2WAGA

The structure of a family 25 glycosyl hydrolase from bacillus anthracis.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
217
Chain Sequence
b'GSSHHHHHHMDRYEIKGVDVASYQGDIDWRELEKQNMKFAFIKATEGSAFVDKYFSKNWTNANKTSMRVGAYHFFSFDSKGETQAEQFIRNVPKYKQALPPVIDVEFYANKKDNPPKREDVTKELSVMIEMLEKHYGKKVILYATQEAYDLYIKDAYPQCDIWIRSVLTKPSLSDERKWTFWQYTNRGKLSGYNGKEKYIDLNVFYGNEEEFENYGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSOZYME, PUTATIVE
publication title The Crystal Structure of a Family Gh25 Lysozyme from Bacillus Anthracis Implies a Neighboring-Group Catalytic Mechanism with Retention of Anomeric Configuration
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 77
structure length 217
sequence length 217
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wagA00
1JFXA 1BHGA 1W1PA 2WBKA 3NDZA 1WZLA 2D0FA 4HZ6A 5I5RA 3GXIA 2E8YA 1CLVA 2ZUVA 1DWJM 4WLCA 5ABHA 4OIFA 4GZJA 5HNNA 1VAHA 1ITXA 1W1TA 4GI8A 4PCSA 2XGIA 1HVQA 2WAGA 4AEFA 1TUXA 1EO5A 3II1A 4CKQA 1UD8A 4WSJA 1HNYA 5HOSA 4P8XA 4N0RA 5A69A 4HMDA 3WH5A 5M17A 3OGSA 1FFQA 3EDDA 2PB1A 2JEQA 2XVKA 4P7NA 3VNYA 2W92A 1JG9A 1UWSA 3SUVA 4JHZA 5DO8A 3CHEA 1UKPA 3WF1A 3W81A 5HPCA 3VD3A 2QPSA 1UKSA 3WUBA 3PTKA 1IT0A 3U57A 4TVDA 1MYRA 1V3IA 5E6YA 2YBUA 3U7VA 3KE0A 1G5AA 1JZ2A 4PYSA 2XSBA 2X8RA 2JF6A 3B9AA 3M46A 3AFBA 1WB0A 2YLLA 1E3ZA 2WHLA 3AHXA 2CBIA 4LYQA 3G6MA 1CYGA 3M7SA 2WVVA 2Z1SA 2XVNA 1MQQA 5AY7A 3KL3A 4W85A 3NYDA 4MTVA 3CMJA 1ZU8A 1GOIA 1M03A 1XD0A 2YIHA 5EBAA 4OBRA 2G3MA 1TR1A 2ZOXA 2ZXBA 4HA4A 4PMYA 4OZOA 3O9NA 2ZX9A 4CD5A 5A8QA 5I77A 4P8WA 3SCOA 3GBDA 3HU7A 1LG1A 1XH1A 1BLIA 4M29A 1XYFA 1UOKA 5CZKA 2VX4A 4PMOA 4PMZA 1MW3A 3T09A 1VFMA 3NCOA 3MS8A 4J3XA 3VTRA 2CERA 2ZXAA 1E73M 1Q4NX 5D9OA 4MAVA 3VU2A 1KWKA 1QHOA 2WMGA 2DH2A 3ZMRA 1E5NA 4HZ8A 1E9LA 1W9VA 1BF2A 3FAXA 1R87A 1XCXA 5LA1A 1I75A 2GFTA 3ALGA 2Z1KA 3RM8A 1ISYA 4MJ2A 1TCMA 2O9OA 1LF1A 3AMLA 3K1DA 4OJYA 3O2LA 4JL1A 3VGFA 3BMVA 3GDBA 5FKYA 4U33A 1ZS2A 2WMIA 1W2PA 1RPKA 2C8NA 1E43A 1C7TA 3N15A 1NOUA 1F4AA 2W67A 1P6WA 3SCPA 4V28A 3NUKA 4B3LA 5C70A 3HJEA 2ZX5A 3CIVA 1FA2A 4MB3A 1BG4A 3WFZA 2J7BA 2F8QA 4GI6A 5HDRA 3B9DA 2EPNA 1ZL1A 2DT3A 2XM2A 3PZOA 1UD2A 3WBAA 1E6QM 2XFFA 2WBGA 2VNCA 3NSNA 1PX8A 4W86A 3AMDA 2FH6A 3WH6A 2XWEA 4UFIA 1QNPA 4OKDA 1E0VA 3IAPA 3AYSA 1VB9A 4W5UA 4CN1A 4TVUA 3OG2A 3K8MA 4CGTA 4OBSA 3VMPA 1UD5A 5CGMA 4HMCA 2WLZA 3CUJA 4MNJA 2D23A 2FHFA 3ZOAA 3CUFA 3EDFA 3QHNA 3GXDA 4ATDA 1XYZA 4X9YA 1M01A 4MB5A 5I79A 2J7DA 1Q6EA 4H8VA 3ZJ7A 1RP9A 1XH0A 3WN6A 3KEHA 3ARQA 4AD0A 1JF6A 3OIHA 1V6XA 3VGHA 1BSIA 5IHSA 3BLPX 4AD5A 1WNOA 3VIOA 5DEZA 1X6LA 1HN1A 2J7CA 3CHFA 1JI1A 3MO4A 5I0DA 4JCLA 3OZOA 3WQWA 2WNWA 5M03A 3ZQ9A 4JFVA 4D6FA 3AQUA 2YA1A 1O6IA 1HF6A 1GPFA 4S3JA 4CCEA 4DWSA 1H5VA 3WF3A 3BC9A 4UR9A 1JZ7A 2XM1A 1JZ8A 4GIAA 3TA9A 2IXVA 1GORA 4W7WA 2JE8A 1GVYA 4Z2LA 3VDAA 4AMCA 4J3TA 3ZO9A 4EKJA 4BQ4A 4XB3A 1MFVA 3L2MA 3PZ9A 3ZJKA 3RM9A 1JZ3A 1ISXA 1XRVA 2VQTA 4JKKA 1XGZA 1OGSA 3BH4A 3WKZA 4W5ZA 2X0HA 3SCNA 3DYMA 4PMRA 1OT1A 2WVSA 2J74A 4C7FA 3AROA 5FIPA 1V3LA 3RDKA 2G41A 4A3YA 2G4FA 3BMWA 3WD0A 1MWOA 2XVLA 1HXJA 4R27A 1V0MA 3PZIA 2V3GA 1YHTA 1WO2A 1HP5A 1R7AA 2ZXQA 3N13A 4WKAA 3CUGA 1JYXA 2OSXA 4P8UA 1CGTA 3WH9A 2BY2A 2G3JA 1HKJA 1JDCA 3CZLA 4P7OA 4CN4A 3DHPA 2WXDM 3BAXA 3J7HA 1PBGA 3TP4A 1XC6A 4JCMA 4LXFA 3VGEA 4AZGA 1HT6A 2VCCA 1DWIM 2ZX7A 3L4WA 3WNLA 4KRUA 1LG2A 1HP4A 2Y4SA 4B9ZA 3THDA 2CKRA 1HIZA 6CGTA 1WDQA 3L4UA 1E56A 4FLSA 1UR9A 2D0GA 1VIWA 5CSYA 5GPRA 3W53A 3WD1A 2RGMA 3PZVA 2GSJA 2DEPA 4TVCA 4D6HA 3G6LA 2WMKA 1QI0A 1C90A 3JUGA 4J7RA 1C8XA 1CXLA 4H41A 5A95A 2CKSA 1E4NA 4M24A 1E4IA 2YDSA 3AYRA 4PSRA 2ZICA 2CNCA 3EMZA 1GOMA 4UQBA 4XX6A 5D9MA 1UH3A 5D9PA 1UG6A 2UY3A 4UFHA 2BS9A 1PEZA 3W6MA 3WDHA 1JYNA 1J0IA 1ITCA 1VEMA 1G94A 2WMHA 3PZMA 3W27A 4XUYA 2W63A 4E8CA 3CZGA 4CU8A 3UR7A 3T0AA 2WCAA 3N11A 1EDGA 5D9NA 4GO9A 3UG3A 2VMFA 2BFGA 2FHBA 3VMNA 4D6DA 2WC7A 2XVGA 2D22A 3APGA 4PMUA 5AYIA 3ZT5A 3SUUA 1OD8A 4KRTA 5DT5A 4EANA 1UA3A 4CUCA 2B31A 2ZX6A 1UD3A 4BQ5A 3AMKA 1BFNA 5BXPA 3RIKA 3GZAA 5CG0A 3AS3A 5EB8A 5GNZA 3IJ9A 4UZSA 3AOFA 3F5JA 4NI3A 2AAAA 2NT0A 1MQRA 1EDQA 4DM1A 1W9BM 2BVYA 1JAKA 2DIJA 4H8HA 5I23A 2WHKA 4ATWA 3ZSSA 4UTFA 1UD6A 5BROA 1LL7A 2VJXA 2J79A 2XYLA 3ZIZA 2WZHA 1C92A 1W1YA 4FK9A 5A6MA 1CECA 1UR8A 5GNXA 2XJ7A 2EJ1A 4QFUA 2WVVB 4AD4A 1CXEA 4J3VA 1TG7A 5IFPA 3N04A 1B3YA 5A3HA 2BY3A 2G3NA 4Q7NA 2YDRA 1WDRA 3VDCA 1GQIA 1J9YA 1NOWA 3WH7A 3L2LA 4PMXA 2O9PA 1UHVA 1GOKA 2CXGA 4HU8A 3ARUA 3W25A 1PZ3A 1VFUA 4GQRA 3SEPA 1OWQA 1E6NA 4CVWA 1KWGA 4QCFA 2D2OA 1HJVA 1V6UA 3WD4A 4MADA 3PZNA 5E0FA 3ZT6A 5BRQA 4QLLA 1HKKA 2XGBA 3I3DA 2VUYA 2ZWYA 2VO5A 3W24A 4DM2A 3VD9A 4ZE5A 2VR5A 2X1IA 5AC5A 1H2JA 4JAWA 1KXHA 5AYBA 1GHRA 4LPCA 5DMYA 2ESCA 5BXRA 3VM7A 1VEOA 2J7GA 3TTSA 5BRPA 3K8KA 2XVPA 3S2CA 1W3JA 3AZRA 1XSJA 2VX5A 3GNOA 3W26A 5ECUA 3WQ4A 4GI9A 3DYOA 8A3HA 3NSXA 4CD8A 1GONA 4YHEA 4PCTA 3WDRA 1GOQA 3WQ6A 1WDSA 4AZBA 1SYTA 2WCSA 1A47A 3W6LA 3UERA 4HPHA 3BLKA 2JIWA 5EMYA 3UCQA 1I1WA 3FAWA 3BAJA 3HN3A 2EPMX 2WMIB 2E4TA 2GDVA 5E0CA 5A8MA 3CZJA 4C7DA 