2WVVA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 157
structure length 438
sequence length 438
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvvA01
5E70A 1KFWA 4UFIA 4AZCA 4BCEA 4ML4A 1CPUA 2D0GA 5CGMA 2ZXQA 4MAVA 4W86A 4OJYA 3AYRA 3IGUA 3PZNA 2GK1A 3U5UA 1CGTA 3E1F1 2GJPA 4KGJA 2VC9A 5A8NA 3TP4A 1CXIA 1J11A 3HZ3A 1WB0A 1W3LA 1R75A 1VFUA 2GFTA 3VPLA 2XWEA 1ZBKA 3N17A 5FCZA 1B3VA 1KTCA 3KE0A 3TA9A 4HU8A 1UA3A 3M07A 1GQKA 4F9DA 2J79A 2CBIA 1CZ1A 4JHOA 1G5AA 3W27A 4FNPA 3T09A 4BZYA 1NOUA 4D1IA 1W1TA 3UERA 1UR4A 2XIBA 3ZMRA 1G9HA 1XCWA 3LXAA 1FA2A 3CZ8A 5A8PA 2D0HA 4JKMA 1E73M 3IJ8A 3HG2A 2E4TA 1E56A 3EBVA 5C71A 2OWCA 5E0CA 2ESCA 4ACYA 2GUYA 1TVNA 3CBWA 4QCEA 1V6XA 3OLGA 1CXFA 3BCFA 4UOQA 4HP5A 1R33A 2YLAA 1PIFA 5EMYA 4N42A 4FNTA 4LYQA 1KTBA 2VCAA 4IM4A 3NCOA 1QNSA 3RIKA 3MO4A 1J0YA 1ODZA 4P7QA 5A1AA 1HVXA 3I3EA 5I5RA 3BUDA 2EAEA 3ZJ7A 3KWXA 3N13A 4UTFA 1JZ6A 2ZWYA 1C93A 3BSGA 3VOCA 2BHYA 4M29A 2VL4A 1LQ0A 1A3HA 2O92A 1CYGA 2X2IA 5A2AA 3LRMA 4BA0A 1H0IA 1VFMA 1UR1A 4R27A 2VQTA 3PZMA 3IK2A 2ZUTA 1VFOA 3ZJ8A 2D0FA 3AS0A 1KXTA 4K68A 3SCOA 3GDBA 1KBKA 3A47A 1NWTA 3KL3A 1O7DC 2CBJA 3AISA 5I2UA 2GDVA 2ZX9A 3VUPA 3AXXA 3AZRA 1V0KA 4UFJA 4WKFA 3TTYA 1JFHA 1ZBCA 1HJXA 3TOPA 4AYGA 4MTVA 4E8CA 3MMWA 3L4VA 7A3HA 1EDTA 1PZ2A 2XVGA 1E0WA 3WF3A 1D7FA 4FLRA 2NW0A 4CKQA 2NSXA 3WD4A 1E6SM 1WZMA 2C7FA 3W6MA 4WSKA 1OB0A 3VX0A 4IUGA 1O6IA 3K4AA 3A23A 2EPNA 4BQ5A 1R8LA 4UFKA 1UR8A 1H5VA 5EFFA 1W9UA 3WD0A 4L4OA 3T08A 3EYPA 4AD1A 1L0PA 1R85A 1HL9A 1UHVA 5I78A 1BG9A 4XB3A 3GBDA 3AXHA 3WH5A 2PWEA 4MNLA 3CUFA 4HOZA 2ZXBA 3K8KA 4D6EA 3WDJA 1B30A 1UZ4A 1MXDA 1CLVA 3J7HA 3SCPA 1EHNA 4CCCA 2IGTA 1W2PA 2XUCA 5DT5A 4LYPA 1XC6A 3CMJA 4M80A 4BQ2A 1OIMA 2AAAA 3L4WA 2DT2A 3W0KA 1NWRA 3BLBA 1UD5A 4AIOA 1RP9A 4ZXOA 4WIWA 5AC5A 1QOXA 2ZX7A 3ZQ9A 3WQ5A 3GBEA 5D4YA 2WCAA 3ARWA 2J7DA 1GOQA 4J3XA 4W84A 4FNUA 1E72M 3DDGA 3O6AA 4UQDA 1VEMA 3D52A 2WPGA 4H8HA 4EKJA 3WD1A 4WK9A 3OG2A 1GONA 4D6IA 2ZUNA 2FYVA 2X05A 3AMDA 1ZJBA 2V3EA 3A3HA 1UWIA 3FXYA 2D23A 2D20A 1R87A 4PEEA 2J7BA 2E0PA 2WVTA 3VDBA 4JIEA 4HOXA 1JF5A 1V0LA 1Q6EA 2X2HA 2W62A 2BY2A 2GJXA 4P8UA 5DO8A 1K9EA 4LGXA 1HT6A 1UQZA 4W5UA 3BVXA 2QPSA 3DECA 3ARZA 1BSIA 2WMIA 2Y8VA 4NF7A 2OSYA 5CPSA 2YFOA 3K46A 3ARXA 1HKJA 1UG6A 2YA2A 4P8XA 1US3A 4KRUA 1HKKA 4NXKA 3ARQA 3RMEA 1WE5A 1KGXA 1R34A 4E8DA 3EDEA 5AYIA 4AY1A 1M03A 5A2CA 1JFXA 5JIWA 5JBEA 3CLWA 2O9TA 1DWJM 1GW1A 3UR7A 4MB1A 3EDJA 2V5DA 4NRSA 3CHFA 4UFMA 4AEFA 3NSXA 4QP0A 4F66A 1E4MM 3TTSA 4QFUA 5HDRA 2YL8A 4V28A 1JD7A 1BLIA 2ZX5A 4W5ZA 3IAQA 5ABEA 3LRLA 1TA3A 3GNOA 2WNWA 1E5JA 4KGLA 3POCA 4C7FA 3OLEA 3WBEA 2V38A 2XM2A 2W67A 3VIHA 3MV11 2XPKA 3A24A 3II1A 1B3ZA 1V3HA 2VX4A 1E3ZA 1EHAA 1G0CA 1CGUA 1HWWA 3W24A 3W38A 1CGVA 4AISA 1E5NA 2YOCA 5DT7A 2BNJA 5A8OA 2OYKA 3WSUA 1C90A 4PMXA 4OGZA 4TTUA 4EK7A 4TX8A 4DUWA 2A3HA 2J78A 1MYRA 2J47A 3VKKA 4W88A 9CGTA 1B3YA 2DSKA 4MJ2A 5A3HA 5A2BA 2DH2A 1ITCA 1C7SA 2Z1SA 2BXYA 1E1EA 3M6DA 1QI2A 1E0XA 3KLKA 4JCMA 2VJXA 1KBBA 1XCXA 3VM7A 1R7OA 2W5FA 3WY1A 4U3CA 3GM8A 2BY1A 3VD5A 8CGTA 3T2PA 4AIUA 3MUAA 3FAWA 3LPFA 3D4ZA 3CZEA 5IHSA 1OM0A 3EJPA 2BFGA 2VI0A 3GYCA 1W91A 4ATDA 2DQXA 1EXPA 3CHEA 3WF4A 3JUGA 1XV8A 1V08A 4A3HA 5EBAA 1FFQA 4D6DA 4ZE4A 3L4ZA 3ZT7A 5FD0A 5E6ZA 2EPMX 3WBAA 5CPQA 2YA0A 1V02E 1E4LA 2E8ZA 3APGA 4F79A 4JAWA 1HKMA 2F7PA 3BUBA 2HVMA 1EGZA 4FNQA 3L2MA 2D3LA 1QW8A 1EIBA 2J8GA 1B90A 1OGSA 2WBGA 2FHCA 1PX4A 1M04A 3F5LA 3W37A 5C8BB 3VGEA 1OBAA 4GZEA 3OZOA 1C91A 2EPLX 3CUGA 2F7QA 3MS8A 5ABFA 4F9JA 3AHYA 5D9PA 4WKAA 2XVLA 4H8VA 1GQLA 4CD5A 2J62A 1OT1A 1OCQA 4AD3A 3VU2A 1GOKA 3WF0A 4ZFMA 1WO2A 4V2XA 2ZUMA 1TVPA 2VCBA 2XFFA 3PZOA 3B8SA 3ZSSA 4WLCA 1Q6CA 4W7VA 1QX1A 2F8QA 3SCWA 4D6FA 1V6WA 4MPKA 1TFVA 1KR1A 2YL5A 3THCA 3EJUA 3WEZA 1XRVA 2FHFA 4XUYA 3AOFA 1TG7A 3WH8A 1LL4A 4HZ8A 1TR1A 2BY0A 4ZEPA 1ECEA 5HOSA 2DSUA 2O9PA 3MKKA 3MMUA 3A4AA 4WKHA 3WL0A 4Y7EA 3B9EA 1R47A 3AIRA 3IANA 4AD5A 3AIBA 4D1JA 4Z2KA 2XVPA 2PB1A 4OOZA 2XG9A 4HMDA 3FHQA 4ATLA 3LPPA 3ARVA 1EOKA 1PZ3A 3WL1A 1V03A 1PJ9A 3AZSA 3N04A 2DT1A 4UQAA 1OGGA 3AICA 2E9LA 1QHOA 1JYVA 3CHCA 5BXPA 4AZIA 1XSIA 1XHGA 4UQEA 4ATWA 4J3VA 2OSWA 2JE8A 4XX6A 4Z2GA 5F7UA 3SCTA 1UWTA 4AIEA 2OYLA 1ITXA 2J25A 3W29A 4PN2A 8A3HA 1PAMA 1L8NA 5M03A 4D6HA 4JFTA 2WLZA 1HTYA 1UD3A 3FY1A 1B1YA 1GOMA 3O9NA 2GDUA 3PZVA 4AMCA 4W8LA 4LX4A 3CV5A 3EJTA 1F4AA 5HPOA 3W4RA 1R46A 2F2HA 1GZJA 1FHLA 1U30A 1V6UA 4QAWA 3LMYA 1H41A 2WYSA 2VOTA 2W61A 1OINA 1KB3A 4IISA 4J3UA 1UR0A 1C92A 4J27A 1AQHA 2G41A 1E1FA 1H49A 3VGDA 3DHPA 3WH6A 2VURA 4UNIA 4B3KA 3GXIA 1LJYA 1PPIA 3ZIZA 4W87A 1XH0A 4URIA 1C7TA 1W3KA 5A6SA 5FOOA 4FF5A 2O9RA 1GQIA 3BCDA 4PSRA 1GPFA 4ZENA 1QI4A 1CBGA 2QLYA 4YHGA 3SUWA 4FLOA 1U2YA 4JHZA 4LXFA 2J77A 1GOIA 3AMLA 1JYXA 4PMQA 1HKIA 3SUUA 2CNCA 1HJQA 3VTRA 3BXWA 1MW2A 3W81A 2FGZA 1UD2A 2NT0A 1QBAA 5A6AA 3UG3A 3ARUA 2VNCA 4U2YA 2XTKA 4TVUA 1FHDA 2OW6A 4JKKA 4L4PA 1WP6A 5EFDA 1QWNA 5TD4A 1HL8A 3ZM8A 4HZ7A 4PTMA 1V6VA 3SUSA 1CDGA 1UKOA 2YL9A 1EO7A 4PMNA 