2WVVA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 157
structure length 438
sequence length 438
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvvA01
2QMKA 3LXAA 3VU2A 2X09A 3A4WA 1QI3A 2IGTA 2Y8VA 4MNKA 2EJ1A 2QPUA 3ARWA 1R75A 1HJXA 3QOMA 3CUIA 5D8WA 3J7HA 4WKAA 3II1A 1ISVA 4JCLA 1CENA 3VINA 4BF7A 1IZJA 5A6BD 3POCA 4OBSA 1VEPA 4OKDA 1B90A 2XVKA 3THCA 4BQ4A 1R86A 3MMDA 4DUWA 2E4TA 3LPPA 4UZSA 2WB5A 4UFKA 4JAWA 1XC6A 1VB9A 2WMKA 4OIFA 1QNRA 1AQHA 1QNSA 2J7EA 5BRQA 4P8VA 4GI8A 5I77A 3D52A 4UCFA 3S2CA 1CXFA 1JDCA 2XIBA 1E43A 2ZIDA 3NSNA 3IAQA 4Q22A 4BCEA 1UKQA 5A6SA 2EPKX 1MW3A 1GOIA 2Y8KA 2QV4A 3VIMA 3LXBA 3PHAA 4JIEA 4W7UA 4CKQA 3B9AA 4ZE5A 4PUEA 2J74A 3RO8A 3GH4A 2J47A 3VGBA 1UZ4A 2OW7A 2EPLX 1TUXA 3SCWA 3I3EA 4UFHA 5DF0A 1TQSA 3U5UA 2XFFA 4WKFA 2RGMA 1WAWA 4WJXA 1H0GA 3T08A 3ZT5A 4NZCA 1W3LA 4LYPA 4JL1A 4Y7EA 5ABEA 3GXDA 3RILA 3ALFA 2GSJA 1V08A 1W3JA 3D4YA 4N42A 3WD2A 4JHOA 4OOUA 3L4WA 4QDMA 4ML4A 4FNRA 1CYGA 5D9PA 4HA4A 3KLLA 1QI2A 2BVDA 1E4IA 3S6TA 3B8SA 2F7RA 3A24A 1KTCA 1UWQA 2VRJA 1BG4A 1EHAA 2V3FA 1E6ZA 3M46A 1OB0A 2G3JA 5DFAA 3EMCA 1XYFA 1UHVA 2WW5A 1H5VA 1OT1A 1G01A 1Q6EA 1KGXA 2ZICA 5EBAA 4W93A 2JEPA 1R47A 3BLPX 1NH6A 1KGWA 2X1IA 1C7SA 3BUPA 3QR3A 1QWUA 3BLKA 1PX4A 3GH5A 1HN1A 3ZJ6A 1QBAA 2HVMA 1B3VA 4TXEA 4PN2A 1VF8A 3RJXA 3TONA 3BLBA 4PCTA 1C93A 1V3KA 3DX2A 4YHGA 3CZSA 3OGVA 4TVUA 1MQRA 3NUKA 4CD4A 3EMZA 1E4LA 1X6NA 2EXOA 5D9MA 3SUUA 3VDHA 2PWHA 3GYCA 1W2VA 2V5CA 1FOBA 2VTFA 4B3LA 2W5FA 5FL0A 4TX8A 2X2IA 2YL5A 1HJVA 4QFUA 4HZ6A 3OLDA 4V27A 2XN2A 5ABFA 4KH2A 2V3EA 1BLIA 3RMEA 1G5AA 3RCNA 3GBEA 3WNOA 3VD5A 3ZJ7A 4J3WA 2CBJA 1UWSA 3EJQA 3W53A 1PS3A 3CHEA 4U5KA 3QHOA 3DX1A 2FH8A 1YQ2A 5D9OA 2XWEA 2Q8XA 2EBNA 3L4ZA 1XH0A 3ZOAA 2A3CA 4ZFMA 1EO5A 1ODUA 3ZR6A 4AZIA 1R8LA 3GBDA 3WUFA 2YBUA 3OZOA 1V0MA 2JIWA 3WD3A 4YHEA 1QNOA 2J7GA 2J62A 2O9PA 1LJYA 3ARVA 4B3KA 3K4DA 2CBUA 4UQDA 1VFOA 1JI2A 4R27A 4ZE4A 2ZUSA 5I5RA 3LPFA 1HJWA 1GVYA 3K1DA 1E6SM 5FKYA 3ZJKA 1GOMA 4CU6A 5IHSA 1GOOA 1RP9A 2X05A 2XVLA 2CNCA 2O92A 4AEEA 2YDRA 1XRVA 4HU0A 1ZBVA 4HOXA 1E5NA 1W1YA 4UQBA 3H55A 3AROA 1TE1A 1FFRA 3CV5A 2DT0A 3AIEA 3AIRA 4TUFA 4A3YA 4AD2A 3WNLA 3ARPA 3BC9A 4AMWA 2DIJA 1LF1A 2XYLA 4D1IA 2FE0A 1JZ2A 1RD6A 2B31A 2BY0A 4NXSA 2XGBA 3OBAA 4HMCA 4HP5A 2FHCA 1DWAM 1C7TA 4M24A 1ZS2A 1BYCA 1E4NA 3WH7A 3LXCA 5E1QA 1JI1A 1OSEA 2XSBA 1B31A 2D20A 4A4AA 3D5HA 1UD8A 3A23A 3CTTA 3AIBA 5IDIA 3SUSA 4GI9A 4GZJA 3NCOA 1PJ9A 2BNJA 4FLQA 4MADA 2XIIA 1ITXA 3WQ8A 4W88A 1W9DM 2CETA 1VFFA 4NZFA 3M7SA 4M29A 3UESA 1XD0A 1ZBWA 2VX5A 1QI5A 2Y4SA 2V3GA 1TQUA 2WWCA 1KXHA 4UOQA 3DYMA 3G6LA 2BV9A 1G9HA 1UKPA 3ZR5A 5CLWA 1KXVA 2YL9A 3DX4A 1TQTA 4HPGA 2J8FA 2PI6A 1GVIA 1UD2A 4IUGA 3EDFA 4AZCB 1XV8A 3ZM8A 2WHKA 2D3LA 5EFDA 1BYAA 4JZ5A 3WD1A 2WPGA 4JFSA 1ODZA 2X8RA 1I1WA 3SURA 3VKKA 4FLRA 1EDTA 3K8KA 4CD5A 1XSKA 3CHFA 2YOCA 4DO5A 1R7AA 2WKLA 4U31A 2G3MA 5I6SA 3WY2A 2VCBA 1CXLA 3AXXA 1P6WA 3WN6A 3EMQA 4AZGA 2WMIB 4UOJA 3WIJA 2XTKA 1LG1A 2F7PA 2WVVB 3CBWA 1C3FA 2F61A 4AIEA 1HF6A 2EEXA 1VFMA 1FHLA 1ZL1A 4PMZA 1JYVA 3CZLA 3A5VA 4D6HA 2C0HA 4FK9A 1JAEA 1JXKA 3THDA 4D6EA 3K8MA 2WZEA 2FGLA 4QLKA 1XSIA 5A95A 1O6IA 1OWQA 1R34A 1UR0A 4CU7A 1CXHA 4QCEA 1QI4A 2AOSA 3AZSA 3WQWA 1E6NA 2E0PA 3WNMA 1E71M 1JZ3A 3N18A 1HTYA 4HA1A 4GKLA 1Q6CA 2DT3A 1QW8A 7A3HA 2VNCA 1E56A 2FDMA 3W82A 4K68A 1FHDA 1QHPA 4GXPA 4BZYA 3ZMRA 3NSXA 1CXKA 4MJ4A 4BA0A 3B9DA 3AHVA 1TCMA 4UFMA 4J27A 5D4YA 3OLEA 4JL2A 1W9VA 4S3KA 3W26A 1JNEA 4M81A 4AY1A 2VX4A 3HU7A 3AIVA 3NYDA 1WB0A 3APGA 3W25A 5DMYA 1TQWA 4CN4A 1QVBA 1W1VA 2A3HA 3BMVA 3WDPP 2D22A 2YL6A 3GNOA 3VIIA 2ZUMA 5CPSA 1OIMA 5FIPA 3QOKA 2X2JA 3AHYA 3L4TA 3EDJA 5E0FA 1VENA 5JIWA 2ALWA 1KGUA 1J9YA 3QGVA 3CZJA 1CEOA 2WSPA 1GOKA 3ALGA 4ACYA 4JCMA 3WY1A 1NWSA 2BXZA 3WD4A 4LYRA 5FL1A 2DT2A 1UH3A 2ZOXA 1Q6GA 3GZAA 5C70A 3WEMA 1UD6A 3ZO9A 1TFVA 5HPCA 2PWDA 3VO0A 1CNVA 5CJ5A 1UD4A 4MJ2A 1KWGA 4JKKA 2WHLA 2TAAA 2CXGA 4JKMA 5I3DA 2VVNA 4W85A 4DWSD 5IHRA 3BCDA 2BVTA 2YA2A 2YKKA 4DO4A 4ATLA 3SIMA 4KGJA 3N04A 3GXTA 2QF8A 4HZ7A 5TD4A 2CPUA 1K9EA 4E4PA 2WM0A 1F4HA 3K4AA 3MUZ1 1PPIA 3IK2A 5CGTA 3F5JA 5A8NA 1TMQA 2GJXB 1KTBA 4GZIA 1EDQA 1LWHA 4EKJA 1V02A 3PTKA 5JIPA 3L2MA 2JIEA 4MB4A 2ZUUA 1Q6FA 3UCQA 1V3LA 1HT6A 4MAZA 1VRXA 4OUEA 5A3HA 1UZ1A 1R7OA 1GQJA 1E15A 2YDSA 1E5JA 1BAGA 1L0PA 1UASA 5JBFA 2J7DA 4W7VA 4ATDA 1ESWA 2MANA 1IV8A 1JXJA 3WSUA 4Z2GA 3D51A 4W89A 5E6ZA 1J0HA 2XVGA 1FH9A 2YA0A 2WZIA 1GJUA 1E4MM 1XYZA 3RDKA 2E9MA 3PZIA 4QCFA 2VCCA 4AISA 5HXMA 1GW1A 2W66A 3POHA 1UH2A 4RE4A 2YLAA 3NDZA 1OCQA 2VOTA 5C8BB 2DSVA 3VIPA 3RM8A 4W87A 3MSGA 1XHGA 2PBOA 4W5ZA 4AZ6A 3VIFA 3WDRA 5A2AA 4CD8A 1AQ0A 1NWTA 2XM2A 1R85A 3IJ7A 3BUIA 4UQAA 3BUBA 1HXJA 2OSXA 3VGGA 5ABGA 1ITCA 4F9JA 3AMGA 3GM8A 4H8VA 4W86A 3OA5A 2ESCA 3RIKA 2J8GA 3ARTA 3FY1A 7CGTA 4CN1A 3IGUA 3OLIA 1HWWA 5GNZA 3AHZA 3MU7A 5DT7A 1HKJA 3MUY1 3VIGA 6TAAA 1C8XA 4CGTA 2BY3A 4LQ1A 3MV11 7TAAA 4CCEA 2VR4A 1MWOA 3EYPA 2D24A 2FHFA 2YFNA 2GJXA 4JFWA 2WVSA 3SCPA 5I24A 4W7WA 3WBAA 