3WQGA

D-threo-3-hydroxyaspartate dehydratase c353a mutant in the metal-free form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNHAAATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords D-threo-3-hydroxyaspartate dehydratase
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate
pubmed doi rcsb
source organism Delftia
total genus 143
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3wqgA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3wqgA02
3B8VA 2DY3A 5FACA 3CO8A 4LUSA 3WQDA 4BF5A 1EPVA 2SFPA 3NZPA 2VD9A 4BEQA 3E6EA 2RJGA 1SZRA 1TUFA 4DYJA 4KBXA 4LUSB 3N2BA 3N29A 5FAGA 3R79A 4ZGYA 3HURA 2QGHA 4BEUA 1QU4A 4ECLA 1SFTA 1HKVA 4ILSA 3AWNA 4DZAA 2YXXA 1KNWA 2RJHA 2NV9A 2P3EA 3S46A 2J66A 3C5QA 1L6FA 1B54A 4BHYA 1CT5A 2ODOA 4PB3A 1KO0A 4XBJA 3NZQA 4FS9A 2O0TA 3AWOA 3WQGA 3UW6A 4V15A 3KW3A 4A3QA 1NJJA 1XQKA 2OO0A 1L6GA 3VABA 4AIBA 3SY1A 5BWAA 1TWIA 2PLJA 2PLKA 3WQFA 2NVAA 3CPGA 4LUTB 3WQCA 1F3TA 3GWQA 3E5PA 3MT1A 5GJNA 3B8TA 1VFSA 2VD8A 1VFTA 1HKWA 2TODA 4Y2WA 3ANVA 1NIUA 1W8GA 3ANUA 5FAJA 3LLXA 5IRPA 4PB4A 5GJMA 1BD0A 4LUTA 3OO2A 1D7KA 3BTNA 4PB5A 2ON3A 1RCQA 3B8WA 1FTXA 5GJPA 1XFCA 1XQLA 1VFHA 3B8UA 7ODCA 4XG1A 4WR3A 3HA1A 3WQEA 4QHRA 4LUYA 3N2OA
chains in the Genus database with same CATH superfamily
4EXBA 2GSJA 2J8FA 2DT2A 3OG3A 2XFFA 3H2EA 1W56A 5D8WA 1F7BA 4I3GA 1QOXA 2FFCA 1LQ2A 3P8IA 3BAKA 4KPLA 3LD5A 4G7FA 7XIMA 1ZTVA 1AQFA 4DJDC 3T08A 4RCXA 3VNIA 3N3TA 5D2YA 4ILSA 4ZR8A 3VIHA 5CC7A 4IM4A 1K1DA 2EKGA 1Z3NA 2J24A 1FHLA 1R8LA 2TYSA 1Q6RA 4C91A 3HG3A 4CCCA 3TAKA 2Z00A 4LY8A 4NP7A 3NZQA 4O54A 4Q8MA 2YX0A 3GVVA 1IIGA 3CLWA 5XINA 4DF1A 5HMFA 4HPXA 1KRCC 4N42A 2OZ3A 1I1XA 3M0XA 4AD3A 3G22A 5TF0A 2I9UA 3BW3A 1ODZA 3MW7A 4QP0A 3FVMA 1E55A 1LOQA 1UMLA 3EWUA 1PL9A 2D20A 1V79A 2ZZ6A 4LYKA 4LUTA 1IR1A 9XIAA 4IIBA 3GAYA 2A85A 4LCRA 1XLAA 3N4EA 4MAZA 3E3HA 5CPMA 3ITYA 1RVGA 3DESA 2NW0A 3PTMA 2VEPA 3R7MA 3SRDA 2YCJA 4X60A 3H2CA 1E4IA 3ENLA 2CLMA 3R0UA 3W76A 5EKYA 2EHHA 1CGTA 3GU2A 2RGMA 4ADSA 4AZBA 1ISWA 1QO5A 1MEIA 3WQOA 4CN1A 4GPNA 3PBVA 2ZADA 2WJFA 4PUKA 2R1MA 4O0ZA 1PZ3A 4W89A 3GIYA 2I7GA 2YL9A 1K8YA 1XLMA 1JDAA 3BJFA 4R53A 3RU8X 2E1DA 5AHFA 1JZ6A 3BSGA 3RO6A 4GYJA 4WJXA 1OD0A 4BKNA 5CJNA 5C2GA 4MMWA 4MHBA 1W5QA 3PZVA 1GKRA 8XIAA 3GTHA 3WBXA 1A5CA 4RK8A 1OJXA 2OZ0A 5BWFA 2YSWA 4RDZA 1KKOA 1JUKA 2EXOA 3ICJA 4OUIA 3IGHX 1QCWA 5T8GA 1TV3A 1V77A 5LIKX 1C8YA 3SCVA 4JTTA 4XV0A 1QBAA 4WGHA 1HXJA 1T7LA 4H6RA 4YTRA 4LX4A 4BCEA 3TYDA 2E0PA 1NVMA 1XBVA 4AYSA 5JIPA 4M6QA 3LV6A 2G5WA 4KRZA 5LKYA 1ZSXA 4BF5A 3IK4A 1V4YA 2QCHA 2ZA1A 5I07A 4CKQA 3W6LA 1KFWA 4XSMA 1TUFA 3MZNA 1GVQA 3MJMA 4LAOA 4YU1A 4Z1DA 3K5XA 2BGQA 4P8VA 3VYLA 2CC0A 2QS8A 2WB5A 3M41A 4QAWA 1BRLA 4E38A 1Q63A 2WNNA 1TQJA 3CIXA 1MW1A 3VCRA 1VEOA 4AIOA 4L4MA 4FR1A 1ZGDA 3QMSA 4BY3A 4H04A 1RY8A 1OCJA 5IFPA 4NI3A 1FRBA 2JKPA 1GONA 3TN5A 2XSAA 3XIMA 2PDFA 4JFSA 4W7WA 4LEQA 2HBXA 2PGEA 2V5LA 5HPOA 2VGFA 2PU0A 2ZYFA 4JBRA 4REQB 5F4WA 4QDWA 2Q02A 3QTGA 4BFAA 1WDDA 3M0MA 1GOQA 1J93A 4EPEC 5DY3A 1CENA 4DJEC 2V3DA 3E74A 4Q4KA 3UZZA 1O1ZA 3QPYA 3AS0A 1EXPA 4XKMA 4YLWA 1R9YA 1UHVA 1VP5A 3W84A 3AIRA 1BFNA 3WD1A 3WD0A 2PDHA 3LERA 4XX6A 1MXSA 5C55A 3UXDA 1O6IA 4J2PA 4JHZA 2R1NA 2HK0A 1PXGA 1EQPA 3M44A 3LPFA 3S46A 3SCOA 2X16A 3SN0A 6TIMA 4DM2A 5LXXA 3EB4A 4GA8A 1QW8A 1C7TA 3LCWA 5F2LA 1R2RA 1CWYA 4LY4A 4FF5A 1JF5A 1EO7A 2C3ZA 1TUXA 3FY1A 3CUIA 1UC4A 5HMEA 1BTMA 4GK8A 1KRMA 4QG8A 3TV8A 2BG5A 3QH2A 4B90A 3VAVA 3WJSA 1N7KA 3GYEA 1XSJA 2Z1VA 4LYPA 1C8QA 2G3NA 2VD8A 3PUGA 4JDYA 3K4DA 4KFNA 4JDBA 3TOPA 3FA5A 4FLQA 4AVFA 5FJIA 4L4PA 1MO0A 1WV2A 1WCGA 5D2WA 4HSOA 3SN1A 4J40A 5KITA 1DTNA 3PJTA 4HK7A 4JIQA 4ZB2A 1IGSA 2V68A 2Y8KA 1ZRQA 2ASHA 4PUJA 3WEMA 1YRRA 3OHIA 4XG1A 1HF6A 3I3DA 1VFFA 3GK0A 1QNSA 3OBEA 3AU6A 1AW1A 2VD9A 3AJ7A 3MVTA 3SURA 4C6KA 4B9YA 3UVAA 2EJAA 2QCGA 3GBDA 3IAPA 2WJEA 4AIUA 3K8MA 4R7WA 2OT0A 4I7WA 1XLCA 3QY8A 1XUUA 3SUSA 4ERIA 4AG0A 1KXVA 2RJHA 4XSLA 2D69A 3ZM8A 2DU2A 4HBKA 4NZCA 1PKMA 4ERAA 1DWJM 4UQDA 1FCUA 4N6EA 1JPMA 4NZ5A 5ECVA 4ATDA 4O10A 3SZ8A 5FSDC 3LHTA 3VABA 4LNYA 3MMUA 3KBSA 2PWEA 3NQGA 3H2FA 3ZR6A 4C6CA 1PDYA 4FX7A 5BNKA 5C9RA 2HQAA 2CXEA 3CU2A 1W9UA 5K9CA 3H4XA 5E70A 4XZLX 2ZRVA 1DTUA 3ATYA 3IUHA 3MV11 4UZUA 1RBLA 3TX9A 2W6RA 2PZNA 3NPUA 4GGHA 4D72A 5T26A 1K9FA 5IBXC 4N02A 1SZNA 2BNJA 1OFOA 1IZCA 3IV8A 1HTIA 3ABQA 2PURA 3SCRA 1XD1A 3QRHA 3WLNA 3MY9A 3FYOA 3W38A 4DYJA 3ITLA 4WIWA 5K7JA 4FX8A 3AICA 2EF9A 2X1TA 3AUOA 3LLFA 1JF6A 1RY0A 1U5HA 3A5VA 5E9AA 1CGUA 4K6AA 1UD8A 5FEZA 3L67A 1ZBVA 1W0MA 2E5CA 2PBGA 3BSHA 4C6OA 2YXGA 5C9XA 4AHPA 4WVXA 1G5AA 5AOUA 2H8ZA 4Z08A 4EXAA 3S2NA 2BVYA 3T1GA 1GJUA 1YTKA 1RK5A 4R34A 4IOTA 2J88A 4IG2A 5DFAA 1EC9A 3SY1A 4MYAA 4O14A 1LYXA 2PP1A 1R86A 3FGCA 1Q8JA 2OCZA 1Z48A 1VBGA 4UTMA 3JUGA 3DH7A 1XPYA 4X2RA 3V3WA 1LBFA 1FWJC 1VFTA 2POZA 4FA3A 3WF2A 4PTDA 3J7HA 2NT0A 5AHMA 4DJDD 1MSSA 3EGJA 1KCKA 5FOOA 1F9CA 4MFEA 3VCCA 3LB0A 4DYEA 3S8HA 3WH7A 3W2JA 1VYSX 5F2MA 3A12A 1B3VA 1UBPC 3WQVA 1OZMA 5FJJA 1XIEA 4HPJA 4TXEA 3IVUA 