3CEUA

Crystal structure of thiamine phosphate pyrophosphorylase (bt_0647) from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr268
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
207
structure length
198
Chain Sequence
MKLIVVTTPTFFVEEDKIITALFEEGLDILHLRKPETPAMYSERLLTLIPEKYHRRIVTHEHFYLKEEFNLMGIHLNARNPSEPHDYAGHVSCSCHSVEEVKNRKHFYDYVFMSPIYSTYTAEELREAQKAKIIDSKVMALGGINEDNLLEIKDFGFGGAVVLGDLWNKFDACLDQNYLAVIEHFKKLKKLADLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thiamine phosphate pyrophosphorylase
publication title Crystal structure of thiamine phosphate pyrophosphorylase (BT_0647) from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium target BtR268.
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
total genus 58
structure length 198
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ceuA00
1JCXA 2J9ZA 2WSRA 2ZTJA 3N34A 4ICNA 5G2WA 3DKLA 2FPTA 1AG1O 2QCCA 1THFD 3QW3A 3ZFHA 1G7UA 4AWSA 2V2DA 3B4UA 1OX4A 4N4PA 3LHWA 5CZ0A 1L6WA 1TTIA 3LBMA 1QPNA 5AFDA 3NQ7A 5F2MA 4JGDA 2Y85A 1IXOA 5DN1A 1TPUA 5DCDA 4TMBA 2QKFA 1WQ5A 1P4CA 4UTJA 3T55A 1SPQA 4ML9A 4FEZA 5G2HA 4UTLA 4GE8A 4H3DA 4NUWA 4ALDA 2OZ0A 5HWNA 3PAJA 3TW6A 1ZFJA 3TIMA 3A23A 3LRKA 1XBZA 3KVLA 3LI0A 3NPXA 4O8RA 5EA9A 3IV3A 4UTHA 1H7XA 3FYPA 3P74A 3GXNA 4JYFA 2V81A 3G3DA 1MEWA 3OBKA 1EEPA 1KM2A 1H1ZA 4UTMA 3NL2A 1VCFA 1SR9A 3UWUA 4BFAA 3S1WA 1JRBA 4N2YA 2A0NA 2V5LA 4AB4A 1FBAA 2V5BA 3MUXA 2RHGA 4B5NA 2C14A 4K6AA 1SW7A 1U83A 1QWGA 3NNTA 3S5YA 4N9CA 3PG8A 1HO4A 2Y88A 4Q4KA 3N3MA 5TIMA 5D02A 4LNYA 5AYYA 3FS2A 2GJLA 3DBPA 4GJ1A 3RLUA 2EAWA 4OE7A 3TQKA 4AWUA 5KSWA 4O12A 1GVFA 1N7KA 2E6AA 1VHCA 3AJXA 1KTNA 3L68A 1LZOA 3ZR4A 1OG0A 5TBOA 1Q6RA 3WK1A 3EX3A 5FF0A 3B06A 2DZPA 3SY5A 5D09A 1O94A 3DI1A 1TTPA 1AW5A 2BXVA 1OK4A 1SU5A 3IEBA 3AO0A 4J9JA 4K7YA 2BX7A 2DZXA 3B0UX 1ZAJA 2DZSA 3LHVA 3MI3A 4POCA 4DQWA 2ZRZA 1H5YA 2V2HA 2WKJA 1LBLA 1ZAHA 2RDWA 2EF9A 1KFEA 2Z1BA 4YCPA 3G3MA 3A9IA 3LGEA 3NPWA 1RZMA 1TTQA 2RKXA 8TIMA 3DH7A 2QJHA 1G4TA 4YCOA 3UWWA 3EX2A 1KFBA 2JGQA 3G1FA 4QNEA 1Y0EA 4YL2A 5KINA 3L9CA 4O28A 1GT8A 3LCWA 4K8HA 4LTSA 3M44A 3I6RA 2BZNA 1VQTA 3N73A 3KAOA 1NF7A 4H4IA 3PM6A 4S2CA 1PS9A 3Q94A 4WXYA 2P0OA 3GLCA 4IX0A 3NQFA 3TC6A 2VFDA 1AW2A 4MY8A 4BI5A 3NYZA 5BRBA 5K9CA 1JUKA 1HFBA 1IF2A 5I3HA 1IXNA 4N02A 3RU6A 1H63A 3TJXA 1KM6A 4H6KA 4KWWA 4MOZA 1QNVA 2C3ZA 2FIQA 5I3GA 1TYGA 4GNJA 2V8ZA 4KFPA 3TAOA 1BWKA 3LRLA 1LCOA 1NVMA 1EIXA 4O4WA 5FF7A 4NNBA 3KRSA 4LV4A 2A1YA 3VNDA 1SSGA 1A50A 1EA0A 3S1VA 3HG4A 5K4ZA 1GVQA 2ZRUA 1XFBA 1C9DA 4MZ8A 5K9DA 1OVDA 1LP6A 5DBTA 1XBVA 3G1YA 1SZGA 3GAKA 1E51A 3IIZA 1VC4A 4NNCA 1KLYA 2CLIA 2WOQA 2FB2A 2Z6IA 5BMWA 3W7NA 2OMAA 3E9AA 4UFMA 1MEIA 3P80A 3B8DA 3G1VA 1K7XA 2C0AA 4BR1A 3T40A 5C54A 4PCFA 3IGXA 2H90A 2DJLA 3ZWTA 5LSMA 4U4MA 4MZYA 4XBSA 4YLWA 3I7RA 3CB8A 4DBEA 4QISA 2H8ZA 2JKPA 4R53A 2ZZ1A 3U8GA 4JY8A 1M7PA 1JCYA 3W2KA 3NQ6A 4JDBA 4DF0A 4JYDA 4OGZA 1TV8A 4O57A 3W7MA 3QH2A 1ZALA 2YPIA 2AGKA 2G96A 3TFCA 5D2VA 1Q6OA 1EWEA 3P61A 4JIPA 4ADUA 5DXXA 3CEUA 2JBMA 3NZ1A 4WZHA 4C1KA 3B0VC 4WXZA 1OHLA 3PY2A 4JTHA 3DFTA 4PC8A 3TJLA 4TX9A 5LGZA 4BWLA 5LGXA 3F1QA 1P1XA 3CU2A 2B7OA 2UV8G 4AVFA 1I8JA 1YYAA 1DVJA 1G67A 4LOCA 1DKWA 1I2RA 4ONVA 3DAQA 3PB0A 4JNMA 4LUJA 1YDVA 4NU7A 2C15A 3STFA 2E5CA 3G22A 3W7DA 4GBUA 2CZDA 3E49A 2WPBA 1PVNA 3UWVA 1H1YA 3W7PA 3LHYA 4PEKA 1LM1A 3O05A 4QSHA 4UFJA 5CZJA 2GVJA 5FEPA 1IIGA 1LBMA 1EWDA 3NAVA 3BW4A 4HPJA 4O19A 3W74A 4JS3A 2DJXA 1TPDA 2W6RA 1MO0A 5TQLA 2JK2A 3O8AA 3SSJA 5FESA 4JX6A 4OV9A 3BGJA 1RQEA 4I9AA 1D3HA 2A7RA 3ZS4A 4FO4A 1T96A 5AN7A 1DBTA 4FF7A 4NJHA 1WOAA 1A5SA 4DPQA 5GVJA 4LY8A 3UNDA 4FB7A 3W83A 1YADA 3C2OA 3C2RA 2ZZ2A 1W8SA 1FUYA 1B4KA 4JTKA 2NWRA 4RZ5A 5HR6A 3QF0A 4MUZA 2CLLA 3BGGA 3GR8A 3UQNA 1EP1A 1B3OA 2E6YA 3E0IA 5FEWA 2C18A 3M6YA 5AC7A 1OX5A 3P67A 2CU0A 3TQVA 2YSWA 7TIMA 1W3TA 2B7NA 1R2TA 3S5ZA 5G1TA 3TE9A 2ZZ6A 3WJZA 3VFLA 3P8JA 5I3IA 1NAL1 1GWJA 1OYCA 3ATZA 4Z0SA 2G95A 2E6FA 5AOUA 1TPC1 3TA6A 4AF0B 1GZGA 3STCA 5KZEA 1ZJIA 2QCDB 1B4EA 5BOOA 2EKCA 1HL2A 3QJAA 3LTSA 3HQ1A 4FNUA 4HT3A 3DU0A 3Q2DA 4Y6GA 2XN1A 2CZEA 3W7HA 2VFGA 2EPHA 4U28A 1TJPA 4KFOA 2VC6A 3L65A 5AC6A 1KFJA 4WY0B 2C6QA 2O7QA 5EL1A 3W87A 3L67A 5D32A 3BPWA 2ATSA 5HNRA 2OT0A 1TRDA 4O15A 3FYOA 3HGSA 1WBHA 3OG3A 1GYNA 3MI6A 4Q32A 3L2IA 3PUEA 5A8GA 5L6UA 3MHGA 3NEVA 5K7JA 4MJZA 4AHOA 3QQ0A 3L21A 2ZYFA 4ZL1A 1GPWA 2VFFA 3LERA 2R94A 1EUNA 4HNUA 4PODA 3M0ZA 2HTMA 1FCQA 3LHZA 3UPWA 1NF0A 1UJPA 4JTSA 2PCQA 3DKJA 4CQAA 1PV8A 3A5VA 1H51A 3BW3A 4ZQNA 3RFAA 3W1LA 4N9BA 4PTNA 1KLZA 1Q45A 2I9EA 1W5QA 3C2EA 3HF3A 3G8RA 1W5OA 2OCZA 4X3ZA 1LOSA 1XI3A 1W31A 4GUIA 3S5NA 4WX2A 3N2XA 3O6CA 3BW2A 1SFLA 1VYRA 1GVSA 4Y96A 4M7TA 5H91A 1DL3A 2ISSA 2RFGA 4O16A 3W75A 3STGA 3DI0A 3S1XA 3OEXA 1WBJA 3LXAA 3HGRA 1G4EA 4I7WA 2B0MA 3BG5A 2QCMA 4W9TA 2YDAA 3SIZA 1GTEA 4FNSA 5HUPA 2NXIA 4HSNA 3CM4A 1YXCA 3LDVA 3SECA 3CIXA 5HUOA 2QAFA 2YXGA 3G24A 2AAMA 2I1OA 3TV8A 1G69A 4EF8A 3LX9A 4IX2A 4IOTA 1OF6A 5FEXA 4E2DA 4MVAA 1SO3A 3JRKA 3TX9A 3GXTA 3W1TA 1L9WA 3VKJA 1IXPA 3TH6A 2E1DA 5AHNA 1LTDA 5CZSA 1OFDA 