2WAGA

The structure of a family 25 glycosyl hydrolase from bacillus anthracis.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
217
Chain Sequence
GSSHHHHHHMDRYEIKGVDVASYQGDIDWRELEKQNMKFAFIKATEGSAFVDKYFSKNWTNANKTSMRVGAYHFFSFDSKGETQAEQFIRNVPKYKQALPPVIDVEFYANKKDNPPKREDVTKELSVMIEMLEKHYGKKVILYATQEAYDLYIKDAYPQCDIWIRSVLTKPSLSDERKWTFWQYTNRGKLSGYNGKEKYIDLNVFYGNEEEFENYGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Family Gh25 Lysozyme from Bacillus Anthracis Implies a Neighboring-Group Catalytic Mechanism with Retention of Anomeric Configuration
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
molecule keywords LYSOZYME, PUTATIVE
total genus 77
structure length 217
sequence length 217
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wagA00
2DIJA 3MUIA 4MB3A 4BZYA 3N15A 3MMWA 1E43A 3LPOA 3AMGA 4M29A 3RPMA 3WF3A 2BV9A 4P8WA 1AMYA 3UG5A 3ARTA 4XUYA 1QNOA 1CGWA 5AC4A 3N9KA 2G4FA 1ISYA 3W6LA 1K9TA 2WHMA 2GDVA 1HKIA 5D8ZA 1ESWA 4ZE4A 1UKTA 3BGAA 2UWFA 1E6PA 4PMDA 2VMFA 1GONA 4D1JA 5LA1A 1E6NA 5A94A 1NP2A 5A8MA 2BHUA 1W1PA 3W81A 3UG4A 5A6LA 2CHOA 1PX3A 2V3FA 3MANA 3WBAA 4AIEA 1HX0A 1WO2A 1WDSA 1XH1A 1RP9A 4MJ4A 3ECQA 5A6BD 2CCRA 1JG9A 4CD8A 5BRQA 5BRPA 3PZ9A 3PZGA 3T0DA 4WJXA 2ZUUA 4UFIA 1V3HA 1BG4A 3VD3A 2BS9A 2VZSA 4A3YA 3THDA 1BGGA 1GCYA 2WCSA 4PMUA 1J10A 3UG3A 1NM9A 1QHZA 1J18A 1TVPA 2G3IA 2VNCA 1VIWA 3L4VA 4DUXA 2QPSA 1VF8A 1W9VA 4NRSA 4OZOA 3TA9A 1UD2A 2AMGA 1UWSA 1KXQA 1G5AA 3DHUA 5FOOA 2Y5EA 4AEEA 4AD1A 1TA3B 1IV8A 1GQIA 4EE9A 1XYZA 3WELA 5D9OA 2CERA 2ZX8A 1FH9A 1BYDA 1QHPA 1UH3A 4OIFA 1M7XA 4KRUA 3OG2A 1CXEA 2BNJA 2BY3A 1PJ9A 1WZKA 2GJPA 4B16A 1VFMA 2XVPA 1BVNP 2YL8A 4X0VA 4W7WA 1YQ2A 1BFNA 3QR3A 2DDXA 4U3AA 2CIPA 2WHLA 3AS3A 3WDHA 3RCNA 4UOQA 1B1YA 2CBIA 5A6MA 3AI0A 3MMDA 3GM8A 2BVDA 2J79A 2CHNA 1W1YA 5CJ5A 1HJUA 3A6OA 1YHTA 2WW5A 4WKHA 3K1DA 2AAAA 1ZBWA 4CD5A 1J12A 4IISA 2ZXDA 2BY1A 1U2YA 2DIEA 1JXKA 1VJSA 1HN1A 2J78A 2ZX6A 2GUYA 1LWHA 2JEQA 3ZSTA 3WMSA 1B3ZA 3WL0A 4LGXA 1ZJBA 1CENA 4PN2A 3WUBA 1LF1A 1VEOA 2E9BA 3CHDA 1D3CA 2Y4SA 3RM9A 1JZ8A 5A3HA 1UWUA 3DECA 2ZWYA 5IHRA 1EHNA 1EIBA 2YOCA 2ZUMA 1XHGA 3FNDA 4OJYA 1LL4A 4WSJA 1KR0A 2OYMA 5DFAA 3WD4A 3FN9A 3AIEA 1CEOA 2YL9A 1R86A 3BAJA 1G0CA 2ZE0A 1XD0A 5E70A 2WC4A 2X0HA 3VILA 5C8BB 5JBDA 3IJ7A 4UFLA 2OWXA 3A4AA 3PTMA 4GPNA 3N04A 1FA2A 1MW1A 2VCBA 3CMJA 3F5KA 3WEZA 1HKKA 1UKSA 1VRXA 4HZ6A 3W4RA 1RH9A 5CXPA 5CG0A 2ZXQA 3CH9A 2VUYA 1CBGA 3MU7A 4X9YA 3NJ3A 5CPQA 3I3EA 1WZMA 5CPTA 1V6UA 1C90A 4F9DA 2D2OA 3OGRA 3PZTA 1OSEA 4PTMA 2WLYA 3WNLA 2WM0A 1XRVA 1CLVA 3FAXA 2O92A 1FP8A 2FGZA 1GVYA 2YBUA 4MAVA 4AZCB 2OYKA 2VVSA 3RM8A 3SURA 4AZ7A 1D7FA 1H0GA 2UY3A 2GK1A 1B2YA 4PUEA 3HN3A 1W9DM 4V27A 5EFDA 3WFLA 1U33A 3WMBA 2QPUA 4F8XA 1TE1A 3POCA 3OLEA 5BROA 4CD6A 1KGXA 2D0HA 3AXXA 2XIIA 2VL4A 4JFWA 4W7VA 5GNYA 4GXPA 4W84A 2F8QA 1GOWA 4ZEPA 4W7UA 3AXIA 2JFEX 4UQAA 1C93A 5JIPA 1Q6GA 2QHAA 1DEDA 4N0RA 1QBAA 1ZBCA 3N17A 4S3JA 2DT1A 5A95A 2J62A 2BVTA 5CZKA 4AEFA 4PRWA 1GOMA 3N12A 1EO5A 5A8OA 4Z2HA 3L2LA 1C3FA 3GBDA 4H8VA 1V02A 3TTSA 2VI0A 3EDKA 1CYGA 4QLJA 4H2CA 1JAKA 1MFVA 3RILA 1KWKA 1NH6A 4OOUA 3ARSA 4W88A 4PMYA 3UCQA 2Y8KA 1HVQA 2VR5A 3VGHA 1X1NA 3MS8A 4KWUA 2W62A 4AW7A 3K4AA 3SCTA 1CZ1A 1UR8A 2X09A 1LQ0A 1A47A 3VIGA 1TA3A 4QFUA 3F5LA 3VIFA 1ODZA 3ZT5A 4HA1A 4AZGA 4MDOA 3ARPA 1CLXA 3I3DA 1W9BM 1M53A 3L4TA 2ZUTA 4ML4A 1WZLA 4PMXA 4GI9A 4YHGA 3AHZA 2VZTA 5D9PA 3TOPA 1E70M 1DTUA 1BQCA 3AXHA 4J7RA 5D4YA 2WWCA 2JE8A 3GNOA 1QNPA 1PAMA 1C7SA 4WK9A 2YDQA 3LMYA 3WD2A 4TVDA 1BTCA 1K9FA 5LA0A 4UFHA 3AYSA 1B3WA 1RP8A 1UQZA 3KL3A 4M8UA 1MQPA 1UQYA 4Q22A 4AZHA 3T2QA 1CGUA 2PB1A 1ISZA 5E0FA 1Q6CA 3MV11 2FDMA 5ABEA 1R87A 4GZIA 1UWTA 4OBRA 1CXFA 1SFSA 3VX0A 2YDRA 3AMKA 2VR4A 1VFFA 1EXPA 2CESA 3L4ZA 4M82A 1JDCA 2WMIA 1WCGA 1X6NA 2IXUA 5ABHA 4JIEA 5DT5A 2ZICA 3VIMA 2BFGA 4U33A 4JFUA 1UZ1A 1J0YA 2WZIA 1ITCA 2GVYA 3CMGA 3DYOA 1TCMA 4DWSB 2VRQA 4FMVA 1HL9A 1JIBA 2EQDA 4J3XA 4P7LA 3T2OA 4W8LA 4GQQA 4PTXA 2XVKA 1LWJA 3VGFA 4IM4A 4TVUA 2D0GA 3PN8A 1OIFA 7CGTA 1W9UA 1DWAM 3NDYA 1J0IA 1V03A 4NSBA 2YA2A 1IZKA 4AISA 3VDHA 3IJ8A 4BA0A 1UOKA 5KZ6A 8CGTA 4GKLA 1W3JA 2G3JA 4J3TA 1DWJM 4DWSD 4P8VA 1BGAA 1J9YA 2E3ZA 1VENA 5GPRA 5HBFA 3ARXA 1QVBA 1HT6A 2EEXA 2JF7A 1BG9A 4CU7A 2X05A 1R7AA 2WZHA 1IT0A 5BCAA 3A3HA 1HJQA 2CXGA 3L4XA 4PSPA 3ARWA 2DSUA 1UG6A 2J8FA 1JD9A 3CLWA 3WQ4A 3CIVA 1J0HA 3MSGA 1QNQA 4HA3A 4MTVA 5ABFA 3QHMA 4TTGA 1GUVA 2O9OA 1W9PA 2XIBA 1G94A 4U2ZA 2CBJA 1E72M 3WNOA 4OUEA 4JFTA 2WHJA 1JZ3A 2ZUVA 3AZRA 1BF2A 3ALFA 1XGZA 2VX6A 4AYSA 4CCCA 1BSIA 1QNSA 3NCOA 3RM4A 5ABFB 5A6SA 4UOZA 3A4WA 1E6ZA 2CBUA 4TXEA 1MXDA 1WNOA 1GOQA 4M81A 1CGTA 2XVNA 1W2VA 5A2CA 4GI8A 5M03A 1B90A 4HP5A 1C91A 3WFZA 3W82A 5CQ1A 2W61A 1B9ZA 3PZNA 5CSYA 2ZUSA 3W38A 4PMNA 3F4VA 2CITA 1V3JA 3POHA 1XH0A 3BLKA 3SCUA 3VVGA 3DYPA 1KBBA 5HDRA 4P7NA 1W1VA 1CGYA 5I24A 3AOFA 2OWWA 2X1IA 5I5RA 3VD4A 3VMPA 5LA2A 4TX6A 1OD0A 2D3LA 2D0FA 3BLPX 2OSWA 1PIFA 1UR1A 1UR2A 4LPCA 4KH2A 1UKOA 1V3IA 2F61A 3WL1A 2V5DA 5DF0A 1BPLB 1MW0A 2O9TA 5HOSA 3WUGA 5HXMA 1JZ7A 1JD7A 4BCEA 3PTQA 3WQ8A 