3LHVA

Crystal structure of the mutant v182a.i199a.v201a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGAGAQGGDPGETLRFADAAIAGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Conformational changes in orotidine 5'-monophosphate decarboxylase: "remote" residues that stabilize the active conformation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 84
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lhvA00
3TH6A 2R94A 3QJAA 3MO7A 2E5DA 2ZZ3A 3N3MA 4A2RA 4NJJA 1E51A 3UWQA 1GG0A 3NQGA 4FEZA 4NJGA 1SZEA 3B0UX 1P0KA 1H1YA 1I2RA 2X30A 1BKSA 1Z41A 4O57A 3GDLA 3PAJA 4JTGA 3GDMA 3G24A 3SJ3A 4LS2A 4WX2A 3S5OA 3KFTA 3CM4A 3P62A 2Q3OA 5I3JA 2A2IA 4O14A 3PS7A 5I3KA 3W6YA 4JTIA 3UZJA 3EXTA 5K2ZA 4FNTA 5D32A 1VCVA 3O6YX 1JCMP 2GJLA 5AC6A 1EX5A 5F2MA 1QO5A 4MFDA 3W1XA 4FF7A 5DBUA 4OQVA 5DLCA 1G7UA 3SY5A 2X1SA 2VFHA 1KA9F 1Q45A 3GXTA 2Y7DA 2PCQA 3W2MA 3G0XA 1RZMA 1TTIA 2E6AA 1LOSA 3VNDA 5KINA 3MP5A 3L0NA 5GVJA 5IM51 3C0JA 4JYDA 2YW3A 3BK0A 3M41A 5HWMA 1RPXA 3MHUA 2VEKA 5AHNA 3SIZA 4JTUA 1YPFA 1WA3A 1H62A 2ZZ7A 3L0GA 4JTJA 4UTHA 3H54A 2NUYA 1KM6A 3F4WA 3PBVA 5LHFA 3W1MA 3V75A 1I2NA 3W7QA 1EP3A 2OJPA 3DZ1A 2ZDRA 1UUMA 4NQ1A 2CFFA 2V2CA 2BXVA 5DCDA 1OJXA 5J5RA 4NXSA 2X1TA 1OK6A 2PC4A 2JKPA 5E1QA 2HMCA 5CPMA 3DKLA 3CU2A 4B5NA 1GYNA 1T99A 4FHAA 3L5AA 1THFD 1NVMA 3TC7A 5HWJA 4PEKA 4JGDA 1VJIA 1OABA 1S3HA 2QDHA 1WOBA 1JVNA 2YYUA 5HINA 3TAKA 3LXAA 1DKWA 4S1FA 3M43A 3W2LA 3L2IA 3DI1A 3NXFA 5LSMA 1GTEA 1D9EA 3EWXA 1B4KA 2Q8ZA 5FEXA 3LHTA 1TPEA 3BG9A 2DZVA 3BG3A 3UY8A 3F03K 2ZZ5A 3C56A 1VYPX 2FQIA 4KFOA 3HO8A 4LRSA 3L0KA 4WOZA 3DU0A 3DH7A 4JY8A 5AYYA 3FOKA 3EWWA 4K37A 1OFBA 1PHQA 1FBAA 1XM3A 4N9DA 3LTPA 3N19B 5BMXA 4N4PA 4DF1A 3EWYA 3PY2A 4LVFA 3W7DA 5SWUA 1YLVA 3S5YA 5D02A 3NQEA 4CQ8A 2VEMA 5FF3A 1TPDA 2WNQA 4QQ3A 1IXQA 4FNUA 1CX9A 3M7WA 4OGZA 3FFSA 1MEHA 3BLFA 3PULA 4ZQOA 2FJKA 1LTDA 5TBOA 1L9WA 3MYOA 4UFHA 2JGQA 4DEFA 2CLIA 2R8WA 3ABRA 3KRZA 4GFSA 5AOUA 2QCGA 5FF4A 3QMRA 3CEUA 1GWJA 3W1PA 3IGSA 4AWTA 3P61A 4Z1CA 3G1FA 3T55A 2Y7FA 4EF8A 3BW2A 4GBUA 3CWNA 3MHFA 1SSDA 2QCDB 4UNLA 2H8XA 2JKEA 1T96A 2WNNA 3GYEA 1I2OA 3P5YA 3FYOA 1WXJA 4M6PA 1A50A 3OIXA 4MJMA 5C54A 3SFKA 3I68A 2VFGA 1A5SA 2C6QA 1XBYA 3TIMA 3W2KA 1IIHA 2QKFA 3PF3A 5AHEA 4MFEA 1M5WA 2WSQA 4XBSA 5KZEA 3TMQA 2XN1A 3B0PA 4P2VA 5EBUA 2RDUA 4OV4A 3LGEA 3M6YA 3DFNA 4DO5A 4UMBA 1K8XA 3B05A 3N2XA 4LUIA 3ZFHA 4HNVA 4NNCA 5C6MA 2WSRA 3ANYA 3QRHA 2ISSA 4DBEA 1OFRA 1D3GA 1ME9A 3HJZA 2FPVA 2P0OA 3EX3A 1XXXA 4IWWA 3HF3A 5EL1A 1DL3A 4O4VA 4QAIA 3OEXA 3BLIA 1QPNA 3HIJA 1LRQA 4ADUA 1R2TA 1VS1A 4RXGA 2R91A 4S2CA 5G2IA 1AW5A 1XUUA 3LCGA 2TMDA 3W84A 2E6YA 4HHPA 2Z2UA 4PH6A 3TX9A 1S5VA 3KXQA 4K39A 4IOTA 1O5KA 2NV2A 3G3DA 3MWAA 2A6NA 2FFCA 4AXKA 1LOQA 3LXCA 1WDWA 1RQHA 2Y63A 4M7SA 2ZQ0A 1DORA 4K36A 5CGQA 3R13A 1R47A 1ZCOA 2ZYFA 3S5NA 4ZL1A 4LOCA 1PCWA 2LLEA 3L21A 3ABQA 4JX6A 2Y62A 3IRDA 2ZA2A 3QSRA 4GRSA 3PBUA 2G95A 1AK5A 4HNTA 4WOQA 1FCBA 1WQ5A 3GX9A 4NZJA 2B7NA 3NL6A 4QJ1A 1GG1A 3RK8A 2DJLA 1MO0A 3HG2A 5AC8A 3LB0A 3G1XA 5LGXA 3LI1A 2GUUA 2ZTJA 3QEZA 5C5YA 5K3VA 1FWSA 1TTPA 3CLMA 3C3NA 5D2VA 3STEA 1GVSA 1OK4A 4ZQRA 1JULA 4C1KA 3PUOA 5KZMA 3W1TA 1IF2A 3W7LA 1YTEA 3G1HA 3GXPA 2C13A 1K7FA 3NPVA 4WJEA 5CZSA 2KZHA 3MP4A 2Q3RA 2GQ9A 5F4WA 2EF9A 3LRLA 4MUZA 2P1FA 4GC4A 3C2EA 2NX3A 2ZCGA 1L6YA 3W1UA 1KFBA 4AMAA 3HGRA 1F73A 3JR2A 2HTMA 2YGYA 3E0IA 4BF9A 1Z48A 1UJPA 1WOAA 1LCOA 3NNTA 1FDZA 3HPZA 4PL2A 2Y88A 3NGJA 4JNMA 1I45A 1OX4A 3NM1A 3M47A 1FCVA 1F05A 5HUPA 1I8JA 1KM0A 1G4EA 4IJBA 5HQEA 4QM1A 1OHLA 3LCFA 5D30A 3TXZA 5HNRA 1LBFA 3NAVA 2GPTA 4A21A 1LRTA 4QNEA 4LV4A 1FDJA 1IXNA 2J27A 4M6VA 2G96A 2AAMA 4O1DA 5H2ZA 3CIWA 2GVJA 1ZALA 3MMTA 3P8JA 4E0CA 1KLZA 1ME7A 4NU7A 2NX9A 7TIMA 6TIMA 5J5DA 4A22A 4OHQA 1VGAA 4GE8A 3TROA 2E6FA 1HO1A 1XCFA 2V8ZA 3IIZA 2J9ZA 1TMHA 1UB3A 1ZAJA 3T4CA 4ADTA 3GVGA 3USBA 2CLHA 1TV7A 3LBMA 2NXIA 4M5PA 3INPA 1KBJA 2E6DA 1GTHA 1DQWA 1ML1A 5C2XA 1V7YA 4DQWA 2VEPA 3HOJA 4FIQA 1VH7A 1XBXA 3E96A 1L6SA 1TQJA 1QDSA 2YDAA 1TPVA 1SFJA 1GVRA 3WK1A 3RMJA 3NQ2A 3BG5A 8TIMA 4UFIA 4N9BA 1W37A 2ZZ2A 3U6WA 5G2WA 1PV8A 4KFPA 2F7FA 3P81A 3NR0A 1TTJA 1ZHAA 3WJZA 1D3HA 4BR1A 4IMEA 4Y6GA 3QFEA 4CQAA 3C8FA 1P0NA 5L6UA 4ALDA 4N6FA 2TRSA 4K8HA 1H50A 1JQXA 1KM4A 3CQ0A 3W7PA 5AHIA 1H1ZA 3W9ZA 4AHPA 3GB6A 3KX6A 4LC6A 1B9BA 1VPXA 3CPRA 3GAKA 4O0ZA 3LRKA 1ZAHA 4NZFA 4TX9A 1I2PA 2CW6A 3P5ZA 1O60A 2WV8A 3IV3A 1LYXA 1AL7A 1H7OA 2Y6ZA 3UWYA 1X1OA 1LP6A 2DZPA 1TQXA 3G1YA 1OG0A 3L66A 3C2OA 3S1VA 1LBLA 3TQ0A 2WQPA 1SQ7A 3LHWA 4X3ZA 1XL9A 4JYFA 3DAQA 3M5ZA 1RD5A 2C18A 2AGKA 4K6AA 4O10A 1K7XA 1NAL1 3FJ6A 1FWNA 1QFEA 2WNZA 3ELFA 1JCJA 1S5WA 1FXQA 2FTPA 4AEOA 1XUZA 3LV6A 3FS2A 3T7VA 2RFGA 3STGA 1GEQA 1LRNA 2CLEA 4NJKA 3V1PA 3I65A 5BNKA 1ONRA 3NOEA 5CZTA 3CEPA 3RU6A 3TSDA 3ZR4A 1SO3A 2VOMA 1F5ZA 1XDLA 2QCMA 4Y96A 1TRDA 1EUAA 4AF0B 2OCZA 4E2DA 2E1DA 4Y90A 1OFOA 4MY9A 1EB3A 3FLUA 1KM1A 5FEPA 1Z44A 1OFDA 2A1YA 2FB2A 1TPC1 4IQLA 1GZGA 1YXCA 1Q6LA 2V0TA 1EEPA 4ZQNA 1TB3A 3LERA 2WKJA 1NF0A 2ISVA 2CZFA 3EB2A 3MBFA 