4YVXA

Crystal structure of akr1c3 complexed with glimepiride
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
publication title In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4yvxA00
3UFYA 4AUBA 3GHRA 1GVEA 2HE5A 4Q3MA 5LIKX 3COTA 1QRQA 4DZ5A 2HV5A 3MC5A 1Q13A 3O0KA 4DBSA 1S1PA 4GABA 1Z9AA 2FZDA 4XK2A 3LQLA 4XZNX 4WRHA 2C91A 3UZZA 4EXBA 1IEIA 3RX2A 3UGRA 4FZIA 5LIXX 1Z89A 3R7MA 1LQAA 1ZQ5A 3CAQA 1S2AA 2PDKA 3GUGA 4JTCA 3WBYA 4JTQA 4LB4A 4ASTA 1EXBA 4PUWA 3ONCA 4IJRA 4HBKA 2PDQA 2FZ9A 4QBXA 2A79A 5JH1A 4L1XA 1XF0A 1RY8A 3LN3A 3UYIA 3N6QA 4XO7A 2PDMA 3RX3A 4WDXA 4LB3A 3M64A 3V0SA 1YE6A 2PDNA 3LZ3A 2PDIA 3KRBA 1RY0A 2HEJA 1ZUAX 4PR4A 2QXWA 1MZRA 4RPQA 3LNMA 2PDPA 1PWMA 3M4HA 4DBWA 3WBXA 3BCJA 3CV6A 1VP5A 4PMJA 4JIHA 2WZTA 1US0A 4OTKA 1MRQA 2IKJA 2R24A 2WZMA 4JIIX 2ACUA 3CMFA 2J8TA 4YU1A 2R9RA 2AGTA 2IS7A 4XVDA 1AH0A 1ZGDA 2DV0A 4XZIA 4LBSA 2PDGA 2NVDA 5M2FX 1EF3A 3C3UA 3CV7A 5HNTA 1UR3M 5AZ1A 2ISFA 2I17A 2HVNA 2BGSA 4YVVA 2PDHA 2PDLA 2PF8A 3GHSA 3R8HA 2IQDA 3O3RA 2HE8A 2ALRA 1AZ1A 3R43A 4JIRA 3V0UA 4JQ2A 2IPWA 3WBWA 4WDWA 2F38A 5JH2A 1Z3NA 4GIEA 3F7JA 4LAUA 1PWLA 3EB3A 1ADSA 1AH4A 2PDBA 2HVOA 1YNQA 4GA8A 4QR6A 3CAVA 1J96A 4WDUA 5LIYX 5LIUX 5DANA 2ACSA 3UZWA 4GQ0A 1A80A 4NKCA 4YS1A 3BUVA 2PEVA 1S1RA 2VDGA 4G5DA 4ZFCA 2FZ8A 2HDJA 3Q67A 1YE4A 4XZMX 4JQ4A 4IJCA 3LQGA 1SM9A 1T41A 4GACA 2PD9A 3V35A 3R94A 3S3GA 4XAPA 4FALA 3GHTA 1Q5MA 2IPFA 3R8GA 4YVPA 4JTRA 3FJNA 5HA7A 4FAMA 3B3DA 1JEZA 2INEA 4I5XA 4YVXA 4ICCX 4L1WA 1X97A 2IPJA 5C7HA 3UZXA 3DN5A 2FVLA 4PRTA 1LWIA 1R38A 2PDFA 2PDXA 4R9OA 2ACQA 4XVEA 3GHUA 1PYFA 4GQGA 3G1RA 1XJBA 3BURA 4MHBA 3U2CA 2ACRA 1ZSXA 1IHIA 3NTYA 4XZLX 5AZ0A 2FGBA 3LBOA 3H7RA 1FRBA 2IPGA 3EAUA 1PZ0A 1K8CA 3LD5A 3M0IA 2PDWA 4XZHA 2IQ0A 3R6IA 3G5EA 4JQ1A 3V36A 4H7CA 1EL3A 3EB4A 2IKHA 1RALA 3LENA 4LBRA 4QXIA 3R58A 4WEVX 1QWKA 1S2CA 3D3FA 5HNUA 4GCAA 3T42A 2P5NA 1PZ1A 2PDUA 1XGDA 4LAZA 3MB9A 1Z8AA 4QX4A 3Q65A 1AZ2A 2PDYA 5KETA 4IGSA 1C9WA 4JTDA 4PRRA 2PD5A 1HQTA 3P2VA 1X98A 1HW6A 3QKZA 1AFSA 3H7UA 4JTAA 4F40A 4FA3A 3UZYA 3UWEA 2DUZA 2FZBA 3WCZA 2IKGA 3ONBA 3CASA 4HMNA 4DBUA 3LEPA 3H4GA 3UG8A 4XO6A 3V0TA 2NVCA 3FX4A 3N2TA 4WGHA 2F2KA 2PDCA 2INZA 1MI3A 3UP8A 1EKOA 4EXAA 1AH3A 2BGQA 1X96A 2I16A 2CLPA 3ERPA 3VXGA 2DUXA 2PZNA 4H8NA 4Q7BA 4WDTA 3WG6A 2IKIA 3BV7A 3LUTA 4JQ3A 3LZ5A 2PFHA 2PDJA 5LIWX 3DOPA 2BP1A 1OG6A 4JQAA 4PUUA 1M9HA 1T40A 1YNPA 1VBJA 3RX4A
chains in the Genus database with same CATH superfamily
5C2GA 1UMLA 4X61A 4TUFA 4TTGA 2ZZ3A 1DP0A 4YYCA 4C6CA 1R3TA 3O0KA 2CBVA 4BCEA 4PTDA 3UESA 4KMQA 2C91A 2C6QA 3VNMA 2EKCA 3E96A 2EPMX 4EIVA 4GIAA 1EZWA 5I3FA 1OFAA 2E4TA 3GAKA 1JUBA 4P7QA 2NT1A 4NASA 4JTCA 3ABOA 3N14A 4ZGYA 5CC6A 2RDWA 4E4UA 4M6QA 5DXYA 3N4EA 3MI3A 2FZ9A 1G67A 1OADA 3OJGA 3WEZA 5XINA 4YCPA 3BJSA 3SGZA 4Z0SA 5E6YA 3VNDA 3BOFA 2VZSA 3VE9A 4LS1A 3DX5A 3IUDA 4NAEB 1D3HA 1JZ3A 1REQA 3H70A 3PTKA 3S47A 1S2WA 4QLLA 2WVUA 5AECA 1H09A 2VQUA 4G7FA 2J8FA 3LNMA 3A4AA 4U31A 3W26A 3O6YX 1AQFA 3CIWA 5G4EA 5FKYA 4RNIA 2RHGA 3GIYA 3V75A 1VLWA 3PZNA 3KX6A 4LOCA 4IOTA 2OT1A 3BCJA 2GWGA 2VO5A 2QPSA 4E2OA 1Q8AA 3EX3A 2CFFA 4R9XA 1MW1A 4W8LA 4M6PA 2NX3A 1HVXA 2Q6ZA 4OBRA 2Z27A 3SCVA 4PRWA 4LCQA 5JU6A 2C1HA 4DAIA 4JPGA 4YHGA 3OG2A 3N34A 3LCGA 3ZT5A 2F6UA 2Q3OA 1B31A 3E6EA 7REQB 3LSCA 2GGGA 3W1LA 6TIMA 2BODX 1O94A 4B4FA 3WFAA 2VC7A 1SFSA 3FYOA 1PIGA 3WIJA 3HGRA 1HGYA 1SR0A 4LVDA 4HKPA 3DHFA 4AMCA 2JKPA 3AS2A 5KZMA 1GUVA 3W83A 1OT2A 1XINA 2QJGA 4IXXA 5A6BA 1XIBA 1POKA 1YPIA 2FHFA 4J3SA 5FI8A 3CU2A 3VMNA 1XS2A 3TYAA 3J7HA 4C5ZA 2VUYA 5F7UA 4XTIA 3PNZA 3N12A 4JIQA 5D03A 5LA0A 3LCWA 4ZQMA 2XZ9A 4IQEA 3DI1A 2OO0A 4FIQA 3SY8A 3THUA 1C8XA 3GK0A 2PCEA 2PRHA 1KM3A 1ICPA 2ODOA 4X60A 4DZIA 2CIPA 1E0VA 2DH3A 4J1OA 5AYZA 4W5UA 4D6EA 3T6CA 2R6OA 5I2UA 3Q4DA 4X22A 1W8SA 2PPGA 4EK7A 1YQ2A 1TTJA 4YYFA 2PTWA 1TPWA 1GEQA 1UD5A 4S1FA 5BWFA 3DFTA 4N9BA 4PEEA 4CLMA 4MAVA 1QASA 4FOUA 1UA7A 3GHTA 3L4ZA 4Q8QA 4S3EA 4JTRA 1KV8A 1K4GA 1R3YA 2INEA 1XW8A 3W4RA 4R85A 2D20A 4I6KA 5AC7A 3TR2A 3GVVA 1WXYA 1J2BA 5AKQA 1SO3A 3DN5A 3VDBA 3BMXA 3NQAA 3AIWA 2Z28A 3KTXA 2Y7DA 2PUZA 1T99A 1PKMA 3TYZA 4PBGA 1W37A 2EPOA 2CXEA 1PS9A 3BURA 1IHIA 4WKHA 3HFYA 2WMJA 4D8ZA 5JXQA 5HNNA 1KBLA 2X1UA 3BSMA 3W7OA 1IF2A 1OWQA 1XRFA 2VQTA 1KV5A 4QISA 3VIKA 3TN6A 5F2MA 1QNVA 1JZ7A 1YHTA 1XRTA 2OLAA 5FEZA 3FOKA 4URIA 4QLKA 4LJ3A 3UCDA 4H7CA 1N8WA 1EEXA 2NSOA 3UWWA 1PVNA 3Q94A 4MJMA 2Y61A 4X9YA 1X38A 3NIYA 3PULA 1R2TA 5DBUA 1FHDA 1FA2A 1DJQA 4H8UA 5ABTA 4S39A 1NWUA 1VBRA 3AIBA 3P82A 1RK5A 3CWHA 2Z2UA 3FGCB 3A12A 2NQHA 1VFSA 4MUZA 2NUYA 4AW7A 4GX8A 2E09A 4E2VA 4P7RA 4F66A 2IMRA 3WY1A 3ATZA 3TYCA 2C19A 2FGLA 2PA6A 3IJ9A 1ISZA 4EKJA 5A2AA 1WZMA 1BSLA 2CERA 4ZCWA 4KIEA 3PANA 4C7FA 1UASA 3DUGA 1XC6A 3NO1A 1RQHA 3WSUA 4TIMA 1U30A 4LYQA 1FHLA 1KBKA 3EBVA 5KSWA 4DIAA 4JX5A 3APYA 3DXIA 1WQ5A 2C15A 3DDMA 3N2TA 2PDCA 3AI0A 1T96A 3M0MA 2VGBA 1ITQA 2UY5A 5CPMA 2FTPA 5CC3A 1JNDA 3AJ7A 1K9FA 5LA2A 3AALA 3S42A 1W1B1 4AEFA 1Y5WA 2ZX9A 2JIEA 