4YVXA

Crystal structure of akr1c3 complexed with glimepiride
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4yvxA00
2IPWA 2BP1A 4XK2A 5C7HA 2HDJA 3QKZA 5AZ1A 1C9WA 4QX4A 2ACSA 4LAZA 2NVCA 3M64A 3GHUA 2WZMA 4JTRA 4XZNX 1JEZA 4WDTA 3DN5A 4FA3A 3V36A 4PR4A 4HBKA 2C91A 3V0UA 2IPFA 4PRTA 3GUGA 2FZ8A 2HEJA 2INEA 3COTA 3R7MA 3D3FA 3LQGA 4YS1A 4DBUA 4QXIA 3LZ3A 5LIKX 4GA8A 4YVPA 1PZ1A 3G1RA 4JQ2A 4Q3MA 4FZIA 2DUXA 3BUVA 1US0A 3EB3A 5HNTA 1EF3A 1X96A 1ADSA 2ALRA 1J96A 2PDCA 2PZNA 1AZ1A 1AH3A 1A80A 1S2CA 1VP5A 4LBSA 3S3GA 3ONCA 3BURA 3LEPA 4QBXA 4JTQA 2FZBA 2FVLA 4XZHA 1YE4A 1EKOA 1M9HA 1Z89A 1IHIA 4IJCA 1X98A 1LQAA 4GCAA 1GVEA 2F2KA 2I17A 1PWLA 1RALA 3WCZA 4YVXA 2IS7A 3DOPA 4IJRA 1S2AA 2PD5A 2PDMA 1XJBA 4JQ3A 3WG6A 2IKGA 4EXBA 2BGSA 3UGRA 3H4GA 3LN3A 3O3RA 3FX4A 4DBSA 4JIRA 3WBXA 4GACA 2PDKA 2FZ9A 1YE6A 3UWEA 3LQLA 2IPJA 3KRBA 2ACQA 1MRQA 2PDNA 1T41A 1Z8AA 2I16A 4R9OA 2PDYA 5LIUX 3O0KA 1Q5MA 2PEVA 2HE5A 1RY8A 4LB4A 2HE8A 3CV7A 5JH1A 3UP8A 4I5XA 1K8CA 3GHRA 1AFSA 4LBRA 4JIIX 5HNUA 3R6IA 2PD9A 4YU1A 1EL3A 2PDQA 3Q65A 2QXWA 1FRBA 1RY0A 1XF0A 1Q13A 2PDIA 5LIXX 4ASTA 3LUTA 3Q67A 2PDFA 4IGSA 2ISFA 4GIEA 2IQ0A 4GABA 3CAVA 2IQDA 1S1RA 3M0IA 1QWKA 2AGTA 3R8HA 3LZ5A 5KETA 4XAPA 1ZGDA 3MB9A 1AZ2A 1ZUAX 3G5EA 3CASA 3F7JA 4LAUA 2BGQA 3BV7A 3LENA 4Q7BA 3C3UA 3M4HA 4DZ5A 3LD5A 2ACRA 4JTAA 1T40A 4OTKA 4ICCX 2PFHA 3R58A 3VXGA 4H7CA 3N6QA 4JIHA 5AZ0A 3RX4A 1X97A 2PDXA 3CMFA 1VBJA 2PDGA 4G5DA 1UR3M 3WBWA 1YNPA 2FZDA 5DANA 2IKHA 3P2VA 4NKCA 3V0TA 4AUBA 1S1PA 2IPGA 4PRRA 2PDWA 4FALA 2PDPA 2F38A 1PYFA 3GHTA 2R24A 2HV5A 2DV0A 1HW6A 2P5NA 1LWIA 2VDGA 3ONBA 4JQAA 1MI3A 4JTDA 4JTCA 2FGBA 3FJNA 4XZMX 3UZXA 2PDLA 5LIYX 4F40A 4XZLX 2PDJA 3R8GA 4PUUA 4XO6A 1OG6A 4QR6A 4WEVX 4XVDA 4PUWA 2IKJA 3EB4A 2CLPA 1PZ0A 1HQTA 4PMJA 3U2CA 4DBWA 4XO7A 4MHBA 4JQ1A 4FAMA 4XVEA 4WDWA 1MZRA 2PDHA 5HA7A 1SM9A 4XZIA 1ZQ5A 3NTYA 3ERPA 2IKIA 3V0SA 4L1XA 3UZZA 4RPQA 2HVNA 2J8TA 3MC5A 3EAUA 1AH0A 3BCJA 3UFYA 3LNMA 3GHSA 1ZSXA 3N2TA 1PWMA 4GQ0A 1QRQA 1R38A 2PDUA 3RX3A 4ZFCA 3WBYA 1IEIA 3T42A 3RX2A 1EXBA 4GQGA 2INZA 4WDXA 2DUZA 3CAQA 3UZYA 5JH2A 1AH4A 2A79A 3B3DA 4HMNA 1YNQA 2PF8A 3LBOA 3CV6A 3UG8A 4JQ4A 1XGDA 4YVVA 4L1WA 1Z9AA 2PDBA 3R94A 4H8NA 3H7RA 4WDUA 5M2FX 2R9RA 3V35A 4WRHA 3H7UA 4EXAA 2ACUA 2HVOA 3UYIA 3UZWA 5LIWX 3R43A 4WGHA 2WZTA 4LB3A 1Z3NA 2NVDA
chains in the Genus database with same CATH superfamily
3R25A 5C7HA 3GFZA 5CAHA 5BRQA 3ZYZA 1XLCA 2H8XA 2J47A 4B16A 4NZ3A 3KVMA 2F6KA 1NWUA 2DUAA 1POJA 3OYZA 3PBGA 2CBIA 3TW9A 4I9JA 3RILA 1O1ZA 5D8ZA 2XIBA 4ORMA 4B91A 1DYSA 3BW3A 2C91A 3NZGA 1CGUA 3PZQA 2C18A 2XINA 2XH4A 2YDAA 4GUHA 2Z1KA 2VEIA 1W8SA 3RGTA 5DQPA 3WUGA 4A05A 2BFGA 4A3QA 5IFPA 1BGAA 3B0VC 2PWGA 4HCHA 5MF5A 3B0XA 2J7DA 1FDJA 4KKXA 4A22A 3L4XA 4WIWA 3ISIX 5HWMA 4FXSA 1AJ0A 4U31A 1ITUA 4YYCA 2JKAA 2GK1A 1S2CA 4AY8A 4LPCA 1FH7A 2VL4A 3S3GA 3OVQA 3EWYA 4HZMA 3R0KA 3A5FA 4I5UA 2W63A 3WJZA 3ARQA 1EKOA 1Z89A 2E25A 5HQEA 4WOZA 1LL7A 3PVFA 1WKFA 1C91A 4JKLA 3P80A 4AWSA 1P0DA 3C5QA 4XBKA 4PE8A 5HPOA 1QI2A 1B3VA 1UD4A 2E6AA 3PNZA 2FH6A 8RUCA 1ECQA 2WC7A 1SW0A 2IS7A 2PD5A 1J6OA 4H8UA 3W6MA 1UBSA 3H21A 3J7HA 3AMLA 2OZ8A 1JXKA 4DF2A 2RUSA 2G37A 3WSUA 2FVMA 3PBYA 6REQA 3TH6A 4MM1A 2J66A 4BY3A 4R85A 4PMYA 5IHRA 1BXNA 2Z2UA 3CZEA 4C6IA 4DEFA 1FOBA 1XX1A 3I3EA 2YLLA 1SW3A 1L0PA 4HPXA 2WNZA 2ACQA 2XVGA 2ZYFA 3QGVA 3GYCA 1B2YA 5GJPA 5E0FA 1T0OA 2PRLA 4IUOA 2C1HA 1VFHA 3LLXA 2YDQA 4L6OA 1J0JA 4MJZA 1ZP4A 5EU9A 2Z29A 2E6FA 1O12A 2UY5A 4QEEA 1UWQA 4DRSA 1KCZA 3N6JA 3TJXA 3W28A 2OQLA 1UBPC 2H6RA 1PTDA 3CZKA 5D9MA 3IGSA 3WLKX 3SRKA 5K4ZA 2VTFA 1JDCA 2OOGA 4FR1A 2I5GA 1UR2A 2PDFA 3HF3A 3VX0A 5C9RA 1SQ7A 1HF6A 2GSJA 3RR1A 3ZVHA 4YTRA 1S5TA 5EMKA 1TWWA 1CXLA 1FHDA 2HXUA 4B5TA 1TVLA 4F9DA 2Q8LA 3VD5A 2ZUSA 2DT2A 5AYIA 3BAJA 3S42A 3KL5A 4Y7EA 2V82A 1KFWA 4KWVA 3WD1A 2VENA 1JUEA 1H7RA 3IPWA 1AMKA 1OFDA 2R1NA 3AHZA 2EG7A 5T8GA 3KLKA 1UQZA 1YPXA 1V3JA 2PLKA 5FL1A 1T40A 4OTKA 1KFCA 2Y7EA 3GLCA 5FEWA 2HJPA 1W17A 2DT0A 4JGDA 3VXGA 4S3GA 1WXYA 4MOZA 2ZX8A 4E5TA 3VE7A 1WCGA 1WXZA 3R0DA 4LBUA 3B4YA 1EWEA 3NL5A 1JULA 1BXCA 1FFQA 1Z42A 4CUCA 1CXIA 1XRFA 3MMWA 3BXWA 3O07A 5XIMA 4JHZA 3WQEA 4OV9A 4AWTA 2P5NA 1ZJBA 3A4JA 4INFA 3WLRA 5C2XA 3C8NA 3ZR5A 2JFEX 3UXDA 4BF5A 3HBLA 2JF6A 3FVDA 2OVLA 3WL0A 2WHMA 3E0IA 1ZRQA 1VRDA 2FTPA 3TFCA 1PV8A 2BXYA 2E1WA 4NAFB 3W37A 4PUUA 3LTPA 3NZ1A 1G01A 1IGSA 4DB7A 1AMYA 4XVDA 4YNGA 4REQA 1E1CB 4N4QA 3E6EA 1J2BA 4LALA 2WMIB 3LRMA 4IP4A 5LA2A 2WBGA 1MZRA 2NQLA 2VX6A 2QDGA 3LCHA 5K9CA 2VZVA 2E4TA 3TW7A 2D2JA 3NTYA 5DF0A 1EJVC 2VELA 2EPKX 4Z2IA 2JALA 4R7JA 4QG8A 3CIWA 1ISVA 1H7WA 2J8TA 3VMOA 2EG6A 1RR2A 3QSRA 1E4IA 2C15A 4Y9NA 3FYPA 4DAIA 4BF9A 2X7WA 4GUIA 4M1BA 2FLIA 3W76A 3BJSA 2DY3A 3WQ8A 2V67A 3C61A 1OWQA 3TNBA 4BFAA 2F84A 5CC5A 3WUEA 3E3HA 3O6YX 3FN9A 1U2YA 4H1ZA 2WHLA 3JVAA 3CV6A 3QMRA 4GXPA 3VGFA 5EPDA 4AVNA 5F4XA 4A6GA 5CG0A 4ZSTA 1XGDA 1Y65A 3GZAA 3BW4A 3N2CA 2PF0A 1Z9AA 4PCPA 1X6NA 5DELA 4GYJA 3N04A 1QPQA 3WNLA 1PIFA 