2X2GA 3OBKA 3M1ZA 2C0AA 2ATMA 3OVQA 2YZRA 3ZWTA 3BLEA 1A5CA 1JJKA 1H61A 4UTKA 2CU0A 2CLLA 4H6KA 2ZA3A 1U83A 3BW4A 4AHOA 2A7NA 1R2SA 3W76A 3IIVA 1O4UA 3NZRA 1F6KA 3T78A 4WXZA 1ME8A 4QISA 1K3UA 1WV2A 2CWNA 1UBSA 3NQ8A 2C19A 3P8IA 1IXPA 3QM3A 3G1AA 4O28A 2PRLA 2Z1BA 4RZ4A 3EXSA 4UMAA 4I7WA 1KV5A 3DKJA 2YXGA 3EX4A 3Q94A 1SSGA 2VFIA 3FKRA 1SU5A 2QCEA 3G1DA 1C8VA 4ZQCA 4JEQA 2ZRVA 3MI2A 4LW7A 3EX6A 2BTMA 4NJIA 4IMCA 2G97A 4GWEA 4CNNA 3OA3A 4HPJA 4PC8A 3PM6A 1WBHA 4JDYA 4C1LA 3O6DA 3SZ8A 4YXGA 1AL8A 3NPWA 4IMDA 2I14A 5F2LA 3EKZA 3HQ1A 5EY5A 3FIGA 4ICNA 1W3IA 1YADA 3NL5A 3UPBA 3G1VA 4RR4A 4TMBA 1QPRA 4EIVA 3W88A 1DJQA 3L5LA 3GDRA 3N14A 2QCDA 3W23A 5CKSA 4Y9AA 1VYRA 3TK7A 1YXDA 2VEIA 3W86A 3NQVA 3HG4A 1FWWA 1JUBA 1EUNA 1MEIA 2V30A 2NXHA 1HUVA 3CHVA 4YMZA 1Y0EA 5AC7A 4Q32A 5DY3A 3S1XA 4MZYA 1VRDA 5AN7A 1ZFJA 2NWSA 1H7NA 3C61A 5AHLA 4Y8FA 3A21A 2C3ZA 3VI2A 3VFLA 4CLMA 3LRMA 1WYIA 1W54A 2E77A 3B03A 4I9AA 1H60A 3NA8A 2W0UA 2Z6JA 4PCFA 3N9RA 3C2RA 3LCHA 4N02A 1TO3A 3W7NA 3GLCA 4L4MA 3H53A 3HG5A 4OWGA 5EMUA 1G67A 1N55A 2QCLA 5L9FA 3W7HA 3A5FA 3QPYA 3W85A 1W31A 3GAYA 4JX5A 4W9TA 1KTBA 5AB3A 1HFBA 4K7VA 2H3DA 4IGHA 5EYWA 4G1KA 3PG8A 3IGXA 5A8GA 4N4QA 3S6DA 3R2GA 3WJXA 3W1LA 2ZZ1A 4PTNA 2QEZA 3DFTA 1PIIA 1OYCA 1QAPA 4N9EA 3STFA 3PSWA 3ABOA 3W22A 4HNNA 3O63A 1YYAA 3CTLA 5BW6A 2GVGA 4UFLA 4FXSA 3TQVA 4ORMA 2RDWA 4O50A 3F4NA 4DO4A 3S5ZA 3T40A 4CCCA 4NX5A 3R89A 3SSJA 5I3FA 4FNSA 3C52A 1JUKA 4GUHA 1TRIA 3OHIA 4ONVA 4PFMA 5D05A 2FPYA 3L67A 3UY7A 3W70A 1PS9A 3NL3A 3UWVA 1SR9A 2OZ0A 1SFLA 3ABSA 4JXCA 4HT3A 1RR2A 5FI8A 3L9CA 1KFEA 1M6JA 3RNDA 3EEGA 4LU0A 4FX7A 2D73A 1MZHA 3TE9A 3TNOA 3UXDA 3PWAA 3TW6A 5I3GA 2YW4A 4LRTA 1NF7A 2WSYA 3ZWSA 4AWUA 3TSBA 3WJWA 3LXBA 2VFEA 4UTIA 3JRKA 1IIGA 2FIQA 4JIQA 5FF7A 1FCUA 1VLWA 1H51A 5CPNA 2EPHA 3W72A 4O17A 5D03A 2V82A 3CB8A 3QPZA 4OU1A 4O0KA 2B0MA 4O1CA 3HMJG 3VE7A 3NL2A 5FESA 5LNVA 4RK8A 2ZZ4A 4HSOA 1VQTA 5AYZA 1KTNA 1TJPA 2YFOA 5LNSA 3TW7A 1PCKA 3HBLA 3HG3A 2QUVA 5HMSA 4XUGA 3KVMA 4O18A 4UFMA 3W7JA 1W0MA 5FF0A 3W75A 2V5LA 5BOOA 1W8SA 2YPIA 4XKYA 5DY2A 4OBTA 4S2BA 2Y70A 4Z0SA 4RV8A 4R7JA 2FPTA 3G1SA 1JRBA 1EIXA 1Q6QA 4UTWA 5D37A 1DOSA 1C9DA 4NVTA 3M5YA 2OMAA 4RZ6A 3B4UA 3S8HA 4K7YA 5DCEA 3LDVA 3N34A 4HNUA 4LVBA 1OX5A 1SO5A 1A5AA 3W1AA 3TFXA 4IX0A 1VZWA 3TQKA 2Z0IA 3A9IA 3DENA 4MY1A 5HR6A 3S9YA 3LLFA 1I2QA 2V2HA 1SZNA 3KHJA 2ATSA 4Z1AA 4WY0B 1OFEA 2QR6A 3O05A 3MUXA 5IBXC 4AAJA 1UCWA 3S1UA 3C4UA 3TU9A 2DU2A 1OF8A 4FXRA 2QJHA 3GIYA 4RKAA 3D0CA 3TC6A 2OX1A 2OT1A 3OVPA 2ZBTA 4EF9A 4MY8A 3TMLA 3DFPA 2NUWA 4UTJA 1MXSA 2JKAA 1FXPA 5CZJA 1VR6A 1SW3A 4EWND 5F1VA 5LKYA 3THAA 2J88A 3BPWA 4O4WA 2F84A 1P5BA 3E9AA 1KFJA 2C15A 2DZWA 3UZ5A 4ML9A 2OT0A 4L4LA 4XKYB 4WQ6A 1K8YA 4DF0A 4JS3A 4BK9A 2J24A 4O13A 3ATZA 3M0ZA 3IEBA 3I7RA 4HKPA 3NO5A 1L2UA 3A5VA 4GXMA 3OVRA 3P60A 1EP1A 5CG7A 3VKJA 1G7VA 3DI0A 3W74A 4N9CA 2E68A 1LOLA 1MEWA 4RX0A 3AO0A 2Q8LA 4IX2A 1QNVA 2YR1A 2EGZA 3W7IA 3SI9A 3K30A 5EKYA 2QCCA 1TPUA 4ZVJA 4PODA 3N73A 2ZRWA 2JBMA 2QJIA 1H63A 1RQEA 5BRBA 1H7XA 3WJSA 4D2JA 4O53A 3LCXA 4A2SA 4FIRA 3GDTA 3QW4B 3PR2A 4FNPA 2R14A 2ABAA 3NEVA 1KFKA 4RLIA 4UUIA 3MHGA 4MKNA 5D33A 1IXOA 1QPQA 1W5NA 2ABBA 3W7GA 3EX2A 5KITA 2QUTA 4R33A 3NDOA 1QO2A 3G22A 3DBPA 1BWLA 3LHUA 1X8FA 3RLUA 3JS3A 4UTUA 5K9DA 4AF0A 2PE4A 3DHDA 1SO4A 5AYXA 2BLEA 4ZMGA 1GVFA 4N6EA 3I7SA 4DO6A 2XN2A 2JGYA 2YSWA 3M5XA 3GZ3A 3QC3A 4DPPA 2NZLA 1T8XA 4Z1BA 2Y85A 2GOUA 2V81A 4OE7A 3N2MA 3AJXA 3M44A 1PVNA 4HIBA 4LTSA 5K9XA 4ORIA 1AW2A 4UR8A 3GKAA 1YTKA 2W79A 4Z1DA 2H8ZA 2GQAA 3IIXA 4GUIA 2QCFA 4BI7A 4QNWA 2PURA 5D2XA 3KVJA 4H4IA 5CZ0A 4UCGA 3W1QA 1QCWA 3A24A 1CW2A 4MIMA 3LTSA 1FWTA 3M9YA 1F74A 2A21A 3KOFA 2XN0A 1W56A 4CNOA 3UWUA 3MBDA 1DV7A 3U8GA 3G0SA 1JCXA 2QJGA 3GK0A 1TPFA 1XBVA 1ZAIA 1I4NA 1QWGA 2A6LA 3UD6A 5LNUA 3L65A 2TYSA 2BZNA 3E12A 2NX1A 3S0CA 1TV8A 1VHCA 4DXVA 1WBJA 3BW3A 3RLVA 4BFAA 4MYXA 1N8FA 2O7SA 3P82A 1FQ0A 4FB7A 4UXDA 3PB2A 3TFCA 3GXNA 1OF6A 2A85A 4DELA 4X9SA 4JTFA 4O16A 4RCXA 1YDNA 4MJZA 5KSWA 1K8ZA 3UWWA 5IBXA 2VENA 3TXVA 1FDYA 1BTMA 4MOZA 1LDCA 1KM3A 5G2HA 4LVAA 4UTTA 4WZHA 3DFOA 1QPOA 3HPSA 3H55A 4O1AA 5ABTA 3LOTA 5TIMA 1F76A 4ZQPA 1M7PA 2O7QA 4AB4A 4ZQMA 2V2DA 3LCIA 1PHWA 4O15A 3RF9A 3MYPA 1N7KA 2VKZG 5TQLA 2EHHA 5K4ZA 3NPXA 4FO4A 4BWLC 1G6CA 3DFSA 3O6CA 3QF0A 3FA5A 3S1WA 4O12A 5CPLA 1O94A 1TJRA 2B7QA 2PRMA 4AVFA 1SPQA 3IVSA 4LNYA 2E5BA 4MZ8A 4XBKA 4ADSA 3NQMA 1Q6RA 4HSNA 1LROA 4YLWA 1ADOA 1XFBA 1NFBA 2QAPA 4MPQA 3QMTA 1DJNA 2G5WA 1U5JA 4A3UA 4A29A 1LORA 1PE1A 1TPWA 3FYPA 1GVQA 2UV8G 5DBTA 2X16A 4MYAA 3QZEA 3GDKA 5AHFA 4N2YA 4AWSA 2WPBA 1XC4A 3NQFA 1GYLA 5D2WA 1L6WA 3LCLA 3C6CA 1DVJA 4TMCA 3G18A 4JTEA 2VELA 3BO9A 1KBIA 2E5CA 2H6RA 1KM2A 2P10A 2YFNA 3R8RA 1XKYA 3P7YA 1KLYA 1M7OA 2J9XA 1OFAA 2ZTKA 5KZDA 4UIOA 3TA6A 3P67A 3STCA 3W7MA 3FEMA 3P74A 3G8EA 1XBZA 5CSSA 1TCDA 5H91A 5LNWA 4O52A 4UTWC 5E93A 1H7WA 1KFCA 2FLIA 4LVGA 3KRSA 4UFKA 5KTLA 5KMYA 3GNDA 3LHYA 3B0VC 1QR7A 1YDOA 1AG1O 1G4TA 2HS6A 5F2IA 4AHQA 2RH9A 5E0KA 2XFWA 1A53A 2GJNA 1K7EA 