2WAGA

The structure of a family 25 glycosyl hydrolase from bacillus anthracis.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
217
Chain Sequence
GSSHHHHHHMDRYEIKGVDVASYQGDIDWRELEKQNMKFAFIKATEGSAFVDKYFSKNWTNANKTSMRVGAYHFFSFDSKGETQAEQFIRNVPKYKQALPPVIDVEFYANKKDNPPKREDVTKELSVMIEMLEKHYGKKVILYATQEAYDLYIKDAYPQCDIWIRSVLTKPSLSDERKWTFWQYTNRGKLSGYNGKEKYIDLNVFYGNEEEFENYGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LYSOZYME, PUTATIVE
publication title The Crystal Structure of a Family Gh25 Lysozyme from Bacillus Anthracis Implies a Neighboring-Group Catalytic Mechanism with Retention of Anomeric Configuration
pubmed doi rcsb
source organism Bacillus anthracis
total genus 77
structure length 217
sequence length 217
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wagA00
1V3IA 2WYSA 2A3HA 4JKMA 3AI0A 1NQ6A 2V5CA 2Y24A 3EYPA 4X0VA 4D6IA 1HJXA 2CBUA 3VIJA 4GZEA 1NP2A 3KE0A 5A2AA 2VJXA 2A3CA 4LYRA 4HMDA 2D1ZA 4XZBA 2X0HA 3NCOA 5BCAA 5A8MA 3WDQA 2VO5A 2WCGA 3GXIA 3BCDA 4UFMA 3VGEA 1E4LA 4W88A 1C93A 1QI5A 2XVPA 1JD7A 4ZEPA 4PMYA 1JYXA 4QCFA 2VZOA 1Q6EA 3SEPA 1BAGA 3RM8A 3VIFA 2E8YA 2CKSA 1UA7A 4KGJA 1KB3A 3WD0A 1W9XA 2WANA 1ZBWA 3ZJ6A 3VMOA 2BY3A 3J7HA 3QR3A 4U3CA 3OIHA 2PC8A 2XHYA 3EDDA 1W3KA 5AYIA 1X6LA 1TMQA 3VIOA 4AISA 2FGLA 1DWAM 4P8UA 5DMYA 3A3HA 1BYBA 1HJSA 3VIGA 1HKJA 1UUQA 2YBTA 4M29A 3RO8A 1Q6DA 1V02A 2EJ1A 2A3BA 4FLOA 3PTMA 4GO8A 3SCUA 3WH9A 3L4XA 4WKAA 1JZ7A 2WC7A 3K46A 4OIFA 2YA2A 4DUXA 2WZIA 1MXDA 3MV11 4JKLA 3KWXA 2ZIDA 1V0MA 1FH9A 2VR5A 2W4XA 4AD2A 3ZT7A 2V3EA 3OA5A 1C7TA 1JXKA 3UR8A 2IXUA 4H8HA 3TA9A 1NARA 3MV01 2EPOA 4PMXA 4NRRA 2MANA 3WD2A 1UWTA 1E6SM 5M3WA 3BSHA 1VFFA 3AIVA 3RDKA 4PRWA 1JDAA 2WNWA 5FCZA 4UOJA 2Q8XA 3I3BA 1VF8A 2W91A 3WIJA 3L4VA 5CJ5A 2V38A 1E15A 1DEDA 2D0FA 4HU0A 4AZCA 1FFRA 2ZWZA 2EXOA 2YIHA 5GNZA 5AYBA 4ZXOA 3K8LA 3POCA 2EBNA 3CGTA 3ARQA 3VNYA 2W66A 5ABFB 2WSPA 4B16A 1E6XM 4A4AA 4B9ZA 1WDPA 1EHNA 2GSJA 3OLGA 3L2MA 4MB5A 5ABGA 3WF4A 1WZKA 3MMUA 2CBJA 2WC3A 1WDRA 1J01A 2CHNA 2WZEA 2XSAA 2VVSA 1MW3A 4D6JA 3RPMA 4MNLA 5CSUA 1MFVA 5BXSA 1PX3A 5JBFA 4UCFA 3MO4A 2WPGA 4LYPA 4M80A 4UQ9A 1FOBA 1C3FA 4DUWA 3WF1A 1S46A 2YDQA 4AD4A 3ARZA 3VU2A 2VRJA 1JZ6A 1US2A 5A8QA 1DWJM 2J8GA 2EPMX 1AMYA 3PZNA 5HOSA 1JZ3A 2DSKA 1ECEA 4MTVA 1MQRA 3VINA 1KXTA 2G3NA 1K9TA 4DWSC 3WD3A 2ZX8A 2WMJA 4TVCA 3NJ3A 1BHGA 1QHOA 3N13A 1XSKA 2JIWA 3OZPA 4Z2IA 1KXHA 1UWIA 4Z2HA 1HJWA 4UTFA 5IXEA 1KGXA 5C71A 1V6UA 3NSMA 1TFVA 2GK1A 2WXDM 1VJSA 2OSXA 1FH8A 2J25A 3D3AA 1ESWA 4N42A 1UD4A 2YDRA 2WMIB 3CHDA 3W82A 3SCNA 3TTSA 1W1YA 1V0NA 1GQJA 4JZ5A 3QOKA 2WK2A 4UZSA 1UHVA 4WK9A 3KZSA 1PX8A 1KWGA 3LPFA 4E4PA 1YHTA 1MW2A 3RJYA 1HF6A 5IFTA 1WO2A 4ACZA 1CYGA 1WCGA 1J10A 1M7XA 2PBGA 3VIIA 1JZ2A 3OGRA 1U30A 1OM0A 2VQUA 2DSZA 4J28A 1BGAA 1VRXA 4FLSA 3CPUA 4QP0A 2WVVA 3ZO9A 3VX0A 3HMCA 2ZX7A 4IISA 4P7NA 1EQPA 4W85A 3WUFA 2OYMA 1XD1A 5HPCA 4YHGA 1M53A 5I5RA 1HKKA 3GH7A 2UY2A 1R87A 1QNSA 4JL1A 3U5YA 2BXZA 1EDQA 4PTXA 5CGTA 3N9KA 1DWIM 4H8VA 3WN6A 1UWRA 2VRQA 4RE2A 4UNIA 2V3DA 5BWFA 3DHPA 1OGBA 4GIAA 3CZ8A 3UG5A 2A3AA 1G0CA 1NWRA 4UR9A 1BGGA 4ATWA 2BY1A 2WHJA 1PAMA 1ODZA 2XFFA 2DSWA 5I0DA 4DM1A 2ZE0A 2JFEX 3T0BA 3W6LA 1DTUA 3WNLA 2VCBA 3WD1A 3T08A 3WQ8A 4B9YA 3IJ9A 4PCTA 1QI4A 2BHUA 2UWFA 2VX4A 1LL7A 2WKLA 1HP5A 2VX5A 3N11A 2XVGA 3AROA 4HTYA 1QNOA 1V6XA 4NZCA 2CYGA 2RGMA 1KBBA 1H1NA 1YQ2A 3CUJA 2JEQA 4URIA 1BLIA 3A4AA 4XX6A 5HDRA 2Y4SA 4CD5A 1RPKA 1X1NA 4IM4A 2X8RA 2O9PA 3T2QA 3WH5A 1VIWA 2CNCA 3GYCA 1GNXA 4M1RA 3THDA 4CD6A 4CCEA 1E0VA 1V6YA 2XUCA 1W3JA 3AXXA 3QHNA 5HPOA 1ODUA 2VC9A 4F8XA 4B3KA 5A6JA 4Y7EA 1CXFA 1E6ZA 4A3HA 2ZUWA 2XFYA 3W38A 2W92A 3WSUA 2VOTA 1TVNA 3SUVA 3MU7A 4JHOA 3W29A 1LG2A 3AISA 4MAZA 4GKLA 2J78A 4N0RA 3VILA 1JAKA 3QHMA 4W8BA 1BFNA 1J0HA 4F66A 2CHOA 3AMDA 1CXIA 3IAPA 2CPUA 2WBKA 4H41A 2PF0A 1H09A 2W5FA 2HVMA 3AHYA 3W24A 5ABFA 3SCPA 2DT3A 4J3UA 4D6CA 2XVLA 4OKDA 5E6YA 3VDHA 4WKFA 5EFDA 4HA4A 2D23A 3WH6A 3CLWA 4JFUA 4KMQA 1XH1A 5D8ZA 3EDJA 5GPRA 3PHAA 4Q7NA 3VGFA 1W32A 2VX7A 5M03A 1U2YA 1E56A 3CZKA 4NF7A 2OSWA 2TAAA 3FN9A 4P8VA 1B0IA 3AHTA 1BYDA 3SURA 1DP0A 4K68A 1OIFA 1XRVA 3AHVA 4KRUA 5A2CA 2B31A 2WZHA 4D71A 1U33A 4PTMA 2UY4A 3A47A 5I24A 4WSKA 1G9HA 1KQYA 3AZSA 2O9TA 1UQZA 1Y7VA 1QNQA 3B9AA 1BSIA 1LL4A 1P6WA 4J3XA 3AHXA 4UFIA 4NI3A 1E43A 3NUKA 3VDBA 2X1IA 1JNEA 2QLYA 3E1F1 2JF7A 2EO7A 4J3WA 3WNPA 2E40A 4TTUA 1W1TA 1WZAA 5CPTA 3WQWA 3GXFA 2QV4A 2WMIA 4AEFA 1VFUA 2BHYA 4KH2A 3PBGA 2YA1A 4MDOA 2ZX6A 1D2KA 4PMUA 2GJRA 5C70A 4P7QA 5CLTA 2D22A 2PBOA 4HMCA 3AIBA 3TTQA 1QNPA 1GOWA 3GBDA 2EPNA 4IUGA 1EDGA 3F4VA 2D3NA 4BCEA 2WVSA 5I77A 3WUBA 3SUTA 3RM9A 3AS1A 1JZ4A 1CGYA 1IZKA 3BMVA 3VM7A 5M17A 4U5KA 2BVYA 2VUYA 4LQ1A 2NSXA 5KEZA 3WY1A 1H0IA 1CTNA 3ARYA 4AW7A 2J4GA 4JFSA 5D4YA 3ZJ8A 3W37A 4D1JA 5BYWA 3U57A 5IHRA 3GNRA 1E0XA 2FHBA 2XYLA 1HIZA 1PEZA 4BA0A 4CD7A 2F8QA 1F4HA 2VMFA 4ZE5A 2OYLA 1CNVA 1W9BM 4DUVA 1VAHA 3QOMA 4D6GA 3IK2A 4FMVA 1JD9A 3CHFA 1BYCA 5DT7A 3RIKA 5I79A 2YL5A 3MS8A 2VNCA 2YOCA 3MSGA 1X6NA 2DIJA 1H5VA 1H3GA 2J47A 3CH9A 3U7BA 3S2CA 1L8NA 1RP9A 3FHAA 