3LHVA

Crystal structure of the mutant v182a.i199a.v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAAIAGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 84
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhvA00
4ZQOA 1TPEA 5HJLA 3LXBA 2X2GA 3S5YA 4WOQA 1FWWA 3N9RA 3W7OA 2A2IA 4O0ZA 3W7DA 3KRSA 2OT0A 1G4PA 2A5HA 3INPA 3QSRA 3CWOX 4HPXA 4GXMA 5AHLA 1UJPA 2WSRA 4PA8A 2FB3A 3LOTA 3HO8A 4PL2A 3QZEA 4QSHA 1OVDA 4MFEA 4ZQMA 1SR9A 1RQBA 2OMAA 3LCLA 5EPDA 3P62A 5K9XA 2FPYA 3RK8A 2VEMA 3GNNA 1PHWA 2Y85A 2Y7DA 3UXAA 4WJEA 1WOBA 4Z08A 3S1VA 3G1AA 2E09A 3R8RA 1OFDA 3G24A 3L21A 1F2JA 3W73A 4IXHA 3MHFA 3QF0A 1RPXA 2B4GA 5G2IA 3NEVA 1QAPA 5EBUA 2ZRUA 1SO4A 3CPRA 2XFWA 3L2IA 5H2ZA 1EX5A 1I2RA 1R2RA 4BWLA 3PUDA 4MZ8A 4A29A 2CLIA 2B7PA 2G5WA 3W7NA 1CW2A 6ALDA 3NPWA 1SZFA 3S8HA 3W7CA 2Y7GA 1OF8A 3W2JA 2TSYA 4H3DA 2ZA1A 2VEKA 2TMDA 3DI0A 3HG2A 1GT8A 1L6YA 3MI2A 3WK1A 3FJ6A 5HR7A 3CTLA 4FNRA 1RQHA 5LGZA 1UB3A 1VHNA 1J5TA 4MFDA 4ZQNA 3L0KA 1H62A 3HB9A 4N9BA 4IGHA 1GTHA 1K7XA 2YX0A 1TYGA 3NOEA 1Q6LA 4HIBA 2ZTJA 3W2MA 5MHBA 2RDUA 4Y96A 3PS7A 1NEYA 2QCDB 3NG3A 4FNQA 4IX2A 2ZBTA 4N4QA 3BW3A 5FEZA 1ICSA 3PWAA 2Y62A 1AL8A 2CZ5A 3DU0A 4IJBA 4LS2A 3SY5A 2ZRWA 1Z48A 2PRHA 3UY8A 5BW6A 3G0SA 3LTYA 4JTTA 1JULA 2NXIA 3QEZA 1PCKA 4UTIA 3TQ0A 1EUNA 2DZUA 1DOSA 2EGZA 3OBKA 3LDVA 1KBIA 4OGZA 2CWNA 1OFRA 3GKFA 4I7UA 3P7YA 4JX4A 3NQ2A 2PE4A 3G1YA 1OFBA 3CT7A 1KLYA 3HQ1A 2QDGA 2YR1A 4MOZA 3D0CA 3NPVA 2PURA 4N6EA 4UMCA 1V5XA 1JUBA 4LT9A 3E0IA 3GX9A 5E1QA 1FXQA 1D9EA 3DH7A 1GG1A 2CZFA 4GUIA 5BOOA 1VQTA 5CSSA 4O57A 1G6CA 2ZQ0A 1C29A 5H91A 2P10A 1GTEA 4UTKA 2ZCGA 4RR4A 1B9BA 2FDSA 2DP3A 1Y0EA 2VEIA 2KZHA 3HOJA 4ORIA 3G8EA 3O63A 2E5BA 4LV9A 3LHTA 3W9ZA 1QDSA 3C56A 3MYPA 3EWXA 2C18A 4JTJA 4PFMA 3TXZA 1KM5A 5AN7A 1GVOA 5HULA 1GZGA 4UTTA 4OHQA 2FB2A 4JEQA 4Y9AA 1YYAA 1TJPA 3M5ZA 5DCEA 2E1DA 1U83A 2JBMA 3JR2A 1SZNA 4Q4KA 4R34A 2R14A 1PV8A 2X1RA 4JYEA 3O6YX 4O4WA 1Q6OA 3GDTA 1TV5A 1WXJA 2J27A 1M6JA 1HL2A 5U4NA 3ZWSA 3EWZA 3P8IA 4Z1CA 2FIQA 1J2WA 2OT1A 1VC4A 1KFCA 1F74A 3GIYA 4AHPA 2E6YA 3NQEA 5HWNA 3G22A 5I3GA 3W7KA 4KFOA 4GUJA 1G4TA 3HPSA 1OX5A 1ADOA 4EWND 4WXZA 1Q6QA 2RKXA 2ZZ1A 5DN1A 1UUMA 1EUAA 4NQ1A 3LLFA 1UASA 2WJZA 4K6AA 1GVQA 1WBHA 3GAYA 5AC8A 1QPOA 3W7HA 3F4NA 3STFA 3EXTA 3PM6A 4ADTA 2VC6A 5LNUA 3NL6A 4DELA 1ZJIA 1SO5A 3CLMA 1FUYA 1KFJA 2NUXA 2NX3A 3U2OA 4RV8A 4UXDA 3KHJA 2X30A 1XI3A 3DHFA 5AHIA 3TU9A 5K7JA 3BGGA 2RH9A 1N55A 1P4CA 4MY9A 1W37A 4UFJA 3NL5A 1T96A 3QM3A 1FCQA 2WQPA 1S3HA 1JCLA 4NJKA 1OF6A 1TPUA 2ZZ3A 2OX1A 3O8AA 4K7YA 3B03A 4A3UA 5D2TA 1AW2A 5K4ZA 1W5NA 1P5BA 4BI7A 1KV5A 5EL1A 4I7WA 4W9TA 4HPJA 3UZ5A 7TIMA 1K3UA 1DQWA 2GQ9A 1QOPA 1G69A 1LYXA 3IVTA 2YYTA 3I6RA 2A21A 1HTIA 2B7OA 1HO4A 3G8RA 3E49A 3W72A 2ZRVA 3SSJA 2XN1A 4LWWA 1SUXA 1W5PA 3RFAA 1DJNA 2FTPA 4R33A 1OX4A 5CSRA 2XN0A 2QUTA 4XZ9A 4FO4A 4XUGA 4FIRA 3OG3A 4RK8A 3U6WA 3G18A 3TMLA 3C2EA 3G3DA 3QQ1A 4LNYA 4HHPA 3EKLA 1VRDA 3W1AA 1TPH1 3QC3A 3WK0A 3PAJA 2YDAA 1OK4A 4OU1A 3EX6A 1SPQA 2H6RA 1C8VA 4O11A 4ZMGA 2VEPA 5AYZA 1XKYA 1KV8A 1FWTA 3S0CA 1F5ZA 3HBLA 3V1PA 2VFFA 4K37A 2C16A 1DVJA 5KTLA 4O1CA 1B4KA 2VENA 4IPIA 1VGAA 3S42A 3PR2A 4IOTA 1I2NA 4O1BA 3BG3A 5FEPA 1TIMA 4RXGA 1MZHA 2Q3OA 1O5XA 3I65A 4FF7A 4A2SA 3A23A 3RLVA 3M5YA 3G1VA 4K8HA 3DAQA 1YXYA 1AG1O 1G4EA 1SQ7A 2O7QA 2Z1BA 5F4WA 2E77A 4UR7A 2GJLA 2C6QA 3RF9A 3G1FA 4EVZA 1TREA 3G1HA 2C0AA 5TQLA 4H6KA 1ME8A 4NX0A 1XUZA 3IIZA 3T78A 3ZS4A 1QPRA 2Y70A 1KTNA 2R8WA 4JDBA 4M5PA 4PTNA 3IIOA 2AGKA 2V8ZA 1XDMA 2O7SA 1I45A 3P8JA 4K39A 4C1LA 4FX8A 3NYZA 4YCOA 3CEPA 4PL1A 2RHGA 3S9YA 3A5FA 3C2FA 3T4CA 3NXFA 5HR6A 3TXVA 5J5RA 4DO4A 1SZEA 1YPIA 2DU2A 4DBEA 4O0KA 2UV8G 1QOQA 2ABAA 4NNAA 5E0KA 2DZXA 3W7QA 1I8JA 1VYRA 1OX6A 3HIJA 5LZLA 4QQ3A 3IEBA 1TRIA 3GK0A 2E6DA 5F2IA 3OVPA 1LLZA 3M47A 3G0XA 4ZQCA 4AWUA 1ML1A 2YFOA 1LROA 2XN2A 3GXNA 4OQVA 1QFEA 3TC7A 3ZR4A 1HUVA 4NNBA 5AYXA 3F03K 2QAPA 1GJPA 3IRDA 3DBPA 1K03A 1DJQA 3QSTA 3CHVA 3WJSA 1R2TA 1H7RA 2ALDA 2QJHA 3SGUA 1M7PA 4X9SA 4MLJA 1SSGA 4UFHA 4Z1DA 5F2MA 4AWSA 1EWDA 2H3DA 3O16A 4HNVA 4WZHA 4DPQA 3W84A 2ZTKA 4RZ5A 4DO6A 3TA6A 2J9ZA 1OABA 1QR7A 1R2SA 4LW7A 1A50A 1OHLA 2I9EA 1JUEA 4LOCA 4PCFA 1KM2A 4O14A 3GDMA 1D3HA 3FA5A 3KVMA 3M7WA 3KRUA 4YMZA 4HSOA 2NLIA 4AH7A 1TMHA 3MW7A 1SO6A 3C6CA 1XDLA 1VZWA 4OV4A 2V5LA 3EX1A 4XBSA 2ZZ2A 3UY7A 3V75A 1YADA 4AHOA 4GE8A 4Y6GA 4NJJA 4RJEA 2X1SA 2QKFA 3UPWA 4IMCA 4ZZ9A 2EF9A 5HUPA 3KOFA 2V2CA 4O13A 1TTQA 3JRKA 3O1NA 3QMSA 3QMRA 4OT7A 2ISSA 2ATMA 3NPUA 5C5YA 3DXIA 2BLEA 1L2UA 5KINA 3L5MA 1TQXA 4M7SA 2ZRZA 2B7QA 4WY0B 4B5NA 1LLWA 2HS8A 1H51A 5AB3A 3WJWA 2GUUA 1LTDA 1VPXA 5IM51 1VHCA 3GDLA 1G4SA 4FNTA 1A5SA 4EF9A 3N73A 3A9IA 5I3FA 3WJZA 1W54A 2C1HA 2CLMA 4E2DA 4AXKA 2OZ0A 1K8XA 2QCDA 4RLIA 2Z6IA 3GLCA 2J6XA 5AHEA 1R46A 3NQDA 1K7FA 4O28A 1LOSA 3NAVA 5KZEA 1JCMP 3GXPA 1C9DA 2QCMA 3HG5A 3LXAA 5A5WA 3UWQA 5DELA 2DZVA 3THAA 4GBUA 2YZRA 2EPHA 3BLEA 3K30A 3SI9A 1JVNA 3W7LA 3QH2A 1KM0A 1XC4A 3ANYA 3MP3A 1KW1A 1RV8A 1ZY9A 3IGSA 4NUWA 5G4EA 