3L2MA

X-ray crystallographic analysis of pig pancreatic alpha-amylase with alpha-cyclodextrin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGQDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
publication title X-ray crystallographic analyses of pig pancreatic alpha-amylase with limit dextrin, oligosaccharide, and alpha-cyclodextrin.
pubmed doi rcsb
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l2mA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l2mA01
3GNPA 1TQSA 2A3EA 3WH5A 1HJWA 1KTBA 2YL6A 7TAAA 5A3HA 3I3DA 1S46A 3ZSTA 4E4PA 3SCQA 4UFIA 1MYRA 5A8OA 2E9LA 1G9HA 2EACA 2EADA 1B2YA 2XN0A 3SCNA 2XWDA 3ARZA 3AHXA 1JIBA 3BGAA 2O92A 1DWFM 3AMLA 4W89A 3VNYA 4C7GA 1J0ZA 4F8XA 2HISA 5D9NA 3N9KA 4OJYA 1KR0A 1RH9A 3AXIA 1JYXA 2XIIA 3QGVA 3UG5A 2XFRA 2EEXA 2XPKA 1JYVA 1GOMA 1GONA 2WZHA 3VIMA 3GYCA 1UD6A 3ARPA 3GXDA 1KXTA 3FY1A 1CGTA 1CGXA 1LWJA 1G01A 1R86A 4M1RA 1UWRA 1UZ4A 2WKGA 4PMQA 4DUWA 2OSWA 4LGXA 1HP5A 1GUVA 1A3HA 1KWGA 2V5DA 3IAPA 4X0VA 4UFHA 1WDPA 5GNZA 4TOQA 4HMDA 1B3XA 1QHZA 3BAWA 3A23A 4ZFMA 4M56A 2OW7A 3UR7A 2D3LA 1PX8A 3WNMA 4AEFA 3A21A 3OGRA 2CKRA 2XHYA 4F66A 2W92A 4LXFA 1UQZA 3WL1A 3DYPA 2W5FA 3VDHA 3VILA 4TUFA 2WVTA 1V3KA 1E4MM 5GQBA 1L8NA 3VD4A 4FLSA 5DT7A 1QVBA 2A3BA 1K9EA 3RJYA 4CU8A 1BGGA 2J7CA 2VR4A 2J74A 2JALA 1ESWA 2YFOA 3WFZA 1UUQA 4J28A 2J8FA 2ZX6A 1AVAA 3DX4A 1ZBWA 2VQUA 1B9ZA 3AMDA 4RE3A 5IFPA 3VGEA 2VURA 2YDRA 4M80A 4UZSA 1VF8A 1DWAM 3ALFA 3VSUA 1OD0A 3OG2A 1PIGA 6CGTA 3W28A 3WUFA 4PTXA 2WMKA 4PTWA 2VQTA 3PBGA 4GO9A 1NWUA 1V3MA 1H2JA 1V0MA 5GPRA 2RGMA 3RO8A 3WELA 8CGTA 4UQBA 1BG9A 1TA3A 2YJQA 2XJ7A 4S3JA 1C3FA 4PYSA 2PWDA 3AS1A 1RP9A 2VRJA 3ARUA 4GI8A 3FW6A 2E4TA 1ECEA 3D3AA 2ZWYA 1JFXA 4P8WA 3QHMA 4D6HA 1EH9A 4TX6A 1PS3A 2UY4A 5EMYA 4DWSB 4HTYA 1GOOA 3GXNA 4AD3A 5I2UA 4FNPA 1GOIA 1MVYA 2VZVA 3PTQA 1JL8A 3HG3A 5I23A 2WMHA 3K4AA 4XX6A 4L4OA 4AW7A 5LA0A 1QI3A 3OA5A 3AMKA 2XFFA 3AMGA 4H8UA 4HOWA 4JZ5A 2Y2WA 1XSKA 5E09A 4AMXA 1UQYA 1WDRA 3VVGA 2XTKA 3WDQA 4A3HA 1TFVA 5A95A 2WMGA 4EANA 3S5ZA 1VFMA 2JIEA 1MWOA 5KEZA 3TTSA 3SUVA 1E4LA 5CZKA 2PBOA 1TVNA 1RD6A 3DC0A 1OCQA 3PTMA 3KEHA 2VMFA 1GOQA 2ZUMA 1M53A 1CYGA 4GI6A 1IT0A 1F4HA 1E3ZA 4PMXA 4UOJA 2OYKA 3A22A 1QW8A 4JCMA 1DHKA 3QOKA 1R46A 5CLWA 2XFYA 3WUGA 4V2XA 3AMCA 5FCZA 4GQRA 4P8UA 3PZGA 1TA3B 4MJ4A 4AZHA 1MQPA 2BY2A 1JNDA 3VDCA 4ACZA 3CGTA 1RP8A 1A47A 5AC4A 1VFFA 1JAEA 2VNCA 4OGZA 2J7EA 1KB3A 1M03A 4QP0A 3CHFA 3CZSA 1VAHA 2WKLA 2YBUA 4PN2A 3AIWA 1H09A 1KR1A 3HG4A 3WSUA 2YL8A 1JDAA 2ZUUA 3DX1A 3MKKA 3UESA 4AZCA 3MO4A 3BAJA 1UWTA 3W4RA 1BG4A 1UG6A 4D6EA 3SEPA 2V3EA 5CSUA 2WHLA 2D23A 1C7TA 1V3LA 4PMVA 3KLLA 1UOKA 3TOPA 1LL6A 5FIPA 1E40A 4AYSA 3AZSA 1O7AA 4M81A 5IXEA 1SMAA 3MV11 5C71A 4CN4A 3BXWA 2BHZA 3VGHA 3WQ5A 1NM9A 4CD4A 4JL2A 3LPOA 4LYPA 4UQDA 5A6LA 1V3JA 3I3EA 4PRWA 1H3GA 3N1AA 4V27A 2D22A 1HKIA 2CETA 4JAWA 1UD3A 3BVUA 4AZGA 3VD9A 2J7FA 4AZIA 4U3CA 1QI4A 1UD8A 3BAIA 5ABEA 3W81A 2WM0A 3FHAA 4E8CA 1VBUA 1UASA 2HVMA 2YLAA 4BA0A 1ODUA 1Q4NX 1V3HA 4ACYA 5E1QA 3WEMA 1F4AA 4HA3A 5TD4A 2WCSA 4P7LA 1EOMA 1SMDA 2ZUWA 5IFTA 1JGIA 3PZ9A 3WF1A 4AD4A 1E1EA 2PF0A 3BCDA 4MTVA 4ACZB 4GZJA 2OYMA 5DO8A 1KCKA 3VMPA 4MAVA 2X0YA 1WPCA 2WPGA 1GPFA 1ZL1A 1UR2A 2G4FA 4NSBA 2VT0A 4FNUA 2X0HA 3F5LA 3BUQA 4AZCB 1C8YA 3CHCA 2ESCA 3A24A 1HF6A 3IJ7A 1J18A 4IISA 3GDBA 1UR1A 3BUDA 2VC9A 2J7GA 1BSIA 2WLZA 1VRXA 5CSYA 4U5IA 1VJSA 3A4AA 3WNOA 4E8DA 1VJZA 1TQTA 2XVPA 4E2OA 2Z1SA 1EQPA 4NXKA 4JFSA 5A6MA 1M01A 1ZB5A 5E6YA 4CD6A 2W61A 2AAAA 2YIHA 1KBKA 4K68A 1JF6A 4H8VA 3ECQA 4HP5A 2VO5A 3L4VA 1GORA 3RM9A 2CBUA 3ZM8A 4Z2KA 1BVNP 2CHOA 1PZ2A 3B8SA 1CLVA 1HKMA 4PUDA 1W9XA 2WMIA 2XSBA 2WHKA 2G41A 3KZSA 3SUWA 3AI0A 3AIEA 3GNOA 4LPCA 1D7FA 1JDDA 1Q6FA 3NSNA 3ZT5A 1SYTA 3T0BA 3CPUA 2ZE0A 3RDKA 3EDDA 1E1FA 2YLLA 3WQWA 4BQ4A 4AZ6A 1JI2A 4UNIA 1ITCA 3VOCA 2VVSA 3L4XA 4ZXOA 4H2CA 1TQWA 1V0NA 1WNOA 4TX8A 3T2QA 2ZXQA 1J10A 2VL4A 4ML4A 2OWCA 3BSHA 1E6PA 2YDQA 1EHNA 6TAAA 3GZAA 4DM2A 1OINA 1QPKA 2BVYA 3ARRA 3TONA 1V02E 1OGSA 4CKQA 1BF2A 3GXPA 1MQQA 2G3MA 2EBNA 4B9YA 4UCFA 4W88A 4UFMA 1VEMA 1C93A 3EJTA 5DFAA 1BYDA 3OGSA 4ATDA 4HU8A 1W1PA 2Y4SA 5A69A 5IHRA 1UD5A 2GDVA 3OZOA 3WY1A 5GNYA 1XGZA 3T0DA 4Z2GA 1NP0A 2GJXB 1BVZA 2EABA 2ZOXA 3CMJA 3M6DA 2ZX9A 2EO7A 4R5EA 1E3XA 3CUHA 4C7FA 1W2VA 3IAQA 2WB5A 3BAXA 3AIRA 3OLDA 4AMWA 3SCTA 1WZMA 2E40A 2ZUTA 4BQ2A 2WMIB 2PBGA 1VEPA 4J7RA 4D6FA 1US2A 3IJ9A 1FFQA 3AIBA 2ZUVA 1GCYA 1V6YA 2VR5A 4CU7A 1VBRA 1W32A 5CG0A 3U7BA 1GQIA 4TTGA 3WDRA 2WZEA 1VFUA 1D2KA 1OIFA 4U3AA 2G3JA 3VIHA 2PWFA 3O2LA 3N04A 2O9TA 2VZTA 4MNKA 2O9OA 4M8UA 3CUJA 3WNLA 4W5ZA 1ITXA 1CENA 3ARVA 1Q6GA 1FH9A 3D52A 4RE4A 2WW5A 2CYGA 1P6WA 1UHVA 2A3HA 3CHEA 3BVXA 3LRLA 1MXGA 1WB0A 1YHTA 1B30A 2AOSA 3AOFA 4DWSD 2NT0A 4MNJA 2JEQA 3ZT7A 1CXIA 3VSVA 5AYIA 4PUEA 2GJPA 3TV8A 1ZBKA 2FE0A 4MPKA 2YBTA 3UR8A 1E43A 4J3WA 3CLWA 1NH6A 3MANA 3VD3A 3BVTA 4B9ZA 1BQCA 3LXAA 4V28A 2YL9A 5FL1A 2GFTA 4HU0A 4IUGA 2WWCA 7CGTA 4MAZA 4QFUA 4X0NA 3SUSA 4D72A 2VX4A 1BFNA 4R27A 5D4YA 1UWUA 4FK9A 3SCOA 2IUZA 1ZJAA 3WUBA 