3L2MA

X-ray crystallographic analysis of pig pancreatic alpha-amylase with alpha-cyclodextrin
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
b'EYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGQDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVWFRNVVDGQPFANWWDNGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title X-ray crystallographic analyses of pig pancreatic alpha-amylase with limit dextrin, oligosaccharide, and alpha-cyclodextrin.
pubmed doi rcsb
molecule tags Hydrolase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l2mA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l2mA01
3VDCA 4U3AA 1CWYA 4AWEA 4OJYA 1V6YA 5C8BB 1WZKA 5JUVA 3WUBA 3WY1A 2QF8A 1FP8A 4KGLA 4W7UA 1QNRA 3VM5A 1BF2A 2E3ZA 2QMKA 2WANA 3GBEA 3GZAA 3VD3A 2EABA 3BVUA 4FNUA 5ABFA 1J0ZA 4W7VA 1E6PA 3M6DA 4TTGA 3BMVA 4AMXA 3PZTA 2VNCA 2A3CA 4D6HA 1NP0A 3RIKA 3ARVA 4QLJA 3A4XA 3W6MA 4HMCA 2FYVA 3VMOA 3BAJA 1BHGA 1XRVA 2XPKA 4PMRA 1CENA 2J7BA 2XGBA 5IFTA 4TOQA 5IHSA 4MB5A 2Z1KA 3K8KA 5I24A 2WMFA 4FNTA 1QWNA 2PWDA 1R75A 1I75A 4MB3A 2NW0A 2GJPA 5F7UA 4NZJA 3VMPA 4Z2GA 1E70M 1PX4A 1C93A 3W28A 1J0HA 1Q6DA 6TAAA 4P8UA 5EB8A 1ODZA 1NQ6A 1MXDA 2YA2A 1JDCA 2W66A 5I79A 3ZT6A 3NIYA 5EMYA 2Y5EA 5KEZA 3BAYA 3WQ5A 1W9UA 3WDRA 5DMYA 4Z2JA 3WQWA 1HXJA 1FOBA 3KWXA 3SUSA 1G9HA 2D0GA 4J27A 1GORA 3ARQA 2E8YA 3W37A 2W91A 3O9NA 3VIPA 1HJVA 2XVPA 1GPFA 3D4YA 4RE2A 3PTMA 3EDDA 4DWSB 3WDIA 2CERA 1FA2A 1AVAA 1EH9A 1K9EA 1BYCA 2AMGA 2WYSA 3L4UA 4NRSA 3I3BA 2IXVA 1GOIA 1VRXA 4DUXA 2OWCA 1C8QA 1UYQA 3RMEA 4GQRA 3PZNA 3F4VA 2VX6A 3L4YA 3WFZA 4AYGA 1ZBVA 3NJ3A 2E8ZA 1ISXA 5A8OA 1BTCA 2EQDA 1W1PA 2WHLA 2WK2A 2WWDA 3WQ8A 1CPUA 3SUTA 3HG5A 1WE5A 1W2VA 2J47A 4X0VA 4HU8A 1KWGA 2J74A 3LPOA 4EANA 4AYSA 1UKTA 4AZHA 1FH9A 3AHVA 1CZ1A 4XZBA 3WN6A 3VMNA 3K4DA 2D1ZA 2WWCA 1K9FA 4KMQA 1VEMA 1V3IA 4W8LA 3CBWA 1B3YA 2CBIA 3MU7A 1G01A 1KXVA 3L4WA 2J4GA 1TFVA 3ARYA 3N15A 3CZNA 1I1WA 4TVDA 4MJ4A 3AMGA 1E1EA 3HN3A 2CCRA 1JYVA 3MANA 5DT7A 2VR5A 3VX1A 1QX1A 1SFSA 4AY1A 3TTSA 5A2CA 2Z1SA 3VIGA 3CO4A 2WSKA 1QI3A 4JAWA 4HMDA 5LA2A 3A21A 5D9PA 1QBAA 2WLYA 4WSKA 2VO5A 4D71A 1XSIA 1FFQA 5ABFB 2ZWYA 3KLLA 4FNSA 3MUIA 3BVTA 5A95A 4F9DA 2J25A 3SEPA 3SCVA 5CPSA 1TQTA 2DH2A 2YFOA 1MFVA 3I3DA 2FHCA 3BSHA 4FLQA 3UG5A 1EQPA 1EA9C 2QLYA 5FKYA 3RM9A 1EIBA 2JIEA 3WNPA 4WKHA 2DT3A 3WNKA 2ZX7A 1BYBA 1OWQA 4UQEA 1AQHA 3SIMA 2WBGA 3IK2A 2DIEA 3AZRA 1V3JA 1TA3A 4DM1A 1LL6A 4UFJA 1I1XA 4JHZA 3QGVA 2WC7A 1TQUA 4Q22A 2XJ7A 3BAWA 4F9JA 5LA0A 1NWTA 1CGYA 4D1IA 4WKFA 4BQ5A 3M46A 4F8XA 4U5KA 3EDEA 1XHGA 2DT0A 3W53A 4IISA 4QAWA 1N82A 2BXZA 1C92A 3VU2A 4R5EA 3WQ4A 3CZEA 1QNQA 2EPLX 2XUCA 4N42A 3WL0A 4Z2HA 1JI1A 2CNCA 1UKSA 1UQYA 5CSYA 4M1RA 1JXKA 1CXIA 1OIFA 4DWSC 2VT0A 3W0KA 3AIVA 4PUEA 2F7PA 3A3HA 2EO7A 2Y2WA 2YOCA 2VQTA 1UWSA 4J3XA 3CUGA 1QNSA 3GNPA 1E6XM 1JDAA 1E6NA 2GJRA 1C90A 2WSPA 3BMWA 4HP5A 4M80A 3PZQA 3D50A 5CZKA 2Y8KA 4EAMA 2Y4SA 2ZICA 4IUGA 3DX2A 4L4OA 3ZJ6A 4XX6A 1L0PA 3WDHA 1E55A 2YDRA 3WENA 4X0NA 4MB1A 1QI5A 2WLZA 1PIFA 1PS3A 2HISA 2EPKX 1E4MM 2WMJA 1LF1A 4H2CA 3ALFA 2WVUA 3N12A 5CG0A 5BXPA 1BVZA 1JIBA 1HF6A 2W4XA 5A8MA 4JKLA 1B9ZA 4CD4A 4IPLA 3OLGA 2VL4A 3ZMRA 5D9NA 3NYDA 4NZCA 4CGTA 3BCFA 2J79A 5JBEA 1V3HA 1B1YA 2C8NA 4Q7NA 1SZNA 2CBVA 3N9KA 2CHOA 3DX1A 1AQMA 1EXPA 1CXEA 2DIJA 4R27A 3RO8A 3SCOA 2YA0A 4AMCA 4ZENA 2ZX6A 1MVYA 3TONA 5DFAA 1ECEA 4ACZA 1PX3A 3DYOA 4PBGA 4L4PA 1UASA 4AC1X 3VM7A 3AYRA 3PZGA 4AIUA 1UWTA 1E6RA 4NSBA 3IAQA 3BVXA 3DX4A 1RD6A 3H55A 5EFDA 3TTOA 3EJUA 4D1JA 3U5YA 3WIJA 4V27A 3GXTA 3S5ZA 4W7WA 5DEZA 5HPCA 4IPNB 4C7GA 3MO4A 2OLHA 1BSIA 1V02A 2WPGA 4YN5A 1QHZA 1E15A 1GCYA 1XC6A 5GQBA 3AISA 1WCGA 1B30A 1CGTA 4WLCA 2OWXA 4HPGA 2E4TA 1HJWA 2FDMA 4MPKA 2CYGA 2QPSA 1ISYA 4F79A 3VDBA 2VQUA 3VD5A 3VX0A 1VEPA 3WF0A 1QHOA 4M24A 3WH8A 4UOZA 4UQCA 4JFVA 4WIWA 3H54A 4GZJA 3ARRA 5AYBA 3WNOA 3EDJA 4KWUA 3NSNA 5IDIA 2V3EA 3FHAA 4FNQA 4UOQA 3L2LA 3OLIA 1DWHM 3O6AA 2WB5A 3AHYA 4PMYA 5I23A 1C3FA 1LJYA 3VTRA 3OZOA 4LPCA 2TAAA 3UETA 4B9YA 4RL3A 2O9TA 3QHOA 1UKPA 4YHEA 3AMLA 4ZE5A 2ZXBA 3WKZA 2VTFA 3WQVA 1QNOA 2E9LA 2D3NA 1HT6A 3IJ8A 4CD6A 5DT5A 3HZ3A 2YL9A 5E9AA 3AICA 1R85A 1UWQA 4OGZA 5BROA 2W62A 1JYNA 4JZ5A 2CESA 3WH9A 4MJ2A 1BGAA 4UR9A 5HPOA 1MFUA 1UKQA 3AHZA 3NSMA 1PEZA 4NX0A 1U2YA 1GOKA 3EBVA 4J3UA 3BGAA 3AHXA 3BLKA 3CLWA 3LRLA 1J18A 2ZUUA 1HVQA 4DUVA 3WF2A 2BHYA 4AEEA 1HJSA 1V6UA 3OIHA 1VB9A 4KRTA 5ECUA 1WDSA 4WJXA 3T2QA 3U5UA 1DWGM 3OG2A 3N13A 1ZJBA 4BQ3A 3SCPA 4MTVA 2WCAA 3PBGA 2DT2A 2D22A 3GM8A 3J7HA 3ARXA 4W86A 3MUY1 3ZIZA 4JHOA 1KQZA 2CETA 4BA0A 4A4AA 1G5AA 3KL0A 2DGAA 1HTYA 1OINA 1J0IA 2VRKA 4AZBA 1R47A 2J75A 4NZFA 3TP4A 2PC8A 4URIA 3OGVA 5CJ5A 1W3LA 2Y24A 4ZEPA 4ACZB 3M7SA 1NP2A 3BLPX 2ZUSA 7CGTA 1B0IA 1YHTA 6A3HA 2RGMA 2NSXA 1O7AA 4CU7A 5LA1A 1UR0A 2ZXDA 1UR2A 1EHNA 1BQCA 3OBAA 5A69A 2ALWA 3SCUA 5A6JA 5ABGA 3WUGA 4B3KA 3CHEA 7A3HA 2O9OA 2BY3A 1X6NA 3DHPA 2XSBA 4PSRA 2WC4A 2XN0A 3CZ8A 5DF0A 5A6SA 5A6AA 4U2ZA 4UOJA 3FW6A 1LG2A 2D73A 1OD0A 1KR1A 1W9BM 2ZXQA 4MADA 2WKGA 5A6MA 4W5UA 4B9ZA 2NT0A 1R34A 3HG3A 