3UVIA 1AL7A 1A49A 4S3KA 4YMZA 4TR9A 2XH4A 2E25A 1XBXA 3LZ5A 1X1NA 3TXZA 3AXIA 3LHWA 5D9PA 6ALDA 5C8BB 3PFMA 3LPGA 2X42A 4CNUA 5T9BG 4QDPA 1XH1A 1KTBA 1E9IA 3ONBA 4OHQA 3O16A 2G3IA 4QE4A 5M5DA 1IZKA 5I06A 2E9BA 1PDZA 4O57A 1EJSC 2DSUA 2OG9A 4YHGA 4NT0A 1VPXA 4NX5A 1HW6A 4GI8A 1M1BA 3M5YA 4QJ5B 3EOOA 4LVBA 1H7PA 3P5ZA 1NWUA 3GFXA 4MUPA 4MWAA 2Y62A 4J3SA 1XLDA 4X61A 1TRIA 3GDMA 4LOCA 3SCNA 4QSFA 1FKWA 3LRMA 2I57A 3ARYA 4TVDA 1KGXA 4HK6A 3CQHA 3GG1A 1IGWA 3R5EA 3UZWA 4MPQA 3V18A 3FA4A 3R0DA 3ANVA 3RMEA 3CC1A 4YTSA 2E9LA 2WBGA 2AOSA 3EAUA 3C4UA 3ME3A 4JQ1A 3NM1A 1KM3A 3UZYA 5LIUX 3H2NA 2IPGA 3I3BA 1W32A 2GDVA 4HHHA 2XFYA 1PPIA 4HQVA 1A5KC 5IOBA 4G1NA 4NAFB 5FACA 3THDA 2ONEA 3V1PA 5GNYA 1A0CA 1E6PA 4MTVA 1R85A 4K39A 3GC5A 3HGOA 1U5VA 3VI2A 3VIIA 4JNZA 1OFEA 4B4HA 4O17A 2PPGA 1MZRA 4H2HA 4HYWA 1XRSA 3WLTA 3W7LA 3TR9A 2PE4A 5A6BA 4WRHA 2CBIA 3KS6A 1MFVA 2WYSA 4MY8A 1W1A1 3EWYA 2W62A 1VD6A 2QCCA 2R14A 4F0HA 3R12A 1ZCCA 4N4QA 2PFHA 1OX4B 4GBUA 4V15A 1NM9A 1NP0A 4US5D 1A5UA 1R5YA 3DENA 2E5BA 4Z0SA 1DHPA 4RKAA 4GNJA 5D9MA 3HPXA 4GXMA 5A69A 4DI8A 4LALA 1AODA 3M07A 4S39A 4WXYA 4GABA 4Z2JA 4NZ4A 3W87A 3W6MA 1DWIM 1H7OA 3TSDA 4NKCA 4Q33A 3IRDA 1OFRA 3RX4A 2X1RA 1YW1A 3EXTA 3KVKA 2W63A 4KGJA 4MNLA 1XQLA 4QM1A 2QVHA 4DUOA 1DJYA 3H70A 1M41A 1QNVA 3SIZA 4EXQA 1KM2A 5D38A 3E5BA 3N9RA 2WW5A 1LLOA 2YL5A 2QF8A 3T42A 1QPQA 3BSMA 3P5YA 4H83A 4WSKA 4PL2A 4LGXA 4GLEA 1DL3A 4IUOA 1H50A 1PKNA 2ZZ7A 4RJEA 5D03A 5BXPA 4X3ZA 3O9NA 1LWIA 4OV4A 4M6UA 4L6HA 1NOUA 3WNLA 1HKVA 5A6KA 3LCGA 4A8NA 2J7HA 3L65A 2OEJA 4LVFA 4RDVA 4HZ7A 1LORA 4AISA 1UA3A 4C1KA 7TIMA 3DOPA 1XW8A 1WKFA 2FJUB 4IWWA 4EE9A 2YGYA 1WBJA 1CB7B 3UR8A 4DJED 2O7SA 1J6OA 1PVNA 4CVUA 3WUEA 4H9VA 2BS9A 3EPMA 1V3IA 2POTA 1WKDA 2BY0A 1E9ZB 5LNUA 3UZJA 1CIUA 1JZ2A 1OCBA 4Q8WA 1VYRA 2Q8XA 4W5UA 3CXOA 4UTHA 2P76A 1ITQA 1ZPTA 3L66A 4K3ZA 4Y9OA 3IJ6A 5HJLA 1QOQA 1W9PA 2D73A 3CJPA 1FWFC 2NUWA 1NWSA 2OLAA 3UXIA 2C19A 4S3BA 1OIFA 1VCVA 1QVBA 4YN5A 1NF7A 2BBFA 4EACA 1KW1A 3DFTA 4QDMA 3TCEA 3I3EA 5CGTA 4QNWA 3GDKA 3W1XA 3A4XA 3L2MA 3GTNA 4O28A 3R0KA 1Q7QA 1OM0A 4QITA 4EOUA 4I9AA 2NVDA 1FWDC 3OEXA 4OUEA 2ALDA 2I9EA 4O0KA 5ABGA 3S1UA 1GVSA 4D71A 3LK6A 4V33A 4Q6JA 3PN8A 1ZCOA 4IMCA 3GU1A 1B9BA 1A5SA 1OHLA 3KL0A 3QV6A 2DIEA 1EGVA 1Q65A 4UFIA 1EP2A 2E4TA 3RCMA 5AZ0A 2NQLA 2WCSA 1YLVA 3HGSA 5D2VA 3U7BA 4V28A 5HULA 3TJ4A 1GOOA 3MO7A 1H7WA 4GIEA 4IF2A 4CQAA 3NSXA 2HVOA 4UFHA 4L7ZA 4AD4A 2PLCA 6PTDA 1DXIA 2FB2A 2OYMA 1W91A 3L7RA 3GR7A 3PPFA 1JR1A 3LM7A 4GUFA 2CXGA 1DJXA 3DG3A 3QYQA 1MDLA 2OX4A 1PYFA 4U3CA 3WDHA 3B9DA 3WMSA 2PDNA 3F4VA 1JDEA 3EMQA 3BAIA 7REQA 4UNIA 3G8EA 2D24A 1VKFA 4ZOBA 4CD6A 1I0BA 5LNRA 1K03A 2X40A 3T2QA 2OELA 4D6IA 4TX8A 1PV8A 2VVSA 3V16A 3VD9A 3CPUA 5G5IA 1W3NA 2Y5SA 4EKJA 2F2HA 1UWRA 1OK6A 3VKDA 2AAAA 1ZY9A 4FIRA 1AZ2A 1O5RA 2E6FA 3WLQA 3KL3A 5FAGA 2YZ5A 2X05A 2XU2A 3TYUA 1TV2A 2ZVIA 2ACUA 5CZJA 3A21A 2VL4A 4P7NA 3GVRA 5JH1A 5FIPA 2XIMA 1AJ2A 1BVNP 2YDQA 1W3TA 4I7UA 2VNCA 2OSWA 1FUYA 4HJWA 2QCFA 5CPNA 2D2OA 4XVDA 4ICCX 3GNXA 1QJWA 1F74A 3IJ8A 1I60A 4CQDA 2VENA 3PWGA 4Y6GA 4UTUA 5I79A 3W73A 3G1RA 1NDYA 4AIBA 3U9IA 3GXFA 1W54A 3QR1A 1MW3A 4H7CA 1V08A 4IMGA 3VINA 3P62A 1F8MA 5I3IA 2G3JA 1ZB5A 2XZ7A 3EX1A 2FHCA 4AZ5A 3WLLA 2ALRA 3L0KA 4YIWA 4EIVA 4A22A 1Q6EA 1C8XA 3KZPA 5BU6A 1QXLA 2WMIB 4Y9MA 1EJWC 3B05A 1K9TA 4ZQCA 4G7EA 5A6AA 1S5TA 3V36A 3GBEA 2NWSA 2ISFA 2NQZA 4XUGA 1ZBKA 4UNLA 2XDFA 3S47A 4Q6XA 3TSBA 2FIQA 1XG4A 1DJNA 3LXCA 5FJPA 4OU1A 1GHSA 3T2PA 1IZJA 1GVOA 4LAUA 1QNPA 3W28A 2DH2A 3OW1A 1P43A 1SPQA 3VOCA 2PDPA 3MDUA 4ZO9A 2EAWA 1IEVA 3UPWA 3O6YX 3Q45A 1A3WA 3P14A 3T9PA 3BE7A 1OT1A 3UR7A 4X9YA 5A6TC 4JQ4A 2VO5A 3ERPA 4CEXC 2WSRA 5E93A 3BG9A 5KTLA 3DC8A 2V6AA 3TKFA 1FP9A 2HEJA 5LHEA 5G1YA 4K37A 2Y2WA 4LS2A 1LZOA 2YYUA 3MJYA 1R3RA 3ITXA 2J75A 1SMAA 3GU9A 4F2UA 5A94A 3ZMRA 1FWTA 3LENA 1VCGA 4AZCA 5EU9A 2OMAA 1J5SA 1TO3A 3NWRA 1XLBA 3WBAA 1F2JA 3S2JA 5J5DA 3RU6A 3N19B 4I7VA 4J2MA 4ZL1A 2DZTA 2EPMX 4XK2A 3VOFA 3ARSA 1C7SA 4L1GA 3TYEA 3E0WA 3VD7A 5FL1A 3TZFA 4CCDA 4QE5A 3CK5A 3U48A 4FALA 3ZLGA 5A2CA 1NQ6A 1XG3A 4H8VA 1RPKA 5A6JA 2O7QA 4UQBA 1SO6A 3WD4A 4LC8A 2OT1A 4LW7A 3JW7A 1ECQA 1T0OA 2V30A 1TREA 3NCOA 1OFAA 1E4NA 3CZKA 4U33A 4RV3A 1SQ7A 4DM1A 3HJZA 4LAKA 4NZJA 3MZ2A 3N4FA 2PSNA 1VLIA 2QJJA 4EANA 4HU8A 5MHBA 4PC8A 2VRJA 3NQ2A 1POKA 2P50A 5CZTA 4F0MA 4V1YA 3ZVHA 2R82A 2X7VA 2ANUA 4DWSB 1O60A 2C15A 2WCAA 3HG5A 1KM6A 3PPHA 3MDWA 1TPC1 1FWHC 1X97A 3P3BA 1AD1A 5A6MA 2DT3A 1HQTA 1EWDA 4H01A 3KOZA 1TZ9A 3HOJA 4Z42C 3HTWA 3TWAA 2QCMA 4TMBA 2XVPA 4UFLA 3AIUA 3FVDA 4Q7IA 1EJXC 4KFPA 2UY5A 3DHPA 4B16A 3EXRA 5LA1A 3BPWA 2RDTA 3SADA 1VFUA 1MMFA 4GZIA 2XG9A 2ZA3A 3JR2A 1YIXA 1WZKA 2BOGX 2O56A 3RMJA 3WENA 1VHCA 3GW3A 1YDNA 5B80A 3AYSA 2XPKA 4HCDA 2VZOA 4NASA 3H21A 1FWIC 4HD5A 1IV8A 4PTXA 2OOGA 2QDGA 1PTGA 4ZBCA 1A0EA 4IIDA 1GKPA 1AUSL 3W7MA 4N4PA 3AWNA 2X2GA 2ATSA 2FGLA 3WNKA 5HXMA 2VR5A 1IT0A 4LV4A 3I7QA 1XKJA 1SMDA 4NJGA 1AQMA 1K7XA 2VQTA 4UTIA 2WZHA 4YHEA 4U28A 1RVKA 3KHDA 1JULA 1KO0A 3CL7A 1HJSA 