4EE9A 1C90A 3T0AA 3KEHA 2G3IA 5A6BA 1TCMA 1XV8A 3ARRA 4D6DA 3UCQA 3ZR6A 1NM9A 4C7FA 4QLJA 1GUVA 3VIPA 2ZUUA 1LQ0A 2E8ZA 1PIFA 5CG0A 1JAEA 3QGVA 1KWKA 2CETA 4W7UA 3GH5A 3K4DA 1W3LA 2PWGA 1FHDA 3AJ7A 1K9EA 4M24A 4AD5A 2GDVA 2WW5A 1BQCA 3F5LA 5CZKA 1E72M 2VVNA 1L0PA 2XVKA 1J0ZA 3POHA 4CCCA 2FDMA 3BSGA 4W7VA 1EQCA 3AICA 4MB4A 4H2CA 5LA2A 2O92A 1FP9A 4HOZA 5A2BA 5A94A 3VDCA 4IPNB 8CGTA 2V3GA 2XJ7A 4R5EA 1HN1A 3AIWA 5ABHA 1KCKA 2X2YA 1UR8A 3BAWA 2DT2A 1XC6A 3ALGA 4PMVA 1G01A 1V02E 1GJWA 2WSKA 1GZJA 1CGUA 1FH7A 1JF5A 4DWSA 1UH2A 1E71M 3FAXA 1OSEA 1SFSA 1B3XA 7A3HA 3AMKA 4Z2JA 3N1AA 3WNOA 3FY1A 4J3SA 1PZ2A 2IUZA 4CVUA 2XIIA 1LWHA 4BQ5A 4UQAA 1TA3B 4HPHA 1H4PA 1TR1A 4TX8A 3W4RA 2XGIA 3WUEA 4W86A 4W89A 3WDPP 2X09A 3GNPA 3ZJKA 1CGTA 3T09A 1ISZA 3AZTA 2YA0A 4GPNA 1DHKA 1UD6A 1V03A 3UESA 1D7FA 1JDDA 1R8LA 3FHQA 4UOZA 3AIUA 1XHGA 1NWTA 3VOCA 1UR2A 3AIQA 4M81A 1CBGA 1NWUA 2W62A 3RM4A 2UY5A 2VZVA 3EDEA 4QFUA 4HU8A 3VDAA 1LLOA 2WHLA 3CUGA 3WDIA 2J7GA 3IANA 1LWJA 1RD6A 3MANA 1EIBA 3CHEA 3F5KA 3WL0A 4TUFA 1ZU8A 4CD4A 2YKKA 1GONA 4CN1A 7CGTA 1BVNP 1MWOA 1TE1A 4HZ8A 3AHZA 4JFVA 3WEOA 4DM2A 3LPGA 3WF3A 3RMEA 2IXVA 1CIUA 5A95A 2Y8KA 1TVPA 4AIOA 3L4ZA 1UD8A 4TXEA 3K8KA 5A6KA 5A3HA 4C7GA 1QI2A 4HMEA 1EO7A 1WB0A 1GVIA 3N04A 3N12A 5BRPA 4AMCA 3M6DA 3CIVA 4JFTA 1HVXA 3EBVA 3W25A 2XG9A 3WF2A 2J7CA 4OZOA 2CESA 1OINA 2V5DA 5CPSA 2WKGA 4M82A 3VGBA 1E5JA 1EA9C 3FAWA 1OGGA 4PN2A 3OBAA 3HJEA 3OLEA 4MJ4A 3ZOAA 4CU6A 1E4MM 4PUDA 1HKMA 3SCSA 4S3JA 4JL2A 4P7LA 4PYSA 3ARPA 4OJYA 3ZM8A 1HL8A 3CMGA 2WCSA 1OGSA 5CSYA 2WM0A 3VTRA 1QBAA 1CWYA 3WDHA 4WF7A 3MSDA 3AS2A 1UKPA 2D0HA 1CEOA 1WKYA 8A3HA 3WMCA 4BS0A 1QVBA 1K9DA 4JCLA 1EGZA 3SUWA 2F61A 4IPLA 1FP8A 1Q6GA 4EANA 1MQPA 7TAAA 2VCCA 1V6VA 1FHLA 5E6ZA 1UWQA 3ZIZA 2ZXQA 1XCXA 1ZBVA 2XVNA 2JF6A 4PBGA 1UD5A 4HZ6A 3GBEA 3RILA 1J9YA 5CGMA 1UWUA 1GQIA 4GO9A 5GNXA 3D5HA 1B3WA 4OBSA 3CZJA 1CGVA 1R85A 3AMLA 4PTVA 2ZX9A 2JEPA 4PSPA 1JI2A 1HP4A 3VIHA 3NYDA 2Y2WA 1W9UA 3RCNA 5BROA 1E1EA 3SCRA 3VD4A 1OT1A 1J0YA 4GXPA 2CIPA 5A1AA 4MPKA 5HXMA 2DT0A 1E3ZA 1WP6A 2EPKX 1SMDA 1WZMA 3BMWA 1V3LA 1TG7A 4MNMA 1OD8A 1W1PA 2XPKA 4OOZA 3VD5A 1B30A 3VMNA 3W6MA 1J0JA 4YPJA 2VZUA 1KGUA 1HVQA 1E70M 4ML4A 2XM1A 2DSUA 1EH9A 1EXPA 1QW8A 3DYOA 1VEOA 1VEPA 1VFMA 3ECQA 2XWDA 4ATLA 1D3CA 2FHFA 1GQLA 1QPKA 3PZMA 1KXVA 3BLPX 3ARTA 3VGDA 1V3MA 5GQBA 3U7VA 1IT0A 4CN6A 3CMJA 2VZSA 4D6HA 3KL5A 3PZGA 1UZ1A 3PTKA 1J18A 4W93A 2J77A 3PZTA 5LA1A 4OBRA 1DWHM 5E09A 2XFRA 1E6QM 5M5DA 4HA1A 3KL0A 2GJPA 2PWHA 1V3KA 1SYTA 1PIGA 1UQYA 4M56A 1BYAA 5FD0A 2J74A 4UOQA 2C0HA 1HJUA 3AMGA 5JBEA 1ZJAA 1WDQA 1KGWA 1UD3A 4GQRA 2GJXB 3CZEA 4J27A 1M04A 3G6MA 3UG4A 1M03A 3KL3A 5FOOA 3NIYA 4BZYA 3MKKA 1VENA 5AC5A 2QMKA 2C8NA 3MMWA 1GPFA 3L4UA 2WMFA 1CXLA 3MUZ1 3B9EA 3VD9A 1Q6FA 2G3MA 1CGWA 4ZE4A 4CD8A 1UKOA 3VNZA 2CBVA 2PI6A 3AIEA 1H41A 4J7RA 2E9MA 1KQZA 4UQBA 5D9OA 5EB8A 3WL1A 3ZR5A 3I3EA 3WFZA 1ISVA 3AIRA 2W67A 4MJ2A 1E5NA 1VB9A 2J7FA 3EMZA 4QLLA 2YL8A 2ZUVA 1ZB5A 5A6BD 1US3A 4PEEA 1QI3A 1O7AA 1C8XA 1CXEA 1LJYA 1MQQA 3W26A 1PBGA 2E0PA 3VKKA 3VD3A 2GFTA 4TVDA 1E3XA 2J7BA 4TTGA 1UA3A 2VR4A 1ISWA 9CGTA 3BAYA 3VGHA 3ZT5A 4HPGA 2CBIA 4ZENA 1J11A 4AC1X 4TOQA 3GZAA 4CU7A 2J62A 3WELA 1WNOA 4U5IA 1GHRA 3AYSA 4AZGA 2ZUNA 4CU8A 3T2PA 3CUFA 2VRKA 5AY7A 3WQ5A 1WAWA 2DH3A 1O6IA 2J8FA 4MNJA 2VQTA 1Z32X 1EO5A 1B90A 4AD0A 4U33A 1PZ3A 1WDSA 3WDRA 2E4TA 3BAIA 4AZIA 3WBEA 3ZQ9A 5A6AA 3APGA 3ALFA 5EMYA 4BF7A 1GVYA 4M8UA 1DWGM 3VUPA 2WWCA 3CUHA 5DO8A 4DWSD 3WENA 1E1FA 3AMCA 2WC4A 5D9PA 2BFGA 1B3VA 4EKJA 5JUVA 3ARVA 3L4YA 1UH4A 2WHKA 4MNKA 1QHPA 5D8WA 5D9MA 1HT6A 4EAMA 1OD0A 1E6RA 3VVGA 3NDZA 4KGLA 5GNYA 4KWUA 1F4AA 3EMCA 2D0GA 1QW9A 1QNRA 1LL6A 2C7FA 1BVZA 1NOUA 3GXMA 4WSJA 3MUIA 2WCAA 4U2ZA 1XH2A 4W7WA 1OIMA 1ZBCA 3EDKA 3UETA 3WNNA 1EOKA 1CDGA 2BXYA 4L4PA 3BH4A 4CGTA 5DFAA 4BQ2A 4JCMA 5DT5A 2ZXAA 3A4XA 4E8DA 1E6PA 4J3VA 4H04A 1UWSA 4JHZA 4JKKA 1E4IA 2BVDA 1UH3A 2XTKA 5A8OA 3THCA 3VIKA 1LF1A 3OB8A 4ACZB 3MUY1 4JFWA 3PZIA 4QCEA 3FXYA 1JDCA 2A3EA 1JGIA 2YL9A 1UYQA 2WVVB 3GH4A 2EPLX 5CQ1A 2Y5EA 2OSYA 2YL6A 1V3HA 3GDBA 1VBUA 1XYZA 3EDFA 1QI0A 1J0IA 4AIEA 1PX4A 1V08A 4AEEA 3DYPA 2XM2A 4LGXA 4R27A 1J12A 3BAJA 1UG6A 2NW0A 1Q6CA 1K6AA 4PMRA 1NP0A 3T0DA 1C8QA 1BF2A 4U2YA 2ZUSA 4QDMA 1NWSA 2WWDA 5I23A 3PZOA 4GZJA 3WQVA 5BXRA 2Z1SA 4W84A 4MAVA 5FIPA 1E6NA 1C91A 1KCLA 5A6LA 3K4AA 5A69A 3CHCA 4CKQA 1OT2A 1V0LA 1JFHA 2QPSA 4V28A 2YLAA 3M46A 1WE5A 1ISXA 4W5UA 4FLQA 2YLLA 1FFQA 3AS3A 4CUCA 4OOUA 3AXIA 2J7HA 3A4WA 2BY2A 1C8YA 6CGTA 1B9ZA 1E0WA 2O9OA 1ITCA 4OUEA 4C7DA 1W9DM 2FH6A 5DEZA 3ZSSA 2DT1A 2GJXA 1BTCA 2OLHA 5A6MA 3BCFA 4QAWA 3ARWA 1I1XA 1VJZA 1UZ4A 3PZ9A 2RGLA 4MDPA 4CVWA 4GZIA 2HISA 1GHSA 4HOXA 4XV0A 3AOFA 3RJXA 6TAAA 2E3ZA 4W8LA 1GQKA 1CECA 3ARXA 4F79A 1H2JA 1NH6A 4UZUA 1KBKA 1EDTA 3O6AA 3WKZA 3CBWA 3BGAA 2O9RA 1UOKA 3VIMA 2BS9A 2DH2A 3AYRA 1HJVA 1XH0A 2E9BA 4ACYA 1XSJA 2WLZA 4NSBA 3VX1A 4LYQA 4ATDA 3MUAA 3JUGA 4AD1A 4W8AA 1ZJBA 1B2YA 3GM8A 3GNOA 4AXNA 4A3YA 1ZL1A 2CKRA 1R86A 3WEZA 3L2LA 3N18A 3WNMA 3ARSA 1SMAA 4UFLA 4RL3A 1MW1A 4PMZA 1I1WA 1JIBA 