4CGTA 1E56A 1B3ZA 2VCAA 1CDGA 4W84A 2JEPA 1EIBA 1K6AA 3N17A 4LX4A 4YPJA 3WEZA 5GNXA 1V02A 4PMYA 5FL0A 1JXJA 4HMEA 1BGAA 2VJXA 3F4VA 2D0HA 1TQUA 1CXFA 5DMYA 1TQVA 4ATWA 3OBAA 3SCSA 2XVLA 4M29A 1H5VA 1KBBA 1ZBCA 1UA3A 1B31A 2Z1KA 3MSDA 3NSMA 1H0IA 2O9RA 1X6NA 4PMRA 4OKDA 1G94A 1CXLA 1WCGA 5A2BA 1R33A 4J3SA 1KQYA 3I3BA 4FNSA 1U30A 3CH9A 4PMDA 3VIPA 1JZ6A 3HN3A 3BAYA 4BQ5A 3T2PA 3EJPA 4DWSA 4RE2A 1DWIM 3DHUA 1R7OA 3AS0A 2C0HA 1FP8A 9CGTA 4BF7A 2BFGA 1B90A 3BVVA 5E9AA 3BUBA 2DH2A 4GZEA 5BCAA 3PZTA 5BWFA 1CIUA 4DUVA 3BSGA 4P7QA 3EBVA 3MSGA 3T09A 2DH3A 1W9PA 4IPLA 4GO8A 2F2HA 3MMWA 4HZ6A 4B15A 5M3WA 1UR0A 3AS2A 4AD0A 1JD9A 2C7FA 4Z2HA 2F8QA 4XUYA 4AWEA 3PZNA 1E71M 4OZOA 4BS0A 1W3KA 1M7XA 4PMZA 4M82A 1WE5A 4HPGA 2VZUA 3SCRA 2CEQA 3QHOA 1HT6A 2WVUA 3MMUA 3AZRA 1NQ6A 2W66A 3ARQA 1UH2A 2BV9A 5IDIA 1V0KA 4B3LA 3CBWA 3BLKA 1W91A 3EMQA 6A3HA 1W9BM 3B9DA 3PZQA 1OT1A 2ZIDA 1K9FA 1QW9A 3DX3A 2WMJA 5I79A 4W87A 1XCXA 3SURA 3D4YA 3VIJA 3VU2A 2ZX5A 5ABGA 2VZSA 3LXBA 3ZJ6A 1JYNA 1QI5A 1W1TA 3MI6A 4UOQA 2E0PA 2VCBA 1OB0A 1C8XA 3WH7A 2CNCA 1VB9A 2QV4A 4WLCA 1TUXA 4HPHA 1UKPA 2DDXA 1HIZA 2FHFA 2UY3A 2X2JA 1FOBA 5I5RA 1MW0A 3DX0A 1HXJA 2PWGA 4FLQA 3VIOA 2F61A 5HXMA 2VVNA 5CPQA 2EPLX 3WENA 3CZNA 3E1F1 1TVPA 1E6SM 1GOKA 4P7NA 1E55A 1TG7A 2GK1A 1GHSA 3GXMA 3RIKA 3ZOAA 1C90A 5A6BD 5C70A 1QI0A 1W9UA 3H55A 3OIHA 3GTNA 2VOTA 2X2IA 3AQUA 3MUY1 1KCLA 4MDPA 2F18A 2YA1A 5E0FA 4F9JA 3AROA 3PTKA 1QHOA 5FD0A 1E6XM 1CGUA 1E4NA 5BRQA 4OOUA 3WD2A 1CXKA 3OLEA 3WF3A 4JFVA 4A4AA 5KZ6A 3J7HA 3BAKA 1HJSA 1NWTA 1MW2A 2J8GA 1R7AA 3WKZA 1MFVA 4EE9A 4P8VA 3VM7A 1UKOA 3EDFA 4J27A 1I1XA 3RMEA 4KMQA 5E0CA 1TZ7A 1H49A 5AC5A 1UH4A 3K8KA 3S5YA 5ABFB 1W3HA 1NARA 4L4PA 4ZEPA 1MXDA 1T0OA 4OIFA 3WD0A 5A6AA 4QLLA 1QWNA 4NXSA 2XUCA 2V5CA 2ZXDA 3BC9A 4U5KA 4C7DA 5A6KA 5BROA 3VIIA 3VPLA 3WH9A 3CO4A 2F1BA 4NRSA 1JG9A 2VTFA 1E0XA 4Z2IA 4NZFA 4HA4A 2EPOA 4ZXLA 3UETA 4U2YA 3M7SA 1QWUA 5HDRA 1JFHA 1HP4A 2A3AA 3WF0A 3L4ZA 2WC7A 2J79A 1Q6DA 4H41A 2GK1B 2YOCA 4A3YA 2BY1A 1KGXA 1HJXA 5A6BA 1EOKA 1JXKA 4TXEA 3AHYA 3VM5A 3MV01 3UEQA 3D50A 1KGWA 4N0RA 1I1WA 2DT2A 4W7VA 4UR9A 1JI1A 4CVWA 1JF5A 2CBIA 3SUUA 3PZIA 3IANA 4TTUA 5F7UA 1PBGA 4S3KA 2D24A 3EDEA 3VGDA 2BY0A 4N42A 3RPMA 1G1YA 2D20A 1EDGA 4HA1A 4H7VA 1FH7A 2BVDA 3AICA 4MNMA 3CV5A 4U31A 2IXVA 2XVNA 3WIJA 3GH5A 2X8RA 2OSXA 1TMQA 1GQKA 4AISA 3W6LA 2W67A 4NF7A 2WCGA 4FNRA 4WSJA 4D6IA 2F7RA 2W62A 2ALWA 3WD3A 2E3ZA 2YA2A 1E15A 1LQ0A 3W6MA 5JBFA 3UCQA 2WCAA 1V03A 3LMYA 1XH2A 3OGVA 5A2AA 5D9OA 1JZ3A 2J25A 1BYCA 2YL5A 5DF0A 1QI2A 1PZ3A 1HX0A 1WKYA 3VMNA 5I78A 1NOFA 1CXHA 1DWGM 3ZR6A 1EDTA 4AYGA 2JF7A 1J0IA 4PBGA 2ZICA 2GVYA 4GINA 4WIWA 2GJXA 1J12A 1UKQA 2XN1A 1IZKA 2X2YA 1HVQA 4UQ9A 2OWWA 5BXSA 1UR8A 3HJEA 1OM0A 4BCEA 4AZ7A 3WD4A 4MDOA 4QDMA 4DWSC 4AD5A 5JBDA 5HPOA 1QBBA 3KL5A 1WDQA 3AIUA 2EQDA 5C8BB 3W0KA 3WH6A 2E8YA 4F9DA 3W37A 2WMFA 1UA7A 2J75A 3ZJ7A 2VX7A 1W9DM 1KWKA 3ZQ9A 3ARXA 3MU7A 4HZ8A 3DDGA 4UOZA 2E9BA 1HKJA 3LPGA 1R8LA 4AEEA 4EKJA 2WVVA 1E6ZA 3T2OA 3ARYA 4JHZA 2V38A 1CLXA 1BYBA 2WVSA 3U7VA 1LF1A 4MB3A 4URIA 1HTYA 2DIEA 3N18A 1J0JA 4HOXA 4GIAA 4UTFA 4AMCA 3T08A 4W8AA 3CZJA 2J78A 2XN2A 4GI9A 4WJXA 3D5HA 4CU6A 1R85A 3F5KA 3FXYA 4D6CA 2YKKA 1QX1A 2QLYA 2F7QA 3AIQA 3QOMA 4MB1A 1R34A 1HL9A 1W1YA 2XSAA 4W8LA 5JIWA 4ATLA 5A8NA 2ZX7A 3B9EA 3MUZ1 4P7RA 1PAMA 1G0CA 4QLKA 2V3DA 1H0GA 4DO6A 1W3JA 2QPSA 4H04A 3PN8A 2BY3A 1FA2A 5ABHA 3AFBA 1ISWA 4QLJA 1G5AA 4PMOA 3H54A 3CUIA 3L4UA 4U2ZA 4W8BA 2FDMA 3WQ6A 1QBAA 3MS8A 2FHCA 3WFLA 4YHGA 1H1NA 2GJRA 3MMDA 3HG2A 3LPPA 1C8QA 1UWSA 1PX3A 2JF6A 1EXPA 1I75A 3GNRA 1O6IA 3LX9A 4AZ5A 3U57A 1W1VA 5HBFA 1LJYA 4CCDA 2DPEA 4UZUA 4WF7A 1ISZA 3AXXA 2WAGA 4NI3A 2JE8A 4Z2LA 3VO0A 2WVVB 1EGZA 1JD7A 1UWQA 1CPUA 1KFWA 4PTMA 1ZJBA 3PHAA 4JCLA 4MB5A 1VFOA 3WY3A 1B3VA 3A4WA 2J47A 1XSIA 2X09A 1C92A 3NYDA 5EFFA 1UWIA 3WMBA 3WMSA 3HG5A 1Q6CA 2EPNA 3AHTA 4GXPA 2OWXA 1XYZA 3D4ZA 1AMYA 4RL3A 4W85A 3AS3A 3A3HA 3OLGA 5D9PA 1E9LA 4BZYA 3II1A 1M04A 2CHNA 1ODZA 3BCFA 1J0KA 4W7WA 3GH7A 1E6RA 2ZX8A 2PC8A 5A8QA 3L2LA 4TVUA 2QHAA 1E6QM 5CJ5A 1QHPA 2W63A 2F1AA 3EDJA 1CGVA 4QCEA 3SCVA 3DX2A 4WSKA 5M17A 1OGGA 4DUXA 1OSEA 3ZT6A 4D1IA 2VUYA 3N12A 3W38A 1ZBVA 5I77A 1V6VA 3GM8A 1BTCA 3BH4A 3HU7A 4XZWA 1IZJA 2D3NA 4Q22A 4FMVA 4BQ3A 4D1JA 1QOXA 2J7DA 3BUIA 2DT0A 4HMCA 1V0LA 4KGLA 5D8WA 4DO4A 1W2PA 2Y8VA 4WKHA 1FFRA 1E4IA 2W4XA 4FLOA 2XM2A 1ISVA 3G6LA 2PB1A 4NRRA 5FKYA 1QNQA 4OBSA 5BXTA 3WMCA 5EB8A 3EMCA 4Y7EA 4J3XA 2DQXA 3CZGA 1US3A 2XVKA 1E73M 1O7DC 1KGUA 4W86A 1BPLB 3THDA 2C8NA 4J3UA 3VTRA 1JZ8A 4X9YA 2WBGA 2WC4A 4MNLA 1ZU8A 2EPKX 3KL3A 4AD1A 2FH6A 1UD4A 1V3IA 2EAEA 4YHEA 2J62A 3AHVA 3NDZA 1DP0A 3U5YA 1CXEA 2QMJA 2B31A 4AD2A 4JFWA 3AYSA 4WKFA 4ZENA 5A8PA 3TTQA 1B3YA 4QCFA 4H8HA 1DTUA 4FNQA 2QF8A 1KTCA 3AISA 2BVTA 4WKAA 1KXQA 2V3GA 2CITA 4KWUA 2QPUA 2JFEX 1UR4A 4CN6A 5JIPA 2BHYA 3PZUA 2XM1A 3WDHA 3BMWA 4JIEA 4AY1A 2J77A 1MW1A 1OBAA 3WF4A 1CGYA 3VD5A 2PI6A 4EK7A 3WL0A 1HWWA 1NP2A 4KRUA 1DWJM 1OD8A 3CMGA 2NW0A 3LRKA 1NOWA 3WUEA 4CD5A 2Y5EA 3THCA 5LYRA 3DYMA 1GVIA 