3LHVA

Crystal structure of the mutant v182a.i199a.v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAAIAGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 84
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhvA00
1OK6A 1H62A 4QNEA 3TNOA 4MJZA 3GDMA 4L4LA 1DBTA 3B8DA 3LTYA 1H63A 2VOMA 1RD5A 5EYWA 1SZNA 3LI1A 1KV8A 4EIVA 4OHQA 4O11A 2X1TA 4UTMA 3RF9A 2VFEA 2ZYFA 3EEGA 4MLJA 4K37A 3PC0A 2GUUA 1B4EA 2R91A 3UYCA 1WQ5A 1L9WA 2P0OA 2ISSA 1KFBA 1MEIA 2O7QA 5I3GA 2CZEA 1YXDA 5C6MA 4MYAA 1PL9A 3SSJA 3VI2A 2QCNA 5HWJA 3PF3A 2QDHA 1QDSA 3VE9A 1EWDA 5CPMA 2DZUA 3CQ0A 5FEWA 5A5WA 1I2QA 5KZMA 3UXAA 4WQ6A 4JTKA 2XN2A 4IGHA 4AB4A 1A5AA 4ZL1A 2BLEA 4MZYA 1X1ZA 1ME9A 3F4WA 3EB2A 1QOPA 3L0NA 3R8RA 4MY8A 3NAVA 4PA8A 1W31A 1L6YA 5F2IA 4FO4A 1PV8A 1OF6A 2QJGA 1VRDA 1PE1A 3TU9A 3BARA 2V2HA 2A7PA 3FLUA 5KITA 3GXTA 2VFDA 3MO7A 4FNSA 1Q6QA 4Q4KA 2PRHA 3LXBA 3GIYA 1EUNA 3G1AA 1JUBA 1H60A 3KRZA 1H5YA 4NJGA 4DQWA 4PCFA 7TIMA 3NL5A 2UV8G 1W54A 1YTDA 3MI6A 4ZQNA 3W7QA 4XUGA 1FCQA 2J24A 5EMUA 3NOEA 5FF7A 2NXHA 1PVNA 2FPVA 2CLFA 2OX1A 3NQCA 4HPJA 1KFCA 2C15A 4IQLA 4KFPA 3RLUA 1NVMA 2ZZ5A 2ZZ2A 3UPBA 4JY9A 3GR8A 3S9YA 2HSAA 4KKXA 4UIOA 3S8HA 1EA0A 1H7WA 1OG0A 4NT0A 3W7OA 3W7KA 2G95A 2X30A 5D02A 5FF4A 2O7SA 5H91A 1SFLA 1PHWA 1UUMA 1L6WA 2XN1A 3P8IA 4A29A 1QPNA 5F1UA 5K4ZA 3MMTA 3W6YA 2BZNA 5HR7A 1EP3A 3W2KA 4IMCA 1D9EA 1JRCA 4C1LA 1VYPX 1GT8A 2RDWA 4WD0A 3OA3A 3FKKA 3G1SA 1RQEA 1YADA 3G0SA 5CKSA 2E77A 4M7SA 2DZXA 4KWVA 3HBLA 3I68A 1G7UA 4G1KA 4DBEA 1J4EA 5AHNA 4NX0A 3W2NA 3BLFA 1AMKA 1EUAA 3EWZA 3W7LA 3O63A 1P1XA 5BNKA 1A5BA 5G1TA 4JEQA 1LBMA 1ML1A 1QCWA 3DFPA 3T78A 3SIZA 3ATYA 3DI1A 2Q3OA 5E1QA 3T44A 1BEUA 1O5KA 4PL1A 5EPDA 4K8EA 4GFSA 1K7EA 1SW3A 1XBYA 2B0MA 3B0PA 4NX5A 4XBSA 2HS6A 4JTHA 2J6XA 4O1DA 1VR6A 4CNNA 1KLZA 1F73A 4CQ8A 4K7VA 1UB3A 2E6DA 3U6WA 4LWWA 3HO8A 4UMCA 1ZALA 2Y7FA 5EA9A 3KVKA 3LCWA 3O6YX 4LVGA 4QNWA 5L6UA 3UQNA 2Y89A 4JTJA 3D0CA 2YW3A 4IPJA 2ZDRA 3W9ZA 4UTHA 1NEYA 4NNAA 1LP6A 2NV1A 5H2ZA 2FJKA 2VFGA 3THQA 3G1XA 4O57A 2VFHA 1I2OA 4MVAA 4JTSA 5FESA 1TJPA 3PG9A 2NUXA 4NU7A 1TPDA 3A21A 3LTSA 5CZSA 4RR4A 3DFSA 3SJ3A 2Q8ZA 3THAA 1AW1A 4A21A 3M5XA 3PB0A 4MPQA 5HWNA 4N6FA 3PSWA 4LS1A 5GVJA 5CZJA 1H7OA 4M5PA 2GQ8A 3N73A 1KM1A 3BPWA 3TH6A 3DBPA 3TJXA 3PULA 5F4WA 1I2RA 2W0UA 3W7NA 2GVLA 4GUJA 4UTKA 3CB8A 4YMZA 4Z0JA 3BGGA 4UFIA 3TQ0A 1YDVA 2H3DA 2VFIA 3C61A 3TQKA 3L68A 4RX0A 3WJXA 1K3UA 1SSGA 3ZWTA 2QF7A 4OQVA 3HB9A 5C55A 1YLVA 2A6NA 4FB7A 2J9XA 3FFSA 3LHZA 1U5JA 3FEMA 2X1SA 1R30A 2ZZ1A 4LNYA 3G3MA 2ZRVA 4TU1A 4A2RA 1GYLA 4K36A 3G8EA 1NF0A 3FJLA 1OFBA 4BF9A 3Q58A 3NQFA 5DY3A 3NDOA 3QF0A 1EX5A 1RZMA 5F1VA 4O54A 1SR9A 2ZFAA 4JIQA 1G67A 3UWZA 3TIMA 4BFAA 4YLWA 3TKFA 1O95A 4HKPA 6ALDA 4GC4A 3GDKA 5CG7A 5D32A 4AHQA 1RQBA 3M6YA 2V82A 1LRQA 2GVJA 2I1OA 3W86A 3AJXA 3WK2A 4DF2A 1QPQA 4Y90A 3GB6A 4OT7A 1IXOA 1TREA 3F03K 1WOBA 1MXSA 5D2WA 5AC7A 2ZA3A 1NF7A 3TR2A 4GUFA 4AWSA 4Z1CA 3MP5A 1WAUA 4M6QA 2V5BA 1KFLA 2DU2A 1KLYA 1A5SA 3W7CA 3MYOA 5LNVA 1EP1A 5D04C 2YXGA 3GAKA 1OABA 3STCA 4JIPA 4AAJA 3EXSA 4ADSA 3HGRA 5IBXA 3LV6A 4QAIA 3MP4A 1ZAHA 3G18A 3KRUA 3NPVA 4NZFA 3SY5A 5KINA 2H8ZA 2JBMA 3G8RA 4Z0SA 5DN1A 1ZAIA 3BG3A 4LV9A 5HR6A 3IIPA 2QCHA 2WNQA 5K9DA 2ZRZA 4UTUA 3VFLA 3M5ZA 4PL2A 1OFOA 1LROA 4AWTA 4MIMA 5U4NA 4JS3A 1WA3A 4JYEA 1W37A 5KTLA 3QRHA 4LVBA 1DOSA 1OJXA 5FI8A 2YDAA 5F4SA 1YTEA 4C1KA 2X1UA 1XL9A 2A4AA 4O17A 2TSYA 2ZRWA 1GZGA 3N14A 1AK5A 3Q94A 3TQVA 1GTHA 2JKPA 5AB3A 3E96A 2Z1BA 1VS1A 3EX3A 1GEQA 1X6UA 5DCDA 3M9YA 3NQAA 2F7FA 4GJ1A 1ME7A 3CTLA 1TV8A 2C19A 2GVGA 3I65A 3O6CA 1FCUA 1K8YA 5CGQA 1YXCA 5HMSA 3W1TA 3O1NA 2VFFA 1JULA 3NQ7A 4XQ6A 4UR8A 5A8GA 1GPWA 3QM3A 3HF3A 4XKYA 2VEKA 1A50A 1GG0A 1ZNNA 1MSSA 3IVUA 5AOUA 2E09A 1JCJA 4BWLC 1GVOA 4K7YA 3RLVA 1KM5A 3C2VA 1QNVA 2C14A 4O19A 5HQEA 2A7NA 4N4QA 2X2GA 1VH7A 2TRSA 3MYPA 4H6KA 4ORMA 5HINA 3B4UA 4DF1A 1WOAA 1GJPA 1UUOA 4TX9A 3CC1A 2QCCA 1OYAA 4JR5A 1I2NA 3SGZA 3W84A 3B0UX 2G96A 1HG3A 4DPPA 3KHJA 2R94A 2YYTA 4MFEA 1TPEA 3R89A 4CCEA 3R2GA 4NNBA 1T8XA 3P61A 2RKXA 4BWLA 1C29A 2JKEA 3W3OA 1XDMA 3UZJA 4B5NA 3BW4A 3G3DA 3W2JA 2DZSA 2GQ9A 5C5YA 4E2DA 3PUOA 1XBXA 2GOUA 4IXXA 1OX4A 3W85A 4FX8A 2ISWA 3O05A 2X16A 1B9BA 1LBFA 3A23A 4R7JA 1OFDA 2C13A 1OX6A 2J9ZA 1AG1O 1LBLA 4JTLA 5D2TA 3STEA 1MEWA 4XTIA 2QUTA 4RZ4A 1SQ7A 2JGYA 3NPWA 4JTTA 3SW6A 4UFLA 3C8FA 3W2MA 4CQAA 3NQEA 3TA6A 4UFMA 4Y8FA 4Z1BA 5I3HA 5BMXA 3QSRA 1ZCOA 4LUIA 4UC5A 3LOTA 4UFHA 4GWEA 5CPOA 1SFJA 3MI2A 3USBA 1F6PA 1SPQA 4WOQA 3IIOA 1T0OA 2QUVA 2AAMA 1W3NA 2E68A 4MY9A 1VGAA 2OT1A 4WXYA 5AHFA 4DO5A 3AO0A 1T99A 4JTIA 3GKAA 4LS0A 1VZWA 3G0XA 5EY5A 3W2LA 3QH2A 5BOOA 3DFOA 4O13A 2GJNA 3LLFA 3KXQA 1GWJA 3H53A 2DZVA 5IM51 4UCGA 2QDGA 2HTMA 3NL3A 1IXNA 3TXVA 2BSLA 4JDYA 4AF0A 5FEXA 5LGXA 1NFBA 1DJQA 3KOFA 3BG5A 4POCA 2PC4A 3STFA 4DXVA 1X1OA 1XUUA 2CU0A 2ABBA 4NUWA 1VYSX 3NA8A 4MFDA 3GKFA 4L4MA 3LLDA 1LRTA 4RJEA 4NXSA 1FWNA 3C3NA 2FIQA 3RFAA 3EXTA 1OVDA 3WJSA 3NXFA 3CLMA 3OIXA 1LORA 1ZENA 1JVNA 2YCEA 3QMRA 4ONVA 