2WAGA

The structure of a family 25 glycosyl hydrolase from bacillus anthracis.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
217
Chain Sequence
GSSHHHHHHMDRYEIKGVDVASYQGDIDWRELEKQNMKFAFIKATEGSAFVDKYFSKNWTNANKTSMRVGAYHFFSFDSKGETQAEQFIRNVPKYKQALPPVIDVEFYANKKDNPPKREDVTKELSVMIEMLEKHYGKKVILYATQEAYDLYIKDAYPQCDIWIRSVLTKPSLSDERKWTFWQYTNRGKLSGYNGKEKYIDLNVFYGNEEEFENYGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Family Gh25 Lysozyme from Bacillus Anthracis Implies a Neighboring-Group Catalytic Mechanism with Retention of Anomeric Configuration
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
molecule keywords LYSOZYME, PUTATIVE
total genus 77
structure length 217
sequence length 217
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wagA00
4AWEA 2GSJA 1VIWA 3AZSA 5A95A 4RE4A 2TAAA 3OLIA 2VX6A 1C8QA 1EDTA 2XVPA 3WQ4A 1SFSA 4HU8A 8A3HA 4GINA 3THDA 3OG2A 5A69A 3SIMA 1D7FA 3VDBA 1DWGM 3N1AA 2VZUA 1W1YA 5A94A 3I3DA 3W53A 4TOQA 1HT6A 4MAVA 3FAXA 1EQCA 4XB3A 3ECQA 4MB5A 3L2MA 4PTWA 4D71A 5ABFB 1JD9A 2BHZA 5E0FA 4Z2LA 1NOFA 2WANA 5E0CA 5GPRA 2EEXA 3WN6A 3PZQA 4TXEA 1ITCA 2ZUNA 2W91A 4UZSA 3UEQA 4DWSC 4BA0A 4MB4A 2JF7A 4EKJA 1ZU8A 2Y5EA 4E2OA 4UOQA 1WPCA 1NP0A 3CUGA 3TONA 2EJ1A 3SCPA 2YDRA 3BMVA 4UNIA 1C8XA 3RM4A 4S3JA 3GDBA 1UD8A 4AD1A 3ZT6A 1B90A 1JZ7A 1CGVA 1JZ6A 1OIFA 4PTVA 2WNWA 4MB1A 4D6IA 3T08A 3O2LA 3WKZA 1HJSA 2W92A 4CVWA 1J0IA 5EBAA 4W86A 3AROA 2GJPA 4PMQA 3GYCA 1FFQA 3VGDA 1NQ6A 1HJVA 3AIWA 1EGZA 5I23A 4U2ZA 4PMUA 1M03A 1XH0A 3VD4A 3ALGA 4OBSA 5GNXA 3KL3A 3UG5A 1QI4A 2WSKA 5FL0A 4AYSA 4GZEA 4JKMA 2X1IA 3WY1A 1GZJA 2RGLA 2VR5A 3VINA 5A6LA 5I2UA 2IXUA 4S3KA 2OWXA 4PEEA 4P7NA 4U3AA 4D6GA 2DT1A 1UKOA 1JD7A 2JALA 2G3JA 2OSXA 2GDUA 1MFUA 2YLLA 2BXZA 4RE3A 5IHSA 3MMDA 4WKHA 1WDSA 2JIWA 4DM1A 1C7TA 2ZWYA 4CD6A 4A3YA 4L4OA 3GH7A 2WVVA 1R7OA 2QHAA 3ZSSA 4OKDA 3SCQA 1H49A 3OGVA 1LG2A 1MW0A 3CGTA 3B9EA 1CNVA 5CLWA 1OGBA 5HPCA 1CXIA 2GVYA 5CGMA 1BYAA 4C7FA 5KZ6A 1SMDA 1VFOA 1KWKA 2VTFA 3GBEA 1YHTA 3ZM8A 3ARZA 3AIVA 2OWCA 3J7HA 4M80A 4H7VA 4JFWA 3BMWA 1UQYA 2D0GA 2O9OA 1C90A 4PMDA 2EPKX 1JYVA 1TZ7A 3CHEA 1GONA 1KQZA 1E6QM 2V5DA 2E4TA 4U5KA 1WP6A 3PZVA 1GQLA 1B31A 1GOMA 3SURA 2QV4A 1B2YA 2UY4A 4PMRA 3WQ8A 2V5CA 1OT2A 5AC5A 2WK2A 5ABFA 4Z2GA 3VD5A 2WMIB 3BAWA 3AXXA 2GK1A 3FXYA 2DIEA 1TA3A 3L4YA 1W9PA 4HA1A 4WKFA 3WNLA 4JHOA 2YL5A 4ZXLA 1CLXA 2NT0A 1L8NA 2G4FA 2VRJA 1MFVA 3GTNA 3BAIA 1H0GA 4JCMA 2CITA 1ZJBA 1DHKA 2FGLA 3WBEA 1TA3B 4IPLA 4EE9A 5A8NA 1KR1A 1UWUA 1PPIA 4MNMA 1QNOA 1EA9C 1GQKA 1E0VA 1HP4A 4CU6A 1D3CA 1OWQA 1I1WA 1VEPA 3WQVA 2E8ZA 1BYBA 1NWRA 3IJ7A 4MAZA 1BVNP 3CPUA 4AEEA 3WEOA 5JIPA 1CENA 1JIBA 2DSZA 2WMHA 5KEZA 2ZUUA 1E1EA 2VC9A 3BGAA 3AS3A 3RM9A 4HZ7A 1G9HA 3QR3A 1CGYA 2VURA 3THCA 4PYSA 1QW9A 2J7FA 2J4GA 3WQ6A 1VJZA 3L4VA 3RIKA 4GXPA 2XVNA 4H41A 4M29A 3VPLA 4AZGA 4HZ8A 2ZUVA 2IXVA 1HKIA 2WC4A 1UR9A 1E3XA 3T0DA 4LGXA 2BY0A 1DEDA 1MYRA 3WF1A 1VFUA 4AD3A 5A6JA 1ZBCA 1J01A 1BG4A 4H8UA 3L4TA 3SUSA 1VENA 1QVBA 1XSIA 2C7FA 1V0LA 3L4UA 4AIUA 4UQ9A 2VUYA 2A3HA 3N15A 5BXTA 2ZX7A 1CXHA 2F2HA 1JZ8A 3EDKA 3EMQA 1G1YA 3CUJA 1UHVA 4GKLA 1UD3A 3CMJA 2J25A 1JXJA 1H1NA 1VEOA 3AMLA 3VDAA 1XYFA 1Q4NX 3QGVA 3ZIZA 4DWSA 2CCRA 4DUVA 4D72A 3CO4A 1Q6DA 2CBVA 1V02A 5FD0A 3UCQA 3VMPA 4JCLA 1Q6GA 4U33A 1BPLB 2DDXA 1MVYA 5BXPA 3PZIA 3SCVA 3HJEA 3NSXA 1NWTA 3W29A 2FHBA 3NIYA 4U3CA 2J62A 5E6YA 2DH3A 3MANA 1ZBWA 2J7GA 3BXWA 3WDRA 1LL6A 3FN9A 4WJXA 1VFFA 3WNNA 1FH9A 1V0KA 1TE1A 1C91A 3M6DA 1UR8A 2J7BA 4E8CA 3ARUA 1ESWA 3BAXA 4JIEA 5GNZA 3VIMA 4IUGA 3PZUA 4F9DA 1QI3A 1J0JA 4LX4A 3F5KA 1EHNA 1W9BM 2CBUA 4QLLA 1CGUA 3RCNA 4W7VA 1DTUA 1BVZA 4PMVA 3ARXA 4WLCA 2WWDA 3DHUA 2W61A 5M3WA 3VIHA 1OM0A 2CIPA 4JL1A 5IXEA 2QMKA 1E73M 5I0DA 1WDRA 7CGTA 1PX8A 2D23A 3I3BA 1UH3A 4YPJA 3AMDA 1E3ZA 5HOSA 3MKKA 4UR9A 2O92A 2J78A 4YN5A 1WDPA 2XYLA 4ATWA 2WMGA 4XZWA 4ZFMA 4ZXOA 5BXSA 3ARPA 4QCEA 3RJXA 4NRRA 3A47A 4H8HA 4BQ3A 1JYNA 4MADA 3TA9A 1Z32X 4AD5A 1UH2A 4Z2IA 4JFTA 5LA0A 1RH9A 4W89A 1V6UA 1LWHA 5GQBA 1MQPA 2V3DA 2G8ZA 1BGGA 2ZXDA 4Q22A 1JFXA 2XTKA 4PMOA 3RJYA 1HJWA 4PN2A 3EMCA 2VR4A 2DT2A 1V3KA 4QLKA 5HPOA 1WE5A 2CHNA 3WMBA 4ZE5A 3WEZA 4W85A 3WQ5A 3PZGA 5DFAA 4PRWA 2XHYA 1J0KA 1GJUA 1XRVA 3QOKA 3EDEA 3ARYA 2DT3A 1WZKA 2DSVA 2J77A 5JIWA 2ZUSA 2E0PA 1E15A 1H2JA 3VIKA 4IM4A 5CGTA 1HF6A 2J7DA 1KGUA 2YDQA 2AOSA 4GI8A 4KWUA 5IDIA 3SUWA 4M81A 4UCFA 4UQEA 5I6SA 4JZ5A 3EYPA 1V6WA 3WEMA 1QNSA 1ZL1A 4Z2KA 3ARTA 1SMAA 1I1XA 3IJ8A 5I77A 3T09A 2A3CA 4CN6A 1UOKA 1XHGA 2J7CA 2A3BA 3OLEA 3SCWA 4TVUA 2ZX5A 1XYZA 2V3EA 3WFZA 1GVIA 1GPFA 3PBGA 1CZ1A 4GQRA 1NWUA 3G6LA 1MW1A 2X0YA 1W1VA 4FLOA 2FH6A 3I3EA 1AQ0A 5M03A 4W87A 1GCYA 3AHTA 4CD4A 4W84A 1PEZA 2DQXA 4J3UA 1E4IA 3WD4A 3FHAA 2WHJA 4YHEA 4AY1A 1JDCA 1Q6EA 1UYQA 3N18A 3AYSA 1GOOA 1ZB5A 3EMZA 2WM0A 3UESA 1CXKA 3RDKA 5E09A 3VGEA 4LXFA 1E0WA 1B30A 3UR8A 4TX8A 1E5JA 4CVUA 3AHXA 1IV8A 3W4RA 4AEFA 3K8MA 3ARWA 2Y8VA 1RP8A 2G3IA 4UQDA 3NYDA 2D24A 1MW2A 4AZ6A 1CIUA 1UD4A 1KWGA 2WB5A 3VUPA 1JG9A 4AW7A 1MXDA 2XWDA 1GUVA 1W9XA 3W81A 3GNOA 1QBAA 3AHVA 3QHMA 4EANA 5A6BA 1XD1A 