1J01A

Crystal structure of the xylanase cex with xylobiose-derived inhibitor isofagomine lactam
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New, Simple, High-Affinity Glycosidase Inhibitor: Analysis of Binding through X-ray Crystallography, Mutagenesis, and Kinetic Analysis
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords beta-1,4-xylanase
total genus 126
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1j01A00
3VDBA 3T0DA 1TCMA 1UWRA 4UQAA 4UTFA 3N9KA 1VEOA 3PTMA 2AAAA 1UWSA 2GK1B 1YQ2A 4K68A 4D6GA 5IFTA 3WL0A 1HL8A 2W63A 3PBGA 4DWSC 3N04A 4UQCA 3RMEA 1BVNP 1U33A 2EPNA 1J0HA 1JL8A 1PAMA 3RJXA 4YHGA 1MQQA 4JFUA 1NARA 4GPNA 4TVCA 1EOMA 2F61A 1JIBA 4U33A 4D6CA 2DGAA 2XFYA 2VMFA 1BVZA 5CJ5A 3MV11 5M3WA 1BG9A 2DIEA 3GDBA 3SCWA 5IFPA 5CLWA 1HX0A 5A6BA 4XZBA 4TXEA 3MMDA 3HJEA 1NP2A 4TX8A 1AQMA 2PI6A 4W86A 2X2YA 1EQPA 4AWEA 1B1YA 4GO9A 3VIPA 1TVNA 1CGXA 1HNYA 3VD3A 5GNXA 2JEQA 2ZICA 3WUEA 4QCEA 2UY5A 2EO7A 3SUWA 1OD8A 4YHEA 1HJXA 3BAIA 5FOOA 3HU7A 2TAAA 3I3BA 3CMGA 2JFEX 3W6MA 3WD3A 4CD7A 1LG2A 4H41A 2OWCA 4S3KA 4DWSB 3BXWA 3MU7A 1BAGA 2EPLX 3GNPA 4BF7A 2VZVA 1VENA 1D2KA 4N0RA 2VCBA 4XUYA 2FH6A 4WF7A 1VIWA 4JFVA 4C7FA 2ESCA 1G01A 1KXVA 2DIJA 3FY1A 3K8LA 3UESA 4A4AA 3WENA 1HKJA 1G1YA 1IV8A 1WZLA 3W28A 1MFUA 3WNKA 3AHTA 1FHDA 2ZOXA 4PCTA 3AIBA 1TA3B 2GDVA 1ITXA 1QHPA 3O2LA 2V3GA 2JF6A 4BQ2A 2VX5A 2W66A 2YIHA 1L0PA 3AMCA 3ARWA 5D9PA 4GI9A 5BCAA 1EQCA 3CZJA 2VUYA 4PTMA 3MANA 1CLVA 1X6NA 1UD8A 1K9TA 4PMXA 4BA0A 3WNMA 2WPGA 2PWDA 1UR2A 3RPMA 2GJRA 4Z2HA 3OGRA 2DT0A 1B30A 4LPCA 9CGTA 1HF6A 3AS1A 1JDCA 3CIVA 3RJYA 1UOKA 5I6SA 3ARSA 2ZX9A 3WBAA 2ZE0A 2W67A 2XYLA 3KEHA 4IM4A 1EHAA 4J3WA 1V02E 3F5JA 4AD0A 1WB0A 1V3HA 2OSYA 1BFNA 3VIJA 4AISA 3RM9A 1E4LA 5A6MA 3AS2A 5I78A 3ARQA 3T2QA 4CN1A 2W4XA 3OBAA 5CPSA 4A3YA 4J3SA 2ZIDA 4Z2JA 2W5FA 5D4YA 1QW9A 3KL3A 4GO8A 3SURA 2WC7A 2JEPA 5CLTA 2VCAA 4FF5A 4AZ6A 5HPOA 1EOKA 4W5ZA 3NSMA 1SFSA 4WKHA 2VT0A 1W1YA 3L2MA 1MXDA 1C91A 3UCQA 2C8NA 2X8RA 1ODZA 3KWXA 1LL4A 1JG9A 5HBFA 3EYPA 1B3XA 1E43A 3RM4A 2DDXA 3SUUA 4QFUA 5A8QA 1H41A 4ZE4A 3FAXA 1WZMA 1Z32X 4CD6A 3WQ6A 1VAHA 4HU0A 4AEEA 2RGLA 3PZNA 4W5UA 3QGVA 2BVDA 3AYSA 4W93A 4YN5A 4Z2IA 4UOJA 3NYDA 4TUFA 3DHPA 1S46A 2JALA 4P8WA 1IZJA 1CNVA 3VD4A 2CYGA 2ZXQA 4QP0A 5M17A 1E0XA 2O92A 1J9YA 1WDSA 4H2CA 2CBJA 4UQDA 1AVAA 1W3LA 2WB5A 1CGVA 1K9DA 1G9HA 3AIEA 3VDHA 1GQIA 4WKFA 2E9LA 1K9FA 2WXDM 5A2BA 3POCA 1FP8A 2W61A 3VGBA 1HJQA 1PZ3A 3UERA 1H2JA 4ZENA 2QHAA 1O7AA 3WQVA 6CGTA 3BSHA 4V27A 4CKQA 1JI1A 3L4TA 4NZCA 1QNOA 1XGZA 4UNIA 3N15A 3WH5A 3ZQ9A 3VMOA 6A3HA 2BY3A 4PMRA 4D6EA 2XM1A 1V02A 3AIVA 1O6IA 4GZIA 3AMKA 4AZCA 1M03A 2WZEA 5I24A 5EMYA 1KBBA 3WF2A 4QLJA 3U57A 5BRQA 4B15A 4AZGA 3W38A 1HVQA 5E9AA 3TA9A 2WANA 4J3VA 3AHVA 4OJYA 1OGSA 4GQRA 2YA1A 1W9DM 1WAWA 3CZEA 3N12A 3BLPX 3M6DA 1VRXA 1UWTA 5TD4A 1VFMA 3EDDA 2EPKX 2XWDA 1V0MA 3QOKA 4M82A 2FHCA 4W8AA 3RM8A 2WMIA 5FIPA 1Q6FA 4DM2A 1JXJA 2CESA 4HA4A 2WM0A 3K46A 2Q8XA 1C8XA 3AIQA 4BQ5A 3GXIA 2BVYA 2GJPA 4B3KA 2WNWA 3L4ZA 1XCWA 5I0DA 3MUAA 4J3XA 4U2YA 2VQUA 2WC4A 1E6NA 3AMDA 3QR3A 1J01A 1KCKA 2EEXA 3WQ5A 2BY0A 2J79A 2ZWZA 2C0HA 4DUWA 1H3GA 2WCAA 2Y2WA 5EFDA 3B9AA 3BMWA 2Y5EA 3VGDA 4W88A 4FLQA 1DHKA 1KR1A 2XPKA 3IJ7A 1VBRA 5HNNA 5I5RA 3THDA 3SUSA 5CSUA 3W37A 1H49A 4Z2KA 5A6BD 1NQ6A 1DEDA 3IANA 4F9DA 3NDYA 3S2CA 1GQLA 2BXZA 1CGYA 2NT0A 2XVPA 5AC5A 5A8NA 1ZJBA 4KGJA 3CZGA 1NWTA 2A3AA 2WK2A 1C8YA 3GH7A 3PZIA 4EANA 5ABEA 4YPJA 3WNOA 2XVKA 4WKAA 1MYRA 2WAGA 1VFUA 3NCOA 1KXTA 3LPPA 3CUIA 1UD2A 1OD0A 2ZX6A 2WBGA 2VOTA 1JZ2A 4B3LA 1JF6A 4P8UA 2D23A 2VRJA 1B9ZA 2YLLA 4TTUA 1XH1A 3VIHA 4PCSA 4V28A 3BAKA 1KGWA 1V6XA 3ZJ6A 4WK9A 4ACZA 2E9MA 4UOQA 4XZWA 1EO5A 2CNCA 5DT7A 4PSRA 2D0FA 3IK2A 2XHYA 4D6IA 2J8FA 4S3JA 1BGAA 3D3AA 1BGGA 2V3DA 1GJUA 1C92A 2B31A 1HKIA 3WQ8A 1QNSA 4UFJA 1ISXA 3WDHA 3I3DA 3VVGA 5A2CA 3VNZA 2GUYA 4LYQA 3WUBA 2WW5A 2FHFA 2VVNA 1DWFM 3WDQA 5JUVA 4L4PA 1QNRA 1JZ4A 2ZXAA 3M07A 2E0PA 3SUTA 5AC4A 2QMKA 1ZS2A 1F4HA 1QI4A 1US3A 2YA2A 5IHRA 1J10A 4HMEA 3GNOA 1V3LA 2FHBA 3WDPP 3ZR6A 2XTKA 1E56A 2J8GA 1BTCA 2WSPA 3K4DA 5JBEA 3TP4A 1TMQA 3DYMA 3NUKA 4MB3A 3UETA 4UFIA 1HJUA 4JFWA 5ECUA 4MNLA 2VZTA 3AHXA 3F4VA 1XYFA 1UZ1A 3W27A 1HXJA 3WD1A 1WNOA 1A47A 1E3XA 4ACYA 4AD3A 3A4WA 1R85A 1NM9A 4U3AA 3WIJA 3AIWA 1A3HA 1ZU8A 4HOWA 4IPLA 5C8BB 4XB3A 1I1WA 2AOSA 3BLKA 5GQBA 3T09A 1ZBWA 2WMFA 2VR4A 2PBGA 4MPKA 2VTFA 4LQ1A 1UQYA 2EXOA 3ZSTA 3GBEA 5D8ZA 3N13A 1TUXA 3SCTA 3K1DA 5DF0A 4MAZA 4JFSA 1B3YA 3MUY1 1QW8A 5DO8A 2OSXA 1NOFA 5I77A 3AS3A 4HA3A 2XVNA 2V5DA 1GOIA 4CU8A 4PBGA 2D2OA 3MUIA 4BQ4A 3L4UA 3PTQA 4MJ4A 3EMQA 1JF5A 3B8SA 4J3TA 1BQCA 3ARRA 1MVYA 3OLGA 5A69A 1EA9C 3UEQA 2D22A 1NH6A 3CLWA 1RP8A 3ARPA 1LWJA 3GBDA 1TVPA 1HL9A 3WD4A 2BXYA 5IXEA 5BRPA 1MFVA 3DYOA 1M53A 4AZBA 2A3HA 4FLSA 2ZUMA 1IZKA 3M46A 4AD1A 3W82A 2E8YA 4QLLA 4DUVA 4KRUA 5DMYA 1XCXA 3PZMA 4BQ3A 2Y8VA 2WMGA 3BAWA 3PZOA 3WFLA 2VJXA 2WWCA 5M03A 2ZWYA 4W7VA 4CCCA 4M24A 3ZT7A 3B9EA 5CG0A 1JGIA 1CXFA 4PRWA 2XVGA 3ZR5A 4OUEA 3MV01 1TR1A 2YDSA 