3WQGA

D-threo-3-hydroxyaspartate dehydratase c353a mutant in the metal-free form
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNHAAATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-threo-3-hydroxyaspartate dehydratase
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate
pubmed doi rcsb
source organism Delftia
molecule tags Lyase
total genus 143
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3wqgA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3wqgA02
7ODCA 5IRPA 1XQLA 3CPGA 3GWQA 5FAGA 3NZQA 1L6GA 1NIUA 1XFCA 3WQDA 3C5QA 3B8WA 4BHYA 1VFHA 1TUFA 3AWOA 4QHRA 4Y2WA 3OO2A 5GJMA 3N2OA 4ECLA 1HKWA 4KBXA 3MT1A 4DZAA 3HURA 3ANVA 3KW3A 1VFTA 4V15A 3S46A 4LUSB 1BD0A 1F3TA 1KNWA 3N2BA 2O0TA 3UW6A 3R79A 2TODA 4A3QA 2RJGA 1L6FA 3SY1A 3WQCA 1FTXA 2QGHA 2SFPA 4PB4A 4FS9A 1RCQA 1SZRA 4LUYA 1TWIA 2RJHA 2J66A 3B8TA 3N29A 4DYJA 4ILSA 3NZPA 1HKVA 4XBJA 3HA1A 2PLJA 3WQFA 1KO0A 1EPVA 3B8VA 1W8GA 2YXXA 1SFTA 3E6EA 2OO0A 4BEQA 2DY3A 1NJJA 4XG1A 5FACA 4ZGYA 4LUTA 5GJPA 4AIBA 2NV9A 2VD8A 3ANUA 1CT5A 2VD9A 1B54A 1XQKA 3CO8A 4BF5A 1QU4A 4PB3A 2ON3A 4BEUA 3BTNA 5FAJA 4PB5A 3VABA 2P3EA 3AWNA 5GJNA 3B8UA 2NVAA 2PLKA 1D7KA 3WQGA 3E5PA 4LUSA 1VFSA 3LLXA 5BWAA 3WQEA 2ODOA 4LUTB 4WR3A
chains in the Genus database with same CATH superfamily
1GONA 2QCDB 3FA3A 3IK2A 3FEQA 5IRPA 1DJWA 2BGQA 3B8WA 3NDZA 1W56A 4K36A 3NCOA 1R3SA 3V75A 4EF8A 1ZU8A 3EPOA 4UTUA 3LCWA 3MCMA 4LEFA 3V7PA 4DYEA 3GNOA 4L65A 5D2YA 5DRIA 3H6OA 3GBDA 4FMVA 2E67A 2ZADA 3NL5A 3SRHA 1KR0A 1FOBA 3ZS4A 1TPC1 1B3WA 3F2DA 1LRQA 4GKLA 1DWIM 3CZLA 1NTHA 8XIMA 4FNUA 2ZRWA 5GPRA 3WMCA 3QHNA 3E9AA 1E6QM 2F6XA 4AVOA 4FX6M 1S2CA 4QLJA 4H2CA 1F3XA 2G96A 1QPRA 3W0KA 3SEPA 3RM8A 1E6SM 4DY1A 1B0IA 2A79A 2VC5A 3BDKA 5C2XA 5A8NA 3NOYA 3GM8A 2OTDA 3VC5A 3UQNA 2HBVA 4DNMA 4PUMA 3SSZA 4MWAE 3H2EA 1N8WA 1SMDA 2NXGA 2W62A 4UTJA 2I16A 3W1RA 1SW0A 4CQBA 3QHMA 1FWRA 3N04A 3R8GA 3AHYA 2J7BA 2FVLA 3H24A 2QDHA 4KRTA 3QV7A 4WJ8A 1E72M 4O8RA 5HK4A 4DF1A 3MS8A 4KCUA 4AB4A 1FCQA 4C91A 3VIMA 4Q4OA 5HWJA 5L6UA 1TX0A 3BLKA 4JNYA 3RO8A 3FJNA 4YIWA 4AZIA 4X2RA 1C8YA 3J7HA 1HQTA 1G67A 4DHGA 3ONBA 2OO6A 2WV8A 5LA2A 1S2WA 2XYLA 3CIWA 4LANA 2BODX 4OU1A 3OZPA 9RUBA 1A80A 2NSXA 4O12A 4CNPA 1P4CA 3AXIA 3SFWA 1JCLA 3HGRA 3L5MA 4PMVA 1W8GA 1RK5A 1Z69A 3E6EA 4F2UA 3QC3A 1ZJAA 4LAMA 1PX3A 1HJQA 3NQAA 4DO5A 4ICMA 4HPXA 1A5KC 4JGDA 2YOCA 2WCSA 2PA6A 1M65A 4LB3A 2UBPC 2YCIX 4CD7A 1TFVA 3GS6A 4M7SA 3N9KA 2V2HA 2ZZ6A 4OHQA 5M03A 5DF0A 3UVIA 4MKSA 4ZO8A 3WJSA 2F8QA 5AHNA 2ONEA 2DSZA 2W5FA 1ZL1A 3C2OA 5CPSA 3LG3A 2O4MA 4GX8A 1AJ2A 4LT9A 3LRKA 3AJXA 5A6JA 4JTIA 1R2RA 3CPGA 1S1PA 5DX7A 2X1RA 2A2IA 5CSUA 4PCPA 4HKPA 1FFQA 4QDPA 1FKXA 2NX3A 7TAAA 3AQUA 4DZHA 4P8XA 1XLFA 3AFBA 3C3UA 2INFA 3S46A 1DQWA 3UJEA 3WELA 3GE7A 4AWTA 1W9UA 4LTSA 4IT1A 4XTDA 2CEQA 1IF2A 1XIFA 2JIWA 2R1PA 3W2JA 1DWGM 2ZZ1A 1MZHA 2OG9A 2YDQA 3T05A 1XLBA 2WWCA 2I5GA 1IT0A 4CQCA 4R34A 2ZZ4A 1UC4A 2XVPA 4GINA 1XLCA 4NZJA 3ZJ7A 3AYRA 1OCJA 1BXBA 3AMGA 7A3HA 5ABGA 1IQ8A 1CT5A 5DBTA 3IGUA 3GH4A 3EPNA 3QQWA 4UTFA 4B4FA 4EF9A 1UKQA 4KF1A 4O1EA 3P14A 3OVQA 3RAOA 3V0TA 3IEBA 4IMCA 4PEKA 4UWMA 3F1QA 1W1PA 4DF0A 5XIMA 1W3IA 4HU4A 1QPQA 2DZWA 1EO7A 4YU1A 1RA0A 2JBMA 2ZX6A 3CHEA 4PMQA 2FJKA 4YYFA 1F6PA 2YA0A 3DFQA 2QCEA 1G9HA 3UFYA 4MNKA 1PVNA 4IPPA 1FP9A 4NXSA 3ZJ8A 4ORMA 5LXEA 4C7DA 4UB9A 1XJBA 3DX5A 2FZNA 4NL1A 3U2CA 5CBJA 1W8SA 3NO1A 4GGHA 2WVSA 4HP5A 3MU7A 4ZSUA 3GR8A 3EKZA 4JQ2A 3T07A 3L68A 4N4QA 4I5RA 4MHBA 4XUYA 3F4VA 3VVGA 4GY7A 3NQCA 3OYXA 4BQ4A 3HA1A 4IMDA 4A3UA 1QI2A 1XCXA 3WD2A 4W5UA 4GIEA 4MTVA 5AYBA 3FGCB 3GO2A 2OMAA 2RGLA 1NJJA 2EG7A 1SSGA 1CWYA 1LWHA 3DN5A 3RM9A 2CHRA 2EJ1A 3IRSA 5G5IA 4JYDA 4KS0A 4PMJA 3FJ6A 1V3KA 4ZO7A 3VDBA 1CDGA 4HMEA 3L9CA 3AWNA 4MNMA 2A7PA 3PK7A 1Q6FA 1EC9A 1JDCA 1Z44A 4LJ3A 4JHOA 5MF5A 3ZWSA 3MANA 1XCWA 5HXMA 3L21A 1NM9A 3W2LA 2P1FA 2YR1A 3PZIA 1P48A 4PUDA 5T91A 1AG1O 1UPMB 3CASA 4BI5A 2J7DA 4UMBA 1CXLA 2X1TA 3EBVA 1A50A 3QR3A 1LL6A 3LLDA 4Q4RA 3Q67A 1XDJA 4XAFA 2VJXA 1VIZA 4JN8A 3BW2A 4MZ8A 3EPMA 3A3WA 3CL7A 1TV7A 5EA9A 3W7DA 2C3ZA 4CCDA 3R1ZA 1TZ9A 2JE8A 3A5VA 3I65A 5F2IA 5LHEA 3U2ZA 1Q63A 2HRWA 2BS9A 1YHTA 1V7AA 4O50A 5AN7A 1JXJA 4IM4A 3RMEA 4EXAA 1YBQA 4WD0A 1E9YB 2XWDA 1VJSA 2ZA2A 4A2RA 3ZJKA 1UKSA 1V6UA 1O12A 4H8VA 3SAZA 2V3DA 3NGJA 3S9YA 1C91A 1KGWA 1DJQA 1T41A 4G7FA 5EMYA 1GVSA 2VD8A 1OHLA 1FWDC 5F2LA 3HG5A 4HNTA 4FHAA 4H6RA 3KZSA 2Y5SA 3R7MA 3FK4A 5E70A 1TIMA 1WKEA 3WH6A 5E0FA 2PBGA 3AIRA 5CPNA 2BY1A 5I3JA 5IDZA 1LQAA 3WLJA 5FL1A 5F2MA 4OE7A 4I9AA 1VH7A 3ARTA 5D2WA 1D3CA 4ZZ9A 4LUTB 1B4EA 4UQAA 4B2DA 1NU5A 2I7GA 3L67A 2L5HA 4XK2A 1C7SA 2VT0A 4R27A 4F9DA 5JBFA 3TX9A 3EDEA 3LNPA 3QOKA 3GYEA 2V69A 1ZTVA 1JI2A 3S0CA 1UH3A 4PUNA 3O15A 2VX6A 3M64A 4JL1A 4EIVA 1FUYA 1GOKA 4G5DA 4TUFA 3JS3A 1XSIA 1D3GA 3WLPA 3P93A 1KRAC 3DFPA 1ZENA 2OJPA 1EWEA 4NJJA 3U7BA 2JGYA 2VVSA 5LNUA 3M5YA 4MPQA 3VI2A 3I4EA 3R10A 3APYA 1UH2A 1CXHA 1ZCCA 2OZTA 4AZGA 1BPLB 4CNNA 2H9AB 1OEPA 1A3HA 3W1MA 1VGAA 1V6TA 4QAWA 4AMAA 2VGFA 1F05A 2V5LA 