4NX0A 3YPIA 5U7SA 4MVAA 3B04A 1SW7A 4Q4KA 3PG9A 1B3OA 3QQ0A 2PRHA 2ISWA 3I7QA 1W1ZA 1S5TA 1W3TA 1ZJIA 4JIPA 1F7BA 4TIMA 3VE9A 5FEWA 1WAUA 2HS8A 4M6QA 3W71A 1K02A 1EPXA 3KVKA 1VCGA 1ICSA 3FJLA 2H3BA 3SR7A 5I3IA 2B7OA 3KRUA 4LS0A 2V9DA 3NZ1A 2BSLA 4CCDA 2A7RA 4GUFA 3CT7A 4I7UA 3MI6A 4MLJA 2DZUA 5CSRA 1W5PA 4O11A 5DCBA 3W73A 3KAOA 1HL2A 3MW7A 4JD4A 1ZENA 3CIXA 3O07A 5LNRA 1SUXA 1SW0A 4U28A 1A5BA 3PVFA 1YXYA 1P1XA 1F2JA 3HGJA 3L5MA 3SW6A 5K4XA 1VCFA 2NUXA 3UPWA 5D09A 5CPOA 3R12A 4R34A 5F2GA 2X1RA 1TPB1 3QW3A 1LLZA 4JN6A 2JK2A 1KW1A 1F6PA 3GR8A 5D2TA 3W07A 2NWRA 1GVOA 5DXYA 1JCLA 2QF7A 4UNKA 1W5OA 3NM3A 1VC4A 2CLOA 3SGUA 1TSIA 4AH7A 4R53A 5K7JA 1K03A 3GKFA 5A5WA 4UR7A 1KTCA 3M16A 2Y89A 4WD0A 1CI1A 1KV8A 2TSYA 2TPSA 2CLKA 1RQBA 2W6RA 2ZA1A 5EPDA 3W2UA 3LLDA 1XI3A 1DHPA 2NLIA 5C55A 4TO8A 1H7RA 2A0NA 2C1HA 2B4GA 3TSMA 4DF2A 4UFJA 3IVTA 5F1UA 4BWLA 5BMWA 3P84A 3W1NA 3OG3A 1V5XA 1T0OA 5HR7A 2X1UA 2VFFA 3NPUA 4GJ1A 2CZEA 2CLFA 4JR5A 3IGUA 4FNQA 3NQAA 4YL2A 3W7CA 2QUUA 3ZS4A 4WY0A 4P61A 1YPIA 3G3MA 3W3OA 1TPH1 3TCEA 3EWBX 3QQ1A 4K8EA 3BVJA 4E2BA 4U4MA 4IXXA 2QDGA 4JTHA 1OVDA 1H5YA 3B8DA 4BI5A 3NQCA 4JTSA 1AW1A 5DXXA 2WO5A 2A4AA 3LM7A 3Q37A 4LUJA 4DBDA 1FWRA 4JY9A 4LT9A 1NSJA 3P80A 3WFAA 2HSAA 3LTYA 2DP3A 1Q6OA 4OV9A 1EP2A 2ZRUA 4Z0JA 3IIPA 3W87A 3PBWA 1TREA 3O8AA 2DZXA 1SZFA 4CCEA 4EOUA 2H90A 4POCA 1FY6A 3UNDA 4FX6M 1P4CA 3RFAA 1DBTA 4GUGA 2ZRYA 4M19A 5LGZA 4J9JA 1HG3A 2ZFAA 1SZGA 3B06A 4UTMA 3PC0A 4XTIA 3BARA 3LHVA 4EVZA 4OT7A 1TTQA 2CLMA 4RZ5A 3BGJA 3THQA 3SECA 1O95A 1Z42A 4KFNA 3G8RA 3TKFA 2BX7A 3PB0A 4JTTA 2A5HA 2ALDA 3IIOA 1VYSX 4K38A 3TJLA 3QMSA 1LZOA 5G4WA 3SGZA 1JQVA 5K9CA 1RVGA 4MLRA 1ICPA 1J4EA 1TV5A 3TJXA 1FCQA 2DORA 4JX4A 1G4PA 1SO6A 2C16A 5U4NA 4JTKA 6ALDA 2RHGA 2BWGA 4XZ9A 1GPWA 3EWZA 5G1TA 3M5VA 4JTLA 1OFPA 2RDTA 4RXFA 1FUYA 1QOPA 4UTTC 3T44A 2IQTA 3LV5A 3UQNA 2Y7EA 3UXAA 5MHBA 4HPXA 1FX6A 3S42A 3O15A 4WXYA 5DN1A 3MP3A 3W7RA 5AFDA 3VCRA 3Q58A 5D2YA 3WK0A 4JYEA 2GQ8A 3HB9A 3O1NA 4UMCA 1VLIA 3MJYA 3IVUA 2EKCA 5FF2A 3EXRA 3CWOX 3HPXA 3NQ7A 4X2RA 3LHZA 1PL9A 1OYAA 4JDBA 3PUDA 2ZRZA 4NJHA 1H7PA 5D04C 3UYCA 1QOQA 3TAOA 3ATYA 1X6UA 3TR2A 3A23A 5HJLA 3PSVA 4RJEA 1YTDA 5I3HA 2Z6IA 5LHEA 1LM1A 4E38A 4QIUA 1MSSA 3N9SA 2YX0A 1W5MA 4MZ1A 5F4SA 1GT8A 4JICA 1R2RA 1KFLA 3W7EA 3O16A 3F1QA 2YCEA 4I7VA 4LS1A 5DELA 4IPJA 2WOQA 3E02A 3W83A 4DPQA 1RV8A 1UUOA 1J2WA 2I1OA 4LVDA 4LWWA 5AHMA 1W5QA 2NV1A 3E49A 3HGSA 4XQ6A 4O19A 5G1YA 1JRCA 4NT0A 4GUJA 1HO4A 3C2VA 2RKXA 5G5IA 2V5BA 3W1RA 2FDSA 3MI3A 2GVLA 5T26A 2YYTA 3Q2DA 3KVLA 1BEUA 2DJXA 4FNRA 2J9YA 5G4EA 1BWKA 1DQXA 5F4XA 3LCWA 5HULA 3C2FA 4Q33A 4O1BA 3PBYA 1JCYA 3DFQA 4NNAA 4IUOA 2AQWA 4FX8A 5FEZA 4YCPA 2QCHA 3NQDA 1ZNNA 1LLWA 4Z08A 1EWEA 4QSHA 3CC1A 4X22A 3LI0A 4IMGA 3UWZA 3DGRA 2VC6A 1LBMA 1Q3NA 4M7TA 3WK3A 2Y7GA 3DXIA 2E09A 4NUWA 1WX0A 1JR1A 3WK2A 1XDMA 4IXHA 1OX4B 1OX6A 2VXNA 2FB3A 4TR9A 3GR7A 4YCOA 3W2JA 4LV9A 3NYZA 1G4SA 3A22A 4PL1A 1KM5A 4UTLA 1UASA 1IGSA 3TV8A 1NEYA 1HTIA 2ZZ6A 1ZY9A 1OYBA 4BI6A 2QAFA 3NG3A 1B4EA 4LC8A 4ZZ9A 3TUUA 1OFQA 4XWUA 4IMFA 2VFDA 1TIMA 3LBCA 4UC5A 1J5TA 5LZLA 3LX9A 2EAWA 5HUOA 1W3NA 1X1ZA 3R5EA 3W7OA 4KWVA 2Y61A 2J6XA 2NXGA 1GQNA 1TYGA 3PUEA 1JUEA 3BV4A 3W7KA 1ICQA 3GNNA 4GNJA 2I9EA 2DZTA 3I6RA 4HN4A 5HWNA 1X7FA 1EWDA 1GOXA 1ALDA 2CZDA 2A7PA 4IPIA 1YDVA 3L68A 3QSTA 3FKKA 3EX1A 1B57A 4NNBA 1R30A 4WUIA 3QYQA 4XTDA 2CZ5A 2QCNA 3TDFA 4CQ9A 3O06A 4KKXA 4TU1A 3QH2A 3NVTA 4O54A 1VHNA 3EKLA 1QMLA 2B7PA 3HGOA 3W2NA 4LY8A 2ZRXA 3BGGA 4KWWA 2C14A 3WJYA 3EWUA 4O8RA 1AMKA 1O5XA 3NQ6A 1EA0A 3G0UA 5D38A 4NXKA 3U2OA 1GJPA 5EA9A 1C29A 2DZSA 4QITA 4YWIA 4CNPA 1G69A 4H3DA 3DHFA 4PA8A 2WJZA 1JCNA 4WY0F 1R46A
chains in the Genus database with same CATH superfamily
3GTXA 4LF2A 3M64A 3MO7A 1GJUA 5C7VA 1AA1B 4NJJA 4H8HA 4WJ8A 1GG0A 4FEZA 4NJGA 2WMJA 1E73M 3M0JA 3N6QA 1HT6A 2PGRA 3ICJA 3PAJA 5A6LA 3R0DA 1G1YA 3Q67A 2Q3OA 5I3JA 5TD4A 3PS7A 3WDQA 2BDQA 5D32A 3D5HA 1W9UA 1TA3B 3S2JA 9CGTA 4AYSA 1J79A 2HE8A 5CH9A 1MFUA 3QQWA 4OBRA 2X05A 3WMCA 4GCXA 3POCA 4OQVA 5DLCA 1QBBA 1US3A 4EACA 1WAWA 3GXTA 1ZBVA 4C6EA 2RGLA 1RZMA 4XO7A 1TTIA 3VNDA 1EDGA 2KX9A 1B3VA 4OTKA 3C0JA 1OBAA 2NVCA 1A3HA 2VEKA 2JE8A 4C60A 4B3LA 4IIDA 2ZZ7A 1H62A 2VQUA 4JTJA 1KCKA 4LCSA 3PBVA 3V75A 1I2NA 3WMLA 4MB1A 3W7QA 1EP3A 4E6MA 2OJPA 3DZ1A 1UOKA 2ZDRA 2P8CA 1OJXA 4MWAB 2X1TA 4NYYA 1OK6A 1ZJHA 5CPMA 4B5NA 1GYNA 3WLIA 1T99A 2F6UA 6XIAA 3TC7A 5HWJA 1QUMA 1OGBA 1KR0A 3TTOA 2QDHA 1WOBA 6A3HA 1M7XA 4DIAA 3LXAA 4DI8A 3FJ4A 2ZX6A 5I06A 3KDOA 3NXFA 3RM9A 5JU6A 2YKKA 5AC5A 4C6FA 1GTEA 2BHUA 4OJYA 3FDGA 2BG5A 3IS4A 3T05A 3BG3A 2DZVA 3UY8A 4EK7A 1VYPX 3S9IA 2FQIA 4LRSA 3L0KA 3MWCA 1O6IA 4ERAA 4OUEA 1DJIA 3DU0A 4GVFA 3WBEA 4K37A 1XYAA 3A64A 4N9DA 1E6SM 3SCRA 3HTWA 3ARPA 3N19B 5BMXA 4DF1A 4LVFA 5M5DA 4Z17A 1YLVA 5FF3A 1T40A 1TPDA 2A3CA 2H9AB 1TMLA 1CX9A 5H6HA 3BLFA 3PULA 4IP4A 1J11A 5IDZA 3MYOA 1H4PA 3UGRA 1NQKA 3KRZA 4EXQA 4RDZA 3GC2A 4IIGA 4JFTA 3U57A 3F4CA 3L4XA 3W1PA 2X7VA 3G1FA 2PWFA 1WXZA 3T55A 2Y7FA 4EF8A 1W1TA 3WNKA 