4MFDA 4AD1A 2UWFA 4WCJA 3LSBA 2DSKA 1L9WA 4Q8QA 2XFWA 1QATA 1PS9A 3H2AA 1V0LA 5GPRA 2PC8A 4JTIA 1EOKA 1EIBA 3QKEA 4PTWA 3W9ZA 2J62A 3TC7A 4KEZA 3BK0A 4O1BA 4HJFA 4HYRA 2Y8VA 5JH2A 4V2XA 3BMXA 3GQYA 2J9XA 4WLCA 1CXIA 2B7NA 1KKRA 2VXNA 2QPSA 1NELA 3CHFA 3L4ZA 3DBNA 3SJNA 3SSJA 2A21A 3PJUA 2PWGA 2VR2A 3ARXA 3INPA 4MPKA 3WNOA 1V93A 5HNTA 3CAVA 4PR4A 4O4VA 3MU7A 3CV1A 3L5LA 4HNTA 3RNDA 1SO5A 1RJQA 3G77A 1J11A 3ZSSA 1A5NC 1W6TA 4L80A 3TW7A 3PJWA 2ZX7A 1Q2RA 3F4WA 1GPWA 1A4LA 1CPUA 4RLIA 5F7UA 3THAA 4JN7A 3BLIA 1H7RA 4RE0A 4AMAA 5FSEC 4JX4A 3H55A 2VFGA 1P48A 1G67A 1VJZA 3K2GA 3DHUA 3UWWA 1US2A 2C71A 3SUTA 1E0VA 4K7VA 1KC7A 4QFUA 4B15A 2YCKX 3B04A 3PBYA 1W5PA 5I6SA 4AH7A 1O5KA 3B9AA 3NQCA 2WPGA 1WE5A 1UWTA 1OCQA 1XLFA 6TAAA 1P1XA 2FHFA 1XXXA 4HSNA 3BMVA 5E1QA 3T07A 1DHKA 2W27A 3V5CA 3ANYA 3N2CA 1REQB 1SSDA 1UR1A 5MKGB 2EG8A 3COTA 1LBMA 1P7TB 1EBGA 5CGQA 1Q7ZA 3WMBA 1YXDA 2YFOA 3B40A 1P6BA 3G6MA 2VRKA 1GWJA 5TD4A 3QW3A 4KH2A 5GJPA 1TB3A 2PTZA 1A5BA 1J10A 3PZMA 3I68A 3AIWA 3WL1A 2E7FA 2WPBA 4CQBA 3G24A 4EF9A 3HMJG 1XV8A 4INFA 2EO7A 3NIYA 1OT2A 3CH9A 4O0QA 2Z6IA 3ITVA 1ONEA 4HN8A 3U5YA 3TYCA 3DHFA 4IMFA 3UXKA 4ZO7A 2PZ0A 2WZMA 3RITA 4DX3A 4HA4A 4EPDC 1VJSA 1OFBA 3NQVA 2ZUUA 3KLLA 2WLZA 4QXIA 1V3KA 4W93A 5HUOA 1EXBA 4DYKA 3RDKA 4US5A 1D8CA 4DZIA 2EGZA 3KOXA 1ICPA 4BWLC 5JUVA 4N7QA 4I5RA 4W7UA 5BXTA 3HPFA 2ZUVA 4CN6A 3LV5A 4B5XA 3D3FA 5EBUA 3GD6A 1GKQA 1ENUA 1VLWA 4WJ8A 1VC4A 5LYRA 3KRZA 1ZLPA 3GTXA 3W1QA 2VZTA 1P0KA 3Q67A 2QJIA 1K4HA 5H8MA 1SGJA 4QG9A 5CBBA 4AZGA 2AGKA 4ACZB 4JY9A 1QDSA 3GRIA 2VI0A 4CVWA 1Q4WA 3LRLA 1RCQA 4W8LA 3OVGA 4BF9A 4LF1A 1EDTA 1VFHA 4QJ1A 1V0NA 1CGWA 2BOEX 3QBUA 4GYPC 3GZAA 2F9RA 3IGXA 1XDJA 1R9XA 1FDJA 1V0KA 4B3LA 4ZOEA 3GY1A 3C2RA 2J79A 5H8UA 2V5JA 3N2BA 4AEOA 3TVAA 3N2TA 1CGXA 3BAYA 3KBNA 4JHOA 3KOFA 2PB1A 1B3YA 3O0KA 3BW2A 2GVEA 3W2NA 1P4CA 5FEPA 4DJEA 1U1JA 2G96A 3WJZA 2XH2A 1G01A 3W1AA 4UMAA 4JD4A 2X41A 2IPFA 3OHMB 4JTDA 4Z0JA 3EMCA 4R7OA 4FIQA 4A8RA 3CTLA 2F61A 1OG0A 2CERA 4DVOA 5M3WA 2DIJA 4FOJA 3C0QA 2KX9A 1S46A 1MXGA 1D3GA 4F48A 1GVYA 2Z2UA 4LBSA 4E2BA 1JCYA 1TTQA 3H4WA 1EYWA 3BCDA 4D9PA 2B7PA 3WYZA 1WA3A 3TN3A 2ZX8A 1A5MC 5LA2A 4P8XA 5REQB 1UD5A 2J13A 2R1LA 1JZ8A 3E0FA 3VOGA 3QGKC 3R25A 3BQ6A 4R88A 2GJXB 4W88A 1OQFA 2YOCA 3GX9A 1XFCA 4MJ2A 3O63A 4P5UA 1UWAA 3B4UA 3LPOA 1Z8AA 4QR6A 4J3TA 3PPGA 3F7JA 1TE6A 3WQDA 3OLEA 3UG3A 1HKKA 1PB0A 2GWNA 5CAHA 5HANA 3QF0A 1K8XA 2INEA 2ZUNA 3BG3A 1JAKA 4DUXA 3DN5A 4LJ3A 2O92A 3WMLA 2BFGA 2FPTA 5DCDA 4AZHA 1NAL1 4PRWA 4DF0A 3UT0A 3W53A 1YYAA 3CWOX 2WSYA 1M7JA 4M7SA 1ZUAX 3DIPA 1OADA 2Z4GA 4LYQA 4XISA 3FXYA 1E56A 2GGJA 2WHKA 5DRCA 1XYAA 3TWBA 1RBAA 4H9MA 4GI6A 3H22A 2A3LA 5TBOA 2J7CA 4U2YA 3PWIA 3OZOA 2CHOA 2GUUA 2BVDA 3NTYA 4XAYA 3LPPA 4W7VA 4KIEA 1E0WA 3W1NA 4L4LA 1WXYA 1HP4A 2QF7A 1F3WA 3BAJA 3R2GA 1XF0A 1US0A 3RGTA 3UBPC 4YJ5A 3FJLA 5FKYA 2PP0A 3NYZA 5I3JA 4HA3A 1WOBA 1AH0A 1H1ZA 2A79A 3B0PA 1E6SM 3QPZA 1NDWA 4PBFA 3WQEA 3VNMA 1GVRA 2VGBA 3G1XA 2A5HA 2BXVA 4IPNB 5AYZA 1GVEA 3M0ZA 2EQDA 4HN4A 4NILA 5C2CA 3CO4A 3VK5A 1LOLA 3NVDA 2NX1A 2ZRZA 2PBOA 3EXSA 4PBEA 1KBBA 4PMDA 2PCEA 4N2YA 1WDPA 7ENLA 4YWSA 4ECLA 1M65A 3QR3A 1SM9A 2Y63A 3SUWA 3HMCA 4NI8A 2AMGA 4PMVA 4IPIA 4OE7A 1WXZA 4AC7C 1B3XA 4K8EA 3GHTA 1WDQA 2OVLA 3VFCA 1NARA 4OVXA 5IBXA 1LUCB 2A3HA 3GYCA 4AEFA 3B4YA 3O6DA 3BLDA 2TRSA 1BG9A 3CYJA 4F8XA 2Q6ZA 4H1ZA 1LRQA 3UG8A 5AC6A 2XISA 4XIMA 3B03A 2H9AB 4LRTA 1HJUA 3OGRA 5U7SA 1K6AA 4WKAA 1M04A 3CAKA 3DI1A 5E9XA 1H1YA 3UETA 1DORA 4JQ3A 1DYSA 2FLIA 4Z2GA 4BA0A 3W7JA 1UA7A 3F5JA 4MYXA 1RALA 1YBQB 3PG9A 1V3MA 1NFPA 5FCZA 5DXXA 1FTXA 1JFHA 1ISYA 2ZDRA 2PP3A 3GXMA 1KTCA 3PNUA 1L8PA 3URNA 4HT3A 2REQB 4LH8A 2HV5A 3IUDA 4UTTA 2UBPC 2IXUA 2PTDA 3TE9A 2C14A 4IH3A 1B4EA 1QPRA 5G2HA 5DT5A 2WMIA 2EPLX 5E0CA 1XRVA 4RV8A 2VWSA 4QEHA 1HP5A 1O66A 3FS2A 3FKKA 3T0DA 2PEVA 2H3DA 4LSBA 4GVGA 1JYNA 3WQ5A 4HA1A 2G4FA 4ADTA 3U6WA 3GG7A 2NQHA 5H2ZA 2VEMA 4MSSA 4JAWA 1CZ1A 1Q6QA 4NNBA 1A0DA 1I75A 3W37A 3QVQA 4B5WA 1XGDA 5DT7A 4PB3A 3UCQA 1MUMA 2D3NA 5T91A 4E2OA 4LU0A 2I16A 4KRTA 3O8AA 2O0TA 1BEUA 5KZMA 3H8AA 2E3ZA 2YFNA 1XP3A 4L1WA 5BXSA 1HVXA 4D6DA 1VF8A 1US3A 1H11A 4GZ7A 3VZYA 4HHPA 3VC5A 5E6ZA 4DLFA 1JYXA 3ZSTA 4PULA 4Y2WA 4JR5A 3ZO9A 4MWAC 4OV9A 4Q7NA 4PCPA 1MW0A 3IIXA 3RM4A 4JHMA 4IMDA 1BD0A 2C8NA 3M5VA 2WNZA 1FWNA 2HRWA 2PLMA 3PS7A 5F4XA 5CC3A 1J18A 3W00A 4JX6A 2X0HA 2GSHA 4LS0A 4A8LA 4C6JA 1K6WA 1UKPA 2L5HA 3N34A 5AYYA 1EH9A 5CPOA 3CT2A 3F2BA 3NGFA 4MZ8A 5HINA 1ADOA 5BZAA 1SSGA 3BL3A 3VD5A 1NOWA 2P8BA 3G18A 3AHXA 1CXLA 5D05A 1LCOA 3CGTA 3W25A 2G95A 3NSMA 5LNWA 4RE3A 3UJSA 4ZCWA 4O12A 2CIPA 1DIKA 4IJBA 3H2MA 3EB3A 3TJLA 1ZHAA 4C6LA 1ZQ5A 1HL2A 4JNYA 2HPIA 3DAQA 3PBWA 4FPSA 3B0UX 1B3OA 1I2NA 1KGUA 1QT1A 1IIHA 5EPDA 3DYOA 3E9AA 3OLDA 2GJLA 3CMFA 1TV8A 3R8HA 3BV7A 1G6CA 1F76A 4GJIA 3SBFA 1PEZA 4JTFA 4JYFA 4DZ5A 4Q4PA 1D3CA 1L2QA 1ODUA 4LXFA 3S1GA 1O1HA 3TONA 3WLPA 3XINA 1JRBA 1XC6A 5LIXX 5F1VA 1BQGA 1ZP3A 3QHNA 5CSSA 5HK4A 2DP3A 3ZIZA 1ITXA 1LWJA 1TZZA 1KXHA 4FZIA 2OSYA 3W7GA 