3S2CA 2GDUA 5HPCA 1LL7A 1K9DA 2DT3A 2WXDM 8A3HA 1U33A 3BLBA 5FOOA 1PJ9A 2WSPA 3L4WA 4PEEA 3H53A 4UQCA 1FHDA 2FYVA 1JNEA 3RJXA 1C7SA 1MFUA 3WNNA 4FF5A 1K9TA 3WH8A 5I3DA 3SCPA 2VX5A 2JIWA 2FGLA 1XD0A 3A6OA 4PMNA 1JZ2A 4D6DA 2VCCA 3SCWA 4U33A 3TP4A 5CGTA 2XIBA 1WAWA 3OZPA 3WN6A 1TE1A 4J3VA 3KWXA 1GQJA 3N11A 1W3LA 2WBKA 4CUCA 2WK2A 3QR3A 4LQ1A 2CXGA 3ARSA 3W27A 2ZXBA 1SZNA 3ZJ8A 3K1DA 2WLYA 1UR9A 3L4YA 1V6XA 5HOSA 5ABFA 1UD2A 2NSXA 4Q7NA 3VIKA 5ECUA 1V08A 2D0FA 1KXVA 2MANA 4UQAA 3O9NA 2DSUA 1DWHM 3A4XA 4PMUA 1XYFA 3APGA 4GZIA 2AMGA 4F79A 1R47A 2Y24A 3VGGA 1D3CA 2G3NA 4AC1X 2WSKA 5DT5A 1E72M 2O9PA 3AJ7A 4WK9A 4JFTA 1H11A 1CBGA 3FAXA 5IHSA 3VD7A 3AIVA 1UYQA 3AXHA 3VNZA 3W26A 4NZCA 3ZJKA 1QNRA 3AYRA 5D9MA 1GHRA 2J4GA 3BMVA 3A47A 2CKSA 4OBRA 1WZAA 3VX1A 4AIOA 1OT2A 1ISYA 5I24A 3ALGA 2DSWA 2DSZA 3MUIA 1JAKA 1WDSA 1XH1A 2BXZA 4KRTA 3CTTA 4ZE4A 5CLTA 4AZBA 4CCEA 4CD7A 4AXNA 2OW6A 2XG9A 2CIPA 4W5UA 3TA9A 5I0DA 2XWEA 5A2CA 1OWQA 4JKLA 4TVCA 1J0YA 1UH3A 2X1IA 2ZWZA 3F5JA 4IM4A 2F7OA 4JL1A 4XB3A 2Q8XA 1UKSA 3VMOA 3DECA 1Z32X 3PZOA 1X6LA 3AZTA 4DO5A 3ZMRA 3T0AA 3RILA 1KXHA 4D71A 3B9AA 3NDYA 3ZIZA 1XC6A 1B1YA 1OIMA 1JZ4A 4B16A 5JUVA 2CERA 1GVYA 1X1NA 3POCA 1E0WA 3D51A 2RGLA 1EO7A 2FGZA 1BYAA 4MADA 2EXOA 4D6JA 4XV0A 4PCTA 2QMKA 3EJQA 3FN9A 4UFLA 1H41A 1R87A 3GXTA 3WD1A 1EHAA 3NUKA 2GSJA 2WHJA 2DIJA 3RM4A 3CZLA 4HOZA 2IXUA 1J9YA 5D8ZA 2VI0A 1NWRA 3SIMA 2A3CA 4JHOA 2YFNA 3WBEA 2CBVA 3VUPA 2EPMX 1HNYA 3HZ3A 2J7BA 1LG2A 1MQRA 2V3FA 2UY2A 3AHZA 3M46A 3VX0A 1HKKA 3KL0A 3OB8A 1AQMA 3UG4A 5I6SA 3KE0A 1HJQA 2NT1A 2YA0A 1XCWA 3BUPA 4AIUA 2WHMA 3VDAA 1ISXA 3GBDA 3VSTA 4ZE5A 1JZ7A 3W53A 1U2YA 3DYOA 5M5DA 3OLIA 2EJ1A 4CCCA 4NX0A 2PWEA 2D1ZA 2D2OA 1LWHA 4HZ7A 1FP9A 1UKTA 3IJ8A 3ARWA 3TTYA 3WBAA 2CPUA 2VRQA 1E5JA 3EJRA 1WP6A 1Q6EA 2UWFA 3A5VA 2ZXAA 1CTNA 1J01A 1DEDA 2G3IA 3WNPA 2WYSA 3FNDA 4UFJA 5A6JA 4EAMA 3CZKA 2X05A 1CWYA 2OSYA 2OYLA 1XD1A 2DGAA 5CPSA 5CGMA 1HL8A 4YN5A 5EBAA 3S6TA 1H4PA 1CEOA 1VENA 1OGBA 4LYQA 2BS9A 3PZMA 4PTVA 3SCUA 3GXFA 1HN1A 1SR0A 3W25A 5E6ZA 3K4DA 1XSJA 5BXPA 3UERA 1FH8A 3BVWA 1GNXA 1NWSA 3GH4A 5A6SA 1UZ1A 1QNPA 1BHGA 1B3WA 2CESA 3WY2A 4CN1A 1EDQA 3RM8A 3LPFA 3VIFA 4KH2A 3RCNA 5A1AA 3M07A 3ZO9A 4FNTA 2VX6A 1BLIA 1E70M 3WY4A 1R75A 4UQEA 3ZR5A 1V6WA 1XRVA 4JKMA 3WDIA 1BAGA 1AQHA 2D0GA 2DT1A 4MJ2A 5JBEA 3K46A 4TVDA 5CQ1A 2CBJA 2X2HA 1GOWA 3POHA 1TCMA 1HXKA 4JFUA 3O6AA 3W24A 3TTOA 2E8ZA 3LXCA 2ZUSA 1E6NA 2YDSA 1GQLA 4OOZA 3WQVA 1WO2A 1NOUA 2TAAA 2CCRA 1CECA 1L0PA 4M24A 2WZIA 4GPNA 4OUEA 1RPKA 1KQZA 3KLKA 3FHQA 5LA1A 2BNJA 3N13A 3GXIA 3G6MA 2G8ZA 5LA2A 4CVUA 1PEZA 2DSKA 1ZS2A 2E9MA 1HJUA 1HVXA 1AQ0A 5E70A 3NIYA 2XVGA 1B0IA 2UY5A 3LRMA 1N82A 1Y7VA 3NCOA 3U5UA 2VZOA 3DHPA 4NZJA 3EYPA 2J7HA 3N15A 2DSVA 1LLOA 4LYRA 5HNNA 1EA9C 5A94A 3FAWA 1QNSA 3MUAA 1WZKA 1TR1A 3K8MA 1GW1A 3CUGA 4P8XA 2VRKA 4UFKA 2W91A 1QNOA 1PIFA 3VKKA 1GJUA 3HMCA 1W9VA 1E0VA 1J0HA 1CNVA 5EFDA 4D6GA 1V6UA 1YQ2A 3EDKA 2FH8A 1PX4A 5BYWA 3SUTA 1CZ1A 3DDFA 2XGBA 4KGJA 4W7UA 2D73A 5AYBA 2WANA 1LG1A 1XH0A 2BXYA 5BRPA 2IGTA 4GQQA 3L4TA 1VIWA 1JDCA 3IGUA 4J3TA 5A8MA 3VGFA 3CZEA 3VDBA 1EO5A 1HJVA 1VEOA 3QHNA 1WZLA 3EJUA 3WNKA 5BXRA 4AIEA 3W29A 2BHUA 3WQ4A 4PSPA 3EMZA 4P7OA 3ARTA 1IV8A 3WEOA 2OLHA 2FHBA 1PPIA 3NSXA 3VIGA 3W82A 2Y8KA 4MB4A 4GKLA 4PSRA 4JKKA 3GBEA 1E5NA 4PCSA 4XZBA 3WDPP 3PZVA 2ZUNA 3WDJA 2WNWA 4QAWA 4DM1A 3ZSSA 2GUYA 3CZ8A 3BLPX 1SFSA 5DEZA 4W93A 1MW3A 3UG3A 1LL4A 1JZ5A 1GJWA 1XV8A 3EJSA 3IK2A 2DEPA 3JUGA 5AY7A 2PWHA 3VINA 5CXPA 3CC1A 2XYLA 3VGBA 3NJ3A 1CGWA 1XHGA 1C91A 3WQ8A 5CPTA 2XGIA 3CIVA 2F7PA 4Z2JA 3CUFA 4CD8A 5M03A 4B3KA 3CHDA 1FHLA 1JYWA 4IPNB 3K8LA 1GZJA 1J11A 4FLRA 1EQCA 3WF2A 2WC3A 2WWDA 7A3HA 3L2MA
chains in the Genus database with same CATH superfamily
2NNCA 1THAA 5I1LB 1RJYA 2ANUA 4YHKL 2P10A 1QEWB 1IQ8A 1NDYA 2E6DA 3II3A 1QLRB 1SXAA 2WKOF 2XN0A 3P69A 4NN5B 5CSBA 3BGAA 3RQ3A 4RVBA 4E2BA 3MRNA 5D1QB 3N9KA 2OPJA 4IJCA 3UG5A 1DKWA 2D7TL 4JTDA 3W3BA 3PDOA 1OVDA 5KANG 1UD6A 4EZJA 3RFZB 3WFEH 3K6FA 3FQUB 1X7QB 5CEYA 3DETD 2IADB 1G01A 3K5SA 2G5UA 4Z95H 4JM4H 2YGYA 1PYWB 3GMPB 4YPGA 2PCFA 3MKCA 5DD1H 5KYWA 3DGGA 1DN2A 4YOKA 1QHZA 1CB2A 2FSEA 2V5LA 3W39A 1MLCB 4OKVA 1RJZB 1MH5A 4ZNEE 1QFWL 5BJTB 3SN6N 4PJ8D 1YMMA 1LXMA 3VDHA 1JPST 2QCCA 3O4LA 1X5IA 3KPNB 3I6KA 3ULUE 4OAWB 5IJDC 3UJTL 3DV6B 1OANA 5BRBA 5JPMB 4NJJA 2H3DA 3QYCA 3AAZB 1ZBWA 1RVFL 1RURL 2NY7L 3MYPA 4XKYA 3OKEA 2V2XA 3SSGA 4JPVH 1WDDA 1OD0A 3OG2A 1PIGA 2EEFA 3L1GA 3GSXB 1QTPA 4IW4C 3P2DA 2I9UA 3MRCB 4P23C 2VDKH 2F84A 4F7TA 1EF3A 1HZHH 4ESKA 2GITA 3VI3F 1EH9A 5CIPH 4FSAA 1UACH 1BM7A 3KP0A 1EJUC 3H4GA 4RX4D 1SDDA 1Q2SA 2ADIA 5JHLA 4MAUH 1I8MB 4IX0A 3DTDA 4ZQPA 5JU6A 3VWKA 3BSZL 4GEJA 1WDRA 3WDQA 3V0AC 3SDDD 1OK8A 4EANA 2WM1A 3MDWA 2JIEA 1MWOA 4JPWL 4JVPA 2PYEB 4P2OA 2UXFA 3U4BH 2ASHA 1DFBH 1I4NA 5DO2C 4PGCA 4RFEB 1IC1A 4UOJA 3MR9A 3WOVA 1Q0YH 5CLWA 4ADSA 1THFD 3CGTA 3Q5YA 2AFNA 2QCNA 3IFLL 5TPWL 1S9YB 4UIMA 2K4AA 5B3SB 3CHFA 1EEQA 3CZSA 4LFYA 3F84A 1XH3A 3BZFB 1RZKC 1DSYA 2HRPH 1TTBA 3PNUA 4D9LH 3N14A 