1UZ1A 4FK9A 2DIJA 1KWKA 1WDRA 1BYBA 3VDCA 4LQ1A 5A6LA 3F5JA 2WM0A 1GOWA 3BAKA 1LL6A 1P6WA 3OLIA 2WB5A 1EQCA 4RL3A 1QWUA 2XVNA 1KGWA 2RGLA 2XM1A 4B3LA 3BVTA 5CQ1A 1I1WA 3S5YA 5GNYA 1QNOA 1E43A 4KH2A 2F7OA 1JI1A 1FH9A 4DUXA 4PMUA 2QPUA 5LA1A 1QI5A 3POHA 3WELA 5DF0A 3VNYA 4GZJA 1TQSA 4NZJA 3BLKA 3DX2A 1ISVA 2BHZA 3LXCA 5BCAA 3WUBA 2V3FA 3SCUA 4PMZA 3MANA 2DSVA 3LPOA 1QNQA 4GINA 4TVCA 4UFHA 1UD6A 1HIZA 1V3LA 4MNJA 1CEOA 4NX0A 1MQPA 2XSBA 4S3KA 4Z2JA 1NP0A 2IXVA 3UEQA 5I6SA 2ZIDA 1VEPA 5LYRA 2O9OA 3WF2A 3DYPA 2C8NA 4MAZA 2G3MA 2OYMA 5IFPA 2WC7A 4PTWA 3EJRA 3AFBA 3WMCA 5GPRA 5CLWA 4HTYA 3FAXA 4FNSA 2ZUUA 2PWFA 1EO5A 3O2LA 3D50A 2RGMA 4D6GA 4GKLA 3THDA 5C70A 5M3WA 3A5VA 2XIIA 1HJWA 4M24A 3KL0A 5I23A 3ALFA 3RPMA 4R5EA 4AC1X 1W9VA 1DHKA 2ZUVA 4H41A 3GXFA 4MJ4A 3UCQA 3T2QA 4AMXA 4OBRA 3NUKA 1V6YA 2FDMA 4UZUA 2XGBA 3VGBA 3UESA 1UUQA 1UH4A 3CGTA 2XFRA 5E6YA 1JNDA 3RM9A 1UD8A 1JIBA 2W91A 2IXUA 3WNKA 2WMFA 3ZO9A 4DO5A 4CD4A 1WKYA 1E4IA 1ZL1A 3VSVA 3PHAA 4J3TA 1YHTA 4OOUA 3U7VA 1BF2A 3VIGA 3VD7A 3NSNA 3ARPA 5I77A 3CZJA 1EH9A 4PRWA 3BVVA 3CC1A 3TONA 1V0NA 5A6BD 2D1ZA 3N12A 4B9ZA 2W4XA 1UKSA 3EJQA 1VAHA 3UG4A 4DO6A 1JZ8A 3MU7A 2E40A 3PZ9A 2XN0A 1UD4A 2CESA 1TQWA 1HP5A 3T2OA 1HVQA 2PI6A 3VIFA 1SFSA 3WNPA 2VZTA 5D9MA 4D72A 1JZ2A 2J7GA 4CGTA 2BVTA 1CGWA 2FH8A 2WBKA 1K9FA 2EPKX 4RE2A 4WSJA 3MV01 2ZOXA 3PZTA 3PZUA 2BXZA 1BFNA 3FW6A 4W93A 4WJXA 3RM4A 3NDZA 5CSUA 4NI3A 3AROA 3L4UA 3VMOA 1CENA 5E09A 3N11A 1W1VA 3GH7A 3F4VA 2QF8A 1KXHA 5CGTA 2FGLA 4E2OA 2WANA 3PTMA 5EB8A 3VD9A 2VR4A 3BUQA 1MW3A 2ALWA 2PWGA 5CXPA 1H0GA 3OGRA 4U2ZA 1WDSA 1XSJA 4MDPA 3RCNA 1EDGA 1CXHA 3AIWA 4CCEA 2A3AA 1C8QA 3A22A 3EDKA 5CPTA 4OIFA 1VIWA 2V3GA 1WPCA 1JGIA 3FHAA 4W89A 4PBGA 2YDSA 1XD0A 1NOFA 1E6PA 3B9DA 4A3YA 4PTXA 1JYNA 3CMGA 1DWAM 1ESWA 1VJZA 3KLLA 1PEZA 1E71M 2X8RA 1JZ3A 1HF6A 1UKTA 1CXKA 1AVAA 1XH2A 1GORA 2XHYA 3W82A 2A3BA 3WDQA 2HISA 1HN1A 3WEMA 4XV0A 4U31A 2JFEX 3VD4A 1YQ2A 1OSEA 1RD6A 2X09A 1Q6DA 2VR5A 3QHMA 1X1NA 1HXKA 4D6CA 2ZICA 3A4WA 3NDYA 3LXBA 1VBUA 3UETA 1GCYA 3AZTA 1TZ7A 1NARA 4HMEA 1V0MA 1ISWA 3ZSTA 2D24A 1EQPA 2YBTA 1J9YA 1BAGA 1G94A 5A6BA 3QHOA 2VVNA 4LYRA 1BGAA 3OBAA 3EJSA 3OZPA 4AYSA 3RO8A 4U3AA 3RM8A 1LL7A 2WC4A 4MB3A 2VX5A 5GQBA 3TV8A 1GVIA 2DDXA 3VX1A 1AQMA 4M8UA 3CTTA 1JF6A 1D2KA 3SCRA 3WF1A 1UWQA 3HG4A 3D5HA 4UFLA 1CECA 2JALA 2A3CA 1JL8A 1BVZA 2DH3A 3BUPA 4YN5A 3AHVA 3WQVA 3PBGA 1LWHA 4YPJA 4EAMA 5AC4A 2OWXA 4JFUA 2J4GA 3LX9A 3S6TA 1NM9A 4AD0A 1JYWA 4P8VA 1UOKA 3GXNA 4B15A 4AZ6A 1HXJA 2GVYA 2G3JA 4MADA 3IJ7A 4BF7A 4DUVA 3BAJA 2CERA 1PX8A 1MQQA 2F18A 2WKGA 3BAXA 3GXPA 1VEOA 3FN9A 1GJUA 1CWYA 3F5KA 1S46A 1E0VA 1UA7A 4CD7A 4HPGA 1BQCA 4GIAA 1JDAA 2WVUA 3CZKA 2FE0A 2PBGA 3WQ4A 3KEHA 2X2YA 3MSDA 2WVVB 1FH7A 3AS3A 3WH9A 2X0YA 2VT0A 3HG5A 3DHUA 3VO0A 4AEEA 1GOOA 1ZBWA 2Y8KA 4DM2A 4W85A 2ZUWA 3DDFA 3CH9A 3WNLA 3AI0A 2EEXA 2Y2WA 3AIVA 4HA3A 2WZEA 1IZJA 2E8YA 3AHTA 1UR9A 4IPNB 3WQ8A 1W9BM 3D4YA 3ZT5A 2XN1A 3HG3A 2WHLA 3VD3A 2CPUA 2ZXDA 1W3JA 2GSJA 2D73A 2WHKA 1W9XA 5HNNA 1WZLA 4RE3A 3QGVA 3W28A 1JDCA 1B2YA 3VIIA 4AZGA 3AS1A 1QNRA 3BH4A 4H2CA 4JFWA 4UCFA 3CZGA 2EABA 2VMFA 4ZE5A 1QI3A 1W1YA 1OT2A 4PYSA 3WN6A 4OKDA 2WVSA 3H54A 5BRPA 5KEZA 3VDHA 2PWHA 3WENA 1US2A 2J75A 3I3BA 4PMVA 2YIHA 2WMJA 5DEZA 2D2OA 4QLLA 2ZXAA 4DWSB 3RILA 4HU0A 2Y5EA 1JNEA 3VIMA 4P7RA 2VZUA 2UY4A 1JXKA 3K4DA 4UOZA 3BGAA 1TCMA 1TQVA 3PN8A 3GXTA 3G6LA 4UR9A 5BXSA 4RE4A 5ABHA 3AJ7A 3GH4A 2PWDA 5HBFA 3OGSA 3NIYA 1UH2A 4CN6A 3BC9A 4W7UA 4PUEA 3FNDA 4CD8A 5JUVA 3U57A 4M1RA 3PTKA 5CJ5A 4TVDA 3ZJ6A 3BAWA 1JD9A 1QBBA 5A6JA 2GJXB 3PZQA 4IPLA 3DX3A 2WMKA 2JEPA 5IHRA 1SMDA 1QNPA 1V02A 1DP0A 2AOSA 4XZWA 3LRKA 5LA0A 4X9YA 1LG1A 3W26A 1JAKA 1VBRA 3MUZ1 3WUEA 3L4YA 5BYWA 3MUIA 4J28A 4PMYA 5BXRA 2J74A 3LPGA 1B0IA 5A8QA 4CUCA 3EDFA 4DM1A 1MW0A 1M53A 4JL1A 1GNXA 3N18A 2DIEA 3S2CA 4GI8A 3NJ3A 4X0VA 1UKQA 3GXDA 1E55A 4J7RA 4HA4A 5KZ6A 4N0RA 4U5IA 1FOBA 4BQ3A 1PS3A 2WSKA 3N15A 1EA9C 1WDQA 1E15A 3VIOA 1U33A 2CBVA 1MWOA 4MNMA 2CXGA 2JF6A 2CYGA 4PUDA 2JEQA 1UH3A 2EXOA 1OD8A 2ZX8A 1CTNA 2WMGA 4AW7A 1K9DA 2W66A 1TQUA 4GQQA 1NOWA 1LLOA 1UYQA 4AWEA 4CN1A 1QPKA 4WF7A 4B16A 4H8UA 1H2JA 3EMQA 1JZ4A 3VINA 1ISZA 4TXEA 2VVSA 1WZKA 1WNOA 4ZXLA 2D22A 2A3EA 4JZ5A 5JBDA 4JFVA 5I24A 1C3FA 1GQJA 4YHEA 2WKLA 2ZUSA 2W63A 3DX4A 2CEQA 2CIPA 2TAAA 3A21A 1XGZA 3RJXA 3WY3A 4PCTA 1QHPA 2VRJA 2CETA 4PTVA 1O7AA 1DWHM 2G3NA 4KMQA 4CU8A 5BXTA 3WKZA 4HZ6A 3PZGA 2F1BA 1V3JA 1IZKA 2B31A 1A47A 4DO4A 1E70M 5CSYA 3SEPA 4FMVA 2XWDA 5HPCA 3WDIA 2F61A 1ZS2A 4X0NA 1VB9A 2YDRA 3SUTA 4ACZB 2WK2A 1Z32X 2XJ7A 4C7GA 2J7FA 2YFNA 2C0HA 2EADA 2WC3A 3A6OA 1M01A 5M17A 2OW7A 1XYFA 2J7HA 3VSTA 1DWFM 1V3IA 3CZLA 2EJ1A 1X6NA 4TTGA 2EBNA 3H53A 5IDIA 5I79A 1AMYA 1B9ZA 4DWSD 4OBSA 3AQUA 3CO4A 2DT0A 6A3HA 1CXLA 2YL6A 2YDQA 1JZ7A 3WQ6A 3IJ9A 1E6RA 3AMKA 2DGAA 4NSBA 4GO8A 5ABFB 2XN2A 2Y4SA 4MDOA 3SUVA 1HNYA 4NZCA 3QOMA 3ZR6A 3K1DA 1DWIM 1RPKA 2V5CA 1V3MA 3BVWA 1HX0A 3S5ZA 3BUIA 4JKLA 1B3WA 3TTOA 2BS9A 5FL1A 4CN4A 2WAGA 1NH6A 