1OM0A 2XWEA 4TX8A 1PBGA 4CD7A 1B3YA 5E6ZA 1OD8A 4WIWA 2X0YA 4M56A 3W26A 2C7FA 2JIEA 2DSKA 5I23A 4MNMA 3ZQ9A 1W3LA 1KXTA 4RE3A 1B31A 4EAMA 2WANA 3PTKA 1PEZA 3ZIZA 2Y2WA 4HZ7A 1KGWA 1C8QA 2D22A 3W27A 1KCKA 2PI6A 5GQBA 2JIWA 4W93A 1BVZA 3WEOA 5BYWA 1UR0A 2GJXA 2PWDA 3HMCA 1OGBA 4ZFMA 1Z32X 1DWHM 3RMEA 1E6RA 2MANA 4U3CA 4W87A 3BMVA 3UETA 3OLGA 2J74A 3GH7A 2WSKA 1ZBVA 3VPLA 2XVGA 4HOXA 1MYRA 3SCWA 4AY1A 4W5UA 5A8NA 2XVLA 4FF5A 1I1XA 3ALGA 4J3WA 1JF5A 3GNPA 5HPCA 3O9NA 2ZXBA 4PEEA 3WUFA 4PCTA 3AZTA 2XSBA 2A3AA 1WB0A 4QLLA 2WCGA 3MO4A 2WYSA 3WDRA 3EDJA 4QAWA 5A6JA 1E1FA 4PYSA 1JF6A 1E6SM 1XSIA 1E4MM 2E0PA 4PMVA 2V38A 3VIHA 1E55A 3MUZ1 4J3SA 1CXIA 4JL2A 4D6JA 3BH4A 3N13A 4P8XA 3AICA 4A4AA 5M17A 3SEPA 2D20A 2PBGA 4WSKA 3AIQA 4HOZA 3WDQA 2VO5A 1H0IA 1CDGA 3WENA 5CPSA 5TD4A 1MQQA 1UWQA 1BHGA 3AIVA 1H2JA 4LYPA 1ISXA 2XJ7A 4HA4A 5EBAA 3UEQA 3VDBA 1MQRA 1E3ZA 1WDPA 2WC7A 3ZO9A 1CXKA 5DT7A 2BXYA 4H8UA 1R7OA 5CLWA 1UD8A 4P7RA 1V3LA 2OSYA 3OB8A 4OOZA 3BCFA 1LL7A 3VTRA 1UH4A 1VAHA 1EGZA 3VIKA 1LJYA 4JKLA 1UA3A 3VINA 3WY1A 2WAGA 3KZSA 1EDQA 3CUIA 3WD3A 1C7TA 4PMZA 3W6MA 2EPMX 4FK9A 2VRJA 1MWOA 5CLTA 5JUVA 4JCLA 4S3KA 5LYRA 1TG7A 1XH2A 3NSNA 1FHDA 3GH4A 2J7FA 3SCOA 1VEMA 2DSWA 1FP9A 3ZOAA 1V3MA 3WD0A 1GPFA 3PBGA 1EQPA 3CHEA 5IDIA 2EPKX 1NP0A 5IXEA 3VM7A 3VIOA 2WNWA 4HMEA 4TTUA 1QW8A 3WN6A 2A3BA 3VDCA 1H5VA 4CCDA 1G01A 1ZU8A 3PZUA 2J77A 2NT1A 1E15A 1HVXA 5AC5A 3OBAA 4V2XA 1WZAA 5BXPA 3OLIA 3B9EA 3BAYA 3AHTA 5JBFA 2DPEA 1NARA 2BVYA 2YLAA 4HTYA 3VM5A 3CO4A 4CU8A 1DWIM 1SMAA 3SCPA 5HNNA 1JZ6A 2VRKA 2Z1SA 2BXZA 3VOCA 4F79A 4P8UA 4PMRA 6CGTA 2XM2A 3AROA 3UR7A 1N82A 1WE5A 8A3HA 1E5NA 1EOMA 3S6TA 2ZX7A 3AIUA 5EFFA 4KRTA 1H09A 2WMKA 1W32A 3D5HA 2WSPA 1V08A 1ECEA 5IHSA 3AFBA 2YKKA 3ARRA 3BAXA 1FH8A 2GFTA 1ITXA 1KFWA 2WB5A 1VEPA 4PTWA 1ZBKA 2VVNA 2UY2A 1E4LA 4MB1A 3K46A 2W63A 2W4XA 1HP4A 4AIOA 2DH2A 1UKPA 3I3BA 1GORA 5EMYA 3VGGA 4D6CA 4CVUA 3DYMA 5A6AA 1LG1A 4K68A 1JFXA 3WH7A 6TAAA 2PC8A 2G3MA 4L4OA 3AISA 1LLOA 3IJ9A 2GJRA 2OSXA 4RL3A 5ABGA 1JZ2A 3PZQA 4W89A 4HMDA 1QOXA 3M7SA 4GQRA 3E1F1 2EPLX 2GSJA 2A3CA 1FOBA 1H1NA 1ODUA 1L8NA 1KCLA 2J7BA 4TUFA 4H8HA 3ZT7A 5EB8A 2OWCA 4NI3A 5BXSA 2CEQA 2HVMA 4PMOA 4TOQA 5FIPA 4ATWA 1UD4A 5JBEA 4X0NA 4CKQA 4D6GA 2QLYA 2V5CA 5E9AA 3W37A 3VX1A 1VJZA 2C8NA 1XCWA 2Y8VA 2J7DA 1HF6A 3OZPA 2Q8XA 4UFKA 4WKAA 1JXJA 4B9YA 3WEMA 3DC0A 4U5IA 4XZWA 6A3HA 1CIUA 2EBNA 3KEHA 4Z2KA 1Q6DA 1UA7A 4C7FA 3OGVA 3MUAA 5KEZA 1V0KA 3N11A 1Q6FA 3EDFA 3ARVA 1V3KA 2ZUWA 5A69A 4W8BA 3ZR5A 4UQBA 4AD3A 4U31A 3O6AA 3F5JA 4GI6A 3J7HA 2J7GA 1CGXA 1VBRA 5I2UA 2X2YA 3WH8A 4BQ5A 4Q7NA 3VDAA 3NIYA 4JFSA 1E9LA 5JIWA 1W3KA 4CGTA 2D24A 2EPNA 4U5KA 4PCSA 1JAEA 3LPGA 4XV0A 2DSVA 1O7AA 1QW9A 4B15A 2XYLA 4AWEA 3K8KA 1OIMA 1OINA 3GYCA 3GXFA 3VGEA 1MXGA 2BY0A 2DT0A 3PZOA 2VQUA 4GZEA 1HJVA 1E56A 3T09A 4UNIA 2WMHA 3MKKA 5DEZA 3VKKA 1E6XM 1HL8A 1E0WA 3VD9A 2VX5A 3GH5A 3ZM8A 1M04A 1M03A 1OB0A 4Z2LA 3MUY1 4QCFA 1CNVA 2WC3A 1GOKA 2ZOXA 2VZOA 4MPKA 3LPFA 1MVYA 3W24A 1KXHA 5FKYA 3BC9A 3PZVA 1GJWA 2CKSA 1DHKA 3II1A 3CUJA 1GHRA 5DMYA 2F2HA 3CTTA 4D71A 3QGVA 1BYAA 4E4PA 1JYNA 4Z2IA 1AVAA 4D6IA 4UR9A 4YHEA 3TP4A 4DM1A 4CD4A 2YA1A 4ZXLA 3TTQA 3NDZA 4UCFA 2XGIA 1Y7VA 5DO8A 4UQCA 3PZMA 4F66A 3A4XA 4RE2A 2RGLA 1V0NA 2XG9A 2YIHA 3FAWA 4UOJA 4P7OA 2ZX9A 2WMGA 2V3GA 1BLIA 4D72A 2TAAA 1JL8A 3PZIA 1JNDA 2WMIB 3WNNA 2O9RA 1V0LA 3NUKA 1CECA 1FFRA 2VTFA 5I79A 1ZB5A 1JYWA 1JZ4A 4QDMA 4AD0A 2OYLA 4D6HA 3IANA 4B9ZA 1TR1A 2VOTA 3KWXA 2J25A 4D6DA 2J7CA 3WQ5A 3ZT6A 3U7VA 1VFOA 3ZSSA 2PWGA 1EOKA 1NWTA 3SCRA 3T0AA 2FH6A 4DUVA 2W92A 2O9PA 3GXDA 2XWDA 2YJQA 1US3A 4UQDA 3VUPA 5HPOA 1OGSA 2JF6A 1BYCA 3A47A 5F7UA 2WVUA 3CZJA 4H7VA 4AMCA 1PX4A 4HPHA 1VB9A 3VIPA 3U5UA 4XZBA 5A1AA 4CUCA 2XSAA 2C0HA 3WDIA 1B0IA 4DUWA 3VNZA 4LYQA 3QOMA 3WDPP 4H41A 1JNEA 1EDGA 1B3VA 1R85A 1ZS2A 1E1EA 1EDTA 1C92A 3VGDA 2YA0A 1CTNA 4Z2GA 2WXDM 2YL5A 2FHCA 3PHAA 2QV4A 4ACZB 3L4YA 4R27A 1NOUA 5I3DA 3AIBA 1G1YA 1K9DA 1XC6A 4CN4A 1TMQA 5I6SA 4E8DA 1W3HA 1W91A 1WAWA 3SCQA 1MW3A 3QHNA 2QMJA 1W9XA 4IPLA 1J0KA 3VMOA 3WKZA 2WLZA 4MADA 4ZENA 2RGMA 3ZJ6A 1OCQA 4YPJA 2VZVA 2VT0A 2W91A 3CZKA 4F9JA 4IUGA 4PTVA 3CUGA 3N18A 3GZAA 2EJ1A 4D6EA 4M24A 2DEPA 4AZCA 2YDSA 3WQVA 1CPUA 1ZJAA 1QNRA 3M46A 2CETA 3ARUA 3EDDA 3IK2A 2QMKA 3APGA 1QI2A 3AS0A 3WNMA 4JAWA 3N1AA 4AZ6A 5D9NA 1LL6A 3L4UA 1H4PA 4J28A 1B3XA 3AMDA 5BWFA 1E0XA 1PPIA 1XCXA 3OIHA 4JKKA 2E9MA 5D9MA 3SCNA 2WVTA 3EMQA 4NRRA 4EKJA 1UKQA 4AD5A 3VNYA 1I75A 3VD5A 3CHCA 4HU8A 4ATDA 2YBTA 3L2MA 4UZSA 3SCVA 3KL0A 3U5YA 1HJWA 1F4AA 4PSRA 1AQHA 1BYBA 3VGBA 1QI4A 1PIGA 1XSJA 1JYXA 1VFUA 3MMUA 2X8RA 1XD1A 2EPOA 3SUWA 4H04A 2PWHA 1O6IA 3B9DA 4W8AA 2NW0A 5BXRA 3BMWA 4UZUA 4JHZA 2CKRA 2G3NA 1V02E 3W25A 1Q4NX 3MSDA 5CGTA 1NWRA 4LQ1A 5E0CA 3K8LA 1HKJA 1UH2A 2ZX5A 3CZEA 5I0DA 4KGLA 1GZJA 3BAWA 1V6XA 3TTOA 1P6WA 3ARZA 3AMLA 1GQLA 1D2KA 1E73M 1S46A 4MJ2A 3GTNA 2YLLA 3WD1A 5C70A 1VBUA 4JFVA 5A8PA 3CZGA 2WVVA 3EBVA 5CGMA 1KWGA 2Y24A 3WNKA 4EK7A 3WBEA 3O2LA 3K4DA 4AZBA 2VCAA 2FH8A 3WDJA 1GW1A 1J01A 3WH6A 4YN5A 2Z1KA 4QCEA 5A8QA 2ESCA 1H11A 