4YVXA

Crystal structure of akr1c3 complexed with glimepiride
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4yvxA00
3R43A 1S2AA 3H7UA 1AH0A 1VBJA 4Q3MA 3LQGA 3B3DA 4PRRA 3GHRA 2BP1A 5LIYX 4WDUA 3UZZA 3WBWA 2IKJA 3O0KA 3V36A 1GVEA 3LEPA 2IPGA 3R94A 2IKIA 3UWEA 4DBUA 3P2VA 5HNUA 4I5XA 4PMJA 4AUBA 4XAPA 2I17A 3KRBA 2FVLA 4YS1A 2PZNA 2HEJA 2HDJA 3WBYA 2HE5A 4JQ2A 2PDMA 5HA7A 2PF8A 4DZ5A 3Q67A 2FZDA 2PEVA 1JEZA 4JIHA 2INEA 3V0SA 2ACUA 1PWMA 3UZYA 4WEVX 1MZRA 1XGDA 1S1RA 1Z8AA 2AGTA 3LUTA 4L1XA 4XZMX 2DUZA 1ZQ5A 4WDWA 4GIEA 5LIXX 1RY0A 4ICCX 3N2TA 4JQ3A 4WGHA 4XZIA 2INZA 4GABA 1XF0A 3CV7A 3EAUA 3GUGA 1R38A 3UYIA 4Q7BA 1YE4A 2P5NA 3DN5A 3Q65A 4JTAA 4FZIA 1X97A 4PUWA 4GA8A 2PDBA 4DBWA 2C91A 4GQGA 2ACRA 3ONBA 4PR4A 3UGRA 1FRBA 2PFHA 5DANA 1QRQA 2ACSA 2F2KA 3H4GA 4OTKA 1C9WA 2F38A 3WBXA 1ZUAX 4XZNX 1PYFA 3CAQA 1T41A 4WDXA 3MB9A 2A79A 3LZ3A 4LAZA 3FJNA 3M4HA 3NTYA 4NKCA 2HE8A 2ALRA 4WDTA 3V0UA 3M64A 4QXIA 4XZHA 3R58A 2IPFA 4ASTA 2R24A 1UR3M 4HBKA 3V0TA 4QR6A 4PUUA 3G1RA 1LWIA 4HMNA 3LZ5A 1YE6A 4PRTA 1RY8A 4YU1A 4MHBA 2ACQA 3CV6A 1YNPA 4IGSA 5AZ1A 1OG6A 3BCJA 4GQ0A 2PDXA 2PDYA 3S3GA 4GACA 3H7RA 3WCZA 3GHUA 2IQDA 1Z3NA 1VP5A 2HVNA 2PD9A 1PWLA 3UZWA 3O3RA 1XJBA 2CLPA 4JTCA 1RALA 2HVOA 1ZSXA 2IQ0A 2PD5A 4LB4A 1Z89A 4RPQA 4YVXA 3T42A 4DBSA 1K8CA 3ONCA 4FALA 4XVEA 1EKOA 3R8GA 3COTA 3UP8A 1X98A 4EXBA 4IJCA 2FGBA 2PDGA 2DUXA 2FZ8A 4JQ1A 4G5DA 3R6IA 3N6QA 4F40A 3CASA 5JH2A 2IPJA 4QX4A 1IEIA 3LQLA 2NVCA 3WG6A 2PDHA 1HW6A 1AFSA 5JH1A 3BURA 4XO6A 1EXBA 1T40A 3RX2A 1Q13A 3LN3A 4LBRA 2QXWA 4JTQA 3CMFA 2PDCA 3CAVA 2J8TA 1PZ0A 3EB4A 4JTDA 5C7HA 1QWKA 2PDWA 4FAMA 2I16A 1S2CA 3LNMA 3QKZA 4H7CA 4LAUA 1ADSA 1PZ1A 1YNQA 1EF3A 4QBXA 3EB3A 3GHSA 4IJRA 3V35A 5HNTA 4L1WA 1A80A 4JIRA 4JQAA 2BGSA 1AZ2A 2PDKA 4LBSA 3FX4A 1S1PA 1SM9A 2PDJA 2PDIA 3GHTA 2R9RA 2VDGA 3LD5A 2FZ9A 3LBOA 4XO7A 2IPWA 4H8NA 1HQTA 4JIIX 1MRQA 3C3UA 3MC5A 5LIUX 2BGQA 5KETA 4EXAA 4YVPA 3R8HA 1ZGDA 2ISFA 3DOPA 5AZ0A 1AH3A 5LIKX 2IKHA 1M9HA 4JQ4A 1J96A 1US0A 3ERPA 3UFYA 4FA3A 3UG8A 2IKGA 3VXGA 1Q5MA 1X96A 4YVVA 1AH4A 2PDUA 1EL3A 1IHIA 2PDFA 2PDPA 2FZBA 2IS7A 3R7MA 4ZFCA 2PDQA 4JTRA 3RX4A 4XZLX 5M2FX 2WZTA 3F7JA 2HV5A 4XK2A 3U2CA 1LQAA 1Z9AA 4WRHA 4XVDA 3G5EA 2WZMA 3BUVA 2DV0A 4GCAA 3D3FA 3M0IA 2PDLA 4R9OA 2PDNA 2NVDA 3BV7A 5LIWX 4LB3A 3RX3A 3UZXA 1MI3A 1AZ1A 3LENA
chains in the Genus database with same CATH superfamily
3GXMA 3QQWA 5LXXA 1ODZA 3H7UA 5K7JA 4IPPA 4XUGA 1VPYA 3GHRA 5FL1A 2ZDSA 3AMDA 3SM0A 4F9DA 1U1UA 3IK2A 1F2JA 4Q4MA 4MFEA 3AO0A 3GU2A 3H7VA 4QITA 3QHMA 5FF4A 3L66A 4AUBA 6ALDA 1REQA 3VKDA 3VZYA 4LVBA 1KFJA 4IJBA 4JN7A 3VGBA 4YTSA 1NDZA 3MUIA 3PS7A 3DEQA 5CC5A 2ZUVA 4GD0A 4UTTA 3URNA 2PDMA 1TPH1 4NX5A 3BH4A 3I65A 3QPYA 1NOFA 3VIOA 1TA3A 2VR4A 3VIMA 5LGXA 2OXNA 3G1DA 2GGJA 2YBVA 3UY7A 1YX1A 1DJIA 4ENLA 1JCJA 3MVTA 4F0HA 3ZR5A 4YCPA 4A2SA 4PMNA 3S46A 3DECA 3EDKA 3FEQA 2V67A 1UKTA 1OFOA 5FJPA 1L6YA 4NX0A 3TC7A 1G4TA 1EJUC 3DBPA 1UR8A 5G1YA 3AZSA 5K9DA 3VCNA 5JIWA 3C8NA 4GXPA 4OBTA 2E9BA 3UYIA 5ECUA 4WJEA 1RBLA 1FCUA 1YRRA 4ZGYA 3SR7A 3PWIA 4LYKA 3GWQA 4DXKA 4FR6A 2C0AA 1E1EA 3LSCA 5EKYA 3GB6A 1RQBA 2PDBA 3YPIA 1SZNA 3NNTA 4PTDA 1G0CA 1OFBA 4GUGA 2GGHA 4PBEA 2VEIA 4QJ3B 3I4EA 4WLCA 4LUIA 3LBMA 2F38A 2FPYA 3IIZA 1YPIA 2QDGA 3OTRA 5D2YA 4JYEA 4HK6A 3KOWA 3QW3A 1P1XA 3SCOA 4B2DA 1RPXA 4MZYA 2QAPA 3M4HA 1E4LA 4LC8A 3U9IA 5F4SA 3A13A 3LOTA 4AF0B 6TIMA 2V9DA 1IEQA 4GPNA 4XZHA 3R58A 3BV4A 4M51A 2J9XA 4UNLA 1RVKA 2YLLA 2YSWA 2R24A 2VKZG 1F61A 4Q8NA 1D3HA 2VM8A 1LUCB 3NQEA 1UA3A 2DDXA 3HFYA 4S2BA 1E6NA 3KBWA 5BXTA 3MHFA 4DZAA 1NFPA 2XM1A 4GQRA 4JX6A 4FOUA 1HT6A 3DCPA 4NSBA 1NWUA 3UT0A 3GHUA 2DU2A 3UQNA 3FCPA 4OT7A 4E0CA 1K70A 4IMEA 4Z1AA 3TXVA 3VMPA 2FDSA 2PRLA 5KSWA 5CGQA 1WXZA 1IR1A 3WQ6A 3STEA 2BX7A 5DCEA 4JS3A 4WJXA 1EQCA 4M82A 3APGA 3KZPA 2YYTA 5C9WA 3LCIA 1JCYA 1VJZA 1UH3A 3C5QA 1SJCA 3CH9A 4EXBA 3MDUA 2YCIX 2XGIA 5I03A 1M7PA 3EA1A 5BNKA 4P8UA 3F4WA 2HPIA 4K3ZA 3W7HA 4PN2A 9XIMA 1GOMA 1K8XA 2HPMA 3LHVA 3ZWTA 4LUTA 2XFYA 1YTKA 4GJIA 1W9XA 1FH7A 3ENLA 3O1NA 3AIEA 2NX3A 1L2QA 1Z6KA 1B3WA 4AWEA 3HBLA 3WQ4A 3KOYA 4OOUA 4CNPA 3ARRA 4ZSUA 5TQLA 3HMCA 2D2OA 2QGYA 3WH6A 4QAIA 2VT0A 3W1XA 1H0GA 5A6BD 4MB1A 3BLEA 5D37A 3UG3A 2C19A 1QAPA 3LCFA 4FNSA 3OGRA 3QR1A 3QY7A 1WKEA 1GUVA 5TD4A 3W1UA 3IAQA 4XKYA 4MNKA 2VC9A 3W1TA 1HO4A 2XM2A 2X16A 5BWAA 2WJDA 2QF7A 4JTLA 4PEEA 3V16A 1X1OA 3SW6A 2XIOA 4BZYA 3GHTA 4DF0A 3AMKA 2J7FA 5T8GA 4LY8A 1LTDA 3TTSA 3EWUA 2E3ZA 4E6MA 4C90A 4FLSA 4NAEB 3EPOA 3DXIA 2XSBA 1MRQA 1M41A 4RK8A 4P7QA 3M0HA 4GZJA 2YCLA 4C6NA 1VQTA 1DPMA 5DEZA 3L68A 4GNJA 4DO5A 2GFTA 4QFUA 3ICJA 1DHPA 1UR9A 3PTDA 4Z42C 2SFPA 3U2OA 4AIEA 3MUY1 2ICSA 3ZJ7A 7REQA 4MZ8A 3MP4A 3W71A 2DEPA 3DH7A 1CI1A 2BHUA 5I5RA 5JIPA 4AIOA 2Z0IA 1RPKA 4YTQA 1Z69A 4C65A 1OQFA 5BRQA 3SY5A 2G4JA 4PL1A 1B9ZA 3MJYA 2BHYA 4ZTYA 3RILA 1RQEA 1TWSA 1ZBWA 3U2EA 5HUOA 4H8HA 1WX0A 3VA8A 1B4KA 3TJXA 1PX4A 4R9OA 2E6YA 2Y7FA 1U1HA 4PUKA 4J3XA 2GL5A 1E6ZA 1DXIA 2W61A 1EBHA 1W5MA 