIA 4LYPA 2O92A 1VENA 1VFFA 1VRXA 1E40A 2XFFA 4UQCA 1M01A 1QNQA 4U2YA 2JFEX 2XSAA 3NSMA 1XH2A 3PZGA 4JFVA 1OWQA 1IZJA 4P7NA 1LL6A 3WDPP 5GNYA 1JYWA 3J7HA 3U7VA 1IV8A 3S2CA 2X0HA 2J25A 2BHUA 3ZSSA 3AMCA 3RJYA 4RL3A 1W9BM 1C7SA 4BA0A 1WZAA 4MB5A 2VCBA 4DM1A 3F5LA 2WZIA 4FLRA 1CLVA 1OB0A 3THCA 1W3JA 4MTVA 1ZBWA 5IFTA 2GUYA 2J75A 4UQEA 4PBGA 1WAWA 3EYPA 2YBUA 1E4IA 2CPUA 1HXJA 3CZ8A 4GO8A 5HDRA 4WK9A 2A3AA 3IJ9A 4OBRA 1RP9A 1TMQA 1ESWA 4N42A 1E0XA 4J3SA 1GVYA 3W6LA 3L4VA 5F7UA 4GZEA 2E9BA 4U33A 1OBAA 5EFDA 5FL1A 2WANA 1KR0A 4LQ1A 5E6YA 5TD4A 3WQ8A 1W3HA 4UFJA 3LPOA 2YA2A 4TVUA 1V0MA 1GQIA 5BRQA 1UKSA 2W4XA 4PTMA 2E4TA 4YHEA 3WF3A 1UD4A 5CSUA 2VT0A 3WQWA 4W7VA 1HX0A 2WCSA 1WP6A 4MJ2A 2WMIA 1KR1A 1GQKA 1KXTA 2PWGA 3CIVA 2CKSA 1HL9A 4EK7A 1UD8A 3GNOA 3WN6A 5CLTA 1B1YA 1S46A 1J0JA 1TA3B 3O6AA 4KH2A 3VD7A 4R27A 1H3GA 2WW5A 5I24A 2WKLA 4MNKA 2PBOA 1KGXA 1EXPA 2XM2A 2F61A 3BC9A 1O6IA 3QR3A 1JXJA 2FHBA 3DYOA 4GI8A 5ECUA 2GK1B 4ZE4A 3SCOA 4AZBA 4HU0A 3CUIA 1QVBA 1JF6A 4IM4A 2WC4A 3WNPA 3M7SA 1QI3A 1H0IA 1C8XA 5I6SA 5A8QA 2WK2A 4D6HA 2YLLA 3GH7A 2WCGA 4D6CA 4AD4A 1CNVA 3CMGA 2XFYA 1Q6GA 2JALA 5A6BA 2A3BA 3K4AA 5FL0A 3M07A 2DH3A 1KCKA 1FHDA 3WIJA 1QHPA 4PMRA 1QOXA 1KB3A 2G3JA 1E71M 1XGZA 2TAAA 1OIMA 1TCMA 1UUQA 4ZEPA 4W7UA 3TP4A 1K9FA 1W1VA 4KMQA 1M03A 1BG4A 1E4MM 3W6MA 1V6XA 1E73M 3CZLA 3VGFA 2FDMA 2DSZA 2G3MA 1P6WA 3VDHA 2IXUA 2VCAA 1ODZA 1B30A 2A3CA 4B3KA 1BF2A 3KL5A 2PC8A 3S6TA 5BXTA 5CPTA 3RO8A 4BQ2A 4X0VA 1PX8A 5D9NA 2ZUNA 4BQ4A 5CXPA 4W86A 1NQ6A 2A3EA 3SUTA 4MB4A 4HZ7A 4DUWA 4BQ3A 1XV8A 1E1EA 2QMKA 1Q6CA 3W0KA 1GZJA 3OLDA 1QW8A 1VEPA 3B9AA 5CPQA 3WMSA 1LJYA 4A4AA 2YOCA 2VRJA 5A3HA 3AHYA 3GH5A 1C92A 3A4AA 3WDRA 3WL1A 1KGWA 5E0CA 1CZ1A 3ZJKA 2GJXB 1PIFA 2DDXA 4AXNA 4CD7A 4ZXOA 3CUGA 3I3EA 3AHZA 1J0YA 3U7BA 4E8CA 3W53A 3ARTA 2YA0A 4QLJA 2J7DA 1G9HA 2CBIA 3CZGA 2XYLA 4TVCA 4V28A 4Z2HA 1VB9A 4J28A 3AFBA 3NDYA 1H09A 4AD1A 1E4LA 4AY1A 1EO7A 2XVLA 1KXQA 4NZCA 1WB0A 1VBUA 1EHNA 1EH9A 4KRUA 3MSGA 2GDUA 2FGZA 4JCLA 4MAZA 2WSKA 1V3MA 2YDRA 3CZEA 1JAEA 5KZ6A 5D8WA 1SYTA 3RM4A 4YHGA 4FLSA 2OWWA 1HJXA 1NWRA 3VTRA 3PZUA 4CD5A 1UKTA 3UG4A 3II1A 3VNZA 1EOKA 1TZ7A 4XX6A 2DIJA 3WUBA 4W5UA 1VIWA 2CNCA 3MO4A 1UKQA 3CMJA 2ESCA 2UY5A 3DHPA 1Z32X 3VIJA 1J18A 1HKMA 1UKOA 2GK1A 3AMGA 2QHAA 3IAPA 1H0GA 5EBAA 8A3HA 3GNPA 2VX7A 1M53A 1B0IA 4PUDA 3ARUA 4F8XA 1E43A 2X0YA 5JIPA 2Y8VA 3FAWA 1ZJBA 5C8BB 3PTQA 3RMEA 3L2MA 4QFUA 4FK9A 3CO4A 4XZWA 2XVPA 3WNKA 1L0PA 4WKAA 4PMUA 4W8AA 2D3LA 2VZSA 1B3WA 3GBDA 1DP0A 1BAGA 4QLLA 4BZYA 4JFWA 4CGTA 1G1YA 3WDQA 3WELA 3ARPA 1V6YA 2FHCA 3VGDA 1V6VA 3VX1A 1W1TA 3WL0A 1JZ5A 5DT7A 5GNZA 3WD4A 1JDCA 2V38A 3M6DA 3QHNA 3NYDA 6TAAA 3U57A 1XHGA 1J0IA 1J0ZA 2WMJA 1ISWA 1TE1A 5HXMA 3UR7A 2BY2A 2UY3A 3F5JA 1ISVA 1J12A 2VRQA 2RGMA 4JHZA 2B31A 1CXFA 2V3DA 1LLOA 1XCWA 1H5VA 1MW2A 4P8WA 2GJPA 5IHSA 4XV0A 3DYPA 4AZ5A 3B9EA 2YDSA 1A3HA 4PMDA 2HVMA 3N15A 1ZBCA 4UFHA 3WD1A 3GXFA 1X6LA 2CYGA 3AHXA 4GXPA 3EMZA 1QNSA 3SCVA 2DPEA 1X6NA 4AD3A 3VIGA 1GORA 4MJ4A 3VMNA 1LF1A 1HJUA 1HN1A 4PTXA 1BYBA 1WE5A 3CUJA 1PBGA 1UHVA 3LMYA 4M82A 3BAXA 2C0HA 5CPSA 2VUYA 3VNYA 1CYGA 1JFHA 3AOFA 3VIOA 1PAMA 3SURA 3WQ4A 2WB5A 1N82A 4JFTA 4M80A 2W62A 3EDEA 1G01A 5DEZA 2WBKA 1HNYA 3EDJA 1DWJM 1WDQA 2BXYA 4TOQA 1W1PA 4UNIA 3WD3A 5A2BA 5A8PA 1WZKA 4UQAA 1W91A 3VIMA 2XJ7A 2JF7A 1C91A 5FD0A 4HOXA 4CUCA 3IJ8A 5M3WA 4Z2KA 3CGTA 1JI1A 1UR0A 1C3FA 4W8BA 1CGYA 3I3BA 4M29A 4WJXA 4NRSA 1UH4A 5HPOA 4EAMA 2ZWZA 1KQZA 3WMBA 4D6DA 1UD3A 1W3KA 2W67A 8CGTA 3AS0A 3PBGA 3RDKA 1H49A 1HL8A 5AYBA 4HMCA 1GJUA 1UWRA 1WPCA 3ZR5A 4PCSA 2V5DA 5CZKA 4W87A 2ZXDA 2WKGA 2VURA 1FOBA 4HMEA 4XZBA 5I23A 3AYSA 4ZFMA 3VGHA 1RH9A 2CBUA 4P8UA 3VIIA 4W5ZA 3FN9A 1K9DA 4AZ7A 3CPUA 3UEQA 2AMGA 3WNLA 3ARXA 1E5JA 2G4FA 3WQ6A 2YJQA 5JBFA 2DQXA 3OLIA 2CESA 1JI2A 2PB1A 1GOOA 3MV01 5A2CA 2DT2A 4PEEA 4XUYA 2XSBA 2XVKA 4WSKA 3ZT5A 4B9ZA 4N0RA 3WDIA 1KCLA 4A3HA 2EEXA 1XYZA 1LWJA 4D6EA 2ZICA 4PN2A 3MMWA 1CXHA 3N17A 1SFSA 1G0CA 1B3YA 4CCCA 3EMCA 1UWQA 3CLWA 3UG5A 2PI6A 2BY0A 3MUZ1 5M5DA 4UFLA 1H1NA 1JL8A 2VX5A 1JZ8A 4AZIA 3VIPA 1FP8A 1Y7VA 5I79A 1L8NA 2D3NA 3AZSA 4B3LA 3B9DA 1E6QM 3WNOA 3CHDA 1GQLA 4UQ9A 2E8ZA 2Y5EA 4M81A 4CKQA 1GOWA 1JZ3A 5D8ZA 1OD0A 5CSYA 1CXLA 3TTOA 2OYKA 1UA7A 1UD5A 2J7HA 3WH8A 4HMDA 4U3CA 1XRVA 4W89A 1E5NA 3E1F1 1OD8A 3TTQA 3NUKA 4OUEA 3AISA 1UH2A 2NT0A 4ACZB 1BGGA 1CXEA 3PZNA 4D6JA 4CU6A 4HZ8A 2CERA 1VAHA 1NOUA 4TUFA 3MV11 2NW0A 4WF7A 2MANA 1JGIA 3WH5A 3D5HA 3K8KA 4D6IA 4URIA 2ZWYA 1V08A 5ABGA 1KXHA 3EDDA 5JUVA 