2ZBTA 4Z0JA 2R14A 1Z48A 4M5PA 3I68A 4M6PA 5DLCA 3P82A 3GK0A 1C8VA 2ZTKA 3LBCA 1J4EA 3DHFA 2ISVA 5IBXC 1OJXA 1PE1A 2W0UA 1TV7A 3E96A 2A7NA 3PF3A 2QF7A 2JKAA 2WNZA 5DY3A 4A2RA 5F2GA 4NZFA 2X30A 1UCWA 4JTJA 3TCEA 1UUMA 1JCJA 3GXPA 1UB3A 4WY0F 3RNDA 2ZRXA 3GKFA 2WJZA 2CLMA 2A6LA 4S1FA 2YYUA 1SO6A 5HWMA 3TMQA 4IPIA 3IVSA 5SWUA 3T4CA 3NVTA 1YTDA 1K8XA 1DV7A 3SGUA 1K8ZA 2ZFAA 4JTUA 4AHQA 1W5MA 3R8RA 1KFKA 1BKSA 4K8EA 4UTTC 2H3BA 3TKFA 4LWWA 2NUYA 4EF9A 1L6SA 1FXPA 1O5XA 1YLVA 5AHIA 5FEZA 3LLFA 2NXHA 4N9DA 6ALDA 4UNKA 1IGSA 1BEUA 3LXCA 2ZZ5A 5CG7A 3GVGA 2E5DA 3GKAA 4UIOA 5EBUA 5LHFA 3OVPA 3LTYA 4NXKA 4M19A 4O11A 1F05A 3LCGA 1QO2A 1W56A 4Z1AA 1TPB1 2TYSA 2QEZA 4MFDA 3NL5A 5AHMA 4ADSA 1H62A 1KM4A 4ZQPA 4ORMA 3UY7A 4IMDA 1J5TA 3D0CA 4CLMA 2ATMA 3LM7A 3DFOA 2H6RA 3L5AA 4WJEA 2CWNA 4Y8FA 3NL6A 1WYIA 1SUXA 3WK3A 3FJ6A 2E5BA 3NQ2A 3TSDA 2RH9A 3BO9A 1LYXA 1TIMA 2QDGA 3HG5A 2ZRWA 3M7WA 4QM1A 2NV2A 4XTIA 2R8WA 2ABAA 5KZMA 4X22A 4GFSA 1XBXA 4MJMA 4FX6M 4IMCA 3IVUA 2R91A 3GAYA 3TC7A 1SW3A 3SFKA 3B03A 1C29A 3ZWSA 1VYPX 5AHEA 3W7RA 1R30A 3QM3A 5MHBA 4ZZ9A 3L0GA 2WSYA 3UWQA 3KRZA 5EPDA 1J2WA 2ALDA 2H3DA 5LNUA 3LCIA 4JN6A 1W5PA 4TIMA 3VE7A 4MKNA 3EXTA 3NQEA 5EYWA 3R2GA 5T26A 1QCWA 3I7SA 1LDCA 4ZQMA 4ZVJA 1TPVA 3NR0A 3W73A 3GDMA 1W1ZA 4S2BA 4WOQA 2VEKA 5C6MA 1TO3A 4K37A 2YX0A 4LVBA 1NFBA 1Q6LA 4O17A 1H7PA 3FOKA 3UD6A 4CNNA 1N8FA 1P0NA 1OFAA 4PFMA 3NM1A 3E02A 4NNAA 1AL8A 1VS1A 5HJLA 3EWYA 4CCDA 4DF1A 5F1VA 1VJIA 1YPIA 1TCDA 1KW1A 1L2UA 5G4EA 4IPJA 4BK9A 1F2JA 2NUWA 4UXDA 1R2SA 4UFLA 3HPXA 2NZLA 1O4UA 1I2OA 3V1PA 2Z6JA 3UZJA 5HINA 1GOXA 4IXHA 3LV5A 4CQ9A 1EUAA 5IBXA 3L5LA 4LS0A 3LRMA 1JCNA 4O0ZA 3GDKA 1FXQA 2FPVA 2QCGA 5CZTA 5E93A 3BG9A 2HSAA 1ZY9A 1EP3A 4JTLA 4HN4A 3NPUA 4LV9A 5CPMA 1H7NA 4E0CA 2HS8A 1HTIA 2LLEA 3DENA 3PULA 4P2VA 4MFEA 4LU0A 4XKYB 3UXDA 1W37A 4O1DA 3TDFA 2FFCA 2QAPA 3KOFA 3S1UA 3S9YA 1KTCA 2W79A 1GTHA 3EX1A 3TSMA 1VYSX 1LBFA 1LORA 3G1XA 4JTGA 1ICPA 4NXSA 1JULA 1QMLA 1TQJA 4DPPA 1KBIA 3P7YA 1LLZA 5ABTA 4O18A 3MBDA 3TMLA 4XWUA 5HULA 3NPVA 2VEMA 1O60A 4GUGA 1D9EA 4AF0A 3EWXA 5I3FA 3PC0A 1V5XA 4YXGA 2ISWA 3QYQA 4JD4A 4RZ6A 2J6XA 2QCDA 3HO8A 4N4QA 1OFRA 2QUUA 4R34A 3TSBA 5D2XA 4XTDA 4AAJA 3O6YX 3LHTA 4FXSA 3HPZA 1GJPA 1SFJA 2PURA 3ABRA 3C2VA 1F73A 4GUFA 2HS6A 2EHHA 1TREA 1EPXA 2P10A 4WY0A 2QUTA 1PCKA 3GR7A 3VE9A 4UTUA 3QW4B 1KM5A 1RR2A 4XZ9A 2V30A 3S8HA 3TUUA 2GOUA 4RK8A 3K30A 4UR7A 5KITA 3INPA 1I2PA 2VFEA 4WOZA 3G1HA 2X2GA 5DXYA 4LS2A 1VCVA 4RV8A 4RLIA 3W7JA 2VENA 4HNTA 5I3JA 2PRLA 3EWWA 3PR2A 5DCBA 5FF2A 4EOUA 3UZ5A 3OHIA 4JTEA 1NEYA 2FTPA 5L9FA 2DZVA 3FKKA 3IGSA 3W85A 1U5JA 1WXJA 3NO5A 4QQ3A 5G1YA 3IGUA 3NQVA 3ABOA 3B0PA 2B4GA 4JDYA 4UCGA 1XM3A 2A4AA 1CI1A 4O1BA 4O54A 5LNVA 2QCNA 2WO5A 5D05A 1ZNNA 1ME8A 5D2WA 3TNOA 4AEOA 4MLRA 3W3OA 3LV6A 4QJ1A 2J27A 2Y6ZA 5CKSA 1B57A 3W72A 2Z2UA 3W1PA 3W1MA 5U4NA 1G7VA 3FFSA 1YDNA 4DXVA 1VPXA 3M5YA 3A5FA 1K02A 4FIRA 1GVOA 3PB2A 3G1DA 2FPYA 2DZWA 1T99A 4YWIA 3RMJA 5DELA 1G6CA 4TU1A 5K9XA 1PHWA 1DJQA 1K3UA 3MMTA 1MEHA 2ZRVA 4LVAA 1KM3A 2CZFA 1X6UA 2ABBA 4HNVA 3W1XA 3BK0A 2A21A 1TB3A 3BV4A 4M7SA 3DXIA 4NZJA 4NQ1A 5FF4A 3NGJA 3W2NA 1K03A 3G1AA 3LLDA 1W3NA 1S5WA 3MP4A 3Q37A 5H2ZA 3P62A 5EKYA 3M43A 4M6QA 4UTIA 2BLEA 2A7PA 3N14A 1WX0A 1LOLA 4CCEA 4RJEA 2CFFA 3MO7A 2NUXA 1A5BA 2J9XA 5AHLA 5HWJA 3W9ZA 3ABSA 3TR2A 2Q3OA 3M47A 4MIMA 4DBDA 2ZA2A 3QPZA 3C52A 4JTTA 2XN2A 1JUBA 3HGJA 2Y7EA 3JR2A 1WDWA 1AW1A 4LRTA 1OABA 1Z42A 3THAA 3TW7A 3W22A 4RX0A 1JUEA 1VR6A 1W5NA 3IIOA 3W7IA 1S5TA 3FJLA 3O15A 3W88A 1GG0A 4RR4A 4A29A 4Y90A 4GUJA 3MJYA 4EIVA 1H7RA 4D2JA 2GUUA 2DZTA 3A22A 2J88A 2P1FA 1JR1A 1QOPA 4WD0A 4UMCA 5G5IA 4G1KA 4JY9A 3PS7A 4BI7A 2J9YA 3T7VA 3FLUA 2QCLA 1JCLA 3GDRA 3EX6A 3LCLA 2X1RA 3EKLA 2VOMA 2KZHA 4O1AA 3TK7A 2Q8ZA 4GUHA 1KTBA 3T44A 1CW2A 2QCHA 3F4WA 4GRSA 1TMHA 3UPBA 1DQXA 2G97A 1QFEA 1F76A 1TPWA 2ZCGA 1FDYA 1NSJA 2C1HA 5AYXA 3UWZA 3TQ0A 2HMCA 1TRIA 3SI9A 1P5BA 3GNNA 3C4UA 4N6EA 1KV8A 3CPRA 2E77A 4O10A 5D2TA 3W7GA 2NXGA 1FQ0A 3EX4A 3HB9A 1VHNA 3IRDA 4CQ8A 3M1ZA 1SZNA 1A5CA 4MYXA 3FKRA 3PWAA 2RDUA 1KFLA 1YTEA 1TV5A 3HGOA 2X1SA 1WV2A 3UXAA 2NX1A 2GJNA 3R5EA 4UMAA 1XXXA 3C2FA 4RKAA 4MY9A 5F2IA 4QIUA 2TPSA 1X7FA 1KM0A 3DFQA 1D3GA 4ORIA 1PIIA 5LHEA 1DORA 3TAKA 4AWTA 4N6FA 5BW6A 1JQVA 2VFIA 1VLIA 4ZQOA 4MYAA 3P5YA 2X1UA 1FWTA 4FX8A 3HIJA 3QSRA 3PBYA 1FCVA 1RQHA 2Y7DA 1F6PA 5D38A 3UYCA 1IXQA 4AMAA 1MXSA 3CLMA 1G4SA 1QO5A 1TSIA 3MHUA 4PA8A 3BLIA 2B7PA 3IIPA 1G4PA 3HJZA 4IQLA 3HMJG 5LNSA 1P0KA 3W76A 1SW0A 1MZHA 4UTWC 3C3NA 3W7OA 3G0XA 3O06A 1ONRA 4AXKA 1RVGA 1VH7A 5C55A 1X1OA 1OF8A 3T78A 3OIXA 2Q3RA 3W1QA 1XDLA 3MW7A 3OVRA 2CLHA 2ZZ3A 1F6KA 3NDOA 1Z41A 3S5OA 2CLEA 3MP5A 6TIMA 2Q8LA 4A3UA 1W54A 4JX4A 3WJSA 3FIGA 5KTLA 5CGQA 5CSSA 1K7FA 1B9BA 3R13A 3MBFA 1KA9F 4OU1A 3NQ8A 2VEPA 1S5VA 2BTMA 3KRUA 5DY2A 1JRCA 1ME7A 3GDTA 2QJIA 3GX9A 4LC6A 1ML1A 4RCXA 5AB3A 5D2YA 4HNNA 4JEQA 1OYAA 3NQCA 4JICA 3MP3A 3G0UA 3S0CA 3GDLA 1TJRA 2ZZ4A 4FNQA 2E09A 2OX1A 1SZFA 3LCXA 4XKYA 3SJ3A 3W7CA 3PSVA 1ALDA 4DELA 3Q58A 2O7SA 4ADTA 3QQ1A 1SO4A 4LVGA 2ZQ0A 2VEIA 5DCEA 2A5HA 3P60A 