3WQGA

D-threo-3-hydroxyaspartate dehydratase c353a mutant in the metal-free form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
379
structure length
379
Chain Sequence
b'QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNHAAATGAQFPAYQALAADGSVQTWERLHGW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-threo-3-hydroxyaspartate dehydratase
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate
pubmed doi rcsb
source organism Delftia
molecule tags Lyase
total genus 143
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3wqgA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3wqgA02
3HA1A 3CPGA 4QHRA 4AIBA 2TODA 3N2OA 1KNWA 7ODCA 3WQCA 3B8TA 3B8WA 2NVAA 1SZRA 4BHYA 3LLXA 5GJMA 1F3TA 3N29A 2RJHA 4PB4A 2QGHA 4PB5A 4XBJA 3ANVA 1HKVA 4BF5A 1FTXA 3E5PA 3E6EA 1NJJA 2P3EA 1D7KA 1NIUA 3NZQA 4FS9A 1EPVA 4WR3A 1L6GA 1VFHA 4DZAA 1XQLA 4ILSA 3CO8A 3AWOA 4ECLA 4ZGYA 2SFPA 2PLJA 4V15A 5GJNA 2OO0A 3R79A 3ANUA 4LUTB 3KW3A 3VABA 2NV9A 5GJPA 2DY3A 2YXXA 4Y2WA 1TWIA 1L6FA 3WQEA 4KBXA 3C5QA 4XG1A 4BEUA 4LUTA 3B8UA 2ODOA 2ON3A 1BD0A 1SFTA 4DYJA 1B54A 5IRPA 1VFSA 1RCQA 4LUSA 2J66A 2VD9A 2VD8A 5FAGA 3WQGA 1XQKA 3S46A 2PLKA 1KO0A 4LUYA 2O0TA 1HKWA 3OO2A 5FAJA 2RJGA 3GWQA 4LUSB 1TUFA 3MT1A 3BTNA 4BEQA 3UW6A 1VFTA 5BWAA 3NZPA 1XFCA 4PB3A 5FACA 3N2BA 3WQFA 1W8GA 1QU4A 1CT5A 3AWNA 3B8VA 3HURA 3SY1A 3WQDA 4A3QA
chains in the Genus database with same CATH superfamily
2V3EA 3C2OA 1AQ0A 1KD0A 4AB4A 3RUBL 1FDYA 1VYRA 3BGJA 2VXNA 5AZ1A 3GTXA 4AXKA 4NIRA 4PTVA 2NQLA 5GNYA 1Q6DA 2JGYA 5HUOA 4WGHA 1OT1A 3DOPA 3LG3A 4NILA 4Y8FA 1FWAC 3AU2A 4F0HA 2E6FA 3O16A 9XIAA 2VMFA 1ZUAX 1H61A 1VBRA 1UKPA 2HZGA 1QOQA 4F66A 2Z00A 3CUGA 3AI0A 4QDMA 4ADUA 3NL6A 1K7XA 1Q6CA 3T2QA 2C6QA 5IDZA 2VVSA 4AEEA 4GUGA 5XIMA 3PBYA 2QR6A 4IJRA 4IHCA 3VNMA 4O8RA 3R58A 1XWYA 4C6EA 3HPZA 1FWSA 1Z89A 3UESA 4JY8A 4KMQA 1F4HA 2ZUUA 3PAJA 1XYZA 3GY1A 2WZIA 3EKGA 3HFYA 3QJAA 3UCDA 2EJAA 3H7UA 5BU6A 3PBGA 2UY5A 3B4YA 4RPPA 1L6YA 5DLCA 1JCMP 1P5BA 1R9XA 4JX4A 1N82A 1I2OA 4LBUA 1OT2A 3WMBA 2ZZ2A 4H9MA 3N4AA 2HISA 4KWWA 3WK2A 4CNNA 2DZBA 2R9RA 1SZFA 2FH6A 2WHJA 1J5TA 3B0VC 2VFEA 3RJXA 7ENLA 3GDKA 1R2RA 4PN2A 4GQBA 4C6BA 1ZL1A 2ZE0A 3NDYA 4ZO9A 4H9ZA 4GY7A 1R7AA 3BOLA 3NJ3A 3FA5A 1R2TA 3ARTA 4LVFA 4WR3A 3L5LA 3AZSA 3T8LA 1KCXA 5BRQA 1C90A 1QPRA 1KRMA 4MB4A 3W6YA 4PUWA 4WOQA 4ZR8A 3U2CA 4K1GA 2ANUA 2YBTA 3ANUA 4IUOA 3A9IA 1L2QA 1B57A 1WXZA 4JIRA 1W56A 2RDWA 1VEOA 3ORWA 4JCLA 4D6IA 4FA3A 3TMQA 3G8EA 1RY0A 4B4FA 3BLDA 4C6NA 2X1TA 3THUA 1Q6OA 2OB3A 1I2PA 1EYWA 3EZ4A 1TRIA 2XHYA 1VIWA 4IMCA 2NX3A 3SY8A 2JIWA 1NTHA 2OU4A 1W8SA 3LK6A 3PTKA 2V0TA 1AJ0A 2PLCA 4Q4KA 4TR9A 4IP7A 5CZ0A 4FNQA 5K3VA 3VIPA 3JZEA 3FXYA 1IGWA 4TV5A 3KTSA 3EOLA 3AIEA 3E38A 4A05A 2L5HA 4JICA 5D9OA 4NYYA 3WQOA 3L4YA 3ARQA 3LCXA 1EJRC 2XIOA 2FFIA 3T09A 1K8YA 3W7EA 3UZWA 3A4JA 3R25A 2X05A 4GABA 4TX6A 4B5UA 1PKMA 3DH7A 4A8LA 3NOYA 4HZ7A 2W5FA 2RDXA 4ATDA 2XIQA 1EJXC 1GONA 1VF8A 1KC7A 4Y8EA 4GMEA 3H21A 2C71A 3SZ8A 3N3TA 1G5AA 2QDHA 5HWNA 4DZAA 1MXGA 3ZVHA 3N11A 4IFOA 4S23A 4MJMA 4WKFA 2DZXA 4LYKA 4HNLA 1WE5A 1GOQA 2ZTJA 5G2HA 1DIDA 2O7QA 3W76A 4MAVA 1NVMA 3TP4A 1OFQA 1EX1A 2WVVB 3IAQA 3W6MA 4I8DA 4BF9A 3QOMA 4KQNA 1T0OA 4O28A 3DX5A 1V0MA 1TVNA 3RCNA 5HDRA 4XISA 3MMWA 2VR4A 4OT7A 1M5WA 1R9ZA 4N4PA 1VP5A 4AX7A 1TV7A 5LKYA 3I7RA 3T6CA 4C5YA 2G3MA 4L9ZA 2GVGA 2HK0A 4Y9MA 4DB7A 4L6DA 2EJ1A 3B05A 2CBUA 3T2OA 4LUJA 2WPGA 3BH4A 2X40A 3VNYA 3L4ZA 1S3HA 2CW6A 2WO5A 1CGUA 1QRQA 4L4PA 3AWNA 2Z29A 3NAVA 4U5KA 3PZIA 3EX4A 4DM1A 3RCYA 2FPVA 2R1NA 2YCJA 5MKGB 1QNVA 3RJYA 2XFFA 3C0JA 1RVKA 3ISIX 3VIIA 4J3SA 3W0KA 4XSLA 1OGBA 2QUNA 3LBOA 5A94A 2GGGA 1UKTA 2OQYA 5LZLA 2J77A 2OZ0A 4Y96A 4AFYA 1OQFA 3QR3A 1IT8A 1YTEA 3SW6A 1GVOA 3PANA 4CU7A 1V03A 3GH5A 3C2RA 3O8AA 3UJFA 3CHVA 5FF0A 1FHLA 4F0RA 3FIGA 3LS9A 3OIXA 3EA2A 1WKFA 4C1NA 1EC9A 1ONRA 5CPLA 3KHDA 2PBOA 1TPH1 3BW4A 5JU6A 2C19A 5DBUA 1PIFA 2Y61A 4OWGA 4IIEA 3KRZA 3P5YA 1V77A 3VD5A 3WD2A 4BQ2A 4HSNA 2JEPA 4GYJA 4ZE5A 2BHUA 2GQ8A 3U4FA 4C6LA 4IP4A 1GQNA 1C91A 1K03A 1HGYA 4GQ0A 3G6MA 4TOQA 1XFBA 4TVUA 4HP5A 1F73A 1TCDA 4CD8A 1ZBKA 1OIFA 3HQ1A 5BWAA 2DH3A 4DELA 1F05A 1MUMA 1V51A 2OTDA 1W8GA 3BLLA 4UMAA 4FALA 1AODA 2PLMA 2XJ7A 1CTNA 6ENLA 2NLIA 3LQLA 4CD4A 3AIQA 4IXHA 2E09A 4HB7A 3IIXA 4RXFA 2GYIA 1FWEC 1CXLA 3FA3A 5CAHA 1B1YA 2WKGA 1I60A 5EMJA 2DPEA 3S0CA 3FGCA 2DT1A 2V5LA 4DJED 1T5AA 4LNYA 4DM2A 3MKCA 3FHQA 4FXSA 1IXQA 3UERA 3VE9A 3CUJA 4MJ4A 4ROQA 3K1GA 4HU4A 3WEZA 4IT1A 1DJQA 1KFEA 2KAUC 1G1YA 4WY0A 4CVWA 3FGCB 5J5DA 1E0XA 3AWOA 1UD5A 4XZNX 1PKYA 1O60A 1H7RA 3AIWA 3VIGA 2V82A 4GUIA 2IQDA 4WY0B 2OVLA 4PH6A 3WH5A 4YTSA 5C9ZA 1IWPA 4BCEA 2I7GA 1P4CA 3A6OA 1GNXA 2W27A 4DYJA 5BMXA 4DBDA 1VFFA 2QNEA 2J66A 4ADTA 3USZA 4Z2JA 1YNYA 3HJEA 3VD4A 3EXTA 5E70A 3F4WA 4GFIA 2DGAA 2VM8A 1WZKA 3EDFA 2V2CA 4U2YA 2VEIA 3LHZA 1A53A 2PWHA 1KFCA 2QDEA 3BG9A 2GFTA 1CXHA 3KS5A 3QHOA 3CUHA 4IM4A 3TDFA 5BNKA 3ITCA 3W7RA 2DDXA 4A3QA 1US3A 2V3DA 4PCPA 1XLEA 2BMBA 3CPGA 1U1HA 4WIWA 3NQEA 1LQ0A 3LLXA 1Z8AA 3A4XA 3MP4A 4KIRA 3TKFA 