1SFSA 3RM8A 1I2PA 4MOZA 1QRQA 1V6UA 2GVYA 3N2MA 5TQLA 4H9UA 4GZJA 1WB0A 4QE1A 3BOFA 1KBJA 3IACA 1W9DM 3BARA 3W01A 3OJGA 3EX3A 2YBUA 1MVYA 1V3HA 2P5NA 3DI0A 5FF2A 3M7WA 4P61A 3CIVA 4KWUA 4RZ4A 4A3HA 3FNDA 4IGHA 4AD2A 4ROPA 3FJ6A 3OVRA 3PUOA 4JTUA 2H90A 2NZLA 4D6CA 3V7PA 2DT0A 3P60A 3S1VA 2QDHA 3G2GA 2R1PA 1UH3A 2GOUA 1MDRA 3EWXA 4NVTA 1S5WA 1JPIA 1YE4A 5CPQA 2BV9A 4X63A 4CUCA 2ZUTA 3WF3A 2NT1A 1SW3A 2JIWA 3WEOA 3AYVA 3EX6A 1SO3A 3N4AA 1FH8A 3NNTA 4AZIA 4DBSA 4PMJA 4XKYB 5M03A 2OJPA 2XVLA 4IICA 4CQCA 1W9XA 4NJIA 3ZS4A 4PUEA 3VNZA 3F03K 4HOZA 1KFKA 2BSLA 1QNOA 3IGUA 4JN6A 1E6ZA 4YVXA 4DO4A 3PUDA 4GI9A 4PTNA 1FFQA 4JTKA 1W5NA 4AX6A 3NVTA 1V0MA 3KDNA 3RLUA 3NG3A 3NQEA 1IXOA 2J66A 1M03A 1EJ7L 1L2UA 4JQ2A 1BPLB 4PH6A 3U4FA 2P8CA 1J79A 2WBKA 2A3CA 4PCTA 3MI6A 1N8WA 2VVNA 3QXBA 2ZXBA 3P8JA 3DZ1A 3M7SA 3RN6A 2XSXA 1UZDA 1L6GA 1O5QA 4MAVA 2HS8A 3UEQA 4MB4A 5G4HC 4QBXA 2ZX6A 4H6EA 4O13A 3AZTA 1F4HA 4AW7A 3MT1A 3RILA 3WFZA 2WVUA 1H60A 2BGSA 1PIGA 3VILA 4DNHA 2QQ6A 4KWSA 2WHLA 3VIKA 4JKKA 3SFKA 2QMJA 2PDCA 1KCZA 2HCVA 5AYBA 3F5KA 3HIJA 2PDUA 2XIOA 3CQKA 4BR1A 3NR0A 1D9EA 1NWRA 5MKGA 1RA0A 1P7TA 4NNCA 1RUSA 3VOHA 1W3KA 4UFMA 1TKKA 1Y7VA 1F6YA 4JEJA 4PMQA 5I7GA 1DJZA 1UPMB 2A0NA 2V2HA 1GUVA 3VUSA 1IR2A 4KBXA 1QI0A 3PZIA 4S1FA 2GDUA 2ABBA 3UWQA 1Y5VA 1OABA 4P8UA 4Y90A 3CHCA 4X0VA 2WQDA 2B31A 4JL1A 3N12A 4MZYA 5DXYA 3E2VA 3W02A 2BLEA 4C6FA 5DMYA 1V3JA 1H63A 5BROA 3IWPA 1B0IA 1SW0A 3ZFHA 3MKVA 3ZLHA 1XKYA 3IJ9A 2Z25A 2QAFA 1Y8BA 2FMOA 1VCFA 2XM2A 4KMQA 5CSUA 1I2RA 4C7DA 4AVOA 4PSPA 2JK2A 1WZAA 1GQNA 4DLMA 3H7RA 1C91A 3CHEA 1XICA 4L9ZA 3BICA 5I2UA 3MP3A 2J9YA 1GPFA 4ZSTA 2I5QA 4AZ7A 1QHOA 3CHVA 4AU0A 2VFDA 1D8WA 1VFSA 1G7VA 3N6QA 4G9PA 3C0SA 1QOPA 5CH9A 1IEIA 4TV6A 4R27A 4J1OA 1WDSA 1IE7C 3VOIA 1I2OA 1J6PA 3DYPA 3NL6A 3BURA 3JZUA 3W27A 3V0UA 1DQWA 2NUYA 1YTEA 3PZQA 4UOZA 1V3LA 5H6HA 4MLRA 5RUBA 4J7RA 3QV9A 4POCA 3KVMA 4IPLA 1AK5A 3USZA 1Z9AA 2P53A 3A4JA 1YDYA 2PGFA 4XTIA 2VFEA 4UCFA 4PUWA 3UZXA 3L0NA 3SUVA 3OYZA 4BQ3A 2CPUA 1HL8A 1E73M 5CBIA 5LGXA 1RLDA 3TAOA 4M6VA 3GIQA 3WQ8A 1W8SA 4N6FA 1RCOB 2CNCA 3BDKA 3REQB 1KBLA 4DB7A 3KWXA 5HNRA 2DSVA 3AZRA 4R9OA 1EHNA 2VCAA 4FAMA 3UJEA 2OO0A 3PHAA 3LMZA 5JMUA 2Y0FA 4YCPA 2GUYA 3LCLA 4W8AA 2D1ZA 3UU0A 4MM1A 1OBAA 5D32A 1EX1A 1H3GA 2Y4SA 2WQPA 4M51A 1TVLA 3CL6A 5EL1A 1OGBA 3UGVA 2J25A 2YB4A 1Z44A 4JTSA 2WK2A 1Q85A 4C6QA 1MNSA 2DZUA 3SR7A 2ZE3A 3WQWA 2X0YA 3MKKA 1LWHA 1TVNA 1LBLA 3CMGA 1XX1A 5SWUA 4QLKA 4ACYA 2AKZA 3MHGA 1WKYA 5CQ1A 4Q4SA 1J9YA 2ZTJA 1DIDA 3KRSA 3CYVA 3E0IA 4CNOA 3NL5A 2R91A 1I8JA 3AIQA 4RE4A 2V3EA 3GTIA 3B9NA 2WSKA 3EWBX 4A6GA 2ZC1A 1VFOA 3T55A 2PRLA 2V67A 4BI7A 3FDGA 4QCEA 3A47A 1XYMA 4G6CA 3A6OA 2CESA 4MIMA 2WMKA 3JS3A 2FQIA 1Q66A 2VCBA 1R7AA 3VDGA 3KLKA 2BTMA 3O1NA 4H3DA 1A5OC 4IFRA 1X1OA 5M17A 4MWAD 3LOTA 4MY9A 3GXDA 2QUTA 1S2VA 4PE8A 2QMKA 4ROQA 3AMGA 4B2DA 2YBVA 4EK7A 3LCHA 5GNXA 1GEQA 1MNZA 1H62A 3AC0A 5K3VA 3PAOA 2FHBA 3MCOA 2YKKA 3KBWA 2E8ZA 1V03A 4QEEA 3FAWA 1GOXA 4N9DA 4YWIA 3MYPA 3U2OA 2QCEA 4F9DA 4MDOA 3HBLA 1Z89A 1P6CA 4KEVA 3B06A 3AXHA 2YB1A 1X1ZA 2DIKA 3RAOA 4EF8A 1XIDA 1R2SA 3CUGA 1LL4A 5JVLA 3PZOA 3T4WA 2WWDA 3IVTA 4NL1A 5H1WA 2TSYA 1H41A 4UZSA 2ZDSA 4DO6A 1X96A 3FN9A 1TIMA 5BXRA 3UWEA 2I5IA 2QVNA 1FWEC 3TDFA 3QMTA 3W7HA 2PDLA 5CPLA 4AFYA 1NEYA 2WO5A 5A6BD 2Z24A 4F0RA 3PBUA 5I02A 2R8WA 3O06A 1XI3A 4QISA 3W75A 1UR2A 3S1XA 2ZTKA 1YHTA 3OLIA 3PR2A 4O19A 3L4TA 2VX4A 2W92A 2NV2A 2NVCA 4KCTA 3WQ4A 5EB8A 5HJXA 1QFEA 3PK7A 4IP7A 3L4VA 1RCXB 3SGGA 3TN4A 3LHZA 2BB0A 3P0WA 1XINA 3SCUA 2BVWA 3VDHA 3CS2A 4J3UA 4MLJA 5IDIA 2ISVA 3WQFA 4HCLA 1S3HA 5G4EA 1CGVA 1WDRA 4PMOA 4GYKA 2RFGA 2Z2BA 3UXLA 4HZ8A 5ABFA 4TVUA 4XAPA 1SZFA 4WSHA 1ZZMA 4PB4A 3WLHA 1D7KA 3MANA 3TQVA 5HDRA 2F6XA 5HR6A 1UG6A 3BMWA 2VRQA 3G3MA 1OF8A 3VIMA 2PDWA 2PDKA 3CL8A 3CM4A 3UYIA 4CD7A 4V1XA 4ERGA 3FSUA 2TPSA 4NJJA 3MC5A 4WY0A 2DJXA 3S1WA 1I9CB 3LCXA 3ITOA 4O16A 3FJNA 1K70A 2PODA 4MUZA 2PTYA 4O8RA 4ZFCA 2V82A 1K3UA 2IPJA 3QOKA 3KX6A 1SUXA 2C0HA 3FLUA 1JCMP 3FW6A 2PA6A 3LBMA 4MB5A 4RZ6A 4XZ9A 3VM5A 1KQZA 1XBYA 3BV4A 4XBJA 2PDYA 5I3DA 1WO2A 3C8FA 4PMRA 4XTDA 1UBSA 3PM6A 5CJMA 1X6NA 2F6UA 3BWWA 2BHZA 2PLJA 3VX0A 3EYPA 4CNPA 5I3KA 1OINA 4GIRA 3KCOA 2AL2B 3A3WA 3SCSA 3SIMA 1E3ZA 2J6VA 3N25A 1GYLA 1JZ4A 3L5MA 4B3KA 4L61A 1EC8A 3G1DA 3PBMA 4HMEA 4ZXLA 1BXBA 3AHVA 4E6MA 3A9IA 2R1KA 3U3HA 4P7QA 2GQAA 2BHUA 2HXTA 3TU9A 4C6PA 1WXJA 3T8LA 1EHAA 2Z1WA 4IXHA 4LF2A 3W26A 2J7GA 3BG5A 4AIEA 2C18A 3N13A 1TPB1 3OU8A 3ABZA 3B8VA 1RP8A 4LUSA 2INFA 4A3RA 3Q94A 1E5NA 3BQ5A 3RR1A 1WZLA 3NO3A 4LCQA 5G1TA 1XC4A 4XQ6A 2QGYA 3K4AA 3W7RA 1B4KA 1VFMA 1UB3A 1KM5A 4XBSA 5H8PA 1XUZA 1J12A 2O9RA 3M4HA 4AHQA 4PZVA 5I23A 1RJRA 2OQLA 2PF8A 3P74A 1FP8A 1SFLA 4AHOA 4XUYA 2CLOA 1CXKA 4AUBA 1QR7A 1OVDA 3T0TA 3WK3A 3G0SA 4MJMA 4BHYA 1SR0A 4A21A 1GW1A 1UD6A 4ZENA 4AXKA 3RRXA 4D6FA 3CAQA 5IM51 4AB4A 1ZNNA 2AQWA 3TR2A 1MRQA 2FFIA 1WBHA 1FWCC 3FIGA 4ATLA 4CD4A 3U5UA 1BKHA 4A35A 2I5GA 3LI0A 2O9OA 2DDXA 3V1HA 5F1UA 3LX9A 2ACRA 5G2WA 4NJHA 3SCQA 4U4MA 