3LHVA

Crystal structure of the mutant v182a.i199a.v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAAIAGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 84
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhvA00
2RH9A 3FLUA 5C5YA 5K4ZA 3VE9A 3IEBA 4XQ6A 4H3DA 2H8XA 5DN1A 1QO2A 1YXDA 2VFFA 4L4LA 4TU1A 3W3OA 1JUBA 2GJNA 3IGSA 4FNSA 2V0TA 3MYPA 2DZUA 2QDGA 1TPFA 3EKZA 3QPZA 5EKYA 4LC8A 1B4EA 3QMTA 1Z44A 4XWUA 3DU0A 2Y6ZA 3QRHA 1O5KA 4TO8A 4I7VA 3W7KA 1IGSA 3LB0A 4A22A 3P62A 3C2RA 1DJQA 1KV8A 4DELA 1YLVA 3NVTA 4GFSA 2QCLA 2VFGA 4E2DA 3P7YA 4JR5A 4PFMA 3EX4A 2EKCA 3G8RA 1NFBA 4PODA 2F84A 1H51A 3CEUA 3GNDA 2OCZA 1GVFA 4O10A 1TRIA 1EWDA 4KKXA 5HUPA 2CLOA 3NPWA 4KWVA 2A21A 2YGYA 4FHAA 3NO5A 3QPYA 3FKRA 3H55A 2ISWA 1SW7A 1F6PA 3NQEA 2ZQ0A 4WQ6A 2CZDA 4RR4A 3I7QA 2ZRXA 3CWOX 4JGDA 5KMYA 3P81A 2DZVA 3B0VC 1GVSA 3QSTA 4FNRA 4AXKA 4D2JA 1WXJA 1W5OA 3L0GA 3LHWA 2V9DA 3IIVA 4O4VA 3SGUA 3WJWA 3EEGA 3S6DA 1C29A 1T96A 2I14A 3G1FA 3F1QA 1X6UA 2ZRYA 2Y62A 3DHDA 5MHBA 1TPWA 2A7NA 2R91A 2VOMA 2WV8A 3EWWA 4UFMA 3PF3A 3BPWA 3VKJA 2Y7GA 3P61A 3MHFA 3OVPA 1VH7A 4OT7A 5LNSA 1UUMA 4J9JA 1QNVA 4QNWA 3LTPA 4IUOA 1NVMA 3NL6A 3LCHA 3MYOA 4M6PA 4HNVA 4JTUA 3TUUA 4PL1A 5DCDA 4N2YA 5I3IA 3HGSA 1WAUA 1EIXA 1WX0A 4K8EA 3GAKA 5LHFA 1X1OA 2NWSA 1GZGA 3P5YA 1FWSA 2J27A 3OVQA 5J5DA 3AJXA 1FCQA 1ZALA 4ZQPA 5EYWA 4Y96A 4YWIA 1D3GA 4O12A 3FIGA 4ONVA 4MY9A 5U4NA 2JKPA 3UD6A 1I2RA 3FOKA 1KFJA 4DF0A 2ATMA 1JVNA 4CNPA 5BMWA 5D2VA 2GQ9A 3NGJA 3QF0A 1JRBA 3LCXA 4AAJA 4RZ5A 3M47A 3FFSA 3QQ0A 3ABQA 1DJNA 2YR1A 3QC3A 3HG2A 1Z41A 3G1SA 3ZWSA 3UWVA 3LV6A 4Y9AA 1K03A 3O8AA 3EX6A 5EY5A 1XBVA 4RLIA 3L0NA 1LBMA 5HR7A 1TCDA 2FPYA 3LOTA 4NZJA 2FLIA 4YLWA 3L21A 2YYTA 3S5ZA 1W3NA 2E5BA 1ZENA 4JTJA 2QCNA 1LDCA 2Y7EA 3NG3A 4JDYA 1KLZA 1NF0A 4K36A 4WY0A 3LHTA 3TCEA 1QPNA 4X9SA 1VYSX 4LV9A 3G0UA 4B5NA 1KFLA 4JTLA 3NQ6A 4WY0F 3SSJA 3BG3A 3DFQA 4ADUA 3R2GA 4PA8A 3IVSA 3TROA 3SI9A 1EUNA 3A5VA 4K8HA 4RK8A 1ML1A 3W87A 1NSJA 2P10A 2EGZA 1LROA 2GVGA 1OG0A 4PCFA 3STGA 4OQVA 2DZPA 5D2YA 4XTDA 1K3UA 5F4SA 2V81A 4LOCA 4TMCA 5C2XA 1BWKA 3S1UA 2VEIA 2FPTA 1Q45A 1FWWA 4UR8A 3W2UA 4CCDA 2VEKA 3S1XA 3W7RA 5HWMA 1QMLA 2GJLA 3P82A 4O50A 1ICPA 4NZFA 4JX5A 6TIMA 3DI1A 3PBVA 2GUUA 2Y63A 3INPA 1TJPA 1NAL1 2QF7A 1KM4A 4OHQA 2EPHA 4A3UA 5AB3A 1K8XA 2ZZ6A 4CNOA 1OFBA 1TYGA 2A7RA 3UWYA 3HQ1A 1GVQA 1OF8A 3SIZA 3NZRA 5CPOA 4EOUA 1OYAA 4RJEA 3MW7A 4X22A 1TV5A 3I7RA 3L66A 3KVMA 2FB3A 1P1XA 4MLRA 5H2ZA 4ICNA 7TIMA 3PUDA 3QFEA 4N9BA 3LCLA 3TQKA 3W7JA 1W37A 3BG9A 3P74A 3W85A 3C56A 1FDJA 1KTNA 4HT3A 1JCJA 1WV2A 1KBJA 3K30A 4CLMA 5AHLA 3PVFA 2W6RA 2P1FA 4HSOA 3KVJA 4PH6A 5CZSA 4GUJA 2XFWA 5AYXA 2NUYA 1W31A 3DKJA 2J24A 3CT7A 3BVJA 1ALDA 1G4EA 4XBSA 2Y7DA 5K9DA 3PUEA 5KZEA 4NNBA 1OFAA 4JTTA 4ZZ9A 3WK3A 4MYAA 3LHZA 1VLIA 3MWAA 1HL2A 5IM51 2O7QA 1GTEA 1XDMA 2QKFA 2QCEA 3NQMA 3Q37A 3MP5A 3W7EA 2I9EA 4O53A 2VFIA 2C3ZA 3E12A 5LNUA 2J88A 3W71A 5DBUA 4CNNA 3NQ2A 5BNKA 3PSWA 3OA3A 1T99A 4WXYA 1OFDA 1LRQA 3UPWA 4M7TA 3R8RA 1IXQA 1EP3A 4GE8A 4A2SA 3NL2A 1SO3A 1TO3A 5D2XA 3GDTA 1DORA 1W54A 4ALDA 1AL8A 4FNTA 3TMQA 4NJJA 5K9XA 3LDVA 3M9YA 3VE7A 5D03A 1PHWA 3LRMA 2E6FA 4LW7A 3USBA 2HMCA 1H60A 2W0UA 3O05A 3WK0A 1G4TA 2CFFA 1ME9A 5DCBA 3F03K 1TPEA 2H90A 1H7XA 1GQNA 2TRSA 1EUAA 3OEXA 3NAVA 2GOUA 4EIVA 4EVZA 3G0SA 1VYPX 1LYXA 1WYIA 3W76A 2DU2A 1VHNA 4UFKA 5EBUA 5G2WA 3GVGA 5E0KA 1S3HA 3GDRA 2WO5A 3P80A 2DP3A 3MI2A 5C6MA 5I3FA 4LVAA 4WY0B 4K7VA 5CPNA 1T0OA 1YTKA 3HG5A 3IGXA 4OBTA 4UTTC 3S5OA 2AAMA 2AGKA 4NVTA 4Y8FA 3MJYA 1GOXA 4AHPA 4Z1DA 1AK5A 3LX9A 3O16A 3C6CA 4ZQMA 2H3DA 4YL2A 4MPQA 3QMRA 3W7NA 2ZZ7A 3EWBX 3QW3A 3S1WA 3W1PA 2QCCA 3TW7A 1H1YA 3G24A 3KRUA 4A21A 4OE7A 3GDKA 3G18A 1THFD 1TTPA 2V30A 3C4UA 3GKFA 2E09A 3LBMA 2VENA 3GKAA 4FNQA 1Q6OA 4NQ1A 3NM3A 4M6QA 2QR6A 1KFBA 1F2JA 4E2BA 1JCMP 3G1AA 3NQ8A 2V5LA 4TIMA 2X1RA 4M19A 1TRDA 3DFTA 3EXSA 2BSLA 2VEMA 1R2TA 3NL5A 2B7OA 3JRKA 1SO6A 3C2OA 2C15A 3N9RA 1F5ZA 2Z1BA 5C54A 4K38A 1IIHA 1N7KA 2FTPA 1VYRA 2WKJA 3TQ0A 5D30A 1VCVA 2R8WA 3HPXA 2BX7A 4DO5A 3UXAA 5DLCA 3M5XA 1FY6A 3GLCA 5HINA 2XN2A 4E0CA 3O07A 3W1NA 4HPXA 3W7IA 1GT8A 3MO7A 4DO4A 1XCFA 3O63A 4POCA 4FX7A 2E6AA 4QSHA 5G4WA 2PURA 5F2MA 2Z2UA 5AOUA 3W1LA 4AVFA 4NJHA 3W7QA 1SO5A 3NPUA 1DKWA 3M6YA 3NDOA 3EWXA 3LV5A 3W1AA 1RQBA 3DFOA 3CWNA 2YYUA 1WDWA 1PHQA 1Q3NA 4QJ1A 2JBMA 3H53A 4O54A 4Y6GA 2P0OA 3PY2A 3W1UA 3HB9A 3RFAA 4GUIA 2GPTA 2E77A 3IIZA 4NUWA 2TMDA 3EX3A 3CB8A 4LS0A 3Q58A 4Q33A 5AC8A 1SUXA 3M41A 1UCWA 3GXPA 3HF3A 1YTEA 3EKLA 3HGJA 1U5JA 1Q6RA 1VLWA 4JTIA 3M43A 4FEZA 4C1KA 1IIGA 2NXGA 4K7YA 3W07A 1EA0A 5L6UA 2V2HA 4I9AA 3MHGA 1XDLA 4Z0JA 4LT9A 1PL9A 3RK8A 2YW3A 4AWUA 4ZQRA 2RHGA 2ZCGA 4FNPA 1TJRA 1H62A 1KA9F 4LU0A 3PR2A 1RQHA 3NR0A 5D38A 1MSSA 3ZFHA 3C2VA 3W74A 1FCUA 4UFHA 1G7VA 1G69A 3DH7A 4O1BA 5CZJA 2ZA1A 4IX0A 1R47A 5C55A 2DZTA 2A6NA 2ZBTA 2EHHA 3STFA 2NZLA 1VGAA 3FYPA 1YADA 5ABTA 2DZSA 4IOTA 4TX9A 2CLLA 3THQA 2WJZA 1W0MA 1I2NA 3FKKA 4GRSA 1M7OA 1OX4A 4O19A 1F7BA 4H6KA 1SSGA 2G96A 