2WAGA

The structure of a family 25 glycosyl hydrolase from bacillus anthracis.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
217
Chain Sequence
GSSHHHHHHMDRYEIKGVDVASYQGDIDWRELEKQNMKFAFIKATEGSAFVDKYFSKNWTNANKTSMRVGAYHFFSFDSKGETQAEQFIRNVPKYKQALPPVIDVEFYANKKDNPPKREDVTKELSVMIEMLEKHYGKKVILYATQEAYDLYIKDAYPQCDIWIRSVLTKPSLSDERKWTFWQYTNRGKLSGYNGKEKYIDLNVFYGNEEEFENYGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Family Gh25 Lysozyme from Bacillus Anthracis Implies a Neighboring-Group Catalytic Mechanism with Retention of Anomeric Configuration
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
molecule keywords LYSOZYME, PUTATIVE
total genus 77
structure length 217
sequence length 217
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wagA00
1UQZA 3DHUA 2W91A 3PBGA 4N0RA 1WPCA 4TTGA 1V3JA 1H4PA 1NWUA 1KXTA 1V3IA 1VBUA 2BVYA 5CJ5A 4P7OA 3BH4A 4GI9A 1E43A 4W84A 3AIVA 3I3DA 4PTXA 1BG4A 4UCFA 3VDAA 4OUEA 3POHA 5DT7A 2VCBA 2WXDM 3VINA 2CERA 2CCRA 1CXHA 2J78A 4CCEA 4JFWA 1OB0A 1EXPA 3UR7A 3ARTA 3AICA 3WQWA 2J8GA 2J74A 1HKKA 2WBKA 3FHQA 2XGBA 2ZUSA 4OJYA 3WEMA 3THCA 5A6BD 2CESA 1FFQA 5M5DA 1UQYA 4FLQA 4P8UA 1V0LA 3EMZA 4PSPA 1JD9A 4J3SA 2FGLA 3GBEA 3A47A 3EDFA 1XYZA 2VZVA 1KB3A 1XRVA 4K68A 1BLIA 4P8XA 4Z2LA 1US2A 2WWCA 1KGXA 2PWDA 3THDA 1DWFM 1XD0A 1H49A 4UQCA 4JL2A 4ML4A 3VDBA 4D1IA 4WK9A 1MQPA 1VB9A 4TUFA 3QHNA 3ZT6A 2JALA 1A47A 4D1JA 1SMAA 1DWHM 3FAWA 2XJ7A 3UCQA 4UFHA 1E5JA 2CHNA 4V27A 4ZFMA 1JYVA 2PB1A 2OWCA 3KL3A 3W29A 3WDPP 3W25A 3A4AA 3K46A 2FH8A 4BQ3A 1QHOA 3SURA 2VQTA 2YL9A 3ZSSA 4P7QA 4D71A 5D8ZA 5D9NA 4ACZB 1C3FA 4JFVA 1VENA 1CGVA 2VX7A 4IUGA 3L4WA 1JZ4A 4DWSD 2JIEA 2ZUNA 3WNKA 5A6JA 3BMVA 3O9NA 3OLIA 1F4AA 5A95A 2J77A 4M24A 1GORA 5FCZA 2EPKX 1W3LA 1W1PA 4ZE4A 3W28A 3IAPA 4MAZA 5E09A 1DWAM 5D9MA 4M8UA 4UOZA 2C0HA 3SCWA 3BAYA 2J79A 4AD4A 1E6PA 2WLYA 2QPUA 4EANA 4IPLA 2Y4SA 3WDQA 5EB8A 1NP2A 2GVYA 4CGTA 2D20A 1ODUA 2G3IA 3RPMA 1KXHA 1JZ3A 3RILA 2VNCA 3ZJKA 4Z2HA 1BYDA 1Z32X 1HKJA 1WE5A 4X9YA 3F5LA 2VR5A 4LYPA 3WH9A 4AC1X 1AQHA 2W63A 1FH9A 4MPKA 4FF5A 3VMPA 1UKSA 3AIQA 3OLGA 1EDTA 1MFVA 5E70A 1U33A 5IDIA 2DT0A 5E0CA 1CGUA 3WEOA 1V3HA 1UKOA 4HOXA 2HVMA 2ZX5A 1WO2A 4JFSA 1J0IA 3VDHA 1W9DM 4U3AA 3WQ4A 5DO8A 1HJWA 2Y8KA 1OIFA 4JFUA 4U2YA 4F9DA 5CGTA 3II1A 8CGTA 4Z2JA 1HL8A 4JZ5A 2ZWYA 2XSAA 3UG4A 1LG1A 3T0BA 1ZJBA 3IJ9A 3L4VA 4WLCA 1US3A 1QW9A 3EDDA 3W0KA 3ZR5A 2CETA 4S3KA 1XYFA 1UH3A 1UWSA 3ALFA 1GOIA 2OYMA 1EIBA 1UUQA 4GKLA 1XHGA 2D22A 2UY2A 4UOJA 1J9YA 1LF1A 3AS2A 2VCAA 4H2CA 5LYRA 1GJWA 3CIVA 4PCSA 3EBVA 3AQUA 3WQ6A 1I1XA 3ALGA 3K8MA 4H7VA 2VX5A 5A8MA 3AXHA 3F5JA 5A69A 2J4GA 3AHXA 2OSWA 4AZCB 2PWGA 1YHTA 1PBGA 1K6AA 3K4DA 4HZ7A 4HOZA 1QI4A 1CXLA 1VBRA 1GOKA 5A6KA 1R7AA 3SCQA 3K1DA 4AWEA 4JKKA 5BRQA 5FL1A 3LMYA 2JE8A 3L4ZA 2WKLA 1CXFA 3ZIZA 1FHDA 5M03A 2FGZA 2WVVB 2D0FA 1E0XA 2A3EA 2BVDA 2A3HA 4D6HA 4BQ2A 1RD6A 2DEPA 2UWFA 3G6LA 1I1WA 1E1FA 1ISYA 1JI2A 1UWQA 1EO5A 4FLOA 4UQAA 4A3HA 4AIUA 1NARA 2ZX6A 2O92A 3GXDA 2BY0A 3WQVA 5A2AA 3WN6A 4AEFA 1WDSA 1WB0A 2VX4A 2YL5A 1E6ZA 4AEEA 3HJEA 4AZ6A 1IT0A 2JEPA 3WY1A 7CGTA 3CH9A 4YPJA 3UERA 3UG5A 1GOMA 4E8DA 3WMSA 1NOWA 3GYCA 2VMFA 2Y2WA 3KZSA 3RM9A 1FHLA 1UR4A 1HP5A 4J7RA 2YKKA 3CZKA 1EOMA 3CZJA 1EOKA 1EHAA 2EPNA 1D7FA 1B2YA 3S6TA 2XFFA 1HVXA 1C7SA 3ZJ6A 2V5CA 4Z2GA 1E6NA 4PMVA 4AW7A 1BAGA 3DECA 4ZE5A 1VRXA 3OLEA 1TG7A 3QR3A 1WZMA 1BHGA 1WAWA 3KE0A 5AYBA 2G3MA 1NOUA 3WDHA 4Q7NA 3M46A 3M07A 3VGHA 2VX6A 3NUKA 4GQRA 2CPUA 1E3XA 3WD4A 3NJ3A 5I78A 4CN4A 5EFDA 1L0PA 3ARZA 1OBAA 2GJXA 1E5NA 4CKQA 4B9YA 3QHOA 5CSUA 3AHVA 1PIGA 2IXUA 4FLRA 4M56A 4BZYA 3W27A 2GDVA 2W66A 3AMKA 1H11A 2J62A 3GH7A 2D23A 2E40A 3GNOA 2FHFA 2WB5A 1VJSA 2V3GA 3MMDA 1ISXA 1W91A 5HNNA 4AISA 5A94A 2WM0A 4MB4A 5CPSA 2J47A 1JD7A 3DYOA 5LA1A 2BVTA 1E6SM 5ABHA 1UR0A 2DGAA 1M03A 5D9PA 3IJ7A 1BVNP 4LYRA 2YIHA 1GQJA 3SCSA 3WMCA 1BG9A 3G6MA 5BWFA 1QNRA 3MS8A 1E6XM 1JNDA 2X0YA 4BF7A 1FP9A 4WKHA 1VEMA 3EMCA 3HU7A 2QMKA 5CPQA 4DM1A 3ZT5A 2UY5A 1QOXA 3NDZA 1KWGA 3PZUA 1SR0A 5HOSA 1VFOA 4KGLA 3GNPA 5HBFA 2C7FA 1H0GA 1W1TA 3WEZA 4W5ZA 4JKLA 2EPMX 2XPKA 4A3YA 3PZTA 5GNZA 2DSKA 3WNMA 2V38A 3SEPA 2ZUUA 3AS0A 3LPPA 2YBTA 3B9DA 3EYPA 1QNSA 4U3CA 1S46A 3T08A 1QW8A 2VOTA 4HA4A 1HIZA 2W5FA 3VIMA 3BC9A 4W7WA 3CUIA 1BPLB 1B3WA 1OGBA 4M29A 3TTSA 1JXKA 1HKIA 2WYSA 3WH7A 1HF6A 2WCSA 3MUAA 1FH8A 4HMDA 4JAWA 2WMHA 5CLWA 3N04A 2VUYA 4JHOA 3D5HA 4HMEA 3U5YA 1I75A 4ATLA 2CIPA 4UFKA 1NM9A 2XVGA 3WDJA 3PTMA 3W6LA 4D6CA 3A6OA 2PBGA 2FDMA 3SUUA 1QBBA 2ZUWA 4EE9A 5C8BB 6TAAA 4ATDA 3K8LA 1W9VA 2J7CA 3AXXA 3SUVA 2YA0A 1GQLA 2WW5A 1OGSA 1H5VA 2WPGA 4AIOA 1BYCA 1BQCA 1BGAA 2HISA 4PMXA 3SCUA 2EQDA 3VDCA 5CGMA 2J7DA 3DC0A 2WCGA 4MNJA 4ZEPA 3IAQA 4WKFA 3QHMA 3CUJA 2WMIB 4PMDA 3PZGA 3WF0A 2BY3A 3L4UA 3LPOA 1VFFA 1CPUA 1UH2A 2TAAA 4PMQA 3WDRA 1J10A 4GI6A 1OGGA 4OBRA 3GZAA 2QF8A 1CYGA 1PX8A 3CTTA 4IM4A 1B3XA 3GXFA 5A6MA 2QPSA 1L8NA 1UYQA 3BLKA 5I77A 1C93A 4AZ7A 5IHRA 3CBWA 2XFRA 1VFUA 3VGGA 1ITXA 1RPKA 2GJXB 1E71M 2YA2A 3ZQ9A 2VQUA 3TTYA 1CLVA 2GK1B 1CGTA 4A4AA 2OSXA 4LX4A 2YDSA 2NW0A 2CYGA 