4PMDA 5D8WA 4C7DA 3PZIA 2DSZA 3K8MA 4HA1A 1BHGA 1HJVA 2EO7A 5A69A 1DTUA 1VFFA 4V27A 5HXMA 2E9MA 5BRQA 1E3XA 3AIUA 1J0IA 2VQUA 4CU6A 1T0OA 3A4XA 2CITA 1LF1A 1KWGA 3VGFA 3M7SA 3PTQA 3AHXA 1NQ6A 1I75A 2YJQA 2CHOA 5AYBA 3GZAA 3SCNA 4AZHA 1NWUA 3ZJKA 1MQRA 3U7BA 4F8XA 5FKYA 1UWUA 2WWDA 4H7VA 2WVVA 1H4PA 1TQTA 1TE1A 2F1AA 4GQRA 4TOQA 4MNKA 4B9YA 3GH5A 4AD2A 4PMRA 3GTNA 1GUVA 1BYAA 2VRKA 1BYCA 4AXNA 4CVUA 2BV9A 3N1AA 4UQBA 2JIEA 2QV4A 1KXQA 1E6ZA 3W6LA 4GI6A 1J01A 2V3DA 3UR8A 1N82A 1W2VA 2XYLA 3W53A 2E9BA 1B3XA 4HOWA 4AZBA 3ARYA 1J0KA 1SMAA 1W9PA 4HPHA 1E6NA 2Z1KA 5ECUA 2VCCA 1BPLB 1RH9A 5A6MA 1ZU8A 3AIQA 3AMGA 3AS2A 3BVUA 3T0DA 3T0BA 1CGXA 3OGVA 2OSXA 4HMCA 2JIWA 2Q8XA 4P7LA 4PCSA 3ZR5A 3AHZA 4DWSA 1WAWA 3VILA 2DPEA 1WZAA 3EMZA 3U5YA 3WNMA 2G3IA 4AMWA 3MUY1 2UWFA 1NWSA 1MXGA 3EDDA 1DWGM 2DSWA 4AZCB 2WCSA 1DEDA 2OWWA 1W3HA 3VVGA 2VZSA 1XSKA 2OLHA 2NT1A 2GK1B 1R86A 3SCVA 4FLQA 3W25A 3GXMA 1HJUA 1KCLA 1RP8A 1VENA 4QLJA 1UWRA 5LA2A 1IV8A 3I3DA 3QHNA 1JZ5A 3BMWA 4M56A 4CVWA 3KZSA 3AMCA 3M46A 4EANA 1ZBVA 2WW5A 1FP8A 3BMVA 2CBUA 1UKPA 1BVNP 1D3CA 2CKRA 2XFYA 1BYDA 1OWQA 1H1NA 1KXVA 3VIKA 1JAEA 7CGTA 3CIVA 4NZFA 2BVYA 2VRQA 1E9LA 1WDPA 4CU7A 3EMCA 3MSGA 1GJWA 2QHAA 1W1PA 3NSMA 1M7XA 5BROA 2X0HA 1J0JA 1J12A 1PIGA 4LPCA 5E9AA 2WHMA 1BGGA 2XVKA 1UR2A 1OD0A 1JI2A 1UQYA 4KWUA 2WXDM 1B31A 1I1XA 4OZOA 1MFUA 2MANA 2DT3A 4E4PA 3MI6A 5A6KA 4A4AA 4GO9A 1W32A 2WHJA 1X6LA 1G1YA 1V3KA 2PC8A 3MMDA 3WDPP 2W92A 1C8XA 4M82A 2DEPA 1SR0A 1KQZA 2E3ZA 1TUXA 4GPNA 4GXPA 4D6JA 3G6MA 3QOKA 1AQ0A 3WQWA 2VZVA 4UZSA 3WNNA 3VNZA 5JIPA 4EE9A 1ISXA 4DWSC 4D71A 1KCKA 1HJSA 5D9NA 1CXEA 3DX1A 5E1QA 1HP4A 1XD1A 3QR3A 1EDQA 2WLYA 3HU7A 3WEOA 1QVBA 2BY3A 4U33A 2WWCA 1KQYA 3WDHA 2BVDA 2WCGA 4S3JA 1ODUA 4W8BA 5FL0A 3TTQA 1SYTA 3BLPX 2J8FA 1H09A 1J0ZA 1MW1A 1FH8A 5CLTA 3BAIA 3HMCA 2X2JA 3WIJA 2JF7A 4AZ5A 3ARRA 4OUEA 3BSHA 5IFTA 4P8WA 1E40A 2FH6A 1C8YA 2PBOA 1QI0A 2IUZA 5AY7A 3OB8A 1FP9A 1CGYA 3WDRA 5JBFA 2BHUA 3SCQA 3AXIA 4ACZA 1G01A 1Q6GA 3WUGA 4GZIA 3SCSA 1OIFA 4Z2LA 5GNXA 3H55A 2ZX6A 4UOJA 4JCLA 3CPUA 5E0FA 3D3AA 4AZ7A 1VF8A 4CCDA 3IAPA 2CHNA 4TUFA 2ZE0A 1PBGA 3CUIA 2D3NA 4KRTA 4P7NA 1PX3A 2X1IA 3CHDA 4QDMA 3WUFA 2YKKA 2WMHA 3ARTA 3L4TA 2F7RA 3KL5A 3SURA 1K6AA 1CNVA 2VO5A 2QMJA 2J7EA 5FIPA 5DFAA 1LWJA 1MFVA 4AD4A 3T0AA 3UG5A 5GNZA 3ECQA 2Y24A 4NRRA 1W9DM 4Z2HA 3CZNA 2GJRA 6TAAA 3ALGA 1ISYA 3VMNA 4Q7NA 1J10A 1BG4A 4M81A 2UY3A 1GVYA 1IT0A 1NP2A 3WY2A 4P7OA 1F4HA 3BAYA 3AYSA 4GI9A 1Y7VA 1E4NA 4JFSA 3N9KA 2J7CA 3VIPA 3D51A 3B9AA 3DYMA 1SZNA 2WZIA 5CG0A 4BS0A 3VGGA 1JXJA 2FHBA 1E6XM 7TAAA 1J0HA 2YLLA 4MB4A 1XYZA 2G8ZA 2VX7A 1UASA 3L4XA 2EPOA 2CKSA 1CLXA 5A94A 1CIUA 1J18A 4PSPA 1BTCA 1KR0A 2UY5A 1H3GA 3WNOA 3GNPA 4XZBA 1KGUA 1Q6FA 2CCRA 1QHZA 5CZKA 4UQ9A 1WCGA 4U5KA 3WD2A 1LG2A 6CGTA 1JG9A 2WSPA 5M5DA 2AMGA 1H11A 2PF0A 3DX0A 3WFLA 4PMOA 5A8MA 5ABGA 3OA5A 3WD3A 2WMIB 2XGIA 4W8AA 2ZWZA 3CUJA 3OLDA 4CD6A 3WH7A 1TMQA 3AIEA 1GHRA 1ZB5A 3WMBA 3GNRA 2XSAA 2YBUA 5D8ZA 1R7AA 2EQDA 4H04A 5I3DA 3DC0A 2QMKA 2WZHA 4MB5A 3VMPA 5A95A 3RJYA 1Q4NX 3VM5A 1QW9A 4UQCA 3WFZA 3HJEA 1ZJAA 5I0DA 2VUYA 1GHSA 4NXSA 1OGBA 3NYDA 2VX6A 4W7WA 3CZSA 3DYOA 4TX6A 3WY4A 3RDKA 3HN3A 3WMSA 3VGHA 3ZT6A 4Q22A 2VZOA 3CUHA 2EACA 5D9OA 5IXEA 4QCFA 1TA3B 1VJSA 2YA1A 1E6QM 2G4FA 3ZOAA 3OIHA 1FFRA 4QLKA 1VRXA 2UY2A 1UWSA 1JDDA 3ARSA 4FNRA 4BQ4A 4JL2A 5DMYA 5BWFA 3VSUA 4FLSA 4J3WA 1EOMA 3SIMA 2VTFA 4Z2IA 3VIJA 1K9TA 1XH1A 4J3SA 3L2LA 3VDAA 3K8LA 1MVYA
chains in the Genus database with same CATH superfamily
3IXAA 5KVFL 5A3IC 4LAUA 4LLAA 4MAVA 3IGUA 1CDJA 1MRCL 1CGTA 2IOIA 2R0ZL 3OF6D 1PCSA 2RCSH 3P3SA 1YN6A 3NFSH 1RD5A 4QLRA 5CPNA 5EU4A 3T71A 1KTCA 2B5IB 3K2IA 5DHVB 3IE4A 1DR9A 4BY3A 4LCUB 4C6EA 4A67A 1NOUA 4ENEC 4KEMA 1M4KA 5C9WA 3EYUH 1F5ZA 4QTGA 2IEPA 2V5LA 1JWMA 1SDDB 4U4IA 1A7QL 2VDKB 4P23B 2V9TA 3U0PA 2JV6A 5E0CA 3CN2A 2X4RB 1V6XA 4XGZB 4N42A 1AFVL 4RAUB 1SEQL 1HHKB 1S2UA 3H7VA 4Y16A 1RULH 3VTTA 2F84A 5A1AA 4JO1H 4IQDA 3G0UA 1BBDH 4AF0A 5BZWB 3KFTA 1YA5A 2YC1B 4R3SB 2XQBH 1UEYA 1CF8L 1UR1A 4QRAA 3GYEA 3UROR 3N44F 5C0CB 4LWWA 2Y36H 4K68A 4YC2B 3RVVC 3QEGL 1TKWA 3NQAA 3QUML 5F7WC 2A6DB 2JKLA 5D7LE 1NLDH 4AYGA 3VNKA 2EDHA 4BFIA 2C13A 3GS4A 3WIFB 1URLA 2TPSA 5H2BB 2VAJA 3WOVA 3DA0A 1OB0A 3BZEA 3DFTA 3RE0A 1FE8H 2B14A 4ODWA 3MB9A 4W6YB 1ADQL 2QW5A 1UJ3A 4QHKI 2B7PA 4QEEA 2R1XA 2ATAA 4HT3A 4XP9H 3HUJB 1NL0L 4WK4B 4CNIB 2H1PH 5I1AB 3ITGA 2P49B 2MQ0A 4FQQA 2L8AA 1UXWA 4CCCA 4XNDA 4XBMA 3G7TA 4WGHA 2QLVB 3KM8A 4HHHA 4C6LA 3W0KA 1CD1A 5FACA 4JG1H 4DKEH 3A3XA 1AD9B 3OTRA 2OODA 1DQQB 2HVKB 3AXMA 3A67L 5J3HD 2DQDH 4Y4FB 3C12A 4N02A 5B39G 1FIEA 4NQXA 4O5LL 4BKNA 3FSUA 3C5QA 4NKQB 1QEXA 3B83A 4PB3A 3MUCA 2M8XA 3RVTC 3HCVA 3GJEB 1V0LA 3EXRA 3VACA 5FV1L 1VR6A 1SM3H 3U4BH 4BEQA 2CLRB 5I8OH 3L3OB 2I56A 3ARQA 3RMEA 3NP4A 1OSYA 2HLFD 1WXYA 1P4BL 3V16A 2FD6L 3QDHA 2GT9A 1AACA 1SLWA 4PV8B 4UNLA 4MB1A 3C8DA 4IL0A 2V5DA 2DLIA 3GLDA 4QP0A 4HUKB 1KB5H 4UV7H 3TTSA 2QNEA 2V5SA 1YZZA 1IC7H 3V6ZB 4MXQD 4KMTL 