4UTHA 4O15A 1GYNA 1LOLA 1OYCA 2H8XA 3BO9A 3PUOA 4DO5A 2WNNA 2A7NA 1O4UA 1F73A 2NV1A 3GB6A 2OCZA 1LP6A 4ALDA 3EX4A 2OJPA 1OJXA 2GOUA 4JTIA 4M6PA 4S2CA 3W7JA 3TDFA 3BG9A 4MY8A 1WA3A 2R94A 4IMDA 3T7VA 3TSBA 4CQAA 5K9DA 1H60A 1H1ZA 2YFNA 2CU0A 4WX2A 3FKRA 5AYYA 3TUUA 1RD5A 4WQ6A 3OEXA 3TW7A 2JGYA 1A5AA 1W8SA 3GXTA 3G1XA 2NX1A 4A22A 4AAJA 3W1QA 4O54A 4KFPA 1X8FA 2NUYA 1W3TA 2BX7A 2QCCA 1B57A 4NT0A 4UMBA 2ZZ4A 4L4LA 3IVSA 2A0NA 3G3MA 3BVJA 4RZ6A 3KRZA 1LZOA 3FJLA 4RXFA 3PG9A 3IGXA 3BW2A 3NL2A 2YSWA 5G2WA 4MKNA 1T0OA 3STGA 3GVGA 3W85A 5EKYA 1XL9A 3BLFA 4IMFA 4WY0A 2DJXA 1HG3A 2VFEA 5FF2A 3BK0A 1JCJA 4A2RA 5KSWA 1RVGA 3P84A 2WSYA 1IXNA 5D2YA 2DZPA 3LHYA 3TJLA 1SFLA 2VXNA 3PSWA 3MJYA 1T8XA 4O4VA 3MHUA 3LV5A 4RX0A 4AVFA 4CQ9A 1WQ5A 1TPB1 3N9SA 5DLCA 1IXPA 4JR5A 3KXQA 3A21A 2Q8ZA 2AQWA 4AEOA 4JN6A 1LBLA 1YLVA 3FLUA 5BMWA 4BWLC 1F6KA 2VFIA 4P2VA 1TTJA 1TV8A 3W74A 2CZEA 3LTSA 2FPTA 2F7FA 2A7RA 1F05A 3NL3A 5HINA 4LTSA 4N6FA 3HGRA 3Q2DA 1H7XA 2A1YA 1S5VA 3BW4A 3W76A 2QCEA 3I7QA 1KFEA 3W1UA 5KMYA 2E5CA 3NQ8A 5GVJA 4QITA 4U4MA 1O5KA 4OV9A 3S1UA 1GYLA 1DL3A 3W2LA 4GUFA 2H90A 1YDNA 3L0GA 4YL2A 4I9AA 1BEUA 1I2QA 4UTMA 3B0PA 4BR1A 2E6AA 3TCEA 1XBXA 3W2UA 1TO3A 4O12A 3O6DA 3E9AA 3VKJA 5K4XA 5L6UA 5AC6A 4ZL1A 1OFQA 2NZLA 3LRLA 4AHQA 4FEZA 4XTDA 1AMKA 2ZYFA 3ZWTA 1TPDA 3VE9A 1WDWA 2WOQA 1KFKA 1W31A 2J9XA 4BFAA 3W7GA 3W75A 2A85A 1MEIA 4HNNA 5D32A 3UZJA 2CLLA 1KTBA 3LI0A 4Q33A 1F76A 3L67A 4FNSA 4K8EA 2DJLA 1GG0A 4QISA 1FCBA 4MZYA 2V82A 3B04A 1MEHA 1VCFA 5C55A 1R47A 4LS0A 2GJNA 4O52A 4C1KA 4DBDA 3N2XA 8TIMA 5LSMA 2BTMA 3TC6A 4KWVA 2ZDRA 3TROA 1GEQA 4XBKA 5TBOA 1VJIA 4DEFA 1S5WA 2WPBA 2NV2A 2FFCA 3LTPA 3UWUA 2IQTA 4UTUA 1A53A 2GQ8A 5CGQA 3M1ZA 3MHGA 2ZA2A 1DQXA 1G7UA 3MP4A 3L65A 3LV6A 4KKXA 2QCHA 3W22A 3PB0A 3NZRA 3F4WA 4AF0B 2P1FA 2CLOA 4K36A 3LI1A 4RKAA 3TNOA 2BSLA 3I7SA 4TX9A 1K8ZA 2QCLA 5FF7A 4JIQA 3MMTA 1KLZA 3G1DA 2V30A 3C2OA 5C6MA 1GVFA 1W1ZA 4Y8FA 5CZ0A 5F1UA 3E96A 4MJZA 5CKSA 3LCGA 2A6LA 2HMCA 3FS2A 3C52A 4ZVJA 4LVDA 5K3VA 4DF0A 5D2WA 1X1ZA 1I4NA 2ZZ7A 1N8FA 3HG4A 1W5OA 3C3NA 4JTHA 1WV2A 1BTMA 2LLEA 3LLDA 3TFCA 4LC6A 3VE7A 1MXSA 3M0ZA 1F6PA 3O05A 1QMLA 4LVAA 3LB0A 4JD4A 2Z2UA 2ZFAA 4G1KA 3THQA 3M43A 4ADUA 5CZJA 1AW5A 3W3OA 5L9FA 4U28A 4FHAA 4LVGA 2GVJA 3B4UA 1ZENA 4ADSA 1LBMA 3WJYA 4X2RA 3NQMA 1MO0A 5F2LA 3LCHA 4FXSA 4N9DA 1TPWA 2DORA 4JDYA 3H55A 3MYOA 3WK2A 2FLIA 4LS1A 4OE7A 1EP2A 4QJ1A 4CLMA 3UWWA 2JKPA 4O1AA 4UUIA 2HS6A 3DFTA 1V7YA 2FPVA 4HN4A 3PULA 4NU7A 4P61A 2A4AA 3TV8A 4PODA 3NDOA 3GR8A 3PBYA 4IWWA 3IVUA 3NQGA 4JTSA 2Q8LA 3W1MA 1D3GA 5TIMA 3M9YA 3W7IA 2VKZG 1FX6A 1EIXA 2HTMA 3S1WA 2C13A 3NQ7A 1FWRA 2VOMA 3B05A 3PBWA 1NSJA 3SFKA 1Z42A 1E51A 2JK2A 5FEWA 5DCBA 3G1SA 4UFMA 4S1FA 1B4EA 3H54A 4E38A 1NVMA 4A21A 3NO5A 3R13A 3LCFA 3W7RA 5AHNA 4GRSA 1PS9A 1TQJA 2E6FA 4UTTC 1ONRA 4AB4A 3R2GA 1HO1A 1FCUA 1FDJA 4DF1A 1GQNA 3M6YA 4O53A 5AHFA 4DF2A 2G96A 4O50A 3VI2A 2H8ZA 1N7KA 3W23A 4UR8A 1FQ0A 1ZALA 5HQEA 1NFBA 4FNUA 2TYSA 4O19A 5LGXA 3PC0A 4FX7A 4UTWA 1LBFA 4FNPA 2G95A 2BXVA 3IIVA 3HGSA 4E2BA 2Y88A 3O15A 3LHZA 4BK9A 4QM1A 1FY6A 4QIUA 3VCRA 1CI1A 4CNPA 2FQIA 1Q6RA 3GYEA 3QPYA 1W5QA 1LRTA 3B06A 4HKPA 3AO0A 1LM1A 4NXKA 4UNLA 3M5VA 3P67A 1IGSA 3BV4A 3U8GA 3W1LA 1TPVA 5AC7A 3TQKA 4PH6A 3N2MA 1W3IA 3B0VC 3PBVA 3Q94A 1G67A 3OHIA 4WUIA 5HWJA 3C4UA 4JY9A 5DXXA 3PB2A 3TSMA 3W83A 1IXQA 1X7FA 3O06A 1H5YA 3HPZA 4HSNA 5E93A 5LNVA 1P0KA 4LU0A 1LRNA 5AHMA 1XFBA 1SW7A 1PE1A 3R12A 3BPWA 1KBJA 5LNSA 3L66A 3CM4A 4JYFA 4M7TA 1H7WA 3P81A 4LC8A 2TPSA 4MLRA 4O8RA 5FF3A 3P61A 2YPIA 1WAUA 2ZRYA 2X1UA 3W7EA 3W86A 3CQ0A 5F2GA 3NR0A 2X1TA 5HUOA 1OX4B 4NXSA 1H7OA 5FI8A 3KFTA 3W70A 5LHEA 3NNTA 1WX0A 3MO7A 5U7SA 1YTKA 3MBFA 2I1OA 3DHDA 2QF7A 3SJ3A 3GAKA 3LBMA 2WSQA 4UTJA 4TMCA 1JQXA 3DI1A 1JJKA 1H1YA 2RDTA 2PC4A 2QCGA 1DV7A 2DZSA 4EOUA 2B7NA 5FF4A 4FX6M 3W6YA 5FESA 3PY2A 4HNTA 5CZSA 4UFLA 5G2HA 2RDWA 2A7PA 4XKYA 3M44A 2CFFA 3E02A 3FYOA 4JTFA 3TW6A 1GOXA 1SW0A 1QCWA 4PC8A 2QUVA 2ZRXA 5CG7A 4Z0JA 3UQNA 2JKAA 1YXCA 3FYPA 3GZ3A 1EB3A 3EXSA 1MSSA 1ICQA 4NJIA 5A8GA 1W5MA 3EX3A 1EPXA 1EEPA 3P80A 2Y89A 4JTKA 4DXVA 3EWUA 3UWYA 3QW4B 5F4XA 1AL7A 3HGOA 4FB7A 4XQ6A 3B8DA 1SU5A 4N9EA 1TSIA 5KITA 1VH7A 2V81A 4IUOA 4DPPA 2ISVA 4CQ8A 1QPNA 2G97A 4X3ZA 2P0OA 5D33A 3IIXA 4AWTA 4MY1A 2WV8A 4XWUA 3ELFA 5D05A 1XM3A 3RU6A 3ABRA 4DQWA 3BG5A 4JXCA 3PG8A 1XCFA 1Z41A 2WNZA 2CLKA 1W56A 4M19A 4L4MA 4RZ4A 4NZFA 1TPC1 5DY2A 3F1QA 2RFGA 5DXYA 2QJIA 3TX9A 3NQFA 5AOUA 5I3HA 3L5LA 5KZMA 1JRBA 1UUOA 1P1XA 3KAOA 3C2RA 1ZFJA 3W71A 1F7BA 3SW6A 2ZZ5A 3UPBA 3FEMA 1ZAIA 4N9CA 4Y90A 3GR7A 5C2XA 3MP5A 1GVSA 3RNDA 6TIMA 5D09A 3DFOA 1RQEA 2X16A 3LBCA 2F84A 3AJXA 3FKKA 4X22A 4IMGA 1QNVA 2CZDA 3MBDA 3DFNA 3L0NA 3NM3A 3QW3A 4YXGA 1XBYA 1VCGA 1PHQA 3TFXA 4JTGA 3STCA 3FOKA 3PVFA 1IF2A 2B0MA 3T44A 5CPMA 1X1OA 4CCEA 4NJGA 5F4SA 2YW3A 2ISWA 3UD6A 1VYSX 1THFD 3QYQA 3EXRA 1PCWA 4IQLA 3PUEA 1BWKA 2FJKA 4BI5A 2EHHA 3WK3A 4XTIA 5D37A 1JR1A 3NVTA 4O17A 3QJAA 3SZ8A 1XBVA 3QPZA 3ATYA 1W3NA 1TTIA 3QQ0A 