2WVVA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 157
structure length 438
sequence length 438
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvvA01
1E0XA 3VGHA 3SCSA 1XH2A 4Z2HA 3K4DA 2EPKX 2WMJA 4WKAA 3RMEA 3TONA 3PTQA 1R33A 2BY0A 4J28A 5D8ZA 1QBBA 4GI9A 5I2UA 3CMJA 2E9MA 3BUQA 3ECQA 4J27A 3M46A 3BVTA 2EJ1A 2WC7A 3WD2A 4WSKA 2JALA 3VDCA 3KLKA 4PSRA 1VBRA 1PS3A 3AZTA 1XSIA 4LXFA 3JUGA 2BNJA 1WO2A 1MQPA 2XVKA 1EOKA 3AHYA 4QDMA 4J3TA 2F7PA 3EDDA 3W4RA 3GXTA 3WUEA 4GQRA 2YL6A 1NM9A 1C92A 3CHDA 3FXYA 3UR7A 1V3IA 2XN1A 4MJ2A 1R8LA 3MMWA 4V27A 4D6GA 1E6ZA 4RL3A 4ACZA 4A4AA 5D9OA 1HWWA 3AROA 2EAEA 3EDKA 1K9DA 2E9LA 2VVNA 6CGTA 4UQAA 1K9EA 4AZGA 4BCEA 1X6LA 1J10A 2GJXA 2NW0A 4CU7A 4KWUA 4HOXA 3CUGA 3WDJA 1D7FA 4KGLA 1VEOA 5M5DA 4R5EA 3BAIA 3ARRA 5DMYA 5LA0A 3F5KA 1E1EA 2WLYA 4Z2KA 4CKQA 2J47A 2V3DA 4JL1A 1UKPA 1VFOA 2OWCA 3VD9A 5M17A 3EMQA 4R27A 1WPCA 3SUVA 4CN4A 3SCRA 1B30A 2QHAA 1UG6A 3VMPA 3RIKA 4JAWA 3ARXA 3RM4A 1VFFA 1UWSA 2VR5A 1EHNA 1TA3B 1KBKA 1XD1A 1JGIA 4DM1A 5C71A 2DSKA 4JCLA 1RP9A 1CZ1A 1C91A 1TFVA 3UEQA 2WMGA 1V6YA 1UWTA 4ZEPA 4JKMA 2WMFA 1QWUA 3WNNA 4OGZA 4PMZA 1XSJA 4AWEA 1W91A 1JZ3A 1MXDA 4UFLA 3DX4A 1QHOA 1SMDA 2CHNA 4AZ7A 1WP6A 4BZYA 4P8WA 3WQ5A 5ABEA 4PRWA 4H7VA 2J8GA 1ITCA 3WN6A 3IAPA 3LXAA 3QHMA 4ACYA 1E1FA 4AD1A 4LPCA 3RCNA 2BHZA 1JZ5A 1JZ2A 1CDGA 3VUPA 3KE0A 2OWWA 1B3ZA 1U33A 1GZJA 3CIVA 2PWGA 4LYRA 1PX3A 3AMGA 4HZ7A 1EXPA 4NZCA 1JNDA 3O2LA 3W29A 4GO9A 2VX5A 4XUYA 3OIHA 4AMWA 3WQ4A 2DSUA 3E1F1 3N17A 3BCDA 1B31A 1CECA 3D52A 2GSJA 3VTRA 4PMXA 2WCSA 4BQ3A 3N1AA 2X09A 4PMRA 3DDGA 2XWEA 3L4UA 1E40A 4P7RA 1IV8A 4UFKA 3WDRA 1V3LA 4L4OA 2VCCA 3EDEA 1JYNA 1H11A 3HG5A 4U5IA 4OOUA 3ARPA 3OA5A 3UESA 4M56A 1OGGA 1DWGM 5JBDA 3D51A 2EQDA 3F5JA 4W8LA 2YFOA 3KLLA 3N13A 4CD6A 3L2MA 3CUFA 1JI1A 3VILA 1G01A 4OKDA 1HXKA 5BXSA 1QWNA 1JDAA 3DHPA 3AXXA 1BGGA 1R7OA 2YDQA 2YJQA 3NCOA 3L2LA 4CD7A 3A21A 5JIPA 1RH9A 1JF6A 2WCAA 3A5VA 2EPOA 1OT1A 1E6XM 1WZAA 3FHAA 4GZEA 3OG2A 1HKMA 4WF7A 3UR8A 4X9YA 1Q6FA 3W27A 3H55A 4J3VA 1BPLB 1T0OA 1BVNP 4PCSA 3DX2A 4W5UA 3B8SA 3ARSA 4TVCA 1G94A 3PBGA 7TAAA 1QOXA 2EPMX 2NT1A 4EK7A 4FLRA 3VIOA 1ODZA 4U5KA 3VD4A 2J7GA 1K6AA 1AQMA 2ZX8A 3AIRA 3AIWA 2IXUA 4HZ8A 4PEEA 5E1QA 1UD8A 3ZR5A 1CXLA 2JE8A 3T0BA 1CXHA 3CZEA 5ABFB 4HMEA 5FCZA 3VDAA 4F8XA 2Y5EA 4MAZA 5A3HA 1XC6A 3VGDA 4ACZB 3PZTA 2J7EA 2PBGA 4FK9A 2Y8KA 4Z2JA 2ZXAA 2XIBA 4DO5A 1HKKA 3B9AA 3II1A 2VQTA 1W3HA 2A3HA 3D4YA 4TVDA 1K9TA 1E3XA 1KB3A 2O9TA 2WW5A 3DX3A 3PZIA 1Y7VA 4W87A 4P8UA 2V3FA 4ATWA 3AS3A 2X2HA 1KR0A 3UCQA 2YA1A 1KXTA 3TTSA 3WH5A 4H2CA 2DH2A 2OYKA 1KXVA 3EJRA 2GDUA 3WNKA 2OYMA 1G0CA 3WBEA 3VIFA 2ZWYA 1GPFA 3MU7A 4X0VA 1H09A 3AHTA 1HT6A 1LJYA 4ZE5A 4B16A 3CHCA 4ZE4A 3BUBA 1V6WA 4CD8A 3QOMA 2YLLA 2XJ7A 1XYFA 1MXGA 4CGTA 3EJUA 2J79A 1K9FA 3KL3A 3SCQA 3MANA 3LRLA 5KEZA 2VURA 4A3HA 5CGTA 2J7BA 1NOUA 1RPKA 4QLKA 4FLQA 1H49A 1G1YA 4AC1X 3UG3A 1W1PA 3VIJA 2OLHA 2VCBA 4HA1A 4PN2A 4C7GA 1GQJA 3AI0A 1FP8A 1MVYA 3GXNA 3AS2A 2DIJA 3EJTA 1XCXA 1ZU8A 2CYGA 1VEPA 2J77A 3ARZA 3SCTA 1QI3A 1JYXA 5JIWA 1C8XA 2F7QA 4NSBA 2IUZA 3NSXA 1XRVA 4M29A 3QHOA 3T0DA 2EPLX 2YFNA 3ALFA 5A6AA 1E3ZA 4AEFA 5GNYA 4Z2LA 1V6XA 2X2YA 2DGAA 3VX0A 4PMVA 4H8HA 2FH6A 3T2QA 4YHEA 1LF1A 4PMYA 2WAGA 3EJQA 4P8XA 1Z32X 5IHRA 1ISXA 1EDGA 2Y8VA 1E6QM 4HZ6A 5HPOA 5BROA 1QNOA 3VU2A 2WXDM 5E0CA 4TTGA 1UD2A 2VL4A 2PWDA 3BSHA 3PTMA 4AYSA 3TA9A 4UTFA 1JXJA 2DSZA 4RE3A 2W92A 4BF7A 2DQXA 1PJ9A 4EKJA 1UD6A 1QI0A 1JAKA 2W5FA 2X8RA 3OGRA 3OGSA 4PTWA 3HN3A 2DIEA 3I3BA 3WD3A 5D8WA 1BGAA 2XTKA 1UR0A 3VGFA 2WVSA 3AXIA 2BXZA 5DFAA 1DWJM 3OLDA 3AHXA 2JIWA 5FL0A 1TCMA 3WEZA 3GH7A 3CZJA 3GXPA 2V5CA 2WBGA 4FNSA 1JNEA 3K46A 3A23A 3WNLA 2WK2A 1EH9A 1Q6GA 3BVVA 3F4VA 3LRMA 1KCKA 3RM8A 1VJSA 3T2PA 2F7OA 1BVZA 4NRSA 3PZGA 5I78A 4GQQA 5EMYA 4PUDA 2YLAA 1QPKA 1AQHA 4AIEA 4B9YA 2XFRA 1MW0A 4W84A 4DUVA 1UKSA 5DO8A 2UWFA 4DWSD 1BHGA 4FMVA 3THCA 3KL0A 2PI6A 3RM9A 1GQLA 1KGXA 1VJZA 3GBDA 1MW3A 1CEOA 2OW6A 1EDQA 1H5VA 4HU8A 1JDCA 2GK1B 1H0IA 2JFEX 5D9NA 4U2ZA 5AYIA 2G41A 4UFIA 4FLSA 1CGUA 4Z2GA 1UA7A 4UZUA 1UD3A 5IXEA 3WY2A 1GOMA 1A47A 4Q22A 1NARA 5HOSA 1CLXA 4YHGA 1C8YA 3DDFA 3ZOAA 4OJYA 4AISA 1BQCA 2BVDA 3DC0A 2BV9A 1ZJBA 1QI2A 3ARQA 3BVUA 3WUBA 3AFBA 2PBOA 2W67A 3TTYA 1J0HA 2YL9A 3D3AA 5CPQA 5BRQA 1J01A 1NOFA 1FH9A 1V6VA 1V6UA 2GK1A 1UWIA 1DWIM 1O6IA 2GFTA 3NSMA 1HIZA 4U33A 1GQIA 2GVYA 2YIHA 4XB3A 2XWDA 3ZT7A 3D50A 1I1WA 2ZUSA 3EJSA 4QCFA 1IT0A 3VD7A 4D1IA 3CV5A 4OZOA 3WMBA 1GUVA 3N9KA 4AD4A 3NDYA 4BQ2A 5E6ZA 5D4YA 3AISA 2WC4A 1J0ZA 2DPEA 3RJYA 1G9HA 4XZBA 4LX4A 4MNLA 4ATDA 3ZSSA 2OSWA 4PYSA 3CMGA 4U2YA 5ABFA 1E56A 2F61A 1B3XA 3BXWA 4W86A 2E0PA 1UQYA 1PIGA 1E73M 3EMZA 2WKLA 5EB8A 4WSJA 3EBVA 1TZ7A 1Q4NX 4W8BA 1CXIA 2DSWA 2F1AA 2Y2WA 3WD4A 5M03A 1E72M 3A4WA 5BXRA 1QHPA 2VO5A 1OWQA 4K68A 2WZEA 3WNOA 2E9BA 3BSGA 1GW1A 2XSAA 3OZPA 3QGVA 5ECUA 4IUGA 1C93A 4DUXA 3AYSA 1V02A 4JFSA 2XVNA 4FLOA 2ZE0A 2D23A 4D6CA 4Q7NA 3WL1A 2GDVA 5BWFA 4ZXOA 4KRTA 4UFMA 2CIPA 4OIFA 4TX8A 