1UROA 4JTCA 1JPDX 5LA1A 4DJED 1XW8A 3LTSA 5LYRA 2FVMA 4UCGA 4HVXA 2YA1A 3L23A 1JVNA 2Y7EA 4K38A 2PTZA 1XH1A 2Q8XA 3BGGA 3IUHA 4ZQNA 3TYCA 3UESA 5A8GA 3VZXA 3BGAA 2CWXA 3UJFA 1V79A 1G7UA 1WDRA 1E0UA 1EZWA 3N4EA 4C1NB 2IKJA 4F3HA 4FOJA 4DJEC 2PURA 3W7QA 4ES4A 4C6NA 3E0IA 4MKNA 2W66A 5HJYA 4ROPA 3QZEA 2WVVB 1R30A 2R1LA 3UJ2A 1BYDA 5I03A 4EX4A 2KAUC 3BLIA 3UJSA 2W9MA 4QEHA 2HS6A 1SGJA 3WQ5A 3KP1A 3N2BA 2W63A 3N9RA 3EWBX 3KWSA 4Z2HA 4HTYA 1CX9A 1MW2A 4KWVA 5T26A 3H4XA 3SGGA 1D7FA 4DJDD 4JFUA 4HZMA 3BXWA 3VD5A 4I6VA 2XN1A 1QNSA 4PTXA 1JGMA 4EE9A 5LA0A 1Z42A 1Q6QA 2BX7A 3ECQA 3VIOA 2G95A 2BVWA 4POCA 3QY8A 3ITVA 1HL8A 1YE4A 3L5LA 1H50A 4ZB5A 4JKKA 3RCYA 1G4TA 1D3HA 2FH8A 3UY7A 3UA3A 4MWAD 5E6ZA 2PI6A 4XBKA 2G50A 4DJDC 4HHPA 5DMNA 3SW6A 1Z48A 5D33A 2OOFA 1TIWA 3GIYA 5JUVA 6TIMA 3LQLA 4UFKA 3SUVA 3IWPA 1NOWA 3UBPC 4RV3A 5FSDC 2FMOA 3VGBA 3QPEA 3VNLA 3WBWA 1E1CA 4RDVA 3IK4A 1BYAA 4MWAC 1VZWA 1LOSA 1EPXA 1SJBA 1EF2A 4IPJA 1FWTA 1WBHA 2Z26A 1C9DA 3AC0A 3MMDA 3IAPA 2GWNA 3VZYA 3LN3A 4KCWA 4RKAA 4AU0A 3VD4A 3QXBA 2OYMA 4FR1A 1TB3A 1FKWA 1RJQA 3MI2A 4JYEA 3FSTA 4XB3A 1VJZA 2RJHA 4Z2IA 1IZKA 3POCA 2D69A 4AX7A 2OGJA 4AZCA 1PHWA 3CC1A 3LM7A 3OYZA 3ZOAA 1CXIA 1RD6A 2PRMA 2DY3A 3M41A 1TWZA 2NQZA 4GUIA 3H70A 2GSEA 2QCDA 2YYTA 4L6OA 1HNYA 2VWSA 4KETA 4AVFA 3KVLA 4MZYA 2I5QA 3RIKA 3GW3A 1X6NA 3ARSA 1GGOA 2VFGA 3DC0A 2YFNA 1XBVA 3UG3A 4FI4A 4J3TA 4GNVA 4QTGA 3EX6A 5T8GA 3UGVA 2WB5A 5BRBA 3KOWA 1XYAA 2ESCA 1E56A 1A5MC 1S5VA 2VEFA 4NNAA 1JUEA 3SQSA 3DERA 1XINA 3OTRA 4E4UA 2PC4A 4LBSA 2CITA 3BSMA 3LD5A 3P81A 1H1NA 1WXYA 1Q6LA 2GOKA 3FKRA 3U4FA 1JYXA 3SY5A 3KEHA 3F5JA 3W2UA 1KNWA 4H9XA 1YXCA 4LYPA 5MKGB 3WMBA 4N42A 3M0KA 1YPXA 2NLIA 3KX6A 3THUA 3GUGA 1R9XA 4JQ1A 1TKKA 5DT5A 1ZY9A 4UQDA 4GXWA 1KBLA 3FXGA 1JPHA 1BEUA 5M17A 2PZNA 3H2NA 5K2ZA 3A3HA 2WCAA 4QBXA 3PBUA 1YTEA 1DQXA 3MUXA 2BVTA 1ZBCA 2VR5A 4L9XA 4S3DA 3RXZA 3WBEA 3TLQA 1EGZA 1EC8A 2AQVA 5BW6A 2Q8LA 3AHVA 4Z42C 2QMKA 2W3ZA 2W0UA 4J7RA 2J75A 4KEVA 2VYOA 3W01A 4O1CA 3SO7A 2DT3A 3W7NA 1OFRA 2ATSA 3H55A 4WLCA 1J10A 4M1BA 4KFOA 2WZTA 3TJLA 4B3ZA 3VGGA 4S3GA 4M3PA 2FGLA 3B4UA 2YA2A 4H8HA 3VGFA 4YVXA 4O15A 2V3FA 1F3EA 4RPQA 4LS0A 1M7OA 4JY8A 1D2KA 4HA0A 3FDKA 3EMZA 4ERAA 4LUSB 3S3GA 4F0RA 2IMRA 1Q6DA 3GW0A 3VE9A 1L6WA 1AMYA 4MB1A 4C5YA 3AUJA 1QNRA 3WUFA 3KE0A 2RAGA 1FTXA 4GZJA 2YL8A 4MM1A 2XN0A 1GOMA 1S5MA 2XFYA 5I7GA 3LV6A 4GNJA 3IJDA 2YX0A 5AKQA 4O0ZA 1E4NA 3GB6A 3NA8A 2VX7A 4YWIA 4W84A 2E68A 4DX3A 5FACA 3IV8A 5GJPA 4UQ9A 1VBJA 2OWXA 3PUDA 3OBEA 5AYYA 4GJIA 1SU5A 1OFEA 4R33A 5J8LA 1WA3A 3RF9A 4Q7BA 3P8JA 3UEQA 4EKJA 4KKXA 4GIYA 4E6MA 1MSSA 3ZLHA 5FAJA 3QVQA 1OY0A 1BLIA 1AK5A 1B5TA 5JQ9A 3RCMA 3SUWA 3LCFA 3UF9A 3WJZA 1HGYA 1DXEA 1UQZA 2PDYA 3NSMA 3V5CA 3KP0A 3NL3A 4Q4QA 3W71A 4EACA 1RVGA 3ATYA 1IZCA 4GZ7A 3ABOA 1XLKA 3B9DA 1E4IA 4ML9A 4AIEA 3QGAC 1TQXA 7ODCA 5K9XA 4EOUA 3VM5A 4FXJA 2O4QA 5HA7A 2DPEA 2PDCA 3PWAA 3PZMA 1L0PA 3C61A 4IFRA 2HXTA 5BMXA 4JTGA 2EKGA 3ZQ9A 4G6CA 4B3LA 3DAQA 4L4MA 4UFIA 4CQAA 1QUMA 1XICA 3TCSA 4QGCA 5I3FA 3LPPA 3FHAA 4GVHA 1NH6A 1CI1A 1AJ0A 4F4RA 2QIIA 2A3AA 3ZSSA 2QCLA 1ICSA 3QZ6A 3EWUA 2F2KA 3AU6A 1EA9C 1UR4A 2NX9A 5I6SA 4OTKA 2OEMA 4WJXA 5CC7A 2QKFA 1FDYA 3C3NA 4MJZA 5J5RA 1YPFA 3BMXA 2PP0A 1UWTA 3VKCA 1A5OC 1P0BA 3WQWA 2WC3A 4KGJA 2QGYA 1DYSA 3SZ8A 3RLUA 1V03A 3GVQA 3TR2A 4JTTA 2PTXA 1VFOA 1QI4A 4HNLA 2E0PA 3LGDA 2Y7FA 3C2YA 3P62A 3PS7A 3O6AA 4KWWA 4AUBA 2BOEX 1EBHA 4P8WA 2ZXDA 3GFZA 4UR7A 2XHYA 1BRLA 2PDHA 4DUVA 2ZOXA 4BY3A 3PJUA 5FSEC 1J9YA 2F7FA 5H6HA 3YPIA 1GQKA 3BOLA 4J3XA 2OGYA 3P2VA 3WLTA 4ZOEA 1FCBA 1R3WA 1H5YA 2Y7GA 1E0TA 3LOTA 5JIWA 5H8UA 3A24A 4Q4KA 1LWIA 1ML1A 1ONXA 2YW3A 2QCNA 4GWEA 4MYAA 2WMFA 2BFGA 2JGQA 3MT1A 1OFAA 1W1B1 1GQNA 1ZAJA 1CXKA 1EP2A 2AKMA 5K7JA 3U5UA 1VBGA 3NUKA 1B1YA 2VC7A 2E8YA 3NDOA 3EOEA 3I6TA 1TPEA 3DIPA 3GFYA 4NKCA 2R91A 2AAAA 2GVEA 1M68A 4DBWA 2B7QA 4GYKA 1WOAA 3S47A 5GNZA 4G7EB 3B8TA 3B9NA 4CEUC 4NSBA 3UWEA 4DYKA 3WK2A 1OGBA 2J24A 2DH2A 5HUPA 4O4VA 4IWWA 1N7KA 1Q7QA 3DYOA 2E9BA 3KHDA 3TSBA 4JIQA 1U2YA 1GKPA 3TVAA 3TYAA 3W73A 4L9ZA 1IWAA 3P8IA 2Q02A 4YS1A 1CTNA 3UCQA 3TQ0A 3LRLA 5A5WA 5H8PA 3EDDA 1OBAA 3W25A 1H61A 1XLAA 4H6KA 3UZYA 3OVGA 2D20A 4PMRA 8A3HA 2EO7A 2J7GA 4IHCA 2EPLX 1ZZMA 1JG9A 3VM7A 3A64A 1E3ZA 1QDSA 6XIAA 4YCPA 5FAGA 3PNUA 3N2TA 3TC6A 4L1XA 4Q8NA 3HPSA 1O94A 2WMJA 2PS2A 1RUSA 4PYSA 1PZ1A 3BE7A 1JR1A 1IXQA 1VYPX 4HQVA 2CLMA 3M0VA 2Y6ZA 1R87A 2ZUNA 2WMIB 3G2GA 4CGTA 4HCLA 2I56A 4K1GA 2A85A 5CG0A 1QBBA 2FFIA 2ZQ0A 4NJKA 1K03A 5CZ0A 4O17A 4LS1A 3AIWA 4HK7A 3O1NA 1G1YA 3CYVA 4PCNA 5IHRA 3HGJA 4S2CA 5CPQA 4RNFA 1OFQA 1KWKA 3G5EA 1S2UA 1G94A 1UR0A 2DSVA 4HBKA 3RX3A 3FYYA 4JTEA 3R89A 4LUTA 2HV5A 4IQDA 4ZB2A 4GLEA 3QOMA 3FCPA 3SRKA 3ZT7A 3LERA 2XGIA 3E74A 1I2NA 4A3RA 4BEUA 3H23A 4OJYA 1WP6A 4NRSA 4KWUA 4O0QA 5LNWA 1JEZA 1HZYA 4DM1A 3LHUA 1FH9A 1P1MA 4PTWA 4OOUA 3GNRA 5TNVA 1TZ7A 4C6EA 2BGSA 1RLCL 3ISIX 4EPEC 1IEVA 1A4MA 4C6OA 4IG2B 4NZ1A 4IIBA 3ALGA 4ONVA 3NYDA 5CJNA 5BXPA 1HT6A 5AHLA 3AIUA 3RMJA 4LUIA 1TVPA 2H9AA 1WAUA 2DZVA 