1TG7A 1V02A 4OZOA 2WHJA 1TA3A 3K1DA 5LA1A 1BSIA 3RCNA 3CHCA 3BAWA 3NCOA 4X0NA 2O9PA 1XD1A 1UH3A 2GVYA 3VKKA 3CZJA 1MFVA 1NOWA 5ABHA 4E2OA 2BHZA 3MU7A 2J4GA 2J7FA 4D71A 4CCDA 2Z1SA 2D1ZA 2O9RA 3T0DA 5A69A 3SCRA 4LGXA 2BXZA 3AIRA 4UQDA 4HOWA 3WNNA 1CXKA 3HJEA 3GTNA 1KWKA 4H04A 4MB1A 2W92A 2F2HA 1RD6A 3ARYA 3ZIZA 3LPGA 1V02E 3AI0A 1VFMA 3PZIA 4MDOA 3WMCA 1MXDA 3BGAA 3IAQA 3CHFA 3VGBA 2ZE0A 1H11A 2E40A 3HMCA 4AIUA 1CGUA 1W2VA 2VTFA 2WWDA 2PWHA 3VM5A 3UR8A 3KE0A 1K9EA 2CBVA 3K46A 2G3IA 3N11A 4MNLA 4CVUA 3NSXA 2X05A 1CXIA 2BY1A 3DHUA 3SCTA 1ZL1A 4KWUA 2CBJA 4QP0A 3ZJ7A 1AQMA 2W66A 5BROA 3WUGA 3EDKA 3NDZA 3OLEA 4V2XA 1BYAA 4LPCA 1KBBA 3WNMA 2XWDA 1CEOA 3AJ7A 4OOZA 2ZX9A 1WCGA 3BLKA 1QPKA 5CGMA 1E6XM 3W25A 2YL9A 2Q8XA 3BSGA 3CH9A 3ECQA 1M7XA 4BS0A 5IHRA 4P7LA 4J27A 4F79A 1WO2A 1G94A 1LL7A 5E0FA 2J74A 1WDPA 3OBAA 1ZBVA 4JHOA 2WMHA 1OCQA 5BYWA 4JIEA 4GPNA 4WIWA 1HVQA 4HPGA 3SCWA 3QOKA 2EJ1A 5DO8A 3OGVA 3VU2A 2DH2A 1UOKA 3L4ZA 4AYSA 2XPKA 1NP2A 1JYNA 4JKMA 3RM8A 1D3CA 4TTUA 4FLQA 4OIFA 2JE8A 6CGTA 2BVDA 5A1AA 2J7GA 3WF0A 2XGBA 1J9YA 2VC9A 4J7RA 1E15A 2EQDA 1Q6FA 2J77A 5E70A 2WVVA 1E56A 4L4OA 3ZO9A 1E6RA 1BG9A 2ZX5A 3POCA 3CZKA 4OJYA 5HBFA 4PMQA 1E6PA 3AMLA 3VD5A 4ZE5A 4AISA 1OGGA 4RE2A 3W28A 4W85A 4P7QA 3OB8A 1C7TA 1R7OA 2CITA 4GQRA 7TAAA 3T2QA 3EBVA 4WLCA 4ZXLA 1C93A 2OYLA 1TVPA 3WKZA 1LQ0A 3WY1A 3OGRA 4GKLA 2ZOXA 1OSEA 3HN3A 4CN6A 2D0HA 2V5CA 6A3HA 1XH1A 1LG1A 1HT6A 5FKYA 2Y4SA 2WBGA 5A6KA 2AOSA 2WNWA 1D7FA 3OIHA 2XWEA 3AICA 1DWAM 2PF0A 3A6OA 1M04A 5EMYA 5M17A 5ABEA 3RM9A 3MUY1 2XHYA 4GQQA 2AAAA 1DWFM 4A3YA 2O9TA 1E4NA 1HKKA 1MQRA 3N12A 3FNDA 3GXDA 4CU8A 4UCFA 2YL5A 2WZEA 1WZMA 4AD0A 1PIGA 4GZJA 2WC3A 2YL8A 4B16A 1HJVA 1SMAA 3IJ7A 4TX6A 1JFXA 2XTKA 4Z2JA 3T09A 3IK2A 3VX0A 1PX3A 5GQBA 1FFQA 5D9OA 4Q7NA 4W93A 3OZPA 1CBGA 5JIWA 3TTSA 1UZ1A 2WHMA 5C71A 1NOFA 4Z2GA 4ACZA 2D0FA 3WF2A 4D6FA 1DWGM 2CKRA 1ZB5A 1W32A 2ZXAA 1J10A 2V3FA 3SUVA 1MFUA 3OZOA 4C7DA 2XUCA 1ZBKA 4J3VA 3ARRA 1DWHM 3EMQA 2E9LA 1E6SM 4E8DA 4KGLA 3OA5A 1QW9A 4HA4A 4UR9A 1NP0A 1U2YA 2OSYA 1QI5A 4PYSA 4DUVA 2UWFA 2JIWA 1JZ6A 1G5AA 1GOIA 5CG0A 5E9AA 4HP5A 3WDHA 5ABFB 1E70M 1V0LA 3ZQ9A 3T2PA 1DWIM 4B9YA 2QF8A 3A4WA 4CD6A 2C8NA 5DFAA 1V6UA 5AY7A 1IZKA 3BAKA 3WDJA 1V3IA 1CGTA 1V0NA 2ZUVA 3BAJA 3VOCA 1EQPA 3W81A 1JAKA 1JG9A 3LPPA 3FW6A 4J3UA 1IT0A 1VEOA 2DT1A 2GDVA 2YIHA 4NSBA 4CD8A 2BVTA 3JUGA 3ZM8A 3B8SA 1OGBA 3AIWA 3ZJ8A 4AW7A 4C7GA 2JIEA 4QDMA 1FHLA 1JD9A 2CHNA 2OYMA 2VVSA 1E3XA 1PZ2A 3VUPA 2J8FA 1V6WA 4RE4A 4PMXA 3QGVA 4JZ5A 3AMDA 4H8HA 1C8YA 4W7WA 5LA2A 3SIMA 2WVVB 4L4PA 1MW0A 2IXVA 2QMJA 1BYCA 3N04A 2XM1A 2EPLX 1ZU8A 1CENA 3GZAA 4JKKA 4JAWA 4W88A 1ODUA 3MKKA 2D22A 3AIUA 1FFRA 4H41A 4X9YA 4AZCA 3BMWA 1WZLA 1JNDA 2Y8KA 4WKFA 1NWTA 1E6ZA 1UR2A 4MPKA 1XSJA 1R8LA 1WDRA 4JCMA 2BV9A 1BFNA 4Z2IA 4ATWA 2OWCA 3LPFA 5A6LA 4AEFA 3WBAA 4RE3A 3G6MA 4P7RA 1W9PA 3OGSA 4H2CA 2JF6A 2VZOA 2W61A 3AIQA 3HU7A 1C90A 1UR9A 3APGA 1BYDA 2C7FA 2RGLA 4CCEA 2PWDA 4JFUA 3T0AA 3UERA 4NF7A 4PSRA 3W26A 5HNNA 4P7OA 5ABFA 4ACYA 2FH6A 3PTMA 4NI3A 3AZTA 3WUEA 3A47A 3PHAA 2WMFA 3AXIA 4UFKA 1DHKA 2Y2WA 4PTWA 3BLPX 4TVDA 4UTFA 1I1XA 4QLKA 1E1FA 4U31A 1JZ4A 3VIKA 3AIBA 1C8QA 2X09A 3TOPA 2ZXBA 1PEZA 1QHZA 5A6MA 2UY2A 3DC0A 1J0KA 4WSJA 1I1WA 2DT0A 4MNJA 1ECEA 3ALGA 4D6GA 1EDGA 1HJQA 5CGTA 5BXPA 1GOKA 3DECA 2JEPA 2XFRA 5I0DA 1EDTA 2O9OA 3F5KA 3SCUA 4MAVA 4QAWA 4UZUA 4F66A 5HOSA 1B31A 3VVGA 1GUVA 1BQCA 5LYRA 1JDDA 1BHGA 4U2ZA 3AS2A 1J01A 4IPNB 4FLOA 2FHFA 1UWIA 4HU8A 4CU7A 5AYIA 5HPCA 4Q22A 3ZR6A 4Y7EA 1E72M 4UOQA 1R85A 4MADA 1CGWA 3AXHA 1UZ4A 1HIZA 4PRWA 3AHTA 5JBDA 4CD4A 4OKDA 4AZGA 1R7AA 4WKHA 3PZMA 3VD9A 3BAYA 1XSKA 5A6BD 1MYRA 1BLIA 1XH0A 5A94A 2W91A 1OINA 4HPHA 2J79A 3FXYA 4B15A 1UA3A 2DIEA 3T08A 5AC5A 2VNCA 5EFFA 1W9XA 3VD3A 3W37A 5BCAA 5E09A 4TXEA 3BH4A 3NSNA 2G3NA 2WMKA 1GOQA 3WF1A 5A6AA 1MQQA 5BRPA 3N1AA 1W1YA 1KXVA 1CLXA 3ARWA 2DSVA 4PMNA 1V3KA 3MUAA 3SEPA 4EE9A 2DEPA 2WPGA 3F4VA 3L2LA 2FH8A 1B2YA 1HP4A 1EA9C 3UESA 1E0WA 4ZENA 2WZHA 3CHEA 1AVAA 3D3AA 1EHAA 4ATDA 1FP9A 2PBGA 1X1NA 2HISA 4BQ5A 1V0KA 4FF5A 2Y24A 2FGLA 2WLYA 3UCQA 5I78A 3FHAA 3WH6A 3MSDA 4CN1A 1EQCA 3TA9A 5EB8A 4EANA 2WVSA 5A8NA 3OLGA 4GI9A 2E9MA 1PZ3A 1U30A 5M03A 2WVUA 1DEDA 4F9DA 3N13A 4JL1A 4HOZA 5A6SA 2X1IA
chains in the Genus database with same CATH superfamily