3V4BA 1K9DA 1Y0EA 1SMDA 2YL8A 1ME9A 3LRKA 2JEQA 3C0QA 1EJVC 3S5SA 1LBFA 4B5NA 3L12A 4QSHA 3URBA 4JIHA 4KCVA 2F8QA 2CBIA 3MDWA 1JFXA 1VC4A 2I17A 2Q71A 4JTIA 3WLNA 2PDXA 1BSLA 3P62A 4CCCA 1DKWA 4C7GA 1E70M 5L9FA 5DY3A 1XUUA 5DFAA 3L4VA 2DY3A 4JQ3A 1UR4A 1EDGA 1PAMA 2ABBA 3M1ZA 4P7LA 3C3NA 4GJIA 3VILA 3WF3A 2PDBA 4FOJA 5C2XA 3MUCA 3MCOA 3W88A 3ERPA 3P8JA 3WQGA 3EPMA 2EGZA 1RQHA 1ISZA 4FF7A 5HR6A 1D3HA 1MI3A 1KV8A 2V6AA 1E6PA 3EB3A 4HNOA 3N15A 3GW3A 1ZENA 3O1NA 4P5UA 1FCQA 4Z0SA 4HKPA 3MQTA 4IFKB 5HNUA 1C8VA 1VJZA 4GACA 1FWIC 3FAXA 4GY1A 2YCIX 1TWSA 1PHWA 2PSNA 4WKAA 4HPGA 1GGOA 3V5CA 2I5GA 3LM7A 4AZBA 4BS0A 1W32A 4GX8A 4LVDA 3SI9A 3QVQA 3PPHA 3QV6A 4TXEA 2PS2A 4O1EA 4PUKA 4FO4A 5TBOA 3QN3A 4ICMA 1XDMA 4W93A 4ZTXA 3CASA 5A6JA 5C71A 3VKAA 3Q67A 4PUEA 1BF2A 3WL1A 1JF6A 1RJQA 4OE7A 1OGSA 3SR7A 4TMCA 3WIJA 1C9WA 4HU3A 3E02A 1VHCA 3QEZA 1HUVA 5CZTA 1FUYA 1H1YA 1E4MM 2D73A 2WBGA 3JU2A 3IUDA 3KX6A 1TYGA 3BL3A 4NAFA 1A5OC 2Z26A 2C3ZA 4WCJA 4YVVA 3SCTA 3CTTA 4H9VA 2ZTKA 2QQ6A 3U2OA 4P7NA 4ZB2A 5GVJA 4MJZA 4MYAA 4ZO7A 1AJZA 1AW5A 1K9TA 3CWOX 2PWGA 1RJRA 2AMGA 1QK0A 1TUXA 1YNPA 4U10A 2G96A 3QY7A 1SJDA 1WA3A 3RXZA 3OG3A 1FWBC 3LPFA 4PTXA 4DWSD 2RJGA 1A0EA 1EYEA 3E0FA 3OLDA 1F2JA 3BOXA 4F48A 3VNIA 2BGNE 3ALFA 5FIPA 1WOBA 1OK4A 3RR4A 3SDOA 2VT0A 1TE6A 2WZMA 5M5DA 3ARZA 3HURA 4JN8A 2PGWA 4O19A 1ZNNA 4PUUA 3QH2A 4AIBA 3WFZA 3Q58A 2XVKA 1UR0A 3LPOA 1Z41A 3IGHX 4JTCA 4EPBC 1TPB1 4X9SA 2Z1XA 4B15A 4GC4A 3UVIA 2E5BA 2R91A 5HJXA 4MB5A 4R88A 2I9UA 2CCRA 1OYCA 1JCYA 4Z1DA 2WHKA 3QRHA 2FB3A 4AUBA 4IMFA 1SW7A 4C6OA 2W61A 1NF7A 2ZX7A 2F9RA 1JCXA 2ZRWA 1YTDA 2QVHA 3U5YA 4Z42C 2ZE3A 3OVQA 3UWUA 4JNYA 4H7VA 4QLJA 2I5IA 3GXPA 1YXYA 4C6MA 4XQ6A 2HROA 1W3LA 3W1LA 4KWVA 2QUVA 1TIMA 3TE9A 5LYRA 2NQ5A 2ISDA 5BXTA 5D33A 4H8VA 1ZJAA 1AFSA 1XGZA 3SSJA 1E6SM 3N25A 3H2FA 1PX4A 1WPCA 4ZO8A 4H9TA 3AIRA 3ZWSA 4NASA 3UZZA 4QLKA 5I07A 4F4RA 4H2CA 2HVNA 3EDJA 4BWLA 4JPGA 1IQ8A 3AISA 3NYDA 4RE2A 1Y65A 3QZAA 1F6KA 2VDHA 2OEKA 2LLEA 4C6FA 2G41A 1UKQA 1CDGA 3VI2A 3LY0A 3KBMA 3VK5A 5A3HA 3PNZA 1QR7A 3BC9A 1FWFC 1XLAA 2ZWZA 2FVLA 2WW5A 4PFHA 3W7PA 2G95A 1K8XA 2R82A 1MRQA 2JKAA 4JFUA 4ICNA 2PF8A 2R1LA 1QVBA 2EKCA 2V3FA 5C9XA 2NXGA 1UYQA 4M7SA 2XM2A 1S5WA 1DJIA 4LSBA 4AIEA 4OBTA 1SW0A 4UFKA 4DEFA 1YMYA 1IIGA 1LRQA 8XIAA 5C9UA 4LFYA 4WDXA 2WCGA 3WEOA 4QR6A 2GK1A 1M7OA 3RX2A 3G1VA 4I90A 1YTKA 1O1HA 4PMOA 4HYRA 1DHKA 1J8VA 2QJHA 2VTFA 1S2UA 2D0HA 5MF5A 3UA4A 3H24A 2FJKA 4QROA 1HNYA 4QISA 2A7RA 3SSZA 1ME7A 3ARUA 4NHVA 1P0DA 2B7OA 3LGDA 2DUAA 3CYVA 3A23A 3CQKA 3NO1A 4CQBA 1M3UA 1QU4A 5EPDA 1W3IA 1RJPA 4GYPC 1QW8A 4EAYA 5TF0A 5GJMA 3DFYA 3B0XA 4LV9A 2Y7DA 1BTCA 2G3FA 3OTRA 2Z1KA 1OZQA 3RCMA 1I0BA 4KW2A 1X6LA 2EQDA 2EHHA 3FCPA 4RZ5A 3F2DA 1CX9A 4WJXA 3ES7A 1TPEA 3V0TA 1Q6RA 3W1XA 1W2PA 3W2JA 2VQTA 1OFBA 4PMJA 4ZB0A 4D6DA 4JTHA 4UTMA 2VKZG 3S2MA 1E4LA 1GOOA 3STEA 2BZNA 1WCGA 5A69A 3U5UA 1CXKA 1K7EA 2A3LA 1XRFA 1C8YA 4QJ5B 2ZQ0A 3B9OA 4EPEC 3HG5A 6TIMA 5IBXC 3T05A 2PC4A 2CBJA 3KOWA 2WCAA 4O15A 4D71A 4G1KA 3OVRA 2W91A 1QI5A 3TQPA 4PCSA 1KBIA 2VWTA 2R8WA 2B81A 4LOCA 3W7CA 4W9TA 1MQPA 1GOXA 4JIIX 2NVDA 1B9ZA 3IVSA 2PDWA 1GQKA 2XSBA 3CC1A 4RZ6A 2CC0A 3HMJG 4ONVA 3POCA 2WMJA 1TTQA 1Q66A 2V63A 1TMQA 4XD4A 3SFWA 3W75A 2ZUNA 4ML9A 4EXAA 4KKXA 4OBSA 1KXHA 1TTIA 1KRBC 4CNTA 1KM1A 4DBEA 2FZDA 2FVMA 1I1WA 2QXWA 3BMWA 3GYCA 3LB0A 3MW7A 4ZQRA 4FIRA 2J7DA 4ECLA 3EXSA 5FA5A 3LYEA 2BBFA 5FF4A 1FRBA 1E71M 3WLLA 3SGZA 3MSYA 4R7OA 3W28A 1GVIA 2FVKA 3WLIA 5HBFA 3B0PA 1XHGA 1IHIA 3UZ5A 3GHUA 4PMQA 4IZGA 3ZJ8A 4IFRA 3DYMA 3U0HA 4CQ8A 1GCYA 1XIFA 3D6NA 1L0PA 4GJJA 5G4EA 3W2KA 5LXXA 3AMDA 4B5XA 5FJIA 3G1FA 3QSTA 4W7VA 1ZBWA 2X8RA 3STPA 3R8RA 3FDGA 4ZXLA 1W91A 4IMDA 1G4PA 4POCA 2ALDA 1RBLA 3SGGA 4IGSA 1SZRA 1EBHA 3ZJKA 1M1BA 2PDPA 1UOZA 3CIXA 1OX5A 1GVYA 2QUTA 1OSEA 1DWJM 1J2WA 3R6IA 1MUCA 1NDVA 1RP8A 1H50A 3LTSA 3TQ0A 1S5MA 3DKLA 2ZWYA 1ONEA 6REQB 3FKKA 4L1GA 2AQOA 4Y90A 1FWGC 2VEPA 2H3BA 3RNDA 2KZHA 3FLUA 3THDA 4M51A 4F2UA 4H41A 3CIVA 1DJHA 4GK8A 3QGKC 4KCUA 1C93A 3EMCA 1E1EA 3VFLA 3ZLFA 3ATZA 3ICJA 2V3GA 2Y4SA 4YYCA 1D8CA 5I23A 1MRAA 1Q6FA 2Y8VA 4E8DA 2A85A 3N4FA 1B54A 1YPFA 4EX4A 1B3XA 2E1WA 4YYFA 5CPQA 2D2JA 1CZ1A 1Q7ZA 1UBSA 1WX0A 2OXNA 3GFZA 4TQTA 2OEMA 4V28A 3I3BA 2Q8XA 4DHGA 4JL2A 4CQDA 1RA0A 1OD0A 2XYLA 4DJFC 3S9ZA 2YSWA 2J62A 4HOWA 3DN5A 1WO2A 5LIYX 3LERA 5FEPA 4W84A 3VUPA 2POTA 4KGJA 4PCNA 1A5AA 1AMYA 3ZOAA 2AL2B 2AKZA 3GB6A 5E5CA 2DW6A 4BQ4A 3UU0A 3BMXA 3DYOA 3PK7A 2C16A 4CQ9A 2G0WA 1ODUA 2J74A 3ZSTA 1BXCA 1V0LA 1S39A 3T4CA 3WUEA 2J8FA 2NZLA 2PEVA 4PUDA 2GDUA 4RPQA 3EOOA 5K9DA 5LA1A 2BXYA 2YBVA 2XH7A 4CEUC 3OGRA 4A21A 4ICCX 4IX2A 2Y89A 2WSPA 4AZCA 1IYXA 5EL1A 4PMZA 3EA3A 3LN3A 5LXEA 3K8LA 3DI1A 1XYFA 3WZ0E 2PPGA 2G3JA 4H8HA 3M4HA 3USBA 2XH0A 3M0YA 3ZS4A 4PE8A 4MB3A 3PZ9A 2PDKA 5EBAA 3KS6A 1PB0A 3VKDA 3SUVA 2BP1A 1QMLA 4YHEA 3CZLA 2P1FA 2PLKA 4P7OA 5TNVA 1EQCA 3CAVA 4L4OA 4FNPA 5LNWA 3RHGA 2O55A 2YJQA 3QV8A 1PL9A 1YE4A 2OR2A 1UQZA 3NM1A 3WLSA 1HL9A 1U5HA 3RITA 1TZ7A 4A22A 1TWZA 3NVTA 3WQFA 5I6SA 3SY1A 2ZRVA 