1AQ0A 3AYVA 2NX9A 3W1QA 3WLMA 1HKKA 2WBGA 3S5NA 1TRDA 4AWUA 1T7LA 2PWGA 2OVLA 3IIPA 4WIWA 4UTWA 1V3KA 3KVLA 5A5WA 1VBJA 3W2LA 3IARA 3G1DA 3EPMA 4O8RA 3PZTA 3DAQA 2RJGA 3B03A 1ZBWA 1EUAA 3LERA 4GHRA 4DBSA 3N6HA 5FIPA 4ZXLA 8RUCA 5LNWA 5ENLA 5GVJA 1VD6A 2JF7A 5CSUA 1A5KC 4NZ5A 3LTPA 1MW3A 4US5A 3S5ZA 1SJBA 2UBPC 1BKSA 4EXQA 4P5UA 1ECEA 1ZRQA 4Z08A 2XZ7A 1HF6A 5CPSA 1E6XM 1DL3A 3L9CA 5CZ0A 4ZB5A 3C2YA 2QULA 1OCBA 3ZT7A 1HTIA 1CYGA 2OU4A 4LQ1A 5TIMA 3HQPA 2YCIX 3DG3A 1KRAC 3GH7A 4MIMA 3HGOA 4GUHA 4F9JA 3ABSA 3CUJA 3TC6A 2QCEA 5CBJA 4A3RA 3SEPA 3XIMA 3W73A 3BCDA 1QBBA 1XG3A 2CLEA 2XIMA 2VZVA 3GO2A 4XV0A 2BASA 2REQB 4PR4A 3FV9A 5ECVA 1ONWA 1UH4A 1F61A 1WA3A 4EF8A 4BWLC 3VU2A 4YCOA 1UG6A 3GZAA 4PBFA 4EWND 2PE4A 3WJZA 3PZGA 1W1PA 2O9RA 3PSWA 2F6XA 4JFVA 3QKEA 2GWNA 4TU1A 3QY8A 4ROQA 3GTNA 4IG2A 2FDSA 3WH6A 1MRQA 3PZMA 4GC3A 4JX4A 2C13A 4BF9A 4MY8A 3FXGA 3PZ9A 1Z69A 3P84A 2B0MA 2GJXB 3LV5A 4B3ZA 4TX9A 1KXVA 3AISA 3LOTA 2E0PA 1V3LA 3VKDA 3BGAA 3SSJA 5IDZA 3MVTA 3N9RA 4HYVA 4KQNA 2CESA 7ODCA 3WL0A 3S2LA 3VKJA 2H9AB 1XPYA 4YTUA 5D09A 2BGSA 5M03A 1X6NA 1JGMA 3WQVA 3WN6A 3P81A 5AVHA 3S2MA 1XI3A 3WUGA 1BF6A 1UB3A 3VIIA 1XH1A 3URBA 2YCLA 3K1DA 1YPFA 4FLSA 5AHIA 2IQDA 1OABA 1AW2A 2HE8A 3NOEA 4QAWA 2EO7A 1HJWA 1SPQA 2NVAA 4JKKA 2V5DA 2XH4A 3O8AA 4B5UA 3T0DA 2VEMA 4GLEA 1ECQA 2G50A 4JHMA 4N7QA 2GJNA 1Q7ZA 3LGGA 3QY7A 2OZTA 5I79A 1I60A 2WCSA 2QQ6A 4A21A 3W7NA 2HVOA 3SSZA 1MXSA 1VGAA 1DTNA 3W1AA 2Y1HA 1OT1A 3BAXA 3AIQA 3B06A 4C6MA 2GUUA 1J10A 3LHUA 1TV3A 2DIKA 1UUOA 3SCPA 2NSXA 3LRKA 4IGNA 5T9BG 4G2DA 1UD4A 3TNOA 2B7OA 3QFEA 1O7AA 2GJLA 3OEXA 4EX4A 1XC4A 4D6FA 1OX4B 4B3LA 5E9XA 3WLNA 1G4EA 4W8BA 4RDVA 3S4TA 1XBXA 1EJRC 3DHPA 1RHCA 2BMBA 2WPBA 4OBSA 3GW3A 3A9BA 2J27A 3SCNA 2GQAA 1KBIA 2VFDA 3R94A 3S3GA 3L67A 4ZSUA 1XYAA 3C86A 3CEPA 3EKLA 5CG7A 1K02A 1MQRA 5H8UA 3HF3A 1PTAA 4LRTA 4YVXA 4L1WA 1XQLA 3MBFA 3VFCA 1C29A 1PIIA 3FYYA 1B3WA 2G4JA 1FWGC 5CXPA 4KEMA 1K9DA 3MV11 3BE7A 4XVEA 4XG1A 3GHUA 2GZXA 2G95A 1FWHC 2DFAA 2CLMA 2W6RA 2YL8A 2J7HA 1NVMA 1GQKA 1R46A 3R89A 2ZCGA 3TJXA 2EPHA 1SJCA 3H7RA 1TUXA 1V5XA 2E9MA 2W27A 3EAUA 3W6YA 1RP8A 1TJ2A 1RSCA 3M47A 7XIMA 1TV7A 3ZZ1A 3HGSA 2VC9A 1PL9A 3NWRA 3T09A 3RILA 5A6TC 1E73M 3AXHA 4G7EA 4W4QA 1V0LA 1QNOA 2VVNA 5REQB 3USBA 1RJPA 4QE4A 4DEFA 4DM2A 4KBXA 5IHSA 3FK4A 3BG9A 4JBRA 3ARRA 1GORA 1QI4A 2HPMA 1W9XA 3D3FA 2A0NA 4UTMA 1PZ1A 2PDUA 3W37A 3TFCA 4LVFA 1RCOB 3H53A 5AHLA 2PDYA 3M43A 3AMCA 3NXFA 4EPBC 3NSNA 1QNRA 3DFSA 4W84A 4UNKA 3W71A 4PRRA 1VYRA 4Y9MA 1YX1A 4FXRA 3AMLA 4TOQA 3VDGA 2A3EA 3N2XA 1MSSA 2Y70A 2P50A 3CL8A 3OYXA 3MDUA 2NLYA 2WZEA 1Z42A 3ZXWA 4WQ6A 5LZLA 1ZJHA 4IXHA 4H00A 1KR0A 4AIBA 5IFPA 2QAPA 4HA3A 1I6NA 5HATA 4J3XA 2E8YA 2BY0A 3DI0A 4ZE5A 4WGHA 3DKJA 3W01A 2WNQA 4UCGA 3DFHA 5IOBA 4XIMA 3UNTA 2CLPA 4AX7A 4H8NA 1HKJA 3R12A 2WOQA 1M7XA 3TCEA 1TKKA 1O1ZA 3KZSA 3VCCA 2Y7GA 5HPCA 3OIHA 4A3YA 4P8UA 2EBNA 3WO8A 2WYSA 3CAWA 4IMEA 2VX7A 3GRIA 1QMLA 1DHKA 1G4TA 1UWQA 1XYBA 5JBDA 3ZQ9A 1W9PA 3RX4A 1YKWA 2A7NA 4CU6A 4UTTA 5F4XA 4I5RA 3P80A 1KC7A 1OIMA 4NT0A 4QG8A 2HK0A 3U57A 2WMKA 4M6UA 1QRQA 2HV5A 4ZOAA 2DZWA 2HISA 4WJ8A 1S1PA 1WDQA 5FACA 3S8HA 3CUXA 4ZOEA 4P7NA 2XVKA 1H1NA 2DSWA 4HZMA 4S3JA 4EXBA 4AZCB 5XIMA 2NXHA 1K9TA 1BYCA 2P53A 4QM1A 1EQCA 3G2GA 5FCZA 2DW6A 3H55A 4FNPA 2XFYA 4NNBA 3ARTA 3G8RA 1BYAA 4D1JA 4UTFA 2C18A 1ADDA 4GO8A 1JUEA 3T05A 3W87A 4B5SA 4DO5A 3WDHA 1H7XA 3QMTA 4H9XA 2A21A 2FH6A 2WWDA 2SFPA 4QBXA 7ENLA 2E5BA 2QDEA 1IYXA 3UYIA 3VOHA 4O1CA 1CTNA 4UQDA 1DIKA 3E0IA 1V7YA 4P8VA 4YTRA 3G3MA 1V4YA 6A3HA 1RY0A 1MMFA 1CI1A 3HBLA 3H2NA 3E3HA 2X0SA 3LYEA 3WMCA 3ATYA 1W9BM 4HPHA 2H6RA 4Q32A 1W1TA 5PTDA 3ICJA 3EX2A 4US6A 4A2RA 4MSSA 3OBEA 3O6DA 2WCGA 3HM7A 3VO0A 4TQTA 2NV2A 1TWSA 1FTXA 4DX3A 1OK4A 1DWGM 4IG2B 3APGA 3SCSA 3UU0A 5DMMA 1E9IA 3OPSA 1UP2A 4Q7NA 4L1GA 1AJ0A 3CT7A 2DVUA 2JE8A 5EA9A 3TJLA 3E12A 5C54A 3W7HA 1YXDA 4HCLA 3GFYA 2H90A 3H4WA 3VNZA 1R2SA 2NUXA 3PPCA 2QLYA 4OE7A 1HP4A 2VURA 3DHDA 2HWGA 3K8KA 4C1NA 5A6MA 2OELA 3GR4A 2A85A 4ZFMA 4F0MA 3TEVA 1NF7A 1UC4A 4MWAB 4XBKA 3EWUA 4IFRA 1SYTA 4AVNA 2NV9A 4NZ3A 4K8HA 4Q8NA 1CGWA 5AY7A 4IL0A 3BJTA 1J93A 4DJFD 2CC0A 4A6GA 4IFKB 2WB5A 4WDWA 3THQA 2WCAA 2VM8A 2WC7A 4FHAA 1PX4A 4POCA 4RE0A 4HPGA 3REQA 1K1DA 4RE2A 1N2VA 4RNJA 1DXIA 2WC4A 3QV9A 1DJYA 3E2RA 2V2HA 4X2RA 5BRQA 3QM3A 1H0IA 6ENLA 4PCPA 2WQDA 3KCOA 2UY4A 1A80A 2ZRUA 4LUSB 2PEVA 3STFA 4L9YA 4ZFCA 1FWJC 4GXPA 5E1QA 3TE9A 2C3ZA 1TTQA 4FIRA 1THFD 1Q6OA 3C56A 1I8JA 3IPWA 9CGTA 4Z42C 3NVTA 3MHUA 5G4HC 2IPFA 3TFXA 2X1IA 3VOIA 3HG2A 5GJMA 1MO0A 3R8GA 5HOSA 3SCOA 1DJXA 1QI5A 4M8UA 4MFEA 3R4IA 4IPNB 4RDYA 5HA7A 1KRCC 4C6OA 3C8NA 1TRIA 2Y7EA 2DORA 3LRLA 1IXNA 4TO8A 3VX1A 3WQGA 3YPIA 2QDHA 1TQXA 1XLKA 1SFLA 1F73A 2FVLA 3ZLGA 4CN4A 1IZKA 3GLCA 1B30A 1D7FA 4V28A 4PC8A 2ZX5A 4GQGA 2XJ7A 3R79A 1P6CA 4U3CA 1MQQA 1JYNA 1W5PA 1FRBA 2V2CA 2XSAA 1U1JA 4V2XA 4QGCA 1UR0A 3BGJA 5HANA 2JQXA 3MO7A 3ORWA 2FTWA 3B8IA 4JQ1A 5C8BB 3AHYA 3TSMA 2EPKX 4OT7A 1J0HA 4MDPA 1W3LA 4G7EB 1PXGA 