2VUYA 1RPKA 3WF2A 5CSUA 3CUGA 4TVDA 1UWTA 1WNOA 5AYBA 5GNXA 2CBIA 3M07A 1OGGA 1CPUA 1SYTA 1R87A 1ISYA 1GQKA 4AMCA 1MW0A 4J3UA 4LX4A 5CSYA 3SEPA 1MQPA 1MQQA 4Z2IA 1D7FA 4GO8A 4XUYA 1V3IA 1C91A 3VM7A 1HJSA 2XN0A 2J4GA 2XGIA 2J79A 4QLLA 3PZUA 4MB5A 4P8WA 4P7OA 2WYSA 1BVNP 2XSAA 3W6LA 1KXTA 4NX0A 1VIWA 2OYMA 2J77A 1JFXA 1C8QA 4ACZB 4U2YA 1J0KA 2E8YA 1KCLA 4W8LA 3CMGA 4HOZA 1SMAA 5GNYA 2ZUNA 5GQBA 2JF7A 5DEZA 1NOWA 3SUVA 2GJPA 4P7NA 3W81A 2WHMA 4BQ2A 2CKRA 1LLOA 2XWDA 4AXNA 3N17A 4X9YA 2JF6A 2QLYA 1JFHA 1HX0A 2WC7A 1KWKA 4GZEA 3VD7A 1GZJA 1CGUA 4MNLA 1JF5A 1YHTA 4CD7A 4XX6A 2YJQA 1GONA 1HP5A 3ZSSA 3I3DA 5FD0A 2FGZA 2NT1A 3WBEA 2W91A 2WK2A 1J10A 3DECA 4M80A 3AS1A 2DSUA 5BXPA 1U33A 2W63A 1GUVA 2BVYA 4L4PA 4P8XA 4GI6A 5A8QA 2XFRA 1J18A 4ZXLA 3D3AA 5I79A 5E9AA 1X6LA 2OYKA 3LRMA 3W29A 3MKKA 4PMNA 3VIHA 2Z1KA 1BYBA 4HU8A 3CPUA 2ZXDA 2VR5A 3A21A 5DT5A 1DWIM 1RH9A 3SCUA 3UEQA 1E73M 1LL6A 1JIBA 3A22A 1EIBA 3E1F1 3VTRA 3HG4A 4D71A 4PTMA 3UERA 1G1YA 4XV0A 3VGDA 1XSJA 1FH8A 4AEFA 3DYOA 1M04A 1V3JA 3AS3A 3VGFA 1JYXA 1Q6DA 4AWEA 1JZ5A 2VZVA 3PTMA 2VO5A 4IPLA 3W24A 1XD1A 3GTNA 1VBRA 2D73A 2PWFA 3AYRA 3ARZA 3W0KA 4TOQA 1NARA 3A3HA 1VJZA 3CGTA 4NRSA 2ZX9A 1T0OA 1WZKA 5D8ZA 3WQ5A 4Z2JA 4OJYA 1VBUA 4PTWA 4HTYA 4YN5A 3GDBA 4QLJA 3VNZA 2CERA 3DYPA 1NQ6A 4GPNA 1BHGA 4Q7NA 2XG9A 1AVAA 4UOZA 1B3ZA 1E70M 3B9EA 3FHAA 3D4ZA 1B0IA 2DSWA 3HG3A 1B3YA 2EPMX 2D0HA 2XHYA 4CN6A 1UYQA 1JL8A 1MXGA 4M56A 2DSZA 4W8AA 1WZMA 1UWIA 3TTQA 2DSKA 1V0NA 4CVWA 3AIWA 5JBDA 3WH8A 4PSPA 5AYIA 3IAPA 1LL7A 1AMYA 2EPOA 4QAWA 3WDJA 1J0YA 3BCFA 1GHRA 3O9NA 2ZUWA 3VIOA 2NT0A 1US3A 4D6IA 1GJWA 3CUHA 4CD6A 3WDQA 1W1PA 1EHNA 3OZPA 1UKSA 1OINA 4AD3A 1JYWA 1NWUA 2X2HA 3OB8A 2F2HA 2GVYA 1W3HA 1I1XA 5A2BA 5HBFA 3BGAA 5HPOA 3AXHA 3KL3A 2DIEA 1D2KA 2WBKA 1CTNA 3WUEA 3BUQA 3AMLA 2GDUA 3VGHA 1PEZA 2FH6A 3DX0A 3LRKA 3KLKA 2V3DA 3AHXA 5A1AA 1XH1A 2WAGA 1NM9A 1UQYA 4PTVA 3DDGA 3DX3A 2WMJA 1R46A 1HJUA 3PZGA 2XM1A 3U7VA 4WSKA 2PB1A 1JDAA 1EO7A 2ZX6A 5I2UA 4F79A 1KXQA 3BSGA 2Z1SA 2IXUA 2YFOA 3ARRA 1WKYA 2C7FA 1TA3B 3DC0A 4V28A 1EDGA 5IXEA 1PIFA 1HL8A 2EO7A 2UY2A 1CGYA 3WF1A 1QWNA 4M8UA 3WFZA 3MMUA 5BXRA 4U2ZA 2VVSA 1HL9A 3MUIA 3TP4A 2CEQA 3OG2A 3WELA 4ZXOA 4FLSA 3WNPA 3PN8A 1C92A 5IFTA 2UY3A 2JE8A 4FMVA 4UQEA 2PF0A 1NWRA 1V6XA 2XPKA 1VEMA 5ABFB 3IJ9A 1DWFM 4AYSA 1UWRA 3CZKA 1H49A 5LA2A 2EACA 3EDDA 3UR8A 1B2YA 3GNRA 4AIUA 1MYRA 4Z2HA 1WDQA 4HZ8A 1Q4NX 4JFTA 2VZOA 3WUGA 3DHUA 4W84A 4X0NA 1HKIA 3HJEA 5A6LA 3MO4A 4UNIA 2WCAA 1JZ7A 4LYQA 1CDGA 5I78A 1DHKA 2DEPA 2VZSA 5CG0A 3WH6A 4MDPA 4TTGA 1F4AA 4RL3A 1UR4A 4DO6A 4PMDA 3T0BA 1W9UA 1JF6A 3N13A 1E55A 1JDDA 5CPTA 3W37A 3O2LA 2D0GA 3AXIA 2F1AA 4PTXA 1OGSA 3SCRA 4KRUA 3N15A 3TA9A 3LPGA 5EB8A 3AFBA 3VGEA 1W9BM 4OGZA 1M53A 1U2YA 5A6AA 4OOZA 2G3NA 4PMRA 1V0KA 4B15A 2CHOA 1MFUA 2WZHA 1DP0A 1S46A 3LPOA 4FNPA 1V3MA 3A6OA 1HNYA 3W38A 4AMXA 4A3HA 4P7QA 1UR2A 3AHTA 1CGWA 3WH5A 4YPJA 4C7DA 3AQUA 3VD4A 2DH3A 4MPKA 3HZ3A 1JZ4A 4MAVA 9CGTA 2CBVA 4GQQA 1GHSA 3VSUA 2VCAA 3TTOA 1WP6A 4H7VA 2WBGA 3FXYA 2E9BA 3K46A 2GUYA 1B3WA 3RPMA 1UG6A 2DPEA 4RE2A 1N82A 2BXYA 3WF3A 5F7UA 3VDAA 1ZJBA 1M7XA 2ZX5A 1G94A 3PZOA 4NXKA 4EK7A 4P7RA 2BS9A 2PC8A 2F7QA 3KE0A 1DWGM 3AMCA 4CCCA 1O7AA 3OIHA 4V2XA 2WLYA 4IPNB 3EJSA 1CXEA 2A3BA 3WH9A 1H0IA 3WMCA 3EDEA 5LYRA 4GIAA 4JFUA 2WLZA 4DUVA 2F7OA 3QHMA 4D72A 1WCGA 3SCSA 1EOKA 1B9ZA 4C7GA 3EDKA 3CHDA 4UQCA 2WHJA 3G6MA 3M6DA 4M1RA 1K9FA 4DWSA 2D2OA 2E3ZA 3L4XA 1WO2A 3A47A 3VD3A 4MNMA 4EAMA 3SCNA 2W61A 4NI3A 3UETA 5A94A 4J3TA 3RJYA 5A6JA 3AJ7A 3AIQA 2WCSA 2A3AA 4H41A 3ZIZA 2G4FA 4IM4A 1ZB5A 1UKOA 8A3HA 2BHUA 1EXPA 3RM4A 4LPCA 5DO8A 1CWYA 4JHZA 1CGXA 2VZUA 2PWGA 1J01A 3BUDA 5CZKA 3BAIA 3WF4A 1MW2A 2DDXA 5M5DA 2XFYA 3UR7A 3T09A 1UR1A 2WMHA 2OSWA 3AOFA 3KL0A 4WIWA 2X0HA 5E09A 2OLHA 2ZX8A 2O9TA 3ECQA 2WC4A 4MB1A 1OT2A 4HMEA 3S5YA 3ARSA 2YDQA 1K9TA 4AD0A 1K6AA 3VSTA 3EBVA 5A8OA 1D3CA 2IUZA 4PMYA 2VMFA 2YLLA 4XB3A 4R5EA 1VFUA 5BRPA 2J7HA 5CQ1A 3BAJA 3O6AA 1HKMA 3PBGA 1QHOA 5A69A 1V3HA 2CITA 4W8BA 1US2A 3WEZA 2GK1B 3AIUA 1J12A 1QHZA 3SCVA 3FN9A 1NP0A 4FNTA 1L8NA 3HMCA 3SCQA 1V03A 4BS0A 3WNNA 1E0WA 3F5LA 2G3IA 5BWFA 4FF5A 3LX9A 4E8DA 1HKKA 5KZ6A 3W4RA 1OD8A 3IANA 4KRTA 5HNNA 3BVUA 3H54A 1ECEA 3KL5A 2AMGA 1JG9A 4FNQA 1CGVA 1PX8A 3AI0A 1KB3A 4NZJA 1HIZA 3EJRA 3VVGA 3F5KA 2QMJA 3KZSA 3VMOA 4M82A 2CYGA 1BFNA 3AZRA 5BYWA 5A8MA 4GO9A 1V0LA 2VQTA 1UH4A 4DWSB 2OWXA 4KGLA 1W1TA 3WFLA 1GPFA 3BAKA 3LMYA 1DEDA 3FW6A 3N12A 1JNDA 2VRKA 3ZSTA 3SUTA 2YIHA 4HPHA 5CPQA 3WL1A 1BPLB 3HN3A 5D9NA 3BVXA 1ISWA 2UY4A 1LG2A 2WCGA 4EANA 1IT0A 2UY5A 1KFWA 1KBKA 3FNDA 5AC4A 1WE5A 1Z32X 1OD0A 1K9DA 4HMDA 1TR1A 4U3CA 1I75A 2CESA 2UWFA 3I3BA 5AC5A 4P8UA 3WNKA 4PUDA 3VD9A 2WNWA 2F1BA 2Y24A 1TVPA 3EJTA 2GK1A 3WENA 4J3VA 3CZNA 2WXDM 1JD7A 4C7FA 3VUPA 2BHYA 3CZEA 1JYNA 4TVCA 1UUQA 4FLOA 5BCAA 1EA9C 1SMDA 4PMQA 2JALA 2X0YA 5E70A 3OGRA 2VQUA 4DUXA 2WANA 2W62A 2WVTA 3VMNA 4URIA 1BF2A 3GXMA 3WEOA 1A3HA 1XCXA 1BGAA 3TTYA 4FNUA 1E9LA 1W91A 3CUJA 4ZENA 4UTFA 