3L2MA

X-ray crystallographic analysis of pig pancreatic alpha-amylase with alpha-cyclodextrin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGQDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title X-ray crystallographic analyses of pig pancreatic alpha-amylase with limit dextrin, oligosaccharide, and alpha-cyclodextrin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l2mA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l2mA01
2OYLA 2WZEA 1WDPA 1V02A 3POHA 3VIPA 4JFUA 3EYPA 4MB4A 4Q22A 1D2KA 1EHAA 3WY2A 1E6QM 1JDCA 2J4GA 3RM4A 5ABHA 1EOMA 3KZSA 5D8ZA 4P7RA 4V28A 4QP0A 4UQAA 3ZT6A 4OBRA 4HA4A 4GZEA 1WDRA 2YL9A 4GQRA 1MXGA 3LRMA 1R86A 2XWEA 3BSHA 3CUGA 1US3A 1HXKA 3WQ5A 8CGTA 1JYWA 3IJ7A 3BGAA 3AZSA 4HA3A 2WC4A 4D71A 3U5UA 1IZJA 3AZTA 2GJXB 2CCRA 1U30A 5A6LA 1R75A 3AMGA 3DX2A 5BWFA 5ABEA 3ALFA 4HPHA 4AD5A 1JXJA 3WBAA 4IISA 2FE0A 4U3CA 3SUVA 4NX0A 1WZAA 3CO4A 3WD2A 2EJ1A 1I1XA 4MADA 2XN2A 1W9UA 1D3CA 2WK2A 3OIHA 1B2YA 1G1YA 1MQQA 2JIWA 1QW8A 1ZBVA 3AHXA 2FH8A 1BVNP 1C8XA 5C8BB 1UWTA 4EK7A 3BLKA 1RH9A 4JL1A 2CXGA 2YA1A 4D6FA 2WB5A 1WE5A 3WBEA 1GORA 1OSEA 4GO8A 1A47A 4CN6A 2A3BA 1V6WA 2QHAA 1CLXA 5E0FA 1NM9A 2BHYA 3A4WA 3SUWA 2D20A 4JIEA 1WO2A 2EAEA 4NZCA 4AZ7A 1BAGA 4D6DA 2FHCA 3S5ZA 1W3JA 4JKLA 2V3DA 1Q6GA 2JE8A 3ARVA 1CECA 1CXIA 3W0KA 2CKSA 1V0KA 1BGGA 1QX1A 2D0GA 5D9MA 1UD4A 1OCQA 4IM4A 4P8VA 4AZIA 5A2CA 2G3JA 3LPPA 1QWUA 3A3HA 3GH7A 2XSBA 2VTFA 2W92A 1M01A 4DM2A 4OBSA 2WPGA 3MV01 4QLLA 1KQZA 1VBUA 3WQ8A 3VD3A 1GOKA 1OB0A 1KGUA 1UHVA 2RGLA 3WNNA 1LL4A 3GYCA 2Z1KA 1DWGM 1XYZA 4UFHA 2VRQA 5BRQA 3LXBA 2IGTA 2PI6A 3NCOA 3DX1A 1W1YA 1C7TA 2F61A 2E9LA 3WENA 1FA2A 3D50A 1JAKA 3ZT5A 2IXUA 3PZUA 1UD5A 4FNPA 4TTGA 1E15A 3OA5A 4HPGA 4J3TA 1YQ2A 4YHGA 3LXAA 1ISYA 1FOBA 3MI6A 2A3AA 4DWSA 3CLWA 4AMWA 5E9AA 1CXFA 1W3HA 3A4AA 1W2VA 4HZ7A 2X2YA 3EJTA 1E6RA 1WDQA 4M81A 3AIWA 2ZUVA 3FAWA 2ZIDA 4AZCA 2YLLA 2A3EA 2ZXQA 3HG2A 4FNTA 3GNOA 2BY0A 2WHLA 3ARTA 2GFTA 2OWXA 3WH9A 1OIMA 1HP5A 4PMOA 1J9YA 1XSIA 4CKQA 5HNNA 5D8WA 3BUPA 2PB1A 1FFQA 3KLKA 1KR1A 3FY1A 3N18A 2X09A 3UR8A 3VIKA 1FHDA 2E9BA 1TFVA 3TTQA 4OZOA 2V3FA 1LLOA 4W7WA 1CENA 3WY4A 1GCYA 5IFPA 5KZ6A 2ZWZA 3CHCA 3FNDA 3VMNA 2JFEX 2O9PA 5LA1A 3ARWA 1IZKA 3W38A 3WIJA 2CETA 5ABGA 1RPKA 4ATDA 3EJRA 1VFOA 1V3HA 2GVYA 4N42A 2NT0A 2CPUA 4BZYA 1JZ3A 1AQHA 2X0HA 2VX7A 1J12A 3WQ4A 2BY2A 3LX9A 1GW1A 2XIIA 2J7EA 1GOWA 3RDKA 3UR7A 3D4YA 2ZUUA 1NWUA 1JYXA 4PBGA 5HBFA 3WUEA 4MAVA 2XM1A 3G6MA 4CN1A 3AS2A 2W63A 4PMUA 1MQRA 1QNRA 1ZBWA 4QFUA 4AZBA 2WXDM 4MB5A 1BYBA 3MMUA 4CD4A 5A69A 1J0IA 3A24A 4NRRA 1XH1A 3WFZA 2J78A 3CHFA 3VKKA 2VL4A 1WDSA 5D9PA 3WNMA 5BROA 1C92A 3QOMA 2WBKA 1TUXA 2J75A 1CGYA 1JF6A 1DWFM 4DO6A 4P7OA 3ZR6A 4W8LA 1XRVA 3MU7A 2VMFA 3PBGA 4PUEA 1B0IA 4AISA 3QHOA 2YDRA 5HXMA 5CG0A 3WQWA 3GXIA 3OZOA 3WL1A 2ZE0A 3K4DA 2VZOA 2E3ZA 4H8HA 2O9RA 3EMQA 5DT5A 1XHGA 4MTVA 4HOZA 1KCKA 1W1PA 2JF7A 4BA0A 5A6SA 1GVIA 3PN8A 1QWNA 1AQMA 1EOKA 1XSKA 4OOUA 3D52A 2PBGA 1UD8A 4B9ZA 1B90A 3RM9A 1V0LA 4U33A 2WMFA 3NJ3A 3WF1A 1E5JA 3WEZA 2GJPA 3MUZ1 3SUTA 4ATWA 3ARZA 1CXEA 4CU7A 1V6VA 3I3BA 5ECUA 1DTUA 5LA0A 4MB3A 1TE1A 4AD1A 1GONA 3WH7A 1ISZA 5HDRA 4HOWA 3W4RA 1CGWA 1L8NA 2VQUA 2AMGA 1CEOA 5KEZA 1K9DA 4X0NA 5FL1A 1W1VA 2VJXA 2OSXA 1QHZA 1H0GA 1F4HA 2WMKA 4ZXLA 1QI2A 4A4AA 2BXYA 3RIKA 1BVZA 4HMEA 3VPLA 4CCCA 3T2QA 1HJXA 1BTCA 3W29A 4UOQA 2GJXA 8A3HA 1I75A 2DQXA 3WY1A 4J28A 3BC9A 3CZSA 3VGEA 4FNSA 1BGAA 4F9JA 3CIVA 1HVQA 3AISA 3VUPA 3L4WA 4CUCA 2EPNA 5JBFA 2J7GA 4U2YA 3WUFA 1R7AA 2E4TA 3DYPA 4W89A 5GNYA 1Q6DA 3UG4A 4PRWA 1QHPA 2EABA 1Q6CA 1NH6A 1MQPA 1T0OA 2VX5A 3O6AA 3BAKA 5BXSA 4U31A 1UKSA 2QF8A 1N82A 4AIUA 2YDSA 2VZTA 3WEOA 2W62A 4UQBA 4DUWA 3T0DA 1CXLA 4RE2A 1BYAA 3GXTA 1OGGA 4JZ5A 5AC4A 1QNQA 2C0HA 2D23A 2YFNA 3CUIA 2CBJA 1KFWA 3UG5A 4P7QA 1VEPA 1KXTA 1WPCA 3AICA 3TTYA 5CXPA 1PX4A 2D73A 1V3IA 1R34A 1ISWA 1KXQA 4FNQA 4W87A 1OT1A 1TA3B 1UH3A 3KL0A 4TVCA 4OKDA 4AD4A 1HKMA 2CBUA 3SCQA 3WDJA 2BV9A 1OINA 3EDFA 2OW6A 3CZLA 3CZ8A 3DC0A 3WD4A 4AD2A 1QBBA 2E8YA 3VGGA 4AYGA 2E0PA 3MSDA 1XCWA 3TTSA 3VIOA 4CU8A 1TVNA 1JIBA 3BUBA 4JFSA 3W26A 2EACA 2VQTA 2XVKA 4YN5A 2VNCA 1R8LA 3AS0A 4NRSA 1JD9A 3AOFA 2GDUA 4AC1X 1US2A 1OT2A 4JAWA 1BLIA 5AY7A 5DO8A 1FP9A 1EDQA 1E56A 1ZBKA 3WD0A 4M29A 3GM8A 3B9DA 1OBAA 1QVBA 2O92A 2YBUA 5C71A 3M07A 4RE3A 3ARYA 4W85A 3BXWA 4YHEA 1EXPA 1FH8A 2D0HA 4KWUA 4J3VA 1E0WA 5AYBA 3L4TA 1CXHA 5DT7A 4L4OA 1HT6A 4L4PA 4PMZA 1TG7A 5CPQA 2WKGA 4TX8A 5A8QA 5M5DA 2NSXA 1E6XM 1MWOA 3SCRA 2OYKA 2ZX6A 4EKJA 5A6BD 1QBAA 3APGA 1V3JA 4JHOA 3AMLA 4ACZA 5JBDA 3VSTA 4OJYA 4PTVA 3KL3A 4J27A 2ZXBA 4D6JA 1ZU8A 1UR8A 5A6BA 2BXZA 3N9KA 2PWDA 1UKOA 3QGVA 1KGWA 2Y8VA 1DWAM 1FH7A 1PJ9A 1E5NA 4J3UA 1GQKA 4ACYA 2ZUMA 3BH4A 3VGHA 3FW6A 2F1AA 3II1A 3CZEA 1PBGA 4ZFMA 2XJ7A 3BCDA 3NUKA 2XVNA 1V08A 2TAAA 2QMJA 2CYGA 1Y7VA 5AC5A 3ARRA 3WY3A 3T2PA 3BAJA 1R47A 3LRLA 4MJ4A 1VEMA 1HTYA 4UFKA 1XD0A 1XYFA 2PWGA 2DH2A 4MDPA 2FGZA 1W2PA 3VTRA 2Y2WA 5BCAA 4Z2HA 4MNJA 4EAMA 3BLPX 1TQTA 2CHNA 3CMGA 2D1ZA 2ZUSA 4J3XA 3BAWA 1O7DC 