3LHVA

Crystal structure of the mutant v182a.i199a.v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAAIAGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 84
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhvA00
3R13A 4O11A 4S1FA 4LT9A 3WJWA 3W1QA 3M41A 3UXDA 6ALDA 2WNQA 3NZ1A 3HG2A 2V2CA 3TR2A 1YXYA 4KFPA 3G22A 2B7NA 4MVAA 1I2NA 4C1LA 3PB2A 1TV8A 4NX0A 1AMKA 1QPQA 2WJZA 3PAJA 3IVSA 2A2IA 5FF7A 4LRTA 2FFCA 2FIQA 3FIGA 1VYPX 5K7JA 5AYZA 4O8RA 3RNDA 1EX5A 3FKKA 1FQ0A 4HNUA 1U83A 4Z1AA 1L6SA 3S0CA 4OU1A 3NL6A 1MEIA 4BI7A 3BG5A 3PSWA 4XKYA 4WOQA 5AC8A 1RVGA 4ZQOA 1SFJA 3L0NA 4KFNA 4Q4KA 3PF3A 3W1UA 3GDRA 2QJHA 4O1AA 3T7VA 2YZRA 1EUNA 3W2UA 2ISSA 3L65A 1ME7A 3NQ7A 5E1QA 3LRLA 1T8XA 3HJZA 3DFOA 1TYGA 2C6QA 4PCFA 4POCA 1TPVA 3L21A 1YTDA 3NPUA 5FEPA 3TKFA 1YDOA 5EKYA 1K7FA 2F7FA 4PL2A 4JTLA 5HMSA 5IBXC 3QMSA 1XBVA 3W70A 1IIGA 2QUTA 1FBAA 1EPXA 1SW7A 3UQNA 3R5EA 2QEZA 4PC8A 1OX4A 4QNEA 1IXOA 4ZZ9A 4O13A 2NX9A 3W1PA 4FX6M 2R91A 3UZJA 3G24A 1TV5A 3W7NA 1LYXA 4UFJA 1QOQA 1LRNA 1I45A 3F1QA 2AQWA 2I14A 4K37A 1KM5A 5AHEA 1PCWA 5AN7A 4A2RA 3LCHA 1TPDA 3P81A 2ZZ1A 3BG3A 3QSRA 1EP3A 4JTFA 1KBJA 5AYXA 5F4WA 1ICSA 1SO5A 3IIXA 1TV7A 1VCFA 4L4MA 2Y62A 2CZDA 3HO8A 4ZQRA 4JTTA 3CPRA 2YSWA 3IIZA 4JEQA 1UB3A 5HQEA 2J6XA 5E0KA 4LV9A 1TPFA 4JX5A 2CZ5A 4GUJA 2E5DA 2XN1A 4IMCA 4JTKA 4UMBA 1VGAA 1FWRA 2X1TA 5FEXA 5BOOA 4GUFA 1EEPA 3DGRA 2ZRYA 4ZL1A 1KV5A 2VFDA 3D0CA 4G1KA 4JTEA 4AH7A 2YYUA 1C8VA 1F76A 4NT0A 5E93A 3QZEA 1W37A 5BNKA 4YL2A 3P5ZA 2JKEA 3GAKA 5F2LA 3S1WA 3PB0A 2YX0A 3KVLA 2FPTA 1OFRA 2NWSA 1OFPA 2NUWA 1HFBA 3A23A 2H8ZA 3MHFA 2WO5A 2Y70A 2C1HA 2HMCA 1VZWA 2H8XA 2Y7FA 3C4UA 1KFKA 4QSHA 4Q33A 3PBVA 3DHDA 3DFTA 3UPWA 4MLRA 2BX7A 2H3BA 1I2PA 4FX7A 5DLCA 2QJIA 1IF2A 4O16A 1M7OA 2AGKA 2ISVA 3E0IA 1W3NA 3FJ6A 1UUOA 3P7YA 4QIUA 4NZFA 3T4CA 1DJNA 1AL8A 3STFA 5LNVA 4K8EA 4DF1A 1XDLA 1GYNA 4XKYB 1WA3A 3PSVA 2GQAA 3O15A 2B7PA 1FCQA 3FKRA 4ALDA 1K7XA 3EX2A 4UTIA 4MFEA 1GTEA 3GKAA 1GWJA 2JGYA 3NR0A 5DN1A 3W76A 1OK6A 2W79A 5HR6A 2E6YA 5C55A 2NX3A 3UY8A 3QQ1A 1VCGA 4RXGA 4UTTA 4WY0F 2FJKA 3QRHA 2PRLA 2Y7EA 3SECA 1LZOA 1WYIA 2LLEA 3HPXA 4TR9A 2A5HA 3ELFA 2C15A 2X16A 4Y6GA 3NQAA 5HJLA 4YWIA 3GAYA 4MYXA 2PCQA 4UFMA 1WDWA 3A9IA 4ORIA 3WJSA 3EWUA 2QAPA 4TO8A 1AW5A 1HTIA 1TCDA 4LS0A 5BMXA 3F03K 5DBTA 4JNMA 1ZNNA 3U6WA 4UTMA 4B5NA 4JTUA 3P84A 3SSJA 3UWYA 3KXQA 2HTMA 2EKCA 3G3MA 1GPWA 3LTSA 3NNTA 3IVTA 4GUIA 1HUVA 2Y7GA 3QMRA 1J4EA 1XI3A 1QO2A 1SR9A 4FIQA 3PBWA 4I7VA 2V2HA 3OEXA 1YADA 3G1AA 3PY2A 3W1LA 3INPA 4Z0JA 5G2HA 3W85A 1H7XA 3BPWA 4FXRA 4N9EA 1SO6A 3TJLA 8TIMA 1F6PA 3LB0A 1O94A 3L9CA 4ZQPA 3S5OA 3W73A 4XUGA 1KTNA 3M9YA 1W31A 4DF2A 4HNTA 3B04A 4IJBA 1S3HA 3G1HA 3P74A 5D05A 1GVSA 2R14A 1YTEA 4Z1BA 1QPRA 3W72A 3ABSA 4M6PA 1KM3A 4LNYA 4AF0B 2P10A 3MMTA 1Q6RA 1TQJA 2CLMA 2ZA3A 3C2VA 1FCUA 3Q58A 3NL3A 1O60A 4FO4A 1VYSX 4ML9A 3DBPA 2VEKA 3HPSA 5D2XA 2X30A 5D38A 2H90A 4ADSA 4LWWA 1IXQA 3LHYA 5DCDA 3PC0A 4JN6A 5LNSA 1W56A 1LDCA 3R89A 3RMJA 3GZ3A 4IPJA 3FA5A 1EA0A 2GVGA 1WOBA 2RFGA 2TMDA 1XFBA 1QWGA 3M5XA 4OV9A 1O4UA 3W3OA 2ZRZA 2WNZA 2WPBA 1YPFA 2G97A 3L0KA 3NPVA 1W5NA 2O7QA 4JY9A 2Q8LA 1TRDA 3KVJA 5HWJA 3N2MA 4O19A 1J5TA 4Y9AA 2V2DA 1OYBA 3MP4A 1HL2A 1KM4A 1PCKA 3W83A 3NG3A 1G4SA 1O95A 4O1BA 1ZAHA 2AAMA 3E12A 4XTIA 2OZ0A 2ZDRA 2NXHA 1GYLA 4WD0A 4OBTA 4JTHA 2JK2A 3TQKA 3PVFA 5CG7A 4O0KA 4AHPA 2I9EA 3G1FA 3WK3A 3CLMA 4WX2A 1RPXA 2B0MA 4GFSA 4HIBA 3ZFHA 1OABA 2YFOA 3DXIA 1S5VA 3H55A 5F2MA 3G3DA 2VFFA 5D2TA 2QCFA 1GVOA 3G0UA 2Z2UA 3OA3A 2XN2A 5HR7A 2VEIA 1NVMA 4MLJA 3LLFA 1FCBA 4FNUA 2PC4A 1OG0A 4A2SA 1SU5A 1SZNA 2HS6A 4UFLA 4AHOA 1DHPA 5CSRA 4JX6A 5KZDA 1SSDA 2WSRA 3HGJA 5K4ZA 4O10A 1TQXA 1I8JA 5DBUA 3L67A 3P5YA 4UFKA 4LVBA 4IMDA 1WOAA 4NJIA 3LDVA 3I7QA 5HWMA 2GOUA 4PL1A 4O50A 2QCLA 5MHBA 4H3DA 4O18A 4MPQA 1QPNA 3CWNA 3GVGA 1NAL1 1O5KA 4LVFA 3OVRA 1TJRA 1P0KA 2V9DA 2A1YA 1SSGA 2Q3RA 3STGA 4LRSA 1V7YA 1A5CA 4UR7A 5LGZA 1R2RA 1ICPA 1FX6A 1OVDA 1W5OA 3NDOA 4MY1A 1X7FA 3R8RA 2J24A 5KZEA 1SPQA 5LNRA 1CW2A 1L9WA 3QC3A 1ZFJA 1PVNA 4NQ1A 4ZQCA 2ZCGA 3W7OA 1VC4A 3NEVA 4JY8A 2A6NA 3MW7A 3KHJA 1XKYA 1XC4A 3LCXA 1DQXA 4NZJA 4E2BA 1XUUA 3GXTA 3I68A 1VPXA 3MP5A 1EP1A 3N34A 2PURA 1T99A 4S2CA 1B4KA 4IXHA 1QR7A 2FPVA 1JUEA 3TC7A 1KFLA 2DJXA 4IUOA 1TB3A 4U4MA 1E51A 2XN0A 4UTWA 1TO3A 3TXZA 4LVAA 4EVZA 5I3JA 4UTUA 2J9XA 4EF8A 3EWXA 2FB3A 1J2WA 4DXVA 3NGJA 2ZFAA 2E77A 3S5YA 2VXNA 3MP3A 1LTDA 3IEBA 4JGDA 1LP6A 4Z0SA 1KM2A 3RK8A 4AMAA 2E09A 2ZA1A 1H60A 3UWQA 2I1OA 3EKLA 3W7KA 1X1OA 5HWNA 3FYOA 5CPLA 5T26A 1JCLA 3FEMA 3S5NA 3SJ3A 1F6KA 3SGUA 2QUUA 4LS2A 3W2KA 2OT0A 5G5IA 1L6YA 4FF7A 1VRDA 5FESA 1VHNA 5K9XA 3QJAA 4K39A 4MY8A 4GWEA 4HN4A 3W7CA 2QCDB 1D9EA 4CNOA 3S9YA 1ZAIA 3JRKA 3BO9A 3I65A 1BKSA 4CNPA 4FHAA 5GVJA 1ZCOA 3NQVA 3OBKA 1LLZA 1H50A 4IQLA 4JTSA 4MZ8A 5KSWA 3TW6A 5FI8A 5K3VA 3LHUA 4HPJA 1TTQA 3LM7A 3BGJA 3YPIA 1ME8A 3QMTA 4X9SA 1LBFA 3CHVA 3G0XA 4WZHA 2JKPA 5EMUA 3CQ0A 4WY0B 3G18A 3CC1A 4NJGA 4LC6A 1OX5A 4FNQA 4PH6A 2Z0IA 1FXPA 1PE1A 