3L2MA

X-ray crystallographic analysis of pig pancreatic alpha-amylase with alpha-cyclodextrin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGQDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystallographic analyses of pig pancreatic alpha-amylase with limit dextrin, oligosaccharide, and alpha-cyclodextrin.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l2mA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l2mA01
1VFFA 4UR9A 4D6IA 4NXKA 1FFRA 4E8DA 4J3TA 4CUCA 1OGGA 3A21A 1VFMA 2F18A 1V0LA 3QOKA 3AYRA 1W2VA 1EDQA 3VGDA 4UQAA 4AD5A 2JIEA 4AZBA 1QVBA 3FN9A 1UR1A 1LQ0A 2X1IA 3PZTA 4P7NA 3WELA 1J9YA 1PBGA 4UZSA 3O9NA 2WWDA 2YA1A 3F5KA 2WHKA 3EDEA 1QHPA 3EBVA 2VZSA 1ITCA 4H8HA 5E6ZA 3WNPA 3GBEA 1HJWA 3CHEA 4A4AA 3UR7A 3S6TA 4PMYA 4HZ6A 2XWDA 4BQ2A 1V0KA 1KFWA 3TA9A 2PWEA 3ARUA 2J25A 5A6JA 5IFPA 5BROA 1E6XM 2ZUWA 3OG2A 5AC4A 3POCA 4B16A 4Y7EA 3SCQA 4H8UA 1UWRA 5BYWA 4KMQA 3AMLA 1PEZA 3O6AA 1GCYA 2QPUA 2J78A 1LWHA 1E3XA 2D2OA 1WCGA 4FLRA 1KCKA 4JIEA 3CV5A 1BYDA 4DO6A 1CGTA 4H8VA 4LYQA 3WY4A 3AOFA 3TTYA 1R7AA 2WHMA 3WL0A 3RJXA 1C8QA 1Z32X 4AMCA 1T0OA 1CIUA 2WCGA 3CH9A 5D9NA 4OOZA 4D6HA 1QNSA 3VD5A 1DWHM 2F7RA 1LG1A 3ZM8A 4B9YA 3TV8A 1CYGA 2DSVA 3S5ZA 2DEPA 3FHQA 1UA3A 3VIOA 3LPFA 1LL4A 4PMZA 2VCCA 4TUFA 5AYBA 3WD4A 2YJQA 1GHSA 2AAAA 3W29A 3DX2A 2WC7A 1W3KA 3GH7A 3VGHA 1UR2A 3JUGA 2VZVA 4AISA 2XN0A 5ABFB 3PZMA 1HNYA 3BLBA 5ABFA 1O6IA 5AYIA 1AQ0A 2BV9A 5GNXA 2YDQA 1CDGA 4FNSA 2VQUA 5A6BA 4DUXA 3SEPA 3THCA 1VEMA 1RP8A 2EJ1A 4ATLA 5CG0A 3WIJA 6CGTA 1P6WA 2YDRA 3HG5A 3PZGA 1HKMA 3A22A 4UOZA 2XSAA 4HZ7A 1ZBKA 1TUXA 4W8LA 4MNMA 4QCFA 1BVZA 1E1EA 1G0CA 2A3AA 3WMCA 5TD4A 4KRUA 2QLYA 5M17A 4ZXLA 4H7VA 1YHTA 4Z2JA 5E0CA 2DSWA 3AIQA 1MXDA 2A3HA 4QCEA 3SCOA 1IZJA 4ZEPA 1OWQA 1NH6A 1G5AA 1BLIA 4PMQA 4FMVA 1TE1A 1HXJA 3VSVA 1UZ4A 1JF5A 1B3ZA 2Y2WA 4UZUA 2WNWA 4HMEA 3VOCA 5C8BB 1KGUA 4JKKA 3KWXA 1WZLA 3BAIA 1V6XA 3CZEA 3MKKA 2DT2A 5F7UA 3BVXA 3DC0A 2J77A 1V0MA 3G6LA 2IUZA 3QHNA 3BLPX 3SUTA 4F8XA 4D1JA 3WMBA 1XYZA 1CBGA 2PBOA 4OBSA 3AICA 2XIBA 1UOKA 1ITXA 1MYRA 2OSWA 2DSUA 3ARTA 1H0GA 3CHCA 2BHUA 1JDAA 5CXPA 3VSUA 2D23A 3L4YA 3B8SA 3MU7A 4IUGA 1B30A 2PWGA 2BFGA 4AY1A 1QPKA 1HP4A 3EDFA 2WSKA 1A3HA 1GQJA 3VMNA 1NQ6A 4IPLA 2NT0A 1UH4A 3SUVA 3G6MA 1JZ6A 2WHJA 2A3BA 2IXVA 1Q4NX 1LL7A 1QWUA 5CLTA 2VNCA 1E4MM 2CHOA 1V02A 3ARQA 3TP4A 2VCAA 1C3FA 1VF8A 1W1TA 3ZSTA 2EPKX 4JKLA 5CLWA 2BHYA 4GQRA 2XSBA 1HF6A 3U7BA 5E70A 3AISA 1MW1A 3WUGA 3A4AA 1KR1A 4E2OA 1QX1A 2X2HA 1C93A 3OGRA 4H04A 5I2UA 1TA3B 1C91A 3BAKA 3W38A 2VOTA 2WCAA 3LXBA 5BCAA 4AZ6A 1QBBA 2WXDM 4WKAA 4P7OA 4UFJA 5IDIA 1TVNA 1H49A 1WDQA 2XFFA 1W91A 4P8VA 3CPUA 3DYOA 1JDCA 4QLLA 5DEZA 3VO0A 1JZ4A 5A8NA 1QNRA 4S3JA 4WSKA 4E8CA 4WIWA 2DH3A 1GORA 3ZR6A 1WB0A 1TR1A 2CKRA 2EPNA 1OBAA 1W9BM 4U33A 1H5VA 2F2HA 1VJZA 3LX9A 2WZEA 1BAGA 1LLOA 1V3JA 1BVNP 1C8YA 1KXQA 3BAXA 2G41A 5A69A 1PS3A 3K1DA 2J7BA 2YL8A 2GJRA 1NWTA 1QHZA 4FLSA 3M46A 3PTKA 4KWUA 1WAWA 4HA4A 1H41A 3S2CA 1GOOA 2ZX6A 1DWAM 1KGXA 2V5CA 1QHOA 1BGGA 3AMCA 1MW3A 1KBBA 1W9UA 2GDUA 5I23A 2YBUA 3WH7A 1VEOA 1JI2A 3DECA 5E9AA 2XFRA 1GJWA 1FH7A 3QHOA 3TTQA 4GI6A 3NSNA 3W82A 3EMZA 3EDKA 2YL6A 1E5JA 8A3HA 2DPEA 4P7QA 4NRRA 3DYPA 4FNUA 4FK9A 4OZOA 5BWFA 1HTYA 1G01A 2Y8VA 3OLDA 1DTUA 4JFUA 3CBWA 3SUSA 3AIUA 3F5JA 4NZJA 2J8FA 4QLJA 3VDAA 3RIKA 3AYSA 2O9OA 3SUWA 3WQ8A 4MNKA 5LA0A 1XD1A 1E0VA 1E6QM 2YA0A 2XFYA 3GH4A 1JYXA 1ESWA 1H0IA 4PTMA 2RGLA 2D3LA 5A6SA 4GO9A 2ZX5A 4M1RA 5A6BD 1UKSA 1KB3A 2J62A 1C92A 1NOWA 5FKYA 1G1YA 1VAHA 5DF0A 4NX0A 3CZGA 2WVVA 2WAGA 4UQBA 2YOCA 2WZHA 1JDDA 5HNNA 1Q6CA 4PSPA 3AIBA 3NIYA 1DWIM 3RM8A 1XH0A 1UWIA 4Z2GA 1UKTA 5IFTA 2ZICA 1CXIA 4F9JA 1GZJA 5M03A 2OSXA 2W92A 3AJ7A 3WFLA 4QFUA 4FLOA 1W9DM 2Z1KA 1NP2A 1ZBVA 4ACZB 3VIIA 5I78A 1Q6DA 3VU2A 1VIWA 4CN1A 1AMYA 4WKFA 1JZ5A 4J3SA 4NI3A 4GZEA 4EKJA 2CNCA 3MO4A 4PTXA 1EDTA 4IPNB 4UOQA 4Z2HA 3MSGA 1WKYA 5A94A 3GDBA 5CSUA 4W7WA 1C90A 2PC8A 4M80A 4AZHA 4CD4A 1R33A 3GYCA 4QP0A 2EEXA 1LJYA 4YHEA 1E56A 5I79A 4D6JA 3CUGA 3ZMRA 1M01A 2Y5EA 4EANA 1XCWA 1C7TA 4JFSA 3T0AA 2XGBA 2W91A 5A6LA 1BG9A 1EQCA 2J47A 1BYCA 4NRSA 4MJ2A 3U57A 4FNPA 1ISZA 3GH5A 4Z2IA 4BQ3A 2WMGA 1CWYA 5HPOA 5GNYA 3KL3A 1H3GA 4AIUA 3OGSA 4W5UA 2VURA 1VFUA 1AQHA 3WNKA 5D9OA 3HG2A 3O2LA 1HN1A 1E71M 1E73M 3A23A 3D51A 2DT0A 2XHYA 5AY7A 4CCDA 1R46A 2A3CA 2OW6A 1XV8A 3KL5A 2YLLA 1EOKA 1ZU8A 3K4AA 3VIPA 5IHRA 3BVVA 4M24A 1YQ2A 1UH2A 3GZAA 1J0HA 4WLCA 4DWSD 4OBRA 3E1F1 1J10A 4L4PA 3WQWA 1ISXA 2VCBA 2E40A 4Z2LA 4D1IA 3GXNA 2BY3A 5HXMA 4W7UA 3T08A 2D22A 1CZ1A 2BNJA 1JYVA 3APGA 1X6NA 4UQ9A 2F8QA 5IXEA 3WUEA 3AMGA 1BYAA 3WMSA 2W63A 2J75A 2XM1A 1C8XA 3WNLA 3B9DA 1UKOA 4F79A 5DFAA 3F4VA 5GNZA 1CGVA 1E43A 5BXSA 5JIPA 2CPUA 1EOMA 1FA2A 3ZO9A 5C71A 2BY0A 1H09A 2DQXA 1UD2A 1BGAA 3ZT5A 4D6FA 5A8PA 3MI6A 1WZMA 3T0BA 4AD2A 2HVMA 2EADA 2XPKA 1VENA 1HJUA 2FHCA 1V0NA 5DO8A 3M7SA 2F1BA 1H11A 4HOXA 3IAPA 3A3HA 1E3ZA 3L2MA 1MFUA 1BYBA 3DX4A 1US2A 2J4GA 1DWJM 2PB1A 1LL6A 4D71A 4D6CA 1K9FA 4GIAA 5EFDA 3NJ3A 1WDSA 3WUFA 1V08A 3AIVA 1TVPA 