3RJXA 2EQDA 5A6BA 2ZXDA 4H04A 2X05A 1E6SM 1NWSA 1BQCA 4AZIA 1V0KA 3WDPP 3MKKA 1EOMA 2OWXA 5A6JA 4PRWA 2GK1A 1EDTA 9CGTA 1LWHA 4F8XA 1JL8A 2WC4A 1E6PA 1OCQA 1GJUA 1H49A 3MUZ1 2WLYA 4ZXLA 4R5EA 3VNZA 1K6AA 1KGUA 2YL6A 2GVYA 1J12A 2PC8A 4UOJA 5A6LA 2W66A 4FLOA 5F7UA 3L4YA 1WZMA 3E1F1 4W8BA 3RMEA 4B16A 2V5CA 3VIKA 3PTMA 4AC1X 2VRKA 3N1AA 3ZR6A 4J28A 4TX6A 3VIJA 3AXXA 2V3EA 3BAWA 2QMJA 4BA0A 2ZWZA 1F4HA 1W2VA 4FLQA 3POHA 1J01A 4TTGA 4BQ2A 1QBBA 1KQZA 1Y7VA 1OSEA 4Z2IA 4W89A 4P8VA 4TTUA 3FHAA 3HMCA 4UQCA 1B9ZA 2EEXA 1ESWA 2FGLA 4IUGA 3W4RA 2JALA 4A3HA 4JFWA 4S3KA 5ABGA 1DWAM 4JFUA 1H0IA 2ZUMA 2CHNA 3N9KA 1UQZA 3ECQA 1C3FA 4J3UA 1NWUA 1XSIA 3WF4A 2CHOA 1CGUA 4E2OA 1TVPA 2DT2A 4F66A 4DWSB 1JZ5A 4ATLA 3VMOA 4X0NA 1GOWA 1E4MM 3UESA 1CGYA 3WBEA 1H3GA 4H7VA 1EIBA 1QI4A 4FLRA 3GM8A 1N82A 2HISA 3ARSA 1JAEA 5I24A 4F9JA 2NT1A 4U5IA 5CSUA 4W7UA 5DF0A 2J4GA 5FL0A 2PWHA 3LPGA 3MUY1 2W91A 3WF2A 5I2UA 1W9PA 1E70M 2CITA 1WE5A 2W4XA 3MU7A 1HJSA 4UZUA 1W9UA 1W9DM 2FH8A 3EYPA 4M82A 4H2CA 4GO8A 4H8UA 4WF7A 2CBJA 1ECEA 1CENA 4PMDA 1K9EA 4PBGA 3K4DA 1B3ZA 1WDPA 4HA1A 2VVSA 3MV01 3VILA 4UQEA 1V03A 2WKGA 1DTUA 2CEQA 1ZBKA 5A94A 3NIYA 1BVZA 1NWRA 4LQ1A 2VURA 3CHCA 3SCTA 4D6JA 1SFSA 2DT1A 3GH7A 1PZ2A 1KXTA 4UQAA 1VJSA 2OYLA 2WZIA 1L8NA 1E40A 1AMYA 3MMUA 3AICA 3KWXA 1BPLB 1E72M 2OYKA 4CD6A 1JDAA 4U3CA 4MPKA 1FFRA 1QW8A 1VEPA 2WCGA 2X09A 2XIBA 3ZT7A 4D6GA 1Q6DA 1GOOA 2WB5A 3OLGA 2F2HA 3ARRA 4CCCA 3SCUA 1NM9A 1O7AA 2PWDA 1FHLA 2F61A 2GJXA 3W38A 1B2YA 1BG9A 2YA2A 3WNNA 3BAIA 1HL8A 3WDJA 2XFRA 1E4LA 3EMQA 4GQQA 4DUXA 1BVNP 2VR4A 2V38A 4CD7A 3PN8A 2E9LA 3VX0A 1V6VA 4U5KA 2DIEA 4RE3A 2VX6A 1Q6GA 2IXUA 3FY1A 4YHGA 3OGRA 3WQ5A 2GDUA 2ZUWA 2OWWA 2A3EA 1M04A 1E3XA 4D6CA 1UWQA 1W3KA 1JF5A 3CUIA 3AIUA 2DPEA 2FHCA 4PTXA 2A3CA 1GCYA 2ZIDA 4PMNA 4XV0A 4D6IA 1CGWA 3M07A 4E8DA 4NRSA 5GQBA 3CBWA 4MNLA 5JUVA 3W37A 4AY1A 2J25A 1QPKA 4UQDA 5ABFA 2X2YA 4BS0A 4NRRA 1M7XA 3VOCA 2E8ZA 1OT2A 3CHDA 4YN5A 4M8UA 1OIFA 4DWSD 4JFTA 1B0IA 5I6SA 4HMEA 1UKTA 3AMCA 4A4AA 3AIBA 1GNXA 3SCVA 3QR3A 3RM4A 2BNJA 2E9MA 1V3HA 3BXWA 1E6XM 4Z2HA 2YOCA 1E5JA 4AYSA 5IXEA 3A3HA 1JD7A 3MUIA 4X0VA 4JZ5A 5DFAA 1A3HA 1CXFA 3K8LA 2AMGA 5LA0A 2J7EA 2PF0A 3EBVA 1NP0A 4WSKA 1V3MA 1TFVA 2QV4A 4BCEA 4URIA 4QP0A 3F4VA 2UY5A 5BXTA 1EGZA 4MNKA 4PMQA 3PZTA 2D3NA 4WIWA 2J7FA 4J3WA 4QCEA 4B9YA 2VQUA 3VUPA 2VI0A 1NH6A 2OLHA 3UR8A 4AZCB 5IDIA 4BZYA 3AZSA 5BYWA 3TTOA 1XD1A 3WY1A 4Q22A 5CJ5A 5D4YA 4AEEA 2E0PA 2X0YA 1V02E 3SUTA 4TOQA 1H4PA 1K9TA 2WM0A 6TAAA 2VZSA 1QHZA 3U5UA 4DWSC 2J8FA 1J0HA 4ZE4A 2UY2A 4Z2GA 2DSWA 2CBVA 1EA9C 4HPGA 2EPLX 1HJWA 1US2A 1QI3A 1E0WA 3CO4A 4TUFA 1J0KA 3AXIA 1UWUA 1EOKA 4JKLA 1ZBCA 1GHSA 3W82A 1W91A 3WSUA 1E6RA 1NARA 4ZXOA 1CGXA 2DH3A 3IAQA 5JIPA 1UR0A 2WMFA 1FHDA 2Y8VA 4AZ7A 3AS2A 1JD9A 4B3KA 1C8QA 1GZJA 3UETA 4HTYA 1CLXA 2WW5A 4QAWA 2EO7A 1CEOA 4C7GA 4J27A 3TONA 4MDPA 1JDDA 2WZEA 2VOTA 1WCGA 3WUFA 4GZEA 3VD7A 4D1IA 1QBAA 3QHOA 4M81A 2VC9A 4QLJA 2J8GA 4U31A 2JEPA 3VO0A 1DWGM 3OGVA 3VIPA 3ARXA 3IK2A 1HL9A 2GK1B 3AHZA 1ZBVA 4AIUA 3EMCA 3QHMA 4UQ9A 3MMDA 3BSGA 3RJYA 1MFUA 1HJXA 3EDEA 2EBNA 4EE9A 1BAGA 2PWEA 2XPKA 3KZSA 4QLKA 2EPOA 4XZWA 1V0LA 5DT7A 3WH8A 2CESA 1X1NA 3GNRA 3NSMA 4Z2JA 1CNVA 2W61A 3S6TA 3WMBA 1EXPA 3W28A 3FHQA 1KGWA 2J77A 4PTWA 2PI6A 4LYRA 3WD2A 2Y24A 3VGDA 3AISA 3L4XA 4WK9A 2DSVA 1KXQA 4AZHA 1US3A 3PZUA 3VGBA 2J47A 4GXPA 1VBRA 2WYSA 1HVXA 1VF8A 1ODUA 3OA5A 3TTYA 1FP9A 3CUHA 2JF7A 3EDKA 1B30A 4OOZA 4D6EA 2J78A 2CBUA 1QNSA 5JBDA 4IPNB 1JFHA 5A8NA 3ARVA 1L0PA 1B1YA 3PHAA 3L4ZA 3GXMA 2QHAA 3WEMA 1M53A 4QDMA 1U2YA 3NJ3A 4W7VA 1IZKA 3O6AA 4W87A 3ARWA 4FMVA 2VL4A 1HKIA 1MQPA 3D5HA 4ZFMA 1IV8A 1EHAA 3RCNA 3PZQA 2ZUTA 2DDXA 1WPCA 2NSXA 5A2BA 1QOXA 4AZCA 1FH9A 5FD0A 3BSHA 4HZ7A 1PAMA 5M3WA 2OSWA 2A3HA 1MXDA 3DECA 1G1YA 4J3SA 4AD2A 3GNPA 3WNKA 3MMWA 4GPNA 4UOQA 1C8YA 2WC3A 1ODZA 5CGTA 1XH2A 1PIGA 2GUYA 1TVNA 1EQPA 1H41A 3WDQA 1UQYA 3FNDA 1DEDA 1UR2A 2V3DA 1J0ZA 1GQLA 2G3IA 4TX8A 1B3VA 4CU7A 3FN9A 3WUEA 7TAAA 3AIVA 4P7LA 1J10A 1AVAA 1R86A 1K9FA 1BYCA 3SUWA 1B90A 3AIWA 1JXJA 3AXHA 2EPKX 3I3BA 2Y8KA 3VDHA 5LYRA 1KQYA 1ZB5A 4EAMA 1V08A 3ALFA 1J0JA 1CXIA 5A6BD 1CZ1A 5AC4A 3CH9A 4GINA 4ACZA 4KGJA 2RGLA 1R8LA 5JIWA 3THCA 1KGXA 5E9AA 2WMJA 3B8SA 3DHUA 2MANA 4M56A 5KZ6A 3RO8A 5D8WA 3VKKA 4OOUA 2BHZA 4DUWA 2WSKA 2CYGA 1CXKA 3PZGA 1XV8A 2GJXB 3QOKA 1CBGA 2YL9A 4U2YA 3RPMA 3N17A 4ML4A 1UYQA 2D20A 5IFTA 1DWFM 2O92A 1RP8A 4UFJA 2BVTA 2CPUA 2DSZA 3GH4A 1JYWA 1LWJA 5BCAA 3WDIA 1NWTA 3WL1A 3ARPA 5I78A 3K46A 1WKYA 1UZ4A 1JIBA 3ZR5A 2PBGA 5LA2A 5CPQA 4AIOA 2VZVA 1MW0A 5CPTA 4KGLA 1NOFA 4AZ5A 3T0DA 3EDJA 2YJQA 3ZJ8A 1VENA 3VD5A 2WVTA 1MVYA 3KL0A 1DP0A 3MSDA 1GVIA 3ARYA 1G01A 2AOSA 3IJ8A 4RE2A 5A2AA 5ABFB 4NZCA 4MAZA 3AI0A 1OINA 1ZJBA 4E4PA 2Y5EA 1JNDA 1G0CA 3UG5A 4ACYA 4D72A 4AWEA 1E15A 1W9XA 2XUCA 1RD6A 1R7OA 3VIHA 3AIRA 4PTMA 3SUSA 3WL0A 3T2QA 1H0GA 1WAWA 3BAYA 2O9TA 2ZUNA 3VIFA 1E6ZA 3AS0A 2YL5A 5A6KA 1HJUA 4ZEPA 1G9HA 2CCRA 2BHUA 1FOBA 1YQ2A 6A3HA 3ARZA 1UWIA 1CXHA 1GW1A 2VRQA 1BGAA 1BYBA 4PUEA 3F5LA 2WKLA 8CGTA 4AW7A 3N12A 3WMSA 3CGTA 4UOZA 