2MANA 5DEZA 3MKVA 5CH9A 2VOMA 5DFAA 2BNJA 1SVDA 2R1PA 1TTPA 1TPVA 3HV9A 4PMOA 4CQBA 4LAZA 2WLZA 4BEQA 1BFNA 3MJYA 1R7OA 4NJGA 3CUFA 1C9WA 4S3GA 1Q4WA 2EKGA 5FJOA 2CCRA 3IANA 2GDVA 4FA3A 1LBFA 2CPUA 2QKFA 2ON3A 3PHAA 1ZNNA 2VRJA 3IS4A 3M7WA 5HMDA 3TC3A 1J11A 2BVDA 1RD6A 3M0HA 3QW3A 7PTDA 4JYFA 2G97A 4H2CA 3M6YA 5AYXA 3QHMA 4HOZA 4UOJA 4WY0A 3W1MA 4Q8TA 1HJSA 5GJNA 3W2KA 3PBWA 5LNUA 2QNEA 3GWQA 1X96A 1R3RA 2WM1A 3QTGA 3M0XA 1P43A 3VXGA 2CITA 2V3FA 2ZDRA 5I0DA 4JQ3A 1XFBA 4UR7A 3W53A 2DZTA 3U4AA 2HS6A 1J0KA 5TQLA 1DQUA 3B8SA 4FS9A 4LEFA 4ORIA 2CW6A 2W79A 4KEVA 1AQMA 2Y8VA 3SCWA 3NL5A 4WVXA 4ZOCA 3AZRA 1JDAA 2J7FA 4F0HA 2I5GA 1KRMA 4YJ5A 3QZAA 2XGIA 3LCIA 3DZ1A 3GC5A 4S3KA 4MAZA 3O06A 3WNKA 5I77A 1OCQA 2FZDA 1ZBCA 4P2VA 1L8PA 1WKFA 3LQLA 4DJDC 1TPDA 3L0NA 1DORA 3RX2A 3UGRA 3V5OA 3FA3A 4GO9A 1JDCA 4MLJA 1VFMA 4Z2HA 1OJXA 3T2QA 4BQ3A 1YTKA 3GU9A 4UC5A 4QSHA 2VKZG 3HGJA 3W82A 2ISWA 3AAMA 3KOZA 3O1NA 1JI1A 3A21A 3R10A 2P76A 2HNHA 1XIIA 4LB4A 3UXAA 3FW6A 4P7OA 5IBXC 4AWSA 1EJVC 1WAUA 1XD1A 1XF0A 1KCXA 4IMCA 3LMZA 2F6KA 1RPKA 2Z1SA 4EVZA 2VFEA 1M6JA 3T8QA 3UJEA 4AD0A 5BROA 1LLWA 4DVOA 5IHRA 2NV1A 4L6OA 3IGSA 3GW0A 1LRTA 3RXZA 1P6BA 3BZGA 4DUXA 4XKYA 1F3EA 4ILSA 2PLCA 4JEQA 5HR7A 4AU0A 1TELA 4O28A 2TYSA 4IPLA 3M16A 4E2DA 1Q2SA 1GJWA 3A4XA 4Y90A 1U5VA 1W8GA 5E9AA 4O4WA 5HWJA 1TG7A 3PFMA 3BOXA 3URNA 3H7VA 2IS7A 2YKKA 3RHGA 1RA0A 4ECLA 3CLWA 3AZSA 1EF3A 3VMOA 1GQJA 3P61A 1H49A 3I68A 1ZP3A 3UWUA 3ARPA 3ITOA 3OZOA 3QVQA 3S2JA 2IXVA 1H7PA 4O53A 4H83A 4RK8A 2PDHA 2PF8A 1MQPA 2OFJA 3R8HA 3S1GA 2J7CA 2QMKA 3FDKA 3LPFA 4O15A 2GJPA 5D38A 5DY2A 1CCWB 5G1YA 4ICMA 4A8NA 1K8XA 4C7DA 4Y9AA 4PTVA 1KFEA 3WBWA 7TIMA 5CSRA 4WD0A 4ZE4A 4RE3A 3S2CA 4B5XA 1F7BA 1P4CA 3FYPA 5F4WA 2B4GA 2CYGA 3LU2A 2NQZA 2QHAA 4GFSA 2VL4A 3A3XA 3XINA 3GS6A 4RXGA 4W89A 1QTWA 3WYZA 2A3AA 4QQUA 3N2OA 2VDHA 2CWXA 3R0UA 2QW5A 2QJMA 4GQ0A 3GVRA 1V6WA 4JIPA 1Y0EA 2VDGA 2R14A 3AU6A 2ZC8A 3E0FA 2QJHA 3OYZA 2J7GA 1JYXA 4AMAA 8XIAA 4DAFA 3QR1A 1XKYA 1XWYA 1LOQA 2QCDA 3CZKA 4XAPA 3TW9A 1GPFA 2R1NA 1TIMA 1JCMP 4GNKB 3KOFA 3DBNA 4UNLA 1ISWA 3QY6A 5FL1A 3MP4A 4XUYA 5MKGB 1KXQA 1UCWA 2NUWA 3G77A 1BXBA 5ABHA 1VPYA 1G4SA 3A4JA 2OSYA 4JGDA 3GY1A 3M44A 1QOPA 1UD2A 3AMDA 4Q4OA 1XLIA 2E6YA 3OTRA 5F4SA 1EH9A 5LYRA 4XZLX 1M68A 4KKXA 3CYJA 4HNUA 3SQMA 2QDDA 1IZJA 4O16A 4UMCA 3DFQA 2WVSA 4XZ9A 1GVQA 3HQ1A 3ITTA 3DENA 3G5EA 5CCZA 2Z00A 4NQ1A 2VEKA 1GQLA 3R2GA 4LRSA 1EWDA 4TMBA 3PJTA 3F4NA 2CKSA 1IWBA 3PNUA 1T8XA 4D6IA 4CQ8A 3MY9A 1CB2A 1S5WA 4B2DA 4WEVX 3VGFA 1QWKA 1ELSA 3M46A 3QR0A 3G1HA 3N04A 3ZO9A 1X8CA 1RCXB 1IEQA 2JKAA 4HB7A 4HMDA 4TVCA 3MPGA 5BRPA 4DYJA 1OX6A 1NH6A 1W6TA 2W0UA 4GVFA 3KDNA 4FNQA 3CIXA 3KLKA 5I03A 2WVVA 2OTDA 3ZR4A 3HN3A 3A13A 1YRRA 1FFRA 1R3QA 2L5HA 3TIMA 4GQQA 1V7AA 3QKZA 3BG5A 1AA1B 3VGDA 3NJ3A 2FZBA 1XX1A 4JTUA 3S1VA 1TZZA 2HXUA 3OVRA 1BGAA 4F4RA 1KLYA 1PBGA 3BMVA 3VDAA 1JCLA 1XIJA 2DZAA 3M41A 2ZUSA 1GYLA 1NDZA 3TXZA 3GBEA 2FHBA 4XX6A 5AYYA 1CIUA 4D6JA 3C2VA 2A4AA 2X7VA 1AH3A 2AKMA 4EF9A 4DXVA 2Z26A 2ZIDA 3SRKA 4C6LA 4O18A 3C2OA 4XAFA 3KVKA 4LFYA 3VIHA 3KRUA 2ZWZA 3TDFA 3WMBA 3ZLHA 1UWAA 1F76A 2J88A 2F2HA 4GMEA 4V33A 4HGXA 1P0DA 3QQ1A 1FWAC 4O1AA 2O4MA 4ZL1A 4MKVA 4ZR8A 4AZ6A 1QPOA 2AGKA 4DLFA 2D2HA 4AUBA 6ALDA 3KDOA 2AQWA 1MEWA 3KTCA 4F79A 1VFHA 2QF8A 3PG8A 4CQ9A 4FB7A 2WKGA 4B5NA 2OKOA 1XRSA 2D69A 3U7BA 2OGJA 3VM5A 3E0WA 3VOGA 4KERA 3DECA 2VR5A 5TF0A 3WD4A 1FP9A 3NYZA 1I9CB 2R94A 1KWKA 4A4AA 3UR8A 3E5BA 1A0EA 4EAYA 4RR4A 3WMLA 4ENLA 3A22A 1IT0A 1X7IA 1FWSA 3ABXA 5LIXX 4DHGA 5CGTA 4RXFA 1SW7A 1EBHA 4MM1A 2PTDA 4B92A 3DESA 2EG6A 5EPDA 2QUMA 1ISYA 4GI8A 4ZQNA 2P0IA 3K1GA 3ZSTA 1H5VA 5JIPA 1VF8A 5SWUA 1JD7A 1JPHA 3C3NA 1OHLA 1XCFA 3LHTA 1WO2A 3KFTA 3ITCA 1CX9A 1Q6CA 1JFHA 5DF0A 1GVRA 4UZUA 2WSKA 4QDWA 2O9OA 4PB5A 3P62A 4XZWA 1YE6A 1ML1A 3CO8A 3W07A 4LV9A 1G4PA 1U2YA 3MUXA 3UG3A 3RCMA 3SIZA 1J18A 1LQ2A 1B3YA 2XGZA 1MZRA 4S3CA 3AMKA 2PDPA 3RLUA 3EWYA 4BI5A 4FNRA 1FWRA 1HUVA 2P3ZA 5LXXA 2VMFA 1RV8A 3FVMA 3DYPA 5CKSA 4KCVA 4C7GA 4G8TA 2XIIA 1VP5A 1WKYA 1JD9A 2W63A 3BW2A 2CHRA 1W5MA 1OFRA 4AG0A 2YIHA 1XPGA 3H12A 5KINA 2IQTA 3ZJ6A 2ZYFA 1E5JA 4LEQA 3CMFA 2BBFA 4HMCA 2FVMA 1S5MA 2ZXAA 1AH0A 1EO7A 1J6PA 4AZBA 3O07A 1FOBA 2J66A 3CWNA 5DELA 3GIQA 1DYSA 1Q6GA 1W3HA 2OX1A 4GVIA 1PZ3A 5HNTA 4UMBA 3GR8A 3T0CA 1QJWA 4B5TA 1JG9A 1JYWA 4CD6A 4CCCA 1VBUA 1LWJA 1V79A 2X05A 1LZOA 1RUSA 3UETA 5FF0A 4LW7A 1DBTA 4RDWA 1LM1A 1W5OA 4WOZA 3V7PA 1OFDA 1A47A 2PU1A 2F38A 4GI4A 3KM8A 5AHEA 1QXLA 4LCSA 1PWLA 1K7XA 1KM1A 3S5OA 3NVDA 1NQKA 2ZZ6A 4PN2A 3N1AA 3TW6A 2VDIA 1FDYA 4PGLA 1F3TA 3U9IA 4CVUA 1XSJA 1OK6A 5I7GA 4I8YA 3N3TA 2ISVA 5ECUA 4R88A 3PZQA 1GYMA 3EWDA 3IJIA 4GC4A 3KXQA 1CW2A 5CJ5A 4KT2A 2NQLA 4YIWA 2HDJA 2H3DA 4H9ZA 4B4HA 3UR5A 2A2IA 3DFYA 4JIEA 2QCCA 1TA3B 3GNDA 3LM7A 3L66A 3V1PA 3NSXA 3N4FA 1NOFA 1E71M 1O6IA 5HK4A 2Z1KA 3TAKA 1A5CA 3GVWA 5K4ZA 1KWGA 3DBPA 4JICA 1KCLA 2MNRA 3EEZA 3G0XA 3W1RA 2E67A 1NWRA 3WLQA 4Y9PA 1XLLA 3WD1A 4EACA 4L7ZA 3WQ6A 3AQUA 5LGZA 