1EYEA 3CWNA 3WO8A 3AWOA 1E1FA 1WXJA 8RUCA 1WPCA 1A50A 2WANA 5C54A 5AYBA 3RU8X 1JXJA 2GDVA 4TV5A 4PB4A 4Y9NA 1IIHA 2QKFA 4MFEA 1RA5A 3SCTA 3F7JA 3VKBA 2XN1A 3B0PA 1LG1A 4P2VA 4S39A 3DFNA 3B05A 4LUIA 2FHCA 2WSRA 3ANYA 4PMRA 4DBEA 1GORA 1D3GA 3OO2A 4JPGA 4UCFA 1CGUA 4HMCA 4GLEA 5CC5A 1E70M 4IWWA 1DIEA 1JEZA 4F9JA 2Z00A 1DL3A 1QK0A 5I0DA 4O4VA 4WKAA 4O0QA 4D6EA 3OEXA 3TQPA 1QPNA 4IIFA 1V4YA 1NARA 3EB3A 5I23A 5CEWA 1XW8A 4YWSA 1FWIC 1QNRA 4HCLA 4DAFA 4E8CA 3NZPA 2WBKA 2Z2UA 3TX9A 4IOTA 3SUUA 1BTCA 2NV2A 3G3DA 3MWAA 4ZSTA 2PBOA 3DESA 2A6NA 2FFCA 1LOQA 1WDWA 1RQHA 2Y63A 2PP0A 1UPPA 1MUMA 2ZQ0A 2PDLA 3VX0A 1PTGA 4DZ5A 3FDKA 5CGQA 1R47A 1ZCOA 3S5NA 3WLSA 1PCWA 2X41A 3L21A 5BOEA 5MKGB 4CNSA 4JX6A 5CC7A 2Y62A 4B5WA 2D0FA 3IRDA 5C7HA 2G95A 4HNTA 4WOQA 2QDDA 4Z2JA 2QPXA 1ZP3A 1S2CA 1GG1A 3VKCA 1VFLA 4S3AA 3KEHA 2OXNA 4GKLA 4L65A 3QEZA 2BY3A 5K3VA 2VGBA 1GVSA 1OK4A 4YTQA 4GPNA 1JULA 4LUTA 1HJQA 2Y24A 2BGNE 2TODA 4C1KA 2V68A 1IF2A 3GFXA 4I6VA 3ZJ6A 3UNTA 2C13A 5GJNA 2WNWA 5CZSA 1QI0A 2Z1WA 4V1YA 3MP4A 1V08A 2WHMA 4MWAE 5F4WA 4WF7A 3BV7A 2ZWYA 3WLLA 1W9VA 3KCLA 4AY8A 1BG4A 3ECQA 2BOEX 1F73A 3JW7A 4BF9A 1BXBA 3UWEA 1LCOA 3NNTA 2I5GA 3OZMA 1A5OC 3PTMA 3NGJA 1DPMA 2GL5A 3KP1A 5D9OA 3ORWA 1WKYA 1KM0A 2DEPA 2XINA 2OO6A 1LBFA 1J96A 3LN3A 3KRBA 2GPTA 1LRTA 1QJWA 1S38A 4L64A 1E0TA 1X96A 4LJ3A 2DV0A 3DYOA 4GQRA 5LIWX 1C3FA 1IXNA 1NOUA 3T2PA 1YNQA 2ZKMX 2GVJA 3DC0A 4ILSA 3P8JA 3L7RA 1KLZA 4NU7A 7TIMA 3ZT5A 4DYEA 1V0MA 5J5DA 3K4WA 2ZX5A 4LUSA 1HKWA 1HO1A 3TWBA 2V8ZA 1CXKA 3T4CA 2J47A 1V6TA 1JPDX 1TV7A 3LBMA 3VIGA 2BB0A 3W6LA 2J6VA 3KDNA 4BF7A 3AYVA 3GH5A 5G1MA 4YTSA 3FXYA 8TIMA 3AHZA 4I8YA 2Q8XA 3UXKA 2ZUSA 3BCFA 4WLCA 3CV2A 3VKKA 4X61A 4LCQA 5REQB 1ZSXA 3UT0A 3QOMA 1DIKA 3HV9A 4Q6XA 4F8XA 2VX5A 4BR1A 4CQAA 3QFEA 4W7WA 2G3IA 4ALDA 2VX7A 1KM4A 3W7PA 5AHIA 3LGDA 1ECEA 1OD8A 3BC9A 2OWWA 1R3WA 3CPRA 3GAKA 1O66A 4AU0A 4HK5A 1A47A 2NVAA 1ZAHA 3WQ8A 2CW6A 2XSBA 4A6GA 2RJGA 1H7OA 2FMOA 5JBFA 3UWYA 1TQXA 3G1YA 3KS5A 1VFUA 3TQ0A 2WQPA 1X8CA 1RXOB 3MB9A 1XL9A 3R6IA 3PJXA 2C18A 1W3LA 4DBSA 1NAL1 3CL6A 4BQ5A 3ELFA 1L6FA 1S5WA 2ASHA 1IZKA 3L2MA 4IQEA 1F07A 5BXRA 1QW8A 1U1HA 1Y7VA 2GFTA 2MANA 3NTYA 1RH9A 1GEQA 1GOWA 2CLEA 4L4OA 4CNTA 2NVDA 4F0MA 7CGTA 3NOEA 5CZTA 5I78A 3N13A 1JI2A 4DRSA 2PTXA 2PUZA 3A4XA 1XDLA 2QCMA 4Y96A 1TRDA 5CLTA 3M0XA 4MY9A 3FLUA 5DT7A 2XVKA 1V7AA 2ZUUA 1E5NA 2NQZA 1B3YA 4DI9A 1KD0A 4IQLA 4Y9MA 1YXCA 3T0BA 2J25A 1Q6DA 1EEPA 4ZQNA 3M6DA 4Q8OA 4PUJA 2WKJA 3TEVA 3G2GA 1GNXA 3WIJA 3LA4A 2ATMA 1D7FA 1D8CA 4QLKA 1JJKA 3HQNA 3M46A 4YJ5A 1HQTA 4QE4A 1XSIA 3GYCA 2WLYA 4H6KA 4J3VA 2EJ1A 1UP3A 2ZA3A 3MV01 4H9XA 3MU7A 4MNKA 1YQ2A 3BW4A 2PGEA 1LG2A 1IT8A 3AIUA 2J79A 3OYXA 1UH2A 2OX4A 4ERGA 1Q7MA 3PPCA 3E74A 4I7WA 2VJXA 2ACSA 4KGJA 1KV5A 3EX4A 4QCFA 2PWHA 3FKRA 4IPPA 1SU5A 1C8VA 4ZQCA 2NSOA 3MI2A 3EX6A 5JBDA 3KCOA 1UOZA 4ZO9A 4GWEA 2QULA 4RE2A 4HPJA 3SO7A 3VKDA 2DSKA 3O6DA 1AL8A 4IMDA 3CHFA 3FIGA 4XSLA 4HA3A 3CPGA 4TMBA 3WQDA 1MUCA 2IS7A 2WHKA 3TJ4A 1PYFA 2G0WA 4HOXA 3U2EA 4F0LA 1JUBA 4ZO6A 4YMZA 1HUVA 5AVHA 1Y0EA 1Z6KA 4A35A 5AC7A 4PUDA 3EB4A 3NVDA 3S1XA 1OT2A 5C9RA 4LSBA 1PX4A 4HMNA 4DJEC 1HJUA 4YTRA 2XGZA 5FJPA 3LK6A 3A21A 4RE4A 4DM2A 2CXEA 2P3EA 2GGJA 2J7CA 4CLMA 2E77A 2GJRA 1JG9A 2Z6JA 2ZOXA 4PCFA 5I07A 3AIQA 2EEXA 5FA5A 3OJGA 2P8BA 3GLCA 2XUCA 4ACZB 3H53A 1NQ6A 3HG5A 5CSUA 3CAVA 2ZXDA 6CGTA 4EXBA 1Y65A 4JX5A 2HPIA 2V5DA 1KXTA 3URQA 3A4WA 3K8LA 2E9MA 1TKKA 5EYWA 2YIHA 1BAGA 3S6DA 2V5KA 2JFEX 2FTWA 1GQJA 1PEZA 2RDXA 2ZZ1A 1MW3A 2QEZA 1C8QA 1E6NA 2Z24A 2PWDA 1DXFA 3CTLA 2R82A 2RDWA 4O50A 1QASA 3F4NA 4CCCA 3UG5A 3FSTA 3R89A 4NSBA 4GYFA 2F38A 1BLIA 3L67A 3W70A 3D47A 1JNDA 1XRTA 1PS9A 3PHAA 3GHUA 4I5UA 1SR9A 1B30A 3N2BA 4A8LA 2XFRA 3ABSA 4HT3A 5BU9A 1HX0A 3FHAA 4B90A 3RNDA 4FX7A 2CKSA 5DFAA 4NI3A 4WGXA 1Q2RA 3WL0A 3TW6A 4LRTA 4AWUA 2FZMA 2E28A 4GI6A 3KL5A 3TN5A 1VLWA 5CPNA 1PZ1A 3W72A 2QV5A 1H41A 2DSWA 4AC7C 1QHZA 3HMJG 3NL2A 3VOCA 3S83A 3JUGA 1VQTA 5AYZA 1PX3A 2YFOA 1J8VA 5DMNA 3IK2A 4N0RA 3TW7A 4B4HA 2OZ8A 4HBKA 3WDPP 1KBLA 2FZ8A 4C6PA 2QUVA 5HMSA 5DRIA 2ICSA 1ITXA 4ICCX 4LAOA 3P3BA 3QY7A 4GG9A 3R25A 4XKYA 1O68A 2IPJA 3UGVA 1ISVA 3VIOA 2IW0A 3PJWA 1EIXA 2VZUA 1DOSA 2VD8A 4NVTA 3PNZA 3GIQA 1UMYA 3B4UA 4LANA 3W00A 4B5XA 4K7YA 3LDVA 3N34A 4HNUA 4Q8MA 4LVBA 3VOIA 2BBFA 4ENLA 1HNYA 4JKKA 5A6AA 2UY5A 9XIMA 1VZWA 3E5BA 4DWDA 2UY4A 3DENA 3C0LA 3LLFA 2GLKA 3B9EA 3SFWA 4YTUA 4Z1AA 4WY0B 2REQA 3OB8A 5ABFA 4D1IA 2X0SA 1C9WA 1E5JA 1UCWA 3PTKA 3G6LA 4GYKA 2OEJA 4GH3A 2R1MA 3AMLA 3C2YA 1E56A 4UZSA 3OVPA 4TTGA 4B5SA 4MY8A 1DJGA 2OKOA 3DCPA 4KRZA 5JBEA 1ITQA 5CZJA 1UD5A 3KZPA 3W4RA 3CBWA 4EWND 5F1VA 5LKYA 1PB0A 1NY1A 1U2YA 4L4PA 3E9AA 1TV4A 3WH5A 3VA8A 3H2MA 1K8YA 4DF0A 4BK9A 3TYZA 2J24A 1NWUA 3RJXA 4D6JA 3NO5A 4GXMA 3BSGA 5A8MA 3WLQA 1QT1A 2E25A 1FWDC 1E4IA 4Q4PA 1PTAA 2E68A 1VJZA 3AU6A 4A8NA 2YR1A 3SI9A 3QLDA 3WX7A 4ATWA 3K30A 5EKYA 4PUKA 3WQOA 3MUAA 2JBMA 2ZUMA 2QJIA 1HVQA 1RQEA 3CL7A 4R88A 1Q7QA 3GDTA 2GQ3A 4DJDC 1PZ0A 3N6HA 3U5UA 2R14A 3PZIA 1XIHA 4RLIA 