1PCWA 5DBTA 3R43A 1W1PA 2I7GA 1DHKA 1MUMA 3F2CA 1HF6A 3B3DA 3KDNA 4QE4A 3LHTA 4Q8VA 3W7LA 1FXPA 3T1GA 2XWDA 5BOEA 2X2YA 3GTFA 2FKPA 1CWYA 5HNUA 4Z2HA 1UZ4A 2TPSA 3OGSA 4DN1A 8CGTA 3EDDA 1EJXC 1EWDA 4JDYA 5MKGB 3GIPA 3H24A 1U30A 5C9XA 1XIFA 1L6FA 3K8KA 3GLCA 3H2FA 3WNOA 1XLKA 4BWLC 1O5XA 1J9YA 4LY4A 4LEFA 1KRMA 1S1RA 1Z8AA 1EA9C 2FQIA 3IUDA 4CU7A 4GI9A 1RY0A 2CYGA 4OBSA 3TJLA 3GR8A 2QJGA 3EKZA 4F0MA 5C0QA 1HL8A 1EQPA 3FEMA 2WCAA 1HGWA 3EYPA 3L12A 4ZENA 2YOCA 4UFJA 4PMXA 3AU6A 1F76A 4B3ZA 4HN4A 4QSFA 4QGCA 5LNVA 4ZEPA 3OW1A 2V5CA 2YKKA 1VHCA 1JULA 1KXVA 1RK6A 1FCVA 1OCBA 5G2HA 2E09A 1BWLA 4YWSA 2NT1A 4DLFA 1W54A 4L1GA 3RN6A 2I5IA 2R6OA 4Q7IA 2PFHA 3OPSA 3T2OA 4JY9A 1P0DA 1ZAJA 1YDVA 2ACSA 2F2KA 1F73A 3ZR6A 2BVDA 4GKLA 2JALA 3MB9A 3BOXA 2PMQA 1YDOA 3RFAA 1VRDA 4F66A 4XB3A 1WKDA 3WF2A 3B4YA 4AEFA 4JEJA 1Q6FA 3WJSA 2Q8XA 4RL3A 4HBKA 3V0TA 1YDYA 1HKIA 4R27A 2Y8VA 4C60A 1PKMA 1RY8A 2JQXA 3T0DA 4NJJA 5EA9A 2VCCA 3CV6A 3CYVA 3OG2A 3Q94A 3UETA 2PDYA 3NM3A 4N0RA 3EWBX 2OPJA 3SDOA 1NDWA 3WL1A 1KM3A 1T99A 3PBVA 3ZLFA 3LHUA 2W63A 1VP5A 4DO4A 5M03A 5F4WA 5DMMA 3H2EA 4RXGA 3CLMA 5HWMA 1UR4A 4RPQA 5TF0A 3LMYA 1I75A 2B0MA 5FEXA 2GVLA 4W84A 3MSRA 2XGZA 3ITVA 2CERA 1RP9A 1WCGA 4H9YA 1XR2A 1FCQA 4ACYA 1T0OA 3UERA 1EKOA 2Q09A 3O8AA 1GTEA 4I6VA 1I45A 3UJEA 4B92A 3UVAA 1U22A 1VH7A 1RCQA 4R33A 1UC5A 4F40A 3DENA 3W2JA 2OEJA 3NGJA 3ABSA 3NQDA 4FB7A 1IEIA 1UIOA 5B7YA 3EWCA 1BQGA 2WPGA 1XXXA 4AZCB 5HINA 1V6WA 2WC7A 2FB2A 4W85A 4EF8A 3ITOA 3OLDA 3BLKA 1QBAA 2CLHA 1GVYA 1JNEA 4HNVA 2OWCA 1OC7A 2CHNA 4DLMA 3ATYA 5BROA 4H4IA 2EG6A 1TWIA 3H2CA 1O5QA 4ATLA 3KLLA 5C7HA 2MNRA 1JPHA 3TQKA 4DZIA 5A6LA 1DL3A 1ADOA 1QATA 2R91A 1PTGA 3WD2A 1H7RA 2PPGA 2Y88A 5HJYA 5CKSA 5MHBA 1HO1A 1TQJA 3IJQA 2HMCA 1BWVA 4OECA 2QJIA 1MUCA 3AIQA 3WQDA 3S2JA 5DXXA 1X38A 1CXFA 3GG1A 3PAJA 5A2CA 1PHWA 3WIJA 3CMJA 3GRIA 3IARA 2D0GA 2WZEA 1J93A 4S3GA 3VD5A 3H21A 2O4MA 4MKNA 3B9DA 5K4XA 3GW0A 5CEWA 1LORA 2PDIA 2V8ZA 4XWUA 4D8AA 1KA9F 1FWJC 3E6EA 4GY0A 5G4HC 4BK9A 2R1NA 2FZ9A 4H8NA 2GSEA 4EOUA 4B5TA 4C91A 2FPTA 5AVNA 4AD3A 1IT7A 1JCMP 5KETA 3R5EA 4F2UA 1KTBA 2QKFA 2BVWA 1G4PA 4Q4OA 4N9EA 4A3RA 1AH3A 5JBDA 4EIVA 4NZFA 4X63A 5K9XA 1VFSA 1US0A 4S3EA 3M0KA 4CVUA 1GVRA 3VXGA 5AB3A 1O66A 3R10A 2GK1A 3TXZA 4MKSA 3RNDA 1X96A 3QY8A 5T9BG 1EJRC 3W7NA 5A5WA 2RUSA 5D03A 4M6VA 2J9YA 5D30A 1D3GA 1CYGA 5ABFB 1RCXB 4FMVA 4XG1A 1GPWA 2E7FA 3C0LA 2IS7A 4ZFCA 3VKBA 3ZLHA 1EF2A 3NQ7A 4P8VA 2WVVB 1SSDA 3ZQ9A 3P5YA 3AJ7A 4BI5A 4BFAA 4LVFA 1RA0A 1RBAA 2BOEX 3OJGA 3A9BA 4WRHA 2WAGA 1IWPA 5G2IA 4QLKA 2WPBA 4CQAA 3CHEA 3EX4A 2WZMA 1QPNA 3CTTA 3BAYA 4M8UA 4RDVA 4RJEA 4M6QA 3UJ2A 4O28A 2D24A 4MPQA 5ABEA 4U3CA 4D1JA 1LBLA 3W2UA 4UXDA 3A4WA 3FJLA 1H7PA 4JL1A 2ZZ7A 2ZZ5A 3ELFA 1XFBA 3U8GA 3O0KA 2BODX 1DJWA 1TVNA 1Q6OA 4KCUA 4LRSA 1TV8A 4J3UA 1RUSA 1TPVA 1EX1A 3KWXA 5HOSA 1V6TA 2RDTA 1EGZA 3VKJA 2ZRUA 4HN8A 4DJED 2QW5A 3NL6A 3PG8A 1L2UA 3W00A 5MF5A 3TLQA 4TV6A 3GO2A 2PAJA 3EPMA 3LPPA 1EEXA 2FZDA 3QLLA 3RPDA 4AWUA 4DYJA 3GTXA 2OWXA 1SMAA 1JAEA 4PCSA 3F5KA 2XFRA 4E2VA 5CPOA 1XGDA 4D6JA 2Q3OA 3IJ6A 3STGA 5A94A 2X40A 1J0YA 2ATSA 3TA6A 3L4YA 2JIWA 4XD3A 3N18A 5EB8A 1HUVA 4CU6A 3TR9A 1LP6A 2XZ7A 3TTEA 6TAAA 3P3BA 1IIGA 1KM6A 1PTAA 1GVIA 1SYTA 4X0VA 3T44A 3WBAA 1VR6A 4PEKA 1XG3A 4O13A 2FLIA 2ZTJA 3QZ6A 1NOWA 3DBNA 3H2AA 2J75A 1KRBC 2WMJA 3WKZA 1W17A 2O4QA 1A53A 1H7WA 4DXVA 1P0BA 1WZMA 2PWDA 1F6PA 4P7NA 1CGVA 3BOFA 4J3TA 1H49A 4XQ6A 4EPEC 1R2SA 2RDWA 3SY1A 3VNMA 3PTQA 6XIAA 5BW6A 3VOHA 2GDUA 4BKNA 5DXYA 3CAQA 1T41A 1QR7A 1LYXA 3L4XA 1O5RA 1R2TA 1GKPA 3WQ8A 3TZFA 3PWAA 2ZCGA 4HTBA 2J25A 2AL2B 6ENLA 3BAIA 3KS6A 1RBOB 2Y2WA 3HA1A 2DZAA 2NQLA 3JW7A 3D46A 2XFWA 3CIXA 4HMNA 4MB4A 2EO7A 2JK2A 4QDWA 1UKPA 3M44A 2VNCA 3UBPC 4F8XA 4GINA 3UA3A 4HT3A 5AZ1A 4X2PA 3B0YA 1EHAA 4AFYA 2QV4A 2XH2A 1XSKA 1UMYA 3W86A 1GVOA 4UCGA 3U5YA 3VKKA 1DWGM 1H09A 5J04A 3C56A 1WUEA 1HJSA 1RALA 4FHAA 4JIPA 1TPFA 2QJNA 1EH9A 1KM1A 1ESWA 4S38A 4TVUA 1UOKA 4LB4A 1TFVA 1XCXA 2FZNA 2PBGA 2FIQA 1I1WA 2VUYA 1MRAA 3DZ1A 3MCNA 4RW5A 3VGHA 4C6KA 4FALA 4XVEA 1AL7A 1CXEA 1XLAA 3AMGA 1UP3A 3CK5A 5F4XA 3NZQA 2DUXA 2G3JA 3ME3A 4G5DA 4MIMA 5F2IA 1AD1A 1SJAA 1KWGA 1XIIA 1XBVA 1EJTC 1B3YA 1JZ8A 4HPGA 1C8XA 1GJUA 2VELA 5E9XA 1AFSA 1Q6LA 3UJFA 2VCAA 4HOZA 4U4MA 5FAJA 1OFPA 2XIQA 3ALGA 4CCEA 2DZPA 2VX7A 1WB0A 2WBGA 2DVXA 2RDUA 3MMUA 3CMFA 1RSCA 2D20A 3LCLA 4PULA 2AKZA 4FAMA 3PNUA 4WKAA 4AH7A 2UV8G 3CZKA 4E8GA 1XKJA 1TMHA 4PMDA 3E0IA 4KS0A 2FGZA 5F2LA 1IZJA 4UR8A 3LNPA 1V93A 1DQUA 4LANA 2ZVRA 2BXVA 4TUFA 1MQQA 5HXMA 3VDAA 2BBFA 5M5DA 2POZA 3UG5A 4PCNA 3L67A 1I2OA 1ISYA 1A5AA 1XISA 2NWSA 3GZAA 4M3PA 3KWSA 3L21A 1XD1A 1V3HA 3CTLA 2J7EA 5IFTA 1JRCA 1E3XA 2J77A 1UMLA 1L0PA 3AAMA 4Z17A 3BARA 2QQ6A 3LD5A 4XO7A 4ONVA 4KQNA 1HQTA 2J8GA 3C2RA 3C3UA 4CCDA 2BGQA 1RP8A 3DFQA 1A5SA 4IG2A 4CEUC 4W8BA 4C7GA 4TX9A 1TPUA 3IGUA 3DOPA 1AJ2A 4HCDA 3FA4A 2EJ1A 4FNPA 1K9FA 3LV5A 5KITA 1V51A 3TE9A 3MWAA 3LLFA 4Q8QA 2YBTA 3WK2A 3L0GA 2BY0A 3N6HA 1H5YA 3VOCA 