3UZXA 5E0KA 4QSFA 1FWCC 7CGTA 2OZ0A 1WNOA 1VIWA 3JZUA 3A24A 2X2GA 2QAFA 4TV6A 4B15A 1E1CA 3DYMA 3THCA 5I02A 1QR7A 3UVAA 2HVMA 5HUOA 4ATWA 4WKAA 4GWEA 3AIVA 3EOEA 3QPYA 3JR2A 2HRWA 2WANA 3KRSA 1E6ZA 3UYCA 2QGHA 1ENUA 1OYCA 2B7QA 2QPXA 5HUPA 1E3ZA 3UEQA 1V02A 2WZIA 4NY2A 3IRSA 2NQ9A 1ITUA 2WMGA 4S2BA 3MMDA 1GVSA 1RVGA 3TTYA 5CPOA 4Y7EA 1S39A 1TR9A 1LUCA 1WP6A 1YW1A 3NQ7A 1O5KA 5I6SA 4DJFA 3VIFA 1TUFA 4U33A 1SZFA 3U3HA 4H01A 3ZVHB 4D8LA 4LBRA 1VFTA 1A49A 1W1VA 2WMIB 3QQ0A 4AB4A 1XXXA 1UR9A 2WSQA 4WGXA 2BVWA 2YA0A 4NRSA 4GCAA 4Q8WA 4Q4MA 5I06A 1JCYA 1VCVA 1P0BA 1WUEA 1K7FA 4JTIA 2ZTJA 4N2YA 4NAFB 3ZWTA 2EJ1A 3C0JA 5CJMA 1HW6A 2ZUTA 3H6OA 1MW2A 3WJWA 1QNSA 3N29A 2DUZA 4GQBA 3THAA 1VJSA 5GNZA 3MBDA 1K6AA 4KCWA 4WF7A 1C92A 3GIPA 3GD6A 3RK8A 1M7PA 3GKAA 3JRKA 3BV4A 5BW6A 4BFAA 4MKSA 3TLLA 1SFJA 3WEOA 4BHYA 2VVSA 1XG4A 2D0FA 3M0ZA 4XB3A 1FCVA 3N3MA 4KEUA 3WENA 1L2QA 1SUXA 4ERAA 1I2RA 1T5AA 1EF2A 4GYPC 2PZNA 3JU2A 2DSZA 3SR7A 3QHOA 1BYBA 4QJ4B 3KOYA 3G18A 8CGTA 4JTTA 4BS0A 1UD6A 4O19A 5DRCA 2BHYA 3CV1A 5CC5A 1M9HA 4A3HA 1T40A 2ZTKA 2C1GA 2E5CA 3N6JA 3MSYA 3TTSA 3KZPA 1LL7A 4J4KA 5I3GA 1UPPA 1KNWA 3GXFA 5KZDA 4DZ5A 3AO0A 4L4LA 2CEQA 4M6VA 1F8MA 3DYOA 3A3HA 2VCCA 3SJ3A 2WMFA 3GXNA 1XYMA 2ZX6A 5A95A 4Z1BA 4EPKA 4J2MA 1SZRA 4PMNA 1TV5A 3LHVA 4B91A 3SQLA 3MS8A 4AF0B 2Y6ZA 4AH7A 1PHWA 1UD8A 5BOEA 1B9BA 4CN1A 4A29A 1HJUA 1B3OA 2OLHA 3GKFA 3WZ0E 3TZFA 4QDMA 2FJUB 1A5AA 1PDYA 2PWVA 1EDTA 3CQJA 3RCNA 4E8DA 1YPXA 5FJTA 2AL2A 4M81A 1SJDA 5LNVA 3GG7A 3SB0A 3RG6A 2UWFA 3W7IA 2O7SA 4QNEA 4HHPA 4LWWA 2PDNA 1ZJBA 3LZ3A 2PTYA 1MUCA 4H6QA 1E5NA 1TV8A 4A8IA 1DWAM 3IIVA 3BAYA 1QBAA 1LWHA 2DSKA 2PC4A 2YBUA 3U6WA 4GQRA 3HV8A 4UTUA 4CUCA 3VD3A 3N2MA 2HCVA 1E70M 3I6TA 4ADSA 4IM4A 3POCA 3W27A 4YTTA 4G1NA 5EMMA 3E38A 4JIIX 1P7TA 4GYFA 4YWSA 3BLFA 1R3SA 4JCMA 3W28A 1C8VA 3PBYA 3G1YA 1IV8A 1SW0A 1K8ZA 2P10A 4L4PA 3U8GA 4FOKA 1S5VA 4JY9A 3PBMA 1G5AA 3OLGA 3QF0A 1MUWA 3L4WA 4YXGA 3N13A 3ZFHA 3MKKA 2AOSA 3EMZA 1KFKA 1JGIA 1JZ6A 3JZEA 3RAOA 1JPDX 4YVVA 3E49A 1DWFM 2Z29A 1V6VA 3GE7A 4E38A 4UUIA 2PLKA 1G01A 5AFDA 2PRMA 2EPNA 4OQVA 3NFUA 2HTMA 2BTMA 3VCNA 1XDLA 1TE1A 3MYPA 4N02A 5EL1A 2NT0A 3ZT6A 1R8LA 4FR1A 2V68A 3CK5A 4QJ5B 1ADSA 5J8LA 4KFOA 2PSNA 4US5D 2J9YA 4C6QA 2YR1A 4O0QA 3KCJA 1B3VA 1UA3A 4HU0A 4GA8A 2E6DA 4H7VA 4AY8A 3FLUA 1VHCA 3MSDA 2RH9A 1C93A 1H0GA 2WPGA 3UCQA 5LKYA 2ZZ2A 3MWAA 3TLQA 3HJEA 3NZGA 4G6CA 4NKCA 1SGJA 1TJ1A 4YS1A 2FGZA 4G5DA 3LG3A 4JY8A 4IQDA 1NJJA 3EX1A 4M29A 2W66A 3OA5A 3ISIX 2V38A 4XZMX 2ASHA 1ZJIA 3MMWA 3WF3A 2OSXA 3KP1A 5EYWA 5JUVA 1F74A 3V35A 3O2LA 2HBVA 1MNZA 3W7RA 4GI6A 3WF4A 1WZAA 4XWUA 4LXFA 1OGBA 2FB3A 3LHWA 3R0KA 2OQHA 4FAMA 3RNDA 4M3PA 1HG3A 4MZ1A 1X97A 5EKYA 4P61A 5BNKA 3NGJA 1UR4A 1Y5XA 4Z1YA 3HA1A 2UV8G 1VLIA 1E0TA 1XH2A 2WXDM 1LT7A 3ZJ7A 4AYGA 1N8FA 4IUOA 3PN8A 3MKCA 1GVFA 2UY2A 1XJBA 1SMDA 4OGZA 4MHBA 4H41A 4DUWA 2YFNA 4LAMA 3CH9A 4AX6A 3ARQA 1WBJA 4E3TA 4JFWA 4LUJA 1DWJM 4AYSA 3H24A 1W3JA 3TMQA 1OFPA 3PAJA 3JUGA 4MWAD 3NZRA 2TAAA 1F5ZA 2QCNA 3VE7A 5FEPA 1V0MA 1XHGA 4F8XA 2EF9A 4DZAA 1O4UA 2YOCA 3VK5A 3NQDA 6XIMA 4J3WA 4JYEA 4OV9A 3TN5A 4U2ZA 1Z7AA 4QXIA 3R58A 3NEHA 4PE8A 2EG7A 1WXZA 2A7PA 4P7LA 3ZVIA 3NDYA 5DMYA 4I9AA 4W7UA 1G6CA 2BHUA 4LF2A 1KXTA 3WQDA 4V1XA 2GSEA 2V82A 1VENA 5LHEA 3H7UA 4ZOBA 3UBPC 1DXEA 3WCZA 2KX9A 3L5AA 1JDEA 3CASA 3MUAA 1GW1A 1C8QA 1JXKA 4PCSA 1JZ2A 3H4GA 3MA8A 1AW1A 3B9NA 1KB3A 2GL5A 3PB0A 1UR2A 3W00A 3RFAA 3KS5A 4QCFA 1S2UA 3EEGA 4PB4A 5CSSA 2FLIA 3MYOA 4P8WA 2CZ5A 4QCEA 1BRLB 3N18A 3ME3A 2IUZA 2C79A 4E4PA 3QPEA 2BOFX 2XFRA 4DJDA 2Z1XA 2YSWA 2XG9A 4A22A 4F2UA 2V3DA 4HJWA 4PCTA 1I0BA 1NELA 5D9MA 3BMWA 1VCFA 3NOYA 4PUUA 4KCUA 5K4XA 7REQA 1FWNA 1GOWA 2F61A 2DDXA 2XGBA 1CGVA 4KRTA 4E4FA 1RBOB 1I2QA 3VUSA 5A6SA 3TN4A 3EDDA 5IBXA 1Q13A 1QPNA 4O52A 1BXCA 2R1KA 4NYUA 2PP3A 4E0CA 1VPQA 1WXJA 2LLEA 4KWOA 1V3MA 4BQ2A 4LVBA 1QOQA 1VFOA 1Z89A 3BLLA 1XSIA 4PUDA 4OZOA 3TX9A 4CEXC 3TSBA 3VI2A 2X1SA 2P1FA 3C52A 1HXJA 2BG5A 3A5VA 4JTQA 4ZA0A 1M65A 4F3HA 2C14A 3FNDA 2E68A 1FBAA 3OZMA 1S5TA 4XUGA 3AC0A 3PK7A 4IJBA 4LV4A 4GZIA 2CHNA 1BGGA 4XO7A 2HK1A 6REQB 1TWDA 3CXOA 4CD4A 1AVAA 5A2CA 4A8LA 3UW6A 1QHOA 4FLRA 4R33A 5EMKA 3WK3A 1P0NA 3PWGA 2FZMA 2PB1A 3PC0A 2VZTA 3IIZA 5HMEA 1UZHA 2ZXBA 3KVJA 4RPQA 2X8RA 4QRNA 2VX5A 3AJXA 3VFLA 2X1RA 1GKQA 1GOKA 1RVKA 1A3XA 3N2BA 3NQCA 3B0VC 4U4MA 3PBVA 2ZDSA 1X6LA 1L0PA 1B57A 3K30A 4GH3A 3CV6A 4C6PA 2Q3RA 1LBLA 4PMJA 2ONEA 3HIJA 1F4HA 4JR5A 3NQ8A 3G0UA 3B9AA 1FWTA 3OLIA 1CGTA 5DRIA 3P74A 2ACUA 1EGVA 2ZVRA 3M5YA 4ZQOA 2C0AA 1K70A 1HNYA 2CZDA 4CNPA 4TTUA 2E9BA 2AQVA 3T4WA 1HP5A 5M2FX 1YIXA 3FEMA 3E0LA 3ARZA 4RW5A 4W7VA 4LF1A 1YDYA 2V3GA 2E9LA 2XUCA 3WH9A 4JTHA 3SAZA 1XLGA 3AS0A 3L4XA 3WFLA 3GNPA 5E5CA 3ARYA 5D4YA 4QAIA 3LCHA 4HSOA 5DX7A 4CNOA 1XLBA 3T1GA 4AWTA 3ARUA 2PDLA 3MW7A 1NF0A 1A5SA 5I3IA 5I78A 3SIMA 4JKMA 1NP0A 4S3FA 3V0UA 3UWVA 3RCYA 1JNEA 1ITXA 5BXTA 1HL2A 2YX0A 2ZZ5A 3B0PA 3UJRA 4RUBA 1FUYA 3FGCA 3PWAA 2B81A 4HIBA 4QNWA 2CLKA 1AJ2A 1G69A 