2WVVA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 157
structure length 438
sequence length 438
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvvA01
4WK9A 2ZWZA 4HMCA 1MFVA 1E1EA 1QX1A 2V5CA 3OZPA 1E0XA 1J0YA 4V27A 4JFWA 1SMAA 2DDXA 4KGLA 4NRSA 4MDOA 3PZQA 3WNOA 5IDIA 3VIIA 2CHOA 1C7TA 1G94A 5E0FA 4P8WA 5A2CA 2XFFA 3GTNA 1EH9A 1W3JA 3D4YA 5CGTA 4UZSA 4CKQA 2DSUA 1GHRA 3CV5A 2DQXA 4UFJA 1W9XA 3L4XA 1E6SM 2QLYA 1CLXA 2WXDM 5I78A 2BV9A 1TG7A 1IT0A 3ALGA 3JUGA 2XSAA 3VD9A 3WMBA 3AZTA 2IXUA 3POHA 3RDKA 5M03A 1W1YA 1W3KA 3EMCA 4W7UA 4MB3A 2CEQA 2YOCA 4MPKA 2G3NA 4CD6A 4DUVA 3MMDA 5GNXA 3CIVA 4PTXA 3S2CA 1TUXA 1QWNA 1UASA 4DWSB 4PUEA 3GNPA 1CEOA 3W37A 4JL2A 1UOKA 1PX4A 4CCEA 3AS3A 1KB3A 4A4AA 4PMUA 3W4RA 2PWEA 1UR9A 1SFSA 2V3DA 1V3KA 1OD0A 3KL5A 2C7FA 5D8ZA 3T2OA 2CKRA 3CHFA 1CGXA 3SIMA 2CBIA 3AI0A 3W29A 4N0RA 3ARVA 2VRJA 3PHAA 2BXZA 2ZWYA 3CZJA 2ZUNA 1QI0A 5LA2A 5I77A 3F5JA 3KEHA 2E8ZA 2D1ZA 4MB1A 1W9DM 4ACZB 5BRQA 2GJPA 2E3ZA 4UQAA 3CUHA 1E71M 5AC5A 1V03A 4PSPA 4S3JA 4GZEA 2O9PA 1Q4NX 1CXHA 3UCQA 1GOQA 4UZUA 1FFQA 3LRLA 4C7GA 1QNPA 4JFVA 3VM7A 4IUGA 1MQQA 4Z2IA 4UOQA 3UESA 1V0MA 2WNWA 4WLCA 3CUJA 1SMDA 1RPKA 1OD8A 2WVSA 4ML4A 3L4WA 3LXBA 1HX0A 1G0CA 1TVNA 5I79A 3ZJ8A 3PZNA 2WZIA 1NP0A 1OB0A 1EA9C 2D20A 1XV8A 1KCKA 3BAWA 1JD9A 3CC1A 2UY3A 1C92A 1UD2A 3FY1A 1JNEA 2G41A 2EABA 4Q7NA 3UEQA 3CMJA 4WF7A 3UG4A 3MS8A 3DYMA 3DC0A 2J74A 1R86A 3SCPA 5I24A 3ZJKA 4JKLA 2WC4A 2WYSA 5C8BB 3PZOA 1LQ0A 2ZICA 3AIBA 3MSGA 1C8XA 1F4AA 2VX4A 2ZXDA 2YL6A 2EPOA 2DH3A 2W66A 4UFHA 4YN5A 4PSRA 1B3ZA 1GORA 3VOCA 1EOMA 5CLTA 1OBAA 4IISA 1HWWA 4LPCA 4BQ5A 3IAPA 1JZ2A 4LQ1A 3VMNA 1XC6A 1NOFA 4D6DA 1E3XA 5GNYA 5ABFB 1GOKA 3K8KA 4U33A 1CBGA 1WDRA 4L4OA 2VZSA 3NSXA 3W53A 2CHNA 1UR4A 4XB3A 2VJXA 1AMYA 1DWIM 4PEEA 4F9JA 3AMKA 1R85A 3IGUA 2WW5A 1NH6A 1AQMA 1M03A 1UR0A 4D6GA 4GZIA 2FH8A 4JCLA 1BHGA 2Z1SA 1HL9A 4ZENA 1JFXA 4LXFA 2WMHA 1H0GA 1ZB5A 4OBRA 1QWUA 1R46A 3BVWA 1WZLA 2TAAA 4J7RA 4MAZA 1QNQA 2YFOA 4D6IA 2XN1A 2ZX6A 2EBNA 5IFPA 1QW9A 1TQWA 2XWEA 4WKHA 2ZE0A 2Y8VA 2OLHA 1B90A 1WAWA 5KZ6A 2X2JA 1LJYA 1UKOA 4MB4A 3MUIA 3N04A 3WD1A 2F61A 4UTFA 4Z2LA 2BHYA 3AMGA 1EXPA 5CJ5A 4PRWA 2X2IA 3TONA 4UFLA 1XCWA 4M80A 2ZUUA 2WMJA 4B3KA 1KXHA 1XH2A 1E4NA 3WNMA 4Z2JA 1NWUA 3EDFA 2BVDA 1MQRA 2UY2A 3PZUA 4GINA 4GI9A 1ISZA 1WDSA 1CGUA 3VPLA 1KTCA 2AMGA 5IHSA 4ZFMA 3DYOA 1PZ2A 3KL3A 2EQDA 3WF0A 4MNKA 1EDQA 1CGTA 3VDBA 2EPLX 2X0HA 3EDDA 2WPGA 5A2AA 3D52A 3CLWA 2VX5A 1JAKA 2XSBA 3ZO9A 3WMCA 9CGTA 1UHVA 2WVTA 5A95A 4BZYA 4MNJA 5HXMA 3AROA 4RE2A 1VB9A 3HG4A 3OG2A 1R75A 3IAQA 4YPJA 1VFOA 4EKJA 1B3WA 3DECA 2ZXQA 5BROA 1NM9A 2ALWA 1OM0A 1GPFA 2J25A 2E9MA 3EDEA 4FK9A 4HZ7A 3VILA 5BWFA 1BLIA 4XZBA 5A69A 3LPFA 1B3XA 1PS3A 1V3MA 2BHZA 1TE1A 1O7AA 1GW1A 2XWDA 1BF2A 5BXRA 4JAWA 3N18A 4W5ZA 1CWYA 2GJRA 3KWXA 2V3FA 3FAWA 1V6YA 3B9AA 1HNYA 3IJ7A 4U5KA 2YLLA 4AYSA 3SCNA 1W1PA 1WP6A 4ATWA 2OW7A 1VEMA 2JEQA 1C90A 3A24A 4X0VA 2BXYA 3U5UA 3VSUA 3AHVA 4F79A 3CBWA 2VZOA 1B3YA 2WZEA 2J7DA 3SCOA 5ABHA 1R47A 1QBAA 2F7PA 1Q6FA 1E56A 2PWDA 4B15A 3EMQA 3IJ9A 2WK2A 3HMCA 3POCA 3CH9A 4AD1A 3AS1A 5LYRA 4JCMA 2EO7A 3MU7A 3AHZA 1J0KA 2Y24A 3LXCA 2X2YA 1VENA 2BY0A 3TTOA 3SCRA 4P7QA 3WQWA 4CU8A 4HZ6A 5M3WA 1J18A 1UQYA 4NI3A 2CERA 3THDA 4AD3A 1CXIA 4W8AA 4AMCA 4W8LA 2JF7A 5I6SA 4E4PA 1GJWA 3TOPA 5A3HA 3AFBA 4CN6A 2BHUA 3CZGA 1OGBA 3HZ3A 1W2VA 4K68A 1EDTA 5F7UA 2FDMA 2OWWA 4HOWA 2DGAA 5I3DA 1V6XA 3KZSA 1MQPA 3L4TA 4WJXA 1NARA 4J3WA 1Q6CA 3GXDA 3TP4A 1SR0A 1GOOA 4AMXA 1V0KA 3SUTA 1K9EA 4B9YA 1V3LA 3N15A 1DHKA 4HP5A 1W9VA 4TVUA 1NOWA 2NT1A 1D3CA 3L4VA 4M8UA 5HPCA 3W82A 2WC7A 1HN1A 1B1YA 4U31A 4KH2A 1GUVA 3WNPA 1QOXA 1DWGM 3AICA 4XX6A 2WWCA 1ESWA 2YA2A 3M7SA 2J62A 5BYWA 1UD8A 3N9KA 1BYDA 5BXTA 4M1RA 2O9OA 4E2OA 3H55A 2WLYA 2F2HA 4JL1A 3BVUA 4AC1X 4DO5A 4X9YA 2E8YA 1B2YA 2Y8KA 3T2QA 2UY4A 3WBEA 1EQPA 2QPSA 1H1NA 1JXJA 4FLRA 1V6WA 3APGA 2XVLA 1V6VA 3SCQA 3DHPA 1KBKA 3OB8A 1U30A 1RP8A 4M82A 3DX4A 3VDHA 1M01A 4NF7A 4FNUA 1H0IA 3CUGA 2VT0A 2J77A 1CXKA 2QPUA 1HJQA 1B9ZA 1ZU8A 4J3UA 5FL0A 4KGJA 5DMYA 4JHOA 4XUYA 4HMEA 3EYPA 4GKLA 3VIJA 5CQ1A 3WD3A 4F9DA 2XGIA 2EADA 4AY1A 3UR8A 2XG9A 3EBVA 3SUUA 2WBKA 2YDQA 3N1AA 1HJUA 1UD5A 2D0HA 1QNRA 4P8UA 2Q8XA 5JBDA 1QHOA 1QHZA 2W92A 2VR4A 4DWSA 1H3GA 1PX3A 1E70M 4D72A 3WQVA 2CYGA 1LL7A 2VCBA 3GH7A 1HKJA 1L8NA 3NYDA 3OBAA 3UG3A 4AIUA 3BVVA 3F4VA 4AZ7A 4CD7A 3BMVA 1M7XA 2WC3A 2B31A 1FP8A 5A6BD 2VR5A 3WD0A 1HJSA 5E0CA 2D3LA 3WDPP 1CGWA 1VF8A 4H8HA 3DX2A 1C91A 2A3AA 3GXNA 3ZT6A 3EJTA 1K9DA 4UFMA 3BAYA 4AW7A 1J0HA 2XYLA 1JF5A 2G3JA 4FNQA 1E43A 3OLGA 2MANA 1D7FA 2X09A 1Q6EA 1PJ9A 4E8DA 2BVTA 4ACZA 3UERA 4JFUA 3DDGA 1J11A 3VTRA 2C0HA 2WHLA 1NQ6A 3AIUA 1VIWA 3BUQA 4NXKA 4AYGA 4ZXOA 3K8MA 1OGGA 2WM0A 2NSXA 2DSVA 5A2BA 3KL0A 1AQHA 1MXGA 4HA3A 2VC9A 3S6TA 4X0NA 2D22A 3EMZA 4P7LA 2FH6A 2F7QA 2YA1A 1EHNA 2OYKA 2J7EA 2E0PA 3UG5A 1UWUA 5A6SA 4OBSA 3AMCA 3U7BA 1SYTA 4V28A 3LRMA 1JDAA 