2WVVA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
total genus 157
structure length 438
sequence length 438
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvvA01
2V5CA 1IZKA 5A8NA 2Y2WA 1BAGA 3O6AA 3CHCA 1EOKA 2D23A 4HZ8A 2VRJA 1QW8A 4IPLA 1H4PA 2PBGA 4DM1A 1XHGA 4LYQA 4UFHA 3PZ9A 1SMAA 3DX3A 3WUEA 3VGFA 1QHZA 4MDPA 3WUFA 3ZT5A 1BPLB 2D0GA 1GVYA 4AW7A 1H3GA 5AYIA 2CBJA 2ZX8A 1ZU8A 2XSBA 2F7QA 5BXPA 1NWSA 3EDKA 2EPKX 3FNDA 2FHCA 3OB8A 3A21A 2DIEA 1ISYA 1W1YA 1G94A 1YHTA 3LRKA 5M3WA 2WSPA 1YQ2A 3WNOA 3ZQ9A 1JXKA 3AICA 3GZAA 2RGLA 1UR9A 1XD0A 3AXHA 2OYKA 2WANA 4UFIA 1R46A 1XYFA 2WMFA 3N13A 4H04A 3GXTA 1JYNA 4WKHA 4UCFA 3BVTA 1BVZA 4AD3A 5E70A 1DWFM 1E1EA 5TD4A 3QOKA 1W91A 1EA9C 3IJ9A 3VGEA 6TAAA 3L4YA 1XYZA 2WW5A 1D7FA 2XFYA 1W3JA 4IPNB 4XB3A 3FXYA 4KGJA 3MANA 4BS0A 1W32A 3BVVA 2JEPA 2Y8VA 3J7HA 3D4YA 2J7DA 4XZBA 3TTOA 4Z2JA 3MUY1 3OGVA 3VD3A 4HPHA 4LPCA 4QFUA 3NJ3A 2NT0A 4IM4A 2OWCA 3CZEA 1TVNA 2ZUNA 3SCNA 4ATWA 4JFTA 1K9FA 1W9PA 1UR4A 3A24A 1UA3A 4ACZA 1V0MA 4CD5A 1MW0A 5AYBA 2Y4SA 2VQUA 4W89A 4MNLA 3MMUA 3DDGA 3IGUA 3TA9A 4W84A 4WSKA 2QHAA 4AC1X 1ZJBA 3WBAA 2D3NA 3LXCA 4PBGA 3U7VA 5IHRA 2EACA 3W24A 1EH9A 2G3MA 1WB0A 4N42A 1VEOA 3VINA 1UD8A 1F4AA 4P7RA 1CGTA 1LG2A 4GQQA 2O9RA 2FYVA 2ZUTA 1KXTA 1K9TA 3T09A 3VSTA 2DH2A 4KMQA 2CITA 1V3HA 4PSRA 1B1YA 3SCUA 1EGZA 5DF0A 1OT2A 2BXZA 2F7PA 1FP9A 1CBGA 2W67A 7TAAA 5D8ZA 5BXTA 1JL8A 4B9YA 1E73M 1WZKA 2XM2A 3THCA 2BVYA 2D2OA 2XVLA 3TTSA 5A1AA 3A22A 4H41A 2YLAA 3GXFA 4PCTA 4RL3A 3IK2A 4OBRA 3AMDA 3AYRA 2GVYA 1W3LA 1TQVA 2DT0A 5LA1A 1QPKA 3BAWA 1LL4A 4CD8A 3WNPA 2EQDA 1QI0A 3VIPA 4X9YA 3VKKA 1NQ6A 3CV5A 2D3LA 2DSKA 5D9NA 1QWUA 1LQ0A 2J7BA 4F66A 2A3BA 3RIKA 1R8LA 3AMKA 2AOSA 1JAKA 4WF7A 5I2UA 4AY1A 3SUUA 2YBTA 4H2CA 4M56A 1CNVA 3N15A 1UH2A 5CPSA 5JBEA 1KCLA 2C8NA 4GZEA 4D1IA 2BXYA 1ZBWA 3SUVA 1WDPA 2E9LA 1HP4A 2FH8A 3WQ8A 3E1F1 4FMVA 1ZJAA 4UQDA 7CGTA 4BCEA 3BUDA 3CO4A 1UKTA 3WY3A 3VD7A 3ARXA 2QLYA 4MADA 4FLQA 4U33A 1UR2A 3RJYA 3CHDA 3BMWA 3CBWA 5AC4A 4C7FA 2J7CA 1LF1A 2XVPA 2JIEA 2X2YA 4PYSA 3D4ZA 2WK2A 3THDA 2GK1A 3LX9A 3CUFA 3W81A 1OGSA 4AD5A 1QI4A 4ATLA 3CZKA 3WDRA 3L2MA 2BHUA 1V3MA 1AVAA 1QNSA 4HZ6A 1NOUA 4W86A 1XCXA 3EJUA 3AIQA 1ZBVA 2W4XA 2D73A 3ZO9A 3RDKA 3GXMA 4OBSA 3W29A 5A2CA 4IUGA 3ECQA 4MAVA 5HPOA 2WWCA 3LPGA 4PTWA 4OGZA 2IXUA 4S3JA 1VENA 2WC7A 1OIMA 1S46A 2CKSA 3T08A 1RPKA 3OZPA 3ZJKA 1BYAA 1ITXA 4YHGA 2E8ZA 2J8GA 1KR1A 2WVTA 1E6XM 1KR0A 1QVBA 4N0RA 2ZOXA 2EJ1A 5HNNA 4JL2A 1Z32X 1HVQA 2AAAA 3WF4A 1BYDA 2BFGA 4EANA 2WKGA 1LG1A 1UA7A 3UEQA 3ZOAA 4GINA 1UR1A 1E9LA 1B90A 4UNIA 2CYGA 1GJWA 3OGRA 4LYPA 4J3XA 2JIWA 1KTBA 3WL0A 2YOCA 3SUSA 4CCDA 2BVDA 1B3WA 1CLXA 3RM9A 3OZOA 2JALA 3W25A 4PN2A 4UQCA 4P8UA 1VEPA 1PIGA 1UWSA 4CU6A 2RGMA 1AQHA 2CERA 2Q8XA 2YDSA 5DO8A 4JHZA 3A47A 4WKFA 2PI6A 3QGVA 1DWHM 2CHNA 3PHAA 1WZAA 1UZ4A 1PBGA 2WVVA 3PZOA 1E3XA 3AOFA 3WELA 4UTFA 5BXSA 2E0PA 4GKLA 4JFVA 3AXIA 5EFDA 1MQQA 3VNYA 2PC8A 1DWGM 2D22A 1EQPA 1E0XA 4XZWA 1QBAA 4P8XA 2WCAA 1FA2A 3WQWA 2UY2A 4PSPA 2OWWA 3WDJA 2XG9A 1G01A 1CXLA 4OUEA 1B3ZA 2FE0A 4JFUA 1JFXA 2VO5A 4D72A 5HPCA 1UHVA 2X09A 3EMZA 4JKKA 1WZMA 1E3ZA 3OLDA 3RILA 4UZSA 3EDDA 3UG4A 2BY3A 3BSGA 1J9YA 4DM2A 1JNEA 4GPNA 5ABGA 3CZSA 1E43A 4AISA 2E8YA 4A3YA 4H8VA 4R5EA 1LWHA 1H0GA 5JUVA 2VR5A 4GZIA 3RPMA 3AZRA 4GI9A 2V38A 4LQ1A 3OG2A 3VMNA 3RMEA 3M07A 2WCSA 1ISZA 5D8WA 2F1BA 5CQ1A 2CESA 1Q6GA 3I3EA 5C70A 5I23A 2F8QA 1EO7A 3WH9A 4D6CA 4FLOA 1HKKA 3BH4A 1PZ3A 4E8DA 1WDSA 4CU8A 5BROA 1CGXA 4NSBA 4D6HA 2OSWA 2WMIA 3TV8A 3RO8A 1JAEA 3PZMA 1BG4A 1MWOA 4RE4A 1W2PA 5CPTA 1G9HA 5A6AA 2J62A 3AHVA 1MFUA 3PZIA 1UOKA 2ZE0A 1E1FA 1GOOA 4F79A 3AIEA 4AZHA 3WH5A 2XWDA 1MW1A 3NDYA 2ZXAA 3LPOA 1KTCA 2WVVB 8A3HA 3AI0A 2J78A 4YPJA 4JCLA 4WJXA 4CKQA 4W93A 3ZR5A 1D3CA 4P8VA 4HOWA 3VIIA 3AZSA 2CHOA 4Q7NA 5FD0A 4FNUA 3WEOA 1HJVA 3ZJ6A 1V6YA 4FNQA 5C8BB 2J8FA 4FNRA 3MO4A 1KGXA 3MMWA 3HJEA 5LA0A 1B3XA 2FHBA 1TQUA 2PB1A 1NP0A 1XSJA 5BCAA 4FF5A 3D52A 1XSKA 3SCWA 4DO4A 2WMGA 4PMDA 1SFSA 4J3UA 2PWHA 3H55A 2BY1A 2WYSA 2VCCA 3U57A 4QCFA 1CEOA 2XGBA 3SEPA 2O9PA 2CIPA 3DX1A 2CBIA 3LXBA 4DUWA 1E0VA 1H41A 1OBAA 2XVNA 4E4PA 2GFTA 3D51A 3A6OA 4W7UA 4AZCB 3GNPA 2UY3A 1NARA 2DSZA 3CC1A 4GO9A 1EXPA 5KEZA 3GTNA 4PTVA 1CDGA 1GORA 4YN5A 1P6WA 1UKPA 2XGIA 2EPLX 3SUTA 1JYVA 3POHA 5LA2A 5A2AA 4E8CA 1TVPA 1HWWA 1CGVA 5A8PA 3CTTA 1QI2A 1NWRA 5I3DA 3BCDA 4U3CA 4TTGA 3EDEA 1H09A 3RJXA 1UWQA 3ALGA 4JZ5A 4K68A 1BGAA 3AMGA 1GOIA 1XV8A 1XH2A 2F61A 2VRKA 1XD1A 2X0YA 3WMSA 3VGHA 1XRVA 4BQ4A 1JDDA 3CZJA 2CBUA 4MAZA 4MJ4A 2XVKA 3WQVA 3ARUA 2F7OA 4FNSA 2WB5A 1U33A 2XN2A 2XWEA 1V0KA 3WKZA 4GI6A 2WHKA 3VVGA 3WFLA 2GJRA 1NOWA 4M82A 4ZE4A 3CUHA 1MQRA 4NZJA 1HJWA 1HKJA 3CHFA 2ZWYA 2ZXBA 2ZUVA 5I6SA 1C8QA 3K4AA 3H54A 4Q22A 3WD0A 3FN9A 3RCNA 1HL9A 3GXNA 1C7TA 4GIAA 1HVXA 4Z2KA 1UQZA 2BS9A 4LXFA 1QI3A 1J11A 3FHQA 2WNWA 1VBRA 1GONA 2G41A 1CTNA 2ZX9A 2CNCA 4MB4A 1NP2A 4PMXA 1UWUA 1FOBA 2VC9A 3LMYA 3MSDA 5E0FA 4CD7A 4IISA 1JIBA 3AYSA 5GNYA 5CLTA 1UASA 2GJPA 