2MCMA 4J6IA 1I0DA 4BEQA 1CLOL 3MJ9H 2NQLA 4NGHL 4FOKA 1C7TA 2X9WA 1U2CA 3L6FB 5IXEA 3SE6A 4EN3D 5D7HA 3T3PE 1AG6A 1DOSA 3L54A 3CD4A 3CSBA 4CD4A 3I10A 3GI8L 4NASA 4YS1A 3JZUA 3BAIA 5ABEA 4NN7B 1ITBB 3BZ4B 1OAUH 3KPRA 1Z69A 1IM3D 3G1RA 5I30H 4PVLA 5C6TL 2RFXA 2Z92A 1JGIA 4DZ8B 3BCDA 1J86A 1BYPA 4XO9A 2Z4TA 3D0AA 2CIIB 4MAVA 1D5IL 1MCWM 3VFTB 1ZL1A 3CDCA 2OX5A 4GA8A 1Q9LA 3KBEA 4AZCB 5CMAB 4K7PH 4PRTA 1HF6A 3VFOB 3BW2A 3GEFA 1B9BA 4F2ME 4E8DA 4N0UB 5A6MA 2ZQKA 3B2VL 3FONB 2JKJA 3QVQA 3FQ2A 1TIMA 4HP5A 4UR8A 4N2NA 1WBXA 4O50A 4X9HA 3SPHA 1PZ2A 4H13C 4X42A 3SUWA 3HS0B 1S8DB 3QEQB 4L8SA 4BKLA 5A16A 1KNWA 3CVHL 4WU7B 2CIKA 4UNIA 2JQMA 1ITCA 3PL6C 2VVSA 4JFDB 4DJDD 2COQA 2X88A 4LANA 4DM2A 1V02E 2RJHA 4EDWH 1A8ZA 4UCFA 3B8DA 5K9QG 5H91A 1C93A 5K59F 3OGSA 5DUMH 1XTLA 4W4OA 3VNDA 2NV2A 3TBSB 1T0MA 4XX1E 4HBKA 1KLUA 2JBMA 2VZ1A 4LEOA 1H1YA 3ASWA 2XXGA 4FQQA 1U8IB 4TSBH 3RKDC 2WB5A 4ZI8A 4WGHA 5HATA 3AIRA 4S2CA 4XPTL 3UTTB 5IHWA 2ZUTA 4BQ2A 2VL5B 3PFRA 1U3HC 2WMIB 3MOQA 4F7CA 3TYAA 3DG6A 5I74B 5B38A 2ZUVA 2QADD 4AK1A 1VFUA 4POZC 4PFHA 4ENZA 2R4RH 4NQCB 1OAXL 3ILPA 3O2DL 3US0A 5FECA 5AAWA 2Z93B 4KVNL 2R2EA 4DIXA 1TZGH 1TDQA 3VXNA 1KM4A 3Q6FA 3TH3T 1MDAA 2VERN 5GGVL 4ZMOA 1VBGA 5M1TA 1FGVL 2R29H 4BK5A 3S1UA 5FKAB 4BWLA 4X63A 3VE9A 5C0DB 2QPEB 4ONHA 5FO9A 3W70A 5FL1A 3RA7H 3FCUB 4IUGA 2AK1H 7CGTA 2OTWB 3HMXL 3SCOA 3FK3A 3UX9B 4PFMA 4AKPA 4AAJA 3KW8A 3UR2A 1IT9L 4PLKD 1I3GH 4I5XA 4F27A 3EBIA 3SAZA 4HJFA 4IF2A 2ROXA 3NACL 3MSDA 1NFDE 2NW2B 3LAFA 2W9EH 3D08A 1PL9A 1MI5E 3Q9QA 3HNVL 2B59A 5KW9H 4H4IA 1YDYA 4PMDA 1JZ6A 3PNWA 5IQ9B 4YHIB 4QXTB 3RGHA 4MNHB 3DHUA 3PS7A 1WSST 3LA4A 2BHFA 1MAMH 1P43A 4JFHD 3QRBA 5C0CB 1FDYA 4BEUA 3PFQA 1RQ5A 3LNIA 3SKUD 1WXZA 3NAAH 1VFTA 4CNPA 2EH7H 4WGXA 2XZ7A 3P14A 1UR0A 3M86A 4R3SB 4JQVC 1WA1X 1E71M 1WKFA 2O30A 3CFKB 4JTGA 5AYZA 5ETUB 4LHUD 2C9SA 5F71A 3MROB 5J6SA 4P57A 3FVMA 4MWFA 3CX5J 4ZJ9A 2EDDA 1TVHB 2J4WL 3MFFA 3HBGA 1GG0A 3FU8A 3CSGA 5LZLA 2Z4QA 3R4IA 1HHKB 1IKNA 3ZDZE 3A67H 1PKQE 4G8GA 5GRZA 4OT7A 3K2UH 5A7EA 1J87A 3BHBA 3UCCA 3ESMA 2X1SA 1FOBA 3MLZL 1IIIA 3QAQA 1W6TA 5A7BA 4UV4H 1ZLSL 3WKNA 2HA1A 2QVMA 5GJSL 4HCLA 2APBA 3HURA 4XWGH 1PWLA 4QXGL 2OZ8A 3ASNB 4RIRB 5CGQA 4DXXA 1N7ML 5T26A 3MRMA 3U36A 1PAZA 3IT8D 3R7MA 1X5ZA 3SECA 3I2CL 2EXYD 3EO0A 4GQ0A 3EOAB 2AF2A 4A39A 1MHEA 2XC8A 3PTKA 1ZHAA 5ID1B 3H7BA 2YXMA 5B39A 3GIQA 2OOFA 3WKZA 3C5JA 4HX1A 1DVQA 4MJJA 1UCTA 2EIEA 1QSZA 1GOHA 2CWRA 1XGRB 3LZOA 1FRGH 2PKDA 3DLQR 1IEBB 5GJTH 1I9CB 2D7OA 3I68A 2XUCA 1TJXA 2DDQL 3A4JA 1E0XA 4NZFA 1PSCA 4G80A 4MYXA 1Q6DA 2GQAA 1KGXA 5GGUA 3QBUA 5HYFA 3AHYA 1KGWA 5E2VL 1A6AA 5H6HA 1TZHB 3QCUL 4TXVB 4Z7VB 1IT7A 5KYYB 4FHKA 3RPMA 3CV5A 2WV3A 2ZZ2A 5TE7L 3C5ZD 3W9EB 4KK5C 3IJ6A 3TQKA 3PJWA 3W6LA 4YE4L 1S7QB 5LGKA 4ENEC 3QQWA 2F53B 1QA9B 4Y8DC 2WJEA 2ICWJ 3RNDA 1EEZA 2WCAA 2PDYA 5A3ID 2J25A 4DY1A 2BFVH 3PWLB 1P84K 1IEHA 1FHNA 3HBPA 1BREA 1IZKA 1DBMH 5KG9A 2D8KA 1IQWL 4Y16B 3UBHA 4YQXH 1UWEH 4ES9A 2ZC1A 5FW7A 2IAMC 3WH6A 3UPCA 2EYTB 4P61A 1UATA 3LN3A 7PCYA 1XWYA 5I7GA 4J9JA 6TIMA 1YXYA 1FXPA 3VCRA 2X41A 2VEGA 1LJMA 3N18A 3G77A 4HOXA 4O2EB 4PIBA 5CPNA 1C5DB 4NO5B 4P5SA 4QQUA 1BW8A 1A6VH 4QHNA 2VCOA 4GJIA 5DX7A 3T0WA 4B9KC 2VXQA 2J12B 1UB3A 4KQ3H 5JIWA 2ZX7A 5AYXA 1XUUA 3FL7A 1MZRA 3CHVA 4DO6A 1MCEA 5JO5B 3ZL4L 4K5MA 5IEKB 3NDZE 4Z7UE 2HKHL 2Q7AA 1KFAL 5IF0A 2C1OB 3EYFB 2Q10A 3CFMA 2DQGL 3KH3A 2GQHA 4HCGA 3QP3A 2FUQA 4Q14A 3V95A 3SDCC 4RFNC 2X0UA 4P23B 3FYIB 3U9PH 1PZSA 2GGJA 3E6HB 5F0LB 1OAYL 2QCEA 4LT7A 1BQSA 4GXUM 5D38A 3LZLA 4FZ8H 1W0VA 3TN0C 2CPCA 3HM7A 4RL3A 4B4FA 4BQ8A 4OFIA 3SDAD 5D9PA 1ZGLM 3USBA 4L4VD 3HZKA 1IRAY 3L2LA 4GSQA 4L0ZA 1LMKA 5E9DE 2ZKHL 5I0XA 2XRAH 1ZGLB 3E2HC 3EDJA 2H6OA 5IVXA 2VUYA 2FLIA 1HSAA 3O63A 3UW6A 2IPUG 3R4DA 3FQYA 1EHXA 1FWEC 3QG7L 1V0LA 5CH9A 3G6LA 3QMTA 4RK8A 4AL8C 5FKYA 4MZIA 3G8RA 5BXTA 1USQA 4R0LC 1S2VA 2JJTC 4PB3A 4Y9BA 5MEPB 1Z9SA 2LAGB 2GPZA 2HXAA 1YO4A 1AL8A 3D3VE 5B3NA 3UZQA 3LS9A 1JJKA 2EPKX 4BH7A 4LAKA 4AE0A 3ARFC 4J3OH 4MCZB 4TULL 4AD2A 3QCTH 3AYSA 2P1FA 1KT2A 1NGXB 4FC3E 3VK5A 4LBEA 2BW5A 5IP4A 1IWBA 4GO6B 3FJTA 3X1BA 3MV7D 3DX7B 3RR4A 3N2JA 4KRUA 2A1YA 4PUKA 3GHTA 1J5CA 1HSBB 4ZZ9A 4D0BA 3OVGA 3PABA 3NDOA 4X4ZA 1BZ9A 1F4YL 2OQJB 3NZUA 1PJ9A 3WS6C 2DW5A 4KK6C 3RWCA 3GR4A 5F4WA 4FXGC 3HC3L 1FVPA 2B4CC 2KI6A 4WHCA 4LDEB 1SEBB 3TC3A 1UCWA 3UP1A 3QQ1A 3V9FA 2OMWA 2X89A 2FWOA 3W01A 1QLEL 3X11A 4GQPH 3EKLA 2DV0A 4XMVA 3H3KA 4Z7VF 1JVKA 3RU6A 1QPPA 4GMEA 4AVJA 4DAFA 1CBGA 3W22A 1LO0L 1BMGA 3Q94A 5E6ID 4OSUL 4UTBA 4L4TE 5GGSA 1SN5A 3LNGA 4WY7H 4APXA 3GUFA 1T3FB 1HCFX 3IU3A 1NCIA 3NVTA 3OV6A 4AYEC 5FJJA 1XH1A 3IPFA 2IDSA 1LP9E 5AW8B 2W0PA 4CCEA 4AYFA 3RAOA 3H7UA 2Q7YA 4OZGE 2CIPA 3ABRA 4BCXA 3DFPA 1J0YA 2FJGB 1VRDA 4UQ3B 2V68A 3NQVA 1TZ8A 3TTEA 1P7QB 1HGWA 3O8XC 4P9MH 2FBJL 1IC4L 4UANA 2PW2A 1XC6A 1UP2A 3WXVH 5FWQA 5J1AB 2IMRA 2J8TA 5LGJB 4O18A 2C3WA 3E3QE 4H6EA 4IHBA 3DUGA 1DQJB 5HHXH 2QJGA 1EHAA 1L0XA 3OPUA 1XQ4A 1U3HB 1CD8A 3S5OA 1UIPA 2WXOA 2UY2A 2FZ9A 2HK0A 1Z66A 1JPFA 4TKWA 5FEPA 3UWUA 1J8HB 