3VGHA 1UMYA 5AVHA 5FKYA 5DN1A 4ZENA 1BXCA 2PDFA 5BU9A 4C65A 2YB4A 3N25A 3LBOA 2DZBA 3QBUA 3WH5A 4XISA 2FLIA 3NVTA 3EYPA 4KW2A 3CJPA 1UIOA 3FX4A 3BCFA 5IOBA 1EJXC 3OA5A 3NEHA 2D0HA 1LYXA 3OQEA 3BVJA 3WUGA 4TTGA 2OR2A 1RJRA 4JNMA 4UXDA 1EA0A 4TX6A 5BRPA 1EDGA 3WN6A 1W9VA 3BW3A 3VD3A 1WKFA 1SZNA 3VMOA 2ZXQA 1VEPA 4D6CA 3BLPX 5TIMA 5I23A 1F8MA 1EWDA 3W7EA 1LRTA 2VCBA 4MKVA 3M0IA 5IFTA 3N17A 3BTNA 3Q94A 3P61A 3F2BA 3T44A 5FEPA 2WVVA 3OIXA 2C6QA 5F4XA 3PAOA 1WPCA 3BV4A 1U33A 3AIVA 4NYUA 2A7RA 2C71A 2NUWA 4PMOA 4Y6GA 3ERPA 5D8WA 3WG6A 4ZXOA 1FXPA 3QV6A 1S46A 3VK5A 1AMKA 4DLFA 1BG9A 4W8BA 1K8XA 3CWHA 5AC5A 2TMDA 1SW3A 3I6RA 4JPGA 1LORA 4M81A 2WC4A 3TA9A 1QI3A 1ICQA 3IGSA 1DWAM 4GNKB 4V15A 4B5UA 2YBVA 3GR4A 2WLZA 4IX2A 1XD1A 3WENA 5TQLA 1JFXA 3H21A 3G0XA 3AZTA 4QJ4B 2OSXA 3KL0A 3GXIA 4B4HA 1VRDA 3BC9A 1GVYA 4HA3A 1ELSA 4GYPC 2EG8A 1RY8A 4XWUA 2EGZA 2RUSA 1UYQA 5EY5A 4DJFA 3GIQA 3T4CA 2POTA 1E9LA 3PR2A 1KM6A 4MWAB 3IJQA 4ZQPA 3ARYA 3CS2A 2NV9A 2QCCA 3ITLA 2BSLA 3H26A 3M47A 4H9UA 1OZMA 3ENLA 4FX8A 2NV2A 1ZUAX 3K13A 3V1HA 1HVQA 3UP8A 1ZP4A 2VL4A 1J5TA 3N19B 4FIQA 3V18A 2ZWYA 4A3HA 2R1NA 3LGEA 3FHQA 1ITCA 4W9TA 1X7FA 3QQ1A 4UMCA 1F3WA 3VDHA 7PTDA 3VCCA 1J93A 3A23A 1XG4A 5AYIA 3C2EA 2D1ZA 3URAA 3OO2A 1QK2A 1VFUA 3MUIA 1C8VA 3B0XA 1FX6A 3DU0A 1TCMA 3C6CA 3MO4A 5CSRA 4A3YA 3NG3A 2CBUA 4CU8A 3R79A 1E5JA 1J12A 4A22A 4ZBCA 1DJXA 3W83A 4X22A 1R47A 3IUIA 1E40A 1GVEA 3RJXA 1F5ZA 2Z28A 1WZKA 3NQFA 3Q37A 2FZ8A 3EA2A 4M29A 4XZIA 5HMDA 4J27A 3U3HA 1SPQA 3TWAA 3WFZA 1WDPA 3UU0A 4LVDA 1LQ2A 1G01A 1U5HA 2XFRA 3HMJG 3U9IA 1JAKA 4PMUA 3PULA 1U1UA 3CO8A 2E6FA 3QKEA 4IQLA 4RE3A 5HBFA 1GOWA 4GC4A 2J27A 3CUXA 1TA3B 1AZ2A 3JRKA 1W9BM 5T9BG 4FA3A 5A6LA 4AX6A 3L66A 2O56A 5MHBA 3H2MA 1DKWA 5F1UA 3MDUA 4D6HA 4LYRA 5HQMA 3Q65A 1Q2RA 5A8QA 2WANA 1NVMA 4ZSTA 4WY0B 2WXDM 3PP7A 2C1HA 4JTKA 2X40A 3MUZ1 3UETA 3T0BA 2P0OA 5EFFA 1VENA 2PZ0A 4ZB0A 1KXTA 1QOPA 1LTDA 1JYVA 3W72A 1J0HA 1EH9A 2OVLA 1PDZA 4OUEA 1P1XA 2BLEA 1UWSA 4U3CA 5HPCA 3WH7A 4BQ3A 1ECQA 1I45A 3FA5A 1LP6A 3CB8A 4H1ZA 1KCXA 1I6NA 4PL2A 1VF8A 3PPGA 3G1HA 4FXFA 2OSWA 3WD3A 4OECA 4BS0A 5C6MA 3EB3A 4BZYA 1XG3A 3QW3A 1E0XA 4P5UA 1R6WA 1JZ3A 3CUHA 3LBMA 4O10A 4NAEB 3ZMRA 3EA1A 4Z2GA 3NPUA 2HQAA 4IL2A 4XAYA 4A21A 4US5A 1JFHA 3WK1A 3MSRA 2C13A 3TR9A 3VABA 4L5ZA 4QISA 3AYSA 4LNYA 1ISVA 3DFYA 3S2NA 4D1JA 4R53A 1PKYA 3GK0A 4L61A 5G1TA 1UBPC 3O2LA 3PPFA 3KCLA 4W93A 3RK8A 2ZZ3A 4LUSA 1LM1A 3EMQA 2ODOA 4GI4A 1E0WA 5B7ZA 3G6LA 3W2NA 4PN2A 3I3DA 5KITA 2VEKA 1H7RA 2WZMA 1F61A 1GVIA 3R8RA 3KDNA 3IVUA 2V0TA 4ALDA 1PEZA 4CUCA 2YCJA 1L2UA 3DCPA 3EWYA 3G0SA 1J5SA 1R3TA 2WYSA 1X38A 2W92A 4KIEA 2HS8A 4HZ7A 4JHMA 1L2QA 3TA6A 4GUGA 4JN6A 3AXKA 2X42A 4K8EA 4UBPC 3N4AA 1A5AA 3CUFA 3GHUA 5EGRA 3CAQA 5AHIA 2EJAA 3VGDA 2W6RA 1OJXA 2HTMA 3GH7A 4LPCA 1PYMA 5LIUX 2C0HA 1H2JA 1XIEA 4I6KA 3RJYA 3UPBA 1TR1A 1Z3NA 5BOEA 4N2YA 4U31A 4QR6A 3KOZA 3STEA 4IOTA 4UC5A 1NFBA 2OFJA 1TVNA 2J8TA 3C4UA 1XP3A 1UR2A 3TNOA 4Q8PA 3IRDA 2QPSA 4FNPA 2CNCA 1VP5A 1KFWA 3HPFA 1MUMA 4KESA 4BWLC 3TTEA 1K7XA 2XG9A 3O05A 2PDXA 4R3UA 2PDWA 3T42A 2PLKA 1SO6A 3M0YA 4YMZA 5CC6A 5C2CA 4I3GA 3TJIA 4TVUA 2ZTKA 4J3VA 2ISDA 1KC7A 3E49A 3FDGA 3T0CA 2Q71A 1DWJM 4LU0A 3URQA 1UQYA 4QIUA 3SRDA 4TX8A 3GY1A 3R0UA 3EDJA 2VDHA 1TV5A 2VP8A 1VLWA 3GUWA 1KFLA 1TJ1A 1RV8A 4GUHA 1C92A 3VTRA 2W4XA 1JDDA 1NQ6A 3UA4A 3R13A 3IIZA 2GVJA 3TIMA 1QHPA 1CLKA 1EO5A 5HJLA 3N2XA 4ZE4A 2X05A 2O9TA 3BAWA 3F4WA 3R94A 4GJ1A 3WUEA 4XD6A 1GG0A 5HNTA 3BAXA 1HUVA 2ATMA 1TWDA 4RDWA 1MUCA 3HQPA 1S3HA 2A3HA 2R94A 4H9VA 2V5KA 3UWUA 2GL5A 3QR0A 2DVTA 4B5VA 3VKDA 4JFVA 1JNEA 1AJZA 1LJYA 4PULA 3RR1A 4HK6A 1EJSC 4F79A 1GK8A 4IX0A 1WOBA 1XKJA 4GQ0A 4XZNX 3SECA 1DL3A 3ZSTA 4NQ1A 4ADSA 1OCBA 3VD7A 4GPNA 1AH4A 1LBLA 2FHBA 3MSYA 3UJRA 4CU7A 4JTUA 3WK0A 1TV8A 3PG9A 1VFMA 3VOFA 4E38A 3MC5A 3LNMA 1ZSXA 2XVKA 1SZGA 2FMNA 3EB2A 1E6ZA 4EANA 5BZAA 4D1IA 3KFTA 2ICSA 2EPNA 2WBGA 2DW7A 3VKAA 3WLOA 5FA5A 5C54A 8TIMA 3MV01 1EUNA 1CEOA 1OT2A 3E1F1 4E4PA 3OB8A 2FYMA 3KXQA 1A3XA 4H7VA 5HDRA 1L9WA 2WJFA 4G7EA 4PC8A 4HN4A 1JZ6A 1AW1A 1GOXA 2XIIA 1OFPA 3N9SA 1ZBWA 2X09A 4WK9A 2DUAA 1QPKA 4X9SA 3TU9A 3DHUA 3HGOA 1PUDA 3KTSA 1TJRA 4UUIA 1E6XM 1XLJA 5TAOA 5AHFA 3B05A 4XKYB 4R7OA 4I9TA 4PUEA 3ME3A 4Q8MA 3A12A 1PXGA 3PBVA 3N14A 3WBYA 2GJXB 2G37A 1TPB1 4K37A 4PTVA 3B0UX 2QCGA 4REQB 2NV1A 5C9WA 1SM9A 1H1YA 2J9ZA 2C7FA 4I7UA 5A6BA 3UG8A 4FLSA 4GX9A 4QJ1A 1GTHA 1W5MA 3WD0A 2WMIA 5ABHA 4QFUA 3DH7A 2X2YA 1UCWA 4C6JA 5CLTA 4XD4A 1ME9A 3W6YA 3EWZA 3EX2A 3QPZA 1UKTA 3UWVA 1UJQA 1XGZA 3EEGA 1X98A 5HWNA 5ABTA 3LXAA 2C0AA 3MVTA 3QEZA 3MDWA 3NZGA 4RE0A 3SI9A 3NO5A 5A94A 4ECLA 1BHGA 1GPFA 4RJEA 4JIHA 4DZAA 1DIDA 4RL3A 1CECA 4ZQCA 1LUCB 3XISA 2QVHA 2WC7A 1R3YA 5G2HA 1KQYA 2IKGA 4HYWA 2QJJA 1JPIA 5I06A 4QRNA 2IPWA 4ADUA 1XRSA 3LY0A 1RCXB 3BAJA 2IQTA 4WDTA 4L1WA 1DJNA 3VZZA 3N29A 2OZ0A 1KXVA 1KB3A 1B30A 3PWIA 2WPBA 4OV9A 4JIRA 4IICA 4YN5A 3TJ4A 1UWIA 2XZ7A 1TMHA 3B04A 1J01A 1F07A 1J79A 2XSAA 1WZAA 4WX2A 4IG2A 3UYIA 1XPYA 1XSJA 1EBGA 1XISA 4IGHA 3VUPA 