3WUBA 5CJ5A 3W81A 2ESCA 3ECQA 3BVVA 1E4IA 4WJXA 1HJSA 1HWWA 1UA3A 3FXYA 4P7LA 4TUFA 1RD6A 2E40A 2XUCA 4B16A 1DP0A 2DSUA 3N13A 1MW1A 2IUZA 2V5DA 2VURA 4BF7A 4LX4A 3E1F1 1E72M 2XVGA 5JUVA 3VINA 1C7SA 3BUQA 4UCFA 3TOPA 2ZX9A 5CQ1A 1TMQA 4F8XA 2OSWA 4XB3A 3U57A 3VD9A 4MAZA 1TR1A 4QCFA 3WNLA 2EADA 4H8UA 1HNYA 3W82A 3PZOA 3VX1A 3WL0A 3SUSA 4ZXOA 1BSIA 1E4NA 1E1EA 4QDMA 3SCNA 5TD4A 3LXCA 4C7GA 2WZIA 5E6YA 4CCDA 5ABFA 2JF6A 3PZNA 4BS0A 3AIVA 4QLKA 3MSGA 4D1IA 2DT0A 2YLAA 2BS9A 2YL8A 1EDTA 4HTYA 1CLVA 5JBEA 3K1DA 4X0VA 3IK2A 1KTBA 5I24A 4MNMA 2VRJA 2Y24A 1J0ZA 3GBDA 3VIMA 2ZXAA 1PZ2A 2DGAA 1R33A 1E71M 1LWHA 3GXPA 3AS1A 3IANA 5A94A 4AYSA 1JL8A 1E4LA 1JI1A 2QPUA 1ECEA 3DECA 1C8QA 1RP8A 3AHZA 2XFRA 4FNUA 2VUYA 1VFMA 1BG9A 3T0AA 1V02E 2G3NA 3WDHA 2VI0A 1K9FA 3UESA 3F5LA 4E8CA 2XFYA 4LYRA 4Y7EA 1V6XA 1E3ZA 2F1BA 2XM2A 4W5UA 4M1RA 2CBIA 3AMKA 3A21A 1UWQA 4MB1A 1PX8A 2PF0A 1UH2A 1B3ZA 3SCWA 3K8KA 4UOJA 2WCGA 4UFIA 1NWRA 2WCAA 4UQEA 3AS3A 3ZJ8A 1CBGA 2NW0A 4S3KA 3FN9A 2VCAA 3GH5A 2WW5A 1UKPA 4R5EA 4X9YA 1QW9A 2D0FA 1HL9A 1VRXA 3ARUA 4U2ZA 1C91A 4ML4A 2XFFA 1UA7A 2VZSA 2EEXA 6A3HA 3VDBA 1SMDA 1JZ6A 1AQ0A 2WMIB 3PZQA 3A47A 1R7OA 1JDDA 3CMJA 1UD3A 1GJUA 1KGXA 2QLYA 1G9HA 4IPNB 1CWYA 3WNKA 4KGJA 1J11A 3A23A 3VIHA 1ZBCA 4PMRA 4JHZA 1WB0A 4H41A 4P8UA 3SCVA 1SMAA 5A2AA 1S46A 1HN1A 3A4XA 4OOZA 1ISXA 1VENA 1QOXA 1R85A 4B15A 4ATLA 1HVXA 1WCGA 1TA3A 4WSJA 1XH2A 1UKQA 2WHMA 3NDZA 3ZSSA 1EDGA 3VSVA 3CZGA 3PTKA 3WMCA 4FNRA 3OLEA 2DT3A 2YL6A 1HJVA 1NP2A 1KTCA 2XGBA 3SEPA 3WKZA 5AYIA 1XSJA 3WELA 5DMYA 1DEDA 3SCPA 3ALGA 3HJEA 2VVNA 2ZX7A 4HZ6A 2GSJA 3IJ8A 3OGRA 2J7BA 3PZMA 2ZX8A 4IPLA 5DF0A 1H2JA 1C3FA 2UWFA 1UH4A 4RE4A 3EJPA 2DT1A 3TONA 3WDPP 5IXEA 3VNZA 3CHDA 3VD4A 3EJQA 1CDGA 4LGXA 2D22A 1TVPA 3VIFA 1KXVA 2QPSA 1CGVA 2XN0A 3BLBA 2VZVA 2ZOXA 3ZM8A 3W27A 5I0DA 1RP9A 3CUJA 2DH3A 1EGZA 3PZ9A 1LF1A 3M6DA 1JZ4A 2J8GA 1M7XA 3B9EA 4AD3A 2BVTA 2G3MA 1PZ3A 1JF5A 4D6HA 1JZ8A 2WMHA 5I77A 4M82A 3U7VA 1GQLA 1XC6A 4E2OA 5D4YA 5IHSA 1PAMA 1JXKA 1O6IA 2EPKX 2DIJA 2HVMA 3TTOA 3GXNA 3K46A 3ZSTA 2W66A 1IV8A 4LXFA 3VOCA 1B3VA 3BSGA 1MFUA 1WZLA 1UYQA 3BCFA 3D51A 3RILA 1OWQA 1H3GA 3AHYA 1NARA 4W88A 2YJQA 4MNKA 4UOZA 3JUGA 3IJ9A 5D9OA 1V3KA 4AZGA 5A6KA 3G6LA 1XGZA 4H7VA 5IHRA 4PN2A 4H2CA 1VB9A 2CKRA 4ZEPA 3NSMA 3KEHA 3UERA 3UCQA 3K8MA 1G01A 4XZBA 1ITCA 3RJXA 2Y5EA 4XZWA 4F66A 1KWGA 3OG2A 1VFFA 2O9TA 5C70A 1GPFA 3PZGA 3SCSA 3L4YA 4P8XA 1M03A 3T09A 3AXHA 1JD7A 3PZVA 4E8DA 1B30A 3AIQA 3U7BA 3EBVA 3W53A 1UQYA 1DWIM 2E9MA 2OWWA 1ESWA 2X8RA 1HKIA 4FLRA 4PMYA 3VU2A 2FHFA 4GZIA 1K9TA 4GI9A 2OYMA 4BQ4A 2GDVA 1UR9A 4C7FA 2W91A 2CNCA 3GDBA 3RJYA 4DO4A 2WLZA 5E09A 2EO7A 5GNZA 1GNXA 5E70A 2ZWYA 1W32A 2J7DA 1W3KA 3A5VA 3MUY1 3OLIA 4FMVA 3BMVA 3H54A 2VRKA 2MANA 3VIIA 1UR0A 5CLTA 1V0MA 3MMWA 5GNXA 5CSYA 1AMYA 3VX0A 2C7FA 4HP5A 3LPOA 2WVUA 2J74A 1E73M 1X6NA 4AMXA 1JFXA 1BYDA 2G3IA 2JIEA 2DEPA 3BAYA 2J8FA 4HOXA 1TCMA 3CUFA 4KGLA 4CD7A 1UOKA 3W24A 4CVUA 4DWSB 4MDOA 4D6CA 1QNOA 2VC9A 3J7HA 3PZTA 1CGXA 3THCA 2QV4A 4LYPA 3PTMA 3BMWA 2PWEA 1P6WA 3WH6A 4Z2GA 3O9NA 3CZJA 1V6UA 3EDKA 3AFBA 2NT1A 3WMSA 2Z1SA 1QNPA 3ZIZA 3ZJ6A 4BQ5A 2IXVA 5I2UA 4P7NA 2VT0A 2D3LA 2GUYA 2WNWA 1E1FA 4M24A 1QI4A 2CIPA 4UQ9A 3CTTA 4W7UA 4PCSA 2XIBA 4D6IA 1J18A 1JFHA 3MV11 4U3AA 2WVVB 4MNLA 3L2LA 1Z32X 2F7QA 4GI8A 1B3WA 3VNYA 2VCCA 5A6AA 4B9YA 3MUAA 1CNVA 3MO4A 2F18A 4BQ3A 4FLOA 4V27A 1QPKA 1HKKA 1NQ6A 3DHPA 1JNEA 4XUYA 3N04A 3IAPA 5I3DA 1MVYA 5A95A 3VIGA 3D5HA 2D24A 2WC7A 4PEEA 1EO5A 3S6TA 3M7SA 4M8UA 1WZKA 1SFSA 2V3GA 1D7FA 2PWHA 4WKFA 1GQIA 1B3XA 1PPIA 3HG5A 5GQBA 5BRPA 4JKMA 4TX6A 2AAAA 1LWJA 1G94A 1PEZA 1HJQA 4S3JA 5HPOA 4AW7A 1ISVA 4GI6A 4NZFA 3L4XA 3RM8A 2OWCA 2J7FA 3AQUA 5M03A 1OGBA 2JEPA 5GPRA 2UY2A 3HU7A 5DFAA 1TQSA 3ARPA 2WSKA 4AMCA 1V03A 3AI0A 3WFLA 5I79A 3CZKA 2CITA 4PTXA 4J7RA 2WMIA 3NSXA 4B3LA 1G0CA 1X1NA 3WD1A 1VF8A 2FGLA 4BQ2A 2BVYA 3WDRA 4MJ2A 1GUVA 1KWKA 1SR0A 4DO5A 1E0XA 1M53A 1JYVA 2VX6A 2WCSA 2WANA 1H1NA 3EJSA 3N12A 1MFVA 1U2YA 1A3HA 3CHEA 4UFJA 1J01A 2EXOA 5HOSA 4JCMA 2ZUNA 4W86A 4QCEA 3DX3A 1KQYA 2W67A 1G5AA 2GJRA 1W1TA 2W4XA 2JEQA 7TAAA 3CPUA 1OM0A 1JI2A 1CZ1A 5A8NA 1JGIA 3AZRA 4J3SA 2VX4A 5FKYA 1V0NA 3THDA 4PUDA 3BUIA 3QOKA 3BVTA 1YHTA 3DDGA 2PC8A 4D72A 5I23A 4AIOA 4D6EA 1DWHM 1E43A 1JYNA 4QLJA 3EMCA 1VJSA 1Q6EA 2WHKA 5A6JA 3GNRA 3WN6A 3H55A 1C93A 1W9PA 1M04A 2DT2A 4NZJA 3VM5A 3F4VA 3VMPA 1HF6A 4D1JA 1R87A 3RCNA 3WQ6A 1E9LA 3W6MA 5CPTA 1J0YA 1C8YA 2VVSA 3OLGA 7A3HA 1E6PA 1UZ4A 3WDQA 1MW3A 3ARSA 5JIWA 2Y8KA 2BY1A 4PSPA 1XCXA 5BXTA 4PMVA 4Z2KA 1W9DM 2YFOA 2DSVA 2EBNA 2WZHA 4UQDA 1LQ0A 2OSYA 3LPGA 3RMEA 2V5CA 2YOCA 4UQCA 4W8BA 5BXRA 3AIBA 4PMDA 4CD6A 3MUIA 1ZJBA 2PBOA 3FHAA 1E40A 4CD5A 2WLYA 2OW7A 3WNOA 4URIA 3ARQA 1HKJA 3K4AA 1UWIA 3RO8A 2C8NA 5HPCA 4XV0A 5FIPA 1E6ZA 4QAWA 2XSAA 4BCEA 4JCLA 2BHZA 2YL5A 3VDHA 3EDEA 4ZE5A 2J7CA 1EA9C 4MPKA 4OIFA 1VJZA 1VBRA 4A3YA 4HU0A 2W5FA 4CU6A 3N11A 1AVAA 2VO5A 1BYCA 4OUEA 3SUUA 3AHTA 4AY1A 3AYSA 3CC1A 1EIBA 3U5YA 5CZKA 2ZUWA 2WKLA 3KE0A 1X6LA 5FOOA 5CSUA 1SYTA 1TQVA 