4MZYA 3RMJA 3B8DA 2ZDRA 5G2HA 3B0UX 1ADOA 4ADTA 4UTHA 5DELA 1RQEA 1GYLA 5G4EA 1B4KA 1MXSA 4UTIA 3A9IA 2ZZ5A 1SR9A 1F74A 4ZQCA 2JGYA 4I7UA 3QJAA 1TPH1 3E96A 1TPC1 2X30A 3NL3A 5KITA 3GR7A 1GPWA 4MZ1A 3OBKA 3UWWA 4JN6A 4JYEA 3G0XA 3RLUA 1C9DA 3WFAA 1OHLA 1QCWA 4Z08A 3W72A 3DFSA 5FEPA 1B57A 4EWND 1IXOA 1WOBA 3A23A 3W73A 3LM7A 1VC4A 3NQFA 4DF2A 4ORMA 4IGHA 3BLIA 1LOSA 3ZS4A 5AC7A 4BR1A 5I3GA 2Q3RA 2PE4A 3TNOA 1MEHA 3LI1A 3E0IA 1J5TA 1ZAJA 4AF0B 2ZRUA 2RDWA 3NYZA 1LBLA 5LGZA 3WK2A 1F05A 4JTSA 1JULA 4BI6A 2QUUA 1TB3A 3C8FA 4N02A 3TV8A 2PC4A 3TC6A 1GJPA 3KRZA 3HBLA 3HJZA 4M6VA 1EWEA 1LZOA 3MP3A 3KAOA 1B9BA 3UWUA 4K39A 1A5AA 4O0KA 4MFDA 1VRDA 4DPQA 3FYOA 4DBDA 4RV8A 4LTSA 4M7SA 5IBXC 1A53A 2BLEA 3UY7A 2YCEA 4BWLA 3HG3A 4ADSA 4GC4A 3W83A 2QCDA 4UTJA 1PV8A 3A24A 4KFNA 4NJGA 1O94A 1GVOA 1H7OA 4XKYB 1V5XA 3I65A 1K7EA 4BFAA 3LXAA 1DOSA 3LCFA 2J6XA 3M1ZA 5AN7A 2HTMA 3PSVA 4EF9A 2Q8ZA 3BW4A 2Q3OA 4K37A 4WUIA 4Z1AA 1H7RA 1I2QA 2A0NA 1HTIA 4MUZA 1LRTA 1OYCA 2C1HA 4PEKA 4BI5A 1OK4A 4I7WA 1SFJA 1WBJA 3C52A 3PB0A 1O95A 1I4NA 2RDTA 3CQ0A 3YPIA 2OT1A 2CZFA 2C13A 4JIQA 1ZHAA 2NX3A 3C3NA 4CQ8A 4HKPA 5G5IA 2X16A 5AYYA 4NT0A 4MZ8A 5LGXA 2J9ZA 2H6RA 3TJXA 3WJSA 4N9EA 1XBZA 2BZNA 2CLIA 1FWNA 3ABRA 1J2WA 4RX0A 3G1DA 1U83A 3NNTA 3GIYA 1OX6A 3W7CA 3L67A 1FDZA 2PRLA 2TSYA 3HG4A 1JUKA 4MY8A 1AW1A 1CX9A 5F4XA 2CWNA 3SY5A 3W88A 2DZXA 4XUGA 3P67A 4WZHA 1JQXA 3CIXA 1HO1A 1AG1O 5EL1A 5E1QA 4ZVJA 1R2SA 2VKZG 3L0KA 3PG8A 4IMEA 3O6DA 2JKAA 3JS3A 2WSQA 4O13A 1BEUA 2FB2A 2RFGA 4IJBA 2G97A 3W86A 4O52A 4JY8A 2Y70A 2RKXA 3GDMA 2WNZA 4FIQA 1C8VA 4X3ZA 1SPQA 1UBSA 4LS1A 2Q8LA 1X1ZA 1X7FA 3DBPA 2OX1A 1W5PA 4BK9A 2QCDB 5IBXA 3TA6A 1SZGA 3PULA 1K7XA 1GEQA 4DEFA 3KRSA 2ZRWA 3G1XA 5LNVA 4LRTA 1OX4B 4NX0A 5A8GA 3TK7A 3LBCA 3TR2A 4UTMA 3BK0A 1RR2A 1RVGA 5LKYA 2E68A 4P61A 2DZWA 5LNWA 5LSMA 2YPIA 3LCGA 1TTQA 3GZ3A 3BLFA 3TQVA 1BKSA 4IMDA 3DZ1A 2X2GA 4UXDA 3UY8A 1YPFA 1VS1A 2V2CA 4FNUA 3BGJA 5F2GA 4XKYA 3A22A 1W56A 1SU5A 4NXSA 1XBYA 2VFHA 1CW2A 4O14A 1BTMA 4H4IA 2HSAA 2DJXA 1ZCOA 1H7WA 3JR2A 1YXYA 4AF0A 4GUHA 3N19B 2A85A 1E51A 2GQ8A 3HO8A 1JCLA 3LXBA 1W3IA 4WJEA 5HUOA 1Z48A 1M6JA 4UNLA 5FEZA 1L6SA 1G4PA 2PRHA 5CGQA 3G1VA 3IVUA 3NQ7A 3GYEA 3UPBA 3A5FA 5CZTA 1EPXA 2GQAA 3DKLA 4UFLA 5DXYA 3D0CA 2Z0IA 4E38A 2YSWA 4ORIA 3RF9A 2QJGA 5F4WA 1K7FA 1OFQA 3HOJA 3B05A 2ZA3A 4JEQA 5F1UA 2CLEA 1W5QA 2NUWA 4GWEA 3C2FA 3FA5A 3LERA 4WD0A 3MBFA 3C61A 1DV7A 4LVBA 3HIJA 1P5BA 4CQAA 1OX5A 3DGRA 3E02A 2A7PA 1I2PA 1YYAA 4RZ6A 1TQXA 3GX9A 5TBOA 2CLHA 4UC5A 4FX6M 5AHFA 3N2XA 3U8GA 3SJ3A 4OV4A 2H3BA 4AHQA 3LCIA 1OFPA 5FF7A 3IIOA 5CKSA 1A50A 3CEPA 1JQVA 3EXTA 4DO6A 1MO0A 3SFKA 5G1TA 2V5BA 1RZMA 5TQLA 4N4QA 5LNRA 5BW6A 2A1YA 4GBUA 1EP1A 2O7SA 3E9AA 2E6YA 4LRSA 1GG1A 2BWGA 1MZHA 3W1RA 4LVDA 4GUFA 3DFPA 3I6RA 2ZRZA 2XN0A 1LLWA 1VHCA 3O15A 4FB7A 2B7NA 2ZFAA 3B06A 3VFLA 4LUIA 5DCEA 3TU9A 3NQAA 3ATZA 1OABA 1EX5A 3PM6A 4A29A 1WA3A 4UTWA 3TSDA 4MYXA 2C6QA 2H8ZA 1LP6A 2QCFA 2C19A 3I7SA 2ZZ3A 3PBWA 4NXKA 2QUTA 4IPJA 5G2IA 3W2JA 1SZNA 2Y61A 1K8ZA 1HO4A 1GVRA 1O5XA 1R2RA 1PCKA 4ZL1A 1H1ZA 4G1KA 1D3HA 5AHMA 4GJ1A 3OVRA 2JK2A 1YDOA 1ZY9A 2ZRVA 4LV4A 3R13A 2QAPA 1JUEA 3RLVA 1W5MA 3P5ZA 1LORA 3THAA 2WSRA 5F2IA 1HUVA 2D73A 4XTIA 2PRMA 4GUGA 1XM3A 2WNQA 5D32A 4IX2A 1KBIA 1LRNA 4MLJA 5HMSA 3CM4A 1A5BA 2B0MA 1TPB1 4UTKA 3Q2DA 1A5CA 1JJKA 2B4GA 2A6LA 1XL9A 1YDNA 3SGZA 3ANYA 1FCVA 3E49A 1L2UA 3TIMA 1TTIA 3DFNA 3RU6A 2FFCA 3N34A 1DQXA 4S1FA 1OF6A 5D33A 1UASA 4O1AA 3W70A 2QJHA 2YXGA 4MVAA 3C2EA 3KX6A 5K2ZA 1SO4A 4JTKA 3WJYA 3CLMA 1KV5A 2BTMA 4JS3A 2WNNA 3TC7A 3VNDA 1RV8A 5DBTA 5FEWA 4O1CA 3KVLA 1AW5A 1Y0EA 3PC0A 4LS2A 5KZDA 5CSRA 1H63A 4JIPA 4JNMA 1TREA 2GVJA 5KTLA 3O6CA 4YXGA 3H54A 2V2DA 4QQ3A 3S8HA 3DENA 2NX9A 1D9EA 3MUXA 3W7HA 1FCBA 2Y7FA 3HGRA 3L65A 3G3MA 5H91A 2CZ5A 3N9SA 3QSRA 4YCOA 4EF8A 1PVNA 4FX8A 3T7VA 5FEXA 4CCCA 4U4MA 2OMAA 2FQIA 2QAFA 4JTHA 1YXCA 1OFEA 3U6WA 1H5YA 4UMAA 2CU0A 4MOZA 1WQ5A 4TR9A 5HNRA 1KFEA 1UB3A 4R53A 3TMLA 5DY3A 4MFEA 5EA9A 1A5SA 4W9TA 3IIPA 5AHIA 2W79A 2E6DA 3CIWA 5FF3A 1Q6QA 1QO5A 4YCPA 3WK1A 5D2TA 1OYBA 3U2OA 1AMKA 3G1HA 3O1NA 3W6YA 1OFRA 3EXRA 5HR6A 1FBAA 1I8JA 5HJLA 2CW6A 1EP2A 3C0JA 3G1YA 1W8SA 3QH2A 3EX2A 3HPZA 4Z1BA 5BRBA 3PB2A 2IQTA 3UWZA 3NPVA 1K02A 3HGOA 1KM2A 1XXXA 2QCMA 1SZEA 2WPBA 4KFOA 4PTNA 4UTUA 4KWWA 1Z42A 3SW6A 4YMZA 3L5MA 1KTCA 1LLZA 3LTYA 1G7UA 4HIBA 2X1TA 5FF2A 4OV9A 3T40A 3W7OA 5SWUA 4UTWC 1G6CA 2DORA 1L9WA 5AFDA 3IV3A 1SQ7A 1F73A 1XI3A 1XUZA 4PL2A 3G22A 3GAYA 1SZFA 3SZ8A 3W2LA 2UV8G 3W1XA 4NNCA 4Z1CA 5I3JA 1LTDA 5CPMA 5FI8A 3L9CA 3W23A 1LCOA 2YX0A 1BWLA 4U28A 4QAIA 3NQCA 2V82A 2E5CA 2ABAA 3A21A 3TKFA 1QR7A 1GG0A 2X1UA 5BOOA 1ZAHA 4LUJA 1KFCA 2TPSA 3NA8A 5KZMA 4UR7A 1B3OA 4NNAA 1ONRA 3BV4A 6ALDA 1AL7A 2OZ0A 4UUIA 5DY2A 1O60A 1F76A 4UIOA 3PWAA 5KSWA 1VZWA 2R14A 4WOZA 1LOLA 3NQGA 3NPXA 1R46A 4X2RA 1O4UA 1K8YA 2WSYA 5K3VA 5DXXA 2Y89A 1KLYA 3M5VA 1SFLA 2NXHA 1LOQA 2PCQA 3IIXA 3MI6A 5F2LA 1XKYA 4IWWA 3S9YA 3CTLA 1XUUA 1VPXA 4HSNA 8TIMA 3L2IA 3GNNA 