1RBOB 3W7EA 5JVLA 1YRRA 1N2VA 1ODUA 1V0MA 1VHCA 1ZU8A 2TMDA 2VOMA 3VKCA 2UY2A 1AA1B 2Z1WA 4WD0A 5AZ1A 4DWSD 2ZZ2A 4U3AA 1W1B1 1V3KA 5AVNA 3TNOA 1EF2A 2J7CA 3VDGA 4E2OA 3LM3A 4C1LA 3FJLA 2WV8A 4NSBA 4JN8A 3VDHA 1IYXA 1KRBC 1J01A 1JEZA 3QEZA 3PAJA 2NUWA 2Z24A 2Q3OA 4S1FA 3BAWA 3D3FA 3FXGA 3MQTA 5PTDA 1YBQB 3RCMA 2NUYA 3KM8A 3VYLA 5HJYA 4PGLA 3H53A 3B8DA 3EWCA 2NV9A 2XGBA 2ZKMX 4AU0A 3OPSA 4WJ8A 3RG6A 2VM8A 3MYPA 1A5NC 3LCLA 2O56A 1US0A 3EB3A 1PBGA 3GFYA 3V16A 1E1CA 5GPRA 3MI3A 3NQGA 2BB0A 2WMIA 4I90A 2WSQA 4GI4A 3MKKA 4O52A 3AS0A 4Q7IA 4O57A 2Y5JA 2FVLA 4GZEA 2Z00A 3TWBA 3RK8A 1JPHA 1TV8A 3NQMA 1TG7A 3IIPA 4CU8A 4HJWA 3VOFA 4AZBA 5JBDA 1S3TC 1JIBA 5A8NA 3T9PA 2VI0A 4L4OA 4AD4A 3SY1A 3QR0A 3GTXA 2DZSA 1EEXA 4O4VA 3U3HA 3P67A 1GOMA 7TAAA 2GOKA 2FTYA 3EOUA 2GVLA 4RXGA 3N4AA 3SCVA 3FDGA 3GXIA 3KL3A 4PULA 2OQHA 1FVPA 1EO5A 1ODZA 2GGGA 1H1NA 2ZXBA 3EDEA 3VM7A 4PBFA 3T0AA 2B4GA 4TTUA 1BYBA 3A4AA 2ATMA 3ITOA 3SCNA 4QISA 4AZ6A 1A5LC 3EX4A 1GCYA 1VCVA 1P0EA 1N8IA 2O7QA 2DQWA 4M3PA 3TOPA 1XLGA 1V3MA 3CO4A 4L7ZA 4XAYA 4JIEA 1MUWA 1K9EA 1P6CA 3BPWA 1E0TA 3VIJA 5K7JA 3KVLA 3QPEA 1YIXA 4JCMA 3BCDA 1LTDA 3V5FA 2NUXA 4O8AA 3VD7A 1KFEA 2XFRA 5J5RA 2J74A 3N15A 1G0CA 1E1EA 1RY0A 4KEMA 3K46A 1WUFA 1LLWA 3QGAC 4GCXA 3QLDA 3Q67A 5KZEA 4AIBA 4LQ1A 4H19A 1E43A 1YBQA 4KWOA 3V1PA 3FLUA 4J3VA 3NGJA 4WR3A 4R53A 4GE8A 2PBGA 1VZWA 3MB9A 1AK5A 3BOXA 3KBNA 4HNOA 1DL3A 1EC8A 2J7HA 4GKTA 3LENA 4J40A 4UNKA 2ZZ1A 4Q8MA 4M7TA 4JTAA 1T8XA 4HN8A 5FA5A 5CSRA 4MMWA 1PKNA 1HXJA 2OX1A 2FIQA 3HO8A 2B7PA 5A2BA 5HANA 3AICA 2GYIA 4Z2HA 4LUIA 3CZ8A 3GDRA 2P0OA 5I3DA 4Q8WA 1K6WA 2PTYA 3SM0A 5A6BA 2Y24A 1OSEA 4OFCA 1ISWA 1UZHA 1Y8BA 2F38A 3WDQA 3GHTA 5C7VA 2NXIA 3CUFA 3M5XA 4PMZA 3R13A 4JQAA 5T9CE 1KWKA 1NIUA 4AIUA 4JNMA 4BQ4A 5I3FA 1OCBA 3SIMA 3HURA 3GU1A 2QJIA 2D2GA 1NWTA 1TPH1 1CLKA 3AMKA 2PP3A 4ICMA 3QR3A 2PDJA 2EJ1A 2BV9A 2PSNA 2VZSA 3N6HA 3QGKC 5A6SA 4AXKA 4A8RA 1F3EA 1CIUA 2VOTA 3E0LA 4MHBA 4AXNA 4H41A 4JHMA 2E8YA 3HFTA 3OGRA 5FSEC 1IIHA 1W3KA 3QHNA 4M5PA 3NXFA 3GNOA 3K4WA 3QPYA 4GZIA 1IT0A 5CJ5A 4W8LA 4PUJA 1FWSA 1SU5A 3L12A 3FHAA 5CGMA 1KTNA 3W7HA 4XKYB 4B2DD 4EWND 1PWMA 3WLHA 1G6CA 1R38A 3HA1A 3H2FA 4LV4A 1LDCA 4G1KA 4ONVA 3BQ5A 5GJNA 3G0SA 4DWSC 4XZWA 4OECA 2YCKX 3B0YA 3P5YA 3FNDA 2VYOA 4EKJA 2FHFA 2DUZA 3S46A 1VH7A 2ISWA 1UA7A 1CEOA 3W1UA 4UR9A 2QJGA 4S3CA 3W4RA 4FOUA 1SJAA 4F4RA 1CXKA 4C65A 1MVYA 5AC7A 3VPLA 4DF1A 1HN1A 1OY0A 4RR4A 2DW6A 2Z28A 1XHGA 1EDTA 4KWWA 4HK5A 4RX0A 5G1TA 1C90A 3GR4A 1S46A 5I3JA 4K6AA 2WQDA 3P6LA 4GVFA 3RMEA 4K68A 3VGEA 1KV5A 4B5VA 1AL7A 2XGIA 2GLKA 1VFLA 1EGZA 3TV8A 1FKWA 1XYAA 3RDKA 1QK2A 2VUYA 2YOCA 1M7XA 3DZ1A 1HKJA 2GQ3A 4YTSA 3APTA 1Q66A 1EZ2A 2BVTA 3MO7A 3WQDA 5LA1A 4I3GA 5D37A 2AAAA 4DO7A 1W37A 4E8CA 3HPSA 4IPLA 1KFLA 4UTKA 2KX9A 4PMQA 2ZX9A 3WK2A 4Q7NA 1JZ4A 1XG4A 3TZNA 3RAOA 3BO9A 4HOWA 3NQ8A 4TX8A 1UC5A 3LQGA 3RLUA 3WLTA 1UWIA 4HZ8A 4DUVA 2WBKA 3FJ4A 4C6DA 2L5HA 4B3LA 2XUCA 1EJ7L 2AL2A 4FZIA 3T44A 5HNRA 4WSHA 1OG0A 4Q8OA 2GQ9A 2GQ8A 1KRCC 1K6AA 3SUVA 1X96A 2J88A 9RUBA 2MUCA 4LH8A 1P5BA 4S39A 2EEXA 3OA5A 6A3HA 2BVDA 4ZQRA 3A9IA 3BARA 4QBXA 5I03A 1EA9C 2VR2A 2H3DA 2CXEA 3DHUA 5CSUA 1QI4A 2AMGA 5I3KA 2AKMA 4IIFA 1MEIA 4CEUC 3C52A 2X16A 3UG5A 4W88A 4MPQA 4N6FA 3UXIA 3T07A 4H6KA 2NX3A 3HV8A 5EA9A 3BQ6A 1ONWA 1CENA 3UXLA 3BTNA 3DYMA 5LSMA 2QS8A 3TJ4A 3MO4A 5A6LA 3W53A 3AUJA 4GACA 1TWZA 2A2IA 3M6YA 3G1DA 1V6XA 2O0TA 3MMDA 2DZXA 2VC6A 3NO3A 3WMSA 3HQPA 3TN6A 2Y7FA 3C0LA 2BY3A 3W71A 1T41A 3MZNA 2NXHA 5I78A 3W38A 1RBAA 4LY8A 1KRMA 1Z32X 3B06A 3ENLA 3WQ5A 1KCLA 4OBSA 5CZKA 1BF6A 3KTXA 1VYRA 1AQ0A 1C93A 1MEHA 2CBVA 4JTFA 3RHGA 2NLIA 4JEJA 3OU8A 2ZZ7A 3DKJA 2VC5A 5E1QA 3H55A 2I14A 3NL3A 2E09A 4D2JA 4HPGA 4RK8A 1YDYA 1R8LA 5G4HC 3KUMA 1J8VA 2J27A 3SI9A 3LUTA 1JZ8A 4GY0A 3M41A 5HJLA 1WOAA 4KQNA 4R7WA 1NH6A 3IJDA 3M0IA 2G3IA 2BY0A 4F0LA 3T8QA 5AYYA 1FUYA 3TTYA 3PNUA 4GFIA 1ZGDA 3BSMA 4D6FA 2OZTA 2TSYA 1LYXA 4Z42C 2Z0IA 2ZXDA 5J8LA 3APGA 2J24A 3WJXA 3H12A 3FK4A 2Z6JA 4LVFA 4BEUA 4ICCX 3VU2A 2B7NA 3R58A 1KBLA 3TIMA 3W7JA 2POTA 4L9YA 7REQB 4IPPA 3M47A 3ZXWA 1X97A 3EOOA 3W1AA 5BRBA 4LEQA 1A5UA 3ARSA 3U2ZA 3OIXA 3FKKA 4ILSA 3WBWA 2F2HA 5DANA 1EO7A 4NNCA 3TYAA 1FWDC 2WNQA 2XVNA 1US2A 3LX9A 3CAWA 5KMYA 3GM8A 4RW5A 3TMLA 4NZ5A 3LLFA 4FOKA 1UR8A 3G1YA 1LL4A 4IX2A 1H41A 1B3ZA 3MCOA 1W3NA 4C60A 2W6RA 2CNCA 1DE5A 4KRZA 1FBAA 4FI4A 1IXPA 3QSTA 3WLLA 3W24A 1TV5A 1XDJA 2E68A 3W1NA 2GSEA 2Z25A 1NJJA 4GGHA 3ABOA 4DAFA 2E5DA 3ANUA 1E5NA 1HL2A 2PAJA 1TR1A 3FAXA 2CLKA 1E51A 5BW6A 1GONA 3UR5A 1E6QM 3SRFA 4JL2A 1G94A 3EB4A 1S38A 3U2CA 4ERGA 2VD8A 3E96A 2MNRA 4XO7A 5IDZA 4A3HA 1FDZA 1HKVA 1TFVA 1O7AA 3GBEA 3RLHA 4GIRA 4N42A 4EXQA 4IT1A 3RF9A 1XIMA 1XIHA 3IJ8A 1YPFA 4OGZA 4KF1A 2ZA3A 3G6MA 3RLGA 3U5UA 1E6ZA 4GGBA 4OE7A 3KTSA 2Q3RA 3FIGA 4KCTA 4IIEA 3O06A 1GQNA 1Q6EA 3RX3A 4CNTA 4D1IA 5LGXA 1W9VA 2WO5A 3CK5A 3UGVA 5A3HA 4MUPA 5IBXC 1SJCA 5FF3A 4QJ3B 1TO3A 3ARVA 3PY2A 3W87A 4L9ZA 1JDFA 1K8XA 3UETA 4CN4A 1F61A 3W88A 4JD4A 