1SZNA 2X2HA 1ITXA 2E8ZA 1GOQA 2G41A 4UZUA 1MXDA 1WNOA 1E6NA 1E3XA 4CN4A 1QI5A 1B1YA 2FDMA 3N17A 3OGSA 1V3MA 3CBWA 4UFLA 2CEQA 4DUXA 2BNJA 2X1IA 1NOUA 3S2CA 4EE9A 3FAXA 2UY3A 2OLHA 1HJUA 1UZ1A 4KRUA 1ODUA 1LJYA 1UWSA 1JDAA 3SURA 4AZ6A 3OBAA 5DEZA 1H09A 5M3WA 1NWSA 5M17A 3PHAA 1J0HA 2Q8XA 1BFNA 4DWSD 2V3EA 2ZICA 4GO9A 3T08A 5FCZA 1QNSA 1VEOA 3ARXA 1JZ7A 1TQUA 2A3HA 1BHGA 3GH4A 3WF4A 1GZJA 2DSWA 3MKKA 3OLDA 1HP4A 2EPMX 1O7AA 4FF5A 3N15A 3ZQ9A 2WWCA 1GOOA 4LPCA 1UUQA 4H8VA 3SCUA 3CV5A 2CBVA 2AOSA 1Q4NX 1J0JA 2EPOA 3B9AA 3QHNA 4KRTA 1EO7A 1H11A 4HZ8A 3IGUA 5E0CA 4PYSA 3ZOAA 4P8WA 1ZL1A 4HA1A 2WM0A 3DX4A 1LL6A 3DDFA 2D2OA 1KBKA 2F7OA 1KCLA 2WHJA 2YA0A 1VFUA 2CHOA 4PCTA 3HZ3A 2GK1B 4F79A 1LL7A 3VDCA 2DDXA 1LG2A 1XD1A 1PIGA 4AZ5A 3OB8A 3BAIA 2J62A 3WH8A 5I6SA 3CH9A 3WMBA 5EFDA 2WVVA 5EBAA 4B3KA 4ACZB 1EHNA 3DX0A 3VGBA 4GZJA 3L4ZA 5EB8A 1UD2A 4AZHA 4DM1A 2F2HA 5IDIA 3ZJKA 4CGTA 1R46A 3EJUA 2WWDA 2F7PA 3F5JA 1DHKA 5I5RA 4NXSA 2WMJA 2HISA 4WSKA 3CGTA 2V38A 4PMXA 1F4AA 3WQVA 5CLWA 3VO0A 2O9OA 1V6YA 3HG4A 1B3YA 1E0VA 4DUVA 2VR5A 2ALWA 1W9VA 5FD0A 4E4PA 4GIAA 3PTQA 1JG9A 5CGMA 3WEMA 4AWEA 4C7DA 2X05A 1I1WA 3DHUA 2WMGA 2XWDA 4W5ZA 2UY4A 4H04A 3W6LA 3GBEA 4J3WA 3WDIA 3LMYA 1MW0A 4R27A 1GQJA 1E4MM 4ZE4A 1ZS2A 3PZIA 2YA2A 3CUHA 4AIEA 4GINA 2G4FA 3D4ZA 1QHOA 2VR4A 4D6GA 3AMCA 5LA2A 3NIYA 4OGZA 2UY5A 4HU8A 4WIWA 3OZPA 3LPFA 2WBGA 2FH6A 3DYMA 1H5VA 1BPLB 1UG6A 4UR9A 2QMKA 3KWXA 4V2XA 2XN1A 1WP6A 2PWFA 4W93A 4UTFA 4W7VA 3W28A 3SCOA 3VVGA 3GXFA 2BFGA 3GTNA 1UR4A 5CPSA 4YPJA 2J77A 4W84A 4U5KA 4AEEA 3L2MA 3I3DA 2XTKA 1XV8A 5I78A 2XYLA 2FHBA 3OGVA 3EDJA 1CTNA 1HIZA 4AEFA 1HXJA 1OIFA 3HN3A 2XGIA 1W9BM 1U33A 5A8PA 4JL2A 3NSNA 1E6SM 4LQ1A 5ABFB 5D9NA 1JAEA 3L4UA 3BAXA 3KL5A 4PTMA 4N0RA 1CXKA 5IFTA 2WVSA 4CD8A 2EQDA 2VCBA 1UKTA 1UWUA 1ODZA 2FYVA 2DSZA 3VMOA 4GKLA 1CIUA 3ZT7A 2DSKA 1CYGA 3AXIA 2XHYA 3FHQA 2ZUTA 3WF0A 1UWRA 1HJWA 2X2IA 3KLLA 2W61A 4WLCA 2YDQA 3VD7A 1FH9A 1CGTA 1EQPA 5E6ZA 3D3AA 4EANA 4GXPA 3WF2A 1PS3A 1NOWA 1QI3A 3AIUA 3AJ7A 4FK9A 1BG4A 4FLQA 5A2BA 2J47A 2VOTA 1PIFA 1KB3A 4JFTA 1WAWA 3AIEA 4M80A 3B8SA 5A8OA 1CGUA 3VGDA 3WUGA 3WH5A 1KR0A 2WYSA 5LYRA 3ZMRA 1WKYA 4TVUA 2X2JA 3AROA 3UETA 1EQCA 3T0BA 1W9XA 3EMZA 3HG3A 4KH2A 4WKHA 3BVXA 4AD0A 4A3HA 3MMDA 1H41A 3O2LA 1UD6A 2ZX5A 4CCEA 3N1AA 2DIEA 2VZUA 2X0YA 4TXEA 3TV8A 1J10A 1J0KA 3F5KA 2RGMA 4PMNA 3MS8A 5EMYA 5E1QA 4AZCB 2BVDA 4LYQA 1C90A 1BF2A 3SIMA 2WAGA 1GHRA 3H53A 4U5IA 1TZ7A 1NWTA 6TAAA 1E70M 3AYRA 1E55A 1MYRA 1BQCA 2G8ZA 1JNDA 1FHLA 1QI0A 1B31A 4JFWA 1W3LA 3NDYA 4HMDA 1UQZA 3QR3A 1W91A 1K6AA 1V3LA 1H4PA 2BY3A 3TA9A 1GVYA 4HMCA 4IUGA 4NSBA 4WKAA 4KMQA 5BYWA 3AXXA 1VAHA 3AMDA 4DWSC 5F7UA 3QHMA 2CESA 4TTUA 1H49A 1HL8A 5A8MA 4Z2IA 2J7HA 2XPKA 1XH0A 4CVWA 4FLSA 1K9EA 1UASA 2XVLA 2Y4SA 2J79A 4RL3A 4GQQA 3ZO9A 1JZ2A 4W8AA 3AIRA 2JALA 1FFRA 3WD3A 4WF7A 4UNIA 9CGTA 1GOMA 3LRKA 4NXKA 3VILA 2ZXDA 3UEQA 1VIWA 4JFVA 2YIHA 2YBTA 1OD8A 3RPMA 1KXHA 1ZJAA 1B9ZA 4Q7NA 3BVUA 3EDDA 3W25A 2DPEA 3M46A 1KBBA 3GNPA 1MW2A 4PSRA 1OGSA 2B31A 5BXPA 1GHSA 2F7RA 1OD0A 3I3EA 2EPLX 3CZNA 1CPUA 1HX0A 3UG3A 3DYOA 2J25A 3MANA 3WSUA 1DWJM 3POCA 4AXNA 1TQWA 3VIJA 2BHUA 5FL0A 5A6MA 3AHVA 4PMQA 4ZENA 1GOIA 1NOFA 1LG1A 1PX3A 1Q6FA 1UR2A 3VGFA 1IT0A 5EFFA 5A1AA 2GK1A 3L4VA 1FP8A 1L0PA 3VSUA 1WZMA 4GPNA 3VD5A 4F9DA 4M56A 3WNPA 3GXDA 3IAQA 4TVDA 4PTWA 3GXMA 3BVWA 6CGTA 3NYDA 1GJWA 4JKKA 2F8QA 1JZ5A 5CGTA 4XX6A 4WK9A 3HMCA 1H0IA 3K8LA 2XG9A 2WSPA 3TP4A 1EH9A 5JIPA 2WVTA 1NP0A 2D3NA 4K68A 3W37A 7CGTA 4UFMA 3ZJ7A 3GZAA 3VM7A 3S5YA 2CERA 3WF3A 4Z2LA 4TOQA 2XVPA 4UZSA 1ZB5A 1UR1A 4NF7A 3SCTA 5A3HA 4NI3A 3A6OA 3VDAA 3BUDA 3A22A 3ZR5A 2YKKA 4Z2JA 2A3CA 2WC3A 3T2OA
chains in the Genus database with same CATH superfamily
1M68A 1WDPA 1PG7H 4S1RH 4R53A 4GBXB 2X70A 1T04A 3ZT6A 1FZJA 3C09C 3IGAA 4PJAB 4ZUVB 4Q8UA 4IHOA 4D9RE 4JQ3A 4HT1H 3LN4B 2ZRXA 3X12B 1L7IL 5B8CC 3GZ3A 4Z7OF 4BXSV 3AWFA 2AKRA 1KN2H 3U4FA 3GVRA 1A5CA 3TZNA 1D3CA 3U7YH 1EBGA 2PGRA 5HGBA 4ZMXA 4G56A 3QDJD 1ZP4A 5D7IA 1T6BX 1NCJA 3NQCA 2QZ5A 1IXNA 5HYJA 3S1WA 1BAGA 4G6KH 1SVDA 5HGGS 1JPHA 4G6AC 3CN0A 2YN3A 2QKFA 5K7JA 3S3JA 4IM4A 3TIMA 1OCNA 2VTFA 4Y90A 3ONCA 3GSRA 3P5ZA 3DMMB 3TH2T 5HMEA 4XZIA 1KGUA 4F7PA 5DJ0A 5EOCH 2PP0A 4AG4H 1C08B 4UI2A 1DWGM 3O3DA 2BB0A 4JN7A 2VRQA 1CT8B 3NCOA 2NY3D 4IKIA 4C6EA 5E8PA 1ADQH 1VDGA 4TLKA 2IXUA 1UT2A 4L37A 2XISA 4LVGA 2E6DA 5SWZA 2X5PA 3PV6B 3M17B 5LGYA 4JIRA 5B1JA 3ROLA 4KCWA 2ZIDA 1KT2B 2YLLA 2W88A 3RNKB 2OWXA 3PP3K 4DUOA 2DZSA 1EBPA 3DMMC 1WWBX 3MV8A 3ARGC 1Z9SB 4WU7A 1BX2B 4ZFZA 1F07A 4HCRH 3TT3L 1CCZA 1FHDA 1WBYB 4DXKA 2OV0A 1CENA 3RX2A 4REQB 4BSJA 4C6BA 1MFBL 1T6WA 2DDQL 4OJFL 4U1LA 3HW7A 3GB7B 1JWUB 3AG4B 2J72A 3D0VA 4A6YB 4E0RB 2OKOA 3OXRA 4M5TA 3QUKB 2G60L 4XHQA 3K2MC 3PWLA 1YPFA 3BURA 1GW1A 4NUWA 1TV5A 1VZIA 3FV9A 3RGHA 2QCDA 4P46D 1H1YA 3V75A 5HUOA 3MMUA 3E74A 4JTHA 1NDMA 3A24A 1T1XB 4V1YA 3TZVD 4NUJA 2YXGA 4PJBB 5KVFE 3OJGA 1WDSA 5D9PA 5LBSH 4H9UA 4KUCD 6PAZA 4DCQB 1CGYA 1F3WA 2YD6A 4H00A 5DXXA 3T4YA 4PUEA 2FZ8A 4FI7A 1QUPA 2WAHA 