3L2MA

X-ray crystallographic analysis of pig pancreatic alpha-amylase with alpha-cyclodextrin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGQDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystallographic analyses of pig pancreatic alpha-amylase with limit dextrin, oligosaccharide, and alpha-cyclodextrin.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l2mA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l2mA01
4EE9A 1BSIA 3ARUA 1E6PA 3ALGA 3U5UA 2EPNA 2BY0A 2XFRA 4W93A 3IK2A 2Q8XA 2ZICA 2NT0A 3L2LA 1SFSA 1WDPA 1NWTA 3DX3A 1V0KA 4WLCA 4CU8A 2DIEA 1D7FA 4P7OA 4D6GA 3CGTA 3PZTA 2YBTA 1ISYA 1W3JA 5CG0A 3TA9A 3HG5A 5EMYA 4PRWA 4UQ9A 1GOKA 1J0ZA 5BRPA 2E8YA 2F1AA 5M03A 5C8BB 4CU7A 5HPCA 4AD2A 4CCEA 2J78A 3L4ZA 1W3KA 2ZIDA 2YBUA 3IGUA 5A8OA 3WF4A 2YL6A 5CGMA 3D51A 1BGAA 1X6NA 3UETA 4TX8A 2JEPA 1JDAA 3PN8A 4Z2JA 3LRKA 5A8QA 2QPSA 4UOJA 1ZU8A 1XHGA 1GVIA 2ZUNA 2OYMA 1ZBWA 1MW0A 3E1F1 2CBUA 1GJUA 4UQEA 3BCDA 1CXEA 4IISA 1Q4NX 3W24A 1UD8A 1JGIA 1GHSA 4FNSA 2V5DA 5CJ5A 3A4XA 3WDIA 3O2LA 4S3KA 5FD0A 4WF7A 1H2JA 2WC7A 4W84A 3AHTA 1TVPA 1TA3A 1B30A 1LG2A 4AIOA 3CZGA 2A3HA 1PIGA 1E71M 2CEQA 4D72A 3AXXA 4HZ7A 4OOUA 3WF3A 1PIFA 3ZSTA 2F7RA 2G4FA 3RM8A 2VTFA 1WE5A 3VGGA 1TCMA 3GDBA 4Y7EA 2DT2A 3O6AA 3U7BA 3O9NA 3ARSA 5ABHA 3AIUA 2EADA 3AMLA 1XH1A 2OWCA 1JZ7A 3KEHA 3BSGA 4CVWA 1JI2A 3WY3A 2JF6A 3AICA 5D8ZA 5A6SA 1HKKA 1H0IA 3W81A 2PWHA 2VRQA 5A8PA 4TTGA 4TTUA 4ACZA 1RPKA 3VX1A 5CPTA 4X0VA 3WY1A 4JKMA 2D1ZA 2G41A 4D6JA 2WBGA 2D3NA 1K6AA 2XFYA 1KWGA 4DUVA 1E6QM 3BUBA 3K1DA 2UY5A 1K9TA 5CZKA 1FH8A 2XHYA 1J0HA 4OUEA 2W63A 3A22A 3UG5A 2VR4A 4Z2GA 1K9FA 1XH2A 5FOOA 2G3NA 3WH7A 3THCA 1DWFM 1XCXA 1WDQA 4GI8A 2VZVA 4ATWA 4AZCB 4PUDA 4WKHA 2A3CA 1Y7VA 5GPRA 1WPCA 3KZSA 5LA2A 1BQCA 4HMCA 2VOTA 1HWWA 3VGFA 2XIIA 1UR4A 2D0FA 1UWRA 3NJ3A 1WP6A 1US3A 2J7GA 3WDRA 1B3WA 2O9RA 1JF5A 4GQQA 1PX3A 3PTMA 4Q22A 1R33A 1KGWA 3PTQA 3IJ8A 2CBJA 1HVQA 4J3XA 3WFZA 1LL7A 2JIWA 2QHAA 3NYDA 4M24A 5I3DA 3D4YA 1QNQA 2PWEA 3GH7A 4PYSA 1FA2A 1E0WA 2DPEA 1UR2A 3HG4A 1QW8A 1J10A 5E0FA 2X0HA 2YLAA 2EABA 4JL1A 4ZXOA 3HG2A 2MANA 4BZYA 4DWSB 4JFWA 3KLLA 2X8RA 1KGXA 3ZSSA 4KRUA 3S6TA 2XN0A 2Z1SA 4CKQA 3QR3A 4L4OA 4AIUA 2IXUA 3ARQA 1JYXA 5CGTA 4ZE4A 5IHSA 1KFWA 3IAQA 5JBFA 2QMKA 2O9TA 2VJXA 3AOFA 4AZ5A 1W9PA 3W26A 5D9PA 3WKZA 3CMJA 2XPKA 2C0HA 2J7BA 3DDFA 5E9AA 4YHEA 4B9ZA 1VFFA 1E1EA 1QPKA 3HMCA 2OW6A 4UZUA 1E73M 3SUWA 2E0PA 3WF2A 1V3HA 4M81A 3LPOA 3ARYA 4J7RA 3SEPA 3RO8A 1VAHA 1ZBKA 4MDPA 2WC4A 1HJQA 5CPQA 2ZUSA 8A3HA 1MYRA 2FH8A 1JYVA 3MI6A 2D0GA 4EANA 2BY2A 2BHUA 3A21A 2DH3A 1JI1A 3KL3A 3AJ7A 2YA2A 3MU7A 2D20A 2VX6A 4FNUA 1SR0A 3K8LA 2VX4A 3VDBA 2EEXA 1QI5A 2XM2A 1MXDA 1C8QA 1UD4A 3WNOA 2V5CA 5M5DA 2E4TA 3S2CA 1EHAA 1CENA 3W4RA 3L4YA 2GVYA 3WUGA 4KGJA 5CSUA 4ZFMA 1MWOA 1AMYA 3WD4A 1FHDA 3T0DA 2WHMA 2ZWZA 2WHLA 3U57A 2E8ZA 3VM5A 3BAYA 2PF0A 3AZRA 4U5KA 3CHDA 3CHEA 3WY4A 1TE1A 1IT0A 2V3EA 3DYMA 4XUYA 3WY2A 5LA1A 1QNPA 4PN2A 2VRJA 3AS1A 1J0IA 1LQ0A 3A3HA 2F2HA 3SCVA 2WC3A 1VB9A 3WQ8A 1R47A 3ECQA 3FY1A 2VO5A 2Y2WA 1GVYA 1WO2A 2V3DA 1BVZA 4U5IA 4W88A 1EO7A 5I2UA 3AHZA 4LGXA 3CZLA 3VDAA 1MQRA 1Q6FA 3TP4A 2ZUUA 1JAKA 1HJUA 4U2ZA 2D24A 3VIFA 2WVTA 4IUGA 5EFDA 4WK9A 5ECUA 1GUVA 3WDPP 1R7AA 3LX9A 3ZIZA 3WL1A 3CHFA 5HPOA 3I3BA 2QMJA 3BVTA 1BVNP 1JL8A 2ZUVA 1CDGA 2YL9A 1HN1A 3VSTA 3W29A 4M8UA 1WB0A 1UR0A 2WCGA 2XGBA 5CXPA 3VTRA 1UD3A 3EJRA 5HXMA 4JAWA 2YIHA 2YFNA 1K9EA 4GKLA 2JF7A 3HJEA 2VUYA 4F8XA 2VT0A 3GNRA 4UQBA 2FYVA 3BCFA 2CNCA 4W8AA 1NP2A 3L4TA 1XV8A 2BFGA 4CD8A 1UR8A 5GQBA 2C8NA 4AY1A 3ARPA 4V28A 4HZ8A 2VRKA 1XSJA 1UZ4A 3T0BA 1VBUA 3CH9A 3PTKA 2BS9A 3RMEA 2CETA 2GJXA 3ZJKA 1UQYA 3CC1A 4V27A 2XVPA 5AC5A 3OG2A 1C3FA 3CHCA 2D0HA 4S3JA 3IJ9A 4JHOA 2XSAA 1EO5A 1PZ2A 2WK2A 2V3GA 1RP9A 1QOXA 4CCDA 2VL4A 4AD4A 4WSKA 3WQ4A 1XYZA 2Z1KA 1JNEA 4C7FA 3ARXA 4M29A 3LPPA 2GJPA 1UG6A 1W1TA 4J3SA 1OT2A 3LPGA 2D2OA 3MO4A 3II1A 3QOKA 1JZ8A 4IPLA 4E4PA 1UWSA 2OSYA 2VQTA 4K68A 3EYPA 1H3GA 2IUZA 8CGTA 2DSVA 4FLRA 1W2PA 4P8XA 3EDKA 3AQUA 3CZKA 4LQ1A 1VFUA 3GTNA 5IFPA 1GQIA 4PTXA 4HMDA 4NRRA 1UA3A 1B3YA 2F18A 3AXIA 4GQRA 4H41A 1E56A 4BA0A 3CLWA 4W89A 4MAZA 3AHXA 3ZOAA 1E55A 1CLXA 2YLLA 4NXSA 3EJSA 1MFUA 5D4YA 1TUXA 5E6YA 3MKKA 3EMQA 1KR1A 3UR7A 3SUTA 1V08A 5GNZA 1H1NA 1JFXA 4W87A 2X2IA 1G01A 5LYRA 5ABFB 1WZLA 1FH7A 3KL0A 1B90A 2J8GA 4L4PA 4C7GA 3S5ZA 1OINA 1VIWA 1DWAM 2DGAA 1SMAA 1CGVA 2ZX8A 3OZPA 4AMWA 4E8DA 3WUFA 1J18A 3SCSA 2ZXAA 3SIMA 2OWWA 2BVYA 4GI9A 3WUEA 3BAXA 4LPCA 1PBGA 1LL4A 3CUIA 3BVUA 2X2YA 2J62A 3L4XA 2QPUA 1FP8A 4UCFA 1GZJA 2OSXA 1H5VA 2WLZA 2VMFA 2A3BA 2X1IA 1HIZA 4AW7A 1CXKA 4LX4A 3BUPA 1UH4A 3HG3A 3WNLA 2J75A 2PWDA 4QDMA 3SUUA 2F7OA 3GXDA 1EQPA 2JFEX 1PAMA 2YKKA 2WNWA 3GXTA 3BLKA 2GDUA 2PBOA 3HU7A 4BF7A 4JFTA 3K8KA 3M07A 3BXWA 2XUCA 4UFJA 2ZWYA 1ODUA 1C7SA 3AIRA 1ZBCA 3W28A 1LG1A 3ARRA 5BCAA 2WBKA 1OM0A 2BVDA 1KBKA 4C7DA 2X2JA 2J7EA 1CBGA 1BYCA 3IJ7A 1B9ZA 2WVVB 3TTSA 1L0PA 1HNYA 4V2XA 4CD5A 2XVNA 4UNIA 4TXEA 1C91A 3M7SA 2W5FA 2VZSA 3GXFA 1LWHA 4PCSA 2UY2A 3D3AA 3G6MA 