3A24A 4PRDB 4WHCA 3KW3A 1NLBL 1K6QH 1E5NA 4W9EC 1P1ZB 5XIAA 4YDLB 2PDGA 3MJ8A 3F5WB 3UY8A 4G6MH 3KVJA 4QHUA 2DSKA 2J44A 2P5WA 3TWCL 1E1CB 2LGNA 3GG7A 3SOBL 3OKEB 4L8DB 4JOMA 1N8IA 3TO2B 4WEMB 3GI8H 1KIPB 3TL5A 4AIUA 1N2VA 3X3GH 4RV8A 3FC8A 5I0XA 4KNUA 3D09A 3ULUF 4ML9A 4G6JL 1WK0A 2FYYB 5IVXE 1J6PA 3QEUA 4N0UA 4NZ1A 4FA8A 4YH6A 4BM7A 3ZTCC 5JW4R 3AXLB 1GR7A 1SBSL 4A04A 2R91A 4NRZA 4FNQA 2P3YA 1AO7B 3CXDL 3LMZA 4D9PA 2Y3AA 3T0EE 3PWPE 4KPHL 2Y07L 3F5LA 1NOLA 4MVAA 3OZOA 3TS8A 3MTXA 5I1CH 2KPWA 3QUMA 5L0QC 4RQQB 4GKNB 2A73A 4YE4H 3QIWB 3H9SD 4GYPC 2F38A 5HMDA 3B0PA 3NSCA 2ZUMA 3MMEA 4XZ9A 1URIA 2PCQA 3N4AA 4W4OA 4D6FA 2K70A 3FUKA 4PJHA 4QXTA 1S7WB 3UTTD 4CEUC 3F83A 2IF7A 1W72A 4WKZA 4DF0A 4DK5A 4C6BA 1QFWI 4ZX5A 1SQMA 5KYXA 1N5AA 4F93B 1MF2L 5IIEB 1SXCA 2Q8AL 1ORSB 5C0JB 3CWNA 1O4UA 3B9EA 4L4VE 4XPTH 5AOIA 4FQIL 2W5PA 4Y1TA 3UTOA 1M57B 4G8IA 4JEQA 2DI9A 1EOKA 3UU0A 3NVQA 2NY0B 4MASA 3LS5H 1XHGA 4NQ1A 4PI0A 4YGVA 3L5IA 4Q6IC 3EKGA 3U4EB 3TIMA 5DZOA 3NTCL 3W29A 3BZFB 1EIXA 3LCYA 1BSLA 1G5GA 1QUMA 3O4LE 1EFZA 4AMCA 2YO3A 2VC2B 3OTTA 4XNYL 2ROXA 5J4MA 1KB3A 1J1PH 3SQOH 4DPRA 2WZMA 4YCPA 3B8UA 4RBPH 1HXYA 4H7ZA 1LJYA 4OGAD 1TJ1A 1PHQA 2O9RA 3W2LA 4LASH 4ZENA 1HAUA 4UM9D 2E76C 4UTCA 4QTFA 2J1XA 2LVCA 4N8CL 2WBJC 5LGJA 1I1FB 5L2JB 4HLZH 1YEIL 3TBYA 3LN9A 4XWOD 4NY2A 2GSMB 2PPFA 4U2YA 2EYRA 1WQ5A 4ICWA 3MREB 2PW2A 4DJEA 3ZM8A 3RA7L 2YL9A 2QELA 4V1DB 1MNZA 4A2MA 3TN0A 2WB5A 4NZTH 2PP8A 3BVNB 4NQDA 4C1LA 2NUWA 4H4NA 4Y4HB 1PZAA 5FXCH 5AAMC 4G8FA 4BE5A 4NP9A 3PBUA 5IROC 5HHMB 5F44A 3T1FB 3QHTC 3MVTA 2NY4B 1YYML 5C0FA 1MCHA 1ZSDA 1XP3A 1AMKA 5FF6A 2YD6A 4Q89A 1Y6NR 1HI6A 1FVCB 4EZLA 3K72A 2ICWB 1FNSH 2UZIH 1JK8A 5F4SA 1YEEH 3Q5OA 3WF2A 1IHIA 3ATBA 5JO5B 4GAJL 5D8JH 2Q5BA 4Y5XB 4CW1A 1FWAC 5C70A 2HK1A 1L5GA 3ZQWA 1PZDA 4DN4H 4YBLB 1MDLA 3T2QA 2FK9A 1UH4A 2NY5H 2BVWA 1JNDA 1WUFA 3GHPA 1NBQA 4X61A 3P62A 1E4IA 1LNUB 3C6LC 1E8ZA 2FL5B 4E68A 3BP5B 4AQAA 3QYNA 2YSSA 2HUEA 1QSFA 3CC1A 1HO1A 4ZT1A 3T65A 2QSQA 3WQPA 4KMLB 3VQLA 2XN0A 1UD4A 1KFJA 3MW7A 2CBMA 1PIIA 5F1VA 3VIFA 1IJ9A 1E67A 3ZY7A 1EF2A 1CGWA 3CHPA 4LGSB 2E25A 4CLMA 3SO3C 4W4QA 4RX4A 3PZTA 4H26A 2PYFA 4XWGH 5DJAA 3SY0A 4L4TE 2Y5SA 3GI9L 3FTZA 3SDDA 4LSRH 1FCGA 2Z1BA 1KXHA 5AL0A 3VUAA 3VD9A 2CGYA 4N8VA 3QG7H 1MW3A 3FJ4A 2O5XL 4MA3A 4PREA 1FFNB 2OAAA 4PJ7F 4XO3A 4NKIL 3SDAB 1ZTXE 5G5DB 4A2HA 4IIDA 1YRRA 1H1ZA 5LIYX 3BW9B 1HF6A 4PRPE 1W72H 4MX7B 1SEBA 4PJDB 4MNHB 1IAIH 4WHTA 2JFEX 3ASOB 1RD6A 2NQ3A 1HXKA 4GKZA 5CKSA 4XXWA 3PF2A 1G7LA 2D31A 2APSA 3LJ3A 5CZRA 3ETSA 3KPRB 1CFTB 1J9CT 4UNTA 3UCDA 4XODA 5I66A 1MFAH 1JGEB 3JWDL 3RO8A 1LD9A 1HTIA 4FQCL 1LL7A 5C9JA 3MLSL 1E9IA 4OFYD 4MB3A 4XAPA 4O4VA 4AVKA 3B3BA 1HL5A 4DJDC 5AZEL 4PRAA 4GC3A 4R85A 5B80A 3QPQC 2KZ1B 1E9QA 1G1CA 5FW8A 2GI7A 4JS3A 1UIOA 3LN5B 4ECLA 1KBIA 5E6SB 3BAJA 1AR1D 2ZYRA 3D0LA 2Z8RA 1OWWA 4KITB 1T89A 1H5BB 5LGHH 2PO6C 2X4NB 5EZJB 4UUJA 1QVOB 2ICES 1FL6B 4YDJB 3Q5TA 3DHUA 3RPDA 2ZUWA 5B4MD 3BUVA 1QRKA 2CHDA 4NQCB 2VL5B 5EN2A 3WQ8A 3UP1A 3ZT5A 1AD4A 3VVWA 2FD6H 2NVDA 3BGJA 1DQVA 3RFAA 1BVLA 1AE6H 1HGYA 2NZLA 1JDCA 3UO1L 3TBVB 1QNRA 3CZGA 3EX2A 4KCTA 5FECA 5ICYB 3WN6A 3MZTA 2NNFA 2D2OA 4QLLA 5FGBA 5TK2A 2G5BB 5FSEC 3B3IA 3UPAA 3RDTA 1I31A 1IQDB 4JQIH 5DMNA 2EVIA 1DLFL 1OX4A 1N4XH 5AQ0A 4N5UA 4REQB 3WBDA 4CN6A 4PGDA 1MWAL 5JUVA 4OFKA 1AGEA 2UZXA 3HGJA 1Q1PA 3SOBH 1QBBA 3N2MA 5A6JA 1RIVL 4F33B 3WQCA 1AH0A 1F11B 2YKLH 3UXIA 3GY1A 4X9YA 2LV4A 4PMYA 4A8NA 3KR3L 2XTLA 1O7VA 5JQ6L 3HN5A 3DETC 5HGDA 3V6BR 4FA3A 3LTPA 4GI8A 4PGJA 1RK1B 3KLHC 4R83A 2FT6A 3DGCR 3JTSA 4JRYD 1F9CA 3VXTA 1XCQB 3F7PC 2WMGA 4N1CA 2K6ZA 3S37X 3TQKA 4WFFD 4GQ9L 1QZNA 4AWEA 1QPKA 4PS3A 1C5DB 5I1KH 1K4CA 4FCHA 4N7QA 3NPUA 1TZGL 3V8OA 4O1DA 5CP3A 4G8EB 1FKWA 3V0GA 5F3FA 2O0TA 1GQJA 2M83A 1ALDA 4JDZA 3HNVL 4CU8A 3LNGA 1SW3A 5SWSD 3JYBA 3OA3A 4W9IC 5G55A 1Z32X 4FQIH 4AC7C 1SDAB 1NICA 4ZUUB 4BH8B 5CBEA 3VSTA 3O0RL 1S8DA 3MVIA 1R9XA 1NKOA 5I79A 5T8GA 5EB9A 4DWSD 1T4KA 3GEFA 2ITFA 3NTCH 4RNFA 3ABRA 5ADPL 4FN0A 2NX3A 3FQXB 4GKSA 2C16A 4JFED 4V11A 4XN7A 4P8QA 1QRQA 3P3UA 1IGCH 1U3HC 4HKZA 4U6YB 2UZYB 2F19L 1O94A 5LN8A 2Z8WC 3BPNC 4JNZA 2HT4D 1W6WA 5D1QB 1RXLA 5AAPA 2EO7A 5D1XB 3ITTA 3D2TA 1R19A 1Z9PA 3FO9A 2G37A 5C0AB 2F74A 5DUJA 4JHUA 2JTYA 5FYJU 1WTLA 3OKNB 4HETA 3EKZA 3BMXA 4IJCA 4PY8I 1BD2A 4ZDHB 4Q9CA 3ZWSA 4F8XA 3SYQA 4IWWA 1GYMA 5E5MB 4R88A 5D5MB 4ONFH 4KK9D 3VFRB 5AUMB 3UXFA 3EEGA 4P2VA 3VFCA 5AAWA 2L5HA 2G3XA 4QYAA 3W75A 3H22A 2QEJA 2I25N 3BPLC 4MD0B 3IEBA 3ME0B 4GEJA 4HLJA 4IRSA 5FEWA 4HOWA 2VCCA 4PJ8D 4GXVL 3FOMB 3HI1A 1MWAA 4JO2L 4NIKB 1OCWL 4JG0L 4S2CA 1DXIA 5CZ0A 3AREB 3LOTA 1PCWA 1R5YA 3WUZA 3IMBA 2A7BA 5DRXA 4APXB 1XSKA 4KH9A 1PTZA 3SBWC 3W85A 5HYJB 2EDXA 3GG8A 1P5BA 3BISA 4GAJH 1KYAA 3WK1A 2P43B 2FLMA 4N85A 1DCEA 4HJSA 1UCTA 4R9OA 3R1GH 4GB9A 1W1PA 4QF1A 3K91A 2H6PB 1M7XA 2J5WA 3G8RA 4KWUA 4UTAL 4GXFA 2MANA 1MHCB 2DEPA 4F4RA 2YQGA 3RR4A 3G2GA 3PY9A 3ZE2B 2VDLB 5JA9A 5IUSA 2ITDA 4OQTH 1KBGH 4EE9A 3NPSC 4X9HA 1Z7AA 