2MCMA 2OG9A 4PB5A 4V1XA 2GSIA 2NVAA 3GXIA 3S42A 3EMQA 3HS9A 4P0DA 4MZRA 1ZA6B 4ICWA 4K2UH 3GSQA 4TL4A 3E3QC 5HYSA 3LNIA 2YO3A 3X2QB 3VAEA 5JDSB 2XG5A 1DEEA 1PF3A 4KRPB 3BWAA 4G71B 3ITYA 4OD2B 2AL1A 2B7DT 5I3HA 3H4WA 1F8MA 3PDOA 5D4JA 1W0WA 3QJZA 5JXED 3U0TA 1K5NB 2UXTA 1ZLUH 4O4YH 4ORMA 3T0WA 3O8AA 2X87A 3FB5B 4F20A 2P3ZA 5T33H 1KNOB 3MHFA 1X8CA 2BVPB 4XX5A 4PB4A 1R4XA 2UY7B 4JN1H 2PRHA 2H2SD 3EWWA 2CKBA 4YX2L 2ZUYA 1QAPA 4MJIB 3A3WA 4KESA 5DMLA 2VXQA 1LEGB 1BTCA 2KC0A 3L5IA 3KGUA 8A3HA 3G08A 3CXOA 2XH0A 4XK2A 4F9JA 3SB3A 4QRAA 5C6MA 4CUCA 3H42H 4GLEA 1QHPA 2EABA 2NY0C 3O8XD 1OFEA 1MQPA 3O6AA 4IMCA 1B4TA 3I7QA 1OARH 1UZGA 3WEOA 3K80A 2OXGB 3F7VA 3DJ9A 2JKWA 2YD4A 5AYZA 3UG5A 1K4HA 2JWYA 1M7JA 1Z69A 4XO7A 1TA3B 4H9ZA 3LCYA 1QZ1A 4OI8A 3WDJA 1OYAA 1E6OL 1UJTA 3FT3A 1BVNT 2DQCH 3EOOA 3QXUA 3T55A 3KMDA 4JDTL 3CFDB 1YMME 2NXYD 3V7PA 2X4TA 3BUBA 5KBMA 3MP5A 3NA8A 1FKWA 4F24A 4DNLA 4JAWA 4MZ8A 5AY7A 3H8AA 4WUUB 1RA0A 1U8LB 2AXWA 3RPKA 2IPFA 1EEZA 5JQ6H 2WWMD 2H3XC 1EXPA 3HBQA 2OMAA 4Q0XL 3CDGB 3TWBA 3FUKA 3W84A 2UWEE 3SDXF 3SCRA 2ZX6A 1GGBH 4UQ3A 4UB0L 4EP8C 5E1IA 2F19H 3BRFA 4HYRA 1KBJA 4PTVA 1AZCA 3U2SB 2VDNB 1SBSL 2KZBA 3N9KA 5L9FA 5E08L 1PJ9A 4AYBA 3W7IA 3BIKA 4ZAKB 5FOBB 4RRPG 4PJ7F 3TBVB 4AGOA 5J04A 5FUZH 3IGKA 2GT9A 2G5UA 3O4LE 2WCPA 1XRFA 1E6JL 1B2WH 3NIFE 4YDJB 2ISVA 1VKXB 5B3JE 2FSEB 3DOIA 4DIAA 3C12A 1NQKA 3B40A 1YCSA 2ARJA 1G6CA 3ECQA 3D05A 4A2RA 4ZAKC 3SRDA 2IAAC 4QTIL 5SWQA 2GSHA 4GEJA 1ONQB 4FQQA 7FABH 3BUQA 1UJPA 1IM9B 4KDVA 5C3LD 1RSFA 3VD9A 3S4SG 1HNYA 4HWNA 2CDFB 3WL0A 3SUSA 2PXYD 3NP4A 1CGSH 1XIMA 4FG6D 1O4UA 4G8GA 1A25A 4EN3B 1VFAB 1F2XK 1WT5C 3V0HA 4HXBL 3ZVVA 3JTSA 1J0ZA 2DGAA 1KLYA 4WTWA 5ISZB 4RNFA 3H4HA 1QOPA 2V9TA 1FDLL 3GPSA 4S0TD 5F6IB 3FYIB 2PNDA 2VUYA 3H9HA 3LSOA 3MV9D 4EXPX 1EZ2A 3WDHA 3KPNB 1SJHB 3MJ9H 2PCPB 5SWSD 4AJWA 4M1RA 1UWGH 5SX4I 3TBWA 4EN3C 3EO1B 2VLJD 2P8LA 1UH2A 2WCGA 3LNFA 1IVLA 1HEJC 3HTWA 2DQJL 4UU9A 3RKPA 1TEYA 3HMXL 5I1KL 4C58B 3KVPA 4B2DD 4PJDF 4KCTA 4XOCA 1V93A 3RYSA 5KW9L 3U9PL 5DUPH 4QHNB 2HWGA 3C52A 2YAHA 1GJUA 2RHEA 3SBRA 1TIWA 3BOLA 1MZYA 4GUQA 1YC7A 3MDWA 4PJXE 4B15A 4X7TA 1TTQA 2PGEA 4ORIA 1Q72H 4KW2A 3D3VB 3ZSSA 1EDGA 1GKEA 4NM8H 4Z7QE 4M6PA 2CO7A 2OJ1A 1KCZA 5C0BD 2OB3A 3FYYA 5E6ID 5IB1B 1R3QA 3ALGA 3T05A 4G1KA 1C3FA 4DBDA 2VRAA 5TGBA 4XBMA 4LCRA 2D2CC 1CDGA 4K7PH 3EKGA 1IBBA 1S5MA 1YEGH 1DBAL 2FNBA 3GUTB 1MNSA 3MROA 4AY8A 3HKFA 3TZVA 2ATKB 2XXCB 4XOEA 1SXNA 2ZONA 2CJ3A 5SWUA 1JZ8A 2XWTA 2R8WA 4LB3A 1PYWA 2DIJA 3E0GA 3OVRA 4LXFA 5AW4B 1XBXA 4I0KA 1MFUA 2BX5A 1E51A 4IJCA 1H3GA 3D1MC 3SDCD 2BCMA 5J11B 5EGRA 2QCHA 4M3HA 1A5FH 4WUKL 4PL1A 2OVLA 3V0TA 5DJ8B 4QRPE 4I5XA 1R3SA 1G7HB 1A4KA 5KVFL 4PG9B 2QDEA 3BSMA 1AKJA 4UBPC 3D9AH 4JLRA 5CC6A 2B59B 4E8DA 3O9WD 3MLSL 3VCNA 1ESWA 1X5XA 5TH2B 3UCRA 4HN8A 3GG1A 1HXYA 1IQ8A 4QE1A 4LMQI 5F2LA 2NNAA 5SX5K 1Q0XH 4J2PA 4O16A 1KKRA 4LLUB 1XXDC 1W3KA 3FTUA 3Q7JA 4GUPA 4Q6IB 3C0JA 4BI6A 2X2UA 5KETA 5J6GA 2W5PA 3TJLA 2ZSVA 1TPH1 1CFQB 3ISRA 3PZTA 1ZAIA 5DSCA 1YNTB 2YPLA 1Z9PA 2Z7WA 4CEXC 4IRSD 2LGNA 5ID1A 2OL3H 1LO2H 1AW1A 2UWEA 4YMZA 3U1QA 4BQ5A 3FU7B 3B5HA 3VXUB 2EYSA 5DMKA 4WGKA 2P10A 3C2VA 4K71B 3LD5A 1LUCA 2GFBB 4BDVB 1ZAGA 1H63A 2X6VA 3ZE1E 4ODXA 3MUAA 2NW2A 4D9PA 4BQ3A 1YAIA 4YAQA 1S2CA 3P3RA 1KGJA 3W11D 2WNGA 3RVWD 5FA5A 1RI8A 2R4RH 5FACA 2FJGA 1TPXB 4LNRB 4ERAA 4AMKH 4PJAE 1VCAA 3W2LA 1JWMA 1LMKA 2BMBA 3U6RB 4XPAH 4Q9RL 2DICA 5CC7A 1WLHA 3H0TB 4NZFA 5GS2D 1RXOB 4U1NA 3TC6A 5IMLA 1TTFA 2G3XA 3E80A 2XZZA 3T0ED 2WSKA 3H3PL 3AI0A 3JWNH 3DEQA 1TWZA 4L6OA 1OLZA 3JVGC 3UC2A 1OLLA 1INQA 3WLMA 2WNKA 1RUAH 3TV3L 1YPZB 1TPXC 3LGGA 2IAMD 4IG2A 3TKFA 2YAPA 4BFIB 4GG9A 2AJUH 3HGJA 2W80C 4FX8A 4NNPL 3BTNA 4C4KT 5IM51 3BV7A 4DP9X 3C6LD 2EIBA 5EZIL 3EYUL 2ZUNA 4OLYL 1ZAHA 3HS0C 2W4XA 4YFEA 3IGFA 1JI2A 1M1BA 1WC7B 2WUCL 3LEVL 2X4OA 3RB5A 3AZRA 5FSEC 1MHCA 4L8CA 1F61A 4QJ1A 3ZKSD 4DN4L 5A6JA 2UXVA 2KUTA 2RJGA 1QFEA 1JTOA 2GG1A 4P5SA 2XFWA 2VVSA 3UT0A 4M7JH 4AGQA 4F8OA 4PMVA 4BJHA 2FT7A 43C9A 2X89D 4JKPH 2WWOA 3OKOB 2YOCA 4HNUA 4ZTYA 1ES0B 3CK0L 4J8RB 3QSRA 3Q3GA 2NTFA 4HIIB 1KCBA 1EJSC 2Z0BA 2E6AA 4LSSH 1A6ZA 1HAWA 3L9BA 4ZDHB 2B4CL 4JCLA 1EFXB 2PXYA 5EUKB 5H37H 1UP3A 5DC0A 1ETJA 4RQQA 4IIQA 3AHTA 3DVIA 2Y6ZA 3TSDA 1DQQA 2WKLA 3KE0A 3QULA 4YDKH 5E1AB 2QJIA 3DPBB 3WLLA 1S8DA 4CN4A 1QI5A 5B21A 3D3FA 3E3QE 3LI1A 5T3XH 4Z7UF 3QEUA 2SEBA 2B81A 2OLHA 4A2MA 1MCJA 5EC2B 2WKOA 1Y0LA 3S9YA 3QISA 4JD4A 4DWSD 4F3FA 3QCUL 1VEOA 3I9GH 1NEZB 3YPIA 4PRIB 4NU7A 2P49B 1TJ0A 5CJNA 2EPMX 4APQA 4JEGB 4L1LA 1AS6A 4N85A 5KVEE 2BIMA 4HA1A 2WM0A 5E9DB 1NIAA 5HYFA 2Q20A 4LLAA 1EAOA 4Q6JA 4PLOB 3RFZB 3U6XA 3IMWA 1W8OA 1AMXA 4JFHE 2VWSA 3UGEA 1U8KB 3DI3B 3TXAA 3NQKA 2I7GA 5I5JA 1F9CA 3ITLA 3EJUA 5CO1A 2NUWA 2X4UA 1UZHA 3HPJB 3PPFA 3M8OH 3ZUNC 4X6EB 3T1FA 3QW9A 3SKUD 3GE7A 3W23A 1XIHA 1RU9L 3V8OA 3BYYA 4LL1A 5JYLA 3QDAA 2X70B 1HIMH 5JZ7D 3D4ZA 3IGAB 2JGQA 3RMJA 4B91A 4IHOB 3MFFA 3DDMA 4P2VA 3ULVD 3DYMA 1BPLB 1YNPA 3KWXA 4B92A 1FFOB 3VFPB 4GMSL 3WUWB 4DAFA 4GRWB 1EXGA 3B8DA 3BQVA 