5E1QA 2VRQA 5FD0A 5D9PA 2E4TA 1LWHA 2F1BA 3PTMA 3S5ZA 5E9AA 1CLVA 3A47A 2WMIB 2VOTA 1K9TA 3T08A 7TAAA 3AS0A 4OGZA 4KRTA 1J0ZA 2D0GA 3T0AA 1R87A 1OIMA 3L2MA 4RL3A 4BQ3A 1QI2A 2CBJA 1E6QM 2O9TA 5HOSA 4QLJA 1ECEA 4CN1A 3OLEA 1G01A 4AD5A 1WE5A 2W91A 3L4YA 1C8QA 1KR1A 1E6RA 3T0BA 2X2HA 3VIHA 2WHJA 4EANA 2QMKA 2YDSA 4Y7EA 4D71A 4NSBA 3OGRA 1WZMA 2W67A 2J47A 3ARUA 4W8BA 4DO6A 4H8UA 3B9EA 3AIVA 1GQJA 1GNXA 4Z2GA 3J7HA 1A3HA 2D24A 4D6HA 4WSKA 3LRKA 4OOUA 3T09A 1W1VA 3B9DA 3MKKA 3RM4A 1E73M 4HU8A 1KXVA 1QNSA 5ABFA 1R8LA 3VKKA 1WKYA 3U5YA 3ARZA 1E5NA 1TCMA 1BTCA 3MANA 4JZ5A 1G5AA 3RO8A 3AS2A 2VQTA 5A94A 1CDGA 3T2PA 2EEXA 4IPLA 3VDCA 1C93A 2AOSA 2ESCA 3WL1A 5ECUA 1EO7A 3RIKA 1W91A 2GK1A 3W27A 8A3HA 4TX6A 4W7VA 2ZX5A 2J7HA 3RCNA 4M81A 3A21A 1W3LA 3VIMA 4CD8A 1W2PA 4FNPA 2YDRA 3WN6A 4FMVA 2IUZA 3FW6A 3VDAA 4R5EA 3WUBA 3MV11 3CHDA 5M5DA 4Z2HA 1LF1A 3CUIA 3PZGA 3CHCA 1US3A 4RE4A 2WWDA 5EBAA 4EAMA 5IHRA 3L2LA 3B8SA 4QFUA 1F4HA 3I3EA 1UZ1A 3WF4A 2VUYA 2YA0A 4H2CA 5FOOA 1KFWA 4CU7A 1E15A 5IFTA 1JI1A 4CD4A 1HKKA 3ECQA 4KRUA 3AMDA 3MO4A 1AVAA 2DT3A 3RPMA 4TVDA 1QW8A 1HXJA 5BRPA 4FF5A 4OZOA 1JI2A 3GBDA 3SCWA 1XD0A 3IJ8A 4W85A 1GOWA 2YFNA 1KR0A 1GCYA 4QDMA 4H7VA 3VMPA 4JFSA 3KE0A 1UH3A 2W63A 1U33A 1FFRA 1E72M 7A3HA 4MJ4A 3TV8A 3VX1A 1M04A 3LXAA 4QLLA 3O6AA 1D2KA 3WH7A 4EE9A 2PWGA 3AHYA 1JFHA 4DO4A 1S46A 1FH8A 1FHDA 2DEPA 3QOKA 2VO5A 2WLZA 1QPKA 4AZBA 3ZR5A 2VTFA 2G3IA 4F66A 5CPTA 3SCSA 3DX3A 3LX9A 4W93A 2F7OA 4KWUA 4GIAA 5A6AA 2DT1A 3PZ9A 2CETA 3VGGA 1ISYA 5A6LA 4B16A 3RMEA 3QGVA 2BY2A 3VIGA 3ZQ9A 3AIRA 5AYIA 5CPSA 1XCXA 2EPKX 3WQ6A 1JYXA 4TVCA 4E8CA 2ZXBA 4DWSC 3SEPA 4AISA 5JIWA 3TTYA 2VVNA 4AMWA 3EJPA 3VD7A 4YHEA 4DUWA 3VSTA 3VGEA 1E4LA 1HIZA 2VZUA 2ZUMA 1CGVA 3A4XA 4AZHA 2XIBA 4TOQA 1XSIA 5IXEA 1MW0A 2WCGA 2DSKA 3AQUA 1JZ6A 1H2JA 3IANA 4D1IA 3OGVA 3RJXA 1JZ4A 2W4XA 2CBUA 3WDJA 2OSXA 1NP2A 4CD5A 1HXKA 5JBEA 3BXWA 1B0IA 1C7SA 3G6LA 4UFIA 4W88A 1FP9A 2J79A 2DPEA 3AIEA 3M6DA 4DM1A 4AZIA 3VMOA 3U57A 2NW0A 4AIOA 2W62A 3HG2A 2OSYA 2BY3A 2JFEX 3KLKA 3BCDA 3ZT5A 1ODZA 5AYBA 3TTSA 2YLAA 2J78A 2XIIA 3WUEA 1MW2A 1MXDA 1V0NA 1JZ5A 3NIYA 3CUFA 2XTKA 4HOZA 3AYSA 1AQ0A 5FKYA 3PTKA 4KMQA 1QBBA 3H53A 2DIJA 2GDVA 4GQQA 3WD4A 1UKSA 1KBBA 1ISVA 4AEFA 3WMSA 3SUVA 5C71A 5A8NA 3OLDA 4JIEA 3LPOA 4W86A 4RE3A 4CN4A 3ARTA 1W3HA 3ALFA 2J8FA 1LWJA 5AC4A 5JUVA 2JF6A 4UNIA 2WMFA 4TTGA 2Y5EA 4PMYA 4TX8A 4UCFA 3SCVA 3MMWA 1RD6A 3VNZA 1C8YA 1ZBCA 2JIWA 3K46A 1G9HA 4YHGA 4AD0A 1MWOA 2QF8A 1UR1A 3WY1A 4LX4A 3ARWA 3AHTA 2F8QA 1UA3A 1MYRA 2WANA 4PMRA 1UG6A 3WY2A 5FL1A 3BLBA 3FHQA 1GHSA 1JXKA 1NOUA 4AD4A 5HPOA 1E55A 2CIPA 3WEMA 1H09A 4H41A 1HKMA 1QI4A 4AZCB 1K6AA 1DTUA 1TQVA 2VRKA 1TA3B 3WY4A 3D3AA 4J27A 3D51A 1W9UA 2FGZA 3PZTA 3CHEA 2VCCA 1EIBA 4M24A 3ARPA 3VD3A 1TMQA 2DT2A 5EFDA 5C70A 4FLOA 1UWRA 1KWGA 1W9PA 1BVNP 4AIEA 3K1DA 4XV0A 1US2A 4XZWA 5D9MA 1UD3A 2VURA 4H8VA 3ARXA 1GOIA 2GDUA 2GSJA 2YL9A 2NT0A 1LL4A 3SUSA 3GM8A 3WKZA 1UR8A 3BSGA 4GQRA 4MNMA 4QAWA 1WO2A 2GFTA 4BQ2A 3PZVA 3GXTA 1KGXA 2WVUA 1XRVA 3OZOA 3ZJ6A 1E6NA 2V3GA 2X0YA 2V3EA 4HOXA 3BLKA 4GO9A 1O7DC 1JZ8A 1JDDA 1IZJA 2CXGA 3ARYA 2HVMA 2YBUA 1E3ZA 3FAXA 1UZ4A 4ATDA 1U2YA 4AXNA 1IV8A 1ZBKA 1Q6GA 2VZTA 3CMGA 1HT6A 3WENA 3WEZA 4W87A 5CSUA 4WSJA 2WVVB 5KEZA 1ZBWA 3HG3A 4LYQA 5HBFA 4W84A 1PAMA 1EOKA 4NZFA 1WNOA 4NZCA 4FNRA 2CKSA 2RGMA 3K4AA 3BMWA 1JGIA 1W9BM 4BCEA 3ZSTA 3AISA 3DYPA 4ATLA 4W7WA 5D9NA 5DT5A 1R33A 1UUQA 2CBVA 3WQ5A 3O9NA 3S5YA 2OYLA 2FHFA 1GQIA 5LA1A 5A8PA 1UWQA 2BNJA 4V2XA 1E6PA 1SZNA 3AHXA 3WDHA 3N17A 5GNZA 1PZ3A 2GJXB 4J3TA 1ZJBA 1XH1A 3OIHA 1OGSA 1H5VA 3FNDA 2PWHA 3DHUA 3BC9A 1TQTA 5A6JA 1NWSA 5BCAA 1GJUA 2AAAA 2VI0A 3SURA 4MTVA 3FN9A 3QHOA 3TA9A 3AXXA 3VIOA 3N12A 3A23A 3GYCA 3MSDA 4ZXLA 1KXQA 2E9LA 1W1TA 3MMUA 2G8ZA 1GQKA 3F5KA 2ZX9A 1DEDA 3ZSSA 3DX1A 3A4WA 5CG0A 5CSYA 4U2YA 1CYGA 1QI3A 3HJEA 2JEPA 4FNTA 1CZ1A 3W28A 3AMLA 3SCTA 1QNOA 1WZAA 3IK2A 6CGTA 3WF1A 1LL6A 5ABGA 3WY3A 5GPRA 4HTYA 5LA0A 2WHMA 3II1A 4HMDA 4P8XA 2WKLA 4MAVA 1BG4A 1ZL1A 3QHMA 1XD1A 5E6ZA 1OWQA 3CGTA 1JIBA 4ZE4A 4UQ9A 3BH4A 4JFTA 4M29A 3AOFA 2YIHA 5CGMA 3WH6A 2ZUTA 4GPNA 3VSVA 1CGYA 2BFGA 3WUGA 4PBGA 4QCEA 3CZ8A 1JZ3A 1QI5A 4OJYA 1E0WA 4MNLA 3PTQA 3FXYA 1GQLA 1JYNA 5AY7A 4MADA 1E6ZA 1VEOA 3CTTA 1H49A 2CITA 3BUPA 3L4UA 2VX7A 2HISA 4AZGA 2XFRA 1CXEA 2FYVA 1CNVA 4QCFA 3VINA 3WNKA 3GNRA 3NJ3A 3D5HA 2CCRA 3CZKA 2XFYA 3OGSA 4U3CA 1B30A 4PCSA 1GZJA 4MJ2A 1X6NA 1EGZA 2DH2A 3UETA 3VVGA 1VFUA 1KXTA 3CPUA 3WH8A 2J7BA 1HJXA 3W6MA 3NSMA 2ZXAA 3T0DA 3EJUA 1VFFA 3CZLA 3MUAA 4WKFA 3BVXA 5CPQA 1DP0A 2PBGA 2UWFA 1IZKA 2PC8A 3WELA 1X6LA 2WCSA 3BAIA 1VBRA 3VD5A 4TUFA 1VAHA 3BGAA 3O2LA 3NDYA 1O6IA 4L4PA 3ARQA 1L0PA 5CXPA 4NZJA 1BAGA 3QR3A 1ZJAA 3MUZ1 2WHKA 2Y4SA 2YBTA 4URIA 4HZ8A 1HJVA 1ITCA 3VGFA 3CO4A 4NRRA 3WFZA 1V02E 3GBEA 5DFAA 5DF0A 4HA1A 2OWCA 1MVYA 2VQUA 2JIEA 3FHAA 3WFLA 2WKGA 1CIUA 3AZSA 1BVZA 2VNCA 3LPGA 4HA4A 4P8VA 3WUFA 2J75A 3NUKA 3VM5A 