4UFMA 1UYQA 1UHVA 3ZT5A 2PBOA 1ZL1A 2DT3A 2YBUA 4Q7NA 1UA7A 1GVYA 1V3IA 4IPNB 2XFRA 3IAQA 3T0BA 3ALGA 2CKRA 2WHLA 1VEPA 3IJ9A 4PUDA 4ATLA 2BY1A 1PX4A 1DWGM 3PHAA 1E1FA 4J7RA 3MS8A 2WVUA 5CPTA 2VL4A 3UG5A 1V03A 1R7OA 4D6FA 3M7SA 1JYNA 3OB8A 5FCZA 3AS0A 1YHTA 1JD9A 4J3UA 4JKLA 2CBIA 2WVSA 4R5EA 1WCGA 2DSZA 3SIMA 2GSJA 3ARTA 1LF1A 3T2OA 1CGUA 2DEPA 3AIRA 1J11A 1UR4A 4U5KA 4OBRA 3AHYA 4GQQA 2XJ7A 2VZUA 1E6SM 7TAAA 2E8ZA 2VURA 1XSIA 1ZBVA 2EPMX 2PF0A 2WZHA 2Z1KA 1BLIA 4KMQA 1JAEA 4JKMA 2QF8A 1SMDA 1JAKA 4PTWA 1E71M 2CXGA 4P7QA 1QVBA 3NSNA 4H8UA 1UD4A 1XHGA 1R7AA 4NF7A 3WDRA 4KH2A 1OT2A 3VX0A 1BYDA 4CN6A 3VO0A 1KWKA 4BS0A 8CGTA 1FHLA 3QHMA 2D0GA 1J0KA 3E1F1 4D71A 3N1AA 1B3VA 3WDJA 4UR9A 2FGZA 4Z2GA 1E73M 5BXPA 3TTQA 3WF3A 1KXHA 1GJWA 3CUGA 1GORA 1Q4NX 3WH7A 1EIBA 1W32A 4JL2A 4MADA 2O9TA 4U3CA 1PEZA 5HOSA 4PYSA 1F4AA 3WEMA 5BXRA 1UQZA 1AQ0A 5C70A 1G94A 2CITA 3CBWA 4XV0A 2V38A 1CXKA 1CGWA 5A95A 1ISYA 5DFAA 1B90A 3F5LA 1GPFA 1W91A 4HOXA 1W1PA 2O9RA 3DYPA 4WIWA 3WEOA 2A3EA 3MUZ1 2DPEA 4UZSA 1V0LA 4OOZA 4JCMA 4MTVA 2WCGA 1GNXA 4D1JA 1WZKA 2VR5A 1UD5A 2W92A 1H09A 4H8HA 3AYRA 2MANA 4UQ9A 3AMLA 3LPOA 3U5YA 1E1EA 3KL5A 3SCPA 2C7FA 1H11A 1L8NA 2YKKA 3VILA 2A3BA 1OGBA 1UKPA 2YA0A 1PX8A 4AIEA 2WWDA 2J7DA 1OBAA 1C90A 3FHQA 4PMDA 4M56A 3CMJA 2WHKA 5A6SA 2WLYA 3EMCA 3PZTA 1QI3A 2J7GA 4M29A 3T08A 1HT6A 5AYIA 1BG4A 1AQHA 1WP6A 1NOWA 1QOXA 4PEEA 2YOCA 1OT1A 1TA3A 4J27A 1P6WA 2J75A 2Y8KA 3WQ4A 3J7HA 1MWOA 2VZSA 1VEMA 3SEPA 1HN1A 5GPRA 5A8OA 2HVMA 3BSGA 5CGTA 2WBKA 2YLAA 2XGBA 1HJSA 2W91A 2J7EA 4W87A 4PSPA 3VGEA 4AYSA 1NP0A 4RL3A 3WELA 1Q6CA 2FGLA 4AD4A 1QI2A 3VDAA 1HJVA 5E6YA 4NSBA 3B9DA 4KWUA 5IHSA 1RH9A 2G8ZA 3VD7A 1VJSA 1FH7A 3A47A 1GCYA 1VF8A 3CHDA 1OCQA 4GINA 2CPUA 5A6LA 1QNQA 1GHSA 2V3EA 1W1TA 1CXLA 2CKSA 3RILA 1ESWA 3AFBA 3VIIA 3MMWA 4B9ZA 5HPCA 1JYWA 4CD4A 2VRKA 1NOUA 2YJQA 3K8KA 1SYTA 3RDKA 2J4GA 2WLZA 3L4XA 4ACZB 3PZ9A 1EXPA 3T2PA 1G0CA 4B9YA 3U5UA 1PBGA 2X09A 1H4PA 2X05A 4UQEA 3ARYA 2YL9A 4HMCA 4C7GA 3NDZA 3ALFA 2XM2A 4IISA 5EFFA 1SMAA 3VIKA 3GH4A 4W8BA 4RE2A 3EDFA 3I3EA 1MW3A 2O9OA 3MO4A 1DWHM 3THCA 5I2UA 4JAWA 2VC9A 5LA1A 3QHOA 1ISVA 4UFLA 4D6HA 3ARUA 1V6WA 4EE9A 3WMCA 1W9BM 4DUXA 1U2YA 4D72A 3IJ8A 4WJXA 2GVYA 3AZSA 1TFVA 3AQUA 4W8LA 4EAMA 4AD5A 1XSKA 1EH9A 4HTYA 3CHCA 3EDEA 1XD1A 4AEFA 3VPLA 1R86A 1C8QA 3U7BA 3WMSA 7A3HA 1WE5A 1PIGA 3CUHA 1CTNA 4HZ6A 1V3KA 4JFTA 3LPGA 4QAWA 2Y4SA 4ZEPA 1FP9A 3FNDA 3UG4A 1JXKA 3TTSA 1E4MM 4Q22A 1W9VA 1W9XA 4D6DA 5ABHA 2JE8A 2J62A 3AMGA 4AIUA 3OA5A 4RE3A 4QCFA 1X6LA 1V0NA 1X1NA 3SCQA 2PWFA 1DWJM 1PZ2A 1C3FA 5DT5A 4HPGA 2WMJA 2WMIB 2EPOA 1UD6A 2VQTA 1KQYA 4ZE5A 1E15A 4DWSD 4EK7A 1BHGA 1JZ5A 3VM7A 3CZ8A 4FLRA 1VB9A 4AZHA 1J0IA 1UD3A 3ZIZA 1QBBA 2DSVA 1E4IA 4HZ7A 5BROA 1V3MA 3S6TA 1LWHA 1GHRA 5E6ZA 1W2PA 4HZ8A 3WKZA 2GFTA 1JDDA 3ZJ7A 3G6MA 3VGGA 4CU6A 4MB1A 2PB1A 3T0AA 5JBDA 3VKKA 4AZCB 4AMCA 4PMOA 2X0YA 4JZ5A 3VTRA 3ARZA 3AXIA 4UZUA 4DM1A 4LX4A 5A1AA 4M81A 4AIOA 1CXIA 2G3NA 4UQBA 1E6QM 1KGUA 3SCNA 4HP5A 1ZBKA 1EDGA 4AXNA 1FA2A 3O6AA 5A3HA 1GQJA 1E3ZA 1BF2A 2PC8A 1R87A 4JIEA 2YBTA 1JDAA 2J78A 3VMNA 4AZ7A 3POHA 1GOQA 5E70A 3WY1A 3CHEA 5A6AA 2D0HA 1GONA 4PMYA 1OIFA 5LA0A 2D3NA 4TX6A 4WSKA 1Q6GA 1CXHA 3NJ3A 5D8WA 1QHZA 3AXHA 3GZAA 4UFHA 2BHUA 2W62A 2CHOA 5I23A 2E9BA 3WF1A 1AMYA 3GYCA 2QPUA 2A3CA 3PZUA 3OZOA 1EHNA 3UR7A 2DSKA 3LMYA 1KXQA 1GOWA 3W81A 2F8QA 1QNPA 1UKTA 4U31A 2ZUVA 1QBAA 2WVTA 2CBVA 4A3HA 1LL6A 5BWFA 4AZ5A 3ZT6A 1W9PA 1Y7VA 4U2ZA 2YL5A 1GOOA 4MDOA 4E2OA 4CD5A 3BC9A 3MSGA 2NSXA 1E6RA 3BAXA 3TOPA 4P7NA 1MW1A 1DWAM 3BCFA 1J0YA 1HIZA 2UY2A 4PMQA 4CVWA 3GXMA 1TE1A 4GKLA 1J0JA 3ZMRA 2JF7A 3ZJKA 3W24A 5C71A 3PZQA 2ZUWA 2XVLA 1G5AA 2DT2A 4JCLA 3CHFA 3OLEA 1CENA 3ZOAA 4JL1A 3W4RA 5A6JA 4R27A 4PUEA 1HP5A 2ZUTA 4MJ2A 3NSXA 4MB4A 4GXPA 3AROA 1PJ9A 2CEQA 3HN3A 1PIFA 1FH8A 3KZSA 3IAPA 2VX7A 3VINA 3WNLA 4OBSA 3OZPA 5CXPA 1JI2A 1JD7A 2CIPA 1WDPA 3OGVA 4OKDA 3ECQA 4NRSA 3K4AA 4CVUA 4AY1A 2BVTA 1C7SA 4PTVA 2WVVB 3PTKA 1V6VA 3CO4A 1NWUA 4CCEA 1WKYA 2X0HA 4N42A 1E9LA 1UH3A 2YL8A 2J77A 2BHZA 2WC3A 2ZX7A 3GXFA 4HMDA 4LYPA 3QOMA 5D9NA 1E6XM 2D3LA 1PX3A 1EGZA 1JYVA 4PN2A 1I75A 4W89A 2G41A 3W0KA 1J18A 3FAWA 4E4PA 1ODUA 3U7VA 1B31A 1HVXA 2ZX5A 3OGSA 2J74A 1CGTA 1E5NA 2ZUSA 1H5VA 2CETA 3G6LA 1LL7A 3A3HA 1OGGA 1C7TA 2J7CA 1XSJA 1UKSA 1B3ZA 4NI3A 5KZ6A 1M04A 4PMUA 4X9YA 2EJ1A 2VO5A 2ZUUA 3VD5A 1XC6A 5FKYA 3W25A 4AD2A 1EDTA 1XYZA 2CBUA 2IXUA 1I1XA 5HXMA 3WFZA 5CPQA 2ZUNA 1J0ZA 1BPLB 3TTYA 1GZJA 1KQZA 5I3DA 3W53A 1UG6A 2J7HA 2OYLA 5LA2A 2CCRA 4ATDA 3AISA 4DWSA 1JNDA 2V3FA 4KGLA 4BZYA 1UR0A 2XFFA 3MKKA 1ISWA 4E8DA 2BHYA 5FD0A 3MSDA 5ABFB 1MXGA 3CGTA 1CBGA 4U5IA 4TOQA 3CZKA 3ZJ8A 1TZ7A 1UH2A 1V08A 2D20A 8A3HA 4GI6A 2WSKA 4WSJA 5JBFA 2DH3A 5CZKA 2CERA 4MNKA 1QHOA 2J7BA 1CEOA 1WO2A 2DSWA 3QHNA 1C93A 2BNJA 5IDIA 3ZSSA 3VDCA 5LYRA 1QPKA 4PMZA 4ML4A 5I79A 3CTTA 1RP9A 2OLHA 1CDGA 4M80A 3W6LA 1FH9A 1PPIA 2XIBA 3OLDA 3GXDA 3BMVA 2PWHA 3OG2A 1CECA 5E0CA 1ECEA 1LLOA 3HMCA 2OSWA 1GQKA 2YDRA 1KBKA 3A4AA 1E6ZA 2GK1A 2DSUA 1B3WA 3OIHA 