4MWAD 2VMJA 3I6TA 4CADA 4PRDA 3TC9A 1P5VA 3MUCA 3SDCA 5HGBB 3EH3B 3TW9A 5B1AB 5CCJA 3H9ZA 5D7IB 1UZ6F 4P3DA 3MPCA 2ZCLL 1YEDB 3VVWA 5HYJB 2VCBA 1NEYA 4LLWA 4Z3TA 3EADA 2ESVA 1GAFL 4N2YA 1FORL 3RVUD 3AM8A 3GSRB 1ZSXA 1MY5A 1NAKL 3ANYA 1FG9C 2DJSA 4F7PB 5DJ0B 4IRZL 2GCYA 3E5BA 3O3DB 1WAWA 4Z7WE 5E8PB 4LSVH 4LVOB 5DEFA 1EQCA 1T22B 5BW7A 4DK5A 4L37B 3MJWA 2E75C 2ZNWA 4M6QA 3ASOB 4CCEA 5SWZB 1T5KA 2BGQA 4Z95H 3LZ5A 2VZUA 3OVQA 4FZEL 3ML8A 1GGCL 5KUMA 5C0CD 4RWYH 1KELL 2VEFA 2AJVL 3ROLB 2VLRE 2OEMA 3P2DA 3WD5H 4QDWA 1GHRA 1L4IA 2ZYHA 1JFQH 2OMTB 4LBAA 5D96C 4WX2A 2A6NA 3UBGA 3VCLA 3RX5A 3MV8B 4WU7B 4V2BA 1XG3A 3R7MA 4HC1H 1P7QA 5CU5A 4QXGH 4LVOC 4KKNA 3QNXA 1H8LA 1K6AA 1EKOA 1V3LA 2WYZA 3DJRA 4R4BA 4U1LB 2NSQA 4KI5D 4BEQA 3F85A 2UV3A 1H6TA 1HL8A 5B1JC 2YARA 2X88A 2XVLA 1TPFA 5L8JB 1PAZA 3FO2A 3V79C 2HMCA 3ARGA 5D7LD 4FQIL 5E8DH 5AAMA 3K6SA 2YEVB 1R3WA 2UYLB 1A4AA 2A3TA 7XIMA 4XWUA 4NUJB 1MEXL 2B31A 3P80A 1KFLA 3P0XA 5F6HJ 2DEXX 2XINA 3VRIA 2IG2L 1HX0A 3WSUA 3OC8A 3T0EA 5JOEA 3DETD 1R6VA 3W74A 1HCVA 2AXGB 5HHMB 2PZ0A 4DAGH 2GSIB 5K9DA 1W31A 3ES7A 1Z48A 5REQA 3N0PB 5AZUA 3ABOA 3NYDA 2VXSL 1KXQE 3HZMA 4CNTA 2ADIA 4JY6A 3GSQB 4B3EA 1ZT4A 4XZ4A 4ANXA 1DEEB 2J6EH 1AC6A 2PP3A 3PDOB 3SCTA 1AIFB 3U0TB 2QXWA 3A6OA 4JFDA 2FIRT 4HV8A 2Z1VA 1RZPA 4K55A 5FECA 1D2KA 4LEXL 1GT8A 4GY1A 1NZRA 2IWFA 2QT3A 1DTNA 4GZEA 4ZSTA 4L64A 1I6NA 3NCMA 3JV5A 2ZPKL 1N64L 4J3OF 2A7RA 2CKBB 4Y2WA 3QGAC 4L9ZA 4H2HA 2CIKA 5FLUA 5FYLH 1F76A 2V30A 2BFVH 4O13A 3G08B 2PGWA 5GSRA 2CDEA 3SCMB 3VB8A 2UBPC 1T7ZA 3Q13A 3A4FA 4PUKA 4E36A 2BP8A 2C3VA 3DARA 2F5BH 1WKEA 2DLFL 4DVOA 1TPEA 1XF4A 3F7VB 3NXFA 1L9PA 2QHAA 3B3DA 1UIPA 3A4WA 1NUNB 3T8VA 4FLHA 2VEMA 1ZE3C 3IU4H 5I1LA 4D6DA 5FYKL 1AY1L 4R3SA 5I1AA 2A9ML 4PULA 1FWWA 1OW0A 4ZFQA 3WIIH 1IWPA 2H6OA 3PANA 1RY8A 1GPWA 1GY1A 1CL7H 2X1PA 3QV7A 3FT3B 1KQZA 3TPUA 3KPSE 1QR7A 2K9FB 4FJZA 5A16A 2X4TB 3NJHA 3QHFL 1AOHA 3OPSA 1O9ZA 4MA8H 3OA5A 3NCYS 4A6YL 2UZYA 2A3AA 4DWSA 1EJ6A 3BIAX 1WHOA 1CXFA 4BELD 3DIVA 3EJTA 1FHVA 1E6RA 2ZE3A 2ZUVA 1C5DB 1TU2B 5T26A 2BIHA 2FGWH 4FQLL 7PAZA 4TVPD 5HNNA 3GBNL 4PRHE 1ZLWK 2FBJL 2ZT9C 2X09A 2GY7B 1EJVC 2BBFA 3QUXA 4UQ3B 3QUMA 8XIMA 3WY4A 3GDKA 2NX9A 3TYFA 3LCFA 1IZKA 4CQ8A 1IGYA 2QYGA 4Y1SA 5DJ6A 2UZXA 3PU7A 5A2LH 4OTXH 4YXGA 3U4BH 2I9LA 1G7VA 1IFHH 3GWJA 4HGMA 1J12A 2PDBA 2HV5A 3UR7A 4OV4A 2GT9B 1Z1WA 2DI9A 1F73A 3VXNA 1MFCL 4CN1A 2B0SL 3S3SA 5FX3A 4CD4A 5A69A 2O7QA 3U7AA 1XH1A 2J78A 4N8CH 4F0SA 3IDNB 1E9PA 1OG0A 1NU5A 1BFVH 3NZRA 1ZCOA 2ARJB 4Z7WA 3UZQA 2DL9A 3LS4H 3K13A 5SWQB 1FWEC 2W9DH 3FMGH 4FZ8H 3WQWA 2VLLB 1GVOA 1GOHA 3VXUE 5JMOC 4WFEE 2P0OA 1AQMA 4Q4EA 2Z6IA 1GZ1A 2VLRA 4Z0SA 4MWAA 4B7LA 2PDPA 4Q9QH 4G8GB 3GU1A 1G7IA 1JZDC 5LGHH 4YVUA 1C5BH 3JTSB 3O2WH 2P50A 4OM1L 3SGDH 1ADOA 2JELH 5D7SH 1ZGDA 1P1ZB 5GS3A 2BOCA 2ZYIA 1MNUH 3WFEL 4O11A 5I8OH 2D7TL 2QQLH 2N0KA 1QWGA 4HHGA 3BZEB 3H9HB 1S2AA 3BW4A 1H0GA 2ZZ2A 5D5ME 4OM0L 5LXVA 4JQAA 4LUIA 2V37A 1H0DA 3TBWB 1B4JL 4Q2ZB 2P8LB 2BO0A 3BT0A 1BVWA 4J28A 3BC9A 2H5UA 3UO8B 3GMLA 2E59A 2WQAA 4FNSA 1YPZE 3CIVA 4N68A 3T8XB 4K7VA 4GFTB 6PTDA 4N25A 5FHBL 3TGXA 4JM2A 2F58L 3Q44A 4HUVA 2IQ9L 1VR6A 3HC4H 2IPTH 4BQ9A 4P5MA 4E5XA 1DXFA 3S4TA 3B0PA 4JZ5A 3RN6A 5AC4A 1MMFA 1QNQA 2C0HA 1IIHA 2OMWA 1YYMH 1HO4A 1XEDA 1N4XH 2XY2A 1KXQA 2NY3C 4X7TB 4OKDA 3QIBB 2CO7B 1O60A 2BV9A 1RUKL 3BH9A 1LDSA 1XVSA 3KM8A 3H2MA 3COOA 1E28A 3W7HA 4JPSA 3W9DA 4CNPA 5B7YA 4AYGA 2D31B 2ITEA 3SZ6A 3Q43A 3I68A 4M0XA 1KTNA 2VQTA 5D02A 1CFBA 3TN5A 2FEEI 4NRSA 5L6YL 5D7LA 5TGBB 5D09A 5I9QC 1FP9A 5E51A 3ME3A 1NJ9A 1A9EA 4GIRA 2O92A 2YBUA 5C71A 3IUDA 3M07A 4RE3A 3MROB 7PTDA 4YHEA 2NNCA 1VZWA 3QDMD 1E0WA 3DN5A 3OYXA 2NCEA 2F84A 4DGIH 3P0WA 2XWTB 1PYWB 3ZHNA 4UTWA 1LE9B 5HI4C 4IXHA 3APGA 4UCGA 3OKEA 4PUNA 3EGSA 1V7MH 1WBZA 2J88L 4E9TA 2PWDA 4LVEA 4L65A 2Y8VA 2BS8A 3EG9A 1L6XA 4YR6A 5E2VL 4HNOA 3QEGH 1TITA 4XVOA 3TZVC 1A4KB 3II1A 5G1MA 1AKJB 4CGUB 4JLRB 3W88A 5AC5A 1ZGLB 3RKDD 5E5RB 1TREA 3CN2A 4IGBD 1T5AA 3CXFA 2QELA 3GQFA 3PWVA 1JHLL 1HXYB 4JJ5A 3BFQG 1TQTA 4PWFA 1QTYT 2OAAA 1WWWX 3BRDA 1HJSA 2OTWA 3B7TA 4P7LA 1K3IA 2ACQA 1B4EA 2VURA 5ABAA 2X30A 1M05A 1T2XA 2VM8A 4ALDA 2QVIA 4US5A 1X5IA 5IY5B 1KJ2H 1RIVH 2BH0A 5J6GB 2ZSVB 2DQIH 3CAKA 4QKXB 3O6DA 1A7OH 5ABFA 4GMTL 5DSCB 4L4MA 2YPLB 3V0SA 2UWEB 4PRHA 3UP6A 4HTYA 3MRNA 2DD8L 5I24A 4LRTA 1SOSA 2VDRB 2LLEA 3BSZL 3FTVA 4KJWD 4EUPG 2VSDA 4XVUC 3ZL4H 5CNHA 4M7KH 3DECA 2NW2B 2AK4E 4FNUA 2IBBA 5EORH 1OD7A 2DYRB 5FF7A 3BKYL 4YYCA 1VCFA 5D7KD 3S0PA 1RQHA 4NCC2 5BU6A 2CBIA 2FJGB 3A21A 4PRNA 2R1KA 4NUMA 1IBDA 3FUIA 3O2DH 3NIFB 1PVHA 3ESVF 4OW6A 3MJ7A 1IEAA 1W6LA 1NANI 1IGTA 4X9YA 4U1NB 4GRWE 3BT2H 2BSCA 3NA9H 1VRXA 3VC6A 5IMLB 5AVVB 4L3CA 1LOQA 2JIXB 3KVMA 1UA7A 3L3DA 4L5FH 3H2NA 3PUCA 3A47A 4PD4K 1R7OA 3QQ0A 3V1PA 4MQSB 3WNKA 3LK6A 2FD6H 3NQFA 1SMAA 1HQRA 3NJNA 2P76A 1QOXA 2Y5QA 2XQYG 5JIMA 3IFNL 4F2TA 2WHMA 3ITOA 3G5ZA 4DBSA 3CZGA 1Q6RA 5GS0H 5DD6A 4YE4L 3KR3L 5C7VA 4UC5A 4HJJL 3JVGA 2VR2A 1V7NH 3KPMA 4HK7A 1IQDA 2X4OB 1GYUA 4HZ1A 1D7BA 4IPJA 3CJPA 4XZNX 