2PU1A 3S47A 3GBEA 3HG3A 4O1BA 5FA5A 4XAPA 4BI5A 4MJMA 3S5YA 5CLWA 4HZ6A 3K8MA 5FJRA 1TELA 4V15A 3W75A 5CSRA 5F1VA 3CPGA 3W87A 1TWZA 2WMIB 1AQFA 3OTRA 2I7GA 4HN8A 3R58A 3WQVA 2Z0IA 5BU9A 4R5EA 2WSPA 3AYRA 4DBSA 2Z1KA 4DWSA 2ZUMA 4QCEA 3O05A 2ASHA 4MDPA 9CGTA 2JGQA 2V3GA 1DJIA 2VQUA 4HGXA 1XISA 1PPIA 1J11A 3QH2A 1EL3A 1TVNA 3W24A 3KL0A 1NFGA 3HGOA 3POHA 4AC1X 3ITLA 5D4YA 4DJED 2AQOA 1SZGA 2YCLB 2P5NA 1ICPA 1A3WA 1PX4A 4S3JA 1NM9A 1Q7QA 2WNQA 1MEHA 2PUZA 4F0RA 3EA1A 3GO2A 4ADSA 1XPGA 3QV7A 3LLFA 4PUNA 1QI2A 2E5DA 4ROQA 2QT3A 4CVWA 1WA3A 3RMJA 5CPLA 1P6CA 4M3PA 1NEYA 3QGKC 1TV4A 3DXIA 4DBWA 2Q09A 3QYSA 1DL3A 4GYPA 3GTXA 4JL2A 4JFSA 3ZS4A 3SUWA 2OGYA 3NQAA 1A4LA 3DESA 3IUHA 2D2OA 4HA0A 5IFPA 3BW2A 1TR1A 3GXTA 3UG3A 1RVKA 4C1KA 3LBMA 3VMOA 2NSXA 1JUEA 4NG3A 2P8CA 3V75A 1NH6A 2TYSA 2BS9A 2BFGA 3UA4A 3K4DA 4UOJA 1GQNA 2EPMX 1GNXA 4HQVA 1R3YA 3H22A 2Z24A 3A23A 3TJXA 5HULA 3QKEA 4PCTA 4D8AA 4UTHA 3S1UA 2G8ZA 2XIJA 2ICSA 1ZAJA 3C3UA 1NWUA 2Z00A 4L1WA 2A7PA 2PDUA 5A8MA 2ZUWA 4K8GA 3LCXA 3U5YA 3RR4A 5J8LA 4M24A 3BXWA 1E9LA 4GD0A 1CX9A 1SR0A 4HVXA 3ZVHA 4F9JA 4C6FA 1K6AA 2F8QA 1HP5A 4CQDA 1BEUA 4ZTXA 2VCCA 3Q94A 2VR2A 1W6TA 1BGAA 3TTYA 4MYAA 5BOFA 2E3ZA 3MUIA 4GIEA 3TMQA 1AZ1A 2OLAA 4QEEA 2GGHA 4LVFA 1J0HA 4IG2A 3VD4A 1S5NA 2VR4A 1GONA 3H2CA 1M65A 4O1DA 3TYCA 1UWSA 2DGAA 1WKYA 2F6UA 3E9AA 1TPH1 1MXGA 2A85A 4PZVA 2DZBA 4Z2LA 4X3ZA 1QI0A 1RCXB 3P8IA 1FCQA 1DIEA 1RJPA 1B3ZA 3BJFA 3SN1A 1EDQA 4YYFA 2R1MA 4W8LA 5EKYA 1ISYA 3WLLA 4LUJA 3ZVIA 1HJSA 1FRBA 1Q6RA 3GYCA 4IHCA 1SSDA 3SJNA 4UFMA 3P80A 3GW3A 1LORA 5I06A 1FCUA 3GXMA 3TAOA 2DSKA 4MYXA 4U3AA 1ZCOA 4I6KA 5E1QA 3FDKA 5AHEA 3FA5A 5H8PA 4KCVA 4GIAA 4S23A 1DV7A 2REQB 4PBFA 2A7RA 4C1NB 1HKJA 1S38A 4XIAA 1Q6EA 3E49A 1E3ZA 5IDIA 4R7OA 2PZ0A 3PP7A 4Q4PA 1CWYA 1JD7A 3WFLA 3H70A 4ADUA 4WZHA 5AOUA 2F7FA 2H8ZA 3L23A 3HPSA 3L4UA 1W1ZA 3DN5A 5EYWA 1K4GA 3IVUA 1ZLPA 1IXNA 3UXAA 1W5NA 3IACA 1TKKA 3N9KA 4PMOA 5DCDA 3M0JA 4QAIA 1CPUA 3WJYA 2DZAA 4NNAA 5DXYA 1US2A 3VDBA 1BVNP 2C16A 2H3DA 1GEQA 5HQEA 2ISDA 5C70A 2NX1A 3QOMA 1B9ZA 1FXPA 1S39A 1W17A 1VF8A 5C7HA 1RCOB 4YVPA 4YYCA 3MDWA 2WMGA 4H7VA 4L64A 4RKAA 3P5ZA 5BWFA 3O8AA 3KOYA 4J1OA 1H61A 4F2TA 6XIAA 2YR1A 2GFTA 3C3NA 3C4UA 3I65A 7REQA 1TMHA 5EU9A 4Z17A 1XYFA 3PB0A 1UQZA 2C6QA 1KD0A 3KRZA 2SFPA 3WLPA 4D1JA 1ITXA 4YMZA 1N2VA 2ZC8A 3PNUA 3C2FA 1TUXA 3UA3A 3G8EA 5GPRA 3H12A 1P0KA 3BGJA 1M3UA 1O5KA 3SO7A 4O16A 1HKWA 2EPKX 1XPYA 5MKGB 1F3WA 4FOJA 2Z7KA 1R46A 3S5NA 1L6FA 3N18A 3LSBA 4PH6A 3RPMA 2YA1A 7CGTA 1KGUA 1NF0A 3TA6A 2OSWA 3DBNA 4BWLA 3GZ3A 2BHYA 1Z41A 3Q67A 1ZNNA 3VCCA 1GTHA 1Q63A 3D3FA 2AAMA 1BWKA 1C9DA 4H7CA 2VQTA 3GR8A 5H6HA 3QVQA 4PL2A 4G1KA 1XLFA 4GZIA 1QBBA 5DY2A 3ABQA 4C6IA 4OFCA 1BVZA 5G4EA 1FA2A 2X30A 1GYMA 1MW1A 1K8ZA 2BP1A 3DFQA 1QNVA 4D72A 2ZRVA 2AGTA 2Q8ZA 3UWYA 3QHMA 1R86A 4GMEA 4QG9A 4GC3A 1JYVA 4XO6A 2NVDA 3T6CA 1NDWA 1OABA 1RVGA 1AQHA 4DWDA 5I3IA 2ISWA 5A6JA 1OCBA 4O53A 2J47A 4UFIA 4B2DD 3FKRA 3KEHA 1W1IE 3DG7A 4Q8OA 3NR0A 2ZZ7A 4LX4A 2XSXA 3BCDA 5FIPA 1KTCA 1QBAA 1VIZA 3IANA 2V68A 2XG9A 3PJWA 2CZ5A 1EJRC 1V93A 1EWEA 4FHAA 2QCEA 1TMLA 5IOBA 1TTQA 2L5HA 3GFXA 4RZ4A 4GA8A 1E9YB 2QCGA 3OG2A 1FKXA 3R2GA 4RDYA 3BCFA 1EIXA 3TSMA 4Q4KA 1ZS2A 2O92A 2E77A 1FHVA 2P50A 1P43A 1VRXA 1M01A 1QAPA 1SO6A 3NSMA 5C55A 3PZGA 1LOSA 2QJGA 4P7NA 1XIDA 2OZ0A 1RBAA 5ECVA 3WDPP 4O13A 1R3VA 3O6DA 4RK8A 1EPVA 2NZLA 3G1XA 3J7HA 1IV8A 2BHUA 4RXGA 2B81A 3RJYA 1EX1A 4BA0A 1E51A 2Q01A 4IIEA 3GLCA 1XICA 3TXZA 5IFTA 1I0BA 3EOLA 2Y7EA 4PBGA 2YBUA 4KESA 4LCRA 4GJJA 4WK9A 3IJ9A 1TIMA 3LENA 4ORIA 3W72A 3UWVA 1TO3A 4Y8FA 3ZWSA 3W6LA 5CH9A 1D8WA 2E09A 1RQBA 2WNNA 1ICQA 4DJDD 3PR2A 5EFDA 3ABZA 3XISA 3GC2A 1KR0A 2INEA 5PTDA 1H5YA 5TD4A 2QUUA 3HG5A 3LPOA 4TVUA 4HNCA 5BRQA 3CT2A 1UKSA 4PTMA 2E4TA 4I5XA 5CSUA 2O4QA 3WQWA 4L61A 3DI1A 1HX0A 2WCSA 4XO7A 4FXSA 5SWUA 4O4WA 1GQKA 2CKSA 2PDFA 3PG8A 4GNJA 1YXDA 3GNOA 4U10A 3BLIA 4I9MA 5C54A 5F2LA 3MKVA 1J0JA 1EJXC 4KH2A 4NZJA 3N34A 4R27A 1SW7A 2FFIA 2WW5A 5I24A 4MNKA 4B5WA 1KGXA 1EXPA 3PTDA 2FHBA 3TSBA 3KRUA 3DYOA 2HNHA 4GI8A 5ECUA 3JS3A 3GG1A 2V63A 1F8IA 1XYAA 3LZ3A 1M7JA 3R89A 3EB4A 4DJDC 2QF7A 4AZBA 2Y5JA 3M5XA 1JF6A 2JGYA 4H4IA 3G77A 5A8QA 1JEZA 1FWDC 4GQBA 1RUSA 3CMGA 1Q6GA 2J66A 2XZ7A 3CWHA 3K4AA 4HYWA 2YYTA 1Z3NA 3BQ6A 3DFHA 1S3TC 4O0QA 3IGXA 1TCMA 1UUQA 4W7UA 2O7QA 3TP4A 1ZALA 4KMQA 1ITQA 2Z1WA 3R8GA 1XDLA 4BY3A 3SIZA 1V4YA 1V6XA 3TFXA 3N29A 2DZWA 1NTHA 4O1CA 2OODA 3L2IA 2DSZA 4DUOA 1Q2RA 3W7LA 4F48A 2F2KA 1EBHA 3WQCA 3N6JA 5DCEA 1MUMA 1BF2A 3KL5A 3B06A 2UV8G 9RUBA 2Q02A 1PX8A 5AYZA 5D9NA 4BQ4A 5CXPA 1BWVA 1NQ6A 2R14A 2C14A 6TIMA 3NQCA 5BNKA 3SUTA 4DUWA 4BQ3A 1XV8A 1KFKA 2ALDA 4OE7A 1XBVA 2OEKA 4GVFA 3OLDA 1VFHA 1UR3M 2VRJA 4C6PA 