4AMAA 3PS7A 4O11A 4MY1A 3W9ZA 1KM6A 4UMBA 4JX4A 4FXSA 1ZAIA 3MBDA 4HN4A 1MEIA 1R30A 3EWUA 2KZHA 3STEA 2YFOA 3UNDA 4NJKA 3TJLA 5K7JA 1VCGA 1GYNA 4O16A 2QUVA 3LRKA 4OWGA 1DL3A 3LHVA 1XC4A 3W7LA 4MIMA 3L5LA 3OG3A 3G8EA 1WOAA 1FWRA 4RXGA 5A5WA 2DJLA 1TIMA 3PAJA 3F4WA 3CPRA 3KFTA 3QQ1A 4MJMA 1TPUA 3LI0A 1JR1A 4L4MA 4UCGA 4RXFA 3QW4B 1W3TA 2E1DA 4AWSA 4WXZA 3NZ1A 4JICA 4AHOA 4QNEA 1NF7A 3RNDA 2NXIA 4BF9A 1PE1A 2ZYFA 3FJ6A 3GXTA 3NOEA 3AO0A 1JCXA 3ZWTA 3SR7A 4DXVA 2AQWA 4N9DA 5TIMA 4JTEA 3BO9A 3W22A 2VC6A 3S5YA 3CC1A 1EEPA 1ZNNA 2F7FA 4DF1A 3GK0A 4P2VA 1M7PA 1FX6A 5BMXA 4IMCA 2C0AA 1QPRA 3EX1A 1OJXA 3W2KA 4R34A 4JD4A 4C1LA 3Q94A 5D02A 5AC6A 3O06A 3EWZA 4HNNA 1JCYA 5CG7A 3W75A 4N9CA 4OU1A 4PC8A 3QMSA 3IVTA 1VJIA 1P0NA 3LGEA 2B7QA 2ALDA 3LLDA 3BGGA 4O8RA 3V1PA 3ZR4A 2QCHA 4AB4A 5K4XA 3LRLA 1IXNA 2I1OA 2NX1A 1QAPA 5EPDA 1OK6A 1W1ZA 1ZFJA 1NEYA 1ICSA 3T78A 1PIIA 4JDBA 4R33A 3QM3A 1H7NA 2X1SA 1V7YA 3B4UA 3UQNA 4XBKA 4XZ9A 3WJZA 3P8IA 2ZZ4A 4LY8A 2QEZA 1FQ0A 2EAWA 3MHUA 1H7PA 2A5HA 4O1DA 3S42A 2ZA2A 1FXQA 1VQTA 3G3DA 1YTDA 3QEZA 1X8FA 4JTFA 4CQ9A 2V8ZA 3FJLA 5I3KA 4QISA 4WX2A 4BWLC 5D37A 3HMJG 2GVLA 3LHUA 4RKAA 1TPDA 1JCNA 3GXNA 5FF0A 3IGUA 3LHYA 3VCRA 4CCEA 1I45A 1TTJA 2FDSA 2J9XA 1N55A 2VFEA 2NUXA 2BXVA 1SSDA 1CI1A 3N73A 4IMGA 1UUOA 1GTHA 4RZ4A 1VR6A 4FO4A 1QDSA 4O15A 4O18A 5LHEA 3B04A 1TV7A 4A2RA 1KM5A 5T26A 3KXQA 1QPOA 3F4NA 3IRDA 3GR8A 5FESA 3N14A 3ELFA 4IQLA 1T8XA 4GXMA 3S5NA 3W7DA 3LXCA 2ISSA 3W84A 4FXRA 2YFNA 1M5WA 3PG9A 3UXDA 2Y85A 3W1MA 3UZ5A 4ZQNA 2CZEA 4O0ZA 5FF4A 3SECA 1S5VA 3TE9A 3W2NA 4ZQOA 2CLMA 3R5EA 3KOFA 4QITA 2HS8A 4IXXA 2HS6A 3TDFA 5HULA 3MP4A 3KHJA 4O4WA 3L68A 1Q6LA 2YW4A 4R7JA 5AHEA 3ATYA 3PUOA 2FJKA 1KM3A 2JKEA 4ML9A 1KM0A 3DXIA 4M5PA 4N6FA 3T44A 3V75A 3P8JA 1GWJA 2ZZ2A 1KM1A 3MI3A 2J9YA 3TSBA 3UZJA 4Y90A 2E5DA 1LBFA 1JRCA 2NV2A 3B03A 1TPVA 4N4PA 1QOPA 3LLFA 1KFKA 5CPLA 2NWRA 5K9CA 1DHPA 3KVKA 2ATSA 2WQPA 2VEPA 4S2BA 1EB3A 2A4AA 2WOQA 4Z0SA 1RPXA 1TMHA 4HNTA 4TMBA 3M0ZA 1XBXA 1G4SA 2ZTKA 3MMTA 5G1YA 3W2MA 3M7WA 3HPSA 3DAQA 2YDAA 1L6YA 3TSMA 3TXVA 1TV8A 1RD5A 3NM1A 5HWNA 5CZ0A 2XN1A 5F1VA 4UMCA 1AW2A 3BW3A 1KTBA 1DVJA 3B0PA 2NV1A 1VCFA 1OFOA 4LC6A 1FXPA 2OJPA 3W7MA 4N6EA 3WJXA 4IPIA 2Z6JA 4QM1A 4RCXA 3TFCA 2ABBA 4AH7A 3PBUA 1S5TA 4UFIA 5AHNA 4JTGA 2CLKA 3W1TA 4NX5A 2QCGA 3EWYA 1S5WA 3LTSA 3DHFA 3S1VA 1QPQA 2A2IA 1YDVA 3STCA 3EB2A 3T4CA 3GDLA 1FUYA 1XFBA 4UNKA 4UTTA 5D04C 4S2CA 1IXPA 2ZZ1A 4NJIA 1ICQA 2G95A 1HFBA 4UFJA 4GNJA 1MEWA 1L6WA 5HWJA 2R94A 3QZEA 2TYSA 3ABOA 3QYQA 2ISVA 2Y88A 3FS2A 2QDHA 3I68A 3O6YX 1OVDA 3M5ZA 2OT0A 3UWQA 1QOQA 3BG5A 3GB6A 2B7PA 4LVFA 4QIUA 3TW6A 2VFDA 1HG3A 5E93A 2C16A 4AEOA 3NEVA 5KINA 4JYFA 4MJZA 4HPJA 3P60A 5CSSA 1W5NA 3NXFA 1H50A 2EF9A 5D2WA 3LCWA 2C18A 3L5AA 3W7GA 3ABSA 3VI2A 1P0KA 4FIRA 4WOQA 1F6KA 4LVGA 1ME8A 3N2MA 3P84A 3TAKA 3CU2A 4HHPA 3BARA 3R89A 5J5RA 2C14A 1DQWA 5LZLA 3R12A 4HNUA 1H61A 4KFPA 3TFXA 1J4EA 1FWTA 3PBYA 1P4CA 3N3MA 5AYZA 3W7PA 4O17A 1WBHA 1SW0A 4JX6A 2YZRA 3DI0A 2CLFA 3M5YA 4DPPA 3UYCA 5D09A 3OHIA 4ZMGA 3BW2A 1SW3A 1YPIA 3NQVA 2JGQA 4LWWA 3TX9A 4NU7A 1QFEA 3FEMA 1PS9A 3S0CA 1QWGA 1DBTA 1N8FA 3OIXA 4JY9A 3NQDA 4O28A 3M16A 3W1QA 4OGZA 5D05A 5HQEA 1PCWA 2ZTJA 2Z6IA 4JXCA 2VXNA 3M44A 4K6AA 4Q32A 4IMFA 1I2OA 3BLEA 4DBEA 4DQWA 1UJPA 2LLEA 1LM1A 1ME7A 4O57A 1FDYA 3TH6A 5EMUA 1KW1A 4IXHA 2G5WA 2FIQA 2VELA 1TQJA 4MKNA 1G67A 4LNYA 2FPVA 2RDUA 4JYDA 3T55A 1ZJIA 4BI7A 2QJIA 1IF2A 3TXZA 5GVJA 2NLIA 4Q4KA 5I3HA 4AWTA 5L9FA 1TSIA 5U7SA 4FF7A 3TAOA 4UTLA 3CHVA
chains in the Genus database with same CATH superfamily
2PP3A 1UR9A 3T0CA 3VE9A 4H3DA 2H8XA 4AC1X 2Y5SA 4TU1A 1KB3A 3W3OA 2OO0A 4E2OA 3IGSA 4FNSA 1DJYA 4P7QA 2YLLA 2PDYA 3QPZA 1B4EA 1XFCA 2POTA 1E71M 3CMJA 2Y6ZA 1J93A 3GTNA 1ITCA 4Y9PA 1KV8A 4E4UA 3NVTA 2OWCA 2QCLA 4KS0A 4E2DA 4P7RA 2D20A 3P7YA 3TZNA 3BE7A 4JR5A 3LGGA 4ZSUA 3SADA 3WQEA 4F2UA 4KGLA 1KD0A 3CEUA 2OCZA 1BQGA 1IZCA 1TRIA 2PI6A 3NPWA 3WN6A 4A8LA 4IIGA 3UVAA 3IJIA 3AS1A 3FKRA 4FF5A 4AZCB 1SW7A 1BSLA 1XPYA 1KGWA 3BOLA 2ZQ0A 4WK9A 4IPNB 3SUWA 3ZMRA 4LB3A 4JGDA 3CWOX 3SURA 5KMYA 2W5FA 2DZVA 1DWHM 4BHYA 1IHIA 4IISA 3AHZA 5I77A 1WXJA 1W5OA 3L0GA 1I9CB 3PPFA 1JAKA 3T9PA 3WY1A 1O5QA 4HTYA 2I14A 4IL0A 2GZXA 2QJJA 4MADA 1QI3A 4V15A 3DHDA 2OOFA 2VCCA 4UZSA 4MTVA 2R91A 3ALFA 2VOMA 2WV8A 4Q6XA 1JZ8A 3TP4A 3VKJA 4WRHA 1QNVA 9CGTA 5C9ZA 3LTPA 5HANA 4IUOA 3NJ3A 3K2GA 1M53A 4M6PA 3WQFA 5E09A 3APTA 4LANA 2BVTA 4P7NA 4XAPA 1WAUA 1WX0A 1NP2A 1K4HA 1GPFA 1RP8A 2J27A 1DWAM 1LQ2A 4MM1A 1AZ1A 4O12A 3FIGA 4ONVA 1WXYA 4L7ZA 2JKPA 3LNPA 3TEVA 5C70A 1KFJA 1BHGA 1HJUA 3AALA 1W9VA 4CNPA 5BMWA 4YHEA 4HU3A 3IJ6A 3LCXA 3QQ0A 1J0YA 3ABQA 4QJ4B 2PGEA 3AJ7A 5FJPA 2CERA 5H6HA 2ZWYA 1K03A 3EDJA 2OU4A 3EX6A 3FAWA 5EY5A 3L0NA 4UQAA 1TCDA 1W1PA 1OSEA 1GOWA 4NZJA 2JF6A 3GZAA 4DWSB 1H5VA 4PUJA 3CGTA 3WLIA 1MFVA 5I02A 4GFIA 1W3NA 4PTWA 4JDYA 3Q4DA 3LHTA 3BAXA 4KEUA 4CN6A 1NOFA 3TCEA 1QPNA 4X9SA 3G0UA 4IIHA 3DHPA 1KFLA 3UFYA 4KCTA 3SSJA 3E5BA 5FJUA 3R2GA 4Y2WA 3SI9A 3UZXA 