1W9UA 3L4VA 4TVDA 2QMJA 1CIUA 2WKGA 3EDJA 1WZAA 1W1VA 4D1IA 3GM8A 3VIFA 2D24A 4E8CA 2JIWA 2XWEA 2YL6A 1FFRA 2BV9A 3TTOA 1D7FA 2Z1SA 1V6UA 5ABGA 1JYXA 4MNJA 2GDUA 1MQRA 4HPHA 3A6OA 5FL0A 1GOMA 3VGHA 1CWYA 2DQXA 3EBVA 4OIFA 4CU7A 1UKOA 3BCDA 2VNCA 2YDQA 5A2AA 2VRQA 4JKKA 3DC0A 1E4NA 3WQWA 1CZ1A 3APGA 3D5HA 3VNYA 4TTGA 2WZIA 5E0FA 3VU2A 3WEZA 3VGFA 5CSYA 3WSUA 4XX6A 2WMKA 3FN9A 4M8UA 2E4TA 4AC1X 3VIGA 1EO7A 3JUGA 1QI0A 3DECA 5JIWA 2VVSA 5ABFA 2OYKA 3WL1A 2XGIA 4CN4A 2J25A 1OB0A 4UCFA 3ARXA 2VX4A 2F2HA 1SR0A 1J12A 1UWQA 1US2A 1E5JA 2IUZA 4D6JA 1FOBA 2WHJA 4M1RA 1H0GA 3WUGA 3CPUA 3AHZA 1UZ4A 1XH2A 3PZGA 4GI8A 3AI0A 1W3JA 4P8XA 1UWIA 4OZOA 2ZXDA 1DP0A 4F9JA 3N17A 1OSEA 1BYBA 1E0VA 3UG3A 4TVUA 4HA1A 5CGMA 1JNEA 4W7UA 5A8MA 2Y24A 2G3IA 4OOUA 4JHOA 3RCNA 2XG9A 1HJWA 5DEZA 3SUVA 4FLOA 3CZLA 4MAVA 4F79A 3UR8A 4UFKA 1ZJAA 1VJZA 4F66A 2V5CA 2VCCA 3II1A 4ZXOA 5EB8A 4LXFA 1UH4A 2XSBA 5GNZA 1W2VA 2VZOA 1QI5A 2XIIA 3O9NA 1MW0A 1ZB5A 2VI0A 4P7OA 4CUCA 4FMVA 1GW1A 4H7VA 4QDMA 4F8XA 1H0IA 3WH9A 1UR1A 4CD8A 3VIMA 2UY4A 3K8MA 1JZ6A 2D1ZA 4C7DA 1W3KA 4WLCA 1ISZA 2G4FA 1ZBCA 2WVVA 3F5KA 4URIA 1V0KA 2WMHA 2XUCA 2GJXB 3WUFA 4GZEA 3RO8A 1UKQA 3SCUA 1B2YA 3WH6A 3KE0A 1HKKA 3DHUA 4PMNA 3PZVA 1WDQA 4CCDA 3OLIA 2PWEA 5AYBA 2NW0A 2QV4A 4EKJA 3VMPA 1MQPA 4AW7A 1Q6EA 4P7LA 1WPCA 2QLYA 1WDRA 1LG1A 1ITCA 4HU8A 2J7FA 1XH0A 3WD0A 1KCLA 1EDQA 2CHNA 3SCSA 1V3JA 2WCSA 3FW6A 1MW2A 3N11A 3LPFA 5A6KA 1OIMA 3L4YA 4MNMA 1OINA 4W7WA 1OM0A 1XRVA 4GIAA 4ZFMA 1JZ8A 3AZRA 3SCRA 1UUQA 5F7UA 3AICA 3VM5A 4KRTA 4B16A 3W29A 2EBNA 3CH9A 2WKLA 4ZXLA 4V2XA 3WMBA 1CPUA 2E3ZA 1TG7A 3CUFA 5M5DA 1KB3A 3KL0A 3VUPA 2ZXBA 1E70M 3W26A 1R8LA 3AOFA 5BXSA 3VOCA 3GTNA 2GJXA 1RPKA 3BAYA 4J28A 4QLKA 2BS9A 4AZIA 4IUGA 5BXTA 4CGTA 2HISA 4UOZA 3WH8A 2E40A 3BH4A 3A4XA 5JIPA 2G3MA 2FH8A 3WDIA 3EMZA 1JFHA 1CXEA 4FK9A 5CQ1A 2PWGA 3AIUA 4W84A 2G3JA 2WHMA 5EBAA 4P7RA 4W85A 5HDRA 1E72M 3L4WA 4P8VA 1Q6DA 3GH5A 1B0IA 5E09A 4MB5A 5A94A 1VBUA 4HOZA 1E6PA 1U30A 1XV8A 1HKMA 1E55A 4JHZA 2UWFA 1JZ3A 4X0VA 1JFXA 2JIEA 3WBEA 4PMVA 1W3HA 1KGXA 1LJYA 2IXVA 1UR9A 3WF4A 2NT1A 3WD2A 4RE4A 1H1NA 2DH2A 3ARVA 3VIOA 2FDMA 4H04A 4GZJA 2O9PA 4Z2LA 5FL1A 3WN6A 4PTXA 3AJ7A 3NIYA 3L2LA 5A8PA 3CUJA 3VX1A 4LGXA 3FXYA 7CGTA 4BCEA 1KWGA 1DWIM 1E0WA 1VFFA 1M7XA 2OWWA 2EQDA 2OWXA 1JZ7A 3AXXA 1NWSA 5D9OA 1GOKA 1V6YA 3TONA 6TAAA 5D9MA 3SCVA 2ZX8A 2BFGA 1NWRA 3VD9A 1GUVA 2AMGA 3ZO9A 1BYAA 2VX6A 4ATWA 4LYRA 5AY7A 3PN8A 3FHAA 3GNRA 1D3CA 1HP4A 4X0NA 1KR0A 5KEZA 4H8VA 3EDKA 1BSIA 2X1IA 2XSAA 1K6AA 3BAJA 2J47A 2QPSA 1UWUA 3BGAA 1UA3A 1CLXA 1UR8A 4L4OA 1N82A 1KFWA 1OWQA 3SCOA 1XD0A 2DT1A 3ZM8A 1GVIA 2OYMA 4MDPA 3RIKA 1IT0A 5BYWA 1FFQA 3WNPA 1K9EA 3AZTA 1LQ0A 3N18A 4NRRA 1E40A 1RD6A 2UY3A 1VFOA 5GNYA 3WNNA 2WYSA 4Y7EA 1DTUA 1M01A 2RGMA 1BYCA 3MMUA 3WF0A 2BY2A 1CYGA
chains in the Genus database with same CATH superfamily
3VDBA 3KTCA 1UWRA 4UQAA 2R1PA 3SQLA 2YCLA 2AAAA 4AWUA 4JX6A 2GK1B 3S5YA 4K68A 4D6GA 3TR9A 3CEPA 1HL8A 3ABOA 4B5SA 4DWSC 4UQCA 5K4XA 1BVNP 3C8NA 4INFA 1JL8A 3RJXA 3MDWA 4TVCA 4HHHA 1DHPA 3OBKA 3FA4A 1BVZA 2E6DA 3MV11 2WZMA 1YIXA 4H6QA 3O63A 3D46A 2DQWA 2DW7A 4GUFA 4NT0A 3K5XA 4N4PA 3HGSA 1NP2A 3SY8A 3I6EA 5IOBA 2P8BA 4AWEA 4GO9A 4XSLA 1CGXA 1HNYA 4R3UA 3GC2A 1ADOA 4PUUA 3ZVHA 4WX2A 3HU7A 3LCFA 3GWQA 3G1DA 4EACA 3M5YA 1PL9A 3UG8A 3R8GA 2JFEX 3WD3A 1TTJA 1QU4A 4H41A 3ZWSA 1LBLA 1H1ZA 4S3KA 3PC0A 2EPLX 4BR1A 4QRNA 1VENA 3IRDA 3WLSA 1X97A 1U83A 4UTKA 4DPQA 4C7FA 4MWAD 5C9XA 2NQLA 1KXVA 2DIJA 3K8LA 2IW0A 2VEGA 1YEYA 2J6VA 2D73A 4FOKA 2D69A 1ECQA 3W28A 1TELA 4GKTA 2Z29A 3IIOA 1ELSA 2WZTA 3HPAA 3AIBA 2GDVA 3O6DA 3RLUA 2V3GA 2ZFAA 3VA8A 2YIHA 2X1UA 4F48A 3EWCA 4PTMA 1OADA 3NQ7A 1UD8A 4JY9A 3MY9A 2F9RA 3SQSA 3RG6A 2CLKA 2QQ6A 3OGRA 3U2CA 1HF6A 1JDCA 3CIVA 5CH9A 4Q6JA 4BF9A 2ZE0A 3KEHA 3NQ8A 3W6YA 1V02E 2Y85A 1RK6A 2DU2A 3VIJA 3JZUA 2FZ9A 3E2RA 3W84A 5I78A 2IPGA 5KETA 4J3SA 3VNIA 1XFCA 1QOQA 4FP1A 3RGTA 4AVOA 1QCWA 4JXCA 1AJ2A 2JEPA 4I8YA 1XIHA 4JTCA 1XBVA 4HCDA 4W5ZA 3NSMA 2V67A 2V63A 1A5SA 5D2XA 1THFD 5FEPA 5KZEA 4L61A 3UCQA 3LGEA 3LCXA 3C0SA 3KWXA 3G1HA 2AL2B 2C3ZA 4QFUA 4OTKA 1H41A 3W7IA 3QV6A 4CD6A 1Z32X 4HU0A 5JVLA 1G7VA 4R7WA 4UOJA 3NYDA 4IFKA 1F7BA 3DHPA 1S46A 2JALA 3P2VA 3PSVA 1IZJA 1WDWA 3VD4A 2E6YA 3HPFA 2ZXQA 5LIYX 2G50A 4H2CA 1O95A 2ZTKA 1FDYA 4RZBA 3GW3A 4RDZA 1ALDA 4XISA 5A2BA 1TTIA 4ZVJA 1HJQA 3UERA 1SR9A 4ZENA 5EMLA 3UU0A 3GRIA 3EPMA 3L4TA 1EX5A 3TXVA 3N15A 1QWGA 3B03A 1F3TA 1PXGA 3WH5A 1O6IA 4OU1A 3HG5A 5EKYA 3AMKA 4H9VA 1MZHA 1MDLA 1WV2A 2NSOA 5EMYA 1KBBA 2BDQA 4E2VA 3WF2A 3U57A 5CBBA 4AZGA 1HVQA 1EZ2A 3PM6A 4KWVA 4OJYA 3BO9A 5TBOA 3M0ZA 3M6DA 4YYFA 3LXBA 1UWTA 4YVXA 1VFMA 5D09A 3QOKA 4M82A 4E6MA 4W8AA 5FIPA 2NQ5A 2Q6ZA 3LLFA 4A8RA 2CESA 2PUZA 3LD5A 4S3EA 1M7OA 1C8XA 3AIQA 4BQ5A 4HCLA 1TIMA 1LOLA 3UF9A 4XAYA 4FIQA 2Z24A 2GJPA 2HE8A 3KRSA 1XCWA 5FJIA 4XZIA 2ISVA 4YTSA 1SJCA 3QH2A 1E6NA 1TX0A 4POCA 1KCKA 3BARA 1Y0EA 1T40A 4LUJA 2TYSA 5EFDA 3TAKA 1VFSA 2Y5EA 1LM1A 2OKTA 3RU8X 4W88A 4H01A 3SSZA 4EPKA 5HNNA 5I5RA 