2WLMA 3L16A 1HJQA 3DNKA 2J2ZA 1B2WL 1R5WA 4UTJA 2GK0B 1TO3A 3W53A 3GB7A 3OLIA 1AZ1A 3GHEH 2IS7A 5KJRH 5G4OA 2C4FU 3WBAA 3GD6A 4Z78A 3CQKA 3BPOC 4KKNA 4WJ8A 2D4FA 2BIHA 1OQFA 2V82A 1L7TH 1MEIA 4PWHA 4ORZC 4W9KC 3QQ9C 4HSQA 3RRAA 3U8GA 5AALA 1TENA 3GSOA 3KCPA 2CA3A 1S39A 4M6OH 4LSTH 3BAEH 2H26A 3NTCH 5HUOA 4ZUUB 1HESA 4GXVL 2WW8A 1NCGA 4ZD3H 2Z7UA 4X5XB 3ROOA 3WD5L 1FC2D 1SY6L 3FRPG 4NQDB 3GBLA 5C09E 3PXJA 5FUOH 1ASPA 4GMSH 4IMGA 3LEXA 3WSQL 2D0GA 3C52A 3ZU8A 4XO8A 3UC0H 3DFOA 2WMPA 3G08B 1GOWA 2C3VA 3E9TA 4FHJA 5EIVA 5ITFB 3WLIA 1FBIL 2BWGA 1GQLA 1KN4H 2TAAA 3GSWA 1IAII 2PO6C 4G7YH 4JDZB 2P45B 2GQ9A 5T5FL 3G6MA 3Q2NA 5E2JA 3Q6GH 3PFUA 4M9PA 3T81A 4LLUA 2HT3D 5C86A 3U5UA 4PV1C 1ZTVA 3N15A 2VELA 2VAAA 3MYJB 4HKXB 4LAQL 3CUGA 3SY6A 4P8XA 4HPNA 3HMCA 5C08E 4BFRA 4HPJA 4NBZB 1ZVSB 3EDKA 3QEZA 3FTGB 1ME7A 4AWUA 3WQCA 3W1XA 4XVJH 2XSKA 4M7LT 4OIAA 5H2BA 5C7HA 1KG0B 4DQAA 2VQ4A 5A8MA 4GW5A 1YYML 4HHGA 2EAWA 4G7QB 1YX1A 2CJTA 3M44A 4AQOA 1B4JL 4ANVA 3KYKL 1Q6RA 1FN4B 4K37A 2YD6A 1A1MA 5CFHA 3JV4B 2FO1A 3QZAA 2X6BA 1P7KB 4IKIA 1MAKA 1QAPA 3RE0A 4KKAD 3JWDL 4N0FB 4R7LA 5C0FB 1EUTA 4WEBL 4M6PA 5CXPA 3LTPA 5A5WA 1Y18B 9PCYA 1C91A 3U7YL 1ACZA 2XGIA 4Z2JA 1XYAA 3ROLA 3I9PA 5KBMA 1JYWA 1F13A 2HAZA 1J11A 2X4QB 1EQCA 1XUZA 4BH8B 3PHQA 5C5YA 1WFTA 2Y2TA 3LOWA 3D2UB 5A43C 3SCQA 3QXDA 1KF9B 1G1CA 4LHJB 4NU7A 2O6PA 3BWUC 3KWVA 3M41A 5IUCA 4G1EB 2CC0A 3QDMA 4JFED 5TE4L 2V2TA 1R0MA 1GTHA 2Q3RA 1ZGLP 1WA2X 4XRCA 1GOMA 4LU0A 4ZO9A 3L7RA 4B5TA 1HDMA 3CXDH 2MKLC 3M0KA 1U91A 5AENA 2XZAL 4GXUN 3HI5H 2G30A 2NQ3A 4HQQH 3BFWA 1F6LL 5DSCB 2OSWA 4G9DA 1T99A 3IAPA 3QDHA 2EZ0D 3RJDA 2GTQA 4F4RA 1Q90A 1ASQA 3DUUA 1JV2B 2B20A 4ZSUA 1I45A 4G2AA 3FFCE 2F5AL 4X7SH 4HJ0C 4P3CL 4NDMA 4O00A 3VILA 2HJKB 3ITCA 3LOTA 4FLSA 1YPZA 4LL4A 2XG5B 1BQHB 5DT7A 1CFVL 3VTTA 3RJYA 4CU8A 2OX1A 2WJZA 3LXUX 4HS8L 3L3OC 1JP5A 5DVOA 2KLRA 5K9XA 1UXSA 1ZD6A 2VLJE 2ZF9A 1AQ8A 5JQ6H 2PYFB 4C1NA 4HU2A 2QTVA 1M4KA 1ED3A 1G5GA 3MRKA 2YJQA 4S3JA 1K72A 1C3FA 2ZVRA 2F9BT 2ZDSA 3GBMH 1X5LA 3T0EB 4JDBA 3D3AA 3CH1B 2YLKA 3H1ZA 2PNDA 3U2CA 3TFCA 3KOXA 5HK4A 3T07A 1V27A 4YX2L 4FNPA 2IAMB 3UNDA 3WQDA 3QDJD 1KLFA 2VDQL 2RUSA 5I1KL 1Z48A 4DPBX 2DQCL 2HQAA 1N12A 1T5XB 1S2CA 3S37H 2I14A 1XBYA 5EU6B 4JBSA 4AG0A 3UYPB 4ABVA 1KBVA 3AQXA 1PCSA 3L7EA 4N5ED 2Z8VC 1A6UL 1PD1A 4E3VA 1F4WH 2ZC8A 3O4OC 3RBGA 1K5NB 4NN5C 4K94H 3TSMA 4MQXC 4OZHE 1WD8A 2IWKA 3CPGA 1NUDA 3MCNA 2E7FA 4JS7A 2WUCL 1R3RA 2CLFA 4ANKA 2HWZH 5DQJA 3LCWA 2ISFA 1H7RA 3HG4A 3S83A 2XXMB 1EGVA 3PP4L 1AZCA 3NJXA 4LLDB 3SDCB 4D6EA 4RFNB 5CSUA 3HNTL 2Y89A 2VQ1A 3MVTA 3G6JF 3RNQA 2G4GA 2J6XA 4X4XB 1XIJA 1A65A 2E7DA 3LN5A 1R3IL 5LIUX 3WQ5A 3G0UA 4XXDB 1GSMA 4LYPA 4C4KO 1ICTA 3VNIA 2NLJA 5KSAD 1FWHC 1TUFA 3TN0B 3WTTA 3VD9A 2BRQA 5HMSA 4O02L 1YJDH 4JG0H 4N8VB 5F1NA 2INFA 2HVBA 3NSJA 3MV9D 1ITUA 5EOCJ 4Z76B 1I8JA 5TD4A 5CSGA 3RAJL 5IFTA 5G2HA 3S97C 1RI8A 4ZQOA 5SWSB 2OYMA 2F54B 1P5VA 3E2HB 2X0YA 1WBJA 3L1OL 4PRNA 2E7LA 1QMUA 1SSGA 2K8MA 4HLEA 2MOGA 5LGYA 3IRDA 4BDVB 2KERA 3FU3A 2I7OA 3LRSB 4EVNA 3KHDA 5E0KA 4EWND 3OU8A 4R84A 4NXKA 1QSEA 3KPMB 5ANHA 4Q4SA 3BRGC 4R0LB 3PPFA 5FA5A 3IN2A 4X9SA 3L3KA 3MNZB 4Z2KA 3ARFB 3V6FB 2OSLB 4MYWB 3MOAL 4DTGL 4OTKA 3FGCA 2C4XA 1QO3A 4JPQA 5EZOL 2EDFA 5I1JH 4R96A 4N28A 5IQ7L 3P2TA 1PZUB 1K4CA 3RB5A 5AQ0A 1DQML 2L7EA 5FGCE 4YXKL 2FQDA 3EA3A 2DQWA 1HHIB 3GZOA 3E5PA 4BZ1L 3ARRA 5IB2A 4OCYH 5E1AA 1U36A 4B5XA 2MKWA 3NJMA 2G3MA 3UGVA 3JVGA 3QJFB 2P8MB 1XKJA 2WBXA 1JRHH 2PCXA 2MH4A 3GTFA 4FP8H 2CNYA 4TSAL 3MUGA 4QHKI 3WQEA 2GDVA 4FRWA 5GNYA 4LCIL 2WOQA 2FTPA 2IBZX 4FXGB 4H00A 3M6DA 4LVDA 1KYFA 5ERWA 4WQOA 1RQEA 3G04B 3PJNA 2AJSL 3WTXA 3VXMB 5BZDA 1VA9A 5JHDB 1Q8AA 5SWZE 1F3TA 3IIXA 3IJ9A 3D4GA 2VR5A 3APTA 4PYGA 2P5WB 2CDEA 3S6DA 1RBLA 3ZJAA 2ZYIA 1ZIBA 2V7NA 3LV3B 5I6NA 1JQXA 3SQOH 2K6YA 4ZUSB 1EEPA 2KL6A 3DUHA 1T1WB 5HWNA 2DBLL 1J05B 4JZNB 2IDUA 2IPKB 4XD5A 5B1JA 2Y3NA 3EYSH 5CBEB 2Q8BL 2O61A 1H7XA 5AYIA 4MASA 3TZFA 3WIFB 1ZBKA 5DJDB 2VC2L 5ALCL 4F7MA 4UB9A 3VD3A 4MDIA 3BVTA 4AVIA 1EAOA 1H7PA 3EZ4A 4FTVA 3U2ZA 3VCCA 1NPNA 4X0NA 2CLEA 5F3BA 1R3HB 5FX3A 3KCOA 1B3ZA 3NL5A 3WLWD 1V7YA 3WEZA 3OGOE 1WLHA 1TQUA 3ELFA 5DMYA 4HF5L 4WFED 3G22A 1LE9B 3K6NA 5D7KD 5ECVA 4Z77A 3GK8H 2B0SL 2A7BA 4WKXA 1CXLA 3I3BA 2YAPA 1U30A 5IMOB 4DZHA 3HS0C 2C16A 2MCPH 3FQ1A 1SJHB 1F58H 3FQRB 4F7PA 4MA3B 2BERA 1FP8A 4JRWA 2BVPA 4Y4KB 3HPAA 4MG4A 3VKCA 4QGYA 1CVSC 2QVKA 3C12A 5CP3A 2IBZY 4AITA 1YG9A 4DX3A 2V2WB 3GO1L 3ITGA 4JVWA 4KJWC 3RTQB 4Y1AE 2VUKA 4GK8A 3KXFB 3QZPA 4JHVA 3BPOB 1SW0A 4BI5A 4NCC2 2ZWNA 1A5UA 2GOUA 1PQZB 4EZMA 2BP1A 4IFRA 5FKPA 2ADGB 4Z7WA 2W66A 4AV0A 3CAFA 3NG5A 3IS4A 3KRUA 3F5WB 5F89A 2QVIA 7PTDA 2QDEA 3DH7A 3ITLA 1MFAL 1FGNH 3P3RA 4MD4A 2R2HA 3UIYA 2Q3XA 3NTYA 1WFMA 4YJ5A 3ESNA 4Z9KB 4ERAA 4TV5A 3VE7A 2OT0A 5IB5B 4XMTA 3EX4A 3DKJA 4EXPX 3SW6A 5AOJA 3RF9A 2NNAB 5JW4R 3QAZC 4IBZA 3VIOA 5EMMA 4AFYA 4U1KA 4OUUA 3FZUD 4FFYA 1GHSA 4M3JA 3OOQA 2B14A 3BOXA 4L6OA 4LP8A 4KC3B 4CJ0A 4JEJA 2PO6B 3V6ZA 4JR5A 4TO8A 2DTSA 5BZWA 5EO0B 3Q1SH 4GUFA 2JI1A 1V8EA 