3SCPA 3AZSA 1SMDA 1RPKA 1FFQA 1K9TA 4TX8A 1FP9A 1GJUA 4XZBA 1IV8A 1WE5A 1E6ZA 1W1YA 3EJTA 5KZ6A 1ODUA 3N13A 3L4UA 3VIHA 5D8WA 4JFWA 4XUYA 4WF7A 1D3CA 2OYKA 8CGTA 4MJ4A 3ARWA 2PWFA 4P8UA 3U5YA 1H1NA 1J18A 2D0FA 3HG3A 2F7OA 4ZENA 1R85A 1CENA 2WMKA 1B90A 4DO5A 3AHYA 5FL1A 4AYGA 3A4XA 3PZIA 3VPLA 4GKLA 2WVUA 2ZUVA 1HVQA 4GPNA 1UWQA 1UG6A 1CECA 3M6DA 1O7DC 2XM2A 4A3HA 1JAKA 4W87A 2CKSA 3U5UA 1E1FA 3TONA 3W24A 2BY1A 1AVAA 4B9ZA 4FNQA 3GXMA 3HU7A 4JFVA 3IK2A 3LRKA 5D9PA 3AZTA 3AIRA 2ZUSA 1K6AA 4RE2A 2YA2A 2UY2A 4GZJA 2X8RA 1JGIA 1ISVA 2XN1A 3AZRA 3ARSA 3SCSA 2DSZA 4ZXOA 1TZ7A 2GK1A 1QNQA 1LG2A 1JAEA 3FNDA 4HZ8A 2W66A 4U3AA 1AQMA 4WK9A 5ECUA 1WP6A 4MAZA 3W25A 3ARXA 1VJSA 1WNOA 1KR0A 2XVLA 3AXIA 3A4WA 3WD2A 1B31A 3UEQA 2PBGA 4AC1X 3ZT6A 1UWSA 3WD3A 5A8MA 1J0JA 2FHBA 2ZUUA 1EH9A 2CBVA 1ISWA 1W3LA 1EO5A 3WNMA 1B3WA 4UFIA 4CKQA 3CO4A 1EIBA 2E8YA 3KEHA 2W5FA 2ZWYA 2WVTA 1NWRA 4PUDA 1ECEA 3M07A 2ZXDA 1SYTA 3K8KA 1GHRA 3BUBA 4CU7A 1GW1A 3TTOA 2EABA 5HPCA 4R27A 1CXHA 2J7GA 1W3HA 5DMYA 3BC9A 3N18A 3BUIA 2WBGA 3ZT7A 1HP5A 2GVYA 2XIIA 3A24A 3CZKA 3NSMA 3FHAA 4OGZA 1KBKA 4PYSA 2WCSA 3WSUA 4AW7A 4RE3A 4PMUA 3OZPA 3BVTA 3BMVA 4NXSA 1WZAA 5BXTA 2D0GA 2EPLX 4MPKA 3TTSA 2XVPA 1PX4A 3BUQA 4WSJA 2ZUNA 3ARZA 2E0PA 2D73A 5HOSA 4UQEA 2O92A 2WWCA 1B2YA 3CTTA 5JBEA 4AEFA 2X2IA 1BHGA 4BA0A 1J0IA 1M53A 1E55A 1JG9A 1PPIA 2GJXA 3KZSA 1JZ2A 4W89A 3AMDA 4TVCA 2GJXB 3L4WA 1JL8A 1J01A 4J3VA 2UWFA 3DDGA 3PZNA 5KEZA 2WMIA 3PZVA 2BY2A 3UG4A 1CXKA 4F66A 3LRMA 2PWDA 4ZE4A 1JD7A 4QAWA 1RH9A 1NM9A 4C7FA 4DWSC 4Q22A 3WF1A 1FHDA 1MW0A 2W67A 3RM9A 2VR5A 1V3MA 2X09A 1JYWA 1GOMA 1UYQA 3AS3A 2VR4A 3OA5A 1B3YA 1LWJA 1QI0A 3AS2A 4UFLA 4MDOA 2W62A 3MANA 1JD9A 1W9VA 1DP0A 4LGXA 3W4RA 1E0XA 2VX6A 1NWSA 1TFVA 4W93A 4AD4A 3WDRA 2BHZA 2BVDA 1V3HA 2ZUTA 1TCMA 2XYLA 5E09A 4F9DA 3WD1A 3WH8A 3WF0A 3VTRA 4PCSA 4DM1A 1XHGA 2EBNA 4JHOA 5LA1A 3BAWA 2YDSA 3ZJ7A 3VD4A 1OIFA 1KQYA 2V5DA 1PX3A 3CC1A 5I24A 4TXEA 4JAWA 1JI1A 2YFOA 3UCQA 1HX0A 4AZGA 1HWWA 4ML4A 2RGMA 1EXPA 4U5KA 5C70A 1QNPA 2WKGA 1CGYA 2W4XA 1WDRA 3VIMA 2QMKA 2G3IA 3W28A 1HJSA 3CMGA 1KCLA 1CNVA 1SR0A 3OLIA 1UD5A 4JCMA 3CUHA 4AZ5A 1IZKA 3WDHA 4UQCA 4X0NA 4XZWA 3CUFA 4UCFA 3FY1A 3VMOA 1V3KA 3MV01 4V2XA 4B3KA 3NDZA 1GQIA 2UY5A 1B3VA 3IJ8A 1BG4A 1CGWA 1JNDA 1TQSA 2DDXA 5AC5A 2CYGA 2D1ZA 3SUUA 1M7XA 3FXYA 4HMCA 1WZKA 4GXPA 3NSXA 3LXCA 3RO8A 2GSJA 1BQCA 3ARPA 2E9LA 5JIWA 2XGIA 3J7HA 4OJYA 2ZIDA 3CUJA 1E4NA 1EO7A 3N11A 2VRQA 1UA7A 3D4ZA 3EYPA 3RMEA 1J0ZA 3SIMA 3D4YA 4LQ1A 3T2PA 1J11A 1M03A 7TAAA 1HKKA 3VD9A 4OKDA 4CGTA 1JZ7A 1CPUA 1OCQA 1E15A 1CXLA 2FGZA 2WYSA 3VM7A 1W9PA 2PF0A 2B31A 1QI4A 2XVNA 3I3DA 2X0YA 5GQBA 4U31A 2BVYA 4OUEA 4D6GA 4TTGA 5D4YA 1CXEA 2OW7A 2JALA 4J3UA 3ZOAA 3BCDA 3PN8A 2VZTA 1E0WA 2C0HA 2EPOA 3KE0A 1MW2A 2A3EA 2AOSA 2EXOA 3BVWA 4BQ5A 3CGTA 2WBKA 4BQ4A 3CLWA 1JZ8A 1KWKA 2VT0A 2DT3A 4FF5A 5CGTA 5FCZA 1X1NA 3FAWA 2J74A 2CITA 1UQYA 2BS9A 2V3GA 1UUQA 2GK1B 3NCOA 3ALFA 2GJPA 3EJUA 3WFZA 1FOBA 4CVWA 2J7EA 4MB3A 5BXRA 1BTCA 3WY3A 4H2CA 1DWFM 1QOXA 3VNYA 4CD6A 3BMWA 3UERA 4YPJA 1UH3A 3WNOA 2DGAA 4PUEA 1PIGA 3OZOA 3WQ5A 1D2KA 3IJ7A 3BAYA 2MANA 1OT1A 3LPGA 2JF6A 1CEOA 3EMCA 2GDVA 5GPRA 3MUZ1 3PTQA 4PMXA 4W5ZA 3UG3A 1JFXA 2O9PA 1DWGM 4DWSB 4E4PA 4PTWA 1JIBA 1ZBWA 2CETA 2TAAA 4JCLA 1PX8A 2QF8A 3AXXA 5A95A 3KLKA 5E1QA 3DX3A 3VILA 3WENA 4IISA 4ZFMA 2UY3A 3W37A 1E6SM 4AMWA 3RM4A 1E70M 1Q6FA 4P7RA 1XYFA 2QV4A 4FLQA 3BGAA 3WH5A 3CMJA 3ARVA 4JKMA 3WF2A 3PZ9A 4OIFA 3FAXA 3QHMA 4OOUA 2YL5A 5ABGA 1ODZA 1XC6A 4LXFA 4MNLA 2FH8A 3T09A 3B9EA 1MWOA 1XGZA 2DSKA 3ALGA 2WC4A 1KXVA 4J27A 5BRQA 2F1AA 5A2AA 4XV0A 1KXHA 1PZ3A 3F5LA 4AYSA 4ACYA 2EO7A 3LPPA 2WVSA 2V3DA 5I6SA 2CBUA 1QW9A 1TG7A 2WW5A 2Z1SA 2EACA 2J7FA 4HPGA 2FDMA 1Y7VA 2VX4A 2X0HA 4BS0A 3AS1A 3VIKA 4DUVA 2V3FA 2JIWA 4N42A 1IT0A 1UQZA 2VRJA 3IJ9A 5A8QA 1F4HA 2YBTA 3RILA 1MXGA 1CLVA 4U5IA 3VKKA 2EPMX 5EB8A 1XSIA 1SFSA 3SCNA 1WPCA 3BH4A 3DDFA 3GTNA 1CTNA 4M29A 2DIJA 5FD0A 5DT5A 1UASA 3K8MA 4TOQA 1ZJBA 2O9TA 1VBRA 2Y24A 1V6YA 3OIHA 1V6VA 3AROA 1UD8A 2WVVB 1PIFA 1U33A 2IGTA 1NP0A 2CCRA 1W3JA 4LYPA 3WF3A 4UNIA 2X2JA 3NDYA 2QPSA 1SZNA 2VI0A 4W8AA 1V3IA 4BF7A 4AZCA 3RCNA 4U2ZA 5A8OA 4PRWA 4QLKA 2PI6A 3VVGA 1GONA 5FL0A 2ESCA 5A6KA 1SMAA 3AXHA 3MMDA 3OBAA 1V03A 1FH9A 2WSPA 4ACZA 7CGTA 2D0HA 1OINA 1CXFA 1L0PA 2E4TA 5E0FA 2XVKA 3WH6A 3BUDA 1S46A 3AS0A 3L4XA 4MB4A 1I75A 1EA9C 2X2YA 3SURA 3CHFA 1KQZA 3DYMA 4JZ5A 1TQWA 2DH2A 1W1VA 3D50A 3TOPA 3MUIA 4R5EA 1ZJAA 2C7FA 1OM0A 3VIFA 1PAMA 4HOWA 4UFKA 4W7VA 3NYDA 4CD7A 2BXZA 4MDPA 5JBFA 2VUYA 2GUYA 2WZIA 4AIOA 1UD6A 2WK2A 1PZ2A 1GQLA 1V6UA 5CSYA 5ABHA 3WF4A 4CCEA 2VX5A 4IM4A 2J7DA 4J7RA 1L8NA 1VBUA 1QBAA 4M56A 2OWWA 1R75A 3N12A 2D24A 1G94A 2ZXQA 3H55A 2JFEX 1GOWA 3CIVA 3N15A 3WN6A 3CZNA 4X9YA 1QI3A 4HOZA 4C7GA 4D6EA 2ZOXA 3L4ZA 1MVYA 1HL9A 1E6PA 1PJ9A 2E8ZA 4KRTA 3D3AA 4X0VA 1GVIA 2WB5A 4WKHA 2XJ7A 4P7LA 4PSRA 1JZ3A 1UKPA 2F7QA 3VGFA 1FH8A 1ZB5A 3VIJA 1I1WA 2WANA 1Q6GA 1MQRA 5CGMA 4W8BA 1OT2A 5HDRA 1E4IA 3LPOA 3ZQ9A 4PMRA 2ZWZA 4Q7NA 1JXKA 1Q6EA 4LX4A 4M8UA 