1UJQA 5CSUA 4JTDA 1XIGA 3C3UA 2Y62A 2PGWA 4ZQOA 1P5BA 1DEDA 2C13A 3NDYA 4WRHA 1WAUA 3MC5A 3G24A 4IPJA 4KGJA 2WK2A 3PZIA 3TZFA 4EANA 4FX7A 4ML9A 1Q2SA 1X7IA 2XVKA 3C8FA 3S83A 4FA3A 1KXTA 3CUIA 2V5KA 1JCTA 3GG0A 2YDAA 3MB9A 4RXFA 2VOTA 5CPOA 4AEOA 3GDMA 4ADUA 2DW6A 1B9ZA 2YLLA 1B57A 3VIHA 3T9PA 4PCSA 5E5CA 4V28A 1W31A 2Y88A 3ZJ6A 4PL2A 1PWLA 2DZVA 1P48A 4H4IA 3A9BA 1LLWA 4PSRA 1TV3A 5F2GA 4LW7A 2B31A 3WQ8A 3BMXA 1TPH1 3LQLA 2FDSA 1ONXA 3KBNA 3I3DA 1IXOA 2NQJA 1DJYA 2GUYA 4EP8C 3THUA 1DWFM 3TX9A 4BF5A 4C1NA 3F2CA 2VFHA 2E0PA 4L4MA 2QMKA 1DJHA 3LNPA 1F4HA 3EEGA 3W2UA 1RD5A 1L6GA 4IIEA 4HMEA 1R9XA 3S1UA 1FRBA 1U5VA 3MWAA 1S38A 3W22A 1AK5A 2OXNA 3DYMA 1LWIA 3UETA 1R3YA 2PURA 3E2SA 3TDFA 5AHMA 4HGXA 2NV9A 1SSGA 4JFWA 3FGCA 3F4VA 3A5VA 3W27A 1HKVA 3W1RA 4GY1A 3COTA 4C6CA 1NFPA 2QDEA 3OVPA 3AIWA 1A3HA 1ZU8A 4HOWA 5G2HA 3T09A 4C1LA 3HGRA 1ZBWA 3IS4A 3OA3A 4MPKA 1F73A 1A5NC 1W1ZA 4GJIA 4LQ1A 3ZSTA 1V77A 5LXXA 3GBEA 3ISIX 5D8ZA 3ITTA 1TUXA 3I7SA 2PDHA 2PEVA 3W88A 1EWDA 2BZNA 4JFSA 3MUY1 1QW8A 3B04A 3PNZA 4YU1A 1G69A 3AS3A 1A5MC 4HA3A 1PZ1A 4CU8A 3MUIA 3E5PA 3R0DA 3LV5A 5CC6A 3L66A 3B8SA 5GJNA 3T44A 3U48A 3DEQA 3UEQA 3ZYZA 4K2SA 4Z08A 1S3TC 3DYOA 2V82A 2A3HA 4Y8EA 4Z1CA 4AD1A 1QFEA 1KCXA 4KRUA 4IGSA 3CAQA 3BLEA 1PTAA 4NJHA 3TW9A 4O57A 5LKYA 1GVQA 3TNOA 3A12A 2P50A 4FR6A 3U2OA 4EAYA 2Y8VA 3BAWA 4WEVX 1SJBA 5FJTA 3UA4A 4M24A 4Q4QA 3B9EA 4MKSA 2XVGA 4S3AA 2YDSA 3C56A 1UYQA 3W02A 3V7PA 4RNJA 4KW2A 1YNYA 4Z1DA 3ZT5A 1WA3A 2YBUA 3USZA 4U4MA 4LNCA 4H9MA 3NQDA 3IAQA 4YCPA 1WDDA 1BWLA 1I4NA 3QFWA 3H23A 3IIPA 1S5NA 3DX5A 3DG6A 1H7WA 2BY1A 3R8HA 1DWGM 2OZ0A 1RPXA 2DORA 3BJFA 3MS8A 4B91A 7PTDA 2VL4A 1R7OA 2F6KA 1AG1O 3TSMA 2YX0A 3EX3A 1YHTA 1JD9A 2WVSA 4R5EA 1WCGA 1VPYA 4NNAA 3BW4A 3QFEA 1CGUA 5BNKA 4C6MA 1EPVA 1ZSXA 1SVDA 2XJ7A 1F3EA 7TAAA 1ICSA 1SO5A 3FS2A 1HGYA 1ZBVA 4A2RA 4IX2A 1PCKA 4KMQA 4JKMA 4MFEA 3V35A 5IRPA 1E71M 3GKAA 2AAMA 2H8ZA 3W23A 1GTEA 3EOEA 1VCFA 5AVNA 1R3SA 4NF7A 3WDRA 3VX0A 1OT2A 1RJQA 4QE5A 3QHMA 2D0GA 4QJ1A 3P7YA 2CC0A 2PP0A 2X0SA 3N1AA 2OEJA 4Z17A 2AL2A 3F1QA 3TTQA 2A21A 1KXHA 2PTZA 3RPDA 3KCJA 4Y6GA 5BOFA 1IZCA 3BDKA 3G1SA 3WH7A 1EIBA 2H9AA 1JQXA 5DXXA 4MADA 3GHUA 3SFWA 1PEZA 1F4AA 4HHLA 1AQ0A 4E4UA 3CJPA 4O50A 4RDVA 5CC5A 2CITA 3CBWA 4MM1A 1CXKA 5A95A 1ISYA 3F5LA 4G9PA 1KTBA 4A22A 1W91A 1KKRA 4HOXA 3WEOA 4XZMX 3T05A 1DOSA 4AX7A 1O5XA 2QDHA 3ITGA 3SR7A 3TUUA 4LUSA 1W37A 1AJZA 2ACRA 2AL1A 2GUBA 4KETA 2MANA 1RHCA 4O8RA 3LPOA 3DESA 1RUSA 4FNPA 2PGEA 1IR2A 2C7FA 4F2TA 2VP8A 4JIIX 3WBYA 4XQ6A 2I57A 2PDNA 1OGBA 2YA0A 4AIEA 2WWDA 5HWNA 4HPXA 3FHQA 3HURA 2WHKA 3OG3A 1BVWA 1T5AA 1TRIA 2IKHA 4M29A 3T08A 3WJSA 5T9CE 1WP6A 1NOWA 3DH7A 2X1TA 3VKBA 3QZAA 3J7HA 3WQPA 3W1TA 3V0TA 5HQEA 1N2VA 3VUSA 1HN1A 3L65A 3BSGA 1GEHA 1W1B1 2XH7A 2DZSA 3RPTA 1Q85A 4RL3A 1I2OA 3HPZA 1QI2A 1HJVA 3FX4A 5E6YA 3B9DA 4IG2A 1TWDA 3EKLA 4X63A 2QCHA 1FH7A 4RUBA 2ZDRA 1IGSA 1VF8A 4I5RA 1GHSA 1EUAA 2V3EA 5RUBA 1W1TA 2BGSA 3TVAA 4H7CA 3ZVHB 1OG0A 1WQ5A 3W2JA 3VIIA 1N8FA 3MMWA 4B9ZA 3IPWA 4JTHA 4CD4A 2YJQA 2HDJA 1UZDA 1X7FA 4WVXA 3TN3A 2ABAA 1EXPA 3T2PA 4XZLX 4QG8A 1G0CA 3W7MA 4LAOA 1XUUA 5H91A 2UV8G 4GGBA 2ZRVA 2X09A 2RDXA 1FWGC 5CG7A 5EFFA 4UBPC 4RE2A 3I3EA 4OV4A 5KITA 3F2DA 3W7RA 4B2DD 3GG8A 3Q45A 5G2WA 2VC9A 3W75A 3QHOA 1TUFA 5DX7A 1XQLA 2FPYA 3ARUA 3E12A 1W9BM 4S3BA 5FF2A 3IJ8A 2PRLA 4GQBA 4XTDA 4WJXA 4DJFA 1G4SA 1ONRA 1YTKA 4W8LA 1R2RA 4AD5A 1XSKA 2OEKA 1XD1A 1FWCC 3WMSA 3WLPA 3G0XA 5HNTA 1PIGA 1N7KA 5AFDA 3EA1A 4HHMA 4ZGYA 3F2BA 3W73A 3LPGA 4QAWA 2Y4SA 1MDRA 4Q8OA 4GVIA 1FP9A 5G4HC 2VGGA 1ADDA 2B4GA 3FNDA 2HVOA 5JXQA 4LYKA 1W9VA 1EX1A 3OHMB 2JE8A 2ZA1A 4AIUA 1RA0A 2REQB 4RE3A 3FEQA 1IEWA 3OW1A 2GJLA 3CTLA 1BRLB 3GXPA 4JIHA 5DT5A 1VFLA 2NUXA 2H3DA 1Q7MA 4R9OA 1BHGA 3CZ8A 1E4IA 3M0KA 5C2CA 3BLFA 1W2PA 4HZ8A 4NZ1A 3WKZA 2GFTA 3A23A 3G6MA 5FAJA 5G4EA 3KUMA 4MSSA 4AMCA 1MUMA 3KVJA 1ZP4A 5LZLA 4JZ5A 4AHPA 3LMZA 3ARZA 3AXIA 3VTRA 4JIQA 3OQ8A 4QEEA 4AIOA 1CXIA 4RXGA 4PFHA 4NZ3A 2Z1BA 1VR6A 4QITA 4PL1A 1FA2A 5A3HA 4LVDA 2PS2A 1E3ZA 4XKYA 4QTGA 4JIEA 3T6CA 1GOQA 2R8WA 4I7WA 3TYUA 3WY1A 5A6TC 5A6AA 3PG8A 4NZJA 3S4TA 1GQNA 2VEPA 4HYWA 2ONEA 2D3NA 1FXQA 2ZZ5A 4TX6A 3TCSA 2XINA 4F0HA 1Q6GA 1CXHA 3LZ5A 4DELA 1Q6QA 2RDTA 1RBOB 4QXIA 2ATMA 1GPWA 2P5NA 3CAVA 2A3CA 1EHNA 3TJXA 3UR7A 2C79A 2E5BA 1KXQA 2F8QA 1P1MA 1QBAA 4M1BA 3UXDA 4UR8A 2V6AA 5BWFA 3O1NA 2YL5A 1GOOA 4MDOA 1IT7A 4GFSA 3BC9A 2NSXA 5LGXA 2NWSA 5AB3A 1AA1B 4P7NA 3OU8A 1J0YA 1HIZA 3GXMA 4F0RA 6XIAA 5C71A 3PZQA 1G4EA 5H1WA 1E9YB 2DT2A 3CHFA 5HUPA 2ZVIA 1BKSA 4PUEA 3O15A 2QGHA 1FDZA 3LM3A 3NSXA 2OOGA 3L0GA 2YYTA 3VINA 1F3WA 3BANA 4OBSA 3OZPA 4IJBA 4IIBA 4C6NA 4Q8WA 2CIPA 4XUGA 4C5YA 4HYRA 3W2KA 4NRSA 2JKEA 3CB8A 1XLAA 4R7OA 2ASHA 4PTVA 1V6VA 3CO4A 1NWUA 4CCEA 1GT8A 5F4SA 1NQKA 3RAOA 4RW5A 2QCDB 3MZNA 4N42A 4NX5A 2UZ9A 2EKGA 4FEZA 2WC3A 3V75A 1R3RA 4IMGA 1EGZA 2V30A 3NQGA 4AWSA 5C54A 4DBEA 5CZSA 5FJUA 3W0KA 4E4PA 4CQBA 1UC4A 1JQVA 3QMRA 2VC7A 3OGSA 2YBVA 3TV8A 4C90A 1BTMA 3VOHA 4ROPA 4O1BA 4NI3A 4CQ9A 3KOYA 5KZ6A 