3L2MA

X-ray crystallographic analysis of pig pancreatic alpha-amylase with alpha-cyclodextrin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGQDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title X-ray crystallographic analyses of pig pancreatic alpha-amylase with limit dextrin, oligosaccharide, and alpha-cyclodextrin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l2mA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l2mA01
4JL1A 3PBGA 2Y4SA 1E70M 3VIJA 1R85A 1KBKA 3OA5A 3DYPA 4ZE5A 4TVUA 7CGTA 2X09A 3W25A 4DWSA 3A24A 1CYGA 4J3VA 4P7QA 1TMQA 1C7SA 5A6SA 1JZ6A 2OWWA 1ECEA 2CIPA 2PBGA 3K46A 4TUFA 2WVSA 4HPGA 2CKSA 1WCGA 1I75A 3HMCA 1GPFA 2WK2A 3VO0A 4AMWA 2VURA 3VILA 2BHUA 2HVMA 4J27A 2VCCA 2WPGA 4J3SA 3U7VA 1JXKA 2EABA 8A3HA 3M46A 3N11A 3ZOAA 1GONA 1PIFA 1NP0A 3EMQA 1ISXA 3L2MA 5E9AA 1E6RA 2W67A 3ARPA 4PBGA 1E3XA 3PZTA 5A94A 3DECA 5AYIA 2JE8A 5BWFA 3WD1A 5GQBA 1ZJAA 3AIBA 2J7GA 1LG1A 2QV4A 3SCVA 3A23A 5DEZA 3RO8A 1HJXA 5AY7A 3MKKA 1CXFA 3RMEA 3G6LA 1TCMA 4QP0A 4QLKA 1Z32X 4F9DA 4Q7NA 3BAIA 2IXVA 2XN2A 4OJYA 4PTVA 1BG9A 2XFRA 4UQDA 3GZAA 1TVPA 3GBEA 2VNCA 1JFHA 2VC9A 4IM4A 1JL8A 3GXFA 2J62A 2JF6A 3MMDA 2X8RA 3RM9A 1Q6FA 2BS9A 2OW6A 4KMQA 4AZ5A 2F7OA 2Y8KA 5E1QA 6CGTA 3G6MA 3W29A 3LXBA 3K8LA 2YLAA 4RE3A 1BVZA 3CGTA 4NXSA 5A69A 1EIBA 5JBDA 4CCEA 1J18A 5A6MA 1XH1A 2XIIA 1GQKA 1E9LA 1MW1A 2WANA 3AIQA 1G01A 3WEOA 2DSZA 1UWTA 2WWCA 3CBWA 3WL1A 1EO5A 3A47A 4PTMA 4W85A 1BTCA 4TTGA 1ZBVA 2YA1A 2WKLA 1B90A 4M8UA 1W2VA 1GOQA 1V3HA 2ZXBA 5D4YA 2IGTA 3WNMA 4F9JA 1CZ1A 3WNOA 2DDXA 2EACA 2WW5A 4MDPA 2D0HA 1GNXA 1HJSA 1CECA 1OM0A 2E0PA 1UZ1A 3CZEA 4AZCA 4DO6A 2EQDA 4AZ7A 5D9NA 2DIEA 3GM8A 1XCXA 3FN9A 2YL9A 1OCQA 1VFOA 2G41A 1NARA 2EXOA 3ZJ7A 4JL2A 3WD2A 4AD2A 3VD7A 2VX5A 2A3BA 2J75A 4W8AA 1FHDA 1U2YA 1KTBA 1H2JA 3KE0A 1WZMA 3KL0A 1EOKA 2PBOA 1XV8A 3GXTA 1M53A 1XC6A 5A6JA 4C7FA 3KEHA 3PN8A 3KL5A 1PX8A 1H11A 1V0NA 2UY4A 2X0HA 4U31A 4UFMA 5JBFA 1UR4A 2ZIDA 1UH4A 3AXIA 4QCEA 4DWSD 2F7RA 3SCQA 4UOZA 2CBVA 3BVUA 2YL8A 3ARYA 3W6LA 3TTYA 2J7BA 3EDEA 3POCA 1MW0A 4TTUA 3CZJA 2EJ1A 2VUYA 1J0HA 1EHNA 2W63A 5CGTA 4PEEA 4QLJA 3AXXA 3VIMA 4U3AA 2Q8XA 4W7WA 1JDAA 2YKKA 1MFVA 5CPTA 3ARXA 5EBAA 2OSWA 1EDGA 3K4AA 1J0KA 4NRRA 1KQYA 4M1RA 3RPMA 1EGZA 1QNQA 3LPPA 3T2OA 2AMGA 1HT6A 4Z2LA 3L4UA 4NF7A 1E15A 3AOFA 3CZNA 3POHA 1UG6A 3W53A 1BSIA 4FNTA 3WUEA 5D8ZA 2WMIB 4JFUA 3APGA 5A8QA 1W9DM 4EANA 3BCDA 3BLBA 3VDHA 1OWQA 4D6JA 2GK1B 4CD8A 3QHOA 4OBRA 1CXLA 4QAWA 5I0DA 2W66A 3SUWA 3EYPA 4DO5A 3IANA 3S5YA 1QNRA 3VDBA 1V6WA 4HMDA 2X2JA 2D23A 4J7RA 2ZE0A 2XN0A 3CIVA 1IV8A 2CERA 3ARZA 2D0GA 4UFIA 2VQUA 5E0CA 4YHGA 4AMXA 1YQ2A 1X6NA 2J8GA 5D9OA 3T2QA 4D1IA 1LG2A 5I2UA 3MMUA 1UR2A 1OIMA 3WDPP 2W5FA 4YPJA 3MUY1 1E6PA 2EO7A 2ZUSA 2O9PA 5A6LA 1JGIA 2VRQA 1J0ZA 1N82A 1VENA 4GO9A 3O9NA 3U5YA 4GIAA 1ZBWA 3U57A 4B15A 3DDFA 4HA4A 1V6YA 1VEPA 4W7VA 1QPKA 1KBBA 2GJRA 3BUBA 2XVPA 2VTFA 5IFTA 4E8CA 1NH6A 5F7UA 4XZBA 4A3HA 1EHAA 5A8MA 1V3LA 4HPHA 1EH9A 5E09A 1CIUA 1UYQA 4GZEA 2F1AA 3ZJ8A 1HL8A 1CXHA 4AEEA 3VTRA 3PZMA 3FHQA 4B9YA 2VZVA 4YHEA 2DH2A 3HN3A 1KCKA 3WDIA 3A5VA 3D4ZA 3WQVA 4M56A 3DHPA 3WF1A 3GXPA 2DSVA 1QHOA 1J10A 3PZIA 3BLPX 4MDOA 2WM0A 1G9HA 4Z2GA 5FOOA 2JEQA 3WNPA 2E9LA 2CYGA 4Y7EA 4NXKA 3BAWA 1H0IA 3A3HA 1W2PA 3CHFA 3QHNA 4DM1A 1LWHA 3AZTA 5DMYA 2WXDM 3WELA 3CH9A 1ZB5A 1RD6A 3VOCA 4EAMA 1KB3A 2W61A 4OIFA 1VEOA 3N15A 3MV01 5FKYA 2A3EA 1HN1A 2C8NA 1XSJA 3IJ8A 2BHYA 2VX6A 3OZOA 1R7AA 4W8BA 3UETA 3BH4A 1B3WA 3CZ8A 1TVNA 2EPOA 2QPUA 3ARVA 3HG3A 2WVVB 7TAAA 3OGVA 5HPCA 4AZGA 4UFKA 3WDHA 1ITXA 3WNKA 1E1FA 2WMKA 1K9DA 4TOQA 1M03A 3AROA 5CSUA 5I5RA 4DM2A 2WMFA 3VGDA 4HTYA 4GI8A 5DO8A 2CEQA 4GQQA 3BVWA 4HZ6A 2VOTA 4XB3A 2PWGA 1EQCA 3EJUA 3W81A 3EJPA 3ARQA 4XUYA 1XH0A 4UFLA 3WUGA 2GUYA 4EK7A 2F1BA 4OOZA 3OZPA 3F5JA 4BS0A 1B0IA 3VNZA 4NX0A 2ZX9A 2D2OA 3VGFA 3SUVA 3H54A 4W84A 3CTTA 1CDGA 4CD5A 1Q6GA 1VBUA 3WIJA 3AIRA 3GTNA 1ISYA 4LXFA 2WCAA 2WMIA 1WZKA 2GK1A 2Z1KA 5DFAA 3GXNA 4CKQA 3W82A 4CN1A 3UG5A 1L8NA 4JHZA 5C71A 3MU7A 1C91A 1FH9A 1JZ4A 1Q6DA 4PMNA 3PZOA 2AOSA 3GXMA 1HX0A 1W1PA 2WHLA 2ZICA 1W9PA 1GOIA 3VM5A 2GSJA 1GOKA 5C70A 2AAAA 2WNWA 4WIWA 4JCMA 5ABEA 3WD4A 2PWDA 2J4GA 1XD0A 3RCNA 2WZHA 3NUKA 3CUHA 2W92A 5IHRA 1R33A 4ZENA 3VGEA 2YDQA 3OLIA 4FF5A 3T08A 3U7BA 3QR3A 1W1VA 1UZ4A 4CU7A 2VCBA 4BQ2A 4PTWA 2XFFA 4BQ5A 3ZT6A 2CNCA 1V6UA 2Y8VA 3BCFA 2X2HA 1M01A 2YFNA 3ZT5A 1BPLB 1JI1A 1W9XA 5EMYA 1B2YA 3WFLA 1UUQA 4M80A 1JZ5A 1E4IA 4UFHA 3T0AA 2PC8A 4EE9A 1ZBCA 3ALGA 1H49A 4Z2JA 1CLXA 1W3HA 2ZUTA 4X9YA 2XVGA 1TZ7A 3VMNA 1XHGA 3LX9A 4BCEA 3VD5A 3CUGA 3AYSA 2YA0A 3NSNA 3WD3A 3AS3A 3DX0A 2PB1A 4GKLA 1GQIA 2DT3A 3IK2A 3WQ5A 4W7UA 3N12A 1RP9A 1GW1A 4R27A 1O7DC 2JFEX 3CHDA 5CGMA 1JXJA 3FHAA 3RDKA 3SURA 2VQTA 4A4AA 3OIHA 3GXDA 4PMQA 4W93A 3WF2A 1DWFM 2E40A 5CXPA 1E4MM 1H1NA 1QNOA 4AIEA 1R7OA 3UERA 3WQ6A 2E4TA 1TA3B 3N04A 3ZJKA 1F4AA 1SMAA 2EBNA 5GNYA 4JHOA 4BQ3A 4W5ZA 3WUBA 4C7GA 4TX6A 3WDQA 1UD3A 3AQUA 3VSVA 1KXTA 3S5ZA 1MQQA 2WMJA 3GH5A 2O9OA 3WBAA 2QHAA 2XIBA 1QW9A 4P8XA 