3D5HA 3AIEA 5I77A 1FP8A 4L4OA 1GNXA 1HXKA 2ZXAA 3WNNA 4UOJA 2XN2A 4HU8A 5A1AA 2E3ZA 1HVXA 3AHZA 2YLAA 1XSKA 2CBIA 3WDJA 5A2CA 4FNRA 1QW8A 3UETA 3WEOA 1H2JA 3QR3A 5M5DA 3RPMA 2XTKA 2YIHA 5A6AA 2Y8KA 4URIA 3ZIZA 3CZJA 3N9KA 1J0YA 4JFTA 2IXUA 4MAVA 3EMQA 4BCEA 2FYVA 2WMHA 3OLGA 1C7SA 2C8NA 3GXPA 2F61A 3WDPP 2WPGA 1DHKA 1OD8A 2ALWA 4KGLA 3SCRA 2J79A 2WMJA 1GUVA 4AZ7A 3PZQA 3T0DA 2FH6A 3ZJKA 3VSTA 4AD1A 3MS8A 3BCFA 1TMQA 4D6DA 1KXTA 4CCCA 3GXDA 5A6MA 1D7FA 2JE8A 2Q8XA 9CGTA 4TX6A 1TQVA 2DT1A 2GFTA 4N0RA 2VZOA 3CUIA 4JL2A 3B9AA 3ECQA 4CU8A 1KWGA 2G4FA 1GOKA 3DX0A 1OB0A 2BVTA 3BXWA 2XUCA 4C7DA 4HP5A 5EMYA 4AD0A 5BRPA 4RE4A 3GXFA 1QI5A 1TA3A 4MB1A 2J7HA 1RP9A 4NZFA 2J8GA 2WM0A 3VMPA 4LYRA 3I3BA 4PMOA 2VTFA 3WKZA 2OSYA 4PBGA 2Y4SA 1HT6A 3EJQA 4GINA 2G8ZA 1NOFA 2XG9A 4PEEA 1B0IA 1ZL1A 2CESA 3AQUA 5FOOA 5BXPA 4U2YA 1UD4A 4KGJA 3NUKA 4TTUA 2FE0A 3AHVA 3K4DA 4DWSA 1VEPA 3RDKA 1B9ZA 4EAMA 3AIWA 3VUPA 3HJEA 3CZLA 6TAAA 3CZSA 2JF7A 4TVUA 3N04A 4EE9A 2OLHA 2ZUMA 3W53A 3MSDA 2NT1A 4A3YA 2CHNA 2F7PA 4QDMA 3A6OA 5HBFA 3GNPA 3EDJA 4HU0A 1MQQA 1R47A 1HJXA 3L4TA 4XB3A 2VO5A 5I5RA 4WJXA 5EFFA 4DO4A 1JNEA 2WHLA 1WO2A 1NARA 2VJXA 3W6LA 2FGLA 2ZXBA 3W6MA 1OSEA 4CD8A 4MTVA 3VDCA 2DIEA 3DHUA 5IHSA 4ATWA 1BF2A 4H41A 1EHNA 3AFBA 7A3HA 3MV11 2BXYA 2QMJA 2E9MA 4J3WA 3UESA 2WLYA 4V27A 3GNOA 3WBEA 4CD5A 1XSJA 1KTCA 2ZE0A 2X05A 2V3EA 3GXIA 1CGUA 3VGEA 3EJSA 3PZOA 3HMCA 5I3DA 1E6NA 1DEDA 2EQDA 5CJ5A 3K8LA 3ZJ8A 1QNOA 2W61A 3VINA 2OWXA 1XH2A 4B3LA 4RL3A 4PN2A 1B1YA 1B3XA 3SCVA 2VZUA 1EHAA 2JEPA 3L4VA 4K68A 1U30A 3S5YA 5FIPA 4Z2KA 3VD7A 4KH2A 3T2OA 2OWCA 3GNRA 3QOMA 3W27A 4UFHA 4BZYA 1EDGA 4PMNA 3A5VA 4W84A 3WQ4A 4W85A 3VD3A 4HPHA 2CERA 1V3LA 3AI0A 2FHFA 2G3NA 2V38A 3EDDA 4JL1A 4CU6A 2CXGA 2O9RA 2WLZA 5DT7A 3MMWA 3CHDA 2VVSA 3IAQA 3W81A 1CGXA 3WDIA 3W26A 3VX0A 1HKIA 5D8ZA 3QGVA 4PTVA 1E40A 2D3NA 3KL0A 1GQKA 2WKLA 4HMDA 2QHAA 3IANA 4TVDA 4ATDA 4B15A 2AMGA 1E4LA 3RJYA 1R8LA 3HG4A 2ZX8A 1UR8A 2XWEA 2ZX7A 5CQ1A 2PWHA 1HIZA 1R87A 1A47A 4GO8A 1HJVA 3THDA 3ARYA 3AHTA 2WMIB 1F4AA 2CEQA 5LA2A 3A47A 2UY4A 1E5NA 2NW0A 1I1XA 4GI8A 1R7OA 1UWUA 4UQDA 5JBDA 1O7AA 3GBDA 2CBJA 2VVNA 3K46A 4W86A 3I3EA 4MNJA 3MUAA 2NSXA 2WMFA 3PBGA 5EBAA 3WQVA 1GOQA 3OLEA 3EJPA 1OIMA 1JYNA 4DM2A 4PCTA 3D52A 3ZR5A 4AMXA 5CZKA 3WY2A 1JXJA 2WC3A 3VDBA 4J3XA 4NSBA 5A3HA 1XH1A 1K9DA 1W2PA 4AZCB 4HTYA 3GM8A 4J28A 1XCXA 4D72A 1UD3A 1TQUA 2YFNA 1JFHA 1OGSA 2ZX9A 3BLKA 1GVYA 1M04A 4FNTA 2JEQA 3WY1A 1BFNA 3WBAA 3II1A 2HISA 4PMVA 1GPFA 1K9EA 1US3A 2XVGA 4YN5A 1V6WA 5CPQA 4MADA 1XRVA 3EJRA 1UR4A 3WEMA 5M3WA 4AIEA 3WD0A 4GZIA 4GQQA 4ZE5A 5ABEA 1H4PA 3PTMA 4UTFA 4AWEA 1W9XA 1FHLA 1E72M 3HN3A 1KTBA 1EGZA 3LXAA 2YKKA 3BSHA 2VL4A 4LPCA 5E6YA 4S3KA 5CPSA 2VRKA 4HA1A 3LRLA 2OYLA 1V02E 3OB8A 3BUPA 1N82A 4P8WA 3ARRA 5A2BA 3SCTA 3VNZA 1WDPA 4U3CA 1TQTA 4EK7A 1MQPA 4DUWA 3PZUA 3T2QA 3W0KA 1QWNA 3BVUA 3VGBA 5I0DA 4CN6A 1ZS2A 1HJQA 1UHVA 1E6RA 3L2LA 3AHXA 3UR8A 3SCUA 3GXTA 4M82A 1UR0A 1LF1A 3LMYA 3CZ8A 3DHPA 1J12A 3ZJ6A 4HA3A 4PMDA 1J0KA 2D20A 1NWUA 1BPLB 3WDQA 2J7CA 1CLXA 3U7VA 2YL9A 3WUBA 2G3MA 1W1PA 3IGUA 3FW6A 4UFMA 1HL8A 1W32A 3VX1A 4GI9A 5D9MA 3WL1A 1NOUA 3MMUA 2G3JA 4W88A 3POHA 1UZ1A 2VC9A 3VGGA 4NF7A 2E9BA 2VMFA 3H53A 1OD0A 1R86A 4NZCA 1UR9A 1ZBCA 4AEEA 4YHGA 3BAJA 5LYRA 4AZIA 3WQ6A 3AMKA 4M81A 3KLLA 2VX7A 4AD3A 1QI2A 5JUVA 1VRXA 4CN4A 1E9LA 1MFVA 1G9HA 1ISYA 1EQPA 1U2YA 3OGVA 4AXNA 3WH9A 1R34A 1RD6A 3H54A 1XD0A 2CIPA 4P8XA 3VDHA 1JF6A 3N1AA 1UKQA 2VQTA 3ZSSA 1GOIA 3VM5A 1VB9A 1OGBA 3MUY1 2EAEA 3HZ3A 3N17A 3DX1A 1HKJA 3BSGA 1X6LA 1VFOA 4JHZA 4MB5A 3SCWA 5CPTA 3PHAA 3WEZA 4CVUA 2OYMA 3VIGA 6A3HA 1KGWA 4XX6A 1UWTA 1BSIA 3UG5A 4V28A
chains in the Genus database with same CATH superfamily
3IETB 1U3HC 2PYEE 1VFFA 2PTTA 1MHHA 3FQXA 3NACH 2BTMA 4V15A 1RIHL 3CLMA 1OFDA 1KYOK 3KYMA 3N6YA 3NABH 1G1OA 3ZDZF 3KYMB 4YXKL 3GDLA 4CUCA 3TGXA 1EEZA 3U7YL 4O1DA 5DK0B 3X1NA 1VFBA 2X3AA 12E8H 2HVJA 5EOQL 3ULSB 4R96B 4EDXA 2A7RA 1V0LA 3VKJA 2A1WH 2ZNWA 3RWCA 3AYRA 1W2VA 1J2BA 2EILB 5AAMA 3VGDA 4AD5A 1O9ZA 4JE0A 4A7VA 5LB1A 1EZUA 4DJDC 5CIPA 4O1EA 5DZPA 2X1XR 5GSVA 3LEPA 1OEPA 2J8UE 3IVUA 4L4MA 2A73A 4HPNA 3NEOA 4JTEA 4PCFA 2PLMA 3FN9A 3T0TA 1L9RA 1C5DA 1SLWA 3RX7A 5KS9B 3MYZA 3LV6A 3OXRB 3RQ3A 4P7NA 3LI0A 1J9YA 1PBGA 2A85A 3UCCA 2X4NA 4UZSA 3KBVA 4DLMA 4FXKB 1NLDL 2LV4A 1XF2B 2WWDA 5C08A 1UM5H 3F5KA 2CO6B 2X4UA 4MWFB 5I30H 3N85L 3GRBA 3JSSA 2ZC8A 1QHPA 3W07A 4OD3H 1NFBA 4XISA 1OQXA 4UNTA 5E2JA 3EBVA 3NEHA 1UUOA 1IGIH 4Z7QE 2ZPKH 2BLEA 4EPBC 4YTSA 3LQLA 1ID2A 1CB7B 5DRXB 1HJWA 3MTXA 5I26A 5J3HD 1OTSD 2IV8A 3U6XA 1E42A 1JK8B 3U2EA 4AL8H 2FO8A 4C6EA 1B0WA 2HEJA 1CD8A 2WXOA 3QIUD 4JMXA 3UTTD 4GAJH 2J20A 1RKRA 3F7PC 5EZIH 3B4YA 4BQ2A 2Y63A 1D2OA 1I9IH 1N8OE 3P30H 2DQJH 5J0BA 1KKOA 5BROA 4CD5A 5HHVL 1UZDA 1EO8L 1E6XM 4R34A 4GA8A 1C8VA 4XBGB 3POCA 5CR8A 1GH7A 4Y7EA 1AO7D 5EF2A 1CURA 2EDJA 1ZA6A 5C0QA 1NAMA 4XMUA 5BYWA 4UIKL 3W9EA 5T1DL 4ZL1A 1R5WA 1E9YB 2POZA 4ONHB 2J71A 2FWUA 1IBBA 4R7DA 5KJ4A 4NKMB 3RWHA 4BCYA 3IRSA 2QV5A 2H3NB 3KHOA 4IF2A 