1IZKA 2D2OA 2W61A 2EBNA 5ABGA 2CKSA 3RDKA 3AIBA 1UZ4A 1QVBA 1UUQA 2C7FA 1WB0A 2X1IA 2JF6A 1ZBKA 2WYSA 1DWAM 3L4ZA 1QHZA 5AC5A 1VF8A 3DHUA 3AIUA 2BY2A 1E4MM 2UY5A 5FKYA 1EDTA 1GCYA 3GNPA 3G6MA 1M01A 1DP0A 5FL1A 1BG9A 1XHGA 2X2JA 1DWHM 3S5ZA 1NP2A 3WQ8A 4QFUA 4AD2A 1OD8A 4TX6A 1MFUA 3GXMA 1WCGA 3VSVA 2W62A 4TXEA 3RJXA 4DO6A 1XGZA 3VGEA 3AICA 3AIEA 4NRRA 3LX9A 3M07A 3WSUA 2XM1A 4PTXA 3W0KA 2PC8A 1E6PA 4LYQA 3IGUA 2VTFA 2VT0A 1ESWA 3TP4A 1ZL1A 5DEZA 1VIWA 1ODUA 1J0KA 3K8KA 3UERA 3EYPA 4M24A 3W82A 3WFLA 2CESA 3WNPA 1CLVA 4OOZA 4B9ZA 5KZ6A 3HJEA 3DYOA 1J9YA 3A22A 3HU7A 4MADA 1ZJAA 3WQWA 2O92A 1UASA 3WH6A 2QPUA 2J74A 2VOTA 3GH5A 5A2BA 1UKOA 1WDRA 3ARUA 1CGVA 3LPPA 2VR4A 4YN5A 1CGYA 3L4XA 3WKZA 1TR1A 2UY3A 2GJRA 1KFWA 1PAMA 5CGMA 1O7AA 1ITXA 3MO4A 4WLCA 3CH9A 3L4WA 5CPSA 3CC1A 4RE4A 4W7VA 4JHZA 4M1RA 2GUYA 2CKRA 4AZBA 3ZJKA 4UNIA 3U5UA 3ZT5A 1J18A 4NF7A 4ATLA 3VSUA 8CGTA 3U7BA 2UY4A 3UG5A 4DUWA 2VUYA 1UHVA 1BFNA 1WNOA 4B3LA 3W53A 1O7DC 4M82A 2WMHA 1PEZA 2XUCA 1XSKA 1HVXA 3FNDA 1LWJA 2F1BA 4BQ4A 2E8YA 3EDFA 2OSXA 1FOBA 2XVPA 1HVQA 1S46A 4HA3A 4HA4A 3BUDA 1F4HA 4AMXA 3VO0A 2Y4SA 2CITA 2WMIA 3ZJ7A 1A3HA 2QMJA 3BUPA 4URIA 5AY7A 3DX1A 4A3YA 1J0IA 2Z1KA 3ZMRA 2JIEA 1UZ1A 2WVVB 1HP5A 1ZBVA 3VDBA 3WDHA 3WQ6A 2BS9A 4PMQA 3BLBA 3K8LA 1E6SM 4QP0A 2GJXB 3A4XA 4B15A 4D1JA 3MUIA 2WHLA 5FD0A 2XN2A 4QLJA 1U2YA 5TD4A 2WHKA 3LXBA 3VMNA 4GZJA 1Q6EA 3QR3A 3CLWA 3DYPA 1LL7A 1WZKA 3WDQA 3L4TA 3FHQA 4S3JA 1BYAA 3CZ8A 3SUUA 3CZGA 1B3VA 2A3BA 4U3CA 4EAMA 1C7SA 3FY1A 4W93A 2XM2A 4CD5A 2OW7A 4PUEA 1B1YA 3N12A 3HG2A 1KCLA 3G6LA 3AMDA 1BF2A 2G3NA 2CERA 5LYRA 3VGBA 5IDIA 5HDRA 3WY3A 2VZUA 3VNYA 5A6KA 1CNVA 3GTNA 3VIPA 3AIVA 2F7RA 1VB9A 5CLWA 3PZUA 1HL9A 3NIYA 4WIWA 2CXGA 1UWQA 4H8VA 1B3WA 2XIIA 1E6RA 4JKKA 3NYDA 5IFPA 4HMCA 1HXJA 2WLZA 3NJ3A 1CGTA 1GOIA 4UCFA 2IGTA 1E43A 2QPSA 3DECA 1HJWA 4FNQA 3GXFA 2EO7A 4UFHA 1EIBA 3FAWA 4WKHA 3VD5A 2FE0A 1BYDA 4KH2A 4GXPA 2C0HA 7CGTA 3CGTA 4TTUA 2WZHA 4IPLA 1GOOA 1PIFA 1TQVA 2XN0A 2OYLA 3ZR6A 3IJ7A 2YDSA 2CBUA 1UQZA 1ZS2A 4PMNA 4B3KA 2X2IA 5A6BD 1E4LA 3VIIA 2EABA 1ISYA 2VRJA 3WMSA 2ALWA 2DT3A 3N15A 2Q8XA 2F2HA 1JD9A 1LG2A 1W9XA 1XCWA 3MS8A 2EACA 1SR0A 2WZIA 4PMDA 3KEHA 1P6WA 3W37A 2XGBA 4UOQA 1AQ0A 1SZNA 3UETA 3CUHA 2OSYA 3H54A 1HNYA 2W91A 5IFTA 1MYRA 1M03A 3RILA 1DHKA 1GJWA 2RGMA 5A8NA 1KQZA 1UA3A 1ZB5A 4CCCA 1BSIA 4M80A 3BH4A 1UR2A 3SURA 1HKIA 4E8CA 4F79A 2V38A 3I3DA 2JF7A 3AZRA 4DWSB 3RPMA 2YOCA 2CBJA 4AZHA 4ZENA 5JBEA 3OLGA 3B9EA 2ZUTA 2J78A 4AYGA 2HISA 3W6MA 2DH3A 3WD0A 2CETA 1TA3A 2YA0A 1W9DM 1LL4A 2V3GA 4NXSA 3SUSA 5CSUA 1M53A 3BAYA 4P7NA 1HJSA 4D6IA 3VIMA 5CXPA 3CTTA 1W1VA 5GQBA 9CGTA 3B9DA 3L4YA 3W81A 4D6DA 5BXTA 5A2AA 1V08A 4LQ1A 4FNRA 2WKGA 1FFRA 2JEPA 5JUVA 2W4XA 2X0YA 4CUCA 4UQBA 2DEPA 4H04A 2B31A 2FYVA 1MFVA 4NXKA 1UR9A 2WC3A 3IJ9A 1ZBWA 2BVTA 1UH2A 3KZSA 1CXEA 1H0GA 3LPOA 4AIUA 4WJXA 1F4AA 3FW6A 1H3GA 2D3LA 2PF0A 3PZVA 1XH1A 4CN1A 4FNUA 3MI6A 3FN9A 4WKFA 4J3UA 2BHUA 1JD7A 2FDMA 5JBFA 2D20A 3M6DA 3LRKA 1VFMA 1OBAA 3VDHA 4TVUA 4MTVA 1GHRA 3SCWA 3I3EA 2VZVA 1GVYA 4U3AA 2DT0A 8A3HA 5FIPA 5A6BA 4NZFA 1JZ7A 2AOSA 2A3AA 4D72A 1GOQA 2WVTA 1JFHA 1JI2A 3LXCA 2VI0A 3AYRA 3WELA 2E8ZA 5BCAA 1KWKA 5LA1A 2XVGA 2YBTA 4LYPA 3PZOA 3CZKA 1W1TA 2WMIB 3DYMA 4MNJA 5A6MA 3IK2A 5A8OA 2PWEA 1WE5A 1OGBA 1RP8A 1QX1A 2VRKA 5FOOA 1TQSA 1VAHA 3ZSTA 2A3CA 1KTBA 4D6HA 3PZQA 2ZIDA 4JFUA 4D6FA 5C8BB 1WAWA 3WNMA 4FNTA 5CZKA 3CUJA 2VMFA 3VIKA 4E8DA 1NH6A 5A6JA 1CXFA 1QI4A 3O6AA 5E70A 1TVPA 4MDPA 2CHOA 3GH4A 3MUZ1 2YDRA 3DX0A 1PBGA 4KRUA 1JYWA 2YA2A 3T09A 4TOQA 4KMQA 3MSDA 3WL0A 2ZICA 5E6YA 1B0IA 1EO7A 3POHA 1KXHA 4Y7EA 2J7DA 3SEPA 2Y24A 1JZ6A 3S5YA 3F5LA 1OSEA 2WB5A 4HMDA 1BG4A 3THDA 3ARYA 2VX4A 3AIQA 3AMKA 3SIMA 1JDDA 3MV01 2BY1A 4JZ5A 1NWRA 2WPGA 5A2CA 1SFSA 4AD3A 5GPRA 5I79A 1I1XA 1EQCA 1NQ6A 3CZSA 5A94A 4J3SA 2FGZA 4AZIA 1YHTA 2VC9A 5BYWA 3GXDA 1US3A 2ZUMA 4W5ZA 2XFFA 2VX7A 1R75A 1EHAA 1SYTA 3CHEA 2CCRA 3NUKA 4EANA 2O9RA 2J7CA 1V3MA 2JEQA 3ARTA 2XVLA 3VOCA 1IZJA 2XG9A 1VBUA 2V3EA 2D3NA 3AS1A 4IM4A 2XGIA 3ALGA 2WSPA 5C70A 1VEMA 3ZM8A 1HJQA 4CU8A 3VVGA 2O9OA 1X1NA 1CGWA 1CIUA 6TAAA 5EBAA 4UQCA 1J12A 1L0PA 4J3WA 2FH8A 3POCA 2FGLA 4OBRA 1E71M 3GBEA 3WFZA 3D4ZA 2VZTA 1N82A 1QI5A 1B3YA 5CLTA 3CZLA 5A69A 3IAQA 2YBUA 5E9AA 1EQPA 3LPFA 3AXHA 2TAAA 2VCAA 2BXYA 4F66A 3VM5A 1W3KA 3WY4A 3BGAA 2CBVA 4HU0A 4FNPA 3N18A 1E70M 2D22A 1RD6A 2DT2A 4P7OA 1XYZA 1UKTA 3BAWA 1V3HA 4CN6A 1FH8A 3BVXA 5IHSA 4DO4A 4V28A 5EFDA 2FHFA 1DTUA 3BLPX 1FP9A 3A3HA 3WH8A 3WF0A 1ZBCA 1KWGA 3SCUA 2QV4A 4H41A 3BAXA 3BMVA 1HX0A 3CPUA 3MUY1 2X0HA 1XH0A 2D1ZA 1TQTA 1LWHA 1QNRA 5HPCA 1LLOA 1UYQA 5D9PA 5A8MA 1J0JA 2YKKA 1UD5A 3OLEA 2CBIA 3OLIA 3U5YA 1UH4A 1UOKA 4AZCB 3EMCA 1UWRA 4FF5A 2J75A 4NZJA 3U57A 3BAJA 3OZOA 2YL5A 1QW9A 3S2CA 2Z1SA 1QNQA 3VINA 2E40A 4GI6A 3SCPA 3W38A 3BCFA 4J3XA 2OWXA 1E15A 1W9PA 2VVSA 2XSBA 5EFFA 3WF3A 4P7LA 1R87A 4NX0A 5M3WA 5HXMA 4HOWA 1KGUA 2AAAA 4PCTA 3MKKA 1W3JA 2D73A 1E4IA 2VZSA 3WQVA 3MMUA 4JCMA 5GNXA 2XHYA 5HBFA 