2O9RA 3WQ8A 5BWFA 2J75A 5E6ZA 2VT0A 3VVGA 3ZSTA 1UKQA 5KEZA 1WZAA 4WKHA 1SR0A 2HVMA 1TA3A 4UNIA 2VZTA 3LPFA 4FF5A 2ZE0A 2GJRA 1UH4A 4MB1A 3ARTA 3CPUA 3BAKA 3VIIA 3VINA 4AD1A 4KMQA 4F79A 1PX4A 4RL3A 3L4TA 1PPIA 3CTTA 2YL8A 2VZOA 2CIPA 2JIEA 2YDQA 4LX4A 4W93A 1LQ0A 3OBAA 3QGVA 5JBEA 1JGIA 2DSKA 3N18A 3PTQA 4MB4A 1EO7A 4W8LA 3LMYA 1WZKA 2D1ZA 3A47A 1W32A 1UD4A 5EFDA 4RE4A 3F5KA 3B9EA 4L4PA 1LL4A 5JBFA 4CCDA 1TE1A 3GXFA 3WQVA 1CGVA 4DUVA 5C71A 1CPUA 5CLTA 3VIMA 1FP8A 1BGGA 2OYMA 2JFEX 1SMDA 1UZ1A 2TAAA 2XG9A 1U33A 1UR4A 3CZEA 3IJ7A 1Q6CA 1ZJAA 1QI2A 2WHMA 2Q8XA 4JHOA 2D0HA 2DT0A 5CQ1A 1J0YA 2YKKA 2QPUA 3GYCA 2EXOA 4V27A 3AIEA 3CLWA 5E09A 1UWTA 1H11A 3VGGA 2VCBA 4GKLA 2WWDA 3IANA 1OB0A 2ZX8A 3BCDA 3SIMA 2FGZA 4GZIA 5M5DA 3D3AA 2E40A 3SURA 1V6WA 4UFKA 1VJZA 3TTQA 1OIMA 4CN6A 3CZKA 3WFLA 1W3HA 5A2CA 1E71M 5FL1A 1E1FA 4U3AA 2DQXA 5HBFA 1KR1A 3ZM8A 4CVUA 1OGBA 3MV11 4IPLA 1GUVA 1V3KA 2QLYA 3W29A 5A8PA 1GJWA 3AJ7A 3DC0A 4M1RA 1XSKA 3WF0A 1KB3A 2D24A 2XFYA 1IZJA 1UR1A 1D7FA 2OWCA 4PSPA 2DSUA 3L4VA 5BXSA 1AQ0A 3GH5A 2Y2WA 4Y7EA 1Z32X 3ZJ6A 1QVBA 4YPJA 4L4OA 4MDOA 4KWUA 4HA3A 1VFOA 5TD4A 2V3FA 1KFWA 1C91A 2C7FA 1DHKA 1I1XA 2A3AA 4PEEA 5HXMA 1UWRA 1NP2A 3WIJA 1XHGA 4N42A 2VRJA 3U7BA 3K4AA 4HOWA 2IUZA 1OGGA 1R85A 5CPSA 1WP6A 1GQJA 5GNYA 5A1AA 1NQ6A 1HJQA 4WKFA 4UCFA 4PMVA 5I3DA 2NW0A 4XZBA 1LL6A 1PJ9A 3MSGA 1V0NA 2J62A 3I3EA 1KCKA 2WSPA 3OZPA 3MUAA 1K9DA 1B3XA 1BYDA 5C8BB 3WD3A 2GJPA 2BY1A 2VVNA 4NF7A 3GTNA 3W0KA 4AIEA 1H09A 2VX7A 3GBEA 3SCQA 2PWFA 2V5DA 1PX3A 2YBTA 1JYVA 2W5FA 2WHJA 3AZTA 3BCFA 4AXNA 1JZ6A 1V3JA 1HX0A 3VM5A 2UWFA 3MANA 4B15A 3UG4A 4HU0A 2PWGA 4D71A 2W62A 1HKMA 5CLWA 2PBOA 1KXVA 1V02A 2QF8A 3RILA 3T08A 5A6SA 3SCRA 3A4AA 1TMQA 5E70A 1VRXA 2VCAA 3CZ8A 2XHYA 3WNPA 1QNRA 1C93A 4CU6A 3AHVA 2UY4A 4NSBA 4ACZB 1CTNA 1PIFA 4MNMA 3VX1A 1OD0A 1BYAA 1ISVA 2BHYA 4KH2A 1JXKA 2E9BA 3WNOA 1W3LA 4P7RA 7A3HA 1KBBA 1EH9A 3AIQA 2G8ZA 1S46A 4AZ6A 1Q6FA 4HOXA 4W84A 3WEOA 3BGAA 4UFLA 3SCSA 2FDMA 2BVDA 4MJ4A 1X6NA 4PTVA 4UFMA 4BF7A 4IISA 4P7QA 1QI5A 4BQ3A 1JZ4A 1RH9A 3AHYA 2XTKA 4PUDA 4LGXA 5ABEA 2YA0A 1TZ7A 1LJYA 3TOPA 3VDBA 1MW2A 3WNMA 1EQCA 1UUQA 3QOMA 1QHPA 1QNOA 2ZUUA 1FH7A 2VTFA 1MW1A 2BXYA 1H1NA 1KR0A 3OLDA 1KCLA 1AQMA 1QW9A 3WMCA 2QMKA 3T2OA 2J7HA 1ZBWA 4OUEA 4HOZA 3LPPA 2BY0A 1OM0A 4AD3A 4Z2KA 1QNQA 1EHNA 2XSAA 1E55A 2ZUSA 1FH8A 1E0XA 5HPOA 3A4XA 3OLEA 4IM4A 1CDGA 3A4WA 3AHTA 4W8AA 3UEQA 4LYPA 1JNEA 2WPGA 1C7SA 1CWYA 4JL2A 3WEZA 2WWCA 1MXGA 4ZENA 3VD4A 2OSYA 3FXYA 3FW6A 5EFFA 1VFFA 3A6OA 1GQKA 1LLOA 4U2ZA 3LPOA 4F9DA 5A8OA 3M6DA 4W88A 3VPLA 1UA7A 1ISWA 1AQHA 2YLAA 2E3ZA 3SCWA 5CXPA 4V2XA 3VIGA 1W1VA 3WENA 5D8ZA 4EK7A 4TXEA 4PN2A 1V6YA 1U30A 4JKMA 4M80A 4WJXA 1KBKA 5A6AA 2BXZA 4CD4A 5FCZA 2DGAA 1TA3B 1VBUA 3OLIA 3AMGA 2XWDA 1J18A 2VZUA 4AISA 1JI2A 4JFSA 3PBGA 3U5YA 2WVUA 1SMAA 4JIEA 1D2KA 3AS1A 2XIIA 3CMGA 4HP5A 5IHRA 2CETA 1UH2A 1D3CA 3T2PA 1J11A 1UKOA 2BV9A 3WELA 3WUGA 1BTCA 5FOOA 1OBAA 1ISZA 1CIUA 2WANA 2D3LA 1E1EA 4K68A 3KL5A 3OB8A 2A3BA 4D1JA 3POCA 3T0BA 1B3WA 7CGTA 3NDYA 1DWHM 2C0HA 1XCWA 3DYPA 2WK2A 1B31A
chains in the Genus database with same CATH superfamily
2WBKA 3NDZA 2C16A 3GR7A 3ES7A 2E8YA 1SR9A 4Q4MA 3MZNA 3MI3A 2B7NA 4MSSA 2XINA 3F4WA 4OIFA 3OO2A 5HNNA 2FIQA 4R88A 1RY8A 4PE8A 5JMUA 2E6DA 4PCSA 4DZAA 3O6DA 4AEFA 3II1A 4CKQA 1HNYA 2CLFA 1XCFA 4N0RA 5A69A 1FFQA 2PDQA 2JEQA 1QJWA 1UUOA 4H7CA 3SUVA 1Q63A 2G97A 1OFBA 5HPCA 1X1ZA 1TV8A 4GX9A 1QPOA 1UKSA 1MYRA 4I3GA 5E6YA 3VNMA 3KE0A 1G5AA 3LGDA 3IWPA 3SAZA 1JQVA 1JPIA 1W0MA 2XSBA 3O07A 4C5ZA 4OWGA 3TC3A 2PAJA 2WHLA 2C18A 3S2MA 3IVTA 2Z1SA 1MQQA 2W9MA 1ZAJA 3VA8A 2X30A 1TPWA 4UMAA 1XICA 5REQB 1Q6QA 1GOIA 1ONWA 3VZZA 3QY6A 2DZBA 3KTSA 2G3MA 2VD8A 2OU4A 3UY8A 4PMYA 4OZOA 4C6OA 1P0NA 1QPRA 3BG3A 3UWEA 5I77A 3SCOA 1YNPA 1XH1A 1UOKA 1FWAC 4ZO8A 4CQAA 3C3NA 4UTJA 4PMOA 4PMZA 1UMYA 1QTWA 3S1VA 3TH6A 1I6NA 2X41A 1TJ0A 3V16A 3VU2A 1JRBA 3CLMA 1TRIA 2WMGA 2DH2A 1E5NA 4E38A 2FZNA 3NQAA 4X60A 1WYIA 4NI8A 3U2CA 3CIXA 1W9VA 1JJKA 3W87A 3VC5A 3DDMA 4Y96A 2W3ZA 4KFNA 4MJ2A 2O9OA 4NXKA 2E6YA 3K1DA 4OJYA 4A6GA 2VGIA 4PR4A 2AL1A 4ZGYA 5EU9A 3VGFA 4N2YA 3W7DA 2I9UA 3H21A 4XIMA 2XSXA 2WNQA 4U33A 2C8NA 1E43A 3R10A 1ZTVA 1NOUA 3ABXA 4O8RA 1Z3NA 4V28A 3NUKA 3QLDA 3HJEA 4GABA 1P4CA 5H8UA 1KM0A 2I5GA 1ZL1A 2DT3A 3PZOA 3DFTA 2ZE3A 1UD2A 4AY8A 1E6QM 1PX8A 3AMDA 2ZA3A 2FH6A 3WH6A 1E0VA 1AQFA 3QFEA 4W5UA 3B97A 3JS3A 1JCTA 2EG7A 4TVUA 3VNDA 3NZRA 2O4QA 2RDUA 4OT7A 3VMPA 1UD5A 1T8QA 2RFGA 5HR7A 1EP1A 3O05A 2FHFA 3ZOAA 2V6AA 1XYZA 1IEXA 2A6NA 3CXOA 5I79A 3LCIA 1Q6EA 1XH0A 1XYLA 4YL2A 4Q4RA 3KEHA 4AD0A 3C4UA 5AHMA 1M68A 1OADA 1WDWA 5IHSA 3BLPX 4PFHA 4DHGA 4O1EA 1OF6A 3VDGA 3NEHA 5T9BG 1X6LA 4O57A 3SI9A 1JI1A 3KDNA 4D6FA 4IMAA 3VKBA 4TO8A 1Y65A 3H2OA 1GPFA 4RPQA 4CCEA 4I8YA 3WF3A 2BP1A 3T7VA 1S5TA 4EF9A 3MZ2A 2IXVA 1UPPA 2JE8A 1ITUA 4Z2LA 3VDAA 3ZO9A 4BQ4A 3EX1A 3BJTA 1TV7A 3TDFA 3BLFA 2OO0A 3PZ9A 3ZJKA 1HZYA 3RM9A 2POZA 3WLRA 1JZ3A 1XRVA 1Y5WA 3TZNA 2VQTA 2E77A 1XGZA 3BH4A 4KRZA 3PPGA 2X0HA 1FKXA 5CJNA 2V5BA 4A8RA 4PMRA 2E68A 1RSCA 1LUCA 1SJBA 3HG4A 