3WF2A 1M01A 1E6XM 3RRAA 1XCFA 1XLHA 3CHDA 1GUVA 3T0BA 4R5EA 5E70A 3DG6A 3DI1A 1C8VA 4URIA 4EX4A 2I1OA 1Q6FA 4XBSA 2ZRUA 4U33A 4LU0A 4MB5A 3IUDA 1EOMA 2XVKA 7REQA 4EAYA 1VC4A 2J9XA 1GJPA 5I23A 2C3ZA 4DJDD 4LB3A 1NP2A 4Y2WA 5FJOA 4W7VA 4UZSA 3DG7A 1BWKA 3UR8A 1B4EA 2POZA 1XLAA 2ACSA 4K8GA 4G8TA 3N2BA 1PS9A 1DWHM 3W6LA 5U4NA 1VFSA 5LNRA 3KHDA 4KRUA 1OX6A 4AZCB 4DYKA 3CLMA 1LBLA 1TJ2A 3VOHA 1HVQA 1OBAA 4AD2A 1ZCOA 3W6YA 1BTMA 5HXMA 4DM2A 3EMQA 3COTA 3P81A 2R91A 5JBFA 2OEJA 3UWWA 1M03A 3QTPA 4J2MA 3KWXA 3E9AA 3F2CA 4CCDA 4LY4A 2Z2BA 5DRIA 1KD0A 2TAAA 5BXPA 3QLLA 3PUOA 1AZ1A 1AH3A 4B5XA 4TUFA 3RMJA 1HP5A 1IZCA 4LBSA 2B31A 3GSMA 3S5NA 3T2PA 3BMVA 3GVRA 4C6JA 2OCZA 2LLEA 1FCBA 3DYOA 2W91A 5I3GA 3T05A 1XBVA 3OLGA 2BXZA 3RUBL 2OXNA 1N55A 4XIMA 1XKYA 2D22A 4GCAA 3L5AA 4WHBA 3TYBA 5CZ0A 1P0NA 1R0MA 2JIEA 5H8MA 2VGBA 3KOYA 3LK6A 3DOPA 3PBUA 3CS2A 4S3JA 2VX4A 3U8GA 1QTWA 2NT1A 2WLZA 1E6RA 4DN1A 2IKGA 1Q85A 2QHAA 3EKLA 4PUDA 2QIIA 3T0DA 2BG5A 4ZGYA 1KFJA 3T4WA 4CD5A 2R1KA 3K1GA 5LYRA 2VX7A 1I8JA 4C7FA 2YL5A 3BLKA 3OODA 2WB5A 1VQTA 1A3WA 3CLWA 4ZE5A 1V6WA 3GH4A 1U83A 4US5D 2I9UA 5AKQA 1HNYA 2ZUVA 3TQPA 4F9JA 3QVQA 3QH2A 4NVTA 3SQSA 3EEZA 4GC4A 1IQ8A 1GVFA 4FX7A 4MLRA 3TMQA 3WK0A 3WMBA 8A3HA 2HE8A 1DJWA 2DH3A 2AQVA 3NXLA 2JEQA 4HMCA 2PC8A 3DGRA 1V79A 3NPUA 3WEZA 4QS6A 1L8PA 4JIIX 4R7OA 5G2HA 4JEQA 5C0QA 3BV4A 2CLLA 5DCBA 2D0HA 1P1XA 1V3HA 4AZCA 1QNVA 1SR0A 5JBEA 4YN5A 1AQHA 4K7YA 5D02A 4ZSUA 4GBDA 3S2CA 4MWAD 3CWOX 2NSOA 3SRDA 4MWAE 4UTIA 4TVDA 4U3CA 1FHLA 1I2PA 3VOIA 2OPJA 1ZB5A 3C2VA 3LI1A 4JTHA 4B92A 2OSXA 2QCFA 4LCSA 4AZ5A 2E40A 4IIHA 4IQEA 8CGTA 3PB0A 1WQ5A 4D6GA 3AXHA 1EJSC 1IE7C 3WQFA 3CO8A 5CPMA 3BG9A 2XH0A 3MPGA 1HP4A 1U5JA 3N6QA 3WDRA 3QR1A 4H04A 3PANA 1DJNA 1WYIA 1PCWA 2C79A 3QV8A 3UG4A 5E9AA 1IZJA 2A7NA 1RJQA 3HIJA 1UKPA 2IPGA 2X0YA 2QW5A 2WCAA 6XIMA 1OD8A 3AU6A 1ME7A 3H4WA 3JU2A 1EX1A 4H9ZA 3ONBA 3NEHA 1GOIA 4DJED 4N4PA 3LMYA 3BLPX 3IGHX 1CGTA 1W1VA 3B9AA 1H51A 2ABBA 1X38A 3S1VA 3CMGA 2VKZG 1VBGA 2FPYA 2R1MA 1TMQA 3VGGA 4F0HA 2PP1A 4S23A 4DNHA 2OWXA 3LCWA 1O66A 5FACA 3PPHA 3U57A 1A5AA 6ENLA 1MUMA 1WO2A 4FF5A 4PUWA 3AALA 2Y8UA 1HO4A 2ZADA 2ZX6A 1U33A 4KW2A 2ZX7A 4DX3A 3TQ0A 3AQUA 1SMAA 2CZFA 2VGGA 5G1YA 1JRCA 1TQXA 2X30A 3NPXA 3A6OA 4XZIA 1ZQ5A 2P88A 2W79A 3NFUA 3AJ7A 3W7MA 1GTHA 3ABRA 2W0UA 2SFPA 1Q4NX 4RPQA 3GXDA 1PIIA 3MC5A 6CGTA 5TD4A 3EAUA 3IIVA 4GI9A 3E2VA 3BCJA 1SZNA 2X1IA 4DJDC 1OJXA 1H3GA 3VMNA 3TFXA 3S1UA 3NQDA 3GR8A 2WAGA 4LSBA 3KEHA 1XWYA 2HVMA 1ITQA 2O9PA 4IPIA 1GOOA 3I4KA 3VIGA 3XINA 2V2DA 4RXFA 5CBBA 1K7FA 3B3DA 2ZXQA 4IGMA 2V2HA 2QLYA 3GNRA 2PURA 4L1WA 1FWWA 4Z1YA 3CQJA 2Y5SA 3IVTA 1XLLA 3H7RA 2C14A 4L1GA 3JZEA 1TTQA 1ITCA 3STGA 4W84A 5AYXA 3UZWA 4AEFA 4KEZA 1BWVA 1PZ2A 3PZOA 4PMOA 2PCQA 1RA5A 5HBFA 3N25A 1GQIA 3KBVA 3FSUA 1VJSA 3TAOA 1EJWC 3IUHA 3VNZA 1NF7A 4TR9A 1SVDA 2X1UA 3GHUA 3QOMA 1X1NA 3GVGA 3P74A 1S2VA 1GHRA 1DQXA 4A8LA 4Q4RA 4K36A 4HBKA 2CC0A 5M3WA 2R1PA 4C7GA 3ZJ7A 1FP9A 3QN3A 2GWNA 5I0DA 1VJIA 1OIMA 5G2WA 3DI0A 4ES4A 3UPMA 4PODA 1UWUA 2QUNA 2BGNE 1BEUA 4C90A 3PFRA 1E55A 3TQKA 3KP1A 3P14A 2YCJA 5REQA 3OBAA 1UOKA 1B9BA 3WLMA 1GVRA 2EQDA 5JU6A 2H90A 2XYLA 4KFPA 4TIMA 5C9UA 5A6TC 3CV1A 1J6PA 3B8TA 3BURA 1F4HA 4BI7A 4JTQA 2BY2A 4HA0A 4X0NA 3H2MA 3O05A 1WBJA 3N2XA 4Y90A 2VFHA 1R47A 1F3WA 3L0NA 3LG3A 1EEPA 5IDIA 4KPLA 4LAMA 4CCCA 2D0FA 5DBUA 4BR1A 8TIMA 2RGMA 1WZMA 2D24A 4M6VA 3WCZA 1A0DA 5CCZA 3GDLA 3N19B 1EC7A 1C9DA 1EH9A 2GQAA 1P48A 4FNTA 2OELA 4LC6A 3EWWA 3F4DA 2C16A 4BQ5A 4EXBA 3UBPC 3IV8A 2Y0FA 5KITA 3KW3A 1C8QA 1EQCA 5M03A 4AZ7A 4JIRA 4HTBA 1FCUA 4RJEA 2F6UA 4BS0A 4QJ4B 1PDYA 1CWYA 5DO8A 4ML9A 3ZR6A 1PVNA 3SBFA 4NILA 4A2RA 4AEEA 1OINA 1XSIA 2WWCA 1WDWA 1SJBA 2ZUWA 3AHYA 2DORA 2P3EA 3ZT7A 3O0KA 4NJKA 4UTFA 2GVYA 3VNJA 2OX4A 1LWJA 2WNWA 4D8ZA 4TV6A 2CHRA 4G7FA 2HQAA 4GY1A 4M6UA 3VMPA 4P7NA 4Z0JA 4UTTC 5HNUA 4DBDA 3A47A 3IK2A 1HKKA 3IV3A 4IM4A 2J7EA 4CQCA 4NAEB 3W85A 2ZRVA 3CHVA 3GKFA 5LIXX 1H09A 3ELFA 4YIWA 5CH9A 4UQBA 1RCOB 4MY1A 2KAUC 5LGZA 4JZ5A 3N13A 2R8WA 3L21A 4HQVA 3NM1A 1VF8A 1XYMA 2FPTA 4DZAA 5DCEA 3PZIA 1HO1A 3C3NA 3GXNA 1DEDA 4DJEC 4DLFA 4HCDA 1SSGA 4Z1AA 4Q4KA 4IP5A 3ARXA 4XB3A 2J13A 4NXKA 5FCZA 4EANA 2RFGA 2HWGA 3QQWA 3WLSA 1BVZA 2FFIA 3DFYA 4O1AA 3WZ0E 3UESA 4O1EA 1LOQA 1SYTA 1NAL1 1J0HA 4PMUA 1M41A 5EB8A 1YLVA 4G56A 4PTXA 5AC5A 3QTGA 3CBWA 4UC5A 2R1LA 1GVQA 3T0CA 4AUBA 4O1FA 3UWZA 2JE8A 1YYAA 2DU2A 1NFGA 4W93A 4P7QA 5FF2A 4WXYA 3KZPA 2PTWA 5BU9A 1DJXA 3CZGA 4IH3A 3VE9A 1Q6DA 1HL9A 2VFGA 3LSCA 3XIMA 2R14A 1JG9A 1W32A 1O68A 1PAMA 3ITXA 4DPQA 3W81A 2QNEA 4E2VA 3VIKA 2FDSA 2A85A 2YKKA 4JTEA 2YBVA 4RLIA 3S1GA 1WAUA 2IXVA 3ABXA 1LOSA 1RA0A 1OG6A 2J6XA 1O60A 1OYBA 3Q45A 1KQZA 2IKJA 3W83A 1G4EA 3DDMA 5ABFB 1TJRA 2IXUA 4DNMA 1B30A 4DF0A 1LUCB 1R87A 1LRQA 3NR0A 5GVJA 2WSKA 1A5MC 3UJFA 1QW8A 2P76A 2G3JA 3FOKA 3P0XA 1WP6A 2OOFA 2RHGA 3UZZA 1R30A 3WMCA 3T7VA 2FGZA 4HPHA 3MJMA 4HCLA 2PWVA 1TPC1 4DHGA 3SCWA 2OYMA 1JQXA 1G4SA 1JAKA 1OFAA 3CB3A 3QXBA 2HPIA 