1E3XA 1AQHA 2ZXBA 2X09A 1HP4A 4HU0A 3ZO9A 1BG4A 4A3YA 2J25A 4Z2HA 3SCNA 4XB3A 2B31A 1KGUA 5FIPA 2WB5A 1CTNA 2WMGA 1GOWA 1J0YA 5A6AA 2ZX5A 2W67A 4F79A 2F1BA 1ZJBA 4QLKA 4AEFA 3OGSA 3A4WA 1XCWA 4HU8A 3EJQA 3EDFA 2XFFA 5AYBA 4EK7A 4OJYA 1V02E 1DWIM 1A47A 3MANA 1BFNA 2PC8A 2BVTA 3LXBA 2E40A 1OT1A 1CPUA 1TMQA 2W92A 5KZ6A 3CZEA 4NZCA 1XH0A 3RDKA 2CYGA 4LYRA 2DH2A 1WNOA 3VD7A 2OLHA 4F9JA 3VD9A 4AMXA 2ZUTA 1EDGA 4M82A 4FLSA 3PHAA 3RILA 4PMVA 3KWXA 2VCAA 3AS3A 2W91A 1CXHA 3OLGA 1PX8A 4KMQA 1EXPA 1KTBA 4FNRA 3UCQA 3AS2A 4PMUA 3T0AA 2YDQA 2EPLX 3ZR6A 4M80A 1B3VA 4MADA 2A3EA 3VNYA 1PEZA 3DYPA 2F8QA 3WMBA 3GBDA 3MMDA 4W86A 1US2A 2J4GA 3VIKA 2XGIA 3PZ9A 1GQLA 3N1AA 1UYQA 4MB1A 3WEMA 5D8WA 1GNXA 4MNKA 4CGTA 1OWQA 3N9KA 1Z32X 2WKLA 3VIPA 4YHGA 5AC4A 2WSKA 5HBFA 4HOXA 2J74A 1HL9A 4JL2A 3GBEA 2XTKA 5LA0A 4PMQA 2WMIB 1H11A 3BAIA 2F61A 4MPKA 1OCQA 2E9BA 1JF6A 4KWUA 2EXOA 4JFUA 4P7NA 1EA9C 3WNPA 5CLWA 3VMOA 1B31A 2WLYA 2J7DA 1UWIA 3DX1A 2WVUA 3GNOA 3FHAA 1XRVA 1V3IA 3WQWA 1QBAA 1ZS2A 1CGTA 1TVNA 2XVLA 4CVUA 1QHPA 1ZJAA 3ZJ7A 4CD7A 4UOZA 1UA7A 3SUVA 3CTTA 3VIGA 5GNYA 3BAWA 3LXCA 3N12A 3VILA 5A94A 3WEZA 4PTVA 2ALWA 1R8LA 4TVCA 4AWEA 1HT6A 1TQWA 2O9PA 2QF8A 2FE0A 2WVSA 1UKOA 2VQUA 4DWSD 5BWFA 4ML4A 1MQQA 3AIBA 1QHZA 1HXJA 4B16A 4DWSC 1CLVA 4JKLA 3WF1A 5IFTA 1UR1A 1R46A 4DO5A 3AROA 3PZVA 4FLQA 1O7AA 4UQAA 3VSVA 2CKRA 1W9VA 1LF1A 3WMSA 2V3FA 5M3WA 3W27A 3W6LA 2CKSA 2PBGA 5A69A 4UR9A 1M03A 3UEQA 3WNKA 1DHKA 2WMJA 1W9UA 3UG3A 1AVAA 1E0XA 4M1RA 4J3WA 1IZKA 1NWUA 1S46A 4PMYA 3OGVA 4UFLA 4BQ5A 1OBAA 5FKYA 3AMCA 2F7QA 1KXVA 3WH6A 4FNPA 3F4VA 4DM2A 2IXVA 5E09A 4HZ6A 3MSGA 2BNJA 4D6CA 1J0JA 3WBEA 3DX4A 2D3LA 1BAGA 1NOFA 1R34A 1W3HA 1HJXA 3BMWA 1RP8A 1UR9A 3T2OA 3AIQA 2QLYA 4UQCA 2CPUA 3D4ZA 3EJTA 2G8ZA 4ZXLA 4E2OA 2YA1A 1BTCA 2D23A 2VX7A 5F7UA 2WWDA 2J7FA 4CCCA 2XM1A 2GDVA 2XVGA 4TVUA 3ARVA 2YFOA 3DHUA 2CHNA 2FGZA 3M6DA 3VGEA 3U7VA 2PWGA 5D9MA 3RJXA 5GNXA 1QW9A 3TTOA 1E15A 3VSUA 1BYBA 3HN3A 4ATLA 1F4AA 4PSRA 1JZ4A 4Z2KA 1UKQA 1ESWA 3I3DA 3QHNA 4H7VA 2AOSA 3MMUA 3W82A 4JHZA 3AIVA 1PX4A 1D2KA 1ISWA 1UD2A 2J47A 1HXKA 4NZFA 3OIHA 3H54A 1U30A 1QNRA 2EO7A 4PSPA 2EPOA 4PMNA 2DQXA 3GXPA 1MQPA 4FNTA 1EDQA 4GIAA 5BYWA 1MXGA 4HOZA 3WDHA 1W1VA 1J0KA 3SCRA 1HVXA 4P7RA 3A4AA 3FNDA 4D6EA 3NSMA 3BGAA 4MJ2A 4FK9A 4AZIA 1D3CA 4BQ4A 2VCCA 4HMEA 2QV4A 4OZOA 1M7XA 4B9YA 1E4LA 5DF0A 3OZOA 4ZE5A 1W1PA 1V6XA 4DM1A 1KQYA 1XGZA 4U33A 2XYLA 3WNMA 1E70M 5CPSA 2XIBA 2XN1A 3MV11 2OYLA 4UFHA 3LRMA 4P7LA 3AIEA 3D50A 3CZNA 1UH2A 1OD0A 1JZ2A 1W32A 5HDRA 5A6MA 3QHOA 2E9LA 1HL8A 1CECA 5BXSA 2OSWA 2CBVA 3A6OA 1FP9A 4X9YA 2PB1A 1R86A 2JIEA 3L4VA 4U31A 2Y24A 4HOWA 5HNNA 1JDCA 2ZE0A 3CUGA 5D9NA 1TQUA 2WSPA 5C71A 1FHLA 1DP0A 1E0VA 4MDOA 3RJYA 2ZUMA 3NCOA 1ISZA 4MAVA 1VBRA 2WAGA 4P8UA 2W62A 3THDA 1QX1A 3APGA 5FCZA 2J8FA 2VR5A 3WH5A 4D6DA 1C8XA 1QNOA 4H2CA 2W61A 5E1QA 1V3KA 2WMFA 1ISVA 1DWJM 3AMDA 3SCUA 1DEDA 2OW7A 3BLPX 4DO6A 1QVBA 3W0KA 1NQ6A 1GW1A 1C8YA 4JZ5A 1LWJA 1XSIA 1W2VA 1AQ0A 3W25A 3OBAA 2DSZA 3U5YA 5I77A 1OGSA 4ZENA 2YL8A 2ESCA 4OKDA 3L2MA 2XVKA 3MUZ1 5I0DA 1BLIA 1KTCA 2JALA 1N82A 3ZQ9A 1E6ZA 3OA5A 1E5JA 3WQ5A 4W8BA 3A24A 4AD5A 4XV0A 4J3VA 4AZCA 2OWXA 1W1YA 4DO4A 1JFHA 5A2CA 1B1YA 2DSWA 1HP5A 2UWFA 3QGVA 1GQKA 4N42A 3EDJA 2EBNA 2WCAA 3RPMA 4MB3A 1OGBA 2YDSA 3CPUA 6CGTA 2WMHA 3W53A 1C93A 3RCNA 4YPJA 5JIWA 1E6NA 1TQVA 4H8HA 3RM9A 4RE2A 3BH4A 4XZBA 2O9OA 1B3ZA 1GOIA 4JCLA 3TOPA 7A3HA 5BRQA 1XD0A 3FHQA 1FH9A 3TONA 1EQCA 1GORA 4QLLA 2C7FA 3WMCA 2VZOA 3ARZA 1BYAA 4AZ7A 2UY4A 3KL5A 1PPIA 4RE4A 4B3LA 1CXLA 4FF5A 2WW5A 3WH9A 2YOCA 4OGZA 3H55A 3VMNA 4QLJA 4D71A 5JUVA 3WDQA 1NARA 2J77A 4A4AA 1WKYA 2XSBA 3VU2A 1PZ3A 2BY1A 1J9YA 4RL3A 1QWUA 1LLOA 4U3AA 2CXGA 4HA1A 3WELA 3K4AA 1V6WA 1VFOA 3VPLA 1XC6A 2BXYA 2J79A 4QFUA 3B9DA 4DUXA 1UHVA 3FW6A 3BVVA 1BPLB 1GQJA 3W38A 4GO9A 1E43A 2VNCA 3RIKA 1EIBA 1V02A 2DIJA 1HTYA 1WZKA 5ABGA 3F5LA 1DWHM 2Y4SA 4IPNB 4NSBA 3VX0A 1K9DA 3SCPA 3OB8A 3GXNA 4N0RA 3WD3A 3NIYA 1U2YA 3ZJ6A 4FNQA 3FXYA 1X1NA 3CUJA 2WYSA 4PBGA 5DO8A 2PI6A 1UKTA 2WANA 2ZX6A 4HTYA 3DECA 3EBVA 3PBGA 1EH9A 3BUQA 4GINA 1H49A 3WEOA 2WKGA 3T08A 2WMIA 3VGDA 3WSUA 5DMYA 4CUCA 3CZJA 1VEPA 1OGGA 3ARWA 4NI3A 1J01A 1X6LA 3WQVA 2X0YA 4IM4A 1KQZA 2YDRA 1R85A 4GI6A 4HP5A 1KWKA 1GOMA 2WZHA 5JIPA 9CGTA 2WZIA 1A3HA 1HX0A 1TG7A 1E6SM 1PS3A 1SZNA 5JBDA 4AZBA 1E4MM 1V0LA 3TTYA 3QOMA 4W8LA 1OIMA 1KR0A 1NOUA 1RD6A 3T2QA 3SCTA 3WENA 1W91A 3OLIA 1HJWA 1HKIA 1Q6GA 1JNDA 2E3ZA 3GH4A 5A8MA 1LJYA 1EGZA 3MS8A 1QI0A 2XJ7A 3BC9A 3VM7A 2WXDM 1QWNA 4D6FA 2Y5EA 1JD7A 3MUIA 3ARTA 4JKKA 3EJPA 2TAAA 2E9MA 1BG9A 1G0CA 5EFFA 5KEZA 2WHKA 4QP0A 4W7VA 1G5AA 3AISA 4OBSA 4MNLA 1GCYA 1JYWA 1QBBA 2W66A 1GJWA 4D6HA 1KXTA 1V6YA 4J28A 4UFKA 4D1IA 4PMOA 3BAJA 2CIPA 4UQDA 4LYPA 3BMVA 5CSYA 2XN2A 4J3TA 4BCEA 3N17A 1T0OA 1C90A 4AISA 4BQ3A 2G3MA 1HJVA 1GOQA 1DWGM 1H41A 3PZGA 1B3XA 3PZMA 1VEMA 4MTVA 1GPFA 1XYFA 1MW2A 3D52A 1G9HA 4WIWA 6TAAA 3BVWA 3PZIA 3BVXA 3G6LA 3POHA 5TD4A 4GO8A 1MVYA 3GNPA 3N15A 5I23A 1VF8A 3GXIA 3AYSA 1UKPA 4AD1A 7CGTA 3UESA 3DX2A 