4K8HA 5A2AA 1K9EA 1ME7A 3CUJA 5FD0A 3VMPA 1G69A 2P8BA 3TEVA 1ONRA 3P80A 4PMYA 2Q6ZA 3NVDA 2D0GA 2GQ8A 2VKZG 2XFWA 3CH0A 1L6GA 4JX6A 3VIHA 2J4GA 4FP1A 5G1YA 2R8WA 1EJWC 1LCOA 3CPRA 1HKWA 1Y5XA 3NFUA 3L65A 4DJEA 1XI3A 1OGSA 2OEKA 3UR8A 1YNPA 2QJHA 3QFWA 5CGQA 1HJSA 1W3KA 5HMFA 2XPKA 2P50A 1H3GA 2WM0A 1O5RA 4GY1A 1WXZA 1H41A 1FWSA 2DQXA 3PUEA 1LQ0A 1GKRA 1O68A 3UT0A 3K8KA 3BARA 5IBXA 4Q8OA 1QCWA 1X8FA 2PTDA 2OSYA 3E2SA 4HPGA 4UTIA 4LAOA 1KV8A 4JTRA 1TPVA 3CZGA 2WMHA 1EB3A 4ATWA 6ENLA 3WH8A 2QUMA 5CJMA 3Q58A 1L8NA 3L4TA 1FY6A 1C9WA 3ANYA 3WNMA 4MY9A 1ISYA 2FDSA 2D3NA 1W1VA 3IVTA 2RH9A 2PPGA 4HNUA 3ARRA 2A3CA 2D2GA 3OHIA 3RX4A 3UY8A 2Y8VA 4PA8A 3CZJA 2C14A 1WDSA 1V02E 4JTDA 2PGRA 1UWRA 4DJDA 2UY4A 4PTDA 1XIIA 4RZ6A 1OQFA 3PZTA 4PGLA 6TAAA 1W1IE 3W87A 3GNDA 2INZA 1RBOB 1XR2A 4UTWC 3IJ6A 1WB0A 3CO4A 4TR9A 3O6DA 4GQQA 3TZNA 4L4OA 1E55A 5DO8A 2XH4A 2DT2A 3DFSA 2WQPA 1I4NA 2JKAA 4HNOA 1W91A 3CV6A 4MWAA 4D6DA 1GKQA 2HEJA 3GG8A 1QNVA 1DHKA 3VDCA 2B7NA 3DHPA 1AUSL 1K70A 1MO0A 2QEZA 4MUPA 3BCJA 4R9XA 4A29A 1YYAA 1PZ3A 2G5WA 5K3VA 1MQQA 2ISSA 3PZNA 1UZ1A 2TRSA 2PDPA 2Y70A 1AQMA 3R6IA 4UOZA 3IIPA 2PLJA 1H09A 3KRSA 3WQ6A 4BQ5A 4C1KA 3PSVA 4NX5A 3CUGA 2BB0A 4Y9OA 3DKLA 5CJ5A 2OO0A 5M3WA 4DAFA 2ABBA 1XYBA 2GGGA 3NPWA 4V2XA 3UZXA 5M1TA 4H9YA 5CPLA 3OVPA 4A8IA 4S39A 3VIFA 3U48A 3B8SA 4A8LA 2NQ9A 3PC0A 2QDEA 3WLLA 3DYMA 3URNA 1ODZA 1JI1A 1GHSA 2E1DA 4RXGA 1MQPA 3K2GA 3LZ5A 4HHHA 1J0KA 2CZ5A 3CIXA 1G4EA 3MUAA 4PTMA 1YXDA 1OM0A 4KFNA 2YZ5A 4FNSA 3A5FA 4UQEA 1GORA 3LCLA 5HQLA 3ARZA 3WLSA 1ECEA 6REQB 4ACZB 3TN4A 4GYFA 1SZEA 4JEJA 1JAEA 2VENA 3O0KA 1A0DA 4E2OA 4G1NA 2E1WA 3ITCA 3G1SA 4AQLA 1CCWB 3IUDA 2IXUA 1HJXA 1QTWA 1O66A 2ISWA 4J35A 3UYCA 4OWGA 2ZE3A 3VU2A 1YDNA 3HTWA 1E9IA 3KM8A 3BG5A 3SR7A 1P0DA 3MB9A 3S9IA 4CNSA 5ABEA 4IQJA 4LS2A 2BV9A 2I5IA 1US2A 4YL2A 3OGRA 2GQ9A 4O1FA 1E1FA 4GGBA 1J2WA 1LT7A 1WQ5A 1CGVA 1NQKA 1M01A 2BBFA 3NR0A 5ECVA 2X7WA 1QOXA 1REQA 1AA1B 2FKPA 3DENA 3WCZA 1K6AA 4QSHA 4UNLA 1UA3A 1Y0EA 3U2OA 4ZTYA 3AS0A 1AQ0A 4NUWA 3MHFA 1B54A 2ISFA 1CGUA 3HFYA 5A3HA 1FP8A 1X96A 4KWOA 3N18A 1KCLA 2P3ZA 1EC7A 4WY0A 1C8QA 1R5YA 2VDGA 2BG5A 1E6RA 2CKRA 3QY6A 4GFIA 3W82A 5JH2A 2OWCA 1W9PA 1QNPA 3SADA 3NURA 4IMAA 4KERA 1BXNA 2OLSA 1GW1A 4HPNA 1FWAC 2Z1SA 3EB4A 2Y63A 1ADSA 3PJWA 4WEVX 2JEQA 2DZSA 3SN0A 4NRRA 2OYLA 2YKKA 5HAOA 3A22A 3GNNA 3TYUA 4MPKA 2HVOA 1F9CA 2HPMA 4PUWA 4O1AA 2QDDA 4WVXA 3ONCA 3SCSA 1SFJA 1TREA 4E2VA 4Z2KA 3ZJ6A 3JR2A 2R1MA 2O9PA 2DZTA 2CIPA 2Y5EA 4XD5A 4URIA 4Z2LA 2WK2A 4GVIA 3C8FA 1SZFA 2HZGA 2PCEA 3MKVA 2V82A 1TJ0A 1P5BA 4NAEA 1E6NA 2NVDA 4ATDA 3S1WA 1XSKA 4US6A 3ABXA 1MXDA 5AYXA 1OX6A 4FS9A 2JF6A 3EGJA 4BQ2A 1V3MA 1EEPA 3HJEA 1NWTA 4JIEA 1AW5A 3FYPA 3SBFA 4NY2A 3MY9A 4FNRA 3KS5A 2A3BA 1ITQA 3BJFA 4WCJA 3ZVHB 4JD4A 3DFTA 3T81A 4DWSD 2INEA 3LQGA 5G4HC 3BMWA 4XZ9A 1E4LA 1KBIA 3K1GA 4YVPA 4XZHA 1SJDA 2AL2A 3G8EA 1FWHC 2BZNA 1HO4A 1U1HA 4H2HA 5F4WA 3ZO9A 2V5CA 1K6WA 1UOZA 2OQLA 1ZAHA 1NARA 1PPIA 5K9DA 2IUZA 3T78A 5G4EA 4V27A 2YDRA 5C9ZA 1XQLA 4DWSC 2A5HA 2X7VA 4GACA 3PFRA 2GDUA 5LGZA 2RFGA 1XUUA 2J79A 4IGSA 1W5PA 3HM7A 3SIMA 4ZFCA 5CXPA 4HPJA 3C2RA 3G1YA 1RZMA 2CZDA 1H7XA 1JCMP 5LNSA 2YGYA 1IXNA 1VFTA 5IFPA 4CU6A 3CHVA 5AY7A 1AZ1A 3UW6A 3PZGA 2YFOA 4YVVA 2QW5A 4FF7A 3G0UA 4LYQA 4GBUA 2CLOA 4PB4A 5KTLA 4MYXA 3R25A 1RCQA 3ID7A 1KCZA 4HHMA 5I3HA 1FWJC 5AC4A 4JTAA 1GJUA 1ZJIA 2YL6A 3ITGA 2GVLA 1HX0A 1V8EA 2ABAA 3C0QA 4FNTA 1B3XA 3B8VA 3B9EA 5M5DA 3TDFA 3WL1A 1W1ZA 4JTHA 4O0KA 4U2YA 1PO9A 3RLHA 3S5ZA 1X1ZA 2F9RA 5ECUA 2TSYA 3LI0A 2PTWA 4Y96A 3WDQA 3RYSA 3M0LA 2Y61A 5KMYA 4AC7C 3QV9A 3W2KA 1XIHA 5D30A 1UPPA 2F6KA 3SY8A 5D05A 4AYGA 2QV4A 4YLWA 4KT2A 3PPCA 1OX4B 3W4RA 1GPWA 4CVUA 1MWOA 3RGTA 2QNEA 2G3NA 2QR6A 2R1KA 2QJGA 4QQ3A 1IEXA 3SJ3A 2QPXA 2D3LA 2VUNA 1OFDA 4HJWA 1DWHM 1YW1A 3BK0A 3GNPA 4XKMA 3GC5A 3M0HA 4A8RA 4GKTA 3BG9A 3DGRA 4IP5A 4IF2A 3PTKA 3QN3A 3FW6A 1AODA 4GXMA 5C71A 2OLAA 4WXYA 1E5NA 2PP1A 4J3SA 2V2CA 4IPLA 2WLYA 4GCXA 3TTOA 1K4HA 4G8TA 2F38A 4EXQA 4J9JA 1J6PA 1Z9AA 1V6YA 1DJZA 2D73A 3W22A 4NX0A 4PL1A 1W1TA 2XM1A 4AIOA 2PWVA 3VILA 1VS1A 1MYRA 3L2MA 3K4WA 1C90A 1QATA 2I9EA 3LHTA 1RXOB 3SCPA 1IR2A 2J62A 3G3DA 3W7GA 4B2DD 3BSGA 4LAZA 4GH3A 3QC0A 1TJPA 3C0JA 2B81A 2NQHA 3F4NA 4RDZA 2P3EA 1ALDA 3WH9A 3BJTA 4MLJA 4B91A 2MANA 3TK7A 3GAKA 3LXCA 3H12A 1EKOA 4NAFA 3U2EA 4RNHA 1NWUA 3WJXA 1JCXA 2G3FA 1VPXA 3CHDA 4JX4A 5HR7A 3S6OA 4XO7A 2XU2A 2XFFA 1UKOA 3BOXA 3VNMA 4LRTA 3DYPA 4PRTA 3QGKC 4IGMA 3QHOA 1E4MM 4XKYA 3OODA 5FJPA 1K4GA 4HNVA 4DLMA 1HL9A 2DVUA 3IIOA 1OSEA 1EIBA 4MB3A 2YJQA 2HVMA 5AHEA 4O11A 4F66A 4DUOA 1M6JA 3ZZ1A 4C6PA 3W6LA 4REQA 1KV5A 3CZKA 5BXRA 3EWWA 1V08A 4S1FA 4DXVA 1NELA 4K3ZA 1BQGA 3OG3A 1OADA 3KHJA 5IHSA 3GKFA 2HSAA 5HULA 1S39A 3MKKA 1LF1A 4AF0B 1PIGA 4H3DA 1YDYA 2WVTA 4IH3A 1KM5A 1E73M 3DZ1A 3SCQA 1HIZA 3S1VA 1F6KA 1NFPA 3VNKA 1YPIA 1UP3A 2NXHA 2JKPA 2VGGA 5CZKA 2W61A 2WJDA 3LCIA 4D8AA 5CPMA 2B7OA 1TPDA 3WEOA 3A4AA 4JZ5A 1LUCA 4D6EA 3CGTA 1FWBC 1DTUA 1RJPA 4TU1A 2ALDA 2ZCGA 4CEXC 2Q09A 3M16A 1F4HA 1JQVA 