4CCDA 2Q3RA 1KFLA 4UTWC 1I2OA 3LRKA 3NQAA 5CPLA 1K02A 3TR2A 2NXHA 3T55A 3ABOA 4NX5A 1BWLA 2PRMA 3CIXA 3P5ZA 3TKFA 3TH6A 1Z44A 1SSDA 5HWMA 2C3ZA 4Z0SA 4K38A 5T26A 3W07A 5I3IA 5D2VA 5D38A 2TRSA 1ME7A 1FDYA 2HSAA 3BLIA 4TU1A 2E68A 1DHPA 1W0MA 3DFPA 3P82A 5FF0A 4E0CA 1LRQA 2CW6A 1OFOA 3UXDA 4LUJA 3OA3A 2BWGA 4Z1BA 1YDVA 1TTPA 4N2YA 2C15A 1L9WA 1PIIA 1T99A 3EKZA 3CB8A 3DKJA 1A5CA 2VELA 4JGDA 1X6UA 3EB2A 4JNMA 4LRTA 4LV4A 4RCXA 3CEUA 4UCGA 3A22A 1IXOA 2CLFA 5FEXA 1H50A 1I2PA 4GUGA 3R89A 2WO5A 5EMUA 3LM7A 2WNQA 5DBUA 3WJXA 3S5ZA 3R5EA 1GVRA 1PL9A 4UFKA 2YGYA 2NXGA 3ZFHA 1P0NA 2YW4A 1G7VA 1OYAA 2JKEA 4O16A 4JIPA 5HMSA 1NAL1 2V2DA 1IIHA 1ICPA 3EWWA 3W1XA 4TO8A 1WBJA 2Y6ZA 1M7OA 1SZGA 1TJRA 5G4WA 5BNKA 2NX9A 1SW3A 4UTLA 2ABBA 3N14A 5ABTA 4PEKA 1EP3A 2GQAA 4HT3A 3M41A 3C61A 3QMTA 3P74A 4OWGA 3FIGA 3I7RA 4NJHA 1OFPA 3LX9A 3HG3A 3KVKA 1KTCA 3CU2A 3QFEA 4WXYA 3VFLA 4UNKA 4LVFA 3NQ6A 3MI6A 2DZWA 5G1YA 4IPJA 4ICNA 3P60A 4ONVA 1QO2A 1O94A 3MWAA 3CWNA 2WKJA 2NWRA 1KM4A 1H7PA 1ZAJA 3DKLA 1XBZA 3C0JA 3RMJA 3IV3A 1JCNA 3OVQA 3LCIA 3EWBX 1QPQA 1OK6A 2C14A 1XUUA 2QDHA 3TK7A 2QEZA 5D04C 2A6NA 5IBXC 3EWYA 4GWEA 2VFDA 3DFSA 1AK5A 3SECA 4Q32A 3W1RA 5K2ZA 2W0UA 2QJGA 3W2NA 1YTDA 3SR7A 3CIWA 3STEA 3A5VA 2BZNA 1FWSA 2QCFA 5LNWA 1FBAA 1OFAA 2YYUA 2JGQA 4JTEA 1TPFA 1VLIA 3NQCA 4I7VA 3GKAA 2V2HA 1WOAA 3MI3A 1JCXA 1UBSA 3MUXA 1VLWA 3ABQA 4MPQA 4GUHA 4O10A 4LRSA 4UMAA 1JQVA 4TIMA 3HGJA 2AAMA 3LCXA 4QAIA 3KVJA 1FCVA 3LHUA 3USBA 5AFDA 2W79A 1DORA 5DCDA 3H53A 2QUUA 3G0UA 4IMEA 3S5NA 2ATSA 1OFEA 2C19A 5J5DA 4GFSA 1TB3A 3B0UX 1NF0A 1JCYA 4MIMA 1O60A 2NWSA 5G5IA 3P5YA 1BKSA 1LORA 2QAFA 3UNDA 3HJZA 3L68A 2EAWA 1K7EA 1LCOA 2PRLA 4M6QA 4OBTA 3RLUA 3S6DA 4BI6A 4XKYB 3DGRA 3TSDA 4IX0A 3W7MA 3LERA 1KM1A 5D2XA 3EX2A 2Y63A 1L6SA 1DKWA 1FDZA 3NA8A 3OIXA 5CZTA 1R30A 3W7PA 2H3BA 5K9CA 4LY8A 5CPOA 2VFGA 5LNRA 3HMJG 4QNEA 3UWZA 5D02A 2Y7FA 3FFSA 3UWVA 1ZCOA 3BARA 3GDKA 4GC4A 3TIMA 3M16A 4YCPA 2R91A 4R53A 3NGJA 3E12A 4CNOA 1U5JA 2V0TA 2CLHA 4CNNA 1EWEA 1KFBA 3N34A 3NQVA 1KA9F 1B3OA 3N3MA 1Q45A 1TRDA 4JTUA 2GPTA 4TMBA 3NPXA 4JY8A 3KX6A 5BMXA 4NVTA 3OVRA 4KFNA 4WOZA 3TJXA 1QWGA 4JICA 3DZ1A 1ZNNA 4YLWA 5CPNA 3LCWA 4MZ1A 3IGUA 4GJ1A 4YWIA 5LHFA 4Z1AA 1IIGA 3LGEA 2V5BA 1VCVA 2J88A 2J9YA 1YTEA 4R7JA 4NNCA 1TCDA 1ZAHA 3A24A 4AF0A 1DBTA 3NZ1A 3GDRA 3NM1A 4FIQA 3W1TA 3TAOA 4HNUA 4UIOA 4ORMA 1FXPA 4MYXA 3N19B 4POCA 1KM3A 1PVNA 1M5WA 1XXXA 1HFBA 1LDCA 5DBTA 5KZDA 3L9CA 5I3JA 1UCWA 2DZTA 4MUZA 3SIZA 2Y61A 4MJMA 4LUIA 2E5DA 3W2KA 3LHWA 4ML9A 1FWNA 3QRHA 4KWWA 1EP1A 2V9DA 4N4PA 3W88A 1S5TA 4JYDA 5EY5A 2ZA3A 3BGJA 1QO5A 3C8FA 1O95A 1GWJA 4UFIA 5D03A 4EIVA 1TV7A 1ME9A 3YPIA 4JX5A 4QNWA 3GNDA 2GVLA 2VFHA 5D30A 3ATZA 2W6RA 1JUKA 3L5AA 1MEWA 2YCEA 1CX9A 4LVBA 3SGZA 3S5OA 3W87A 3WFAA 3LRMA 1YXDA 2ZZ6A 4UC5A 3I68A 5F1VA 4K7VA 3JS3A 3PBUA 1H63A 3TMQA 1K8YA 2Z6JA 4GNJA 3W1PA 3HPXA 4EF8A 1LOQA 3PF3A 3LHVA 1WYIA 5EA9A 2I14A 4JS3A 5C54A 1A5BA 1ALDA 1YDOA 2J24A 3EEGA 5I3KA 3LXCA 2EKCA 3Q58A 2GVGA 1JRCA 1YPFA 1J4EA 4S2BA 3PSVA 4BF9A 3Q37A 4MVAA 1OYBA 1Q3NA 5DY3A 4FXRA 5EYWA 3S1XA 3HF3A 2PCQA 2CLEA 3C2VA 1L6WA 4CCCA 4O1DA 1AW1A 1H7NA 3DENA 1VS1A 5G1TA 3KVLA 3TE9A 3CC1A 1RZMA 2QCNA 4WD0A 1VYPX 5LKYA 4O18A 3O6CA 2Z0IA 2Y7EA 4IXXA 1VR6A 2D73A 4N02A 3IIPA 4NZJA 4TR9A 4ZQPA 1EA0A 1SFJA 1SO3A 5BRBA 4JX6A 3TAKA 2YXGA 4AMAA 3VNDA 1KM6A 1RR2A 4H4IA 3M5XA 3T40A 4WY0F 4MYAA 4J9JA 4ZQRA 2NUWA 1GPWA 1H61A 1ZHAA 2QR6A 3O07A 4M6VA 3TQVA 1NF7A 1OG0A 5HNRA 3ABSA 3DFQA 4JTLA 5SWUA 5IBXA 3W1NA 4D2JA 3UYCA
chains in the Genus database with same CATH superfamily
3FXGA 1OC5A 5HJLA 2YIHA 1QI5A 4CEXC 3S5YA 4WOQA 2OZTA 3F4CA 3N9RA 2XIIA 4GXMA 5AHLA 1UJPA 4HA4A 4CU6A 1PIFA 4PL2A 1B3ZA 2EO7A 4JTQA 3R79A 3A13A 3KLLA 4AW7A 1W1PA 4HQVA 4CQCA 2Y8VA 2J7FA 3E0WA 2O9TA 4XD3A 4IPNB 1WOBA 4Z08A 3LGGA 5TAOA 3GR4A 3L21A 3W73A 3MHFA 2B4GA 3NEVA 5EBUA 3IJLA 2XFWA 2OYLA 3BMVA 2V69A 1I2RA 1R2RA 4BWLA 3FXYA 2BVWA 4DI8A 4D6CA 1NDZA 5C0QA 2QVNA 2FHFA 1EJVC 4LUTA 4GQ0A 1J0IA 1V51A 2ZX8A 3W2JA 4ACYA 4Q6JA 1M01A 1E71M 6XIAA 4LBSA 3FJ6A 4H9XA 5AVHA 4FNRA 5PTDA 1RQHA 3QZAA 2X41A 3AXMA 4H8VA 2ZXBA 4PUNA 1OC7A 1J5TA 4ZQNA 1HX0A 4U2YA 4AZ5A 4IP4A 3UU0A 1NELA 1K7XA 1I6NA 3VIGA 1DE5A 4JNZA 5ENLA 3O7UA 2RDUA 1FH9A 1O5QA 1WCGA 2BASA 5AY7A 3SCWA 3WH6A 5I77A 3R0DA 4BA0A 1US0A 2V5DA 4FNQA 3BL3A 2ZBTA 4PBFA 1RY8A 4N4QA 1ISXA 4CCZA 4YYCA 3TTQA 1ICSA 3MMDA 4LS2A 5CXPA 3CUXA 4C6BA 2VTFA 4QJ5B 4R7WA 1JULA 1UYQA 4RPPA 4XUYA 2XINA 2NXIA 5A1AA 4W88A 4FALA 2DZUA 2VZVA 2OFJA 4NP7A 3N29A 4OGZA 2I56A 1B5TA 3P7YA 4JX4A 1MVYA 1GNXA 4MDOA 1OFBA 3CT7A 1KLYA 4ZO9A 4MOZA 3D0CA 1M04A 3VGDA 3QV9A 5CC6A 4WKAA 4UMCA 3EAUA 3GW0A 1TVNA 3MUZ1 1JUBA 1X1NA 5E1QA 1BD0A 1FXQA 1KR0A 4U31A 4C6DA 1IEIA 5CG0A 4GHRA 2ZQ0A 3AIQA 1C29A 4UTKA 1H3GA 3UETA 1JNEA 3PANA 2DP3A 1E4MM 2VEIA 3DOPA 4I5RA 1HT6A 3O63A 3PZGA 2FDMA 2KX9A 4LV9A 4QEEA 1QTWA 5E0FA 5DQPA 1QDSA 3TXZA 1UWIA 1KM5A 1GVOA 1YPXA 4RE2A 4OHQA 2IKJA 1T41A 3ARUA 4H41A 1SZNA 1TZ7A 1S46A 3LK6A 4JYEA 3O6YX 4OUEA 