3CEUA

Crystal structure of thiamine phosphate pyrophosphorylase (bt_0647) from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr268
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
207
structure length
198
Chain Sequence
b'MKLIVVTTPTFFVEEDKIITALFEEGLDILHLRKPETPAMYSERLLTLIPEKYHRRIVTHEHFYLKEEFNLMGIHLNARNPSEPHDYAGHVSCSCHSVEEVKNRKHFYDYVFMSPIYSTYTAEELREAQKAKIIDSKVMALGGINEDNLLEIKDFGFGGAVVLGDLWNKFDACLDQNYLAVIEHFKKLKKLADLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiamine phosphate pyrophosphorylase
publication title Crystal structure of thiamine phosphate pyrophosphorylase (BT_0647) from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium target BtR268.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Transferase
total genus 58
structure length 198
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ceuA00
4LWWA 1TPH1 3CWNA 3O6YX 1DORA 2GQ8A 3DBPA 4IX0A 4N6EA 2PCQA 3F03K 3RFAA 4PL1A 4GJ1A 1ZY9A 3HBLA 4LV4A 4R7JA 4LVGA 2ZDRA 4NXSA 5TBOA 5DCBA 2BTMA 2ZTKA 4P2VA 4NNAA 4PL2A 4R34A 1WA3A 4ZQOA 3EX1A 3STEA 3BG3A 1ADOA 1NAL1 4HHPA 1EPXA 1P4CA 3ABRA 2GOUA 2GVJA 3C56A 2PC4A 2WSQA 5DXXA 2E6AA 5DBTA 1KV5A 3IIOA 3M5ZA 1U83A 3R8RA 5HNRA 2A6NA 1ME8A 3LI1A 4BI6A 3MI6A 2FPYA 3N14A 3W2JA 3EWUA 1QDSA 5AHEA 2FQIA 5LKYA 2QCDB 4HN4A 3TE9A 1I45A 1OX4B 1JUBA 1LOQA 4O17A 4IXXA 1UUOA 1XUUA 2E1DA 5KTLA 2VELA 1EUNA 1EWEA 3TFCA 1F74A 3IGSA 1QFEA 4NNBA 3SECA 1G4EA 3QMTA 4RK8A 2O7QA 4MY9A 3TQKA 5D38A 4IWWA 3GKAA 4LT9A 2G96A 4M7TA 5D32A 3O6DA 3SJ3A 4AH7A 5FF0A 4QNWA 1XI3A 3GR8A 3ZR4A 3KVLA 4JTHA 1SPQA 2ZBTA 2C16A 3SI9A 1KW1A 5FEWA 4KWVA 3EXTA 2YPIA 3P8IA 3EX3A 3OBKA 3QW3A 1J2WA 2Q8ZA 4AXKA 4Y8FA 3TFXA 3CIXA 3W86A 2E6FA 1RV8A 1YTDA 3SR7A 3DFNA 4GUIA 1H1YA 1FWRA 4R53A 2YDAA 1UBSA 3TNOA 3GNDA 1JUKA 3S5ZA 4DBEA 2ZFAA 2VEMA 1F05A 5LHFA 3HGSA 3M47A 5HMSA 1W3TA 4X22A 3S1WA 3JS3A 5D2YA 2YW3A 2DZTA 1H62A 4H3DA 2VKZG 1FXPA 1H7RA 1LDCA 5I3GA 2O7SA 4DF2A 1JCLA 3HG3A 5G5IA 4MUZA 1FDJA 3MBDA 4ZQPA 2VFGA 3G1AA 2OX1A 2C14A 4XKYA 3EWXA 2JKPA 2WOQA 3DI1A 3LXBA 3OG3A 1XCFA 5D2XA 3T44A 4BWLC 4NU7A 2Z0IA 4BF9A 2QJGA 2H8ZA 4O19A 5HUOA 1KM6A 1KM2A 3MYOA 2FJKA 4ZL1A 3W72A 3NL5A 2ZA3A 1OJXA 4M19A 3LHTA 5A8GA 3ATZA 4Q32A 1VHCA 2A1YA 4XQ6A 3W22A 3C6CA 3CEUA 4ZZ9A 3S1VA 3GYEA 4AF0B 1W3NA 1OX5A 3W7LA 5J5RA 1QPNA 3L0NA 1QCWA 4FNSA 4O15A 1RVGA 1OX6A 1SFLA 3CEPA 3TV8A 1WXJA 3TAOA 3STCA 3A23A 4XUGA 3UZ5A 5K4XA 4G1KA 5KZMA 1XDLA 3TKFA 2NWRA 3NM3A 2G5WA 4FX8A 4JX4A 4UFIA 1DQXA 1PIIA 3G24A 3O8AA 1FWSA 1Q6LA 4N9CA 3QSTA 5I3IA 1KM5A 1SW3A 3PSVA 3AJXA 2QCDA 3HPXA 1OX4A 3TK7A 3BW3A 1SR9A 3Q2DA 4RCXA 4UTJA 3W74A 2A2IA 4JGDA 4LS1A 1K3UA 1XUZA 5E1QA 4JX6A 3S5NA 1FDYA 4RJEA 4DF0A 4OV9A 1DJQA 1VPXA 4YMZA 2V5LA 3M6YA 2V9DA 3NG3A 1ICSA 3LDVA 3TH6A 2ZZ6A 1VGAA 5MHBA 2CZ5A 1MZHA 3OEXA 4XBSA 3TSDA 1O94A 3QEZA 4I7VA 1KBIA 3R89A 4RZ4A 3G1SA 3UWUA 2YZRA 3S8HA 4A3UA 3KRUA 1L9WA 4GC4A 5E93A 2GQ9A 5FI8A 4O0ZA 1ZAIA 3TW6A 2QCLA 2UV8G 1WOBA 1R2SA 4GUGA 3MI2A 4GRSA 2HTMA 2J9ZA 4JXCA 5AYZA 3G3MA 1CX9A 5AC8A 4YL2A 2Q3RA 1SUXA 4DO5A 2H6RA 4NZJA 3M41A 4UMAA 3HB9A 3VI2A 4QM1A 4MLRA 3NQAA 2FTPA 3GIYA 4IOTA 3O16A 5F4SA 4XBKA 3E9AA 1SO6A 1PVNA 1ZAHA 3W73A 2Y62A 1TPVA 3Q94A 1GYLA 3A22A 2CZDA 4ADUA 1KM1A 3HGRA 4OHQA 3USBA 3NM1A 2A4AA 4C1LA 4ZMGA 1K7FA 1FXQA 3NEVA 4DXVA 1PCWA 3PUOA 1RQHA 1PS9A 4DO4A 2QCGA 3LBCA 4NQ1A 4PCFA 1W54A 1YTEA 3DENA 3O06A 4D2JA 3RLVA 4ZQNA 3C2VA 1YPFA 4R33A 1O95A 4O57A 3FKKA 3WJZA 5F4WA 2GPTA 4L4LA 3JRKA 1VYRA 3BLFA 4O8RA 5D2TA 4Y6GA 1SW7A 1ICPA 4O16A 2AGKA 2P0OA 4MZ1A 4AHPA 1NF0A 3QM3A 2X16A 3H53A 3STFA 1NVMA 3FJLA 3KVJA 4HIBA 1FCUA 1TPWA 3W1XA 2YYTA 3P8JA 5CZJA 4K38A 3L65A 3LHWA 2NV2A 1K8ZA 3BV4A 3VE7A 4O14A 2Y7EA 3DU0A 5AYYA 4HT3A 3TC7A 4NZFA 3W07A 4JIQA 4DQWA 5C55A 1TPUA 4ML9A 4CNOA 2CZFA 1OFEA 2BXVA 3W87A 5AHNA 4QAIA 1VLIA 4CQAA 4OT7A 3W1NA 1ZENA 5CPLA 1GTHA 3MP5A 3QMRA 4Q4KA 3FS2A 1LOSA 2X2GA 4MYAA 1ALDA 2G97A 2J6XA 3N9SA 3S6DA 2FDSA 3LTPA 1LLZA 2Y6ZA 2NX9A 2A85A 4CQ9A 6TIMA 1TREA 5EKYA 1LRNA 1Z48A 1G69A 3MW7A 2Q8LA 3QW4B 2Y85A 1KBJA 1TRDA 1P0KA 3NGJA 3VE9A 3F4WA 4XTDA 2NUWA 1SZFA 5G2WA 3SZ8A 3GDMA 3PY2A 2ZA1A 5FF3A 3UWQA 1C8VA 1HL2A 1XBYA 2P1FA 3M5YA 3D0CA 3NPUA 4CCDA 4O54A 3OVRA 4UIOA 2QUVA 4B5NA 4S2CA 1H1ZA 4UFHA 3O05A 2V8ZA 2ZA2A 3W7RA 1O60A 2BX7A 5D03A 4BFAA 4NJGA 2FFCA 3W1UA 1TV5A 2ZRVA 5G2HA 4EOUA 4WXZA 1W31A 1TJPA 4DO6A 2JGYA 1MSSA 3E96A 1LM1A 4MY1A 5K3VA 2CLMA 4BR1A 4GBUA 1GG1A 3LX9A 1W5MA 2ZZ1A 5EMUA 1JRBA 2FB3A 5AN7A 1EX5A 4O13A 2TSYA 3I6RA 2QCHA 3QC3A 1NF7A 1JRCA 3M7WA 5IBXC 2V30A 5EL1A 1SZGA 4JTGA 2NV1A 4WQ6A 5BMXA 3WK0A 1H61A 1PE1A 3UWZA 1VCGA 3W2UA 5C54A 3IIPA 4ICNA 5F2MA 2ZRWA 5F4XA 4LU0A 5F1UA 1FWTA 1SSDA 4Z1BA 1JUEA 1Q6QA 3LHYA 5DY2A 1DQWA 5D04C 2EGZA 5CPNA 5AHLA 3PBWA 1I2QA 4HSOA 5DELA 3HJZA 3FIGA 3C3NA 4RV8A 2DZWA 3P81A 3MHGA 5CZSA 4E2BA 2RHGA 3S42A 3IIXA 5HR7A 3NPWA 4QNEA 3PUDA 4K6AA 1TJRA 4I7UA 3LTSA 1XDMA 4IMFA 1OVDA 1KTCA 3M5VA 2FIQA 3P5ZA 4UC5A 3NXFA 3TDFA 1GYNA 3DFPA 3LHZA 4PC8A 5HJLA 4DEFA 2CW6A 4LTSA 4FNUA 1IXPA 3W76A 2DORA 1TO3A 1SO4A 3NDOA 1KFCA 1SW0A 3UNDA 3Q37A 4JTLA 4O50A 4RZ5A 3CTLA 