3WQGA

D-threo-3-hydroxyaspartate dehydratase c353a mutant in the metal-free form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNHAAATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate
pubmed doi rcsb
source organism Delftia
molecule tags Lyase
molecule keywords D-threo-3-hydroxyaspartate dehydratase
total genus 143
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3wqgA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3wqgA02
4WR3A 5GJMA 3B8VA 4ILSA 5IRPA 1TUFA 4DYJA 1FTXA 4KBXA 3BTNA 1SZRA 3WQGA 1BD0A 1SFTA 5GJNA 1D7KA 4LUTB 3UW6A 4ECLA 2OO0A 4QHRA 4BF5A 3AWNA 5GJPA 3NZQA 4Y2WA 3CPGA 3R79A 1L6FA 3KW3A 2RJGA 5BWAA 2PLJA 5FACA 2VD8A 2ODOA 4XBJA 2SFPA 4BHYA 1VFTA 3HA1A 1W8GA 4LUSA 3E5PA 3N2OA 3VABA 2NV9A 1VFSA 2PLKA 2P3EA 2RJHA 2YXXA 3ANUA 1KO0A 1F3TA 3LLXA 1L6GA 2O0TA 2DY3A 2VD9A 1VFHA 4ZGYA 1TWIA 4DZAA 3GWQA 1HKWA 3S46A 3WQCA 4PB3A 3MT1A 3OO2A 5FAJA 4FS9A 3E6EA 3NZPA 1KNWA 3ANVA 1B54A 4XG1A 3WQEA 1EPVA 4BEUA 3WQFA 4LUTA 4BEQA 3SY1A 4PB4A 3HURA 5FAGA 3B8TA 2TODA 2QGHA 1XQKA 1RCQA 1XFCA 4A3QA 4PB5A 3N29A 3B8WA 3C5QA 3B8UA 1NJJA 4LUYA 1QU4A 2ON3A 3N2BA 4AIBA 3WQDA 1HKVA 1NIUA 1CT5A 3AWOA 2J66A 2NVAA 4LUSB 1XQLA 7ODCA 4V15A 3CO8A
chains in the Genus database with same CATH superfamily
2YFOA 1Q65A 4OZOA 4UTLA 2ZDRA 1M53A 4YVPA 3VX0A 3QY7A 3UW6A 4M80A 3O0KA 3WEZA 1N2VA 2XIMA 4Q8VA 2Y89A 5F2GA 4M7TA 3MMWA 2P1FA 3EWXA 4RCXA 1DPMA 1FHVA 3EKLA 3VFLA 3IVSA 2PC8A 1PIGA 1TJ0A 1OFQA 2VENA 4KQNA 1Q7ZA 3TQPA 3CT7A 2J62A 5HWMA 2YB1A 4AMCA 2VMFA 3PJTA 1K8ZA 4O1CA 1I1WA 4H9UA 1Q8AA 2QDHA 3R7MA 4ES4A 5HNUA 5HPOA 3UA4A 1M68A 3WSUA 4GJIA 3L4YA 3PB0A 1JCNA 2VC9A 6CGTA 2I5IA 3V0SA 2YDSA 2I57A 1PYMA 1UBPC 4UFHA 5ECVA 2J24A 4B9ZA 4EXBA 1BGAA 4HYVA 2OYKA 3PFMA 5HNNA 3ZR6A 4FR1A 1NWUA 3KOXA 3RPTA 3SUUA 3ARTA 1L6SA 1TFVA 3B9AA 1HJVA 3KAOA 2OO6A 2W0UA 5C5YA 4FF5A 3DAQA 3TW7A 1J0KA 2Y0FA 1Q8JA 2D2OA 2OGYA 5FEWA 3V4BA 3HU7A 1QO2A 2QEZA 4AWTA 4YU1A 3LCGA 4MWAE 4NXSA 5G4EA 5A8OA 3JW7A 1IR2A 4WY0B 3GH4A 2QV5A 1VFUA 1OF6A 3LHTA 2KZHA 3U6WA 2AQWA 1R47A 4Y9NA 3TROA 4GI4A 5CPSA 2Z6IA 1LZOA 3SCQA 3PK7A 1BQCA 1XDLA 3QEZA 1RA5A 4FOUA 1LWHA 4UFKA 4O0ZA 3M5ZA 3LLXA 1EGVA 3CQJA 4ONVA 3NSNA 2G8ZA 4V28A 5I6SA 4Y9PA 4HJFA 2Z29A 3GC2A 4CQ9A 4HIBA 1BF2A 1EP2A 1P48A 1QFEA 4X9SA 4Q6JA 4IOTA 1RCOB 4PTXA 4J3SA 3TCEA 3SY1A 4KIRA 1X98A 2GVJA 3LPGA 3T4WA 5AOUA 3TN3A 4R7JA 1S5VA 3WK3A 1OABA 3SCSA 1NJJA 3HGOA 5FSEC 1UH4A 2ZE3A 4UNIA 4LBSA 4JD4A 4ATDA 4ORMA 2QGYA 3LHUA 3T07A 3G0UA 4WXZA 4R3UA 4P8XA 1HZYA 2VURA 1Z42A 2PF8A 3LRMA 3QR3A 4HYRA 2IPJA 4QISA 2RGLA 1Q6QA 3I4EA 3ITVA 2MUCA 1IXPA 4CD7A 4NY2A 3PHAA 3TN4A 3AIRA 2IKHA 5LNRA 1UOKA 2QCMA 2CZDA 3VC5A 1SZGA 2BASA 4NKCA 5HWNA 1WKEA 3ORWA 3RXZA 3MBDA 1WDPA 5E9AA 3W2UA 1HJQA 5IFPA 3AZTA 2PLKA 1XIFA 5HMDA 1BGGA 1MEHA 2X1RA 2YCKX 3PJWA 1W3NA 4MHBA 1Q2RA 1LTDA 3EDFA 3GTHA 1OFBA 5DMYA 2JEQA 2WC4A 1BXCA 3IACA 3BGAA 6PTDA 4HHLA 1JXJA 3KP0A 1HP5A 3MKVA 1BF6A 3GVQA 1Z6KA 1V6WA 2Q02A 4YTSA 4E5TA 5I77A 4BF9A 3F4WA 1FWIC 4NYYA 4AZGA 2XFYA 3CS2A 5HJYA 1E6QM 2I5QA 3N4AA 1WQ5A 4ADTA 3BE7A 4FMVA 3IJIA 4QS5A 4Z0SA 3HTWA 3DZ1A 3GU2A 3KVKA 4CD4A 2X05A 2D2HA 1A80A 4F8XA 2VZVA 2Z1XA 1H51A 4IIEA 2BB0A 1QR7A 2VEIA 1Y8BA 1PDYA 2BWGA 3M4HA 1AH0A 4AY1A 1AG1O 1FHLA 3SJNA 4EACA 4QNWA 4TVUA 1DJYA 4WY0F 1UUOA 1K9FA 5FF2A 3LXCA 1VPQA 3SCTA 3GKAA 2VC6A 3MZ2A 3RLUA 4ZQRA 3TDFA 5LNWA 3SGGA 1W56A 2HISA 1IHIA 4LSBA 4HZ8A 1NOWA 3SN4A 4AD2A 2B7PA 4DUWA 2W91A 3U7VA 2WVVA 4OUIA 4P7QA 1W9BM 3MCOA 2DFAA 2Y85A 1S3HA 4WEVX 4B5UA 4MNKA 3KHJA 1W32A 3NPVA 3W7QA 2Z6JA 2FDSA 2OJPA 3ZXWA 3LNMA 3S2LA 4GHRA 3T44A 1TPH1 4PN2A 4GE8A 1A4LA 4K6AA 4LQ1A 1OFEA 2OT0A 2RFGA 1J79A 4ZQNA 3VZXA 1D3CA 3OODA 2G3NA 4YMZA 1IV8A 4WD0A 3EXSA 5TBOA 1LBLA 4LCRA 1KM1A 2I56A 1RPKA 3UXKA 3WNPA 4LOCA 3GKFA 5FAGA 2UY2A 3GH5A 1TMHA 1SFJA 2VFFA 4E2BA 3VX1A 4YHEA 1WUFA 3ITTA 3PB2A 1CZ1A 3NM1A 1ITCA 1PYFA 3U5UA 1FWRA 2UBPC 1CGVA 1H60A 2V38A 1PJ9A 4IG2A 3U2ZA 3AIQA 2F6UA 4QFUA 3WL1A 3VOGA 5EY5A 1LOQA 3AO0A 4B9YA 3O3RA 1JDDA 1R30A 4HCLA 3MBFA 3G6LA 1HF6A 3GDMA 4Y90A 3L4VA 3MUCA 4M0XA 5FEZA 5AC5A 3E9AA 3IGHX 4JTUA 2WNQA 5A6KA 1DXFA 1XX1A 3SUSA 3OOQA 3UG3A 4IMGA 2NXHA 3B05A 3FXGA 3PZUA 3KL0A 4AUBA 3BLDA 4GOAA 2LLEA 1IE7C 4F66A 1NDYA 3TYDA 3TONA 4PULA 3HBLA 3T05A 2Z27A 5JUVA 1I2PA 1J0YA 5GNXA 2AGTA 3IGUA 1U5VA 4OWGA 3TP4A 3JZEA 4K8HA 4RUBA 1DIDA 1PEZA 1H49A 2QJJA 3COTA 2GLKA 4J3XA 3C4UA 4W7VA 2CKRA 5J5RA 1VB9A 2CLOA 4KGLA 1THFD 3OGVA 1UIPA 2R1LA 4C1KA 2CEQA 1S38A 1PZ1A 3WQDA 3PZVA 4NJJA 2HV5A 2ZTJA 1A5KC 2Z2BA 2CERA 2J27A 5HWJA 3UYCA 3BG3A 2EG8A 3OGRA 4WGHA 2PBOA 1F6PA 2QJGA 1R8LA 4EIVA 1I2RA 1I75A 3WQ5A 1ICQA 4J5NA 1YTDA 1LYXA 2VFDA 3FK4A 3THDA 2I7GA 2WCAA 1M6JA 1DKWA 5DRCA 1HVXA 3DFPA 4XZIA 3A64A 4AD3A 5CCZA 2P10A 3RIKA 1C9WA 1ZSXA 4FXFA 4US6A 4G1NA 5GNYA 4ZSTA 5FJRA 4TUFA 1F3EA 2A5HA 2NQ5A 4W8AA 4UBPC 1VPXA 2OWXA 4YNGA 4AY7A 1JVNA 1ISVA 2P3EA 2BP1A 3QLLA 1UMYA 3V18A 1SUXA 1H5YA 2E40A 2YW4A 3G1RA 4DZAA 3MV11 2PZNA 4XBSA 5JIPA 4JDBA 4U31A 3VD4A 4DM2A 1OEPA 3UWZA 5IHSA 1OJXA 1NSJA 1W17A 