3W4RA 3ARQA 4GZEA 3A3HA 1VJZA 5I79A 3OGRA 4CVWA 3U57A 2J7FA 2VRJA 3CO4A 4PTVA 1UD4A 1W3JA 3TP4A 1HN1A 1LG2A 3AYRA 4AD5A 1HX0A 4HTYA 3CMGA 3CGTA 1B3YA 1RP9A 1OCQA 5GPRA 3MU7A 1KXVA 1DWGM 5IHSA 4MJ4A 3VM7A 1VF8A 4CU8A 5A6LA 2OLHA 1GW1A 5ABFB 1N82A 4W88A 3WQ8A 2DSZA 4V28A 1C91A 5A2CA 4UZSA 1CGWA 5DT5A 1QNPA 4Z2IA 2UY3A 3PN8A 1DP0A 3VD4A 2FHCA 4MTVA 2C8NA 4PMNA 1KQZA 3DYPA 4HPHA 2XFYA 3MO4A 2WC4A 1PX3A 1UR2A 4DM2A 1PX4A 2E4TA 4P7RA 1KQYA 1D3CA 4CCCA 3CHFA 1J0YA 3RJXA 2VJXA 1E73M 1M7XA 3WELA 4CD7A 3VIKA 3WF1A 3VIFA 2NT0A 4LQ1A 3FW6A 5A6BA 1MFUA 2XTKA 4HA1A 4W89A 3OZOA 3T2QA 2ZUMA 4P7NA 1NWRA 1JAEA 3ZJ8A 4J3WA 3MMWA 1GZJA 1E6RA 1UD8A 4GIAA 3VIIA 4QCEA 3AMDA 2DH3A 5HPOA 1H3GA 5M17A 3CHCA 2XHYA 3ZOAA 1WZLA 1UKTA 2BY2A 3AI0A 1C7TA 3AIUA 4OIFA 3LPGA 3FAXA 4F8XA 2D3LA 2ZX8A 1UD6A 3GXIA 1UD3A 2E8YA 2GDUA 4GQQA 3W26A 4UQEA 1WCGA 3RDKA 1CXIA 4UQBA 1E9LA 4J3XA 2X0HA 3AIBA 3UEQA 1XD1A 4MB5A 1LL4A 1GOQA 4EAMA 4HOWA 2XM2A 2GFTA 4AZBA 3GXMA 5GNYA 3BAJA 1B3ZA 1UH4A 3WF4A 4QP0A 4JL1A 1GONA 2PWHA 3A4XA 4GPNA 4HA3A 4UNIA 2D0HA 5BYWA 1QPKA 1YQ2A 2Y5EA 1SMDA 1VAHA 2CBIA 2PWEA 5GNXA 3EDEA 3ZJ7A 3PZIA 4PRWA 2V3DA 1W9UA 4WKAA 5DFAA 5BXPA 4AZGA 4XZWA 3PZOA 3WUEA 2DSUA 5EMYA 4C7DA 1ZJAA 1CLXA 1IZJA 1TFVA 6A3HA 5I6SA 1FH7A 2VCCA 4Z2KA 3AHTA 3N12A 2XVPA 5A1AA 1EQCA 2RGMA 1GVIA 3N1AA 4R27A 3FN9A 7TAAA 4L4OA 1H2JA 1H09A 3EDKA 2YOCA 4QCFA 2VC9A 1LL6A 5CSYA 1J18A 1RH9A 1V3LA 1HJVA 1J0KA 4GZIA 2DIEA 3PZ9A 1ISWA 4MJ2A 1DEDA 1ZBCA 4E8CA 1MXGA 4FK9A 1V6WA 2DH2A 1J01A 2W67A 2WK2A 2QV4A 2CKSA 3VPLA 4UFJA 4X0VA 1TZ7A 3AZSA 1HJSA 1NWTA 4GO9A 1XH2A 1ZBKA 3W6MA 1IV8A 1EDQA 2BHZA 2OSYA 1E56A 1B90A 5BXRA 1BYBA 1R8LA 3VIJA 2VVNA 3CMJA 2YA1A 3TONA 2CBVA 3WH8A 4DWSA 2PF0A 4UTFA 1UOKA 3WH5A 4M82A 4PMUA 4CD8A 1CZ1A 4KRUA 4C7FA 4ZXOA 4PMYA 3CPUA 1O6IA 1HP4A 3L2MA 2ZICA 3B9EA 1NWSA 1BGGA 1KCLA 2CXGA 4BQ5A 3TA9A 2ZIDA 3TTOA 4YHGA 1JG9A 5A8OA 3WIJA 1E4IA 4JIEA 5M3WA 3OBAA 2YDQA 2D3NA 2WHKA 3GTNA 3SUWA 4KRTA 2X8RA 5CXPA 3T2OA 1MYRA 4KGJA 2BNJA 2WVUA 4AXNA 3SCOA 5E6ZA 4B15A 2EPLX 5KZ6A 1TA3B 4W8LA 4B3KA 1V3KA 3OIHA 1JDDA 1W9XA 2BY1A 3RJYA 3WFLA 5JBFA 2YL6A 2D1ZA 3NYDA 2F8QA 4HPGA 1EO7A 1HJUA 4YHEA 4H8VA 2YDRA 1WDPA 1UD2A 3U5UA 4U5KA 5CLTA 2GJRA 4LPCA 4AY1A 2CKRA 4DUWA 3RO8A 2VR4A 9CGTA 1LL7A 1JL8A 2E9BA 1E40A 4MB1A 5C70A 1J0HA 1W3HA 4JHZA 4D6IA 1NOFA 1V03A 4NF7A 1V0NA 1QI2A 3CLWA 2DIJA 2EJ1A 3AISA 1K9DA 1B31A 1AQ0A 1UD5A 1JNEA 3OGVA 1J0ZA 4V2XA 3VU2A 2DSVA 1B0IA 3ARWA 4U33A 4H41A 1EDGA 4HZ8A 3APGA 1HL9A 3ZSTA 4OKDA 3WUGA 5I23A 1E55A 1UKQA 1VEPA 2WKGA 4QDMA 4RL3A 4W85A 1PAMA 8A3HA 4PMOA 2EO7A 3W24A 2WZEA 4TX8A 4MNLA 3WMBA 4KWUA 3WD0A 2VZUA 1H41A 4AZIA 2DT3A 2YLLA 4TXEA 2IXVA 3PHAA 3PTQA 4NRRA 2G4FA 3ARXA 3KL5A 4W8BA 1PJ9A 1TCMA 1CTNA 3BCFA 2VZOA 3VVGA 1G9HA 3AS1A 1CBGA 2YL8A 1ISZA 1UZ4A 4GI8A 3J7HA 1CXKA 3WUFA 1OM0A 1KR0A 1FFRA 1KGUA 2GK1A 4W7VA 3W81A 3M7SA 1KBBA 1A3HA 4WF7A 2O9RA 3VD5A 3WH6A 2VZTA 4PBGA 1XGZA 1JIBA 3TOPA 4HU8A 1K9TA 3AROA 1XH0A 3AYSA 2VO5A 1NQ6A 1UWRA 1UKPA 1HJXA 2VL4A 1OD0A 1GQKA 4XB3A 1JXJA 1XSIA 2BHYA 1VIWA 4UZUA 4OBSA 4D6JA 5AC5A 2QMJA 3CZLA 2J7BA 5IFTA 4Y7EA 3UETA 4D6DA 4XZBA 1ZB5A 1MVYA 3AXIA 4MNMA 2WC7A 4PUDA 5BROA 5AYIA 5IFPA 3ZT7A 3N18A 3CZGA 3WNNA 4LGXA 3K8KA 2RGLA 4BA0A 1GHSA 1NH6A 1QHZA 4XUYA 1E1EA 3AOFA 1V6VA 1F4HA 2UY4A 1EGZA 3KWXA 1OINA 4M81A 1GVYA 2VRKA 2ESCA 3ARVA 3VILA 2A3AA 3WENA 1JI1A 2WZIA 5IXEA 3FXYA 2JEQA 3VTRA 4DWSB 5HXMA 3PTKA 4W7UA 1Y7VA 4PMRA 1UA7A 1V6UA 2W61A 1HT6A 4KH2A 1ZS2A 1UR9A 1JYWA 1MW3A 1W2VA 2GJPA 1V6YA 5I0DA 4C7GA 3WNLA 5D9OA 1OT1A 2X05A 2E9LA 2AMGA 3GH4A 3MANA 2FH6A 5FL0A 4D6GA 1W1VA 1R85A 4X0NA 1TVNA 3EDJA 4ZENA 4CN6A 2E0PA 1MXDA 3CHEA 2NSXA 4CVUA 1JFXA 2G8ZA 4L4PA 3PZMA 5F7UA 2GSJA 5TD4A 5CQ1A 1R86A 1MWOA 3WF3A 4JFTA 1BVZA 3BAIA 1B3VA 2AAAA 1H0IA 4J3VA 2X09A 2DSWA 1XSKA 3SCNA 5BCAA 1LWHA 1GHRA 2VRQA 5I2UA 5BXTA 3ARSA 3QOKA 1MW2A 3QGVA 1LQ0A 1VEOA 1G01A 3VGEA 1LWJA 4MDPA 3GDBA 4MB3A 5EFFA 4UQ9A 3RIKA 4NSBA 1UR1A 3HN3A 1JGIA 4PTMA 7A3HA 1ITCA 4S3JA 3VMNA 1CWYA 4MADA 2F61A 3POCA 2YJQA 3BSHA 5FIPA 1V0MA 2W4XA 3AHZA 3A4WA 5CZKA 6CGTA 2G41A 4NI3A 4UFIA 1MW1A 3RM8A 5KEZA 4PN2A 5FD0A 2X2YA 4CN1A 1UWUA 4FLSA 5E9AA 2ZX7A 2WVTA 1PPIA 3W38A 1GNXA 1HNYA 2E3ZA 1CXEA 2J7EA 1CENA 2PBOA 4CD6A 1V08A 1CDGA 2WNWA 5E6YA 3SUTA 3PZQA 2D0GA 5JUVA 3WSUA 1R7OA 4BQ4A 1KGWA 1AQMA 3BAXA 4B3LA 3U7VA 1G1YA 3BAKA 1JYNA 3CHDA 4QLKA 2GUYA 2ZXBA 4N42A 5A8PA 3AZTA 3VNYA 3VD7A 3VO0A 2OWWA 3WNPA 2E9MA 3ZMRA 2XVNA 1EHNA 2WAGA 4AMCA 2BXZA 3ARUA 3WBEA 3HMCA 4U5IA 3BSGA 3WUBA 1C92A 4JKMA 2VI0A 1AVAA 2X1IA 3N15A 1XC6A 3PZNA 1XSJA 4UOQA 2Z1KA 1GJUA 2XGIA 5HDRA 4J3TA 4CD4A 5JIWA 1Q6FA 1DHKA 2EXOA 4WIWA 4GINA 2XG9A 1ZL1A 2J7GA 1JZ2A 3SCRA 1BYAA 2WZHA 1X1NA 1G0CA 2JF6A 3RCNA 3VOCA 3RM4A 2VZSA 1WZKA 2AOSA 2DT1A 4OZOA 2CHOA 1HKMA 3RMEA 3BXWA 1WDQA 4WSKA 1MW0A 2QLYA 2ZUTA 3L4TA 3CZ8A 3N17A 5D8WA 2JFEX 1OD8A 3ARRA 1HVQA 3WF2A 1E4LA 1JFHA 5BRPA 1GUVA 4IPNB 1JYXA 5AC4A 2WBGA 4NRSA 1BF2A 1BTCA 3WDIA 3WD3A 3VM5A 1FOBA 1WZAA 1JF5A 3AIRA 4ATWA 1KCKA 1KR1A 2G3JA 1V0KA 1Q6CA 2QHAA 3FHAA 4JCMA 3TTQA 3PZVA 2WHJA 