1C5CH 1NGPH 3NG3A 4JIHA 1EJWC 2QPUA 1SJAA 2K6ZA 3LMJL 2J78A 4NHCH 5HDWA 5AHNA 5D8WA 4B5XA 2OT0A 4WWID 4FLRA 4XOBA 4QT5A 5CNHA 2BNQB 3CV5A 3FRPB 3QZOA 1GY2A 1LMIA 1CGTA 4H8VA 4LYQA 1MEIA 3P0GB 2NXYB 1R7AA 4H9ZA 3VD2A 1X9LA 2CRIA 1T0OA 1M3UA 3CH9A 4OTXH 2VO8A 3H0TB 1WICA 4LAJH 3FTGA 4FRWA 3N2TA 1KNOB 5AZEH 3UWEA 1L8PA 4O2EA 1EZWA 5FYKU 4GXVH 2RA1A 1OHLA 2O5NA 4HXBH 4D6HA 1QNSA 3VD5A 3TTEA 3DERA 4DYKA 4QSFA 4Y1AA 4B0MM 3HB9A 2X1OA 4JG0H 5KYUA 4X4YA 2FO4B 2NNAA 3D0LB 3FEMA 4HNOA 1CYGA 1P4BL 4GRLA 2L04A 4M93B 3VFRA 4NNAA 4WWPA 4P2QB 2DSVA 4PUMA 4ZQPA 3EZ8A 1OGAE 1SVBA 3AU1A 4LSUL 3HO8A 3TNOA 4H0IA 3UAFA 4JY4B 3V5CA 3WO4B 2ZWLT 1J8HB 4DIAA 3FRUA 4NQTA 4LARH 4HPXA 4NZRH 1EX1A 5F2GA 1OE1A 2CLVB 1R5VB 1RJCA 2AGJL 3JWNG 2DJXA 5MKGB 2ABAA 4TULL 2DBLH 4ZTPL 3US9A 4HSHA 4Q8TA 1NC4A 3O0RL 3TBYB 4FABH 1H15B 2PN5A 2VZVA 4U4IA 3RWEB 1YJDC 7FABL 3L65A 1XT5A 2C3WA 5E23A 2GGEA 1NWOA 5GGRA 3PZMA 2V7NA 2Y25A 1NGXA 4LPYA 2DQFA 3FFCE 1OSYA 2D2JA 3UPBA 4X42A 3W87A 2BV9A 4NNXB 3K4WA 2QQ6A 5ENWB 2NSMA 1WJ3A 5D71H 4QTIH 1TLKA 1CDGA 2CA4A 2G5UA 1U8KB 4Q8UA 4FNSA 2OO0A 4HCDA 3MJ7B 2VM4A 1JTPA 4K23L 2P8BA 3DTXB 4BSWA 4H8NA 4GP5B 2OMUB 3RCYA 3WLJA 4LARL 3MVTA 2OKMA 5CG0A 4A2RA 4ZODA 1TB3A 5GS3A 4KROD 4NUPA 4PGBA 5AAMC 1RA5A 5BZWB 3HG5A 4AF0B 4N1HB 1YMME 2JGQA 3IIOA 2GGHA 3HRZC 2MCG1 4HFWA 4EVNA 1IZCA 1XF3A 4AL8L 2XACC 2VXQL 1TUXA 1ZVYA 1T1ZA 2NNFA 3I02A 4XMLH 5I1IH 4A05A 1FZJB 4R7LA 5AVUB 1E1EA 1G0CA 4XNYL 4UTKA 2F2KA 3VFWA 4ZW7A 2GHWB 3CAKA 1H3PH 1OK4A 2D4FA 2CJSA 3MOQA 4JM2B 5EU5B 4X83A 3MW7A 4KRUA 1S8DA 2P28B 3MNVA 2NQLA 1V7MH 2EE9A 1Q9WA 2BGNE 5E0CA 1G4MA 3T77A 2DSWA 1YHPA 1MXDA 2FT7A 3AIQA 3E6EA 5H91A 5FGSA 2NW2A 1LUCA 1IZJA 4O10A 4I88A 3CQFA 2QQNL 4NO3B 2WQRA 2HWGA 3MRPB 3DOIA 2IBBA 1J86A 2V5MA 1TE1A 1K8DA 3GNDA 3RO6A 3ZE2B 1WAUA 3LV5A 1G7PB 4ZMXA 3HS0B 3FSTA 1FZKB 2X4PB 3ZXWA 1NANI 2ISDA 5I0WA 3DC8A 4J2XA 3KWXA 3REVB 2WP3O 5D1XA 2ZSVB 4JO1L 5E8OA 3VGAC 5F7UA 3S35H 3BVXA 4UIMA 5SX4I 4PC8A 4TF4A 2PLJA 5GZNC 3L48A 5DMGD 3C2YA 1MJ7L 3QHNA 1B9KA 4DCQA 3PAOA 1A7QH 4GIRA 5KITA 1K5NB 1N3NB 2RJGA 5EIIA 3CJPA 5T5NG 4WSGA 5DX7A 1RERA 1XYZA 3GJFA 5HUPA 5GXBB 1I8KA 4OBSA 1K4HA 5LXGL 3NBNA 3WHXB 3W7CA 2PP8A 3VTTA 3E2HB 1XZ0B 4JFDE 4YS1A 5IMKB 3QQ4A 3HNSH 4PJXB 5B7EA 1LQ2A 2HSIA 3PTDA 5I19L 4W4OA 1J9TA 4TLKA 3P11L 1D9KB 4XNZC 3CSFA 3K71A 3CHCA 4NHVA 3MNWA 3WIHH 3GBMH 4WFHD 3NQCA 2GJNA 3BL3A 5CXPA 3H4HA 3US1A 5HJXA 3RYSA 2OJEB 2PYED 4K7PY 1UFUA 3VI4F 1ADWA 2OJEA 2BFGA 3LKOB 4FQ2H 2QXWA 3WFBH 1BZEA 2ZOKA 4XVJH 3OC5A 1I4FB 1NC4D 4W9KC 5BZAA 2YD4A 3VMNA 3F62A 4IPLA 2C9VA 2NT0A 4DP4X 3MJYA 3IK4A 1M42A 3SUVA 4PY8I 3O3BA 5LIKX 5BRZD 4R8WH 3FPXA 3EWDA 2DMGA 3CFDB 4Z3IA 1Q4NX 2AITA 5I1HL 1LL7A 2I14A 3Q13A 4OFYA 4JN6A 2XG5A 1WUNT 3C8NA 4K3JH 4WU7B 1X7IA 2PDFA 4HNNA 2R0ZL 1E4MM 3NJXA 1KTNA 3RIAF 1ZWIB 2DDQH 3ARQA 2PCPA 3GFYA 1KIQB 1IIHA 1VF8A 2V4LA 3ZSTA 2PUQT 2PCFB 5CLWA 3H23A 3ULAB 3KPNA 2OFJA 3C2AL 4ODSL 3RDTD 2XSBA 4JG9A 3WUGA 3AISA 4X7SL 3QULA 4PJXF 2PDGA 3GTVA 1SVDA 1QX1A 4UWQB 3UEZA 2YWYA 4Z77A 3NZHL 4PQXA 5GS0C 3FLUA 4Q8BA 4JRXD 3GNML 2CLKA 3SM0A 3U4AA 5AW9B 3QF0A 4DGVH 2J9YA 1QBBA 2GJZA 3R7MA 2PABA 4WOQA 4WKAA 1ADSA 1BWLA 2VEGA 4OVXA 1XHHA 4J6IA 3BKYH 1DVJA 4ZZFA 1DXIA 3V5OA 1R3IL 2EH8L 4JUSA 1F6AA 4PUBL 4C56B 1NJJA 1DJWA 3K2UH 4YGVB 4PR4A 3W70A 2ICWB 1R30A 3OKEB 4JN7A 3SGZA 4DZIA 1XR8A 4GUQA 1LP9F 3H7VA 3QUZD 4L5FE 1VGKA 4OLUL 4RRPM 4AE0A 5DEZA 1X38A 4LH8A 2R6OA 4OQVA 1T7LA 1GYMA 3D39E 1GW0A 1MFCH 3QG6A 3IV3A 2FATL 1QNRA 3RO8A 2DJSA 1ZT1A 2CCLA 3QT2A 2KT6A 4R4BA 3ME3A 5CZRA 3FN3A 2PTWA 4ZB2A 2AAVA 3A67H 3KW8A 1BD0A 4Q8MA 1TR1A 2XQYK 3C6LB 2INZA 3KYAA 2QAPA 4C1NA 1BX2A 3PS7A 5CBBA 1G9NH 4YWGH 1RZ7L 3UGUA 4U33A 1RFDH 1Z2KA 2FIKA 1MFBH 2Y7OA 3SDCA 1I7UA 5K9OB 3GMOB 2CO7A 1MFEH 1SN2A 3BP6B 3HI6L 3LY6A 4OIAA 1Q0XL 4LNVA 4E9RA 5JHAA 2IKGA 1I7TA 5I1DA 1XUUA 4PFMA 5GVJA 4C6CA 1G7JA 4GMTL 2FT8A 4NJ9L 5DD0L 5JOPD 1QYGH 1KXQA 1KJMB 4ZPVB 5AL8A 1AHMA 1KG0B 2WBWB 2PS2A 4FS9A 1TG8A 2H26B 2G41A 1PD0A 4BUHA 2V2TA 4AIXA 4N6EA 2J7BA 1MVFA 4G8FA 3UC0H 5CGYD 2J6XA 5D55A 2GJRA 1QHZA 1V7AA 3GDCA 1XRTA 2VDOL 3C0QA 3U8GA 3QY6A 1B0RB 3WXVL 4RW3A 2Q2EB 5HHPB 1NFGA 1LMKA 1FYTB 1QUNA 4MNQB 3O6DA 2Q7YA 1SEBB 4EOUA 3THQA 3UGRA 2O61B 1K6QH 4YEEA 1GOOA 4A39A 1RY0A 3MJ9L 3BSMA 4IU2A 3EO0B 2XA3A 4JM4L 2ZX6A 3VI3E 2QJGA 5I0XA 3O0LA 4OWGA 5D9SA 5PTDA 1NIBA 2N1KA 3NMEA 3N3MA 5DJDA 4WHYG 4NQCE 4BFEA 3GRWA 4WDUA 2PDKA 4RFNB 5FGBA 2F7IA 3ZU8A 1W9UA 2CZFA 1ZANH 4IBLT 5DC4B 2GDUA 4H6QA 4Y2WA 4AWJC 3W9DA 3WH7A 3SQRA 2ESVB 4Q6IA 3T0EB 3DECA 4H20L 1DQUA 3LOTA 3B6SB 1H0DB 4YXLH 3G1YA 4KIEA 2ZA2A 4GRLD 4I6VA 5K3VA 1JGDA 4X2UA 2O4MA 4RDWA 2FVKA 5I9QB 4I4WA 3Q45A 4LK4A 2NZIA 4RAHA 1BGXL 1OM3H 3SDAC 1MFAH 3H2MA 1C1EH 3QPYA 1YEDB 3EMZA 1NIAA 3EDKA 4WX2A 4QHUA 3RHWF 3TURA 4ELMA 4XCCH 5KYXB 4K3ZA 8A3HA 4S1QL 1FWIC 4NRRA 1L6FA 3VQ1C 1CF8L 4OZOA 4I85A 2YR3A 5BWFA 5KSVA 1A7RH 1HTYA 4X61A 3B3DA 1DTUA 4JFUA 3CBWA 4N87A 3SUSA 5HYJD 1BFSA 4RRPG 1FBAA 5F89A 4W9FC 2J8FA 3GHSA 4JY9A 4WCJA 4XO7A 1VLWA 3RIKA 2DIAA 2O9OA 4GY7A 