4W88A 3BLBA 4IM4A 3CTTA 3LRMA 3RM4A 4M56A 1W3HA 2AOSA 3LXBA 2O9PA 3U57A 3BXWA 1VJZA 5D8ZA 3TTQA 4UCFA 4UQ9A 1XH1A 2VURA 3FN9A 1UD5A 2UY4A 4HA1A 3VIIA 4UFKA 4JIEA 3GBDA 4S3JA 4AIOA 2VR4A 5IXEA 5GNZA 4AZ5A 2BY0A 4U31A 4OOUA 1DEDA 1R33A 1C7TA 4CU8A 4ATWA 4W8AA 1XCWA 2F7RA 2WHKA 4FLOA 2J7DA 3ZQ9A 1V3KA 1W9PA 3AS3A 5A6BD 2WW5A 2ZUTA 1Y7VA 1PPIA 1VBRA 4QCFA 4HMEA 3D3AA 4PMXA 1B3VA 2VCAA 1LL4A 1UWRA 2WHJA 4CCEA 1HN1A 3OGRA 4NF7A 1XH2A 4E4PA 1UD3A 3CIVA 4GI9A 1C7SA 1TR1A 2EXOA 2GJXA 2WVSA 5CLWA 3LPGA 1OB0A 2ZUNA 3AS2A 3WY2A 1NWRA 3WNLA 1EOMA 4AZ7A 4QP0A 1KTCA 3M07A 5TD4A 3N04A 1DWIM 1NARA 2EBNA 1AMYA 1LWJA 2Y8VA 4BS0A 1UR1A 3N11A 3T2OA 1RH9A 4J3VA 1W1YA 4TTUA 1XSKA 1U30A 3VINA 4DUWA 3K4AA 1FH8A 2UWFA 2DH3A 3IJ9A 2XWEA 3D51A 4D6IA 4M81A 3U7BA 5JBFA 2WMGA 3HG2A 3WNMA 3W29A 2NT1A 3WD0A 4PMQA 2WKLA 3I3EA 1EOKA 4FNRA 3WMBA 2FGZA 1WAWA 4GO8A 1BGGA 1VJSA 8CGTA 1TG7A 3RPMA 4QFUA 2EJ1A 3MUZ1 2X0HA 5CPTA 2V5CA 2BFGA 4WSJA 3WF3A 3WNNA 4D6FA 3BH4A 3BUPA 1WDRA 1CEOA 2VJXA 3WMSA 3HU7A 3ZOAA 3BUDA 2JE8A 3B8SA 3AOFA 2E0PA 3AI0A 3MKKA 4ZE4A 2A3BA 3LMYA 4AD0A 1DTUA 4RE4A 1NOUA 3UR8A 3AYSA 3EYPA 2OSXA 1B3ZA 3AIBA 3W24A 1PX8A 1BYDA 1KXTA 3CMJA 1J10A 1GVYA 2G3NA 1R7OA 5CSUA 3AIEA 4FK9A 3SCTA 1WNOA 1JZ4A 3UERA 3LPFA 1W9XA 2EAEA 4PRWA 4AD2A 1XGZA 2ZX5A 3A47A 1CNVA 1CGWA 1JGIA 1X1NA 2XFFA 1GOOA 2OSYA 4PN2A 4HOWA 5EFFA 5EBAA 1BG9A 1W3JA 3VNYA 1B3XA 1PBGA 3NSXA 3GTNA 4E8CA 5M3WA 3AIRA 3ZT7A 2W67A 5I0DA 4ATDA 1JDDA 3WD4A 2C0HA 4J3WA 4E2OA 3A4WA 1GHSA 5FD0A 2D0HA 2J8GA 1ZL1A 4BQ2A 3BC9A 2B31A 4WF7A 4UFIA 2DDXA 3WMCA 2QV4A 2EACA 2YLAA 1VIWA 5BWFA 2ZUMA 2F2HA 1WP6A 3GH5A 1H0GA 3DX0A 1SMDA 1WO2A 2GDVA 1H0IA 1GNXA 4JL1A 3KL5A 3UEQA 1ZBKA 3G6MA 5CQ1A 5GNXA 3ZR5A 2G41A 3L4TA 5I3DA 3CPUA 3T0BA 5AYIA 5GNYA 1GOWA 2YDQA 4AD4A 4PTWA 1SYTA 2VMFA 4GXPA 3ECQA 3ARUA 3T0DA 3GNRA 2Q8XA 4W85A 9CGTA 4MNKA 4CCDA 4U5IA 4BCEA 5A8QA 2XGIA 2J7FA 4CU6A 2GJXB 2X8RA 3MS8A 4NI3A 3CZGA 1CLVA 3CHCA 1FP9A 2J78A 4QLLA 1MW0A 1KWKA 2CIPA 1UWIA 4MDOA 1H41A 3VD7A 1OGBA 1VBUA 3W26A 1JG9A 1JZ2A 1MW1A 2VCCA 3K8LA 3VKKA 2WZHA 3FNDA 1PIGA 1E40A 1TQSA 5BXTA 4EE9A 5HBFA 1CXLA 4P7NA 2PWHA 1MQPA 4FNPA 1QVBA 3SCWA 1E43A 1R86A 3ALGA 1E73M 4W8BA 3ZSTA 1XD0A 1M01A 3MUAA 1E3XA 2O9RA 5ABHA 3CH9A 3WUEA 1ZB5A 1NOWA 3WBAA 3CHFA 2X2YA 1P6WA 1HP4A 1UD8A 1G0CA 3AMDA 2VVNA 3AS0A 5I77A 4B3LA 1OM0A 3WL1A 2DPEA 3QHNA 5D4YA 5ABEA 2CEQA 1GQLA 4GI8A 1R46A 3S2CA 3JUGA 3ARZA 1WDQA 4ZXLA 5E6ZA 1FFRA 1B31A 3EJRA 1VFUA 4PTVA 5D8WA 4FMVA 1RPKA 3N18A 1HIZA 1CXKA 1V03A 3VGGA 1C91A 2IGTA 3CV5A 1JFHA 3DX3A 2X2IA 3PZOA 3AJ7A 1D3CA 4UTFA 3VGHA 2ZX9A 3ZT5A 4XB3A 3EMQA 1CGXA 4CVWA 4HPHA 2F7OA 4CN1A 3FXYA 5HNNA 3VIJA 2DSWA 1IZKA 1MQRA 4AD1A 1M04A 1QHPA 4TX8A 4OBRA 4ATLA 1E6SM 4AZIA 3F5LA 1GVIA 4JFTA 5M03A 2XM1A 4OZOA 1KCLA 1OGSA 1V0MA 4KGJA 4D6JA 1JZ8A 1E0XA 3T2PA 1UKOA 1VFFA 4Y7EA 4W87A 1CGUA 2PI6A 3RDKA 2PBOA 3T09A 1QI4A 4Z2LA 3OZPA 1IT0A 3WH5A 3DHUA 2XVNA 5HXMA 3SUUA 2ESCA 3CZSA 1J0KA 1JNDA 2FHFA 4TVUA 2UY5A 1LWHA 3FHQA 1TZ7A 1VENA 2PWGA 2VZTA 3ZJKA 3PZVA 3WFLA 1GQKA 1JYXA 1J0JA 2J7HA 1ISZA 5I5RA 2W5FA 4PMOA 4P7RA 1BPLB 1VEOA 4OBSA 2WM0A 5M5DA 7TAAA 3CZJA 3B9EA 5FOOA 2G4FA 1CDGA 4HOZA 3AS1A 4P8XA 4DO4A 1V08A 3EDKA 3U7VA 3VIHA 3W82A 1UUQA 4OKDA 3WELA 1W1VA 4TUFA 2VCBA 3D4ZA 4JCMA 1H3GA 3K1DA 2O92A 3VD9A 3A4AA 4A3YA 3VD4A 2XHYA 5E6YA 2C7FA 3HMCA 1E3ZA 2D23A 5C71A 4DM2A 1TVPA 1IZJA 1H1NA 2VX7A 4E8DA 1GUVA 1KGXA 4AZCA 2WNWA 1DP0A 2A3HA 2G3IA 2UY3A 3KE0A 1D2KA 1E6QM 2VZUA 4UQAA 1H5VA 2D24A 1FHLA 3VIMA 2FHBA 2F8QA 3VSUA 5I78A 2X09A 4W84A 4NRRA 1R8LA 3VGBA 1HVXA 4UQDA 5E1QA 1PZ3A 1MWOA 2CKRA 1E71M 4WK9A 2F61A 1GJUA 4YHGA 3VSTA 3WDJA 3SURA 2CXGA 4DWSD 3MSDA 3PZUA 4F66A 1UD6A 2BXYA 1JL8A 2VZSA 2GK1A 3PTQA 1TE1A 4JL2A 3KL3A 3GH7A 3VIOA 1QI0A 3A24A 4PSPA 4XV0A 1JZ5A 1QBBA 3OLEA 2WMKA 4V2XA 3CC1A 3FY1A 4UFHA 1JYWA 2BV9A 1F4HA 3WD1A 1J12A 4Z2IA 3O2LA 2JEPA 1SMAA 3OGSA 5A8NA 3DYMA 5LYRA 5M17A 5IHRA 3DC0A 5IFPA 2XIIA 1V0KA 4PTXA 3S6TA 3UR7A 4W5ZA 1QI2A 3GXIA 2W92A 1UQZA 1ITCA 1W9VA 1H4PA 1JAEA 5JIWA 4MDPA 3VOCA 1Z32X 4JKKA 4HOXA 1V6WA 2WVVA 1WKYA 3QOMA 1ESWA 2XVKA 3AXIA 5A6LA 1V0LA 1OGGA 1WZMA 4PMUA 4PCTA 4GPNA 2CBJA 4M82A 3GH4A 3WH6A 2RGLA 4J28A 1JF6A 5FL1A 2J8FA 2VX5A 3T08A 1HKKA 2XYLA 2YKKA 2ZOXA 5DO8A 4PMDA 3L4VA 3VIFA 2WMIA 5BYWA 3OA5A 1JAKA 2V3DA 1H11A 2V5DA 2XSAA 1W32A 2DSKA 4LYPA 4QCEA 2YA1A 3WY3A 2BY2A 1NOFA 3CMGA 1RP9A 1UD4A 1UZ4A 2WAGA 3D5HA 2OW6A 3DECA 4CVUA 4GINA 4OIFA 1TUXA 1J0YA 2HVMA 3UCQA 3AIWA 2F7QA 1B90A 2YL5A 3EMZA 4UFLA 1CTNA 4BZYA 5CPQA 4AISA 3AROA 4AZGA 3W25A 1CECA 3A5VA 1BAGA 1ISVA 3ARPA 1DWJM 4OUEA 1HKMA 1S46A 3VSVA 1QWUA 1XD1A 3T0AA 1JFXA 3ZSSA 1UOKA 3RJYA 1K9DA 3WDPP 1HL8A 1E5NA 4QLKA 1EDTA 1E56A 1LLOA 1T0OA 3A23A 1E72M 2YBTA 3NCOA 3TA9A 1UHVA 1TQVA 3H53A 1SR0A 5A6BA 3WD2A 2VVSA 3MSGA 1H09A 2EPNA 3TV8A 2D3LA 5BXSA 3RILA 3LXAA 3ZR6A 3FAWA 3LXCA 4MNLA 3A22A 2ZX8A 4GQQA 4AZCB 1Q6GA 1BLIA 4CUCA 4XZWA 3SUWA 1UH3A 4HZ8A 1TMQA 3FAXA 4CD7A 4QDMA 2VC9A 3BCDA 3PZ9A 3W6LA 2WVTA 2UY2A 2W61A 4AIEA 2WZIA 4AZ6A 4D72A 1B2YA 1EO5A 1DWAM 2YL6A 3AHTA 1X6LA 1UD2A 