4QG9A 3L9EA 1NVMA 3FQTB 1QVBA 3B40A 3WDHA 4EDXB 3NCMA 4RGMC 1HDMA 5DJDA 4KVNL 2P5ED 4ZXBA 3RB5A 4DF1A 1N6QH 1JNLH 2EO9A 2CDEA 1H3TA 1SHXA 5JIMA 1HNGA 1EEUA 3STLB 1XXDC 2F8OA 1TZ8A 5IM7B 1KKRA 4YXHH 1A7RL 4I90A 4BUGA 3D3AA 1PBGA 5C08B 2G9KA 4J1UB 5CGQA 4HJWA 1R3LA 5LSMA 3NM3A 5AYXA 5C97A 2H32A 1JXGA 4XMXA 2BVPB 3KRUA 1ME7A 2PGWA 2OX5B 2OMXA 1FZJB 3O3RA 1W9DM 4LSSL 2F54E 5AB1A 1KEMH 2PS2A 1J88A 1KULA 4QDGA 4OTXL 3UPCA 2DL9A 3CSTA 4KROC 3WD5L 2CRZA 1R0MA 4QRRE 4OJFH 4UIKH 1TELA 3AQYA 3QQ3B 1XYZA 2QCDB 2ZCHL 4LQFH 1YUHA 5JZ7D 4NOBA 4UTTA 1H3GA 5KVGE 1P4CA 3TYEA 1OCJA 2XVBA 3MLSH 3O3AA 4MGGA 2Z93A 5JH1A 3CHRA 1BQGA 5IUCA 4DQWA 3LEXB 2QDVA 4WXZA 3WX7A 3N34A 1CTMA 3PAJA 2ZWZA 3QK0A 3LZ5A 4FX8A 4XNUL 1A6ZA 3E74A 1U95A 3Q2WA 2XSAA 4Z7NB 1R7AA 1OABA 2F7FA 1EJXC 4IIBA 4E4UA 1JRHI 5I3JA 4F8QA 1QW9A 4A2SA 5C54A 4K9EL 3NYDA 4RAVA 3GMNA 4JNXA 2K45A 5GZOA 2EACA 5E9DA 4ZAKD 1TA3B 4AV5A 1MUJB 2XN9B 3MLWH 4RRPA 1UWSA 4XB7A 2VFGA 3W23A 3VSUA 4HKXA 1L0QA 5I02A 2A38A 2JCWA 2Z1PA 1I1AA 3S3SA 2OLSA 3BRDA 2NQCA 4KGJA 5A8NA 2FZNA 1J11A 1YVLA 4UTAA 3LXUX 3DH7A 4ZMQA 3QAQA 4KT2A 3MY9A 3N17A 4Y2DC 1NAML 3KE0A 5KSBE 2HWZL 4Y90A 1BLNB 3FRUA 3FQRB 4K94L 2QDGA 5C92A 2JF1A 1DLFH 4GW5B 4ZO9A 3IJ8A 4G7RB 3W7MA 1JPTH 4UINL 1XH3A 5EU6A 1R33A 1D3HA 1TWWA 2P9RA 4UNVA 1RIVH 3FT2B 3FU0A 3VA8A 1ZK5A 2POZA 4HAKA 2HNHA 4JO3L 4Z18A 3BVJA 3VKDA 5H1WA 4M3HA 4C1NB 3ZJ7A 3N13A 2WHVA 1F1DA 4QYOA 4M9PA 3WLLA 2PD5A 4M6QA 3L9RA 3I6KA 2A99A 1CYGA 4OZ4A 3RB7A 3ALXA 1TZ9A 4P2QA 2BOBA 3RVXD 1GTFA 4O8AA 3ARBA 4G9DA 3JZUA 5BRZD 5A2KH 3H4XA 4IBLT 2AXFA 4O13A 2EIEA 4X5QA 3DO7B 3AXXA 1V0KA 3ZVHA 3GC4A 1HS6A 1C8VA 2X1QA 1WBJA 3PTDA 3CFTA 3MWAA 3QRFM 3QZOA 1KUMA 4HZLB 2XXMB 4WW2A 4M61B 3WKPA 3WF3A 4G8TA 3VC6A 1AYRA 4YK4B 2EZ0C 4B0MB 4N2HA 3ZR4A 2EPNA 2V82A 1XIHA 3ESPA 3Q6GL 4TM9A 4L18A 5KANG 3UTZA 3IE9A 4MWAA 3BKJH 1LK3L 4YFLI 5FM8A 4PP1C 3QULB 4WDXA 1NGPL 4GH1A 3IKCA 5T1DH 1UROA 5EFIB 3ZKSD 3UIZA 1OY3B 3VFOB 3NDYE 3SE9L 4I1NB 2FX7H 2V17H 2W9DL 3O15A 4AEIH 1B6DA 3X3FH 2VLKA 4JFZH 5B7FA 5CWSA 1JZJA 3CUPB 2DZEA 1RVFH 3D52A 5AZ2H 1D5MA 3X1EA 5T1KB 1JNHB 1DJIA 2F15A 3K71A 2WNQA 1G0YR 2HP4A 5F1UA 2Q8BL 4GRMA 3SKOB 4X6CA 1RUKL 2BBFA 3GTIA 2V3EA 3V0HA 1UWIA 3FXYA 1MEXL 1E3FA 3MRFA 3PIQA 5EHFA 3BARA 4KRPD 1TVBA 4NBXB 4JGMA 1QPNA 3MCMA 5E5CA 3OAUH 1BOGB 2H32H 2IPKB 4PUJA 4ZMLA 3NEVA 3S37H 2HRPH 2E7LC 4TLKA 4NF7A 3O8XC 1MIEH 4IXHA 1RZKL 1W8NA 4YR6B 2VABB 4GQZA 4K39A 4NXKA 3SQBA 4L1SA 4WFEE 1JFXA 4PMEA 1AIZA 2O9TA 5GJTH 4DF9A 1T3FB 4TSAH 3CHFA 5KYWA 4NCC2 4DZ5A 1UB6B 4EPSA 4F66A 4JQVA 4C57C 1U8KB 4ZFZA 4ONGH 5ABEA 3LRLA 4X99A 1QSEA 1A1NA 3IJIA 1HQRA 1J5CA 4ZTXA 1RQBA 1Y0LA 4I2XB 5LNEA 2OZ4A 1NAMA 1JCNA 1SPQA 3GK0A 4BFGA 2Y6SC 5JLZB 3O16A 4U10A 3DI3B 2A5UA 4AISA 3QORD 5A8OA 1DBKH 2OYKA 3PSWA 4HN8A 2KZKA 4MJ2A 4HD9A 4P5RA 5HI5D 4JO2H 4IBVA 4B3ZA 3BQVA 4OIAA 3UC2A 2OV0A 3C2VA 1Z8AA 1WUNT 3ENLA 3LIZL 3RVWD 2CKBB 2VDRB 5T3XE 5IHSA 3G24A 3K2GA 3E2QA 3WF4A 3JUGA 3I9PA 5MI0C 3URAA 1X7QB 1XR9A 3ZYZA 4MM1A 4O1AA 4KY2A 4PB9L 3L2MA 1A22B 4HYTB 1ZA3A 3N2TA 4PVMA 1B90A 4MJ5B 1MSSA 3EW3B 5JR1H 1Z6JT 2Q3AA 3I9AA 2Z27A 1OPGL 3AHYA 4WKAA 5ID0A 1ACXA 1OT1A 3TF7C 2XTJB 4N4QA 1AQDB 2O6PA 2XHNA 1TVPA 5KYUB 1XSOA 4DXKA 2NY3C 3FFDB 1M9SA 2F8QA 2AQ2A 2Q86A 4UTAH 4L80A 1NOAA 3V4BA 1QLRA 2RCSL 5C0RH 4BR1A 3MUJA 3NFSL 4LU0A 5D2NB 3ZKMC 5C0EB 1DIOA 3QNZB 3QPZA 3DRQB 3F00A 3EF7A 4DFHA 2YQ2A 3EYUL 1WKEA 3TNBA 5AZUA 5CGYC 5BZZA 5AW4B 4CKVX 3S1GA 1VACB 4KVNH 5LB1A 4NZUH 2GABA 3U30C 1BXCA 3VXRE 5HWNA 4P5TA 5F7UA 5J9PA 1F74A 1RULL 4BCXA 4Z78B 4JO1L 5SWZE 1BBDL 2WLZA 4NYLB 3ARFA 1ZY9A 5AD0B 2OTWA 2WLIA 1GOMA 3TYDA 5C3IA 1F4AA 3K3QA 3AU1A 2XQBL 2HVJB 3HLAB 4R34A 3MV7D 3O41A 1R2TA 5AHEA 2AKRA 2Y36L 1GGOA 4LCIH 4M48H 3TO4B 2IH8A 3OX8A 3L1OH 2VURA 4J3OF 3TH3T 4W87A 2HN7A 4LY4A 3QWOA 5K9JH 1NLDL 2CCLA 5KOVC 3BWUF 4QNPF 5DVMA 4YAQA 5CC3A 5ILTH 4PR5A 2CZNA 3VTRA 3K5XA 5LXGH 1FE8L 3ARUA 1G7JB 1RY8A 4C5ZA 4JKKA 3G5ZB 4L4PA 1I53A 4NX5A 2BP0B 5HVHB 2Q2EB 4XP9L 3C56A 4YUEH 1LEGA 3C2RA 3UXLA 2H1PL 3FUEA 1GOWA 1LL6A 3HGSA 1NGWA 3O11A 3BQUB 5MF5A 2A6IB 1YKWA 3FFSA 4KH2A 1Y07A 1A14H 4AC2A 3EH5B 1RZFH 3PC0A 4AEHH 4YDZA 4DKEL 3LIZA 2WLHA 2VQ1B 2DQDL 4O1CA 4PJGE 3P0YH 1OGAA 3WUBA 1ZA6A 4PMZA 2XH4A 1EBPA 3QBTB 5BOEA 2NXZB 5DCBA 4ELKA 4G7FA 4CDGC 2I27N 3VJ6A 4S3KA 4U1SA 5KG9A 1Q45A 2WUBH 1OF6A 2VE6B 2NQJA 4FXKC 4JJ5A 1KYUA 4PS7A 2O9OA 3LKQA 3SGEI 1SM3L 4YHIA 3SIKA 3U4BL 1H62A 1ME9A 1OFBA 2PWFA 5I8OL 4Q97A 2KUTA 4RBPK 3IARA 1HJWA 2UXFA 5I09A 3DX8A 2EUZA 1DHKA 2PXYC 4XMLH 3VGBA 3GM0A 1XPYA 2JJSA 5D2LE 4DK3A 1KGCD 1KB5L 4UV7L 3EX4A 2XFRA 3DJ9A 4O11A 2DEXX 1VKXA 5C9RA 1IC7L 4LPXA 2W91A 2FWSA 1HESA 2OZ4H 3HAEA 4ASTA 4AH2B 1INDH 1TLMA 4FR1A 2H1LM 5HWJA 5L6UA 4C65A 1K6QL 2WXIA 2PRLA 3RAOA 2XIOA 4U1MB 3E9TA 3N29A 4G6ML 3KS0J 1RJYA 4URKA 1FYTE 2BVTA 5C09E 4M1CC 2Y88A 1B57A 3RM4A 1DVXA 1I8JA 2F5AH 1JTOA 5FF2A 3NA8A 3X3GL 2J1KA 3H2CA 2WWMC 2QF8A 4A2LA 2Y5TB 3U7WH 3SDXA 4DCQA 4PU2A 2H3NB 3OR6A 1UVQA 3IJEB 3P9MA 2DLGA 1N6VA 