4MWAC 4N0RA 1RV8A 5EYWA 2QLYA 1R3TA 4JTGA 1W9UA 4K8EA 2WMFA 4UR7A 5C70A 1W17A 4S3FA 3N12A 3LGGA 3AYVA 4Q8TA 3W1NA 1A0CA 2PODA 4NNAA 3T81A 3MTWA 3QQWA 1E0TA 3B06A 1GK8A 1LLZA 1X97A 3UP8A 1UH3A 2GSEA 2CKRA 5D2XA 4DYKA 3CO8A 1PKNA 2MNRA 5F2GA 4WXYA 5TAOA 3R10A 3M0LA 1FKXA 1VENA 1X1ZA 4AC7C 1UROA 2J27A 2J9ZA 4HN8A 2VR5A 1KRCC 1W3JA 1CYGA 1EQPA 2PURA 4L4LA 1E6QM 1KQZA 3AXIA 3QMRA 4F0LA 4GYFA 2ON3A 2R1KA 3B8SA 3HZ3A 2G50A 3S83A 5DEZA 1R86A 2DZWA 1BG4A 3QMSA 4FNRA 4J7RA 3M7WA 1TA3B 4NXSA 2CZEA 3CUZA 2VZTA 4U4MA 3WLKX 2IMRA 2XZ9A 3K30A 4GOAA 3F4NA 4Y6GA 1GQIA 3T0AA 4RL3A 3AFBA 3LCFA 3WQDA 1QI3A 3GAYA 4LQ1A 1BGAA 3KTXA 1ZFJA 4E4UA 1WNOA 4FNTA 3MC5A 1IIHA 2FQIA 3R4IA 4N6EA 3TNBA 3W37A 3MI2A 1QT1A 3CV2A 2NV2A 3IIVA 1Z6KA 1EO5A 2ISFA 4QP0A 3TK7A 2DVUA 1IEVA 4IQLA 4UTKA 1OX4B 2YDSA 2DFAA 3VGBA 1RK5A 3M0MA 2V8ZA 1XYCA 2OFJA 3PG9A 1GTHA 4KIEA 4TIMA 2B0MA 5EFFA 1AW2A 2XPKA 1CGTA 5I06A 3WNNA 3CTLA 1C8XA 1WKYA 1OVDA 2EEXA 2YDQA 4KBXA 2BVDA 3W24A 1JYVA 3AHZA 1XIHA 2G4FA 3PBUA 3MP5A 4AZ6A 4E8GA 1FH7A 1LWJA 3WJXA 3I10A 3VOFA 2ZC8A 3XINA 4IIBA 3HPFA 5DMMA 3IK4A 1ENUA 5D2YA 3V16A 3WY1A 2HSAA 3VMPA 3QFEA 4PRTA 4FK9A 4ZOBA 2XGIA 3EKLA 4G6CA 3Q4DA 2HVOA 3PJWA 2YZRA 3N9KA 1EUNA 1WXYA 3ZJ7A 4QG8A 4QE1A 3AICA 1XISA 3P60A 5CAKA 3H6OA 1XCWA 1KBLA 4CN1A 1FWDC 2D0GA 4LVGA 3M6YA 1POKA 2WQPA 2OLSA 1XPGA 1QHOA 2B7PA 2HPMA 3KZPA 3W87A 1DIOA 4MVAA 3P7YA 3A5FA 5REQA 1KLYA 4ALDA 4W8AA 4Z1AA 1V3JA 2ZUWA 5EMUA 3BLEA 3ZLGA 1K3UA 5FD0A 4M6QA 4OUIA 4LGXA 5I09A 4JXCA 4HVXA 4UMCA 1KR1A 4IG2B 4CNUA 1XRSA 1Q4WA 2NLYA 4MTVA 3THCA 5H6HA 1TMHA 3K5XA 4I5RA 1HJVA 3VCNA 2B31A 5H8MA 3TC6A 2OODA 1IEXA 4LCRA 1GZ1A 2AQVA 1IXOA 3QY8A 3BAXA 2P53A 1Q2SA 3M0ZA 3L4XA 3R2GA 1QBAA 2ZRZA 3S6TA 2GQ9A 4HNUA 5D9NA 4ACYA 5JH2A 4MJ2A 2VZVA 5AC5A 2VNCA 3BGAA 3OU8A 4CCZA 1G7UA 4R85A 3GLCA 4PRRA 4NXKA 3CPUA 1HP4A 4PB3A 3AHTA 3EWXA 1QXLA 3SECA 5DT5A 2GJLA 1FWNA 4X2PA 2P8CA 3MCMA 4M1RA 2WOQA 1SR9A 4A29A 3LPGA 2Z0IA 4I9JA 3GC4A 2NQ9A 2PCQA 2QCEA 4FXJA 1OM0A 3V7PA 2BG5A 4PB5A 3TVAA 8XIMA 1BVNP 1EKOA 4ZSTA 5HINA 3W01A 2J79A 3ITGA 1DBTA 3RN6A 4S3BA 3W29A 3F4VA 3QW4B 3QMTA 3HPAA 1PV8A 2J88A 4J3TA 3VNJA 1US2A 4EPKA 4KH2A 9XIMA 4AMAA 3Q45A 3WKZA 5LIWX 4PRWA 4GHRA 1LRNA 4US5A 2VCBA 3LCHA 3QKEA 4ZFMA 1QTWA 3RIKA 2YL5A 1JFHA 3CMFA 1H3GA 1LF1A 3AXXA 3OOQA 3U7BA 4PUJA 2WMIB 4UQDA 3LZ5A 2A0NA 2FTYA 2GDQA 3AQUA 2VZOA 4IH3A 1UR2A 2YXOA 4HQVA 3NQ8A 2Y63A 1OCQA 5AZ0A 4P8XA 3K46A 4S38A 2BVTA 1GOMA 2ZADA 2DV0A 2OO6A 3ZYZA 1J0IA 2YFOA 3ATYA 5A8OA 5FL1A 2EG7A 3ABRA 4PMVA 3W7IA 4DBUA 1U5VA 1TQJA 3B8DA 3S2JA 3WH9A 5E0KA 3EMZA 3F7JA 1HGWA 4F9DA 2CWNA 1W3HA 3QFWA 1WDRA 4TUFA 3PFMA 2QGYA 4FOKA 3G24A 1H0GA 1JDEA 1E1FA 3M0KA 3R11A 1FH8A 1BLIA 2RJHA 5FJTA 2I14A 3POHA 5F2IA 3T55A 4DNHA 1LRTA 1EWDA 1VBHA 1AVAA 2YFNA 1I8JA 4FR6A 7A3HA 2OOGA 4URIA 3EWUA 2QJMA 3MPGA 2D3NA 3GO2A 2QAPA 1YEYA 5AHFA 3UNDA 3LXAA 1HKMA 3TONA 3JW7A 1SUXA 2GUYA 1AH0A 3Q2DA 3UPMA 4IICA 1EEPA 2WJDA 4Q7IA 5LNSA 4G1NA 2OO0A 4LUTB 3WQVA 4HTYA 1KM4A 3VNZA 3W3OA 2ZXBA 2GGEA 5DRIA 2CEQA 2XGBA 5LNRA 2C0AA 3PM6A 1J10A 4MSSA 1XLBA 3JS3A 4S1FA 2V9DA 4XD3A 4DQWA 3U3HA 5HNRA 1ZB5A 3FJ6A 1Q85A 1LCOA 4EKJA 4L1WA 3AMKA 3CHDA 1GUVA 2VFHA 4OTKA 4O0KA 4AD5A 4M81A 3SIMA 4WD0A 1F07A 3W70A 4N7QA 3BSHA 3CV1A 3FYPA 1PHQA 2CZFA 3DFTA 3KCOA 1LUCA 1NP0A 3WF2A 2D23A 1E5JA 5LHFA 1R6WA 4HK7A 3U2EA 4G9PA 1FX6A 3N29A 1EXPA 2CLHA 4YWIA 1LDCA 1NDWA 4ZSUA 2QVNA 2EO7A 4BY3A 3P74A 4UQCA 2QDGA 5A6KA 1UASA 1ICQA 2DZPA 3KRBA 1X39A 3M9YA 2DJLA 2Q09A 4UTUA 3FEQA 1V6XA 2YA0A 1V3IA 1OD8A 5TIMA 3LTPA 3TFXA 3GTNA 3W7OA 3ONBA 1FCVA 1G7VA 5CJMA 5T91A 5H2ZA 3GXMA 4NP7A 5JVLA 3CZ8A 3AMLA 3MY9A 3O6AA 2ZZ5A 4IIDA 5FJOA 1A49A 4MIMA 5LA0A 3EOUA 1QWGA 2P0OA 2XUCA 1CB7B 3PJTA 3H2OA 3LLDA 2PRMA 4AY1A 1MFVA 1QCWA 5M03A 3VGDA 4KGLA 4R5EA 4DPPA 1RH9A 1GPWA 4QEEA 3TN4A 4I8YA 4QBXA 3B9AA 3CHEA 4AH7A 3DI0A 1SPQA 1SSGA 4V2XA 5DT7A 2FHCA 2CIPA 3SCUA 2XSXA 3QOKA 4UQEA 1QI0A 3LX9A 3UPBA 3CT2A 4KFOA 1MEHA 4HHHA 2DQWA 2E40A 3O7UA 4YNGA 2D0FA 3WD1A 2FIQA 3BMVA 4AIUA 1BRLA 2P5NA 4IJCA 5G5IA 2OPJA 2ZA3A 1GJUA 5HMDA 3WD3A 3EPNA 1OFPA 4NU7A 4IJBA 2VX7A 2BS9A 4HIBA 4OV4A 2E67A 1QW9A 2VGBA 1IE7C 3OGSA 3NG3A 3EWCA 1TPUA 4W8BA 4F9JA 1JDAA 5D03A 3LOTA 4JTRA 5AHEA 1XSJA 3LCIA 4X0NA 3SY5A 3TYEA 4XB3A 2NSXA 1LOQA 3BW3A 2PWEA 1DXIA 4PGLA 2SFPA 1XYBA 4HA1A 1EXBA 2QYGA 5E09A 5FOOA 3BDKA 4HHPA 2WVTA 4XZHA 3GRIA 4K39A 1ZSXA 2FGZA 1E6NA 3TAKA 1Y8BA 4WRHA 3VX1A 1BFNA 3KBNA 1V6TA 4E0CA 1BKSA 4QJ1A 3MBDA 4P8WA 3AIUA 3CAQA 3S3GA 1ZHAA 3AIBA 4W5UA 1G6CA 3MV01 1HVXA 2NUYA 5D4YA 3UF9A 5CPNA 3N2BA 2ZXDA 3E5BA 4U3CA 1W9XA 2E77A 1IV8A 4OKDA 1B0IA 1PCWA 2DSWA 3E12A 4FLQA 4GIRA 1KBBA 2NQZA 2J13A 3WH7A 3TNOA 3GX9A 3L0NA 1HTIA 2OZ3A 3KWSA 2XDFA 2A7PA 4JD4A 1YDNA 2YW4A 4EP8C 1GOWA 3GNPA 1DXFA 3EPOA 4UXDA 2NV1A 4GXMA 1DJYA 4LXFA 1MW2A 1FP8A 3M41A 3G1RA 2TSYA 1N55A 3DFPA 2DZUA 2BGSA 3G2GA 5DMNA 4WDUA 3RAOA 1SFJA 2GL5A 2VRKA 3AXKA 2J24A 3WNPA 1KTNA 4HZ6A 2A2IA 6PTDA 2ESCA 1AZ1A 1KXTA 2YXXA 3IJLA 3ZVIA 2EPMX 4WSKA 3PZNA 2GZXA 1P0BA 4UZUA 2XSAA 1B3OA 3UJRA 4YVXA 4HMCA 