4DAIA 4K8HA 3URBA 3WH9A 1JZ4A 3W87A 1UH2A 5ABEA 4HPHA 2GVGA 3WLNA 1OG0A 1V3KA 4DZHA 3F2BA 1LQAA 3ZT6A 2V81A 2JIWA 2CLPA 3N18A 1JFHA 3S1UA 3VOFA 1HN1A 5EMLA 4UR8A 3W2UA 4CCDA 2VEKA 3S1XA 3AQUA 1QMLA 4D9PA 3H7UA 1Y65A 4MGGA 6TIMA 1BSIA 4AZGA 4H00A 4C6FA 1CXEA 1DPMA 3RGTA 2DH3A 2REQA 2WBGA 3INPA 1TJPA 3R25A 3ES7A 1KM4A 2R1PA 4A3UA 1K8XA 4AZHA 2ACSA 4ZXLA 4HNOA 1CB2A 4L65A 4KPLA 3IRSA 1J8VA 4D1IA 4EOUA 1UZHA 1V6UA 4V33A 4XBJA 2VT0A 2WJFA 2YXXA 2FB3A 5H2ZA 4ICNA 3GU9A 1IGWA 3W7JA 1W37A 2BMBA 3BMWA 1V0KA 1IEVA 3KCLA 5HNNA 1JCJA 8XIAA 3K30A 3PVFA 3KVJA 4PH6A 5CZSA 4GUJA 4LY4A 5AYXA 1W31A 3CT7A 4IIDA 1ALDA 4GPNA 2Y7DA 2OTDA 3F2DA 2QULA 5KZEA 4LUSA 1OFAA 2VYOA 3WK3A 3NDYA 1IYXA 5JBEA 1VLIA 1GTEA 4PUUA 3NQMA 2PU1A 4HU8A 4YYCA 1BYAA 2BY3A 2XSAA 2VFIA 2C3ZA 1W1YA 4F2TA 1O1HA 3E12A 4Z2LA 1T99A 3O6AA 1LRQA 3VNMA 4RNJA 1JPDX 2W4XA 1EP3A 3NL2A 3ME3A 1ONXA 1W54A 3O0KA 4Q4PA 4AU0A 3OZYA 5K9XA 1B1YA 4HQVA 5HA7A 3M9YA 3CUZA 1SMDA 1PHWA 4B3ZA 3LRMA 2E6FA 3GFZA 3PZNA 4LW7A 3USBA 4XIAA 3WQVA 4XUYA 3N13A 2IPJA 2W0UA 3WK0A 2CFFA 5I78A 5KZ6A 1W17A 3MMDA 3OEXA 5CH9A 2WHMA 4EVZA 1F3TA 5JBFA 4DBSA 5CJ5A 3G0SA 1VYPX 2UY3A 3WD4A 2DU2A 2AKZA 4ZOEA 3GDRA 6A3HA 3MI2A 4HZ7A 4LVAA 4K7VA 4QQUA 4PCTA 4OBTA 3IGXA 1V6YA 4UTTC 2AAMA 2VC7A 4A3HA 1V4YA 1RJPA 2OLAA 3RIKA 4Q4SA 4R5EA 4ZQMA 1UR8A 1Q4NX 2XVNA 4MPQA 3ABXA 3NOYA 3H23A 1PTGA 3QW3A 4PUWA 3TW7A 4LYQA 4LUYA 4GI8A 4GXWA 3K4DA 2WMHA 5JVLA 3MZNA 2ZUTA 3LBMA 3UCDA 3CNYA 4M6QA 2OELA 1HJVA 3WDJA 1ZL1A 2QR6A 1R3RA 5XIAA 1P0DA 5DX7A 1NWSA 2UWFA 5C9RA 1JZ7A 2FZMA 2RAGA 2QPXA 3DFTA 3EXSA 3TVAA 1R3QA 4GVGA 3OB8A 1R2TA 3NL5A 4LUTA 2JEPA 1SO6A 4AX7A 3C2OA 1E6NA 1CPUA 3R79A 3Q67A 4ZFCA 1F5ZA 2HQAA 4KQNA 1CXHA 3T05A 3QR1A 3WBAA 1VCVA 2BX7A 4MNMA 1CGYA 1KCLA 1SGJA 4LPCA 2Q71A 4C90A 2INFA 2VCBA 3WZ0E 1FKXA 3AIEA 4DO7A 1XCFA 3WLRA 3O63A 1XHGA 4LEFA 4Q8VA 5I09A 3S2CA 3UZZA 3W25A 5AOUA 1M7XA 4RNHA 5FACA 3W7QA 3TA9A 3B8UA 4U5KA 4QDPA 4DX3A 1DKWA 4W7WA 3NDOA 5EU9A 1BF2A 4QE5A 4FMVA 1BGGA 4LXFA 4XVDA 3OYZA 5IHRA 4QJ1A 3P3BA 2OWXA 4O54A 1C8QA 4Y6GA 3BJFA 1C7TA 1QASA 5BRQA 4NUWA 4MWAA 4LS0A 4C5YA 4Q33A 3MUAA 4GIAA 3OZMA 3EKLA 1F07A 4JFTA 1HP4A 3RM4A 4JTIA 3GXFA 2CKRA 2MNRA 3W07A 2V2HA 3NIYA 1XDLA 3MY9A 2G41A 4HJFA 1PL9A 1B3VA 4DWSC 4NYYA 4XAGA 4TQTA 2YW3A 3RPTA 1IEWA 4ZQRA 2XUCA 1W3HA 4LU0A 3PR2A 3VOIA 4GBDA 3M46A 1FCUA 1HP5A 1G7VA 3DH7A 1VIZA 5CZJA 5C55A 1R47A 3OU8A 1NOUA 2A6NA 4GVIA 4J3VA 4UNIA 4LB4A 4MNJA 4CQDA 4MKSA 3THQA 4GRSA 1OX4A 1D7FA 4IG2A 2GJPA 3IJ7A 3B8DA 2ZDRA 4IL2A 5G2HA 3B0UX 1RQEA 1GYLA 5G4EA 1XRTA 1UWUA 1SR9A 3DECA 3ITOA 2V5KA 4ZQCA 1CLVA 3GH5A 1RBLA 2TODA 2QV4A 3VABA 1FOBA 4ERGA 3WUGA 4JYEA 3C0QA 3RLUA 1OHLA 4AXNA 2YCLA 4HMCA 4PMYA 5FEPA 4NZ5A 1HJXA 1KKRA 1NDVA 1A3HA 3VKAA 3LM7A 1KCXA 4P8VA 3DG3A 4IFKA 4NZ1A 2PBGA 5HAOA 1B5TA 2J62A 1I0DA 5FJRA 2JQXA 3LI1A 1J5TA 4X0VA 1EIBA 5E0FA 2Y5JA 3WK2A 1RCOB 4ROPA 2WMIA 3DIPA 4Q8TA 2ZUUA 4H04A 4N02A 3TV8A 4HMDA 3HJZA 3SM0A 3MP3A 3SN4A 2J25A 3F5LA 1L0PA 5REQB 1RAKA 1KBKA 1GNXA 4RV8A 1WDPA 4ZO6A 3UJFA 4PB4A 3P2VA 3NO1A 3UY7A 1UR2A 2YCEA 4GI4A 1UWAA 3HG3A 1GQJA 1PV8A 1PX3A 3N29A 4KFNA 1R3SA 3GU1A 4GH3A 1W6TA 2X7VA 2XFRA 1H7OA 3VIKA 3U2CA 4AZ7A 2GJXB 4IMAA 2J74A 3KWXA 3OGRA 3THDA 3FHAA 2Q8ZA 3BW4A 2J7HA 1H7RA 1I2QA 1VBGA 1OYCA 3VGHA 4PEKA 2ONEA 4PMNA 1SFJA 3PB0A 4E4FA 2RDTA 3WCZA 2OEJA 1U5VA 3YPIA 2OT1A 1BXNA 2C13A 3R8GA 1ZHAA 3IK4A 2P76A 4QLKA 2V3FA 4NT0A 1LG2A 3L2LA 4O0QA 3RM8A 1FWNA 1ZU8A 2E28A 4RX0A 2PTWA 3NNTA 2WWDA 1OX6A 3O7UA 2TSYA 3SY8A 1AW1A 5F4XA 3SY5A 2JF7A 3CQHA 4XUGA 3P67A 3DG7A 3CMGA 1HO1A 3BZGA 3RMEA 5EL1A 5XINA 5E1QA 7A3HA 1R2SA 2OB3A 3PG8A 4M80A 2JKAA 3BTNA 2WSQA 4O13A 2OYKA 4O52A 4XZIA 3GDMA 2WNZA 1UC5A 4JQ3A 1TX2A 3DGBA 1M01A 4DJED 3EDKA 2OX1A 3HU7A 1TR9A 5IBXA 3TA6A 4KIEA 2ZRWA 3G1XA 1EX1A 5A8GA 3TK7A 3WLKX 3U7BA 3TR2A 3A6OA 1E6QM 2DZWA 5LNWA 5LSMA 2YPIA 4IH3A 3TQVA 3MS8A 4IMDA 4G7FA 4X2PA 4A05A 1YPFA 1VS1A 2V2CA 4V27A 3SCRA 2EPLX 1A5KC 1A0CA 4OVXA 4X63A 4DB7A 5ABFA 4O14A 4RDWA 2PWEA 2HSAA 1ZJBA 1YXYA 4AF0A 3N19B 1E51A 3HO8A 3K4AA 3V36A 4KF1A 2OVLA 1SM9A 2ZICA 3LXBA 5HUOA 1Z48A 3KCOA 3STPA 3ZVHA 4JAWA 1M6JA 5FEZA 1UA7A 2V6AA 1P6BA 1Z3NA 3NQ7A 5CZTA 5LXXA 1EJTC 5DXYA 3B9AA 4HHMA 4E38A 4H9YA 3AXIA 3RF9A 1TUFA 2YIHA 3ZZ1A 1K7FA 3CLWA 1OFQA 2OZTA 4KEMA 3SUSA 4HNCA 1W2PA 2R9RA 3WMBA 1R9XA 4GNVA 3EMZA 1J6OA 2FFIA 4I8DA 4R7OA 2E9LA 4WD0A 3C61A 1DV7A 1OZQA 2GVYA 1BVWA 3B8TA 4B5SA 3S47A 1OX5A 3DGRA 1IWPA 2D0GA 3RILA 2DVUA 4KRTA 2BODX 1VJZA 5TBOA 1XX1A 2CLHA 3NEHA 1AH4A 4FX6M 3U8GA 3B9OA 3SJ3A 1Z6KA 2H3BA 3LCIA 4V2XA 3IIOA 4OBRA 1NFPA 4AD2A 4PUDA 4TVUA 4DO6A 1OB0A 4M82A 4GBUA 1EP1A 3E9AA 5FD0A 2W63A 1SZRA 4GH1A 2SFPA 4GUFA 1S38A 1KR1A 3O15A 2ZFAA 2H9AB 3NQAA 3E2VA 1I0BA 2VRJA 1RH9A 2HCVA 2C6QA 2DIKA 1M03A 4TUFA 5JU6A 1N82A 1W91A 3M64A 3I7SA 1GHSA 2QUTA 3VOGA 1DIEA 2X7WA 3I10A 1GZ1A 1Z89A 1UPMB 2P8BA 4QBXA 2INEA 1EJUC 1D3HA 1UG6A 4C6KA 1PO9A 3N04A 4GJ1A 3E3HA 3VZXA 3BMVA 3URNA 4DXXA 4JL2A 5M5DA 1OCNA 2XVKA 3WQ6A 1LUCB 1QK2A 1XYZA 1JDDA 