4B5WA 3RDKA 1V3LA 1YIXA 4A3YA 2G4FA 2XVLA 4O0QA 4H9YA 3QBUA 1F7BA 1WO2A 4FF7A 1TJ1A 1JYXA 2BTMA 3V4BA 3NOYA 1W1IE 5FESA 1JDCA 3MCMA 3CZLA 1TMHA 3CMFA 5F4XA 5AHLA 1XC6A 4JCMA 5J5RA 3GHRA 3L4WA 5KITA 3URAA 3H22A 1G4PA 1FQ0A 1IYXA 5XINA 3LQGA 3G0UA 2VP8A 4O8AA 4NIRA 3W1NA 1HIZA 6CGTA 3I6TA 1RR2A 1UR9A 1OCJA 3TMLA 2QJIA 5CSYA 3KS5A 2GPTA 2HCVA 2HEJA 2DZVA 2O55A 1US0A 2C1GA 4H7ZA 2NQJA 3NO3A 1C90A 4BEQA 4WVXA 3GNXA 1DJYA 1C8XA 4H41A 1W56A 4M24A 3CL7A 3H2CA 2DIKA 3AYRA 1H50A 3O7UA 1GOMA 2Z1XA 2FVLA 1UG6A 1S5MA 1UC4A 2UY3A 2ODOA 1G4SA 3W6MA 3WDHA 1ITCA 1VEMA 2WMHA 4JDBA 4XUYA 4H6QA 2W63A 2F9RA 3W75A 2PDHA 3FA3A 1M7PA 5CZTA 7PTDA 5K9DA 1EDGA 3UWZA 1YE4A 2C3ZA 3VMNA 4D6DA 3KS6A 2PURA 1TRDA 4GX8A 3APGA 4S3FA 4ORMA 3F4DA 3N9SA 3CUXA 3NNTA 1NF0A 5AYIA 3G1VA 5AC6A 3KP0A 3SUUA 4KRTA 4EANA 4JQ2A 4Q4OA 4CUCA 2Y62A 4NXSA 1IXNA 1ELSA 3WBYA 5CG0A 3I10A 3QQ1A 2BOGX 1QO5A 3NL2A 1T40A 3GTFA 1VCFA 3FIGA 2O0TA 1YPIA 4ATWA 5F1UA 1EIXA 3QR0A 3TFXA 4EXBA 5LNSA 4LOCA 3SIZA 3W85A 1WDDA 2J79A 3TC6A 2HWGA 3ZIZA 1C92A 1W1YA 4EWJA 4KW2A 3FV9A 3PB0A 1A53A 3OTRA 4NYYA 4BFAA 1JGMA 5LHEA 1FWNA 4QFUA 3VZYA 3LV5A 1AW1A 1M65A 2G3NA 2Z1VA 4Q7NA 2YDRA 4M3PA 4AB4A 2RHGA 1J93A 1NOWA 5HQEA 4C90A 4HU8A 2X16A 4LUTA 1XDMA 9XIMA 4GQRA 3KX6A 1OWQA 4CVWA 1KWGA 3QSRA 2D2OA 3WD4A 4RV8A 3PZNA 1L6GA 5E0FA 5G1YA 3MSYA 4XO7A 9XIAA 3PPCA 2OPJA 1X7FA 5AYXA 3G1RA 2GSEA 4US5D 3VD9A 1N8WA 1I0DA 5BW6A 3WQPA 1DJXA 2ZRZA 1NDZA 5XIAA 4JN6A 4PB3A 1KXHA 5AYBA 3PANA 3WX7A 5DMYA 3B8WA 3HM7A 5BXRA 2J7GA 3TTSA 1GG1A 3S2CA 3HG5A 3PFMA 1UMLA 3AZRA 4X2PA 3W26A 4QS5A 3WQ4A 4UTHA 6ALDA 5I02A 4M6QA 4JY8A 3HFYA 3EX3A 5EMUA 3WQ6A 3PG8A 3KHJA 3NPUA 2WCSA 4P61A 5CCZA 3ISIX 1PDZA 1A47A 3W6LA 3UERA 1EPXA 4LVAA 3BLKA 4KFPA 3RU8X 1NVMA 2HTMA 1I1WA 3KBMA 3VKCA 4E2VA 3FAWA 4Z1CA 5CG7A 1H7WA 3M0JA 1POKA 2EPMX 2Y7EA 3OYZA 2GDVA 3RJXA 2GGIA 5A6BA 3TN6A 1NWSA 3LG3A 4AZIA 5FAJA 2OXNA 3QLLA 3LRKA 3N2CA 4Z08A 4HNTA 3CM4A 1XIDA 4E2DA 1JL8A 4KQNA 1XKYA 3N34A 2INFA 2XH0A 3VNZA 3L5MA 2YL6A 3RGTA 1A5MC 2EF9A 3B8UA 2QT3A 3E3HA 4RNJA 3G0XA 3UXDA 4IHCA 5CZ0A 4FLOA 5F7UA 1WZMA 1NSJA 3OQ8A 4W8BA 5MKGB 3P5ZA 2Z1BA 4LV9A 4BWLA 3CL6A 3AXXA 4KFOA 1AODA 3BAWA 4AVOA 2ZWZA 4M1BA 4FLQA 3QZEA 4H4IA 1KQZA 4LSBA 4EPBC 1OSEA 4AFYA 3E6EA 1LCOA 1B9ZA 2EEXA 4OTKA 2VWTA 4NILA 1DWAM 5MF5A 2ON3A 2J66A 2ZUMA 3KBJA 1LZOA 2DVTA 4JTJA 3EB2A 3N9KA 2Q8ZA 3ECQA 1EXBA 1VYSX 1CGUA 3BSMA 3TJIA 2BX7A 3QPZA 3LOTA 2HDJA 4E2OA 4DN1A 4KIEA 2ZRVA 3UZZA 2C15A 5G2IA 2VEGA 1E4MM 4JTCA 4DXVA 2FPTA 3UCDA 2CZ5A 2H9AA 4NJHA 4FLRA 1J5TA 3IJ6A 4WJ8A 3RX2A 1N82A 5TF0A 2HISA 1NEYA 4HPNA 2XFWA 4L6HA 2QUTA 3ARSA 4H9UA 4F9JA 3C2OA 3L67A 3H55A 5CSUA 4W7UA 2VC6A 3FSUA 5H8MA 1FWSA 1VYRA 4RK8A 4BI6A 2A79A 1M5WA 1W3IA 3MUY1 4NNCA 3TMQA 4WGXA 4I5UA 4HK5A 2HS8A 2AQWA 1E70M 3P80A 4I8DA 4H2CA 2C71A 4H8UA 4QR6A 2H8ZA 3NL5A 1ECEA 2ZA2A 1K9EA 2CFFA 1XQLA 2PA6A 5I3GA 4PUMA 1DE6A 3CQ0A 3MV01 3VILA 1GEHA 1DTUA 5A94A 1BVZA 4LQ1A 3CHCA 1SFSA 3TROA 1RAKA 2DT1A 3MSRA 1S2TA 2WZIA 3OG3A 1D3HA 1AMYA 3LEPA 2PP3A 6REQB 3WQEA 4DB7A 3NQGA 1JDAA 1Z8AA 4U3CA 3Q58A 2X09A 1QW8A 2NXGA 4IG2B 3OLGA 5HNTA 3ARRA 3WLHA 1LYXA 3SCUA 1ICQA 2XIMA 1FHLA 1JUEA 3LSCA 4JICA 3HURA 2GJXA 1X8FA 5HQLA 1UR3M 1DHPA 1BG9A 2YA2A 8XIMA 5I3KA 1HL8A 3M0VA 1MXSA 1E4LA 4GQQA 1YYAA 2VR4A 4CD7A 3PN8A 3N14A 2Y5JA 4M6UA 1P6CA 1V6VA 4U5KA 3I6RA 4B90A 2VELA 2R94A 3PBVA 1EJSC 4LJ3A 1PZ1A 3BJFA 3DIPA 4WOZA 4J5NA 2ZUWA 3OODA 1P0DA 2PRLA 4C6PA 2Q71A 5DMNA 3CUIA 1KRAC 2FHCA 4QXIA 7ENLA 4D6IA 5K9XA 4B92A 1CGWA 4E8DA 4NRSA 3CBWA 4MNLA 2Z28A 3VOGA 4NRRA 1M7XA 2HPIA 2GYIA 1F76A 4YN5A 3MWAA 5KSWA 2YFNA 1OIFA 4EPKA 3ID7A 4HMEA 3AMCA 3AIBA 4RW5A 1V3HA 1IHIA 2IKIA 3UXLA 5TAOA 2POTA 1JD7A 3MUIA 1O68A 1GJPA 2QDHA 1OX5A 1FRBA 3WK1A 2AMGA 3E5PA 3TYBA 4QJ3B 1OFEA 3GU9A 2PF0A 1NP0A 3LGEA 1XUZA 5KINA 4WSKA 1V3MA 4FB7A 1QWGA 4URIA 1XLMA 3B05A 2X1UA 1DKWA 3PZTA 4WIWA 1HG3A 4IPIA 4J3WA 3CJPA 4QCEA 5KZMA 2VQUA 3VUPA 2VI0A 1OQFA 1L6YA 2OLHA 3UR8A 4K39A 5IDIA 1O1ZA 1IT8A 4ZTXA 4CQDA 3AZSA 3A24A 3TTOA 4GUJA 2P5NA 5CJ5A 4IQJA 2C1HA 3SUTA 4NZJA 4B5XA 4IIGA 2E7FA 1XGDA 1K9TA 2YCKX 3W01A 4LC6A 3U5UA 1PSCA 1J0HA 1SJAA 2DSWA 3FYPA 1EA9C 1SW3A 5LXXA 1HJWA 3TYAA 3OZMA 3AXIA 3KOFA 1EOKA 4B5VA 3P67A 1ZBCA 1GHSA 3MI6A 3W82A 2Z25A 3SSZA 4IMEA 1E6RA 1SFJA 4RZ4A 3S1GA 3R8HA 3IAQA 2ZRYA 3O15A 3DG3A 2X1RA 1FWFC 3SQSA 4FOUA 1ADOA 3NO5A 3T44A 4HTYA 4QAWA 4R3UA 5CBJA 4IH3A 2DP3A 3NZQA 1JDDA 1AL8A 3FGCB 1XRSA 1QMLA 3MHUA 2VOTA 4C60A 4D1IA 4G7FA 4M81A 1IXPA 4U31A 4F40A 3VO0A 3G18A 1DWGM 2IMRA 4NQ1A 4ICCX 1LOQA 4AIUA 3QHMA 2GQ9A 1B54A 3CASA 4DZIA 3GIQA 3KLLA 5LNVA 3EDEA 2EBNA 3F7JA 3DGRA 3SW6A 4B3ZA 5E93A 4KT2A 5LGZA 1TJ2A 2KAUC 1XISA 3HPFA 3AISA 4C6DA 4TX9A 1W5OA 2DSVA 1KXQA 3BOXA 3CV6A 3R0DA 3T4WA 3ZWSA 1US3A 3PZUA 4B5NA 2J47A 4MFEA 3BANA 4O1FA 1HVXA 5LNWA 3CIWA 3RPTA 1VF8A 3OA5A 3TWBA 3MP5A 1RZMA 3CUHA 2JF7A 2YXXA 5AN7A 3OHMB 3F2DA 4H9ZA 1U5JA 5HNUA 4EPEC 3GXTA 4IPNB 1JFHA 2GVGA 1WBHA 3L4ZA 4GNJA 2QHAA 4GWEA 4I7WA 3WEMA 1M9HA 5J04A 4QDMA 3NJ3A 3O6AA 3VCCA 2Z7GA 3PF3A 3GS6A 1VGAA 3EOEA 1KFKA 4DJEA 3P6LA 4DJED 4KWOA 