1G94A 3NDYA 4L4OA 5IHSA 1V3JA 2VT0A 2FH8A 3T2OA 1JF6A 2NT1A 2ZXBA 4Z2GA 5A6SA 5JBDA 2WVTA 1UKTA 1IZJA 3K1DA 6A3HA 1E40A 2X05A 4E2OA 2D20A 1H49A 1W2VA 2J79A 3UR7A 2VZTA 1HJQA 2BVTA 3WQ4A 3VMPA 3EMQA 2VCAA 2FHCA 5E0FA 4PTWA 1GOIA 2OWCA 4X0NA 1HX0A 4CCDA 5EFFA 1GCYA 1J0KA 4AIUA 2JIEA 3M07A 3SCTA 2WB5A 1E73M 1HXJA 1MVYA 1ZBKA 4BQ4A 5IFPA 1W91A 1XGZA 1V6WA 1JYWA 1XD0A 2AAAA 3CZGA 1R7AA 3WD4A 2OWXA 1JXJA 2PWFA 2XWEA 3IJ8A 2PWEA 1DWFM 3DHUA 2CCRA 3OG2A 2ESCA 1HL9A 2G4FA 4HP5A 2OYKA 1B3YA 1HNYA 1V0KA 2WHMA 2J7EA 4UQCA 2YDSA 4HZ7A 3AQUA 2DEPA 4AWEA 2YBUA 4FLRA 1UKSA 1HKIA 3NSNA 1B31A 1BPLB 3L4WA 2BHZA 1C92A 3F5JA 2QMJA 1AVAA 1NOFA 3N17A 2WVUA 4XB3A 4GI9A 4PMOA 5CPQA 2ZOXA 2QF8A 3WH8A 1GJUA 1JYVA 4B15A 3L4TA 3TTYA 2WMKA 4GI6A 1OWQA 1BG4A 2G41A 3PZUA 1UKQA 1VEMA 1GOKA 5HBFA 5E70A 1B3ZA 3U5UA 1QOXA 2AMGA 1MYRA 4TVUA 3LMYA 3WDJA 3UG3A 1CXHA 3DC0A 1QHZA 4UQDA 1E55A 1UR4A 4CN4A 1JNDA 2G3JA 5LYRA 5A8NA 5LA0A 3SCOA 1UD2A 5FL1A 3TTOA 1JL8A 4AZ6A 5BRQA 1W1VA 1CLVA 4RE4A 1MXGA 3SUUA 1NOWA 2D2OA 1WPCA 1C7SA 4JIEA 1JYNA 1A3HA 4TX6A 1ISYA 2WBGA 4QLKA 1GW1A 4J3TA 3WUGA 1GOMA 1MFUA 3W81A 3W0KA 3BAXA 5KZ6A 1KR1A 4LXFA 1R7OA 3G6LA 4FF5A 2DDXA 2VL4A 1E4NA 3ARUA 3AXHA 1CGXA 1N82A 2CEQA 3NSXA 3QHOA 5FL0A 2GVYA 3ZT6A 1CLXA 1H0GA 1AQMA 2UY3A 1B1YA 4HOWA 4YHEA 4P7OA 1XCWA 2Y8VA 4GINA 1H11A 2FGZA 3FNDA 2V3FA 1E9LA 1M01A 2QHAA 3CZLA 3WF0A 4D72A 3TOPA 4U31A 3GXDA 3LPPA 3MMDA 3TP4A 1AQ0A 3AFBA 3UEQA 4LX4A 4Z2KA 2DIEA 5E9AA 1TA3A 3SCWA 3ZMRA 3OLDA 1EHAA 3LPOA 1PJ9A 3GTNA 2VTFA 4MB3A 5C8BB 3PN8A 2F2HA 1QBBA 4AZ5A 2EQDA 4PMNA 3VPLA 4WLCA 4AY1A 4WKHA 3BLKA 4ZFMA 1WZLA 1UR9A 3W27A 5ECUA 5ABEA 2DGAA 1VFOA 2J75A 1SR0A 1JI1A 2D3LA 3BAKA 3DYMA 4AZ7A 2Z1KA 3SCVA 1G1YA 1KR0A 3OGVA 3AZRA 1I75A 2WLYA 4E8CA 3SUSA 5F7UA 4F9DA 2X0YA 4F9JA 4NRSA 4PUEA 3I3DA 1LG1A 2ZWYA 4W87A 4DWSB 5AC4A 2E9LA 5A8PA 4WIWA 4V27A 1UR0A 1TUXA 3O9NA 1PPIA 5D9NA 1W9VA 2CXGA 3HN3A 2OWWA 3HU7A 3IAQA 4RE3A 3CTTA 2BY0A 4UFKA 3B9DA 2CERA 1ITXA 3WMSA 4P8WA 2DQXA 1ZS2A 4XUYA 4AZBA 3OZOA 3TONA 4UFJA 1KFWA 3S6TA 3W28A 3VD7A 4PMQA 3II1A 3CO4A 4FK9A 4XZWA 5I2UA 1JG9A 1FA2A 2VI0A 2W61A 4JAWA 4U3AA 4D6FA 2QPUA 2D24A 2XGBA 3VGGA 1RP8A 5EBAA 4UQEA 3DECA 1XSIA 4H7VA 4GQQA 1G5AA 4Z2LA 4AZCB 1GOQA 2W63A 4YN5A 4D6EA 3ZSTA 1OB0A 3BC9A 4P8XA 1UR1A 3A6OA 2XSBA 1CZ1A 4LPCA 3SIMA 4AZHA 3B8SA 2VURA 3PZVA 1BG9A 1OCQA 4S3KA 4B3LA 2WMHA 3ZJ7A 4MADA 2EEXA 2ZXDA 5DF0A 2ZUMA 5TD4A 1OBAA 3VO0A 3WFLA 1JFXA 3IJ7A 4MB1A 3K8MA 1Q4NX 4H8UA 5CLWA 4EK7A 2DPEA 1EOMA 1JZ8A 3WMBA 3VM5A 2YJQA 3PTQA 5I78A 5IDIA 1IV8A 3PZQA 2DSVA 2VX6A 4Q22A 4W5ZA 1RH9A 3CUIA 4AYSA 1K9FA 2JE8A 5JIWA 1XYFA 2XIBA 3AS0A 1W3HA 2J7DA 1CPUA 3M7SA 2JALA 3UERA 2G8ZA 3WH7A 2GDUA 3OLIA 5JIPA 1AQHA 3WQ6A 5FKYA 2BV9A 1MW0A 4V2XA 1JZ5A 1TZ7A 3O2LA 3W53A 5BXPA 4HA3A 1W9PA 2PB1A 2WMGA 5BXTA 4AD3A 5I3DA 2GK1B 4BQ3A 3OGSA 3BXWA 4GI8A 4UFHA 4WJXA 2ZUTA 5E0CA 2NT0A 1W2PA 4PCSA 1KXQA 4P7RA 2ZX5A 3WEMA 4KRTA 1GOOA 5I6SA 2BNJA 1VBRA 5HNNA 4X9YA 3WNKA 2ZICA 4PSRA 1CXKA 4D1IA 3FW6A 5CXPA 4PMDA 1CENA 3SCQA 3WBAA 2AOSA 2CITA 2GUYA 4ZXLA 2PWDA 2WAGA 1GORA 1A47A 3N15A
chains in the Genus database with same CATH superfamily
4PUWA 2WYSA 4JKMA 4H1ZA 3EYPA 2NX1A 5C9RA 1K70A 3HG5A 4C6LA 3IRDA 3VIJA 2GLKA 3KE0A 3NDOA 5A2AA 2PDMA 4R53A 3B9OA 1XF0A 3WLKX 3NCOA 1EJ7L 4XZIA 3GXIA 2XVPA 3EZ4A 2GOUA 4QCFA 3CPRA 1Q6EA 4MJMA 4PMJA 1BAGA 2QYGA 2V2DA 3BO9A 4S3EA 4GIYA 4IMFA 3WD0A 5HNTA 2BY3A 3J7HA 1W3KA 4HYRA 4UMBA 3QKEA 4YCOA 1FWAC 1OABA 1CI1A 5L9FA 3UWVA 3GWQA 3TC6A 3MI3A 3CB3A 1A53A 4IIGA 4CQAA 2VP8A 5FEWA 1K7XA 2FFIA 1UUQA 3DX5A 1ZZMA 4AVNA 1Z44A 3QV8A 2QCCA 1V02A 1KNWA 2EJ1A 3VCCA 2A3BA 3BANA 1Q45A 4X61A 5KMYA 3PTMA 2TRSA 3WH9A 3PJTA 5G2WA 2YCLB 2YA2A 1MXDA 1V0MA 3INPA 2VR5A 5EMJA 5TBOA 3NGJA 3OA5A 1AW2A 4IIHA 1JXKA 3UR8A 5F4SA 2PC4A 1JR1A 1BKSA 4PUUA 3BSHA 3RDKA 3LHWA 4LCQA 4PRWA 4J4KA 2Q8XA 1XR2A 3GFZA 3PUOA 2W91A 3L4VA 2P3EA 1E15A 4HU0A 2WNQA 2ZRYA 5KZMA 2IKIA 2C71A 2YIHA 3WBXA 3UW6A 3POCA 4JS3A 3CGTA 2RH9A 4DB7A 4F48A 4GGBA 5ABFB 2WSPA 4IMCA 4A4AA 1RJRA 1TPWA 1F07A 1WDPA 2R94A 2GSJA 5A5WA 3OLGA 3FJ4A 4KCVA 4QM1A 1Z3NA 2WZEA 4GRSA 2XSAA 1OJXA 3TUUA 4Q4MA 3A4JA 3S1UA 5F2MA 2INFA 5AYZA 3RPMA 3W7CA 4LUTB 1OYCA 4N02A 4JQ1A 2WPGA 4O18A 3L0NA 4M80A 1G4TA 1C3FA 2YDQA 3ARZA 2VRJA 1US2A 5A8QA 2EPMX 1IWPA 4DI9A 3PZNA 2PGFA 4O8AA 3SDOA 3VINA 1V77A 4O4WA 4DWSC 4LANA 4C6BA 2WMJA 3U8GA 1SUXA 5CC6A 4DO6A 2DU2A 5D32A 4I8DA 1XLEA 5F4WA 3XIMA 3GUWA 1IIHA 2E5BA 2YZRA 1P0DA 3IV8A 3STPA 1V6UA 3HM7A 1TFVA 3NSMA 2H8ZA 1VJSA 2Y63A 2C14A 1FH8A 3M16A 1ESWA 2YDRA 3CHDA 3ITVA 3SCNA 1V0NA 1GQJA 3LLDA 1H7RA 1LRQA 4C65A 3LZ5A 1NDYA 4Z1BA 1YHTA 1MXSA 1WO2A 4ACZA 4WCJA 4S39A 2HTMA 1WCGA 3VIIA 2PBGA 1XIBA 4RXFA 2DSZA 2G96A 3VNLA 1OC7A 3IUHA 1BGAA 3CPUA 2WVVA 3ZO9A 5FF2A 2Y5JA 1GGOA 3OHMB 3N3MA 5I5RA 3VCRA 2UY2A 2GGEA 4G6CA 2WZTA 3UA3A 3HA1A 4WOZA 1EDQA 2WZMA 3MA8A 3IJQA 2HWGA 3S47A 1UWRA 2VRQA 3N34A 4UNIA 2V3DA 4AQLA 4H19A 5HR7A 1GQNA 3O0FA 3GY1A 2YFOA 5KZEA 4IQEA 1OFPA 1G0CA 1NWRA 2BGNE 3GXPA 1X7FA 2FDSA 1ODZA 2XFFA 2DSWA 5LXEA 2G95A 3P74A 3D3FA 2F2KA 2JFEX 4GY1A 