3NDZA 3WBEA 2C0HA 1PAMA 2B31A 4CD4A 4GO8A 3NSMA 4EE9A 3W27A 2YFOA 3SURA 4B9ZA 1HN1A 1GQLA 3PZQA 3CMGA 1GOWA 3K46A 3WUGA 3UERA 3A4AA 3NCOA 3PN8A 4UQAA 1CYGA 3EDJA 2PWDA 2VQTA 3AHTA 3AIVA 2WZHA 2J25A 1X6LA 4Z2HA 5A6LA 3ARYA 3K8MA 1GQKA 3A3HA 4AZ6A 2WMJA 4AYGA 4Y7EA 2WC3A 3AHXA 4HMDA 1NWTA 4V2XA 1TQTA 1J0YA 2PF0A 1O7AA 3N04A 2FGZA 1UD2A 2XM1A 4XV0A 2W62A 5E09A 1J0HA 1MXGA 3VM7A 4Z2LA 2F1AA 1BYBA 1H0IA 1H2JA 1JZ5A 3WD2A 6A3HA 2X8RA 1UKQA 2J77A 2EPOA 4P7NA 3EMCA 1E4MM 2X2JA 1JI2A 1J12A 4D1JA 2X0HA 3WDHA 2PWEA 3OLGA 3ARPA 1VJZA 3TTYA 1CXHA 3WD3A 3PZUA 4PMRA 1GCYA 3CZLA 1UYQA 3LPFA 2WVSA 3KWXA 5JIPA 2ESCA 5IFTA 1E56A 4KRTA 8CGTA 2W66A 3SCOA 4E2OA 4UOQA 3OLEA 2O9TA 1E4LA 1ODZA 3MV11 4ACYA 1VAHA 3MUAA 3VUPA 5F7UA 4ATDA 4MB5A 5ECUA 1GPFA 4MB1A 3W37A 1JYXA 1UQYA 1VFMA 1LWJA 4MNMA 2WVUA 1NM9A 4U3AA 1FH8A 3A4XA 1JF5A 1OD8A 1W9XA 4KRUA 3VIJA 5E6YA 1UD5A 1AMYA 1HF6A 2XYLA 1Q6FA 3WSUA 3A5VA 1PJ9A 1UZ1A 2BY2A 4DWSD 1FHLA 2IGTA 3OBAA 4W8BA 2WPGA 4M1RA 4U5IA 4NZFA 3VX1A 1KGWA 4RE2A 1W1TA 2YFNA 2HVMA 1JZ4A 3BSHA 3ZT7A 4M24A 2QPSA 1BTCA 4U2ZA 1Q6DA 1E0WA 5DT7A 1J0KA 1GOQA 4CCCA 1Q4NX 4HPGA 2XFFA 4P7QA 3BUQA 4C7DA 1G5AA 1UKSA 2VZSA 1KCKA 1IT0A 3BAJA 1QNOA 4ZE5A 3BUPA 1V3KA 5CSUA 2VX6A 4TX6A 4KGLA 4JKMA 1TA3A 5A3HA 2J4GA 4UQEA 2FGLA 4CU7A 1C8XA 2XIBA 5CSYA 4BQ5A 4X0NA 1E72M 1NWUA 3T2OA 4U31A 3DECA 2DQXA 3FAWA 4D71A 1OINA 3SIMA 1RP8A 1QWNA 1RP9A 3ZJ7A 1V3IA 1HX0A 4TVUA 2AMGA 3UG3A 4MNJA 3VD5A 1XSIA 3EBVA 1XH0A 3WIJA 2WLYA 4NX0A 3KL0A 4W88A 4TVCA 4OOZA 4TXEA 2GUYA 4DUVA 2PBOA 1CPUA 5A6JA 4UR9A 1GW1A 4NI3A 1C8YA 5D9MA 3WH6A 3QHMA 3IJ7A 3L2LA 1MFVA 4CGTA 3F5JA 4AZIA 4D6GA 4HP5A 4W85A 3WNKA 3NYDA 5JBDA 2VURA 1OM0A 2VZUA 3BC9A 3LXAA 1ECEA 4P8WA 3ZMRA 3BUIA 5I24A 1W3HA 1XGZA 3CGTA 3AFBA 1V6WA 1GQJA 3TOPA 1QNPA 4HTYA 3S6TA 3ARRA 3N17A 4W87A 3AHZA 1B3YA 2XSAA 1JZ6A 1TR1A 1OSEA 3K1DA 3CLWA 4JIEA 1K9DA 2YDQA 4OJYA 4PUEA 2YL8A 2VZVA 4AD1A 3M6DA 4LYRA 1B0IA 3WH8A 3W82A 5LYRA 4R27A 3GBDA 4XUYA 3VILA 6CGTA 4YHEA 5A6MA 5C71A 2E9BA 3ZJ8A 2QV4A 1M7XA 1F4HA 7A3HA 1WO2A 3WF0A 3VDAA 3WQ5A 1L0PA 4PMUA 3VTRA 1TG7A 1FHDA 3CZNA 1CGYA 4CD6A 2GJXA 1QI5A 3AZTA 1BLIA 4MPKA 5I5RA 2VT0A 3HG4A 3LPPA 1IZJA 4AD4A 2DT3A 1C93A 1KGUA 2JFEX 3DHPA 3D50A 1W1VA 3AROA 5JBFA 4PMNA 5HDRA 2VI0A 5E9AA 3GYCA 4FK9A 1R7OA 3B9AA 4B3KA 3VIOA 2XFRA 4PMYA 2W63A 2WMKA 4M80A 4UFKA 2W91A 2XPKA 2OW6A 2X05A 1QW9A 4DUXA 5JIWA 1V0NA 3WMBA 4AYSA 3I3BA 4HZ7A 3LRLA 3H53A 5A94A 2QF8A 1TQWA 1J0IA 1HL8A 1R85A 4BA0A 1E55A 4D6IA 3N11A 2C7FA 3HG5A 3NUKA 1CXIA 1X6NA 2WSKA 3DDFA 3AIUA 1AQMA 3VO0A 1VFFA 2V3FA 4DWSC 3F4VA 5AC5A 1HKMA 1C90A 4ZXLA 4UOZA 3CMJA 1R33A 3ZSTA 1WDRA 1KXVA 2V5DA 1KXHA 1WE5A 3WY1A 3CZ8A 1UWIA 2D0HA 2EO7A 2VX4A 5IXEA 2VX5A 3CIVA 4C7GA 1EDGA 1C3FA 5D9OA 2G3NA 2FHFA 4FNPA 4AEFA 1H11A 2DSWA 3CHEA 2UY4A 3M46A 3S5ZA 3VIGA 3O9NA 3BGAA 1UD4A 2Z1KA 2WXDM 1FH9A 2JF7A 1SMDA 2X2HA 3VD9A 1C7SA 5DFAA 3WN6A 3WL1A 5IFPA 1HIZA 2W61A 1E5NA 3BLKA 4EAMA 1TA3B 3GXPA 2E4TA 3FW6A 1B30A 4MNKA 5DMYA 3PZNA 5DEZA 3K4DA 1E4IA 1HJSA 5AY7A 2QPUA 3AS2A 1NOFA 1OWQA 3ZT6A 2V3EA 4CVWA 1D2KA 4UOJA 2OSXA 4M29A 2XN1A 1DHKA 1WCGA 2DSUA 1OD0A 3W26A 4Z2IA 1UG6A 3OLIA 2ZUMA 4QP0A 2XVGA 4PTMA 1JXJA 3CZGA 5FKYA 4H8UA 4ML4A 3GH4A 2X1IA 1TZ7A 3VGBA 3MMDA 1Q6CA 1UD3A 1PZ2A 3BAKA 4TX8A 3ZR6A 2G8ZA 1QX1A 3PBGA 3WY4A 1H5VA 4A4AA 4EKJA 1E71M 4MDOA 3W4RA 1W9BM 3SCSA 1V6XA 4ZENA 1MQPA 1VFUA 2J7HA 1HXKA 3IAPA 1VIWA 3SCPA 1PEZA 3AXXA 3BVXA 1BFNA 3BAIA 2ALWA 4PMOA 2QMJA 2VNCA 5ABHA 1OIFA 3L4TA 3KL3A 2J7FA 5FL1A 3VSUA 2DEPA 1FP8A 3GH5A 4AMWA 4EK7A 1R86A 1XC6A 3DYMA 3DHUA 4ZFMA 2WAGA 4RE3A 4B15A 3GBEA 1BG9A 1JZ3A 2D24A 3ARQA 1VEMA 4DO5A 1US2A 1WKYA 5CG0A 1QNQA 5DT5A 3TP4A 1E6QM 3POCA 2DDXA 1LL6A 1GHRA 4QLKA 5EB8A 5A6BD 4AIOA 3O2LA 2XHYA 2DGAA 3HG3A 1KFWA 2WZIA 1CXFA 4JFWA 4KWUA 2WHLA 1PX4A 3QOMA 3SCQA 1HJUA 3BLBA 1JGIA 2YDRA 3II1A 5A69A 1K6AA 1MVYA 2J7GA 3T0AA 4J3WA 1ESWA 1PX3A 1B3VA 3EMQA 1WDQA 1JZ2A 3SCRA 2A3AA 3KE0A 3L4ZA 5CGTA 2WHJA 1UKOA 3D5HA 4PMZA 1RH9A 2EBNA 3HU7A 1GHSA 1OGGA 1CXKA 4BQ3A 1M03A 3OA5A 3VU2A 2CKRA 3VDHA 1O7DC 2TAAA 1MXDA 2QMKA 4D6FA 4NZCA 1J18A 2F7RA 4W5UA 2BHYA 4H7VA 1E4NA 5ABFA 2DSVA 4JL1A 3MS8A 4QLJA 1TQSA 2DH3A 1R87A 2BHZA 4H8HA 2J74A 5EMYA 2CPUA 2GSJA 3VM5A 1Y7VA 1HNYA 5A2BA 4HMCA 3BAXA 5ABEA 5BRPA 4PUDA 1V08A 3IJ8A 1TCMA 1V02E 2EABA 1QBBA 3F5LA 4QAWA 3A23A 3WENA 1UH4A 2YA1A 3UCQA 3G6MA 4AMCA 1MYRA 1GNXA 2GK1B 4UQ9A 3VIKA 5GQBA 3VOCA 1KQYA 1ZB5A 2VX7A 5CJ5A 1O6IA 5I77A 2OYLA 3BUBA 1UR8A 4DO6A 3AIBA 1CXEA 1JDAA 2OW7A 3WQ4A 3B8SA 1GZJA 3K8LA 3N18A 4OIFA 2UWFA 1BSIA 1EO5A 2ZUUA 2ZUSA 4U2YA 2ZX5A 2WWDA 4F9JA 1CWYA 4W8AA 1MW2A 3WF2A 3VIHA 1JDCA 4Z2GA 2WC4A 4GQRA 1R75A 1BYCA 3W6LA 3U5YA 2WM0A 2YBUA 5FOOA 1VRXA 2VUYA 3MSGA 1TFVA 4AZ7A 2E40A 1ISXA 1AQ0A 3TTQA 1GOMA 2EPNA 2XJ7A 3AS1A 5A6BA 4HU8A 3W6MA 2WCGA 5HBFA 1DWAM 1KQZA 3MUIA 3CH9A 5CLWA 3MI6A 1JZ7A 3VGDA 4TTUA 4JKLA 4AMXA 1CGUA 1HT6A 2ZICA 1EQCA 3HMCA 2F18A 4HA3A 5EBAA 4J3TA 3WNLA 3WF3A 4AZCA 1CENA 1GJUA 5M03A 5I0DA 3L4XA 2MANA 3NSNA 