1EH9A 4ZTYA 4JZ5A 2FGLA 3T2OA 2GUUA 2YOCA 3BLFA 1BSLA 3B8TA 3LY0A 1V77A 4B15A 2OKTA 4RKAA 1XHGA 3HPFA 1JQXA 4JFVA 1XGEA 1UD6A 1H1NA 1XIMA 2QDDA 3OZMA 4GVFA 5BXRA 4MY1A 5ENLA 4DJFC 1DIOA 4WLCA 4OECA 4HKPA 3UPWA 3NQAA 4QTGA 4DAIA 2HVMA 1YADA 1WDWA 1GVRA 1VS1A 3BZJA 1OX5A 3EDJA 3WLNA 1I6NA 3BTNA 3DHFA 4JR5A 5F4WA 3A3WA 1AH4A 2R1MA 4UQEA 1F6YA 1LG2A 3KLKA 4LAMA 4PBFA 1KM3A 5CZ0A 3SDOA 1YDNA 3BO9A 3IIPA 1XPYA 2VR2A 2PPGA 3PAJA 3AJXA 4B2DA 4MADA 2F6XA 3BOFA 2BFGA 1CYGA 1I0BA 2DQXA 1O7AA 4UFJA 4NT0A 3IV3A 4MWAD 1AQ0A 4URIA 5JBFA 3RMJA 3AZSA 2PGEA 2V8ZA 3WDRA 3MTWA 3ZO9A 3C2YA 1XUZA 3F5KA 3ANVA 1DJNA 3LXBA 4OJYA 2Q6ZA 2J6VA 4A8LA 4Y9MA 4P7OA 3V5FA 4RPQA 2QW5A 1IZCA 2VZSA 3WF2A 4CN1A 1DJIA 3NSMA 4B3KA 6TIMA 3AXIA 3AIUA 3NGJA 1WYIA 3WQ4A 5FF4A 3A22A 4NAFB 2OZTA 5F1UA 4AIBA 1HJXA 3AIEA 3ZR4A 4DJDA 3CLMA 3N2TA 1TO3A 4QG9A 4C90A 3BZGA 3DFQA 5CPLA 2I16A 3TNBA 2ZA3A 4HD5A 1FX6A 1CTNA 4LBRA 3EB4A 2WKLA 3LPOA 3VNIA 2P8BA 4PMOA 5KZDA 2AKZA 3WLTA 3CWOX 4TQTA 5D38A 1TTIA 3SQMA 2YX0A 2GFTA 1JZ6A 3H26A 3B0XA 4NF7A 1MW1A 2R1NA 4C6BA 3KBNA 4DF2A 1VFLA 3VOJA 5A95A 4O53A 3T7VA 4LVBA 3UZJA 4YCPA 2RJHA 2JK2A 4M81A 2BSLA 1V02E 1G1YA 3OB8A 4KEUA 5IOBA 2PP3A 2NQJA 1EP3A 1Q4WA 3VIGA 4R9XA 4QGCA 3OHIA 1FVPA 4HPNA 4Y8FA 4EANA 3P67A 1J0IA 4XAGA 1M04A 3UZYA 3AAMA 4W4QA 3EOUA 4D6JA 1U1JA 3L4UA 1OFDA 4FLOA 1Z8AA 3OZPA 3TJIA 5DLCA 1SO4A 5RUBA 1X96A 2WPBA 3HIJA 1QW7A 8TIMA 1TJPA 4DO4A 3C2VA 1NDWA 1BXBA 2VC7A 4M29A 2PDFA 1JD9A 1UQZA 4AIUA 1QCWA 5BOOA 5AKQA 4US5D 2OSWA 4WJ8A 4IL0A 4O1AA 4L4OA 2QULA 3CYVA 3GZ3A 2G41A 3VNZA 4IQLA 4LS2A 5REQA 5D30A 3T40A 5LXEA 1HL9A 3VU2A 4B90A 4CEUC 3I7SA 4K38A 3F2BA 2CZ5A 3LV5A 3BUVA 4XVDA 4MG4A 3M5VA 2E3ZA 3C2OA 4DI9A 1XDMA 1E5JA 3WQOA 2V68A 1YXCA 1VFTA 2YW3A 2Z24A 1QAPA 1I2OA 3T0DA 1MUWA 1HO1A 1AMYA 1SZNA 3BOLA 3RNDA 4JTRA 4FSAA 4Z1AA 2ZWYA 3MANA 2J7FA 3KOZA 4J3TA 3TWBA 4V1YA 5C7HA 1TR9A 4F2UA 1RV8A 2PGRA 5BW6A 1UD8A 2QZRA 1CGUA 4ICNA 4LNCA 3BG9A 1EQCA 2H8XA 2GSJA 4AEEA 4DUVA 3MKCA 3VUSA 1B57A 4HMEA 1PCWA 5HNRA 2OX4A 3SCNA 3OBKA 1JYWA 5EMYA 3LTSA 3ES8A 3EDKA 5LA0A 3G2GA 1QUMA 1X6NA 1GVSA 4X0NA 4LYPA 1GJWA 1I60A 3BMXA 2XDFA 4HJWA 2CLKA 5BYWA 3ZVHB 4PSRA 1M7JA 1XKYA 3CV7A 2V6AA 1CGTA 2B31A 1XWYA 1A5SA 1H11A 4KETA 1VCGA 2RKXA 2W61A 4Q4QA 4HU3A 1M9HA 1R5YA 1RJPA 3W75A 1JR1A 3DFOA 4TX8A 3A23A 3GU1A 4XTDA 1NDZA 3KOYA 1CXKA 1V6UA 2Y61A 3PPFA 3ARZA 2HNEA 4B5VA 5FIPA 2GK1B 3GDTA 2OXNA 1X6LA 3PM6A 3NPUA 1K77A 4WDUA 2ZX7A 1AW2A 4JQ3A 5GPRA 2ACUA 5E6ZA 4ZB5A 1HGYA 2XIQA 2VX4A 4WK9A 1L6GA 1MMFA 4HHHA 1BG4A 3KDNA 2XIBA 4CQDA 4MAZA 1XLEA 3M16A 4JXCA 3P84A 3FHQA 4ENLA 2X2GA 4RE3A 2Y88A 3FA4A 1KM6A 3D3AA 4HPJA 1XI3A 1C7SA 4LUJA 3GR7A 3W27A 1IIGA 2NT1A 4S3FA 2J47A 1ME9A 3N73A 3NQFA 3LHZA 4QJ1A 3USZA 3B4UA 2J7GA 2VEFA 2WBGA 4ALDA 3WNNA 5D9OA 1P43A 3EX3A 4QLJA 3CWHA 3UJEA 4REQA 3GC4A 4KRZA 1UIOA 4G6CA 3IJQA 4GVHA 1T99A 3GTNA 1US3A 3CEPA 3VNJA 3PTQA 4RV3A 4EF9A 5HXMA 2FZDA 4PMQA 2XIIA 5LHEA 1LT7A 1TR1A 2XIJA 4QQ3A 4C6OA 4P8WA 4QHRA 2UWFA 3DKJA 3W53A 2WCSA 2WJFA 4UFLA 4OOUA 5HR6A 2XYLA 5D2YA 5FACA 3GXPA 1LJYA 3M9YA 3ARVA 3VGGA 3DESA 3NURA 2VQUA 2OEMA 3LBMA 3O07A 3PUOA 1AW1A 4KT2A 2DZTA 3EDDA 5IBXA 2WSYA 1TJ2A 5L6UA 1KFLA 5SWUA 2G3JA 4UR7A 3QSTA 1JJKA 2ZBTA 4IH3A 2Y24A 3M0KA 4E2OA 3ARRA 5FCZA 1RBAA 2AMXA 2ZTKA 1TJ1A 4CGTA 2J88A 1ZPTA 1FXQA 3A4XA 4ZOCA 4Q8NA 4S39A 4BQ5A 2E68A 1WXZA 3H2FA 1ME7A 3N34A 1YQ2A 2B4GA 1EL3A 3RCNA 4N7QA 2ATMA 4AC1X 1N82A 3TNOA 1GW9A 1E1FA 1MYRA 3RLHA 3S1GA 4GBUA 5F2MA 5I78A 1HVQA 5EB8A 4WCJA 2XGZA 3C3NA 2RDXA 3VK5A 1G01A 3D0CA 1ISZA 3RFAA 4MB4A 2EPOA 1DWJM 5JIWA 4MUPA 1L6WA 1TTJA 4I9MA 3H4WA 3N11A 4IFKA 3S9IA 3VYLA 1D3HA 4HTBA 4MLJA 2GUYA 1CDGA 1NF7A 2GJXB 1WKDA 1XLBA 2F7FA 1OFPA 2J74A 3J7HA 5EMUA 2XSAA 2FYMA 1P1MA 3H53A 1OX4A 3UVIA 1FWAC 2ZYFA 3PAOA 4MF4A 1PCKA 1F2JA 3S5ZA 1FXPA 3NVTA 5AY7A 1R2RA 1LDCA 3SCPA 1XCXA 1WZMA 3QLDA 3EWBX 1H7NA 4G2DA 1FWEC 5BRPA 2GVYA 1AVAA 4GLEA 3Q94A 5D2WA 4HU0A 4H7CA 3U5YA 4J3VA 1S5MA 1XLHA 1A53A 2Z1SA 3B8SA 2PCQA 1C90A 3QMSA 5KINA 4IIBA 4CVUA 3CB8A 4ROQA 2G3IA 1VENA 1I2NA 4H4IA 1UWAA 1BWKA 3S2NA 5JQ9A 3B03A 3EOLA 2GOUA 3B9NA 3A9BA 1J4EA 3IV8A 1V3KA 5EBUA 1B3WA 3ZLFA 4GFIA 1FWFC 3B8WA 1NOUA 1WBHA 4BA0A 3ZT5A 4WSJA 3HMCA 1SO5A 2DZAA 4OIFA 5E93A 2Q8XA 1LQAA 1TJRA 3CASA 2ZX8A 5C55A 1U1UA 3UD6A 3VNLA 2C18A 1FWHC 1LBMA 5LXXA 5IDZA 1F7BA 3AS2A 3GS6A 4K37A 3HO8A 3UCDA 3BW2A 3FKKA 1H2JA 5CG0A 2YL6A 4OVXA 3CBWA 4S3GA 3OVQA 4DI8A 1DXEA 4CN4A 3IUIA 1SJAA 4IMFA 3MPGA 3PR2A 1A5AA 1C92A 1Z9AA 2IW0A 1O66A 1XKJA 3GZAA 4IP7A 4QE4A 3AUOA 1I8JA 1DIKA 4GQGA 1GOQA 1W5PA 3I3EA 3O6AA 4GZJA 4CU7A 3LB0A 3EPOA 3P81A 2F38A 3G0XA 1DWHM 3LPFA 1W1YA 2CLIA 3DFYA 2CXGA 1V0LA 2A7PA 2ICSA 2WC3A 2YL8A 5CJMA 2TYSA 3GDLA 4DJED 3H70A 3ZZ1A 4MJ2A 2YXOA 3GUGA 3W70A 3SZ8A 1EOMA 4NP7A 1PX3A 3H6OA 1FFQA 3CZ8A 2A3EA 2J66A 1OX4B 4AVOA 1QWKA 2PDQA 1CXLA 5DMNA 1LRNA 4UTUA 1FWTA 4C6DA 3MMDA 4PH6A 4PFMA 4E8DA 3MW7A 2ZZ5A 3MKKA 4AEOA 1BYDA 3FOKA 1HL8A 4W7WA 2WAGA 4L65A 1QNOA 3ZLGA 3IWPA 5I02A 3KTSA 1QOPA 5MKGB 1YX1A 3EEZA 2QAFA 