1C8YA 1MQQA 1WKYA 2V3FA 2ZX9A 2J7HA 2Z1SA 3MUIA 4HP5A 5DEZA 3VGDA 2BHUA 1WDRA 2Y24A 2BV9A 1K9EA 1LLOA 1JDCA 3O2LA 4W86A 1E0WA 2Y8VA 1BFNA 4PEEA 5JBDA 3GH5A 2IUZA 3I3BA 2WANA 2OWXA 3OZPA 2CITA 2J8FA 3KL0A 4ACYA 4F9JA 1V02A 3N11A 3L4YA 5AY7A 4GZJA 4AZ5A 1R87A 4M1RA 1E4MM 1GPFA 4TTUA 3WNOA 2J75A 3VGFA 1RP8A 4RE4A 2XWEA 1KWKA 1GOOA 1OWQA 5ECUA 1V3MA 2BXYA 4PUEA 4W87A 1TE1A 5HPCA 3IJ8A 4TVUA 3B8SA 2D2OA 3VKKA 4D72A 1XH1A 1MQRA 3VIOA 4TOQA 3MUZ1 4WSJA 1DWJM 1V6XA 4QAWA 4H04A 2XYLA 4UFMA 3AS3A 4E4PA 1JDAA 2DPEA 4J3UA 4OOUA 1CECA 1XV8A 2B31A 1E4NA 4TVDA 4M80A 1W9PA 1ZU8A 1G5AA 3AMLA 4LXFA 1K9FA 2VT0A 5D4YA 5CPTA 2V5DA 4GXPA 1DWIM 2WSKA 5FOOA 4AD1A 1M01A 1OIMA 4IISA 3BAWA 3VIGA 5C71A 3ZO9A 4NZCA 3WD2A 4HZ6A 3WFZA 3JUGA 1ECEA 1FP8A 3B9AA 3KEHA 4CUCA 5JBEA 5I24A 3M6DA 3W37A 1ZBVA 2OYLA 2EPOA 4Q22A 1BSIA 4AYSA 1U30A 1JZ6A 3BGAA 3NCOA 4HMCA 1HJQA 2Q8XA 3AJ7A 5JIPA 1QNQA 3D3AA 1B30A 3VIHA 3T2PA 1C8XA 3VGBA 1QBAA 1UG6A 3DHPA 1JF6A 1SFSA 4QFUA 4RE3A 1WNOA 1TVPA 1H1NA 3EMQA 1U2YA 1CGXA 4GO8A 1LJYA 4BCEA 1W3KA 3MSGA 4H8HA 2WMFA 3F4VA 4PMZA 1TUXA 4CU6A 1ESWA 2WCAA 1QI0A 2ZXAA 5ABGA 2ZXQA 3L2LA 2OYKA 3O6AA 4HU0A 4DWSC 3S2CA 4AZHA 3ZR6A 4LYQA 1UZ1A 3VX0A 4D6EA 2XUCA 2WC3A 2XWDA 5CG0A 2PI6A 2WMIA 4P7LA 3LPFA 3MV11 2VURA 3OG2A 2WVVA 4P8WA 2XVLA 2WMJA 1B9ZA 2JF7A 5A8QA 1TA3A 3I3EA 1V02E 3IANA 2W92A 4J28A 4U31A 5BXSA 3UG3A 4AD2A 5EBAA 1SYTA 4W93A 1XCXA 3FNDA 1OSEA 1TR1A 1ODZA 1QI5A 2XM1A 3U7BA 2EBNA 3SCTA 4E2OA 2NT1A 2WHMA 3VMOA 1UWIA 3WL1A 4YN5A 1GCYA 1W32A 1E6QM 2V3EA 4F79A 2O9PA 3WL0A 4W8AA 4KMQA 1KBKA 4FMVA 4UR9A 3ECQA 1CGYA 1C90A 4W5UA 1GQIA 2MANA 3CUGA 4URIA 5A6SA 5E0FA 3UESA 2O9OA 2XVKA 1D2KA 3VD9A 2E8ZA 1KFWA 2ZWZA 4PTWA 4RE2A 3T0AA 5FKYA 2G3NA 1EQPA 5ABFA 2DT2A 2EEXA 1P6WA 3WD1A 2BS9A 2CBJA 3WBAA 1DTUA 2JIWA 3DYMA 4TX6A 4CD5A 3BLPX 1PZ3A 1JAKA 3CUHA 5A3HA 1M04A 4QLJA 1OT2A 4JCLA 3SIMA 1QNOA 1E3ZA 5A2BA 4XX6A 1C8QA 4OOZA 1IZKA 3BCDA 3GBDA 1UR8A 2PC8A 3W82A 2WHLA 5DF0A 2CBUA 1UWTA 4ACZA 3SCVA 4P8VA 1Q6EA 1ZBWA 1J0JA 4AD0A 4DUXA 2F2HA 3AIEA 3OA5A 4MAVA 2CNCA 3NSXA 2FHBA 1J12A 1Q6DA 2ZE0A 4AZCA 1Q4NX 3VUPA 4CU7A 1JZ7A 4AIEA 3L4XA 3IK2A 3ARPA 1TMQA 5I3DA 5ABEA 4F66A 5A8NA 4XV0A 3GNRA 3N9KA 3NSMA 3ARYA 1W9BM 2BFGA 4R5EA 2WLZA 2WSPA 3T0DA 1WP6A 3K4AA 3MKKA 2XIIA 1QHPA 1X6NA 2WMKA 4D6FA 3ZM8A 2WWDA 3NIYA 1ISVA 1J11A 1PIFA 2WVSA 3AHYA 4H8UA 2DQXA 4EKJA 1GOWA 2VVSA 1EH9A 3SUSA 2XIBA 1AMYA 1CEOA 3AFBA 3W53A 3NSNA 3N13A 3GM8A 1E72M 1M53A 1PZ2A 4WJXA 4CCDA 4AD3A 2D24A 1E70M 4EK7A 5I5RA 4B9ZA 3AIWA 4U2ZA 4PSRA 3CUFA 2WMGA 1FA2A 2W62A 1JZ8A 1X6LA 1XCWA 3VX1A 4DUVA 3MV01 2A3BA 2ZOXA 3MUY1 3AMCA 4MDOA 3T09A 1O7AA 3MMUA 4TVCA 4UFLA 3WKZA 4J27A 3SCPA 3QOMA 1KXQA 1VFMA 1JZ5A 3VIPA 1EA9C 1UHVA 4QLLA 1E15A 5LA0A 2A3CA 2PWFA 3UR8A 1QI3A 2DDXA 2VTFA 1CNVA 2YLAA 2J25A 2O9TA 1G94A 2XSBA 3OGSA 3NDYA 4PYSA 2YBUA 3VD3A 1E0VA 1Q6GA 5DMYA 4MNKA 2ZXDA 3CZEA 1W1YA 3FY1A 3OLDA 1NP0A 4UQDA 3WQ5A 5GQBA 3VNZA 3OB8A 4BS0A 3F5KA 5LA2A 2CEQA 4ZXLA 3E1F1 1HXJA 3MSDA 2ZUVA 1B1YA 1W2PA 1UA3A 3AZRA 3AMGA 4PCTA 3BMWA 5A6AA 4B16A 1QVBA 1CIUA 1PEZA
chains in the Genus database with same CATH superfamily
4M51A 1PHWA 1H4PA 1KXTA 5CJ5A 1KLYA 4H3DA 4GI9A 3B8UA 4PTXA 3Q37A 3LNMA 3VDAA 2GVEA 4OUEA 1REQB 2BMBA 2ZZ2A 1Q3NA 2WXDM 3TNBA 3VINA 3G0XA 2ISWA 4CCEA 2UV8G 2QUNA 4W4QA 3K1GA 3ARTA 2J8GA 4S3GA 5FF4A 3A5FA 4Q7BA 2CESA 2RDXA 1K1DA 5F2MA 2OGJA 3EDFA 1B4KA 1XYZA 2GGGA 2VZVA 1KB3A 1XRVA 5DMNA 4Z2LA 1US2A 2WWCA 5D05A 3THDA 1JUBA 4JL2A 1M7PA 3S2JA 1RZMA 1VB9A 3ABQA 4TUFA 2GL5A 3ZT6A 1A5BA 3OQ8A 2JALA 3KDOA 2PWUA 3P5YA 3STPA 1VJIA 2XJ7A 1E5JA 4FIQA 2CHNA 2PB1A 3W29A 2PD9A 4JTKA 1EJRC 1MDLA 4JIQA 3GDMA 5T9CE 3K46A 3SURA 1SZRA 1O95A 2IS7A 1EL3A 5BOEA 3R79A 2P8CA 3ZSSA 5EPDA 4P7QA 3VFLA 4D71A 2BXVA 5XINA 1VENA 6ALDA 4IUGA 4ILSA 5EMUA 3SN1A 4GQBA 4H7CA 2WZMA 5BMWA 2YCEA 3R4IA 5G1TA 4IHCA 4GQGA 5HNUA 1FWNA 4M24A 3DIPA 2G4JA 5E09A 1M41A 5D9MA 2O55A 3O15A 4NX0A 4G7EB 3BAYA 2WLYA 3DX5A 3KZPA 1Q7ZA 3QRHA 3KCOA 2ICSA 3FVMA 1UJPA 1I9CB 4IPLA 5AHIA 3E0VA 3DBPA 3SAZA 3WDQA 1NP2A 2D20A 3CUZA 1KXHA 2W27A 1JZ3A 2VNCA 3C6CA 3ZJKA 1YDYA 1RK5A 2P0IA 2WV8A 1GEHA 2E7FA 1Z32X 4JEQA 4FPSA 2FTPA 3IPWA 2QGHA 4WOZA 3EWXA 3CXOA 4OV4A 3QPYA 2DZSA 2YXOA 2XDFA 3AIQA 2PP1A 1MFVA 2IKJA 3ITCA 1U33A 4MY1A 1EEPA 1Y65A 1CGUA 3QJAA 3PJWA 3QLLA 4BWLA 3KHJA 3LI0A 1W9DM 4U3AA 1YTDA 2EF9A 4U2YA 1J5SA 3E0WA 4JTUA 3II1A 1VP5A 3QSRA 2PF8A 2Y0FA 3UG4A 3L4VA 1QW9A 3EDDA 1EZ2A 4S3KA 3L5LA 3UJ2A 3BOLA 1UH3A 2ISDA 3ALFA 4XKMA 3TUUA 3QW3A 3IWPA 2D22A 1LF1A 4NZ4A 3REQA 3GDRA 3MC5A 4BEQA 4H2CA 3CC1A 3CIVA 3KTSA 2GSEA 1FWWA 3OHIA 3K8MA 2C71A 3WJXA 3AXHA 7PTDA 1XUUA 2EAWA 1BQGA 2J4GA 4AZCB 1K6AA 1DTNA 4Q4MA 3SCQA 3K1DA 2YZRA 5FJPA 2GQ9A 4ZR8A 5BRQA 5FL1A 3LMYA 2JE8A 1EC8A 2WKLA 3T8QA 5M03A 4C1NA 2WVVB 1OFDA 3AYTA 2G97A 3AWNA 1QW7A 4D6HA 2GOUA 3LM3A 1LT8A 1OYAA 1RD6A 2OX1A 3HTWA 1E1FA 1JI2A 3P0WA 1UWQA 3WBXA 2IPFA 1TX0A 4FIRA 1EO5A 2PDMA 4ZTYA 1GKPA 3H2AA 3KP0A 2DFAA 1H7XA 5CCZA 5A2AA 1ZNNA 1WDSA 1WB0A 2VX4A 2YL5A 4Z1AA 2KZHA 2QPXA 3GR7A 3MWAA 4I5XA 1BSLA 2JEPA 3WY1A 3CH9A 1SJCA 4QTGA 