4IISA 1AMYA 1FHDA 5A8QA 3AMCA 1L8NA 3CHFA 4AZ5A 2ESCA 4CD4A 2G8ZA 1EGZA 1XD0A 4GPNA 2ZXBA 1NWTA 1H41A 3T08A 4PMUA 3AQUA 2J7FA 1UD4A 4GZIA 4AW7A 2G3MA 4MB5A 3GDBA 4M81A 5CQ1A 1C7TA 1V0LA 4MNMA 4PMOA 2V5DA 4QCEA 4PSPA 1JZ4A 2XYLA 2ZX7A 2F8QA 4H8UA 1E55A 1PX8A 2O9PA 2VZOA 1EO5A 3WY1A 3HG3A 3D5HA 4HOZA 1LL6A 4AZCA 3SUWA 2J7HA 1TMQA 3WH7A 3WBAA 3VNZA 3TV8A 4UQDA 1FFQA 2BY3A 3FAXA 4D6EA 3T0AA 1UR8A 4F9DA 3ZQ9A 4BA0A 1B9ZA 1Q6CA 1OIMA 1HP4A 4MNKA 4U31A 3ZJ6A 1LG1A 5AYBA 2ZX9A 3AJ7A 2WSKA 3OBAA 3MUAA 4J7RA 1BYBA 4UOZA 1OB0A 1CBGA 2W63A 3PZNA 3L4VA 4RE2A 1CWYA 4GINA 5A8PA 1E0VA 2VJXA 2EXOA 1NWSA 2ZUVA 1E0WA 3BAKA 1UH3A 1QNPA 4AEEA 4W89A 5I24A 3O9NA 5DF0A 1OT2A 4CVWA 4BQ5A 3OB8A 2WANA 1J11A 3GM8A 3PZ9A 2WMKA 1B90A 1TQWA 1JZ8A 3W25A 1DWFM 3PHAA 2C8NA 1W2PA 1GHSA 3WMCA 3APGA 5BXPA 1GQKA 3NSNA 1PZ3A 2WWDA 3GXIA 3AHZA 4S3KA 1CXKA 4OUEA 4N42A 1HTYA 1TQUA 4UQEA 1GJUA 3W28A 3WEOA 3LPGA 1W32A 2VNCA 2X05A 1GVIA 4XZWA 2G4FA 1GOWA 1PZ2A 1U30A 2CPUA 2D0FA 5A95A 2DT1A 3BVWA 1UKQA 4E4PA 1DEDA 3WEMA 3QOKA 2J4GA 4AY1A 2EADA 2F18A 1VRXA 3BMWA 2MANA 3CO4A 1FA2A 4DWSC 4UQ9A 3IANA 3WF2A 2WBKA 1Q6DA 1UR1A 5E0FA 2VX6A 4QLLA 4IPNB 4CU6A 4JKLA 5I0DA 4CCDA 2EEXA 1E5NA 1E9LA 2BFGA 1E5JA 4N0RA 4P8VA 1NWUA 2WWCA 3TTOA 3AS0A 3MV11 2ZOXA 3RO8A 4AD0A 3TTQA 1V3JA 3SUTA 1OGSA 1GNXA 4HPGA 1KGWA 3WENA 3AOFA 3KWXA 1YQ2A 4YPJA 1OCQA 4W7UA 3W6LA 3WH9A 1BAGA 3VSTA 4ML4A 3WDIA 3WD1A 1HJXA 4GIAA 3ZIZA 2PB1A 2GJPA 3OGVA 3U7VA 1CTNA 3K4AA 3UG4A 1OD0A 1TE1A 4OBSA 2RGLA 1KBBA 3LMYA 3SCOA 2BHYA 3VIGA 2FHBA 3VGGA 3N11A 1WDPA 2PWFA 1R34A 4V2XA 1C90A 3PTKA 2DSVA 5AC4A 3ZJ8A 5DT7A 1HJVA 1ISVA 3GZAA 4C7FA 3IJ8A 3NDZA 2QF8A 4HTYA 1MW2A 5BRPA 4XV0A 4XX6A 4AMCA 3A4AA 4CVUA 1MQQA 1B2YA 4MB1A 2ZX5A 1W3LA 3WF4A 2G3IA 4C7DA 1WZMA 1GORA 5I6SA 5I5RA 1MWOA 3KL5A 3WF1A 2ZXQA 2J62A 4JFWA 4HPHA 4PTMA 3ARWA 6A3HA 3K8MA 1ECEA 2HVMA 5I77A 4AZ6A 1CPUA 1TUXA 4F9JA 1OIFA 1GOKA 2WM0A 2E3ZA 1H4PA 4MB3A 2WHMA 3W24A 1QBAA 3AMLA 1VENA 2CEQA 4QAWA 3VM7A 3A24A 1EA9C 5DT5A 4JFVA 5CG0A 4KGJA 1SMAA 1JFXA 2ZWZA 1C8QA 3VPLA 2QLYA 2WCGA 2E4TA 3PN8A 3MMDA 2ZUWA 1R46A 2EPNA 7A3HA 3VMOA 4UFJA 1M04A 4W7WA 5A6SA 4ZXLA 1W9VA 3WDPP 1E6NA 2ZUUA 3QHNA 1ISWA 4D6JA 1JF5A 3J7HA 4ZFMA 4JFTA 3HG4A 3EJPA 1D3CA 4M8UA 1ISZA 1FHLA 1KR1A 4AIOA 1EOMA 1NP0A 2DDXA 3VIHA 4UR9A 5E09A 1TG7A 4Z2IA 3GNOA 2ZX6A 4UOJA 1HF6A 3CZNA 1V02E 3ARVA 3VKKA 1HL8A 3CBWA 2NT0A 5CJ5A 4JIEA 1R7AA 1W2VA 3SCNA 4AXNA 1BTCA 4JL2A 1H1NA 4MDOA 5ABHA 1JYVA 1VFUA 1AVAA 3BUIA 1JAEA 2ZXDA 4PBGA 3BC9A 3TOPA 1R86A 2D0GA 2D0HA 1WZLA 1V3KA 1US2A 4MJ4A 4AD5A 3WIJA 3GNRA 3BLKA 1OM0A 2WVVA 1UR4A 2AMGA 3GYCA 4X0NA 4MB4A 2D24A 1W1YA 1JXKA 4MAVA 3WUGA 4DWSA 3PZMA 1D2KA 1BYCA 1W9BM 2BVYA 1R47A 1QNSA 1HN1A 1OINA 3EDJA 1H2JA 1NOWA 5A6LA 5HNNA 3WUFA 5CSYA 1V03A 1C3FA 1X6NA 1QW8A 3ZO9A 1V0KA 4NI3A 4TUFA 2VRQA 3K1DA 2ZUNA 2PWHA 1TVNA 5LA2A 1I75A 1WDQA 2NSXA 1HJUA 3T2OA 4W8AA 3M7SA 2YL8A 3HZ3A 5CPTA 1XV8A 4W88A 4CCEA 5GNZA 1PX4A 1FH7A 4HP5A 2FHCA 3N04A 3H53A 4BS0A 1JIBA 1MW1A 1E4NA 1GONA 1BLIA 4P7QA 3SCVA 5A1AA 1V0NA 4GO8A 5F7UA 5D9MA 1R85A 2J8FA 1KQYA 1PPIA 1CGXA 2A3EA 1WKYA 2G3JA 1WDSA 2VQUA 1KXQA 1KTCA 4D71A 1LQ0A 1UWUA 4WK9A 2WNWA 1M7XA 4W85A 1J0YA 3A6OA 1CENA 3AZSA 1W9UA 3CUIA 3HMCA 3A47A 2QMKA 2W66A 4JHOA 3W26A 4MPKA 3MSGA 1JL8A 4PTVA 2UY2A 2XFYA 1G5AA 3S6TA 4EE9A 1V0MA 4GKLA 1JG9A 2J25A 3ZT6A 4UZSA 2CNCA 5I3DA 4DM2A 5I23A 1HKJA 3VX1A 2IXVA 3AHVA 1CYGA 4L4PA 4GI8A 4E2OA 2WHJA 1MQRA 3VD3A 4LGXA 2XPKA 2WVUA
chains in the Genus database with same CATH superfamily
4P9HC 3ZHFA 2QTVA 2G75B 1XH2A 4ZR8A 3K4DA 3SCSA 4GBUA 5SWZE 3FB8A 4WKAA 2PMZA 2WSDA 3WIHH 2DV0A 2RDXA 1QBML 3O3BB 3TONA 1A53A 4X6FA 2H9GB 3LEPA 4OZFB 4PV9B 4PMFA 1QMUA 4NQCE 4GISA 1Y6MR 1Z42A 3RNDA 4YHYC 1QBBA 3GMNA 4GI9A 4KC3B 1JGDB 4DAGL 4ELME 4Q6XA 1KB9K 2NYZA 3C12A 3UTTB 5CFHA 2E9MA 4UMAA 2AL2A 1ZLVK 3M46A 1I8MB 4EI0A 3LCWA 4YVPA 4HF5L 2ACQA 3QULB 2EJ1A 4L23A 5EFIB 5DGQA 3ZDXF 1W8OA 3WD2A 4WSKA 5GSVB 3VDCA 2JALA 3F83A 3ABMB 2CWNA 4JG9A 4ONFH 3MNDA 5KS9F 5KUMA 4GKSB 4QRRA 5C09E 1VBRA 3CWOX 2AEQL 4G7EB 5L8JB 4Y5YA 3AZTA 1M56B 2DQ6A 4I0PB 5FYJL 4XCEB 1REQB 3DENA 1FZMB 3K2KA 4OAWB 4K9EH 1QKZH 4LGPB 2XVKA 1SQMA 4ZTYA 1Y18A 3VOFA 1B3JA 1BAWA 2PDMA 3LDBB 2FTPA 5LGKA 2MRYA 3LNFA 3PJWA 2HFGL 5DK3A 1TTJA 3UA3A 1JOIA 3NEHA 4PGEA 1GZ1A 4YVXA 1U8IB 1FAIL 3MU3A 5I16B 4YFEA 4K7PX 4GQRA 1OZQA 3KM1A 1I8LA 2IAAC 1M71A 1NAMA 1X3DA 3HR6A 3LNPA 1FORH 4BSWB 5AW3B 4YEFA 1P4LA 1V3IA 5E8NA 2BZ7A 5XIAA 3W7QA 4JFFA 1OABA 4WW2B 1QWHA 3MMWA 4QSHA 2WZPA 4IPPA 5IQ9B 4V27A 1SJDA 4U6VL 3W7JA 4D6GA 1Q9KB 3N41F 4R9XA 1Z41A 5I3KA 4ACZA 3VW3H 2B1HH 2XN9E 5AVTB 4X99A 3ONBA 1E2VA 1WGVA 2LFGA 4PP2B 5FACA 3W1UA 3IACA 3TBTA 5T9CE 1U3HA 3B6SA 1CLOH 3ISWA 4XHJC 4ZUUB 3X11B 3LU2A 3AROA 2EAEA 1SDYA 2DM3A 1AQKH 1H3PH 2IAMD 4C56E 2X6AA 5DD3H 2EF9A 4K5PA 4UQAA 3ZRFC 3KPRD 1WAEA 1G4EA 4G83A 1T8XA 1XX1A 2HKHL 3MO1A 4NQDA 1GGBH 4KWUA 4JDEA 4WDWA 1PLGH 2R1LA 1V27A 2NUXA 4HHHA 4E3VA 1FNGB 1YXDA 6ALDA 5M5DA 3GHEH 1U9KA 3QZBA 4NSKA 