2FGZA 6CGTA 4PMNA 1MQQA 1EO7A 3BLPX 3VIFA 4CD5A 1HL9A 1QHZA 1B9ZA 5M17A 1WKYA 4MNLA 1E6ZA 2BVDA 4JFSA 1O7AA 4MB3A 5CG0A 1VAHA 2CKRA 4C7DA 1ODUA 5JBEA 3ZT7A 5CPTA 5A1AA 2OYMA 3AS0A 1VBRA 4P8WA 3SCNA 2PF0A 1QNPA 1H3GA 2B31A 1OGGA 1FHDA 4NZCA 4ML4A 4UQBA 4QP0A 3AMCA 1WO2A 1GNXA 2D3LA 2E8YA 2YA1A 1UZ4A 5A8QA 4X0VA 1JF6A 2NSXA 3WUBA 3K46A 1E6SM 3O9NA 2J7HA 1UUQA 1J11A 5HNNA 2VO5A 4H8VA 2BHYA 3MU7A 4TVDA 2VZVA 3CZJA 4WIWA 1KB3A 1NM9A 1MQRA 1KBBA 3WL0A 1G94A 1W2PA 4P8UA 2D1ZA 4TUFA 2G3MA 4UTFA 1JYWA 2PB1A 3FY1A 1V03A 1HXJA 1ZS2A 4H2CA 1HJUA 4J3XA 3KL0A 4HOWA 1E71M 1E70M 1GW1A 4HPGA 4N42A 2J47A 2CESA 1C7SA 1GHSA 3T2QA 2BNJA 1CYGA 4LYRA 4DUWA 4UOJA 1E6RA 4RE2A 4TX6A 5CXPA 4CD8A 4XZBA 1EHAA 4C7GA 1NOUA 3F5JA 3GBDA 1ZBKA 3SCRA 4HOZA 2E3ZA 3MUY1 1XSJA 1JL8A 1HKKA 2MANA 3E1F1 1BFNA 2C8NA 4J3SA 3WUFA 1XV8A 4Z2JA 4QLJA 1XD0A 4UQCA 4A3HA 2ZX6A 3WH7A 1IZJA 1UQZA 4CCDA 2CETA 5D9OA 4ZE4A 3PZTA 2J79A 3AQUA 3WELA 1FOBA 2XFYA 4AZ7A 2G41A 1KXHA 1YQ2A 2VVNA 1JDDA 3WNPA 2WVVB 1JAEA 2VQUA 2Z1SA 4UFMA 1AVAA 3VIPA 3RMEA 2VRKA 3WNKA 3VMOA 4V2XA 1Q6CA 3MS8A 3KL5A 4D1IA 3RO8A 2DSWA 1UKTA 2QF8A 2Y24A 1JI1A 1HVQA 1UWQA 3VKKA 1X6LA 4BS0A 2BVTA 3GZAA 2EPOA 3AHYA 1JGIA 2CPUA 1CXFA 5LYRA 1TUXA 4IPNB 3VILA 4ACZA 2ZOXA 2VZOA 2VMFA 1UH4A 2XSAA 1UWIA 4GO9A 4BQ2A 1EXPA 2HVMA 4P7OA 5FCZA 3POHA 1AMYA 5A2BA 3M46A 2WZEA 1GJWA 1GHRA 3ALFA 3OZOA 5AYBA 5A8MA 1NOWA 2CHOA 1MXGA 3CUHA 3NDYA 3DYPA 4NF7A 3IJ9A 1K9TA 1PBGA 3GM8A 3W26A 4W93A 2PWGA 2O9PA 4PCSA 4DWSB 4OBRA 4OZOA 3KE0A 4OUEA 1ODZA 1OD8A 1M53A 2VI0A 5BRQA 3DC0A 4PCTA 3WDIA 3NDZA 3PZNA 3GNPA 2DSUA 1HKMA 1BLIA 4F79A 5GNYA 3MMUA 3WDPP 3M07A 2QLYA 1VEMA 3ZR5A 2AAAA 2QMJA 1V3JA 3EDDA 4CGTA 3ZOAA 5FKYA 3ZJ8A 5ABEA 3ZQ9A 1UKQA 3F4VA 3CUFA 3AMGA 3PN8A 4GQQA 1BQCA 3TP4A 5A6KA 4OOZA 4P7RA 1JF5A 1C92A 1H5VA 2PWFA 3VTRA 3RILA 3N17A 3VDHA 1G0CA 1ISWA 3UR7A 5I3DA 1W1TA 1IZKA 4U31A 3TTQA 2BHUA 4GPNA 3WQWA 2D20A 3CTTA 3VIJA 3UG4A 1D2KA 2WYSA 4F66A 1E43A 2CNCA 1W32A 4GZJA 3L4XA 2YBTA 4W5ZA 3HN3A 2UY3A 4M24A 3U7VA 3VOCA 3U5UA 3VNZA 5AYIA 5ABGA 4MJ2A 2OYLA 2VJXA 1V3LA 3WMCA 2W66A 2PBOA 5JUVA 4BF7A 1NARA 5BWFA 2WC7A 1K9DA 1QBBA 3BAYA 3LPOA 2WLZA 5DMYA 3M7SA 3D3AA 1U30A 4R5EA 1QNQA 4CKQA 1WZLA 3VD7A 2WC3A 4KRTA 1KXQA 2GK1B 1LJYA 5E9AA 5DT5A 1EQPA 3NSNA 2E9BA 2CBIA 1OCQA 1QHOA 4PUDA 3W24A 1X1NA 3ZO9A 1RD6A 3AZTA 1UG6A 2JFEX 2ZUMA 4KH2A 1G5AA 4Q7NA 3A4XA 1W2VA 3VGGA 3AJ7A 3QHOA 3NUKA 4ZENA 3VIIA 4EK7A 3EBVA 3K8KA 2CKSA 1XGZA 1TVPA 2XVGA 2WVUA 2WBKA 4WK9A 1EOMA 4P8XA 5A8OA 4AZCB 1V02E 1V3IA 3HU7A 1QI2A 3OLGA 5CPSA 2OYKA 1K9EA 3CBWA 2PWEA 4W8LA 4AC1X 1HX0A 2OWWA 2GJRA 2DT0A 1J0YA 1J0HA 4V27A 4HOXA 2YL6A 4YHGA 4P8VA 3T2PA 4XV0A 2D0HA 3U7BA 3BCFA 1K6AA 1UZ1A 1V6XA 1XCXA 2C0HA 3OBAA 4JKKA 3WDQA 3NSMA 5CLTA 1KGWA 4U5IA 1BYDA 4HA3A 4MJ4A 1GVYA 2X09A 4W5UA 1W9VA 4PTXA 2Q8XA 2VX7A 4BQ4A 2DGAA 3CUIA 1WZAA 1V08A 3WUEA 3WH6A 4WF7A 3SUUA 3UG3A 3LPFA 3CZEA 3GNRA 4FLSA 3MV11 4PMZA 4D6FA 1OD0A 1UR1A 2W67A 2A3EA 4QAWA 3W27A 2WMIA 1EOKA 1DWIM 2J8FA 4CUCA 2WCAA 5D8ZA 5HDRA 4NSBA 3IAQA 3B8SA 1W9DM 2YIHA 1LQ0A 3CH9A 3W6MA 5DO8A 2YA0A 2PC8A 3HMCA 5EFFA 5FOOA 3GH5A 5I78A 3GXMA 5A6BD 2YKKA 1H11A 4WSKA 3N12A 2DPEA 2W62A 2EQDA 4KGJA 4CCCA 3TTYA 4MDPA 1UD5A 3PZOA 3U57A 1E9LA 5A8PA 4OIFA 2WZHA 4J7RA 1DP0A 2VVSA 1EO5A 4J3VA 1KBKA 5E6ZA 3WF4A 5C71A 1CBGA 5HXMA 2PBGA 3WSUA 1FHLA 5LA2A 2VT0A 3WD1A 1VBUA 3OZPA 1NP2A 3S6TA 4W7UA 4KRUA 1VRXA 2WW5A 3NCOA 3U5YA 1CGWA 1PJ9A 3OLDA 3AHZA 2J8GA 6TAAA 1LLOA 1RPKA 1LL4A 1H09A 3WL1A 1WNOA 2J75A 5BYWA 3A4WA 4QFUA 1B3XA 2Y2WA 3ZMRA 2BXYA 1SYTA 3VM5A 4NI3A 3T0BA 3CZ8A 1PAMA 2YOCA 3K4AA 3PTQA 1P6WA 5JBFA 4FLQA 4X0NA 1H4PA 5E70A 4FLRA 2XFFA 5FIPA 3MUZ1 1VJSA 3F5LA 7A3HA 5BRPA 3BCDA 4AIOA 2GJXA 1V0MA 1LF1A 1UR4A 1ISXA 3PTKA 5A2AA 4KGLA 5HBFA 2VZTA 1B3VA 1FP9A 3CHCA 1C8YA 3GH4A 2OSYA 4E8DA 3L2LA 4B3LA 3FAWA 4AISA 1H0IA 1E55A 4QCFA 5EMYA 1BG9A 1C93A 1E1FA 2BY2A 1LWJA 1O6IA 2JF6A 3AYRA 4MPKA 1B3YA 2XVLA 2ZXQA 3VIGA 3CZKA 3AIQA 1BSIA 5D9NA 4D1JA 3SCTA 2WMJA 1R87A 1UKSA 3ARSA 3MMWA 5A6MA 1JZ3A 2NW0A 1E4NA 1KGXA 2ZXAA 3WNOA 4UFHA 1CPUA 2NT1A 3OGSA 4MDOA 4ACYA 3N11A 2VCCA 5C70A 2CERA 1HN1A 3L4ZA 1EIBA 4PUEA 3ARVA 2UWFA 3WD2A 1W9UA 3AS2A 5A6AA 2CBJA 5DEZA 3CZLA 2EPMX 2GUYA 3WNMA 2EO7A 2VZSA 1PZ3A 3WF2A 1OGSA 3N04A 1SR0A 3B9AA 2D2OA 2V38A 3AMKA 1WAWA 1V3HA 3VX0A 5ECUA 2ZXBA 1MW3A 2BVYA 5AY7A 3GXFA 2XVKA 1J12A 3OB8A 4WSJA 3VO0A 3AXHA 4M8UA 2XM2A 1RP9A 1KCLA 1AQMA 1JNDA 4FMVA 4PMYA 4LYPA 3SUTA 1QI0A 1DWJM 1QOXA 3ZJKA 3ZR6A 1JI2A 4B16A 4UOZA 5IHRA 2A3AA 5C8BB 3VVGA 1UA3A 3MUIA 2XIIA 4QDMA 2FHFA 1DWFM 1JZ5A 1OT1A 1HVXA 1VF8A 4GZIA 5DT7A 1A3HA 2YL8A 4D6DA 2DIJA 2CXGA 1B3WA 4HMEA 1UD2A 4OOUA 3RPMA 1QPKA 3KWXA 4BCEA 1R86A 3AIEA 1TR1A 1E5NA 3VGFA 1E4MM 1I75A 1B1YA 3T0AA 2D22A 3CIVA 1GOIA 3IK2A 3MO4A 3WIJA 5ABHA 1AQHA 4CD7A 5CZKA 2GDVA 3LPGA 3RM8A 1H41A 5DF0A 4M82A 2WHLA 1GORA 1B3ZA 2G3NA 1NWSA 1L0PA 3BC9A 4PTMA 4HP5A 3WF3A 4UQAA 3AXIA 3N9KA 4ATDA 1GQIA 3DECA 3S2CA 4AZHA 3NJ3A 2VCAA 1PX3A 1M04A 1B0IA 5D9MA 4D6EA 1M7XA 1JXKA 1OIMA 1V6YA 5JBDA 1V3MA 4DWSD 1W3JA 1WDQA 7TAAA 4GI6A 3IANA 