3UERA 2A7PA 2Q3RA 4S39A 2OZ8A 3CYVA 3LB0A 5FF7A 1HG3A 1EHAA 4Z0JA 2YCLA 3KM8A 3MDWA 4ERAA 1XPGA 1R2TA 4GRSA 5C9ZA 4Q4OA 5LNUA 4ZOCA 3DECA 4HCHA 4LVFA 1VRXA 5DRIA 3DFNA 4UTTC 1TG7A 1Q6LA 3CV7A 4PC8A 2HE8A 4JIHA 2OOGA 4GH1A 4IMGA 2Z25A 2BZNA 2G3MA 1NOUA 2QDEA 3ZVHA 3NGJA 4B5WA 3P14A 3NJ3A 5I78A 2GJXA 3RR1A 2QJGA 4M3PA 2QF7A 3QHOA 3KXQA 3O0KA 1PIGA 2C91A 2IXUA 3EOLA 3TYAA 3NQ8A 3K4WA 3W27A 3AMKA 4C6IA 2F6KA 4CNSA 3L0NA 2F7FA 1W91A 5HNNA 1JCLA 4O15A 2J47A 2BVTA 1E6SM 1ONEA 3EX6A 2FFCA 4EXQA 1M03A 5D9PA 3G1FA 3IJ7A 4LYRA 4KW2A 2E1DA 4GHRA 3PFRA 1GQJA 3SCSA 4O1CA 1QU4A 4OHQA 1K4HA 4IX0A 2HXTA 3HU7A 4YTTA 3IVUA 4UTUA 3CB8A 1EPXA 2UY5A 1GYMA 3NDZA 1KWGA 2V9DA 1IT7A 5AC8A 4KGLA 4LJ3A 4C91A 5HBFA 5EGRA 3B4YA 4EF9A 1W1TA 5K9CA 3EEZA 2GZXA 4RDVA 1OVDA 3VYLA 4HPJA 5GNZA 2V68A 3WNMA 2V38A 4AG0A 3N2XA 4TV6A 3T08A 3KBSA 3R13A 1QO5A 1HIZA 3VIMA 3BC9A 4ALDA 1BPLB 4O1BA 4ZMGA 1OZMA 4JYEA 4DBEA 4TIMA 4HN4A 1DYSA 1HKIA 2C3ZA 1HF6A 3MUAA 4QNWA 3E2RA 1FH8A 4HMDA 4PTDA 2WMHA 3T40A 2CWXA 2VUYA 3G1HA 4EVZA 4JTFA 1ICSA 3TCEA 2GJLA 2INZA 3U5YA 3GKAA 4ATLA 1KCXA 1X6UA 4E4FA 6TAAA 4ATDA 1W9VA 2WKJA 2P10A 1GQLA 3RLVA 2XZ7A 2E77A 1H5VA 2AGKA 3NPXA 2WPGA 1BQCA 2HISA 4HJFA 2ZKMX 3O6CA 3VDCA 5K9XA 2HK0A 3EEGA 3VKDA 3JZEA 2I9EA 1EF2A 4NZ1A 2DZUA 3IVSA 4UR8A 3EX3A 3R58A 2BY3A 1XINA 2VFIA 3LPOA 4YLWA 4DJEA 1IEVA 3P62A 3RO6A 4QJ4B 3WDRA 1XLEA 3QGAC 4GCXA 1J10A 3H4GA 1RCXB 4DX3A 2QF8A 3LHWA 4IM4A 3PUDA 2WSRA 4AEOA 3LCIA 3D0CA 1X8CA 1DJZA 4I6KA 1BKSA 2GJXB 2VQUA 4XKYA 3W73A 1OFEA 1Q6RA 2XH2A 2NW0A 2WNZA 2CYGA 4YU1A 1L6FA 3GFZA 4GJ1A 4ECLA 3I4EA 1AMKA 2CZVA 2CLHA 2JQXA 4L1WA 1S39A 5I79A 2NVAA 3RLHA 4V33A 4C6BA 1UD4A 1IGSA 4GG9A 1HX0A 3EX4A 3TMLA 4HTYA 1TPDA 1RP9A 5GPRA 1KLZA 3IUDA 4QDWA 3W7EA 5IHSA 2EKCA 2PDXA 4LB3A 5B80A 1GW1A 4HB7A 1EWEA 1C91A 3EA3A 3QV8A 2E68A 1VRDA 1MUCA 2WO5A 2R1NA 1CGWA 5DT5A 4Z2IA 3PN8A 4GXWA 2X1TA 3WX7A 5H91A 1DP0A 4FXFA 4XAGA 1KQZA 3S5NA 4C1NB 3DYPA 3BARA 3Q45A 1RV8A 4H6RA 1U1JA 4GFIA 4DM2A 3GFXA 4PH6A 4GYJA 4P7RA 1CLKA 4FX8A 4CCCA 4UMCA 3SRFA 4Q8WA 3WF1A 3GYEA 1NQKA 2O4MA 3OZOA 1RLCL 1R3WA 4ZVJA 3T2QA 4LUTB 3VABA 5F4SA 1JAEA 1JDEA 3MKVA 3MMWA 1E6RA 3LG3A 2ZTKA 3N6JA 1EJTC 3SB0A 2ALRA 5HUOA 5M17A 3VFCA 5IM51 2PURA 3ZOAA 3DG3A 4I5UA 2VKZG 2VR2A 3MCMA 3LPGA 4F8XA 2PDYA 2D3LA 2NWRA 4EOUA 3F2DA 3RDKA 1XCFA 4J3XA 4O4VA 3B8IA 4MB5A 3H53A 3H23A 4HOWA 3M0XA 2XM2A 4RR4A 3GXMA 2YB1A 3QEZA 5GNYA 1GONA 2PWHA 5FJUA 3HQOA 2D0HA 4XZIA 1UROA 2Y5EA 2DZWA 2CBIA 3E0IA 2PWEA 5GNXA 4F40A 2CLEA 2DVUA 1W9UA 4WKAA 5DFAA 2H8XA 3CAKA 2AQOA 2IQDA 3CAQA 3FSTA 4XZWA 2DSUA 2IPGA 1GK8A 1ZJAA 4F2UA 1X7FA 1LM1A 4PZVA 3N6HA 4LNCA 4C1KA 4MYXA 2AL2B 3ENLA 1CI1A 1EQCA 1XP3A 5FJIA 4YJ5A 1UB3A 4JEJA 1H09A 5C9RA 1YXDA 2VC9A 1DXIA 4IMCA 1E1CA 2IPWA 2CLLA 4M5PA 1R6WA 3GNXA 1EB3A 3L2IA 1ISWA 4MJ2A 1ZBCA 3LXAA 4WQ6A 1G4SA 3LX9A 1J01A 4IIBA 1T6MA 1W5QA 1CW2A 4LCQA 3W6MA 1Z69A 1PKLA 3W7PA 3ITXA 1B90A 4NG3A 3ES7A 3C0QA 1E9ZB 1TJPA 2VVNA 3TONA 2VEKA 3SSZA 4G7FA 4M82A 1CZ1A 4C7FA 3TXZA 1HFBA 1FWEC 4PMYA 2NVDA 3EWWA 1O6IA 1HP4A 1TCDA 1XG3A 1P48A 4L9XA 3B9EA 1EIXA 4ZFCA 4N6FA 1NWSA 1PSCA 1BGGA 3GWQA 5C2GA 2ZIDA 3TTOA 3GXPA 4I3GA 3G1DA 3GTNA 4OE7A 2OKTA 1MYRA 3W1QA 4MGGA 2B7PA 5E6ZA 4OWGA 1FWFC 4MY9A 1R9ZA 5KZ6A 4KBXA 4LFYA 4L80A 2BY1A 4HZMA 2F8QA 1IZCA 4H8VA 3TJ4A 3UJSA 1WDPA 3C2RA 3WJZA 4DUWA 3W22A 1JL8A 2QJJA 1J0HA 5C70A 3F4WA 1EYEA 1BWLA 3G8RA 1V03A 3KCJA 1TKKA 1CX9A 1J5TA 3U2EA 3FJNA 3IJIA 5KSWA 4PCPA 1FVPA 2EJ1A 1RAKA 3MBFA 4CCZA 1K9DA 1UD5A 2YGYA 1JNEA 4XWUA 1CB2A 3QQWA 2DSVA 4A2SA 1YTKA 3H2NA 1A5SA 4HZ8A 1HL9A 1YRRA 4LVGA 2PDPA 3WUGA 1UKQA 1VEPA 2FVLA 1XYMA 4QDMA 4LSBA 4W85A 5I09A 3AYVA 2WZEA 4L9ZA 3W74A 4TX8A 4GIEA 1E9YB 3MO7A 3WMBA 3GG8A 1H41A 4MHBA 2QXWA 3QC0A 3S5ZA 2QT3A 3PHAA 3PTQA 3W88A 8XIAA 4US5A 3KL5A 4W8BA 5CH9A 4HNVA 2VZOA 3DZ1A 3CT2A 3L21A 3B0XA 2I57A 5HNRA 4GI8A 3J7HA 1ICPA 3WYZA 1OM0A 3M43A 4WY0F 4W7VA 3CHVA 1X38A 3RHGA 4WF7A 3B0YA 2O9RA 3P60A 3U4FA 3WH6A 1IWAA 3CIXA 4X2RA 1ZRQA 3MCOA 1KW1A 4HU8A 3M44A 1ZLPA 3AYSA 2VO5A 1NQ6A 3BLDA 1UWRA 3W1XA 2VL4A 1OD0A 4X61A 3OBKA 2Z00A 1VIWA 4RDYA 3MT1A 4D6JA 2QMJA 1JQVA 1IXNA 3NEHA 3AXIA 1W1ZA 4MNMA 4PUDA 1M68A 1LYXA 3CZGA 4RK8A 3VOFA 3WNNA 2RGLA 1AODA 1DQXA 3PNZA 1NH6A 1QHZA 4XUYA 3AOFA 5BOOA 2A3AA 2XGZA 3TNOA 4KFOA 3VTRA 4DJEC 1YADA 2GGIA 2FZ9A 4RPQA 3UJEA 3S1XA 1V6UA 5HJYA 1H7NA 2Z26A 4EP8C 5DXYA 4KH2A 1UR9A 4LVAA 4Q8OA 3A24A 1XLDA 2GJPA 5I0DA 4GUIA 2X05A 1DQWA 2AMGA 3UJFA 1YPFA 3VNIA 2FH6A 3LV6A 5F1UA 4MF4A 1PHQA 3QMTA 4NP7A 3WZ0E 3DENA 4Q8TA 3A13A 1TREA 2NSXA 3ZLGA 3ZYZA 4CVUA 3PZMA 2GSJA 5TD4A 2C1IA 1R86A 5C54A 3LUTA 1MWOA 3LZ3A 3WF3A 3MSRA 2YFOA 1BVZA 2WQDA 1HQTA 1PXGA 2AAAA 4ZODA 8RUCA 2DSWA 1XSKA 3SCNA 1OCNA 5BCAA 5FJJA 3QV7A 2VRQA 2PGFA 5LIXX 3EAUA 1WKFA 3ARSA 3QGVA 1VEOA 1GPWA 4G6CA 3C56A 4UQ9A 3UZJA 4NSBA 4BK9A 2DZVA 4QG6A 3TFCA 3EA1A 4S3JA 3E0LA 5HWMA 1GG1A 3POCA 1R47A 1VPQA 2YJQA 1V0MA 5A5WA 4XUGA 2ZZ1A 3AHZA 3A4WA 1SU5A 4NI3A 1K03A 1JPKA 5KEZA 5FD0A 5CAKA 4CN1A 4FLSA 2ZX7A 3OW1A 1PPIA 2RHGA 1HNYA 1Q4WA 5BW6A 3UNDA 5HR6A 4XAFA 3M6YA 3GLCA 4AXKA 