5CLWA 3WNLA 8CGTA 4Q22A 2DSZA 1J0JA 1OCQA 1I1WA 1XH0A 3BLPX 2XVNA 4BF7A 4NXSA 4TTUA 5A1AA 3AYRA 3TTQA 2F18A 1CXFA 1JYVA 4BA0A 3EDKA 2VL4A 3AIQA 1HKIA 1WZKA 1CPUA 5CZKA 5A8OA 1JL8A 4Z2KA 6A3HA 2PF0A 2XVPA 2BY1A 1E9LA 4C7DA 5JIPA 1UKTA 6TAAA 3W0KA 2YKKA 2J4GA 4UQEA 1UA7A 3QHNA 4CU6A 1E1FA 5EB8A 3A6OA 3BAJA 1HP5A 3A4AA 4UOZA 1MFUA 4PMXA 3VD4A 1QVBA 3GXIA 1WDPA 1EQCA 3AXHA 2VZVA 2VCAA 1DWFM 2A3EA 1PPIA 3MI6A 1ITXA 4BS0A 5DT7A 3WNNA 3PN8A 2D2OA 1J12A 1KCLA 2EJ1A 1VEPA 3U7VA 2WSKA 1RH9A 3D4ZA 4PMVA 1FH7A 1T0OA 3W25A 1TZ7A 1E5JA 4AZ5A 4GXPA 5I0DA 3M07A 1LLOA 3EJSA 4PYSA 1GVIA 3PBGA 2XGBA 1ODUA 3WF2A 3F5LA 1ISXA 2XHYA 3BUBA 1UH2A 2WMKA 4D1JA 2XM2A 1BYBA 2ZX8A 5GQBA 3VO0A 5A6BA 3A3HA 3H54A 3GNOA 3SCUA 2WSPA 2YL5A 3PZIA 3AXIA 3N11A 3W81A 4GO8A 1E4IA 3AIWA 1TVPA 4LYPA 1PEZA 3BUIA 1LG1A 1KQZA 2EAEA 3K8LA 3W6LA 1KTBA 3GH5A 1UH4A 4QLKA 2CNCA 2PB1A 3ZT7A 3VIKA 1VJZA 3LMYA 3LPPA 1J9YA 1EO5A 5D4YA 2GK1B 1JNDA 2JALA 2RGLA 2ZUVA 4CCDA 5D8WA 2X05A 3WIJA 2X1IA 3SUWA 4OOZA 2ZUSA 1NWRA 4PMNA 4W89A 3OA5A 3GXPA 3W38A 2D73A 4UQBA 2A3HA 4DUXA 2GVYA 2PI6A 2JE8A 3VGHA 1XHGA 1UYQA 1V6UA 4EK7A 3EJQA 1DWHM 5I5RA 1XYZA 2XVKA 2ZX7A 1HP4A 1TQSA 4MB5A 1TR1A 2XUCA 1TQUA 4M56A 1WB0A 3VIPA 1BGAA 2F7RA 4N42A 4LYRA 2FGLA 3ZMRA 4AEEA 1M53A 1PBGA 3THCA 1DWJM 3I3DA 1Y7VA 4B9ZA 2IXVA 2J7GA 3D50A 4J3VA 3DX0A 2A3BA 1PX8A 3HU7A 4DWSD 1BFNA 1HL8A 4J3XA 4OKDA 4P7NA 1J0IA 4ACYA 4UQCA 4U2ZA 1QHPA 3W24A 2W5FA 4D6EA 1W32A 4CUCA 1K9FA 3NCOA 4OIFA 2CESA 3VNYA 1VJSA 2V5DA 1XSJA 1UWTA 4S3KA 4PTVA 2BS9A 4HU0A 4PCTA 3BUDA 2OW6A 2O92A 2DSWA 1BGGA 5FIPA 3WD2A 4AZCA 2OYMA 1TA3A 2XPKA 1C3FA 1XGZA 3MUY1 1J10A 4B3LA 3VGDA 2D0FA 1V3IA 1YHTA 3CZSA 4NX0A 3EJRA 1UR2A 4WKAA 4CGTA 3ZM8A 1R34A 3RM9A 2GUYA 1MW3A 5EFFA 1OINA 2XJ7A 1OSEA 1PIFA 2OWXA 2WB5A 1JD7A 2UY5A 5I23A 3RJYA 2A3CA 3VIFA 2WCAA 3VU2A 1WDQA 1BYCA 2YJQA 2ZIDA 4D6JA 3WSUA 4PMQA 1UD4A 1NWTA 5E6YA 4QP0A 4CVUA 5A6KA 2G4FA 1UD6A 1HVXA 3A5VA 3CZNA 3WH9A 1BSIA 4PUDA 4HPGA 1OT1A 3KLLA 1ZBVA 1YQ2A 1P6WA 2OSWA 4U5IA 3MV01 1KGWA 1JDCA 5JBFA 4CVWA 2VVSA 1JG9A 1E0VA 2FHCA 1H4PA 1XYFA 3BAXA 1PIGA 1V0LA 3N13A 2E9BA 5E09A 1FHLA 1I75A 3A22A 4JKMA 5A8QA 4FNSA 4R27A 2EPNA 4H04A 3ZJ7A 1FOBA 1FH9A 2WVVA 4PMZA 3WEOA 5M17A 1VBUA 2E40A 3VX0A 3DDFA 2XN0A 3WDIA 4W5UA 4ZEPA 2D3NA 1E4MM 5FCZA 4UR9A 1UWIA 2ZUWA 4AWEA 1MW1A 5BXSA 2C8NA 2J7CA 1CXLA 3ZIZA 4PMDA 3EDJA 2X8RA 2WAGA 3BSHA 4IM4A 2PBOA 3W26A 5I2UA 7CGTA 1VFMA 4U3AA 2XM1A 3M46A 1HJWA 3AZRA 3NDZA 2IGTA 4D6CA 1BYAA 3OLIA 3WF3A 3VUPA 1V3JA 4GZJA 1Z32X 3VGBA 2QMJA 3WBAA 2GJXA 4UFKA 1V3HA 3GH4A 4HPHA 1X1NA 2EPMX 3G6MA 2W61A 2XVGA 1JF6A 4UQDA 5D9OA 3K4DA 5BXPA 1J01A 1EDGA 3ARSA 4PTWA 3GXMA 4GI6A 4FLQA 1CENA 1G1YA 2CPUA 2WZHA 3CZEA 1EHAA 1UKPA 3WL0A 2VMFA 1I1XA 3GDBA 5HDRA 4D6FA 4PMOA 1FA2A 1GOMA 1H11A 1E40A 2Y2WA 2FE0A 1DWAM 3WDQA 1XSKA 1RP9A 2O9RA 4P7OA 5DO8A 1BPLB 1BG9A 2VX6A 5TD4A 2QV4A 2FHBA 1WCGA 4PN2A 2WMGA 1B3VA 4AZ6A 4GI8A 4FLSA 1R7OA 2ZOXA 3WDRA 2DIEA 4A3YA 3WQ4A 3BAKA 2XN2A 2EACA 5ABEA 2D23A 1N82A 1Q6DA 3WQ8A 4JKKA 1GVYA 4UOJA 1TFVA 4OUEA 3GXFA 3GZAA 3WH5A 5HNNA 3QOMA 1ISWA 3BVTA 2EXOA 1V08A 2J8GA 4C7FA 2DT0A 4BQ4A 3BCFA 3ZR6A 1GONA 2G3MA 4JHZA 3ZOAA 4PTMA 1UKQA 1A47A 2BVYA 3I3BA 1JZ7A 1R7AA 5A6MA 4TXEA 1OIFA 3RILA 1VRXA 1JAEA 4ZE5A 4A3HA 1ZS2A 4AD2A 3L4ZA 2WMIA 1E6XM 1H41A 3RM8A 5DEZA 4IPNB 2QHAA 4F8XA 1V02A 5E70A 3UR7A 3ARRA 1BQCA 1HF6A 4P7RA 4MDPA 4J3SA 1KQYA 5A8MA 4CCCA 1KWKA 1KGUA 1UQZA 2F1AA 1OT2A 2YL8A 2V38A 1HVQA 4WIWA 2PWFA 4DM2A 3AJ7A 1LG2A 1HTYA 2Z1KA 3PZMA 5EMYA 4J28A 1WPCA 2WBGA 1B31A 3HN3A 3NSNA 3HG5A 1CECA 1CTNA 1JYWA 1UWSA 4LGXA 2J7FA 3E1F1
chains in the Genus database with same CATH superfamily
2W07B 1CD1B 3KBPA 4IPIA 4IJTA 3IACA 3INUL 4R8WL 5H37A 5IDIA 2H3XC 2OR7A 4BR1A 5FJUA 4W70A 3AWEA 3G9AB 4Q6KA 4I87A 1OAUL 3EFDL 2H9GA 1PY9A 1EF3A 1R24B 3JTSB 3S83A 2O5ZH 3WMBA 1NDYA 2YOCA 4RESB 5C0IA 5D8JH 3NL5A 3VXNA 4XOAA 3U7WH 4A4AA 2AEIT 1UR9A 3HTWA 2BZ7A 3SGDI 1FWCC 2HV5A 3SIMA 3GLAA 1W0WB 4AIXA 3QDME 2PZNA 1OZUA 4WJG3 4J4PA 1WX0A 3EZJB 3DV4B 1ETJA 1SBSL 2DZWA 4LLUB 4NKOB 1IEIA 3QC3A 3RX3A 2VDQL 3BRDA 1LL1A 1N6VA 3GSOB 5AC5A 4FKKA 1VLIA 3WN5A 4OVUA 4Z7VB 3LLDA 3MJ9A 5B1CA 3DUUB 1JVNA 2O4EA 3CV1A 4WY7H 4Z2IA 5E1AA 3H12A 2BNRA 3WFCH 5DQDH 3KR3H 1OB0A 3NCJL 2W38A 5K1JA 3MBED 3O3AA 3CC1A 1P1MA 4XBJA 1NBQA 2FLMA 2NR6C 4I8YA 3O9WB 1DIDA 4Y89A 5T3XL 5TF0A 2DDQH 1CUOA 1XM3A 3VK5A 4PJ9D 2DH3A 4KWVA 4GAJH 3QZLA 4K2SA 2BOFX 1T1YA 3LNDA 4IS6A 3Q94A 3REQB 1TO5A 1NFDF 3P54A 5CCKL 2ADFH 5F3BB 1ZNNA 3ENLA 1UWGL 2VERN 5F0MB 5CBAB 4O8AA 2V7HB 3GLDA 4HC1L 2Q86A 2P80A 1TPB1 1AW2A 1OP9A 4GEIA 3L8QA 5HHOB 4D6GA 3NTCL 3W3OA 4I0PC 1PG7X 1ZT7B 1HK6A 1QWUA 3BFOA 3BVWA 4OZHA 2X7LA 1EEXA 2GEEA 1MCOH 2HTLD 3RVWD 1OCWH 2YFOA 2XN1A 3D2UD 1P9MA 2B7DT 5EO9A 4KRPD 1T7XA 4Y7OC 4GUOA 3E2RA 1DQIA 4ONHB 4KKBD 3TONA 3UU0A 4HPYH 1KXHA 3SGKA 2XA8H 1HEZA 1OK8A 1Z9NA 4IGBA 1AO7A 4PU2A 1EUUA 2XQYK 4CSTA 2CGRL 5TDPB 2X4PA 2FX7L 