2XIIA 2CXGA 3PTMA 1W9VA 1J0ZA 3AIWA 2VOTA 1QNRA 1VF8A 3VX0A 3WDPP 1UWTA 1DP0A 1W9DM 5E1QA 1E6ZA 2YA2A 3GNOA 3EJRA 4MB3A 4UFJA 3AMLA 2BV9A 2ZX7A 2WBKA 4UQBA 1BQCA 1I1WA 4D6JA 2Y24A 1KBKA 1KWGA 3DYOA 3UR8A 3GDBA 1V6UA 3BAYA 4PEEA 3HZ3A 2PWFA 4V28A 4LGXA 9CGTA 3VSVA 1JD9A 4ACZB 3WQ6A 4A3HA 1HXJA 3ARWA 3AS0A 3DYPA 5BRQA 4ZEPA 1VBUA 2G3JA 5M5DA 2Z1SA 5I78A 1X1NA 1E6RA 1JG9A 3PTKA 4F8XA 3T0BA 4MTVA 1ISVA 3WDIA 3EDFA 1V02A 2O9OA 3A4WA 2D20A 1UH3A 3CPUA 1SR0A 4W5ZA 1EDTA 4X0VA 1HKIA 4CN6A 2VZOA 3EJTA 1PIFA 3KEHA 3EYPA 5EFFA 5HOSA 4MJ2A 5CXPA 3WFZA 1R34A 4D6EA 1E40A 1HTYA 1OCQA 3BCFA 1PPIA 4B16A 4PTXA 1BGGA 1DWJM 5GNZA 1DTUA 2G3IA 2V3GA 3EJQA 4GI8A 4U5KA 4HU0A 3GM8A 1V0LA 4GZJA 2F2HA 3UETA 2EPMX 3VPLA 2VMFA 2OYMA 3U5UA 4PCSA 3OGSA 1B31A 3WEMA 4TOQA 1J10A 1E70M 1CIUA 3HG2A 4CN1A 4JCMA 4M8UA 1LL7A 2DT1A 4PMVA 3GH7A 5KZ6A 3VDCA 3U7BA 3TONA 2A3CA 1QHPA 3ALFA 1UR0A 1US3A 1UUQA 2WHMA 1G1YA 2JE8A 5M17A 4J3SA 3T0DA 2Y8KA 1LLOA 3SUWA 3W38A 4QLLA 2WKLA 4PRWA 3UR7A 1BHGA 1JFHA 3ZM8A 4JAWA 1FFQA 2A3HA 4NXSA 5GPRA 3AJ7A 1PX8A 3AHYA 4CVUA 3NSXA 4M81A 1DEDA 3L4VA 3AQUA 4FLRA 2E9MA 4NF7A 2VL4A 3LRMA 4P7LA 1EOMA 2DT2A 2BVTA 1OT1A 3WNNA 1K9EA 3GXIA 1E6NA 3VMPA 1UD6A 1WAWA 5FIPA 2VR4A 1NH6A 2J7EA 3W28A 1E5JA 4J7RA 5A8OA 3APGA 4ZXOA 1A3HA 4KH2A 2YIHA 1XH1A 3AIRA 1T0OA 4OZOA 3VMOA 2CEQA 5A8QA 2CCRA 4CCEA 1M01A 1FH7A 1ZBKA 1KXQA 5D4YA 3GXDA 2VRQA 3MV01 2YJQA 1EDQA 3VGGA 5IHSA 1B2YA 3WEZA 4FLSA 4J28A 3WUBA 1WZLA 3W53A 2VJXA 1VB9A 2YKKA 3IAQA 1ODUA 3F5KA 4AD2A 3VIFA 4GXPA 3RM4A 4URIA 3QHNA 3IANA 4W7VA 1EIBA 4BF7A 1TUXA 1R47A 3WDQA 1GQIA 3PZVA 4CN4A 2XN0A 2D0FA 3BVUA 5CPQA 1IV8A 2ZWZA 4FNTA 1CGWA 1G0CA 1B9ZA 2IUZA 1OGBA 3PZGA 1TE1A 1WNOA 2D1ZA 3CUIA 1MW3A 5E6ZA 3MUZ1 3AS3A 1E15A 2JEQA 3KLKA 5FL0A 2OLHA 3D3AA 2ZIDA 3WNMA 3PZTA 1ZBCA 3WY2A 1GOKA 3DX2A 1UWRA 4AWEA 1CZ1A 1N82A 2GDVA 1H49A 4BQ2A 2ZX6A 4TUFA 1RD6A 2UY5A 3B9EA 2VTFA 1ISWA 5BYWA 2YLLA 3ZIZA 4NXKA 2J47A 2EEXA 2XTKA 3UG5A 2VCAA 1I1XA 2WLZA 3K8KA 1JI1A 1JD7A 5A6SA 1WPCA 1QHOA 4L4PA 1WP6A 1GUVA 2ZXQA 4J27A 4NRRA 4QDMA 5A8MA 5FCZA 2V3DA 5GNXA 3OIHA 4AZBA 3BVWA 1JZ8A 3DC0A 4NRSA 4OOUA 2CETA 1SYTA 3VDBA 1ZS2A 2X2IA 2ZXDA 1QOXA 3M7SA 3N1AA 3S5YA 1V6VA 1HJQA 4HOXA 4AIEA 3KL5A 1M53A 3I3DA 4DWSA 4JHOA 2CBVA 3UESA 2DPEA 1U30A 5IDIA 3SCTA 2YA0A 1JF6A 3AISA 2ZUWA 3KZSA 5I79A 4AIUA 3MKKA 1C92A 2NT1A 3S2CA 2J79A 1W2VA 2O92A 1I75A 3WH7A 5BWFA 1CLVA 2EADA 3CUJA 3BMVA 3VIMA 1H1NA 4AEEA 1KBBA 3DX4A 3ARTA 3G6LA 4AD0A 3T2QA 1E6SM 1ITCA 2EXOA 4UFLA 5CZKA 2YL5A 1L8NA 3EJPA 1PS3A 4BZYA 1SZNA 3JUGA 2J75A 3WMCA 3ARSA 4J3VA 5A6KA 3HN3A 1VFOA 1CECA 1ZL1A 3DX0A 5BXRA 2FDMA 1KWKA 4W8LA 3QHOA 2G4FA 2W5FA 1J0JA 5HXMA 4S3KA 4P7OA 4XX6A 4B3LA 1JNDA 2NSXA 4L4OA 3T2PA 3BXWA 1Q6EA 1V3LA 3EJSA 1JYWA 2BY0A 2PWGA 5ABFB 1GVIA 4CUCA 4HMEA 1BF2A 2A3EA 3FAXA 4JFSA 3PTQA 2VVNA 2E3ZA 1TMQA 1M04A 1OB0A 5CGMA 3ARVA 2JF6A 3WD1A 4TVDA 1R7AA 2DIJA 4PMQA 4AZ5A 2OSYA 4AXNA 2NW0A 4AZGA 4UFMA 3KLLA 2W92A 1HJXA 3AMCA 3N9KA 5D9PA 4F9DA 1V3JA 3SCVA 1J01A 4WIWA 3WF1A 2WMHA 1V03A 4HOZA 2VCBA 1EHAA 3MU7A 4WKAA 1HP5A 1W3KA 3N12A 1W1PA 2WZEA 1EHNA 3VNZA 4WK9A 4QCEA 4DWSB 4WLCA 2WMIB 1FFRA 3B9DA 3NIYA 5E0CA 5A95A 2OWXA 1KB3A 4D6DA 1W9UA 3WD4A 4HA4A 4OKDA 3ZSSA 1LJYA 1VJSA 1U2YA 2IXVA 4V27A 1BVNP 2VVSA 3BLPX 2GJXB 3L4WA 4W7WA 2Y5EA 3RM8A 2GDUA 2YL6A 3W0KA 1C91A 1XCWA 1DWIM 1E6PA 1A47A 4LX4A 3QR3A 3FY1A 2HISA 3GNRA 3VD4A 2XUCA 2VZTA 2FH6A 3L4UA 3CUGA 4HA1A 2WBGA 2YL9A 4UZUA 2EAEA 4WSJA 3ARZA 3FHAA 2BNJA
chains in the Genus database with same CATH superfamily
1AJZA 1IZKA 1P7BA 3FO9A 1I9IL 2Y2WA 4XPHL 4FF7A 1INQA 5I0ZA 3O6AA 4JTSA 1XF4A 1BD2E 4Q9BA 1EOKA 3H2PA 1Q8JA 3MV8E 1EFXB 2MCMA 4BIKA 3D8MA 1T2JA 1ZA6A 4WV1B 1A5BA 3QN3A 2Y1AA 3WUBA 4DM1A 4F8PA 3LRSB 4Z7OB 4DVOA 2XBTA 2VR9A 1JCVA 1J5TA 3OKLB 5DMGD 5FR3A 3PWVA 2PE4A 3C6LB 2FQDA 1ZXKA 4GBXA 4BUQA 4NCC1 2JBMA 1EJ6A 5KTLA 2Z31A 1ROWA 4E2VA 1Z5HA 2GEEA 2MQCA 3QFDA 4LDLB 3SY0B 3VQ1C 1QHZA 2OKOA 4UV4H 3DU0A 5EBUA 2JQMA 1R9ZA 3KPSE 4HW6A 4NN7B 4IBQA 4WUUE 4XPBL 2FVNA 3FMGL 1SZGA 2OR2A 4QNWA 1LP9E 5AVTB 1IYXA 4X6EB 1AZCA 3QQ9D 1KXQE 5DGRA 4LAZA 3BQUB 4XAYA 2CBJA 1MDRA 2I7SA 3GSVA 5F9JA 4GABA 2TSBA 5AB1A 5T5FA 1B0RB 1XCQA 4TN9A 2F7QA 3GI8L 1KJMA 5SWZD 3UTQB 2NLYA 3FJ6A 5HUPA 5HGAB 5BXPA 1CG9B 3OW1A 5ECVA 2WXOA 5JPNC 1SEBB 4C47A 1IEIA 3E02A 2NY5C 2N01B 1G94A 3CAFA 4KK9C 5JXAL 5FYLE 1RPXA 1VESA 1MG3C 1W3IA 1T04A 4JTUA 3FQ1A 3KCOA 4O54A 4X8JB 3NZQA 5M3WA 5I74B 2WSPA 3WJJC 3U7YH 1KN4L 4FS0A 1OHLA 2VERA 4M93C 5MHBA 3RHGA 1G9MC 2ZSWB 1LNUA 3U30B 3HM7A 5JH1A 1HIMH 4GW4B 3AXHA 32C2A 4KK6D 4IMCA 4JIHA 3LQZA 2MJWA 4PV8B 3UZJA 1OC5A 1RU9L 4AHPA 3W85A 1QSEA 4XCCL 4HK0B 5IQ7L 1UROA 3ZVHB 3CL8A 1R46A 1AG1O 1XYFA 4DBEA 3LLDA 3OHXC 4LFHD 3N13A 5DRZA 5M94B 3B3DA 3P9MA 5DD5L 3GXTA 4HKJA 5GS1A 4H04A 5HHXH 4UINH 2W9MA 4WKHA 4AD3A 2X4NB 5CJXC 3RB5A 5A7BA 1IEBB 2FKPA 1XB3A 4QX4A 4IJ3B 1GKRA 3R7RA 4JTCA 4KAQH 5C9RA 2IFFH 4HIJB 4OY9A 3VI2A 1E5UI 3FFOA 1BMWA 3NQEA 3TH6A 4JO3H 3HZYB 3L4YA 4CGUB 2HPIA 5HULA 