4N4PA 3QMSA 1TCDA 3R5EA 3WK3A 3TSDA 3EWWA 2J88A 2ISVA 2CLEA 5FF0A 1TRDA 1W5NA 1O60A 3GNNA 4HN4A 5LZLA 4HNNA 3LRMA 2DP3A 4PC8A 3RNDA 2NXIA 2TMDA 1WBHA 3KX6A 4FF7A 1QO5A 4K39A 3KVMA 3ZS4A 2CZ5A 1VCFA 1W56A 3W1AA 5D38A 2Z6IA 2FDSA 2YGYA 3M7WA 3NR0A 2FB3A 1YDOA 2NX9A 5D33A 3UWVA 2ZA2A 3S42A 4ZQOA 4LRTA 2PURA 1XUZA 3FYOA 1RQHA 3L67A 3C0JA 4UTTC 4MJMA 1LOLA 1K02A 3I7RA 1P5BA 3P80A 3LX9A 1Q6RA 4PFMA 1G4SA 1QOQA 3EX6A 5T26A 1VYRA 3W23A 3ABRA 3FA5A 2GQAA 3R12A 4Y6GA 3W1PA 1ICQA 3S1XA 3MHGA 5C2XA 1IIGA 4EOUA 1RPXA 4U4MA 5AHMA 4HT3A 1W5MA 4GE8A 1O5XA 1H1YA 2A1YA 4O0KA 4HNVA 1ALDA 1H51A 3S5NA 3SECA 3ABSA 2DZWA 5D2XA 5KMYA 5KSWA 1TQJA 3W7RA 2A2IA 3TMQA 4IMFA 1W3IA 2VEPA 5AC6A 3TXZA 4UTTA 4IJBA 2Q3RA 3M0ZA 1ZHAA 4KWWA 2HMCA 4QJ1A 3HMJG 3N9RA 1DVJA 4RXGA 5CPNA 2H3BA 2ZRYA 4UMAA 2P10A 3LERA 2VKZG 2NWRA 1OYBA 5AYZA 1JR1A 3LTPA 2WKJA 4N9EA 2CLOA 2NXGA 5LNWA 3O6DA 3NGJA 4O18A 5L9FA 4LOCA 1TPH1 4GUIA 3TSBA 3KRSA 4XZ9A 3OHIA 1LLZA 3QMTA 2F84A 4DF0A 1PHQA 3NQMA 3W76A 3SR7A 1QAPA 1M7OA 5F4XA 4GBUA 1LRNA 4NJKA 3QSTA 4OGZA 4Z08A 2PRMA 2QCGA 3PAJA 2C3ZA 1FWTA 3E0IA 3FOKA 3O06A 3CIWA 3DFNA 1OFQA 3LCFA 3TDFA 3P8JA 1SUXA 2YFOA 3GAYA 2B4GA 4S1FA 1EP2A 4GUGA 5DBUA 3DKLA 4CNPA 3QQ0A 1XFBA 3MHUA 1J2WA 1TTQA 4UTWC 4O10A 1LYXA 3NM1A 4O0ZA 2VXNA 1LLWA 4H3DA 3C4UA 3A24A 2RH9A 3G1VA 1LCOA 2E5DA 4RZ5A 3Q2DA 4LT9A 2OCZA 4CLMA 4S2CA 3PS7A 3OVPA 3P60A 4FNQA 3F4NA 1GQNA 4PH6A 4X9SA 3HGSA 3TCEA 4PEKA 1TTJA 3W2UA 3UY8A 1EWEA 3UD6A 4GRSA 1PS9A 4BK9A 4LVFA 1IGSA 5TQLA 1SW7A 4JTGA 2OMAA 3TK7A 3LI0A 3TFCA 3L65A 1JCLA 4UTWA 5SWUA 2R8WA 5HUPA 1R47A 1RR2A 4M6PA 2W79A 2EGZA 1THFD 3QEZA 3LCHA 3MI3A 4O8RA 4QISA 3STGA 5J5DA 3L5MA 2QCEA 1XBVA 1KM6A 3TW6A 2A0NA 2Y88A 1IXQA 2JKAA 4TMBA 4N9CA 5D2VA 4ZVJA 3T7VA 3LHYA 1PIIA 3HPXA 3QYQA 1KV5A 3CEPA 3W87A 3HG4A 4HSNA 4K38A 3NM3A 2Y7EA 1Q3NA 4Q32A 3HG5A 2YZRA 5DELA 1KBJA 2DZPA 3NZ1A 2VEMA 1IXPA 1H7PA 3M16A 3DXIA 2J9YA 3U8GA 4FEZA 4J9JA 2FQIA 2I14A 2BWGA 3N34A 1ZAJA 3IIXA 1JUEA 2H8XA 2AQWA 3VCRA 1HO4A 3B06A 1D3GA 4IOTA 1TRIA 4AHOA 1HFBA 4N02A 3S1WA 1NSJA 3G1YA 4FNTA 3LCGA 3TAKA 3GX9A 2V5LA 2WQPA 3EWBX 1UASA 3FYPA 4CCDA 1SO3A 4LC8A 4EVZA 2CW6A 5LGZA 3LXCA 4RV8A 1XCFA 2H6RA 2D73A 1JQXA 2CZDA 4UFJA 4O53A 2IQTA 1MEHA 3TSMA 1DQXA 4NVTA 1GOXA 2ZZ4A 4O1BA 5I3JA 2B7NA 5AN7A 3GXPA 4RCXA 3IVSA 5KZDA 3DHFA 2E6FA 4Z1DA 4OU1A 4MYXA 1HTIA 8TIMA 4X2RA 3PSVA 3BW2A 3PM6A 3T55A 3P81A 1G4EA 1F7BA 3QJAA 5LSMA 1TB3A 1I8JA 3Q37A 2C0AA 1Z41A 1KTNA 4R33A 3BLIA 5F2GA 1VLIA 4YL2A 4PODA 5K7JA 5AC8A 2HS8A 1VHCA 1JCYA 3LBMA 5C54A 4JYDA 2NUWA 4UTIA 1QWGA 1M7PA 2NX1A 4LUJA 1Z48A 2G97A 1DJNA 2WOQA 5E0KA 3GYEA 3BK0A 3P82A 1W5PA 3N3MA 1QPRA 2V0TA 3S0CA 1L6SA 2QCLA 3PBWA 4K6AA 4Y96A 4O12A 3H54A 2DORA 1ZY9A 3NQGA 3V1PA 4HNTA 1YPFA 3A5FA 1TIMA 3ANYA 1SO4A 4CQ9A 4E0CA 3NZRA 3QZEA 2TYSA 5G5IA 3M41A 3CIXA 3NL2A 3EKZA 1TPB1 1F5ZA 5K9CA 3DU0A 3GR7A 3EWUA 4E2BA 3NPUA 3IGSA 2CZFA 3S5ZA 1T96A 2WNNA 3L0GA 4OV9A 5HNRA 3UWQA 4UTJA 4RXFA 1KM2A 2OZ0A 1ZFJA 3WJWA 1KM0A 1XDLA 1DORA 3KVLA 2WV8A 3G1HA 3G22A 2B7OA 2Z6JA 2EF9A 4RZ6A 3VNDA 1KFJA 3ABQA 5D03A 3E02A 3TAOA 1FWRA 2QR6A 3LRKA 4GNJA 4JX4A 3VE7A 2A85A 4A3UA 1KW1A 2QCDA 2GPTA 4XTDA 4P2VA 1SZGA 2ZTKA 1S3HA 3C2OA 3EWYA 3HGOA 3PWAA 3WJZA 4Q33A 4OV4A 3PVFA 1FWWA 5LHFA 3MW7A 3NQ8A 4N2YA 1LOQA 2WSQA 5EKYA 5D05A 1YPIA 1SO5A 2XFWA 4UFKA 5D30A 4KFOA 1LOSA 3O07A 1A5CA 5LHEA 5LNRA 1OX5A 2CLMA 2RDUA 3JS3A 3I7SA 3CT7A 4ZMGA 2Y61A 2C16A 3L9CA 5FEZA 3MWAA 4BI7A 3KAOA 1BKSA 3IEBA 2CWNA 1QMLA 3L5AA 4WX2A 4X3ZA 4FX7A 4GUHA 1SZEA 5DXXA 4O52A 4TMCA 5DCBA 5E93A 3LHUA 3UPWA 2E5BA 4YXGA 4FIQA 1WXJA 3GXNA 3L2IA 3W71A 2E6YA 2BXVA 4YWIA 2Z0IA 2YX0A 1OFPA 3GDTA 4ZQPA 2C18A 3LCLA 3CEUA 1FDJA 4ZQCA 1EB3A 4D2JA 3S1UA 3HG2A 1IIHA 4ALDA 2DJXA 4JTEA 5BRBA 1RV8A 5LNUA 1P4CA 1UBSA 2JGQA 3EX2A 4GXMA 1OFRA 5CZ0A 1TYGA 2FPTA 5AHEA 3HIJA 5TIMA 4MOZA 5DCEA 2RDTA 3W1QA 3CM4A 1CX9A 4WJEA 3O8AA 2GJLA 3UXDA 1XKYA 5HULA 3NPXA 3B05A 1G4TA 1SU5A 4NJIA 1B57A 2DZTA 3HQ1A 4O1CA 4WY0A 1K8XA 5I3IA 3PBVA 1E51A 3EWXA 3L21A 3NQVA 4O16A 1KTBA 4OBTA 4AXKA 5K9XA 3BLEA 4E38A 1Y0EA 4LY8A 1NAL1 2B7PA 4DO4A 1SSDA 3P84A 3R13A 3TROA 1D3HA 2YR1A 4TR9A 2EHHA 1BTMA 4IWWA 1AL8A 1KFKA 4HIBA 2NUYA 1RVGA 1GVQA 3BV4A 1FCVA 1DHPA 4NJHA 3S5YA 1X8FA 3E49A 1WV2A 4Y9AA 1VPXA 5FEPA 3MBDA 2VELA 2AGKA 5D37A 1ADOA 3W1XA 4ZQRA 3SGUA 4JX6A 4CNOA 2E6AA 1QO2A 2J27A 4R34A 3WK1A 3DHDA 1W3TA 4EWND 3B0VC 1AL7A 1R2SA 4I7UA 3QW3A 3M47A 4NNCA 3W72A 1R46A 3PB2A 2ZZ6A 2WO5A 1XXXA 1GYNA 1XBZA 2QCMA 3GNDA 3E12A 1I4NA 2ABAA 3LDVA 4NXKA 3TV8A 3TC7A 4LVAA 5I3KA 5F2LA 3UWYA 1FXPA 3W7EA 3G1DA 1LM1A 4O14A 2OT0A 3FJ6A 1W1ZA 3FKRA 2LLEA 3WK0A 4WUIA 5CZTA 3TUUA 2C6QA 1H7RA 3GZ3A 3RU6A 5DBTA 4M6VA 3FS2A 1H50A 1FDYA 1UJPA 1B3OA 3PG8A 4W9TA 4MUZA 3W1LA 2E5CA 3T40A 4AHPA 1H61A 3LHWA 1VCGA 3OG3A 1VC4A 1H7NA 4PTNA 2V2DA 1EEPA 4UNKA 1WX0A 4FNUA 2Y85A 4JN6A 3ZWSA 3IGUA 4QIUA 5AFDA 3QW4B 3DFTA 1OYCA 4RKAA 5J5RA 1AW2A 2ZBTA 3V75A 3GDLA 2YSWA 3N19B 2Z2UA 3W7IA 2WSYA 3C56A 3GDRA 4U28A 4JYFA 3YPIA 3PUEA 2QAFA 4NZJA 