4O1EA 1KM2A 2WQDA 5JVLA 4C5ZA 3HIJA 5G5IA 1E5JA 3QN3A 1B54A 1PX3A 2OSXA 2WCSA 3QKEA 3F4NA 3TMLA 4XAYA 3S6DA 2V3GA 1W2PA 1KGUA 2MUCA 3UESA 3RCYA 4YN5A 3PR2A 1HVXA 1DXFA 3CAWA 2W79A 3RM4A 3J7HA 4R53A 2A3LA 4GX9A 4O52A 3BLPX 4JIQA 2DQWA 4GFSA 3ITTA 3EX3A 1KCZA 4ZQPA 2CW6A 6CGTA 1CXLA 4GO9A 3H54A 3R4IA 4J3WA 1IQ8A 1EPXA 2WM0A 2Q8LA 3SUWA 1YHTA 3NIYA 1EJWC 1CGYA 2VTFA 4FXRA 4GUFA 1U5HA 1E71M 1UWUA 2AAMA 5G4WA 1CXIA 2YL8A 3LHZA 2V3FA 1OT1A 3QOKA 3G18A 1V0LA 3MJMA 3N14A 2XISA 1BRLA 2CZFA 4LX4A 1K4GA 4AMAA 4MWAC 3FYYA 3ARVA 3WLQA 1OZMA 3TQPA 5DO8A 4CN1A 5BXPA 4GBDA 1DEDA 1OK6A 3W85A 5FESA 3NPWA 1VKFA 4IH3A 4L61A 1OWQA 1IWAA 3P7YA 3DHPA 1G7VA 3GFYA 4TX8A 2X1IA 1V3IA 5HA7A 4Q8UA 2EKCA 2ZUMA 5DELA 4MWAE 4DJDA 2D2JA 1G94A 3K1DA 4YPJA 1EP2A 3W1AA 3VNKA 4PCFA 3TTOA 3O63A 3B9OA 2CCRA 1O60A 4ZOBA 1UC4A 1UB3A 4QE5A 3L9CA 4KRTA 3N2TA 1VC4A 4O8RA 1LT8A 1ITQA 1YTDA 1H61A 5ECVA 3CV7A 5D02A 3DGRA 3EAUA 1W1IE 3VDCA 3MUXA 4Z08A 2OZTA 4B2DD 1UH2A 3HPZA 3NAVA 2W92A 2XVGA 1OCQA 2AGKA 3M1ZA 2E0PA 3SQLA 2XIBA 2A3BA 4D2JA 4MGGA 3O07A 2Y1HA 4FIQA 1MZHA 3STFA 3SRKA 3S1XA 2C18A 4HB7A 3OZYA 1VPQA 1YKWA 4WDXA 2OYLA 3MUCA 3HM7A 2A79A 5I24A 3NQ2A 1ZP3A 1AUSL 1W37A 2HE8A 5AHEA 1XH2A 2WBKA 4K38A 1GOOA 1J10A 1HGYA 3BAWA 4QXIA 5EYWA 2CZVA 1KXHA 4ASTA 3BSGA 5EBUA 1R5YA 1HKMA 2EGZA 2RDXA 2CLFA 2QZRA 3JZEA 3WSUA 1NVMA 3BAXA 3ANUA 5RUBA 1TJ1A 1I60A 3SCWA 1W91A 3UWWA 3W6YA 1SW3A 1YMYA 4IIEA 4GQ0A 3RK8A 3S3GA 1I0BA 4CVWA 2TRSA 3FGCB 2NUWA 2QPSA 2IQDA 4JR5A 1Z44A 4FO4A 3UR8A 4CN4A 3WD4A 4NJGA 4AMCA 3CL7A 4JTCA 3VILA 2HVOA 4XV0A 1EHNA 4D71A 2O7QA 3VGGA 4IFKB 3HF3A 1SQ7A 2NW0A 2ZIDA 4BQ5A 5PTDA 1Y5VA 4ML9A 1UQZA 1QOXA 3TV8A 3VMNA 4TVDA 4GJ1A 3BWWA 2OQYA 5EBAA 4CQ9A 3L0NA 4H19A 3GVGA 3M0MA 3N12A 2V2DA 2J6VA 3SGUA 4K39A 3CEPA 1XLMA 4EE9A 4DUOA 4LEQA 1N82A 3HG3A 3S83A 1HP5A 3GBEA 1ZB5A 2ZXDA 3LBCA 1SSGA 3IIVA 4NNAA 1ZJAA 4XAGA 3AICA 3T0BA 4DHGA 1JDAA 3QLDA 2YA0A 2B7OA 1CLVA 3W1PA 3KBNA 3NXLA 4ICNA 2PLJA 3VGFA 3QVQA 4PTWA 2J8TA 4WSKA 3BGJA 1SPQA 3HN3A 3QTPA 1PJ9A 1KV5A 1OY0A 4M0XA 1PSCA 3SCRA 4QJ5B 5H8UA 1NY1A 4XBKA 1ONWA 1XCFA 4QCEA 4FOKA 4K1WA 2PCQA 3I6EA 1FP8A 1S5MA 2A4AA 4V1YA 2ZYFA 2P3EA 2IUZA 1YNQA 1EC8A 1V0KA 2WMIB 3GHSA 1I0DA 2O55A 3WNPA 4FNQA 5JBEA 3T09A 5BWFA 1XIMA 4L1WA 4M19A 2ZWYA 3DFPA 4LALA 3SCTA 1WDWA 3MYOA 5CQ1A 1C92A 2PDJA 4US6A 1TZ9A 5IXEA 3THDA 1MXDA 1GOWA 1XIDA 3TYBA 2C79A 3GC5A 3WDPP 2VZUA 3RLHA 2IPWA 2DQXA 4I8DA 1SZEA 2R1PA 2NSOA 2QIWA 2VI0A 3AZTA 3H70A 4ZQMA 4S1FA 1VIWA 5LIKX 4J3SA 3M0JA 4Y9NA 4A3UA 2HWGA 3SIMA 1IGSA 3MHUA 1EUAA 4U31A 4H83A 3T55A 4YVVA 2XIJA 3N11A 4ZB2A 3QY6A 2YCEA 4DWSA 3AUJA 3A3HA 1XIBA 2E40A 5IBXC 3NQFA 4HIBA 2FZBA 4DY1A 3L2MA 4GYKA 4UOZA 3PAOA 1W8SA 4OVXA 2Q3RA 2GGEA 4V28A 5LNUA 2AKMA 1TPB1 1PIFA 4PMZA 1QW9A 4YNGA 4G6CA 1ZS2A 2GOKA 1NIUA 3L2LA 4XZLX 3WZ0E 3KL3A 1LQAA 2Y7GA 4HMCA 4QDMA 3VIIA 3VFCA 3RPMA 3WELA 5C54A 4XVDA 4WJ8A 5CPTA 3R89A 1WQ5A 1PIIA 5D9NA 5D8WA 4E8DA 4C6QA 4I8YA 1RQHA 4L4LA 2QPUA 1JNDA 4PUJA 4GI8A 1VFTA 5I0DA 1AG1O 1WNOA 3BSHA 2Z26A 4FI4A 4ZB5A 1JAKA 2XPKA 1MI3A 1UKOA 1E73M 4GVIA 4UFKA 3AIUA 1ECEA 1V77A 2W6RA 2ZICA 3WUFA 3C86A 3QR3A 4GCXA 2H90A 4RDZA 4ERIA 3UPMA 4DBUA 4KRZA 3CWOX 3DIPA 3MA8A 3EDJA 1PKLA 2OLHA 2W5FA 1XKYA 1V6UA 1GNXA 1T7LA 1V02A 3EDFA 4AD1A 5FI8A 2AQVA 2XVNA 1H2JA 3UF9A 4IIBA 4GIYA 1JDCA 4UTLA 1PX8A 2FJKA 1MXGA 1QW8A 4C6CA 3TEVA 2X1RA 1PVNA 1IGWA 2EPLX 1RR2A 3QEZA 3UZYA 2PWEA 3PVFA 4ZXOA 1BTCA 3CHCA 2V5DA 1XIEA 4A2RA 4HNNA 4A8NA 4J1OA 2WHMA 4GIEA 1PEZA 1SZFA 2GJXA 3QYSA 1A5NC 2JBMA 4AIUA 3KXQA 5DCDA 3W26A 3CZEA 1XWYA 3AS1A 1JG9A 4UTMA 3M43A 1POJA 5FJOA 4EWJA 3QXBA 3MI6A 2YPIA 4G2DA 1YE4A 4UFMA 4NU7A 2I1OA 3U2ZA 2AMGA 4HU4A 3KCOA 3GU1A 3VC6A 5LXEA 3CPUA 1FWNA 4UWMA 2VD9A 1QVBA 1MDRA 1JYWA 4DYEA 3IVSA 1HG3A 4IWWA 2PURA 2C1IA 5FSDC 4U28A 3QQ1A 1AQ0A 1C9WA 4M56A 3MQTA 3W38A 3M5ZA 4TIMA 2A3AA 2L5HA 2B7NA 1JDDA 3FJNA 4NKCA 1D8CA 1QCWA 3I10A 3A4XA 4K37A 2PWUA 4JTJA 1E55A 3GXTA 3CHFA 3EA2A 3WMBA 1MQRA 5GNXA 2QUMA 4RNIA 2QCDB 1OYAA 3B8VA 2FJUB 3EX6A 1TG7A 3FXYA 1KXQA 2QVHA 2ON3A 2WZHA 3LCGA 3UWYA 4LUYA 4M6UA 1B3ZA 1LROA 3WLNA 2B81A 3TC6A 4NRRA 3QV7A 2WKJA 2X1UA 2OEMA 1SO4A 1ZNNA 1G67A 1XDMA 5TAOA 4JGDA 2JEPA 1XJBA 5IHRA 1XLGA 1Z48A 1LWJA 2PTZA 1TTPA 4X0NA 1GW9A 5DQPA 3P81A 3TA9A 1QOQA 1MW3A 4QEEA 4LH8A 3WJWA 3GU9A 4O1FA 3IJ7A 3WFZA 5EU9A 1NTHA 1TUXA 1EDTA 3N73A 1O5KA 2YLAA 2OMAA 1S5NA 3I4KA 5D9OA 2NQZA 4GY1A 1RD6A 4IPLA 5AYZA 5LHFA 3GYCA 2Z1WA 3DHUA 4OU1A 3TYAA 1WBJA 3NEHA 1UUMA 3W6LA 1OX4A 1YBQA 4KWVA 3OBKA 2ZDRA 4F2BA 2E28A 5E70A 3CNYA 3AUOA 1DQWA 3CV2A 4IXXA 3VFLA 1UASA 3OOQA 3H22A 4X61A 3FJ6A 4KBXA 3S5YA 1KLZA 1KKOA 4RE0A 4CN6A 3CV1A 1GOKA 1E6XM 1XHGA 1IXPA 1FH9A 3SFWA 3VTRA 1R9XA 1H62A 3G22A 3IVUA 4ZL1A 1S2CA 3AQUA 4GC4A 3S4TA 5CPMA 1A0DA 2ZE3A 3LNMA 4GVGA 1TV3A 1WKFA 2H3DA 3TW7A 4J5NA 4GIAA 2HNHA 3R0UA 3PFRA 1UBSA 4OOZA 3EOLA 4L56A 3WUEA 3SAZA 2YA2A 3ARQA 2J7CA 3NSMA 3APTA 5HNTA 2VX4A 4HU8A 4I7WA 3W74A 3ITYA 1FDZA 2GUBA 4S3DA 3M16A 1QI0A 1A3XA 4L4MA 4W5UA 