3BAKA 1AQMA 4FLSA 1V8EA 4IUGA 3DG6A 1HUVA 4JTCA 4XTIA 2PRMA 3ARQA 1K9DA 3H22A 3QHOA 4Y9NA 3CM4A 2PFHA 3AS2A 3Q2DA 2A6LA 4BCEA 1FCVA 3E6EA 4AIBA 2GLKA 3N34A 4S1FA 1UASA 4O1AA 4FOUA 1FH9A 2CXGA 1CGXA 5HNUA 3C2EA 5K2ZA 3W4RA 3L4TA 1YE6A 1Y8BA 3REQB 4JS3A 3GTIA 1RV8A 1VEOA 1BAGA 5DBTA 4O1CA 3KVLA 1H63A 4ERIA 3U0HA 2H9AA 4JNMA 3RO6A 4HZ8A 4G2DA 2V2DA 2P5NA 5CBBA 3R0UA 2HNEA 4HBKA 3N9SA 4LYRA 1QBBA 1UUQA 3H8AA 4DZ5A 4FX8A 3SRHA 4KESA 3T7VA 4CCCA 4YTUA 3PWGA 4H8VA 4O8AA 2BHUA 1WQ5A 2Y8KA 4B15A 3RRXA 4TR9A 1UOZA 6REQA 3PTQA 1UB3A 4J40A 1XLMA 5DY3A 4JKKA 4MFEA 1R6WA 1JF5A 1CYGA 1B90A 1YBQB 2D2OA 3VDHA 4GYKA 1OYBA 3U2OA 3N6JA 3EXRA 2BDQA 5A6KA 4EX4A 5HJLA 1EF3A 4E8CA 5A6MA 5KETA 3E2RA 3R6IA 1EQCA 2VZTA 3HGOA 4NRSA 1F4HA 1KM2A 1UKSA 2ZVRA 2QCMA 1SZEA 2WPBA 4KFOA 3ZXWA 4KWWA 4YMZA 2BV9A 3L5MA 1KTCA 4ASTA 4IFRA 2R1MA 5FF2A 3W7OA 1VIWA 2UY2A 2Y24A 4FLQA 3IV3A 1V93A 4AVOA 1SQ7A 5A95A 2YL9A 1WZKA 3KP1A 1PAMA 1QRQA 3SZ8A 3W2LA 2UV8G 1E3XA 2EG7A 2DW7A 3W23A 2DFAA 4U28A 2VO5A 3RDKA 4QAIA 5HPCA 4RNIA 3WLQA 2X1UA 1ZAHA 2J7CA 4L9XA 5KZMA 4Z17A 3BV4A 4AMCA 2OZ0A 6PTDA 2XVPA 1F76A 8RUCA 4PE8A 3ENLA 1K8YA 3M0IA 4GKTA 3VZYA 1RP9A 2WSYA 1TVPA 3M5VA 3MI6A 2XTKA 1W9PA 1UZ1A 1XUUA 1V6WA 3CTLA 4AYGA 1VPXA 4HSNA 3L2IA 5ABHA 3NSMA 4L6HA 1KM6A 2XFYA 3FCPA 3KOWA 1R30A 1AFSA 2KZHA 4R85A 4Q7NA 1XSIA 2V67A 4PULA 4LH8A 4OWGA 4RNFA 1DL3A 4QG8A 5IXEA 1XC4A 1V6TA 4JQ4A 3P0XA 3GQYA 5CQ1A 3WDIA 5A5WA 3TNBA 2DJLA 4IP7A 4UBPC 2VR4A 3T4WA 4KMQA 4MJMA 4PSPA 3QKZA 4KEZA 1DXEA 4H7VA 2PWVA 2DQWA 4CU8A 2R1LA 2E1DA 4AHOA 4Q8NA 3BCJA 1NF7A 2QV5A 3RNDA 2YCKX 2FYMA 4BF9A 2WZMA 5CGMA 3GXTA 5EFFA 2BGNE 3NOEA 1DWFM 4HZ6A 1JCXA 3ZWTA 1OY0A 4TVDA 3EWCA 2YBTA 1VEPA 3BO9A 5EFDA 2ISDA 5I6SA 3CC1A 1EEPA 3BANA 1OWQA 2F7FA 3U4AA 2NVAA 5CLTA 4IMCA 1E4LA 8XIMA 1YE4A 5IHSA 1EO5A 1OJXA 2VDIA 4JD4A 3M0MA 1P6WA 7PTDA 3CL6A 1F3WA 3ZM8A 4A3YA 4M6UA 3AC0A 5D02A 2QGYA 1DWGM 5AC6A 1K6WA 3S2LA 4A6GA 5FJTA 5AECA 4N9CA 4PC8A 3QMSA 2QDDA 3VAVA 4RZBA 2YBVA 2VL4A 1FWDC 3N25A 3AMGA 2FTWA 3BAWA 2AL1A 2QCHA 3SGGA 3LY0A 3RLGA 2WLYA 1QAPA 1OK6A 3SCPA 4AD3A 3AIQA 2YBUA 1U1HA 3T78A 2GGGA 3RR1A 2XWDA 1H7NA 3ANUA 3B4UA 1R3TA 2OFJA 2OQYA 2POZA 4NI3A 3H2MA 1FQ0A 2EAWA 2A5HA 4O1DA 3A9BA 1FXQA 1CT5A 3QEZA 1X8FA 1ODUA 1ZTVA 2ZX5A 1W3JA 3FJLA 4WX2A 4BWLC 3HMJG 3RAOA 1TPDA 1JCNA 2VZVA 5FF0A 2FDSA 1J6PA 3B9NA 3VGEA 2BXVA 1SSDA 2QIIA 3TYUA 4C1NA 3WKZA 4IIEA 1CB7B 1CI1A 1DEDA 1XLFA 1UUOA 4HK6A 1F8MA 1VFHA 1QDSA 4O15A 4O18A 4A2RA 3PPCA 1GOKA 3NQBA 4H7CA 2NQJA 2J47A 1QPOA 1EHNA 2OKOA 2AL2A 3ELFA 4IQLA 4EE9A 4DWSD 4GXMA 3W7DA 3LG3A 3LXCA 2WJEA 3LN3A 3W84A 1ZS2A 1CXFA 2WXDM 4H6EA 3PG9A 4CU6A 3UXDA 1E1EA 4TVCA 3UZ5A 3BLOA 3OQEA 3WBYA 3RU8X 1C7SA 2XIMA 3KOZA 2PTZA 3OBEA 4H6QA 4ZCWA 3WEMA 2NQLA 3PZQA 3RG6A 2BOGX 2PPGA 3UXIA 1UQZA 1ZP4A 3KHJA 1XLDA 2ZE0A 3L68A 3NUKA 4R7JA 5M2FX 5AHEA 3ATYA 3PUOA 5IDIA 5E5CA 1KM3A 1TCMA 1HGYA 3T44A 4MSSA 1XLHA 4WDTA 3COTA 3PNZA 4AY7A 3TSBA 1LBFA 3KDNA 9XIMA 3B03A 4V1XA 1HKMA 1QOPA 2NWRA 3ALGA 2WQPA 4RPPA 3CAWA 3H4GA 2VEPA 3HPAA 1EB3A 4LYKA 2WOQA 2X41A 1YQ2A 3CUXA 4HNTA 3U5UA 1FP8A 2C91A 3HPSA 1TV8A 4CQBA 1RD5A 3LUTA 4LAUA 3SO7A 4QTGA 5F1VA 4UMCA 5AZ1A 4DUOA 1AW2A 4AX6A 2R1NA 3SFWA 4LC6A 1WZMA 4DJDA 3QGVA 2OJPA 3W7MA 4N6EA 3WJXA 3RCMA 3PZUA 2Z6JA 4FLRA 4QM1A 2OKTA 4RCXA 2ABBA 5AHNA 3M0LA 1YNYA 4HCLA 2ZUWA 3B9EA 4YHGA 3MVIA 3STCA 3ABZA 3GDLA 3OJGA 3PFRA 2OYLA 4GZ7A 3LENA 1A5NC 1XGDA 4J1OA 3VC5A 4P7OA 2WC4A 2R94A 1KKOA 2ZC1A 3ABOA 3QYQA 2Y88A 1OVDA 3M5ZA 4AYSA 1DJWA 3RCNA 3UWQA 1EA9C 3BG5A 4LVFA 2C16A 3LD5A 1KO0A 2WB5A 3PZIA 4MJZA 3SDOA 5CSSA 1LT8A 5D8WA 2F2HA 5JMUA 2C18A 4ZO7A 3OPSA 3L5AA 1KXHA 3W7GA 4JFUA 4R3UA 1TV2A 3N2MA 3CU2A 1SJAA 5J5RA 5LZLA 3R12A 1H61A 4KFPA 3TFXA 1HIZA 5AYZA 1TWZA 1FH8A 2GL5A 1HVQA 1YBQA 3V7PA 5HXMA 2PODA 1KGXA 1P7TB 4ZMGA 4CN1A 1FHUA 4IGNA 4LWWA 1Q6DA 3TX9A 4IQDA 3KHDA 1KXVA 1DIOA 2V5CA 2Y8UA 2P3EA 3OIXA 1NDYA 3T81A 3TOPA 1LL4A 1PKLA 5D05A 3G5EA 1PCWA 4C7FA 2PDPA 5CJMA 3WL1A 2VXNA 3M44A 4K6AA 4WSKA 2Z27A 4OUIA 2WM0A 4DQWA 3GNXA 2LLEA 9RUBA 1ME7A 1Y7VA 3TH6A 1KW1A 1PIGA 2G5WA 3VMOA 4IPLA 5M1TA 4LNYA 2RDUA 3WH7A 1LL7A 1AMYA 3TXZA 2AQVA 4JHOA 4A4AA 2EPMX 4PMRA 1Q2SA 1X98A 2RH9A 3FLUA 4C7GA 1UWRA 4HMNA 1GQKA 1QO2A 5CPSA 2GVEA 1VFMA 3SIMA 1JD9A 1Q6EA 1CXIA 4B3KA 1NWUA 1XIMA 2DZUA 2IQ0A 5EKYA 2XPKA 4XWUA 1K8CA 1US2A 3MT1A 2HXTA 4TO8A 2ZXAA 3TN5A 4RDVA 4A22A 1Q8AA 3C2RA 4B2DD 4DELA 3P6LA 4L61A 4GFSA 4OUEA 5CCZA 1E4NA 4Y9OA 2ZXBA 4C6DA 4WKFA 4N0RA 2EKCA 3WMSA 1ISYA 1NFBA 3WF2A 3QKEA 4IG2B 3AHVA 2OSWA 3MPGA 5HUPA 5CPQA 3V1HA 4KWVA 3PJXA 4B4HA 2YGYA 3LPGA 3QPEA 3NO5A 2JALA 2YA2A 2YL5A 5DMMA 1F6PA 1R7AA 7TAAA 3NQEA 3MANA 2CZDA 2GGIA 2ZRXA 1GVSA 2ACQA 3QSTA 1R7OA 4EXQA 3CQJA 2O9RA 4AXKA 2AGTA 1VBUA 4D2JA 3ZJ7A 1OBAA 1QPKA 1VBRA 2V9DA 3IIVA 4O4VA 3WJWA 3W0KA 3G1FA 1S2UA 3F1QA 1X6UA 1AZ2A 3ZT5A 1ZZMA 1UD5A 2Y62A 2A7NA 4DI9A 1CIUA 3EWWA 3PF3A 1JNEA 4QS6A 3MHFA 1VH7A 4OT7A 4J9JA 4JFSA 4JTDA 1DXFA 3U9IA 1LWHA 1H1NA 4US6A 4GK8A 3TUUA 4J2PA 1VB9A 1FTXA 3GR4A 