1TTQA 4FIRA 4LOCA 2X30A 4GUFA 1GEQA 2NUXA 3W83A 2PRHA 4S2BA 3N2MA 2QUTA 2GQAA 2ABAA 3IGUA 4JTUA 3ZWSA 4MOZA 1EP3A 3SFKA 2ZQ0A 1YXCA 2EHHA 4Z1DA 5F2IA 3L66A 3FYPA 3S5OA 5C6MA 5FF4A 4OU1A 4ZQMA 3GAKA 3ABSA 5TIMA 3DH7A 3W7EA 2B0MA 2E68A 2VFEA 2V2CA 2OT0A 5F2GA 3H55A 1X6UA 5C2XA 2Y63A 3GK0A 1HO1A 4XKYB 3O07A 2V81A 5SWUA 4JTIA 3EKZA 1AL8A 5CPOA 3GDTA 4FX6M 5D2VA 3NQ6A 4M7SA 4YWIA 3TJLA 1SSGA 5AHFA 3ELFA 1FY6A 1ZAJA 1IF2A 4LS0A 1BWLA 5A5WA 1Q6OA 4KFNA 3FLUA 4O18A 4O1CA 3KX6A 1V7YA 3Q58A 3NZRA 4W9TA 1OYCA 4O4WA 3LCLA 4I7WA 2A7RA 1P0NA 2ISVA 3LM7A 3UZJA 1QAPA 5DN1A 3C4UA 3NA8A 1GZGA 4JTFA 3W7KA 1LYXA 3B0PA 1FDZA 1GQNA 3PSWA 1KTBA 2HMCA 3QQ1A 4IMDA 1JR1A 1GT8A 2C0AA 3TMLA 3MBFA 4UTWA 1X7FA 1H7PA 3LCGA 4MZ8A 1Z42A 4CCCA 1NFBA 1H63A 2B7OA 1VLWA 1JQXA 4IGHA 1TYGA 4EF8A 3KAOA 1K03A 2CWNA 4UMBA 2CLKA 3TX9A 4UFJA 1WOAA 3G3DA 1QO5A 4JDBA 1W5PA 1LZOA 2CFFA 3HIJA 1YTKA 4UNKA 5FF2A 3VFLA 2EPHA 1X1ZA 1GWJA 3IIZA 5D02A 4K36A 4QSHA 3EWZA 4JYDA 2YGYA 3PG8A 1IGSA 2Y7DA 4N4QA 5HWMA 2OT1A 1WDWA 2V82A 2J9XA 4OBTA 5K2ZA 3LOTA 3T7VA 3WK3A 1DHPA 1MEIA 4TMBA 1LCOA 1N55A 2F7FA 3BVJA 2R91A 3G1XA 4RX0A 2GVLA 4BK9A 3NNTA 3HG4A 3W1LA 5HUPA 5KZDA 2J27A 1KTNA 2WSRA 3OIXA 4HNVA 2EKCA 3BG9A 5FEPA 2J24A 2JK2A 1DOSA 4N02A 5HR6A 3GAYA 2WJZA 5LGXA 1H50A 4HPJA 5CSSA 4WOQA 2QDGA 1L6WA 5H2ZA 3UY8A 1QOQA 4TO8A 4WY0F 1P1XA 3BG5A 1M7OA 4LUJA 1OHLA 3PWAA 2RKXA 3I7SA 3CQ0A 1FX6A 1LBLA 4IX2A 4N9DA 4K7YA 1JCMP 3W7JA 3LCFA 4TX9A 1AW2A 4S1FA 1BTMA 1R46A 5AOUA 3S0CA 3UQNA 1SQ7A 3W7OA 3WFAA 3TAKA 4AMAA 4ZQRA 2KZHA 3E0IA 4M6PA 2J9YA 3QJAA 1F2JA 4LVAA 4FX7A 1XL9A 4WJEA 2H3DA 2BSLA 1R30A 3NQ8A 3W7HA 3HQ1A 1ML1A 1SFJA 3QYQA 3QMSA 1YXYA 4BI7A 1H7OA 3CU2A 1YADA 3GDLA 3QRHA 3WJWA 2QCFA 5U7SA 1PCKA 4RXGA 2C1HA 1NSJA 4Z0SA 3ATYA 2YCEA 3KVKA 2QR6A 3IGXA 3NQEA 4UFMA 2XFWA 1B4EA 4AAJA 1A53A 2Y88A 3SIZA 3KOFA 4CNNA 4UTLA 4LY8A 3V75A 2YYUA 3U2OA 2VENA 3QPYA 4JICA 3NQCA 3QPZA 3LXAA 2YW4A 1LOLA 3B06A 3LXCA 3C2RA 3T55A 2V5BA 1VYPX 3NL2A 3LHVA 5AHIA 4QJ1A 4YXGA 4TR9A 3A9IA 3UXDA 4ZVJA 4WD0A 1EIXA 3NQGA 1L6SA 4O1AA 3THQA 2ZZ7A 2AQWA 3UWVA 2Y7FA 2DJXA 2VEPA 1A5AA 2RDUA 3C2FA 5F1VA 1SU5A 4JDYA 1F73A 3M0ZA 2GVGA 3G8RA 2WNQA 2ISSA 4FXRA 5EA9A 3W1QA 4K39A 3LCWA 5H91A 1G4PA 1O5KA 5FF7A 1DJNA 3IVTA 3LERA 3MWAA 2HS6A 1KLYA 5LGZA 4LV9A 1FUYA 3FKRA 3OA3A 3STGA 1MEHA 1XM3A 3CIWA 4HNUA 3N2XA 4RLIA 4A2SA 2VEIA 1PHQA 1WBJA 2VC6A 1SZNA 4LS2A 3SY5A 5DLCA 4WY0A 3R13A 2TRSA 1VS1A 1WV2A 5ABTA 3W1PA 2A7NA 3EXSA 3WK1A 3GNNA 1G4SA 5U4NA 3IV3A 3P5YA 1VYSX 2A6LA 3QH2A 3MI3A 3LV5A 2QCEA 2Z6JA 5L9FA 3RU6A 4O1BA 4DPQA 4UXDA 2OMAA 1WYIA 3L9CA 1D3HA 1OYAA 4AHQA 3MP4A 1H60A 4YCOA 3BK0A 1DVJA 3P7YA 5D05A 1UUMA 4UTUA 5BOOA 3UWWA 3G8EA 3LV6A 2H8XA 3RF9A 5LNVA 3BLEA 5D30A 3UXAA 5F2LA 1B57A 1H7WA 4MFDA 3N19B 3UD6A 4JTSA 4QITA 1OYBA 2OJPA 1XC4A 2QCCA 3VNDA 1VHNA 1VR6A 2X1UA 3F1QA 4AVFA 3I68A 2ZRXA 3EXRA 5AC7A 1S5WA 5CPMA 4AWTA 2AAMA 3RMJA 1HTIA 5D37A 3S1XA 3GXNA 3RNDA 3DFTA 3O1NA 3W1MA 2WKJA 2ZRUA 1TB3A 3G1YA 1HO4A 5HQEA 2JKAA 1MXSA 3G18A 3SSJA 1W1ZA 3OVPA 5BMWA 3F4NA 1V5XA 1G4TA 3QSRA 3IVSA 3A5VA 1L2UA 1RQEA 1BEUA 3NYZA 3L21A 3MJYA 1ONRA 2D73A 1M5WA 3M16A 2ZCGA 3ABOA 2NUYA 4JNMA 3G1FA 3BARA 1BWKA 1U5JA 4O4VA 4JYFA 5LZLA 4AHOA 1JCJA 1LTDA 1J5TA 1IXQA 4WXYA 4POCA 5D33A 4M5PA 1TTJA 3G0SA 3NPVA 1NEYA 5LSMA 4YCPA 2ALDA 4RKAA 4WUIA 2YXGA 3GDRA 1W3IA 2CLLA 4Z1AA 4FIQA 2QAFA 1KFEA 4UTMA 3MHUA 4MIMA 3NQVA 1YYAA 1YDOA 3CHVA 4DF1A 1F76A 5EY5A 1OF8A 2WV8A 4EF9A 1B9BA 1JJKA 2I1OA 4GWEA 3TMQA 5GVJA 4PEKA 1YXDA 1D3GA 3IEBA 3DKJA 4UTHA 2Z2UA 4FB7A 3P74A 1AG1O 3TC6A 4A2RA 2QJHA 3B0VC 1VC4A 1YDVA 4FO4A 1WAUA 3LB0A 4I9AA 4U4MA 3RLUA 1N8FA 5I3FA 1VCVA 2YX0A 1WBHA 5CZTA 3W1RA 1S5VA 5CSRA 3L5LA 4NJKA 1GVOA 2NLIA 3W3OA 3NQFA 5CGQA 4NVTA 3R2GA 4OV4A 4J9JA 3UWYA 5K9XA 5I3JA 3W7IA 3S9YA 2CU0A 1EUAA 4N9EA 1OFPA 3L2IA 2QKFA 3L68A 4MYXA 4Y9AA 1LRTA 5CKSA 2HSAA 5K9DA 3N73A 1LORA 5J5DA 1M7PA 3CM4A 2OCZA 3NL6A 3OHIA 2VFIA 3E49A 4UTTA 1GVSA 3DFSA 4CQ8A 2B7QA 3GZ3A 3WK2A 3HMJG 2X1SA 4FNPA 4O53A 1LBFA 4H4IA 4OE7A 1QOPA 2WO5A 2ATMA 3LCHA 3NQ2A 2QDHA 5FEXA 3NAVA 1HUVA 2VOMA 2YR1A 3YPIA 4GXMA 4MZYA 3L5AA 3G1DA 3EEGA 1OG0A 4NX5A 4ZQCA 4QISA 5DXYA 3R5EA 1W5NA 2C6QA 1JULA 1IXOA 1H7NA 1SO3A 4Z0JA 3NQ7A 1VH7A 3W71A 2XN2A 1N7KA 1EB3A 1QNVA 2RDTA 3W2NA 4HNTA 2V2DA 4AWUA 4Z1CA 3M1ZA 3M43A 3N3MA 3L0KA 4IXHA 4AEOA 1RQBA 1FQ0A 2B7NA 1UJPA 2C15A 3SGUA 3DI0A 3W7MA 1JVNA 3DKLA 4JR5A 3PB2A 3G0UA 5G1TA 3P62A 5D2WA 1JCXA 4KFOA 1L6YA 3PF3A 3W1TA 3T78A 1ME7A 1RZMA 4NUWA 4P61A 1E51A 2QJIA 2EF9A 1TRIA 2ZRYA 1T96A 3NQDA 3EX4A 1VRDA 3FOKA 3GB6A 3W1AA 5AC6A 3TU9A 3CC1A 2A5HA 3PC0A 2ZYFA 3H54A 4LRSA 2ISWA 4DPPA 4FNTA 1YPIA 2DZPA 2Y89A 4Y90A 3BGJA 3TSBA 3B0UX 1J4EA 3LBMA 3V1PA 2E09A 1TV8A 4CLMA 1LROA 4LRTA 5TQLA 3P80A 4DELA 1XBZA 1F7BA 3LRKA 1T8XA 3LCIA 1GG0A 2E5DA 1F6PA 3PB0A 4UR8A 3SGZA 2G95A 3M9YA 4UNLA 2DP3A 2W79A 3ZFHA 3G1HA 4C1KA 4OWGA 4HNNA 3NVTA 3B04A 2P10A 3NZ1A 4HKPA 4YLWA 3WJXA 2E5BA 3CLMA 3N34A 3DFOA 4TMCA 4N2YA 3CPRA 5LNUA 1A5CA 3WJYA 5DCEA 5BW6A 2BZNA 4O0KA 4UMCA 1DKWA 4UTWC 4LVDA 4OQVA 2B7PA 2YFNA 3OVQA 4MJMA 1D9EA 1OFDA 