5A3HA 3AHYA 4B4FA 3A4AA 3WL1A 1XIIA 4FIRA 1S5TA 2GJXB 4CD7A 3CUGA 3I3EA 1J0YA 3M0LA 4EWND 1P0BA 3EWXA 2YA0A 4QLJA 3S2MA 1VCVA 3CZGA 2XYLA 3GXNA 4TVCA 2XIMA 3MCNA 4O1FA 2POTA 4Z2HA 3TNOA 4J28A 1Q3NA 4AD1A 2PGWA 3LCWA 5F2GA 2XVLA 1K7XA 1WB0A 4JD4A 2GDUA 3NWRA 5I7GA 2Y62A 4JCLA 1OYBA 1R30A 2YDRA 3ELFA 2GGEA 5CZSA 2OQYA 3RM4A 1IYXA 3H2AA 4JTEA 4FLSA 1LBMA 1W0MA 3QPEA 2VELA 3PZUA 4ZO6A 4CD5A 3II1A 3VNZA 1TZ7A 4XX6A 4KERA 1XIHA 4MUPA 4W5UA 1VIWA 1GG0A 2ZVRA 3WK3A 3KVLA 4QISA 2UY5A 3DHPA 3BJTA 3DGBA 3UU0A 5K4XA 5I07A 1MNZA 5LZLA 1J18A 2R1KA 3AMGA 3NZQA 1JCLA 1E0TA 4XKMA 5EBAA 3MHGA 4QEHA 3VZZA 1JGMA 2VX7A 1E43A 5JIPA 3FAWA 1ZJBA 4G1NA 1JJKA 2RDWA 4Q8NA 3A64A 4R3UA 3M0KA 3R8HA 3CO4A 3R8RA 5DCBA 1TPFA 1L0PA 2WSRA 4H9VA 4JYFA 1Q6LA 2VFHA 4W8AA 2D3LA 3BOFA 3IEBA 4JTRA 3MMTA 3RR1A 1CB7B 1BAGA 1X6UA 4BZYA 4JFWA 3UPMA 4CGTA 1G1YA 4GX9A 1UBSA 2PC4A 4DBUA 1O94A 4ZO7A 3AJXA 3W7EA 4DYEA 1IWAA 1UZHA 4E3TA 3GIQA 3M6DA 3NYDA 1MRQA 3BZGA 4OGZA 1XHGA 1OFDA 2WMJA 5HXMA 2CLOA 4C6QA 1HW6A 4LNCA 1J12A 2VRQA 1L9WA 4L4MA 2ZA3A 1CXFA 1LLOA 3ZXWA 4S38A 1WDDA 4W4QA 4P8WA 2GJPA 3WFAA 3DYPA 3O0KA 4G9PA 4Q6JA 2B0MA 1A3HA 3LXAA 2HVMA 3WD1A 3H54A 3T78A 3DEQA 1I45A 1QNSA 2QCDB 3F4NA 4UMAA 3M0HA 1GORA 4KFPA 3W74A 4IWWA 4US6A 4GUHA 2C13A 4PTXA 3BAXA 1G4EA 1QDSA 3NQ8A 1D9EA 1Z9AA 3LHTA 4HNTA 4K2SA 4GBUA 3VNYA 3Q45A 8RUCA 2HBVA 3AOFA 1R9ZA 4PMJA 1S2UA 2J9XA 3WQ4A 2WB5A 1DHPA 4NNBA 4E3VA 1QFEA 4N2YA 3ZLGA 8TIMA 1H63A 1RQEA 2W62A 4JGDA 1SFJA 2WBKA 5G2WA 1J5SA 3UYIA 3AXMA 4KEZA 4TO8A 1W1PA 4UNIA 5A2BA 1XM3A 5A8PA 1W91A 3VIMA 1KTNA 1KM4A 5CBIA 1C91A 2G5WA 2HMCA 4HOXA 3CGTA 4IX0A 4W8BA 4R9XA 3DCPA 2EF9A 1MSSA 4FALA 4M29A 3RLVA 2I5QA 2VGIA 1UH4A 5HPOA 4JDYA 1UD3A 2W67A 8CGTA 2G3FA 1B4KA 4KPLA 1KM3A 4O28A 1WPCA 1LOQA 3ZR5A 4PCSA 2C3ZA 3W70A 4W87A 3U0HA 1VYSX 3GFZA 1PS9A 4HMEA 4XZBA 2JQXA 1M41A 1D3HA 3VOFA 2DJLA 3PF3A 4ZQOA 3VIIA 1L6GA 1XDJA 3KOZA 4QGCA 3WNLA 2AMGA 3HG4A 1QWGA 3BLOA 3WK0A 1XLEA 2VFIA 2PDHA 3LM3A 4XAFA 2P3ZA 2PB1A 1GOOA 3VCRA 5A2CA 4PEEA 5HQLA 3GYEA 4HJFA 4Y9PA 4B9ZA 1BRLA 1M7OA 1IEXA 3H26A 1LWJA 4Z08A 3CV7A 4US5A 4R7WA 4RW3A 2GPTA 1G0CA 2EKGA 4OVXA 2Z27A 3P5YA 4QJ5B 4I6VA 3PNZA 1Y0EA 1R3WA 1NDVA 3V5FA 4O18A 1H1NA 1OFQA 1JZ8A 1Y7VA 2Y7DA 3V36A 3QEZA 4B3LA 3B9DA 4GCAA 3U4AA 4UQ9A 1GOWA 1YIXA 5HUPA 5CSYA 1CXLA 3TTOA 1UA7A 2J7HA 4XVDA 5HWNA 4UUIA 2VFGA 4HMDA 3LQGA 4U3CA 2QAPA 4DXXA 4JXCA 2V5LA 3B4YA 3NUKA 4PL1A 5CC5A 3FEMA 2QCLA 4TMBA 1UZDA 3USBA 1XLGA 3PBYA 4D6JA 4CU6A 2CERA 1VAHA 1PXGA 1FWJC 3EA3A 4QTGA 4OV4A 1TX2A 2NW0A 4E0CA 2MANA 3WH5A 1S2CA 3I7QA 2O4MA 3BO9A 2QVHA 2ZWYA 1G4SA 1V08A 5ABGA 2O55A 3EDDA 5JUVA 1I8JA 3L0NA 1TPB1 1TA3A 2G95A 4JTTA 3TW7A 1K8YA 1BSIA 4BEUA 1Z6KA 1XD1A 3ABXA 4K39A 4A05A 3CZJA 4IFKA 5KZEA 1FKWA 2NX3A 3RO6A 3L12A 2Z1SA 5GJNA 5I00A 1XGEA 4EACA 5A69A 2BXZA 2YXGA 2PP0A 1PCKA 3MVTA 3SFWA 4B5UA 3AIRA 4GZ7A 3GVRA 3WNNA 2VEKA 3GTNA 1KWKA 5T26A 4H04A 1O1HA 3KRSA 4MB1A 3C8FA 4F0LA 4QR6A 1MDRA 3NQBA 3AI0A 3PZIA 4JR5A 3M41A 3H21A 1DXEA 3XINA 3AUJA 5CJMA 1EP3A 3OEXA 4AIUA 3IV8A 3Q58A 1CGUA 7XIMA 2WWDA 2PWHA 3DOPA 4ORMA 2GVLA 3AO0A 2IKHA 4NAEB 1ZJIA 3I4KA 2G3IA 2X05A 1Q8JA 5FSDC 1CXIA 2NUXA 2DQWA 3AYVA 1ZL1A 3P8JA 2QGYA 4QP0A 3ZJ7A 2VGBA 2VEIA 1H50A 2E6DA 3B3DA 3IJLA 3TW6A 3GNDA 1CEOA 2ZX9A 3BSGA 3KHJA 5IHRA 4P7LA 1LL7A 3B8UA 3R0DA 5E0FA 3RGTA 3PBUA 3EX1A 3TU9A 1ZBVA 4JHOA 2WMHA 1OCQA 3G22A 4X22A 5BYWA 4NVTA 4DJFA 3SADA 3UJFA 3OO2A 3URBA 3L4ZA 2IPGA 1NP2A 4LF2A 1S2AA 1Z69A 3BLEA 1JYNA 4YWSA 3RM8A 1JCYA 4FLQA 3W86A 2JE8A 1KFJA 4HU3A 1EXBA 5A1AA 4LAMA 2J7GA 1SW3A 1Q7MA 4IPJA 5HJXA 1OFBA 1Q6FA 3TDFA 3HQOA 4B90A 1E6RA 2J13A 1BG9A 3W7HA 3NGJA 2ZX5A 4ONVA 3CZKA 4MGGA 3VE7A 3S9IA 4W85A 3CH0A 4P7QA 1C7TA 1R7OA 2CITA 3PANA 4GQRA 7TAAA 3SY1A 4BHYA 1PWMA 2OYLA 1TVPA 3WKZA 3HN3A 3WLHA 6A3HA 1XH1A 2XIOA 4KS0A 1F61A 4A3RA 5J04A 4DPPA 1EP1A 2AOSA 2HQAA 2WNWA 3C0JA 4KT2A 3I6TA 2XWEA 1DWAM 4JX5A 3G5EA 4M6UA 3HV8A 3MUY1 2XHYA 4JNZA 4GQQA 4XSMA 3RITA 3W84A 2O9TA 4O52A 4UIOA 4QQ3A 1GVFA 1RJQA 3ANYA 3GXDA 1IGSA 1W54A 3T0CA 2YL5A 3L68A 2WZEA 4B16A 4EXAA 1HJVA 1SMAA 2RJGA 5AN7A 4XZNX 4Z2JA 4LF1A 1D8CA 3IK2A 3MDUA 4GY7A 2PTDA 2QJHA 5H8MA 4ZVJA 2CU0A 4CNTA 4GGHA 3OZPA 1CBGA 4RW5A 2FKPA 2V5KA 4HHLA 1ONRA 3SM0A 5K9CA 2QKFA 4LH8A 1DBTA 1LM1A 1DWGM 1XLMA 4MFEA 1AJZA 1J10A 3SUVA 2Y89A 1KM5A 1AJ0A 1Y5WA 4J3VA 4GC4A 1V79A 2RUSA 3EMQA 4E8DA 4MM1A 4S3FA 3JW7A 7TIMA 4IQEA 4DUVA 1LTDA 1G5AA 1W1B1 3T2PA 2XN0A 4MVAA 3L0KA 1ECQA 2C8NA 1K7FA 1Z48A 2GQ8A 1V6UA 4DO4A 5LKYA 3FEQA 1IZKA 2QCNA 5CGQA 