2W66A 2NSXA 2D1ZA 1XYFA 2J7EA 3CZLA 1L0PA 5M5DA 1EQCA 1G9HA 2ZIDA 3GXIA 3GXMA 1V0MA 4MNJA 3BSGA 4NF7A 2XTKA 3AIRA 2FHFA 1HJXA 2VURA 3ZMRA 3GDBA 4AIUA 2XFRA 3M6DA 1EH9A 4GO8A 4URIA 5FL0A 3W28A 4EANA 4PBGA 3WIJA 2G41A 4M80A 3RDKA 3WSUA 3OZOA 4NZCA 4C7DA 1QPKA 3WMCA 1GJUA 3W53A 5FD0A 3WF2A 2CBVA 5IFTA 4HMCA 4QP0A 3W29A 1J0ZA 1GOIA 3UERA 2WPGA 4D1IA 3B8SA 3ZJ8A 2E40A 1SMDA 1C8YA 2WVVB 3WF4A 1TZ7A 3RIKA 1CXHA 1EHAA 1F4HA 2OLHA 3VIIA 3CBWA 4FLRA 1CWYA 4JZ5A 3G6MA 3WH5A 3T2PA 3BAKA 1PX8A 3NYDA 4D6FA 2XHYA 4N42A 3RO8A 2GDUA 4MDPA 2JEPA 4XX6A 3WF1A 1UWIA 4MNKA 1W2PA 4PUDA 1HIZA 1EA9C 4M1RA 1JDAA 2CPUA 1OT2A 5AYIA 2WMJA 4AZIA 1Q6EA 2VX4A 2GK1B 4BS0A 3ZJKA 3ARYA 7TAAA 4ATLA 3KL5A 3AIWA 1TFVA 1LG2A 1UR9A 1CGVA 4J3UA 4J27A 3HU7A 4BQ2A 4GO9A 1KBKA 4DWSC 1PZ2A 4CCEA 1WPCA 1WDQA 3AS1A 4AZ5A 4FLSA 1K9EA 1JI1A 2A3EA 2WHKA 3AHYA 1XSKA 1UYQA 1JI2A 2DH3A 3CGTA 3T0BA 2QF8A 4CU6A 1W1TA 1V6YA 4XB3A 3WQWA 1FH7A 3EDEA 1JGIA 1I1WA 1KR1A 4DM2A 4JHOA 5E09A 5GNXA 1AQ0A 2YL6A 4AXNA 4TVCA 1KGUA 2E8YA 1WDRA 2GJXB 2VQTA 2E9LA 3THCA 2BY2A 2WK2A 2D23A 3SUVA 1GOOA 2XGBA 3QHOA 5GNZA 4W5ZA 2EXOA 5C71A 1ISVA 4DWSA 1C8XA 4V28A 5D8WA 4W86A 4ZE5A 1JYVA 1E6QM 2J47A 5AY7A 2CNCA 3FHAA 2D3NA 5ECUA 3SUUA 3SUTA 4WF7A 1UWRA 4AC1X 3FXYA 3WH9A 1UHVA 1PZ3A 3MV01 3EMCA 3IAQA 4MAZA 3B9AA 2FGLA 1KXVA 2PWEA 4CN6A 2XFYA 1MW2A 4P7QA 3U7BA 3WQ6A 2VC9A 4AD2A 2G8ZA 2DQXA 4ACZA 2J75A 2WCAA 4CVWA 5FL1A 2WKGA 5CSUA 4JL1A 4WKFA 4PMQA 5BXTA 4HOWA 1QI5A 1U30A 2IXVA 3VMNA 3VIJA 3VO0A 3UESA 1E71M 1E4NA 2IUZA 3JUGA 1XV8A 1ISWA 3D3AA 2ZXAA 2NT0A 2DSZA 3S2CA 3U57A 3AHVA 2VJXA 1SR0A 9CGTA 5A2BA 4BQ3A 5A2AA 2PF0A 1DP0A 1GQKA 3QOKA 3SCSA 1IZJA 3AS2A 2XUCA 3OLDA 3BCDA 4MB5A 1R8LA 3UR8A 2J7HA 4OBSA 4C7GA 3NSMA 2ZWZA 3ZJ7A 3VU2A 2BHYA 4RE4A 1KB3A 3KE0A 4A3HA 2XM1A 3OGSA 5IFPA 1NWSA 5A6BA 1NOWA 2VX7A 4UQ9A 1OWQA 3BAIA 4GIAA 3L4WA 1E4IA 3K8MA 3BSHA 3SUSA 5M3WA 3GNRA 4IPNB 4KGJA 1E40A 1US2A 4E2OA 4MB4A 3TTYA 3CZ8A 1M01A 1UD3A 1QI0A 4CN1A 1H49A 2DT3A 3ARQA 4ACYA 1V6WA 1GQJA 4LXFA 2WBGA 3FHQA 4QLKA 1KQYA 3LPPA 2XPKA 3VD7A 2DT2A 1UD6A 3CUFA 3IAPA 1E3XA 1QI3A 4OKDA 4FLOA 1QBBA 4BF7A 1V6VA 2XFFA 4UFJA 2E4TA 4L4PA 2WMFA 1EO7A 1WKYA 1TUXA 1GVIA 3RJXA 2AOSA 4Y7EA 3SIMA 3AJ7A 3EYPA 1OT1A 1E5JA 3OA5A 1DWFM 2VCCA 1HJSA 3CUHA 1ZL1A 2WKLA 1TVNA 2WZEA 1FFQA 2WBKA 5A6KA 3FY1A 2DGAA 2EO7A 2WVSA 4UTFA 7A3HA 4HZ8A 1AQMA 3W0KA 1H3GA 2V3EA 4GZJA 3CHFA 2BHZA 4R5EA 1B30A 5AYBA 5E6YA 4JKMA 1HNYA 2ZUNA 5I78A 4UQEA 3NSXA 1HP5A 2PWFA 4MNLA 1HXJA 4W85A 1SYTA 1HKMA 3GBEA 4HPGA 3HJEA 3AQUA 3M07A 1GHSA 1X6LA 3BXWA 2HISA 3AZSA 2JALA 3CPUA 4AD4A 4FLQA 4LYRA 1WP6A 1K6AA 4HU0A 1UR4A 3T08A 4Z2JA 3G6LA 1A3HA 2VZUA 1QHOA 4U2YA 3RJYA 5FCZA 4GINA 1OGGA 2UY5A 1JDDA 1UZ4A 4LX4A 1RPKA 2PBOA 3AMCA 1CXLA 4B3LA 2E8ZA 1DWGM 4KMQA 3TONA 1UD5A 1KQZA 2B31A 3DHPA 4E8CA 2J4GA 4ZXOA 2WWDA 1OBAA 1JZ5A 3WF0A 3EMZA 1NQ6A 1JFHA 1NOFA 1GNXA 3WUEA 3FW6A 3AYRA 1E0VA 4J3VA 4JCMA 1UUQA 4B3KA 1BAGA 4UFMA 5I77A 2UY4A 2FHBA 4BQ4A 2W67A 1MFUA 3AHXA 1NWUA 2J8GA 1RD6A 1J0JA 3ZR6A 1J11A 4WLCA 3WNPA 1FHLA 2V3DA 2A3HA 2W5FA 2CYGA 1H41A
chains in the Genus database with same CATH superfamily
2HPMA 4MB3A 4UTKA 3EKZA 2BDQA 3AMGA 5CBIA 1IXPA 4RZBA 3UZZA 2BV9A 3LN3A 2RDXA 3H7RA 4XUYA 3NO1A 3G1VA 1NIUA 5AC4A 2C6QA 3N9KA 4C6FA 1LRQA 2G4FA 4FNPA 4K36A 4QRNA 1HKIA 1U22A 1UKTA 1E6PA 1TPWA 3B06A 1GONA 3C2EA 2Y5JA 1S1PA 1KBLA 5A8MA 3V0TA 4NILA 1E9IA 2GSHA 1T99A 3WBAA 1HX0A 3CEUA 3FVDA 4MJ4A 4PZVA 1HFBA 4WX2A 4ZGYA 3VFLA 1TB3A 3DFNA 1GOXA 1PTDA 2F9RA 4GIEA 3VD3A 4A3YA 3M0MA 4ENLA 1U5JA 1GCYA 4I90A 4JXCA 4JGDA 1UROA 2G3IA 1VIWA 1ICQA 1TWDA 4GUIA 2AMGA 1UWSA 3EWXA 4IUOA 4WOZA 4PL1A 4B3ZA 2Z2BA 1XYZA 3WQPA 3QH2A 1QHPA 3H21A 2AQVA 1M7XA 4LAUA 3RMJA 4PBFA 5FEXA 2F84A 2BNJA 3SGZA 1PJ9A 1XI3A 2QVHA 2VGIA 2W79A 1BVNP 2YL8A 2V8ZA 4GQBA 3QYQA 1YQ2A 1BFNA 4ZB2A 3C61A 2YBVA 3W2UA 3IGUA 1CB2A 3LUTA 3MMDA 2BVDA 4LNCA 2PZ0A 2ISWA 3K2GA 3HPSA 1ME9A 3K1DA 2BBFA 1VPXA 3W74A 2PGFA 4FP1A 4MVAA 1LORA 1VJSA 1HN1A 4KT2A 4POCA 2OODA 1JQVA 2Q6ZA 1A5AA 2QDEA 3NQ7A 3ZSTA 4HNCA 3WL0A 4LGXA 3RHGA 1CENA 3FA5A 5B7ZA 3LB0A 1XIDA 5G2WA 2NQ9A 3A9BA 3RM9A 3T0TA 1AH4A 5A3HA 2V9DA 2Q01A 3A13A 4NL1A 4JTLA 2YOCA 2O7QA 2ZUMA 4H00A 1WKFA 1KR0A 1X1OA 3AIEA 1CEOA 1G0CA 3VOFA 2ZE0A 3M16A 2X0HA 4GC3A 3G2GA 2VHLA 3IJ7A 1XLMA 2OWXA 3AUJA 2OFJA 3BOFA 2IPGA 3F5KA 3WEZA 6XIAA 3L7RA 4XKYB 4HZ6A 1VRXA 3HA1A 3PBMA 2ZXQA 2VUYA 3S2NA 3MU7A 1R3RA 2Z2UA 3K30A 5CPQA 4AU0A 2ZVIA 3KOFA 5CPTA 2KAUC 1F07A 3T8LA 3OGRA 2CZ5A 1XBXA 2O92A 1PTAA 3IACA 1W1IE 3W01A 4AZCB 4MSSA 5HMFA 4LC8A 2UY3A 2GK1A 4PUEA 2PTZA 4O57A 1GZGA 2ODOA 3W7KA 3BGJA 3WMBA 1M65A 4F8XA 4ERAA 5HNUA 3LEPA 1BVWA 3AXXA 3UT0A 5GNYA 3DUGA 2WZTA 4R9OA 1GOWA 3BE7A 1PKYA 5CAKA 2BOEX 4ZEPA 5HR6A 4UQAA 1Q6GA 1UUOA 4H9XA 3NZGA 4PTNA 3S1WA 3C0QA 1DEDA 1ZBCA 3N17A 2GUBA 2DT1A 1KRMA 4NZ5A 2NXIA 2GYIA 3N12A 5A8OA 1C3FA 3G1AA 1V02A 3TTSA 3CS2A 3C56A 3WX7A 2YCEA 1JAKA 3ITYA 4K8GA 4OOUA 4QQ3A 3ARSA 4PMYA 3VGHA 1HVQA 1X1NA 2NQ5A 1VR6A 3MS8A 2W62A 1HUVA 4AW7A 3K4AA 4Z1BA 1ZQ5A 1UR8A 1A47A 3VIGA 1TA3A 3F5LA 1ODZA 3ZT5A 3TTEA 1G6CA 1LOQA 