3PZVA 2EPHA 1VPXA 4I3GA 5K4XA 4F0SA 5KZMA 3FS2A 3QKZA 5AVNA 2E5CA 5HOSA 1EO7A 1W3TA 3CMGA 1O5KA 4XD5A 1G0CA 4N9EA 1WZAA 3E2RA 1EB3A 3K8MA 1M01A 1XX1A 4FX7A 2JF7A 3V1PA 3UWWA 5AC8A 4GKLA 4MNKA 2DUXA 2F6UA 5F4SA 2ISVA 1EZ2A 3PUOA 3P67A 1J0KA 3VGFA 1WB0A 1XLKA 3B8WA 4YLWA 1WXJA 4J27A 4NL1A 1R3VA 1XGEA 5DANA 3UZXA 1PCKA 2VFGA 1XBYA 3QC0A 1VEPA 1ECEA 3FSUA 2IS7A 4A3RA 2EF9A 1UP2A 2FHFA 2ZX6A 3UT0A 3MKKA 5A2BA 4ZVJA 4E2OA 3GU1A 4GC3A 4INFA 4MDPA 2ZX5A 3PPGA 3WFAA 2H3DA 4I7UA 4QFUA 1M04A 3CLWA 2YKKA 4UTWA 4JEJA 1HG3A 3WQ5A 4XWUA 4ZOAA 1OCBA 1VHNA 3H7VA 1A5LC 1S38A 2D2OA 5CGQA 3G8RA 1XBZA 4GO9A 2FPYA 1T6MA 1AG1O 3LSCA 4MY9A 4FI4A 1BD0A 4RV8A 1SQ7A 2Y7EA 2E25A 1L2UA 2UZ9A 2IXVA 3OZYA 1D2KA 3VIOA 1DWIM 2BHYA 1FCBA 5D09A 5C5YA 4GXPA 3UA3A 4CD5A 3CM4A 2Q8LA 2RGLA 3Q65A 4B3KA 1E1CA 4HJWA 1NWTA 4LEFA 4U3AA 5ECUA 3IJDA 1XIDA 4QS6A 1W9DM 1S2CA 1VCVA 5JH1A 5AYXA 4H04A 5TQLA 4GI9A 5ABHA 1H1ZA 2V5JA 3CV6A 1E1CB 2C0HA 1JI1A 2FFCA 3KCJA 4IPJA 2DZAA 3I4KA 3SUTA 2FMOA 1HN1A 1XCFA 3NXFA 3S4TA 2G5WA 1BTMA 3TLLA 4GGHA 1L6SA 2ZRXA 4RUBA 4XKYA 1UH4A 4ZA0A 3UYCA 3H4XA 2DSUA 2YCKX 3BWWA 3EDDA 2E9MA 4F40A 3UG4A 3PHAA 3CQ0A 1LL6A 4J28A 1RBAA 3KOXA 2BASA 1ZZMA 3F03K 3A13A 1H09A 3ARYA 3VNDA 4UOZA 3QBUA 3BO9A 1CENA 4HD5A 2ISWA 3SO7A 3HQNA 4UFJA 3SFKA 3OZOA 5FCZA 4MFEA 5FJJA 5D8WA 4GYPA 3WDQA 1SFSA 1OC5A 4GNKB 2XGZA 1G4TA 5A2AA 3VUSA 3GNRA 3N2MA 1TQXA 3AUOA 1SZGA 4IWWA 2E6YA 3BJTA 2WQDA 1GPFA 3T08A 3V0UA 3GNDA 3RGTA 4LF1A 4ZTYA 2WWDA 5CSRA 1VLIA 1TX2A 3BSGA 1IXNA 4R7JA 3N04A 1UOKA 1FFRA 2QV5A 2QV4A 3ABSA 2ACRA 2ALRA 3AMCA 3RO6A 3FAWA 4AAJA 3BLIA 3P8IA 2PZ0A 3CJPA 1LT7A 1LTDA 4K8HA 2PF0A 3DAQA 4QNWA 2YLLA 2YA1A 1A5SA 3QLDA 5C54A 2VFIA 2CXEA 1SZNA 1VFLA 3UY7A 2W66A 1PKLA 3E0LA 4BF5A 1Q8JA 5IBXA 4IISA 1UPMB 5I3GA 3PZOA 4XZWA 2ZZ3A 4Z2LA 4M3PA 2JK2A 3IV3A 3LEPA 3DC8A 3OLEA 4HJFA 5IOBA 4ZQOA 2QCDB 4Z17A 2QW5A 1LL4A 3IEBA 1XC6A 4I7VA 3W07A 3W22A 3GHSA 3TTQA 3F5KA 2BOEX 1UZ4A 1TV2A 5A95A 3MVIA 4B5TA 3W1UA 1TSIA 1FWRA 1FQ0A 1JCTA 1DVJA 1F9CA 2PDJA 4ADSA 4MLRA 4D1JA 3O0KA 4HPHA 4D2JA 4NQ1A 4IMAA 5HWJA 1OF8A 3KDOA 1UP0A 4DF0A 3KVKA 1J0JA 3U2ZA 1MVYA 4HMNA 1HXJA 4HPNA 5CH9A 3FYYA 3H55A 3AOFA 4E6MA 3BSMA 1NP2A 1AW1A 1XH2A 1EIXA 1ZS2A 1AZ2A 3HM7A 3KBVA 3M16A 4IIHA 4ZL1A 5LNVA 3L67A 4DIAA 1Q4NX 4DUXA 4IIFA 3OODA 1ONWA 2J7EA 1MW3A 5CGTA 5AKQA 2YYTA 1DWGM 4AVNA 1LG2A 4UBPC 1G69A 2X30A 1K4GA 3G1SA 5C6MA 3W7DA 1LROA 4RX0A 4MNJA 4DJDA 3N6QA 3S9YA 4MY8A 3VGGA 4L9YA 1PJ9A 1FXQA 1QO2A 3BV7A 3QQ0A 1JNEA 1ITUA 3W23A 4WX2A 3N9SA 1MYRA 1EF2A 3CAKA 3EKZA 3EXRA 1ICSA 1DP0A 4MYXA 2XVNA 5G2IA 5HNTA 4RW3A 4Z2IA 2XINA 4LANA 4EF8A 2PBGA 1Q65A 4AU0A 1G4SA 1UUQA 3TROA 5EMKA 4NZ5A 5A1AA 4NVTA 3ID7A 2QS8A 3TN5A 3A24A 4NX5A 4M80A 5E0CA 1LWIA 1DOSA 3BCDA 3VU2A 3BW2A 2WWCA 1LQAA 2Z28A 1SO6A 3LHUA 4EE9A 2I16A 3VGHA 3DC0A 3H23A 3KBSA 2YYUA 3DFQA 2WC7A 3VOCA 4DO5A 2D22A 4ZENA 3TA6A 4H8UA 1B4KA 3TU9A 1UP3A 1QO5A 3STFA 2PI6A 4PA8A 1GKRA 2CHRA 1BGGA 3DUGA 2XIBA 3SN0A 4AD2A 1M03A 5CG7A 3MWCA 4LS0A 1NM9A 2HCVA 3RDKA 3LSBA 1XI3A 1V79A 1YXCA 2PRLA 3CIWA 3MBFA 3APYA 3ITYA 2QUMA 3M64A 3GG7A 5PTDA 3QM3A 1EJWC 1V7AA 4B90A 4XBJA 1CXIA 5J04A 3I6RA 1VYPX 4US5D 5FSEC 4AY8A 4ACZB 9CGTA 1XG4A 4MGGA 4TTGA 4MLJA 1WP6A 4NT0A 1TZZA 3RO8A 3SGUA 5E9XA 4HPXA 3O2LA 4A4AA 4G7FA 4DYEA 3RX4A 4DJFA 3BZGA 2V2HA 2ZX8A 5IFTA 3M0HA 1BHGA 3P93A 4M5PA 1XL9A 1UH2A 3M5ZA 4TX8A 5AC7A 4NF7A 1W37A 1F3EA 2ZA1A 3IPWA 2PTYA 1DJXA 1E43A 2ZX9A 4DNMA 1A5MC 3RG6A 2BWGA 4AF0A 4YTTA 3SUSA 5C9WA 2X1IA 2OYKA 2QCLA 3MB9A 4LALA 4UOQA 2WMGA 4DAFA 2J7CA 3R5EA 1OABA 4YCOA 4AF0B 3KTCA 3P80A 3OG2A 3FVMA 3JZUA 3ABOA 1XIGA 2R94A 3VAVA 4F0MA 1K6WA 3BANA 2YDRA 3GU2A 3W02A 4K6AA 4HU0A 4O11A 3S6DA 2Y7FA 3VD9A 2FDMA 4K2SA 3FFSA 4MY1A 4XBSA 3RRXA 4MWAE 3S1WA 1VIZA 3KVJA 1YDVA 3NQDA 1MSSA 3DBNA 2PAJA 2G97A 3EAUA 3VTRA 1GG0A 4E2BA 3S42A 3JRKA 2UV8G 2WXDM 1NAL1 3VDGA 2DH2A 1EA0A 1MQQA 2W9MA 2IXUA 3TWAA 1C92A 2WJFA 1XD1A 2FZ9A 4HA0A 2D1ZA 4JIQA 1ECQA 1TIWA 1L9WA 3SB0A 3CZGA 5T8GA 1ZP3A 5G1YA 4NJIA 4MWAA 1V6VA 4PBEA 1P6CA 2ZXAA 4O50A 2VGFA 1E51A 3APTA 2YCLB 1U2YA 3E0VA 5H1WA 3FXGA 2OX4A 4FX6M 2A79A 7XIMA 4HNCA 4HHLA 1RY8A 4WZHA 4EK7A 1S46A 1R3QA 2WHLA 4L1XA 3ITXA 3W4RA 2PC8A 3UXIA 3TWBA 1F7BA 2GUBA 1A47A 2WLYA 5IFPA 2EG8A 1YX1A 4DO7A 4DZIA 1VZWA 1ZALA 3WQCA 5F1UA 4LYQA 4B91A 1QPOA 1VH7A 1UWQA 3B8IA 3O05A 1VBUA 2W67A 3T44A 4REQA 1FFQA 4MFDA 2PMQA 4DXXA 2I56A 2XN0A 5DCBA 4C7DA 3GHTA 5JIWA 1ML1A 3GUGA 4QITA 3UG5A 3VOGA 1YDYA 3LXCA 3B40A 5CC6A 3MUAA 3MU7A 1K9EA 3GC2A 4WDWA 1XLHA 3NSNA 4IOTA 1JYWA 2VCAA 4XZMX 4ZQPA 4FNUA 4Z0JA 3EGJA 2PLJA 4UC5A 1ZBVA 1X7IA 2ZYFA 3WELA 3SUWA 3KCLA 3WN6A 4O1AA 1ALDA 3T0TA 2UBPC 4Y2WA 5CGMA 3G18A 1GORA 3L2IA 2CLMA 1QDSA 3PR2A 2VX4A 3WLRA 4K8GA 4BQ3A 4FSAA 4PULA 2QCGA 2OJPA 3G0UA 4O8AA 1JDCA 1V3LA 1W2VA 4NJKA 4HBKA 3W2LA 3W81A 1V6WA 2YZ5A 2WNNA 3GFYA 3C86A 4BI7A 5A8GA 3TOYA 1XIMA 2WC3A 2YA2A 2HMCA 2PTDA 1AQFA 4LS2A 2EXOA 4NZJA 1HKIA 4JQ1A 4XO6A 1JD9A 4QG9A 4U2ZA 1I2NA 1AQMA 1XR2A 2FZMA 3QR0A 4LAKA 4N42A 3DGRA 1DE6A 1S5NA 3S5ZA 3OBKA 4UCFA 1B3WA 1Z42A 