4B9PA 2JKRM 3BEVB 2JIXA 4NZUH 4R7XA 2KZHA 2RJHA 4WV1A 3DKHA 3OF6A 4QHKJ 1BEYH 2EKJA 1I8MA 5FWRA 4A38A 2VW4A 1H7OA 5AW6B 1U8LA 3PCYA 4Z3IA 4CKQA 1RZKL 2V3DA 2VKWA 1OJXA 2J47A 4Z7QE 5DQDH 2EDFA 2CO2A 4JL1A 2HLAB 1DXIA 3HI6H 5J1SC 5GSRA 4B9JA 1UKPA 4JIHA 3TW7A 4PS7A 3VD9A 4Z0JA 4AIBA 4RV3A 1NBZB 1BWKA 3E6HA 3DOIA 5J56B 4EDXB 5JMOC 1WUZA 3N06B 4LU5L 1T22A 2QDWA 3IIVA 1Z2KA 5DC2A 2Y07L 1CE6B 3ARDA 3VXPB 2AK1L 4LEOB 5GJMA 2UXFA 3LERA 3LRSB 3WJSA 4Y5VC 1LEGA 4NO0A 1A9BB 1K4CB 3BWUC 3WXVH 3RIKA 2HKFH 2A4AA 4JAWA 5ITBL 4Z5RA 3UD6A 1TXKA 5E2VL 1VFFA 2H6RA 4RA0C 2Z4QB 1B6DA 2J6EA 1JGIA 3LZRA 3MRPB 1X98A 2V6AA 3V0GA 4J1UA 1WYIA 5KBMA 4I9JA 2EECA 1QTYT 2A77L 4PBFA 4DM1A 2AGJH 3P73B 3FB5B 3ZE2B 1L0QA 3MRIA 3PGCB 1CZ1A 1TFVA 1D5ZA 4HFUH 3SCMA 4DK5A 3P69A 3HE7C 3CFBB 3GRBA 4JKMA 5C55A 1SXZA 3HG1E 4HJJL 3QFJE 5GS0D 1SVCP 4TUJB 2EAWA 3HFYA 4CNSA 1J8VA 2IPKA 3G6JF 1JCVA 5EZJB 2J3SA 3C6LC 3F58L 1FWDC 2NVAA 5LAXA 3LYEA 3ZKMD 1RUQL 1TRIA 3DX4A 1BEYL 1QMLA 1QHOA 1MUWA 3IGAB 3HUJE 1CI5A 1RXOB 2QUNA 1SMDA 4RW3A 2X12A 3EYFA 3P3BA 4P8WA 1BQHA 1HKWA 5I82A 3VXUA 3CAQA 4PRWA 2ADAA 4H7VA 2NZLA 2BSEA 1AFSA 1YY9D 4F7PB 2GQHA 1A6UL 1ITCA 5HJXA 1XH3A 3WN6A 2R1MA 3NR0A 2QJGA 4PFHA 3FO2A 3GSUB 2O6DA 4ZCWA 3TVMD 2YAEA 5DLCA 4RGMC 4PJCF 3VA8A 4JG1H 5DQJB 3ZHNA 4H88H 3DC8A 3RCNA 3RPBA 1H6TA 3TLQA 4CEUC 1OF2B 1ADSA 2XNAB 4PJGE 3VXSA 5DJYB 4JRWA 1JZ2A 1YEFL 4PV8B 4JFEB 1Q4WA 2Q09A 1H3WM 1AZNA 1QFOA 4K9EC 5LHDA 3K6SA 1DHPA 2H2PD 2Q9OA 4ORIA 4ZBCA 4U1KB 4WTZG 5ENWB 2OULB 4PG9A 5F7DB 2OWWA 1FDJA 1MHHA 4R6UA 3DVIA 1GZJA 4L29B 5DI8B 1XRTA 3FYEB 2IG2L 3VWKA 3HE6B 4F7EB 2L7UA 3QJSB 3S34L 4GJTB 3K2IA 5FSDC 4HZ7A 4KTYA 1JNNL 1NELA 3FA5A 4ICWA 3MNWA 1KTKE 1AKJD 2WBJC 3CVIL 4C6IA 3EO9L 7ENLA 1QFUH 2C9XA 1B5TA 4ERGA 3MBWA 4X4KA 1DSYA 2ZG2A 5DJZA 3G1RA 2YD2A 4XUYA 1AIFB 2AJUL 2D7PA 4EJ1C 2JJWA 2OL3L 1UROA 5FYJH 1TPUA 5C2GA 2UXTA 3IB4A 5MHBA 3MOQA 4TUKL 3SQMA 3N9RA 1NFDF 3P62A 1ID5I 3GNXA 5M94B 1EXHA 1EPVA 4Y5VA 3ARGC 1C08B 3N17A 3BCDA 1B31A 3UYCA 3D52A 3VTRA 4X6CA 1HEZA 4ZMLA 3KPMA 1H7XA 2VSDA 5IKCA 3TIEB 3N1AA 4PMRA 2YAQA 2XWEA 3DDGA 3L4UA 4IIHA 2Z31C 4ORGB 4Q4PA 3VE0A 2VR2A 1OTUD 5DQDL 2Q7YB 1V51A 1KM6A 4XMUA 3CT2A 1SVBA 4JRLA 4K8RL 4WEVX 4DZ8A 4KHXL 4C83B 1JYNA 4JPKL 2VCCA 1YNTF 1GS6X 3L1EA 1H11A 2QR0A 2EIMB 1WX0A 3V95A 1ZA6A 1H1ZA 1EUTA 3K6IA 4E3TA 5T5NF 3KPSA 1BFTA 4OOUA 1U8NB 2P7TB 3MJ9H 4MKMA 4OCYL 3SQBB 4PB9L 1HYSC 4YXKH 5HYSG 3GSRB 5I18H 2Z27A 1JGDA 1IQDB 3TA4D 3GS0A 1NU5A 3C2AH 4G8GB 4NZ5A 5L7XH 1HCVA 2NXHA 5KVFE 1GGYA 3WIHL 5HDQL 3D51A 3UOAB 2EQDA 1QPOA 4KBXA 2VDPH 1EWEA 1G6RB 2JQXA 2ZF9A 5HHOD 3RPIA 1IFGA 4JN2B 2W0FB 3DUUA 4KZDL 4EUPG 4LEEA 2OPJA 3THAA 1QWGA 3GMQB 3MA9L 4YHMH 5EN2A 5RUBA 4HJGA 3B8DA 3VXNA 1KNWA 3OKNA 4AAJA 3L2MA 3EOAA 2OR7A 1L5GA 1JI1A 3KDPB 1UXMA 2CHWA 3Q6GH 4KNQA 3VILA 4RGOL 2DWXA 3BZFB 3DKLA 1NAL1 3GMMA 4IOIA 4LUJA 4HS3A 1TWZA 4DJFA 4QJ1A 4HJ0C 1BGGA 3EEGA 2YDQA 3BKJL 3L2LA 3K0WA 3R0NA 3O6YX 3DGDA 4FQCH 3OOQA 2Z7YA 5JIPA 2ZKHL 1PDKA 3FHEA 3DARA 1JF6A 1VERA 3HVNA 3PWNB 3PUDA 3PUEA 2EPOA 1OT1A 2HVJB 1LEIB 4POUB 5A7EA 3OG2A 1B3IA 4FXGA 3EJZD 1IEBB 2GIXA 4JO3H 4X9YA 3SDXE 3WXWL 4OM1H 5J1TC 1RK5A 4ZQMA 5B1JA 4U1SA 2ZCKL 4ZOEA 5BOPA 2ADIA 1U1UA 2O5YL 1KJVA 3QJFB 3BKCL 3ARSA 4DJDC 4M93C 2BTMA 3FTWA 2VDLL 4TVCA 4X8JA 4M62H 1S7XB 4N2MA 5ETUA 3SDDD 1NANI 1GYNA 3LCXA 1QOXA 2A9DA 3GNNA 1C08A 1BW8A 3P9LB 3PBGA 3RJOA 5IB4A 4TSAL 4DF1A 4S3DA 4PWKA 1A1NB 4U6VH 4CLMA 1FZKB 2J7LA 2JKSA 4N8CL 4ZMXA 1Q0YH 1GS8A 1A3LH 3QG6B 4NO2B 4KX9A 5CIPA 1V7NH 4PJ7A 5EO9A 5DFVC 4ERSH 2DLFL 5EZIH 2NQLA 5IW6A 1ZA6B 4LCIL 4HUUA 4DP9X 4JXCA 5F71A 4GK8A 2IXUA 4HZ8A 4LASH 1UD8A 2ORBL 3W70A 4XKMA 4CCZA 3GSNH 3CVDA 4LRSA 1L6ZA 4FE9A 3MTWA 3UTSE 2X4PA 2FK9A 3MN8A 4FNLL 3OA3A 4S2CA 1CXHA 3V5FA 1HO1A 1LYXA 2JH2A 5B39G 5ABFB 2BRQA 3U82B 1AW2A 3T9PA 4J6RH 1GS7A 3P8JA 1N6QH 2P0IA 4F8XA 4AT6B 1NCOA 2ZKHH 5A3HA 1JVKA 4GEJA 3ZVVA 2HXUA 1FFOB 1XC6A 3RUBL 3WN5A 3DGGA 4F92B 4K1GA 3E96A 4WY7L 3R8BB 2Y61A 3W7NA 3GMPB 2O5YH 3X1BA 2SEBB 1JPST 1O5PA 4YDZA 4TS6A 3D12B 1TPB1 1ZP3A 4V2CB 3KYAA 5LXGH 1ZSDA 4JFHD 2WLLB 4POCA 4LU5H 4H0IA 2EC9U 3MSPA 4N9GA 5EZPA 3KOXA 4DO5A 3T3MB 4BH7B 3MY9A 3LKSA 5AZEH 4ZMZA 4XNXH 1K9TA 1KB3A 2O9TA 3QZPA 5C0CD 3DX3A 4G8GE 3PZIA 3B9KD 3MCKB 3VA6A 4ATWA 5IB3A 4JRYE 1KR0A 3GFXA 2NZIA 1JCYA 4X9SA 2YA1A 1GY1A 3AITA 1MCBA 1C12B 3RL1A 2E09A 3TTSA 5C07D 4GMSH 1CDYA 5DVKA 5JOPE 4B5VA 1PCKA 2X4TB 4HZLA 2XA8L 3IUHA 2ROXA 15C8L 3UAAA 4HEPA 3L9CA 3T2LA 3OHXB 4X5WB 1AA1B 4PB3A 4C6DA 4GG9A 2PURA 1X5MA 4NKOA 3WBEA 4V2BA 2J66A 2QCGA 1CR9L 4HZ1A 2CDGA 3G5VA 3PNWB 3QHFH 1Q9OA 3SN6N 1G4MA 4BUHA 1LJYA 2OZ0A 3DXAD 3RJDA 4N8VA 5D72L 1KTJA 3NPUA 3GHBL 5FF6B 2WUBL 3S4SB 1EP1A 5JIQA 3JQOB 4N28A 4WI8A 4PJAB 4F1SA 4APQA 4PCNA 1A9BA 4GW5A 3EJUA 3V9CA 4ZX6A 2ZADA 3PUOA 4QG9A 1NFAA 2B0SH 2OA9A 4WHCA 4L0ZA 3LRLA 5KITA 2VXQA 4B92A 5CGTA 3U7AA 2RCSL 5KOMC 3SN4A 4OZHF 3KNBA 1S3HA 3IMVA 3VI3B 5T5FA 4Z9KB 1J1PH 1JRHH 4M61B 2J7BA 2IWKA 3U4FA 1WAAA 4V1DE 4FLQA 1Y6KR 4NQSB 