1I1WA 3TP4A 3VNYA 4U5IA 3HG2A 1FHLA 2J7HA 3BXWA 4BZYA 4RE4A 1RH9A 2XGBA 5CZKA 4AD3A 4ATLA 5A6BD 4R5EA 1XGZA 1NOWA 2VT0A 3CZLA 5HXMA 2BVTA 1HVQA 4J3UA 1K9FA 4LPCA 4PMXA 4M24A 1RPKA 1UWQA 3BMVA 5FD0A 4DUVA 4PCSA 1PS3A 2QLYA 2DH3A 3BAXA 4ACZA 1UR1A 2FH6A 1JZ8A 1UWSA 1UD6A 2WCGA 1JD7A 1CGUA 1WE5A 1AVAA 4ACYA 3VD9A 1KR1A 3W26A 3CPUA 3RJXA 3AFBA 1CENA 2PF0A 3AIWA 2XN1A 3AMDA 2XVKA 2WLZA 1AQHA 1C92A 1LL4A 4GI6A 4KRUA 1GVIA 3L4WA 5CLWA 2WBKA 4NRSA 2XFYA 4D1JA 4UQ9A 2WMHA 1GZJA 1WZAA 3MMWA 3D50A 3B9EA 3GNRA 1DTUA 4PMDA 2CBIA 3U5UA 1GORA 5JBEA 2E8ZA 5A6KA 3EJRA 4HZ7A 4XX6A 1EQPA 5HPOA 3CC1A 1CGVA 1LLOA 1R75A 2W91A 4GINA 2EPLX 1EO7A 3B8SA 3MANA 3AI0A 4FMVA 5ABFA 1W9BM 2GFTA 3O6AA 4GI9A 3VD3A 2V3FA 1KGUA 3BAJA 3RIKA 2EAEA 3ARTA 5EFFA 3DC0A 5LA2A 3MUAA 3GDBA 1RP8A 3SUTA 1ISVA 3VINA 2C7FA 2W4XA 3EBVA 2XPKA 3BC9A 2JIWA 4XV0A 4FLRA 9CGTA 1HP4A 5I78A 3AIVA 4Z2IA 3I3DA 4GQRA 2CKRA 3LPGA 2G3NA 1NWTA 3CHEA 3WMCA 1LL6A 1J0JA 1VFMA 4ATWA 1G0CA 1WNOA 5A8NA 4IPLA 1MYRA 3WF3A 1JZ3A 3MSGA 1JNEA 2CHNA 4PUDA 4BQ4A 2J78A 3OGRA 4OOUA 2V3EA 5FL1A 1DP0A 2WC4A 1GQJA 3TTOA 3AHYA 3CZGA 3J7HA 1E0VA 3MO4A 4YN5A 1JAEA 1V03A 4RE2A 2OSYA 1BFNA 2ZWZA 1PJ9A 1FFRA 1ZL1A 2V38A 1PEZA 3BAYA 1EDTA 1MXDA 2ZUMA 1GOWA 4MNMA 1OD0A 1UQYA 4CD7A 2G8ZA 3BUIA 1V08A 4CU8A 2WC7A 3AS2A 3F5LA 3L4VA 4WKHA 4BF7A 2J7EA 3WEMA 2CCRA 2XYLA 4CUCA 4W8LA 2NW0A 2HISA 1JAKA 5A2BA 3KZSA 5IDIA 3M6DA 3W28A 4P8VA 3BVVA 3WY2A 4H7VA 5I23A 4CD4A 3WMBA 1FP9A 4X0VA 4AYSA 2BXYA 1PPIA 3DX2A 3GNPA 1ODZA 2DT0A 4NZCA 2VVSA 1YHTA 3HG4A 1K9TA 2OYLA 2UY2A 1DWIM 1BYCA 3AISA 2EEXA 4OKDA 1KCLA 1B1YA 2O92A 1J11A 1J01A 5CQ1A 4B9ZA 1LL7A 1KQZA 1W3LA 1GVYA 2Y2WA 5E6ZA 4NI3A 4U2YA 1T0OA 4KH2A 1NWUA 1B3XA 1H3GA 1JYNA 3WQ8A 1WP6A 1AMYA 3AS0A 3RILA 1XSKA 1B3VA 2JEPA 3SCOA 3CMGA 3AYRA 3OB8A 3EDJA 4MADA 4V27A 4P7OA 2YLLA 2DSWA 3I3BA 5CSYA 3WENA 4FNUA 2G4FA 2NSXA 4AW7A 2WHMA 4K68A 4URIA 1CXIA 5GNZA 2ZXAA 2ZOXA 5I79A 1JG9A 4MPKA 3VIFA 1WB0A 1PBGA 1CGYA 3WY3A 1DHKA 2E9MA 5M17A 4AZBA 2DPEA 4AXNA 4H8UA 1VFFA 3WBEA 1JF6A 2DT2A 4JKMA 4LGXA 5AC4A 3HU7A 1G5AA 4KRTA 2OWCA 1LWJA 5KZ6A 7A3HA 3RM8A 4JFVA 2WSKA 1UASA 2CXGA 1PIGA 2YDSA 4ATDA 1R47A 1G94A 1BGAA 1OD8A 4FNRA 1TG7A 3VIGA 4W86A 1CBGA 3A4AA 1GCYA 5CPSA 3ZM8A 3VX1A 1BLIA 3AMLA 2F7QA 4MAZA 3DYOA 1V02E 3UCQA 1C8QA 1UOKA 3WY1A 1HIZA 1BYDA 2FE0A 1DWGM 1E1EA 1HNYA 3H53A 1E56A 3IJ9A 3UG3A 3SUSA 3ZSSA 2D0FA 2VRKA 4MB1A 4TXEA 1UWIA 2CBJA 3S6TA 4UQCA 1WDRA 3NDZA 5FIPA 1V6VA 2ALWA 5HNNA 3VVGA 1R34A 4JIEA 3GNOA 4N0RA 2WCSA 2ESCA 1WO2A 3QGVA 2DSKA 1OB0A 3OLGA 3B9DA 3UR8A 4OGZA 4B16A 4AWEA 1PZ3A 4H2CA 1PX3A 4D6IA 1HTYA 4OBSA 3TTSA 4H41A 2V5CA 4MTVA 2WVUA 3WH7A 5DT7A 2EADA 2YJQA 1J0YA 2RGLA 2FYVA 2WLYA 3RJYA 2G3JA 3AIUA 3UESA 1JZ7A 5ABGA 1GJWA 2EPKX 2IXUA 1V3MA 1P6WA 2UWFA 3D4YA 3PTQA 4V28A 1CXKA 4PSRA 2DGAA 4PMRA 3EJSA 4AZIA 1WPCA 4J28A 1SFSA 3CO4A 3AHZA 5BXTA 1QI3A 1JDDA 1V3IA 1ZU8A 1UKOA 2BNJA 3W24A 4PCTA 3BMWA 4DWSB 4AD4A 1KFWA 2WC3A 1LQ0A 2ZXDA 1GUVA 1VJSA 3NYDA 3WNNA 2VX7A 2BY1A 5A8OA 4PSPA 2VR4A 5I77A 4DO4A 3MUIA 3L4ZA 4KGJA 3WH6A 3BUPA 3AZSA 2DQXA 2J7CA 2CBUA 3OBAA 4AYGA 2VMFA 1EXPA 1B3YA 3A6OA 3DHUA 4P7RA 2OW7A 3HJEA 1QI0A 2V3DA 3ZJ6A 1ZBKA 1CGTA 1BHGA 3BVXA 2XGIA 2W62A 3PZUA 2NT0A 1HJVA 2J47A 1R87A 1CEOA 1UQZA 5LA0A 1MW3A 1CXEA 4AIOA 3VGBA 1NWRA 1V0LA 2C0HA 2ZUWA 3VX0A 1WAWA 3NSMA 5M03A 4MB4A 2J7DA 3ZQ9A 5E70A 5BCAA 2A3HA 4IPNB 2A3CA 3AZRA 4PMOA 2XTKA 1TQUA 2VZTA 1OGGA 8CGTA 2YDRA 4D6HA 2J8FA 4CCCA 4GZIA 2VCAA 1J0IA 1OT1A 3CUJA 4P7NA 1FH7A 4M29A 3CLWA 2JIEA 4QLLA 1HF6A 1VEMA 2JF7A 4QCFA 1HKMA 1OGSA 1M04A 3ZR6A 1SYTA 2EPNA 1XYZA 1XRVA 5HOSA 1TR1A 2WZIA 1UWUA 3LRKA 2F2HA 3GH4A 4A3YA 2D22A 2J77A 3HZ3A 2E9BA 2XM2A 4WSJA 1UD2A 1SMDA 3WDRA 3MV11 3VMPA 2YL5A 2J79A 3VGHA 2WHJA 1HJUA 3ARWA 3ALFA 2GJXB 2MANA 3W6MA 5LYRA 5I24A 5CPQA 4FLQA 2YBUA 3CUIA 1XSIA 2WWDA 1V0MA 1OSEA 2CESA 5A8PA 1R46A 3ARSA 3THCA 1K9EA 3M7SA 3EMZA 4MNJA 1E43A 1E6ZA 4H04A 3ARUA 3ZR5A 5D9PA 1E6XM 1DWAM 2GDVA 2FHFA 4D71A 1HP5A 5C8BB 2VZSA 1S46A 1TQVA 4M82A 2CPUA 1HL9A 4U33A 5D8WA 4GXPA 1C90A 4PMVA 2WB5A 3T2PA 3LRLA 3S2CA 3UR7A 5GPRA 1KXVA 3SCRA 4AZCB 3OLDA 4IISA 2YIHA 1ITCA 4UFJA 1CGXA 2XUCA 5BXPA 2FHCA 4LYRA 2GVYA 5E0FA 1UWRA 4KWUA 3VSUA 1DWHM 3IAQA 1UH3A 5I3DA 5A1AA 1MXGA 1QI5A 1C8XA 2QF8A 1E6NA 2VX4A 1D3CA 3FAXA 3M07A 3OLEA 1ZS2A 1H5VA 4WF7A 1NQ6A 4LQ1A 2XSBA 1BYAA 1VBRA 4WJXA 2FGZA 1MWOA 5BYWA 4XZWA 1E4LA 1W32A 5EB8A 4JFSA 3W27A 2ZX6A 2DT1A 4ZFMA 1UH2A 3WY4A 1VIWA 1O7AA 4B3LA 2WVVA 1M7XA 3GBDA 1C7TA 3E1F1 3BVTA 4D6FA 1V3JA 1QVBA 3BSHA 1AQ0A 4UZUA 4CN4A 2X2YA 5GNXA 3OGSA 3EDKA 3CV5A 3VSTA 1U33A 4LX4A 4NSBA 3SIMA 5A2CA 1W3JA 1E71M 5BXSA 1HWWA 3MUZ1 2X0YA 1MQPA 1QI4A 2V3GA 4WKAA 2J7FA 3PZVA 4OUEA 3RM4A 3PTKA 1IZKA 4E4PA 3SCSA 2BXZA 2WVTA 1BVNP 3D5HA 3II1A 1OINA 5A3HA 2GJPA 3PHAA 5HDRA 2BVYA 2D1ZA 1R8LA 2XVNA 3JUGA 3ZMRA 3OG2A 3DDGA 4PTXA 3SCTA 2XVLA 4UNIA 4HOWA 4LYQA 1J9YA 3T0BA 2D24A 1D7FA 4PUEA 1HXJA 1H4PA 1JD9A 2E8YA 3VKKA 5BROA 1B31A 1GHRA 1QHPA 3HG5A 5LA1A 1JNDA 2J74A 4D6EA 3PZGA 4PYSA 5A6AA 2WMGA 2X1IA 3VIKA 4MJ4A 