3WQGA

D-threo-3-hydroxyaspartate dehydratase c353a mutant in the metal-free form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNHAAATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate
pubmed doi rcsb
source organism Delftia
molecule tags Lyase
molecule keywords D-threo-3-hydroxyaspartate dehydratase
total genus 143
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3wqgA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3wqgA02
3N2BA 2YXXA 3CO8A 2QGHA 3LLXA 1SZRA 1NJJA 2RJHA 3ANVA 1NIUA 1XQKA 3B8TA 1L6GA 3ANUA 1XQLA 5FAGA 3AWOA 2PLJA 3B8VA 4LUSA 4DYJA 3NZPA 2NVAA 3GWQA 7ODCA 4BEUA 4DZAA 4WR3A 2VD8A 4Y2WA 3WQDA 2P3EA 3BTNA 3WQEA 1EPVA 4BEQA 5GJMA 1HKVA 3OO2A 3S46A 1VFHA 2ODOA 5FAJA 1B54A 4LUYA 5GJPA 3HA1A 1VFSA 2SFPA 1VFTA 1L6FA 5IRPA 3E6EA 1SFTA 3SY1A 3E5PA 3C5QA 3HURA 3UW6A 3WQCA 3AWNA 1KNWA 4QHRA 2RJGA 4LUSB 5FACA 2NV9A 3N2OA 1BD0A 1XFCA 4PB3A 4ECLA 1CT5A 4PB4A 5GJNA 4PB5A 3VABA 4BHYA 4XBJA 1TUFA 2VD9A 3WQGA 2TODA 1RCQA 1TWIA 1W8GA 1KO0A 1F3TA 2ON3A 2PLKA 3KW3A 4BF5A 4A3QA 3N29A 4XG1A 5BWAA 2OO0A 4LUTB 3WQFA 4FS9A 3NZQA 4ILSA 1FTXA 1D7KA 3MT1A 2J66A 1QU4A 3CPGA 3R79A 4ZGYA 4LUTA 2DY3A 1HKWA 4V15A 4KBXA 2O0TA 4AIBA 3B8WA 3B8UA
chains in the Genus database with same CATH superfamily
2WJDA 3EEZA 1QI2A 2J77A 4DHGA 3OVRA 4X2RA 1DE5A 4GYKA 1M7PA 4CQ9A 4JIEA 3W7RA 4NP7A 5AHMA 4DIAA 4H41A 2DJLA 3LBMA 4Z1DA 1GCYA 5KZMA 4JTIA 1AA1B 1VJZA 4EWJA 1BVZA 3TMQA 1GPFA 3L4WA 1J01A 4MYXA 3IK2A 4NYYA 2IPWA 3M46A 4F8XA 1WKFA 3RLUA 5LSMA 2DORA 3MZNA 3MYOA 3FX4A 3GM8A 2XFWA 3C0JA 2WVVA 3N12A 3E0IA 1RA5A 4ZQMA 3IUHA 4DO7A 3IUDA 1TVPA 1HL2A 3DN5A 4IGSA 4XTIA 4HHPA 3QOKA 2DZTA 2W61A 1W1A1 4JEJA 1F3EA 4UTIA 5IDZA 1E40A 4WUIA 3VOIA 3TXVA 1GUVA 4JTDA 3HPZA 3UU0A 1VAHA 3E2RA 1UP0A 3VMOA 1KO0A 5EMYA 2NVDA 1K7XA 2AQVA 2BHZA 2JQXA 3L4UA 1YDOA 4XSLA 3KZPA 5LNUA 1Z89A 4HYVA 3HJZA 1RCXB 3NL3A 5DT7A 1RBLA 6ALDA 5FL0A 3VVGA 4QQUA 3LG3A 1M6JA 3W3OA 1UR9A 5EBUA 5HWJA 3FY1A 1NH6A 1E9IA 1S5MA 1A3WA 5LIXX 3NDYA 5AHNA 4PRTA 4CCZA 1QNOA 4CVUA 5CKSA 1DPMA 4K8HA 3EX2A 3AIRA 3POHA 4AF0B 3NOEA 3W2JA 2OSWA 1TX0A 3S1WA 3HQOA 1NFGA 1O7AA 3S2LA 2HBVA 2PLCA 1H7OA 3LSBA 4ES4A 3MO7A 1QOXA 1VD6A 1EO5A 2ZTKA 1SW7A 3LEPA 3L4ZA 4JL2A 4X3ZA 1X7FA 1LDCA 4CNOA 1IR2A 1FWFC 3SR7A 4AC7C 1TTQA 4O0QA 1VHNA 1PEZA 3ZWTA 4MUZA 4AZIA 4DJDD 2BOFX 3O07A 4S2BA 2VJXA 3ZO9A 2OO6A 4OGZA 1ZSXA 3U2CA 3GBDA 3LHWA 3W28A 2VTFA 4TVDA 1FKWA 1I2RA 3LYEA 4Z1AA 1TWZA 4PB4A 1R9XA 1W1YA 3DXIA 5E93A 3UZJA 3LPFA 4L9YA 1R5YA 3GR4A 1EJRC 4YPJA 3DU0A 1RD6A 4JDYA 4XKYA 4DBWA 1CEOA 2Q09A 1K8XA 3CEPA 1A80A 1KCZA 2VFFA 1GHRA 2CCRA 3L4YA 4ORMA 1W1PA 3LV6A 3W27A 2X41A 2J7GA 5AZ1A 5FSEC 5ECUA 2BGNE 3IIVA 5A3HA 1ZAIA 4HNTA 1G4SA 3NUKA 4CU7A 4ZQPA 5LIWX 3W53A 3LU2A 2L5HA 1OFAA 3WH8A 1K9FA 5DN1A 4IQJA 2AQWA 2CZDA 3KWXA 1DIOA 4PMJA 4Q8NA 3KOFA 3FS2A 1YXCA 1E6RA 2GK1A 2J7DA 2V81A 4KT2A 4H7CA 3H21A 3ZT7A 1XGZA 5I0DA 3PBGA 3LDVA 1PZ1A 4PEEA 4O15A 1FWBC 2ATSA 3BLIA 2SFPA 2IPGA 3G5EA 3MMDA 1OADA 4GZ7A 1PCKA 5AFDA 1J0ZA 5AY7A 4LEQA 2ACSA 2NXGA 1JYNA 4QDWA 4EXQA 3VZYA 3K46A 5DMYA 4YWIA 1TZZA 2ZRVA 1AH0A 1UZDA 4XZMX 3VA8A 3WDQA 2V69A 3QOMA 2A3BA 2ZRWA 3CV1A 4N4PA 3OHIA 1UR8A 1NDZA 3O0FA 3WDJA 3BCFA 3PVFA 3VGGA 4NRRA 3MCNA 3QQ1A 1FRBA 4X61A 3D47A 1JD7A 4H9YA 4AXKA 4YTRA 4L56A 1ESWA 4MY9A 3N2BA 2PWVA 2RDUA 2WKGA 3NM3A 2HVMA 3S5NA 4IPPA 1CXLA 3FKRA 1HJSA 5TIMA 3AMCA 2CERA 3F5LA 3GNPA 2YCLB 1UKQA 3NR0A 2PP0A 4LVDA 2FDSA 4N9EA 3BMXA 2VZUA 2J4GA 4WR3A 1EEPA 2D0GA 2R8WA 1HO1A 2NWRA 3ECQA 3VFLA 4IMAA 2VVSA 3GBEA 3TX9A 1K02A 2R1KA 5EFDA 4JXCA 1DQXA 1QOQA 4HK7A 1JI1A 3DFOA 4MB1A 2WWDA 1GQLA 3QW3A 4WDUA 4MJ2A 1NDVA 2CBVA 2B31A 4FLQA 3T0CA 1IIGA 3BG9A 5EMKA 4NAEA 3I3DA 4WKAA 3OIXA 4FNRA 3GXIA 2R1MA 5H8PA 4ECLA 1ME9A 1WXJA 1FUYA 3HJEA 4FNTA 4JS3A 3HQPA 3E1F1 3BG5A 4JKLA 3GKAA 4H9UA 4B3KA 3P81A 4LBRA 1VH7A 4KEUA 3P8JA 2ON3A 3AHXA 5BOOA 4MJMA 4QAWA 2QQ6A 3S2JA 5D9NA 3LCIA 3CWOX 4U2ZA 4QDMA 3ZLFA 4TOQA 3BLLA 1HKJA 4GNKB 3W71A 3DGRA 1D3HA 2E5BA 5AN7A 2V82A 2V9DA 2NUWA 2OX1A 2R24A 3R8GA 4J3ZA 1GKQA 4PR4A 4TV5A 3GTXA 2NVCA 4Q7NA 4DB7A 2WJZA 1FHVA 1WAUA 3B4YA 4D1IA 3BOLA 1Q6FA 1Q65A 4GQQA 4CD5A 4BEUA 2CZ5A 4Z1YA 2KZHA 2EPOA 4Q8WA 1J2BA 3LGGA 4O14A 3WNMA 3AMKA 5CEWA 2ZCGA 4G56A 1O12A 3AXKA 4R9XA 4GHRA 1FWRA 2J9YA 3R7MA 4JQ2A 2V5CA 3LSCA 1FFRA 1QBAA 4F40A 1TPH1 4Q7IA 1V3LA 1SZGA 4D8AA 4MUPA 3L0NA 4Q6JA 2YW3A 2WVVB 2Z1KA 3MANA 4JOMA 2JF6A 5HNTA 2O4MA 4XVEA 4XZHA 3L2LA 1PTDA 3V5OA 3JZEA 4BI6A 1MW0A 1OGSA 1XYBA 2R82A 1UWQA 4IIEA 3VNLA 2C15A 4XKMA 3IV8A 3NO1A 2F9RA 1X38A 3NTYA 3UG3A 1YIXA 3IGSA 3MT1A 3PAOA 4C1NA 4JNYA 2G96A 1DWIM 1J0IA 2Y89A 1V4YA 3O6CA 2HS6A 3FAXA 2WMIB 3KDOA 3ANUA 2QKFA 2R6OA 2VRKA 4UTTA 2D1ZA 3GO2A 2R91A 3WLHA 1EFZA 4ZB5A 3GZAA 1M03A 1RQHA 1LLWA 3NYDA 3CMFA 3VD4A 4NJIA 4YIWA 3W74A 4OBTA 2B7NA 5J5RA 3FHQA 4GNVA 2BXYA 3UWWA 4OFCA 1RBAA 5LHEA 3MMWA 2V5KA 4O12A 3E6EA 1EWEA 2PFHA 2PDYA 3TC7A 3PK7A 2NV9A 3G0SA 2DFAA 3VNJA 3FW6A 2ZZ6A 1VIWA 3QY6A 2ACRA 3OBEA 2TSYA 1W9VA 4HMDA 1HNYA 3I3EA 2XZ7A 4AIOA 5DY2A 1FCVA 1CLXA 