3DHDA 3O6CA 3FYOA 3EKLA 3CB8A 1AW5A 2LLEA 5HWJA 4BWLA 3ZWTA 1QR7A 3N9RA 2NWSA 3TUUA 4CCEA 4E0CA 2JBMA 1C29A 1XBVA 3CT7A 1TMHA 1TPFA 2Y7GA 5KMYA 4A29A 2CLIA 4AWSA 2IQTA 2QAPA 4PH6A 3EWYA 4IMCA 1DL3A 4O10A 2QCMA 4Z08A 3GDKA 2GJNA 3TCEA 5G4EA 2PE4A 2DZXA 1RD5A 3K30A 1EWDA 1LBMA 3FFSA 5FESA 3DAQA 2QUUA 3FEMA 1ICQA 1CW2A 2GJLA 3MUXA 3DXIA 4PTNA 3HGJA 1I2RA 4O28A 5EBUA 1AW1A 5LNRA 4E38A 1W5OA 4WY0B 1THFD 2Z6IA 1XBXA 2R94A 4WOZA 4MVAA 3R12A 3C2OA 1GPWA 1EP1A 1H51A 3GLCA 3HF3A 1KFLA 1Y0EA 2ZTJA 3M5XA 4GNJA 4RXFA 1I8JA 4IMGA 1KFBA 1LRQA 2WSYA 2RDWA 3NQMA 5LHEA 4TU1A 2C3ZA 4UR7A 1X8FA 3MP3A 2RFGA 3KVMA 4XZ9A 4Y96A 3MMTA 2NX1A 1LLWA 1QPRA 3BW2A 1ZFJA 3B05A 4IPIA 3EB2A 2W6RA 1QWGA 1W5QA 1K8XA 1Z41A 1OFRA 3GXPA 1R2RA 3W7PA 1VZWA 3DFQA 5EPDA 3LRMA 5DY3A 1FWNA 4UCGA 2E6DA 3PVFA 3B8DA 3EWBX 3NOEA 3B4UA 4JTTA 2FLIA 2XN1A 4N4PA 3G22A 3NR0A 2WPBA 4ADTA 2W0UA 1G67A 1HFBA 4JN6A 1RPXA 5BNKA 3INPA 4JEQA 3VKJA 5AHMA 1TTPA 7TIMA 3TW7A 3HPSA 2R8WA 1TPB1 2TPSA 1R2TA 4JTJA 1TQXA 5G4WA 1I2PA 1OFBA 4Q33A 3ANYA 4IPJA 1S5TA 1TPEA 3W2KA 4JYEA 2VFHA 1QPQA 3GKFA 1TPDA 1JQVA 1TPC1 3ZS4A 1T0OA 4CNPA 2WNNA 3C2EA 1EA0A 3TQVA 2EAWA 4KWWA 3W84A 4X3ZA 5CG7A 1ZALA 2ZZ2A 3TA6A 4U28A 1ZHAA 4LUIA 3UYCA 3BGGA 1TQJA 2JGQA 2WQPA 4O52A 2E6YA 3S1UA 2NZLA 4UTIA 2C13A 3GX9A 3W7NA 1ZCOA 1DV7A 3IVUA 2DZSA 1W8SA 4ALDA 1TCDA 2DZVA 2F84A 4UUIA 2QEZA 2B4GA 3I7QA 4A22A 4ORIA 3FJ6A 2ZZ5A 1I4NA 5HULA 4K7VA 2ABBA 3THAA 2Z1BA 1IXNA 2E77A 3QFEA 3PUEA 4LC8A 3A5FA 1GVRA 4FF7A 1GJPA 5HWNA 5T26A 1LP6A 2C18A 4FNQA 1ZNNA 2BLEA 1ME9A 2I14A 3W6YA 5I3HA 4BI5A 3TROA 1B4KA 4MJZA 3LLDA 1GTEA 1WX0A 2VEKA 3DGRA 3VCRA 4N6FA 1FCQA 2BWGA 2H90A 4EVZA 2V0TA 5DBUA 3NPXA 1TSIA 4JD4A 3GVGA 3L5MA 4LC6A 3RK8A 1OFAA 3LGEA 4NNCA 3TIMA 2QCNA 3KFTA 4GUJA 3EWWA 3EX6A 1O4UA 4O12A 3HG5A 4JTEA 4XWUA 5AYXA 1X1OA 3WJSA 2GUUA 3O63A 3W9ZA 2PRLA 3TJXA 3NO5A 1T99A 1ZJIA 3UPWA 3U8GA 3MHFA 3C8FA 3LCXA 2V2HA 4UFLA 1KFKA 1M6JA 1SO5A 3PBVA 3BO9A 3QQ0A 4AF0A 3C0JA 5K7JA 1CI1A 2ZZ3A 2I9EA 4KFPA 3W85A 3ABQA 1AL7A 1Q3NA 4PODA 1VQTA 2VXNA 3C61A 1G7UA 1OF6A 1VJIA 4NJIA 2A21A 2YFOA 3M44A 1JCYA 1GVFA 1BKSA 4HSNA 2FPTA 5LNWA 3O15A 3P60A 3LI0A 5CZ0A 1FCBA 1PL9A 3L0GA 2OZ0A 3C52A 4ADSA 1H7XA 5D09A 2DZUA 2YSWA 2Y61A 3BPWA 1AMKA 1K8YA 8TIMA 4GE8A 5KZEA 3QF0A 1K02A 4FEZA 1K7XA 2TYSA 4NJJA 3IRDA 4O1DA 3P84A 1PV8A 2ZRZA 3PULA 1VCFA 3CWOX 3UPBA 4JY9A 3GXTA 5AB3A 2NXIA 3HO8A 3JR2A 3QZEA 1RR2A 2XN0A 4AB4A 1KLZA 2VFFA 3S5YA 5KINA 2HS8A 4LVFA 3EX2A 4K37A 3MO7A 1KM0A 3KXQA 3W7DA 1UCWA 3LHUA 2E5CA 1TTIA 4MPQA 1Q6RA 1EEPA 1R47A 5IBXA 2NXHA 1OK6A 1FWWA 3LRLA 4JY8A 2TMDA 2FB2A 4JX5A 2A0NA 3T40A 1XXXA 2CZEA 2FPVA 4ONVA 4QQ3A 1I2NA 5BRBA 2ZZ4A 3MYPA 3NL3A 4NJHA 3KHJA 4RR4A 1W37A 3W88A 1MO0A 3HOJA 1QO2A 1TV7A 4L4MA 3U6WA 1DBTA 4IUOA 4LNYA 3LLFA 1P5BA 3I7RA 2CLHA 4MKNA 2NXGA 3W23A 3PS7A 3BLIA 3W7CA 1KV8A 2Q3OA 4M6QA 1OFQA 3DHFA 1OABA 1G7VA 1GOXA 5AFDA 3T4CA 3TSMA 4RZ6A 2CLOA 4A21A 4WX2A 2C19A 1UASA 4JIPA 5K4ZA 3TXZA 3DZ1A 3AO0A 1IIGA 2ATSA 1Q45A 1XKYA 1FBAA 1O5XA 4UFKA 4WZHA 1EP2A 3TXVA 1F6KA 5KITA 1UB3A 3BW4A 5L6UA 3I65A 3PAJA 3W7QA 5FEZA 5EYWA 4K8HA 1IIHA 1YLVA 4MLJA 4M6VA 1A5BA 1KA9F 3L67A 1OK4A 5LNSA 2PRMA 1B3OA 4UTKA 3PM6A 1YDNA 3GR7A 4PA8A 3IIVA 2DU2A 2VFDA 1QMLA 5IM51 3UY7A 1WQ5A 4PFMA 4O11A 3FA5A 3KRSA 2PURA 2Y70A 5G2IA 3TR2A 4FNRA 6ALDA 4TIMA 1JCNA 5DCDA 5G1YA 5C5YA 3G1VA 3PG9A 5E0KA 2H3BA 4GUHA 3PR2A 3A21A 1W56A 3E12A 4X2RA 3W7GA 1F5ZA 4N9BA 4NX0A 1KM3A 2X1TA 2R14A 1I2OA 2QF7A 4JS3A 4FHAA 3E02A 4EIVA 3LTYA 1H5YA 1S3HA 4LVBA 2J88A 3A24A 5I3KA 3W75A 4MY8A 4QIUA 1FCVA 1A5SA 3PBYA 3PBUA 4NXKA 1W0MA 4H6KA 4MFEA 4NT0A 4X9SA 3W70A 1KM4A 4OGZA 1XFBA 3P82A 1AK5A 1K7EA 3B03A 2JKEA 2CLEA 4KKXA 1KFJA 1TIMA 3KRZA 1PHWA 3TQ0A 4GFSA 4XTIA 2RH9A 2DJLA 2WNZA 2X1RA 4IJBA 4UTTC 3W2MA 1G6CA 3P61A 3HPZA 5KSWA 4FXSA 2CLFA 4E2DA 4IQLA 1GVQA 1HG3A 4DBDA 1SZEA 4K8EA 1MEWA 1Z44A 1QPOA 4EWND 3HGOA 2A7PA 4JTKA 3SW6A 1A50A 3W2LA 5HINA 3HG2A 5K9CA 3P67A 4IMEA 3G0XA 4HPXA 4ORMA 1C9DA 4LW7A 2NX3A 1OFOA
chains in the Genus database with same CATH superfamily
1YDYA 8A3HA 4XUYA 2PDKA 1GHSA 1QVBA 3TZFA 1XIEA 3F03K 3RFAA 4PL1A 4MNLA 1DJZA 3QV9A 1EA9C 4I90A 3ZVHA 2Z1KA 5TBOA 3VDHA 3TA9A 2ZWZA 2CYGA 2ZTKA 4NNAA 3EX1A 4OBSA 5JIWA 3RN6A 1EPXA 2GVJA 3S2JA 2WSQA 2Q02A 2CETA 3IIOA 2C1GA 3M5ZA 5HNRA 4PTXA 1Z7AA 1V0LA 3GH7A 1ME8A 4BI6A 4HA1A 2QPUA 3EWUA 1QDSA 1QRQA 4YN5A 5DRIA 1KXVA 3ARVA 3KE0A 3TE9A 1I45A 4TTGA 5FL1A 1LT8A 4O17A 3SUTA 1KWKA 3TFCA 2YXOA 3CUFA 4BA0A 4RK8A 4J5NA 2O7QA 4MY9A 3TQKA 4IWWA 3C86A 3GKAA 4JIIX 5D32A 4QNWA 3GTXA 4DNHA 1UZ1A 3OIHA 3QY7A 1HJWA 3EXTA 3BANA 3DG6A 4AZCB 1SM9A 3D5HA 4J3ZA 4I9TA 3SR7A 4GUIA 3PNZA 1H1YA 1PTDA 4D6FA 2DFAA 3UBPC 1KKOA 2WVTA 1JEZA 3AI0A 5LHFA 2Q09A 3A3HA 3HGSA 4E4PA 5D2YA 1B3YA 2YKKA 2YW3A 1U30A 3AC0A 2WM0A 1H62A 4TVUA 1H7RA 2PWVA 2VVSA 5I3GA 2O7SA 4E3TA 4P8WA 3MBDA 2VJXA 2C14A 1MXGA 1UWAA 3OG3A 1XCFA 3RX3A 3T44A 4BWLC 4NU7A 1OT1A 2WM1A 3OO2A 2FVLA 2CIPA 3K4WA 1IWBA 2D24A 2PDYA 2PGWA 2OKTA 1MUCA 4Z17A 5A8GA 2FVKA 4LAZA 1J9YA 4Q32A 2Q71A 4YVVA 4XQ6A 2HISA 3R11A 3GYEA 3ANUA 1MUWA 1VJZA 3FAXA 