2JMRA 3O06A 4DF0A 1RZPA 2R7EB 2VN6A 2HTLC 3EH5B 2WO4A 3L4CA 1OAKL 3QDGD 3QEHB 4KGJA 3RIAF 3BLEA 4XN2A 4MKNA 4XMKH 3A4JA 2NY1C 3LM7A 4AUUA 4IX0A 2FQEA 3BVVA 1JHKH 2VL5A 4PRIA 4Z2JA 3TTOA 4F58H 4LF3B 3GSWB 4TUKH 3MUY1 3OGVA 3WLRA 2EH7H 1EPVA 2C3XA 3TX4A 4NL1A 3U36B 5K9JL 5TPWH 2OEKA 3LV5A 2EDKA 4PCYA 3W1RA 5F8RC 4B2DA 2BSTA 2ZUNA 6ENLA 2UV3A 1QATA 3BQ5A 4X9HA 4NYLB 4YHMH 1DLHA 1UIPA 5DURD 1WEJH 2UUDK 2XH2A 3A24A 3O3AB 2XV6B 2HX8A 5C08B 1V0MA 1WEJL 2BMKB 4JQAA 4UF7C 1PU0A 4UUJA 5K69A 1MLCA 4PODA 2LU3A 5KG9B 3DETD 4UYQA 1OF6A 1XF4B 4ZMVA 2KHAA 3IDIB 1IWPA 4MNLA 2G2NA 2VDMB 3WN5C 4BK5A 3TA9A 3HG0A 2AZUA 2JKPA 1J6PA 4WSKA 3U7VA 1GW9A 1TCDA 1K8DB 4WGXA 4FIQA 4P3WA 2GSIB 3QR0A 4ELMB 3WG7B 4UZGA 3I6RA 3WBAA 1U3NA 2D3NA 3TN0B 1AUSL 2ODHA 5I0VA 4IXHA 5IHRA 2EACA 3LQZB 1VYPX 4KDWA 2HRWA 2G3MA 4AIBA 4ODHL 4Z0BL 5I7GA 4IBSA 4OZHE 1XF5A 2VN5A 2INFA 1SFLA 1SUHA 3ZIYA 1P0DA 2INZA 3FQ2A 4M1GH 1MPAH 3TJLA 3I6GB 2JIXB 4ZW8A 3WEXB 1A6WL 2X28A 2FYVA 2IAAC 5LG6A 2EUZA 3SDXB 4KF1A 1HEHC 2ZUTA 3BT2H 3C8HA 4XNBA 5DS2A 5IROC 2XY2A 2VUKA 5CN3A 3BGFC 3AYVA 3NG5A 3VSTA 4LJ3A 5MHSD 3SKMA 3GDTA 1RLCL 4LUJA 1F3JA 3MV7E 4A6YB 5K5YA 3JV6A 5E8OB 5JIHA 3A4EA 4AVJA 1KLFB 4H6EA 2LTQC 2AXGA 1NC2B 3MV9A 4GOSA 1B1YA 1USQA 2Q9OA 2TSAA 4LLVB 5DF0A 1AANA 4ZOCA 2NPLX 4YDKH 5FYJH 1V77A 4DQWA 1SR9A 4RZKA 1A6AB 5D8ZA 3BO8B 3KBPA 3PJSA 1QDSA 4OUIA 2D3JA 3ME0B 5FYKD 2XM2A 4GUFA 3R8QA 3TR2A 3T2NL 2LFEA 8PAZA 5IW6A 3WL9A 2D2OA 3MV9E 4L5FE 4CSPA 1LE9A 3S4TA 4KI1A 3Q05A 3W70A 2I5YL 3GXFA 4PCTA 4RL3A 1BDYA 3W1ZA 3RRXA 4ZQKB 4QHNB 1QO3A 5K9JH 5TDPA 4POUB 2BW5A 1TIWA 3SKNB 2DZBA 3GTTA 2DT0A 3MMEB 2WLIA 4ML4A 4G1EB 3T6WA 3RPDA 4H9XA 3WQOA 1EZLA 3IU4H 2AGJH 2WQWA 1S3HA 3QH3A 1ANUA 2NLIA 1HHGA 2ZCKH 4R4FL 5CBEA 1AJ2A 4N2LA 1UUSA 5AL8A 3MRIB 1T1WB 1I8MA 4FOKA 4YS1A 1M7IA 4L29B 5AVXB 3KH3A 4GYBA 3CWHA 3RU6A 2D3LA 4W9DC 3ULUF 4MYWB 4PV9B 2J7BA 4AI7A 5GJMA 4E42B 3ISWA 2D2GA 3UPCA 1JGDA 2O6FA 4PW9A 4U1NB 3RIKA 1IF2A 1R8LA 1E65A 3HVDA 2QFPA 2YWZA 4ONHA 3K5XA 3EXLA 2X4OB 5AW6B 5D5MA 1O66A 4A1RA 1NPJA 1RZ7H 3FB6B 1Z48A 1MI3A 4MD0B 3GMMB 3GTXA 5DJXA 2YLKA 5IFJA 3NQVA 3MNVA 3VKAA 5I2UA 1BJ1H 1OGAD 2FSDA 4PY8I 4PYHA 5E8OA 4ZX4A 2IBGA 3KVMA 1NZRA 3NR0A 3MZ2A 2ZUXA 3X13A 1E5YA 1UH2A 2H32A 1MFBL 2YPLD 1TV8A 3S1VA 3LCIA 3F7QA 4KRNA 1II4E 1NICA 1P2CA 1Y6NR 2YUXA 5E5UB 1JVNA 3GLCA 5CPSA 5FUZL 3V4PB 4X6DE 3QWOA 4MNGB 4AMKH 1U5VA 3TE9A 5JBEA 1IGFH 2C9RA 1GVOA 1L9SA 2H45A 2V4LA 2EZ0C 1QYGH 2QGEA 5D7SH 3SOBH 1E8ZA 4OB5H 4OZGE 4MHBA 3HURA 2DQGL 1JZJA 4HD9A 2BXYA 4DWDA 1U8PB 2HKAA 3UBXG 4U4BA 5GGQL 1WDPA 3D6NA 4OB5L 2X9XA 1UP0A 4FXJA 1O7DE 4PMJA 3T77B 5IBLC 3E1F1 4FMVA 4IFKA 4ONGH 1ZJAA 4MWFB 3QS3A 3GKWL 1MUMA 1OX4B 2DVUA 1XYAA 2E6FA 7CGTA 4M6AA 1AGFB 3KTCA 4G6CA 4LVBA 4INFA 5G5DB 1EXBA 1QSFD 4IMDA 3TH2T 1Z7AA 3WY3A 3L9BA 3OJVC 2K78A 4C8XA 4NC0B 5JMRA 1NMAL 1ORQB 5AAMC 1AGEA 5FJTA 2H9GB 2HNHA 2BM3A 4X22A 5CBAB 1FAIH 4X42A 4MFEA 1QKZH 4UNLA 5EYWA 2I60H 5IVXE 2Z31C 3O45B 5KVEL 4DJDA 5H2BB 5DJ0B 1SW3A 2J20A 2LLGA 3SPIA 1MMFA 2J4WL 4HQVA 1LF1A 2IH3B 3NGBB 4XTDA 4JAMA 1OG0A 4F7PA 3DERA 2JIEA 3AUWB 4XR8C 1X97A 3D4ZA 4ZZFA 5L2KA 3THDA 5DRNB 3M1CA 2GK1A 2P53A 3RNDA 4YDNA 3USZA 1KNWA 4JIQA 1A25A 1OGSA 1HO1A 3AAMA 3WLOA 5AHLA 4XVOA 1LTXA 1NIAA 2Y5SA 1MQKL 3CZKA 1JPFB 1ZVHA 3T6QC 3OYZA 1VBHA 2VDPH 4Y16A 3W83A 3FKRA 2INEA 5BPPA 4C91A 4NQDB 3RTLA 1MN4A 1TETH 4UXDA 1ZBVA 5AC8A 2D73A 4NN6B 4KK9D 5C0JA 4ZQMA 1PD1A 4GQZA 5F89B 1NIEA 3DSNA 3P2DA 1BECA 3MREB 3ARDD 4MTMA 5IESH 1LEIB 2YYUA 4HGKC 2O5XH 3AWFA 3GXMA 2Z1VA 3QEUA 4OBSA 4B5NA 5C0QA 3IXTB 3D3VA 3DV6B 5CJOL 4NQSB 2QVNA 2X88A 3IEBA 1ONQA 4MAVA 1NFGA 2P46B 4FZ8L 4GNJA 5HPOA 4GZEA 2PMQA 3HZMB 2WWCA 3W2MA 2DJ4A 2PFHA 1PS9A 2Y61A 4TRPH 1FDYA 1UYWL 4S3JA 1TLKA 3WS3B 3W7NA 1W0VA 3UC0L 1OIMA 1M42A 2LE9A 5DT1H 5E03A 5H37H 1S46A 3RY5A 2DQCL 4E9WA 5HJBA 1RPKA 3NGFA 1UYWH 4U1KA 2Q6WA 4FSAA 5LBSA 1XL9A 4ZBJA 3G9AB 2V2CA 3CC5A 3RUGA 1JF1B 3N1PC 4CQ8A 4CEXC 4UTAA 2H3NA 4YHGA 1G7LB 2NY3D 3SO3C 4JM2F 5C2XA 2J8GA 2YAMA 3ILDA 3FT3A 4N4PA 2YXOA 4TX9A 1E6XM 4WNQA 4IK6A 3CIWA 2IH8A 1JMZA 3ZXWA 1QVBA 4N0RA 1CWVA 3MFFA 4ZODA 2NV9A 4PJHF 3MRQB 4P8QA 4XO9A 2XOTA 2AJYH 1FSKB 3O6KH 3QFJA 4L4TA 3SDAA 3GUTA 4RLIA 3RKPA 5AOUA 4DZIA 2G97A 4WO4D 4ZNEA 3QQ1A 4MSSA 3IT8D 2H3KA 4MBOA 4AYDC 1NPNA 1BYDA 1H7RA 1DLHB 1HHKA 2HS6A 5IBUG 2WKGA 1L4IA 2F53E 5KBNC 1QG3A 3S0CA 1A80A 8RUCA 4G8FA 2BNQE 2M8XA 5L88H 4ZMYA 1B90A 1U3HC 2HJKB 3TYGL 4RW3A 3FT3B 4UNIA 3U2JA 4HYTB 1ZTXL 3G08A 4LYPA 2Y69B 1MFEL 4K3DH 4F7EB 4QTHB 4DJED 5FFOA 5B38A 2JIWA 1ZHNB 2YOCA 1Q7MA 2RJHA 1NBYB 4YDIH 3QT2A 4XVTH 1WLHA 4BSVB 3FSAA 3OZOA 4DPBX 4A05A 2JALA 1DQTA 1FV1B 2DWEB 2GGHA 4G2AA 4N90E 1W54A 1RI8A 2P80A 1QR7A 1AQHA 2BSDA 3RVXD 3TO4C 1ENUA 4K0OA 2FIKB 1HH9A 2WXFA 3P0GB 1E30A 1RVFL 3HMWH 5FS5A 2YDSA 5G1MA 5DO8A 2PI6A 3ABGA 1IM3B 4NAMA 1G7MB 2FB4H 2VSMB 5KSAD 3WHXA 3QLLA 2CHNA 3PHAA 4HBCH 1UZ4A 2E6DA 1C9WA 5AZ1A 3AOFA 6XIMA 1J8SA 4UT9A 3O3BA 3WQGA 3RZCC 5C6MA 2B15A 3K2KA 2ZXGA 1KTLA 2J1XA 5B1JC 1K7EA 