7ODCA 1XBVA 4XSMA 4G5DA 3BSHA 1W5NA 3EA1A 4GACA 2YCJA 3DFYA 4J3SA 5DX7A 4Q6XA 5HJYA 1KA9F 1T5AA 1ODZA 5CGTA 3ABOA 4C6QA 1H41A 2ABBA 3JVAA 1KCZA 4Q7BA 2A2IA 3TX9A 4TX8A 1B3VA 1DJNA 3GR4A 2D73A 3ITTA 3NPXA 1JPMA 1EUNA 3GY1A 3SGUA 1AVAA 1R86A 1ZLPA 4FEZA 3VABA 1T8XA 4BI5A 4LAOA 4IIFA 1JXJA 1ZCOA 3I3BA 3FFSA 5LYRA 4MG4A 4DLFA 4GUHA 1J6OA 1KQYA 1ZB5A 1V08A 4LUSB 1BTMA 1CXIA 1ADDA 3ZZ1A 3W7QA 4YTUA 3CH9A 1UZHA 2RGLA 3B8DA 1KFCA 3E2VA 3PWAA 4JS3A 4IJRA 5KZ6A 3RO8A 3BLIA 3VKKA 3T6CA 3UPMA 5CAKA 3O1NA 3PZGA 1IWPA 1SVDA 3UQNA 4RV3A 3QOKA 2YL9A 3KVJA 3N4FA 2EG8A 1XIJA 3E02A 3N17A 5CSSA 5EBUA 1UYQA 3QPEA 5IFTA 3HOJA 2CPUA 2DSZA 4BJHA 3WDIA 1EL3A 5I78A 3HO8A 5DANA 1MEHA 2FMOA 2FPVA 3WCZA 4U28A 1JIBA 3L5LA 5LA2A 2R8WA 2ISFA 2FTPA 4JTDA 1Y8BA 3R6IA 4AWSA 5AHFA 4AZ5A 3T0DA 3EDJA 3ME3A 3S6OA 2KX9A 4FPSA 1VENA 4JTUA 1O66A 3M5XA 3IK4A 3MSDA 1XI3A 2RH9A 2B81A 3IJ8A 4EVZA 1TSIA 3GC5A 3IIZA 5ABFB 1S2WA 2E1WA 5DRIA 4QDPA 3GHSA 3PBMA 4E4PA 1JNDA 3W2LA 3BDKA 3TU9A 3GAKA 2PTDA 2XUCA 4DNHA 3VIHA 3GIYA 1H0GA 1JVNA 3W7LA 1MUMA 3KBVA 4Y6GA 1E6ZA 4UC5A 2VFHA 3AS0A 5A6KA 1PV8A 4ZEPA 1G9HA 4BK9A 5DLCA 1WOAA 2ALRA 1YQ2A 2FKPA 6A3HA 3TNOA 4Q6JA 3E49A 4IJBA 4DF0A 2VFIA 4GH3A 3B4YA 3R58A 1DORA 3NG3A 4IL0A 5BWFA 3WQ8A 2VT0A 1VC4A 3ATZA 1A80A 1FBAA 4A35A 2OEMA 4WKHA 1GZ1A 3BG9A 1SR0A 4L4MA 2HVMA 3ITCA 1VCVA 3CPGA 4F79A 2G0WA 4RL3A 1VPYA 2GUBA 2JBMA 3U2OA 3H4XA 3MJYA 3OBAA 2PDKA 3MMTA 2P1FA 4XQ6A 1MDLA 4XD6A 2DSKA 4GYPA 4ZZ9A 1EO7A 1AD4A 4PL2A 2R1LA 4DJDA 4DJDD 3FLUA 4RE4A 3F5KA 5HNRA 1I2OA 4XVEA 3GXFA 3HV8A 5K3VA 1CPUA 1FP8A 1E0UA 4N6EA 1SMDA 2TAAA 3IIPA 4N9CA 1UR4A 3USZA 3QVQA 1Z89A 4K2SA 3UVAA 4GCAA 2UZ9A 5CPOA 1XLGA 2Y0FA 1EC8A 8RUCA 3A13A 4ZBCA 2Q8XA 1FXPA 1O5XA 1O94A 4JHOA 2D0HA 2WSYA 2QPUA 3IEBA 5BMWA 3FJ4A 2J13A 3CLWA 4XAZA 4ASTA 3VGGA 3FK4A 3PP7A 3IANA 3SIMA 3ITXA 1SO3A 4HNCA 5M5DA 3PBUA 4UFKA 3OU8A 1VJZA 3OZYA 3TTQA 1EX5A 3SFWA 1E1CA 1VZWA 3BJSA 3RITA 5LHFA 3KFTA 1OK4A 5KMYA 2FLIA 3PULA 3ZM8A 1G4TA 1GUVA 1SO6A 3W29A 1LOSA 4X63A 3LCLA 1ZZMA 4WJEA 1SFLA 2QIIA 1WAUA 2HSAA 4HYWA 3AJ7A 4UIOA 2QJHA 4L4LA 2NZLA 2D24A 4GUGA 5C9XA 3USBA 1S5WA 4PULA 2AGKA 2OWCA 3RX3A 1IXOA 2R1PA 5KZDA 1XLAA 5LIWX 1CLKA 1ZP4A 2QAFA 1X7IA 1FUYA 1EJVC 4XZMX 1I1XA 3IGXA 4I7UA 2A3AA 5HXMA 4DX3A 1NP2A 1DJQA 2VRJA 4HOWA 3O6CA 1S39A 3LLFA 5CPSA 5K4XA 4NJIA 2EHHA 1R0MA 1NQ6A 2QDEA 4PMVA 5C9RA 5I3DA 1YPXA 3ITLA 1GTHA 2NW0A 2PWVA 1AFSA 3GDKA 4WY0B 1LL6A 1PJ9A 2O7SA 3MSGA 4KEMA 3GVQA 3W1AA 3I3EA 2WSPA 4RLIA 3OZPA 1B3XA 5K7JA 3WD3A 2FZMA 3GTNA 3H53A 4AIEA 1PDYA 3SCQA 1YE6A 5FEXA 2V5DA 1PX3A 4RDWA 6ENLA 2WHJA 3GSMA 3WLNA 2DW6A 3BCFA 4ZOAA 5BMXA 3QM3A 3MANA 3TV8A 1EJ7L 2HVOA 2VM8A 3ZLHA 3L2IA 1QFEA 3TCSA 4D71A 2PWGA 1EB3A 4F2BA 5EMLA 3H7RA 4FOKA 1HKMA 2PBOA 5AYYA 2QF8A 4GYKA 4V33A 1R9YA 4PA8A 3A4AA 1TMQA 1VRXA 4WR3A 3CZ8A 2XHYA 3TLLA 4CU6A 3THQA 2QUUA 2CZEA 4MNMA 5LXEA 1Q7QA 1UUMA 1OX4A 2NXHA 3WNOA 2G95A 1YTEA 4I9TA 7A3HA 4XTDA 1EH9A 1NQKA 2G8ZA 4AZ6A 3HGSA 3URBA 3MTWA 3BGAA 3WEOA 3SCSA 4XKYA 2BVDA 1XBXA 4NYUA 3MBFA 2PDGA 1LM1A 1AL7A 1R46A 4PTVA 1O5RA 1EC9A 4AG0A 4BF7A 4BQ3A 1RH9A 4PBFA 3LHUA 3R7MA 3RR4A 4GQBA 4LGXA 3APTA 2YA0A 1PYMA 1TZ7A 4IQDA 4OUIA 3VDBA 3WNMA 2DJXA 4W4QA 1GK8A 2ZUUA 5D2YA 4IGHA 2VTFA 4BEUA 1PXGA 2MNRA 3B0PA 8TIMA 2Y88A 3UNDA 1KR0A 1N55A 1P7TA 4QNWA 3TQVA 4DF1A 1ZBWA 4OUEA 4MOZA 2PLMA 4H01A 4HOZA 3E0VA 3KXQA 3NZ1A 3N2MA 1TE6A 3PSWA 2ACQA 4Z2KA 1QNQA 2XSAA 3CH0A 3NURA 3LHYA 2ZUSA 1FH8A 1E0XA 1XRTA 3OLEA 3A4WA 4W8AA 3P60A 3UEQA 1MDRA 1JNEA 2WPGA 1C7SA 3ABRA 2VKZG 1MXGA 1RV8A 3LCFA 2OSYA 2DZSA 3FXYA 3PR2A 2Y89A 1F8IA 1GQKA 3TK7A 3LPOA 2GGEA 3C6CA 3FJLA 4UTIA 3W1LA 2BVWA 5A8OA 3M6DA 4W88A 2QVHA 4FX7A 1ISWA 4JNYA 5D09A 1MEWA 3HBLA 1JCMP 1AUSL 1RCQA 2E3ZA 3SCWA 4V2XA 1W1VA 4IGMA 1PIIA 1V6YA 4M80A 1U30A 4FX6M 2V30A 4Y9PA 1ZQ5A 5A6AA 3STPA 4MJMA 2CZDA 3AMGA 2XWDA 1J18A 4JHMA 1F74A 3PBGA 4JIEA 2XIIA 3M0KA 1D3CA 3W9ZA 3W23A 1RQBA 2BV9A 1OYCA 2P53A 1F07A 4RKAA 3V0SA 1OBAA 2WANA 4K68A 3ITYA 5C2XA 3POCA 1B3WA 4UTWC 3KBWA 2C0AA 1B31A 1BHGA 4Q8UA 4Z1YA 2D0FA 4HZ6A 2A21A 4FNRA 1CLVA 2ZUVA 3GXNA 1XW8A 1DWJM 3IVUA 4HSNA 4MGGA 2ABAA 5ABHA 3MP4A 4GZJA 1P6BA 3UA3A 1ITXA 2JK2A 4GI8A 3S2JA 2OZ8A 3RLUA 2WAGA 1TPUA 3H2EA 3R13A 1EO5A 3S0CA 1EP3A 3LHWA 1UD8A 4WSJA 1IZCA 3TSMA 5U7SA 3STEA 1BKHA 3W2KA 2QKFA 3WH5A 5M17A 4ILSA 2PB1A 5HWJA 4P7NA 1Q2RA 5FI8A 2Q6ZA 3VNYA 4LVDA 2RUSA 4JHZA 2IQTA 5AZ1A 5E1QA 3NO1A 1VHNA 1TV5A 3H7UA 3U57A 3WUBA 3U7VA 4DPQA 4LFYA 1JZ2A 1L6SA 2X8RA 3TE9A 1AH3A 4WUIA 4WX2A 2YLLA 4FP1A 1O12A 4JPGA 4KEZA 3AHXA 4LYQA 3G6MA 2PDMA 1EJTC 4Q4QA 4LB4A 3KL3A 3NYDA 4XD3A 3IGSA 1ZU8A 4ZO6A 2OKOA 4HBKA 3C2EA 1RALA 4DIAA 2ZOXA 5BZAA 2ISVA 3B04A 1YEYA 2V2CA 4JTQA 4EACA 4UMCA 4DZHA 2ZX9A 1VYPX 5H8PA 2H90A 4QISA 3U48A 3TEVA 1LG1A 1BLIA 1KKOA 5IRPA 3VCNA 3C0SA 5CZKA 1I60A 2JQXA 1XIFA 3T09A 2REQA 1EFZA 3NCOA 5CGQA 3VFCA 2CERA 4IICA 2VD9A 3S5YA 5M2FX 3L23A 4MAVA 4IIHA 2CLHA 3H23A 1GYMA 4O17A 2OG9A 4Q8PA 4WDTA 1TV2A 2ZCGA 3C5QA 1DQUA 1K7EA 3FAXA 1DIKA 1I2RA 3PVFA 2GFTA 5C9ZA 3RM8A 1S1PA 3P61A 4WRHA 1LF1A 3AMLA 4KESA 3W1TA 4JL1A 5FJOA 