2XZ9A 3E0LA 3M0VA 4O0KA 2H3DA 4ZTYA 1FP8A 5B7YA 1RK6A 3W7PA 3OA5A 4FI4A 1AFSA 1B31A 1W1IE 5ABTA 4PTWA 1C90A 2XUCA 2Q6ZA 1BG9A 4QAIA 4R53A 2FIQA 4LCQA 1YKWA 4Q7BA 1UR0A 1WP6A 4TVCA 1PL9A 3TU9A 4HA4A 2MNRA 1KRAC 1KBBA 3BUVA 2GVEA 3RFAA 3EOSA 2VC5A 1JGIA 3TNBA 3TJLA 1S5TA 3AIVA 3RR4A 5D03A 4IPIA 2XJ7A 3JU2A 2BVYA 4Y2WA 4AZ5A 5GNZA 1TA3B 4IIBA 4L1WA 3QLDA 1DTUA 4O17A 2BHUA 1PYMA 3LCXA 1SJCA 1YE4A 3IEBA 1NWRA 1VS1A 5BZAA 2PTWA 3AZSA 3SY1A 3EDDA 3UR2A 1ZENA 1UH2A 5DXXA 4O28A 2VX6A 4JX4A 4LV4A 3VOGA 3VO0A 5HK4A 2WJEA 1YHTA 3BGAA 4IICA 3P3BA 3CLWA 1SO6A 4A3HA 2H90A 3HBLA 3TFXA 3DESA 2ZUTA 1TKKA 3WNPA 1QCWA 3RCMA 1GOXA 4NQ1A 1EYEA 1THFD 3WF1A 4L5ZA 1AL7A 3M5XA 5A6KA 2YDRA 3ZMRA 3F5KA 1UWTA 5I24A 3N25A 2YA2A 1U2YA 4ML9A 4QQ3A 3AS1A 1OD8A 2JIEA 4TU1A 1K8ZA 1F9CA 2VOMA 4PMZA 5LZLA 1A5MC 4UFMA 3KBMA 5I23A 2O7QA 2GJLA 4AZBA 3NIYA 3M1ZA 3EA2A 5LXXA 3O6YX 1Q7ZA 1XSKA 1OCBA 3VKAA 3EOOA 4LYPA 3TC3A 4Y90A 3WD2A 1AQ0A 3MHUA 2V5JA 2PUZA 3WDIA 4D6HA 1OBAA 1Q8AA 2OG9A 1O5RA 1TSIA 3QY7A 1XGDA 3TYAA 3SFKA 1W6TA 5CBJA 1ECQA 1ELSA 1R7OA 3EDKA 4A6GA 3TTOA 1LL7A 4UQ9A 3STCA 4GJIA 3DFNA 3MS8A 2XFFA 1FXPA 4J28A 1NDYA 3QHNA 5AHEA 3IJ6A 2VFEA 2QDHA 4DWSC 4FPSA 4Q8QA 1OC6A 3QMSA 4WX2A 3S1XA 1H2JA 1XDLA 3W7DA 4K6AA 3SADA 4KWOA 5C8BB 4KF1A 3R12A 4JTRA 2D69A 1WZMA 3T2QA 3S9YA 5LXEA 3LD5A 3UWZA 2DVTA 4NF7A 3I4EA 3WQ6A 1MNSA 3CUZA 1YXYA 1W9DM 1MYRA 1EA0A 1EWDA 1R6WA 1X96A 5I3DA 1G9HA 2PODA 4ZGYA 3W88A 1CENA 1XIDA 1J11A 1R2SA 3VKDA 3W87A 3OYXA 4HJWA 3NPWA 2OWCA 1EXPA 2B7PA 3C61A 1XRVA 4FR6A 2OELA 4NZFA 1M01A 3SQSA 2A85A 4CNTA 4DUXA 3S6OA 4H01A 4JTCA 3UA4A 6A3HA 3NNTA 5C70A 1LZOA 4XAYA 4ZQCA 1H1YA 3U2EA 1JAEA 1RLCL 1SZEA 4GYPA 3UFYA 2E3ZA 3UNTA 3KBWA 4MY1A 2XN0A 3HG3A 4B5WA 4O16A 1V0KA 1EIBA 4IT1A 3ID7A 2WM0A 4TMCA 5CSSA 3GC5A 2XGBA 3TIMA 3W2KA 5D2YA 4HN8A 5K4XA 3T08A 1IEWA 1NFBA 4BQ5A 5EMJA 5DLCA 5I6SA 4U3CA 4AZHA 3W72A 2DZUA 4Q32A 1GJWA 4S38A 2ZX9A 3UPBA 3AAMA 4P61A 1RQEA 2CETA 4YYCA 2A21A 4JIQA 3ARWA 1ODUA 1A3XA 3GX9A 2D2HA 1L6YA 1GTEA 3BURA 2CZEA 5FA5A 3O1NA 3PULA 1VCFA 2XM2A 3QJAA 4AVFA 1GQJA 4J3VA 3W70A 1UROA 3KW3A 4TX6A 3I7RA 2NX3A 2YZRA 4HNVA 3I6EA 4JDBA 4KCUA 4OV9A 4LY4A 3T81A 4K38A 1EGZA 4A8NA 1FDJA 1A49A 2A3AA 4BWLC 1PO9A 2P1FA 1RSCA 1W3KA 3B06A 3WJSA 4UTJA 4AYGA 4RL3A 5CAKA 3VTRA 2X1IA 1F74A 3RAOA 2PDUA 4N6EA 4W89A 2C16A 2VUNA 1IV8A 4GKLA 1OM0A 3NPVA 4OIFA 3PNZA 2YCEA 1GONA 1IZCA 1JPHA 1H1ZA 3DC0A 4S23A 1J6PA 2AAAA 1G94A 4TX9A 3AHYA 5A2AA 1XLLA 2QULA 3LCLA 4BR1A 1SZFA 1JAKA 4HB7A 4ATDA 2QUMA 1AH3A 1NU5A 4DUWA 2FZ9A 4YWSA 4TX8A 1I4NA 5HQMA 1OG6A 1VZWA 3WQCA 3UY8A 2VKZG 1VPXA 3SQLA 2FVMA 5F4XA 3DOPA 1X7IA 2Z4GA 4J5NA 3W6MA 1A5LC 1E6NA 2VC7A 4AY7A 3MYPA 4M80A 1RP8A 4XIAA 2ZC8A 3VABA 3W7GA 3D3FA 5CZKA 1JUKA 1WX0A 2FYMA 3UWYA 2BP1A 2V30A 2G41A 5I7GA 3R1ZA 3PG9A 5H2ZA 5MKGB 5KZEA 4ICNA 1OYAA 4BWLA 2E25A 5CPSA 2EJ1A 3RRXA 5BMWA 3EWYA 3MV01 5J8LA 4D8ZA 2YZ5A 5XINA 3SRFA 1V77A 4MJZA 3EX4A 2NT0A 3LS9A 4F3HA 5GVJA 1ZCOA 3UNDA 1UPPA 2WC4A 4IP5A 2BS9A 1IWAA 1XQKA 1JCYA 5FEWA 1V6VA 1UP3A 2A7PA 3GXDA 1S5WA 1OF6A 1TWSA 4HHMA 4NAEB 5BROA 5F7UA 1UD4A 1EA9C 3AHVA 3HPSA 3PPCA 2DT3A 4KWWA 4WEVX 1F6PA 4MHBA 1TV3A 2OR2A 2Q01A 1QWKA 4OQVA 2WBKA 1J96A 4DYKA 5CLWA 4XZ9A 1VYPX 4JFUA 1KLZA 1FWDC 1QVBA 2BODX 1EQCA 3PUOA 3TP4A 1U5HA 3WD0A 2NXHA 1XPGA 5EYWA 3S1VA 3UPWA 1HXJA 3C4UA 3GAYA 4EACA 4HK5A 4REQB 4RPQA 3T8LA 2IKHA 1BYDA 3GTHA 2PCEA 3OP2A 3WFLA 3MTWA 5DANA 3ZM8A 2I56A 2PDFA 5C7HA 5EFFA 4L6DA 4K7VA 1TO3A 5CZ0A 1KXQA 4PMUA 1G69A 1DIEA 2FB3A 4PUUA 3LPOA 4RZ4A 4E4FA 3WQPA 4WJEA 1ADSA 1P6CA 2ZE3A 5FJRA 2V3GA 1CGXA 4W5ZA 4AEEA 3PY2A 4M7TA 3GR7A 1SQ7A 3RPMA 2BY3A 2PC4A 2JF7A 3EX3A 5T8GA 2FZNA 4M0XA 3TR9A 2EKCA 5C2CA 1B0IA 3FA5A 4B92A 3KRBA 1WUEA 5DFAA 3CIWA 1GGOA 3MO4A 4ZO7A 3BTNA 1MSSA 4C65A 4QJ4B 4DJDA 3B03A 2P5NA 1JRCA 4E4UA 1XLHA 4BI7A 1R8LA 1BXCA 2Y61A 2W91A 3H6OA 1SR9A 2E6DA 4LAMA 1GG1A 3N17A 2QCDA 3CZKA 2ZXDA 4EE9A 2CXEA 3RITA 1GPWA 2QMKA 3T8QA 5F1UA 2GOUA 4AD2A 1EX1A 4M6VA 3VFCA 5M17A 1ZBKA 4D9PA 1YBQA 4N2YA 3T44A 3VNDA 4FHAA 1S3TC 1CXKA 1WXZA 2WAGA 2Z28A 4LAZA 3S1UA 1KBJA 2QF8A 3EB3A 1S1RA 7TAAA 4GFSA 1J0YA 5DRCA 2G4JA 2J66A 3PZVA 3DDMA 2ZA3A 4E2DA 3OGRA 4IP7A 3P67A 3NQ2A 2QPUA 1GJUA 3R0KA 1V02A 3O0KA 1W5QA 4EPDC 1V3KA 3T4WA 5I3IA 2QGHA 4MWAC 1PAMA 2XG9A 3GSMA 3NQCA 1H09A 3MP5A 1O1HA 2GOKA 3ABQA 4K8EA 2E40A 1WOBA 3QC0A 3LRLA 1M7OA 2ISDA 2EG6A 3ICJA 2C3ZA 1JJKA 2WCSA 1B2YA 2F61A 5DMNA 3CHVA 3KE0A 2X1TA 2DPEA 1FH9A 1V7YA 4L1XA 4FXSA 3H24A 5FAJA 2Y5SA 2OYLA 2GVYA 3OOQA 4G1KA 3QYQA 1BSIA 2I57A 2PDJA 5FESA 3WNNA 1F61A 4J2MA 2WHJA 3W1TA 1G4PA 5G2HA 3VIPA 1K8YA 2YXGA 3KBNA 3H2CA 4E5TA 4PRRA 3DBNA 3QSTA 2HXTA 3N14A 2DIEA 4Q33A 4GYPC 4LYQA 1V3HA 4WQ6A 3A6OA 3INPA 2D2OA 4GA8A 1MI3A 3BLFA 5AC8A 3WUGA 4YYFA 1EDTA 3B0PA 4L6OA 3M0IA 3IACA 1Q8JA 3W83A 1FWIC 4DN1A 4JKMA 3AZTA 4CVWA 4GY7A 2HMCA 5JBFA 1E0WA 3HFTA 5AYIA 3A4XA 2DY3A 2UZ9A 4BK9A 1LLZA 1JCNA 3LBOA 2VP8A 3GG1A 2J62A 4UXDA 2VX4A 3W7OA 1JRBA 4PTDA 3O16A 5IBXC 3AIEA 3E0WA 2V68A 2PF8A 3WDHA 3UJ2A 1EBHA 3BV7A 1WO2A 