3VPLA 3TONA 4FNSA 5CG0A 3NIYA 3D52A 4DWSC 4U3CA 1JDCA 3DX1A 5AYBA 4AMCA 1CGWA 1E6SM 1XYFA 1KXQA 2WBGA 3UG4A 1QNSA 4H8VA 4AD0A 1OIFA 1FA2A 3SUUA 4QDMA 2XWEA 1QOXA 3QOKA 3TV8A 2GJXA 4UCFA 3N13A 3WQ4A 1UKPA 3NCOA 1LF1A 2QMKA 3AMKA 2VRJA 3WF4A 3PZ9A 3ZT7A 1QBBA 1E40A 4PN2A 2XSAA 1UKSA 3VIHA 2Y5EA 4J3TA 1W9VA 1U30A 4DUXA 4J3XA 4PMYA 4AEFA 2BHZA 3DX4A 4U5KA 4C7DA 1NOUA 4MB3A 1JYVA 1FH8A 2TAAA 1JFXA 1US3A 3EDDA 2D20A 3BUQA 5CLTA 2O9TA 1JYXA 3A22A 4WLCA 4HMCA 1H09A 1VRXA 4IUGA 1KXHA 3FW6A 3T09A 1NP2A 2Z1SA 5D9MA 3VM7A 4JZ5A 4AY1A 3VIIA 4WKFA 1JZ2A 3ZIZA 1B3ZA 3BGAA 2GDUA 2PI6A 4S3KA 1UD5A 3NJ3A 1IZJA 5A95A 1FP8A 2G3IA 5EFDA 4LYPA 3QOMA 1UA3A 3FNDA 1V3KA 1E4NA 1W1YA 4X0NA 3DX3A 4H8HA 3A4WA 1GHSA 1TQSA 1EDQA 3WL0A 2QMJA 1TA3A 4JFWA 2BFGA 1NM9A 2D73A 1E3ZA 1ISZA 1V0KA 2J25A 3EJTA 5FCZA 1KTCA 2F7PA 6A3HA 4CVWA 3PZQA 1QI2A 4HA3A 1BF2A 3WF0A 5BRQA 2IUZA 3VU2A 2VZUA 2XJ7A 1UR9A 4HZ8A 1A47A 2ZUNA 2D3NA 1WDPA 3K8KA 4HMEA 4Z2KA 4HU8A 4UQBA 1HXKA 1SZNA 3BUDA 1W91A 4UR9A 1QWNA 4B3KA 1E5JA 4AIUA 3AXHA 1GQLA 1W9UA 3F5KA 5E6YA 4ML4A 1E72M 4ZXLA 2YFOA 3FY1A 1MVYA 4W5UA 3SCPA 3BLKA 2FGLA 1O6IA 4WSKA 3EDFA 5JIPA 3GYCA 3LXAA 1A3HA 1VFUA 4HU0A 6TAAA 4AISA 3ECQA 4Z2HA 3VDAA 3LRMA 5ABHA 3D51A 2V5DA 2WZEA 3WFZA 2WYSA 5IHSA 4ZEPA 4FK9A 3WQWA 1CNVA 4W89A 3AHVA 1CWYA 4W87A 3AIEA 3FXYA 2XM1A 2VR5A 3AHXA 3W38A 2FDMA 3W37A 1QW8A 1NOFA 2OYKA 1MW2A 5I6SA 3CZKA 3L4YA 3F4VA 3AS1A 1J12A 1E5NA 3K4DA 1DWJM 1NWSA 1HJQA 2Y24A 1B30A 3WN6A 4N42A 2CITA 3WH5A 1K6AA 4NZFA 1E73M 1DEDA 3GXIA 3VD4A 1BYBA 2YL6A 2O9RA 2OWXA 3MS8A 2X05A 1JYWA 2ZX7A 4FNQA 4M81A 1GOOA 1HKJA 4PRWA 5JIWA 1VF8A 1MQRA 5CJ5A 3N9KA 4HOZA 2BVDA 1WZLA 3VIPA 2WAGA 3N17A 4AZHA 1UR8A 1UHVA 1TFVA 1E6QM 3PTMA 3TOPA 5FL0A 4ZXOA 3GH7A 4CGTA 1KWGA 1I1XA 4EKJA 2FHBA 4UTFA 2ZUVA 3VIOA 3CMJA 3N18A 2F61A 4F66A 4UOQA 4J3WA 2ZXQA 1ESWA 1BGGA 4D6DA 4F8XA 3EJQA 3DYMA 4CN6A 1ZJBA 2DIJA 3AMGA 4P8UA 3IJ7A 1KR0A 3NSXA 3LXCA 3BSGA 1TQTA 4P8WA 5ECUA 3VGGA 4AC1X 2VZOA 2XG9A 4MB5A 1KGXA 1XCWA 2F18A 3W4RA 4AZ6A 3FAWA 4HA1A 4TX8A 4W88A 1XH2A 3CHCA 2YA2A 2WHKA 3QHMA 2EPMX 4CVUA 1XD1A 1OBAA 2BY0A 2G3MA 1QBAA 1IT0A 1VB9A 2ZX8A 1JF5A 1E0WA 3H55A 1CLVA 3AMCA 2ZWYA 2XHYA 1F4HA 1HVXA 3L4XA 5TD4A 2OYMA 3CZSA 2WKGA 4OZOA 1QWUA 2B31A 1PAMA 2CETA 1PX4A 1OGBA 4D6CA 2OLHA 4BA0A 4S3JA 4GPNA 1X6LA 2F8QA 4UZSA 1Q6CA 5AC5A 3IGUA 3ZSTA 3LPOA 5HBFA 1GJUA 2DEPA 2PWFA 1C8YA 2YBTA 3KLKA 4E8DA 3WSUA 1WKYA 5M3WA 4GO8A 1UA7A 1R86A 2VO5A 4TVCA 2VI0A 2ZUUA 4L4OA 3AICA 4MJ2A 4WK9A 1QNPA 1QHZA 5A6BA 5KEZA 4MNLA 1LJYA 4CU6A 1BQCA 1MFUA 1E0XA 1US2A 3AHTA 3K1DA 5A2AA 3ZO9A 2RGMA 3A4XA 3SEPA 1X1NA 1VAHA 4ACZB 1C93A 4UQAA 1D2KA 2QPSA 3KWXA 5IFPA 4AD1A 3WDJA 4AD5A 4Q22A 2YOCA 4E2OA 1V02A 1W1TA 1WDSA 1GOMA 3N1AA 3BAKA 3KL3A 4JCLA 5JUVA 3ARRA 1UR0A 1W3KA 2FH8A 1KWKA 4ZE4A 4D72A 3D3AA 3WUFA 2BY3A 1AQMA 4L4PA 4FLOA 1H41A 4HP5A 2VL4A 5IXEA 2BY2A 4JFTA 4DUWA 3KLLA 4QFUA 3SCUA 1QX1A 3WMSA 3VMOA 4CD6A 3NDYA 3WKZA 2WSPA 2NT1A 3MSDA 5DF0A 1EOMA 1FOBA 1CTNA 1TQWA 1UD8A 1OT2A 3CUFA 2DSUA 3WH9A 3WEZA 1HKIA 3TA9A 1EA9C 2UY3A 3PZNA 3IAPA 1L0PA 3WNLA 1BAGA 3A21A 1H0GA 1JIBA 3SCNA 1FFQA 5BRPA 2PWEA 3B9AA 1E55A 3AJ7A 1V6XA 1CPUA 3L4TA 3K8MA 1UKTA 1ISWA 4V2XA 5M5DA 2VVNA 5ABFB 3WH8A 3EMCA 4NZJA 3UEQA 2VJXA 3VUPA 3LPFA 3LMYA 4HOXA 2BV9A 3T0DA 3I3EA 2A3AA 2X2IA 4GZJA 1BG4A 3SCWA 4TVDA 1HJWA 4UOJA 3L2LA 1Q4NX 5BXRA 2CHOA 3THDA 1PZ2A 4MNKA 3O2LA 2ZX5A 2XWDA 4KGLA 4F79A 2OSXA 3TTQA 2UY5A 1UD4A 4CCDA 4FLSA 4PMUA 1WDQA 2E3ZA 1SR0A 1TUXA 3VDCA 4FNPA 1B9ZA 4JKKA 2D3LA 4JKLA 3W0KA 1G1YA 1UKQA 4MAVA 4D6GA 1JI2A 3WD0A 4RL3A 4UQEA 1KGWA 1Q6EA 2JALA 1TE1A 4P7LA 1VJZA 4U2ZA 4JAWA 4PMZA 5DT5A 3MI6A 1Y7VA 1ODUA 1C3FA 2PWHA 1HKKA
chains in the Genus database with same CATH superfamily
1OZTG 3PBGA 3I6RA 4WWKB 5JLZA 2V9RA 4AUJA 5ACZB 1MPAL 2BVPA 3CHXA 4Z95L 1V8HA 3K0YA 1GGYA 3G08B 5J4MA 4AQ8C 4ZOCA 2RJHA 1A4JB 2B0MA 4KHXL 5CZ0A 4UU9B 1XLMA 2QT3A 4OI8A 5FCUL 1OOAA 4X6EB 3M7WA 1OTTC 3MNWB 1ISXA 4LV4A 1NAML 5K93A 1RUPL 1W15A 1F86A 3SYCA 5EN2A 1WBZB 1J5CA 4PG9A 3GPEA 5AW1B 1R3LB 3AU1A 2FTAA 4X50A 5D7KE 2X70B 4N9CA 2WIMA 3LEVL 4IOTA 1RJLA 2VDKB 5BOZG 2VNCA 4K7FB 4YHIB 3N91A 1PIIA 3QEGH 2COQA 1Q6FA 3QARA 1EJ6A 4OV4A 3V4UL 2EUXA 4HUUA 5SX5K 3RB7A 4AQ1B 2YBRB 2WKOF 1A4CA 3T6ZA 1XH1A 3RLVA 1GQKA 1E9LA 4M1DL 2LTQB 5KYUA 4YDNA 3CCHA 4NP4H 1QD0A 5BMXA 4LS0A 5IQOA 3PC0A 3O6LH 1E9PB 2H3XC 2PS2A 5DUBA 2WBJC 4YHMH 1V3HA 2X0SA 5D4YA 3FO2A 2EACA 1Y65A 5GSVA 3CZEA 3RTQD 3I2CH 2EQDA 3RVVC 4X2UA 3RL1A 3GM8A 3P80A 4RZBA 4YDLC 2CCVA 2XRAL 2Z8SA 3CPRA 3QJHA 4U1GB 1FV1A 1GEHA 1FHDA 3OPZH 3D69B 3FU8A 1JPSH 3AYVA 4Y2DB 2Q87A 3VFUB 1SRDA 1M53A 2G2RA 3KEHA 1BJ1H 4AV4A 1CX9A 1DDTA 2F68X 2GVGA 1LE9B 2TRHA 1P5VB 3SPGA 2G60L 2FMOA 1RSFA 4L9DA 3UP1A 1RURH 1I85A 2P52A 3FQYA 4UBDC 2QJHA 3TASA 1BLNA 5LGJA 1F00I 2WO5A 4YVPA 2K6ZA 1C5CH 3OVQA 4EJ1C 3MDJA 4DJFA 1IZCA 2P46B 3FQTA 5IK3A 3UZXA 5F1IB 4A2FA 1I1AA 2J88A 4K36A 2F9RA 2H26A 1GGIL 2Y69B 4I90A 1OZMA 5HPMA 4NF7A 1QPNA 1VFBB 1HK6A 4YIQA 1UG6A 4FNTA 3WUEA 5DWUH 4I5BB 4YHOL 1RK6A 4G6CA 5HGHB 