4QOKD 1XLLA 1E4HA 2OM5A 1ZAHA 3EWBX 3NZRA 4C57C 5J12B 2BCKB 1UC5A 2XU2A 4LFYA 5BNKA 2WXQA 5GGVH 3L3KA 1IR1A 5JPNA 3WJLA 5C0EA 5J04A 2NVDA 4OF6A 5EFIB 1XR9A 2UBPC 1ITUA 3B9NA 1K3UA 5JLZB 2IANA 1I9RH 2QKFA 1HINH 1SN5A 4FERA 4G9DB 4JNMA 3LXUX 1EL3A 1CXLA 4KJYB 4EIZC 4OUEA 5M95B 2ZADA 3DN5A 2Y62A 1W3TA 5C2GA 5TQ0L 4L0ZA 3KPRE 4NQXA 4RDBA 1G1CA 4GEJA 2CMRH 4JFUA 5BQ7A 2XLLA 3EXJA 2ODOA 3STCA 4B5VA 4D72A 4NC2B 1UHVA 3QM3A 2PO6C 2AI0H 4XBKA 4MNQD 4JKKA 3VFVB 1EDYA 1XX1A 5G2HA 2HB0A 2P3YA 3EDDA 2QPEB 4NIYE 3BSGA 3M8OL 2GB2A 4CVZB 4BELD 3GFUA 3CC5B 1MI5B 1OZTG 1SLVA 3RUGB 4JJ5B 3W9DB 3U2CA 4O8RA 1OW0C 4HX1A 1FCBA 4GXVH 4LL4A 3AREC 4W9KC 1J5DA 3E6HB 1R9XA 4A3YA 2MCAA 3RWFB 3NQFA 1E5AA 1WUEA 1H0GA 4AY0A 3MACH 4LSTH 5IJKC 1DO5A 3PWPA 2EO1A 4K9EC 3I02A 3KGRA 4NM4L 4Y88A 3GHEL 1FHVA 2A5HA 2ZPKL 3HV8A 5DJ2B 3G6JE 3ETSA 5IBXA 3DPDA 3O8XB 4YH6A 4Q8PA 1NAKH 4XNMB 1G0DA 4UQ3A 2UXGA 5BZDB 3QQ3B 4GRLD 1EF3A 3JWOH 1UQSB 5DHYA 2E7HA 4YAQB 4MRBA 5BO0D 4A2SA 1IJNA 3LA4A 1L5GB 2ZDRA 1EEQA 1RLBA 1YJDL 2G60L 2GITB 3N06B 4MZ3A 3ASWA 4LT7A 4PCKA 4Y5VB 4Y9CA 3NEVA 2QBWA 2F8QA 2CE6A 3F84A 3WIHL 4PJIE 1XDLA 4TNVF 3TESA 4U4MA 2A1WH 3T8XB 1HKKA 3NTYA 3EG9A 4NO5A 1C08A 4XVSL 4E8DA 4BQBA 3ERXA 1WDSA 1T0MB 1TPVA 3E9TA 4JTTA 4ADTA 4M1CD 3LV3A 3KXFA 4JYFA 3BZFB 4YTQA 2WMIA 3TV8A 1SY6A 3ATYA 3MRCA 1GOXA 1JAEA 1CL7L 1JZIA 3L1FA 3PZMA 1DJXA 2BZNA 2CO7B 4KFPA 1LUCB 4DO7A 1XPYA 4NFBA 5F6HI 4OU1A 1DN0A 2O0TA 3UA3A 1FL5A 5HUOA 4DIAA 4OFCA 3DX8B 4GVIA 3ULUD 1P2CB 2WUCH 3F12B 4RE4A 3UXFA 2J62A 1WH0A 2Q2EB 1MFUA 5GJPA 4M4RB 2BERA 4ETQB 3X11B 2GT9B 3LUTA 3PZIA 4Q7DA 5DRXB 3HS9A 1EMTH 4NNCA 3BKJL 4N2HA 3NVTA 1JE6A 1UM5L 4K9EL 1EGVA 1GOOA 3R10A 3BG9A 4K5OA 5DELA 1TLMA 4O0ZA 3W01A 3WH5A 2VDQL 1BQLH 4N8VG 5TQLA 1IWAA 4UTAH 1KEML 2ZXAA 4L9LC 2DZAA 3W88A 3LPOA 4O58L 4GW1A 1KTCA 4WFEE 3RWGA 3S3DB 1OX5A 4AENB 3G6JF 3LQGA 1AXSA 4UQ2B 4BDVB 1U8PA 5IFHH 5H37A 4CLMA 4W93A 1BZ9A 1HZHL 2GIYA 3ZR5A 4DW2L 5IROA 4P8VA 4I7VA 4HOWA 1IBYA 3SHSA 3N3TA 3QXBA 5IVNA 3KYKL 1FFPB 3VIIA 3NO3A 5I3FA 4OM1H 4LHUG 4YBLC 2F38A 2DYPB 1X4ZA 1FYTE 1XB6A 2JJVA 2K1MA 2YEVB 2ZQKA 3RIFK 5AOIA 5HYJA 3FOMB 3L81A 1O5XA 3P9WB 5IJDC 1I4FA 1XDMA 4EUPB 3GJEB 1HJVA 1QAWA 2EIMB 2ZPKH 4ABWA 3RG1C 5FF6A 2VLJB 1MNNA 3L95B 3NJFA 4BCZA 4L1GA 1AI1L 4NQUA 4ML9A 1X5MA 1E4XL 1TZGH 2XQBH 3S42A 1EP1A 3TEVA 3CAQA 1TTGA 2Q2LA 3C09B 2GG1A 4X6CB 2X4TA 3SBWA 1E4XH 1TZGL 1UB6B 2WBWB 1NP0A 3ESMA 3PP7A 1XSJA 3IDMB 1ZSXA 4HIBA 3OWEA 3W0WE 2VLRB 2KMWA 3BGMA 5BCAA 2NX9A 2WBJA 2DL2A 4ZTYA 2V5TA 3SCWA 2EYRA 4DEUA 4PMDA 1K8DA 1CT8A 2EXSA 4WWID 3TCLA 2GEQA 4LEBA 2QHRL 2EE0A 3MRHA 4HS8H 4EI6B 2WWOA 5C0JB 2PDYA 3QF0A 3WCZA 1ET7A 2D8KA 4PI0A 1OFDA 2XGBA 4Y9NA 1LBLA 2DJUA 1Q9LA 4ZXBB 3K72B 5EZJA 2QHLA 1A1MB 1X5GA 2C3GA 4O4YH 4AVFA 4C54A 3P80A 1E0VA 1H41A 3CFCL 4AX3A 1BAFH 4X0KA 3W7MA 1J1PH 1W15A 3CAVA 1WD9A 3CVHL 2FO4A 3O6LH 4PGZA 4GYFA 4LW7A 3CXHJ 5F1VA 2PPAA 4WK0B 4LASH 1CLYH 3A6OA 3D51A 4JY5H 5EULV 3KNBB 5FYJD 1ED3B 1MHHA 2J6EL 4Y2DD 1MCWM 4NZ5A 3GNPA 3GI9L 4MA3A 2PNDA 3EYVA 2DSZA 2QR6A 2Y0SA 3AGWA 3ZR4A 4GKSB 4KO7A 1JRHH 1S39A 1JCNA 6TIMA 1A9BA 4DI9A 2WP3O 4P48A 5EZIL 2EKSA 2Z7WA 5AYTA 4DKFH 2W9LA 3GTNA 1PO9A 1CDGA 1MJUH 5FYKU 4NQDE 1KCXA 4PTVA 4IGBC 5J6HA 1TZ8A 3HS0A 3ABKB 3VVWA 4JM4L 1PLAA 1UWYA 2XNAB 1NM4A 1U93B 2F53D 3BP4B 3CXHK 3CFMA 3DIDA 4P2QA 1SJVA 3HBLA 4LCYB 3IGKA 3SUTA 3R0DA 4L6OA 3POHA 5LA2A 2G50A 1JV2A 1DL7L 2V9DA 3INPA 1KN4H 1QHQA 4Z1CA 1B4TA 4N1CA 4XGZA 4DNLA 3V4BA 5FM5O 1AJ0A 3G18A 5M2FX 4LAQH 1A6UL 2EDJA 4MXWL 4YGVA 2WJZA 2WQXA 4Z1DA 2H1LM 1KCSH 3T3MB 1MFAH 2A9ML 2QQKL 4LAQL 3NXLA 3CCHB 1QTWA 1JPSH 2Q01A 1R3HB 5I17B 3PHOB 5T1KA 4MCYA 1URLA 4GX9A 3QIWC 1CDUA 3L3KB 1FNSH 2CRZA 1GC1L 3ALGA 4DERA 1WCQA 4JZ5A 5C9UA 1EAPB 3L54A 2X4SB 5CCKH 4L9YA 4DYEA 1YN7B 3KPLB 1NCUA 2H26B 5DMKA 4DGWC 3AMGA 1XV8A 1F3XA 1SQ2N 4FYRA 1FVCA 1NIDA 4AQAA 2JK5B 4MD4A 3CQPA 5CN2A 4AHQA 4UCGA 5EU3A 4WI3A 1XD1A 4XX1G 4KAQL 2F7IA 4U6XB 4N2FA 1XRVA 4KROD 5ICZB 1HK6A 1TJ0A 5LNDA 3KYNA 2HKFL 5IEKA 2BMKA 4ICXA 4YHYC 3E6EA 4HT3A 4O28A 4GUGA 1R30A 2VD8A 2O6CA 1NEZA 4FN0A 4J3OG 4Z76B 1O68A 3KAOA 4PUNA 4X63A 3EAUA 4FNSA 2V5LA 3GYRA 2WB5A 3SD5A 1GHFH 1OSPL 2XKSA 5PAZA 1BFSA 5BOZG 5ICYA 3QISA 3WK2A 1H7OA 2H6RA 1DDTA 1HW6A 1OSPH 1FWFC 1F4YL 4HKBB 1E4KC 3U36A 4FYQA 4CQAA 1EA0A 3KOZA 1JGLL 5D71L 2Y3NA 5AW3B 1AR2A 3KVKA 4IF2A 1IUZA 2A4CA 4NZJA 1DSYA 2O7SA 2JGQA 3GE7A 1R5VB 1A7NL 1SN2A 3CFJB 1HJWA 3RK8A 3RTQB 3TYCA 4XOCA 3CHFA 3KYMB 3UZ5A 1VHNA 3L9RB 3VFOA 1N5AB 3QNZB 1JPTH 1AP2A 5D93C 3WJMB 5JHLA 3A12A 5I6SA 3FLUA 4J4PA 1KJ3H 4LLDB 4NN5B 1SGKA 2GGIA 3W22A 4DKFL 4H3DA 1HL9A 2NNCA 3HRZA 4KK6C 4JPIA 4WWPA 3MBXH 4MZIA 1WCBB 1BWVA 4KMLB 2YXGA 4OE7A 3VZXA 1SVBA 4Z2KA 1UQZA 3MQIA 4CRPA 2Y23A 1QI3A 1EX0A 1T5KA 4QJ5B 3NOEA 4ICWA 2J9XA 2WKJA 4TKWA 2QKSA 4OFYD 3LIZA 1RZ7L 3EBIA 3MCOA 2OMAA 3IDNA 2J8HA 4AL8L 4MB4A 1YKWA 4XD6A 3W1NA 1U3HD 1WV2A 2W94A 4OLZL 4QTFA 5AD0B 3Q3GA 3LMYA 3MSDA 4UUIA 1A0EA 4CD7A 4WFGD 3JR2A 2J21A 2AQOA 5FV1L 4XGZB 3SGDH 