5BRPA 1R3RA 2CHRA 5TQLA 3WBXA 2P53A 1OFBA 3YPIA 2J78A 1JZ5A 3VGFA 1W32A 3LB0A 2OMAA 2NQLA 5LIKX 3NFUA 3T9PA 5BXSA 1QNSA 1TMHA 3AOFA 1JNEA 3QPYA 4J35A 1EP1A 1E5NA 5REQB 4O1DA 3TQVA 5A6TC 2CPUA 1UKSA 3AYSA 4PBEA 2R9RA 3N2OA 3OVGA 2W6RA 4ZZ9A 5E0CA 3WLLA 4GQBA 4OV4A 2Q8XA 4PE8A 4O1BA 2VD9A 3TA6A 4UNKA 2Y7GA 3UWQA 2V8ZA 4IOTA 1OC7A 2JGYA 5JMUA 3GVWA 5EMMA 2RGLA 5BMXA 5TD4A 4KW2A 2BZNA 2W63A 1AJ0A 2X16A 4ASTA 4JIIX 2HDJA 5DO8A 1PZ3A 1JPKA 3BH4A 4QG6A 1O6IA 1KQZA 2FH6A 3TQPA 5BOFA 5CPMA 4KMQA 2OGJA 2NLIA 3GD6A 5I3JA 4X0NA 3SIMA 5K4ZA 4O10A 4GNJA 3GDMA 2WZEA 4F48A 1S2UA 3BAWA 4UQCA 3GH4A 3HF3A 2JKAA 3GNXA 3PSWA 1X39A 4RDYA 2Z1VA 4GUFA 5KETA 2JK2A 4DXKA 3GZ3A 4JNZA 1V08A 1XRSA 4RW3A 4ZMGA 3MP3A 3LTPA 1HL8A 3J7HA 1LM1A 4I5RA 1V93A 3H4GA 3HG2A 4H9VA 2O9OA 1XFCA 4HZ7A 3THDA 3PBYA 4YTQA 3I10A 1OB0A 2TMDA 5FCZA 4WDXA 4IGMA 3SCWA 2FGLA 5I78A 3W24A 4TVUA 1KCLA 1WNOA 2PDXA 5JUVA 3VM5A 1GVEA 4ZFMA 3F4CA 4Z1BA 2IQDA 3GH5A 2D20A 2GWNA 1UA7A 4CCEA 4O4VA 5FJTA 2Y8VA 5AECA 4F4RA 3PJXA 3PUDA 5FJIA 3RLHA 1NELA 4G7FA 3UXDA 2R94A 3M7SA 4LBSA 3CUFA 2VZOA 4ZBCA 3KVJA 4D6CA 1NSJA 2GVLA 4TTGA 4XISA 1XRFA 4UZSA 1MDRA 4GLEA 3IRSA 5LNSA 1GOIA 4P7QA 2X0SA 3A24A 4GGBA 4HT3A 2OEMA 2GVJA 3VIOA 2HXUA 3PB0A 3ALFA 3H2MA 3S5OA 3N19B 4DPQA 4QFUA 1AQFA 3W1AA 4IXXA 2FZMA 3HURA 1DWHM 4LVGA 2D2JA 2OZTA 3G1SA 5DELA 1ITCA 3K2GA 3V3WA 3V0TA 4KEMA 1R9YA 1MUMA 4IIGA 2X7WA 4Z08A 3PPGA 1MMFA 3ME3A 1F5ZA 1FXQA 4MGGA 1AH4A 5HJXA 4DO5A 4Q8PA 4G6CA 1W1ZA 6CGTA 5DBTA 4C6FA 1R38A 2UV8G 2EJAA 1K8CA 4MVAA 1CI1A 5C6MA 3SFWA 1Q13A 4Q4KA 3VAVA 4LCSA 1FWCC 2J27A 1H60A 1C93A 4W88A 3QGKC 4W4QA 2G3FA 1ZUAX 4JYFA 4EAYA 5CGMA 1M04A 3TV8A 3OZMA 3ARXA 2QDDA 3AS0A 1Y5VA 2F6UA 3UR7A 5E6YA 4AZCA 3AIUA 4PRWA 2VCBA 1GHSA 4PBFA 4GK8A 3HG4A 1TJPA 2IPJA 1LLOA 2ZKMX 4DWDA 3LENA 2A2IA 4QE4A 1UASA 4AISA 1SFSA 1EDGA 1ZPTA 3IJ7A 3HMCA 4DJFC 1BWKA 4U4MA 3SCPA 5DX7A 1MW1A 3L67A 4KWVA 4IIHA 3AUOA 1IR1A 4MAZA 3DIPA 4P7NA 1S2WA 1VYRA 3SBFA 3L66A 3A5FA 2I7GA 4LB3A 4TUFA 3K13A 3GG7A 1WE5A 2DZVA 1DJHA 3QHOA 4J7RA 3KXQA 4QTGA 1J0KA 3USZA 2AL2B 3VUPA 5TBOA 4XAGA 3ISIX 4DLFA 2PLKA 3LERA 5BNKA 3GDBA 1I9CB 2YDAA 4KPLA 4NZCA 2OVLA 4HZMA 2C13A 3VCRA 5HOSA 1OK6A 1VEOA 4V2XA 3M41A 1SFLA 1QO2A 3HU7A 4P7LA 1FWEC 3ZT5A 2VZTA 4Q8UA 4P5UA 2PURA 3PG8A 1WKEA 1J9YA 1R3VA 4HNNA 1KM6A 4OT7A 1JYXA 4CQAA 4UTKA 4MSSA 1VR6A 4UMAA 1RHCA 5K9CA 1T8XA 4OUIA 3NDZA 3CB8A 4JYEA 4B91A 4DELA 3PTMA 3LNMA 4GG9A 1KGUA 4J3WA 4FALA 1TA3A 1YXDA 4A8LA 4F0RA 4IFKB 4PTVA 5CJ5A 5G1YA 1EHNA 4BCEA 3NA8A 4PCTA 1DXEA 4M6PA 3HM7A 3T0DA 2ASHA 2D0HA 2G37A 3ERPA 2O9TA 4FO4A 1MWOA 3W38A 1YNYA 2RDWA 3LA4A 1UIOA 3QGVA 4Z17A 1W31A 3H8AA 2Q3RA 3N9SA 1UWRA 3QPZA 1S5NA 3C0QA 3CT2A 2G3NA 4DRSA 3WUFA 3AYVA 5D30A 1UWAA 2Z6IA 3O9NA 4GISA 2XH2A 2D0FA 1UR3M 1GOKA 1QK2A 4IHCA 3M0YA 1V0MA 3AXHA 5D2TA 2WANA 4EKJA 3QTPA 1O5KA 4AW7A 4KRUA 3NQ6A 2QUNA 1B57A 3UZ5A 3FJ6A 2VQUA 5C9XA 5K3VA 2J7EA 3BICA 4B4HA 5I03A 3W4RA 2EQDA 4XUGA 1TTJA 4AWUA 1SSGA 2PWDA 3RM8A 2GUYA 4G7EB 1XLEA 3RXZA 1PX8A 1XX1A 3GDKA 4ATWA 2VX5A 3QVQA 3CAQA 2QT3A 1KR1A 1SUXA 2P3ZA 1ICPA 4S3KA 4GXWA 5A6JA 3WQOA 3UXAA 3VIHA 3RU8X 4KCWA 4LPCA 5AYBA 5RUBA 2ISSA 1N55A 3LPPA 3FFSA 5XIAA 2QCMA 3LNPA 5DT5A 1VQTA 3N11A 5A8QA 1GT8A 2VI0A 3MSRA 1WZAA 1KFWA 2VGFA 2Q8LA 1F3XA 2Y85A 3EA3A 3R5EA 1OFDA 4LNCA 5F2GA 3A9BA 3B40A 4AU0A 5C0QA 1V6UA 4FAMA 4QEEA 3EYPA 1V6TA 3I7SA 1K7FA 3S2NA 3TAKA 2DGAA 3O05A 3N6HA 1G4EA 4IJCA 6TIMA 3GUWA 1TE6A 3KOXA 4HOXA 3LXBA 3MWCA 3M7WA 5U4NA 1GOWA 3TN3A 3VPLA 1REQA 4FIQA 1Z44A 1O1ZA 5AHFA 1UB3A 1DWFM 4MDOA 1F3WA 3CQIA 2BHYA 5AKQA 3WH9A 3PZTA 3VILA 4UR8A 4DAFA 5T91A 4JTTA 3JRKA 3TYZA 1HN1A 5CAHA 5LA2A 2W67A 3NGFA 1GVYA 3W7NA 3DH7A 3OLIA 2DUXA 1P4CA 2BVDA 4DJEA 3BLDA 4C6IA 1VP5A 1UG6A 2PP3A 4U33A 4X63A 2WXDM 3QR0A 5EBAA 2QS8A 5BXTA 5AHIA 3CO4A 3N1AA 1ZS2A 5DCEA 4W5UA 3AHZA 4V1YA 1GQKA 3WIJA 4UQAA 3ARVA 4WSKA 1I2NA 1KFEA 4O19A 1BF2A 1TVNA 1ZL1A 4H00A 1XICA 3TOYA 4IZGA 5HUOA 5F2IA 3GW0A 4QDPA 2EGZA 2V38A 3W75A 2I5GA 4V33A 3NQGA 4E3TA 2C0HA 1TR9A 2J74A 2RUSA 2VFIA 3B04A 1LG1A 1GG0A 2BB0A 4JFTA 1F8IA 4O8RA 3TN6A 5A6LA 4P7RA 5D2VA 5EPDA 4LAKA 4BA0A 1W3TA 1H62A 1XRTA 2DZAA 3GIQA 3ZYZA 1VIZA 2INFA 1T96A 2BLEA 2G97A 1PIFA 1HUVA 3TJIA 4M1BA 1FDYA 2J25A 3C3UA 5E5CA 2GGHA 1L2QA 4AWTA 2W79A 3WX7A 1AD1A 2D73A 1QHOA 2VURA 3R13A 2VZSA 2YKKA 1QPNA 7TIMA 3G77A 1W54A 3W1UA 4H9TA 3W7EA 3A3WA 3NQ7A 4NI3A 2PDQA 3B9OA 3VCCA 1MNZA 1N2VA 1HKMA 1EB3A 3B8UA 3T0BA 4E4PA 4HPJA 2C79A 1JD9A 1VENA 3NVTA 1E3ZA 5BWFA 1CWYA 3GH7A 3PM6A 4GCXA 4LCRA 4DJFD 4HCDA 3EXSA 1EJWC 4MADA 4JTAA 2EG7A 2QDEA 5BYWA 3HO8A 4AG0A 5C7VA 1BQGA 1L8PA 1IT8A 4L7ZA 4XD4A 1S5VA 3AXXA 1LYXA 4N9DA 1FBAA 3W26A 2A79A 4QGCA 1XLCA 3TTEA 2AL1A 1GZJA 1JZ4A 4O53A 1KKRA 3S6TA 3ARPA 1U30A 1FWTA 4WK9A 3SIZA 1E6XM 4EIVA 3CU2A 4EX4A 3E0FA 4O54A 1E6PA 1EH9A 1F07A 3OQEA 2WV8A 3M64A 3TSBA 3LPGA 3KRUA 4UQBA 4JTQA 4C6MA 1CXIA 1SZNA 1K4HA 4LRSA 4L65A 4A3RA 1PV8A 1ZAJA 4LVBA 2ZX7A 4M8UA 5HQLA 2Y6ZA 4GBDA 4X9SA 1W37A 4G7EA 4H8NA 1E0UA 3B9AA 4DEFA 1HFBA 1J10A 1F3TA 1UP2A 