3CEUA

Crystal structure of thiamine phosphate pyrophosphorylase (bt_0647) from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr268
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
207
structure length
198
Chain Sequence
MKLIVVTTPTFFVEEDKIITALFEEGLDILHLRKPETPAMYSERLLTLIPEKYHRRIVTHEHFYLKEEFNLMGIHLNARNPSEPHDYAGHVSCSCHSVEEVKNRKHFYDYVFMSPIYSTYTAEELREAQKAKIIDSKVMALGGINEDNLLEIKDFGFGGAVVLGDLWNKFDACLDQNYLAVIEHFKKLKKLADLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiamine phosphate pyrophosphorylase
publication title Crystal structure of thiamine phosphate pyrophosphorylase (BT_0647) from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium target BtR268.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Transferase
total genus 58
structure length 198
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ceuA00
3Q94A 2OCZA 1JUEA 3TAKA 1KV8A 1QPOA 4OE7A 1F74A 4M19A 3SFKA 1T96A 3NQGA 2XN0A 3P84A 1NVMA 3UWVA 4IMEA 1EP2A 1OX4B 1R47A 4LRSA 5KINA 3DI0A 1VCFA 3W72A 4N9BA 4LS0A 2QUTA 4MY9A 2NV2A 3UYCA 2A7RA 3HG3A 4WOQA 1K03A 2QR6A 4TMBA 2H3DA 2IQTA 3TV8A 4JIQA 3OVRA 1GOXA 4N9EA 4UTLA 1LLWA 2ZTJA 3W7MA 2PC4A 4IXHA 1FWRA 3C6CA 2F84A 1M5WA 3G0UA 3B05A 4E2DA 3NPXA 4E2BA 3FYOA 1OFEA 2YFOA 3TQKA 3IGSA 2OJPA 2DORA 4CLMA 3L21A 3O07A 5C2XA 1TMHA 5HNRA 1WQ5A 3W74A 3HGRA 3DI1A 3OG3A 1VCGA 2ABBA 1FUYA 3IV3A 4ZQMA 1XC4A 2X1UA 2AAMA 4MJMA 4R53A 3UD6A 4UTMA 1X1ZA 2G97A 5TIMA 2EGZA 4UTWA 3G3DA 3VCRA 4LT9A 3N3MA 3R5EA 5DN1A 3MP4A 3TC6A 1F76A 3LTSA 3LTPA 1FDZA 3MW7A 1DVJA 4TU1A 2FFCA 1LP6A 2P1FA 3E12A 3TQ0A 3FKKA 4K7VA 1OVDA 2QAFA 3JRKA 2YW3A 1FWWA 4DO4A 1G4TA 3TSDA 4Q32A 1Z41A 5AHEA 2EPHA 1HUVA 4NZJA 2VFIA 4ADSA 1C9DA 3W1PA 3IVTA 4H4IA 3KVKA 3H55A 3Q37A 5D30A 1G67A 2R14A 1SU5A 4CNNA 4L4MA 1JULA 3CHVA 4MUZA 1I8JA 4HIBA 2WPBA 3CEPA 4LVFA 3W7EA 1CX9A 2WSYA 4NXSA 1F05A 1SW3A 1XDMA 5HWNA 1JCYA 1C8VA 2J9XA 3TSBA 1K8ZA 1GVFA 1N55A 2A1YA 1A53A 1MEHA 1TJPA 3W1LA 1ME9A 2Y7GA 5AHIA 1OX6A 1EA0A 4M7TA 4N6EA 1TTQA 1B57A 5IBXC 3W86A 1W5MA 1XBXA 1S3HA 1TPB1 5BRBA 1FCUA 1LROA 4K36A 3E02A 1G6CA 4MZ8A 2J6XA 4MPQA 4U4MA 4MVAA 1VGAA 3M16A 2YCEA 5EY5A 1F2JA 1L6SA 4E0CA 3FYPA 1O95A 3P61A 4FXRA 1ZENA 3CC1A 3W07A 2DZSA 5CZSA 1X7FA 4JDBA 3I68A 4ALDA 1W1ZA 3PY2A 3RU6A 1WXJA 1YTDA 1L6YA 3NXFA 3V1PA 4DF1A 3C2VA 3NOEA 3CIWA 3HO8A 2J9YA 5EPDA 1OFDA 2WV8A 4OGZA 1W8SA 4JS3A 1YDVA 2BTMA 1GTHA 2C3ZA 1LM1A 4NNBA 3LLFA 1LCOA 4NX5A 5H2ZA 4KWVA 4DF2A 4TO8A 3T7VA 4ZZ9A 3S1VA 2BX7A 1SZGA 1RZMA 4MY8A 4TR9A 1ZHAA 4RZ5A 4HNUA 3PUEA 5LKYA 2VFFA 2Y62A 3CB8A 2A2IA 3U8GA 1GPWA 1I45A 3NR0A 5AC6A 2RDUA 3EEGA 1Q6OA 3W6YA 2ZCGA 3QC3A 1ZY9A 4IX0A 1B4KA 5KITA 3W2JA 1VLIA 2GVGA 3IIPA 3O15A 2X1RA 4RZ6A 3KVLA 1TYGA 2GVLA 4WY0B 2Z6JA 3W7JA 3BGJA 3LXBA 1YPIA 3A23A 5AYYA 2ALDA 2ZZ5A 3S8HA 2O7SA 3PVFA 4LRTA 4BI5A 1JUBA 1TPH1 3QMRA 3W1UA 1FQ0A 1PHQA 2X30A 4IGHA 2WSQA 3LI1A 3PF3A 1FCBA 4ZQCA 4GWEA 2FPTA 3PBYA 2WNZA 4FXSA 1KM6A 2Y7DA 1OK4A 5FF7A 4LUJA 4YXGA 1NFBA 4N02A 2BWGA 4JX6A 1DOSA 2R91A 1TTPA 1PVNA 2BSLA 3EXSA 3SZ8A 2EAWA 4JTSA 1GEQA 2JKPA 2EKCA 4JR5A 4JXCA 3HG4A 1LOQA 5CPLA 1OFQA 1W54A 1WOBA 1YDNA 2NXHA 4FIQA 3BO9A 3PR2A 1IXPA 1GWJA 3IIVA 4AF0A 4A2RA 3N9RA 3TW7A 1X1OA 3T78A 3ABQA 4XUGA 2RDWA 4Z1DA 3RMJA 2C14A 2V82A 4O1BA 3UWYA 3KVJA 4Q4KA 5KZEA 5EBUA 5K9CA 5ABTA 4JTUA 4O17A 3S1XA 4UTTC 3NPUA 4WD0A 2E6DA 4JX4A 4WQ6A 4IMDA 3LI0A 3HMJG 5LNSA 3W71A 3G1AA 2E68A 4O8RA 5HUPA 2PE4A 3H53A 5HWJA 3W1MA 2CLKA 1UCWA 3DGRA 3A22A 4Q33A 3W75A 1XCFA 4BWLA 1YPFA 3RLVA 2FIQA 4IJBA 1M7PA 1H61A 3W87A 3DH7A 5LNVA 4MYXA 3QSTA 3U2OA 1KBJA 4RX0A 2G95A 3C56A 3NL3A 4TIMA 1D9EA 2A5HA 1TPVA 1AK5A 3DFQA 4QISA 2VC6A 1H7PA 4A3UA 5I3FA 1KM4A 1ZFJA 1H1YA 2B7QA 3P62A 2C15A 5FEWA 1NSJA 1SZNA 4IPJA 3B0VC 2FDSA 4RXGA 3EXTA 3G1FA 2BLEA 1Q6LA 4Y90A 1K3UA 1JCLA 2B7PA 4CQAA 1KFLA 4O28A 3I7QA 4XZ9A 1IXOA 3WJYA 6ALDA 3UWUA 5I3HA 3G3MA 3PAJA 1QR7A 3W1AA 3FLUA 4XTIA 3W7KA 4FNSA 8TIMA 2JBMA 1QPRA 2VOMA 2A7NA 2WSRA 1VYSX 2DZVA 1PCKA 4FIRA 4JTIA 4W9TA 1AL7A 2JKAA 2NUYA 4G1KA 4UNKA 2V2HA 3OA3A 2ZRVA 5D2TA 2E5DA 3PM6A 3DBPA 2Y70A 5E1QA 4JX5A 4U28A 4BK9A 2ISVA 2PCQA 2RHGA 4JGDA 4PL2A 3ZWTA 5E93A 2V5LA 2C0AA 3TA6A 1R2RA 2P0OA 4FX8A 4LTSA 1GJPA 3IVSA 1GVSA 5F4SA 3LM7A 4O13A 5D37A 3G1XA 1AW1A 4O12A 1PL9A 3GR8A 1EWEA 2V81A 4ICNA 5U7SA 3W3OA 3CLMA 1GQNA 5KMYA 3K30A 1W5QA 3MWAA 4AHOA 4EWND 1TV5A 2B7NA 2QCFA 4LV4A 3W2LA 4RV8A 2WOQA 3MP5A 3MUXA 4X9SA 3QMSA 1TPUA 3JR2A 3EWYA 1EEPA 3NNTA 3NDOA 2H8XA 4FX7A 2W79A 1W37A 1VH7A 2ATSA 3WK0A 3MYPA 1X8FA 1LOSA 5IBXA 4JYFA 3UY8A 2VFEA 2C6QA 3QYQA 2W0UA 1MXSA 4S1FA 2WNQA 2ZBTA 1QFEA 2YYUA 3SGZA 2QCCA 3ATYA 3E0IA 2C18A 5K9XA 3BK0A 3DHFA 5D02A 1B4EA 4JTKA 1E51A 5K3VA 1VRDA 3P5ZA 3Q2DA 3UNDA 1TQJA 3DFTA 3W1NA 1P0KA 4I7UA 2ZZ3A 3HGSA 3P74A 2PRHA 5G4EA 4QQ3A 3HG5A 3SGUA 3LV6A 4MFEA 5DCDA 3M5VA 2NXIA 3AO0A 1PHWA 1ONRA 3BPWA 1Q6RA 1VHCA 1RQEA 3TU9A 4QM1A 2CZEA 1ME8A 2V2CA 4M6VA 1ICPA 5G5IA 1Q3NA 4AWSA 2XFWA 1QO5A 3BLEA 1MEWA 4GC4A 2WQPA 1VC4A 5U4NA 3N19B 1MO0A 4FNRA 3UQNA 2YR1A 2BZNA 1QNVA 2QUUA 2ZYFA 3O6DA 4HSNA 3THQA 5F1VA 1LLZA 4A2SA 1EP3A 2HTMA 3W76A 1BTMA 