5E8EB 3AIWA 1U4EA 4HKJB 1RCXB 1V7YA 2OX4A 2WXMA 4UDTB 2X16A 3UJTH 5L7XH 2YDSA 5I1CL 4EPKA 4LPTA 4OZHA 3T6CA 1PDYA 3CMGA 4POZC 4EIBA 4M7JH 4YE4L 5JHDB 3G1YA 3PWUA 4RKAA 3F8UB 5LCVH 4BD4A 1U8PA 4Y19B 5GGRB 3W2JA 4LNVA 1U1UA 1T1YA 5HYSA 1LTDA 1BVKB 4AVJA 1HN1A 5J12C 2NX5A 3VD4A 3NCBB 3P4OB 3DTDA 3V4UL 2DD8H 1NGPH 3O9WB 1WBYA 1RZPA 1YCSA 5JW4M 5I3KA 4XPTL 1KFGA 5CLXA 3IDNB 3IACA 4L2LA 5M94B 5DZVA 1JUKA 4UBPC 1BREA 1PKMA 3C6SB 5DJ0B 5GSVA 3BX7C 4QRPB 5AB2A 3UAJC 3KW7A 3LS5L 3ESNA 1VBGA 2RBLA 5D7IA 1BVZA 2DH3A 5GGUB 1F6AB 3AHVA 4NZ3A 2AMUA 5LIWX 1XQ4A 5DYFA 2NNAA 3UACA 2R23A 3RXZA 1U93A 2BSTA 2DWEB 3B9KA 2IDCA 5DYOA 1YPZA 3KYOB 1GJUA 1QWHA 2Q76A 1G0XA 2NSMA 5E6UB 2Y61A 3EO9H 2QKIC 5B1KA 4HIHB 4RNHA 5DC9B 4Z17A 1RZGB 4YMPA 4C47A 1QPRA 1A21A 2NLJA 1J1PL 5DC2A 3RGHA 5I15H 3QQXA 3SQOL 2OMZB 2GYIA 2X7LA 3OQRA 2HE5A 1TEGA 2CPUA 1WZLA 3I84A 4LASL 2PURA 5FB8A 1UP3A 4I0PD 1W1IE 1IWAA 4JFFB 3H54A 4MD4B 1US2A 1KB5A 4P2AA 3R10A 4LNYA 2X4QA 1GW0A 4IQEA 2OMYB 2APWA 3SQMA 4QR6A 3L3DA 2Y0SA 5DRCA 1EBAA 3KPMB 2AAVA 1REQA 3PAOA 1LT8A 5BXSA 1GYVA 2PWDA 4A8LA 4PL1A 1Q63A 2XV6B 5HBFA 3SY8A 1KPUA 1UH2A 5IB2A 4NZTL 1PKQA 2VITA 4KJWC 1OYBA 4BUHA 4P9HH 1KTDB 4E41B 3QDJD 1OV8A 2DQHH 4NJIA 4EEEA 3IDJA 5IK3B 2WGXA 1E0OB 4OKVA 5BXRA 3JWNE 2W6RA 1RUMH 2DZPA 2YCIX 1CD9B 4GNJA 2I24N 3QDGE 5KBMA 1FNSL 2DI8A 4ZYKB 2H8XA 1XYLA 3F4CA 2UZIL 4WJ5B 4M1BA 1JFQH 5KZ6A 2YD1A 3H56A 1YEEL 4E0CA 1C08B 3OP2A 3LKSB 4DP1X 3QXAA 4NM8L 1QZ1A 1OPGH 3TV3H 1OD8A 3RIFK 4XAKE 5D8JL 1P4LB 3TJHC 1SFDA 2DB8A 2VMCA 4OLVH 5SX5H 5D2XA 3T8XB 3G18A 3UTTA 4DN4L 1QACA 5IMOA 1I2QA 1GC1H 4ORGA 2E5BA 4HB7A 1FUNA 3HAEH 3F05A 2NY5L 1GYUA 1O7AA 4Y96A 2HTKD 5MKGB 2K7PA 3FSOA 4ZFCA 3QAZC 2IKJA 1TQCB 5D38A 3S2LA 2C0HA 2UVFA 2Q7AA 4XAGA 1WYJA 1HXMA 4IMGA 1E2WA 4QOKA 3NK4A 2H26B 5FWRA 3KOYA 5SWUA 4JJHA 1KRBC 2ZRZA 2XRAH 5I9QB 2YXFA 4LHUA 5KANI 3NCYP 3MSYA 3CO4A 4R84A 3G1RA 1AXSA 2L3BA 5HHNB 2EO1A 4XWGL 1W3TA 1CC3A 4A2DA 1DWIM 3H3KA 1HYRC 4LEOB 1Q5MA 1ZPUA 2O56A 1TWZA 4LSRL 4U1IA 4DI9A 4GRLD 3EJYC 4S39A 3MR9B 1NH6A 3QG7L 3ZE1E 3S5NA 4C7DA 1ZANH 2E74C 4X5LA 3QZBA 5CGBA 4PQXA 4V27A 4AOFA 5CCHE 2ISFA 3N2BA 4FALA 3QWRA 5I6OA 5KBDA 3KVQA 4S3FA 1U83A 1I75A 1PJWA 2YR3A 3OKLA 3TYCA 3CAQA 5IW1A 4LCYB 2CPCA 1XWVA 5D5MF 3MFFB 2DLEA 1IM9D 1W72L 2YD3A 3QRHA 6PCYA 1TE1A 4FXSA 4OI8A 3KPLA 1IAIL 4IGBB 4NZ4A 2FJGB 4YE0A 3GMRB 4V15A 3HE6D 3CFIC 2V2TA 3RX9A 1CFNA 1KIUB 2XNAB 1LP9B 1NQBA 4N3TA 1MFAL 2OXNA 1IKNC 3MRKA 4GS7C 1PYWB 5ECUA 5FF7A 1ZJIA 3VI3E 5A6MA 3QB7C 3DENA 3P81A 1U58A 2CRYA 2A4ZA 1NFBA 2QL1A 4LCWE 3PL6D 4NQVA 1VZIA 5MENB 2HT3D 4Z7VA 3U7YH 4LESA 2EF9A 5HHPA 2BRRH 4U7MA 1ZLDA 1GKRA 4Q7IA 2WCSA 1M1XA 3PCYA 4RGNE 4FLQA 1WWCA 3MRQA 4XOCA 4R3UA 5LGHL 3DJRA 3I2CH 1T66D 4NUGH 2EICA 5D05A 2IH3A 1MI5E 3GNNA 1ZHKA 3V6OA 3N4FA 1XB6A 1R3SA 4LGPB 4B4HA 1KFEA 3MODL 1E9LA 1DVYA 3OJ2C 1ZVSB 4GACA 1J8HD 2X0HA 1PIGA 2WHMA 4CC4A 4FZEH 1AE6L 4I5UA 2HJKA 3L17A 4LKXA 1UQYA 4PJXE 1MFUA 3OBEA 5HJ3B 2YZRA 2FEEI 1LRNA 2WHJA 2DIBA 4MS6A 3C52A 3L3GB 3ZE2F 4WCJA 4X6BA 3QZEA 4AJYV 3S3DB 1RJLB 4AJVA 2VZVA 4PLJD 4I5BA 3WLWC 1A49A 4D71A 5FOBA 1OHLA 3GB7B 4JQIL 3EWBX 3HU7A 1MDAA 4U33A 4JVPA 3KBJA 2Z26A 1N4XL 4RFNC 4X0KB 3BLPX 5F96H 5CJOH 1JMXA 3UAAA 5G1YA 3D25B 2DKUA 4AWTA 1F1GA 3ARRA 4FB7A 3BSHA 3M44A 1XBXA 1LE5B 1J5OL 2YKLL 5L2KE 1JN6A 1SOKA 3AXIA 2QSCH 3WFHB 1USZA 4DP7X 1UQSB 2ZE0A 1IR2A 3VW3H 2RJHA 3I7RA 4FSAA 2QQKH 1RBAA 5HWMA 2F7RA 4I9WD 2ZZ7A 4HCIA 2P3EA 4Z76B 3PWLA 4MNQD 3C75A 2QMJA 1LQAA 5EF1A 3LTSA 1PXGA 3T0AA 4P46B 5HK4A 1F3JA 3BHBA 2WQAA 4Q7NA 3DURB 2QQLH 1ONEA 3WUWA 5I1KL 1NP2A 3CFJB 5M7QA 2Y2TA 4PIBA 1GZHC 5F6IC 3V4UH 3ZHNA 1U8NB 3CIXA 5E51A 5FO7B 1TTUA 1GZQB 3VNIA 3RUBL 3L7FA 1BTCA 2VLJE 1VADA 4G7EB 2F58H 1GXEA 4LNRA 2Z31A 1SDYA 1YHPA 2PCPB 4Z0XB 5CC7A 3CN1A 4BQBA 5LBSH 1RL1A 5B38G 2WMIB 4GJJA 1T7VA 3A4EA 5ESAB 3VI2A 3U0TA 4Z7NF 1KW1A 5TIMA 3L7EB 4PRTA 1GHRA 1GEQA 3WQOA 2QULA 4US5D 5BMWA 2CHWA 3TYFA 2G50A 2EYTB 4WTZA 1IX2A 1NDGB 5C0GA 3US0A 1P7KB 3RZCB 3LKPB 4JFXB 2AJYH 3B5GA 3VM5A 3QARA 1OGBA 1IGCL 4I9XA 3DYOA 1FBIH 3L5JA 3ZT6A 3GSOA 3UWEA 4FMFA 4G8GA 5FK9B 1H7RA 2OKTA 1WICA 3DWTA 3N1FC 4YTUA 4FHBD 4YXKH 3QXBA 4AKOA 5DT1H 5I5JA 2DKSA 3K8LA 2EDLA 1QDSA 3T3PB 1XLMA 5E70A 1NIFA 3QF0A 1TIMA 2LFEA 1B0GB 4AYFA 1P6AB 3H2PA 3HNTH 3UBXA 3BO9A 2VC9A 4BDVA 1Q8MA 4M3KB 3HLKA 4ONFL 4XWUA 3OMNB 3SFKA 1ZWIB 4ZG1A 5BVJB 4HJ0C 3G9VA 5H94B 4QY8B 1FDJA 3KAOA 1OTTD 3SCMB 3L5WB 4JQIA 2XKUA 2PUQT 1JWSA 3TSDA 1SVBA 3SN4A 3W3BA 1PIFA 4PTTA 2VCAA 1O60A 2WLMA 5KZCB 2YCLA 3GZPA 2GEQA 3ENEA 3NGBC 2B16A 1FL5A 3B2UD 2J6WA 2BO0A 1XYAA 1NC2B 2OMBA 1SLXA 3VOCA 1XXXA 1AD0A 2O92A 5LO7A 1H0IA 3NO1A 4S2SB 1PKLA 1KXTA 1GZ1A 5GZNA 4JRYA 3RHWK 4NM8H 2GDVA 4JUSA 4NN5C 4OM1L 3D39B 3HC2A 2I7GA 3UZWA 2ZG1A 3O3BB 3QUKB 5AHNA 4BIKA 4OZGE 2N0KA 1ILUA 3R1GL 3TN5A 3UNDA 3PBYA 4BWUA 2JGQA 1YY9D 3ZUCA 2YW3A 3UJRA 3SGZA 4OCXH 4DZ8A 2VW6A 2R69L 2CO7B 3GMOB 4DGUA 3T08A 1ZV2A 3P9LA 4L5FH 1BG9A 3GGWA 3M0VA 5F2MA 4OQTL 4KIEA 4HOZA 2ZXBA 1KBGL 