4JCLA 4OUEA 3SUSA 3SSZA 1HG3A 3MUZ1 4UC5A 3UETA 4OECA 1EJXC 1GOOA 5M2FX 4C7DA 3LHVA 4NNCA 2GDUA 3B8IA 1BLIA 3CYJA 3SN4A 3S5SA 4NX0A 1P7TB 1Z9AA 1B1YA 3G24A 4X22A 4LC8A 1K03A 1R87A 3STEA 4RJEA 1XC6A 3A3XA 3QR1A 1DOSA 2GUUA 3HGSA 5FIPA 5C9RA 3UERA 2Y24A 4E2VA 3KCLA 2F6KA 4X0VA 5I07A 1OJXA 2OLAA 4M5PA 1EC7A 1UC5A 1IEXA 1YBQB 2E4TA 3CWHA 3TSMA 2NUXA 3RGTA 4W87A 3WH5A 5LA1A 3RU6A 3V5CA 2XIIA 1LQ0A 3HQNA 3MV11 1E6QM 2GK1B 1NOWA 3P14A 2P8CA 1BGAA 3R2GA 4ZEPA 2GJXA 4PUKA 3EEGA 4LYRA 2WC7A 4WKFA 3K5XA 4F2BA 3H7UA 3M44A 3IVTA 1DJXA 4A8IA 3N3MA 4GI9A 2C0AA 4RNJA 3G6MA 4LV9A 1A5UA 2DZXA 4FZIA 1GOQA 3UXLA 3BQ5A 4HTBA 1LRNA 3TZFA 3QQ0A 4AMAA 4M7SA 3BQ6A 3LN3A 2VR2A 1Q45A 1J12A 1ECEA 3MBDA 3TTYA 1RPXA 5A6AA 1TVLA 3W0KA 1QBBA 4WOZA 3CAVA 4LU0A 3MZ2A 3G6LA 3NAVA 4ILSA 2OTDA 3CPGA 4AD1A 4LT9A 1U1UA 4HYRA 4WY0A 3A13A 3QV7A 4IISA 3A22A 4H6EA 1UD3A 2FGZA 1FP9A 2E7FA 5CZTA 1DKWA 2DU2A 4I6VA 3W01A 3BARA 1FH8A 4IPJA 3SI9A 1OX4A 4MG4A 4ZOCA 5H8UA 4WZHA 2R14A 3PB2A 3KEHA 1X98A 4C1KA 1XCWA 4CQCA 4GIYA 1AJ2A 1VYSX 3THAA 2HCVA 3LHZA 1IEVA 3NO3A 4IIFA 1NAL1 3VC5A 4O52A 3KL5A 4HN4A 2I9UA 1GQIA 1NWUA 1QDSA 2MUCA 1EGVA 4ADUA 1D9EA 1JF6A 1PB0A 4AF0A 2XVKA 5CG7A 2VWTA 4PUMA 4DI9A 1ZB5A 3LQGA 1BGGA 3K4WA 2RJGA 4ENLA 3LLDA 1ISYA 4QROA 4A21A 3MSYA 4NI8A 1E9ZB 1GYLA 5AVNA 3N6JA 2V2HA 1T8QA 4F0SA 3AHTA 4IMEA 3CUGA 1YPXA 3MUXA 4HNLA 4NX5A 1P1MA 2REQB 1DEDA 2XVGA 2ZE0A 4XD6A 2GQAA 5D04C 1MUWA 3S0CA 1Q2RA 1WOAA 5BXRA 3FJLA 4M29A 4XV0A 4LQ1A 3IAPA 3W2NA 1D7KA 4RDVA 4DJDC 3R8HA 4I9MA 2OQYA 1AJZA 5G4WA 4TXEA 4DXVA 1H0IA 1TPB1 3QN3A 2JEQA 4L1GA 1OG0A 4KFPA 3T55A 5FF0A 1CGUA 2XHYA 4EF9A 3QSRA 5C9WA 1OX5A 5FAGA 3AZRA 4DYEA 4J3XA 1R9ZA 1P0EA 1QRQA 1JZ6A 1DJZA 3KVKA 2V3EA 2ICSA 4F0LA 2ZFAA 1XIHA 3CPRA 3T40A 2Y2WA 1VC4A 3WQWA 4DBEA 1NWTA 2GDQA 3OG3A 3W1NA 4PBGA 2WYSA 4F2UA 2VXNA 3P5YA 4HP5A 3RPDA 1DIDA 5G4EA 2AGTA 2NQ5A 1O68A 4RZ5A 1WZKA 2X30A 4MNMA 3NZRA 1YE6A 4GMEA 4IG2A 3K4AA 3N15A 2VFHA 1RALA 2QJMA 1E1CB 2BXVA 1TRDA 4LANA 4AAJA 3W7KA 3ABXA 3THCA 4C90A 4NRSA 3STGA 2J7HA 3HIJA 3S8HA 3IIZA 3WO8A 1A5OC 4H4IA 6REQB 2YIHA 3C3NA 1OCJA 2Z7GA 4CD8A 2UY2A 3LOTA 1VBUA 2I16A 5AC5A 4FEZA 2D22A 1RCQA 3GLCA 3WLJA 1JYVA 1J8VA 1DJNA 2YGYA 2Z0IA 4H19A 1EDQA 3CC1A 4FLSA 1TJ2A 3SECA 4E8DA 5FF4A 3HPXA 3BJSA 1WZLA 1RY8A 1GEHA 3CUIA 1EZWA 2A6NA 2F7FA 2E77A 5T26A 5HUPA 2PP1A 1TV4A 2QUUA 2WB5A 3N9KA 2I17A 1UKPA 3BK0A 3NWRA 3MSGA 4EPKA 1OY0A 2ZWZA 4Y8FA 1OYBA 3N2XA 5GNXA 1X6NA 3RM4A 3ABSA 3R43A 4XB3A 4QCFA 6TAAA 3POCA 1JIBA 1XISA 4I5UA 3CIXA 1JZ3A 1EJVC 1PPIA 3HN3A 3O63A 5DQPA 1HL9A 4MKNA 5CPLA 3DENA 1QFEA 3U5YA 3ZFHA 1I2QA 4NJJA 3H70A 2EPMX 1Q6EA 2FMOA 3C5QA 1JQXA 1AZ2A 1WDWA 1I8JA 3WFAA 4HU4A 1EGMA 2D24A 3WMCA 3H4WA 2VMFA 4N02A 5M03A 3PBWA 3O2LA 1CNVA 1Y0EA 3C52A 2GL5A 3II1A 1SGJA 5KITA 1KM3A 1K9DA 2YJQA 3TW9A 4KETA 4L61A 3LMZA 6REQA 1CECA 1A47A 3KTXA 3A4JA 8A3HA 2E8ZA 3HV8A 3SJ3A 4FLOA 4ROQA 1UD6A 2XVPA 1Q6DA 4E6MA 1W56A 2UWFA 2DUZA 4XX6A 5EY5A 3W7HA 1TJRA 3GUGA 2RHGA 3IS4A 3M4HA 1CXHA 4V15A 4KBXA 3RCNA 2G4FA 1QASA 1KRCC 7XIMA 1VBRA 1H61A 3HTWA 3FCPA 2IQTA 3CM4A 2P8BA 3FVDA 3EWUA 1KC7A 2EHHA 2YB4A 1Y65A 4RE4A 4UTWA 3FA4A 2QNEA 3EA1A 1QAPA 4I9JA 1OIFA 5HR6A 2GQ9A 3IVSA 3V36A 3H53A 3WJYA 3OLEA 3EZ4A 3QV8A 1HKIA 3UVIA 5I77A 2OWWA 4DY1A 1T99A 4UCGA 2W62A 1W0MA 2PTZA 3HGOA 1U33A 2YL8A 1H0GA 4B15A 1B90A 2XIQA 3DFHA 2B0MA 1I45A 3DHPA 2X2GA 4EWND 3ZWSA 4QS6A 1EOKA 3P93A 4MNLA 2G8ZA 3LZ5A 3F5JA 5A8MA 2P50A 5FF2A 1ZBVA 3S4TA 3NQEA 4L4LA 1IWPA 4PCSA 3N2MA 5HMEA 5B7ZA 2O56A 3KVMA 4UOQA 3EWWA 4YMZA 1S39A 3CH9A 5EB8A 2F2HA 2WNQA 3E2VA 4FNUA 3W7QA 1XLJA 1B3WA 4LUTB 3G1RA 1TPEA 5J04A 2X42A 4XQ6A 2HPMA 1WCGA 4B5VA 1Z41A 1XLMA 3N3TA 2BGSA 4Q6XA 2XSBA 3WLRA 2GZXA 1UOKA 4XBKA 3KOWA 3RG6A 1XIEA 4UTLA 5CLTA 3CQKA 4JQ1A 2Y70A 4JTFA 1KRBC 4UQDA 3WLSA 1QWGA 3KFTA 4NU7A 5FSDC 2VCCA 4CU6A 3GTNA 2QJHA 3TMLA 5JQ9A 3WLTA 5AYZA 2VEKA 1ONXA 1H49A 4KQNA 3EMQA 3BDKA 4S3JA 4Q8MA 1VFFA 3VNYA 1B30A 4OBRA 4XO6A 3I4KA 4KFOA 3V5FA 2Y7EA 3WMSA 1L6WA 4MOZA 4EPEC 2CLFA 4NIRA 1ALDA 1JUBA 3APTA 3N4AA 3MU7A 2AOSA 4PTXA 1DVJA 3KOZA 3WQ8A 3ZXWA 2W9MA 1A0CA 3SJNA 1XIIA 1I1XA 2XFRA 4INFA 4PMOA 2BFGA 3WQGA 2BVTA 1ZGDA 2ZZ2A 1LL6A 2EBNA 1RQBA 3W07A 3BL3A 3LI0A 3EDEA 5LNVA 1A5NC 4C6OA 3ZVIA 3JVAA 4YVVA 1TIMA 2XDFA 1XLKA 1XLIA 1BWVA 2ZUWA 1DJWA 4RV8A 4Z2IA 2E1WA 1NJJA 4B5UA 3S9IA 3WFZA 3GNDA 1V6WA 1OSEA 1ZQ5A 4MLJA 1JXKA 1LUCB 1UW9A 4RE2A 2HNEA 2TAAA 3AIQA 3MP4A 1SM9A 1QOPA 2QJIA 1IXOA 4EXAA 3RNDA 1Q6CA 1H7NA 3HMJG 3PWIA 2ABBA 3R58A 2ODOA 4GGHA 4UR9A 4MB3A 5CBIA 4WOQA 3AALA 2NQZA 1G01A 3B05A 4LF1A 1JL8A 2X40A 2CNCA 2ZYFA 2OZ3A 1Q6GA 4S39A 3GC4A 2A3CA 1UJPA 3GVQA 5DY3A 4HSHA 2YCKX 2FMNA 3GQYA 3BJFA 3GFYA 7REQA 3LZ3A 4H9MA 3SB0A 4XZWA 4UB9A 3IJQA 3BOFA 3JR2A 4XAFA 1DIKA 2ZXQA 4N6FA 2DZPA 4H2HA 5D09A 3BSMA 2XH7A 2TODA 1SVDA 2PWHA 3TE9A 3SY5A 5CPOA 4H6RA 2UY4A 2AL2A 5ECVA 1CGWA 5HANA 4I5XA 4QSFA 3PZIA 2HBXA 3W1LA 5CC7A 1AQMA 1YMYA 1H41A 1X8CA 1U1JA 3I6TA 1PKYA 3WZ0E 2J7BA 1NM9A 4HD5A 4JEQA 3STPA 1E51A 3EDFA 5D9PA 4O8AA 3BZJA 1GWJA 1MXDA 