2DJLA 3DZ1A 3NQDA 2NZLA 3LV5A 6TIMA 1DV7A 2YYUA 3T4CA 2WJZA 2QAPA 1BWLA 5HUOA 4YCPA 5EL1A 3W7HA 3M1ZA 3M5VA 1JUKA 4O28A 5MHBA 4JTUA 1VLWA 3ATZA 4FXSA 1N8FA 1FCBA 1K7XA 4MZ8A 4XBKA 4QITA 1MO0A 3RK8A 3LGEA 1DQWA 4ML9A 3RMJA 4FIRA 3W7JA 4UXDA 3GVGA 4JTFA 3ZFHA 2YW4A 1XM3A 3U2OA 4DBDA 4MY1A 3JRKA 3OBKA 2YPIA 2YFNA 3PBYA 4BI5A 4H4IA 3OVQA 2ZZ7A 3INPA 1O94A 1YTKA 1I45A 3HGJA 3SFKA 1J5TA 1JQVA 4ADTA 3W88A 1KM4A 1QR7A 3DAQA 2ZA1A 2ZZ3A 1GG1A 1FX6A 2Y62A 4HNUA 3TW7A 2A5HA 3KVJA 3P7YA 2NLIA 2NX3A 1WYIA 5U7SA 4MZ1A 3MP3A 1TMHA 4UTLA 3TMLA 3MJYA 3LCIA 4NJJA 5G1YA 4DELA 2VC6A 3VKJA 4O15A 5BW6A 4HHPA 4JY8A 5CPLA 4LV4A 4XWUA 1CW2A 3M43A 5DXYA 3ABOA 3S1VA 1BWKA 2Y7DA 1A53A 1S5VA 3FIGA 4UMBA 3B03A 3LHTA 1S5TA 4IX0A 5HWMA 5HJLA 2ZTJA 1F2JA 3CWOX 2QCFA 3EKLA 1HL2A 1Q45A 1KTCA 5G4EA 4JDBA 4O4WA 4MLRA 1P0NA 3W1UA 4N6EA 3IIZA 1SW0A 2G5WA 1I2PA 2PRLA 3DI0A 1MZHA 4TO8A 4IUOA 2FTPA 5FF3A 3TFXA 2FPYA 1N55A 1TPC1 3WJYA 1S5WA 4IX2A 3HPSA 1TTIA 5AYYA 4JNMA 3CWNA 3A5VA 1X7FA 2FB2A 4UR7A 1KBIA 2R14A 3LM7A 3PBUA 4DEFA 1Z42A 1PCWA 3W7DA 3NVTA 5LNSA 1ICPA 4HPXA 3LHVA 4MKNA 4X22A 1W8SA 2CLLA 1TO3A 2ATSA 3HPZA 4JICA 3PUDA 1TJRA 3TJLA 2Y7GA 4FHAA 3QQ1A 2V30A 3W7GA 4I9AA 4DPQA 1FQ0A 3OEXA 4NQ1A 3NQ2A 3EXRA 1ICSA 1ZJIA 1SZFA 1R2TA 4LW7A 3DKJA 1JCNA 2QUUA 3O16A 5ABTA 3HG3A 1OF8A 3HOJA 4S2BA 5F2MA 3G1FA 3W70A 4UNLA 1VHNA 1DL3A 2QKFA 2WPBA 3TC6A 4FX6M 2CLIA 4IPIA 3G0UA 3CU2A 1K8ZA 1XI3A 5K2ZA 1FXQA 4LVDA 4AWUA 3DENA 3BVJA 3DFQA 2NV2A 4XKYB 3NQ6A 4ICNA 2ZQ0A 5EBUA 3NG3A 5AHLA 3O15A 1TV7A 1R2RA 3P5ZA 4ZZ9A 2WSRA 4HSOA 4A2SA 3C6CA 4Z1AA 3W22A 5IBXC 3PR2A 4O4VA 3L0KA 4EF8A 3TX9A 3QFEA 3H55A 4ZQMA 4P61A 1F6KA 2QCDB 2V9DA 3B04A 3EX1A 2W6RA 4JD4A 1IF2A 3P74A 5BMWA 4O50A 3QPYA 4BR1A 1LTDA 2A6LA 1F05A 5CSSA 2ATMA 3N2XA 5G2WA 2EAWA 1WDWA 2C1HA 1JCXA 2E1DA 3W07A 4EF9A 1JRBA 1OFAA 4N9DA 4CCCA 1FWSA 4FXRA 1JJKA 3I6RA 3MUXA 2FFCA 2VENA 3A22A 1PCKA 5FF2A 3W1NA 4BI6A 1M6JA 3G24A 4AEOA 3DGRA 1TSIA 3LCXA 3I7QA 3OVRA 1P0KA 1Q6LA 3LXAA 3NNTA 3C2EA 4LTSA 1YYAA 4M7TA 2PCQA 3C52A 4ORIA 1OX4B 4IMGA 3P67A 2V2CA 1EPXA 5G2HA 3QPZA 2QJIA 3S6DA 4LS2A 1FUYA 1WBJA 4QSHA 3IV3A 5AHIA 4TIMA 1Z44A 3NEVA 3GK0A 1C8VA 5DLCA 3IGXA 3IVTA 4AH7A 3IIVA 1TV5A 3P62A 3HJZA 1YXYA 1W0MA 1KFEA 5I3FA 2H90A 4AMAA 3NO5A 2Y6ZA 2Y70A 1TPFA 2KZHA 2ZCGA 3LBCA 3E9AA 3L5LA 1W5QA 1TTPA 4R53A 3K30A 3W1RA 1LDCA 4AVFA 2P1FA 1OFEA 1V7YA 1GVSA 3W75A 2CLHA 1H1ZA 1Q6OA 3WFAA 4A22A 2BTMA 1VJIA 4WXZA 5D2YA 3TE9A 4JXCA 1CI1A 5D09A 1GVRA 4OWGA 2B7QA 3QC3A 3C2RA 1L2UA 1FBAA 1F76A 1G4PA 1EIXA 4LRSA 3NL6A 3W73A 3BGJA 4WY0B 2WNZA 3C2FA 5K3VA 3MHFA 5K4XA 1TQXA 1HO1A 2JK2A 3BO9A 1HUVA 3EX4A 4IMEA 1V5XA 4AF0B 2VEIA 4O1AA 3NYZA 1VCVA 2Y63A 2XN0A 1N7KA 1QPOA 1GTEA 3W7PA 4OE7A 1FDZA 1G7VA 4QM1A 1FY6A 4YCOA 2RHGA 5G4WA 4N9BA 5G2IA 1OHLA 4WZHA 1KA9F 3UY7A 4M19A 3L66A 1M5WA 4FNPA 3BW3A 1G69A 2ZRUA 3IRDA 1G6CA 5AYXA 1F74A 3ZR4A 3UNDA 2ZRXA 3LB0A 1H7XA 2I9EA 3UZ5A 3ELFA 3LRLA 3GLCA 1K03A 1ONRA 1LZOA 2FLIA 3CPRA 2EKCA 3PY2A 1C9DA 3W74A 2CLKA 3JR2A 3SI9A 5KZEA 2X1RA 1KM3A 1GVFA 5LKYA 4JX5A 1U83A 2A21A 5DY2A 2PE4A 5CSRA 1B4KA 2OJPA 3M5YA 4IXHA 5TBOA 1TPVA 4WOZA 1QFEA 3M44A 2CFFA 1JCMP 3UWWA 3MBFA 1XC4A 4JGDA 4LC6A 4QQ3A 2BX7A 1K7FA 2QJHA 1SO6A 1TPUA 2NWSA 2V8ZA 4I7WA 3A9IA 3W1MA 3UWUA 1O4UA 4IMDA 4DO6A 3N2MA 3N9SA 3KFTA 4LU0A 2ALDA 3W7MA 1OK4A 4UUIA 2TPSA 4WY0F 1VQTA 3BG9A 2QEZA 2EPHA 3CHVA 4K8HA 4RK8A 3S5OA 1ME8A 4I7VA 3P5YA 1TPWA 4RLIA 1W5OA 2Q8LA 4ADUA 4KFNA 2A7RA 2V81A 1AW5A 2RFGA 1UCWA 3DH7A 4FNRA 3SZ8A 1DKWA 3F1QA 1YDNA 3W83A
chains in the Genus database with same CATH superfamily
4OTKA 3FVMA 4ML4A 1SJCA 1EZ2A 3AMKA 2VOMA 1UR9A 4PRRA 4HTBA 3LU2A 4OHQA 1CXIA 2X1TA 3UG5A 1C91A 2VC9A 4MLJA 3ZLHA 3PFRA 5CAKA 4ZE4A 2REQB 5AVHA 3PC0A 5E5CA 2R91A 3UYCA 1S38A 1CGYA 2ISSA 1MEIA 2O7QA 3N6JA 3KTSA 4U5IA 5HATA 5HWJA 3LGDA 1OC5A 2WMGA 4YTTA 3CQ0A 5A5WA 1GZJA 1P0DA 4IIBA 2XN2A 4DAIA 4IGHA 4AW7A 3CYJA 2BLEA 1HJQA 1GPFA 3EB2A 1N8WA 3AIBA 5I06A 4XKMA 5BYWA 4LBUA 5C2GA 1PE1A 2PWFA 3BARA 4MSSA 2A7PA 5KITA 4B5XA 2X05A 3MO7A 3MV01 3VKCA 4Q4KA 2PRHA 1Y5XA 2P50A 4OVXA 3GIYA 3RJXA 3F4CA 1A3XA 3WF1A 8A3HA 1H60A 3KRZA 1H5YA 4NJGA 4Z2GA 2UV8G 1N82A 2VD9A 4B90A 1UR1A 1FCQA 5TAOA 2J24A 3V5CA 3GTXA 1PVNA 3DG6A 4UQEA 5DF0A 1O6IA 4C6OA 4HPJA 1RK6A 4WDTA 4IQLA 1NVMA 2ZZ5A 1GYMA 2G41A 3QN3A 1E40A 2R6OA 4JY9A 4DZ5A 2VNCA 4AZBA 4TV5A 4RE3A 4KWSA 4H2HA 3AMCA 3VZZA 3S8HA 3MMUA 4W8AA 3BANA 2DVUA 3IUIA 5FF4A 1NWUA 4LAOA 4Q6XA 4XAZA 1E4NA 1UUMA 4A29A 3RG6A 2P88A 1HGYA 1RD6A 3MMTA 3PJWA 5HR7A 4GO8A 1EP3A 2IKIA 3W2KA 3AZSA 1VYPX 3H2CA 1WXYA 5BXRA 3SCUA 2E77A 1EF2A 1O5QA 5IFTA 4ZO7A 1EJ7L 1V3IA 1IT7A 3GUWA 4LUSB 3E3HA 4GX9A 2FHFA 4Y8EA 1J4EA 5AHNA 2VC5A 1EUAA 2PDMA 4JCLA 4FOKA 4IQEA 1P1XA 5I5RA 1ML1A 4HU8A 2YL9A 3BZJA 3TONA 3T44A 1JCTA 5EPDA 4J1OA 2C8NA 5CC7A 1HJWA 2AMXA 1F73A 1W9VA 3VD5A 1LQ0A 3DECA 4LWWA 4UMCA 4QNWA 1IEWA 3QV8A 3D0CA 2OZTA 2YW3A 4IPJA 2L5HA 2ZDRA 3W9ZA 3LYEA 4LQ1A 3LPGA 4S3BA 4NNAA 3JW7A 3ITXA 3A4XA 2NV1A 2PP3A 3BAIA 3MJMA 1JAKA 4JTSA 