2WKLA 1UR2A 2V3FA 3DYMA 1K9FA 2O9TA 2EPNA 2XUCA 3VX1A 3WH9A 3CMGA 2VQTA 1PIGA 1UWTA 2Y4SA 4M56A 4FF5A 4GO8A 3LMYA 3CHFA 1XSKA 2Y8KA 1PX4A 2ESCA 1KXVA 2WZIA 3K8LA 1E40A 2X0HA 3ARQA 1EH9A 2FDMA 1WZMA 4J3WA 4Z2HA 2E9MA 4D6HA 1J9YA 1CDGA 1S46A 1JZ4A 3A3HA 4CN1A 1CWYA 3SUVA 2DSKA 1R8LA 2F61A 3KEHA 2JE8A 2XGIA 4URIA 5IFTA 2FHCA 3BSHA 2F8QA 1VFMA 4PBGA 4X9YA 1TFVA 1QNRA 1KCKA 1FFRA 1PZ2A 1ISZA 1FH7A 1WCGA 4J28A 4MNJA 5LA1A 3VNYA 4AD4A 1EDQA 4R27A 1JNEA 4D6CA 4LPCA 3SCUA 2D0FA 2WVSA 4IISA 1UR0A 1CGXA 1OB0A 2BV9A 1KXTA 1VB9A 2EPLX 1ZJAA 3AS1A 2XSBA 1UWSA 3AIBA 4J27A 4AZIA 3PZMA 3VM7A 2WAGA 2VL4A 3FHQA 4HA4A 3UERA 5IFPA 2UY5A 2WSPA 2WWCA 2PI6A 5F7UA 4B15A 4W88A 3CZGA 2E40A 3ZT5A 3APGA 5D8WA 4JAWA 1HJQA 1UA7A 3BH4A 3WF0A 4AD2A 1E4LA 3OA5A 4JFVA 2ZICA 3AICA 3VMNA 1G01A 3VGHA 4V28A 1HJXA 4W8BA 1V6VA 1ECEA 1BTCA 1HNYA 1E0XA 2WHKA 4H04A 4XX6A 3EDJA 3W6LA 3VIOA 4DUXA 2WMKA 4UFIA 4AXNA 3K1DA 1U33A 3TOPA 4UFLA 1ISVA 1TCMA 3D5HA 4PSRA 1OSEA 3K4DA 2PWHA 3T2OA 1JDAA 1XC6A 4JHZA 2ZUWA 5CSYA 5M5DA 4CU7A 1CXLA 1DWAM 4AD0A 3ZSTA 4TTUA 2YDSA 2XGBA 5I79A 3KZSA 1NH6A 1US2A 3PHAA 2J74A 8CGTA 3GXIA 4Y7EA 2WLYA 1JZ2A 2ZIDA 1E6NA 5CQ1A 5BCAA 1CXEA 3EDFA 1KFWA 4CN4A 1Q6FA 4AIEA 5BROA 1E6XM 1XH1A 1V0NA 1U2YA 1LL7A 1JYXA 3N13A 4LYQA 3BAJA 3SCOA 3W28A 1GQJA 4AZCA 3IAPA 1W3KA 4BZYA 3WENA 1M01A 4ATLA 3WH5A 5FL1A 3L4WA 3AISA 2O9RA 4J3TA 2AMGA 2VOTA 3WDJA 6A3HA 5D4YA 1FA2A 3II1A 3TTOA 1OBAA 3FNDA 4D6JA 4W7WA 2EXOA 2GFTA 3QHNA 2V3GA 2VX4A 3ZJ6A 3WDHA 2BY3A 1LG1A 2ZX9A 4RL3A 3CLWA 2PWDA 2VNCA 4EAMA 1C3FA 1GOQA 2IUZA 2DEPA 1FH8A 3AIRA 9CGTA 2D3NA 2ZWZA 2ZE0A 2VCBA 1BHGA 1CTNA 4A4AA 3WBAA 4GIAA 2BY1A 3TTSA 1CEOA 1UKPA 2YL9A 2JEPA 4PMXA 4HTYA 4ZEPA 1R7AA 1A47A 3QOMA 3W82A 1OINA 1KQYA 5A2CA 3DYOA 4E4PA 5CJ5A 1XCWA 3AI0A 2VRQA 2BFGA 2X8RA 2WCGA 3ZJ7A 4F8XA 3JUGA 1GOKA 1ITXA 2Z1KA 2XJ7A 3VGBA 3W0KA 5AC4A 3WH8A 2WMFA 3BAKA 1GOWA 4B9YA 2EBNA 3VD9A 1ISYA 1JAKA 4FK9A 3BLKA 4B3KA 5CSUA 2QPUA 1BGAA 1QW8A 5A3HA 1JFHA 4LQ1A 4HZ6A 1HKJA 2CEQA 1US3A 2BS9A 3W25A 4BQ5A 1BYCA 3W38A 2W5FA 1TVNA 2XPKA 3LPPA 3MSGA 1X6NA 4P7LA 1HL8A 5EFDA 4B9ZA 4MNKA 2WPGA 1F4AA 4CCEA 4JFUA 1FP8A 3AFBA 1XH2A 1W1PA 3WUGA 5EB8A 4JL2A 3SEPA 3PZ9A 2ZUTA 2X2YA 1DWHM 1TMQA 1TG7A 3FW6A 3AIUA 1W91A 5A6SA 1BAGA 2FH8A 1J10A 4TTGA 2OSWA 2WCSA 1HIZA 4F9JA 1CLVA 1E72M 3B9DA 2UY2A 4P7QA 5D9PA 3VD3A 4KMQA 1J18A 1CECA 2YLAA 3AOFA 4PSPA 2WKGA 3CHDA 3VDCA 1PIFA 5BXRA 3OGRA 4GI9A 3GXDA 1QI5A 2XG9A 3WFLA 4DM2A 2QPSA 3WD3A 1CGTA 3VU2A 1N82A 2GJXB 4UFJA 5CPQA 1J0ZA 1W3HA 2YBUA 4CU8A 4L4PA 3G6MA 3DHPA 2W63A 4W8AA 1EDGA 2E9LA 1KR0A 3PTMA 2XM1A 3BSGA 1WB0A 3SCSA 2ZX8A 4HMDA 2WHMA 3MV01 4AZ5A 1W3LA 1E6PA 3WMSA 4WKAA 2XIBA 2YJQA 1UWRA 1ZBVA 2W4XA 3W37A 3UETA 4M1RA 4MTVA 2XFRA 1BF2A 5TD4A 2RGMA 2YA2A 2WBGA 4UFKA 4JKLA 2JEQA 2WVTA 3O6AA 4XUYA 4HMCA 4AMCA 1MWOA 4HPHA 4N0RA 2XWEA 4AZBA 4TVCA 4UZUA 2JIEA 2WXDM 3MUAA 1E56A 3OIHA 3WD0A 2X05A 4OJYA 1UD6A 4U2YA 2CYGA 3MSDA 2HISA 2DH2A 2VX5A 3A6OA 2OLHA 2J7EA 1IT0A 1Y7VA 3AZRA 4K68A 4ACZB 3POCA 3A4AA 1HP5A 1F4HA 4NRSA 4HU0A 5I24A 3ARRA 5I5RA 1R85A 1QHPA
chains in the Genus database with same CATH superfamily
1R3YA 2P50A 4JTUA 3T81A 4RE4A 2Z27A 3GHRA 5FSEC 1OX5A 4Q8OA 2XVPA 3WQ4A 4J35A 1OX4B 4HU8A 3DERA 1AZ1A 4HQVA 3VDBA 3N1AA 4OE7A 2VZUA 1X8CA 5A94A 3GVGA 4HPXA 1FWEC 1UMYA 1HT6A 4QQUA 4W4QA 3S5ZA 3GDRA 4DO4A 1Z89A 2G37A 3GC5A 3S6OA 5ABFB 2IQDA 4G2DA 2YX0A 3GG8A 3W87A 4GG9A 5CZTA 2WANA 5EMUA 2C91A 4F0MA 5E0CA 1PZ1A 2EEXA 3HQ1A 2AAMA 2J9ZA 2AL2B 4TXEA 2W91A 4JTQA 4I3GA 4IT1A 3TYUA 4EKJA 4RZ4A 3KOWA 4UOQA 3KHJA 1NP0A 2PF8A 3GHTA 3TONA 2GL5A 2YDRA 3BMVA 3RM4A 4B90A 4PTNA 1QK0A 2QCNA 4GE8A 4NHVA 1GZ1A 1B90A 1JZ7A 4BK9A 1JZ6A 3CWOX 5T8GA 2DZPA 4MB1A 4D6IA 3P8JA 3GR8A 4CVWA 3FA5A 2ON3A 1J0IA 1L6FA 1XX1A 1V51A 2Q3RA 2E25A 3AROA 2WJFA 3GYCA 5CZ0A 3VGDA 3QMTA 3RG6A 1NQ6A 2D73A 1XQKA 1EGZA 3FV9A 5EL1A 1M03A 3OVPA 3NWRA 4Y9PA 3KL3A 3V4BA 1QI4A 1ZP4A 3R10A 5FL0A 5K3VA 4GZEA 1S2VA 2X1IA 2DU2A 3PBVA 3BW3A 3H2FA 4B4FA 3VINA 2ZRYA 5I2UA 3C0QA 2Z0IA 2OWXA 4HTBA 4P7NA 4PEEA 1KBLA 2DUZA 5EGRA 1V7YA 4D6GA 1JD7A 4FHAA 2OSXA 4ZSTA 5G1YA 2GDUA 3GHSA 2INFA 3MVTA 3RLGA 2J9YA 4RE3A 3GZ3A 4KWVA 4FB7A 2ZE3A 2Z26A 1HO4A 1WDSA 1YYAA 1S2CA 1C7TA 4CD6A 2NZLA 3CYVA 4H8NA 1Q7QA 3ANVA 3BV7A 3ES8A 1ICPA 1R7OA 4Q7BA 2QHAA 3G5EA 4DPPA 3DH7A 3OGVA 5CPNA 3QPEA 3CGTA 2WNNA 5K4XA 3B9EA 3WK1A 2NVCA 4RPQA 2GVYA 3FKRA 1R3SA 4CQ9A 3GC4A 5LSMA 1VBHA 1BYAA 4Y9MA 2PDLA 2WM1A 1XWYA 2ANUA 1S1PA 3W2JA 2NXIA 3ZM8A 1TX0A 1PKYA 1E0TA 3URNA 2OFJA 4ZOAA 4M80A 1XISA 1FBAA 1PKMA 5AHEA 2O9OA 2OO0A 4GVGA 1MUCA 2PP0A 3CHEA 1GONA 2PMQA 3UW6A 1XCFA 4MPQA 2V5DA 2E4TA 3V5FA 3FSUA 5MF5A 2DJLA 5LIXX 1WP6A 1EGMA 4YLWA 2QGYA 4HB7A 3SURA 3WQ8A 1DQUA 1OFRA 1OT2A 4JGDA 3P14A 5G4HC 3RNDA 3N9SA 2E09A 3H2MA 3L5LA 2EGZA 3ZS4A 5LZLA 1TA3A 4K3ZA 4D8AA 2B0MA 2ONEA 4NZ5A 1KLYA 1ZQ5A 3BAIA 1H0GA 4XAZA 2FGLA 1QPRA 3O0FA 1P0BA 4EE9A 3C2VA 1EUNA 1FQ0A 4DXKA 3NQGA 2R1LA 1QNOA 3G8EA 3KBJA 1ZAHA 2BOFX 1WYIA 1VEPA 5HQLA 1XLCA 2OEMA 3IJ7A 3ABQA 4MAZA 1FHVA 1EC8A 3CPUA 1WQ5A 2DSZA 3PFMA 2ZUUA 2VC9A 1G9HA 1W8SA 1XKJA 