4IG2A 1LRQA 4QI3A 3GQYA 3SCPA 2WJ5A 2XUCA 3ARGB 2G75A 4YHYB 4M80A 3I6EA 4BQ2A 4XN1A 1QO2A 3R4DA 4P2YA 4DPPA 1NWRA 4AIOA 3CVCA 3EO1B 5CH9A 1ACCA 2QUTA 2MQGA 3HE7B 1E72M 4OZFA 1DQWA 4JFEA 4QROA 1AZZC 1N6QL 1MCPH 2FYVA 1JNLL 4L3CA 2ISWA 5KSUB 5KBKA 1G87A 3A3HA 2D20A 3HRZA 2NR6A 2EE6A 2C7UA 4ZFFA 4JIEA 4YXHL 4PRIE 2GY7B 1T2XA 4HUXA 4WWNA 3ULVE 4XNQB 1XFBA 1XKJA 1JZEA 3N50A 4RW5A 4P5UA 5AYIA 4M1GH 3AY4C 4FJYA 4YYCA 4DVOA 4Q4IA 3V4LA 4JLRB 3H23A 1V51A 3II3A 4ZQPA 5DUBA 1KEML 2F6UA 4I87A 2BNRD 2EXWC 4H13C 1MUMA 2V7NB 5GS0C 2ISDA 4GBXA 4HUUA 2W67A 3R4RA 3MV11 2MCMA 4I6VA 4ZBJA 4R26H 1B3ZA 2VGBA 1E3ZA 1L3WA 4KBPA 1HWWA 4OJFL 4UIKL 4NEHB 4LQFL 4WWKB 3CV1A 4TTUA 1QPQA 4Q7BA 5EA0H 3RUGB 4JK0D 1MYRA 3UAEA 3EYOB 3F7KA 3KHOA 4A55A 4IBTA 3RTQA 3N55A 5I1EH 2VERA 4QAIA 3U82B 4ABUA 3MUAA 4MKMA 3TA4D 4TNWK 1NJ9B 1ZALA 4KKBD 4ZE4A 3GR7A 4JFDA 4R5VA 1K70A 3D69A 4JN6A 2VR6A 2V8LA 2HX9A 3PG9A 3OD3A 1EIBA 4XH2B 1J87A 4GO6B 2RAGA 2OULB 4P57B 5E7FA 4P4KB 3CTLA 5EBWB 2P7TA 3MLWL 4JHMA 2BWQA 1D5ZA 4EF9A 3KXFD 2ADIB 4GIEA 3MODH 2FX8H 3U79A 3QQ4A 2NY1D 1WO2A 3KLSA 2I16A 3PZOA 2NSQA 1QX1A 5AW6B 3D3VE 4DLFA 3H6AA 4K7FB 2R4SL 3LB6D 4XUYA 5E6IA 2R69A 2NOYA 2YAMA 4HZ8A 2DSUA 2WSQA 3FT4A 4M8QB 3MMUA 4UIMB 3R06B 2DQEH 2VWEE 3ILQC 4CBPA 4UOW1 2PB1A 4AY8A 4OQTA 4AGQA 2VD8A 3MRMB 4ATLA 2XWRA 5GS3A 5B1AB 3WL1A 4JY6A 4WI0A 3TNMA 1VGKB 2E9LA 2P5EA 1JPTL 2FJUB 3IIVA 3CLFL 1TTIA 2LLLA 2A6JA 1X5YA 4HUNB 5FYLD 3BG5A 1J5OH 4JFTA 1UD3A 5BZDB 3PUCA 2JQZA 4N5EC 1CFSA 3ZL1A 1HKWA 1LP6A 5E7BA 1V6UA 3QRBA 1XB3A 4X98A 1F4WH 4FOJA 1Q94A 4J27A 2P8MA 1L2QA 4XNZB 5MERB 1H49A 4OBTA 2D7QA 3DHPA 5DHXB 4IBYA 3FKRA 5CSBA 4PWJA 4E42B 3VDGA 1CE1H 2QTVA 4YHNB 5BW7C 4RZBA 4NO2A 1ETB1 3L5LA 5HYFA 2KZBA 5HHQB 3TW7A 5BRBA 7FABH 3LLDA 2OJPA 2AFNA 2BSCA 4PJEB 3R8HA 4Y2OA 4GP5B 2FGZA 3QZAA 3UG3A 1KBJA 1FDLL 3PQYB 1FHDA 4MZ3A 2WW8A 3EGDA 3V0WL 3BKJL 3HNSH 2CUAA 3ZTNH 4HZ7A 1V6VA 4NIYE 3GIPA 2EIDA 5T1DL 3P2VA 4PWHA 3ZZLA 1E4WL 2YD7A 4X42A 4Q8TA 2X1UA 4MTMA 2OG9A 1I1WA 3UBHA 1A5MC 4OTKA 2FX7L 2V17L 1FH9A 1GVRA 3LNMA 1OTUC 4AEIL 3X3FL 4LUSB 4OZFH 4QRNA 1B4LA 2YPLD 4JFZL 4HJTA 3AW5A 4ELDA 2VFHA 4LBSA 5JORA 1SSGA 1N3NB 2V3FA 1RVFL 5AZ2L 4F37F 3CS2A 2CBOA 3WLRA 4IU3A 4KKPA 4OGXH 4KRNA 3X12B 3BZ4A 2IXVA 4JIQA 4NNYA 1JZIA 1GA2A 3EKLA 3OAUL 4PRHB 4Q14A 3NQFA 3D0VB 3ABZA 3S37L 2HRPL 2C3ZA 3PNWA 1MIEL 4AYBA 4IPPA 3HS0C 2R2EB 1SOSA 3BZJA 2DMGA 4OLWH 5LNDA 3MRDA 4H41A 3ECUA 2MKLC 5C1MB 2AJZA 5GJTL 4TSAL 4JTCA 2IQ9H 1EGMA 3PV6B 1PGRB 1R24A 1S7QA 1JIBA 1E28B 4ONGL 4IP4A 4DVBA 1SJDA 4UB0H 4JQ4A 4R90H 4YSAA 5REQB 3ATFA 3DO3A 4G9FE 2NY6D 2Z0IA 3TONA 1ML1A 3PPCA 4G9PA 5L4MA 3BIKB 3V0VB 4PBWD 3QIUC 1MCFA 3MUGA 5D7SH 4Y4KC 1DBKL 3RWCA 1WH0A 3I65A 3X2QB 3VXUA 4WCYH 2VZTA 1BTMA 3B56A 4XB8A 1NGZB 2K3TA 1K9FA 4HNLA 2BXZA 3FW6A 3SGUA 1JUBA 4YVXA 5E09A 4IOIA 4J4PD 4JO4H 2D2JA 1HKVA 4HUVB 4V2CB 3F4VA 3LNIA 4JRXB 3NFPA 2FR4B 5LZLA 5HHOB 1NBZB 4R0LB 4LT9A 1HQTA 1AHWC 1OCRB 3T40A 3DVNB 1K3ZA 4RIRA 4F20A 3EZ8A 4XZMX 2AQWA 5JR1L 3KZPA 4OM1H 4L05A 3EB4A 2A1WL 4JTJA 2WZ5A 3B9DA 2K4AA 3GO1H 4LSTH 3BJSA 3L8QA 3KLLA 5D7KE 2RDXA 2V68A 3E0LA 1JZ3A 4TO8A 5C0CD 1DVUA 3DEQA 3B7YA 1AVAA 1Q9WB 3QDMD 4U31A 2R69H 2P0OA 4KRZA 1OSEA 3PVFA 3LSOB 4W9DC 1T5XB 3RFRA 3C60D 3ME3A 5C0RL 4R7DB 1IEAA 2NUTB 3O05A 1EUUA 1EXUA 5I8EB 3IJYB 1VFTA 4H3DA 5DN1A 2WC4A 3OHXC 3S9ZA 1XCTA 2A7RA 1IGIH 4TMBA 5ACMA 4XC3H 3HHRB 4RXFA 2ZZ3A 3MRRA 4G80B 1G7IA 5EOTB 2P24A 4NZUL 4WWOA 3VWJB 4E9VA 1WLHA 2B08A 3QFJD 3QUHA 5DQ9B 4F7EB 4P2RE 1F18A 3SGJA 2F18A 1CFQB 1B4TA 2PP7A 4EF8A 3J07A 4CD7A 4HPJA 3SDYH 2HG5A 5IBXA 2E67A 1KCBA 3VO0A 3MPGA 4S1RL 4C55A 1BF6A 4J2MA 5J1AA 4QG8A 2Y2WA 5INCA 4EI6A 4LCIL 4M48L 2DVTA 3T6WA 3EG9A 3DPDA 1X5JA 3L1OL 3AHTA 2FO4B 1F97A 2WXJA 3QPYA 4B5EA 2JJUA 5HPMA 4NHVA 3PJSA 5K9JL 3W0WA 4ZQRA 3INPA 2AK4A 2IANE 3KNBA 4C90A 3O6FA 2IPGA 3C5ZB 5BRPA 1U8HA 3LCHA 5ILTL 3WJLC 2QCFA 2DMBA 5F7EH 2X40A 2CR6A 3TJIA 2PTXA 3IDIB 3LMJH 3LDBC 3W1PA 3HZKB 5ICUA 5LXGL 4D8LA 5G5IA 3FKUS 4YIWA 3KPQB 2OMTB 1VHCA 3GXTA 5TPWL 4YUEL 4EE2A 4YEEA 3SDOA 1S7VA 3AUWB 5I71C 3CUXA 4I4WA 4ZMXA 3W88A 2B1OA 3KPOB 2YHGA 3RTLA 4XPHH 1A14L 3VI4A 5IHRA 5BO1H 1V5JA 1RZFL 5CAKA 4AEHL 3L4YA 4HHGA 1H50A 5BYWA 3PWVB 3EBGA 3UP8A 5A8QA 3P0YL 2VFEA 2CLLA 2X1SA 5GJSH 5T9CE 2LHAA 5BQ7B 1QRNA 2EG7A 1UKQA 4CDHA 5EBLB 1E8YA 2KKQA 2HKHH 2WUBL 4I13B 4XBJA 2CBVA 1UGKA 3P3TA 2DP3A 1NFDB 4FQXA 3ZW3A 5DJ8B 3PXJA 5TE7L 4HLEA 5J1SC 2PYEA 4BSVB 4CN1A 1N68A 3MJ9A 3OR7A 1ISZA 2DTSA 2VVSA 1MHEA 1D5RA 2R24A 2DYPD 4C56D 4XMLL 1GOXA 5AVHA 1T04A 2R4SH 4JUTA 4HZ1A 3WY3A 3N25A 2RQ8A 3PZGA 5E0KA 4E9QA 3RLGA 2OZ4L 4RMSA 2XI9A 2E6JA 3THMH 1INDL 2L04A 3G1FA 3SUTA 4ACZB 3DHDA 2J7FA 5GS1B 3OODA 4X4XA 4K3HA 4D0BB 5LKYA 1XGEA 1I3UA 1ZS8B 4OZIB 1OB1A 3T0EC 4L65A 2CCVA 4PB0L 3WSQH 1A80A 5BV7B 1FZKB 2C9QA 4TTGA 3MNVB 3X17A 3CLFH 5HR6A 3J8F7 3TCXA 2DW5A 4LBEB 1WAAF 2HFFA 1EMTH 3BFOA 3QW9A 1XLGA 3WQ6A 2YXVA 4FYTA 3VB9A 2P8CA 2Y4SA 2F5AL 1HNYA 3MZ2A 1QATA 3ZR6A 1XTMA 1R0AH 3SKNB 3EFFB 2IS7A 