3JUGA 1E0XA 1O7DC 4AIOA 4D6CA 1E6XM 4GQRA 2ZUVA 3NSMA 1W9PA 3MV01 1WPCA 3PZQA 3H53A 1KR0A 2V38A 4MB3A 3PZTA 3CMJA 1J11A 1H2JA 1OGBA 2WWDA 2EPNA 2OW6A 3BVVA 1WDPA 2WMFA 5GPRA 3BAWA 4OZOA 3A4AA 3AS2A 1NOUA 4L4OA 1GNXA 4F8XA 4NF7A 4BQ3A 4U33A 3AMKA 1ZJAA 3TV8A 5JUVA 1CGTA 1JZ6A 2V5DA 1A47A 3KWXA 3PZVA 5I0DA 3UG3A 4PMXA 2DQXA 3L4UA 4AYGA 4W5UA 1AQMA 2VZTA 1M01A 1E6QM 4QP0A 4CU8A 2VC9A 3GXPA 1B30A 3CZ8A 1SZNA 3RM9A 3ARQA 3ARXA 4ACZA 5EMYA 3CHCA 5A6BA 2FHBA 3VX1A 4UR9A 1UR9A 2EADA 4F9DA 3GXFA 3UG5A 2W92A 3WMBA 1V02E 1XGZA 1MW1A 2BY1A 3L4VA 2G41A 5ABHA 3BVWA 1QW9A 3VM5A 1WZLA 1E6PA 3GXNA 3WY4A 2JEQA 3D50A 5EFFA 3ARUA 1HVXA 4DWSC 1EQCA 1UOKA 3MI6A 3VSVA 2DGAA 2VI0A 3CH9A 4D6FA 2F18A 3U7BA 3EJPA 2O9OA 4NRRA 4AZ5A 1H41A 3T2OA 4WKHA 1FA2A 4IISA 1JGIA 1XH2A 1DWHM 3AYSA 1E3ZA 1MVYA 3IJ8A 3S5ZA 1OIFA 1ZBKA 5A6KA 3WMSA 1TQVA 4J28A 1CLXA 2OWWA 4AD5A 2ZXBA 1B3XA 2XVNA 1FFQA 1ISXA 1ISZA 1UA3A 3GH7A 6A3HA 1GCYA 3VMPA 1EOMA 2VRQA 5A6MA 4TX6A 1QBBA 2WMGA 3VIKA 1XCWA 1UKTA 2F8QA 2FYVA 4N0RA 2VT0A 5HDRA 1UD3A 2J7FA 4CVUA 2DT1A 4AW7A 4U3AA 4UFIA 4MDOA 3W27A 1NP2A 3VILA 1J0JA 2EQDA 2J78A 2VX7A 5C71A 2ZE0A 2NSXA 3HG2A 4WF7A 1HP4A 3F4VA 5M17A 3T0DA 1H09A 2OYLA 5M03A 3CLWA 1CECA 1GQIA 1C90A 1JAKA 3WY3A 4ZEPA 2NW0A 1JD9A 5CGMA 1GOQA 3WL0A 4J3XA 2BY2A 3K8LA 4P7LA 5BXTA 1HVQA 1BG9A 1BTCA 4FNSA 3LRLA 4D6JA 2E8ZA 3N1AA 1G0CA 2C8NA 4ATWA 3MSDA 3MUAA 5A2CA 4HOWA 4OBRA 4DM2A 2D0FA 3WQ4A 2GDVA 1BVZA 1C8YA 1TA3A 1E1FA 2J75A 4AC1X 3MMWA 3FAXA 2WVUA 2EAEA 2QHAA 3PZNA 1E1EA 3VDCA 2D1ZA 1TG7A 4D1JA 2WMIA 3KEHA 2ZX7A 3ARYA 1V6WA 2J7CA 3PTQA 3PZMA 1ZU8A 4H8HA 2Y2WA 1UWUA 2WKGA 4WLCA 5E6YA 1DTUA 2ZXAA 4HA3A 6CGTA 4H8UA 1BSIA 4KMQA 1OBAA 2ZUTA 4UFJA 4GINA 4AZBA 1PZ3A 1H11A 5A8PA 2O9RA 8CGTA 3DDFA 3L2LA 4XZBA 5CLTA 4X0VA 4RE3A 4JFVA 3PZ9A 3CO4A 3WQ6A 4PMUA 3WDHA 2WVVA 4BQ5A 2WSKA 1E72M 3AS0A 1E40A 1HJQA 4UFLA 5FCZA 2CCRA 3ZT6A 3OLGA 4Z2LA 1VJSA 4PMVA 3VX0A 1OM0A 5IFPA 1CBGA 2ZXQA 2XUCA 1KCKA 1QNQA 2XVPA 4J7RA 5HOSA 4PSRA 3VNYA 4Z2KA 4DM1A 2YL8A 3UG4A 1H4PA 4AZ7A 4PRWA 4XZWA 3AICA 3W28A 3SCOA 4PEEA 4PYSA 4E2OA 4PBGA 4H04A 1J0ZA 3VDBA 1R33A 1PX3A 2PBGA 3MS8A 1V6UA 3CC1A 4CUCA 3U57A 1KQZA 1QX1A 3FAWA 4UZUA 1QNPA 1ZBCA 1QOXA 2G8ZA 3ZQ9A 1VEOA 2IXVA 3T0AA 1CIUA 3VPLA 5BROA 1H1NA 1LWJA 5LA0A 3VIJA 3NIYA 5M3WA 1WZAA 1EQPA 1W9XA 1BYDA 1WDRA 3ZT7A 3SCTA 2J25A 1TVNA 1QPKA 3AZTA 1E3XA 2Y5EA 1NOFA 3NDYA 3HG5A 3ZJ8A 4D6DA 4AD1A 2CHNA 1BGGA 4NSBA 4B16A 3SUWA 3VOCA 3GXIA 1H3GA 3DHPA 3WQVA 3GNPA 3NJ3A 3OGSA 1PZ2A 3T2PA 2VURA 2HISA 1EH9A 1W3KA 1KBBA 1VAHA 2A3EA 3WDIA 2VL4A 3WUBA 2JFEX 4LXFA 1PBGA 3U5YA 1J0IA 3AISA 1MXDA 3WKZA 5E0CA 5LA1A 2OWCA 1E0VA 3WD0A 1TZ7A 5KEZA 2BHZA 1KQYA 4UQ9A 1W2PA 1UA7A 5CXPA 4CCDA 4F66A 4WK9A 1PIGA 4TTUA 1B1YA 5FOOA 1SR0A 3T2QA 1UD5A 1FP8A 4AD4A 1Y7VA 1U30A 3BXWA 3TOPA 1UQZA 2GJRA 4J3SA 1FP9A 5AY7A 1GQLA 3N11A 2X2YA 4MTVA 3BSHA 1GOWA 3BVTA 4H2CA 5I23A 3CZGA 3BH4A 1PAMA 1LL4A 1V6YA 1LQ0A 2J7BA 2BFGA 2CIPA 1KR1A 3CUFA 2GFTA 1V6VA 1CLVA 1W32A 2EABA 2VX6A 3TTSA 3FHQA 2E40A 4S3JA 4PCSA 3CIVA 1UR8A 3EJUA 4AZCA 2W67A 4D6GA 2RGLA 3L4YA 3WF0A 1RP8A 2OSYA 3BAYA 3AMDA 1IZKA 4JKLA 1E6RA 4B9ZA 2PWEA 2XN1A 1DWJM 2QPSA 1X1NA 5BXSA 4LGXA 2WC3A 1MFVA 1M03A 4AZHA 4EE9A 4E8CA 1GORA 4U5IA 4B9YA 1HXKA 1EGZA 5JBEA 2E9LA 5ECUA 2ZWZA 2ZWYA 1QI0A 2XJ7A 1WDSA 1FH7A 1CZ1A 3QHNA 2YBTA 3MANA 4PMOA 2CKSA 2YA1A 2VJXA 1JZ8A 2D23A 4KWUA 2DH2A 4WSJA 1BQCA 3N9KA 4MNJA 1SFSA 3A4XA 2AAAA 1CXIA 2W4XA 2D3NA 3BAXA 3BMWA 3W6MA
chains in the Genus database with same CATH superfamily
2X09A 1AR1D 3OAUL 3VU2A 2A2IA 4ODHH 3A4WA 1L6SA 1BKSA 3KYMB 4YGAB 2IGTA 3AY4C 4N0FA 5KBNC 4J6RL 4L1GA 3MLUH 1YEHL 4HDIB 2V5SA 4HIEA 3AABA 4LNVA 3SKUD 2D7OA 1R75A 3OMZA 2VE6A 3UPRB 4LCQA 5FJPA 4HC1H 1NKRA 3BKJL 2A4CA 3N9SA 1EGJH 3IDJB 5EOCL 1LL1A 3QUHA 1M05B 4LUIA 5D8WA 5HUOA 3J7HA 5E2VL 3MV7B 4I85A 3II1A 3OAUH 3MLYL 4CNSA 2B8OT 4LCRA 4LCCC 3HZYB 4Q56A 3SUVA 3GHBH 1TTGA 2E7DA 4MAUH 4WEUD 3WIFA 1JS4A 1Z6JT 1CDJA 4MJIA 2OYPA 4WFED 4HWZA 5LO7A 2XV2A 5C0NC 5KJ4A 2ZYSA 1S39A 4K5NA 3ZQWA 4XNXL 5C08E 3P7YA 4KEMA 1VYSX 3QQ3A 5XIAA 1R86A 2X2UA 3PQYD 4DUWA 4TX9A 4QXGH 4UZSA 2YHGA 2XZAH 3V5DB 3DESA 4KEVA 1DJNA 3CCHA 1ROCA 1THFD 2PW1B 5JNYB 2C18A 5CAKA 5DMKA 1J4EA 2PLMA 2Q7AA 1HG3A 4W9JC 3LGEA 1VF5C 4K5LA 3C8DA 4AGMA 4LLWA 2FJUB 4WRLA 3A3YB 5LHDA 3RFZA 2WOQA 2NX5A 2DQFA 4JTDA 1F56A 3EBAA 1XAKA 1JDCA 3TT3L 4IMEA 1UA6H 2XXGA 1A6PA 1GS6X 4Z7UF 1EJRC 4Y5YA 2QVNA 2XIBA 5SX5H 3NSNA 1WGOA 4GSRA 2HRGA 4BCEA 1WD8A 2X7VA 4DAGH 1BGXH 2LU3A 4MA7L 4WAFA 5A6SA 2PDFA 3PL6C 3MBXL 3MRQB 3VFMB 4RSVA 1BZ7B 4AU0A 4BXVA 3H8AA 1M3IA 3VIMA 3PHAA 1LOSA 4X9SA 4CKQA 4XP4L 4I0KA 2Y61A 4H8QA 4HNNA 4PIRF 4NUPA 7TIMA 4H13C 3UC0H 2Y0FA 1BD0A 3TH3T 5C54A 3M17A 4ZAKD 3G5ZB 1AO7E 1NDGB 15C8H 1F8IA 5E9DD 3DO7B 2OVLA 3LHTA 4DF0A 4DNMA 1L8PA 4Z3JA 3QO1B 5K9OA 4UFHA 5FACA 5C0RL 3D8MA 1OARL 3IFNH 3VNMA 2Q76A 5LIWX 1UJ3C 3NJXA 2XFFA 5FA3B 2OZ4L 4MTMA 3GKZA 5CN3A 1UJ3B 1WAWA 1C08A 1BYOA 5DEJA 5TF1H 3VTMA 3JV6A 1AANA 3NCJH 1EWEA 1BD2A 