1TPDA 2QUUA 5EFDA 2PDFA 3BAYA 4AZGA 1GOKA 4DO6A 1V6YA 1D3CA 5AY7A 3OGVA 1IT0A 1MXSA 2E8ZA 3B9DA 4V27A 3QW3A 1EHNA 1UHVA 3AIVA 5FSDC 1EF3A 1WKDA 1JPKA 3WMCA 4M7TA 2CZDA 4RZ4A 2ZZ7A 4XAGA 3S8HA 3RU6A 4UTIA 1DIKA 1XRVA 4GCAA 5A8PA 1RSCA 2DT0A 4HNNA 2QCMA 3O63A 3A64A 5A5WA 5ABEA 3PP7A 1XH0A 2J78A 1GZJA 1Q7MA 4ZGYA 4LWWA 1OHLA 1H5YA 3L23A 1IF2A 2YL9A 5F4WA 1DWFM 4NZ1A 3VNLA 1T96A 4EACA 3W73A 1JNDA 1DJGA 4MUPA 3N3MA 8A3HA 5A6AA 5HANA 1J6PA 1FWWA 3M44A 1E4NA 2Z6IA 4JIEA 1RCQA 4UUIA 4LYRA 3H22A 5FAGA 1T40A 3H70A 5D02A 1VS1A 4PFMA 2QJIA 2PTWA 3CUFA 2A3EA 3GC5A 4JQ4A 2D3LA 2OWXA 1BG9A 2WVSA 3M0VA 4AEOA 3B8VA 1JCLA 1OG0A 4HTBA 1IWAA 2HK1A 1KM6A 2ZDRA 4IL0A 4D1IA 1SM9A 5M3WA 4GJ1A 3FV9A 3S1UA 5BW6A 3A22A 5G1MA 3N19B 3ZFHA 1OYBA 3BCJA 5I24A 4GD0A 3MS8A 1GQLA 3DFNA 3DHUA 1JAKA 3S5OA 4MMWA 3ZVHB 3E5PA 3QYQA 1F6YA 4JAWA 3G1AA 3I7SA 3GTFA 2NW0A 3E0WA 4HZMA 3W2UA 3L66A 4DUWA 4L80A 1CLKA 2FGBA 3TLQA 3GXIA 3NQMA 3S5NA 4E2VA 1JYNA 3FY1A 1TELA 3G3MA 5AYZA 4PBFA 2EPOA 2VEGA 2RGMA 3WLJA 1Q45A 3SQSA 3F5JA 3S5YA 1V5XA 4DN1A 1PXGA 4CNOA 3U7VA 2EKGA 1FHDA 4MM1A 4B9YA 1XG3A 1E9LA 4S3JA 2DVTA 1G9HA 3BLFA 1KKRA 3AUJA 2RUSA 4MB1A 3H2NA 3HU7A 3MZ2A 1T7LA 3MT1A 3CHFA 5CBIA 1MMFA 1GVQA 1FVPA 4QS5A 1I4NA 5IDIA 1TV4A 2AQWA 1CBGA 2Z1BA 5I00A 2XG9A 5DELA 1YADA 2Y0FA 5CPMA 4A3HA 3AS0A 3TIMA 4D8AA 3UR7A 4RE0A 3W71A 2IKHA 4KS0A 5FKYA 1MDLA 2BY0A 5DCDA 1ZCCA 2VFDA 1O4UA 1A4MA 2PDCA 1KRAC 2NT0A 1W1PA 4TV6A 2Z1SA 4XZIA 3LBCA 1I1XA 4HPJA 6XIAA 5DXYA 3W7MA 3LPPA 3NQ2A 4C1NB 5A8NA 1KFLA 4L65A 1J9YA 4H6EA 4I9AA 4PMDA 2C1GA 3W1MA 4YXGA 4CGTA 1P1XA 4K3ZA 4QQ3A 1IZJA 1XYAA 3A4AA 3HB9A 1NY1A 4ZE4A 3QZ6A 3ZIZA 4QG6A 4NI3A 1EP3A 4U31A 5KZDA 4HA3A 2GLKA 3W2MA 2BY3A 4PC8A 2OQHA 3CMJA 4A2SA 3WH8A 1UZ1A 4OU1A 1BVWA 2IQTA 1DPMA 3MUXA 1JCJA 1P7TA 2OZ8A 3DYPA 5XIAA 4LUSA 4L9XA 3SURA 4Q33A 1WUEA 2ACUA 1KFWA 3GUWA 3GFXA 3ENLA 2PDHA 1YKWA 4X9YA 5D2WA 4AX6A 1VR6A 4NKCA 4LCSA 3T0DA 4LUSB 4UNLA 3GDMA 2ZVRA 2GJXA 4O4WA 4M0XA 1BF6A 2B4GA 4RLIA 2XM1A 2PU0A 1SMAA 4Q8PA 4AISA 4PZVA 1YXDA 2PRHA 4HMEA 3OVGA 4CCDA 3QQ1A 3QV7A 2DIJA 1XYLA 1XIJA 3GVWA 3GIQA 3A3XA 4UMBA 2W79A 3DU0A 3VOHA 4YU1A 3H4WA 3ES8A 3OBEA 2AAAA 3T1GA 3PWGA 1DQWA 1HX0A 2VELA 4S39A 2WSYA 2WKJA 5ABTA 1YE6A 2GQ3A 4LY8A 4DY1A 4JCMA 2DZTA 5FI8A 1JCNA 4LC8A 2HXTA 3S1VA 2MANA 2VC9A 4LT9A 4PUMA 1E9YB 2FLIA 3W53A 2ZICA 3MSRA 2DP3A 3KP0A 2D2GA 3UFYA 2JQXA 3PUGA 3L0GA 1DHPA 2OKTA 2RDUA 3RLUA 3EDKA 4O12A 3G0SA 4KF1A 1ONXA 3IANA 3WNMA 1RAKA 1UWRA 3N1AA 4L56A 3ONCA 4PR4A 5FJUA 3EX6A 2HNHA 2Y70A 4AD1A 1Y5WA 4J3VA 1IGSA 1V08A 3MANA 2X2YA 4BI6A 3EEGA 3IJIA 3MSGA 1VAHA 3DG6A 3A9BA 4CLMA 3BG5A 1U33A 4UTFA 3BARA 1O6IA 2YB1A 2ZXQA 1RD5A 3GIYA 3MYOA 4JDYA 2FPTA 1XLGA 1GEHA 2BOGX 3O06A 5J5RA 4JEQA 1UUMA 1KM3A 1PTDA 3WDRA 3ZM8A 2GOUA 1W0MA 2OWCA 2V2DA 2V68A 3IJQA 3TQKA 2PDGA 4MPKA 4HCLA 1FHUA 2J8GA 3IWPA 3TW6A 4HOZA 2QAFA 1THFD 3T0CA 4ZZ9A 2ZRUA 4YJ5A 1MW0A 5F1VA 3QTPA 1XD0A 4F2TA 2E0PA 2GQAA 5B7ZA 4FF5A 3TEVA 3VCRA 3VOJA 1RHCA 3R7MA 3WD4A 3NPUA 1PO9A 3FHAA 3NM3A 3MHGA 1WZLA 3AS3A 4NAEA 3UJ2A 3VVGA 3B0UX 5DX7A 4YCPA 3EDEA 3GQYA 4Q4RA 4IMEA 3A4WA 4A3UA 4P7QA 5DQPA 2UWFA 4QGCA 1EUAA 3PVFA 1KR0A 4BEQA 2V30A 3OPSA 3TZNA 4UFMA 1GEQA 1MWOA 4RDVA 4GYKA 3LV5A 3IUHA 5I3KA 2V5DA 4DJDD 5FF2A 4JTKA 4XIMA 2A7NA 2B7QA 1XCXA 1CGVA 1UD2A 3PY2A 1IZKA 1AK5A 4LB3A 3WUBA 1RBOB 4DWDA 1D9EA 3SCRA 4ZMGA 4MNMA 1GYLA 1VFMA 3LU2A 1S2WA 1GT8A 1RQBA 1AA1B 2X1SA 1VQTA 3C8FA 4ZB5A 1D7KA 3C2YA 1VKFA 1OB0A 3R94A 1HW6A 4PMRA 4XKMA 2Q8ZA 3A3WA 3REQA 7REQA 4NAFB 4G56A 2O4QA 4AYGA 1JRCA 1TMLA 2VEMA 1L8NA 1ADOA 2J47A 3IVUA 3GM8A 4NJHA 5HMEA 2E8YA 1I9CB 1RZMA 4U5IA 1ZCOA 1S1RA 1XXXA 4WQ6A 5DF0A 1EJSC 3C5QA 3ARVA 3RR1A 5E0FA 2HWGA 4H00A 4HYVA 1J0YA 3S46A 4B2DA 4U28A 4HMDA 2O0TA 4NI8A 3OO2A 3WLPA 4J3XA 3WF0A 2CZ5A 4HNVA 4AY7A 3CEUA 4PSRA 4LBRA 1JGIA 5KINA 4ORMA 4BF7A 1XPYA 2ZC1A 2OLHA 5FF3A 3OLGA 6TAAA 1SR0A 1JZ5A 2ADAA 3GU9A 3WCZA 4KWUA 4IUGA 3IGUA 1XW8A 3II1A 4DJFD 1LOLA 4IQDA 1JGMA 3PB0A 3IJ8A 4XZLX 4GO8A 4Q8WA 2J25A 1GW1A 2ACSA 1HZYA 4X22A 2NVCA 4GIYA 1REQA 4E2DA 4IX0A 3NXLA 5CSSA 4BR1A 2XH2A 4CVUA 1EBGA 3C2FA 3RYSA 1GVRA 1QI4A 2PFHA 1A4LA 3WK3A 1M65A 2OG9A 3TAOA 4Q8NA 3SADA 2DW7A 4P7RA 1RLCL 2FGLA 5HATA 1E5NA 4QCFA 1MNSA 2ZCGA 4EPDC 3HQPA 3UJEA 4XVDA 5CBBA 4UZSA 4NY2A 4UTWC 4Q6JA 4GISA 2REQA 4JY9A 3B8UA 1PZ1A 2O56A 4FEZA 4DBSA 3G1XA 2HV5A 2O9RA 4BKNA 3W2NA 1U5JA 3R0UA 2REQB 4AHPA 1HKWA 1DORA 1XKYA 3UG8A 3NQGA 1Z32X 1AL8A 2HTMA 2F2KA 1TO3A 3L7RA 3QF0A 4DF2A 1CT5A 1GYNA 4H1ZA 4D6EA 5T9CE 2YOCA 3RPDA 4IMGA 4KEZA 3DFSA 1O68A 1ZJHA 3PJUA 4K38A 1EHAA 1MEIA 1XKJA 1SVDA 4AHOA 5AFDA 4G8TA 3OP2A 3OQEA 2P8BA 4E3VA 1HL2A 3CYJA 3ELFA 4JX5A 3MJMA 4LEQA 3TYAA 3GK0A 1BYAA 3ANVA 3OVPA 1B30A 2XIJA 1HFBA 4Q8OA 4KETA 4MWAD 4YTRA 3NZQA 4UTLA 3T2PA 1EPVA 1KGWA 2Z6JA 5IXEA 1O1ZA 5EBUA 5HR7A 1H5VA 4PSPA 1D3GA 1LBMA 4LX4A 4AXNA 1XQLA 1R47A 3F1QA 1SSDA 3HO8A 3MI3A 4Q7BA 3RU8X 4KCTA 5HPOA 3CHCA 1QNRA 3FJ4A 3OYZA 1XGDA 2GK1B 2FZBA 3RILA 3NPXA 1CXEA 4FMVA 2YL6A 3IVTA 4AD3A 4ZXOA 2GDVA 5CEWA 5I78A 1NDYA 3MP3A 2NXIA 2Y8UA 