2XIIA 1G5AA 2O9PA 2QZRA 1EXBA 3R43A 2YB1A 1DP0A 2QLYA 5C0QA 2ACUA 1XJBA 1DJWA 3RCYA 1Q85A 4A21A 1R3QA 3IJQA 3ZLGA 4N6FA 4LS1A 5CBIA 3KLLA 1H7OA 1ZBWA 4R3UA 1I2RA 3W7NA 3G1RA 2GDQA 2GVLA 4AY8A 4IFRA 5HPOA 4YMZA 1V6UA 3MS8A 4PSPA 3C61A 3EDKA 4Q3MA 4RX0A 2FMNA 3HN3A 1AZ2A 5C55A 1WDSA 3I10A 4MHBA 1BYAA 2OEJA 2J9XA 3FFSA 3VMOA 4DWSA 2E9BA 3TEVA 3FEMA 2IPGA 4LNYA 4TU1A 4X61A 4A2RA 4XVEA 1Q5MA 3K2GA 3WLSA 2OX4A 1GHSA 3HZ3A 3NDOA 1C8QA 3QF0A 5H8PA 3EB4A 1SR9A 2W92A 1XLAA 2NVAA 4HVXA 3UWEA 1VEOA 4J3UA 4K2SA 1JZ4A 2VOTA 1F4HA 4HKPA 6ALDA 3V5FA 1U22A 1VIZA 5D32A 3VYLA 4AHQA 1RQBA 3M6YA 3BJTA 2VRKA 2V5JA 5XIMA 2GVJA 3MUCA 1JPDX 4CEUC 4AZ7A 3W86A 2D2JA 4Y90A 2OLAA 3GB6A 4X9YA 1IXOA 1TREA 4HA0A 1RLCL 1HP5A 1NF7A 3O6AA 1PZ0A 3TYUA 3PWIA 4M6QA 2SFPA 5EMMA 3B3DA 3VOHA 2BHYA 2ZUUA 3STCA 3WLHA 4JIPA 1US2A 3EXSA 2BY0A 3PZIA 1W2VA 4CKQA 1DTNA 5FJRA 4TOQA 4RV3A 5KINA 3CO8A 2QCHA 3IUDA 4KF1A 3DBNA 3CK5A 1UWSA 2ICSA 1XQLA 4MIMA 1UPMB 4DJDD 1W37A 5KTLA 3ONBA 3QRHA 4Q8WA 1DOSA 2C0HA 2YDAA 2WZIA 1YTEA 4C1KA 5JVLA 3QXBA 4BKNA 5M1TA 1PX4A 5M3WA 1A0EA 2TSYA 3EOUA 2ZVIA 2ZRWA 2VCAA 4F0LA 1AK5A 1H4PA 4LXFA 3TQVA 2JKPA 4GJJA 3E96A 1VS1A 1X6UA 2QT3A 2BASA 1UWRA 4HCDA 3PZQA 4M24A 3R0UA 1UUQA 3UU0A 3PJTA 4GJ1A 4GQBA 1ME7A 1TMLA 1AQ0A 1I75A 1FCUA 4M3PA 4C6IA 3WX7A 3O1NA 3ITYA 1DXIA 2J7FA 1UIPA 3HF3A 4WSKA 4WJXA 3PPFA 1A50A 5EFDA 1MSSA 5AOUA 3VOIA 3VKBA 3EDFA 2O92A 5TF0A 1JPIA 4O19A 4TV6A 1IHIA 1VEMA 4AWEA 3QHNA 1XIJA 4ORMA 3S2CA 4Q8UA 4DM1A 2OVLA 3CC1A 2EPOA 4QG6A 1OYAA 2GOKA 3SGZA 1AQMA 2Y5SA 2OGJA 5MKGB 1GUVA 1JNDA 1TPEA 2JEPA 4CCEA 4RNFA 2OSWA 4L1XA 4GK8A 4GYPA 2J78A 2WC3A 2JKEA 3W3OA 3UZJA 4B5NA 3W2JA 3B40A 5ABFA 1TVNA 1VIWA 1HXJA 1W1IE 5C5YA 2W66A 1PUDA 1CCWB 1MDRA 4AU0A 4FX8A 2ISWA 3UJ2A 3K4AA 1LBFA 3QZ6A 4R7JA 4NRSA 2INFA 3WF3A 2J9ZA 1LBLA 3N04A 4RZ4A 4HOZA 3WELA 1BF6A 1V3KA 3VIKA 4PUWA 4PUDA 5BMXA 5I3HA 4Q8OA 4YPJA 4US5A 4LUIA 1EHNA 5CPOA 1SFJA 2EJ1A 3N2BA 3RDKA 1U1HA 1EJVC 2QUVA 5ENLA 1T99A 4JTIA 2OKTA 3MV11 5EY5A 5BOOA 3O3RA 3DFOA 4O13A 4JTAA 2GJNA 4PTXA 3OVGA 1TA3B 4UQBA 3LLFA 3H53A 1UWAA 1C7TA 4DXKA 4C90A 2YDRA 2BSLA 1NFBA 2Q02A 3AU6A 5E0CA 4G8TA 4DXVA 1X1OA 1XUUA 2CU0A 4GINA 1E9LA 4GIAA 3NA8A 2Z1WA 1DJHA 3C3NA 4ICMA 1OVDA 1OSEA 1YBQA 2YCEA 4PGLA 2O4QA 4XAGA 3EWWA 4NZCA 2ISVA 1TE1A 3GNNA 4HN4A 3U0HA 2DP3A 3RNDA 1CLVA 2C1GA 5A2AA 3WQEA 3F2BA 3KX6A 5B7ZA 4OUIA 3ZS4A 2CZ5A 4JIHA 5AC5A 1AJ0A 1UPPA 3M7WA 3NR0A 1WDDA 3AROA 2VO5A 4ZQOA 1WAWA 4D6JA 1FFQA 2PURA 1XUZA 3DIPA 1S2AA 5A6AA 4MJMA 5KZ6A 1LOLA 3EDJA 1K02A 2XJ7A 4X63A 4KEZA 5FL1A 3RITA 4PFMA 1G4SA 4Q7NA 4S3EA 2GQAA 2QGHA 2TODA 1ICQA 1NH6A 2WJFA 5C2XA 4BCEA 1HJSA 1V3LA 2A1YA 4J3ZA 5ABEA 1ALDA 1S5NA 5DT5A 2YKKA 4EE9A 3M6DA 5KMYA 3U2EA 1TQJA 2MANA 2QJMA 2VEPA 1CXEA 2BS9A 3DG7A 3ERPA 2WC7A 5A6LA 3R25A 1P0EA 5CPNA 6A3HA 3TW9A 3K5XA 2QMJA 3GHUA 1I0BA 1JR1A 4WKHA 1TCMA 4QBXA 3GG7A 5LNWA 1NDYA 4A3QA 2ACRA 3FN9A 3O6DA 3NGJA 3TJIA 5DANA 4ZB2A 4XZ9A 1LLZA 2F84A 1DIKA 4BZYA 5EB8A 5I79A 3SR7A 1QAPA 3N29A 4Z08A 2PRMA 3GSMA 1VBHA 1FWTA 2PWEA 3E0IA 3TWBA 3U7BA 1M53A 1OFQA 3DFNA 3OLGA 4B3KA 4C91A 1QI2A 2XYLA 3LCFA 2ZOXA 3VIOA 5DBUA 1ISZA 4LYPA 3CH0A 3MHUA 1VJSA 3SIMA 4C6MA 4PR4A 3TN6A 3CV1A 3A4JA 1IT8A 4H3DA 3BE7A 3WKZA 3PPCA 1OCQA 1L8PA 4AZHA 4CD7A 4PMRA 3PS7A 4GPNA 1AH4A 3VOFA 5IOBA 2PBOA 3O2LA 3W2UA 1EBGA 1XINA 4LVFA 4LNCA 4IQJA 4WEVX 2V5DA 2EG7A 3V0UA 1SZRA 4C7FA 4KEMA 3CWHA 2VEFA 4M6PA 1GVYA 3AIWA 1THFD 4JZ5A 1VFOA 4IZGA 5CJNA 5J5DA 3L5MA 2QCEA 3SUUA 1KM6A 1IXQA 1WKFA 4Z2KA 4C6JA 1KGWA 2YXOA 3NXLA 3HPXA 1JDFA 1S3TC 3FX4A 2FGZA 5B80A 4URIA 5BRPA 1PEZA 3HG4A 3W87A 4K38A 1AJZA 2FKPA 1GK8A 3CNYA 1R6WA 4Q32A 1MW2A 3HG5A 3VC6A 2PDPA 3VD9A 4XZNX 2VEMA 5DMMA 1IXPA 4I9JA 4JIRA 3KBMA 2J9YA 3WYZA 4PBEA 3W26A 4YTQA 1KGXA 1ZAJA 1RP9A 3IIXA 1JUEA 1HJUA 3VCRA 3WDRA 2E4TA 4AHOA 1EGMA 4ACZB 2CC0A 2D0GA 1PKYA 1F8MA 1KB3A 1XLGA 2NSXA 1JPKA 2WWDA 3H2OA 1EQCA 2DSZA 2Y0FA 1XSIA 1DWJM 4CCDA 1V6VA 2PDBA 5LGZA 1TWIA 2D73A 1JQXA 3BAWA 2EKGA 3UA3A 4Q8VA 1MEHA 3TSMA 1S2CA 1WZMA 1E0VA 3GXPA 4HCHA 3DHFA 4QGCA 4Z1DA 3CZGA 4OU1A 1RBLA 1UD8A 2XSXA 3BW2A 3P81A 4HP5A 5LSMA 3ZR5A 1I8JA 1G9HA 1KTNA 4V1XA 1XIEA 3A12A 5F2GA 5C9WA 2BXYA 3BCJA 1XV8A 4DZAA 4AMCA 1VHCA 5C54A 4S3GA 5JH2A 5E0FA 1JXKA 3RN6A 2OODA 2NUWA 4WF7A 4LX4A 3GYEA 3RAOA 2Z7KA 2PCEA 4ZEPA 1R3VA 1A47A 1FHLA 2IKJA 3RPDA 2PDUA 3NQBA 4ZSUA 3PBWA 4O12A 1WNOA 4IL2A 2CXGA 3NQGA 4B15A 1B1YA 5I77A 4PMQA 3ANYA 1OZMA 5H6HA 3WH5A 3EKZA 4B9YA 1TPB1 2PZNA 4F0HA 1Q6CA 4L4OA 1FKWA 4MKVA 4UTJA 1KM2A 2OZ0A 1E72M 1DORA 1NWRA 3KVLA 3PNUA 4RZ6A 3VNDA 2PWDA 4AISA 1L0PA 3ABQA 3T05A 5CH9A 2QR6A 3LRKA 4GNJA 1FFRA 3BOLA 4JQ3A 2A85A 3CQKA 4EPEC 1LWJA 1J9YA 2OEKA 2BDQA 3GUGA 3WUEA 4ZFCA 2GPTA 4XTDA 3B9EA 5XIAA 1X96A 3RYSA 3C2OA 3EWYA 2GDUA 4Q8NA 3AALA 1FWWA 4H04A 3TYBA 4QLLA 3NQ8A 4N2YA 4JIIX 5D05A 1OADA 1SO5A 1CYGA 2XFWA 1IWAA 3QV7A 2O9OA 5LNRA 1OX5A 2DT2A 2YCIX 4ZMGA 1HJVA 2A79A 2C16A 1E3ZA 4BI7A 3KAOA 4D1JA 3VVGA 1TR1A 3CAWA 4IM4A 1EYWA 3E0FA 4WX2A 2WMJA 3WMBA 4F0RA 4J27A 