1HKKA 1UUMA 3BE7A 1PZ2A 3ITCA 3WCZA 2EPLX 2X7VA 1H7XA 1TV8A 1KM1A 4RNIA 1K1DA 3P74A 1IGWA 2ZVRA 3C6CA 1GW1A 1KXVA 3CMJA 3FAWA 2PDGA 4HA3A 4D2JA 4YHEA 3WK3A 2VD8A 2P0OA 4BI5A 3S9ZA 1VLIA 4WDWA 2JE8A 3DFSA 5HDRA 3C8FA 3OO2A 2JGQA 1LORA 1TJ0A 2OPJA 5IHSA 2PU1A 3MDWA 1QXLA 1DXIA 1HF6A 3B9DA 3VK5A 4S3DA 4E8GA 3QEZA 1XM3A 2QLYA 2D3NA 4DJFA 4B16A 2BY2A 4C6PA 4Q4MA 1OK4A 2E1DA 4R88A 4DX3A 1W2PA 1AMKA 2F38A 3DEQA 3TCSA 3NSXA 3ONCA 3AXMA 1XYZA 1R46A 5D05A 3VC6A 3ZLHA 4W85A 1NP2A 4N7QA 4PB5A 1OF8A 3CWNA 3QFEA 3RO6A 4JIPA 4OE7A 4ZL1A 4LX4A 3AYRA 3ABZA 1LG2A 5IFPA 3PJWA 2W27A 3DI0A 4NASA 1N8IA 1UQZA 4L4MA 1W91A 4GX9A 4AUBA 4KGJA 3FJ4A 2DSKA 3EWXA 3H55A 3EOLA 1LROA 1DYSA 3FKKA 2BWGA 1UMYA 4AY1A 3CIVA 4C91A 4ZOBA 1W8SA 1TV7A 2IUZA 2Z29A 4WXZA 1YDNA 2BOEX 1WAWA 4GUHA 1IE7C 3OG2A 1MXGA 3T2OA 6XIMA 3TTSA 3WF0A 3H54A 3U2ZA 3DFYA 3UT0A 5EMUA 4NJGA 3UG4A 5KSWA 3DBPA 4W84A 3TEVA 4B90A 3U4AA 3VINA 3O7UA 3GXMA 1JCXA 3S5ZA 4I8DA 2CLOA 1IHIA 4CUCA 1SFTA 3NZGA 1NTHA 2AGKA 2DSVA 2A3HA 1XLDA 3URAA 1JF5A 4O1CA 1OVDA 3CT7A 1UC4A 1XR2A 2YCLA 2CBJA 3GNOA 2X05A 3WKZA 3EKLA 4IFOA 3P60A 4GZJA 4GXMA 2QUVA 1FWGC 1FHUA 2XU2A 1FX6A 1B9BA 5M1TA 3BV4A 1FKXA 3VU2A 3AU2A 1H5VA 4R7JA 1SMDA 4FXFA 4D8LA 3DCPA 3N4FA 1YLVA 3CAWA 7ENLA 2PU0A 1BWLA 3FV9A 1POJA 2DIKA 2NQJA 1EYWA 1YYAA 1J5TA 1W3JA 1GVIA 4PYSA 1KD0A 1YNPA 2HZGA 3AICA 2FQIA 4G9PA 2OXNA 4FP1A 4IXHA 1JR1A 3QV6A 3QZAA 4KS0A 3HQ1A 4DWSB 3GYCA 2XWDA 3IWPA 5DCDA 2DVXA 4IG2B 4E2BA 4OBSA 5SWUA 1ADOA 3DFPA 4RUBA 3KBJA 1FOBA 4JTKA 4HQVA 2DEPA 1ME7A 3F7JA 4PUNA 4GOAA 1QPRA 4LAOA 3MWAA 1XSJA 5CC5A 4X2PA 3BO9A 1C7TA 4JNMA 4A05A 4AIUA 4GC4A 4PSRA 3GXNA 3F2DA 5CGTA 1RR2A 1KBIA 2Z27A 1US0A 5A8PA 2CKRA 3CZGA 3LBCA 5TNVA 1C91A 3WLKX 3TCEA 2PGWA 3GE7A 4JQ4A 3LM7A 3BAKA 4NZ3A 4PL1A 1IWBA 1UMLA 4LGXA 1Q5MA 3MA8A 1H1NA 4LBUA 2NSOA 1MVYA 2WJFA 4AD5A 1VFUA 4DBSA 1A5SA 3MDUA 3CYVA 1QW7A 2XVNA 2B7QA 4XKYB 3ALGA 1O94A 3KP0A 5D9OA 2DUAA 2V3FA 4Q8VA 3H2FA 3EX1A 3IANA 1BVNP 4Q8TA 4DJED 3FYOA 4E0CA 4LC6A 1HZYA 3ARQA 3CLMA 4BQ2A 3PWAA 1W9UA 4LB4A 3UZWA 5I2UA 1W2VA 1K9TA 5AC7A 4M24A 2XH0A 2FJKA 4QNWA 5JIPA 1A5KC 5I79A 4BEQA 2Z1SA 1H3GA 1KCXA 4JHMA 3TQKA 3SZ8A 4IUOA 2CLKA 5I5RA 3TYUA 4LUYA 3M0HA 2TRSA 1KQYA 3CGTA 4AX6A 4U31A 4JY9A 1K4GA 1GQNA 4P8VA 3P5ZA 4GJ1A 2YCJA 1KNWA 2J8GA 3DYMA 3PNUA 3LGEA 4FLRA 3UQNA 1JPIA 1M68A 2HVOA 3L5LA 1POKA 2HS8A 8TIMA 2ZOXA 1KFJA 1HJXA 2XIBA 3TAOA 1DQWA 1BHGA 4NNAA 3K8LA 8CGTA 4GYJA 1OCQA 4B3ZA 5ABGA 4W7VA 3UGVA 2BY1A 3HG5A 3TOPA 3AXIA 2XTKA 1BYBA 4PCPA 3G8EA 4E38A 3GYEA 4ZSUA 1ZJIA 3FK4A 3WQFA 1T0OA 3ARUA 2ALRA 4H8HA 3BC9A 4B2DA 3EMZA 3NQDA 3BAYA 3SCOA 1XG3A 4RLIA 3KM8A 4MTVA 5IFTA 2EKGA 4Q4OA 3ORWA 2ZX5A 2AQOA 2RJHA 2ZZ7A 1XS2A 1VF8A 2FZBA 3LTSA 1E71M 2XIOA 4D6GA 3N73A 3OIHA 3OZYA 2DH3A 3WD3A 2CLEA 2ZVIA 4M81A 1D8WA 3KP1A 1GJPA 1XIFA 3A3HA 3TLQA 1VCGA 4HPHA 1KM2A 3W1XA 3WUEA 3VZXA 2QGYA 1XXXA 1RD5A 3QC3A 3ZSSA 4L6HA 1QI0A 3C0SA 1ZZMA 3KL0A 1IT7A 3EB2A 3KAOA 3XINA 4JD4A 4MKVA 5EMLA 1FY6A 3DGBA 3PJUA 4G5DA 4NAFB 2E0PA 4V27A 3SUTA 3E74A 2PMQA 3ZT6A 5HINA 1NF7A 3WYZA 4RKAA 4YS1A 3REQA 3C2VA 1F8MA 3LK6A 3GKFA 1T40A 4JFSA 4L4PA 1M9HA 1XIJA 2LLEA 4NYUA 3ZLGA 1QPKA 5HNUA 5FJUA 1WKYA 3CJPA 3CV7A 2OO0A 1U5VA 1ZP3A 1GZ1A 3DG7A 3VD9A 1S2TA 3C0LA 2FB2A 3G3MA 1Q85A 3U57A 2BSLA 5E09A 4GWEA 1YPFA 1WKDA 3JZUA 1GK8A 5A94A 4AEOA 7CGTA 4UTFA 3V18A 2VYOA 4JTLA 4U5IA 3B9EA 6ENLA 4QRNA 2PAJA 2C18A 4FF5A 5HJLA 3WK2A 3VDGA 5DRIA 1XH2A 2B7OA 1CLVA 3EPNA 2VDGA 4J27A 1QNRA 1EQPA 3F2CA 1KGXA 4PA8A 4I9TA 2A5HA 4I90A 3B8SA 3KL3A 1H7PA 1MO0A 1Z69A 3CTLA 1BXBA 3BVJA 3CL8A 4US5D 4AMCA 1Q3NA 2ISWA 2PZNA 4F2TA 3BGJA 3CB3A 1BKSA 3ITOA 1NFPA 5JU6A 2PWUA 2WMJA 3GAKA 4QJ1A 4AX7A 4WF7A 1JDFA 3PBMA 1E4NA 4PMRA 1Q66A 4PUDA 1SJBA 1XPYA 3EWDA 5E9AA 1L2UA 3N13A 3HGRA 3SCSA 2QCFA 3TWAA 1CT5A 4A22A 3SSJA 3PTKA 1QPOA 4IMFA 1XGEA 4NL1A 4OVXA 1RVKA 2F2KA 3N9RA 1J5SA 2DSZA 2O55A 1GKRA 3ONBA 3WBYA 2CWNA 3QKEA 4RZBA 1L8NA 1LL4A 3UCDA 5K2ZA 1UA3A 4S3EA 3GW3A 4FMVA 1KBLA 1MEIA 3M07A 3CZEA 1O5QA 1FCUA 1WXYA 1H7RA 4NVTA 1EUNA 3MSDA 3UA3A 1Q7MA 3W84A 3ITYA 1HVXA 2NVAA 3WQVA 4ZO9A 1E70M 3TC6A 1XH0A 1D3CA 3DHFA 2EPNA 2GQ8A 5DF0A 3KOYA 1W3NA 3FVMA 4J40A 3GB6A 1O60A 1RJRA 2PDLA 3WH6A 2VEPA 3A64A 2QEZA 1RXOB 3OGSA 1SFJA 4GCAA 2YL5A 3T09A 4MF4A 2Y8KA 5DEZA 4XWUA 1IXNA 2NW0A 4HU3A 2GGJA 1KM4A 5C9ZA 3DYOA 5KTLA 2WMIA 1D7FA 2V67A 4US6A 3DECA 4OOUA 3EX6A 3LUTA 1ZJAA 3PSVA 4TTUA 4NXKA 4E8CA 1KFCA 3TONA 1QNQA 3QQWA 1CB7B 1TZ9A 5A6BA 3VD5A 2I1OA 3V0UA 1LQ2A 2C6QA 5K7JA 3QFWA 1QI4A 5E9XA 2QDGA 1TB3A 4IMCA 1TR1A 1V7AA 2TPSA 3FDKA 3GS6A 4GKTA 3STFA 1RPKA 3C2FA 2VGIA 2QAFA 4DJEC 3CL7A 5D8WA 4LOCA 4DLMA 1U22A 3FIGA 1TPFA 3Q37A 3ENLA 4GH3A 1P5BA 1UBSA 4KWSA 3KCJA 5EGRA 4FXJA 1A5BA 4P8WA 5G5IA 1LF1A 2P10A 3WUBA 1QPQA 3G1FA 1WDPA 3IIOA 5HR7A 2I5QA 4POCA 3LI1A 3CK5A 5F2LA 1KFLA 2PD9A 4QLJA 3GVVA 2WHMA 2ACQA 2JALA 1JI2A 1P0NA 3GDLA 4PFHA 2OT0A 3MKCA 3MB9A 4CQ8A 4O1AA 2OT1A 3OVQA 4IJRA 4NSBA 4AWSA 1EPVA 1G1YA 3G0UA 2VC9A 2X2YA 4GXPA 1NARA 1VFHA 4YL2A 1ZU8A 1EC8A 4B2DD 1TIWA 2J47A 