3M6DA 3RILA 1SFLA 1WXJA 3A23A 3K5XA 1U1HA 5K4XA 2P53A 2NWRA 1RCXB 1REQA 1Z6KA 4IMAA 4P7OA 4JX4A 4UFIA 1Q6LA 4NF7A 1SW3A 1KBKA 4IL0A 1UH2A 1J0YA 3QBUA 3BW3A 1SR9A 2JQXA 3Q2DA 4UTJA 4NAFB 1BQCA 3B9AA 3S5NA 1VFMA 1VPXA 4LBUA 3VMPA 4EAYA 3WQWA 1UIPA 3WMCA 2XSBA 3TH6A 4KGJA 1XSJA 1E9IA 3OHMB 4DLMA 3QEZA 1KBIA 1EQPA 2VX5A 3G1SA 3UWUA 2BV9A 2VUYA 3BCJA 4ZFCA 3E6EA 2GSEA 3U7BA 4IIDA 5E93A 1EGZA 5FI8A 4GHRA 1Z8AA 4ZOBA 3U2CA 4GVGA 3SM0A 4GUGA 4GRSA 2WJEA 1OZQA 3T81A 4UCFA 1HQTA 8XIMA 3GBEA 5M5DA 4YL2A 1M65A 2DH2A 1IEWA 1VP5A 3VI2A 4KWSA 1S2TA 1MDLA 5CLWA 4PGLA 4H83A 4MADA 3EOEA 1PVNA 1O5RA 1W9BM 4PZVA 4AYSA 1SFSA 5KEZA 3UJSA 1VD6A 4JBRA 3USBA 2BXZA 1W9UA 1K7FA 4PMYA 4H01A 4LUSB 4MNMA 4DXVA 3KCJA 2XVPA 4S3DA 3PUOA 4OJYA 1PS9A 4H9YA 3VOGA 5I07A 3UXIA 2XZ7A 3LBCA 1ADSA 4PCFA 3SCPA 3DENA 3O06A 3VX1A 1EBGA 2UY4A 3EA2A 3WQPA 4R85A 2PC8A 3GG7A 3E1F1 3LMYA 2GPTA 4L4LA 5IOBA 4QDPA 2POTA 1H49A 1VYRA 5CG0A 3BLFA 1DWGM 3TYBA 1ICPA 2AGKA 2XVNA 4AHPA 1NF0A 1GQKA 2WVVA 4HIBA 4Q6JA 3I3BA 3W1XA 3P8JA 5CZJA 5XINA 3LHWA 2X41A 3FHAA 2GOKA 3QTPA 1S46A 3GW0A 2BOGX 4WGXA 2OYMA 3VE7A 5C9RA 4PMOA 1TV4A 1XYAA 3KW3A 3N3TA 4NZFA 4DQWA 2ACRA 2BXVA 6A3HA 5AHNA 1VLIA 3B3DA 1Q7QA 3E2RA 4QP0A 1JZ5A 4K1GA 3WQ8A 1E0XA 3HURA 2PPGA 2VC7A 2G97A 2XIOA 3N9SA 1LLZA 2Y6ZA 3IUHA 2GDUA 6TIMA 1TREA 1JAKA 2KX9A 1LRNA 1Z48A 2WXDM 4PBGA 1WKYA 2Q8LA 5BYWA 1CB7B 5EFFA 1TRDA 3F4WA 5G2WA 3SZ8A 1E3XA 2W66A 2ZA1A 1F6YA 5FF3A 3FJ4A 4CCDA 1DJIA 3GU1A 2QUVA 3M46A 4B5NA 1H1ZA 2BHZA 4JZ5A 4UFHA 7PTDA 5A95A 5EGRA 2V8ZA 3CV7A 2ZA2A 3W7RA 3AXXA 1XLKA 3G6MA 1XCXA 1FWFC 1Z3NA 1LQ0A 1DP0A 3I10A 2QJMA 1W31A 3NZPA 3GHSA 1TJPA 1MSSA 3E96A 1FFQA 2CLMA 1GG1A 2PLKA 2WWCA 1H09A 2HPMA 2ZZ1A 2O4QA 5EMUA 1JRBA 2VGFA 2I16A 5JH1A 1AH3A 3WF0A 3ITCA 1EX5A 2TSYA 4EAMA 2PCEA 1JRCA 3M7WA 3EPMA 2V30A 3D46A 5EL1A 1SZGA 3UWZA 1LQAA 1VCGA 2WWDA 2F38A 4IL2A 2J79A 4ICNA 1H0IA 1Q6QA 1PX8A 3LHYA 4JFWA 1XIGA 1WZLA 3AHXA 5CPNA 1KRCC 5AHLA 3H26A 1UWIA 1WUEA 5DELA 3W0KA 1EPVA 4KWOA 1HKWA 1W3KA 3S42A 5HR7A 3M0HA 4M80A 3ABZA 4QNEA 3PUDA 3WD2A 1YNYA 1XDMA 4X63A 1V93A 3EBVA 1EIBA 3WCZA 4DI9A 4XO6A 1R3QA 2DORA 1GVEA 1TO3A 2W92A 9XIAA 1BVZA 1KFCA 2DUAA 1PKLA 3CTLA 1TTQA 4FIRA 1F3XA 3FSUA 2YL5A 2OEKA 1RY8A 5LA1A 3VNIA 1HKKA 3N6QA 2QUTA 2GQAA 3B9NA 3IGUA 4JTUA 1AH4A 2WZHA 1I6NA 1YXCA 4I8DA 2EHHA 4Z1DA 3VAVA 5EMMA 3FYPA 4KRTA 4NZ3A 5C6MA 2HCVA 3AFBA 3AWOA 3ABSA 3DH7A 3WH5A 2B0MA 2VFEA 1M53A 1K9TA 3VOFA 1X6UA 3IK4A 1HO1A 4ZO9A 4XKYB 4JTIA 3N13A 3GXDA 3ERPA 4G1NA 1WE5A 3AIBA 1Q6CA 4RUBA 1ZAJA 3U0HA 4AZ7A 1Q6OA 3VDCA 4D71A 4DJDD 4ZGYA 3WQOA 3KX6A 1V7YA 2JF6A 3Q58A 4O4WA 2NQ5A 1GUVA 1P0NA 1XYFA 3CL8A 1AJ0A 2XIQA 1POJA 2BASA 1FWJC 1EXPA 3NA8A 4BS0A 1GZGA 3OYZA 1LYXA 4R88A 5ECVA 4AC7C 1GQNA 4LNCA 2DPEA 1J0ZA 2BY1A 2OR2A 1GT8A 1VJSA 2W4XA 1Q6DA 4MDPA 4B5WA 4JKMA 4RPPA 1H7PA 1UMYA 1Z42A 2B7OA 1VLWA 4IGHA 2XUCA 4FOUA 3KAOA 1RJRA 1E6ZA 4XAFA 4WKFA 3HV9A 5LIWX 2CLKA 3CH0A 3SCQA 1XLDA 1YTKA 4UNKA 5FF2A 3F2DA 1WXYA 1Y5WA 4TV5A 4DJED 1UR1A 2CHNA 1AZ1A 1R9XA 2Y7DA 4N4QA 1WDWA 3NIYA 2V82A 2J9XA 4ES4A 4JQAA 5BXRA 2J25A 1UR8A 2CXEA 1DHPA 3MQTA 1LCOA 2OGYA 1LJYA 1TE1A 2W27A 4C6NA 2F7FA 4M81A 4C6IA 3QHNA 3BVJA 1OGGA 2XM2A 4GKTA 4BK9A 3HG4A 4AIEA 4D6JA 2J27A 1KTNA 3RLGA 1HKIA 3M0XA 4DNMA 1TUFA 1WUFA 5HR6A 1W1IE 4OBRA 5BZAA 5CSSA 1PKYA 4WOQA 1GOMA 1MMFA 3VM7A 3BCDA 2HK1A 4WY0F 4W8LA 2A3LA 2Z7GA 1E4NA 3I7SA 4JEJA 1NARA 2P3ZA 4N9DA 3TN6A 1QBAA 2YL9A 2YB1A 3LCFA 1WP6A 5GJNA 3T42A 5I5RA 3OQEA 2EQDA 3SCSA 3TAKA 1A0CA 4A35A 4RE3A 4KGLA 2J9YA 1LL7A 1XL9A 3RM4A 1R30A 4XSLA 3NQ8A 2QIWA 3HQ1A 1SFJA 4YYFA 3GNRA 1YXYA 4BI7A 4GIAA 1H7OA 2V5KA 4LYQA 4RXGA 3MZ2A 5HPCA 1NSJA 1TVPA 3ATYA 3VOJA 1MVYA 4CCZA 2QR6A 5FSDC 4AAJA 1GHRA 3KEHA 5CLTA 3ZO9A 2XFFA 3KOFA 3MSYA 4CNNA 4UTLA 4DJDA 1R5YA 3NSNA 4BQ3A 3WUGA 1JDCA 1LOLA 3B06A 3EYPA 2VVNA 3R43A 4HYRA 3C2RA 1P7TB 1EHNA 1EQCA 4OTKA 4PCTA 3I6EA 1RCQA 3NL2A 4TR9A 4QLJA 3W82A 3FAWA 5ABFA 1EIXA 4DWSD 3NQGA 1L6SA 5C71A 4C1NB 3ZT7A 2Y7FA 3ENLA 5I09A 3QPEA 2CERA 3ZYZA 5F1VA 1SU5A 1J0HA 4JKLA 4XVDA 4JDYA 4M1BA 1B2YA 1IT8A 4P7QA 4WDXA 1EXBA 2J78A 3LERA 3BMWA 5A6MA 4TX8A 1J0IA 5LGZA 1RBLA 1MW3A 3FDGA 1FUYA 2OB3A 4LH8A 1V6UA 4IFKB 1MEHA 3S83A 3OZOA 4DJEA 3BLLA 3N2XA 4RLIA 4Y9NA 4RL3A 2VC6A 1SZNA 4LS2A 3K8KA 3R13A 1NDYA 1VS1A 5ABTA 5FJUA 3EXSA 2BGNE 3GNNA 2OXNA 3WQGA 5U4NA 2VRQA 3OW1A 2TODA 2A6LA 3QH2A 3LSBA 4B3ZA 4DJFD 3U5UA 4AQLA 3MI3A 5LIXX 4P5UA 4QE1A 3ONCA 1R0MA 3T0DA 2QCEA 4X9YA 2ZX8A 2FZ8A 2WBGA 1D3HA 5CZKA 2XM1A 5D05A 2H9AA 3AZSA 1JZ4A 1C7SA 3LV6A 1UH3A 3BLEA 3O3RA 1DJXA 3EAUA 4G7EA 5D30A 3UXAA 1QI2A 5TD4A 2V3DA 4H6EA 3W24A 3UD6A 3TNBA 2OZ8A 2ISDA 3NWRA 4JTSA 1OYBA 3VNDA 1XC4A 3F4DA 1VHNA 3LNPA 3I68A 2ZRXA 1IZCA 1B31A 4AD3A 2DUXA 3VD9A 1XIBA 4AWTA 1BYDA 3S1XA 3GG0A 4DWDA 3W1MA 3ARZA 2ZRUA 1TB3A 1HO4A 1P6CA 3IVSA 2Y24A 5FOOA 1HXJA 1DJHA 3F5JA 3R58A 1Y5VA 1A80A 3ZR6A 3ABOA 1HVXA 2NUYA 3G1FA 3K13A 4WDWA 2AOSA 4POCA 3N6HA 3EDJA 4M5PA 1TTJA 1NEYA 1MW1A 5LSMA 4WUIA 1W3IA 2Y2WA 4IISA 4W5ZA 4MIMA 3CT2A 1RUSA 1YDOA 1QNPA 4P7LA 1ISZA 2ZXBA 4EF9A 3CHFA 3FA3A 4PEEA 1Q66A 2F8QA 3QVQA 