4HU4A 4FIQA 1WXJA 2Z0IA 2C18A 1EXPA 3LCLA 3CEUA 1FDJA 4ZQCA 1IIHA 1F3TA 3RIKA 5BRBA 5LNUA 4RE0A 4HSHA 1OGGA 3ZOAA 4GXMA 5CZ0A 5AHEA 3HIJA 1EA9C 1KCLA 2CWXA 2GUBA 1TG7A 1KBLA 4XAPA 2D69A 3NPXA 3B05A 2DEPA 4NJIA 1IZKA 1B57A 1TMQA 3FSTA 7ENLA 2VP8A 3HQ1A 3WEZA 1B90A 3KBVA 1X6NA 3H6OA 2HPIA 4KIRA 3KP0A 4PSRA 3L4VA 3L21A 2RJGA 3AI0A 4O16A 1V3JA 4AXKA 3BLEA 2UZ9A 3V18A 4WSHA 1UQZA 3P84A 4HIBA 1GVQA 4GGHA 2PDNA 2HROA 3E49A 3M0MA 4NIRA 3CUJA 3W1XA 4MWAC 2XSBA 3QTGA 4JX6A 3S6OA 3ZT5A 1E4LA 3B0YA 1QO2A 3PPHA 4R34A 3DHDA 3QGVA 1W3TA 1R2SA 2OYLA 1W1PA 3M47A 4OKDA 3GH5A 3A4AA 3LUTA 4ZO9A 3CUZA 3PB2A 4PB5A 5I23A 2YDQA 3GXDA 3WQDA 4AY7A 4M80A 2QCMA 3GNDA 1DJXA 3E12A 1EDGA 3ZR6A 3TC7A 1R3WA 1H11A 3W7EA 1JYWA 4RE4A 1UWQA 2RJHA 4Q8TA 3SRDA 2XH4A 3KHDA 2OT0A 3EWDA 2LLEA 4MWAA 3C8NA 3GZ3A 2GSHA 1IGWA 4J3SA 1A3HA 3RU6A 2XIOA 4M6VA 1H50A 2GK1A 1JNEA 2E40A 3WUGA 1D3CA 2E5CA 4PEEA 2YL6A 1H61A 2IQDA 3B0XA 4GGBA 1R87A 1VCGA 3VNKA 1VC4A 5LIKX 2V2DA 1EEPA 4Q4PA 3STPA 4JN6A 3IGUA 2VGFA 3NIYA 4J4KA 2V67A 3DFTA 2F2HA 1OYCA 5J5RA 3CZLA 4IHCA 3O7UA 3TTQA 3W7IA 4MUPA 2XVLA 3C56A 4MNKA 4U28A 4JYFA 3PN8A 3YPIA 3OU8A 1BRLB 1VPQA 1KXTA 1JYNA 1EJWC 1A80A 1UG6A 3T4CA 2QAPA 1BWLA 2QMKA 4DNMA 4C6NA 5HUOA 4CD6A 3M1ZA 2WHLA 1JUKA 1ZTVA 2V38A 4U31A 4BQ4A 1C8YA 1R9ZA 4XBKA 1UMLA 4QITA 4KBXA 3LGEA 2DH3A 1DQWA 4ML9A 4FIRA 3LPFA 1POJA 3KTCA 4ASTA 4CGTA 5CC5A 4JTFA 2YW4A 3SCWA 3JRKA 2YPIA 1B5TA 4D72A 3INPA 1W17A 3SFKA 1K4GA 2ZZ3A 1GG1A 4EANA 3T2OA 1XLDA 2NX3A 5EMKA 4W7UA 3ZJ7A 1TMHA 2HPMA 3LCIA 4PMZA 4KRTA 5G1YA 2G3NA 1QUMA 3RCMA 4DELA 3OZYA 1EJUC 5J04A 3M43A 5DXYA 3ABOA 1TWSA 2PDKA 1BF2A 5D8WA 1U33A 4IX0A 3VFCA 1OIFA 2V3EA 5HJLA 2ZXDA 2PLKA 1F2JA 3OG2A 1NM9A 5G4EA 1ZP4A 4C6FA 4I5UA 3DC0A 4LBSA 4H9ZA 1E5JA 3NVDA 1E43A 3HPSA 1TTIA 5AYYA 3TYAA 4XK2A 3CWNA 2IMRA 4UR7A 2R14A 4DUOA 1V8EA 3PBUA 3ONCA 4TQTA 4MKNA 4MJ4A 1W8SA 2CLLA 1ZPTA 2ATSA 2OB3A 3PUDA 4BQ5A 1S1RA 3W7GA 4I9AA 4DPQA 1UZ4A 4LJ3A 2VC7A 2YL8A 4JBRA 3LK6A 1PO9A 1R2TA 1S2WA 1DIDA 1AH3A 1M01A 2Z24A 2PWVA 3FAWA 4H1ZA 2VCBA 2QKFA 1DL3A 3TC6A 1DJYA 3N2OA 3DENA 3SQLA 2YLLA 4QRNA 1UH3A 3GY1A 3KZPA 1OGBA 1OY0A 3URAA 2PDQA 5IXEA 3O15A 2VYOA 1P48A 4ZZ9A 2QVHA 5IBXC 3GIPA 3C0LA 3TX9A 3QFEA 2V9DA 1Q6GA 1A5UA 4JD4A 3A4WA 5BMWA 4BR1A 3FXYA 3VINA 2IPFA 5CSSA 3N2XA 2FDMA 2H9AA 2BOEX 4EF9A 3UPMA 4D6HA 1O7AA 1OFAA 1QK0A 4PUMA 1FWSA 3I6RA 3MUXA 2FFCA 5FF2A 1VBUA 3AIUA 3KCJA 4H8NA 4XZHA 3I7QA 1EIBA 1QU4A 5ABFB 1Q6LA 4LTSA 5LA1A 2GLKA 3CAVA 3OZPA 4B2DD 2FZBA 4EX4A 4LAMA 4U33A 1KFWA 3I3DA 4DX3A 3S6DA 1HF6A 3WEMA 1Q65A 2XVGA 4QSHA 3IV3A 1RA0A 3NEVA 3GK0A 3IVTA 4XSLA 4AH7A 3CZKA 1YXYA 4RUBA 1W0MA 1BVWA 5I3FA 1TUXA 3R7MA 4S3DA 2Y6ZA 2J7BA 2AMGA 3V4BA 3VU2A 3LBCA 3L5LA 3QR1A 4QE4A 1W5QA 3CGTA 3SM0A 2QGYA 2P1FA 4UWMA 1BGGA 4X2PA 5HNTA 3WFAA 5I24A 3ARPA 4R5EA 4LF1A 1QT1A 4HA4A 3TE9A 4GD0A 4JXCA 4AD5A 1CI1A 1W32A 1XIBA 4YVVA 4OWGA 1G4PA 1EIXA 4LRSA 4U2ZA 5ABHA 1P0BA 4WY0B 3GVWA 2QULA 3C86A 2WHJA 2JK2A 1HUVA 4IMEA 2W3ZA 2PTYA 2VEIA 3O0FA 3NYZA 3SUTA 1VCVA 4AUBA 2Y63A 3MKVA 4OE7A 2PTZA 4QM1A 3C0QA 1FY6A 3VGHA 1JZ2A 5HNNA 1L6FA 4N9BA 1ZP3A 5A2CA 2X0HA 4M19A 2P76A 4J28A 4AD4A 3QLDA 3UNTA 4J5NA 3IRDA 1YBQB 1FH8A 4NKCA 3H2NA 3KBSA 1F07A 1KCKA 2EPKX 3QTPA 2ZX6A 1AMYA 1XWYA 2I57A 1TZ9A 1ONRA 1ZB5A 2FLIA 3SY1A 3CPRA 2EKCA 3IJ9A 2I17A 4G7FA 5KZEA 2A3AA 2DIJA 3MA8A 1GVFA 3GFYA 1E0UA 3BL3A 3K8MA 3DHPA 2PGWA 4KS0A 1NDWA 5CSRA 1JCMP 4FOJA 5I07A 3UWWA 3MBFA 5A8OA 3MDWA 5CJMA 2ONEA 1XC4A 4Z42C 2BX7A 1NWTA 1TPUA 3VIIA 1NFGA 2OEMA 2NWSA 3E2SA 5FOOA 2PF0A 1P7TA 3OYXA 4EXBA 2A3CA 5FJUA 4GA8A 1K9EA 5C71A 3IRSA 2O9RA 4WY0F 4QE5A 1VQTA 4BEQA 1EGZA 1ME8A 4ATDA 1TPWA 3PHAA 2Q8LA 3WNMA 2PZ0A 2IPWA 1GGOA 2RFGA 3OB8A 1OK6A 3P14A 3ME3A 3LTYA 3E38A 1WZAA 4EIVA 5GJMA 4UTMA 2XH0A 5CPQA 3RF9A 2VFEA 4ATLA 2GZXA 1E73M 3UZZA 3CHCA 4K37A 4N0RA 1B4EA 4FR1A 1WQ5A 1L9WA 4XV0A 1KFBA 5C6MA 5BXTA 3ID7A 3VI2A 3PF3A 3VE9A 1VFFA 1V77A 3V16A 1UZDA 1EWDA 4TVCA 1CTNA 1M7XA 5FEWA 1OCJA 5HDRA 4WR3A 4X0VA 1X1ZA 3LPPA 3F4WA 4EPBC 4PRTA 1QOPA 2DW6A 2D24A 3BJSA 3CQIA 4MY8A 4PA8A 1W31A 1L6YA 1V93A 2QJGA 3TU9A 3N6HA 1YPXA 2CBVA 4YS1A 5EGRA 4LYRA 3EDDA 1WDRA 4C6QA 3G1AA 7TAAA 3CUHA 4DQWA 1W54A 1YTDA 3M7SA 3N4AA 3QR0A 3SQMA 4YYCA 5FF7A 2FPVA 1QI0A 3QQWA 2GQ3A 4CUCA 1KFCA 2I16A 1E0TA 3WNKA 1GJWA 1JFHA 2NQJA 4FLQA 1EOMA 1HW6A 4M82A 2HSAA 2ZXAA 4XO6A 3MC5A 4XD4A 1JZ7A 2Z2BA 1H7WA 4HMNA 4NF7A 1EA0A 2G95A 1AA1B 1JDAA 5D02A 2UWFA 1E5NA 4H9MA 5CC3A 2O7SA 3THCA 2G3MA 3H7RA 2J7EA 1L6WA 3P8IA 4WJ8A 3TCSA 5F1UA 3CPGA 3W6YA 2PPGA 3BC9A 3PP7A 3TTSA 1D9EA 1JRCA 3VMNA 1GT8A 1WB0A 5CKSA 3O9NA 3MPGA 3GFXA 4M7SA 4KWVA 1RVKA 3B8SA 1G7UA 2PDGA 1GOWA 3D3AA 1DHKA 3NSMA 3W2NA 3T1GA 3WQPA 3EWZA 3O63A 2YL5A 3IJ6A 4Q22A 4GZJA 3KBJA 5G1TA 4L1GA 1E9ZB 1EL3A 1LBMA 4Q4MA 4QP0A 3DFPA 3SIZA 1CLXA 2Q3OA 4PULA 2J8GA 4ZOCA 2QUNA 4WVXA 4FA3A 4PL1A 2CNCA 5A8MA 4TUFA 3T42A 4GFSA 1K7EA 4NX5A 1UR3M 3HTWA 3QKZA 4K7VA 2WM0A 2OSYA 4UB9A 4KW2A 1WZLA 1ZALA 2Y7FA 1TVLA 1J0JA 3EMZA 2QF8A 3JU2A 3V5OA 3M0IA 2Y89A 