2DZTA 3SODB 4I1NB 5CH9A 4L4TD 5BO0D 2YRZA 2AEIT 4OZFG 5IJCC 3W27A 1FH2A 4P49A 4R33A 1TKWA 1S7TA 5SWZE 5AZEH 2L4OA 1E4XH 3SW6A 1J8VA 2G3MA 3DENA 1JF5A 4FHKA 1MG2C 5I77A 4HKZB 1NMAL 1Y5XA 1HC1A 4M7SA 2G37A 1XGTA 3LERA 4G43B 3U82B 3MV8E 5EBGA 3Q3GB 3MSYA 2I5YH 1N3NB 4HD5A 1AH4A 1UEYA 3BP4A 5EOTB 4H88H 3FUMA 3EH4B 5LJYH 3RK8A 3UERA 2BGNE 3K8MA 5JHMA 4H7CA 4XZWA 4RQQB 2FATL 3BN3B 4D8LA 4IIQB 4IMFA 4XWGH 1DQQB 3K1KC 4EIGB 1LL1A 2HLEB 3QULB 5IUSA 1KBGH 4NUGH 4Z7QB 3TSMA 4C7FA 4QNPF 3IJEB 3BAEH 3GDBA 4MY8A 3OF6A 3QEUB 4LAKA 2SEBB 1HL2A 5JW4Q 5F9DC 4MKMA 5AEAA 2PXYC 4EXAA 5CWSA 4R34A 3U2EA 4ERSL 1RD5A 3VIIA 3OJDA 1N5YH 4IIQC 1BQHG 3HFMH 3THML 3ES6B 3NIGF 2BJML 4F3FB 4LSUH 1E73M 4AMXA 3UMTA 3RG6A 1BYDA 4XO6A 4S1DC 4XX1E 1BZQK 5FW7A 1DQLL 5CP3H 1IGSA 1K5WA 3QZWG 4APQB 4XN5A 1W72L 3HC3L 5I1GL 1CI1A 1WCBA 4OD3H 1MQKL 1PKMA 1DN2A 4PJ9B 2PABA 1B4KA 2D2HA 1NCBL 4FXLA 2ZC1A 3MV11 3B8UA 1O0VA 1B3WA 2CR0A 1ZLDA 4BHUI 3DHPA 2V4LA 3NL5A 4APQC 2X4UB 1EO5A 2H9GA 5TE7H 2P8BA 2PWHA 3K3QA 1AGDB 3WLJA 4POCA 4K8RC 5HPOA 1U3ZA 3FOMA 4GI6A 2YD1A 2HCZX 3SFWA 2NSMA 3AACA 1MH5A 2VN5A 3ARBD 2AJYL 2YCLA 4J1UB 4BINA 3P30L 1X1NA 1NVMA 5FO7A 3MFFB 5MEQA 2J5WA 3R6IA 3OGCA 4FI6A 4G70B 3NK4A 4JANA 3VXOA 4DO5A 2O6FA 1F11A 1UXWA 3K0YA 3W1PA 5HNUA 25C8L 1H9DA 3OKLA 3N12A 4EPSA 1VGAA 4CADB 5CEWA 1U2YA 3U4EA 4DO7A 1S7XB 1P5VB 4FABL 2CJUH 4W86A 3C09B 4E9VA 3GDTA 1W1TA 2OQYA 3H4FA 1L9TA 3G1AA 4BZ2L 7TAAA 2Y36H 4C4UA 1KJ3H 4P3DB 1BOYA 5DY2A 3FO0L 4D7PA 2ARWA 1M7UA 2QUUA 3ZW3A 1Y6KR 3EMCA 4M8VA 1QA9A 4HUNB 1Q8MA 2ESVB 1P5UA 4R90H 5B7EA 4FQ1H 2TSYA 1HF6A 4D1JA 3RCNA 5DURB 3W1RA 3SDCC 4XVJH 2GCYB 5AHEA 5JIWA 1W5OA 4PY7A 2J7LA 4K23L 4Z2KA 4P61A 3LPGA 1EGMA 3QB7C 4CD6A 1G1OA 2A7BA 5DXYA 3LCLA 3W3OA 3PJSB 1HKJA 2X1OA 2Z26A 3MYZA 5BPPA 3ZIMA 3L5LA 4ETYA 3NDOA 4NP7A 3AM8C 2Y1VA 3EYQC 3P4OB 4OGAD 1BEXA 2GJ6E 4KMTH 3VCLB 2NWSA 4NX5A 3CHPA 2HTMA 1SGJA 1EZVY 3UPAA 5DYOA 1P7QB 1G7PB 2X2HA 4DZHA 3GHBH 3BPWA 4OCWL 3QNXB 4FHJA 5ABZA 5BW7C 4D8AA 1E6NA 2X28A 4R4BB 2QF7A 4RSVA 1MWAH 2X1IA 3GF8A 1GS8A 1QEXA 3S3CB 3ARGB 1FBIL 1B9BA 3LHPL 1NWPA 4R4FH 3UF9A 1NDWA 4G6CA 4ES9A 4P99A 2XCMC 1Z44A 4WY0F 4GXUM 1OK8A 4KY2A 2KAUC 3CV7A 3HKZA 3N15A 1K3ZA 2KDGA 1GRWA 3F12B 3VRIB 3LV5A 1IAOA 1WIOA 3EF7A 2X1XR 1R0AH 4CKVX 4G8GE 1DYSA 1VFUA 4PCTA 3VDCA 3RVWC 1YJDL 2QFRA 5C0AA 3SPVA 1W16A 3VI3A 4QHUA 5REQB 4MZ1A 5AAMC 5EBAA 3HZMB 2ADIB 3ELAT 3DIPA 3NRPA 2NQ5A 4JY6B 3BE1H 1ZT4B 3TA6A 3LKPA 4CGTA 3SGUA 2R15A 1DJHA 1IGIL 2X6UA 3T4AA 1NCUA 2V63A 3BEVB 3T0EC 3SDYL 5D03A 3OB0H 4Q9CA 2YD3A 3A13A 3WHE1 3X17A 1B3YA 4JFDB 4C6PA 3A67L 1B3JA 3P4NA 4W5ZA 2R1PA 1TR9A 2QGEA 2WQDA 4HNVA 1ZS2A 2NZIA 3DUSB 4GINA 5AFDA 2IEPA 5MEOA 1SFHA 3QG6A 2V2TB 3MRBB 2ZDSA 4V2XA 1N18A 5GSRB 3OYZA 2PPEA 5TPWL 1NL0H 2BIIA 3NJLA 4AEEA 2EDTA 3R79A 2Y07H 2C3VB 1JCTA 3R94A 3L9RA 1XF5A 4UILH 4WJKB 2QCMA 2JK5A 2OMVA 2XGIA 1AHMA 3V4VH 4FFZA 1XF4B 5EIQA 5IV2B 1JAEA 3BAXA 5I1EH 4N0RA 2BM3A 4MQXD 4XTRD 5HTSA 2ODHA 2WVSA 3S1UA 1S5IH 5I1LB 4IGSA 2JKAA 3ROOB 3WO8A 4R3SB 5I1AB 3L0KA 3ZT7A 1IBZA 4DGVL 2QR0A 4YHOL 1NMBH 2X2IA 3DXIA 2NY0B 4JS7A 3S7GA 2B7QA 3FRUA 3TPUB 3ABSA 2KZKA 5T3ZH 1EBHA 4G42A 3IJIA 5D37A 3AADB 3KDPB 1W15A 3RVVD 1WKYA 1IC7H 3TFCA 4ZQMA 4OZIA 2C5DC 1OW0C 4JDEA 1TV4A 2GDQA 1SUXA 4KY1L 2W79A 3PPCA 5CKAA 1GOFA 1H15B 4LK4A 1OFDA 4Q8QA 5EH1A 5AECA 3OGOE 3NEOA 5C0ND 4GAJH 4TR9A 4LSPL 3SOBL 5KANI 2BY3A 4G72B 3TYFB 4DWSC 5DJ6B 4HKJA 3EX1A 3NM1A 2UZXB 3EJZD 3BOXA 4CVWA 4YXLL 1JZ2A 5DX7A 2I9LB 1IE5A 4XTDA 3N2JA 1TZHA 2Y3NA 2QVHA 2OULB 3VXNB 2ED9A 2PGFA 2H0FA 3TX4A 3LMZA 2CO1A 4FFZL 2XKNA 2PUZA 5LDSA 1QSEA 4POZD 3QUXC 3M46A 4JNYA 3CVCA 3BQUA 4LPUA 4UM9B 4KXBA 3PWPD 5BW6A 3V0IA 3NIFF 1EMTH 1NFAA 4PJ8D 1BPVA 4UT9A 2DWEA 5BXPA 1E9PB 1GHSA 1V7YA 3CZNA 4Z7WB 1TQWA 2VH5H 2VSKB 4WY7L 3UZQB 2HVNA 3AXKA 1OIOA 1JGDB 3BKMH 3FUHA 1GOIA 2F9BT 2LU7A 2YPLE 3L4VA 2CC0A 1DVFA 3INUH 1YXDA 4TMBA 2CKBL 4ES4A 4RDQF 2VXQL 2VLRB 5DK3A 3PF2A 3R0UA 2GJ6A 3KPQB 3IJ6A 4UZSA 4NF7A 4D2JA 3DI0A 3RU8X 4ZW5A 3S0CA 2FT8A 1CICD 2WWKO 4YBLB 2BOCB 2PMQA 4XNZC 3DGCR 1FWTA 1LRTA 4E41A 5IBLD 1O7VA 4NFBA 4WI5A 4AL8C 4GUIA 4A6GA 1E6QM 1VGKA 5D71L 4IRJD 3GQYA 3S3PA 3TCSA 3RZCA 1OF2A 1DBJH 4MWAC 1AJ7L 3IJYA 3PNUA 4M5ZH 1UCBL 2WC4A 3AMGA 1T40A 3QWOA 4YBLC 4XUGA 2YRPA 4BCZA 5CN2A 1MQQA 4IT1A 4JM2B 4D9LH 1OQXA 3CHXA 1FYTD 4K73A 1WDDA 3TMLA 4LSQL 4QJ5B 4OGQC 2NZ9D 1OANA 1WA3A 4P5MB 4E5XB 5CKGA 4G83A 1MSPA 5BUAA 4ANWA 1EEYA 3QDJA 4XMZA 1BXBA 2OMWB 3FFDA 4DEUA 1FC2D 2FIQA 1LD9B 1Q6GA 4H7ZA 3ARVA 4PJXF 2OR7A 4PS4H 4RFOL 4MXVE 3P3YA 2G3JA 1H3PL 2WNZA 4WK2B 4F8TA 4Z7QF 3X13A 4AITA 3GDRA 4N1EA 4JM2C 2HG0A 4OT1H 1E28B 1BXNA 3W9DB 3GYCA 1P4IH 2X4NA 1HJCA 3KPRD 1LQSR 5LQBH 4H4NA 1KPRA 1T83A 4KMLB 4KO6A 1LO3L 1OF0A 2D8KA 4FQCH 1NJ9B 1N2RA 2W8CA 3X3FL 3HIZA 5CJQL 1B54A 1A9EB 3UBXA 1LO4H 4DPRA 2A3EA 4DP2X 3GO2A 1I7RB 1XGQA 4X8GA 3QXDA 2CO3A 1YHPA 2JI2A 2SODB 4KI5C 2Y89A 4FEZA 4RAVA 3OKEB 1TFVA 4V33A 3EGSB 1LLOA 1AHWA 4HBQA 4WHYG 4Z76A 3LCIA 3W38A 2PODA 2AQNA 1KRMA 2GVYA 3T8MA 3MVTA 1L3NA 3UIZA 2P43B 3KW7A 4QGYA 