2J27A 3IIOA 4MFDA 4N4PA 5C2XA 1QMLA 5CZSA 4R34A 3PG9A 1KBIA 1LORA 2P0OA 2YCEA 3M1ZA 3HF3A 1AL7A 5F1VA 2DZUA 1KTBA 4QM1A 3UY7A 1SQ7A 3V75A 3CEPA 1W3TA 3O1NA 2A7PA 1H62A 3C0JA 1NF7A 4O1DA 2ZRVA 3UZ5A 2A4AA 4Y96A 4N4QA 3ATZA 3GLCA 1GTHA 5J5DA 5TIMA 3NQMA 1DQWA 3FOKA 1W54A 1GZGA 1N8FA 2ZRUA 1EB3A 4ADTA 4E2DA 4TMCA 5HUOA 4DO6A 1LRQA 1P1XA 4LU0A 2EPHA 1JCJA 2VELA 3NXFA 1R30A 4RLIA 2BWGA 5FF4A 4H6KA 2E5BA 1A5BA 1QAPA 3MO7A 1XL9A 3GB6A 4OGZA 2JKAA 4A3UA 3WJXA 1JUBA 2CFFA 4LS1A 1TPH1 3KRSA 4O4WA 2FDSA 2YW3A 1Y0EA 3ZWTA 5A5WA 3E49A 2QCEA 4O57A 4QAIA 1LOSA 1KA9F 1TPWA 2VFEA 3NQFA 1I2QA 1LBMA 2GPTA 1VJIA 2C19A 4L4LA 1MZHA 3DHFA 3M5VA 4MJZA 3LV6A 5DY3A 4GBUA 1XBYA 2EGZA 2ZZ7A 3TSDA 1OF6A 2E6FA 3M7WA 3LCIA 3FYPA 4JYFA 1F74A 1SZEA 1OFBA 4RV8A 1GG0A 4P61A 4XBSA 3TIMA 1QPOA 3LGEA 2BTMA 5IBXA 5LKYA 3UWWA 2CZEA 4HSOA 4TU1A 4N02A 3F4NA 2DJLA 3G1DA 4AF0A 1FWSA 1UJPA 4DO5A 4I7WA 2X1RA 4UMCA 2ZQ0A 4O14A 3A5FA 2GQ8A 3VFLA 1M5WA 3IGSA 3TAKA 3W6YA 3I6RA 4PEKA 1FUYA 3G1XA 2NLIA 2VOMA 2H6RA 1EP2A 3C56A 3TFCA 2HSAA 3GR8A 5KZMA 1H1YA 1H7PA 2QCHA 2DZTA 3THAA 2VEMA 2EHHA 4NXSA 3E9AA 2NZLA 2E68A 5EY5A 4Q32A 4UFHA 1ZY9A 3M5ZA 1TIMA 1S5TA 3T55A 3QF0A 4OE7A 4JDBA 3AO0A 5BMWA 4AAJA 2QDHA 2J88A 3O6CA 4GUGA 3BLEA 2A7NA 4R33A 5AHNA 1H7RA 3CIWA 1L6WA 4FIRA 3TDFA 1RR2A 3K30A 3SZ8A 4KWWA 4GJ1A 4D2JA 2Y63A 4RXFA 1NFBA 3DKLA 1AW2A 2V81A 4QJ1A 1DVJA 3MI2A 3W2NA 3I7SA 2DZVA 3IV3A 3ZS4A 1JCMP 4M7SA 3LCFA 3TX9A 1DOSA 1FWNA 3N2XA 3GYEA 5LNWA 3DFNA 2Z6JA 3FLUA 3QPZA 1K02A 3WFAA 3QPYA 3W22A 4JX4A 4PA8A 5D2YA 3C3NA 3GX9A 1OF8A 1W5QA 3W1MA 2CLEA 1H7OA 4RX0A 5H2ZA 4FB7A 5AHLA 1SFLA 4TX9A 2ZZ5A 5EYWA 1IXPA 3C2FA 4JR5A 3W7IA 2EAWA 1PIIA 3ABOA 2Y7DA 4QQ3A 4OHQA 1JJKA 3THQA 1P0NA 4MYAA 1TRIA 3PM6A 3LTYA 1S5WA 4M19A 2R8WA 1SW0A 5A8GA 3UXAA 1CX9A 3LCGA 4BR1A 4UTKA 1XDMA 2ATMA 3USBA 3B4UA 4IGHA 4NJKA 2RKXA 2C13A 5LSMA 1OJXA 3DAQA 4RJEA 4UR8A 3BW2A 4CCDA 3HG5A 1C29A 2IQTA 4JYEA 4AWSA 4K38A 3IRDA 1T96A 3E96A 2QCNA 2X1SA 3Q2DA 4CNNA 4Y8FA 1ONRA 2NXGA 1KM1A 3T40A 4R7JA 2G95A 5AB3A 3DI1A 3H54A 4UNLA 4KFOA 2ZZ2A 4CLMA 1C9DA 2WKJA 4ZQNA 3GK0A 3KVMA 4OWGA 3R12A 5HUPA 2W0UA 1Q6LA 3LCLA 5TBOA 1WQ5A 3NL2A 3EXSA 2CLHA 2ZRWA 3WK2A 4X22A 2DP3A 3DI0A 2A85A 2YXGA 3DU0A 2NX1A 5F4SA 2YPIA 4MZ1A 5G2WA 3RLUA 5FEWA 1GVFA 2DU2A 1GEQA 4DEFA 1OK4A 3FJLA 3TAOA 2ABBA 3LHWA 4QITA 4A29A 2CLLA 1P5BA 1AK5A 3WK1A 3TC6A 1VQTA 3U2OA 1Z41A 3LX9A 3KRUA 2QDGA 4Z08A 2CZFA 3TROA 1LRTA 1RV8A 4RK8A 4X3ZA 1FWWA 4JICA 1DBTA 3N9SA 3M16A 4ORMA 2CU0A 3CWOX 3DZ1A 1PS9A 5D09A 1U5JA 3EXRA 2RHGA 1OFOA 3V1PA 3A5VA 3KRZA 3B05A 3B06A 3W88A 1K3UA 3W1TA 4X2RA 2QCDA 1XM3A 4HPXA 4OQVA 1F73A 3T44A 4WXZA 3W75A 2QAFA 4JIPA 4JXCA 3HG3A 4MKNA 2VC6A 1ZAJA 5KINA 4UUIA 3LHTA 4FEZA 5DXXA 5KMYA 1WV2A 3UWZA 1THFD 4WY0A 1F5ZA 1CI1A 1UBSA 3PBUA 3GR7A 2BXVA 3NQ2A 2QJGA 2PRMA 2V30A 4FNSA 4HNNA 3QEZA 1MEWA 3P61A 3DFQA 1R2SA 4FXSA 1RD5A 1KM0A 1OFAA 5AFDA 4JTJA 3U8GA 2RDWA 2FTPA 2TPSA 3S6DA 3W7QA 4IXXA 1KTCA 1DV7A 1X6UA 3FS2A 1TTJA 1SO3A 3KFTA 3TJXA 1YXDA 3GXNA 4BWLC 4MY9A 4C1KA 1W5PA 3A24A 2GJNA 1JQVA 2Z6IA 3W7DA 1SO4A 4WXYA 3TUUA 2ZZ4A 1JVNA 2YW4A 2CLIA 4DELA 3W84A 1ML1A 1L2UA 4GNJA 1IIHA 2DZSA 1Q3NA 1OYAA 4OV4A 3DKJA 1FWTA 2FPYA 5IM51 4PTNA 3PBYA 3E02A 2ZBTA 4JS3A 1TREA 3GXPA 5I3HA 1MO0A 4UIOA 2FLIA 3CT7A 3SI9A 1G4TA 4UNKA 3MHGA 5D04C 4ZMGA 4JIQA 2DZPA 3C2EA 3HGRA 3LV5A 3Q94A 1A50A 4W9TA 5CPNA 1PHWA 2E6DA 4O17A 5D2VA 2G96A 3C6CA 3TW7A 2C3ZA 2A7RA 3S1XA 4KKXA 5CPMA 1R46A 5EA9A 3L5AA 2RH9A 3TSMA 1V5XA 2V5BA 5KTLA 1OX6A 4CQ8A 3N73A 1A5AA 5D33A 1TSIA 3Q37A 3G0SA 3W7MA 5DCBA 7TIMA 3UNDA 4UXDA 1TJPA 3TNOA 1OFDA 3T78A 1D3HA 3O07A 3WJYA 4A22A 5LHFA 4BK9A 1I2RA 3MUXA 1ICQA 1JRBA 5LHEA 3LI1A 1FDZA 3P80A 1K7EA 3PUEA 3O06A 4NNAA 4O1CA 3HOJA 5F4XA 1OYCA 1VR6A 1B9BA 3CU2A 3TV8A 1G4PA 3ATYA 4MZYA 3KAOA 3P67A 1GG1A 2B7QA 1VLWA 3H53A 3M44A 2CLKA 3SFKA 1PL9A 1DJQA 3W7PA 2CLFA 4IMEA 1H61A 4EWND 4O4VA 3DFSA 3L5MA 3W1AA 5G1TA 2O7SA 2NV1A 3NM3A 4JTIA 3EWYA 2PRHA 3C8FA 2CWNA 3CIXA 4I7UA 4ADUA 3W9ZA 1ZHAA 2ZRXA 4QISA 3W7RA 2X1UA 2BZNA 4K8HA 1QO5A 3MBDA 3KX6A 1HO1A 3BG9A 5FF0A 1NF0A 3O8AA 2Y89A 4CQAA 1VH7A 4BI5A 1B3OA 3N19B 3UWVA 4YCOA 3F4WA 1G7UA 2NUXA 3TMQA 3RU6A 3AJXA 3B8DA 4M6VA 3VCRA 2DZXA 3O16A 2X2GA 1Q6OA 4KWVA 3W74A 1R47A 1W3IA 1YPIA 3LCWA 3W7LA 4HT3A 2JGQA 2ALDA 3M43A 1QNVA 4NXKA 4LVDA 3FFSA 1M7PA 2P1FA 1EWDA 3S5ZA 3PWAA 3LERA 3C2RA 3NL5A 4LUIA 4Y90A 3NYZA 3NQDA 3G1VA 2V8ZA 3A22A 3DFPA 3RF9A 4UTLA 5U4NA 5LZLA 1F2JA 3TMLA 1BWKA 3P60A 4GC4A 2BSLA 6TIMA 4K7YA 3W1XA 1ADOA 5DELA 2WSYA 4RR4A 3BLFA 5F2GA 3HBLA 4AWUA 5AHIA 1H63A 1TMHA 2V5LA 4FX8A 5K2ZA 4FNRA 3CEUA 4NX5A 1AW1A 2OMAA 2TSYA 3IGXA 4HHPA 5CGQA 5ABTA 1A53A 1K8ZA 2Y61A 5L6UA 2Y88A 3CB8A 4IOTA 1P4CA 1PHQA 2C0AA 1GOXA 2ZA2A 2RDUA 3QFEA 1XBXA 1RQHA 2PE4A 4TIMA 3STEA 2FQIA 3JS3A 2OJPA 3G1YA 1W5MA 5HINA 4ICNA 3LOTA 1H1ZA 1H51A 3EWZA 3BVJA 1X1ZA 3W2MA 4ONVA 4YLWA 4EIVA 1JULA 3LBCA 4RZ6A 1DORA 4IX2A 3LHZA 1G67A 4MJMA 2GQ9A 2A6LA 5BRBA 3KOFA 5D37A 4FNTA 2Z1BA 3NQGA 1H5YA 1YLVA 3HMJG 2E6AA 