5DBTA 5D05A 1SO4A 4KFNA 1VPXA 1LRQA 3GZ3A 3W73A 3EWXA 1TSIA 4HNVA 1O60A 4MIMA 3MYOA 3LHUA 3UWWA 1HTIA 1XUZA 5D03A 2QCNA 3TW6A 3T44A 1TRIA 1G69A 3HQ1A 1TV7A 2DZUA 4UTIA 1I2QA 3NYZA 2CLOA 4RLIA 4DPQA 2ZZ1A 1DJQA 5FEXA 3UWZA 5G2IA 2Y89A 3LCWA 3I6RA 4RXFA 5LSMA 1TREA 2GQ9A 3GX9A 2QCEA 3HOJA 2X2GA 1ZAJA 5AOUA 1P4CA 1SZEA 5LNRA 4PCFA 4ZVJA 3SJ3A 2NLIA 2ZRWA 2QJIA 4IX2A 4PFMA 2CWNA 5HUOA 2FB3A 4LS2A 3WK2A 2VEMA 3S42A 4AHQA 4Z1CA 4O0KA 4XKYB 5AHNA 4PODA 3TC7A 4X22A 3R8RA 3LBCA 3L5LA 1OABA 3G0SA 3LHZA 4DELA 4QITA 4YLWA 4AXKA 3PSVA 5BW6A 4JD4A 4YL2A 3G0XA 1HG3A 3ELFA 2R94A 3NQEA 4R7JA 3LCGA 1DKWA 1UUMA 1KLZA 5AHFA 4HT3A 3W2KA 5LNUA 3L68A 3BARA 3NQ8A 1T0OA 5KSWA 3B04A 3G1HA 3NPVA 1KTCA 2Z6IA 1XBZA 4UTTA 1ML1A 3PC0A 3N9SA 4GBUA 2ISSA 5CPOA 3LXAA 2ZTKA 1H63A 2E5BA 3M47A 4DBEA 2VFDA 5FF3A 5EL1A 2QCMA 4NX0A 5CSSA 3PS7A 5D2YA 5EKYA 3USBA 1GG0A 3LCXA 2HMCA 3NPWA 4KFPA 3SECA 1XDLA 2ZA2A 4WY0F 1QWGA 1LORA 4K7YA 1H1ZA 3MI3A 1T8XA 1VHNA 3NZ1A 1FDYA 1SQ7A 2Z2UA 5CKSA 5A8GA 3I7SA 5L6UA 2E09A 1TPWA 4NJGA 2HS8A 4GNJA 4QSHA 1XKYA 3S5ZA 4AMAA 3C0JA 3WJZA 3RNDA 1K7XA 1PIIA 2AQWA 3OVQA 5AC7A 1WBHA 1AW2A 3BLFA 3KAOA 4EF9A 2ZZ6A 2CZ5A 4O1CA 1W3NA 4PL1A 4PH6A 4OU1A 4YCOA 1J4EA 4O11A 4AH7A 4UFKA 1XUUA 1GT8A 3DKLA 4RR4A 3EX3A 3TJXA 4CNPA 2QJHA 4WY0A 3NL5A 4N9DA 2A85A 1SO6A 3L0GA 3W2NA 4N4QA 1M6JA 2F7FA 5D33A 1OFAA 4N9CA 3RLUA 4RKAA 3LHTA 4GUFA 2H6RA 4OWGA 2WKJA 2QCDA 3ZFHA 2R8WA 2RFGA 1N7KA 3PBWA 2Q3OA 4HHPA 1SW7A 3A21A 3GNDA 3W70A 3MI6A 5CZJA 2CU0A 4FX6M 4JTJA 5GVJA 3LXCA 1F5ZA 1FCVA 1KFKA 3A5VA 1FWTA 3O6YX 1AL8A 4D2JA 1HO4A 3BV4A 1K8XA 2DZPA 3DZ1A 2ZQ0A 2Y7EA 4EF8A 4NVTA 3VKJA 1ZAHA 3M9YA 3PG8A 5CPNA 3S5YA 3GLCA 1XXXA 2ZZ2A 3M7WA 4M6PA 4KKXA 1MSSA 4EIVA 3EWZA 4O4WA 4FEZA 4CQ9A 1V7YA 2OZ0A 2LLEA 4OV9A 5CG7A 4NNCA 4J9JA 4BR1A 2E5CA 5AYZA 3M5XA 4HKPA 1XM3A 1KFBA 3P81A 3NAVA 5F2MA 2I14A 3UPBA 4JY9A 1RV8A 1R30A 3M43A 3FEMA 3B0PA 1KM3A 1L9WA 1DJNA 3VI2A 4LWWA 1FX6A 1R2TA 3NQ6A 1K7FA 3GXTA 3BG5A 5AC8A 5MHBA 1SO5A 4A21A 5CPMA 4ZQPA 3ABRA 1SFJA 3LRKA 1MEIA 1O5XA 4JTEA 3F4WA 1YXDA 3QMTA 4O15A 1G7VA 4O19A 3TSMA 4EVZA 5G2WA 2DZWA 4IMGA 1WAUA 1XFBA 3LDVA 5HINA 4S2BA 2YZRA 1GTEA 3WK3A 3VFLA 3HPZA 4OT7A 1GVQA 3HG2A 1ME7A 3QQ1A 4LVDA 3G24A 1TPEA 3CPRA 5FEPA 2A0NA 3C2FA 2V8ZA 1RPXA 3O06A 5AHMA 4DEFA 4JTTA 4GUHA 3R13A 4Z1BA 1P1XA 1F6KA 2Y7FA 1ZJIA 5G1YA 1U83A 3UPWA 5K9DA 3TR2A 4JTLA 1YLVA 1TTIA 7TIMA 3PUOA 1A5BA 2E6FA 3GDRA 1O94A 2C16A 1LYXA 4IPIA 1PE1A 1YADA 2GOUA 3RK8A 4ZQOA 1UJPA 5DY2A 2FLIA 3CT7A 3FJLA 2YXGA 3W85A 3FS2A 3BG9A 1KW1A 4NJJA 2AGKA 2QCHA 1OG0A 3TAOA 3HGJA 2WJZA 3B8DA 1RVGA 2Y85A 3TQVA 3MHGA 2NUWA 3ATZA 3S1WA 5C54A 3BG3A 2E6AA 4O1DA 4Y96A 4E38A 3PB0A 2Y61A 3LOTA 5IM51 4JYEA 1JRBA 3S9YA 1FWSA 4DO6A 5LHFA 3THAA 4HPXA 3MJYA 5KZMA 3W1RA 3LCFA 5LGXA 2CLHA 5EYWA 3B4UA 1WV2A 5F1UA 3DHDA 2DZTA 1I2PA 1U5JA 2ABAA 2B0MA 2ZRXA 2Y6ZA 4TMCA 3KVMA 3M41A 4UTWC 2VEIA 1IIHA 4WXZA 1H50A 4LC8A 4MLRA 4C1KA 2ZRUA 4K37A 3GB6A 1G4EA 2EHHA 1BWLA 4LW7A 2TYSA 2YX0A 1ALDA 4JNMA 5C5YA 3GDLA 2JKEA 3P67A 4IWWA 2NXGA 4AWTA 4IUOA 3GNNA 3O05A 3KHJA 1RQBA 1RQHA 1EIXA 5K4ZA 1VLWA 1ICSA 1UBSA 5G2HA 3STCA 3FJ6A 4O52A 3N2MA 4UCGA 5D09A 1JCMP 2FJKA 1LZOA 3L66A 4DO5A 1QPNA 3MI2A 2NWSA 1GVOA 1VYRA 3EWBX 3G22A 5K7JA 4M5PA 5AYXA 1G7UA 2WO5A 4O54A 3EX2A 1QPQA 3FFSA 3M5YA 2ZRYA 3NM3A 2GVJA 1SSGA 5BOOA 5D2VA 3UXAA 1XBVA 3EWWA 3UZJA 2PRLA 3EKZA 1OF8A 3P8JA 1RD5A 4Y9AA 4NQ1A 4ZQRA 5DXYA 3DFNA 3L0KA 2GPTA 4PTNA 4FNUA 4C1LA 3TMLA 5D2XA 2JK2A 2H90A 3KOFA 3E49A 5F4WA 3DAQA 2NZLA 4LS1A 1OFBA 4ZQNA 5D32A 3QQ0A 3SY5A 3F1QA 3G18A 5AHLA 1VR6A 3W1XA 4R34A 1H7XA 2C19A 4O1AA 5I3JA 2E1DA 3T4CA 1LBLA 1TPFA 2YPIA 4NT0A 3PUDA 4CCDA 2YYTA 4EOUA 3YPIA 5T26A 2G5WA 1NEYA 3QF0A 3SSJA 4WJEA 4GJ1A 3I7RA 1DV7A 1X6UA 4K38A 3TIMA 2VENA 5FF2A 3P8IA 3ABOA 2KZHA 1HL2A 1KV5A 3AJXA 4Z1AA 2UV8G 3SW6A 3STGA 5FF4A 4IMFA 5DY3A 4K6AA 2NX3A 3EWUA 3G8EA 3NL2A 4XTDA 1DBTA 2RDTA 3PBVA 2BXVA 1EX5A 1KFJA 3W7PA 3QPYA 4LVBA 5I3IA 1I2RA 3TUUA 1FXPA 3RF9A 1GYLA 2QCLA 3EX6A 3MHUA 2D73A 3R2GA 1B3OA 4LC6A 3W1QA 3DFOA 3EX4A 4HN4A 5J5RA 4LUIA 1IXNA 2ISWA 2TSYA 3IVUA 1K8YA 5D04C 5FEZA 3NG3A 3PULA 4UXDA 3BW2A 4CCCA 5AFDA 3GIYA 1OF6A 2PURA 2GJNA 1OX4A 3DENA 4QNEA 1G4PA 3UXDA 4UFMA 4FB7A 2X16A 3NQ2A 5TBOA 1H7NA 4JDYA 4XKYA 5E0KA 4I9AA 4RK8A 2NUXA 1R46A 2ZA1A 1A50A 4XBSA 4UFIA 3EXRA 3DXIA 3QW3A 1DHPA 5I3KA 1H5YA 4FNTA 3INPA 4A22A 4XWUA 5F2IA 3PSWA 3PB2A 3S5NA 1B9BA 1SFLA 5D2WA 3LRMA 2GQAA 3FOKA 4QIUA 3L5AA 3L0NA 1UASA 1UB3A 4UTHA 4JN6A 1GVRA 4JYDA 4GUGA 3QJAA 1XL9A 5K2ZA 2QJGA 1NAL1 3NQMA 3VE9A 3TK7A 5EMUA 3LERA 2J27A 1OFRA 4UFHA 4HSOA 4O57A 2JGYA 3SI9A 1QDSA 2E6YA 1TPDA 3LHWA 1OHLA 2OT0A 4WOZA 3GVGA 4AEOA 1FCQA 1W56A 1W0MA 3GXNA 2V0TA 2QUVA 4GUIA 5AN7A 1WA3A 4UFLA 1H62A 2YW4A 4KFOA 3G1SA 5CSRA 2Q8ZA 3IIXA 1OYAA 5HMSA 3QSRA 4QAIA 1J5TA 2ZA3A 3TNOA 3P80A 1JUKA 4WUIA 3WJWA 3W7QA 3ABSA 1QCWA 4O10A 1VCVA 3NO5A 4LVAA 5K4XA 1YTKA 4IQLA 4RZ4A 1LTDA 5C6MA 2NV1A 4XBKA 1A5CA 3KXQA 5F4XA 1JCXA 4BWLC 3LCHA 5EA9A 5HQEA 2Y88A 1BEUA 1A5AA 4K8EA 3KFTA 3TCEA 3TH6A 1TTJA 3ANYA 2X1SA 2NX9A 3HB9A 5HULA 2JGQA 3W84A 3R12A 