2TSYA 1OZMA 1Q8AA 3L3JB 3DI3B 3QVQA 4BH7B 5IB1A 3LRHA 1JNNL 3GR7A 1DSFH 1EWEA 4AQEB 1GEQA 1KLZA 2F53A 3AGVA 2XIQA 3HKFA 3GXUB 5IBXC 1MWAB 3E8UH 4GO8A 3DKJA 2EH8H 1DSFL 5DU7A 1ND0A 1TIUA 1XR8B 3VFSB 4BXVA 5ERWB 5GXBB 5JXAH 4P46C 2DB8A 5CCKL 3WUGA 4JRFA 4KZCA 3UERA 3SOTA 4UQAA 3HQPA 1CYGA 3GM0A 2Z9TA 1KPRB 4HQQL 3WIFA 3RGVD 4KXZI 2MRYA 3A67H 1X6LA 4Y2DA 4Z2HA 1HIML 1KLUA 1MCBA 5CUSL 5DLMH 5L6YL 4OF3A 4AZ6A 4A2GA 1YXDA 1ADQL 3RUGE 3SE4C 2BP0B 4S1SL 1SJEB 1X5FA 2XUWA 4F37K 1XVSA 1KY6A 3QPEA 4P99A 4D0DB 4RW5A 1XQ4A 4D0CA 3SI9A 2PGEA 1IFHL 1RJYA 3TYFA 1P0BA 4I7WA 5SV3A 1P53A 4YXGA 3UJIH 2FTWA 1E8YA 1RULL 4CL7A 3F00A 1UD2A 3TIEB 2XM1A 3ITYA 1MXGA 3I7QA 5I06A 4ANUA 3VM7A 3CQHA 2FD6H 2X44D 2ZKYA 1TQCB 3TO4A 3ATEA 5BV7L 1S5MA 1TE6A 5EEZA 4I5RA 5D33A 1HCFX 3WFHB 4YTSA 2IFFL 2E6YA 5DC2A 1H0IA 1M57B 3MCKB 3WD2A 4DVRL 6A3HA 1S5HB 3HC0B 1JXFA 3O9WB 4EN3B 2IJ0C 1CB2A 3FUJA 4ZTPL 1QW7A 5A6TC 3D2UB 1KBLA 3VXSB 4IOTA 3DLQR 3BUYB 1OAKH 3KLSA 1XL4A 2CBOA 5E2UH 4HUUB 2ZKXA 3I65A 5REQA 2MCPH 2BVWA 4FQCL 4IL0A 4MVAA 4FMFA 2XFGB 1YECH 4D0BA 3RFZA 2OXHB 5MKGA 4LARL 2Z93B 3IFOA 1XIBA 4D1JA 4FXKC 1N64L 4RSVA 2VDOB 2NQJA 1U8LA 4LEOA 4FTVD 1T99A 1GY1A 3OLGA 2XG5B 2WSDA 1VPOH 3ARPA 4FKHA 4L23A 3FCUB 4ONFL 1CXHA 2KDYA 2WTRB 2AAMA 5ADOL 2EKCA 2R9HD 4E2BA 1N6VA 3T55A 1GCYA 5L4FA 3HNSH 3LPFA 1OZUA 1PG7W 2WVSA 3KYOB 4HU2A 4JYDA 1LL1A 4HHWA 3MLWL 3DVGA 3QWOB 4MNGA 1KYUA 5IBUB 1M3IA 4JFHE 1QTYT 2A6JB 2FEJA 3SQOH 3UBGA 1D9KB 3WQFA 1SDYA 3GSOB 4MMZC 1MCOL 3CZUB 4YL9A 4D94A 2PODA 5LGJA 5LDSA 4O52A 1U8LB 3NQ6A 5FW8A 3PBUA 2Z2UA 1XF3A 3VJ6A 4IHOB 4K4KA 4UV7H 7PAZA 3LKNA 5FPIA 5HI5C 1ODZA 3MV11 3NACL 2Y5QA 4QDWA 3GLEA 4ACYA 2NNFA 2VX7A 3BWWA 3VUPA 1A5OC 4GKOA 3B0PA 3HBGA 3PAOA 1CLZL 5E1IA 1QZNA 1T22A 2VLME 3CDZA 4LBEA 4E68A 4X98B 1OD9A 4X6CF 3OJ2C 5F44A 2I26N 4RAVA 2BIHA 3AT0A 3O9WA 4EN3A 5ISZE 1MJJA 4G5DA 2VLMD 1VZGA 4JANA 5FO7B 1IGYA 1YBQA 2GI7A 4NP4H 4F7KA 2MSPA 5CF3A 3W75A 1XIWD 1ZIBA 3F5WB 1YTEA 2F08A 1MCFA 3GMQA 1VFTA 2ZOWA 4AX6A 3C2FA 4G9FA 2WBJB 1XH3A 3AY4C 4GUOA 2DUXA 3MLXL 1RZKH 2F8VA 3GRWL 4TPRH 1W9XA 2YHGA 3PQYA 3UYPA 1SY6L 3K2IA 1UD5A 2VXTH 5DQ9A 2V30A 4HHMA 4QDPA 4GI4A 3MU3A 1E5ZA 2O93L 3W1AA 4UIMA 1NL0L 1T89A 1ZWIB 1U8QA 4E9VA 1HESA 4D0CB 3TXVA 2BY2A 4DWSD 3TZVC 1JGUL 5CWSB 4UMAA 5BMFH 1ORSA 2QJGA 5DZLA 4P5MA 4B60A 2IF7A 4JGDA 2OTWA 4KCVA 1QSEE 2CU0A 4AF0B 3Q8BA 4JMXA 3OJMB 4WDUA 1D5ZA 2EE3A 2YPLB 4M1RA 5B1CA 2VDGA 2NV2A 2XZCL 4KVCH 5FDWA 3MV7A 4YLCA 1JZ4A 2ZXEB 4C6PA 1QFPA 3ZT7A 2AK4A 4I88A 2YLHA 4DBUA 2XZCH 1X5LA 1LRQA 1MEIA 5FKPB 7ENLA 5GS0H 1Q6DA 1VGKB 3LRSA 1E0WA 4WSGA 1UADC 4HZAA 4NUQA 4R2GD 2WAHA 5BS0D 3UVAA 1AZUA 1PD6A 3MZGB 4YLQT 4WY0F 5TFSL 1DBMH 1I3GL 5DZNA 3RO6A 1SHMA 3VFRA 1BM7A 3BUQA 1G5AA 3TXZA 5D1ZA 4DM2A 5JHDD 3AVEA 4DX3A 4IMLA 4K5LA 3CUXA 1YY8A 3R06A 3ZL4L 4JQ3A 3IJEB 4P4KB 3ZBMA 1EEZA 4ERGA 5SWSA 1OP3H 1SLXA 4DZBA 3BUPA 3M0HA 5AYUH 1AS8A 2NRDA 5KAQG 4YWGH 2VX6A 2ZKHL 5F7EH 1YNLH 5CGYC 1DIOA 3HB9A 4ETQA 5JU6A 1NSNL 1NGPH 1REQA 1X7SA 2VJ0A 3XISA 3TWAA 4JKMA 4O15A 1F7BA 1UMLA 5ALCH 2C0AA 3MV8B 2A83A 5CD3A 4YL2A 1QFHA 2R0KL 4CBZA 3QXVA 5BRZE 3MKCA 4F3HA 1XEDA 4Z7OE 4WWKD 2YDAA 5CSYA 4BQ5A 3M0IA 3R4RA 5CZ0A 4L0YA 1ET5A 4LSBA 2DQXA 7ODCA 3QWRA 3FT9A 3Q01A 4GUCA 4JRYB 1XQLA 2MQ3A 4F2TA 3D39E 4NP4L 4WNSA 3B4YA 4B5TA 5T33H 5HJYA 4TVUA 3F4WA 2XWBA 4XB7A 3OR6B 4MA8H 5F3BA 2Z8RA 1NC2D 1XH0A 3WFDL 2AABL 5JHMA 4FC3E 3TO2B 3TN0C 3W07A 3H8AA 3CEUA 2W80C 4NX0A 4YFLF 3CH1A 3NQGA 4JM2A 1DJQA 4OD2A 4W88A 2AABH 5HDBF 1I1FA 5AW8B 3RWDA 2P5EA 3SPHA 4UDUA 1GYNA 2GUYA 4DUVA 1K4DA 4Q4SA 4TXEA 1XIJA 2H3BA 4ZQTA 3O3BB 3H6OA 4IJBA 4OVUA 2PBOA 3WKYA 1MFEH 4ZW7A 2I9LB 4S1QL 1Z6KA 5C0FB 4MMZB 3M1BB 4WTZG 3QRGH 4NVTA 3QJUB 4Z3EA 3WHE1 4P59H 4BSWB 3D0LB 3T4WA 3A6BH 1T21B 3QHMA 3QXUA 3IJ7A 1QAPA 1YADA 2YZ5A 4OVXA 4LAUA 1ZLEA 4JHVA 3F5JA 4AZIA 4DYJA 4ZFMA 1J1OH 5E95B 2BIPA 2ARJA 2F5BH 1HE8A 3B3BA 5FHBL 5IB1B 1ZHAA 3GQYA 2GTWB 1HXMB 2EDWA 2M1KA 2IOOA 4KKAC 3ZE2B 1JCLA 1FZOA 2VZUA 1JN6B 4LESA 4NM8L 1WKFA 3MW7A 5J8LA 4HH9B 5LXXA 4Q9RH 4DJDC 2VIRA 4YHPA 3SZ6A 2YB1A 2AQSA 3MXVH 4RZBA 2OQHA 1W3HA 1A7BA 1SRDA 4K7FA 3BPWA 2AJZB 4RPQA 2J6WA 2X4NA 4M61A 1E9PB 4GKTA 3MXVL 1P4LB 3X12A 4EZLA 3FQNA 3S6TA 3ARRA 4OCRH 5BZWB 4JX0A 2FDBP 2MPAH 5EWIH 4WO4A 4N0CD 4B27A 3NIGF 2V68A 3N17A 4P4KA 1N9PA 5DURB 1JZ6A 1S2CA 2GTWA 3IJIA 1TWSA 2BODX 3PDOB 1OSEA 2QVFB 1WV7T 3K1DA 3DARA 3KM1A 3SB3A 2ZQ0A 3QY6A 1I7ZB 4AGLA 4NZDA 3BKJH 3EPMA 1Y0EA 1B9KA 2DZVA 4AZUA 1WFJA 4L3FA 1YDPB 3G1SA 5BRZA 2BXVA 2R1XB 2NXYC 2AXHA 4KI5E 4M6MH 3OG6B 3M6DA 3VD1A 2YPKA 4P5KB 3WK0A 2UYLB 3D85D 1KB9J 4RFNB 4FFYL 2F2KA 3ZDXE 3NGJA 5EDSA 3UPRB 3EYFB 1OAUH 2BCKA 1ZV9A 4ISVB 2ACSA 3QYQA 2DD8L 1JUKA 3TLRA 2JKSA 4BUGA 3K91A 4H00A 3VILA 3QDGB 1DBAL 5ADPH 4KTGA 2A6IB 1PYWA 5EC2B 5BVJB 6CGTA 2YBRA 3FFCD 2E9BA 2ADFL 2YARA 2GK2A 3VXRD 2QV4A 5I1HL 1N8FA 1I1AC 4GKZB 3DZ1A 3C2RA 3ICJA 2XWBB 3H4XA 4HUKB 5DJZA 4R3UA 1RZKC 1EGJA 1WO2A 3M45A 3LKRA 3MJ8A 3N9SA 3WF0A 3MCYA 3VDAA 5TJWK 3RXZA 3WQ5A 