3WDJA 3N4FA 4QNEA 4Q3MA 1WKDA 5EMJA 4HYVA 1UIPA 2GDVA 5G1YA 2OT0A 4IXXA 3ZM8A 3H2OA 3FA4A 3B8SA 4S3BA 1OGBA 3AIWA 1OG6A 4GG9A 2JIEA 3CIWA 4QDMA 2IS7A 1JD9A 4IMAA 3VUPA 4QBXA 2PDPA 3LY0A 3T40A 1YDVA 1UPMB 2WV8A 3QGVA 1G67A 2PWVA 7ENLA 4B5TA 3AMDA 4H8HA 1C8YA 2BOEX 1O4UA 1A5UA 2NQ9A 3R25A 2IXVA 1NJJA 2WJEA 1YNQA 1OF6A 2EPLX 1ZU8A 2V5JA 3L66A 3C61A 4W88A 1LLWA 3O6CA 1EJTC 1RAKA 1FBAA 4O1AA 3VNJA 3W7MA 4FNQA 1R8LA 1WDRA 1XFCA 2BV9A 3KTXA 3LPFA 1ZJHA 4AEFA 3G6MA 4UTUA 5HMSA 2JF6A 3S5OA 4FXRA 2VZOA 4PCPA 3HU7A 5GJMA 1UR9A 2ABAA 2C7FA 4WOQA 4CCEA 2PWDA 1PUDA 3W26A 3QMRA 5HNNA 1ME8A 3UXLA 5AYYA 2FH6A 3PTMA 4NI3A 3AZTA 4XZ9A 3PHAA 3AXIA 4KRZA 4UFKA 3DENA 3BLPX 4LB3A 4UTFA 1I1XA 4HSNA 4U31A 2D2GA 4ILSA 3HOJA 3COTA 1DE6A 1PEZA 3PJTA 4WSJA 2DT0A 5BOEA 1OK4A 1XUZA 2DZPA 2PODA 3HPXA 3RU6A 4AEOA 4RDZA 4ERIA 1XXXA 4BFAA 2CLFA 2OOGA 3GAKA 2DP3A 4Y9NA 4CNPA 3MT1A 4DZIA 3SZ8A 2O9OA 3F5KA 3SCUA 5CSSA 1JCXA 4ZODA 1B31A 1GUVA 3REQB 5LYRA 3TZNA 3ME3A 4U2ZA 3EOOA 3NPUA 3AS2A 4Y9MA 1J01A 2FMNA 1L6SA 1K02A 3CQKA 2FHFA 1UWIA 2XH2A 4CU7A 2TSYA 5HPCA 2ZDRA 2PDXA 4Y7EA 4GY0A 1IIHA 3EOSA 4ZOBA 4LUIA 4GVIA 1CGWA 1O95A 3AXHA 8XIAA 4LVBA 2PLMA 2ZZ3A 3ERPA 3U2CA 1TZZA 3PZMA 1JCNA 3S6OA 5EMUA 2HS8A 1XH0A 3KS6A 3IPWA 1JUKA 4OECA 1EPXA 3E12A 1F76A 3BPWA 5A94A 1OX5A 5LNSA 1TVLA 1EBGA 1Q2SA 1UA3A 1GT8A 2Y61A 3VD3A 3V3WA 1TJRA 4HU4A 3BTNA 5HANA 2WMKA 1F07A 4CQCA 1MQQA 4WY0F 3R0KA 5BRPA 3IJQA 2BMBA 4HNOA 1I2PA 3ARWA 4RV3A 1V3KA 3ID7A 4FB7A 3Q37A 4LBUA 1B2YA 2IW0A 4UWMA 3H55A 1K7EA 4ATDA 3Q2DA 1RALA 3EOEA 3EXTA 4NZ4A 4JIIX 2Y24A 4JHMA 1XLHA 3EA2A 1W3TA 2WLYA 2R9RA 2MNRA 3L65A 3MSDA 2PDWA 4O19A 1ONXA 3ZVHB 3VKJA 3OLGA 3KP0A 4IT1A 3T4CA 3SBFA 5M03A 1EJWC 4IF2A 2AQWA 2X1IA 1D3GA 4Y90A 3KM8A 1JZ7A 4YN5A 3TYZA 2ZVIA 1FH7A 3SB0A 3FHQA 1VJZA 2WZMA 3W2JA 3H23A 3KTCA 1JVNA 2E6YA 3W7OA 1MWOA 4IIFA 4KRTA 1F9CA 2V6AA 4PCFA 1VFUA 1GJWA 4DIAA 2QJMA 4HHMA 3HF3A 1VC4A 1OGSA 3TQPA 3BLFA 2DVTA 3GB6A 1YHTA 5DMYA 4NYYA 3QV9A 3FYPA 1LT7A 1VFOA 3L7RA 4S39A 2WC7A 1THFD 2QCCA 3HFTA 3GSMA 3B8DA 4W84A 1OM0A 3FK4A 4LYQA 3NO5A 3CM4A 2E0PA 2VWTA 1JIBA 2QPUA 3EXRA 2PDNA 4HA1A 2VX4A 1ZHAA 3ABRA 4PTNA 3UYCA 3MC5A 3F4CA 4IL0A 4YL2A 3SGZA 1DVJA 5D38A 1ELSA 1IQ8A 4J3TA 4IIBA 2IKGA 3C52A 2YFOA 5F1UA 4LRSA 1KFWA 4Y6GA 3QFWA 4PMZA 4H8VA 1UQYA 1RA0A 3MJMA 4LXFA 5G1TA 2CFFA 1M9HA 1OQFA 2J6VA 3MW7A 5C2XA 2OZTA 2XIIA 1K8CA 3M46A 1REQB 5J5DA 4A29A 3WBWA 2HCVA 2REQA 3KZPA 3GKAA 1XLCA 3G0XA 2OWXA 3EX4A 4FO4A 4IICA 3UJRA 1EX5A 3WEOA 3WD0A 4NXSA 1P1XA 3GKFA 1MMFA 2VEMA 3ZT7A 3ZWTA 4BR1A 5FI8A 1IIGA 3HM7A 3QKZA 2PTWA 2QCHA 1W2PA 2WVTA 4C6KA 1OFAA 4HA3A 3H2FA 1PDZA 5CQ1A 3G6LA 3RX2A 3WSUA 1PV8A 2YBTA 3GE7A 4AZ6A 3LGEA 5LGXA 3T81A 4DWSD 4TTGA 4PTDA 3ITGA 4V27A 4REQA 4CN4A 1PZ1A 2YL6A 4H2HA 2QIWA 4LU0A 4YTQA 4IPLA 3SRHA 1ADOA 3PZVA 1E9ZB 4R53A 5CJ5A 2VO5A 1MVYA 4FEZA 4AIEA 3B97A 3W2MA 4IH3A 3C6CA 1W5QA 1I2QA 1UR4A 3LGDA 5CG7A 3DBPA 3QC3A 2YFNA 5CAHA 5F2IA 1FH9A 4LYRA 2I1OA 1WX0A 1GG1A 2ZA2A 3C2RA 3KL3A 4DWSC 3FAXA 1O66A 5FACA 1KKRA 2VR5A 5D9PA 3VDAA 1Q4NX 3CIXA 1W5OA 1LG2A 2CETA 1CGXA 1SO4A 5AC8A 1I75A 1KV8A 1KRMA 2W63A 1MRAA 4DEFA 3GAYA 5JBEA 3JRKA 4K7VA 3GS6A 1TFVA 2NQ5A 3ZSTA 2XIBA 7REQB 1DYSA 2ZXQA 1EGZA 5C0QA 3I3DA 1VS1A 1PTAA 3HTWA 3W7DA 4DJDA 3V4BA 2PZNA 2XVNA 2HWGA 1MDLA 4L9ZA 4WCJA 3LERA 4S1FA 1CIUA 3NZ1A 1SUXA 4U5KA 2PURA 1SFTA 1REQA 5JMUA 4GI6A 3NZRA 4NI8A 1EIBA 1VBRA 1MQPA 2YYUA 5FAGA 3WD2A 1TJ1A 4DUXA 3S6DA 4IGMA 4AIOA 3PWIA 2OX1A 3NJ3A 3KZSA 1FH8A 1YXCA 4K36A 3GG0A 1JF5A 4NUWA 2J8GA 3BMVA 3VNKA 1X39A 3VIFA 4JBRA 3MANA 2Q8LA 4UZSA 4M6PA 1JPHA 4GKTA 2BY3A 5EPDA 4ZFCA 1BRLB 3T55A 1R2SA 3S42A 4HTYA 5LIKX 3PPFA 1K8XA 4FX6M 4O17A 3AIEA 1DQWA 2VP8A 4OU1A 4O11A 1U1HA 1VPXA 4DO7A 1E1CB 4U5IA 3NXLA 3PTKA 2WCAA 1I4NA 1Q6DA 4AZCB 1TJ2A 3ABOA 2OQLA 5A2AA 4R85A 1V3HA 3IV3A 1EGVA 3ZJ6A 1GHSA 4JX4A 1BVWA 2RH9A 1NSJA 3PY2A 4M8UA 3E3HA 2VEFA 3VDCA 3T05A 1EC7A 2WHKA 3AHVA 4BF7A 5REQB 1FWIC 3S5SA 2QGHA 3O0FA 2CLKA 1XCXA 3MUXA 3K8LA 1GVSA 3C8NA 1YE6A 3AS3A 4D9PA 5DANA 2J78A 1QXLA 1W9UA 1ZP3A 4LALA 2GJRA 2WJDA 3I68A 4TIMA 5F2MA 1FDZA 1JCTA 2PWEA 3ARSA 1ICSA 1YDYA 3A3XA 2E6AA 2TMDA 1XYCA 3QTGA 4B5XA 1XQKA 1JXKA 5LNRA 4POCA 4DNHA 1DJYA 3B0PA 1QI4A 5MHBA 4PMYA 4GO9A 4A2RA 1ISZA 3RLGA 1DOSA 1TPDA 1VRDA 4K7YA 2EO7A 3GG8A 4JTSA 2P0OA 2ZUUA 2OZ3A 3ZOAA 5CJNA 3U6WA 3NOYA 4ZA0A 1F4HA 4IL2A 2Z29A 3KCOA 3VZXA 3Q4DA 1GVQA 4L4LA 2VZTA 5FCZA 1EF2A 1QNOA 3AXXA 1UKPA 3OQEA 3FJNA 3NYZA 2ZUSA 1UWTA 3TNBA 4GVHA 3U8GA 4AVFA 4CNNA 1S2WA 4L80A 4FNTA 2RDXA 