3VCNA 1W5NA 4AEFA 3PWGA 3T0TA 3AWOA 1AD4A 3N11A 2TYSA 3HG3A 4RK8A 4DXXA 4M8UA 1W3TA 5I02A 1WDDA 3CM4A 1EFZA 1WO2A 3HPZA 4RR4A 5CG7A 3AROA 4WRHA 5E6YA 4AVNA 1Q2SA 1KM3A 4Q7NA 3HQ1A 4JQ3A 4PTNA 2XISA 2WZHA 3S2CA 4UTLA 2CXEA 2HISA 4MVAA 1XLDA 1JF6A 2ZX8A 3QMSA 5DEZA 4I5XA 3W75A 1F6YA 2GSJA 2REQB 1UHVA 4ILSA 3PHAA 1HKVA 3TAOA 1A0CA 5DY2A 1W5OA 2NW0A 4RW3A 2E7FA 2WBKA 1XIDA 2V5BA 5JIPA 2WNNA 1LROA 2FPTA 1GOQA 3ZLFA 2PDMA 2PB1A 4XG1A 1XYFA 1XX1A 5A6AA 5FJTA 4M7TA 4H01A 1MQRA 1FCVA 1WNOA 3EKLA 4W8LA 4MB4A 2OLHA 5EU9A 2XIOA 2GPTA 3MUY1 2YW4A 3KOFA 1EDTA 2YCLB 3AXHA 3ZYZA 1SO3A 4CQ9A 4YCOA 1HVXA 4DPPA 1O7AA 5CLWA 5KZEA 2B7PA 4DELA 1EGVA 2QV5A 3VNZA 2WVUA 3G22A 1PZ0A 4Q4PA 2DORA 3EDFA 5LIWX 1XLGA 4OBTA 1KW1A 3KS6A 4MJ4A 3GC4A 3ITTA 5FF0A 2WZIA 4ZO9A 1Q6GA 4NIRA 4Y2WA 3EXSA 1CYGA 2E5DA 2F2HA 3F2CA 3ABQA 3UR5A 1EX5A 4HA1A 2PDNA 1KKOA 3KW3A 1ZAIA 1MZRA 2ZC1A 1FHUA 2XH2A 3KRBA 2PEVA 3BOFA 2O0TA 3K5XA 1E6PA 1K7EA 2OQYA 2F84A 5PTDA 2OKTA 3CL6A 3W81A 4GFSA 3H53A 3TYBA 1GOIA 1F76A 1SO4A 5EMKA 3L0NA 4K2SA 2PC8A 1R46A 1WZMA 3EA3A 3KL3A 2QJNA 4IIDA 3DOPA 3L4XA 3TQKA 3MZNA 4U5IA 1SFTA 3QQ0A 4RPPA 5HINA 4GYPA 3RCNA 4DXKA 5AOUA 3F5LA 2CETA 3S8HA 2V81A 3G1VA 3U7VA 2WO5A 3CMFA 2ACQA 3EMCA 1EL3A 1S3TC 2UY3A 4P8UA 1G5AA 1AL7A 2QF8A 1IHIA 1YKWA 3HG2A 3W6MA 1AW2A 2GYIA 2POZA 4CD8A 4U33A 3S4TA 1LT8A 6A3HA 4AD1A 3O7UA 1AD1A 1Z7AA 1V3JA 2RDTA 3SN1A 1LDCA 3GC2A 1BWVA 4GUJA 2EHHA 2V3EA 4JDYA 2DQWA 1LOLA 4XIAA 3PAJA 3W1NA 1M53A 3R0KA 1M7JA 2WCGA 5HJXA 3AS2A 1VCFA 1Q6RA 5TD4A 1TELA 1RP8A 1UWUA 4LBUA 3UXKA 1FWNA 1ME8A 2JK2A 3S1UA 1TV4A 2DUXA 1PZ2A 2QGHA 3TQPA 1JRBA 4MAZA 3L4WA 1PTGA 3XINA 2YDAA 3B4YA 4I90A 4X60A 4CD6A 1TPUA 5HNRA 3O07A 4PCSA 3FFSA 5J5DA 2VZTA 3IJ8A 1AH3A 1JYWA 3DBNA 2XTKA 1KFKA 2BVYA 1DWFM 5D9MA 3WY1A 4GZIA 4AIBA 2IQ0A 3NZRA 4LF2A 1KTNA 3FS2A 1WE5A 3ARQA 4AZ7A 1QT1A 4UZUA 3B9AA 3HU7A 3W38A 1LBFA 3UD6A 4P2VA 3QTGA 3SCVA 6REQA 4ACZA 4DZ5A 3M5XA 2GOUA 4IIGA 3RX2A 3ZT5A 1M5WA 2WSPA 4DB7A 4YPJA 1TSIA 3LYEA 4XV0A 1DIKA 3MBDA 3SUTA 1TMQA 2QAPA 1KBKA 2QUNA 3CAKA 3W26A 4JFSA 2GQ3A 3N6JA 7REQB 3CH9A 2PBOA 3TXZA 1VB9A 4XZWA 1O1ZA 3OOQA 2OWWA 1EZ2A 1WUFA 1WAWA 1EOMA 3MP5A 2UV8G 1RPXA 4PH6A 3UWZA 2PGFA 4UOJA 4XIMA 3NWRA 1AQFA 3LMYA 6CGTA 1OABA 4X2PA 1KM2A 3M5ZA 1AH0A 1IGWA 3GXNA 4TO8A 1ITXA 3INPA 4C1LA 1EQCA 2J66A 3VFLA 2AMXA 3M9YA 4AD5A 3M0XA 1US0A 5H91A 2J8FA 4HPHA 2YXXA 3RG6A 1R2TA 3P3BA 3K30A 4IL0A 3VOJA 4HYRA 4KPLA 3H22A 2DIEA 4Q4MA 2CWNA 3CQKA 2C91A 3ARUA 1RPKA 2W91A 1JZ4A 2ZUMA 1ZBKA 3UXAA 4DO7A 3VDGA 2PRHA 3L2IA 1A5BA 3W29A 3PUGA 2TAAA 2RDWA 1AL8A 5LHFA 5BRQA 4CCEA 2PDJA 3TE9A 1UUOA 4U10A 3B40A 1R3RA 1PX8A 5U4NA 1GVQA 4PUKA 3DESA 4EPBC 3T0AA 4JFWA 4GG9A 3NYZA 4JR5A 3TFCA 2G41A 4E2DA 3RUBL 3AYTA 3NJ3A 4GC3A 4LW7A 2D24A 3TONA 2E9MA 4WHBA 3AICA 1HKMA 3KRZA 1HKIA 3WNKA 4OOZA 3PNZA 1KCKA 4LUJA 3CHCA 3CMJA 1I2QA 3ZVHA 1WV2A 1CB7B 5B80A 2VURA 1SW7A 2PF8A 3WLQA 3SIZA 1IXOA 4B5TA 4LB4A 4RE2A 3BAKA 1ZHAA 2CESA 3MI3A 2DEPA 4P7QA 1VEOA 4GO8A 5G2IA 4DWSB 4Z2JA 1X8CA 3DC8A 1DP0A 4BA0A 3D3FA 3W1UA 3DG7A 2FIQA 3NAVA 1B9BA 3IARA 1Q3NA 3M46A 4CLMA 1YDOA 3SRFA 2GJRA 2Y89A 3NQ8A 1XC4A 1W3LA 3JW7A 4E0CA 3STPA 3TSMA 1POKA 3GTXA 4XX6A 4H7CA 1VCGA 1SSDA 2E25A 1JXKA 4ZL1A 3UPWA 4BF7A 2ZX7A 4DN1A 5HNNA 1MUWA 2BY0A 4BWLA 3LHVA 1OYAA 3U4AA 5D9NA 3TMLA 1KFEA 1F2JA 3QMRA 1OYBA 2J25A 1W3HA 1GT8A 4JXCA 1J96A 3FVDA 1BTCA 3HG4A 3L4VA 3W7KA 3BLDA 5CAHA 1RH9A 1Q6CA 4G1KA 4KBXA 3OA3A 3CMGA 3WIJA 4GO9A 1THFD 2GGEA 2XJ7A 4IISA 4BF9A 2CPUA 2CZFA 4LXFA 2BY3A 3N1AA 1VPYA 4AXNA 3KBSA 3CQIA 3NQMA 4CD4A 3MJYA 1OINA 5EBAA 2PD9A 3QV8A 3OEXA 4HNNA 2WNQA 1U30A 2YBTA 5DY3A 1DJIA 3AO0A 2LLEA 2V67A 4Q8VA 2WOQA 1E9ZB 4MOZA 3PJXA 3T8QA 3WDJA 3TH6A 3WDHA 2G3MA 4DWDA 3ARPA 3DGBA 3D0CA 1VHCA 2BGNE 1BWLA 4MLRA 1H63A 1OFBA 3L0KA 2UWFA 5I09A 4WDXA 1Q8AA 2CLEA 1RBLA 1TG7A 4AWEA 3NZ1A 3D46A 3SCUA 5KZMA 3N3MA 5FI8A 4KEZA 4KEMA 3G1FA 3H54A 1XL9A 1CGTA 3G24A 1NFGA 5LIYX 1H7NA 3AS1A 4H9TA 1JPKA 4MNLA 5T9CE 1YBQB 4GUFA 5REQB 4GCAA 2VGIA 2CFFA 2E8ZA 1KGUA 5KINA 4BHYA 2PMQA 1LOQA 2R14A 3ZR6A 1Z41A 4O57A 4GJJA 3HF3A 3DUGA 4TMBA 2GJPA 3W74A 3AIQA 3PZVA 4E8GA 5CBIA 2Z24A 2YDSA 2VCCA 4A2SA 4Z08A 1KWGA 1EF3A 1F3TA 2VX4A 2TODA 4B9YA 3JUGA 1L6YA 1TRIA 1FH7A 3GDBA 1NDZA 3A4XA 4RX0A 2VO5A 5A6SA 1QW7A 4NJHA 1ESWA 3ARWA 1V0KA 3WO8A 2HNHA 1M3UA 3L0GA 3LZ3A 1JCJA 5CZJA 1XIGA 3CQJA 3KBWA 1SQ7A 4LNCA 4N7QA 5CKSA 4L1GA 4UNKA 1MFVA 3CWNA 2NZLA 1V51A 3IGXA 2IPGA 3BAIA 2BXVA 1A5SA 4O53A 4GQBA 4XD3A 3I7QA 4UTTC 4Z0SA 2D22A 5SWUA 3MHGA 4NNBA 1UASA 3PJTA 3LSBA 2FZMA 2H8ZA 3AI0A 1PIFA 4INFA 3UXDA 1EOKA 3KTXA 3L7RA 4WUIA 2H6RA 2VHLA 1VFSA 3WD1A 5I3IA 2EPOA 2Z4GA 4CVWA 1OG6A 1TUFA 3R4IA 3HPXA 4EPKA 3TP4A 1XLLA 4CKQA 3Q45A 1QVBA 1KFBA 1N8IA 3S5NA 3MP3A 4L4PA 4AF0A 1BD0A 4QJ5B 3SSJA 2Z6JA 3E2VA 4QG6A 4CQDA 3FYOA 4AC1X 3OZYA 2FTWA 3NSXA 5KZ6A 1WKYA 4UIOA 2NUXA 1BG4A 1UD6A 4PSPA 3W7IA 4ZEPA 4DYJA 4IZGA 3AAMA 2CLFA 3T0DA 3W23A 1ADOA 3OJGA 1WBJA 4Z1CA 3C2VA 3DECA 4AD0A 5A1AA 2VI0A 4O54A 4RDYA 1A5CA 2ZE0A 2Y62A 2ADAA 2EG6A 2O9OA 3F4CA 