5A7BA 1QWKA 1JHKH 4Q74A 1P6AB 3WUEA 2JI3A 1IAIM 5CLYA 4UTWC 1FVDA 3DETC 3RU8L 1PDZA 4K1WA 1A5SA 4OJCA 4H9MA 2VLJE 1DO6A 3PWVB 1UOLA 4IP7A 4JJ5B 5CZJA 1CU4H 1IC4H 4P46A 4MKSA 4NKDA 4XP1H 3QOMA 3KPSB 1RBOB 4NN5B 1PYFA 1XC4A 4HWUA 4MJHA 5C7XL 1RULL 4EACA 3IDUA 4U4IA 1R30A 4F57L 3CVDA 3OZOA 1GCFA 4KU1A 2ZSWA 4XP6H 3N4EA 2VGFA 2I56A 4XD6A 4PTTA 4AKOA 1BAFL 2HKFH 3UJFA 4CVZA 1EP1A 5G2HA 4XVTH 2JNZA 3LHUA 2Y1HA 1V0LA 3KS0J 4NN5C 1HHIA 3REQA 3FSUA 2VDKB 4PRHB 4HD9A 4CU7A 1V6VA 3P67A 2FB4H 4AUUA 1QACA 4UINL 1H50A 5JXEA 5HDRA 2W9LA 2HS6A 3EOAA 5HDQL 1CGWA 5CBBA 1E5ZA 4NASA 1MRAA 5JHLH 3ZE1F 2OSXA 2EHHA 3TQ0A 5I8CA 3NSYA 1EZVX 4HIEB 4PP1D 5GGTA 3UXDA 2Z4GA 1X38A 4XCNA 5DRXA 3E9TA 1RH8A 3C0LA 1PLAA 4PJAF 3ABKB 2RH9A 1ZD6A 3A5FA 3ZTJG 2P0IA 4M5SA 3MJ7B 3VUPA 1HOCA 2ZDRA 2PWVA 1IGTB 1BMGA 5K9CA 1S3RA 4XOBA 2EDXA 4AGMA 2EUVA 4L3CB 4B9PA 4GSUA 1WUEA 2CGYA 4IQJA 3L3DB 1UBPC 4NP4H 3NQ7A 3MCMA 4A22A 3NRQA 3O8XA 2H2PC 3CUIA 3EX3A 3C5QA 1N12A 1HQRB 2BGSA 5TTRA 2VKWA 2X40A 1OT1A 4EUPH 3A6CL 3G5ZB 3OPZL 3MZNA 5DD6B 2ESVE 2EDMA 2OR9H 4W9IC 4RMQA 3KPMB 5FR3A 3WXWL 4GSDL 2EACA 4GQ0A 1ZLSH 3NQ8A 4L80A 4I3RL 5GVJA 4AC1X 4YSCA 2A2QT 2VHLA 1W72B 4W9EC 3SQBA 1K6QL 1EDHA 4TV3A 2SFPA 4ETQB 1NGQH 3BGMB 4L0PB 1NAMH 4OZ4A 3HHRB 3ZDWA 4HNCA 5D5MB 4DZIA 4PJ8A 3HS0B 4ZS6C 1I3UA 3CIAA 2WKGA 3GJEA 4Q3MA 2AQTA 1OY3B 4I2XA 1KM0A 2QJGA 4Q97A 4JHWL 1YDOA 4F91B 3OVGA 3QAQA 4ZD3L 3S9DB 2GUUA 4J27A 4D6JA 1SN0A 4NQUA 3BP4B 3S6OA 1HHHB 1RZFL 4N90D 2CSPA 1E5NA 1S2VA 1FH5H 4I87A 3IDYC 3GFYA 5H8MA 2ZUMA 2OO6A 2VUOA 4BYHA 1KV7A 4A68A 1JPSL 2YJLA 3WLHA 4JTTA 1R47A 2ISWA 4AK1A 1H1ZA 1CICA 3MGTA 5LB1A 4OZFH 4MDPA 5F9OH 2X6CA 4KZDL 1TX0A 4DKAA 2FQGA 4I0CC 4NWUH 2VDRL 2FVKA 2NSOA 2R1LA 1VGEL 4PJBF 1UA3A 1GC1H 4M7LT 3EW3B 2E40A 5CWSB 1I8IA 3T0EE 2Y7LA 3FFCD 4C1KA 5DCDA 1E72M 2XVGA 3VINA 3ETBF 3P73A 2Z1WA 3LEYL 4N8PA 4XB3A 4RX4D 2DUXA 3U57A 4P3CH 4FRWA 2EADA 4X7SL 2RGSA 2Q0ZX 4AGLA 5H8DA 5CEZD 2X12A 1WCBB 3GM0A 1Z9LA 3MA7B 1WUFA 3B0VC 3L7FA 1AZ2A 1UWFA 2VXVL 1AZUA 4GP4B 3NQBA 3W57A 3S88L 4RGND 1LBLA 4JFDE 3KBPA 5CHNA 4KPHL 4OTKA 1AGFB 1V51A 1C8QA 4JTAA 1RP8A 4IBLT 1CD8A 4UT6H 2XY1A 1OALA 4F2UA 3MSPA 4ZSOA 4PRBA 1U4EA 4CC4A 4LYRA 3VI4E 1V6XA 2ZAIA 1P4BL 2H9GB 3MV9A 2DI8A 4FA8A 2PF0A 3SCWA 4F3HA 3EKLA 5IB2B 4B4HA 5FM5O 3H2FA 5SWSA 2H7WA 4DKFL 2VLJA 3FOMB 4GQBA 3UJJL 3SPGA 3NO1A 4P06A 1R38A 3VXTA 3IDMA 3M0MA 5GJTH 2YCLB 1W0MA 1NEPA 1JZEA 1A9BA 4B2DA 5FO7B 5MEQB 4JICA 1G9HA 1UQSA 4NYUA 5D2WA 4IH3A 3TF4A 1ZBCA 4Y5VA 3RU6A 1F11B 4JHVA 2MH4A 3OKLB 2FL5A 4QYOA 3RBSA 4R7WA 1SPDA 1UKQA 3DTXA 2PLTA 3UYPA 4ZBCA 5DK0A 1WA2X 3OLEA 5AKRA 3E6HA 3D0LA 3FOLB 3DO7A 4FYQA 2OA9A 1ESOA 3S8GB 1N9PA 1V6TA 3CFCH 3WIFA 1HYSD 2VVNA 2DUZA 5C0BA 1JGUH 4UIMB 5E6IA 2UWFA 3QS3A 2ZZ7A 3KYKL 1PD1A 2D22A 1QA9B 4D7BA 3IK4A 4Y7OC 4ZX5A 1P5UB 3AU1A 2AK4B 3US9A 2X0VA 3IRPX 4EMZA 1AZRA 1T04B 2BASA 1FZJB 4N2OA 4PY7B 5GZOD 4E2OA 1JXKA 5I26A 4LAMA 3TTOA 4N2KA 1XIJA 5CGQA 3MRCA 3VFGH 3UW6A 4YHKL 4PWIA 4YL9A 2AKRB 1IEVA 3PNWA 3QNFA 3WLBA 1P5UC 4PZVA 2CKRA 3NSMA 1BFSA 1G1CA 3W75A 3CZUB 1G01A 3UGRA 3F64A 1YJDC 1UUOA 1YQVH 2VN3A 3BQ6A 4KK9D 5HI3C 2HMIC 2EUZA 4DW2L 5IQOA 4DZ8A 2GYSA 1I9RH 1JULA 1VCBC 3TJHD 4PGZA 3O9WA 2IPUG 3RJYA 4DO4A 2VOMA 5TE4L 3E02A 4K8RL 3OAZK 4YHML 2V5MA 1KBLA 5D96B 4OQTA 2PDKA 5CLTA 4ODSL 1O75A 1QPOA 2H47C 5HJ3A 1XMEB 2JIEA 3K2UH 2NYYC 4HOXA 3ULVE 2FUTA 3APTA 5JUEH 2FX8H 3V55A 4P57A 1I8MA 3FB6A 3W6YA 4KJWC 1PZDA 4O58H 5G2WA 3BGFB 4BQ6A 1YEFL 1IAOB 4MWAE 2IH8A 3WMSA 4XZUA 3L17A 1KTKE 1QI4A 4ZFZB 4IRSA 4RMUA 3SPVB 5TQ0H 4QHUB 4OVVA 4HCIA 4AGPA 3BK0A 1A1OA 2WO5A 3QSTA 3MO4A 5GGRA 2R8SL 1YA5A 3IMRA 3LKPB 2I9UA 2Z4TA 3CU2A 3ZFHA 3BGFC 3D0VB 3BPOB 3OXRB 4XD5A 3CZFA 3LD8C 3TYUA 5E5MA 3KVLA 1SFSA 2V3GA 3PWLB 3TTEA 4DQOL 3VNMA 4LPVA 3HG5A 1DO5A 2QCDB 3P4NB 4M7LH 3MLUH 2O1AA 1FF5A 4AOFA 3NR0A 3RM8A 4KNSA 1BF8A 1NDMB 3AU2A 3FEQA 2YSSA 4YZWA 1RJCA 1TQSA 3DIDA 4ZMQA 2L0DA 5MEOB 1XRTA 4RW5A 2R2BA 4PS7A 2EZ0C 5H91A 4GW1A 5C0CE 3WDRA 3BPOC 3T4YB 1VC4A 3T4AC 1PZ1A 5T1KD 1CLOH 3CH1A 3ABRA 3MVSA 2RAGA 2AGTA 1OM3L 2IAMA 3DH7A 1J01A 1RZKC 3NPZB 3MOAH 4KKLC 2G30A 4PGCA 3L9RB 5HYSB 2JK5B 3N9GL 4UNTA 3EKCA 2XG5B 3BWAB 3C6LA 2XZQH 3UR5A 4KI5E 1TZGH 5DD1H 2YQ2A 1U95A 3T0VA 3FQUA 1W0WB 2JCCA 3BVTA 3B0YA 3HMWL 3WAKA 1JYNA 1JTPA 1UACL 5E2WL 5D7LE 2QR0B 4MXWL 4I4WA 1ZGLP 3STBA 3LMJH 1N8ZA 4XMPL 3ISYA 3HN5A 2DJXA 3FRUB 3VI4A 3W6MA 3MHGA 4UWQB 4G42B 1OVDA 2X2GA 2Y8KA 3UYRL 5F8RC 5BXTA 2YRLA 4GBDA 5CSZA 2NY7H 4PUWA 4Z3EA 4W8BA 2BOGX 5J57B 3X1EA 2X89A 2HRLA 2X1RA 4L1DA 4CD5A 1VP5A 4OZIB 1MHHA 2GAZA 3Q48A 1YEJH 1A4CA 1G5GA 4JDEB 2BSED 3ILQD 1N0LA 1KCXA 3QYMA 4KOBA 4OIFA 4HVXA 4B41A 4LFYA 2PN5A 4AY1A 1QR4A 3NZ8A 3SYCA 4NQVA 3S8FB 4E2DA 2O5YH 1MUWA 3DX8A 1LOSA 4I13B 4LJ3A 1XYAA 3CSFA 5CCHE 2FB2A 4HLZG 4HKJB 2PTUA 3CBWA 4UFLA 5TK2A 1RV8A 1JBJA 4ZXBD 1NOUA 1RZMA 1HJUA 2X1QA 1X6UA 5M3WA 3W1LA 5I16A 1J1XL 4TYUA 3TASA 1QNSA 4XPHL 4JPWL 3GJFH 2XKNB 3Q05A 1QSEB 5I3KA 5KTEL 4OFVA 2OX4A 3GDLA 5AW9B 2DWEB 4O2EA 5EHFA 4DLFA 3B56A 1EEZB 1I9JH 2D2OA 1FHGA 