4P4RB 4AC1X 4GUPA 2CO3A 1SGKA 3STBA 1INQA 3QWRD 1VPXA 4YNGA 4JTJA 1FFOA 3W7LA 2JIXD 3V4PA 3VI4F 5ENWA 3P73A 3CWGA 4IKNA 3G9AB 3L1FA 2ROYA 3ROLB 1GQJA 2VXSL 2HXTA 4G6CA 1L6PA 2AKRB 4ZW3A 3AS2A 3GXNA 3ARFC 4R7DA 1NUFA 1HZYA 1K8YA 3EB2A 4Y9OA 2FBJH 3B3IA 1DANT 4QHLB 5B38B 1PKQB 2VXTH 1I8UA 1E4KA 1XVSA 4CNIB 1FO0B 1QI3A 3ZE2F 1JYXA 1OZMA 1BM3H 1YPXA 4NQ1A 5DSCB 5GS1B 1C8XA 5CCHE 1ZHBB 2ZQ0A 3JW7A 2F7QA 4NO0D 1MPAH 5G1TA 4PU2A 4U0QB 2YW3A 4ORMA 2XETA 2FGBA 3OPZL 4FEIA 4F7PA 4L3CB 4M29A 4JHBA 3CU2A 4K7YA 4AGLA 1MRDH 2YEQA 3MJ8A 2YFNA 4X8XA 2PPGA 2J13A 2ZXEB 5LKNA 1E8ZA 4AEFA 3ALFA 3KFTA 1PZCA 4WTZA 3B2PA 4HGXA 5GNYA 4DYEA 5FWQA 2X2YA 4DGVH 2DGAA 1J8HB 5D5ME 4PMVA 3T9WA 4TO8A 4GRWF 1WVZA 4Z77A 3ZE0B 1Z3GH 5KSBB 2CK0L 1MNUL 4NAQA 4F0SA 2FH6A 2C3WA 4P59L 5C0DB 4YHEA 1LF1A 3TJXA 5EOQL 3MJ6A 3Q1EA 3F58H 3N2JA 3WTUA 2ARWA 4L5ZA 4OU1A 3WOVA 4ZAKC 3L4CA 3H7VA 2WAGA 3EJQA 4P8XA 1NDYA 4C90A 2ZYIA 2IDTA 3OXSB 2CW6A 2YAOA 2Y63A 3WFDL 1WWAX 3SDCC 1ISXA 3TFXA 4ETYA 2MTPA 3B0VC 4V1YA 2HJFA 1H7WA 4KESA 1G6RL 4YLQT 3K5SA 2CGYA 4GXUN 4NLHA 4JFFD 2I5YH 4P2CG 3G7TA 2CLRB 5HPOA 4GO6B 2YPVH 1WCBA 2YZ8A 4NYLA 4ZUSB 2NX5D 4XNYH 3ES8A 1EYEA 2WXDM 4QG8A 1R5WB 5EIQA 4TTGA 3LQAH 2WNZA 2ATSA 2VL4A 3O0RH 3L67A 5E0CA 3DIVA 3PTMA 4O19A 3E9TA 3KS6A 5I03A 1MHPL 3TA9A 1AS7A 4JY5H 2NCMA 5F3HA 3VI3A 1QI0A 3U9WA 3VKAA 2W5FA 4Z78B 1GK8A 3OHXC 3S96A 4OCWL 4NJ9H 4KXZH 4R5XA 3I3BA 4YNYB 3HPFA 3QORD 5JIWA 3GEWB 4JBSA 4UDTA 2G60L 4OZHB 2XCMC 2MNJB 4YSUA 5I1LA 3AXIA 4NRXB 2H3DA 3SE4C 1P1ZB 2PTZA 3PDOA 1DWJM 3EHBC 3GLEA 1UZ8A 3ILQC 5JMRA 3PTDA 5FAGA 5EO1A 3ZMNA 1X39A 2WXPA 1JMZA 1DVFC 3RP1A 2AGTA 1QPRA 4V11A 5I0XA 3LCIA 1EEYB 1RHCA 4P59H 4UCGA 2Q8BL 4AU0A 1BXNA 2WBGA 1FE8H 1TPXB 4FNSA 5D8JL 1UJPA 4MVBD 2RGSA 4KX8A 1EH9A 2OOFA 3NCYP 5CEXA 2CLOA 1ONQA 4JY8A 4AQ8A 1DLHA 3REWA 2KYIA 3SDXB 5HDBB 3ZMEA 1BVZA 1EGJH 3LQAL 4NRSA 1YBQB 4MLJA 1NCAH 5KWYC 3KLHD 1R2SA 2I60H 5JW4Q 4PUDA 2YLAA 1KENH 3REQA 1AQHA 1AXTH 5E08L 2PTVA 3CFDA 2XFRA 2ZYHA 4XPGL 3QMSA 3HZVB 5AC8A 2G5BB 2QVFB 3D8MA 2R2HA 2VB5A 3T3PB 4TUUA 4FYRA 4ODUB 1TUPA 4YHNB 2YGYA 4UC5A 1BHGA 3MRHA 1I1RA 2PPFA 2WQWA 1H6FA 4P2VA 4MQ7A 2PI6A 4JQ1A 4LY8A 1WG3A 3D0LA 4N2LA 3OVGA 2XXGA 1AUSL 3DSNA 2JI3A 4XNZC 1QFWM 3WX7A 1MW3A 4WHYG 1D5XB 1EDQA 2W5PA 2OW6A 2PXYC 4IBQA 1CEOA 3BLOA 1OGTA 3S3PA 4NC1C 1TQCB 1GW0A 3UABA 3FYOA 1GYAA 4CVXB 1PTZA 4HK0A 1FAIH 2R2BB 5H94B 2YDAA 3MV7A 3R4IA 4RIRA 5CLZA 1WBYA 1G7VA 4RNHA 3ESVF 4FA3A 1Z0NA 3SIZA 3GFZA 4UFIA 2F53B 2NWRA 1FWTA 1GJIA 5IM51 1BD2D 4MXVE 4OFYA 5KSUA 3V0DA 2Q7AA 3TEVA 4Z2GA 1QYGL 4K7VA 1G7MA 3SGKA 4D8PA 3I68A 3ENEA 1UD3A 4UQIM 5IXEA 4XP6H 3WY2A 2A6JB 1V5XA 1KRCC 2NOYA 1A47A 3EFFB 1K2DB 1HNFA 5FGSA 4B5EA 2JGQA 4H9YA 4Q22A 2Y69B 2E76C 4AM0Q 1DJQA 3WJMA 3V18A 5E6IC 1LP9E 4XKYB 2V8LA 3VXRA 5KYWA 3KZ8A 1AC0A 4EF8A 3BW4A 1C8YA 2X1QA 1VKFA 3GYEA 1XLBA 4OJYA 4NN6B 3VRLF 1EHLL 1ZQ5A 4KS0A 4RZBA 4Z18A 1VBGA 1A64A 2O6FA 1MCLA 3G08B 4NM8L 4NZTH 4PREA 4ETQB 1VFTA 3TTEA 3D6GA 3EOBA 4TVPD 3ZE2E 3K4ZA 4H5SB 2F54B 5C0GA 2F6KA 1R3HB 3LCLA 1ZTVA 1S7VA 3VQ1C 3HG1B 1L6SA 1CS6A 4ZODA 4CC4A 5GRJL 5D2NA 5CPQA 1V6VA 2HCVA 5KSAD 4I9AA 3NSMA 2K6WA 5AAWA 3D05A 5FLUA 4X6FB 4M6ML 2J73A 4TULH 5I73C 1HIZA 5H2BB 2QAPA 3NJXA 2JEPA 1S5NA 3TBSB 2ICEA 1JUFB 1YLBB 2YIHA 5AVXB 4LNCA 2XWDA 1O7VA 2PCPB 4XNXL 2PDIA 4CSZA 5C0CA 5D03A 3V10A 1I1WA 3SYPA 3W0WA 3MJ9A 4MFEA 2ZRXA 2ZUSA 4QCFA 3BG3A 1PDZA 2WN3A 1WIPA 3CV5A 4U6XA 4O8AA 5HVHC 4D1IA 4WI5A 4WI4A 1HDMB 1MFEH 1YNTA 5AQ0A 4G6FB 5E6ZA 3L3DB 4PVBA 3RE0A 4NL1A 1VR6A 4AX6A 4K8RD 2IH8A 4N6RA 4DZHA 1ZT7B 5F3FA 1X5HA 3TYBA 3NM3A 4XZBA 5FYKD 4PRHD 5IW1B 2CHXA 5AB3A 4LSBA 4HQQL 1MKFA 4Y4FA 4ES8A 5LGZA 1RPQA 1AODA 4ONHB 1JCMP 3ZSSA 2I16A 1AE6L 3L5XH 5F7DA 2OSWA 2OR2A 4WJEA 3I9AA 4PYSA 4OLVL 3CMGA 4YDIH 5LXEA 1OAXL 4UF7C 4PC8A 1ZGLM 1EJTC 3SDDB 3U1QA 3BYTA 4HK0B 3HQNA 4WKZB 1FJ1A 4QPEA 2D4DA 1WGOA 3RHWF 1E9OA 2XZCL 4W86A 4YBLC 3P40A 1PIGA 4J6RL 3R0KA 4LU0A 4X6BA 2WKLA 3V5DB 1OYCA 3ECBB 2ZWNA 3V1PA 1S38A 4G6FD 2VFIA 1ZHKA 2EDJA 3AREC 2R4RH 2I27N 1KN2L 1TU2A 1TZ7A 4Q8QA 2F6AA 4YAQB 4Z76B 3AQZA 1I2QA 4PRIE 2DSWA 3GRWL 5EB9A 2F1AA 2WOQA 3VAEA 3VXRB 1YEEL 3AREA 4O15A 4ADSA 4XHQA 3TPUA 2H90A 2Y2WA 4ATTA 5C9ZA 4MKTA 2VC5A 3UY8A 4YDVA 1YDYA 4ADUA 1E72M 4WY7H 1AP2A 3G6JE 3ZLHA 1FRGH 5B7ZA 3O16A 1I9JL 1L0YA 1LO5B 4UTAL 3CYJA 1C5CH 2PO6C 4ALAC 2PLJA 4NP7A 2B4CL 3UU0A 4RJEA 4K68A 3H9ZA 3OODA 1N2VA 4JZJA 2E9BA 4HALA 4WO4B 2H6PB 4PCKA 1N0XH 2O7QA 3BOFA 4XCFH 4KI5C 4YIQA 5FJPA 4JIRA 1C93A 2CK2A 2B1OA 2BWDA 2XVNA 3TA3D 3TQ0A 4FLOA 1D5ZB 2C18A 1AZVA 3MZGB 5KSVB 1PKOA 5JPMA 2Q76A 3FQUB 4W9IC 3O15A 3O7UA 4YIWA 3A13A 4JYDA 2OMNA 1SHSA 3G1SA 4HTBA 3SDYL 3EYSL 4KRTA 4UFMA 2CIPA 1AKPA 3WQPA 4OIFA 4GGBA 2JELL 3MUCA 4L6HA 1YUHB 3H8NA 1KYUA 2D2OA 4ANXA 2W61A 2YYTA 4PJIF 2NY3B 1IM9B 4F7CA 1G7QB 4N2BA 4OF3A 4JFDE 2VGIA 1T21B 3UP1A 5CSGA 3ULUF 1QNZH 1SVZA 3MB9A 1XF5B 2APXA 4PV1C 2A7PA 1GSMA 3AIBA 1SY6A 3QBUA 1NMAH 4NJAH 5A6TC 3FO1A 6FABL 1QPPA 4Z7NE 4HCFA 3MYPA 1L5GB 4Z23A 