3BCJA 3SN1A 4O4WA 1DXFA 3GDTA 1TV5A 1UD5A 4QEHA 3GVRA 3N3TA 1B2YA 1HL2A 1YMYA 4Q4PA 2ACQA 4IL0A 1J2WA 1H1NA 3WCZA 1VC4A 1XV8A 4KEZA 2HK1A 4KFOA 4A8RA 5M5DA 1J0HA 4MKVA 3PZOA 1ADOA 2IMRA 2HRWA 2WCGA 3CO8A 2RKXA 1UUMA 3GVWA 4NQ1A 1PDZA 2VGIA 1C7SA 4U2ZA 1GVQA 1OY0A 1WBHA 3SCSA 3N2TA 3B9OA 1CLXA 2CBJA 5AC8A 3HPFA 1JPKA 3VIMA 3STFA 1E55A 2E0PA 4LYQA 1ZJIA 1SO5A 1Q5MA 3CLMA 1F3EA 1FUYA 1KFJA 2CITA 2NX3A 1W3HA 2YL5A 3DHFA 5K7JA 1M41A 2RH9A 1N55A 1P4CA 3IJQA 4HB7A 1E4NA 3GVVA 1M03A 2VCAA 1OF6A 2ZZ3A 3GD6A 4QX4A 1AW2A 1W5NA 3NSNA 3EPOA 4BI7A 5EL1A 3TZNA 3ITXA 1KCZA 4HPJA 4PMNA 4M0XA 3HJEA 1HKVA 1HJXA 2GQ9A 2ZKMX 3VOIA 1LYXA 3IVTA 4KCWA 3IK2A 2WZIA 3T8LA 5HMEA 3G8RA 3W72A 1W5PA 3RFAA 2FTPA 4MB1A 3MV11 3WEMA 2QUTA 4XZ9A 4FO4A 4XUGA 1UPMB 4FIRA 3C0QA 3VD4A 1AQ0A 3EA1A 3TMLA 2HNEA 3EKLA 9CGTA 4B15A 2OSXA 1T40A 1K9EA 3ZJ7A 2DIJA 3PAJA 2H6RA 3WH5A 4O11A 3S9IA 2WHMA 1RJQA 4E3TA 2D2GA 5A2CA 4C7FA 1KV8A 3NZPA 3HBLA 3VUPA 2C16A 4EWJA 5KTLA 4O1CA 4L5ZA 1B4KA 2WCAA 1UR9A 1VGAA 1OINA 1P0BA 5T9CE 1I2NA 2E8ZA 1HKIA 4JHOA 3I65A 2Q3OA 3A23A 1JZ4A 4HPHA 1D7FA 5CC5A 1G4EA 2E77A 1UD8A 4W93A 4UR7A 3E0FA 2OWWA 3RF9A 4PBEA 4EVZA 5HK4A 4MDPA 1TREA 4IFOA 1UR2A 5G1MA 4H6KA 1ME8A 2P88A 3IIZA 2VGGA 4PB3A 2ZXAA 4PTNA 1FHLA 3IIOA 2GYIA 2V8ZA 2REQB 2ZUUA 2O7SA 1I45A 1S2UA 3CZ8A 4IHCA 3WLQA 1XYMA 4S23A 2FTWA 5GNYA 4MJ4A 1W1VA 4QBXA 3LENA 5AKQA 3CZJA 5EFFA 3T4CA 3NXFA 4HOWA 4FLRA 5HR6A 1SZEA 3B9EA 3H2FA 3V16A 1WUFA 1P1MA 4Q22A 6REQA 3HIJA 1YQ2A 1HKKA 1W3LA 4HN8A 1PUDA 2UBPC 2E6DA 3OVPA 1DJGA 1LLZA 3M47A 3G0XA 4AWUA 3GXNA 1QFEA 2Y24A 2BY1A 3USZA 4JTRA 1GGOA 2QAPA 1K03A 5LYRA 4IGSA 2QJHA 2HPMA 1M7PA 4X9SA 4MLJA 2HE5A 1PTDA 1EWDA 4XAFA 1JL8A 3DN5A 1UIOA 4NAEA 1ONEA 1OABA 4PTDA 3TW9A 1V6XA 4ZE5A 1WUEA 1Q7MA 1WXYA 3TJIA 4B5TA 1KM2A 1D3HA 3M7WA 4YMZA 4HSOA 2NLIA 4AH7A 1SO6A 1LQAA 1UD3A 1XDLA 3SJNA 5LA0A 3U2EA 4AHOA 4GE8A 1DWAM 3OQEA 5HANA 3V35A 4Y6GA 4NJJA 4RJEA 4A3YA 2D3NA 3P6LA 4IMCA 3VNLA 4O13A 3V7PA 1TTQA 1DJXA 4OT7A 2QJJA 3QMRA 3DHUA 3LM3A 2ISSA 3CJPA 2CXEA 1BQCA 5C5YA 2BLEA 4PRWA 4C65A 1K6WA 3QOMA 5KINA 3DDMA 2INZA 1EQPA 1EFZA 2HS8A 3GH5A 3VOFA 1LTDA 1G4SA 3VC5A 2WJFA 3HQNA 4PTMA 4FNTA 5H8MA 3VZXA 3N73A 5I3FA 1W54A 4U10A 2QCDA 2J6XA 3SGGA 4D1JA 3EGJA 2O9PA 1K7FA 1U5VA 3U3HA 1JCMP 4GVHA 1RBAA 4P5UA 2QCMA 4JTDA 4HYVA 1WDQA 7PTDA 3UWQA 3H21A 3QLDA 1FFRA 5DELA 3THAA 3HV8A 2YZRA 5KZ6A 1NY1A 3TYBA 2EPHA 3BLEA 2JEQA 3TJ4A 1KNWA 3RIKA 1IT8A 3LUTA 3QGKC 1Q7QA 3GHSA 3QV8A 3GUWA 1OYCA 2QIWA 4NZ5A 1VPYA 3DBNA 2WNNA 4HCLA 2OCZA 3WYZA 3ORWA 1UH3A 4JKKA 4JIHA 2A3EA 1PSCA 1OJXA 4JTIA 4DHGA 2DZAA 2ZX5A 3EA3A 1WA3A 2AMGA 1ESWA 4CQAA 4DAFA 4HA1A 4Y9NA 5E5CA 2REQA 5AYYA 3OEXA 2FH8A 1SFSA 1A5AA 4HTBA 4YYFA 2A79A 4YTTA 1L6FA 2NUYA 4L4LA 2UWFA 1QI2A 3UEQA 3BUVA 3KRZA 2OZ8A 4DJED 3NL2A 2O4QA 1J0ZA 4YVPA 5G2WA 1R0MA 3UF9A 1TVLA 3WLJA 2CXGA 2DUAA 3ARWA 5FF2A 2VL4A 3BK0A 1DXIA 3P84A 5D2YA 3RJXA 3LHYA 1LWJA 3TJLA 3W82A 3Q4DA 2WM0A 3UP8A 2W61A 4O4VA 3MHUA 4RX0A 4AVFA 4CQ9A 1WQ5A 1TPB1 3N9SA 5DLCA 1IXPA 3T05A 4AEOA 3VM5A 4JN6A 1LBLA 2DW6A 2Q02A 2OYMA 3QGAC 3SCQA 2PDPA 1KD0A 2A7RA 2OR2A 4AVNA 5HINA 4N6FA 3Q2DA 2A1YA 2J77A 1RBOB 5IOBA 4XIMA 4CD7A 1F8MA 3MMWA 2QNEA 4GIEA 1E6XM 3MO4A 4OV9A 4HK6A 3W2LA 1E5NA 3CMJA 4GUFA 4I9AA 1XH2A 1I2QA 2OLHA 3S9ZA 3B0PA 4BR1A 2E6AA 1E1EA 6TAAA 1ITQA 3V0TA 1MZRA 2D2HA 2VM8A 3BE7A 3O6DA 4KWSA 2YA2A 5L6UA 2EBNA 1OFQA 2G37A 3WUGA 4HTYA 4FEZA 4DZIA 2ZYFA 2EPNA 3ZWTA 3EA2A 1TPDA 2WOQA 2J9XA 4JNYA 3W7GA 3P0WA 4MKSA 2PAJA 1KTBA 3LI0A 3F2BA 2VQUA 4FXFA 4IT1A 4YVVA 1PKMA 2QIIA 5DMYA 1GG0A 3BZJA 4P7OA 1FCBA 2PTZA 4MZYA 4EXAA 1MEHA 4XV0A 4O52A 3PFRA 4ZO6A 1O68A 4GYPA 1GUVA 1GZ1A 3IPWA 2BTMA 4MB3A 1H2JA 2DT2A 5ECVA 3LZ3A 1GEQA 4AD5A 3UWUA 1EJRC 2IQTA 3TYUA 3ZO9A 3PZTA 7REQB 1R7OA 1G7UA 4HZ6A 4L1GA 3LV6A 2UZ9A 3GWQA 3PB0A 3F4WA 4G7EA 4AF0B 2X42A 3TNOA 3WX7A 1EYWA 3OA5A 5D9NA 3T09A 3G1DA 4B5UA 3C2OA 3T2QA 3JUGA 4LPCA 3UZWA 5F1UA 1GVEA 3LCGA 1ISZA 4P7RA 2W4XA 4DZHA 2FYMA 5K3VA 1I4NA 4B3ZA 3HG4A 1J96A 5LA2A 3UGRA 1W5OA 3N6HA 1GZJA 1MFUA 3LU2A 3NUKA 3SCVA 3VE7A 1MXSA 3RRAA 1CGTA 3T0TA 1DWFM 5CSYA 3RPMA 5C7VA 3H22A 3LMZA 3THQA 4F0HA 4GYPC 4HPGA 3MV01 3BMWA 3GVQA 3B4UA 4ADSA 3H2AA 4X2RA 1XJBA 3NQMA 1MO0A 4N9DA 2DORA 4B5XA 4JDYA 5DRCA 2WW5A 1CT5A 4BY3A 5E0CA 1Q6GA 4LS1A 3C2YA 4QJ1A 4H9TA 2JKPA 2HS6A 1PJ9A 1V7YA 2FPVA 3UYIA 1EJUC 4P61A 3W37A 3CMFA 3TV8A 2PDQA 1UZHA 4WJ8A 4Y2WA 1AZ1A 4PMDA 1R3VA 3WQ4A 1D3GA 5TIMA 4WRHA 1WZMA 3W7IA 2VKZG 3ITYA 4QLKA 5A8OA 2J78A 1Z42A 2JK2A 4J3WA 2PDLA 3SAZA 5B7YA 4GZJA 3C0LA 1K70A 2D1ZA 3RO8A 4J3TA 2GVEA 5H8UA 1VBUA 3GRIA 3NO5A 5AHNA 3CZKA 5H6HA 3SCNA 4FLSA 4IP5A 4AB4A 2FKPA 4P7NA 1FCUA 1FDJA 5AHFA 2VD9A 2G96A 3N1AA 1J18A 1ZALA 4QRNA 3QN3A 3PPFA 3OODA 3KCJA 1LBFA 4UTWA 3WLMA 2BXVA 3HGSA 4E2BA 2WLZA 3O15A 1TR1A 1FY6A 4GVFA 3BAJA 5LIKX 5A2AA 3VCRA 3LPOA 4FLOA 1A3XA 4CNPA 3VIIA 1NWRA 1Q6RA 1TX2A 3GYEA 1LRTA 1LM1A 4NXKA 3ARRA 4QFUA 3P67A 4HOXA 3ZR6A 4B3LA 1Q6CA 2PWUA 3AYRA 4PMYA 3TQKA 3N2MA 3B0VC 3Q94A 3BLOA 3OHIA 4WUIA 