1KGUA 5LHFA 1AQ0A 2P53A 5CSUA 2NWSA 1GZGA 3WQWA 3V35A 3VX1A 3LU2A 1FWSA 3OVQA 4Q7IA 1PUDA 1FCQA 4YWIA 4QE4A 2REQB 3KTCA 4MY9A 1KQYA 5U4NA 1T40A 2J8TA 1XYAA 1I2RA 2VGIA 3AIVA 5LA2A 4DF0A 3R0DA 3VA8A 3BUVA 2BP1A 1QVBA 5E9XA 3NGJA 2G4FA 3UA3A 3RX2A 3WLHA 4RZ5A 2GDVA 3QC3A 1A3XA 1Z41A 2RDXA 2VR5A 1GVEA 1W8GA 3AMCA 4Y9AA 4AISA 4QG9A 1XBVA 4RLIA 3QC0A 3QY7A 2FLIA 4YLWA 3L21A 4W8BA 3RN6A 2QF8A 3LPFA 4FR6A 3T0AA 2DQXA 1ADSA 4DI8A 3S5ZA 4JTJA 4HN8A 4XKMA 5ABGA 4WY0A 4K36A 1DJIA 4EACA 3ZR6A 1CEOA 2AOSA 2XG9A 4IM4A 5EB8A 5FOOA 4AIEA 4JTLA 4F9JA 3DFQA 3GXDA 2EBNA 3VIOA 1YEYA 3IVSA 2YCIX 1TA3B 2DVTA 4LX4A 1EUNA 2E40A 1DIKA 3A5VA 2XU2A 4LBRA 3IJ8A 1Q5MA 1JYVA 3GC5A 1VFSA 1NSJA 2P10A 1BXBA 4S3BA 1LROA 4PFHA 3BQ5A 2DZPA 5D2YA 3GW0A 1EL3A 1K3UA 3URAA 3TQPA 4S3GA 2FPTA 5DANA 2VDGA 5I2UA 3UR2A 3F4DA 2V38A 4JX5A 3DI1A 3SUTA 3MU7A 2IKJA 2WM1A 1NAL1 2QF7A 5D8ZA 4D6JA 5CBIA 1PZ2A 3AWOA 3PTDA 4CNOA 1HJWA 1FKWA 2PSNA 3N2BA 4S3DA 5JXQA 1E72M 4MWAC 2J77A 4NZ3A 3C2YA 4JKLA 1GVQA 2DIEA 3NZQA 3NZRA 3BLKA 4IQJA 4X22A 1I6NA 3ARZA 4CVWA 4QEEA 2VX7A 3PTMA 1P1XA 1V3MA 4GCAA 7TIMA 4I9MA 4CEUC 1EO7A 4HPGA 4N9BA 4D6IA 4Q3MA 4XD4A 4OZOA 4GI9A 4L5ZA 4NHVA 5A2AA 3E0FA 1AA1B 3KBWA 1HL8A 4ZODA 3M0JA 4WDUA 4CLMA 2P8CA 3CV2A 3LA4A 2P1FA 4HSOA 1XGEA 2XFWA 2NUYA 3W27A 3DKJA 3BVJA 4BQ4A 3A3WA 1J10A 1HGWA 3B40A 3PUEA 4NNBA 4JTTA 3VNKA 4ZZ9A 2XIBA 3PJWA 4MYAA 3QGAC 3GG0A 3MWAA 1FWFC 2XH4A 1CGUA 2FTYA 4C6NA 2O7QA 4JQAA 5BROA 3Q37A 1UMLA 3MP5A 3W7EA 5G1MA 1WB0A 2QUNA 2G4JA 4G6CA 5LNUA 3W71A 4LF2A 5DBUA 4CNNA 3LGDA 3R0KA 1KWGA 4WXYA 4YVPA 4QDWA 3WMCA 4A2SA 1SO3A 5D2XA 3EOEA 4ALDA 4DUWA 4EPBC 4NJJA 4K8GA 1UJQA 3LDVA 4GJIA 3MA8A 4BA0A 1WKYA 3IUIA 1QU4A 3IAPA 3UPMA 3IJLA 4IHCA 1GOOA 4S3CA 1TPEA 1H7XA 3NAVA 1E4IA 2PC8A 4C6CA 3A3XA 3CHDA 1LYXA 2HNHA 2GWNA 3VGFA 4UFKA 5G2WA 4ATDA 1XLAA 3GVGA 1S3HA 4MDPA 5LA1A 3P80A 5DEZA 1EDTA 1Q7ZA 4TV6A 5XIMA 1HVXA 5FA5A 3S5OA 1UWSA 2AGKA 4NVTA 5LYRA 3NZGA 1GOXA 3GTXA 1AK5A 3C86A 1HL9A 4PUNA 2FZ9A 3FHQA 3A4WA 2NVDA 1QNQA 5A6JA 3W1PA 3VIMA 1A80A 4G7EB 2GSHA 1THFD 3GKFA 3KW3A 2WNWA 2VENA 3GKAA 2EPOA 1Q6OA 4PGLA 2FZ8A 4US5A 3MSDA 4D6FA 3HV9A 3CWHA 3FSUA 1LT7A 4C60A 1F2JA 4DNHA 1X96A 3NYDA 2BXYA 3G1AA 1VBHA 5TAOA 1TRDA 1XG4A 4XAYA 2B7OA 4GZIA 3TWBA 3RHGA 2Z24A 3VUSA 1A49A 1VYRA 3GM8A 4C65A 2A3EA 2R8WA 3VOCA 3UXAA 3M0XA 1J9YA 5DLCA 3M5XA 3FV9A 1L6GA 1O66A 4H2HA 3S6OA 2XN2A 1EJRC 4J2MA 3O07A 3W1NA 1GT8A 3MO7A 5FAGA 4DO4A 4JOMA 4FX7A 1AD4A 3VGGA 1K9FA 1PX4A 2E6AA 1RK6A 3PBGA 4BQ5A 1V77A 4QROA 5G4WA 2PURA 5F2MA 2Z2UA 3UT0A 2X8RA 2GJXA 2QXWA 5GNZA 1E0UA 3M6YA 1W1IE 3GBDA 1WDWA 2ASHA 5GNYA 4WKHA 1P48A 2Q01A 3A47A 3HB9A 4GUIA 2GPTA 2E77A 4XV0A 2W62A 1YW1A 2O4MA 3T2PA 5BXTA 4J7RA 3Q58A 1O5RA 3GXPA 3HF3A 3HGJA 2XISA 1VLWA 3WF0A 3CJPA 4FEZA 1TWWA 3UR5A 3CO8A 5L6UA 4PCSA 4Z0JA 3E5PA 1OGBA 2GUBA 2WC7A 4NAEA 2VD8A 3CZGA 1FP9A 5TD4A 3BC9A 2RHGA 1H62A 3OIHA 4C1NB 1KA9F 7CGTA 5I3DA 1RXOB 2GJRA 5D38A 1TELA 2OQHA 1GOQA 1DJHA 2A3LA 3MO4A 1B3XA 3ARTA 3PANA 3CZEA 4RE2A 4JBRA 2Z1SA 4ATLA 1U2YA 1UD6A 3LQLA 2ZBTA 3PP7A 3BAJA 3ONCA 4BY3A 1CECA 1C92A 1NDWA 3STFA 1VGAA 3R7MA 1YADA 4GACA 4YN5A 4TX9A 2CLLA 2WJZA 1GUVA 2J4GA 1I2NA 3FKKA 3CZKA 1HKJA 2QQ6A 3CL8A 1F7BA 3I3DA 4MZYA 2G96A 2IKIA 3VINA 1R5YA 1ADOA 4UTHA 3EZ4A 3ZVIA 4YVVA 4FXFA 1B4KA 1PSCA 1D7KA 4DJDD 2QW5A 1Z8AA 4QFUA 3A64A 1OC6A 3NSNA 1YKWA 1TPH1 3HZ3A 3XIMA 4FZIA 1TPC1 3GR7A 3POHA 4PTXA 4QJ3B 3BSGA 1QATA 3JZUA 1EOMA 3E74A 5T91A 3KBSA 4EWND 1IXOA 3A23A 3W73A 1I60A 4GABA 1VC4A 4DF2A 4ORMA 4IGHA 1LOSA 3ZS4A 1JYNA 3WMLA 3CAKA 1I1WA 4XG1A 4BR1A 3QV8A 5I3GA 2Q3RA 2PE4A 3TNOA 3VOJA 1KC7A 3TYZA 2QUMA 3E0IA 4IPPA 2ZRUA 4DHGA 1LBLA 1BF6A 5LGZA 1F05A 1AJ2A 3EDDA 5AYIA 1S39A 2PB1A 2CBVA 3FVMA 3TC6A 1GJPA 1EGMA 3ZYZA 3KRZA 3HBLA 1UD8A 4M6VA 1EWEA 3AXXA 3KAOA 1A5AA 4O0KA 1UP3A 4DBDA 1ZB5A 1PKMA 4LTSA 3DN5A 4MAZA 1XF0A 1F3XA 4Z2HA 1E9YB 3N4FA 2YLAA 3GHSA 3CZLA 4ADSA 1FFQA 4JKMA 3U48A 4PMVA 3W83A 2QCDA 1OM0A 2CC0A 4UTJA 4RE3A 2VNCA 1O94A 3CAVA 1GVOA 3AUJA 3OHMB 4AD0A 4D6DA 1V5XA 3I65A 4BFAA 3LXAA 4PCPA 3WO8A 2J6XA 5AN7A 1H3GA 3PZ9A 4EF9A 1NFGA 4EWJA 3WQPA 4RPQA 2Q3OA 4WUIA 4Z1AA 2VJXA 5IOBA 4MUZA 2PTYA 2BS9A 3CYVA 1LL6A 5CAKA 3TYCA 1KNWA 1RBAA 3A12A 4TOQA 1WBJA 3AISA 1YMYA 3Q65A 2DH2A 3H2FA 3IANA 4TXEA 4HK7A 3EGJA 5CG0A 5FKYA 2CZFA 4EAMA 4JIQA 1RJRA 2EQDA 3CV1A 4H6RA 4MZ8A 2NW0A 2J9ZA 3WJSA 4IP5A 1POKA 3G1DA 1UWQA 1XIGA 3QGKC 4Q4OA 2J66A 1JUKA 2CWNA 2DEPA 4E6MA 3W88A 5CC6A 3UZYA 4WZHA 1JQXA 1BVNP 2VP8A 2DVXA 2VKZG 1AODA 4IMEA 3JS3A 1FFRA 1PBGA 3VCNA 1ZBKA 4JY8A 2Y70A 4M1BA 1C8VA 1SPQA 1UBSA 4KWSA 1A4LA 2Q8LA 2VZUA 1X1ZA 2D22A 3BLDA 2QCDB 4DUXA 4I5UA 3I6EA 4C91A 3F7JA 1EJSC 1K7XA 4NX0A 3VNJA 3TW9A 3HURA 4UTMA 3UJSA 4E5TA 1QBAA 3UG5A 1ISXA 4DYEA 3LCGA 4JTRA 1TTQA 2PDQA 4AD5A 3GUGA 1TJ1A 3W38A 2PDMA 1XIHA 4WSJA 3DZ1A 2DIJA 2QDEA 2X2GA 5DRCA 5GQBA 1Z32X 4M29A 2NT1A 2OX4A 1XBYA 2VFHA 3L4YA 1NWTA 1Q7MA 3IUDA 1CW2A 2G3IA 2WVTA 4H4IA 3EDFA 4JIEA 4HCDA 3W28A 4M0XA 1H7WA 1A3WA 1XKJA 1LF1A 4WDWA 2OWWA 2D2GA 