4MNKA 1EP2A 5CIPB 2FR4A 3GE7A 1XDTT 2X4QA 3RUGF 3U0PB 4IBVA 2Z26A 4NQEB 3GH4A 2X42A 3UJJL 1J79A 2RGLA 2ILLA 3HPJA 4BI6A 1WISA 2ZX5A 1G0YR 3PREA 5DQ9B 1RJRA 2AABH 3ME0B 5I8OH 5L2KA 1W3TA 2J13A 5E1AB 1L6SA 3TT3H 3LJ3A 1MCEA 2DTML 6PAZA 4PZVA 1OCJA 4DEFA 3M0YA 4BK4A 4O9HH 2PW2B 3FT1A 4LRSA 3TCTA 4XN1A 2JQMA 5MENB 1VAHA 2OI9C 3QJUB 4Z7UE 3SY1A 2H6PA 3FYYA 2MFNA 3CZGA 1T6MA 2AL1A 4JEGB 3EYQD 3DG3A 1DEEA 1JDDA 4JVPA 1FO0H 4XCNB 1URZA 2HRHA 3TS8A 4ONHA 3AIBA 4RGOL 4QITA 3ZTEA 2HVKA 2JCCF 3I9AA 4MD4A 1MO0A 3L08A 5EIVA 1N55A 1JMXA 3PWLB 3RM8A 4Z2GA 3URBA 2O6EA 4WY7H 4OD2A 2WV3A 3BH8B 2DKUA 1GZJA 5M03A 4M6QA 4UNUA 1R3HA 3U0WL 1QLEB 1IHIA 1G7QA 3SOBH 1KCZA 1G7VA 2B7PA 2W92A 3AJ7A 3WFLA 3IMRA 5I8CB 1R9FA 1A3RH 2Z4TA 4HHAA 5KYNA 1FWCC 3H7BA 1TETL 5DLMH 2NY4B 4UTMA 3EOBB 1CFTA 3HPFA 2JXMA 3VXPB 2BLFA 3NIDF 4AKQA 2HXUA 5TTRA 1SW0A 1U95B 3U48A 1AMYA 5KJRH 4WKFA 2JKIS 2QPDB 3PV7A 4J3SA 4OZGB 3WFHB 4NI3A 1SUXA 2X44D 2X5PA 1K8ZA 1S7XB 3GSNL 3IS1X 2DQDH 3ES6B 3TCLB 1KXVC 5GS2H 5AOLA 4HEPG 3IBEA 1NVMA 1T7WA 4X4XA 4O2CA 2Y7EA 2VH5H 3D4GA 4IPNB 4E41B 2PLTA 2I9LA 1AIFB 4UOQA 5IOKA 1WKYA 1ORSB 2ISSA 1I8LC 3WJMB 5CSUA 1C90A 1BYNA 3DEQA 4LQFH 4M80A 2AJVH 4XBJA 4KRMB 4PJCA 1GJIA 1CFVH 1LBLA 4TQIA 1URIA 1KULA 2QAFA 4YHEA 5ITFB 3CUGA 2AQ1A 3NO5A 2Y5EA 4EANA 3MLRH 4BQ6A 5CWSB 4OD1H 1TJ0A 2E9GA 2NY2D 5ACZA 1A5CA 2CLIA 3GUTB 5DCBA 4AG4H 2BSCA 4WFHE 2F1EA 4PJCE 4ZTOH 2QSQA 3WXWH 1C5CL 3IRZA 3W1RA 2J47A 3EKZA 1RLBA 4LVFA 2ZE3A 1LYXA 1BYCA 4MTMA 2BZDA 4RIRA 3V4PA 1PV8A 1TPC1 1H3UA 2GJ6B 1TX2A 3GMLA 2NLYA 4LVGA 5J11C 4OFKA 5T1KB 2ZJSH 1P6BA 3UTTB 5F88B 4BQ3A 3KD4A 5DHVA 1CWYA 4M6OL 1I8IB 5AECA 4WFED 1IXPA 4W9EC 1KTLA 4XVSH 4B9CA 5EORH 2A77H 1LNUA 5DZOA 5CJOL 1KGYE 2FFIA 3ESMA 4OT1H 4FG6D 35C8L 2V5BA 1RUKL 1NY1A 3UTQA 2DTMH 4AUYA 1O5KA 4H26A 5EU7C 3FX4A 4JPGA 4HNLA 4Y9MA 1AO7A 3HG2A 1HN1A 4J23A 4MXQD 2KPWA 4FIQA 2W9EL 3S3JA 1EX5A 5B3JE 2HRWA 4WEBL 5FKPA 2OSLB 5I1JH 1S5IH 5J1AA 1F8IA 1HKWA 2OB3A 3SDOA 1NSNL 4I13B 5TE6H 2XHYA 4A2EA 3MOAH 3P3SA 3SKOA 3TWYA 2JK5B 3BIKA 4NNPL 3G24A 3Q67A 3LGDA 5BMFH 4EI5A 4OZIE 1VRDA 2A3CA 3KPLA 2FNBA 2E27H 1WA2X 2HJFB 2GW5A 1ME7A 4LOEA 4Y4HC 3F7JA 2LVCA 3JUZA 3K4AA 3QHZL 5E9DE 4B96A 4R90L 1YC7A 3PLYA 3KW3A 2VR8A 2EDEA 2XWTB 3NA9L 3SGJA 3EFDL 4OKVA 4HHHA 3DVFA 4N25A 3KWWB 3ALPA 5AEAA 3BP5B 1PQZA 2G37A 2CGZA 4GAFB 4WY0A 2ZAHA 1PQZB 4DWSD 1U36A 4K1WA 1A6TA 4LT7A 1KBVA 3EYFA 1VHPA 3KYNB 4OCXL 5ESAA 2OP4L 4EBQH 2I5IA 2JQXA 1XGYL 3S88L 2VCBA 5L6YH 3W7OA 1Z1WA 4MRBA 3PUGA 1SOQA 4XP9H 1F13A 3BWZA 4D9LL 4AQEA 2C18A 4IWWA 1A5NC 1LP9A 5MI0B 3EYQC 3QNFA 3RPIB 1YX1A 4AB4A 2GSHA 3EX3A 1X5HA 12E8L 1FCGA 2MH4A 1N2VA 2Y6SD 4MZ3A 4QXUL 4TUKH 4ABUA 5EU6E 1F9CA 2FGWH 4TV3A 3BJFA 2B8OT 4GUCA 4EPEC 1JYVA 1CYXA 1HHJB 3M88A 3EWWA 3PE9A 2OZ4L 4JTIA 1EBPA 4JFFA 2LLGA 3W0WA 3GU9A 4O17A 2W63A 4W9JC 5IFHH 3ESVF 1C8XA 4F9PA 1DQQA 1ETZA 1OY3B 2UBPC 3TA3A 4MRCA 4Z78A 3B9DA 3V0VA 5J9PA 1DQQB 1ETZB 5GGTL 3II2A 2NQCA 3B2UD 2W9LA 2X70A 1HZHH 2N59A 4LBEA 5DD6B 1CGVA 1E43A 3OA3A 4LCWE 2DBJA 5BXSA 3EO9L 5IHLB 4HH8A 2M83A 3GDKA 5C71A 4O4VA 1IMHC 5ABAA 4PYGA 1PWLA 2FTAA 3G18A 3GHTA 2GQAA 4JPQA 3K13A 1W72L 3ZT5A 4KO9A 5BZZA 2V9DA 5C55A 4FXKC 3O41B 2UZPA 4I3SH 3IFPA 3RKDC 5G4OA 4Y2NA 4KXZH 2KDGA 2ODIA 1A3XA 3L1FA 1E4XH 4HYTB 5DUPH 2R0ZH 3M45A 4R7NB 2R1WB 4UNVA 1MAKA 2LFGA 2P24A 4MHHG 4Y88A 5IVXE 4DVBB 1G7UA 4NCC1 2GOUA 1A6WH 1VENA 4XBSA 4NP9A 1LO4H 5KBNC 2DZEA 5CBEB 2EEDA 4PGBB 1IJ9A 3OTRA 4N4YB 5KZCB 1YYLH 3PNRB 3H26A 3R13A 3H6JA 1M7OA 4Q4KA 1G6RH 2WN3A 3ZTJH 4KHTL 2PAJA 4JTCA 3M5XA 4ZAKD 4AH2B 2AK1H 1ZHBB 3I7QA 4YYFA 1ADDA 1EPXA 3B9NA 1H8LA 2PDLA 1T3FB 1QG3A 3ARFB 5H8MA 4I9WD 1LM8V 3CASA 1PTAA 5C0AE 2AJ3B 2B1OA 2WXKA 2RH0A 1AD0A 3Q2VA 4P5SA 1W8GA 4GIAA 2NQZA 3HC4H 3QUYC 1QFHA 4LLMA 1ETJA 3NR0A 1R3IH 4PJIF 3C5JB 3H1ZA 3I4KA 4PI2A 4UB0H 1PKOA 3WTVA 2APTA 3IKCA 1FDZA 2CZEA 4HF5H 4P2VA 4DGVL 1YPFA 4HK3J 3S9ZA 2C9AA 2WAHA 3VXUA 5IQNA 3EAUA 1IV8A 2CD0A 1RZ8B 1W1YA 4UILL 1RZ8A 2IH3B 4QNWA 1P7QA 3N13A 3VIHA 4PRRA 3DUSB 2EDDA 4A7QA 3VC6A 2ICEA 1D3CA 2X0WA 3EF7A 4NAFB 4ERSL 1MFDH 1MJJA 3RZWA 2WUBH 5I9QC 3EF4A 2P45B 1TPXC 4JO8A 2NZ1A 4JANB 2PWFA 3O8XB 4MA7H 4PY7B 3BKMH 4ZOCA 4YSSA 4OCNC 2E7LC 4M48L 1OJXA 5CJQL 3WGUB 3WQDA 3EJZD 1H1NA 1K8IB 2D0FA 1W72A 2F7OA 3I6RA 1R85A 3CV2A 2RFXA 2QDHA 4WHTA 4KUZL 1ZAGA 4N3UA 5IROD 1CENA 2RFXB 4JHAL 2IKHA 2WMKA 4LB3A 2NWSA 2E67A 5DCEA 3WG7B 3TIDA 5GGTA 4P57B 3AHYA 2JKAA 4GH1A 2JVUA 1JWSB 3MRBA 4G71B 4XODA 4QDPA 4WO4D 4WDWA 4XVUC 2ZUVA 3MWCA 3A9BA 2ZKXA 1TELA 1UG6A 4O11A 3SDCB 4O0ZA 3BZEB 1ZAIA 1M1XA 4B6ZA 4LESA 4A3HA 3KLAA 2OJ1A 5AVYB 5KSBA 4PG2C 1WHPA 4NU7A 1I7TB 4R3SA 2HDJA 5KSBB 3EFFB 2YRZA 3TONA 1IAII 5I6KA 5FJTA 3NP3A 4F8PA 1HE7A 4FNQA 1MZZA 2BNUA 3DV6A 1A3LH 2Y2YA 4PGEA 3CU1A 4A3UA 2DVXA 3LH9A 4KDWA 3V4UL 5D9PA 3AZTA 4H9MA 1EC7A 4YHIB 5L2KE 1OFQA 3BHBA 5CSRA 1M71B 2ZUSA 2QHLA 3ZQXA 2IPTH 2WTPA 4G1EA 2FBRA 3U7AA 2ICCA 1K6AA 3NL5A 3TCSA 4HVXA 3CEPA 4X2RA 1E9ZB 1XL9A 4RWYH 4JFFE 3LEVH 1S2VA 2CXKA 1JGIA 2X8RA 1ISVA 3B0YA 4JZJB 4P5RA 5EO0B 3L9RA 