3WJXA 3KVJA 3M16A 1FCBA 2VXNA 1T0OA 3W1NA 3U2OA 4FXRA 3PSWA 1VRDA 3PG9A 5F4SA 3GZ3A 4RZ4A 1LOQA 3CHVA 3H53A 3W07A 1JJKA 4IMEA 5AC8A 2BSLA 1UBSA 1I2NA 1KBJA 1OYBA 2TMDA 3BLFA 1SQ7A 4BWLC 3UWYA 2Y7GA 3M41A 3KXQA 2DORA 5FI8A 4NX5A 3EB2A 1RQBA 2GQ8A 3N9SA 3NQAA 4DO5A 1OK6A 2VFHA 1WAUA 2PRMA 1H61A 2QJGA 4OV4A 1VGAA 3NQGA 4Z08A 4IGHA 3EKZA 4MZ1A 3B04A 3TXVA 2PC4A 1SZEA 4EVZA 2Z0IA 3OA3A 3TFXA 3L0KA 1YPFA 2CZ5A 3LB0A 3M9YA 3MI2A 3ATYA 1JQXA 4L4LA 5D04C 1XCFA 1OFBA 3BARA 3SR7A 4UTKA 5F1UA 3A21A 2DZUA 1UUOA 4KKXA 3B05A 3ANYA 1TTJA 3FEMA 3O1NA 2B7QA 3LHUA 4Z1DA 1A5AA 1F74A 2DP3A 4A2SA 3C0JA 1V7YA 3P8IA 3I7QA 3ELFA 4FNTA 2A85A 4QNWA 4DF2A 4M6VA 1JCMP 3PUDA 1A53A 5J5DA 1AL7A 1OX4B 1QAPA 2C13A 2E68A 5FF3A 2NX9A 4UC5A 3EEGA 3C6CA 1LRTA 4GWEA 3NL3A 1XBYA 3QMSA 1ZAIA 3BVJA 2ZDRA 4NX0A 1WA3A 2X1TA 2A2IA 1PCWA 4TR9A 2PRHA 3N19B 3W70A 5A5WA 3RLVA 4BI6A 5HR7A 3VCRA 1K8YA 3EWBX 4UFKA 4UTWA 4UFHA 2GPTA 4O53A 4A22A 2OT1A 1K7EA 4IJBA 3G1SA 3GNDA 3W71A 1MSSA 2DU2A 3MHFA 5BMXA 3PBVA 4ZQCA 4TMCA 4KFNA 3IVTA 3O6DA 1H7WA 1CX9A 1TQXA 1M7OA 4UTTA 2ZA3A 1OFOA 5C5YA 3DFPA 4RXGA 3QEZA 1QPOA 3N9RA 3LOTA 1QPRA 1RD5A 4AHPA 2BWGA 2V82A 3QZEA 5CSRA 3KVKA 3SW6A 1LLWA 4QAIA 2C19A 3JS3A 3NZRA 4Z1BA 5E0KA 4L4MA 5EY5A 1X8FA 2G5WA 4NJKA 4IUOA 3IIVA 3WJYA 1ME9A 4Q33A 2WNQA 2XN0A 2FQIA 2Y63A 1H60A 4GC4A 1JVNA 1TPH1 2GQ9A 3RK8A 4FNRA 4NJGA 2IQTA 1FWNA 2WQPA 4NJJA 2QDHA 5D37A 3WFAA 5D03A 4LRSA 4DO6A 3QMRA 1VCGA 3L66A 3HG3A 1M6JA 1XC4A 1N55A 1AMKA 1GQNA 5AYZA 1EX5A 2EGZA 1XDMA 3NXFA 3CEPA 3W7EA 2V2CA 5D30A 3W7KA 4E38A 2GQAA 5EMUA 1VLWA 4N9EA 1QR7A 5F2LA 3YPIA 1ZCOA 3I65A 3KHJA 3WK0A 2XFWA 3HOJA 4O52A 3NA8A 5F4WA 4RXFA 4O1CA 1OFEA 3S42A 4JIQA 4X2RA 4I7UA 4XUGA 5U7SA 3KX6A 3MYOA 5K3VA 3W7LA 4UR8A 3SZ8A 5LZLA 3KFTA 2WSQA 1ZENA 3QC3A 4MPQA 1RPXA 3EXRA 5F4XA 1DQWA 1YXDA 1T8XA 1FX6A 4LT9A 4O13A 3W7QA 1XL9A 2NLIA 4DO4A 3KVMA 4PH6A 4C1LA 3CWNA 3L5MA 4BF9A 1FWWA 4GXMA 3W1AA 2YFOA 2C16A 5KMYA 3QPYA 3F03K 3W23A 4X9SA 2YW3A 1FWRA 4XBKA 3QMTA 2YCEA 3CTLA 1R2RA 3DGRA 1O5KA 2Y61A 5G2IA 4WUIA 4FHAA 1VZWA 1F7BA 3LCHA 4K38A 4FIQA 4KWVA 3CC1A 3EWZA 5CPLA 5I3KA 1IIHA 3G18A 2D73A 1I2QA 3SGZA 4EWND 1FDJA 3F4NA 4HSOA 2WV8A 1RV8A 1X1ZA 5BNKA 1Q6QA 3V75A 3P81A 2ZRYA 2OJPA 3TROA 1Z44A 4PL2A 2YZRA 2TRSA 1EB3A 4AH7A 2H8XA 4P61A 2Y62A 2RDTA 3C56A 2F84A 2CLFA 4HHPA 2FDSA 4JTFA 4JR5A 1XUZA 4IXXA 1GEQA 4K7VA 1QPQA 1GYLA 1SSDA 4Y9AA 2YGYA 1LROA 5AHFA 3P84A 1R46A 1XKYA 4WQ6A 4E2BA 1OFQA 3TU9A 3PBUA 4HPXA 4MLJA 2YYTA 2QUVA 4DEFA 3CIWA 2GVLA 1TPFA 2GVGA 4JX5A 3C8FA 4LW7A 3DHDA 1M5WA 4UNLA 2JKEA 2X16A 3HG2A 3U6WA 1ICQA 2CLKA 2QCEA 3FA5A 3MYPA 2VELA 3DZ1A 1I45A 1ADOA 3W2JA 3LCFA 3BG3A 5J5RA 4O14A 4OQVA 3N2MA 3GYEA 3G0SA 1EP2A 4JYEA 5K4XA 1H7OA 2VKZG 2AQWA 3THQA 1QOQA 4NJIA 3UY8A 1O95A 4LVFA 3W86A 3LTPA 3NOEA 5C2XA 4PL1A 3W2UA 1GVRA 1ICSA 3W6YA 4MY1A 4LS1A 3NQDA 4OBTA 4IMFA 3LXBA 3HBLA 2F7FA 2FB3A 2Y70A 1ZHAA 1Q3NA 2NX3A 3GIYA 1S3HA 1YXYA 4XQ6A 3PVFA 3W1UA 1L6YA 1AK5A 3QFEA 3BLEA 3EXSA 1DOSA 2Y89A 4OT7A 4YMZA 3USBA 3GB6A 3EWUA 2J24A 5DBUA 4QITA 1BWLA 3A24A 2NWSA 1FCUA 1H50A 1XUUA 4I7VA 1F5ZA 1HG3A 1W0MA 3M5XA 3C61A 3R12A 4R33A 4O0KA 4LC8A 4A21A 1TPEA 3DFNA 2YW4A 2YR1A 1W3IA 1KV5A 4LVDA 1FDZA 3L0NA 5HQEA 4TO8A 4NT0A 1DJNA 3R89A 3O63A 1PL9A 4FX7A 4HIBA 1GG1A 2E6DA 4R7JA 5IM51 4K36A 2Y7FA 2CLOA 3QSTA 4HKPA 4OHQA 3HPSA 1KFCA 5CPOA 4ZMGA 3S6DA 4CNOA 3M5VA 1FWSA 4JTIA 5D33A 3MWAA 3WK2A 4LUIA 3G8EA 2NV1A 5LNWA 3O16A 4Z1CA 4ZQRA 5E1QA 1OX6A 3CWOX 1YDOA 5LNRA 2QR6A 1QDSA 2PE4A 3PUOA 4UFIA 4OWGA 1DHPA 3CT7A 5LKYA 3VI2A 1HO1A 3H55A 4FNPA 2A6NA 3H54A 5G4WA 5HMSA 3STEA 3PBWA 4O50A 4CNPA 3DFSA 2ZZ7A 4JXCA 3TXZA 3W2MA 3NQMA 2FLIA 5K2ZA 2FJKA 1FY6A 1LRNA 1UASA 2TSYA 3W84A 2CW6A 3P5ZA 1HUVA 2V0TA 3W2LA 1YTKA 1OFPA 2V9DA 1LRQA 4UMBA 3NM3A 5CPNA 3E12A 3O07A 4IMGA 4NVTA 3IIXA 3CQ0A 3RF9A 1PHQA 1SO5A 2YFNA 4CCCA 1R47A 4IWWA 3LI1A 4K39A 3ABQA 2JGYA 3W1RA 4O4VA 4UUIA 2ZA1A 5KZDA 2I14A 1BTMA 3NG3A 2WNNA 1I4NA 1KM1A 3WJWA 3OVQA 3QRHA 1WOBA 3M5ZA 2QCFA
chains in the Genus database with same CATH superfamily
5GJMA 4JN7A 3VPLA 4MB3A 1G1YA 2WSRA 2ZTJA 3B9OA 3N34A 5DMYA 5G2WA 3ZT7A 3WL0A 3ITYA 1THFD 2O55A 4AWSA 3AALA 4N4PA 3RILA 3LYEA 1QPNA 5AFDA 5F2MA 4L1GA 4AZIA 4JGDA 1IXOA 1Q13A 1TPUA 2PGEA 8XIAA 2PLMA 2ZWZA 1P4CA 1SPQA 2WVUA 2PP0A 4FEZA 5G2HA 3WLPA 1BQGA 4IP5A 4NUWA 4Y9NA 5HWNA 3PAJA 5CQ1A 1ZFJA 2O4MA 3LMYA 3LRKA 1R5YA 3KVLA 4UTHA 1RVKA 3GXNA 4Y9OA 1MEWA 3FA4A 4ES4A 1X39A 1PTDA 4A6GA 3NL2A 4GI4A 1JAEA 1S1RA 3S1WA 2PPGA 2BASA 1NELA 4N2YA 2A0NA 2UY5A 1FBAA 3EA1A 3KBSA 3MUXA 2GGJA 4MUPA 1BRLB 1W1PA 2A79A 1SW7A 4K6AA 1U83A 1PSCA 3H70A 4MAZA 3PG8A 1Q7QA 4XSLA 4HK7A 4Q4KA 5AYYA 3E74A 3DBPA 2EAWA 3KL5A 4GY7A 3ARQA 5KSWA 3URBA 1GVFA 4QG8A 2G3NA 1VHCA 3AJXA 1KTNA 1LZOA 3UJ2A 3BQ6A 1OG0A 2BY1A 1Q6RA 3WK1A 3EX3A 2Q6ZA 5I2UA 5FF0A 1EX1A 5BRQA 2DZPA 2DW6A 3DI1A 4GI9A 1ZB5A 1AW5A 3OLDA 3WQFA 1FWAC 4J9JA 2XG9A 4IJCA 1ZAJA 2DZSA 3MUY1 4DB7A 4V15A 1H5YA 2V2HA 5FJOA 1KFEA 3G3MA 3LGEA 1RZMA 2DZAA 4PMNA 5HJYA 2RKXA 4AIOA 4CEXC 8TIMA 3DH7A 1E1CB 2QJHA 1G4TA 3S6TA 4YCOA 1WXZA 2JGQA 1B0IA 1TWIA 1Y0EA 