2YZ5A 2C79A 3CK5A 3BMVA 3S83A 3GDBA 1KFBA 1OFOA 4B5TA 2H3DA 3MT1A 1F4AA 1VLIA 1P6WA 2JGYA 2ZX5A 3CIVA 1FA2A 5C6MA 3CC1A 2J7BA 2J9XA 5K2ZA 2XM2A 2ATSA 3E96A 3EWYA 3V3WA 3UR5A 2VNCA 1E0TA 4W86A 3MDWA 3TCEA 1QNPA 1YPFA 3TZFA 2RAGA 5C55A 4Q8WA 2EJAA 1YX1A 3IAPA 1VB9A 4K3ZA 2XISA 5D2TA 3SECA 3HPAA 4JXCA 1ECQA 4CGTA 4R34A 4OBSA 1U1HA 5DMMA 2D23A 3CUFA 1TWIA 4X9YA 1M01A 4E6MA 3RNDA 4H8VA 4GYPC 1YXYA 3TXZA 4JQAA 4DJDC 2P10A 2QULA 2EGZA 3OIHA 1V6XA 3KRZA 4AD5A 4NHVA 1WNOA 3W7IA 3Q65A 3ANYA 5DEZA 3MUCA 3DXIA 1HN1A 3CHFA 1E9IA 5I0DA 1VS1A 3OZOA 3WQWA 3ZQ9A 3LN3A 3VZXA 4CNTA 1F73A 2GQ8A 1JZ7A 3BC9A 2XM1A 1EX1A 3OYXA 4HCDA 4GIAA 4JDYA 2QR6A 2NWRA 3GUGA 1GVYA 4ZL1A 3LLXA 1MZRA 4J3TA 3QSTA 3BZJA 1MFVA 3L2MA 1ZY9A 2BBFA 1XPGA 1SM9A 2DZXA 2HNHA 3QEZA 2OT0A 4JKKA 1TIMA 3WKZA 3GK0A 4H2HA 3LZ3A 3ICJA 5HK4A 3VCRA 1OT1A 3H24A 4AX6A 2J74A 3W72A 1K6WA 3AU6A 4C1NA 2DFAA 2XZ7A 3PUDA 3A21A 4NL1A 4R27A 1UBPC 4GY0A 3WLSA 5KTLA 1UASA 3URQA 3NR0A 2ZXQA 3IS4A 1QCWA 1YDVA 4WZHA 4P8UA 1CGTA 1UW9A 3GX9A 2FB2A 2WXDM 4LXFA 4AZGA 1HT6A 2VCCA 2OR2A 3WNLA 4KRUA 2Y4SA 4B9ZA 1L6WA 2V8ZA 3O0KA 3TWAA 3THDA 3NEVA 4EX4A 4XTIA 5KETA 1WDQA 2X42A 2Z1WA 4K8HA 1GPWA 3WD1A 2DEPA 4TVCA 1CB2A 3JUGA 4J7RA 1C8VA 1E4NA 4D8AA 2YDSA 4PSRA 4JYDA 3BO9A 4LS0A 2CNCA 5ECVA 3NQBA 3FSTA 4H6EA 4LEQA 1BWKA 3AALA 1PEZA 1KTBA 2GVLA 1W1ZA 3VNJA 4E8CA 3CZGA 4DI8A 3FX4A 3NXFA 2VEKA 3UR7A 3L65A 3S1WA 3SGZA 3W7GA 3N11A 1GVRA 1LBFA 2XN1A 1A5CA 3PFRA 1OFRA 4QE1A 1A3WA 5BOEA 3TXVA 3OVGA 4ADTA 5LNUA 3OJGA 4EOUA 5D03A 3Q67A 5DT5A 1UA3A 1AJZA 2ZX6A 5CC6A 3KRBA 4BQ5A 3AMKA 4H6KA 3RIKA 3GZAA 2OLAA 3T40A 5EB8A 4UZSA 3HB9A 2AAAA 1TV3A 2NT0A 1EDQA 1W9BM 3NQCA 1M7OA 4XZNX 2WHKA 1Q6OA 3ZSSA 5CZSA 1W8SA 1XBYA 5JQ9A 5BROA 1A5KC 4KEUA 2XYLA 4QITA 2QGHA 1AZ1A 5A6MA 3C0JA 3TTEA 3NQVA 3A5VA 2WVVB 3M6YA 1QASA 1OJXA 1CXEA 2ZADA 1B4EA 4X61A 3N04A 2BY3A 2KZHA 3M44A 3VDCA 3WH7A 3THUA 3GDLA 2O9PA 1UHVA 2WSRA 2CXGA 1R2TA 2G37A 3BICA 3LXAA 3LSBA 1VFUA 2PF8A 4XBKA 4LWWA 4N4QA 3B8IA 4O4VA 1Q5MA 3FA5A 1RLDA 2VUYA 1DJZA 2VR5A 5AC5A 3CQIA 4JAWA 1X8CA 3UA4A 3AUJA 4V1XA 4LPCA 4Q32A 1TJRA 5BRPA 4F2UA 4YVVA 4Q4KA 2NQLA 5ECUA 1VR6A 1PTAA 1HL2A 3WYZA 1TJPA 1REQA 8A3HA 3TYUA 5HMSA 4YHEA 3RPDA 1M6JA 4MYXA 2OQLA 5EMYA 4Y90A 3DFQA 4GGBA 3EXRA 3BAJA 1ZALA 2YDAA 2WMIB 1TWWA 5D33A 5E0CA 2B4GA 3P74A 2QDGA 4PCNA 4H04A 1X6UA 4IX2A 2X05A 1FY6A 1DQWA 1UWAA 1EOMA 2OWXA 3INPA 4PRWA 2GK1A 4CLMA 4FNPA 9CGTA 4F8XA 3MCNA 1OCQA 5DBUA 1H49A 4X2RA 4GYJA 4ZXLA 1TZZA 4MWAE 3LTYA 1XIIA 1VCGA 3C52A 4FI4A 4DXXA 2W66A 3RRXA 1RY0A 3PTMA 2WQPA 4YYFA 5AB3A 3N1AA 4GXWA 4J28A 2V3EA 1XDLA 1LT7A 1Q66A 2QMJA 4BA0A 3CAKA 4EAYA 1F4HA 2QAPA 4JIRA 4WDUA 1J01A 4TTGA 3VE9A 4BQ2A 5T8GA 1WKFA 3GB6A 4WDWA 1TYGA 1QK0A 4Z2IA 4TTUA 2FGLA 3WO8A 1EEXA 3W4RA 3KOXA 4A3HA 5BU6A 5AKQA 3DFSA 4LNCA 3CQHA 3EGJA 4MUZA 1UQZA 4J3UA 1NWUA 3GG1A 5AHEA 3WF4A 1RJPA 5M1TA 3MY9A 2DT2A 1W5QA 4F66A 4DWSB 1JZ5A 2PTZA 1SSDA 3VMOA 4X0NA 4C65A 1MSSA 1YTKA 3UESA 2QJGA 2XIQA 3S4TA 1CGYA 4CNSA 1H3GA 3GNNA 2CLLA 1PUDA 3L5AA 4MY1A 4W9TA 4ZOCA 3T0TA 5HANA 1JAEA 1PKLA 3PJTA 4AWTA 5I24A 1NIUA 4REQA 2V82A 4JIHA 1NY1A 5DF0A 5FL0A 2G4JA 4IT1A 3QXBA 1XG4A 4F4RA 2O56A 1MMFA 3STCA 4IIBA 2CITA 5FSEC 3MU7A 3GC4A 3P5YA 2Y61A 2FH8A 3EYPA 4M82A 3LHTA 5XIMA 4ADSA 3P8JA 2VDIA 4Y8EA 1CENA 4PMDA 3ELFA 1XINA 3WLPA 1WDPA 1Z44A 1S2UA 4A29A 4MVAA 2CEQA 2V9DA 1PE1A 3NIYA 3SCTA 4MPQA 3GH7A 1PZ2A 4MZYA 5F4WA 2PDNA 4GFSA 3TAOA 2YCLA 1L8NA 1I9CB 3KWXA 1BPLB 5C2CA 4CD6A 2ICSA 2GJNA 4MPKA 1VEPA 2XIBA 3ZT7A 2Z24A 4D6GA 4DQWA 5CC7A 3EA2A 4UTLA 4L7ZA 5DMLA 2GJLA 4CCCA 2FPYA 1A5BA 1NM9A 5CZJA 4C6BA 1KM1A 3ZR4A 3T9PA 3HQNA 2XIJA 4NNAA 4CQCA 4EP8C 3CHVA 2XH7A 5AYZA 2Z7KA 3PNUA 3HPXA 1K7XA 1RVGA 3EMQA 4IIDA 5C7HA 2HK1A 1BVNP 3SADA 3NM1A 3OVRA 3TOYA 4A8IA 2Q02A 4CEUC 4NJKA 1N8IA 4YWSA 2GGGA 3OW1A 4Q8QA 2VX6A 2YCIX 2PDJA 4IFKB 4DO6A 2OWWA 1XIHA 1E3XA 2R91A 3CS2A 4D6CA 3ONCA 3N6HA 1JF5A 4A22A 3AIUA 5FACA 1XIEA 3C2FA 3N73A 3U0HA 1BXCA 1GCYA 4PMNA 4JR5A 4XV0A 1XIMA 1FWRA 4B91A 4GG9A 3W37A 2PRMA 1NAL1 2J25A 2X2YA 1EZWA 3VOCA 1SFTA 3WJXA 4M8UA 3LQLA 4DWSD 4JFTA 1UKTA 5A8GA 4A4AA 3GDRA 4GNKB 4Z2HA 3PC0A 3W7EA 2Z29A 3A3HA 3NQMA 4X0VA 4UBPC 4JEQA 1HKVA 1UP0A 3S9ZA 4O10A 1CXFA 2BSLA 4JN8A 3NZGA 5LA0A 4LAUA 3EBVA 1PWLA 3RK8A 4PCPA 5DCBA 3F4VA 2UY5A 5BXTA 1EGZA 4PMQA 4B9YA 3GC2A 4C1LA 4ZB2A 3TN4A 4BZYA 1V77A 3GTIA 4HKPA 3WY1A 4AEEA 2X0YA 2ZZ5A 3LRMA 2IPJA 3LCWA 4JYFA 2J8FA 3EWBX 3W71A 4NAEB 2UY2A 1NDWA 1LBLA 2PTXA 4Z2GA 3V0TA 2CBVA 3N9RA 1IXQA 2OEJA 4DJFD 4F48A 3CO4A 1J0KA 3M0YA 1RVKA 1EJWC 3WSUA 3EKZA 2GOKA 3D6NA 1Q3NA 2DH3A 3E9AA 1U22A 3M0XA 5LIYX 2WMFA 1FHDA 5H6HA 2YX0A 3AS2A 4B3KA 1BXBA 1C8QA 7XIMA 1CLXA 4GIEA 4XD5A 2CZVA 3DAQA 4J35A 1PCWA 3PPHA 1W6TA 1BRLA 3V75A 4L65A 2R1MA 3VD7A 1IGSA 5E0KA 3IK2A 1HL9A 3GIPA 3CYVA 2DZWA 1VPXA 1OX6A 3EMCA 1MRQA 1XWYA 1WUEA 3E0FA 3H4WA 3NQDA 3C86A 3N2XA 4EE9A 5D02A 1BAGA 3QKZA 4CCZA 1QU4A 1V0LA 5DT7A 3WH8A 1NF7A 1X1NA 2OELA 3DHDA 3NSMA 1CNVA 3S6TA 5EMMA 2F6UA 2E6FA 3SO7A 1KV8A 4IP7A 2VHLA 1KGWA 1XQKA 4PTWA 4G1KA 4LYRA 1EUAA 1RCXB 3L4XA 4QTGA 4LBRA 1VBRA 