4EOUA 1QFEA 4PODA 4LUJA 3C61A 1G6CA 1KFCA 3IVUA 4YXGA 1VLIA 3SIZA 2G5WA 5I3GA 2VFGA 4N9CA 1UCWA 3PR2A 3UYCA 1F05A 2VKZG 5H91A 3LXAA 2V0TA 3BK0A 2TYSA 1MSSA 2WOQA 5K9DA 3TQVA 4CCCA 5L9FA 3GDMA 1Z48A 3IIPA 3LXBA 2YGYA 3SR7A 4YMZA 4M6QA 4AEOA 4U28A 1LROA 1ZENA 4FNPA 5G4EA 1DL3A 3IGUA 1GQNA 1W8SA 3QQ0A 3S42A 4UTHA 3LXCA 4YCPA 3I7RA 3ZR4A 3HGSA 4NNBA 3LRKA 3MI6A 3SGZA 5CZTA 1I4NA 4BI6A 1DKWA 4ZQMA 3DENA 3EWWA 1HO4A 5AHMA 2ZYFA 1UASA 3MWAA 1QOPA 1R2TA 4N6FA 1NSJA 4MOZA 4E0CA 5TQLA 1T0OA 1TPB1 4N2YA 3N14A 3N3MA 3STCA 4HKPA 3ZWSA 4LVGA 2ABAA 5G4WA 2DZWA 4O15A 3MI3A 3PS7A 4NVTA 4UTTC 2DORA 3C52A 4MIMA 1JUKA 3S8HA 3QSTA 1SZGA 1KLZA 2R94A 4DF0A 3WK0A 4NNCA 3W7JA 5K9CA 3TXVA 4DBDA 2FB2A 2EF9A 5KITA 4LY8A 3HGOA 3EX1A 2NWRA 1IGSA 4O53A 3A21A 3NQEA 1OFEA 4NU7A 1I2OA 3BGGA 3QW4B 2CW6A 1ME9A 3RFAA 3W1RA 2JBMA 3HIJA 1LOQA 2HS8A 1EUAA 4O52A 1LM1A 1RZMA 1YDNA 4NJHA 5CPOA 1W1ZA 2C16A 1TPC1 1WBHA 2CLOA 4XBKA 5FF3A 3VE7A 4RKAA 1SZFA 1D3GA 4IMGA 4WOZA 1H7NA 1KW1A 1H7WA 2D73A 3PG8A 3NQ6A 1PV8A 1YXCA 3HG4A 3BV4A 4UCGA 5BW6A 3O6YX 3LLDA 4LW7A 5CZ0A 2QCCA 1G69A 2RDTA 3N9RA 4R53A 1M6JA 3W71A 5D30A 1TTPA 3QW3A 5AHFA 3DH7A 2F84A 1NEYA 5CZJA 1JQXA 3S1UA 4DQWA 4N6EA 3GIYA 1X8FA 1MEHA 2GVJA 2J9ZA 3NZRA 4TMBA 3GDTA 5F2IA 1KV8A 2VFIA 5I3IA 3W1NA 2V82A 2YDAA 4LV4A 3MBFA 5CSSA 3WJZA 3L66A 3TA6A 1VHCA 2B7OA 2WV8A 1OX4B 2QR6A 3G1SA 1GVQA 4HNVA 1XBZA 2NXIA 3MHUA 3TCEA 1YYAA 2Y6ZA 3C2OA 4S2BA 3R2GA 1FDYA 4JTGA 1FCVA 4JDYA 4DPQA 4GRSA 3SW6A 2VEPA 3LHVA 3QM3A 3L0GA 3ANYA 3GDLA 1N7KA 2ZZ6A 1JCYA 3GNDA 3W07A 1TPEA 3OVPA 3CTLA 3EEGA 4LTSA 5DCEA 4AHQA 4IPIA 2YYTA 4K6AA 3TU9A 3B0PA 3O63A 3TQ0A 5AC7A 3SY5A 4CCEA 1XUZA 4P2VA 1FDJA 4MUZA 5AOUA 2C14A 3PUOA 1LCOA 3NM1A 3L2IA 4LC8A 3TFXA 4M5PA 3BW4A 5FEZA 4RZ4A 3VE9A 1QCWA 3EX6A 3HB9A 2BLEA 3W87A 1ZJIA 3L68A 1WAUA 1JCNA 1GJPA 2Y85A 3EKZA 3PUDA 4O0ZA 1EWEA 3NQCA 4J9JA 5D2WA 3W2LA 3LTPA 1GT8A 1XCFA 2UV8G 5G2IA 1SUXA 3VNDA 1A5SA 4N9DA 2GJLA 3NOEA 3W86A 4IWWA 5G1YA 1FXQA 3VKJA 3P62A 1KLYA 1YTKA 1B57A 2ISWA 1HG3A 3M47A 4LOCA 3MYPA 3EB2A 4GXMA 3ABRA 1MXSA 3BARA 1B4EA 5AC6A 3B03A 3P8JA 4BFAA 2A0NA 3P82A 4PFMA 3KVKA 2QF7A 5D03A 1EIXA 2YFNA 3BW3A 1N55A 4NUWA 3G8EA 1JRCA 1Q6QA 3O6DA 1G4EA 1KFEA 3IIVA 3EX3A 3P8IA 4EF9A 3TSBA 3O05A 1BTMA 1KM6A 4UFIA 1Z42A 2VENA 4XQ6A 1LBLA 3LBMA 4XWUA 1GVRA 4XZ9A 3BLIA 2QKFA 1KFJA 2ATSA 5HNRA 1FY6A 2QCMA 3NVTA 4NJJA 2OCZA 3M5YA 1XXXA 3OIXA 3EX4A 3GKFA 5C6MA 2Q8ZA 5LGXA 2E1DA 2GVLA 4RCXA 1G7VA 3QH2A 3HQ1A 2NV2A 2H3DA 4A21A 3UD6A 2NUYA 1W0MA 4AVFA 4DO4A 3UPBA 2C18A 2QUVA 4GE8A 1ALDA 4AXKA 1LOLA 3L5LA 4M7TA 2QCGA 5FF2A 4UMAA 4XTDA 1K03A 3TK7A 1VCVA 3LI0A 3MYOA 1SW3A 1BWLA 1F7BA 2E5CA 3NA8A 1TTIA 2OT1A 4I9AA 3NAVA 1WXJA 1K8YA 5K4XA 4H4IA 5LNUA 1Q45A 4GUHA 4UTWC 4K7VA 5J5RA 2WQPA 2ZTKA 1RQEA 2Q3OA 3W23A 1AG1O 4ZVJA 5I3FA 4RZ5A 1JCXA 2TRSA 1QDSA 4E38A 3VI2A 1VS1A 4OT7A 3B0UX 3G8RA 3GDKA 4HSNA 1WX0A 3OG3A 1YDVA 1ZALA 2OX1A 3CM4A 4BWLA 3NPWA 3TH6A 1O5XA 1OHLA 3M0ZA 2B4GA 1RQBA 4DPPA 3W7GA 1VYRA 1WBJA 3NPXA 5I3KA 1Z44A 5D32A 3W7EA 5EBUA 5DXYA 1BEUA 3TE9A 3W2JA 4CQ9A 4WQ6A 4Z1DA 5D02A 4WUIA 3QYQA 4IMFA 2A21A 3ABQA 3HPZA 4QNWA 5AYYA 4IX0A 4JD4A 4N9BA 2XFWA 4WJEA 3OVQA 2WNNA 4BF9A 4O28A 3B0VC 5EL1A 4K36A 4UC5A 2ZZ3A 4Z1CA 4DBEA 3NQ8A 3UWUA 4AB4A 2WSQA 4O54A 3MJYA 5CKSA 5SWUA 1UUMA 5HULA 4AWTA 5DY2A 3RLVA 1OFQA 2YR1A 2GUUA 3OHIA 2ZTJA 3S1VA 3NO5A 5F1UA 3JR2A 4JYDA 4O12A 3GNNA 2J9YA 3M6YA 3PULA 4UTJA 1JR1A 1LLWA 1TPUA 3LRMA 5U7SA 2VFHA 1KFBA 5EPDA 5C5YA 1IXNA 2W6RA 1K8XA 3EWBX 2KZHA 3W7HA 5C54A 3EXTA
chains in the Genus database with same CATH superfamily
3RCNA 4S1FA 4LT9A 5A6KA 1X6NA 4IISA 4OFCA 5CGMA 1WE5A 4MSSA 3OZPA 3W0KA 9XIMA 4GYPA 2WNQA 4E5TA 5I07A 3HG2A 3S4TA 1YXYA 4MADA 1TV8A 3R79A 1QPQA 2WJZA 4PN2A 2XPKA 2WHKA 3GTNA 1TX2A 3MTWA 1HP4A 3ZVHA 1EX5A 3FKKA 2XM1A 5D8ZA 1L6SA 1UD4A 4I8DA 1Y5XA 2WMFA 2BVTA 1R3QA 2FGBA 3PSWA 4QROA 4XKYA 4X0VA 4ZQOA 4W5ZA 1L2QA 1CBGA 4O1AA 2QJHA 1EUNA 4DNHA 3L65A 3PPHA 1A0EA 1T8XA 2XVGA 1Y7VA 3DFOA 3E0FA 1P7TA 4POCA 3VYLA 3LLXA 1IT8A 3WBYA 2D3NA 3L4ZA 2V5JA 3QMSA 3CQJA 5FJIA 1GJWA 4DJFC 2GWNA 3AIWA 1FBAA 1ONXA 4U10A 3UQNA 1EKOA 2H9AA 2QEZA 1I75A 2BY1A 4ZZ9A 2QMKA 3UA3A 3UZJA 3VIIA 2O55A 3G24A 4Q8OA 3W7NA 4FMVA 4UFJA 3TN4A 1QOQA 1LRNA 1DQUA 4ZO9A 4DJEA 2I14A 4UQ9A 4K37A 4M0XA 3MZNA 2PAJA 4A2RA 6CGTA 1MUWA 1JI2A 1TPDA 3KWXA 3P81A 3QSRA 4JTFA 1KBJA 5F4WA 4O0QA 5CJ5A 1XLAA 1VCFA 3APGA 1NDWA 2WWCA 3ES7A 3IIZA 5HQEA 2J6XA 1TWIA 1KRCC 5E0KA 4NAFB 3S9ZA 1OM0A 4XZLX 2X1TA 2ZRYA 1HVXA 1KV5A 1F76A 4W5UA 4F2UA 3FA3A 1W37A 4ZO7A 1BXNA 2E40A 1VKFA 3SGGA 2JKEA 3GAKA 5F2LA 3S1WA 1PTDA 4ZOEA 3KVLA 4M6UA 3AIVA 1ITCA 4FLSA 1OFPA 4QRNA 3QV7A 3VU2A 2NUWA 1HJVA 1NOWA 2H8ZA 1GOMA 3BXWA 3AHXA 3WLSA 2EG7A 1VZWA 2AOSA 4MJ2A 2H8XA 2Y7FA 5DRCA 3C4UA 1KFKA 3K1GA 3PBVA 2CBVA 3K5XA 3DHDA 5TF0A 5XIMA 4HA1A 3GNPA 3LZ5A 2VZOA 3EBVA 2H3BA 4AU0A 4C5YA 4JTQA 2ISVA 3E0IA 3S3GA 1BVWA 3AZTA 3P7YA 4NZFA 3STFA 3CHDA 4K8EA 4W87A 4WDTA 1XDLA 3UA4A 1GYNA 3GG1A 1TKKA 2QGHA 3MSRA 4UTIA 4MFEA 1GTEA 