2QW5A 4K8HA 3VGDA 2CBUA 2PFHA 3BLPX 5D4YA 1Q4NX 3E2VA 4LH8A 3SADA 4S2CA 2OSWA 1PS9A 2XM2A 4WXYA 1H49A 3GLCA 4IX0A 3NSMA 3DG3A 3WLHA 3GNRA 1GNXA 3Q65A 5BXRA 2ZUSA 3EA3A 1E0VA 3VD3A 1IF2A 3EMCA 5I3HA 1IXNA 3GHRA 1OINA 4I3GA 3RU6A 1H63A 1ZP4A 2VJXA 3A64A 2XZ7A 4GYKA 2PLCA 4GNJA 2V8ZA 4HZ8A 3TAOA 1V7AA 1BWKA 3F2BA 1LT8A 4L61A 1N8IA 4NP7A 5FF7A 1SSGA 1A50A 2HK1A 4KQNA 3HG4A 5EU9A 2DIKA 1GVQA 5CZKA 1DWAM 4MZ8A 3NURA 4E3VA 3PANA 4Z1YA 4PMZA 2PA6A 4J3VA 1E51A 4LUSA 2FB2A 3R6IA 5BMWA 1FHDA 2OMAA 4PUJA 1F9CA 1XGDA 4HOWA 3IJQA 4WKAA 1BHGA 1W3JA 3II1A 3AXMA 2ANUA 2W61A 3VAVA 3IGXA 3T05A 3ZWTA 4HA4A 2VGFA 4AD1A 4YLWA 7REQB 3L4XA 3GY1A 3NTYA 2X0SA 4DBEA 4DYKA 2ZZ1A 2XIMA 1JCYA 2JF6A 4B5TA 3NQ6A 4JDBA 1XC6A 4JYDA 4O57A 3W7MA 3ARVA 3QH2A 1A5UA 2AGKA 4Q8PA 2WJEA 8CGTA 5D2VA 1Q6OA 4CVWA 5CGTA 4WZHA 4C1KA 1GVEA 5FJJA 4AZCB 1EH9A 2DQXA 4BWLA 1P1XA 2C79A 3CU2A 1YYAA 1TJ0A 1CGWA 3IUHA 4J4KA 1P6BA 1XRSA 1J9YA 4LOCA 1YE6A 2BODX 3E5BA 1DKWA 1I2RA 4Q4SA 2C15A 2DIEA 3W7DA 4H2CA 1S39A 1H1YA 1CGTA 3W7PA 4PEKA 3DECA 1LM1A 5FCZA 4QSHA 1XLEA 1A5NC 1UOKA 5CZJA 2GVJA 1IIGA 1NOWA 4HA3A 3T1GA 3QN3A 5C8BB 3S2NA 1L0PA 1JPKA 2CC0A 2PODA 5A69A 5FESA 1PDYA 4OV9A 3BGJA 3IJ6A 1XRTA 4B92A 4KGLA 4NYUA 2P3ZA 1MDLA 3WD4A 2QPSA 4DPQA 3MCNA 4ERAA 1EDTA 1W8SA 4JTKA 4RZ5A 2NWRA 3VIIA 1B3YA 1EEXA 1POJA 5FEWA 4H9XA 1OX5A 1NP2A 3HQPA 2E28A 1W3TA 2B7NA 3QR1A 4C6KA 1UROA 2ZZ6A 4GNVA 1WZAA 2DH3A 3ZJ8A 3ZMRA 1WKFA 3M0KA 4Z0SA 2CPUA 3MUZ1 4WDUA 1J8VA 4M0XA 1GZGA 4M81A 3STCA 5KZEA 1WZLA 1B4EA 2DSKA 2PDFA 2GVYA 3FA3A 2WC7A 2WHLA 3WH9A 1I6NA 3BJSA 3Q2DA 4KCUA 2XN1A 2F38A 3W7HA 2EPHA 4U28A 3E0LA 2VRQA 1A4LA 3L67A 5D32A 1W9DM 1IZCA 1UD5A 2Y8KA 4CN1A 3HGSA 3OG3A 4MMWA 4AIUA 3PUEA 4DJED 3PN8A 3WUGA 3LA4A 1QNPA 2VI0A 2WKLA 4C7GA 3KTXA 4GXPA 4ZL1A 4A4AA 2R94A 4PODA 2HTMA 2EG7A 3BGAA 5HAOA 5C70A 3WQ8A 2PCQA 4CQAA 4XZNX 1H51A 3BW3A 3SQSA 1LQ2A 1XIJA 4PTDA 4N9BA 3DCPA 4ZENA 3VIFA 1AVAA 3RM4A 3AIRA 1XI3A 1HKVA 2E4TA 3OG2A 3N2XA 3BW2A 3O6CA 4CCZA 1SFLA 1VYRA 4M7TA 5H91A 4QEEA 3ZJ6A 2RFGA 1ISVA 4U31A 3DI0A 3SRDA 1WBJA 3MVIA 1J0IA 1EL3A 3T07A 3HGRA 1PKYA 3U2CA 3F2DA 1N2VA 4FNSA 3PWIA 4US5D 3B8SA 1YXCA 2D0HA 4NIRA 2YXGA 4KF1A 3LENA 1W32A 1F3TA 3SCRA 2WHKA 1CENA 3RM8A 1AJ0A 1OF6A 4GCXA 3JRKA 3TX9A 1EDGA 3GXTA 3KP1A 3W1TA 3RCNA 1YPXA 4GIRA 3CTTA 3GC2A 1R3VA 2WKGA 4ZO7A 4QLLA 3BOFA 3V3WA 2QPUA 3BL3A 1UH4A 1OZQA 5JU6A 3A13A 3GK0A 2ZVIA 2WSPA 2ZTKA 1UP0A 3UG5A 3MKCA 3ZQ9A 1PE1A 1HP5A 1JYWA 4ATDA 1TV7A 1JCTA 2E40A 3S3GA 4V2XA 3M0JA 3PJWA 3VIGA 3BSHA 3CT2A 3TCEA 1UUMA 2WWCA 1O66A 4RNFA 2ZRXA 2CLMA 3H7RA 4S1FA 1SO6A 1WE5A 3O6AA 1FHVA 4IPIA 2JALA 2HVMA 2VYOA 1W5MA 3R8RA 1R38A 1KFKA 1BKSA 4UTTC 3QY6A 2NUYA 3FJ4A 4QHRA 1UR9A 4W8AA 3VYLA 2G3FA 1L6SA 5AHIA 5FEZA 2NXHA 4N9DA 4DM1A 4Q22A 1KO0A 4LBUA 5LA1A 3LXCA 3VIOA 2ZZ5A 5CG7A 2PCEA 3GVGA 3GKAA 1M68A 3AU2A 3ITTA 3LTYA 2QJJA 1IR2A 4O11A 1F05A 4Z1AA 2TYSA 1H62A 1KM4A 1VEOA 4ORMA 4IMDA 1DJIA 3AXKA 1E6NA 3LM7A 3L5AA 4WJEA 4PUUA 3CAVA 1SUXA 3GH7A 5PTDA 3WK3A 1A0DA 2RH9A 4E8CA 1EXBA 1LYXA 5HATA 2QDGA 3AMGA 2ZRWA 2D3NA 2Q01A 2AMXA 2VR4A 1VEPA 1EZWA 4XTIA 3WLQA 2A3EA 4PBEA 1Y8BA 3K8KA 2ABAA 4QLKA 5E0CA 4IMCA 3W26A 1Q8JA 1PJ9A 1C29A 5AHEA 1KXHA 4GKLA 1AZ1A 1R30A 3GM8A 4LNCA 3LK6A 3A3XA 1PTAA 2BFGA 5EPDA 2ALDA 2H3DA 3B9DA 3WDJA 2ISDA 3LCIA 4EP8C 4XUYA 1VFHA 5CLTA 5EYWA 3EPMA 3C8NA 1F61A 4ZQMA 1RCQA 2G37A 1CECA 3ZR6A 3WNNA 1WKDA 4S2BA 3N11A 1XSKA 4K37A 2WAGA 4LVBA 4V28A 1KWKA 3DFYA 1H7PA 3FOKA 1DPMA 3REQA 1P0NA 2QYGA 4PFMA 3NM1A 3F2CA 5F1VA 4AZHA 2FTWA 3UFYA 5G4EA 2OYLA 2I56A 2ODOA 1Q4WA 3HPXA 3V1PA 3T08A 3R8HA 3UZJA 5LA0A 4LAUA 1GOXA 3URNA 4G5DA 2YA0A 3LV5A 1EUAA 4HJFA 4CQ9A 4LS0A 2QCGA 3AHTA 4JTLA 5BXTA 4QE5A 1H7NA 3JW7A 4GACA 2ALRA 3DENA 3PULA 2D2OA 1YBQB 4IICA 3CQKA 3CH0A 4AD5A 2PZNA 4MFEA 3UXDA 1W37A 4D6DA 4J3XA 3LPPA 3DIPA 3TDFA 2FFCA 3KOFA 4WF7A 3S1UA 1EYEA 2FVMA 2W79A 3VM7A 1KRBC 1BSIA 1LL7A 3EX1A 4PBGA 1JYVA 4QFUA 2JEQA 1LBFA 2OSXA 1LORA 4WK9A 3N18A 4NXSA 1ZPTA 4H19A 1DWGM 1QMLA 4DPPA 1V6TA 1XIHA 1LLZA 1ISWA 1RXOB 3H22A 3NPVA 1BXNA 3B8IA 1XLAA 2VEMA 1KBBA 4AF0A 3EWXA 4UQDA 5EB8A 1V5XA 2ISWA 4J1OA 3CUXA 4HN8A 1IQ8A 4JD4A 1ZRQA 3HO8A 3NDZA 5AVNA 2QUUA 1CXKA 5LIUX 1J0HA 1OD0A 3MVTA 3H4WA 1WDDA 5E9XA 3H4GA 2J66A 4ASTA 3FSUA 3FVDA 5JBEA 5ECUA 1V0MA 3C2VA 1F73A 4GUFA 2PDQA 3N2TA 4PUDA 1D3CA 2EHHA 2IKHA 1AQMA 2V3EA 1TREA 2P10A 5ENLA 4XBJA 5A6BD 2QUTA 2J47A 4G7EA 2ZE3A 3GVRA 4HMDA 3R1ZA 4XZ9A 3S8HA 3TUUA 2E9MA 5ABGA 4UR7A 4MKVA 5KITA 4PR4A 2VFEA 3FGCA 1X7IA 1LWHA 1ZJHA 2BVDA 3G1HA 3OLEA 1V6WA 5DXYA 1K6AA 3NZGA 2GSEA 3MSDA 3CIVA 2WM1A 4JCLA 1FWDC 1EGZA 3W7JA 2OVLA 4K3ZA 3CUGA 2PRLA 4IFKA 3LM3A 2IMRA 3CZKA 3OHIA 3WD0A 4JL2A 5I24A 5L9FA 4BKNA 4OJYA 3KTSA 3FKKA 1AQFA 1TVNA 3EMZA 4DJDA 3ANVA 4C6BA 3IGUA 1OM0A 2QGHA 3B0PA 3SN4A 2B4GA 4IF2A 4JDYA 1CXHA 4GK8A 1B90A 2ZXQA 1US0A 1GGOA 5D2WA 2BY2A 3TNOA 4AEOA 4MLRA 2WMKA 4WLCA 3AHZA 1A49A 5A6AA 3RO6A 3W72A 3W1PA 3FFSA 2FMOA 3UJFA 3I3EA 1K02A 4FIRA 3FHAA 4UOZA 2FPYA 4PMUA 1LQAA 4YWIA 4ACZB 3U57A 3M64A 5DELA 1X38A 1DJQA 4UQBA 3CUJA 1MEHA 3D47A 4LVAA 1XG3A 1FP8A 4HNVA 3GXFA 