1DTUA 4AZ6A 5AY7A 3VIOA 1O7DC 5DEZA 3VMPA 4MNMA 3ZMRA 3SUSA 3LRLA 2VCBA 3GXMA 4WKFA 3K8MA 3B9EA 2YL5A 1BHGA 2CHOA 3I3EA 1HKJA 1CIUA 4UOQA 1E4NA 4AYGA 4MB4A 3VINA 1JZ3A 1NOWA 2WWCA 1UWQA 1WDSA 1YHTA 3POCA 2XG9A 3CIVA 2VZTA 4F66A 5A1AA 1V0NA 2RGMA 3GH5A 3AZTA 5I5RA 2EJ1A 1EDTA 4LYQA 2F7PA 1XSKA 2VC9A 3W37A 3WIJA 4AYSA 2ZX7A 1HJSA 2Y8VA 2FHFA 1WCGA 3EDEA 5D9OA 2CERA 3K4DA 2IGTA 3CUHA 4NRSA 3N04A 1BYDA 4JFSA 1UQZA 2GK1A 5A8NA 3NSXA 1M01A 3VD3A 1U33A 1B0IA 2JEQA 4X0NA 5BXPA 2YJQA 4WKAA 3A23A 5I79A 1E40A 3TV8A 3K46A 4PMDA 4GZEA 3BAKA 3H53A 2CESA 3VDHA 4CN1A 3WBAA 4RE3A 4QCFA 1GHRA 4NF7A 1OB0A 3MUAA 1JZ5A 1ISXA 1EOMA 1WDRA 2Y8KA 3VD4A 3UERA 3BLBA 1HKMA 3PZOA 5ABFA 1GONA 1J12A 3NSNA 4MB5A 1UOKA 2OYKA 3VGBA 2GFTA 3OLDA 4P8VA 2BXZA 4J27A 4D1JA 4J3UA 5A6JA 4AD3A 1M53A 3SCWA 3MMWA 3WDJA 1I1WA 2CCRA 2BHYA 1NP0A 1OSEA 4ACZB 4R5EA 3AMGA 2NT1A 1HF6A 4Z2LA 4GZIA 3SCQA 5I78A 1MW3A 3ZJ8A 1TR1A 5FL1A 3WH8A 3NUKA 1R7OA 2J7CA 4FLOA 3OLEA 4HA4A 5I24A 3PZNA 1NH6A 1JIBA 3PZQA 4ACYA 4DWSA 4W5UA 3VVGA 2EPMX 1W9XA 5HOSA 3ALFA 4AC1X 4H04A 4W7WA 4D6IA 2VVNA 1UASA 2O92A 2W4XA 4P8WA 4NX0A 1QHOA 3VGHA 1AQMA 1CGWA 4ATDA 2WM0A 2GSJA 4CD6A 2DT0A 2G3JA 4UTFA 5A6BD 2FDMA 4CD4A 3BSHA 4B15A 2PWFA 4JFVA 3BUDA 2ZX9A 3AMKA 1FFQA 4KH2A 3N11A 1TA3B 4UZSA 5DT5A 1EOKA 3AI0A 4QCEA 1V3LA 1KCKA 2DSUA 1C92A 5JBEA 1Q6DA 2D22A 3WQ6A 2D73A 2EQDA 1B2YA 1W3LA 1KBBA 4PMRA 4B3KA 4TUFA 1JD9A 3FAWA 3MV01 4HPHA 1I1XA 2BV9A 5ABEA 1VRXA 2HVMA 5I6SA 3RM4A 2DT1A 3WFLA 1NWSA 3SURA 4E8CA 2VZUA 4F9DA 3DHPA 1FFRA 3VIMA 1PJ9A 5IHRA 5AYIA 1V6VA 4AIEA 3LPFA 1JYNA 1VENA 3VO0A 1NWRA 4U3CA 3AHYA 2BHZA 4MJ4A 5C70A 1YQ2A 1ITCA 4NXKA 3A5VA 3AHVA 1M04A 4JIEA 2ZOXA 4GPNA 2UY3A 3IANA 5A95A 2DEPA 1E6XM 1V03A 5BXTA 4PUEA 3WD0A 2JE8A 2RGLA 1VEOA 3T09A 4FMVA 3FAXA 3ZT7A 1UH3A 3D5HA 4OOZA 4TOQA 1MW1A 4P7QA 1WZAA 1TFVA 4LXFA 2GK1B 4ZEPA 1CYGA 4TVDA 3DDGA 1WZMA 2J7HA 2VURA 3AFBA 3LMYA 4JCMA 1O6IA 2GJXB 4OBRA 2DT3A 4MNJA 2V38A 2XWDA 3KLKA 6A3HA 3S5YA 5A6LA 1H0GA 1E72M 3GYCA 2CBIA 3ZT6A 4KRTA 1VJZA 3VD5A 1JDDA 4PTWA 1Q6CA 5EB8A 2DSKA 2FHCA 1E3ZA 3VIIA 3CZ8A 1UZ1A 2AAAA 3ZT5A 1V0MA 4AZGA 1CGUA 2GUYA 1C7TA 4XZWA 3CMGA 2EAEA 1E1FA 1UUQA 1CXIA 2FH6A 3J7HA 4WSJA 3MUY1 2EPKX 4AMCA 1VJSA 2VX5A 1UD6A 4GZJA 1E6RA 3LXAA 1CEOA 1G94A 4AZHA 3F5KA 1TQSA 3VUPA 2AMGA 1ITXA 1ZB5A 4H8VA 5A3HA 1ZL1A 4XX6A 5IXEA 3WD1A 2NSXA 1QI4A 4URIA 2WCSA 3EMCA 3PZUA 1Q6EA 2WVVA 4BS0A 3AYRA 2FHBA 1UWUA 3GZAA 2DDXA 5IDIA 2WPGA 3AXHA 1L8NA 1P6WA 2YA0A 3EDDA 5A2BA 4EKJA 1BGGA 1ODZA 1OD8A 4GXPA 1CZ1A 3HZ3A 4WJXA 1SYTA 1UD5A 1UWTA 4PCTA 4Q7NA 5EBAA 1E9LA 5DFAA 3CO4A 2HISA 4W7UA 4PEEA 4A3HA 3EMZA 2X05A 2FGLA 1FOBA 3AIWA 2WZEA 2WHJA 1JAEA 1KXHA 4M56A 1E5NA 3VIHA 4YN5A 2G3IA 3DX0A 3VKKA 2CITA 5A2AA 1R87A 3W6MA 1TQTA 1CWYA 5CLTA 3NDZA 1JXJA 2BY3A 4UFMA 1WAWA 2GJRA 3WNNA 1I75A 1XD1A 4H8UA 1KB3A 1JG9A 1V3JA 4TX6A 3UR8A 5A6KA 1W9DM 3B9AA 1KCLA 3WD2A 3CUFA 4DUWA 2A3AA 3EJUA 2WMKA 3AZSA 4U2YA 2ZXQA 5E70A 1CGYA 1LL6A 3DYOA 3JUGA 3VDCA 3WL0A 3T2PA 3UG4A 3CZSA 3B8SA 4KGLA 1QNSA 5BROA 4AXNA 1QI2A 3MSDA 4PTMA 3CV5A 4EAMA 4PMXA 2ZXDA 3VOCA 1H4PA 1CXFA 3WN6A 4BQ2A 1GOOA 2X2HA 7TAAA 3N18A 3KE0A 1KXQA 1QI3A 4HPGA 3ZR5A 5BXRA 3AS0A 1EHNA 1ZBVA 3GM8A 1IZJA 1W9BM 3NDYA 2VVSA 3DC0A 3BUIA 4AEEA 4OIFA 1IV8A 2NW0A 3WF0A 5CQ1A 3L4WA 4CN6A 5M17A 1VFMA 4CN4A 4W85A 3F5JA 4QAWA 1NM9A 3SCOA 3OGRA 1JXKA 3TTQA 1J11A 4Z2IA 4UFIA 4W5ZA 1BF2A 3VNZA 5FL0A 4CU6A 2EACA 5E0CA 1OIFA 3WUBA 2ZUWA 3CBWA 4AD0A 3M46A 1CGXA 1H09A 1G1YA 1F4HA 4R27A 3A47A 1V6UA 1R75A 4NZJA 3VIJA 1SMDA 1UKSA 1V3MA 4HA3A 1JZ6A 2VI0A 3ZM8A 2XWEA 3N13A 3QHMA 3FN9A 3L4UA 5DT7A 1E4IA 1TZ7A 1ECEA 1CNVA 3IAPA 4PMZA 5A6BA 1MFVA 1RH9A 5E6ZA
chains in the Genus database with same CATH superfamily
1L0YA 4Y5VB 5E2UL 1RIUL 2HTKC 2BP1A 5I00A 4YX2H 2KDYA 1IFGA 4X5QA 2A0LD 3AY4A 1AI1L 2ZYSA 3KHQA 3IK2A 4FOMA 4UTCA 2MCPL 3SGKC 1F4YH 2NT0A 3VI3F 2D03L 1P0EA 1P5UA 3L2LA 3O4LD 1SFSA 4UTWC 4EUPG 1TV7A 1XBZA 4DZ8A 1NWTA 3QPXH 4R5XA 1O1HA 2CFFA 2NDFA 2I7OA 2DIEA 4GPVA 3H2WA 4D6GA 1ACCA 2VR8A 4UV4H 3V0DA 2A3LA 2GPZA 3JZUA 4KI1A 4X80L 1B2WH 3PWNA 4PY7B 4WKZB 5BJTA 4KZEH 4NNBA 4DI8A 2NR6D 3S0CA 4OD1H 4HPJA 4TUOA 5EBLB 2B0MA 2R7EB 3BIKB 2A7NA 2JIXD 2XY1A 1NPUA 2KERA 1E9PB 2J6VA 4MHBA 4L65A 2V6AA 4P59H 1REQA 2FPVA 5JQ9A 3V0SA 5I1DB 5EMYA 3OG4B 2ZCHH 1GVSA 4PRWA 1U8PB 4FQ2H 1J0ZA 5BRPA 4PFMA 5AHEA 1I4FB 3IFPB 3AB0B 7FABL 5A8OA 4JY4A 2OTUA 3H7LA 1XAKA 3MJWA 1D8WA 2PTTB 2OYPA 1XXXA 4O02H 3QNYA 4XX5A 2VENA 4CCEA 1JNHA 1MNZA 3UZVB 3WHE1 3G6JE 2EYSB 3QEHA 5IMLB 3L4ZA 2J78A 2VSCA 2ZOUA 2IWGA 3BP7B 3C5ZD 2ZIDA 1H0DA 3OKYA 4RESB 3S36H 4N9GB 1JPDX 2BMKB 2FT6A 2TODA 4KZ0A 1NOLA 5DQDL 4J5VA 1WQ5A 4FYTA 2VKXA 3QXDA 5L2JA 2CU0A 2YL6A 3WF4A 1X6NA 4R4NC 4Z2JA 3FT9A 1JDAA 4S1SH 2H6PB 4WSGA 4YSOA 3L5XH 1K7FA 2RALA 5FJTA 4HFUL 3EH1A 3FUDA 4OJEH 1CVSC 4ADGA 3GW0A 1BWLA 2VP8A 4Q8UA 3RA7H 4R85A 1V05A 1WQVT 1H3WM 5EBWA 3UJJH 1Q9LB 2PS2A 4ZZ9A 1GZ1A 2ZUNA 5KUMA 4MTMA 2EVJA 4PS7A 1UEMA 4DW2H 2QFPA 5CJMA 3PRZA 4WWOA 3FSWA 2CXEA 3MLXH 4ZOCA 3CVCA 1FQ9C 4QRRE 5ESVB 1ZGLA 