3VIHA 3BGGA 2G3NA 3MO4A 2WZTA 3AS1A 1OIMA 3GWQA 3NDOA 4R33A 2RKXA 3UWZA 3BAKA 1J0HA 4Z2KA 3PUEA 1UD8A 3GDTA 3EWDA 4P8VA 4QRNA 3RLHA 1SZEA 3HQOA 3N2XA 3ARSA 4XZ9A 5HULA 4C1KA 4IL2A 4OBRA 3TH6A 2PTZA 4ZBCA 1V0KA 3WJYA 4D6FA 1DTNA 1ZAIA 5D04C 2W92A 1Q6GA 3SN4A 2VGIA 1G94A 4XIAA 3QPEA 4H9YA 2DJXA 3C6CA 2VDIA 4H83A 3OA3A 1U30A 3SUUA 1BWKA 4KWSA 1CGWA 2XVPA 3ZT7A 1BYCA 4E8CA 3ZJ6A 1PBGA 2OGJA 2VVNA 1B2YA 1R3SA 4NZCA 2VOTA 4C6JA 4E3TA 4U33A 4RE4A 1EJUC 4F2BA 3GS6A 2HBXA 3WQEA 2XISA 3P61A 2OT1A 3DEQA 3WQPA 4XBKA 4A35A 1K6AA 1MFUA 5F4XA 1S2AA 3P82A 2RHGA 1J01A 2A3AA 3WNOA 4ASTA 1X1NA 1GW9A 2A3BA 1KLZA 4LRSA 3NO3A 4Q8VA 3H26A 3TA9A 2YGYA 3FK4A 2Y5JA 2RH9A 1SO3A 4Y7EA 1EEXA 2DIEA 4AYSA 1WOAA 3HG3A 4D72A 1WDQA 2DSZA 4WHBA 2XIIA 3N2CA 2J7HA 2F6XA 2HS6A 2C79A 4QM1A 5CKSA 4A8RA 5D9PA 1VB9A 4PL2A 3G5EA 4UOJA 4BQ5A 4DO4A 1JUKA 1TVLA 1J79A 1GKPA 1VFOA 8TIMA 3HG2A 1K1DA 3QYSA 1BVZA 3S1GA 4JNZA 1Q3NA 1XIIA 3OJGA 3W38A 3PULA 1OINA 3CZEA 3AC0A 1G4EA 3K4AA 4OIFA 4DJDC 2Z24A 3KBJA 4Q3MA 1O12A 1JZ2A 3OQ8A 5HWMA 1XC4A 2Q3RA 3GNNA 4JFWA 4ERIA 1GHSA 3TC3A 4LBSA 4S2BA 5E1QA 4C7FA 3EYPA 4GUFA 4J5NA 4MKVA 3IGSA 3N34A 2D24A 4HOXA 4HHMA 4GI6A 5C9RA 3MZNA 3PTDA 3V75A 3WFLA 5F2LA 3N13A 3QPZA 3WNKA 4GCXA 4N02A 3TUUA 4L64A 4RDWA 4JDBA 1CI1A 1LORA 5H8UA 2EPNA 5D38A 1J0ZA 3M0JA 2GVYA 3L21A 1EP2A 2PP3A 4O0QA 1FBAA 3F4CA 3SCWA 2I5QA 1H1NA 1EOMA 1EJ7L 2P50A 2XIMA 4ATLA 3WQ8A 5KTLA 1VJSA 1ZRQA 1OK6A 4M6VA 2C7FA 1CIUA 5A8QA 2QDDA 4FNSA 5BRPA 1U83A 3CQJA 4HT3A 5BYWA 1V3MA 5AN7A 2Z2BA 1EA9C 1JZ6A 1R8LA 1ISYA 1UB3A 2WK2A 2QGHA 5I0DA 2QKFA 1ADSA 4EWND 4J2PA 5D30A 3CO4A 3VKJA 5IM51 1H4PA 3YPIA 3BUVA 2Z2AA 4O1CA 1XIBA 1GKQA 2FZ8A 3MUIA 1TV3A 1ZJIA 4Q4SA 5F2MA 3RPTA 3WSUA 2FH8A 2GVLA 4Q32A 4YTQA 5U7SA 4YTUA 5GNZA 3MSDA 1NQ6A 3MHUA 3H2CA 3VPLA 3HGOA 3CUIA 1H62A 2INFA 1X7FA 5KMYA 1SFTA 3NQFA 4LTSA 1R0MA 5DBTA 1RPKA 2VD9A 1NQKA 3WQ6A 5CZSA 5BMWA 4OJYA 2BHZA 1X8CA 4PMUA 2PD5A 4TTUA 3HV9A 5HXMA 3GAKA 3WBEA 2X0HA 4CU6A 4WJ8A 2WANA 1T8QA 3SCPA 4KT2A 5BXPA 2ZZ4A 5FACA 3S47A 4J2MA 3I4EA 1TKKA 4EIVA 1RR2A 3GG8A 1C9DA 3BAJA 5AOUA 4AWTA 4G2DA 3N6HA 4ERGA 4J3ZA 1X8FA 1DL3A 1JVNA 2ISSA 4JQAA 4W87A 4WF7A 1TV5A 3BLOA 2PGEA 4WSJA 5FEZA 4AZCB 1K8CA 1W31A 4HK6A 1IEWA 3CGTA 4XV0A 4XVEA 4Q8MA 1FDJA 1PUDA 4B4HA 2WKLA 3PWAA 2FMNA 3EBVA 5D32A 5ECVA 1JXKA 3LZ3A 4Y9AA 4PYSA 1H51A 1EP1A 3BQ6A 3FVDA 1GTEA 1ITXA 1F61A 1JJKA 4LB4A 3W85A 6A3HA 2UY2A 5A6MA 1F76A 4GUJA 1TPWA 3AJ7A 3GXNA 3OZPA 1Z7AA 2WVVA 1N8WA 1QHZA 4Q6XA 1MDRA 2WZEA 2E1DA 3ZWTA 5CJ5A 4CEXC 3LM3A 3VNKA 1XBVA 1AUSL 3UPWA 3R0DA 2D69A 3LV6A 4IPLA 4DXKA 3W84A 1VFTA 1QNQA 1SJAA 2C1IA 4EANA 1UC5A 1Z44A 1K9FA 2V81A 1NOUA 2XFYA 3C3UA 2Y24A 4OHQA 5HMFA 4XTDA 2XH4A 1QK2A 1QHPA 3CUXA 3V1HA 1NFPA 3M07A 3N17A 2PE4A 2CKSA 4HZ8A 1AD1A 2DSVA 4HU8A 1D8WA 4YHGA 3LBMA 3URQA 5MKGA 4K68A 4Z08A 4LCQA 1JPIA 3CS2A 4O16A 4A6GA 2PU1A 7CGTA 3RFAA 1UR8A 2WNQA 3AXHA 1MQRA 5CPOA 1W1B1 2QCHA 3TX9A 2V5BA 1SW3A 2JKEA 1CGXA 2Y5EA 1B5TA 1TJ1A 1DQUA 2A1YA 3MV11 1WAWA 1I2RA 4C91A 4OOUA 4AZ5A 3UQNA 3KL3A 1TPFA 1KWKA 3QTGA 5I03A 3CLMA 4LAMA 2VEKA 5CC5A 4GIAA 1M7JA 2G3IA 3PN8A 4P8UA 4MNLA 1TR9A 5A2CA 1DQXA 1KGUA 3C2VA 3LNMA 2DVXA 1EDQA 3K1DA 4TMBA 2NXHA 3M0IA 3WH6A 4H8NA 3TTOA 3AZRA 4MF4A 2OT0A 3G0XA 4AQLA 4J40A 3P6LA 4XX6A 3SRKA 1WAUA 1LP6A 2XWEA 1OC7A 1XJBA 3D47A 1B3ZA 4KFNA 8RUCA 3BLKA 3PSVA 2PP0A 3HA1A 3GXFA 3SCQA 5A6TC 3CL8A 3U4AA 1C7SA 4ROPA 4M8UA 3R1ZA 5KITA 2GSJA 3VIJA 1JI2A 3DESA 4GFSA 1V8EA 3C2EA 4O52A 5JIPA 3DBPA 4RJEA 1E6RA 4J3UA 3TSBA 1DJNA 4JTQA 1V4YA 3S2NA 3R8GA 2ZDSA 1A3HA 1NU5A 5LSMA 3FW6A 7TIMA 4ZOCA 2WB5A 4N9DA 4P61A 3M47A 2CFFA 3ABZA 3VKBA 1UKSA 2DEPA 3SM0A 4JN6A 4MKSA 1YW1A 3WF4A 4UQBA 1TWIA 2QPSA 3NL5A 1OFDA 2FJUB 4QDWA 1W5NA 2BXZA 2ODOA 3W7QA 3ITLA 4CCEA 3WD0A 4AZIA 4LC6A 2VOMA 3RMEA 5C7VA 1XV8A 3VZZA 2PWFA 3WBAA 3H12A 3B9EA 4PTDA 4FOUA 4Q4QA 4KEMA 1TWWA 4X2RA 3SJ3A 4W86A 5HJYA 3UZYA 1ELSA 4WUIA 2GGJA 2ZUTA 3FX4A 4TVDA 1FWTA 2WBKA 3KWXA 1CECA 3M5VA 5RUBA 5LNUA 4V1YA 4JOMA 5CLWA 4W85A 1UW9A 1UBPC 1W9PA 2YLAA 1KTCA 2YW3A 2GOKA 1MXDA 4HSOA 5REQB 1JDFA 3NZ1A 3WDJA 3H54A 4LRTA 4GXWA 3JVAA 4LU0A 3NPVA 3AYTA 3NPWA 3SIZA 3RPMA 2IKGA 1US0A 2OYLA 4GQRA 2ACQA 3HIJA 5I77A 4QAIA 3PAOA 1M9HA 1X6NA 5LA2A 3F5LA 4GRSA 1ZLPA 3HPXA 3OIHA 4B2DD 2X09A 2WMHA 1SYTA 3CH0A 1B9BA 1ZGDA 4PTNA 3NFUA 2PTXA 4S3EA 3EWBX 4MPQA 2WV8A 1HJUA 1XDLA 2WPBA 2V5CA 4KCWA 1W1VA 4H3DA 4CKQA 1BQGA 3HGJA 3TTYA 2J9YA 3SQLA 4F8XA 1M6JA 4H9XA 3I7QA 4HSHA 4D6JA 2BY2A 4N6FA 3WQ4A 3WX7A 1V0NA 2J6XA 1L8PA 1ZY9A 1UA3A 3BTNA 4GZ7A 4XAYA 1AL7A 1IR2A 2F38A 5ABFA 1VBJA 1QNOA 2G37A 1OBAA 2RAGA 1TPC1 2EAWA 4CN6A 1A5KC 1JD7A 1PZ0A 4CNSA 1OCNA 2O7SA 4IPPA 4IFKA 1SJCA 3AMGA 3M5XA 2PGFA 1UC4A 5ABFB 3CL7A 2P88A 4JKKA 5ABGA 1GVEA 5KEZA 4RZBA 3CK5A 3ZQ9A 5AYIA 4RE3A 4RKAA 2IPJA 3BG3A 4QCEA 4P2VA 3V18A 1BEUA 3PBVA 2BX7A 4QEHA 5H91A 4FXRA 4DAIA 1GJWA 1U1UA 1IEQA 1F8IA 4GVFA 4DXVA 2ATMA 2WMKA 3KE0A 3VINA 3BZJA 4UQAA 2F84A 3BXWA 3NURA 1TWDA 4JKLA 5CSYA 3NR0A 1IZCA 1GWJA 3SRDA 1ODZA 3R13A 4FXFA 3SCOA 2Q01A 1ZBCA 1IR1A 4QAWA 4RCXA 