5CJNA 2JF6A 3NQKA 2DW6A 1GQNA 2WYSA 3N2CA 1G7PA 2EXWC 2OSLB 1ZE3H 3L4ZA 4P06A 3GG8A 2OMTB 3R4DA 1P5UB 1GCFA 1E0TA 2UY5A 2CHDA 1GCYA 3MV8E 1U3HB 3B6SB 3DOSA 3GNPA 2APSA 3K7UA 3NJGA 1BPVA 1VRDA 1TO4A 1XXXA 1URZA 2FL5B 5CEZD 1QRKA 4YGVA 5FL1A 4JEQA 1YEDB 1CFQA 2VP8A 4MWAA 4AB4A 1J5HA 3W11D 1YIXA 2NQHA 3V5DA 1YNYA 5HYJA 3S5ZA 3WYRA 1YNLH 2DIKA 4KIEA 4A6GA 2ZOOA 1CLYH 1LBFA 5ADOH 4S1FA 1MFUA 1UOWA 4Y1TA 4BQCA 3RWCA 3VSVA 5I1LB 4PD4J 3WFHA 3W07A 5BWAA 3FQ2A 3MLZL 3VXGA 3A9IA 2W62A 1TYJA 4BE6A 2XWJB 2Z0IA 4TXEA 2CO4A 5CZVH 3RJXA 5C0DA 5D05A 4FZEL 4BZ2A 4CBZA 4IMKC 3VGEA 5HNRA 4G8FB 5TAOA 1YEKH 3LX9A 1IGYB 4WGVB 5EZOL 4GXWA 1BZ8A 4KHXH 3BPNB 4R26H 2A2QT 3LCFA 3IJDA 5M1TA 4RZ5A 3DO3A 3FZUD 3W0KA 1HQTA 3FH5A 5EEUA 1OAKL 3QEQD 2HBXA 2NTFA 3D46A 3GBMH 4UUJB 3TH6A 1LNUA 1PSKL 3G6AA 3MZTA 3NZSA 5JHDD 2EEAA 3VI2A 2KBGA 5J12C 3UZ5A 1NFIB 3HFFA 3BVNB 5E8PB 5HMSA 5EDSA 3OMZA 1NCDH 2WLIA 2B3IA 3MUGB 1J5SA 2V2DA 1F86A 3FCTA 3BE7A 3LQGA 4AQEB 3K8KA 3OKYA 3IVSA 2NY2B 4EVNA 5E8EA 3O3DA 3JRKA 3QPXL 4U1HA 3D30A 5K9CA 1IX2A 2OMUB 4PJBE 5I71B 2VM4A 5HI5C 1U5HA 4BF5A 1PNCA 2LW3A 1JCLA 4QAIA 1J9YA 1PNDA 1U8CA 3MRDB 3SE8H 1K7XA 4LUTA 3HE7B 1KXTB 3CFIC 3T05A 1ONWA 2ZXCA 3F7YB 4UWQB 3WH6A 4N3TA 2OMWB 4FQCL 3PFRA 4QTHB 3NZHH 3MLZH 5A2BA 2D31A 2BO0A 1WDRA 3NJMA 4ELDA 4LVNC 3SI9A 1CGVA 4P2RA 1PZAA 1CLYL 3UADA 1TZGL 3VCLB 4D0CA 4QLRA 5LJYH 1LRNA 3O6ML 5KVMC 3O0FA 1S9XA 3VCNA 3V8OA 2Z2UA 5GIRB 3U1PA 3W7MA 3I6KA 5CH9A 2IAND 1J8RA 1JCTA 1FWAC 5DRNB 1I8IB 2OZ4H 4PGDB 5DVPA 1N0LA 5DA0B 4R3UA 3KHDA 4G7QB 4N2CA 3TO2B 1CFQB 1RSFA 5DMGD 1FNSH 2H32A 1CFVL 4U1LB 3CH9A 2FL5A 3L4WA 1H0DB 3RDTB 3EPOA 3WLMA 3WLWD 4RE4A 5MENE 2VXSH 2BBFA 4JOMA 4L8BA 3T8XA 4B53A 2K0RA 4O13A 4QROA 4S0HA 2GUYA 3TNNB 2P5ED 3WUWA 2IALA 1AY1L 4OD1L 3WEAA 3ZJKA 4LYKA 5D9SB 2V2TB 2ZZ6A 4NF7A 4ATLA 1YHPA 4JM4H 2XNAA 3VSUA 3R06A 2DBLL 1JRBA 1IBGH 3BD3A 3U7BA 1FE8L 2B7DT 4FCAA 5D8JH 3LGDA 2Y89A 4YBQC 4I7UA 4W9CC 1X5GA 1UENA 4IRJC 4ZMYA 3AB0C 1HHIA 1GVSA 1AKJB 2LLNA 5LWYH 3B05A 3OIXA 4H13C 1SW7A 1PG7H 4XP5L 4NP4L 2RHGA 3MRMA 1EK3A 3URQA 3S4SA 1DTNA 1XGQA 2MQ0A 1IQDA 5FYKH 5G5DB 4B3LA 2TSAA 1KCSL 3HG0A 4D2NA 3UNTA 3QZWG 3D69B 1DQVA 1F05A 1PEZA 3DIFB 2FO4A 4WW2F 1QASA 4DN4H 2YD4A 2XUCA 3A67L 4QUOA 2AQSA 3APTA 1A49A 2XYCA 4TR9A 3N4FA 5BQDA 2VABB 4NN6C 3EYOB 1HVXA 2ZZ2A 4GAYA 2BSLA 2VMJA 2G3ZA 4HPOH 1LWJA 4NQUA 5CZXC 5I02A 4ELMA 3PF3A 1K2DA 4BQ4A 3FQWB 2E8YA 1UZHA 2C15A 2YUVA 3U7WH 3EDFA 5D2XA 3T71A 1MAKA 3V75A 1TZIA 3ZTNH 1BQ5A 4X80H 4U4IA 3V4VL 4Q4EA 1M7DA 5DRZB 5IKCB 2HT3C 3L5AA 3BD5A 4MD4A 4O02L 3VO0A 3IIOA 1FKXA 1P6BA 3LTYA 4LNRB 3V6ZB 2WMIA 4FI7A 5CJOH 5A69A 1BIIB 3PL6C 2C13A 4WSHA 4TQIA 4AQZA 4URIA 2BK8A 2Z1KA 4FQIL 5GIRA 3ZMRA 1AFVH 4DEWA 2I9LA 4MWAD 1HP5A 3BKMH 4R7VA 5IW3A 1XRSA 4JAMA 1UWXH 3ARFA 4OLWH 3GMPA 3N40P 2NNFA 1S7TA 2L3BA 5DELA 2PP9A 4WNQA 4LCIH 3A9BA 1GGBL 3LNHA 3I9GL 5L4IA 4XP5H 2AEIT 4GRLC 3GLDA 1EF2A 3SE9H 5FD0A 4KTEH 4AG0A 2XN2A 1B9KA 3KDMB 4BFEA 1EAQA 2UUDH 3G5YB 5TD4A 1IFHH 1S2VA 3EA1A 3QFWA 5F1UA 2ZZ3A 1Q6EA 5IB1B 5CD5D 2ICES 3CLWA 1MUCA 5D9SA 1LL7A 2B8OT 3MCOA 4YL9A 1OD9A 4WV1B 2B4GA 1QW7A 3QF0A 2QCHA 2ZE3A 1DO6A 2OJZL 3WIFA 1RUMH 1Z66A 1ZT7A 4HIHB 5JXAL 2FSDA 3S5LA 3FT0A 5D93C 1WIOA 5BO0D 3CYVA 4L1HA 3X1NA 1W1IE 1CD0A 4Z7UE 4FD0A 5F2FA 4HDIA 2AXGB 1FX6A 1WKDA 5AOUA 3LKRB 3BJFA 2H6OA 1WHPA 2JKIS 4FXKB 3VG9B 5JIMA 1F4YH 1BYAA 3CZ8A 32C2A 4CC1A 4ZSUA 3DA0A 3IJEB 3TZVA 3PU7A 4XPBL 1NQKA 3FTSA 3VZZA 5AB2A 5TE6H 4KU1A 1N2RB 4MRBA 1KFBA 2CBMA 1KCLA 2BC4B 2X4NA 3ZL2A 3ME0B 4XG1A 3QE5A 2K7QA 4RFEB 2P46B 1BQSA 1NGPH 3FT1A 4PCFA 2Z3FA 2NX3A 5U4NA 5LYRA 1ZHNB 3PJSB 4XVSL 3OYXA 2C26A 3RMJA 2G4EA 2VZUA 3H8AA 2C3XA 3VNYA 3KHJA 3RWIB 1CNVA 4U1SB 5I1JH 3Q5OA 5IWLA 4NHUB 4LVBA 3NFNB 4KRNA 4OZIB 3AIVA 2RKXA 5C09A 4DNHA 1G7LB 2GJJA 1S9YA 3V4BA 3IJHB 5CJ8A 3SCMB 3WO4C 3HV8A 1A1OB 3PZUA 3MJGX 1OKEA 4RDQF 2A74C 4X7EC 2IH1B 4NQXA 4KZEH 1FY6A 2V5JA 4WIWA 3M1BA 4S10A 1TKWA 1LDSA 2VLRE 2NW2A 4L3AA 4DTGL 5I66A 1BGXL 1JZHA 4JKKA 5EUOE 3LBMA 5FEWA 3QV9A 4EBQL 3HB3B 3NYDA 4OTXL 5IFPA 3BIKA 3OKLA 4QO1A 4U1GC 4KVNL 4DT2A 3QARA 1PKLA 4OV4A 1OQXA 5D7LA 1GOIA 2O7SA 3O3BA 3KGUA 2CU0A 4UCFA 3VB8A 1E43A 3WTSA 2JMRA 2QPSA 3OJVC 1BV8A 2OVLA 4WAFA 3FDKA 2OU4A 1AO7D 3THQA 3Q06A 3SBQA 4OJDH 3UACA 4H1LG 4U05A 2DYPA 2OX5B 1FWWA 2I14A 4UFHA 1W17A 4WKHA 1EZSA 1W16A 3QC3A 4GS7C 4MM1A 1Q7ZA 2FE0A 3DFNA 1KELL 1H7RA 4W9JC 2PFHA 1D5MA 3ARBC 5FECA 4P3DB 4DXKA 1D6EB 4TTUA 2CBQA 2F9BT 2WZHA 2F6XA 4BZ2H 4RZ4A 2FRGP 5L0QC 1HGYA 1YE6A 3VFGL 4LPYA 4OQ1A 4R97B 3WLJA 2OYLA 1U8MB 1RAMA 4Q9RH 4KI5F 4ODVL 5FFOA 3ZR6A 4IFOA 3IJ7A 3DJ9A 3DI2B 3F7QA 5IROA 1SRDA 5CEZH 1VHNA 2BG5A 2CBUA 3SBWC 3CZFB 1UQZA 2YDSA 4MKVA 1YYMH 4PMNA 2X2IA 3IWVA 2V68A 1Q9LB 3EEZA 4PS4H 2VUKA 3UF9A 5A6BD 1YRKA 1UCTA 2YSSA 1L7IH 1RKRA 4XZ4A 4OTXH 1AFVL 4YFDB 5C0JB 1DKWA 3WMSA 4HKZA 1R9ZA 4MD0A 1WWCA 1NBVL 3V5KA 2QFRA 4P2OD 2Q8XA 5D9PA 2LU5A 3VFNB 3QIBB 1F6KA 1IL1B 1DFBL 4R5TA 3ULVC 3MS8A 4JS7A 2CAKA 2QJIA 1MFCH 2WXNA 2WZIA 3BGGA 