1F8IA 3GU9A 2Y8UA 3WQVA 1NY1A 3AHZA 3G77A 3M07A 3ARXA 3W37A 4IFOA 2BHZA 4FLOA 1KRCC 1BKHA 5I3DA 3GYCA 2ZICA 5LGXA 4AEEA 1I75A 2JQXA 4L4LA 1KGXA 4A4AA 2XH7A 1ZP3A 4M19A 4S3JA 1RQBA 5CC5A 3COTA 3BQ5A 5BWAA 1XS2A 2WSYA 1B90A 1Q4NX 1BFNA 3E12A 1JCNA 3MYOA 1UBSA 2AKZA 3VX1A 1JD9A 1PBGA 2PDIA 3TC3A 4BJHA 1UR1A 4LYKA 1XKYA 2J9YA 3C0SA 3GTFA 3LENA 2REQA 1BQCA 4Q4SA 3HQOA 3UXIA 3MCOA 3GG1A 4R9OA 2FFCA 1GZGA 1RY0A 4DJFD 4ICCX 3H2OA 4WJEA 4CCZA 1MW1A 3QRHA 3APGA 2ZZ5A 5EKYA 3T08A 3W7CA 3PVFA 2YL5A 3UXLA 2CLKA 3LS9A 2Y4SA 2ZUUA 2PDLA 1YTDA 3TJXA 1XHGA 1A47A 2PODA 5I2UA 2YCLA 4MDOA 1XD0A 1O5XA 4QLLA 4Z1YA 2PDKA 3WLIA 4LVGA 1VBRA 3CZEA 2JFEX 2C16A 2QQ6A 1KKRA 4DJFC 2B4GA 4RW5A 1GOOA 1I60A 1EUAA 4YTQA 2X1UA 4C6QA 4FEZA 1A49A 4W87A 3II1A 4BF5A 5CGMA 1CNVA 1A4LA 2TPSA 3KCOA 1V0MA 4A8NA 3B8UA 1Q66A 6XIMA 1GJWA 4PZVA 3MMWA 3QSTA 3ZIZA 2BOGX 4NU7A 2XM2A 2OYKA 1SUXA 1BTMA 3EX1A 1AQHA 1MFUA 2C1IA 3WQEA 3GXPA 2ZDRA 3QPYA 3QJAA 4LOCA 4PUJA 4PFHA 4JHZA 3STGA 3IGHX 4HCDA 1H11A 1TTPA 1V3IA 3ZM8A 2YLAA 4FLRA 2RHGA 1KM0A 3GLCA 4D72A 4X3ZA 4ACYA 4AZCB 4LC6A 3SCTA 3ZVIA 4C6MA 3PTQA 1HKJA 2E3ZA 3PBYA 4LH8A 1B9ZA 2GUBA 4DIAA 2G97A 3GG7A 3MCNA 5FESA 1PKLA 2QDGA 4JAWA 1PIIA 2AAMA 3F5KA 4HSNA 3QMTA 2DIJA 4X0VA 2GDVA 4GI8A 3M44A 1L6FA 3S83A 2PSNA 1GVOA 3FY1A 1GG1A 1C7TA 4J3UA 4BCEA 2AOSA 2Z7KA 3MQTA 3IJIA 4Q33A 4LY8A 1XPGA 5F7UA 1JCYA 3OVRA 2X0HA 3OGSA 2ZRVA 3BV7A 3BUVA 2E9LA 2XVNA 1DHPA 3P60A 2Y88A 3O63A 3K4DA 2P0IA 3NQ7A 3VAVA 1LRNA 1GTEA 3CV2A 1ZJHA 2DW6A 2O55A 5D32A 3WF1A 2PFHA 4KH2A 2GJLA 5CSYA 1GYNA 3GXTA 3P67A 5BOFA 7XIMA 3VPLA 1UOKA 2BDQA 2BNJA 3G6MA 2GVGA 2NWSA 3U6WA 4C6LA 5C9UA 2J6XA 3FNDA 1D8CA 5EPDA 2WHJA 4YTUA 3B97A 4J5NA 3FGCA 5GQBA 1XLEA 3H4GA 1VQTA 1XYCA 1XFCA 4PEEA 3EX4A 1V6VA 4LWWA 2GGIA 3LBCA 5HNUA 4K7YA 1UW9A 3HPAA 1H0GA 1O4UA 2BY2A 4MY1A 3W85A 4GQRA 2QZRA 4OIFA 1QFEA 3HBLA 1K77A 1QO2A 4B3KA 4OKDA 3BO9A 2YYUA 3WFLA 1VPQA 3RFAA 4IIEA 5JMUA 5I07A 3MTWA 2XH0A 5FF3A 4F48A 1P0KA 1FQ0A 3KDOA 1TWIA 4US5D 1M9HA 3WSUA 1E1EA 1VBUA 3AJ7A 3DG3A 1Q4WA 5C7HA 3EOSA 3EWXA 4M1RA 3VNIA 5GVJA 1P7TB 1YTKA 1XC6A 1YNYA 1ZNNA 5EMMA 1K7FA 3TW9A 4XZBA 1FWCC 3S2JA 4JKLA 1P0EA 1NF7A 1EQPA 4ICNA 4N6FA 1ISWA 1TWWA 2OEJA 5DBUA 4WSKA 3U57A 3P74A 7REQA 1LZOA 1ZGDA 3M7SA 1UWAA 2NVAA 1T8XA 3EOUA 5C9RA 4XQ6A 4MIMA 2OODA 3PUOA 2PE4A 4A05A 3GZAA 3WQOA 4IMEA 4OBRA 3VKJA 1Q7MA 2QYGA 2X2GA 3G1AA 3OLGA 4ZMGA 3K4AA 3W84A 5I00A 2VRKA 3GDMA 4UR8A 1TCDA 3V5FA 1LG1A 3GX9A 4UFHA 2IXVA 3LX9A 3RLGA 5F4SA 1B2YA 3W7HA 3ZFHA 1H62A 2ZUSA 1V4YA 3ORWA 3LGGA 3R2GA 1EJVC 2GFTA 4NZ4A 4N9BA 4CNTA 3IAQA 1KQZA 1DJHA 2MUCA 1UUMA 2ZKMX 3FN9A 3ITXA 1XDLA 3WNNA 5HANA 2PDUA 2PTYA 1K02A 1BGGA 2ZIDA 3BW4A 4LUYA 3MO7A 1QPOA 1I1WA 3VOGA 4DF2A 1LLZA 3E38A 3FIGA 3L12A 1JF5A 4U4MA 2KX9A 3TYZA 2J13A 1RCOB 3L4UA 2A3EA 2VFEA 1HP5A 3R12A 3ATZA 1U83A 3C56A 2YSWA 3UCCA 4X0NA 2QS8A 3MW7A 3CAVA 4ERGA 1MXSA 2UY2A 4KWSA 2Y7DA 4LVFA 3C2FA 2WHMA 1K8YA 5CQ1A 2J7HA 4N02A 1IGSA 4H8UA 2BOFX 4QXIA 4D6JA 4S23A 3I7RA 5BMWA 3C5QA 3OBAA 5C0QA 1UKPA 3GSMA 2NT1A 1VFHA 5FF2A 2VZUA 2VFFA 5AB3A 3G3MA 2VOTA 4XBSA 3N13A 1GZJA 3CWOX 3VYLA 1P0NA 4DWSA 2FHCA 3SCNA 4JY9A 1LL7A 2J7EA 4ZQOA 1NP0A 4YWSA 2XIBA 3E2QA 1TX2A 1CXEA 5I78A 1XWYA 2HBXA 4C6IA 3SY1A 3WUBA 2SFPA 4C1NA 2QIWA 4WGXA 1BRLB 1NSJA 1UIPA 2WQDA 1CGXA 3R43A 1Q6EA 1H7PA 2Z2BA 3ELFA 3JVAA 3WYZA 4IJCA 5HMSA 3L2LA 3UZZA 4L56A 1KBBA 1BSLA 1RD5A 3WEMA 3T6CA 4CD5A 2VMFA 3M1ZA 1R9YA 8CGTA 3C86A 2X41A 2PF0A 3RRXA 4PB5A 1QK0A 3NPVA 1JULA 4LVAA 4MFDA 2VR4A 4MUZA 3O0FA 1MI3A 3HO8A 1EP1A 4QDMA 1R86A 3U0HA 4NG3A 1MRQA 1P6BA 2PP3A 5CZTA 1OC5A 3TOYA 4H6EA 1MNZA 3WLNA 2IS7A 2HCVA 3CT7A 1P6CA 3W7JA 1CBGA 1BGAA 5A2CA 1GYMA 4UTHA 4F0LA 1BVNP 2Z29A 1IWPA 2J78A 3IVSA 3RRAA 4MF4A 3NM1A 2QCHA 3XIMA 3UPMA 4KCTA 4FOUA 4MZ1A 4D6GA 2J6VA 3UVAA 4M51A 2CHNA 1PB0A 3LPOA 3JZUA 2Q3OA 3LM3A 3QFEA 4K6AA 1X1OA 4R88A 4AXKA 2ZRUA 4DBDA 4GQGA 3KWXA 3WNLA 2ZA1A 4G9PA 2FVKA 2X30A 2AMGA 5LNVA 2XIJA 2RJGA 3QH2A 4CNOA 4FOKA 1HN1A 3U5YA 4EVZA 5A8OA 5H2ZA 1EJTC 1IZJA 3RR4A 4AD3A 2VWTA 2QCMA 1A3WA 5D9PA 1XYLA 5H1WA 5A6BD 4JX5A 2Z1XA 1ISZA 3LV5A 1S5TA 2VOMA 4QS6A 3NXLA 4RCXA 4UFLA 3VFCA 4RZ5A 1T5AA 1VFLA 4L80A 1W3JA 3KBJA 3M0MA 4O28A 3AZSA 1RAKA 4GI9A 5REQA 2NWRA 4LAKA 1CGYA 3VMNA 1UWQA 3SURA 4NI3A 3M7WA 4NZ5A 2CU0A 4DO6A 2XN2A 3RO6A 2C19A 1T0OA 4UFMA 3H4WA 1C8XA 1XDMA 2DSUA 2P53A 4KGLA 1TYGA 1MW0A 4FIRA 4UTKA 2H90A 3FAWA 1C29A 4XAPA 4LY4A 3LMZA 1OIMA 4YTSA 4JOMA 2BTMA 2X1SA 5CCZA 4OT7A 1JPMA 4AY1A 2G8ZA 3K8LA 1XLHA 4C6KA 5AC8A 5EL1A 1B3VA 2PWEA 2Z1KA 3IJ9A 1W5QA 2HMCA 3EAUA 1ZBVA 4QROA 3VXGA 4XZLX 4LF1A 4NZCA 1RSCA 3W3OA 5FJOA 2QMJA 2Z00A 2HWGA 4MGGA 4BFAA 4B92A 2NVCA 2UY5A 4DM2A 1G7VA 1E51A 4HJFA 2VR2A 4UR9A 1R0MA 3V4BA 3WBAA 5DELA 1BVWA 4BI7A 3TTQA 3SCOA 2V30A 1OGGA 1BYCA 3RILA 3D5HA 1QI5A 1POJA 1QI0A 1QNQA 4WKHA 3SGZA 3P84A 4E3TA 4FXRA 3VIKA 1P6WA 4YHGA 4R7WA 2GZXA 5MKGA 1ODUA 1SR9A 4BK9A 3ZT6A 4UQCA 2DT1A 5DLCA 5EB8A 4NJIA 4NF7A 1IT8A 4ZOCA 2HE5A 4HOXA 2EQDA 2Y5JA 4KRZA 4TTUA 2ZBTA 1L6SA 4DAIA 1YMYA 3UNTA 3USZA 2VELA 