3S1UA 3UPCA 3W71A 1AGDB 1UWEL 2XG5A 2BP8B 2P44B 3SDAB 4ZOEA 3QFJE 3OG2A 3IAQA 1DEEB 3LSBA 4YX2L 2OMUA 5FWRA 4CVXA 2ALWA 4MAYB 1GPFA 5HR6A 3HUJF 3MYJA 2E9MA 1QZ1A 3OIXA 1MJUL 5KSBB 2YB1A 2OJPA 3LVTA 5EDXA 5JW5B 2MHAB 2V9TA 4QE4A 4XP1L 3UP6A 3FAWA 5U4NA 4ATWA 2EVJA 5AZUA 3RNQB 2HS8A 4JM0A 1J05A 5BZDB 3RAOA 1KB5A 1S2VA 5C7XH 3UABA 3CSYB 5EA0H 5LJYH 1UZDA 2V17H 3RKDD 3M0MA 5CWSB 4O10A 1FFPA 2F54A 3ZDXB 2VXSL 1AZVA 4N9OB 4UIOA 1RIVH 3TTOA 1KRMA 1CZ8H 1MZRA 2VAAA 4RX4A 4GG6E 4CAGA 3G5XB 4XP6L 3DERA 4MDJA 2HUEA 3TOPA 2EDKA 4PM1A 2J57A 5F7UA 1IGIH 3SO3C 2FIKB 1MJ8L 3MLUL 5I3DA 3QM3A 1IWPA 2A6JB 2XXFA 3Q6GL 1SR0A 1T89C 3JWDL 4DPCX 1DJGA 2Y23A 1K9EA 5BZZA 1W9VA 3AC0A 4TVUA 1Q5MA 5HPCA 3C60D 3P2DA 3PAOA 1B1YA 3QFWA 1BJ1H 3WNPA 4ZI8A 1TO4A 2R83A 2XKNA 2GYIA 5T1KB 3BPNC 2QDEA 4J40A 3OYXA 1DJHA 1L5GB 3S5LA 4YHML 1IWBA 5BXTA 4J2XA 2QFRA 4HCFA 3UJEA 3D0CA 4C91A 1SO3A 3BH8B 3WGVB 2DQFA 2EC9U 3K1KC 4JQVA 3LZ5A 3RAJH 3IT8D 1U30A 2EE3A 1S9XA 4Q8VA 3SD5A 4G5DA 3ZKND 1BDYA 1QTWA 2WD0A 3WE6B 4PS4L 3BWAA 1BIHA 2ACSA 4HMEA 3LH9A 4C65A 2I07B 3MC5A 3VXMB 4TU1A 5IF0A 1QNRA 5CCZA 4FQLH 1KKRA 3OM3B 1JPHA 3H3PL 2R27A 4LLAA 3PDDA 1RJQA 2XH2A 4JHAH 5I6LA 2VR5A 1V55B 3WD0A 4P49A 2V9UA 1Y6KR 2OK0H 3S6OA 1BD2D 3HC4H 4EN2A 3FCGA 2G3JA 3BP7B 3UNDA 1QTPA 2AQTA 4JFUA 4HT1L 3C8HA 3QIUD 4RNRB 4QXGH 3J2PA 2QHRH 2CXEA 3FOMB 3UBHA 3V0IA 2E46A 5LN8A 2B20A 1A21A 1P7KA 4RAVB 5FF6A 5ADOH 3IGKA 3TYUA 4YZFF 2XKUA 3A47A 1B0RB 1NDVA 3TZVB 1ZEAL 4OWGA 4LF2A 1RHHA 3VXPA 1JVLA 2BNQD 1XPYA 1MRCL 3L4YA 2NTFB 3JS3A 4EVNB 5I15L 4JG9A 2CZVA 5FHBH 3DJ9A 2IOOA 4NO3A 2W67A 2BS8A 1C5CL 3JV5A 5CC5A 2CLRA 4YHZH 5H94A 4D2NA 2V5MA 5CO1A 4Y9AA 1A9BB 3SIKA 5HHMB 3VRLF 4XP4L 3MV9B 2KLTA 3SSJA 4UOW0 3NIDF 4WSKA 4Z3JA 4O02H 4HU8A 5DFVC 1QNSA 1R8LA 3BSZH 2R91A 4A8NA 2Z7KA 3O6FB 4JTUA 4MWAC 2WY3B 2BCKA 4KUZL 4V2BA 2Q3XA 2AXFB 5EU6A 3KPSA 1IAKA 4LLMB 1JF1B 3NJLA 4IRSC 1FGVL 1WT5A 4WUKL 3TO4D 1WQ5A 2QAPA 1Y5WA 3DKHA 1U8CB 2KKQA 4YMZA 2EO9A 1MCHA 3CHDA 4Z2HA 4A68A 3PGCA 2RFGA 1K7EA 4WUUB 4HW6A 5TQLA 5JR1L 4M02A 4LPVA 1KCVH 2Z31B 2B59B 4OJAA 4D94A 4I5BB 4B91A 3ARDD 3I6LD 2CDGB 3UIZA 3MO4A 2YRLA 2WLIA 4IP7A 4OZOA 5AOLA 4ELMB 1WDAA 3BSMA 2OX4A 3VMPA 1UH3A 4Z7AA 3MCKA 4DAIA 3BRGC 4R26L 5FEBA 2Z7GA 4UI2A 3O6AA 3LRSA 4DO4A 5CP3A 4GSDH 1M7IB 4JGNA 2X0WA 3TNNB 3BGJA 2WLLB 3MRMB 4KY1H 1QSFB 3NDYE 4R7LA 4K7PL 3O63A 3VKAA 4TF4A 1QFHA 3TNMB 1FNAA 3TCSA 2O72A 4HZAA 1J5DA 4IK6A 4PJ5B 3AWFA 3IGSA 4HZLB 1H8NA 1AKJB 4ZPVA 4X7TB 1AQKL 3KS5A 3V0FA 4ZTYA 2SEBB 3SY1A 3CFJA 5C2UB 3UOAB 4EMZA 3S8HA 2NY5L 4PJIE 3C56A 5AW9B 2C15A 3UPBA 4JCWA 4UBPC 4IU3A 5JBEA 3LV3A 4UDTB 3FYPA 3QAZC 4Z5RA 3JV6A 5EIVA 1I8IA 1T1WA 2PMZA 4NCDA 5IBXC 2C7UA 5D2LE 3PHQA 4C8XA 4ZSTA 5MHBA 2YMOA 1BQRA 4QOKD 5FUCE 2ZRYA 1PO9A 1MXSA 4X9IA 1H0DA 5MKGB 1N2RB 2N4IA 5GJSH 1UB3A 2X4UA 4M5TA 4JIPA 4PV9A 3RBGA 4YXLH 1O5RA 3U6WA 3TXVA 2OVLA 1U91A 3QV7A 3CUPB 2HVJA 4L9DA 4JK0D 4L1WA 2VEGA 2EEDA 2V37A 3E6HA 3HQ1A 2VO8A 2HVNA 2GI7A 3A4EA 1B6DA 1K3IA 2DLIA 2OMXB 5IRPA 3OXSA 3VD0A 1QU4A 5IFJB 4ANUA 2CIPA 1ZTXL 1EZVX 1H09A 4H41A 5JMUA 5G2WA 3ARED 4XVOA 2FBRA 3PZTA 2C9VA 3LMJL 1TTGA 4G9DB 3AM8A 1P5UC 2CLLA 3UTTB 1E4XI 3ARPA 1SUJA 4E9RA 4C6KA 4WEUD 2IDUA 4Z95H 2J7LA 1ONEA 5D1ZB 1W8OA 2NX9A 5E6SB 1SVBA 4Z7QF 3TT3H 3OR7A 3ZE1E 3RGBA 4JQ1A 3GTTA 1RZQA 2VOMA 5XINA 4HLJA 2NVAA 3JSSA 2I5YH 4QAWA 5C2GA 1YC7A 1Q45A 1KGXA 2DLHA 1ZLPA 2V3GA 2V2XB 4HKPA 4DK3A 1KTRL 1NGWA 3LCWA 5J8OA 1Q6GA 3UXLA 2X16A 3THAA 3T81A 4PJBF 5BQ7B 1HQRB 4BH7B 4Y1SA 2WQVA 1F5ZA 1NOAA 3IJHB 1HDMA 3K4AA 5C0QA 4BCEA 4GKOA 4ZOBA 4P3CL 4RFOH 3DO4A 1DL3A 4F4RA 1UUQA 1DV7A 1L6WA 1NCIA 1F5WA 4JFFD 3HRZC 3MROB 2FSEA 1UB5A 4Y5XB 1E51A 4L8DA 2X89D 1C9SA 4AYBA 2VDMH 1NC4D 3G1YA 3BC9A 3L3KA 2AAAA 2R14A 5CHNA 3OD3A 4AV5A 1H3UA 3L1FA 3B03A 4H7CA 1MMFA 3MMUA 4JDZA 2G8ZA 1MPAH 4XMPH 3ULUL 2IQ0A 4OCRL 4JM2D 1Q9LA 2AF2A 2E76C 4OUOA 3MV8A 2ZDSA 3CFMA 1RK0A 2H3DA 5AW6B 3TKFA 3DUUA 3O8AA 3UQNA 3BH4A 4G42A 2L7UA 5EF0A 3CFEB 2ZUTA 3T0XA 2PTXA 5ABTA 3TIDB 3SGGA 2Q3AA 2Y6SD 1U95B 2GHZA 5PCYA 4ADGA 1WWCA 4YWIA 3BIAX 4RIRB 3L4UA 2HUHA 2XBZA 5AVNA 3UA4A 3CLMA 4BKTC 3WLRA 4PCSA 2WXQA 1HE7A 4WSHA 4JPWH 3G18A 3EJUA 1K8XA 3S96B 5CPQA 5E4EB 4HJEA 3TJPA 1X6LA 4PUKA 2DLTA 3KHOA 4MS8D 4AH2B 4PRAA 4UBDC 5ERWA 5F3BA 3RXZA 2KH2B 4MDIB 4I2XA 4PJHE 3PJSA 4X6BB 2BM3A 3UXDA 3VM5A 2JJSC 3T6XA 5AD0A 1VPOL 3QNZA 2XVNA 4L23A 2MFNA 3SI9A 4M6OH 2GJ6E 2NXYB 4ZS6C 3HQNA 1NMCC 2VDNL 1H5BC 3G1SA 1F74A 3CH8A 6A3HA 3LA4A 3TGXA 2A3LA 4H6RA 1U2CA 1HILA 4ONHA 1XCTB 2J4GA 3QIWC 3DOHA 4JFHE 2PLJA 1SN5A 2VGIA 1AIFB 1R3KB 4AGQA 1WD9A 3GMRA 1XDLA 1SHXA 4IIQA 4WEEA 1DVFD 4YSPA 5KVDH 4PYHA 4L18A 4NQVB 5FA3B 5AYZA 1QO5A 1HTIA 4YHIA 2PPEA 3G8EA 2Z1XA 4E41E 3P9MB 1QG3A 1H3PL 2A73B 4JTGA 2J43A 1DEEA 5IREA 3QV8A 3NAAH 5EU9A 2D2GA 3VC6A 3GNOA 4NQSB 3W81A 3NQKA 5DVOA 4HIJA 3W72A 3NFSH 1EJWC 1F90L 1VJZA 2XVBA 3MQTA 4OM1H 4KBXA 1KN4L 1ED3A 4PW3A 5JHBA 5JHAA 4QHUB 3QB7C 4PJXE 