1D8CA 1XPGA 3LU2A 4X9YA 2D2JA 2YGYA 2PWVA 1FWWA 4NG3A 4JN8A 1H7NA 4S3FA 3XISA 5L6UA 4YVVA 4F0SA 5FKYA 2CBUA 4PMJA 3S5SA 2VC6A 2IXUA 5HXMA 2JGYA 2HWGA 7REQB 4UWMA 1O1HA 1J0ZA 1PS9A 4H6EA 3TTYA 1GZJA 3W53A 1UG6A 5LA2A 4WXYA 1K7XA 4B5NA 3AISA 1O5KA 4IUOA 3O3RA 4FX6M 2CLOA 4BZYA 1ISWA 3T0CA 4E8DA 5I03A 4MZ1A 1XWYA 5ABFB 1UUMA 1VBGA 3XINA 3IJDA 4U5IA 1TJ2A 4TOQA 5D2WA 1V08A 4REQB 1KLYA 4F3HA 3C2OA 4G7EA 3LN3A 1XLEA 4NAEB 1YMYA 4Q33A 1ENUA 3R8RA 3HV9A 4BFAA 4Y9OA 4NJIA 4XZ9A 3F4CA 2EHHA 5JBFA 5CZKA 2CERA 3NFUA 4V33A 3O0KA 1WO2A 1HUVA 2VFIA 5IDIA 3ZSSA 3VDCA 3N6QA 2DZTA 2E67A 3EKZA 3VNMA 2Y70A 1KFJA 3QV9A 4V1YA 3UVIA 3GXTA 3NZGA 2ZADA 2XIBA 2IKIA 3MA8A 3BMVA 5CSSA 4S3GA 5E0CA 1QJWA 1KBKA 1Z3NA 3DCPA 2F6UA 4TVDA 2QMJA 1CIUA 3EDJA 1EYEA 2ZA3A 3TFCA 4ZA0A 2HZGA 1F6KA 3VIFA 3DFSA 2ZZ4A 1VYSX 1R47A 2YL6A 3BL3A 3DG3A 3W83A 4P2VA 3NEHA 3STCA 3TTOA 2Z2BA 1EJSC 3L5LA 3WQGA 4OBTA 1UJPA 1IF2A 2KX9A 2PDWA 3A6OA 3QMSA 1XM3A 3MDUA 4CNTA 4JQAA 1UKOA 5K3VA 3P61A 2VNCA 3M0LA 3KOZA 1Q13A 2QCNA 1CZ1A 3APGA 4ASTA 1JPDX 4RV8A 4X2PA 2R1MA 4GUHA 1JR1A 3WEZA 1EC9A 3CMFA 4NAEA 4GZ7A 4JGDA 3FN9A 3DHFA 4HQVA 4JDBA 4C5ZA 1QPRA 1EPXA 1F3XA 1EO7A 3JUGA 1OF6A 4XKMA 1QI0A 5FI8A 4A2SA 3U0HA 4GUJA 3TSDA 2OYKA 3ABRA 4UUIA 4CN4A 1OB0A 3VDGA 2J24A 2VX4A 3ARXA 4FF7A 2F2HA 1Q2RA 4I9JA 1US2A 3T4WA 3GQYA 2WHJA 2W79A 4NY2A 3SECA 4HNTA 5DBTA 1UMYA 3T42A 2QUNA 3AI0A 1XR2A 4OQVA 4IIGA 1UWIA 4AY7A 2ZXDA 4MJMA 1XIBA 3N17A 3TYZA 4KFPA 3KP0A 1VHNA 1OFBA 2OQLA 4TVUA 3W01A 1XLKA 5CGMA 1BSLA 3VKDA 5A8MA 1PTGA 4JHOA 2VD8A 2VFFA 4MLRA 1ZJAA 1VJZA 5EMUA 3II1A 2VCCA 5EB8A 1Q65A 1UH4A 2XSBA 1SM9A 1T0OA 1TKKA 1WX0A 1FUYA 3FSUA 4KRZA 4QSHA 2YW3A 1QI5A 4GVHA 4HK7A 1RLDA 3O9NA 3CPRA 3DI0A 1AUSL 3EOSA 5MF5A 1GW1A 3QJAA 4H7VA 5TF0A 4F8XA 3XIMA 1TV2A 3CUZA 4OECA 3WH9A 2MUCA 3M0HA 3THQA 2VENA 2G97A 1ISZA 1G4PA 2G4FA 4H83A 2WVVA 3L0NA 4UMAA 2XUCA 2P3EA 4G1KA 2E28A 5I3KA 3FDKA 4TV5A 4AY8A 3LGDA 1I2NA 5FJOA 1M7PA 5AYBA 1P4CA 3E2VA 2V9DA 4AW7A 1XICA 1A53A 3DU0A 4GD0A 1WDRA 2QYGA 4XZHA 2BOEX 1LG1A 1XH0A 2J9ZA 3G1AA 1REQA 3SCSA 3M5ZA 1V3JA 4GYFA 3BV4A 4UTMA 3FW6A 1JPHA 4H6RA 5FJJA 1MW2A 3N11A 3LPFA 1OIMA 3NDOA 4CQAA 3S6DA 1AMKA 3APTA 4W7WA 3NNTA 1OM0A 1REQB 3QPEA 2PDFA 4IFRA 1ZENA 4ZXLA 2CLHA 3DBPA 1S2VA 4I9MA 1DIKA 3FEMA 3RR1A 2O7QA 2DUXA 3VKJA 3LM7A 2ZXBA 4DJFD 1R8LA 2GJXA 1NEYA 4BEQA 1AD4A 4PA8A 5BXTA 3WH8A 1A80A 1O66A 4US6A 2FH8A 3QV7A 1HO4A 2HQAA 1CXEA 2E77A 2PWGA 3CIWA 1Z89A 3C0JA 1Q6DA 6TIMA 3CWNA 4LALA 2DVXA 3UCCA 2X42A 4LVFA 1XV8A 4QE1A 5JMUA 4DF0A 4GRSA 4X0VA 1ZCOA 1W3HA 1BQGA 2NX3A 1LJYA 4LSBA 1X38A 1ME8A 2NT1A 4RE4A 1H1NA 3SSJA 3PPHA 4IF2A 4GZJA 2O9PA 3IJIA 1FKWA 2QJNA 1GZ1A 3NOYA 3TQPA 4BEUA 3GHSA 3HZ3A 1TPB1 5A8PA 3VX1A 4LGXA 7CGTA 3UR2A 1DWIM 1B9BA 3Q2DA 2H3BA 1ZFJA 1XUZA 3CL8A 4ZTXA 1M7XA 2HCVA 3EZ4A 4YLWA 1S1PA 1GOKA 3TONA 6TAAA 5CPLA 3UWUA 2BFGA 3RRXA 2XDFA 3V0UA 4EF9A 1GUVA 1BYAA 2PP1A 2INFA 4LYRA 1ITQA 3SJNA 3FHAA 3GNRA 2GYIA 1HP4A 4XIMA 1KR0A 2PRHA 4IMCA 5KEZA 1LCOA 1XXXA 1KM5A 3GNNA 1J93A 5ABTA 5DMMA 1UA3A 1CLXA 3U2ZA 2VWSA 1XBXA 5FESA 3HQ1A 3TW6A 4YS1A 2G5WA 3SY1A 1XGEA 1GVIA 2ICSA 1R3QA 4O19A 1K9EA 4NRRA 5F4WA 1PKYA 5GNYA 3TU9A 2WYSA 2RGMA 3ATYA 3EOUA 5AC6A 1CYGA 1U1HA 3OVRA 1Q6LA 4UTFA 3N9KA 3B9NA 4WD0A 2QDDA 3V18A 3PBGA 3CASA 1DQXA 1J0HA 2FMNA 1O12A 1NARA 3E0LA 5AHNA 1EC8A 5HMDA 5CJ5A 2PU0A 1Z7AA 3GDBA 5FSEC 3EXTA 5IFPA 5CLWA 2V68A 3MMDA 1PB0A 4L6OA 4HCHA 3MI2A 4W86A 3WLOA 4DO6A 4G7EB 1IHIA 1M68A 4NAFB 5GNXA 3R79A 4LBSA 4LAMA 2ZICA 3NL6A 4QCEA 2EO7A 3SUWA 3DENA 4YHEA 3MT1A 5FOOA 3I3BA 2GOUA 4NU7A 4UC5A 1CI1A 4TU1A 2Z2AA 3M4HA 2VGIA 3G1FA 4MKVA 1DIOA 3LHUA 5CC7A 4BF7A 1PE1A 1D2KA 4N0RA 2INZA 4XUYA 2FH6A 4IWWA 2Q3OA 4WF7A 1PKLA 4Q4RA 3E96A 3K13A 1XLJA 3WK2A 3M0YA 1VKFA 1W1A1 2A6NA 1G01A 1KTCA 1RXOB 3FY1A 4H3DA 5G4WA 2R1LA 2BVWA 1WZLA 4Y2WA 3LUTA 5D33A 1MFUA 3LTYA 3WNKA 3AHTA 1SFTA 1Q63A 3I6TA 4J2MA 4S2CA 3IJQA 1ITXA 1QHPA 4Z0SA 1TZZA 3DG7A 2VX5A 1LZOA 3R12A 4PUJA 3UVAA 5D9PA 3ITYA 1VPXA 4M7SA 4WY0B 1EQCA 3CZJA 2VUYA 3W1MA 3E0IA 4IP7A 1CLVA 3U9IA 5MHBA 1LTDA 4IMFA 1K9TA 4PMXA 2C1GA 1IWPA 1UR2A 1QK0A 3RPMA 3D3FA 4H6KA 3GU1A 3TYAA 4LPCA 9CGTA 1TQJA 1PDYA 4GABA 5DN1A 3BPWA 3W7CA 2XYLA 2C16A 4ZO6A 3UXIA 2G96A 4KEUA 1SW7A 3F5JA 3W1PA 3RNDA 4AD0A 1WB0A 3C0LA 5DY2A 4AISA 1WXJA 1E4LA 4YVPA 3V4BA 4CN1A 5CPSA 4A3YA 2ZIDA 2OQHA 4YWIA 3BVJA 3KHDA 2W5FA 3KL3A 4GO8A 5AHEA 4R53A 5KMYA 4RW3A 3UZXA 3REQB 5CJNA 4XD3A 2EF9A 2OLAA 2OELA 2VCAA 3B8VA 4NNCA 5JH1A 2H9AB 2XISA 3A3XA 1SFSA 1W1YA 3L2MA 3KCOA 3WLKX 1Y5XA 2ZQ0A 2BASA 6ALDA 1LL4A 1JG9A 4OFCA 1TV5A 3EYPA 1E43A 2DDXA 3SUUA 4LANA 3W00A 4WJEA 4ZE4A 1I0DA 3GDRA 1VAHA 3MP5A 2C1HA 4Q4SA 3QGVA 2BVDA 5A8GA 5AVHA 4TUFA 3S3GA 2CYGA 2VM8A 3MUXA 3RITA 4L6DA 1DPMA 1MEHA 4QP0A 3W1NA 5M17A 3A64A 3NM3A 1E0XA 2Q71A 1RSCA 4UQDA 1AVAA 4HSHA 1W3LA 2WB5A 1CGVA 1K9DA 3AIEA 1IWAA 1K9FA 2WXDM 4LF2A 5IM51 3POCA 1FP8A 3AJXA 3VGBA 3LTSA 1PZ3A 4NZFA 3M1ZA 1R9YA 4QDWA 5EA9A 1KM0A 3BSHA 1P6CA 4NZCA 3GU2A 3EXRA 3MSRA 3IGUA 1M3UA 1OYAA 4RPPA 1XIEA 3RF9A 3LRMA 4PMRA 