3UA3A 3G1RA 2W66A 3TSMA 3O06A 1G1YA 4CNSA 3OBEA 1IEWA 5LNVA 3SQLA 2V3FA 4LU0A 1QI0A 1XFBA 1SW7A 1PE1A 3DYPA 2O9OA 1UA7A 1H7WA 2QS8A 3BC9A 4EXQA 4MLRA 3OG2A 2V68A 3C86A 1GQJA 1TUXA 4ZOCA 1Q2SA 3NR0A 4NXSA 2HV5A 3KOZA 3KFTA 2D22A 5LHEA 1WX0A 1PX8A 3SM0A 3AALA 3MCMA 2EPMX 3GAKA 4H04A 2WSQA 4UTJA 1IQ8A 1W2PA 3SFWA 4OZOA 1PTGA 1E72M 4EOUA 3PY2A 4HNTA 5CZSA 3BH4A 2RDWA 2A7PA 3M44A 3FYOA 1BAGA 2GJXB 4Z2IA 4GI9A 2BHUA 4PC8A 3LGDA 5CG7A 3MS8A 3OGRA 3PFMA 3FYPA 4ATLA 4AD0A 1EB3A 3EXSA 1ICQA 3BXWA 4ML4A 5A8GA 1W5MA 3EX3A 2RJGA 1KGXA 3N9KA 1RCQA 4JTKA 4XX6A 3IK4A 3VZYA 4DM2A 3BURA 3QW4B 4QROA 3EWCA 1E56A 3ZLFA 3UCDA 1UC5A 3KHDA 3TN5A 1SU5A 1F4HA 2W9MA 3B8UA 4IUOA 2PSNA 3AIEA 2G97A 3GTIA 2P0OA 3EYPA 1UMLA 3H24A 4MY1A 1MXGA 1JFHA 4XWUA 3BSHA 2WC3A 3H12A 4C6NA 4DQWA 3BG5A 3PG8A 4LJ3A 3U7BA 1Z41A 4DJFD 2D23A 4IUGA 3N13A 2WHLA 3F1QA 1JIBA 2XH2A 1XLLA 4UQDA 3L5LA 5KZMA 1VFOA 1JRBA 1KB3A 3S5SA 1Q2RA 1SYTA 3SW6A 2BVTA 3FEMA 5C2XA 2XVKA 3U7VA 3VXGA 3W01A 3D46A 3I10A 2HNHA 4RDYA 1RQEA 1OCQA 2G8ZA 4IMGA 1I1XA 5J8LA 3A3HA 1YBQA 1QBAA 4IQDA 1PHQA 4JTGA 3F4VA 1I60A 4PZVA 3NCOA 4OIFA 2B0MA 3T44A 4DIAA 4EE9A 4CCEA 3FAXA 1E6QM 4Y9OA 1KCKA 1NM9A 1PCWA 3WK3A 4ZE4A 3T4WA 3I3EA 1XBVA 3QQ0A 2FTYA 4UTWC 4IM4A 3NQAA 5CPLA 1OD8A 4NX5A 4XVDA 2XPKA 3GC2A 3CIXA 4LBRA 3TH6A 1KR1A 1Q6EA 3IANA 1CXKA 1LUCA 4J2PA 1I1WA 2C3ZA 4K38A 1FWEC 3W07A 2X09A 2XYLA 4CGTA 1O1ZA 3VGEA 2TRSA 1FDYA 3GU2A 1Q4WA 1D8CA 3VOCA 4TU1A 3BCDA 5E70A 1W0MA 2G4FA 3DFPA 5FF0A 4OECA 1UWSA 4XISA 1ELSA 3K4AA 3UXDA 3WDIA 3ANUA 2BOGX 4J3XA 2HVMA 4N2YA 2C15A 2XVPA 1WDRA 1L9WA 3KWXA 1NDVA 4JGDA 1X6UA 4F0RA 1UP2A 3WL1A 2ACRA 4RCXA 4UCGA 5JVLA 3A22A 3ARQA 1XF0A 4F0LA 1HKWA 4NHVA 3Q67A 1Q8JA 1V6YA 2DDXA 4CD5A 5EMUA 1T5AA 3LM7A 4ZR8A 5LXXA 4BF5A 2R1LA 1IR1A 4IIGA 1GQKA 1OYAA 1R86A 5HMSA 3T6CA 2INFA 1ICPA 1UKOA 3QR3A 1DTUA 2OQHA 4G9PA 3VM7A 4UNIA 4Q4RA 2XWEA 4C6EA 4ZTYA 3TOYA 5A6LA 1WBJA 1R9XA 1EEXA 2VR5A 4E2VA 2NX9A 2YBTA 1ODZA 2XVLA 4FK9A 4QG9A 3BZGA 4KRTA 4PEKA 2PDUA 1XCXA 3M41A 1T8QA 2IW0A 3P74A 3QMTA 2YZ5A 3RM4A 4NJHA 4MWAD 3HG3A 3RRXA 1KTCA 4B3KA 4LVFA 1WDSA 4E8GA 1XR2A 1QO2A 1O94A 3CWNA 2WKJA 4IGNA 2A3HA 3HFYA 1OCBA 4B9ZA 3SRKA 4L9YA 4D6HA 1GK8A 3RMJA 2NSXA 4O1EA 3DYOA 4LALA 4GMEA 3OW1A 3K8LA 2YOCA 1XUUA 2Y4SA 2QDHA 1R9ZA 3OZOA 2DSUA 1EDGA 3EWYA 2VFDA 3DFSA 1PB0A 4IJRA 3W1RA 3TA9A 2W0UA 5HJXA 1H41A 3W2NA 1V0NA 5EU9A 3STEA 3QHOA 2VP8A 2JGQA 4JTEA 4JKMA 3PZVA 3MI3A 3MQTA 5C2CA 4DXXA 3K1DA 1GQIA 4KGLA 2CBIA 1IEXA 3GG8A 4GUHA 3RCYA 1KCXA 1B1YA 4WKFA 4ZB0A 1JQVA 4TIMA 1RVKA 2AAMA 2GZXA 1TFVA 5HPOA 1FCVA 1HN1A 3GDBA 2NLYA 2HQAA 1DORA 4JZ5A 2IKIA 5J5DA 2FGBA 2FMOA 3R0KA 1JCYA 5G5IA 2ZX6A 1BXCA 1M1BA 3L68A 3WNMA 1K7EA 2J62A 3RLUA 3IJ8A 3DGRA 4IH3A 2P8CA 4HMEA 1R30A 4GGBA 1Q7ZA 2VR4A 4LY8A 3WD4A 4QNEA 2Y7FA 1W1TA 4OOZA 3RLHA 1FP8A 3CO4A 3GDKA 4GC4A 3M16A 4W89A 1EJWC 4Q4MA 1HGYA 4R53A 4CNOA 2V0TA 3LPGA 4Q7NA 4W85A 3A4JA 1GOWA 1EWEA 4C6MA 1XLAA 1H11A 2GSHA 2Z2AA 1GORA 4HMCA 3SCTA 3N3MA 1WKYA 1TRDA 1CYGA 4JTUA 4GVGA 2FGZA 5BXSA 5DMLA 4WOZA 3TJXA 1QWGA 3KZPA 3WD1A 3DG7A 3DZ1A 3VIOA 3R25A 2X0HA 3RX2A 5LHFA 4Z1AA 1ZJHA 3BLPX 4RDVA 1IIGA 4C1NB 3K4DA 1SM9A 2P50A 1VCVA 2J88A 2J9YA 4JL1A 4C6QA 4CUCA 1TCDA 3A24A 4AF0A 4KMQA 4ATDA 3W1TA 2YJQA 1UJQA 4UIOA 1KM3A 1FWIC 3FCPA 2Y61A 3GTNA 3PJWA 3QRHA 2V9DA 1SJAA 5EY5A 1JAEA 1QO5A 1GWJA 3S2CA 1ME9A 3YPIA 4QNWA 4C6PA 3GNDA 1LG1A 4ZA0A 5CBJA 3UZYA 5D30A 5DX7A 3N2OA 3L5AA 2YCEA 4LVBA 3W87A 3V18A 3LRMA 4DWDA 2ZZ6A 1QHPA 3ARZA 2EPKX 2YLAA 2F6UA 5IRPA 3OYZA 1XYBA 3AS2A 3AXHA 2OSYA 1W17A 1K9DA 3LHVA 5EA9A 4GYJA 1YDOA 1FKWA 3WDPP 3Q45A 4MG4A 2EKCA 3NSXA 1J4EA 2YA0A 5DY3A 1XRVA 2A3BA 1JXKA 1KGWA 3DIPA 2PCQA 3CPUA 4WDTA 3PNZA 3ES8A 4O1DA 1H7NA 3DENA 3KVLA 4WD0A 1DJZA 4O18A 3WL0A 2Y7EA 3OLGA 1DJIA 4IISA 3GBEA 3F2DA 3IIPA 3RMEA 4ZQPA 5MKGA 2PZNA 3CT2A 4NKCA 2AQVA 3VNDA 1JYNA 4H4IA 3AUJA 4WY0F 1FWHC 4MYAA 4ZQRA 1LLOA 7CGTA 1TMQA 4MNLA 1VIZA 1YIXA 1UROA 5KEZA 1ZHAA 1EDQA 2QR6A 4IMAA 1K1DA 3TQVA 3W00A 3WF3A 2P76A 4L80A 3T0DA 3ZSTA 4UTFA 5HNRA 3ABSA 3OHMB 4JTLA 5IBXA 1VEOA 1NFGA 4D2JA 2GVYA 1Z69A 4WSHA 4F3HA 1TPEA 3EDKA 5FA5A 3UPMA 3RM8A 5LIYX 3QZ6A 3A4WA 3HPAA 3B97A 2FVKA 4O0ZA 2C1IA 3KRSA 2OT0A 3GIQA 2P5NA 4FOKA 3WY1A 2A5HA 3QSRA 4HPXA 4S3DA 4JEJA 2WSRA 4PA8A 1M53A 3EOUA 3HO8A 3QZEA 4YJ5A 1TELA 2VUNA 1NDYA 2NVDA 5MKGB 1BG4A 3P62A 5K9XA 2PD9A 4ZB2A 1XRFA 2VZUA 3GNNA 1L8NA 1J2BA 2FJUB 1MNSA 2DW7A 3S1VA 3G1AA 4XZIA 1S38A 3R8RA 1OFDA 4Z2HA 2XIOA 2Q6ZA 3QF0A 3VNKA 1CEOA 1KRMA 1D8WA 3L2IA 1EX5A 2QXWA 1OIFA 1GKQA 2PDWA 3PUDA 4P7LA 2B7PA 3W7NA 1YE4A 1CW2A 5FJJA 3NPWA 1SZFA 3S8HA 2XM1A 2YKKA 2Y7GA 3V4BA 3CASA 2ZA1A 3KWSA 3AS0A 3HG2A 3N6JA 1GT8A 1L6YA 1UWQA 3MI2A 4I6KA 2OELA 1CGUA 5HR7A 3CH9A 3B0XA 5LGZA 1UB3A 1VHNA 3CUGA 4GG9A 1K9TA 3GUGA 2ZWZA 2GUBA 3L0KA 2NQLA 4N9BA 2FHBA 1RK5A 4M1RA 2Z4GA 4PEEA 1GTHA 5FSEC 4HIBA 2ONEA 5CGMA 2FZDA 4Y96A 3UZZA 5D9MA 3THCA 2YDSA 3E2RA 5BXTA 3EDDA 2QCDB 1GCYA 2J7BA 1GHRA 2PGWA 3SEPA 2J25A 4GBDA 3PWAA 2Y62A 1QI3A 2FZNA 3G77A 3DCPA 