4NAEA 1AJ2A 4PMXA 1OC5A 2V5KA 3D5HA 4MDPA 1TZ9A 2VGIA 3UJRA 1B3YA 3CUZA 2Y61A 4WDXA 4GVHA 1IR2A 5CLWA 1S5NA 4ZQNA 1F8IA 2RDXA 5F4WA 1W9DM 4DM1A 4A2SA 3KP0A 3IGXA 1TTIA 3UR7A 1Q3NA 2VCCA 1VCGA 4J9JA 3DFOA 3KOFA 3LB0A 4E0CA 1TTJA 3LTSA 1R3WA 3W1MA 4FNRA 2CLHA 1A47A 2R6OA 2GDVA 1I1XA 3V18A 5K2ZA 4CU6A 3OG3A 2ISSA 2XU2A 1GOKA 2QJMA 4AIEA 1ITXA 2V69A 3UYIA 1K4HA 2BODX 3MV11 3FEMA 3TSDA 1GORA 4KESA 3WLNA 2PE4A 2ANUA 2D1ZA 2I9EA 1CCWB 3WQOA 1KXQA 4QX4A 1CPUA 3N9KA 4H6EA 3V4BA 2G50A 5FJPA 4GX9A 4KWSA 4HT3A 1KM3A 5TF0A 2WZMA 3F5LA 4BZYA 5IXEA 2VEMA 4BWLC 3QQ0A 4PUNA 3OEXA 4FA3A 4D6EA 3VCCA 1XYCA 4XBJA 4NYUA 4N9BA 4C6FA 1QUMA 2QMJA 3MZ2A 3W7NA 5DBTA 3SCQA 3PUDA 1XG3A 4GA8A 4L9XA 4NHVA 1DPMA 2GPTA 4RZ6A 5BZAA 4HU8A 3PJUA 4IMCA 5HNTA 3TEVA 4UOQA 1UWTA 3Q2DA 5ABFA 3VDBA 1DXEA 4C91A 4IX0A 1PL9A 1P6WA 4I9TA 3BAXA 1NWRA 2V0TA 5AHMA 4MSSA 4LYPA 2ZWZA 4IICA 3THQA 5BROA 1VS1A 1BQGA 3REQB 4JXCA 4ECLA 3UWUA 4ML4A 3ZT6A 3HQOA 1IHIA 4EPEC 4AH7A 3LM7A 2QQ6A 4RKAA 2OB3A 1YQ2A 3S9YA 3WN6A 1SZRA 5AECA 2XSBA 4OV4A 4M51A 4JTLA 2TODA 2F8QA 3S5YA 3N3TA 2EXOA 2PDMA 3OQ8A 3W7GA 3OOQA 2WC4A 3WBAA 5E9XA 5BOEA 3WG6A 3WFAA 1Q6CA 5F2IA 4JOMA 2VRQA 2ASHA 3BAKA 2XFWA 2X40A 3FX4A 3AYRA 1EGMA 4MNMA 3ZJKA 4PMNA 2QF7A 3FW6A 1YTKA 1Y0EA 1UASA 1DXIA 2DDXA 2RKXA 4BCEA 1A53A 4CNOA 1MRQA 5HMFA 2PDNA 1R7OA 1CXEA 3GX9A 1BYAA 4DZIA 3GUWA 1AUSL 2WKJA 1GKPA 1IEQA 4R9OA 1K70A 1NOFA 2O7SA 2BS9A 4C6PA 3LRKA 1E72M 1XBYA 3DBPA 3D46A 2CLFA 5ABEA 2UWFA 3W2NA 2PBOA 2CHOA 4HB7A 4YWIA 5GQBA 2DJXA 4P8VA 2PC4A 1DJIA 2ZRWA 3NPWA 2CU0A 3OZYA 3AISA 4JTKA 3HPFA 3BOFA 2QXWA 4I7UA 1GG0A 2BMBA 2ZZ3A 2NWSA 4IGSA 4X3ZA 1QPRA 1V7AA 5I5RA 1TV2A 3CAVA 1I2OA 5E6YA 4BHYA 4H6RA 3TXZA 2F61A 1TE6A 3B0PA 5FJUA 4UTTA 3RCYA 2CEQA 1W0MA 2EPOA 1G4TA 1KTBA 1LL6A 3N18A 3VIFA 2J7GA 4AZIA 1UUQA 4E6MA 2YJQA 3CH0A 4HPJA 1RP9A 5CJMA 1VEOA 4ROQA 1SPQA 4PEKA 5FJJA 2Z4GA 1PKLA 4PB5A 4A29A 2ACRA 2PZ0A 5EYWA 2YGYA 1VKFA 4JIHA 1ML1A 1DWJM 1JVNA 1XSJA 4HTYA 3W1TA 2DEPA 1FP8A 2HISA 6PTDA 4S3BA 1M65A 3NO5A 2RDTA 2FZDA 4QLKA 2PGWA 1KKOA 1O1HA 3S2MA 3T55A 1E4LA 4C6QA 4PMVA 4Z2JA 3KBMA 4IGHA 2FJUB 1L2QA 5A8QA 2VFEA 2XN2A 2OLAA 3TLLA 3EWXA 1V03A 3TW6A 5KSWA 1VEMA 4V15A 1BAGA 4YTUA 2BASA 1KLYA 4H7ZA 4TX9A 3FGCA 3VX1A 1EZWA 2INFA 2J8GA 3MV01 3IAQA 4AC1X 2VC9A 4XZMX 5MKGB 1J0IA 1DIDA 1VBHA 1XISA 3O6CA 1DWIM 1U5VA 1A0EA 2OKTA 3O7UA 2YB4A 4M19A 2UBPC 1E6NA 1QO5A 1DVJA 4FNUA 2CLPA 3FS2A 4MNKA 3DIPA 2QCDB 3CPUA 3CGTA 3CYJA 4JQ1A 4UMCA 3AS3A 4Q4MA 4K1GA 4B4FA 4HA4A 4HK7A 2PWEA 5HA7A 4RW3A 1HJWA 4ALDA 5D9PA 3V0SA 3EPOA 3FXYA 3V7PA 3P5ZA 5DY3A 4JYFA 2ZVRA 3IJLA 2UV8G 1OX5A 1AW5A 1OT2A 3OB8A 4MY9A 4MJMA 4C1KA 3DEQA 3CUIA 4ZENA 1KRAC 4QNEA 3SY8A 4NX5A 3ZSSA 4IFRA 2E8ZA 4D6DA 3UJSA 1QPOA 4HMNA 1OCNA 2Y2WA 5HWNA 2A3HA 4H8HA 3NSNA 2ZCGA 1LQ2A 1HG3A 3MP3A 3KZSA 1CDGA 4MZ1A 3LDVA 3SCTA 3PJTA 4GVGA 3KS5A 2ONEA 1XPGA 1VFMA 3P3BA 4E4PA 4CD4A 3LXAA 3VTRA 4UCFA 3LV6A 2GDUA 4C6LA 1DV7A 2ACUA 2HVOA 2JGYA 4AW7A 4GRSA 5EY5A 4MDOA 1L6SA 3QKZA 2A3EA 5CPNA 3C0JA 3SUUA 3WJYA 3ID7A 3NOYA 1KM0A 1D2KA 4MGGA 4EAMA 3PC0A 5C9XA 4N6EA 2QULA 3TA9A 2W9MA 2H8ZA 2HS8A 2QV4A 1H7PA 4UTHA 1BYDA 4ZVJA 3RPTA 1R3VA 5F2MA 3R7MA 2I56A 5TAOA 3GDBA 1VHNA 4QXIA 2CYGA 3TK7A 3IRSA 3IVSA 4ZXLA 4KIEA 4GXMA 3HU7A 1UD2A 1QU4A 1LLZA 3EDKA 5HINA 1SSDA 4HU3A 4BWLA 2CPUA 4D72A 3JRKA 5JQ9A 3RFAA 4Z2LA 2QCDA 2OGJA 1UYQA 3W3OA 2J8FA 1H7XA 4UB9A 2Y89A 3GAKA 3ONCA 2BXVA 5JIPA 3RIKA 1ADOA 3I68A 3JS3A 3H70A 1PKYA 1BG9A 3GTNA 3H2OA 4KCWA 4N2YA 4ZZ9A 1KBBA 1FQ0A 1LQAA 2BOGX 1R2TA 4PH6A 4H2HA 1KBKA 4FF7A 3FY1A 1UUMA 2FB2A 1LORA 3BMWA 3B9DA 5EBUA 3MP4A 1ZLPA 4AAJA 3MI6A 2E77A 4F2TA 2ZA2A 2DZVA 2JGQA 4X2PA 3CPGA 2EJAA 1PZ3A 3B8UA 1UQYA 2PI6A 2OJPA 4CD8A 4PFMA 1NQ6A 1M1BA 3KRSA 3OLDA 1F3XA 4NU7A 4GYKA 5E93A 3WF3A 4LWWA 2FZ9A 3P8JA 3KHJA 3LBCA 3R8RA 1XFCA 5DLCA 3W27A 2QJJA 4WX2A 4Q4SA 1MXDA 4H01A 4IL2A 1MDLA 5A6BD 3G8RA 1WKDA 3WFLA 3WLJA 1LP6A 5G1MA 1QCWA 4UXDA 4GJJA 4D9PA 1CTNA 3CNYA 3FFSA 1ELSA 4TMCA 3LU2A 4NZ1A 1AFSA 1BVNP 1EBHA 3SN1A 3R6IA 4J3XA 4G1NA 4Q6JA 5AYZA 1JQVA 4HYVA 2DSUA 4JIPA 2W92A 1EL3A 3QKEA 2PDQA 1BG4A 1PJ9A 4IFKB 3OTRA 4O13A 1OGBA 4O0KA 3S9ZA 2GJXB 1H1ZA 2ZZ4A 1G1YA 3KCOA 1SO3A 3WF0A 3POHA 2XN0A 1KFBA 1H11A 3AWOA 3JUGA 3EWUA 5DX7A 1HGYA 2G3NA 1R3YA 1AZ2A 3AZTA 1H0GA 1VPYA 1UP3A 3MHGA 7ODCA 1S2WA 2DZUA 3H22A 3B8SA 2BGQA 3NQCA 4EIVA 4S38A 3LCGA 4H9MA 1NVMA 3MKCA 2FZMA 1VFOA 3GW3A 3BC9A 4OVXA 4QDWA 3N12A 5F4SA 4L5ZA 4AG0A 2WM0A 1R3SA 5DN1A 3RX4A 4QSFA 2Y6ZA 3H7VA 1CT5A 5B7ZA 4CLMA 4N0RA 1YHTA 3IRDA 3U4FA 3KOWA 2OKOA 4PUEA 3QYQA 1KXVA 1UR3M 4H9TA 1E3ZA 3HMJG 1DIOA 4FR6A 1OABA 3S6OA 3WLPA 5E0KA 5C71A 4MG4A 2OZ0A 4S2BA 3FHQA 1OQFA 5XINA 1MW0A 2WC3A 3DFQA 1F8MA 1LLOA 1TQJA 4Y8EA 1YDNA 1LWIA 1DP0A 1SUXA 3B8VA 4ZO9A 1IV8A 2NSXA 4AY1A 4K1WA 3ICJA 4WQ6A 2Z7GA 1T7LA 5G5IA 3WMLA 4Z1BA 4IMGA 1RSCA 4XG1A 2PUZA 6TIMA 2PLMA 5J5DA 4IIBA 3I3BA 1JFHA 1ZL1A 2EG8A 2CETA 5BOOA 3HGJA 1T6MA 2O92A 1GHSA 3PF3A 4GO9A 3B9OA 3M0LA 3TN5A 1EDQA 3AZSA 3M0XA 1IR1A 