3WH7A 3KEHA 3H4XA 4JFUA 2FZMA 1VEPA 2OO0A 2PODA 1ITCA 3T81A 3UCQA 4ZBCA 2FJKA 1PPIA 3THQA 2P8CA 1I2OA 3BLLA 4IP4A 5FESA 4FK9A 4KETA 1CGWA 1TJPA 1PZ2A 4C5YA 3WLKX 4M56A 1T40A 2EPNA 2OKOA 1TPDA 3A21A 4UQ9A 3T8QA 1B2YA 2OFJA 3DFSA 2MUCA 1DTUA 4D1IA 3THAA 3UERA 4MPQA 2CCRA 4H83A 5HWNA 4W84A 1V03A 4DUVA 5CZJA 4M5PA 4K68A 5A6BD 1X97A 3PULA 1NDZA 2W0UA 4PUKA 4JQ4A 4GUJA 2AL1A 1HKVA 3QYSA 4UFIA 1UC5A 1YDVA 3J7HA 1XLLA 3TQKA 3WJXA 3APYA 1XHGA 1K3UA 1SSGA 3QGKC 4H9TA 3HB9A 2D22A 4FB7A 3BMXA 5EMLA 3WDJA 4ERAA 1EKOA 2BMBA 3UT0A 3NZPA 2X1SA 3WD4A 2ZZ1A 3GBEA 4S3FA 4K36A 4HU3A 1WP6A 4AD0A 2VDHA 1UKOA 3Q58A 4BF9A 5DY3A 4DIAA 3W02A 1VB9A 1EX5A 3H4WA 1K77A 4PZVA 5HNUA 5IDZA 2ZFAA 2DY3A 4IT1A 9XIMA 3RM8A 1BG4A 1EC8A 4GC4A 3GDKA 1M65A 2PDFA 1AJ2A 3TLLA 6PTDA 3APTA 4GQQA 3V1HA 3WK2A 1MQQA 3VOGA 3F03K 3I4EA 1WOBA 1MXSA 5AC7A 1QBBA 2ZA3A 3PZTA 3R58A 1JGMA 4IICA 2G37A 4Z1CA 1WAUA 1GORA 2QUMA 3W7CA 1UWTA 5LNVA 3GAKA 4QQUA 4B5TA 4ADSA 2R1LA 3MKKA 4R27A 1UJQA 3LV6A 1ZAHA 3UGRA 2BB0A 4DZHA 4NZFA 3SY5A 5IHRA 2H8ZA 3G8RA 2CITA 3BG3A 3IIPA 1MNZA 4C65A 4UTUA 3M5ZA 2HZGA 3WUFA 4YU1A 2HWGA 3I6EA 5FD0A 4NL1A 1U1JA 1OJXA 2VL4A 2E9LA 5F4SA 4ECLA 1E4IA 2W5FA 1W1VA 4ZXLA 3G5EA 2A4AA 4O17A 1E3XA 3N14A 3AXMA 1R85A 3Q94A 1GTHA 4AIOA 3QZAA 2WVUA 2E25A 4MGGA 2VGIA 1V51A 4P8VA 2CYGA 4FMVA 3CTLA 2C19A 3I65A 5IFPA 1V79A 1RXOB 3W1TA 1W9UA 1JULA 1CLKA 3ARTA 4UR8A 3DYOA 4JAWA 1H5VA 1GG0A 3EGJA 4KPLA 2E09A 1LG1A 4AVOA 1JCJA 2XVKA 3C2VA 1J11A 1HQTA 9XIAA 2C14A 5H8UA 3UA4A 3AMGA 3PZUA 4H6KA 2HNHA 3URQA 5HINA 4DF1A 1GZ1A 3W37A 1WOAA 2W67A 3ZJKA 2QCCA 4JR5A 1ISVA 3B0UX 2Z00A 2G96A 5HBFA 5I2UA 1V6YA 1YIXA 5CXPA 3CUFA 3R2GA 3S2JA 3AS0A 1T8XA 4CQBA 3TJ4A 2RKXA 1C29A 3BSMA 4FP1A 4AYSA 5CCZA 3BW4A 3VILA 3QY7A 1CXFA 1CENA 3WMLA 3PUOA 3XISA 3QY8A 2PFHA 3OIHA 1OX4A 3W85A 4B92A 3O05A 4MWAB 1LL6A 2X16A 1J12A 1B9BA 1OFDA 2C13A 3EA3A 1JDDA 2GK1B 1AG1O 4JTLA 5M03A 4XTIA 2QUTA 3C3UA 2WYSA 3GRIA 1SQ7A 3NPWA 4JTTA 2OQLA 1EJTC 2P3ZA 4UFLA 3ZVHA 4NP7A 1NOUA 3C8FA 4CQAA 3NQEA 3VO0A 4Z1BA 1GONA 2AOSA 3QSRA 1ZCOA 4L1WA 3AHXA 2PDHA 3USBA 1SPQA 3Q45A 4PTMA 2AAMA 4MY9A 5HOSA 2G0WA 4WXYA 3RX2A 3AO0A 2YCJA 3N13A 2BNJA 2QJJA 1S46A 3IARA 3KL3A 1VZWA 1ZUAX 2D23A 4OUEA 3G0XA 1GQKA 3W2LA 3N6QA 4QDWA 4OOUA 2VUNA 4HJWA 2DZVA 5IM51 3T0DA 2HTMA 3COTA 3NL3A 4A35A 1IXNA 4QSFA 5FEXA 5LGXA 3AISA 1DJQA 4TVDA 3ZT7A 5E9XA 3LMZA 3STFA 3CASA 4PMYA 2ABBA 3GKFA 4RJEA 2GSJA 4NXSA 3WLMA 4G2DA 3ZSTA 1DJGA 1XYAA 3RFAA 1ENUA 2XFRA 1GQIA 1HKMA 3WJSA 3NXFA 3CLMA 3OIXA 4FLSA 3QMRA 4EK7A 1WKDA 4N4PA 4PFHA 3R5EA 3WK3A 1HL9A 5TD4A 2J88A 1W5NA 4ZA0A 1ZBKA 2WAGA 4HNNA 3LRMA 1SYTA 3MCOA 4PC8A 5D9MA 2NXIA 4QJ4B 2WLYA 2ZUNA 1QO5A 2XIBA 4R9XA 3LNPA 4RNJA 1ZS2A 3AC0A 2Z6IA 3GW3A 2W91A 4I6KA 3AIVA 2F2KA 3S42A 4LRTA 4AD1A 3FYOA 3L67A 4Q6JA 2VT0A 4FZIA 1P5BA 2P53A 3P80A 2YIHA 3LX9A 3GU9A 3CMJA 3WF4A 1RA5A 1VYRA 1DWHM 3R12A 4Y6GA 1M1BA 3UR7A 4EOUA 4Q4OA 2WB5A 3T07A 1RPXA 4U4MA 4GO9A 1J0KA 4O0KA 2A3EA 4ICCX 2W63A 4QR6A 2DZWA 1CB2A 4V15A 2CESA 4CD5A 1W3IA 3WD3A 2BVWA 4AG0A 3WD1A 2VX7A 1E9IA 3TXZA 4AEFA 3SY8A 2CBJA 3GNPA 3GD6A 2HMCA 4PB4A 3HMJG 3N9RA 2NSOA 1DVJA 2ZE0A 5T8GA 1Q7QA 4DJEC 4P7QA 3LERA 5BU6A 5AYZA 1R38A 1NFPA 1XH1A 4LAZA 3MB9A 5E70A 3LTPA 2NXGA 3SCTA 4CNTA 3ARYA 2F8QA 4O18A 2QV4A 4LOCA 3WQ5A 3TSBA 1BQGA 3OHIA 3QMTA 1PHQA 1XYZA 3B9AA 3IANA 1M7OA 4TX6A 4Z2JA 4GBUA 1BFNA 3W25A 4XZBA 3WL1A 2QCGA 3SRKA 2C3ZA 1UP0A 3FOKA 3CIWA 1XR2A 2BODX 3TDFA 1VFHA 3P8JA 5BZAA 3GAYA 1HVXA 1IEXA 4S1FA 1EP2A 1FWGC 5A69A 5GPRA 4GUGA 2KAUC 4R9OA 3ARXA 3QQ0A 4MAVA 3P6LA 2D0FA 1XFBA 1AFSA 4RPPA 1TWZA 1A0CA 4JQ1A 1J0ZA 3NM1A 4O0ZA 1QW8A 2VXNA 1LLWA 2J7GA 4RW5A 5DMYA 4KESA 4GBDA 3A24A 3G1VA 2ALRA 1LCOA 3GC2A 4RZ5A 3Q2DA 4LT9A 4YWSA 2OCZA 2H9AB 3WQFA 4CLMA 3G2GA 3UJFA 4S2CA 4KH2A 1UOKA 5I6SA 4W86A 3WENA 4X9SA 3HGSA 1TTJA 3AS1A 1EWEA 2NLYA 1PS9A 1W1YA 1ELSA 3TK7A 3K46A 4D8LA 4FLOA 1FHUA 1MUWA 1ISYA 3JZUA 5SWUA 1RR2A 1VD6A 5REQA 2D0HA 2EGZA 3LCHA 1E0WA 4O8RA 4ZOBA 4QISA 2XVPA 5CPSA 1XBVA 2UBPC 2C79A 3TW6A 2A0NA 1O12A 3PZOA 2V68A 5C9UA 2JKAA 1FWCC 2Y1HA 3T7VA 1XG3A 3LHYA 3TWAA 1HX0A 4FLRA 4Z17A 1O1ZA 3CEPA 4NG3A 4HSNA 4ACYA 2CPUA 2WM1A 3GXMA 2Y7EA 3AXHA 3ZM8A 1KBJA 4IP7A 1R3TA 4DBWA 4GZIA 3KWSA 3TLQA 1H7PA 3M16A 3DXIA 4DJED 4J9JA 4OJYA 4GNVA 3WUBA 4AC1X 3QPEA 1E56A 4JFVA 2H8XA 1YHTA 5DRIA 2AQWA 4JPGA 1D3GA 1B3YA 4IOTA 1HFBA 1F8IA 3U7VA 1QW9A 3S1WA 1TVPA 4F0MA 4M6UA 3G1YA 3LCGA 3AYTA 2EO7A 2V5LA 3GYCA 1W1A1 3AXKA 2PBGA 3ABXA 3S9IA 3FYPA 3EA1A 3UZXA 4Y9NA 4HPHA 4LAUA 4QDMA 1FH7A 3SJNA 2CW6A 3LXCA 4RV8A 1XCFA 3WQ6A 2H6RA 1HVQA 2QPXA 3QC0A 3LG3A 1DQXA 3TZFA 3MMDA 2ZZ4A 3E6EA 4O1BA 2B7NA 3KW3A 1I1WA 3HV9A 1HTIA 8TIMA 1WPCA 3AYRA 1XLFA 4LFYA 4NZ1A 1TB3A 2C0AA 3B8IA 2Y5JA 4R33A 4C6LA 1QNRA 4O1FA 4PODA 5AC8A 4ILSA 4ES4A 1W3JA 3VAVA 1AODA 3K8LA 1VP5A 3GR4A 4XAYA 1M7PA 2DZAA 2NX1A 1Z48A 2WOQA 4PMOA 2ZX5A 2JQXA 3BK0A 3P93A 4B5WA 3S3GA 3N3MA 2W61A 3S0CA 3PJXA 4FALA 3BOXA 4GYKA 4R7OA 1XFCA 2PTWA 3IJ8A 4K6AA 1QNOA 3H54A 4AZGA 2HDJA 1E1CA 3MZNA 