5D9OA 5KSWA 4JTGA 5C2XA 2PWDA 4A3YA 3POHA 4ML4A 1HZYA 2G8ZA 3CLMA 2NSOA 3HJEA 4IJCA 4BWLA 1S1PA 3VKCA 3LYEA 3MSRA 3G1HA 3NEVA 1QNQA 3T0AA 4F2TA 3A9BA 2Z2AA 1SVDA 3WJWA 3NUKA 3APTA 5I00A 4R7JA 4BI6A 3ZT6A 4J28A 1RPXA 4EWJA 4Z2IA 4JZ5A 1ZJIA 4S2BA 4M24A 3FJ4A 1VYPX 1EC7A 2YCLB 4GC4A 3VVGA 2GUBA 1UP3A 4XZBA 4WDWA 3MB9A 2JKEA 3GH4A 5CZKA 2CITA 3NSNA 4ZOCA 3WG6A 1SYTA 4ZZ9A 4ZVJA 4TQTA 1DE5A 4KCVA 2VEFA 1LQ0A 1YADA 4AXNA 1V7AA 4GYPA 4RW3A 3VA8A 1SW7A 1W9VA 3QJAA 5CC6A 4E8CA 3L21A 3ZJ8A 4JCMA 2GZXA 3A23A 4Z17A 2V5DA 4JCLA 3G5EA 1JCJA 4QS6A 5EMKA 2EG7A 4S3GA 3ABOA 4U2ZA 2ZRYA 5TAOA 3TW9A 4D1IA 3D46A 4J3ZA 3UY8A 1JL8A 2NQJA 3SUUA 1FCBA 3KWSA 2V5KA 3CZGA 3DU0A 3NOEA 1NOFA 1N8FA 3QV8A 3HGJA 3IIPA 1XJBA 2DVTA 3BTNA 3TP4A 4B5UA 1W3HA 1LJYA 1PX4A 2NSXA 4FOUA 1FHVA 2QPXA 4PCFA 1EJTC 3MUIA 4WR3A 3IGSA 2PWHA 1XIIA 3W1RA 1EGZA 1NSJA 2BX7A 2NUXA 3BVJA 3WY1A 2DZXA 3F2CA 2WC4A 4BS0A 2XUCA 2FZ9A 3HPZA 2ZIDA 2JBMA 3NDZA 2BXYA 4ZQMA 1RV8A 2P0OA 3W7EA 2WOQA 3DFYA 3S5OA 4FXJA 1YXYA 3CEUA 1R47A 2WSPA 4UCGA 3VOJA 1CXHA 4F4RA 4YXGA 3QHMA 4PUDA 1IEXA 3DG7A 4HTYA 2GL5A 3T0BA 2Y24A 3STCA 3TXVA 4D6EA 1EQCA 1GZGA 1WKEA 1VBHA 1ADSA 1H61A 2CZVA 3I65A 2AQOA 2XN1A 4PSRA 2GVJA 1E51A 1YEYA 2YYTA 4GJ1A 1P0NA 1HT6A 3WLIA 2Y8UA 2NV1A 1Y5WA 1VGAA 1E1CA 3MWCA 1GYMA 5HQEA 3ZXWA 4A4AA 5K4XA 1ZL1A 1ZAIA 4GXPA 4I8YA 3R58A 4CGTA 5FD0A 1T40A 3N17A 5FAJA 1QPNA 4HNCA 2V9DA 1AL8A 2CZ5A 5DBUA 4ZODA 3KBMA 3MBFA 1XRFA 1DE6A 2I1OA 1LLWA 1HG3A 3R1ZA 3VCNA 2XTKA 4JIIX 2BODX 1XSKA 1DJWA 3V35A 3W81A 4US6A 1YDVA 3W7KA 1NFGA 1TMQA 3WH9A 5KEZA 1TPVA 3ARRA 1KRAC 1O68A 4C6BA 2YDRA 5EBAA 1OGSA 4C1NA 4XZNX 3UNDA 2QUMA 3N29A 3WDJA 4W84A 1XDLA 4HTBA 1TE1A 4IX2A 4DAIA 2VX6A 1QI4A 2XGIA 1F8IA 2HE5A 4MG4A 2QIIA 3S5SA 4QG6A 4F0SA 1UKQA 4MKNA 5AHLA 3VIOA 3V0TA 1I4NA 4MJ4A 1EDQA 2QNEA 1DVJA 1CCWB 4GINA 3TW6A 4RDYA 1PKYA 3WLJA 3TTQA 3DDMA 1PWLA 4IFOA 3QQ1A 1GOWA 1OIMA 3M0JA 2C13A 4DBDA 5CBJA 2CZDA 1A3XA 4YVVA 1QNRA 4ORIA 1AW2A 1B30A 3NEHA 1VBUA 3TA9A 5D33A 3O07A 1Q3NA 3PVFA 2B0MA 3S5ZA 4AF0A 3O6AA 1O5XA 1Q6CA 3GHSA 2D0GA 3PTDA 2YW3A 3UCDA 1J01A 2VUNA 4EPBC 1OC5A 1BYCA 4RX0A 4XAFA 4D8LA 4GGBA 4MKSA 2QT3A 2OQYA 1E43A 4A05A 4C6NA 3CB3A 4HP5A 2FPYA 2W61A 4EAYA 3H6OA 4QCFA 4JOMA 1N2VA 4WGXA 2WVVA 5FL0A 3ZYZA 4O1AA 1TJPA 1IXQA 3GFYA 3B97A 4UTFA 4Q8OA 4BF7A 2VGIA 3TNOA 2QV5A 2X0SA 3HN3A 4RNHA 2ZUSA 2C7FA 4EAMA 4BZYA 1ZENA 1VB9A 4B92A 4JPGA 3G3DA 3VPLA 1UZHA 4NYUA 5H91A 4L9YA 3TQ0A 3E2QA 4QLLA 3POCA 4JYDA 1UWUA 4DZHA 2E9MA 4ZTYA 3MA8A 2G3MA 3SI9A 4DZAA 4UTTC 2XGBA 3GW0A 1GG0A 1IHIA 3W1TA 1KCXA 2BHYA 3HPSA 3EPOA 2VEKA 3W7DA 3ITTA 3S5NA 3AQUA 4WF7A 3CB8A 2WM0A 5HA7A 1UCWA 2WXDM 4G8TA 2J7DA 1XIMA 1VPYA 1FDZA 1YMYA 1PZ0A 2DZVA 4IIFA 3LUTA 1EP3A 3LHVA 2XH0A 4GCXA 4LQ1A 3GKFA 4FNUA 3ZR5A 1E15A 1MUWA 3VNDA 1ISXA 5CAKA 2XINA 3AMKA 4LBRA 3TTEA 3GAKA 1CW2A 3AIVA 4OQVA 4NX0A 4CU7A 3NQFA 2OQHA 1OZQA 3B8TA 1TWZA 1GK8A 1FY6A 3ARPA 1T99A 2QDEA 1TPWA 3F1QA 3UP8A 2FZNA 3W7PA 1X8FA 2Q71A 4L4OA 1MYRA 4PODA 2ADAA 1DPMA 5HMSA 1GVFA 4L65A 1TA3B 3LHYA 4LVGA 4YVPA 1AMYA 4UTLA 5AHNA 1NWTA 1P0BA 2WMHA 1RP9A 3ABSA 5FESA 4KRUA 3MTWA 4GQQA 1DXFA 4RUBA 1JCNA 2ACQA 2VFFA 2DEPA 3EKGA 4JFWA 4O4WA 1B2YA 1XLHA 1T8XA 1CXEA 2OGYA 2UY2A 4KEMA 2CETA 3T81A 3IVSA 3JZEA 4UTWC 2IS7A 1XLIA 1MRAA 1KNWA 4CU8A 4GHRA 2NQ5A 4MWAE 4UNKA 4AY1A 1R3QA 2XWDA 3OQEA 4R85A 2CWXA 3AMCA 3U0HA 2D0HA 2GJRA 1E71M 4GO8A 4F3HA 5J8LA 4LVDA 5AC7A 4O8AA 4KESA 1J2BA 1X7FA 1KWKA 2V2DA 1KTNA 3BJTA 4WX2A 1JYWA 1XHGA 3MVIA 1G4TA 1L0PA 4PA8A 4FMVA 3OTRA 5BWAA 1ONWA 2GFTA 5C9ZA 3ID7A 1JDDA 1BHGA 1HVQA 3A3HA 2DUAA 2ACSA 2HSAA 4G1KA 4DN1A 1ZU8A 1EBHA 4D6GA 2CKSA 3WLSA 1RQEA 2DORA 8XIMA 3WEZA 3CQIA 2VURA 2VC6A 1D2KA 3MI2A 1QW9A 3TNBA 4ICMA 2EKCA 4KWWA 4DWSC 4J4KA 1SFJA 3OBKA 2HXUA 5I3HA 4C5YA 1Q4NX 3MUAA 4W8BA 1PJ9A 3SSZA 3VZXA 4BEQA 2XSBA 1RSCA 3NQDA 5A2BA 2XZ9A 3QFEA 1G69A 5ECUA 2HPMA 4K68A 2XIQA 1KV8A 2P10A 1E6NA 4Q4RA 2JGYA 4GNVA 1AD4A 1JCXA 1A3HA 5E6YA 2Y70A 2Y61A 5HWNA 4XWUA 2RDWA 3LTSA 4I6VA 2C1GA 3FA3A 3M46A 1FHDA 3EMZA 5D2XA 1X98A 4B5NA 1JYVA 5DRIA 3CWHA 5LHFA 4QIUA 4UQEA 3W29A 1R87A 4F66A 3UR2A 4TUFA 3UWYA 3IIVA 3MUY1 1UR8A 3I4EA 1V51A 1X6UA 4IG2B 3TLLA 3KXQA 1IWBA 3EX4A 4ONVA 3E5PA 1PTDA 5F2IA 2QR6A 3BXWA 3FGCB 1W17A 4GI4A 1RA5A 3DGRA 3T0CA 1UC5A 3DERA 4WKHA 1EO5A 4Z1CA 4JTHA 1E1EA 2BP1A 3AYTA 3HO8A 1TPDA 1KV5A 3QLLA 1XPGA 3TZNA 2VX7A 1N8IA 3ATZA 4IP5A 1KA9F 5CKSA 1EJRC 4DHGA 4F9JA 4Q8NA 3FHAA 1G4PA 3MUXA 1E6XM 2GSEA 4YCOA 3KTSA 2ISDA 2WAGA 1SJAA 1JXKA 3BCJA 1TX2A 1K7FA 2YCEA 5IFTA 4U3AA 1H49A 4TU1A 3C5QA 2O9PA 3SCPA 3DECA 4C6MA 2VFIA 1JRCA 3M16A 3H26A 5GQBA 5BOOA 1GGOA 1SJDA 5KINA 1KLZA 5D02A 3OA5A 3DFSA 1UKOA 3MCNA 1S5MA 3JVAA 3MSYA 4B5VA 1RLCL 1ZJAA 3EX2A 4DPPA 3D3AA 3GM8A 1EF2A 3CPGA 3WQCA 2DSZA 4RXFA 2PDGA 1W3LA 2QULA 4F40A 1GQKA 4FXRA 2PI6A 1Q7MA 2ZX5A 1EYEA 3AHZA 4PMYA 1EGMA 2ON3A 5ABTA 2CKRA 2QUVA 4YL2A 4DIAA 2W4XA 4W86A 2CLLA 2WHJA 3SQMA 4HOXA 1MUCA 1XH2A 3KE0A 4JL2A 3RJYA 1XBZA 1A50A 1KFCA 1LT8A 4KCWA 2PTXA 1Y5XA 3S42A 5B7YA 2RJGA 1AH4A 1XWYA 4N9BA 