1TV4A 1XUZA 3DFNA 4LYKA 1I60A 1UH3A 2B0MA 4Z2KA 1O5RA 2PTDA 5BXRA 4I5RA 3TN3A 4CU7A 3ZLFA 2FYMA 4B5NA 2B81A 4KS0A 1GPFA 4PUMA 4KCVA 3GXPA 1TE1A 3UA4A 2QCEA 5FIPA 2XSAA 1SFTA 1BWLA 1T99A 1I1WA 3KOXA 3P84A 4CQAA 1QNQA 1GGOA 4M1RA 2Y5EA 1J5TA 4MAVA 4QEHA 1P7TB 1J2WA 2CFFA 1XRVA 1NDWA 1ZSXA 2YA2A 1YTEA 4O19A 2JIWA 3HG4A 3QZAA 3GW0A 2V38A 2XZ7A 2Y7GA 1NF0A 4IFKA 1AQMA 1H63A 5K4XA 3T78A 5FSDC 2GJXA 4KETA 3MY9A 2QCNA 5A2CA 1DJYA 3GR7A 3PSWA 3UWYA 1A5SA 2WNNA 3BAIA 1TX2A 3HB9A 1SZGA 1MWOA 1T96A 1K4GA 5U7SA 2RAGA 3S2JA 5KZMA 3LGDA 1GTEA 5RUBA 3ZT5A 1M7PA 2H9AB 5FJTA 3SJ3A 1JCTA 2PDBA 4CVUA 3EYPA 3DC8A 4FO4A 3RJXA 3VGDA 1F6PA 1Y5VA 4WDUA 2QEZA 1RJPA 4NZJA 4EOUA 5CXPA 1WXJA 2QGYA 2YW3A 1DJHA 4M81A 3UJ2A 1TPB1 2WZTA 2BHUA 5BNKA 4DELA 2AKZA 3T81A 4O10A 3GC5A 3U2EA 1G9HA 3W7QA 4E8GA 3SCSA 1XIGA 1XIFA 2CXGA 4UR8A 3RITA 3QC0A 3A4WA 1R85A 3MVIA 4TV5A 4UBPC 1UWSA 3WQCA 4RNFA 2FJKA 3SCUA 3M0JA 4J3ZA 2X05A 2BLEA 5H8UA 2GVEA 4PUKA 1QASA 3WH5A 3OHMB 4JFSA 2EPNA 2P53A 4Q8PA 3GU2A 3TQVA 3C8FA 3H2CA 3SEPA 3GRIA 5K9DA 2DP3A 2D20A 4PBEA 3H2EA 1IEVA 3KX6A 3PJWA 1PZ1A 3CXOA 1KM6A 2PS2A 4Q3MA 3ZFHA 3II1A 2DSZA 5EMLA 1HL8A 1VYPX 3M5VA 3T0TA 3ZR4A 4A3UA 3Q94A 3WQWA 3SQLA 2FDMA 3EA1A 3LRLA 1EP1A 1W1PA 3HV9A 2D2OA 1XC6A 4XZHA 3ES7A 1YE4A 4W7UA 4AHPA 2HXTA 3ARZA 3ZMRA 5CQ1A 1IT8A 3WH6A 3PZTA 2VFDA 1QJWA 3WK1A 2WVSA 3UNDA 3W1RA 3MSYA 1HJVA 4HHHA 3M07A 3YPIA 3FAWA 1V77A 2WK2A 5T26A 3R79A 4HPNA 4IJRA 2VXNA 3NQEA 4RE2A 1V6UA 1MUCA 3WEOA 3A5VA 3W1LA 1XW8A 4JKKA 1OADA 2DSWA 1BVWA 1AODA 4IG2B 1R5YA 1ZHAA 3LCFA 5AYBA 4RE4A 3UQNA 3EWDA 3WLOA 2ODOA 4AD1A 5AC6A 5A94A 5I79A 4D71A 4Q4PA 1W5NA 3UWEA 1Q7ZA 1NDZA 5AHLA 1U1JA 2PA6A 3KVKA 1OFPA 3DFTA 2PDYA 2C6QA 2QUMA 3M0MA 3LV5A 2XVLA 1UCWA 3ARWA 4S3EA 5DEZA 3I6TA 1YEYA 4AC7C 1YTDA 3O0FA 2HE5A 3POCA 3THAA 3BSHA 3QW3A 1XGEA 2G4JA 2PODA 4LS2A 1N8WA 4NX0A 1XYBA 5LXEA 4HNNA 3W7CA 4PMRA 3L4WA 1EX5A 1PB0A 1BF2A 3MHUA 1H7NA 1ZCCA 2PD9A 1GVIA 4W9TA 3A4XA 4LXFA 2W5FA 5KZ6A 3HZ3A 4LYRA 1DTUA 4C6CA 1CGXA 1CLXA 3QF0A 3AXKA 1IT7A 1IWPA 2CERA 4Q32A 1OCQA 3EB2A 1WX0A 3P60A 2VRJA 2VR5A 4A3RA 2GJNA 3NQ7A 5AC8A 2YDRA 4C5YA 4UWMA 4M8UA 3SFWA 3QHMA 1YXCA 2VNCA 4AVOA 5AVHA 4KEUA 1ZBVA 2WOQA 2YL6A 1TJ1A 2XIOA 5LNUA 4RNJA 1YPIA 2DIJA 1ZUAX 3WL1A 9XIMA 3TAKA 3FA4A 2QPXA 2A3LA 3LY0A 3SCOA 4QAWA 3V5CA 5MHBA 2E3ZA 4LAUA 3B04A 1FXPA 1A50A 3TYEA 1OFEA 1PTAA 5CSYA 3SDOA 4IGNA 4N7QA 2NQZA 3HPXA 4LVAA 3H8AA 3HPAA 1V7YA 3ARYA 2DZBA 4GYPC 3WNKA 4KFOA 2W66A 3C86A 1ECEA 4K2SA 2PWUA 3GXMA 4FPSA 2VVSA 1K9DA 4I9MA 1KGUA 4MWAB 1I0DA 4QCFA 4AF0B 4LUSB 4GZJA 5LKYA 4LC8A 4ZQMA 4BI6A 4ZTXA 1BKSA 1M6JA 4M82A 2HV5A 1HW6A 1XIBA 3AZRA 3M0YA 1DQWA 3T40A 3OVPA 4GBUA 1MI3A 1WNOA 3SR7A 4DO6A 2E9MA 4DXKA 4Q4QA 2Z1XA 1ZBCA 4PMDA 3H2NA 3PG9A 3B40A 1A4MA 2WJEA 2PMQA 4O0QA 4K8HA 4ADUA 4DVOA 1JZ5A 3QV6A 1E70M 1W5OA 5D33A 4O4WA 4DBWA 1SJDA 5FAGA 4RV8A 3MSGA 4AVFA 3OW1A 1Z44A 1IXQA 1EUNA 3NIYA 4UQEA 4O0ZA 1SM9A 7PTDA 2ZWYA 1XUUA 1CGYA 3ERPA 4IJBA 1E15A 3BG5A 4NAFA 2O9OA 4UQDA 1HJUA 1XH1A 3P8IA 2GJPA 2FH8A 1EJXC 3I6EA 4MZ8A 2IUZA 1E4MM 2V5CA 1F3TA 4GQ0A 4DI9A 2PDUA 2PU1A 3QPZA 4JYDA 3AMGA 4ZFCA 1RCXB 1US3A 3WJWA 4EWJA 4YMZA 4R88A 1JDDA 3T42A 2FHCA 3CL8A 4D1JA 2EKGA 2ZTKA 1P1MA 4GMEA 5FI8A 5BYWA 5HOSA 5LNWA 1QHZA 2VEKA 5JH2A 2GUYA 1SGJA 4H9XA 3CJPA 1HJQA 1YKWA 1GQJA 4JQ4A 1XPYA 4HA1A 2CZEA 2BNJA 1DWFM 4ZO8A 3TSBA 5DMMA 3VIIA 1O5QA 5G4EA 2QJHA 3VOJA 4OZOA 2Y4SA 3VNYA 3R43A 3LPGA 5AHEA 3CMJA 1GW1A 5I3IA 2GVGA 2VX5A 2BP1A 1H0IA 4P7OA 4HJFA 1OGSA 5LNSA 4YPJA 1GPWA 3PTKA 2E5BA 3R11A 4E4FA 4AF0A 4LVGA 1J0KA 1V3LA 1ONXA 1GYNA 4LOCA 2FQIA 4PR4A 3MHFA 4LFYA 1Q8JA 1UOZA 3DHPA 4C6BA 2VGFA 4XISA 1DWGM 4IQDA 2HEJA 1VFFA 2INEA 4PTNA 5I3HA 3KE0A 3OJGA 2HBXA 3BL3A 3CL7A 3LGEA 3ATZA 3L7RA 3A21A 1V0NA 4H6QA 1WKEA 5CZJA 4OU1A 1E40A 3AC0A 1UIPA 4IPJA 3AXIA 3QJAA 4JX5A 2YXGA 1A4LA 3F2BA 4ZFMA 4CEXC 2YZ5A 1ENUA 4FLOA 4QCEA 4EP8C 2YBTA 2CZ5A 2PDCA 5M17A 1GYMA 2V5DA 1JD9A 1GZJA 3VK5A 5F1UA 1A0CA 1JYNA 2YL8A 1KCXA 2FZBA 1B9ZA 4GD0A 1KGXA 1XYFA 3GWQA 5CC3A 4CCEA 3BLLA 2NW0A 1LM1A 4PTMA 1JZ6A 4DIAA 1VB9A 4O54A 2QPSA 1MNZA 3EWZA 4M29A 4O18A 1CGVA 2W4XA 2JQXA 2G96A 1ZP3A 3LPFA 3UY7A 2DH2A 1W3HA 4ZEPA 4XTIA 1FWEC 4KWUA 1A49A 1Q7QA 3O6DA 4MJ4A 3BANA 1DKWA 2VP8A 1ZTVA 4JTIA 1LRTA 3N9RA 4TQTA 2QPUA 3KRZA 4QE1A 3MUY1 1IXOA 5A95A 1JRBA 1TZ7A 1JUKA 1ZAJA 3A64A 4PFHA 1XKJA 4O14A 1VFTA 4OIFA 2X09A 3RO8A 3UZ5A 1UH2A 1S39A 5CGTA 4V27A 4KH2A 3Q37A 4BF7A 1W9BM 4FMVA 1JCYA 1GG1A 3TJLA 2WVTA 4RPPA 4HNUA 3SCPA 4AEOA 1Z8AA 5C6MA 2X1TA 2EGZA 2OEKA 2YXXA 3A3XA 3EX2A 4C7DA 4XD3A 1UP2A 4W5UA 2OFJA 4LNYA 1TKKA 3ABSA 1R3RA 4B5SA 3VM5A 4YJ5A 5JH1A 1XLBA 1WDSA 3GHRA 3ARTA 2Q02A 3BZJA 2VDIA 1E6PA 4PC8A 2UZ9A 1VLIA 5D30A 5G2IA 2VWSA 2QZRA 2E5CA 2V5BA 2R94A 5HAOA 1OHLA 5HMEA 4B15A 1ME9A 3EDDA 1REQB 4UFLA 4JYEA 4MFDA 4ACZB 2XFYA 1JUBA 3H26A 1X6UA 4UUIA 2IQDA 3L2LA 1OC6A 5HQLA 3GIYA 4FXFA 1J18A 3VZYA 1VCFA 2B7QA 1MW1A 3S8HA 1N7KA 5TBOA 1W1TA 4R33A 3ATYA 4ADSA 4FX6M 3TOYA 1IIGA 2YCLB 5LA0A 3BV7A 