3CQJA 4IOTA 5D30A 3URQA 4FHBD 3T08A 3ZT5A 2D7QA 3FTVA 4J9JA 4C6DA 4US6A 2YN5A 4YS1A 4FALA 3P4OB 1OQXA 4GMTH 3SGDI 1D5ZA 3FC8A 4JL1A 4RGND 2VM8A 3LD5A 3QFWA 2ZCZA 5MP6L 3HHSA 3L48A 4NUWA 3ZDXB 2QUVA 1K8IB 3GXDA 5CH9A 3ALFA 4WTQA 1TZ8A 4MLSA 1KMGA 4QNEA 2G9HB 3EF7A 4X7TB 3L7FB 4IU2A 4MD4A 1JK9B 3V0VA 4UNVA 5IFHH 2ABBA 3D4YA 4NO5B 1DV7A 4C83B 1MHPL 3KBPA 4NSKA 2JBMA 4N42A 4XOBA 1P0BA 2YD2A 2I57A 1Q0YL 3SD2A 4DB7A 5JLZA 5IROA 5B22A 4ML4A 1CYGA 1ZHLB 2XV3A 4FNLL 4Z1YA 2NXZC 5SWSB 2HTMA 1IM9D 3KLLA 5B39A 2K7PA 5KVFH 1T99A 4KK8D 2HRWA 2YR1A 32C2B 3B8SA 4EI5B 4R7NB 3S3PA 1AC0A 4QHKI 3HR5B 2D3VA 3OKYA 4J8QA 1ZPUA 4NHCH 1EEPA 3GD6A 3DFTA 1YMHA 3OKMA 4Y9AA 4RCAA 4YHKH 1UWXH 1RD5A 1NAKH 2MPAH 3SQBB 3VFOA 3FT3A 3ASWA 2ICWI 2A4ZA 2UY7B 1A8ZA 5E8EB 1KM3A 3X17A 1KTRL 3I9AA 5I15L 3AT8A 3NNTA 4NJJA 4NRYB 1K8YA 3N2OA 2WW5A 1K7FA 2POZA 4A67A 1OT1A 1F3WA 5HINA 1G01A 3BW9A 4Y5VB 4ZTOH 4NOBA 4W93A 5IVXA 5EBAA 1R47A 3OP2A 4D9PA 3SPJA 4BHUI 4JFFB 1R3HB 3FONB 1PMYA 1H3UA 4JOMA 4O4YL 3DMMC 5SX4H 1P53A 4LRIA 3ET9F 4GGBA 4X50A 2BSSA 4XHQA 5AC6A 4HUWA 5MEPA 1TLKA 5I82A 3QR3A 1QWUA 4GAYB 3I68A 3NEOA 1NBQA 2P46B 1XRSA 2JKIS 4HK5A 2KC0A 4U3SB 4B9GA 4FDWA 4KRPC 1L6WA 5DC0A 1VF8A 4MVBD 1H7WA 1DQDL 1LTXA 3RJXA 3WO4C 4K9JA 2O30A 4UTBL 3N6JA 1U9KA 2A83A 4NQCE 3MXWH 3TONA 5FGCE 5B4MC 1C93A 3R0DA 5T91A 4DYEA 1N8IA 3WLNA 2EG8A 5GZND 4YTUA 4NAQA 5GGRB 3CZSA 5B38G 1A0EA 3A6BL 1E9YB 1M5WA 1YKWA 4TXVB 3GBML 4OUIA 8XIAA 2WQVA 4FQCL 1IEVA 4JO8A 3ESMA 3HPFA 5D1ZD 3CLEL 3TXZA 3PPEA 1JCVA 4YDIL 3L9RA 3P2TA 5BNKA 1N6QL 4KJYB 2PMQA 3AALA 2J9XA 3TWBA 1E9OB 5MERB 2N56A 3VDHA 2PWHA 3TNMA 3BV4A 4GABA 3BLLA 2CKBH 2V5CA 3MDUA 2EDMA 2VTFA 4F5CE 4B3LA 1PSKH 2XN9D 3BEVB 2W5FA 1UXSB 5E5MB 3N2MA 2X2IA 2WNNA 4S1SH 2EPHA 5FO2A 1ZP3A 2EIJB 1NWPA 1ME7A 2E7MA 2EICA 3B8UA 3TTEA 2NPLX 3RYSA 2HJFB 1X7QA 5F2GA 4W68A 2E3VA 2IDFA 4HZ6A 2GSGB 4BD4A 4X6CF 3QIUB 3OLDA 1BEYL 2ANUA 4UBDC 3GNDA 2JWYA 5A7EA 4V27A 5F89B 4YTQA 1X5FA 3G3DA 4ZQPA 3KXFD 4H7ZA 5DK2B 2PDWA 4KH2A 1TVBA 4QGTA 1FHGA 1BLIA 3L7FA 4KKAC 3C60B 4EUPH 1QU4A 5KYWA 3L5MA 2ZD0A 3GBEA 3VD5A 1VD6A 3PBYA 1F5ZA 4G7VL 4J3WA 4DQWA 3SE3A 1FORL 4FFZH 2J57A 4NPKA 3GHTA 2BGNE 3K0YA 4OFKA 1CFQB 2QJGA 2ZZ1A 4U5KA 3W1PA 3W53A 4QXUH 4AIXA 3DX1A 3JWOC 5D9OA 4KITB 2XWEA 5L2KA 3W11D 1TQXA 2Q8XA 4I7WA 4KF1A 3VXGA 1XH0A 1SOXA 4M6AA 2ICEB 1PZ5B 1KG0B 4PWJA 4BE5A 3FF7A 3LNMA 4FIQA 3UAJD 3OR7B 2A77L 2HTKC 1DIOA 4U1KB 2EEDA 3ZE1E 5B39B 3VG0L 3MMTA 1H15A 1EANA 2KQMA 2V0AA 4IRJC 4LCWA 3N1MC 1I8IB 3FU5A 2GITB 3K81A 5DUBA 1R8LA 4NN6B 2X41A 3W1UA 2TRHA 3WUFA 2EDHA 4XPGH 2ZOKB 2JIWA 3S9IA 4GFSA 2GVLA 1RIHH 4S2BA 1JSYA 3QYCA 3QUMH 3T1FA 3UJIH 2FJKA 2J7GA 2NZLA 4Q9RL 2J62A 4YO0A 1WYIA 3M1OA 2O9PA 4PB9L 3S4SA 4GMSH 4M51A 4XZIA 4B3KA 1FL5A 4F2FA 1EAOA 4R53A 3VZXA 4UQDA 5E4EC 4I5UA 1TU2B 4ZE4A 2ZUSA 3P82A 3LPFA 5CHNA 3ETBJ 1E6SM 1TPVA 1LDPH 1NPUA 5C0GA 5FKYA 4PJ9D 1WUNT 3STLA 1DXFA 1MFBL 2Q6WA 4J3ZA 4XAGA 3ZJKA 3VNDA 4L8CA 1NMBH 3H2PA 4CU6A 1OG6A 2W5PA 3HPSA 1M6OA 1RP9A 4OIAA 4BCZA 5C0CD 2ZJSH 1GVSA 2HLAA 1DO6A 2YDRA 2MTAA 3H12A 3N06B 1PG7H 1ZBVA 4G9FD 3D2UD 3JTSA 1QBML 4JHUA 4P59L 5D7SL 3AROA 4DERA 5C3TA 4UQBA 5KJRH 1P9MA 3BPCA 4HJ0D 4YSSA 3CV5A 1P5UB 2UX6A 2FB4L 1LP9F 3AIRA 5HHOA 3K5RA 3VFRA 1X8FA 5D96B 4X6BA 2APTA 5CC7A 3B0UX 7ENLA 3PG9A 4DP4X 3GQYA 2K78A 3ARPA 3N1FC 1OPOA 1URLA 3F12B 3GF8A 3JU2A 2DIJA 4ZYKB 4EI0A 2XZ7A 4LPXA 2QVIA 4EI6A 1JZ2A 2EVFA 1CWVA 2ZUYA 4QTIH 3KP0A 4DJFA 3UZJA 4HMCA 1VHCA 3URBA 4R26H 5G2HA 4UT6H 1DWAM 3B3IA 5HWMA 1X5XA 2Z92A 2Y36L 4GT7A 3DHFA 1NFGA 4FX8A 3BDYH 1E4NA 4Z7VE 1YEJL 3C5XA 3LXCA 4NN6C 5I1CH 2JGQA 3JVGA 4OCLC 4QDPA 5ICYB 4O58H 4M6MH 4OLZL 2XSBA 2LAGB 2P28B 3ZYJA 4NB7A 5KVGL 1VIZA 1DQDH 4OIBA 4W1TA 3A23A 3CTTA 3M44A 1EUAA 4G1MA 3DGRA 5EOCJ 4WO4D 5SWUA 4W9IC 2ATSA 2C1OB 2YEZB 3EYOB 3OKDB 5DD3L 3RNQB 2OFJA 3SUSA 2BNJA 2XIIA 2JIXD 1U41A 2B15A 2EC9U 2DWSA 1TQBB 4DIXA 1ITXA 3WQ8A 5E9XA 5KG9A 3GMQA 3TBSA 3K4ZA 4BFKA 1X39A 2N4IA 2NXGA 1J1OL 1EKOA 1W9DM 2QJHA 5CR1A 5ALBH 1UWAA 3EOUA 1VSCA 4B3VA 1HYRC 5DUPL 4PRHB 4LKCA 3LEXB 4LLAA 4M29A 4TUUA 5DWUL 5ACLA 3CV6A 3UESA 1YNKH 5B1CA 4PWHA 5E1GA 6ALDA 3GDLA 4LP5A 4U1JB 3TYBA 2YK1L 1FO0A 2Y4SA 1PHWA 3EH4B 5TGBB 3NCCB 2GITA 5DUBB 4Q8QA 1TLMA 1N4XL 25C8L 2XWJB 4NZ8A 2ZOKA 2IALA 3DIDA 5D93B 2BV9A 4XRCB 4PM1A 5D5MB 5D93C 1UKPA 2ZE3A 4PB5A 1M7JA 3SFWA 5JPMA 1JZHA 1XQKA 1VRDA 3URAA 4N6QA 3LEVL 3S1GA 3W1ZA 3MJGX 2XRAH 4HXBL 3W07A 4HPGA 4IICA 2J8FA 3V3WA 3ZTCC 4GKNB 1I1AA 3TIEB 3EDFA 1YY8A 3SDOA 4H8WH 5E51A 4KK9D 3ZM8A 2WHKA 1TREA 2HDJA 4DKDC 5EFDA 5LN8A 3QG7L 2YS4A 3IRZA 2RH0A 1A6VL 5AKSA 2NCEA 3WIAA 1QPOA 3Q2LA 3W1XA 5EEWA 3ATDA 4JFSA 4UNKA 5HYQB 4NQDD 4RDBA 2ITFA 4ZFOA 3UFIA 5C0GB 1PF3A 4ODTL 3SURA 3D48R 4FLRA 3RX5A 1K70A 1MOEA 4R0LA 4WDIB 2PCPA 3K8KA 5JUEH 5HDQH 1XSKA 4PP2B 1AG1O 2IXQB 3K80A 3BDKA 1KJ2H 5E8OA 2HK0A 3MA8A 4IX2A 2DBLH 4EXKA 2V5MA 3HC0B 4GPVA 4DO5A 2G3MA 5I6SA 1DUYA 2WBJD 3WY2A 2VCBA 4NZRL 3U3HA 3DNKA 3QDGA 3SE9L 1DIKA 1JMXA 1CXLA 1SGKA 3MRKA 5DS8B 