1ZY9A 2NVCA 4B4FA 1QWKA 4HNTA 1U1UA 1XX1A 3A5FA 7REQA 4FSAA 1SO4A 4CQ9A 1O66A 2EPMX 3QZEA 2CERA 5G5IA 4XD6A 1FOBA 3M41A 4NAEA 1F5ZA 1K8CA 4E2BA 3I3BA 3LBOA 3NPUA 4L64A 7CGTA 2FFIA 5AECA 2WNNA 4OV9A 5HNRA 3WMCA 4RXFA 1KM0A 2EF9A 1BVNP 1K9DA 1GW9A 4FXJA 3E02A 2PU0A 2WJEA 1FWRA 2WJDA 3DOPA 4JX4A 2PAJA 1EO7A 3VD3A 3W81A 4JFWA 3VIJA 1E9YB 1KW1A 2QCDA 2GSEA 1ZSXA 2GGJA 3WBAA 3KP1A 5DQPA 3PWAA 1EH9A 4QEEA 2X8RA 5LHFA 1W3LA 2WC4A 2HCVA 3B9OA 1R3YA 2V63A 3UR8A 1LOQA 2WSQA 3ORWA 4UFKA 1A5CA 3JS3A 4H7CA 1J0IA 4HCLA 2JIEA 2VDGA 2WQDA 3GQYA 3IEBA 2CWNA 2ZUVA 4FX7A 1SJAA 1XIMA 1XSJA 3CJPA 4ZOEA 3OLEA 2IW0A 4TMCA 1EZWA 4GQRA 4HK5A 3LHUA 1T5AA 3UPWA 3TA9A 4LBRA 4YXGA 3GXNA 3L2IA 2E6YA 1WZKA 2BXVA 1DEDA 1F61A 1OFPA 2IQ0A 3S4TA 2V3DA 4QEHA 1EB3A 1KXVA 4D2JA 2R24A 3HG2A 3S1UA 1QBAA 2OZ3A 1ISXA 3CAKA 1PAMA 1Z8AA 1ZBVA 2DJXA 2VURA 3K1DA 1Q2SA 1RV8A 3UGVA 1J10A 1EGVA 2JGQA 1UIOA 3EX2A 4KEUA 4DLFA 2ZE3A 4L61A 1UR2A 5TIMA 4MOZA 5DCEA 2RDTA 1ECQA 4A3YA 5CGTA 4E2VA 3W1QA 3CM4A 1CX9A 5E09A 3DYPA 3LQGA 4V2XA 1XKYA 5HULA 3FYYA 1ONXA 3L4UA 4HJFA 1SU5A 3N4FA 2DZTA 4O1CA 1H3GA 4Z2IA 5I3IA 3GG8A 4HA1A 3RRXA 3EWXA 3NUKA 5A6MA 4IISA 4GIYA 4LY8A 1EOKA 2B7PA 1D3HA 2YR1A 4TR9A 4J3VA 2X42A 2CKSA 3KTXA 1KFKA 2NUYA 2XZ9A 3IWPA 4G56A 1A0DA 2CHRA 1X8FA 4RZBA 1MZRA 2DPEA 3ZIZA 3VGGA 4Y9AA 4Q8PA 4D9PA 2AGKA 1TFVA 4Q4RA 3SGUA 4W93A 3VCNA 3ZLFA 3I6TA 1H0GA 3PZMA 4W8LA 2PDIA 1RSCA 4KGLA 4QJ5B 3QW3A 5CSYA 1KWKA 2WO5A 1XXXA 4GISA 1XBZA 2E7FA 3NCOA 1MVYA 4Q7BA 3CTTA 1I4NA 4LY4A 2ABAA 3LDVA 4NXKA 3TV8A 4HTYA 1TR9A 3UWYA 4PUUA 3G1DA 1LM1A 4O14A 3TN3A 3FJ6A 2WPGA 3M0YA 4WUIA 5CZTA 1UD6A 2C6QA 1H7RA 4HOXA 1E6PA 4D8ZA 5DBTA 3WQWA 3FS2A 1ADSA 1FDYA 1UJPA 1B3OA 2BY2A 1QHPA 4MUZA 3T40A 1X39A 1YE6A 3D3FA 2OLHA 1H7NA 1J18A 2G4FA 3AICA 3A13A 3WBEA 4FNUA 5BOEA 2Y85A 3ZWSA 4QIUA 4XBJA 2GUYA 2XIJA 1ITQA 1UZHA 2Z1SA 2YSWA 4M8UA 1KXQA 2Z2UA 5FACA 2VVSA 3U4AA 4IMAA 1H49A 3GDRA 5TNVA 1Q4WA 3B8VA 1ZLPA 4GZEA 2J8FA 5CBBA 3PJUA 1PTGA 3ARUA 3UFYA 1XRTA 4NZJA 5LIYX 2NZLA 3LV5A 4ZO6A 1XISA 2WJZA 3FAXA 4P7LA 1DXFA 1YEYA 1ZGDA 3KRBA 4JTUA 3A9BA 3W6LA 1QK2A 2QDEA 3CHFA 3RK8A 3U48A 4WDUA 3MZ2A 4IFKA 4KCWA 3GVGA 2DFAA 5C9ZA 1KRBC 2WVVA 2HVMA 4PTDA 3VGBA 3ZQ9A 3OBKA 4ROPA 4E8GA 3MUZ1 3SURA 3OVQA 3DFHA 1YTKA 1I45A 1JQVA 2XPKA 1XDJA 4DNHA 3IJIA 5HMDA 1JG9A 4MJ2A 1ECEA 4AIBA 3OYZA 2NLIA 1J0YA 1WYIA 1N8IA 3GU1A 5U7SA 4MZ1A 4MB1A 3AWNA 4NJJA 2VI0A 2Z7GA 3W27A 1NY1A 2VC6A 3VGEA 5BW6A 2YBVA 3UXKA 1Q63A 1EHAA 4XWUA 4GX8A 3S1VA 1FHVA 1BWKA 2Y7DA 1A53A 4XB3A 2MNRA 3LHTA 3FJ4A 2HV5A 3T9PA 5HJXA 5HWMA 3CWOX 3EKLA 1HL2A 1Q45A 1KTCA 3N12A 4NZ5A 2ZWZA 3W1UA 2PD5A 4K8GA 4ERIA 3FHQA 1SW0A 2PRLA 3DI0A 5DMLA 1MZHA 5FF3A 1SM9A 1VKFA 1TPC1 4DWSC 2BP1A 4A3HA 2OPJA 1JZ3A 1W6TA 3WF2A 2XM2A 4GIRA 4HHMA 1Z42A 1PCWA 5LNSA 2HQAA 3M46A 1ICPA 4U2YA 1H1NA 3PTDA 1JF6A 2POZA 1B9ZA 1UKQA 4JICA 3SGGA 3TYCA 2Y7GA 2Y2WA 3GE7A 5RUBA 2V30A 3FDGA 2PP0A 1F3EA 3NTYA 2ACSA 1SZFA 4LUSA 1PWMA 3UW6A 1WCGA 3EOSA 4JHMA 2GGEA 3O16A 1SR0A 4WHBA 4H9YA 5F2MA 3SN1A 1TV2A 4UNLA 4WKAA 3B8WA 4EKJA 1VHNA 1Y65A 4L65A 1PYMA 4DAFA 1DXEA 4FX6M 2CLIA 1XI3A 4GZ7A 1FXQA 1V0MA 3V3WA 5LXEA 3UJEA 2F6XA 2QIWA 3E2RA 4H9VA 5H1WA 4QCFA 4G1NA 1Z69A 3P5ZA 4XISA 4HSOA 4F48A 3S6TA 6REQB 2CZVA 3W82A 2XWDA 3DC8A 3M0KA 3PR2A 4ZB0A 3H55A 4ZQMA 3N15A 3DGBA 4Y2WA 1RCQA 1EQPA 1J93A 1EEXA 3FHAA 2PLMA 2W6RA 3RX4A 2UY4A 3P3BA 1VPYA 1REQB 1WKEA 1F05A 4LEFA 3FXGA 4REQA 3G6MA 2FGLA 1XCWA 1KKOA 1Q7MA 1JCXA 2I5IA 4N9DA 4CCCA 5D4YA 3N11A 3A22A 1AVAA 1B3WA 1V3MA 1PCKA 1Z3NA 2GJPA 3W1NA 1M6JA 2O4MA 1TSIA 3LCXA 3LZ3A 2XIQA 3OVRA 1NIUA 4PUEA 1P0KA 1X8CA 3NNTA 3C2EA 3DEQA 3TTOA 2XFYA 1R0MA 2PCQA 2CHOA 3CB3A 3HV8A 3MVTA 1UKTA 5T9BG 1OX4B 4GYJA 5G2HA 1HKKA 2PTDA 3QPZA 1ZBCA 2Z25A 1CGUA 5PTDA 3BQ6A 1P1MA 4A8LA 3N4EA 4TIMA 3IGXA 1TV5A 3H21A 1QNQA 4JN7A 3HJZA 1KFEA 2H90A 4DWSD 3THDA 2Y70A 3T09A 2KZHA 3PNZA 2DW7A 2F9RA 2ZCGA 3E9AA 1RLDA 4R53A 3WLQA 3K30A 3W1RA 3WLOA 1U5VA 1E70M 4WRHA 4GC3A 1GVSA 1M68A 5A94A 1Q6OA 4A22A 2BTMA 2YLAA 5DO8A 4WGXA 3PWGA 1ISWA 3CZJA 5FJOA 3QC3A 1L2UA 1EJRC 1FBAA 3AWOA 2YA1A 3WBXA 3BGJA 2WCAA 1TQXA 3THUA 4G5DA 3EX4A 5ECUA 3CHEA 1I6NA 1HKWA 3UP8A 1GTEA 4GYPC 4M1RA 3K8KA 4YCOA 1US3A 2RHGA 5G4WA 5G2IA 4K1GA 4WZHA 5C8BB 1M5WA 3PTMA 3T6CA 4D6IA 3BW3A 7XIMA 3CAQA 1F74A 4F79A 4PTWA 1FHDA 1UR8A 3GWQA 2WBKA 3LRLA 3PBMA 2VUYA 4WGHA 4A05A 3GH4A 2WMIA 1C9DA 4NZ3A 3SI9A 2X1RA 1Q8JA 4QTGA 2D3NA 4JX5A 2A21A 3RGTA 3WBYA 2PE4A 1B4KA 4HPNA 2O55A 4IXHA 3BH4A 3GDBA 4D71A 4MB4A 2CFFA 4LC6A 1LL4A 1RJPA 2FTYA 1K7FA 2QJHA 2ZWYA 1QATA 4FXFA 4HYRA 2GGIA 2V8ZA 4RNHA 3UWUA 1LLOA 3GH7A 4ZCWA 3NFUA 1OCNA 3KFTA 3MO4A 2UY3A 2X7VA 3M0VA 3W7MA 1HNYA 2JIWA 1I1XA 4OZOA 3CHVA 3S5OA 4H9UA 4S3JA 2VD8A 4CN1A 1L2QA 1XRSA 4C60A 2QW5A 4ZXOA 3OGSA 2V81A 1DKWA 3F1QA 3W73A 3QR3A 3W83A 1OB0A 1KRCC 4MJZA 3TNOA 4L4LA 3VOJA 5EU9A 1H63A 2XVNA 2O56A 3KOWA 1UOZA 1RD5A 2ZC1A 1SZNA 4ZB5A 4IJRA 1Z89A 4PCSA 2AAAA 2ZYFA 3LSCA 3WH9A 3GTFA 2E1WA 3BV7A 4RNIA 2GUUA 5DX7A 3QGAC 4S3CA 2P0OA 1VFTA 1YX1A 