1CXKA 2G5BA 4GNVA 3KDMB 2D2GA 2YSSA 6REQA 2WJDA 2BVOA 1NCCH 3MGTA 1A3LH 3WEXA 3VRJB 4J27A 2Z6IA 4I0CC 3EADA 4L2YA 4ZEPA 1VGKA 3KYOA 2PCQA 3V5KA 1WCQA 3IGAA 4G7EA 3UCDA 5GIRB 4NP7A 5CSZA 3ZLQC 5CD3B 3B2XA 3K0YA 3VXRE 5JOFB 3PAUA 2A2QT 3DIPA 4NC0B 1H8NA 2OJEB 1BXVA 3K5RA 4FQ2H 4QRQB 2FVMA 1NGYA 4A6YA 4X83A 5J57B 5E8EB 2XT1B 2R2BB 2CBIA 2OMTA 4NNYA 1G6CA 2ICWA 1X5JA 3RITA 3BE1L 4R2GC 4G2DA 3ZYOA 2D20A 1EDGA 3SYCA 1FH7A 2YEZB 2XZQL 4ZFGH 1RVKA 2OZNA 3STEA 2GT9A 1PCKA 2JCCF 1GQKA 4Z0SA 1ME9A 4GACA 3OMNB 1LQ0A 5LSMA 2OJZL 3ZQWA 3HE7A 4EBQH 5A2AA 3MRGB 5FJPA 5DRXB 2J21A 4REQB 4W9GC 3QSRA 3AY4A 4F58H 2VLRE 2HN7B 2ZICA 4OM0L 4WIWA 1WK0A 1BQGA 5I76B 4JNZA 4R4BA 2J1WA 5BXSA 1BD2A 2FD6L 4YHNB 4JFFE 2MTPA 3F7YA 2RDXA 2Y72A 4KK8D 5CZRA 2VX7A 4WTQA 2HS6A 3DBXB 2ZTJA 2D9CA 1FA4A 3ARBD 1UUSA 1I1AA 2ZP9A 3WO4C 3RDTC 2ZUQC 4M8QA 5DFTA 1S3KH 4D9PA 3MLVH 3UF9A 1FFPB 2YCEA 2OKTA 1UXWB 2CG9X 1GSKA 3LM7A 1XGTB 1EYEA 1W3NA 3CZJA 1Q9WB 5DMNA 3EG9A 4R4ND 1RY8A 2IV8A 4HIEB 3KRZA 4GBXA 4CVZA 3KPLA 3TBYA 3RFAA 4Z08A 4P3DB 4HGKC 1FG2B 4IMFA 2X12A 3X12A 5K9DA 2W95A 3NA9L 3WK0A 4U1JB 1FF5A 2EE6A 3S5LA 5AKQA 4M5YL 3AFBA 1G6RL 4P5MB 2E4FA 4N9GB 2NZ9C 4XX1G 2MQCA 3RL2A 5IB1B 2GFBA 3WFLA 3T1FA 4IU2B 5IG7A 4FFZH 4GT0A 3O9WD 4IOSD 3RNKB 2EDOA 3G9AB 4L4JA 4XTRC 1KBGH 5DY2A 4GKZB 2DPEA 1XYMA 3B04A 5LCVL 3US1A 1KJ3H 2ABBA 4HWEH 2VUOA 5FUZL 4PJCB 4QF1B 1OM9A 1MRFH 1YIXA 3SE4C 3BTNA 4WDIA 1TJMA 3CO8A 2IH8A 3V0HA 4JEQA 1J0KA 1T6MA 2JLPA 1E6RA 3QUKB 5A8QA 4F91B 4ZUVA 4KTDL 1L2QA 1HHJB 5DU7A 5D2NA 5DQPA 1RZKH 1Q85A 2JJVA 5E8NB 2DLFL 3DPBA 1HE7A 3ZT6A 3QFDB 3SOTA 4UR7A 1V6VA 4HAGA 4JRXB 4JFHE 4Z1DA 3UZEA 5XINA 4M43L 4ZVJA 4HPYL 4G9FE 4TLKA 1MRCH 1L9TA 3GLCA 4OFCA 2BO0A 3O4OB 4QMEA 4UINH 4C6NA 4AGMA 2DQXA 1RA0A 1US3A 3TS8A 2NX5D 4Y16C 2YXGA 1CFBA 2LTQB 1JPMA 4MNLA 1T4KA 2BZDA 2FH6A 1UD4A 1E9PB 3FRUB 2A6DA 3W0WE 5AL0A 2ZZ6A 2C9RA 4IRZA 3TX9A 5D33A 4KKBD 4QCFA 2XZ9A 4XVSL 5EO1A 3VE0A 3EFOB 4CNIB 2VEKA 3GHRA 5E6UB 4GG9A 1YA5A 3JV5A 1KM1A 2AGJH 1JGUH 3UJFA 3BGMA 3LKSB 4O1DA 4KXZH 4GKSA 1RK5A 3VXTA 3MJMA 5MERA 3STFA 5T5NG 1BTMA 4CMMB 2AANA 3NDYE 4KXBA 5I6OA 4QRPB 2RACA 1TU2B 4PJDB 5E5CA 4YTSA 3VFPA 4N8PA 4GG6F 3P11H 1BF6A 3L4WA 4PJHE 4TRPL 1W1A1 2FYVA 3GS6A 4Y5VA 3FB7A 3H2EA 3A6OA 4I48A 1U92A 4BIKA 4L9YA 5D1XC 2VCCA 1H3WM 2XIBA 4JFQA 3VFSB 2Z25A 4G59C 4Y2DC 2GC7C 3VFUA 3T6CA 1SZNA 3ESUF 1KB5L 1FZJB 5DFWH 1DLHA 3LSCA 4Y2NA 1IUZA 2O6DA 3NCBB 1A5NC 4XPGH 3M9YA 1TZ9A 3LI1A 5ICUA 2NXZD 3M7FB 1ROWA 3TSDA 3V5DA 1YEHH 1KIPB 3FO0L 3C9NA 2OCCB 3REVB 4JFZL 2XNAA 1CLYL 3RRQA 5HUPA 2RCSL 1N59A 3OSVA 4KAQH 2DP3A 3NQ7A 3QFJA 5CHNB 4ZPTB 2OW6A 4BZ2A 1I7RB 4Q33A 2UZIH 5A2CA 3ILEA 4DKFL 4OI8A 1PTDA 2XSXA 3BWUF 2JQAA 2GVGA 3W9DA 3T0AA 3H70A 1CYWA 1U1JA 3N41B 1CLKA 4B16A 2Y7NA 5D04C 3NIGE 2JKAA 1LEIB 3CN0A 3CU7A 2NY5H 3WGVB 3UTPD 2IQTA 4OQVA 5DGQA 1OAKL 4OFYD 4WI4A 4OD3L 2CDFA 1ET8A 1IGFH 3HZ3A 4F37K 3V52H 1XDLA 4UQ2A 5D70L 3KE0A 3QMRA 1S3HA 3BQUA 3BUPA 4N2BA 5C0AE 5HGDA 4XO3A 4CCCA 2F6XA 1YKWA 1IGML 1ES0B 5L4IA 4WW2A 5DUJA 3HN8A 3FX4A 2OMVB 3A5VA 2CUMA 3TJPA 1MHHA 1OT4A 3E3HA 4NO3B 3S2MA 3FNDA 3WUWA 1VPOL 2X2UA 3VTAA 3N2MA 3G5YB 2OYLA 2HXTA 4CMHC 4PI2A 3EO1A 4A21A 3X13B 1HL8A 3U9IA 4NP4H 1QSFB 3IYLW 1O5QA 5C8JB 4LCSA 5DJCB 3QG6A 1CTMA 3ABMB 3N19B 4PJCF 3EKCA 3CHXA 3GI9L 4M48L 3FO2A 4XVTH 3DFHA 2QJIA 3H85A 3UWYA 3BW9B 5BS0B 4HPOH 1KEML 1UM6H 3ZWTA 4ONGL 2PFHA 3GMLA 1BLIA 1P9MC 5F3FA 4JKMA 2QCDB 3WDIA 2MHAA 1MO0A 1LO5B 3SFKA 4TVDA 4S1RL 2X2HA 1O5DT 3W24A 5DCDA 4MFEA 2ZOOA 3QCVH 5C9ZA 3L3GA 3CSTA 1CECA 2PA6A 4M24A 4KO5A 4BV1A 2WWNA 3LHAA 1PEZA 3W2KA 1AQ0A 3I6GA 2QQKH 2ZQ0A 4UU9B 4NPYB 5JIIA 3UEZA 3TO2A 4NZJA 3UDWA 2VXTH 2DSVA 3S3SA 1GA2A 1FDLL 2E6PA 3M8OL 2PW1A 3IGLA 1PWMA 1BYNA 3ZLFA 1X5HA 3SUTA 4AY7A 2E9GA 3E1ZA 1D9KC 3HTLX 3C8HA 5KS9E 4L4VE 4IP7A 2O5NA 1FHVA 5HGHA 1BVOA 3N4EA 4DO7A 2QLVB 1JDCA 1G7HA 3OM3B 1Z8AA 2Q09A 4I6KA 3W29A 1I3VA 2F74A 4LLQB 3F2CA 5ISZA 4J8QA 2VD8A 9XIAA 4S1QH 5DWPA 3QEUB 1BWVA 3DFQA 1ZTXL 1U83A 4AK2A 3H3BC 1TFHA 4LCWB 3STLB 2RHEA 3GZKA 4FFVC 4QAWA 4PJDF 5L2KB 2GUYA 2CRYA 3QNZA 1RU9L 3MNVA 3QAZB 2NY5C 3TESA 3DRQA 3VINA 1YBQB 4UNUA 1EP3A 1XIFA 3NL6A 5C0JA 1DN0A 5K39B 4XNQB 3RHGA 4TMBA 2OXHA 3NVQA 4Q4KA 4Q58C 2DF3A 1A0QL 1FHLA 1O0VA 5LAPA 1YMMD 4FABL 5HDBB 2RD0A 3O4LD 2ITFA 5GRJH 1L8PA 3PIQA 3FU7A 5F21B 5HHOE 1GGCH 1FRBA 2BSSA 2WLIA 2EACA 3QWNA 2XWDA 2DIKA 2FWLB 1NAMB 1G7PA 4JMNA 2A0LC 2NUTA 4NZ5A 5C07B 4OM1L 2VGIA 1P2CA 3BKML 1JYVA 3GMOB 1GONA 4LARH 4FCAA 3NIFE 2DZEA 1PG7X 3V4BA 3Q1EA 2ZUXA 1A0CA 1CE6A 5GJMA 3MRHA 2YB4A 4OLEA 2FTAA 1GZHA 2FWUA 3P40A 5MI0C 3FSVA 4OLWH 1Q66A 5HAOA 3LKQB 4IFKA 1NINA 1EUNA 4MXQD 3TWCH 3EPNA 4L9LA 3KDOA 2CO6B 5EUOA 3N41F 1SEQH 4R2GB 3VWKD 3WJJA 5IRPA 3DOHA 3WFZA 4O9HH 1XF1A 2DW7A 3W56A 3N25A 4O4YH 4C4UA 3M1BA 3TYBA 4P2OD 4I0PA 2WMKA 3L1EA 3R1GH 1X44A 1MVFA 3FUMA 4AJVA 1OAZH 1V0MA 3SHSA 2ZVIA 3AUVA 3RO8A 1ADWA 1ZTXE 2FTWA 3P9WB 1E1CB 1N8WA 4G8FB 1GC1C 3ARUA 1R1CA 4HCIA 5T1JA 3TYGL 1ECEA 2CZDA 3M5XA 4J2QA 4PJEA 4KI1A 3FT2A 1X8CA 1SVZA 3SQBB 1DDTA 