3GB7A 4ECNA 1DIKA 3C4UA 3QJAA 3TSMA 2JKXA 3LOTA 1IC1A 1GAFL 3FH8A 4GAYA 3VJ6A 5KG9B 2PCXA 3NH7H 1DQIA 1NGXB 1JGIA 4XGZB 1GHSA 5DFWH 1IEBB 1LOLA 2V9DA 2IG2L 3P02A 4DVBA 4G6JL 3D69B 5CJ5A 1F2JA 1BG1A 1NWPA 3UTZA 1G7MB 4GD0A 3WDIA 3KLDA 1SY6L 4JHVA 3RKDC 2KQNA 5KYXA 1WT5A 2QEJA 1PE1A 4RV8A 3UGUA 1A3RH 1O7DE 2AXWA 3KJ4B 3ZL4L 1DVUA 4KQ4H 5DC2A 1DCEA 4KETA 2WC7A 4W84A 1UXWA 3O4LB 2OZ4L 3PG9A 3ILPB 1DYSA 3LDBB 4FMKA 4YHNA 4XMTA 1TVPA 4BRJA 3N25A 1K5NB 3OKOB 3OXSA 4U4IA 4OZGE 3H26A 1FXQA 2YXFA 5T1KA 4AIOA 3NL2A 2NCEA 5D6DA 1OAYL 1X4YA 2JGYA 4KXZH 1SFDA 3P3RA 4DP8X 5TPWL 1PIGA 5HYQB 4M7SA 3DPBA 3LKOA 3AXXA 4OOUA 4G9FE 4E9SA 1GY1A 1SXSA 3FTYA 4FJ6A 4PJBB 4G72B 1EEUA 2VTFA 3R7MA 1AFVL 1EAQA 1WE5A 1FWHC 5DQPA 3THMH 2APXA 4NSKB 5D7JD 5JZ7D 1CI5A 4Y7EA 5IT2L 2DT2A 3LMZA 3R43A 4X4XB 4N0YL 3CBJB 4W9EC 5E8NB 4MWAB 2EKJA 3NL6A 4PC8A 1U8IB 2DIBA 4RWHA 2XHNA 4AYBA 4YXHH 3GKAA 4FHBD 4U6YB 3RX2A 1HSBA 4P5SA 5D2LB 1XH1A 1T4KA 3KPMB 1JZ7A 4X63A 3SW6A 3L3OC 3N40P 3QIUA 2PTZA 1TDQA 4JM2A 4C1LA 2HJFA 2ZRVA 4OGXH 2LU4A 3SDAB 5C0NC 3U4BH 5MENE 2A79A 4QPEA 1OL0A 3WY3A 1R5VA 4IBWA 3NZPA 4EXKA 2YAQA 1DVJA 2ZRXA 3MV8A 5D8ZA 2WYZA 3CPLA 4Y2OA 4HS6A 1HKKA 3V79C 1VFSA 2PWHA 2Z92A 4URKA 2E6YA 3OEXA 5C3IA 5A8PA 3WTWA 3L65A 4TTUA 4HH9A 1XWYA 4JFZL 1RPKA 4ACZA 4P07A 2BOGX 3CHQA 1WBXB 5D6CA 3RJQB 2XIMA 4H9YA 1BVKA 4IBLT 4N0UE 5CZXD 4TR9A 4WDUA 2Q3OA 3NPUA 2WUBH 5E6IC 1J1OH 1EC8A 3TO2A 4I9AA 4D6JA 1TFHA 4OZHA 4G9FD 1U8HA 2D3NA 2HFTA 2BIOA 1S2EA 3IJHB 4JJ5B 4QTIL 5FO2A 4DUVA 1K6AA 6PTDA 2BSCA 3SRHA 3C6LD 2DVXA 3O11A 4Z0XB 1K9TA 4OZIF 4K6AA 1I2OA 2HPOA 1FH8A 4FXKC 3WX7A 3CT2A 3EB4A 3SCMD 4OUEA 4NAFA 5GSVA 4ZQCA 4MMXC 4KK9C 1JVNA 1EJFA 4O4YH 4WWKA 1PVHA 4IIQC 4B91A 4I3SH 3VAEA 3SY6A 4E42B 1K9FA 4GQBA 4Y1AA 4R83A 3IJEA 1WAPA 1AQDB 3MOAH 1D9KC 2K0RA 5FOOA 2EXYC 1ZCRA 2VSMB 3BLLA 3THCA 1XCXA 4NQVB 4NO5B 1HK6A 1U8CB 3NCFB 2LTQB 1KM2A 3BP6B 1UJ3B 3PAVA 2R4SL 5DRWA 4R4BB 4AZCB 3N0AA 2HT2D 3NR0A 1S8DA 4YTQA 1G1OA 4R2GC 3B7TA 1GTEA 5D1XE 2A3CA 3VU1A 5DN1A 4NPJA 3EFOB 1WPCA 5AFAA 5AG8A 4MIMA 4P2OD 4UTMA 4POCA 5DY3A 3BXNA 3S6OA 2OMXB 3VGFA 1OHQA 2GK2A 3QQNA 4BE6A 5D02A 1UR4A 5I8OH 1UWRA 1US3A 3H24A 3FFOA 3KMDA 4QRBA 4UT6A 1YQVH 2DQFB 3HMWL 5TGBA 4HQQH 4AZUA 1JF5A 5BUPA 4KHXL 2UZIL 1MEXH 4P59L 1ITQA 3PTMA 3PK7A 1VRDA 4HK5A 2UWEF 4V1XA 2XKNB 4BSVB 3CIQA 3CH8A 3QIWB 4NEHB 3AALA 4KCWA 3SOTA 3W7EA 4YTTA 3D8MA 3IJ8A 4WGVB 1R9FA 2ZA1A 4JG0L 1SYSB 1RUQL 1SW0A 2AKZA 4R88A 3G2GA 4GRLC 3WFZA 2NUTA 2JIWA 2OX4A 2Y22A 2QHAA 5T1MB 4IJCA 1T6WA 4Y90A 1LGVA 2VDQB 5ABZA 3D4YA 4WJKB 2IMRA 4J3ZA 4M7KH 5JXAL 4LU0A 1VYRA 3MLZH 3RWGB 4FQXB 2H3NA 4DKTA 5HDLA 5FV2A 3H9YA 1XF0A 4WGWB 4KZDL 1L9NA 4PY8J 1Y6MR 4QRSB 4JTKA 5E0FA 1N19A 2X0HA 5DUBB 1TUFA 4JL1A 1YECL 2VR6A 2E6JA 1NF0A 2NY5L 4YTSA 2OXGA 4GS7C 4AEHL 5A3ID 1P1XA 2DS4A 2AJ3B 2B15A 2YEVB 3QR0A 4U28A 1UADC 3KLLA 1FG2A 4PJ7A 4BK4A 3MSYA 1Z89A 4JM4L 3ZSSA 5JLZB 2RHGA 3N3MA 4XQ6A 2APTA 4MNQA 1PZCA 1TV2A 3LBCA 2BVQB 3GI8H 4AIUA 2IXUA 1KFWA 2CZNA 3IAQA 5FEXA 4LOFA 2XX1A 4K7YA 2UX7A 4PODA 3LD8C 4KI5C 3TBWA 5AHLA 5C0IB 3HUJF 5EV7A 3O0LA 4PGZA 5DVPA 4AZ5A 1W9PA 3W26A 2FEDC 2CO1A 3C6CA 4TQPA 5L7XH 3QZBA 2XPKA 3S1UA 3KLQA 5GRJH 1ZLWK 5CBJA 4GMSH 4QEGA 1DYZA 3DDFA 4X8JA 2FO4A 4JY6A 3IJSA 2CO7A 3C8NA 5LNWA 5IESL 1DSYA 1E1EA 1IILE 2FNWA 1QPKA 4KKBD 4UZUA 2QDGA 3RP1A 1TMHA 1CS6A 5DMKA 3B9KC 2MCMA 3BPOB 3TUUA 2OTWA 1LD9A 3WF2A 3B7SA 4RIRA 3RWCA 5LBSL 1KW1A 2A73A 3MLZL 5CJXC 1KB5A 5JHDA 4WOZA 3I75B 4BR1A 2EC8A 5CEZE 1MSSA 3F7KA 1D6VH 4JJHA 5E00B 1U41A 3TBBA 1L6ZA 4Q8WA 3KLSA 3MRLA 4ZMLA 3B2VL 4N3TA 2CO7B 4DJDA 5CPQA 5FCSH 4XP5H 3PBYA 5CU5A 2Q8AL 1NPNA 4YDZA 3WFHB 1RK6A 4O10A 4PR4A 4F0SA 1MYRA 4ZFOB 2FH8A 3CXDL 4UWQB 2PWVA 3PM6A 5L2KB 1UWYA 4GBXB 4XMWA 4NN7B 3EAKA 1FYTE 3VACA 2GGGA 2BHUA 1TZAA 2EEAA 4TKWA 4RETB 3N85H 2VDPH 1R3SA 3PFMA 5DHVH 1QDSA 3KL3A 3TBWB 3C0JA 1UOZA 2YA2A 5CHNA 3BWWA 3BV7A 4LAJH 2VW6A 3TA3C 3E5PA 5DI8A 4GUPA 1EDYA 2QSCL 3WO3B 3NAAH 3QEQE 1SGJA 1M1XB 1OGPA 4U1NA 3HZMB 1EP1A 2X89D 1UD4A 5T3XE 5JLZA 3MCKB 3OX8B 5CZSA 3NOIA 4ZUWB 1ZVHA 3SY0A 4MNHA 1CENA 5BW6A 4MCYB 3DUSA 2XACC 3L5MA 4RXFA 3CFKA 4TSBH 4D8OA 2P9RA 5INDB 4QOKA 3UGVA 4KXBA 1OAKH 3U2JA 5KSVB 4PUNA 1KIPA 2VSKB 4K38A 2Y7MA 5AOKA 5JXEA 5FGRA 3VA8A 4JZJA 5JMOC 1JJKA 3WD4A 2DYPD 2AJSL 5DCEA 1RK0A 2WHMA 1BV8A 3LS4L 3ULUF 2W95A 1UACL 4XOAA 2NQ5A 1CUOA 4PVMA 3IPBA 4NUWA 2NYZA 2JXMB 2FYMA 1BQHG 2GCYB 4N2BA 2P8LA 2PF0A 2VEPA 3KGSA 2DW6A 1WWBX 1Z48A 4N7QA 2YD5A 3U0WH 5GS0D 1TXKA 2FECI 2KZ1B 3L9RB 3OHXC 1F5WA 1RPQA 4G8GE 3S37H 3EGSA 4G8EB 3M47A 3F5WA 3QJZA 4XUYA 4PR5A 4QXTA 3HHSB 4MQXC 3TZVA 1RVGA 3C60C 2VRJA 4PN2A 1S7UA 3HB3C 5CIPA 3VABA 2F2HA 4LSSL 1XFPA 2BZCA 2EDRA 4U7MA 4ADIA 3V1PA 2JH2A 1KRAC 5FI8A 2P53A 2VO5A 3V4PH 1Z41A 1GVYA 3N42F 2YB1A 3H6OA 4W88A 2OMTB 2C3VA 3EWYA 1BW8A 4LRSA 1RURL 4XNAA 1TJ0A 3TC9A 3OC8A 4QRQA 3LGDA 2RFXA 3T6ZA 3TP4A 1EGJH 3W0WE 2BB0A 3GZ3A 5TQ0H 3BWSA 1J8VA 43CAB 4HXAH 5AN7A 1LQBC 1Z7AA 2VYRE 1UCTA 2ZWLT 2B7QA 2FZDA 1AZZC 4ORGB 3AADB 3VIFA 5E2UH 1QFWH 4ZQKB 1N0LA 2XDHA 