4L6HA 3UXIA 4ACYA 1RHCA 3GKAA 4NY2A 4K68A 1B5TA 3WLPA 4BJHA 2E6YA 3GHSA 4L9YA 2Y7EA 4PMRA 1VB9A 2C15A 2X16A 5HJLA 3WY1A 3UT0A 4MNKA 2DT1A 3ANVA 1WDWA 3A9IA 3EWUA 3VIOA 1TCDA 3LEPA 3SAZA 4LS0A 2WKGA 3QHNA 4AY7A 1DJXA 2GYIA 2OOGA 3SSJA 3KXQA 1ZGDA 4W4QA 2IPWA 2WBKA 3NNTA 1HUVA 4XAFA 3TOPA 1JD9A 3M0JA 1XI3A 1GONA 4FIQA 3PBWA 2VGFA 1OADA 5BRQA 3KL0A 2J79A 5G2HA 4E4UA 1GVYA 2VO5A 4FXRA 4LCSA 4N9EA 5LIWX 3LYEA 4GQ0A 3WUBA 4ZA0A 1VAHA 3T6CA 4GZIA 3VKCA 1W31A 4QDMA 1S3HA 3G1HA 5D05A 2R14A 1QPRA 3CMFA 4CU6A 2HE5A 3VMPA 3WH8A 1TQJA 3HURA 1PAMA 1XYCA 2XIBA 4HOXA 3WFLA 4ML9A 4QEHA 3DBPA 3ME3A 1JZ5A 1S2TA 4HSHA 3SSZA 1RBOB 3SCTA 2YB4A 4UQCA 2Z2AA 5A6BD 2QV4A 1W56A 1LDCA 2E9LA 3BAXA 4AIEA 3P0XA 1M03A 1X38A 2GVGA 1ZCCA 3DOPA 3R8GA 1XFBA 1QOXA 1NWTA 4OV9A 1RCQA 2ZRZA 2WPBA 3EDFA 2IKHA 1YNPA 1UWRA 4V28A 4ERIA 3AUOA 3N2MA 1J5TA 3MP4A 1PCKA 3FX4A 3W83A 4WR3A 1G4SA 3KCOA 1O95A 1XRVA 3W27A 3E12A 2OZ0A 1LQ2A 5LIYX 1SFTA 1C90A 1OCJA 1PIFA 1XCWA 2JK2A 1P1MA 4HGXA 3SB0A 4GVIA 3KCLA 4HIBA 2FZNA 1OABA 2Z7KA 3H12A 2VX4A 3WFZA 3ZJ8A 3G0UA 3BLDA 3OA3A 3ZLHA 1QW7A 3ZMRA 1OEPA 5HR7A 3LLFA 2XDFA 4XBJA 1PO9A 2PC4A 1OG0A 1VEPA 2HS6A 1JYVA 4UFLA 4TV5A 1SSDA 3ZR6A 3USZA 5K4ZA 1JF6A 3RX2A 3EAUA 3CIVA 2JIEA 1ZRQA 4UR9A 3MB9A 4YNGA 3CZKA 1E0WA 3RJXA 5HWMA 3BTNA 2GOUA 2G0WA 3SURA 1DIOA 4GH1A 5MHBA 3OOQA 1C7SA 3I4EA 1UD3A 4LVFA 4A3YA 1TJRA 2V9DA 1E9LA 1SSGA 2OEJA 4Z2HA 1QK2A 1V7YA 1KNWA 2AKZA 7CGTA 4MY1A 2WHJA 5LNRA 3I10A 1CW2A 2OYKA 3AS1A 4CN1A 5EMYA 1Y65A 3GXFA 3SM0A 3RAOA 2ZCGA 9XIAA 1VC4A 2GGEA 2J7DA 1NARA 3GC2A 4XV0A 1CXIA 2J66A 2BMBA 3MCNA 1QUMA 1K8CA 3JZEA 2NQZA 2PDJA 2OU4A 1QR7A 2FPVA 1KFLA 5DT5A 4W88A 4X0NA 4U4MA 3BC9A 3CH0A 1JG9A 4C6MA 2Y2WA 1Y5VA 4LVAA 5I3JA 2I7GA 4CNSA 2PLCA 2FB3A 1VFSA 3MP3A 1A0CA 4F4RA 4JGDA 2E09A 3EKLA 1P6CA 3FYOA 3OQ8A 3FEMA 3S5NA 1RUSA 5I3DA 2ICSA 1VHNA 2CBJA 4KESA 4K39A 4GWEA 4W8BA 4W85A 3DFHA 2BNJA 1H11A 3FVDA 2ZX9A 1ZCOA 3OBKA 1H41A 4IQLA 1K9TA 3B9AA 4HNLA 4HPJA 3M0MA 1NIUA 3QMTA 4GBDA 4X9SA 1LBFA 3GRIA 2IXUA 1CGTA 3QOKA 3SCWA 1Q7MA 2JKPA 3UXLA 5EMUA 1KRMA 2DH2A 3CQ0A 3G18A 4LC6A 1HZYA 1FXPA 2PF0A 1EQCA 3DIPA 5FJTA 2J27A 3IIOA 4MFDA 5C2XA 1SJCA 4B5XA 1KBIA 1LORA 1RJQA 2DZUA 4QM1A 3V75A 3O1NA 3C5QA 2A7PA 2WZIA 1FFQA 3CZLA 4QGCA 1H62A 4KIEA 1NF7A 2WAGA 4CGTA 5A94A 4JNZA 3UZ5A 2V67A 3CB3A 3PFRA 4NI8A 4QR6A 5BXTA 1TVNA 1VF8A 2PCEA 2YXXA 1E43A 4EAYA 2GDUA 4E4FA 1DQWA 1W54A 1GZGA 3OZYA 4KGLA 4LAOA 3AWNA 3VOIA 4MNMA 1ECEA 2BV9A 3S2LA 4DO6A 2EPHA 3U9IA 1UW9A 5LA1A 2FHCA 1KWKA 3BSGA 2R1KA 2BWGA 1MFVA 3H2EA 5I0DA 1QAPA 3UBPC 2OODA 3RHGA 2JKAA 2CFFA 4KF1A 4KCTA 2ZUNA 2FDSA 4O4WA 1JNEA 4XIAA 1Y0EA 4OIFA 3W82A 3QGVA 1GKRA 3FNDA 1Z9AA 2QCEA 4DNMA 4O57A 4QAIA 1QVBA 3TP4A 3NQFA 2J75A 1OZMA 1KB3A 3LSBA 3L2LA 1NWSA 1VJIA 2C19A 3AMGA 1UZDA 1QNPA 4JQ3A 3BGAA 5DY3A 4J3SA 3SUTA 2EGZA 2R1NA 1IWAA 1MVYA 2GSHA 1S1RA 4NRSA 2Z4GA 4Q8UA 5CC7A 1F74A 1OFBA 4RV8A 1TV4A 2XVPA 1QPOA 1XSJA 3CL7A 4LUYA 2PGFA 3AYRA 4HSOA 3F4NA 3G1DA 3NQBA 1T7LA 4XAYA 1DWFM 2OSWA 4UMCA 5B7YA 2J7BA 5KEZA 4O14A 3A5FA 2GQ8A 3VFLA 2BVWA 3IGSA 4US6A 3CO4A 4PEKA 1HGYA 2H6RA 1XGEA 4YJ5A 5HNTA 3GR8A 2QCHA 1W3LA 3KZSA 2VEMA 4NXSA 4BY3A 2HISA 3CV1A 2X8RA 3M0XA 3QKEA 3MVTA 3VILA 3VOFA 1S5TA 1KGXA 3N04A 3RM9A 3O6AA 5BMWA 1MXGA 2QDHA 3GG7A 2C79A 3N6QA 1JL8A 4GYJA 1KXQA 3S2MA 4AQLA 3QY6A 4TVUA 1IEVA 4MWAD 1PIGA 1UP2A 1IZJA 1KQZA 3K30A 3SZ8A 1XQLA 2GJPA 4GJ1A 1NFBA 3DKLA 3W53A 1A4LA 3LM3A 1NOFA 4E3TA 2VYOA 2EPKX 3HV9A 3ITOA 4PGLA 1QXLA 4WSJA 3CQIA 3IV3A 1JCMP 4HPNA 3TYCA 2Z1KA 4JIRA 2PDPA 2C8NA 1RXOB 3WFAA 4HPGA 3JW7A 3VKKA 2NQLA 1OT1A 2DH3A 4HMEA 1OF8A 3W6MA 3W1MA 2CLEA 1BVZA 3KBMA 2DZBA 4EP8C 4LAMA 5G4HC 3M0IA 1PIIA 3DG7A 2OLSA 3OLDA 2Y7DA 5E0FA 4J7RA 4CQCA 3THQA 3BAYA 3WLJA 4F8XA 4ML4A 1S5WA 4FZIA 3MUIA 2OO6A 3UXAA 2OKOA 3HM7A 3LCGA 4FP1A 4UOZA 1XDMA 3MMUA 1PWMA 4IGHA 3GFYA 2BB0A 4YYCA 4JIHA 1QI5A 2C13A 5EFDA 1E9IA 4S3GA 4MHBA 3GG0A 3RLHA 1V0MA 3BW2A 2IPGA 1F9CA 4JYEA 3CWHA 1BKHA 2J25A 3JU2A 1E6PA 1RBLA 4MB3A 2Q6ZA 3GTIA 5GQBA 4CLMA 4HYWA 4ZQNA 5C7VA 1PBGA 3GK0A 3SQLA 3TWAA 3R12A 1JDDA 1NWUA 1R7OA 1WQ5A 5CPSA 1J18A 3EXSA 3H2MA 5J8LA 4DWSA 3GTHA 3T2OA 2A85A 3SCRA 2WC3A 1E5JA 4QFUA 4ERGA 5A8PA 4ZSTA 1GVFA 3N25A 3OBAA 2ABBA 3SCNA 4A29A 3WH6A 1P5BA 3WK1A 3TC6A 4PMDA 1Z41A 3LX9A 4D1IA 3KRUA 2QDGA 4Q8MA 3WQ8A 1V4YA 1VP5A 2PBGA 1RV8A 2FZ9A 4RK8A 1GEHA 1XRSA 1DBTA 3N9SA 1E3XA 4IGNA 1CTNA 3DZ1A 5D09A 3V1PA 1MRAA 2GJRA 3LPOA 3VZXA 3KRZA 3B05A 1GGOA 2WVVB 4XISA 3BL3A 4D6GA 2C71A 2PDLA 4Y7EA 1EHNA 2RJHA 4LH8A 4P8XA 4HPXA 1GUVA 1XYZA 4B5TA 4ZSUA 1E9YB 3UG4A 1ENUA 4UUIA 2VVNA 5KMYA 1WV2A 4ZODA 2OXNA 3EDJA 1YKWA 2OWXA 2F9RA 1EYEA 4AD0A 2QJGA 3NQ2A 2FH8A 1MEWA 4E8CA 3DFQA 5MF5A 1R2SA 4FXSA 5AFDA 3TYDA 4UQDA 4XD5A 2DT2A 3FS2A 1TTJA 2BHZA 1YXDA 4C1KA 4KRZA 4AZBA 2GDVA 1SM9A 3LNMA 3AUJA 1R86A 2QNEA 3W84A 5FAGA 3AIEA 4GNJA 3WD4A 2FPYA 3V5CA 4JS3A 4IIFA 5I3HA 3D3FA 1Y5WA 4JHOA 3HFTA 5ABFA 3SI9A 1XYFA 1TR1A 4DYJA 1G4TA 1FH9A 5D04C 1XISA 1TZ7A 3LV5A 3Q94A 1K9EA 4FALA 4W9TA 2P3EA 