5I3DA 1EXPA 3CO4A 3GAYA 3MMTA 4PMRA 4B9ZA 1LJYA 1LG1A 1ZCCA 3U5UA 2ACSA 5K3VA 3IGHX 4L64A 3TYDA 2OOFA 1GOMA 1ZS2A 4Z0JA 4YTQA 1BVWA 3TXVA 2YB4A 4HNTA 2PF0A 3CB8A 4IMDA 3D46A 2G41A 3B9OA 1W1YA 2Z2AA 4X0VA 4PA8A 2V67A 1CLVA 3CC1A 3BH4A 3QQWA 5GNYA 1JL8A 2WK2A 1XLJA 1EC8A 3QSRA 1YLVA 1X6UA 2OR2A 1HJXA 4N0RA 3SN0A 1GCYA 1VFUA 3W25A 4HOXA 1XV8A 1V6YA 4H9TA 4GGBA 5M5DA 1W1A1 3BLDA 3EOSA 1Q6DA 1QW9A 4ACZB 4LNCA 1O60A 4E8GA 3AZTA 3PTDA 4DNMA 1W1IE 1EC9A 2OJPA 2POTA 5DQPA 1GK8A 1R3WA 3TYUA 1NSJA 3ELFA 3LCFA 4KEZA 1LLOA 2W91A 4CD5A 3I3BA 3W02A 1D3CA 5K9DA 2MUCA 4H04A 3L68A 4DWDA 1C90A 1QNPA 2PDWA 1ZAIA 3SUTA 1BSIA 1OGGA 4MKNA 3AUJA 3CHVA 2YCJA 5CSYA 4UTJA 2B7PA 3V36A 4D2JA 3S6DA 2PBOA 3E02A 3D47A 1RALA 3LENA 2X2YA 3TQ0A 3WDRA 2F9RA 3S5SA 1TMLA 1GT8A 1FWBC 4ML9A 3TKFA 1XH0A 2ZZ1A 3IRDA 3CUZA 1H61A 2WJDA 3EWWA 2JEPA 1OZMA 2NXGA 3AS3A 3QOMA 5BWAA 3SGGA 4QROA 1C3FA 4MVAA 1GEHA 5T8GA 1A5UA 3BC9A 3ONBA 3KHDA 2REQA 3W3OA 4HMNA 4ATDA 4IFOA 5IDIA 3W2UA 4DPQA 3S9YA 2GK1B 3CM4A 4JNMA 3MANA 1F2JA 4CCEA 4E6MA 4Q4SA 4DI9A 1TMHA 4GJJA 2DT1A 1EO5A 4FLQA 4KRUA 3SRFA 2ZVIA 3ITXA 5E70A 3P0WA 1R3VA 3AXKA 5CGMA 1IXPA 3VD9A 3CUIA 2Y63A 5KZ6A 1R2RA 4K37A 4NZJA 2GJXA 4NYYA 3L0GA 3LTYA 4GKTA 2GLKA 5E0CA 5E09A 3OVPA 2NWRA 1PKLA 2EG8A 4MJZA 4W87A 1LBMA 3A5FA 4MJ4A 4PUNA 3NPVA 3TR9A 3HQNA 2H9AA 2PRLA 3T8LA 3COTA 1EPVA 3AIRA 5MHBA 1EX5A 2J7BA 5K9CA 2VC5A 3GNXA 1A5LC 5C9WA 4DNHA 4MDOA 1MW0A 1IEIA 3OBAA 3WH5A 1KM6A 4X2PA 4IX0A 3MCNA 2YXXA 1FH7A 5I3HA 4BK9A 1RH9A 4Q6JA 5HNRA 3FIGA 4FPSA 4IIFA 3MUZ1 3AMGA 2G3MA 5G2HA 3NXLA 3QZEA 4K36A 3EOUA 3BPWA 2I9UA 5EBAA 3G3DA 4PUWA 3ONCA 4CD8A 4KFPA 5JH1A 3KHJA 3EKZA 5KMYA 3DHUA 1L6FA 2YGYA 1OX4A 3RX3A 4WDXA 4LB3A 4DJED 4L65A 3VCRA 2O7QA 4YL2A 2PZ0A 2X7WA 4EPEC 4D6CA 3KRBA 1T8QA 4U5IA 3GNNA 1RJQA 2HEJA 3TTEA 2CU0A 4GY1A 2G37A 4O50A 2BX7A 3WJYA 3AS1A 3VIOA 3NYDA 1DXFA 4KGJA 3M4HA 3WNPA 1OSEA 1Q6RA 3LHYA 3EX4A 5XIAA 4MUPA 4DBWA 4UR9A 4HTYA 1R6WA 1R86A 4O1BA 4E8CA 3AROA 1BTMA 1NOWA 1US0A 1QO5A 2IKJA 2R24A 1TJPA 1VHNA 3T0AA 2Y2WA 1WDRA 2GVGA 1Q3NA 4UFLA 1ODZA 4KRZA 1G7VA 2VI0A 3SUSA 2VWSA 1QW7A 3SADA 1C91A 4NZCA 3KTSA 5EY5A 2A3LA 2VZUA 2XWDA 3T4CA 3RPTA 2PDGA 3L21A 1HX0A 4NSBA 3BLPX 5D9NA 5AZ1A 1RBAA 4QJ1A 4LS2A 4NJHA 4Z1AA 1EJTC 4AVOA 1I1WA 2A3CA 1W3KA 4GGHA 1DJHA 1T0OA 3AFBA 1PO9A 2J6VA 4FLOA 4MY1A 5REQA 3T0BA 1KM0A 4MWAE 2WSYA 1XSKA 1CECA 3R43A 3AYTA 2E77A 1VRDA 4H9MA 3K5XA 3ZYZA 5A94A 4FK9A 2AMGA 1TZ9A 3II1A 1EJ7L 2V5KA 2PDBA 4NNCA 1ZB5A 1ME9A 2R82A 3L4VA 4HSNA 2DH2A 3DG7A 5BMXA 3W7LA 4IIHA 4HD5A 5T91A 5AHMA 3CAVA 1UBSA 3QGVA 3K4WA 4KESA 5AYIA 5IM51 4CCZA 4JTEA 4Q33A 2BOEX 3VZZA 3P93A 1PAMA 3AUOA 2JBMA 4FI4A 3CUHA 4GD0A 3IJDA 1RJRA 2O9TA 4AZIA 3SUUA 1VJIA 3PJXA 4C6KA 3H2FA 1TJ0A 1EX1A 2PURA 1KTNA 4GY7A 4XD4A 2J77A 4DPPA 4PL1A 1WDDA 5M17A 3NM3A 4LYKA 3H26A 2WKJA 3T2OA 4B5VA 1D7KA 3OVQA 4DBDA 1O5XA 4JN6A 1G94A 1LRQA 5FL0A 1P6WA 3SCTA 5I09A 3BWWA 3R0DA 9XIAA 2W4XA 1JFXA 1LT8A 1EP2A 3CTTA 2WWCA 3D0CA 3G1XA 4YNGA 3UCCA 1HL9A 2PDFA 5HQMA 2Q09A 3NUKA 4O11A 1PYFA 1TWZA 2IXUA 1OINA 1M7JA 1ZBVA 1EDQA 3VMPA 2ACRA 1JPMA 3ALFA 2ALDA 4BZYA 3K4DA 3M5VA 3P3BA 3XISA 4DB7A 2QJJA 4KWSA 4XTDA 4FF5A 4JZ5A 1S2TA 2ZRVA 2OYKA 3MSRA 2CZEA 5FAJA 5LA1A 3WELA 3K46A 4QE1A 4AZCA 4I6VA 1SU5A 4RX0A 3WBEA 1KM2A 2XVLA 1EBGA 3INPA 5C5YA 2EEXA 4QHRA 3LLXA 4MZ8A 2DQXA 4MB5A 1MFUA 3UG4A 1QHPA 2DQWA 2Z1WA 2Q02A 1EGMA 2D2OA 1IZCA 1XDMA 4RE4A 3GC2A 4WXZA 2ZZ7A 1AZ2A 3VGBA 4PFHA 5EMUA 1UP3A 4V27A 5DCDA 3TJ4A 1JVNA 1AUSL 1XL9A 4M7SA 4TX6A 1E9ZB 4C6FA 4H9YA 3EWBX 1X98A 1DIOA 3S2NA 4QEHA 3EXSA 4M51A 3RO8A 4H9VA 3K8LA 4LAKA 3CT2A 2GUBA 3F2DA 4U28A 4LU0A 3IJLA 1MNSA 3W7EA 1O95A 1ZFJA 2ZKMX 1CT5A 2OG9A 4MYXA 1HKIA 1GYNA 1DHPA 4DWSB 2PGWA 5H91A 2INZA 1MI3A 3FSTA 5C55A 2YZ5A 3O9NA 4IUGA 3IV3A 2NW0A 3UPMA 3SUWA 4IIDA 4L9ZA 3NZ1A 2NX1A 1FCBA 2YZRA 2CBUA 4L6DA 1AL7A 1OGSA 4ZBCA 4KH2A 4HPJA 3WUEA 5IRPA 2VCBA 1DJIA 1BLIA 4K7VA 3DERA 5KTLA 4JTFA 5AN7A 5BRBA 4Z2IA 5A8OA 2VWTA 1TVLA 3FKRA 3BARA 1UHVA 3EOLA 5A6JA 4K1WA 1LL4A 1VCGA 4DUOA 2NLIA 4JOMA 5K2ZA 4Y2WA 2D0HA 4IP5A 4OBTA 3PSVA 1VJZA 4WKFA 4BR1A 1M5WA 2FFIA 4P8XA 4Z2JA 1UKTA 2ZRYA 3WBAA 4MWAA 2IW0A 1GVEA 4EAMA 5L6UA 1QT1A 4DLMA 4F0KA 3TH6A 1OD0A 5AC5A 4HHMA 1TIWA 1DOSA 3IK4A 4R5EA 4LALA 2WHKA 4AFYA 4N42A 1Z32X 4A35A 4IFKA 4FX8A 4GXWA 1W3NA 1PX3A 4FZIA 4NVTA 3TAOA 2XISA 2ZOXA 2VP8A 1AD1A 2Q8LA 1Q7QA 1ZQ5A 5LXEA 4WJXA 3NDZA 4JN7A 4NZ1A 4B2DD 2XIBA 2A6LA 4RL3A 1BVNP 3LY0A 2Y5EA 1I4NA 3IJQA 2PWUA 4NIRA 3OVGA 3QV7A 4UOQA 1Y7VA 2PMQA 3TOPA 1X39A 3PZVA 5MF5A 3RIKA 4LUSA 2DJLA 3W29A 2Y88A 5T26A 2DZVA 2WZHA 3MP5A 3DGRA 3M64A 1WV2A 3L2LA 1RXOB 4XAYA 2PDIA 5D02A 1JYVA 2YLAA 1Q4NX 4AD4A 3BJFA 1G0CA 3BLIA 3QBUA 4UBPC 1UC5A 1F05A 4D9PA 2WHLA 2V9DA 4ADTA 4HCDA 3BW3A 1E0XA 2YL9A 1XIHA 1TX0A 5FEXA 4PH6A 3WLLA 2BXYA 3B8UA 4QEEA 3I3EA 2D3LA 3O6AA 1ICSA 4DF0A 2POZA 1DV7A 4MFDA 5F2IA 3QHNA 1E1FA 3RPDA 5C70A 1V77A 4HPXA 3GH5A 3EWZA 2V69A 3TA9A 4HN4A 5DT7A 3CHEA 2O9PA 4XVDA 1LTDA 1VPXA 4H8HA 3B4YA 2X40A 4PMUA 4CGTA 