3RO6A 1GOIA 4BF5A 1XM3A 5DLMH 1Z5HA 5EC2B 3DHJA 3WLTA 4AW7A 1B0RB 5TQ0H 2XA8L 1JXFA 1QI3A 5EBMB 3WO4B 3E6FB 3RDTB 1W56A 2W1NA 2ZUQB 4N22A 3D12B 2C9XA 1TSHA 3UAAA 4OB5L 1DFXA 5HDQH 1IAIL 4Y8EA 2ZP0T 4LJ3A 1XISA 1RD6A 4KHTL 3CIAA 1TTUA 3FN0H 3KPRD 3C6LB 4S3GA 3L2NA 1NLBH 3O6MH 3G1XA 3ARGC 2D3VA 4YGVA 5D2LA 4A1RA 3U46A 2J7EA 4QP0A 3OWRA 1ZT4B 4KJPD 1WAAF 3NA4A 4PJFE 3FSAA 3UTZB 1A2YB 1UG6A 5I8OL 1JMZA 1WFUA 3H8NA 2B4GA 5AOKA 2IG2H 3L08A 4AYSA 1K77A 2DMKA 1CS6A 3F12A 4JDVB 5BVJA 4JZJA 3E6EA 2VM9A 3B0XA 1WQVT 1H3GA 3DG7A 3BVUA 4KKLD 3URBA 3NSCA 1QR4A 4I4WA 2C3ZA 2EG6A 4AL8H 3TJ4A 1KRMA 3E0FA 5HI3C 3WEMA 4CDHA 4ZB0A 1D8WA 3WF1A 2IALB 4FNLL 1T1ZB 4RDQF 1LO3H 1AXIB 3IRSA 4UMCA 4NRYB 1E2WA 3LEYL 3WJMB 4M7LL 4IUOA 3L3JA 2QKSA 3UBFA 3G3LA 2OMXA 3T6VA 3QRFM 1ZV2A 3N55A 4ZUTA 5CSYA 2Y85A 5U4NA 1EQPA 2GCYA 5I8CB 3T0EC 3ATFA 4Y4FA 5CP7A 1L6ZA 2DI9A 4RAUB 5FAGA 4HLJA 3GSNL 3L4VA 2CBUA 3ENEA 4KZ0A 3U6RB 4KDTC 3IJYA 4HXBL 3GX9A 5EEZA 2J88L 4L3EB 1MUJB 3AI0A 3L65A 3U4EB 3TZNA 1FUNA 4Q6XA 1W72B 4OF5A 1SYTA 3VOCA 4XNXL 5HDBF 5INDA 1FWRA 3RPIA 4AEIH 3HCVB 2B4CH 4ML4A 5DVNA 1E6PA 43C9A 1EHNA 3UL4A 2EDTA 3UYOD 1WS7A 4BA8A 4NKCA 3ATDA 3NJIA 4LH8A 3JRKA 4IMAA 1FL3B 2R8SH 1B88A 3GMQA 4Z3EA 4G6CA 1NDVA 1KXVC 5LO7A 3CE1A 3SBPA 5EA0L 1NCDL 4O5LL 4FQJH 4G43B 1ZV9A 5BZZA 3HOGA 5D1XB 1KIQB 1W2VA 1PSKL 1HL5A 1UOVA 1YEEH 4NSKA 4Y2DB 1R38A 3PUCA 1FNEA 2Q76B 3ILQD 1VEPA 4LLYB 1G84A 4JDEB 1HK6A 3P0WA 3SBFA 4HWZB 5I18L 1I9IL 1P7BA 5DXWA 3LKOB 4FS9A 4IPIA 2ATKB 2XTSA 3PWUB 4RSVA 1TJ2A 1ZMYA 3LTSA 5JH1A 5I8KH 2EJAA 1S38A 1ITXA 3ARVA 3IDYC 4Q6YA 3FHEA 3SY5A 1QPQA 2CJSA 2NDFA 4B5EA 3AOFA 3QNXA 4WXYA 3HHSB 4PUEA 2IH1B 4PB5A 4PV8A 3BFQG 2YBTA 3ESOA 1EF2A 1JTTA 3CQ0A 1K4HA 3H42L 5T8IA 4HU0A 2IH3B 3TASA 2AGKA 4EF9A 1LMIA 5KBNC 2Z2BA 2WQ8A 5I1HL 3CHPA 2IUZA 1E4XH 4DPCX 3D2TA 1R19A 2QPXA 1P4LB 4EPEC 3PM6A 2LLLA 3ME3A 3ZHNA 5CUSH 1ADQA 4LIQL 3P2BA 5JOEA 3TVMA 4JY9A 2O9RA 4NUGL 2VLLA 4S39A 3T5WA 1Q9OB 1NCNA 1BCIA 1UG9A 4H6QA 1JGEA 1XR9A 2AV7A 3S4SA 4XXWA 2P8LA 1Y5XA 5D7LA 4G8GD 3DIFA 2BSDA 3SGUA 1MCWW 3CLEH 3BSGA 4A38A 5CAYB 5KVGH 4JQAA 5I0ZA 1DQTA 1FFTB 2DH3A 3LENA 2E6JA 4Q6KA 3GSRB 1FYTB 2K6ZA 1XBDA 1IEQA 1HEZB 1XLGA 2PEVA 3OR6B 3QDJE 4BS0A 1VS1A 2YRZA 1R3QA 2QQLH 4A55A 2ZRZA 1R3WA 3S36L 4E41A 5MP6L 3IFOB 2WVUA 4R8WL 4CMHB 1E6JH 3W11C 2FJHA 4I9WD 5LBSL 3T4YB 1TMCB 3KLHC 1NDMA 3UZVA 2HX7A 3WH7A 2BVQA 4WTWA 2CNCA 4GBDA 4B9IA 3VJ6A 1GTEA 4UTAH 4LASL 4I9XA 4QDGA 4X9GA 3LB6D 3T55A 3A6BL 5ID0A 5TDOB 3HG1A 3TA6A 5D7JC 5U7SA 5I19L 3QR0A 1TG7A 1SUXA 4Y2OA 3O2VH 3ZZ1A 3GRBA 1WT5A 5D71H 1ZVYA 3B5HA 4MHHI 3QUMA 1U58B 2OK0H 2Z2UA 5BMXA 4PJ5B 2Z91B 3RR1A 3K2IA 1NEZG 3PBMA 3GIPA 3ABQA 1KTRL 5DEGA 2Z1BA 4GXWA 4OZFB 3MRIA 5BPPA 1IIKA 2FZ3A 3PDDA 3M88A 3RG6A 3TU6A 2FL5B 4L8BB 4JYEA 3H7LA 2Y07L 4LIQE 2ZJSL 1D9KB 2W6RA 2J20A 3RUGE 3MREA 3USZA 3ETSA 4TUKH 3SBWC 1KY6A 1KTLA 5EF0A 1K2DA 2OL3L 1NAKL 1VFBB 5AB9A 2A83A 4H9UA 2P49B 4YH6A 2GQ3A 3RIAK 1YNQA 2MEJB 4MNQA 5KYUA 3ZGHA 4QKXB 4Y4KC 2IXQA 2X5PA 2RB8A 5TQ2H 3IPWA 3PZIA 2QBWA 2Z1VA 2VJ0A 3CQFA 4D9QD 4YHLL 5TH2A 5F1SA 3RTQC 2GWNA 5I1IH 2IXVA 1K03A 4ZS6D 2X8RA 4TUJB 1V79A 4C5YA 4FNRA 1KACB 3ABLB 3DX6B 1USZA 3MGOB 1IF2A 4GRMB 4QEGA 2YL5A 4HEMA 5IBUB 1HX0A 3FH5A 4F33A 3ECBA 4AYGA 4FD0A 1INEL 5ANME 1GKRA 3CH8A 3L67A 3N2BA 1CFTB 3HJEA 2R59A 2QHRH 3EJZC 2VISA 1OIOA 5HPOA 4LKCA 3MHZA 1TTFA 1UA7A 5CGBA 4I1NB 3REWA 3ZJ7A 3SYQA 1E6OL 1E28B 3T9WA 4TSCH 3OPZL 3ZE1E 1VDGA 5IHZB 1KJ2A 2Y7GA 4WSHA 1IVTA 4K36A 3VXPB 2ZCZA 5LIKX 5HI5D 4DAGL 5F7AA 5F7EH 4XMKH 2EDXA 2EIKB 5MI0B 3G6JB 1IT8A 2QSTA 2F08A 3CV7A 5KWYC 5A8NA 4P7RA 4JFYB 1IEIA 2P3EA 2G95A 2OMZA 3QE5A 1FA2A 2IKGA 1K8ZA 2ED6A 4XNDA 5IOPB 3MSRA 2Q01A 4K8EA 2OP4L 5FHBL 1AR2A 4PG2A 5E5MA 5LXGH 5IGXH 1UZHA 1PZ5A 1ZOXA 3GNRA 3FUFA 2H3NB 1CDUA 3QXAB 3D07A 3BWWA 5HBFA 3IIVA 3IMWA 15C8L 3FQNB 4JPSA 3ZVHA 3PV6B 2ZYFA 1F0LA 3PHAA 3LKRA 4EUPB 1AYRA 4MA7L 1VFOA 4U6HB 4HH9B 3SQSA 4ZMXA 2BMKA 1KFKA 1ZE3C 4YSPA 3TH4T 2NV1A 4L64A 4N2LA 2M1KA 2Y6SD 4MXVF 5AD0B 4OVUA 4P4RB 1Y65A 2GSGA 3IVKB 4Y19B 1UWGH 4UTHA 4UB0L 3LTYA 4CQDA 3QEHA 5ESQA 2G50A 4K55A 1Y0EA 1ZSXA 2W63A 1W8SA 4PJIA 4JTAA 2LLEA 4QCEA 3DX2A 3MRDB 4N6EA 1QEXA 1VZGA 1YY8B 4JIQA 1XL4A 5LBVA 1MNUH 4HALA 2J13A 2G37A 3GM8A 1NDTA 5KZDA 1IZJA 2QFRA 2H3KA 2QEJA 3U0HA 4S3AA 3QEGH 1FFRA 1TV2A 2JB6A 2W4XA 3FFDA 4G8TA 3ARGB 8PAZA 3CZGA 6ENLA 2HLFD 1T1YA 3NCYS 3UADA 4NFBA 1RH8A 1KCUH 2C0AA 4EDXB 2PCEA 2P24A 4F8OA 4XI5C 4E0RA 2J6EH 3I6SA 1BWKA 2VDOL 4XHQA 1UBPC 4ZENA 3RX4A 3LH2H 4PZVA 4H8HA 2X1WL 4TN9A 4PS8A 2ATPA 3GC3A 4MMZA 4YZFE 2X89D 1UR4A 2XBZA 2DWYA 3PSWA 4W81A 4BFIB 1TNMA 4NQXB 3SGKC 3K2GA 4ZSTA 1HWWA 1CF8L 4L3AA 1NOWA 4D8PB 3SE8H 2YOAA 4N6RA 4PD4K 4M6NL 5DMMA 1XCTB 3FSUA 3FB6A 4BHYA 5LIYX 3GPSA 5K33A 4KZDH 5GHWH 4UQCA 1HNGA 4DBUA 5AVYB 1MFUA 2GW5A 1S5MA 1QYGL 4O58H 4PJ7A 3LZFL 2E67A 3W88A 5J6HB 1OCRB 3HVNA 4HNCA 4RRPG 3LNHA 3QARA 1JCYA 1TE1A 4BE6A 2EINB 3NZGA 3FYYA 2VDIA 1KM3A 1TMHA 3KPSA 4LSBA 2R69H 4PJXE 1EFQA 4PGEB 4ZMTA 4OLVL 5I2IB 3BQ5A 4X98A 3SGJA 1A6PA 4QXWA 3GJFB 