2AKZA 4YTTA 4HBKA 4PYSA 3TCEA 2J7FA 5DCBA 1YDYA 3U2ZA 4MSSA 1UJPA 1VJZA 3L4VA 5K7JA 4H41A 4M29A 3VPLA 3GU1A 2ZUVA 1Q3NA 5DELA 3TNBA 1E3XA 1KFLA 3T40A 3KVMA 1QT1A 3WF1A 1TQXA 4LWWA 1DQXA 4AD3A 1DBTA 5A6JA 1H7WA 4NAFB 3L4TA 3EKZA 1M68A 1QVBA 3CTLA 4DF2A 2DUAA 2YBVA 5C7HA 3AJXA 3L4UA 2X1TA 2OJPA 4UQ9A 1BRLA 2A3HA 4EWND 1R9ZA 2PEVA 2P10A 5BXTA 4KWWA 1JZ8A 3G1HA 4GKLA 3M0VA 4R7OA 1ZZMA 1WXYA 2EG6A 2FDSA 2J25A 2ZZ1A 1H1NA 1XYFA 3QGVA 2E77A 2OQLA 3NZGA 4DUVA 2P76A 4WSHA 2CBVA 4IPJA 3RHGA 3UJRA 2J13A 2FYMA 4JDBA 2XIQA 4XZHA 3VI2A 2QJHA 5A5WA 3S83A 4K8EA 2V9DA 4J2MA 3G2GA 4QS5A 4CQAA 4BJHA 1YXCA 2J62A 4DX3A 3LEPA 3QPZA 3LCLA 3ZLHA 1ZBWA 2XSXA 2E5CA 3K30A 1LL6A 4PODA 3WNNA 2J7BA 3ARUA 4MUZA 4IUGA 9RUBA 3HQOA 1W9BM 2CBUA 4QLLA 1I4NA 1CGUA 2Q09A 2XN2A 3RCNA 3IV3A 3THQA 5FF2A 3CPRA 4MKSA 2WWDA 4JX6A 3CC1A 1TWWA 5DRIA 2FPTA 3MSRA 3U0HA 3TV8A 1OM0A 2ZZ6A 2CIPA 2OX1A 3F2DA 5IXEA 1R47A 2H9AB 1WDRA 3W2UA 1AD4A 1DKWA 3ATYA 1PX8A 2D23A 3OVQA 1UH3A 2DP3A 3KAOA 1EFZA 4I5XA 3MKKA 2H6RA 2O92A 2XYLA 5CGQA 5FEWA 1QOPA 3LY0A 4ZFMA 1P0EA 5BXSA 3UZWA 4S3CA 1JYNA 4DLMA 4MADA 1XLIA 3CPGA 3E0FA 1Z32X 5G1TA 4Z2IA 4JFTA 1RH9A 2R94A 5GQBA 2V3DA 1MDRA 2G8ZA 2PGFA 1HJWA 3SFWA 3GAYA 1T40A 2DT2A 1DXEA 4QLKA 5HPOA 3LGDA 5GJPA 3WMBA 4H3DA 3WJWA 3V1HA 1P0DA 4JTFA 4W85A 4LS0A 4OV9A 1AJ0A 1J0KA 3O7UA 1X38A 3LZ3A 1WZKA 5KMYA 1SUXA 3QFEA 3TU9A 1E15A 3VIKA 3I65A 4IICA 1N55A 1N7KA 4Q8VA 4UQEA 4JTGA 4JZ5A 2PDUA 1V6WA 2PP3A 4LC6A 4N4PA 2PD9A 4Z2KA 3ARTA 1RJPA 2ZCGA 3IUHA 4UMBA 2Z28A 4MOZA 1UOKA 2J7CA 3F1QA 3TLLA 3CO8A 3CU2A 4TVUA 3R43A 1RHCA 2Z24A 3WLQA 1FXQA 4REQA 2PTXA 1JRBA 1MW1A 2DJXA 2VFFA 1W1VA 2Y61A 3W1NA 3I3EA 1PYFA 5D03A 3EEZA 1PEZA 2FB3A 4BEUA 4J3UA 3FHAA 2EKCA 5FEPA 4FIRA 3OZYA 2J88A 3AYSA 5KSWA 1ZY9A 3N4EA 5DMLA 3EMZA 1YEYA 1CXKA 5REQA 4H6QA 1O1ZA 1MMFA 1B54A 3DFTA 3Q65A 4TX8A 4CVUA 2Y6ZA 3AHXA 3W4RA 3K8MA 2X1RA 3ARWA 1XBYA 3UXAA 1MW2A 4XAFA 5AZ0A 2WB5A 3LHZA 4FNUA 4AW7A 2V5JA 4EPEC 3B0YA 2H8ZA 1W9XA 3W81A 3AHVA 4EANA 2FGZA 6CGTA 3N2OA 1ZLPA 1EO7A 1BKSA 2VWSA 3VIFA 2A6LA 3UY7A 2Y7DA 1S39A 1WAUA 4JFSA 4MUPA 1VAHA 2O55A 3OW1A 5JXQA 5CPTA 5A1AA 1QCWA 2PZ0A 3AS0A 3NGFA 1QNPA 1EX5A 3S5NA 1OGGA 3W7EA 4DJFC 4QP0A 4JTEA 2LLEA 1WO2A 5IRPA 1UZ4A 4ASTA 1A5LC 4C6NA 3H22A 3LXBA 3K46A 4NIRA 4HZMA 3BW4A 1F6KA 2AGTA 4YVPA 4RX0A 3TMLA 4EIVA 1J11A 5HNNA 1OCNA 2VZVA 3CZJA 1XGDA 1KB3A 1MQRA 1W2PA 2D1ZA 4UTFA 1JPIA 5CC6A 1ME8A 5HUPA 1H60A 1PTDA 1ZS2A 2QCFA 4HOWA 4N42A 3E3HA 1M7JA 3O6DA 1DPMA 1T96A 1CYGA 2XGZA 4G7FA 3KBNA 6REQA 5CAHA 3E2QA 3VZZA 3C2YA 4FIQA 4JYDA 2QUNA 2QJGA 1XYBA 4S3GA 4M51A 4S3FA 1BF6A 3MYOA 5LXXA 1XV8A 4QJ4B 4E0CA 3L0GA 2QS8A 1UROA 2Y7EA 4WOZA 1KM6A 4G1NA 2HS6A 3PBWA 1H51A 1UR3M 3M6YA 1R30A 1X98A 4ZE4A 3AQUA 1LOLA 1TVLA 3OU8A 2G41A 1AG1O 1KRMA 5LHEA 4IZGA 1E9YB 2O7QA 5G5IA 6XIAA 2VVNA 1CX9A 1JDDA 2WVVB 1JAEA 1AVAA 2QUVA 1VIZA 4A8NA 3RMEA 2VRKA 1IGWA 4JTJA 2V82A 4B92A 4FSAA 3KL5A 4KKXA 1SSDA 1UKTA 3UYIA 1HVQA 2YZ5A 2BVTA 3NEVA 3MWAA 1Q2SA 1JQVA 2OCZA 4H9YA 2Z4GA 2CPUA 4IPNB 3RUBL 3MI2A 1UOZA 3LZ5A 3SB0A 2X1UA 4LAZA 2OEJA 2XSAA 3R2GA 3MI6A 2IQTA 2Z2UA 1JQXA 1XIFA 5A2BA 5GVJA 2WZEA 1GJWA 2Z1XA 2FB2A 5AYBA 3CMFA 3CUHA 1B4EA 3IJ9A 4RZ5A 4M6UA 3QV7A 2O9PA 4ZQRA 1B57A 4DWSB 1RBLA 4H00A 4OZOA 4OUEA 3DKJA 2GDQA 5AN7A 2A3LA 2Q6ZA 2V2DA 4UTTC 3JW7A 2CZ5A 3EGJA 3PZNA 4PZVA 4E38A 3GNPA 4HNTA 5LNRA 1BLIA 5GNYA 2W9MA 3EDDA 4NQ1A 4JTSA 2HXTA 2HRWA 5JMUA 4GQQA 1ZUAX 4QEEA 2J6VA 3DHDA 4QS6A 2QJNA 2W27A 2OX4A 4P7RA 1JF5A 4IX0A 1C92A 4MYAA 2PWFA 3W1AA 2FKPA 2I7GA 3A24A 3IUIA 1FKWA 3B04A 1G4SA 2FZBA 4UCGA 4Y8EA 3W83A 3PFRA 1K1DA 1ISWA 3R8HA 1DXIA 3LRMA 3WJYA 4QJ5B 1ZNNA 3VIJA 1D2KA 1SJBA 1LQ2A 2CNCA 1A5UA 1L6WA 4GZJA 3L4XA 3BZGA 2YBTA 4QEHA 4X61A 2QCCA 5FEXA 4DJDD 1XS2A 2ZVRA 2D2HA 3B0VC 2PTWA 4H7ZA 4KWOA 4MJ2A 2OYLA 4DBEA 2W66A 1Q8AA 3EB2A 4FPSA 3BAYA 3OBKA 4LBSA 1U30A 1QNQA 4GH3A 4F3HA 3VD7A 1UUMA 3N2CA 3HG5A 1OF6A 5DT5A 1EJVC 4GY7A 4PBFA 3NSNA 2E9BA 3C8NA 1TPH1 3DI0A 3BJTA 2ZUMA 3BANA 3JS3A 1OYCA 1YDVA 2W6RA 4MZ8A 2C1HA 1J96A 3A4XA 1W2VA 3VGGA 4JIIX 3UZZA 3JR2A 3VIIA 1VPYA 7TIMA 2I5IA 2XVGA 4EP8C 2HQAA 4XKYB 5A8OA 1V02E 3HU7A 2R1PA 1TYGA 1WDWA 4WCJA 2DZVA 2FJKA 2GJRA 3NURA 4IQLA 4NYYA 3C5QA 2VENA 4GVFA 2CZVA 2RJHA 4V27A 4HOXA 2PDBA 4UTLA 4YVXA 4A8LA 3T2PA 4XV0A 2D0HA 1P6BA 2ZDRA 4MMWA 2GOUA 3BCFA 5ABTA 4NUWA 4JKKA 3NSMA 4JD4A 2QW5A 5CLTA 1WUFA 1XIMA 2P8BA 4W5UA 5HATA 2C15A 1R3TA 1OC6A 1UASA 1KRCC 1V08A 1FUYA 3SUUA 1OFPA 4IIEA 4DJDC 3PJXA 3GNRA 4HT3A 4FLSA 4DJDA 4D6FA 1OD0A 1QUMA 2W67A 3NPUA 2BG5A 1LLZA 3SGUA 5D8ZA 4NSBA 1K7FA 1VP5A 3B8SA 3EXSA 3BOXA 4FOUA 4DAFA 1P4CA 2YA0A 1M3UA 1H11A 1DQWA 2IKHA 2YYUA 1JCLA 3QR0A 1MUMA 1TRDA 3G1RA 4O15A 1XJBA 4BR1A 1L6SA 3U57A 4OIFA 3M0HA 3OHIA 5CG7A 1DP0A 2VVSA 2F7FA 3EWUA 4U4MA 4I8DA 3HOJA 3U2OA 2CLKA 5E6ZA 3WF4A 1CBGA 3FEMA 3TXVA 4O57A 4H6RA 1KCZA 2G95A 4DXXA 1MZRA 3WX7A 3MJYA 4KIRA 4QM1A 3R89A 1VBJA 3GHUA 1NP2A 4KRUA 3C8FA 1PJ9A 3NQCA 1RPKA 2RUSA 3QSRA 3WQGA 5BYWA 1B3XA 2BXYA 1P0KA 4JEQA 4NI3A 3NDOA 2PWVA 1EPVA 3PTQA 3ZR4A 2DZAA 4FLQA 5BOOA 2XFFA 1GOXA 4GC4A 5LIUX 3RCMA 