1XFCA 1UJQA 3BVJA 3CMGA 4GUIA 4C91A 3HOJA 2I17A 3SECA 3I6EA 4LUTB 1L6YA 5FJIA 4IPPA 1SQ7A 2J9XA 2HQAA 3APTA 4WK9A 1ME8A 3MV01 3URAA 4MADA 1NM9A 3O3RA 2J75A 1DTUA 3O7UA 1NDYA 4WSKA 1VEPA 1E0UA 3NQ2A 2QUTA 1KCZA 3B8WA 5BU9A 1BF2A 3FDGA 4DXKA 1Z3NA 1A4LA 4GIEA 3UVIA 3EB3A 2FZNA 1AH4A 1SJAA 2FMNA 1GGOA 4UTTC 1X1OA 3OODA 2HPIA 1F07A 3WNLA 4IIBA 4QS6A 3PFRA 2YCEA 4ZZ9A 5FJPA 2ZWYA 4MZYA 1ISVA 1Z6KA 4NG3A 3ZM8A 1ZLPA 1YYAA 2YDQA 1RCQA 3RM9A 2INFA 5D2XA 1EFZA 4XSMA 2V5JA 4C6EA 1XR2A 1CPUA 4A8RA 1O12A 4NP7A 4I5UA 3H54A 3LQGA 5I3JA 1T41A 2PD9A 3GG1A 1Q5MA 3EPOA 3L65A 1UIOA 4S2CA 4GISA 4LPCA 1YDNA 2V81A 1MYRA 4A3UA 1LL6A 3FJNA 4W5ZA 3EXRA 5BXPA 1VFFA 3VPLA 3OQ8A 1UOZA 2EXOA 3WLIA 1JZ8A 1F8IA 5HWMA 2I56A 3EDJA 3QW4B 1KKOA 2ZE3A 3T44A 4O8AA 4O4VA 1QUMA 1UIPA 4S23A 4BQ5A 1XLFA 1H7OA 3PJWA 4LT9A 1HIZA 2EAWA 5EGRA 2CZVA 4J3ZA 3U2OA 3VIPA 2D1ZA 4RZ6A 1ZL1A 2XTKA 3DFPA 2PS2A 1M3UA 4OV4A 1TV2A 2JF6A 5I00A 1OX5A 2FMOA 5DO8A 5CAKA 3UF9A 1BWLA 4GXMA 3MI2A 1MDRA 4H7ZA 5C7VA 1J0IA 2VHLA 4NZ4A 4QIUA 1KQZA 4K8GA 4M80A 3EDFA 3OZPA 1J5TA 3LS9A 4MNKA 3GR7A 1W1ZA 4W86A 1S2CA 3BCFA 1SZEA 3B8DA 4HZ7A 5HNUA 3PS7A 2ZQ0A 3BK0A 3CUGA 4JYDA 2ZRXA 1FH8A 4LAOA 1Y5VA 4MB1A 4MLRA 3CAKA 4B5WA 1NWTA 3UY8A 1C7TA 4IX2A 1H1ZA 1JDFA 1JJKA 2GOUA 3N4AA 2GYIA 3VKAA 1AFSA 4JTAA 3MMUA 1I2PA 1OFBA 1SO5A 1CZ1A 1U5HA 1IGSA 4KFNA 1T6MA 1J0ZA 5U4NA 3VTRA 4WY0F 2E3ZA 1RPXA 3CHDA 1GTHA 4R7OA 4Z17A 4M7TA 3C0QA 3OBKA 2BVTA 1CENA 1UJPA 1F9CA 5K9XA 1DE6A 1M01A 5A6KA 2Q01A 1NWSA 3NL2A 1GWJA 1IWAA 3VZXA 3EPNA 3V18A 2VGGA 3T2PA 4NI3A 2G0WA 4H4IA 3LGEA 3NSMA 4PSRA 1B5TA 1KFLA 3VINA 3BOLA 4Q8OA 1WYIA 2A7RA 1KGXA 3M0LA 2D22A 3U5YA 2NWSA 4L4MA 3GTIA 3NQBA 6TAAA 4JXCA 2HE5A 1F3WA 5LIKX 1K7EA 8A3HA 1UH3A 3EB2A 3OU8A 3TUUA 4H1ZA 5FF2A 4Z1CA 3EXTA 3WMSA 1DWIM 3R25A 4N9EA 3ID7A 4XZNX 1PZ2A 1UQYA 3TWAA 3S6OA 4C90A 2EHHA 3UZZA 4LANA 4JTSA 3BTNA 1XUZA 3HURA 4UTHA 1WCGA 3R7MA 3MZNA 2HSAA 3ZOAA 4UXDA 4R7JA 6PTDA 3A4WA 5I3KA 4HMEA 1ZY9A 3RYSA 4DZHA 2JFEX 3LXBA 5C9XA 2BXZA 5HPOA 2A79A 3VNIA 3UJFA 2OQYA 2OGYA 4Q4KA 3K2GA 4NZFA 3HMCA 2PDMA 1OC6A 1DJNA 1FWDC 5J5RA 3URQA 3VD7A 1GNXA 2QV5A 2PAJA 3B8VA 2QJIA 5EFDA 1QI3A 1ZALA 3IACA 3M6DA 3SCQA 3KBWA 4B9YA 3TYBA 1F6KA 3WNOA 1PSCA 2YDSA 4PZVA 1PIFA 1XUUA 5E0FA 1ALDA 3E2QA 3WLTA 2OEJA 3W6LA 1R9ZA 3P0XA 3KL5A 4QITA 4FNSA 1KKRA 4PTMA 3CQKA 3TROA 1ZPTA 3WNNA 3CPUA 5MKGA 3S9IA 5HR6A 1PYMA 3MCOA 2DP3A 3OLDA 4NRRA 1YDVA 1X7FA 3POHA 1UYQA 1GVYA 4IQJA 3RJYA 5CJNA 4J5NA 1D9EA 4UMAA 1V03A 4WHBA 4MNJA 4XZIA 1QW8A 5C2CA 3DFOA 4ZSTA 3BLEA 4HSHA 2VCAA 1NDVA 2ISFA 4JDYA 1B2YA 1S2VA 1JDDA 4RZ5A 4MMWA 2PLJA 4HU8A 3SRDA 5U7SA 4ONVA 4HNOA 3KBMA 4HPNA 3WD0A 5CBBA 4HHLA 4FP1A 4LUYA 4HK6A 4EOUA 1V3HA 5HDRA 2PU0A 4OFCA 1LROA 1N7KA 2OZ3A 3H2EA 3W1TA 5D9PA 5D2WA 4EWJA 1QNQA 1F3XA 3UQNA 4L56A 4MTVA 1W17A 3MUCA 1IEVA 1XDJA 1W2PA 5CLTA 1J96A 2CHOA 5DANA 3QJAA 4QG9A 3UZWA 4KF1A 3B05A 3L23A 5H8PA 4GKLA 1VC4A 3BUVA 4DJEA 3E9AA 3I10A 2E5DA 3UXIA 5A6LA 3GYCA 2VELA 1KXHA 3WDIA 2QCMA 5DLCA 3B40A 1X1NA 2DZSA 3OGSA 4OUIA 1KFJA 1BEUA 4AC1X 2Z2BA 4F9DA 4DYKA 2A6NA 2BV9A 1P5BA 4J2PA 1JCNA 5CGQA 3IWPA 4PMXA 4X63A 2VEGA 3C4UA 2GDQA 4ZQCA 5BZAA 1UD3A 1N82A 1FWEC 1OB0A 1ZJAA 2X0YA 4REQB 3LBCA 2QEZA 1FH9A 2QS8A 4EANA 1XIMA 4I3GA 1LWIA 2PDXA 4KW2A 3TU9A 4GIRA 1PTGA 3O63A 4MY9A 2BY1A 3R13A 1BG4A 2E6FA 2R91A 4FXJA 1A50A 1M04A 3NURA 1H7NA 3Q58A 3IAPA 4OWGA 3KBJA 2VEIA 1A5MC 2GVLA 1Q85A 3BGGA 4C1KA 4J27A 2I5IA 4PYSA 4QTGA 3MO4A 3KWXA 1UQZA 2QYGA 3CTLA 4J7RA 4JNZA 3WQWA 3SY5A 3M9YA 3UGVA 3GU1A 3WF0A 1RLDA 1GKRA 5HINA 4DN1A 3NO3A 1G7UA 1XLCA 1EL3A 1GVIA 1EOMA 2CKRA 3PUGA 2D2JA 4O54A 2O4QA 2J24A 2PI6A 1H1YA 5FA5A 3AXMA 3R1ZA 1FQ0A 2PP0A 3UJ2A 2ZX8A 3USZA 2VJXA 1EIBA 3G1AA 5EMYA 4JHOA 3KRZA 1I2NA 3EGJA 4GBDA 3UJSA 4QX4A 1GZJA 4B16A 1QK0A 3HPSA 3WLHA 1HZYA 3GDLA 3UERA 3LBMA 4IF2A 4JCLA 3T0TA 1A53A 2J4GA 1TWIA 3IEBA 1GTEA 3LV6A 4A05A 3C5QA 1HFBA 3W7CA 4RV3A 1CLKA 1W2VA 1XIGA 4L4OA 2OWWA 3PTQA 3FFSA 1C7SA 2IKGA 1TCMA 3ALGA 4UB9A 5A8MA 1PDZA 2CLFA 1DPMA 3TP4A 2DZPA 3FHQA 3RN6A 3MTWA 1KD0A 1NEYA 4XO6A 2WSPA 5AYBA 1S5NA 5HULA 3UP8A 1EKOA 3VGGA 1B3ZA 4I7UA 5A3HA 3HPZA 2WW5A 3I65A 3GNRA 4D6DA 1ME7A 1UWIA 3I4EA 1F6PA 3VAVA 4UTLA 2CLHA 2BY3A 3BV7A 3GDBA 2VT0A 3ABQA 1LRNA 2PFHA 2YBVA 1JR1A 3WQ8A 1O68A 4AWEA 3S0CA 3KL3A 1OF6A 2QUVA 2DVTA 3M7SA 4GYKA 3VIGA 3W2MA 3ES8A 4A2SA 4JQAA 3I6RA 3CZLA 3GTFA 3DIPA 4CVWA 5AHFA 3NZPA 1US2A 1W56A 1CXLA 1ZAHA 1NY1A 2ZA1A 5AC6A 1GQIA 1XP3A 3GBDA 2D2GA 3W7JA 2OWCA 3S6TA 2AAMA 2DVXA 1RBLA 4WRHA 2GVYA 3BLKA 1JI2A 3N9SA 4C5YA 5B7YA 2Y85A 3I4KA 3SCRA 2PGRA 3PR2A 5ABEA 4WXYA 3VNYA 1PX8A 4JFTA 1W32A 2XDFA 2OZ8A 3LK6A 2EGZA 2DSVA 4HT3A 5HJLA 4ASTA 4ML4A 4F2TA 3HTWA 1UWSA 2RJHA 3QH2A 2PDQA 1V6XA 1VAHA 2ICSA 4HNCA 1D2KA 3VILA 1POJA 3N6QA 1WX0A 1OIFA 1UKSA 2X42A 3W7PA 3UXLA 2X16A 4BJHA 3VM7A 1WE5A 4H8VA 1ONEA 3S1XA 2Y8UA 1ZENA 1KFBA 1XM3A 5BU6A 3SGUA 2CWNA 1TA3A 1CLXA 3NEVA 2WQPA 4GCXA 4BF7A 1JCJA 4QDPA 3ANUA 1YBQB 1NP2A 4HK7A 1E4LA 4O0KA 2WAGA 4BEUA 1PWMA 3O15A 