1ISZA 2BNJA 3VNMA 3ZQ9A 1LCOA 1JNDA 2DJXA 4IP4A 2NV2A 3VGEA 1VJIA 2PRLA 3OW1A 1QHPA 3E2SA 1XKJA 4RDWA 1LWHA 1VEPA 3SN0A 2YA1A 3ELFA 4XZBA 2IQ0A 2O9RA 3RX3A 4GH1A 3TYBA 2V0TA 1UWUA 3U2OA 3GNNA 5HATA 4QSHA 3OBKA 4CNNA 3MUCA 4FSAA 4JTJA 3UZXA 4A3QA 4XG1A 4H6QA 4ZE4A 3NURA 2A1YA 1Q6LA 1PX4A 3TJXA 3PPHA 4UOZA 4ZCWA 3TUUA 1HKWA 2XM1A 4MFDA 2IMRA 3ZJ6A 3P84A 4AIBA 3CHEA 4C7FA 3I7QA 2YXXA 2AKZA 5HBFA 3PS7A 2DT2A 3FN9A 1DJGA 4NKCA 2ZA2A 3LRMA 2Y0FA 3CHDA 3U7VA 3E49A 4IQLA 2G5WA 1EBGA 4R33A 2HROA 2WZMA 1ISXA 2QCDB 2H9AB 2VNCA 4QP0A 3CV2A 3VOJA 3CAKA 1L6SA 3R10A 1TE1A 4KEVA 3LCWA 1T41A 3G2GA 3NQFA 4FX6M 3ARYA 1OD0A 2UY3A 1ICQA 1EL3A 3SY8A 3RPTA 5I3KA 3ES7A 3KBVA 3AMDA 4EVZA 2VFGA 2NV1A 3EOUA 5C9UA 4KGLA 5EA9A 4EAMA 3WBWA 1Z48A 3L7RA 1W9BM 4W8LA 3IJDA 5HPOA 4H8VA 4Z1CA 1K9EA 4JIRA 4Y9OA 3T1GA 2AMXA 2WVUA 3VYLA 1SO5A 1FWJC 4DF0A 3QY8A 4QX4A 1ISVA 5ABFB 1O5XA 3SN1A 3C2EA 1LOQA 1Z6KA 3MMUA 4QE5A 4UIOA 4M6QA 4BF5A 3TN5A 1CGYA 3KVLA 1ISWA 4K7YA 4Z2GA 4EF8A 4QR6A 4ZO8A 4GO8A 3WLMA 1C8VA 1H11A 5E1QA 3Q4DA 4A2SA 5A69A 3GIYA 5A1AA 1Z42A 3D46A 3L23A 4LY8A 1PKNA 1TQJA 1UOZA 4HHHA 2YDQA 4NAFA 3PZOA 4LAUA 1KWKA 2J6XA 3LGDA 3PHAA 1PTAA 3RMJA 2GGGA 1S46A 3QTGA 1JUEA 4ZFCA 1RZMA 1Y5WA 4K1WA 1TJ1A 2GFTA 3IJ9A 4R5EA 4XSMA 1ADDA 2WZHA 4MM1A 4QISA 1HKVA 2XGZA 3VDHA 3V1HA 4AB4A 1UBPC 9CGTA 1JFXA 4YHGA 3GTIA 4ZR8A 4LS1A 3PUGA 2WCGA 1MXSA 4HPGA 3VGDA 3H22A 2VL4A 2DIJA 3LLFA 3T78A 2BDQA 3SDOA 1ONWA 4MLRA 4CD4A 3DHUA 1OWQA 3OJGA 5G2IA 4H9ZA 3IRDA 1XIMA 3CASA 4FOJA 5I02A 1GZGA 2YR1A 4AVNA 4BFAA 2QPXA 4JX5A 4R9OA 3WN6A 3TR2A 4AQLA 3THQA 1Q4WA 2WMGA 3L12A 5HJYA 2VOTA 2PDPA 3U9IA 3VKJA 3F4WA 5AYXA 1ZRQA 3MVTA 3L0GA 4C6KA 4ZXLA 2FKPA 5F4WA 3JW7A 4I7WA 3AIWA 3VD3A 2QMJA 3THUA 1HGYA 3LLXA 4IH3A 4AFYA 2VM8A 3FA3A 1W5NA 4N9BA 1XP3A 2A3EA 4HHLA 2JKPA 2ZWYA 2PLJA 4K2SA 3VX0A 4IPNB 1M7JA 1RCOB 2CXGA 1HJWA 1I6NA 4LALA 3A47A 2GWGA 1FCBA 4E2OA 2RH9A 1WPCA 3QH2A 1RUSA 4GABA 3CBWA 4A3YA 2HEJA 1J18A 2XPKA 3G1DA 5CSRA 1QNVA 1JCLA 1XYCA 2GJXB 1NY1A 4D6DA 4HMNA 5A2CA 4ZE5A 4Q4PA 4ZXOA 3R4IA 1OFRA 1SO4A 1IZKA 4GI4A 4XO7A 1A4LA 3ZSTA 1KFBA 5IXEA 3H26A 1YX1A 4XIMA 3ARTA 2X09A 3MKKA 2WW5A 1EF2A 2ADAA 4LTSA 4UNIA 4GACA 3B9NA 3SUVA 5CSUA 2CLHA 4CEXC 1R3TA 2WQPA 3B0XA 3L4TA 1VFLA 3C86A 3OGVA 4HPXA 3QMTA 1OABA 3PTQA 3TZNA 1OIMA 2PDIA 3SCUA 5DMMA 2IKGA 2F8QA 2OWXA 4X9YA 5CPNA 3C2OA 1AL8A 2IKIA 1E5JA 3B8DA 3VNZA 1HJQA 3QMRA 2VEGA 5FD0A 4YTTA 3CO8A 1SYTA 3WLPA 1JYWA 1UYQA 5F4SA 4IGHA 3VOHA 3WELA 1SO3A 5FL1A 3NGJA 5ABEA 1H5YA 3KHJA 2GGEA 1E72M 1K70A 3DFTA 2B81A 2E9LA 2QVNA 3FHAA 4D6IA 5T9CE 1XBVA 4KERA 1MW3A 2WC3A 3PPFA 1N8WA 3NSNA 3K1DA 1EO7A 1K7EA 2FVLA 2FPVA 3QW4B 3UCQA 1GTHA 2WVTA 2PE4A 5CPQA 5CPTA 3AJ7A 3MUY1 9RUBA 6PTDA 3N6QA 4NUWA 5JBEA 4B9YA 4YCPA 2VELA 3WEZA 4GX8A 2OKTA 1P1XA 1LBFA 4ZSTA 4HK6A 3WSUA 4IQDA 1TV2A 5FKYA 4P8UA 2O9PA 5BRQA 4EANA 3NZ1A 4GC3A 4PUWA 5HPCA 3MI2A 1GORA 2R1NA 3MI6A 4AHPA 4YU1A 3RYSA 3KS6A 1JDEA 2X1UA 4LNYA 4WSHA 1KTNA 3IK4A 2WMKA 3VD7A 3ZJ7A 2WNZA 3Q45A 3NEHA 1TYGA 3S2CA 3U5UA 2VRJA 4GIAA 3EOEA 1ZP4A 2CWXA 1WBJA 2QCGA 2YBVA 4D6EA 4ADTA 2UBPC 4JX6A 4UWMA 2ZZ5A 1RVGA 1D2KA 1CGVA 4IMGA 1KXTA 1BXNA 3ZS4A 3NCOA 4HCLA 1ZHAA 1ZNNA 3ZJ8A 4UNLA 1S1PA 3WL0A 3MW7A 3WJXA 4GVIA 3C56A 3AWOA 4JPGA 4O1FA 5H8MA 1WB0A 4MB4A 1OT1A 3BAXA 3ABRA 1KV5A 3QXBA 2DW7A 4ORIA 1B5TA 4QLLA 2HSAA 4G8TA 4U3AA 2AKMA 3D5HA 5D8ZA 3S1GA 2WLZA 1WDQA 4WGXA 1HO4A 2NX1A 5DBUA 2RAGA 5CC3A 1XYMA 4Z2HA 3P0WA 4PH6A 5LKYA 1G67A 2VEIA 5C5YA 2GSJA 2P88A 3M0ZA 4K8GA 1CCWB 2ANUA 2GYIA 3W00A 4K36A 3H2EA 2XYLA 1BSLA 2INEA 4K1GA 1VKFA 1C8YA 3N04A 1DWAM 1WDDA 5EU9A 4JTUA 4U10A 4UTHA 5LA0A 4GJJA 2Z1WA 1ZBCA 2CKSA 1LOSA 1A50A 5IDIA 4I6KA 3UJEA 1IIHA 1TX2A 1PHQA 2JKEA 5REQA 3RILA 1BPLB 1TPWA 3CS2A 4DQWA 1PXGA 1W5MA 1ZBWA 1YDYA 4TV6A 1KW1A 1E1FA 2IS7A 1TELA 2QW5A 3LCGA 1TTIA 1OT2A 2PPGA 4F79A 3FOKA 4A4AA 4BS0A 4A35A 2Z00A 4NZ5A 4HOWA 5FOOA 4QE1A 3TYCA 5HWNA 1L6GA 1DHPA 5HMDA 4Y6GA 4EP8C 2ZICA 2CLMA 4O1EA 1V3MA 1H7WA 3AMLA 2OEKA 3TW7A 3FXGA 4QM1A 3GXFA 1AMYA 1PUDA 2IXUA 3CQHA 4ONVA 1B4EA 4MWAB 2XISA 3LRKA 5G1TA 4PUEA 4O4WA 1VBJA 4LF2A 3VI2A 3BSGA 2OZ8A 4CKQA 3DYPA 5A5WA 4JN7A 1A5AA 1B54A 1TCDA 3BW2A 3WF3A 2WZIA 5GNYA 3AJXA 3W1MA 4AZCB 3UG5A 2NLYA 4HNOA 1H4PA 5CJMA 4PMNA 3OBAA 3BLKA 4DBDA 3G1VA 3C2YA 4B5XA 1JFHA 1GYNA 3RCYA 1JZ8A 3A5VA 1LTDA 2PF0A 1TWIA 5D32A 1YQ2A 3QZ6A 3LM3A 1NDWA 2XVLA 1XKYA 3MY9A 3NXFA 1UZ4A 1TCMA 3URQA 3QGAC 1QU4A 4J3TA 2WLYA 3CEUA 1EJSC 3NQ8A 4XD3A 2ZADA 2QXWA 3NJ3A 2FZDA 5LNRA 4BJHA 3Q2DA 1E4IA 2ZBTA 3EPMA 3KTCA 3ANVA 3AMGA 3AC0A 3KZSA 1XQLA 2GSHA 1LQAA 3AISA 3KUMA 1P0DA 3NM1A 4W86A 3RHGA 2J13A 1CPUA 1J79A 3OU8A 3NZPA 3CZJA 4AH7A 2FPYA 2WVSA 3Q58A 4YTSA 4C5ZA 4F0MA 4DZAA 2WPBA 4PMYA 2CLPA 4W7UA 4DNHA 3DKJA 4P8XA 2PRHA 1FWHC 4H7VA 2IW0A 1B9ZA 1TPDA 2BASA 4WHBA 3DC8A 1XDMA 5L9FA 1J2WA 3B0UX 3EXTA 2QVHA 3BGGA 3FYPA 3OQ8A 1C29A 4GPNA 3KRZA 5IHRA 2HQAA 2H9AA 3IIXA 3DI1A 3V7PA 2ZDSA 3U7BA 1BG4A 4RXFA 4DUVA 4O0ZA 1WV2A 3UEQA 3K30A 4GI6A 4L80A 1DE6A 2QCEA 3T4CA 2J9XA 2OYKA 3USBA 1DWGM 