2A21A 1GOOA 1M7XA 4M7SA 4NZJA 3W2NA 3G1AA 1TCMA 1W3NA 3S9ZA 3PJXA 4UTIA 1EC8A 2BLEA 2PGFA 1WX0A 4DUXA 3SCPA 4RJEA 4MHBA 2QJNA 2J9XA 5AHLA 3VCNA 1LG2A 2Q3OA 1V6YA 4JTTA 2XN2A 3HGJA 3POHA 3V0UA 2Y7EA 3GSMA 1AW1A 3IIOA 1X97A 4IT1A 2HWGA 1MNZA 3BWWA 4WR3A 1HP4A 3A9BA 1IR1A 2CBIA 3GBEA 4QE4A 4GUJA 4D2JA 3A22A 4G1KA 3NCOA 4AMCA 1HXJA 4GVHA 1JCLA 3GDRA 2F6UA 5AC4A 5BU6A 3VDHA 3BZGA 3EOEA 4IG2A 3CASA 1XLDA 1HKWA 4X0VA 2G50A 1NP0A 1I1WA 4GUHA 2YL8A 3F4WA 9CGTA 4GHRA 1DQXA 4DX3A 2G97A 1F76A 2NVCA 1FDYA 3OLIA 2FHFA 3KLLA 3QLDA 4EAYA 3LNPA 3HV8A 1TRIA 1P5BA 1TWSA 4QJ3B 4OOZA 4B4HA 3AIQA 1O1HA 3W7GA 2O9TA 3U2ZA 3EX4A 3HB9A 1CGUA 1VHNA 1QUMA 3PWAA 4GX9A 1YTEA 4LCQA 1HJQA 1TV5A 4GFIA 1WV2A 1E9LA 1DWFM 3CZJA 1ZSXA 2FYMA 3NQBA 3ARYA 4H8NA 1KM0A 3VD9A 2BOFX 3DG7A 2WMIB 1D3GA 5C9XA 4ORIA 3TAKA 3HFTA 3KBNA 4I6KA 4NZCA 2VFIA 4YPJA 2VTFA 3P5YA 2VX4A 1XQLA 3GXDA 3CZLA 2F6KA 5T9BG 3MJMA 3WO8A 1F6PA 1QW7A 5D38A 4AMAA 4K2SA 2OB3A 2VZVA 3UESA 4ZEPA 1FH7A 3CLWA 2HEJA 4IQLA 3HMJG 3QV6A 1W9PA 5LNSA 2VC5A 1P0KA 1SW0A 4QS5A 1XLFA 4UTWC 3G0XA 3O06A 1BVZA 3KUMA 1KCKA 1VH7A 1XCXA 1NIUA 1HJWA 3SRKA 3K2GA 5HOSA 2CLHA 2ZZ3A 1EHNA 2YCJA 1GJUA 4JX4A 3WJSA 5CGQA 1RA0A 2PDJA 3UCDA 4F79A 3NQ8A 1TR9A 4Q8TA 5DY2A 1JRCA 2C1IA 2YCKX 5AB3A 3FXYA 4HNNA 4JEQA 3VZYA 3NQCA 3SY8A 1DJWA 4JICA 1GONA 2ZZ4A 3SJ3A 5FIPA 3PSVA 1UKOA 1NWTA 2O7SA 3KOZA 3Q58A 4F0MA 1UWUA 2VGGA 3WZ0E 2A5HA 3WJXA 2JQXA 4GQBA 3CO4A 3W1NA 4FXRA 1VRDA 5CPQA 5F4SA 4BHYA 4I6VA 3RN6A 1LOQA 4ZODA 2ZX9A 3GG0A 5E09A 2BSLA 3BLFA 3MZ2A 4G8TA 4PFHA 4Y7EA 1RQBA 1XKJA 3V5FA 2GQ8A 1Z69A 4DO5A 1OK6A 1WAUA 2PRMA 2YJQA 3MT1A 3AMLA 5BXPA 2BXZA 1DJYA 4G56A 4NZ3A 4PBFA 3OA3A 3MDUA 3RDKA 3NO3A 1QJWA 3M9YA 4E8GA 3T9PA 1G5AA 1XCFA 3E0FA 3I3BA 4GD0A 4IQJA 4UTKA 3E0VA 3UJSA 2DZUA 4W5UA 1UUOA 4KKXA 3B05A 3ANYA 6ENLA 1TTJA 4L1WA 2DP3A 4LX4A 1JI1A 2A85A 4M80A 2GVEA 7CGTA 1F6YA 1AL7A 4KGJA 2IUZA 3ORWA 5EMMA 3RPMA 5FF3A 3OBAA 1BGGA 4UC5A 1S5NA 1UR3M 4HNCA 3DHPA 3MB9A 3AAMA 1XBYA 4UQCA 2NT0A 4LGXA 3QMSA 2ZDRA 2X1TA 4AY1A 1NDWA 2PRHA 2VOTA 3W70A 2CITA 3QR0A 4N42A 3VCRA 3C0SA 2GPTA 4O53A 2GFTA 3KEHA 2BY0A 3GNDA 1MSSA 1IEXA 2BV9A 5I06A 4MNKA 1W2PA 4ILSA 3URAA 5BMXA 3PBVA 4PUKA 3IVTA 3O6DA 2J7BA 5HANA 1M7OA 2ZA3A 1IHIA 1OFOA 5C5YA 1QPOA 3N9RA 2PDUA 1RD5A 1UH2A 2WC4A 1Q7MA 2OKTA 2BWGA 3ZXWA 5TAOA 5CSRA 1LLWA 3VGHA 3WDPP 2C19A 4OZOA 1BYDA 4Z1BA 1KR0A 1OC6A 3K1DA 1X8FA 3CZEA 3PTKA 3TJIA 4IUOA 4GA8A 4O8AA 4WVXA 1Y65A 1ME9A 2HNEA 4Q33A 2WNQA 1H60A 2GQ9A 2YL6A 1HKIA 4FNRA 4NJGA 2IQTA 4F40A 1FWNA 2WQPA 2Z25A 4NJJA 4RDYA 3IJDA 3QMRA 4XAPA 4CU6A 4G1NA 1RY8A 2RUSA 5IXEA 1F4AA 4HMEA 3H23A 1CLVA 3N6JA 4KETA 1AMKA 1VD6A 1GQNA 5AYZA 2EGZA 2V5KA 3CZGA 3TZFA 5TF0A 5D30A 3VNJA 5HPOA 3SUVA 1XGEA 2VEGA 3LY0A 2EXOA 3C86A 5DANA 3VCCA 2W66A 3KDNA 1BF6A 1QR7A 4P8VA 4BEQA 4K1WA 1ZCOA 1AUSL 2XFFA 1I9CB 4HU0A 1J11A 2JFEX 1E6ZA 1SMAA 3HOJA 3MUIA 3GTFA 1F3XA 1OFEA 3S42A 4X2RA 3BCDA 1E3XA 4HTBA 2OTDA 4GVGA 5K3VA 3MMUA 4LY4A 4QEHA 2W91A 3T0BA 5G4HC 4GYPC 3M46A 1UP2A 1NH6A 1CYGA 3GC4A 3GFZA 1YXDA 1S1PA 1T8XA 4LT9A 4I9MA 1XL9A 1CNVA 1XRFA 3VMNA 1RH9A 4DO4A 1HJXA 3DYPA 1VFSA 4X0NA 1IEVA 4BF9A 3W25A 4GC3A 3W1AA 3VUSA 3MUAA 5KMYA 1XWYA 2V3FA 1ISYA 2WMHA 2YCEA 3CTLA 1RBAA 2Y61A 1G94A 3CC1A 1DIOA 3QYSA 1MW1A 2VZTA 1IIHA 1KCLA 2D73A 4XZIA 1FDJA 1ZGDA 4BQ5A 4GQGA 1RV8A 5BOEA 5FJTA 1Q6QA 3TROA 3FCPA 2TRSA 2ZUVA 2H8XA 5A6MA 5H8PA 4DRSA 3H8AA 3T2PA 1E0UA 1OADA 1J5SA 2FDSA 4JR5A 1GEQA 4H7ZA 1JXJA 4K7VA 3R8GA 1GYLA 1SSDA 4LEFA 2DVXA 1XFCA 1R46A 1UZHA 3SQMA 3FEQA 4E2BA 3BJTA 4RNIA 1CIUA 3EEZA 1Q6FA 4PB4A 2FKPA 1XLIA 4YVVA 2WZTA 1V3IA 2EPMX 2QUVA 1AMYA 2GVLA 4JX5A 2GVGA 4LW7A 5CSYA 4MADA 4HHHA 3RG6A 3N12A 2XUCA 1I45A 3H2EA 4OQVA 5K4XA 1UR0A 3BMWA 3CV1A 1O95A 2GJRA 3E2RA 4LVFA 4AYSA 1A47A 2Z00A 3DG6A 4LS1A 1MW2A 2GZXA 3NQDA 4PTXA 3LXBA 3N6QA 3MS8A 1YNYA 1Q3NA 1SFTA 4PSRA 1MDRA 1UMYA 3VNIA 1AK5A 2WHJA 2REQB 1R8LA 3BE7A 5J04A 3BLEA 3EXSA 4KBXA 4L9YA 4OT7A 1MFVA 5DBUA 4CN6A 1BWLA 1E5NA 3T81A 1BXBA 1H50A 3QV9A 4R33A 1V3LA 4W7WA 2UY4A 4LC8A 3OP2A 4LEQA 1X96A 1W3IA 3V5OA 3BURA 4CU8A 4ZBCA 4PEEA 3TCSA 1PL9A 1JPMA 2ONEA 4J2MA 3VGFA 4K36A 3QSTA 4HKPA 1J96A 1BG9A 4HYVA 1CWYA 1W8GA 2G4FA 4QG9A 1EJSC 4HCHA 4CNOA 4XB3A 3M5VA 1S38A 5CPTA 2NV1A 1LQ0A 4QAWA 4ZQRA 3VNZA 5M03A 3ZYZA 2QR6A 3RJXA 3ES8A 3PUOA 1YNQA 3M0VA 5LKYA 3DBNA 3H55A 1SFSA 2A6NA 3U9IA 4CUCA 5HMSA 3UJEA 4CNPA 2PF8A 3DFSA 3VKDA 1H0IA 1HIZA 2FJKA 2XVPA 1NM9A 3PTQA 1EJUC 2CW6A 3RR1A 2OO0A 2G41A 3K8MA 4K8GA 2PU0A 5CPNA 3E12A 4XIAA 3AHXA 3IIXA 3IUIA 3RF9A 2V3DA 1SO5A 4IWWA 1VFOA 5FD0A 4B4FA 2YDRA 4W5ZA 1OZMA 2ZA1A 3WLRA 1E9IA 1I4NA 1S3TC 4TTGA 9XIMA 3OBEA 2DH2A 1FRBA 2QCFA 1MW0A 3QC0A 4AC1X 3E38A 2OYKA 3L4UA 1E15A 4MNJA 2WZIA 2QCCA 3GC5A 3AISA 3QHMA 3B4UA 3ARUA 2W63A 1L6WA 2NQLA 4AZ7A 3NQ7A 2O92A 5DCDA 4TMBA 3LSCA 2QKFA 2A3HA 1EPVA 3T55A 4YS1A 4GE8A 4H3DA 1P7TA 4FOJA 4Q8UA 1UD4A 3AS1A 3VC5A 4C1NB 3NPXA 1UWRA 1H7XA 3P74A 3AZSA 1W1A1 3OBKA 3W4RA 4OBSA 1Q85A 3HQNA 1XF0A 2ZC8A 1FP9A 1UMLA 4URIA 4R5EA 2QNEA 1KXVA 1JRBA 2VX5A 1QW9A 1W1B1 2RHGA 2OXNA 2WLYA 4M82A 2FZ9A 1QVBA 3NNTA 1HQTA 