2X30A 3WNLA 4A21A 3WD1A 3WLOA 3WQ8A 2HPMA 3B3DA 1Q6RA 4LAMA 1QWKA 3FS2A 3L67A 3MWCA 3S5ZA 2NX9A 3HF3A 2VX4A 1LL7A 3H2NA 4WQ6A 4CCZA 4AUBA 3N11A 2XVGA 1QNOA 5ENLA 1V6XA 4NZCA 2RGMA 5LNRA 1H1NA 1YQ2A 2JEQA 3YPIA 3QYSA 3A4AA 4W9TA 1AA1B 5JU6A 2YCKX 4GFIA 4PBEA 3T2QA 5FAJA 2YCLA 4CCEA 1E0VA 3SAZA 3W73A 4LB4A 4DO7A 3AXXA 1ODUA 5A6JA 4WGXA 3WYZA 4KCWA 4V33A 1LQ2A 2ZUWA 1XLLA 3BL3A 2E5DA 2XFYA 3WSUA 4JHOA 4BY3A 5M1TA 1K8XA 4MAZA 2J78A 3VILA 1PHWA 4V1YA 4A2RA 4HK5A 2PDHA 1BFNA 3M6YA 4F66A 2OVLA 3AMDA 1FKXA 5DANA 4FAMA 3NOEA 2DZTA 1XLCA 3UPBA 2W5FA 4S23A 3W24A 5ABFA 3CV6A 4E4FA 3LGDA 2DT3A 4J3UA 3FVDA 3AU6A 1DJWA 2QF7A 1KKOA 3WLSA 3V16A 3VDHA 3HFYA 5H91A 3CLWA 2F38A 3KVMA 1ADSA 4Q8QA 3UU0A 3DFQA 2DORA 4LYKA 3THQA 3PHAA 3VGFA 2PFHA 4A3RA 3VAVA 4WGHA 1OK6A 5CPMA 2TAAA 3P0XA 4P8VA 1XPGA 3BV4A 3AHTA 1BYDA 3SURA 2ZA1A 2QXWA 4HPJA 5BZAA 2B31A 2Z2AA 3HGSA 1U33A 1I2PA 5HWNA 2IQDA 3D0CA 2QVHA 3GIQA 3OVQA 1Y7VA 2R1NA 2V69A 3B9AA 1FQ0A 3AHXA 3APYA 3I6TA 2JF7A 4J3WA 1W37A 2CZDA 2E40A 1W1TA 4RV3A 4ZQOA 2B7QA 2FJKA 3GXFA 3WQEA 2AKMA 2BASA 3DC8A 3GTXA 3ZFHA 1D2KA 1QR7A 4NIRA 2G97A 1KTBA 2DZPA 3CU2A 2PBOA 3AIBA 3E3HA 2R6OA 4O12A 4HCDA 1QCWA 4KWSA 4GACA 2E28A 5I77A 5I03A 5AN7A 3VM7A 3SB0A 3THUA 5I7GA 2VUYA 3BLOA 1EC7A 4RCXA 2DJXA 1CTNA 3NPXA 2J4GA 3W23A 4PUJA 1E0XA 2FHBA 1A5AA 2XYLA 5CCZA 2CZ5A 5CSRA 2Q01A 4O10A 4ZE5A 3EXSA 4C6IA 2OYLA 3FCPA 1W9BM 4DUVA 3A23A 3FYPA 2X41A 4XAPA 4FMVA 4PCPA 1Y5VA 1FWHC 3W00A 2YL5A 2X2GA 2VNCA 4LS1A 2RKXA 3S1VA 4C6EA 4KEUA 3TAOA 3L5AA 1H3GA 3TR2A 1R0MA 1L8NA 3W74A 3AYVA 1SJBA 2F6XA 4NNBA 1RP9A 4EE9A 1TCMA 3UCCA 3V18A 1XV8A 1RY8A 1TRDA 3W7HA 2FZBA 3MSYA 3UCQA 4WHBA 2ZUUA 3CB8A 2NQLA 3QGVA 1YXYA 4W7UA 1VLWA 3GH5A 3BJFA 2VEGA 1RVKA 3O15A 1K9EA 4QITA 1RLCL 4M24A 3QVQA 4FIRA 1KC7A 3LEPA 2WW5A 3DFYA 3F5LA 3PWGA 1E72M 5KINA 3MP4A 3QV6A 3DFTA 1XLGA 1I0BA 4JTQA 2PD5A 4JDBA 4MB4A 1TV7A 1SO5A 1E0UA 2VFIA 4GUGA 3ES7A 5ABHA 1EJUC 3TN3A 3W7PA 4I9MA 2DT2A 4Y9MA 3AO0A 1XC6A 4GVFA 4PMVA 3HQ1A 5F4XA 2OLAA 1JF5A 3BQ5A 4DWSA 1UH2A 2C1GA 1OSEA 3MUCA 1B3XA 2OB3A 4M6UA 4NILA 3MHGA 3N1AA 1PZ2A 4LAZA 5DCDA 5CZTA 3G1RA 2VXNA 4XBSA 3MZNA 4FX8A 2BGQA 3LBMA 2J9ZA 1YKWA 4K8EA 3AZTA 3EWWA 3TN6A 8XIMA 4GPNA 1DHKA 1UD6A 1V03A 2OXNA 4TMCA 3EPMA 3EEGA 4H01A 3FHQA 5CPOA 3W7OA 1H62A 4UOZA 3ZS4A 1VYRA 4HNVA 1UR2A 1ME7A 1W17A 4ML9A 3H12A 2UY5A 3PPHA 2OQHA 1QWGA 3O07A 3H54A 2OO6A 4HU8A 1XG4A 3CIWA 4NUWA 1VYSX 3RLUA 1LWJA 1TWWA 3TSDA 4JTKA 1EIBA 3CHEA 1IXPA 1RZMA 3NQ6A 3CASA 3WL0A 1M5WA 4TUFA 2QAPA 2QIWA 2VC7A 1IWBA 2VD8A 2YKKA 2OQLA 4EWND 3R0KA 7CGTA 3IUDA 1J79A 4DI8A 5CAKA 1FWEC 1AUSL 3FFSA 1TE1A 3B0XA 4JFVA 4K1GA 2ANUA 3G1XA 4GY0A 4LTSA 5CEWA 3S9YA 2H3DA 3U2OA 5TIMA 3W76A 1TVPA 1XUZA 1T99A 4AIOA 1UD8A 3UVIA 3TQPA 1S2VA 3SFWA 1QI2A 3GAYA 3G1SA 4FOJA 1H7OA 1AJ2A 1GVIA 2Z7GA 3CIVA 3EBVA 3NA8A 2XG9A 2J7CA 2V5DA 4DVOA 4M82A 3B4UA 3OIXA 3OBEA 2XN1A 2F6KA 1EA9C 5LIYX 4JY8A 3OBAA 3HJEA 3OLEA 3C3NA 4DHGA 2HS8A 3ZOAA 1E4MM 2FB2A 1RALA 4F2BA 5EYWA 3SCSA 4S3JA 3TCSA 2QUUA 2E1DA 4PYSA 1Q66A 3ARPA 4OJYA 4LB3A 3ZM8A 1J96A 3ANVA 1P43A 3I7QA 2BGSA 4I9TA 2WM0A 3VTRA 2FZNA 1W5OA 4WF7A 1TKKA 3AS2A 3LV5A 3NL3A 2HRWA 3GS6A 4DF0A 4A6GA 4JCLA 1XW8A 3SUWA 2F61A 1FP8A 4WDWA 4LAUA 4EANA 3CQKA 4R33A 3FKKA 7TAAA 5E6ZA 4HNOA 1X96A 2BZNA 3ZIZA 2ZXQA 3S2LA 4OE7A 2R1LA 3LBOA 1LDCA 3S5NA 3ID7A 4GWEA 3ZWTA 2ICSA 1XXXA 5EBUA 2VEPA 3SQSA 3CZJA 3AMLA 4M7TA 2XH0A 3BUVA 2ALDA 1HP4A 4HKPA 5IDZA 3LCXA 2Y2WA 5FJUA 3KRSA 1OT1A 4Z0JA 4LUJA 3F4NA 4UNLA 4MPKA 1OD8A 4B92A 1W1PA 3U6WA 5XIMA 2ZVRA 3GVVA 2XPKA 1KRMA 3VMNA 3AUOA 1A5MC 2OZTA 1HVQA 4DY1A 4MZ8A 1E70M 4ML4A 1JCYA 4JHMA 1EH9A 3IRSA 4J3ZA 2XWDA 4JGDA 3O7UA 3KW3A 1W6TA 2BTMA 4LVBA 2X0SA 3BLPX 3S4TA 3ARTA 3JZUA 1D3GA 4KERA 1FDYA 5BU9A 1W1A1 1J5SA 1UROA 4DF2A 1IQ8A 2VZSA 1P0EA 3GU2A 4U4MA 2J77A 1WXZA 3PZTA 2SFPA 3LXAA 2CLHA 3G1DA 4GIEA 5E09A 5MF5A 1VLIA 3KL0A 4IXHA 3V0UA 1V3KA 5CBBA 1G67A 1UP0A 1UQYA 4M56A 1BYAA 1WDDA 3UP8A 2A7NA 3MP5A 3WLRA 4IGNA 1HJUA 3AMGA 3LNMA 1KV8A 3IK4A 4LW7A 1KGWA 1XBVA 1M03A 3WK1A 4YU1A 3KL3A 5FOOA 3NIYA 4BZYA 1OHLA 3MKKA 1O66A 4MZYA 2C8NA 3MMWA 3L4UA 3MUZ1 3VD9A 4DPPA 1Q6FA 2G3MA 4N4PA 1CW2A 1B5TA 3A9BA 4XVDA 2CBVA 1YDNA 1I2QA 1KQZA 1M65A 3WL1A 2NVCA 3AIRA 3KRBA 2W67A 4MJ2A 4QLLA 2AKZA 3V5OA 1ZB5A 1QU4A 5A6BD 3GFYA 1EP2A 3L68A 2VEFA 1XDLA 4PEEA 1XDJA 1QI3A 1O7AA 3IVUA 9RUBA 3R10A 3L66A 3W26A 4IIEA 2E0PA 3M0MA 3VD3A 2GFTA 4TVDA 2Y7GA 2J7BA 5T9CE 1RD5A 2VR4A 9CGTA 3VGHA 3ZT5A 4HPGA 2CBIA 4H9UA 1IHIA 1Q6LA 2RJGA 2ZYFA 1GPWA 2QCHA 1F5ZA 3NPUA 1XDMA 1SJDA 1PHQA 3BURA 2IKJA 1XRSA 2GSHA 3TQVA 1UWAA 2VRKA 3JVAA 1D8WA 2J8FA 3PFMA 1EO5A 4ALDA 1HO1A 4IPIA 4GKTA 4U33A 1WDSA 4AZIA 3ZQ9A 2ZRZA 3VKJA 3LXBA 2FPVA 4Q8WA 5TNVA 4JNYA 4M8UA 1D7KA 1DWGM 3ENLA 2WWCA 3NXFA 4AG0A 3BSMA 5FF3A 1E1FA 2FTWA 2WC4A 4EKJA 3W7DA 3L4YA 1UH4A 2WHKA 5D9MA 1QT1A 2HK0A 1YBQA 5LIUX 1ZY9A 4KGLA 3P61A 5GNYA 4KWUA 3N2MA 4R9XA 5B80A 3EMCA 3RRAA 3MC5A 4TO8A 2XN2A 4L9XA 1NOUA 3IGXA 5B7ZA 3WJWA 1XFCA 4LS2A 4U2ZA 2FTPA 3UETA 1EOKA 3W2UA 1RQEA 4O50A 4CGTA 4BQ2A 2CLFA 4L65A 5DT5A 4JXCA 3ISIX 3BLEA 5T91A 