3MMUA 4AUBA 3FA3A 1O68A 1EUNA 2UY4A 1GOMA 1EOMA 5CPMA 1M7PA 3APTA 1ONWA 1TTPA 2D20A 4DHGA 4ERGA 3L4TA 4MWAD 3FVMA 1EJUC 1TV2A 3N14A 2RFGA 2D0GA 1E55A 1JDFA 2QS8A 2G41A 4UNLA 1X7FA 3KOFA 2JBMA 4GVGA 3LGGA 4H8UA 3TLQA 1CECA 1IWPA 3PJXA 3UXKA 5TF0A 3E5BA 2BGNE 1VPYA 2ZX8A 2Y7FA 3GXIA 4CQBA 1CDGA 1XS2A 4UXDA 3AMKA 3VGEA 3W4RA 3FOKA 1ISXA 1V3LA 3VIHA 3WO8A 1ITCA 1YTKA 3N9RA 4UMCA 5IXEA 3RYSA 3QTPA 4PULA 3ORWA 1B3VA 3NNTA 3SUUA 4PB5A 3NTYA 3OYZA 3ARZA 2ZZ5A 3SY8A 4UQBA 3CUZA 2EXOA 4AEEA 1QMLA 4KWWA 4Q4MA 3UWQA 2XFFA 2VFFA 4GIYA 4LBSA 1OWQA 4B5SA 1IZJA 4KIRA 2Z1VA 1WUEA 1QRQA 3N19B 2PLJA 3U7VA 4JEQA 3TN4A 4TMCA 2J25A 3ZSSA 1W9BM 4XBKA 3STFA 3TAKA 4PRTA 1VGAA 3HA1A 4DM1A 2H6RA 1CLVA 3RF9A 4MTVA 1ZBWA 3IJDA 2PU0A 4UQEA 3EWCA 2Z1XA 5AHFA 4YVXA 1E4IA 5JH2A 2CPUA 1HXJA 3CZ8A 4Q8WA 4OBRA 4WRHA 4I9JA 1ESWA 3F03K 4J3SA 1EUAA 5C2CA 5C9XA 3L4VA 1XG4A 2ADAA 3QZEA 4O4VA 2QIIA 1OBAA 4NL1A 2WANA 3WQ8A 4OWGA 2YA2A 3FFSA 1V0MA 4C6EA 2W4XA 4LFYA 3CTLA 4QDPA 1UD4A 2VT0A 4MZYA 3VFCA 4W7VA 3N25A 1WP6A 4MJ2A 2WMIA 4N4PA 3NQDA 3VNIA 3G1DA 1KXTA 1RXOB 3GR4A 2ZADA 2Y88A 3P6LA 1KCZA 3R4IA 3UXIA 4GYFA 3WN6A 5CLTA 4NX0A 1S46A 5HR7A 3O6AA 5A5WA 1KBIA 3W83A 5IRPA 5EY5A 1SVDA 1FQ0A 3GWQA 3UFYA 2YCLA 3DH7A 2F61A 3U9IA 4GFSA 4NZ3A 3QR3A 1JXJA 2FFCA 2V8ZA 4Y8EA 4LUYA 4X2PA 1FUYA 5J5RA 4MF4A 1A5BA 4XKYA 4HU0A 1DXFA 3G0UA 1SZRA 2PDJA 1XBXA 2WC4A 3M7SA 4D6HA 2YLLA 2WCGA 1RLCL 1YPFA 2CLHA 5FL0A 1KCKA 1FHDA 3WIJA 1QHPA 4BF9A 1QOXA 2G3JA 1E71M 4DBDA 4ZEPA 1F05A 3G24A 1J96A 5JXQA 1I2RA 2YDAA 1QOQA 4DNMA 3H7VA 4O8AA 3CZLA 3VGFA 2QNEA 5KTLA 4XD6A 1XCFA 2IXUA 1ODZA 1B30A 2A3CA 1AH0A 1CB2A 2PCEA 3S6TA 3CYJA 4W86A 3GK0A 2FB3A 4RNJA 1GYNA 1J2WA 5D2TA 1ONEA 4JTGA 2YCEA 4HZ7A 2BOFX 4UTLA 1E1EA 3D6NA 5C5YA 3M0ZA 3KS5A 4LNYA 1Q6CA 4MWAA 3W0KA 1VEPA 2NQHA 2YOCA 4FNSA 1VP5A 5BOOA 5AYXA 5CPOA 3WDRA 2HVOA 4F2UA 3NL2A 5E0CA 1R0MA 4A8IA 1PIFA 4AXNA 3EWBX 4IZGA 3U7BA 4E8CA 5HNTA 4H9ZA 5AB3A 1NU5A 1VH7A 4MLRA 2BODX 1G9HA 3WJWA 4QNWA 5HWMA 4V28A 1KO0A 1W8GA 4AY1A 3GDLA 2YGYA 3NVTA 4GJIA 1AH3A 2FGZA 2WSKA 4WQ6A 1JAEA 3CL8A 4WGXA 3SRDA 3USZA 5AECA 4WX2A 1SYTA 2VOMA 1HJXA 1NWRA 4JYDA 4QIUA 2ACSA 4K1GA 3P82A 1UKTA 1EOKA 1S1RA 2VGFA 2JK2A 1XUUA 3IVTA 4DPQA 4BEQA 1UKQA 2ESCA 3EPMA 4XKYB 1Z32X 3VIJA 1TRIA 3CQHA 3IJ6A 4FR1A 3N6HA 1JPDX 8A3HA 3GNPA 1M53A 1B0IA 2R6OA 4H1ZA 4F8XA 2X0YA 1XLJA 3TWBA 3PTQA 3RMEA 4YTTA 4FK9A 2QZRA 4XZWA 1F6KA 2FIQA 2XVPA 3WNKA 3UGRA 3GD6A 3M47A 2OFJA 5D33A 1B3WA 2VZSA 3G1YA 1LDCA 3DFOA 4ZSTA 4W9TA 5F4XA 2J8TA 3IGSA 1DXIA 3IARA 3WELA 1KRCC 3ITVA 3VGDA 4J2MA 4LB4A 1JZ5A 5DT7A 3LRMA 3BV7A 3T44A 2C18A 2V38A 4XD5A 3WX7A 6TAAA 1QPRA 3U57A 2GUUA 1J0ZA 3OOQA 5C7VA 3UR7A 2BY2A 2UY3A 2VEGA 1RK6A 1RV8A 2HXUA 4GH1A 2G4JA 2QDEA 3CHVA 1LCOA 2V0TA 1XCWA 2Z1BA 5IHSA 5D2XA 4TR9A 2YDSA 3BG5A 4PMDA 5FESA 4R34A 3EWYA 4MY8A 3GXFA 1X6LA 3AHXA 3QY7A 3SCVA 4MJ4A 3R10A 3N2BA 3VMNA 1LF1A 1HJUA 1HN1A 3ZR4A 1FWCC 1BYBA 2QJNA 3CUJA 1PBGA 1UHVA 3IUDA 3LMYA 3S46A 2C0HA 1PKNA 3GNNA 4C6LA 3G1VA 3P3BA 2ON3A 3GHRA 4MIMA 3VNLA 1HNYA 1DWJM 1RY8A 1WDQA 3AAMA 3IIXA 4NAFA 3P2VA 2IPJA 4JTAA 1R2RA 4ZL1A 1WZKA 2QUTA 3VYLA 3CL6A 3UCCA 3W9ZA 3IJ8A 4CUCA 1C3FA 4E5TA 3UD6A 2AL2A 1A50A 3I3BA 4JX6A 3OVRA 2FVMA 1DJZA 3WMBA 4D6DA 4O14A 1W3KA 1G4TA 3PBGA 3OVQA 1H49A 1HL8A 2ZKMX 4XUGA 5DBTA 3OVGA 5AYBA 2I9UA 4O57A 4ERAA 3V7PA 5CZKA 3TOYA 3HZ3A 1XLIA 1TPEA 2VURA 5I23A 1DKWA 1RH9A 1JPIA 4LY8A 2CBUA 3PG9A 3VE9A 1YX1A 2PTYA 4YTSA 1K6WA 4GISA 3CPUA 3ARXA 1LOLA 5K7JA 1XIJA 3WQ6A 4GXWA 4GYJA 3OLIA 1JI2A 3B8VA 2OGJA 2DT2A 1VR6A 2XVKA 2V30A 4N0RA 3EPOA 4A3HA 4IQLA 3CWNA 3JR2A 2ISSA 2PFHA 1U5JA 3M16A 1SJBA 2IKJA 2OU4A 1XYMA 5LXEA 1SFSA 3JZUA 5FAJA 4GUJA 4C1LA 5FJUA 5C9WA 2BY0A 3IK4A 1POJA 1SQ7A 3LNPA 1L8NA 4I5RA 3N4EA 2D3NA 4MUZA 1X38A 3QLLA 6ALDA 4MKNA 2OX4A 1TQJA 5IM51 1FWGC 3EAUA 3ANUA 3SI9A 1GQLA 3S0CA 3H2NA 3BW3A 2Y5EA 2YXXA 5D8ZA 1TJPA 1EA0A 4QQUA 4WJEA 3WMLA 4UR7A 3TMLA 4W89A 1E5NA 2Y7GA 3GVVA 3TTQA 3PS7A 4FX7A 3QQ0A 3VKBA 4OUEA 3AISA 4BKNA 2F38A 1CXEA 4I9AA 3PZNA 4GWEA 4LS1A 5D02A 5FF3A 4TUFA 2V67A 3DKJA 4URIA 1LQAA 2ACRA 4S3EA 2PDIA 2VYOA 3K5XA 1VQTA 3K1DA 3KBSA 1ADSA 5LA1A 4J2PA 3RCNA 3O7UA 2O9PA 3LI0A 1J79A 2RKXA 5I02A 2E1WA 3KBJA 5ABHA 4E2OA 4HKPA 4JTCA 2J7FA 2NXIA 3MTWA 3U2EA 3PC0A 4CCDA 3P14A 1WXYA 3C86A 2C1IA 2FZNA 2BXVA 3QY6A 5LNUA 3E2RA 3PUDA 4Q6XA 4GI4A 4O15A 1BXNA 4U28A 4M7SA 3LTYA 1YXYA 1V02E 4N02A 4ZGYA 4P2VA 4XAGA 3WMCA 4GJ1A 3CHFA 2C1GA 2E40A 2HROA 2OB3A 4KKXA 1XG3A 1W2VA 4QJ3B 1RQHA 3VM5A 1FTXA 1QASA 2F6XA 5C6MA 1HFBA 