1K4GA 1YBQB 1XJBA 3H9SB 5GS0C 2J1YA 1ZCOA 2TSBA 5ECUA 2QHLA 2FATL 3LX9A 5LCVL 1H6EA 3V0VA 4U0QB 3V7AG 2WXMA 5HPOA 2WSQA 5EA9A 1FF5A 3UTQA 3UZEA 3BVTA 1KACB 1KJVA 3LK6A 4YZWA 3GTTA 4WTWA 5HJLA 5FDYA 3DO3A 4RNRB 3JYBA 5LGJA 1JGDB 1CDGA 1BZ7A 5I0WA 1HN1A 2YL9A 5IB2B 3QCUH 3W29A 4XAWH 1UR0A 4EAEA 1NBQA 1JTTA 2ADIB 2EXYD 4DI9A 5T1JA 4G1MA 3GIPA 1UVQA 1IEHA 3CC5A 2PU1A 4MFEA 4I18C 3VE7A 2XWBB 4OV4A 5BOFA 3AREC 4QLRA 2X30A 3HI6H 1DQQA 4WTQA 5HHOD 4K8RL 3ZZLA 4Q4RA 2UZIH 4GRLA 1SF5A 2A99A 5FGCE 3RE0A 2CWNA 3DIDA 1I3UA 4QQUA 5DK2B 1JZHA 3RL2B 4DBWA 2X7LA 2JV6A 3C9NA 1MRCH 2YGOA 2VUYA 1AIZA 2HB0A 1UWAA 3TS8A 4GBXD 2APVA 2P8MA 3ZVVA 1UQSB 3BCFA 3V6BR 3EX6A 4H9UA 1JPST 4L37B 2F9RA 2Z28A 2WXIA 3UBXB 4ZZFA 1NP2A 3L4TA 1XV8A 5D93B 5HJBA 4W8AA 1HZYA 3EA3A 3W7CA 3O41A 2BFGA 4CD8A 3NXLA 4MD4B 1WFNA 4G80B 1OZMA 3PDGA 4HIHA 1RL1A 2GSHA 3EKLA 1AZ1A 8FABA 3M5XA 4GC3A 1CK0L 2DMBA 1MH5B 1XZ0A 1AXTL 3E6HB 1JDEA 4GYFA 3LQZB 2EXSA 1A3QA 2VC6A 3PTKA 2J55A 3V5HB 1IIGA 3GDRA 2LLLA 4KQ3L 3ZS4A 3X3FH 4BA8A 5IVXB 2MUCA 1E90A 1T0MA 2E46A 1TYRA 3L3HA 2G0KA 4HHWA 4G8AC 5EL1A 3GNNA 1GL4B 4OV6F 1QAPA 3N50A 4AE1A 1FNFA 1G7QB 4M5PA 1MWAB 1AK5A 3CIWA 5JPMB 2V5YA 3U79A 5IJBC 3P14A 3DTUB 1KG0B 2Q0ZX 4GMEA 3CHVA 2YAPA 3IJ9A 4KERA 4GW4A 2JJSA 5LGYA 3VKJA 2FT7A 5K3VA 3O4LA 1EHLH 4JHOA 4E5TA 5FJRA 3W7OA 1MFEH 1N4XH 1FXPA 3FZUD 4JGNA 3GG7A 4QTHB 3QW4B 2PDBA 1RLCL 2VL4A 1OYAA 4AD4A 3HTLX 4L48A 2A74C 3UTZB 4D0CB 1OX6A 4FS9A 2NTFB 2K9UA 2CHWA 2O56A 3OKEA 1IAMA 3B8WA 5ESQA 3I7QA 3LTSA 2Q7YA 5KG9A 4D0CA 2EYRA 3P8IA 3MJ9A 2Z1KA 5EC2B 4YDVB 3SKNA 1NJ9A 1JUEA 5ESVA 1N10A 3TA3B 4C56A 3TQVA 3AUWB 5GZOA 1A7OH 2P49B 1JHKH 3HBZA 1CLCA 2VDRL 3HC4H 3SN0A 1FLRH 4JY5H 1H9DA 1JCLA 3B8TA 2B9BA 1T66D 1XYAA 3NFPA 5DJ0B 3MOQA 2E9GA 3GHBL 1IIHA 3IMWA 1ALDA 4AGNA 2J8UA 5MEQA 1E5ZA 2G9HB 2MSPA 3PJLA 3Q2LA 1O7SA 1IUZA 3UL4A 1GKRA 5G2HA 3KPPB 1S3TC 3II1A 1I2RA 3EOSA 3V0TA 1KCRL 2F8IA 4WUUE 3T8QA 3PP3K 5CC7A 3TMLA 3GHPA 4FCAA 5I6XC 1YE4A 4K23H 1J1PL 4Y2DD 1UIOA 2BC4B 2VQTA 5BVJB 1UWSA 3BLEA 4WI6A 1WRFA 5HDBB 3ZKXB 1KMGA 4PS3A 5AAMC 1O66A 2H32H 3REQA 4IWWA 4YC2B 2PTTA 3IYLW 3TH2T 5IVZA 3EDKA 4WNJA 3AQUA 4R7WA 5FAJA 4LQ1A 3QNXA 5M7QA 4CJ0A 4J6IA 2X4UB 4PJDB 1OVZA 2DD8L 4ZOAA 1CU4H 4V1DA 1GQIA 3U46B 5L9FA 1AL8A 3ZE2E 2F18A 2OCJA 3S96B 1DXFA 4CC1A 1L0QA 1WHPA 3T3PF 3G3MA 4BA0A 3KCJA 1CFVL 3KP0A 5GGVY 4X4ME 4MAZA 5FAAA 3AHXA 3GGWA 1EJ7L 5BNXD 4OY9A 3PUEA 2OMUA 3BG5A 4Z78A 1VSCA 4JVWA 2ZCZA 4LOEA 4Q9RL 2VXUL 4NXSA 4RE0A 2JLPA 3AM8A 1MFUA 2X1XR 4AQ8C 4WSHA 5K9JH 1K6QH 1ND0B 1TUXA 1DJSA 3QRHA 3VOGA 4CSTA 1E6OH 1NCUA 5GS0H 5EZPA 2XZAL 4JZNB 1YEYA 4PJ7E 2XWBA 1AH4A 3KW7A 3O3BB 1AOZA 4MGXA 9RUBA 2OTPA 4CMHB 4ENEC 4E0RA 3CASA 5BVPL 3O3EB 2V5TA 1YW1A 1V08A 4KX8A 4FMFA 5C8JB 1L9PA 4W87A 1Q7QA 4PUBL 4HVXA 3WBDA 4EPBC 2ARWA 4A7GA 4Y5VA 4M7ZC 2B1HL 3SDDA 4UDTB 1LP6A 1IT9H 3RFZB 1NCNA 3NSCA 1MIML 1WFJA 1QNZH 1Q5MA 4GCXA 3P1VA 4JANA 2QHRH 4U1SB 1PZ0A 1SW3A 2CDGA 2BTMA 2FJSA 1W3TA 4NP4L 5JHDD 3K2MC 4M3KB 2AXGB 4O12A 5BV7L 2CE6A 1AGFB 2DICA 3H9SA 1U92B 4X4ZA 3ROOA 2YPIA 3IMRA 2UUDK 3FS2A 4QJ1A 4ZQKA 5DUPH 5C0DB 1F18A 2HVOA 3G1SA 4E4FA 1SMAA 2ZX8A 5EIIA 3D87B 3OZPA 1NANH 5TJWK 3WUFA 2K8MA 3GMQB 4XC3H 1TB3A 4JPQA 1KPRB 2ZXAA 3FRUB 5J56B 3RF9A 3SDXF 1E7UA 2JELH 4GI9A 5FX3A 3OG3A 3FOLB 4G2AA 3SQRA 5EBUA 3S5LG 3BAXA 4B53A 2HJPA 2AL1A 1W1IE 1YEHL 4NCDA 2OMTA 4AGMA 5IB5B 5LN4A 2WP3T 1OLLA 1FP8A 3B0PA 2GQHA 3WV0A 2JIXB 1KIRB 3F83A 2WLZA 1VESA 2VMFA 3RWHA 1UC5A 1DFXA 2P0OA 1JGVH 3KEDA 4I18A 3NEOA 2FIKA 4KKNA 5B1KA 3VB9A 5DLML 4AW7A 1IXOA 3FQ4A 4G9DA 2X6UA 4PR5B 3EPMA 1DVFD 2LOEA 1UH4A 2J75A 1L6SA 1WUNT 3WIHA 2A6LA 1X5HA 5AD0A 4IL0A 4PP2B 2HX8A 4FX7A 2HFGH 3K7UA 5D4HA 5LN8A 1DJXA 5INCB 1MF2H 2UZYB 2WB1A 2GFBB 1NFIB 2YKKA 4Y7MA 2JXMA 4G6FD 4AJWA 2GDUA 5HR6A 3WKQA 5J06A 1MJUL 1K8IA 3HU7A 1TZOA 4GGBA 3K8KA 2J66A 3RTQB 5FV1L 5CCGE 3M07A 4UFJA 3QWOA 4P5KA 2VH5L 3A9BA 1FE8L 5HJDA 2XI9A 5F1NA 3MHUA 5D8JL 2I16A 1ZBCA 3ZZQA 3GS6A 5INDA 2WM1A 3CWNA 2RB8A 1LG1A 3ARRA 3SQMA 3TZFA 1E65A 1Q0YL 1AIFA 1U0QA 5DDHA 5JMUA 5LIKX 4HF5L 4S1QH 3LNDA 3C09C 2BVDA 3GRWL 2A9DA 4KJPC 4R84A 3NNTA 4Q8OA 1J9SA 3RR1A 1AKJB 2X2JA 4U6XB 3R1GL 5D7IF 2B59B 4PJGA 4DOHB 1I8LC 3ULUD 2A7PA 5E6IB 4Q97A 2NVAA 2VWTA 2ZFAA 1CBGA 1EQWA 2OULB 5KOMC 3EO1B 4Y4FC 4MQSB 4XMPH 2CDFA 1W5QA 4JEJA 4ZW3A 3TTSA 1QPXA 2XU2A 3WN5A 4A66A 2B59A 1QSVA 2CK2A 4PJGB 1EPXA 1JRBA 2XVNA 1E2WA 3OXRB 4PYGA 3DFOA 4X6BB 1ZZMA 3R5EA 3MDJA 4R6UA 2HLEB 4OCSL 1NC4B 1ZANH 1HCFX 3HAEG 4RJEA 1D2OA 4JY5L 1FWSA 3MLYL 1YTDA 4JREC 1LWHA 1W1A1 4WFHD 1PTDA 3D3AA 2B7DT 5D5MA 5ENWA 2WYIA 1ZVSB 4YSDA 4L0YA 4LVBA 1FBAA 1KBGL 3DBSA 1AQHA 2OLDA 3C08L 4JFFB 2AXFB 3QVQA 3E02A 1HP4A 3K6DA 3RTQA 3SN4A 1FBIH 4A3YA 2HFFA 2J25A 4I1NB 1I9CB 1OC6A 2EGZA 3RDTC 3SCNA 4ODVH 4XB3A 3SDYL 2B31A 1LD9B 1NDZA 1UBPC 4Q8NA 1W0WB 1VFLA 3P61A 3BN9D 2P5WD 3T6XA 1XIWD 2WMGA 5AOIA 4JBRA 3ARBC 3QPEA 1CICA 2CM5A 1J0YA 3K0WA 3WZ0E 2ZX5A 4F79A 3RNKB 4AUUA 5C6MA 4PJEB 4Y9FA 4G9DB 5DRIA 1A66A 1SUHA 4AEFA 2C9QA 3S83A 4DIXA 2O5XL 1BEYH 4GKNB 4POZC 