3L65A 3O6CA 2A6NA 3WJSA 3WJXA 4JTGA 5G1TA 3TXZA 1L6WA 4GFSA 2FQIA 3NQDA 4S2CA 4UNLA 2Q3RA 1A5SA 1FY6A 1TO3A 3HGOA 1IIGA 1BWKA 1KTNA 3HIJA 2QEZA 4KWWA 2CW6A 4UUIA 4MLJA 2ZZ4A 3W22A 1BKSA 1M7OA 5SWUA 4OHQA 1TB3A 1GG1A 4CNOA 1WDWA 4JICA 2YFNA 1KFEA 2RH9A 3IGUA 3W7HA 2A4AA 4MJZA 4HNTA 2FPVA 2X1TA 4PC8A 1FWNA 1EPXA 2ZRZA 5H91A 2J9ZA 1TV8A 4MFDA 3A24A 5HR7A 5BMWA 1JQXA 3C2OA 5KZDA 3L5MA 1SO3A 1VQTA 3HPXA 1QOQA 6TIMA 5F2GA 3B0UX 2DP3A 2VEPA 2QF7A 5LNWA 4UMAA 4UFJA 4LY8A 1LOLA 1ADOA 1Y0EA 3L2IA 3CWOX 4DBDA 3OEXA 4X2RA 1KBIA 4OQVA 3M5ZA 3CQ0A 1TRDA 4LU0A 4DPPA 1H7RA 3GDKA 3O1NA 1D3HA 3F03K 4PA8A 4M6QA 3GDTA 2PRMA 3E96A 3W7IA 4Z08A 2V9DA 4HPJA 1JJKA 1W3IA 1F7BA 4Y6GA 1K7EA 4GE8A 3OHIA 3UWQA 4FNPA 2ZFAA 2CFFA 2CZFA 4DXVA 4MYAA 1Z48A 2B4GA 3IRDA 2O7QA 1LBFA 4HNNA 3TDFA 4ORMA 3O63A 4MY1A 4UTJA 5CZ0A 3KRSA 2GUUA 3VNDA 4FF7A 4ADTA 1DORA 4QNWA 3HPSA 3P7YA 1J2WA 3CEUA 1YTEA 4AWUA 1OYCA 5DXXA 2OX1A 3NQ7A 3W7CA 2J24A 3KX6A 4UMCA 5LGZA 3MHFA 1OFPA 4AB4A 3CIXA 1R2SA 1P5BA 2XN2A 4O0ZA 2GQ8A 3G1DA 3C8FA 1HO1A 2C13A 4MKNA 2VFGA 3G8RA 3BW4A 1LDCA 4O53A 1IGSA 5C55A 4NJIA 1KM1A 4OBTA 2CLIA 3C52A 3GKFA 1AMKA 3BVJA 1I2OA 4Z0SA 1VS1A 1C29A 3UY7A 3ZS4A 3P82A 1Z42A 1ZALA 3BLIA 3LLDA 1JRCA 1GYNA 2VKZG 3C2RA 3QM3A 1JR1A 4PEKA 1AW5A 1N8FA 1ZNNA 4K8HA 3P5YA 2CLMA 3L9CA 3OVPA 5DCEA 3EB2A 2WNNA 4X3ZA 3SIZA 3KRUA 3LRLA 3VE7A 4O4VA 3HBLA 3QPZA 3EKLA 1QOPA 4WZHA 3JS3A 3GYEA 4N4PA 5CGQA 3S0CA 4NXKA 1PV8A 4MZYA 3OBKA 1F73A 3CWNA 2YDAA 3GK0A 4LOCA 3S6DA 1H60A 2TPSA 3IIZA 4Z0JA 3G1VA 2V30A 4UMBA 4H3DA 1KM0A 3M6YA 3S5OA 2A21A 5FI8A 1TQXA 4LVGA 1LRTA 4K39A 4TX9A 1UUOA 2EF9A 3M0ZA 5LHEA 3W83A 2CZDA 4GXMA 1YXYA 3TMQA 2H8ZA 5AB3A 3HF3A 2H3BA 1SR9A 1W31A 4FNQA 1THFD 1D3GA 3B03A 2QCDB 3IEBA 5CZTA 1O5KA 4GUJA 4B5NA 4CCEA 3DU0A 1Q6QA 4Y8FA 5BNKA 3D0CA 1OFOA 1LBMA 3WK1A 4O18A 1V5XA 2OMAA 3W2UA 3EX1A 4JIPA 3QW4B 4ML9A 5TQLA 4UTUA 4JEQA 1QMLA 1EWDA 1G4SA 3W7OA 2J88A 2YSWA 3MBFA 3W7DA 5DELA 1SPQA 4DQWA 3NQVA 3QRHA 3DFPA 3U6WA 1KTBA 3LCLA 3NQAA 3NQCA 3O8AA 3MP3A 1TPC1 3FIGA 4WXYA 1ICQA 3HJZA 4WX2A 2VXNA 1JQVA 4BI6A 4RJEA 5I3GA 4OV4A 4JTFA 1NF7A 2B7OA 4JTHA 1AG1O 2DZXA 4IXXA 1TJRA 3NM1A 2GJLA 2YGYA 4IOTA 3STEA 2QDGA 1VYPX 5HR6A 3C4UA 2V2DA 3LHVA 3T40A 1JVNA 1HFBA 4IMCA 3FA5A 1FBAA 3NGJA 3CTLA 2G96A 2Y63A 4ORIA 2RKXA 2Q8LA 5DCBA 4LNYA 2Z0IA 1DL3A 3LV5A 4P61A 3TXVA 1SSDA 1RR2A 3TROA 1KA9F 4H6KA 3A9IA 2ZDRA 1DQXA 4YCPA 4MOZA 2HS6A 3F4NA 2QAPA 4NU7A 3PBUA 3FKRA 3B06A 1WYIA 4YWIA 3LX9A 3DFSA 1S5WA 3TKFA 1FXQA 3N2XA 2CLEA 2P10A 3P60A 3MBDA 1KFCA 3I65A 3LHYA 1EUAA 5DLCA 1QAPA 5G4WA 3TFCA 1K02A 1T99A 4R33A 1OJXA 3Q58A 3NL6A 3W88A 1PS9A 1W5PA 2Z1BA 1IXQA 2C1HA 1QO2A 4AF0B 4RCXA 3QZEA 2DU2A 1SW0A 3NZRA 1S5TA 2OT1A 4FO4A 5L9FA 3S1UA 3G1YA 4O16A 4NJKA 4FHAA 3PG9A 3GAKA 1DQWA 5D38A 5KTLA 3M1ZA 3OIXA 5J5DA 2XN1A 2TRSA 1WX0A 3W1TA 2QKFA 3KRZA 2ATMA 4XQ6A 4A29A 2VELA 3H54A 2W6RA 3QFEA 2V5BA 3W7GA 4UTKA 2A6LA 3QEZA 4UR7A 4AHPA 1EUNA 4LV9A 5F2LA 1S5VA 4N6FA 4ONVA 3W7NA 3LB0A 3N73A 1XBYA 1Z44A 1ZCOA 3C2EA 1W3TA 3TE9A 3WFAA 4L4LA 4P2VA 3N34A 4ADUA 1H7WA 1GZGA 1VJIA 3GAYA 4BF9A 3M44A 3W2MA 5FESA 1WOAA 5HWMA 2A7PA 1H51A 1OYBA 1YYAA 3GDMA 1EP1A 3W7RA 1VZWA 2QCGA 3LTYA 3T55A 3TJLA 4O50A 1H7OA 3V75A 4GRSA 3C61A 3IGXA 1L2UA 3ZWSA 3TFXA 3LBMA 1YXCA 4UIOA 3C3NA 3BW3A 3A5FA 4M7SA 3NEVA 1OK6A 3LCIA 2DJXA 3CM4A 5FF0A 4UC5A 2FTPA 4NNAA 3UZ5A 1LRNA 1SUXA 4BI7A 3NA8A 2NX1A 4N2YA 3L67A 4O14A 4MZ1A 3LGEA 1OX5A 3IIOA 2FB2A 3GR7A 3W23A 3O16A 2NWRA 4BFAA 2FPYA 2I9EA 4CQ8A 1P0NA 4QJ1A 4POCA 3W7LA 1W5NA 3R89A 1Q45A 3CU2A 3E9AA 4I7WA 2DJLA 3TX9A 4UR8A 2VEKA 2ZZ7A 3STFA 5LZLA 4DF0A 1JCJA 1FDJA 1W5OA 1MZHA 3ZR4A 5A5WA 2CLLA 2CLFA 4NUWA 1I4NA 3RFAA 1CI1A 4YMZA 3W9ZA 3NQFA 1JCNA 3GXPA 3SR7A 1TIMA 3MO7A 4NZFA 2I1OA 3DKJA 4AVFA 5HJLA 1IF2A 1CW2A 1O4UA 1F6PA 4ZMGA 1NF0A 4AAJA 1YDOA 3N14A 1EB3A 2HSAA 1I2NA 1WBJA 1KM5A 3PWAA 5DBUA 3BGGA 1ZAIA 4JY8A 1KM2A 4ZL1A 4I7VA 2VFHA 1XI3A 3GKAA 1PCWA 2TMDA 5BMXA 3MMTA 2E77A 1SZFA 3NVTA 1TCDA 4NJHA 3QH2A 2QDHA 1KLYA
chains in the Genus database with same CATH superfamily
4R7WA 1VJSA 1A5LC 1F74A 3OLIA 4E4PA 3CWHA 3CZJA 1OX4B 2CC0A 1SR0A 3W72A 3BCJA 2X2YA 1HKIA 4MWAE 3PZNA 2QUTA 2NV2A 2VC9A 1A5MC 3N25A 2QT3A 4RDWA 5CC6A 4RDVA 1EL3A 1K8CA 2INEA 3LPOA 4GY1A 2J8TA 4B9YA 2PGRA 2YA2A 2PC4A 2FVLA 4IXHA 3C6CA 1M5WA 4D6JA 3VDGA 3WLMA 2GGGA 1CIUA 1E73M 4E2BA 3TQKA 3MANA 1BSLA 3KBNA 4CLMA 1YBQA 1FFQA 3H8AA 1KXTA 3O07A 3ALFA 3G2GA 1YE4A 3V7PA 4OBRA 5CZKA 3VZYA 2X1UA 5FAGA 1E71M 5TIMA 1B1YA 3REQA 4HNLA 1MMFA 7ODCA 2FFCA 2P1FA 3K4DA 3TQ0A 3URAA 1AH0A 4K7VA 3PZMA 3VGGA 2YW3A 5B80A 1FWWA 3TSDA 5BXRA 3ONBA 4ZOAA 5AHEA 2VFIA 3CHFA 4ADSA 3IVTA 5HMEA 5M17A 4J2MA 1W9DM 2ZX7A 1XHGA 4AIUA 4JFVA 1G67A 2R14A 1JULA 4MUZA 1UROA 2DQWA 4NXSA 3WKZA 1F05A 1JCYA 1K8ZA 4MB1A 1A53A 1MEHA 1E9YB 2GSJA 4HNCA 1OX6A 2WCSA 1TTQA 2DSVA 5CPSA 2OG9A 1W5MA 1XBXA 2V3EA 1EYWA 1XGDA 1HXJA 3E02A 1IEXA 4TXEA 3W53A 1J0JA 2RAGA 4MPQA 3RG6A 5EY5A 1VGAA 4PSPA 5HOSA 3P61A 5C9XA 3FCPA 3W07A 1ZLPA 2DZSA 3WD4A 3U57A 3WLOA 3PK7A 5H8MA 1YEYA 4JDBA 3I68A 5HJYA 3SCTA 1G01A 1YTDA 3NXFA 3V1PA 2GZXA 