1J0YA 4P2VA 4Y96A 2EPNA 3SQSA 1GOIA 4ZA0A 3UG5A 4AWSA 3KRBA 5I5RA 2OU4A 2PDQA 3ZJKA 4ENLA 2UZ9A 4KWOA 2PDBA 1OFQA 1ZALA 4YTQA 4B5TA 4ZOAA 2DT1A 3ARZA 2XHYA 4H41A 3L4UA 1B57A 2DJLA 4JKMA 3LTPA 4M56A 1TJ1A 1BAGA 1SZGA 1FBAA 4BQ4A 1PX8A 4DBUA 3M64A 2JE8A 4R9XA 3LMYA 3ALFA 3OOQA 1E0XA 4QNEA 4NIRA 1XLKA 3NDOA 4JYEA 3PB2A 3TROA 1M3UA 1TJ0A 1VR6A 4H4IA 3UXAA 1F3TA 2XN2A 2BDQA 4E3TA 4J3VA 2BGNE 5K9XA 1NH6A 3OBAA 1BTCA 1OC7A 2E5DA 1NFBA 1KM4A 3U2ZA 1PIFA 3BC9A 1VIZA 3LQGA 4W4QA 1T8QA 4UTJA 3AISA 3IK2A 1N55A 5IHSA 4KCUA 2GDQA 4IMAA 7PTDA 4NNAA 1XL9A 1FWBC 1UD3A 1AZ1A 1MI3A 2DZWA 4WJEA 3UA3A 6ENLA 4WXZA 5A8PA 2OX1A 3PTQA 4I5XA 3LA4A 4AMCA 1BXCA 3GSMA 4UMBA 4C6DA 3IUIA 3TFXA 4XD3A 4OECA 1W1YA 2QZRA 3S2CA 3EEGA 1OCNA 4F2BA 4G2DA 3WF4A 1AVAA 4NSBA 4LB4A 4S3JA 3VO0A 5A2AA 2ZZ5A 3Q2DA 4B91A 4AQLA 4I9TA 3VDAA 3WNMA 3CAWA 3GH7A 1BKSA 3WD3A 3CV6A 2DZPA 3ZR4A 4NF7A 1TZ7A 4L6DA 3QKZA 1RJPA 4DI9A 2YCLA 2F38A 2WZEA 3PULA 2YJQA 3BW4A 4REQA 2VZUA 3FHQA 3WQGA 3ZJ7A 3W83A 3WH6A 1X38A 2CWNA 9XIMA 3EDDA 4C1LA 2Y7EA 2XH7A 3PF3A 3C0JA 1HKJA 3PFRA 2VWTA 4GH1A 1IEQA 2DZAA 3D6NA 1VBRA 4ZSUA 1TMHA 1QK0A 4PUNA 1YNPA 4DQWA 4DBWA 2CLFA 1YDOA 2CCRA 3RO8A 2QYGA 1NIUA 1FXQA 2JEQA 3L2LA 2HNEA 1JD7A 4NQ1A 3YPIA 4CNNA 4CNSA 1I45A 2X1UA 1HUVA 4U5KA 1QI3A 1RH9A 3VIGA 4UQCA 4XZHA 1W2VA 4OOUA 3T40A 2KZHA 3DFOA 2JEPA 1QAPA 1AA1B 1JEZA 2XWEA 3SRHA 1XFBA 4AWEA 3PSVA 3AMDA 4S3EA 3V5OA 4NG3A 1XDMA 3VGHA 3AXMA 1UUQA 2WWCA 3QTPA 3MUZ1 1KFEA 2Y5JA 5M2FX 4ZMGA 2E09A 4Q3MA 3W85A 4CD8A 3QC0A 3AZSA 4PBGA 3XISA 1ZBWA 4XAZA 1KM1A 4QQ3A 2FDMA 2INZA 4OZOA 2P3ZA 1DJHA 3E96A 4O18A 2ZOXA 5HJYA 1CT5A 1Q5MA 4MB3A 1WUEA 2VZVA 4HKPA 1J96A 2ISWA 1B3ZA 3UA4A 4L64A 7A3HA 4NZ1A 5E5CA 1UYQA 3KW3A 1U1HA 3UWUA 3NQAA 4HMNA 2D22A 3G1FA 1HKMA 4GMEA 5HAOA 1Z41A 2V2CA 2VP8A 5I3FA 2WV8A 3BCFA 1TRDA 1LG1A 1EZWA 1V6YA 3UY7A 3WSUA 1HKWA 4FI4A 3NPXA 1H09A 3LGGA 1GVIA 8TIMA 3CZJA 2QJNA 2YBTA 1M01A 2HE8A 2Y1HA 2Z1XA 4AVNA 3LG3A 3B8IA 1FHUA 3AXKA 3ES8A 5JU6A 2G37A 3K8LA 2BY3A 3HG2A 4TX9A 1OF6A 2C79A 1TJ2A 3KVJA 1H7XA 7REQB 2Z1BA 3LDVA 3SY8A 3LHUA 1WAUA 3A3XA 3WK1A 4K8GA 4A3UA 4OKDA 3VNJA 2C91A 3TIMA 3SRKA 1E0TA 3TQKA 1KFLA 4C6IA 1TWWA 5HOSA 5EYWA 2C16A 2GYIA 1ZAJA 2UY4A 1TR9A 4PRRA 2A6NA 5C7VA 3NDYA 4NXSA 5DBTA 5LXEA 3UCCA 5JBFA 2V38A 1CTNA 2DH3A 3GR8A 3EBVA 4I9JA 5K2ZA 2XVKA 3B9OA 3EWZA 3RJXA 5CEWA 2H8XA 3UERA 3KZSA 4M19A 2QCDB 3O6CA 3I7RA 2JQXA 3TC6A 5GNZA 3C2YA 3AAMA 3QV7A 4H19A 3VGDA 3DFQA 4J27A 3GXTA 1QWGA 4HU4A 4OTKA 5EMJA 4DWSD 2HK1A 1P0EA 1V6TA 4U5IA 3B3DA 1HIZA 4ML9A 1G1YA 4MNKA 3NFUA 3S2MA 3IJIA 1XISA 1UD4A 2YA0A 3AHTA 3AHYA 4IGNA 5AC8A 3S0CA 3O2LA 3GDLA 4W5ZA 2PDXA 2DSWA 3LGEA 3R8GA 1AH3A 2OODA 4LUJA 1UZ4A 3WUGA 3RIKA 2NX9A 2ZZ3A 3A22A 1XGZA 1GOMA 3BAXA 3B8SA 2CFFA 3S3GA 3S6OA 2D2HA 2VGGA 1KRBC 2JALA 4MNJA 2Y6ZA 1MQRA 4G7EB 5C9WA 4NU7A 3WKZA 2YDSA 3DFPA 2VC5A 2Q09A 3KVLA 3W7IA 2YLAA 2DVXA 1QHPA 2JKAA 4L1XA 3FDKA 3FK4A 1DQUA 1XCWA 3A13A 1S38A 4P7LA 5J04A 3QGAC 3P93A 1CLVA 2PTWA 3OVPA 5HQMA 3THCA 4Y9AA 2ZRXA 4O52A 1NY1A 3PG8A 3LBCA 5D8ZA 4KIRA 1OEPA 1M53A 4C65A 3BZJA 4KT2A 2ZRUA 4D8ZA 3AWOA 3EDJA 1UP0A 3R4IA 2FTPA 3WUBA 4ZE5A 1KB3A 3AOFA 1VFLA 1OC6A 3KUMA 3GWQA 4UB9A 3M5XA 3G0UA 1S3TC 3OIHA 2GQ3A 1S39A 2ZUWA 1ML1A 2ISSA 4AWUA 2TODA 3WDPP 3NGJA 1UR9A 3EOUA 2FVLA 4AZCB 5A5WA 4X2PA 3TH6A 4G56A 3NO1A 5A8MA 3AO0A 4QAIA 1JUEA 4QJ4B 3F4NA 3II1A 3VKBA 2WVSA 2ZICA 4I8DA 1ISVA 1UZ1A 2J4GA 4IX0A 2GGEA 1GYNA 1S5NA 1PSCA 1ZBCA 3APGA 2DZSA 5A95A 5EMUA 5A6SA 1EPVA 3LEPA 4FLSA 1TA3A 1YPFA 5I3GA 3KDOA 2G4JA 1KR0A 3MWAA 4MADA 4DWDA 2VHLA 3VDBA 4E4FA 3EDFA 2VX5A 4TVCA 5AVHA 4GRSA 4PFMA 2GJNA 1UR4A 3A24A 4TV5A 2H3BA 2QHAA 4UXDA 4DUVA 1X6LA 2QJMA 1FWGC 4HA0A 1VEPA 1L6FA 4PUUA 3E2SA 3URAA 3B0VC 2VZSA 4XD5A 4JTQA 1TTJA 3F4CA 1J0IA 3UWZA 4HMCA 4DPQA 3G1AA 4XZIA 2Q3RA 4QGCA 3ZVHB 3W23A 4HPGA 1R38A 4CQ8A 3CUFA 4TTGA 3WLKX 1GTHA 3NXLA 1TWIA 5A1AA 8RUCA 1QO2A 2WNQA 1MQPA 2PRHA 4X9SA 3GC2A 1JDFA 1RBOB 2WKLA 2ZRWA 2XGZA 1LG2A 3M0LA 3GNDA 1TV4A 5AVNA 2J7FA 2OR2A 3PSWA 2CLEA 1V6XA 3QLDA 1TTPA 1CEOA 2E6AA 3P61A 3RM9A 3RPTA 1BVWA 3U2EA 4NAFA 2JF6A 3APYA 1YNQA 2EEXA 1BWLA 3GXPA 5GVJA 4HZMA 1UP2A 5CLWA 2UY3A 4R3UA 1PHQA 5DO8A 1YKWA 1R9ZA 3KEHA 3HZ3A 3RX2A 3KFTA 3OIXA 1F6PA 4IL2A 1J4EA 3VKJA 5BOFA 3F4DA 3EWCA 1UJPA 4IQLA 3WH8A 1NTHA 1G9HA 4J5NA 4Y9NA 1U22A 3GXNA 1FCVA 5E09A 1W3JA 1VENA 1Z69A 2FPVA 2VJXA 5BYWA 2CBUA 5F2GA 1OX4A 1ONXA 4AYGA 3HFYA 1E3XA 4QLJA 3VIFA 4ZQRA 4WDTA 5FF3A 5C70A 1CX9A 2VMFA 3SECA 3GE7A 2V8ZA 3IIZA 3R11A 3SM0A 1CI1A 3C0LA 1SJCA 2J7EA 3WLRA 4JIHA 3QMRA 1RK6A 3E0VA 3CV2A 3RLGA 4Z1AA 3OGSA 4S3FA 5D04C 3K13A 3HV9A 3MP5A 5A8NA 3RG6A 3KP0A 5E0KA 3IJDA 1UPPA 4YTTA 4GUJA 1J0KA 4HMDA 4W87A 2UV8G 1FH7A 3L12A 1GZ1A 4L5ZA 4I90A 1DXEA 4GBDA 3KHJA 3RR4A 4DJFA 4HU0A 3U2CA 4M6PA 2VOTA 3GDTA 3ORWA 4TMCA 2O4MA 4ZO8A 1MWOA 2X1SA 5AC4A 4PB5A 2V0TA 2YLLA 4HPNA 1R6WA 2RHGA 3NQ8A 4QRNA 2FZBA 1E4MM 3M1ZA 2FB3A 3W82A 4LWWA 5T9CE 3EKLA 4GNKB 2ZVRA 1JGMA 3A4WA 2E8YA 3E6EA 4M29A 2GVGA 1WP6A 2PC4A 1XRTA 2Z26A 1TPUA 4GWEA 2VT0A 4UR9A 