5E09A 2QMJA 3II1A 1W2PA 5AC5A 2WXDM 3GXPA 4M8UA 4CD8A 3BSGA 5C70A 1E0VA 2WBKA 2V3FA 4BF7A 3WD3A 4NXKA 1TCMA 2J77A 4PCSA 2VZVA 1C8YA 1TVNA 1EHAA 1GHRA 2XG9A 5GPRA 2D0FA 4U3CA 4J3TA 2CPUA 3BUIA 4C7FA 4MNJA 1BFNA 3WQ6A 1A47A 2GK1B 1KXHA 2XTKA 4CKQA 3B9AA 1GQIA 1A3HA 1HX0A 1PZ2A 4MB4A 1WZLA 3AMCA 4P7LA 1KXQA 3IGUA 2G3JA 3B9DA 3F5JA 2W63A 4MAZA 3KEHA 2X1IA 4ML4A 4OOZA 1V3LA 3TOPA 2ZUVA 5I2UA 5BXRA 1E0WA 2WVVB 3QR3A 4DO6A 1W91A 1E4LA 2D2OA 5JIPA 2PF0A 2F1BA 1US3A 3L4ZA 2OW7A 1KFWA 2DEPA 1OBAA 1NWSA 2ZE0A 2WCSA 2XFRA 1VF8A 4RE3A 2F1AA 5FIPA 3IJ7A 3NUKA 2QHAA 3WEZA 2E9BA 4LX4A 3ZJ7A 4D6CA 1GW1A 1M03A 2PBGA 4BQ4A 1KGUA 1XV8A 4P8WA 1ZBCA 2WMIB 1JXJA 3CUHA 1EQCA 2VOTA 3SCSA 2JEQA 4JFWA 3EJPA 5A3HA 4EK7A 5CGMA 2YJQA 3QHMA 3OLDA 1OCQA 1XH0A 3EJSA 4ACYA 3MI6A 1V3MA 1XYZA 3MMDA 2A3AA 1HP5A 5I6SA 3BAKA 5HDRA 1Q6EA 3GXNA 3ZO9A 3BVVA 3BVWA 3PHAA 3AXHA 2G3MA 3N1AA 3F5KA 1J11A 2G8ZA 3GNOA 1UR8A 3WEMA 3POCA 3CGTA 3WF4A 1XYFA 3S5YA 1ZBWA 1YQ2A 1UG6A 4B15A 4YPJA 2IUZA 2OYKA 1M7XA 4LXFA 2BVYA 5A2AA 4LYQA 4X9YA 4W93A 2OYLA 1MW3A 1ZS2A 2E40A 1UWUA 2WHMA 4LYRA 2V38A 1GOQA 3A6OA 3HG4A 3DDGA 2BS9A 5A94A 3UESA 4HZ7A 3VGDA 1E4NA 1KQYA 2FH8A 3VNZA 3LPPA 4UNIA 1DWFM 1M53A 1CBGA 3E1F1 1JZ6A 1JF5A 4U33A 3IAPA 1JZ3A 2CHNA 2X05A 1KR0A 1Q4NX 4HA4A 3ARSA 2XVLA 4PMVA 4PUDA 2ZUWA 2BHUA 3VDAA 1VFOA 1R87A 1Q6CA 3VPLA 3W81A 2BY1A 2EPOA 4PYSA 1Q6FA 1UZ1A 1CLXA 1JZ7A 3KLKA 1GOMA 3VIKA 4PMNA 1MXGA 4LQ1A 4TX6A 2JF7A 3PN8A 2CKSA 1V02E 2WMHA 4B16A 3BAIA 1JNEA 2IXUA 1E9LA 1IV8A 3AZSA 1ITXA 4AD3A 1WDPA 5CXPA 1DHKA 2XN1A 4JFSA 4LGXA 3CZLA 3KZSA 4PTMA 1MW2A 4GZEA 4ZFMA 4HTYA 1NH6A 4PMZA 1O7DC 4JFUA 3VVGA 1CYGA 8A3HA 2JF6A 5E70A 4S3KA 2XWDA 2YIHA 2VRJA 1BYAA 2A3EA 3AIQA 1KTBA 1VFMA 5D9MA 1WB0A 4MAVA 1V6XA 1LQ0A 1ISWA 3G6LA 2YLLA 3WEOA 1UH2A 1TQWA 1ZJAA 1QOXA 2OYMA 3AIUA 2GSJA 1XSJA 5A6KA 3W27A 4CN4A 2EPMX 4V28A 3QOKA 3CUJA 2XVGA 1QPKA 3AXXA 4GZIA 1GQJA 2GUYA 1K9TA 3PZIA 2DSVA 3THCA 1V6VA 1KCKA 4UFMA 4GKLA 1LG1A 1RP8A 6CGTA 2DSZA 4W89A 2VI0A 2J7CA 2DSUA 3DDFA 1AQ0A 4MNMA 4XUYA 1O6IA 1JD9A 1UR9A 1W3KA 3APGA 1KBKA 5A2BA 1QW9A 2PWEA 2ZIDA 1V0NA 3CUIA 1H49A 2YL8A 3MMUA 3VILA 1FH7A 2BVDA 3K8MA 2J62A 4AEFA 4J7RA 4DO5A 3ARWA 3D52A 1QNPA 3SCQA 3GXDA 2FGLA 3K46A 1KBBA 2VX4A 4EKJA 4FLSA 2CITA 5CGTA 3TTYA 3VO0A 3VGEA 1J01A 2X2HA 4AXNA 1BG4A 1KGWA 1HL9A 4TVCA 2EEXA 4M29A 1K6AA 4ZXOA 1E5JA 2FH6A 5CLTA 3RJXA 3WH7A 4UQBA 5FL0A 2X2JA 1GJWA 2MANA 4P7OA 3AMKA 3WUFA 1EDGA 2OSWA 4UZUA 1WZAA 2JFEX 1E1FA 1W9DM 1VAHA 3VUPA 1CXHA 1HJUA 3MV11 1OT1A 3WF1A 5D9OA 3EMCA 4TXEA 3GXFA 1TA3B 1PJ9A 3WSUA 5AC4A 2BVTA 1OD8A 4A3HA 2GFTA 1G1YA 4HA3A 5JBDA 2ZXAA 4K68A 3CHDA 3N17A 2GVYA 2XN2A 3PZMA 3RM8A 1MQQA 3ZJ8A 2ZWZA 2DT1A 4NXSA 1QW8A 1NM9A 3WY4A 2JIWA 3DYPA 1CGVA 2WC3A 1UH4A 2QPUA 4D6GA 4FLRA 3EJTA 1HKIA 3RCNA 3AZTA 4PEEA 1B3WA 4FF5A 3NDZA 1UR4A 1HWWA 4KRUA 1XCXA 3LRKA 3EJQA 2E9MA 4D6EA 1GZJA 4P8VA 2FE0A 5BRPA 2D20A 3W38A 3GYCA 3MV01 3PTKA 5E0CA 2OWWA 4HZ6A 4UZSA 5A8PA 3VGFA 1HXKA 4KH2A 1ODUA 3SUVA 2J7EA 5BCAA 4AMWA 3GDBA 1JD7A 3WBEA 3SCRA 1UA3A 1OSEA 1EGZA 3NDYA 4WKAA 2XFYA 4N0RA 2F18A 3LX9A 4DWSA 4D6DA 4JKMA 3ARTA 1R7AA 4JCLA 1NWUA 1EO7A 2V3GA 2JALA 4CD5A 1HNYA 4H7VA 1JI2A 1CXFA 4H8UA 1WPCA 1C8XA 3SCNA 4C7DA 5A1AA 3EDFA 1E4IA 1KB3A 2EADA 2BHZA 5BRQA 4H41A 1HJXA 3L2MA 1PAMA 3THDA 4CN6A 2BNJA 3VDHA 2CBUA 2YBUA 2YDSA 2PB1A 3GXMA 4P7QA 1H2JA 4H8HA 4H8VA 4U2YA 2DQXA 2XIBA 4AW7A 5E0FA 1J9YA 2VZOA 2X0YA 3UG4A 4Z2KA 4GIAA 1OT2A 2PWFA 4GO9A 5FCZA 3CZKA 2WCGA 4CCCA 3MMWA 1G94A 3BUBA 4GI6A 1HKJA 2J7GA 1D7FA 3AFBA 3UG3A 1GONA 3L4XA 5AY7A 1L8NA 1W1TA 1OIMA 3WDQA 1BVNP 4AD5A 1E6ZA 4HU0A 3CUFA 2YFNA 2VRQA 1ZU8A 2GDUA 3POHA 2WZEA 3OB8A 1U33A 2AAAA 4H04A 1HJQA 1FHDA 3ZM8A 3W4RA 3BUQA 2VUYA 5HOSA 1LL7A 5KZ6A 1UA7A 3AQUA 3IANA 1EDQA 1CIUA 3HJEA 1MYRA 2XM2A 3BAXA 1F4AA 1US2A 4J3SA
chains in the Genus database with same CATH superfamily
4U3AA 4KTGA 5FF7A 3WY1A 2ATKA 5DHVA 1KXQE 4W7VA 3WLOA 1ZCOA 3HB3B 3F3HA 5EU4A 2WXOA 1AL8A 3RGTA 5EFIA 3KM2A 3S8WA 5FDWA 1YEWA 2VE6A 4PJBB 1OSPH 1UG9A 2VXUL 3BH9B 5LGKA 4WO4A 2Q3OA 2R6OA 2VDPL 4P8UA 3ZTNH 1QSFD 4OJFL 5JXEC 3G08B 1M7PA 5HWJA 2CSPA 3ZT6A 4DW2H 3W01A 4ACTA 1F90H 1W9UA 2XACC 3RX4A 3CU1A 2BSRB 4LLWA 1ESOA 1FSKC 1BVLB 4FGMA 3TA3B 4NQCE 3RVTC 2NY2C 1ED3B 5DHDA 4UTAA 1OB1B 2A9ML 4NRSA 3O4LB 4GG6F 4PUUA 1SZGA 4FPSA 3PPSA 1UYQA 3RMEA 2Y6TE 1BF8A 2QNEA 3L4YA 1RUML 3SKMA 5T5NF 2WHLA 2PTUA 1J1OL 2R0ZH 1IAOB 3LHPL 4OGQC 4HSAC 1JPSH 3AHVA 3QV6A 1JGVH 3R1GL 3C87A 2X6AA 1OSYA 1ADQA 5E4IA 4NGHH 4XRCA 1G01A 1WAAE 1KXVA 3R1ZA 4JDVA 2FO4A 4R2GD 2I17A 1E1EA 1EPFA 5FGBC 4PJHF 1JXGA 5DT7A 3VCLA 4P2RE 1CCWB 2FBOJ 3Q48A 1E0TA 3ESOA 2XQBL 4QO1A 2JI3A 4FF7A 5F1IA 3WKPA 1MNNA 4YEEA 2X38A 1SUHA 1VJIA 3KLLA 1EJXC 1SXNA 5A95A 4NSKB 4P4KD 3NJMA 2P8LB 1SOXA 5E95B 2PTVA 4EUPB 7FABH 4J2QA 4J5VA 1IGTA 1BZ8A 4GCAA 1ZA3B 1QSVA 4DWDA 1S3TC 1M7DA 3LN3A 3EHBC 2BW4A 4NB7A 1OWQA 3DGRA 5EDSA 1NDZA 1DQIA 2FPYA 4PQXA 4HC1H 5HGBA 3OG4B 3NQ6A 1TQUA 1N7MH 4R88A 5ALBH 3VFTB 4YE4L 5EKYA 3EDEA 2B9BA 1OSPL 1XHGA 4IDLA 1ETZA 4IRJB 1QPRA 4IISA 4R5EA 5TQ2H 