1A3HA 2PRHA 3UY8A 3VOGA 3G0SA 4U5KA 4F79A 4CN4A 2OKOA 1PCKA 4UTIA 5FAJA 4ZCWA 1EUNA 4GQQA 2I57A 1DOSA 2EGZA 1F4AA 3GFYA 4PMQA 4S3CA 3OOQA 4WKHA 4I7UA 1EGVA 3GW3A 3NQ2A 2PE4A 1M3UA 2DZBA 2W27A 1W32A 2QDGA 3NPVA 1Z3NA 1PKLA 1IE7C 4KCUA 5EBAA 1GG1A 2CZFA 5BOOA 1MRAA 3QY7A 3LBOA 3DG6A 4LUSA 1GTEA 1I75A 1B9BA 3FGCA 3HOJA 1L6GA 2E5BA 4C6CA 1KXQA 3LHTA 2V5KA 3W9ZA 2R1PA 3URBA 5C9XA 3E2SA 3MYPA 4PFMA 3L4TA 4PCNA 4DZAA 5FL0A 1GZGA 2L5HA 5A8MA 3W02A 4UTTA 2BVDA 4JEQA 1YYAA 2AOSA 4ZSUA 3M5ZA 3PUGA 5DCEA 4LAMA 3OTRA 4R34A 1IZKA 4MSSA 4J28A 2OGYA 3NVDA 1Q6OA 3IRSA 1ZB5A 2OKTA 2F2HA 1D2KA 5ABEA 3F5LA 3P8IA 3AFBA 2FIQA 1KFCA 3GIYA 1MNZA 2E6YA 3U0HA 5HWNA 4W7WA 5I3DA 4GUJA 4LQ1A 3ECQA 4PTWA 4DY1A 3WLTA 3L4UA 4S3FA 1Q6QA 4EPDC 3MVTA 1EUAA 1US2A 3QQWA 4YNGA 2WJZA 4K6AA 3UESA 1XH1A 2PU1A 5BYWA 3TYZA 4MPKA 3R8HA 1QPOA 3BJSA 3F4NA 3URAA 2BGNE 3PM6A 3VIJA 4Y9PA 1E43A 5LNUA 3UA4A 1P0EA 1UOKA 3ARXA 3U2OA 5I5RA 1KXVA 2X30A 5AHIA 1CTNA 3GH4A 1XIGA 5JIPA 3WN6A 4AY1A 2HJPA 1W37A 3NL5A 2X40A 3SURA 4AX7A 1FCQA 4E4FA 1JCLA 1KXTA 1POKA 2PTWA 4XB3A 1DIOA 1ZRQA 5C71A 2V63A 2OX1A 1JD7A 1BF2A 3GFXA 3TCSA 3O8AA 4K7YA 1NP0A 3B03A 5D2TA 1V3HA 4OUIA 2CBUA 3KOYA 4KGJA 2WHJA 2PP3A 1EBGA 4LY4A 4B5WA 7TIMA 1K3UA 3DECA 2BGSA 1QOPA 2BHZA 2YL6A 4LFYA 2B7OA 2FVLA 3GG7A 5GJPA 3SSJA 1ZUAX 1J0YA 3IJ9A 2XN0A 1HJSA 1PZ2A 3VDAA 4RK8A 1XLGA 3U6WA 1MMFA 4LNYA 2ZXQA 4IIEA 1TPH1 4H2CA 3WK0A 2E8YA 3HU7A 1ISWA 3SADA 5BRQA 1OQFA 5AYZA 2ZICA 1FWTA 3BICA 1F5ZA 4QE5A 2VFFA 1CNVA 4K37A 2HWGA 2OLSA 2VENA 3XIMA 2OB3A 3S42A 4FF7A 4A2SA 3M5YA 3N25A 1M68A 3G1VA 4D72A 3DAQA 1YXYA 1HQTA 2PA6A 5F4WA 1CB7B 1JEZA 1P48A 4QP0A 2WK2A 3TC3A 3G1FA 4LUSB 2C0AA 3R8GA 3VVGA 1TE1A 4PBGA 1QATA 7REQA 3KP1A 4LUYA 3K5XA 2Y70A 2HEJA 4M5PA 2XWDA 4Q8MA 1J12A 2AGKA 4K39A 1QASA 2J79A 1XLDA 2V6AA 3NYZA 3WQOA 1JGMA 4TV6A 3SUUA 1PDYA 2OOFA 2PDYA 3VD9A 3CEPA 4XO7A 4MNMA 2RHGA 3A5FA 2PODA 5JMUA 3WBWA 5A94A 3F4DA 1A80A 4IIDA 3K8MA 1XIDA 3NURA 2DU2A 4XD5A 1JDFA 5FOOA 1VENA 4AZGA 5E0KA 3PPGA 1KKRA 2E1WA 1VYRA 2PDKA 5D9OA 2VMFA 1TRIA 5FD0A 3WNLA 1B3VA 2J8TA 5F2IA 4DWSD 2YFOA 3AMDA 1LROA 2XN2A 3TC7A 4NNBA 2XFRA 1GJPA 3DBPA 3WJSA 1R2TA 1JDCA 1H7RA 2ZE0A 3VZZA 3SGUA 3H4WA 2EG8A 5F2MA 4AWSA 1OSEA 3AMCA 3O16A 2G50A 3EB4A 4HNVA 4LAKA 3W84A 1H5VA 4JKLA 2ZTKA 4X0NA 4DO6A 3AJ7A 2J9ZA 3TA6A 4L4PA 4LW7A 4QDWA 5JIWA 4I6VA 1LWHA 3VTRA 1JUEA 3AIRA 1FH7A 3MANA 4E2OA 1XG4A 3FA5A 3WLKX 3KVMA 3KRUA 1JYVA 1OG6A 2EJ1A 3MW7A 3C6CA 1VZWA 3UY7A 2ZZ2A 1YADA 2I5GA 4CD6A 1TG7A 1NJJA 3UPWA 4GJJA 1VBRA 4ZZ9A 2EF9A 5HUPA 1U1UA 2V2CA 3JRKA 1GOIA 1S3TC 3QMSA 2ZUMA 1CXLA 3V1HA 4RE3A 4KBXA 4B9YA 2ATMA 1XLBA 3NPUA 3DXIA 3L5MA 2EPLX 1TQXA 1W1B1 4WY0B 1QHOA 4GXPA 1TJ1A 5AB3A 3WJWA 5JBFA 4C1NA 3N15A 4NZ1A 5IM51 4ZENA 5CJNA 4JIEA 1A5SA 3A9IA 3WJZA 2MNRA 3LQLA 2C1HA 1B31A 2OZ0A 4QG6A 3OU8A 1HZYA 1J10A 2VGBA 4W86A 4CD8A 5AHEA 1TWZA 5GJNA 1OADA 1LQ2A 4ZOEA 3NAVA 3W53A 1Q8AA 4DNHA 5A5WA 1I9CB 2DUXA 2VGFA 3RXZA 4GBUA 4Z2JA 4YTQA 3K30A 3SI9A 4O1FA 1VPQA 1UWUA 4W8BA 2AL2B 4XD6A 2PWDA 3MP3A 1RV8A 4NUWA 5CLWA 4GK8A 3PUOA 2F38A 4C6LA 2A7NA 1O4UA 4OBSA 1F73A 2NV1A 1YHTA 4DZ5A 1LP6A 4DJDC 2O4MA 1OB0A 2DFAA 1V93A 4HHLA 2OJPA 4S2CA 2E9MA 2QW5A 1EH9A 3HN3A 4MY8A 4LB4A 3TSBA 3JVAA 1H60A 4Z1YA 3DYMA 2CU0A 2C91A 3ES7A 3KDNA 3TUUA 4WQ6A 3WDJA 1AJ2A 2XH4A 1W8SA 3GXTA 3G1XA 2NX1A 4A22A 1AH4A 1IWBA 1QNPA 1W9PA 3MUAA 2NT1A 4NT0A 2OTDA 3C0SA 5JH1A 4GYFA 5JXQA 1UPPA 1E6ZA 2BXZA 1O6IA 3VCCA 3BVJA 4RZ6A 1QW9A 4RXFA 3PG9A 3KL3A 3GSMA 3BW2A 1QNSA 3SCPA 2DH2A 3STGA 2NQ9A 3W85A 5EMKA 3BLFA 3L4WA 2XIBA 2DJXA 1HG3A 2VFEA 2WVUA 2XUCA 1ONWA 1HJQA 1V03A 3OZPA 2DZPA 1UR0A 4K2SA 2Z1XA 4F0SA 4AZ7A 1T6MA 1PPIA 4LAZA 2ZOXA 2C71A 3GU1A 3MJYA 2Y5EA 4K3ZA 1EDTA 2PBOA 1JAKA 4JR5A 4WDUA 3UFYA 4LB3A 2PWEA 2BOFX 3VKDA 1F6KA 1Y5VA 2VFIA 3W74A 2CZEA 4IFRA 1F05A 4QDPA 4Q8UA 1RUSA 3VNIA 1O7AA 2QCEA 4NYYA 5KMYA 5FJTA 3NQ8A 4LSBA 4ZO8A 2PP1A 5A6JA 4FLQA 1LG2A 4DYKA 4GOAA 2XZ9A 2HISA 1LUCB 3L0GA 1YDNA 3MT1A 1NQKA 2V67A 1VJSA 1XBXA 2J8GA 4D9PA 3PZQA 4O12A 1RAKA 5AC6A 4AHQA 4XTDA 2D24A 2OO0A 3ZSSA 4LBUA 7TAAA 1W31A 1G01A 2A85A 3GZAA 4GH3A 2CLLA 4GQBA 2XISA 1JF6A 4R27A 2CKSA 4GI6A 1VCFA 1R47A 4LS0A 2EXOA 3UCQA 4DBDA 3HTWA 2GJRA 2WMFA 2OX4A 3OGVA 3EKGA 4I9MA 4EK7A 2WPBA 1OBAA 3LTPA 4H19A 5CGQA 1LL4A 3MHGA 2ZA2A 4LYKA 2QCHA 1RBLA 3W22A 4IIFA 3NZRA 2CLOA 3LI1A 1EL3A 2BSLA 1A4LA 3I7SA 4TX9A 3QR1A 2PPGA 1K8ZA 3T2PA 4LNCA 3SBFA 5FF7A 1KLZA 5C6MA 1XFCA 1EBHA 5C9ZA 4Y8FA 2IPJA 5CKSA 4V1XA 3AHVA 1AUSL 2A6LA 4FPSA 4FOUA 4LVDA 4GA8A 1FA2A 5D2WA 3MSDA 3SQMA 4AY7A 1EJTC 1WV2A 1BTMA 3TFCA 2OXNA 5T8GA 5BCAA 1F6PA 1JPMA 2MANA 2CCRA 4LVAA 2BBFA 3LB0A 2WAGA 4G1KA 3CYJA 4P8UA 3V36A 3RCNA 5CZJA 3W3OA 4PUJA 5FAGA 2ZE3A 4U28A 4FHAA 3N12A 4LVGA 2GVJA 3QTPA 1Q13A 1EJSC 1ZENA 5I00A 1UA3A 4UQ9A 1RD6A 1F3WA 1TPWA 3CV2A 1S2WA 2PZ0A 1WZKA 2Z2BA 2FLIA 1VAHA 5E6ZA 4OE7A 4QDMA 3NIYA 1EP2A 4CLMA 3UWWA 3DFTA 4HN4A 3PULA 5IHSA 3CQJA 2A4AA 1BYDA 3NDOA 4P8VA 2VC7A 3PBYA 3NQBA 1TWWA 3IVUA 4TV5A 2D0HA 4UWMA 4LXFA 4AVOA 