2R1LA 1V08A 5HA7A 2NVCA 3WSUA 2GQAA 1R7OA 4BQ4A 2Z2AA 1AQMA 3GAKA 4B3LA 3U7VA 5JVLA 1KRBC 1JYNA 3CHDA 1NJJA 2ZXBA 4FOJA 3TQVA 2E6YA 1ONXA 3RNDA 2A6NA 1NDYA 1FCQA 3UR2A 2E9MA 4AMCA 4I9JA 4EF8A 4WR3A 1ZJHA 3WBEA 4H9TA 3BSGA 3WUBA 3IACA 4B90A 2VI0A 2WOQA 4Z0SA 1AVAA 1KBJA 3EWUA 4E2DA 4N9EA 1XC6A 2OU4A 3PZNA 3S3GA 4LAOA 2XGIA 4FHAA 4ML9A 1ZL1A 2J7GA 3SCRA 1B4EA 1F3EA 3M4HA 4KWOA 4IGNA 2VZSA 3M0MA 1K3UA 1WZKA 2AOSA 3WJWA 3DERA 4WGHA 4QR6A 4A29A 4Z1BA 1QXLA 3BXWA 1WDQA 2VELA 3VKAA 2ZUTA 3L4TA 3CZ8A 4QEHA 1R3TA 1PZ1A 2INEA 3GVQA 3ARRA 3BCJA 1HVQA 3ANVA 5DMLA 1W5MA 3TYDA 2E28A 3GVGA 5AOUA 4IPNB 3TVAA 4GD0A 3V1HA 1BF2A 4DQWA 2FKPA 2PODA 1WZAA 1JF5A 3EXRA 3AIRA 4GNJA 4KCTA 4QGCA 2Y7FA 4LU0A 3LEPA 3N4EA 3PZVA 4QJ5B 3R10A 1LBFA 2PDHA 2V3FA 2ZX9A 2Z1SA 3MUIA 4CNOA 5TF0A 3VGDA 1R9XA 1WDRA 1K9EA 1HKWA 4Q32A 4RXFA 4MUPA 3NO3A 3O2LA 4TMCA 1S2AA 4GK8A 4PEEA 2AKMA 3H2FA 5AHEA 3UYCA 2IUZA 1Q13A 4NY2A 1F61A 3CPGA 2J8FA 1LORA 1PVNA 4ACYA 1J2BA 4MWAB 4GZJA 1QASA 4M1RA 3V35A 2TRSA 3NQBA 3S0CA 3BURA 1RD5A 4RE4A 3WLIA 1IXQA 2INFA 1OWQA 4BI6A 4PUEA 2OVLA 1F3TA 3IJ8A 1EFZA 1XH1A 4O50A 4N02A 3MA8A 3QY8A 3MUZ1 4WSJA 2YXXA 4NVTA 4L4MA 1SGJA 1AUSL 3AS3A 2DPEA 4QE1A 4IXHA 1GVOA 2Z2UA 1XV8A 3TYUA 3L5MA 1W9PA 3ISIX 2QQ6A 4JDYA 4L5ZA 4EXAA 5CZ0A 5KMYA 3JW7A 3ITTA 2OEKA 3VDGA 1M01A 1VFSA 2JGQA 2PP0A 3NDOA 5C71A 4OTKA 2A4AA 4A21A 3B9AA 1ZBVA 3AU2A 1XQKA 1A0EA 1TE6A 1BSIA 1S2UA 4HMCA 4NXSA 3U48A 3IJDA 5FF2A 4IICA 5J8LA 1EX5A 5CPOA 3TC6A 4GVGA 2YW3A 4CLMA 3BL3A 3VGBA 4HSNA 1EBGA 4AC7C 4X3ZA 3ITVA 2QIIA 1H1NA 3EMQA 2A2IA 2IKGA 1BXCA 1U2YA 2O7QA 3MW7A 1A49A 4UC5A 1CGXA 2PDWA 1KFLA 1LJYA 1VCFA 1TUXA 1VR6A 3TN3A 3O06A 5C0QA 3B8WA 3W7QA 3C3UA 4MKSA 4HU0A 2XZ9A 4DWSC 4LYQA 3VI2A 1SZGA 4D6EA 3BQ6A 4RNJA 2XUCA 2WC3A 1NFPA 3O63A 2WMIA 2VENA 4LUIA 4P7LA 2XN1A 1BXBA 2WVVA 1L6SA 3U2CA 2PLMA 2OFJA 5FACA 2XVLA 3R0DA 5DRCA 2ODOA 1KV5A 1V02E 3IANA 5HK4A 3WJSA 3SADA 3DHDA 4J28A 2X30A 5BXSA 3UG3A 1TR1A 1QI5A 2QS8A 5U4NA 2G3FA 3U7BA 3I6EA 4O53A 3KVMA 4IMDA 3VMOA 1UWIA 4RV3A 3WL1A 4YN5A 1GCYA 1QWGA 3RX3A 2V3EA 1SW7A 4F79A 1L8PA 3GU1A 1A0DA 3LBOA 3KRBA 1CGYA 1X7IA 3BLLA 1C90A 3R1ZA 4R53A 3M0VA 5AVNA 4OVXA 2DZAA 7ODCA 3W01A 2TPSA 3CUGA 4FXSA 1FWJC 3MYPA 3UNTA 3T8LA 3DFTA 4KCVA 2XVKA 3RMJA 3GXTA 3PWIA 5EMMA 3LYEA 2ZWZA 5AB3A 4PTWA 3PNUA 4MSSA 4RE2A 2QJHA 4M6VA 5FKYA 3E5BA 2G3NA 5ABFA 3A9BA 2EEXA 1XIFA 2Z6IA 4ZQNA 3F2BA 1UBPC 1QPNA 2VGFA 4QS6A 4CD5A 4XAPA 3PAJA 3BLPX 1JAKA 1UZHA 4RZ6A 1RJPA 5I3JA 1OT2A 2ZADA 4JCLA 3WLOA 3DC8A 1QNOA 1E3ZA 3VOGA 2XU2A 4K7YA 1V7AA 4MUZA 1ZY9A 1UR8A 3CQKA 1VFTA 3W82A 2CW6A 3PFMA 4ACZA 3SCVA 3CV1A 1S3TC 3DKLA 4LBSA 1GZGA 1KRAC 4C6QA 2P50A 2F2HA 4JOMA 3EXTA 4MAVA 1BRLA 4C6EA 1J12A 1GGOA 4R7WA 1KM5A 3MHFA 3VK5A 4AZCA 1KM0A 2C16A 2OGYA 3VUPA 4O17A 1N7KA 1IHIA 3RU6A 5I3DA 3O0FA 2E6FA 5A8NA 4LB4A 1W9BM 4R5EA 2Z1XA 4UNLA 4QE4A 3CQHA 3DGRA 1XPYA 1VBJA 2FPVA 5LIWX 2H90A 2XIIA 2PLJA 2WMKA 1ENUA 2BP1A 4DYJA 1O66A 5M2FX 1PIFA 1OX6A 4DBUA 2WVSA 2VGGA 4PB3A 3TK7A 3WLKX 1EH9A 4R7OA 3AFBA 4YWIA 1CEOA 3B3DA 3NSNA 2FMNA 3SQSA 4G1KA 1OADA 3MHUA 4WDTA 5FEZA 1M53A 3CASA 1PZ2A 4WJXA 4CCDA 2D24A 2TSYA 5I5RA 4H9YA 4Z1YA 4M19A 2HBXA 1FA2A 2W62A 3URQA 4DUVA 2F6XA 1NU5A 3HGJA 3AMCA 4MDOA 1O7AA 1SFTA 4UFLA 3WKZA 4WX2A 4PMJA 4J27A 3QOMA 1VFMA 3R2GA 5AYYA 1JZ5A 2LLEA 1QFEA 1UHVA 3OQEA 3DFSA 3WK0A 6XIAA 4Q4SA 1JEZA 2NLYA 1E15A 3EX2A 4WVXA 1U5VA 1QI3A 2DDXA 1CNVA 2NUWA 2E09A 1G4TA 4ZCWA 3W7IA 2YDAA 2J25A 1RA0A 3NDYA 1HZYA 2BBFA 1E0VA 3O3RA 1TYGA 4CQ8A 3PSWA 1EP1A 4MNKA 3OOQA 2Z0IA 1W1YA 3OLDA 1NP0A 1ALDA 3WQ5A 3M16A 2FQIA 5D02A 1RUSA 3ABOA 1G6CA 4L64A 3DESA 3WCZA 4ZXLA 1HXJA 4NQ1A 1AD1A 1UA3A 3IRDA 3AMGA 3PBUA 4B2DD 2C13A 1P1MA 1QVBA 4B5XA 1PEZA 4FF7A 1WPCA 1ADDA 1W37A 1L2UA 1NWUA 2BVYA 1BG4A 3N3TA 1GEQA 5CC7A 1YMYA 3PJTA 2E5DA 4PODA 1YE4A 3IVTA 4GNVA 1IEXA 3AICA 1UC5A 1AA1B 2J74A 4Q8PA 1HKKA 4PUUA 3FK4A 2NQ5A 1X96A 4HNTA 5K3VA 1FFQA 5M5DA 4FLQA 4Z42C 4GX8A 1V0LA 3EMZA 4PSPA 4L9YA 1JD9A 4J3SA 1OABA 4YTRA 3CQ0A 2D2HA 1BLIA 1QPRA 4GC3A 3QV9A 1LWIA 2PWDA 3W7GA 3H7VA 4B5NA 4UQCA 4ML4A 5FJOA 3CQJA 2W0UA 1Y5VA 3NL6A 2PTZA 3TYZA 1A47A 4D1JA 3LM7A 1DWHM 3FAWA 1TTQA 2IQ0A 2QIWA 3TLLA 4V27A 4Y9PA 4P2VA 3W25A 3W1TA 1YX1A 4AQLA 3A4AA 2GVGA 4US5D 3MMTA 3HG3A 1A5UA 4HPNA 2X7WA 2C15A 4NIRA 4DZAA 1S1RA 1YLVA 4ACZB 2GQ8A 3TOYA 3P8IA 5G1MA 4DWSD 2ZUNA 2Y7DA 3O9NA 3RCYA 3OLIA 1F4AA 2VEPA 1LUCB 3ERPA 5CEWA 4IUOA 3KHDA 1GORA 5H6HA 1H1YA 5FCZA 2EPKX 1DL3A 1W3LA 3UXKA 3NO1A 3IAPA 1F8IA 3AWOA 4M8UA 1TTIA 4UOZA 3H7UA 3SCWA 2J79A 4AD4A 2Y61A 2QCLA 4O0ZA 4AWTA 2QPUA 4EANA 3DU0A 1GG0A 3R0KA 2Y5SA 2Y4SA 4GY1A 3S83A 3GU9A 3RPTA 1FWHC 2X16A 4Y9OA 4Z2HA 1BYDA 2PP3A 1HKJA 1OC6A 4Q4RA 2QDDA 1FWDC 4L1GA 3F5LA 4DJDC 3A23A 4WXZA 1B9BA 2JBMA 1AQHA 2BX7A 2W63A 4MPKA 3UW6A 2J9ZA 2JGYA 4FF5A 3VMPA 3S4TA 1EDTA 1GW9A 5IDIA 3GUWA 2VXNA 4K8GA 1JGMA 3S1UA 3B4UA 3PC0A 3TN6A 1S38A 2HVMA 3V1PA 4JFSA 2UZ9A 4CQBA 5DO8A 3NQEA 3A4JA 4JFUA 4ZB0A 4F9DA 2GPTA 3ZLFA 8CGTA 5D38A 2OR2A 4CQCA 4JZ5A 5LNRA 3TW7A 1I60A 3IJ9A 3W0KA 2QKFA 4QROA 5IBXA 2WSYA 4GBUA 1P43A 1K7XA 2PC4A 2Q3OA 