3JS3A 1A0DA 2VVNA 3M5ZA 4Y7EA 3L5MA 4R34A 3T6CA 3SCVA 5D9MA 2YL6A 2VHLA 1IGSA 1QW8A 4TMBA 2FTWA 4RE0A 1E1EA 4H83A 3QRHA 4R85A 3BJTA 4JHOA 1KB3A 2I5IA 1QT1A 3GU1A 4C6JA 1U5JA 1E4MM 1UD8A 1UHVA 1VB9A 2PCQA 2YPIA 1WUFA 1ODZA 2WSYA 2VO5A 1GW9A 4A3UA 2B4GA 2PDWA 4WGHA 3BMVA 5CCZA 2KX9A 3NYZA 4S3FA 3UYIA 3UESA 1XIBA 3LQLA 4LXFA 4YN5A 4AD0A 1W1TA 4CD7A 2PZ0A 3FGCB 3GU2A 2PTDA 3S83A 3LHYA 3ZVHB 4BZYA 2VX7A 5AB3A 3T05A 3GHSA 4YCOA 1KLYA 3M6YA 3E02A 4FNSA 4DNMA 1V5XA 1GVQA 2PC8A 4U5KA 4JQ3A 1OFQA 4IF2A 3ZR5A 2DSWA 1WYIA 2OJPA 2JBMA 2EPHA 1AUSL 4AY8A 4KKXA 5FI8A 3M9YA 4Z42C 1L9WA 4KH2A 2XH4A 3MI3A 2JIWA 4FX7A 4XVDA 1SU5A 2R1PA 1I2PA 3MKVA 3H2NA 1E43A 4DF2A 3E5BA 2RKXA 2CIPA 4GUJA 1UKOA 3RJYA 1SPQA 1NF0A 1RBOB 3N34A 4QBXA 2WO5A 4MWAD 4DWSD 4I9AA 1E6ZA 2GJNA 1UWSA 4L4OA 4AWEA 1OFPA 1PX3A 3R0DA 1V3JA 1XYFA 1IEIA 1VFOA 1QNPA 3UR5A 4HTYA 4URIA 4UFHA 3ITXA 1XH1A 4RK8A 3IJ8A 1JDCA 4ZTXA 2WSKA 2ZX8A 4ZENA 2A0NA 2ZRYA 3WNOA 3TKFA 3VXGA 2RGMA 3AU6A 5FJOA 1REQB 1TG7A 3BOXA 2PDMA 3W1QA 1VRDA 1I1WA 4G1NA 3K4DA 1JDDA 4K68A 5DCBA 3ZJKA 2YFNA 3E5PA 2J88A 4JZ5A 3GFXA 3AWNA 3WMBA 3BLOA 1XBZA 4DVOA 1KM5A 3MC5A 3L2IA 2OEJA 3PTDA 1G7VA 3L4VA 3VNKA 4US5A 3UXKA 2FDMA 3VIKA 1RY0A 1PDYA 1DORA 1BTMA 5C54A 3W86A 3G1YA 4ZQOA 2XN1A 2GUBA 1JPMA 4HU0A 3ARZA 4KCVA 3FDGA 2VGBA 2X8RA 2ZC1A 4J1OA 1BF6A 2PGEA 1SW3A 3UVAA 1AW2A 1YRRA 1BVWA 3L65A 4CCCA 1YTDA 5FJPA 3OPSA 2CESA 1MZHA 2XSAA 2CHOA 4UCFA 4B4FA 1F2JA 3QHMA 1CBGA 3NL2A 4C6NA 2PA6A 3NVDA 5T9BG 2ZA1A 4LJ3A 4PMQA 1XCXA 4ATLA 4MZ1A 5HXMA 2QCLA 4OJYA 5JXQA 4MAVA 2WPGA 4B9ZA 4Y9AA 4ICCX 3M47A 3GFZA 4IM4A 2QR6A 3QR3A 4YTUA 2Z25A 4JTSA 2HWGA 3F1QA 3SW6A 1NQKA 3CTTA 4ERIA 1DBTA 1OZMA 5CZSA 3BCJA 1GOMA 3N2TA 1KA9F 4QG8A 1ML1A 3OEXA 1TFVA 2GQ3A 1J93A 2V6AA 3TJ4A 4ADSA 3M0MA 3TWBA 4CGTA 3WDRA 1UCWA 3PFMA 1X1ZA 1TUFA 2Y8UA 3EB4A 2O92A 2FJUB 4AD3A 4F66A 1W9XA 3CQJA 1JDAA 1W8GA 3SCTA 2A7NA 2V5DA 3MJYA 1DJQA 2F6XA 4GRSA 1XD0A 3UF9A 5A2BA 4BY3A 1FFQA 1VBGA 3M5VA 1B3YA 4AIEA 2XFYA 2VC6A 3HZ3A 1Z32X 3GVGA 3T7VA 3TXZA 3MHGA 3KCOA 4UTTC 3KHDA 4LSBA 1UUOA 4NZ4A 5C55A 4XK2A 1Q7QA 3B8TA 3SO7A 1J0JA 1QI5A 1Y8BA 3SM0A 2PTYA 3MJMA 4FNPA 1VEMA 3C2RA 6XIAA 2NXIA 4HA0A 4XZLX 5A95A 1M3UA 3SRKA 5ABHA 4W8BA 4EK7A 2C8NA 2REQA 4JFVA 5BXPA 5KZDA 2FZ8A 5FJJA 5LGZA 1S3HA 3EWBX 4MWAA 3L9CA 3EGJA 1I2OA 1PWMA 4GZEA 4RZ6A 1JPDX 4LUJA 1NWSA 2ZIDA 5D33A 1P0KA 2YOCA 4WSJA 1V6XA 4ZOEA 4PFMA 4HVXA 1OGBA 1EP2A 3VNIA 2ISFA 4DM2A 2WNNA 2Y63A 2CBUA 4H6KA 4ZQRA 2EEXA 4H2CA 1VLWA 2BY0A 4YLWA 2G50A 4NY2A 1HQTA 3VCNA 2FPTA 3F2BA 4HZ8A 3LHTA 3BZGA 4GIEA 4Y96A 2CU0A 1T7LA 3OLDA 4JQAA 5I00A 4M1RA 4UOJA 1NOUA 4C6DA 2PWGA 1OX4B 1R3SA 3GRIA 4FS9A 3AI0A 2A3LA 3U0HA 2D2GA 3SUWA 4CNUA 3EWCA 1UQYA 3OA3A 2ZTJA 1TMLA 3GHTA 2HV5A 4KESA 4CQDA 2X0HA 2WQDA 3FJNA 4WXYA 1DV7A 1LWJA 1PCWA 3G1XA 4QIUA 2VR5A 3I6RA 2PBGA 4XD5A 1XJBA 3WJWA 3DKLA 1CLKA 4LW7A 2QZRA 4DM1A 4YVPA 3RO8A 3HB9A 1RA0A 4IL0A 5CH9A 1OCNA 4UFKA 1US2A 1OC5A 5B80A 2YLAA 1MFVA 3DX5A 2X1RA 1PWLA 2C91A 2Z6JA 4K3ZA 1CDGA 4CD6A 3HA1A 1BFNA 1PIIA 5MF5A 2ALDA 4WY0F 2W5FA 3GHRA 1E4LA 3TLLA 4PN2A 5HA7A 3AUJA 3OODA 1M65A 3EKGA 2DSUA 1QTWA 4PSPA 3ITGA 3W1RA 2G95A 2GDVA 2CFFA 3MCMA 2PSNA 4OKDA 1FWWA 3P7YA 3OVPA 4BF9A 4BQ3A 3A9IA 2WM1A 3W6YA 1JZ7A 1WQ5A 3BCDA 3WLNA 1F4HA 2CYGA 4DUOA 4J2PA 4RXGA 2VFDA 2FHBA 4V28A 1LT8A 1BYAA 1C8XA 3PZUA 2VEMA 2W0UA 5HAOA 2E5CA 1K77A 4NT0A 1R3WA 2EG8A 3WNKA 2OGYA 2O4QA 1P43A 1Y5XA 3G1HA 4QJ5B 4OHQA 1HX0A 1EKOA 1D8CA 3C8NA 1J4EA 3K1GA 4M19A 2J75A 3VMNA 2DT0A 2WOQA 3M6DA 1SSDA 1PIGA 5AC6A 2DH2A 4WVXA 2RDTA 4CEUC 3CUXA 3PZGA 5AC4A 3P0XA 2PLMA 1KV8A 3MMTA 3HPFA 3ABOA 1C9WA 3URBA 1AW5A 1XUUA 2G3IA 3WQEA 4TR9A 1TV5A 3M16A 3CZLA 1X1OA 3AIBA 5LGXA 1ICSA 3B0VC 1KCKA 4Y9NA 3QKZA 4C60A 5M5DA 4GUIA 2PDNA 1EF3A 2HK1A 5ENLA 4O18A 1C9DA 3LTYA 3NDOA 1BAGA 3AFBA 1MUCA 1ZTVA 3VX1A 1FCQA 1V0LA 3UBPC 4BF7A 2QUTA 4QXIA 1FWNA 1GVOA 3IARA 1LBMA 2VEFA 5XIMA 3G3DA 1W3HA 4Y9PA 5FF3A 3W02A 4JY8A 3BW4A 1KRMA 4F9DA 4OU1A 2GJPA 4OTKA 4C1NB 3M5YA 3WQ5A 3SEPA 2W92A 3KWSA 5KEZA 4TO8A 1XL9A 1DHKA 2WHKA 1SR0A 3UYCA 2O0TA 4IL2A 1Q2SA 1I60A 3PN8A 3UZYA 1N8FA 1RLDA 5DXYA 3KLKA 3DG6A 3AS3A 3QM3A 4K39A 3WLIA 3PZ9A 5HWMA 2OKOA 3WD1A 1EOMA 5AZ0A 2J8FA 5CJNA 4UTUA 2ESCA 2YXOA 4LVAA 3GWQA 1G0CA 2Q8ZA 1PJ9A 2NQ9A 2PS2A 3GDRA 4Q4RA 4JAWA 4ACZB 1VBHA 2VQTA 1D3GA 4Q4SA 2PRMA 4H8UA 1R86A 4JHZA 1CB2A 3P2VA 4Q4QA 2KAUC 4C7GA 4XAZA 5IRPA 1IQ8A 1J0HA 3PF3A 4MMWA 4CCDA 1KM0A 1E6SM 1OEPA 2ZUMA 1R3QA 1A5CA 2FLIA 2WMHA 3DERA 1TREA 4GO9A 3W7LA 1UWIA 2EF9A 2JEPA 3SQMA 3V0SA 4MNJA 4Q22A 3TK7A 1U1HA 2R1LA 4YJ5A 1Y7VA 5BU6A 1W5PA 1XD1A 1G4TA 4HU8A 3W23A 3VKCA 3RRAA 1RAKA 5A6MA 1E9LA 3F4VA 1RH9A 4KFNA 1U83A 5CC6A 4Q8OA 4C6LA 3PZQA 1E3XA 3W7JA 1YNQA 2ZZ1A 3V35A 1V02E 3WH7A 4MNKA 4FX8A 3NQAA 1YPIA 3S42A 3UGRA 9XIAA 1MQPA 1RP9A 2V2DA 4MPKA 3B0YA 3BAJA 1A53A 3EPOA 5JBDA 1E55A 3O15A 4D6JA 2QJNA 2IKJA 3UWEA 1EEXA 4CNPA 3FYYA 1BYCA 4E3VA 4OOZA 2V5BA 1LRQA 1QR7A 2DDXA 1O4UA 5TAOA 3GTFA 1HIZA 3VOCA 3ZR4A 1I75A 1QHZA 4CN1A 2OSXA 4W8AA 2YW4A 5GJPA 4GQGA 2YB1A 