4Q4EA 3QDMD 3CHRA 4TSCL 3M1CA 4DUXA 3H4WA 2E5CA 2WBJA 4UUIA 5GRJH 2UBPC 3L6FB 2XUCA 4E9XA 5DHVB 3I02A 4N42A 1NQKA 4Y1AD 3VRJA 4TUKL 5DRXB 4YSRA 1AR2A 5JDSA 4TV6A 3BW2A 3DGGB 1JHTB 4NNPL 2PO6B 3PWAA 2NWRA 3WUZA 4LCWB 4QXIA 3W2DL 3QXDA 3NO1A 3O6YX 4XPHL 4HK3J 2ZCLH 1SDYA 3G5XA 2BS9A 1RZ7H 3U36B 5IY5B 2QZ5A 3T3MF 4WTZA 2V9DA 4N8CL 4I90A 4WOZA 4MZ1A 2FIKA 3RL2A 1LBLA 1Y0EA 3UCRA 1R34A 4KO6A 2GUYA 5TK2A 2XJ7A 2X5PA 5I23A 3BVNB 5H37H 3CEUA 3U0TA 1UD4A 1X5ZA 2ZOLB 4K23L 2KLSA 1A02N 2VERA 2X4TA 1A0EA 2AERT 2EKJA 4IOFD 4HPGA 5EF1A 2JTYA 4LBSA 4MUZA 1FWTA 1L5GA 4TUJB 3GTVA 1JDCA 5FOJA 2Q71A 1I1AB 3GS4A 5ID1A 1FHLA 1QW7A 3BH8A 3SY5A 2A38A 4OR1A 1WAUA 5EEWA 5F9WB 1TX0A 4YCOA 2IFFH 1Q4WA 2IEPA 2DJSA 3TVMB 2XN0A 4H3DA 3WDIA 4JMXA 2XOTA 3FSWA 4WO0A 1MW1A 1SW3A 5JIQA 5T9BG 5GS0L 3W7HA 1HHGB 1QR4A 3EO9H 1INEH 3UBXB 3MRRB 5GGVL 3IJDA 3OLIA 3VVVA 4Q7BA 3WTVA 4IBSA 1OIOA 2F19H 3CQQA 4O1FA 5HDLA 1JFQH 3MJ9H 4TR9A 4FTDA 2XHNA 5BXPA 3TBYA 1YBQA 4L4TE 4DRSA 4JHWL 5DC2A 1F3JA 4NUQA 2TODA 3UZYA 1EHAA 3LENA 3T0VA 4F33A 4PMOA 4EVZA 2JB5H 4ZMNA 5CH9A 3B8WA 4XVUC 1H3TA 2WMGA 1UOZA 1UJ3C 5F89B 4RNRA 4XC1L 1R7OA 3D47A 3QI9A 1NJ9A 4XPTH 3ROLB 4RFEB 5HGGS 3HV8A 4OF7A 4B2DD 4UOJA 5FM5M 5HDQH 3V6OE 3QFJD 3TPUB 1LEGB 3DBXB 3IJSB 4RAVA 1JQVA 2DZSA 4UANA 4AWJC 5DRWA 5E6IA 2UZIL 3P84A 2OT0A 4S2SB 1TRDA 3OV6A 3EOTL 1H41A 2ADJA 1B0RA 3AUJA 3WKPA 4F3FA 3EH3B 3ZY7A 1YMMA 3RURA 1A6TA 3VE9A 4Q3MA 7PCYA 1DDTA 4M4RA 4WEVX 4IQLA 4Z7OE 1K5NA 5EMYA 4RBPH 2VLKD 3TFBA 3B2MA 4A6YB 4A38A 3W23A 1NPJA 5JYLA 2YDAA 2OCJA 2YPVA 4H1LA 4E36A 3RI5F 1P5VB 5F1IB 2ED8A 4PTDA 1KT2A 4XB7A 4WTWA 4KGLA 1A3LH 3PZQA 3GVQA 1A0QL 3A0OA 1YSOA 2UVFA 1G94A 1RLDA 5HTSA 3GTNA 4UV7H 5EBLB 3B56A 2DSUA 4UM8A 1BXBA 3WLSA 1TZZA 5CCJA 1JPFB 2XQ0A 3B9KA 3RDKA 5FPIA 1W1YA 3S97C 2UZPA 4PY7B 4JG5A 4LP8A 1MFEL 1OTSD 5FJTA 2W80C 1Q1PA 1CEOA 4XCEA 2P3YA 3CLFH 4X83A 4TSAH 1ZGLP 3AS3A 3ZE2E 1ZLEA 3HPXA 5I3HA 4PJDA 1OCBA 4FZ8H 2C7FA 4X6EB 1NCOA 1WOBA 3GSWA 1VGAA 4Z0XB 4TYUA 4XNXL 1DOSA 4JREC 1F76A 2RCSH 1YXCA 5T1DH 3AI0A 1MAJA 2BSTA 4M1DH 2C91A 4WHBA 3AGVA 3PNWB 2P9RA 3BWUF 3CUHA 3TCEA 4YN3A 3NFNB 3N2XA 1VGEH 4P9MH 1FAIH 4Z3FA 2JK5A 3VG0L 3NZQA 3T9WA 1REQA 3EYSL 1KB5H 3ISYA 3VM7A 5AVSB 4EN3C 5LGJA 5JQ6L 1A6AA 3CUJA 3ZRFC 4HG4K 1RPKA 3K2MC 1MLCB 3VI4E 3L4WA 5CSSA 3EAUA 5D7IA 3QJHB 2D20A 1E6OH 1BOYA 3C8NA 3DSFL 4P9HL 4PJ5A 4ELKB 5IGXH 3HFYA 1MCRA 1FVPA 1GR7A 4LVGA 3CMJA 3UG4A 4HWBA 3DYMA 3NTYA 4AHOA 4LVOC 3HE6D 5GRYA 3WMLA 4N28A 3IDUA 2K45A 4AVKA 2C4XA 4LCVA 4U1GB 1CDBA 4QM1A 2BWDA 4K2UH 2YC1B 4G6JL 3FYIB 1BFTA 5TAOA 5K7JA 4QQUA 3IAPA 2OGJA 3ZWTA 4M5ZH 3EB4A 4DPBX 1EL3A 5DD3L 3VZYA 1FBIH 4JZNB 3V4UH 5A43C 1UXWB 1IQDA 4R53A 2R4SH 1W37A 5MKGA 2OJZL 5ABAA 3L12A 5AYUL 4PLKC 3D6GA 3MVIA 1MDLA 4KX8A 4APXB 4CQ9A 2OJEA 4JKPL 1TJ1A 4S2CA 4CQBA 4WKHA 4K0OA 1G87A 3ZYJA 1M6JA 1W31A 1I7RA 3CFTA 1F8TL 2YSTA 4JGJA 5C0CB 2E6AA 2BNRE 5GSRB 2CQVA 3QQXA 3GJEB 2A74B 1NWUA 2FGWL 4HFUL 1TWWA 3HS0C 1KACB 3WKMH 2QGCA 4U7MA 3MTXA 2VX5A 2A4EA 2I85A 1YTDA 1E50A 4OZ4B 2R24A 4NJGA 3TJIA 1CDIA 4KJQD 5IFAH 4H8WH 2WLHA 3DHDA 3PL6D 2EXTA 1ES0A 2IVFC 2J25A 3VTTA 1UBPC 1E30A 2PGWA 2EIMB 4Y2NA 4GBUA 2E86A 2DZVA 4MX7A 3BJ91 3Q48A 1IGCH 1KLGA 2JKPA 4P46C 1OAQL 3F2DA 4RGMB 4Q14A 5TH2B 5E1HB 4D3CL 2C4FT 2JEQA 5FSDC 3BPLB 5DD5H 1EYWA 3VOFA 3BURA 3O6KL 3TDFA 3EOBB 2WW8A 2P53A 4LDLB 4DBDA 1BVKB 2YXXA 5FECB 1VLXA 2V8LA 3QJRB 5KTEH 2CLKA 2DVUA 4WX2A 2X2YA 2D31B 2PDKA 4GUGA 5FAJA 1AGFB 1WH0A 4JRLA 4C60A 4Y4HC 3BXNB 1CLOL 3DX7B 5I6SA 1G7HB 2EH8L 3ULUF 4WEMB 1JV5B 5BO1H 1Y1DA 2HSIA 3P3RA 1K8IA 3DENA 3RDTD 3KXFA 4FIRA 4LSVL 4PN6A 2Z6JA 4MYPA 3KEDA 4UNVA 3NCWA 3V0VB 3CFBB 4WU7B 5DJ0A 4OM0L 1KENH 3PWVA 2DMHA 3N2CA 3F12B 3KDPB 1EJXC 5I8CB 1GUVA 3TX4A 2VRAA 4PB3A 3AICA 4FX6M 3G0SA 5LBVA 3FX4A 4Y16B 5BYWA 4TLTA 1ONQA 1ROCA 5C0ND 4DKEL 3GVGA 1YEFL 1GVQA 3H55A 2K78A 2NVDA 2BVOB 2UY4A 3RWCB 2FO8A 5AVYB 1IGJA 1S78C 1PXGA 2X7WA 3APGA 2AI0H 1M7DA 3RU6A 4HUVB 5KANG 2ALRA 3HZVB 3MHFA 4ZFZA 1B9ZA 3VFSA 3RLHA 4GXVL 2XU9A 3C12A 3UWVA 5CQ1A 2W95A 5AHIA 2RQ8A 2XV0A 2XG9A 2Q8XA 1QHOA 3N4AA 2HWGA 3C6CA 4DWSA 2XKSA 1JPEA 3M17A 1FL3B 3CAQA 4D72A 3WQVA 2CYGA 1G6RL 4LVNC 3UFIA 3L08A 2A2QT 2DM7A 4N0FA 4QS6A 4EPSA 5CP3H 3OF6D 3D3VB 3VTAA 2VYRE 4YL4A 5HDBE 1A1NB 2FK9A 5AALA 5HI5C 1XIWA 3UBXG 2QCDA 4JD4A 4HHAB 2OI9B 1SXAA 1WA0X 5K39A 1SO4A 2DI9A 1K2DA 4CLMA 4OLYL 4BI6A 1OGGA 4FSAA 3EHBD 4IFRA 3RB7A 1Y6NR 4I1PA 3Q45A 3I7RA 1EHNA 3TFCA 2E0PA 2ZVRA 4FQCH 5KYYB 3V2AR 1TPFA 3ZKXC 2FX8L 3ZS4A 4QRPE 1JK8A 4M5YH 1ZPUA 4C6LA 3N3EA 4KRTA 1MFAH 2HT2C 1WCQA 5CJXA 3ZTCC 3WG7B 4WJ5B 2CM5A 4KZEL 3OLEA 1MFCL 3F7VB 2R69A 2BSSB 3FQXB 2W91A 4FQJH 2YUVA 1A2YA 2X2HA 4S11A 4U1NB 4N90E 4D71A 2IWKA 2FPVA 3NM1A 1VFLA 2J47A 2N01B 2FTYA 2POZA 4NQVA 3ARUA 3UL4A 1TVHB 2R1WA 4G5ZH 1Q9OA 5TE6H 2WP3O 4X0KB 1FNLA 2UUDH 1ZAHA 3FC8A 3QPYA 2VR7A 1GW0A 1IGFH 1JRHH 2BVQA 3FFCA 3OJVC 5A94A 4CBZA 4CQAA 4YVVA 3PUGA 3AWOA 3QIBA 