3AXXA 3KPPB 4OZIA 2FPTA 2FLMA 3CAWA 2JV6A 3WN6A 3ZL1A 1OADA 3EMQA 5D09A 4G2DA 1DLFL 4AJ0A 1RZKH 4BM7A 3C6SB 2ICWB 5JIIA 5AW4B 2XTKA 4ZVJA 5I06A 4TN9A 2HKHH 1S6NA 1C3FA 4AIEA 1NBCA 5TH2A 2BNQB 4X6CE 2PCYA 2WWMC 4WI0B 5CNHA 3BGMB 5TFSL 2GC7C 1FHLA 4BUGA 1SVCP 1ZL1A 1CLZH 4P5UA 4QO1B 3FN3A 3ARGA 3ML9A 2OJPA 2D9QB 4CCZA 4JO1H 1SJDA 4M1BA 4D6HA 1D7DA 1OK4A 2ZPKL 1FCUA 4RZ4A 2VIRB 1MRAA 3O4LA 4LPWA 4H9TA 3KPLB 2WUBL 3K8MA 1Z8AA 1MJ8L 3SSGA 1XIWC 2F68X 1Y5VA 4QLKA 5G4WA 2NMSA 4HKJB 3QXWA 5AD0B 2XIDA 5DMGD 4C54A 4EUPB 1R34A 3D4CA 1O6IA 1OWQA 3WTWA 3QH2A 1HHIA 5KW9H 2A21A 2W0UA 5AUMB 1JV5B 2MKWA 4QCEA 4H25A 3CVHB 3WQWA 4GUOA 2QCFA 2X4OA 1BVKA 4X7SH 3RRAA 3Q9PA 4NAEB 1Z9LA 3WNMA 5LA0A 3OQ3B 1E71M 3O9WA 3RIAK 3WEAA 4JTGA 1HTYA 1WZ1H 3RGHA 4LSRL 3TJLA 2IBZX 4Y16B 4DN4L 4IFKA 1W8EA 1X44A 3E2HC 3W82A 1PCSA 2HS6A 4K68A 2HXAA 5J13B 2ZOWA 4OV4A 1ZE3H 4KKNA 1RQBA 1QHPA 4GXPA 2WQDA 5GGVY 4MCYB 2C15A 2VLME 3AG3B 5CCGE 3ZMRA 2CH8A 3B2PA 3DBPA 3GSMA 1FL3B 5AHEA 3SW6A 3NSXA 2HJKA 2VDML 4LSBA 5EIIA 4ZW3A 4JIRA 1SYVA 2HB0A 4XKYB 3ESPA 4UC5A 3NAVA 3FBQA 3MTXA 4HIIA 3HQ1A 2VXVH 4UFMA 3GMMB 2YCLB 3OLEA 5D4YA 5FESA 1UENA 3KNBB 1CT5A 1FRBA 5IB4B 4Q3MA 2PGRA 4S3KA 3PNWB 4XMPH 1S3HA 3KPOA 4C55A 3LMZA 2KLTA 3PUOA 4RGOH 1MFBH 3D3VD 1IM3D 3EJCA 3F2LA 5AW2B 5DMYA 1AGBA 3DX8A 1QPRA 1WB0A 1WKDA 2D2HA 2ZZ3A 5AW8B 3LDVA 3MJ7B 5DURB 3WDPP 1E4HA 1EAPA 2CKNA 2LU7A 1U95B 4JPIB 2D22A 1UOWA 1M9WA 4PB0L 4Z77A 1U6AH 1UCWA 4E42A 2W6RA 5CPSA 4XC1L 4ZTPL 2XU2A 3HHRB 3DXAA 3OHXB 1OIMA 3NGJA 3RX8A 3W39B 4MQXD 3NESA 2DEYX 1JPFB 3QCVH 4N24A 5HDBB 3P4MB 3VXPA 4RH4A 4WFFE 1LO0H 3RTQD 3W75A 2P3EA 3L3OB 1R2RA 2GJZA 4FABL 1QR7A 2BHFA 2PCPB 3FO2B 3MRQA 1IAII 3QGVA 3QXTA 2J8UA 4BJLA 4LYQA 4ALAC 1YXYA 1XF4A 1FBIH 5F7LB 2I5GA 3R8BB 3QV7A 1ZV5A 3ROOB 2WJ7A 1CDIA 1UUSA 4IK6A 1F3JB 4F92B 2R1XA 4KWOA 4ACYA 3MV8A 4JCMA 3WY1A 4O1FA 1SLWA 2BXZA 3IDXL 5EA0L 5D7IE 5HGAA 2OTPA 3D09A 4TL4A 3LG3A 3P84A 1OTSC 4R26L 1AKPA 1UH3A 1WA1X 4HLZH 3DI3B 1E6OH 4MCZB 3GZAA 2ZRZA 5C70A 4MIMA 3KHQA 2WWNA 3SJVE 3GS4A 4XCNB 2R24A 3BPWA 3O0RL 4PGBB 3QEQE 4MJZA 4KY2A 4MJ2A 4UM9A 3AJXA 2DYSB 3W00A 1EGMA 5TDNA 3K72A 3QXDA 3QLDA 1CB4A 4X6FB 3UXIA 4JKMA 5I3DA 1AD9B 3B6SB 5KOMC 4HS3B 3BCDA 1EEXA 4UB9A 2CRMA 2V5JA 2YA2A 4NNPL 2GVJA 3H2NA 1OANA 3V52L 2DWEB 4KGJA 4PBDA 4C83A 1XBXA 5M2FX 3M1CA 4QJ5B 1FNSH 2WINA 5TD4A 4JR5A 2VXQL 2Z1PA 4DPAX 2WM0A 1J79A 3AG1B 3PY2A 4ZPTA 1F4HA 3R4RA 1QAPA 1Y18B 2X28A 3K4AA 1I3RA 4TSCL 5CGTA 1BM7A 3VXRE 5A8NA 1ILUA 5C0DA 2X16A 4S10A 2ACSA 2E7FA 2ADGB 4EVNB 2IQ9H 4PHXA 1VKXA 4BHUA 5H6HA 3ZYIA 1W56A 3CK5A 1SM9A 1XIFA 2R23A 1GIGL 1T7WA 1Y6NR 1JPTH 2HLFD 3OZKA 5IFAL 4J3OC 1DBMH 3BZEB 3M64A 4GJJA 1Q6FA 4O16A 4I2XE 3UZZA 2EDQA 4IJTA 4ZS6C 1OALA 2AAVA 4MAZA 5E4OA 2HG5B 1MN4A 1E9PB 4OAWB 4QYOA 4YAQB 5EBMA 1UZ1A 1GQJA 2VZ1A 3ICJA 3R6IA 3DX6B 2M26A 3GSNB 1JOIA 4M7LT 4PCPA 5TQ0L 3T2LA 1IBHA 2XXMB 2OMWB 3FQRB 3P69A 3WXWL 4W7VA 2EXSA 3RBGA 2COQA 2BBFA 1ESWA 3QSRA 5JVLA 1XH3A 4I48A 3QZLA 4WDXA 2R56L 4GFIA 4CMMB 2IPTH 3H9HB 3HRZA 3LKRA 4R90L 5J12C 3SCSA 3WSUA 1BEYH 3IGAA 3F4WA 1A1NB 3SODB 2CC0A 5A5WA 2YXOA 3ULUH 4P2VA 3BUTA 1CURA 1VFBB 1EBGA 4LALA 3V0EA 3ZDZE 1AJ7H 3TO4C 2YBVA 5LIXX 4IOSA 3TA4D 5IQ7H 4H1ZA 4JDTH 4MA3B 5E6ZA 5D6CA 5ADPH 2BLFA 4B5NA 2VXUL 2XVGA 4Y4HC 4CQAA 1IL1B 1WAAE 2WZIA 1GJUA 5C0ND 4AYDC 1E4MM 4GAFB 3UBPC 2WBWB 2VRAA 2E9MA 4FQHB 4L1XA 2BOFX 4L1WA 4QCFA 4GG6B 2VCCA 4AISA 5DHYA 1AXSA 3QJRB 1XGPB 1WBYA 3D39B 2RKXA 1MVFA 2PKDA 3P3BA 4E2BA 4QKTA 4ALAL 2YLAA 3GZQA 3NDZA 2BW4A 2QQNH 3X1FA 2FZ9A 4PJHB 2CDGA 1FV1A 2VOTA 4JDVB 5SWSD 4N9EA 3RM8A 2NY2D 2JJTA 2VZ3A 1RMFL 3TCXA 2FZ8A 1LYXA 1TKWB 4JTFA 2HRPH 5KVFL 4A3RA 3ZE2B 4E0RB 2ZTJA 1ONXA 4BKLB 1ZTXH 1XHGA 4AZ6A 4HIQA 4GRSA 2C16A 4EMZA 1HL5A 3ZKMD 2BNUB 2AS5M 32C2A 3TOYA 5A2AA 2YBGA 2A6IB 3UVAA 2XM2A 1NUFA 2YPLE 4YHOH 4PR5B 5FGRA 4QHNB 5AWNL 2N1KA 2YGOA 2KI6A 4G6AD 3TXAA 1NGXA 4RZCB 2Z1WA 2JXMA 4FQ1L 3D18A 1HXJA 1GTEA 2P50A 1ITCA 3QPXH 4PJ9B 4XC1H 5CGYD 3KPRD 2AJZA 1XBRA 3QXDB 4XPAH 1Q94A 4MDIA 3I6GB 4H8VA 3T2NL 3W01A 3WLJA 4R7XA 1XCQB 3GX9A 4K2SA 3MCLL 1JCTA 1E6JH 2FJFA 3FY1A 3BW9B 4Y5VA 5DHEA 4E6MA 5IP4A 5AWNH 1XIWD 4G7VH 2WGNB 3KYKH 3OLIA 1HWWA 3ZGIA 2DUXA 3U9IA 1WFMA 2YPKB 3UAJC 1V8EA 3FCTA 1UQSA 3NSJA 3BPOC 5I1DB 3MU7A 3U0TA 5IB3A 4CGTA 3DGGA 4LQ1A 4O57A 1NSJA 3I6LD 4NZ1A 1BWVA 4HJGB 3MV11 7TAAA 3CDZB 1EAJA 1QVOA 2VR4A 3GJEB 3I2CH 3II3A 2ALAA 1J93A 1ZGLM 3C75A 1UP2A 2OZ3A 4HWEH 2H3BA 5IJVB 2GCYA 4X22A 4GVHA 1IAIL 3K2UL 4HIXH 2H4EA 5IOKA 2RJGA 4FJZA 3SJ3A 2WVSA 4G1EA 3QEHA 2KLSA 3HZYA 2F6XA 1JVKA 2CJSA 3O11B 3MV7A 3HC3L 2X4UA 1DDHB 1YUKB 3Q8AA 4TVDA 3HUJA 5CR8A 2B1AH 4P2YA 4HLEA 1S1PA 4N9DA 4NL1A 4DYJA 1T0MB 1PZAA 2WSDA 4KTGA 1B4JH 4YE0A 1UUOA 1FH2A 3MU3A 3NDZE 4UNUA 3NABH 3QZ6A 1H9VA 3BT0A 3L9EA 4AV4A 5D7LB 1A3LH 4P5MA 4LVNC 1M7DB 3GC3A 4M1CD 5DD5L 2Q71A 3VOGA 1OE1A 2YQGA 1KBGH 1MW0A 2P8LB 5JXEC 4EBQH 3M0XA 4WO4B 2KZHA 2NUWA 5GJSL 5HAOA 3QHTC 2P26A 5F7BA 4GYJA 4NQCB 5HY9A 4LLWB 2F5AL 3T0WA 1L0YA 1MCOH 