4X2RA 3QV6A 2R9RA 4JX4A 4L9XA 4MWAB 2H8XA 1Z32X 3R1ZA 5I00A 3NQMA 1SJBA 4JDBA 5F1UA 4YWIA 1J79A 4H2CA 2NXHA 1DTUA 1Q85A 2FB3A 2ASHA 4OUIA 1MEHA 4ERAA 4IP7A 4H7VA 4AEOA 5M3WA 5FACA 1GQNA 1AD4A 2Z6IA 1EDQA 1O94A 1BHGA 1FBAA 2V68A 3KUMA 4BEUA 1DJZA 3LX9A 1TTQA 2HBXA 2F7FA 3FS2A 3ITLA 1REQB 4KW2A 2W66A 1EL3A 3N1AA 1TCDA 3VNJA 3CUZA 4B4HA 4LYPA 1TX2A 1O68A 4JTRA 1P7TA 4ZE5A 1TA3B 1ISZA 4HTYA 5EFDA 3UCQA 2ISDA 3F7JA 2DUAA 4L4OA 4IPIA 4B90A 3U2CA 1AVAA 1CLKA 1AMYA 4W93A 3RJYA 2WSQA 3PANA 3OG3A 1B3XA 2V5LA 1XRFA 1BF2A 5C6MA 3BUVA 5I3IA 3POHA 4D6EA 4IOTA 5EGRA 3M0IA 2WNQA 2YJQA 2DFAA 4HZMA 2Z2UA 4DPPA 1HX0A 1Y65A 1J0KA 1DQXA 4KWOA 1LOQA 4R5EA 1V8EA 4DJFA 4ALDA 3NOYA 4N02A 4JHOA 5XIMA 1ZY9A 1R3TA 3LQGA 4FNTA 4C6PA 4O1DA 2J74A 2WANA 1JDEA 1ZP4A 2UWFA 1GWJA 1QNSA 1IEVA 1WXYA 3ZYZA 4O4VA 4O57A 1TE1A 3FYOA 3WUGA 4NXSA 1KB3A 2EQDA 2J78A 2E77A 4QSHA 2O9PA 1DORA 1GEQA 2PRMA 2HEJA 1UROA 3FA5A 3M7SA 1UWAA 2V38A 4ZO6A 4DZ5A 4H2HA 1EJVC 2PEVA 1W9BM 5CCZA 5CSSA 4AZBA 3CT2A 2GSHA 2Y62A 5J5RA 3WF4A 2D2HA 3EXSA 5F2MA 4AY1A 1BG9A 3XISA 3ARYA 2OLSA 1YIXA 2UZ9A 3GX9A 3ITXA 2VZVA 4FLRA 2GSJA 2BOGX 4UTWA 4KCWA 1QASA 3DG6A 4LS1A 4QJ4B 4LQ1A 3UWVA 4N6FA 3N4FA 4UNKA 3LTSA 4GI4A 1JUEA 2HSAA 2BY3A 3WLIA 4IP5A 5DCBA 4C6LA 4L6DA 4OGZA 1X39A 1UD8A 5I3GA 5I07A 3UNTA 2ALDA 4DNMA 1HJWA 5GJPA 1VFUA 3ONBA 4FP1A 1V08A 3VDGA 3UXKA 4G7FA 2FFIA 2HS8A 4JNMA 3WLLA 4H7ZA 2NUXA 1TV4A 1ZL1A 1BLIA 4NAEA 4XZNX 3SB0A 3I6RA 3PNZA 4ZO8A 1W9PA 4C1NA 1LCOA 5HQLA 2WKLA 1TIWA 5FF3A 1XYAA 4HA4A 4JTUA 1KO0A 1CXHA 5EY5A 5HUPA 2YL9A 3GDKA 4MADA 3WJXA 1JPDX 1E15A 4PMQA 4H6RA 3UCDA 3KBSA 5K9CA 3H4WA 1M68A 1S2UA 2DSWA 7ENLA 1EYEA 2OQHA 1NJJA 3C3NA 1C8YA 1XRSA 4F0RA 3HGRA 2VFDA 4LUTB 4LRTA 3HQ1A 4NILA 3LZ5A 1P1MA 4GUHA 4RZ6A 2E1DA 4MHBA 4B9YA 4E8CA 4LOCA 3UWQA 3NEVA 3CPGA 4A29A 1NDVA 1VYRA 1VYPX 1XC6A 3MKCA 1G4SA 3MU7A 2EG7A 1ADDA 1PWLA 3O3RA 4FIRA 4AW7A 1C8QA 4OQVA 3WQOA 3WQVA 1C9DA 1CGXA 2VRJA 1S2TA 1XP3A 1TV7A 2REQA 1KFKA 2DT0A 4D8ZA 1ITXA 1WAWA 3W1LA 4IIDA 5FAGA 2XG9A 4DUXA 4ILSA 2HBVA 4XKYB 3MMDA 5EPDA 3BG5A 2FHCA 2AOSA 5AHMA 5T9CE 1IZCA 1W9VA 1X98A 3NL2A 4ZFMA 1BSIA 3TVAA 3MWCA 3OVQA 2I57A 2RGLA 2TODA 4MMWA 2I14A 3E49A 2EKGA 2Z28A 3ABZA 3N4EA 1RA5A 1U83A 4D9PA 4OJYA 4HZ7A 5EMYA 4J27A 3ARTA 4BR1A 2YCLB 3AISA 2VOTA 1J5TA 1OIFA 1Q13A 3HB9A 3CHVA 4S3BA 1DJNA 1MDLA 1YNYA 3A23A 4LBRA 4I5UA 1DJYA 1EXPA 2NXIA 1XBXA 3LI1A 4LU0A 1VFHA 7REQB 1DIKA 3W29A 3ZO9A 4LAMA 4IX2A 4HZ8A 5REQA 1KTNA 3LMZA 3CXOA 5FD0A 3MO4A 1ADSA 4MYAA 3VIHA 5FF0A 3ZS4A 3BLOA 4QCFA 4NUWA 5AC5A 4LUSA 5AYYA 1H1YA 3TR2A 2CWXA 1OX5A 1QO2A 2PA6A 4AISA 3V5OA 3TYZA 1W3TA 2PDKA 4LBSA 5GPRA 1CGTA 1CBGA 5FCZA 1XYLA 1GVSA 1I2QA 2QULA 1TSIA 2B4GA 3M0XA 1CNVA 3ARXA 3NG3A 4BF7A 4JTGA 5AN7A 3WNLA 4MDOA 3T40A 2A21A 1UD2A 4H9MA 3TP4A 4KH2A 3CQIA 4KCVA 2CLIA 4K7VA 2F6KA 3BLIA 1W2VA 4ZODA 1JD7A 3B0XA 4JQ4A 1ICSA 3ERPA 3RPTA 3OBEA 3PZMA 4JFVA 3L23A 4PTVA 1KR0A 5B80A 5HQEA 1F3XA 1TMQA 2OT0A 3II1A 2PDUA 2WSRA 1Y0EA 1ZZMA 1KLYA 2D73A 5C71A 4F4RA 5C2XA 4L9ZA 2A3CA 1G01A 3T6CA 4H9ZA 1XFCA 4O1AA 4I90A 1UWQA 2WC3A 1X8CA 2C16A 3UEQA 2ZRVA 1MUWA 1HVQA 3CHDA 3KVLA 3RX4A 1OF6A 1TRDA 1UD4A 2W62A 1W5OA 4PUMA 2FHFA 4GYPA 1Z9AA 2DSUA 1ZHAA 1UWSA 3LPGA 1XH0A 2EPKX 4N9DA 3ZVIA 2C7FA 1F8MA 5LIWX 2TMDA 4EACA 2EHHA 1TWWA 5AYIA 3OGVA 1BGGA 4IQLA 1AH0A 1VBGA 2C15A 3B06A 4AD2A 3PZTA 3QFWA 3H26A 4WDUA 4YLWA 2DVUA 4DJDD 3AWNA 3MI3A 1UH4A 3GKAA 3CZJA 3DI1A 3E2SA 4MY9A 1GCYA 4PYSA 1LG2A 4ADTA 2EG8A 2Z2AA 1ZRQA 1Q7MA 4FNRA 1UR0A 1J11A 1F07A 1D3CA 1FTXA 1LBFA 3N17A 4QNWA 2HE5A 4JTTA 4FLOA 1ZBCA 2JGQA 4PC8A 4IUOA 2ZZ3A 2A3HA 3GK0A 3KW3A 2INEA 3SUTA 4PUEA 1XICA 2CLEA 2WC4A 4NNCA 4WEVX 3OHIA 3LCHA 1PZ3A 4JKLA 4EXQA 4ZQNA 2JF6A 2DT3A 1PS9A 5CLTA 3V3WA 3WH7A 2VD8A 3S0CA 4U2YA 3H6OA 1WKYA 2JGYA 1JCLA 4Z2LA 3PZIA 3FXGA 2BHZA 1E3ZA 3QJAA 2Y5JA 4I7UA 4GYJA 3HPAA 5CJ5A 1V7AA 5E1QA 1T8QA 4V2XA 3KVJA 3LK6A 3UNDA 2GZXA 3AXKA 5C8BB 1X97A 4J4KA 1MW1A 3VNZA 3KTCA 2OSWA 3W1QA 2E1WA 3WFLA 1CECA 2Y5SA 3TYUA 4GQGA 5DX7A 1LZOA 3MANA 1EC9A 1XIJA 3UGRA 4DBDA 5CGMA 4XZBA 5FJJA 4F0LA 2PRHA 3BANA 4KEUA 2QMKA 4MG4A 3ITCA 3OU8A 3PUOA 1Z41A 1EX5A 3MSDA 3DFSA 5A6AA 2WCGA 3CJPA 2NT0A 4O11A 3TTQA 3GVRA 1NSJA 4LXFA 3UXIA 1GORA 4US5A 1ITCA 3W1RA 3FLUA 2CBUA 1RXOB 3M64A 4REQA 1Q2SA 4H9TA 2HXTA 2DORA 3NVTA 3GC2A 3DX5A 3M47A 2WVSA 4F9JA 4HA1A 1Q7QA 1VJSA 2YGYA 4UMCA 3T9PA 1F5ZA 4IISA 1H50A 2NLIA 1S2WA 4GY7A 3MO7A 4ZO7A 3BXWA 3SUSA 3L7RA 2AAAA 4X60A 3POCA 4CNSA 3ZT6A 5A1AA 3QGAC 4GACA 3VE7A 3TSMA 2Z1SA 4Q4QA 5KZ6A 1SO6A 3PJWA 5HBFA 3B05A 1PYMA 2RHGA 4D6CA 3QGKC 3VC5A 1X6UA 3MBFA 4XISA 2ZQ0A 4PFMA 2WJFA 4M29A 3T4CA 3NL3A 3TK7A 4E5TA 4GGHA 3LGDA 2R8WA 5A95A 3UCCA 4HJWA 5DBUA 5XINA 2ZRZA 4V33A 2D3LA 3AHYA 1QNQA 1JCXA 3COTA 3S6OA 5BXSA 1JXKA 2QVNA 2PLCA 3AU2A 3ZZ1A 2FGBA 1A49A 1V3LA 2PDGA 3U5UA 3CUXA 5GJMA 4HGXA 4W9TA 2QMJA 3PF3A 4RV3A 3KZSA 4MJZA 1GVFA 1LOLA 4ZR8A 1ONRA 2EXOA 3WF3A 1YLVA 2DJLA 3JRKA 1KCKA 3VX0A 2YXXA 1TREA 1TB3A 1QUMA 4QS5A 1Q6GA 1YEYA 3RX2A 