4D6EA 4GY0A 1V02A 4O0QA 4AZCA 3TWAA 2WZEA 4G7FA 8RUCA 1AH0A 3NQ2A 3LRLA 4HJWA 3T07A 1JRBA 1GVRA 3GVGA 4JY8A 4B15A 3WQCA 4A35A 3TA9A 1PCWA 2WANA 2YA1A 1W9DM 1WAWA 3N12A 4KPLA 5G1YA 7TIMA 3TJIA 4AFYA 3RM8A 2FHCA 2XFWA 3PJTA 2FFCA 3N29A 4G2DA 1CCWB 3LK6A 1MI3A 3MMTA 3KVLA 2DZWA 1W17A 2BVYA 1IEQA 3KVMA 2EKCA 3V1HA 4GBUA 2REQA 3L4ZA 3FYYA 3MUAA 1PO9A 3UWYA 1AODA 5A5WA 4CNUA 4MY9A 2VQUA 4YWSA 3AMDA 1J01A 4O17A 1YTEA 3UQNA 2J79A 1W8SA 4TIMA 2C0HA 1LQAA 4V1XA 3O16A 1JCJA 3VGDA 1P7TB 3GYEA 4QNEA 3GS6A 1ZNNA 1KR1A 1NU5A 3CQHA 1VBRA 2CXEA 3N9RA 3THDA 4K1GA 3SUSA 2WSYA 3JRKA 4QJ5B 1H49A 1I0BA 4NZ4A 4GYPC 3N73A 1NQ6A 2GOKA 3EPNA 4JTEA 2AMXA 4JICA 3IANA 1BXNA 4F9DA 2QZRA 5XIMA 3HFTA 1GQLA 4QDPA 2WNNA 1XBZA 3UJRA 1YBQB 2XVPA 2ZZ7A 4JQ2A 3KLKA 3PJXA 5D03A 5ABEA 3IVSA 1FWJC 3GU9A 3WNOA 2POTA 4LRSA 3UJ2A 3LLXA 3WQDA 4HU4A 2ZX6A 5XIAA 4FSAA 4B3LA 1T41A 1JF6A 1SQ7A 3NPUA 3CWOX 3W7QA 3C3NA 1V6XA 1WKEA 5BRBA 4WK9A 5FEXA 4GXWA 2CNCA 5DT7A 2D0FA 3QBUA 3R43A 2XHYA 4D6IA 2HNHA 3B05A 3I7QA 3AWNA 1Z8AA 1BGAA 5E1QA 1BGGA 2V3DA 1RCQA 4QISA 1ZAHA 4UFJA 3AALA 1A5AA 1ISXA 3K1GA 3WDHA 1TJ0A 1M65A 3LOTA 2GWGA 4LYQA 2FHFA 2VVNA 3CL6A 3CQJA 5CZJA 5JUVA 3CU2A 4IG2B 5E93A 1JZ4A 3RLVA 4C1NB 5AC4A 2Y1HA 4M51A 1QXLA 4M6PA 5IHRA 1Y8BA 2NX1A 4DZ5A 2QVNA 2Y7GA 1V3LA 3GR8A 3ZR6A 3WDPP 1K1DA 2GQ8A 2J8GA 2WSPA 3HQOA 1NFBA 1NF0A 1TMQA 4D8ZA 2CZ5A 3EX6A 3VCNA 5ECUA 3H4GA 2A6LA 3NAVA 2X16A 4J9JA 4FXRA 5CBIA 2VYOA 4G1NA 1UZ1A 3A22A 3GTFA 1YDNA 1HXJA 3WD1A 1A47A 4ACYA 4AD3A 4U3AA 1NM9A 4AC7C 3B0VC 4IZGA 3LHWA 1I1WA 4F2UA 3MKVA 4M19A 3NTYA 4O12A 2VR4A 2PBGA 3HQNA 2VTFA 4L1WA 1KFEA 4MWAB 1GW9A 4KCTA 2EXOA 2PDGA 1G6CA 2A4AA 3SCTA 3K1DA 4MAZA 1B3YA 3L67A 1E1CB 2V5DA 3G1VA 4PBGA 4O13A 4O1EA 4BQ4A 1NFGA 3L4UA 4MJ4A 3EMQA 4MF4A 5FSDC 2FVMA 3IIZA 5A69A 1EA9C 2D22A 2CU0A 1NF7A 5ECVA 1XQKA 4L1GA 2J9YA 4H9TA 2ON3A 1Z41A 1V7AA 1TVPA 2CWNA 3SRHA 3UWWA 4XAGA 3I7RA 2X2GA 3LQGA 4GLEA 2ZUMA 4JTTA 3M46A 3W82A 2L5HA 4QLLA 3OP2A 3IWPA 4KWSA 1X8CA 3OO2A 1DIDA 4WXZA 1XCXA 1MRAA 1N55A 3OPSA 4A3QA 4BQ3A 2PZNA 3RX3A 2FZ8A 2VJXA 1DJZA 4PRWA 4ADTA 2PF8A 1TR1A 3CT2A 2SFPA 2XN2A 2PBOA 1ZL1A 4HNLA 2PU1A 3WLLA 1YNPA 2GVLA 2DT3A 2B7OA 4Q7NA 1UA7A 1GVYA 1V3IA 2BODX 4IPNB 4QS5A 4PCFA 4IQDA 3T55A 3MVTA 2CKRA 1EJWC 1VEPA 4KWOA 3CAWA 1E1FA 4J7RA 2IKJA 1HW6A 1TR9A 3W7EA 4DXXA 3UG5A 1V03A 3SDOA 4FZIA 3NR0A 4D6FA 3OB8A 5FCZA 1ZQ5A 4RK8A 4MWAC 4L5ZA 1KBIA 4MY8A 1UCWA 2DEPA 2X41A 1BEUA 1J11A 4D9PA 1UR4A 4U5KA 4OBRA 4KIEA 3W1AA 3H54A 2O56A 3ZLHA 4JQ1A 2E8ZA 4O0KA 2VURA 3GB6A 2C6QA 1QPQA 2Z2UA 4ZTYA 4C1KA 2PD5A 1PUDA 3QZEA 2VDIA 4XVEA 2Z1KA 3DC8A 1JAEA 2J9XA 4PTWA 3LTPA 4ZB5A 1ZLPA 2CXGA 4P7QA 1Q6RA 3WZ0E 2H6RA 1QVBA 4H8UA 1OY0A 1KM3A 1UP2A 5BMXA 5BOEA 1L9WA 3E02A 3UGVA 3GFXA 4FB7A 1NELA 2GPTA 8CGTA 3IK4A 5J04A 3O07A 1J0KA 1V7YA 3JU2A 3LCHA 4DXVA 3GE7A 4MG4A 2XN1A 3NVDA 3GO2A 4EXBA 2FGZA 1E73M 2QNEA 1EEXA 1PDZA 2Y89A 3DFHA 3GG7A 4JYFA 1ZZMA 2GWNA 1TSIA 2C18A 4JL2A 2QV5A 3C2EA 2DUZA 4XSMA 3W07A 4PYSA 3CB3A 3RFAA 4Q4MA 1LDCA 2DJLA 4C6LA 1B90A 1GPFA 3OYXA 4GX9A 1XF0A 4WIWA 1V0LA 3UW6A 2FZMA 5DRCA 1WZKA 1W0MA 1UD5A 1XJBA 3TEVA 1RZMA 1H09A 4B5UA 3AYRA 1SZEA 3RK8A 3EX1A 2QCGA 1E1EA 8XIAA 1VBHA 1DJXA 2PODA 2PDKA 4ES4A 4NI8A 4ZFCA 4L9ZA 3HG4A 2ACQA 1UKPA 3LHZA 3SQMA 2J7DA 3NPVA 3M0JA 3CHVA 3CMJA 1RQBA 2WLYA 1K7FA 3PBYA 3PZTA 4GA8A 1QI3A 1W8GA 3GVWA 1EIXA 4FX8A 1AQHA 4EPBC 3KBWA 4XO7A 2OO0A 4PEEA 1OT1A 4J27A 3WQ4A 4MOZA 4FOJA 5F4XA 3MJYA 5EYWA 4XD4A 1H63A 3A21A 3IARA 4QSFA 4W87A 4PSPA 5D37A 3WJXA 5H6HA 2FGLA 5G1MA 4NSBA 4RZ6A 1OG6A 4KWUA 5IHSA 1RH9A 3HOJA 4O10A 1OC6A 1GCYA 3EWBX 1OCQA 3C2VA 5I3GA 1QNQA 1MXSA 2CWXA 2OO6A 2C15A 1CXLA 2FB2A 1ESWA 3URBA 5HPCA 1TCDA 3P93A 1JYWA 2OZ8A 3SRKA 1R0MA 1NOUA 3K8KA 4ILSA 5HNUA 1GTHA 1YNQA 2OLSA 5T26A 5HJLA 4B9YA 1RY8A 1I45A 2PPGA 4NNBA 5HJYA 1UUOA 5FJRA 4UQEA 2VDGA 4V15A 2HTMA 4JQ4A 4JEQA 2P0OA 3NDZA 4C7GA 1K8YA 2HVNA 4IISA 1SMAA 3RYSA 1OFAA 4GWEA 4W8BA 3TC6A 3M47A 4GIYA 1DWHM 4JAWA 2I5IA 3ZZ1A 3FA5A 4JD4A 4A8LA 4N9DA 1CLKA 4E38A 1H7RA 1VC4A 4WGHA 2JK2A 1P6BA 3AZSA 4PODA 1EFZA 1TFVA 5EMMA 5AHIA 1KNWA 4DZHA 4EAMA 4ZSUA 3LGGA 4I7UA 1O4UA 3EDEA 4AEFA 4R34A 3L68A 3U7BA 7A3HA 1WE5A 3CUHA 1JPMA 1P7TA 1V3KA 2FPVA 3RUBL 4X9SA 4JFTA 1F74A 1N8WA 4J35A 3G5EA 2A7NA 4XAFA 2X30A 3EXSA 4DO4A 3TQ0A 1W9XA 4ZOAA 2Y7EA 1HFBA 4JIPA 4YJ5A 3N9SA 3OA5A 1E9IA 1V0NA 1X1NA 3SCQA 2PWFA 4BWLC 1C3FA 4GK8A 4EPEC 2GQ3A 2JKAA 3CV1A 2EPOA 3OQEA 5G1TA 4DF2A 4ZE5A 1SU5A 3GK0A 4DWSD 4XO6A 1AL8A 4DAFA 1VB9A 4AZHA 4B90A 1O94A 1J0IA 1KV5A 3ZIZA 4H1ZA 2DSVA 2QXWA 1OFPA 4F0MA 1LWHA 1GHRA 3B8TA 5E6ZA 3PJUA 4XD5A 1FCQA 4MB1A 1MNSA 3NA8A 3LENA 5AYXA 4IH3A 3VKKA 1S5VA 3PJWA 2POZA 4AZCB 3UYIA 3T81A 2X0YA 3HM7A 3STGA 4AWTA 4UZUA 4DZIA 3H7UA 3R7MA 1F07A 4LX4A 4M81A 4EWJA 5A1AA 2OMAA 4AQLA 3HB9A 4UQBA 1KGUA 3H2NA 4HP5A 1ZBKA 3S5ZA 1Q66A 3BSMA 3O6AA 4ICNA 3TN4A 4MUPA 3PY2A 4DYEA 1OX4A 1OX5A 2YBTA 4LFYA 2NQHA 1JDAA 2J88A 2J78A 3UR5A 1VYRA 5E70A 4GACA 3CHEA 4NP7A 1GONA 4PMYA 2QIWA 3RLGA 4BI7A 2YPIA 3NXLA 4S3CA 1K4GA 1WBHA 1IT8A 