1E6PA 4J3VA 3PWAA 1NDWA 1FHVA 4G9PA 3GFXA 2BVDA 1I6NA 3OVGA 3V3WA 2XTKA 2JKAA 1ECQA 4GY7A 5A8OA 1FWTA 2BVWA 3MUY1 3QPEA 4UNKA 4JFWA 5DBUA 3EWDA 3B4YA 4B4FA 3EPNA 1UYQA 1UASA 1HG3A 3GH4A 1HFBA 2YL6A 2O55A 1XYZA 1UB3A 3EDFA 3KHJA 3LRLA 4QNWA 1GEHA 3QM3A 2V5LA 1YTEA 4AEEA 3DYPA 2FVLA 1TWSA 1J12A 1GVOA 3UFYA 1UG6A 4IXXA 3RCMA 4PMRA 1TREA 2VFEA 2WWDA 3PZOA 2Z1SA 2XIMA 4AU0A 1EBGA 2CFFA 3T42A 3FLUA 4NXSA 7TIMA 5A6LA 2ZVIA 4ZQMA 3GG1A 3W1PA 1B57A 1BQGA 4W5UA 3WX7A 3GKFA 3OP2A 4GE8A 4CUCA 4GQGA 3AXIA 3AXKA 4AWUA 1EJRC 4ECLA 3TMLA 2QUVA 2PGRA 1VFLA 1W9DM 4MFEA 1BXNA 4ERIA 4X2PA 3D6NA 5A6MA 2OLHA 4ZTXA 4GYKA 4QQ3A 3W2KA 4MDPA 4HOXA 1FCBA 5BMWA 4DZ5A 4XV0A 4O11A 3R89A 4WY0B 6TAAA 3F7JA 3RUBL 4NY2A 3RO6A 3UJSA 4F79A 3LTYA 4UZUA 3R8GA 5HJYA 3TX9A 3WKZA 3GLCA 1T0OA 3RX3A 3BGAA 2O9RA 3VIMA 2BS9A 3AYRA 1HJVA 3U2ZA 2E9BA 4ATDA 4MHBA 1PTDA 3D47A 3AXMA 3P5ZA 2VELA 3N6HA 4N4QA 4EVZA 4NT0A 1ZL1A 2C0AA 1J93A 3MQTA 3KCJA 5AC6A 2X7WA 4IJCA 4PEKA 1YDOA 1HO4A 1MW1A 4PMZA 3RR4A 3NDYA 4L4OA 5IHSA 2FH8A 4O1EA 2NT1A 3CYVA 3LTPA 1UKTA 3EKZA 1A5SA 1SO6A 1IZJA 1L6GA 2FQIA 6A3HA 3C2EA 1H49A 2YB1A 1VQTA 1HJQA 2BVTA 3W72A 3EMQA 1S5MA 8TIMA 3E96A 3QLLA 4X0NA 2ABAA 5A8GA 4GH3A 4LF2A 2WB5A 1P0BA 1TJ1A 5IFPA 1W91A 4JTTA 3CQJA 3WD4A 2OEKA 4I6VA 2XWEA 2CCRA 3GAKA 2OYKA 2ZZ2A 3LQGA 1B3YA 2YDSA 4HZ7A 3EWXA 1D3HA 4ICMA 1UKSA 3QPZA 4XSMA 3NQGA 3WQGA 1C92A 2QMJA 2AQVA 4JNZA 3SI9A 1WX0A 5DQPA 3ITXA 3SY1A 3CAQA 2WVUA 1GJUA 4B15A 1JCJA 3L4TA 5I00A 2WMKA 3QTGA 4HQVA 8XIAA 3PZUA 4PL2A 3G24A 4FIQA 5C7VA 4TR9A 4MOZA 1XS2A 3CT2A 3G1VA 4MYXA 1E55A 4AFYA 2DVTA 4OVXA 5A8NA 5LA0A 1TTJA 5I09A 1UD2A 5FL1A 1FBAA 3HQOA 2PDXA 5BRQA 4ZFCA 4FNTA 2PDFA 1MXGA 3NAVA 1NOWA 3UQNA 1WPCA 1C7SA 1IE7C 5AECA 1SFTA 4IGSA 2WBGA 4GUJA 1AG1O 4ZOBA 1S5WA 3UNDA 4C6CA 3W81A 3W0KA 1SSGA 3BGJA 4NZ3A 2Y0FA 1UUOA 2NZLA 1O1ZA 2I5GA 3ARUA 3G3DA 1CGXA 2ZRXA 1XIDA 3CUXA 1EB3A 3O63A 5FL0A 4DJED 2HVOA 3GNNA 1DJNA 1AQMA 4MF4A 4P7OA 4GINA 2Y8VA 1H11A 3FNDA 2AQWA 2PF8A 3E0LA 4LVDA 4J5NA 3FGCB 3L21A 1EX1A 2HNHA 4YTUA 2QJGA 3MTWA 3P2VA 4LUSB 5J5DA 1KM4A 4JTUA 3LPPA 1DJHA 1JJKA 3MMDA 4FP1A 4RKAA 3AFBA 4EACA 4ZB5A 3ICJA 4NJGA 5E9AA 3AC0A 3SCWA 3TAKA 5GJPA 4M1BA 4G5DA 5E93A 4D8ZA 7ENLA 1FKWA 1NFGA 2VTFA 1OZQA 4LBRA 1QBBA 3QC3A 5I3KA 2P0IA 3H2FA 4XZLX 3PUGA 1LT7A 2Y6ZA 1WZLA 3FOKA 5ECUA 5ABEA 2CHRA 1P4CA 1ZAIA 1R2TA 3EWBX 2D3LA 3OEXA 3BAKA 4AZ7A 2Z1KA 3SCVA 1G1YA 3W7RA 4E2BA 4TIMA 4ZOCA 4ZBCA 2PA6A 3AZRA 1HQTA 2OEJA 2WLYA 2DJLA 3C4UA 4E8CA 4NZ1A 4IZGA 4HJFA 4QHRA 1NU5A 4A35A 4L1GA 1M7JA 1NFPA 1UR0A 1TUXA 2ADAA 5D9NA 3FA5A 3OYXA 3HN3A 2OWWA 3EX6A 3B0UX 2CERA 3UWEA 2DQXA 3QBUA 2XDFA 1ZS2A 4XUYA 4AZBA 1GKRA 4KEZA 4QROA 3S6TA 3HG3A 2NWRA 5T26A 3CUZA 3CO4A 4FK9A 4XZWA 5I2UA 3CNYA 1JRBA 2QPUA 5EBAA 5G2IA 4FPSA 4UTHA 4GQQA 3BV7A 4WRHA 3P14A 4H8NA 2GJLA 2O56A 1OB0A 3PBUA 2PDYA 3WQFA 3A6OA 1C29A 5HWJA 3LGEA 3B8SA 4ZB2A 4XUGA 4IP4A 1OCQA 5HJXA 3GTFA 4B3LA 5FJJA 3VO0A 3TN4A 3VDGA 4N9EA 3RR1A 5BNKA 1P7TA 1F8IA 3VM5A 3WLJA 5I78A 5IDIA 1VRDA 1XQKA 2DSVA 1TMLA 2DZWA 1GVQA 3DFNA 4Q22A 4IQDA 4LRTA 4LOCA 4W5ZA 3S6OA 5G4HC 1R3VA 1K9FA 1EP3A 1ZUAX 1W3HA 2J7DA 2QUNA 4GJIA 2DFAA 4YL2A 3V5CA 4C60A 5HMFA 3UZ5A 4HHMA 3W1TA 1H7PA 3QY6A 3KVKA 1AQHA 5FKYA 2BV9A 1T7LA 2C6QA 3M41A 4E8GA 3O2LA 1FWGC 1VR6A 1XUUA 2PZNA 1W9PA 2PB1A 1I9CB 3KLKA 4UB9A 5I3DA 4BQ3A 4ORMA 3FX4A 4OV9A 2ZUTA 5E0CA 2NT0A 4PB5A 3W2MA 3DHFA 3WEMA 4QSFA 1I2RA 3PB0A 5I6SA 1IF2A 4OFCA 3U2EA 1VBRA 4ZQCA 5HNNA 4X9YA 2ZICA 1IGWA 4GNVA 4HYVA 1WBJA 3I65A 3SCQA 2CITA 4ZXLA 3SJ3A 3H4WA 3LMZA 5GJMA 2RAGA 1ZP4A 4L61A 4DNHA 4DZAA 3ZLFA 3AI0A 1NQ6A 4AYGA 4DX3A 2DVXA 1NP2A 4F40A 4HSNA 2A3CA 1KM2A 4XZNX 2R1PA 1NIUA 3VGEA 4QS6A 4W88A 3EA1A 1C93A 1JYXA 2Y61A 1VCFA 1K6WA 1BXCA 4FXFA 2E8YA 2V8ZA 1S5NA 4LRSA 4KGJA 1KB3A 4BJHA 1QOPA 2KX9A 1XLIA 4S3FA 3OBKA 3UWYA 3OIHA 2PC8A 2XHYA 2OOFA 3EDDA 4DZIA 5AYIA 3DKJA 4HT3A 4Q6XA 3SGUA 3VIOA 4AISA 4YWIA 3WO8A 3HPSA 3NPWA 2DW6A 1DWAM 2X42A 1PYMA 3AWOA 4P8UA 4MJZA 4KWVA 1HJSA 4QDPA 3DGRA 2ZTKA 4UTTC 3R5EA 3T05A 3LERA 4RUBA 4C1NB 4QSHA 1CLKA 3VIGA 3U4FA 2QUMA 1IR2A 1L2QA 4MYAA 1THFD 1OX4B 3QH2A 2EAWA 3L4XA 3KWSA 2EKGA 3K46A 2WNNA 2WZIA 2VEMA 3PS7A 2ZIDA 1FH9A 2IPGA 2GOKA 1YEYA 1C9WA 3BG9A 3ZT7A 2J8TA 4Y96A 4H8HA 4IP5A 2EPOA 4LUYA 4JYDA 2MANA 4RX0A 1UWTA 4MUPA 4A05A 3O0KA 4TMBA 2ZRWA 1GVFA 1XRFA 3AIVA 3RCYA 3SQLA 3EOUA 4JIQA 3JW7A 3QV7A 3NZGA 3WIJA 1DEDA 2D2JA 2NLIA 5DMNA 4JD4A 2EXOA 3TXZA 4ZXOA 4G7EA 4JDYA 3BE7A 4I5UA 3B97A 4I9JA 3L2MA 4MB5A 2I16A 1IIGA 1J01A 2CHNA 4YTRA 5DN1A 1EC8A 1PYFA 4FHAA 1EWDA 1R30A 4D6JA 5JBFA 1PX3A 4FALA 3MO4A 3H24A 2QNEA 3KP0A 2Q09A 3GVRA 4NP7A 2PWUA 2P88A 4LYPA 4YNGA 3HQPA 1S5VA 5HMSA 2NQHA 3B8UA 4ZO6A 4DUWA 4AD4A 1JZ6A 3KRZA 2VHLA 1AMYA 3DFHA 5HOSA 3BLFA 1JZ3A 1KXTA 2G3NA 4OV4A 3GYEA 3F4DA 3WD3A 2ZX8A 5LNSA 4TVCA 3ITOA 3UA4A 1A0EA 1KXHA 3HB9A 4H3DA 4JBRA 4JTAA 5KTLA 3VNMA 1HJWA 1S3HA 5IXEA 3W1XA 5C71A 4GBDA 2OSXA 3R2GA 1AFSA 3D3AA 2BG5A 3S5YA 3RMJA 4A22A 3W82A 3GU1A 4FS9A 4JZ5A 5AB3A 4RZ6A 3VFCA 4UZSA 3UNTA 3ITCA 2W27A 1XQLA 5C9WA 1PX8A 4PRRA 4O16A 3C2RA 1HF6A 2XISA 2RDTA 