2BS9A 5H1WA 2YYTA 1SO6A 3QLLA 3BZJA 4RJEA 4C6BA 1XRVA 3CV2A 4CNUA 1JF5A 3B04A 2V6AA 1W5NA 1VQTA 3WL1A 2VUNA 4OOZA 3F5LA 5H8MA 5CPNA 1RK6A 1EEPA 4M5PA 2QV4A 3MZ2A 1UR1A 2I7GA 4IP7A 3P14A 3U2EA 3V4BA 3A3WA 3D5HA 2NXIA 3KUMA 4OU1A 2AGTA 2DSUA 4DJDD 3GNOA 4GG9A 3HB9A 2GVEA 4BA0A 2ZADA 4XQ6A 2NVDA 4K7YA 3RR1A 1PEZA 2WJZA 4GINA 1GHSA 5HJYA 1E9LA 4B3KA 4DO6A 1XKJA 1XYFA 3FA5A 4H19A 2HVNA 3PBUA 2FTYA 1MRAA 2PWEA 5AB3A 2XVNA 3QFWA 3KAOA 4CQAA 4L9XA 4Q8PA 3IIXA 3VC6A 4Q8MA 4IIGA 3NNTA 3M5XA 3ZVHA 3AHZA 2HMCA 5ABFA 3FHAA 2WMIA 4HVXA 3QC0A 4XD5A 1H7WA 1RR2A 1A0CA 4LVGA 5LSMA 2XM2A 3VABA 2DIEA 2I9EA 4M24A 1JQVA 3LX9A 4UOZA 5FJRA 3PB2A 5C9ZA 1QHZA 4O0ZA 4NAFA 3F2CA 2O55A 1TZ7A 4IISA 2OWXA 2WMHA 1VRXA 5ABGA 5HBFA 3ZSSA 3W81A 2FVKA 1KTBA 2Q8ZA 4OUEA 2A3BA 3WK0A 2ANUA 2GSJA 4OIFA 4I9MA 2I5QA 1QFEA 3L7RA 3IVSA 3PF3A 3UR7A 5D37A 1BWVA 2W67A 3BAJA 4NL1A 2JK2A 1REQB 1YXCA 2YCKX 2VC6A 4IJCA 3F03K 2OO6A 1BQGA 3DKLA 1OFQA 1H7RA 1S3TC 1BVZA 4M82A 2JGYA 1JF6A 3T07A 2QCLA 1Z44A 2RGMA 4GIYA 3BAIA 1JEZA 1TPUA 2IPJA 4JDBA 4UQCA 4K2SA 9RUBA 4QG6A 3RO6A 3U7VA 2VD8A 1O66A 4I90A 3Q37A 1O5QA 4AD1A 1FHVA 3PZOA 4AY1A 4ES4A 4O17A 3SCUA 2NQJA 3OZYA 2VFIA 2QMJA 3NAVA 3KVMA 4H6RA 4DWSC 2VRQA 3WFZA 1GJPA 4AZ5A 2DZBA 5AZ0A 2I14A 5EU9A 2R1MA 3LBOA 4PEKA 3PUDA 3TONA 1K8CA 2HZGA 3JW7A 3L4UA 1OM0A 4GUJA 4XISA 2D23A 2XFFA 3A47A 1W9UA 2O0TA 4UNIA 5DBTA 5F2LA 2RFGA 1Q66A 4U5KA 1PKYA 3GDMA 2WO5A 3K4AA 3EDEA 5M3WA 4G1KA 1VEOA 2Y4SA 3M0VA 1FKXA 1OEPA 3T81A 2GQ3A 1LF1A 3B8TA 1V02E 1VKFA 3UXDA 5DCEA 4AF0A 3H8AA 2YL5A 1QI0A 3WDPP 2PWHA 2JALA 3OP2A 1B0IA 3DCPA 3HU7A 3RRAA 1PB0A 1P0EA 3W7GA 4MGGA 3LCXA 3RGTA 4BWLA 1X1ZA 2OT0A 1U1UA 2CZFA 3NQGA 1PTDA 4ZO9A 4AIUA 4AHOA 1ZP4A 4J3UA 3GU2A 4LYRA 3ZR5A 2J9ZA 7TAAA 3NDOA 1K4HA 3RU8X 1EIXA 2Z7KA 1WKDA 3EMQA 1OCJA 3AIEA 1RQEA 1FY6A 1EQPA 3ARSA 3QMSA 4C6NA 4EXAA 4FX6M 4LCRA 3IV8A 2XIQA 5IFTA 3A64A 1H4PA 5HAOA 1HT6A 4FOJA 2J7DA 8TIMA 4NI8A 3TV8A 3DG6A 3G1VA 2Z0IA 3P6LA 4NNAA 5D32A 1TTIA 3N15A 1Q45A 4NHVA 3LUTA 1J5SA 1E72M 3L5MA 4F0RA 5D04C 2NQ5A 4OOUA 2Y0FA 1E4MM 2PGEA 1YNPA 3P8JA 4K3ZA 3UWEA 2JEQA 3UFYA 2BHZA 2BZNA 2V0TA 3CLMA 3T9PA 4AXKA 1VIZA 2GQ8A 4Q3MA 1H51A 1W3IA 3PPGA 5RUBA 1N8IA 4ZTXA 1TPC1 3IGXA 2DT0A 2XHYA 2XN1A 2TPSA 5KEZA 4W8AA 3WD3A 1CBGA 4K39A 4IPIA 1CGUA 4AD3A 2QUUA 3OO2A 1R87A 3CBWA 3GVQA 1L6SA 1BHGA 3UZ5A 3LDVA 2UY3A 2G4FA 3U0HA 1V0KA 3R8RA 5FD0A 1ISXA 2BB0A 3KWSA 3WLRA 4CEUC 3FSUA 5DXXA 3WKZA 3B9DA 2W3ZA 2PDKA 3TQVA 1LQ0A 2OLSA 1OYAA 1SSGA 4GJ1A 1J12A 3ARWA 2OMAA 3E1F1 4FO4A 2PP1A 3HG5A 1WB0A 1ZU8A 1MZHA 2WLYA 3N73A 4C6DA 1XBYA 3W7MA 3JS3A 2F8QA 3RM8A 4L1XA 4DJFC 1LDCA 3TNBA 3CPGA 4KWUA 5AC8A 4K68A 3W6MA 2G5WA 4JKLA 3IGUA 3BQ6A 4ZENA 1DKWA 1W0MA 2CLIA 1LP6A 4DXXA 1ZUAX 4HNNA 4CNSA 3HO8A 4WSJA 2VENA 2YDRA 4DWSD 3JVAA 3EOOA 4IIEA 1A4MA 3WLJA 2FYMA 4MPQA 4XKMA 3LCLA 5BYWA 4YTSA 2VEPA 1XGZA 2XN2A 1VS1A 1OCNA 4LVAA 3CWOX 2ATMA 1QO2A 4JIHA 4OTKA 4JTLA 1RQBA 2VRKA 1BG9A 3MU7A 3QLDA 2HS8A 1L2UA 4O12A 5CBIA 4XAGA 4IZGA 4ZQPA 6XIAA 1K9EA 1TVNA 2J8TA 4YU1A 1N55A 2DY3A 4PMQA 1OFOA 1KGWA 1PKNA 3W2NA 5CEWA 3VX0A 4OVXA 1DWHM 1IT7A 1MEIA 4AQLA 5FJUA 4HQVA 3VUPA 1EPXA 4DI8A 1O1HA 5LGXA 4D72A 4ICNA 5HQEA 5AOUA 4BY3A 1LYXA 4ADUA 3MUIA 5CLWA 5HXMA 1J0YA 3GHSA 2WM0A 1AZ1A 2ZRWA 2XVGA 2Y24A 5G4WA 2PWFA 3C6CA 4Q6XA 3QSTA 2QVNA 1R9YA 1MUMA 3UR2A 3EZ4A 2WSRA 3C61A 5K7JA 3GB6A 5ABFB 1JIBA 1JCTA 1K8YA 4RNFA 3ABZA 5FAGA 1XLHA 2QVHA 4KWWA 5CPLA 4W7WA 5HJXA 1VYPX 1GW9A 3IIOA 2J25A 4WDUA 3W7QA 4Z1DA 3TVAA 1WZLA 4Y6GA 3NR0A 2BFGA 2J47A 3EKGA 4ZTYA 3SURA 2Z6IA 1VBHA 1YNYA 1TSIA 4ZO7A 4HOWA 3WUBA 1R0MA 4DBEA 3BAWA 3UT0A 1P0KA 3BL3A 3Q67A 1JXJA 3C0LA 3W1NA 2V63A 4IP4A 3H2AA 3S83A 5I5RA 2P0OA 4RPPA 1FFQA 2AL1A 2OQLA 1W5QA 2YXOA 4YVPA 3QV8A 5C0QA 4R53A 1W54A 2PWDA 3B3DA 1BRLA 1V6TA 3GXTA 3KBSA 4ICCX 1ODUA 1NIUA 3E0VA 3QYQA 2XYLA 3MQTA 1YMYA 4GVGA 3P5ZA 2JGQA 3H2MA 3VOCA 4AD5A 2QCHA 4UWMA 1EGZA 4JFUA 3WLPA 3W1UA 1R85A 3STEA 3TZNA 1TPFA 4Q8VA 3OGRA 4D8AA 1XQKA 1WDSA 4J40A 4UFHA 4L61A 4ERGA 4GYJA 1ZSXA 3N2CA 2WC3A 1FCUA 1JCXA 3MWCA 3G0SA 1UZ1A 1TPB1 4ATLA 1KM5A 4G9PA 3B9EA 3S1UA 3VNJA 4Q7IA 1B1YA 2IQ0A 2F84A 1IWPA 4AHPA 3VYLA 1QOXA 2YCLB 1X8FA 5KZEA 2OX4A 4NUWA 1NARA 4UTKA 1DJWA 2RDUA 3FA4A 4IWWA 3MT1A 5A2BA 1S3HA 3QMRA 5HMFA 1US3A 1Y8BA 3QRHA 2H8XA 2PLMA 1FWWA 5GPRA 2QDGA 1I1XA 1IQ8A 1XGDA 3S9ZA 4RW3A 3QTPA 3DGBA 1NFPA 3MB9A 1FXPA 3ZIZA 1OF8A 2BDQA 3LRMA 4N9DA 3CL7A 5F1VA 4HP5A 1VFLA 2TRSA 2XSBA 3OQEA 4UFMA 4S3BA 3W88A 2EJAA 4XSLA 6REQA 4CU7A 1P1MA 2OB3A 2Y89A 3VVGA 3CYVA 2DZXA 5A6AA 3O6CA 1EC7A 1M1BA 3HPFA 3GFXA 5D8ZA 3BICA 1DJGA 5JIWA 1RZMA 3EA1A 4O14A 3N9KA 3ZR6A 3LEPA 3PPHA 3UG8A 5I07A 2J8GA 4H2HA 4DO7A 3TN3A 2YW3A 1Q6QA 2ZUWA 1TMQA 1XICA 2OODA 1XLMA 3SQSA 3H22A 1QU4A 2D3NA 3F1QA 3VZYA 3CIVA 3L5LA 3WLSA 3RJXA 5CPTA 1E40A 4ZVJA 3V16A 2XH0A 4Q8UA 3L12A 2PDJA 2X09A 1I2OA 1YEYA 2G3FA 1IEWA 5FESA 1XD0A 1CDGA 2VGFA 3DOPA 1YTDA 4U10A 3ES7A 3UXKA 1UBPC 1RAKA 1FXQA 3WH8A 4UFIA 4X9SA 2A3HA 3B0YA 3OIXA 3CEUA 2VOTA 4LY4A 1KTCA 