1TV2A 4CQCA 5DT5A 2OYKA 2JFEX 4QEHA 1GJPA 3A24A 1UWTA 3EB4A 4JTDA 1ZBVA 3WO8A 2YYUA 2GQ9A 4IHCA 1HKKA 2P50A 1BYDA 4L4PA 1POKA 3HMJG 2OSYA 3HGOA 2CBVA 4AVFA 2H9AA 1OINA 4HOWA 2Z1VA 3GY1A 3LM3A 1BXBA 3SRHA 4F3HA 4QG6A 2D1ZA 1YADA 1J0ZA 3GXNA 4LAUA 1DJHA 1N7KA 3EKLA 3LM7A 4QLLA 4OWGA 1U33A 1PZ1A 1DJGA 4DWDA 4O54A 3URBA 3CMGA 4JHMA 3B8SA 2F2HA 1W0MA 7ODCA 3LRMA 1I9CB 3SN4A 4N9CA 2IXUA 4YHGA 5LKYA 2QDDA 4LNCA 3FX4A 4C6EA 3M41A 1W9DM 3LS9A 3QMRA 1HKVA 3N34A 3WL0A 4XBJA 3TJIA 1VBRA 1IIHA 1E9LA 1ONXA 3WQCA 4DWSD 1TMLA 4WIWA 2PWGA 1SFSA 3APYA 3IIXA 3MCMA 2A6LA 1PTDA 1GZGA 1WBHA 1L9WA 2QCLA 3AIWA 2QR6A 1GK8A 1T6MA 1ZGDA 4DF1A 3I3EA 4JIEA 5U4NA 3AROA 3V1HA 3NL5A 2ODOA 1K8ZA 3W2KA 3AHVA 3GNOA 2CBJA 3H23A 2PTXA 3UG8A 1LQ2A 3OQEA 2DZWA 3AXIA 3F2DA 4W88A 3IGSA 4Q7NA 2J7DA 1VYSX 3VABA 1R3QA 3KRZA 4TVCA 4GH3A 3TN6A 3O05A 1W3IA 4H3DA 2CEQA 3UD6A 4O17A 3STCA 4IMAA 1WXJA 2ISWA 6A3HA 2G0WA 4UFIA 4EWND 4XK2A 4UIOA 2OODA 1JYXA 1JI2A 1W56A 2J9ZA 1KBKA 2OVLA 1B1YA 1BYAA 3DFYA 3AHTA 4H9UA 1LL6A 3ARSA 3WY1A 3ZT5A 4P7RA 3ZSSA 1IEWA 1J6OA 3IIOA 2QCCA 1E9ZB 2H6RA 1W6TA 5A6MA 3P6LA 2VO5A 1IV8A 4A35A 4EPBC 2OKOA 3CBWA 1YYAA 1NWSA 1R46A 1ALDA 2QUVA 1SR0A 4DPQA 5ABGA 1EP3A 1HJVA 3H12A 4O14A 4I5XA 2GVYA 1WDPA 1J18A 3KS5A 2QGHA 5H8MA 2G8ZA 3VGEA 2HDJA 2C13A 2JKEA 4MM1A 2QYGA 1JZ3A 3IJ9A 3IGXA 4ADUA 4ACZA 1GTHA 1E1CA 2BNJA 3TAKA 2Y8KA 2D23A 3BMXA 4IIGA 1WUFA 4ML4A 1MZRA 3UXLA 2ZUSA 3AWOA 1WPCA 3UWZA 1DV7A 2WMFA 1GOIA 1ISWA 4XZMX 4HPXA 1O7AA 1PO9A 1TX0A 3T2QA 3VIJA 2HQAA 4WDWA 4GKTA 4S3JA 3WMLA 1S46A 1PHQA 4ICCX 3LLXA 3GVWA 4C6OA 3BMVA 4JQ3A 5EFFA 5M1TA 3UR2A 1XC4A 3GUGA 1BF6A 5IDZA 1SO3A 4CU8A 1JYVA 4BQ3A 3TN3A 1V02E 4QISA 1EGMA 4R9XA 4JTAA 3HPFA 4FZIA 2D69A 4PUWA 4GYFA 4GA8A 1M53A 1BKHA 3VCRA 1RJRA 2DZSA 3DKLA 4XIMA 3VO0A 3GIQA 1JZ6A 1UPMB 4ERGA 5A8NA 1E6SM 2QS8A 4JFTA 1XGEA 1C7TA 3G1VA 5DANA 1QRQA 4C7DA 5JMUA 4MPKA 2EJAA 1OYCA 4J3VA 3OEXA 1SGJA 2OU4A 2YB4A 3C2FA 3SI9A 4UTKA 5HK4A 2QCFA 4DO7A 1J4EA 1M7XA 1Y5XA 3WDRA 4Q33A 3C4UA 3W7EA 3CC1A 3VDBA 3P80A 3ZWSA 1H7OA 4M7SA 1R3YA 2QJHA 3DYOA 4POCA 5E0CA 2OOGA 4BWLA 2Y61A 4L6OA 1E4MM 1FKXA 3GVQA 3BG3A 2NVAA 4XIAA 3BLDA 4UZUA 4CNNA 1JRBA 1PZ2A 1TKKA 3FHAA 1RK5A 1FWFC 4Z2IA 5I23A 4IGHA 1O12A 3T4WA 1GT8A 3TJ4A 4GVFA 4LF1A 3AFBA 4UFHA 2ANUA 3M7WA 1JPKA 5T91A 4Y8EA 1MYRA 3OYXA 4MB5A 1B0IA 1ME8A 4UB9A 2OZ8A 3JZUA 2HVNA 2ZA3A 4GGBA 3W76A 2PD9A 3M46A 1E40A 4BHYA 3W4RA 3FSTA 4ZB0A 1TWZA 3E9AA 4M5PA 8TIMA 1VB9A 3TKFA 1QNVA 2R94A 1Q4WA 3T81A 1WDQA 1VD6A 4L9YA 3SIZA 4ROQA 3TC3A 3RIKA 4BY3A 3NR0A 3W75A 3MZ2A 2VFHA 3RM9A 4QQUA 4B5WA 4BF5A 4DAFA 2XN1A 3ORWA 1E6PA 2FMNA 3N6QA 4CNUA 4AY7A 2PF0A 2CHRA 3NDOA 4NRSA 4J35A 3L4VA 1KCLA 2NVCA 1UPPA 1GOXA 3L0KA 3VD4A 4J9JA 1JCTA 3WD0A 4DIAA 3WENA 3C6CA 1ZENA 4O1CA 1Q65A 4Q22A 3FJ4A 2QDEA 1LG1A 4HK5A 4NZ1A 4AXKA 3GS6A 3WEOA 1RJQA 1JPMA 1YQ2A 5D2TA 2PDCA 2TAAA 1JZ4A 1V4YA 4AVOA 2ZVIA 3MMWA 1TR1A 3V5CA 3S8HA 3S5NA 3W84A 3CT7A 3SRDA 3IRSA 3EMCA 2JEQA 4NG3A 1UP2A 4AIBA 3H2NA 5HR7A 1GZJA 5AFDA 5BXRA 3RGTA 4GNVA 3E12A 1TE6A 4MJ4A 5KINA 4E2DA 2XVKA 1W5QA 4QBXA 4L80A 1OGSA 3EPNA 2E5DA 1ZU8A 1NWRA 1CIUA 3ZMRA 3HQOA 1ICQA 5HQMA 2OX1A 4W89A 5EL1A 3AC0A 5GQBA 4Y2WA 1W32A 5AC6A 4Q4PA 1S3TC 1X6LA 2HISA 2VDGA 2G97A 3WH5A 2I56A 3ANVA 3LBOA 3EX2A 1FWGC 2QCMA 3EOOA 3KTSA 1K7EA 1H5VA 3MC5A 4DX3A 4EXAA 2HCVA 5HAOA 4WUIA 3R8RA 3AJXA 4D6FA 4JN8A 1CB2A 4Y9MA 3NQAA 3NZRA 3TCSA 2IKHA 5CPSA 5FSEC 3RU8X 4XZ9A 4FA3A 1C8VA 4XSMA 5TIMA 1ZTVA 4NYUA 4DZHA 1G7UA 5CZTA 3THAA 1TJ0A 3I7RA 5FA5A 5HDRA 3NZPA 2FZMA 1JGIA 3B0UX 3KP1A 4HOXA 2EF9A 1KFWA 4HKPA 1ML1A 2GUUA 3GDBA 3U7VA 2IW0A 4RNHA 3VD9A 1OHLA 3PTMA 4W7WA 4FX7A 4DELA 4UTHA 4KESA 4C6JA 5CGTA 3HG4A 3TTYA 3T7VA 3RLUA 4BS0A 1TJRA 1TPC1 2V5BA 3A6OA 1E5NA 2ESCA 1CDGA 2HRWA 4LSBA 4JD4A 4RDWA 1FUYA 5LZLA 1P5BA 3WDJA 3QZAA 4WSJA 1FHUA 1EUNA 3A12A 4TR9A 1OFDA 4W7UA 1R3RA 2QCGA 3LPFA 1Q6EA 3C52A 3SRFA 1BGAA 4PRRA 1K6AA 3LG3A 3GZ3A 3UZ5A 5LIYX 3UZZA 4ATWA 3LPOA 1T96A 2IKJA 1KGXA 4CNOA 4I3GA 4Q4SA 2BWGA 1PPIA 2ZX7A 3LEPA 4FPSA 4PTXA 4WXZA 2FFCA 4BA0A 5CJMA 2IKIA 3GUWA 3P2VA 4U3AA 3HTWA 5H91A 3GTHA 1IR2A 3PTKA 2PC4A 4NY2A 2I5GA 4NI8A 3N2BA 1FCBA 1IYXA 2PZNA 4YJ5A 1THFD 3HGSA 1ZJHA 4MY8A 5CPLA 3LLDA 3IV3A 4MTVA 4W5ZA 3G0XA 1ZCOA 3SQSA 1VEPA 4AZIA 3F4VA 3F1QA 4NL1A 2D0FA 3AI0A 3GNRA 5LIXX 1YTEA 4NAFB 3SCQA 1R85A 3G8RA 1UCWA 1A4MA 2C6QA 4ZCWA 4GABA 3K4DA 2B7QA 2VRQA 1CW2A 4AEEA 1AW5A 4AC7C 1OX6A 3VE9A 3CL6A 3WLSA 1WYIA 3DFTA 1M01A 4CD8A 1Q8AA 4EF9A 1V6YA 1CXKA 1RAKA 3UR7A 2WWCA 4HA3A 4PMOA 2Z1KA 3TW9A 3M5XA 4NHVA 4NJKA 4H01A 3UXAA 3WBEA 3NPUA 5CG0A 2QUNA 5C9RA 2WJEA 4HHMA 2WV8A 4HYWA 1GQKA 3CB8A 2Z7GA 1R3WA 4KWSA 3KVMA 1JVNA 3SEPA 3U6WA 4JBRA 1JD9A 3G1YA 4B5SA 3KBJA 5AHLA 1VFFA 5CZJA 2QUTA 5DY3A 3FFSA 4IGNA 3GDLA 5AKQA 1UIPA 3EXTA 4QR6A 3QQ0A 1YE6A 2DH2A 2WZIA 4GC3A 1I2NA 3BW4A 3AYVA 2NZLA 1EFZA 3EB2A 2WHJA 1S5VA 1TZ7A 4GE8A 3ABOA 1H60A 4PUNA 2DP3A 2VFEA 3CUIA 1ICPA 1P6WA 1HFBA 2X7VA 5GNYA 5BRPA 1S3HA 2XVPA 3W7CA 4Z1CA 5I09A 1S2VA 3BK0A 