1D3GA 3CHCA 2JIWA 3DKJA 3SY8A 1ZBKA 2Z2UA 3BQ5A 3GVVA 3Q65A 2VRJA 4UWMA 4XZWA 3STPA 4LB4A 1WAUA 3LB0A 4DWSA 2Y5SA 4HN8A 4U4MA 2QMJA 2ZUSA 3TTOA 1FWCC 3DECA 2WANA 2DH3A 1K6AA 3UNTA 5CSRA 1S5VA 3L5LA 1NWUA 4J1OA 5CGQA 4US5A 3B8VA 3KLLA 2FTYA 3NO1A 2GWGA 1POKA 3S9YA 2CU0A 2JFEX 3ITGA 1EUAA 4MTVA 3ALFA 2QKFA 2OKOA 3AMLA 3P0XA 3WLHA 3FVDA 1F8IA 2R1LA 4CD6A 4DZHA 3NL6A 3AHVA 2OLHA 2B7QA 2IKJA 3GZ3A 4LX4A 3VGHA 3HMJG 1BXCA 5XIMA 1XLEA 3WH7A 1LBFA 3SQSA 2DQWA 5FEXA 1EJTC 4FLRA 3GC4A 1LWJA 4DJFA 2VOMA 5I77A 3G1DA 4AMCA 1LL6A 1X38A 3CLWA 1NU5A 3VTRA 2WLZA 4QISA 2VZTA 4ZB5A 1W5NA 2C6QA 1H7NA 4GQBA 4CQCA 2REQB 3B8TA 4G2DA 4JFTA 1QNVA 1G9HA 1LG1A 4HNTA 4LFYA 4GYKA 4MKVA 3O0FA 3JU2A 5BOEA 3N3MA 1TR1A 3WUEA 5DRCA 4XISA 4AVOA 4AUBA 2C15A 1J5SA 1J2BA 3AS3A 3USZA 4DBUA 3W7MA 3PUGA 3UJ2A 5G1TA 2C1IA 3DFHA 1L6YA 1GOOA 3PF3A 1ME7A 3U9IA 3EPNA 3AIEA 4JQ2A 1X97A 3T0TA 3W02A 3PZNA 1M1BA 3EX4A 1VRDA 4E6MA 1UWRA 4I9JA 3HTWA 3H54A 4LRSA 4FNTA 3TR9A 4YVXA 3V5CA 4B3LA 2Y89A 4UOQA 4Y90A 3LBMA 1X6LA 1CGYA 2I5IA 1LROA 4KEUA 3FDKA 3M07A 5C8BB 4HK6A 4B4FA 3G5EA 1IE7C 3QZAA 2QPSA 1GG0A 2E5DA 3H2OA 4UR8A 2O56A 1E6RA 5A94A 3AAMA 1DXFA 3LPGA 4PUWA 3M9YA 3ZFHA 1DIDA 3NVTA 1QW9A 4C7FA 1UR3M 4HKPA 3DFOA 4W7UA 2PAJA 1OM0A 4N2YA 3CPRA 3E5PA 4NZ1A 3WJYA 5DCEA 1DKWA 3S4TA 4Q8OA 4LVDA 3RCMA 4IPLA 3KBVA 4OQVA 3OVQA 2B7PA 2PWDA 4CQDA 4BEUA 1D9EA 3UEQA 3ITLA 4CD5A 5CC5A 4AZ6A 3GHUA 1KGUA 4BHYA 2NWSA 3TUUA 3PTKA 4E0CA 4HU0A 1TMHA 5KMYA 2Y7GA 3O9NA 4A29A 2IQTA 3WFZA 2QAPA 1XS2A 3EWYA 5C9XA 4L6OA 3AU2A 1N82A 1MQQA 1YBQB 4DAFA 1EWDA 3FFSA 3DAQA 3RXZA 1Z69A 5LIYX 4C90A 3IJ6A 3T08A 3DXIA 2UBPC 2IKHA 4PTNA 3GNPA 1ITQA 3COTA 4WY0B 2C79A 1ITUA 1FWIC 1VFLA 2R94A 4MWAB 3QKZA 2O9PA 4MVAA 1GPWA 3GLCA 3HF3A 3UPMA 1J6PA 2WSYA 1RP9A 1TZZA 4AIUA 4O1EA 4TU1A 2D23A 4GBDA 1KCLA 2RFGA 1PZ0A 3KVMA 4F4RA 4ILSA 1IWPA 2WZEA 1QPRA 1RY0A 4IPIA 1W5QA 1BVWA 4XVEA 1QATA 1RJQA 3VNYA 3W7PA 1VZWA 3HMCA 4XX6A 3U2EA 2XH2A 3NOEA 1J93A 2FLIA 1DEDA 1QI4A 1UC5A 3ALGA 2WPBA 5M17A 1W2VA 2W0UA 2A79A 3KM8A 1R86A 1RPXA 4PBFA 3DYOA 3INPA 3WFLA 4RDVA 1V02E 1K77A 1S38A 1R3SA 4BZYA 1FVPA 1LT7A 3PP7A 1PTGA 2TPSA 3LLXA 3REQB 3AWNA 3UG5A 4RW3A 2Z2AA 1WXZA 4P8VA 3ZLFA 1I75A 1P0DA 1V0NA 4LALA 3OPSA 3WQEA 4JYEA 3IJ8A 2VFHA 1TPDA 1JQVA 4PMVA 3ZS4A 1T0OA 4CNPA 1Q13A 3CO4A 3WLTA 4P7RA 3MCOA 4H8UA 2EAWA 1E43A 2PEVA 4AZCA 3TA6A 4AD1A 2XU2A 1WKFA 1HN1A 1P6WA 2JGQA 3T0CA 3WBYA 2NZLA 2C13A 1W8SA 4E4UA 4DX3A 1TCDA 1DXIA 3NFUA 1XIMA 4FXFA 4LAKA 6XIMA 1I4NA 2DUZA 3LA4A 2Z1BA 4LC8A 2V6AA 1Q2RA 3CUJA 3TTEA 1GJPA 2AMGA 4QQUA 2VMFA 5HBFA 3K8MA 3IAPA 2BLEA 1XRTA 4MJZA 1KWGA 4ERIA 2VD8A 4EVZA 4ACZA 3EDEA 4JD4A 3GVGA 1GGOA 3L5MA 1TFVA 1OFAA 3RK8A 2F9RA 2ZADA 4NNCA 4QXIA 2ZVIA 2V68A 3IWPA 3H7RA 4XWUA 1X1OA 4H2CA 3KZSA 4OVXA 2PDFA 4S3GA 4UFLA 2FZMA 1KFKA 2BVYA 1SO5A 4JCMA 3PNUA 2I9EA 4DJEC 1KD0A 4KFPA 3W85A 3BAKA 1EOKA 2CPUA 3B40A 5A8PA 4HPGA 3C61A 4IFOA 1G7UA 1OF6A 1IEXA 1XYBA 1GVFA 1FHVA 3F2CA 2Y5EA 4XAGA 4E8DA 3P60A 3LI0A 5LNWA 1FCBA 4L61A 2GGJA 3C52A 2X42A 1UBPC 4KCTA 1K8YA 1X6NA 1K02A 2TYSA 4NAFA 3IRDA 3WBEA 3P84A 3H22A 3EGJA 1J01A 4JY9A 1XSKA 1KQZA 3AS1A 4QROA 4NL1A 5C2CA 1RR2A 4YTSA 4ROQA 3FYYA 1NP0A 2HS8A 3EX2A 4K37A 3VINA 3KXQA 1UCWA 3LHUA 4MPQA 5T9BG 2NXHA 3OTRA 1LWHA 1QK0A 4NILA 2ACUA 1R3VA 4EPDC 4YYCA 4ONVA 2ZZ4A 3OJGA 5GJMA 4GH1A 3SCRA 2X0YA 1FWEC 3TTQA 1MO0A 3GFXA 3CQKA 2NVCA 1QO2A 4LNYA 1P5BA 1MW0A 4AG0A 3W23A 3PS7A 3BLIA 4KCVA 2Q3OA 1G7VA 1UD2A 3ZVHB 4HNCA 2C19A 3D3FA 4Z2LA 2YZ5A 3AO0A 4HZMA 2PLJA 2ATSA 4H6RA 5AY7A 5M03A 4WZHA 3EMQA 3GBDA 4E2VA 3RITA 2ZX5A 2YXXA 3KTCA 2R1MA 4K8HA 1H0GA 4MLJA 4CD8A 4PUUA 2ON3A 3OU8A 3WF4A 1KQYA 2XGZA 4UTKA 1F3WA 1TJ0A 5C2GA 2WYSA 4L64A 2D3NA 1QMLA 4YHEA 1HP5A 2BP1A 3TR2A 4FNRA 4DWSC 5IRPA 2D2GA 4H7VA 4TIMA 4CN6A 1B3WA 3EB4A 4CEXC 5C5YA 4XAZA 3RM8A 2VGGA 3PG9A 4GISA 3URNA 2H3BA 1HZYA 3PR2A 1DIOA 3A21A 5HJXA 4X2RA 3W7GA 1F5ZA 3MB9A 1I2OA 3S9IA 4EIVA 4B9ZA 1UR2A 2Z26A 4PCSA 2JIEA 1QJWA 3XINA 4MY8A 3QKEA 4H6KA 4MFEA 1KM4A 4IJRA 3DYMA 3MZNA 1XFBA 1K7EA 1P48A 1J11A 2JKEA 2CLEA 2QYGA 1HL8A 1Z9AA 1ONEA 3GZAA 3VZYA 3TQ0A 2QDEA 2VR5A 3DEQA 4PR4A 4CQBA 2WNZA 2X1RA 2DT2A 2FHFA 1G6CA 1Q6EA 4M8UA 5BXPA 2ICSA 5KSWA 3GHRA 4FXSA 4E2DA 4HCLA 1S2UA 2QHAA 4K8EA 4RW5A 1MEWA 1QPOA 3TJ4A 1UKQA 4JTKA 3SW6A 2PDIA 4C60A 3SCOA 5HINA 2ONEA 3HG2A 1VBRA 1GOQA 2OEJA 3GNXA 1UW9A 1TPH1 3CWNA 3O6YX 1DORA 3DBPA 4IX0A 2PCQA 5IHRA 5DEZA 5B7ZA 3LMZA 2YA1A 3HBLA 4M82A 1IEQA 2R6OA 3VD4A 3GE7A 2ZDRA 2WPGA 5AYIA 1NDVA 1DYSA 5DCBA 3RR4A 1FA2A 3LU2A 4ZFMA 3BG3A 1KXHA 3OVGA 2B81A 1P4CA 4HHPA 1HGWA 4BKNA 4OOZA 4DIAA 2CBUA 2A6NA 1CCWB 4GXWA 4XZIA 5CAKA 3MI6A 3N14A 3ZJ7A 1Q7MA 3W2JA 1N8IA 5AHEA 3N2BA 1F61A 1OBAA 5LKYA 5FJOA 2YA0A 5CJ5A 2R1PA 2YDSA 1UOKA 1XCWA 5A6SA 3OA5A 2BY3A 1J0JA 3WLRA 4W88A 3I4KA 5FF0A 3O6DA 3SJ3A 2Z27A 1XI3A 2XG9A 3ZR4A 2C16A 4X61A 5FEWA 2YPIA 3PTDA 2CHOA 3UWEA 1AODA 4LYKA 4AXKA 5A69A 3TFXA 1SJDA 3APYA 3CIXA 2VR2A 2FH8A 5BRQA 3DFNA 3GTFA 1FWRA 3V0SA 1FHDA 4R53A 2YDAA 1UBSA 4I5RA 3GNDA 3UXLA 1JUKA 4DBEA 4Z2JA 2PTXA 4QBXA 4X22A 1LQ2A 2OZ3A 2DDXA 2DZTA 2VKZG 2QXWA 1XD0A 