2PE4A 3H2WA 3X1EA 1S7TA 4N6FA 1GVFA 1CWVA 3JZYA 3GDLA 3FAXA 4ADGA 2ZXEB 3L5LA 3VTMA 4WI3A 3AXHA 2XVBA 1O6SB 4NZCA 3I85A 3SDXB 4Z3HA 1SGJA 1IFHL 3BG5A 5I3KA 2POTA 1OT2A 1ISYA 1ELSA 2DSWA 4KMTH 4L1HA 3ZZLA 4WK2B 5E8OB 3OXRB 1KZYA 2AJ3B 3N6YA 1JRCA 2XWEA 2D7QA 1C5BH 1TPXC 4OWGA 4MJIB 2F7OA 1UUMA 1YSOA 3OKYA 1XXDC 3RILA 1KXHA 1Y6KR 4LSPH 4C57C 4C1LA 1DQQA 3BH9A 5D2YA 5JUVA 2FQEA 5TDPA 3SGGA 2X6MA 4GRLA 1CK0H 2LTQC 1MJUL 4JHUA 2Y6ZA 2QMKA 1NIDA 2P8PB 4UCGA 1XB3A 2DIJA 4N2IA 3CZLA 2IXUA 2VI0A 1KELL 1NWRA 4JHOA 3WBEA 4PRPB 4M1DH 3MLRL 2ZZ1A 4ERIA 2HSAA 2Q71A 3S4TA 4IJRA 2MRYA 1U95A 2NT1A 3US9A 1I2NA 5H2ZA 4ZE5A 3A9IA 2QV5A 4MXWH 3MO7A 2D2OA 3F7RA 3BIAX 1YECH 3IDYB 4QNPF 4UT9L 2X30A 4LKXB 1FCUA 4HG4K 2H5UA 3S98A 3O41A 3IBEA 1IGTA 3W3OA 4XT1C 4YVNA 1A6TB 4GQ9L 2G3IA 1GW9A 3HB3D 4OF3A 4ZX5A 1NBYB 4YBHA 1J6OA 3RWIB 1DQDH 3MHGA 3DJ9A 5I71B 1RUQL 4YN5A 4PTVA 5C2BH 1XLHA 5E56A 2CHZA 1XSJA 1ADSA 3OL2A 2EIZA 5BXPA 1UA6L 1NWSA 1GNXA 4YSTA 1TJIL 1MREH 4KH2A 5CWSA 1MCLA 2ZG3A 5F88B 2PDLA 1AP2A 1JZIA 1AC6A 1AQHA 2HTLC 3LQMA 5GZNA 4I2XE 3GVGA 2VSCA 3MACL 1HXKA 1VJIA 3T3MB 2VLKB 3TTOA 3O0KA 4X0KA 4O19A 1NOUA 1RZJL 3KD4A 3H23A 5CPMA 1D7KA 3CPLB 3V4VA 3DJZA 3KLAB 5HHMD 4MWAB 3SM0A 3CFTA 2E5BA 1TREA 1BBDL 1JGLH 2NY1C 1HYSD 2XG4B 4LALA 1DQVA 4P9HC 1VZIA 1DR9A 3VKKA 1D7BA 5DZOA 2H3BA 4NQSB 3FT4B 3EOYG 1PFOA 3QJRB 4W7UA 2ICES 1ZP4A 4QGTA 2D73A 1QOPA 3L95B 2ZKMX 3LS4H 1R2RA 2A4ZA 4H6RA 4YVUA 1SFDA 4DVRL 4FKKA 1NGQL 2YX0A 1E3FA 1IKFH 4N2OA 3V6OC 2JCCB 5FHAL 3PNZA 2YBGA 4NYYA 4C6LA 3NFSH 2BHUA 3WQ4A 1IV8A 1OF6A 3QDMD 4WWPA 1QNZH 4TPRL 1MN4A 3W82A 5IW6A 2AVFA 1KTDB 3B34A 1M1XA 3IMSA 2CR6A 4KZCA 2ZUNA 2IPTH 4OJFH 4U1HA 3GXUB 3UG3A 2DEPA 5D7JB 4NYLB 2GKIA 2NX5E 5FACA 1NAMH 2YK1H 5LNRA 1JPSL 4GVHA 2NY6D 1DLFH 5MHSD 4UYQA 3OXSB 3NCFB 1X4ZA 3P61A 2NY3C 2H6RA 4R85A 1G7JB 2AJYH 3FOLB 1A6WH 1MFDH 3M1CA 1C12B 4C56A 1V7AA 2V5TA 1KYOJ 2FGWH 4PODA 3FT9A 2YXXA 4XGZB 2YSWA 4C7GA 3TJHC 4RGNB 3OAZK 4OJYA 1KR0A 2VM3A 1YPFA 4PY8J 3SDXF 1SFHA 1MCOL 1GHFL 1AS8A 5ABTA 1L6WA 2MQ3A 4PB4A 3NFUA 1UWRA 2YPVH 3M1OA 1IGIL 4LGXA 2E3VA 3PHOB 1NJ9B 4X0VA 2C7UA 1XLFA 3T2NH 4L1BA 2A9CA 3FS2A 4UT6H 1E5BA 2XHYA 3DYPA 1IGCH 1NBZB 4GXMA 1KYAA 1WEJL 1DVTA 3D9AL 1TPVA 1OQXA 4LFHD 5AHIA 3COTA 5ILTL 3EWDA 2APSA 2ZX6A 3WKQA 5HJBA 4YAQB 1XCQB 3LCHA 2VURA 3GB6A 1DWAM 1NFAA 4NENB 4DKDC 4HISA 1VHCA 5B3JE 4PTWA 3IJEB 2E9WA 3VXSB 1SGKA 3RVTD 2R56L 1Q0EA 3TFKC 3FJ4A 1L9QA 4MKSA 3KYAA 3ZKQD 2EXWC 2APVA 2J5LC 5FOJA 4JDTL 5IFHH 1DQXA 5DA4A 1DO6A 3IACA 5RUBA 1IAMA 4D6HA 2PTUA 2XH2A 4NHUB 1J5HA 4Z0XA 1S9VB 1XBVA 3Q3GA 1B5TA 2IQ9H 5FYJD 1WWBX 4XBEH 4IPPA 1EWHA 2HG0A 3GIYA 4MJ5A 2W07B 5IFJB 3K0WA 3AMKA 1TEGA 4KOBA 1FJ1B 4TM9A 2H2SC 3ATAA 3UTPE 1JHKH 1OG6A 4NKOB 3VVGA 2XTKA 4HCRL 1KPRB 2FATL 1T6VN 2VC5A 3TJIA 1EBGA 5BZAA 1X96A 1HILA 4DF9A 1RALA 3MRQB 2VMFA 1CYGA 3TCTA 1F4HA 1DHKA 4IMLB 5GISL 2H8PB 4L48A 4D0DA 1D5BB 5FW8A 4Z17A 3ESPA 4HIJA 4ACZA 1A5FL 2HH0L 3OKDB 4S1DD 3XINA 2HRGA 3D48R 2UWEA 3MWCA 3EYQD 1EO8H 3HLAB 4GG6B 2YBUA 2FB3A 1OXYA 1KR1A 3D18B 3T3MF 2OLAA 1GPOL 4PRDA 3H9HB 5AVVB 4R4FH 1NKRA 2ZG1A 1QSED 3UAJC 4GP4B 2DI7A 2HYMA 3FXIC 3VI4A 1AFVH 1QWKA 3CUPA 3G5ZB 3MCKB 2LLNA 4PRWA 4K5OA 1HKIA 2BSTA 1UD3A 1NF0A 4AZGA 4OIBA 2HWGA 1Q94B 2WXQA 3MCYA 1VBUA 4W68A 2XV0A 4XISA 1V3HA 1XLKA 4XD4A 5EUKB 4NNPL 4DWDA 4LCCC 4AXWB 1HOEA 4FZEH 2VDLL 3PQYB 3QS3A 5DO8A 1HQRA 4AH2B 1JGVH 2VITB 1GPFA 3BIKB 2XISA 4AHQA 3LMJL 1XIWA 4MSWB 3DI2B 4P2RB 1W72H 1QRNB 4B9GA 3BUQA 2P3ZA 4HZLB 3C6SA 3NL2A 7XIMA 3HRZB 5JXAH 2AQTA 1DVFA 3LNMA 2PETA 1A5OC 3B9KC 5T1MB 4U5IA 1VJZA 4XN4A 3TIEA 3S6CA 1XGPB 2OQLA 3KWWA 2X0VA 1PCWA 2AAAA 2V9QA 1Z3RA 2PDFA 2CLMA 3S47A 3IDMB 5DMGD 1KPUA 3D0VB 5AVTB 5JHLL 2R23A 3B8SA 2XETA 4U7MA 1N3NB 4A2RA 1OSZB 1J5DA 4BCYA 3AIEA 3V0GA 1JNNH 4MD5A 4JOMA 1CJYA 3BXNB 1YQVL 4TX8A 4ORGA 3MUCA 3SB0A 4K7FA 3EX1A 3TPUB 3BSHA 3KWSA 1L6XA 4M00A 4PTUB 1QPKA 1CZ8L 1JUKA 4M7TA 1GWJA 2H0EA 1GYMA 1H50A 1IIHA 3LHPL 3C6LC 1HXYB 2EBNA 3FCBA 3LV6A 3MXWL 3QIBC 1VEMA 2LU5A 4NLAA 4G8EA 1RJLA 1FKXA 3KPPB 3HZYB 4KV5F 3GUWA 2B08A 3RVVC 1AGDB 2H9AA 4ZGYA 1JK8A 3D34A 4C1KA 4FTVD 1NGWB 5AVUB 1SJBA 2Y5SA 2OULB 3UJJH 2BSRB 1YDNA 4E9XA 4IIEA 4JG9A 1YMME 4MNGA 3IIPA 1XG4A 4IP5A 4JBRA 3VRIA 5EZLA 2KQNA 1SUJA 3N04A 4M8UA 3QZWA 2VWSA 5CZVH 2GJZB 1F8TH 2DS4A 4PJ9A 4HJSA 4C6JA 3CHEA 4GUHA 4LSQH 3EYUH 3BVXA 3OD3A 4OV4A 3CFEB 2JEQA 2A4EA 4NWTL 1RERA 4HDIA 2J8UF 4AYDC 3FDGA 5DD0L 4YWGH 4XAGA 3G2GA 4X6BB 1H5BC 4V28A 3IGFA 1C16A 1W17A 1UJ3C 3FOKA 4MAZA 2AJVL 2YAQA 3UA4A 4ETQB 5F1VA 1U8LA 5EORH 1TPXB 3TPKA 2ZSVA 2ZCGA 3ETBF 1OJXA 1ONQB 3NABL 3NN8B 3KPOA 4Q8PA 1TLMA 4JFXA 2BOBA 4O2CB 4NO0A 4E42A 2A2IA 3SCSA 2WYIA 4WHTB 3TW7A 2JELL 2OZ4H 1M56B 2HMIC 2GIYA 3CFJA 4PMRA 4HETA 3FV9A 4FNSA 1RQHA 5DXYA 5DC9B 3CAQA 2VE6B 2V5RA 2N01B 3LSOB 4OUIA 5DJ8A 1ZALA 2HG5B 3MX0B 4XMZA 3O6KH 3PANA 3S0PA 1JZHA 3FA5A 2AEPH 2C7FA 3HFML 2BOCA 2F8QA 2IANB 5KOMC 2TSBA 4BFEA 3GGWA 2AQSA 3JWNG 1BG1A 3A3WA 4NM8H 4G9PA 3EFFB 3CK0L 3KYMB 2O5ZH 2DQHH 1XGEA 2ZA1A 4LP5A 4E5XG 5IDIA 3VB8A 4X6DB