3EA3A 3H23A 2PBGA 1VBGA 3BG3A 2J7EA 4JL1A 3VKKA 4V1YA 3UZJA 3V5FA 4WZHA 2FPYA 1EP1A 5D8WA 3HQOA 2Z6JA 3W24A 3W1XA 4PULA 3GUGA 1NAL1 3AWOA 3AHXA 2Z25A 3OHMB 1E9YB 3WK2A 4ZQRA 1EXBA 3MP3A 4GZJA 1KR1A 1R7AA 3MHGA 3CQ0A 2ZXQA 5A8PA 3C8FA 4R34A 3KCLA 3H2CA 2ZC1A 1QWGA 2C0HA 4GBUA 4W85A 4KETA 1WUFA 5HQLA 4S3AA 3HPXA 3TMLA 5H6HA 3TC7A 3V0SA 4Z2LA 1CNVA 4ACYA 3E2SA 2ABBA 4CQCA 4MB4A 1UR8A 5CQ1A 1DIDA 3DEQA 5G1MA 4Y9NA 3W9ZA 3LTSA 1XISA 1R5YA 3NQEA 2RUSA 3A6OA 4RNHA 4HN8A 1HKVA 4ROPA 4CCDA 1BTCA 3WUFA 3KBNA 3A9IA 1FP8A 4FMVA 2V5BA 3GQYA 4HTBA 1Q6LA 4M0XA 1ZBKA 2WZMA 2BVYA 4ACZA 1QATA 2VFHA 2QPUA 3RU6A 2O92A 2Q71A 3IUHA 4HNVA 5I24A 2OYMA 1ZGDA 5BCAA 8XIMA 3C3UA 4GNJA 3W22A 5D2VA 1EA0A 1E6RA 4XBJA 4J9JA 1U5JA 3EYPA 5A8NA 1W9DM 4XD3A 1GOIA 1UZDA 3V3WA 1NFBA 4C6JA 2VD9A 2IPWA 3KLLA 1UKQA 1U1HA 2FHCA 2ISSA 5JH2A 5CPQA 4CD7A 2FDMA 1QI2A 3VNKA 1BQCA 3F7JA 3RRXA 1ESWA 3GSMA 3WF2A 3M5ZA 2F7FA 2WKLA 3W85A 3NL6A 1YNQA 2ZZ4A 3H4XA 4HU4A 4IMFA 4IPJA 3K8MA 3BDKA 3O16A 4RLIA 4DF1A 4ALDA 2V5CA 1XIFA 1F6YA 2HBXA 3ITVA 3BSHA 1QCWA 1YXYA 4A3QA 4LC6A 3KW3A 1P48A 1WDWA 4F0SA 4BQ4A 4MJ2A 1EP3A 2GK1A 3Q45A 4QP0A 5T9CE 4PMVA 3CQIA 1V3IA 3TJIA 3FEQA 4C1LA 2FH8A 5CAHA 3WQ5A 1XYZA 4FNUA 1J9YA 4PUEA 3F5JA 4OECA 3IVTA 3WDQA 3HFTA 3TCSA 1WKEA 4JTKA 2VX4A 4LX4A 1V08A 1QVBA 3D6NA 1O5RA 1DQWA 3WD2A 4GI9A 3G1RA 1H11A 1Q2RA 5EFFA 4JTJA 4GOAA 3U2CA 2GJRA 3W70A 4HU3A 3ECQA 3I7RA 4D6GA 3FJLA 1L9WA 1ZZMA 1AG1O 1M7OA 1HKWA 1R47A 5BMWA 3KP0A 2A1YA 4C1NB 3PZIA 2YBTA 5FOOA 3KOWA 4S38A 3LD5A 4KS0A 4RZ4A 4XZHA 2EQDA 3WH7A 1TE6A 3AICA 4LYPA 4UQAA 3L4YA 1J4EA 2OOGA 5D33A 3HZ3A 1G9HA 3QXBA 4GZ7A 3WNMA 3EB4A 2XVPA 3M0JA 1MEHA 2OEKA 2IKHA 3LA4A 3W72A 1EWEA 2RKXA 3UWZA 3AIUA 2YLLA 3WLKX 4GVHA 4KWVA 2RDTA 1NOUA 1R30A 2XFWA 3REQB 3W7DA 3NG3A 5D2YA 4HA4A 3LPGA 4G56A 1Z8AA 1XYCA 2JIWA 1H63A 5JBEA 1I75A 4N9CA 1J01A 4JFSA 3OB8A 3B0UX 3P2VA 4GJIA 2ZICA 1FVPA 1W9VA 3UZYA 5B80A 4UQ9A 4Y96A 3Q2DA 2Y7FA 3FAWA 2ABAA 3W2JA 2GGJA 1WOAA 1VR6A 2DT2A 2ZA2A 3AYSA 3O0FA 3S1WA 1B54A 4PFMA 1A5NC 1TPEA 3VKCA 3HMJG 5AC4A 1EHNA 3SZ8A 4TXEA 1VYSX 1B4KA 5A8GA 3ERPA 1EB3A 1F4AA 4GX9A 1TR1A 1H2JA 3DC0A 3AWNA 3KS6A 3GX9A 4PBEA 3UA4A 4HNLA 5FF4A 5LHFA 1V51A 3G1SA 3TK7A 4OKDA 4O1EA 4BF5A 2GUYA 2PCQA 4H3DA 3F4CA 4NU7A 1OG6A 3GXDA 4HA0A 1EJWC 1XLDA 3LI0A 3TTOA 1SO4A 3UPWA 5C6MA 4PUKA 2VTFA 2YXGA 3EWXA 1JULA 1D3GA 2BOGX 2X1TA 3UA3A 4GK8A 3QPZA 4Q4PA 1UUQA 1MXGA 4JN8A 1J0JA 3DFNA 1SSDA 1U33A 1KQYA 3BAKA 3U4FA 3O05A 3S5YA 2H8ZA 4V15A 4DELA 2YW4A 4WCJA 1LQAA 3LHZA 1MVYA 1BPLB 4YHEA 1S2AA 1ZAJA 4QJ3B 1SMAA 3WBYA 1UWUA 3AHVA 1QDSA 4CN6A 4GH1A 2E8ZA 2E1WA 1SZGA 2C1IA 3I7QA 5CC7A 3OLEA 1B4EA 1IR2A 1E1EA 3M0YA 2YFOA 4LH8A 2J78A 5I23A 2P8BA 3SO7A 4UQBA 3IK2A 4LGXA 4DYEA 3GM8A 3D3AA 1CXEA 2BLEA 1CXFA 2PODA 2CLOA 3UY7A 1H3GA 4AHQA 1V0NA 2QCGA 2XH2A 2GPTA 4WY0B 5J04A 4Q22A 4I7VA 4PUMA 5CG0A 3W76A 4DF2A 3SW6A 1L6WA 2DPEA 3ARXA 3WDJA 1ADOA 2FB2A 2OEMA 3GUWA 2I57A 1HGWA 3WBXA 4J28A 2ESCA 2YA1A 1NTHA 2WHJA 3G1FA 4L6HA 4NX5A 3RUBL 1KCKA 4I9TA 3WK1A 1TJRA 2WZTA 2P88A 1FCQA 1AD4A 3P67A 2GGHA 4ERIA 3PP7A 2YL6A 1WPCA 4RZBA 2Z1BA 2WJFA 4R27A 3OW1A 4NJIA 1TQJA 2QUNA 4GZEA 1AMKA 5C2XA 4L80A 2FJKA 3P8IA 3G6MA 4LBSA 1CWYA 3GDTA 2WHMA 2DJXA 2VZOA 3FCPA 1BXNA 1HKMA 4IH3A 3SRHA 1UR3M 3THDA 3N25A 2VR2A 4UIOA 5DT5A 4AEOA 1AK5A 4M1BA 4WR3A 2BGNE 4Z2KA 3C2EA 3MSGA 3AHTA 1G1YA 2BWGA 2ALRA 5G5IA 3I7SA 2OYLA 2D24A 3G8EA 3VOFA 5HMSA 1NFGA 1WOBA 3CHCA 2C71A 1ONRA 1IT8A 3W7KA 4AIEA 5TD4A 3ZLFA 4IICA 1GG0A 2J79A 1EOKA 1QPRA 4XIAA 2C8NA 2Y5SA 4BI6A 5LIYX 2XSXA 3V5CA 4IMAA 3HG4A 4ZODA 4E5TA 3SFKA 2DW7A 3KL0A 3ITLA 4F48A 3OGVA 2KZHA 1SM9A 1FDZA 4DWSA 1AW5A 2QT3A 3TQKA 1NDWA 3B4UA 1XCXA 4XKYB 2ZX7A 5GJPA 4FALA 3N17A 1A0DA 3KBVA 1YADA 4AEEA 3CZGA 2C7FA 1MXDA 4I5XA 2QCFA 1JRBA 3OA3A 2ZFAA 4QQ3A 2DU2A 2QIWA 2CNCA 5C7HA 1LG2A 4K38A 1IXOA 1R38A 4R9OA 2Q8XA 3MI6A 3T7VA 2QR6A 1Q63A 2J6XA 3L2IA 2GSHA 1JAEA 3STPA 1AL8A 3GG0A 3NTYA 4EE9A 4XAZA 1FWIC 3C0SA 4Y9OA 2NZLA 3UD6A 3LLDA 1PZ0A 1J8VA 3AXIA 1H41A 4NF7A 2Z1VA 3ITGA 4AY7A 4GFIA 3W23A 3AXXA 2G3NA 3FJ6A 2YB1A 1JPKA 1XYLA 5BXSA 3R6IA 5G1TA 5FF7A 1K03A 1GOOA 1H5YA 5DN1A 3PAOA 4JTGA 3N11A 1AMYA 3NCOA 3NM1A 2QIIA 1E6SM 4GNVA 1UOKA 4LS0A 1E4NA 2WJEA 2UZ9A 1KW1A 4GRSA 1K6WA 1KFCA 1CB7B 3RITA 3CHFA 4LC8A 1JZ5A 3EA2A 3R5EA 5IXEA 3IVUA 5DCBA 4YN5A 1UUMA 4JHZA 1PHQA 3ZS4A 3T42A 4JEJA 3H2OA 1V3JA 2J13A 3EMCA 5DMLA 2PTZA 2WNZA 3NA8A 2DUAA 1HVQA 4L5ZA 1EJUC 3W74A 1EHAA 1JZ4A 1IR1A 1UWTA 4IGSA 1IXQA 1CGYA 3BQ5A 5FJJA 3GG8A 4LSBA 1YTEA 3PM6A 3VC5A 2WNNA 3QGAC 1B9ZA 4AXNA 3NPXA 4UR8A 1E56A 2KAUC 3UWYA 1WBHA 2PGFA 1C8YA 3WQOA 1JUKA 3E74A 2NVCA 3SY1A 1IGWA 2QCDB 2B7NA 4PTXA 4MG4A 1ZCOA 4LTSA 4DM1A 3PUOA 3FAXA 3PZUA 2DUXA 2ZUUA 3UNDA 5G2IA 1M53A 1H50A 2YPIA 3M0KA 5JVLA 1UW9A 1KBBA 3A23A 3W84A 4PCNA 2GFTA 2JKEA 2ZA3A 4XBSA 1VB9A 4ORMA 3CZ8A 3OHIA 4N4PA 4I7WA 3ENLA 3IUIA 5H2ZA 3HPAA 3IJ6A 1XLAA 4I9JA 4AD2A 3GC4A 4CU8A 3SDOA 1JPIA 3AOFA 7A3HA 4PODA 1TV4A 2QJNA 1EYWA 4LUTA 3ANYA 2V30A 3GHRA 1D8WA 3CZEA