1Y8BA 5F2LA 1JZ2A 4H9YA 3NPVA 1QNVA 1OM0A 1U30A 1J2WA 3S8HA 4IGHA 3UR5A 1Y5WA 4XZ9A 2ZX7A 1OFOA 4IISA 4P7NA 1OEPA 3SN1A 3NM3A 4UTWC 2OYMA 3HPXA 4Q33A 1M53A 1TZZA 1M3UA 5LZLA 2A5HA 2OZ0A 1BSLA 3IJDA 4HYWA 3U5YA 3REQA 4L4LA 4FX6M 2P8BA 1JCTA 3EKGA 3H7RA 1DWIM 1QASA 4BF9A 1G7UA 3WN6A 3O3RA 3PVFA 3EOLA 5BWFA 3UXAA 3KDNA 3ATZA 4C5ZA 5JXQA 4MWAD 1WYIA 3F1QA 4L9ZA 1BGGA 4NU7A 4UR9A 2BY1A 5D09A 2WHJA 1S2TA 2Q8ZA 3R7MA 5I0DA 4CLMA 4MUZA 4DM1A 2ZE0A 3W6LA 2VCBA 4I8YA 3UVAA 4KW2A 1DV7A 3PWIA 4E4UA 3JU2A 4I90A 4C1NA 3M9YA 5FESA 2OTDA 2VX5A 3R1ZA 2CYGA 5BW6A 3GHRA 2V82A 1OX4A 1QJWA 4CD5A 4IM4A 2X8RA 1P0KA 2QGHA 1XBZA 3WH5A 1VIWA 3TFCA 5AVNA 4M1RA 3THDA 3A21A 5I3FA 2CLLA 2A4AA 4MFDA 3PP7A 1DJZA 1V6YA 1IT8A 3W01A 5U4NA 1EIXA 4NJJA 4Y7EA 1CXFA 3WMLA 2Y70A 3UF9A 4PC8A 4A3HA 4Q4RA 2QDHA 2XSXA 3W38A 4GC4A 2VOTA 4JN8A 2W79A 1TJPA 2CC0A 3SUVA 3MU7A 3W29A 1LG2A 4ICCX 2ALRA 1RLDA 3PUDA 2ACRA 1JAKA 1VYPX 3P0WA 2OKTA 1R3YA 3KCOA 3V1PA 3VZXA 4DN1A 3MUXA 3IAPA 2INZA 2PF0A 5DRCA 3AHYA 4M51A 2FMOA 3BLDA 1DXEA 3QMTA 4D6CA 5E6YA 3TWBA 4WKFA 3WH6A 3EB2A 2V5JA 1K02A 4Z1DA 3CL8A 5D2VA 1TPEA 3EDJA 2C13A 1AH3A 3RG6A 1LOLA 4FB7A 4MWAE 2R9RA 3NO1A 3T81A 1E56A 3FN9A 2DZUA 2WZHA 4D71A 4K8HA 4LC8A 1A3XA 1EBHA 4PTMA 2UY4A 1UQZA 3C5QA 4IL0A 3IV3A 5LNWA 3AAMA 1LL4A 2AGTA 1P6WA 1OCJA 4NI3A 1E43A 4UFIA 2QS8A 3W7IA 1MDLA 3VNKA 2Z26A 4PUKA 2QLYA 3E1F1 2H90A 4R3UA 4Q4KA 3WNPA 5EMMA 1P5BA 3RXZA 3OYZA 4HHPA 3GG7A 4EXAA 5HQMA 3LUTA 1WZAA 3OG3A 1LLWA 3WK3A 1SFLA 1PWLA 2ACQA 1VFUA 3G1HA 4DXVA 5E1QA 3Q67A 4TV5A 4LEFA 2V2HA 4HMCA 2ZA3A 1QNPA 3GBDA 1EDGA 3F4VA 2D3NA 2WVSA 2PLJA 3RM9A 3AS1A 1QO5A 1GTEA 1JZ4A 4ENLA 3K13A 1MI3A 5M17A 4U5KA 4EIVA 3W07A 5C0QA 4UTTA 3WY1A 3CYJA 2VC6A 3LHTA 4AW7A 2Q3OA 4DYEA 2PU0A 2FVMA 1VC4A 3NQEA 3W37A 4RV8A 2NV9A 3VKAA 5BYWA 3TZNA 1Q5MA 3ANYA 3U57A 2AL1A 1YDYA 4PULA 3M1ZA 4AXKA 1R9ZA 2F8QA 1F4HA 2QJNA 2Y8UA 4XD5A 2VMFA 3T55A 3M43A 3C52A 4QBXA 1W5QA 2GQAA 3PAOA 3LHZA 3MW7A 4LNYA 5DT7A 5I3IA 2NXHA 4CNNA 2Z27A 2YOCA 1LRNA 3MSGA 3NQDA 4GH1A 2DIJA 1H5VA 1K7FA 1OK4A 3NYZA 1RA0A 1S2CA 5AYYA 1C90A 1P1XA 3HPZA 3T0AA 3V0SA 1Q65A 3KEHA 2C3ZA 1RJPA 2HMCA 4BKNA 4IMAA 2QEZA 4WUIA 3JR2A 3R8RA 3E2SA 4QLJA 2GL5A 1YADA 1YE4A 3R0UA 4YVXA 1LQ0A 1PKLA 4JX6A 1KWKA 3E0VA 4NG3A 3DAQA 3DG6A 4IFOA 3AJ7A 4L1XA 1SO4A 3SQMA 4HA0A 2GDVA 4NXKA 1BQCA 4L56A 5CZKA 5AHLA 1KBJA 3G0XA 2OZ8A 3POHA 3MDUA 4JYEA 3STGA 3QR0A 4H2CA 4HHLA 5LA2A 4PUNA 4XK2A 4IPNB 1W3TA 8CGTA 2V3GA 3KZPA 3AIWA 4H00A 3BAWA 2ZADA 4ZO8A 2W9MA 4GJJA 4DAFA 1A5NC 1G01A 1V02E 2E6DA 3IGHX 2OGJA 3AALA 4JTRA 1WKFA 5JQ9A 4N9DA 7A3HA 1XYMA 3AMKA 4RNJA 3WNOA 1PSCA 1W5MA 2F7FA 4KQNA 1DXIA 3LM7A 3RLGA 4CVUA 4S3GA 3AJXA 1DPMA 4E6MA 3CEPA 2XGIA 4RZ4A 4GHRA 3WUEA 2HEJA 5DMMA 4PA8A 2W0UA 2YA0A 4GLEA 1A0CA 1ZHAA 3UESA 3WLIA 2XZ7A 4BHYA 1R8LA 2DUXA 3VZZA 3NNTA 1ICPA 3AIUA 1TYGA 2PLCA 1XHGA 3VOCA 4LSBA 3QGKC 4M81A 3ZXWA 1K4HA 2O4QA 3TSBA 4MY8A 1NWUA 3RM4A 2VZVA 3EDEA 5CZJA 3LY0A 4PFHA 3KBNA 1MZHA 4P5UA 3CUGA 2ASHA 4AWSA 3WDIA 3IANA 1PKMA 3QMRA 4UTWA 5FJRA 3CPGA 3TV8A 2I56A 3V7PA 4QE4A 4OU1A 1ZU8A 1SGJA 2R82A 7ODCA 2RJHA 3ZR4A 2VDIA 4Q8NA 4CN1A 4X60A 3TYCA 3L23A 4H6KA 1MWOA 4DYKA 4IPJA 3WEOA 4DM2A 3M0HA 1R3QA 5FACA 1CIUA 2GQ3A 2Y8KA 4JX5A 3L4ZA 1OFEA 4TXEA 1AZ2A 4O8RA 4EPBC 5A6KA 4Y9OA 4C7GA 3VA8A 3UPMA 4N6FA 4HMEA 4PTNA 4FI4A 1WB0A 4WDXA 4MWAB 1LBMA 1WV2A 2PRMA 3WLMA 4M6QA 2WSQA 1HVXA 2WM1A 3DG3A 8RUCA 5CJMA 3UD6A 1OINA 2WKGA 1ZNNA 1WXYA 1MZRA 1E5JA 2BB0A 5E9XA 1XICA 3FAWA 2D69A 1XLBA 1OGGA 1KFLA 4CU6A 1G69A 4PUDA 3FIGA 4LT9A 3SY5A 3HMJG 1YNPA 2IKGA 1L9WA 1HL8A 4ICNA 1A5BA 2C1HA 4AHOA 1QFEA 2NQJA 5K9DA 2X16A 4MGGA 3BQ6A 4GGHA 3W22A 1PTAA 2V9DA 2G4JA 3WDHA 2XIOA 2BP1A 2D0HA 1TTPA 3CAKA 1WKYA 1H7WA 2CXEA 4LF1A 3CJPA 1EGZA 3EOOA 2E68A 4IPLA 3W1LA 1MQPA 1ZSXA 2VCCA 1V6VA 4H7CA 1FHLA 3CEUA 3BGGA 2NQ5A 3EEZA 4CQBA 3FDGA 4NYUA 3R11A 3GBEA 1AJZA 5GNXA 4MY1A 3C6CA 5HANA 4I7VA 4OBSA 4PBFA 1CGVA 4B5VA 2AMXA 4PTVA 3UXKA 5J8LA 5HA7A 3RITA 1JI2A 2A7PA 1JQVA 3DI0A 3TYEA 3OTRA 4H6RA 1ZFJA 3RCNA 3SCRA 2ZZ3A 2NUWA 1R5YA 5HXMA 4F2TA 4YTSA 2V81A 2EPKX 3CK5A 1HL2A 2QCMA 4NJKA 2BWGA 1TV4A 3H22A 5BU6A 4OOZA 1TIWA 1B30A 3VD5A 1GG1A 2BXVA 1OFDA 4YPJA 3L65A 1RXOB 4GXMA 3UZXA 1KGUA 3GR4A 2CWNA 3FJ6A 1X6UA 4H83A 3N19B 4KPLA 3SFKA 3EWCA 1VEOA 3WLPA 1VFMA 3ECQA 4ATLA 4QISA 2AGKA 1LTDA 4HVXA 3H7VA 1M68A 2HV5A 1RPXA 3PUEA 4C6JA 1KXVA 3TOYA 1PCKA 1TZ9A 5GQBA 1MEHA 3WCZA 1IT0A 1AODA 1YXCA 4CN6A 1B54A 1X39A 1XBYA 1XLFA 3MY9A 1GW9A 2A79A 3FYYA 3PZGA 5C9ZA 3VOFA 1J18A 2YXGA 4W93A 3S83A 3GE7A 4Q7IA 1PDYA 4OBRA 4H2HA 2XFRA 1E6QM 4HA1A 1I4NA 5KETA 4GIRA 3H53A 3TLQA 5G5IA 1PIGA 4NAEA 4O0KA 2J74A 2CU0A 2Z4GA 1H51A 5J04A 3USBA 5FSEC 4X3ZA 2C18A 4CEXC 1WDQA 3TR9A 2GJXB 3GD6A 3PNZA 2QDGA 1TELA 3JRKA 2XN0A 3XINA 1VENA 4AHPA 1E0TA 4FZIA 3SR7A 3BDKA 1GPFA 4OQVA 4QJ5B 1CXLA 4Z1YA 1A5LC 5CPNA 2J27A 1CGWA 3KM8A 3H23A 1VPXA 1HKVA 2VOMA 2PI6A 3AIEA 1VZWA 3PTDA 5CC7A 4GUFA 4UQBA 4CNSA 1ISVA 3UJEA 3GTIA 3EMZA 4YCPA 3B8TA 1E9YB 4TV6A 3GG8A 2B4GA 3P80A 3U2CA 2NV1A 1ELSA 1C8XA 1GVRA 4H9XA 2POZA 3QY8A 1S2UA 3VKKA 3ZVHA 2GGJA 3IIZA 