4GKLA 1XHGA 4YS1A 1UUOA 1J9YA 4DNHA 4N4PA 2HK1A 3AS2A 3QPZA 3NA8A 2ZQ0A 1GJWA 4PCSA 3EBVA 3AQUA 1GQNA 4YVPA 3W3OA 3CLMA 5A69A 3AHXA 2OSWA 1PBGA 3K4DA 5D09A 1QI4A 1CXLA 3QM3A 1GOKA 1GVSA 5A6KA 3QMRA 3DFOA 4AWEA 3RPDA 1OX5A 1DOSA 4JKKA 3MY9A 1CXFA 3SY8A 4NZ5A 1PZ0A 2D0FA 2A3HA 4QJ1A 3LLDA 1TRIA 4QBXA 4AB4A 4BQ2A 4NNCA 4JXCA 2DEPA 2GVJA 2POZA 2QCDA 2OJPA 4UQAA 1BTMA 3WQGA 2Q8ZA 4ZL1A 3JVAA 3L9CA 1NARA 2AL2A 1VPXA 2Z4GA 5E0KA 2ZX6A 2BY0A 1Q45A 1UBSA 3HJEA 1K70A 1IT0A 4BF5A 4FAMA 1OZQA 4GC4A 5CZTA 1XF0A 3H6OA 3WMSA 1NOWA 3GYCA 1XLJA 2ZBTA 4X60A 1Z8AA 3DH7A 1EBHA 1KCZA 3KZSA 3RM9A 4DVOA 1FWSA 3IIPA 4J7RA 3R8GA 2A79A 3CZKA 1VFHA 5DELA 2EPNA 3UZXA 4EAYA 1B2YA 4S3FA 2XFFA 4QDPA 3U0HA 1BAGA 3LHUA 3LQLA 4FOUA 1JCTA 1WZMA 3BZGA 3E49A 2HV5A 5REQA 2PTWA 1LOSA 3W84A 4Q7NA 3IJLA 2HTMA 3GD6A 4GQRA 1WDDA 2CPUA 4N2YA 3WD4A 3HFYA 5EFDA 2V2HA 2YZ5A 3ARZA 1OBAA 1AD4A 2ISSA 4CKQA 3MPGA 3V3WA 2V82A 3HMJG 1LQAA 1PKYA 1W1B1 2GDVA 2W66A 3IJQA 4B3ZA 1H11A 3GH7A 4F2BA 1XDJA 1QTWA 2WB5A 4PUWA 5HMDA 2V3GA 2FZMA 3B0PA 3QYSA 4PB4A 1JD7A 2HSAA 3RX2A 4K8HA 1BVNP 3KTXA 3N14A 3HBLA 4O0QA 1KRCC 5C2CA 4GA8A 3YPIA 1QNRA 3MS8A 1JNDA 4UBPC 5LZLA 4LAKA 3G5EA 1Q63A 3OODA 4A3RA 2V5BA 3DG6A 5CPQA 3QY6A 4HJWA 5JXQA 4KEZA 2J8TA 1MEHA 3GY1A 4RUBA 3TXVA 4HU3A 1YPXA 2RJHA 3B04A 3BE7A 3LHVA 5DY2A 5RUBA 4JKLA 2EPMX 3HG5A 3KBJA 1TSIA 3PZTA 4GXMA 2QJMA 1J96A 2DSKA 3G24A 3SEPA 1JCYA 4ICCX 3EYPA 3NR0A 4GVHA 4NUWA 1S46A 1PTGA 3B03A 2W5FA 3CM4A 4W7WA 3O07A 3T1GA 4U10A 4S3CA 2E67A 1A3WA 3TTSA 1LTDA 3U4AA 2XIOA 3G1YA 4KPLA 1NFGA 4UTMA 1VZWA 3CWNA 3E74A 3XIMA 2R91A 3N04A 3KTCA 4JHOA 3D5HA 4NJKA 2XVGA 3KVJA 5T26A 3MTWA 3A6OA 2PBGA 3SUUA 3THQA 1QBBA 2ZUWA 3TN4A 3M0HA 3FXGA 4LAMA 4EE9A 1O1ZA 2CC0A 3PY2A 2A6LA 5CPNA 1VKFA 3SUVA 3M0IA 1BVWA 2YA0A 2GQ3A 3FA4A 4BKNA 1PE1A 3E0FA 4HGXA 2OELA 3ABRA 1BYCA 4LV9A 2G0WA 2P53A 1IXOA 3UWQA 1TQJA 3SW6A 2E5BA 1PTDA 1KBLA 2Y85A 2NUXA 3HV8A 2EG6A 4L56A 2GUBA 1V5XA 3H21A 4PCNA 1XWYA 2QVNA 5AHMA 3P8JA 1VFFA 5C2XA 2Y7EA 3MZ2A 4PMQA 2PTXA 1YPIA 1FWIC 3GZAA 1PX8A 3I7QA 3GXFA 3BLKA 3TYCA 1C93A 4AZ7A 4P61A 2BOGX 3CBWA 4TR9A 3UBPC 2XFRA 1VFUA 4GUJA 1ITXA 2IKHA 3M47A 2ON3A 3MYOA 1N55A 3TTYA 4CNTA 2I9UA 1B5TA 1ZAIA 4HSHA 4U28A 3LBMA 5D2XA 5E5CA 3W4RA 4IT1A 4ZOBA 3A3HA 3L7RA 1ECQA 1OC5A 4V15A 4FO4A 4XVEA 2J7FA 3JR2A 5G4HC 1Z6KA 2GGHA 4PTVA 3QLDA 4RNIA 1TMLA 3TP4A 2QCFA 1LG2A 3BICA 3UT0A 1UASA 4AX7A 3HF3A 1VHNA 1W5PA 1ZTVA 1KXVA 3SN0A 3LGEA 3VM7A 1VF8A 5AC6A 1ITUA 2DUXA 4W88A 3WQ8A 6XIMA 4V28A 3OHMB 1RBAA 1H60A 4A8IA 1B3OA 2VM8A 5LGXA 2UY3A 3E9AA 4E3VA 1R2SA 3VD4A 4MTVA 4PMNA 5D32A 2GYIA 1WYIA 2WC4A 4KCWA 1PX3A 5K2ZA 1UR2A 3PTDA 3CU2A 4XZHA 1J0YA 1FDYA 5D03A 2V5JA 3UGVA 3WELA 2A7RA 4CD7A 4D2JA 2RH9A 3VIFA 2Q09A 4LQ1A 3FW6A 5A6BA 4YYCA 2XTKA 4FNRA 4HHMA 2ZUMA 3UCCA 2XSXA 3NL2A 3MHGA 1XLIA 2Y6ZA 4QITA 1GZJA 4DBDA 2BOFX 2PGRA 3PG8A 1UD8A 1QMLA 3OJGA 4FP1A 4A22A 3W75A 4AHOA 3C8NA 1H3GA 4DPQA 3UGRA 3KDNA 3VE9A 4UR7A 4HT3A 3AI0A 4A8NA 1C7TA 4OIFA 1EC7A 3VZXA 3TYBA 4I9AA 3FAXA 4Q8VA 1KFEA 1UD3A 2GDUA 1OFOA 1K6WA 5H1WA 3QKEA 4UQEA 2Z1VA 1WCGA 1E9LA 4Q8UA 3AIBA 2ZC1A 2WZTA 3P81A 4LEFA 3UEQA 1SPQA 2D2JA 1JCNA 4EAMA 3KLKA 1B3ZA 4JL1A 3NVDA 3V7PA 4DY1A 2QUMA 4GPNA 3UF9A 4HA3A 5BYWA 2Y8UA 3KS6A 2OT1A 3EDEA 1IR1A 3PZIA 4PRWA 4LALA 3HPSA 5AN7A 1HUVA 1F5ZA 3WUEA 5F2GA 5EMYA 4C7DA 2IPJA 3AXKA 4HTBA 3XINA 2NQHA 4WJ8A 5I6SA 4NAFB 4A35A 1FXQA 4XBSA 4Z2KA 4LH8A 3PAOA 1DJHA 2ISVA 2ATSA 5D33A 1H2JA 3EDKA 2YOCA 3FYPA 3S2NA 4GNKB 3MJYA 1LL6A 1EXBA 1LOQA 3ZLHA 2CLIA 4XTIA 4B5SA 1P0NA 2JKPA 1I0DA 3N25A 2I16A 2WJZA 3VPLA 3UZWA 1TZ7A 1DIDA 3TC3A 1IV8A 1RVGA 1XFCA 1XJBA 5HMEA 5BZAA 1E56A 2A7NA 2G95A 1R8LA 1YBQB 1NSJA 1EJUC 3CMJA 2V2DA 3QF0A 2YA1A 3VCNA 4IGMA 2CBVA 3PJXA 4JTRA 4JX5A 2W9MA 1U5JA 4UTFA 1TPVA 1I45A 1Z44A 3ANUA 3CPUA 4ZQPA 2Y89A 1B57A 3IRSA 3WG6A 1TWSA 3H2MA 1KCLA 2V67A 4HHPA 2CXGA 4CEUC 2D69A 4GGBA 3TA9A 4Q33A 4YHGA 5FSDC 3N9RA 5M3WA 1XGEA 1I6NA 3OBAA 5AZ0A 2YDQA 4YNGA 2AAMA 1P0EA 5CXPA 2BNJA 1M7JA 4JR5A 3T81A 1ICQA 3OVRA 1MUMA 3V18A 2OQHA 2EPLX 2EG8A 1TA3B 1Y5WA 1KTNA 3QZ6A 1JDDA 1W9XA 3IARA 3RJYA 3WFLA 1M7OA 3NYDA 1CT5A 5DLCA 3KX6A 1EZWA 4MVAA 4D8LA 3U5UA 4G8TA 2GJRA 1EJWC 3N19B 2CKRA 5HMSA 3RO8A 3RN6A 3IGHX 9CGTA 1A50A 4Q8NA 1W3HA 3A9IA 4D6IA 1NOFA 3AU6A 4DLFA 1XYCA 4JTJA 1V0NA 3AISA 1PUDA 3N6QA 3WLNA 4MG4A 4FR1A 2WNQA 1AQ0A 4XD3A 4XZLX 3A21A 1S5TA 3SRKA 4HD5A 1B0IA 4H9VA 1FWBC 1PS9A 4Q4QA 4RDZA 5I23A 4HCLA 2IMRA 4NZJA 4PMOA 2EO7A 3W24A 1GT8A 1GWJA 4E3TA 3WD0A 4LOCA 2DT3A 4O1AA 3P67A 4TXEA 2I14A 4NRRA 3HM7A 4JTIA 1RQHA 1PJ9A 2QEZA 1XIHA 1TPEA 3G1VA 1FFRA 4S3AA 3TQKA 3M7SA 2OEJA 2GWGA 1SVDA 2QUTA 4J2PA 1JIBA 3MVIA 4NX5A 5H8MA 1XH0A 3RR4A 1SQ7A 5LNVA 2KX9A 4L61A 1UKPA 3TCSA 4GLEA 1GQKA 1JXJA 3SZ8A 2BHYA 4U4MA 5AC5A 4GYPA 4ZQCA 4Y7EA 2CHRA 2VC7A 3I7SA 3UETA 4XZBA 1ZB5A 4P5UA 5BROA 3ZT7A 1NEYA 3K8KA 3UYIA 4BA0A 2R1PA 1GHSA 4MZ8A 3UVAA 3M5XA 1F4HA 5CZJA 4BR1A 5KINA 1EGZA 1GVYA 4LS2A 5LIKX 3VILA 2ESCA 2VDHA 5IXEA 4IQEA 3FXYA 2JEQA 5HXMA 1FWTA 2NLIA 4JQ2A 2B81A 2W61A 3CUXA 1TMHA 3APTA 1ZS2A 1JYWA 3HGOA 3HFTA 3BDKA 3FFSA 