5CH9A 3RG6A 2ZZ6A 1EWDA 3GVGA 3TTYA 2XN2A 4G7EB 1FP9A 4XKMA 3L68A 2J78A 4M19A 2QCDB 4ZOEA 5JBDA 1PHWA 2WQDA 3PHAA 2R6OA 1YBQB 3LLDA 1OABA 1Q6RA 1IZKA 3CUZA 4W87A 3BLOA 4F0KA 1QOPA 4IXHA 4JTKA 3RO6A 4LAMA 1EP2A 1XYCA 1DQXA 1IV8A 1EHAA 3BUVA 2V68A 2ZUTA 3NQ2A 1QOXA 1NDYA 4D8ZA 2FTYA 5FD0A 4HZ7A 3FJ6A 3SY5A 5M3WA 1EF3A 1MXDA 2ZTKA 1SGJA 2IQ0A 2C14A 7REQB 1A5LC 2FZBA 3NYZA 2YXGA 3WNKA 1LLWA 2I57A 4CNPA 3BE7A 3KRUA 1EQPA 3WDQA 3K1GA 5HINA 3LUTA 3M4HA 3W70A 1GQLA 4AIBA 3UY7A 2XH4A 4Z1AA 3H26A 4UNKA 5G1TA 3W1MA 1J10A 1QATA 4LV4A 2OQHA 4LY4A 5EMJA 3C0LA 1BYCA 2FVKA 3UPBA 4O16A 3GZ3A 1B90A 3P0WA 3THAA 2Y8KA 1P0BA 2PU0A 1F6YA 1UROA 5CBIA 4EAMA 3L0KA 4ZB5A 3V5OA 3BOLA 4S2BA 2VENA 1K7FA 4ACZA 1R8LA 5ENLA 3THCA 5FEPA 3CWNA 3H6OA 3DHUA 3W00A 4DELA 2RDWA 1DIOA 1PKMA 4QJ4B 3LRLA 2NLYA 4DUWA 3GHUA 1BWLA 1X1OA 2VDHA 4YJ5A 2QCFA 5EMKA 3RPMA 1F3EA 4YIWA 4NAFB 4HU4A 4GVFA 1DWFM 2O92A 4JD4A 3F4CA 3UXKA 3S9IA 1L2QA 4CNOA 1DXIA 1UZDA 5AOUA 1RK6A 1OY0A 4NZ4A 1JYWA 2Y7FA 5BCAA 2OMAA 1YTDA 2WZTA 4HNLA 3WL1A 3M9YA 1FVPA 1UZ4A 4IFRA 1X39A 3CYJA 3MVIA 5CPQA 2VZVA 5FF4A 1KBLA 1MW0A 1KV5A 3G1YA 4KGLA 3R79A 5C9UA 3UU0A 4C5YA 5AC8A 2VDGA 1OYBA 4PODA 2WVTA 4FO4A 4MWAA 4MWAD 4TIMA 3KL0A 1DP0A 3G22A 3VE7A 4HHPA 2G96A 4AWUA 4RE2A 2PDPA 5A2AA 4NZCA 3ANUA 3AI0A 1OINA 4P5UA 2TSYA 1G0CA 4FOJA 4U4MA 3AIRA 3SUSA 1LLZA 3T2QA 2PGRA 1DXEA 5F2GA 2NXIA 2A4AA 4O1BA 2ZUNA 3IGHX 3W7NA 2VC7A 4HU3A 4RUBA 2ZYFA 3TYCA 2PE4A 1FOBA 3UGVA 2E1DA 1R3RA 2PGFA 1BGAA 1BYBA 2V5KA 4FALA 3F5LA 3IV8A 2WKLA 1JEZA 4PC8A 8CGTA 1XC4A 2A6LA 3G77A 4MKSA 4UOZA 2O9RA 4NZ1A 1HGYA 1TWSA 2VC5A 1UKQA 2EG6A 3M1ZA 1WZAA 3CV2A 3REQA 3W1XA 3TUUA 2F84A 4R9XA 4O0KA 2RKXA 1D3GA 2VZTA 9RUBA 2ZE0A 4AMAA 2PPGA 3CPUA 1XR2A 4TU1A 3VIIA 2ZA1A 1XRFA 3SSJA 2WJZA 2VZOA 2JIEA 4DYKA 4LX4A 5D38A 1MNSA 3PTQA 1IWBA 3FVDA 1DPMA 4W8LA 1XX1A 4JIIX 2D1ZA 3A47A 1W32A 1V93A 4J9JA 4E3VA 3N29A 3T8QA 3M5VA 3B9EA 1LL4A 3TQ0A 3VXGA 4CCDA 1CGVA 2HK0A 1DIEA 5CLTA 2F6XA 4XZ9A 1BGGA 3SY8A 2JFEX 5G4HC 1UZ1A 3BLDA 2X7VA 3CZEA 3IJ7A 5T26A 4BR1A 1Q6CA 4UTTA 3N25A 1AA1B 1XF0A 3KVMA 4LAKA 4JX6A 4PTDA 4S1FA 2PP0A 2ZZ3A 1K4HA 1J0YA 3KCJA 2EXOA 4OE7A 2VCBA 3RN6A 2WWDA 1R9ZA 1Q8JA 4ZTYA 3EAUA 2WJEA 3D3AA 2E40A 3UJ2A 2NV2A 3UF9A 1DJIA 1TPDA 2CU0A 4TMBA 4IGSA 4CN6A 2EKCA 3D3FA 2ZRXA 3CZKA 4GVHA 4DYEA 3WFAA 1XLCA 5FL1A 2NSOA 4QM1A 5HBFA 4CVUA 1VBHA 3GVRA 2NVAA 1V3KA 4LUIA 2HPMA 4AF0B 2YSWA 1ONXA 2Q3OA 5REQA 4M1RA 5LIXX 1XSKA 2PUZA 3GXPA 3O06A 1CI1A 3BPWA 4FIRA 5BRBA 5C9WA 1IZJA 4A21A 1R38A 3P62A 1H51A 3VOIA 4PSPA 2PODA 3CV1A 3PG9A 4Q8NA 4RX0A 5BXSA 1AQ0A 2Y2WA 4JN7A 1Z32X 3B0XA 3CAWA 4GA8A 3BV7A 4G9PA 4NASA 1KRCC 1KFWA 1DHKA 1K8ZA 4Z1DA 2WNZA 2C1IA 8XIAA 4B2DA 4H8NA 4B2DD 2ONEA 4QS6A 3K4AA 3AXKA 1OGGA 3JZEA 1JDEA 1GQJA 1P1XA 2E28A 3CQKA 3B06A 2CZFA 4UCFA 4GI4A 5DN1A 2G3FA 3DFNA 4PB5A 1T99A 5G2HA 3O8AA 4LCSA 4WDXA 1FHVA 2J62A 1K9DA 2JKEA 3HG3A 3N3TA 2BY1A 4NF7A 4ERIA 4H9XA 4RPPA 4K8EA 2NQZA 3GBEA 3W1RA 4GZ7A 2PWFA 3A4JA 3AZTA 2NX9A 4QRNA 3W2MA 2L5HA 4AXNA 1JZ6A 2CWXA 2UWFA 3NQFA 3R11A 1DOSA 1RQHA 4O54A 3UJEA 1X38A 3ZVIA 2W62A 3UVIA 3T08A 3RILA 5A6SA 3WK2A 4MYAA 3SQMA 1OFQA 4L9ZA 3MKCA 3WNPA 1C93A 4O52A 4FR6A 2AAMA 4IPPA 5F2MA 1CTNA 2FFIA 3UXIA 3VX1A 2VUNA 3GU2A 1OD0A 3O3RA 1BYAA 1R47A 4O11A 1FTXA 3R43A 4KH2A 4GNVA 2NLIA 1W3LA 2OX1A 6XIAA 1YDYA 4H3DA 1F61A 2CHRA 1S46A 4NX0A 2HROA 4JOMA 3BGJA 4HNVA 2DZTA 4W84A 2Y8UA 1IT7A 4O28A 1A5AA 1HUVA 3H2MA 3ENLA 4HHHA 4QG9A 1X6NA 4IISA 4P7QA 1QI5A 2XTKA 4A3RA 3A5FA 4M6PA 3LCHA 4O0ZA 3TOPA 1MW2A 1A4MA 1EEPA 1QHPA 1A0DA 3H7VA 4D9PA 3DFHA 2BXYA 3VC6A 3AO0A 1FWGC 1I8JA 1C9DA 1AZ2A 3W76A 2GL5A 3GWQA 3GU1A 1X97A 1QW9A 2QMKA 2J7HA 4Y9MA 1KKRA 3LPPA 1OM0A 1TREA 3L21A 1E51A 4V15A 3SRDA 1E55A 2DZPA 2J88A 4MY8A 4JBRA 4Z0JA 1OCNA 2B7QA 3AHTA 3W73A 3K2GA 3U2EA 4IMGA 4AEOA 1SZGA 2F38A 3VFLA 1G4EA 3E12A 4PUKA 2PDLA 1VFFA 3ITGA 4UR8A 1LLOA 2LLEA 2ZDRA 4RXGA 3KOZA 3KOYA 4HGXA 4F9DA 3MW7A 3W02A 1RHCA 3HF3A 1UA7A 4A8NA 3UJFA 1TO3A 5EPDA 3W88A 2YLAA 1LRTA 3SRKA 4US5A 1KM3A 5D8ZA 4EK7A 1YKWA 1I2PA 4K36A 1HGWA 4WJXA 1R3WA 2BODX 3C8FA 3GE7A 1TA3B 4JGDA 3EPNA 4AISA 4DEFA 4JFSA 2QCCA 3U5YA 2WVUA 3CMGA 4OFCA 1UH2A 1G6CA 4POCA 1WXJA 1UKOA 3CL8A 3DKLA 1SJDA 3WELA 1BTCA 5FOOA 3E0IA 1CIUA 1OC6A 1EJUC 3DZ1A 3KL5A 1K8YA 1XUUA 3KRSA 2A3BA 3VNLA 3D46A 3C2YA 7CGTA 1XCWA 2AKMA 1W1PA 5FJUA 4OGZA 1NDVA 4ONVA 5I5RA 3KBSA 1R9XA 3MYOA 2VEMA 3KVKA 2PD5A 2JKPA 1KO0A 1VAHA 4S3GA 2PZNA 3BWWA 1HVQA 1GEQA 2X2GA 5DQPA 1MNZA 1TZ9A 4ZO9A 3OGSA 4PFMA 1YNQA 4X22A 3EDDA 4GYFA 1X98A 2HXUA 3RLVA 2XVKA 1DJWA 1JG9A 1FWJC 4I6KA 3LHZA 5DO8A 3TW7A 3WQDA 4S3EA 3S42A 3CHEA 1UKPA 3WF1A 1TPEA 2ZRUA 4FA3A 3LXBA 3VD3A 2PDWA 4QSFA 2YB4A 1FXQA 4J4KA 1D9EA 3W1PA 2BGSA 3G1DA 3ZVHB 2JF6A 2E25A 3B9AA 3M46A 4PL1A 3QY7A 3AFBA 1GW9A 1WB0A 4S39A 1DJGA 3EXSA 1LWIA 4HNUA 3M7SA 5AY7A 3EX6A 4EXAA 1ITQA 3A22A 3LU2A 4E0CA 3OPSA 4M6VA 1QWKA 4MTVA 4JEJA 3CPRA 4AQLA 1FWHC 1RK5A 2PS2A 5BOOA 3U3HA 2YIHA 4YWIA 5EBAA 5GJMA 4OBRA 1Q13A 3BVJA 1AK5A 3O0FA 3ORWA 3T4CA 4HA4A 1ICPA 3O9NA 4QG8A 4C6NA 1BF6A 4CD5A 5I7GA 4L1XA 5A8QA 3HU7A 1HKWA 