3MP3A 3H55A 4QDPA 1QK2A 5HMFA 4FOJA 3GH5A 2BDQA 3TUUA 1MO0A 3TCEA 3W22A 3PZ9A 2QV5A 2FH6A 4ROPA 1B5TA 3G1AA 4QQ3A 1PKYA 1S39A 2BB0A 4NASA 1KC7A 1F3EA 4H6EA 3RDKA 4QX4A 4W87A 1QPKA 5I2UA 1EJSC 1JL8A 4IQDA 4AQLA 4UBPC 1ZBKA 3WMSA 2C1HA 3RG6A 5A8OA 3WLHA 3TLLA 5CC3A 3UJSA 4M81A 1SVDA 4MNMA 3GSMA 1Q4NX 3E0FA 1NWTA 5AC8A 3PJXA 3JVAA 1K9TA 2VEMA 4IF2A 4MLRA 4NZJA 1V0MA 4ZVJA 3K8MA 2A7PA 3VNLA 3B97A 2O9RA 1D7KA 3CQKA 3N13A 5E0KA 2H8ZA 2J24A 3N6JA 2WWDA 2CIPA 4PFHA 3VD3A 4DWSB 1XSJA 1LQ0A 3ZVHA 2GLKA 2BASA 5HWNA 1V3MA 1CGUA 2WK2A 2W4XA 3SECA 4KFPA 3WLOA 4OZOA 1NU5A 1X7IA 3GKFA 4E3TA 3QPZA 1F05A 1F4AA 4S3AA 2OEKA 2XIMA 2WB5A 3O16A 1OD0A 3QPEA 4RE3A 1P6CA 3F4CA 1K8YA 1V3KA 5E9AA 3TONA 2GYIA 1KR1A 2OQLA 3QC0A 3RLGA 1AW2A 2V69A 4UTFA 2PTYA 3CH0A 3NQGA 4Y9OA 1TTJA 4QAWA 2X1TA 4V15A 1FHDA 6XIMA 2WYSA 4N9BA 4UC5A 4GO8A 3Q4DA 1NQKA 1SUXA 3HFTA 2POTA 1CB7B 2Y70A 1OSEA 3CZLA 2QIIA 2VJXA 3E2RA 4G1KA 1B31A 2CESA 3GQYA 5LNRA 4AZ7A 4WK9A 5I3KA 2WNNA 2KZHA 1XYZA 3MKVA 5EMLA 3W73A 2BFGA 3RMEA 1JPIA 4FXFA 1A3WA 1CX9A 1J0HA 2VHLA 3GXFA 5AHNA 1YPFA 3NDYA 1KXTA 2RKXA 3OZPA 2PP0A 3TZNA 1G4EA 2PDPA 4MOZA 3R7MA 3OO2A 3QFEA 5BYWA 5HATA 4WY0A 4M1RA 3SFKA 2MANA 1W3NA 3T2PA 3P61A 2VC7A 4LWWA 5DF0A 3DYMA 4DJEC 3KCJA 3B9AA 5CBIA 4PB5A 1EGVA 4WHBA 3CO4A 5HULA 1RVGA 1XV8A 2NLYA 1NF7A 1M65A 4LT9A 2GJXB 1XD0A 5A69A 1DKWA 4OFCA 5C70A 3HU7A 4HU0A 1EIBA 4MY1A 2X0SA 3CL8A 1TPWA 1VBJA 3E1F1 4Q3MA 5D9MA 4FF5A 3PM6A 2WHKA 3UA4A 1KM4A 3MUZ1 3NO5A 2XGBA 2P10A 4AG0A 4MUZA 3OA5A 1EC7A 1Z42A 3VGDA 1KQYA 1KRAC 5F1VA 4PTMA 1KD0A 2E5BA 3MHGA 2ABAA 1EP1A 1HJUA 4WX2A 3UWEA 4KEVA 3I6TA 4IL0A 1IWBA 3DAQA 2JF7A 3BLFA 2PLKA 4X3ZA 3TYEA 1XM3A 4PMJA 2BXZA 4D72A 4H9VA 3W7IA 4J2MA 1GKRA 3A4AA 4DAIA 1C7SA 4YS1A 4TV5A 1VJIA 4UFLA 3WBYA 3LB0A 3CU2A 3W53A 4PZVA 3KAOA 3WQFA 3NWRA 3TOYA 1GQIA 2YA1A 5D32A 1UD3A 1W1B1 1FWDC 1PWMA 4JNZA 4NZCA 4ZQCA 2CLKA 4GZIA 1U1JA 2NX1A 3WX7A 2EAWA 3UJRA 3AXHA 1E72M 4OUEA 3AXXA 1Y7VA 3QMSA 3VINA 1ZQ5A 1E4IA 3ECQA 3AS0A 3L5LA 3CZGA 1RLCL 1J0JA 3INPA 1A0EA 1R3VA 5CXPA 1AQFA 1CLXA 4XZIA 1JFHA 1EDGA 4Y9AA 2QLYA 4G7EA 5E0FA 1PB0A 4HSNA 4GJJA 2B31A 2WXDM 4V27A 4F2TA 1UR1A 2OGJA 1QOPA 2A0NA 2XVLA 5HJLA 5TNVA 4R7JA 2C71A 3PC0A 1EO5A 3OLGA 4US5D 3GXIA 1F6KA 5CC6A 1EPVA 1JXJA 5L9FA 4G8TA 4F48A 3C2EA 4DBWA 1W9UA 2C1GA 2OZ3A 1OK4A 3SO7A 4KEMA 4PR4A 3VCCA 3C0SA 3FHQA 4MWAA 1BPLB 5LNSA 1AODA 1LDCA 3K8LA 2DH3A 4KIRA 2BV9A 2F6UA 1UZDA 2GGGA 1S38A 5DRCA 3SCNA 4XAFA 1DBTA 3LZ3A 4LAZA 3KM8A 3PWGA 3BGGA 1FXQA 2ALRA 3WLRA 3V0UA 7TIMA 3OIXA 1OX4B 1YBQB 3S2LA 5CAHA 1OFRA 5I02A 5FEWA 4FK9A 3P93A 3VAVA 8RUCA 3PZQA 2J88A 2V6AA 3OODA 3W83A 2VEGA 1PV8A 3NCOA 3OZOA 4KT2A 1UKSA 1WV2A 3WH8A 4DYKA 3W2NA 2FVKA 3ZOAA 4ZA0A 4JEQA 2I9UA 1V3JA 1ME7A 3HOJA 3B8UA 3IWPA 1AW1A 1HIZA 3KVKA 2OO0A 2CFFA 2QCNA 1ZSXA 2IQ0A 5H1WA 3DDMA 1GJWA 1FWAC 3TWBA 2CXGA 4NZ4A 1K8CA 2NWRA 3GH7A 3NQ8A 5CC7A 1P43A 4KGLA 2QHAA 8XIMA 5FJRA 1JZ7A 2Q01A 3N2XA 5AHIA 1FWSA 1US3A 3ES8A 4PH6A 1VCVA 4RPPA 1HKWA 1XLBA 1Y8BA 3WNKA 1BVWA 3SSJA 7A3HA 5JUVA 2OYMA 2P8CA 1EIXA 4L64A 1LLZA 2V0TA 4HPJA 4AX7A 1AK5A 3HGJA 3GG7A 1LF1A 5FJIA 3ZR4A 3VIKA 1DOSA 3DERA 3SY8A 3P0XA 4GX8A 2ONEA 5HPCA 2E25A 4ZOEA 3WJYA 5DY2A 4AD0A 4DF2A 3W7PA 2D2GA 3MVIA 2A1YA 5LHEA 3N4AA 1UJPA 2Y7DA 4QHRA 1QWKA 1TTIA 3HJEA 5K4ZA 5HPOA 5T26A 2Y0FA 3CUGA 5DMLA 4H9XA 2UBPC 2VUNA 1TZZA 4HPNA 4IZGA 4NZ3A 1WDSA 4C1KA 3O6YX 3PY2A 2NQ5A 4QROA 2DPEA 1JQXA 4MKVA 2C14A 1P7TB 2VGFA 3NFUA 2WQPA 1A80A 4TO8A 3TFCA 3NZGA 2A3EA 2FTWA 2DIKA 1S1PA 1W3LA 1DE5A 4EANA 1XINA 4B3KA 3KRSA 4UUIA 5A8GA 3N2OA 1J12A 3R8HA 3GFXA 1H4PA 3QF0A 5CBBA 4NYYA 1H1NA 3WF0A 5SWUA 2WNWA 2PS2A 3BQ5A 1EA0A 4HCLA 1J96A 1E51A 2WMKA 5LSMA 4BI7A 4O4WA 2GJNA 4GRSA 1T8XA 1Q5MA 2G3IA 4MB3A 1OABA 1MFUA 3TNBA 4GBUA 3U4AA 3MKKA 1F74A 1RD5A 3FVMA 5GVJA 4UTTC 1R9ZA 1OT2A 1DXEA 3A22A 1MNZA 5A8PA 4KIEA 2QDHA 4OE7A 2FHBA 1FKWA 3D6NA 3LERA 4A6GA 1LWHA 1O4UA 2PTDA 4JZ5A 1R30A 3F03K 3TIMA 1UUOA 3LGEA 2PTWA 1NP0A 2XDFA 1NF0A 3PBGA 5I3DA 1X8FA 2VL4A 2FTPA 5AECA 3CUHA 2V81A 4JFSA 1W3JA 4YTRA 4PSRA 3IEBA 4UTIA 3T05A 4LPCA 1ELSA 3V1PA 1AZ1A 2VVNA 3HQPA 3KX6A 3FK4A 1NAL1 4OHQA 1S2AA 3ZT7A 2P76A 3BMWA 3IJIA 3CEUA 4G56A 1JGMA 1PBGA 5I6SA 5I3FA 3WMCA 4A05A 4B9ZA 1Q2RA 1O6IA 4YCOA 4S3FA 2UY3A 1R7AA 3F5JA 3VX1A 1X6NA 3E3HA 3KRBA 2RGMA 4GFIA 3WQWA 2PF8A 3GD6A 3REQA 4LYRA 3L5AA 4C1NB 1VPXA 3VDHA 3NYZA 4LCQA 3KCLA 5IBXA 3N04A 4YL2A 1EWEA 1AMKA 4GLEA 4WOZA 2YW4A 1E0XA 1HTIA 4DNHA 1J6PA 4NVTA 3THCA 3ZSTA 1H11A 2R1KA 4LC6A 4QS6A 1OFEA 4JL2A 5IDIA 4GUIA 2YXGA 3LRKA 4B16A 3VZZA 2ZBTA 3VIPA 3ZLGA 3NSXA 3WLMA 1V79A 3I3DA 3FNDA 1B3OA 1BD0A 2BG5A 3E0LA 2GGIA 4ECLA 3CB3A 1OIMA 4UCFA 2HK1A 1V03A 3BPWA 2OG9A 2P88A 4L6HA 4INFA 4O0ZA 1JF5A 2Z27A 4KRUA 3TDFA 4MUPA 2DSVA 2REQB 3AYSA 3GE7A 4R34A 1BKSA 2A2IA 3TN5A 4K2SA 2NV9A 3TX9A 1VEOA 4Q8PA 1RCOB 4AB4A 3W7OA 3DHDA 1AQHA 2ZX9A 3DFOA 2UY4A 4PMRA 1A5LC 1QHOA 1U5VA 3B8TA 2HZGA 4O1BA 5XIAA 1FFQA 4NP7A 2IPFA 4YTTA 3FKRA 4G1NA 1W3HA 4XD4A 1UR3M 2GDVA 5AC7A 3T8QA 