1E3XA 1SZFA 2Q3RA 2QW5A 4MSSA 2OFJA 3BTNA 1LOSA 3LLFA 3WLLA 4AC1X 3SN4A 4B5WA 3UZZA 4FR6A 2VFDA 4FSAA 5G2HA 1OC6A 3QZAA 3GXTA 3MSRA 1OFBA 2ZUNA 4CU8A 3T2PA 3CUFA 3N2TA 5C2GA 2VQTA 1B90A 3H2EA 4XAFA 2IQ0A 3WDRA 2E4TA 3BAIA 2A3LA 1N2VA 5A6AA 5FSDC 3ALFA 3S3GA 4BF7A 4K36A 1GVYA 1TWDA 1UIOA 4Q8VA 2Z7KA 3CUHA 5DO8A 4DWSD 3AMCA 4NJHA 3H21A 4M0XA 5D9PA 1LYXA 1K4GA 1LZOA 1QHPA 2VFGA 4EAMA 1E6RA 1R3SA 1TIMA 1SJCA 1WAUA 1F4AA 4GVIA 2TYSA 1LCOA 3LHUA 1QW9A 1LL6A 1BVZA 5HULA 3NO3A 4Y2WA 1WXJA 1KV5A 4WSJA 4YIWA 4W7WA 4IQJA 5LHFA 4KFNA 3WNNA 5DFAA 5DLCA 3Q94A 4KESA 4XAZA 4I9AA 1F7BA 4JHZA 1JCXA 2FFCA 1BTMA 2VDHA 3RYSA 3QN3A 2FKPA 3E2QA 1FVPA 4ACZB 2I17A 4EXQA 4P61A 3V5FA 4R7JA 1JDEA 1UZDA 1JDCA 1TCDA 1E51A 1VPYA 2WVVB 2EPLX 5CQ1A 4HCHA 3LCWA 1V3HA 3UR2A 3DUGA 4OT7A 4HHHA 2GPTA 4MPQA 4R27A 1LBFA 2AAMA 3BAJA 5H8PA 4I3GA 2NW0A 1QUMA 2VEIA 3QGAC 4U2YA 4QDMA 3ITYA 2CZFA 5I23A 4GZJA 3WQVA 2PGEA 3GNDA 5D2WA 2DZSA 3IJ6A 1RA5A 4O4VA 3QMSA 1Z8AA 1C91A 3EX4A 1XGDA 3VYLA 2QR6A 1W3NA 4L64A 2QPSA 2YLAA 1WE5A 1F76A 3GR8A 4FLQA 3V1HA 1FFQA 1KA9F 2EG7A 5FA5A 2BY2A 1C8YA 4WXZA 4IX0A 4K39A 2O9OA 4OUEA 4TQTA 4Y9NA 4C7DA 1W31A 5DEZA 3MBDA 4NZ5A 2GJXA 4K7YA 1DKWA 4GUIA 2NUYA 2RGLA 4GZIA 4K38A 1GHSA 3W87A 3TN5A 4J1OA 4KF1A 3AOFA 4LCSA 1W5NA 1QMLA 1GQKA 3ARXA 2VGIA 3FEMA 1KBKA 2WJEA 2D73A 4MZ1A 4L6HA 5AHNA 1TSIA 1JQXA 1P6CA 4DYJA 3CBWA 4QJ1A 2PU1A 3DBNA 1XSJA 4NSBA 4LYQA 4QEHA 5GJNA 1R46A 3B0PA 3MP3A 3GM8A 1N8IA 4AXNA 1DL3A 4A3YA 2DW7A 5EY5A 2RFGA 1SZNA 1GZGA 3N18A 3WNMA 1DOSA 1SMAA 2OELA 2QCEA 4UFLA 3TEVA 1OADA 1V3JA 3DIPA 4IF2A 1JF6A 4HTBA 2ZXBA 3GQYA 4G56A 3N2OA 4QEEA 1K3UA 3F4WA 3BW4A 1GYMA 2X05A 1TRIA 1W2VA 5REQB 3RPDA 4IL2A 3HQNA 5E0FA 3PJXA 4PTWA 4QGCA 2Y89A 3KUMA 3FKRA 4CNPA 4OBTA 2JKPA 3M07A 3SCTA 1E73M 3H8AA 1MVYA 2C16A 4BQ4A 1XGZA 3T0TA 1H50A 2AAAA 3HV9A 4IG2A 3MVIA 1JXJA 4KIEA 2OODA 1EJTC 3DHUA 4GYFA 1V0KA 2WHMA 3UT0A 4JTHA 1F8MA 3AQUA 2DEPA 3CL6A 2G50A 1IGSA 1LWIA 3LI0A 1B31A 1W1ZA 1BPLB 1PTGA 2FTYA 3L4WA 2XZ9A 3QY7A 1TB3A 3DFSA 4AC7C 1AVAA 1E1CA 3LM3A 4GI9A 1BD0A 5CPQA 2ZOXA 3C0QA 3A3WA 3DGBA 4IMGA 3TTYA 3SIZA 4WJ8A 4A3UA 4BI5A 3O8AA 4O52A 1KTNA 2G41A 1ICQA 2YCEA 5HBFA 2Q71A 4Q7BA 4B4HA 4GABA 4DWDA 1MYRA 3TWAA 3LV6A 4DBWA 1W0MA 3UG3A 1K8YA 1CXHA 3P8IA 3L2IA 4O13A 3UCDA 4XSLA 1XLKA 5BMXA 4UQDA 4CN4A 2G3JA 3Q45A 4JQ3A 2GSEA 2A6NA 5LYRA 3SCOA 3TTOA 3H26A 4ZR8A 4AZ6A 2BLEA 2HBVA 3S5SA 1W1VA 3MWAA 1EEPA 1PCWA 9XIAA 4TX6A 1ISYA 4QLKA 1GW1A 2Z6IA 1UPPA 4ADTA 4DEFA 4FR1A 2YW3A 3N6JA 5CH9A 1MFUA 3B0YA 4KETA 1PXGA 3W88A 3BAXA 1KR1A 1I45A 3G6LA 3I68A 2DDXA 4FF5A 3T40A 4JN7A 3AXHA 1YTDA 4PCFA 4F0RA 1N82A 2Z1VA 2CEQA 5C55A 3SRFA 1CLXA 3QKZA 2UY3A 3KBJA 2PZ0A 4YHEA 1WDWA 3LI1A 1NF7A 5DX7A 4S2BA 4GISA 3HGRA 1E9LA 1M01A 3MYPA 3LOTA 3W71A 3CZLA 3WF0A 3PFRA 3UWUA 3LCLA 4U31A 3WFAA 4MY9A 3EA3A 3CIXA 3T9PA 2QQ6A 3JZEA 3TP4A 1AQ0A 4XG1A 5HQEA 3UEQA 3OOQA 2Z1BA 1TA3A 3TCEA 1O95A 2C91A 3KCLA 1S3TC 3OLDA 1EHAA 3LSBA 4M3PA 5AC8A 2Z24A 2GUBA 4IX2A 2OO0A 3KP1A 5C8BB 1Q7ZA 4AZ5A 4CEUC 1PE1A 3VPLA 3PBMA 4QG8A 3BLKA 4ZFMA 1UR9A 5AHFA 4GYJA 3W27A 3M0XA 4CQ8A 3M0JA 3GTHA 3O06A 2PTYA 3O05A 1ITQA 7PTDA 1KR0A 4DXKA 4EOUA 4F3HA 1X8CA 5F7UA 3ATYA 3I3DA 3CWNA 4DWSB 1SZRA 5AC4A 1NF0A 4LVAA 3PG8A 3IJLA 4HJWA 2CLKA 4AMAA 1SM9A 4LY8A 3O9NA 3CS2A 5LIWX 1R6WA 3FVMA 4RE3A 4S38A 3B9DA 4GQ0A 3N2XA 4ZODA 2YSWA 3WMSA 1OX6A 1RK5A 5REQA 2ZC8A 3OZOA 3TONA 1ONEA 4UFJA 3N29A 3W28A 4PMQA 2YYUA 2QJIA 4FXRA 1QAPA 2W61A 1TE6A 4JAWA 4D6FA 3HO8A 3VGGA 2J9YA 1RP8A 3V75A 3W9ZA 1XSIA 4H7VA 3F4CA 4AZCB 1XIEA 2A7RA 4YWSA 3UJ2A 2REQB 4KKXA 1YNYA 2W63A 3TFXA 2PAJA 4P8XA 1UR1A 4AF0A 1TJRA 2XSBA 3M0KA 4LPCA 1W3IA 4AZHA 4ZQRA 3PZVA 1BG9A 3GDKA 1ML1A 4S3KA 3ZJ7A 5L6UA 5H8MA 4MADA 1EWEA 3H4XA 1WUEA 5BOOA 5TD4A 1OBAA 4M6VA 3STFA 4Y90A 3EX3A 1Q4NX 4LJ3A 3TMQA 5CLWA 4MIMA 3EWUA 3GDTA 1EOMA 3WMBA 2HS6A 2YJQA 3W83A 3PTQA 2P10A 4JTIA 1IV8A 2VX6A 4US5D 4L1WA 4Y9AA 3TSMA 1JULA 3F03K 3CUIA 2OZ3A 3H6OA 2JE8A 2V5KA 1Z7AA 2JALA 3WH7A 1PL9A 5JH2A 2GDUA 3APTA 3C8FA 3URQA 5ABTA 3WQ6A 1GEQA 4QG6A 4UXDA 3W7NA 1EYEA 3TE9A 5D04C 2BSLA 1JZ5A 1TZ7A 1SO3A 1KRCC 3DZ1A 4H6QA 4JR5A 4GNKB 3I4KA 4INFA 4HA3A 5SWUA 3LN3A 3WQOA 2WMGA 3UZJA 1PDZA 4IFKB 1XIJA 2GK1B 5AHEA 3OW1A 3KTSA 4WJXA 4LWWA 1JUKA 1W2PA 3PG9A 2ZZ7A 4KRTA 3KRUA 1DORA 4EXBA 2WJFA 2DZBA 1ONWA 3KVLA 1CXKA 3LX9A 4AVOA 2R91A 4PMDA 4WDUA 3QQWA 4HZMA 3EB4A 3VI2A 1KW1A 2ODOA 1GORA 2Y1HA 2X40A 1HZYA 1ZGDA 1V3IA 1KBLA 3FXGA 1O5XA 2A3HA 3W7QA 3SW6A 2PWVA 4FXJA 4X0VA 3ABRA 5BRBA 3QFEA 2F9RA 1FDZA 2QCDB 3GDLA 4O0QA 1KCZA 4JIPA 1W5PA 4LYRA 3L5LA 4HMDA 4XZBA 2X0HA 1PVNA 5BCAA 1F05A 3BCDA 2PCEA 1E4LA 4D9PA 3E02A 4ZEPA 4PMYA 1F6KA 3SEPA 2QUTA 3IUIA 1UW9A 1UA7A 2CKSA 1UCWA 1UP2A 1J6PA 2A1YA 1ZBWA 3MCMA 3ZJ6A 3W3OA 3VMOA 4FA3A 3ABSA 3QR3A 4JTJA 4U3CA 1JCLA 1F6YA 3SM0A 1G4PA 4HNNA 3ORWA 4RDYA 1X6LA 3N4EA 4ILSA 4XZHA 3TLLA 1SPQA 2FGLA 4UMAA 1XFBA 5DMYA 2VC5A 3R12A 1BYBA 1DQWA 1U1HA 3CMFA 2I7GA 4E5TA 4E3VA 3PK7A 3WJXA 3RO8A 2J6VA 1Q6DA 2B7OA 3URAA 1R47A 3EKLA 3MKVA 1T8QA 1FHUA 1LORA 3P62A 1O94A 1JZ7A 3KS6A 1VHNA 3QQ0A 2WC7A 4OIFA 3C0SA 