2Q71A 4Z42C 2QULA 3LLFA 1K6WA 3P0WA 4GI9A 4YHGA 1ZGDA 3STCA 3GG0A 5D9PA 1GVFA 1DTUA 5TBOA 1AD1A 4O14A 3EWYA 3PJXA 3PJWA 2CW6A 4DF0A 3BVJA 3NQ8A 4DF2A 1OVDA 3LMYA 4J5NA 2VGFA 4Y9PA 1QAPA 4XK2A 5LA0A 3C8NA 4UFHA 4JIHA 4JTCA 3UBPC 3T2QA 2QCFA 2PB1A 1PDYA 1TZZA 3MV11 1R87A 4IGNA 3NQ2A 2Z24A 1VFFA 3BWWA 4FO4A 3I7QA 1JDCA 2QXWA 1RLCL 2WSQA 4ZTXA 4DJED 1ADOA 1ZP3A 5ABHA 5JVLA 3HB9A 1XXXA 1RY8A 2ZICA 4AWTA 1PCKA 1EIXA 3N6JA 3NQBA 4O11A 5AFDA 3BURA 1UZ1A 1KFKA 1J0YA 2DJLA 1NDZA 1PV8A 3CMGA 2PTXA 3AYVA 1JIBA 2EQDA 5CPNA 3V5OA 4E3TA 4A35A 2PDNA 1LYXA 3VGFA 1OIFA 1V7AA 4IGSA 3E5PA 1DWAM 1V03A 4GRSA 1TUFA 3TWAA 4DBSA 2FZBA 4Q4KA 4YWSA 3E0IA 1QDSA 4KCWA 3OEXA 3L0GA 1AD4A 4P8VA 5FESA 2O4QA 5HMEA 1J9YA 4YU1A 2E3ZA 3EOLA 3W9ZA 5HBFA 3ARXA 3QZAA 2CZEA 2EEXA 4J2PA 4CU7A 5E1QA 3L5AA 1KFLA 3A3HA 3O07A 1PUDA 1HJQA 2DSUA 3OODA 5AECA 3R58A 3UCDA 3S83A 1JD9A 3CLWA 3QTPA 4LCRA 2J13A 2YGYA 3CIVA 4MTVA 3N2OA 4ZO7A 3S2LA 1GUVA 1W9PA 2JKPA 3L12A 2XIBA 4RJEA 1G94A 1KM1A 2CBJA 3M41A 4RKAA 2C0AA 4JFTA 3AZRA 3UW6A 5FJOA 4CNUA 4AYSA 3PPCA 3NCOA 2FJUB 2ZRXA 5FJTA 1E6ZA 1FCQA 2CBUA 3CYVA 4M6VA 5ECVA 3KBSA 4CQ9A 4R88A 3PB0A 5A2CA 1C29A 5M03A 1OFQA 3GW3A 5I00A 4Q8WA 3W82A 3C0SA 2WZMA 1B9ZA 2CLPA 2E5CA 1NDWA 2EG8A 1V3JA 3TW7A 3TXVA 2PDFA 3SCUA 4GC4A 1HQTA 3DYPA 4P7NA 3CT7A 3HG2A 5I5RA 1F7BA 3LCGA 2HSAA 5D33A 3TH6A 3BG3A 1P0EA 4BHYA 1IEXA 4PULA 3BLPX 3N9RA 4GJJA 1KM5A 3PK7A 1V3IA 3WL1A 3L67A 2ACQA 4S39A 5HOSA 4XKYA 1OF8A 3NR0A 1GKQA 3VNIA 1XP3A 1DJWA 1EJXC 1OM0A 2AL2A 2XWEA 2J66A 4TX8A 4AXKA 1RBAA 1K8XA 2X0YA 1TREA 3W26A 4GA8A 4GUHA 3U4AA 4GXWA 4O1CA 1JCNA 1RJQA 1KXTA 1FKWA 1LZOA 2J88A 4KFNA 2DW6A 1FKXA 3ZIZA 4KCUA 2A21A 3CL7A 1C8QA 4FNTA 3W27A 3LTYA 1KCKA 4TV5A 4W93A 3BJTA 1H50A 2PWDA 3KVLA 2PGRA 1KFEA 2ANUA 1DWHM 3RMEA 1E6RA 1U83A 4W87A 3TQVA 3PSVA 3UETA 3BLFA 1V77A 1IGSA 1J2BA 3QQWA 1ZBVA 3VPLA 2ALRA 1MYRA 4AY1A 4AG0A 5A8NA 3DEQA 3S1UA 1TWSA 2ZXBA 3GDMA 4JR5A 1YLVA 5FF0A 3BQ6A 3CL6A 1WB0A 3O05A 4QLLA 5L9FA 1FWAC 2WCGA 1H7OA 1KFBA 3HGJA 5CZSA 3LTPA 1HO1A 4S3AA 1P1MA 2E0PA 4ES4A 3LM3A 4XO6A 3MUZ1 2PU0A 1CXIA 3IUDA 5TIMA 3IV3A 3N13A 3SGUA 4RV3A 4O17A 3SEPA 2D20A 2PBGA 2Z1BA 4JD4A 3WDQA 3TC7A 1XLJA 4HNOA 4BR1A 3VABA 4LF2A 3OPSA 1F9CA 1UWQA 4PUWA 1ISXA 1ML1A 3KM8A 1VP5A 3O0FA 4YJ5A 5A6TC 2WC7A 3PNZA 1W56A 3H22A 4S3CA 5DT7A 4NAEA 2A4AA 4H8UA 3P5YA 4P7RA 1V3LA 4OVXA 3LGEA 3BQ5A 2A0NA 4XKMA 1BSLA 1KV5A 3B0PA 3KBNA 4FR6A 4AF0A 3BTNA 3H26A 3WY1A 1XF0A 3H2OA 3WD3A 3S5OA 3VOHA 2EPMX 5J5DA 1LLWA 4UUIA 1TG7A 3LHWA 5AVNA 1FHDA 4Q8OA 1G7UA 2J7FA 4QITA 5G1TA 2DSWA 3KVJA 1FP9A 3LOTA 1MEIA 1H63A 3PBGA 1LUCB 1EC7A 1Z48A 5IDIA 4DAIA 2EPKX 2GVLA 3FJ6A 4QTGA 5EMKA 3FGCA 2CWXA 4HMEA 3EWWA 4ZTYA 5CC5A 5J5RA 1QW8A 4RNFA 2ADAA 3VDCA 1H5VA 4CCDA 4DJEC 1TWWA 4GABA 1ZU8A 2NT1A 1K77A 4QG9A 1HVXA 1Q13A 1WZAA 3MWCA 5JBFA 1AH3A 4XZHA 3AXMA 4K39A 5HWJA 1TJ1A 2BVYA 2YLAA 3VM5A 3CO4A 2HZGA 3OOQA 3GWQA 4L6HA 3MYOA 2BXZA 1QT1A 4WXZA 1B57A 2XM2A 3PG8A 3UR7A 1EF2A 4QHRA 2DUXA 1E5NA 1XLBA 2ZRVA 3EWDA 3UXDA 2WMKA 1W32A 1ADDA 2ZRYA 3ARRA 1TR9A 1FH8A 3EPNA 5F2LA 1KFWA 2ALDA 2C3ZA 1VEPA 1ZBKA 3EPMA 3MCOA 4WCJA 1RALA 1S1RA 5LKYA 1RVGA 3K46A 2CLEA 4QDWA 4RDZA 4BEQA 3NO3A 3M47A 3HQOA 3TNBA 4O1EA 2PF8A 4JTFA 1IEIA 2PDJA 4AH7A 3WH7A 6TAAA 4KPLA 3A4JA 2G3MA 3LLDA 1V6TA 4L4OA 3AISA 4NJGA 3SBFA 4NG3A 1VFHA 4PCPA 3W00A 3LA4A 1OFRA 1S2VA 4QE5A 1PWMA 2J6VA 2B7OA 4I6VA 1KCLA 1EPXA 3ZT7A 3ZWTA 3F2BA 3DFHA 5BXSA 4PMOA 1R2RA 1UD4A 4DZAA 2NXHA 3MHFA 5CBJA 2FMOA 1TV7A 4D6GA 7ODCA 2HVNA 3AUOA 4AMAA 2E25A 1X98A 1DIOA 3HZ3A 1CT5A 1Q65A 4H9MA 3OZPA 2V81A 3GDKA 2Q8XA 2IQDA 4OQVA 3W7DA 2J8TA 1KRCC 3R94A 1JXJA 2IQTA 2NQLA 4OBTA 5BWAA 1HKVA 3KEHA 3P14A 2Y62A 4Z2KA 4C7FA 1TV5A 3OGVA 1X97A 2ZA1A 3EOUA 5A69A 4W8BA 3MSRA 3ZR5A 3F5JA 1IXOA 1WBHA 2OX1A 1VBRA 5I2UA 4FS9A 2AGKA 3VDAA 3FFSA 4K2SA 2PURA 2E5BA 4U5KA 1JAEA 2QF7A 1VZWA 1EUNA 4XV0A 2DSVA 2XYLA 2ZDRA 4JX5A 3GKFA 4O52A 2YW4A 1OK6A 3K8KA 1OIMA 3TR9A 2OU4A 2DZAA 3R11A 5AVHA 3HV9A 4TMCA 4GZEA 4GY7A 3LSBA 3HQ1A 4GIYA 3UR2A 3MKKA 1ZY9A 1XLKA 3VKKA 1HL8A 3W85A 4GCXA 1M04A 5C9ZA 4FAMA 5EU9A 1DOSA 1OB0A 4Z2LA 4NUWA 3K1GA 1JJKA 2VZOA 1FWRA 4X61A 4MWAA 5GJNA 1LDCA 3D47A 3MI3A 4ROPA 2J9XA 1XIMA 1V79A 4JTRA 3L0NA 4N4PA 2CKSA 3C2YA 1RA0A 3II1A 4MOZA 5H2ZA 4D71A 1SZRA 2PLKA 4D6IA 2WOQA 3W7MA 4R9XA 2WQPA 1HGYA 3HO8A 2XGIA 5I3JA 3IARA 2B7PA 5CBBA 1TMHA 3UQNA 1N55A 3ATZA 2PEVA 4PUKA 3BLIA 4FOJA 4JDBA 3WLRA 3A4XA 4RE2A 4I8DA 4NNBA 4UOJA 2ZX9A 1GVRA 4D72A 4M6UA 1JL8A 3GW0A 3PZIA 1JNDA 3R10A 2A2IA 1KFJA 3TN5A 3SY8A 1I0BA 2BGNE 1CECA 1FFRA 3KP1A 1A3XA 1MUCA 4AD0A 3KCLA 2J9ZA 3N19B 3IANA 4D6HA 2VOTA 3RX2A 3KWXA 4RDWA 2J7CA 4JDYA 3WQ5A 1I6NA 3U7VA 1HGWA 1VFOA 3APTA 3ZSSA 1QMLA 1X1ZA 2PWGA 4BF9A 3OVGA 3SCRA 4GHRA 2V5BA 4FB7A 4DUVA 1GYNA 1LQAA 3M9YA 4XVDA 4QGCA 2QUNA 4UB9A 4NYYA 3VUPA 5HPOA 2JF6A 3ZR4A 4Q8NA 3U2ZA 3NQMA 4G1NA 3C2VA 3CZJA 1VB9A 5DBTA 1FXQA 1Z3NA 4RZ6A 1UMLA 5A1AA 2ISFA 4G1KA 2CLMA 1LQ2A 4DUWA 1TPFA 3SJ3A 3UZWA 4H41A 1F2JA 1S2TA 1B3VA 3B05A 1N8FA 1AJ2A 1E1EA 1EDTA 1C92A 2W9MA 5JH1A 4ACZB 1J93A 3QR0A 3V5CA 1JPDX 4GUFA 