4H04A 2YCIX 3GIPA 3OYZA 4CNSA 3TTQA 4W9TA 3CXOA 3OLGA 3TA9A 1R2RA 3GXPA 4UTMA 3DHDA 3R25A 1TZ7A 4DZHA 1DXFA 2Y5EA 4FF7A 4GE8A 1XV8A 5AOUA 1IXQA 2CLLA 4V1XA 1LP6A 1TPUA 4S3GA 4PMVA 2UY5A 1ONRA 3HPAA 3NSMA 4IIDA 3RK8A 3AROA 1AK5A 4XBJA 4S3AA 5J5DA 4GYFA 2NQHA 3P82A 3TFCA 1CW2A 1XF0A 2XIJA 3W1PA 3RUBL 1XLFA 3WMLA 1XCFA 3W29A 4AHQA 3R11A 4NILA 4QG9A 3FGCA 1AD4A 3NL6A 3TW6A 2H3BA 1XSIA 3RM9A 4XAPA 4HNCA 3IGXA 3U6WA 3HFYA 3UWUA 1P6WA 2CBIA 2OSYA 3NEVA 4HA1A 4ML4A 5KINA 3WLQA 1MRAA 4GZIA 4AXNA 1MFUA 4CU8A 3Q94A 3IGHX 3BMWA 1HJUA 3E96A 4AZ6A 3Q65A 7A3HA 1Q6RA 4N4QA 4LYKA 3UCCA 5HMFA 2NWSA 2C1GA 2W4XA 3CNYA 1E0XA 4PMDA 1QATA 8RUCA 1WDRA 2BBFA 1W3IA 2YDSA 2DQWA 4W7WA 5BW6A 4MIMA 1R85A 1JCJA 1FVPA 1CYGA 2ISVA 4Z0JA 4NNBA 4YNGA 5CZJA 2Q02A 1LUCA 3L5AA 3MVIA 2GGIA 4MJ4A 4IFKA 3TYEA 3CH0A 1E73M 1UPMB 4Z0SA 1JGMA 3PFRA 4B5TA 1EZ2A 3W7IA 1KTCA 2V3DA 1V0NA 3EXRA 1JG9A 2FHFA 1ZFJA 4DI8A 1FTXA 4C6EA 3R79A 2PWFA 3V75A 3OHMB 3FNDA 4UTWC 2QJGA 3M0JA 1JZ2A 1F6KA 2G3JA 3ZOAA 2CEQA 2FTPA 2HNHA 2YYTA 1TRIA 5LIYX 3VKBA 4XBSA 1G7UA 3NPUA 3DAQA 2VCAA 4ROPA 2Z26A 3APGA 3VE7A 3P62A 5CBBA 2QCNA 4XTDA 4BQ4A 1TMQA 4HBKA 2HE5A 1F05A 2GLKA 1Z8AA 5G4HC 3BAIA 5EL1A 1EJTC 1V51A 3SUUA 1P6BA 3MBFA 2OQLA 4R3UA 4YVXA 1F73A 2DZBA 4Q3MA 2BGQA 2OZ0A 4MPQA 3VMPA 2WBGA 2J24A 3P6LA 1O95A 2NUYA 3R6IA 2EAWA 1EPXA 2E68A 1K6WA 4IX0A 4MB5A 1KBKA 4PB3A 4GY1A 1ZLPA 3H7VA 3EDJA 4NXSA 1UIPA 2OLHA 1MW2A 3I65A 4Y9MA 2AMGA 5JH1A 2E6FA 4B5NA 4L64A 3P61A 4PUJA 4IUGA 1FHLA 2WNWA 2PGFA 1F6YA 3GXTA 4MYAA 1MQQA 4WJXA 1IT0A 2YBTA 1DJYA 2DZWA 2YLLA 2H8ZA 4A2RA 4KEZA 4UBPC 2I14A 2CC0A 3WEMA 3O3RA 3XISA 2EXOA 1VHCA 5D4YA 4WRHA 3M43A 1M41A 2HISA 1KXHA 1E15A 3B8VA 3H23A 2V2CA 2Z24A 4KCTA 4F0KA 3EKZA 4ZA0A 3H7RA 3B4UA 3SRDA 4FIRA 2C19A 1W1VA 4LS0A 1XLAA 1R30A 2Q3OA 3G1AA 1OZQA 2C71A 1X1NA 3GNRA 3PC0A 4UZUA 1EIXA 1TPC1 2QCCA 4JN6A 2GSEA 4ZVJA 3UD6A 1HP5A 4LH8A 5D2WA 3NXLA 3VM7A 5HULA 1MRQA 3VOFA 2CLIA 3S5YA 1C3FA 1SJDA 3FEQA 4R7WA 4JIHA 1CIUA 1NEYA 3U48A 4PGLA 3GC2A 4HSOA 1BD0A 1JVNA 2ZXAA 2ZUUA 4IQEA 3LCHA 4UFLA 1ZJHA 2FFCA 3FSTA 5LHFA 5C2GA 1W5OA 2VGGA 1JQVA 1GKPA 3IIPA 2NSXA 4KRZA 4IX2A 4JICA 4LUIA 1V8EA 4NHVA 5KZ6A 5GQBA 1M53A 2A6LA 3RR1A 4PZVA 4PTNA 2Y5JA 5MKGA 3FLUA 3F4DA 3F03K 2ACUA 3QV9A 1ME8A 3IJIA 3S2MA 3CL6A 1S2VA 1ITXA 3F4NA 1CTNA 2QYGA 2MANA 1V79A 3SURA 4A29A 4H3DA 4XZNX 5G2WA 4J9JA 3WQ4A 4CN6A 2Y4SA 3LCFA 2J7FA 3PZNA 1XYLA 4DBUA 1I0DA 4AD4A 4RDZA 1IXPA 3E2QA 2E5DA 3SGZA 1QI3A 3TDFA 4MFEA 2ZXBA 1X6LA 2BOGX 3D6NA 5LIUX 1E56A 5IM51 1R7AA 3CV6A 1EX5A 3V1PA 2ZUSA 3G22A 1RK5A 2YSWA 4RV3A 4MY8A 4DF1A 5C71A 3QZEA 1ZY9A 2G0WA 3TN4A 2ZRUA 1BQCA 1F7BA 3ATZA 3M0XA 3URNA 2IPFA 3TQ0A 1YTKA 3NL5A 3VE9A 1L6FA 1BKHA 2VENA 1S2AA 2HRWA 2OQHA 1XYAA 7PTDA 4LUSB 4GVGA 2QIWA 2QHAA 3DUGA 3PP7A 4EPBC 1KFKA 4WLCA 2AAMA 3KBSA 3PWGA 1OFOA 5IOBA 5E6ZA 2C14A 5K9XA 4Z2JA 3D0CA 4KIRA 3GG8A 1OYCA 4ZODA 1NVMA 3XIMA 4PCFA 3O6DA 3MUIA 2X0YA 2ABAA 5L6UA 3UWVA 4QJ3B 1J6OA 2DQXA 3VIMA 1LOLA 1TWDA 3REQB 3BXWA 2PTXA 2Z1BA 1EHAA 2O7SA 3ARRA 5CG0A 4DZIA 4WJ8A 1EJ7L 4NJHA 1AG1O 2VUYA 4M82A 4ERGA 4LFYA 2WHLA 1EUAA 4IGNA 1ITUA 2GVGA 3A23A 4PTMA 3B97A 3D3AA 3GY1A 2BX7A 4HNUA 2J7CA 4S2CA 5PTDA 2V5LA 5C2XA 4ACYA 2ZRZA 3T0TA 1UR4A 1HW6A 2POTA 1VFSA 4EXBA 4P2VA 4DXXA 1JEZA 4I7VA 3I68A 4QHRA 4H7ZA 1WBHA 2NZLA 4PCNA 1M5WA 3EBVA 4LVFA 5FEXA 4RX0A 3VDCA 3UPMA 3VIFA 1F4AA 1ZALA 2YYUA 3DFQA 3MUAA 3EMCA 3RIKA 3ARSA 5A8GA 2G3MA 2C1HA 1WA3A 3PUEA 1B3ZA 2Z1XA 4AYSA 3LXCA 4RW5A 4WD0A 3A12A 1Q6OA 2PBOA 1W1B1 1R3YA 2OX4A 1HT6A 3ITLA 2QJJA 4W93A 1JCMP 1WDSA 3VZZA 3B8WA 2J8TA 2Y62A 1W9PA 2HE8A 1H63A 1VCVA 3IJLA 3S47A 3H2AA 4B3LA 2V63A 3RMEA 3K8MA 4F9JA 3CZ8A 4PL2A 4CN4A 1V3IA 2QAPA 4BKNA 2XWEA 4HJFA 4D71A 1PBGA 1PS9A 4D1JA 4L9XA 4TIMA 4XUYA 3E38A 4FOKA 3QYSA 2WK2A 5D2XA 3P80A 4NG3A 3WEOA 1PDZA 4AEFA 3WBEA 1AODA 4FR1A 2XGIA 3BG3A 3NQBA 3NO5A 3NG3A 1KKOA 1V03A 4N0RA 3GK0A 1QK0A 1UR2A 1H51A 4GQRA 4F0HA 4JCMA 2WMFA 4HSNA 5BU9A 1MEWA 3UW6A 4FA3A 1FWAC 2HVNA 2CZVA 4S3BA 5I3FA 4J3UA 3IGUA 1DWJM 1CX9A 1XBXA 1GNXA 4R27A 2ZDRA 5GJNA 4UQEA 1CZ1A 3T2PA 2GJRA 4LEFA 4C5YA 1TPVA 1DQUA 1PE1A 3UJFA 4ICMA 2FH8A 3APYA 1P7TA 2WZTA 2QCHA 1IF2A 5F2MA 5CXPA 1LWIA 2POZA 3BLEA 3VIGA 1VJSA 3PR2A 1E9YB 3L4XA 5H6HA 3MHFA 4Z2KA 1Q4NX 2J6VA 1NOFA 1AZ1A 3DG3A 3E0VA 3W7MA 3HV9A 4QS5A 1NIUA 1B3VA 1VRXA 1Q63A 3WK0A 1S2CA 2OODA 3LXAA 3IVUA 1FHDA 3CUJA 4LUSA 3OTRA 3G8RA 2BVWA 4DO4A 1IEQA 4HZ6A 2BMBA 5E70A 2FHCA 2W3ZA 5I3GA 1KWGA 4U2YA 3WD4A 1OINA 1GVRA 4IFRA 3W2UA 1L0PA 5I06A 3N4EA 1XI3A 1VFTA 1X97A 3B3DA 5JIWA 1PYFA 2HTMA 1B3XA 2HPIA 4AHOA 4WDTA 4D6FA 3LHUA 1XHGA 3AYTA 2WSPA 4FK9A 3WLOA 3ITVA 1PTGA 5AYYA 4DO6A 1XDJA 3L0KA 4HYWA 1JCTA 2D23A 2Y1HA 4DPPA 1QUMA 3CQ0A 2C7FA 3GR8A 4H9XA 2OFJA 4HMEA 1OGGA 2A4AA 2A7RA 3BWWA 5A8OA 2VDIA 4MZ8A 3W7CA 1KTBA 3BANA 1XFBA 1HP4A 2Y88A 3ZR6A 1X8FA 3QPEA 5A6BD 5AVHA 5MHBA 4LUTA 3VGBA 5K9DA 1LRTA 2EPKX 1DJIA 4IJBA 4OZOA 4HMCA 3WY1A 4QNEA 4GQ0A 1X6UA 2VZVA 3A21A 4LRTA 3KX6A 3NQVA 2E9MA 3UY7A 5I09A 2IXVA 2YBUA 3E12A 4RNFA 4N42A 2E6YA 1TTPA