2ZX9A 2HEJA 2WV8A 2PDYA 3UT0A 4D6EA 1W8SA 3N4EA 1J93A 2YL5A 2BTMA 3ZVHB 1GTHA 4IGSA 3VD3A 2FHCA 1LM1A 1C92A 1LCOA 4O8AA 3C0SA 1H3GA 2E8ZA 2DH3A 4TO8A 1IEIA 1JZ5A 1G94A 2OGJA 2BX7A 3KL3A 4EPBC 2WKGA 3MUY1 5RUBA 4HNUA 1PDYA 3WDHA 2WANA 2VFFA 2A2IA 2OYMA 2OB3A 5PTDA 1IEVA 1T40A 1GPWA 4GGHA 4DI8A 3N17A 2RDUA 2GK1A 3EEGA 2GVGA 2HNEA 3T2OA 5DO8A 1OC6A 1TYGA 3KVLA 2Z6JA 8CGTA 4WKAA 2NVCA 3AIWA 2XVNA 1JUBA 1ADDA 1EQPA 3DYOA 4HZ6A 3HV8A 3CPUA 4DUVA 3VX0A 1FCBA 4L64A 1S39A 5CBBA 2WNZA 2Y7DA 4N7QA 1M53A 4YXGA 5BCAA 3I3BA 1NFBA 4N02A 2D1ZA 2NQLA 1PVNA 2BSLA 3ARRA 4L7ZA 2Y24A 1UA3A 2F61A 4JXCA 2D69A 1OZMA 3S2MA 3HG4A 4B92A 3AHYA 3OW1A 1LOQA 2EJ1A 4LB4A 1RALA 2B31A 3RMEA 1ONWA 1UR1A 2ONEA 1K77A 4U31A 4L6HA 4FAMA 2NW0A 3CQIA 1CXFA 4XUGA 1QPKA 1XQLA 2DEPA 4Z1DA 4HHMA 3KVJA 7ENLA 5M2FX 5I77A 2A3EA 4AX7A 5ABTA 1DPMA 2ACUA 4E8GA 3NPUA 4CQDA 2E6DA 4WHBA 5LNSA 3W71A 2E68A 1NTHA 2ZX6A 5HWJA 1DJHA 3W75A 1XCFA 4IIEA 4BWLA 1X7IA 3GNOA 4H9TA 2HK1A 1M7PA 3W87A 3QSTA 1TVPA 2NQ9A 3C56A 1WZLA 2IQ0A 2QPSA 4R3UA 5I00A 3DFQA 2CNCA 2VC6A 1H7PA 2NVAA 4G8TA 4A3UA 1H1YA 2B7QA 2V63A 5CC5A 4GBDA 4IPJA 3B0VC 4RXGA 4XAZA 4TTUA 2B7PA 4CQAA 4O28A 3UG3A 4XZ9A 2VT0A 3WJYA 1BTCA 5I3HA 3G3MA 1PJ9A 2XM1A 3QQWA 4HSHA 4KGJA 2PLJA 1UD3A 3ANUA 3BOLA 3W7KA 4O0QA 3ZVIA 1MFUA 2VOMA 1GJWA 3RHGA 4JTIA 1UWAA 1YW1A 2XFYA 2UY3A 2JKAA 3R11A 4A6GA 3P0WA 2ZRVA 2E5DA 3PM6A 4FK9A 3DBPA 4HCHA 5E1QA 2GGHA 1EO5A 3GTXA 4ZTYA 4MHBA 4BK9A 2RHGA 1XIGA 3ZWTA 4K68A 4FXFA 4DM2A 4GVIA 4DUWA 1YIXA 5F4SA 2D0GA 3T8QA 1A49A 2WMJA 3G1XA 4O12A 2UY5A 2SFPA 3CLMA 3AZSA 5KMYA 1JNDA 4IFOA 3MWAA 5FL1A 2QCFA 3CS2A 3MP5A 3MUXA 4X9SA 3QMSA 2FJUB 3VGDA 4CD6A 3JR2A 4FF5A 4EANA 2W79A 1W37A 1VH7A 4CCZA 2ATSA 2O56A 3RM8A 1IT0A 5FJIA 4J3VA 2W0UA 4L9ZA 2EJAA 1KNWA 2O9TA 1ZBWA 3ITGA 5K9XA 1B4EA 1BF2A 1ELSA 4GZ7A 5K3VA 1CLKA 3M6DA 5HNNA 3P5ZA 1A3XA 3UNDA 2A3LA 1NP0A 2EPKX 1W1PA 2VWTA 2F38A 2NSXA 3R0DA 1KQZA 1NWSA 1E0XA 3ZXWA 3P74A 2PRHA 5I6SA 1BRLA 1EYEA 4E3TA 3M5VA 1XPGA 1VFLA 1XLMA 4IFRA 1PHWA 2WVVB 3BPWA 4ZOCA 3W82A 3TU9A 1UR0A 4W7VA 1FRBA 2CZEA 1V3KA 3S5SA 2HVNA 3AI0A 2XFWA 1QO5A 3EOOA 4XKMA 1EBGA 4A35A 1E9IA 3UU0A 4LAZA 1O12A 2POZA 2VD9A 2ZYFA 3O6DA 2ZX8A 4PCPA 3KCLA 1PIGA 1CEOA 4ROQA 3SURA 1EIBA 3W76A 1BTMA 1SO4A 1VPXA 3GZ3A 4L9YA 1HVXA 1TSIA 4HNVA 4J28A 2QZRA 2BOFX 1HTIA 3OHMB 2VYOA 3PANA 4CU6A 1TJ1A 3SCRA 4E3VA 1HKVA 3T44A 5JIWA 1G69A 1TV7A 3QV9A 1VFOA 4MWAB 2CLOA 4RLIA 1OGGA 5FJRA 5FEXA 2WSPA 1JGMA 4DNMA 2IPJA 1C7TA 4RXFA 3CL8A 4EK7A 1XH1A 2GQ9A 2QCEA 5GQBA 2X2GA 1ZAJA 2ISDA 4ENLA 2HZGA 1SZEA 5LNRA 4PCFA 2NLIA 4C90A 5HUOA 3GUWA 2PU0A 3HFTA 3VIFA 3M07A 1DJWA 1XLHA 1QK2A 5AHNA 3WH5A 4NF7A 3GXIA 2OODA 1OABA 4DELA 3GG0A 3MMUA 4P7NA 3TOPA 5TNVA 1DIEA 2AOSA 4JD4A 3G0XA 1E55A 3ELFA 2R94A 4R7JA 1DKWA 3VABA 1KLZA 1B3ZA 1L6GA 1KRAC 3KTCA 4Q6XA 3EA1A 5E9XA 3KOZA 3DEQA 3NPVA 1UR9A 1Q6CA 3EDDA 5CPOA 3LXAA 4W4QA 2OELA 2OWWA 5FF3A 3ABZA 4W5ZA 5EL1A 2QCMA 4NX0A 3TC3A 4I9MA 3SFWA 1TZZA 5A8OA 1NP2A 1X1NA 3POCA 4XISA 3BOXA 3S6TA 2FHBA 4ATWA 4K7YA 3EWDA 1H1ZA 2VC7A 3MI3A 3NZ1A 5L6UA 2E09A 1TPWA 4XB3A 1QHZA 2Z24A 1OB0A 3KP1A 2J7DA 3AS3A 4WDXA 2PS2A 3WJZA 2X05A 1PIIA 3OZOA 1WBHA 2D2HA 1AW2A 3KAOA 1VEPA 4TX6A 1BXNA 4AD2A 4PH6A 4YCOA 1J4EA 4HPNA 4O11A 1GW1A 2FGBA 4JQ3A 3IACA 1GT8A 1CXHA 3EX3A 2QJHA 1WZKA 1SO6A 5G4HC 1ZP3A 4MWAC 3CBWA 2F7FA 5D33A 1S5NA 3T1GA 4GIEA 1B90A 3B9DA 3IUHA 4DI9A 3KTXA 1TJ2A 1XG3A 2WMGA 3ZFHA 3IARA 5EFFA 2RFGA 4KCWA 3W6LA 1SW7A 2G8ZA 2JE8A 4ZTXA 4U3CA 5DMMA 2KX9A 1I1XA 1KCXA 4DJDC 4PGLA 1SVDA 1XF0A 2XZ7A 3IWPA 2XGIA 4GOAA 1MW1A 3KLKA 2IXUA 3RCNA 3LGDA 1DJZA 2ZQ0A 5MKGB 1NOWA 5E70A 1JL8A 2YXOA 4C6MA 4CUCA 3VKJA 1W3LA 5CPNA 2IKHA 1XXXA 4AW7A 1UIOA 2ZZ2A 3DYMA 3XIMA 3ZR5A 5GJMA 2I5GA 2LLEA 1AQFA 5AYZA 3TYDA 4HHLA 1XM3A 1XLCA 1KFBA 1XIHA 4IPNB 1XSJA 2I14A 4P7QA 1AJ2A 3WFZA 3B0PA 1A4LA 1DJNA 4RE2A 1FX6A 1K7FA 3GXTA 4LCRA 2FHFA 4A21A 3ABRA 1W3HA 1O5XA 1F3WA 3GNXA 4Y9NA 4HOZA 1G7VA 3BSGA 3TSMA 4EVZA 2JF7A 2ZWZA 4V27A 1GONA 1WAUA 1XFBA 5HINA 4S2BA 2YZRA 2X0SA 5HANA 3WK3A 1OIFA 4WRHA 2L5HA 1XLEA 3CAWA 3RO8A 5FEPA 4KRUA 1M7XA 5C7VA 3O06A 1TZ7A 3AHTA 3UNTA 2BVTA 2V68A 4GZJA 1PBGA 4HPGA 1P1XA 2QIIA 1F6KA 5G1YA 5HDRA 1XJBA 3UPWA 3TR2A 4JTLA 4C91A 2D23A 3WQEA 4H7CA 4JTRA 3HFYA 1A5BA 1QATA 1NDZA 2OEKA 1XICA 3IJQA 1R9XA 1PE1A 1YADA 2HXTA 5HATA 3UYIA 5AY7A 1B3XA 3W85A 3BG9A 2AGKA 3TA9A 3HGJA 3B8DA 1RVGA 3TQVA 1CTNA 2E6AA 1MUCA 5IM51 1V02E 4DO6A 5M3WA 4HPXA 5KZMA 1OADA 7XIMA 3LCFA 4R88A 1OZQA 3B4UA 3K5XA 3GNRA 1XIJA 5F1UA 4DLMA 2HWGA 1I2PA 4A8NA 3FSTA 4TMCA 5HQLA 4WXZA 4C1KA 4LC8A 2O4QA 4MLRA 4GI8A 1LL6A 3G1RA 4OTKA 4LW7A 1BWLA 1ALDA 4V28A 3ZLGA 3LNMA 3V3WA 5C5YA 4V1XA 3CZLA 3GDLA 4ZXOA 3P67A 1RQBA 1RQHA 3CV2A 2V38A 1UBSA 5G2HA 3STCA 2ISFA 3FJ6A 4O52A 2JIWA 3WEMA 4UCGA 5D09A 1JCMP 2FJKA 4OOZA 4ILSA 2DVXA 1LZOA 2V67A 3MI2A 2C79A 1GVOA 5K7JA 4AXNA 1G7UA 3WQ5A 1SZRA 2WO5A 4NRRA 4O54A 3M5YA 1J10A 3VKKA 2YB4A 2GVYA 4L9XA 1ISXA 2OO0A 1S2VA 4NQ1A 1H1NA 4PTNA 3HQNA 2DW6A 1V0KA 4FNUA 4GYPC 4F0KA 4QS6A 3ARWA 4GY7A 2JK2A 3RRXA 3E49A 4MB4A 4MADA 3OGVA 4J5NA 4ZQNA 2HPIA 5BU9A 3ZSTA 1KWGA 