3QV7A 3AIBA 3UZJA 5I6SA 3WFAA 4MWAB 4NKCA 4N9BA 3RX4A 1OZQA 1Q85A 2RGMA 1OCQA 4YPJA 2VZVA 3LHYA 2RDUA 2W91A 1LWIA 4HNVA 4DPPA 5BOOA 3ES8A 4IUGA 3L9CA 4HZMA 3GVRA 3QV9A 3GZAA 5IOBA 3U6WA 5G2HA 2OO6A 1ZJAA 4JTJA 4ZQNA 3IJQA 1YRRA 2KX9A 1VBJA 3EDDA 2QMKA 2QGHA 1T5AA 2Q09A 3DBPA 3OZYA 3GIYA 4RNJA 5JQ9A 3QFEA 1K7XA 3W7RA 3QV8A 3UPBA 1H4PA 3EXSA 5BWFA 3OBKA 1E0XA 3MVIA 5FA5A 1LBFA 1TVLA 2FGBA 5I3HA 4E8GA 2WVTA 1VYPX 2YDAA 2BWGA 1MRAA 2ZA3A 3NOYA 3M0XA 2EHHA 1OFPA 1I75A 3WQCA 3B4UA 5CZTA 5CG7A 3L2MA 8TIMA 3C86A 3S46A 1L6WA 3U5YA 1HJWA 4PSRA 1MZHA 1Q2RA 1QPRA 2Q02A 2PCQA 5CPMA 4WXYA 2ZZ2A 4ZO8A 4H4IA 3B9DA 4W8AA 3O7UA 4H6EA 4F48A 5BXRA 4Q8TA 5F4WA 3KHDA 4U28A 3LYEA 4GYFA 1EB3A 3IRSA 3VKJA 4GJIA 3MSDA 3UP8A 3JS3A 4IWWA 1HKJA 1BWKA 3GVGA 4HCHA 3CZEA 1Q8JA 5I0DA 1GZJA 3BAWA 1V6XA 3ARZA 3QW3A 3GFYA 1D2KA 1OFOA 2CXEA 3G1XA 3WD1A 2VDIA 4XO7A 4JFVA 4LW7A 5A8PA 2WVVA 2A3LA 1ZENA 1F05A 4L65A 3WBEA 1FWSA 2YPIA 3O2LA 2GJLA 4S2CA 2VCAA 8XIAA 1GW1A 3WH6A 1DJIA 2NV9A 1YXDA 2CLKA 2ESCA 3MKVA 1H11A 2NSXA 2D1ZA 1L0PA 2OZ3A 1KKRA 4MNJA 3PG9A 5BU6A 1YNQA 5LIKX 3W1NA 4L5ZA 4GVGA 4GO8A 4IP5A 2FYMA 1P7TB 5FL0A 3KBMA 4EANA 2W0UA 2G41A 4M80A 3GDTA 4F0MA 3WSUA 3OZOA 5AC6A 2VOMA 1NVMA 1IHIA 3H4GA 2X41A 4OUIA 1PB0A 3WF2A 1MNZA 3FX4A 4QP0A 4UTUA 2GQ3A 3MPGA 4XZMX 5AHLA 4RLIA 3TW9A 1XRFA 2ISSA 3USBA 1C8YA 4NT0A 3S1XA 1O1HA 3SY5A 3L5LA 2FFIA 1F4HA 3STPA 4JZ5A 4EF8A 3O63A 3BAKA 2DVUA 3EOEA 3AJXA 1FWHC 1W5QA 4JQAA 4K1WA 3RO8A 4MDPA 4L56A 3EXTA 1VIZA 5LNSA 3G5EA 4FZIA 4DY1A 1K8ZA 1HIZA 3O3RA 2CPUA 4KS0A 3DI0A 1IQ8A 2GK1B 4QJ4B 2Z6JA 4PTDA 7TAAA 3IS4A 2BVWA 3NZPA 3W1AA 1QR7A 1RSCA 1UR9A 4AAJA 1WOAA 3ISIX 1TPC1 2VFGA 3CAKA 4LJ3A 1EX1A 3MP5A 5B7YA 1MZRA 1A5NC 3OZMA 1TPH1 4RXFA 3USZA 3ANUA 5C6MA 3LV5A 5HR7A 3PPFA 3N6QA 1UYQA 1JI2A 3CGTA 2QF8A 4CU6A 1SVDA 4ROQA 2NXGA 2FB3A 4R7WA 4XB3A 3EDEA 4YXGA 1KR1A 4GG9A 1AQ0A 3JVAA 4AXNA 1FWFC 4X60A 2E8YA 4QSHA 4H01A 4KIEA 5GNZA 3GB6A 1JPKA 4TMBA 4UNLA 3WQGA 4Q4MA 3HV8A 1E6QM 3INPA 2Z28A 3RR1A 3SUTA 1M41A 5GVJA 4NAEB 3W70A 3WH9A 1UHVA 3MV01 1UMYA 4EPKA 1WUFA 2XFYA 3U7BA 3WQ6A 2ABAA 5HUPA 3R8HA 4AD2A 4CVWA 3UXKA 1JRBA 4XD4A 1XBZA 1YDVA 4HOWA 1TO3A 3UESA 3L5MA 2IUZA 4M51A 3KRSA 1ISWA 1I2RA 2F2KA 1EJSC 1T96A 1QASA 3B0VC 3E0VA 1WKEA 1AW2A 1FXPA 3URNA 2VDGA 3AS2A 4EACA 4C6QA 2X1TA 1PVNA 1R8LA 3UVIA 1EP2A 1YADA 4A3HA 1K7FA 5DELA 4KQNA 5DXYA 1DQWA 4FXJA 1DJXA 1BQGA 2PDBA 3R0UA 5IRPA 3BAIA 1E4IA 2VDHA 3TYCA 1FWWA 2B81A 3WLKX 3MKCA 4E6MA 4IPNB 4E2OA 4MB4A 1A4LA 4IHCA 2WSRA 4AF0B 1TTQA 3QGAC 4ACYA 1GQJA 1Z89A 4QLKA 3QKEA 2XPKA 3T9PA 1QPNA 4K8HA 2I9EA 2IKIA 4LFYA 1J5TA 1V6VA 2XFFA 4L4PA 2VFHA 5HNRA 3GXPA 4Y7EA 4B2DD 3TC6A 3EYPA 4DO4A 1YNPA 1DWFM 3EB3A 2ZKMX 3STEA 5E93A 4FXFA 2VYOA 3MQTA 1DPMA 5EMJA 1IGWA 4A05A 1LOLA 5FACA 2WV8A 3HG4A 3OTRA 4NAFB 2DGAA 2EO7A 4UTFA 3U0HA 7A3HA 1AQMA 1DTNA 2V3EA 4HGXA 1XLGA 1O94A 5E6YA 2NZLA 4UTWA 4LVFA 1P43A 1TWIA 4UQEA 3KCOA 3EKGA 1V93A 3LENA 1HXJA 1RJRA 3H55A 4W85A 1SYTA 3GBEA 4HPGA 2B4GA 4FR1A 3M07A 2R1NA 2JALA 4AD4A 2X16A 5G1YA 4HU0A 4C5YA 1EP1A 1PE1A 2OZTA 5F2MA 4WGXA 2VZUA 5XINA 3MW7A 1A5LC 3I4EA 3RJYA 4Z0JA 1VS1A 3L23A 4M19A 5AZ0A 3GYEA 2E8ZA 3URBA 1W31A 1UD5A 1VQTA 3DI1A 1IEVA 4GJ1A 1OBAA 2GL5A 3WF0A 1SW0A 4S23A 3BG9A 1NOFA 4V1XA 3VZXA 5I07A 3G8RA 4UC5A 5FJRA 6XIMA 5I77A 1QUMA 2UY4A 3TN4A 3QY8A 4DIAA 1NDYA 1T8QA 1LM1A 1M5WA 2G50A 2J8GA 1RD6A 3NURA 1MDLA 5J04A 1ZCCA 3DG7A 2OVLA 1OF6A 2W5FA 2CLHA 4FPSA 1D3HA 4GISA 4C6MA 5T26A 4Y9MA 3MVTA 4KESA 4LSBA 3MMWA 1E43A 3FJNA 1YE4A 3LPOA 1Y5WA 1I2NA 1O66A 3SM0A 2NUYA 3GTIA 4EP8C 2OLSA 4IXHA 2QDHA 4ZOAA 2PDIA 4C6EA 3TN6A 3ARTA 2ISDA 3W75A 1CGWA 2XSXA 4KWVA 3B8DA 1ISYA 3W6LA 1RQEA 1ZALA 5D8ZA 4HU4A 3BGAA 1PS9A 4PMDA 2VMFA 3BPWA 3C0JA 4E2VA 1NP2A 2ATMA 1QJWA 2BHUA 1SO4A 4ML9A 4LB4A 5CGQA 4DXKA 1XIGA 2CHOA 3MANA 2QJMA 3IEBA 3GC4A 1VFLA 3ANYA 3WK1A 4E4FA 1XH1A 5A6BD 1RUSA 3A3WA 3IJIA 3JR2A 3NEHA 4NNAA 2ZE3A 5BRQA 3NNTA 3PZ9A 1VCVA 1UC5A 4WJXA 2PWVA 4X2PA 1V3HA 1BG4A 3EWBX 1W3IA 5AOUA 3CT2A 3NVDA 2VXNA 2WCSA 2A7PA 4PMUA 2YCLB 3UG3A 2HPIA 4PB3A 2V63A 4DUXA 4GUJA 4FNSA 1VF8A 4Q4QA 4X2RA 4OZOA 3TA9A 1TYGA 1UD2A 3WK3A 1VFSA 5FOOA 3DHUA 1IV8A 4GACA 2FPYA 2CERA 3GTHA 1BYDA 4NXKA 1VC4A 2ZZ1A 4WD0A 1YXYA 3OG2A 2P1FA 4A3UA 3K4WA 1WZKA 3AU2A 1YE6A 3CAQA 4X0VA 1B4KA 3WJYA 3QR3A 3OVPA 5EY5A 2CIPA 3BW3A 4I8YA 5RUBA 4NYUA 1YPIA 2CHNA 1W1YA 1UP3A 3BV4A 3A6OA 2XN1A 3SFKA 3H2NA 4WKHA 1FQ0A 2QR6A 1OFDA 2ZXDA 5DX7A 2DIEA 1UIOA 2GSEA 2ZX6A 2JEQA 5K4ZA 3WMSA 1B3ZA 4RPQA 3BOLA 1ME8A 3UXAA 3WUBA 2C1HA 3BICA 3F4NA 3I65A 2Y4SA 4QR6A 3VE9A 1DJZA 1GVOA 3DECA 3G0XA 4IGHA 1S3HA 3EA3A 4L80A 3FNDA 3P7YA 1NEYA 2OYMA 4ADTA 3MB9A 4X63A 3TMLA 2XGZA 4IQJA 5E70A 2WC4A 2HXTA 5JBDA 4UFLA 5CZJA 3LCHA 3SAZA 3KBWA 3A4AA 3PTMA 1LBMA 1JCXA 2NQJA 4ZQPA 3QY6A 1HKKA 3GR8A 3W4RA 5C2GA 1RH9A 3JZUA 5CXPA 1NFPA 4IMEA 5G4HC 1JVNA 3NJ3A 1WZMA 2O55A 1F76A 1C90A 3UWVA 4RE0A 2E6YA 3PUDA 3PZTA 4F9DA 1OSEA 2NWRA 2WLYA 3NM1A 1K1DA 3FAXA 1GVYA 1G4TA 1WDWA 2YBUA 3WQDA 2BOGX 3SURA 1H0GA 1B2YA 4Q4OA 4REQA 1R3QA 2ON3A 1SU5A 3TSDA 3KTSA 1FDYA 2DZTA 2D0HA 4ZOBA 2VL4A 