4Q7BA 1UD5A 4DUOA 3M4HA 4WUIA 3LHUA 2JKEA 3WK3A 4OKDA 1HTIA 1P4CA 3VKJA 3VNKA 1RLCL 2VRKA 1EB3A 1FXQA 4GQBA 4AMCA 4X60A 3NQVA 4MAZA 2BWGA 4KRTA 4Q33A 1RCQA 1PPIA 2GUUA 3FCPA 3GNPA 4WKAA 2WWDA 3G1AA 2YFNA 2ZE3A 5HATA 2PDWA 3QYSA 3C0QA 3QV9A 4QITA 2YB1A 1XBZA 4UTMA 2YA0A 4GYPA 2OT0A 4RDYA 1RVKA 4H00A 2QDHA 2Y8VA 3BJFA 4U10A 2EBNA 3LCXA 4U5IA 3G3MA 1TJPA 4GLEA 2JKPA 4ZMGA 7CGTA 2PP0A 1MFVA 4PCNA 3S9IA 1TPDA 1K7XA 3P61A 3UPWA 2V3FA 1PZ0A 3L4YA 4JNZA 1BTCA 1Q6OA 2FPVA 4V2XA 4XAZA 1E0UA 2TYSA 5LHEA 1VBUA 3R2GA 1BSLA 3MT1A 4H2CA 3B8WA 4P8XA 4DXXA 5BMXA 3LS9A 5TNVA 4H3DA 3VIMA 1W3LA 3GNDA 3WD0A 4XWUA 3BLEA 3IIZA 1RPKA 1JZ7A 3KRUA 7A3HA 2BTMA 4GINA 3VVGA 3CZJA 3WJSA 3TSMA 4ZA0A 1FWRA 1REQA 4C6KA 2OSWA 1EXBA 4WLCA 1W9UA 2INZA 3NDYA 4GZ7A 5BXTA 1CBGA 3KOZA 3H24A 3UVAA 3DBNA 2BVYA 3UZYA 3AAMA 4MKSA 4MKNA 3H4XA 2NX1A 2QR6A 4Q4OA 4XKYA 4AD5A 3WELA 3VNIA 4ZB0A 4I6KA 5AB3A 3LBOA 4PBGA 2HK1A 4UQCA 3DENA 2HNHA 2PRMA 1WPCA 5DMLA 3W2KA 3BLDA 4P7RA 1VENA 3BCFA 4A8IA 2G97A 4LVDA 5ENLA 3WYZA 3THDA 1WZAA 4ZQCA 3WEMA 3WQPA 1OFRA 5DY2A 1KR0A 1O95A 3DH7A 3DYPA 3VKDA 3KXQA 3GYEA 3O9NA 2PWFA 2XPKA 4PTVA 2OQYA 3LXBA 4OT7A 3ZVIA 1D8CA 1R46A 1ZAHA 3B05A 3MJYA 3PZUA 4GQQA 3QMTA 3CC1A 3OG2A 3SUTA 1J11A 3DXIA 2OR2A 2WSRA 2VHLA 5HUOA 2QYGA 2GJLA 4XZNX 2VZTA 5E6ZA 1Q6GA 3FYYA 3GUGA 3CUJA 3E49A 2VURA 4LAKA 4UNLA 3E5PA 4QAIA 3LZ3A 2X2YA 2J7BA 3W1XA 3G1RA 2GDQA 3L4VA 4ZO6A 1MO0A 2CZDA 1HKMA 1WV2A 4RDWA 4QE5A 2UY3A 3VKBA 3N9SA 4ERAA 1VGAA 3HJEA 2A1YA 3G6LA 5I24A 3W7DA 3VCNA 3F5JA 4IUGA 1SW7A 1J9YA 3L66A 1ONRA 4RNIA 4WY0F 4S3KA 3GTFA 3VNLA 5H8PA 1PCKA 1TUXA 4C5ZA 1JR1A 4OBRA 4EVZA 1E9YB 3S1XA 4YTTA 1F6YA 4NT0A 4F79A 3S6DA 3VDAA 3WO8A 4J7RA 1I9CB 1PIGA 3NL6A 3PUEA 1JF5A 2A0NA 3LPOA 5A8GA 3CHFA 2A7PA 1HKWA 4L4MA 4POCA 1PWLA 1NWSA 2A3CA 5GNXA 1V02E 1VFUA 3SGUA 1GZGA 4NJIA 3IAPA 4OUIA 1EIXA 3RPMA 4E2BA 4NYYA 2XIIA 2YXOA 3WDHA 3SECA 1XJBA 3KDNA 2BY1A 1TPFA 1MW2A 3HTWA 4WXZA 4OWGA 3UXKA 3D0CA 3K8MA 4NP7A 1TRDA 5C9WA 3WBXA 4XZBA 2HZGA 2XISA 1B3WA 1F2JA 4YYFA 2HK0A 3SIZA 4QTGA 3TDFA 3GE7A 3MCNA 3EXTA 1YE6A 3RM8A 1A5BA 1NELA 4D6HA 2ZVIA 3TYCA 3H6OA 5D8WA 1IWBA 5EMYA 3A23A 3SY5A 2ZE0A 3VGBA 3I3DA 4RE0A 4LS0A 2WMJA 1Q5MA 5D03A 4XD4A 3D47A 3EKZA 2EKCA 1YDOA 3ZVHB 3TWAA 1KTCA 4GUGA 3M5ZA 1XLDA 1RQBA 2P3ZA 2NV1A 3QFEA 4V1YA 4IXHA 3GD6A 4K3ZA 4KGJA 4YU1A 3CQKA 1KBJA 3EWBX 4QDPA 3VABA 3W73A 3N29A 3GVWA 2ISVA 4E38A 1FKXA 1EOKA 3NO1A 3AIWA 1RHCA 4Z1DA 2IQ0A 5E09A 4GABA 7ENLA 4JNYA 1E0VA 1H4PA 1S1RA 3BE7A 4JHOA 5KETA 3LZ5A 2QCCA 4HNVA 3AXXA 5CBIA 3L2MA 4CNPA 1K9TA 4MJ2A 3GG1A 1AW1A 2DIKA 4HU0A 4L56A 2OWCA 1J5SA 2OYLA 4WSKA 1Q4WA 4WY0B 3KBSA 4HVXA 3FDKA 2Z1SA 3BGGA 4DZ5A 1G4PA 2BOEX 4OHQA 2PU0A 3C4UA 4AD0A 1LBMA 4AX6A 4P7LA 4HHLA 1H2JA 2PDXA 4AYSA 4DJFD 3PTQA 1NU5A 4X2RA 1W9PA 4ENLA 2PTZA 3MYOA 3GNXA 4S3DA 1TPUA 3KS6A 1EWDA 1YNPA 1S2TA 2VCAA 3GH5A 2ZRXA 3ITLA 1SO6A 3EX3A 4FNSA 1JCJA 4KEVA 1Z6KA 3SCRA 1CX9A 3WQVA 3NSXA 2VZOA 3SO7A 4RDZA 1RXOB 3MW7A 4JX6A 2FB3A 4GNKB 1K02A 3PULA 4REQB 2P8BA 3M0KA 4PYSA 3CUHA 1QI5A 3SN0A 3CEUA 1IEXA 3CUGA 3ZWTA 2E6YA 3URNA 1F07A 1LG1A 4JS3A 1JPMA 5CPQA 1EA0A 4ZR8A 4IHCA 3DCPA 1YX1A 1UHVA 1V6TA 1FDYA 1PTGA 3GG8A 4DO4A 1NSJA 2NV2A 3WDPP 3IGUA 4L4PA 3E12A 2VEGA 2Z1VA 1E0XA 3VA8A 5T9BG 2ZC1A 1JNDA 5D38A 4F2UA 5BMWA 1PKMA 4PMJA 2C0AA 3LMZA 3W25A 1MQQA 3AIBA 2A6LA 4FAMA 3BLFA 1XIEA 2V6AA 2QVHA 4LS1A 3EA2A 1ZBWA 3F5KA 4X61A 4EACA 4ZO7A 1MYRA 4UTJA 1E71M 3VKKA 1LOLA 3ALFA 1OF6A 2D0GA 3PK7A 4TVCA 1KV8A 4XAFA 2XH2A 2P1FA 2V5LA 1AQFA 1NARA 4RDVA 3SZ8A 3N2TA 3GG0A 3H23A 2C1GA 1UC4A 3IS4A 3SB0A 3MMUA 3NM3A 4WCJA 1KM4A 3CQ0A 4QJ1A 3QRHA 2W62A 1FWBC 2C19A 4CKQA 1UJQA 2E0PA 4GKLA 1F6KA 3P7YA 2WVVB 3P0WA 2PLJA 3LCIA 1OF8A 2HNEA 1JZ3A 4FK9A 1LT7A 1YXDA 2PF8A 2XFFA 3UG8A 3W75A 4F0SA 4JTGA 1X6LA 2Q71A 1KQYA 4WY0A 4AQLA 4J4KA 2WHKA 2GSHA 1E9IA 3M6DA 5D2XA 1GK8A 3PJXA 2H3BA 2MANA 2HBVA 2WYSA 3H7UA 5LXXA 3A13A 2C1IA 3L67A 1YW1A 1EPVA 4HHPA 5EMUA 1UR4A 3K1DA 1WB0A 4WJEA 2HDJA 2WXDM 5CPOA 4WJXA 1C9WA 3GFXA 4O16A 5IHSA 1UG6A 4W5ZA 3S5OA 3KBWA 4B5UA 2YCIX 3LBMA 1FCVA 3EOLA 4MYAA 5DMYA 3DU0A 2IMRA 1R3TA 3BOLA 3EBVA 4FNQA 3AXMA 4WDTA 5DRCA 2NXGA 2WPGA 1I2QA 1B57A 2P0IA 1QDSA 1RUSA 2QDDA 2J4GA 5C2CA 2YR1A 2DGAA 3KCJA 4UCGA 3STEA 2NWRA 1MQPA 4JQ2A 4HNCA 2CW6A 3TP4A 3G2GA 3U0HA 1F4AA 1DWAM 2ZZ5A 2DJLA 2I7GA 5CGQA 1C92A 5IFTA 3WH7A 3ZJ6A 2W67A 2ZZ6A 4ZQPA 5FEXA 4G2DA 4HNLA 5DXYA 5A2AA 5B7YA 1PHWA 2WSYA 3P93A 5IRPA 4M24A 3LEPA 4Q8NA 3MVTA 4L65A 2OLSA 2F6XA 4GISA 1B0IA 2EPHA 3TCEA 4RUBA 1E1FA 1UD3A 1TR9A 2ZDSA 3O1NA 4LF2A 3S0CA 3T08A 2OT1A 1VPXA 1OZMA 2W3ZA 2D23A 1GVEA 4M0XA 3ARRA 4TMBA 3W7RA 3VI2A 5KZDA 2C0HA 4GWEA 4D6CA 1S2AA 2BHZA 3W2UA 3E0VA 3PZNA 4DYEA 3W2MA 3TN4A 3GBDA 3LYEA 2WVVA 5CG7A 1MDRA 2Q09A 5AHNA 3MBDA 3HG2A 2J79A 3W2LA 4X63A 4GK8A 4BQ3A 3AWNA 4GH3A 4DY1A 1MQRA 1V3IA 2X1RA 4QE4A 1KXTA 4ZL1A 3A12A 2J62A 4NJHA 3G18A 3M0VA 3UU0A 2CLIA 1OD0A 3VUPA 2C8NA 3KRBA 1DHKA 1LZOA 5FESA 1ZAIA 3MCMA 4C1NB 1A3HA 2Y62A 4JFTA 4KGLA 4BKNA 2I16A 