2FVMA 3M9YA 4DBSA 3IJ6A 1EIXA 3ARSA 2A3CA 2AMXA 3B05A 1U5HA 5REQB 1E51A 3G1SA 4UFMA 2ASHA 1B4EA 3CPGA 2PWHA 4N0RA 3I6TA 3R13A 3RR4A 3W6LA 1ONRA 4UCFA 1DPMA 3R2GA 3VGGA 1GQNA 4A8LA 4BJHA 3M6YA 4O53A 4DF2A 1VFUA 1Q66A 4GH1A 4HCHA 4J35A 3N2CA 3WH7A 2H8ZA 4UR8A 2PD5A 1NFBA 3R43A 5FSDC 2X0SA 2C8NA 5LGXA 1NP2A 2Y8KA 4DLMA 1V3LA 3KCLA 4RNJA 3U2CA 4GIYA 2WXDM 3NZQA 4AUBA 3LHZA 4BEQA 1W91A 5A6BD 4TUFA 3II1A 2WM1A 2UY4A 1UH4A 5BOEA 1KGUA 2OZ3A 3FVDA 2PDIA 1VRXA 4C5YA 1W5QA 4UNLA 3M5VA 2EEXA 3TYDA 2PDJA 1G0CA 1TPVA 3WNPA 1BXBA 3PPCA 1G67A 3VIKA 2XG9A 1E9LA 1XP3A 2YL9A 3BQ6A 1R8LA 1XRTA 3MDUA 3HPZA 1P0KA 1CCWB 1LRNA 2YB4A 3L66A 2ISFA 2GK1A 4M7TA 8XIAA 1IWAA 1EOMA 4LC8A 1WAUA 4YHGA 5CSUA 4NAFB 3W86A 2VRJA 3CQ0A 3WKZA 5HUOA 3AHXA 3CH0A 3VO0A 1A5UA 1YTKA 2J75A 3MBFA 4W8AA 1YNQA 5I06A 2RGLA 3CXOA 3QKZA 2PS2A 3U9IA 4PCPA 3DI1A 1JJKA 3N18A 3SCRA 2QCGA 1DV7A 1HW6A 2DZSA 1E3XA 5FF4A 4DI9A 5C9UA 5FESA 1P43A 5HQLA 1TR9A 2GOKA 4K68A 1JZ8A 3TW6A 2E40A 3FV9A 1W1IE 4Z0JA 1J79A 1UR3M 1YXCA 4W5UA 3GZ3A 2GJPA 1ZBCA 2NVCA 4TVDA 4UZUA 3B3DA 1XIEA 2FFIA 3P80A 4J5NA 4DXVA 2QDDA 4I9TA 4KETA 5F4XA 1JGIA 3V5CA 4XQ6A 1JI2A 2QULA 3FNDA 3SUWA 1AODA 2NQZA 4TQTA 4DPPA 2VX5A 4D8AA 4LAOA 4JIRA 3IIXA 4AWTA 4RL3A 4X60A 4GVIA 4F8XA 2WV8A 4X63A 3GH7A 4S3JA 1XM3A 7ODCA 3AXKA 1C3FA 5BU9A 3WQWA 2DH3A 5BOFA 1S2VA 1ZS2A 2CLKA 4M19A 1JDAA 4L4MA 4NZFA 1TPC1 1C92A 5DXYA 5DT5A 2QJIA 3NSMA 1JZ2A 1UUOA 1DIEA 1P1XA 2J7EA 3C2RA 3W71A 3A6OA 4ZODA 4N42A 3ITOA 4AD1A 3AYTA 3F7JA 2R9RA 4YPJA 3MP5A 1W9DM 4I8YA 1GVYA 1TWDA 3HMCA 4ATWA 1UD4A 2HZGA 3LBCA 3AJXA 3FKKA 2GSJA 4AXNA 3L0NA 3QW3A 1XINA 4YXGA 1A5NC 1S39A 1BHGA 3TFXA 2CBVA 3J7HA 3STCA 1HJWA 4PE8A 4KCTA 4Z2KA 4KIEA 4AEFA 1IF2A 2WC4A 5CPMA 3TN3A 5F4SA 2YW3A 3QYQA 3EXRA 4IQLA 4XTIA 1A0DA 2DUZA 3AMLA 3SZ8A 1EHAA 1GYMA 3ATYA 1TTIA 5IDIA 1KFLA 1QBBA 3VKCA 3CUJA 4GQGA 3GXIA 2G3NA 2RUSA 1IWPA 1K02A 3ME3A 3V0UA 1CGXA 1EYEA 2PRMA 4JAWA 1NQ6A 1VFTA 5HWMA 4Z0SA 2V3DA 3RX3A 5I3IA 3GO2A 4A8NA 5D2VA 5D38A 3RPDA 4X2PA 4KPLA 2HSAA 1ZZMA 2C79A 4XZLX 3SB0A 1X97A 1Q6DA 2CW6A 1OFOA 4LH8A 3QHNA 1E0WA 4HK7A 4Z1BA 2YCJA 5DMMA 5ABHA 5H8PA 2D69A 3S6OA 3R1ZA 1TTPA 4HZ8A 1PIIA 1E0TA 3CB8A 1A5CA 2DT0A 2GGIA 1V6VA 3RUBL 1IXOA 2DVUA 5FEXA 1I2PA 2JIEA 4FI4A 4GUGA 3M0XA 3R89A 4FR6A 1Z9AA 5AYIA 2FGLA 2WNQA 3I4EA 4HZMA 2HK0A 1GVRA 1PL9A 5AYBA 2NXGA 5C9RA 4E4UA 3R11A 4DLFA 2Y5SA 4I5UA 5C8BB 1VEPA 3P0XA 1IIHA 4PUDA 3EWWA 3NEHA 2Z24A 2Y6ZA 3GFZA 1FH8A 3RM9A 5BNKA 4OJYA 2ABBA 4DUWA 1Z89A 3SCUA 3N14A 1V77A 5ABTA 4LYRA 2C7FA 1V3MA 3VCNA 4Y8EA 1KRBC 4H1ZA 1FRBA 4HP5A 3N4EA 3KVKA 2VT0A 3VFLA 1A5KC 2BDQA 1XHGA 4UNKA 2JF6A 3AIBA 3PJXA 3NQ6A 3MI6A 1JG9A 3TTYA 2RDXA 3P60A 1ZBWA 3MWAA 3VILA 3STPA 3T0BA 3UR5A 2QF8A 3OIHA 1QRQA 1XBZA 3IV3A 1XQKA 2EJAA 3EWBX 3POCA 1L2QA 2ACUA 1DWGM 4GJIA 2DSKA 4ROQA 3P93A 1B3WA 4KQNA 4URIA 5D04C 3T2OA 3TWAA 3OLIA 4GWEA 4JN8A 5JBEA 5K2ZA 1WKEA 1TCMA 2C0HA 3H7VA 1CZ1A 1YTDA 3SR7A 3QV7A 1FBAA 1Y8BA 1TPFA 4I7VA 3MUXA 4UOJA 4IQJA 1VLWA 3O6AA 1AH0A 3RAOA 1RP9A 2XH0A 1DJWA 4LANA 3U4FA 4DWSA 4O10A 5A6AA 3LCXA 1UQZA 3KVJA 2HXUA 4HJWA 4J3SA 1UZ4A 3USBA 4AWEA 3S5NA 4IMEA 4WEVX 2QZRA 5HPCA 4EXBA 4GACA 2XU2A 1F3XA 4MIMA 1EX1A 1R5YA 4R9XA 6A3HA 4MMWA 1XYLA 2QAFA 3HJZA 1LCOA 2PRLA 3MUY1 3S6DA 4IX0A 5I7GA 1KM1A 3E38A 1DKWA 1KQYA 1N82A 3GC4A 1UD6A 3H23A 2VFGA 3UWZA 3FFSA 3UWVA 3T08A 4JTCA 3BARA 1SMAA 3VDHA 3U48A 1GW1A 3E12A 1U5JA 1U33A 3QYSA 1P7TA 2WMIA 4CNNA 1OCNA 1J0JA 3CK5A 3A9BA 4PB4A 2VEGA 1PX3A 3VC6A 1XIJA 3PJUA 1CIUA 3NQVA 2CIPA 1W1A1 4TMBA 3NPXA 1QI4A 2INEA 4NVTA 2IKGA 2QGYA 3JZUA 3OVRA 4B16A 4JICA 2Y2WA 1XLFA 4HHMA 2AKMA 4GJ1A 2OVLA 4YWIA 2QPUA 4G2DA 1UHVA 1GVIA 3V5FA 3LGEA 2V5BA 3U4AA 1LQ0A 1YTEA 4BKNA 5E9XA 4NNCA 3TZFA 1ZAHA 2XDFA 3NZ1A 3GDRA 4ZGYA 4PMJA 1XQLA 5A6MA 3TAOA 1S2CA 4POCA 3N19B 3PZUA 4LX4A 4NRRA 1LDCA 5DBTA 5KZDA 2QMJA 2WNWA 2DZTA 1O66A 2IPWA 3W2KA 3LHWA 1EP1A 3VD7A 3KBJA 2JFEX 4N4PA 3W88A 4JYDA 4D6FA 3PTMA 3BGJA 5D03A 1NOUA 4UFIA 4EIVA 3ANVA 3ISIX 2VFHA 2W91A 3U2ZA 4JL2A 1BVWA 1JUKA 1RPKA 4XIAA 2YLLA 4ZEPA 3BV7A 3I68A 3JS3A 2G0WA 3DC8A 3KL5A 1K8YA 1GOOA 1LOQA 2EG6A 2I14A 3REQB 1A5BA 1R6WA 1ALDA 3EEGA 2GVGA 1YPFA 2G3MA 1TV3A 3Q37A 4MVAA 1OYBA 4FXRA 1PKNA 3HF3A 4G6CA 2YBUA 4INFA 1AW1A 5G1TA 1P6BA 2PFHA 1RZMA 1VYPX 1TWIA 1BGAA 2JF7A 2Z0IA 1VR6A 2D73A 2YXOA 1CENA 3A3XA 3N11A 3PTQA 1EA0A 1SO3A 1MQQA 3AISA 4JX6A 3AS1A 4AMAA 1KM6A 1RR2A 2I7GA 1B90A 3E1F1 3M5XA 3SY1A 4J9JA 3ZM8A 4WIWA 1GPWA 5FJIA 1XPGA 1FWCC 3WQ8A 2VD8A 1DIDA 3GYCA 4XD4A 3CHCA 3S6TA 1PWLA 2BMBA 4H7CA 4IIBA 3PK7A 4EX4A 4ZQOA 2WBGA 3M6DA 3LXBA 4CD4A 3CAKA 5EB8A 2A2IA 1EF3A 3E5PA 1V0KA 4D8LA 3D3FA 1ITXA 3OLEA 3INPA 4JCLA 3CWOX 5A95A 2FB3A 3LOTA 3LMYA 4QSHA 3WH8A 1OVDA 3MY9A 2WC7A 2DVTA 1SR9A 2OMAA 3LCLA 1RCOB 5IFTA 3B40A 3FHAA 3KTSA 1MW2A 2Y85A 1RSCA 5B80A 4GY0A 2ZUWA 5JU6A 4IXHA 2V5JA 4O0QA 5G2IA 1SVDA 2EG7A 4GZEA 1BPLB 3CPRA 1W8GA 5H2ZA 4KCVA 1UUQA 1CLKA 3K4WA 4MZ8A 2ZXDA 4A29A 4ENLA 3WQEA 4H8UA 6ALDA 3W7CA 1TUFA 1OF8A 1YNYA 3QXBA 1PX4A 2VEKA 2TMDA 