1XLJA 1RLDA 2O9PA 4A8IA 4DAFA 5I3JA 2E1DA 2V69A 1LBLA 4DY1A 4NT0A 3DOPA 2XH2A 1XD1A 4P7LA 3QF0A 4WJEA 4GK8A 1X6UA 3TIMA 1A3WA 2VENA 3H26A 5FF2A 3LK6A 1A0CA 4PTXA 5TD4A 1RBOB 1HL2A 3UG4A 2QPXA 3H7VA 3UJ2A 3GTIA 4IMFA 5FJUA 3H4GA 2NX3A 4I5XA 4D8LA 3PBVA 1TA3A 3QHMA 2BXVA 2QUNA 1KFJA 3P0XA 4GACA 4QLKA 1I2RA 3MDWA 1GYLA 4TTGA 2C0HA 1CXEA 1FHVA 1B3OA 3QYSA 1Q65A 4DBSA 4C7FA 1RCOB 2ISWA 4RL3A 2BB0A 3M0KA 3IVUA 1TUFA 5FEZA 4JQ1A 3A13A 3LZ5A 3JUGA 4UXDA 3VUSA 1OX4A 3DENA 1G4PA 4B5XA 3B8SA 4UFMA 4FB7A 2X16A 3NQ2A 2GGEA 1UWIA 1FWCC 1M65A 1FP9A 4L6OA 4GKTA 4XBSA 1JAKA 3DXIA 2PMQA 4RW5A 4FNTA 4A22A 3CUHA 3PB2A 1B9BA 3FOKA 3L0NA 2BY3A 1E1CB 4UTHA 2VGBA 2XIOA 3NWRA 4M24A 4CNTA 1XRVA 1DWHM 4GUGA 4I5RA 1VJZA 4M56A 2QJGA 4W5UA 4C65A 2YZ5A 2W67A 3VE9A 3LERA 3O6AA 3WY1A 2OT0A 1QRQA 3D46A 4BEQA 4C5ZA 2WBKA 3PFMA 1W0MA 3GXNA 3B9NA 2YW4A 4KFOA 2G50A 4QRNA 3IIXA 3MUAA 2Z27A 1J5TA 3TNOA 4PMOA 4YHGA 2DIKA 1YTKA 5C6MA 2NV1A 1A5CA 3KXQA 5F4XA 3LCHA 1TWDA 2Y88A 1BEUA 2VRJA 3TH6A 3ANYA 3THDA 2X1SA 3V16A 2NX9A 2JGQA 1KXQA 3R12A 1VBJA 1L6WA 4GFSA 4NZ1A 5KZ6A 4CN4A 4S2CA 3SQSA 2ZXQA 1MUWA 1FY6A 2X8RA 1TO3A 3GVVA 4ZEPA 1KO0A 1ZBCA 1GKQA 3W22A 2ZZ4A 1M7OA 1UG6A 1PTDA 1GG1A 1WDWA 1E1EA 3ISIX 1QTWA 2RH9A 3ARQA 3IGUA 2A4AA 1CGVA 1WKDA 1KC7A 1ZU8A 4PC8A 1UZHA 3SEPA 1VBRA 5H91A 4LNCA 2NT0A 1DHKA 2VZTA 3BAKA 1IZCA 1W1A1 4BQ5A 3HPXA 4XAGA 5F2GA 3B0UX 2VEPA 2QF7A 3BMWA 3V18A 3OBEA 4UMAA 4F2UA 4LY8A 1BPLB 1ADOA 1VIWA 4AZ6A 3AU6A 4WKFA 3PZ9A 4C7DA 1FWAC 3WBWA 3IK2A 2ADAA 3CWOX 4NYUA 1J0IA 4X2RA 1OWQA 2AMXA 3M5ZA 4LF2A 4P8XA 1BQGA 3OZPA 4DPPA 3JW7A 3KHDA 4FR1A 1ZBVA 3KUMA 3E96A 5LIKX 1K9DA 1GOMA 4DHGA 4QLJA 1F7BA 1K7EA 3HQOA 4GFIA 4PUUA 3LG3A 3H2AA 1OD8A 2O7QA 1RXOB 4GH1A 4IG2A 3L4XA 3QY8A 2INFA 1HJQA 4ADTA 4R7OA 2RUSA 3QV8A 4RDZA 4AWUA 1ZTVA 2ZUUA 2OX1A 3W7CA 1LJYA 4UMCA 1XCXA 3DFYA 2EKGA 4NILA 4L4OA 3W00A 4O0ZA 3B9EA 1R3SA 2PDQA 3EPMA 2QGYA 4GJJA 4GJIA 2J47A 4DB7A 4EXBA 1W8GA 2QUMA 1CCWB 4M80A 3IJIA 1HW6A 4LX4A 4O53A 1JZ3A 1KM1A 2X1IA 2WAGA 3OLGA 1UWRA 3GKFA 1UR8A 3BVJA 1I2OA 4Z0SA 1VS1A 3APYA 3HPFA 1XYFA 1ZNNA 4K8HA 1TELA 4Q4SA 3GH7A 4IF2A 2BVYA 1VFHA 4X3ZA 3UR7A 1AA1B 3GDBA 3QPZA 3VDAA 4WZHA 3JS3A 3S0CA 3T2PA 4MZYA 3CWNA 1V7AA 3GK0A 4I8DA 1DWJM 4B3ZA 3RAOA 1UD2A 2PLCA 3M6YA 3S5OA 4MUPA 5FI8A 1TQXA 4K39A 4JN7A 1XISA 2EF9A 5LHEA 1XRFA 2CZDA 4GXMA 4HYWA 4G2DA 4QSFA 3TMQA 3SCVA 3HF3A 1CLVA 1W31A 1THFD 2QCDB 3TTYA 1R9YA 4GUJA 4HA4A 3VD5A 3DU0A 1K6WA 2IPGA 1Q6QA 1V93A 1UKQA 2PP1A 3KDNA 1OFOA 3TOYA 1TZ9A 4CN6A 3WF4A 3QW4B 5TQLA 2W9MA 4B9ZA 4UTUA 4JEQA 3HN3A 1DJIA 3W7OA 3WQ4A 4RE4A 3VD7A 2PGFA 5DT7A 4NG3A 4JFUA 5DX7A 3SY8A 1KTBA 3W27A 3NQAA 3NQCA 3MP3A 4X61A 2XDFA 4WXYA 1PSCA 1ICQA 1UOKA 2VXNA 1JQVA 2W62A 1KR0A 2QS8A 2W92A 3FSUA 1PB0A 3GIQA 4RJEA 3UESA 4KESA 4HU3A 3M4HA 5XIAA 1TJRA 1U5VA 4DJEC 4KIEA 3NZGA 4IOTA 2J74A 1E6PA 2QDGA 3QOMA 5E6YA 3N6HA 3PWGA 5HR6A 4TVUA 1WDPA 2PDIA 3U3HA 1EJUC 3FA5A 3ZOAA 3R25A 3WX7A 2G96A 4ORIA 3AXHA 2Q8LA 3CGTA 1DL3A 4YVPA 3STPA 4H6KA 1XLLA 2F2KA 4Y2WA 1LWHA 3A9IA 4UR9A 4B4FA 4C6QA 1DQXA 3LMZA 1XH0A 4Q7BA 4Q8WA 2QAPA 1WDRA 4IPLA 4NU7A 3FKRA 1S1RA 5I79A 4TV6A 1Q85A 1FXQA 5XINA 1KFWA 3MBDA 3LHYA 2F6XA 2ESCA 4P8VA 4U2YA 1OJXA 3UEQA 3W88A 1PS9A 1YMYA 1YNPA 3H22A 3DX5A 1IXQA 4H83A 2C1HA 2PWEA 4L1WA 2WVVA 2DU2A 1M01A 3NURA 1SW0A 5CAKA 1S5TA 1X98A 2VR4A 4QE1A 2PDCA 1S5MA 1V3HA 3UZXA 2ZUSA 3G1YA 4O16A 4FHAA 4HJFA 4ZFCA 3VO0A 1NM9A 1VBHA 4RPPA 1DQWA 3OIXA 5J5DA 2PP3A 2XN1A 4IGNA 3LNPA 2IXVA 4FS9A 3W1TA 1IV8A 2QW5A 3AS0A 3KBSA 3KRZA 2ATMA 1I0DA 1IYXA 3R4IA 2VELA 3VILA 4ZB5A 2V5BA 1G1YA 3W7GA 4JIIX 4F8XA 4EXQA 4Q8UA 4LV9A 5FJTA 1T7LA 3GXFA 4N6FA 1VFMA 2PWVA 1ODUA 3WNMA 4ONVA 3JZEA 3LB0A 4PTDA 5BXPA 4A8LA 1WDDA 5IXEA 5JU6A 2GL5A 4ERGA 1OIMA 3WFAA 4NZ3A 4P2VA 1DIKA 1MW2A 1GZGA 4C6NA 1C7SA 4BF9A 3W2MA 1WOAA 3D5HA 3GDMA 3W7RA 3GQYA 5A69A 1I9CB 3ZJ6A 2PLKA 1H7OA 4GRSA 1I1WA 1L2UA 1Y8BA 3U0HA 2PZNA 3TFXA 3PAOA 4MMWA 4M7SA 3LCIA 3CM4A 5FF0A 3T0TA 4PRRA 3UZ5A 1OGSA 2G37A 3GTFA 4N2YA 4O14A 3LGEA 4F66A 3B8WA 3IIOA 4JHMA 3BUVA 4CQ8A 1P0NA 1L0PA 3CL7A 4RV3A 3CU2A 1DE6A 4I7WA 2BHZA 3N15A 3ABXA 3TN5A 1MZHA 1C8XA 1EJ7L 4GHRA 2CLFA 4GGBA 3ZM8A 4G7EB 2PWUA 4RUBA 3GXPA 3SR7A 2DT2A 2I1OA 3F2DA 1CW2A 3IUIA 4LUSA 1HT6A 4A3RA 3FDKA 3WD1A 4Q4PA 1EB3A 2VGIA 5TAOA 1I2NA 3A47A 3WMCA 1KM5A 5BU6A 3WSUA 3BGGA 3PTQA 1XI3A 5DFAA 3GKAA 3SN1A 1TX2A 1R3VA 2TMDA 3MMTA 3TW9A 2HV5A 4U10A 4D8AA 3QH2A 2QDHA 3J7HA 3LGGA 3WNNA 2FZBA 1XC6A 1J79A 3Q94A 2OCZA 4NRSA 2ZXAA 3NQGA 1HKJA 4Z2HA 3K4WA 1EP2A 1FWGC 1NH6A 4LS0A 3MSRA 1QI2A 2HXUA 2WWDA 3HG3A 1PX4A 4TMBA 3K13A 4X2PA 4JPGA 4UTLA 2ZTJA 2F84A 4W8AA 4CU8A 3G0UA 5JIPA 3EOUA 1G5AA 1PAMA 1VFSA 4TOQA 3NPXA 3FYOA 1OFEA 2YFOA 2OJPA 2DORA 1FWHC 5A8QA 1P0DA 1EQCA 2GVEA 1KGUA 1JGIA 2GJPA 3II1A 3PZTA 1EEXA 3L21A 5GPRA 1TMHA 5HNRA 2XIMA 1ITQA 1WQ5A 3RJYA 4US5A 1TR1A 3WDIA 5I5RA 5MKGA 4G56A 4CN1A 2AAMA 4GNKB 2Q8XA 3UD6A 4UTMA 1X1ZA 1Q6EA 3G3DA 4S39A 5E0CA 3R5EA 1JPHA 3WNPA 3MP4A 3CMJA 1OC5A 3TC6A 1FWIC 3LTPA 1EFZA 1DVJA 2Q71A 3H2CA 1OVDA 1OSEA 3GHSA 4GYFA 3T81A 4AZ7A 1B31A 4R9OA 3SRHA 3N9KA 4DM1A 