4QR6A 4PBEA 3SCNA 3ZVIA 2P8BA 3OZYA 1BQGA 3TN5A 4MUZA 2PWEA 1FDJA 3VXGA 4UZSA 3G1AA 2NVDA 3N11A 1B3VA 4GIRA 4XKYA 1U33A 2WMIB 1GK8A 4ATWA 4V1YA 1OGBA 3BICA 2WZIA 2Z0IA 1UIOA 1FHUA 4BF9A 3V16A 4O19A 3T0AA 1R3TA 3MYOA 1DWFM 4ZL1A 3WNNA 2ACSA 3W72A 5A6BA 2ZA3A 3KOXA 3LHTA 4W8AA 5IHSA 4C5ZA 3ZIZA 3QTGA 4GABA 3CEUA 3S1VA 4AF0B 4EPEC 5J5RA 4FS9A 4NHVA 2WVVB 3CEPA 2Z2BA 4J2MA 4XUGA 3UZ5A 1DJWA 4G1KA 4PUDA 3CHDA 1EO7A 1XDLA 2G41A 3TKFA 1D2KA 4PB4A 3ARRA 2NSOA 3ZJ8A 5G1MA 4N9CA 3G24A 5I3IA 1KM5A 3AJXA 2QCDA 3HPXA 5CQ1A 3CWHA 3L4UA 4AD0A 1OX4A 3AMDA 4KIEA 5F7UA 4FF5A 4U2ZA 2A2IA 2NQHA 5DMNA 1K3UA 1XUZA 4JX6A 4LBRA 1ZBCA 1PO9A 1DJQA 4Q4RA 4YMZA 5E09A 3ZR5A 3M6YA 2V9DA 1XQKA 4AD5A 3O2LA 3LDVA 2CBJA 1CIUA 3NYDA 2ZZ6A 5DANA 1VGAA 4A3HA 5MHBA 2CZ5A 4XBSA 4I7VA 4Q8UA 4RZ4A 2VDHA 1WZKA 5RUBA 1OT2A 3KS5A 1TG7A 3MI2A 2XFYA 1A3HA 2HTMA 3QFWA 5AYZA 1DWAM 1CX9A 1NDWA 5TAOA 4NZJA 3PPCA 4UMAA 2WKLA 5GQBA 4MLRA 3NQAA 3GIYA 1EOMA 4F3HA 3DUGA 3AALA 3PZUA 4L1WA 1H3GA 1ZAHA 3F2BA 3Q94A 4KS0A 1GYLA 1U5VA 1EC8A 3HGRA 6PTDA 3NM1A 2A4AA 4RE2A 4DXKA 1BF6A 2O92A 1FXQA 3NEVA 2DGAA 3VGEA 4YJ5A 1XLGA 4DO4A 2WNWA 2YA2A 1BVNP 1W54A 4WHBA 3WLJA 4D2JA 1L6FA 3C2VA 3LYEA 4GIYA 3WDHA 1VEPA 3VIGA 2D2HA 4M3PA 2X7VA 3BTNA 5F4WA 4XD6A 4IFRA 4H6QA 1XLCA 1RAKA 4B5XA 4QG8A 2VL4A 4O8RA 5D2TA 5FKYA 4Y6GA 1SW7A 1VIWA 1RXOB 1TE6A 2PTZA 4O16A 2X0HA 4MZ1A 3MJMA 2GGIA 2X16A 2CC0A 1MZRA 2WCAA 2CXGA 3FJLA 4C6QA 1FCUA 2YYTA 4K38A 3L65A 4ERAA 3SN1A 3QQWA 1K8ZA 4GXPA 2B31A 3GUGA 1UR0A 2Z00A 4HT3A 3GIQA 3DDMA 1ZB5A 1V3LA 1TPUA 1XYMA 1OFEA 4QAIA 4JIRA 2WMGA 7XIMA 1UQZA 2JALA 1AQHA 2XIMA 1PEZA 3QMRA 3LY0A 4Q4KA 4NKCA 4W86A 3FS2A 1TV2A 4MYAA 1ALDA 3BSMA 3F4CA 4PMXA 3ZLHA 4DYKA 1P7TA 4AC1X 2J4GA 5EKYA 4S39A 1G69A 2Y85A 1V3MA 3RM9A 5HOSA 1ZBWA 2WSPA 3ZSSA 2NUWA 2QS8A 3VPLA 3GDMA 3PY2A 3UWQA 4C1NA 3M5YA 2HXTA 3URBA 4O54A 5BXSA 4S2CA 1EL3A 1AD4A 3O05A 1TX0A 1M68A 3CUHA 1MFUA 1A4LA 1L0PA 1GYMA 3S6TA 2BX7A 5D03A 3T8QA 5A8MA 1TV5A 5G2HA 4EOUA 4RDYA 4WXZA 2RGLA 2C91A 1FTXA 3L4YA 2XINA 3UR7A 4DO6A 1LM1A 5K3VA 3LENA 4BR1A 1S39A 1A5MC 4GK8A 1W5MA 3TQPA 2WMJA 2J77A 5EBAA 4B5TA 4O13A 3QC3A 1KR1A 3UERA 3W37A 5F4XA 5C9UA 3AXMA 5DY2A 1V3IA 2GFTA 5CAHA 4MNKA 2EGZA 3A4AA 2VURA 3MSRA 3C3NA 1PWLA 3HN3A 3L4ZA 3K4AA 1QI3A 4J2PA 3VIMA 4AX7A 5C9WA 4DB7A 1UR4A 2WHKA 1KTCA 3M5VA 2PDPA 3F5KA 2OTDA 3VA8A 5FJJA 3WDQA 3ITYA 2FMNA 1JPKA 4MKSA 4PC8A 4J40A 1NQ6A 4DEFA 2BXYA 2QMKA 2OSXA 4FNUA 1IXPA 2OEMA 2EXOA 4CD7A 3UNDA 1P1MA 3Q37A 4O50A 2FGBA 4M6UA 4CVUA 4LOCA 2X7WA 2X30A 4GUFA 3W83A 3KS6A 2RAGA 3OBAA 4WSJA 2IQ0A 1M41A 4HNOA 3OZMA 1DE6A 3RRAA 3U7VA 4V27A 3JVAA 3WBXA 1S1RA 2ZQ0A 1XFCA 3W00A 1ONXA 2P0IA 4XAYA 1J0KA 5FF4A 4ZQMA 5TIMA 1V7AA 2V2CA 3WZ0E 4F2BA 1H1NA 5CSUA 3H55A 4UQAA 4EXAA 2V81A 1V08A 3EKZA 2GJXB 2PDJA 5CC6A 5CPOA 3VC6A 5D2VA 1E15A 2OQYA 3B8IA 1SSGA 1US2A 1K9EA 4AIOA 1BWLA 5A5WA 4IIEA 3FLUA 4O18A 1JL8A 5PTDA 4O1CA 4JN7A 3NZRA 4I8YA 4I7WA 2A7RA 3LM7A 4KCWA 2YL6A 3WBWA 5DN1A 2XSXA 2HE8A 4DUWA 5ABEA 4UQBA 4G56A 4JTFA 1KGWA 4K2SA 3B0PA 4DN1A 1QHPA 4YNGA 1WO2A 4Y9OA 3PSWA 5EU9A 3CL6A 3QQ1A 1JPMA 4GMEA 2C0AA 4TUFA 1BFNA 3WENA 2ZVRA 4NASA 4UTWA 2C0HA 1O6IA 4LSBA 1BLIA 3LCGA 2ISFA 4GO8A 2O55A 1HKMA 1E4LA 1W91A 1EDTA 2W61A 3KBMA 4U5KA 4E3VA 1AZ2A 2CWNA 4QE5A 1TJ1A 1ITCA 5CPQA 3A3XA 4FR1A 1LZOA 2CFFA 3HIJA 2OZTA 1EZ2A 3QZ6A 4DZ5A 1RLDA 4D8AA 5FJPA 4JYDA 1L8NA 4ZCWA 3PG8A 4R7OA 4OBTA 2FDMA 4MWAD 2WVUA 1MEIA 2OOFA 2XTKA 3VC5A 1V0MA 3IJQA 4KF1A 2Q6ZA 1V6TA 3NNTA 3TYDA 3V35A 3IK2A 1TVNA 4N0RA 1CXFA 2ZUTA 2EKCA 2ZC8A 5FEPA 4QAWA 2J24A 2JK2A 3H7VA 3S2CA 2FTWA 3VIJA 2HNHA 2X40A 2WJZA 1H50A 5GNXA 3CPUA 2PGEA 4QLKA 5H2ZA 1VIZA 1QOQA 4TO8A 3FCPA 5GNZA 3FY1A 3BG5A 1SVDA 2WC3A 1KFWA 4V15A 4K1WA 2RKXA 2G3IA 4IX2A 5E6ZA 4TX9A 1TMQA 4S1FA 2GJRA 1BTMA 5AOUA 1BAGA 3S0CA 3UQNA 1N8WA 1JZ2A 1CECA 1R8LA 4L56A 4AMAA 4JTDA 3VNZA 5IXEA 3B8WA 3IUDA 4MHBA 2X2YA 1C91A 3MMWA 2V63A 2WC7A 4WJEA 2H9AB 4H2HA 4FPSA 3W7HA 1ML1A 3BSGA 1TELA 3CU2A 3LGGA 3E2QA 3WJWA 2QCFA 5U7SA 1PCKA 4KERA 4Z0SA 1E40A 2YCEA 3WH9A 4JHOA 2OWXA 3KVKA 1G01A 3ITXA 4HHHA 4UFMA 4AWEA 4AEEA 4JNZA 3BMXA 1ISYA 3SIZA 1E0UA 5FA5A 5HNNA 4F0MA 3U2OA 5BWAA 3QPYA 1VEMA 2DVTA 2OG9A 3LXAA 3AMKA 3CZLA 3LXCA 1HIZA 4QDWA 3CAVA 4B91A 2POZA 1VYPX 5FJTA 2ANUA 4YXGA 3R8HA 5B80A 3UXDA 4ZVJA 4BCEA 2PFHA 3THQA 1XQLA 3NZGA 5C70A 2PI6A 2RDUA 4PRTA 2XWDA 4PUMA 4R9OA 2X8RA 1AVAA 2YDQA 3B9DA 2GVGA 3G8RA 2WNQA 1DJGA 4A8IA 1XINA 4FXRA 3W1QA 1EF3A 3LCWA 1EH9A 3VNMA 3N18A 4X0NA 3DHUA 3GXIA 1O5KA 1DJNA 4I9MA 3IVTA 1E9ZB 1GVYA 1KLYA 4HMEA 1YBQA 4AEFA 4LYPA 1B9ZA 1UWSA 5DF0A 1FRBA 1JGMA 3SEPA 1ISWA 1XM3A 3CIWA 1BTCA 2YCKX 2I5QA 4UQCA 2XGIA 4HNUA 4R5EA 3VO0A 2OSYA 1LWIA 4WY0A 3WD0A 2MUCA 1FOBA 2A7NA 3WK1A 1TA3B 2PDCA 4MWAA 3FGCB 5A2CA 1G4SA 2WBKA 2IMRA 1VYSX 3TTSA 3NSXA 3S9ZA 4HYVA 4GIEA 1BF2A 1HF6A 5L9FA 2Z6JA 1J96A 1JYVA 2A3EA 4UXDA 1WYIA 4KETA 1V3HA 1QXLA 1H60A 1GCYA 3L4XA 3N2OA 5BRPA 1NQKA 5BOOA 3K1DA 3UWWA 1Y5XA 3G8EA 1OD0A 3RF9A 2E7FA 5LNVA 1I0BA 3GNOA 1ZLPA 4XKMA 4PMZA 1JF6A 2A3BA 1CXIA 5FL0A 1HKVA 1R7OA 4W93A 2QCCA 2V3GA 3NVDA 3EXRA 2D1ZA 1S5WA 