1Z32X 5E6YA 2WMFA 4MJ4A 4UUIA 2DZBA 1IXOA 5DEZA 1CPUA 2ABBA 3W7GA 3EX2A 3MJMA 1K6AA 1W1PA 1BWLA 4UTUA 2PE4A 4U5KA 4DUWA 1SO4A 1E0VA 4HSHA 3T08A 1JYNA 3I7SA 2VUNA 4GXPA 2X2YA 1BGAA 3BDKA 3QC3A 5FJIA 2GWNA 1T8XA 1YBQA 1R9XA 2GOUA 2JQXA 4CN1A 2V81A 4MAVA 1PVNA 5AZ1A 1XIMA 5AZ0A 3LPOA 1XIIA 4NAEB 4RZBA 3EMCA 4YVVA 4JTAA 4EPEC 2I5QA 2H8ZA 4GUIA 2QCFA 2D1ZA 1ONEA 3KVJA 5CZ0A 3MDWA 5EB8A 1TMQA 4MIMA 2L5HA 3M9YA 3OLGA 4CNOA 1GPFA 1JCXA 2NQ9A 2DIKA 4R85A 1ZAIA 4GQ0A 2A6LA 1TIWA 1FTXA 3N25A 2NX1A 4U10A 1HZYA 4G2DA 4E3TA 4DXVA 4W89A 2W63A 3BW3A 2WMGA 4ICMA 4MYXA 2O7SA 4DELA 4MB4A 4DY1A 4PRWA 4O1EA 1JPHA 2OQYA 3GC5A 3OG2A 4MOZA 1KM3A 1UC5A 1OWQA 2BFGA 3H55A 2JEPA 1FWAC 3LOTA 3WLHA 5TIMA 3T6CA 1M7PA 1JXKA 2V2DA 3LCIA 2V6AA 3GVVA 3UW6A 2VKZG 5K4ZA 1PKLA 4AVOA 1LF1A 1G6CA 4FALA 3FA5A 3OW1A 1XYFA 3ARWA 3S1WA 4O12A 1XD0A 1O94A 1TJRA 4AVFA 1SPQA 1PX8A 1QU4A 2CNCA 2FGBA 4LNYA 3DECA 4XBKA 2MUCA 4MZ8A 2GVYA 3NQMA 5M03A 3DOPA 2CHRA 5M2FX 1NELA 1XFBA 1E9IA 1NFBA 5A6TC 3GNPA 3QMTA 1PZ2A 2G5WA 2I56A 1LORA 1PE1A 3W0KA 4CD6A 3LMZA 2UV8G 3BMWA 4PBEA 3CQHA 3GDKA 1A5MC 1F3WA 5CJMA 3EWDA 1SJAA 3C6CA 1DVJA 1J6PA 4GX9A 4H9UA 5CLWA 5IOBA 3TTYA 4K3ZA 2G3JA 3SUSA 5EGRA 3R8GA 2J9XA 4TQTA 3DUGA 4JBRA 3P67A 4LYRA 4XK2A 1BF2A 3W28A 4UTWC 1KFCA 3KRSA 4UFKA 1S2WA 4FI4A 2C1IA 1YDOA 1AG1O 3UVAA 2HS6A 3M0HA 1UIPA 5F2IA 1EBHA 3FX4A 2XFWA 2GJNA 2VURA 1CIUA 2PF0A 4MVAA 2D2HA 1SW7A 4Q4KA 3GTIA 1XINA 2AMGA 2PRHA 5GNXA 2VC5A 2W67A 1S5TA 3NWRA 1ZJIA 3VE9A 2DUXA 1BYBA 2ISDA 3B8SA 3KRUA 2V9DA 1XYCA 2CBUA 1M3UA 4DWSC 4TXEA 3BGAA 1MMFA 2XWEA 3MI6A 1XH1A 4HU4A 8A3HA 2IPGA 1W5PA 3W73A 1P0EA 3KAOA 3OBAA 4B91A 4HYRA 4JD4A 1K9FA 2NT0A 3CIXA 3O07A 5LNRA 1SW0A 2PDNA 4ATLA 4JQAA 1F2JA 3SW6A 1PTDA 2CBIA 1UWAA 4AD1A 3IGHX 1V3JA 2X1RA 4QG9A 4CN6A 1LLZA 2NWRA 5DXYA 3AICA 4UNKA 3BWWA 1VRXA 1P7TB 1VC4A 2OOGA 2WVTA 3EDJA 3L12A 4R53A 5K7JA 4QROA 3BZGA 2V5CA 4B9ZA 5A5WA 4UR7A 1R6WA 2YL5A 2TPSA 1YE4A 1BG9A 4Q4OA 5EPDA 3AMCA 3LLDA 2V3FA 1DHPA 5BXTA 2QJJA 3MSDA 3VCCA 1UBPC 1XCWA 3IVTA 3VDAA 4BWLA 5BMWA 2OSWA 3TJIA 3SY8A 4DUVA 1IR1A 2CYGA 1BF6A 3EA3A 1NFPA 1RLCL 2XZ9A 3GVRA 2PB1A 2CLFA 4ZEPA 1JDFA 4K2SA 2XH0A 2WC7A 3VUSA 4P61A 1ITCA 2RJHA 3W3OA 4B2DD 1HJVA 1XG3A 3EWBX 3NURA 4K8EA 3ES7A 2QMJA 1QOXA 4IXXA 4H7ZA 1OVDA 1H5YA 1AQFA 5M1TA 5DXXA 3W29A 4DBDA 3JZUA 3B8IA 3EDDA 4MUPA 4NILA 3NSNA 4Z2GA 2OZ3A 1P6WA 3OODA 1REQB 1EP2A 3U7BA 2ZRUA 2XM2A 3QHMA 2WW5A 1XLBA 4CCEA 4POCA 4L6DA 4FX6M 3WNMA 2WC4A 2WZMA 3SIMA 4GUGA 2ZRYA 3FY1A 3TONA 4C5ZA 1SZGA 4UTMA 5A6BA 1YE6A 3LHVA 1UIOA 4GACA 3TYAA 4DZAA 1EGMA 5JQ9A 4RZ5A 3M07A 3GG7A 4G7FA 4AZ5A 3BGJA 3SECA 4GZ7A 1O95A 1F9CA 4D8AA 2PA6A 4JTTA 3BAWA 3IIOA 3RIKA 3TJLA 3ONCA 3QMSA 1LZOA 3SGZA 2E7FA 3VD4A 4QG6A 4MLRA 1KCLA 1G4PA 2GDQA 5U4NA 4GCAA 3N15A 2FZBA 6ALDA 2RHGA 3SRKA 3R79A 2RDTA 4UTTC 2A3EA 3T44A 3E1F1 4YYCA 2Y7EA 4AZBA 5MHBA 1W3KA 3KLKA 4QDWA 4FPSA 2GGGA 3W7RA 2V5JA 3Q58A 2OO0A 4JYEA 2GQ8A 2OPJA 3WD4A 1VLIA 1E43A 3LENA 2EKCA 3PP7A 4Q8VA 4WDWA 3SQLA 1PL9A 2WM0A 4AX7A 4JDBA 2V3EA 4PMDA 4KWSA 3MKKA 4NJHA 3R43A 3UYCA 2O9PA 4URIA 5I5RA 1ZUAX 3TR2A 3GIPA 4WEVX 4DUOA 4IPNB 3NDZA 3ITVA 3URNA 2Z1KA 4XZLX 1O7AA 5HNNA 2AQVA 1Q2SA 2YX0A 4MZ1A 5F4SA 4JNZA 3LY0A 2D2GA 4HOZA 1QI4A 3O16A 2CPUA 4I7VA 1Q8JA 4CU7A 1RV8A 2HK0A 1UUOA 4LVDA 3UJ2A 1ADDA 4HCDA 4KF1A 2Z28A 5G1YA 4NT0A 2Z1SA 1BSIA 1HO4A 3W1RA 4LUTB 5T26A 4I6KA 2VEFA 1BEUA 4FNRA 5G4EA 2BODX 1DQXA 4OIFA 2IKJA 1JPMA 3C2FA 5ABGA 3PBYA 2Q09A 1L8PA 4IIHA 1SM9A 3DFQA 1IQ8A 2OU4A 5FEZA 1VKFA 1EF3A 2J7GA 3E0WA 1IV8A 1LLWA 1RK5A 4QSHA 2WVVA 3CC1A 3DFHA 4BQ2A 1DWHM 3DGRA 2VC6A 1M41A 3ZLGA 2Y7GA 2ZUTA 1ONXA 1KRCC 2E09A 4MAZA 1WX0A 1JR1A 3EEZA 3WK2A 2VXNA 3WD0A 1WZKA 4HNOA 4DBWA 4YVXA 1G4SA 3A22A 1W91A 2UY3A 1F3EA 1KM5A 1PO9A 4UTLA 1HGWA 1IWBA 2DGAA 2GGEA 3TV8A 5GJPA 1CGXA 2Y4SA 1B3ZA 3RG6A 1ZY9A 3GZAA 4BI6A 4F9DA 3NG3A 4LC8A 4ZZ9A 4IMFA 4NZCA 3ZQ9A 4W4QA 5CXPA 2FH8A 5H8MA 1OINA 4ROPA 1W3NA 2P5NA 3W7OA 3VCNA 3BLOA 4LUSB 2Y61A 5CGMA 1OB0A 4H9ZA 3RO6A 5C9XA 3SQMA 3GNNA 1TUXA 3MSYA 4L6OA 4GNJA 1E9LA 3I6RA 3PPHA 1EHAA 1D3CA 1GOXA 4DM1A 2CZDA 2A7PA 2PTZA 1KCXA 1YDVA 3IJ7A 3EX1A 4LUYA 4NNBA 1UA7A 4JIRA 4Q7IA 3PZOA 5A8PA 3STPA 3V0UA 4KT2A 4S3GA 4AFYA 1JF5A 5HXMA 1ISZA 1PBGA 4NXKA 4PB3A 1Q6FA 3VXGA 4Q7BA 3ARSA 2ZWZA 3BOLA 4H3DA 4FZIA 4PUEA 1JCNA 3A4JA 2PC8A 3QJAA 2ZZ3A 5LIKX 4X2PA 3UWQA 1E51A 1VENA 1H1YA 1I2RA 2CC0A 3LS9A 2IMRA 1TX0A 3GDMA 4JQ3A 3P62A 1P0DA 5A6JA 4PMYA 5K2ZA 3UZJA 4AY7A 5EMYA 1VCVA 1JCMP 4LAMA 1QW9A 2GJLA 3VMOA 4LYQA 4BQ4A 4HVXA 4W8BA 1GZ1A 5F2MA 1QO5A 3PZUA 4MFDA 3TYDA 5DBUA 1OIFA 3QGAC 3SY5A 2D3NA 3BUVA 2VFHA 1KA9F 4J40A 3SCOA 2E8YA 2PCQA 3REQA 3G0XA 1DTNA 5HANA 1LOSA 5KINA 3MP5A 3LNMA 1KQYA 1WO2A 5IM51 3CJPA 4JFUA 4MM1A 2YW3A 3OZOA 3ZJ7A 3M0IA 4QRNA 3MHUA 1BYDA 1FWCC 1XYLA 5GNZA 1WA3A 1K77A 4UTHA 3H54A 2NUYA 5ECVA 3F4WA 1L2QA 1J18A 4CEUC 4D6CA 4TUFA 2FVLA 3BL3A 1T5AA 5DCDA 3E2SA 2VZOA 4NXSA 5FCZA 1ECQA 5E1QA 4YNGA 2WM1A 2CBVA 3MMWA 1THFD 5A3HA 3VGEA 1VJIA 1OABA 1JVNA 1QI3A 3B9DA 2HVNA 1DKWA 4S1FA 4QEHA 1HVXA 