2YL8A 3W1PA 4LFYA 4H4IA 1WE5A 3KVKA 4FI4A 3P14A 1KB3A 3Q37A 2NQ5A 4CNNA 3CL6A 1NIUA 3CEPA 3M0HA 1CYGA 3W7EA 1C93A 1UKPA 1XDMA 2J9XA 3V0TA 2JQXA 3QZ6A 3W1LA 3W37A 1E56A 2Y7GA 1IE7C 3CT2A 2Z1KA 5H6HA 5AHIA 1R8LA 5FAJA 2I56A 2P0IA 3ARYA 4MB5A 1UD4A 3T0CA 5BRBA 3WQ8A 2OQLA 1L6SA 2DSZA 2YCEA 1F2JA 4BQ4A 1O95A 4HB7A 4FXRA 4J3XA 3PZQA 1XFCA 2C1IA 3CC1A 3CYJA 3WQOA 5CZSA 2P8CA 2DUAA 1QI5A 3AAMA 3H2NA 3UJFA 1W1ZA 2PI6A 4WK9A 1E72M 1UMLA 2ACRA 3RU6A 3POHA 3CTTA 4DF1A 1V51A 3W28A 4U3AA 1OFDA 4AIEA 1D8CA 1YDVA 1RJQA 2C3ZA 3VNKA 1RP8A 4NNBA 5CJNA 1GVYA 1TFVA 2VTFA 1O5RA 1VAHA 4NX5A 1KCLA 3TQPA 5C71A 1KXVA 2PWGA 3RM9A 1QU4A 1W3JA 2DW7A 1JD9A 3KDOA 5GJPA 1SZGA 4JQ2A 4TR9A 1ZHAA 1A80A 4I9TA 3KLLA 3PUEA 5LKYA 3ZQ9A 2Y62A 1E3XA 2C1GA 1V3IA 2Z29A 1NWRA 4MG4A 1TWIA 4GQBA 1UD5A 1XP3A 2Y8VA 1Q6OA 5LXEA 3W6YA 1US0A 2FGLA 1FWBC 3QC3A 1ZY9A 2BNJA 3O15A 1SMDA 3L4UA 3EMZA 4DBUA 2GVLA 4WY0B 3LXBA 1M7JA 3A23A 3IJ9A 5AYYA 2O7SA 4IGMA 4LRTA 1WUFA 3P6LA 3B97A 2PDJA 4W89A 3E3HA 4P7RA 2X30A 2HJPA 5BWAA 4KERA 4LUTB 2DSUA 4ZQCA 1FTXA 2WC7A 3FJNA 3NDYA 2DZBA 4IP5A 3CAKA 1XIFA 4LUJA 8XIMA 2P3EA 2BWGA 1DOSA 5B7ZA 4OUEA 2OSYA 1ZJHA 2CKRA 3SZ8A 2F6UA 2BY1A 2EAWA 2JKPA 2EKCA 4JR5A 3USZA 3OO2A 3S9IA 1AODA 2Z7KA 5CPLA 1GORA 2XINA 1YDNA 2NXHA 4FIQA 2KAUC 5EMJA 2FMOA 5EFDA 1WCGA 3TW7A 2BDQA 3WENA 2DT3A 5EMKA 4MJ2A 2C14A 2V82A 3L4YA 5KZEA 4Q22A 5EBUA 3RILA 3TLQA 4DX3A 2TODA 3CIVA 4JX4A 4IMDA 4IISA 2R1KA 5HUPA 4PN2A 3SUWA 3H53A 2QJMA 3SCWA 3LPPA 3WLSA 3L4ZA 5A8PA 3VNJA 1FKWA 3DGRA 2Z1XA 3MUIA 3A22A 2WHKA 4IJBA 1UYQA 3O3RA 3CUIA 1QXLA 4K2SA 5IOBA 2PDGA 1KBJA 4RX0A 4YS1A 2G95A 4XZBA 6A3HA 3GU2A 1RH9A 1AK5A 4E8DA 3DHPA 4UBPC 2VGGA 1QNRA 3P62A 2C15A 3H21A 3G1FA 3OG2A 1K3UA 2OR2A 1KFLA 3UZYA 4E6MA 1EOKA 3ZT7A 3I7QA 1IXOA 6ALDA 1J8VA 3OYZA 4LCQA 3PAJA 4CQBA 3W1AA 1XYBA 3OBAA 1JI2A 1LG2A 8TIMA 2JBMA 2BBFA 3T05A 3ITTA 2A7NA 2PUZA 4GO9A 4E2OA 1PCKA 4AY7A 1E6QM 2C91A 5ECVA 2H9AA 2NUYA 2OX4A 4PUDA 2O4MA 4U28A 2ISVA 3NZQA 4JGDA 1E1CA 3AWOA 2AQOA 4MWAD 1FHUA 1ZGDA 2XPKA 3KWSA 3L4VA 1K70A 3IVSA 3ALGA 4IL2A 3LM7A 3H2OA 3FA3A 3M0LA 1CLXA 1AW1A 3GR8A 1EWEA 1OQFA 2V81A 3TZNA 3DG3A 3U2ZA 4HMEA 3CHCA 3W3OA 4DJDD 1WZMA 3PPCA 4M1BA 1EGZA 2WM1A 2QLYA 2G3MA 3W2LA 1E4NA 1WO2A 2V5KA 3NNTA 1EEPA 3NDOA 5A2AA 1LL7A 4FX7A 4BS0A 4JBRA 3WK0A 3AYRA 1X8FA 5IBXA 4JYFA 3UY8A 2VFEA 3QYQA 4S1FA 2WNQA 1XWYA 3AXKA 3L23A 1IZKA 5AYBA 8XIAA 2R82A 1QJWA 3DHFA 3EDEA 2HVMA 2PDXA 3CAQA 4YPJA 3Q2DA 3DFTA 3W1NA 4I7UA 3HGSA 2O55A 2J7FA 4Q7NA 4QQ3A 5G4EA 3T4WA 3U4AA 5KEZA 3LV6A 3CO8A 4MFEA 5DCDA 2YBUA 4DUOA 3IRSA 2V5JA 3PWIA 1ONRA 1NDYA 4AD0A 4YTSA 4M6VA 1ICPA 1VRXA 1W1B1 2IPWA 4C60A 1LUCB 4KH2A 4GC4A 5HBFA 1VC4A 2X0YA 3UQNA 4FNRA 4I8YA 5DQPA 2XTKA 4LGXA 3KS6A 4HSNA 3LU2A 4HMDA 3K1GA 3T0AA 2J79A 2HTMA 5D05A 3W73A 3GXMA 3LHUA 3UWWA 2E7FA 3FVDA 3SQMA 4PMVA 2QCNA 1W91A 3HQ1A 3M0JA 2DZUA 1B54A 4UTIA 4B2DD 3KM8A 4MNLA 5G2IA 3E38A 3CQKA 1HKMA 2XVGA 5LSMA 4AUBA 3OZMA 2VP8A 1V8EA 5AOUA 3WF0A 2V3GA 5LIYX 2FDMA 3SJ3A 4IX2A 2CWNA 5ABGA 3GWQA 2FB3A 4LS2A 3S42A 4Z1CA 3OLDA 4O0KA 3AFBA 4AYGA 4PODA 1OD0A 3TC7A 3VDBA 2RJHA 4X22A 3M64A 2PP0A 4TV5A 3LBCA 2ZUVA 4YLWA 4DJFC 4Y8EA 4ECLA 3XISA 2X40A 4KEVA 2QJNA 2VHLA 2OFJA 2HNHA 5AHFA 4HT3A 5I3DA 3RCMA 3L68A 3NQ8A 1T0OA 3FN9A 3H24A 1R9ZA 3B04A 3G1HA 3RR4A 3H23A 3MVIA 1KTCA 1AH3A 1UHVA 1XBZA 4UTTA 1ML1A 3PC0A 3VIMA 4AYSA 1PYMA 2Q09A 4HQVA 4JN8A 3CMFA 1H63A 2ZWYA 1XLGA 1Z6KA 1WPCA 4UQBA 5D2YA 5EKYA 1GG0A 3LCXA 2HMCA 1XDLA 2ZA2A 1HQTA 5KETA 4BA0A 1U22A 4D6IA 1VBUA 3EYPA 1VHNA 3WD0A 1FA2A 3VCNA 3H7UA 5CKSA 2OYKA 4ZA0A 2FH8A 1SJCA 2HS8A 4QSHA 5IRPA 2WVTA 2C8NA 3DUGA 4C6PA 5AC7A 1Q13A 4YTRA 4F3HA 2ZZ6A 5CPTA 4PYSA 4OU1A 2GQ3A 4S3DA 1RBAA 2GDVA 3K2GA 3VGFA 2YDSA 1VFTA 3FHAA 2VX4A 3NL5A 4N9DA 2A85A 3VCCA 3W2NA 1OFAA 4GUFA 4Q8NA 9CGTA 2H6RA 3R6IA 2Z1WA 1V0MA 2FVKA 2QCDA 2Q3OA 5CC7A 1RVKA 1PYFA 2YCLA 1JPIA 3WO8A 4FX6M 2DT0A 2WMKA 3FV9A 4A3QA 4Q8QA 4D2JA 1HO4A 1PZ0A 5A6JA 1K8XA 4BEUA 4C1NB 1RAKA 3NQBA 3URBA 1R3TA 1VIZA 3EMQA 4MNJA 1YRRA 4FLSA 2WYSA 1ZAHA 3M9YA 1RD6A 3R8HA 1NOUA 3N4AA 3ARZA 3UJRA 4GVGA 4O4WA 1GQKA 4FEZA 2HROA 2Z2BA 2OZ0A 2PDHA 4M51A 3ORWA 3M5XA 2XSAA 2JIEA 1XDJA 2YA0A 1KXHA 1W1VA 3VC6A 3M43A 4HZ7A 4URIA 3VIPA 2WZMA 4KIRA 1X8CA 2R1MA 2ZVRA 3VI2A 4PMZA 3NQ6A 4XAFA 4GKLA 1SO5A 1UZDA 2X42A 4LQ1A 4HA0A 1V77A 5F7UA 1SFJA 3LRKA 3NXLA 4JTEA 1YXDA 4O15A 2QNEA 3AIRA 4ZO9A 3WNKA 1D2KA 3OGSA 3WL0A 3UR2A 1GTEA 2WHMA 2E9BA 3HPZA 4GI9A 1ME7A 3QQ1A 3BOFA 4LVDA 3G24A 1TPEA 3OTRA 2P88A 1GEHA 2A0NA 3C2FA 5FA5A 1RPXA 4MM1A 5AHMA 4DEFA 3QV7A 2W3ZA 4HTBA 1KRBC 1UD8A 4H9VA 1TTIA 1UD6A 4JFSA 3GDRA 1UJPA 5DY2A 4DUXA 2FLIA 3AYSA 4H2CA 4XZWA 2QCHA 5C9UA 4KW2A 5CG0A 2QDDA 3AALA 3MHGA 3ATZA 3S1WA 2CZVA 4O1DA 4E38A 2AL1A 3PB0A 4JZ5A 4Z1YA 4JYEA 1JRBA 1FWSA 3BAWA 4PBFA 3PZUA 1EHAA 1R87A 1DXIA 4PB4A 3PTMA 5LGXA 4KWOA 4HYRA 3THCA 3VOGA 2QMJA 4DZAA 4HK5A 1ADSA 5FCZA 3DHDA 1BXBA 2Y6ZA 2VEIA 2X09A 1H50A 2HBVA 1HX0A 2ZRUA 1H2JA 5ABHA 2WB5A 2EHHA 1ZZMA 2YX0A 1OCNA 4EWJA 4GX9A 2FTYA 3S2CA 3GNNA 3O05A 1IR2A 3DBNA 3KHJA 1S2CA 5K4ZA 2CBVA 2PDFA 2Z7GA 1Y65A 3CV7A 4LBSA 