3VKKA 1WUFA 3LRMA 3VE7A 4CQAA 2WSKA 3UGVA 2OKOA 3OW1A 3MMTA 3TSDA 2ZOXA 3KZSA 1XYMA 3PJXA 2F6KA 1XLIA 3B4UA 3ECQA 2DT3A 4ATWA 1Y7VA 2CLKA 2ABAA 5HUPA 2PWUA 4XZBA 4RNHA 4E38A 4IGHA 9RUBA 3C52A 1GYMA 3MVTA 4M19A 3VA8A 4N4QA 5M2FX 1HO4A 3N18A 3AS2A 2DORA 3P84A 3AO0A 4QDPA 1OFEA 4Y9OA 3H2EA 4DI9A 4C6CA 3I3EA 1X96A 4UIOA 3KOZA 1IXPA 1R2SA 2YXGA 3KLKA 1VLWA 4L4MA 2W63A 1ZQ5A 4Y9PA 3DG3A 2QCCA 1NJJA 2QF7A 4LAUA 4FZIA 3IRSA 1EZWA 5E93A 4K36A 1GZGA 2OSYA 5EA9A 1V3KA 3W1QA 2OYMA 3NSMA 3NOEA 1CNVA 3RF9A 3KVLA 4MKNA 2XWDA 1EC8A 5HNNA 2BTMA 3D0CA 3DCPA 4GKTA 3RM4A 5I79A 1P0EA 2HVMA 3UR8A 1XF0A 3Q94A 3UD6A 4UNKA 6XIMA 3S2CA 1VBGA 4EVZA 1Q6QA 3GR8A 5I2UA 1AQHA 1A3WA 3LHVA 3I68A 4O1DA 3UVAA 1TREA 1PPIA 5HJLA 3E74A 1EPXA 3D46A 5ENLA 3TXVA 2O9OA 1LUCB 4C65A 3QR1A 3FSTA 2J8TA 1H63A 1KKOA 4IXXA 4JX6A 3OEXA 4BFAA 2F7FA 3FJNA 1LOSA 1DEDA 2HRWA 5T26A 2GJPA 4UTTC 3PZMA 3CQHA 5M1TA 1LJYA 1OJXA 4Z1CA 2CZVA 3GZ3A 5BWFA 1G01A 5DCEA 1UD6A 3NQVA 2XN2A 1WZMA 1JEZA 4NG3A 1W1ZA 1XP3A 1VJIA 3QV9A 3PG8A 4JBRA 4PMYA 4GZJA 5AC6A 1RK6A 4M56A 3GIPA 1VD6A 1LG1A 2R6OA 3CZKA 1FWCC 4FX8A 1B3VA 4MADA 4Q8QA 1E72M 1O5QA 4AD4A 3HJZA 1XLMA 4NZ3A 4CUCA 1KW1A 3O07A 1JL8A 3FEMA 3ZSSA 3HF3A 1KFJA 3K4DA 3N73A 5F7UA 3IV8A 2J9XA 1Q2RA 4GLEA 4PTWA 5JBDA 3C0LA 2GJNA 1Q13A 3ITOA 1CPUA 1P6BA 1HF6A 4AZ7A 1A50A 2GWNA 5U4NA 3AYRA 3STGA 3SEPA 3VDHA 3OYXA 4HN4A 2WNWA 4O17A 3IACA 3QGAC 3S6OA 2Q3OA 3G3DA 4EXBA 2Z4GA 4AEFA 3O6YX 5BU9A 2GGIA 2PD9A 4W4QA 1BRLB 2VENA 5K7JA 4DJEC 1W3KA 1UZHA 2CLOA 4C6QA 3CNYA 4Q22A 3PTMA 4MDOA 3BAIA 3V5OA 1E56A 2TODA 3P0WA 1E4IA 2VDGA 5I7GA 4W88A 1A80A 2CLEA 1W5PA 2FB2A 1BPLB 1I45A 3HOJA 4AG0A 1JZ3A 1GJPA 1ZP4A 4GI4A 1VPYA 4B16A 1JAEA 3CU2A 3UNTA 1CXFA 3OZMA 4GIEA 2NT1A 2VCCA 4J4KA 4R9OA 1W1YA 1XIEA 2C1HA 3O6CA 2WCSA 3G1DA 3UYIA 7TAAA 3COTA 4H6RA 1TX0A 3FA4A 3NNTA 5DY2A 2Y62A 1KQYA 1V93A 5C2CA 1U22A 2OSXA 5DMYA 3T40A 2C18A 5GJNA 3B04A 1R7OA 3CWHA 3EA1A 1XLJA 3KW3A 3VKCA 3I6EA 1OFOA 1EH9A 3PNUA 5LIUX 3VM7A 3VYLA 1LZOA 3AU6A 2PDNA 1H60A 3CV7A 4XUGA 5FL0A 2ATSA 2VL4A 1F6PA 4AWSA 5JBEA 4ERAA 2BSLA 3NDZA 2GPTA 1QOXA 1QNSA 3M5YA 4H6KA 3SAZA 3GE7A 5G1TA 3GG1A 5LGZA 2H8XA 4LUYA 1ITCA 1MO0A 4DZ5A 3NUKA 5CPTA 4IPIA 1PZ2A 1YRRA 3TZFA 3KP1A 4JKMA 3LRLA 2BY1A 1UIPA 4YIWA 4CU8A 1H11A 1QW7A 4NRRA 1O5RA 4JIPA 3RMJA 4DI8A 2I1OA 2W62A 3BVJA 3IIOA 4QHRA 1BYDA 3N2OA 1I75A 2IPFA 2H8ZA 4G5DA 1GG1A 4XSMA 4JNMA 1OY0A 4WEVX 4PB4A 3W86A 3HV8A 2BODX 3WJWA 3MMUA 1PYFA 4QE5A 2CERA 4RDZA 3QY6A 5TD4A 1J5SA 2JALA 4UCGA 3VDBA 3E6EA 1VRDA 2H9AA 4FS9A 2AMXA 1W1A1 3IJ6A 3K8KA 3GSMA 1WQ5A 1YPXA 3AHVA 3VIKA 2F2HA 4RW5A 1QATA 4OOZA 3M46A 1OFAA 1LLWA 3UBPC 1RCXB 1PZ3A 2H9AB 4E5TA 1UA7A 1JZ7A 1OFRA 2VP8A 2ZUSA 3MI6A 1RD6A 2X1RA 4QE4A 1ZJBA 1H7WA 3EEZA 5DN1A 2CHNA 4B5SA 3GVRA 2JGQA 1JPMA 1NOWA 1SO4A 2XFWA 1NEYA 2G4JA 2VX6A 2GWGA 7PTDA 3BPWA 4JHOA 3UXDA 2VO5A 2BXVA 2WM0A 1ADDA 2E9LA 1DTUA 3WO8A 3P81A 5HA7A 1FP9A 5CC3A 2ZZ1A 2IKIA 3E2SA 3KHJA 3LCLA 3LHYA 3GKFA 3WJSA 5A6BA 2QCNA 1P0KA 1KM0A 2RDTA 3MUZ1 1HJSA 4WLCA 2C13A 2NVAA 3TMLA 3FKRA 3FOKA 1LBLA 2P0IA 1V7YA 4TX9A 2OOFA 1TV8A 2BV9A 1Z9AA 1ISWA 1DXEA 2VURA 3CT7A 3W7HA 4AWUA 3V5FA 3NVDA 4L5ZA 2D20A 5HMSA 1UD4A 4K7VA 1KFKA 1MZRA 2DZSA 3H53A 3LHTA 3G22A 5A8MA 3OA5A 3PWIA 4O10A 1TJRA 3EWZA 1BWVA 4OECA 1UMYA 5MHBA 3VC5A 1UR9A 2KX9A 3B97A 4L61A 3W27A 6REQA 1VPQA 2QZRA 4JTJA 3IIPA 4PUNA 5AVHA 2WJZA 5D8ZA 2PDYA 4DWSC 2NV9A 2E3ZA 2JBMA 3TOPA 4Q8UA 3GR7A 5GPRA 4IPNB 5JXQA 5AHLA 3VD7A 3TYZA 3O15A 2OQLA 5IRPA 3HMCA 3W26A 2HJPA 1ISXA 5AC4A 3UWEA 1KA9F 5DRCA 1OYAA 4MZ8A 1HVQA 3S1XA 2A5HA 4D8LA 1UWTA 1MNZA 1H7OA 3F2CA 1F4AA 4AWEA 4D6CA 1H0IA 1H7NA 4ZQMA 1S1PA 4S2CA 1HQTA 4I7WA 3TV8A 1M7PA 4A2RA 3V35A 2R14A 3WUFA 4JTAA 4HYWA 5L6UA 3NCOA 1X98A 4NJGA 2VGGA 2AL2A 4XKYB 4CQCA 1VRXA 2YPIA 4PCTA 2W6RA 4D9PA 1VFUA 1D7FA 1DWAM 1A5NC 1E6XM 4LS1A 4UR9A 3KBWA 3VZYA 2OMAA 2E68A 3T0BA 4JGDA 1QPQA 4WSHA 1EGZA 1OWQA 2XFRA 3KFTA 3DENA 3E2QA 5C55A 3GVVA 1EWEA 2JFEX 2GUUA 1E73M 3L4WA 2IQ0A 2OEJA 4TU1A 3BCFA 3RX3A 2FHBA 4D6HA 4RNFA 3GTHA 4PTMA 5LHEA 2YCEA 2NUWA 2QMKA 5CZKA 1LM1A 3EOEA 5FF7A 3WK1A 2VC6A 2VX5A 3AALA 4NYUA 4EF9A 2CBVA 4C1LA 3R79A 4IQJA 5C2GA 4H01A 4H7ZA 1KGXA 2AGKA 2WYSA 3ZLHA 4E4FA 3GTIA 3CPRA 3GBEA 2HQAA 1FDZA 4HGXA 4BEUA 5E6YA 1NDZA 4X63A 1Q63A 5KETA 3UWQA 2MUCA 1LQ2A 2DU2A 5D05A 1FHVA 3UCQA 3ABXA 3MYPA 1KB3A 4H9UA 4F3HA 3V3WA 4JTUA 1N8FA 2OSWA 3UXAA 3R12A 3U8GA 1PX8A 2VI0A 1ITQA 3B3DA 2BDQA 1EGVA 3TR2A 3TYUA 5FJPA 2OZTA 2AL1A 3A12A 1VEMA 4MZ1A 3NIYA 3UR5A 4AVOA 5LGXA 4OZOA 3GG0A 1RPXA 2QEZA 3E9AA 1CWYA 1KXVA 3DERA 4EOUA 4IQEA 3KOFA 4J35A 1CW2A 3AJXA 3NQ7A 2X41A 5JQ9A 3UEQA 3MDUA 2JE8A 3ITTA 2VC7A 3G1YA 2WHMA 3ZT5A 3N14A 2O92A 4C6IA 4ILSA 4O53A 4X3ZA 4NNBA 3RK8A 5JBFA 4X60A 3THQA 1JDDA 4JN7A 2V5KA 1TE1A 2O9TA 4KRZA 4O1FA 4GBUA 4C90A 1W9VA 3IIZA 1KV5A 1M68A 1O95A 5CJNA 4JL1A 3W83A 4G7EA 3NEVA 1LL7A 1CEOA 4JFTA 1VFSA 2WM1A 5BCAA 3UR2A 4Z1BA 4YVPA 2D2HA 5EB8A 4QIUA 1KCKA 4G7EB 2ZVIA 2DQXA 5I02A 3VD3A 1B4EA 1TCMA 2TPSA 1W54A 5T9BG 2P76A 2HBVA 3GH4A 4GI8A 1TA3A 1AMKA 2X0YA 4H2HA 