1VJSA 3VNIA 1ELSA 4A21A 3DFYA 4QX4A 3PTKA 3MC5A 2YCJA 5A2AA 3IJDA 3CHCA 4E8DA 2V8ZA 3W1LA 3FAWA 4AISA 1H0IA 5EMYA 1J93A 1C93A 1TTJA 1LWJA 1O6IA 4QE4A 5MKGB 1SVDA 4E3VA 1ALDA 4JQAA 3ITVA 1U5HA 3VIGA 2VDIA 2OTDA 3AIQA 3SCTA 1R87A 4OVXA 1UKSA 3MMWA 5A6MA 5AYZA 4JTHA 1E4NA 3GY1A 3E49A 3KVKA 2TRSA 1YPXA 3Q94A 4LV4A 1XR2A 4LYKA 3N11A 4FEZA 1JCNA 5C70A 4Z1DA 1YLVA 4N2YA 2PLCA 3W72A 1W9UA 5BRBA 1RLCL 4JY8A 1XFCA 4WX2A 2CBJA 5DEZA 1S2UA 3L65A 2VZSA 4AB4A 4R88A 5HUOA 3OYXA 3WF2A 1OGSA 3KDNA 1MNZA 4GX8A 3N04A 2D2OA 3AMKA 1ZALA 2QEZA 3VX0A 4DI8A 2BVYA 1OX4A 4US6A 3OB8A 4WSJA 2XM2A 2WKJA 2OVLA 3RFAA 1IE7C 3DFNA 1EL3A 4EF8A 3SUTA 1QOXA 1CW2A 4AMAA 4B16A 1GT8A 2NLIA 5IHRA 5C8BB 3K13A 1UA3A 3MUIA 3W07A 1EJUC 3EWYA 1OT1A 4E4FA 1M9HA 2PRMA 3HJZA 3NA8A 3CH0A 5DT7A 2YL8A 3TVAA 2DIJA 2CXGA 1M65A 1XBXA 4HMEA 1Z48A 5D2VA 3RPMA 1FWCC 4NAFA 1QPKA 3H2AA 2AL2A 1I75A 2UBPC 1WBJA 1EJTC 3H2NA 2D22A 5CZKA 3RM8A 1SGJA 1RLDA 2V0TA 1KLZA 3S5SA 5H8UA 3L7RA 2HJPA 4JR5A 3NQAA 2PDGA 4PFMA 4LVDA 3CAQA 3LGGA 4CNUA 4LJ3A 3WF3A 3BLIA 3AXIA 4UBPC 3AUJA 3NJ3A 3DDMA 4BKNA 4Q33A 1W8GA 1B0IA 3TXZA 1M7XA 1V6YA 3BUVA 1V3MA 3ORWA 4ZQMA 4DWSD 1GVFA 4LVBA 2V3FA 3DYMA 3W02A 3HPAA 2EPNA 2CZFA 3W7OA 1EF3A 3ITGA 3W74A 3CYJA 4IGNA 2Y8KA 3TN5A 3C3UA 4DJEA 2CLMA 4HA0A 5D2XA 3N29A 2ACUA 4Y9AA 4J3WA 2P3EA 3ZXWA 1J9YA 3M43A 1HFBA 1PTAA 1JZ4A 2F61A 1R8LA 2XGIA 4URIA 4GNVA 4DHGA 3BSHA 4PBGA 1OFAA 1TJ1A 4QDPA 1KCKA 1FH7A 4J28A 3VE9A 4AD4A 1EBHA 3WLPA 1KV8A 4GXMA 3EWXA 2CLIA 3SCUA 2D0FA 2WVSA 4IISA 1UR0A 3TCSA 2V67A 1OB0A 2Y5SA 4AHOA 1XIDA 4Y2WA 1XUUA 4ADUA 4J27A 3W3OA 4QR6A 1PDYA 4HSNA 3VM7A 2VL4A 4HA4A 5IFPA 2G0WA 1W3IA 5F7UA 2ZRXA 5F2IA 2A0NA 5FJPA 2D2JA 3A64A 4XO7A 1HJQA 4E8GA 1YE6A 2I5QA 5HAOA 4JFVA 2ZICA 4N7QA 4XK2A 1IIHA 3C2RA 3S1VA 3NZRA 4MFDA 5HR6A 1ECEA 3LDVA 1ZRQA 2E6YA 2X16A 4LNCA 2WHKA 2PDXA 5HMEA 3EDJA 1P1XA 2Y85A 4PUUA 4YWIA 3P3BA 4AXNA 3K1DA 1U33A 2HCVA 2YXOA 1TCMA 5H2ZA 1RVGA 3K4DA 4DYEA 4O1BA 4FA3A 3PC0A 3RPTA 1DWAM 4O18A 2PTZA 4NASA 5AHNA 4V15A 4TTUA 2YDSA 3ZSTA 2NSOA 1NH6A 5AYYA 3GXIA 3WQPA 4M1BA 4Y7EA 2WLYA 2Q3OA 3M4HA 1EXBA 1WA3A 3WLHA 3QZAA 4EVZA 5J5RA 5BROA 2Z29A 1QAPA 1LL7A 2OGYA 1JYXA 4OHQA 1FTXA 3BAJA 4MY9A 4S2CA 5CSSA 3SCOA 1GG1A 4ZGYA 1W3KA 3WENA 3M9YA 3OVGA 2GGIA 5HINA 3L4WA 4A3RA 4HN8A 1S3HA 1SM9A 2AMGA 3U4AA 2RDWA 3FNDA 4O1EA 3W7IA 4W7WA 2EAWA 3QHNA 1EJ7L 2V3GA 3R79A 1GWJA 1D8CA 4C6FA 4JN8A 1ADOA 4ZR8A 1DIOA 2PWDA 1ONRA 1SU5A 4DIAA 2HE5A 3E96A 5C9WA 1IEXA 1MO0A 9CGTA 2ZE0A 1E9IA 2POTA 4CNOA 5FAGA 2V2CA 2VCBA 2E67A 4O19A 4K37A 2PDMA 4LCRA 1Q7ZA 1UKPA 2YL9A 1A0EA 3PY2A 4XZMX 1YKWA 1A47A 4WGXA 4HD5A 2HNHA 4EPDC 1GPWA 4RUBA 3AI0A 2WCGA 2YZRA 1KFKA 4F8XA 1VCGA 2XJ7A 4A3QA 1XQLA 4JNMA 2PU0A 1LT8A 1FWDC 4XD5A 2VXNA 4LS2A 4DUOA 1YDOA 1AUSL 3Q2DA 4DF0A 5CSUA 1G67A 1Q8JA 3MP4A 3NQMA 1UP0A 5A3HA 3E12A 3D46A 4LQ1A 5CZJA 2PGWA 4LUYA 2NQHA 3SGZA 2XPKA 4KQNA 1J8VA 5FF0A 3LPPA 4DELA 1X6NA 3ITOA 3COTA 2ACQA 3TZFA 1TV5A 3AFBA 4N9DA 1W1PA 1TG7A 4XTDA 3VNKA 2WCSA 1KNWA 4ZZ9A 1E72M 5F4XA 2UY2A 3N73A 3GTHA 4D9PA 3M0XA 4HU3A 4GUHA 3VDCA 3OGRA 2F9RA 3MP3A 3SQSA 2NQ9A 5TQLA 3GW0A 4DM2A 4OWGA 3B0XA 3WD3A 5CPQA 2VR2A 3P81A 4UFJA 2WNZA 4NX0A 5C54A 3IEBA 3ERPA 1Z6KA 4W8AA 3PTMA 5D30A 3E0IA 2R9RA 4LUIA 4AVNA 4JIQA 2ZZ2A 3BSGA 4GMEA 3STPA 2PGEA 1HO1A 3VOJA 2OOFA 4EXQA 4PRRA 4DI9A 4UMCA 1H7RA 2YJQA 2OOGA 1V8EA 2W4XA 3W37A 3ABZA 3M5ZA 3UWZA 2XFRA 5TD4A 2WBGA 4UFKA 2JEQA 1WKFA 2GQ8A 3QFWA 2WVTA 2WQDA 4AMCA 3QSTA 3HA1A 3SR7A 3S9ZA 4L64A 1Z7AA 1SSGA 3HFYA 4UZUA 3MUAA 2FVMA 3R6IA 1GEQA 3PBUA 4H9TA 4JIHA 2AMXA 1W1B1 1IT0A 3TOYA 3A4AA 1HP5A 3LXAA 9XIMA 2GSJA 2CWNA 3AZSA 2E28A 4RNFA 1A5SA 1Q66A 5C55A 4AXKA 2OQHA 2VX6A 4JY9A 1EDTA 1SFSA 1H50A 2QCHA 4GINA 3OG2A 3UG8A 3MHGA 3AU2A 1VC4A 2GWGA 3IPWA 1W1YA 2YCIX 3W70A 4PMJA 4XZNX 1TO3A 3I4KA 2FVLA 2HWGA 3FAXA 3BO9A 3EB3A 4JNZA 3S47A 2RHGA 5BNKA 1JD9A 3GNXA 1BRLB 1JCTA 1UIPA 4Z2LA 4IX2A 3MT1A 2C16A 1ITCA 3UEQA 1RQBA 1ZU8A 1TWSA 1KD0A 3GXPA 3QV8A 2GYIA 3KCOA 4UNIA 2CC0A 1C8XA 3LLDA 4S3JA 4DB7A 4DN1A 1GKRA 4AD1A 1J5TA 4N9CA 3MTWA 4PTVA 2ISSA 2DZSA 2WNWA 1GZGA 1EYWA 3T08A 2QIWA 2E6FA 2BLEA 3KP0A 5EBAA 4XKMA 4W86A 3PBMA 1Q2RA 2GJPA 5JH2A 3OO2A 4REQB 1TPUA 4JQ1A 1HJVA 1AH4A 4IP5A 5HK4A 5I23A 1VR6A 2P3ZA 3KZPA 2J27A 1V5XA 4OBSA 3CQ0A 4UTKA 1HL2A 4EOUA 2WSKA 3PB2A 3WY1A 2V30A 1NIUA 1LORA 2FMOA 4NNAA 3TFCA 4I9TA 3M1ZA 3G22A 3OEXA 4H9VA 1FWRA 1Q4WA 1F61A 3EX3A 2DT1A 1U22A 1UKOA 1XDLA 4EAYA 3CL7A 2YLLA 1QK2A 2EPHA 5DY3A 4MGGA 1V77A 4IJBA 3EX2A 2VGFA 2JIWA 2YCLA 4DM1A 4DZAA 2UV8G 2WVVA 4Z08A 3QGKC 1OC5A 4A22A 3A21A 3EX6A 3ZSSA 4GBDA 4OKDA 1GKQA 5LNUA 3NZ1A 1R3RA 1MW0A 1OGBA 2VFDA 3APYA 1CXIA 3I68A 2ZRZA 3RX3A 1JUEA 2VGIA 3FKKA 3LX9A 3AAMA 3EWCA 1KWKA 2REQB 3LM7A 4PA8A 3NQ7A 3P7YA 1S1RA 3TROA 3ARZA 2OWCA 1D9EA 2Y88A 3EWWA 5D2TA 5DRCA 3TYCA 1VRDA 1TZ7A 1Q65A 1TELA 1AD1A 3FJ4A 1GQLA 1GOMA 2YCKX 1B2YA 4PMRA 1NF0A 2PDFA 1RVKA 5FA5A 2WK2A 1X6UA 3UVIA 1NY1A 2KX9A 2OLSA 1HQTA 3AXXA 2GK1A 3FXYA 4LVGA 1FKXA 3MB9A 3WK0A 1W9PA 4HA1A 3KRZA 4JHOA 1K6WA 4LVFA 3VCRA 4IOTA 3WQEA 1H61A 3W1RA 2NT0A 3SO7A 3LNPA 4KWSA 