3UR8A 3MHUA 1U1UA 3NDOA 4GCXA 4CVUA 2YX0A 4O50A 1PYFA 3DFSA 3GC4A 4V33A 4JTHA 2W66A 5BROA 3I4EA 3HJZA 3EDKA 3LU2A 3OLEA 1BYAA 2FZ9A 1RR2A 3WNMA 2FJUB 3AJ7A 1TCDA 3TYEA 2X1RA 1FWRA 4DYJA 3PJUA 3MZ2A 3W25A 2Q8XA 3CH9A 1WO2A 1O5RA 1WDPA 3OBAA 4HPNA 3SFKA 4JIEA 4LW7A 4HPGA 3GHSA 2NQJA 2HBXA 3QOKA 1RPXA 3OGVA 4JIHA 3L67A 2DH2A 1UOKA 3DGRA 5HAOA 4AYSA 1N8WA 1EEPA 1D3CA 4TTUA 3BLLA 3N6QA 4UNKA 4MY9A 1VZWA 3OZYA 6CGTA 3UXDA 3WF0A 5CZJA 2VC9A 4J7RA 2EQDA 2J77A 5E70A 2J9ZA 3GDMA 3POCA 5HBFA 1SU5A 3AMLA 4ZE5A 3SRKA 2Y0FA 3S2JA 2XGZA 3W7IA 3N3TA 4RE0A 1C93A 3NQVA 3I7RA 4CN6A 1T96A 2V5CA 1LG1A 3BANA 3W7QA 5U7SA 1R5YA 1XBZA 5G1MA 1D7FA 1MUWA 2R1NA 3OIHA 4UTJA 1M04A 5M17A 5D09A 1HG3A 3O06A 4LEFA 1JCJA 1WV2A 1DWFM 1EJ7L 3KRBA 4A3YA 1XW8A 4H3DA 1HKKA 3CO8A 5LIXX 5XIAA 1XINA 1RK5A 2QQ6A 3SW6A 4PB3A 4J9JA 3M5VA 3WQOA 4MKVA 2QR6A 3GR7A 1YBQB 2EAWA 1IR1A 3IJ7A 4LC6A 5DELA 4HZMA 5H2ZA 2OXNA 3VX0A 4ZB5A 4R9OA 3ENLA 1MO0A 4JQ2A 5CCZA 4LUSA 1ZPTA 4Z2GA 4ACZA 2ZDSA 1UP2A 4DJEA 2YPIA 3LA4A 4IMGA 4JN6A 1KV5A 1MFUA 2ACQA 2YB1A 4UR8A 3H4XA 5AHLA 1ZBKA 1F3EA 4EXQA 2NSOA 3ARRA 2NUYA 1UW9A 1KRAC 1VD6A 2E9LA 1DJWA 4KGLA 4S3GA 3IS4A 2GGGA 3OA5A 1QW9A 3VZYA 4AU0A 1P0EA 4FZIA 1NP0A 3EB3A 1QI5A 2JIWA 1F8MA 2YW4A 3GC5A 3VI2A 4EF8A 4Z42C 1DWIM 3MJYA 3UF9A 1TWIA 1WAUA 3EWWA 4CD6A 2VHLA 3UJEA 2GSEA 4WSHA 1PKYA 4DI9A 3BAKA 2MUCA 1CGTA 1V0NA 1JAKA 3LPPA 3FW6A 1IT0A 4HCDA 1TREA 2YIHA 3MO7A 4ICNA 2BVTA 4PC8A 3F4WA 4UC5A 5FEXA 3NL3A 4AW7A 4QG6A 4J4KA 1K3UA 2ZQ0A 3EZ4A 1FWSA 2CHNA 3ANVA 3VFLA 1S5VA 4PMXA 2PP3A 5B7YA 3MWCA 4JZ5A 2CZDA 2WVVB 3BOXA 4JTUA 3EWDA 1BYCA 1QO2A 3UR5A 1LBLA 4C65A 4JKKA 4Y96A 3G2GA 3MKKA 5AFDA 3HQNA 3T1GA 1PHQA 1FFRA 3PK7A 3BMWA 2HPMA 3S3GA 2QUMA 1V77A 3GVQA 3KOXA 9XIMA 2Y8KA 4WKFA 5TAOA 5BMXA 1NWTA 1JQVA 1UR2A 5CPNA 3S9ZA 4JCMA 4DZHA 3V5OA 1BFNA 2W3ZA 3E74A 3W1RA 1ENUA 4RE3A 4P7RA 1MZRA 3TYAA 4HNLA 5BRBA 1C90A 3APGA 2RGLA 1VCGA 2OZ8A 4AX6A 3QW3A 4PSRA 3JZEA 5ABFA 4ACYA 3WUEA 1AD4A 3A47A 4FPSA 2TPSA 2WMFA 5EGRA 5KITA 2OR2A 2Y2WA 4TVDA 1KFEA 3UY7A 2X09A 2YZ5A 1OX4B 4JY8A 2ZXBA 5A6MA 2I5GA 2Q3RA 1EC9A 2NQLA 4A8LA 4MNJA 5AHNA 3ALGA 1XIFA 1EDGA 1HJQA 4PODA 1GOKA 4QITA 1BSLA 3DECA 2XFRA 3H53A 3E6EA 4MAVA 4UZUA 4F66A 4OT7A 4P61A 3CL7A 4IP4A 1F74A 2X16A 3VXGA 2PGRA 5D32A 3H7RA 3P0WA 4XVEA 5EMMA 4JPGA 1E72M 3OIXA 2A5HA 1UZ4A 1A0DA 1T40A 4PRWA 1P7TB 5JBDA 3KVJA 3OBEA 4AZGA 4E8GA 1SZEA 3GDTA 2W0UA 1R7AA 4IFRA 3VNMA 3BAYA 4LEQA 2H90A 4Z1AA 4LSBA 2AGKA 3UY8A 4ZQCA 1A5LC 1QOPA 1IF2A 4C6DA 2FZBA 3GXPA 3FXYA 4B15A 3DX5A 4ZB0A 4E4FA 2ZRUA 2VNCA 2XH0A 3EEZA 4E2DA 5FF4A 1W9XA 4GIRA 3MYOA 3BH4A 4JTFA 1YNYA 3AUOA 3LCHA 3MQTA 3WF1A 5A6AA 4N4QA 3C0QA 2QW5A 3FYYA 1S3HA 3OYXA 1M6JA 3KBNA 3A5FA 1W1YA 3CS2A 3A22A 4F4RA 3B9OA 3NM1A 2DSVA 2I14A 4PMNA 3SEPA 2JKEA 4EE9A 3PFMA 2DEPA 1OYAA 3L2LA 3A13A 3S4TA 4Z0SA 3N9SA 1G69A 3UESA 5CEWA 4ZENA 1SJCA 3CHEA 1AVAA 1VHNA 1EHAA 2ZCGA 8XIMA 2PBGA 3KDOA 2A3LA 1V0KA 5HJLA 5DMMA 4XIMA 2VEPA 4DBEA 4IPIA 2PRMA 4RNIA 3MP3A 2NWSA 1XRTA 3B05A 2P0IA 4CN1A 3W71A 1EQCA 5H8UA 4EANA 2FZ8A 2WVSA 4TQTA 5A8NA 4GI9A 2NLYA 2E9MA 1PZ3A 4V1YA 1GEHA 1U30A 4O0ZA 1YTDA 4GY1A 1DEDA 3N13A 4AY7A 2GWNA 4NIRA 4HOZA 5A6SA 2HV5A 5KEZA 5H91A 1RP8A 1BPLB 2AMXA 3RILA 3GM8A 3KUMA 3MWAA 1HVXA 3ISIX 3U2ZA 4EAYA 3NQFA 3ITYA 4H9TA 4S3DA 3CUFA 1W9DM 2BTMA 3GDBA 4Q8PA 1QO5A 2J7BA 5M2FX 2ZE3A 3KWXA 3VINA 3QW4B 2A7NA 3CQIA 4OOUA 3TX9A 1KWGA 3VM7A 4P8XA 4LAZA 2X2YA 3CAQA 1AH4A 3CBWA 1NQKA 1YRRA 3ZT6A 3C0SA 4BF5A 2NT1A 3HFYA 4OBSA 1SZFA 2VDHA 3RNDA 1B3XA 1XJBA 2PGEA 1KFBA 1UD2A 5K9XA 1EYEA 3W7PA 2KX9A 4TX8A 1PTDA 4GOAA 1QK2A 3LD5A 2AL1A 1Q7ZA 1PKLA 5HWJA 3LZ5A 2IUZA 3RN6A 2H9AA 1LUCB 3AQUA 2YB4A 2Z2UA 1NFPA 1Q8AA 4ZOCA 3W27A 2PCQA 4LANA 3WQFA 3BDKA 3K30A 3T8LA 4B2DA 2Q71A 2J27A 3GH4A 4BJHA 4Q8TA 1HL2A 2IPWA 1E0VA 3KP1A 4JOMA 2A6NA 3R11A 4DM2A 1V6TA 4Q4RA 2QULA 6REQB 2WLZA 4GLEA 5LNVA 1AA1B 1JPKA 1KW1A 3AU2A 2J24A 3NXFA 1LT8A 1XYBA 3CB8A 1SMDA 4NY2A 3UWEA 4KFNA 3WBEA 1XD0A 2G97A 1U33A 1UB3A 1KBKA 2GOUA 3AALA 4IISA 4Q4QA 4FIQA 2PDLA 4YVVA 4M56A 3THDA 2D73A 3WQDA 4O1EA 5DMNA 1ME7A 3CASA 3PZ9A 1R87A 4QS6A 1YNPA 3PM6A 5I2UA 1DORA 2YW3A 2BG5A 2FVLA 5I5RA 3LBOA 3QHOA 1MEIA 4EOUA 1W5MA 5FEPA 1UWUA 4AD5A 6ENLA 4Y2WA 1KLYA 4HPXA 4IMFA 3PBVA 1J5TA 3DFYA 3WQGA 1IXQA 5AC4A 1W3IA 3W82A 3U5UA 3WEMA 4DB7A 2YXOA 3SCPA 4QCFA 1UASA 2CZFA 3T0BA 1OIFA 2HSAA 2VDGA 3S9YA 2Z2AA 3LX9A 4XD3A 4KCWA 2PTXA 1DQXA 1UD6A 1NVMA 1DJNA 3PB2A 4C6NA 1GVRA 1T8QA 3WH9A 4J3XA 4S3CA 4BCEA 4FNRA 4X63A 4A6GA 1K9TA 1KBLA 1KC7A 3E02A 