1VQTA 5HNUA 4W9TA 2R24A 4H9TA 4PRTA 1AFSA 3IAQA 2O4QA 4ASTA 4GH3A 5G1MA 3GH5A 1DJIA 4LANA 1H51A 1LF1A 3KBVA 3DBPA 1UH2A 3G1SA 1H5VA 3WLMA 3QR0A 1O12A 2OO6A 2PDMA 5DANA 1JZ7A 4L56A 3R89A 3P82A 4M80A 1CNVA 3DKLA 3QY6A 3T78A 2AL1A 3P81A 3HM7A 1BGAA 4R33A 4J3XA 2HROA 4IQEA 2C1IA 3DFHA 3I4KA 3WLOA 3VD3A 4P7OA 3S9ZA 2D2JA 5DN1A 5AHIA 3WK0A 3GO2A 3CNYA 4ZEPA 5HUPA 1B31A 1R3VA 1A5AA 4IIEA 1HL9A 1UWIA 1W5MA 4BJHA 3RHGA 1O4UA 7CGTA 2Z28A 1PAMA 2XJ7A 2A1YA 3ZJ6A 3AXXA 1GORA 2FTYA 3TQPA 2JIEA 3LRKA 1C29A 4ZB5A 4E4UA 3P80A 1G0CA 1TQXA 2ZE0A 3ARTA 5KMYA 4MZ1A 4WDUA 9CGTA 2BVTA 2NXHA 5CSYA 3C3UA 5DCBA 2IQ0A 1L6WA 1S2UA 4B2DD 4DBEA 2QLYA 3WD2A 2GK1B 1DEDA 2OWCA 3UPBA 2NX3A 3MKCA 1THFD 4YNGA 3WL0A 4FNQA 4XIAA 1KM0A 4OFCA 3MO4A 3MMDA 3CZEA 4B5SA 1QTWA 2FGBA 1XS2A 1BYAA 5IHRA 1QUMA 2CZEA 1RQBA 4IHCA 1LL6A 3PJXA 1GQJA 2NVAA 3WJXA 4Z1YA 2QPUA 3GHRA 5BU9A 3VU2A 2DUZA 4ATWA 1ZS2A 3OG2A 4W85A 3N18A 1NU5A 3M5ZA 3GR4A 5BMWA 4CCEA 2F8QA 1FA2A 2DW7A 5AFDA 4E2DA 2G50A 8CGTA 2F2KA 2XIIA 5FA5A 1CLXA 4JKLA 3BH4A 3GXIA 6REQB 1JPHA 3N2OA 1G4SA 4C6EA 4Q22A 2YW4A 1E5JA 4GFSA 3TJXA 3W2LA 3MMTA 4PMZA 5F4SA 1PZ2A 1XLLA 1OWQA 4ZXOA 4QX4A 2ZFAA 3IS4A 3T09A 3TLQA 3IJ7A 4TO8A 3T6CA 1SO4A 4JS3A 4TOQA 1IF2A 2PUZA 3QSRA 4NUWA 2QGHA 2TAAA 1QU4A 5I78A 2NLYA 1OD8A 4BI5A 3QY7A 5DX7A 1K9DA 3P67A 4E5TA 4M8UA 1R7OA 4JX5A 3URQA 4PMXA 4Y7EA 3GTFA 3HQPA 3ISIX 2I17A 4UFKA 1TSIA 5MF5A 3WH5A 3IJLA 3C86A 5I09A 4EPKA 4KWVA 1IYXA 3NQ6A 5M1TA 5FF0A 2ZZ4A 3SQLA 1UUMA 3NXFA 1JGIA 2ZBTA 1U33A 4A8IA 4Q8VA 2IQDA 3TTYA 3CV7A 2OFJA 4YYFA 1F4AA 4PYSA 1A5LC 1M9HA 3MHFA 4CN4A 4J3WA 3OA3A 3CASA 3NZ1A 3UYCA 6XIAA 1TFVA 4UWMA 3Q65A 2PS2A 3K30A 2Z1KA 3UFYA 1FCQA 3U57A 4WY0F 5BRQA 2CLHA 4UUIA 1KD0A 3DXIA 1K8ZA 1CDGA 3BZGA 1PZ1A 3HA1A 3M0YA 4WOZA 5HWMA 1E72M 3G1YA 3I7SA 4JTJA 1KLYA 3EPNA 4UC5A 4GZEA 4IZGA 2X30A 1UR3M 1S2TA 4GOAA 4CQ9A 3TMQA 2OGJA 2Z27A 5A8QA 1IT7A 3L4YA 2DQXA 5LNSA 5AB3A 2PWUA 1BVZA 2ZC8A 3C8NA 4FX6M 1V5XA 1UW9A 3ABXA 3GDRA 4URIA 3PNZA 2GJPA 3GC4A 4HPHA 2OYKA 2NV9A 4JTRA 5ABEA 1M7XA 3DGBA 3F2DA 4FNRA 2VKZG 1Q6FA 2ODOA 4P8WA 3N2XA 2J27A 4LBUA 1HNYA 3EDKA 5XIMA 3UJFA 2CHRA 3E49A 1YXCA 4LTSA 3VD4A 5LNVA 1CYGA 4C7FA 2D0FA 4GUGA 1W1ZA 5FJTA 1SJBA 2HTMA 3ZWTA 1QPOA 4LAMA 4UTWA 3W3OA 5DMLA 3IEBA 4IIGA 2E6DA 1MXDA 5DLCA 4MKVA 3VX1A 2F84A 3ZOAA 1JPKA 3W7CA 3UD6A 2DQWA 5AC5A 3KCLA 3UJ2A 3TA6A 1YNYA 3VKAA 5HPCA 2CHNA 2PDIA 3GFZA 5DF0A 3HV8A 5AKQA 4ICNA 3GUGA 4PCNA 3BOLA 3S6TA 4LCSA 2F7FA 4V27A 1XIJA 4H8NA 2YZRA 3P0XA 3VGBA 4GUHA 3WFAA 3EZ4A 1E70M 1UJQA 2HISA 2IMRA 2PD9A 2RAGA 1LROA 3L4WA 3QGVA 5CC5A 1EUAA 2ZKMX 2Q01A 1Q2SA 3BO9A 1I6NA 3BJSA 1HKIA 4KFOA 4DWSA 4E3VA 2H6RA 1OFDA 4AEEA 2JF7A 4IFKB 3CUXA 1VJIA 4TIMA 2CYGA 3BUVA 3MCMA 3NA8A 3DEQA 3W1UA 2QCDA 3IPWA 3EOLA 2QKFA 3BLPX 3W24A 3K1GA 4XZWA 3W2KA 3LGDA 3RLVA 1FFRA 1W1PA 3SY5A 3QW4B 2NWRA 2Q8LA 5CG0A 4H9XA 4DXXA 3CZ8A 4K2SA 1XIGA 4I9MA 3SCWA 3NQMA 3UWVA 1VEMA 1F07A 3ZQ9A 1JIBA 3TEVA 4ORMA 1DQXA 1XD0A 4PUMA 2CLPA 4PEEA 3BANA 3T8QA 1P6WA 1WDWA 3I6RA 1H0GA 1JAEA 3SW6A 1TPEA 2IPWA 4F0LA 8A3HA 4JIPA 1D3HA 3N11A 3N15A 3ARVA 3HQ1A 3H24A 2HVNA 4GKTA 2VQUA 3LNMA 1XH0A 1E6QM 3CTTA 3SAZA 2W3ZA 1BQCA 4A2SA 3PP7A 1JZ3A 3QQ0A 3UR5A 4HNOA 3W4RA 3CQ0A 1PHWA 4OIFA 1Z6KA 2V81A 4Q4OA 1ADDA 4YPJA 1AW5A 4CCZA 1EF3A 1YQ2A 3GVGA 3GS6A 1SR9A 4Q8PA 1W1TA 4XVEA 2PU1A 3ARWA 1RHCA 2GGIA 1S2CA 1R2TA 1XYLA 4MNMA 2XVGA 2DFAA 1NJJA 2E6YA 5EMLA 3UG4A 4UOJA 3HQOA 1KR1A 1FDYA 3L5AA 1NP2A 1R3YA 3H12A 1DKWA 3CBWA 4JFUA 3VFLA 2Q3OA 4DELA 3V0SA 3VGFA 2WMJA 1ALDA 3K46A 1DWAM 3KCJA 1KXTA 4Y8FA 1HO4A 3ABRA 1Q6GA 3ALGA 1ZJBA 1ELSA 4X22A 2NXIA 2J8TA 3IJQA 4WDXA 2HDJA 2VELA 1OYBA 2PCQA 5PTDA 1KBIA 4M7TA 3WF0A 2P1FA 2X2YA 3GG8A 3AU2A 4RZ5A 3TYBA 5CSRA 1WX0A 5A6LA 2XIBA 3V5FA 4IUGA 4LFYA 4LRSA 1XSIA 2G97A 1VRXA 4O11A 4S3AA 2CW6A 5EY5A 2QUNA 1ESWA 4IL0A 3E38A 3HF3A 1F61A 3STGA 2CEQA 4XD4A 2V3GA 1BLIA 9RUBA 5EMMA 1OX6A 2WC7A 2VYOA 3HPAA 3WZ0E 5C54A 1KWGA 1NF0A 3R10A 1LTDA 1HO1A 3FX4A 3T2OA 3K4WA 2X8RA 4NZFA 4FOKA 4H7VA 5TIMA 2PGWA 1H1NA 3JU2A 2AKMA 4ZB0A 4GFIA 3ZT7A 1K7EA 1OYCA 3GHUA 3LU2A 4Z2LA 4GQBA 1REQA 4GY7A 3PZ9A 1Y65A 5D37A 4FB7A 4J9JA 2ZZ2A 2QXWA 5C0QA 5HBFA 3IV3A 1A53A 1F6KA 3QFWA 3CPRA 3L2IA 1GG1A 4H00A 1UKSA 1QWKA 1JNDA 5G2IA 5IRPA 3PZUA 4FSAA 3OO2A 4UTKA 2QV4A 1EKOA 1EUNA 3SCTA 3CHDA 2E77A 1OY0A 2WVTA 3GNRA 2P88A 2E28A 1ITUA 1WUFA 2V5CA 4RW5A 3GG0A 2B7OA 4IXXA 3HGRA 4GACA 4MGGA 5DELA 4DEFA 1K4GA 5HNNA 5BMXA 3GKAA 2HBVA 3T4CA 2W5FA 4WOQA 4L6OA 1WYIA 3CQJA 3S9YA 1SZRA 1S1RA 2VEGA 3QSTA 4S38A 4OT7A 4FNPA 1Z42A 2QJGA 4MY1A 2DUXA 2RDXA 3E02A 2HZGA 4LUIA 3AJXA 1J5TA 1EIXA 1U5JA 2VM8A 4HCHA 5TNVA 3FYYA 1LM1A 3WCZA 1IXPA 5C7HA 2AAMA 2P3EA 2RH9A 1KFJA 1O7AA 4AY7A 5K9DA 3UESA 2YA1A 2ABAA 2EJ1A 3M0HA 3UQNA 4ZQNA 2DZBA 1Z32X 1XYBA 3AUJA 4H8HA 5C6MA 3NURA 4CEUC 1E40A 1FXPA 2ATMA 2ZA2A 2RDUA 3TYZA 1K8CA 4NHVA 3URBA 2HMCA 3MHUA 2OOFA 3H4GA 4S3DA 2HS6A 2OLHA 3NL3A 1EA9C 4GY1A 5CCZA 3CT7A 1CLKA 1U2YA 4ACZA 1EDGA 2YR1A 4GQRA 4GVHA 2MANA 2XM1A 3QM3A 4LC6A 2I56A 3W86A 2NQ9A 4P7RA 3WX7A 1UQZA 