1L8NA 2G4FA 1A49A 3DIPA 1MFVA 2VRJA 2O56A 3GTNA 3TC7A 3UWEA 3CAVA 2CITA 4G7EA 4IPLA 4M3PA 5C5YA 4MNMA 5F4SA 3VOFA 5C9XA 1GQKA 1HP4A 2E8ZA 1BYBA 1NWRA 4B5VA 3RITA 4QIUA 3W7JA 1BVNP 5JIPA 4YYCA 1JIBA 3CIXA 2G50A 4IIDA 3RLUA 5KEZA 4POCA 4HZ7A 4ADTA 3HGSA 1XG4A 2EG8A 1JPKA 2OODA 4NP7A 2ASHA 2J4GA 2OR2A 3RIKA 1FCQA 4BEQA 4S3EA 3TSDA 2WC4A 3QEZA 1UR9A 1ME9A 1CCWB 4CEXC 2VOMA 3P82A 3T0DA 4NY2A 3VCCA 2BY0A 4XSMA 1DEDA 1EEXA 4GLEA 4NZ1A 1J01A 5XIMA 3P2VA 5K9XA 4GUIA 3SUSA 2QCLA 1Y0EA 5I3IA 6REQB 3WBWA 1V0LA 3VA8A 4FP1A 1S5TA 3B05A 2VKZG 4HNLA 3TW6A 3KOZA 5IOBA 1AJ2A 2F2KA 2Y0FA 4XD4A 4CQCA 3EMQA 1G1YA 3IARA 1UHVA 1Y5VA 2QCGA 1UD3A 4S3BA 5FI8A 4JXCA 3CQJA 4KS0A 1VEOA 3VDAA 2OG9A 2ISDA 3PTDA 1S5VA 2GQ9A 4DWSA 3EWBX 3CO4A 3T05A 1NQKA 3QVQA 4JCLA 3IGUA 2FIQA 2DDXA 2CW6A 1MVYA 4YNGA 5BXPA 3PZIA 3SCVA 3V5CA 1O94A 3NSXA 3TTEA 1LQAA 2FHBA 2DORA 3R7MA 1S2TA 5E6YA 1Z41A 3QY7A 3MANA 3GG7A 4HHPA 1WKEA 4JQ4A 1YMYA 3WMLA 1TE1A 5I02A 4LUTA 1ESWA 3ME3A 2QNEA 4MY1A 2H9AA 4B5WA 4RDWA 1XP3A 1QW7A 4ZQNA 3RXZA 1BVZA 3ARXA 1IT7A 3EB4A 1NFBA 3S9IA 4GJ1A 4GYPC 2HBXA 2QMKA 1E73M 4RZBA 4GY0A 1XLJA 7CGTA 5HQEA 2A1YA 3RX4A 2BGQA 2DZWA 2QAFA 3LN3A 4YPJA 5CKSA 3AMDA 1SW3A 1WDPA 4ATWA 1GEHA 3ABSA 1GVSA 1DJNA 4QCEA 4NRRA 1MI3A 3A47A 4H8HA 4BQ3A 2DVXA 2GQAA 5M1TA 1NDYA 3I6EA 3OA3A 3RCYA 3EOOA 3MMTA 1QO5A 1WKDA 4PUKA 5BMWA 2X41A 3LTPA 1JFXA 2XTKA 4PMOA 4PN2A 2ZQ0A 3IS4A 2VR4A 4Y9NA 2A7NA 4UNLA 1V3KA 1XYLA 4DF1A 2CHNA 3A22A 3L5AA 4HK5A 3WEZA 2MNRA 4O10A 5AVHA 3SADA 3RLVA 5DFAA 1GJUA 1XRVA 2FQIA 3QKZA 4C1KA 1XLFA 3QOKA 4XAPA 1JEZA 3R12A 3EDEA 3GB6A 4C6LA 2J77A 2QF7A 2E0PA 4UTMA 3WLSA 1HF6A 4JTAA 5AC8A 5I6SA 4C6BA 3EYPA 2ICSA 2TSYA 1U1UA 1QNSA 3MBDA 1UWAA 2DZTA 3IJ8A 1UJQA 5I77A 3T09A 3CXOA 3OLEA 3SCWA 3DCPA 2ZX5A 3A4JA 2V3EA 1GVIA 1GPFA 3TE9A 3ONBA 3EXRA 1CZ1A 4RJEA 1QPNA 3B8TA 1XRSA 4O28A 3G6LA 4DPQA 4RW3A 2X0YA 3U9IA 4FLOA 4XD3A 2QCDB 3A3WA 1YADA 1GCYA 2YW3A 1WDDA 1E4IA 3WD4A 4O12A 4H4IA 4JDYA 2WHJA 4LW7A 4YHEA 2PLJA 1HKWA 2CLEA 1UYQA 3N3MA 4ZSUA 3S2NA 4FXJA 1OFBA 4J5NA 3RMJA 1ZB5A 3PWAA 1OCBA 4PR4A 3UESA 3RDKA 1PB0A 1Q6RA 3VGEA 4IQDA 4LXFA 2V81A 1O5RA 3UR8A 1E5JA 4MG4A 3ATZA 1IV8A 4AEFA 4Q4PA 8XIAA 2YFOA 2D24A 4JHMA 3STCA 3HURA 3T7VA 4QNEA 1BTMA 4KF1A 5U7SA 3LXCA 3QN3A 2XWDA 1GUVA 3BLEA 3GNOA 5HWMA 2B7QA 1XD1A 2ZDSA 4K7VA 3SSJA 1EPXA 2NQJA 1KRAC 2YCLB 2BGSA 1FCVA 3QQ1A 4PULA 2ZVIA 5M17A 1WKYA 4MNLA 1E6ZA 2BVDA 5CG0A 1AL8A 2CKRA 3W2NA 4PCFA 1BQGA 4HHMA 4P8WA 3SCNA 2PF0A 2W79A 3M0ZA 4QHRA 5D02A 4ML4A 2HROA 4Q4MA 3AMCA 2YA1A 4WGHA 4JTTA 4X0VA 1JF6A 3SECA 4HIBA 2P0OA 3VOIA 2BP1A 1FWNA 3NQFA 2WJDA 1LP6A 4TVDA 1Z8AA 3PM6A 4WIWA 1F8MA 1KBBA 4MM1A 3WL0A 1JYWA 1VKFA 4P8UA 2G3MA 5FAJA 2PB1A 2C3ZA 3LCWA 1V03A 5CBBA 1HXJA 2J6XA 3I7SA 2QXWA 4J3XA 1F73A 2YXXA 3EKGA 4GXWA 4I5RA 1GVQA 4AUBA 2CESA 1I0DA 2ATSA 4DUWA 3N6JA 1E6RA 4RE2A 1DORA 2R91A 5CXPA 4OTKA 5AKQA 1EHAA 1UIOA 4C7GA 3VYLA 4Q7IA 3GBDA 5J5DA 3C86A 1ZBKA 5REQB 1W31A 4Q8MA 1BXCA 1XSJA 3S2LA 3GVVA 1JL8A 3PVFA 2Q71A 3G3DA 2MANA 3E1F1 1XKYA 3CL8A 3V75A 1BFNA 3WQCA 3O6YX 2C8NA 3PJTA 4Z2JA 4QLJA 1DL3A 4GX9A 3BARA 4BWLC 3QYSA 5EPDA 4B2DD 3WJZA 3NPVA 2CETA 4KEUA 3M0YA 3RK8A 4E2BA 3C4UA 3GQYA 3WK2A 3PZTA 4RZ6A 2I9EA 4AF0B 1RK5A 1KXHA 5CBJA 4OT7A 3H4XA 4XIAA 3NZQA 3SRKA 1TB3A 4QRNA 1DIDA 2ZZ4A 4V2XA 4H1ZA 2F38A 5EKYA 1KM3A 3AC0A 3CT7A 2I9UA 2DSWA 1GQNA 4DJED 3FVDA 2Y24A 4LAOA 1UWQA 4BS0A 1WX0A 3GIPA 2ZRUA 3AHYA 1JGIA 1LRNA 5LYRA 5AB3A 2A85A 3Q45A 1GVRA 1TUXA 2VZOA 4NXKA 1UH4A 1RBAA 4PH6A 1UWIA 1EXPA 4P7OA 2H3DA 5FJOA 1NOWA 2I1OA 1H7XA 3NDYA 5F1VA 4F0RA 4NF7A 1K9TA 2DFAA 2GJNA 1PBGA 4BI7A 4W93A 4F0KA 2QUMA 3BOLA 4OBRA 3O05A 3LV5A 4S3DA 3IGHX 2Y63A 1OD8A 1O1HA 3O3RA 1OCJA 4PCTA 3WDIA 1UP3A 3WLJA 4Y90A 3BL3A 5I07A 3OYZA 3UXDA 2Q02A 3WDPP 3S8HA 1PO9A 2QLYA 3WBYA 3G1XA 2QMJA 4FR6A 2BX7A 3ZOAA 4CGTA 5FKYA 1P7TB 3R8RA 3ZJ8A 3URAA 3ZQ9A 3EOLA 1NTHA 3CUFA 4K2SA 1IXNA 3OVRA 1W1A1 5A6KA 4HVXA 3KOYA 4K1WA 4UTUA 4OOZA 1R0MA 3V7PA 3BSMA 1OEPA 4LS1A 4A05A 4DO7A 4Z1CA 4PE8A 3CV2A 3BICA 1YNPA 4Q32A 3CQKA 1TSIA 3TTQA 2BHUA 1FWWA 2IS7A 3WQWA 3CTTA 1IXOA 4Q8QA 1E43A 1N8FA 4JIRA 3TC6A 1W32A 3UJSA 2VELA 4XZIA 1EA0A 1P1MA 2PWUA 3VNZA 2WSRA 5ABGA 4MZYA 3TN4A 4I6VA 1V3LA 2BOEX 1QBBA 3HF3A 3QXBA 1WZLA 3T55A 3OZMA 3F7JA 4KRTA 4WY0B 4TIMA 3STGA 3BCJA 1KKOA 4CNSA 3NQBA 5LNWA 1EQPA 1LCOA 3LK6A 2ACRA 1KRBC 5CH9A 1DJZA 1ZJHA 1ZENA 3A23A 4BFAA 3W24A 3ZO9A 1KTNA 1QXLA 1G5AA 4OUIA 1G4PA 4DWDA 5H8PA 4UNKA 4EK7A 4ZENA 3NUKA 1A0CA 3SRFA 2R14A 1TVPA 5HANA 2XZ9A 2ZYFA 9XIAA 1RAKA 3OLGA 4H83A 3EA1A 4WXZA 2NQZA 2PWEA 4AX7A 5KITA 4B3ZA 1XFBA 1VYPX 1J0HA 2C1GA 2YL6A 3H2CA 3RR4A 2DV0A 2TODA 1MRAA 4US5D 3IJIA 1NFPA 3WDQA 4MWAD 2DZUA 3M5VA 1KGWA 4KBXA 1REQA 3I7RA 2Y8UA 1GVYA 2X09A 4PTXA 1RV8A 3CAWA 3SN4A 1S2AA 4ZO6A 4BQ4A 3S1GA 1WZAA 2IQ0A 4ICNA 3WH6A 4E2VA 4XAGA 2XISA 3H55A 3CZEA 2YSWA 3SFKA 3FCPA 5EMKA 1OG0A 3NL6A 3WG6A 4L9ZA 2WMIA 4BF9A 4UUIA 1O12A 1O5XA 5XINA 2J8FA 3JZUA 3IAQA 2C6QA 4QG6A 3W6MA 3EOSA 5DO8A 3HMCA 3GD6A 1A3WA 2YKKA 3N12A 2EQDA 1RALA 4BWLA 3T1GA 4MDPA 5TIMA 3LQLA 5A8PA 5K9CA 3TWAA 5JH1A 2WZHA 