3IANA 3Q9PA 5FYKD 2XN0A 2ISDA 3IMSA 4MMXA 1IAII 2J8GA 3T2QA 4MGGA 3L45A 4AG4L 2EXWD 3MODL 1UR2A 4XP9H 1XTMA 1MFNA 1ED3B 2H9GA 5FM5O 4A6YA 3W84A 1J0ZA 1E4HA 3B9KA 4V15A 4Z7VF 5AAMC 3CHVA 3O41A 5HJLA 4P8QA 5HHOB 3AO0A 2DI7A 2VTFA 3LV6A 5AQ0A 1EHAA 4LLVB 5FECA 4LEEA 2B0SL 1WFOA 5F2LA 4XO9A 2V17L 1Y18A 2VZVA 4HCLA 3C5ZB 4PGJA 3GE7A 3SGDH 1DQLL 3BDBA 1MCOL 2V5SA 4E9QA 1C5DB 3BLPX 1D2OA 4NPYB 5SWQA 3WNPA 3BO8B 4PRRA 3IMWA 4EDWL 4DM1A 4OJFH 2UWEA 1EX0A 5IFAL 2MCAA 5J12B 3CH9A 2DIAA 4LEOA 2K45A 1KB3A 1M6JA 1SGKA 1J5SA 3N15A 2AI0H 1HN1A 3LTVA 1PWMA 5C55A 1R7AA 3OGVA 2IVFC 4LFHD 5DHMC 1E7UA 1DN0B 2WMKA 1K9DA 3C0JA 4G5ZL 2OB3A 3TEUA 1BV8A 2LR4A 5IESL 2VDLH 1A6TA 5CC7A 3BVWA 4WW1B 3EJUA 2OMVA 3S2JA 1SPQA 3CVHA 2QHLA 1AKJB 6PCYA 3ETSA 2UWEF 5FF7A 1I7RB 1UYWL 1A3RH 4ZD3L 3UJTL 2D2OA 2DM4A 5DT1L 3SQMA 4MA1C 1SHMA 2YZ8A 1GTFA 4PM1A 1U36A 4AVOA 3I50H 4W68A 1DJSA 3QWNA 5HD8C 1U92B 3F85A 1XF3B 1IVLA 1HX0A 1OPGH 4L9ZA 1LLAA 3CQPA 3N6HA 1L9QA 3TXVA 1HU8A 4JCMA 5FV1L 5ABEA 5KBKA 1XM3A 3RCNA 3NT0A 4L0ZA 2WZHA 3ML9A 2NW2A 3HMWL 3MSPA 3MLYH 4GRSA 3L3GB 4U4BA 3VGEA 4OD3H 5JW5A 4MAYD 5CJXC 3U6RA 3EOBB 3UWUA 4XXCC 2CNCA 3D9AH 4ODBD 5I02A 3M0IA 2Y8VA 4J9JA 1JPFA 4ZXBA 3UPWA 3UJRA 1BPLB 4UR7A 3APDA 3P4NB 1UUQA 4HBKA 1Q65A 1NBZA 3TJHC 1E4IA 5GS0H 5IBLD 1X1ZA 3ALGA 3MUXA 2VXSL 2WWNA 3UROR 2XVGA 1TZ7A 4N8CH 4ZAKB 5AKRA 1S7QA 1VFAB 2H2PC 1OGAA 4FXFA 1BD2B 1NSNL 2A83B 3PAUA 3THUA 4CVZA 1W1IE 2YWZA 5KS9B 1MLBA 2FDSA 5F2MA 4BDVA 1N10A 5FDWA 5KVMC 4PJAA 1U8MA 5CJ8A 1GY2A 2VITA 3ZJKA 3GR8A 1SMAA 4NHUB 1A5MC 3IVTA 2AEIT 2E6AA 2ICWJ 2Q3AA 4HUMB 2ZKXA 4HPOL 1Q9WA 4U5IA 1KJVB 3V1HA 2HT3C 4BZYA 1QLEL 3KUMA 1JK9A 2GT9B 3SBRA 3ZUNC 3CZLA 5HVHC 2APTA 1A0QL 1Y0LB 1S5WA 3B0VC 4QRNA 1D9EA 2JV6A 3S1VA 2NV9A 1QBLH 4JPKH 4DETA 3KS5A 4ACYA 3IU4L 3Q6FB 5ICZA 3AFBA 1NDZA 3DUSA 5I18H 5DFWH 1LL4A 3GK0A 3FRUA 4P23D 3UTTE 1AHWC 3ULVE 4EZJA 4N5EC 1M7IB 1LD9B 4QRSB 1GORA 2E8ZA 4O15A 4GKZA 1RLBA 2Y5TA 1WRFA 1Z3NA 5E4AA 4L9XA 2VXQL 4NSKA 4U10A 3L7EA 3VFOA 1FVDB 1W56A 1CN4A 4KV5E 4JRYD 1MHHA 3PWPD 3GDBA 3EX3A 2C7UA 2A77H 2ZSVB 2XPKA 2ADYA 4DGVL 1AHKA 3NFNB 1O66A 4OQTL 1LDPH 2ZQKA 2JF1A 3GI9H 2FNBA 1VLXA 3WMCA 3HZMA 3M0VA 1CICD 4CLMA 4ZOAA 2X3BA 3MBWA 3B9OA 1NJ9A 4IW4C 1CK0L 4KTDL 4NO2B 1I9IL 3U83A 5FL1A 4X5PA 4P4KA 5AYUH 3QV8A 4XAGA 4QITA 1MCQA 3QZWG 1PJ9A 1G1CA 4MYWB 2LU3A 1GOWA 2A7RA 2G8ZA 3IGFA 3QDGA 4KK8C 4DZBA 1IEVA 4WKHA 3WFHB 4JHWH 1LVEA 4F0SA 2BMKA 3GD6A 1J8KA 4WJ8A 4YNGA 2DQIL 1XF5B 3VH8B 2Y1YA 4GMSL 2EINB 3HG4A 2CKBA 3TXAA 3HAEA 1BYCA 3AISA 4HNLA 2DMGA 3U4KA 3UR2A 1XX1A 1HHKB 1OC5A 3BZEB 5E6ZA 1DEEB 1VADB 3MQIA 5A43C 4AZ8B 4LCWA 2O61A 3AS0A 3MBEB 4LT9A 3I3BA 1XHHA 1D5IH 4K68A 4S0TD 3U9UB 1XIGA 2ZPKH 4Y2WA 1DFBH 2CR0A 1CXIA 1N59A 2PTZA 2ZXAA 3U4FA 3W7QA 3TT1L 1S9YB 1QEWB 4AZBA 1R19A 4JFHE 5BZDB 2CLKA 4CDHA 1ZS8B 3S4SA 3SE9L 3OKOB 5FWRA 1TJXA 1LEIB 1VPOH 2HVOA 3RQ3A 2DQFB 4WNSA 3VX1A 4JHBA 1BLIA 3CQKA 3NPWA 2X53A 5DD3L 1HNYA 1TVHA 2ENPA 3QW9A 3ZSSA 3NSFA 3E8UH 1LO4L 3CDCA 1B3OA 4L3ED 4WO0A 3CJPA 3NXFA 5DRWB 4UIMA 1GSMA 3RGVC 2XN9A 3WMQA 1CFSB 1HTYA 3DHMA 4MTVA 5G5DA 1KO0A 1QRQA 2X1XR 4MJIE 1O6SA 2VLRE 4KKXA 2XQYK 3U3HA 3H2QA 4KEMA 3R8QA 3NG5A 4Y4KC 3NH7L 4AYFB 3VZZA 3SFWA 4U6XA 3TN0C 1JDDA 4C6CA 5ETUB 3WQFA 4NZ5A 1LQ0A 4ACTA 2PYED 3FTGA 5E23A 4R9HA 3DIDA 3GHBH 2R69H 1BHGA 2FB2A 5D2LA 5DZJA 3BOXA 2J71A 4YXHL 3BRFA 1XX9C 5I19H 1R24A 5CKGA 1FZMA 2NY4D 3BPNB 1JGLH 2JKEA 1TQUA 2XETA 5BPPA 1D6VL 1U3HA 4DZ5A 5B8CC 3V6ZA 4DYKA 1OGSA 4M3JA 2PO6D 3HZYA 3HHSA 2GQHA 3FQWB 3TN3A 4M3PA 4L4VA 2E9BA 1CLCA 3WDRA 2X6MA 2AQTA 4IU3B 1MSSA 4UF7C 2MIZA 1OSEA 3S96A 3RPKA 3TYGH 1R46A 4KXZI 3VVWA 1E6ZA 5E5MB 1F3DH 3G1FA 1J8HB 1MJ7H 1LOLA 4YYCA 4YSQA 4IMGA 2CPUA 4YSEA 2Z25A 2XFGB 1J5IA 1Q1JH 2Z26A 1I7ZA 3U7WH 1Z9NA 1KXVA 2NZ9D 3CBKB 3STLA 3DO7B 4XAKE 3ISIX 5FJIA 3GG8A 1VYPX 3WQOA 1MZZA 1ZS2A 1YX1A 1VBRA 3T0ED 1R0MA 4IFKB 1YZZA 5J9PA 4OTKA 3OMAB 3ANYA 2EH7L 3E1F1 5BNKA 3UGRA 3TYZA 1FCCA 3SDAA 2E77A 3T71A 3SKNA 3LCFA 3WKMH 4ZPVA 2DLEA 2X2YA 4LX4A 3QQ4B 2GUOB 1KCXA 2BIOA 3KCPB 1GK8A 4YEFA 5I1LA 1MQPA 1BBDH 3FHEA 4ZTOH 4ONGH 3S7GA 5GRWA 2F74A 3MBDA 3PHAA 2BVYA 3RTQC 1R8LA 4WJG3 1SBBA 2VAAA 3DDGA 4KO6A 4L6HA 5K9KB 3TBBA 2OMAA 3EZ8A 4H20L 3UO1L 2ZYHA 5C09A 2VKZG 4YX2L 3GGWA 3VA2C 4D6EA 4J6RH 4R97C 1C8PA 1GC1C 1MFBL 3GG7A 3FGCB 3A6BL 4M7KH 3A3WA 5CG0A 2ATKA 2MTPA 3ZPDA 3U7AA 5AG8A 3E0GA 3S37H 5DRXA 3UPAA 1KNOB 4X4KA 2UZIH 2I69A 3WQ4A 3JW7A 3ZE2B 4ONFH 3SYAA 3EO0B 1Z42A 1OX5A 4LCQA 3ABMB 4RGMC 3NCJL 3E0LA 4PP2B 5CAYB 5CCZA 5AW6B 1LJMA 3SCMA 4E2VA 2EE2A 5BXFB 1U58A 4AVIA 3FW6A 5L2KD 4BE6A 4JZ5A 1MIEL 2RQEA 2B5IC 4N0FA 1KJMA 4R3SB 3V8CA 5C6TH 4S3KA 3O3UN 2ADJA 43CAA 3BUYB 5A95A 3LKRB 2OJEB 1F3TA 3ASOB 4MNQA 5DJ8B 5I6OA 4X0NA 3M1CA 3HIJA 1RQ5A 2EXWC 3ISYA 1ZTXH 1F0LA 4CSTA 1XGPB 3NQVA 3LEXA 4R5VA 3BWAB 4LVNB 4CVWA 4QTHA 3VQMA 2C15A 3WF0A 4I7WA 4JN2B 1KMGA 4A7GA 3C6LD 3O16A 5DJ0A 1P4IH 4KDTA 4ISVA 4NG3A 3Q44A 3C2AH 4YVNA 4P07A 1X5MA 3V55A 3P82A 4WRHA 4F2EA 3CVHL 1RVFH 3OZ9L 4YTUA 3UGUA 5FO9B 4DTGH 3BLKA 3QWQB 3PCYA 