1JCLA 1RK5A 1XYCA 4MUPA 3GVRA 1KRMA 1RUSA 3OLDA 3DYMA 1L6SA 5CGQA 2PZ0A 3P14A 3G1VA 3A5FA 3FXGA 1E73M 2C7FA 2WMIB 4UZUA 4NKCA 3RLHA 3D0CA 2Z0IA 2GSJA 3WUFA 2R1KA 1E0TA 3TC3A 4L9ZA 4RW3A 1MYRA 3QV9A 4HYWA 4JEQA 5F1UA 2WCSA 2CLEA 3T8QA 3AIUA 2NUWA 3OG2A 2INZA 3FA5A 3AU6A 1JGIA 1W3KA 1CENA 4W86A 3E0VA 3HIJA 3UR7A 4KWUA 1P5BA 4L56A 3E02A 1I2PA 1YYAA 4RZ6A 3VMPA 1BYBA 1XYLA 1J11A 1TQXA 4GINA 1M1BA 4UC5A 2GGHA 2CITA 4ZTYA 2DSKA 1RVKA 5EMJA 4AHQA 1OFPA 5FF7A 3M4HA 5CKSA 2ZUNA 2FKPA 5G1TA 1UQYA 1RZMA 3DYPA 4N4QA 2A1YA 4LRSA 1GG1A 1UH4A 2V69A 4UQEA 3TJIA 1FVPA 3I6RA 2ZRZA 1LLWA 4FB7A 1MUWA 3S2MA 3B06A 2Y5EA 1S2TA 3ATZA 3CMFA 3QFWA 4GZEA 3QN3A 1XIDA 3TSDA 4MYXA 2X05A 2C1GA 3UEQA 3VDAA 4DBUA 4ACYA 3OODA 1LP6A 4FXJA 2J13A 4LCQA 1PZ1A 4NXKA 3QY8A 2HK1A 2PLJA 1BYCA 4LAOA 1K8ZA 3GU2A 3UXKA 1O6IA 1HO4A 1R2RA 3LQGA 4AZCA 1H1ZA 1E4MM 1TVNA 2QMKA 2JK2A 1VJSA 3CIVA 4LV4A 2ZRVA 2PGFA 2I17A 3EBVA 4KEVA 4WJ8A 2QAPA 2J7EA 3L12A 1M65A 2HV5A 5DRIA 3RLVA 4JQ2A 1W5MA 3P5ZA 3THAA 3VIFA 2O4QA 1XSJA 2YA1A 4JZ5A 4CNUA 5C7HA 1SR0A 3SY1A 2PWHA 3B8IA 1KBIA 4MLJA 4HA1A 4E3TA 1A5BA 2B0MA 3J7HA 1H4PA 1A5CA 1JJKA 1S1RA 2B4GA 1XL9A 1YDNA 8CGTA 5PTDA 1DYSA 3TIMA 1TTIA 4TTUA 3DFNA 3RU6A 1OT2A 1NTHA 4DJFC 1Q13A 1V03A 4NG3A 3AHXA 1XIJA 3CAQA 1XH2A 3ZJ8A 2RGMA 1FH7A 4JTKA 4PTMA 2BTMA 2DSVA 3OZOA 2WNNA 5FEWA 1A5LC 4I9JA 3PC0A 4NF7A 4LS2A 3AHYA 4DJEC 1CWYA 7REQB 3WQOA 1TREA 2GVJA 1J12A 1T41A 3WD3A 2CESA 3H54A 2O92A 3T2OA 3DENA 1FWEC 4IFKB 3S2JA 3KP0A 1D9EA 3W01A 3VKDA 1Q7QA 2BG5A 4LQ1A 3KBNA 3G3MA 5H91A 1EBHA 3RPMA 1XW8A 5JQ9A 4GA8A 5FEXA 2VVNA 4U4MA 4JTHA 1TKKA 1TUXA 1WUEA 1KFEA 3TMLA 1Y5XA 3BJTA 1A5SA 4CUCA 4IIBA 1DTNA 4QR6A 1XRSA 1QO5A 2HVOA 4YCPA 2VQTA 1WDSA 1EYEA 2F6UA 2J8GA 4D72A 2X0SA 2ZX7A 1K1DA 1UZDA 3O9NA 1EFZA 3QLDA 1QK0A 1W8SA 1MDLA 2FZBA 3EX2A 4MPKA 3HPZA 1KRBC 4Z1BA 4O1FA 2AMXA 2QNEA 2IQTA 3W26A 2EPKX 3NPVA 1XXXA 1MW2A 4M3PA 4WKAA 1LLZA 3LTYA 1HX0A 1BRLA 1RBOB 2YCLB 3WFLA 4GY0A 3VGDA 1I75A 3T40A 3K5XA 1K9EA 1VAHA 2E67A 1H0IA 2I56A 1G6CA 2DORA 2W3ZA 1XI3A 3VIIA 3G22A 3EB4A 4HYVA 4YJ5A 5I3JA 5A3HA 2GQ3A 5FI8A 3L9CA 4U10A 2YX0A 2PD5A 3LMZA 1BWLA 5G4HC 4XB3A 4JIHA 3A4JA 3WUBA 4MKVA 3CPGA 1X1NA 4KH2A 1JD7A 5DMNA 5BOOA 2BHZA 1KFCA 4NAFB 2WMFA 4UR7A 5I79A 4QJ5B 1U30A 4W8LA 3N11A 5H8UA 2PA6A 1TZ7A 1AL7A 1WPCA 1O60A 1ADDA 4UIOA 5KSWA 2ZOXA 3VYLA 1G0CA 1VZWA 1IE7C 2R14A 3THUA 4WOZA 3WD1A 1R46A 3WDQA 1GKRA 3IACA 2Y89A 1KLYA 1SFLA 2NXHA 1LOQA 3IIXA 4US5D 3S9YA 3ZLGA 2D1ZA 4CGTA 4UQDA 1FWCC 3GNNA 4AMAA 3PS7A 3DESA 1V79A 4UMBA 4B16A 3NVDA 4FXSA 1MEIA 3S3GA 3WDPP 4E2VA 3TJLA 4S3EA 3BDKA 1VCGA 2PBOA 4GXPA 3LRKA 4MIMA 1J0HA 2Y0FA 2PDXA 4GI6A 4QHRA 4CVUA 3HMCA 1TIMA 3FNDA 3G2GA 2HWGA 2OEMA 3PAJA 3VKBA 3LI0A 1JR1A 5LIUX 1XG3A 4L4MA 2BHYA 4W89A 1ZP3A 3QW4B 4HB7A 4JICA 2WZEA 1JZ2A 2BFGA 1MNSA 4JNYA 1FWIC 1PE1A 4AIOA 3FJ6A 1DWJM 3H4WA 2AQWA 1E40A 1F6YA 3DFYA 2VC6A 4DF1A 3GK0A 1M7PA 3TYAA 2CXEA 2DW6A 1QPRA 4OECA 3BWWA 4GIRA 3GNRA 1PTAA 2AL2B 3S1GA 3TYEA 1UOKA 4GIEA 4R34A 1ZQ5A 3F5KA 3KOXA 4ACZB 2EXOA 2VI0A 3RITA 1VPQA 5A8PA 3EWZA 4HNNA 4BQ2A 1CLKA 1P0NA 2L5HA 3LGEA 2NQHA 2B7QA 3VDBA 3WBEA 4MB4A 1EPVA 5HQLA 4O8RA 3A4AA 3LRLA 2NX1A 3AMKA 1W1ZA 4LGXA 4ERAA 1GHRA 5C9XA 1NEYA 4JN8A 2HE8A 1GKPA 4R33A 4WGHA 3QM3A 2OGYA 1O12A 2X1SA 1EJVC 3SQLA 4WF7A 3P8IA 5C9WA 4FAMA 4A8NA 2QEZA 4C5ZA 4UQ9A 1H7PA 5LXEA 1JDCA 2IMRA 1U22A 2ZA2A 1WP6A 4DLFA 3G3DA 4L4OA 4JTFA 3K8MA 3E1F1 2XFFA 3ZQ9A 4J28A 5I3KA 5EBAA 3LHUA 3GXMA 3UGRA 4Z2IA 3N73A 1X97A 5HBFA 3GXIA 1VR6A 2IW0A 5LHEA 1TG7A 3N17A 1Q2RA 5T26A 3KXQA 4RE0A 1LQ0A 3IRDA 4HU4A 3EB3A 1KFWA 1T8XA 3APGA 3MCOA 4GCXA 3VD3A 2ISSA 1GEHA 4AC7C 3AYTA 1IEXA 1QI0A 2YXOA 4DM2A 3DOPA 2CETA 2FH8A 4XSLA 5M17A 5FF4A 3G6MA 1PYFA 3AOFA 4DZIA 5IRPA 4CD4A 1T8QA 3GNPA 3TE9A 3W2NA 1V0MA 1B9ZA 3KOFA 2XVGA 3CUHA 4R9XA 4ZSTA 2HS6A 3TLQA 3F2CA 4GYPA 1TE1A 2ACUA 3B8VA 4C6OA 3QHMA 2PGWA 3V18A 4A35A 2FJKA 3EOOA 3WF4A 4N6FA 4M5PA 2X0YA 2ZZ2A 4QSFA 2J9YA 4AEEA 2NV2A 4CQCA 1TPVA 4N4PA 1KFKA 1DHPA 4A8RA 3PZGA 4A8IA 1DJGA 4S2BA 4OOZA 4PB3A 2A4AA 1RSCA 4GO9A 3OA5A 3GG8A 3D46A 3BCFA 1TMHA 2E4TA 2WC3A 4J3ZA 4EPEC 4EPDC 6XIMA 1PKNA 3W2MA 3TTQA 1ZLPA 3NDZA 4ZOBA 1IR1A 5HWNA 2G3MA 5CZ0A 3AHTA 1DVJA 2NV1A 1VCFA 3N15A 1XYMA 3OO2A 2NVCA 3RUBL 2PLKA 3BQ6A 3RO8A 3TFCA 1CDGA 4F8XA 1S5TA 5A6AA 4UFIA 3S9ZA 1MI3A 5CC5A 2OSXA 2VUYA 1ZRQA 3CTTA 5LIXX 4H9ZA 5E6YA 3LTSA 2E9BA 3S1VA 2J7FA 1A0DA 1YNQA 4HOWA 5FJJA 6XIAA 3QTPA 4HSHA 1XFBA 4IQEA 1PB0A 4S2CA 1IXPA 4NJIA 5JUVA 3ITGA 5AZ0A 5HMFA 1UWTA 3KEHA 2DZAA 3GG7A 1UYQA 1HFBA 4HGXA 4UFJA 2VGBA 1ZPTA 3KE0A 5I24A 1MEWA 2CHOA 2F8QA 5D9PA 2ISVA 2Z7GA 3I68A 5CC3A 3GH4A 4NP7A 2OT0A 3TW6A 4QIUA 4PZVA 4R9OA 4MB1A 3NEVA 4DRSA 4X9YA 3CS2A 1PX8A 3NXFA 1QW9A 1S2VA 4NRRA 5D2WA 3EYPA 1S2WA 3ABSA 3VI2A 3OLEA 3LYEA 4D6HA 1ISWA 1F6KA 3WNMA 2WK2A 1J2BA 4PR4A 3P84A 3TAKA 1E43A 1C91A 2ZUSA 2C14A 1Q6GA 4HNUA 1DWIM 1J4EA 1FWTA 4X61A 3WUEA 4JX6A 1VFFA 5BRPA 1TWDA 2XGBA 3R10A 3SAZA 3OHIA 2ZADA 1VENA 2XIIA 1YPIA 3VDCA 2GGEA 2VMFA 1AJ0A 1OD0A 