4Y1AE 1RAMA 4Y9OA 5FA4B 5CJ8A 4M7LH 5AYBA 1U6AL 1HGYA 4U4MA 1DWIM 2ZAHA 1VZGA 2FK9A 4ZNEE 3LN5A 2QPXA 1I3RA 3LXBA 5KAQF 3QYCA 1TMQA 1BWVA 5KZ6A 3SZ8A 1SVBA 4GW5A 1Q2SA 4JTUA 3FSOA 1JUFB 1H5BC 1BJ1J 4QXWA 1WNOA 3W9EB 3DBNA 3BFWA 1XRFA 4K73A 4K2SA 4EXQA 2ZUTA 2IPFA 4J2PA 1H3VA 5GHWL 1S5MA 4DEWA 1BQSA 4LB4A 3GTHA 5C0FA 1EWEA 4Q6YA 3RKDD 5JOEA 5T8GA 3KWXA 4DK5A 2YUXA 4M5YL 4X6DE 4KV5E 3SN1A 3TNBA 4A2DA 1T41A 2N1TE 1PX8A 3I2CH 5G2WA 4KO5A 4OFVA 3QR1A 4FNRA 4OSUH 3NBNA 3AS2A 3RIFF 2WLLA 3T0AA 1RZQA 1A49A 4YO0B 1U8MA 2YDQA 4FIRA 2A9BA 5DQ9A 3BT2H 2EPLX 2V2CA 3BAEH 1TF4A 4M80A 5F2GA 1HAWA 1LK2A 4HAGA 2DTMH 4NO2B 5ETUA 4NZUL 4UTAA 4Y16B 2J5WA 1A6VL 4AGOA 5ESAA 5D30A 3O3BA 2DUZA 4QRTA 1TTQA 1PEZA 2PW1A 1MLBA 5EOQL 1KB5H 1T7YA 1U8QA 2IBZY 2F5AH 2WKOF 4E41D 2F8QA 2OGYA 3Q94A 3UX9B 4DJFD 4E0CA 3PJWA 3S4TA 1SDYA 2BNUA 2MKLC 1USQA 4HWUA 4R5TA 2APFA 5IQLA 5AVRB 4Y8EA 4B96A 4U1GB 5BZXA 2J4GA 4QTGA 4GH1A 2J1XA 4O02L 3VIKA 2AZUA 2N7SA 3PZ9A 2ZXGA 4QHUA 4TLUA 4ZSOE 1GQLA 3RB5A 3FC8A 1KJMB 2J3SA 4C1KA 4P5UA 2HVNA 4OUIA 1NQBA 3WEMA 4GQPH 4LEOB 2GOKA 1LOQA 2I5IA 1TCDA 5AZUA 1JSYA 4LU5H 4XVEA 4D0BB 4JJOA 3F4NA 2JWYA 1Z32X 5BO1L 1G7HA 4KCVA 3QDAA 3VIPA 1DJYA 4Y5YC 2P4AB 4A67A 1K5WA 2WSKA 4YHGA 3BN9C 4KWSA 4HFWA 4ODHH 5HJYA 3BZ4B 3G04A 4PW4A 4HOXA 2J74A 4O54A 3RKPA 4PJBF 2HROA 1SQMA 3R8BB 5KYYB 2FB2A 5LSMA 4S1DD 2K7PA 2CK0H 4PJAF 1F74A 1WOAA 5AL8A 1I8IA 1QFWM 3LNFA 3OZKA 1BLNA 4ETYA 5HP5A 4NYLB 2W81C 5ID1B 4AQAA 1FWNA 2IANE 5EUOE 3H4HA 4IGNA 4K5MA 4JTDA 4LC6A 1WGOA 5JMRA 5EY5A 2IG2H 1EBPA 4LSRL 1BBJA 1FBIL 4PREB 4ZT1A 1YN6A 1E9YB 2PRMA 1DVFB 3LERA 5TQ2H 2WLMA 1ZT4A 3QBTB 3KWUA 2OV0A 4MQXD 5I17A 5DO2C 4ADUA 1MXSA 5DXWA 5JHBA 2EXOA 2FDBP 3L1EA 5B3JE 4PJ9C 2BJML 1YDPA 4LCCC 4EMZA 2ZKHH 3MRQA 2P5PA 1JNLH 4MRCA 1E1CA 4Q0XH 5CLWA 3VMOA 1SJEA 5GS1B 3MC5A 3QJVB 2EYRB 1ZLDA 1LLZA 4JE0A 5LHFA 2EVFA 4YHPA 4FG6C 2Q7YB 3G6JF 4P61A 1UP2A 2CLPA 3QO0B 3CPLB 3T0EE 1DE4B 5BS0E 4N2DA 3MV8B 5G2NA 4UYQA 1TEFA 3E1ZA 3I6LD 3OO2A 4XAFA 1DIOA 3QJFA 1TETL 1P2CB 1ASOA 25C8L 3GSVB 3RWEA 1YEGL 3NACH 2ZC8A 1TO3A 4YZFE 1IL1A 3B2UD 3HE7B 4L4VA 4NNXB 5EC1A 2CAKA 3EO0B 3BW4A 3PB0A 3QV7A 2BRQA 4KH9A 4U6YA 2E7MA 1HH9A 3UO8B 2QQKH 1IAII 3CTTA 4DZBB 1CCZA 1D9KA 3EYSL 1CFMA 4HJTA 5LHEA 5GJPA 1MWAA 3TR2A 3WEAA 5BZDB 3UTTD 1G7QA 1HQ4A 5T3ZE 2QSCH 4P4RB 3BAWA 1R3LB 2WWMD 1KM3A 1INDL 2FLBT 4UM8B 4K5OA 2HX7A 1J6PA 3N12A 3OBEA 1XIJA 1U42A 4JTAA 1HHGB 1KIUA 4XG1A 2ALWA 3HCVB 4DX3A 2E5BA 1R3LA 3D39D 3NWRA 2WVSA 4UAOB 1HQ4B 1YY9C 2O5ZH 1TPB1 1UKOA 2QF8A 2VDHA 3Q65A 1KLUB 1PYWB 4ML4A 3QUYC 3MACL 4P2CG 1MQQA 3TOYA 4TNVF 1HXJA 4RXGA 4XXCA 1E9QA 3V9EA 2WJ7A 4B16A 3CDGB 1V55B 4KNTA 4H9XA 3WF1A 3DX7B 1N8ZA 1IL1B 4NNXA 5FYLE 4HIHB 3VXPA 5J11C 5I6OA 1VC4A 4TX9A 4KVCL 4A7VA 3STZA 3JU2A 1UBSA 3H8AA 3NL3A 1GQNA 3VFNB 5DJ6B 1TPXB 2CBMA 4RZKA 1O7AA 1OXYA 4UQAA 3VSVA 2OK0L 2CKRA 3IRSA 3MYOA 4IIHA 3BDBA 1XIEA 1RZFL 2PF8A 1F2XK 3TYEA 1AXSB 1F4YL 1NGXA 1ZD6A 1FN4A 3MJ6A 5JW5B 4EXAA 5MKGB 3LKQB 1AHKA 4W9DC 1JR1A 3L1OH 1TJIH 1W72L 2D7PA 4GKSA 1UOLA 4U6HB 4Y19B 5SWZB 4RNIA 1JHKL 4B5NA 1QK2A 4Q4PA 3HF3A 4XPFH 5GJNA 2L7QA 4PV9B 4HTBA 1WS7A 4GVFA 1M03A 3UEQA 3RX8A 3BANA 2B14A 4G6AD 3E2HB 2RDXA 1DVFA 1LDSA 1Z5YD 4J3WA 3VFUB 3NJIA 5J12C 1IZKA 4G1MB 1NWUA 5I06A 3GC4A 3HPZA 1F6AA 1DQJA 3NM1A 4UFLA 5H2BA 2G75A 3BEWB 3DSNA 4Z9KB 4RMVA 3T0WA 4ZMVA 4N9GA 3THAA 3UCCA 2G4JA 1KXVA 4TXVB 5F9JA 3SDOA 4DM2A 4ZB2A 5I74C 1Y65A 5E09A 1VA9A 1KJVB 5IVXF 2O1AA 1W8NA 5IUSA 1BECA 4HFWB 5AWNL 1E8XA 2BNJA 3FDGA 4W9TA 1A7RL 4FO4A 2NWSA 1EEXA 3DX4A 2JGQA 3WBEA 2D8KA 4FI7A 5G1MA 1BAGA 1DLFH 2ED9A 4ODSH 1HJXA 4APQC 2X28A 4ERSH 1KTRL 1SHMA 3BMWA 3B5GA 1RP8A 5EIIG 2B7PA 3VOHA 1UR9A 2E28A 1AGDA 3RVTD 3T2OA 2GVJA 4R26L 3G77A 2MPAH 2QLYA 2X4NA 4R7LA 3WG7B 3KPRD 1WLHA 1T1YA 2YPKA 2G8ZA 4ZXLA 3QUXA 1X5GA 3HAEA 4IOFD 1MREL 1E9PA 4ZUSB 3T3PE 3S1VA 2A77L 2NY5C 1BTCA 3VZZA 2C13A 4KKLC 4L9LA 5F7UA 3Q3GB 1G84A 3W7LA 2H45A 3CIAA 4WXYA 1IKOP 2XM1A 2J6EH 4PI2A 3MKGA 1Q13A 4A8NA 1DBAL 5EMJA 1GGBH 5HA7A 3QG6B 4XPFL 1KF9B 4O53A 2IGFL 1X3DA 1FORH 2AVGA 1W8OA 3CHRA 4TNEA 5L7XL 4WFED 1LBLA 15C8L 1QW9A 2Z7UA 1E15A 3OZLA 4JRYA 2TMDA 1BYBA 3W2NA 4B5TA 2W9EL 3KRUA 3ZZ1A 1R2SA 4MNGB 5I76A 2F38A 1F4WH 1CBVL 3QPQC 4PSRA 2D7TH 3GMOB 4JFDA 1JZ4A 2EDLA 3HKZA 1TIWA 4R7JA 4GLRI 4IJBA 5AB2A 3QHNA 2W27A 5F7BA 1MFBL 5EZJB 2GT9A 1KN4H 3AQZA 1OIOA 3WE1A 1OTSC 5D7JA 3AIVA 2IDSA 5FJIA 2YGYA 2C0AA 4XBJA 2YAHA 1PLBA 1T83A 3EUDA 3QIBA 4QYOA 4J40A 2I5YH 3BPLC 4MCMA 1LEGB 1O9ZA 3H3PL 4BQBA 5KSVA 1QWKA 1A7NH 2J47A 2XT1B 4UU9B 3H54A 3TE9A 4EF8A 1QNRA 4NWUH 2EDKA 4NFDA 2BOCB 4LSQH 2EPOA 3MPCA 4XE0A 2V2DA 4GW5B 1F8TL 1X96A 3WLHA 2DQXA 4D3CH 1M7DB 5ICYB 4P5MB 3REVB 1KD0A 5E4OA 5C07D 3KOFA 3I74A 3QLDA 3KBFA 4ZMTA 1MXGA 4IHCA 1LUCB 3OKDA 5J11B 2APWA 3SCRA 1OGAE 2WSRA 4QISA 1ZHNA 4JEGB 3RDJA 3A3XA 2CLZB 4FS0A 4HIXL 3IXAB 2J8TA 2HG5B 4P7RA 2Q7NA 3QC5X 4U1LB 4D6EA 4P2QB 4Q4EA 4KDVA 5L2KA 3OGCA 2HCZX 3X12B 1CK0H 1M2OA 4HUNB 1D3CA 2VJ8A 3WLPA 4AZIA 4IOSD 1P53A 2QV4A 1M7XA 1Q6RA 4B9YA 1IWPA 1EJWC 5DF0A 