3R11A 3SCSA 1LT7A 3EOUA 2ATMA 2EDKA 2IBGA 4KJWC 4P0DA 5CMAA 1TZ7A 4IOSA 3WZ0E 3PSVA 3OF6A 4JDVB 3FSUA 5U7SA 1CDHA 1JGVL 3BWAA 3PGDA 1M41A 2ESVA 1LM1A 1JAEA 3WTTA 4FFYA 3MV9D 3DVNA 1A0CA 1BOGB 3WX7A 4ESKA 5G2NA 4Y9CA 2QSTA 3RGHA 3FNDA 1SO6A 1JGDB 5ALCH 3W5MA 1ICQA 3KWSA 1AQMA 3MY9A 1NUFA 1E9OA 1THFD 4NYLB 4XP6L 3O81A 4QI3A 5B1JC 1LOLA 2I9EA 1VJSA 2B0SH 3GT6A 4Z77B 2XVLA 3AXIA 4NQEE 3PDGA 4ODXB 2E75C 3CSBA 1YLBB 5DA4A 4UC5A 1B31A 3UEQA 1B9BA 3UWWA 4FXKA 4YCPA 4MYWB 5J6SA 2FJHA 1QEWA 2IXQB 3X3GH 5A8MA 3HLAA 1RZIA 2FHBA 1J05A 2JJSC 2ZUUA 4OCMC 3FTWA 4DOHE 1Q6OA 3COTA 4PVNA 1FFNA 3CXFA 3MODL 3OG4B 5DK2B 4F1SA 3TESA 1B3WA 3EH2A 4Y5YB 3OPSA 5I6PA 3GYEA 3O45B 1KF9B 5JDJA 4XOEA 3V6ZA 1PD6A 1KELH 5FK9A 4D0CA 4FQHA 3LEYH 5FO7B 3ILPB 4D0CB 4DGYL 1J96A 3RWJA 5DHMC 1SYTA 1XRFA 3MNZA 3NABL 1Q9OB 4PGCB 2YB4A 3Q94A 1WAAE 1GHRA 4CU7A 2ENSA 3F6IA 4MNGE 3CAQA 1OSZA 3THMH 3B9KC 5HPCA 1FL5B 2XX1A 2EDHA 4R27A 1XBDA 4MQXD 5GRZA 3X13A 4CNUA 2F5BH 3DU0A 1NMBH 3OKMB 3QUYA 4MS8D 1Z89A 2V8ZA 4P5UA 1P0KA 3BUIA 3JRKA 5KJ7E 2VGGA 5J11B 1NGYA 1ITUA 1WF5A 5DRZA 3TBVB 1HP5A 3TEXA 4OQ1A 3ULVL 5FV2A 2Q6ZA 4ADJA 1VJIA 4CC4C 3HAEH 2BERA 2VM8A 1EFXD 3LTPA 4OD2B 1OAXH 1N6VA 5I30L 4JBRA 4L2YA 3RUGA 4AW7A 3O3AA 1XGRA 2BRRH 3NZPA 1II4E 2DL2A 5HYEA 2V33A 3OKOB 5HHPA 4DBEA 4HWNA 3EOBA 4HNVA 3O6LL 3QCUH 1U2HA 3KZ8A 1FWXA 4JO2H 4HHLA 5BV7H 2D7MA 5AC6A 4HKJB 1TFPA 1MAJA 4MD4B 5L0QC 3GF8A 2GC4C 5I71B 1ZS8B 3CK5A 4C56E 2AI0L 2YDAA 3NFUA 4JY8A 3QK0A 3DOSA 2W3ZA 1FNHA 3VXQB 4U1HB 3PAVA 5IHHA 2ZZ5A 1QPXA 1U3ZA 5DHYB 1MWAB 1X4ZA 4KZCA 1QOKA 5HYIA 1PZ1A 4P5TB 2E0PA 4NZ5A 2WWCA 2O92A 5JW5B 3SSZA 1FO0A 2NX1A 4I48A 3DUUA 3F12A 1Q94A 1BFVL 1DOSA 1FIGL 1WH0A 4D8PB 1BBDL 1IQWL 4S1RH 3GDTA 1PDZA 1IARB 2PU0A 3ARED 5DBTA 5HR6A 3IUIA 4UDTB 1U2CA 1E8YA 1JG9A 4JTLA 4GW4B 2CW6A 5E1IA 4Z3JA 1JZ2A 4W89A 3HAEG 3NCYS 4JFZH 4PV1C 4ZZKA 1MUCA 4DJFC 3FOMA 4XKMA 1E0OB 3TWAA 2XTSA 1JL8A 3HAEB 1M7UA 3STFA 2GITA 3PZNA 4RV8A 5KEZA 2WMIA 2F53D 4FG2A 4IKJA 3MLSL 3SR7A 5C6TH 3MYJB 5ACZB 1TOXA 1AR1B 4MKMA 3U0PA 5T91A 4CEXC 3QGAC 2A2QT 4F8OA 3L5LA 3H3KA 4F66A 3TJPA 2PWDA 1AS7A 4ZE4A 3NGFA 1NM9A 4G70B 4PREB 4DWSC 5BU9A 3QDJE 4F2MB 1FHDA 1GRWA 3ITGA 4IMGA 1PZ0A 3H2CA 3WLBA 2VN4A 4HJGA 1H7NA 4PRAA 1TV8A 4MYAA 1NCUA 4QYOA 4ZAKC 2ISVA 4L64A 1EUTA 4DP2X 2VDQL 1A5OC 1E1CA 2CBMA 3QJFA 3EEGA 2X89A 2QV2A 3ECBA 1PJWA 3DTXA 4BSWB 2FMNA 2APSA 4NSKA 1FGNH 1UXLA 4BJLA 1GOMA 6PCYA 4HSCX 1U91A 1UYQA 3W1PA 4ECLA 3V18A 1LWJA 3AS2A 1J1XL 3RTLA 3U9PL 2R9RA 4UFLA 4MDOA 2C7UB 2C9PA 2JKJA 4UT9A 4W81A 4OLWL 2ASHA 3W9EB 4ZB0A 4NQCD 2HVKB 4IDJL 1DP0A 1HU8A 4LGXA 2ACSA 2DZBA 3KBNA 4DGYH 1QWKA 3FS9A 3QQDA 1YEIH 1LDCA 1E0XA 1XLLA 2QULA 2BWDA 1TYGA 3ONBA 3QC3A 2TODA 1TFVA 3WDRA 2NNXA 3ATEA 2HJPA 5CHNA 2XYLA 1FZMA 5ABZA 4C6MA 2HJFA 4KK8C 1EGJL 1KCSH 4NN7C 5CHNB 4HWBH 1NPJA 5EOCH 4GNKB 3BW3A 1QFPA 4R26H 3ZKND 1CTMA 1IWPA 2E77A 1E27A 4RXFA 4EIBA 4PRHD 3S3BB 4X80L 1HTIA 3VTRA 1NA8A 4PJDA 5F4XA 2XV3A 4OKVB 2WLIA 5B38B 1DBKL 1VYSX 5FKPB 2R2BA 1F11B 1TKKA 3VD4A 3GJEA 3VNKA 4G72B 2B7NA 4IOSD 1CLOH 1AP2A 3UP8A 2XTJD 5LWYH 2AXHA 4JDEA 3HFMH 1BZ7A 3DURB 5FO8B 4KKBD 4AI7A 1CE6A 3FCUB 4PJ6A 2AQTA 3CC1A 1NBVL 5I24A 4O0QA 3DRQB 3WK0A 2YFOA 3UCQA 2CBOA 4QRQB 3S2LA 4C5ZA 4ELKA 4NS0A 3HUJF 3D39B 3BISA 4IM8A 4FQLH 2PYEB 4ML4A 4BK9A 4JTTA 3LDBB 1IGMH 5GGRY 4LVHB 4U5KA 1NDWA 3TYAA 1HOEA 3SKJL 1EVUA 3SBWA 1XH3A 3FFSA 2F8VA 1R19A 1NCCL 1ZLSL 3S36L 2Z65C 4ZMAT 1MNUH 5FECB 1QMUA 4L4TE 1PZ5A 1ASPA 4LLYB 4IG2B 2I32A 1A64A 5F1OB 3VIMA 3G7TA 2G3IA 3GSRA 4H88H 3NIGE 4HW6A 2Z1PA 2C6QA 4GRMB 4JX4A 3W7GA 2C13A 1T5AA 5FSEC 1CNVA 1OZTG 4N86A 4Y4HD 2WLJA 3CUHA 4A8IA 4JR9H 1AZRA 3K0YA 4GK8A 5EA9A 3TWCL 1A4CA 4NPJA 6REQA 1P9MA 4LGSB 4MHBA 5GJNA 2NX3A 1F00I 1GZHA 1H5BB 3UTTA 2CPCA 1CBVL 3PP3H 4JM2F 4ES8A 3EOLA 3VMOA 3GZQA 1IGJB 2V30A 3BSZH 4OF0A 3MV01 1I60A 1GGOA 1QCWA 1EHXA 1FL6A 2BIOA 4UIOA 4JMNA 1I8JA 1U3JA 1GVQA 1QATA 3NDZA 4IQLA 5C0CD 1F58L 2WXMA 2H9AA 3FOKA 1LD9A 2XI9A 4GG6B 2VDGA 3LK6A 3CN1A 2Q8AL 3N1QC 3V10A 5AC5A 2VAAA 4XNQB 1UROA 2CM5A 3SDDD 4UV7H 1FVCA 2R4RH 2QKFA 5CP7B 3P82A 1EWEA 3QH3B 1M7XA 3VJ6B 4RH4A 3GKZA 3KPLB 1FV1B 1ZGLA 1WZKA 4QRAA 2EAWA 1KRCC 3QUZB 4DJFA 1MCOL 2R29H 3GMQA 2XKNB 5KN5B 4FD0A 1F4WL 3IDYC 1YEFH 4MSWB 3MB9A 3HHMA 3APMA 1A7OH 3PWJA 4P3WA 4PVMA 4Y4FA 5D32A 3OWRA 5AB2A 3VFUA 2E9LA 1IKOP 4P5MA 1LQAA 1OYCA 5EMKA 2Z93A 3IDNA 3FB8B 3I2CH 4PUJA 1KFAL 4OJYA 1EJSC 1RBLA 3WUWG 4XPHL 1RVKA 3UJFA 4C47A 2OOGA 3NSCA 3EPOA 4NC1E 4YJ5A 4ETYA 5CFAA 4AWSA 1KIRA 1E5ZA 2Q5BA 4TQEH 3QIBA 5KVGH 1J0ZA 3SPIA 5D37A 1T1YB 4JQXC 1Z5LB 2XINA 1AE6L 2CKBA 5KVDL 2VGFA 1TJIH 1UYWH 2VDLH 4LAQL 1K7EA 3O06A 4A35A 3PXLA 1CL7I 5IK3A 4ABQA 4OCRL 4M8VA 4RETB 2CGRH 1OAQH 1HI6A 1VGEL 3LKNA 4N2OA 3HURA 5BW6A 1TTIA 5F1IA 4EUPA 3VXUE 1KIUB 1SPQA 4WJG3 3L3IB 1CXLA 2FEEL 3D1MC 4JO4L 4P99A 1DQLL 2GWGA 4M03A 4FDWA 1VLIA 4AVFA 1W9PA 2ZOTA 1OD9A 3L13A 4HQVA 4WI3A 3EWCA 1Z0MA 2DS4A 4OV9A 4QJ4B 1SW7A 5FOBB 3RYMA 5I1LA 1QPQA 2X0YA 1KCRL 1U3HB 3GSOA 4FN0A 4HD5A 4U31A 1MHPL 5IHUL 3I6SA 3ZS4A 5AWNH 