3W2LA 3L2IA 5LSMA 2OLHA 2BMBA 3AFBA 3MDUA 3EWXA 2WZEA 1FHVA 1ZP4A 2Q8ZA 3VNKA 1TPEA 3F03K 5E0FA 1R0MA 1RJQA 2ZZ5A 4FF5A 1TJ2A 3C56A 1P6CA 2G3NA 1LL7A 1M1BA 2VR5A 4JY8A 3EWWA 1NWTA 1LLOA 3PNUA 1FBAA 4EAMA 4E4FA 2NQLA 4JFVA 4N4PA 4Q4MA 1S3TC 1O5QA 3C86A 5SWUA 3CV7A 3S2NA 3S5YA 5D02A 3L4UA 2WNQA 1ODUA 1IXQA 3KP0A 1XPGA 4FNUA 4M3PA 1HIZA 4GZEA 3S47A 3T2QA 3GHRA 6XIMA 3SY1A 1MEHA 4S3KA 1O1HA 5HOSA 2FJKA 3E38A 3SURA 3QY8A 4GFSA 2QCGA 3BLPX 1XLIA 3NXLA 2QT3A 3QMRA 3UJRA 3TCSA 1JZ6A 1GWJA 3IGSA 4XZMX 4GBUA 4JL2A 4O8AA 4UNLA 1W2PA 4Z2IA 1OZMA 1T96A 1V02A 2WNNA 3OU8A 3DYMA 4W7VA 3FYOA 2O0TA 4D6HA 4PCNA 4JIIX 4IUGA 4US6A 1A5SA 4LB4A 1NOFA 5RUBA 3WUGA 2C6QA 1XBYA 4HZ6A 4PMOA 4CVWA 4F48A 3W2KA 1WDDA 4Q8WA 3QV7A 1M5WA 1WP6A 3UR2A 3UVIA 3PJUA 4ZTXA 5EBUA 3HJEA 3LGEA 4FP1A 4DO5A 4UMBA 4W8AA 3N2XA 3WSUA 4HNVA 4NNCA 3I3DA 4P7OA 4BA0A 2XIBA 4ZE5A 4EANA 1ZJAA 1HN1A 3TTSA 2IQDA 4HB7A 3EX3A 1XXXA 2AKZA 4L5ZA 4AD4A 2X40A 5EL1A 5EU9A 2X1IA 3LPPA 4QFUA 2J7EA 2VCAA 1KR1A 2J75A 3CH9A 1LRQA 4ADUA 1QHOA 1R2TA 2PLJA 4RXGA 2R91A 2E1WA 1RCOB 3WH6A 1E4MM 1JYXA 3WL1A 1AW5A 3OIHA 3W84A 1EO7A 1CB2A 4HHPA 1XISA 3KXQA 4K39A 3ITOA 3A47A 5JVLA 3BAIA 2DT2A 1ZPTA 5D8ZA 2QQ6A 3AJ7A 1AFSA 3AIVA 3RXZA 4F0SA 4IG2B 4K36A 1RP8A 2ZYFA 3B9NA 4LOCA 1SZRA 3SCQA 4AC1X 5E0CA 3LBOA 4LF1A 1AK5A 4B92A 3A3HA 1WQ5A 3GX9A 4F2TA 2B7NA 4PR4A 2HK1A 2WCAA 1TWIA 3RK8A 3AU2A 1QBAA 1XSJA 5AC8A 3LB0A 3WUBA 2GUUA 5C5YA 4IGNA 4D72A 1E6PA 1TTPA 5D2VA 1EJTC 4ZQRA 3GVQA 4GGHA 4HPNA 4DJEA 5M3WA 3N4FA 1VFMA 1EDTA 1JYWA 3W1TA 3W7LA 1YTEA 1QNOA 2I5IA 1K7FA 1QI2A 4TX6A 2Q3RA 4HJWA 3IJQA 3ID7A 1L6YA 2BS9A 1RLDA 4CD5A 1E1CA 1S2TA 3UEQA 3E0IA 4DN1A 4P7NA 2FMNA 4LX4A 3Q65A 4PL2A 4KBXA 3K13A 3QR0A 3KOWA 2Y88A 3FAXA 2Z7KA 5CSYA 4P7LA 1TJ0A 4H8UA 1OX4A 3VNZA 1ZBKA 5HUPA 4J4KA 1HL9A 3WY1A 1G4EA 5HQEA 3GU2A 4QM1A 4C1NA 3LCFA 1VFSA 3NAVA 4US5A 1K8CA 3BE7A 4ZODA 4LV4A 4E2VA 4HMEA 2EPMX 5D4YA 4DJFC 4PRTA 2VRQA 2J27A 3EA1A 3HQOA 2G96A 3CIWA 3WLOA 1ZALA 3GO2A 4K68A 1ME7A 2NX9A 2Z2BA 2YOCA 3QR3A 3APYA 3TROA 2E6FA 1TWZA 1PYMA 4GY7A 3IIZA 1ZAJA 1FKXA 4QJ3B 2AL2A 3GVGA 4JTQA 1T8QA 3IAQA 1KXHA 4M5PA 4H00A 1DQWA 3KBMA 1ML1A 1PXGA 2OVLA 4DQWA 2VEPA 4B9YA 3HOJA 3EPMA 3VOHA 1VH7A 3E96A 2REQB 5ABFB 2INFA 2YDAA 1TPVA 1SFJA 1GVRA 3IUDA 3WK1A 1E0UA 3R1ZA 4YN5A 4G8TA 4F79A 1CYGA 3VX1A 2ZZ2A 4YYFA 5G2WA 2R1NA 1A5KC 4KFPA 2OWXA 1TTJA 2J78A 1CXHA 2INEA 4IMEA 5F7UA 5L6UA 3ARVA 2TRSA 4K8HA 3VD7A 1H50A 1JQXA 3CQ0A 3CV6A 2DW6A 4LC6A 3CO4A 5IHRA 4O0ZA 4WDUA 4KESA 1B3WA 3TP4A 1SFSA 3B9OA 3LMYA 3LRKA 1I2PA 1FP9A 1NOWA 5A94A 1O60A 4A3HA 2WV8A 4XVEA 2R9RA 3ZO9A 2R1LA 1AVAA 2Y6ZA 4B3KA 4AW7A 1X1OA 1UW9A 3AMKA 3T0TA 3L66A 3OPSA 3OQEA 1X6LA 3S1VA 1LBLA 3P0XA 3GFZA 4X3ZA 1AQ0A 1QHPA 4JYFA 3DAQA 4W8LA 4OUIA 4HQVA 1K9DA 1K7XA 1YDYA 1FWNA 4HHMA 1FXQA 4AEOA 5HDRA 2GWGA 4A8IA 1XUZA 1QRQA 3FS2A 4IJRA 3UA4A 4LNCA 1V51A 3FGCA 1LRNA 4NJKA 1W3JA 3M0YA 4ZENA 5CPSA 3I65A 1C92A 5BNKA 2XU2A 1ONRA 4OVXA 2WPGA 3RU6A 3TR9A 1EKOA 4NZ1A 5IDIA 4JQ4A 4Q8PA 4UQBA 4E2DA 2OYKA 2E1DA 3TYEA 4GABA 4G56A 5ECUA 1KM1A 5I24A 1E6QM 1TVNA 3M0MA 3N12A 5FEPA 1OFDA 2A1YA 4ZE4A 2FB2A 2WWDA 3SCWA 2CWXA 3EDKA 4KIEA 3V5OA 5I09A 1YBQB 1Q6LA 2V0TA 3WQCA 1TB3A 1OM0A 1H0IA 3LERA 3MBFA 3OBKA 3R11A 4PMJA 3OVQA 1XGZA 3WDHA 3GFYA 2GJXB 3VYLA 1A5CA 2G37A 3BURA 4LQ1A 4KEUA 2A7NA 4ZB0A 4AHOA 5C9UA 1NP0A 1O4UA 3NZRA 1F6KA 3T78A 1WUFA 2J7DA 3KBSA 1IEXA 4LPCA 3FEQA 2CWNA 3IJLA 3NQ8A 2C19A 4QSFA 1IXPA 3QM3A 1W9BM 4D9PA 2PRLA 3O6AA 1UPMB 3GXFA 2HBVA 3Q94A 4I8DA 3RCNA 1GONA 4JEQA 3RPMA 4WDTA 3RX3A 3TLQA 1HKJA 4DJDA 3AUOA 2G97A 1TWSA 4CNNA 2PF8A 4NP7A 3SZ8A 3NPWA 5F2LA 1AH3A 4ICNA 3UFYA 1OSEA 4RR4A 4E4UA 3CT2A 3M0VA 1GKQA 1DJQA 3AI0A 2QCDA 3KCJA 3TK7A 1YXDA 2NLYA 4PFHA 1FWWA 3CHVA 1XQLA 3QV6A 4Q32A 1VRDA 2ZXQA 5AN7A 1EOMA 2NWSA 4LEFA 1H7NA 5AHLA 4Y8FA 2JALA 1PAMA 2PGWA 1WB0A 1E1EA 2C3ZA 3VI2A 2J62A 4H41A 3F2CA 1WYIA 1W54A 4I9AA 3NA8A 1CCWB 3WQFA 3HFTA 3MKCA 4N02A 2INZA 4L4MA 2HV5A 3S46A 4Q3MA 3ITXA 1XGDA 5EMUA 1N55A 1L0PA 3EKGA 2D24A 5AB3A 2HNEA 4IGHA 4KCVA 3IGXA 4N4QA 3WLPA 3R2GA 2A3AA 1EDQA 3W1LA 4PMUA 2AL1A 3V3WA 1OYCA 1PUDA 2XSAA 1M68A 2VRJA 4JCMA 1YYAA 2Z1XA 1YW1A 3BAXA 1BD0A 4GZJA 4FXSA 3B9AA 2FZNA 3S5ZA 3T40A 4NX5A 3SSJA 4C7GA 1GOQA 4FNSA 4H01A 3U9IA 1RUSA 4ZOAA 1Q65A 1ITUA 1E3ZA 4ONVA 4GX8A 4W84A 1SGJA 1XYMA 4NRSA 3UWVA 1R3TA 2OZ0A 2WYSA 2ZX7A 4C7FA 1SFLA 4MF4A 5FL1A 4XAFA 1RR2A 1TE6A 1M6JA 1V0KA 2MNRA 3QV8A 2D73A 3TE9A 2G41A 5I3GA 3PWAA 1P0BA 2PP1A 4IIEA 3N04A 2P3ZA 2CERA 4LAUA 1IIGA 1W9XA 4JIQA 5FF7A 4X0VA 1JZ8A 3CPUA 2EPHA 4O17A 3QPZA 3XIMA 4JTCA 4BY3A 2B0MA 2PD5A 3GG1A 3BAKA 4O1CA 2Z1VA 2PDFA 5LNVA 4HSOA 1SMDA 2QNEA 1KTNA 5C9ZA 1PCKA 2DVXA 4MHBA 3HG3A 1XIDA 3L23A 4O18A 1W0MA 1Z8AA 3W75A 2V5LA 4P8WA 5A95A 1EYWA 4RV8A 1R7AA 4BHYA 1Q6QA 7TAAA 2DH3A 2WB5A 4UTWA 4C6NA 5D37A 4PGLA 1J0YA 2OMAA 3DDMA 4ML4A 4JKLA 5DCEA 4W87A 2ZVRA 3WQ5A 4DUXA 1SO5A 2ZADA 3CZKA 2UZ9A 3N3TA 3DC8A 1JYVA 4XAZA 1VAHA 3AXHA 3UR5A 2Z0IA 3C8NA 2J4GA 3A9IA 2OEMA 1J2BA 2B81A 4A3QA 3WCZA 1DEDA 2ATSA 3AMDA 3MUZ1 1XHGA 