2A1WH 2CHOA 1YNTF 3NCXA 3FRPA 2EKGA 5GGQL 4RMVA 4P07A 4MZ2A 1VH7A 3QY6A 1DVFB 3L4CA 1M7PA 2R0LL 2JJSA 4ZSUA 3SECA 3BQUC 5HR7A 3IS0X 1WXZA 1VD6A 1S5NA 5IDIA 2Y72A 2GJ6B 2N3JA 1FAKT 2J55A 2ZUXA 3BIKB 1ILUA 1RMFL 4N6EA 1FGNL 5IGXH 3WQVA 3WFBH 4GUOA 1P69B 1KTDA 4ABWA 1QFWL 5FI8A 3N3MA 5KVEL 4C7DA 2VXTL 4MY9A 4N87A 3PGFL 4U10A 5ACLA 1DVFC 1VGKB 2FVLA 3CUHA 1WK0A 2QSVA 3I10A 3RZCB 2QGYA 4XCCL 2PSNA 3IJYB 5DHVA 5D5MF 3WLRA 1QTPA 1MCPL 4UTFA 4DELA 3GXFA 3FB7A 1XLLA 3QWOB 4FQQB 3VFNA 4TVPE 4YPJA 2X6BA 2V8ZA 1YPZF 5GZND 1D2OA 1E0UA 2BINA 3L2MA 4Z0JA 4OLZL 2XYLA 3B2DC 1R5YA 4XCFL 1QFWI 1UUNA 3RZCC 3Q8CA 3CFEA 1KN4L 4MA7L 1Z5LA 3KBHE 1K02A 4UQIM 3UVIA 1XI3A 4L2LA 5I0WA 4G7VL 3N9SA 2JMRA 4D94A 3D47A 4DERA 1HU8A 3MODL 4WQ6A 2XUWA 4LCVA 5HHVL 2Y61A 1SDAB 3P1VA 4GA8A 1FH9A 1NKGA 3X13B 3GSXA 3LSOB 1D6EA 1NOWA 4O50A 3QUML 4XI5D 3I02A 5A2BA 3WUGA 2VWTA 3TJEH 4TULH 1KPRB 1QR1A 4WOZA 2K9UA 2HZGA 1HILA 5FJOA 1ECZA 3P3TA 4AD0A 3LIUA 3Q2DA 2NY3B 4YJ5A 1AGBA 1A7PH 1N2RB 3N1AA 2DIEA 4UU9B 4TXEA 3FTYA 3UBXB 3F5KA 1Z2KA 3N3TA 4B96A 3FS9A 3DRQA 3R1GH 1XGQB 1TKKA 3HE6D 4IIDA 3QXDB 1G6RH 1TZ7A 3MN8A 5C0CA 3GAKA 3JWOC 1DDHA 1SXBA 4O9HL 1BQCA 1I9IL 1FHLA 4RAVB 5T1MA 1W3LA 3S96A 3SD5A 2X3CA 3FN0L 1T83C 5I9QB 4RNIA 1DBTA 4Z76B 4DTGL 1I2RA 1RBAA 4TTUA 1H49A 4H0IA 2PU1A 1ROCA 1BF6A 4AL8L 2HQAA 1MLBA 2JALA 3WD3A 4UNIA 2DLGA 1J05A 3H2AA 3GU2A 1H7NA 2D69A 3O6FD 1FVDB 4FULA 2YBTA 4GJJA 3EDDA 4ZQPA 4ABQA 1KJMA 1AHWC 4IHCA 4EPBC 3WK2A 3QJFA 3QQ3A 4UIKH 3VOFA 4P46B 4NKDB 4JPVL 4WXZA 5FJUA 1FWBC 3TZVB 4QF1A 5DD3L 1CE1L 4YXKH 3HIJA 4LBRA 4PMQA 4KQ4L 2VAAA 5F7KC 3CIQA 4CMMA 1Q7QA 5KTLA 1L0PA 5A7EA 4K2SA 1MCKA 2ZSWB 5T1KA 3DUHA 3GRWA 4JRFA 4WHYH 2KS0A 1DSWA 4PTTB 1HZHL 5JNYA 5ALCH 5KUKA 1A66A 2EKCA 7CGTA 4P46C 4X2RA 3FCBA 4A2GA 3REQB 4HX1A 1M9HA 1A7RH 4U3SA 1N0XL 1AI1H 4YL2A 3A22A 3Q2CA 1CIDA 3I50L 2A3CA 2WC3A 1FNHA 3PC0A 5CU9A 1V02A 2DW5A 3EOAB 1NFIA 3HI1A 7ENLA 2XA8H 3SPIA 3FBKA 5E2JA 5ABHA 4HA4A 4FB7A 2VLME 4JPGA 3MNDA 5I8CB 2NNAB 4O52A 2YRBA 2ZYRA 1KM3A 2DIKA 3GS0A 2BWGA 4HEPA 4DFHA 4XCNB 1EJ7L 4JBRA 3NMEA 3QDME 5E99L 4JO2H 3AXLA 4RIRA 4GUPB 2J1ZA 2DVXA 3W7PA 4U3CA 3V2AR 1VHNA 1W9UA 4UMCA 4UTKA 4AEIH 5JXEC 2JIWA 3MO7A 4GRWF 4ZW6A 1NBQA 1S7WA 4AUJA 3MA9L 1OSEA 3MLTA 3RAJL 3O8XB 4WTXA 1CBVL 5ID1B 2HXAA 1OSZA 5H8UA 3EYSL 1WO2A 3L5JA 5D7IF 2H2SC 4AQEA 4UF7C 2IBGA 2GSGA 4XIAA 1CECA 2EYSB 4F7MA 1QX1A 5DMKB 4PM1A 4F48A 1GOGA 1OCQA 1QWUA 2MEJB 1LUCB 2XSBA 5AHLA 3GXUB 2EDFA 3MV01 1VBUA 4ODXB 3WQ8A 4ELME 5HHXH 1B3IA 4YAQB 5HGAA 1ZHLA 2EH7H 3B7SA 2QAFA 4UFHA 2IGTA 1POJA 2NQLA 5A3ID 3DOPA 2J8UA 1E7UA 1JCXA 1Q0YL 3D50A 3O8XC 4QAMB 1JAKA 3DBNA 2NXYB 3NJKA 3PZUA 4TTGA 1JWMB 5C92A 4MJ5A 3SQBB 1GHFL 3LH9A 3O3AA 1OP5K 3WIAA 4YVVA 1Z66A 5D2NA 3AIWA 2VKZG 5T3XD 2HFTA 5BOFA 4OZ4B 5FF4A 5EU6D 1OCWL 5JHAA 2BY0A 3ARTA 3REVA 4C6MA 4NQCD 3GJEB 1OTUD 5D8WA 1NINA 4I2XB 4G5ZH 3MCYA 1INQB 4H20H 5HQMA 2E9BA 2CLHA 1QP1A 4DZBA 5KZ6A 2NXYC 3MRHA 4Q4SA 4IG2B 2ZCZA 4JTIA 1TF4A 2JFEX 2A3LA 3P4LA 2PP9A 4L0ZA 2B2XL 3ZK0A 4PJ8C 1AGEA 4IYKA 2XIIA 4ZTOH 2OMZA 3ETSA 2O0TA 2P26A 2WWMC 1MHCB 4L8CB 4GB9A 4H8PA 3GU9A 3HGRA 4HPOL 1RZ7H 4MB5A 4EI6A 1MNZA 3MGTB 1S3HA 2ZYSA 2YGNA 1JUKA 2VDKL 3CHFA 5EOQH 3VKKA 2WTRA 3NZ1A 4LLDA 3LGEA 1KGCD 4MY1A 1KCRH 3MBED 4PW9A 4M1DL 4MS6A 4LF3A 1I8IB 43C9B 1JNLH 3P73B 5DT5A 4MTVA 2RJMA 4HOZA 1W1B1 2NTFB 1GVIA 1CICC 3VI3E 5C0AE 5GRZA 2EXYD 1UD8A 3KVDD 4I88A 3ENLA 1A6ZB 4MYAA 4M43H 5GJPA 4AJVA 2A99A 2PXYB 1MRFL 3AXMA 2QZRA 2O5XH 1JGLH 3L7FB 2W07A 1VYPX 2ZA1A 4DJMA 5CHNB 1VKFA 4LSTH 2DYPD 3ZRSA 2B3RA 1L8NA 1S8DB 3RIAF 2VJXA 1QHZA 4TVPL 4L4TE 4PRBB 2J21A 4HH9A 2GQ3A 4NENA 5ELIA 3T2QA 1O12A 2XXMB 3VFWA 4GQZA 3MNWA 3GKFA 4DI9A 2NZ9C 1Y0LB 4ICCX 4FG6C 3MRDA 3MV7D 2VLJB 1R9FA 4WK0B 9XIAA 2J7GA 3IFPA 4LO9A 4W89A 3DYPA 4QIUA 1RAKA 3EO0A 1NH6A 5IWLA 3BAKA 4UV7H 1TPUA 3WQEA 1SJVA 3VXTB 1VLWA 4MTMA 3PBMA 1A9BB 4DUWA 3VNKA 3T0DA 2Q71A 1H6EA 2FTPA 5CR8A 4CC4C 5AOKA 4JPQA 3NFUA 3FTZA 2CBJA 4Y5VB 5DUJA 3ZN6A 3NSCA 4O19A 4QYOB 4FF9A 4XC3L 3B4UA 3DTXB 4GH1A 3UYPB 5IQMA 2IQTA 4PODA 3CK5A 1U5HA 3E6HB 2ZG3A 3IVKA 3D0LB 3ZE0B 3CZLA 1XIFA 3O6LL 3DO7B 4Z1YA 5AVUB 2QJDA 3KHQA 1L0XA 2DN7A 5JQIB 3D06A 2FO4A 3WIFB 4OZHA 1R8LA 3TWCH 4U1HA 2WO2B 5E6IB 4OKVA 2K70A 1YNYA 1A14H 3T1FB 2WMPA 4Y5VC 4AUBA 3O6FA 4NKIH 3QPXL 3AY4A 3AU1B 1INDL 1OBAA 4OZIE 4N0CD 1RJPA 4BM7A 2F53D 4YFLI 1IKOP 3WKNA 2D0HA 4J3VA 3L4TA 2RDUA 4J6RH 1J5CA 5DT1L 1A0EA 3SO5A 2WXFA 1IBHA 3QDMA 4LASH 3NJJA 5K2ZA 1GSMA 4R84A 3MRCB 5E6IC 2YPKA 3U6WA 3F62A 1FE8H 4JTDA 1D5IL 1XQLA 4HETA 2GJNA 3WTSA 3WLBB 1I1CA 3GSWA 4PRDB 5ITBH 5IESL 4J3UA 1B3OA 3SDCB 2ZQ0A 4UTAA 3QTGA 3VFUA 1AXIB 4K5NA 5J0BA 2KQMA 2I5IA 2Y7FA 2QMJA 1J5OL 3M44A 1ID5I 4X4ZA 4OCYL 1IWBA 4DZ8B 4Q14A 4LLWB 4YBHA 1EFZA 1QAWA 2VAJA 3O9WB 1QSEE 4JKWA 2WTOA 3A9IA 4ELMA 1A5BA 3UFYA 2ITDA 4IGBA 2OTUA 3UPBA 4IL0A 1LXMA 3BVVA 4R7DA 4PJGE 4TSCL 2IUZA 1R3HA 1XLAA 4K94H 3GZOA 5JUVA 4HKPA 3T40A 1C7SA 1HHKA 5DEFB 5HJ3B 4EXQA 2AQPA 3F4DA 3CLEL 4P57B 3W82A 3VX1A 4BFFA 1I8MB 2A4CA 3O9WC 2WZIA 1FO0A 4CCDA