2GIMA 4I18C 2NY4C 3CSTA 2PCEA 4NPYA 3BQUA 3TCXA 3O6MH 1EK3A 2ITEA 2OW7A 4QX4A 1JFQL 2DZSA 3G5ZA 5L8LB 2JALA 3CQ0A 3PN8A 1UUMA 3QDHA 4HPYH 4BEIA 1E0WA 2QUMA 3SADA 2XA8L 1Q9LB 1PHWA 3GSNA 4UDUB 1KC5H 1YYCA 5GIRA 1KGJA 3KE0A 1IO4C 4HCRL 1K85A 4AWTA 2GLKA 5G2HA 5ELIA 1HXMA 2KQMA 1AW1A 3ILDA 3W2DH 3Q01A 4KF1A 4V1XA 4M1DH 3BHBB 3EO9H 2ODHA 5E8PA 4PWEA 5D7IE 4PJ7E 5D2NA 5JOPE 5BUGA 4BQ5A 2F0CA 2QQQA 2AJSH 2VT0A 4LY4A 2DT3A 4ZFGL 5EEYA 3S2AA 4FIRA 1WT5A 3AUWB 1X1NA 4KQ4H 5CMAB 2V3GA 4ZMGA 1PZUB 3EHBD 3G1AA 5K9KA 1SJVA 3MJWA 4KT2A 2H2PD 3ERPA 2A4AA 3F6JA 3EJUA 3GHBH 1FOBA 4ZPTA 4K39A 2RHEA 1R17A 3SGDH 1J8VA 5FHAH 3PIQA 1M71A 1PLGH 3OQ3B 4QHKJ 2X40A 4P23C 1LXMA 3B6SA 4H2CA 3S6CA 1DWFM 4CD6A 4HJIA 3BMWA 5F7EL 1NDMA 4EBQL 4URKA 1XDMA 1NUNB 4OHQA 3O8XC 2GY7B 1QO5A 2IQ9L 1U8NA 1Z42A 5K1NA 3FQTA 2KERA 4WQ6A 1WXJA 4U1NA 5DXXA 3LXUX 2DGAA 3EFDH 1SN5A 3MRGA 1I8MB 1KBGH 2UY7B 2FWOA 2P3ZA 4YPGA 3QPXL 4NFDA 3K5SA 3OZOA 1ZSDB 3IN2A 4PV9B 3T8XA 1G69A 3AQXA 3NJHA 3IARA 4IGSA 4LF3B 4PV9A 4UM9A 3WLQA 2O55A 1XBVA 4AY8A 2R0KH 1IC1A 2OR7A 1XFBA 2LU4A 3A6CH 1OC6A 2GCYB 1MSSA 3UU0A 1I7RA 1CEOA 6ALDA 5KS9F 2V9RA 2V5YA 5CEYA 4APQD 4ADGA 3GG1A 4QF1B 4YNYA 5SX4H 3PTQA 3SJ3A 2Q09A 4GRWF 1JFXA 3F83A 4KDVA 3QWOB 3STPA 5EZPA 4DWSB 3FQWB 3B3IA 1GYVA 4E4PA 3O2VL 3ZJAA 1RUKH 3JT2A 1D7DA 1OSZB 2A6LA 3ILEA 4LE8A 1VRSA 4M5ZH 4NBZB 4KXAA 1FRGH 2KLSA 3WXVH 1BQSA 1WKEA 3HPAA 4JCLA 5BUAA 4LVEA 4HEPA 3KP1A 4XVSL 3ZHDA 1A5BA 2V37A 4LKXB 3UZVB 3TH2T 3WENA 5CJXA 2E47A 1KO0A 1A3RL 2ZCLL 1LLWA 2UY3A 2RBLA 4DVRH 1X4YA 1T83C 3W37A 5ICUA 3EWZA 4JRYB 3FQUB 5A2FA 1PKQB 1E6SM 4A8RA 5EBLA 4JRYA 5EU4B 4P7RA 2ZXWB 4BFAA 1C16A 2QV4A 4C4KO 2D7NA 3REWB 3RLVA 4JKMA 1TPH1 3QHZH 4WCYH 3TN0A 4A2DA 4BCZA 3REQA 4OIFA 4Q74A 3STCA 3QHMA 1AG6A 3DUGA 1XGUB 3RY5A 5IM51 1S7QA 1XC6A 3VWJB 4HFUH 1XGZA 4HC1H 4MHHI 2DSKA 3ALGA 2Y5TB 4UQIM 3JU2A 3ZVVA 4XZMX 3UZYA 3MC0A 4XO6A 5IMMB 4DB7A 1REQA 1KXHA 1PZ3A 4LW7A 5B21A 2AK4E 4AYSA 5I6NA 2DUXA 5DHXB 1MJUL 1R5WB 5C0JB 1F5ZA 1BLNA 3CXHJ 4RX4A 4XMPL 4DERA 3OAUH 3MV7E 1BF8A 1JERA 2A7PA 4GCAA 2HNEA 4X8GA 2MUCA 1JPSH 4R4FL 4WJ5A 5F72S 4ZUVA 5JUEH 2QPEB 1WKFA 4JIRA 1LQSR 4M1DL 4ZYKB 5C9JA 2IFGA 3QJHA 3NQDA 3V52L 1MHHB 2JMRA 4I1NB 3M5ZA 1Y7VA 3D09A 4YHKH 5DSCB 2A6JA 3WLLA 2X0HA 1HKFA 2C0AA 2C1OA 4DUVA 2HK1A 4XPHH 3TR9A 1CDYA 4HJJH 1Q8JA 3GC2A 1RIUH 1OHZA 5LBSA 4PJCB 2N4IA 1DVXA 4N42A 5DLML 2NY6D 1YXDA 1RZIB 3FN0H 5JHDD 4F91B 1AYOA 4P2RE 5A8QA 1Z9NA 2DYPD 4Y1AB 2X2GA 2V9TA 3O6FD 4HLEA 3GGWA 2YBTA 3LCIA 3RILA 1CLVA 3PPCA 4R88A 5EB8A 1ZV2A 4E41A 2KQNA 1F4XL 4F27A 1CLYL 4JPVL 5AKVA 4FCHA 2VDMH 2FUTA 4PREA 3RNKA 4D8PA 3BJTA 2W27A 2QVTA 5ALCL 5E5CA 5ES4B 2HBXA 3EX2A 1YPZF 2X87A 4WK4B 5DVPA 5C0CE 2LOEA 1G7IB 2DIJA 1RZQA 2IDFA 4APQB 1ZANL 4DPBX 4XKYA 3T65B 4DXXA 1YDOA 1F90H 3QJFB 5F3FA 4C6LA 5E24E 1S5IL 1G7HB 4TOQA 4MCYA 1W31A 1G7LA 3NK3A 1YQVH 2YCIX 1HK6A 1JUFA 4BR1A 5C0DA 4BXVA 3GSUA 3AROA 3X12B 2WVVB 3O2VH 4RMQA 2EH7L 1ZEAH 1SU5A 3RGTA 1FYTE 1U33A 4MNQE 4NERA 1NP0A 2YPIA 2B15A 4LYPA 2QHRL 2YPVA 1JJUA 4I9WE 5ESQB 2K78A 3SDXB 2X2JA 2P5WB 2I57A 3W39B 2OGYA 4GVHA 5LAPA 5SWSD 4ETQA 1QFUH 1QQDB 1JXDA 2DKMA 3PFMA 3AREC 2CLZA 2YGPA 5DZAA 3UJJH 1V3IA 1DQVA 1O5DT 1OAYH 1XLAA 5DS8B 2NW3B 5A2IH 1VCGA 3VOIA 3TC3A 4AZCA 2RFGA 3LS5L 4JQ3A 3FZUC 5FA3B 4GEIA 1LHZA 1QAWA 2H2SD 2ESCA 2QJJA 1NCBL 3CHQA 4DNMA 2C19A 3OQ8A 1SMAA 3TIMA 3DHJA 4BFOA 1NEZG 1FRBA 1S2UA 3TAKA 4ACZA 1UGKA 3TO4C 7CGTA 1KJVB 1OINA 3IMWA 1CXFA 2UVFA 1F42A 3QMSA 4NKMA 3WH6A 3TX9A 2ZCLH 2MPAL 1EZLA 3T4YB 1EYEA 2RAGA 3QQ0A 3BUDA 1HHKA 4XZUA 1S46A 5H94A 3T4YA 2VXQA 1HQTA 1UJQA 2FPVA 4HU3A 2OLDA 1I75A 1GXEA 1FCVA 1ZLWH 3C2OA 3DKJA 3OVRA 4LNYA 1KQZA 1W1VA 3ETSA 5BXFB 2M26A 4Q8PA 5DJXA 3T7VA 1HGYA 1GA2A 3D50A 3TOPA 2B7DT 1ZJAA 3IGAA 4G2DA 1PAMA 1MCWM 2LHAA 2E6AA 4QISA 4XMZA 1QMLA 1RZJL 1WX0A 1TITA 5JW3H 4KERA 4NAEB 4BY3A 2X6MA 4LSQH 5ACMA 1PSCA 4FYRA 3N2BA 2GZXA 3RKDD 5JNYA 5DLCA 3W2NA 2MKWA 5JQ9A 3OVGA 1O9WA 3K80A 1MRDL 4TVPE 2VUYA 5AW8B 2WZIA 4AIOA 4A37A 2DLHA 1PZ2A 2WK2A 3IDGB 4RX4D 5FYJL 2DRUA 3BVDB 2FJFA 5CN3A 1R3WA 1KCBA 4UTHA 4GFIA 3WF4A 3C08L 2Z1VA 4CCEA 1RJYB 1JE6A 5EOCL 4ATTA 1IIGA 3MYJA 1VS1A 1IBHA 2PEVA 1HG3A 5HYJE 1ME8A 5DMKA 2J7DA 2NX5A 4M43H 2W0FB 1JZJA 4GLRH 4JHMA 3SCMC 2J4WL 1XG4A 2ISWA 4B5ZA 1TQCC 4XMLL 3O7UA 3DHMA 1L6ZA 3QKEA 4ZS6D 4LSTH 4NJKA 3N12A 4K7FA 3GINA 5CD5D 4YVXA 3T42A 2LLLA 4ONFH 5HJBA 4E0RA 3H55A 3DIVA 2V2XB 4GS7B 2XH7A 4Z0SA 5PAZA 1K5NA 1N3NA 1JV5A 1SDYA 4LLDA 3CHXA 5DMIH 3R7QA 3ZDWA 3C3UA 3SD5A 1XYLA 3CIVA 2F74B 1AGBA 1KM4A 3TEZA 3EYSH 3L1GA 4R8WL 3VCRA 2AXFA 3IXTA 3L3GA 1MAML 1OPGL 4OF7A 1HH9A 2QKIB 1RK0B 1QI3A 1YNKL 3QSKB 3HZMA 5TFSH 3SDYH 1LCOA 4C7GA 3GHUA 1PHQA 3B0VC 4HEME 2VFGA 3HIJA 2XISA 1GAFH 4KU1A 1G1KA 2Z6JA 1E6PA 1CFNB 3SHSA 1HSAA 5HI4D 4KPLA 3RWGB 1JHLL 1CFNA 4QXTA 3LNMA 4F2EA 1DQJB 3C61A 4BFIB 4X0VA 3FS2A 4C5YA 4LIQE 4WCYL 6XIMA 2R69L 3KPPA 4LCUB 1QBLL 2WWNA 4MSWA 3VGFA 5T9BG 4IIFA 1NU5A 2YQ2A 1MCPL 3VIJA 5SWUA 2X6BA 3O0RH 2WANA 1N8IA 1BVLB 4X8JA 1WV7T 1O60A 4JOMA 4Y89A 3S7GA 3VFPA 