3WK0A 2IPGA 5CLTA 4EAMA 2WSQA 4W7WA 3GYEA 3P3BA 3T78A 1YQ2A 1EJTC 3DKJA 4MOZA 4QNEA 2TYSA 3VO0A 1BSIA 1TTPA 3TJ4A 3MMDA 2PP1A 3VZXA 5GQBA 2GVJA 2VUNA 2WC4A 2CWXA 4GVGA 1PEZA 3WQWA 2JIEA 2YBUA 1DJWA 4PEKA 1QPNA 4Q4MA 1JUEA 4Q7NA 3GXDA 1K8ZA 2UY4A 3O3RA 3MJYA 4YWSA 1A3XA 3KDNA 1GVFA 1OX6A 3O0FA 3SBFA 3K13A 3E0IA 3EB2A 2IUZA 1FCUA 3LXBA 4CN4A 4CNPA 2PWVA 1WKEA 2DZVA 3C61A 2E5DA 2CYGA 1OX4A 4FLRA 5LIKX 3ZT6A 4S3DA 3VABA 1B3YA 3DIPA 1FKWA 1L6FA 4YL2A 3IAPA 2IW0A 2R24A 2Q02A 1FA2A 5CQ1A 2QPXA 3PZGA 5I5RA 4ZQNA 1XQKA 3MUY1 3OLIA 4AC1X 1R9YA 3WLTA 3TN3A 1ZTVA 1R46A 1XBXA 5IHRA 2Z7GA 1U1JA 3NSXA 1JQXA 4GE8A 4TO8A 4HCDA 4A8NA 3VGEA 5BXRA 1UMLA 4FAMA 3W74A 4I6VA 4K1WA 2BB0A 4LNCA 4RK8A 2PUZA 4AHQA 3LD5A 3SRFA 2GGHA 4PBGA 2OGYA 7ODCA 2VUYA 5BROA 3DZ1A 2FKPA 1NF0A 4LY4A 2Y6ZA 4RXGA 3LCWA 4GGBA 5JMUA 2E4TA 1S2TA 2QJJA 4N2YA 3VM5A 4R7WA 1XICA 2JF6A 1XUZA 1UJQA 5EU9A 4O57A 2AOSA 5XINA 5EMMA 4M1BA 3K4WA 3VXGA 3P0XA 3WLOA 1TJ2A 3LA4A 1R3YA 4M6PA 3EOSA 1EIBA 3PC0A 2ZUVA 1XLCA 1RA5A 4W8LA 3W25A 2J7BA 3TYCA 1E0WA 1AJ2A 1CB2A 2PDQA 4DZHA 5KZEA 3N2TA 1NWRA 1F3WA 2EG6A 4C60A 4NZFA 4PL1A 5E6ZA 1W5OA 4S3CA 4ZODA 2YX0A 3PPCA 4IG2A 3G77A 3G1HA 5AECA 2BVWA 2BFGA 2ZFAA 5HQEA 1RUSA 4DVOA 2VFFA 2TAAA 3QSRA 3LENA 3ZR5A 1TG7A 2TRSA 3R8HA 1E40A 3CEPA 2HEJA 2WAGA 4C5ZA 1RCOB 2WSRA 2VD8A 5HPCA 1HKJA 4J1OA 1KFBA 2PDMA 1QPKA 4LUIA 1ZAHA 4RDYA 3LDVA 3PBMA 3KL0A 5FAJA 4J3WA 2QPUA 1W6TA 5G4WA 4JTFA 4GQQA 3CAWA 4NZ4A 4UB9A 2XVLA 2X16A 3MO7A 3EB4A 3TXZA 3TW7A 1AD4A 3IUIA 4GUHA 4XTIA 5EGRA 3NYZA 3T9PA 3GXTA 1PWMA 1CGYA 4DLMA 2NWRA 3DFOA 1TR1A 2FZNA 2HE5A 3GVQA 4R53A 3T07A 1TRDA 2P3EA 1PE1A 4S3AA 4FP1A 1UQYA 5CXPA 4MZYA 1VFHA 1WDDA 1HP5A 1O94A 4YN5A 1ZAJA 1QASA 4LAOA 4MWAB 1QUMA 5C8BB 4V15A 1XSKA 3M6DA 4I9MA 3VC6A 1P43A 5GJPA 4KFPA 3ARWA 2CPUA 1UZDA 3VMOA 5K9XA 3T42A 1L6WA 1ZPTA 3MA8A 4GQGA 1EC7A 2OLAA 2Y85A 3AHYA 2VHLA 2WMIA 4GNJA 3L4TA 1XS2A 3WG6A 1XLLA 2X2GA 1RQEA 4B5WA 1UD3A 2QMJA 4E4PA 4R3UA 1ME8A 3T7VA 3UETA 3L4UA 1JXJA 3LI0A 1NFGA 1SFLA 3C0SA 3EX3A 2O9PA 5I3DA 5CCZA 4JS3A 4NJJA 5JUVA 3K2GA 3WLMA 3PZUA 3XISA 3TYDA 2VC5A 4L6OA 3KM8A 4REQB 1KNWA 3PUDA 3VMNA 3B8TA 3GNOA 4PCFA 2X7VA 5IHSA 1P48A 4EXQA 4XAZA 4RNJA 4JQ2A 4BK9A 3P2VA 3MKVA 4I5XA 2WLZA 3ALGA 2ICSA 3DECA 2Z1WA 1WV2A 5I3JA 1VCFA 1C29A 4IGMA 4MG4A 2WJEA 3B03A 3NQ6A 3CB8A 2PGRA 3W7KA 3WNLA 5K4ZA 4FHAA 1F3XA 4R27A 4HK5A 3L0KA 3UY8A 1X6UA 4A3YA 3LQGA 3G6LA 1FWJC 4YS1A 3Q37A 4LUTA 1A5BA 2VWSA 1MEWA 5BOOA 2TMDA 3ANYA 2QHAA 3FDKA 4QSFA 2QT3A 1YIXA 3KVMA 1PIIA 4W89A 1K02A 4GX9A 1XINA 4LH8A 2FTPA 3V36A 1JF5A 4C6KA 2Q6ZA 3GD6A 4ZQCA 1E9IA 1OEPA 4GVHA 4OGZA 1TFVA 3DFHA 3XIMA 4N9CA 2HPIA 1JR1A 4WKHA 3V0SA 4BI5A 1BYBA 3P5ZA 3SCSA 4QTGA 2POZA 3EMQA 4XAFA 3RM8A 2PZNA 4R34A 4JHMA 2BGQA 1E0UA 3LGEA 1ICPA 1X1OA 3FJLA 3GKAA 3HFTA 4NX0A 4LAZA 3BV4A 1S2VA 4LV4A 3W00A 2HDJA 3LMZA 1F8MA 3CWNA 4UQ9A 2HE8A 1HT6A 4HNTA 2H90A 3O6DA 3BLPX 3R43A 4MHBA 4IIGA 2Y1HA 2I57A 1I6NA 4AMCA 1FTXA 3M43A 3N4EA 2DUZA 4EWJA 3NL3A 1MZHA 1H41A 1Y5VA 4JYDA 1P0NA 3M7SA 1RVGA 1W9BM 3VDCA 3R0KA 2CNCA 4K37A 1I0DA 4WXZA 4GZIA 3FYOA 2NUXA 3IARA 3GBDA 3TC7A 2FYMA 1YHTA 4J9JA 4RNIA 3TYBA 1J93A 1QI2A 3GH7A 3PZQA 4KWOA 2VQUA 1DE5A 2C8NA 1E15A 5A6SA 3S9IA 3NGJA 4DLFA 1W5MA 3LNPA 2AGTA 2XN1A 4DRSA 3S2LA 1KO0A 1YLVA 2EBNA 2BOFX 2OWWA 4DPQA 4LW7A 3TR9A 2F61A 5AHNA 4LVBA 2CU0A 1OZMA 3UWVA 2UY3A 2HNEA 3J7HA 1KM5A 1FOBA 4ES4A 3ARRA 4JFSA 3IK2A 1EGMA 3W7NA 1VGAA 1WBHA 2QIWA 1TVPA 5EMLA 3SQMA 3TJIA 4AW7A 5I3IA 4O13A 5D37A 2ASHA 2O4MA 1IEIA 4JZ5A 2WNZA 4S3KA 2AKMA 2C91A 4KEUA 4ZOEA 1KBKA 4HCHA 5CG0A 2C15A 4OV9A 2CLPA 5CBJA 4PMNA 1KWGA 2QF8A 3CXOA 3GHRA 4AIOA 2CLFA 2W0UA 2WVUA 4ZCWA 2XTKA 2ZA2A 4LVAA 1S5TA 1M41A 3H8AA 4L6HA 4S3GA 2Z27A 3L9CA 5I3HA 3UG3A 2J75A 4WK9A 2VJXA 2VR2A 4GPNA 4N9BA 2NX9A 4QX4A 1NARA 3JR2A 3LUTA 4WY0F 4R9XA 2VYOA 1ESWA 1H49A 5A6BD 3WLHA 3BJSA 3WLQA 2V38A 3BE7A 3N6JA 2J7GA 4JTLA 5CPSA 3WJZA 2YDAA 4QLLA 4KRUA 3W9ZA 2CESA 2VRJA 3NZRA 3UWYA 4OQVA 2X0SA 3NQBA 1DWHM 2ONEA 3U48A 1R87A 3TCEA 4HA4A 1QFEA 2CETA 3BK0A 1KTBA 4UTJA 3ARXA 4MUZA 1B90A 1E6ZA 2QJNA 4NUWA 4DF1A 3L5MA 1Q5MA 3CL6A 2XVGA 1J18A 4UTHA 5FESA 2Z25A 2FTWA 3WBWA 8CGTA 4JYEA 4XO7A 1ZU8A 4XUYA 4GH3A 3NWRA 2PA6A 1PIGA 1PTAA 3NTYA 1E0VA 3BAWA 3LHWA 5BOEA 1A0DA 2CLLA 1I2QA 1KM2A 3WDHA 2IKJA 5AHIA 5G2WA 4QXIA 4PODA 3AHXA 1B31A 2HS8A 1XH1A 1HJQA 4I6KA 3W1TA 1UWAA 3RRAA 1DJZA 3KLLA 1P7TB 5SWUA 5AB3A 1CLVA 1NWUA 4Z1YA 1JG9A 3QHNA 3U9IA 1TB3A 1V02E 3BQ5A 1JULA 3ZR6A 3QXBA 1PYMA 2QCFA 4CD6A 5K2ZA 3NEHA 4Q4PA 1IT7A 1ISVA 4GG9A 2GJXB 2H6RA 2XZ7A 3APGA 1S3TC 3NL2A 4FLSA 1NSJA 3A21A 3D3FA 2X42A 3ARPA 3IRDA 4H4IA 2R1MA 4FPSA 5KSWA 4ENLA 1J11A 3WBYA 5K9CA 1JZ4A 1K70A 1X38A 4QJ3B 4C6PA 4C6DA 1GHRA 3LCGA 1XLFA 1V02A 1T8XA 3W6LA 1YDOA 2Y5SA 1M7XA 3KUMA 3WF1A 3WMLA 1PVNA 2GJRA 4OFCA 3DG7A 4B3ZA 2V67A 4O1BA 4NRSA 5DO8A 1W5QA 2EPLX 1NWSA 2Z1VA 1HJXA 4YMZA 4JTDA 1Z69A 4O0ZA 4X61A 4BWLC 2NSOA 1DYSA 1J96A 1M53A 3AXMA 3EX1A 3OBAA 5D9MA 5EY5A 5AHMA 3HBLA 4WDTA 4UR8A 3ITVA 2INZA 4QQUA 1TPVA 3O9NA 1WDSA 3EX2A 3NZGA 3DDMA 5BZAA