5CHNB 3PGFH 3B2DC 2EKGA 4WNQA 1FYTA 1DVFC 3REWB 5C0BE 2QGCA 4R4NC 1PKQB 5DLML 4D3CL 2VCOA 2BP1A 4LLWB 4GIRA 2ZWSA 5DJZA 1XGQA 2IADA 4JR9L 2WWMC 3FXYA 4QKXB 3HNSL 3F7VB 4C6BA 4Q9RH 4LUSA 3FUFA 4HN4A 1TPXC 4EKXA 2O4MA 4B5EA 2QVTA 4N42A 1LO5A 1EUNA 3NQ8A 3CQHA 4FNLH 5EO1A 4K8RL 4Z78A 1OW0C 2VC6A 2FSDA 4OCLC 4M81A 2VLRB 2QV5A 5SV4A 4UV7L 3Q65A 3EWBX 5LN8A 2HKHL 2XVBA 2BNUB 2Z92A 3GSXA 2JKWA 1WEJH 3WQEA 2HWZH 3GH7A 5BZXA 2L7UA 3NQBA 3U7YH 1AXSB 4F66A 3EFFB 2PDHA 4OLYL 4ELDA 5IW6B 2ZCKL 4E3TA 3CMOL 2A0LC 3MV9D 1F41A 2V2XB 2IH1A 4CVUA 4GX9A 4NKQB 1PTAA 5E8EB 2YZRA 5JHLH 1RZIB 1WX0A 3CZSA 1RXOB 3PG8A 1OD9A 3QUZB 3FUHA 3BHBB 4ES9A 4C83A 1X6LA 4MAYC 2HPIA 1E51A 2C16A 4ML9A 3TAKA 4X8JA 3D39D 3D3VE 4UNVA 5SV3A 5AHFA 4WI2A 3EYSH 1KBLA 2DQWA 5IBLC 3NJNA 1LEGB 4DBWA 1VAHA 4JX0A 4ZGYA 1KELL 4AE0A 1MVUA 3CNYA 2YOCA 5D4HA 1WDSA 3WHXB 4EPDC 5L2JA 2VL4A 5DY3A 2BWDA 2Y7SA 3I65A 3G1YA 4HHHA 1KTNA 1UBPC 3WMSA 1IE7C 2HLAB 2ZCHL 1QO2A 1ZLWH 3TMLA 4FXJA 1X5AA 1OT2A 5I8KH 3QCVL 1PLAA 4L1LA 4EIBA 5I1CH 2FB4H 4J1UA 2FPVA 2JB5H 3VXQB 5FIEA 4HJTA 4GUFA 3MHGA 2PU0A 4Q8UA 1SBSL 1GA2A 3HPAA 3I3EA 2FO4B 4KRMB 3EOSA 3SCWA 4NO0A 1UP2A 1LK3L 1SFTA 1HJWA 4IG2B 3FF7A 2Y0FA 1XLDA 5HAOA 1F4XH 4UXDA 2QQLH 3PJXA 2DTML 1A3XA 2NV1A 3ETBF 4PJCA 4CL7A 3U4BH 3BFOA 4DKEH 2YEQA 3QEZA 5ISZE 3N40P 4NKOB 5KSVA 3KR3L 2TSAA 2VC7A 3BW2A 3B0UX 1VJZA 3OJGA 4JBSA 4G59C 1Y7VA 2WLHA 1TIMA 2YEVB 4X8XA 3AWFA 3NO5A 1U8JA 1JZ6A 4KCUA 1RFDL 2CCWA 1OKEA 5ITBH 4FG6D 5EOCJ 2CNZA 1NDYA 4YVUA 4PJCF 3MZNA 1A65A 2DD8L 3QG7H 1HC1A 3W7JA 2CKBL 2EUVA 4LEXL 3O2DA 3GKWL 8A3HA 3DHDA 3VRJA 4FQIL 2HPOA 1DUZB 5TH2A 2DQHH 1C1EL 4L8BA 1CICC 1RBAA 3AIBA 2OPJA 5AZUA 1ADQA 5GRJL 4WFFE 2BTMA 3P62A 4LBRA 4JTFA 3D08A 4I2XE 1TWZA 4NDMA 2IXVA 4E8GA 5I1GL 5T3ZE 1ZLSH 5CJQL 3SO3C 3RPDA 3FQUA 1YECL 5FF2A 3MMDA 4I3RL 3IBEA 1U8KA 2AK1L 1M1XB 3GJFA 1YNPA 4P59L 2MPAL 4OV6F 1G6VK 3IGHX 1BVZA 1S7UB 2VEFA 4DBUA 5A69A 2PD9A 4BK8A 3FU9A 4NO3B 1JDEA 3CV1A 3E6FA 3PNWB 1WGVA 1I3UA 3SE4C 4TMCA 3WUZA 1DJIA 2NXGA 4EP8C 5FDYA 2YA1A 3ULUF 1AH3A 1WT5C 4FOMA 4IBSA 4PUKA 4YZFF 2WW5A 1CFMA 2WXPA 3VW3L 4E4UA 3LNIA 4IBWA 2VDOB 4WKZA 1UUNA 2WTPA 2VX5A 1WVZA 5I1JL 3NVQA 4LJ3A 5CAHA 2NQCA 3F2DA 2IAMD 2R29A 2MHAA 3LBOA 3ZKXB 1M57B 4KPHH 4LCCA 1H15B 3F4CA 35C8H 4TNWF 4RWYH 1SLUA 4E5XB 1HHIA 2ZIDA 4JPSA 4LE8A 3ZHKA 2RJMA 3TTYA 1CDYA 2VE6B 1KFKA 2LHAA 5CZXD 2O6FA 5T3XL 1LQSR 3LV5A 4M6UA 2Q3OA 3WI9A 3GSOA 2MSPA 2E5DA 4U3AA 1JDAA 3NEVA 5E2VL 3MJGX 3DXAD 1CGSL 4JZJB 2BP3A 3IKCB 4M1RA 1ZLPA 1GOFA 2FJFA 4NNPH 3ZGIA 3NOYA 3V7AE 1NAMA 4S3AA 4MS8C 4HUKB 4WHDA 4A39A 3CZNA 4HC1H 1OM9A 4PY8J 5D8ZA 3FT1A 2BODX 2O6DA 4UUJA 1XRSA 2ZE0A 4IXHA 4P5TA 2CERA 2VQUA 2Q8AH 4UQ2A 4OF8A 3O3DA 2DYPD 1U8IB 5GGRA 1VHCA 4TMBA 3QUMH 3SO5A 4R26L 2IALA 5IHZB 1FCVA 3DHJA 2GJNA 4YPJA 1BJMA 4BEQA 2EO7A 1RUSA 5TE6H 4D8PA 2DLFL 4APQA 1ZBWA 3BK0A 2R0WL 1H6UA 2ZZUT 4HA4A 3REQB 3Q01A 3LEYH 3TCLA 4WX2A 2IANE 2ENJA 2WXHA 4TIMA 2E67A 1EJOL 1GYCA 2GWNA 3KHOA 4RAUB 4X61A 2XGZA 4ZS6D 2NY4C 1V05A 3EIFA 3QKZA 1GS6X 2EIKB 2ODIA 5HQEA 8XIAA 1WAAE 1T21B 1QHOA 5G4HC 2BSLA 4DPQA 3QVQA 3V79C 1MFEL 3GMOB 2PAJA 3D3VB 2IDTA 4NXKA 4JPQA 3BAWA 3O8XC 3A3XA 4PLJC 4IZGA 5DMYA 2XWJA 4V2BA 1M41A 2JKTM 5IEHA 1T8QA 3DX9B 5FHBH 1K4GA 3MLWH 4OAWB 4Y9EA 4J3OG 4MKTA 5E2TH 1Z9AA 3ARVA 4K9EH 1CJYA 4X3ZA 2A6LA 2CK0L 1ITXA 1EBHA 3ZIMA 3O4LE 3DSNB 1MXSA 1CT8B 3W72A 3DRQA 4Y7MA 3VFWB 1T66D 1FN4A 5D7IF 4PFHA 1S2AA 3W86A 1E5YA 4IEFB 1X5ZA 3QHFL 4M5YL 3LCHA 3V0JA 3A4DA 2FD6H 1MRAA 3E9UA 4RRPM 2PEVA 4PRID 3MV8A 5HGAA 3BKJH 3N9RA 5I6PA 2Y62A 1TWDA 5GS3A 2UY7A 4LXFA 4YO0B 2MQ0A 4YDLB 3UA3A 4KTEL 2GK1A 2BASA 5DFAA 3GHEL 4CN1A 3QJFB 1AFVH 4NN6C 3M5VA 4F8QA 2YUWA 3CFKA 2AOSA 2IV8A 3H8AA 4PJHE 5EUOA 3PJTA 1DBJL 1PVHA 4KFMA 4FTVE 3EB4A 3I68A 4K1WA 1L6WA 3T0EC 2WNWA 3N85H 1U8CA 2PWDA 2KLRA 4FA8A 2W92A 1EFXD 4DVBA 1AAJA 1P7QA 2H3BA 2LW3A 4QHKI 5ISZB 3G5VB 4R85A 4F93B 2XWZA 5ESAB 3QR3A 4PRTA 2AEPH 4CU7A 3RPTA 5KITA 2EYSB 2XFFA 4XP1H 4WFGE 2X4OA 3M1ZA 1PYWA 2X41A 3R4IA 3UTPD 4ZUTB 1UWEL 4B60A 2HX9A 4ELMA 4OUUB 3FIGA 4EOUA 5EF1A 3UYPB 2MJWA 4PJ7A 1OVDA 1A0EA 4G3YL 4BCEA 2FO8A 3RZCD 1QPPA 4HLZH 5DEGB 2W1NA 1ASOA 3TURA 4C5ZA 1F3XA 2DT3A 4DNHA 3IK2A 2GVEA 4DI9A 2ZOWA 4PMQA 1FWFC 1E4MM 5JIQA 1T04A 3UERA 4GIYA 1UWXK 3FCSA 3IU3B 3GRIA 3T4WA 4ELMF 4EPBC 1RZJC 2OTDA 4PJ7F 4I2XB 1TPH1 1L6GA 3FC8A 4LLDB 2Y5JA 1OL0A 1JV2A 3V6OE 4BEIA 3L5MA 1AO7A 4GKNA 3S6DA 3Q5TA 4P57A 3VXTA 3QQ1A 3PUGA 1SEQH 3NFPB 4GBXC 3BKCL 2DW6A 1NOWA 1ASQA 1UWQA 4X9IA 1I53A 2ORBH 4C57C 2M26A 3KDOA 3QEHB 4AH2B 3MPGA 5GJMA 1JNJA 2PA6A 1KR1A 1NCBH 1UT2A 5IR1B 3U9PL 4FOUA 2DQTL 5EZPA 1NDTA 3RY5A 4GAGL 4WZHA 3QNFA 3RFZB 3TBVB 1N8IA 1R9XA 3D50A 5T5NG 1U4EA 1QSFA 3E3HA 4HZ7A 2D9QB 4L65A 1LUCA 3F4NA 4I4WB 4GNVA 4GYPC 1EO7A 1QQDA 1RUQL 3KTCA 1OWRM 4G8EB 1XP3A 2Z6FA 3V9FA 4ZFGL 4JRFA 4Z7UB 1A1NA 1TEFA 1SUJA 4X5WB 2V6AA 4WY7L 1J0JA 4IPLA 5M7QA 1VCAA 1FWTA 3OPUA 4BI6A 3V5HB 3SPHA 4DAGL 3EOTL 3AHYA 3ZLHA 4MA1B 2EDLA 4JFQB 1P0KA 1IC5L 3BAYA 1A7NL 2PP8A 2G75A 4V33A 5F6IC 3BUIA 3QRFM 3L4VA 