2V69A 5CPMA 4IGMA 1HTIA 4JQ3A 3GXNA 1ELSA 3GWQA 4FOJA 3DFTA 3REQA 2QULA 3CTTA 3G1YA 3A13A 3R0DA 3G18A 1W1ZA 4AZGA 4YVPA 3OVPA 3F4NA 1G4TA 3QSRA 3A5VA 4OECA 2UY3A 1GZ1A 3NYZA 2EJ1A 3EWCA 1RJPA 3AU6A 1CLVA 1KCKA 3M16A 2ZCGA 1ZBVA 4L1GA 3UG4A 3BH4A 3BARA 4EPBC 4WF7A 1WAWA 4JYFA 5LZLA 3RG6A 4AHOA 2QF8A 1IXQA 1E6QM 1XW8A 1Q85A 5D33A 3G0SA 3T09A 3CV1A 4U5IA 2ALDA 2D20A 3SN4A 1LG2A 4XV0A 4Y7EA 3GDRA 4Q4OA 4Z1AA 2HRWA 4FIQA 4OZOA 4UTMA 1XH2A 3MHUA 4GI9A 3H4GA 1QT1A 3CHVA 4DF1A 1VENA 3H21A 4GVFA 1F76A 1OF8A 5HK4A 3SRHA 1JJKA 2I1OA 4MSSA 4GWEA 1YXDA 4ZB2A 3VD3A 4D72A 4IQEA 5CC3A 4QRNA 3EDKA 2XZ9A 1YDVA 4I9AA 4E8GA 1KBBA 3SADA 1CPUA 3L2MA 1VCVA 2YX0A 3AOFA 1WBHA 5CZTA 3BLDA 3W1RA 2NLIA 3W3OA 3NQFA 4C6BA 4KCUA 1CLXA 1QWKA 3UA3A 4J9JA 2QDDA 5I3JA 1F3TA 4W89A 2BVDA 1VKFA 4XIAA 4GQGA 4Q22A 4N9EA 1H41A 4Y9AA 4C6FA 5I06A 3A47A 1PPIA 1LORA 3C2YA 3UXKA 2XH4A 3AYSA 4OIFA 3CBWA 1BKHA 4PSPA 1OSEA 4UTTA 1GVSA 1ZJBA 3DFSA 2RJHA 4ICMA 1K1DA 2Z24A 3WLQA 3DC8A 4HBKA 4O53A 4GY0A 4H4IA 4OE7A 2WO5A 4XZLX 4AZ5A 2QDHA 4GI4A 2WAGA 4MZYA 3L5AA 3EEGA 3TOYA 1OG0A 1Q6GA 1VFFA 5DXYA 1QW7A 4W87A 3R5EA 3W38A 1LUCB 3N2TA 1SO3A 4WR3A 1OCNA 5A6TC 3NQ7A 3SBFA 3W71A 3LD5A 2ZXAA 2XN2A 4JL2A 2RDTA 3PPGA 4AWUA 1YX1A 3LEPA 2V67A 1BRLA 3L0KA 5LA2A 1XRFA 1UJPA 4GYJA 5MKGB 3SGUA 4J3WA 1NOFA 3DI0A 1NWRA 5LIUX 3SUUA 4JR5A 3P62A 3WMSA 1JCXA 1ECEA 4H9VA 2VZSA 1S2AA 3R1ZA 4CNUA 4NUWA 1E51A 1UH4A 1SMAA 4R7WA 8XIAA 2EF9A 1WNOA 4J35A 2GSHA 2ZRYA 1T96A 4Q4PA 3N4EA 3GB6A 5AC6A 3DCPA 1W9XA 1ZU8A 2PDLA 4MWAE 1W17A 4B5UA 1UD4A 1E1CB 3PC0A 2ZYFA 3UG3A 3AJ7A 4IIBA 1TV3A 1OADA 4OFCA 5JBDA 3ZQ9A 3TSBA 1A5NC 1J4EA 1E6XM 2E09A 4CLMA 2RGMA 4J3VA 1E0VA 3H2CA 5H8MA 5TQLA 5LIKX 3P80A 4PULA 4C7DA 3GQYA 1F7BA 1T8XA 3V0TA 1YNPA 4QTGA 3SGZA 3UZWA 1RLCL 1RA0A 2DP3A 2W79A 1YQ2A 2PZ0A 4HNNA 3B04A 3VGBA 2P10A 3NZ1A 3ES7A 4YLWA 1BYAA 3CLMA 3TYEA 4XAPA 5LNUA 5BW6A 3LM3A 2BZNA 3SCWA 3EDFA 4O0KA 3CZJA 1JI1A 2PDWA 3APTA 2BFGA 2YL8A 2DZBA 4UTWC 3KBSA 1SZRA 3GTIA 4MJMA 1OFDA 3O6CA 3EKLA 1PDYA 1OB0A 1T41A 2I17A 4W8BA 2YLLA 3N9RA 3DYPA 3WF2A 4LUTB 4H1ZA 1F3EA 3CT7A 1TPFA 3I3DA 1EGMA 2XSAA 1TJ2A 4PYSA 1R7AA 3GTNA 4IMCA 1DL3A 5D9OA 5G4EA 4WEVX 4RV3A 1UKOA 1LBMA 5BWFA 1M7JA 2QUUA 2E9LA 5E9AA 1CW2A 2PDHA 3R0KA 3WLNA 3HGJA 1I2RA 4O28A 4ZBCA 5AC4A 3GVWA 4ZOCA 5EBUA 1AW1A 4TVCA 3H2NA 4GO9A 2QUMA 3LPOA 4KPLA 3LPFA 2VHLA 4B16A 4WOZA 3BOXA 2VRKA 3SRDA 2OWWA 3C2OA 4G5DA 1XSIA 1Y0EA 3M5XA 4GNJA 4RXFA 4IMGA 4ACZB 1KFBA 1LRQA 3UVIA 2RDWA 2CITA 1EYEA 3TCSA 3MMTA 4R27A 3B05A 2Z28A 4NRRA 1C8XA 3FX4A 1HJXA 2W6RA 1Z41A 1OFRA 1XLHA 1P43A 2VR4A 3LRMA 1XKJA 1FWNA 3MA8A 1S2VA 2CLPA 4KW2A 4IP7A 2CCRA 2XN1A 1JDEA 4LAUA 3G22A 3NR0A 4ADTA 1IZJA 3C8NA 1W6TA 5BNKA 4PCNA 3VD7A 2J7EA 5AHMA 3URQA 1W1YA 3TW7A 4J3SA 1TPB1 3PBMA 3PZTA 1YHTA 4REQB 1OFBA 4Q33A 4IT1A 4MB3A 2BODX 2W91A 3ANYA 1S5TA 3QOMA 4JHZA 3W2KA 5C7HA 1Q8JA 1QPQA 3GKFA 2PP0A 3ISIX 2GQ3A 1EA0A 4W7WA 4JIEA 1CZ1A 1ZQ5A 4X3ZA 8RUCA 2ZWYA 1ZALA 2ZZ2A 3UJRA 4LUIA 3BGGA 3UYIA 2FMOA 2WK2A 1TZ7A 2CBIA 1XF0A 2WQPA 4O52A 2PDGA 3F4VA 3RHGA 2E6YA 4UTIA 3RU8X 4V33A 3IVUA 4K3ZA 1A4MA 4C6OA 4JL1A 2F84A 1O1HA 2SFPA 4UUIA 1A5LC 2QEZA 3KBJA 4Q4QA 3I7QA 4A22A 1MNSA 2ZZ5A 4TV6A 5HULA 3VIHA 2ABBA 1ZJAA 3THAA 1XPYA 4GC3A 1UZDA 7A3HA 4FF7A 3WNPA 1KKRA 5HWNA 1Y7VA 1UKSA 5BROA 2C18A 3R4IA 4IGNA 2I14A 1MW2A 3TROA 5CC7A 4QCEA 1FWGC 1QUMA 1B4KA 3ARXA 1GTEA 1WX0A 2WMIA 2VEKA 3VCRA 3FN9A 2BWGA 3GXFA 3AHZA 3UCDA 4LEQA 3LGEA 4INFA 5H8UA 2VO5A 2QCNA 5I78A 1C9WA 3N25A 4O12A 3HG5A 1PBGA 4YTRA 4CNTA 3W9ZA 3WEOA 3POCA 2VC5A 1T99A 3UPWA 3U8GA 2GVYA 3MHFA 3W4RA 3C8FA 3LCXA 2QLYA 1WDQA 3GIPA 2HNEA 4AF0A 3C0JA 2G3FA 2ZZ3A 3KRBA 1EGVA 1VQTA 2VXNA 3EOUA 1ZJHA 1VJIA 1H2JA 3PFRA 2WJFA 2A21A 2PU1A 4MWAC 2VT0A 4RE0A 1JCYA 1BKSA 1TMLA 5CZ0A 2J7FA 2EBNA 5M2FX 4WSHA 6REQA 1H7XA 2YSWA 3QN3A 3BPWA 1AMKA 3FXYA 4GE8A 5KZEA 3QF0A 1KC7A 3EOLA 2ZX7A 1K7XA 1Q6FA 3LUTA 4B5SA 2XIIA 2ZRZA 3W29A 3CWOX 4MPKA 3MC5A 1GZJA 5DT7A 3E5BA 2NXIA 3HO8A 3AIVA 1YKWA 2XN0A 3B97A 3S5YA 5KINA 4LVFA 1AMYA 1KM0A 2VWTA 4GVIA 1OIFA 4TVDA 1UPMB 1E6SM 2E5CA 1TTIA 1EEPA 1R47A 5CBIA 4L65A 3LRLA 1XP3A 4NZ4A 1S2WA 5JMUA 4JX5A 2J8GA 2A0NA 3T40A 4IHCA 2FH6A 4QQ3A 5BRBA 1KNWA 4L1XA 3MYPA 1E9LA 1J12A 3PZOA 1T6MA 3W88A 3FV9A 1W3HA 3HOJA 4L4MA 3U6WA 3LLFA 3I7RA 3FVMA 2G4FA 4S3EA 3A64A 1ZCCA 4M6QA 1OFQA 1LLOA 4D8ZA 1FWDC 3GG1A 5AFDA 3T4CA 3TSMA 4A21A 1DPMA 1K8CA 2CLOA 4HCDA 4F48A 2P8CA 5AZ1A 2FHCA 4JIPA 1VFSA 3KL0A 1Q45A 3IS4A 1UHVA 4NG3A 3TXVA 1F8MA 1V6VA 3V3WA 3URAA 3I65A 5FEZA 5EYWA 3ZJKA 2HV5A 3ZZ1A 2OELA 3ABXA 4M6VA 1A5BA 1KA9F 5LNSA 5XIAA 1YDNA 1A0EA 4U31A 4PFMA 2PURA 4DY1A 2Y70A 3E3HA 3NJ3A 5G2IA 4DYEA 3OZPA 1JCNA 5DCDA 5G1YA 2ZIDA 5E0KA 4LGXA 4IF2A 2OPJA 1W56A 3E12A 1KM3A 1VEOA 4RDWA 2R14A 1H4PA 1XISA 3ME3A 1UPPA 2IPGA 3KLKA 4Q8NA 3LTYA 3WNMA 4LVBA 5FIPA 1UD6A 4HOZA 2NQZA 1A5SA 3PBYA 4XB3A 4NXKA 3RRXA 1W0MA 4NT0A 3W70A 1XIHA 3P82A 1JDFA 3GUWA 1IR1A 1QBBA 3WQVA 1GOWA 1I9CB 3T0BA 3MMUA 3U3HA 2YB4A 2RH9A 3MSGA 2VDGA 4IJBA 1XLBA 3I4EA 4Q4SA 4UTTC 2J7BA 3W2MA 4JTRA 3HPZA 1WB0A 2CLFA 4IQLA 3BC9A 2PGRA 3GXMA 1SZEA 