4IGBB 3RWDA 4MNQE 3ZTNL 4ORGB 3PPGA 2VT0A 4Y4FA 4DW2L 2PDYA 1F90L 2V5LA 3A3HA 2NXGA 3VXPA 4HKBB 4QCIA 3BOXA 1IGCH 4P2RD 1OTUC 1JCTA 1J9TA 4GRSA 3TIDA 2GJRA 2D7OA 4Q3MA 5FO9B 3PZQA 3ZZSA 4AV5A 1OLZA 1B88A 3DX2A 3MXWH 4HT1L 1U8KA 1R3TA 2DUZA 4JTCA 1YECH 43C9A 3W00A 3KBVA 3P3UA 2WLZA 1PIFA 1L6FA 1LF1A 4U6VL 4R4BA 1DE6A 2E7CA 3OODA 1BVZA 2NLJB 3N2CA 1BD2E 3VJ6A 1TX0A 3FU6A 1NGQL 4JPGA 1ZHLA 2R0ZL 1OAZH 4ZMVA 2IG2L 4R27A 1JPSL 1RL1A 5F2IA 1JGVL 4FI7A 3UTSA 3H2PA 1BGXH 3EH2A 3N3TA 2XPYA 1NUDA 2QXWA 4Q4SA 4LLMA 4MNQD 4JM2C 2ATSA 1NEZB 3RPTA 2PO6B 3EFFB 2IAMD 4YDJB 4HX1B 4F8PA 4QI3A 1J1PH 2ZXCA 3FA3A 2NZ1A 4APXB 2HLAA 3BGMB 4H5SA 2VQUA 2BVOB 1A4KA 5CZJA 5FLUA 1XIWC 2X1SA 2G96A 1EBAA 2WNNA 5AOJA 5IQMA 5EPDA 1P6FA 5IDIA 1BD2D 4GBDA 4EZKA 3AUVA 1RHFA 1XCQA 5IW6B 4N0CC 4QLWA 3L9RA 1K4CA 2ZWKA 2OL3A 4UOW1 1FWNA 1MHCB 2WKOA 4YHEA 4ZE5A 1N7ML 1SXSA 2FLRT 5ALBL 4G42A 4Y16C 3WQVA 2ZA3A 1U4EA 3ATFA 5DURD 5E9AA 5SWSB 4C6DA 2NRDA 4JQIA 4OI8A 3F05A 3TMLA 3WEXA 4NX0A 1XUZA 3LDVA 3AHXA 1QCWA 4JQ4A 3AGWA 2XY1A 4H88H 1DSFH 1XH3A 3N13A 2PRLA 2JKJA 1ZJBA 3G6JB 3MXWL 4O12A 2PXYD 3TTEA 2PR4L 4KJPD 3ARXA 3HZVA 1OWWA 1FCBA 1YECL 4H0HB 4ABWA 1MRAA 4F2EA 2HJKA 1OINA 1DSWA 5DJZA 4WSHA 2X4TB 4QRQB 2DD8L 3AAMA 4MAYB 1IEAB 3WLHA 4X2PA 5LA1A 1YY8B 3D39E 4A8RA 2FWSA 1OAZL 3MCOA 4JE0A 3FU7B 5EOTB 3HCVA 4QRUB 4P04A 2HV5A 2BY3A 2OMYB 3DHPA 2ODOA 4N2MA 3ZTJG 2KLTA 5G4WA 5C7XH 2XG4A 5HNRA 2RJMA 5A2IH 1GPOH 2FJUB 1L9SA 1BBDH 3O6FC 4LOUD 3B3IA 1S78D 2E5BA 1W9BM 3N1PC 2ZXQA 3MJ8A 1FDZA 4R33A 3LCHA 5CU9A 2R23B 1XJBA 1MFMA 4GQ0A 3FQ1A 4X6DF 4JDEB 2VQ1A 3GRWH 3LXBA 3BPLB 3HPJA 1N3NA 1LP9A 3FN9A 2ZYRA 1NOLA 4MYPA 2R2HA 1TYGA 3AREA 4APQA 3BKMH 4KRMB 4J35A 3HRZB 5JHDA 4FEIA 1P7HL 3R8GA 1PNCA 3ECUA 2K7QA 4NOFA 3N9GL 1XCWA 4NFCA 1PCWA 2OCCB 4G8GE 1V3KA 3LPWA 3TO2A 5AW3B 1PG7W 4NQXB 2QJHA 2A1YA 2X1RA 2O4QA 3UXKA 4JX0A 1I8LA 2E6DA 4YXKH 1C7SA 2GTQA 3D39D 3FFOA 4HV8B 5TD4A 4NILA 3N04A 3IIXA 2J1XA 1D9KA 5JW4N 2XWEA 4IHBA 4Z7OF 2W38A 2WMGA 1D5RA 1LT8A 2Y72A 1UWFA 5DQDH 3KCPB 2E77A 1RJCA 3WF3A 4RJEA 1CICC 5F2MA 2FVKA 4UUJB 4H88L 2VJXA 5I03A 3EGSB 3VXRB 3UAJD 5E4EC 5DK3A 3KJ4B 4JY4A 4ANUA 1CDBA 5TBOA 2GSGA 4PRHB 5E9DB 1WVZA 4FFVC 2CHRA 4G8GD 4PRPE 4AH7A 2H8PB 3DA0A 2YN3A 4I5RA 4G2AA 3S5OA 3IIVA 5JHMA 2XFFA 3QQ4A 5CP7A 5HGGS 1GTFA 1L9TA 2EDEA 3TC9A 3L5HA 3GTNA 2CFFA 4HUVB 4ZQOA 4G43A 1I1RA 2C1PB 5JW4Q 4LCUB 2AK4E 3P2BA 3PM6A 2D0HA 5C7XL 4X2RA 1PCKA 4X6CE 2P88A 1BBDL 1T1XB 1ACCA 2H8XA 1G6CA 3KRUA 1H0IA 3QORD 4MKNA 4XNQB 5J89A 4LVAA 3GRWL 1HE7A 4Q89A 3T0BA 1MNZA 4YN3A 2Q3ZA 2NZ9C 2WXGA 3FCGA 5BRZB 3BKML 2EE3A 1IEQA 4NN6C 4L37A 4NC1E 3O7UA 3CZGA 1FP9A 1Q72H 3THMH 2LTQB 1YIXA 4UBDC 5AFAA 4PRPD 3KS5A 2ZOKA 3OX8B 2GJ6A 4HKPA 3VKKA 3TX9A 3MROA 2ED7A 1G7IB 4PUJA 4YXKL 4ERSL 2EDDA 2E9WA 4JNMA 4LVDA 2GC4C 4XX1E 1PU0A 5DFTA 5L7XH 1A65A 4QSFA 3MLPA 2W60B 3W0WA 1C8VA 2AK4D 4QG6A 3MNMA 3KXFB 1JUEA 4OZIB 2DZSA 4WXYA 3G0XA 4J23A 4FSAA 5DQDL 4EUPH 3IXTB 2CLKA 5B3JF 1KXTB 4UTFA 1OP3K 4JIQA 4U3SB 3IPBA 1WKEA 3B34A 4F8QA 1XKJA 5DO2D 4GH3A 2R0KH 1DIDA 1MQRA 5I9QC 3O8AA 1A80A 1CBJA 4OBRA 4O0QA 2OKOA 4PFEA 1AJ0A 4ZMLA 1VFFA 4NS0A 1GY1A 4Y7EA 3S1WA 1XGRA 2W9EH 3NDYE 1VHCA 3NVDA 3NMEA 3FHQA 4FS9A 4XHJD 1MCNA 4XNZC 2Z64C 3PJWA 1O94A 1KLYA 5J6HB 4Q7IA 3V6BR 5ANHA 1T1ZA 4NIYE 1GW9A 3LRSA 1TYRA 4HETA 4YBLB 4P8XA 1V6TA 3C0LA 1KIQA 3GS0A 3HS0A 3RWHA 4M5SA 5F2FA 3QYCA 1XQKA 1DEEB 5FLVA 2C7FA 1R3QA 4O4VA 1FL3A 2ID5A 1ETJA 4QHNB 4E8DA 4CSPA 1DP0A 2K8MA 2EDQA 4N6FA 3D08A 2ISWA 3NVTA 2VZUA 3IGFA 3BHBB 1TZGH 3O6DA 1ZMYA 1FHLA 1Q72L 5AOZA 3OHXB 3THML 1OJXA 1NF0A 4AX7A 4FNLH 5AVHA 5ETUB 1RZ8A 4EP8C 1GJUA 2RTTA 1PY4A 1T83C 2VZSA 4UQ3A 1AJ7H 4C56A 1ZLUH 5ENWB 1ET7A 4RNFA 3OLEA 1HYSD 3SQBA 4WTQA 3BTNA 4BFJA 3A4JA 5FSDC 4QITA 2CLVB 4J4PA 3LEXA 2HK0A 3H2QA 5HNTA 2JKTM 1UWXH 2IGFH 4UIKH 4XO9A 4UTWC 2QQNH 3NPVA 1AZUA 2P50A 3G5ZA 3OPUA 1L0XA 3T0TA 2YLHA 3MBEB 3WHXA 4PWHA 4GPNA 1B0RB 5I74B 4IQHA 2BVQB 2Q86B 2QV5A 3QQ0A 2R0KL 4WTZA 2ICCA 3NQ8A 1NCGA 4K71C 3C2SA 2WJ7A 4LF2A 4S3FA 2JNZA 4LU0A 5F1KC 2V3DA 5IROA 4KRNA 2DDQL 4Z1DA 1K72A 1TOXA 1Z42A 3QCUH 3QZWG 5K9DA 2W9EL 4Y4KD 2F7QA 1L4IA 1CTNA 4AHQA 2J12B 3BZDA 1BZQK 3QEQE 1F97A 3ARPA 3RU6A 3Q6GH 1QWUA 4JX4A 5IBUG 5HVHC 1KYUA 1C16A 3CC5B 4L8CB 1E56A 4PUMA 1YNPA 3OAWA 4M48H 2D3LA 3FYEB 4DJDC 2L04A 1BLIA 4QYOB 1UH3A 2OGJA 4LBEB 4S1FA 3W6LA 1DWAM 5E09A 3TJXA 4DUOA 4H00A 4ONFH 4R8WH 4DLFA 1TCMA 4RGMC 2GUBA 3WTWA 4X9SA 1R3SA 5AG8A 2Z35A 1BJ1H 4H8QA 4MJIA 3LQMA 3F5JA 2R14A 4GVIA 4G70B 3T0EA 2P76A 2OTUB 2NVDA 1IZCA 2QS8A 1XWVA 1AJ7L 3QEQD 4ETYA 4YSRA 2AV7B 1XLCA 2WTPA 5E24E 1I4NA 4KROD 1NPNA 2Z29A 2G4GA 3L4ZA 1QTYT 2IV8A 1OF2A 4Z1AA 4OCRL 1VF8A 3L5WA 5FAAA 3BGGA 4HKXA 2IGFL 4UIKL 2I5YH 5IMLB 2VOTA 4UTTC 4OVUA 3BEWA 2LU5A 3TLLA 3EYSH 2IH1B 3CQKA 2BCMA 4N2EA 3GSNA 1BXBA 2A3TA 4XWUA 4JY5H 4L3CA 3ZE0B 3PWJB 4XNUH 4PV9A 2GT9A 4RAVA 4YDVA 1Q6EA 3WJXA 3IMWA 2Z7UA 3H7BB 2V6HA 5F7MC 4WX2A 1LQ2A 4A6YB 3CVIH 4W9TA 3POCA 3EOUA 1DBBL 5K9OA 3QCUL 4XC1H 2XXMB 4LIQL 2D3VA 5K59E 4BXVA 1UWUA 3JVFC 3VFVA 3KVQA 3Q6GL 4GMSH 1T8XA 5D71H 