1LUCB 4O17A 3QGAC 1O66A 5H1WA 2GSJA 5EA9A 3L5AA 2XFYA 2AL1A 1LWIA 3FAWA 3VNZA 3MO4A 1OX6A 1E4LA 5M17A 4D71A 3VINA 1TJ1A 3PFMA 3WL1A 5C2GA 1TSIA 3Q37A 4R88A 3RX3A 4UXDA 1R85A 3CS2A 3EWCA 4H9ZA 2PDFA 1I2RA 1JFHA 1V0NA 1G9HA 1ICQA 1JRBA 5LHEA 1LLOA 4LAUA 3CZEA 1CZ1A 3PPGA 3WDPP 3PUEA 2XWDA 3ARTA 4Z2IA 3DFYA 3EPOA 3CU2A 2BFGA 4I5XA 1G4PA 3ATYA 4L4PA 2CLKA 1DJQA 1BRLB 3NZGA 3T42A 2CLFA 3H2OA 3BDKA 3L5MA 2O7SA 2NV1A 3EWYA 1VFMA 1G01A 2PRHA 2TODA 3OJGA 2X09A 4J27A 2BZNA 3DYPA 4AVNA 5E0CA 2G4JA 1GHSA 3PZIA 3WN6A 1QI4A 3N19B 3AROA 3GXMA 1G7UA 2NUXA 2X2GA 4RNIA 3K4DA 3W74A 1R47A 3U3HA 3AIQA 2ALDA 3UYIA 4INFA 4LVDA 3I3EA 4PUJA 4AY1A 4DYEA 1F3EA 1E5NA 3AS3A 1A5UA 4U2ZA 1TJ2A 3CUGA 3NYZA 5BCAA 4HHLA 2V8ZA 1TUFA 3DFPA 1NELA 3P60A 3FGCA 3G1RA 3W1XA 5DELA 1JEZA 1IHIA 4AWUA 2PDYA 3S1GA 4H7CA 2ZWZA 2QIIA 1FHUA 3GFXA 1BYBA 3G6LA 3R8HA 1UUQA 3IGXA 1W32A 4W86A 1A53A 1K8ZA 3CB8A 3VUSA 1EGVA 2Q71A 1PHQA 3QFWA 1M1BA 3N15A 1GOXA 3GVVA 4C6JA 2P50A 2ZA2A 3JS3A 2OJPA 3SUUA 3R0UA 4ICNA 4NZCA 4LJ3A 4LCRA 1V3MA 3N2CA 3A4AA 4ZOCA 1HNYA 1RLCL 3ZM8A 1OQFA 4B5WA 1MNSA 4PBGA 4RZ6A 1XX1A 1DORA 1X39A 1W17A 1I1XA 3HN3A 2GQ9A 4QLLA 4JN8A 4W93A 3WF1A 1H5YA 2W62A 2EG6A 1TFVA 3HMJG 2AKMA 1NH6A 2WK2A 2MNRA 4C6LA 1UA3A 1EC7A 1VLIA 3PR2A 4C60A 2CPUA 1LQAA 4D6JA 3SFWA 1MW3A 5C9UA 2UY4A 1XH2A 5DX7A 1UROA 3TQVA 1V3KA 2BASA 4RDYA 4WEVX 3NIYA 4QE5A 3SN4A 1FA2A 4AEOA 3A12A 4FNPA 1DL3A 3WMCA 3OP2A 4IP5A 5DMNA 2XIOA 1XLMA 3ZR4A 1XYAA 1W9UA 4QJ5B 5CZTA 1EYWA 4IIHA 3KW3A 4KETA 5DRIA 1PTGA 3EWWA 4GI8A 1E3ZA 2ZYFA 1UASA 2J4GA 1R2TA 1VFLA 4N6FA 1H5VA 2ZVRA 5TQLA 1TPB1 2G8ZA 1SYTA 4IF2A 2FYMA 6REQB 5G4WA 4I9JA 4O15A 3R94A 3MI3A 4NVTA 4UTTC 4ZTYA 3S8HA 1GQLA 2R94A 1AUSL 4FPSA 2I5GA 1A49A 2XH7A 5KITA 2W91A 1IGSA 5LIUX 4J3XA 3TYEA 1OFEA 3B3DA 2V38A 1I2OA 3GTXA 3A47A 3BGGA 2QULA 3QW4B 2CW6A 1XD0A 4HOZA 4DUOA 3WDRA 3EOUA 3ZVHB 1F3XA 5CPOA 4GJIA 5FOOA 2DIJA 1SZFA 3IJLA 1D3GA 4W7UA 4WOZA 1OB0A 1H7NA 1VFOA 3NSMA 2E4TA 4XIMA 2UWFA 3UR7A 4DBWA 3MCOA 3LLDA 3ZO9A 4UTFA 3N9RA 1W2PA 3H4XA 3K46A 3W71A 2W4XA 2OGJA 1TTPA 2ZX5A 3EB4A 1Y8BA 1P7TB 4DJFD 1X6LA 1AD1A 2QW5A 4WRHA 1NEYA 1JQXA 4DQWA 3RDKA 2BY2A 3GDTA 1SFSA 4ERAA 2VFIA 1JYWA 3N13A 2YDAA 5HK4A 3U7BA 5CSSA 3L66A 4GXWA 1J0ZA 2H9AB 5C7HA 2DSVA 1VBGA 2D20A 1GVQA 1B3WA 3GBEA 2NXIA 3MHUA 2Y6ZA 4TV6A 1VIZA 4JTGA 2OYMA 3QR3A 1FCVA 2A79A 1AA1B 4DPQA 2BVYA 2O56A 4GRSA 4H8UA 4Q8WA 5FJJA 2SFPA 2VEPA 1LT7A 2YBVA 1TPEA 4LTSA 6A3HA 4P8VA 2ZDSA 1Q63A 1TJ0A 1ZP3A 2PDCA 3O63A 1C7TA 4I6KA 2W63A 1QHOA 3W38A 5FA5A 1DJZA 1KXVA 3I6EA 1LCOA 4XKMA 2HJPA 5CBJA 1QCWA 3EX6A 8XIMA 3VNIA 4M51A 3N3TA 4PMZA 2VJXA 4CNTA 4H19A 1JCNA 1UC5A 3BWWA 1GJPA 1M9HA 2Y85A 5JIWA 1AQHA 5AVNA 3ITVA 2PDBA 3V36A 1UHVA 2HVOA 5G1YA 1RH9A 1FXQA 3VXGA 3OLGA 3VCCA 3ARYA 3QV8A 1YTKA 4D6DA 1HG3A 3M47A 4LOCA 4JPGA 1ESWA 3DESA 4AMCA 2FZMA 2MUCA 4C6DA 4HK5A 4YTUA 1FWJC 4IL0A 5B80A 2DUZA 3BW3A 3SCUA 4D6HA 4YTQA 4NUWA 3URAA 1B3YA 3O6DA 3AU6A 4Q4MA 3TSBA 1HGWA 1Z42A 4XQ6A 4AX6A 3HQPA 1RK6A 3AZRA 4XZ9A 1O68A 1KFJA 3IV8A 4HMDA 1LF1A 2GGIA 3N4FA 3OIXA 5TNVA 3GKFA 5C6MA 1GOKA 2FKPA 4YU1A 3PTQA 1KRAC 4AZ6A 1B9ZA 3KHDA 3QZAA 4J1OA 3HQ1A 3LGGA 2H3DA 3UD6A 1ISVA 2NUYA 1L0PA 1TWWA 2C18A 2OEKA 4F9DA 2AL2A 1LOLA 1SMAA 2X7VA 3L5LA 3ARZA 2QCGA 4S3KA 3AWOA 4KW2A 2ZE3A 1QRQA 3UEQA 4ECLA 3VOHA 2FH6A 2CIPA 3CHFA 3IK4A 2CC0A 1XRFA 4TTUA 1UIPA 1WXJA 1AD4A 1XW8A 4HZ8A 5K4XA 1GPFA 1EJRC 2VM8A 2WQPA 3CUXA 3LMZA 2ZTKA 4BKNA 3N17A 2Q3OA 4PCNA 1Q13A 1EA9C 4L1WA 4D72A 3L4XA 1JCXA 4WCJA 2VURA 3GZAA 2VZSA 3B0UX 4QBXA 1FHVA 3U57A 1PEZA 3TZFA 4US5D 1ZALA 4HQVA 4BWLA 3FHAA 1O5XA 2B4GA 3AJ7A 3W7GA 3NPXA 1QK0A 4H7VA 4F66A 2RAGA 1BEUA 4B9ZA 2HROA 3C0QA 3QYQA 2NT1A 3SY8A 3ABQA 2QUMA 5AYYA 4PZVA 1MRQA 4WJEA 4YVPA 2WNNA 1NQKA 4U3AA 4AIBA 4W7WA 2JF6A 4DBEA 2A3AA 5IOBA 4JTDA 5SWUA 5D9OA 1OFQA 1Q2SA 4QQUA 3WBXA 2ZTJA 3MV11 3CAWA 2J78A 1AH3A 3BZJA 1YQ2A 3PULA 4UTJA 2NV9A 1JR1A 2HVMA 1TPUA 4PMYA 1R38A 1LL7A 1E6NA 1JDAA 3AI0A 4GINA 4FK9A 3WJWA 3VX0A 3UG5A 2XH0A 5CXPA 2WVUA 1TG7A 2ZOXA 4DLMA 3NZ1A 1I60A 2V2CA 3VA8A 5FSEC 1WAWA 4EWJA 1ZLPA 4MVAA 1I2NA 4C1LA 4NX0A 3PAJA 2A2IA 5FF7A 1EO7A 3FIGA 5K7JA 4IIDA 1CECA 3A6OA 4FI4A 6ENLA 4M29A 1HJWA 1K9FA 4Z1AA 4PTMA 4DYKA 1GJUA 3U2EA 2WNWA 3S0CA 1MEIA 3WQDA 3CAVA 3OB8A 1XG4A 4QP0A 3QR1A 3OGRA 2ACQA 1CLVA 4Q4KA 1MDLA 1BD0A 1RBAA 2ISSA 1ME7A 3MSDA 2D23A 3BE7A 1G5AA 2ISDA 2UY2A 1V08A 3KLLA 4H2HA 1TPVA 4JL2A 5KZ6A 2IPFA 2F7FA 1V93A 4PL2A 5IBXC 2WVSA 3W6LA 2QUTA 2WMGA 3S83A 1UWTA 1MW0A 1SW7A 3R4IA 2ISFA 1IXOA 4FX6M 3GO2A 2W27A 1LYXA 1XPGA 3OU8A 1JCTA 2B31A 1KM5A 4HJFA 3H2FA 1E71M 4AZHA 3VKAA 2BHUA 4AFYA 3WMLA 2QMJA 2ZZ1A 3UW6A 5CPQA 1ICSA 1KXHA 1KR0A 3IIXA 1YHTA 4UNIA 5A8NA 3HO8A 4JTTA 5IHSA 4W7VA 1F8IA 3VIPA 4LV9A 2QF8A 2XN1A 4IMCA 3VFCA 1FWRA 3AS0A 4CNUA 5BOOA 4GUFA 1EEPA 4GFIA 3EDKA 4JTEA 4AH7A 2YYUA 1DWHM 5HMEA 4MNJA 5E93A 3QZEA 1Z8AA 1SGJA 5BNKA 1ZP4A 3PJWA 1JZ7A 2XH4A 3EMZA 2VZVA 3ARVA 5BOEA 1XS2A 3PB0A 2GL5A 3W37A 1BVNP 1RLDA 1HFBA 3MHFA 2VQTA 4AEEA 1UZHA 3SBFA 2HMCA 