4JBRA 4IPIA 1N55A 3GRIA 2OU4A 3OZMA 3NSNA 3THAA 4DI8A 5GJMA 3NQ6A 3LRMA 4PCTA 2J74A 3WX7A 1SFSA 4IQEA 1QNOA 3CUZA 4FR6A 5E1QA 1XRTA 5C5YA 1KXHA 2DT0A 3UWQA 4O14A 3MBFA 2X0SA 1A0EA 3SCWA 2DSWA 3DG6A 1PKNA 3GFXA 3NTYA 3KLLA 3WQCA 1I9CB 1RHCA 2CC0A 4ZOBA 3M4HA 1FXQA 1V02A 1H51A 1X6UA 4FAMA 1D9EA 1QWKA 4IMFA 4H6QA 4MNJA 1OC7A 3HV9A 5F2GA 1B3YA 5E5CA 3O8AA 3BCDA 3VGEA 3URBA 2QUUA 2JF7A 1O5QA 3WDRA 5K4XA 5IBXC 3C0LA 2C8NA 2VXNA 3LEPA 3EWCA 2GWGA 4QCEA 2C79A 1WDQA 2X0YA 5FJRA 1WZLA 1MVYA 3V5OA 1XF0A 1PWLA 3SN4A 1JJKA 1OZQA 1ONEA 4Z1BA 5HUOA 4M5PA 3A9IA 3F4DA 1V3LA 2A3LA 4WOQA 3S42A 2VX5A 2OT0A 3CZ8A 2Z25A 2VRQA 2E5CA 2EAWA 4QQUA 2IPFA 4LEQA 1J8VA 3HQNA 2ZZ2A 2Z2UA 1VCVA 5ENLA 1A5NC 4K1WA 2YBUA 1RQHA 2G4JA 1OG0A 4F0SA 3TUUA 5KZDA 2CBJA 2BWGA 2GK1B 2BVDA 1MDRA 2VQTA 3MJMA 3PG8A 2C15A 3AZRA 4PRWA 4OGZA 1KM4A 2QHAA 1MMFA 4P7NA 3OP2A 3GNXA 2JIEA 3W9ZA 5EFDA 1I2OA 1TTIA 3QYSA 2FJUB 4K7VA 4NILA 3BLLA 3WLMA 3CB3A 2JEPA 4HU3A 5RUBA 4Q8QA 4WKAA 1W3NA 1TO3A 4XSMA 4R5EA 4J3ZA 3P5ZA 3WBXA 3SFKA 3LLFA 4HHLA 3ABZA 5BXSA 3APTA 3B03A 1C3FA 5ABFB 4QSFA 2A6LA 5JXQA 5CSSA 3DHFA 1H7OA 4RUBA 1VRXA 1QHZA 4DQWA 3W1LA 3T55A 1LWJA 1RR2A 4HN8A 4K8GA 5A6MA 3W88A 1TPWA 5LXXA 3THCA 2WJEA 4YYCA 2A6NA 3PPHA 4C6FA 1SO5A 2E4TA 3S2LA 1XBZA 1I2RA 1CENA 2WSKA 3HB9A 1UJPA 1KLYA 1ITUA 2E40A 3O6YX 4RZBA 2BASA 1H1ZA 3RPTA 1JGIA 3C52A 2OZ3A 3M5VA 2WAGA 1AFSA 4Q8UA 5F1VA 3REQB 3BJSA 4GVFA 1XGEA 3DXIA 3UZ5A 4FB7A 1VEMA 2VEMA 4ML4A 1XV8A 2CXGA 4JCLA 3HJZA 2Y85A 3D3AA 2ZUVA 1S5WA 4W86A 3SGUA 1N8FA 1JDFA 4FXSA 2OXNA 3VE7A 1Q45A 1UD2A 1XIBA 1DOSA 3CAWA 3DKJA 2ZRXA 2OKOA 5DCDA 3RU6A 1T8QA 4RE4A 1CLXA 5E09A 2VM8A 4UCFA 2DV0A 4Y8FA 3EDKA 3T40A 3QW4B 2PWHA 4QEEA 1DJYA 3CQHA 4C7FA 3QKZA 4WSJA 2O9RA 3L4ZA 3OHMB 2A7NA 3HGSA 4BEQA 4Z1DA 2XZ9A 1QJWA 1QO5A 4AY8A 1OB0A 3IANA 3QLLA 1NP2A 2VD9A 4DBUA 4AZBA 4ROQA 4W7WA 4AISA 2ZX5A 5DT7A 3UZJA 3AUOA 1KBJA 1UR8A 4I7VA 2QVNA 3SQLA 3GXDA 4IFKB 1ENUA 3ES8A 2ZRZA 1LLWA 4GIRA 2PU1A 2VNCA 5EMJA 1IWBA 4Q32A 3B0PA 4C60A 1H4PA 5AFDA 3LA4A 2CHOA 3E0LA 4IUGA 3BSHA 1VKFA 3NQDA 4C90A 4EP8C 2E09A 3A4JA 3LDVA 1MEIA 5D37A 3I6EA 3IIXA 5D38A 3LI1A 4QE5A 2QF7A 4ATLA 2PRLA 1OD0A 3GDTA 1YIXA 4HZ6A 4IJBA 1FHLA 1VYSX 2CKSA 3EXTA 1P7TA 1O60A 2WNWA 3CIVA 3WDIA 3NXFA 2HJPA 1NAL1 3NNTA 4IPNB 1J2BA 4S3EA 3AHTA 4GRSA 3VOCA 3QYQA 2NQLA 4E8CA 5J04A 9XIAA 2XSXA 3ARVA 1QXLA 2P10A 4AD2A 3WKZA 1SZRA 1VJIA 2ZDSA 5E0CA 1LL4A 4EK7A 3ZLGA 3RDKA 4U5KA 2ALRA 1XFBA 3W53A 1W9XA 2Z6IA 4KIRA 2BMBA 2RDUA 3BL3A 4XVEA 4L9YA 1KM1A 3WMSA 4M80A 1FWGC 3CBWA 4I8YA 1HJWA 5JU6A 3W2MA 4DVOA 2E5BA 1KLZA 3TV8A 1S1RA 5AC6A 2QCFA 5DANA 1YQ2A 5GJNA 4G56A 5D4YA 4PMNA 3LTPA 1RBAA 2VEIA 2QAFA 3AIEA 3E96A 1T96A 1J4EA 3AMDA 3LLXA 4F0MA 1X97A 4WGHA 3S2MA 1I0BA 2ISVA 3O06A 1M04A 2XVLA 1VR6A 3HFTA 3TYDA 2O7QA 5CPOA 1X7IA 4H9MA 1VLIA 4PR4A 1QW8A 3ANVA 5C8BB 1NDWA 2EF9A 4PCFA 4JIIX 2WKGA 4JFTA 4AWSA 4D9PA 1UB3A 1OVDA 4E4FA 3I3BA 4IIFA 1KRMA 3VD9A 1KA9F 4JCMA 3HN3A 1DE5A 2VGBA 3WF4A 3D47A 1O95A 3LHYA 2FZBA 3RM4A 5A6KA 1W1YA 1ZFJA 4P7RA 3UWYA 3GZ3A 4CCCA 1GEHA 4W8AA 5DQPA 2EPMX 3SUSA 2DZAA 3NZPA 5K9CA 4FO4A 4WY0F 4B9ZA 5I5RA 4QS5A 4YTTA 4PBEA 3GDLA 8XIAA 3B8IA 2GUUA 1PSCA 4AH7A 1GZ1A 3I68A 1VIWA 3MYPA 4HK5A 4WQ6A 4O16A 3BG3A 2WKJA 3GAYA 3Q4DA 4PSRA 3WLRA 2QJIA 1JL8A 3AXXA 1F7BA 3CEUA 1V3HA 2BP1A 2P76A 2E6DA 2J77A 3FA4A 1EEXA 1QAPA 1NEYA 3V3WA 5FEWA 1FA2A 4E3VA 2Y8KA 1GUVA 4XO6A 3EEZA 4O8AA 4FX7A 2RDXA 4MJMA 3OLDA 8RUCA 1R2SA 3KVJA 1V77A 2DJXA 3W1XA 1QMLA 1H60A 4AIUA 1N82A 1QBAA 1O6IA 4EPDC 1EDQA 3BLEA 3NL6A 1CZ1A 2E77A 2ZX9A 1Q7ZA 4AMCA 3N4FA 1Y7VA 4H83A 4LSBA 4A6GA 3W28A 2EXOA 4F8XA 4H41A 1YRRA 3GHSA 3U8GA 4J4KA 1G6CA 3TN5A 2FTPA 3RPDA 4U3AA 4QLKA 2HXUA 3KBNA 4LCSA 1JDAA 1JRCA 3LK6A 3QLDA 1A53A 5BOOA 5AHMA 1Z32X 3KTCA 1MW3A 3PZQA 4XSLA 4M6PA 1QWGA 1A5UA 1CXFA 2CLPA 4M0XA 4PMZA 1IIGA 2XGZA 3RNDA 2FTYA 5IXEA 5KEZA 4CN1A 3AXMA 1F74A 5FJUA 5L9FA 3TTYA 3H2AA 3R58A 2E6YA 4FNQA 1OX5A 1LBMA 4EWJA 4UNIA 2VEGA 2J88A 1FBAA 1ZJBA 1ZS2A 3GDKA 3UR2A 1XGDA 3VIJA 4JYFA 1XBYA 4C6CA 4ERIA 1M7XA 1ZCOA 4V1XA 1XIJA 3WJWA 1FHVA 1X39A 1TQJA 1CW2A 3FKKA 2IQDA 3SUUA 1Q6OA 5JVLA 1ONWA 2ANUA 4PE8A 5A2BA 3TAKA 5AC7A 1DPMA 5LKYA 5GNXA 1NDYA 4ZOAA 2H3BA 2J7CA 4F9JA 3OPSA 3P82A 4JKMA 1IE7C 4Z1AA 3WQ8A 4S2BA 1J11A 4F2TA 2WNZA 3SM0A 2AGTA 3GVVA 1RVKA 1YADA 4GYJA 3BQ6A 1K3UA 1JZ7A 3S5SA 1X1NA 3EOOA 3T9PA 4LGXA 2WPGA 3W86A 1OFOA 1IIHA 3N73A 4ZODA 3W1AA 4QAIA 2GVYA 1EJUC 3DDMA 4JN7A 4AY7A 5FL0A 3ZR4A 3G8RA 4P8VA 3ZXWA 1EHAA 2V9DA 2B31A 3W7OA 3DFOA 2I1OA 3KRUA 3UGRA 1K9DA 4GMEA 1SYTA 4FALA 1U22A 2YXOA 5D2XA 4QJ3B 2NSOA 2XWEA 1FCUA 2PLMA 3V1PA 4HA4A 1WCGA 2GSHA 4WOZA 3KZPA 5D02A 1EJRC 4O4WA 2ZZ7A 1OT1A 1ZRQA 4JQAA 4N0RA 4UTTA 4I9JA 4NZFA 3CU2A 1PCWA 5D04C 2OB3A 3WQDA 4UFJA 4HCHA 1W54A 3OZOA 3P7YA 2Q8ZA 4ZO6A 5M2FX 4DZIA 4C6DA 2XIQA 1TWSA 1US3A 3WZ0E 3E02A 4MFEA 1TA3A 3RPMA 3LPGA 5I77A 4O13A 1TMLA 2F6UA 3NQBA 1V0NA 2BXYA 2HK1A 1SJAA 3O16A 3GVRA 3LHZA 2OELA 3WQ4A 1RA5A 4GVGA 5E9XA 1W32A 1PYFA 3A6OA 3QGVA 4AZ5A 3WL0A 5FF7A 4AZ6A 4AHPA 1S5NA 