3DC0A 2ZE0A 2YZ5A 1LWIA 5LA0A 4PCPA 1QNPA 3LGGA 1XBZA 1JUKA 2Z24A 4CQBA 4YTUA 4IL2A 4IGMA 3G6MA 4K68A 2X8RA 4HZ6A 2ZUUA 4CKQA 2PGEA 5BOFA 4FX6M 1VCFA 2PGWA 2GQ8A 3P82A 3MBDA 3M07A 2JKPA 3UZWA 2CLPA 5REQB 3QW4B 3UYCA 3ANYA 4YVXA 3Q37A 3BJTA 2J66A 4DBSA 2X2GA 4LUSB 2BXYA 3UG4A 2ADAA 3O0FA 3PPFA 5G1TA 3R8GA 4I9MA 4X22A 3UP8A 1ZCCA 2J7BA 2V63A 1S5TA 2YDAA 5LYRA 2Q8ZA 1QPQA 1FWHC 3Q2DA 3QV9A 4RE2A 1B9BA 3KBVA 3N15A 4D6GA 2ZXAA 1RZMA 3WG6A 1M6JA 3FYPA 3MI2A 3WLPA 4IQEA 1IXNA 2A7RA 4JTKA 3PUGA 2PLMA 4D1IA 2VZOA 3W88A 5JH1A 2FGLA 3B8WA 3T07A 2Y8UA 3SADA 2OLAA 1T40A 3OLEA 3RLVA 1NP2A 2QXWA 1K77A 3CAVA 4KPLA 1JJKA 5IM51 3NJ3A 2R82A 3O2LA 4HSHA 5KTLA 4JICA 4PODA 4JAWA 4ORMA 1FHVA 1OM0A 1JUBA 2J7HA 3LRLA 4M1BA 1W1A1 2Y89A 4Z2KA 2YDSA 2VX5A 4Z0JA 3W25A 4ZSTA 3DG3A 4F0SA 3AALA 3PG9A 2R1MA 4LYQA 1B57A 2YCKX 4PB4A 5BOOA 1JDFA 3AIBA 4XD5A 1SM9A 1KFLA 3N3MA 4FEZA 2O92A 4JFWA 1ME9A 1J2BA 3KL0A 2G41A 1A5MC 1K9EA 2G3FA 3RHGA 4CCCA 2TYSA 5LIUX 3V4BA 3MSGA 2JE8A 1ITUA 2NUYA 2XWEA 2XUCA 3DU0A 3TSDA 2ISFA 3VNYA 4AZ6A 2EPNA 4UQBA 5E93A 1UZHA 1P0NA 2OB3A 3SCUA 4TXEA 3U57A 5JXQA 4B5VA 3MT1A 1HP4A 4Z1BA 4MDPA 2GVEA 4IXHA 4DI8A 5C5YA 4CGTA 3RO6A 1X1NA 1J01A 4PSPA 5E6ZA 4BJHA 3KOXA 2O9TA 4IQJA 1PL9A 5D33A 5G2WA 2NQHA 3T8LA 5CLWA 1W1TA 2PU1A 2Y24A 4D6HA 3IK4A 3S5SA 1HL9A 3QHNA 2PDQA 2AQWA 1H7NA 1M5WA 4IX0A 3VOJA 3QH2A 1A5KC 2HNEA 3QV8A 1XLFA 2XINA 4W8LA 1OCNA 1L6SA 2WSPA 3UPBA 2ZZ6A 2CZ5A 1ZLPA 2ZZ1A 2VENA 4R7WA 4DVOA 3IANA 3PK7A 4P7OA 2XHYA 3R13A 9XIAA 3EWYA 1XLDA 3CLWA 2VC6A 1KBJA 3RX3A 3RAOA 4Z2GA 2ZKMX 3KP0A 4B91A 1EZ2A 3CZ8A 4D8LA 3AYTA 1NQ6A 1L6WA 5CBJA 1QI4A 1F3TA 3WLTA 3O6DA 2YIHA 4TTUA 1VEMA 4UQDA 3RUBL 4Q8WA 3G2GA 3V36A 4N7QA 4UTJA 2DZBA 5LGZA 4MF4A 4FS9A 1GVEA 2IPGA 3H4XA 5DFAA 4LS2A 6REQA 3WUBA 1FDYA 4JN6A 3G8EA 3GAKA 3W07A 4P5UA 1W5NA 3A9IA 3PUEA 3H2OA 3PZVA 2NQJA 4RCXA 3UXDA 3A5VA 5DMYA 5ENLA 1TPDA 1ZAHA 5G4EA 5D05A 4RX0A 2IMRA 1JEZA 2Z25A 4E2BA 4TOQA 1EYWA 2VEPA 2W0UA 3CPRA 3G3MA 1N8FA 2WVUA 1GGOA 3URQA 4REQB 1AJZA 3ARPA 3AS2A 4AHPA 4AX6A 3VKCA 2DUZA 2V3DA 4WF7A 2ZUTA 4WKFA 4IM4A 3R25A 5I3HA 2DY3A 1A5CA 3PSWA 3DGBA 3GXDA 3GNXA 3CGTA 4KKXA 1VFOA 4TX6A 2GWNA 1HKJA 3NZ1A 3WQGA 5CG7A 2W27A 2VVSA 1XF0A 2X0YA 2XZ9A 3VKAA 1R38A 2C0HA 3IJLA 2J79A 4H8UA 4Y8FA 3VNDA 2OFJA 4TMCA 1PE1A 2HK0A 2XTKA 1OZQA 1XH1A 1A50A 3FN9A 1XLJA 2GJPA 3I7QA 5I78A 4RNJA 4JTFA 2W3ZA 4WCJA 2EPMX 3TSBA 3LYEA 4GOAA 4OTKA 1ZUAX 3R79A 1WE5A 4Y7EA 3WQEA 1DWAM 3FSUA 3QR0A 3UWUA 1DP0A 3EOEA 4FXJA 2H3BA 1Q6DA 3BL3A 3P60A 4UMBA 3UZJA 2O7SA 1ZFJA 1AA1B 1QNOA 5TBOA 1SZRA 3NQBA 3OP2A 1C29A 3C2OA 2X05A 3BQ6A 3DYPA 2W9MA 2DZTA 3U3HA 4O18A 1XYCA 5I7GA 3VM7A 1IXQA 1OJXA 3SJ3A 3B8IA 1H1ZA 3MUAA 4FLQA 3WK0A 3VUPA 4IGSA 1OFQA 2OTDA 5CSYA 2J8FA 2X7WA 1MW2A 3NPVA 1XW8A 1LJYA 3S2CA 1J5SA 3LSBA 3QMTA 2ZRYA 3U7BA 2H9AB 4F79A 1ODUA 4IMCA 1G9HA 4RLIA 4YIWA 5D9PA 4UR7A 5FF7A 1UKQA 1XRTA 2F61A 3B0PA 1Q3NA 3DKJA 3W7DA 4TQTA 3VIFA 2W67A 3G0SA 1MW0A 1QO5A 4LV9A 4I5RA 3CUFA 3GIYA 3MY9A 4U5KA 3EKGA 4N42A 4H6QA 2VMFA 4UQAA 3P8JA 3A64A 4AF0A 1UR2A 4J40A 4GZEA 3JUGA 2ZZ4A 1HXJA 3VOGA 3M0VA 4CD6A 1R47A 1Z7AA 1FWEC 4K8HA 2QF8A 3SSZA 3M6DA 1HL2A 2FMOA 4IICA 3B0VC 2G50A 2YBUA 5DN1A 3BURA 2VXNA 1VLWA 2ZTKA 3I7SA 1LUCA 3NO3A 2XH7A 4HP5A 2CXEA 3CUJA 3LU2A 3OBAA 3V7PA 1ZJIA 4WY0F 2PDWA 1DE6A 4M6PA 5J5DA 4ATDA 1CEOA 2Y4SA 1CTNA 1GKQA 3W7JA 4Q8MA 4XBSA 2XH4A 1VRXA 1KM5A 5IOBA 1UZ1A 4X9SA 3N29A 4MAVA 5D09A 2Y6ZA 1NDYA 4S3CA 3R11A 3M0LA 3V35A 4BEQA 1FWWA 4LUJA 1ZJBA 2PZ0A 3BG9A 3SUVA 3KL5A 5KEZA 2JKAA 3EBVA 2E6FA 3EWDA 3SN1A 3E0VA 5IFPA 4MFDA 2F9RA 4N4PA 4QG8A 5EMJA 1U2YA 4MNJA 3W2MA 1KQZA 2DSKA 1QT1A 4Y96A 3B03A 2E68A 2WSKA 2X0HA 3H8AA 4R3UA 3N19B 1BYCA 4LS0A 4OV9A 1WP6A 1W31A 3BSMA 4UOJA 1M9HA 1NEYA 5CZ0A 2VFFA 1Q7ZA 2PP1A 2VC5A 3IUHA 1K02A 3UFYA 2V3EA 5KZEA 3UU0A 1GPFA 1W1VA 2PU0A 4QRNA 1FVPA 3XIMA 2G4FA 1DIOA 3RXZA 1SFJA 2P0OA 4A3HA 1XG4A 4W86A 4RV8A 2WHLA 3BE7A 5IRPA 1Q6CA 2PDFA 3MCOA 4ACZB 3N9RA 1FWTA 4IPNB 1E1CB 1K3UA 1WZKA 3ARUA 4I7VA 5M2FX 1XPYA 2XN2A 3G1XA 2WM1A 4D6DA 3O6AA 4UTUA 1TJ2A 3G5EA 3W0KA 3GM8A 4K6AA 1ZPTA 1DIDA 1MWOA 1UOZA 3JU2A 3VD7A 2PDLA 1DVJA 3C61A 2E8ZA 2PP3A 4U2ZA 3W81A 3WQPA 1GW1A 4KFOA 1DWHM 4NZ5A 5BZAA 3G1HA 3QRHA 2RH9A 3GTIA 3ATZA 4Z0SA 3W23A 2V2CA 3UR5A 2KAUC 3WBWA 4PB3A 1O1HA 2R1LA 4HU3A 2PBOA 4O53A 3MZNA 1E0VA 1E6QM 1EOMA 3NQCA 5D04C 4GI6A 3W6MA 3TW6A 1D2KA 1JQVA 5CAKA 2CHOA 2GVJA 4FXSA 3E2QA 3S5OA 5ABTA 5J8LA 1WDDA 3EEGA 3KHJA 5CZKA 5D2XA 1KWKA 3TH6A 2CPUA 5AOUA 1WOAA 9CGTA 1DWIM 3BZGA 4P8WA 3S9YA 2WMHA 4JYFA 3WD3A 4W8AA 1XCWA 1TR9A 2VQTA 3NVDA 1K03A 3IS4A 3LUTA 2CNCA 4PE8A 4QP0A 4E4UA 1LL7A 1SFTA 1W8GA 4MWAD 4GIRA 2INFA 4WGHA 2G3NA 3L4ZA 2J6XA 1EO7A 1K6WA 4NF7A 4J28A 3HPXA 3HURA 2D3NA 1B3VA 4S2CA 4B5XA 5I79A 3RR1A 1GYLA 5HJXA 1XX1A 4PCTA 1J0IA 2FVMA 4O0KA 3O7UA 1QW7A 4WGXA 1M03A 2PC8A 3OQ8A 7CGTA 2I9EA 1O95A 1YDNA 2G37A 3TYDA 4TMBA 3S1GA 4LVDA 4O12A 5MKGA 2VDHA 3CQ0A 1DJQA 4K7YA 3EGJA 1UQYA 1PCKA 1N8WA 1GOQA 1R9YA 3IVTA 4O19A 4AAJA 1P6BA 