2D3LA 4IJCA 4GMEA 2D2OA 4H2CA 4AZGA 3UPWA 4MLRA 4GLEA 3TWBA 8XIAA 3M0YA 4MDOA 4M8UA 5DLCA 3CMGA 6TAAA 2PDQA 3TR9A 2OPJA 1W3NA 1RY0A 3SIMA 3OLIA 1B3XA 1LQ0A 2OELA 5GPRA 1EQPA 3PSVA 1IR1A 2DW6A 3AMDA 2PTYA 1FCQA 2VCBA 3GIQA 4RW3A 3LN3A 1FVPA 4JQ2A 1GWJA 2WYSA 2PTZA 4R85A 1A5KC 3E0WA 4RXGA 4WY0F 3ZXWA 3RR4A 1YRRA 2PRLA 1LZOA 3MU7A 2A5HA 4F0RA 2E25A 4Y6GA 3B9EA 3R1ZA 4JIIX 4YWIA 4RPPA 4MYXA 2PCQA 1F61A 2RUSA 1C9WA 4ORIA 1UP3A 4W8AA 1AW5A 2WB5A 5BMXA 4H9TA 4UTMA 1WKDA 1CEOA 4H6EA 3AAMA 4PUEA 3KE0A 1PXGA 2PD5A 2WZMA 5BU9A 4GI9A 1R5YA 1SR9A 5AKQA 4I7VA 2V2HA 1PJ9A 3G1AA 3PY2A 1QHZA 4B9YA 3INPA 4Z0JA 4BQ2A 4LAKA 1BG4A 1UR4A 1E4MM 3F4DA 3MV01 1IEXA 1O5QA 3BPWA 2BDQA 4YVXA 2FVLA 3TJLA 1F6PA 1PX3A 3L4YA 3VOCA 3LB0A 1TUXA 4XUGA 1KTNA 2G4FA 3PNUA 4MJ4A 2PGEA 3OPSA 3M9YA 1QI2A 4DF2A 4HNTA 1JFXA 3GY1A 4HJWA 1GVSA 4Z1BA 1YTEA 5E9XA 3BSHA 1VPYA 3MMTA 3UNTA 2DW7A 3E6EA 3IK2A 3ZVIA 1VYSX 3KEHA 2VEKA 5D2XA 3WLTA 2HEJA 1IXQA 1BG9A 3WDJA 3VVGA 5IDIA 1F3TA 5LNSA 3CL6A 4Q7IA 3PZTA 2YLAA 3GZ3A 1V6VA 4NRRA 1EA0A 1MYRA 2J74A 4EPDC 2TMDA 3SUVA 1QWGA 1EGZA 3U7VA 3W3OA 2WNZA 4CKQA 1YPFA 1M7XA 1UH2A 3DCPA 3TZNA 4HHMA 1XIJA 3K13A 1BYCA 3KVJA 4Y9AA 3NZQA 2GJXA 4XG1A 4XTIA 1E4NA 1S38A 2E28A 1OY0A 3N1AA 1GYLA 3QR0A 2Q09A 1RCOB 4JTHA 4KQNA 4FA3A 2AGTA 2F6UA 3G1FA 3WK3A 1YW1A 4IICA 1RPXA 3KBSA 3ZFHA 3CNYA 3HJEA 2YFOA 3DXIA 2O4MA 5F2MA 4DUXA 2VFFA 4UB9A 4PB3A 1GVOA 4DJDC 1V02E 2VEIA 1NVMA 4ZO6A 4MLJA 1FCBA 4GVHA 1SU5A 1SZNA 1EJ7L 1C93A 5CSRA 4JX6A 5KZDA 1O12A 4QS6A 3B40A 4DLFA 4C7FA 4ENLA 3BLOA 4DY1A 1TQXA 3MUY1 1TVPA 3MWCA 3EA2A 4LVBA 3K8LA 2Z2BA 1X98A 3POHA 3AHZA 1J6OA 1PX8A 3AHVA 3WLOA 1VFHA 3LDVA 2RDXA 1S5MA 4PL1A 2QCLA 4ATWA 3T0AA 1QPNA 3WNOA 1O5KA 5CCZA 3OVRA 3ZSTA 1P0KA 3VIJA 1R2RA 1ICPA 3NDOA 1ZQ5A 4JCMA 1L9WA 4EPEC 2XSAA 1FWCC 1PVNA 4B16A 4ZQCA 4H01A 3NEVA 3RRAA 1YPXA 3KHJA 3AFBA 4L6DA 1XC4A 4E8DA 2VGGA 3GXTA 2FGLA 3MP5A 3TTQA 3N34A 3WQ5A 1IYXA 1DP0A 1JUEA 2DJXA 4IZGA 1TB3A 1QNOA 1E51A 2XN0A 5A1AA 4UTWA 3TXZA 5LA0A 4EVZA 3ZSSA 3ZLGA 2J9XA 4EF8A 4OJYA 4DXVA 3E0LA 2V5DA 3S5YA 5AY7A 3AISA 5AC4A 3IEBA 3FJ4A 1KM2A 2HXTA 1H60A 1M01A 5I78A 4YYFA 5HWNA 3IPWA 3VGBA 1R8LA 1V3HA 1F6KA 3SGUA 4LS2A 3W2KA 4RNFA 5G5IA 3TN3A 4FF7A 1XV8A 2REQA 4YHEA 5FESA 5FAJA 5K9XA 3WF2A 3RM4A 1ONWA 1Q8JA 2WJFA 1PX4A 3S9YA 1XLBA 1ZAIA 3JRKA 2ON3A 3ID7A 1BKSA 2WMIB 1GQKA 1LLZA 3WUFA 2JFEX 4MZ8A 1D7FA 1EC8A 4Q6JA 2Z25A 3LM7A 4GQBA 1RP9A 1XLIA 3WLIA 3AMKA 5ECUA 4NJGA 3CC1A 1T41A 2P8BA 2Z0IA 4IM4A 1EJSC 1XIIA 1TVLA 5I02A 1QMLA 1KWGA 5CZSA 1AJZA 3XIMA 2XSBA 5G1MA 2VDHA 4RDZA 1PDYA 4RDVA 2PDXA 1W3TA 2CHRA 5A6TC 3VIMA 3HQOA 2PU1A 3C0JA 4O1EA 4MWAC 4EXQA 3PBGA 4O1DA 4QE4A 1MW1A 3H2NA 1ZL1A 2ZRVA 4F0KA 3KBWA 5LXEA 1P43A 3ATZA 4GHRA 1GTHA 5ABFB 3FOKA 2DQWA 4KGJA 1N8FA 2ZRUA 1XYLA 3M64A 1EB3A 1XIBA 4FLRA 3ITLA 1JCJA 1FWHC 5EU9A 1K6WA 1A5LC 3NXFA 4H6KA 1F4AA 2EG8A 1A5BA 3MO7A 1S2WA 3WELA 1XL9A 3GB6A 2JIWA 3WQWA 4A3UA 1S2UA 1ITQA 3MKKA 1TPH1 2PWFA 1XCXA 3AQUA 3BJTA 4IJRA 3R6IA 3UJEA 2VFEA 5FL0A 3BSMA 1XIHA 3V3WA 4L4LA 4Y9OA 2OB3A 5EFFA 2XINA 1E55A 2AAAA 1NJJA 3VIKA 3K2GA 3T07A 2ZZ7A 3TSDA 4UZUA 3RILA 1B0IA 1BSIA 3Q67A 1UP0A 2VC7A 2Z27A 3LGEA 7ODCA 1OD8A 4A3RA 4DHGA 2QT3A 1K1DA 4DJFA 1VD6A 4UOJA 3R0KA 4N02A 5HPOA 2YKKA 4K2SA 5EBAA 4AF0A 4XSMA 3ZJ6A 3TA9A 3CHEA 3PJUA 2B81A 2YL8A 2XHYA 3TAKA 1EJWC 8RUCA 2ZVIA 2VOMA 1EP2A 4QG9A 2E8ZA 1F3WA 4YPJA 1TZ9A 3APYA 3AYTA 1H1YA 4IH3A 2PDMA 4PUWA 3E9AA 4GOAA 2E68A 4Q32A 1ZY9A 3GH5A 2OOFA 3A13A 3GE7A 3AO0A 4DUWA 4RE2A 4C7GA 4WGHA 4AAJA 4AG0A 2J88A 1P0BA 3CGTA 2PWGA 3PZNA 4FIRA 3TDFA 1NFGA 4FR6A 1DIDA 1XR2A 1R87A 2XFFA 1U5HA 1DTNA 1Q4WA 1UZ4A 4RXFA 1CGYA 1AH4A 1AW2A 2V81A 3V7PA 2I16A 4PMXA 2OR2A 2DZVA 1KKRA 1A80A 2PP1A 1XLJA 3MMWA 2Z6JA 4GC3A 3FLUA 3CUJA 3D3AA 4PA8A 5D2YA 3C3NA 1WB0A 4RX0A 2DVUA 1SFLA 2X0YA 1BLIA 3PANA 4JR5A 2PSNA 3GC5A 3KOZA 1KBLA 5I23A 4QQ3A 4OHQA 1V3LA 1XGZA 1P0NA 3CK5A 2Z00A 4MYAA 3DGBA 3WBEA 2O9TA 1UWUA 2DV0A 3LTYA 4WJ8A 4LFYA 2R8WA 4HK7A 2JALA 1CX9A 2WHMA 3WQEA 3ITXA 3SUSA 4BR1A 2IQDA 3H6OA 3SN1A 4EX4A 3BOXA 1KO0A 4AC1X 3R7MA 1OT2A 4PMNA 5CJMA 4Q6XA 3UGRA 4W89A 1IV8A 4TUFA 5LSMA 3DAQA 4UR8A 1S2CA 3KRBA 2CESA 2I5IA 4AWSA 2FTYA 1KRBC 3IRDA 1DEDA 3NEHA 2QCNA 2PPGA 2F6XA 3IAQA 3MANA 3RPTA 4Y8FA 4D6FA 4G56A 3T40A 2OG9A 3AHYA 4R7JA 1GKPA 2G95A 3H54A 4EACA 2HCVA 4UNLA 1BXCA 3GW3A 1CNVA 1C9DA 2WKJA 2VGBA 3KVMA 4WGXA 3TLQA 4ZR8A 2W0UA 2CYGA 1OSEA 4P8WA 3NL2A 1LG2A 3VKBA 5FCZA 2ZRWA 4XAGA 3RO6A 2DP3A 2NX1A 2YPIA 5G2WA 3RLUA 4AZ5A 2J7EA 2NVDA 4WF7A 1HN1A 2R6OA 4DEFA 3TAOA 3LHWA 4ZE4A 4QITA 4J3ZA 4JQAA 4L9XA 3PTKA 3U2OA 4JKKA 3KLKA 3BJFA 2INZA 3TROA 2VRKA 4LB3A 1E15A 1FWWA 2IKIA 4ORMA 2F61A 3W88A 5C2CA 7XIMA 4F0MA 3OZMA 4GX9A 1QT1A 4OQVA 1F73A 4C6BA 2QAFA 1ADDA 2VC6A 1ZAJA 4NP7A 4H00A 4L61A 4WY0A 4PRWA 3W28A 4JTAA 4GCAA 4HNNA 2PRMA 4FNSA 1U1JA 3QEZA 2DY3A 3D5HA 5HXMA 1Q66A 1TV3A 3WQGA 4JTJA 3U8GA 2RDWA 1GK8A 1QI3A 3H24A 3N4AA 4GO9A 9RUBA 2G50A 1FWGC 3UZZA 1TWZA 3ZLFA 3TJXA 2ZX7A 3GXNA 4HPHA 2YXOA 3A24A 4KPLA 1IEQA 