2J7EA 2E7LC 3QNZA 3MRRA 4RRPA 4UWQB 2F53A 3W28A 2ISFA 1EMTL 1IBHA 5IGXH 3LSOA 1NUFA 1A7RH 4Z7WE 2W60B 4A66A 5EC1B 3JV0A 3WLOA 5DJDA 3DLQR 3QQXA 4BK5A 4ANKA 2H7WA 1S7WB 3BD3A 3DETC 3SJVB 4MCZB 1TR9A 4IBUA 1KLUA 3VKBA 2OMTA 1MQKH 5C2BH 3R06A 1NFAA 1XSKA 4XN1A 1DIDA 3CMGA 1EVTC 5EC2B 4I9XA 1W0VA 2QGHA 3EJZC 5KYXA 4JNYA 3QDJD 1J2BA 4AXNA 3VFVA 5TPWL 1B0RB 5LKNA 1CMOA 3S5NA 1TREA 4NC2B 4B95C 3KPRA 4J4PA 3R25A 5MENA 4B5UA 1K8IB 1KJ2L 1VJIA 4NM4L 4W86A 4G1MA 1XBDA 4OV5A 3QUXD 4DLFA 2VXQA 3DYOA 2FTPA 2JMRA 4HKJB 1V02E 4PWKA 3I6LD 1BYDA 1ZALA 4FP8L 1E1EA 3H53A 4I7UA 2DQCH 4U0RB 4UOW0 4GAAA 2JBMA 4LAMA 4LB4A 2CBJA 3I6SA 5LO7A 4MPQA 3FRPA 2OEJA 5HVHB 1REQA 4OSUH 3UY7A 1HEHC 2AQWA 4UTCA 1P0BA 4H0HB 3ONBA 2C79A 4OB5H 1X5LA 4U4MA 1YSOA 3ZE2F 3K4WA 3E0WA 3FT3B 4LARL 2YAOA 2Z4TA 2WLYA 1EEXA 1AZVA 3QCUH 1CXKA 3FB8B 2WWOA 5D05A 5CJMA 2Y7MA 1AHWB 4GRLD 3EFOB 2YZ5A 4GW5B 3CO4A 3GNNA 2BSEA 5D7LB 3TNNA 3BDXA 3BMWA 4OCWL 1ME9A 1ORQB 2VR4A 5JNYB 4UTJA 3AZSA 3M88A 2DQXA 2BSCA 4H44C 1YEIH 1BMGA 1F3JB 3SDCD 3HJEA 3O2DL 4XC1L 4PJHB 3QKEA 4G5AA 4TTDC 3UPBA 1QFWH 3MQTA 5LXGL 2IWFA 3F05A 3RHWK 1PB0A 1WAWA 3DVGA 1HSAA 1A4LA 2ALDA 5BCAA 2BVOB 2Q8BH 1ZLWK 1OVZA 5E6ID 1OAUL 3TJPA 3BSZH 4BFGA 1XKJA 5GVJA 1TQCC 1T0PB 2FFCA 1NCAL 3ULUL 2C9RA 2JJUA 4DZHA 3Q1SL 3GSQA 5BOOA 3TZNA 1H3PL 3LKOA 5HDWA 3ZWSA 1AY1H 4US5A 4QQ3A 2BIHA 4DP4X 4LCIH 4N0UA 1E2WA 4PRDA 3ARWA 1XIWA 1PKMA 4XNBA 4NQVA 5LYRA 3WIHL 4O9HH 1U91B 1JNNL 3VJ6A 3OOQA 3AADB 1ETZB 2GTZA 3THCA 2BC4A 5D9PA 1DWAM 4OU1A 3DKJA 4FABL 5CPOA 4HJIA 1OF8A 1JK8B 5I0VA 4IKIA 4PJGE 2BGSA 3C2EA 1GMIA 4RFEB 4P3DA 4HIQA 3V3WA 2CJSA 1R4XA 3UMTA 1IMHC 5L8KB 2B3IA 2EDYA 1JGEA 5F7KC 2XQBH 1GWJA 4N2HA 2OR9L 3PRZA 4B50A 4Q6YA 2XZ9A 3TV3L 3W9DB 5EN3A 2LV4A 2BCKA 2R29L 3ULAB 5IKCA 5AC6A 3BN9D 1QYGL 2JWYA 5AHEA 1Z5YD 2J9ZA 5H37G 3BVTA 1BZ7A 2OMXB 3NO1A 2Y2TA 2HVNA 2FATH 4O28A 4HTBA 4DHGA 3GVQA 5A2CA 3ABRA 1YEEL 5E8OB 4OUEA 2WXKA 3PTKA 3HS0A 4E4PA 2BXZA 3RGVB 3IDXL 3II1A 1YLBB 4YGVA 2WKOA 4YNYA 1AP2B 2JCCB 3L3DA 3HG1D 2R7EB 2V7HB 5TGBA 2PURA 4HOWA 3LTPA 2YCEA 4LDCA 3T0BA 1PDZA 3QEQD 3HN8A 4NJHA 1DDHA 1U1JA 4A2GA 5LA1A 4H1LG 1JNDA 2FVKA 2IAMC 4Y4KB 3HE6C 4MJ4A 4FNSA 4YFEA 1ROCA 3QZNA 4U3CA 2WJEA 1PCXA 4XAFA 4PJFB 1OSPH 1NBVH 2WBGA 1OIFA 2ZF8A 1ALDA 2F5AH 2MEJB 4MZ3A 3NCOA 2V2HA 4MDIA 6XIMA 4RMSA 4J3TA 2Q86A 5ABAA 3EO9L 2KMWA 3CSFA 1FH8A 3GXUB 2KERA 3QR2A 4H88L 5CLTA 1CO1A 1H09A 2R9RA 1UM5L 5D1QB 1SZGA 3WFEL 5KN5B 2QCCA 3QZOA 2SFPA 4TLTA 5GZNA 4Z8FH 5FGCE 5AZ1A 4PTTA 4HCDA 3DX8A 2X0UA 5B8CB 3IGAB 3QPXL 3CZFA 1JPEA 1W6WA 4KNTA 3JV4A 3OR7B 1WUNT 2O93L 1I2RA 5LSMA 1T6MA 3P0GB 2FJHB 1XGUA 4NJ9L 4Z17A 4QHRA 4D0BB 2VZUA 3SRFA 1FJ1B 3C6EA 3MT1A 3UAEA 3G2GA 4OLWL 3L1OL 2WUBH 5BS0A 1N0LB 3PWLA 4LPWA 4IKKA 3TS8A 4X9SA 4PS4L 3PHSA 3CC5A 3SCPA 3RURA 3BDYL 4AEIH 2E7DA 4QRPA 2P5NA 3BRGC 3EA3A 4ETQA 1EHXA 2YPLD 1HEJC 1L4IA 2VH5L 4Z7VA 3C5SB 3ZMNA 1O6VA 5CBJA 3B56A 2AJVH 2ICEA 3DUHA 1XFCA 3D85A 4F15C 2V5YA 3VTAA 1H9DA 3CWHA 2JJSC 3DHFA 1CF8H 4XMZA 4N26A 3GSUA 1COBA 1K6AA 1GSKA 4MCYA 3THML 3S34H 4L3FA 2AZAA 4WJ5A 4AKOA 3RITA 1T66C 2VISB 1EL3A 3B3IB 2BVDA 1OK6A 2F9BT 1O7VA 2ZOLB 2Y7QB 5IDZA 2G4EA 4EN2A 2G95A 3PQYB 5B80A 5KUKA 1I1XA 2FHBA 2H6OA 3ALWA 3N18A 5GRYA 1MAMH 1Y8BA 3EOOA 1FXPA 1A5UA 4P8UA 4MVAA 3LY6A 1ZT1A 3NSXA 4NQDA 3A6CL 3C5JA 5KVEE 3GFZA 1KGXA 3O2VH 5H2BA 4HA1A 4AJVA 4ZT1A 4JRYE 3PWPE 3PDDA 2HUEA 4BK9A 1SOXA 4R97B 1QBAA 1E0WA 3H56A 3FKKA 4FXKC 4HLJA 4OLEA 2DY3A 1F4HA 2XHYA 3WBDA 3B7UX 1R3YA 1BQHA 5SWZB 4RXGA 2RCSH 3TFBA 4MMZC 2QZ5A 2ZT9C 5IQLA 2I57A 4DWDA 4LGSB 1C8YA 4RGMB 4OFIA 2X6AA 5JQ9A 3KLKA 2WBXA 3D25B 2XICA 3QI9D 1WK0A 3CX2A 4TVCA 1KIUB 5EPMB 4KY1L 3KVJA 2QUMA 1OAYL 4KOBA 4CU6A 1BQCA 1WG3A 4D9QD 5C6PB 4OT7A 1PTGA 3L7RA 2B5IB 4ACZB 2X7VA 1S7RA 3RZCC 4UQAA 1U22A 3IFNL 4OFPA 3KHQA 4DYEA 3UFYA 4DBEA 2YD5A 4WIQA 1W3KA 5LGKA 5DHVB 1OP9A 2H0FA 3K2KA 5AVHA 1RUML 3DURB 2CWRA 3PFRA 1ACYH 4K3DL 4AMKL 5A3ID 4IGBD 4MY9A 5B38A 1FOBA 1UD8A 3WH9A 1I9RH 4AQEA 4WEMB 3RU8X 5J5EA 3PZNA 3SCNA 3HPLA 1RBOB 2CKNA 3CSYA 1DIOA 1V6XA 2GJLA 3K8MA 5J5DA 3LYRA 1UKTA 3TW6A 1QR1B 4A29A 3BLDA 1FAIL 2J8HA 4EPSA 5B21A 4IFOA 3VUPA 2WXQA 1ACZA 2ZKYA 3LPFA 4PJEE 1ZT4B 4KEZA 4M5SA 2V0AA 3U4EB 2OL3A 3BP6A 2ZRYA 4XVEA 4LIQH 3RI5F 1TJ1A 4O02L 5JW3H 2ITDB 3INUL 4MAUH 4M9PA 1DVFB 3BWUF 1JTPA 2B77A 4Q4OA 1CB4A 3Q94A 4GE8A 4MAVA 2AK4A 1M7DA 4MJJA 4W9GC 4DZAA 4POZD 5DRZB 4FR6A 3PUEA 1A25A 3MX0A 4MD4A 2JALA 4N85A 3B8UA 4PMZA 5DT5A 5BOPA 4AVHA 3NR0A 7FABL 3SBWC 1IGFH 1F6YA 1UFUA 3T65B 4L3EE 4UMAA 5FOBB 2X1WL 2R82A 1M6OB 4F58H 3TR9A 4TUFA 1XPYA 2KL6A 2X4QA 5B7YA 4CADB 3MACH 3AM8A 4J3SA 5GJNA 3SDDC 2VLKD 4LU0A 3EYVB 5E9AA 2K6WA 1LG1A 2QV4A 1YYLH 1CC3A 2R0LH 2H47C 4W9TA 3X14A 3NCFB 2PYEE 5CP7B 4QEGA 1KLZA 1W37A 1FZKA 1E90A 3ZRSA 1UWGH 1P1MA 1MQ8A 2CLVB 4JQ1A 1ZFJA 3O0RH 1PDKB 2OW6A 4YC2C 5D1XA 4IHBA 3RWGA 3ROLA 4O58H 5E03A 3OKEA 1EIBA 5I16A 5CUSH 1BW8A 1HHHA 2A1YA 2HQAA 5A6MA 2GQ8A 3CFCH 1FL3B 2WZMA 4MAYB 1QACA 4L1XA 4W6WB 2WWCA 1NC4A 4PTMA 3QV7A 4DK3A 5KBLA 4L29A 1KEGH 3FUJA 1QO5A 4X60A 