2ACRA 1RBOB 3TNBA 2FGLA 3C4UA 1DHKA 4H04A 3VABA 3CZGA 2QJHA 2PMQA 5CC6A 1TV3A 4DWSA 3GNOA 4HD5A 2J74A 2OX1A 2XGBA 3POHA 3ITGA 3WMSA 2BXYA 1MXSA 2OG9A 3TLLA 2E4TA 3THAA 1FH7A 2J88A 2F84A 1EJSC 1P5BA 2C15A 4ML9A 2OT0A 2WZIA 4B15A 2VZVA 1EF2A 3DERA 1A0CA 3WDRA 4JS3A 4Q7NA 3ATZA 1Q4NX 3BTNA 3IEBA 1UR9A 4QLJA 3OVRA 3QKEA 4A8RA 3ZR5A 4UOJA 3FA3A 1VBHA 3W74A 4ZFCA 1GVEA 5C2GA 1LOLA 4RX0A 4PYSA 5JH1A 2UWFA 3SUTA 3ALGA 3K1DA 3W7IA 3VD3A 7ODCA 1G94A 4K1WA 1TPUA 2QCCA 2VX4A 3NEHA 2PP3A 1H63A 3G1RA 3RDKA 5BRBA 1H7XA 2GSEA 1AMYA 1U33A 4A2SA 3QW4B 1R3RA 3ME3A 3PR2A 4NY2A 1PIFA 1KFKA 4L9ZA 2PLMA 2E67A 3CNYA 1FFRA 1QPQA 4JEJA 2Z26A 3H24A 2VZSA 4M6UA 2QUTA 3GC4A 4R33A 3NDOA 1QO2A 3DBPA 4JN8A 4ZR8A 1X8FA 3RLUA 4AF0A 3GTFA 4DJED 1XLLA 4LYPA 2BLEA 2R6OA 1GVFA 2VGIA 4XV0A 4UWMA 6TAAA 3NJ3A 1LUCA 1POKA 3GZ3A 3W25A 2Y85A 2XIMA 1NIUA 3IACA 2XSXA 1X38A 3AIEA 4HIBA 4NAFA 4HZ8A 2YCIX 3EYPA 2WCGA 2XFFA 3GKAA 2QGYA 2G4JA 4GYJA 3IIXA 2GQAA 4GO9A 1VB9A 3CK5A 4V2XA 4QNWA 4W5UA 2PURA 5D2XA 3AOFA 1HP5A 4C90A 3W1QA 1CW2A 3LTSA 4US5D 3WUEA 1JZ4A 4G6CA 2A21A 1E6ZA 3KOFA 5C71A 2XN0A 2W4XA 4PMZA 3MBDA 3U3HA 3GK0A 3VINA 3PFRA 1YMYA 3PWGA 3BCJA 1DJHA 3L65A 2TYSA 4M1RA 3QV9A 4WR3A 1VHCA 4P8UA 4BFAA 2GGHA 4FB7A 3NZQA 3MZNA 3GR4A 5DF0A 1YDNA 3FJNA 1K8ZA 3UWWA 1V79A 1PJ9A 1K4HA 3TXVA 1FDYA 1HJWA 1LDCA 4UTTA 7ENLA 3NCOA 3HPSA 2WVVB 3V1HA 1LQAA 3MA8A 5HAOA 4TVCA 9XIAA 2O7QA 4AB4A 4ZQMA 3ZJ8A 1SMAA 1PHWA 2WAGA 3V36A 1TZ7A 2EHHA 4FO4A 1AJZA 4BWLC 1KGWA 3DFSA 2DY3A 4Q4QA 1FHUA 4HZ7A 1KFWA 4GK8A 2PDWA 3K8MA 2B7QA 2PRMA 1CGWA 4ADSA 4HSNA 4YLWA 1ADOA 2YXXA 5DMMA 2PDYA 3WDIA 1BKHA 1PDZA 1U5JA 4OECA 3MSRA 1FH8A 1GVQA 2X16A 4MYAA 3UPMA 3ZSSA 3TOYA 1CBGA 4Y2WA 4PB5A 4AWSA 1RY0A 3FVDA 1C7SA 1OGGA 3VZZA 5B7YA 3VOJA 3MUCA 3QOKA 3WQGA 1R9ZA 1AJ0A 3G18A 2X8RA 5HA7A 4GVHA 3PPFA 3BO9A 1KBIA 2E5CA 4REQA 4V15A 3T4WA 2DPEA 1KLYA 1M7OA 5T9CE 1OQFA 1AH0A 5KZDA 3STCA 3FEMA 1BVWA 3P74A 3QFWA 2YDRA 5CSSA 4EXAA 5H91A 2NT1A 2VNCA 1H7WA 1EHNA 3UJFA 1P7TA 2QMKA 3KWXA 3E0LA 3LHYA 3B0VC 2NQHA 4BCEA 3QHNA 1G4TA 4DAIA 3ZVHA 1UR3M 2WK2A 4HK6A 3DHUA 1M03A 5FJTA 2ZIDA 1K7EA 4NX0A 4QX4A 3YPIA 5LIXX 4MGGA 3CASA 2BVWA 2YDSA 3PG9A 1WKEA 3QQ0A 2QYGA 2ISWA 4KERA 3I7QA 1W1ZA 1W3TA 4IFRA 1F7BA 3B8WA 1E15A 1WAUA 4J3UA 2HS8A 1E4LA 1UR0A 3FJLA 2DUAA 2H3BA 2AOSA 3ITLA 3GRIA 3KOXA 4LS0A 3NZ1A 3M0LA 4CCDA 1SR0A 1XIFA 3CT7A 3UR8A 3H7RA 5TNVA 3W81A 1LQ2A 3T1GA 3T9PA 4O11A 4MDPA 1HL2A 3MW7A 1UR8A 4KIRA 4C65A 2V38A 4WKFA 1SUXA 3GUWA 3PVFA 4GJJA 3REQB 3SSZA 4TV6A 3S2CA 2WMIB 5J04A 4C6KA 3R12A 4R34A 1UA3A 3KBVA 4U3CA 1REQA 2E8ZA 2OQLA 3QW3A 2Y8VA 5CJNA 4C6OA 4IL2A 1F6PA 5D2TA 3W07A 1GVOA 1JCLA 1W5OA 3OYZA 2CLOA 3GNRA 4AG0A 4RPQA 3GKFA 4G5DA 1KTCA 1VFHA 4DJDD 4WD0A 1CI1A 1GVYA 1S5NA 3BJSA 2PSNA 2NLIA 1E71M 3VAVA 1H7RA 4LBSA 2Y5EA 4HU0A 3CYJA 3TSMA 4UFJA 3P84A 3CAWA 5LXXA 4QXIA 3OG3A 5EBAA 1T0OA 4DLFA 5HR7A 4GXWA 4YHGA 1EOKA 4HPHA 3MANA 2VDGA 3BAYA 3CXOA 3IGUA 3NQAA 1ZBWA 1IWPA 3VD5A 3ZS4A 1Q85A 2BHZA 5KETA 3TCEA 1JZ5A 3C5QA 1GQKA 3BVJA 3R0KA 4U4MA 2QDGA 3EOUA 2DUZA 4JTHA 4JHZA 3H2FA 4JTSA 4WK9A 3WZ0E 2GSJA 1FWRA 4LT9A 1NSJA 3EBVA 4MKVA 2HSAA 4IFKA 2DP3A 4XAPA 5BRPA 4J3XA 3EMQA 4OV9A 1I75A 3W87A 1TREA 1FY6A 3L4WA 1H2JA 2HVMA 3RFAA 4GIYA 1NU5A 2YCKX 3EGJA 3H22A 3FHQA 2ZFAA 1ZGDA 1OZQA 1H5VA 3BARA 4C5YA 1YIXA 4OT7A 4P7RA 1UHVA 1TTQA 4J27A 2YL8A 4HNCA 4K8GA 3MY9A 3TKFA 2BX7A 4KCTA 1RAKA 3JU2A 4CCZA 3PB0A 3NO3A 2IKHA 3S3GA 5G4WA 1RVGA 1S1RA 1C7TA 4H9MA 1DIOA 3A13A 3E3HA 1TV5A 1E4NA 3O7UA 1EQCA 3QYSA 3NFUA 2BWGA 5ENLA 3GY1A 5BWFA 4UNIA 2P0IA 5G1TA 1MUWA 3VMNA 1S46A 1OY0A 1SFTA 2BHYA 1FHLA 1FX6A 1J12A 3S42A 3O15A 1QNSA 3MP3A 1M9HA 3VCRA 5D2YA 1RA0A 2QVNA 3RM4A 8XIAA 3O1NA 3SDOA 3MUIA 3WENA 1RCXB 2D0HA 3IVUA 3WBXA 4M51A 3HPXA 3URAA 3IARA 6ENLA 3QTPA 1A5NC 2PDPA 3PUDA 3S4TA 3GW3A 4W86A 2ZRZA 1I6NA 3OTRA 4X0NA 5H1WA 4AIOA 5D04C 3I4KA 1IYXA 2CLPA 5HJLA 2I16A 3L4YA 1PIGA 2XIQA 2EKGA 3QY6A 3VUPA 4GVGA 4QIUA 2GDUA 4XZBA 1MSSA 1KRAC 3N9SA 1YRRA 2FKPA 1HP4A 4JQ2A 1GT8A 1KFLA 5CG0A 3AIBA 2Y1HA 1XCXA 1CB7B 1VP5A 4LS1A 2GUYA 2VHLA 4WVXA 3N9KA 2WOQA 1JDCA 3W83A 4DPQA 1J2WA 3UJSA 1AZ2A 1XRSA 2PD9A 2HRWA 3HGSA 4XQ6A 4XG1A 2Z25A 1OD0A 3AHYA 4GUJA 3MC5A 3SCPA 1OCJA 3C2VA 5G5IA 3WNPA 2V5BA 3MI3A 2GVLA 1OCQA 3Q2DA 2HE5A 4EPDC 1XQKA 3KVLA 4KH2A 4FR6A 2C79A 2J9YA 5F4XA 4NYUA 3WQ6A 3T0AA 2FFIA 4IUOA 2QCHA 2X0YA 4D1JA 3GTHA 2ZUNA 1Z89A 4Z08A 1EWEA 3HFYA 4KCUA 4HTBA 4R9XA 1E1CB 3VOFA 1CGTA 5IHSA 1Z9AA 1LBMA 4M7TA 5EMMA 4QCEA 1JCTA 2O4MA 1DP0A 4C6JA 1OX4B 1OX6A 1XC6A 4TR9A 2HEJA 3GR7A 1XS2A 3W2JA 4S3JA 3TWAA 2PWUA 4C1NB 4PL1A 1XH2A 1FRBA 2HVOA 2PZ0A 2EPOA 1QTWA 2IKGA 2ZZ6A 1B4EA 3TUUA 4XWUA 3W02A 4AVNA 2VFDA 4NF7A 4UC5A 2YXOA 2JIEA 4U5IA 1MQQA 2EAWA 3EOOA 4GY0A 2QVHA 3CO8A 1LQ0A 4ZBCA 4D6GA 4XUYA 1XDJA 1UD3A 2YL6A 3COTA 3B3DA 4NZ4A 2AL2B 1JUEA 2QS8A 3W7KA 1ICQA 2DZTA 4HN4A 4V1XA 3TN3A 1EWDA 2ZUWA 4CD7A 3LYEA 3AYTA 3VIPA 1R30A 1TG7A 1V02E 4XTDA 4S3FA 2D22A 2CZ5A 3TDFA 5AY7A 1VHNA 2B7PA 3HGOA 1R3SA 4LY8A 4AEFA 3BGGA 4KWWA 3WJYA 4AZIA 4O8RA 1AMKA 