1W72A 4MMZA 1Z9OA 4GG9A 3S0PA 5ECGA 3RVUD 4IRSD 4NKDB 1NCAL 1F0LA 3CC5B 3VM7A 5C0EB 1HJSA 2YRPA 5IB1B 4JN1L 5I1AA 1JN6B 1MHEB 2C7UB 2X89A 1DLHA 4HFWA 2GPZA 2YC1A 3NJKA 4A55A 2XGIA 3P62A 1WSST 5IT2H 3PZUA 4H6KA 5FCUL 5JORA 4GX9A 2CZVA 2DB8A 3CQHA 1N0XL 3GZOA 2QCLA 1WAAF 3V5FA 3H2OA 2CO2A 4JFFE 4N8CL 5SV3A 1KTLA 4LLMA 4P2QE 5DO2D 2DJLA 1INDL 1YUHB 1RV6X 3UBXA 4NX0A 2I5YL 3FSTA 3MLUL 3F01A 1E42A 1JFXA 1FCBA 5EL1A 1V7MH 4MYWB 1J0KA 4V15A 2E8YA 3NFPA 4BZ1L 5JOEA 1MZHA 1B0RA 2HQAA 5BMFH 1SMAA 3BLEA 3OVGA 2VUOA 4JYDA 5AYXA 4F7PB 5CGYC 4LGRB 2JF7A 3IARA 3S2MA 2Y25A 5BO1H 1KB5H 1MI5A 3QJQB 3P2BA 3B9VA 4OQTL 1A21A 3ZGHA 1TJPA 3F65A 2ZA2A 4C6CA 2FVKA 4P7NA 4KDVA 4YNGA 2AKRA 1OW0C 1XDJA 4NT6A 5CZTA 3U4KA 4YBQC 3U30C 2WHMA 2HX7A 1UCBH 3N6QA 4OLWL 4PBEA 4ZZ9A 4ZTEA 1BQHG 4JN6A 1A4JB 5I76B 2GSMB 1OFBA 3N17A 4AXNA 1XDTT 5L0QB 4X6EA 1N10A 4M00A 4Q8PA 4ZD3H 2CLFA 3S5OA 2FGWH 2VISB 3PWVB 2DVUA 3KDPB 3RPIB 5FDYA 4U0QB 1F07A 4IQDA 2H9GB 2IWEA 1MFMA 2VFDA 2PZ0A 2WV3A 2RGSA 4KK8C 2HROA 4PJ6A 5HJGA 3LCGA 2I5QA 1J1OH 2W88A 1GONA 4NOFA 4JCWA 1SHXA 2OCZA 3DFYA 4IP4A 1E2ZA 3T3PF 4F7TB 2VX7A 3IPBA 2KBGA 2EH8H 4OJCA 2YDAA 1D7KA 4NKMA 2NT1A 4IPIA 4JTTA 3NWRA 3CFQA 3ONCA 2Y07H 4QEGA 1GZHC 3W7IA 3GKAA 1YDPA 1PZ1A 4JEGB 4D7PA 4XG1A 3DECA 4M80A 3AS1A 5LHFA 4BFIA 1E9QB 1MPAL 2KMWA 1HNFA 3P4NB 1Z3RA 4LDOB 2ZCHL 5DYOA 3T4YA 3B2MA 4PLOB 3ZE2E 4BWUA 1GUVA 3QCUL 3SPIA 2GJJA 1S5IH 1MY7A 2OL3L 4HK3N 5A8QA 3WFDH 3ZX1A 2WYHA 1ICTA 2VDRH 3LTVA 3N43F 1J18A 3HOGA 1MCQA 1WITA 3GI8L 1XFPA 2Z9TA 4JQIH 3V8CA 2OR8A 1F8TH 4JMXA 3D3AA 3HQNA 2CJUL 3WMPA 1K72A 2Q3RA 1NCBL 3P40A 2DLEA 4XBGB 2OMAA 4DXXA 1NPJA 2BDNH 3JYCA 1H8NA 5DRZB 4C56E 3LRMA 3FPYA 4HWUA 3QR1A 3GK8L 1TWWA 3WBXA 4EF9A 3LBCA 4Q97A 3O8XA 1BYBA 4XAKD 1RJRA 3P14A 3BMXA 3O6ML 3RGVB 4NG3A 3BO8A 3OXRA 5D9SB 2EUZA 3TIDB 3VFNB 1KT2A 2OQJB 4HD5A 1GCFA 2QDDA 2ZOLB 3UZVA 1IGJB 1OF2A 1UIOA 3M0HA 2DUZA 5IB1A 5K9QG 5HJBA 5GJTL 3AQXA 2GBTA 3TMQA 4L0PB 1XIDA 5MKGA 1ZSHA 3SYAA 5F1SA 4JE0A 1ZVHA 3FJNA 5J04A 2YLKA 3E1F1 1CD9B 4P2AA 5AVSB 2AGJH 3E38A 4TUKL 2VYRE 2QV2A 3UERA 2R2CA 3BZJA 3ILQC 5CINL 1DQXA 2G60L 1DVUA 3UZQB 1X7FA 4N7QA 4Y8FA 4ZT1A 3VC6A 2FL5A 3BKYL 3GYRA 1C8VA 4RAHA 2NR6A 4WI0A 1L3NA 4XV0A 2D69A 3VGDA 4Y1AE 2E9WA 1IGCH 4XAWL 2OMNA 3GW0A 3AS3A 1MUCA 1MCBA 2NDGA 1CK0L 3OZMA 4IIGA 3T6QC 3KLSA 1I7ZA 5EBWA 3NQ2A 2FMNA 4UIMA 3HE6C 2VZVA 4MCNA 1E67A 4EI5A 4PUMA 4GQ9L 1OF8A 3PTMA 3IUIA 1CE6A 3QVAA 3FB8B 1KEGH 3VH8B 4QTHB 3PV6B 4XAWH 3GTNA 5D5MA 1PIIA 5KS9A 4PJ7F 4UMSA 4MYAA 4F2UA 4XZMX 3FQYA 1G1KA 2PWFA 2HVJA 2GSGA 4MNQD 2VJ8A 3W0KA 4OCWH 1NARA 1E5ZA 3V0TA 1IQDA 4M7SA 1Y6MR 2VLLB 3K71A 3CGTA 1T04A 1VJZA 4NRSA 4E9VA 2AVGA 1T0OA 4Y9NA 5IVXB 3WJSA 1QFWL 4DJDC 5FCUH 4GKTA 3L8QA 4HTYA 4NN5C 3IRDA 5A94A 2IKHA 1D9KB 5HVWA 4QLJA 3MVSA 3VNZA 1HHKA 1GVRA 1X9RA 1L9SA 4KV5E 3OW1A 4UUIA 1YADA 4AEOA 2Q3AA 5E6ID 2XG9A 1AVAA 2PTWA 4BI6A 4KC3B 1BYPA 1B3ZA 3IDXH 4Y9EA 3AREA 5EIIB 2A85A 4ZW8A 4QPEA 3HUJE 3RWJB 2DSWA 3TA3A 4MCYA 2VDMH 5T5NF 3WL9A 3W11C 1B3YA 3QCTH 2XHYA 4JTAA 4NIYE 4M56A 5F1IB 3FYYA 3JVAA 3KBSA 4KJPD 1E7VA 4YGVB 3SE8H 4DI9A 4JFXA 1V0NA 5JIDA 4YDIH 3C08H 3UWZA 5IK3A 1S5WA 4IRJD 3AAZA 3KPPA 1GKQA 3K4WA 4O5LL 3TFCA 2UV3A 2VR3A 2XKUA 5GJSH 4Z7QB 3LOTA 2AEIT 1CL7I 1K3IA 3V6FB 3L68A 4EI5D 4O2FB 4PB0H 5LBSH 1ZTVA 2V5BA 1JK8B 4JO5A 1Z89A 2PD9A 5IB5B 1C9DA 3WDJA 2M83A 5F2MA 4XVSL 4ZJ9A 4XBKA 3IF1B 4HX1B 4FMKA 1U8CB 4JFED 1J0YA 1P69B 3E74A 1UXSA 2P48B 3BCFA 5E5MA 2ZUWA 4GSXA 4B6ZA 1AHMA 2QPEB 3D08A 1NFDE 4OKVA 4PJCB 5MI0C 2GJ6B 3VB8A 1S7XA 4AGLA 2FBOJ 1EFZA 3CUHA 3SGZA 1S2VA 4ETQB 3WDQA 2DZEA 1UKSA 2O7QA 2A7NA 2ENSA 3B2DC 4AD3A 3G3LA 3CPLA 4WK0B 1JYWA 4X6BB 3MSYA 4MZ1A 2IGLA 4WKZB 4WEMB 3DU0A 1JPMA 5A2BA 5DX7A 1QZ1A 3UJFA 3BGAA 4JM2A 5GZOD 1Q66A 2P52A 2HKFL 4H00A 3NFUA 4AVKA 1OGTB 1QMLA 5F7MC 3SDCC 4D6GA 1XGYL 2WBKA 2IQAB 4ES9A 1TZOA 1LMIA 1WJ3A 3DJ9A 3OGOE 5HYFA 3H6JA 2Z7KA 3S88H 4P9MH 2P5WA 4V11A 1ACYL 2FH6A 3KLKA 1R3SA 3AHXA 2V3DA 1XH1A 1U8PB 5MHSD 1NM9A 2DQDH 2EYTB 1UQYA 2WAGA 1R3KA 3APNA 4FOKA 2CBQA 4I0CC 1BX2B 4JRFA 4P46A 1R46A 1AZRA 1FO0H 2UXVA 1A3ZA 5JHDE 2C79A 2XM1A 3E8UL 4HH9A 1IJNA 3WEXB 4QRPE 4PRDB 5FO9B 1CFNB 5E5UB 5E5LA 5HUPA 4PYHA 2XWBB 3ISRA 1HKFA 2FNWA 4JPVH 5DJXB 2X70B 5DZOA 1KXQA 1VZHA 3GO1L 2PDMA 4JGMA 3QRGL 1JXDA 1YN6B 4MZIA 2IXUA 2YFOA 2QF7A 2DTMH 3JVFC 1R19A 1DBKL 4U1MA 2XX1A 1A5OC 2C7FA 3E3HA 1DSYA 2NNFA 2P7TB 2A79A 4DBSA 1G7HB 4JK0D 3EYOA 3RNQA 2HMID 1KSRA 1VKXB 3MGTA 1T5AA 4AC2A 3W83A 4Y5XB 4YSCA 5IXEA 3Q2VA 2VQ1B 4TMBA 2UY2A 4Y9OA 5AVVB 1CGYA 3WF1A 4EWND 1QWNA 4Y4KC 3GWQA 1ZS8B 1U8LB 1KRMA 4NJ9H 3OVPA 2CO6A 4Q58C 3FZUD 4AE0A 4WK4B 5CINH 4AUJA 4OGYL 1HTIA 5T5FL 1G7PA 5KYUB 3MUIA 5LAPA 5K93A 3TP4A 3IS1X 1V7NH 1KA9F 3LNPA 4B90A 3D1MC 2VSCA 3EOOA 5I1IH 2QGHA 2GJZB 1QFWM 3WELA 3T3MF 3LCHA 3R7RA 4N0UE 1T03H 1ORQA 1F58H 4H3DA 1C92A 3W1RA 5IFTA 2BNQE 4X6CB 3RY6C 3UR5A 3WMQA 2BP0B 4BCYA 4YDJA 1P7KA 1LT7A 1Q5MA 3DAQA 4UQEA 1EZ2A 3QJHB 5F4WA 4I2XA 1KBIA 2EYSB 3HIJA 3PHSA 1V6XA 4KVNL 