3T1GA 3AQYA 3SPHA 1SJAA 3M1ZA 3BD5A 1EA0A 4HWEH 4UB9A 4G82A 3SCMD 2IPUK 1AP2A 4F0RA 4AWJC 1VZIA 1MO0A 2K4AA 3ZE1B 4NRYB 1IM9A 1DOSA 5TK2A 4ONFL 3KZSA 4IMGA 2FBRA 4H9ZA 4ZFMA 4EACA 4IIGA 4JTUA 5D7IE 3MRDA 4N5EC 1EUUA 1DE4A 4JFUA 5DY3A 1G9MH 1Z6KA 2XWDA 2A3EA 1JN6A 2E7HA 3ZW3A 2YLLA 1MFBH 4IFRA 4QDWA 7REQA 3SOBL 1QOXA 4HH9B 2H3DA 4W4NA 3MXVH 1NFDA 3IF1B 4IIZA 3QOKA 2WNQA 4TQTA 4OUUA 1A49A 2YD2A 4XXWA 4KETA 1KCKA 2NCEA 2DSZA 3L95B 1IKNA 4AYFA 4PFHA 2PZNA 3MUHL 3REVB 4PGCB 4JFFA 3ZZLA 4YYCA 1PL3A 1E5CA 3TESA 3SCQA 5HYQA 2IF7A 2GL5A 2XG5A 2A3LA 3GMMA 2I5YL 4Z95L 4L8DA 4PFMA 3GJEA 4RQQA 3IMBA 3V1PA 3TZVD 4FXFA 2F54E 2V9QA 4AQ1A 2UZYA 3GJFH 3SDCC 3EYSL 3EG9A 3WS6A 4I2XA 1YHPA 2XIMA 1XF2B 3T0WA 4JY5L 4ENED 3GKZA 2JQZA 2MANA 4MNHB 1K4DB 2AJYH 1FXQA 2JFEX 3EF4A 3ZTDC 4DPRA 2I57A 3TURA 1O7DE 3SBWA 3CVIL 3MOAH 3WSUA 5AC4A 5D6DA 2AQRA 2D2CC 4XC1L 4PJDA 2XJLA 4Z7NB 5AOIA 5F1VA 2Q7YA 3ULUH 2OZTA 1I8MB 3CPGA 2MFNA 4ADUA 1HESA 3LI1A 5D05A 4A2GA 4GMSL 1QYGH 4HIEA 2E9MA 4N2LA 9XIAA 5T91A 5E0CA 4LCCA 4PJCA 4HZ6A 3QIUA 3DLQR 1B0GA 3QHTC 5EWIH 1RD5A 4PRID 3SYCA 3DBPA 1FSKB 1KV7A 3UTQA 4NLHA 4ZBJA 3GSXB 4R84A 4WKAA 5E23A 2F18A 1UT2A 4DWSA 4JKMA 1ZSDA 3ENLA 3FO2A 3QDME 4PJ6A 4HNOA 3VA8A 1WPCA 3UWQA 2CNZA 1W0WA 5F1UA 4FIQA 1G9ML 3GMLA 3VDHA 4JYFA 4LMQE 4WW2F 1SLXA 3T8XA 4E9LA 4EXPX 1MFBL 4JAMA 3Q3GA 4U1GC 2PWFA 4PJGE 4PG2A 2OTPA 3MXVL 2OR2A 1P0SE 1NGZB 5FK9A 4F9LC 4J39A 4LVBA 2HVKB 5C0IB 3OJDB 3VYPA 3NFSH 1L8NA 3DO3A 4NQTA 4CSZA 3MC5A 2Q20A 1L2QA 1Z0NA 3E5PA 5FJOA 4ZMGA 4OF8A 3UA4A 3C6LC 4BUHA 3WGVB 5KZ6A 5JHLH 1I9JL 3BAXA 3ULAB 2XKNA 3HLKA 1WSST 1RCOB 5JUVA 3DOSB 1PYWB 2E3ZA 4RMWA 2ZE3A 3QQ1A 5G1TA 3E0VA 1S5NA 4Y6GA 2DBJA 1YPZF 1E6PA 3T1WA 3BMVA 4D6HA 3QDMD 2R24A 4QLJA 4OT7A 4LU5H 4F57H 3MC0A 1HUVA 3QJHA 2AJYL 2X9YA 1TMLA 1YPIA 1QWNA 5AYXA 1I75A 2NW0A 4ZUUA 1J0HA 2ADJB 3R0DA 1WA0X 3MOAL 5B4MC 1YJDL 2X1PA 4B5XA 2IQAB 2P45B 1S6NA 2W66A 3EXSA 1W5PA 4ZFFB 2A0LC 3ULUL 4G7RB 3GMRB 4I0PB 3M8OH 3TEZA 4HPXA 4CL7A 3PNWB 3UBXB 3EDDA 1QYGL 2BHFA 3QUYD 4J3OG 1TWSA 4CC0A 3HC0A 5EIIA 4ZS6C 5ID1B 4XCNA 4PH8A 5FA4B 4GQRA 1NFPA 4ZG1A 5B7FA 4P05A 3ELFA 3TEUA 3SQOH 3L13A 5IBXC 2ESVA 3GC2A 1MUCA 3E6HB 5HHNB 4Q8TA 5J1AB 2BIIA 1KKOA 4BFEA 1DQUA 3AY2A 2BSDA 3PQYD 4Z0JA 3NFNA 2D1ZA 4HWZA 4MBOA 3CXHK 2FWLB 4A2SA 1V7YA 3BT0A 1NL0H 1CVSC 2KZBA 2YUWA 4WHDA 5ABTA 2VR5A 4FX5A 2J88A 3EX1A 3CO4A 2P8PA 2NWSA 1ES0B 4GYKA 2VO5A 3I2CH 3SGZA 3V6FB 5EF3A 5JHLL 4F9DA 5F88A 5C2XA 1PUDA 4B50A 3SFWA 5E6IA 3I3DA 5J5DA 4B9GA 3UW6A 4I18C 4XOAA 2HJLA 1BYBA 4QIUA 3W2KA 1XIWB 3MV9D 1AQHA 5DY2A 5FA5A 1TSHA 2FEEI 3IK4A 4NKIH 3SO3B 4LK4A 1CGYA 3WQGA 1VBHA 4WKFA 3RHGA 5KZEA 4WI3A 5GGVH 4LAZA 1QTWA 1SHSA 3CQJA 3S2AA 2H1PH 4NKMA 5AYZA 3KPSB 5CSYA 4LE8A 5C07E 4HNCA 4OJDH 4Y16B 1ICTA 3V8OA 2Y2WA 4W4OA 5E7FA 4U6YA 4L48A 3QI9A 3M8OL 5CZKA 3DFSA 2BSSA 2XA3A 3O1NA 4S1DC 2A1WH 1QSZA 3WDHA 3DVNA 3KPQA 1E55A 2I5GA 1AO7A 3ILQD 2CUAA 4IXXA 2VDPB 2W4XA 1CFVH 4IPLA 5DJDB 2VL4A 5KVFL 1J8VA 3GAYA 1DDHB 2H9GB 4YHNA 2J6EA 3BCFA 5LNEA 4G7YH 2J8TA 1PFCA 5MKGA 5GRJH 4WKXA 2X40A 3C60C 1UZDA 3U79A 1N0LB 2AJXL 5ID0B 1JZEA 4XNMA 3AB0B 3DPBA 2F6UA 4BQCA 2H8ZA 3FO9B 1HQ4B 4DHGA 3KX6A 1ECEA 4JYDA 4UILL 4UC5A 4HJEA 3KXQA 1MIEH 3G5XA 4B5WA 1QLRA 1XL4A 3WIJA 2PCYA 1NL0L 5FOBA 1S9KC 4MA3A 2OSLA 4S10A 3SM0A 1CGTA 3PY2A 3O6FB 1J4EA 5EPMB 4LB3A 3NO1A 3C5JA 5K3VA 2ED9A 2R29A 3N85L 4WIWA 2R0WH 1AKJD 2AQQA 3WNOA 3EDJA 1TV2A 4X6BA 1F61A 2XWBA 3B5HA 3PWNA 4LF3A 1EJ7L 4PMYA 3X1GA 1DUYB 5I23A 2ZNXA 3CT2A 4F1ZA 1IC5H 4NKIL 4DPPA 4MJHA 4RL3A 3G1HA 3P5ZA 2ZOLB 3QDGD 5E8OB 4ZUWB 2AGKA 1Q7MA 3IJ8A 5GGVL 3QIBB 1BLNB 1EZVY 1R85A 1UWQA 2W1NA 1UFGA 3DBXA 2H1PL 4CSTA 2Y7QB 4CEUC 3J8F7 2PZ0A 2C14A 4DEPB 3EOAA 1XGUA 2XN9B 4D0BB 3EZJB 4DUVA 1HJSA 1VB9A 4EZLA 1QP1A 2NV2A 1LO3H 1F73A 2FZ3B 1DTNA 3VKCA 1YJDC 2BPBA 3U5UA 2P8MA 1RIHH 3IU3B 4MTVA 3PBGA 3QWOB 2D22A 2A1WL 2PDUA 4XPTH 5U7SA 3CYVA 5SX5K 2YHGA 4Y4HB 1CFVL 4ZSOE 2COQA 1ZAJA 3G9VA 3IJQA 5E4EB 4LAQL 1KA9F 4K3JH 5F7KC 3D25B 3WV0A 1CD1B 2ZRYA 4G7YL 5JUEH 1L6WA 2ZKXA 3NCYS 3UDWC 1DQQB 2A99A 1DBMH 4LSRH 1D7BA 3SCUA 2BIHA 1JMZA 4ZFOA 1LE9B 1X6NA 1HXYA 2WQXA 3DTXB 3PVFA 2GFBA 3MZGB 4R4ND 2POTA 1HH6B 2UUDK 1JGDB 4AM0B 4HF5H 3GFYA 1RJLA 1B4LA 3IWUA 1BEYL 2DRUA 4RFNC 2OYPA 3MJMA 3U57A 3BXWA 4OQTA 1I3VA 4UFKA 1IHIA 1ALDA 3W87A 1KLZA 5FDYA 2YGPA 4IRSD 1XB6A 3OKMB 5LAXB 5CEYB 3WUZA 3HG1E 4DF1A 2AI0L 4S3CA 4AVOA 4X83A 1KRMA 1A02N 1CGSL 3BFQG 4PMXA 4NN6B 3GC3A 5E99H 2EDLA 3OVPA 1RJPA 1XH2A 3O06A 3PWUA 4HJGB 1A66A 4KVPA 1TX2A 3NBNA 1ACXA 3L3DA 4X4XA 5B39B 1QPPA 3B06A 4IFOA 4L18A 4QHMA 1W1YA 3WFDH 4N8CH 2UWFA 4NAFA 1T5XA 1IBBA 1OCOB 4URKA 1XIMA 4D6IA 4F37K 3ILPB 3O3EB 1SHXA 4ETQA 1TPXC 4HLEA 3GF8A 3D3VB 3GWJA 3UYPB 1H3UA 3BWAA 4HNNA 1XYAA 3FUEA 1HJCA 1N59A 1VKFA 1AGFA 3VXNB 1LO3L 5EO9A 2Q3RA 2VLJA 1EJFA 3HC4H 2FMNA 1RIHL 2QCDA 2CALA 5EBLA 5AL8A 3IGXA 1CE6A 4XPTL 2FB3A 3IEBA 3QO1A 3W24A 3KD4A 3F85A 4EXAA 1REIA 2BK8A 4ELME 3FT4B 2PTTB 4M3PA 5I9QB 3DN5A 4MCZA 1XGZA 4Y19A 2OOFA 1DXFA 1GOOA 1FX6A 3QZBA 3TCXA 5JUEL 1F02I 3DXAE 3VNKA 4NHUB 5H35B 