1KFJA 1EO5A 5DBTA 5C71A 1HG3A 4C91A 4QQ3A 2QZRA 4DBUA 1FHLA 4GIRA 2VT0A 4PCPA 3WD1A 2VEIA 1XLHA 1EB3A 4DY1A 3OZPA 4K8GA 1E9ZB 4XBSA 1RPXA 3EAUA 4W7UA 4Z0SA 1PS9A 4JN7A 3LI0A 1CGWA 2OELA 1MEWA 5FF4A 4EWJA 3K2GA 3S42A 3KTCA 3HQNA 3DG7A 1JPMA 1GVEA 1TKKA 3GS6A 4ECLA 1C29A 3W2KA 3W7RA 3OTRA 4J3ZA 4KEMA 4QFUA 2Y2WA 3E2SA 3I10A 5B7YA 4UWMA 5KZEA 4RLIA 3NPXA 3K4AA 3H4GA 4XD6A 1P6WA 3GXTA 4FALA 1KM5A 4PB5A 5E70A 5FIPA 5HNRA 1NDWA 2JKAA 5BRPA 4AIOA 1OQFA 1THFD 1V6TA 1UR4A 2GJXA 2R1NA 4KGLA 3EWDA 5HBFA 1FP9A 4HYVA 4LV9A 2Z1WA 2VGGA 3CUXA 1NVMA 4CCZA 1BG9A 2GWNA 3CEPA 3FJLA 3AYRA 1PIIA 3H23A 3UWYA 1K03A 2ZXQA 1BSIA 5D9NA 3TQ0A 2WMJA 3S1UA 3DUGA 1K8ZA 3H7VA 2NW0A 4ZVJA 2ZXAA 1CPUA 4L6OA 2F6XA 4MDOA 5RUBA 3AXMA 4TV6A 3L4ZA 2GSEA 2PCQA 3ARVA 2UWFA 4D8ZA 3AS2A 4JICA 2L5HA 1DV7A 2OZ8A 3GLCA 3WNMA 4C6KA 4IMDA 4X3ZA 3VAVA 1XLMA 4JPGA 4GGHA 4DNHA 3T78A 1XDMA 5DBUA 1WAWA 4IXXA 3L2IA 3H7RA 1V3HA 4MHBA 5ECUA 3Q58A 2ZXBA 5AY7A 2Q01A 3GXFA 4I7WA 3AXHA 3ZLGA 1FX6A 1KCLA 2IPWA 3QZ6A 1ZSXA 4FMVA 1T5AA 4GK8A 4D2JA 1DWJM 3ZJKA 4Y8FA 3ZR6A 1JI2A 4UOZA 2J66A 3UZ5A 2DVUA 2QDEA 3URQA 1VF8A 4GZIA 2X7WA 3EPMA 4D6DA 1B3WA 4Q8NA 4OOUA 2R6OA 5HQMA 3KWXA 1SZFA 3S46A 1E5NA 4JX4A 1XW8A 2Z2AA 1B1YA 5F1UA 3FVMA 3BGGA 1W5MA 1GOIA 3WIJA 3MO4A 5ABHA 2OGJA 4NL1A 1AQHA 2GDVA 5G2HA 3UGRA 1XDJA 1AW2A 4M82A 2G3NA 3IV8A 3N6HA 1NWSA 3T44A 4G9PA 4HP5A 3GFYA 3N9KA 4ATDA 3LHYA 2KZHA 3QV9A 3DECA 5DLCA 4AZHA 4O11A 3WLNA 3TW7A 3V18A 1AW5A 3UBPC 1NDVA 3U8GA 4D6EA 1JXKA 4NZJA 1QATA 3WLIA 1TMLA 4LSBA 1K9FA 3H2OA 1H7PA 3CMGA 1PIGA 4XG1A 1BWLA 3CHFA 1PX4A 3QM3A 2I5GA 2WZIA 3ARQA 2FDMA 1F05A 3KBVA 3UA4A 4C5ZA 3MYPA 1VFLA 2GSHA 5TBOA 5E1QA 4Z2HA 3DENA 1CDGA 1S46A 4RK8A 1DTNA 3A3HA 1P48A 4CN1A 1I6NA 1CWYA 2HS8A 1O68A 3SUVA 3BLLA 2DQWA 2DSKA 3KEHA 4GUGA 3CUZA 3O07A 2F8QA 1VFMA 3M41A 1Z69A 3W1XA 3HG2A 1FFRA 3L66A 1ISZA 1WCGA 3GIYA 1QNVA 2RDTA 1W3TA 4R85A 3GG1A 4IGHA 4D6CA 3GE7A 4QE1A 1NFGA 2HTMA 4IHCA 4AH7A 4ZB0A 3GX9A 2DZBA 2BV9A 3NNTA 1KXTA 1RA5A 1UC5A 2H8XA 4JOMA 1TPEA 1ZCOA 4DBSA 3GXNA 3PG9A 4AYGA 4AZIA 4ICCX 1VYRA 2WAGA 3MP5A 3TSMA 5B80A 2P88A 2E40A 4IL0A 3CEUA 3APGA 4WQ6A 2Q8ZA 3BH4A 3BPWA 1SZGA 3GDMA 4LCSA 1E4LA 3P61A 2XIJA 3GFXA 4P5UA 5AYXA 2MUCA 4W8BA 1Z42A 5C2XA 2DIKA 3WQDA 2XN0A 4HK7A 1YX1A 1AQFA 3VIOA 5LHFA 4DUXA 4UFIA 3E9AA 1T41A 1ISVA 3BWWA 4PSRA 1EEPA 1OYBA 1JDAA 5LIKX 4CU7A 3IIVA 3LBOA 4XO6A 4AD0A 4IIBA 2XGBA 1UMLA 5I79A 2J9XA 4C6MA 4O14A 3IRSA 1US2A 3PHAA 4RNIA 3R0KA 3QZEA 5BCAA 1CXEA 1Y8BA 1KFWA 2VGBA 1XH1A 1VHCA 3N13A 1VZWA 3V0TA 3W28A 1GQJA 2ZKMX 2X0SA 2NV9A 4K36A 3TLQA 3RPDA 3IAPA 4BZYA 3USZA 1M01A 3NTYA 4UTJA 3E5BA 4KCVA 1RJQA 3W71A 6A3HA 5D4YA 1QO2A 3TYAA 4S38A 1E0UA 1XIBA 3VOGA 2EXOA 4XQ6A 3KRSA 3ZJ6A 2BY3A 3CNYA 2ZX9A 3CLWA 1G7UA 1RCOB 1EBGA 1LBMA 2PDHA 4TV5A 1GOQA 2IUZA 3YPIA 1F7BA 1FH8A 2ZWZA 3DEQA 1ADSA 3LU2A 4IMEA 5I3KA 3C56A 3M0MA 1BHGA 3QLDA 4A4AA 3ES7A 4GIAA 2BY1A 4RCXA 3TTSA 2P0IA 3FA4A 1ENUA 2ZZ3A 2JEPA 1XRFA 4PMXA 1I9CB 3RRAA 4HTYA 4FXFA 3I6TA 1R3QA 1R7AA 4PFHA 5A2CA 3KS6A 4E4PA 3N6QA 1XCWA 2VRQA 4Z1BA 1BD0A 3CK5A 2R8WA 1GOKA 1TPDA 3NG3A 3M44A 1RQHA 4KETA 3BAKA 3OOQA 4WJ8A 3ZFHA 1EJWC 4FNTA 3VD9A 1JAKA 5CPLA 3G8RA 4FK9A 3PPCA 4NT0A 1BGAA 2NUXA 1QW8A 2OLAA 4HZ6A 1HKJA 2CEQA 4PEKA 4LAKA 3W38A 4NKCA 3GTIA 1J6PA 1TVNA 3H54A 3NL3A 1TV2A 4A35A 5BU6A 5EFDA 4MNKA 4JFUA 4R34A 1XH2A 3QQWA 3WUGA 2HK0A 4DBDA 3PZ9A 2Y7FA 1W91A 1J10A 3LTSA 2ZTKA 4E2DA 4F9JA 1CLVA 3B9DA 1GYNA 3XINA 1J4EA 4IMFA 2B7OA 2QR6A 1IXQA 1R2SA 2OXNA 2VD9A 1YRRA 2YLAA 3W7LA 1AW1A 4B5TA 3RF9A 3AOFA 3GU9A 4XWUA 1ZFJA 4QAIA 3CHDA 1SJCA 3GXDA 4HJFA 3W7MA 3NZPA 1GTHA 2Y62A 1RD5A 2QPSA 1CGTA 4N9EA 1N82A 4MVAA 2GJXB 5CSRA 1J0ZA 1EIXA 4RXGA 1W3HA 2YBUA 5D04C 4HN4A 4L4PA 3W75A 2W63A 3LENA 2E9LA 3FJ6A 4HMDA 3A13A 1T8QA 1RBOB 1FWFC 3LRLA 3LYEA 3TR9A 1DOSA 1UWRA 4H01A 3UETA 4OU1A 3SGGA 3JRKA 4KFNA 1BF2A 2RGMA 3FDGA 2YA2A 3TSBA 2X1SA 2P53A 3O6AA 4XUYA 1V7AA 3B3DA 4AEOA 4ZL1A 2XWEA 4N0RA 1E56A 4FF7A 3UWQA 2PDPA 4U2YA 4YIWA 3MSDA 3P93A 1PUDA 2DH2A 3C52A 5JVLA 2J7EA 3ONCA 3WLRA 3POCA 1TUFA 1F4HA 1AMKA 4NRSA 4HU0A 5I24A 3W7GA 4LNYA 3GVQA 1O66A 1QHPA 5D32A 4ERIA 1JULA 1K8YA 2TAAA 3OLIA 3AYVA 4WDUA 1BWKA 5M2FX 3EPOA 3THDA 5A69A 4TMBA 4PC8A 3PPHA 1D7FA 3ZZ1A 1U1JA 4LU0A 2PUZA 2VEPA 3KTXA 5E5CA 3IJQA 3BMXA 3W53A 3UJ2A 1MZHA 4TOQA 1TPFA 3UXKA 3VZYA 4MAVA 1EQCA 4MB5A 3KDOA 3L2MA 4PTWA 3S1XA 4R7WA 3KRUA 1EC7A 5E0FA 1B4KA 4C1NA 5GPRA 4UTWA 4PRTA 3WN6A 1OABA 2ZUNA 4UZSA 1K3UA 2GPTA 4U10A 4BA0A 2JF7A 2X2GA 3LRKA 2BGNE 2Y5EA 4E2OA 1KM2A 3NPWA 3CUGA 2BVWA 5EMJA 1UD8A 2GVGA 2RJGA 2HNEA 3W7DA 1DE5A 2YGYA 4KERA 4N6EA 3NQ6A 1VD6A 3VFLA 3WKZA 1HJSA 1LOSA 2W92A 4FNSA 2C79A 3LSBA 2ZC8A 1MDLA 1Z3NA 3IUDA 3P6LA 3TEVA 8TIMA 5D38A 3AIWA 3UPWA 1DE6A 5LGXA 4U2ZA 4PMUA 1SO6A 3VD4A 4WDXA 4Q8TA 5FF3A 3TUUA 3UG5A 4AYSA 4LBUA 3V3WA 2SFPA 4DEFA 2VR5A 2RGLA 3S0CA 2E1WA 4AAJA 1W5OA 2IXUA 4S3KA 2Z1BA 1X96A 4YCOA 4XAYA 3B40A 1ZGDA 2BXZA 3L67A 2EHHA 3UZJA 1DJGA 2ISWA 2HVOA 5IHSA 3MMDA 4H6EA 4XSLA 2GQ3A 4A3YA 4L4OA 3GH7A 1PSCA 3H4WA 3VNJA 1EP1A 1JUKA 4QJ1A 5T9CE 4GCAA 3QMSA 1LG2A 