2Y85A 5LIUX 4B4HA 1Q8AA 3UEQA 5HULA 5HMSA 3PS7A 4QIUA 3GQYA 3APYA 3UW6A 1ICSA 4E4UA 4PCTA 1R7AA 3CTTA 1O6IA 4QS5A 4LBRA 4DJFC 1XIIA 2E7FA 3MU7A 3G1HA 3PAOA 3L5MA 1U5HA 5FF0A 1HIZA 3MS8A 3NGFA 4KMQA 1ZPTA 1W91A 1EIBA 1UD8A 1H5YA 4QGCA 4OQVA 3F4VA 4F0KA 5F2LA 1UMYA 4IPNB 1TSIA 4ASTA 2YYUA 1XQKA 4ZOCA 1JPKA 4QG9A 3DUGA 1K8YA 3CTLA 2GOUA 2ZICA 3RLVA 2AGTA 4W86A 5H91A 2XWEA 2EPLX 4LEFA 1FA2A 3F03K 3UJEA 4IOTA 2NQ9A 2PB1A 1RJRA 1PEZA 2XIJA 1NFPA 1G7VA 2GVJA 1G67A 1QVBA 3RCNA 3GXTA 3E74A 1UROA 2VWTA 4PEEA 3LLDA 2PFHA 3G77A 2WW5A 3C2OA 3S2LA 5HUPA 3VD4A 1X1OA 1QT1A 1ZNNA 4BQ2A 1BXBA 5GJMA 1EQPA 1I4NA 1MXGA 2J9YA 4LRTA 2PDGA 5A6AA 4PCFA 2QUTA 1BGGA 2ESCA 1GQLA 2VQTA 4ROPA 1ZS2A 1OT1A 4NKCA 1MSSA 3S4TA 4FS9A 4EF8A 3W72A 4L4LA 4AIOA 4FIRA 4CVWA 3E38A 2R24A 1D3HA 5K3VA 2QVNA 3IJQA 3TROA 2JK2A 4IQLA 1JCNA 4HD5A 1RD6A 1QNPA 3W7IA 4GNJA 4NZCA 3NSMA 3FJNA 2A4AA 4Z08A 4NJGA 2G3FA 3IJ7A 1OFOA 1J93A 2D73A 5A6JA 4EPKA 3PHAA 2WMKA 1M53A 5I7GA 1ZJAA 1PYMA 4U2YA 1GVYA 5JUVA 2V30A 3N4FA 1LCOA 3BGJA 1Y5WA 1QW7A 4WF7A 4UZUA 5LHFA 3RYSA 4C1NA 1QK0A 2DVUA 1FWIC 2EO7A 3NCOA 3BMXA 3ZM8A 1B90A 1W54A 1MXSA 4O1DA 4H9UA 4UQAA 3CPRA 1XBXA 1W5QA 1IZKA 3HN3A 3K8KA 3L65A 2CBJA 4LCRA 1DJGA 5H1WA 4HHMA 2ZUUA 3KLLA 4NI8A 4QFUA 4XZ9A 3OBEA 4M80A 3UFYA 2V5JA 1XRTA 1I6NA 4GI8A 2VEFA 1BFNA 1RLDA 1I75A 1ZZMA 3UCDA 1AD1A 2OZ3A 3ORWA 4GO8A 2ISDA 1HFBA 3DFHA 3GIPA 3EX6A 3LHVA 3T6CA 1V51A 1LG2A 1TPVA 4Q8UA 3RPDA 1HT6A 3L0KA 1Q6RA 3M43A 3ZOAA 3TLQA 2CLMA 1SO5A 2AOSA 1QOXA 1YNQA 1EC9A 2HSAA 3ALGA 1R2RA 3T2QA 1D7KA 1ZFJA 3PB2A 4YCPA 1GKRA 1JGIA 4MVAA 3HG3A 3USZA 3C6CA 1K8ZA 4XV0A 4F48A 2FGLA 1W1ZA 4PB3A 5M2FX 1BYCA 1X7IA 2Z7KA 3O6AA 1QHOA 1Z3NA 3AYVA 1IWAA 1MFUA 2IPWA 3O15A 2HTMA 2DSVA 1KR1A 1K7EA 2AAMA 3K2GA 2QKFA 5A1AA 4J3WA 4ZB5A 2ZQ0A 1WDRA 1H7OA 3KVJA 3M0ZA 1QNOA 2HPMA 3MSDA 2AL2B 4QNWA 4LUJA 5FF4A 1PO9A 4BA0A 4YTQA 1CYGA 3E2SA 2WKGA 4F0MA 1B5TA 3ZIZA 2ZUMA 2YZRA 1C8YA 3EPNA 1TJ0A 4WVXA 3L4TA 4NXSA 2YX0A 1R6WA 1W1IE 3CH9A 4PCSA 5IM51 4F8XA 3L9CA 3OO2A 4YLWA 2DUXA 3R89A 3NVDA 1HJSA 5C70A 3OHIA 4MB3A 3BG3A 1NFBA 1IGWA 2XWDA 3ZJ8A 1NOWA 3SUWA 1EPXA 2CITA 3N2OA 2E28A 3JZUA 4B9ZA 7TIMA 5CZTA 4NUWA 3SGZA 4UTWC 4KFNA 1VRXA 4YHGA 3AHXA 4JTUA 4A4AA 3TR2A 4P61A 1EDGA 2VQUA 4C6EA 2RH9A 2V2CA 1I2NA 2Z27A 4LCQA 1X98A 4MLJA 1TPEA 1ZBKA 3JR2A 1K77A 3GVVA 1VR6A 1DIEA 3R4IA 2BBFA 4HZ6A 5KINA 1AW2A 4FXJA 3G0UA 3GTHA 3PTDA 1P0KA 1THFD 3SQMA 2GGIA 3MI2A 2D3LA 3VC5A 4HP5A 7XIMA 3VNMA 3QBUA 4LNCA 5ABTA 1UZDA 4FLRA 2A3AA 3QW4B 3VIPA 3SAZA 4I8YA 2Q01A 3E2QA 1D8WA 1KXHA 5CPTA 1JF6A 4X9YA 1M5WA 1YMYA 4J3TA 1DXFA 3O8AA 2VVNA 4MUZA 2IPJA 4JN6A 3AHTA 3EDJA 4XSLA 3EGJA 2ADAA 3I6RA 2CIPA 4LRSA 2OO6A 1F74A 2ZDRA 3HG5A 3CYVA 2G3MA 3AOFA 3ANYA 4XD5A 3CIVA 5ECVA 5BU6A 4CQDA 1XH0A 3B4UA 3OZOA 5D32A 1QBBA 3TONA 2WMHA 3W26A 4JX4A 1WDPA 1A3XA 2BSLA 1L8NA 3F4CA 1QFEA 1DQUA 4IMDA 4EPDC 4GJ1A 1KC7A 3UVIA 3MUIA 2X42A 3L23A 4KBXA 4W8AA 2EF9A 3NYDA 2VC7A 3UCCA 1BD0A 4FLSA 3B9NA 3JW7A 4UFKA 1MMFA 3WD3A 3IJIA 1FHUA 1XLMA 1QWKA 4QM1A 4DJFA 3B9EA 4XAPA 2GUBA 1JZ2A 1RK6A 4V33A 4D8LA 3VD9A 4Q22A 4NY2A 5CC6A 3LPPA 3BW2A 4ZB2A 1MW3A 1S3HA 2GJRA 4GFSA 2YDSA 3W7LA 1ICQA 3NZQA 4D6IA 1UP0A 4UMAA 4NRRA 3LD5A 3M5YA 3AIQA 1GT8A 1R9XA 3DESA 1WUEA 4DPPA 5FJIA 1TWIA 3PR2A 4NQ1A 3UG3A 3N14A 3PPCA 2QUUA 4RV3A 2V81A 2OO0A 3G3DA 1R2SA 1W3IA 4FXRA 2WJZA 1FWCC 3ANVA 4Y96A 4ORIA 1B4KA 1DOSA 4PRRA 2FMOA 2ZA1A 1ALDA 3A3HA 1JPDX 1UKOA 5F1VA 3NEVA 4LTSA 2XSXA 1VD6A 4PN2A 4ERIA 4EK7A 1EXPA 4I7VA 2TPSA 3VILA 3ZZ1A 1KWGA 5I2UA 1ONEA 1EYEA 1GQKA 3VC6A 4O1CA 2V3GA 3WBEA 1C7SA 1QMLA 3UCQA 1T8QA 3RM9A 3LHYA 2ZIDA 3NL2A 3ITCA 2V9DA 4UFMA 1W6TA 3TYUA 4XZLX 1Q6LA 3PBMA 3OVGA 3GS6A 3LERA 3V3WA 1JCXA 2GFTA 4HYWA 1OB0A 3W86A 2YA1A 2X1SA 1K3UA 1L2UA 3EKGA 1RD5A 1SFJA 1HQTA 4FOJA 1FWHC 3KCLA 3HMCA 4HNTA 3S6TA 2D2HA 2ATSA 2Q8XA 1QXLA 3S2NA 4ATLA 3GC2A 3AIRA 3SSZA 1GW9A 4Y9MA 3N1AA 3D3AA 3UD6A 2NQHA 3AIEA 2XM2A 3HFYA 4L1XA 3H54A 1TB3A 4CQBA 5M1TA 4ZBCA 5F7UA 1UD6A 1LRNA 1GVSA 1QRQA 5HR7A 4QROA 5CAKA 1LUCA 3VZZA 1W3TA 2VUNA 4OOUA 1L6YA 2Q8ZA 3MDUA 3UWQA 1UJPA 4DWSB 3AYSA 1V4YA 4GIAA 4N9CA 3NDOA 3MKVA 1XYLA 1JDAA 3RX2A 2PWHA 4LGXA 4GX8A 4YWSA 5CJNA 5H2ZA 4PSRA 2ZOXA 1QI0A 4Y9PA 1WZLA 1U1UA 1UW9A 3EPMA 4AMAA 1FWAC 3EOSA 9CGTA 3M16A 1JYXA 4GYFA 4JFUA 5XIAA 4AB4A 5BXSA 4M56A 2QCMA 3STCA 3WF1A 4H8NA 5CLTA 4NJJA 2PLCA 2J75A 2DQXA 2CCRA 2J77A 3FKRA 1G5AA 2UY4A 4EXAA 1Q63A 4X22A 2C13A 2NVDA 3RNDA 1XINA 4W7WA 2P50A 4JTJA 4S2CA 5EGRA 3OA3A 3HGOA 2QGHA 3EXRA 4MADA 1AJZA 3NYZA 3M64A 2AQOA 3U7BA 2X0SA 4XKMA 3NA8A 4JTRA 4JBRA 2PRHA 3DN5A 1XC4A 4IISA 3LHWA 3XISA 3URQA 3V0UA 3EMCA 4PRTA 1GEHA 3ZSTA 3MDWA 3O16A 1XH2A 3GDTA 4YS1A 4DBUA 3ZLHA 5DMNA 1NDVA 1LT8A 4KT2A 3TC7A 1KW1A 3AFBA 2P8CA 3M7SA 4MF4A 4LF1A 1Q6QA 3U48A 1FWNA 4FB7A 3VFCA 4PSPA 1ADSA 4TTGA 3E2RA 3M7WA 2OTDA 1XLEA 3R12A 4DZHA 1V93A 3EA3A 1CW2A 2Z2AA 4HYRA 1S5MA 4HSOA 1NOUA 4FIQA 2XJ7A 4R27A 3S83A 5HNNA 2QV5A 4K37A 3WKZA 3IIOA 4RL3A 1OCJA 3WNNA 4IJCA 3NJ3A 2J25A 1V8EA 