3SKOB 1TPWA 2DV0A 3Q8CA 1S4IA 4Y9FA 5TQ2H 3SJNA 2WZMA 1I8LA 1NF0A 5KVFL 5HVGB 1N8OE 4IX0A 4FQIH 1BZ9A 4WW2C 3QSKB 4JTRA 4WKZA 3VFPA 1OGPA 4TUUA 3T4AB 3L6FA 3G5EA 1DVXA 1G7QA 5DHVA 1PLAA 3QULA 4LY4A 3OAWA 5D71L 2Y5JA 3D69B 1O6SB 4OCWH 1KFWA 4ZUSB 4HJGB 3PIQA 3AUVA 1PCXA 1TU2A 3L66A 5KBMA 1OSYA 2HE8A 1RR2A 5IBTL 1U8JB 3HGSA 2DV6A 3GIVA 1SOXA 1JI2A 3ITCA 2YFNA 1XRTA 2QUVA 4R7DB 2PXYA 2PSNA 1GKQA 1M04A 3RLSA 3KZ8A 3MLRL 4A21A 5E8DH 1FH8A 3O0RL 1BF5A 5I6NA 1UROA 1EZSA 3L95A 3X1FA 3AQDA 3W7KA 1KTLB 1WIUA 3SDCD 3EKCA 1PAZA 4M3PA 3A4DA 2NV2A 4TVCA 4JPQA 3WJMB 4AISA 4AOFA 3VNKA 4X80H 5KYNA 2YCKX 2Z8SA 3R7MA 2NW3B 1X5LA 1Y18A 4N2AA 2CJUL 1KFJA 3QDGE 1KC5H 4KRZA 3PWUB 5DXWA 5I1AB 4RMRA 3TVMA 2NY4C 5I75B 3BMXA 4X6CF 3SCMD 1DQDH 2V2HA 4K7VA 4TL5A 2OR9H 4NQCB 3B0XA 5U7SA 3GSUA 4HIEA 1MJ7L 1YYCA 4N0UA 5EEUA 3KLKA 3TWCL 3N1MC 3O3DA 3ZT5A 1PKMA 2GJ6D 3CZUB 3QN3A 4N9BA 5KSVA 3K2UH 4HF5L 1PZBA 4FG2A 3C6LB 5E2UH 2FTPA 1BQHB 5FKYA 4QRTB 4PR5B 1TWDA 5AKRA 2HK0A 2YS4A 4LCIL 3K71B 3CO8A 4JFHD 2YAOA 1BGXH 1TJRA 3DPDA 4QNPF 3UIYA 3BLDA 2OCCB 4H1ZA 5J6GB 2JWYA 3URAA 3ROLA 3BJFA 3M0KA 4M9PA 1CDHA 4JTTA 4E41D 2OXGB 5F6IC 3TR2A 4AD4A 5IB5A 3H22A 1JR1A 2OBGA 2AEQL 1ETA1 1F9CA 3D3AA 3WY4A 4Z9KB 3IU3B 1IIGA 2OQLA 4HLZG 4K3JH 4YNYB 5D2TA 1D9KB 2D2JA 3LH2H 3T6CA 4XN9A 1LZOA 3FOLB 4JKWA 1VZHA 2XY1A 2SODB 3QUYD 3ARXA 3RDJA 3MXWH 3SQMA 4FX5A 3FO0L 3LKQB 2Y8UA 3T78A 3CT2A 4KNQA 1UZ6F 1OJXA 3F4NA 3EWBX 3KWWA 2BZNA 4PB0L 3PZVA 3RBSA 2X44D 1KG0A 5C0GA 4EI5C 3NM3A 1GT8A 2IQAA 4XPGH 5IB3A 1AZUA 1U2YA 1AFVL 4PJAB 1TIUA 4CDHA 4GAGL 5DO2D 1PKLA 4R2GD 3MUCA 2FSDA 4PGJA 3SHSA 1QR7A 1FYTB 4NZCA 3NYZA 3H9SB 4C4KT 1XIMA 1N3NB 3BMWA 3SYPA 5DT5A 3TYCA 5SX4I 3DXAB 1MVFA 4PY7A 3R25A 5IB2A 4TMPA 5C3TA 1SBBA 4ZTOH 4NJAH 4RBPK 2NY6D 4OCLC 4CEUC 1IYXA 4E9VA 4BH8B 1J1PH 1A5CA 3NWRA 4XZIA 5EBMB 1TVLA 3UZXA 1T2QL 1XZ0A 3FUHA 3GU2A 4XVSH 1HCFX 3SADA 1KXQA 2B1AL 3PREA 4TNFA 4UU9B 1I45A 3T0EA 3RWJB 5BZWA 4ZYKA 3V5KB 3HJEA 4LSDA 1XINA 2BX7A 3NDZE 4IDLA 5GSVB 1NM4A 4IKJA 5FKAB 1IU1A 3BKMH 5KUMA 3V1HA 2M2DA 2N3JA 1T8XA 2YPLB 3UO1H 2ZG2A 5B1JC 4M29A 4PJ8D 2LU5A 2CNYA 2QIIA 5CR8A 4XHJD 1UB6A 3L3HB 2VD9A 4G9PA 1MLCA 4R4FH 1VEOA 4XOBA 1H49A 3DHJA 1KPUB 1VACA 3L5WB 3SDDD 2RJMA 15C8L 4BY3A 4ELKA 5IFHH 5KYXA 1KYAA 3D5HA 1NGXB 2XFYA 2VWEC 4XMZA 4NDMB 3H7UA 2DH2A 3HZKA 1P7QD 4YQXH 5JPMC 4HX1A 4YFLI 2X0VA 2RUSA 4DJMA 3ZTJG 2I26N 3KMDA 4GP5B 1XL4A 4ONGH 3W7GA 2PPAA 3PPFA 4YSCA 3WHE0 3O2LA 4R34A 2P5NA 2DLGA 3V5CA 3TEWA 1DBKH 4O00A 1ITCA 4JTFA 3WFZA 1RUKL 2KZWA 4G72B 2VQUA 2GBVA 1BVZA 4O16A 2WQSA 2FX9H 2A4ZA 1PJWA 4MJHA 2DN7A 1XYMA 1W5NA 4BCYA 1I1WA 5G4MA 1U58A 3JZ7A 4OE7A 5I1JL 1BJ8A 2AK1L 4M3JA 2CZFA 2R2EB 3EDKA 2BP0B 2XVPA 2BDNH 4N9GA 3HBLA 1MCJA 2P48B 4PJCA 1EEZB 4NZ8A 4YK4B 5GSRA 4NAFB 7FABL 3A6OA 4IFKB 3VFVA 1SZFA 2OZNA 3G6JF 1F3DJ 3MLZH 1YRKA 4PP1C 4A8IA 3P3SA 4RMVA 4QXTA 3LDVA 1S39A 3SGDH 2ZSVB 2W5PA 4AZ5A 5EBUA 3NQ7A 3F5LA 3DAQA 1PLGH 5C2BH 1CX9A 3JUYA 2R2BB 2M8XA 2C3VB 3EYOB 4KK8C 1QUNB 4ZFOL 3CZFB 2Y25A 1E28B 5FLVA 1TVPA 4OGQC 4FQXC 4P2CG 1DUZA 2JKNA 6REQB 4AYDC 1R3VA 3RWHA 3LHWA 4AFYA 4JFQA 3E0GA 2A9NH 2AFNA 1EO5A 5IV2B 1XLJA 4FKHA 3L3DA 2PW1A 1X5AA 3IRPX 4JY8A 4AVFA 3RR4A 5DDHB 2FWLB 1QZNA 1LD9A 2BSCA 4PD4K 1GTHA 3O11B 1XFPA 4LSUL 4RDZA 1I8MB 3UZZA 1WA1X 4OZIB 2IS7A 4LASL 3VA2C 1JPMA 2EIZB 3W2LA 4AEEA 4ZXBC 1BVKA 1JSYA 2IXVA 4ERSL 4R7JA 1J0IA 3HE7D 5BXFA 2F38A 4KAQL 2CUIA 2D31A 2GIMA 1R3RA 4FCAA 4OIFA 4NZUL 4P59L 2CESA 2YW4A 1POKA 3H7BA 5F6HI 2VITA 2DQIH 2EG7A 1BGGA 3WD2A 3GIZL 1RZJL 2QL1A 5E5UB 3BN9D 3CFUA 2YPVH 1CICA 4APQC 4H1LH 4REQB 3FT0A 2Y7OA 3OB0H 3QDHA 4QRQB 4ZBJA 3BUTA 1IM9A 4G7QB 5EFFA 1S3TC 4IMLA 2ZC8A 4NZTH 3SQBB 3HBQA 3HG1A 3TA3C 4PMQA 2VLLA 1D3GA 4KFPA 2UY6A 3IKCB 5AVUB 3H42H 4J3OH 4BFIA 2J8TA 2PP3A 5GS1C 2DIAA 3CK0L 4XXWA 1DSYA 4HH8A 1KGWA 4G6AD 5JDJA 4MJJA 4HIXH 3VA6A 5KYWB 3OJDA 5B7YA 1J8VA 4PV1C 2BVOA 4Z7NB 3RWCA 3WLQA 2WYTA 5F7MC 5TFSL 1PUDA 1AXTH 3ATAA 2EE2A 4JTDA 1GL4B 7REQA 5C09A 4HHPA 2W0KA 1M1XA 5HY9A 4PMDA 1M2OA 5KG9B 1EBPA 7CGTA 3RF9A 1T22A 1LO5B 3ZLGA 4AYID 2ESVA 3C6SB 3GU1A 3QS2A 1I31A 1MQ8A 5DUPH 2RGSA 2H45A 3BP4B 5D9OA 1CVRA 4HSHA 5BRZA 4WZ9A 1CENA 2J6VA 1S7WB 3REVB 4D7BA 1EF2A 1IR2A 4QG8A 5JUEL 5M7QA 1RZGA 1DWAM 3DFYA 1M7UA 4AZ8A 4JNZA 3DVNB 3PJUA 4P7OA 1BG9A 1J87A 1U8KA 2YSSA 2A77L 4QYOB 1N7MH 2NXZB 5C07B 4LO9A 3PB0A 2XN2A 4F5CA 3QUZC 1BQHG 4HWBH 1E4WH 4TSBH 3VQLA 1G9MC 4PJGF 4LP5A 2J8GA 4BQ4A 2ARJB 5ENWB 5LKYA 1UKQA 4OCYH 2ENJA 4F7EB 1KLUB 5JPNA 1EUNA 1M2VB 3PAJA 1JEZA 3B37A 2ZPKH 4H25B 3WSQH 3W9DB 3BOXA 2J6EL 3NIFF 4BKSC 5FF3A 3VNIA 4JRXB 1PBYA 3FO9A 1ZS2A 3FSUA 1KBLA 1E6XM 4HCRL 5FYKH 5FJRA 4NNAA 4WNJA 3UR7A 5D1ZI 5E5RB 2FIQA 2YL8A 3WMPA 4A55A 5KINA 1P84J 3FQXA 3LN3A 3W1UA 4JHMA 3ITYA 5AEAA 1G7MB 4U1NA 1JWMB 3J27A 4MXWL 5BV7L 4XI5C 4Y19E 4LB3A 4LGXA 1FKXA 2PPFA 2TYSA 1HZKA 2ZKXA 4G3YL 1PYWB 5HHXL 5B8CA 2VCOA 2GBTA 3LMZA 3OKOA 1W54A 5MEPB 3E80A 4HU2A 