3DI0A 2W92A 6ENLA 5HA7A 2BODX 1L0PA 3WK1A 1OZQA 4X9YA 3CTLA 1Z6KA 1REQB 4MWAA 1XWYA 2F9RA 1H62A 3DFHA 1EKOA 2YX0A 1W9VA 1RA5A 3NOEA 3W2MA 5MHBA 4P8WA 1NEYA 3NG3A 1V3IA 1SJCA 1LWIA 3BW3A 4WDWA 5I79A 3WUFA 5FEZA 4M8UA 5DMNA 5KETA 4YTUA 3M64A 3R10A 4IJBA 4BQ4A 4O8AA 4C6KA 3SY5A 4GQRA 2ZRWA 1F3TA 3LTYA 4JTTA 1NFPA 3W4RA 4DVOA 5M03A 3LS9A 3UJRA 3VAVA 1KBIA 4PSRA 1OFRA 3GKFA 3H26A 3EDJA 2FHCA 5AECA 1RH9A 4WGHA 3HQ1A 2YR1A 4OVXA 2PURA 4N7QA 2ISDA 1BLIA 3OGSA 1MXDA 4N6EA 4V28A 1EJ7L 4LT9A 4QLJA 3E0IA 2HDJA 3DH7A 3N2BA 1VQTA 4O57A 1G6CA 1XSIA 1IT0A 3OB8A 2P10A 2ZCGA 5JUVA 1R87A 5BRPA 2KZHA 3G8EA 3SRDA 1CLVA 3U5UA 3UJ2A 4YS1A 3C56A 4C6IA 1AJ0A 3EWXA 2R82A 2C18A 4UB9A 3KDOA 4J3UA 5AN7A 1IGWA 1ZTVA 4C6FA 5HULA 4H9MA 3MZNA 4W87A 2FB2A 5C9WA 5LA1A 4Y9AA 1TJPA 3AYVA 4PUMA 1JNDA 3V0SA 1U83A 2JBMA 2J7HA 3JR2A 4Q4KA 5HNTA 4G7FA 4D6EA 2X1RA 3K8KA 3CB3A 1TJ2A 2Q09A 2J27A 1YX1A 4WHBA 3ZLHA 3KRBA 5U4NA 2PU0A 3APGA 1TZZA 4NF7A 3GNPA 2C1GA 2OT1A 1CXEA 4AZIA 1ZU8A 5ABGA 4AHPA 8CGTA 4PN2A 3MB9A 2NQJA 4A35A 1G4TA 3C5QA 2VZSA 2AKZA 4EWND 4WXZA 4RDWA 3KOXA 4G8TA 1IR2A 2ZZ1A 3LLFA 3LY0A 2J7DA 2W63A 4KRUA 5I0DA 3GAYA 3RG6A 2QJNA 1TJ0A 3TYCA 2IQ0A 4XKMA 2VVNA 3SCOA 3WD0A 5HATA 3L2LA 3GNXA 4XZBA 3KHJA 4DJFA 1XI3A 3TU9A 3AC0A 3O0FA 3SIMA 4YHEA 3BGGA 1E1CA 2SFPA 2VZTA 2OOGA 4MY9A 4UFJA 4Y9MA 1T96A 4MNKA 1C8YA 4KWOA 2A3LA 1W6TA 1IT7A 2YCLA 1TPUA 3E0LA 3FN9A 3GXDA 2Z1SA 4A3UA 5K4ZA 5CH9A 5I23A 1KV5A 1POJA 4I7WA 1MW3A 3UZ5A 1V6UA 1E0XA 2DVXA 1VIWA 4AU0A 3ONBA 3UR2A 3UVAA 3I6RA 1K9FA 1NWUA 3E49A 2X8RA 2P3ZA 3GIPA 5DO8A 1SUXA 1DJNA 4Q7BA 3NZGA 4Q4OA 2VX6A 4WDXA 4WF7A 3O9NA 2I9UA 3QQ1A 4HHPA 1VRDA 2XGIA 5HQMA 4I8DA 1VFFA 3QC3A 1E5JA 4KRZA 1N8WA 4OU1A 3EX6A 1SPQA 4BS0A 2ZUSA 1XKYA 1ZJAA 4DUVA 3CMGA 1H0IA 4WR3A 4E5TA 4JOMA 4C7GA 1DVJA 1X6NA 2NSOA 1B30A 3PR2A 4IOTA 4O1BA 3BG3A 4ZXOA 1TIMA 4RXGA 3EPMA 3RLVA 1JD9A 3PZMA 5CJ5A 1SQ7A 1IV8A 2FZMA 1ENUA 4C6OA 1HL9A 2GJLA 2F2KA 4FMVA 4DWSC 1C7TA 4QGCA 5TQLA 3E0VA 3HQPA 3XISA 4FA3A 3T78A 3M0MA 3A3WA 2Y8UA 1KTNA 4JDBA 2GGGA 2PDXA 3P8JA 4DN1A 4S3GA 4C1LA 1X39A 4FX8A 4H6QA 5GNZA 1DWIM 4YCOA 3BAKA 4PL1A 2GDQA 4Q8NA 3EMCA 2R6OA 1V7AA 5GQBA 3TXVA 4DO4A 5M3WA 2VCCA 3AHYA 1YPIA 4DBEA 3MZ2A 4O0KA 4EP8C 1QOQA 4NNAA 3VKAA 1OT2A 4C7DA 5AZ1A 3MA8A 1OX6A 5LZLA 4QQ3A 3IEBA 3GK0A 2DV0A 5BU6A 4FS9A 4ZQCA 1ML1A 2RJHA 3ZR4A 2FZBA 3DX5A 4JBRA 3F03K 3IRDA 1DJQA 1V0MA 3ZR5A 3VKBA 1SSGA 3AWOA 4UFHA 3N17A 4ICMA 2H3DA 3K2GA 3HA1A 4WZHA 4LEQA 4DPQA 4HBKA 3PN8A 1JI1A 2GGHA 3VNZA 2WMIB 4DM1A 3WLLA 1QR7A 4RZBA 1R2SA 3WF4A 3BCFA 4Q4QA 3L4XA 1WE5A 3M46A 4LOCA 2WVVB 4O14A 1WAWA 4OV4A 2DQWA 4XBSA 1FHUA 3O2LA 4S3BA 3WSUA 2ADAA 3M0VA 2GQ3A 2E9LA 2QUMA 4QXIA 2QKFA 4PMOA 4H7ZA 3KOFA 3O1NA 2D3LA 3KE0A 1E73M 3L4YA 5C70A 2DT3A 2VJXA 5J04A 1L2UA 4WVXA 1XIHA 2ZRZA 1WZLA 4B5NA 1E1CB 1LLWA 2BGQA 1P7TB 3BOXA 3WDRA 1DXEA 1KRAC 1VPXA 3AHTA 3GTHA 2V38A 3GU9A 4QE1A 4IGMA 2VVSA 3GY1A 4MM1A 3WMLA 3RDKA 3D6NA 3T8QA 2CLMA 2G3FA 4PGLA 4AXKA 4E2DA 4QJ4B 4RLIA 2Z6IA 3GLCA 2YCKX 1R46A 3NQDA 4O28A 4DBUA 1LOSA 3AWNA 4QS5A 5KZEA 1CPUA 3ZLGA 3GXPA 3GHTA 1O1HA 3I3DA 1EIBA 3KBVA 3HZ3A 5CQ1A 4JTAA 1X6LA 3LXAA 3ABZA 3LN3A 2DZVA 5G4HC 3CWHA 3V3WA 3PBGA 3L2MA 5DEZA 3G5EA 3W7LA 2BS9A 4JHMA 1KM0A 2VUYA 1KW1A 1ZY9A 3UG5A 2VI0A 3CL6A 3IGSA 4O15A 1GYNA 1LOLA 3TWBA 2H8XA 3BO9A 3TLQA 4DO5A 3WUEA 2PDCA 5EMJA 3URNA 3TVAA 3TONA 3UXLA 2PTDA 4PCTA 3EX4A 1X38A 4L9ZA 2OG9A 2PF8A 4M6PA 1JPIA 4LEFA 3WQFA 3W7JA 3TDFA 4PULA 5EMLA 2R94A 3T7VA 1H1ZA 3VINA 4H6EA 2D2JA 5HMDA 1QHZA 2P0IA 1FWBC 1QW7A 3EOSA 3SY8A 5GPRA 2VR2A 2JGYA 3W1QA 3VOJA 1GONA 3VK5A 1Y5XA 3WQ6A 1B3YA 2A3AA 3FX4A 2VZOA 1X8FA 1W3TA 2QCCA 1FVPA 4GZIA 4UMBA 2ZZ4A 2OYKA 2A0NA 2QT3A 3G3MA 4MWAE 1XLJA 1UWRA 4DYJA 4MKNA 1T0OA 4XG1A 2PDMA 3GVGA 4OTKA 2E28A 3UGVA 3M7SA 4EPKA 4IMFA 1KWGA 4WY0A 1H0GA 1CWYA 4RNFA 1SGJA 5CLTA 4A2RA 5KSWA 1E4IA 2WSYA 2XIJA 1C91A 2JALA 2QV5A 4BZYA 1P6CA 5A6SA 3H2NA 5DANA 2VXNA 3MTWA 3PSWA 3LNMA 3LV5A 4J3ZA 1JF5A 1LL7A 3MJMA 3A21A 3UT0A 2Q8ZA 2AQWA 1QT1A 3FLUA 3H2EA 4LCQA 5FKYA 6PTDA 2J7GA 1TV8A 3APYA 2F7FA 3NL3A 1BKHA 1EGMA 4P8XA 1S5VA 5EMYA 1KFEA 4REQB 3W1UA 4DJEC 2E5CA 2WJEA 5GVJA 2X7WA 4U4MA 1UKSA 5GNXA 1O5KA 4XSLA 4HNOA 3ZVHB 3AS3A 4L56A 1ZP4A 1W1YA 5HNNA 4H83A 4WSKA 4UTMA 2H9AB 1REQA 3TCEA 3FJ4A 4Q8OA 3W24A 4PMXA 1IYXA 3HV9A 3VKJA 4EACA 5K4XA 3LRLA 4R85A 1TIWA 1AMKA 4UOQA 4X61A 3SRFA 1G94A 3VE9A 1WDWA 4BFAA 1E15A 1OIMA 2IKHA 4CN1A 1MEIA 4HNNA 4L64A 3UZJA 3TTEA 2WKGA 1J6PA 4MUPA 1WB0A 3L67A 1JPHA 1BFNA 1FWDC 1X96A 3T0AA 4QISA 3VMNA 4MWAB 3GG0A 2V82A 5C55A 2FH6A 4UQCA 2VWSA 2G4JA 4C1KA 1GHSA 5JH2A 2WSPA 4R7OA 1OWQA 3TC6A 2AGTA 2ZDRA 3RILA 1XRSA 1VJIA 1S5WA 4FF5A 2NV2A 4HSHA 3BLKA 3UG3A 3UCCA 4YWSA 1A53A 4UTUA 3PTDA 3M1ZA 5DF0A 2P53A 4D71A 3ARYA 1DQXA 3MP4A 3L65A 3ZOAA 4KKXA 1UH2A 1BTCA 4RKAA 3BTNA 2XSXA 4HJFA 2QCLA 4C6JA 5RUBA 3MMTA 5FJRA 4KERA 2Z29A 1C9WA 4H9UA 1EPVA 3KBSA 3E96A 4MJZA 2HMCA 2HE8A 4HVXA 3IUIA 4NILA 5LXEA 2CHRA 1X1ZA 2IXUA 2ZZ7A 3BOFA 3RR1A 3C3NA 2GUYA 4JTHA 2XFYA 2LLEA