5B80A 1EA0A 3G0UA 3VZXA 3WEMA 1HW6A 3U2OA 1JF6A 5EA9A 4FLSA 4RE0A 1C29A 4HZMA 4PBFA 3R10A 5I6SA 5HQLA 2WJZA 4WY0F 3CQIA 2NSXA 1CXLA 4Z2HA 1OT1A 3NQGA 1SZEA 1R87A 1P0KA 3RRXA 1Z41A 1BYAA 5AVNA 4O57A 4JTGA 2ZUVA 2OZTA 4LS2A 4WX2A 1V6YA 1E0XA 1NDVA 3DGBA 4DJFA 2A2IA 2ZDSA 3KBWA 4O14A 5I3KA 1V3KA 1W1IE 1BVZA 3VIIA 4QHRA 3BQ5A 5AC6A 4UQDA 4C6DA 1G7UA 3H2OA 1Q45A 1UWSA 1GOOA 4HMDA 3FGCB 1BXCA 2E6AA 1TCMA 4PUWA 3L0NA 5GVJA 1UZDA 3BK0A 4JN7A 1PKYA 3M41A 4CN4A 1RPXA 4KS0A 1YEYA 5AHNA 3SIZA 4FOJA 2JF6A 1V6VA 3L0GA 1RVKA 1PWLA 3UZZA 3GG0A 3N11A 3B8TA 1KM6A 2AQOA 5HQMA 5LHFA 3W1MA 3BLLA 3OGRA 2CFFA 1K6WA 2V2CA 2O55A 1TX2A 2PC4A 2JKPA 4RW5A 3DKLA 3CU2A 4GQGA 2W3ZA 2XH4A 3L5AA 3RX2A 1NVMA 1WZMA 3QKZA 4PEKA 3WD1A 1WDQA 1EC7A 1S3HA 3PBGA 5HINA 3EDEA 1S2UA 5CBJA 4F0HA 3N18A 4W93A 3DFYA 3DI1A 4YPJA 3CUFA 2VI0A 4PTDA 4TVUA 3BG9A 3CAKA 3DG6A 1HKVA 3ZVIA 2AMXA 4KFOA 5E6ZA 2YCJA 4WOZA 3GS6A 4IQDA 4NZ3A 2EG7A 1OFBA 1PHQA 2HWGA 3NYDA 3LTPA 3T81A 3EWYA 1FFQA 1VFTA 1XLHA 3UBPC 3IJ8A 3NZGA 2VEMA 2X7WA 2XZ7A 3ZXWA 1J9YA 1VIZA 3M7WA 4OGZA 2O4QA 1U30A 2EPLX 3IRSA 4JHOA 4ZQOA 1LTDA 1L9WA 4UFHA 3WF3A 3SQSA 3F5JA 2R8WA 3ABRA 5AOUA 3OZPA 5E9AA 4MB5A 1DJXA 4IICA 3VIKA 4CKQA 4AWTA 4Z1CA 1V3HA 1Q6GA 1AD1A 3BW2A 3MHFA 1SSDA 2QCDB 4IG2A 2H8XA 1YKWA 1I2OA 2WLZA 2YA1A 4M6PA 1UP0A 2CEQA 3PJTA 3OIXA 4MJMA 3SFKA 1IHIA 3B8VA 3LGGA 4PMVA 3KBNA 3PZMA 1YPXA 5AHEA 4BZYA 2WSQA 4XBSA 2QPUA 3TMQA 2QHAA 2RDUA 4ATDA 1XD1A 2F6KA 1BVNP 5CZKA 3AZTA 4AZ6A 1ME9A 3C0SA 4WGHA 1SJBA 1JIBA 2ESCA 2Z27A 2O9TA 3HF3A 1KRBC 5FACA 3BLIA 5HJXA 3WLKX 2XISA 3XINA 4LB3A 3TVAA 4S2CA 1O12A 3KE0A 1XUUA 1JZ2A 3ABXA 4LALA 2G3FA 3CIVA 3LCGA 4AZ7A 2E6YA 2VL4A 4M82A 1KBBA 3I6TA 4PH6A 4H8NA 4AY1A 1O5KA 4PMQA 3WLNA 3CMFA 2OR2A 1VJSA 4AXKA 3LXCA 3ZOAA 4M7SA 4F0RA 4ACYA 1A0DA 2IKIA 1EH9A 3BICA 4MB3A 2C91A 4QBXA 3RITA 1W9PA 1HKKA 1YNYA 3R13A 4XAGA 2LLEA 3RPDA 1Q4WA 1NTHA 4GRSA 3PBUA 1W3HA 3E5PA 3TN6A 1FCBA 3NL6A 1X7IA 3O9NA 4QJ1A 2VD9A 3II1A 1Q6CA 1MO0A 3WD3A 5LGXA 3LI1A 1Z7AA 2W27A 4JIEA 2ZTJA 2OODA 3WFLA 3C3NA 3STEA 3JVAA 1JFXA 3BCDA 3UU0A 1JDEA 5PTDA 3NPVA 1Q7ZA 2QGHA 3MQTA 3SN0A 3VGFA 4MUZA 4GC4A 3ARQA 4LBUA 2NX3A 2ZCGA 3W1UA 4AMAA 3HGRA 3VPLA 1WZLA 3UERA 4OFCA 3E6EA 3JR2A 1G9HA 2YGYA 1UJPA 1WOAA 1XLCA 3NSMA 4JNMA 3SRHA 1I45A 3NM1A 3M47A 1FCVA 3FW6A 4HA4A 1ISWA 1UH3A 4RNJA 5D30A 3TXZA 5HNRA 3W38A 3PFMA 1YNPA 5CQ1A 2WQDA 4YU1A 1FDJA 1J0KA 5BRQA 4M6VA 1CEOA 4RPPA 2AAMA 4O1DA 4PTVA 3AZRA 4EKJA 2PDQA 4OHQA 1VGAA 4GE8A 2HDJA 1XCFA 1TMHA 1UB3A 3KTSA 4FLOA 1IT0A 2CLHA 2C71A 3ARZA 3OLIA 4HU8A 4MNJA 2E6DA 4IT1A 4RDWA 1V7YA 5C2XA 3APTA 1XPYA 2EPNA 3UYIA 3RM8A 5AKQA 2BOFX 1XBXA 3F2DA 3VNLA 1TQJA 1QDSA 3SGGA 2VYOA 1VEMA 1JAEA 2IXVA 3BSHA 1JD9A 3GTNA 4GHRA 3VZYA 1AD4A 3BG5A 4CVUA 5EMLA 5FJOA 3ABZA 4GQBA 4PUNA 1MFVA 3GW0A 2ISFA 4DWSB 3AMGA 3V5FA 2F7FA 4J3SA 1H11A 1ZHAA 1VBUA 5HNTA 3WJZA 3KTCA 3P93A 4Y6GA 4AZCA 3C8FA 1P0NA 2EJAA 7A3HA 3QC0A 1H1ZA 3VIHA 3W9ZA 4E5TA 3GB6A 3KX6A 3ZM8A 1XLFA 1VPXA 3UJEA 3S5SA 2VRKA 4XAYA 4AISA 4NZFA 5FJUA 3P5ZA 2G3MA 3E0FA 2XGIA 2GJXA 1LYXA 3KM8A 5AC4A 1LP6A 3ENLA 2BVYA 3HPFA 1A5LC 3C2OA 3N17A 1SQ7A 3LHWA 3URBA 3O2LA 4E8DA 3LLXA 4ZB5A 1CNVA 1RD5A 2AGKA 4LFYA 4D6FA 4K6AA 1W2VA 2OOFA 3FJ6A 1QFEA 4A3YA 2WNZA 3EOEA 3BJTA 2FTPA 1DWJM 2E3ZA 3OOQA 4CU8A 2DSZA 3LV6A 3IWPA 4FA3A 3T09A 3STGA 3GBEA 4OOZA 3CAQA 4KMQA 5IRPA 1KB3A 3C0QA 5FJJA 2CZVA 5M17A 3CUGA 3TSDA 3ZR4A 1SO3A 2VOMA 1J5SA 1F5ZA 3DYPA 4AF0B 2Z29A 2XHYA 4Y90A 1OFOA 4UQEA 1EB3A 1TV2A 4D6IA 3ITYA 5A2AA 1X97A 3KS6A 1IE7C 3OGSA 4HCHA 3M4HA 1LUCB 4UOZA 4J28A 3MKVA 2QJNA 3GBDA 3V35A 5ABEA 2G4FA 3CZLA 3PZGA 1D2KA 4S3CA 4NAFB 1NF0A 2VM8A 2QZRA 3GQYA 1A3WA 2X2GA 3M1ZA 2C0AA 4O1FA 3SRDA 2YZRA 3W01A 3BLEA 1XIJA 4KRTA 3WUFA 4UQ9A 2CLLA 3BAJA 3VGBA 2WKLA 4MNLA 1R2SA 1RJRA 1J93A 5FSDC 2XPKA 3ZR6A 2DT0A 3T2OA 4QGCA 4QISA 1K3UA 5HJYA 3CHDA 1WV2A 2PODA 3BZJA 1VPYA 2ZXAA 4JHMA 2I57A 4MTVA 1G5AA 4RZ4A 2ON3A 3EXSA 1TR9A 1ZLPA 3LSCA 1W1A1 1SSGA 4QS6A 3ZZ1A 2FYMA 3OVGA 2QCEA 3G1DA 2V3DA 3USZA 3KZSA 2VCBA 2ZRVA 2BTMA 4CQCA 4WSHA 4EE9A 4IMCA 1H3GA 2QPSA 3MUY1 3OA3A 3TYCA 2XTKA 4M29A 4PC8A 1WBHA 3EDFA 1K70A 4JDYA 4YXGA 2I14A 3EKZA 3HQ1A 1W1B1 5EY5A 6PTDA 1W3IA 2QIWA 3UPBA 3E0VA 1E6XM 5CGTA 1FP8A 4JTRA 2PBGA 1R86A 3W88A 1V6UA 3GDRA 3W23A 5CKSA 2VEIA 3W86A 4HPGA 3HG4A 2NXHA 2OYLA 1CXFA 3UCCA 2WBGA 4AEEA 5DY3A 4MZYA 4GYPC 1ZFJA 1Z69A 3C61A 4H9VA 4WHBA 3LG3A 3AS3A 2XIIA 4J5NA 4HHLA 4PUUA 1J0HA 1R8LA 4FAMA 5EMKA 5C9WA 4RNFA 1TO3A 3W7NA 4CD8A 1UWQA 4J35A 4DJFD 2QXWA 4XO6A 2QCLA 1KBKA 2HNHA 4JOMA 3A5FA 2Y0FA 1W31A 3GAYA 4W9TA 1KTBA 1OADA 4K7VA 4REQB 2H3DA 2PDBA 4G1KA 4ERIA 4E4PA 3UETA 2CIPA 4PTNA 3DFTA 1QAPA 3QBUA 4P8XA 3PSWA 3I6EA 1FA2A 3W22A 4HNNA 3O63A 5BW6A 2GVGA 4W85A 4ORMA 1IEWA 3ZVHB 1TWWA 5XIAA 4DO4A 2EO7A 3ZIZA 2XIOA 4B5TA 4E8GA 1Y5VA 4H83A 3HV8A 4PFMA 2ZC1A 4X60A 2FPYA 3UY7A 3NL3A 1LL4A 2J13A 1EJVC 2WZHA 1UKTA 3G5EA 5FI8A 1KFEA 2YDQA 3EEGA 4LU0A 4YS1A 1JI1A 4DBUA 1B54A 3TNOA 3VC5A 1XLMA 3UXDA 1BQCA 2WSYA 2HQAA 3LXBA 1OCNA 2VFEA 2AAAA 1D8WA 3JRKA