4TLSA 1MI5A 2VR2A 1FRGL 1EH9A 5K33A 1DQUA 3RUGA 4KVNL 3U2CA 2ICEB 5I78A 1ZT1B 1NVMA 2GT9B 2A0LD 3ZHDA 3JUGA 4N1HB 2IWEA 3TZNA 5D7HA 3USBA 3RB5A 1BZQK 3UAEA 4H88H 3OXRB 2WV3A 4CQCA 4AHPA 3S2CA 1TUXA 2W9DH 5DJZB 4B4FA 3T2NH 2O93L 3RHWF 5B3SB 3L5LA 2PS2A 1OP5K 2G30A 3M1BB 4WO4D 3K72B 2OEJA 1DQVA 3DLQR 4I9WE 3CHFA 4D8PA 4E2DA 3OKMB 5HYJE 5HJGA 1NCBH 4M6NL 4ZPTB 5CIPB 2UUDK 5GRWA 1NINA 4PGEB 1RUAL 5EWIH 4DVBA 2D1ZA 1U8JA 2ICES 1ZZMA 4AEOA 1F58L 3ATEA 4BFAA 4ZW3A 3RKPA 3GJFB 3MACL 3O7UA 4X9HA 2FJFB 4C7GA 3Q1SH 4JFVA 5B80A 2CRYA 5I3FA 2EXYD 4HYVA 5I6XB 4AQAB 4KQ3H 2OODA 5C0AB 4CNPA 3MBWB 1G0CA 1KTLA 4L9YA 2Y22A 4YIQA 1OPGL 2WUBL 5C6PB 4DGIL 2DPKA 3WJMA 3LTPA 4ORMA 3EOSA 4FP8H 1N26A 4Y8DC 2ZAGA 4IMEA 2J21A 2BRRH 4K9EC 5CC6A 1LP6A 1I82A 1UTDA 3MR9B 3VWJD 4UFHA 4QSFA 2DYPB 3W07A 5AENA 1L6GA 2H6PA 5CLTA 3QHFL 3FEQA 3S1VA 4IHBA 2V5TA 4Q6JA 4IJ3C 5GNYA 1FNEA 3FRPG 1OARH 2VZSA 3UAJD 1E9YB 4XB3A 4KY2A 1IGSA 1XYAA 2FMNA 3T4CA 3PG9A 3C6LA 3SOBL 1DLFH 4QRPD 4G9FB 3QQ3A 2WWNA 2GQ3A 1A5LC 1Q8MA 2AVGA 2TAAA 1XL9A 2HLAB 2Z3FA 2E5EA 3MBDA 3TT1L 2ZX6A 5FIEA 2P1FA 3Q06A 2Y8VA 4D0BA 4GA8A 1LJYA 2F61A 4N90D 5EB9A 4JY5L 1QFEA 4MHBA 2BHYA 4F8OA 5JW4R 3W39B 3A67H 4XN1A 4QMEA 1K4GA 4KKLC 1DN0A 4A04A 1SUXA 4ZAKA 4LRTA 4OFYA 1WK0A 1WDSA 3DX8A 2G2RB 4XTIA 3L65A 2X4RB 2EPLX 2QAFA 1VJIA 4X9SA 1T03L 5MP6H 5LXXA 3AZUA 3ECBA 1POJA 3IU3A 4MNJA 4MKVA 4YNYA 5F0JB 1D9KA 1CL7L 2A83B 5BUGA 5DJDB 1HXYB 5SWSB 3DECA 3ILEA 4XCCL 3RGVB 4YPGB 5JXAH 1OM0A 4YAQA 2DEYX 3KYNB 3K1GA 1V3MA 4Y1TA 1CFVH 2W9EL 2H9AB 4O13A 3H7LA 3KWUA 1V77A 4BK4A 3FJTA 5FYKE 2IXQB 5IWLA 4DI9A 5FLUA 4U5KA 2YLLA 1S2TA 4OIIL 2VZ1A 1FNFA 1YNTA 4F8PA 3DBSA 4KDTC 3SKUD 4JTJA 2VDLL 3CFKB 3VQMA 3FDGA 2CR6A 3N2BA 2WK2A 3MLVH 3POCA 2VH5H 5SV3A 3WFHB 3AXKA 1FYTA 3VC5A 5JXED 2QLVB 3ORWA 3IFPB 2BY0A 4FRWA 1N3NA 2R69H 5LDUA 5HPMB 4GBXB 3WIIL 1SZEA 3THDA 1EMTH 4WWID 3CIWA 2V0TA 3IV3A 1TPVA 3MOQA 2ZZ5A 1NFBA 4B3ZA 2BHUA 3MO1A 5DJ8A 3PP7A 4K55A 5C7ZA 1CLYH 3VG9B 4C6OA 3PF3A 1BKHA 2E7LC 3D18A 2E3VA 4NNCA 1OCNA 2EDXA 3TP4A 4NKQB 4M6VA 1F7BA 1X7TA 1J9RA 1M7JA 4EQ3A 4CDGC 1JE6A 3AB0B 4FALA 4OD3H 4PVMA 4Q0XH 2YQGA 3VFGL 5KJ7E 4CKVX 3DUSB 3QDGD 4ABUA 5HR7A 2QADB 4OAWA 1BYDA 1PZ5A 5F4SA 4X42A 3F7KA 2W07A 5G5DB 1HINL 3BVUA 4AC1X 1CD1A 2FATH 1B2YA 1F2QA 5DHVH 3FGCB 4JEQA 2OV0A 3DHPA 1RMFH 1YPIA 5F8RC 4AL8C 1FIGL 1E4HA 3CAFA 3GRIA 1ZU8A 2K0RA 4KGJA 4EXKA 1R24A 3JTSA 3EYPA 3TASA 3L2NA 2PURA 3ZL2A 2YDQA 4P8UA 1UD5A 3UBXI 4HA0A 1NGXA 4HWEL 4LL1A 4IRZA 2WTPA 4NDMA 4GG9A 4K6AA 3B2UD 2Y69B 2EVGA 4AZ7A 3N14A 1E4XH 1L9MA 2XV2A 2CO1A 4F8TA 2IPWA 4PGLA 5EF3A 1W0WA 3FSOA 2VE6B 1JPIA 4QLRA 2AJXH 4KI5E 2DFAA 3GXNA 3S48A 3DV4A 3HBGA 5GS2D 3GEFA 3V7PA 3KXFE 2XZQH 2VDHA 4LLUA 4NKOA 3DFHA 3LOWA 3GSOA 1PE1A 2FECL 3AADB 3SO7A 3CVCA 2Y72A 4Z7VA 5E5MB 4H9VA 2FT8A 1CS6A 1ZHAA 4MA7L 2JB6B 1PDKB 2GBAA 4U6YB 3CQKA 5HK4A 1AHWC 4O2CB 4XAGA 4MAUL 1ZA3B 4WAFA 4YDIH 5LIKX 4KK6C 4EOWH 3GRWA 2MKLC 2TSBA 1LWHA 4TVPH 3S5ZA 3A6CL 1Q72L 3T0AA 4P3WA 3O9WA 5CS7A 2OL3L 2CRIA 1I3RB 4KZDH 2AQWA 1ECEA 5BNKA 2EDWA 2WLMA 3U1QA 25C8H 2EYTB 3EOLA 3KTSA 1IJ9A 3T0BA 2B0SL 3NPUA 4KO5A 2UV3A 3RPIB 4BFGA 2NY0D 3S5OA 4L5FH 3JWNC 5TE4L 4W8BA 4DO6A 2EGZA 5C0BB 3B9EA 4NAJA 2ISWA 4V15A 3NZHL 3REQA 3FMGL 3SODB 2N7BA 3EYOA 5GGSY 3LKRB 4HS8H 3P8JA 5CBAA 2V7HA 3VKKA 2VYOA 1YPZE 1XJBA 3MGAA 3QJQB 3FKKA 3KBMA 4E9LA 4HJIA 5HHOA 3L9CA 1EO7A 1W91A 2BK8A 1DYZA 5CZVL 1ZT7A 2QV5A 2ZX5A 1RV6X 1G7UA 5GGSB 3OZLA 1TMHA 3V0TA 4DYEA 3WN6A 4FMVA 5J5EA 4OZIA 4MA8H 5F9OL 3B4UA 3CUIA 1XIHA 2WWDA 4EAMA 1KC7A 4KNSA 4G7YL 4JFOB 5FOOA 5J1AB 4BA8A 4S0TD 5AHEA 1HKKA 1ILSA 3QORB 3CHVA 3DH7A 2AK4E 3QQNA 3ZQWA 2PA6A 5TDPA 4LF3B 3QG6B 1QW8A 1RPUA 4WK0B 1PHWA 4MJIE 4I7VA 1AGDA 4YDKL 5DK3A 2BP8A 5SWUA 3GHUA 3SDAA 4DKAA 5I1DB 5DQDL 2BSRB 3V0WH 1I3UA 3VX1A 3V6FB 3NEHA 3F7RA 4LMQI 4LCQA 4EE9A 4MAYA 2PUQT 3LZOA 1A7QL 5KSBA 3T1WA 3L67A 2DTMH 1YLVA 4F66A 4PRTA 5JW5A 2MHAA 1P4IL 4W93A 2WJEA 2K4AA 3VGGA 4P4KB 3ESMA 5E99L 3TN5A 1MRDL 4A2MA 3KYKL 4CNIB 1Z48A 4WGWB 1F8IA 4AJVA 3RNQA 3BJTA 1SW7A 3FFCE 4IIBA 5BZDA 4LPXA 4PCKA 3UTSB 1DBAH 4LVHC 1LOSA 2ZUMA 1XSIA 1Z2KA 3CSYA 1GYNA 5CWSA 3B0UX 4Q4OA 2VXNA 3DJRA 3FTUA 1YEWA 3OB0K 2W4XA 2JTDA 4AQLA 3BXWA 3G6LA 4PULA 4B5VA 4Y4KD 2GTZB 3VMOA 3U57A 3SAZA 4FAMA 4ZFCA 5KYUB 1WXJA 2J78A 3S7GA 2HNEA 1LO5A 1F6FB 4JUTA 5DJYB 3C6SA 3W0WE 4HOZA 2A6JA 1HXMB 1CLKA 4IHCA 3F4WA 1FLTX 3AU0A 3QWOB 4MFEA 2GVLA 3DK0A 4MA3B 4RDQG 5F96H 5JUVA 5GJTL 1JTPA 4I5XA 2H2PD 4GUFA 5T1KA 4E3TA 4NUPA 1MELA 1G5GA 2GVJA 1AMKA 3OTRA 5B7ZA 2QF8A 3NK4A 1X7FA 1SUHA 3ULSB 2NY1C 1GGOA 4OLZH 4CMMB 1JXKA 5E8NB 4G8GE 4KDWA 1JCMP 5I6OA 2VGGA 1QI4A 4BHUA 1K6AA 3FVDA 3WE6A 3VXUE 4F15C 3GU9A 2EKGA 3MP3A 3BJLA 4BFNA 2I07A 3B4NA 3VD3A 3VXMA 5J56B 2JGQA 3XISA 4Z42C 3AQZA 2PDIA 3N50A 1E6JH 1S7RB 2WQRA 5LGKA 2YL9A 3VFLA 1TV8A 2NT0A 3K4ZA 5E23A 3GZPA 1M1BA 4Q8NA 3O6ML 3PBYA 4N0UE 1NMAH 3IEAA 3NZ8B 1DQMH 5DEFB 3BP7A 4L9XA 4AXNA 2VZTA 