4M8VA 1FRBA 4ENLA 1IAIL 4PJXF 3OZOA 1D6EB 5AOZA 3C6LA 3TYGH 1OSZB 4A7TA 1SHXA 4NZ8A 2PGEA 4DM1A 1FFTB 1N3NB 4DHGA 1XGZA 3FQXB 1AJ7L 3FKKA 2HFFB 3GYEA 1S3KH 3WL9A 3WQPA 4BQ9A 1YMMA 2DQJL 4A2FA 2PDMA 3U2SB 5KSBF 3GUFA 1I9RH 2HP4A 1OAXH 1XB3A 3QJOA 4PJIA 1J2WA 2W88A 1C5DA 3CZNA 3OGCB 3T04D 3UP1A 3X12A 3BJSA 3QARA 5FWRA 2WXRA 3M0LA 4R9OA 4XXDA 3ITVA 2YQ2A 2V2WA 2OZ4H 5J1TC 1SEQH 1UZGA 1D5MB 2D4FA 3BJLA 3CN2A 5DJXA 3M8OH 2OSWA 2AKRA 1TTPA 3R2GA 4QNPE 5C2GA 1DDHA 3K71B 2X9WA 5KVGE 4RVBA 1DBKL 3FT2A 1FP9A 5E6IA 1OF8A 1W1B1 2EUWA 1Z3NA 4JO1L 4MDJB 4Z23A 1EX1A 4INFA 4RK8A 1P9MC 2K1MA 1T7VA 3EHBB 3TU6A 5J0BA 3U1PA 5E08H 5CR1A 4GUHA 3UXIA 2Q6ZA 3LRSB 3HRZC 5BS0A 2NQLA 3P60A 1LBMA 5AYQA 2P3ZA 5E95B 4DCQB 2AJ3A 1IGCH 4ZO6A 4UU9A 4FQ2L 3F00A 2WSPA 4X6CE 5EBGA 4ZDHB 5D2XA 2QCEA 1AR1C 1SMOA 4I4WB 4M7JH 5JYLA 3ULUC 4NB7A 3ROLA 1E0VA 3QK0A 3CSGA 4KDTA 1KEMH 4G2DA 5CN3A 4NHUA 1ISZA 1CYXA 5C0CA 1BVLB 2VERA 1IBBA 1BXVA 3NA9H 3FSVA 4E3VA 2BODX 2GY7B 2W62A 5GS2H 1MIMH 1QX1A 1UB5A 3IDGB 5BMFL 4DZAA 3APGA 5FCZA 1BVWA 2J8FA 1FYTD 4UBPC 3TZNA 3IDYB 2W65B 3OHXA 4EF9A 5HHVL 2W61A 3CSFA 3VXTA 5E1QA 1XIGA 5ALCL 5E8EB 1DWJM 3DKJA 3LY6A 4L4TE 3T5WA 2YYTA 1E28B 3WGUB 3HNSH 1SXZA 2OW7A 3BLPX 3PGDB 1XI3A 1QVBA 4U1GC 1IE5A 2R1XB 2ENSA 5D6DC 1GW1A 1IC5H 1NQ6A 4NQED 4PUMA 2REQA 3MRBA 5C5YA 1E5AA 4EX4A 2OL3A 1LWJA 1QOKA 5H8UA 3IDNB 1EBGA 2FZNA 4Y19D 3W25A 1WD8A 1ZLWH 3OBAA 2Y70A 3HTWA 1QASA 3WLTA 1OFPA 3TYUA 3V5DA 4IDLA 5DZJA 1DVZA 1ZFJA 5I77A 3MRRA 1OGSA 4S0TD 5KZEA 5GZNC 2YL8A 1NMAH 2UY6B 4BWLC 1QLEH 3DRTA 3F6JA 4HISA 5HHPA 1F8TH 1N0XL 1EEZA 1RVFH 1N82A 3VCRA 3FV9A 1HSAA 3GMQA 4B9KC 3WQ5A 3A24A 1UTDA 1P4LB 4PJFA 1KELL 3DROB 3UF9A 3D4GA 4R4BA 4AZCA 5HQLA 4XX1G 4POYA 5DMMA 1KFAH 1GYLA 3C8KA 4KNUA 2FGBA 5GGVL 5K9KA 3UWVA 4ELMB 3DXIA 9XIMA 1W0YT 4ZFCA 2XDFA 5CJQH 4JLRB 4PS4H 1HP5A 3BKYL 4WTZA 4A8RA 1CFTB 1S9XA 1OX4A 3FXIC 1MFAL 4HCRL 4UDTA 5DHXB 5EUOF 4ZQNA 3D39A 3DX9B 3EDJA 3VVVA 2Z8VC 3S4SG 2XSKA 3BVJA 4Z0XA 3RPMA 2IPTH 5LAXB 3Q8FA 4QG8A 1JBJA 2B8OT 1NKRA 3NG5A 4FFZL 3APMA 4HIJA 3VWKA 2VDRB 1WDAA 1ADSA 3WD5L 3RXZA 4C6BA 2VXVL 3CQHA 3KR3L 2VXSH 4N5ED 1MDRA 1G4MA 3KBNA 5EUKB 1FORL 3RTLA 3L13A 3VW3H 5E8OA 1V5JA 3QH2A 1OGTA 3FTVA 5CMAA 7REQB 2X70B 1YLBB 4QQ3A 4H8HA 1RLBA 2H2PD 3N4AA 3JWOL 1T0NB 4AQ1A 3CMOH 3DFSA 2E6AA 3GR8A 5F44A 4LAMA 5D1QC 2ORBH 4Y2OB 3VFSA 5IQ7H 1B3ZA 1Q6QA 1PKOA 5DS1A 3MCYA 5G4MA 3W56A 3NJLA 4B5ZA 2DZTA 3FU7A 5HYSG 1J96A 1YEFH 4IIFA 3S3JA 4LY4A 2HJFB 2ZCHL 4JCLA 4IYKA 4RGMB 3Q6FB 3UFIA 1FC1A 1FVCB 4GKTA 1U3HC 2BVOA 2GAZB 4U05A 4XN1A 3FHQA 3TJHD 4LPVA 1FH9A 1UUOA 1VBHA 3KVKA 2C4XA 3ZRCC 5KSAA 1U8IA 2K6ZA 5I07A 1GORA 4S1RH 1IGMH 5DWUH 5M2FX 5T3ZL 1ROWA 4M93C 5LO7A 3CVBA 1NLBH 2Y7EA 4GW1A 2P1FA 2HKHH 4W9LC 3U2ZA 4OD3H 2UY4A 1PPIA 2WQXA 2Y7FA 1CXLA 3M0JA 2WW5A 3NACL 4H13C 2R83A 3EYVA 4D71A 3SSJA 3O3AB 2IAMB 1FE8H 2BNRB 4KJWC 2TRYA 4P2QD 2OS7A 3DVIA 5E1AB 3R7QA 5JW4R 1QSEA 2AJXH 2XNAA 3QNFA 4LIQE 5KZDA 4S11A 4YHNB 4IG2B 1EVTC 3QEGH 4NN6C 1WIUA 3VXRA 4BEIA 1UXWB 2Y06L 1DQVA 3OWRA 3RWEB 3VU2A 1IM9D 1F90H 3MLRL 3QO1B 2R4RH 4L3CB 1GIGL 3SE4A 4GUQA 3PNZA 3WELA 5EC2A 3SKNB 3K4AA 2OSLB 2HNHA 3RB7A 1SHWA 3N3EA 1HINH 3C09B 1IEBA 2K3HA 4RAHA 4A04A 1IBHA 4QFUA 3ZDYB 4DNHA 4AL8C 1KCSH 1KJ3H 2NY4B 2ZCKH 4YHPB 5CUSH 5B7EA 1FDZA 1KDIA 1SR9A 3RX5A 3FW6A 1GQJA 5EIVA 3QDJE 4NKMB 5ELIA 1YDPB 3AZUA 1X5LA 5ADPH 1E43A 4ZSTA 2YPLE 2VN3A 2IKIA 2QCGA 3RIKA 4JTEA 1Q9LA 4GW4B 4QGTA 4YSRA 3S7GA 4KRPB 3WK2A 2ARJQ 5CD5D 3U6RA 3TW9A 2DIJA 1R3HB 3X3GH 1CF8H 1FJ1A 2C1IA 2J21A 1WZKA 3RVXC 4Q4SA 3F5LA 3H3KA 5ABGA 1ESOA 1MFDH 2IAMA 3OD3A 4IPNB 4Z7IA 4TSCH 3SCPA 4E38A 1I8IB 4WNQB 2C9SA 3AHYA 4LPXA 5KZCB 4UIOA 1P6FA 2OMVB 1OQXA 4N0RA 4U4BA 5LNEA 3T0EC 2CLLA 4ALDA 2F6KA 4AQLA 3FONA 1JNHB 1N70A 3OKMA 4FNQA 1W8EA 3G1YA 4HKPA 4LRNL 1X1NA 2WZ5A 5BV7H 1RI8A 2FATH 5EUOA 5LCVH 5J6SA 5ILTH 1FWJC 4QXVA 3VRLF 1VFTA 2PI6A 4J5NA 2P10A 3ELFA 1PCWA 1ONQA 1Q66A 2VGGA 2OG9A 2BSTA 2ATKA 3BUQA 3IF1B 4ODTL 1OAJA 2CZFA 3WEOA 2V5SA 2WMIA 4R7DA 1VF5C 2IAAC 1AJZA 3PJSB 4YSQA 3DA0A 3MB9A 4BEQA 3PUDA 1GOGA 3BIKA 4JX0A 3Q8EA 4JNMA 4PWFA 1DN0A 1SLVA 2E76C 1T0NA 3T8MA 4AQ1B 4ZTOL 4RZ4A 1V7MH 4WKZA 5BJTB 5I1GL 1YEDB 5IHZA 3C9NB 2X1TA 4KROD 4B5WA 3QMTA 4Y1SA 2GVEA 4I5BB 4OTXL 1DBBH 3LRGA 3BOVA 4LFYA 4DZ5A 1N7KA 1VFBB 3QQXA 2A21A 2CJUH 2G3ZA 2IH3A 2WXFA 3OJVC 1A3HA 3MJ9L 4O18A 4YE4H 3WIHL 1C5BH 1TJGH 2ZZ7A 1I7UA 1PS3A 2BMBA 4KUCF 4NO2A 1VCGA 1Z9NA 4OU3A 2GTWA 3DEQA 1KPVB 1BPVA 4PUKA 2BNQA 3FA4A 3VE9A 1E4MM 1V0LA 3JV6A 4RGOL 5TK2A 2A2IA 2Z0IA 3QOMA 1UJTA 1NC2D 4OZIE 5CPLA 4Y4HD 1POJA 1N2RB 5DWPA 3HZKA 3N6HA 4KWOA 5C0CE 3HBLA 1ZAJA 4L4LA 2F54B 4IQHA 3QS2A 4KK8C 4Z7OF 1JGUH 3G5YA 5HPMB 4JFFD 4FQIH 1AG6A 1J5CA 1VQTA 5FF2A 5FJUA 3BD4A 3C8KB 4R9HA 1VACA 1YMMD 4F7TA 1XRTA 3K13A 1JNDA 5TK4A 3PSVA 1OAQL 1BAFH 4F0HA 4ORGA 4YCPA 1EGZA 4NJAL 3MS8A 1CE1L 3QXTA 2ITCA 5CSZA 1QI0A 4AX6A 1A2YB 3G18A 3LB6C 4LNRB 2QUMA 4O1CA 1DEEA 1EWHA 2ZAGA 1HCVA 3LH2L 4XWOC 1JWUA 4NX5A 4R8WH 4MA7L 3DRTB 4G6MH 4D6FA 2UY6A 3V6OC 3HPLA 1FV1A 3ALPA 3H2AA 