1DKWA 4JFWA 4W7VA 4MIMA 5F1UA 4W84A 3K5XA 4HN8A 4DN1A 1KA9F 3ORWA 1DQXA 5U7SA 2POTA 7PTDA 2VM8A 3ERPA 1SM9A 5HMDA 2QCLA 4IIEA 2AKZA 1C9DA 5SWUA 4JNZA 1GEQA 2YB4A 4S3JA 2WKJA 1HTIA 1N8IA 1Q6QA 1XYMA 4PRWA 1H51A 2A85A 1IR1A 3MUXA 3ONCA 4QLJA 3ITLA 3TK7A 3S4TA 4QROA 3TIMA 3SZ8A 3WLNA 2VR5A 3H54A 1D8CA 4S3DA 4B5WA 1IWBA 1QWKA 1RQBA 4KWUA 1F73A 1CZ1A 1K8CA 1J6PA 3H53A 4A3QA 1SJBA 3VIFA 1AW5A 8RUCA 4I7WA 4P61A 4MDOA 1CLXA 3IUHA 3T4CA 3I3DA 1NU5A 1N7KA 3L4TA 2ZUTA 3W3OA 1A53A 4KWWA 2VZTA 4BKNA 3WZ0E 3LSCA 2HRWA 1BQCA 5AC7A 1VYSX 2QYGA 3AXHA 4I9AA 2WWCA 3R12A 1QNPA 2ZA2A 1M3UA 1C7SA 2Q3RA 4WK9A 4XVEA 4YCPA 4TVDA 1BTCA 4F0LA 3RU6A 4HNTA 1FUYA 2F6KA 1B3WA 3LERA 1UQZA 2P88A 3KL3A 1RAKA 4GNKB 1D7KA 5BW6A 1Q6CA 3GR4A 5ABEA 1UWTA 2OGJA 4GX8A 5AKQA 1LOSA 5LIXX 1CXFA 2IPWA 4IPIA 1SFSA 4R85A 3AMKA 4LV9A 4JTQA 1EXPA 4LS2A 2CESA 3L4ZA 2PC4A 2PDLA 1YDNA 4GYPA 4GY1A 2AKMA 3P67A 3R2GA 1S38A 3LQGA 2OJPA 1M6JA 1IR2A 1F8MA 1GG0A 2QCCA 4JFUA 4MG4A 3H2AA 2WZIA 3DYOA 4DWSB 3H7UA 3CPGA 4W8LA 3VE7A 2XVKA 1M68A 1XFBA 4HVXA 2QIIA 4DWDA 1W1B1 4HJWA 4QJ3B 4NSBA 2E1DA 1RXOB 1EWEA 1VGAA 3BANA 4BA0A 1UOKA 1SJAA 5KZ6A 8CGTA 4GKLA 1W3JA 1F3EA 4LBUA 3TSMA 3B8UA 2G3JA 2PP0A 3VKDA 3KAOA 4C6JA 1DWJM 1IE7C 1XS2A 5LIYX 1QK2A 4XZLX 3QN3A 4HKPA 5JH2A 3MCMA 2JF7A 3P5ZA 2WZHA 3S6DA 1IT0A 1H7PA 2PFHA 2CXGA 1DXFA 1W54A 4JN8A 1PCWA 1AH0A 2J8FA 5T9CE 1QNQA 4S38A 3QHMA 4TTGA 2O9OA 4OE7A 1RD5A 1L2UA 4OUEA 2WHJA 2ZUVA 1TPUA 4K7YA 2VFEA 3EOSA 5ABFB 5A6SA 3IVTA 4UOZA 2G95A 3A4WA 2Z6IA 3H2MA 3QZ6A 4HA0A 5D2XA 4TXEA 1MXDA 1GOQA 5HINA 5D03A 2XVNA 1W2VA 5DCEA 1B90A 2QUTA 4FOUA 5LNWA 3P93A 3UYCA 2RKXA 3G24A 4CNSA 4ZZ9A 4FI4A 2O56A 5D2WA 3W38A 3F4VA 3G1YA 2F7FA 1Z69A 4XAPA 5H8UA 1P6CA 3VVGA 5HDRA 1W1VA 3CUXA 4IIHA 3LXAA 4TX6A 1WDDA 2D3LA 1Q66A 4DO5A 4LYKA 1XKJA 2FTPA 3URQA 5D38A 1UKOA 3NPVA 3M0YA 4RDVA 2VEKA 2O9TA 3NQEA 3NQAA 4GGBA 5IBXC 2X42A 2YXXA 1JD7A 1MI3A 2Y61A 3PTQA 2CZFA 2GGEA 1B3YA 1OD8A 3GFXA 4M56A 4LWWA 3KCJA 4AYGA 1F6PA 2DW7A 3KW3A 3PUOA 4RE3A 3AALA 4Q8UA 1EGVA 2ZDSA 3ICJA 2WANA 1PEZA 2P3EA 5HULA 1IT7A 4HZ7A 2D22A 1BVZA 1UR0A 1Z32X 2Q8LA 2PRHA 4U3CA 3BMVA 4JEQA 3W7GA 1Z41A 1EZWA 1N2VA 2GDQA 3PJTA 5I02A 2OEKA 1Q4WA 4DJFC 3ALGA 4J3WA 3GNPA 3O9NA 3GG8A 1VRDA 3LQLA 4PEEA 1NDVA 2A3AA 2XSBA 4O1AA 1TJRA 2ZZ4A 2GUUA 3MO4A 1XYAA 3EWZA 5BNKA 3WCZA 4PYSA 2VKZG 4UTTA 2QCEA 3CNYA 3VIHA 3FEQA 3BH4A 3QSRA 4G7EB 4P8XA 3AICA 1YBQA 3HURA 4ORMA 1UP2A 2FTWA 3B04A 2R8WA 1DYSA 5E5CA 1CDGA 4CQDA 4BI7A 1J4EA 5TD4A 2C16A 4O19A 3U4FA 3AIVA 4LYPA 2XJ7A 4HA4A 3UEQA 3VDBA 3QMRA 1FWGC 3WLLA 2Q8ZA 5EMLA 2BXYA 4LAZA 4C6DA 5DMNA 1R7OA 4HHPA 1JCYA 2OSYA 4OOZA 5H8PA 3RXZA 3MTWA 3HGRA 3VTRA 1EGZA 2DVTA 4GYPC 3GHRA 4YTUA 4LVAA 3CV2A 3FSTA 2WAGA 2FLIA 3BW4A 3KFTA 2SFPA 1EDQA 3CUIA 1C7TA 4EPEC 2VWSA 4QS5A 3W6MA 1X7IA 3RCMA 5BMXA 2QT3A 4S3KA 3W87A 3TJIA 4A2RA 3SN1A 3QLLA 2V82A 3U48A 3EA1A 1VEMA 3GHUA 3UWZA 3PAJA 2P10A 1V3MA 4HYRA 1EQPA 2QCGA 1XUZA 3V3WA 2BXVA 3W1TA 1NP0A 2QCHA 3M7WA 3T4WA 3LXBA 1A5KC 3WN6A 1RBLA 3NG3A 1JCTA 1JDFA 4OFCA 5CSRA 4IIDA 3OBAA 4NU7A 3B9EA 1TPB1 3AHTA 2PDMA 2HBVA 4HTYA 3CEPA 4GD0A 5DCDA 1DWIM 3OU8A 1SMAA 3SCPA 3CV1A 2OMAA 3VOCA 1NELA 6CGTA 1TCDA 3W1RA 5AHFA 2UBPC 3OQEA 1CX9A 2INZA 4L4LA 1ITUA 1EOMA 3AIUA 1EFZA 3I6RA 1H09A 3LK6A 1S5MA 1EL3A 1NF0A 5IHSA 3AFBA 3DKJA 1ITXA 2WB5A 1TV2A 2VWTA 4PTWA 4YLWA 3W2JA 5LNVA 3DFYA 1YTDA 4JY8A 3WYZA 1E4LA 3RR4A 2E5DA 4HHMA 2W63A 1HP4A 2HNHA 3SN4A 4C1NB 2PODA 3N2TA 2ICSA 4ADUA 5EMYA 3VGGA 5F2GA 1F61A 3THAA 3KOZA 4WUIA 1OJXA 4CVUA 3TW6A 3DYMA 1JPMA 1EJTC 1LG1A 4K68A 1JFXA 6TIMA 4INFA 5C9UA 2PC8A 3CLMA 1LLOA 3GNXA 3WJSA 3EGJA 4W89A 3DFTA 1S3TC 1V8EA 1LRTA 3E1F1 2RJHA 5HQLA 2YYTA 3TYDA 2GSJA 4I3GA 3BO9A 4EX4A 4E4UA 4RCXA 1L8NA 2J7BA 1ZAJA 5EB8A 2OWCA 2CEQA 3NZ1A 5FIPA 4TOQA 3T1GA 1X6UA 4N02A 1GK8A 3VCNA 1SR9A 3TDFA 3CPRA 2CLOA 3LBCA 1KCXA 2X7WA 2PP1A 5FEZA 4JTDA 2JKEA 3W23A 1TJ2A 3N29A 3WQOA 1TWZA 3UWUA 2P8BA 3CWHA 1Y0EA 4B9YA 1RQHA 6A3HA 4XZWA 3DN5A 1Q6DA 3M0IA 5FAGA 3MUAA 1AZ2A 4HYVA 3R8GA 3EDFA 3UVAA 1AW1A 2Y88A 3ARVA 3LU2A 3S47A 4UQBA 5I7GA 1KM0A 4U31A 3KBJA 4DI9A 3MDUA 3LG3A 3OHMB 4EIVA 1MO0A 1SZEA 2J7GA 1CGXA 3BW2A 2GVGA 4Q7NA 2BSLA 1IF2A 3VDGA 4GQ0A 2D24A 3PBWA 4NASA 3PUEA 4RZ4A 4WOQA 2DIKA 3W1UA 1O7AA 3GO2A 4AWEA 3GVVA 1HL2A 1OINA 2X7VA 3VFCA 1MXGA 2DT0A 5K2ZA 3DC8A 4YTRA 4UNIA 2WMHA 4WVXA 4B2DA 5DEZA 1E6XM 1K70A 3GH5A 4US5D 4EXQA 3PWGA 1M03A 4XIAA 4WDUA 3MUY1 3NQVA 2ZOXA 4J4KA 1XKYA 3W24A 3CB8A 3BC9A 3TX9A 3LY0A 4TR9A 4O4WA 2BTMA 3EX6A 1EBHA 5DMYA 4E0CA 4E4PA 5CAHA 4UR9A 4FOKA 4F0RA 4DM1A 4PA8A 5C2XA 3B9OA 1Y7VA 4L9YA 5AN7A 4Z1AA 4DF1A 4GNVA 5H1WA 3UZYA 1KC7A 1FCUA 4F66A 5D04C 3Q65A 1XWYA 4MWAC 2Z2AA 2V3GA 2G97A 5DRCA 5HQEA 4XBJA 2O9RA 4RDYA 2BP1A 4PR4A 3NUKA 2DU2A 4WZHA 3TJLA 2VTFA 1XG4A 3ABSA 4DHGA 4M1BA 4UMAA 3TLLA 1GVEA 4B9ZA 1TR1A 3KVMA 4PFHA 3W2NA 2OKOA 2J25A 3BCJA 1EOKA 1NWTA 3H2CA 3T0AA 1FDZA 1SFLA 3V0SA 2ZTKA 2O9PA 4Q8MA 6ALDA 4EPDC 2XWDA 3W1QA 3OW1A 4K38A 4LVBA 1OGSA 2QW5A 5DY3A 2WVUA 4LH8A 1A5OC 2QVNA 3U5UA 3F4DA 4AWUA 4RR4A 4NX0A 3B8IA 4AC7C 1B0IA 3FYYA 3VNZA 1QK0A 4NZFA 