2X7VA 3B0UX 3U2EA 4NL1A 2CHOA 4IFKB 2CZVA 3B0YA 4JX5A 2QPUA 3SW6A 2PDXA 1GOWA 3MI6A 1QNPA 1UKTA 4QG9A 4JTSA 4S3DA 1KFCA 4IGHA 1LL6A 3BCJA 4HZMA 1W9PA 1IQ8A 1IEXA 4E0CA 4S38A 4LOCA 3P60A 2J8TA 1O5QA 3TOPA 1DWAM 3BCFA 1AZ2A 2UY2A 3M41A 1J0JA 3ZJKA 2ZUWA 4UTLA 1G5AA 3OTRA 3N4AA 3OLEA 3W7HA 2O4QA 3W4RA 1SO3A 2GGGA 5A6JA 4L1XA 2DJXA 2NXGA 3Q65A 4MJ2A 3QTPA 3KLLA 1BWVA 2CEQA 4H2HA 2ANUA 1ME9A 4IQEA 1FH8A 3TCEA 3IAPA 1T8XA 6PTDA 3VOIA 2AQWA 5EY5A 3WNLA 1SZRA 5DY3A 1JI2A 1WOAA 1WDPA 2YCKX 1SGJA 1O5RA 4OKDA 4PB5A 3K4AA 4PULA 4AY1A 3LLDA 1D3GA 2BVTA 2VEIA 8TIMA 4WJ8A 5L9FA 3KX6A 1Z44A 2J77A 4XD6A 2BHZA 4XVDA 4LYPA 5DCEA 3FA3A 5D9NA 2D3LA 1PX3A 3W85A 3BLDA 3TYBA 1JYVA 1Z48A 4JTUA 3R89A 1UZHA 1ODUA 4WY0A 1HVXA 2ZX5A 1XINA 3PPFA 2J74A 1CGTA 1E5NA 3N2BA 2B7NA 1H5VA 1GVFA 1AFSA 3G6LA 4Q8UA 3UZJA 3LEPA 2JKPA 2D2GA 1C7TA 4Y90A 3H4XA 1XSJA 2E5DA 1B3ZA 3DI1A 3M0XA 3ITXA 4GJJA 4XBJA 4X60A 2EJ1A 3ANUA 1IXQA 1XC6A 5C9WA 4NYUA 2QF7A 4AD2A 4DJDD 4O1FA 1XYZA 3KCLA 1EUNA 1XKJA 2GVJA 4IMEA 4EVZA 2CLEA 1OEPA 4KS0A 5I3DA 4O28A 3DFQA 1XCFA 4LC6A 1MRQA 2CCRA 3LBMA 3KP1A 1W54A 3FVDA 1NSJA 3MCMA 1UR0A 2O7SA 1J4EA 2XFFA 3C86A 3K30A 3BGGA 3MKKA 4PH6A 1F05A 3TA6A 1GJPA 2BHYA 3GDLA 4JTAA 2R9RA 3W7JA 4LAZA 4HNUA 4RNFA 1K7EA 1TZ7A 1VZWA 2YXOA 3VNKA 2D20A 1P0NA 2YFOA 2ZRXA 3MYPA 2YXXA 2YSWA 3PB2A 1F61A 2OG9A 1US0A 3LCIA 3INPA 1VQTA 2WSQA 4MNKA 3NQVA 2P53A 3U4FA 1CEOA 3QHNA 3THAA 3DFOA 1C93A 3WLTA 1QPKA 4M80A 3T1GA 5HATA 2F7FA 3W6LA 4QGCA 3OLDA 1FH9A 2FMOA 4HYVA 3GXDA 1TWWA 2NUYA 3SN4A 2PWHA 3OG2A 1A0CA 3G1RA 4DI8A 3HMCA 4IT1A 1E6ZA 1JUBA 2DSUA 3OIHA 3L4VA 3L5AA 2WJDA 1MZRA 5TIMA 1WZAA 4AXKA 1W1VA 1B3OA 3GM8A 1YKWA 2KAUC 4D1IA 2GVGA 4WY0F 2D24A 2NZLA 2I7GA 2BV9A 3VAVA 1D7FA 1A5UA 5CEWA 1V6UA 4NXKA 3MSYA 5ABGA 1JYXA 3MO7A 1GWJA 4WZHA 4EXQA 5FL0A 1FCBA 1CWYA 3GX9A 4OIFA 3N6HA 4MHBA 3BCDA 4TX9A 1DV7A 4AX6A 4LCQA 2VRQA 4JKKA 2BGNE 3DC0A 1E4NA 2Z1WA 3W2NA 3D5HA 4TTGA 3R11A 2HXUA 5E0FA 3VU2A 3UPMA 4YMZA 1RY0A 4GNJA 3M44A 3R1ZA 4OV9A 4AC1X 1EEPA 3VIGA 3OZMA 4KT2A 1YX1A 4JIRA 5JIWA 2VVSA 3ANYA 4B4HA 4UCFA 4YNGA 2IUZA 2H8XA 3N25A 4M1RA 3S2LA 1I2PA 4ZL1A 3OVGA 1H0GA 2PFHA 3WUGA 1XG3A 4G56A 4GVFA 2P8CA 1YYAA 1W3JA 4LUIA 3QF0A 3NL2A 1RK5A 3NYZA 3NZ1A 3LA4A 3MW7A 4GY7A 5CGQA 2C1IA 1XLIA 3UZ5A 1M41A 1BYBA 3UG3A 4DAIA 5T8GA 3ENLA 3M5XA 4HA1A 4W7UA 1RA5A 1VJIA 4OOUA 3ITVA 3RCNA 3SRDA 7ENLA 2ACUA 3B0XA 4WQ6A 4F79A 4DBWA 3M7WA 3ZS4A 4F66A 1YXYA 3A9IA 2Z7KA 2V5CA 1OFDA 4ZXOA 4DX3A 4LXFA 4IPIA 3R0UA 2AGKA 4S39A 4US5D 1W2VA 4EPDC 1XLBA 3QC3A 4IP5A 4XIAA 3QW3A 1W6TA 1MW0A 1GYMA 3E2QA 4IGNA 1ZB5A 4P7OA 4CUCA 4QDMA 5DMLA 3ZVIA 2C71A 4LS0A 1H0IA 5LIXX 3UZZA 1FWHC 1UR1A 1ZCCA 1XG4A 1JZ6A 2D1ZA 1L6YA 5REQA 2GJXB 3BUVA 1LUCB 1OC5A 4KWWA 1OFQA 4AVFA 3SCUA 3WH6A 5AOUA 3OIXA 2HK0A 3DHUA 2PLJA 3PZVA 1WDQA 3YPIA 3OLIA 2OJPA 4KERA 4K37A 2NW0A 3GC4A 1MQPA 1Q6EA 1RVGA 1VBJA 2Y6ZA 2VXNA 3HTWA 3L23A 4DLFA 3F03K 3MYOA 4HU8A 3A3WA 2FFIA 1KCLA 3UNTA 3GHRA 1KFKA 3G77A 4HKPA 2TMDA 3GG1A 3GLCA 1S2UA 1OYCA 4RX0A 4UMBA 5HA7A 3KDOA 5A6KA 1KLZA 5C9ZA 1QWKA 1SUXA 3CC1A 5CZ0A 1JZ8A 3AZRA 2F84A 3LXAA 3SCRA 2BTMA 4I9TA 1BWKA 1JEZA 2HSAA 4ZQRA 3VM5A 3NQEA 4DWDA 2HS8A 2EBNA 4WOZA 2GZXA 1LRTA 1OZMA 3URNA 3WMBA 3ITOA 4M6QA 2E3ZA 3I68A 3CS2A 3EWXA 4QEHA 5CPMA 1DXIA 1KB3A 4HHPA 3VUPA 1E70M 1VLIA 3W26A 1ZAJA 3T8LA 3AOFA 1M5WA 4IL2A 3JVAA 4GVGA 1KM1A 5C9RA 4KFOA 1FWIC 4WDTA 4J28A 4QX4A 5AZ0A 3TK7A 2F38A 3PWGA 5BU6A 2IMRA 5JIPA 1JFHA 2HMCA 2J27A 3N2XA 2WHMA 3LXCA 3G8EA 5HDRA 4DJDA 4HB7A 4P8VA 2QUTA 4MJZA 3W1QA 5K9XA 3QY6A 4MB5A 1VBUA 3L12A 4HOZA 4YYCA 1E6PA 2YB4A 3VOFA 1E55A 3CT7A 2XN0A 1Q7QA 2P0IA 2V2DA 1JFXA 3WBEA 4PMVA 2B81A 4QM1A 3WF4A 5HMSA 3ONCA 5AHFA 1S2CA 3ICJA 3ARVA 4JEJA 5GJMA 2OPJA 2GGIA 3CQ0A 1UC5A 1QTWA 4GYPA 3BG5A 3VNLA 4PTXA 1TB3A 4Y9AA 3WLHA 3GTHA 1QPNA 2QR6A 1TWSA 2OWWA 2EQDA 2F6XA 2OWXA 1JZ7A 1NWSA 3STEA 3H8AA 2VKZG 4YTUA 2ZX8A 5U7SA 3VD9A 2AMGA 1YDOA 5IBXA 3NPXA 4ATWA 5AY7A 4CQDA 4X0NA 1IIHA 1EBHA 3H2FA 2QAPA 1BSIA 2A7PA 1K6AA 1RQEA 4O1AA 3BAJA 1T8QA 5H8PA 1QATA 1S5MA 3LG3A 2VDHA 1UR8A 2X40A 2Y5JA 3CL7A 3SCOA 1V8EA 4RLIA 3ZM8A 2QCCA 1IT0A 1FFQA 1K77A 3AXKA 3WNPA 1LQ0A 3N18A 5CBJA 1E40A 1CB7B 2UY3A 3CM4A 4B2DA 1M01A 4AUBA 2OODA 5I02A 2VEMA 3T0DA 1TCMA 1BD0A 2Z00A 4ONVA 1UWSA 3TFXA 2GUUA 1YQ2A 5IFTA 3BICA 3WL0A 1J6PA 2W63A 3BW3A 1BXCA 3N04A 4LAKA 3RMEA 2VELA 1DXEA 4DEFA 2EPNA 3CNYA 1GYNA 3LSCA 1PAMA 4YHGA 4JFUA 3DUGA 1EOMA 3MHUA 2E1WA 2DGAA 3QVQA 2VMFA 1EB3A 1GEQA 5M3WA 2UBPC 1BG9A 2DIEA 3MBFA 4EF8A 3NL5A 1MEIA 4TXEA 1JJKA 3HJEA 1EZWA 2PI6A 3KOFA 2X2YA 1EQPA 1B1YA 3D6NA 2Z7GA 3VD3A 4J2PA 3WUEA 2UY5A 3AUJA 4EX4A 3BWWA 4ZB0A 1XIMA 3IGHX 3LSBA 5D32A 1HJXA 3A4JA 3NG3A 4ROQA 3BAIA 4HK5A 4M7TA 3GR7A 3B4YA 3CMGA 3W7OA 1YW1A 1UP0A 2A85A 4GUGA 4CD7A 4Z42C 2OWCA 3ORWA 3A13A 2NWRA 3MU7A 4Q8NA 2DY3A 2VZVA 4RZ4A 2R94A 3E5BA 1XX1A 5C7VA 1FWEC 1IGWA 3F7JA 4JFVA 3UT0A 3QW4B 3S5OA 5J5RA 4HNCA 1QW7A 1HKJA 3PUGA 1G1YA 2I9EA 1FWSA 1V4YA 5I3HA 5FEZA 1FHDA 2ZOXA 2Y8UA 1G67A 4PCTA 4A05A 3KW3A 4AYGA 2OX4A 3W86A 1XBYA 1EC7A 