4NI8A 4LBSA 2HVOA 3HGOA 3K1GA 1A50A 5I03A 3RCYA 1IV8A 1CT5A 3P6LA 3C0SA 1RA5A 1OFOA 3HV8A 3MKKA 1UG6A 1MQRA 4LWWA 2VM8A 2NQLA 4DRSA 3HPFA 3VIKA 4FR6A 3A3WA 1UKTA 4U10A 1ZY9A 1XYLA 4Y9MA 3F5LA 4NXSA 1SJAA 1W9VA 3SQLA 1BSIA 1WA3A 4ZQOA 1VPYA 3E2VA 4NIRA 1JNDA 1E6PA 1NAL1 5A3HA 5HQLA 3ABRA 2GOUA 3C56A 5E6YA 3H2AA 2QZRA 5DBTA 5DMLA 7ODCA 2OODA 4GCXA 2DV0A 3LI1A 1AJ2A 3BE7A 5D8ZA 5D8WA 3NZQA 4R3UA 2XVLA 2QCDB 3OYXA 1PTAA 1CENA 1KR0A 1OX4B 1KRAC 4IXXA 2AAAA 1UUOA 2EPOA 4X60A 1XUUA 2VELA 1CDGA 3W6MA 1QFEA 4NNBA 3SECA 4KWUA 1NY1A 1G4EA 1B1YA 3KCLA 4LT9A 2G96A 1MRQA 2F2KA 4M7TA 3KVLA 3WELA 1SPQA 4F9JA 3RMEA 4KWVA 4GZJA 3P8IA 3EX3A 4UNIA 4X0VA 3QW3A 4PTDA 1GJUA 3CMJA 1YTDA 3D3AA 2V3FA 4RNJA 2DQXA 3O7UA 1OCQA 2ZFAA 2VEMA 4J28A 4HTBA 3GH4A 5C7VA 3S1WA 4JFUA 3JS3A 1RK5A 1K4HA 1CTNA 4AZIA 4H3DA 7REQA 1ITXA 3VFCA 2E8YA 1JCLA 1UKPA 2D0GA 2PTDA 3HFTA 4ZQPA 2HEJA 2I9UA 3EWXA 2WOQA 2DY3A 2GJXA 3DI1A 3LXBA 5D2XA 3WD1A 3BJSA 1GOIA 3PFMA 4DVOA 2QJGA 2H8ZA 5HUOA 1KM6A 1KM2A 4XD4A 3IANA 1U1UA 3L4WA 5IDIA 1YNQA 2FJKA 3NL5A 1Z32X 2MNRA 3T6CA 3ATZA 3CAKA 3JZEA 1VHCA 2A1YA 4ERGA 4PN2A 5HMEA 2AMXA 4D6DA 1K6WA 3DESA 3IJIA 4F0RA 4D6CA 3OB8A 1OX5A 3W7LA 4GLEA 1QPNA 3L0NA 2ZXDA 2DSWA 3TAOA 5ENLA 3STCA 4GA8A 4DXXA 4W5UA 1R9ZA 3ANVA 5CPSA 3VCNA 4C65A 1KO0A 1US0A 3GS6A 1Q4WA 1PIIA 4ZB0A 1FWSA 4B90A 3QSTA 4HHMA 2WCGA 3PSVA 3WX7A 2ZICA 4AVNA 4RPQA 2G4JA 5E1QA 5DQPA 1S1PA 3N12A 1NJJA 2D0HA 4HPNA 3E0VA 1PIGA 3VIOA 3TLLA 1ICSA 3RX2A 1R3RA 4HA3A 3TSDA 4RNHA 3AROA 1L8PA 5KZ6A 3R89A 2A3HA 3GHTA 4EK7A 2JE8A 4A3UA 4GC4A 4A8LA 4O0ZA 1ZAIA 3MT1A 2BBFA 4LQ1A 1GQJA 1AH0A 1WOBA 1R2SA 3MU7A 2PD9A 4US5D 4M29A 2J9ZA 4JXCA 4A4AA 5AC8A 5FJRA 2DIJA 2BOEX 2GGEA 1SUXA 3ICJA 4DO5A 3M41A 3HB9A 2WW5A 1L2QA 2FTPA 4MB4A 3O16A 4WDTA 4XBKA 5F4SA 3E9AA 2OYLA 1JYXA 4IM4A 1VBHA 3EOSA 2D69A 4N7QA 5JXQA 1TIWA 1QU4A 1SJBA 4ROPA 1BHGA 3A22A 1Q65A 4GINA 4ADUA 1KM1A 4UQ9A 4C1LA 4ZMGA 4MJ4A 2EKGA 4ZO6A 4GQQA 3C0QA 4ZOAA 2J6VA 3IARA 2WHJA 3RLVA 1ZGDA 2FKPA 1YPFA 4R33A 1O95A 4O57A 3FKKA 1JIBA 3VGGA 4IG2B 1OC7A 4ZXLA 2NV9A 2P0OA 1T8QA 3NGFA 1RH9A 3FEQA 1UP2A 2BY2A 3V7PA 3TVAA 1W1VA 3H53A 3WNOA 4MJ2A 1NVMA 1MFVA 3KVJA 1EJSC 4HD5A 3BV4A 4GGBA 4O14A 3TC7A 4JIQA 5C55A 3UGRA 4JQ1A 4ML9A 3VMOA 4PUJA 3W87A 1R9YA 4CQAA 4OT7A 1A49A 3D47A 2VUNA 1GTHA 3AS0A 2EPMX 2OLAA 1LOSA 3DG3A 4PMUA 2OVLA 3P2VA 3S6DA 2FDSA 3LTPA 3RO6A 4CQ9A 1RCOB 3OGRA 3MW7A 1M3UA 1KB3A 3QW4B 2NT1A 1KBJA 2Z1WA 1P0KA 3VE9A 1F07A 1HL2A 2OQLA 4S3CA 3NPUA 3D0CA 3OVRA 3E38A 4UIOA 1YE4A 4PUKA 1XGDA 3H8AA 1O60A 2TAAA 4BFAA 4K8GA 4NJGA 1E72M 4M1RA 3W1UA 2ZRVA 4H04A 3T07A 1PXGA 4MY1A 3VZXA 2Z25A 4GBUA 1Q7ZA 3FXGA 3LX9A 1B5TA 1XG3A 1ADDA 1U5HA 2WKGA 4GD0A 5D9MA 4CVWA 1M04A 2CHRA 3I6RA 1NF7A 3V36A 4JTGA 2NV1A 4WQ6A 1T7LA 1H61A 3UZZA 3XISA 1RK6A 5LYRA 5C54A 5F2MA 4B9YA 2D0FA 4QDMA 1SSDA 4QSFA 1JUEA 1KGXA 1TA3A 3FGCA 1DQWA 3WBAA 4HSHA 3D6NA 1P0EA 3PBWA 5G4HC 1QHOA 1R38A 4RV8A 3WD4A 2DZWA 3RIKA 3P81A 4Q8TA 1XH1A 4PTWA 5CZSA 3S6OA 2X1IA 3NTYA 4E2BA 3WLIA 2PLMA 3QR1A 2WHLA 4ZE4A 4K6AA 3VIFA 1TJRA 4I7UA 2J62A 3LTSA 4A05A 4IMFA 1OVDA 1VBGA 3GG8A 1S3TC 3P5ZA 4LUYA 4UC5A 2YBTA 4J27A 4TOQA 2IS7A 3TDFA 1NH6A 1EF2A 1GYNA 3DFPA 3LHZA 5HJLA 2E25A 1AJZA 1OD8A 2CW6A 3BAJA 4Y8EA 4LTSA 5I02A 2R1NA 4PB5A 2XWEA 1E6NA 1MXDA 1SO4A 3NDOA 2D3LA 4DBSA 4RNFA 4HA4A 4P8XA 1GEQA 1CXLA 2NUXA 2PRHA 1XH0A 4S2BA 4ENLA 2IKIA 3UJFA 4KRZA 5KETA 3N2MA 4L4OA 5HPOA 2ABAA 4S3JA 3SFKA 5HAOA 3C0LA 5F2IA 3QY8A 4L5ZA 3S5OA 4Z2GA 2XIBA 4OU1A 3GAKA 3WD3A 4DAIA 2QT3A 1IEVA 5C2XA 4MF4A 4UQDA 4V1XA 3O07A 3KL5A 4L9ZA 4FALA 3M0LA 3GDTA 3AUOA 3ARSA 4M7SA 4XZNX 4YWIA 3TYAA 3W28A 1B0IA 1M01A 1R87A 2WMHA 3TJLA 4MB5A 2VCCA 1FY6A 1V6XA 4TX6A 8CGTA 4HU4A 4KFNA 4WJ8A 4W9TA 3QV6A 4U3CA 1DXEA 1UYQA 2ISVA 2VCBA 3UZJA 3W26A 3ARYA 3C4UA 3LPPA 3BLPX 3AZRA 4LCRA 3T8LA 3W7KA 3AXIA 4C6KA 4D8LA 1FDZA 2J7HA 1KTBA 1X1NA 1JR1A 3PK7A 3EMCA 3IV8A 4ZE5A 3S5SA 3MBFA 3TOPA 3KWSA 1X7FA 3KHDA 2X0SA 2PDNA 1NFBA 4GYPC 3BAWA 4P7NA 1XV8A 2WC4A 1CLKA 4BY3A 2NLYA 1EEXA 4QE4A 4B3KA 4GX9A 4EF8A 4IH3A 3ZXWA 3GY1A 1XLFA 2WZMA 4GYFA 1ESWA 4KBXA 1A5OC 3MTWA 4J3UA 2E4TA 1WOAA 2QUNA 3MANA 1QO5A 4JDBA 1W5PA 4UFJA 2PP1A 3P14A 3B8UA 3VFLA 4AU0A 3MV01 1GWJA 3IIZA 5D02A 2OGJA 3OODA 1Q4NX 4QSHA 3EWZA 3SSZA 3CZKA 2YGYA 4C6DA 2OT1A 4C6CA 3LOTA 3T7VA 3QC0A 5TF0A 3CZEA 4PRRA 3BMVA 1KCZA 2CEQA 4C91A 2R91A 4FXJA 4RX0A 4L9YA 2GVLA 4DO7A 2XGBA 3GTHA 4UB9A 4US6A 4CKQA 5BU9A 2FZDA 3OIXA 4HNVA 5E70A 1LUCA 3BG9A 3VCCA 4YHGA 1DOSA 2DT0A 1A3XA 1GOKA 3CUZA 2ZUNA 7ENLA 3MDUA 4JAWA 1P1XA 4AZHA 1M7OA 3PWAA 1WZMA 5MKGA 3M0IA 4TQTA 2PWGA 1JF5A 4WIWA 4FLOA 1W9PA 4JNYA 1HL9A 1PWMA 3GD6A 1C90A 3W7OA 1RBAA 4TXEA 3UR8A 1V8EA 5C9ZA 4LAMA 2R1KA 3U2ZA 2VGBA 3HM7A 4FOKA 2KZHA 4XBJA 4M6PA 1JXKA 3B8SA 3R10A 1F2JA 1F4AA 4FX7A 2H3DA 3VDGA 1ZPTA 3CAQA 2IPJA 1E1CA 3CMGA 3MWCA 2WCSA 4QFUA 3GDLA 2C1HA 4GX8A 4Z2KA 4F0SA 3NQEA 4IICA 1B4EA 3AHYA 3SDOA 2Y88A 4FMVA 4J3TA 2R9RA 2VCAA 2HK0A 4LY8A 1TVLA 4EPKA 3R6IA 2F6UA 4JICA 4KRUA 1XLMA 3QPZA 4OOUA 2PD5A 3SB0A 4F0KA 2VP8A 3T55A 2V5BA 3TYUA 4KIRA 3LHVA 4QJ1A 3A9IA 2ZZ7A 2AQWA 3UWVA 1GEHA