5I3GA 1YXDA 2AQVA 1Y7VA 1PL9A 3SSJA 3AFBA 4EPDC 2QCNA 1GVIA 1YRRA 1QDSA 3WLRA 1IZCA 3WN6A 3V36A 1Q6EA 5KZMA 3UXAA 4WQ6A 1BHGA 3FEQA 4D6EA 4ZL1A 5HAOA 4B9ZA 2UY2A 1BG9A 3L2LA 3NAVA 2WMHA 1PV8A 1OF6A 1YNPA 4DB7A 1VRDA 4GXPA 2V2HA 1PDYA 4LAKA 5J8LA 1DJIA 4LUYA 2PDJA 3S1GA 1EUNA 1XYBA 1JUBA 3CMGA 3EWCA 5XINA 2C91A 7TIMA 1DJZA 3WD2A 3GO2A 3DYMA 4ZQNA 4JIEA 1MDLA 1NJJA 3WSUA 5EMUA 1C93A 2GYIA 4US5D 2QQ6A 1C90A 4KFPA 3QY6A 2ZZ2A 3CUXA 3UXLA 2VRJA 4IQDA 4I6VA 4L7ZA 3UPBA 3RXZA 3GR8A 3S9YA 4QG9A 3WLTA 4K1WA 1XSKA 2VWTA 1OG0A 4IUGA 3W7KA 4GNKB 4XAFA 2X30A 3OBAA 4PBGA 2FH8A 4MB5A 3II1A 4EAYA 5H91A 1SFLA 4B3ZA 1UBPC 4ZTXA 4MNMA 3VZXA 2NQ5A 4IGNA 5K4ZA 3MSYA 1TA3A 4W8BA 4IMCA 1KBKA 3WQVA 1MRQA 1XGZA 4WIWA 3FKKA 3G1SA 1FWJC 4P8XA 3OLIA 3GM8A 1H41A 4E8DA 2WSPA 1TZ7A 2DZXA 3HBLA 3I68A 4G1KA 4GCAA 3LPOA 1AMKA 2PU1A 4BS0A 3W7LA 5BNKA 3KBNA 1A5BA 2WKLA 4JEQA 1QCWA 3ATYA 5JUVA 1ZZMA 1XLKA 4YTSA 1LQ2A 4PMXA 1E4MM 1XG4A 3MY9A 4JL1A 3BCDA 1BEUA 2G3IA 1R7AA 2G3JA 2B0MA 4AZ5A 4L56A 1ZU8A 1XLHA 4E4FA 4Q7IA 1VR6A 3VNJA 1KLZA 1UB3A 2E6DA 4XZMX 5CZKA 3HO8A 6XIMA 5EA9A 1DE6A 3KVKA 3LCWA 3O6YX 4LVGA 5M2FX 5L6UA 1GOMA 1TKKA 4BA0A 3FGCB 1NEYA 3NJ3A 3Q65A 1KCZA 2XG9A 1VFLA 5H2ZA 2VFGA 4O57A 4MVAA 5BXSA 4H8VA 4RDVA 1NQ6A 3LA4A 2NUXA 1M04A 3KS5A 1KXHA 1FWDC 1MFVA 5CZSA 4EAMA 4RR4A 3ZVIA 1Q6DA 1KD0A 2Q8ZA 2DSWA 3B9DA 3M5XA 1X7IA 3PB0A 4DY1A 3TTYA 3UJSA 3VPLA 2GQ8A 5FSEC 3BPWA 3TH6A 3DBPA 3TJXA 4HZ8A 1RK5A 3OW1A 2IS7A 1MUMA 1YE4A 4Z0JA 3TQ0A 3N17A 5IRPA 1V08A 3WFZA 1Z32X 1E1CB 1QW7A 4HYWA 2QF7A 2WCGA 2A6NA 1CWYA 1B3XA 3LHZA 1U5JA 3VABA 3G3MA 2FZDA 1T6MA 4IH3A 4LB4A 1NF0A 4NAEB 4CQCA 3FJLA 2BVYA 3NQFA 2PP1A 4H7VA 1H0IA 4KEVA 1M03A 3BLDA 4B5VA 5F1VA 3MCMA 3UVIA 5T9CE 4ZODA 4LCRA 5FL0A 5A6SA 1TIWA 2AL2A 1G67A 3UWZA 4P8WA 1BSIA 3R8GA 3OO2A 2YOCA 3BAYA 4YLWA 1BSLA 3KS6A 4M51A 2QPSA 4Y9MA 1E6XM 4EWJA 1FH9A 1IWBA 2VX6A 3H70A 3TP4A 1A4MA 2V82A 1BYDA 2I1OA 1AD4A 3AJXA 3ITOA 1QPQA 4AY1A 2XGZA 1Y8BA 4ZSTA 4I5RA 1K6AA 4F40A 1KFLA 1KLYA 2HK0A 1A5SA 2Y4SA 3MYOA 1EP1A 1R3SA 5D04C 2JFEX 2CKRA 2YXGA 5JXQA 1PKLA 1OABA 1RBOB 2GGHA 1XLJA 1V02A 4AFYA 4YN5A 3MP4A 2JBMA 4Z0SA 1ZAIA 4ROQA 5HR6A 4MDPA 4W88A 2WNQA 3AOFA 4E2OA 1UW9A 3FY1A 4F4RA 3VFLA 4PB3A 1S1PA 4PL2A 4AWTA 5U4NA 4JS3A 1AZ1A 1WA3A 4JYEA 1AD1A 3ITCA 3VD4A 4LVBA 3VKAA 4IL0A 5FI8A 4MADA 3D46A 4NAFA 1NELA 4G9PA 2X1UA 1XL9A 2WLZA 3ZYZA 1SJDA 5JU6A 1IEQA 2PF8A 3AHVA 5DCDA 2WK2A 3M9YA 4LEQA 3NGFA 2YCLA 3PTKA 5H8MA 3L4TA 1TV8A 2GVGA 2RAGA 3KM8A 5CGQA 1K8YA 1E0XA 3NQ7A 4XQ6A 2FYMA 4FOUA 5A8GA 1BXBA 3QM3A 1XLEA 2VEKA 4AD2A 4ACZA 3AHYA 1ZNNA 5FJJA 3IVUA 3ZO9A 2GJXA 3TC3A 4AX7A 1CEOA 1VFUA 3QOMA 4GYFA 4CU6A 4BWLC 1GVOA 4K7YA 3RLVA 1D8CA 1XS2A 2A7NA 4BEUA 1XGDA 5LIWX 1VH7A 2TRSA 1J6PA 3GVVA 1ZL1A 3B4UA 4LUTA 1GJPA 5E6ZA 1SVDA 1H2JA 3LY0A 1B3ZA 3W84A 1GHRA 2XDFA 4IG2A 3FV9A 1HG3A 5CG0A 4DPPA 3KHJA 2R94A 4XZLX 4MFEA 5JQ9A 2E0PA 4NNBA 3P61A 1BVZA 3W6MA 4BWLA 3DX5A 4PBFA 1P6WA 1T8QA 3CL8A 2A3LA 3D5HA 2GQ9A 2V5KA 3IAQA 4ZO8A 4ZE5A 1XBXA 2GOUA 5JMUA 4S39A 1BTCA 3CQJA 4YTUA 5EFFA 2WW5A 3GZAA 3LGGA 4UQAA 4LH8A 3W00A 3SQSA 3STEA 1MEWA 4LANA 1OM0A 4UOQA 2HVOA 3ARZA 2XSAA 3AJ7A 4WKFA 3TA6A 1BYBA 1GCYA 4UQCA 1IZJA 2XINA 3LOTA 4GWEA 1DWIM 3MI2A 3SN0A 3W53A 3MUY1 1JYVA 4PCNA 3U5UA 5JBFA 1W3NA 2E68A 3HFYA 1VGAA 1VFSA 2OT1A 4P8UA 3CYVA 3FNDA 1ESWA 1ITUA 3GKAA 4LS0A 5B7YA 3W29A 4F0SA 4GI6A 4QG8A 1OCBA 3KXQA 2WKGA 2QDGA 1QOXA 3VXGA 3TXVA 3FK4A 4JDYA 7A3HA 3KOFA 3BG5A 4POCA 2WHKA 2ODOA 1OWQA 4IFKB 2PC4A 1BPLB 5A1AA 4NUWA 1VYSX 4MFDA 2WVVB 1C7SA 5FSDC 3LLDA 1OG6A 1FWNA 1NWSA 1NQKA 3EXTA 4WCJA 3RM9A 1XKJA 1E55A 2IXVA 4C6CA 2Q6ZA 1LORA 3AMLA 2POTA 4H8HA 3QMSA 1TCDA 1EYEA 1TRDA 1O60A 3R0DA 2TMDA 1WBHA 1QI3A 3RPTA 1VCFA 3W1AA 5D38A 2PMQA 2FDSA 2YGYA 3EOEA 1J96A 1YDOA 4GY0A 5D33A 2ZA2A 2FVKA 1RQHA 2FMOA 3C0JA 4KCVA 5FJPA 3VGFA 4UTTC 2WVTA 4GKLA 3TZNA 2E8ZA 1QOQA 3EX6A 5T26A 2FHCA 3W23A 3ABRA 3FA5A 2TAAA 3W1PA 3OPSA 1IIGA 3SCQA 4P7RA 3PBGA 1O5XA 1H1YA 1GQJA 2NVDA 4A8NA 2Y8VA 4HNVA 5GNYA 1H51A 4F3HA 2BGSA 2BY3A 2OU4A 5KETA 3ABSA 5D2XA 1V4YA 5KSWA 2ZUTA 1SMAA 3JZEA 5FA5A 1XW8A 3TMQA 3DFYA 2KX9A 4IMFA 1UMYA 3NEHA 1UA7A 4UTTA 4IJBA 1A3WA 2Q3RA 4IF2A 2Y5EA 3MQTA 1UD2A 4RXGA 3IS4A 2H3BA 4UMAA 1RY8A 2P10A 2X0YA 2VKZG 2NWRA 3TR9A 3CV7A 2OXNA 2WKJA 4FAMA 1XIHA 1XF0A 3DN5A 4N9EA 3UZWA 1JPMA 2CLOA 5FAJA 4DWSB 2ZADA 1TPH1 4GUIA 2J25A 3GS6A 1SFSA 4MKSA 2QNEA 3HFTA 3LQLA 4DF0A 4HK6A 3UR5A 4IGMA 1QI4A 1MYRA 5F4XA 4OGZA 3EAUA 3PAJA 4GI4A 4E5TA 3ITVA 3FJNA 4MWAE 2VQUA 4W5UA 3SAZA 1UP3A 3GIQA 1SUXA 1V6XA 1BKHA 3NSNA 1GKRA 6ENLA 3DKLA 2FJUB 3KE0A 3ITGA 4FF5A 2YBTA 3Q67A 1J2WA 4MWAD 4UTWC 1LYXA 1S5MA 4EACA 3C2YA 3C4UA 1LF1A 4C6KA 3VNZA 2E5DA 1G94A 4REQB 2ZXQA 5C2CA 4HOWA 1RHCA 3UR2A 1UWUA 1XD0A 2GVEA 4DJDC 3F4NA 3EBVA 1GQNA 3T0CA 2WZHA 3AHTA 4PH6A 2E9MA 4E8CA 3TCEA 4PEKA 5C70A 2A3HA 1W3KA 4GRSA 4BK9A 2Y8KA 2FZ8A 3HQOA 3WLNA 1EO5A 4JTGA 3ALFA 8RUCA 2OMAA 3VNIA 4L6OA 5LIXX 2D20A 3EPOA 5AVNA 4UTWA 1RUSA 1FWAC 1ONWA 3L2MA 1UROA 2R8WA 1BRLA 1L6GA