1OC6A 1VLIA 3PSVA 1RLDA 3GDTA 1YXCA 5C2GA 3PBYA 4WVXA 2E9MA 1A4LA 1KBBA 3RRXA 2OWWA 3KBMA 4EK7A 4JTHA 3LV6A 4JFUA 4HMEA 4PRTA 1XQKA 3N9KA 2PSNA 2J13A 3TFXA 4LVGA 1K7XA 3BTNA 4C6DA 4IPJA 3MV11 3PPHA 1YNPA 1K4HA 1FWBC 4HA0A 1A0CA 4EPKA 2E5CA 1NFGA 1Z3NA 5BU6A 1N8IA 4JTSA 4Z1YA 4AYSA 2PODA 3MYPA 1R3SA 4CQ8A 2PD5A 5D4YA 1Q6QA 2DW6A 1H3GA 3WN6A 2D22A 3AS3A 2F6XA 2GJLA 1MFVA 4WQ6A 5BCAA 5ABHA 1OEPA 3S6TA 3KEHA 1EB3A 1X7FA 3W7QA 4UQCA 4O50A 1LRNA 2ZUWA 2ATMA 5FEZA 4HNTA 2CLMA 4AVNA 5JH2A 1OF8A 3SZ8A 3JR2A 4GG9A 3WH9A 6PTDA 3HPSA 1A5UA 4AZ5A 2VR2A 3BOLA 4NI3A 3I68A 4CLMA 3ISIX 3QZEA 1MNSA 4J7RA 4RXFA 3QYQA 1UBPC 4EKJA 1NARA 2B7PA 1FQ0A 4GISA 4DB7A 2BVTA 4ZOAA 2VFIA 3HQNA 3AIRA 3RU6A 3NOEA 3W02A 3G1FA 3GNNA 2I16A 1GQJA 2E8YA 1R7OA 2WLZA 4KCTA 4NXKA 2NX9A 4PBGA 4RKAA 5BU9A 3OB8A 4H7CA 1ZAIA 2QNEA 4S23A 1K9DA 2ZUNA 1W3KA 3P62A 2V5JA 4OV4A 3KRUA 4PRWA 4K8GA 1BG4A 1FDJA 2BVYA 3W7KA 3BW2A 3EB3A 4NAFA 4RNFA 2HTMA 1GHSA 1OYBA 3ITGA 3NA8A 2VZTA 3UGVA 4JIRA 4JQAA 1VS1A 4OIFA 1QK0A 3MMTA 3CM4A 4L7ZA 1UD6A 4U33A 3O15A 3N3TA 5KZMA 4U10A 2P53A 1BXCA 1GVQA 4ICMA 1KNWA 3S9ZA 2DJXA 4B5NA 3W3OA 3CIVA 4AZCA 1OB0A 1P4CA 3TWAA 1Q8JA 1DWFM 3KOFA 2BMBA 1MXSA 1G6CA 5JU6A 1TVPA 4M24A 5GNZA 1OCJA 4TU1A 1GYNA 3GG0A 4GH1A 1LBMA 1JYNA 5A8MA 3A3WA 4IIFA 3SCVA 1UJQA 5D2VA 2DVTA 2GJRA 4ORIA 1PAMA 2IQTA 1BWKA 1EOKA 2TSYA 2CBIA 3FA3A 4DJDC 4YXGA 3P8IA 3S42A 3GDRA 3N25A 1IHIA 3RCMA 3G3DA 1CPUA 1WZAA 2LLEA 1QNRA 1BYBA 2GQ3A 5CJNA 1VFMA 1IT0A 2WZTA 3L4TA 3WNNA 3DHFA 4PGLA 4RW3A 2ZC1A 3JS3A 2EPHA 1BEUA 4Q6XA 3KLKA 5H2ZA 1KKRA 4FSAA 3TYCA 5G1MA 3WQ5A 1GZ1A 3SGZA 2DV0A 3AYRA 3O06A 1BSLA 3BJFA 2ABBA 4M7TA 1TYGA 4XAZA 2NVDA 4GQQA 3BV7A 4LB3A 3F2BA 3T0TA 3UZXA 3G0UA 1XUZA 3DC8A 4L5ZA 3VK5A 3L4WA 2CZDA 3R0KA 3M6YA 1TQXA 2WVTA 1GG1A 4M80A 3D3AA 1EJ7L 3ARZA 3PBMA 2X1SA 4RZ4A 2ZX8A 1QDSA 3FDKA 1DIEA 3GR7A 3R94A 4PUDA 1C91A 5DLCA 7PTDA 3RMJA 3QM3A 5KMYA 3B04A 3HG2A 1XUUA 1SMDA 3C0QA 2YXOA 1UYQA 3MV01 1C93A 5ABFA 4HYVA 2CWNA 4QLJA 3MDWA 1BVNP 3USZA 4HMDA 3RF9A 1XLEA 3NDZA 3Q67A 1E6RA 3D5HA 4JIHA 1U5JA 2WVVA 2ZFAA 3EMQA 3PULA 5FJUA 2WOQA 2Y7EA 2E6DA 1VFLA 2AGTA 2CITA 2F84A 4L1XA 3MPGA 3UW6A 3SJNA 4UQEA 3EX1A 3AMLA 1QHZA 1SR9A 3HJZA 3FAWA 1UD5A 5A2AA 3PPGA 4ZMGA 4Q8OA 2E6AA 4AZHA 2VZSA 4WOQA 1UW9A 3FW6A 3E2VA 2BZNA 2NV1A 2G96A 2QEZA 5E09A 3IUIA 4CD4A 3A21A 1OG0A 1XIGA 1E9YB 2CLLA 3GBDA 3NQ6A 3RJXA 1B4EA 3H2MA 2P8BA 4I9AA 2GDQA 4YMZA 3CQJA 4DUWA 1P0KA 1US2A 3WK1A 3WK3A 3T08A 4GXWA 3WBXA 1QPRA 1YXYA 4KWWA 1PYFA 3AOFA 4QM1A 5C9ZA 2XH0A 3NM1A 3LA4A 3EWWA 4Q8TA 3MTWA 2Z4GA 3MW7A 4RDYA 1XRVA 2GK1B 3E96A 1WOBA 2YL6A 1YPXA 4Z1DA 3HO8A 1XYFA 3L2IA 4O15A 4WDTA 4DUVA 2A6NA 4LBUA 3LY0A 4NJIA 2QCEA 5IHSA 5HR6A 3G6LA 3G1SA 4KFNA 4DEFA 4KF1A 2J7GA 4HNCA 4JTEA 3WDIA 5E5CA 2E4TA 3G1RA 3LHWA 1GHRA 2HS6A 4YU1A 1BVZA 2ACQA 3TN4A 3TQVA 1M7OA 2WMGA 1TELA 2XIIA 5M17A 4ADSA 2CU0A 3H7RA 5U7SA 3WCZA 3QTGA 1LM1A 2KX9A 1N2VA 5FJTA 1P0EA 3VI2A 3IGHX 3ZVHB 5H6HA 3LDVA 3PJUA 5I06A 1RH9A 4E2OA 5GJNA 1T5AA 4Q32A 1VBUA 1VBHA 3WDQA 2Z29A 4BF9A 5HANA 5F7UA 2VDIA 4A3QA 3LTYA 3EMZA 3C2YA 4RZBA 2DZVA 3Q58A 7XIMA 1MEWA 4IJCA 1W1ZA 2C8NA 3GTNA 3DFNA 1ECQA 1SW7A 3EZ4A 3LTPA 2HVMA 4JQ1A 1E56A 4CD5A 3K4AA 2X42A 4ZE4A 2AL2A 3MP5A 1IZKA 3LXBA 4D6IA 1HJXA 1M3UA 1HW6A 4HHLA 3B40A 2ISVA 3ZIZA 1TO3A 5A6TC 2P3ZA 3XINA 4V1XA 1EXBA 3NGFA 4IUGA 3BW3A 3K46A 1OGBA 3HZ3A 1BXNA 5A6KA 5CZSA 1FWRA 4DWSC 1HNYA 2CKRA 1KTCA 5BMWA 4E38A 1ISXA 1UHVA 5D2WA 3NSNA 2DGAA 2QJMA 4WKHA 4GUJA 1NH6A 4Q4RA 3QBUA 3MS8A 3C8FA 3B9NA 2YCJA 4S3KA 3WLJA 4Y90A 4FNUA 4P61A 3S1WA 2XSXA 1V0NA 1Q45A 1EF3A 4WY0B 3QHOA 1Q66A 2ZXQA 1H7XA 4OBRA 4MZ1A 1XYBA 3HV9A 3TMQA 2BGSA 1IT8A 3CIWA 4A22A 3NYDA 3PP7A 1QI5A 3PZOA 1RV8A 2P0IA 1CCWB 4CD7A 4IFOA 5A6BA 2JIEA 1ISVA 1LLWA 3QC3A 5E6YA 5FL0A 3K2GA 4EX4A 3SGGA 8A3HA 3DG7A 4MVAA 2D0HA 3QSRA 4A21A 3W24A 3QGVA 1XPGA 3ES7A 4CQDA 3FAXA 1QPOA 3GFZA 2RJHA 4QJ1A 3P0WA 2GUYA 4IP4A 2ZA1A 1LRTA 4BCEA 2IKGA 1YXDA 2VURA 3W28A 1F9CA 1Q6RA 2PI6A 3FV9A 3VOIA 1JZ2A 3PBUA 1OFAA 4ZTXA 1AH4A 4Y9PA 1MEIA 3CQHA 3CS2A 4TTGA 4UR9A 2QJJA 2RJGA 5FEPA 4HD5A 1M1BA 5AYBA 5HMSA 1Y5WA 2VYOA 1SFLA 3IV8A 3THUA 2ZX6A 3BAJA 5K3VA 2BSLA 3ZJ8A 3BICA 3NO1A 2VEKA 3EDEA 4DO6A 3CYJA 3P74A 2HV5A 2BOFX 2YZRA 2Y85A 2Z00A 1WO2A 3VPLA 4A3YA 4MSSA 4JHZA 5FOOA 4O10A 1TJPA 3GR4A 3GC4A 4RE4A 5I3JA 3W1MA 4JCMA 3OA3A 3PJTA 2AL1A 1OC5A 4MYXA 3T0CA 4C6MA 4GCAA 2VCBA 1B90A 3W1NA 2ZRWA 2PDNA 1CGWA 3R12A 4AWSA 4UMAA 3LENA 4G7EB 4IMFA 1H51A 3AZRA 3M0ZA 3W01A 3WYZA 1XYMA 2AMXA 3FDGA 3W87A 3O9NA 3OHMB 3BGAA 4JPGA 2ISSA 1P48A 3BJSA 1HZYA 3DI0A 4G9PA 1VF8A 1FHLA 2CC0A 3LHYA 2UY5A 2I17A 4IFRA 2FVLA 1UWRA 2BY2A 1BFNA 3STPA 3S1UA 2A5HA 1X1ZA 1IE7C 3I3BA 3VOFA 4AY8A 3KTXA 3CAKA 1FP9A 3S5ZA 3BLLA 4AYGA 3VNIA 2C3ZA 2ZOXA 4R85A 3V0SA 1KBIA 2X30A 2ACUA 4ZXLA 2DIJA 2J62A 3IIPA 3SBFA 4ZO9A 3THQA 4R7OA 4A8RA 3KDOA 2FTYA 3W7RA 1E4NA 5HWJA 3WNMA 2FPVA 3URAA 3K1GA 2V2HA 1D9EA 2QAFA 4WSHA 4LW7A 1I1XA 3E5BA 4JCLA 1SJDA 5A3HA 1XI3A 1NELA 2YR1A 3PUDA 1WAUA