3QHFH 4A39A 4LSRL 4HS8H 4HCRH 2E67A 1N8ZB 1EP3A 3MV7B 4AE1A 2W67A 3EOTH 3L9EA 1S9YB 1UM4H 1I6NA 2EYTB 2F58H 3U1PA 4XNZB 3W39B 3VFOB 4ZFGH 2ZAHA 3KL5A 4TPRH 3BLFA 1WX0A 5E2UL 4IK7A 5KJRH 2R51A 4ZX5A 4GXUN 3WIHL 4OV5A 1OZMA 3RY5A 5CD5D 1O4UA 4CCDA 3S48A 2XGIA 4S3BA 5I3HA 1F3TA 3RRAA 5IVXE 3QFEA 4IOIB 5I15L 1EMTH 1I8KB 2CIPA 1W3NA 4Z7WE 2A9CA 1KGJA 5J0BA 3PE9A 2E28A 3K8LA 2FSDA 5E99L 3G0UA 3FFSA 4NPJA 4EWJA 4FP1A 3MOQA 5DI8A 3BSZA 4JZOB 3LGEA 4YWIA 3MUGB 3UCDA 4FMKA 3B37A 3U6RB 3GSMA 4BFAA 1F3DH 4N8CL 1G0CA 1XCTA 3AS0A 1DJIA 3LY0A 3NA4A 3HVNA 5GIRB 1M1BA 1XR9A 3KBNA 4ZXLA 4OZIF 1MCOH 3RAOA 4FMVA 4JFYA 4NJGA 3PPEA 1FL5B 3OKNA 4ODXA 1QO3B 3VGHA 3W7LA 4A38A 4ZB5A 3HC4L 3S2MA 1CS6A 2EXTA 3EWXA 5EZLB 4FB7A 1O9ZA 2NTFB 3UG8A 4HUUB 4FQLH 1VP5A 1TTCA 1ET8A 4KGJA 4KJYA 4X4YA 2J4WL 2O4MA 2ISDA 1PD6A 3RF9A 2VGFA 3FUKA 3LKPA 1FLTX 3OZPA 5IW1B 3GUTA 1EAPA 2ETWA 3ARGA 2V7NA 5M1TA 3QHFL 4Y1AE 3LG3A 4HS8L 3PZVA 4HCRL 1ISZA 3WK0A 2DBLH 5M5DA 1HHIB 2F58L 5DSCA 2G4FA 2DYSB 3B9KA 3U9IA 2YPVA 3EDKA 3U7VA 1H5BA 1IUZA 4ZFGL 3CDYA 4F9PC 5HVHB 4PS4H 1TTRA 4FQCL 4PY7A 1G5GA 5KS9F 1O6SB 2EDHA 5KJRL 2V8ZA 4JGJA 3HMCA 3IRDA 3QUZA 2YJLA 1S5MA 2GOUA 4UUIA 4NC2B 4AUJA 4K3EH 1FWRA 2OFJA 3WSQH 2C26A 2OO0A 4OW6A 4WUUD 1ZLDA 5KITA 4D2NA 1EMTL 2C1HA 1W31A 3QWRD 4BI7A 4FG6D 1L0QA 4Z7UA 1YO4A 1OP3H 1HVXA 5C9JB 1NZRA 5DRCA 1RUMH 3UFYA 4RGMB 4XXCC 3G04B 1UD6A 1J1OH 4R9XA 4ZL1A 3O16A 3APNA 4NNYB 1QR1A 4A7UA 4PBWD 4UFHA 3LHPH 2DUXA 4IKLA 3QYMA 1U8CA 5IIEA 1P2CA 3W11D 3V35A 3T40A 4HIIA 4L9XA 3UR7A 2CM5A 1MI5A 5TDOB 4NQDA 1ITCA 5C09B 1MCOL 1A53A 3FTYA 1XIBA 1P5UC 5IBLC 1EL3A 1QSFE 3X1FA 4MWFB 5DT1H 3NH7L 1A5NC 1FO0A 2Z93A 4IOFD 4K5NA 1EK3A 1POJA 4YHYC 1R2RA 3LXUX 4J28A 1CDUA 4KCTA 3LNDA 2XQBH 5AYUH 4Z77B 2E4FA 3D85D 2F84A 4Q9CA 4U1NB 3UPCA 3NIFF 2ZQKA 4H9MA 2MNJB 4ZUVA 5F21B 2GHZA 1IRAY 5LNRA 1WHPA 2CCWA 1G0XA 2ADAA 4CVUA 1MEWA 4GINA 5HTSA 1RPUA 1R3HA 2QPEB 3C5ZD 3QEHA 1EPXA 1V05A 4BJHA 2HT4C 1ZE3C 1HKMA 1Y18A 4XSLA 3NL2A 3LH8A 4YPGA 2DBLL 2IIJA 3ARDC 1YEEH 4YFLI 6PAZA 4YE4H 2EPNA 5T1LD 3TV8A 3QR0A 2I9EA 1C29A 4TXVB 1A9BA 2G5BA 2R59A 1HL4A 3VE0B 3LOTA 2DUAA 4E0RA 4PS4L 4WWNA 2V2CA 4JHVA 4L1SA 4L1GA 3NTCH 4ROPA 3FPYA 3MBFA 3UBXI 3LCXA 4GSXA 4QG8A 1NC2A 4QKXB 3UJ2A 2VIRB 3TDFA 3BAEH 3OBKA 5IT2H 3Q5TA 1RUPH 3CVCA 3WFAA 4K3EL 4AGPA 3WSQL 4HT1H 2QGBA 3L48A 5EU7E 3T3PE 1EJWC 3HZYB 4OZHB 3T65A 2VXQH 5F4SA 4IG2B 1KIPB 4U6VH 3Q44A 5CJOH 4RH4A 4C83B 4DNHA 1DVSA 1A0QH 4X0KA 1MI3A 1NGQH 4Q2ZA 4FQJL 1AXSB 2EDYA 3VUAA 3DFOA 3I02A 4PR5B 3OB0K 2P24B 4KK6D 2IG2H 1V4YA 4UNVA 5AN7A 3RKDC 2BVWA 4WEBH 1VCBC 2ZE0A 4P5KB 2MHAB 2K3TA 4NYUA 1FH5H 4MD5B 2E9BA 4XMTA 5C5YA 1TWDA 4L7ZA 5DT1L 1LE5B 4X6EA 1R24B 4F7CB 4GYPC 2HS6A 4E9YA 4UTKA 3UJIL 4MS8C 1G4TA 1ZHKB 5AYUL 2VSDA 2V5YA 1HQRB 3NRQA 3FCSA 2VERN 3D30A 4AUYA 3QNXA 4LLQB 3WEMA 5ESQA 5HY9B 1AIFA 3DROA 2EIMB 5GJTL 1TVHB 5AAWA 4UTHA 2NNCA 4C6PA 4WTZG 1YA5A 1P1ZA 3MRKB 4N2YA 3DDGA 1SQ7A 4GW5B 2WWNA 3B8VA 1E4NA 3HF3A 5B1JC 4HK6A 3CN4A 2A74B 1UTDA 2X05A 2YPLD 4N2KA 4P46C 1YEEL 4NUMA 1TF4A 1IE7C 3GHSA 2WZ6A 1ZAHA 1Q6CA 3VPLA 3WL9A 2IANE 3M1OA 5KZDA 1NBYB 3SQLA 1JPFA 3NTCL 3P9WB 2GSIA 1UZGA 2AL2A 2VC2H 2MQGA 3UR2A 2Z3FA 3BAEL 1P6CA 2PWUA 3M5XA 5IT2L 3TR9A 1RUPL 1O7DC 1RBLA 4HBKA 1NCWL 1HDMA 1NUNB 2YIHA 1BYAA 3T3ME 1XF3B 2PR4H 3TIEB 2ZZ1A 4MAVA 3UGXA 3WIAA 4X7TB 4AC4A 3BURA 4S23A 1UH2A 2VXQL 5CJOL 5CBAB 4XUGA 1I3UA 4MJ6B 1A0QL 4RFEB 2DD8H 5AW6B 1K9TA 5LGYA 2HFEB 4UFMA 4GKLA 2JIXB 5DK0B 1NWOA 1RXLA 3FSUA 3CSYB 1BSLA 4JFHD 4K37A 1XEDA 2DU2A 3MMUA 4WEBL 5KJ4A 1XWYA 2J21A 1ZLVK 3BDBA 3ARWA 2C4FU 5DMGC 1QNPA 1FH5L 3PL6D 2IAND 1OM3L 2NYZA 2FGLA 3AY4C 3EO1A 4G1MA 1JGLL 4UR7A 3G24A 3BWWA 4JZJA 4JO3H 2EVFA 5DJ2B 5H4YA 3FSAA 4CVXA 5KYWB 3RJXA 1OF8A 1IEBB 1U91B 3AMKA 4PGZA 3O4OC 1KEMH 1OF6A 4ZZKA 3OMNB 1SEBB 2NX5B 5H6HA 4GJJA 4JFOB 2F53A 3GXFA 4KY1H 4LOVA 3ITOA 3N9GH 4KQNA 4F5CA 5IB3B 4HA3A 2ZXAA 4K23H 3KYNA 3OKKB 1JUFA 3SKUD 3MSPA 3KTCA 2JIWA 4PJXB 4OZFH 1UH4A 5IB4A 1A4JB 1ZKAA 3NDZA 5D7LE 3RPIB 1XIEA 5KSVB 1DJWA 3BISA 4P8VA 3RNQB 1UFUA 5K33A 3VWKD 4AMWA 3GDBA 4IBLT 4FLHA 4YWGH 1U2HA 1UA3A 3P4MA 3TC3A 2VC2L 1G9EA 5DZOA 3GO1H 3GDLA 5I02A 5K7JA 1XGQA 4HD9A 3T2LA 3U7AA 4XD5A 4GD0A 1A5FH 2BHZA 1BCIA 1V5XA 3WK3A 3LN9A 4FYTA 4WWKC 1D5BB 4ZJ9A 1P7QD 1TE6A 4PJAE 2VQ4A 2WCGA 3A3WA 3GSUB 3MRIA 3UG3A 5CMAB 3RNDA 4XNBA 4GEJA 2DN7A 4GP8B 5EU5A 4XZHA 3CVDA 3LCWA 4GRLD 4UWMA 5D7LD 3ZM8A 1Z5LA 1LWRA 5CM1A 3QB7C 3R06B 1JCLA 1OM9A 2Q2LA 2Y7NA 4UM9A 2WTRA 1U8OB 5HGHA 1OQOA 2QF8A 2VLKA 4M7LT 3DUSB 4LCWB 3FF7A 3GZAA 1EEUA 1PNDA 4DQWA 1WV7T 1FFTB 4JO3L 3IWVA 2JELH 1F86A 2DW7A 4TOQA 4I18B 2WMFA 5I24A 1KEML 2GJPA 4KY1L 3KLDA 3JV6A 3E74A 1GOHA 4K23L 1N5AB 4C6FA 4XBEH 3WQWA 1HXJA 3DFYA 3NEXA 4L4VE 2G95A 2QKIC 3O9NA 4R6UA 4ERSH 1GPFA 3D4YA 1DQXA 1FG2B 1THFD 1OSZB 1YRKA 1K9EA 2Z31D 5DJAB 2PP1A 2ITCA 1GGTA 4PJ7E 3BQ6A 1EBGA 4FFWD 2DLTA 1VRXA 4LVOC 3RVXC 4BGLA 4B4FA 1A1OB 3F4VA 1L9PA 3EUDA 1RQHA 4YWGL 1U8NA 5AZ1A 1RY7B 4KO6A 1UZ8B 3GPSA 3UZVB 1PZUB 4Q4IA 2J47A 3CFQA 4ZAKC 3GO1L 4AZHA 4I7VA 3V36A 1A5FL 5SWZB 