2W9LA 4UTJA 3VNKA 3PGCA 4FABH 3DN5A 1B6DA 4A6YB 1N64L 1ML1A 4P8QA 1YMME 1CL7L 2CO3A 3K91A 5KVMC 1TE6A 3PJXA 4U10A 2QZRA 1N59A 1JHLL 2PW2A 1F4WL 2JB6B 3DV6A 3F12B 4FGMA 1CBVH 2G2NA 4PRAB 1G0CA 1XBYA 2O72A 4HWEL 2SFPA 4W9GC 4QIUA 1WFTA 2UXTA 4LJ3A 4YHZL 4QP0A 1G5AA 3MNVB 1UZ8B 1W72A 4NS0A 4WVRA 4K9EH 4W7VA 1RKRA 3D46A 3WIHH 3IMSA 5TF0A 5I6LA 4AH7A 2YJLA 3EOBA 4QRFA 3QDMD 1MAML 2NX5D 3BQUC 5CP7A 2W66A 4PJXE 2OI9C 2PO6C 1MCJA 3KBVA 4KK5C 1J1XL 3L9RA 4OJDH 1K4CB 5HR7A 8FABB 3RWDA 1IFHL 6ENLA 3DERA 1H60A 1KC7A 1B0RB 5FYJL 1A6TA 1ULVA 1FZOA 1LHZA 3N1GC 1OJXA 2YCJA 4MKMA 1IWBA 4LUSA 3VXSB 4WOQA 2I14A 4GY1A 5JQ6H 1K03A 3IIOA 1NCTA 2D2GA 4NAEB 5A5WA 4F33A 4BCEA 1P6AB 1GAFH 4K2UH 5GJTL 2I5QA 1FYTA 5I18H 4JTJA 1XO8A 4QHNA 1T0OA 2CO6B 2R0LL 4FQQA 4AK2A 2B5IB 3O4LE 3OV6A 1IF2A 4LCCA 3WJYA 4ILSA 4PIBA 4C6LA 1M65A 1EZVY 1HJVA 3FT1A 5KVDH 2CHRA 2CZVA 3SN6N 2YMXH 3BO8B 2P46B 3N41B 1X5YA 3WFCH 3PZGA 3PWUB 1NGPL 3OXRA 4MTVA 1BWMA 2OL3H 4LCVA 2J9XA 1FWGC 1P4BH 1TQCC 3E8UL 5JNYA 1DXIA 2YQBA 4BRVA 1G7JB 3SE4C 3Q7JA 4UT7L 3SPVB 4C60A 4C54A 5CGYD 3EWXA 1YHPA 1Z3GL 2V2WB 4QKXB 2XX0A 1HKFA 2CRZA 3D25B 4JQIL 5F93C 2IPWA 4WU5B 3OF6D 5IJVB 3POHA 5BQ7B 3NZRA 1LDPL 3QCVH 1GSKA 4IP5A 5TD4A 4GO8A 4RZ5A 1MVYA 5AUMB 5CP3H 3OKLA 3EKGA 2EEDA 1FIEA 3MHGA 3GXIA 4FJYA 2QVHA 3D06A 2ERJB 3NIDE 4OKVB 5E00A 4C6KA 4P3DA 2IFGA 2A1YA 2JJTA 4Q58C 3KLHD 4OU1A 3AYTA 2Z4TA 3TYFA 4HLJA 4HWBA 4JFDE 2FPTA 3UCRA 1F0LA 2GJLA 5ACZB 4I3SL 1O7DC 1B0GA 4IS6B 3VMPA 3KHJA 4HYTB 1H7NA 2YD0A 1YPIA 1XPYA 4GG6B 1WZ1L 3FO1A 3UBPC 3MUXA 2WJ5A 3P11H 5I6MA 3SIZA 1CD0A 4Z1YA 3EWUA 1CIUA 4OLVH 1E4NA 1UMYA 2GL5A 2ON3A 4AYGA 3GVQA 3KTXA 2W38A 2YK1L 4MB4A 4OV9A 4FP1A 2DQGL 5AZEL 1N7MH 3S5SA 4PFHA 3QLLA 1M4KA 4A7UA 4G7QB 1UWQA 2ICCA 2V33A 5CAYB 2IC2A 1CE6B 4MSWA 2VZTA 5D1QD 4UQ3A 3GS4A 2OX5B 2AQ1A 2N0KA 3U82B 3VFRB 5K9QI 4X5LA 4K3EL 3NOEA 5E99H 4P5TB 3BN3B 3Q2NA 3QFJE 1TZGL 5AVYB 4LBUA 3BFOA 3D85B 3LLXA 5L6YH 5DR5L 3AT8A 1DLFL 5ABAA 2HT3D 2BVQA 2XFXA 4PJCA 4C4KT 1M7OA 4LYQA 1JNNL 2F7PA 3HV9A 4NQDB 3SQBB 2GC4C 2R9RA 4EIGB 4MPQA 4ZB5A 1XSKA 1RK7A 1U5VA 3LN4A 2XBZA 2GJ6B 1YYCA 2V9TA 2VITA 4KKCC 4LSUH 4N5EC 5FW7A 3QZAA 4MAYC 4NZ5A 3L12A 1FFPA 2ZD0A 3QDJA 1EAOA 4AYSA 3IACA 5GGUA 3PS6A 1YNYA 4KFPA 4QYOB 2DQUL 1J5IA 1WHOA 3K72A 3UTOA 1AHMA 1VLIA 4E6MA 1ZY9A 4KEUA 1OF2B 2FWUA 5GVJA 2C1GA 4AT6A 4IPJA 5JIHA 4RMRA 1EFXB 5IHBA 4JRXB 4GRWB 5MHSD 1OLZA 2CERA 2YEZB 2AQWA 2L5HA 2BOBA 3B37A 5LGHL 3TAKA 3C5ZA 3RFZA 1ZLPA 4A2RA 3VD3A 3CV1A 1FAKT 1B0IA 2AJUL 3VXMB 4Z17A 2FX7L 5L4MA 5BXPA 3NZQA 1YYMH 2YJQA 4OWGA 4PJ9B 2NW3A 5FB8A 3TV8A 5C8JA 2ZUQB 2WZTA 4YIQA 2OEJA 3KTSA 4PMDA 5AAMA 4GZEA 4C91A 1BYNA 3BAKA 4XPAL 1RV6X 3U1SL 5HYJA 4J2XA 2EECA 3TVMC 3V16A 3VDHA 2PR4H 4DVRH 3WBAA 3EXJA 4FQHB 4HNCA 2BWQA 1FDLH 2HE5A 2OR7A 3MA9L 1SUXA 3QG6A 5F8QC 5TGBB 1JZ5A 3MUAA 4LLUA 4GHRA 4DZHA 3IKCA 3GSOB 1X7QA 4WUUB 1WDRA 1ZA6B 4FZ8L 1MCOL 1H7RA 1MEWA 1LBFA 1PVNA 3IUIA 1DJNA 3OA3A 4CD5A 2FBOJ 5HHNA 1QLEL 2FECL 3NQIA 3BLBA 1SYVB 5HHXL 1IC7L 1RU9H 3LH8A 3P73A 4IGBC 4J2QA 3ATFA 1Z6KA 5B1JC 4M19A 5ABFA 2YGPA 2X0SA 1J12A 1IC0A 5A8GA 5EHFA 1UOKA 2OYKA 3R0MA 1TLMA 3OR7B 2OU4A 3U46A 1VGAA 4XP9L 3P0YH 4PJ7F 3LQLA 5BZAA 2EHHA 5EO1A 1SGKA 3LTVA 4I5XA 4LGRB 1KUMA 3L3KA 4LPTA 1OCRB 3T40A 2ORBL 1U2CA 1CZ8L 1XGRB 3EYSH 2VISB 4QR7A 5DRXA 5HJGA 2WNGA 1HHJA 3RA7L 3WDJA 4PGJA 3IMBA 1I1WA 5C2BH 1L6FA 5JPNA 3FFCD 1NP0A 2BC4A 4RQQB 5I74B 3SKMB 5BVJA 2BINA 1HQRB 2WQRA 3P2VA 2G50A 4YVUA 1PYFA 4N2YA 1I9EA 2I85A 4JVPA 2BVWA 1JEZA 1TPEA 4XKMA 3SCQA 1MW3A 4AVJA 2P52A 3MXWH 3WLRA 2H3XC 2Q86B 5DK0A 2NX5B 4CAGA 1HJBC 5F7YC 3E38A 1BFVL 1F6KA 5CU9A 4MCNA 5KANI 3UIZA 3A13A 2YPVL 1RFDH 3GTVA 4R90H 1IM3D 3TBTB 4HA4A 5I24A 2DBLL 2IALB 4MBRA 4OJCA 5D6CB 3PZQA 3II3A 4HIIB 3PDDA 5LQBL 4DWSA 5JR1H 3PPSA 2FX9L 5D7EA 3FB8A 5GGSB 1IBFA 2DQ6A 3OTTA 4N2HA 5MEOA 2VCCA 2YKLL 4XXWA 2YK1H 2FBRA 4MASA 1A5OC 2HT4D 4JO1H 2AK4D 4P46A 4OV5A 1YPFA 5FYJH 1W9XA 2VQ1B 3CWOX 3W1AA 2X1PA 3H3BC 1AQKL 5HOSA 1MCWM 3ALFA 2G5BB 4U1KA 2NZ9D 3T4WA 4NJJA 3LKPA 1K3ZA 3VCCA 4F3FA 4BJLA 3WFDH 4ICNA 4MHHI 5ACLA 4YNYB 3O0FA 1E9QB 3C5JB 2VVNA 3WSQH 2ZCKL 3U2EA 2ATMA 2W4XA 3RBSA 1QPQA 1KLUA 1PYWA 3A67H 1TEYA 2R69L 1PDYA 1AI1H 2GQ3A 2RAGA 4LVDA 2MOQA 1FVEA 2JQAA 2WM0A 2X4TB 5LNUA 1MI5E 4KPLA 4M7ZB 3GMPA 1MHCB 2G3JA 2JKLA 1F58L 3B05A 3KGUA 1SRDA 5DVOA 4B15A 4B3ZA 2ICWA 3JTSB 3D39E 1FFQA 2M1KA 2Y1HA 4GWEA 3ULVH 2WOQA 4DZBA 4EI5A 5IROD 3FU9A 3UXLA 1BZ9A 2V7HB 3OC5A 5FA5A 4JO3L 4Z0JA 4X6CF 1I1RA 4DP5X 1ADDA 4PJEF 2XRAH 1XLLA 4QCEA 4XPTL 2WUBL 3X1NA 3N6YA 3OWEA 5CCZA 3RBGA 5KYXB 4ILDA 1ADQL 4DUOA 3SPCA 2ENYA 2IVFC 2ZKYA 1C92A 2H0PA 4OV5B 4LAQH 1BP3B 1ZV9A 1Q6DA 3UADA 4DVBB 4KROB 5C0GA 4GAAA 5C7HA 4OD1L 3ZE0F 1S9WB 3BWAA 3WQ6A 5IBXA 2D73A 4XMZA 2X7LB 1P5VB 1T2QH 4XBEL 3WUZA 5GS1C 4B3KA 4MJ5A 5JYMA 1EPVA 1S7SA 2PP9A 3NFSH 3MBFA 4TUFA 1JD9A 1WGVA 3FAWA 3VNJA 3P2TA 1UXSA 4FFYL 4X9BA 1TJ1A 4JQAA 2NV9A 4P4KC 2HVMA 4BHUA 2NX5A 1CURA 4NKOA 4F7PB 1OB1A 4FQXC 2QJNA 3SBWC 1AG0A 2FEDD 3IE4A 4HBKA 3IKKA 1A5CA 1Q8AA 2ZSVB 1MCQ