4GNKB 2VD8A 1LL6A 3NQ7A 2XHYA 1UZDA 4B5NA 3P8IA 3FYOA 4GVGA 2ZRYA 1KCXA 3FNDA 1GORA 1DYSA 2DSZA 2ZUMA 4V1XA 4LCQA 1GG1A 3WBEA 1DIEA 4QG6A 7TAAA 2NZLA 4D6IA 3PUDA 3U4FA 4FP1A 5I2UA 1VFOA 1A5UA 1WKFA 2HQAA 2J13A 1BAGA 4NXKA 4L64A 3VIFA 1LLZA 3WLRA 3FV9A 3A4JA 4YPJA 8A3HA 4HOZA 2J7EA 4GYPC 1K9DA 3L4WA 3QGVA 3TR9A 2P50A 4GH3A 1QI3A 3GHSA 3W02A 3AJ7A 2XPKA 1EB3A 3GYEA 1V0NA 1LORA 3EWUA 2ZRXA 3W01A 4GACA 2ONEA 3QHMA 2WMIB 5FI8A 3VCCA 2OODA 2CIPA 3TX9A 3O9NA 1IWBA 4FF7A 3M0LA 1NP0A 3IJLA 4A6GA 5C2CA 4M6QA 2NVAA 1R38A 3NOEA 2ZVIA 1DJWA 3HQPA 2PDHA 1K3UA 5C8BB 3PTMA 4IGMA 2OG9A 2PWEA 1L9WA 3DCPA 4DYJA 1ONXA 2XFFA 3KRBA 1RY0A 4O4VA 2C79A 2J9ZA 4HSHA 3S1UA 4MAVA 3K4WA 5FJUA 1ONWA 3NQ8A 3SM0A 4GY0A 4DZ5A 3KXQA 3ITXA 3WUBA 2JKPA 1MUCA 3DIPA 8XIMA 2CLPA 1OCBA 9CGTA 1HP4A 3BICA 4UQCA 4DJDC 2R8WA 4E2VA 3DI0A 1UD3A 3F5JA 1Y0EA 3CZJA 5M1TA 1VCFA 3T2PA 2PDGA 4ZXOA 4YCOA 4PB3A 2ZFAA 3RJYA 3GAKA 3MCNA 2PCEA 4E4FA 4U4MA 5K9XA 3KTXA 4N2YA 2Q71A 4PEEA 5A8GA 1EEXA 1G67A 3WEMA 5LIKX 3A47A 2ZA1A 3MV01 3GU9A 4HGXA 4FXRA 1JYXA 3NQEA 2BVTA 3FYYA 3GD6A 3KCLA 1JPIA 3AUJA 1WO2A 3ENLA 3R0UA 3WDIA 2PDJA 3BDKA 3NZ1A 5I24A 4IGSA 4GBDA 5K9CA 1SO6A 4LVGA 3GDKA 1V08A 5E70A 1QPOA 1GZ1A 1Q66A 3R89A 2XN2A 3EKZA 4MJZA 3MSRA 3H54A 3B8VA 4S3CA 2G96A 4WJXA 3S6TA 3VCRA 5DO8A 3LQGA 2Y1HA 3WH8A 2VGFA 3TYUA 3OG2A 2QPSA 3CAQA 3W0KA 3XINA 3EX6A 4OHQA 4H2CA 3OZYA 1LM1A 1UHVA 4S23A 3VM7A 2PB1A 4JDYA 3D5HA 4PFHA 3PWGA 1ECEA 1KV8A 3O7UA 2PDWA 4XBJA 3QOKA 4WQ6A 5CZSA 4NHVA 1H7RA 1ZHAA 3GW0A 2GK1A 1KWKA 1XISA 3WJXA 1EGMA 1E71M 2OMAA 4LT9A 1GKPA 3T78A 3FEMA 4H9XA 1TTPA 5CC3A 3CXOA 4LY4A 1AD4A 1KCLA 5CSYA 1C9DA 3MMUA 4K2SA 5JH2A 2O9RA 4KEVA 4C5ZA 1TE6A 3OU8A 4IJBA 4MVAA 4GKLA 3PF3A 3W7LA 4B3ZA 5DCDA 2CZEA 3KRUA 3BW4A 1JF6A 3S9ZA 1KGXA 2TMDA 4N9CA 5FL1A 4GRSA 3HFYA 3W82A 1Y5VA 1CB2A 4J3ZA 2CITA 1JDCA 2QJHA 5CBIA 4B16A 3FLUA 2VUNA 3RPDA 4C6CA 1TV8A 3HV8A 2GYIA 4PUMA 1KTCA 5AHIA 4HOXA 1QHZA 2YDRA 2PGWA 1S2UA 4TVCA 2FZ8A 3IAPA 2X7VA 4JBRA 4WDXA 1GTHA 4QJ5B 2BHYA 3S8HA 1TPUA 4ERGA 1T96A 4YWIA 4EPBC 4EWJA 2XFRA 3VZZA 4C7GA 1OFRA 1OC6A 2C16A 5A94A 3HQOA 4ZQMA 3FJ4A 1ALDA 3CUZA 3W7IA 4XTIA 4Q33A 4GCXA 4TXEA 4J3UA 3R94A 2PP0A 1TV4A 3OLEA 5T8GA 3S2JA 2HDJA 2V67A 2J7CA 3STEA 1R7OA 1TV3A 4PTMA 1GQIA 1TE1A 2IPFA 3ZM8A 4Q4OA 4GX9A 1WA3A 2A3LA 4W9TA 2EG7A 5C9UA 2NV9A 4L1XA 5AHNA 4HK5A 1Q6FA 3Q4DA 5HA7A 2HZGA 7CGTA 3VCNA 1B3XA 4BR1A 4YYCA 2IKJA 1BYBA 4XD6A 5BCAA 3C61A 8CGTA 5H8UA 3A21A 3FN9A 2HJPA 3R8GA 3VKKA 3LD5A 4FLQA 1B54A 2PC4A 1XSIA 1IEXA 4TMCA 1J01A 1ESWA 2DJXA 1MUMA 3GNRA 3N3TA 1QPKA 3IVUA 2WV8A 2DZXA 4DZHA 3D3FA 1KM5A 1P6BA 3R25A 3NEHA 5HANA 5LGXA 4GYPA 1ODUA 1YW1A 4M8UA 1HKVA 2O7QA 2JIEA 1GYMA 1H3GA 1XIIA 4WKAA 4LW7A 3JVAA 2OFJA 2XSBA 1PKMA 1GCYA 3QQWA 4XBKA 3EPMA 5KZEA 3F4CA 4HPGA 3HZ3A 4PL1A 5HINA 2IKIA 4JTGA 2HRWA 3KHDA 3BL3A 3SRDA 1M3UA 3A9IA 4JN7A 2EKCA 1PZ0A 1XLMA 1ZU8A 3G6MA 1NM9A 4ACZB 1KWGA 3ITCA 5D8ZA 1EJ7L 2EPHA 3IANA 2NWSA 2QUTA 2VWTA 3W22A 5K9DA 1KGWA 1VBHA 4QSFA 2J9YA 3DHPA 3KRZA 1X8CA 4Q22A 1GQKA 1LBFA 1KRCC 4YXGA 3WF0A 5FEPA 3ZJ6A 4BQ4A 4UUIA 3S0CA 4LVFA 1EPVA 4LFYA 4QCFA 3FJLA 3HQNA 3SCUA 3VE9A 1GUVA 1F8MA 1OYAA 1ENUA 2UY5A 3TJ4A 3FX4A 3W1RA 2R24A 4O16A 2ZUSA 3QKZA 3LXAA 1PKYA 3LLFA 4GQRA 1V7AA 2Y2WA 1NWSA 4YTQA 3V5OA 1WP6A 3CQ0A 4LCSA 1NF0A 1JYNA 7TIMA 4YVVA 1TTQA 2VGIA 2FKPA 3GQYA 3L12A 4X22A 3B4YA 4KWVA 1H63A 2VCAA 1YKWA 1BHGA 1ZALA 4W88A 2QCFA 1NAL1 4UMBA 3H22A 9RUBA 3BSGA 3ZIZA 5DY2A 3AMLA 4FX8A 1UCWA 2NUXA 3ARQA 5GJNA 2GDQA 1QDSA 4H83A 1GOMA 3DERA 3KVMA 4ZENA 3LNPA 3QGKC 3CV6A 5I79A 1BVWA 2GOKA 1BEUA 4FALA 3R12A 3N25A 2A7NA 1HXJA 3ZSSA 4XWUA 2YZ5A 3EBVA 3TIMA 5M5DA 3O05A 5BU9A 4ZODA 1N8FA 5A6AA 4O18A 2DZPA 3VNMA 3L5LA 5C9ZA 1EA0A 1IEWA 2FVMA 3GM8A 2PDPA 4MJMA 3BSHA 1KLYA 5K7JA 2HSAA 1C7TA 3MU7A 2DT3A 1HKWA 2R1PA 4LVAA 1BPLB 3TUUA 2PP1A 2KX9A 4A21A 2R94A 1Q63A 4EVZA 5GQBA 2IKGA 1HJSA 1DXIA 4RDWA 2D69A 2PMQA 2V5LA 4WVXA 4BEQA 3H7VA 5DX7A 3PG9A 4U3AA 1YPXA 2V5JA 3QW4B 3M07A 2QIWA 3P93A 4UMAA 3NL5A 4MKSA 1S2CA 2EKGA 2HWGA 2H9AA 1HIZA 4LH8A 2BLEA 2OOGA 4A29A 3L0NA 5IBXC 4DXVA 4MWAB 2Q3OA 4HNCA 3C2EA 3LCIA 4Q3MA 4IX2A 5T26A 3W6LA 1WUEA 4V15A 2AOSA 4LV4A 1HKJA 1ZFJA 3AIVA 4HZMA 2A3BA 1KB3A 3WQ8A 2WNWA 4AD5A 5IRPA 4IP4A 4QM1A 1O68A 2F2HA 4P7LA 4UTTC 3W9ZA 3MYOA 4DO5A 9XIMA 4QEHA 5AC7A 3TVAA 4GA8A 1GVEA 1OGSA 4QAWA 3VILA 3NG3A 3ITLA 5C2XA 2XSXA 2E9BA 3GSMA 2VELA 4MOZA 4HN8A 1DQWA 5AC6A 2RUSA 4IXXA 4QE1A 3CTTA 2XH4A 4GK8A 3KBJA 2ZUNA 1EEPA 4NAEB 2E1DA 7XIMA 1T40A 4NX0A 3AMGA 2J75A 2YPIA 3F03K 3SCOA 4A35A 3K2GA 4LB3A 3VVGA 4XO7A 5DQPA 4LC8A 1CBGA 1QO5A 3BLLA 4IFRA 1SR0A 3RR1A 4QR6A 3DGBA 1MZHA 4NVTA 5CGMA 3WD2A 3PN8A 1B4EA 3PP7A 1W3LA 2YZRA 4QXIA 1XQKA 4P7NA 2OQHA 5CPQA 1O1HA 1GHSA 1SM9A 4Z2JA 3MMTA 4XAZA 3M7SA 2AAMA 1UKQA 1OINA 1QU4A 3EXRA 4F3HA 3FGCA 5H6HA 1CT5A 4HZ6A 4F9DA 1US0A 4ICMA 1FA2A 4MGGA 2QUNA 2HS8A 3AFBA 1OZMA 3LHYA 3W28A 4KBXA 2HK0A 2HVNA 5HAOA 3G1FA 3IRDA 1M7XA 1UPMB 2QQ6A 4KMQA 3RLGA 4DJEC 4ERAA 1B3YA 3FCPA 3G22A 5D2XA 5DANA 4HNTA 1HNYA 5IFTA 1CIUA 