1TT6A 2O5YL 3NJNA 2K6WA 2NYZA 1FXPA 3IJ9A 4AUYA 5J8LA 3TCTA 4ZO8A 2ZA3A 1T8QA 1N2RA 2UZXA 2H0EA 1A6ZB 4OFQA 3VXSE 1LE9B 1CFVL 1V10A 2FX9H 1BYNA 3KXQA 4NO3B 5FGBA 2D2CC 1H7RA 1AZ1A 3F7YB 2EACA 1QACA 4HHLA 4NUJA 2AJUL 3GNRA 4YDZA 4XZHA 4H9UA 1RZGB 4O02B 1WDQA 3L9CA 4CEXC 1OVZA 2J8UE 1NEZG 3WUGA 1KJMA 4M43L 3NXLA 4W84A 1AOHA 4JDEB 5EY5A 3SQMA 3BP7B 1RKRA 4PRID 3EO9H 4TPRH 4X83A 3RU8H 3UDWC 4XNMA 5I73C 1HKIA 4WJEA 3BDYL 4DY1A 1PWMA 5J6HB 1UIPA 3NK3A 2GYIA 3K5XA 3P5ZA 3FUKA 2EVJA 1ZSDA 4OZGF 4OTKA 1TV8A 2HFEB 1IM3A 2EKCA 1AGFB 1CDGA 5ALCL 4KHTH 1G7JA 2EE0A 1DHKA 4LPTA 1G4TA 2J9ZA 4LOCA 3SPHA 3CSTA 3WH6A 4MDPA 3FN0H 4ECLA 4UTAA 3MRCA 1THAA 3SIZA 1S7XB 3I2CL 2IDUA 1U92A 3GFZA 1UR4A 4PW3A 3PUCA 4JFPB 4KFNA 3T0BA 3MSRA 3VNKA 5IJKC 1GGUA 1W9UA 2VEMA 1WV2A 1JF6A 1P84K 1SUJA 4JS3A 3SD5A 5J9PA 4U1GC 1TZIB 1E55A 3HC0A 4ZMYA 1JDDA 1XLFA 4OLYL 4AMAA 3SE8L 3UMTA 2Z0BA 3CZUB 3U1PA 1WWCA 4KBXA 4PTTA 3S9DB 2B5IB 1NFBA 4WI9A 4FFVD 3N3MA 3TA9A 3LPGA 4IBSA 2GUUA 4IMDA 3MV8D 5A16B 3AFBA 1JDEA 1O7DE 3QNZB 3H9SD 3SQOL 1ZWIA 2VITB 5DLLA 1EMTL 1M53A 4WSGA 1BF5A 1GRWA 1DBBL 4Z7OF 5A6AA 5K3VA 1S3RA 4OOZA 3VD2A 3F3HA 1TSIA 4ZA0A 1KC5L 3VRLE 3U0WL 4B15A 2GEEA 3ABQA 1Z3GL 4QRSA 3IMBA 3V5DA 1A6TB 4BZ2H 2XBTA 3FQWA 3LVEA 3RZWA 2J7LA 2VN4A 5CCHE 1AACA 2WW8A 4FNPA 1TCDA 1LWRA 3UZWA 1JMZA 1HNYA 5EO0A 3RVWC 1OHQA 5E2TL 1HCVA 4A3HA 2C3XA 4XXCA 3UCRA 2HFGH 1DYSA 4P7QA 3IGAB 3D7PA 1T22B 3RVVD 3STGA 2NUTB 3MLPA 3VXNA 1CGWA 4RNRB 1SYSA 4RFNC 3GVVA 1ZOXA 5TTRA 2JELL 1AH4A 4O4VA 5EN2B 5IGXL 3AQUA 3OV6A 4FQXB 2EIEA 5DJ0B 3HZ3A 4EEEA 4TSAL 5IJVA 1JZ4A 4MPKA 1W8GA 2IGFH 3NQKA 5FA4A 3KWVA 1HXYB 1JPEA 1IT8A 3MHUA 2WZ0A 3MBED 3LNIA 4MJHA 5A6BD 1SXAA 4BF7A 4XPGL 3CVIL 3GGWA 5K4XA 2QQNL 4PRBB 2E6QA 2F1EA 4MXVF 1S5TA 1EBAA 5HYEA 2HE8A 3R8RA 2VCAA 1E4KA 3CUXA 1A9EA 2FAUA 1D7BA 1FZMB 4HXAL 4GQZA 4WUUB 5DWPA 1W3NA 4POUB 3K46A 3OSVA 1UG6A 3LZFL 4GRMB 1AR1C 2DPEA 3HZVA 1MJ7L 1NCDL 2BOBB 1MAJA 1RIVL 1X7SA 2K8QA 4Y9CA 2EVHA 3KTCA 4LH8A 3WF3A 2ZZ2A 5LNVA 1ZJBA 4CRPA 4HCLA 1EHKB 2EH7H 3RIAF 4NKQB 2XQYA 1ID2A 4RRPG 4IKIA 2AEPL 3AU2A 4LRSA 4I5RA 2Q76B 5AFAA 1EDHA 3CEUA 2O4QA 3H4XA 5EZJA 4BFAA 2BM3A 1HHJA 2F54A 3VYPA 4PR5A 2D31B 3ATEA 1XIBA 4RLIA 3NRFA 1E28A 2ESVD 1K5NA 3S96A 4AEIL 1XYLA 3AMCA 4CCCA 4POCA 2JXMB 2WLYA 4ECNA 1UJQA 1ZHKB 4UQ3A 1QR1B 2TMDA 2E7BA 4K15A 3SKOB 3GHRA 1CXEA 3BE1L 3EW3B 3H1ZA 2NXYC 4DW2H 2A3BA 1H0IA 4HHMA 5GJNA 3FTUA 3EDEA 4HC1L 1PG7X 3NDYE 2BVQB 4X2UA 1J48A 3U2CA 2O6CA 1P0DA 3HM7A 1F90H 3MLRL 5CIPB 3CQPA 4DUVA 5AZ2L 1ZAJA 4NWUL 3WIIH 3HOJA 3OYZA 1DEEB 4GUPB 4BEIA 5BRZB 5I5IA 3QHMA 4FXJA 2WQWA 2E27H 2EKSB 5IWLA 4UMCA 3WKQA 1XF5A 5GGTL 4W9DC 12E8L 1VERA 4PTUA 4FF9A 1XCTB 1JGVH 4C7GA 1VA9A 4WW1B 2OMVA 3EDKA 3ES6B 1H7XA 3F4DA 2O0TA 3CHDA 4UQCA 2V6HA 3FA3A 1OSZA 4M1RA 4M5PA 2I07B 1OYAA 3VW3H 1GEQA 3M9YA 2D2OA 5DXYA 3O8XC 4XCNA 5EEYA 1LLWA 5DFTA 4KQ0A 4O8RA 4V1XA 4QITA 1RU9H 4XD6A 1AAJA 4A7QA 3CYVA 4PZVA 3A47A 4NIRA 3STBA 3OJDB 1UGNA 4S1DD 4F7PA 2CZ5A 4MNMA 1Z9PA 3ZE1B 3N5AA 4ODBD 2DUAA 3MY9A 5FUCC 3QUKB 4OUUA 3FMGL 2X4PB 4J3TA 2Q3OA 2ODHA 3RB7A 4P0DA 3AIQA 3E2QA 4FTVB 3ULVH 3W7DA 1BFVH 4PJGF 4R4FL 5I0XA 3J8F7 2F15A 2JTYA 3RVWD 4BSJA 3KVMA 5CLXA 1BFTA 3GMPB 4H9ZA 2YBRB 3IMWA 3WO3B 5EIQA 1SF3A 1JFQH 4H01A 1M2VA 3GVQA 3H2FA 5ID0B 1UWGL 4XX1G 5H8DA 2JQMA 5B1BB 2G4FA 3BWSA 3L95A 3TV3H 2V7HB 3WXVH 4FYRA 3PGFH 5T5FH 5HYSB 2QELA 2PYEA 4QY8A 5L9DL 5E08H 4TL5A 4E5XA 5DO8A 1CN4A 4OJFH 1INEH 5EO0B 2QADD 5CZKA 3I02A 3RX7A 4W6WB 4I0PD 3BAIA 4YHPB 4MMZB 5H4YA 3WF4A 1MW2A 1S38A 2VABA 4PRNA 3UDWA 4LC6A 3UR7A 4DTGH 2FZ3A 3DI2B 2NY0C 2OSWA 2WMHA 2V2CA 3CU2A 4LF2A 1L2UA 3BDXA 2XWTA 4TV3A 4I5XA 5I9QC 2OLHA 4Q6JA 3C5SB 2ZX8A 3LHPH 1FBIL 3MRLA 3NFNB 1B9KA 5EIIG 1PTDA 4QXTB 5DQDL 2DL9A 3NPWA 3FFCD 2ZZUT 3GC4A 1OT2A 4M8VA 1AZCA 1NCJA 3ASNB 3MRIB 4Q6IB 4RVBA 5GGRA 4GIEA 4HCDA 2R1XB 4MAYA 5JIQA 2ZF8A 3GI8H 3UBXB 4EZJA 1K6AA 4AKPA 5IEHB 3EBVA 2LU5A 3QG7H 3H9HA 3HRZB 5BMFL 4YQXL 1AGCB 2YPIA 2CLEA 4R96A 1XLHA 4R5EA 3CZFA 2EDWA 3VFVB 4AJYV 3EIFA 3TX9A 1JE6A 1I2QA 2ACQA 1BV8A 1W0MA 3FQNB 3F7KA 1T5XB 5JR1L 2RACA 1QHOA 3FCBA 1J1XH 2CBOA 2TRYA 4FQIL 4JFDD 4BV1A 4E41B 1OFAA 1W31A 3G1YA 3OA3A 4LB3A 5EZJB 4BQ8A 4ZW6A 5FHBL 5CCJA 2CITA 1WK0A 4LSPH 5E8NA 4DXKA 4YBHA 5IBLC 2GK1B 4UTTC 1FG2B 1QO3A 3G1AA 3WQFA 1I8AA 2AVFA 4HCRL 1JV2B 3NCJL 4M48L 2DQTL 1LEIB 4XT1C 2BVWA 1RZJC 4C6FA 1EWHA 3FN9A 3F4NA 3SCVA 5D7LE 3M8OH 4WZ9A 2WHVA 3MRFB 1YX1A 3FKKA 4H20L 2BVPA 4NZDA 3H7BB 2PXYB 3HMCA 1N59B 3SE3C 1A5NC 1TWIA 3WNNA 5EBLB 3IEBA 1I3RB 1E0WA 4EIZC 4DNHA 2NW3A 1FCVA 1SN0A 3KW3A 1XF5B 3L9BA 3LX9A 3V5HB 2Q6ZA 2JMRA 3PJXA 4XP9H 4U3XA 3SDAA 1DHPA 2I60L 2DWDB 4YX2H 1ZRUA 2ZPKH 3W4RA 4M02A 1OD8A 3KH4A 4LOFA 4WWPA 1B54A 1B0GB 1SY6H 3IANA 5HNNA 1MPAH 3G08A 4LF1A 3PDOB 2AEQL 3RUGB 1XUZA 4XVTL 5A6IA 5LG6A 4M7TA 4QHNA 2CHWA 2DQJL 1ECEA 1CE6B 4PU2A 4ZSOE 3UBFA 3MTRA 5LBSL 2LV4A 2VWSA 2IADB 2YK1H 3TM6A 2IMRA 4NQDB 3G9AB 2Q7YB 5KBKA 4AY7A 1HS6A 4LAQL 1I1RA 2XTLA 3QJSB 4IHOA 4YHKL 1JG9A 4FNQA 