5DXXA 4EVZA 5U4NA 3VMPA 3HG2A 3AZRA 3QRHA 4C6BA 1X97A 1WNOA 3UZJA 1MUCA 3NEVA 4PFHA 3QBUA 4G5DA 2EPOA 2YCIX 4GYKA 1GYLA 3PBMA 1OZMA 2PTZA 3UETA 1LP6A 5LA0A 1H60A 4DWSB 5AVHA 1JQXA 2HZGA 2DUZA 1H4PA 2O56A 3GFYA 3SY5A 2VRKA 4LUSB 2VZUA 4LV4A 2VL4A 3WLQA 3A4XA 2XVGA 3VCNA 4AWEA 4PFMA 3UZYA 1RZMA 2PS2A 3M9YA 5AHIA 1V03A 3ALFA 5FEWA 5FJJA 1SR9A 4XTIA 3GNXA 4KETA 3WUFA 3PN8A 1OFEA 2G37A 4K68A 2WO5A 1QTWA 1QT1A 4E2VA 1HKIA 3APYA 4D8LA 3EX6A 4MWAE 1ZFJA 4R33A 2VENA 3AS1A 3ATYA 3RPDA 5AC6A 2X40A 4IQDA 1A5OC 3BW4A 3LCIA 2DORA 3DC8A 2ANUA 3UVAA 4K8EA 4LCSA 3O15A 3CU2A 1KFLA 7A3HA 4ZSUA 3L0GA 4IOTA 2QJJA 3ARVA 1IEQA 3WK1A 1L6YA 2LLEA 3SSJA 3EX2A 5KINA 1JNEA 4V1XA 3W1NA 3GQYA 3L4WA 3RHGA 3SCNA 3SN4A 1PO9A 3E96A 3A12A 4RNFA 3MS8A 3WFZA 1TWDA 4X61A 3WEZA 2NXHA 3OQ8A 3T4WA 2V3EA 3OA3A 4UOZA 4P8VA 4QJ4B 1TWSA 3UZWA 4G8TA 3TZFA 4C5YA 2OO0A 4ADTA 3S8HA 4XQ6A 4D1IA 1XQLA 5BXSA 1QNPA 4MHBA 4EX4A 4AFYA 3UPBA 2DZSA 1VJSA 1NIUA 1FHUA 4PUEA 2GWGA 3GY1A 1HKVA 3AIVA 5DX7A 1SO5A 4AWSA 1H7XA 2YCKX 1GK8A 4L7ZA 4Q8UA 1S5WA 1EO5A 1HF6A 5DT5A 2NV2A 2DU2A 3HURA 4TV6A 2WWCA 1A4MA 3O07A 1B4EA 5A95A 2PP1A 2Q3OA 4XK2A 1YPXA 2R91A 2PEVA 4OQVA 2F84A 1H51A 1KRBC 4IIDA 1XKYA 1US3A 3SCSA 2Z2BA 3M5ZA 4JKLA 5FF2A 5A8OA 2D23A 1L2UA 3EDFA 2HS6A 3W38A 3FLUA 1LL4A 1TQXA 1W9VA 5E93A 1AW5A 3CMFA 1AD1A 3KAOA 4G56A 5DRCA 3VPLA 1QNRA 4Z1BA 4JTKA 2VOTA 3MPGA 1NF7A 1VFLA 1DTUA 1WBHA 2DY3A 4HSHA 4A2SA 3DFTA 3CXOA 3URQA 3EWZA 1B5TA 4AX7A 3CV1A 1RD5A 3CWOX 2A2IA 3WJSA 5I3DA 1ZAHA 4LV9A 3PZOA 1A3XA 3L5LA 2VZVA 3GIPA 3MSYA 1QK0A 1LUCA 5HA7A 2PDYA 1O5QA 3KXQA 3A3HA 3NEHA 5I3HA 4I3GA 4ZBCA 1I0DA 4HK6A 1V7AA 2GVEA 2ZX6A 4YCPA 3B8TA 2CWNA 2ZUTA 4FNUA 3LCGA 3T8QA 1TPUA 2Y6ZA 2EPNA 4Q8VA 3B0XA 2P10A 4A35A 3TTEA 2C79A 1HJWA 3M7WA 3O9NA 3MCMA 2RDUA 1A5CA 4UTTC 4WY0A 2GSJA 2CW6A 4INFA 2EJAA 5HATA 1PJ9A 4MWAB 2CLMA 2GZXA 3UT0A 3V0TA 1TTJA 3AYTA 3TYBA 3IVSA 3SUSA 1UG6A 3W1PA 2DSUA 2IPFA 1GVIA 4GHRA 4HIBA 4RDVA 3CUXA 1E40A 4IMCA 3LV6A 2XSAA 1XH2A 3LDVA 2QVNA 3B0YA 3TN6A 1FWEC 1PWLA 3TH6A 4IGSA 1POKA 5GNYA 1FXQA 1T8XA 1C29A 4H6EA 2WJZA 4AQLA 3ONCA 3S2CA 2X0HA 4Z0JA 2VKZG 4GK8A 2E67A 4RL3A 1C7SA 3W7NA 1BTMA 1X98A 2OT1A 4MB5A 2VCBA 3CJPA 3F5LA 1AL8A 1OB0A 3THCA 1SZNA 2VUNA 2PE4A 1TPC1 2J75A 4AAJA 1WAWA 4PUMA 2B4GA 4UTTA 4GO8A 2QDHA 1G7VA 3GTHA 4N9CA 4M0XA 4DZAA 3SQSA 2ATMA 4N42A 2DFAA 1IT8A 1E0XA 1DTNA 4KFOA 3FGCA 2UBPC 2DUAA 5F7UA 2E9BA 1LRNA 3LEPA 4U33A 3WYZA 4RJEA 5FL1A 2FGBA 3T42A 4B91A 2Z6IA 5E6YA 2P3EA 1W3HA 4EPBC 3CLMA 4IGNA 3T0TA 4P5UA 4NAEA 1MZHA 3PWAA 3BARA 4LUTB 1DIDA 5HQMA 2PWGA 3CIVA 5F4WA 4C91A 3LLDA 5KMYA 4AC7C 1UD8A 4PRRA 1AJ2A 2E7FA 5CAKA 1B1YA 4CEXC 1TA3B 3UNTA 1ZP4A 4DN1A 4HCLA 1YPIA 3I6RA 1H3GA 2WKLA 2PBOA 3CEPA 1U5HA 3DZ1A 5AZ0A 2AQVA 2XM2A 5I09A 3BC9A 3A9IA 1KM1A 1R6WA 1A5AA 4N6FA 3S1VA 3SCOA 3IIZA 3ATZA 2B7PA 1E0UA 3BSMA 2XINA 4OV9A 2BVWA 3SSZA 4DVOA 2C19A 1H0IA 1C8XA 2WK2A 2P76A 2HXTA 3V1HA 3GH7A 4D6CA 2EKCA 1CNVA 4DF1A 3W22A 2PPGA 3LHUA 5A6BA 1XFBA 3ZLHA 3QSRA 4YNGA 3M07A 2HNEA 2DH3A 2Y85A 1KB3A 1XGZA 2QJIA 2TAAA 1OIMA 4AY8A 2CLLA 3W6MA 4PUUA 4KEVA 1J6PA 4QRNA 2OPJA 1FDYA 1S2TA 1K4HA 2FDMA 1XBYA 3DDMA 4WR3A 2VCAA 4H6QA 3EXSA 4B3KA 5IBXC 3RPTA 3IUIA 5CPTA 4QE4A 2ZUNA 2ZZ1A 4O8RA 4GX8A 4MB4A 4Q7BA 3HQPA 1IXPA 2V2HA 3QQ1A 1QW8A 4ZR8A 3B9AA 3WMSA 1A0EA 4QE1A 3QM3A 1MEWA 4KQNA 4AB4A 1O1ZA 1LQ2A 1CZ1A 3CC1A 4BWLC 4A3QA 3AHZA 4EPDC 3OJGA 2Y8UA 3C2VA 3E38A 3W53A 5FEZA 1Q6OA 5GVJA 5G5IA 4MZ8A 1AW2A 2CBIA 1OFPA 2YSWA 3AFBA 3NDYA 1E4LA 3ITCA 4CQ8A 1EO7A 3I10A 4NZCA 3B8IA 3HQ1A 4KRUA 3W76A 3E5PA 4KF1A 1F7BA 5LHEA 4MAZA 4S2CA 1V3MA 4DJEC 5KZ6A 4IJBA 4JTIA 3SRFA 4DI8A 5D8WA 4YHGA 2OWWA 5D03A 3R43A 4LUTA 1VLWA 1I6NA 1OEPA 1L6WA 4UTWA 3EGJA 3CMJA 4A21A 1OCJA 3LHVA 2WQPA 1SJAA 2GK1A 3TVAA 3CV6A 4NX5A 3P67A 4NKCA 4LAKA 1UJQA 1XKJA 1YYAA 4Q4SA 4PUDA 1US0A 2Y8VA 4XZLX 3LB0A 3TUUA 3VKDA 5GJPA 4QFUA 4K3ZA 4AIBA 5CC6A 4O0KA 1K77A 1Q65A 4PMUA 5LXXA 2CXEA 1YTEA 2H9AB 3HGSA 3ITXA 4L65A 4NJGA 4LVDA 4HK5A 2ISFA 3WDQA 4UMBA 1V6YA 4GE8A 3WQPA 5A6TC 3WL0A 3E2QA 5HNUA 3WD4A 1JDCA 1Y8BA 1PTGA 4J40A 3QHNA 2FZMA 2NWRA 4QG8A 5DBUA 3NO1A 1ISWA 1N55A 1BQGA 4UBPC 3AWOA 3I7SA 4R7JA 1ISVA 5JQ9A 4JHZA 1GZGA 2B31A 3EOUA 3TFCA 1H5VA 4XV0A 1X8FA 3QPZA 3B9EA 4I8YA 1UP0A 1R3QA 4HJWA 3VDGA 4LAOA 2G0WA 3EMZA 4GXPA 4QROA 4JDBA 2DPEA 1X6NA 3VIGA 2V2DA 2ZA1A 3RG6A 5KSWA 1EKOA 4I90A 1WE5A 1XRFA 4M82A 1TV3A 3DKLA 3N2TA 4MWAC 3DG3A 5CPSA 4XAZA 3CEUA 3TC3A 2VUYA 2R82A 5I3FA 1JR1A 3SQLA 4PE8A 3BICA 3SURA 3W1QA 3N3MA 1P6BA 3IIPA 5C9ZA 4M80A