2ZRWA 1V3JA 3C0JA 4G5DA 4HT3A 1U33A 2RJGA 3QOMA 2NT0A 5CBBA 3GO2A 4NJHA 1J18A 2C0AA 4QP0A 4F0KA 1FCUA 4OU1A 4DNMA 4I90A 1KFWA 1BKHA 1QOXA 3W2NA 4EF8A 3N2XA 2FH8A 4IL2A 2QDGA 4NZ1A 1A3HA 3BAKA 1GWJA 4JPGA 3N1AA 1MQQA 4QJ4B 2VX5A 3TCSA 1DJQA 2JKAA 1TG7A 1KGUA 3CB3A 3IIVA 4BI5A 2ZXBA 1KXVA 4Z2GA 2Z1VA 3ID7A 3WNMA 3WDPP 4IIDA 3WD0A 1UKTA 3L66A 3BAIA 4ZZ9A 3DHDA 2BHZA 2FIQA 3W6MA 3QF0A 1OWQA 4ACYA 3UXLA 4M51A 5AYIA 5FOOA 3GXFA 2D3NA 4H7ZA 4ADUA 4NAEA 1ZJAA 2IQDA 3OQEA 5ECUA 2OVLA 5AFDA 5U4NA 3IRSA 5CPNA 4ZSUA 1FP8A 1YEYA 3THQA 3C6CA 1KXHA 1NVMA 1KCZA 1KLZA 1J96A 3KUMA 2EPKX 3HGJA 2DSUA 3H2AA 3ABQA 4S3BA 3W72A 2DSVA 5EKYA 3WD3A 4BF5A 1RD5A 1LF1A 1YTKA 2BV9A 2VZUA 2XINA 3QRHA 4B91A 3K4DA 4GUHA 5F1VA 2DH3A 3M0VA 1TWSA 2REQB 4JTHA 3VABA 4EXQA 3NQCA 4JYEA 2P76A 1SFLA 4A8RA 3W74A 4XB3A 1EOKA 4AC7C 1ODZA 1HN1A 1XXXA 1H41A 2JBMA 3A4WA 3TC6A 4H9MA 2OCZA 4W7UA 1FBAA 4TMBA 2AGKA 4Q8TA 4Q7BA 1F07A 3HJEA 1G6CA 4AH7A 1JIBA 1K7XA 4AD1A 4XKMA 2E9MA 1XINA 5HUOA 3OLIA 1W1A1 5DBTA 1PTDA 1VBUA 1VIWA 3QXBA 3REQB 4UTHA 1WE5A 3BGJA 3CH9A 2E6YA 4HNNA 1E6RA 4F40A 3SN0A 1VH7A 1KTNA 2V81A 1J6PA 4DJEA 3VC6A 3AHZA 4ZOBA 4FXJA 4X2PA 5ABEA 1VHCA 2V5CA 1VBGA 1A0CA 3QHOA 3THUA 1XRFA 3SRKA 2VJXA 4DXKA 1TZZA 3MWAA 1TZ9A 3OVRA 4D9PA 4S3KA 3URNA 3RYSA 3S47A 2JKEA 4WHBA 1RD6A 3K5XA 4C60A 1UC5A 1UKPA 5H91A 2O9OA 3G1VA 3I7QA 1R9ZA 4PCPA 2WQPA 1TB3A 2X2YA 4XD4A 3BJTA 4YTRA 2X1TA 2WSQA 3VDBA 4JFUA 1KFBA 3CUJA 3W76A 3N2OA 2HBVA 2RDWA 4ZOEA 1RQEA 2EEXA 1TPDA 1JULA 2X16A 1T5AA 4UMCA 1FWWA 3B97A 2JE8A 4C6LA 3GG8A 3RM9A 2WZMA 5FD0A 4AB4A 4LWWA 4UTWC 3VD5A 3VOFA 4GUIA 3TW6A 1MFVA 4HB7A 2O9PA 4H1ZA 1RBOB 2CBUA 2XGIA 1YBQB 2E25A 3GVGA 2VX7A 4Y96A 2ISFA 3POHA 2GVEA 3BCJA 2B7OA 5I09A 3LLDA 8XIAA 2BS9A 7ENLA 3FSTA 1ZENA 2WK2A 1C8VA 3VMPA 2Q09A 2CC0A 3KM8A 2F61A 1PV8A 5CEWA 2HBXA 1QBAA 3MA8A 1FTXA 3GHRA 1UC4A 2VRKA 1QNSA 1RLCL 2YKKA 3P74A 1FH9A 3ME3A 2OYMA 3W87A 4YTUA 3Q65A 4ZFMA 3VM5A 4KRUA 2V5BA 1XIGA 5BRQA 3MB9A 3H2CA 4Q7NA 4WY0A 4MB3A 4WGXA 3L5MA 3LRKA 4GNJA 4L6OA 2VDHA 1XCWA 3W1XA 4AX6A 4EX4A 3PZIA 3FDGA 3S1VA 3GNXA 3L68A 1JPDX 1DWFM 2V0TA 2WMJA 1Q2SA 3E6EA 3GTIA 5A8NA 4KCUA 1SGJA 4XG1A 1EX5A 3CQKA 1K8YA 3W7MA 4O52A 3VD9A 1RP9A 3VDCA 3ALFA 1EDTA 2UV8G 4DUOA 5I0DA 1ZB5A 4LB4A 6XIMA 4RDZA 3AMDA 4TV6A 4IUGA 3QFEA 4HHPA 1ZRQA 3BAWA 4LEQA 1OF8A 5FF7A 5EMKA 4GZIA 2VFIA 3SN1A 3IARA 3S2MA 4GZEA 4JYFA 3WX7A 1B4KA 1EYEA 3E0VA 2PTXA 4HA1A 2QLYA 3MSDA 5EU9A 1IT8A 1XYCA 5XIAA 3W3OA 3RO6A 2ZIDA 4RV8A 3T6CA 5E0KA 5D32A 2Y63A 2DVTA 2ISSA 1CGXA 1R87A 2C7FA 1MFUA 4ZMGA 3QR0A 1H1YA 2QMKA 3L5AA 3YPIA 4QS6A 3T8QA 1B9BA 3QMTA 4W93A 3QQ0A 5T9BG 4G8TA 5HDRA 4LUIA 4YIWA 1Q6CA 1A5CA 3LCFA 1KR1A 3M0ZA 3ZT7A 3SO7A 5FF0A 4KF1A 4G7FA 2D2JA 3CGTA 4QCEA 1F4HA 5G1YA 4DIAA 2FPVA 5KEZA 3QSRA 1U1HA 1SR9A 1KA9F 3MUXA 3LCLA 2PDXA 1JAKA 3NEVA 1SQ7A 5AHMA 1DORA 4M19A 1LOLA 3EMZA 2IQ0A 1HX0A 3P5YA 3EB3A 1I0DA 2Q8LA 4C65A 4C6JA 4BY3A 4PMUA 2EJ1A 4L1GA 5XINA 4IM4A 3CWNA 1LROA 3XIMA 4CNUA 3BWWA 5G1MA 1TWDA 3B06A 3N4EA 1TV7A 3EOEA 4CQBA 3NL3A 2OOFA 1NWTA 4JIHA 4DO7A 4DVOA 4YLWA 4MSSA 3NQ6A 2C1HA 5A2BA 1V4YA 4JKMA 2HTMA 5JBDA 2J6XA 1V6VA 4K8GA 1E73M 2J25A 4O4WA 4AZIA 5I03A 4U3CA 1YIXA 1R0MA 4AZBA 3FAWA 5CSSA 1K7FA 4DWDA 2QXWA 4XUGA 1VJZA 1ISXA 3KBWA 4MTVA 2WHLA 3UR8A 1GQNA 3RK8A 1RXOB 4Z0JA 1J2BA 2PLJA 4WF7A 3EDEA 3LEPA 1CW2A 1W8GA 4KESA 1JCYA 4JYDA 3SADA 1Q13A 3AIWA 2HK1A 3BGGA 1AA1B 4UOZA 4DB7A 2OZ0A 3WUEA 5DN1A 1J93A 2PDYA 3SRHA 1TRIA 3GFXA 3ITOA 5FJTA 3HJZA 3PZNA 3NZPA 4XQ6A 1GVFA 3PBYA 3URAA 2DIKA 3QGAC 3TXZA 1TPWA 1C93A 1HTIA 3QN3A 1Q45A 3AXMA 1PKLA 4GJJA 1FWCC 2XVPA 4XZ9A 1MXGA 3PJUA 3CUHA 1EUAA 1VIZA 2YL5A 3KS6A 2QCHA 2GDUA 1GOKA 1MSSA 1DBTA 1OHLA 2O4QA 1IXOA 2QV4A 3IAQA 3LRLA 1XIBA 1NIUA 2GWGA 3GTFA 2DORA 5AVHA 1GW1A 1JZ7A 2WSPA 2NQ9A 4GY1A 4M1BA 1RJRA 3MUAA 1IXQA 4LTSA 2BODX 4MIMA 1HKKA 1R3TA 5A6BD 3TC3A 1UKOA 2X42A 3IJDA 4NUWA 5BOEA 3BSMA 3WKZA 4LAZA 4N42A 2DZWA 2IPWA 4I8YA 2ZXAA 3UF9A 1E4NA 1S2AA 4I5UA 5C54A 4UFIA 3ALGA 2F6KA 2BNJA 1JDEA 3NZQA 3E96A 3W29A 1NARA 1E1CB 3R79A 1WBJA 3CAWA 4LNYA 3M46A 2PRLA 4WRHA 5CAHA 1YTEA 4K7VA 3U3HA 1SW7A 3ZVHA 3H2NA 1QW9A 2CZFA 3QH2A 3RG6A 3WEOA 2VGGA 2G0WA 2ZVRA 2X0SA 4GQ0A 1M65A 3PZ9A 4A3RA 4Z2IA 3AHYA 5FAJA 4DWSC 4AQLA 3K13A 5U7SA 3IVTA 1IGWA 1MI3A 3ATZA 1EJTC 5FJPA 1R3WA 4US5A 2IXUA 2PODA 4IX0A 4MYXA 3NQDA 4O12A 1V79A 1V6YA 3FA3A 1D8CA 5I3KA 2BXZA 3N2CA 5H8MA 3CIVA 1DHPA 3UJFA 5D2TA 2V69A 3M6DA 4ZQOA 5DXYA 4S1FA 4X60A 5GJMA 2NX9A 3T0TA 4A3UA 2PDMA 1XBYA 3P0WA 3AYSA 3GH7A 5TAOA 1MRQA 1PAMA 3MDWA 3UA3A 1BYCA 3B9EA 4JCMA 2OGJA 5LA1A 2HCVA 4XO6A 1G9HA 1L6FA 3FGCB 4JFSA 3RILA 4AEFA 3CLWA 1LCOA 2QKFA 5J5DA 4UCFA 1VFSA 5HJXA 1UZHA 1KBIA 1QNPA 4MWAC 3PVFA 5BROA 3VTRA 1XV8A 3EA3A 4UC5A 2ZUVA 3WMLA 3PBWA 2OR2A 3C0QA 2YBTA 4N9BA 5JXQA 1CLVA 5A6JA 1XBZA 3E0LA 2OSXA 5LNSA 1U5JA 3EZ4A 1R6WA 4A8IA 4J3WA 3LQLA 2G3MA 5D37A 4GI9A 4MYAA 3GXTA 3FSUA 3OBAA 1CLKA 4O54A 3URQA 1J2WA 1R3QA 3ARPA 3AHXA 1VRXA 1WNOA 1H0GA 4JGDA 2QUVA 5CZKA 4C6KA 1HUVA 1FP9A 7PTDA 1CI1A 3LM7A 2BVWA 3AXHA 