3I10A 4DF2A 1M5WA 3P7YA 1U83A 1A80A 1TWSA 4PCSA 3FKRA 2OLSA 4EVZA 5EGRA 3HU7A 5D4YA 2Z7GA 1RD5A 4NAEB 4DRSA 5BRBA 4WEVX 4DJDA 3B8UA 2Z6JA 1LP6A 4IQJA 2FZ8A 4JXCA 4LUYA 4EWND 1JZ5A 2G0WA 2WSQA 2FGZA 1HJXA 3W07A 1JJKA 3TK7A 1U30A 3VDCA 1TCMA 1MW2A 4LS1A 4HHMA 2BXZA 2J77A 1XIHA 3S83A 2WKGA 4GX9A 5KETA 3LZ3A 3TOYA 5LA0A 4BEUA 1W1IE 3RK8A 1SFTA 4S3CA 2ZXQA 1E9LA 2WJDA 4MB1A 4H9ZA 4IGSA 1EZ2A 4C5ZA 2IQTA 1S2AA 1FOBA 2I14A 4E2VA 4GE8A 3U4AA 3W22A 4XB3A 4Y8EA 3C3NA 3KTCA 2A3BA 4N0RA 2E68A 1JQVA 4M1RA 1TPFA 1OFPA 3KAOA 3UPMA 3WO8A 2OYLA 3BGGA 3T44A 4O53A 3R6IA 4C90A 4UQ9A 4FO4A 3AS2A 5DMMA 2IKIA 3SN4A 3RYSA 3QOMA 3H53A 3MPGA 1FKXA 2J9ZA 2Z29A 5JIWA 2Y7FA 3BLLA 4RZBA 3VXGA 3RFAA 4NY2A 1O95A 3C52A 2YXOA 3B0XA 2CU0A 5REQA 1CGYA 3ZWSA 1KGWA 4UR7A 5DCEA 1IT8A 2GJXA 3W1PA 2ZWZA 3D5HA 2IW0A 4D2JA 5ABHA 4WD0A 3UZ5A 2WZIA 4XAGA 5C9UA 3NPWA 1UROA 3B8WA 1X8CA 1W37A 2EPHA 3PWAA 2GGHA 2A2IA 3NQ7A 3DFNA 1DWGM 1I0DA 2AQVA 4OBSA 3NAVA 4KW2A 3QN3A 1AMKA 2WMGA 2GOKA 1NDVA 3FEMA 5HR7A 5BW6A 2J6XA 3DC0A 3VE7A 1OG6A 2G3FA 1QMLA 4KGLA 1EWEA 3DCPA 1QI5A 5JBDA 2A4AA 3OYXA 5XIAA 5LGZA 4DXKA 4ZGYA 1UWSA 1QPKA 2QJHA 3WIJA 4OBTA 3GZ3A 1C3FA 3MV01 4GUIA 3W71A 3EOEA 4JFTA 2E1WA 5AECA 3M47A 3TSMA 4HHLA 4FF7A 3KL5A 2B81A 2XFRA 1BGGA 3LM3A 3DUGA 2WJZA 1VAHA 3WELA 3C61A 4U31A 4H6QA 2E40A 3QPEA 4ES4A 1QK2A 2HJPA 5A8GA 1T5AA 2GK1A 1HFBA 5J5RA 1T41A 1S2WA 2X7WA 4DY1A 3E2RA 1TR1A 2WM1A 3U7VA 4XO6A 5C5YA 4UFJA 3GUWA 6A3HA 2CZFA 2TMDA 3EWDA 1VPQA 1BYDA 3MQTA 2QAPA 4GQGA 2EBNA 4PEKA 2HVMA 2Z7KA 1X39A 3PZTA 2R6OA 2ZCGA 4FXSA 2QIWA 3PZGA 4NRRA 2VC7A 3PB0A 1MFUA 2A6LA 5I0DA 4I5UA 4H2CA 5AN7A 4FP1A 4JIRA 4JN8A 4B3ZA 5DY2A 3Q4DA 5CG7A 2B7QA 3N1AA 3K1DA 5D30A 4TX6A 6REQA 4NRSA 1PX3A 3GNOA 3C2EA 2VTFA 1FVPA 1H7NA 2PF0A 4H6KA 4AD5A 1UH4A 1I2QA 4IGMA 3VNLA 4NJKA 3LLDA 1F3EA 4ZE4A 4QJ3B 1LUCA 4Z1BA 3OVQA 5AZ1A 3MS8A 3Q37A 2WANA 4B9ZA 3VE9A 3W7NA 1H0IA 2FZDA 2WC3A 2Z0IA 1HJVA 1NQKA 3A5FA 2PDJA 3MYOA 2H9AA 2FH6A 3SFWA 4HVXA 3AYRA 4OOZA 3CEPA 1PKLA 2ICSA 4FR6A 2PLKA 3AFBA 4E8DA 2W0UA 3R13A 3ARQA 4UOQA 3N9KA 2D3LA 3QHOA 1GTEA 2OWXA 1YBQA 5FF4A 3W88A 2OKTA 3VMNA 2V3FA 3MP4A 4YTUA 1T6MA 1OK4A 4IMEA 4UBPC 3TN6A 1QBBA 3AROA 2FMNA 2F6KA 2REQA 3RUBL 1O94A 4FXFA 3BLEA 3FXGA 2RUSA 3IRSA 1JNEA 3THQA 1RAKA 4DUWA 2R94A 2WMFA 1E9YB 5FJOA 1XLGA 1PWMA 4FLRA 4Q4QA 4BQ5A 3NO5A 1LT7A 2O55A 3NJ3A 1VRDA 2J78A 3R79A 1LRNA 1EEPA 3WDQA 1TCDA 4Z2KA 1R3SA 1VHNA 1FX6A 3KOYA 2HWGA 3QEZA 3NQBA 2EPOA 3BAWA 1V02A 3N9SA 3AIEA 3GNPA 1GCYA 3EA1A 3VTRA 3TMLA 1V02E 3EOSA 3PC0A 1GQIA 1MQQA 7TAAA 1CECA 2YCIX 1B90A 1VH7A 3QQWA 4GC3A 4K36A 5KZ6A 3WQPA 3FV9A 3R43A 4KERA 2PRMA 5L9FA 1IEWA 2BY2A 3T05A 3FSTA 3W72A 4H8UA 2BMBA 4OJYA 3EA2A 3O0FA 1ZFJA 1TIWA 4QS5A 3VMPA 4PN2A 1V6VA 1OB0A 2VUYA 3N3MA 4O15A 1MEWA 4LPCA 1ICQA 3O15A 3W0KA 1LOSA 3SB0A 4IJRA 4XD6A 1ZP4A 4I6KA 5K4ZA 4DAFA 5CLTA 1Q13A 4GXWA 2VEIA 1HGWA 1JI1A 5B7ZA 3HG4A 4GG9A 4RNFA 3TTOA 2W67A 3R94A 1P0DA 4ZQOA 1W9BM 4AAJA 5C71A 1HJQA 1JCTA 2Y85A 1EFZA 3A4AA 5IXEA 3KBJA 4Y9PA 4K1WA 4RPQA 4WHBA 3SEPA 5EA9A 2V5BA 4K7YA 1W31A 1R46A 3AMLA 4RPPA 4LYRA 4DNMA 2DPEA 3H54A 2IKHA 3BOXA 5LSMA 2FJKA 3OLGA 4M1BA 1J2WA 1KBKA 1UIOA 4K38A 3W6YA 3MI3A 3CZLA 4PMNA 1E0UA 3O05A 4RNIA 2OKOA 4JTLA 4KEUA 3H7UA 3E0LA 3E1F1 4IFKA 5CJ5A 1NDZA 1A47A 1UIPA 4HNNA 2IKJA 5AYXA 1ZJHA 1GEHA 2BASA 3AALA 4YS1A 3EA3A 2PAJA 3H23A 3ITCA 3ANUA 3BGAA 1EOMA 3NZGA 4O1EA 2V63A 1DJQA 4CNTA 4NZ3A 5ABFB 3VNKA 1HX0A 1LDCA 2WCGA 1GQLA 1BG4A 1W3IA 2YIHA 3B9EA 4MJZA 2WNWA 2VOMA 4PGLA 4O1CA 2ZWYA 1K77A 3LNPA 3S5YA 4DJFC 3PUEA 3P6LA 4XO7A 3P84A 1JDCA 1H4PA 2QUUA 1KQYA 1W1VA 2OZ8A 1WAWA 1ME9A 1QASA 1FWWA 1HGYA 3UJRA 4HZ6A 3EDEA 3LXBA 1Z7AA 3IIOA 4ZQPA 4TTUA 4WY0B 1ITCA 3ES7A 2C0AA 3JRKA 4GJJA 4WKFA 4FNSA 4D6HA 3N6HA 3LS9A 2A7RA 2QDDA 3WDRA 4PTVA 4LVAA 1XGEA 3DKJA 3GB6A 3PANA 4FHAA 1UASA 3UW6A 2DVUA 4MDPA 1C92A 4K1GA 3W1LA 2J47A 4D8AA 1TV5A 5I77A 1UMYA 4LUTB 4JGDA 3VNYA 3LCFA 4HYVA 4GYFA 3S6DA 5L6UA 1TTIA 3G0XA 3CUJA 3BLFA 3GLCA 3B0YA 3LN3A 1UR0A 4QROA 1V6WA 5DQPA 5A3HA 1UWQA 3NZRA 2R9RA 4XKYA 4F79A 2GWGA 1XLJA 4H7ZA 1BSIA 2WHMA 4M3PA 4UR8A 4QHRA 5JBEA 4HGXA 1J0JA 3WNPA 2VCCA 2SFPA 1PBGA 4C60A 3EB2A 4JTEA 1F5ZA 3PZNA 4LUSB 5CPSA 1HN1A 1M68A 2D23A 1DOSA 3IANA 3PAJA 3PTKA 4KS0A 3M9YA 4AY8A 1K9EA 3M0IA 1EX5A 4D1JA 4FK9A 5CZ0A 2CBVA 5CXPA 1CB2A 3RLHA 3UF9A 2OEMA 1WQ5A 1TV7A 4JIEA 3AS1A 2V69A 3ZZ1A 3L0GA 1XIBA 3DG6A 1JD9A 1LRTA 1E6RA 3HFTA 1BF6A 2IXVA 2W91A 1JPDX 1IXNA 2QCLA 4DXVA 1XCXA 1I1WA 1Q6LA 1VZWA 4EX4A 5HQLA 1ME8A 4Q8TA 1K02A 3CUHA 2QCNA 1GJPA 4JNMA 4C7GA 4RR4A 5GJMA 5DMNA 1G4EA 1H2JA 1VS1A 2YDAA 3DHDA 4L9XA 3QZEA 1S5VA 4O1FA 1PYMA 2ZXDA 4AWTA 1UD2A 2A3AA 2AGTA 5BOEA 1C9DA 5JXQA 3W74A 1Q45A 1XM3A 4CLMA 2Y7GA 1PTAA 3OGVA 2DW6A 3BLOA 1G7UA 1BRLB 1J8VA 4G5DA 3OQ8A 4GKLA 3B8DA 3LCIA 1DWHM 3HURA 1ICSA 2W9MA 3L23A 3Q58A 1B1YA 3MMWA 4S23A 1L6SA 1M6JA 2FYMA 1WZMA 3VZZA 1BYBA 2XYLA 4ZFMA 2B4GA 3UGRA 2OWWA 3VGEA 2OSXA 3KOWA 1ISZA 1TMLA 3ITGA 3ZLFA 4LV9A 4JEQA 3KM8A 1JI2A 3PPCA 3C2VA 2AMXA 4FS9A 2VC9A 2YL8A 3BLKA 4A3QA