2OXNA 3HIZA 1U0QA 1KM5A 2DQGH 1IEAA 2OXHB 4U6VL 5MENE 3MRGB 1HIZA 1UPPA 3K30A 2QMJA 1C9SA 3K1GA 4MJ5A 3P9MA 3SOBL 3KZSA 4P23C 4RDVA 3S6OA 1YNTF 3AZRA 3HB3D 3OPZH 3E0IA 5CCKL 3PWLB 5GGQL 3DG7A 4XMWA 2XWXA 3D4GA 4GO9A 1V0LA 2VQTA 1UH4A 2OWXA 1HZHH 2EGZA 1W1TA 2HX9A 5FYKD 4LC8A 3WFLA 1Q9OB 1QZNA 3CG8A 1J9CT 2OCJA 3DIFB 1W72L 2C9XA 2B0MA 3LMYA 1G6RB 1C5DB 1X5MA 3OJMB 1OP3K 1DSWA 1WD9A 5AHIA 1JNDA 4WJKB 3BRFA 4HN4A 2JKNA 1NDMA 1FAKT 1P2CA 3QWNA 4ZOEA 4G9DB 3UIZA 3UTSD 4JKNA 4UF7C 3RA7H 4YHNB 5C97A 2AJSH 1W6WA 4U49A 4HPHA 1BVOA 4Q4MA 5CPQA 5TE6H 3KPTA 3RRXA 1F00I 2Z0UA 3O11A 4HYWA 3J07A 4IBUA 2IVFC 3KRBA 4Y2OB 4PJDA 3VFUA 4Q9RH 1FNFA 3FQUB 1O6SA 2MKLC 3HN3A 5F1NA 3SDAD 4D9RD 4ZZKA 4JTLA 1ISWA 5FW6A 1DN0A 3DIVA 2IH3B 5C0FB 1LDSA 2XA8L 4Y4KA 2UY5A 1KFWA 1RZ8B 1Q38A 3A6CL 2CR3A 1WE5A 4HGWB 2Q7NA 4OZHB 2F6KA 4HMDA 4UNTA 1JNHB 4NQCA 4OFIA 1A7QL 2GAZB 3VXUE 5HY9B 3O6YX 5AZ1A 3QF0A 1I75A 5C3LD 4WDUA 3I3BA 3CFCH 2AXFA 2QVFB 2GUOA 3VD9A 3UYRL 1AGEB 2F1BA 3I6KB 3OZ9L 5ICZA 1XKYA 3ZDZB 2HMCA 4ETQA 1Z2KA 1GGCL 4JG0H 1XLLA 2GK1A 1O6TA 1M71A 5FF6B 3O07A 4J3VA 4OLVL 1NMCB 2LOEA 4QJ3B 1FWSA 3KLQA 4WSHA 3TXVA 5KTEH 1HKLL 1NQBA 3VUPA 4PI2A 1OCNA 4KXZH 4MLIA 5FAAA 1W0WB 5CBAA 2F6AA 2B59B 3OKEB 5JMOC 4TVCA 3EADA 4Q8WA 1XKJA 5BOJA 5BCAA 2AQNA 1ZIAA 1RZ7H 1DJQA 4M3HA 5E4IA 1MWAL 4TLKA 3GG1A 3QKZA 4GRLC 4NO5A 2JALA 4XGZA 1I8LC 2PO6D 4YLBA 4PJIB 2X0YA 1F2XK 2EDKA 2IBZY 1DANU 4MXWH 2VQUA 5E70A 4DUXA 3A5FA 3OGRA 3ARDA 2W62A 3PTDA 1HDMB 2EYTA 3QZPA 4A63A 5IMLA 2PDJA 5G4HC 3UWUA 5TPWH 1KFCA 4WUIA 5EBLA 2K9UA 2H2PC 3C2AH 1VHPA 4W9ZA 4S3BA 1W2KT 4PRPD 1XCXA 1W91A 3WFBL 1YEGL 1B2WL 3CFBA 3AT0A 2APXA 3MLVL 2VIRA 4HPXA 4GQPH 1SJMA 4AIOA 1CLKA 3O1NA 3FT4B 1W9PA 1FDLL 3QIBC 3W0WE 1TVDA 3KM8A 5DI8A 1I2NA 3PZQA 4TKWA 5CSBA 2APVA 2O6FA 2PPDA 4ACPA 3PZTA 2Q7YA 3CMJA 3H23A 4AFYA 1MJUL 1H2JA 3MGTB 1A9BA 2UZPA 5D04C 4GEIA 2Z4QA 5C92A 4IHOB 2VP8A 1KBGL 3B40A 4HGMA 3ULVC 5HR7A 4N8PA 4EN3C 4NJHA 3FN0L 3HGJA 1WDPA 3CK0H 4NQEB 1RK5A 2WMFA 2WB7A 3BVNB 3UTTB 4JFZH 1JUBA 3W7GA 3QZBA 1MHCB 4JPQA 3RWDA 3A4AA 5KVEE 1BG1A 4L4OA 1GNXA 3HBQA 5IHWA 4PJEB 4F8XA 3QJHA 3IM1A 4U33A 5CN2A 4A6YA 4I18B 2PDBA 1QSVA 1TQCB 1TOXA 4G8IA 3U4EB 3UR2A 3AMKA 1QPXA 3SDXA 5AB3A 1TQCC 3TV8A 1I9RL 1CGTA 1SO6A 1A47A 4LY4A 1XR8B 3IVKB 2NY1B 3UG3A 1ZHAA 3MUXA 1PG7L 3UPCA 3L4UA 1CFVH 2DQXA 5I74C 2I9LA 1NCHA 3J2PA 3LIZA 1AQMA 3LQAH 4YVXA 3IRCA 3DBXA 3QR2A 4OV5B 4BF9A 4G8FA 1K7EA 4F15B 1OAUL 1TDQA 5F96L 1VCVA 5KOVC 2DW6A 1MSPA 2Y8UA 1LLAA 3IU3A 1BF8A 4AT6A 4GA8A 4JQ3A 1J6PA 3SQSA 6XIMA 1V7ML 5B38A 1B30A 1X1OA 3CZ8A 1SZNA 5ITFB 3RM9A 5DFVC 4F48A 1VACB 4JHWH 2CZNA 1RY8A 2QDWA 4QF1B 2FHBA 4DH2A 2EADA 3QC6X 2MUCA 4JRXE 4MJID 5CSZA 5HANA 1B0RB 3AZUA 5JQIB 3S2AA 2DTML 4KESA 3ZMNA 4Q4OA 5T8GA 1MW1A 2BVOB 2DQTH 1UEYA 2BC4B 3V4LA 3KPMA 5JMRA 3M0IA 3GSWB 4P23D 1KT2B 2OQJA 1VCBC 4KY1H 4MA8L 5J9PB 3OHIA 5AVYB 5AG9A 1QW9A 4FAMA 1RVFH 2BP8A 1PY9A 3FUEA 5F89A 5TF0A 2HLFC 1W1A1 4QRRE 5DWUH 1SO4A 2B59A 1F4YL 2DQUH 5I03A 3GXNA 4NZRH 4FYSA 4G6ML 3ORJA 1AQ8A 1SLXA 5EFFA 1Y1UA 4V1DA 5IR1A 2LE9A 3PWVA 2QCGA 1NIBA 4WUKH 4A8LA 1HVXA 4DWSC 2QZRA 3JZEA 4XO4A 2CO6B 2ALRA 5BV7C 4UNLA 4HK0B 2BP3A 4HGXA 4MD0A 3IDNB 4PGCA 1G7QA 2CLZB 3NIGE 1J8VA 3QNXB 1ZPTA 4DJED 4W9HC 4CADA 4RDZA 2SODB 3EJZD 1JGLH 2CK0L 3QN3A 4L3FA 3EJPA 3HGRA 2O9OA 2G5WA 2X4TA 3RZCA 1K8DA 3EYVA 1OWWA 4RE0A 4O11A 3PPSA 1Z9MA 2WV8A 1LGVA 3HBPA 4A21A 2NY1C 2P5WD 3T2OA 7XIMA 2XQBH 1PY0A 3D3VB 2NCMA 1FA2A 4YDKL 3T42A 3WLKX 5CILH 4BWLA 1JGIA 1AD1A 1T20A 4MFHA 3CMOL 4GWEA 4FG2A 43CAB 2AK4A 4GW5A 4HIJA 1CI3M 1E3ZA 1YPZF 1G67A 4Q6IC 1OIFA 3IJYB 1F6AB 1S5NA 2EJAA 1JWUB 3FQTB 5IVOA 4J28A 5DK0A 5AW9B 1FVPA 5AOUA 2OWWA 4JGNA 4AD5A 1E8WA 3KS0J 4W8LA 1KBVA 3UJSA 1BRLA 2V5RA 4HETA 4HWEL 7PCYA 1ISXA 2Z6FA 6A3HA 3U4FA 2P80A 3IMRA 3P3RA 3BXNA 2R56H 2YMOA 1ZLWH 4NHVA 2WXRA 5CG7A 2J20A 3FO0L 3QPKA 5JQ6L 3CDYA 3V4PB 3O3AB 5JPNC 3LEVH 3GJFK 5D55A 1XCWA 4FXKB 4JFOA 4H6RA 4NWUH 3WIIL 4YWGL 4YSOA 2CUHA 2F6UA 5BW7C 2F8QA 2B2XL 3ZDWA 5HDRA 4XD5A 1VRSA 1HQ4A 1UD3A 2J7FA 1CYXA 2O26U 4K4KA 2VM4A 4ZFFA 4GRMA 2WXIA 3KYOA 1LK2B 4L8SB 3HS0A 2HKHL 3BQUC 3CQIA 1RZJL 4U3AA 4KTEH 3SN6N 1BA9A 3DHDA 2BJML 5KVFE 4XTDA 3WE1A 3USZA 3EYSH 4LARH 1J0JA 3C6LD 1KJ3H 5D1QE 4UOW1 3US0A 5FK9A 2FLIA 5SWZB 2ZE0A 1T1WA 3QUZA 2NY5C 1LO2L 4M62H 1ELSA 2F53A 3EX2A 2YPVA 1AUSL 2OGJA 4XPBH 3F4VA 1Z9NA 4IGMA 1CF1A 1NAMB 1T1XB 3QS2A 3CN2A 3GK0A 4GXMA 5I3KA 3WJWA 2DLFH 1RJYB 4CQBA 5M03A 3MLZL 5I18L 3CLWA 3QXAA 5JXAH 3RFZC 1CECA 2OT0A 2FBRA 1O1ZA 5DLCA 2CA3A 1XLEA 3F7JA 3KOFA 2B4CH 4EDWL 1QRNA 2VLJB 1SW7A 4L4MA 4K0OA 4ZEPA 3WFEH 1OGAD 4LCYB 3G6JA 3QQ9D 4Y5YC 3U6RB 4QTGA 1ECYA 4MGGA 2BY2A 1IARB 1TJIH 3ENEA 3K8LA 1K3UA 4P7LA 1I7TA 3V36A 1PCXA 1UPMB 1CFMA 5CSSA 4ZFOB 1IT7A 1FWWA 1A7RL 2IOIA 4FNSA 4HIBA 3N1AA 1G0CA 2C8NA 2QT6A 4D0DB 4X3ZA 5A2CA 4GX8A 1OAQH 1WFUA 4F33B 1IE7C 4I9WD 4ORGA 2VM3A 3MYPA 4NZUH 2CDGB 4JDVA 4PGDB 4Y4FC 4B9KC 2H9AA 4HLJA 4KAQH 4J39A 1RUQH 3L5AA 3KYKL 4NO0B 3P93A 3R1ZA 1CU4L