1V6YA 1UZDA 2E9LA 2UBPC 3MANA 2FB3A 2Q01A 1XLLA 2JKEA 3HO8A 1PO9A 3KLLA 4MYAA 3V0UA 5C6MA 4F48A 2QGYA 4CN6A 4WD0A 4I7VA 1WDWA 2G96A 4A6GA 2HS8A 2NQLA 3CL7A 1KFBA 3RCMA 4L4PA 4JTHA 4C6CA 5F7UA 1XR2A 1WUFA 2ISFA 3HPAA 5CQ1A 1OJXA 4JFTA 1RLDA 3DGBA 2FZ8A 1H0IA 4LYKA 3LCLA 1SJBA 4UTTA 1YDNA 5AZ1A 4NJJA 3LRKA 1C8VA 1W0MA 3QOKA 1MW2A 4KWSA 1AW1A 2OZTA 1LWJA 4MDPA 2ZRYA 5EFFA 1VD6A 4GUGA 3TYEA 3EPNA 3NVTA 3HN3A 1PIIA 2F84A 4S3BA 4AY8A 7A3HA 1IEIA 1S5MA 2Z7GA 2R9RA 3TTEA 1F3XA 2DZTA 1R38A 2XIMA 1CCWB 1FKWA 3EB2A 1R46A 1UMYA 4UFIA 3EOEA 5T8GA 4PN2A 1F6KA 2X2YA 2X42A 4NYYA 3KCLA 3LK6A 4KIRA 2PDCA 4I9MA 3G77A 3S5OA 2J7EA 3VKBA 1CENA 3BLEA 2QULA 5C9UA 4CD6A 2B7QA 1CDGA 3D6NA 3PUOA 2Q71A 3NPUA 3C4UA 4IF2A 3QY7A 4DO5A 2FPTA 3DG7A 3KOXA 4PULA 4S3DA 4WZHA 2HPMA 5GJPA 4N42A 3VD7A 3SQMA 5EMLA 4QE5A 1TTPA 1EHNA 2BXZA 4HIBA 5CC5A 2YBVA 1AJ0A 2CFFA 5TBOA 4XSMA 1V93A 1H7WA 2X1IA 4UWMA 2CZ5A 3P82A 3QPEA 2Z1KA 4AF0A 3BOFA 5JIWA 1PL9A 3FJ6A 1DHKA 4LTSA 1KTBA 4WIWA 4GINA 1XLBA 2XG9A 3PUGA 1YDOA 2WZHA 1X1NA 3ITOA 4JIIX 2JF6A 2NQJA 3LRLA 3VOCA 4WGXA 3B9NA 4GJJA 2CHOA 1HKMA 1A5NC 5FJRA 3H2EA 1TJ1A 3VOIA 4C6OA 1AW2A 5DBTA 3N17A 1RJQA 2JFEX 3QC3A 1C9WA 4WY0B 3E5PA 1SZNA 3HA1A 5KZMA 3FEMA 1E4LA 1TPUA 1JFHA 4DYEA 1GUVA 3WLHA 2Z29A 4O18A 1EKOA 1VCVA 1EC9A 3HQPA 5F2LA 2VFGA 9RUBA 1BTCA 1BD0A 3VM5A 1FOBA 4FZIA 5MKGA 2G3JA 1SSDA 3OVQA 2QHAA 1T41A 1T0OA 3G22A 4NJHA 1MQQA 1WKYA 1OK4A 1A5OC 2J7HA 1RR2A 3EOSA 4O54A 2Y24A 2BV9A 1SO5A 1OFPA 3HGSA 2BVWA 1LLOA 1JDCA 1Z7AA 4DXXA 2Y8VA 3MUXA 1F6PA 1Q7QA 3APYA 1SR9A 2HS6A 5JBDA 1WV2A 1WKDA 1TV8A 4OECA 2NXHA 3TFXA 1V02A 3N11A 4JPGA 4AZ5A 1R87A 1GPFA 4OGZA 2DVTA 3ZWTA 2EHHA 1RP8A 3NZ1A 2XWEA 1IWBA 4W87A 4LY4A 3URAA 4D72A 1MQRA 3GC5A 4E2VA 1S5WA 5CKSA 1K8CA 4E0CA 4JGDA 1H51A 4TOQA 3C2FA 1DWJM 4ZQMA 4I6VA 1JPHA 3P74A 1JDAA 2ZZ6A 4OOUA 1CECA 4PA8A 2B31A 3QN3A 1DJQA 1G5AA 3AMLA 4PB5A 3F4NA 4LXFA 2R94A 2V5DA 4EWJA 3H55A 1XFBA 3IV3A 1HL2A 3SO7A 3BAWA 3W1PA 3ZO9A 3GTFA 3WD2A 1MZHA 1ECEA 2PDQA 2A85A 3KEHA 4CUCA 4XD6A 3LXBA 3W37A 2J13A 4AYSA 3BGAA 3QQ1A 4IG2B 4JDBA 4I7WA 1UPMB 3GXNA 5JIPA 4BFAA 3D3AA 3SRDA 1QUMA 4PUKA 1UG6A 4RE3A 1WNOA 3EWBX 2OPJA 4C6JA 3UXDA 3TLQA 3G18A 4LF2A 1XLFA 3F4VA 3WLJA 1FKXA 1QDSA 2HPIA 2V5KA 3FOKA 2WCAA 1E0UA 1ZGDA 4KFPA 3D46A 3G8EA 3LHYA 2OYKA 3H26A 3S2CA 2PWVA 3VX0A 2XWDA 5CG0A 5I3FA 3MV11 2VYOA 4P8WA 1VLIA 2WMJA 5CJMA 3I3EA 3KRUA 1Q2SA 3ES8A 1BF6A 1Z9AA 3V5OA 1DJGA 1SO3A 1OFQA 1SYTA 3FNDA 1L6WA 2BSLA 2QW5A 2XM1A 3V36A 2EBNA 5FI8A 5I3GA 1C29A 1DBTA 1VCGA 4LF1A 4JQAA 3NM1A 1X97A 1YNPA 4I5RA 3FSUA 3UWUA 1KBKA 4UR9A 4N9BA 4RW5A 4JTCA 1UMLA 1TPFA 4Q6JA 2FJUB 1YYAA 2QCEA 1KM6A 1IQ8A 4Y8EA 5A6SA 4C65A 4C6MA 1LOLA 3GG1A 4BHYA 3N4AA 1WKEA 4MKNA 4RV8A 1SZEA 4JTSA 2Y63A 2QR6A 4LUYA 4RKAA 3W2KA 1OG0A 5KZEA 2JIWA 3FKRA 3ABXA 3G2GA 3DYMA 3RK8A 3NNTA 3JS3A 3WO8A 1VIZA 5A3HA 4NASA 1YEYA 5HWJA 4PR4A 4Y9MA 4MPQA 3B8DA 3CQIA 4RZ4A 3ABSA 3GAYA 3H2OA 1IZKA 1TO3A 1TWIA 4O8AA 4Y90A 2PC8A 3VC5A 3LS9A 5DF0A 4UIOA 4DJED 4S2BA 3RG6A 1NAL1 3WLLA 1Q6EA 2B4GA 4GYKA 3M41A 2OOFA 3NM3A 3NOYA 5HANA 2YCLB 1QK2A 2QJIA 4AIBA 2C18A 2PA6A 1TB3A 2CNCA 4OV9A 4O28A 3P0XA 1DE6A 1Q4NX 2HWGA 3NZQA 4Q6XA 2PDGA 3QGKC 1THFD 1JZ7A 3L4XA 3WBYA 1PYFA 1TMQA 3TMQA 4F0RA 3N34A 1S2TA 5ABEA 4XV0A 1MMFA 3MZNA 3NSMA 2BFGA 1ZENA 4DPPA 1V77A 3T0DA 4G1NA 2EGZA 2QVHA 1WP6A 1CB7B 1R3YA 5J5DA 2ACRA 3MKKA 4XZNX 1QHPA 2B0MA 4H4IA 1W56A 2WWDA 4OUIA 3NIYA 3TW6A 1KA9F 3R12A 3AHYA 4G9PA 2XFWA 4WXYA 3HG4A 1GOWA 3K13A 4MLJA 3SUSA 2XIBA 3FYOA 3PG9A 1E72M 1MO0A 3AALA 4AD3A 1AQFA 1E70M 4AWSA 3AIWA 4U2ZA 4PSRA 3CUFA 2WMGA 3KP1A 1JZ8A 4KRZA 1XCWA 2ZTJA 3MV01 2A3BA 2ZOXA 4TVCA 4FNSA 2QCCA 2ZDSA 3R94A 1EWDA 1XM3A 3CWHA 1XS2A 1D9EA 4QLLA 3S1VA 3GX9A 1G69A 1U22A 2A3CA 5L6UA 3UR8A 4IFRA 2VTFA 1I2QA 1U1HA 1FWAC 5CGQA 2H6RA 4IL0A 3LZ5A 4JIPA 3BG3A 4AX6A 3S1GA 1ZJIA 2PPGA 1Q2RA 2WQPA 5DMYA 3CZEA 3EPOA 3W7LA 3P84A 3FY1A 1OHLA 2ZZ7A 4L7ZA 2NWSA 3OB8A 4BS0A 4UTJA 3G1AA 4MFDA 4KF1A 3I65A 2NQZA 2CEQA 3E1F1 3NPVA 2ZUVA 1W2PA 5CBIA 3RU8X 1V4YA 3AUJA 4PCTA 3PS7A 4B16A 4PEKA 2ADAA 3A12A 4PGLA 3GQYA 4X9SA 1CIUA 3DHUA 2W91A 3PBGA 3SGGA 1V3JA 1WOAA 1V3IA 4HHHA 1E43A 4W84A 3M9YA 1KNWA 1MNSA 2REQA 2DW7A 3OVPA 1MDRA 5DCEA 5DT7A 3DOPA 2CERA 2CCRA 2RJGA 1OYBA 4JQ4A 4J35A 3KRZA 4JFWA 1OB0A 3QH2A 2KAUC 3LV5A 3E02A 5G2HA 5JMUA 3TJXA 3WQWA 3LCFA 4NNAA 1L6YA 4UB9A 3NEVA 3EX1A 3WEMA 3THCA 3TZNA 4P8UA 4I9TA 1BWVA 1F73A 3PULA 4FSAA 4D9PA 3P3BA 1GTHA 4K68A 3WK1A 3SM0A 3GR4A 1KGXA 4Z17A 1H49A 3VDBA 1DVJA 5C9XA 4RPPA 3W1NA 1MQPA 1X98A 5FAGA 3QHNA 3P7YA 4FXJA 4JTAA 4QIUA 4UUIA 5LHFA 1SMAA 1JRBA 1IE7C 4DF1A 4UFHA 3S9YA 1X8FA 2V63A 4ZFMA 4H01A 3KL3A 3WDPP 3A5VA 5DQPA 2V8ZA 4KEVA 4DZ5A 4BQ3A 1OFBA 1Y8BA 2VQTA 2YL9A 5I3HA 5DN1A 4B4HA 1TRDA 4DI8A 1C3FA 4JFVA 4K36A 2A1YA 2YR1A 3PK7A 4S1FA 4UTLA 5TIMA 1TJ2A 4WEVX 3L4WA 1JZ4A 3CK5A 4F0MA 3ABZA 3OO2A 5A6JA 3BMVA 1XIJA 4QEEA 3B97A 4E2BA 2J77A 1O94A 1K4GA 4ZE4A 3W28A 2OLAA 2NZLA 2C0HA 4AH7A 1VPYA 1E6PA 3G3MA 4L65A 5CBBA 4CGTA 2G3IA 3RPMA 4WDXA 3LCGA 4ZQOA 2ZA2A 1Z3NA 1A80A 4HU4A 2XN0A 1WE5A 1XBVA 2ZRUA 