5ABTA 1N7KA 4Z0SA 1KC7A 3SN1A 4Q3MA 4NU7A 2VX4A 4LF1A 1VLWA 1VFMA 1O5KA 3MS8A 3EZ4A 4J3XA 3VTRA 1E73M 1Q4NX 2VGBA 4HA0A 5G2WA 1QPNA 4YCPA 2B7PA 1KWKA 3VKAA 1XGEA 3PB2A 3W86A 5IBXA 1O95A 4HZ8A 4KERA 1E9LA 1I0BA 1BF2A 5EL1A 4EPDC 5DRCA 1R87A 5CKSA 1XCXA 4YLWA 1I75A 3ALGA 3MO7A 2Z1KA 1ISYA 1VJIA 1TCMA 4UCGA 5FJRA 4LBUA 3VNIA 4AC7C 2Q01A 4JNMA 3O2LA 2ACRA 4N9BA 2P76A 2X0SA 3NPWA 4LS1A 1W2PA 3N15A 1C7TA 2VGGA 4HZMA 3LHVA 1BSLA 1RBAA 3SCPA 4LANA 1F05A 3AJXA 1BG4A 3WFZA 4GI6A 1KM6A 5HDRA 3B9DA 3DBPA 2EPNA 4HCHA 2XFFA 3ZYZA 2HV5A 4F2TA 4Y2WA 1UIPA 2PGEA 4O15A 4C6JA 2YZRA 3LY0A 4GFIA 3EOLA 3AYSA 3KOWA 2Z2BA 4QEHA 1S3HA 3IRDA 4J1OA 5JU6A 5MKGA 3OG2A 2YXOA 3WLIA 3K8MA 3KDOA 2Y70A 2W27A 4HMCA 5DBTA 3F4NA 3W83A 2H6RA 1KD0A 4MNJA 2ZVRA 3EDFA 3QHNA 4H83A 3TC7A 4MB5A 1LDCA 2HBVA 2J7DA 4HNOA 3QQ0A 3ZJ7A 2OX4A 2DUAA 3QJAA 3DU0A 3WN6A 3NGJA 3ARQA 4A3UA 1MZHA 2TYSA 4O50A 3ONBA 5HATA 1JF6A 3S1UA 3UT0A 4JQ1A 3VGHA 4FXFA 3UR2A 1TPH1 2D2GA 4OQVA 1K4GA 3GNDA 4UTKA 3MO4A 2WNWA 4JFVA 1F9CA 2YA1A 1O6IA 1PTDA 4G1NA 4S3JA 1NTHA 1FWTA 3GTHA 3UCCA 3EWZA 3V1HA 1GORA 3RCMA 4EKJA 3PWIA 3GO2A 4IUOA 4LUJA 3UJSA 4DBSA 2RJGA 1SU5A 2I5IA 3CT2A 1S5NA 4GRSA 2AL2B 4W5ZA 2RDTA 1SZFA 1OK6A 3SCNA 3DYMA 4C7FA 3AROA 5FIPA 2G41A 4ZQPA 3WD0A 1MWOA 4FXRA 1EJXC 4LTSA 1BVWA 3UWVA 1HXJA 1V0MA 1RBLA 3PZIA 3A64A 4XWUA 2V3GA 3S5SA 1YHTA 4O53A 1HP5A 1R7AA 3N13A 4WKAA 4MJZA 4GQ0A 2OSXA 2Q09A 3DKJA 3WH9A 4NJGA 2G3JA 1EJRC 3NL6A 3SR7A 4CN4A 3DHPA 1W1A1 1PBGA 3TP4A 2OTDA 3BOFA 3VGEA 2ZX7A 1IIHA 1LG2A 4M0XA 1HP4A 1XS2A 3GQYA 3QYQA 5I07A 1F6PA 1D8WA 1E56A 2DU2A 3KCLA 4FLSA 4GQGA 6REQA 1VIWA 1KTNA 2RGMA 3PZVA 3LERA 3G6LA 1XLEA 4IG2A 1QI0A 3MCOA 4XBJA 1TPVA 4LU0A 3VYLA 5A95A 1JULA 4ORIA 1CW2A 2ZICA 1ONEA 4KS0A 4K8GA 3EMZA 2DW7A 3RLGA 4NP7A 3UZWA 4UFHA 2TPSA 2OJPA 3CO8A 1J0IA 4INFA 1G94A 5HA7A 1JCLA 1PTGA 1SZRA 2GDQA 3OBEA 1ZAHA 1I2NA 2GVEA 4YXGA 4GO9A 3UG3A 2VMFA 4ZO7A 2VFDA 4G8TA 4H6RA 2WC7A 1A5SA 2XVGA 2D22A 2QCGA 4PMUA 3PJWA 4S38A 4WD0A 1RCOB 3L12A 2HRWA 3FYYA 4K1GA 4RXFA 1BFNA 4GY1A 3AS3A 3NQ7A 5FAGA 3IJ9A 3EWWA 4JIQA 1F2JA 2WJFA 3K13A 1UP3A 1MQRA 3QW3A 4XAYA 2BVYA 1JAKA 4DO7A 4H8HA 5TIMA 4A2RA 3SQLA 1ZENA 4MKVA 2QEZA 2OKTA 2UV8G 1ZGDA 3MYPA 4FK9A 4JTFA 3UYIA 1Y5VA 1H60A 5J8LA 4IP4A 4ALDA 4AD4A 4HVXA 4DBUA 3BW3A 1TG7A 5K9CA 1KFLA 1TTQA 1OVDA 3VUSA 6PTDA 3EX2A 1WDRA 1FWWA 2BMBA 1Q7ZA 1CX9A 1J9YA 3LGGA 3WJZA 2O4MA 3LI0A 1QDSA 2CWNA 3ARUA 1TV4A 1PZ3A 2A85A 4QCFA 1HJVA 1WV2A 4UUIA 1QOQA 3N2OA 4QLLA 3RUBL 2OO6A 3I3DA 2ZWYA 4ERAA 3WJYA 3QR1A 4IQEA 4S23A 2YFOA 4ZE5A 1F3WA 2FFCA 3JU2A 1FWCC 4ZSUA 1N2VA 2BXVA 4YTTA 4I90A 1ZSXA 2ESCA 3VM7A 1VEOA 2ZBTA 4DZ5A 2XVPA 1W3JA 2VX5A 2XIOA 4GI9A 1GTEA 3NSXA 1WXZA 2OFJA 4PCTA 3WDRA 1GOQA 2IKJA 1WDSA 4AZBA 5GJNA 3I4EA 4HPHA 2NQHA 3H12A 2G5WA 5AHIA 5AHNA 3HN3A 3FGCA 4XAPA 3V5CA 3S46A 3CZJA 4C7DA 2PDBA 3GKAA 4GJJA 4PCFA 1E6SM 2PFHA 3TAKA 3MKKA 4G56A 4L6DA 5HJXA 5A6JA 3S8HA 3RYSA 1LWHA 2GQ3A 5FF7A 3W74A 1D7KA 1E6PA 4JQ4A 1GJUA 1S38A 3MUZ1 3JRKA 4R5EA 3G1HA 1J12A 3IRSA 1XLLA 2PC8A 2IKHA 5HMEA 5T91A 1EPVA 3N6QA 3L4YA 4KCTA 1MO0A 1AW2A 3E1F1 3G5EA 1RA0A 3UD6A 3WK3A 1D8CA 1TTJA 4QQ3A 2BOFX 2V5CA 3NQ8A 2VRKA 3ZR6A 4TX6A 4H9MA 2EPHA 3QF0A 3WK0A 1W2VA 2VEPA 3POHA 2P3ZA 1ALDA 3H2AA 1XFBA 1QBBA 1Y7VA 2OGJA 4O19A 4W89A 3FHAA 3HMCA 3MJMA 4UQCA 1ESWA 3Q37A 5D2VA 1TUFA 3NFUA 3BV4A 4S3KA 4JFUA 1H0IA 2YR1A 1Y5XA 2GQAA 3WG6A 5G4EA 4LBSA 4QX4A 3VKJA 1JCJA 3FEQA 4QSHA 4CQBA 3PM6A 1TVPA 3APYA 2JGQA 3WBEA 5K4ZA 4H7VA 1HQTA 2W79A 1QI4A 3OQEA 1Z42A 2HS6A 2FVMA 4QEEA 3FOKA 4S2CA 2PD9A 3EB3A 2NT1A 4BWLC 1H7XA 2PWHA 1EBHA 2CLPA 3LPGA 1TCDA 4RDZA 4PUWA 4FS9A 2W91A 1LUCB 2HE5A 3LTPA 3WF2A 2QJMA 5HJLA 1Q45A 2PTYA 3A3XA 3CTLA 4JTHA 5D2WA 2W4XA 1WE5A 5H91A 3GYEA 3R1ZA 1HJSA 2X1TA 5C54A 1W9UA 2VOMA 5CPLA 3T8LA 4GO8A 5H2ZA 3P81A 4WF7A 2XDFA 2CBJA 4GJIA 5PTDA 1G67A 2VVSA 2I56A 4IMFA 1AJ0A 3B0UX 1RBOB 1V03A 2ZZ2A 5G5IA 3W7MA 2FJKA 3YPIA 1NWRA 2PSNA 2VURA 3S3GA 1KXTA 4UQAA 2OYLA 1JDFA 4IL2A 3KP1A 4LUSA 3AICA 3Q4DA 1E72M 4LS2A 3HQPA 1FFRA 1KLZA 2WCGA 1RJQA 2YYUA 1Q6DA 1GOOA 3N19B 3DBNA 4GIYA 1DE5A 4JTRA 5IM51 1B2YA 3WLKX 3PK7A 3WNNA 1A0EA 2VR2A 1KLYA 3BAIA 3MVTA 5IBXC 1JCYA 2XFRA 4DUXA 3GG8A 5HMFA 3EXTA 5BU9A 1TWDA 4GK8A 4UXDA 3E2SA 3VX0A 3H70A 3UZXA 4RE3A 4IIEA 4E4UA 1Q6GA 5LKYA 2IXUA 4O18A 4YHGA 3OGRA 1UOZA 4B5UA 4RZ5A 2GDUA 2A3EA 1UWQA 2DPEA 2G50A 4PTXA 1W3NA 4DWDA 2ZIDA 3LM7A 1DJHA 3M07A 5GQBA 3H2NA 2CLIA 5ABFA 3C0QA 1OT2A 3CHDA 1KRBC 1LRNA 4K7VA 3SCVA 3QR3A 3RM4A 2BNJA 2E9MA 3BXWA 3R12A 1E6XM 4QGCA 2NV9A 4YYCA 1E5JA 3R8GA 4AYSA 5IXEA 2I17A 4I5XA 5F2IA 4Q8OA 1W31A 3PBWA 2WNNA 3PNZA 4KWVA 2HBXA 3RF9A 4RNHA 4MZ8A 1TFVA 2P88A 4QDWA 4K38A 2QV4A 3N4EA 4QE5A 2PLKA 5G1MA 3SGGA 2ISSA 2HXTA 4ICNA 4PEKA 1ZHAA 5E5CA 1MUWA 3NM3A 4RE0A 4MY9A 2J7FA 5LZLA 4LUTB 3WLQA 2WO5A 1NH6A 4JTSA 1FWDC 5BYWA 3QH2A 4LW7A 2NVCA 1AD1A 3WQGA 2PDCA 4Q22A 2WOQA 4WHBA 3N3MA 3TKFA 3SY1A 1I4NA 1KTCA 4R7WA 4TOQA 3V36A 3QMSA 2VZSA 1NFGA 2EPLX 1US2A 1QI3A 2P3EA 4ZB0A 1GGOA 3DI1A 2C13A 2FJUB 4Q4SA 3EA3A 4DAIA 4ZXOA 1XBZA 1CGXA 5BNKA 3FCPA 4IJCA 4J2MA 4HPXA 4AZ7A