4Q8WA 1SW0A 2CBVA 4LAOA 4QLLA 3TYZA 2YCIX 3USBA 2GQ9A 4S3JA 5EFFA 2WANA 1P7TB 1XYFA 4W86A 5HPCA 4GO8A 5I00A 3G8EA 1TUFA 5I3IA 1GNXA 2DW7A 4NG3A 1XLJA 3PWIA 1H7PA 4DPPA 2OWCA 3ITYA 1MW3A 2GJXA 1AZ1A 1RK5A 3VXGA 4KCWA 1KXQA 3RPMA 1R2SA 2BGSA 3M0JA 2YA2A 5M03A 4IMDA 2GJLA 3T55A 2BBFA 1XP3A 3BVJA 4LX4A 3TA9A 4D6DA 4KEMA 2JEPA 4AZ5A 3VAVA 1F5ZA 2Y4SA 4O57A 1LUCA 1QT1A 2NQLA 2ATSA 2NXIA 4B5XA 1EJWC 3GIQA 4AIOA 3TU9A 1UJPA 3AS0A 5MF5A 2FFCA 3WQCA 1VHNA 3F4NA 3OYXA 3OZOA 3WFLA 1D8WA 4JAWA 2NLIA 4JTAA 1QASA 4DM1A 3LTPA 1WAUA 3LSCA 3QW3A 2H9AB 4RE2A 3PSVA 4C6FA 2VWSA 4UR9A 4X3ZA 3W37A 3ARUA 3E74A 1V3HA 3LMZA 4AG0A 2WZTA 5TIMA 3VINA 2H90A 3WO8A 1ZS2A 4M6PA 1GPFA 3N04A 3SRFA 4DUXA 3HG3A 7ODCA 1UYQA 2WLYA 4FIRA 6REQB 4JEQA 3TV8A 5HQMA 5BU6A 2VRJA 3NGFA 5CPMA 3LZ5A 2PFHA 3E2RA 3KLLA 3BARA 3V5CA 4AVFA 2PDBA 3DYPA 3VKBA 1P1XA 4EOUA 4BQ2A 1VLWA 4KIEA 1A5OC 1DJGA 2I14A 2TRSA 3LGGA 4B4HA 1V3MA 5FESA 1WCGA 3FJNA 2R14A 1RBLA 4GIRA 3M0YA 4L6DA 1CXFA 2OWWA 1MNZA 1P0DA 2PWHA 1XH0A 3WCZA 3GNNA 2NSXA 1JNDA 3B0VC 1W37A 1HG3A 2YXGA 3QV7A 1JF5A 1X1NA 2OEKA 3F2DA 5A6TC 3NTYA 5BOFA 1XLFA 4R88A 2CBJA 2E6FA 4JEJA 4PMJA 4D8AA 4FNTA 5I7GA 4A4AA 3NZGA 3QTGA 1L6YA 2G37A 4AYSA 3KL3A 1XBXA 4GNVA 4D6CA 4RNFA 2W4XA 1CECA 1X38A 5HUPA 4DZIA 4Y6GA 2Z1BA 2J8GA 4LY8A 1A3WA 1QI4A 3KBSA 2R6OA 1DEDA 3A13A 4QE5A 3DFSA 1TCDA 1NQKA 1M41A 2Y8KA 4XUYA 2DUZA 4DO6A 1IWAA 3KS5A 3GHUA 4M24A 1MXDA 3S83A 3OJGA 2DT2A 4AHOA 4WR3A 1XLKA 3DUGA 4JTFA 2G4JA 2NXGA 4Q8OA 4PUUA 2EBNA 1XYZA 3KTCA 5KITA 3TFXA 1P4CA 2ZDSA 1ZLPA 4AZHA 1Z69A 4D6GA 2OKOA 2CLHA 2FTPA 1XRSA 2PUZA 3U57A 3UG4A 3CUIA 3W4RA 2BDQA 3IGSA 4LAUA 2DZVA 3RRXA 1W91A 2ISVA 4MY8A 3K1DA 1GEHA 1RH9A 5AYXA 3VFCA 4UTMA 5F4XA 1E4LA 3LTYA 1JFXA 2I9UA 4BI7A 1AW5A 1VYSX 1E9ZB 2VOTA 4PMVA 1R2TA 1NFPA 1KXTA 3CIXA 3WENA 3NFUA 3WLIA 1DOSA 3QV9A 1X1OA 3GG1A 3RLVA 3UNDA 3BCDA 4I6VA 4CCCA 3CV1A 1O5KA 3HQ1A 4W5ZA 4BFAA 4N9DA 5CH9A 2DZBA 3OA3A 5CPOA 4N6FA 4QLKA 1PWMA 1OIMA 5JVLA 1REQA 4IJCA 1XICA 4JIRA 3WY1A 4BK9A 1CENA 3WH9A 1GOWA 3AXXA 4G1KA 2FTYA 3RMEA 3DEQA 3CM4A 3V75A 2WC7A 4GVIA 4MZ1A 4Y8EA 4HNUA 1MEWA 3UZXA 1XC4A 1X7IA 4Q8PA 2H3BA 2ZXDA 3PTKA 1PSCA 3N9RA 3TLQA 4L4MA 1K9EA 1JZ2A 3FDKA 1BFNA 3ECQA 3EKGA 3APTA 3VI2A 2FHCA 3DECA 1DTNA 3WMCA 1CGWA 1E70M 9XIAA 5M3WA 1ME8A 1K70A 3TYEA 3BQ5A 5CSUA 3LCXA 1J5SA 3IJ6A 4P7RA 1CWYA 3PUGA 4PYSA 1A3XA 2HVOA 4XAYA 3RRAA 1Q3NA 2X09A 2QCDA 3H24A 5LSMA 4ZO7A 1P6WA 3BLEA 3A4AA 1F3TA 4KEZA 3W1UA 3VKJA 4IGNA 5DY3A 3UQNA 1M01A 4UTKA 2O56A 2C8NA 4QQUA 2A79A 3GWQA 4M7SA 3FHAA 5L9FA 2D0HA 4M1RA 1HO4A 4LANA 4YWSA 2P5NA 3NYZA 2W3ZA 2F8QA 2WMFA 4R53A 1EIBA 3NDYA 2V82A 1XLCA 2IUZA 1T8QA 4QROA 1RCQA 2D0GA 4Q7IA 4PB5A 3W1MA 3V35A 4ZB0A 2W92A 3CMJA 2OEJA 1XYAA 3W1TA 2WVSA 3DENA 3URBA 2WZEA 2QDEA 4B2DD 2HNHA 1LT8A 3NWRA 1G4TA 1JZ3A 2WZHA 2PSNA 4W89A 5EA9A 2CZVA 1JCMP 1QMLA 1QOQA 1FWGC 1UD2A 3W86A 3ZQ9A 1HL2A 1E1CA 1A4MA 4F4RA 3LK6A 3XISA 1M1BA 4GKTA 1MDRA 4E2DA 1C8XA 2YB4A 1QW8A 4QDMA 1WKYA 3AROA 1UBSA 1REQB 5BWAA 1V03A 1UMLA 1W54A 2ODOA 4S2BA 2I17A 1K8CA 1K7EA 4YS1A 2FPTA 2XVKA 5LNUA 4IPJA 3K4AA 4BF7A 2Z25A 1GVYA 3AHVA 4UZUA 4NNCA 1AQFA 4OV4A 4IFOA 1ISWA 3R10A 1E0WA 4Q4RA 1DL3A 3UG8A 1OZQA 1OK6A 3EYPA 3FKRA 1XF0A 2WLZA 3G1HA 1QI2A 3NUKA 2YCEA 4RZBA 2X40A 1EJSC 3W88A 4KS0A 4KFOA 1T6MA 3G18A 4BWLC 2OSYA 2X1SA 2WVTA 2WWCA 1QBBA 3SQLA 3W23A 3D47A 5EMLA 3QR1A 1E3ZA 4I9JA 2MANA 3N29A 2TSYA 3VGEA 4JTQA 1XUUA 4DRSA 1AQMA 3K8KA 4O1DA 3WF3A 1AQHA 3KBMA 4CNPA 2VX6A 1Q6EA 5AECA 1Z89A 2A3HA 2BVYA 1J12A 3MQTA 4H01A 1VF8A 4FNRA 3RITA 2E09A 4HP5A 1O5QA 4Q8MA 2E9LA 5AYZA 4QDPA 3OA5A 4KWSA 2TPSA 1JL8A 5BMXA 3QHNA 3AYRA 1UPPA 1XYLA 3LG3A 3NO5A 3INPA 4AFYA 4CNSA 4PSPA 3WD4A 4JHOA 2OYLA 1JPKA 4NZ3A 5ABFB 1HT6A 2Y7GA 4PA8A 3VDGA 4MWAA 3DC8A 3KCJA 4O28A 1RQHA 3VIKA 5K2ZA 4DX3A 4BS0A 1S1RA 4GXPA 4L6HA 3GHTA 1EJXC 4DWSB 2V3EA 3GVWA 4DJFD 1V3IA 1TCMA 4IQJA 4CKQA 4UB9A 1ZNNA 3GY1A 2JF7A 3CL7A 1UWSA 4A2RA 4MKNA 3W38A 3G8RA 4JTIA 3CL8A 4HA4A 3W2KA 3SSZA 1MVYA 4BKNA 4QAIA 7REQA 3KX6A 3BAXA 4Z2HA 1EJUC 4JTJA 2QPXA 3STPA 3VZYA 1TA3B 4IG2B 2A4AA 4YTTA 1TX2A 1OYCA 3G1YA 4Q32A 3GXMA 3CPUA 4EPEC 3F1QA 1NQ6A 1FDJA 4JICA 6ALDA 3Q58A 3AU6A 2BVDA 3NSXA 2VR4A 1F3XA 2WXDM 2Z4GA 2H8ZA 2BOEX 2QCCA 1W9XA 3TTSA 4AHPA 2E7FA 3CH0A 4XIMA 4A2SA 2GQ3A 1TVPA 3TTQA 3T81A 3UWUA 2HE8A 5I3FA 4GH1A 4H8VA 3UVAA 3QV8A 7REQB 3I68A 5T91A 1LRQA 3B8DA 4I7WA 2V3GA 1LUCB 2NQHA 3ABZA 3MZNA 4UQAA 1GONA 3CU2A 1PDZA 2WJZA 2E5BA 4UTIA 4FA3A 1FWSA 5CBJA 4RJEA 3WLPA 2BOFX 2INFA 3C86A 1KRBC 2WJDA 3THAA 1K9TA 3CZLA 1I45A 1EXPA 1ZGDA 3BC9A 3LZ3A 1ZBWA 4MY9A 3KBVA 4D2JA 4OBTA 3UGVA 5A6MA 1ZAIA 4W85A 2X7WA 3QYSA 1RY8A 3N18A 2D1ZA 3CTLA 3E0FA 2JF6A 1IZJA 2C13A 4PUWA 1FH7A 3T09A 4REQB 3TYBA 2NX3A 4WJEA 4H04A 2J4GA 4IWWA 1BYAA 4FHAA 3NQ2A 3RX2A 2D20A 3FA5A 3S9YA 1WPCA 3CPGA 5IM51 4CVWA 3M0MA 1C29A 2RHGA 1GHRA 4H6RA 4P61A 4IMEA 4KWOA 2GGEA 3RN6A 3VPLA 4MB1A 1RSCA 1V6XA 5EBAA 1W1TA 1P7TA 4IPNB 3SQSA 3TZNA 3ANUA 1XPGA 3R8RA 4FI4A 4AF0B 4ZXLA 5E9XA 2O9TA 1WX0A 2E5CA 1EFZA 4DBDA 1WDQA 2O4MA 