5IG7A 5K4ZA 3GO1L 3QUYA 2OFJA 3U82B 4PG2C 3MRPB 1QRND 1HJSA 4M7JH 1TJIH 3BPWA 3W39A 3E6EA 2GOUA 3L16A 4KCWA 5L88H 3FN9A 4LOEA 3WXVH 3QXDB 1TZAA 3W0WA 1NCJA 3P77A 4HIJB 4L8DB 3KL0A 1SSDA 4JGUA 4V1DD 3KL5A 3D2UA 1PFCA 25C8H 2X0HA 4IL2A 4K8GA 2Y3AA 5HY9A 2X1QA 2Y1ZA 5HYSB 3AXXA 4JPIB 4MJ5A 4TU1A 3GIPA 2YXMA 2NTSP 3PP7A 2AKZA 4N20A 3RPMA 1FC2D 4WEEA 1JZGA 5JORB 2C4FT 3SKUD 3R6IA 4Z42C 3MZGB 1OC6A 1ONQA 4L3AA 1CFNB 4D9LL 3T0EE 4RMBA 2VD9A 3UTOA 1IR2A 2OAAA 4W4QA 1F5ZA 5BMFH 4CD8A 2A73A 2YPVH 3V6OC 1X4YA 5JOFA 1NFGA 2Z93A 1Y6NR 4PJ9D 1OANA 4HHAB 3RPIA 4GRLC 3TWYA 2AQOA 4XPAL 2YK1H 3D0VB 3NCYP 2GEQA 2CZEA 5I2UA 3QULA 4K94L 1OIMA 4I0PC 2DAVA 2XWCA 1E6PA 2PODA 2EJAA 4QRTB 4GO9A 4R0LA 1S2VA 2J9YA 1N5AB 1NY1A 3SRDA 4HKBB 4LCRA 5C0GB 1H7OA 3SDCC 1R3WA 1WD8A 3PWPB 1A9BB 3PL6D 2R1WB 15C8L 2IPTH 5BVPH 3RDTA 4JVUA 3UOAB 1P6FA 5D1ZI 1EH9A 1B5TA 1CIUA 4GZEA 2WNGA 1HL8A 1CXHA 3R0MA 2WTRA 3KJ6H 3QY7A 4B5VA 3FHQA 4M6PA 5G2NA 5E6IC 1MMFA 5LBVA 4Z0XA 5T1DH 2NW3A 1KTDB 1O5KA 3AAZA 1S7SA 2XKUA 5GGQH 4BH7B 2FPTA 4O2EA 2HT4D 1T4WA 2WXDM 4XCCH 5KSUB 3UTSA 1NGYB 1W0YT 1RSYA 5JIIA 3DJTA 3ZYZA 3H0TB 3BGMB 4S1DD 5L2KE 4C6EA 2QPUA 3K6SA 2V8ZA 5SX4I 4LVOC 4ANWA 5CWSA 2VL5A 5IB5A 4PI0A 5DMKA 1K2DB 1YBQB 2I16A 4AXWA 5IQNA 3HJZA 4CNIA 3VE0B 3OW1A 5CMAB 4JO4L 1RPQA 3QPQD 4Y4HA 3KYMB 3N2BA 1B0IA 4BWTA 5HHQA 3IDIA 1Y5VA 5LNVA 2W65A 3WBYA 3BE1L 3CTTA 4XOEA 1UBSA 4CD5A 2FX8H 2QKIC 3GVWA 2ZTBA 3MVTA 1BEYH 4B92A 3KPLB 1Q6DA 5IB1B 3MVSA 1W1PA 4F80A 2P26A 3CVCA 2GSJA 1R3QA 2AABH 3GLAA 3BN9C 4CMHC 1XBXA 1BX2A 4K73A 3ZTJH 1IBBA 4NENA 4YTQA 3GDKA 4JBRA 2YDQA 4HFWA 1NCNA 5HJ3B 1EEPA 2BGQA 1YKWA 4DP8X 3ZVIA 4GT0A 1NANI 4F3FA 2HLEB 4A21A 1M01A 3QWRA 1AGBB 1NOAA 1T0NA 4L3EB 2W5PA 2XZCH 4Q52A 3CN3A 1JI1A 4FALA 3OKDB 4IIEA 1ZBCA 1FPTL 1T20B 5GS2D 5F7FA 4B9JA 1U8LB 4G7FA 3RFRA 1CQKA 3NEXA 3WD3A 4YHYB 1O4UA 2PB1A 3V6FA 2A6IB 2PFHA 4N8VB 4NC1C 5IMMB 4JHMA 1I7TA 4MKSA 3S3DB 2CZDA 4XBEH 3TSMA 4DP1X 1Z5LA 4MQXD 1T5WB 3TFXA 8RUCA 5CXPA 1NEZA 3WQ6A 2HKFL 1VRSA 2P76A 4OM0L 1ZTMA 4MBRA 3O11A 4JHOA 4O10A 5GSRA 3A0OA 4XO7A 3W7PA 5LGZA 1L7TH 3T44A 4YSRA 2B1HH 3SGEI 4NZTH 1G7LA 1CLYL 4Y5VC 2HJPA 1W17A 2EH8L 4GLRI 3UTTB 1NKGA 4YXLH 3L9CA 3DN5A 2J6EA 4I7VA 3MRCB 5HVFB 4KKBD 4LGRB 2NY4B 5DBUA 3T0WA 5CS7A 3MKVA 5F4XA 2BOEX 4E0RA 2ATPB 4K37A 4O13A 3O8XB 3D39E 3ZTNL 5EZOH 4UQ9A 4QNWA 1DTUA 3A9BA 3S0CA 2BVEA 2PCPB 4XOCA 4NP7A 1W5PA 5FCSH 4XX6A 3KPSD 3I9IA 1CGVA 1YMMA 1XR2A 1TETL 1KC5L 1V5JA 4P2RA 2DQEH 5C0RL 5B1AB 4WDTA 4DNMA 5LAXA 5IMKA 1Q85A 3I6KA 4LTSA 5D8JL 5ALCH 1YRRA 4ZQTA 3V0VA 5I03A 4K4KA 2XJLA 3NFUA 4F1ZA 1L9NA 5M95B 4ADSA 2CLPA 5SWSA 2G2PA 1E0VA 4PGDB 2PTWA 4GEJA 1K4CB 5KYWB 3QM3A 1F1AA 2AXFA 1PEZA 4NN6B 3SM0A 2NVDA 4L5FL 2BG5A 4WWKA 4C1LA 5ACZA 4XWUA 4KI1A 3NSCA 3UXLA 5DD1L 3H23A 5I23A 4KJYB 1XJBA 4DP6X 2Q2LA 4HJFA 4M7ZC 3BVDB 2CDEB 4X6EA 2I56A 2VGIA 2VGBA 3MYJA 3MNWA 3OAUL 1B1YA 3S8FB 1E6JL 3ILPB 4GEIA 1BM3H 3OZKA 7PAZA 1WBZA 1W3LA 3MC5A 5HMEA 1QFEA 4F7MA 4BHUA 2NLJB 4I77L 1R3LA 1TZGL 4HJGB 4ZMVA 3AT0A 1GT8A 2V81A 1S2TA 3ELQA 2X70A 2YLLA 1EJUC 2NSXA 1XO8A 4OJDH 2MMXA 1OAZL 4LHUG 3OD3A 4YHIA 1FNHA 1RZGB 1XMWA 1PBGA 2HFFB 2CR6A 5FLVA 2LOEA 2HKAA 5AAPA 3EH1A 3HU7A 1RHHB 1G5AA 3W1XA 4FC3E 1FZJB 5LXVA 2YBRA 3VFSB 1UASA 4DEPC 5I30H 1POJA 2Y9RT 4GH3A 1HH6B 1OAQL 2AERT 5E9NA 4MJIB 4M5ZH 4FA7B 2QSCH 4JFXB 1H5YA 5HUPA 2OT0A 5EZLA 1E9PA 3SUSA 1B6DA 2E1WA 3QI9C 4GBXB 3S6TA 4UQCA 1UQSB 1WDRA 2OL3L 4DKAA 5HNNA 1D5ZB 4OZ4B 3GNOA 1KIQA 2WCSA 5L2KB 1HZLA 2VC5A 3KBWA 1ETJA 3NZ1A 3PGCB 4D6IA 4H8PA 4JIPA 4Z76B 4BFEA 1GGTA 3BPOC 2YJQA 2Y8UA 3D69A 5AVNA 1V3MA 2UWFA 4FQXA 3VFUA 3AUWB 2WPBA 1A6VH 1P69B 2WJZA 4AZIA 1ICTA 4OM1L 4IGBC 1YLVA 1XF2B 4PB5A 4TYUA 3N4AA 1FFTB 4BEUA 3AQDA 4J3ZA 3PBUA 4GA8A 4C6IA 1YY8B 4AD4A 3DMMA 2F6XA 5CNHA 5JHAA 3OODA 3I75B 1MCDA 3A12A 3BE7A 3FB7B 5I1DB 1EXPA 3TGXA 2F19H 4JHUA 1V55B 3PWJA 2MNUA 3H1ZA 4XX5A 2C9PA 5LKYA 3OP2A 5FA4A 3UGVA 3G22A 4K15A 1VFBA 1T5AA 2YN5A 2DQUL 3H3PL 1BQRA 1FZOA 5D32A 2B9AA 3GB7A 4DKFL 4M8QB 4B5TA 3TVAA 3OZLA 3ZR6A 3GU2A 3QJQB 5F6IB 3T1WA 2CLZB 7TIMA 1ZIBA 3HZ3A 5C92A 3MXWL 2H0PA 5LQBL 3BOVA 2VDIA 2V2WA 3GSMA 2NQ9A 3H9SD 1KJ2A 4NKIH 3FXGA 3FONB 5HHOA 1K9EA 3I4KA 4H04A 3AREB 4LLVA 2Q02A 3MSRA 5AW8B 3LZ5A 2J56A 4U6YB 3M16A 1OO2A 1WFMA 1A7PH 4C65A 3C5ZA 3T2PA 1HE7A 2ZP8A 3G6JE 1VS1A 3OLDA 1C5DA 1IXPA 4UFJA 5T8IA 4ICNA 4D8ZA 3BO8A 4YCOA 3GM0A 4TUUA 3FH5A 2VX4A 4P23C 1SFLA 4AYDC 3MV7D 3M07A 3T07A 2DP3A 2XSBA 3EFDL 3IJDA 5FEXA 3SD2A 3UACA 4OCXH 1I2PA 4MYXA 3GBDA 1SW7A 1DN0A 5L8LB 4C1NB 4S3FA 4K3EL 1DE5A 3W5NA 5FB8B 3R5EA 4HCRL 4MA8L 1DO6A 3V52L 1J7VR 2Y5QA 3D39B 1T2QH 2ZQ0A 1W3JA 1E71M 1MEXL 1VGEL 1QR4A 1I7RA 3ISWA 5AAWA 5KTEH 3CU2A 4LF2A 4Q4QA 1OD7A 2NYYD 4PRAB 3GNXA 4NJAL 1Q6RA 5F96L 1XIEA 2XYBA 4UNIA 4HSNA 5DXWA 1JGVL 2F58L 1H8SA 2X6VA 1U92A 3AWEA 3VKKA 4QXGH 5BVJB 3DIPA 1QHPA 1KFAL 2FVNA 2EDEA 4Q6IC 3PHQB 1N2VA 5TDOB 2D31B 2H1PH 3CFNA 1VBGA 1XYFA 4M62H 3FU6A 4PRIE 5K1VA 3S35X 4QHUA 3KYAA 1IE5A 3WIHA 2K4AA 2WYZA 1FIEA 4Y5XA 3X12A 2PLCA 3W7DA 4M1BA 4J3XA 4LLYA 