4J4PA 5D1ZA 3WQ4A 4BE5A 3CUXA 3GGWA 3DHFA 4GY1A 4JFXB 4PMDA 3KEHA 1FF5A 1NUNB 3TH2T 4FXGC 1OADA 1AYOA 3Q2CA 5LO7A 4UOQA 1AQ0A 2PLMA 1CFSA 2XV3A 4JZOA 4P8VA 4JHWL 1A6ZA 2PGEA 2PR4H 2BP8B 2WO4A 3UETA 1HHHB 2F08A 5CBJA 2K8QA 5E4EB 3CUHA 4DELA 5CHNB 4QT5A 4JPIB 3O0LA 3DV6A 1TX2A 3QDMB 4N8VB 5IFTA 4NUQA 3QZAA 4MAYA 3LB6D 1BBJA 3QBTB 4O2CB 1VDGA 3RILA 2C91A 3NM1A 3NIFB 1GJWA 4YO0B 4PW9A 5FM8A 2HFFB 4OD2B 1UA3A 2OXHB 1KW1A 1V79A 3S3SA 4UOW0 1ZB5A 4CCCA 4TIMA 2QEZA 2IPKB 3QDJB 4E8CA 3DROA 4O9HL 3P14A 2IALB 4ODTH 2ISVA 4DWSB 1DQJB 4AZHA 2OXGA 4ZENA 1J9RA 2VQ4A 5EU6B 3E74A 3IS4A 3WLRA 5JBEA 3CH8A 5ESQA 3FSWA 4JPVH 3SPCA 2GSIA 2YCJA 4MFDA 1M2VB 3MLYL 1WC7A 4GXFA 3DIPA 3U6WA 1D6EA 3GZ3A 3H3PH 4OQTH 3ATBA 1NKGA 4TLUA 4W9KC 4BFGA 1TA3A 1W9DM 4S2BA 2V3GA 3WLBA 3I9GH 4K3ZA 3IBEA 4EP8C 5I74C 4X8CA 4EOUA 5C0BE 1DUYB 1NY1A 4PGLA 4MJJA 5KOVC 3KD4A 3JV6A 4DVBB 3NTCH 2A7BA 1ID2A 4JQVA 4HSQA 4UT6A 1MFBH 3ARGB 2N3JA 1IE4A 3EXSA 3ULAB 1ZANL 2CQVA 3B9DA 3HI1B 4MCNA 3L4YA 4AF0B 2J55A 2E46A 2DQUL 5T3XE 3OEXA 5DTFB 3T0ED 3LQZA 3GSQA 2FTAA 3TX4A 4H3DA 4O1FA 2PYED 3X17A 5A2AA 5ICZA 3UXAA 3W9DB 3V0JA 4LQ1A 4HJJH 4YSEA 4I9XA 4KVCH 5JUVA 3BH9B 2W4XA 3NCJL 2ED7A 2DEPA 4H04A 4MYPA 5IQLA 3KZPA 4NXKA 1UR9A 2BVTA 3IJ9A 2DQHH 1B57A 5DT1H 4A2RA 3GKZA 2B15A 3ATDA 1M2OA 4AIUA 1URLA 4NDMB 5D6CA 2OLSA 3FW6A 3O45A 5JOEA 1A8JH 1T66D 2X9WA 5D7IE 2GYIA 1EJOL 2GITA 3QLLA 2PF0A 1A6AA 4HUUB 1XH1A 1LQSR 1QUNB 1SLUA 5EUOF 2X28A 5GRZA 4BK5A 1L4IA 1AH1A 1J2WA 1GOXA 2VOMA 3M4HA 4Y8FA 4NWTL 2BHUA 2QSCL 3ATZA 3S1WA 3M6DA 3GI8H 1ZLSL 3CM4A 2FYYB 2B7PA 4P2AA 5HDQH 1J05B 1QTSA 3P67A 4ODVH 5DUBA 4LSUH 1SYSA 2DZAA 2EKSB 2ISFA 3SCWA 4F80A 2IGFL 4OD2A 1OW0A 2Y7LA 4NQVB 3OC5A 4GMTH 4HGMA 4APXB 1V6UA 2F74B 2JCCB 3T4AA 1QOKA 2ID5A 4M1DH 1GW9A 2A85A 4PUUA 3W7HA 4D8LA 1CFTA 5AVUB 3A4JA 4O0QA 3QA3B 4DVOA 1OAZH 3ABXA 1QP1A 3HR5A 3ZW3A 5MEOB 1CN4A 5F8RC 2ZBTA 2DBLH 2A3AA 2Z29A 4ODSL 3NQ8A 4G6ML 1K5NB 2P8LB 4D72A 2YMOA 4RISL 4BY3A 3UMNA 1JNHB 3DX5A 4L5FL 2WB1A 1URIA 1W6TA 5EIIG 1NIAA 1EJXC 1CC3A 2XVGA 4M51A 5F70A 2PDNA 1IBGL 4JNMA 1F97A 1MVUA 1I7RA 5DS8A 1JWUA 3VNJA 2P5EB 3D9AL 1OALA 3V4LA 5HNTA 2VMEA 2IWFA 3V6BR 2N4IA 1XIJA 4OKVB 3RZWA 4JQVC 4MNGB 5G4NA 3RFZA 3QV8A 5A8OA 2P8MB 1S7TB 2PDXA 3BWAA 1LOSA 4NQCD 1NEZG 1EIXA 2WZ6A 2HTKD 5FFLA 3CL6A 4BFIA 1ME9A 4BR1A 1KTBA 4QM1A 2GHZA 2VDQH 5DN1A 2ZCLL 3QR0A 1SU5A 4EAEA 3QULA 4BZ1L 4EUPB 3SSGA 2PTWA 3FTXA 1E8WA 4HYRA 3CUJA 1TV2A 4BCYA 3TEWA 1NDGA 4XVJH 1OOWA 3RBSA 3LHWA 3UCCA 4ZMGA 2VMFA 3MBEB 4S3CA 1X7QA 5HJDA 3R7RA 1NH6A 1CXFA 3O6AA 5HGAA 1S9VA 1XKJA 1XF2B 5AECA 1TZOA 3NQFA 4O58H 5FDWB 2HZHA 1GY2A 2CKBL 1QSEE 1XIHA 2CHOA 1XIWA 4G9DB 4LASL 4LPUA 3O9WC 2Y5TA 1ZGLP 1IEXA 1ZLDA 2YBRB 1PBGA 2BGSA 1VGKB 2Q5BA 4L1BA 4I0PA 1W1B1 2A21A 3FO9B 1GT8A 3DSFH 2NY1D 5IQNA 3T09A 1XAKA 5EF1A 1PU0A 1ZCOA 3MSDA 2GUOA 4PJ8B 3V6OE 3X12A 1WDDA 4B5ZA 2WZ5A 2JKTM 4I2XB 2PRMA 4HIXL 4JKPH 1KZYA 4HPYL 3DNKA 1QPQA 3NQBA 1SSDA 1YQVH 4NO2A 1UFGA 4Y9BA 5EO9B 5IQ7H 3T0XA 3VNKA 1RZIA 1RQBA 2J7DA 1JS4A 3QUZA 4HH9B 4NPJA 5E4OA 2Y24A 3TBWA 3UO8B 5IT2L 4EI6B 3S5YA 1JZ6A 2V4LA 1OSEA 1A14H 1IM3D 3VXME 4PCYA 2WB5A 4DI9A 1KB5A 3ZX1A 1VZGA 2FEDD 5CC3A 4ZUVA 3DLQR 3KPQB 4KF1A 4HCGA 1HYRC 1YNLL 4ADGA 1RHHA 1IWBA 1VS1A 3PNUA 4O8RA 4WKZA 4BI5A 1DVSA 1JDDA 3MV01 5I1GH 2YBVA 4RNJA 4GJJA 4JIQA 4HX1B 3MRIB 3PGCA 3UYRL 1ZSHA 4PJ8D 4GH7B 3OD3A 3JVFC 3PB0A 2BY1A 4QKXB 5LDSA 4JZ5A 4HIIB 2OL3B 2JCCF 4N0UE 4P9HH 2NYKA 4HSHA 5EIIB 1F56A 1CZ8H 1T4KB 2VDPB 1N0LB 2WLJA 3CXDH 4PS4L 4R97C 5GPRA 3TYCA 4D8OA 4RNRA 3SDAB 5BS0A 1EQCA 2PS2A 4RDYA 2AJYH 4AEOA 2WINB 4LAQH 1P0KA 2Z7KA 3UC0L 3V4VH 1UJQA 1RULH 1XMWA 5CC7A 3OYZA 1MZHA 1I8LC 1HDMA 5L8LB 1IM3B 2VC9A 5BYWA 1RCYA 4R4FL 1US3A 2QHRH 4HBQA 5ADPL 2ZUMA 1RUPL 1VZIA 3VFWB 1R75A 4EDXA 4M6QA 2CCRA 3V6FA 3LRHA 1UB6B 1LQ2A 4GY7A 1RK0B 2QNEA 1O9VA 2YS4A 3ZL4L 4F2FA 4HPYH 1V3MA 2R0KH 3ZDYF 4AV4A 2O93L 4EACA 1T1YB 5LXXA 5LGJA 3ZJAA 1KCZA 4PJFA 5IBLC 4DJED 1BXVA 1IZJA 4LESA 4Z7VB 1SXSA 3NN8A 3QXWA 5TH2B 3HMWH 4X7TA 4GX9A 4A2MA 1BMGA 2V3EA 2WP3O 5D7KE 4L9DA 4GABA 3UH8A 4EZJA 1TTAA 1KA9F 1D7BA 2HT3D 3SRFA 2RFXB 4QHUB 4TNVK 3V4UL 1OAYH 1GGIH 2FWSA 4NC0B 4IM4A 3U6RA 3BP7A 2WSPA 1VEMA 4XCFL 1ZP4A 2VEGA 3ZM8A 1G7JB 4U7KA 5HHMB 1M6OB 1MCOL 3FO9A 2CMRL 1CGWA 4EX4A 3AY4A 3N0AA 4NZ4A 4JG5A 4L4VB 5DEFB 3YPIA 1MEXL 3CV2A 1H8LA 4IPJA 4UQCA 4KTDL 3NJKA 1E3FA 2BP0A 2J1ZA 1G1CA 2R29A 4G3YH 3ES7A 3ZZQA 3KRZA 3H9SD 4R4FH 43CAA 5HGDB 2ERJC 2FGLA 3UZJA 2XISA 1HSBB 4GP4B 1CU4L 2OZNA 1E71M 5ECJE 1V77A 5DDHA 4ZQCA 2VDGA 4JJHA 3ILEA 1U1HA 3U0WL 1SOQA 1IGSA 2ZWKA 2VZTA 1OFRA 5G1YA 5CO1A 3K2GA 2VERA 1QI5A 3MREA 2VDPL 1B3YA 3L5LA 5HTSA 5ELIA 4EPKA 1JNLL 1TE6A 4UAHA 3UWYA 4HK7A 4HK3J 2X70B 2WWMD 3CZLA 1LE9A 2GABA 1EFXA 3ELFA 4OF5A 4O4YH 1DORA 4J9JA 2XZCH 1EQPA 2AKZA 4OZGF 3FQUA 4K71B 3AXHA 3TGXA 2R2CA 4KZEL 2GK2A 1S5HB 3ZQXA 1I1YA 1PXGA 4ESKA 4AUBA 4DETA 3FK4A 3BKJH 4L0YA 5LXVA 4AT6A 3BGAA 1RVGA 2WQSA 3CFDB 4D9LL 2KQMA 4G1MA 4ANKA 3JWDH 1ADOA 4E4UA 1YC7A 3N2OA 