5C54A 1GTHA 3E5BA 5H6HA 1ZS2A 3M0KA 3M0VA 4L1GA 3QQ1A 3QBUA 3VGDA 1R2SA 2FZMA 2YL5A 3VYLA 2ACSA 2GVEA 3I4KA 2PAJA 2GJNA 3L4YA 4R27A 1LBLA 1ZLPA 4IJCA 1G1YA 4FSAA 1IIGA 3CWOX 3TQPA 3EB4A 3LD5A 3HPAA 1TMQA 4MKNA 3BLDA 4DYEA 4E8DA 1ZJHA 1W91A 1P1XA 2XH7A 2R9RA 1MW3A 4US6A 2WLZA 4MADA 3SJNA 1UR3M 2CLFA 4JICA 4OECA 3VUSA 3WLHA 4DUOA 3TYUA 3GQYA 3CZKA 3W7NA 1DVJA 4FX7A 1JRCA 5HWMA 3N18A 3ENLA 3DDMA 3G1SA 2EJ1A 4D6EA 1WV2A 5C7HA 2DEPA 5D2TA 2YDSA 1UPPA 7REQA 4KW2A 3IK2A 1QI2A 3WNMA 4OTKA 3EPOA 5D9NA 2C91A 3V4BA 3AMDA 3W76A 1PPIA 4WY0F 3PNUA 1HKWA 2EG7A 3CB3A 3OIHA 4JKKA 3WLSA 3SCNA 3T42A 1DJYA 3EMQA 3W1XA 4EKJA 1UKQA 3VNYA 3VD5A 1A0DA 1ONRA 3LMZA 3DG6A 4NY2A 1I2QA 1I2OA 2PDXA 2D2JA 1F4AA 4E3VA 1XSJA 2WNNA 2X30A 3MMUA 3R8RA 1K3UA 2X8RA 4S3BA 5C55A 2EPOA 4H19A 1L9WA 1Q7ZA 2TODA 2D2GA 4YMZA 4BF5A 3N34A 2X2GA 4JHZA 5T91A 2CKRA 4G9PA 2G3NA 1MXSA 1AFSA 1M7JA 3K8LA 1UH2A 2ZX5A 4O1BA 1R5YA 4KGLA 1PDZA 3TTOA 1ZJIA 2A6LA 3N6HA 4H6KA 3BLOA 1E73M 1YPXA 2YLLA 2B7QA 5C70A 1A5MC 3CZGA 3SSJA 1TJPA 3HG3A 1POJA 4EK7A 1XLAA 3K4DA 2VR2A 1ZPTA 3LM7A 4Z17A 1J01A 4HHLA 4M7TA 2ZFAA 2FJKA 5T9BG 3M5XA 5G4WA 2I14A 2W66A 2OTDA 5M5DA 3GDRA 4XISA 1EQCA 1G9HA 3GXIA 2JKAA 6ENLA 4NF7A 4FA3A 1BWLA 3BLEA 3RRAA 5IDZA 1HJXA 4GUGA 2QJNA 2YCJA 3RLHA 3M6DA 4A2SA 1EH9A 4PBGA 3WIJA 2HCVA 3A23A 3PWAA 4LAOA 3MBDA 3P6LA 1QPKA 2DV0A 1GJUA 3KRBA 3P3BA 3C2FA 5FD0A 2YR1A 5IFTA 1G4SA 4O16A 3W29A 4KEZA 4DAFA 5K9CA 3V1PA 4HYWA 4S3EA 2WPGA 2PGEA 2XN0A 1L8PA 2ZBTA 1SMDA 4QISA 4EXBA 4QIUA 1CXHA 2OEJA 1XIHA 1R0MA 2HE8A 1CWYA 3WH5A 2TMDA 3T2PA 1R3YA 3G3DA 3W7IA 3PPHA 3NYDA 4O15A 4PEKA 2INFA 3ITOA 9XIMA 5FSEC 4Y9AA 2H90A 2GGJA 3QYSA 2OOGA 2ABBA 3ANVA 5F4XA 2JEPA 4DJFA 3WF1A 4MNKA 4QXIA 3NL6A 4M1RA 2FZDA 1JDAA 5AYIA 2WMJA 5FJPA 4D2JA 3ONBA 1Y65A 3XINA 3W7QA 5DRIA 3UPWA 4ZL1A 3KL5A 4E5TA 4DRSA 3D6NA 1TFVA 1LG2A 4AFYA 1UJQA 4JBRA 1UBSA 1CGVA 4J3UA 4C91A 4J27A 5GJMA 4B5TA 1KBKA 3B0YA 4C6CA 2PLMA 3IJ6A 1PZ2A 4CCEA 4IQLA 2Y7DA 3AS1A 4IL2A 2F38A 1QNVA 2D73A 5EL1A 1K9EA 1JI1A 3G8EA 4N9DA 2WHKA 3AHYA 1WX0A 3N2XA 3NL3A 1C8VA 1W1TA 4RZ5A 1DIKA 1L6YA 4GXMA 5ABTA 3A22A 4RPPA 4DZ5A 4JHOA 5E09A 3W71A 4V33A 2E9LA 2WK2A 4YTQA 1W1ZA 3SUVA 2QJHA 4LF1A 2V0TA 1GOOA 5G1MA 2PRMA 4G6CA 2PA6A 5C71A 1ISVA 4NJIA 4IQDA 1C8XA 2J24A 1ZAHA 2OX4A 4F2BA 2D3NA 1OC7A 2XZ7A 4HQVA 3VZZA 4AC1X 3UNDA 2CHRA 3FXYA 1PZ3A 3B9AA 1KXVA 1MW2A 3C5QA 1JQXA 2VC9A 1EYEA 3CTLA 4HPJA 2J75A 4ACZA 5FL1A 3PFMA 4PMQA 5BXTA 2IXVA 2O4MA 3BK0A 4ZQRA 1XGDA 2BB0A 3D3AA 2ZXAA 3S2CA 2NWSA 2VJXA 1PIIA 1ZZMA 5A2BA 3CQIA 2FVMA 3TYBA 1IZCA 5A2AA 2PF0A 3KXQA 3P61A 2PCEA 2QAFA 3QOKA 2VGBA 1RCXB 2XUCA 3OLDA 3O8AA 1L6FA 4S3FA 4OBSA 4C7GA 4KF1A 2VENA 1XFCA 3ZJ7A 4MLRA 4RE4A 3VU2A 1KB3A 3KE0A 4AVOA 1NSJA 4FXRA 2CWNA 3OGSA 1MEWA 1G4EA 1Y5VA 4GX9A 2QDDA 4IFKA 2VEIA 2PDKA 3UD6A 5A6BA 3DGRA 1NOWA 5HNTA 4GIAA 4IL0A 3KTCA 1JUBA 3L4WA 1UB3A 1UUMA 3LBMA 3SUSA 3NQGA 3SECA 2C13A 3GNRA 3WLIA 1W3NA 1VH7A 4B91A 1YTKA 3PR2A 2YFNA 3O16A 4FNUA 3TA6A 1QI0A 4CQ8A 2BASA 4NVTA 1V6WA 4LXFA 2WBGA 2HS6A 3FHQA 1KQYA 2NX1A 3OHIA 3CUFA 3SRDA 1QI3A 3NEVA 2ZTJA 1PO9A 2FZ8A 3JZEA 4LUSA 1TUXA 1GVIA 4G2DA 3SIMA 1TIMA 3AJ7A 1R9XA 1THFD 1E5JA 3OA5A 1RBOB 4CQBA 3CUHA 3KX6A 3B0XA 2WZEA 3SDOA 4Q4PA 2QQ6A 1TQJA 5EBUA 4KEUA 3UWEA 3OQ8A 5DANA 4Z0SA 1T0OA 4UXDA 1H3GA 4A8IA 1XYLA 4JTIA 3OIXA 3CHFA 3CQ0A 1VPYA 4GWEA 1HNYA 2OO0A 4QX4A 4AVNA 4TO8A 2ZUNA 3E96A 1VJIA 4YIWA 1HP5A 4I5UA 4XTIA 1OABA 2E6DA 1HKMA 1I4NA 4DXVA 3AQUA 1GHSA 1XIFA 1OHLA 4OU1A 4C6IA 3BXWA 1U1JA 4FLQA 4EVZA 3G6LA 4JX4A 4TU1A 1XYBA 1XUUA 5E9XA 3NXLA 4U2YA 2ZCGA 4NZ4A 3DFSA 1XBYA 2ONEA 2UY5A 4UTLA 1CXLA 4B3LA 2WNZA 1DWGM 4KMQA 4Y6GA 3TONA 1V7YA 1XYCA 2ATSA 3S5NA 3DHPA 2ZZ6A 3ITVA 5FEPA 5I3IA 4IX0A 2FVKA 1JZ5A 3EMZA 1EJ7L 4QEEA 4UMBA 1JFHA 3UJ2A 3WUEA 2NUWA 4YNGA 4JCMA 1A5UA 5AHEA 4B3KA 2XINA 4UFMA 1GW9A 3CYJA 1EWDA 3KP0A 2FHBA 3GDLA 4BQ4A 4I5XA 4WY0A 2W67A 2CZVA 3AHXA 1J0JA 4R33A 4YVPA 3ZR6A 5BU9A 4LRSA 1J11A 2OGYA 4W4QA 2Z00A 4NX5A 4Y9NA 2V3DA 3VOJA 2CYGA 4MLJA 1F3WA 2DIJA 3MUIA 3CJPA 4HPNA 4Q8QA 4BZYA 1AMKA 3N15A 1L6SA 3LTSA 3Q67A 2CU0A 5I3KA 4NI8A 2Y6ZA 3AWOA 3E2VA 3WF3A 4GKTA 1AMYA 1QNOA 6REQA 2CFFA 2IW0A 1QWGA 3GFZA 4NZ3A 4L64A 5C5YA 1GVQA 4MF4A 2V69A 3Q37A 7XIMA 4O10A 2TSYA 1ESWA 3UXLA 1FCBA 4A8NA 3WQEA 3VA8A 1E6NA 4ZBCA 5A94A 3BGGA 1Z8AA 4Z1YA 5JMUA 1IYXA 3HPXA 3W81A 4IIBA 1PX3A 2V3FA 4UTHA 4AIEA 1WO2A 1WDSA 1RP9A 2XIMA 2I56A 2CCRA 4ZR8A 1JG9A 2R94A 4CNTA 4CD8A 3H23A 1EC9A 2C1GA 2ZUUA 4UFIA 3GVWA 2BS9A 4HNLA 4WEVX 3THDA 1OEPA 1BGGA 3ITTA 4LC6A 4AWSA 3QMSA 1NM9A 3W7PA 3PTDA 3PBVA 2VNCA 2WO5A 3CAWA 3L4VA 2QPSA 1S2WA 1W9VA 4NRSA 1S5WA 4JTSA 1KXQA 1G5AA 3N2CA 4XSLA 3G1RA 1SJDA 3TLQA 1J5SA 1O1ZA 2ZX8A 1UH3A 2BY3A 4B16A 1VFMA 2XVPA 2XFWA 3WK0A 4W7WA 4AEOA 1XIJA 2DDXA 3N4AA 1W5NA 3UWYA 3TUUA 4U3AA 3AS3A 1A80A 3WDHA 3RCNA 2CBIA 5A6MA 4XBSA 1ECQA 2QDGA 1FVPA 2J79A 4GBDA 5CJ5A 1VFTA 2NX9A 3MMTA 1ZBWA 4CD5A 1J12A 3IJDA 2YXGA 2J78A 4M7SA 1O12A 4Q4RA 2ACUA 2GUYA 1LWHA 4A3RA 4R34A 1V5XA 3EA2A 3ZXWA 1VEOA 2E9BA 2V67A 3CHDA 3GK0A 4NJKA 3N4EA 4CEXC 3A9IA 2E7FA 1TRDA 1UWUA 