3FVMA 3MUXA 1IEWA 5ECUA 3W00A 2QAFA 3DGBA 2I17A 3SADA 3PZVA 3EMZA 1L6FA 4UTWA 1P43A 4JIQA 4B3KA 4DWSA 3CWNA 5FF7A 5I00A 4FEZA 4US6A 1LJYA 4Y9AA 5IOBA 1I2RA 1FH8A 3N73A 2CESA 1JNEA 1CI1A 3REQA 1GZ1A 3CV2A 4BI5A 5EBAA 3BVJA 2C7FA 3LTYA 1WA3A 2BGSA 1GJWA 3UGRA 3VCRA 1TMLA 4RZ4A 3U9IA 4W8BA 1XGZA 1XDMA 1XP3A 2AQWA 5HQMA 2RDUA 4ATWA 1RBLA 1VAHA 1VPQA 2FMNA 5FEPA 3VDCA 4C6NA 5GNZA 1XRSA 1XIDA 3CL6A 2A7RA 4BEQA 4O15A 3F4NA 4P5UA 5F2GA 3CIXA 3W23A 3T1GA 1LF1A 3BK0A 4H83A 1HJXA 5LNVA 4O53A 1R9YA 1TX0A 3HM7A 3HQNA 1RY8A 3D6NA 2GL5A 4TOQA 1VLWA 4LJ3A 2OG9A 1N82A 4I5XA 1BHGA 2XH7A 2V8ZA 3SN4A 3SSJA 1E9ZB 4NZ4A 5AHFA 4ZCWA 4F0RA 3GIQA 3INPA 4IIDA 3PSVA 2CWXA 3UPBA 4HGXA 1JYVA 2ZFAA 1D9EA 1TVNA 4GIEA 3G8EA 4UFIA 1ADDA 4EF9A 4J2PA 2X8RA 5D2YA 1CXHA 3R8HA 1PDZA 1XDLA 2DVXA 4EPBC 1B31A 1OIFA 3B0UX 2OMAA 4JN7A 3BLIA 1XM3A 3P82A 3ARUA 1W56A 3N34A 2XDFA 3C3UA 5DT7A 4JKMA 3W02A 4D8AA 4J1OA 4AWEA 3ZLGA 4I9AA 3Q58A 5C9ZA 3AI0A 3FSTA 4IZGA 3P62A 2VT0A 3CMFA 3VINA 2GWGA 3GO2A 4N9DA 2FFCA 4GUFA 2O4QA 3P2VA 5I77A 1D3GA 2G8ZA 2DT1A 2FTWA 3G1FA 2VDHA 1MNSA 1ZALA 2PWDA 5HR6A 2PDPA 1YDVA 1PYFA 4AYGA 1SFSA 1Y5XA 4TU1A 3OYXA 1PUDA 4K39A 1SZEA 3UXAA 5D2WA 1ZJHA 3WUFA 3M1ZA 3FV9A 4KCUA 1HX0A 3FA5A 1C3FA 2AMXA 2FGBA 4IXXA 4U5KA 2RGLA 1LROA 4JICA 5C54A 3TZFA 3EOEA 4JCLA 2WM1A 4Q8TA 1FWJC 1S5VA 2CKRA 3NZRA 3R8GA 3R0UA 4O12A 1W1A1 3ABQA 2BHYA 1GJUA 4NZFA 4QR6A 4K38A 1Z7AA 1OYCA 2OLHA 3E0FA 4IMAA 3QQ1A 3QFWA 4P8WA 1TUFA 2PCEA 1TMHA 5MKGA 1FWTA 3MUAA 3CU2A 2IKIA 1AD4A 5L6UA 3QV7A 4U28A 1W31A 3DAQA 3PZGA 3AYTA 2XIQA 4JY8A 5I06A 3I7QA 3UZJA 3EX1A 1V0LA 2I57A 4NNBA 4ZXOA 3GHSA 3FEQA 1FFRA 3OLEA 3IACA 1M7OA 3TTEA 1IEIA 5DFAA 5A8OA 4FNPA 3WIJA 1YXYA 1J10A 4X0VA 2DIEA 4FSAA 5TQLA 1HUVA 2O9RA 3W74A 4HOZA 4YHEA 3EDFA 3S1WA 4ADTA 3PBWA 2YPIA 1W1YA 5FJRA 4G7EB 3RM4A 3QY6A 1ISXA 3IARA 4IMEA 4P8UA 3RXZA 1KO0A 3NQAA 2R9RA 3I65A 1OX4B 4MTVA 3TTQA 9XIAA 4WGHA 2QIWA 1PHQA 4QLLA 1DHPA 4XK2A 4IL0A 4H7VA 1FWGC 2CHNA 3FA3A 1R3QA 4W89A 4XSMA 1WBHA 4LAZA 1QATA 4MNJA 5REQB 4JR5A 5AY7A 3G24A 3W7PA 1ICPA 2WQPA 3PZ9A 2I5IA 4HSHA 4IIGA 3HOJA 3ABZA 4MY8A 4B2DA 3Q4DA 4HIBA 2IPFA 1QR7A 4O11A 2J7FA 4A8NA 1JCLA 2REQB 1UPMB 2QJNA 4KERA 2YLAA 1QI3A 3W29A 1XLKA 3V5OA 2AGKA 3WNOA 1B54A 4YVPA 4L6DA 1QO2A 1DBTA 3PG8A 4LAOA 3W1PA 3GU9A 5I09A 1BPLB 4RCXA 1XD1A 3PFMA 4L6HA 1O94A 2WANA 4ZOEA 1EF3A 2Y63A 1DJQA 4HMDA 2ALRA 3C2RA 4KIRA 3WFZA 3ZO9A 1QPKA 2PZNA 1U30A 4LVBA 2PGFA 4WKFA 2VFFA 2VCBA 3NPVA 2KZHA 4TO8A 1VP5A 2Z1BA 3TR9A 1ISZA 2QF8A 4B9YA 3VOGA 1DJZA 3N3MA 2DZWA 4M6PA 2D3NA 1V0KA 1GOQA 4PA8A 3UNTA 4ZE4A 3O2LA 1EGVA 3KL0A 3VD3A 3WUBA 1E56A 2VEPA 4O17A 2F9RA 2F2KA 3TVAA 4ZOAA 5HDRA 3B97A 3BSGA 1H5VA 2YBUA 4IF2A 1FHVA 4AISA 1OGGA 4Z17A 3W70A 5IBXA 4J28A 1F9CA 5M5DA 1XL9A 3TUUA 1YNYA 4XAGA 1TRIA 3GH7A 3CZLA 4MIMA 5A69A 3UERA 5AFDA 1H62A 3AUOA 4OJYA 4LUTB 1PSCA 4XQ6A 5D2TA 3H4GA 3N11A 3TX9A 4DBSA 1SFLA 4G7EA 2GZXA 1FY6A 4GVIA 1ME8A 3LGGA 4NRSA 4A35A 3AU2A 1UR0A 2PDKA 3K8LA 3WD4A 3MA8A 3VUSA 2ZUTA 2FVKA 2ICSA 3N2MA 5HK4A 4CD7A 3NOEA 2WCSA 4UFJA 1RAKA 1OX4A 3PP7A 3PWIA 3ITTA 4Z0SA 1KLZA 8XIMA 4LB4A 1V6VA 3HQ1A 1W8GA 3TC3A 1K8CA 2WKLA 4J3SA 4AHQA 1YADA 1OVDA 1VYSX 4HKPA 2ZUNA 5DCDA 1UR9A 5GNYA 2Z26A 3M46A 3W84A 4O28A 3M44A 2DZPA 3URAA 3DHDA 3TKFA 3SGGA 4GQRA 1Q13A 1KNWA 2PDIA 1QPNA 3TE9A 5EMMA 3I4EA 2WZHA 5BCAA 1J12A 3SFKA 5B80A 2DZAA 4GI6A 2REQA 4I8DA 2G5WA 1X7FA 2WMGA 1KM2A 1MRAA 1QNRA 4AFYA 4H4IA 3CHCA 4J3UA 4DO5A 1H1YA 2V3EA 2YCEA 4V1XA 5HJXA 5CEWA 1XLFA 4XTDA 2D69A 4UTLA 4JL1A 3G5EA 5EKYA 2OYKA 5D09A 2OWWA 4W85A 1EJTC 4Y8FA 4UR7A 1LWHA 1XCXA 4WOQA 1IXNA 3BZGA 2W27A 3EEGA 4H7CA 1EHAA 1M3UA 3TCSA 4MPKA 4MB4A 4WK9A 3TXVA 3W2JA 2ABAA 4GJIA 3GVQA 4G5DA 3QY7A 3K5XA 3WLIA 2QMKA 1Q45A 1TYGA 4PTWA 3HGSA 4S3AA 3V0TA 1GEQA 4Y6GA 1R86A 3ITVA 4MWAC 4WKHA 5EMJA 1G7UA 3K4AA 2IW0A 3IUIA 3MP5A 1B3OA 3LHTA 3PPGA 1WKYA 4UOJA 2NQJA 5CPSA 1HVXA 2VDGA 1MEWA 1WE5A 1H49A 3K4DA 5A5WA 4HSNA 4XD6A 4QJ5B 4WGXA 1AG1O 4LUTA 3CT2A 2CLEA 4F40A 4PZVA 3TC6A 3RU8X 2NVAA 5D4YA 2OEMA 3L4UA 5E5CA 1W5PA 4DI8A 1ZENA 1W5MA 3HPZA 3UYCA 1TELA 2QCHA 4K7VA 1C29A 2FKPA 3EXSA 3STFA 3TYZA 3ZQ9A 1OZQA 3MSRA 2NT0A 1RP8A 4QSHA 2XZ9A 4WDWA 4IP7A 2PDHA 5DXXA 1TA3B 4H9YA 1F73A 1V02A 3U6WA 2YSWA 4JFVA 1V5XA 3DHFA 1QOPA 5CSSA 1WZKA 3QMSA 4V28A 5BWFA 2HVNA 4YL2A 1TIMA 1AH0A 4LUYA 3UY8A 1IF2A 5G4WA 3SURA 2GGHA 4WZHA 3MWCA 4CNSA 4Q6XA 2J78A 4PRWA 1W3JA 1NM9A 3IIXA 3WENA 3G0XA 1OK4A 1O5KA 4GQGA 2GGEA 2G95A 1Z69A 3C2YA 5AHIA 3CAQA 1JL8A 4MB1A 1J0YA 1WAWA 1P7TA 4GIYA 2A79A 1PX3A 5DT5A 3W9ZA 5C5YA 2CKSA 4R3UA 4ATDA 2P10A 3CM4A 4JFWA 4E3TA 1CZ1A 4ICNA 4L61A 2OSYA 4YXGA 2TRSA 3VOCA 3DKLA 3GY1A 1UWRA 3AMCA 2YW4A 3MANA 1S2UA 3R94A 5BRPA 1XLIA 3L0GA 3EZ4A 3OVRA 1ZY9A 2ZXAA 1L6GA 1OK6A 3A3WA 1JCMP 1KA9F 3IEBA 1F76A 4DWDA 1F7BA 4Y9OA 3DERA 3UR2A 1EJRC 3OQEA 3AIVA 3G22A 2QCGA 2H9AA 4R34A 1R9ZA 4ZTYA 1T5AA 2QUVA 3E0WA 4ACYA 3GNNA 1KM1A 3C2EA 1H50A 2QAPA 4MZYA 3GB6A 3BDKA 1JXJA 2E9BA 4TX6A 3NZPA 4DUWA 2FZ8A 4AX7A 3RO6A 4HA3A