4UQAA 1MUCA 2ZUWA 2YW4A 1JXJA 4ZB0A 3WUGA 4QEEA 5HJYA 1L2UA 3MVIA 1IIHA 3CO8A 4IIBA 3V1HA 3R43A 1POJA 2INFA 4Y9MA 5IM51 4PTNA 4UOQA 1PZ2A 3E02A 3GXPA 1VFUA 1MO0A 3CT7A 2O0TA 4UNKA 2PZ0A 3MHGA 4ZMGA 3VDBA 2ODOA 2DZPA 3CTTA 3HGRA 1A50A 1J6PA 3FEQA 2IS7A 1XSIA 1PHWA 4QHRA 3C6CA 4KKXA 5CPMA 4CQDA 3N12A 1WDSA 2RH9A 3TSMA 4QG6A 4LGXA 2V5BA 4NL1A 1S3TC 5I06A 3SCQA 1V0KA 3KDOA 2BBFA 3I3DA 1AJ0A 3N73A 3WENA 4MKVA 2XGZA 1SZRA 3G0SA 2W9MA 4QLJA 5DCBA 3UNDA 3TQPA 3VK5A 5T91A 1OFDA 4XD3A 3EPMA 1JPIA 3T09A 3O07A 5LHFA 4BK9A 4I90A 5C9RA 2HVNA 4KT2A 1XRTA 2PP3A 1C8QA 3M46A 4L4OA 3VIHA 3KP0A 4KS0A 4WHBA 4HB7A 3P80A 3VKDA 3O06A 3DHPA 3GXDA 4HYVA 4KEUA 4C65A 4O1CA 1OYCA 2V3EA 2E9MA 2JEQA 4PTDA 3B8SA 3P67A 2B7QA 3SFKA 1PL9A 1HKVA 3AXMA 4JAWA 4R27A 1H61A 2Y8KA 4O4VA 5E5CA 3ONCA 5G1TA 4BEUA 3GWQA 4V2XA 4ADUA 3W9ZA 3EDDA 3M7SA 4WDUA 1HF6A 3MBDA 3KX6A 1HO1A 3BG9A 4U31A 5FF0A 3RUBL 1VH7A 4BI5A 4FAMA 2OLHA 3KDNA 3UWVA 3B8DA 2DZXA 3O16A 4Q22A 4KWVA 5I24A 1W3IA 5LIXX 4HT3A 2OZTA 3F4VA 2JGQA 4HU8A 1L8NA 2WJEA 4NXKA 3FFSA 1M7PA 2XTKA 1EWDA 4EE9A 2I5QA 3VABA 1E1EA 3NQDA 4S3JA 3V35A 2OQHA 1D3CA 5U4NA 5LZLA 1LJYA 5CEWA 4YVVA 1BWKA 5DMYA 3VGGA 2AL2B 4K7YA 1ADOA 4U5KA 1J01A 3W26A 4RR4A 1OCBA 3BLFA 4Y8EA 4PB4A 2V5LA 5K2ZA 4RE4A 1MZRA 1OGGA 3KWSA 4NZ4A 2OTDA 3GD6A 1DJGA 1FH8A 1PDZA 4OKDA 4NX5A 1AW1A 2OMAA 3TTYA 5JIPA 5C9XA 5L6UA 1RALA 3RJYA 2Y88A 4ZFCA 4IOTA 1P4CA 4AWEA 3GXIA 4J3UA 2BGSA 4C90A 2Z24A 4XZBA 2IMRA 3LS9A 2PE4A 4TIMA 3CQKA 1FRBA 3REQA 3W29A 1K6AA 3WD3A 3H7VA 1W5MA 4E6MA 5C9ZA 3LOTA 1J96A 5D8WA 4F0LA 1H1ZA 4PMQA 2ZC8A 3T05A 3W2MA 1UD6A 3AXXA 3VAVA 4WKHA 1EJVC 2VCCA 4IX2A 3VX1A 4MJMA 1B30A 2A6LA 5D37A 1X96A 4FNTA 3NQGA 4LYKA 4PODA 3OTRA 1G6CA 3XINA 3NCOA 3IVUA 4YXGA 4MDPA 4N9CA 4CD4A 3N11A 5A2CA 1US3A 2VKZG 1ELSA 1XIEA 2Y24A 3VDHA 2V0TA 3H7RA 2WC7A 3QHOA 1MSSA 4IFRA 2WOQA 4HHHA 5K9DA 2VEFA 5L9FA 3WNPA 3DECA 1Z48A 2VL4A 1QW8A 1W3HA 3LXBA 3EZ4A 5GJMA 3SR7A 4YMZA 4M6QA 3ZOAA 3VDGA 3HA1A 1LROA 4GXPA 3MSGA 3ZJ7A 1ZENA 2XH2A 4GIEA 1GQNA 3O3RA 1JZ3A 3FY1A 3M07A 5JUVA 3KTSA 1J0YA 3I7RA 1ZU8A 3HGSA 1QHPA 3A3HA 3MI6A 3SGZA 1I4NA 5DANA 4BI6A 1DKWA 2YLLA 4ZTXA 1XF0A 2GGJA 5HANA 1PZ0A 3NO3A 3HZ3A 1NSJA 1J11A 4MOZA 5CG0A 2ZX6A 1T0OA 1TE6A 1J8VA 3N3MA 4LBRA 2DQXA 3U4FA 3JUGA 4LUSA 1K4HA 2QUNA 4GI4A 3ALGA 3SCSA 3QSTA 4XB3A 4NZ5A 1DYSA 3I3BA 1FHLA 1CXFA 3W7JA 2OZ3A 3KUMA 3TXVA 4TTGA 4F0SA 4DBDA 2EF9A 4LY8A 2IPJA 3EX1A 3HGOA 5AZ0A 1GOWA 2VMFA 1WZAA 4DXKA 3ARXA 4C7DA 1CIUA 1M53A 1DPMA 4QJ4B 1ME9A 3QHMA 1K9DA 2JBMA 4J40A 1GVIA 1EUAA 1LM1A 3UJSA 1YDNA 2C16A 1WBHA 5FF3A 4YN5A 3VE7A 1OWQA 2FZDA 2GGHA 4IMGA 4B3KA 1Q7ZA 1UYQA 4CVUA 3PG8A 4GIYA 1PV8A 3BV4A 2XWEA 4UCGA 2XJ7A 3P0WA 3TJ4A 5CZ0A 1QI0A 2QCCA 1BGAA 2RDTA 3A9BA 2EJAA 5KETA 2X0HA 1XIMA 4E2OA 1UZ1A 4GGBA 2BOEX 3DH7A 1UKSA 2F84A 3W81A 1W8GA 5CZJA 3S1UA 3MKVA 3GIYA 1G1YA 1X8FA 3NZRA 4TMBA 5I3IA 1HJUA 3QLLA 2V82A 2G37A 1JZ4A 2B7OA 3ERPA 1NQ6A 4HNVA 2CCRA 1WDDA 3TCEA 4MWAB 8CGTA 4S2BA 2DSWA 3CUZA 5CC5A 1QNSA 2Y5JA 4J3VA 1IT0A 2E67A 3B0XA 3IANA 3EOEA 3UZWA 2GK1A 1T6MA 4G6CA 3GTFA 4XAPA 3LHVA 3WQVA 3RM8A 3GDLA 1UD5A 3GNDA 2WPGA 3NJ3A 4M82A 2V3DA 4IFKB 3EEGA 3R25A 5DCEA 4IPIA 4JEJA 4K6AA 2PF8A 4B90A 4RNJA 2PS2A 4P2VA 2EBNA 1RPKA 1WCGA 1TX0A 3UCDA 3TOYA 1XC6A 3NM1A 1JI1A 2EQDA 4C91A 4QCFA 1H4PA 2BLEA 3VDCA 2XSXA 2P76A 1ZJIA 1HXJA 4REQB 1KC7A 1E0TA 1RA0A 4IMAA 1MXDA 4XZNX 3UP8A 2YZ5A 4PSRA 1EWEA 5D2WA 4B3LA 3LTPA 1XCFA 5G2IA 3VNDA 1A5SA 5HPCA 1WPCA 3ICJA 3VKJA 3P62A 2DGAA 2P3ZA 4OECA 4WDWA 3MYPA 4BQ5A 5A3HA 5LA2A 4A3QA 1ZB5A 3ABRA 1EHAA 1ISWA 5AC6A 4HCHA 3B03A 4BFAA 2BVDA 3T1GA 2ZXAA 4PFMA 3KVKA 2VD9A 3PJXA 3LZ3A 2DVXA 1PKYA 1G4EA 1KFEA 2PP0A 2FHFA 3LNPA 4GKTA 1BTMA 4DZAA 4UFIA 3UWEA 5I00A 1IQ8A 3LBMA 1PZ3A 3BLIA 2QKFA 2WCAA 4HU0A 1XXXA 4NI3A 4PUKA 3COTA 1PKNA 3GNRA 3VC6A 4QTGA 3UR5A 4DB7A 3ZYZA 4HU4A 4LB4A 3AYVA 4ZB5A 1W0MA 3M6DA 4AVFA 3ZR5A 3WH5A 1DJHA 3UPBA 1B3VA 2CLPA 5FF2A 2Z29A 5EMJA 3UCQA 3TN6A 3MYOA 1HKJA 1OGSA 3QTGA 1BWLA 4CN6A 1Z69A 4IPLA 2W66A 2IXVA 4GNKB 3NA8A 4AXNA 1TTIA 3WBAA 2DIEA 1K8YA 4QLKA 4C6EA 1V3IA 2INEA 5IFTA 1OG6A 4YTSA 4H4IA 1Q45A 4GUHA 3QKZA 1HJQA 1R3WA 3AMLA 3TYZA 3WL0A 1AG1O 2TRSA 4Q8PA 1B1YA 3NO1A 4JKLA 5I7GA 1LWJA 3DHUA 2VX6A 3GDKA 3ZZ1A 1AH0A 3UFYA 3QLDA 3OG3A 1YDVA 4ZE5A 1VFTA 2BHYA 3TN5A 4H9XA 4DPPA 3N6JA 5I3KA 1XLHA 2WLZA 3CAKA 5D32A 1UKTA 2FVKA 4CQ9A 1VEMA 2DSUA 3BQ5A 1CWYA 3II1A 2A21A 3HPZA 4QNWA 1ISZA 4IX0A 4X61A 4ZOBA 3GM8A 2GWGA 4BF9A 4O28A 2DPEA 2HE8A 3RITA 4P7NA 2ZZ3A 3RCMA 2JF7A 1H49A 2GSEA 2XVKA 3F4CA 2I56A 3WNMA 1XIDA 1ZS2A 3ARPA 4PEEA 1HL9A 3VTRA 4JFUA 4AWTA 1MDRA 3TW9A 1WUEA 2FFIA 3PNZA 2X40A 2W61A 1ZBVA 3VCNA 1RA5A 3WF3A 5F1UA 2QPUA 1JIBA 5H8PA 4JYDA 5BXSA 3M6YA 1QW9A 3S47A 2GJXB 1LLWA 3UVAA 2YOCA 3LRMA 3L4TA 2VFHA 1KFBA 5EPDA 3MUZ1 1OIFA 1EXBA 4B3ZA 5C54A 4O11A 1I6NA 3W1QA 3DG3A 4MM1A 3IJIA 1X7IA 3SADA 4G1NA 2WW5A 3UXDA 4DJDD 4GQGA 6ALDA 1GQJA 4LBSA 5BZAA 3PUGA 3PZUA 3ARWA 1QU4A 4KFPA 3G22A 4P7QA 1W1A1 1R6WA 2D0GA 5J04A 2PGWA 4CD7A 6XIMA 2FFCA 