1L0PA 4JGUA 4NT0A 4Z17A 3GT6A 4JRYA 2X4UA 1A0QH 1KELL 5FDYA 5TK4A 1S7TA 2GPTA 5FOJA 1FHDA 3KVLA 2J55A 4O53A 4PMUA 4AVNA 3MRFA 3UTTA 1FNGA 3BRGC 4R34A 5U4NA 4GP8B 3EFFB 1AO7D 1OJXA 1YMYA 3IDUA 1T7ZA 1YN6B 3C9NB 1SDDA 2ZBTA 2E9GA 3E0GA 4LF2A 2Y1VA 1AFVH 3DMMA 2HLFD 4UNTA 4EWND 2QDVA 4OZIF 3CJJA 5AVSB 1JP5A 1LK2A 1JFQL 1LO2H 4P04A 1KGUA 2MKLC 1F3DJ 3QIUA 3KTSA 3QZWB 1UOZA 4N3UA 5C09D 2GTQA 2VI0A 3BCJA 3SDOA 3IDGA 5IT2H 1JFQH 5JHDA 3BUTA 4JQ4A 1OCBA 4KVNL 3FHEA 1D6VH 2E75C 5IF0B 4HS8L 4F37F 1AQ0A 1T7XA 5JHAA 1R7OA 4LS0A 4ERIA 5L9FA 3OB0K 4Z23A 2OA9A 4UTBL 4LSRH 4B5ZA 3NRFA 4JDTL 2HTMA 5HQEA 3TYUA 4HDIA 4JDEB 3SDXE 3W7JA 4ZTXA 2X05A 2W91A 4AJ0A 5B7MA 4JDTH 2MPAL 4O2EA 1HG3A 1YNYA 2FIQA 4GLEA 2R1YB 5EU7E 4GXMA 5FYKH 3T4AC 3WLWD 5HVWA 3I3BA 3M0VA 2E7LC 1NF7A 2GGJA 3ID7A 3U2IA 4HJEA 5DI8B 3QPYA 2E7MA 1IGYB 3QDJB 1YBQB 5I1DB 1JHLH 5J9PA 3T0CA 4DUOA 2A74C 1N10A 1YEJL 2EUXA 4HJFA 4OZHA 4HOMA 1ZT1B 3Q2VA 3HKZA 3N11A 4FTVB 5GHWL 1I2PA 1NCDL 3PHQB 4DZ8A 1MRQA 3T8VA 4HF5L 3ECWA 5HYQB 1RIHL 3FQ4A 1S5IL 4H25A 1IE5A 4FL4C 4ECNA 1AW2A 1X6NA 4DELA 2NX1A 3A64A 1AQMA 3L3DB 4YHOH 4ENED 4XO4A 2YEZB 2VDRB 3VH8B 3VXOB 5K9CA 3LZOA 5DZ9A 2B39A 1HHIB 4ODSH 4QE5A 5AC5A 1VERA 5I82A 3L3OC 2E46A 1YY9D 3S36X 1DL7H 3U4AA 5C3TA 3V6BR 1F00I 2NVCA 3FBKA 1YMMD 1EO8L 4F93B 3O9WD 4EN3D 4HUMB 1I8JA 4XPFH 3EKGA 1A7QH 4I4WB 1EC8A 2OQJB 2QADC 4HWUA 1R33A 4NWUL 5IB4B 1WDRA 1KXVA 2ICWI 3MC5A 2V5DA 3QQ0A 4LNYA 1MFAL 1KXHA 1WE5A 2A9MH 3EOBA 5D7JB 5F0MB 3TCXA 3WY1A 3CZ8A 1U8CB 1TMHA 5F96H 1UWIA 2ZZ4A 3J27A 2D0HA 2YUWA 3DX9A 2EO7A 3KXFB 4LLQA 4N0YH 4ODWB 2YPVH 3GIQA 2VX5A 3LK6A 5JMUA 4C7GA 3FU7A 1YYLL 3V0WL 2WWMC 4KEVA 1UKPA 2FDSA 3CHEA 3WUWB 3S5ZA 5ILTL 3V9FA 3WKQA 3QZLA 3ZHDA 1YDYA 3NSCA 1IU1A 3EH1A 4Q0XH 1P0KA 3S5LA 4I13B 3BGAA 2DUZA 2H2SC 2NQCA 5HI5D 1FH9A 2JF7A 4TUOA 1JSYA 4OZGF 2ZSVA 3SFKA 1WBXB 5J1SC 2ORBH 1R24A 3T8MA 1QR4A 1ZUAX 3UU0A 1LLAA 1EBAA 3S6OA 4WVXA 3MR9B 4NPKA 1E5NA 1YE4A 5C2CA 3DMMB 1Q90A 1N70A 2VXSH 1KKRA 4NM4H 4Y2OB 1A2YB 4EAMA 3NIGB 4LSRL 1RXLA 1GSKA 1PDZA 3I9GL 3PZNA 2DYRB 2K6WA 1N8OE 3R8BB 4Q97A 1DBTA 2ZWKA 1E4IA 1HJSA 4KO5A 2H8PA 3EEZA 4U7SA 4Z2GA 2QPUA 3SYAA 4DVBB 1TJRA 1NINA 1NOFA 2DVXA 3HMXH 3REQB 2V3EA 3GSNB 3PXJA 4JKWA 4MLIA 5C6PB 3H9SA 2D3VA 5GGTL 1WCGA 1DHKA 4DLFA 3QEGH 4RIRA 5JORB 5AW0B 2DIBA 4YR6B 2WQAA 1JWUB 1U42A 2VXUH 3GI9H 1HYRC 2ZRYA 4Z2IA 4QWWC 1F42A 2W79A 1XSOA 1AKJB 4KTEL 3TO4D 3OLIA 1T96A 1QNZL 3BSZH 4QRPE 1GK8A 4RJEA 3SDAC 4QP0A 3VKBA 1M5WA 2Q71A 4NNXB 3CJPA 4B91A 3HAEH 1AHWB 2GABA 3RR4A 3O6YX 1XLCA 4NQVA 5FKYA 1BMGA 4PJ8C 1Z89A 1M3JA 3GIVB 1HQRB 1W80A 4KK5D 4LLDA 3WFEH 3S47A 1ND0B 1MHPL 2VDMH 4YTRA 5B3NA 4X5RA 1NANI 4E9XA 4F7CB 1P7TA 2I9TA 2E7LA 3CV1A 3MKVA 2CG9X 4J2MA 1PZ2A 4MMWA 5C09E 4FFZL 1U3HA 1P84J 4LHJB 3GBNH 4F2BA 4TX8A 2EDTA 4LCQA 1JXDA 1XDTT 3ARDC 4I9WD 3ZR6A 2DQUH 4K3JL 3BVJA 2Z25A 4WFFE 5I3KA 4XI5C 5F7NC 4TNVK 2FZ3B 5E6IA 1JZGA 3TBBA 1P1MA 1IKNC 1T1WA 1ZENA 4F48A 1I1RA 3W6YA 4JHWL 4LSDA 1NWOA 1I8UA 3EYOB 1SSDA 1YEEL 4MXVE 3FUIA 3VA6A 5D9SB 1GTNA 2J66A 4WI4A 1H8OA 1BCIA 5IB5A 5K1NA 1V6XA 4W9ZA 4ODBD 2D69A 2OU4A 5SX5H 2RMNA 3MLTB 4NNYA 4QRUB 1ZLPA 3FO2B 2J7HA 4HU3A 1GMIA 1DDHB 1Z3NA 4ORMA 8XIMA 5G55A 5DMGC 1HH9B 2XWRA 4IGMA 1HXKA 3AY4A 4KROB 2GPZA 2VFGA 3TC7A 3H1ZA 3TO4B 3I4EA 3IAPA 4NFCA 4KFOA 1LBFA 1M05A 3PVFA 3GHBL 4NBXB 4M51A 4QE4A 2D2CC 3FTZA 1N5AA 5AHNA 3S3JA 3NIDE 4UC5A 3ZIMA 1ZAGA 1OX6A 1EZVX 4GGHA 1OIFA 1XLIA 2PDQA 1XIWA 4K36A 3NMEA 4OLXH 1OTSD 4PM1A 4EZKA 3CN0A 2J12B 3B43A 2NQHA 3OO2A 3ZE2F 4FHAA 2R69L 3QYCA 2DEPA 4GCXA 1FP8A 3TLQA 1E9PA 4FE9A 5SWZA 4AMWA 5CN1A 1D7CA 5D72H 4E9RA 4ELKB 3FVDA 3HHSA 1R86A 2YR1A 3QDGA 2VDIA 2V37A 1T66C 1A8JH 2LTQB 3HPZA 3M5ZA 2B4CL 3RDTB 3QEQE 1XC6A 3D69B 2XSXA 4HEME 2Z4GA 1CLOH 3MRNB 3P4LA 3RHWF 3X14B 4X5XA 4AUYA 1F3WA 2ZA1A 3VFGH 4DVRH 2B4CH 2OMBA 4OF5A 4RE3A 1I60A 1BG9A 2IAMC 5C07A 3STFA 4HNNA 3OR6A 2UY7B 5D1ZC 4H9TA 2PDGA 4DAIA 2I57A 1FFOB 5DZOA 2P0IA 2V6AA 4LPUA 5GRUL 4PV1C 2R1XA 3WLNA 4DI8A 4GEIA 3RGTA 3LH8A 3OPSA 3R2GA 3H2WA 1W0MA 5DT5A 2FZ8A 3ZLGA 1MUWA 3RPIA 2F53B 4Y0GA 3NCYS 2WOYA 5T1KD 4KWOA 3W2NA 2QGCA 3NQCA 3FYOA 4AIOA 2Z27A 4JN1H 3ZKSD 3GW3A 1Q63A 4JFEE 3IMSA 3ITLA 1GG0A 2EIZA 2NXZB 2OMUB 5JTWA 2WZIA 3R6IA 4L8CB 3MYOA 4ONFH 3S5NA 5F0PB 2OCJA 1RCOB 1PX4A 3SCQA 1NIBA 1HJUA 2YZRA 3BLBA 5INCB 5DUML 2W27A 4KNTA 4N90D 1R3WA 4RE0A 3U25A 3JWNH 5BVPH 5D7JD 1IAII 1WT5A 3II1A 1H5BB 3QO0A 1RK0A 1ILSA 1TFHA 1ZCRA 1FWAC 1X5ZA 4YTUA 4DEPC 3CYJA 3AT8A 3O41A 7REQA 3S2MA 4J3WA 1WQ5A 1MCOH 3EMQA 4M7ZB 2ATAA 5LGZA 1CQYA 1JK8B 2G96A 5CNHA 1QEWA 1JZ2A 4Z5RA 4HBKA 4M3PA 2WLHA 3D09A 1VCVA 3KZPA 3UY8A 3K1GA 2E5CA 4HPOL 3L4ZA 4WHYG 4RNIA 3F2DA 2WHJA 1POKA 1ONRA 3CV7A 4XO3A 5I9QC 4HJWA 5BOPA 1OHZA 1OPOA 3ES6A 3HU7A 1ID2A 3K4WA 3O2WL 4HV8B 2NSMA 3VWKC 4UR8A 5K9DA 2VGIA 3ABRA 3L65A 4IKJA 3QDGE 3VU2A 4R33A 3VDHA 7TIMA 1ZQ5A 2WY3B 4LNCA 3MO7A 2AQQA 1URZA 2DTMH 2DZTA 4FQLL 2OP4L 3UTOA 2WOQA 5IHWA 1N12A 2QUUA 4LVHB 4M1CC 1FUNA 5HNTA 1ZALA 3NN8A 4IRSD 1UVQB 2PYED 