1J6OA 5A8PA 1KR1A 3LCXA 4QITA 3B0VC 2Y2WA 2R9RA 2ACRA 3A21A 3A3XA 1XM3A 1FVPA 3CNYA 3K1DA 3EOLA 4QNWA 2VDIA 2PWFA 4ZGYA 4AFYA 1Q85A 1I2PA 1OC6A 2WKLA 3T09A 5DFAA 4QX4A 1TTQA 5LNRA 3GTHA 1XQKA 3PANA 4QDWA 2Z1BA 2GUYA 4HB7A 3O6CA 3VIIA 4O19A 4YHEA 2DSKA 3R5EA 4LBRA 1LG2A 2F61A 2FZDA 4BR1A 3WFAA 1RK6A 2ACSA 4TVCA 4W89A 3D6NA 4FPSA 3E5PA 2YIHA 3KLKA 2V6AA 1UD5A 2QXWA 3VINA 3GTNA 4KCVA 7ENLA 3LXBA 3L4YA 4N9EA 1DIEA 4H8NA 3W1QA 1EYEA 2A0NA 4P61A 3RN6A 3PB2A 4EAMA 3GD6A 9XIMA 4AW7A 1A5LC 3N3TA 4U28A 5TBOA 1NWRA 5HMEA 1PCKA 2D2HA 4TV6A 3IJ7A 4NYYA 1XBXA 2DFAA 3T4WA 2PD5A 3TFXA 2WSQA 1J0IA 3C8NA 3H2FA 1FFRA 2YCEA 3DI0A 3PN8A 4IP7A 1JYNA 5A8MA 3W7RA 3I3EA 1Y65A 1UP2A 3B06A 1SMAA 2PGEA 3O9NA 1GVFA 1HKKA 2HK0A 3VIPA 4W85A 3BMVA 3NQVA 4N9CA 3OBKA 1OCNA 4Z0JA 3DEQA 1KRBC 3UWWA 2OPJA 2HPIA 1OK6A 4Q3MA 3RITA 1S38A 3KOXA 3VCRA 3TCEA 3W76A 1Z8AA 1TRDA 4TVDA 1GQLA 4Y9MA 3PBGA 3N6HA 3MP4A 5JBDA 1B57A 2PDBA 1TZZA 2Q01A 4OV4A 4QM1A 5HR6A 3AISA 5HPOA 2GK1A 4GBDA 1IEWA 1MDLA 4NNCA 3QTPA 3TROA 5I3GA 2X1IA 2PWUA 3AOFA 3WK3A 3MUCA 3W27A 5BCAA 3FJLA 3PBWA 4UZSA 3TOPA 2XUCA 4XAZA 2NQ5A 3TN6A 5DMMA 3VDAA 4GY0A 1UZ4A 3H8AA 1EX1A 3B8DA 3Q2DA 1YXYA 3HURA 3AALA 3GHRA 1KD0A 2XINA 2ACUA 4PFMA 3VOHA 1T40A 3KUMA 1FWWA 2A1YA 1W31A 4YTRA 3P0XA 5FJIA 5ABFA 4HU8A 1Q65A 1V0LA 4IGNA 1Q13A 4JIPA 3W7MA 4MY8A 3SDOA 1CPUA 2Z1VA 3WF0A 4GZEA 2PUZA 4Q6JA 2Z2AA 5KETA 1I0DA 1NDVA 2WSRA 3OG2A 5DMLA 4XUGA 4D2JA 3AMLA 5BNKA 1GYLA 2CCRA 1OF6A 1VBHA 1XLIA 3THQA 5LIKX 4Q6XA 4HTBA 3REQA 4M6VA 3LCGA 4AHQA 3PFMA 4ZFMA 3CTTA 4JL2A 1H5VA 1RLDA 1R9ZA 3KAOA 3BGJA 5BXTA 3I10A 5D2TA 3PZOA 1C93A 1ZPTA 4L64A 4D71A 4F0KA 3R0DA 4H4IA 3AU2A 3TWBA 3CHFA 5A69A 3VX0A 4XZMX 5FEXA 4HT3A 4AD4A 4OZOA 3OGVA 4NASA 1TE6A 3UERA 1TV3A 1U5VA 1HFBA 1HG3A 1WYIA 3THDA 3S6DA 2PCQA 3B9OA 1REQB 3A47A 3W1TA 3QZAA 3IPWA 4B5SA 3AHXA 4GISA 3NQGA 4V33A 1PS9A 4HIBA 5XIAA 3IIVA 1B31A 3WNPA 4UOQA 2XVGA 3NDYA 2PDGA 3PY2A 1ISXA 1ADDA 1PAMA 2A4AA 2PGWA 3PB0A 2QJMA 1XH2A 4IFKA 4K39A 1EPVA 4TXEA 4BKNA 4F0HA 3LHWA 4H19A 2Z27A 1HJVA 1T99A 2DGAA 5B7YA 9CGTA 1IXPA 2D0FA 5CBBA 4W5ZA 3NGFA 3MWAA 1V5XA 3W7PA 4Z17A 2VVNA 2FPVA 1O1HA 5A6TC 3QR1A 1LLOA 2GQAA 1JD7A 1YLVA 1ZLPA 1DJGA 4HYVA 2HNEA 4I7WA 4GOAA 4ZA0A 2DDXA 1MNSA 3I4KA 4Y9NA 3NQEA 3QSRA 2V68A 5AZ1A 2CZEA 4C5ZA 2R82A 3KCJA 3CYJA 2GJXA 1R7AA 4ZE5A 3PBMA 2FQIA 1WUEA 2V3GA 2D23A 2DP3A 3WF2A 4O1BA 2OZ8A 1R85A 4LCRA 5BU6A 3WLKX 3DHDA 1M41A 1JQXA 3TYEA 2X8RA 3E2RA 4HMCA 2IKIA 1JIBA 1GQJA 4KMQA 1HW6A 4H00A 1M7PA 3GH5A 3W24A 1QPNA 2I14A 2WHKA 1DVJA 3WQPA 1ZB5A 3PTMA 1HGWA 2AL2B 2HROA 1EJ7L 3HIJA 4J2PA 2VZSA 2VC9A 4S3CA 3IV3A 4LALA 4N6EA 2GDQA 1L8PA 4YJ5A 3N12A 4UMAA 4XAGA 4J3WA 1TTJA 2QPUA 4ZQMA 3AMCA 2NUYA 1DEDA 1H7WA 2H3DA 5FF4A 4YNGA 1K9FA 2GGHA 4RNIA 1E3XA 4RLIA 4Y8EA 5CZSA 4KEUA 1XYZA 5CEWA 3LSCA 3GU2A 5D09A 2FGZA 2FHFA 2QLYA 4HZ8A 1X6LA 1DIOA 2Z7GA 3TQVA 5AZ0A 5DMYA 2V38A 3E0VA 2J47A 1H49A 4JTFA 3BAYA 4I5UA 4H9ZA 1D7KA 1E0VA 3M6YA 3VOIA 1JCTA 3TXVA 3OIHA 4MSSA 1EGMA 3MI6A 3V16A 4CQ8A 4DBEA 1E43A 2BHUA 1BKSA 3M0ZA 3PM6A 3VIGA 2XDFA 1DXIA 4IXXA 1BYBA 4S3AA 1PV8A 4YXGA 2KZHA 3LUTA 1OD8A 3BLFA 1EIXA 1G4PA 2VZVA 1Y5WA 2E6AA 2PDQA 4MDPA 4WDUA 2GGJA 1UG6A 3MA8A 3M0JA 4RZ4A 2DJLA 1NF0A 3A4WA 4JNZA 3CQ0A 3UR7A 4W4QA 1W17A 4GK8A 4UQBA 1EXPA 4D8ZA 3S9ZA 1SJCA 1PKMA 3LB0A 4DI9A 4IUOA 3PTDA 3E3HA 4XBJA 3S6TA 1VC4A 2CLIA 3WQFA 3MPGA 3BANA 2P88A 1JUKA 1W37A 2DZPA 5G4WA 2PAJA 2NQJA 5FCZA 2D2OA 2NX1A 4HSHA 1JUBA 3ANUA 2FZ9A 5E0KA 1XUZA 1JNDA 1NOUA 1QU4A 5EMLA 1W2VA 2NT0A 4I8DA 5E93A 1VFFA 4TX9A 3E0WA 2EKCA 2PWDA 4TMCA 3DFNA 1SVDA 3M43A 1U5JA 3V0SA 2VEPA 3MSDA 1EXBA 2VCAA 4OUIA 1KTBA 4NVTA 1Q5MA 1W2PA 3OLIA 1MEWA 1XRFA 1FH8A 1NIUA 1VD6A 4NHVA 4ORIA 4JQ4A 1OCQA 4DUXA 1DTNA 1GQIA 4BI6A 1IEQA 3N2OA 4QE4A 1EHNA 2WHLA 3KVMA 3KBMA 1AVAA 2ZUTA 1UUQA 1RP9A 2QUTA 1NOFA 2G0WA 4KRUA 3VO0A 2X16A 1XLMA 5C55A 3BURA 1S2VA 4S3FA 3IJLA 4HMDA 2QUVA 3W1PA 1JDEA 1ZQ5A 4NAFB 1F73A 3VNYA 4NI8A 2I57A 3TW6A 2FPYA 4CN4A 5D03A 3P0WA 3KBVA 2VUYA 3PZUA 4J40A 3BH4A 3TZFA 3NOEA 4WZHA 1W1A1 3N34A 3NL2A 3G1DA 3CK5A 1DE6A 4FK9A 4P7OA 1UD4A 1CGWA 3W02A 3FEMA 3FAXA 2G3IA 4TIMA 4ZXLA 1FHDA 4H7ZA 1HJUA 4GXPA 4Y90A 2OCZA 4TV5A 4F2BA 3WQGA 1YE6A 4JS3A 1UZDA 4LFYA 5FEZA 1QW9A 5IM51 1W0MA 2CW6A 3R11A 3WJYA 2EPHA 3USBA 1E15A 2DZUA 4S3KA 4E5TA 3EXRA 2R6OA 1WDWA 4K68A 3L5AA 1UR9A 3V35A 3ITOA 3UNDA 5AECA 3TMQA 1GEQA 3AYVA 2YL9A 1YDVA 2V2DA 4G2DA 2Z0IA 3JZEA 3QF0A 1G0CA 3M6DA 1PE1A 2ZUWA 2EEXA 1PTAA 4R7JA 3CUIA 3IS4A 4Y9PA 3FVMA 2RGMA 2G4FA 4KFPA 3W00A 2PLCA 1V93A 5D2VA 4GD0A 2WZEA 4LRSA 3ITYA 2BHYA 1I8JA 4QNEA 2HVNA 1J0JA 2ZXBA 2O7SA 4JTQA 4GI6A 1FDJA 1CIUA 5HWMA 3SCRA 4D6IA 1UR3M 2MNRA 3MSGA 4XTIA 4B16A 4S3BA 3WEZA 1PTDA 4WF7A 1HXJA 4FF5A 4PB3A 3CPUA 2DU2A 3F7JA 1UA7A 2V63A 4JICA 1M1BA 5HQEA 3MV11 4TOQA 3GG0A 3F03K 3P5YA 4TQTA 3LU2A 4QE1A 3UG5A 5CPTA 3OLEA 3RHGA 1JZ8A 1HL2A 3MMTA 3TC7A 5CC3A 4PUUA 2OT1A 2V8ZA 2VC6A 2Q3RA 5XINA 2UZ9A 1Q8JA 2ZFAA 4MMWA 4JTJA 2FB2A 2FB3A 1NWSA 1DBTA 4NJGA 3GXMA 4GHRA 1GWJA 3EKGA 4Y7EA 1HF6A 5C9XA 1U1JA