2FIQA 2ANUA 1VYPX 4Q7NA 5AYZA 3CV7A 4O8RA 3RNDA 3MPGA 2YCKX 1P6WA 4IUGA 4C6IA 4PCSA 4OU1A 1XH0A 2GVYA 5B7ZA 3BG5A 1AMYA 4H41A 1UWAA 2XUCA 2ZX8A 1SFJA 3L0NA 3PTMA 4JQ4A 1Z89A 3PF3A 3GDRA 1FH7A 3T7VA 1Q6GA 2PDGA 1LL4A 2WJDA 3W2UA 1WO2A 3LRLA 1WKEA 4M56A 4QDWA 1TYGA 5M5DA 4PCFA 1EIBA 1YTDA 3NPUA 4U2YA 1UKPA 4QSFA 5FEPA 4EXBA 5EKYA 3BANA 1K7FA 1UPPA 3AXHA 5HMSA 1G94A 1IIGA 4L1XA 8A3HA 1EPXA 3PP7A 3NDYA 1BYAA 1T8QA 3R5EA 1OX4A 3Q45A 4L80A 4O13A 2NX9A 3W1PA 4B91A 3GU9A 2R91A 4HA3A 1TV5A 3DC0A 1Q4NX 3M0KA 5CSYA 3V0SA 3F1QA 2AQWA 4L9ZA 5AN7A 4B2DA 3BG3A 4O8AA 5AYXA 2R1PA 1SO5A 3CYJA 4R7OA 5BWFA 1X8CA 5A6MA 2Y62A 2CZDA 1ITUA 3CPRA 1Q8AA 2YSWA 3LSCA 1UB3A 2DT0A 2PDHA 4P5UA 1B90A 1TPFA 4JX5A 2CZ5A 1E1CB 1GNXA 1XLKA 3IJ6A 4JTKA 4UMBA 1UBPC 3UJRA 1VGAA 4FSAA 2G41A 5AC5A 1HQTA 1US0A 2WMKA 1HKIA 1W1B1 2WANA 2V5KA 4G1KA 3D0CA 2NLYA 3H2CA 1RJRA 5CAHA 4NT0A 2REQB 2Z28A 4YL2A 2CZVA 4B4FA 4CCZA 4ZBCA 5I03A 4KMQA 3T0BA 2FPTA 4ZFMA 2QS8A 2RJGA 4A3HA 3QZ6A 2C1HA 4DO7A 2HBVA 4IHCA 4Q8NA 2FHBA 4TVCA 1IEWA 3VD7A 4Q33A 3MUAA 4GG9A 3DFTA 1H0IA 5A95A 5A2BA 3WX7A 2BX7A 1I2PA 2WM1A 5HMDA 4FX7A 2QJIA 4O16A 4GY0A 1M7OA 3WMSA 1UR8A 2AGKA 1L6GA 4V1YA 4QIUA 1DJNA 2HDJA 1E70M 3VDAA 3T08A 3ARSA 1BHGA 1WA3A 3SRFA 2GQAA 3CZ8A 2QVHA 3FKRA 4ALDA 5C71A 4Z2JA 3OYXA 2P5NA 2PI6A 2JGYA 3E2QA 3W76A 1OK6A 2A3HA 4MAZA 5C55A 5HR6A 2NX3A 3UY8A 3QQ1A 4UTTA 1W9PA 3QRHA 3SECA 3P2VA 1WYIA 3HPXA 3DYMA 5FACA 2WWDA 1J5SA 4KEMA 5BYWA 4LSBA 1U30A 4YIWA 1DWIM 4FOUA 4TO8A 1HTIA 2BODX 4PBEA 4ATLA 2XVLA 1JXKA 5DBTA 2D2JA 1AQ0A 4LBUA 4B5NA 4OBRA 3P84A 2VVSA 1GPWA 1UWSA 1LL6A 1J4EA 1XICA 1QO2A 1L8PA 3OEXA 3W1LA 3RG6A 2WCSA 1XQKA 3NXLA 3W85A 1UR1A 1H7XA 1J9YA 3GW0A 3HTWA 4NKCA 1ITXA 1SO6A 3UXKA 4PMUA 2XU2A 5M2FX 1O94A 3S5OA 3W73A 3M0HA 4H8HA 4RE0A 2J7FA 3Q65A 3THUA 2BY0A 4IJBA 2PTDA 3ABSA 4M6PA 4OBSA 4AF0B 3IUDA 3M0VA 4QE1A 4GK8A 1I9CB 4AD3A 1Q6RA 2J8TA 2CLMA 3C2VA 1VBRA 3NL3A 1O60A 4FO4A 3VD4A 3AIUA 1O7AA 3OG2A 1QTWA 5D38A 4ADSA 3STPA 4LWWA 4BS0A 4LYPA 3PC0A 4JN6A 3R89A 2XIQA 4IPJA 4MKSA 3WDIA 2RFGA 4S39A 1O4UA 2NVCA 3FV9A 4P8UA 2WHLA 2G97A 3L0KA 1XJBA 2O7QA 4FS9A 4JY9A 1TRDA 4O19A 1OYBA 3M0LA 2X0SA 3NG3A 3QV6A 5C9WA 4O1BA 1ZAHA 2NXHA 1KKOA 1DE5A 1Q6EA 4OBTA 2V69A 2WMIA 3TQKA 4M81A 3PVFA 5CG7A 3FJNA 4AHPA 1H09A 2AMGA 2EEXA 1REQA 2YDQA 3MC5A 4WX2A 1V7AA 2B0MA 4GFSA 2GFTA 3IAPA 4HBKA 4K1WA 1EO5A 3G3DA 2CNCA 2QCFA 1TWSA 2XN2A 1QBBA 1NP0A 3OHMB 4FXJA 4IPPA 4DWSD 4FNUA 3U5YA 2O9RA 2X1IA 4A2SA 4LCQA 1ZBWA 4L6OA 2FMOA 1FP8A 2W92A 2WSRA 3HGJA 4LANA 3B9OA 3RPDA 3TC3A 3KZPA 4O10A 1I8JA 5DBUA 4QDPA 4LF2A 3L67A 4UFKA 3L2MA 2NQ5A 4IMDA 1WOAA 4DRSA 3MJMA 3R10A 1P0DA 1V8EA 1XHGA 1JDCA 3SRHA 4O50A 2E1WA 4O18A 2EPOA 3ITYA 3AMCA 3CWNA 4UQEA 5JU6A 3GVGA 5FJRA 2Q3RA 4UR7A 5LGZA 3WQPA 1R7AA 1W5OA 5KZEA 1X7FA 1SPQA 1OD0A 3PZVA 3QC3A 2VQUA 4NSBA 3VMNA 4Z42C 3OODA 4NQ1A 3NOYA 3QXBA 4A35A 4J3WA 2PMQA 3W7OA 3B4YA 1ODZA 3G6MA 4NZJA 4E2BA 1XUUA 1VPXA 3VIGA 1EP1A 4AYSA 1B4KA 3WSUA 3TC7A 4NZ3A 2BY3A 1VENA 3N9KA 4DIAA 1ODUA 4J2PA 3AHTA 3F7JA 3PWIA 4IG2A 4XK2A 4UTUA 1N8WA 1HT6A 3EWXA 5IDZA 3LA4A 1J2WA 2ZFAA 4HCDA 4JL1A 1LTDA 4Z0SA 1LP6A 3PZGA 4AMAA 3RK8A 2ZA1A 1W9XA 2I1OA 3KTCA 3SJ3A 2D69A 4GY7A 4FXFA 4CVWA 3FYYA 3WLLA 2Y1HA 2J7HA 2YCJA 2HNEA 4OUIA 4MY8A 4B15A 4HD5A 4GO8A 4DUVA 2V3FA 1D9EA 4CNOA 5AYIA 1UOZA 3BO9A 4CNPA 4FHAA 1KGUA 1H50A 3V5FA 1GORA 5KSWA 3TW6A 3NSNA 5K3VA 3YPIA 2Y4SA 3CHVA 1WDQA 4H1ZA 3G0XA 4WZHA 4QJ3B 4WY0B 5CLTA 4RZBA 4FNQA 4I3GA 1WDPA 1PE1A 4B5VA 2HBXA 4AIOA 1E4IA 4R34A 4DBSA 3HF3A 2YL6A 1AL7A 5F1VA 3FN9A 1KTBA 3H21A 4JHMA 4GISA 4DI9A 3PPFA 3SY1A 4N42A 4AD1A 3WUEA 1UKQA 2CBUA 4G9PA 4D1JA 2A4AA 4Y96A 4AVOA 3GLCA 5J5DA 3NQMA 1J12A 4S3DA 1VBHA 2XISA 2YJQA 2YB1A 1LRQA 1P1XA 4LU0A 1E1FA 2QQ6A 1R3SA 3PK7A 3KTXA 4A8RA 5FF4A 1UQZA 2PLKA 2E5BA 3WYZA 3OLEA 3EEZA 4XZMX 3O0FA 4OGZA 3LGDA 4GVFA 3KRSA 2VGIA 4EPKA 2Y8VA 3E49A 1LOSA 1KA9F 1TPWA 2POZA 1I2QA 1LBMA 1A5OC 1MZHA 3M5VA 4MJZA 3LV6A 2J13A 3D46A 4LY4A 1Q65A 4GBUA 2DSZA 3EPNA 1PTAA 5A8OA 3WO8A 4HK6A 3LCIA 2E0PA 4JYFA 1SZEA 1GG0A 4P61A 2DFAA 1E40A 4XZIA 2BTMA 5IBXA 2PB1A 3BCDA 5LKYA 3CAQA 4KERA 1LT8A 2DJLA 1CDGA 1XFCA 3RXZA 1W2VA 4ZO8A 2X1RA 4MMWA 2VC5A 2F2KA 2OO0A 2ZQ0A 3VMOA 3TCSA 3UU0A 1MMFA 3W6YA 2ZUVA 1V77A 1E0UA 5EMMA 5IHRA 1FUYA 2NLIA 1FP9A 3ZT5A 3AIRA 3C56A 2NT0A 2HSAA 5KZMA 3WH9A 1H7PA 2ZXQA 1UD2A 2DVTA 2EHHA 2NZLA 3UERA 3SRDA 3ZQ9A 3CYVA 3GHUA 3BAWA 3M5ZA 2PA6A 3T55A 3WEMA 3QF0A 2G3NA 3GUWA 3LUTA 4ZCWA 1HJXA 4GUGA 3OW1A 3BLEA 3OQEA 1UQYA 2G3JA 3N2TA 4R33A 1L6WA 5FJOA 5D9NA 2Y63A 2BGNE 3MQTA 7PTDA 4QJ1A 1DVJA 3MI2A 3WF0A 3LU2A 3W2NA 3LCFA 3TX9A 5HQLA 1DOSA 3N2XA 3GYEA 4H9VA 2YA0A 4J3TA 2DZAA 4NF7A 1UH3A 3QPYA 4HTBA 2VD8A 4Q8QA 5CLWA 4E8GA 1H1NA 3CPUA 3GX9A 2FVMA 5C8BB 2GLKA 3REQB 1PSCA 3W25A 1H7OA 5H2ZA 3RU8X 1M3UA 4TX9A 2ZZ5A 3C2FA 4I5RA 2EAWA 5A6BA 1F8MA 1JJKA 1Q5MA 2HZGA 4H8VA 1DXIA 4AD2A 2CHOA 3PM6A 4OOZA 4CU7A 4S3AA 5ABGA 4UTKA 7REQA 3LD5A 1O1HA 3USBA 3THCA 4NJKA 3QV9A 3DYOA 1B31A 2PWUA 2BXYA 4MTVA 1OJXA 1NDZA