1JULA 4W5UA 4PJCA 2BHYA 1CFBA 2CO6A 1E4NA 5AOJA 1EBPA 2R4RL 2H3DA 1SYVA 2FJFA 2Z29A 2PP9A 1X4YA 4JREB 1YEHH 2BHZA 2J5WA 4G82A 1BZ7A 1FNLA 3MJ9A 1LP6A 4FQQB 1XKJA 3FUDA 3GLDA 4PJ7F 4XXWC 5EMYA 5F1NB 3EBHA 1DXFA 1Y7VA 4HMCA 5A2BA 3W5NA 3EXRA 1G0XA 1DFBL 2P45B 3BAXA 1ZS8A 3O2DA 3FB8A 2E5EA 4Z7QE 3GVQA 4Q4MA 2P5PA 3DGGB 3RU8H 1V08A 4L5ZA 1LZOA 4QHUB 4R3SA 1J9RA 1DQIA 2AK4B 5GRUH 1GYVA 3S34L 1GGCH 5HPMB 1V02E 3PP4L 1QBBA 1MI5E 2PLCA 3Q9QA 3QW4B 2J8UB 5E2WL 4AWTA 3A23A 1RK6A 1XR2A 4M6PA 2NTFA 2CXKA 4AMCA 3OHXB 5C7VA 2IXQB 1GGCL 5DEGA 1MYRA 4GW1B 1A4MA 1OSZA 2OR9H 3BEWB 4GAJL 1GNXA 3JWNC 3IDJB 5GQBA 3RX7A 2VDPB 4UTWC 1ORSB 2AJSL 1QUPA 1HILB 1ZB5A 3GG8A 4JS7A 2G30A 3QUYD 5DHVA 1O6IA 1KG0B 2BMBA 4BI7A 2KKQA 2OJ1A 1KEGL 4FFZA 3LKNB 2OYLA 4POCA 3LOWA 1MCSA 4MJHA 3G04B 1GYLA 1UR8A 1YY8B 3R06B 4DO6A 2ZZ3A 3KBVA 4LAOA 3QQ4B 3UTSD 1AZBA 2AXFA 3CDFA 4N6QA 3KDNA 1EYWA 2B59B 3HAEB 4KI5F 5IEHB 1K85A 2Z0IA 1DBJH 2HT3D 3NM1A 4LKXB 1T5XB 4RVBA 1A4AA 3N18A 1I53A 1GY2A 1NFIA 1KJMB 1DVZA 1U93A 1ZV5A 1EO5A 2ZUUA 3UTQA 5FAGA 4PUBL 4U2YA 1YEYA 2ZX5A 3SADA 3UOAB 4Y2OA 3VFUB 3UC2A 1RZIA 2NW2A 4OIBA 1S7QB 4IK7A 4WWKC 5KYXB 3IWPA 4W8AA 5FF2A 4N8VB 1LO0H 5FO8B 5F2IA 3WF2A 4A8LA 4OV9A 3FB7A 5K4ZA 3ILEA 2WC4A 4LC6A 3LAFA 1SZEA 4QHRA 3W1XA 1JZFA 2L7QA 2UY6A 4PREA 5H94B 3OVUB 3O4OC 1J48A 4LEOB 3VI4E 1EPXA 1ED3A 3H7LA 4ZS6C 1R75A 1NGXA 3G5YB 1XLBA 1BYCA 2A6NA 3V18A 3W6LA 4XWOC 5LN4A 4AF0A 2ZCHH 3CMOH 2WM0A 2M2DA 4ENZA 3TIMA 1BXUA 2N59A 3L3IA 3MSGA 3FO0L 3D4GA 3T0ED 1ISXA 5AHFA 1QWKA 4MWAD 1BFTA 5ES4B 3TTQA 5E8EA 5HYJB 2BGSA 3DMMC 1AGEB 4YIQB 3UL4A 4HGXA 3WZ0E 3UPMA 3R1ZA 3KR3H 4YHLL 1KM1A 4MUPA 5IRPA 3W6MA 2WCGA 1VJIA 1B4JH 5HBFA 3KPTA 3O8XD 1KQZA 3QYMA 3UXDA 1AHKA 5FM4A 3VFCA 3RYSA 3ERPA 3P3YA 2PDUA 3G5YA 2XFXB 3KXFE 4BHUA 5CZSA 1CE6A 2G9HA 3VGDA 4TTUA 1WFTA 4DAGH 5A2IH 3NIDF 2ZICA 1MUCA 3UJJH 4X6CA 3MFGB 4ZSOE 1UXWB 1EQCA 3N2TA 3KGSA 1BZQK 5K1JA 4MLJA 2E67A 1FJ1A 2ZC1A 3FSTA 3N40F 2MHAB 1XCFA 3W56A 3PPSA 1OCNA 3VXME 4I90A 2ZUYA 4RGOL 1IQDB 4AZCA 2RH9A 5I0DA 2Q3RA 2HFTA 3L4XA 1TYEB 2H32B 1QU4A 3NQBA 4J1UB 4YHYB 3C5ZB 5IM7A 2J1YA 2Y6TE 5FGCE 3PTMA 2VQ1A 1LEKB 4RMQA 1TQXA 3G6AA 5JR1H 2NY5H 3L0KA 4PJ5A 2Z7UA 3BW9A 1MNSA 5KINA 5CZRA 2X38A 5IV2A 2A1YA 3DHDA 4LSUH 1U4FA 4TLKA 1DP0A 1G7HB 3AALA 4XBSA 4P5SA 3QG6B 3WXWL 3I9PA 3LV3B 5DUJA 1OSZB 2KZHA 4X7TB 1R3LB 2SEBB 4OCRL 5K93A 2QUVA 1DOSA 2CDFB 1GR7A 3CXDL 4HK3J 3ZTJG 3C0SA 3GNOA 1HO4A 4YMZA 4MJZA 2HV5A 1IVLA 4Z7UB 2ZD0A 4C56D 2O5YL 2P9RA 4MB3A 4WQOA 2D7QA 2FBOJ 3VW3L 1L9WA 1RQEA 1G67A 5LNEA 5L7XH 3KJ4B 4QO1B 4HCIA 4K8GA 4IP5A 4D6JA 3RVVC 3Q3GB 2QF7A 5C9XA 4JFPB 1M6UA 3VXTB 4IPIA 5L7XL 4N0FB 4X60A 1NDMB 4JRYD 3QUXC 4DF9A 3PWPD 1PCWA 3SE8H 1F3RB 4U1HA 3HZ3A 1V6UA 2ICES 1YJDC 2PWFA 2QZRA 4BBWA 4H8WH 5KSAB 3PWAA 4JRWA 3S6DA 1XEUA 3IN0A 5HHOE 3W9EA 1ICQA 1HXJA 4LEQA 2HT3C 5G1YA 2HLAB 4A3HA 2OAAA 4LOVA 1R38A 1SXBA 4HSOA 5D37A 3OKOB 4G6JL 4KTDH 1DBAH 6PCYA 3DBSA 3QUZB 4OZIA 1EHXA 2CRYA 3NJNA 4OD1H 4REQB 3SJ3A 4N25A 4AMKL 3DFSA 4MJMA 1X1NA 1B4JL 2A7NA 3QUGA 3OPZL 2CH8A 1OAYH 4F8XA 5CP7B 1OVZA 4NJ9H 5A16A 3MRBB 3S1GA 4EDWH 1G7VA 1V02A 4LV4A 4B95C 5I1GL 5JQ6H 1EXHA 3A4WA 4RRPA 5D2LA 4WKZB 3G3MA 3NQMA 3RHWK 3ARFB 3OGCA 5J3HC 4RFEB 1P6CA 3UGXA 2XA3A 5EB9A 3P8IA 3U3HA 2I24N 4F92B 2FWLB 2OK0L 3K74B 4B5XA 2X6BA 4JGMA 1J5OH 3EJTA 2R51A 2NY0B 4OM0H 4H9UA 1IM3A 4XPAL 2VLKD 1IILE 5CXPA 3SPCA 4WV1C 1C12B 3Q8AA 5I1DA 5ERWA 3O63A 4I9MA 4JR9L 4GA8A 5B39A 2EE2A 2IG2L 1YDPA 5F93C 2XHNA 4KK5C 1JCTA 5IT2L 2ITCA 1XGYL 1Y0LB 3EYUH 3HE6D 3KBEA 3ETTA 5BS0E 3THML 4Q4OA 2DQFA 2X1OA 3BDXA 3UTZA 4PTXA 3F7LA 5ESAA 4F5CE 1PTDA 4QR6A 4PGDA 3EYFA 2HS8A 4UTBH 5GNZA 4OJFH 4QHUA 1DTUA 2P5WD 4N7QA 5TIMA 1E27A 3FQNB 4DF1A 3EJQA 3FU6A 5AD0A 1I9CB 4LVFA 5L2KE 1T0PB 4JFEA 2FR4B 1V0LA 4N2GA 3TROA 2TMDA 3UAJD 4K5PA 5IVXF 4S38A 3UETA 1RUKL 2VMFA 2C4XA 2G9KA 2IV8A 2ZA2A 5KG9A 4RDQG 4LPWA 4PCSA 2FZ9A 3DJTA 2Z1XA 1GS8A 3LD5A 2V69A 3F1QA 1B2WH 4G6ML 5GIRB 4MZYA 1LL7A 3TA3D 2ZRVA 4PMVA 4S3AA 4LSSH 4ZFOA 1J93A 2Q8BL 1N2RB 1M6JA 3QXTA 1NFDE 5KZ6A 3QDME 3K0YA 3U7BA 2Z35A 4LBAA 2RDXA 4L3EB 5KVEE 2P5ED 3PC0A 5I6XC 3ALFA 4WQ6A 2K3HA 4LFHG 1UR0A 1X3DA 5D1XA 4WKZA 1D5XA 1XF2B 4JFEB 2FR4A 1RAKA 2OOFA 2X42A 4XH2A 3EX1A 1Q9WB 5B38B 2ISWA 3FXYA 3EKCA 4JTHA 4MDIA 4EPBC 2DZUA 3MJMA 3U8GA 3QMSA 1F1DA 4ZO8A 1XCTB 1KF9B 4JFXB 2WHMA 1Q72H 3G5WA 1WOBA 3ARGC 4PVNA 1AXIB 3BUVA 5M17A 2ALRA 4M6OH 1O7SA 4OZGA 5ICXB 4FIRA 4TYUA 2GKIA 3NOIA 3BN9D 3SPJA 3MBED 1PKYA 4N02A 3P40A 3O6FC 4HALA 4ZK8A 2WKLA 5HSFA 1T4KB 3QEQD 4GIOA 2C3VB 1R3RA 4QLLA 1Q38A 3KCPB 1FWHC 1F8IA 3UR7A 1NJ9A 1ET8A 4Y16D 2DI8A 4KJQD 1A6ZB 1OAXL 1BLNA 3ZM8A 2LGNA 5D9SA 2HRPL 1TJMA 2XKUA 3O3EA 5DO2C 3SJVD 4A63A 2WQUA 4BJHA 5IQOA 3HS0B 2F68X 4O1DA 5CLZA 1F3TA 3MLSL 5BO1H 4JQIL 4GW5B 2PF6A 3ULUC 3GMOA 1SQ7A 3W0WA 5I1JL 4JY6B 3AJ7A 4R90L 3VTMA 5AENA 1GWJA 1W5QA 3V75A 2HAZA 1JHTB 4Z7NB 1TJ2A 4FXKA 1YXCA 5CPNA 2WO5A 3U6WA 4CVUA 3OF6A 4FLHA 4LL9A 4R90H 3DXIA 4JTFA 4BE5A 3LZNA 2E7FA 5C55A 3D2UD