1KXTA 4N9CA 3NOYA 3WD2A 4Q4QA 4AD2A 3N3MA 5D02A 4LNYA 2Z1XA 5HNNA 4EPKA 5M1TA 4S3AA 1CEOA 3EDEA 1R9XA 3V7PA 3L68A 1UYQA 4NL1A 5B7ZA 5TBOA 2NQZA 3BAXA 3B06A 4E6MA 4L64A 5REQB 2BXVA 1OK4A 3IEBA 3PPHA 2BX7A 2DZXA 3B0UX 4TVDA 3TYBA 3KDOA 3PZMA 6PTDA 3OYXA 3DEQA 1SYTA 3AMKA 4POCA 4DQWA 2OOGA 1ZAHA 2EF9A 3IK2A 1G0CA 3NPWA 2PP1A 4ATLA 1U1JA 2ADAA 2P5NA 2VURA 1KFBA 4QNEA 3G1FA 4A3RA 4O28A 5BWFA 5KINA 2BS9A 1BD0A 1GT8A 3LCWA 4HP5A 3M44A 1DXIA 3OZPA 3N73A 4H4IA 4GABA 3WLJA 1V3HA 3UA4A 4Q8NA 5A8PA 1DTNA 1EF2A 1AW2A 3T0AA 1RLDA 3PBMA 4BI5A 3NYZA 4ZTXA 3WQEA 5I07A 2Y2WA 2I17A 4N02A 1V6VA 3ITVA 5DX7A 4H6KA 2X41A 3QBUA 1QNVA 1GCYA 4MOZA 5I3GA 2DUZA 4KFPA 1SVDA 3D3AA 4JAWA 1E6QM 1LCOA 4O4WA 4UZUA 3LBOA 4NAEB 5K4ZA 4EPBC 3WLMA 2WZHA 3WF2A 1LP6A 5DBTA 2OU4A 3B4YA 3G1YA 4C6EA 3IJ8A 3DESA 4M1BA 3ONBA 4NNCA 1KLYA 3RRXA 2CLIA 2Z6IA 2XWEA 2VNCA 4XO7A 3E9AA 4JKLA 4ZXOA 1KKRA 3E0WA 3BANA 2WMFA 3S2LA 1QASA 2C0AA 5D9PA 4ATWA 5C9ZA 5C54A 4PCFA 3U3HA 1RJPA 4MZYA 4NY2A 2XZ9A 4WJ8A 3R0KA 4PZVA 2H8ZA 4EXAA 2JKPA 2PWDA 4JY8A 2CKRA 1GOIA 1LWJA 3U5UA 1P48A 1LT7A 1EWEA 3SUUA 2FFIA 5EBAA 1OCJA 4B3ZA 4I5XA 2HXTA 3NZ1A 3B0VC 3T4WA 1ITXA 1OHLA 3PY2A 3EB3A 1MYRA 4J3ZA 4PC8A 1YEYA 4TX9A 5LGZA 3AU6A 4GO8A 2VDGA 3RLGA 2B7OA 3PFRA 5EGRA 1I8JA 4Q8OA 4EXQA 1DVJA 2OLSA 2Z7KA 1A0CA 4ONVA 3PB0A 4NU7A 1TZ7A 4GBUA 2CZDA 3E49A 3AUOA 1B3ZA 2WPBA 1D8CA 2XJ7A 4UFJA 4FS9A 2G3JA 1OCBA 1JD7A 5FEPA 4XD4A 3RXZA 1UWAA 3NAVA 3THCA 3VM5A 4MWAB 3U7VA 2CESA 4JS3A 4NKCA 4C6JA 3WLTA 2DJXA 4H6RA 4MDPA 3MO4A 3THDA 1XICA 1E4NA 2PDGA 1K1DA 1MO0A 3QTPA 2HBVA 1KFWA 4W84A 2JK2A 1U33A 1CGXA 2ZE0A 3IK4A 1RQEA 3OHMB 1D3HA 1U22A 4JL1A 4XIMA 3ZR5A 4DUWA 1O5QA 3C3UA 4FO4A 1DBTA 1DE6A 4FF7A 1A5SA 1OT2A 1GKQA 5GVJA 1LUCB 3UNDA 1YADA 3VMOA 4KH2A 2WVTA 3TWAA 5HR6A 4JHOA 3QF0A 4PUNA 3GR8A 3NWRA 4A3YA 5LIXX 2WNWA 1EP1A 3E0IA 4L65A 2C18A 3M6YA 5ABFB 4F66A 5IDZA 1GW9A 3IGHX 2NLYA 1R2TA 5CLWA 3R58A 2FH8A 3CUZA 3WUBA 2WANA 1GQLA 4XZHA 2EPOA 5I3IA 1NAL1 5F7UA 1AH3A 2Y8UA 3CMFA 1PYFA 4N0RA 5H6HA 3C0QA 2HBXA 1WAWA 5BOOA 4LCSA 1HL2A 4FOUA 3LTSA 2XYLA 1DXFA 3GNOA 3O2LA 3EDFA 2WCGA 2F2HA 2GGHA 3L65A 4E2VA 1OGGA 3FXGA 4WY0B 2O7QA 3W87A 2W3ZA 2J7CA 2QUMA 2VHLA 4MJ2A 4KEZA 5HNRA 3HFYA 3QOMA 2CBVA 3RIKA 4C6FA 2J25A 3MPGA 3CHEA 5L6UA 1IEIA 2PBOA 1HN1A 4BZYA 4C5ZA 4CN4A 4MJZA 3QQ0A 3L21A 3QTGA 2ZYFA 1GPWA 2VFFA 4UQAA 1EUNA 4EE9A 3M0ZA 1NF0A 2WCSA 3DKJA 3B0YA 1PV8A 4Q6JA 3TN5A 4G2DA 3WH8A 1W5QA 3HF3A 1V4YA 1B2YA 4Z2KA 1T40A 1HVQA 1IT0A 1QOXA 4HGXA 3S5NA 2RGMA 2YCLB 3MV01 2OEJA 3TVAA 2BVYA 4Y96A 1XPYA 3F4VA 3BOXA 4HZ6A 1EQCA 3STGA 3WNLA 4I5UA 2I5QA 2Q02A 5CC6A 3LQGA 2B0MA 1C8XA 2QV5A 1JGMA 3AYVA 2YDAA 4LCRA 5HUPA 1XD0A 4KCVA 2DT2A 4FOKA 1TWWA 1UBPC 4X2PA 4FXFA 1V3JA 3LDVA 3SECA 2UZ9A 5HUOA 5A8OA 1G69A 4NI8A 3SURA 3G1RA 2WLZA 3LX9A 4JIEA 4ZO8A 1V03A 4IX2A 1DJGA 1C3FA 1BGAA 1SO3A 2VC7A 3N9KA 3VTRA 4AXNA 1TMQA 4NZ5A 2GLKA 2C91A 3EMQA 4J5NA 3VKJA 2DZBA 2OQHA 2OOFA 1IXPA 3BOLA 2QMJA 3GWQA 2XIBA 4FF5A 4IP4A 4Z0JA 1NY1A 3WMLA 1Z48A 4H8UA 1WDPA 3P82A 4C6MA 1R3RA 4R85A 3NVDA 5CC7A 1C8VA 4MB1A 3SCSA 3LBCA 2W0UA 4D6GA 4DWSA 3G6MA 3W82A 1D7FA 3E96A 2A7NA 3PF3A 2YL5A 3ABZA 2WNZA 5JVLA 2X30A 4JTJA 4OBRA 5AKQA 1JCJA 3VK5A 2VT0A 2FDMA 1HJSA 2INZA 3ZLFA 5HWMA 3S46A 4R88A 1PIFA 1K8XA 1YTDA 1PZ3A 2ZFAA 4JTUA 2J4GA 3WQGA 4EPEC 4KIEA 4AIBA 1E6RA 4LF2A 1YLVA 3M0IA 6ALDA 1GQJA 1IGSA 2CNCA 4PMOA 4A8LA 2VC9A 1XX1A 3IJ7A 3RAOA 4UIOA 1ZS2A 4Q8MA 4NXKA 1SJCA 4GH1A 5AHMA 4ADSA 3WN6A 4NF7A 2VWTA 5DMNA 4CLMA 4RZBA 3DFOA 2GK1A 2BNJA 3MV11 3NL6A 2VM8A 3OTRA 3NQ2A 1PDZA 1REQA 4QM1A 1ESWA 4XZMX 2NV2A 1RBOB 5HQLA 4EANA 1OC7A 4X22A 1QK2A 2QLYA 4JPGA 2R91A 1SW3A 3MSRA 3SFKA 3B03A 3ZWSA 2HVOA 1VYPX 3QM3A 5BRPA 4ZZ9A 2WSYA 4GYFA 4S3CA 3VUPA 5LNUA 5CJMA 4JN6A 4TIMA 5AZ0A 3VE7A 2AL2A 3EXTA 2ZDSA 3MA8A 3H2AA 1QCWA 2Z26A 3KCOA 1LDCA 2W62A 2ZUMA 3O0KA 3NR0A 1SJAA 1FWFC 3W73A 4H9MA 3GDMA 2FZNA 4JFTA 3K5XA 7ODCA 1NFBA 3HJEA 5CBBA 4O17A 4RE3A 4QDWA 3PJTA 3TTYA 4CNNA 3TTQA 4PRWA 2IS7A 4C5YA 2EQDA 2XINA 4B5XA 4M24A 4NNAA 1AL8A 1VS1A 2QIWA 4DJDC 3FDGA 4Q7IA 4CCDA 3FX4A 4DF1A 5I03A 1KW1A 4E8DA 1GOWA 3A12A 1L2UA 3RITA 1GHRA 3MUCA 1FA2A 4UXDA 4UFLA 2NZLA 3TN6A 1O4UA 3WQDA 1GPFA 2WQDA 3VNMA 2EJAA 2Z6JA 4V33A 1TZ9A 1X98A 5LIWX 3L5LA 3LRMA 4K1GA 4O0ZA 3GDKA 5CZTA 5E93A 3M0LA 5IOBA 1WKEA 4LV9A 5CPMA 1C8YA 2OYMA 1KQZA 2BGQA 3PZQA 3VD7A 1V6UA 4XKYB 1AH4A 2NV9A 4DWDA 4GIYA 5FAGA 1XH0A 1KTCA 3ITCA 1E9YB 3AWOA 4ACYA 5EFDA 3DFHA 3O0FA 4CEUC 3GU9A 3GBDA 2YB1A 1JULA 3R25A 2YOCA 2O9OA 1TQJA 1KBIA 1YRRA 4H9ZA 3SCWA 4O18A 4B2DD 1EOMA 5HULA 1O60A 4DJDD 3GE7A 3I4KA 3PC0A 3GHUA 2XGBA 1PWMA 2QMKA 4ZOAA 1DXEA 2QCDA 4N4QA 1OFRA 1S2UA 4D6EA 3CV2A 5D2XA 3GXIA 3PHAA 3UVAA 4XTDA 4AAJA 3O6YX 2PDIA 3N4FA 4M8UA 5DT5A 4FXSA 2PURA 3ABRA 2AGTA 2FHBA 2HS6A 5A6JA 2F9RA 2HROA 4IPPA 3F5LA 1WPCA 3KL3A 2X0HA 3VOHA 2Z1SA 1YQ2A 3MKKA 4CQDA 3QW4B 4IUGA 2B81A 2V30A 4LAKA 5FL1A 3N4EA 4TOQA 2GOUA 1P0DA 3K30A 1UA7A 4RK8A 1DIDA 1TUFA 5HNUA 4AZ6A 1BAGA 3L4TA 4U2ZA 3UP8A 4H00A 4WOZA 1Z32X 3BLDA 2X2GA 4MM1A 3DOPA 3ZOAA 3HN3A 4HCLA 4CNTA 4S3DA 1UIOA 4IQEA 3F7JA 1GW1A 1NDZA 