2BINA 2P45B 3U7WL 2OL3B 4EN3A 1ZAIA 1THAA 4PMDA 1TTJA 4TVPL 5ABZA 3S98A 5ISZB 4QIRA 1Y1UA 3B8WA 2MHAA 1V7NH 3U4KA 1MLBB 3WHXA 3WN5C 3UJTL 5L7XL 1ZSHA 4AT6A 2QDEA 1CGSH 3GZAA 5E00B 4URTB 4M7JL 5SX5K 5LCVL 2AL2A 1FV1B 3SW6A 3NPZB 1N64H 4MD5A 2AW2A 4N2LA 1FDLH 3VOIA 4BQ9A 3V0WH 3HUJF 2DD8L 3RGTA 1LP9F 2YYUA 1INQA 1XI3A 3N1AA 2VC5A 4UQBA 2GJ6A 3IWPA 1KXQA 1E6ZA 5DVPA 2R2HB 4G3YH 1AS7A 1JPGA 1E4WH 1S38A 1J96A 3RWJB 3MJ6A 1TPC1 3NZSA 4HJ1A 3WJJC 1A0QH 3QUZB 2Q6ZA 3EOAA 5CBAB 1AXTH 5CEZD 3V8CA 4ZB5A 2G4EA 5HGGS 5F1IA 3VCCA 4IBQA 3BXNB 1FA4A 2ZOTA 1WBZA 3S8GB 3UWYA 3DSFH 5JMOC 5J0BA 3CCHA 4JCWA 1S7SA 3SRKA 2I85A 4J5VA 5K9DA 8XIMA 4XMWA 1VENA 1VCBC 3EO9L 3FS9A 3KZSA 4Q8UA 1RIHL 2H41A 4OCRH 3JTTB 2CKRA 1IXNA 1OWQA 4J9JA 1YEDB 5I15L 3PY2A 4LVAA 3MROB 3UABA 1DJGA 1L6SA 2HFGH 4UT6A 1JCVA 1A3RH 3CFKA 4H20H 2R6OA 1J12A 3QQWA 3BH9A 4POUB 2VIRB 4G42A 5E2VH 3NQDA 5T5FH 3IYLW 1JPFB 3LENA 3FFCA 3ATAA 3K5SA 3DNKA 3WEBA 3AQZA 5IBLD 4MCZB 1UM6L 1ZQ5A 3M0ZA 4ZS7H 1DQJA 3N14A 1T21A 5JXED 4N24A 3PWJA 2VN5A 2GGEA 3QR3A 4JXCA 5IFJB 5FFGA 4F5CA 2DW7A 4A7VA 5ICXB 2YB1A 2FWOA 4GG6B 1LOLA 1MW1A 4GJIA 4YDVA 5C0IB 3Q2NA 2BNQE 3TPKA 1RY7B 2JF7A 2PP3A 5CCKH 1XYCA 4HCFA 4P9HL 3ELAT 5EF0A 2OZ0A 3ZZSA 1AKJB 5FEZA 3OB8A 1NGYA 1KPRB 2DQHL 2BHUA 2JBMA 4KWSA 1S2EA 4KW2A 3H55A 1RUML 3GG1A 4ONVA 5KSAC 1G4RA 3UTQA 1RSYA 4XTIA 4TL5A 1YEFH 1I1YB 4KRTA 3FT3A 1HWHB 2UWEA 2BNUA 2KAUC 1JFQL 4KXAA 3RWEA 3ABGA 1E2VA 5GRUH 3TIEB 4MJHA 3RPIB 2HMID 3G8EA 2A1WH 3MJ9H 3TV3L 1AZ1A 1IM3B 2D7OA 4CSZA 3W70A 5DJZB 4GH3A 3ES6B 5IQ9B 4OLVL 4KKLD 3NIDE 3S4SG 4S23A 1GC1L 5LCVA 3KVLA 3VIPA 3T4AA 1KFCA 4L29A 1E6XM 4B9KC 4GFXA 2EHHA 4WGWB 4OT1H 4LO9A 1XWYA 3UH8A 4V1XA 2RALA 4QXWA 3F58H 5KVMC 3QI9B 3WNOA 2X4SA 4UQ9A 1IL1B 3WCYA 4L3EA 2I9LB 1PDKA 1EERB 1K5NA 3KWVA 2MMXA 3FQ4A 1XIWC 2PF0A 1FWTA 3OA5A 4YZFE 2XRAL 4FTVB 4CD6A 3GVQA 3DXAD 4W7WA 3D06A 5DCEA 5D9OA 4QCFA 3NA9H 4YIQB 1Q72H 1ZANL 4S1RH 3DI0A 5L0QB 1TIUA 2YEQA 3T3PF 1A5AA 2DEWX 3NJVA 4BELD 2BGNE 3BLOA 4DF2A 1P4UA 3EBAA 3D33A 1KY6A 3QY8A 3TCEA 1G9MC 2BOCB 1ITUA 4GVHA 4O19A 4WFHE 1DSWA 1Z66A 2E86A 5DJYB 1TX0A 4IJRA 1O12A 3R0KA 1UT9A 5H6HA 1YW1A 4KEZA 3B4NA 3MRPB 1K03A 2J79A 1W8SA 5JOPD 1UR4A 2WINA 3BFQG 3UX9B 12E8H 5TPWH 2REQB 4OFCA 4GNKB 1JVOA 1R9ZA 4LDLB 4IJ3C 3LCIA 4AQ8A 1SXNA 5H4ZA 1C12B 3R7QA 1TVNA 3CBWA 2R9HC 1CXFA 2DLHA 3TU9A 2ZDSA 3IVKA 3FUHA 4K7PY 1BQHA 1ES0A 3DMMC 3VNDA 4PB4A 3CQ0A 1MI3A 3MV9A 5D1ZI 4HWZB 3T8VA 3U7YL 1A6TB 4LW7A 5FKAB 2BRRL 4B95C 3WTUA 1UOLA 2X1TA 2WWOA 4YDMA 3W86A 1AG6A 3PNZA 2PD9A 3FEMA 1KCUH 4B5UA 3ZZQA 3EJZC 3I2CL 5EEVA 4JTIA 4NUGL 5TE7H 2XETA 4JDEB 4UT6H 1JFHA 1HJXA 4PY7B 2WBJB 4HW6A 4R7NB 3Q1SH 5BS0A 5CR1A 1PY4A 4PWEA 3V9CA 3HBGA 5CN3A 5I6XB 5LBGA 4CNTA 1PZ2A 3QFGA 1PL3A 2LLGA 5BOJA 4DZAA 3HG0A 4FZEL 1AODA 2GK0A 3OF6A 3H2MA 5E94B 4RZ4A 3ZJAA 3IDXL 1XGYH 4AD1A 1EHXA 4NO5A 2C9SA 5I78A 2FEDD 3RL2B 2GAZA 2QIWA 1TMLA 4JM2D 3M0KA 2OYPA 4UAOC 5DK2A 3JWNG 4X80L 1T7LA 3BCJA 4PB0H 4HULB 1UD5A 1W54A 5F96L 5CJOL 3NAVA 4WENB 3XISA 5A7BA 3W01A 1GOQA 4Y1AE 4CSPA 4O4YH 4N2KA 4H8HA 3HS8A 1A6VL 4AIZA 3MUXA 4BBWA 5HDBB 3GSVB 2WVTA 2AVGA 2QSCL 3PF3A 4G56A 1ZOXA 2FQFA 4TVPH 3BDYH 3VW3L 1EHLH 2QQKL 1KIQA 2Y89A 3K46A 1HHGA 3QMRA 3AFLA 2DMCA 3HBQA 5G1TA 2A3TA 4X4YB 5JIWA 1KO0A 3CLWA 1ZGLA 3RGVD 4UIOA 3SPGA 2Z1VA 4PUKA 4GUGA 2D03H 2QQLL 2WLJA 1U3ZA 3G6AB 4M7ZC 4PJDF 3C6LB 2A2IA 3NXFA 1A8JH 5F9JB 2IPUK 2V38A 4BXSV 4U1NA 2CLIA 8FABB 2CLVB 3DFYA 2G2RB 1AL7A 1VZWA 3F65A 2GVGA 1MJUH 3NZRA 1AJ0A 2WYTA 2VM8A 3OHIA 3QG6A 5DURB 3RUGF 3FYYA 1MIML 2A3HA 4CVZA 2OPJA 1ITCA 1WBXA 2F58L 2Z1SA 3HZVA 3C3NA 3EOOA 5DI8A 4BFRA 3MCG1 3WO4B 3PL6A 3NACH 4B5XA 5LBSL 4U3CA 4QO1A 1XIBA 1V54B 5ERWB 4PTNA 5FD0A 3TQVA 2AJYL 3LQZA 1S78D 2D3LA 3F12A 3EJCA 3BLEA 2BOLA 4DO7A 1FBIL 1OGSA 5T5NG 4HYRA 1RIHH 1EC7A 4E9LA 5DK0B 2WB1A 4JNMA 2X2GA 3VFTA 3IDUA 4YXKL 5C0BB 5DT1L 1P1MA 1X4ZA 2WYIA 3GSQA 4ZVJA 1IBHA 3DX6A 2BDQA 3HNTL 2GVJA 1XRVA 1WWAX 1ZLVH 4C5YA 4X5WA 1UM6H 4KWVA 1M71B 2VLLA 3VFWB 1EFXB 4X5RA 1T0PB 4WKHA 3WL0A 5FYKD 3ASNB 4ILDA 4WJKB 3IS4A 3FA5A 5CJXC 4ZSOE 2XG9A 4J12A 1EYWA 3FHQA 2J9XA 3BGFC 5FCUH 1FWEC 3CLMA 3N04A 3ZS4A 4MY8A 4W70A 2DT1A 2H8ZA 2N56A 3CHCA 5BXPA 4CGUB 1XSIA 1A5SA 2YRBA 4EQ2A 4LLMA 1W3IA 2WNKA 4Z2GA 5T1LD 4DZBB 4AWSA 3LZPA 3R0NA 5IEHB 2W07A 1WXZA 4BWLC 1F2JA 4UQ2B 2V6HA 1MZRA 2WO4A 4ZUVA 3MV8D 1AZ2A 3OSVA 4JZOA 1O9VA 2PO6B 5I16B 3DBXB 4QAWA 4YXGA 3HW7A 4WUUB 1C92A 2A2QT 4BZ2A 3IF1A 2R2BB 1TJPA 1RPQA 1MH5A 5CZVH 2R0LH 2E68A 1YQVL 5L9FA 4PJBB 1WX0A 2WJZA 3ULUD 4PSRA 1JV5B 3G08B 3H9SA 3MBWB 2CUIA 2J13A 2XWJB 2QLYA 3ESUF 5C0DB 1B2WH 1U2YA 4LXFA 3LNFA 4FULA 4PJEF 4DBEA 2ITCA 4IX0A 3K6SA 3CAVA 2F68X 4RFEB 4OCXL 1VFAA 1TQBB 2OW6A 1XKYA 1ZKAA 2GG1A 4O0QA 4L5FL 4LEBA 2WJ7A 3QLDA 1YNYA 1CDGA 3CO8A 3PGDA 1P0KA 4FYSA 1TR9A 1P6WA 2EIKB 3CQPA 1FFOA 1L9SA 4OR1A 1KV8A 5CQ1A 4JY5H 3BPCB 3G1DA 2F7OA 4XBKA 4X8JB 4U1LB 4PMUA 3SKJH 2WV3A 1DVJA 3AAZA 3WLBB 1JCYA 4WWPA 5LBSA 1UUSA 3LPWA 4WNJA 3KX6A 5XIMA 2X1RA 1MCPL 4EPDC