4CQCA 1O12A 3D46A 4NZFA 2XG9A 4TOQA 3WLQA 1VQTA 1V02A 1YNYA 1TYGA 5KZMA 4CQAA 1OSEA 1K02A 4LS1A 2CXEA 3M7WA 4P2VA 1W2PA 3GVRA 1EHAA 3C56A 4A3QA 1YRRA 4D1JA 1KTBA 1E6ZA 1JI1A 3E49A 2JGYA 2ISWA 4NI8A 4F0SA 2G50A 4D6HA 3R58A 1V0KA 3AXKA 2NX1A 5D02A 2OPJA 5FKYA 2GL5A 4ERIA 2OT1A 3VUPA 2QT3A 3EA2A 3N9SA 3SR7A 4G9PA 3CK5A 2YCLA 5CJNA 3C52A 4WX2A 4ML9A 2REQA 3DBPA 1BRLA 1IIHA 4QEEA 4ZO9A 5D05A 3OVGA 3ABOA 2NSOA 4LRSA 4C6NA 5FF3A 3FFSA 3WDQA 1GQJA 1QI5A 3GK0A 2GVLA 4KFNA 2ZADA 3KZPA 1EQPA 2QAPA 4J28A 1FDZA 1OCJA 4P8VA 1TMLA 2CWXA 4WDWA 2BX7A 4DBSA 5E09A 1AUSL 2O0TA 1LOSA 1JFHA 3SSJA 5FJIA 1E1EA 2EPLX 3PZGA 3T0BA 1CLXA 3KE0A 3H2MA 3NL2A 3PPGA 4HYWA 3N19B 5GVJA 4MB5A 5J8LA 1BG9A 4LS0A 1L8NA 2OLHA 4LC6A 3BG5A 3WLSA 1VPYA 1QNQA 1XIJA 3SUTA 3NDZA 1XFCA 1C3FA 2VP8A 3NNTA 1FCVA 1M03A 2J78A 3P82A 4NAFA 4TV5A 3W7PA 1ZJIA 3NQGA 3PNZA 4MM1A 3HG5A 3QBUA 5AZ1A 3FIGA 2FJKA 5D2VA 2XUCA 2PD9A 5H2ZA 2J7BA 1ZCCA 3V1PA 3M64A 3STCA 4AF0A 3OGSA 2D0FA 5I5RA 1AK5A 7A3HA 3U2EA 3QPYA 1F76A 3WLLA 3OHMB 3TTYA 1H5VA 1UD5A 2QCNA 1E6PA 4OQVA 2OO0A 1DWAM 4MNMA 2ZCGA 1HJUA 2Q3RA 1IR1A 3KW3A 3TAKA 4RR4A 1EWEA 1FWBC 2X41A 1B3OA 3EA1A 4JX6A 4QJ3B 2QYGA 1KBLA 3P60A 5LIYX 1E72M 1H7XA 3ZS4A 1OIFA 1MEIA 3E12A 1R85A 4CNTA 3WF1A 3HG2A 2XFWA 4O10A 1IT7A 2PS2A 4FLRA 1E9IA 4PE8A 3UERA 5I3DA 1W1VA 1E0TA 3ONBA 4D8LA 4PUNA 1IYXA 4I7UA 3O8AA 4L4PA 1XG4A 5IHRA 4JN8A 5D8WA 2W9MA 3DC0A 1JCXA 4IFKB 2XVNA 4J7RA 1DV7A 4FAMA 2ZC8A 4AXKA 3WLMA 2NVDA 4K1GA 1RZMA 5K4XA 4O19A 3P3BA 3GIPA 1GZJA 3OTRA 1IXNA 1Q6OA 1JDFA 3ONCA 2ZZ4A 3HPSA 3SEPA 6A3HA 4K68A 1W5MA 2YCLB 2ZZ6A 4HA0A 4F79A 3M0XA 3OIHA 1PXGA 4JX5A 3A3HA 4JL1A 3DU0A 1QNVA 1IZKA 5M2FX 1PUDA 1SU5A 3PPCA 3MC5A 3H4GA 2WBKA 1EPXA 1TIWA 2XU2A 1JPHA 2CU0A 2WW5A 2AL2B 5A5WA 2Y5EA 2Z26A 2E67A 3E5PA 2YLAA 3GR4A 1UD4A 1F05A 3BAYA 3N13A 3A6OA 2VNCA 1UWTA 1H09A 2Y70A 1Z7AA 3HM7A 2BXVA 1HQTA 4E38A 4S3EA 2A21A 5DT7A 4D6FA 4LU0A 3HMJG 3FJ6A 1MXSA 3O15A 4IUOA 1AL7A 4ORIA 2EPMX 1TIMA 3BOXA 4PB4A 1LL7A 3U8GA 2WHKA 4LYRA 5DMLA 2EGZA 5CSRA 3EXTA 3E2SA 2J8FA 5HBFA 1XL9A 1A5MC 3WF4A 2GDVA 3C2RA 3L2MA 2FQIA 3LGEA 4A05A 2A6LA 3RDKA 3VIHA 1NU5A 3GNDA 4ZQPA 4PZVA 2X0HA 2Y5SA 1YNQA 3W7JA 2YR1A 4GUFA 1FOBA 2PWDA 1W9PA 1DQUA 3VMNA 4PR4A 2VEMA 1ISYA 3PWAA 1Y5XA 3QY8A 1B3VA 3DYMA 1JZ5A 1AD1A 2JQXA 4BQ3A 4DWSA 4YL2A 1ELSA 2FMOA 3M44A 2Z1KA 4LRTA 2YDAA 3PZTA 3VDHA 3DXIA 4R85A 2WVUA 2J79A 3AS3A 3UXIA 3TYAA 1W9DM 1QNRA 3I3BA 1GOOA 3MHUA 1C8QA 3TKFA 4YVXA 4EPDC 2VD9A 1V0MA 3WN6A 3WYZA 1ADDA 2YYTA 4LV9A 4UCGA 4O8AA 2PTDA 2FHBA 4G7EA 3DX5A 4PMDA 1LQ2A 1HKIA 1ITXA 3GDRA 2CLEA 3TR2A 2HE5A 1PIIA 4XZNX 3SECA 3UZWA 5TF0A 5AHFA 2XN1A 4W8BA 5H8PA 5PTDA 2ZZ2A 5F4SA 3V0UA 3R43A 3UPMA 2J7HA 4C6MA 4LUYA 3NQBA 2V2DA 4KH2A 4KFPA 4CCEA 3WL0A 2PTWA 1F73A 3EB2A 4WSHA 3GXNA 4W87A 4WKFA 2QJNA 3B0PA 3VKDA 4C1NA 4JHZA 4JL2A 3M41A 1JCTA 3UFYA 3B3DA 3UJ2A 1TUXA 3CPRA 4I7VA 1CB7B 3W2MA 1E9YB 3CHVA 4KERA 6ENLA 1GYLA 3BH4A 1LWJA 1TPVA 4NU7A 4O50A 5G4HC 2PE4A 5AYBA 4HA3A 2BY0A 2FLIA 3QC0A 1P0NA 2FVKA 4JIQA 3CMFA 3W6YA 4NILA 4JCLA 3BLKA 4LBUA 1TA3A 3S5NA 1AL8A 2W63A 2E6DA 2QJMA 2ADAA 1MZRA 4EPKA 2XVLA 1F61A 3FVDA 1OD0A 1SSDA 3TZFA 1XRVA 3NVDA 1VD6A 2BTMA 3W85A 4YHGA 1R9XA 3LA4A 1X6UA 3JRKA 2E28A 1YXDA 4AYGA 1W5QA 3UNTA 4U5KA 2F2KA 1TREA 3C3UA 1ZQ5A 3I3DA 4LF2A 2FZMA 5LIUX 3GX9A 3I7RA 3BCFA 4TO8A 1CGYA 4YJ5A 4Q4KA 1XIHA 3CO8A 3KVJA 4Q6XA 2A3AA 3KWSA 4CD6A 5C71A 3GNPA 1MWOA 2ZOXA 4D8ZA 3TSDA 2JFEX 1KFJA 3ZR5A 4POCA 3U2CA 3W07A 1E40A 1CNVA 1BVNP 2NUWA 3SY5A 3N9KA 3UCCA 1OCNA 2PU0A 4RE0A 3BLOA 6XIAA 4F0LA 1EXBA 3T0AA 4LGXA 4R9OA 1WDDA 4PBGA 3VIMA 1FH8A 4DY1A 2VCCA 3DHUA 4K7YA 4AZCB 3F4DA 4HHMA 5A1AA 3WZ0E 1DE6A 4ZL1A 3O0FA 5FA5A 2ZZ7A 1P0EA 4OT7A 5H1WA 1RPXA 3JZUA 1DWIM 5TQLA 4OFCA 3WQPA 3VD7A 3RHGA 3Q2DA 4PTDA 1PBGA 3MCMA 3ZWSA 3PZMA 1SPQA 3B04A 4AD0A 3W7DA 4JTLA 3CAKA 3GXIA 1E4IA 3C2FA 5EMMA 3EX2A 4PUDA 1JAEA 3POCA 2WB5A 2BGNE 4XIAA 3UXAA 1AODA 3WJYA 2O55A 2PLMA 4CNNA 1XD1A 4R5EA 1J5TA 3M0IA 3VIOA 4XISA 3GYCA 3LX9A 1EDQA 1RQBA 4L9ZA 1TSIA 4AD4A 4ZOAA 1CPUA 4GG9A 2ZUUA 3TOPA 1OG0A 5BWFA 4HOWA 1UP3A 3THCA 1OYBA 3L67A 4O14A 1JPMA 4WOQA 5DMMA 2GJRA 3QV6A 1JRBA 3MP3A 4W8LA 1UZ1A 1O60A 1VFMA 3HA1A 2PDCA 4E0CA 3LGDA 5E0CA 2GGIA 3CV2A 3EX4A 2YA1A 6TAAA 2AQOA 4B5SA 2IQTA 4CCDA 1WZKA 1XGDA 5HNTA 4HK7A 3MVTA 2OLSA 3MHGA 4FNPA 1YPIA 4GIYA 2ZQ0A 5AN7A 1LLWA 4PMRA 4ZFCA 4QITA 3V16A 4AWUA 4JHMA 2Y7EA 4XSMA 4ROPA 5LYRA 3W1AA 1ONRA 3B0YA 3W7HA 1JNEA 3CUGA 5IXEA 3VGFA 3PBMA 3WQFA 4N0RA 3A5VA 2FVLA 3L4XA 3G1XA 1E0VA 2E6AA 4OKDA 2D3LA 2R9RA 1QVBA 4JKKA 3IGXA 3B40A 2FB2A 1UR9A 3S6OA 4U2YA 4U28A 1TKKA 3CHFA 2YLLA 2ON3A 3VGDA 4PTNA 1TPB1 1BTCA 1BQGA 2VQTA 3VO0A 4LAKA 4HMNA 4UQ9A 1HW6A 3LERA 5DT5A 1LL4A 1IGSA 1LQ0A 3MP4A 2V30A 2NUYA 3PNUA 4JTEA 4PMNA 3H23A 3QTPA 1OY0A 4X63A 4ACZA 2J7DA 3N6HA 1AMKA 2YCJA 3VNYA 3CQHA 3O06A 3RUBL 3G24A 2IS7A 1HKMA 1W5NA 2E8YA 4IXHA 4UNKA 4GMEA 3W25A 1C8YA 4X61A 5HMFA 3APGA 4DJDD 4AWSA 3C8FA 4E6MA 1WV2A 4PRWA 4ZEPA 4Q8QA 1UJQA 1EBHA 2ZX6A 3E2QA 1A0EA 3PZOA 2D22A 4J40A 1PO9A 