3PWNB 4G7YL 2YRBA 3P4NA 2UZYB 4GQGA 3SB0A 4AY1A 4ZX5A 1S38A 3X2QB 4AC2A 3BW9A 3ZIZA 1KYDA 2PLTA 2ACQA 5AHMA 1DQML 4M02A 3PJSA 1ZGLP 3O06A 3PAVA 1BD2A 3W9EB 5J0BA 3V0AC 3S47A 2ARWA 1TQCB 4PJ9C 1G7UA 3NJGA 2V2CA 5KS9A 2LABA 4JMNA 4PWJA 2YDAA 2Z00A 1SOQA 2ZCZA 2I9LB 1TCRB 4ODHH 4O0KA 3UTPE 3BXNB 1NUDA 2ZTKA 4L2YA 2WV8A 3EJTA 1GXEA 3A67H 1IX2A 3HRZC 3BZFB 2Y1AA 5C0BB 3E6HB 5KVGE 2G37A 4GG9A 1CFVL 1KJVA 3LHVA 1BJ8A 2OTPA 3BH9B 1F6AA 4BQ6A 2FVMA 2GT9A 3P0XA 4N0CD 1KSRA 4UR9A 2WZ6A 4N86A 5E8NA 4P3WA 4QRRD 5KS9F 3APFA 4CSPA 1GQLA 4ML4A 1DTNA 1G9NH 2FIQA 1EO8L 1W72H 4X4ZA 2EKJA 2GOKA 1WGOA 3H7UA 3Q6FA 3D51A 5HNRA 3WLRA 2P7TA 3OA3A 1M4KA 1IBZA 5F6HJ 4XXWC 3S36H 4B9KC 2FPYA 4JFZL 1W8NA 3G1DA 3TO4D 4ZMTA 4ZNEE 1LD9A 3RWIA 1A7OL 2APBA 4S1DC 4X42A 5HJXA 1TQBC 2G9HB 3GQYA 4TLSA 1FVDA 5DVMA 3ORWA 4HFUH 4PRWA 3JWOC 3ABSA 2W79A 5ES4B 3KMDA 2PRHA 4Z0BL 2YXFA 3QPQC 5FL0A 5ERWB 1BIIB 3BLLA 2FQFA 5FO2A 2DQDH 4YS1A 3IUHA 4NO2A 3MCLL 3MGOA 4D6DA 1NFIA 3EYQD 3BD4A 3W7IA 2BDNH 3GDCA 3LXCA 1TQTA 1RHCA 4AC1X 2IBGA 1JCLA 4RISH 5I00A 3RGHA 5D7IA 4DO7A 3S3SA 3L5XL 1QOPA 1RCQA 4Q4KA 2IAMB 1CUOA 3HE6B 4KZEH 2PO6C 4Y5YC 3HZKB 3P30L 1WQVT 5E4EC 3HVDA 3PIQB 1IVTA 1PAMA 2L8AA 2B7OA 3NRQA 3VH8A 2DQGH 1F1GA 3RIFK 4LL4A 3JTSA 2DEPA 1Q9KB 1YEHL 4MZ1A 3QDMD 5AZ2L 5JMUA 1HHKA 2D2HA 2J6EL 1DEEA 1OY0A 4AZ8A 3QZEA 2ZSWB 4MJ2A 2WBJB 1X7SA 2YD4A 1SY6H 3UAJD 5C0FA 3K1DA 2GPTA 3AABA 2IQAA 3SKMB 2NZ9C 2WQPA 1HQ4B 3IRPX 3U9UA 1CFQB 1FKXA 3FFDA 3BQ6A 4A6GA 1UR0A 2WLIB 3IVSA 1KWKA 5F1NA 4O19A 1CDCA 3UG8A 4B27A 1AQMA 2HSAA 1H41A 5LIXX 4F7TB 5BZDA 2YQGA 4QOKA 3AUVA 2DSUA 1BBJB 5D2YA 1JWMB 1EA9C 3WNLA 1PZ0A 3G6JB 4F0RA 2IWEA 1LEIA 1AJ7H 4C4BA 2DQFA 3KYKL 4UTBA 4P46A 3GINA 2WNNA 2F15A 3MRFB 2LLLA 2V68A 4GZJA 3QDJE 4DNLA 5DRWA 2Z7GA 1AUSL 4WOQA 4XVSL 4PGEB 1GKPA 4LSPL 1CFSA 4ETYA 4DRSA 2OSXA 2UY5A 1U8OB 4NN7C 3TOYA 1P43A 1CE1H 4JKNA 3VDCA 5I76A 5LBGA 1RHFA 4JKKA 2XWRA 4HQVA 3I6LE 4JANB 2YAEA 4DN3H 4JAWA 1JNLL 4AYFA 1TTJA 4F15B 3DARA 3EBHA 3CDFA 4BE5A 4S2SA 4FQ1H 5ETUA 2IPKB 5EKYA 4I48B 4RCXA 3D0AA 2CDGB 5DFVD 3SN4A 3LHAA 4P2OA 4WJKB 1JRHH 1DLFH 2WBWB 2OQLA 1YRKA 3QTPA 3MLPA 4K9EC 1E6RA 4AV0A 3ARPA 2W67A 4FI4A 4PBGA 1BFSA 3F04A 5AYIA 1VYRA 1F1DA 4Q74A 4XO3A 1OX4A 5HNUA 4PRIB 4KAQH 4MA7L 2Z0BA 2GTWB 1G7MA 3TQ0A 4TULL 5J5RA 2VDKL 3QQ9D 3W1MA 4EEEA 1PG7W 3UP8A 4EI0A 3FS9A 1BG9A 3CE1A 3IVKB 3FQWA 3GXFA 2BS9A 1R17A 3CXFA 1W6TA 4FXKB 3SSGA 6CGTA 2JK2A 4IU3A 1IFHL 3GWJA 1IGIL 1TENA 2A4CA 3L6FB 4KJWD 3C6LC 1RI8A 1A50A 4MMZB 4YSCA 2AQPA 5I0ZA 2J7LA 5E5MA 4U7SA 1J8HA 5AWNH 3S3CB 5IMOB 3W74A 4AXKA 3S2AA 3LUTA 3HAEG 5KZCB 3NM1A 3CUXA 3TZVD 3SE8L 1BG1A 3U0WL 1HIMH 1LQBC 3EGJA 4O02A 5JO5A 3HGOA 4XD4A 3O6ML 2EDXA 3N9GL 4WI3A 2P8CA 4E4FA 3BURA 5FEPA 2PBOA 1XV8A 4UB0H 4LASH 3VB9A 4IFKA 2AXHA 3S5LA 4LKXB 5BJTB 4JVPA 2JKLA 3SD5A 5IIEB 4GQ9L 3S4SG 3CSPA 3RG6A 3W1PA 4O2FA 3KCPA 2YLKA 5JPMC 4WDXA 3PF3A 5CCHE 3FPXA 4NKCA 5CN3A 3H4FA 1SHXA 3U1QA 4CNTA 2PDBA 2OSLB 1ZA3A 1SJAA 2AC0A 1GKQA 5EOCH 2WMIB 3U2OA 3APGA 5A8QA 3VDHA 5TBOA 1HZKA 5D93C 3N42B 4Q9QL 4RE0A 4X4XB 3R7QA 4ICMA 1UMLA 1QNRA 4WFHD 4GGBA 1GHFH 5H8DA 4RDBA 5GS0D 2IANB 3ULVF 3V5CA 3GW0A 1ZHNA 5HWJA 4Z08A 3AU6A 1MRCH 3I6GB 1KNOA 1QPXA 2ADIB 3LMZA 4AYEC 2A6JB 2ZUSA 2VKXA 4F9PC 4KV5F 3O9NA 3HG1E 5CCKL 2VJ8A 4AY8A 4NAEB 3KDPB 4XN4A 3QEQE 4LZKA 2QF7A 2XYCA 3RX9A 4LO9A 4PP2A 4A7UA 3SDDB 4H9YA 4IJRA 3MN8A 4NC1E 3CQJA 1FWSA 3BZ5A 4HPHA 2GQ9A 4KMTH 4GQ0A 4HV8B 2F1AA 1U1UA 1GGUA 4R3SA 2VFFA 1KCKA 1KG0B 3TEYA 5EO0B 3O4LB 3LKRA 4KDWA 2OJEA 4N6RB 1R2TA 5DJ8A 4Y7EA 2DMBA 1UGNA 4GUJA 4JGDA 3H9HB 5ABDE 1EV2E 2BFVH 3TLLA 3GW3A 3GMRB 1VEOA 2F08A 5FKYA 1E5ZA 2C8NA 1XGPA 4FQLL 1CU4L 3CZ8A 2Z1VA 4JN2A 3K80A 4Y1TA 3QO0A 3HV8A 3WKNA 3HC4H 1FWEC 1LTXA 4Q4IA 3GHSA 3NGJA 3VXUD 4F8LA 1RIHH 4GSDL 4FTVB 2EUZA 5FO9A 4UM9B 3VXPB 5LVEA 3ITOA 2EXSA 3CK0L 2EE0A 4XBPA 5KSWA 1PKQA 1NCDL 4JMXA 5E56A 1KENH 4XPGH 1J1PL 2QAPA 2ZG1A 1OX6A 3QDJB 3PZOA 2B1AH 1B88A 1I8MA 4QO1B 3WLBA 2YO3A 4CRPA 1IO4C 4ENLA 1FUYA 2CO1A 5J56B 1GOIA 3VM5A 3BARA 4GMTH 3ABXA 1GOKA 2Y1HA 2GG1A 1J87A 1QTPA 3L1EA 4PVMA 1B9BA 2OXHB 1ZK5A 1Q3NA 3T4YB 3P8JA 4DPCX 2XWBA 4Q0XL 5J06A 2YPLE 5G4MA 4FG6C 1DLHA 2BNUA 4FF5A 4JDEB 2HNEA 1KUMA 4XMWA 3YPIA 3HFFA 4K3HA 3MRKA 1LM1A 1A14L 5FYKE 1V5XA 3L5WB 3VTMA 3EFFA 3L3OA 4G8GD 5I17B 2NYYC 4EE9A 3LS4H 4PB9L 1I4NA 1H0DA 4NRYB 4U1KB 2GCYB 3AYSA 3WQ5A 1SO4A 4TQEH 4OCSL 5ENLA 3RDKA 2B2XH 5E8EA 4E9WA 3WF2A 3KGRA 4UDUB 4S1QH 1QNOA 1R7OA 4UT7H 1VACB 4KUCD 1RZIA 5IEKB 4KX9A 3OC5A 1N5YH 4LSBA 4E9LA 3QUZA 4I0PB 3BHBA 4QROA 3BEVB 1J1XL 1KXTA 4CQ8A 4O1AA 4LGPB 4U1SB 3T5WA 4YE4H 3TP4A 1I2NA 2CXKA 4DVOA 2J7HA 3EXSA 3TPUA 1XDLA 1CDHA 1RPKA 3F4WA 4X5XB 3NIFE 3UZEA 1TKWB 3PFUA 4JRLA 1LEGA 4TN9A 1WZ1H 1T83A 3Q2DA 5DXYA 1EXUB 1EJVC 2QLYA 5DS8B 4BZ1A 1UD6A 3W26A 5E6IB 2LU4A 1DVXA 4L3CB 3WHXA 4HS3B 3QHZL 4GMEA 4S38A 4JX5A 2E46A 4OLVH 2P5EA 1UCBH 3L4WA 1P7TB 1HTIA 2HLAA 5J1SC 1HUVA 4KCVA 3NIDE 4ADJA 3GNML 3SQOL 3ILDA 3U5UA 3VOHA 4LT7A 3RJOA 4ENED 3TN0B 4TQ8A 3VXQA 2NLIA 4LVOB 3ABOA 4QTIH 5DI8B 5CZXC