2W66A 1Y65A 3TKFA 1CW2A 2QJHA 3IGXA 4C60A 4DXKA 3UWEA 4O4WA 2ALRA 5F1UA 1OX6A 1PSCA 4MFDA 4B5TA 4K6AA 2AGTA 4PUWA 3WNMA 4JTKA 4FI4A 3SGUA 4JTGA 2GJRA 3UGRA 1B30A 3KBJA 3WLQA 3RJYA 1UOKA 2QS8A 3ARSA 4MVAA 2ZX9A 3PTDA 4XK2A 2CFFA 5U4NA 2W67A 5D05A 1EHAA 3MCOA 4J3WA 1SSDA 1DTNA 1ZAIA 1KM2A 3E0VA 4L9YA 1KKOA 2I5QA 2FQIA 2DVUA 3IRSA 1BFNA 1RBAA 4PBFA 4JX4A 5IDZA 1POKA 2GGJA 3ARQA 2W4XA 4RJEA 1S1RA 4Z2JA 4NIRA 4QR6A 1TV7A 4IP4A 1QUMA 4EOUA 2X1RA 1D7KA 4LUYA 4P5UA 3SURA 3IIXA 1K3UA 1LP6A 3CV7A 2WKJA 3KS6A 1VPQA 2PGFA 2VWTA 1ZGDA 4GC3A 1T7LA 3Q67A 3PANA 3VKAA 2X8RA 1ODZA 3PULA 5HBFA 2ZTJA 1B3XA 3RM4A 4DO5A 3P81A 2RJGA 3HIJA 4NJKA 3FAXA 1WZMA 1IWBA 3WQ6A 4CNPA 1R3VA 2A79A 2VUNA 4AEEA 3EB3A 2FTWA 4L6HA 2PDCA 1TZ9A 4W93A 1XC4A 4YN5A 4Z2IA 2QUUA 1CNVA 3RXZA 1SFLA 3EX2A 3UBPC 1SJDA 3FK4A 2CBJA 2ISDA 3VDHA 1G9HA 3WJWA 1DXFA 1GQIA 2E9LA 5KZMA 3BJSA 2HBXA 4L7ZA 2QHAA 4XKYB 1O7AA 3W7DA 1JCLA 6CGTA 1TPVA 2QPXA 4R33A 4K39A 4CKQA 4GIEA 3RN6A 1JPKA 3W74A 1QNOA 2BP1A 3EKGA 1KRMA 4FHAA 3ZQ9A 1T6MA 1EJUC 3VMOA 4KCVA 5HJXA 6A3HA 3USBA 2OEMA 3GFZA 2BY3A 2XM1A 1F76A 5EMJA 4LEQA 1K8XA 1M03A 4ZBCA 3V0SA 3QGAC 2Z0IA 5CAHA 1ITUA 2RDWA 1KO0A 1P0DA 2GQAA 5BRQA 1XFBA 4CNSA 3W38A 1QT1A 1O68A 2VOMA 3AHVA 4Z0JA 3TYDA 4HNVA 1Z6KA 1QOPA 4GQRA 4WR3A 1L6WA 3BLPX 1XLFA 3E0FA 5TD4A 3EDDA 4MMWA 3UWQA 2EPKX 2XWDA 1V0MA 5CC3A 1Q6FA 3WX7A 4DM2A 1JXJA 1K03A 1I6NA 5C2XA 3QPZA 4DNMA 5KSWA 2Q8XA 4LVAA 2XH4A 4OHQA 2Y61A 4Y9PA 1P0KA 1WKDA 3M16A 2CLFA 1EA0A 2WNWA 3WMLA 1TJRA 2G37A 4J3XA 4DN1A 4U2YA 2WC4A 4K7YA 4QG6A 1F9CA 3QR3A 2EEXA 3WQ5A 1K02A 3HO8A 4GH1A 4DUWA 2ZA2A 4C6DA 2WCAA 3GXNA 3TR2A 1ADSA 3B9AA 2BOFX 3WQOA 3BMWA 1DHKA 3CQKA 2XPKA 1LRQA 3ID7A 2DZUA 3BV7A 3W37A 4E2DA 4DLMA 4Z2KA 9RUBA 2B7QA 4LVBA 4L9XA 4J1OA 3B8UA 4FIRA 3UD6A 5I09A 5KTLA 1SW0A 1HO1A 1OCJA 2QCFA 2YYUA 5AC5A 1ZJBA 4DZAA 1FWNA 3CZGA 1TTQA 4IL0A 4RDWA 2ZZ3A 3Q94A 4XZNX 5DCDA 3P84A 3G2GA 2NXHA 2E1DA 1MYRA 2WAGA 3URAA 1VFUA 3NCOA 1AW5A 3LPPA 3OHIA 3PBWA 1UD2A 3H22A 1OD0A 5D38A 1P0BA 2WBGA 4FNSA 1KV8A 2FLIA 1W5QA 2VRJA 1XH1A 3W87A 4C6PA 3H7VA 4QS6A 3QLLA 4K38A 2E9MA 4UOQA 3W76A 4XZWA 3H6OA 1XLDA 2J8FA 1W3TA 4S3JA 3D3AA 4XTIA 1GJUA 1C92A 3ZLFA 4EIVA 2ALDA 3EWYA 4Q8MA 3VVGA 1DE6A 1UIOA 5A2CA 2E7FA 3WUBA 5DRIA 1H62A 2WV8A 3M07A 3W1UA 4WDUA 1H7OA 1P0EA 1ZS2A 3KVKA 5IBXC 1US3A 2NLYA 3O8AA 2E09A 5ENLA 3UP8A 3GNOA 4P61A 2XTKA 1V6TA 3K4DA 5JBEA 3F4DA 3TP4A 3NUKA 1I8JA 4EWND 3DN5A 2NQZA 3ATZA 3AHXA 1A5CA 3QQWA 4DBSA 3TJLA 1WNOA 3R58A 4BY3A 2GDQA 1H51A 5K2ZA 1E0UA 1R85A 3WIJA 4LU0A 2XU2A 3M9YA 5C8BB 2AOSA 4K36A 5GQBA 2ZC8A 1K70A 4DYJA 3R4IA 1EP3A 4IXXA 4JBRA 3KTXA 4RNIA 3FIGA 1W5PA 3ITCA 3N13A 3PK7A 5DF0A 4ENLA 3STPA 2OSXA 1NOFA 5I77A 4GHRA 1JCYA 1GOIA 4MLJA 3PUEA 4KIRA 2D2OA 1M9HA 4LUSB 1ZTVA 3PTQA 1JF5A 1B4EA 3CIXA 4J3TA 5B7ZA 1BQCA 3CEUA 3TZNA 1NH6A 3KRZA 1RP8A 3ARPA 2YZ5A 2YCJA 3WD4A 4ERAA 3W3OA 5LNWA 2BWGA 5BRPA 4JYEA 1MFVA 1M53A 3F4WA 1I60A 3CH0A 4GIRA 1YTDA 4GX8A 3GAKA 3A5FA 3O0FA 3GUGA 2WMGA 2WWCA 2RFGA 3DGBA 1HG3A 2PMQA 1NAL1 1WBJA 3WBWA 3MV01 1XKYA 2GGHA 4OVXA 5DXYA 2W3ZA 1UHVA 3AYVA 4LY8A 1A0DA 3V3WA 5BW6A 4YXGA 2NUWA 4NJGA 2W9MA 4R88A 3BLOA 2XFRA 1FWBC 3T0BA 3V5CA 3ALGA 3CLMA 4ZQMA 3I65A 3IJ9A 4PUDA 4LC8A 1WXZA 4E5TA 4ATLA 3DKLA 1OYBA 1PX4A 3PHAA 4Y9NA 3FDGA 1TMLA 2BG5A 3S8HA 1EJRC 5CPTA 1MO0A 3M7SA 2ZRUA 1JYNA 1D3HA 3AS0A 2E6AA 4Q4KA 1XISA 4J3UA 4LCRA 5AZ1A 4LRTA 4ZO7A 2I9UA 3SIMA 2GSJA 3U4AA 1LF1A 2O4MA 4XAPA 1FCVA 3FYPA 3P5YA 2R24A 2XGZA 3AHYA 3QKEA 3H21A 2XSXA 2VZUA 1R30A 1W5NA 1TV4A 3GUWA 1MMFA 1TPEA 2EPMX 4UR7A 1S2TA 2PF0A 3HG3A 1IIGA 3D0CA 2BSLA 1VCGA 5AC8A 2PLCA 2QJIA 1GKQA 2WJEA 1WUEA 3UXLA 1PHQA 3NSNA 1KTNA 1UD4A 1FBAA 1OFEA 2EAWA 3R2GA 1R7AA 1F8MA 3WLRA 1V5XA 4KH2A 4F40A 1BYDA 4PCNA 3VO0A 2PDMA 1FHLA 1BF6A 6REQA 4D71A 4YTQA 4N9EA 4UR9A 3M0IA 5LGZA 5FAGA 5BXPA 1CX9A 3LBOA 3CWHA 1GJWA 1E51A 1HQTA 2IQTA 3CUGA 1Q4NX 3ONBA 4K8EA 1RR2A 4TMCA 2E6FA 1H5YA 3MBDA 3FJLA 2O9TA 1JDFA 2AQVA 4FALA 4IQJA 4HA0A 5BXRA 1XIIA 1G94A 4XV0A 2V38A 4FNUA 2ABBA 2W27A 1AD1A 3D47A 3DYPA 1ICPA 3APYA 4UZSA 3SY5A 2DPEA 4OOZA 3TAOA 3PUOA 4MTVA 4D1JA 4F4RA 4ALDA 4ZCWA 3LYEA 4Q3MA 4Y9MA 2FZDA 2WJFA 3GNDA 4WDWA 2PGRA 1OCBA 4PTNA 2DIKA 1EF3A 3URQA 3SCPA 3IUDA 1X39A 1L8NA 3QV8A 5DMNA 2Q8ZA 4ZB2A 3G1XA 3KHJA 5LNSA 3VILA 1VD6A 5FF4A 3RMJA 2P1FA 3VI2A 1OBAA 1XYCA 1XW8A 4M56A 4MGGA 2G3FA 2J7GA 1HT6A 5AYIA 4D8LA 5D2YA 2EG6A 4A3UA 1TA3A 3FGCB 1Q8JA 3EWZA 3H2MA 1P6WA 3CK5A 2J75A 5EBUA 3CYJA 3KBSA 1TWZA 1MWOA 2VZSA 1VEMA 5AC7A 2PSNA 3SJ3A 5A8OA 1WYIA 4JNZA 3B0PA 2WBKA 5CGTA 5HULA 4DHGA 1WKFA 2YLAA 4Z1AA 2W91A 2QIIA 2J7EA 4JN7A 4AYSA 1TPFA 1Q6CA 4GGHA 4H7ZA 2QUVA 3L2IA 1GOXA 1J2WA 1GVOA 5DELA 3A47A 1AJ0A 3LCWA 1J5TA 3WBXA 2CPUA 4XBSA 8XIMA 3RILA 2CKSA 1PTDA 1XRSA 3KOXA 2FIQA 3ME3A 4UCGA 1KFLA 4MUZA 4IFOA 4M3PA 5FA5A 1GVSA 2VGFA 1SYTA 3RDKA 2WLZA 3L4XA 3PNUA 4ERIA 2Q8LA 1TMHA 4I6KA 1PBGA 4W4QA 1A5KC 2X05A 5K9DA 1EXBA 2YL9A 4R9XA 4HMCA 3LB0A 3ALFA 1DJGA 4G5DA 2QDGA 3VIKA 3GH4A 1MEWA 1D9EA 1KD0A 2O9OA 2ZCGA 3C4UA 3MO4A 5M1TA 3PBUA 5I00A