3FFSA 1K9TA 4AC1X 2OOGA 1JDEA 4A3YA 1MNZA 3EWWA 1XYLA 1XYAA 2I5IA 1WP6A 4KRZA 1OF8A 4AU0A 5E09A 1RD5A 4Y9AA 2FH6A 3CQJA 1PX8A 4ZQRA 5JQ9A 2NVDA 1FHLA 1E4MM 1Y7VA 3V5FA 2WHJA 4D6CA 3LD5A 3HM7A 4C1LA 3TMLA 5D2XA 3KOFA 1RBLA 4LS1A 1MW0A 3SY5A 2DFAA 3G18A 1VR6A 4LYPA 4R34A 1H7XA 4O1AA 5GNXA 1P1MA 1UPPA 1HJXA 4G7EA 4CCDA 4AX6A 1J01A 3I7RA 1DV7A 4K38A 1XLFA 2PD5A 2PF8A 1KV5A 2WZIA 2UV8G 3LY0A 2GOKA 8RUCA 3STGA 5FF4A 4C6BA 3ZSSA 4HHHA 3TN3A 3F7JA 3EWUA 3VOIA 3CZGA 3T2QA 3FJ4A 3WLHA 3BLDA 1EX5A 2PODA 3W7PA 1XLKA 4CEUC 4LVBA 5I3IA 3TR9A 3M0IA 3TUUA 4J40A 4J27A 3VM5A 2P76A 2Y0FA 1JCTA 5M03A 3SCUA 3R2GA 3FGCA 4GYJA 4B3KA 2CHOA 4J3WA 1PPIA 3E0FA 5D04C 3QZAA 4FR6A 4CCCA 1OF6A 2PURA 3ONCA 2GGJA 3RYSA 3NSMA 3W25A 2O9OA 4CD4A 5CGMA 3WDJA 3AROA 4DBWA 4XKYA 3UXKA 3JVAA 4I9AA 3O7UA 3GBDA 1A50A 5CJMA 2IUZA 4OZOA 1EJXC 1J0KA 4IM4A 1OT1A 5T9CE 3UA4A 3MJMA 4XX6A 2VCBA 3CH0A 3LRMA 5D2WA 2GQAA 1OEPA 3F5JA 4GZEA 4JL2A 1UASA 1UB3A 2IMRA 2ASHA 3GC5A 4AEFA 4JYDA 3B4YA 5A6KA 2E9MA 3AXIA 1NDVA 3SCSA 1DWIM 1NAL1 2OZTA 3VKDA 1F07A 5EMUA 2W5FA 2J27A 1EF2A 3GR4A 1OFRA 4UFHA 4HSOA 4Q8VA 2JGYA 4OIFA 1QDSA 2E6YA 3VMOA 4GIAA 1Y5VA 1W56A 3BQ5A 2V0TA 2R9RA 4AZCB 1ZJBA 4GUIA 1H62A 4Y9MA 3G1SA 3VA8A 4E8CA 1JDCA 1OYAA 4H04A 1PWLA 2ZA3A 2FZMA 2BXZA 2WZHA 3FXGA 4WUIA 5IDIA 2FKPA 1QCWA 2Y8UA 1VPQA 3WNLA 1CGTA 2BOEX 4IQLA 1LTDA 1C90A 1NFGA 1JCXA 4CVUA 3ZT6A 3VDCA 3LMYA 4DJED 1PKNA 4F0MA 4K8EA 3TCEA 1TTJA 3HB9A 3W84A 4L5ZA 3B8IA 4IT1A 3L65A 3DC0A 3T6CA 3WJSA 1MDRA 3WJXA 5G1TA 2FQIA 2WW5A 2VL4A 1CT5A 4ML4A 1TWZA 3E2RA 1A5SA 3V5OA 1GVIA 3SB0A 4DWSB 3ME3A 4GQGA 4R85A 3NEHA 1IIGA 3HIJA 3V0UA 1E43A 1TCMA 4UUIA 4PUMA 1BKSA 3QKZA 3T09A 4ZBCA 4OHQA 3LENA 8A3HA 4RDYA 7CGTA 1KFEA 2WJFA 4HNTA 3EOLA 2GUYA 1SFSA 1A5OC 1Z7AA 1EPXA 2DZAA 2ZRZA 1Z69A 4MFDA 5ABFB 5BMWA 3WD2A 2FZ9A 2A79A 4J3UA 4S3EA 1VQTA 1UC4A 3CJPA 2JALA 2WC3A 3FW6A 4GA8A 1O68A 4GISA 1Y0EA 4RNHA 3ITOA 4BQ3A 4HCLA 3T0DA 4NIRA 3CMGA 2QV5A 2OSXA 1KBIA 1S2WA 4WVXA 2BP1A 1PDZA 1WZAA 2ZE0A 3GDKA 1D3HA 1HL9A 1H09A 4A05A 4Z08A 3DYPA 1VEOA 2V9DA 4HPJA 4N0RA 1W3IA 4GE8A 3IANA 4OECA 2VQTA 3UWQA 1EGVA 1Z48A 1MI3A 2IS7A 1LBFA 2VR5A 2WZTA 1WXZA 1NOFA 4LUTA 4MY1A 4A4AA 2Y4SA 1U1HA 1VF8A 1YBQB 3W01A 6XIMA 1KRMA 3QHOA 4L80A 3SRKA 1J2WA 1SJAA 3B9OA 4HNOA 3KX6A 4G7FA 3QPEA 3TYCA 1HL8A 4AB4A 3CIXA 1EJVC 1P5BA 3REQB 3VC5A 2GQ8A 1CGUA 3C8FA 4H8VA 5JBFA 1VB9A 3QKEA 3SN4A 4QE4A 1LDCA 3BMXA 4J4KA 1V6XA 2CLIA 5GNZA 2EG7A 1C29A 3UY7A 4DWSC 1Z42A 2HQAA 3OVGA 1OINA 5A1AA 3LLDA 3BLIA 1S3TC 4PEKA 4X60A 2AKZA 1AW5A 1YX1A 2YDQA 2CLMA 3L9CA 5D9OA 1U1UA 1F4HA 3S83A 3B0XA 2YBVA 3WUBA 4GPNA 3BJTA 3SO7A 4O4VA 3HBLA 1ISWA 5CGQA 1QNSA 4NXKA 3S6DA 3OBKA 1F73A 4LOCA 4HCDA 5EMLA 1H60A 2TPSA 1DE5A 4QDMA 2D3LA 4UMBA 4H3DA 4C6LA 2AKMA 3LEPA 3Q67A 2PDNA 2A21A 4Q4RA 4GO8A 1IT8A 3I10A 3WF3A 2G4FA 3M0ZA 4AZGA 1AQMA 1J12A 4W88A 1QBAA 3UXLA 3SM0A 2R1NA 5AZ1A 3RX2A 1B0IA 3UZWA 4XUYA 2W66A 2QV4A 5BNKA 1MQRA 1KBLA 3D0CA 4PE8A 3WK1A 1W9XA 1V5XA 2WJEA 4JIPA 2D24A 4ML9A 4FOKA 3M0VA 2YCKX 1EWDA 2OTDA 3DHUA 1Q63A 2VRKA 3MBFA 3W7DA 3R94A 2VI0A 3PPFA 4AEEA 3SADA 3UCDA 1ECQA 1SPQA 3NQVA 3W81A 3SRFA 3TP4A 3LCLA 4L4PA 1R3YA 3QLDA 2CXEA 1C8YA 2DY3A 2C7FA 3PP7A 4P8UA 4OV4A 4JTFA 1B3YA 4PMUA 2W4XA 4IXXA 3KOWA 2YGYA 4AIOA 3STEA 5HA7A 2GK1B 3OP2A 2AL2A 3OU8A 4IIHA 3T40A 2CERA 2Z1SA 3BL3A 3I4EA 1EDTA 2UY2A 3O0KA 3ES7A 2CBUA 3CTLA 2XUCA 4ZO7A 4EAMA 3GIPA 3AWNA 1ZCCA 1EC9A 4DJFA 3G6LA 1JZ6A 1K4GA 1RR2A 4B5VA 1KA9F 2VWSA 3BLLA 1UP3A 2ZDRA 3EOSA 4JCMA 5DMLA 4YCPA 3VOJA 2E0PA 4NHVA 1E9LA 3OGRA 3DGBA 3H4XA 1FH8A 2REQB 2G0WA 1WYIA 4S3FA 3WQ6A 3EEZA 4YWIA 1PKYA 3GM8A 4H6QA 2P10A 3A3HA 2MNRA 3P60A 1XSKA 2YOCA 5DLCA 4D6DA 3LBOA 4R33A 7PTDA 1GOKA 2FZNA 1V3JA 4IH3A 4WGXA 4RCXA 3AYTA 3QZEA 2ALRA 3NZRA 2OT1A 3MUCA 1V3MA 2XYLA 3D47A 3TZFA 2OWXA 3GAKA 3IJLA 1XX1A 5D38A 5KTLA 4XD4A 4KF1A 3VMNA 4WSKA 1UUQA 1P7TA 4KMQA 4A29A 3MPGA 1XQKA 4LAUA 3QFEA 1QVBA 2I9UA 2VMFA 2V3FA 2A6LA 1XYMA 5F2LA 3UETA 3QGKC 4RNFA 1BGAA 2YLAA 1S5VA 3WH6A 3W02A 4RW3A 1WUEA 5CSYA 3W7NA 4C6CA 1OG6A 3KE0A 2PTDA 2WMFA 3VNZA 1KKRA 1W3TA 1UKTA 4PUKA 4EPDC 3N34A 3H7RA 2Q6ZA 1VJIA 3GAYA 4TVCA 1R3QA 4PSRA 3OOQA 5HWMA 4AISA 1YYAA 1EP1A 1VZWA 1W2PA 1DJYA 1NDWA 1NWUA 1A5UA 2GWGA 3TJLA 3N6QA 1V0NA 3CUFA 3IGXA 2ZC8A 1POJA 3ZWSA 1GOQA 2VX5A 3AIVA 3KBMA 1XRSA 4AMCA 4F2TA 1OK6A 5HAOA 3A4WA 3QY7A 1VP5A 2FTPA 3KCOA 4NNAA 1A0DA 4U2ZA 4QLLA 4UQAA 4NASA 3MDUA 4BI7A 1F3XA 1OX5A 4PCTA 1E6XM 3GR7A 3O16A 3GVQA 4BFAA 2FPYA 2W61A 4QJ1A 3RPTA 4POCA 2CKSA 4FSAA 4HK6A 3R89A 3AIQA 1Q45A 4IUGA 2GJXB 2J8FA 2WC4A 3TX9A 5AKQA 2JEPA 1UZ1A 3STFA 5LZLA 4JIEA 1FDJA 1IEQA 1S1PA 1W5OA 1AZ2A 3ZR4A 2CLLA 1CI1A 1QWKA 3TNBA 1Q6GA 3W9ZA 1JCNA 4IFKA 5BWFA 4NZFA 4WLCA 1ENUA 1IF2A 1EDQA 4IL0A 1NF0A 1K9FA 4FXJA 5DBUA 2DPEA 3AMKA 3GSMA 2QHAA 2VFHA 3HMCA 1BF6A 2FVMA 4XV0A 1UBPC 2WK2A 1H0GA 2E77A 1HVQA 1TCDA 4NJHA 2R24A 3UVIA 1QI4A 3GTNA 4B5WA 3TAKA 4OE7A 1QPOA 3UFYA 3C86A 3SFKA 4DZ5A 3P84A 1NVMA 3KL0A 4IMEA 2OQYA 5KINA 4QG9A 2Y1HA 1VCFA 4XD3A 1NWTA 2PDKA 3KL5A 4F0SA 4IPPA 3NIYA 1BRLB 4MNMA 1ZJAA 3UYCA 1K03A 2H3DA 2IQTA 9XIAA 4B5SA 