2H3BA 4E5TA 4JQVC 3WYRA 4BGDA 3K4ZA 3JZYA 1NPUA 3VXUB 4W8BA 1RLWA 2NY3B 1E4IA 5IJKC 4TMCA 5C07A 1BEXA 2F8OA 1J8SA 4D0BA 4PH6A 2L5HA 2ZWZA 4A7TA 1SHXA 3BLFA 1EX0A 2AKRB 1Q6EA 1FNGB 3RI5F 1H51A 3NIGB 3IACA 1JV2B 4FXTA 4UM8A 2AF2A 1KCRH 4FG6C 3URAA 5F71A 2YMTA 4Z7VA 1C5BH 1HXKA 1URLA 3UBHA 4YMPA 1VPYA 5A1AA 3LN9A 2JIXB 3QV9A 1XCQA 1RZGA 3FT3A 2E3ZA 2OX1A 3ULUD 2YLAA 2WBJB 4U6VL 5KYWA 5CJNA 5HI3D 3SPVA 5TQ0H 1QW8A 1NC2D 3OX8A 5E1GA 1KCUH 3CIQA 5I8EB 1AR2A 3QR3A 4YHZH 3QQ1A 3QZBA 4MYXA 4XZHA 3NPXA 4RDYA 1I8AA 2QQLH 4B60A 1BOYA 2YIHA 4PJ9B 3T0EE 1GOXA 1SYVB 1OX6A 3MRIA 5DYOA 3B5HA 3CZJA 2FECI 3FCSA 1TO3A 1EEYB 3FQRA 3RU6A 2PW1B 2OKTA 2UVEA 3ZWSA 3CFIC 5CC7A 4PJEB 1O68A 4LOUD 2NUWA 3OKEA 2DI8A 4NGHH 2WMHA 1Y5WA 5F1VA 5CCKL 3VVVA 3ZVHB 4M7LT 3A3YB 3K72A 5TDNA 3CVHH 4K5OA 4YHYC 5M95B 5I3GA 2OL3L 1AHWC 3OZ9L 4OGXL 3CMOH 3UYPA 1DHKA 4ZQKB 1OD8A 3WD5L 3BP7A 4KGLA 2CKBH 5HGBA 3OKKA 4UFJA 4C91A 1GUVA 3T6CA 4H40A 4AZ7A 1FL3B 1CG9A 2NX9A 1N12A 3QUML 4IRZA 4P57A 1Z9AA 2CZDA 3ZJKA 1EXUA 3DX8B 4Z08A 4MMZC 3NSFA 3VSTA 5I1LB 3FO1B 2Q02A 2Z4GA 3V35A 5HHVH 4UQ3B 4PJXA 1AXTH 4N24A 5DGRA 5BO1L 3STLB 4ZMTA 4CCCA 1P6CA 2BG5A 2JKPA 2OAAA 5BQ7B 3C2FA 4UOW1 3DI1A 2GQ3A 1CU4H 3MFFB 3O4OB 3GXDA 2R15A 5JYLA 3KPQA 3S37H 1D7FA 1D5MA 2BK8A 3CX5J 4WW2B 2ZYHA 3TZVD 2CLHA 4BJHA 3VYNA 1LLAA 2GFTA 4ZQNA 1YEJH 5CPNA 3KPMA 3QFWA 1RUPL 4DPAX 5DBUA 5ABTA 1N10A 3CUIA 4JL2A 3AAZA 3I6GA 4E9SA 3CIXA 3B9AA 3ECQA 2F53A 4EI5D 4PCKA 4XWOC 5BVPH 2EKSA 4NQED 1KWGA 2G4FA 1GOKA 3HI5L 4JE4B 3VUSA 2YXGA 4CL7A 3BXWA 4PEKA 3T3MB 3KHQA 1OE3A 4N28A 4HP5A 4N2HA 3RVWC 2JJSA 3IMTA 3WO3B 2HPIA 4HPYL 4K8RD 3DSNA 5FGRA 3BZ5A 4XSMA 1LWRA 5HWJA 2OZ8A 2VGIA 3K5XA 4NL1A 1V10A 5GJTL 1ZTMA 3WL9A 5A7EA 2JF1A 5EUOE 1IM3A 5GGSY 3ZKXB 5A6IA 2XN9A 1PS9A 3V95A 1RP9A 5I1AB 2RUSA 4LNRA 3O0FA 4QO1B 4WI7A 2WPBA 4U1NB 4YDMA 4PMOA 2VTFA 3TF7C 3N34A 2RDTA 4OLVL 3MUGB 5DEFA 3U2SB 3F4CA 3S4SA 4N0UA 5D8JH 1KT2B 1IEVA 1SZGA 2G8ZA 15C8H 1B0IA 1ZL1A 5FOOA 1DVFA 1EAJA 1XLBA 1FDYA 5K7JA 2B4CC 4OCYL 3EX4A 3G8RA 2A9DA 4L7ZA 3QWRD 3MPCA 1JGVH 1HQ4A 1UD4A 4FZEH 4X6DA 4KGJA 3B06A 4HYRA 3NUKA 4KJWD 1VHNA 4OCLC 3SE8H 4A3RA 3OGOE 1H3XA 4XHQA 4N0UE 1EJ8A 1N5AB 4ZD3L 3T6VA 1KLUA 5B39B 2O72A 3FQWA 3GLEA 2ZAGA 1K3ZA 3BJLA 1J1OH 3SDDA 3AIWA 2VC7A 3HJEA 1JPTH 1YEHH 3PABA 3LQZB 1GS6X 3H4XA 3T2NL 3CUPA 4HSNA 1P43A 4BFNA 2JK2A 2WKJA 4EE9A 1CE1H 5AB9A 3KHJA 4GAGH 2VDKL 3BJ91 1Q2SA 3GI8L 1H1ZA 5K9CA 2CZNA 3DO7A 1W5PA 3FKUS 5EEWA 4IP7A 3FK4A 2CHNA 4L2LA 4GRWH 3TC6A 1OP3K 2YX0A 1XTMA 3NGJA 3SY0B 2FSEA 2E6YA 2CRYA 4D3CL 4ODWA 1S2CA 4O50A 3QRBA 4OTKA 4NN5C 1SQ2N 3V6OA 1R47A 1MQQA 1SEQH 5BZXA 3WJWA 3ABRA 2V2DA 3T0CA 3ZYJA 1TPWA 5D2VA 2DJMA 1OGTA 4BH8B 1EGJH 4OLZH 3H22A 1HXYA 2R2CA 4K3DH 2OK0H 4ZXBA 5I5RA 4WJXA 2PW2A 2Z8VC 3HQNA 2WHLA 5I75B 1E2WA 1XF4A 1SZFA 3BIAX 3RDTC 5F0PB 3WN5B 2DKSA 4M6NL 1NARA 1V5XA 4F57H 4XP1L 1MCBA 3OPUA 1AGEB 3Q44A 2FGLA 2R24A 3TLRA 3VACA 2EVFA 1G4TA 2X2UA 2J56A 4BA8A 4CD8A 4QQUA 1INEL 4ZPVA 2XPGA 2ZP0T 4NOBA 3NXFA 2DIEA 4F5CA 5IHSA 1E6JH 4Y8AA 4YDLB 2B59B 4OJAA 3B9KD 4P3CL 2E6FA 5LO7A 5T3XH 2JKEA 2VFHA 4WO4C 4Z7UA 5REQB 3VABA 1BA9A 2PR4L 4OUUA 1FWDC 2RGMA 1EXHA 3AFBA 2J57A 3CDZA 2VLKE 4O19A 1N67A 4IXHA 1ZVSB 2ZTBA 4OH2A 2NQ5A 2NQ3A 3DXAB 4IEFA 3GG0A 3GIQA 1ZVSA 2VLJE 5D7LA 5LG1A 1FO0B 3UESA 1HHIA 2WLYA 2YZRA 5EBMB 3GNOA 4ZRGA 4IU2B 2A99A 43CAB 2VDRL 1NBQA 4R4ND 1WUFA 1KTCA 4U1IB 3V8CA 2Z8SA 3LSOA 3INPA 2ZE0A 2CLEA 1TIWA 3QI9B 1BJMA 2YLKA 2P1YA 4YZFF 3UGVA 2CZVA 4WW1A 1CGUA 1CT5A 2V6HA 3HE7C 4KTDH 4MCNA 1SXNA 1UM4L 3PZOA 2HVJB 2VYRE 3MFGB 2VD9A 4F0RA 1IGTB 2O26U 3MRQB 4LIQL 5CD3A 2HK0A 3L3DB 5E93A 2IBZX 4N8CH 5E0QA 3MRJA 3VWKB 5J13B 4KI5E 2PXYD 5KG9A 1OZMA 4MMZA 3L4CA 4HHPA 2EQDA 3BGJA 4Q7BA 2EUVA 3TBBA 2HTLC 2IVFC 3LVTA 1K6WA 2OXNA 3R2GA 2OMZB 4Z8FH 2JI3A 3APFA 1N5YL 1QNOA 4CAGA 4QQ3A 2WXIA 3VINA 3CIAA 2VLLB 5AVRB 2APBA 5DT1H 5C0FA 3BPLC 1VD6A 4PRDB 3WFDH 4HNCA 5LNDA 4IPJA 3IE9A 4H25B 4B3LA 3MNZB 2VZUA 5JPMC 1EHAA 4KKCC 4DH2A 4K68A 1BMZA 5DCDA 3HHRB 2O7SA 1IGWA 2HVNA 5BV7C 4QAIA 4ZQRA 1UGNA 2BIQA 2UY6B 4FXSA 1G7LB 2OWCA 3QOMA 1TTPA 4I3RL 2GL5A 5L4MA 2QNEA 2DFAA 5F1SA 3W27A 2E5CA 1CICA 3I75A 5C7ZA 5GRUL 1RUAL 3APNA 4DTGH 1GEQA 1DE4B 3MV8B 1R3SA 4J3OC 3AM8A 1A65A 1YEEL 2A6DA 1MQ8A 2CWRA 3PWPD 2XBDA 5EWIL 3MP5A 4WUUB 3QYCA 4G1MB 4BZYA 1EDGA 2JWYA 3HV9A 4HCHA 4DZ5A 4F0HA 3GHEL 2HT3C 1AANA 5C09E 3W39A 2IDCA 5T8IA 3ZDXF 3WLHA 3PQYA 4A3QA 4KESA 1MCLA 4Q8OA 3WS3B 4N6FA 3SKMB 4MD5A 1F7BA 1ONRA 3GBLA 3GMRA 3UZZA 3SPHA 2LAAA 4I8DA 1GZPB 3O07A 4HYVA 3VKDA 4NC1C 3VWJA 4MBRA 1TKWA 2G3NA 2O4EA 3C08H 3EDDA 4KKQA 5DCCA 1A4JB 3KPRE 3HG1B 3ZMNA 4CU6A 1FXPA 2Z1BA 3IJLA 3TDFA 4DO7A 2R4SH 2WLZA 2AV1B 3BQUD 3BUTA 3SDCD 1QR1B 3NAVA 3IAQA 3GIZL 4RGMC 4GFSA 3LEXA 3W81A 4AH7A 1CGXA 3WDIA 1KM5A 3VX0A 3W26A 1OANA 3IWUA 1J9CT 3JWNC 5EBWA 4KV5E 1RURL 3PWVB 4IUOA 3UWUA 5D8ZA 1KPRA 4YN3A 3M5VA 3TYBA 2VJ8A 5SV3A 1I9IL 3P30L 4X9SA 3IFOB 4LTSA 4OZ4A 4X98B 4LNCA 3OJMB 4XZ4A 4TVDA 3DVGB 4AVNA 4JAMA 5AHIA 2XQ0A 4ENED 4L9LB 4M48H 3P9WB 3V0JA 3ZKMD 1KDI