4DUXA 2P5NA 3KWXA 4KWOA 4NNAA 2W4XA 1UMYA 5DY3A 3MZ2A 2GQ8A 1C7TA 1KBIA 2IXUA 3TA9A 2WSYA 1NARA 3S42A 4K3ZA 4IMEA 1E6SM 5M3WA 2YW4A 1C8VA 1JPHA 1NQKA 2QV5A 1JDAA 4UOJA 1YE6A 4C1LA 4FNUA 4O1FA 2D0FA 4AZCA 2G0WA 2REQA 5GNZA 3K8LA 1Y65A 2OX1A 2EBNA 5EMKA 3ARQA 3UZYA 3VNYA 2W66A 4B9ZA 1U5VA 3NL5A 3WF4A 3MMUA 2HPIA 1UC4A 1L2UA 3SECA 1NY1A 3VOGA 1WDRA 4R9OA 2OKOA 1JCMP 3BMXA 4JN6A 4BI6A 3DCPA 2VVSA 1MW3A 4HMNA 2L5HA 4MNLA 4KEVA 1MFVA 4EWJA 4UCFA 3BLLA 1NELA 4ERAA 1IXNA 4BR1A 3WF1A 1S46A 1TTIA 3VU2A 4U28A 4BEQA 1I60A 4O15A 3K5XA 3S2JA 5CAHA 3HJZA 1ECEA 1MNZA 4ZMGA 1Q2SA 4GA8A 4E3TA 1GVEA 2ZZ5A 4KEMA 1RCOB 2ZDSA 3NJ3A 4HNUA 1FWDC 1QHOA 4LV4A 2DZAA 3N13A 3IIPA 2PEVA 4Z2IA 2I1OA 1UWIA 2C1IA 1QPOA 4GX8A 3B8WA 4UTFA 3PJWA 1KGXA 4IFKA 3I6EA 2GK1A 2WXDM 4WDTA 2XH4A 4WR3A 4GNJA 2PTZA 2J25A 3GDRA 2VENA 1UD4A 4LAOA 3PPFA 3TTSA 1T6MA 1BWVA 2WK2A 3WBYA 1UHVA 1DIEA 4K8GA 3OJGA 2PDBA 1P1MA 4E4PA 1EFZA 3RJYA 2Y7DA 3G8RA 3FSTA 1Z89A 2ZC1A 3ZLHA 4A8IA 1J10A 1M7XA 1XIMA 1T40A 2VQUA 1YTKA 1N8FA 1TWZA 4J28A 5LXXA 4FLSA 1YBQB 4QP0A 4CQCA 2I5QA 3PBYA 1M1BA 6PTDA 3DFPA 4S3AA 4F0MA 3CWOX 3WUFA 1R3RA 1Q4WA 1XD1A 5HPCA 1HKKA 5CBJA 3GH7A 2QCDA 4PH6A 1R38A 1KFBA 2OT0A 1NTHA 1O5KA 3T78A 4JL1A 2BXZA 3QC0A 4HPXA 3SGGA 4UUIA 4DJDC 1F6PA 2V30A 2VR2A 2VWTA 2EG6A 1UR3M 4GIAA 3UG5A 3HBLA 1NSJA 2PDNA 2Z2BA 4K7VA 1EZ2A 1LRTA 2ZE3A 1PAMA 4OGZA 2HXTA 3SO7A 3W2JA 1XISA 3T44A 1IWAA 1IEQA 2PD9A 4BEUA 4C90A 3H55A 4B9YA 2PLKA 3IJ9A 1LBLA 3PJUA 2BHUA 5T8GA 2YFNA 1OYAA 4E0CA 3B0VC 1HP5A 1T8XA 3NVTA 1GYNA 3AROA 1MSSA 1KBBA 4AHQA 2J24A 4URIA 2QPXA 1UOZA 5HDRA 4PE8A 3BW3A 2VD9A 2Y4SA 4R34A 1Z42A 2TPSA 2CNCA 1DE5A 4ORIA 3CTLA 5F2IA 4CD6A 1QW7A 3UGRA 4DNMA 2H9AB 1VFHA 3TYAA 4K6AA 3TYZA 2X1UA 4B3KA 4FNSA 2G5WA 4G1KA 1TX2A 2EHHA 1TPDA 3B04A 2W92A 3A9IA 1FWRA 4KWWA 5LGZA 3AISA 4GKLA 4ASTA 3QHMA 4W8BA 1CB7B 4LVGA 4XO7A 1J0HA 2CHOA 2C79A 4YYFA 1CXIA 4IHCA 4DLMA 4ZGYA 1ONXA 2CPUA 3W7LA 2WBKA 4H41A 3CHVA 3M47A 1H09A 3DHDA 3SJNA 3BWWA 3SCPA 1G6CA 1R9XA 2XVLA 2QCLA 3ABOA 4OKDA 3WJSA 4HA4A 4JFUA 4KMQA 5E5CA 4JTCA 1XH1A 1M9HA 3B03A 5GPRA 3RLHA 4Q7NA 2Z28A 1ZCCA 2NVAA 2VX7A 3URBA 5M03A 4QX4A 5F2GA 5D37A 1K8CA 3CZKA 4NF7A 2OSWA 1B0IA 1LLZA 1W56A 3W1AA 1OIFA 1XRVA 4C6OA 4QE1A 3MYOA 4KRUA 1U5JA 3G1AA 4YTTA 3A47A 5I24A 1G9HA 3UXLA 3WJYA 2YGYA 2O7SA 1H7XA 1TPUA 3RLVA 2UBPC 3VDBA 2QVNA 4GK8A 4XBJA 4AEOA 2GZXA 2V68A 4G7FA 3W6YA 3PC0A 4TTUA 1GK8A 5G1MA 1X1ZA 2EGZA 3WQWA 4FX7A 5EMUA 1H5YA 2QV4A 4AEFA 2BHYA 3UPWA 3VZYA 4KH2A 1XINA 3QW3A 2YA1A 4MDOA 1G7VA 1V79A 3NEHA 4PMUA 3IIOA 4JYFA 2I5IA 4DUOA 4Z1CA 2PDKA 1N55A 4C6KA 2D22A 3TTQA 1GOWA 1Q7MA 1B4EA 3C2FA 4IUGA 2IPWA 4BCEA 2TSYA 3WUBA 3SUTA 3TROA 3EXRA 3SSJA 1UJQA 1FXPA 4XWUA 4LNCA 2BVYA 3NXLA 2NSXA 1QOQA 3ARYA 4JFSA 5D4YA 3O1NA 1TJ2A 4WY0F 5IHRA 3GNRA 1TPFA 1A0DA 2C19A 1EL3A 3K2GA 1HIZA 5C7HA 3M5XA 4JPGA 3RNDA 1PEZA 4ZZ9A 3KOYA 1Q13A 1CNVA 3IK2A 3OQ8A 1JD9A 3CQIA 5BWAA 1SR9A 4GD0A 5I79A 1OCNA 3MS8A 1X6NA 4UTUA 2J47A 3IVSA 3U7BA 1QRQA 3TA6A 2R1KA 3H70A 5IRPA 1DJQA 3CLMA 3V36A 2HK1A 4HU4A 5FEXA 1FDJA 5HUOA 3KBVA 3NVDA 3ARRA 4D6DA 3E9AA 3ZR6A 4RNHA 1NM9A 1DQUA 4C7FA 3WK2A 1GUVA 4F0KA 4IWWA 4KS0A 4CQDA 1PIFA 3K4DA 1W3LA 2VM8A 1DE6A 1XLMA 4L6OA 5HR6A 3O16A 1VFSA 4M19A 1W8GA 1IEWA 3C8NA 2BBFA 1L0PA 4RDVA 4HNTA 4FOKA 4CCCA 2OCZA 2HSAA 3BSGA 2NWSA 4W7VA 3QSTA 1Z48A 4JQAA 4RXGA 5JH1A 5G4EA 4H9ZA 1FP9A 3PB2A 5A2BA 5A94A 3VDCA 3KBSA 2H9AA 4R5EA 2Z6JA 3C61A 4BF5A 2X7VA 5D05A 4EP8C 2HQAA 2IS7A 2CLPA 3A5FA 1TQXA 5K9XA 3T8LA 1U83A 4DIAA 1TPC1 4US5A 1SZGA 1BEUA 1HW6A 4RLIA 1Q7QA 4Z17A 3KOZA 4Z2JA 4FNQA 3FY1A 4JQ2A 2JGQA 2FB3A 2NVDA 3ZZ1A 1N7KA 2XIIA 1MUWA 2ISFA 1TX0A 1XIFA 1QK2A 1Q63A 1H4PA 4D8LA 5C9XA 1ZENA 3UXDA 3W4RA 1KKRA 4AX6A 3GNPA 2CLEA 5AHIA 3LXCA 2XH7A 1CGTA 3H2OA 2FVKA 1AL8A 1L8PA 1JDDA 3B05A 3CV2A 3TK7A 1YPXA 4B5NA 2ZCGA 4IGMA 3HG4A 2ABBA 5CG7A 3KBMA 6XIAA 3O6DA 4IQLA 1CBGA 2W62A 2IW0A 2V6AA 3TIMA 2J7GA 1RD6A 4G2DA 3NQ8A 3F5KA 3W7MA 3QXBA 3XISA 4CD4A 3GDMA 1BVNP 2GVJA 4LS0A 4UWMA 4HZ8A 4ZSUA 1QPRA 2GYIA 3LPGA 4DJDA 5FJTA 5A95A 4N7QA 1TPVA 3K8KA 3AWNA 1EGMA 5A3HA 3OZMA 1EO7A 1EUAA 1Z69A 3N04A 1YXDA 3K4WA 3N12A 4AMCA 4JFTA 3W25A 3WF2A 4OZOA 3PY2A 1VBGA 5CPSA 1P48A 3KFTA 4Q4OA 3ANUA 2ZZ6A 3VGBA 3KS5A 3ME3A 1RR2A 2PP1A 4PN2A 4PRTA 4MJ4A 2P8CA 4DJFC 2DZVA 4XD4A 3NQFA 1B4KA 2CWXA 1P7TB 4P7LA 3WBWA 3CMGA 2OG9A 1OGSA 4DAIA 2E25A 4XAGA 4RNFA 1UKPA 3IGUA 1GZ1A 1CEOA 1MNSA 3WMCA 3W1MA 2P3ZA 1KM0A 4QQUA 3QF0A 1Q6GA 1OCBA 2QJMA 2NV2A 3HOJA 3TC7A 4HNLA 4A2SA 1ZBVA 2XVNA 4GVHA 3NQ2A 2WOQA 4MVAA 3UG8A 3SRKA 4UTJA 5CGQA 3DERA 1K7EA 3RILA 1W1B1 1J9YA 1TV3A 5CGMA 1FWNA 4GO9A 5C54A 1P0NA 3T07A 3BJSA 1B3WA 2QDDA 4PUMA 1R85A 2V63A 3AUJA 2QGYA 2ZX9A 2JEPA 4JTEA 4PSPA 3VKCA 1QDSA 5D02A 5HMEA 2PURA 1DJGA 3GC4A 1R3TA 4FO4A 5BROA 1ZPTA 2VGGA 3EAUA 1J0YA 4GXPA 2CIPA 1OY0A 2D2GA 4XKMA 2DT0A 3U0HA 3IEBA 1SMDA 5XINA 1WZMA 3BMWA 1V3LA 1TG7A 2GJNA 2ATSA 3DN5A 2Q8LA 3GR7A 5AHMA 3ABZA 2HE5A 3DH7A 4AWTA 3W85A 2VZUA 4BWLC 1REQB 4Y6GA 3VNDA 3KXQA 3TNOA 1EUNA 1RJQA 2XFWA 1EF3A 2OEMA 3A22A 3MJMA 4HU3A 3GX9A 2FHFA 4WX2A 3OQEA 1GQLA