4H9ZA 4LYPA 5DY3A 3WH9A 1FH9A 4WY0A 1DKWA 3T44A 4YCOA 2FVMA 5HQEA 4RE0A 2ZVIA 2BB0A 3LI1A 2DT0A 1SW3A 3WEOA 4XIMA 2W6RA 1WO2A 3VDHA 3GHUA 2E25A 4JNYA 1XQLA 2BODX 3WQ4A 1HJWA 1R2RA 1OIFA 3UJRA 5HJLA 5CGTA 1XYBA 3I7RA 4Z2JA 3UWYA 2ZWYA 3E6EA 4NAEA 2XSAA 3REQB 1LG1A 3T0BA 3UA3A 2W3ZA 4WLCA 3ZR5A 2OX4A 1A4MA 1HO4A 3LXCA 1UWSA 2OYMA 1UUQA 3R5EA 2UY2A 4UOJA 1AH4A 3UA4A 3LGGA 1R3QA 5LYRA 3WQ6A 1BXNA 4RDWA 4H7VA 1QR7A 2VX5A 4DIAA 5A8MA 3W1UA 3ICJA 4DZHA 1YHTA 4GIRA 4TQTA 4HOZA 2C19A 4M7TA 4A8LA 3W83A 2P3ZA 2E6AA 3NQFA 4NJGA 4HK7A 2YFNA 3ZIZA 1LBLA 1FHDA 4MZ1A 4QRNA 3PPGA 2FGZA 1DIKA 1E0XA 1WX0A 2GGEA 1A3XA 2BVDA 5C7VA 2H3DA 1N2VA 5M1TA 1ITQA 3OP2A 1DV7A 2UWFA 3G6LA 3BTNA 4R9XA 3TN5A 4FLOA 4A3HA 2CXEA 2NX9A 1ONWA 3CJPA 1M6JA 4GOAA 4HCDA 4BI7A 2BDQA 3GXDA 3WQVA 2HXUA 1BRLB 4AEFA 4NT0A 1E6ZA 3FX4A 4AEEA 4AZ6A 3CNYA 4POCA 4YPJA 1XXXA 1Z42A 5MKGB 3NURA 3LQGA 5D2VA 5LNWA 4YL2A 1AH0A 3UG5A 1B54A 2P5NA 1OG6A 2Y2WA 3AUOA 2TMDA 1FHLA 5IDZA 1HP5A 3BV4A 2ZE3A 2YKKA 1EOMA 1JCMP 5H8PA 3NZRA 1D7FA 5D37A 1HVXA 2HVOA 2V5CA 4Z2GA 1PV8A 4PMVA 4HYWA 2R6OA 3H24A 3OLEA 3TEVA 3RLGA 3GIQA 4O16A 4B5TA 1JUKA 1WAWA 2BASA 1GYLA 4HMNA 3M46A 1E9IA 3PM6A 2VX6A 3NUKA 3VKJA 5CC3A 2FDSA 4CN4A 1P5BA 2QDGA 1IIHA 1E5NA 2NX3A 4B9YA 1US0A 5CSUA 3AHVA 4MY8A 3SR7A 3LHZA 1IR2A 3JRKA 2J62A 2D23A 4DO7A 4GFSA 1VJSA 2ZDRA 1ISXA 4AISA 1YIXA 5A94A 3QVQA 4MB4A 3SGUA 1KBIA 1DXFA 4ZO7A 1TPC1 5LA1A 2TODA 4DXKA 2DZBA 1UR0A 4AVOA 3F4CA 1YNQA 2OZ0A 1EGVA 2YIHA 2YYTA 5LXXA 3WMCA 4R34A 3CT7A 3EOUA 3QBUA 4LCRA 4IL2A 5BWFA 4JQ3A 1E6XM 2X0YA 1VEMA 1VFLA 1S1PA 2QMKA 1MNZA 3TZFA 3NZPA 2PDBA 3ZT5A 3GFYA 3PZUA 1SR0A 5HOSA 2C14A 1VFOA 2ZA1A 4YVVA 1O4UA 3WEZA 4CNPA 2VWTA 3NZGA 4A3YA 1S2CA 1S2WA 4HHLA 2YBTA 1XISA 3B9DA 1UC4A 4PL1A 1YTEA 5DCDA 4CQDA 3I4KA 3NQAA 1VYPX 3CUIA 3W2LA 4K37A 2ZCGA 4PRTA 4M29A 4YMZA 1JXKA 3WH7A 4AHQA 3K2GA 2WCSA 4DBWA 4JAWA 3CH0A 4QHRA 2Q02A 5CLWA 4HNCA 3DXIA 1TJ0A 2O0TA 4HMEA 1K7EA 1NM9A 5AHLA 4WCJA 4US6A 2OMAA 3WDJA 3W6LA 2FDMA 4N9CA 7ENLA 4LT9A 1EPVA 3K8LA 2J7CA 3AXXA 5EU9A 3IK4A 4X63A 1OFAA 3K30A 3SRHA 2RUSA 4HPXA 4AIOA 1AJZA 1BGAA 1WBHA 1JRCA 4PMXA 3SCUA 4WUIA 2EQDA 4DJDD 4J1OA 2J7DA 2X1RA 4JNZA 1TWWA 3U9IA 4MNJA 4ZEPA 1V8EA 3IAQA 2QDHA 3OZMA 3QHMA 2WMIB 4PMDA 3PZGA 1MEWA 4HYRA 4GUHA 2VGIA 1Q8AA 4AYGA 2Z1BA 5CZSA 4ROQA 1CPUA 3BLFA 4GI6A 1OGGA 1UWAA 5HR7A 4JTEA 1FDJA 1CYGA 3DBNA 1EP2A 5A6MA 2QPSA 3UPWA 2FZBA 5I77A 1K8YA 1NF0A 4ZZ9A 1GKRA 3VGGA 4PBFA 1RPKA 2CZDA 3ZQ9A 2QCNA 3GIYA 1CGTA 4A4AA 1W54A 4XSLA 5FAJA 4WJEA 2X40A 2P0OA 2P3EA 1VJZA 4CVWA 2VRJA 2HE5A 3IGSA 3OYXA 5IOBA 3M1ZA 1A0CA 4MKVA 1W3JA 1HN1A 4O19A 2I7GA 3AYRA 1NY1A 4AD5A 4EIVA 1W8SA 1S2VA 3GHSA 1TZZA 1OCQA 3TSDA 4N7QA 5AYZA 2C1HA 1DWGM 5CPLA 4DNMA 4NAEB 2HRWA 1N82A 2NX1A 4JHMA 2ABAA 4XD5A 3TIMA 4YYFA 4LUSA 5A2CA 3KOYA 3WLQA 4UZSA 5FF3A 2I5QA 4Y9AA 4QAIA 1TV5A 2Y70A 2FHCA 4A3QA 4XAZA 4H2HA 2VFDA 4L1XA 3M0YA 4HPHA 4LS1A 1T8QA 4K3ZA 4H9UA 2CLOA 5XIAA 1I2NA 4QSFA 1MXSA 1PX4A 3HIJA 1KQYA 1A5LC 2XIJA 3IEBA 3DI1A 4E38A 1NDVA 3CHFA 3RJXA 3TWAA 1M7XA 3UCDA 6PTDA 3OVGA 4GGHA 3VIKA 4DXVA 3T0TA 1X39A 3HOJA 2Z7KA 1PB0A 4EX4A 5FESA 4P7NA 3Q58A 4LY8A 1NWRA 4J3WA 4FNQA 3WQDA 3C2OA 1TPH1 3VNDA 2O4QA 5GJMA 4QS5A 4GIAA 3P93A 3AMDA 4HVXA 4B91A 1DIOA 2R8WA 3NGFA 1H5YA 3CHCA 1WZLA 3CAVA 5BRBA 1FUYA 2Q8LA 5EMKA 3BANA 5CG7A 3AIUA 3KVLA 4GVFA 5I03A 2ZX8A 3M5YA 3T4WA 3LRMA 2HQAA 3GXIA 4ES4A 4LBUA 1H62A 4GQQA 3W26A 3U3HA 4UQBA 1QOPA 4DI9A 2X0HA 3B06A 2HMCA 3N73A 4A8RA 1LL4A 3C2EA 1FDZA 3W7OA 3BAJA 3HURA 4O0KA 3A4XA 1FCBA 1ADOA 4UXDA 4QG8A 1QPKA 1YQ2A 4ICNA 1SMDA 1VAHA 2C79A 1P7TB 2YPIA 4H8NA 3ZJ7A 3BW4A 5C9WA 2V3DA 2I5GA 1T96A 3NQMA 5DMMA 3GZ3A 4GYFA 4WDUA 3PZOA 1VH7A 2V5LA 2BGNE 1ONRA 3IUIA 3GC2A 2QV5A 1W17A 6A3HA 2VCCA 2X41A 2R14A 4XBJA 4AFYA 3AHTA 3N12A 2DP3A 4IX2A 2XVPA 2Z1WA 2VC5A 4I8YA 4MJMA 4LC8A 5A1AA 2RGMA 1GVIA 4DLMA 1JR1A 3N1AA 1XLKA 1RJRA 4YWSA 3FN9A 3E96A 4QCFA 4IIGA 5F4WA 1O5KA 1J18A 1RH9A 3O6YX 7REQA 4MZYA 1HJVA 4ZO8A 1IEWA 1J0KA 4GZIA 1VLWA 3PZ9A 3UY7A 4RCXA 1MXGA 4E8CA 3TW9A 4DUOA 1V6WA 1H50A 2W67A 2Z28A 4GZ7A 3EGJA 4LEQA 2X2GA 4H00A 3AZSA 2WJFA 3BVJA 1OF8A 2RDWA 5D30A 3O8AA 2EJAA 1EDQA 1G67A 1Z41A 3CEUA 5BXRA 3BO9A 3VIJA 1H7OA 3RRXA 8TIMA 4IJBA 4JTQA 1DXEA 1XLHA 3TV8A 1A5AA 2TYSA 4O12A 4RXGA 2ZRWA 4QG9A 5CSSA 4ZXOA 3L2MA 3L0KA 2C0AA 4BEUA 5ENLA 2R24A 4IMAA 3KBNA 3UPMA 5DCBA 1LLWA 4XO6A 3BLIA 3UP8A 5A8OA 3GG7A 4JIEA 2OLSA 2X1SA 2D3NA 2WHKA 3T2OA 3NQ2A 4KGJA 2B7NA 3QMSA 4FOKA 1P0BA 4B15A 1NFBA 2PZNA 3MP3A 4MWAE 4GABA 3TA6A 4W8LA 2YX0A 1JCXA 5LNSA 4CNUA 5JBFA 2YL6A 2D1ZA 4YTSA 4NJIA 4HPGA 3FEQA 3MKCA 4CQ9A 1HJUA 4YHEA 2VUNA 1LRQA 4PFHA 1UD2A 4U5KA 5CLTA 4LPCA 3STEA 4ZBCA 1FQ0A 4IPPA 3KRSA 4MB1A 2ATMA 1XRSA 2G5WA 3TC7A 3PSVA 3QV6A 3S47A 4NF7A 1QI2A 3CLWA 1UIOA 1QPOA 1JULA 1W1A1 4AMAA 1B31A 4GUFA 1O5QA 2XIQA 1KD0A 3OGVA 1J0ZA 1LZOA 1W5NA 4V2XA 5D2YA 4YXGA 4JNMA 3Q65A 5JH2A 3ARWA 4U33A 4H41A 3BZJA 3GB6A 3GKFA 1E1CB 3ZSTA 2C1GA 1E55A 1ZQ5A 1GVQA 1PAMA 3T7VA 3T55A 4LWWA 2VZUA 3EA2A 3S9IA 3UXLA 3TJLA 4L6DA 3SJ3A 3NFUA 1RBLA 2G4FA 1REQA 3BCFA 3VVGA 3AS1A 1CBGA