2IKIA 5CBIA 3PK7A 4H9MA 2BASA 4L6DA 4UB9A 3C61A 5CC3A 5CGMA 3DBPA 2VTFA 2YYTA 3GBEA 1IIGA 3KM8A 2VEMA 3AIVA 4Z1YA 3J7HA 4H9XA 3NVDA 4CLMA 4LUSA 2G4JA 1UQYA 4WXYA 2WNQA 2D0GA 4U28A 4GACA 4GOAA 4PMDA 2EPKX 1JYVA 4YL2A 1KQZA 4U5KA 3FXGA 1QMLA 4UIOA 4Y96A 3PZVA 3D6NA 3GDLA 1B31A 2QV4A 3WQFA 2UY4A 3DI1A 2V5CA 5AC5A 5ABFA 1LZOA 2WMIB 3GR4A 4HPJA 4ILSA 3DFPA 3T9PA 4YU1A 1OZMA 3L0KA 3AYTA 4ZO9A 4IF2A 2XINA 1P7TA 4GD0A 1AFSA 3RU8X 2YL5A 4DVOA 4ZQCA 2C0AA 4CEUC 1CLXA 3G0UA 3LG3A 1UW9A 2FZ8A 1A5NC 3G1DA 4I9JA 3WBEA 1KR1A 1PPIA 3GAKA 2WQPA 4IUOA 1E0VA 1D3CA 2B4GA 1OWQA 1I1WA 1XIGA 1L2UA 1JPDX 4M7SA 4RNJA 3WLLA 1QU4A 1Z44A 3EZ4A 3WEOA 2ATMA 4AEEA 1CENA 2NWSA 2WMHA 3LBMA 1T99A 3BGAA 3AS3A 4H2HA 3B8VA 3QR3A 4XBKA 1YBQA 1CGYA 3GU2A 4NI8A 2EJAA 1QW9A 4IXHA 5HMSA 4LVAA 4GXPA 2XVNA 4I7UA 4AZGA 3H6OA 1SJAA 1HGWA 3FEQA 2IXVA 1HKIA 1PYMA 8RUCA 3LTYA 1T0OA 4C6DA 3GO2A 4FAMA 4LGXA 4HSHA 2DY3A 3LS9A 1A5KC 4QSHA 1ZBCA 2HXUA 1Z9AA 2IPFA 1X8FA 3FGCA 2FPYA 1TJPA 3M7WA 4Q6JA 1VENA 2IKJA 2FVKA 2C7FA 4HMNA 3LGEA 1S3TC 3A12A 2CZDA 5DCEA 1L8PA 5MHBA 3N15A 1ZPTA 1GVOA 3EDKA 3CUJA 1R9YA 3W9ZA 2Z00A 3CMJA 5G2IA 4LY8A 4GQGA 2JGYA 3IJLA 1Q4NX 4V33A 4D72A 1Q6DA 4UTWC 4I9MA 3VMPA 1Q6GA 4LC8A 1BPLB 2PURA 2V2HA 4X60A 2REQA 4AU0A 3MUCA 3TQKA 1RCXB 3W29A 4IJCA 1ZHAA 2QJMA 2I16A 3NIYA 4U3CA 3IJ6A 3MSYA 3APTA 5DMNA 5TNVA 3LHUA 3B9OA 2J7GA 3LNMA 3BXWA 3WDRA 3FN9A 1VFFA 4E8CA 3M6DA 2WJEA 1K7EA 1T8XA 3BAXA 2FMNA 2PPGA 3R58A 3VIMA 3PZUA 1QI3A 1SO4A 1I60A 1J0JA 3DG3A 1TZZA 3C2OA 2XU2A 1DTUA 3DOPA 1E1CB 4WLCA 4RDVA 3DHUA 1GTEA 1Q85A 2W61A 1O5QA 1ZP3A 4YWSA 5M3WA 2VUNA 3VIHA 3CV6A 4JL1A 1J5SA 5J04A 1H7NA 1XLDA 5EY5A 4FR1A 7ODCA 3TJIA 1A5BA 3Q4DA 3VABA 2Y5JA 4QJ3B 1E3ZA 5HOSA 3LCHA 1R5YA 1KM4A 2J78A 4YN5A 3TAOA 2WMGA 1QOQA 4ZXOA 3W76A 3RJXA 3W1MA 3B8DA 4KCWA 2QJJA 3MWCA 4Q3MA 5C9ZA 4AD5A 1UH2A 4WOQA 4ZTYA 5LA0A 3L68A 1V6UA 1DJWA 1XLEA 1LWHA 1EP2A 4LB3A 1YPIA 2O4MA 4V1YA 2ZXDA 3N9RA 3RJYA 2X30A 3PG8A 4FNQA 3D47A 3W6YA 1R6WA 3HQPA 3BK0A 1SQ7A 1WE5A 2AGKA 4R9OA 5AECA 4ZE5A 3NQ2A 3QC3A 3PZGA 4PRWA 2XHYA 1WV2A 3QY8A 2HBVA 3UYCA 2DT3A 2NWRA 5JIWA 2FZMA 3UFYA 4N4QA 4IM4A 5CGTA 6TIMA 1KGUA 3QRHA 2BZNA 3T0CA 3SUWA 1F3TA 1IEWA 1CT5A 4UCFA 3ZLFA 3B0UX 1FHUA 1Y65A 1GW9A 1ZL1A 5DANA 1I1XA 3IIXA 3USBA 4LUTB 4CN6A 2XFWA 1XHGA 1W0MA 2C18A 1VFHA 1XYZA 4FX6M 1VGAA 2HV5A 4GY1A 4Q8UA 3WFZA 3UJFA 1PXGA 4DLFA 4PCNA 3W1PA 2VDGA 5FSDC 3HGJA 1LT7A 2FH6A 2VFIA 1IYXA 3T07A 5AC6A 5EA9A 1R2RA 3E6EA 3HMJG 4V1XA 4WY0A 3SW6A 1JDCA 1TV4A 3C6CA 1B5TA 2GVLA 4EPBC 3GFZA 1GOOA 1TJ2A 3R5EA 1YTEA 2POZA 1A50A 3GNDA 2WM0A 4DBWA 1B30A 1OC7A 4C6EA 3TYEA 2X7VA 4HU4A 4ZFCA 2Y8VA 4I6KA 4RXFA 5C0QA 4UQDA 4XTIA 3SZ8A 4AZ6A 3PBYA 1CIUA 3LLFA 4XVDA 2XDFA 1JG9A 1OVDA 2Z6JA 3SDOA 1MXDA 2DUXA 2VYOA 5A6BA 3LMZA 4UTIA 2VM8A 4A2RA 1DJXA 2R1MA 4CD5A 3AU6A 3ITXA 3CIWA 2AL1A 1QHZA 3FLUA 3NL2A 1B9ZA 3HTWA 3E74A 2PLKA 1K70A 1O7AA 4MB3A 3EEGA 3PWIA 4C7DA 1ODUA 5JBEA 3ZT7A 4HHHA 3LCXA 3TJ4A 1VBRA 1TPB1 1IEQA 3LA4A 2B31A 3N3TA 1FHDA 4NZCA 2QPXA 4XZLX 5BOEA 4L1GA 3S9YA 1GNXA 2E8YA 4C6CA 4IG2B 1L6GA 2QV5A 2OKTA 3O9NA 4US5A 2J7HA 5ECVA 1LUCB 2VO5A 4H8VA 4ES4A 1X39A 3H53A 1OHLA 3QY6A 3UQNA 3PF3A 4FI4A 4TUFA 2PODA 3FY1A 4MIMA 3CV1A 1C8VA 4O16A 4X2PA 1HJUA 4FOJA 3KL0A 1GW1A 2NLYA 1Q6LA 3VKBA 1C7SA 4WRHA 4MWAC 1ONWA 4HK6A 2BNJA 1P6CA 4LYRA 2QQ6A 1RXOB 4CD8A 3CASA 1NOUA 3F5JA 2R1KA 3SCRA 2E3ZA 3CT2A 3MUY1 4S23A 1HKKA 1PHQA 5SWUA 4J3SA 3PWGA 3T8LA 4WEVX 4A3HA 2ZZ7A 2NXHA 3F4CA 3WH7A 1W56A 4FXRA 1J2WA 1UC4A 1EF2A 2KAUC 5HWJA 3DG6A 2I17A 2GGGA 2OZ3A 1DJIA 3FA3A 4LTSA 2Y70A 5D9OA 4RR4A 2J79A 3TA6A 1FOBA 2XFYA 4D8LA 3BJSA 4GUFA 3VOHA 2P5NA 3V1PA 3NM1A 2CU0A 3TR2A 2CZEA 4OECA 3GK0A 1TJRA 2NX1A 4UFMA 5L6UA 3VIPA 3WNKA 3VMOA 1R9XA 3LCIA 5L9FA 1Q6CA 3UWWA 3TW9A 2QDGA 6ALDA 4D1IA 4GA8A 2OEKA 3ZVIA 2QF8A 1V4YA 3VKKA 1BVWA 3GSMA 3GZAA 1HGYA 2EPOA 4LRSA 5E0KA 3OIXA 1F3EA 1CXFA 4B5SA 3DC8A 3T4CA 4ACZA 4DQWA 1CB2A 2VMFA 2FZDA 3UY8A 4I90A 1YE4A 4MKVA 2YR1A 4GO9A 3SAZA 4BQ2A 2HVMA 3PUEA 5FCZA 3U4FA 3HV8A 3POHA 2VEFA 4NNCA 2UZ9A 4EACA 1ZAJA 3OZOA 1MXGA 4X22A 4QDWA 3LLXA 4G56A 2PWGA 3B4UA 2HVNA 3UWUA 3QPYA 4FNRA 4PCSA 3RN6A 3BG5A 3QW3A 2A2IA 3P60A 2R82A 1M53A 2VI0A 3CLMA 1TWIA 2EF9A 4S3AA 1HKMA 4F79A 3QLLA 3M07A 3DFQA 2NV1A 1VEMA 3ZR5A 1FWSA 4NG3A 3AO0A 1M41A 1FRBA 3VKDA 1XUZA 1UKQA 3W01A 3F4VA 3VNDA 1BQCA 4F2TA 4DZIA 4RNHA 1XG3A 4H6KA 3PP7A 1H5VA 4R53A 4XBJA 3M0IA 3VTRA 2Z7KA 3M0JA 2NQLA 2E7FA 1G0CA 2TPSA 5C9UA 3UR7A 5I3DA 1P43A 2O4QA 2C13A 4RW5A 1IZKA 1H5YA 1YPFA 5CJNA 5T91A 4HCHA 3UG4A 4YJ5A 4F48A 4M5PA 3MCNA 4ZB2A 2RFGA 3HN3A 3NL5A 1F76A 4M24A 3VOCA 3U5UA 4MJMA 1VS1A 3DZ1A 3LUTA 4N02A 1F74A 3WMCA 5JUVA 4BF7A 3LHVA 4M0XA 3NR0A 3LPOA 2WLZA 3M7SA 1EJSC 3B97A 3D3AA 4R5EA 5DQPA 2A7RA 3R13A 4GCXA 5E9AA 4B2DA 5CAKA 3QYQA 4AVFA 1GGOA 5I06A 5I03A 3R0DA 1OCQA 1QHOA 1UUOA 3G18A 4J1OA 4PUDA 3ITYA 4GYFA 1X1NA 3THUA 1RD6A 3AZTA 1UG6A 2JFEX 5MKGA 4WHBA 4GFSA 3ITLA 3ITTA 1HZYA 4KFPA 1JGMA 4DNMA 4O1AA 1EOMA 3VK5A 4AZCB 7XIMA 1TIWA 4LUSB 1VJIA 1QI2A 1O5KA 2H90A 1QDSA 1NF7A 3E0VA 3PJUA 2OYKA 1K9EA 1XYCA 1V79A 3CBWA