1FVPA 3OVRA 3SY1A 1ITXA 4N9EA 3W7MA 1QI0A 1FWRA 4QAWA 4JNYA 2PWFA 3MSYA 3H4WA 3B05A 3IGSA 2ZUTA 5C2XA 2CWXA 5D9MA 4AD4A 3WL1A 4REQB 3GBEA 3HGRA 1O6IA 3WN6A 3DI1A 1T8QA 3OG3A 2P3ZA 1XC4A 4E2VA 4R53A 3VCRA 3N3MA 3B8TA 5DN1A 4AD5A 1F76A 2J13A 4WEVX 1NU5A 3OB8A 3UG5A 4TU1A 3TTOA 1LP6A 5CLTA 4L61A 3FKKA 4L1XA 5LA0A 4GCAA 2E28A 1G4TA 3ARSA 2V5DA 1Z41A 2BVWA 2D3NA 2EPHA 1GW9A 1HUVA 4NZJA 3M0XA 3PJWA 2BVDA 4K1GA 3H55A 4UQ9A 1RCQA 2QPUA 4L4MA 3CHVA 3VKBA 1I8JA 5DMYA 4LVFA 1U30A 4AQLA 3UJEA 1CX9A 2WSYA 4YYFA 3U2CA 3AZRA 4HMCA 1C8VA 2WPGA 3EB4A 4UZUA 1N55A 2A1YA 4CEXC 1TJPA 1ME9A 4ZOBA 4M7TA 1E6SM 4N6EA 1JPDX 2PD9A 1B57A 4Z2GA 3W86A 1JF6A 1S3HA 3TWBA 1FCUA 5AZ0A 2ICSA 1LROA 2QJJA 2XIQA 4K36A 4YWSA 3DC8A 3NYDA 4MVAA 4NAEA 4E0CA 3P3BA 4EE9A 1A3HA 1ZENA 4U5IA 3T07A 5REQB 3AXMA 2YL9A 4QE5A 1X7FA 1ZRQA 3UXIA 2XFFA 1ZL1A 4ALDA 3BSHA 4H6EA 2WXDM 3PY2A 3C2VA 4GQRA 3CIWA 4B16A 1TKKA 3HO8A 2J9YA 2E8YA 6XIAA 2CCRA 3WQGA 3CNYA 4JS3A 3THUA 4IICA 3ID7A 1YDYA 4I3GA 4HA1A 1GZJA 3S2NA 3BURA 3S3GA 5H2ZA 4J35A 3UPMA 4DLFA 2ZUNA 4DF2A 3RCYA 1HIZA 3KWXA 3T7VA 3TYUA 5FACA 5JBEA 1RZMA 4AC7C 1KD0A 4RZ5A 3KBWA 5IFPA 4RE0A 3U8GA 4Y9PA 4C5YA 2XSBA 4CNSA 1O1ZA 2CESA 1L2QA 1W9BM 4EPKA 5C9ZA 2ZCGA 1V6TA 1B4KA 4YVVA 3W2JA 3IIPA 2X1RA 1X6LA 4RZ6A 3W7JA 3Q4DA 4EX4A 3RLHA 3F4DA 4Q8PA 2ALDA 2ZZ5A 4QROA 5FJOA 1BD0A 5CGTA 4BI5A 1CXIA 1UZ4A 1FQ0A 1Q7ZA 1PHQA 4GX8A 4IGHA 2F9RA 1MRQA 2WBGA 4TVDA 1JPKA 3C0LA 3G5EA 3OODA 4LYQA 3O2LA 3APGA 2XWDA 2FPTA 3PBYA 5FD0A 5FF7A 3S1GA 4JX6A 3SBFA 2R91A 1W1YA 3K8KA 1J2BA 2YXXA 4JTSA 1GEQA 2QIWA 3BICA 3ARXA 3WD3A 3K4AA 3VXGA 2BHYA 4XK2A 1WOBA 2BHUA 4GC3A 1E70M 2WCAA 4GINA 3WQVA 3CH9A 4AF0A 1X1OA 3T78A 2RDWA 1M41A 3GC2A 4J7RA 4KWUA 4JTUA 2VO5A 4DJFD 4RZBA 3QTGA 1FWFC 4WD0A 3G1AA 4O8RA 2PE4A 1ZUAX 4QDWA 4JQ4A 2CLKA 2WLYA 1RY8A 5LYRA 2BASA 3RLVA 2FIQA 3U2OA 4TIMA 2MUCA 2A5HA 3MY9A 1TVLA 4UB9A 4WDUA 1MXDA 3GE7A 2QDEA 3DERA 4GD0A 1AFSA 1WAWA 1ZFJA 4NAFB 5FEWA 5FSDC 3ITXA 3EXTA 1Q6LA 4Y90A 2DIEA 2X41A 1CNVA 5C70A 1J6PA 1K9EA 3WDRA 3RITA 5J8LA 2BS9A 1QR7A 4XTIA 1W32A 1QPRA 4FLQA 1Q4WA 4C6JA 2D2OA 4FIRA 3BE7A 3N1AA 4BKNA 1F6YA 1JPMA 1KCKA 4GQ0A 5GNYA 3H2MA 4G1KA 4UNKA 1KGXA 2V2HA 3OA3A 1REQA 5D2TA 1Q7QA 1R38A 4WDTA 3BC9A 2OKOA 2PCQA 3TJIA 1DJGA 1Y5XA 4R27A 2C0AA 3TTQA 3PZGA 4PCNA 1R2RA 1F3EA 4FX8A 3UG8A 1GJPA 1LG1A 4O13A 2J77A 4LCSA 3VD4A 1UMYA 3FA4A 4ICNA 3HPAA 5D4YA 3GH5A 3TYAA 3DCPA 3K46A 4JL1A 4QTGA 1GQNA 2EG6A 1XGEA 1DTNA 1F8MA 2W27A 2VUNA 3FK4A 3ECQA 1TV5A 4TQTA 4LV4A 3AU2A 4RV8A 1C8QA 2XG9A 1DJXA 3NTYA 4J1OA 3EWYA 4AZCA 1BGGA 5I07A 2O9RA 1XLAA 5IHSA 1LOSA 4GQQA 5C7HA 4EKJA 2C6QA 4AD1A 1MXSA 3QR0A 1QFEA 1TVNA 2YYUA 3EKGA 3SGZA 3E0IA 1AUSL 2I17A 1JEZA 1UWUA 4JTKA 1E51A 5HJXA 1TWSA 1POKA 1VRDA 1R3WA 1TQJA 4MB3A 1HGYA 4MJ4A 4IP4A 4QFUA 2ZZ3A 3SGUA 3AO0A 2XZ9A 3D3AA 3HJEA 3D6NA 2OSWA 1Q6RA 5CBIA 3VIOA 1VHCA 1RQEA 2CBIA 4D1JA 4EXAA 3PHAA 1OCJA 4QM1A 3LSCA 4DWSA 1ME8A 2PBOA 2V2CA 4LF1A 3BLEA 3N3TA 5FOOA 4BF5A 4PRTA 5U4NA 2YR1A 3Q65A 1QNVA 2QUUA 1LLZA 4JKKA 4QG8A 4A2SA 1EP3A 4KFNA 1DQUA 1PZ1A 2YA1A 1E5JA 1O60A 4MIMA 4KS0A 1XUZA 3T0BA 3WQFA 5D03A 4F4RA 3TW6A 4S3AA 4XD5A 1I2QA 2G4JA 2ZZ1A 2UZ9A 1DJQA 4S3KA 4D6GA 5CEWA 5I0DA 1EF3A 3I6RA 1IQ8A 4NL1A 1S2UA 1BYAA 3HOJA 3FVMA 3WUGA 4NYYA 1G0CA 4JAWA 4C7GA 2QJIA 4PFMA 1MUMA 3WK2A 3ENLA 2PA6A 4Z17A 3NDZA 5FL0A 3QLLA 4KQNA 4QITA 4JIHA 4AXKA 1P6BA 5A6AA 3FYYA 4F9JA 5BW6A 4YL2A 3SIMA 4BJHA 1HG3A 3LCGA 3OIHA 1UUMA 4JTCA 1NELA 1GZ1A 3VIIA 1FH7A 1TV2A 3F5KA 3WLKX 3RRAA 2XWEA 1ODZA 1AMYA 3N9SA 4EPEC 3GFZA 4GBUA 2ISSA 1O5QA 2GSHA 5A2BA 1RUSA 2E5BA 3M47A 4Q3MA 1EJRC 2VFDA 3MKCA 3USBA 2Z00A 3NPWA 1W9PA 1WKFA 3SECA 1QHPA 4WY0F 3R8GA 3CB3A 1LORA 2NQZA 3ZVHA 1T8XA 3VOHA 3WH9A 1SQ7A 2Z2UA 2WHLA 3I7SA 5A8GA 1JD7A 2EPMX 4NJGA 5JMUA 1MQPA 1F61A 1XKYA 1SFTA 4AVNA 4YU1A 4AMAA 5E6ZA 2GGIA 1F8IA 2DT1A 1K7XA 2AQWA 3KOXA 5LIUX 4EF9A 1OCBA 2ZIDA 4O1CA 1W3NA 4PL1A 4S3JA 2HK0A 4UFKA 1KKOA 3DKLA 1MW3A 4RR4A 3VVGA 3TJXA 2CETA 2DVTA 1LQ2A 1E4IA 3LPGA 1UR2A 4N4QA 1M6JA 2G3FA 1NFPA 4GMEA 4EACA 3AC0A 2PPGA 3RLUA 4DWDA 3V5CA 2WKJA 2J62A 1N7KA 1E0VA 3PBWA 1QNQA 4I90A 3NSNA 3MI6A 5CZJA 2CU0A 3SUTA 4PFHA 2P50A 1KFKA 3A5VA 1FWTA 3O6YX 4H9XA 1AL8A 1IWPA 2ZXDA 1L6FA 3BV4A 3T9PA 1UOZA 1DIDA 1UR3M 4W84A 2XVLA 3S2LA 4Z2JA 3AS2A 3EPNA 4I9JA 4HZ8A 4GG9A 1CBGA 4I6VA 3JU2A 3PG8A 4EP8C 3WF1A 3S5YA 3GLCA 2INZA 3M7WA 1MSSA 1Q4NX 4EIVA 3MCNA 1ISZA 1QASA 4CQ9A 1V7YA 3CZEA 5CG7A 4UTFA 3MU7A 1UH4A 1PIFA 3R10A 4I6KA 5EU9A 2OO6A 3P81A 3GUGA 5F2MA 2VUYA 3UPBA 4W8BA 3PJTA 3SCPA 4JEJA 1RV8A 2WZEA 1E5NA 1R30A 3CASA 4O1EA 1TWWA 5LIWX 1ZBKA 1ONEA 3HU7A 4H7ZA 4LWWA 3GVRA 3TCSA 1R2TA 3ZYZA 5MHBA 3WF2A 4ZQPA 4F79A 1MEIA 1KCZA 4GI6A 4IG2B 3DFHA 4GABA 5G2WA 4OT7A 2DDXA 3HG2A 1MZRA 1HKWA 4HBKA 2REQA 1UP0A 3S4TA 3QV6A 3KS5A 2Y7FA 4J3ZA 1RPKA 5K9DA 1OT2A 1P6WA 3BAXA 4IQJA 7TIMA 1B3WA 1DXEA 2E6FA 1O94A 2C16A 4ZR8A 1LYXA 1XV8A 1KR1A 3VGBA 4ZXLA 1I75A 2GOUA 3RK8A 4ZQOA 2CYGA 3CT7A 4JKLA 1OG0A 1EBHA 2WJZA 5CAHA 2Y85A 3R58A 5JUVA 2Y61A 1WDQA 3PUGA 3S9YA 4IJRA 5LHFA 3THAA 4DNHA 5C2GA 1IWAA 3MJYA 3IV8A 1P48A 2OWCA 3W1RA