4O1EA 1OQFA 5CJ5A 2DZVA 1KRAC 3B0XA 3ITXA 4L5ZA 3IGSA 3GIQA 3OYZA 1L6GA 1U5JA 1NFPA 3NQVA 3ABOA 1ODUA 2V68A 4O1BA 1BPLB 1EQPA 2QCNA 1OWQA 3VDAA 4HZMA 2YXXA 3GDBA 6REQA 1J12A 1RPKA 4PCNA 2J27A 2Y6ZA 3UXKA 1UD2A 1B57A 4KRZA 1EBGA 4UB9A 3VO0A 1VPXA 3A5FA 3G1DA 2DZWA 1T99A 5K9XA 1PHWA 1K9DA 3ITOA 4GNKB 2VZOA 2IXUA 4QXIA 4AQLA 1KM3A 2FTYA 2CZFA 1X6UA 3W1XA 1Q8AA 1TB3A 3ZVHB 3T0DA 5JIPA 3C5QA 3QR3A 3S47A 1DP0A 2RJHA 4FLRA 3DXIA 4NQ1A 5FF4A 2G4JA 3U4FA 5C9WA 2O0TA 3LLDA 1S5WA 3MP4A 1E1FA 4RUBA 5H2ZA 3P62A 3M43A 4M6QA 4AIEA 2Y1HA 3QVQA 1LOLA 4CCEA 3GS6A 2NUXA 2FZMA 1A5BA 3ABSA 4MIMA 3C52A 3JR2A 1WDWA 1OABA 1Z42A 5XIMA 3W22A 1ECEA 2PDYA 1JUEA 1D8WA 1W5NA 3MC5A 1J0JA 4K68A 1H11A 2X2YA 4E4FA 3WYZA 1S5TA 2FZBA 3FJLA 1CPUA 1QBAA 3MTWA 3O15A 3FVMA 4RR4A 1QATA 3OODA 4Y90A 3MJYA 4ZFCA 3LPOA 2WK2A 1H7RA 1WB0A 2GUUA 4ZXLA 1PTGA 1JL8A 2P1FA 4WDWA 3DDMA 1QOPA 2RGLA 3KBWA 4JY9A 3PS7A 3VU2A 4BI7A 1JNDA 3URQA 1X8CA 1E3ZA 1VBRA 4IGMA 2VOMA 2KZHA 1U30A 2VDIA 2Q8ZA 3GW3A 3A4WA 3MU7A 3S6OA 3UPBA 2NQJA 1K9TA 1Q6DA 4DBUA 3H6OA 1NSJA 5AYXA 4ZB2A 1TVPA 1Q7ZA 1TR1A 2QXWA 4I9JA 1SM9A 2PF0A 3C4UA 4N6EA 3BMXA 4MDOA 3CPRA 4O10A 3S4TA 4JQAA 1SZNA 1A5CA 4JFUA 1DTUA 4DJEA 1OB0A 4Q4OA 1XLHA 2X1SA 3UXAA 2GJNA 4LUYA 4UMAA 4HNLA 5F2IA 4H41A 4QIUA 3ENLA 3OIHA 1V08A 4AEFA 3WBWA 3DFQA 3HU7A 1PIIA 2VO5A 2GJPA 4AWTA 4LYPA 1JQVA 4LUTA 3P0WA 4ZQOA 4M51A 4LYRA 1FWTA 3EB4A 4FX8A 4KWOA 3HIJA 4R7OA 1W17A 1RQHA 3WEOA 3AXXA 3UYCA 2OLAA 3LN3A 4LAMA 4PA8A 2B7PA 1G4PA 3NIYA 4IL2A 3WFZA 3AS2A 1R3TA 3W7OA 1ZZMA 4RL3A 3RX4A 1X1OA 1FFQA 4US5A 2Q3RA 3W1QA 1XDLA 3MW7A 1TV4A 3WLKX 3ANUA 1M04A 1Z41A 2FVKA 3MP5A 5LIKX 2W9MA 4A3UA 1W54A 3SFWA 1B9BA 1DJXA 4OU1A 4Q4MA 1L8NA 4AX7A 1ME7A 3BJFA 1TA3A 3GX9A 4RCXA 4JHMA 4PRTA 1S2VA 2GJXA 3G0UA 3S0CA 1TJRA 1VPQA 2E09A 3OB8A 3BZJA 2ZICA 2GL5A 4W87A 4DELA 3V36A 3ZLGA 1RD6A 1SO4A 3GTHA 5LA2A 1XIIA 5AY7A 2ZQ0A 2XM1A 1XIMA 3WBXA 3BXWA 1ODZA 2J7GA 3KVJA 2JIEA 4GZJA 5CEWA 3UPMA 5FACA 3GQYA 2J62A 4RZ4A 1Q6CA 2ZADA 3CHVA 1M03A 4JKKA 4OUEA 4MNMA 1KBJA 1OYBA 4LAOA 4NG3A 1VFMA 2Y7GA 3M41A 3VZZA 1QXLA 2YDQA 1WDSA 4ZFMA 4HU8A 1O68A 2ZX8A 2VFHA 1H61A 5MKGB 4MZ1A 1SZEA 1QRQA 3M0MA 1ZP3A 1TE6A 2CZ5A 1VF8A 1Y5WA 1GVYA 3WCZA 4GINA 1EF3A 3TN4A 4HSHA 3B8UA 1JDFA 3PZIA 4R27A 3BARA 4IHCA 1UW9A 2BHUA 3SR7A 3A21A 4CU7A 1UR2A 1DQUA 2BXYA 2GDQA 1MXGA 1ZBWA 1X6NA 3LHUA 1A5AA 5A3HA 3MKVA 3OQEA 1QHZA 1XJBA 2CCRA 3V0TA 3P8IA 3I7QA 3ELFA 4B5WA 4H7VA 4DF2A 4GG9A 3CUHA 4M6VA 2GSHA 4H6QA 3KRBA 1A53A 1S5MA 5J5DA 3UR5A 2QJMA 3SJNA 5H8MA 3EBVA 3AS3A 1HKMA 1QAPA 4GH3A 2XIJA 1TFVA 3NL3A 4JCMA 3PJUA 1WA3A 4NZ1A 2A2IA 1PCWA 4L80A 4C65A 4PCSA 4TR9A 3N19B 3TOYA 3OGVA 5A5WA 4IIDA 3PZ9A 3RLVA 4GI8A 3BLKA 3HURA 4UFKA 3FN9A 2OT1A 1K7EA 3W6MA 3G1SA 3BUVA 2DU2A 5C2GA 2FGBA 2VX7A 3WD1A 3MHFA 3AMCA 3EA2A 3N2BA 3USZA 1H7WA 1CX9A 1O7AA 4Q6XA 5E70A 4UTTA 4A35A 1UZ1A 4HYWA 2ZC1A 1PBGA 3LOTA 2DFAA 1UKQA 1DWHM 2VL4A 2ESCA 2MANA 1JGIA 4DXKA 2CERA 3M7SA 3VABA 3SW6A 2GOKA 3WLOA 3I4EA 5E0KA 5BYWA 3ONCA 1IWBA 2DUXA 1VENA 3EAUA 2XN0A 2Y63A 1TPH1 3VOGA 3KM8A 3CGTA 1WZMA 3VILA 1EXPA 4OOUA 5D37A 1MUCA 2J7HA 5I3DA 1T5AA 2X7WA 1HVXA 1EJ7L 4U5IA 4HB7A 4QS6A 2X0YA 1RALA 1R85A 1S2WA 5JH1A 1XDMA 3NXFA 4E4PA 3EZ4A 2V2CA 3G6LA 1Z3NA 3W7KA 4F4RA 3W38A 3XINA 5EMUA 4RE0A 1A0EA 4XZWA 1NWRA 1VLWA 1FVPA 2AL1A 3M07A 5AC5A 1TVLA 1HW6A 5DF0A 1FWJC 2XFWA 3IJLA 3NA8A 4NAFA 5F4WA 4O1CA 1EHAA 3MY9A 3CQIA 4J3UA 2OWCA 5U7SA 2VCBA 2PTZA 3V18A 3SZ8A 1ZENA 3QC3A 2J77A 5M5DA 5F4XA 1DQWA 5DRIA 2BOGX 4O13A 4U10A 3W7QA 3T2OA 2HDJA 3WEMA 3KVMA 3M6DA 2BVWA 4PH6A 3L5MA 1GVIA 1FWWA 4C90A 4X61A 4JOMA 5HDRA 3F03K 1JZ6A 4X9SA 2QQ6A 4PSPA 1FWRA 3QMTA 3V5CA 3OZMA 3DC0A 4WUIA 3LCHA 1F7BA 1YIXA 4KWVA 5ECVA 1PKLA 1JFXA 3G18A 4IIBA 2IXVA 1I2QA 1F8MA 4F0KA 3F4NA 4WSJA 2OEKA 4HSOA 1C8QA 2WV8A 4BCEA 5BNKA 3TTEA 5LXEA 4HD5A 1EYWA 1E56A 2OJPA 3H12A 4DUVA 3E2SA 2KAUC 4AH7A 1UA3A 1LLOA 1K4HA 3FSTA 4LUSB 5A6BA 2G3IA 1LG1A 1VIZA 1GJWA 3SY1A 2Q71A 2F84A 1HX0A 3K13A 1LROA 1JF5A 4WQ6A 1EC7A 3QOKA 1OFQA 1Q63A 4GI6A 3TU9A 3TJ4A 1UUQA 4JNYA 5I7GA 4PE8A 1XH1A 4IMAA 1B9ZA 4FP1A 1Z8AA 4IIFA 4JFSA 1YE4A 3C8FA 3DHDA 1N82A 4UNLA 2X16A 3HG2A 3U6WA 1ICQA 2QCEA 4CVUA 3FA5A 4DJFA 4HBKA 2PGWA 4G6CA 2ZOXA 3W2JA 1CLKA 5J5RA 3GYEA 3G0SA 1EP2A 4ZOBA 2VKZG 4RW5A 2UWFA 3H4XA 3CNYA 3L7RA 3LTPA 3NOEA 3WLNA 3WH7A 2HK0A 2BY3A 2NX3A 3FW6A 3LD5A 2VZSA 4KCWA 1L6YA 4IIEA 2RJGA 1DOSA 2Y89A 2XFRA 1UWSA 1I0DA 3LLXA 4YMZA 2J8FA 1B30A 3EYPA 1ENUA 3A24A 2NWSA 1MQRA 3AYSA 1XG4A 4CQBA 3JVAA 1F5ZA 2OQLA 1W0MA 2CWXA 5I09A 1LWIA 2YW4A 4A8RA 4B90A 5EFFA 3POCA 4OKDA 4MTVA 5HQEA 3KBJA 2IKJA 4TO8A 4WIWA 1PXGA 4HIBA 1GG1A 2BGSA 2Y7FA 3SCNA 4E5TA 4OHQA 1BTCA 5ABHA 5CPOA 2EJ1A 3LPFA 4YN5A 4AWEA 4LANA 3MWAA 3O16A 3VVGA 3XIMA 5E1QA 3AIEA 1I1XA 1QDSA 2PE4A 3ZLHA 3RMEA 1DHPA 3CT7A 3VD5A 2DT0A 4LBRA 1ELSA 1HO1A 1FWCC 5G4WA 2PDCA 2O9PA 3STEA 2F2KA 3PBWA 1VBHA 4Z17A 2ZZ7A 3BAYA 1T7LA 4JXCA 4GVFA 3TXZA 3W2MA 3NQMA 3BAJA 3WKZA 1BQCA 2EG6A 4C6CA 1UASA 2TSYA 3W84A 1HUVA 4YTUA 1I0BA 5DQPA 4DHGA 2DIJA 3O07A 4NVTA 3RM9A 2R1MA 5DMMA 3DC8A 3LI1A 5I23A 3ABQA 2JGYA 3L23A 