3BZFA 3V18A 3CAWA 1B3YA 4X5WA 2QADC 1TFVA 3LIZL 4ZUTA 3TC7A 3ARYA 3F6IA 2BS8A 1BF6A 4NO2B 2DTMH 3P74A 4NM8L 2F8VA 5EO0B 2K9FB 3GSWA 4PJFE 5INDB 4JW3A 1QX1A 4L4VD 2EXYD 4XI5D 3KLAA 3QC3A 1BIIA 1A5SA 2WQDA 3L7RA 4GQGA 2VDKH 3LENA 4X9GA 1QBAA 3C08H 1FVPA 5J13C 1XSIA 4UZGA 3KBEA 3OZMA 3UMNA 2FVLA 5D1QC 1OW0A 3RIFK 4ECNA 3DOIA 3PHQB 3CHPA 5GJSH 3NPSC 1F45A 3RNKB 3LGGA 3KNBB 5FYJL 4DO7A 1HZYA 1MRCH 2QSQA 2R1YB 2X6VA 5LGZA 4YMPA 3LERA 1E0OB 4FXGC 3HNTL 4F9JA 2JELL 5LA0A 4QRSB 2G3XA 3CLMA 4K7PY 1X9QA 4FMFA 2OP4H 2DEWX 3ARFA 1GTEA 3FVMA 1MG3C 4HKJB 4YHIA 5CPMA 4YXLL 3RWJA 2R2EA 2PN5A 2NMSA 1ZGLP 3RGVC 3CDCA 4FTVD 1ONEA 3KVPA 4XBEL 4LRTA 2DZEA 3GJFB 3STPA 5J6SA 3T9WA 1U95A 1LL1A 2WSPA 4LW7A 5D1ZD 2Y4SA 4JO2H 5DS8A 1L0PA 4LPWA 1XEUA 3BVDB 2H9AA 2O6PA 3PDGA 3HGOA 2WQVA 1NDYA 2WMJA 4JFEE 5CUSH 5ACZA 2X28A 3L9BA 4JN6A 2HTLC 5FOJA 3M64A 3JWNC 3TT1H 5BOZG 4XMZA 2VDQH 3NQFA 3TH3T 5GGRB 2DEYX 2NQJA 2ZWLT 2E6FA 4O02A 3N9KA 3EAKA 3SSJA 5EIIG 2KZKA 3K5RA 1HSBA 2YRBA 4NQEA 5DVMA 1UASA 4AC1X 3BIBX 4AIUA 3N6JA 1BEUA 5JMOC 5BPPA 2DDQH 1H7XA 5DEZA 2DTML 1QA9A 1IT7A 4O51B 1QK2A 1PD1A 4R90H 2HX7A 1B30A 2RKXA 4KNUA 2B0MA 2RFXA 2VDKL 2JB6A 4RDWA 3C08L 2WNKA 1BZ9A 3GTFA 4FEZA 3FQ2A 4JFVA 3OJVC 1US0A 3W2UA 1ZTMA 4JFED 1TNNA 2CHXA 4KWUA 5GJSL 2X88A 4ACPA 2NSOA 2LV4A 1QBLL 5HR7A 3O6AA 3MNVA 1LJYA 3WJMB 1MRCL 4G5AA 4ZOBA 3EYOB 5IMMB 4U4BA 4K8HA 2YX0A 1XRSA 1GZGA 2WXJA 3S3CB 5DT5A 3IKCB 4KY2A 2OP4L 3BZ5A 4KQ0A 5BROA 3GNDA 4HCLA 4GYFA 3QUKB 5BW7C 4YC2C 1UKQA 4BF9A 4XXDA 5ALCL 3OXRB 4GSQA 4Y5YC 4BINA 5FHBH 3N19B 3BGAA 2B7PA 2YPKB 4CNIA 3A9IA 4UTBA 2J1WA 3L17A 4FI8A 2X7WA 1WDSA 3RFZA 2QHLA 4FQXC 5IKCA 1EGVA 5CKGA 3SCPA 5DU7A 4JO2L 2IV9A 5IRPA 2UYLB 2CETA 1LD9B 3CN1A 3CFBB 5HYSB 5F7HA 5EZPA 3ETSA 4LRIA 2VRKA 2X70A 5CUSL 3BPWA 4S3AA 4HIJA 4OCRH 1MCHA 2FT7A 5EL1A 7CGTA 5EB9A 5DD1H 5C92A 3TT1L 6A3HA 4JQ3A 2VDQL 5HHOA 3ZBMA 3VE7A 2ZXDA 4JUTA 3FTSA 5JO5A 3UWUA 2K7PA 2J55A 4GGHA 3P3BA 5ABGA 3WUGA 2JKSA 1Y0EA 3OXSB 5CGYD 1NWPA 2IFGA 4WEUD 2WC4A 2CIIA 3F8UB 5JA9A 3FW6A 1LNUA 3EWBX 2Y7EA 3ISIX 1FZJB 2N3JA 3HHSA 1DBBH 1SJEA 3SN1A 2APVA 3FH7A 3X1NA 32C2B 4LIQH 3S3JA 2NUPB 4R90L 3EX4A 1OFRA 2BIOA 3AC0A 1RUQL 4EKXA 2EJAA 3W86A 1ORQB 5F7DA 1TPUA 1XRTA 5DHEA 4AGMA 2X7LA 2WHKA 1EFXA 2P5EA 1Y7VA 3ONBA 1PPIA 5FW7A 3NAVA 2VCAA 4M7TA 4I3RL 5I75C 3TO4D 4Q97A 1TR1A 3VI3B 4EQ2A 3BPCA 1OQFA 1YMMA 3GAKA 5KZMA 2I60H 4Y2OA 1LWJA 1UYWH 4J3VA 1VBGA 4DPBX 4AQ8C 3CVHH 2ATPA 4LB4A 5HYJB 3LN5A 5JBFA 2VUNA 4IU2B 3MCKA 2VDLH 5DYOB 3JTBA 4KXDA 1ADDA 3W7GA 5HMEA 1WAWA 3F65A 5FHBL 1TIMA 3SOBH 3VWJD 5CPTA 5PCYA 1GCFA 4YR6A 4WSJA 1WDRA 2FFCA 3UJEA 1K70A 3K6SA 1LQBC 3J2PA 4NZ3A 1EXBA 1FYTE 4IGNA 3ZKND 2A3BA 1LILA 1DVYA 4Q56A 4TV3A 1EVUA 4G72B 1K8DA 3NZ8A 2FAUA 5HI5C 1CNVA 5DD1L 1JGIA 2YAFA 4Z95H 3NCYP 4XSMA 2NOYA 4K7YA 2Y1VA 2NQHA 4ATDA 3ZGIA 5IUCA 2NLIA 4HWBA 4YHMH 1XIHA 4UFIA 2BX7A 3QO0A 3MA8A 5B21A 2B7QA 3OO2A 1ETB1 3VFRB 4Z1YA 3G6MA 1UB3A 5L8JB 2NNAA 2AQSA 1RLDA 2QGHA 2AABH 4QTIH 4E9QA 3E2VA 4FKEA 1OGPA 5CEXB 1FYTD 1S7XA 3MR9A 2OZ4H 5DVKA 4C4KT 4PJIA 2BP1A 5A8QA 4X8CA 4X42A 3LHVA 3SY6A 1A3RH 5MENA 2Z91B 1QFEA 1OGBA 2D7QA 2OEMA 2J73A 3VCNA 3W7OA 3GLEA 1R5WB 3HPFA 1QFOA 2IPKA 4GAYA 3CUPB 4QXTA 3SCWA 3MVIA 2I60L 1INEL 1UYWL 4WK0B 3Q45A 4NZDA 2OXHA 3SW6A 1TJMA 3M7OA 3CVHL 3LZLA 4OGAD 3QXWA 5I77A 5AECA 3WL1A 2Y7DA 3IDJA 1R46A 4BI5A 4XAGA 2VDLL 1AHMA 3MYJA 1CYXA 3G5YA 3I50H 3N18A 1V03A 3CV5A 1I9EA 1AYOA 4PJEF 2L8AA 1H3WM 2ZX9A 2HKHL 3EJYC 4MD0A 4QHRA 4MJZA 1IZKA 1WISA 3HLAB 1QHPA 1JOIA 4BFIB 1JZ8A 3ISWA 3KPPB 1UKOA 9PCYA 4UTJA 4I9WD 1I9JH 1XR8A 1UB5A 4PRIE 2GGEA 4O1CA 4ZCWA 2C9RA 1TYJA 1SLUA 2WOYA 2UY7A 1YNTA 1JTOA 3UPAA 1UACL 3W7MA 1BFTA 2VZTA 2QAPA 1JYXA 3DCPA 1NSNH 2ZCGA 5I5JA 3US0A 1VEOA 2E5CA 3QRHA 4YHML 2QULA 3H2MA 3OA3A 2GQAA 1DJGA 5CF3A 1G7LA 3VIHA 5HMDA 1YJDH 4TUFA 3NCFB 4H4IA 1QOPA 2O92A 4C1KA 5DZNA 1GK8A 3ARDB 2C3WA 2AABL 3FUFA 1V79A 4QTIL 1VH7A 1RZ7H 4WQ6A 1LEGB 2OZ4L 5U4NA 2G3IA 3E3QE 3NDOA 1AZ2A 2OJZH 4AF0A 4TSBH 1A3RL 3O81A 3RX2A 2VM9A 3B4NA 1SXCA 2X09A 1ZWIA 2Y5TB 1BXCA 2ZG3A 3CDGB 1XM3A 4XWGL 3JU2A 5IEHB 2NY2B 3A67H 3CFJB 3TPUA 1LRQA 2RR3A 3CV7A 1HK6A 5DRZA 4KOBA 4JN8A 5D2XA 3NT0A 2AC0A 3WD1A 1OG6A 4PMJA 1GYAA 4R2GC 3TSBA 2DQMA 3CNYA 3GX9A 1WQVT 3I6LD 3I50L 3P2VA 4V1DB 1YNYA 3W1TA 3NGJA 4P2OA 3LZ5A 2DI8A 1P1VA 2P7TA 2QFPA 2X4PA 4KXAA 4PCTA 4P2VA 5EU7C 1S9XB 1SXZA 1AACA 5KVDE 5DTFB 1UP2A 4BEIA 2FJGA 2QEZA 3L4VA 5GGSB 1S1RA 2V5DA 1TQXA 3HRPA 5T1JA 3SQSA 4CC4C 1T66D 4NP9A 1ZS8B 3AXLA 5HUPA 1F1AA 1DLFL 1J0YA 1D3HA 1T2QH 2GIYA 4JRXA 3AROA 4PRRA 1N55A 4OUEA 1U8MB 2X7VA 1NSNL 3T0AA 3AT9A 3WDPP 3TFKC 4ICWA 3F1QA 4A29A 3UTTA 4Z0XA 3PWPB 3PQYE 2BGSA 3EHBB 4PJBF 1YQVH 1RHCA 2Y70A 5BXSA 3A22A 3GLDA 3D0VB 4HG4K 2R91A 2BGQA 4QRPB 2NY4D 3MNWB 2OMUA 4JANA 4W6YB 5CD3A 2AKMA 1EO5A 4P46B 2VERA 4HCFA 3SGJC 3ABXA 2VEKA 3MODH 1RZ7L 3BSGA 5ACMA 1OD9A 1E0VA 4QAMB 1JZHA 2V3FA 2XKSA 4M6NH 4QRRD 1NFBA 1CX9A 1BOGA 4DIXA 1YMHA 5F7LB 4C7FA 4IPPA 3WQ6A 2OJZL 1LWIA 3AM8A 2R1PA 4TSBL 1GQIA 5DRXA 5DRNA 2KBGA 2XXCB 2WIIA 3IIPA 1AZZC 3B7YA 1RVGA 