1GGUA 3EH3B 2FKPA 4P7OA 3TYAA 3BAWA 3HW7A 2A4EA 4XMPL 1VZHA 1OOAA 1P5UC 1BX2B 2Y5JA 3KDOA 1Q9WA 5C08E 5HSFA 4ASTA 2HX8A 4L8BB 3MRJA 4EIGB 1TQJA 3FCTB 1W1A1 4DN4L 5LIYX 2RALA 3R0DA 1FH8A 3GDMA 3P9MB 1DQMH 2QW5A 3BVXA 1FRBA 1FHUA 4PS8A 1PKYA 1R9FA 4NAEA 1IAKB 4XP6L 4LSUL 5JORB 4G8GD 3PWVB 4P23A 5D2LB 1FP9A 4G72B 4UTAA 4AUYA 3WH8A 2YAMA 3SCUA 3WKYA 4OLUL 5KSUB 4L1XA 3C2RA 1KPRA 4XPHH 3NA8A 2KZKA 2NY7L 3K71A 3B34A 5EOCJ 3OR7A 1KIUB 4H41A 3BAXA 3BMVA 2GIYA 4MSWA 3CPUA 1S3TC 4AVFA 5KANI 2GB2A 4CNUA 3E0WA 3EF7A 2X0HA 3OKMA 4GBXB 2FSEA 3FB6A 4N2YA 1T22B 1YMMD 1J1XL 2GBAA 1QNRA 5J1AB 1RCXB 1OGAB 3BIBX 3RAJL 4GUGA 2X4UA 5A8MA 2PW2B 5HVWA 3GU2A 3M1BB 4ZAKB 4YK4B 1JV5A 3FUIA 2CBIA 5HMFA 3EGJA 1UC6A 2YD6A 1UH4A 3EMCA 4R4BB 2CLFA 2A6KA 2YQGA 4KEMA 4IRSC 3FSAA 4JY6A 4YVUA 3TNMB 5JA8B 2K4WA 2GC7C 3UIYA 2J75A 3GYCA 3IETB 3KPOA 3U57A 3OVRA 3VOHA 3DCPA 1KENL 2OTWB 1QRNA 2R39A 3RI5K 4XZUB 2I60L 2P26A 4NQCA 3RUGA 2FLBT 1RY8A 3GIQA 3AU6A 5C3TA 1UURA 2PPDA 2X6MA 3SCPA 3UXLA 4C1NB 4OVVA 3NGBB 4RAHA 3W1NA 3AUOA 2JKWA 1OWRM 4O10A 5CAHA 4PODA 2OWXA 2G97A 5JYMA 4ZW7A 5IMLA 5J13B 2OJZH 3O6KL 2IAMA 3MDJA 3PP3H 4J3BA 3S3DB 1QATA 5I75B 3IGLA 1WH0A 2YD7A 3OAUH 5FM5O 4LS0A 5IR1B 2OQLA 1J9SA 4KK8D 4GKZB 1DBMH 3C60B 1R87A 4NX0A 5M3WA 5GSRB 1TITA 3NIDE 3H24A 2AAAA 5C0BA 5EBMB 1W3JA 3FEMA 1MN4A 2E56A 1E4IA 2XC8A 5F89B 1HKFA 3RWFB 3H4HA 3RWJB 3MOAH 5K9QI 1D5IL 2ZUQB 3OAYH 2BXVA 5GNXA 5C9RA 5B3JE 4MTMA 4IISA 3CFNA 1L8PA 5ADPH 1CE1L 4Z7AA 4LBRA 4XISA 2NX1A 2GCYA 4IBZA 4WU7B 3EWUA 2D3JA 5LG1A 1WA1X 4P5SA 2WPBA 2Y8UA 1RSYA 2CLZB 5DUMH 1POKA 1O68A 3NVDA 4Q2ZA 4GW1B 4YE4L 4G8EB 3QTPA 3C6EA 3C2SA 2ENYA 3N1GC 5KZCD 1H5BA 4I9WD 1XD0A 3FCBA 2ZXBA 4WI3A 4ZW8A 3NJJA 4PMUA 2CLVB 2J8UE 5EF0A 3P30H 1EX5A 1IR1A 5B80A 4NENB 3KS5A 4JFDD 4GRMB 3BN9D 1UJ3C 2GFBA 2H3NA 1ZHLA 5E93A 3D2UD 5CQ1A 2DI8A 4MDJA 4QXGH 1AD1A 4MNMA 4PJ8C 4QCEA 2QCDB 1KV5A 1T6MA 4MJ5B 4JZOB 1GZQA 3US9A 2Q8AH 1PDYA 3GDKA 2XYLA 4R7WA 2NY2C 2ZX7A 5IF0B 1I2NA 1A14L 5HJ3A 4H8UA 5C0QA 2O9PA 3BUYA 4NQED 4YHLL 5DY2A 3WY1A 1U4EA 1XR8B 2HFGH 3EFFA 2V5YA 1T20B 4GXUM 1R2TA 4J8RA 1XG4A 3SJVA 3GW3A 2C1HA 3WBAA 2Y0FA 1KV7A 1TPFA 5T8IA 3FTYA 1KG0A 4PB0H 4QXWA 3VG0H 2W59A 1Y8BA 1TJRA 2FMNA 4DYKA 1FFQA 3MX0A 1XIDA 5KSVA 4JFDB 4L9XA 2ZSVB 5EUOA 4G5DA 3GBLA 3B3BA 3S97C 1L6WA 1LK3L 3QDJA 3VFWA 3ZQ9A 1MY5A 4ORGA 1FZMA 4KY2A 3GZKA 1XFBA 3F5WA 2X89D 1VHPA 2APBA 4NJAL 4U31A 1IEIA 2W88A 2V9TA 5FV1L 1J86A 1X4XA 3TC3A 2ENJA 3D0LB 4LRIC 3VTTA 2GQAA 4ES4A 4QY8A 2R82A 1H51A 4L9LB 3SGUA 3S4TA 2ZNWA 5I1CL 5JQ6H 3P7YA 3EO0A 3WBDA 3BGJA 2DMGA 3ROOA 2DM7A 1LT8A 1DVFB 5DQ9A 1BZ7B 2NLJA 5DZ9A 5E9DB 3L4VA 5D1XD 3RB5A 4RE2A 1CWYA 5A8PA 1LT7A 1TPH1 1OYBA 3P3TA 1I9CB 5EOCH 2HB0A 2BNQD 3L7FB 4IOSA 4FLHA 1G1OA 4NM8H 4NZTL 4LVOC 5TGBA 4AEEA 1QNPA 4W89A 3P11H 3T55A 5FYLH 5I24A 4GE8A 1G4PA 3D18A 4X9GA 2Y0SA 5H91A 5J6SA 2Z1VA 5DF0A 3PRZA 1XCQB 4O02B 1DIDA 2AQ2A 1CLZL 1XLDA 2WGNB 4RMSA 5JW4R 3ILPB 5C2UB 5MHSE 1HL2A 1YVLA 4PMJA 2AXJA 3GM8A 1L9OA 4JJOA 5MERB 3SY0B 4OGYH 4ZFGH 3JWDC 3KBHE 4XD5A 1KTLA 4CC0A 3PAYA 5KG9A 1WOAA 1N64L 3F6IA 1YEYA 4DUOA 3PHAA 3OVQA 3WEXB 3RX8A 2C8NA 1PZSA 3HMXL 4JDVB 1AZ1A 1DBJH 4OF7A 1G6CA 1TWDA 4WCJA 1YYCA 4H8PA 1P1XA 4R4ND 5TDPB 1JRHL 2DQFB 3RLSA 1RK7A 1ZTXH 5EG6C 3EA2A 5K1NA 4NKOB 3QI9C 3R1GH 3SJ3A 3UYPA 3NZQA 3T5WA 1GPWA 3WMCA 4XOAA 1PZDA 4KXAA 1UWGH 4OCMC 4X4ZA 4N0FB 1Y5XA 3TU9A 2YXGA 3IUIA 4BWTA 3GXIA 2A5UA 5KVGL 1BD2B 1CXKA 5B7FA 1QLEB 4OUEA 1UUNA 2MFNA 2Z1PA 1TQUA 4XRCA 2J8OA 1NF0A 4P49A 2OMWA 1WXYA 3TXZA 3OR6B 1HI6A 5D71H 2CLRA 1UT2A 3QUYB 5BV7L 1J5TA 3FJTA 4Y2NA 5KVGE 1GVIA 4KK9D 4DX3A 4G6AC 1J96A 1OY0A 4CNPA 4KTEL 1GOWA 3H7UA 5C9JB 1PZ2A 2D7NA 1XTMA 2E74C 3U0TB 3VI3E 2KLTA 4M00A 1N59A 1JGUH 2ADGA 4FCHA 5GZNA 1UKQA 5HJBA 4A6YB 4HK3N 1YEGL 2J56A 4PR5A 4DJEA 2UUDK 2AKRA 2I26N 4ZZKA 1DEDA 4ZDHB 2Z4QA 2IH1A 4NQXB 1NFGA 4WHTA 4P04A 4L8CA 4ZD3H 2OR9H 2Z92A 5F7EH 3UTPE 3QOKA 4YYFA 1KGCE 4IWWA 5F7KC 1XIWD 1D6VH 4BSVB 4KI1A 1I2PA 3D3FA 1HOEA 3BMWA 3LMJH 4S1RL 5E4AA 5L9DH 3LN9A 1AL8A 5FO8B 4GB9A 3AYVA 4O52A 1PLCA 3TYZA 3IANA 5I1DA 3D0CA 3WF2A 2WBKA 1GPOH 2VX6A 5AL0A 4ODWA 4QLLA 4RZ6A 1CL7L 5F7LB 1P0BA 3JYBA 4S1DD 5DS2A 4NUJA 4L3FA 3T07A 1GR7A 4ELKA 1DZ0A 4IPNB 4I88A 2B59B 1I3GH 3BPOB 5I0DA 3KLHC 2IBZY 4JN2A 2FQIA 1RURH 1S78D 3TWYA 4IRSD 1SQ7A 1A6ZB 4XBGA 2EEXA 1E5NA 1E9LA 3RRQA 1E5JA 3MJYA 4AY8A 4JN1L 1U58B 1NWUA 4FKHA 3TT3L 1TMLA 4NO3A 5H35A 2WWCA 4NIRA 5CBBA 3MV11 5ANMB 4H9TA 4B0MB 3BEVA 1Q9WB 2VLKB 2QUTA 4NAFB 3TTQA 1DQIA 3QEQA 5D1ZI 1AXSB 1V3JA 1KD0A 3SUTA 3LZ5A 1FN4B 3GJFA 3STLA 3RY4A 2MUCA 4N02A 4HS3B 4JO4H 3PFUA 3WENA 2MJWA 5I6XB 2BZCA 3QXTA 1A50A 4URKA 3O3EB 4MNQE 4GAYB 4M7KH 2M83A 1OCQA 3HC3H 4XPTL 4H1ZA 2XWBA 4NPYA 4Q9CA 2RBLA 3W6LA 4JVPA 5J9PA 5KJRL 2GITB 2WAQA 3SKOA 1HJXA 3TXVA 2BMBA 1QRND 4LRNH 5DEGB 3KCPA 2KMWA 1TPWA 2BOLA 4K94H 1AQKL 3TVMB 1OP5K 2AXHA 1BFOB 1FZJA 1KGCD 2GI7A 3HZYB 4LCWD 5FO9B 1Q38A 4N1HB 4OBSA 1HZKA 4XMPH 1KBBA 3O2WH 1RJYB 4O1EA 1AS8A 1KCRH 2FHBA 3MACL 3UGEA