3B9EA 4KEVA 4UUIA 4MWAC 5KZDA 4JFVA 2I14A 1BTMA 2FVLA 3KE0A 1XV8A 2BHYA 4LRSA 4XD6A 4HTYA 3GH5A 2J9ZA 5BXSA 3KTCA 4OVXA 3DKLA 1PIGA 2FPTA 2GWGA 4B5SA 3QW3A 3ZFHA 3WF4A 3S9IA 1T41A 2V2DA 1OX4A 1TTIA 3CXOA 3LBMA 3GR4A 5DN1A 1P0BA 4PMJA 5LIYX 4UTJA 4ML9A 2Y5EA 2VP8A 4PMYA 4ALDA 4F8XA 1FHUA 4O8RA 3IV3A 4L9XA 4FALA 3TYAA 2BP1A 4ICCX 4WGXA 1DWIM 2WXDM 4KEUA 2V81A 3G3DA 1EEPA 3TTSA 1M53A 3D3FA 1UR8A 1SR9A 1IT8A 1JZ7A 4B9ZA 3EOLA 1VFUA 3CMJA 4MSSA 4GQQA 3UR8A 2P8CA 4AB4A 2Y0FA 4D8AA 3ALFA 1XIEA 3OZOA 1V77A 3U2EA 3WEZA 2C14A 1QWGA 4TQTA 3S5YA 1MMFA 1M7JA 4MKSA 1E72M 1PZ0A 2VD8A 1HO4A 2PMQA 3DERA 4D71A 3FS2A 1A5OC 3RLUA 4MWAD 4OE7A 2FMNA 1UQZA 4NASA 2X7VA 4J2PA 4HNOA 3N6HA 3ZR4A 3IRSA 1JG9A 2P50A 3NUKA 2EG8A 4EX4A 3I3DA 4TVCA 5D09A 1TTPA 1XLLA 1SU5A 1VJZA 3AO0A 3TW9A 1Q6EA 4W86A 3LHVA 1JPDX 3PZVA 3MI3A 3SRHA 2WKJA 1OGBA 2DDXA 1LBLA 2RDWA 2XDFA 3A9IA 4HPNA 2NQ9A 4N7QA 1QW8A 1EJWC 1M3UA 2IPJA 5DMLA 1ONXA 5CXPA 2XHYA 1H4PA 5M3WA 4S38A 3UWWA 5CC3A 1NARA 3S5SA 2BZNA 3VD4A 1QI3A 5FSDC 1VQTA 2XVKA 3KAOA 5FOOA 1NF7A 1PPIA 3PM6A 3WNMA 4REQA 2P0OA 3RPTA 3TC6A 3ARPA 2VFDA 1IT7A 4YNGA 1S2CA 5K9CA 3LGGA 1PZ1A 1DWJM 1HFBA 3D5HA 1R7AA 3TJXA 3UA3A 1QNOA 4KWWA 4MF4A 2E8YA 2FIQA 4IPLA 3TR9A 2QGYA 1XLKA 1M9HA 1NVMA 1EIXA 1E5JA 3KRSA 4QDMA 3S1VA 2H9AA 3WQOA 3G5EA 1NTHA 1SZGA 1K77A 3CAQA 1XGZA 3B9NA 5BU9A 1VC4A 2HE5A 2WOQA 4UFMA 1MEIA 3P80A 5A6SA 4IZGA 1K6WA 5JMUA 1XLBA 2H90A 2DJLA 5LSMA 4U4MA 4XBSA 2PWHA 3PTMA 3GD6A 1R7OA 4KMQA 2PSNA 3I7RA 3OVGA 3CB8A 1U2YA 2J7EA 3AS0A 4R53A 2PDPA 3H21A 3U8GA 5KZ6A 1ZQ5A 1M7PA 3W2KA 3K8LA 3NZQA 2CXEA 4JTRA 1UWTA 2D2HA 2YPIA 2G96A 1RK5A 3TFCA 3P3BA 4JIPA 3P61A 5DXXA 1NOUA 3CEUA 2PWGA 2JBMA 4WXZA 3TJLA 2EPKX 1T8QA 5LGXA 4LBSA 2UV8G 5AYBA 3AHVA 2P53A 3WF0A 1G67A 3UVIA 3REQB 3IUDA 3CV7A 4GZ7A 4DN1A 4LUJA 1YDVA 1WO2A 2YIHA 2VR2A 3G22A 2HJPA 2G3MA 5HJXA 3UWVA 2BG5A 4YVPA 3LHYA 2WB5A 3KWSA 2J7FA 3O05A 3WDQA 2Z29A 3TC3A 1AD1A 1EWDA 5B80A 4HPJA 4O19A 3CPGA 2WVVA 2W6RA 4PCTA 1BF2A 1SR0A 2R24A 5TQLA 1XLMA 4JX6A 4MJ4A 1TELA 4HU3A 3TN3A 4EAMA 3IPWA 2A7RA 4W85A 3ZS4A 2XWDA 1T96A 4NJHA 1WOAA 3CL6A 2OSYA 3DYOA 3GG7A 4MGGA 4LY8A 4FB7A 3C2OA 1FWEC 4X60A 5A95A 3NSXA 4MUZA 2CLLA 2HXUA 4WJXA 3BGGA 5A1AA 3UQNA 1P1MA 1A5KC 1B3WA 2W27A 2E6YA 2CU0A 1HL9A 4Q7BA 4JIRA 2YSWA 3TQVA 3S83A 2POZA 3W02A 7TIMA 3APGA 3L2LA 4DWSC 5G1TA 3JU2A 4P7LA 4HPHA 3VFLA 3U48A 3ID7A 3P8JA 1GOKA 1OYCA 3ATZA 2G95A 1JDCA 2E6FA 5AOUA 4AF0B 2QV4A 1ZJIA 2EKCA 2J78A 3TQPA 4IGNA 4LB4A 3AQUA 4KRUA 1E55A 2V38A 4QJ4B 3WH6A 4C6LA 3HQ1A 3KZSA 4HT3A 3DU0A 1TKKA 3B8WA 2CZEA 1VIWA 5D9OA 2VFGA 2YA1A 4AU0A 1Q65A 4XO6A 1TJPA 4KFOA 1UC4A 3NO1A 2VC6A 3H2FA 1KFJA 2C6QA 1W3LA 5HQMA 3BPWA 2ATSA 1PEZA 2OT0A 2EPLX 1CLXA 4BQ3A 1WBHA 1GYNA 2Z7GA 3VNKA 3QFWA 1F3EA 5A8GA 3FGCB 3NEVA 3R0UA 4X63A 3WX7A 1PYMA 3SUTA 4GQRA 1FCQA 3LHZA 3UPWA 2NW0A 4JTSA 4ZQNA 3W1LA 4IFKB 4PTNA 2AKMA 5A2AA 1Q45A 1FKXA 4DZHA 3G8RA 1W5OA 2C8NA 5FJPA 4X3ZA 2I9UA 1LOSA 3RHGA 1W31A 3E6EA 3VKAA 5D9MA 3QQWA 4WX2A 2PU1A 1OD8A 1RCOB 2VZUA 2ISSA 3GH4A 3GNXA 1OSEA 3W75A 3EDDA 4BA0A 3S1XA 3OEXA 2XIIA 2VDHA 5I79A 4F48A 1G4EA 4I7WA 1LL6A 3BG5A 2QCMA 4W9TA 1BRLA 1GTEA 3O9NA 1VP5A 4EXBA 3TP4A 3T42A 3PWGA 1ISXA 4BS0A 4FR1A 3CM4A 3CIXA 2BBFA 2QAFA 5E9AA 1YHTA 2I1OA 2J7DA 4IOTA 1JZ5A 4P5UA 3COTA 5KEZA 2BGNE 9RUBA 4OFCA 3RGTA 1L9WA 1RSCA 2PBGA 3G77A 1QNSA 5AHNA 3E2QA 4L4PA 3B9AA 1LTDA 2AQOA 5CZSA 1MUMA 4JZ5A 1OFDA 4M5PA 1QHPA 3GFXA 1KKOA 1UPPA 4W8BA 4B16A 3QV7A 4XAZA 1J4EA 4E3TA 5JIWA 3B8TA 4Q3MA 3KS6A 1OJXA 1FWHC 4GX8A 1E1CA 2JKAA 2L5HA 4A2RA 4NZFA 1PWLA 1UCWA 1H41A 4QLJA 4H04A 4WEVX 3GKFA 5BZAA 2A6LA 1H5VA 2YYUA 3BLLA 1G01A 2W92A 3OOQA 2W67A 3CS2A 3NVTA 4GYJA 3SGUA 2ISFA 1AA1B 4NYYA 5BOFA 3TOPA 2H3BA 4J40A 3NXLA 3TKFA 4LWWA 3AIVA 3SN0A 1FXPA 2PDWA 2VWSA 3LLFA 4W93A 1K9EA 2A3AA 4UNKA 1HGWA 4ZOCA 4IG2B 6CGTA 1ISZA 3OQ8A 2E5DA 2VGIA 4M19A 2Z1WA 3R7MA 3WLLA 2XSXA 2YBVA 3LCGA 1QO2A 1W56A 2ON3A 1TPB1 2QEZA 4AVOA 4YHGA 4UNIA 1YX1A 4ZQPA 4YHEA 3UY7A 2PAJA 2ATMA 2CWNA 4H9YA 4Y8FA 1WYIA 3FJ6A 2E5BA 1KXQA 1XR2A 2ACUA 3TSDA 3BO9A 3HG5A 5LXXA 4ZOEA 1AH0A 3ABXA 3H2CA 3SQLA 2DY3A 1CDGA 4DZAA 2VD9A 5KZMA 1HT6A 2GWNA 4MJMA 2E1WA 3IVUA 7REQA 4DI8A 2DUAA 3GAYA 4A8IA 1XS2A 3UERA 3ALGA 4IIGA 3WNPA 2OLHA 4I8YA 3KW3A 4Y8EA 2OFJA 3SGGA 3UWQA 1J2WA 3VIJA 4MKNA 5FJIA 3R2GA 3I7SA 3CQHA 1M1BA 4ZVJA 3BMVA 3HPAA 4AZCA 5AVHA 3LUTA 4FXJA 1W1ZA 2JF7A 5C6MA 1TO3A 1Q6LA 1D7KA 3UD6A 3NZPA 1N8FA 2JE8A 3ITGA 1M01A 3E02A 1VBJA 1SGJA 3EWYA 4US6A 5IHSA 1VJIA 1GHSA 1YPIA 1TCDA 3SO7A 2MUCA 1F2JA 4H9UA 1R2SA 2GGEA 1GUVA 4XVDA 4RNHA 1EFZA 5HA7A 1KB3A 5HINA 3E1F1 3M0XA 1BLIA 3NEHA 5IBXA 1JCNA 1XHGA 3KL0A 4AD4A 1IEQA 2QVNA 3PPCA 5C9UA 1UC5A 2HS8A 3U5YA 3CYVA 1HZYA 3CHDA 4LU0A 2ZXAA 5RUBA 3P14A 1RJRA 4O1DA 4UWMA 5I78A 1A3WA 5HNTA 3S9YA 1XINA 2V5DA 4KEMA 1GTHA 3PBGA 2IKGA 3KOWA 2J13A 4Q4RA 3ERPA 3CHFA 7TAAA 3G1XA 4JTGA 1ICPA 2FH6A 3EWCA 2D3LA 3RPDA 3MBDA 4W7UA 1W1VA 2DQWA 1B54A 5IHRA 3QLLA 4PRRA 3GG1A 4PUWA 4QDPA 3DN5A 2OZ8A 1D9EA 4D6CA 4YXGA 8A3HA 1W1TA 3QYQA 4RZ6A 3VINA 3ARXA 2ZXDA 3TSBA 3WQ4A 4ZB0A 4J28A 1ONWA 4JQ3A 3LHTA