2MMXA 5KVFH 4BFOA 1V3LA 5AALA 3A67L 4EO5A 2NZLA 3MV9E 4C6NA 4PV1C 2LU4A 2AJXH 2C7UA 5BVJA 1OVDA 2D2OA 1P4CA 3ENEA 2KS0A 4HCDA 3ZHNA 2OW7A 2AXHA 3GGWB 4FZ8H 4AK1A 3QBUA 4UILH 1M6JA 4PB5A 5F1NB 2YB1A 1VRDA 4F33B 2IAMC 4EI5D 3LIUA 1T1WB 4BQ4A 3IETA 1ZVHA 4LHUD 5DZVA 5EEZA 3EA3A 2V8MA 4LARH 5CGMA 2YJQA 2I07B 1DFXA 1GOGA 2X4OA 3MI6A 3PCYA 5FO8B 4P9MH 1M65A 2WBXA 4MXQD 4JM2B 3KYMB 2BVPB 4GKSB 1AGEB 2YBVA 3N85H 4G9FD 1ZBWA 1YQ2A 2V30A 5CHNA 1HI6A 2A77H 4HHAB 4RW5A 3FFDB 2IDFA 1T2QL 3HPAA 3CN3A 4LYRA 4MZ2A 3S2JA 4N9BA 2RQ8A 2VJ0A 3VGDA 4FQPA 4RZ6A 1IX2A 3LPPA 4UNIA 1CBGA 5SV3A 3F83A 5IJVA 3MA9H 5CBEB 3F7LA 2CJ3A 4ADIA 4K7FB 5C0AB 4HNVA 1YQVL 3QIWD 4EI6A 1YDPA 3VFWA 4X4ME 2BY1A 3TCSA 1PDKA 4HEPA 4MZ3A 1TFPA 3BAIA 4OFYD 4WR3A 2CWXA 4AD3A 3OB0H 2XN1A 4JFSA 1MPAH 2PXYC 2MTAA 3MODL 2NW2B 2IXQA 4HPYH 3UTOA 4OI9A 3P0YH 3W3BA 4M6NL 5D2LA 1T2XA 3K4WA 1HQTA 3TOYA 2JF6A 5C0JA 1UGNA 2NX3A 1I1YB 3PHOB 1WB0A 4PCPA 3NWRA 1NBCA 2C3ZA 2XOTA 3FOLB 5I6KA 4IBWA 1TTQA 2XFXB 4RLIA 3UGUA 3KYAA 3V4LA 3AIUA 4FXKA 1BBJB 2OZNA 4WWKB 2W79A 4GGBA 4LAQH 4LPXA 2PU1A 3NSYA 2BZ7A 3OR6B 4PBDA 1XFCA 4PW9A 2D7PA 4KIEA 1A4AA 4PJ8D 5HI4D 3GDKA 2BRRH 2MNUA 2AF2A 3QDGE 2E7BA 4LOUC 5D7SH 2YL8A 1ZENA 1S78C 4FZ8L 3N43B 1XHHA 4S3EA 3WQOA 3GXDA 4UANA 4RCAA 3X14B 3B1TA 4TU1A 4XZ9A 3CFUA 2VELA 3WBYA 1CI3M 1A9EB 1KGWA 1SEQH 4LARL 4M29A 4ZXOA 1E5JA 1BEYH 3ERPA 4H1ZA 4P9ML 5LN8A 2CDGB 2DORA 3P80A 3MUJA 4KTEH 4J3BA 2AVFA 4GJ1A 5DUMH 5D6CA 4YCOA 1TZHB 1L3WA 3TSDA 3DI0A 5D7HA 3WF1A 2WXLA 3KRZA 1O1HA 2A77L 5FF3A 2AI0H 4Y5XA 2XN2A 1MQQA 2DT1A 1CGSH 4N9GA 4KXZH 2G4EA 3KGSA 3LLXA 2HTKC 1H60A 4DGIH 3T7VA 4FF5A 5CJXA 5JOFA 4RV3A 1GZJA 3PTKA 3MA9L 4D9LL 1E9OB 5F7WC 5D4HA 1M7UA 3HFYA 3WJJC 3BQUD 4OGYH 2XFYA 3LX9A 2FNBA 1F00I 1S7TB 4LVOB 1U8HB 1MPAL 3UAJC 5J6GB 3ATBA 4HPYL 3AO0A 1WBJA 3RGHA 3P0YL 5CZVH 1C8XA 5DXYA 3QY7A 5I00A 1ZLVH 1A4MA 3NL5A 1LOSA 3G6JF 2CBUA 3GXMA 2YD6A 4H26A 4TUOB 1CICB 1YY9D 4QG9A 4AXKA 4ZAKB 5L2KE 3B83A 4U7SA 1OAYL 2D7NA 1ZE3H 5FF0A 4JFDB 4OCYL 3VI4A 4TULH 1OIMA 3MB9A 4N6RB 4ERIA 2QADB 1SU5A 1W8SA 1U33A 2BRRL 2AAAA 1NUFA 3B5GA 2DZAA 4P57B 3HMXA 1WFJA 5D33A 1F11A 5D7SL 5FYKU 3JUZA 2VDRH 1XLIA 3QORC 1IR2A 1CWYA 4OJYA 4NJIA 3VXQA 3XISA 1VYRA 2WP3T 2J8UA 3VM5A 5JYLA 4E9VA 1SDDA 5J13B 5E94B 1XL9A 2EABA 1VESA 1KLFA 1SEQL 5D1QB 5E2UH 4G6AD 4AMXA 2VNCA 5CJMA 1NJ9B 1BHGA 3VD0A 4PMRA 4Y7OC 1P0NA 5FA3B 4Y2WA 3WIHH 3G1DA 3K8KA 4KTEL 4ILSA 5DUML 5AVUB 4ZSTA 3EYFA 1BX2A 4KC3B 2WMPA 1FVCB 2RACA 4FXGB 3SGEH 5I15H 4FQ1H 1JDCA 3EKZA 5E8PB 3NIYA 4YNGA 1N10A 3LBOA 5L2KD 3FEMA 3ZDZE 4KRPD 2DLGA 1JVLA 4X7SH 2W91A 2XVPA 4DGIL 3EYQD 2ZCKL 4HAKA 4F7PB 3L4UA 4ZUSA 2KPWA 3OL2A 3LQAL 1S7UA 5AYYA 1BIHA 3C2EA 1OK4A 2VX6A 1NCOA 4RIRA 5L8KB 2KZWA 3SJVA 4OGYL 2E8ZA 3D34A 1TR9A 2FIKA 5DO2C 1OGAD 2YUXA 1TRDA 4HU8A 4UF7C 4NC1C 5CZVL 1EIXA 1HHJA 4EI0A 3G1VA 1ECYA 1XDTT 2WWCA 1T03H 1XBRA 4PTNA 3HQ1A 1XXFC 4QX4A 3TNNA 2FRGP 4E9RA 2J4WH 1U8IB 3GMOB 4JFPB 4KDTC 1ONQA 1P1XA 4XHJC 2VC2B 4KU1A 4AXWB 4KPHH 4LFHD 4TULL 3S2NA 2VWSA 4YK4C 2VABB 4LAUA 1IU1A 4FALA 4I9XA 1T22B 1CB4A 4KO5A 1ILUA 3BZ4B 2VDRL 3WAJA 3C5XA 2HG5A 1MFVA 3FB7A 4FLQA 4PP2A 5EH1A 1JP5A 2ACQA 2I5QA 1LOLA 1EXUB 2GJZA 1KTDA 1AFVH 2HS8A 4FQCH 4DVBA 1LL6A 2SEBA 4KNSA 4XZIA 5I76B 1I1XA 1TVLA 4PVLA 4FHBD 1QK0A 3T8MA 2PCFB 1JEZA 1MCBA 2H47C 1WWCA 3WQ4A 4YNYA 3RWCB 2PYEB 1FCQA 4BCXA 1JI1A 2GBVA 2CNCA 1P6BA 2N56A 2FYYB 2CW6A 3OAUH 1QVOA 4FQ1L 3N2OA 2F7PA 1BRLA 3G8RA 2VQTA 1R3LA 2G2RB 1E6XM 1F6YA 4TN9A 1HYSC 4X7SL 1Q9OB 3NSCA 4YC2B 6ENLA 2XC8A 1KTKE 1FF5A 3PUUA 1AC6A 3SGUA 4NY2A 2YDRA 4MNGB 1FGVL 1J5SA 1NBVH 1QI5A 1MDAA 4P5MB 1JJUA 3ONCA 1QSEB 4FQXB 4UR8A 3ALFA 3G5EA 1T20A 3GLZA 1TVBB 1V7MH 4EPEC 4NZCA 1UEYA 1RK0B 3T2NL 3RBSA 1D2PA 3ULUF 3B0VC 3NH7H 3N42B 4OZFB 3IDIB 5G2WA 2ZD0A 3FCBA 3THAA 1DKWA 1AQMA 1IL1B 1P5VB 4A04A 3FKRA 3MVTA 5DFAA 3QY6A 3QUXA 3O3DA 2VN4A 1T03L 1TRIA 2PDGA 4ZXBD 3TBSB 3HUJA 4WUUE 1NAL1 3VZZA 3H55A 4Y4KC 4ZTEA 4KHXH 4NAJA 4BHUI 4O00A 2XU9A 1VPQA 3FA5A 2WPGA 3P02A 1QHZA 4K71B 3BIKB 1JVNA 3IMRA 1YEKL 2DEXX 4KPHL 3QDJB 1CD9B 1BKHA 2BOGX 4DZIA 4HIHB 2QPSA 1O5DT 1ISYA 4ZTXA 3VDBA 3WF0A 1KBVA 2DPKA 1QHOA 4M24A 4UOZA 3US1A 2EIJB 1ZT1A 3Q7JA 1PCXA 5AYBA 1HKLH 2MUCA 2WOBA 4YAQA 4FHKA 4EPDC 1YNQA 1L6YA 3P82A 4XCCL 5JMRA 3UZXA 4WI9A 3DBNA 3A4DA 1AFVL 4OE7A 2P3ZA 1H7WA 5DD0H 3QXAB 3CU2A 4HZLB 3WHE0 1A7NH 1QNOA 5B7ZA 1L6PA 2D3NA 5I75B 3VH8A 3HZ3A 3VVWA 4NCC1 1FY6A 3MNZB 3FRUB 4KKRA 2OR9H 1P69B 3WE6A 1B4TA 3OAUL 4R7NA 3X13B 1XLGA 3BLKA 1KB5H 4JIPA 4GG6A 3B03A 2IVFC 5C0BA 5EMUA 4KI5F 1OEPA 1KJ2A 5HHPB 4KROC 3H6AA 4H3DA 2X1WL 4PTTB 4FQJH 3PIQB 5FHAH 5I8OH 1F3XA 3SGEI 5DMNA 3H9YA 4JHOA 1KQZA 2FQDA 5DZLA 3BZEB 1NBVL 2UZXA 2BOCA 3ORJA 3B7TA 1BXXA 3BW4A 4Z3JA 4XWOD 1A5MC 2FUQA 1V7ML 3VA2C 3O0LA 5H8PA 4QSHA 1FG9C 4DEUA 3P5YA 5DJYB 1LGVA 2R8SH 3LQAC 4KBXA 3W3OA 4WUKL 4RAUB 3N2MA 3TX4A 1IFHH 2DZUA 4XB8A 4PJHA 1Q3NA 2F08A 1LMIA 3UJIH 2PDPA 1QQDA 4CADA 5F6IC 2APWA 4GFSA 1EJ6A 1UEMA 1VLXA 4DVOA 5A40E 1H50A 2A73B 2LLEA 4KHXL 5A6MA 3WKNA 4MX7A 1KLUA 4BFBD 1Z89A 4HXAH 5GJTH 3CTTA 1K8CA