3FEMA 4F0HA 1QWGA 3PPGA 3NQDA 4OGZA 4PMZA 1FHVA 4ZFMA 4JXCA 2ZIDA 4Q32A 1I2OA 2QPSA 1UJPA 1QXLA 2BVYA 4O57A 1UKOA 4XD6A 4W8AA 4IXHA 1BWVA 4J27A 2MANA 4KT2A 5J8LA 2OR2A 1PYMA 1M7JA 3AI0A 3H2CA 4JYDA 3T55A 1R0MA 2NLIA 4Q4KA 5I3HA 4AWTA 4JHMA 5H8MA 3KRBA 4FF7A 4ZOCA 5DF0A 5C5YA 5K4ZA 4XQ6A 1XV8A 3AIRA 1R3VA 1XC6A 5DN1A 2YZ5A 1OADA 4L4LA 1XJBA 3I4EA 2J79A 2V0TA 1TPFA 3VKKA 3EKZA 1F61A 2BOEX 3ZJKA 1RY8A 1EGZA 1Z44A 3QMTA 1JFXA 1UP0A 3DU0A 3XISA 5BZAA 4XAFA 1B0IA 1GOMA 1O5KA 1UD2A 1QT1A 2J75A 3RJXA 4NYUA 1DJQA 2UY4A 4NILA 3RM9A 1U5HA 3CUFA 2O55A 4PFMA 2Z1WA 3G8RA 1O7AA 1TFVA 2Z1KA 3D5HA 1H51A 3GNDA 1GORA 4O10A 4F0RA 4DAFA 2CLOA 3GC4A 2A21A 4ZR8A 3UW6A 4FHAA 3QPYA 2WW5A 5HOSA 3H55A 4F9DA 4UB9A 4WQ6A 1HKWA 2ZX8A 3I7QA 3PUGA 5E6ZA 3P81A 1A5MC 3EKGA 3B0VC 2V3DA 5A94A 1SJBA 2V63A 4FNRA 3GDBA 3SN1A 3LHWA 4D6CA 3SGUA 4E8GA 4Z1YA 1SYTA 3S6DA 1C29A 1T96A 3WIJA 3MUZ1 4PMXA 2ZRYA 2E25A 5MHBA 3WLLA 1TPWA 4LUSB 4GKLA 3WLPA 1XLCA 2HXUA 4UFMA 4ICMA 2ZXDA 3BPWA 2GGJA 4BKNA 1DE6A 3P61A 3HFTA 1MQRA 4QNWA 3WQCA 3NL6A 2HJPA 3LCHA 3MYOA 2PU0A 3WD2A 4N2YA 3LBOA 5I3IA 5CLWA 3SB0A 3HGSA 1NM9A 4IT1A 1MFUA 2BBFA 3AYSA 1UC4A 3P5YA 1QNRA 3AJXA 1X7IA 1ZALA 1MZRA 1Q66A 4YS1A 1WDRA 3UD6A 1QI5A 1P7TA 3SQSA 2VRQA 4J3SA 1ZBVA 3DEQA 2ATMA 4WJXA 2DGAA 2PDBA 5D2VA 4ECLA 3QF0A 3TTSA 4PB5A 1QWKA 4ZGYA 1JRBA 3PPHA 3FFSA 1DJNA 3V0TA 3HG2A 3G1SA 3H26A 3ZWSA 1ZBCA 4W84A 3O8AA 5HR7A 2YYTA 1OGSA 4HYRA 2WLZA 1LDCA 3AMDA 3NG3A 2FZDA 1KLZA 1NF0A 3ZSTA 4B5NA 5I06A 3NQ6A 4WY0F 3H7VA 3BG3A 4ADUA 4PA8A 3TWAA 4L80A 1E1FA 3WD0A 3WFZA 3BAIA 3RRAA 4M24A 2EGZA 2D69A 1L2QA 2VX6A 2X40A 2PDIA 4PCFA 4H01A 4DJFA 4LOCA 4TMCA 3KCJA 5C2XA 3AXKA 2OZ8A 4RDYA 3GRIA 3ITXA 1FWWA 3AIBA 3W7RA 3P82A 4O50A 3C8NA 4EP8C 3FA4A 1ICPA 1E55A 1N8IA 1X6LA 5JBDA 2PD9A 5A1AA 1M9HA 2R6OA 3UF9A 4AWEA 2ZZ6A 3MUCA 4EPKA 4MMWA 1TYGA 1JI2A 4H8UA 3DERA 3MUY1 3HQ1A 1OF8A 3TN6A 3UWYA 5HJYA 3GH7A 2EG8A 3UR8A 2CBJA 2FH6A 3OTRA 5RUBA 4RJEA 3MW7A 3KS5A 1TV5A 5FJOA 1BXCA 3C5QA 3GFYA 3VXGA 1GGOA 3I7RA 4GQQA 4ZENA 3FJ4A 1XR2A 3TTEA 2XGZA 4MLRA 4LAZA 3TQKA 1GW1A 1ISVA 5BU6A 1V08A 3MUIA 3P74A 3CV6A 3C56A 4LALA 3G1RA 1OT1A 5CC7A 4K2SA 1IT0A 5AHLA 2W6RA 3GHTA 2OYMA 2O0TA 4XBSA 2XWEA 5GJMA 2PTDA 3LHZA 4U31A 3BICA 2ZX6A 1HKVA 2QCEA 1XD1A 3ARYA 1KR0A 5A6TC 3NQ2A 5BNKA 2ESCA 2C0HA 3OA3A 4I5RA 4XSMA 1OFDA 3UPWA 4M7TA 3R8RA 3H2AA 2HEJA 1IXQA 1QUMA 4B9ZA 1T5AA 1TO3A 4MF4A 1DORA 1EZWA 1AL8A 4FNTA 4S38A 3TMQA 4J3UA 4AZ6A 3JVAA 1ESWA 1NARA 4HPNA 2HMCA 1H60A 1G4TA 5A6SA 3EDEA 4K68A 3BGAA 4MNKA 1ME9A 5EMMA 1GQNA 3MSYA 3LS9A 4EIVA 1UR4A 1WYIA 3ICJA 4Q6JA 5EBUA 4XO7A 4DYKA 2YOCA 1UPPA 1Z69A 2WO5A 4HA3A 3GG1A 5C6MA 2WCGA 4WY0B 4PMDA 2YDQA 4I9TA 1T0OA 3HG5A 3V0SA 2OZ3A 1ONWA 4UQBA 5H1WA 4Y8FA 1OCJA 3L4VA 3G6LA 4G8TA 3AS0A 3LX9A 3UYIA 1ISZA 1XSKA 2QS8A 4YL2A 1UR3M 2ZZ7A 3VIJA 3EWBX 3S1WA 1VFLA 4DJFD 2QCCA 3G24A 1NWRA 1E70M 4OE7A 2FZNA 3GDKA 3LPOA 2PAJA 3G18A 4JFWA 1TTPA 2V30A 3C4UA 2YB1A 2YL6A 4NIRA 3MC5A 2WZTA 1OCBA 1H41A 3CL7A 3NM3A 1KFBA 3T0BA 3U4FA 4TIMA 2V5LA 2X1RA 4M19A 2VEMA 1IWBA 3JRKA 2VUNA 1JDEA 3PZTA 4MJ4A 4ZB0A 4E3VA 3GD6A 4NL1A 3VC6A 2Z1BA 3B8SA 4GY7A 3FGCB 4K38A 4FLOA 1N7KA 2FTPA 2WKJA 2O9TA 3WLMA 3HPXA 4PBFA 2CHRA 3GLCA 4E0CA 3BAYA 3GTFA 4WDXA 2WQDA 4AZBA 2BASA 1MMFA 2CBIA 1RALA 4PMQA 1R3YA 2OQLA 4QSHA 1X8CA 1EH9A 1QHPA 4OTKA 5A6BD 3W1LA 3T1GA 4NJHA 1LUCA 1AH3A 2C79A 1OC5A 1DQUA 2CPUA 3VU2A 2PCEA 2PWFA 3NPUA 1OC7A 1S5MA 3LV5A 3W1AA 1VBJA 3CWNA 1TMQA 2JBMA 3W1UA 3RFAA 4PEEA 4NZ4A 3IIZA 4HP5A 2ANUA 2TMDA 2PMQA 3K13A 1QHZA 4O1EA 4B9YA 1UCWA 3ZOAA 3M43A 4TX8A 2GFTA 1KCKA 2QGHA 4ZEPA 3GWQA 2NXGA 1C90A 4K7YA 3V4BA 1EA0A 7XIMA 3MHGA 1QNPA 4GVHA 2VC5A 2FJUB 4GISA 1IZJA 3RK8A 4AWUA 1A5OC 3H12A 4EAYA 5CGTA 4FNPA 1TJRA 1ZGDA 3NZPA 1RQHA 5C0QA 3C2VA 1RJQA 3WF1A 4UFHA 1Q63A 3SRDA 4C6MA 1XLJA 4DIAA 1EHAA 4UQCA 3GHUA 2EHHA 4GVFA 3FYPA 3FDGA 4PMOA 4Q22A 1XIFA 4XD3A 2DZSA 4IOTA 3C3UA 1ZUAX 3KM8A 1RLDA 2OXNA 1TV4A 4W85A 2RGLA 1M7OA 2FVKA 4O19A 2DSUA 2GUYA 4LBUA 2OEKA 3RMJA 9XIAA 1JXJA 3ZIZA 4ADTA 3BL3A 1R87A 2XHYA 4GGBA 1WDQA 1WUFA 4UTIA 2ZZ5A 2OLHA 1WCGA 1REQA 4FS9A 1VP5A 2JGYA 3QJAA 5E70A 5A8OA 4LBSA 1IWAA 1JIBA 3E96A 2X30A 1GPWA 2F6XA 3UWWA 4JN6A 2E0PA 3G0XA 4BEQA 4Z08A 3W72A 3GSMA 3DFSA 4BJHA 3SQMA 1B57A 2Z00A 3ORWA 5D9OA 1Y5WA 1WOBA 3T2QA 2VZOA 5IDZA 3NQFA 5CXPA 3BLIA 3H21A 5AC7A 3T07A 3T0DA 2VM8A 3UCCA 2HVNA 5AYBA 4AF0B 2RDWA 1UW9A 4BI6A 2QUUA 3C8FA 4AUBA 3HN3A 4BS0A 1DIDA 5HPOA 2PC4A 4C6EA 1H09A 4YPJA 1LZOA 1B9BA 3UWUA 1W1A1 4MFDA 3TR9A 1F3EA 3FYOA 4JEJA 4DY1A 4QDMA 3M07A 2YDSA 5IBXC 2XVLA 2BLEA 1S2CA 3WENA 4QP0A 2I5QA 5A6BA 4GC4A 4PUMA 3WNKA 3A24A 1L8PA 4NJGA 1JPHA 3CK5A 2BVWA 2CIPA 4XKYB 1CXLA 1K7EA 2XH7A 3M1ZA 3PSVA 3OZPA 4DZAA 2P50A 2YJQA 4C6JA 2DSZA 3QLLA 2CNCA 2A0NA 1HTIA 4QX4A 2BY2A 3LNMA 4PTVA 3A3HA 4IJRA 2C1HA 3OVGA 1JF6A 1OK4A 4ZB2A 3T42A 3OOQA 3N6QA 1O95A 1XLEA 2B81A 4H41A 4GO8A 1E56A 3TN3A 3C3NA 5DO8A 4ATWA 5G5IA 2X16A 5AYYA 1A5UA 4QCFA 5LGXA 3EWDA 3TJXA 2CLIA 4JIIX 2JFEX 3ABRA 4CN4A 3FXYA 2HPMA