4C6IA 4GC4A 4RLIA 4INFA 5HATA 1IWPA 2FMNA 2QJIA 1A50A 1Q85A 1JYVA 1GYNA 5G4WA 3SURA 4WUIA 4M5PA 3MI2A 2AMGA 1OB0A 4M6VA 3WUFA 1ZP3A 1E6NA 4HMCA 1NTHA 1EF3A 3R0DA 1ADOA 4DHGA 2GJNA 1BTMA 3JUGA 5J04A 1V3LA 3QC3A 3TE9A 3QYQA 4XX6A 4O0QA 2PAJA 4KCVA 3C0SA 5M17A 3T0CA 3UWYA 3I4KA 2G95A 4UOQA 5K4ZA 4NL1A 5G2WA 3ISIX 1GTEA 4L5ZA 1KCKA 2XZ7A 1G0CA 5ABFA 2F84A 5CPTA 1SO3A 3AHTA 3L0KA 3M5XA 4W5UA 3ZWTA 4I9AA 1WAWA 2OU4A 2Y6ZA 1DJXA 1X97A 3RU8X 1PS9A 4C6EA 3WJWA 4LUSA 3I6RA 3WDHA 4KWUA 3IJ9A 1W2VA 4TTUA 2PI6A 2EG6A 4J2MA 3DDMA 4WOZA 4H8UA 4ZGYA 3EGJA 1J0ZA 4BCEA 4JY8A 4A3HA 1J9YA 1DJZA 1G7UA 4E8CA 3P6LA 1H61A 4CU8A 1B3ZA 3U4AA 3HGRA 1VJSA 3P0XA 1E9LA 4IPIA 3ELFA 1Z32X 3ZFHA 4N4PA 1E0XA 5KETA 2GSHA 1ZJHA 4XZLX 2FJUB 2FZ9A 5HQEA 2POZA 4HCDA 3B8UA 3WBYA 3H12A 1OG6A 3WBAA 3OW1A 3ICJA 1P0KA 3CJPA 1YBQA 4WXYA 3U0HA 3OVPA 1TX0A 4J2PA 1Q5MA 4R27A 3OLGA 4CLMA 1B5TA 4NRRA 4N9EA 2GJPA 5EL1A 1RP8A 5C9RA 1B9ZA 4KW2A 1OD8A 4A8NA 5JBEA 2PDNA 4GQBA 2CYGA 1GK8A 4GO9A 1NOFA 3TQKA 4DNHA 2OQLA 2Z2AA 4RDYA 1Q4NX 2BY3A 1EHNA 4DQWA 3L21A 3L4ZA 3GDBA 3ZJKA 1VZWA 1G94A 4XZWA 2FH6A 4GABA 3PPHA 4S3AA 4K3ZA 3Q67A 4FB7A 3W71A 2DSKA 3NOYA 2HS6A 1Q7MA 4O11A 3T8LA 1E6XM 1W9UA 3WMSA 4L56A 1ICSA 2CHNA 4QX4A 3PG8A 4CN6A 1VC4A 4ADSA 2ASHA 4GPNA 1SJCA 5I06A 3AC0A 1PX4A 3STGA 1XD0A 4GYKA 1BSIA 1A5LC 3P14A 4NZJA 1R9YA 3SB0A 4UNLA 1BRLB 1BVZA 3DOPA 3MJYA 4NZ5A 3DYOA 3WFZA 4Z1DA 2ACQA 2QGHA 1AJ2A 3DKLA 3HB9A 1QPQA 2R91A 1CXIA 4DF1A 2EHHA 1UKSA 4CQ8A 4L9YA 2DIJA 2DZSA 3C5QA 2GSEA 2OX1A 1LG1A 1NY1A 2Z2UA 3S1XA 4GY7A 3P7YA 4CCZA 3E0WA 1QJWA 2XH0A 2CPUA 3DFNA 4O1EA 2ZZ3A 2ZE0A 4Z08A 2WVVB 1RK6A 2VDGA 2QF7A 3KWXA 1VEPA 1BXNA 4HQVA 3WD1A 1XLGA 5DXXA 4O8RA 4JTSA 2CCRA 2RAGA 2UY3A 2W6RA 3R5EA 1W5OA 3T9PA 4RW3A 4TX6A 3PZQA 3CUFA 5REQB 4UTJA 2G5WA 4AY8A 3AYTA 3DH7A 1JGIA 3NPXA 2DUXA 1VP5A 2P3ZA 3EMCA 3UWWA 4H9VA 4GGBA 1XW8A 1GOIA 4KWWA 4L4LA 1VKFA 1KO0A 4PUKA 3BURA 3ARWA 3GVVA 2GQAA 3CUXA 4MNJA 4PUJA 1TWIA 2VOMA 3PTDA 1VEOA 3W7EA 3GRIA 3CHEA 4M3PA 1U5HA 2HEJA 2ABAA 3BMVA 2G97A 3OP2A 4E8GA 5FJJA 4FXSA 4GXWA 3CMGA 5FJOA 3N15A 3G0SA 3UWVA 2E8ZA 4N6EA 1K1DA 3VMOA 5A6SA 1KKRA 3KL5A 1Q6LA 1OC7A 5DCEA 1ICPA 4F2BA 3NR0A 3IEBA 3RU6A 4S2CA 4MNLA 1GOXA 2PLCA 2FFIA 2DQWA 2INEA 4QBXA 5D09A 4A3YA 1WDRA 1FDYA 4OOZA 3IUDA 4OBRA 3NPWA 4QDWA 3W7GA 1EUNA 1YXYA 4ASTA 4MZ8A 5GNZA 2Z28A 2PWGA 4FLSA 4B5TA 3OYZA 3WDJA 4NNAA 1ONEA 3GNOA 4OE7A 3HPXA 1FY6A 3ERPA 3H7RA 1L2QA 3UP8A 3WLKX 3CEUA 4OV9A 4J27A 4BHYA 1OM0A 3KDOA 1UR0A 1ZCOA 2A3CA 3R11A 3W26A 1SMDA 1B2YA 4DN1A 2YA0A 4GINA 2MNRA 2E77A 2E5DA 1MW0A 4F2TA 4R7WA 3RM8A 4IGHA 1F9CA 2PDUA 2UZ9A 3WBWA 1TWZA 3OO2A 3A5FA 5G1TA 4JNYA 3K46A 1EO7A 2A2IA 4GFSA 3L9CA 4IHCA 3NQMA 3W7RA 4GYFA 4HVXA 4IZGA 1FKXA 3EWCA 2P88A 1OQFA 1ZBCA 3ZMRA 3OQ8A 1RLDA 4GJ1A 4C91A 2WJEA 2FB3A 2ANUA 3OG3A 3WLOA 2BXYA 1GEQA 4UIOA 3E0IA 1GVQA 2VL4A 1OADA 4OBSA 1E51A 1OT1A 4L61A 5AB3A 2P8CA 3M0HA 2CHRA 1K6AA 4M56A 1KM0A 1XBVA 1GJUA 4B92A 1YDYA 2X1IA 1O1ZA 3TJLA 5CQ1A 2D2GA 3LDVA 2JALA 3T08A 4IICA 4F0HA 1FHUA 2Z7GA 3SAZA 3AWNA 2WHJA 4RK8A 4FZIA 1QK0A 1M7OA 3AALA 3E3HA 2Q01A 3ZSTA 4DF0A 3L23A 4GX8A 3GR8A 3LN3A 3OPSA 1KBKA 3CC1A 1JRCA 1R3YA 2PRMA 3P2VA 4XAPA 4F0RA 4H6EA 4CD5A 3WMBA 1NP2A 3E1F1 4PTWA 2WMGA 3HN3A 2DSWA 3P62A 2WKGA 1SYTA 5LKYA 1AH3A 1V51A 4AHQA 1B0IA 2A85A 1UROA 2W67A 4GGHA 1EZ2A 3CQIA 1TVNA 4EAYA 3VNKA 3U9IA 1HJWA 3L65A 3PFRA 5KMYA 1EIXA 1BWLA 4MFEA 5AZ0A 3G3DA 5AC8A 2VHLA 2VGBA 2FPYA 3SUVA 3T4CA 2HMCA 3LUTA 4ZE5A 2Y8VA 1W3TA 2OELA 2PF0A 3AOFA 1IF2A 1OGBA 4Y7EA 3OBEA 4A22A 2FGZA 5CXPA 4DJFA 3HV9A 4LUSB 2D23A 2VZTA 3B0UX 4GUJA 4Z2LA 1RUSA 3F4VA 2PWVA 4IMCA 4G7EB 1K4HA 4JIIX 3SBFA 3GUWA 3TW9A 4UTWA 1SVDA 1L8PA 3S1WA 2E1WA 3UU0A 1RAKA 2WMIA 4G56A 1SMAA 3A24A 3SGUA 3BAJA 3R2GA 2DEPA 3UT0A 3V36A 4DBEA 4IT1A 4D6EA 1GT8A 1PZ2A 2POTA 2CFFA 3EAUA 4DBWA 2ZICA 2PA6A 1UR4A 4J35A 4DELA 5CC5A 5BXSA 3E2VA 4HZ7A 4LPCA 1W3IA 1E15A 1QWGA 3KOWA 3PULA 1EJVC 2I9EA 1YE4A 2OTDA 4R33A 4U2ZA 1SJDA 4HPXA 4CUCA 3SY8A 2B0MA 3VKAA 3S42A 1UP0A 3U48A 3KRSA 4WIWA 1OGGA 1OVDA 3RAOA 4E3VA 1K4GA 3UY7A 1H0IA 2IMRA 3UGRA 1FWJC 2E0PA 1XS2A 2VEPA 1ITUA 4ATWA 3F5LA 5C9XA 2VEKA 1US2A 2TAAA 3GAYA 3QPZA 1VYPX 4DPQA 2XH2A 1Q7QA 2GVGA 1UB3A 3EWZA 3GBDA 4Q4MA 4C6QA 1VCVA 1ZZMA 3W1QA 1EC7A 2NWRA 5A2CA 4WSKA 4XAFA 2CWNA 3W1PA 3OEXA 3CL6A 4U5IA 3UZ5A 3BK0A 3WNOA 5AYYA 2C19A 1XFBA 1PVNA 2O7SA 5A2AA 1TPFA 4XKYA 1KKOA 4UTFA 4PL2A 1KFKA 5BRBA 3N3MA 1WZAA 4RNHA 5E5CA 3WLJA 5CZTA 1XH2A 4JFWA 3RX4A 2WYSA 3UR7A 1KC7A 3TXVA 1UA7A 1V6TA 1VGAA 1NDVA 2GGJA 5MHBA 1KBJA 2PD5A 3BMWA 3TMLA 1T7LA 2CESA 1UH2A 1NH6A 4PCNA 2PZ0A 3II1A 3PANA 4NZ4A 3L2IA 4FS9A 4GQQA 4K39A 4TVDA 2ISDA 4E3TA 5HR7A 4F0MA 5F2LA 4DLFA 3NXLA 3QY6A 1RCXB 3B9DA 4LXFA 4E4UA 1JUKA 3CO4A 1Q6RA 5C7VA 3MO4A 1NFGA 3QVQA 4GI8A 3TN6A 1LLOA 1CXHA 3KEHA 1IQ8A 1H1ZA 3IS4A 1W1B1 5A3HA 1B1YA 1F4AA 2V2HA 1EA9C 1S2VA 2QUUA 4LVDA 4C5YA 5CGQA 2ABBA 1MRAA 1S3TC 1X8FA 3AWOA 3ABSA 1C91A 4Q4SA 3TEVA 3WQGA 1J10A 2PWUA 2YBUA 3I6EA 4L80A 1D7KA 4PMZA 4IMAA 2C1IA 4B5WA 2EQDA 3M6YA 4GD0A 