3M1ZA 4DZIA 1F3TA 5IHRA 1CW2A 1GZ1A 1EIBA 3TKFA 1HW6A 5DFAA 3WD4A 3FN9A 3BAJA 1FDJA 2YL9A 1R86A 3M0ZA 1XD0A 3MCNA 3V7PA 3VILA 4O53A 1QRQA 3PS7A 1KRAC 3AO0A 4YYCA 3W72A 3CK5A 1MW1A 4JYFA 3CMJA 2MNRA 5EMUA 3B9NA 1UKSA 2CLLA 2XU2A 4H7CA 3U3HA 1LLZA 3W1LA 3QMTA 2ZZ3A 4K3ZA 4ORIA 2INEA 2WJZA 2ZZ7A 5I03A 2D2OA 1OX4A 1R2TA 4J1OA 1XC4A 3KOXA 4JTGA 3NO5A 4GIRA 2C18A 1CLVA 4HU3A 4R7JA 5AHNA 1FP8A 1GGOA 5HWNA 5C2CA 2OYKA 3SFWA 1YXCA 2VVSA 3RM8A 4AZ7A 4IMFA 5AYZA 3HN3A 5H91A 4JN7A 4DNMA 1W9DM 3OYXA 3FXGA 4XZNX 1U33A 4I9MA 2OT1A 2QPUA 3POCA 5KMYA 3OLEA 5BROA 4IMCA 3TAKA 3M5YA 4A6GA 1XLCA 3GAYA 4GXPA 3NGJA 3B8WA 2I5QA 4G7FA 1RY0A 4W7UA 3AXIA 2JFEX 4N9EA 3RNDA 3VNMA 1KKOA 5JIPA 3MA8A 1OK4A 1TTJA 3Q94A 3H8AA 5A95A 4DYJA 5CZKA 4AEFA 1GOMA 4Z2HA 3GBDA 4H8VA 1YBQB 4L9XA 4LTSA 2Y63A 2LLEA 4H2CA 3VOIA 3RILA 2NLIA 3I7RA 2W27A 1KWKA 1WQ5A 3M4HA 3UCQA 4C65A 3SCTA 2XIQA 4HD5A 4LEQA 3W22A 4DO7A 5BOEA 2RUSA 4WJEA 1J96A 2Z1VA 1EJWC 1BRLB 3ARPA 3U8GA 4ML4A 2C15A 3AHZA 2YB1A 1I2PA 3DG3A 1E70M 3IUIA 1TPVA 3CV6A 2ZRUA 5LNRA 2PP3A 5D4YA 4O0ZA 3H6OA 3GNOA 2QJIA 3S5SA 3M0JA 3MP3A 2YDQA 4PODA 3WD2A 3F03K 3KZPA 1K9FA 4WRHA 3F2DA 2PDQA 1QFEA 4US5A 3LHUA 1IEQA 1RA5A 1BKSA 4MGGA 1KO0A 4DQWA 4M8UA 5KITA 1MQPA 4AX6A 1ISZA 4H7ZA 1A0CA 4O1DA 4GZIA 2HK1A 2V5JA 4LY4A 3M5VA 1WXZA 3VX0A 1K7EA 4HPXA 4Y8EA 3XIMA 3KVKA 3LRLA 3N73A 1SFJA 4GLEA 2WMIA 1X6NA 2IXUA 4EWJA 4JIEA 5DT5A 2DUZA 3VIMA 4U33A 3FIGA 1ITCA 1W0MA 2VD9A 1H5YA 3VI2A 4WGHA 4P7LA 3T2OA 4GQQA 4PTXA 4O4VA 1LWJA 4H6QA 4IM4A 1WBJA 3PN8A 3UY7A 7CGTA 1W9UA 3NDYA 2Z26A 3ZWSA 2V2CA 1SO3A 2FVLA 1IZKA 4QAIA 3ABQA 2I5GA 3VDHA 3WLJA 3IIPA 3IJ8A 1LTDA 4JNMA 4NXSA 4O1FA 1XPYA 2QUMA 5LZLA 3MP4A 1Y8BA 4W9TA 3HFTA 3QY7A 4PBEA 4DWSD 3T07A 1P0NA 1BGAA 3QPYA 1VENA 3S0CA 4HK5A 1SQ7A 1QVBA 3UG8A 3WK2A 3UA4A 1BG9A 4EWND 2QPXA 4I9JA 3UU0A 4GY0A 5BCAA 3IRDA 5BRBA 4RXGA 3L4XA 4PSPA 4U4MA 3ARWA 4M6PA 3P80A 2I16A 1J0HA 1AJ0A 1O60A 1M7PA 4C6LA 4U2ZA 1IWAA 1E72M 3RUBL 3WNOA 1JZ3A 3ALFA 1XGZA 2TRSA 3RM4A 1FY6A 1O4UA 2PTYA 3URAA 3RCYA 1CGTA 1KTNA 1O5RA 2FIQA 4HP5A 1C91A 1J6OA 4JTAA 3WFZA 2OPJA 3GU2A 2W61A 5EYWA 2ZUSA 5HK4A 2BGQA 4GVHA 3QW4B 3UXIA 3PANA 5CJMA 1XH0A 3UY8A 3ABRA 1KBBA 1SZNA 4GYKA 5C9WA 1CGYA 4EXAA 5AYXA 3AOFA 4Y96A 4N9CA 3VD4A 3VMPA 5LA2A 3TYAA 1OD0A 1PHQA 3CIWA 4LPCA 2XDFA 3T44A 2F61A 4KFPA 4ZCWA 1YEYA 4J9JA 1MW0A 2R91A 4H6RA 1DORA 3H4XA 1WOBA 1W8SA 1FWIC 2PDWA 3ZVIA 1H7WA 3NA8A 1MEHA 2C7FA 1SO6A 4OHQA 4KCTA 3PVFA 2JIEA 1H7RA 5I23A 4MNMA 1GKRA 3FKKA 1W3LA 3S1GA 6PTDA 4XZIA 1ZCOA 3R0DA 3ELFA 4V15A 4EPBC 4C6OA 2YYUA 4WDWA 4EAMA 1VHNA 3PTKA 4KWOA 2Y2WA 3TAOA 3FKRA 3T05A 1S5VA 4FHAA 5GQBA 3RX3A 5D30A 2JIWA 1S2UA 2GJXA 5CC6A 1A5CA 4C6NA 1OGBA 2DZUA 1DQUA 2MANA 3L68A 1ZHAA 3OLGA 3MI2A 2J74A 2WSKA 2XVGA 2YSWA 3SCWA 2X1RA 4W5UA 3CL8A 2XVLA 4FF5A 3Q58A 1OC6A 3UR5A 1JF5A 4PUNA 5HPCA 2ZRZA 4AVFA 4ZB5A 2G5WA 4BWLC 1P7TA 3WUFA 4C6PA 4PCTA 4GGHA 1OADA 3CU2A 4U10A 2WYSA 3WDRA 3EDJA 4QAWA 1ELSA 1E1FA 3DU0A 1JF6A 3MJMA 4F2UA 1E6SM 1E4MM 4PMVA 3I6EA 4J3SA 4JL2A 4D6JA 2PLJA 1EA0A 4RW5A 4A4AA 4MKSA 3AIQA 3LS9A 4HOZA 2VO5A 1I9CB 3BDKA 1OG6A 4IMAA 4KERA 1H2JA 5EBAA 1MDRA 1P0BA 4IX2A 1E3ZA 1WDPA 4P2VA 1CXKA 3R25A 1UD8A 4CNPA 3W7HA 2QNEA 3OB8A 3T8QA 3BV7A 1GVSA 3BCFA 4S2BA 1LL7A 1UH4A 4LS0A 4JKLA 1UA3A 3O6CA 5TNVA 4ZSUA 2FMNA 5HAOA 3VKBA 3KZSA 9XIAA 4WDXA 3EX1A 4PMZA 3RLGA 4FK9A 9RUBA 2VRJA 2RHGA 5JUVA 5LYRA 2I57A 1XH2A 3W7LA 2P0OA 1A3WA 3SCOA 4HJFA 2VC7A 1P48A 3B8TA 2FKPA 1ZNNA 3ZOAA 3BZGA 5CC7A 1NY1A 3JU2A 3WD0A 1GPFA 2ZRWA 4DPQA 3CHEA 4KRZA 5LIUX 5IXEA 1OFBA 1T41A 3VIOA 4Q6JA 2Y0FA 5K4XA 1TE6A 3R1ZA 4CCZA 1KFCA 2CZDA 4GZ7A 2A3BA 3P8JA 4LB3A 1G01A 1XICA 3BSMA 3PZUA 1E15A 1RZMA 4D8AA 5AC5A 4V2XA 5BXPA 3BAYA 3GC2A 3O1NA 3PBYA 2NSOA 3LHVA 4YWIA 2DPEA 4BY3A 1S5NA 1JUEA 4F4RA 4H3DA 2NQZA 1XGEA 5F1VA 1T7LA 4AY8A 1VCFA 3TYEA 1UPMB 4Q8PA 1JZ6A 2VRKA 7REQB 2Z1SA 3T81A 2QZRA 4P8UA 3VNKA 5D09A 3QC3A 3L65A 3G1FA 8A3HA 2DY3A 2WSYA 3S6TA 5EFFA 3MBFA 3D5HA 1BD0A 1PKLA 2WSPA 1V08A 1ECEA 1E0TA 2YKKA 4KFOA 1IXQA 2PDHA 2NV2A 3LHTA 3UF9A 4DB7A 1DJQA 5MF5A 1GYLA 2VVNA 1KCZA 4HK6A 1NJJA 2W4XA 3IVSA 1AG1O 3NL2A 2DH2A 4AIOA 2XIOA 4IMGA 4XAYA 1UKPA 3KRZA 3DHFA 4Q32A 4D6CA 3W83A 5A6AA 1FWEC 4XSMA 4E2BA 1AL7A 3IJ9A 1UP0A 3LDVA 5ABGA 1IT8A 3PZQA 3QFWA 4HMDA 1QOXA 4GQRA 5HJLA 3COTA 4ASTA 4F0HA 2A3CA 1FOBA 1ODUA 4ZO9A 3W88A 3MHGA 1Q8AA 1OG0A 4H8HA 1XLHA 2V5KA 2HVMA 2C71A 4ATWA 5JBEA 2X40A 2C14A 2V5CA 4GCAA 1L2QA 3PPGA 5BZAA 5JXQA 1VJZA 4F0SA 2C8NA 2Y8VA 2FDSA 2J7DA 1HF6A 3UYIA 3QPEA 4UFKA 4PGLA 3HGSA 8XIMA 5HJXA 2EBNA 4C6KA 3HG5A 3QJAA 1OFAA 3VNJA 5I06A 5KEZA 1V0KA 1QPQA 1VYRA 2ZUWA 4NP7A 4AD3A 2YX0A 3O6AA 2R14A 3J7HA 4UCGA 1PTGA 3WH8A 1O5XA 4BQ5A 2E6FA 3GUWA 3NIYA 4JFSA 1W8GA 1E9LA 5JIWA 4IGMA 5D02A 4B90A 2PMQA 2V5LA 3ZS4A 3LPGA 4B15A 1K02A 2BMBA 1J79A 4MYAA 5DY2A 3GXFA 3VCCA 2BY0A 1XDLA 2HDJA 2VQUA 2E28A 1E56A 2HWGA 3BUVA 3E9AA 4IXXA 2VX5A 2HEJA 4DJDA 3N2MA 2HXUA 1CNVA 2WC3A 1GOKA 4DBUA 5FKYA 4H9VA 2PDCA 3C6CA 3LZ5A 1B3OA 3CUJA 3SRKA 1GHRA 4IP7A 3FGCB 5H8MA 2F2HA 3CTTA 4RNHA 2OG9A 1BYAA 4I7UA 2NLYA 3FCPA 1P5BA