3H2OA 4MPKA 5D9PA 5DBUA 5HOSA 3H8AA 1DJHA 3CHCA 2AKMA 3QKEA 1IEVA 1UZ4A 3L0GA 1GJPA 5EGRA 1EO5A 4AZCA 4HTYA 1TQXA 2HXUA 5XIMA 3H7UA 1A5NC 1YPFA 4Q8UA 3DI1A 5I3HA 1W0MA 2WSKA 3GG7A 3WH7A 5I3GA 2ZA2A 1AJZA 1FHDA 2ZXQA 2EF9A 1R3VA 4HMDA 2KAUC 3IJ7A 2GWNA 2VFGA 2O92A 1FRBA 4L7ZA 3STFA 4E4PA 3WK2A 2AAAA 1EZWA 4IQEA 3W24A 2G3FA 3SCWA 5G2HA 2DZUA 4P5UA 5I23A 3MO7A 5A8PA 4H8NA 5BXPA 1D3GA 4V33A 1K8XA 5FL0A 1TV2A 3FS2A 3NM3A 1DTUA 2JIWA 3VIPA 3NQVA 4PBEA 2YL9A 1YDOA 5HK4A 1PHQA 1GKQA 4AWEA 1N8WA 3F2CA 2R82A 1O5XA 1FWDC 3P80A 3ZOAA 3Q37A 1P0BA 1JG9A 3T1GA 4TU1A 1RALA 4NJGA 4I5RA 4AZ7A 1UA3A 1JCJA 5ABHA 1XIDA 2VYOA 1Q6DA 2Z1WA 1QPNA 1Y65A 1I4NA 4H2HA 4J4KA 4HU8A 3DG7A 4JQ1A 4CD8A 2DPEA 2W5FA 3LMYA 4X0VA 1KM4A 1GVIA 2B7QA 4ZQCA 1WB0A 3EWWA 4PCSA 2GUBA 3N2MA 2BY2A 2DVXA 1AZ2A 2XWEA 5C0QA 4ZO8A 1KFCA 3WUGA 1OCQA 4WZHA 4OTKA 4AW7A 5A6LA 2BG5A 3FW6A 3WNKA 2ZRUA 2RDUA 1Z44A 1VFHA 1JZ8A 3KCOA 4HNVA 3TH6A 2YFNA 4BJHA 4NNBA 1Q6GA 1GGOA 4UR8A 2HROA 1UR1A 3KOFA 3IPWA 1GKRA 3GC5A 2R1KA 2P0IA 3SCVA 4S3DA 3LHWA 1FCQA 4LUTA 3IIZA 1CCWB 4AMAA 3KVLA 3S5YA 1VFFA 1UQYA 4FO4A 1H7WA 3BPWA 3S2CA 3PBGA 3PC0A 3WJSA 2YSWA 4UWMA 5TD4A 1GQLA 1SW3A 2PEVA 2ZX5A 4ICCX 4U33A 3CZGA 2WO5A 4NJIA 4M6UA 2V2CA 3W7CA 5DELA 1A47A 2FZNA 3NL6A 5CG7A 1P5BA 1S2TA 1FCBA 2Z7KA 4EXAA 1S39A 3LPPA 1R3SA 1XC6A 5F7UA 3AICA 4AIEA 1B30A 1G4SA 1B90A 1XJBA 4HU4A 3SJ3A 5GJPA 3VGHA 1U2YA 2WHMA 4NZCA 3AMKA 2RH9A 1LWIA 2CETA 4XZMX 4LYKA 2DUAA 1QATA 1XM3A 3LYEA 1YDVA 3T42A 3MI6A 3MUY1 2WKJA 2WQDA 4ZCWA 4XZBA 3L7RA 3NAVA 4EAMA 4I6KA 1TZ7A 3VDAA 4MUZA 3OLDA 1D2KA 4GWEA 2L5HA 1L2UA 1ZUAX 3B8IA 5G2IA 1KNWA 3KZSA 4Y9OA 1W6TA 1J6OA 3TQ0A 4TTGA 5HMEA 3G1SA 2ZC1A 4DEFA 2DJLA 1K6WA 4RPPA 3BV7A 1SZEA 2EJAA 3HF3A 3W73A 3Q45A 1QXLA 2EO7A 1XH1A 3GFZA 3VNDA 3VIJA 1UWQA 3UWEA 1S46A 2QCEA 3WK1A 4C7DA 3N4FA 3E38A 1O6IA 3FAXA 4HSNA 1QTWA 1E43A 1H4PA 1QHOA 1ZAJA 3CIWA 2VFHA 4DXXA 3P61A 2V5DA 5BMWA 5FSDC 1VLIA 2YDQA 5C6MA 1PWLA 4BZYA 4ML4A 3UYIA 3QFWA 1VYRA 4GISA 4OGZA 3R8HA 4ILSA 1W1PA 4K8EA 4NIRA 1GPWA 4GXMA 5BZAA 1G4EA 4I3GA 1J0JA 4NJKA 4ECLA 2NQZA 2XN0A 3V7PA 4WKHA 1S2WA 4CNOA 3BJSA 1UW9A 1POKA 2P53A 2NLYA 1ADSA 3ARYA 5LIXX 2W27A 3BLIA 1PTAA 2ZZ1A 4AVNA 2YBVA 5HQLA 3TSMA 3U7BA 1V93A 3EX1A 1XCFA 3HPZA 3W81A 3AS1A 3B9OA 3MUIA 3WK0A 4PCFA 4R7OA 1KRMA 1FFRA 4HK6A 3N14A 2GPTA 3APYA 2DY3A 2PTZA 3S5SA 2C3ZA 3RR4A 3GXDA 3LCHA 1EBGA 4EP8C 1FWNA 4JIEA 2XWDA 1UASA 4HCHA 3MUZ1 3S4TA 1KFEA 3UR2A 3TK7A 2WM1A 5A8MA 2PBGA 2H6RA 2G4FA 3H21A 3TTEA 2A1YA 2OLAA 1X1ZA 4FOJA 1XLIA 2Y7DA 1VEMA 4K1WA 1VRDA 3K1GA 3M1ZA 3MHFA 3TA6A 5DF0A 2BGQA 1MO0A 5TNVA 4ZO6A 3CHDA 4H9YA 5JH1A 2W62A 3FVMA 1Z48A 4PMYA 4CEXC 3NDOA 3PUEA 1PB0A 1B31A 2YYUA 1SSGA 2PU1A 4S38A 1EDGA 1QPRA 2OZ8A 2C71A 3GIYA 1UUMA 2I5GA 4H41A 1PL9A 1XYMA 3D6NA 2BOGX 2XVGA 2PGFA 1OFAA 4LUTB 1E55A 4RE4A 1R46A 4JNZA 3LU2A 1X7FA 2DW6A 2XISA 2ACRA 4GI6A 1H7OA 3ITGA 1V8EA 4TR9A 1TWWA 5DEZA 3NZRA 2ZX9A 4UZSA 3AYVA 2J77A 2ZRVA 3O63A 3MWCA 2DVUA 1W1ZA 2A6NA 3WELA 3K8MA 5EYWA 4UTTA 4Q4PA 4DWSD 1J0HA 1UWRA 3BANA 2YIHA 1R3RA 4ZB2A 5CZJA 1YMYA 3AU2A 4MFDA 1E6SM 2DGAA 3ATYA 3FEQA 3W7OA 1PE1A 3CAVA 1N8IA 5KZ6A 1R86A 2PDLA 1I2QA 4I9TA 5A69A 1G7VA 4B4FA 5CGTA 5MKGA 1KBBA 1S1PA 5D9NA 1U83A 1YYAA 1MQPA 2ESCA 3EEGA 4RZ4A 3WQWA 4MKVA 2FGBA 2X8RA 1P6CA 1JD7A 3LI0A 4H6KA 3M43A 4XVEA 2CNCA 3TYCA 2F9RA 2UY4A 4O0KA 4LYQA 2D24A 3L4TA 1O4UA 2EAWA 1E3XA 3O16A 3CNYA 4YN5A 1F74A 3QPEA 3S3GA 1D9EA 2QIIA 3BLPX 3MI3A 3ZJ7A 1JXKA 3MVIA 1MW2A 1IT0A 3O6YX 3G1DA 3REQA 3QZ6A 5AHEA 1WXYA 3UESA 4UFMA 2DDXA 4MPQA 4JTCA 1UR8A 1TV5A 4AXNA 3SGZA 3N6JA 4QNEA 4QG8A 2XM2A 3SIMA 2XH7A 5LHFA 4KKXA 2WZIA 3U2OA 3BV4A 3TWAA 4FNQA 1EGZA 3V0TA 1BWVA 5JMUA 1HGWA 1PKNA 4ZVJA 4JTKA 3GLCA 4UQBA 4KRTA 3R0KA 2V5KA 5A8QA 4IJRA 3SFKA 3TAOA 2QUMA 2RDTA 2PDIA 1TVLA 1G69A 1M7PA 4C7FA 2J9XA 3LM3A 1WOAA 1YE6A 3UCQA 4BEUA 3PS7A 2CBIA 3DN5A 5LA2A 1WZLA 3HURA 2TODA 4D71A 4H19A 3N6QA 1A0DA 1W3JA 5LGZA 2BMBA 3G3MA 5C70A 4RNJA 1J11A 3IJ8A 4AX7A 1W8SA 4XSLA 3LV6A 1E0UA 4HSOA 2PDKA 3GW3A 3S5OA 1G5AA 5I07A 2XGBA 5D33A 1YHTA 5E6YA 2GZXA 3UY8A 5EPDA 4FX6M 1W9VA 3WH5A 5LZLA 3RO8A 3FY1A 4FIQA 4GIEA 1DWGM 3VGBA 1W3KA 1UUQA 5CC6A 4AU0A 3WFAA 4TIMA 3MDUA 3NXFA 1JDAA 4UXDA 3G5EA 1DQXA 2QCLA 3SI9A 1V7YA 3AZRA 4IF2A 3UJRA 3CZEA 4GC3A 4LF1A 2DT1A 2QS8A 1E56A 3SIZA 2FTWA 3JR2A 3MJMA 4XK2A 3EWYA 3VOCA 4RW5A 3DG3A 3VKCA 1KQYA 1LP6A 5JU6A 3K30A 3W7NA 2YXXA 3LENA 3DBNA 3DFHA 1UR2A 2QF8A 2C15A 1RJQA 3TTOA 3UBPC 3ABXA 4NYUA 4FOKA 3IIOA 3HGSA 3PBVA 5EMJA 4ZR8A 1TMQA 1ZL1A 1FKWA 3R13A 3GG0A 3TMQA 4EWND 5K3VA 3ZLHA 3E5BA 1QHPA 2PRHA 2NV1A 1WOBA 3HPAA 3FYPA 1U30A 4Z2KA 5CJ5A 3AIBA 3H55A 1NFBA 3WBXA 1TRDA 4KGJA 1XR2A 3ABRA 2XIOA 3CYJA 4RL3A 4OUEA 4RX0A 1IEQA 4RXGA 3NJ3A 2DIEA 3ZJ8A 2WMKA 1V5XA 1XQLA 3W7KA 2CLFA 1W1IE 3DFTA 3NIYA 4NSBA 3ARXA 3UR5A 2XTKA 5DCBA 3PY2A 1BD0A 2FZBA 1SFTA 4J1OA 1PTGA 4I5XA 4GUGA 3WQVA 2D73A 2QVHA 1M5WA 4F9JA 4XD5A 3WH6A 3EMQA 2X1UA 1EF2A 1QRQA 3KP1A 4TX9A 4EKJA 1JUEA 4IISA 2W79A 1LRTA 1OFOA 1DVJA 1ZBKA 5B7ZA 3I6TA 4MJ4A 2YJQA 3UWQA