1XEUA 5DT1H 5HYIA 2GY5A 3GHSA 4MRBA 5C6MA 4L9ZA 3FOMA 3L81A 4HU4A 5DZNA 2N1TE 3HC3H 2CKSA 2OU4A 4JM2F 4LY8A 3N2JA 3KPLB 1ZV9A 4G6KL 4PWHA 2QDWA 1Z6KA 4X6DB 4XNMB 1T83A 2WZTA 3GO1H 5EOCH 3MW7A 3HNVL 3AHXA 1EHKB 4QD2E 3HF3A 1ODAA 3MCOA 3OIHA 3VKCA 1O5PA 2VXQA 1H5VA 3RX9A 1FLRH 3TZVA 3R5EA 4YSUA 1NCNA 5DEJA 4XE0A 5DBTA 2PCXA 2XWBB 1FORL 5F7YC 4C5YA 3OKMA 3A23A 3L1OL 1E9ZB 3MJ6A 5KZEA 3GYCA 1NEUA 5D37A 1A50A 1VPXA 2ZZ4A 1ZLWK 3PWPE 2NTFA 4EVNA 2QIWA 3UGRA 4RSYA 2TRYA 3RAJL 4JO3L 3IK2A 6CGTA 1O5KA 4EEEA 1A9BA 3GJFA 3QJUB 4NZ1A 3MV9A 5FYJU 3PUOA 4WCYH 5E6ZA 3TWYA 3IPEA 3ULVC 1GGTA 3D39E 2ZKHH 2YIHA 5KVDE 5CGMA 1N8WA 5HGDB 1F0LA 3O6FA 1TVDA 4IBVA 5INCB 2OKTA 3IPBA 3LHTA 4YXHL 3MBWA 4JLRB 3ZZSA 3QXBA 3MRCB 1I3GH 2AXFA 4LLMA 4DGUA 4UTUA 1JF1A 4DNMA 3LD8C 1CD8A 1GZJA 3ROOB 2Q2EB 4GE8A 4C58B 2L7QA 1VFUA 1U8CA 2J7BA 1HJXA 1U8PB 4EPKA 3NSMA 3KNBB 4KX9A 5FGSA 3DX9B 3AQXA 4WUUA 5JNYB 2Z31A 5JHDB 2X2GA 3RY4A 2B59A 4I5BA 2CDGA 3F4DA 3ISRA 4ZQKB 3LNHA 4ZQNA 1GQNA 2OM5A 1E27B 3F3HA 1GC1C 3E12A 1I7TB 1JZDC 1DBBH 2WXPA 4K7FB 3QR3A 3S3JA 4M43H 4IBYA 4EBQH 1KV8A 4ELMA 3O2DL 4HGMA 3TK7A 3TR9A 3O2VL 2WKGA 4PHZA 3LPGA 3AO0A 1DVJA 1KXQE 2B5IC 1R3TA 4G9FA 5DVNA 3T0EE 1WG3A 2DQUH 1M7IA 5A1AA 5GZOD 3TNNA 2ITFA 3ARBC 5MENE 2WLLA 4AMKH 3MRMA 5IW3A 3T3PB 1QSFA 4BA0A 4WJEA 2Q20A 4UV4L 4MY1A 2VFFA 4YSSA 3TNMA 4Z2KA 3CDFA 2KDGA 2XJLA 1PG7H 4C7DA 5FHBL 1AJ7L 4QHKI 2VW6A 4Y19D 6PTDA 1RCOB 4HZLA 2MNRA 1AKJA 4X7TA 3RWEB 3GXIA 3C0SA 1MG2C 1A9VA 4LOCA 4MZYA 1DWFM 2SEBA 5DT7A 1N59B 2YAPA 4O02L 1ZV2A 1JGEB 4NI8A 4KHTH 2BJMH 3BSZL 2ROYA 3DTXB 4UDTA 1UH2A 3SO3B 2XM2A 3LUTA 3T4WA 4R9HA 3L48A 2A83A 5DJDA 4RXFA 3NSDA 3ZLHA 3RGVA 5KS9B 3RE0A 2WSPA 4ZMWA 1MSPA 3CV6A 3W6LA 3BARA 2CNZA 2WYZA 3ZT7A 1UCWA 1QFWL 1N2RA 4ODSL 2R0ZH 4KU1A 4I9WD 3BPNB 5LAXB 1NWRA 2EHHA 4NNXB 5HYJD 1DWHM 4F24A 2G96A 3SDXB 4GJTB 1XYZA 3U4BH 5ENLA 3H2NA 3AGWA 1RK1B 2HG0A 5CMAB 2E27H 3CUPA 3F85A 4WU5B 4KRMB 1A0DA 1NMBL 1SDAB 1N18A 3HU7A 4NJIA 1ZY9A 3GMMB 3C5ZC 4PWIA 2H4EA 2AXGB 2EUVA 2ZOWA 2W5FA 4X9GA 4RSVA 2OMXA 3NCOA 4KCWA 4QEHA 5IFJA 1XSJA 2YMXL 1S9VB 3BP5B 4Q4PA 2IQ9H 1XLIA 4PJCE 1UR3M 2OYMA 3IU4L 5LNWA 2RAGA 4LAQH 2X30A 1U8NB 4G9DA 3ITVA 3CZSA 3UTTA 2QYGA 2BRQA 3A3WA 1MW3A 1TPDA 2X3AA 3MOBL 5D1ZA 1ADQA 3N3TA 5E6YA 4GYFA 5FF0A 2AQ2A 2E6PA 3UJTH 5D7JD 1IEBB 3DUSA 1AUSL 2BWQA 5D96C 3ZGHA 4XTRC 1QWHA 1JXDA 2C6QA 2V2XA 4FYTA 5IKCB 4O19A 1PIGA 3DVFA 3QG7L 3SM0A 2O5XH 1S2EA 2VC2B 4P5TD 5DC0A 5D2NC 4HSCX 4OZHE 5M17A 4ERIA 5BQ7A 1HQRA 1OTUC 3NZ1A 4BH7A 1XR8B 1S5MA 4Z7WB 1CFBA 5IR1B 1UWIA 3OAUL 3IJHA 5BXSA 2AHIA 1DCEA 5IW6B 3W26A 2BBFA 5CZSA 4WZHA 2Q8AH 3MLYH 4LEEA 3WXWH 3MROA 3FUMA 2X3CA 4A2GA 5I09A 1W56A 3DN5A 1KV5A 4Y5XA 1AO7E 4NQTA 3GK8H 1ID5I 4FYSA 1U1HA 4HPHA 4YXLL 2EPMX 2FJHB 5FGCB 4LHUB 1OC5A 1JF6A 1FG2B 3KPOB 1DXIA 3IRZA 2HKHH 4PAZA 3M0HA 1AZZC 5HDRA 1UUNA 1V4YA 2FE0A 2TRSA 5ADPH 3D87B 1GZPB 2HWZH 1IIHA 4U4MA 2YXFA 4Y2WA 4E5TA 3TF4A 1Q9WB 2HBVA 1MVUB 4MWAB 1YX1A 4GP8B 3LZQA 4OFVA 2Z4GA 3K2KA 2DJMA 3MAWA 3SN1A 3ZL4H 1HNFA 3CFEA 3BVTA 3ZR6A 3GKWL 5DQ9B 1QBMH 4IRSB 1DFXA 4NYLB 3QUXD 5A2JH 3TIDA 4NHVA 2ASHA 3N19B 1U95A 4GG6F 1WV7T 5T33L 3SE8L 4AD2A 2WHVA 3TT3L 5FYKD 4RIRA 3RM8A 4UTCA 3CHQA 5JU6A 3ARRA 1U8LB 2A3TA 2F1AA 2F54E 5JOPE 2V38A 1P6AB 1ONRA 2B4GA 5C9XA 3S96A 4XNDA 4JYDA 2Y07L 2X0SA 4A7GA 1RBOB 2NYYC 2G3FA 3VYLA 4E0CA 1R30A 1A49A 4FHJA 1K6WA 4S1FA 4Z23A 3BIBX 4AH2A 1XEDA 3F64A 3HHRB 2V5CA 1DSWA 4JR9L 3SY6A 5K9XA 1GGBH 2ESVE 4P5MB 4MDIA 4RFOL 4X6BA 4P8WA 5BRZE 4RGOL 1J5IA 3E9AA 2W81C 1K8YA 3AT8A 4XPAH 3N29A 1JZIA 3DFQA 3VI3B 1EBAA 1IBFA 2VDML 3EX4A 4K8HA 3IAGC 3MLXH 1FNHA 4F5CE 4MKNA 3BICA 4UINL 3R13A 2VN7A 2XI9A 3KL5A 1XCTA 3UBGA 3UZWA 2J4WH 3TJHC 2PKDA 3R8GA 1X5XA 5J1AA 4AT6B 3E2QA 1AIFA 1CFSB 1R3KA 3CWOX 1S3KH 3LTSA 1EHLH 2J1WA 3QAZB 4IKKA 1OP5H 3OMZA 2V5SA 1JRCA 1GZGA 3MJMA 1HZLA 3STCA 1QOPA 3A5FA 5FA3A 4CC4A 4C59B 1AG0A 5L4JA 1Q4NX 3P9MA 2A73A 4UZUA 2ZJSH 2ZBTA 1FFQA 1H3VA 3V6FA 4D8LA 4YDLC 1T0MB 1DO6A 4NQSA 3C6EA 3F58H 2MUCA 1D7BA 2GDQA 4PUJA 2XQBH 4S3EA 3MI2A 5TPWL 4MOZA 2AXHA 4JS7A 2H6OA 1GPOH 3FO1B 4QHUA 2YD6A 4OKVB 4CNIA 2HZGA 1AZBA 1MI5E 1HL4A 2QQKL 4C6PA 4KI5D 1RK5A 4X4YB 1NEYA 5IQOA 3OJMB 3V4VL 4RGNB 3KXFD 5DRXA 2V2TB 5C8BB 1K72A 3DGGA 1JHTA 2PO6A 4LCWA 1Q1JH 2HG5B 4KEUA 1ZGDA 4XCFL 3H9ZA 1ADWA 3M86A 4F8LA 3U36A 4PHXA 4MLIA 4C1KA 4M6OL 2VJXA 4QCIB 1AMYA 1U0QA 3VSQA 2NZLA 2FH8A 4JCLA 2Z1SA 4LXFA 1HXMA 3BVNA 3ZZ1A 3P2BA 2JKTM 2DWEB 1H50A 3ZX1A 2ZOLA 3SN0A 2OO0A 2DP3A 2DYRB 3P4MB 2Z2BA 3TEYA 2F6KA 1B90A 1BJ1J 2B8OT 3N04A 4TUJA 4ECLA 1KM3A 1FUNA 1URZA 3ARFC 2X2IA 2YK1H 5E24E 1I1AA 4URTB 5MHSE 4NI6A 5KETA 1FO0B 5HMDA 3C5QA 4Z2JA 4JB9H 4IRZH 4W9ZA 4LRNL 1XRSA 2F1EA 4FG6C 5EU6E 3KPSE 4JMNA 1CGTA 2WZ0A 5TK4A 3DIFB 1UHVA 2HA1A 4A7SA 4AQZA 3NFSL 2YN3A 4GD0A 4DJFC 1HHGA 3P81A 3C5XA 4Q4SA 3UBXA 3MRRA 2JKAA 4N2KA 3EDEA 4DPAX 4HZ7A 4DPPA 4Y4FC 4YSEA 1TTAA 2CHZA 5BXRA 4JAWA 3N18A 2VFHA 3BVDB 2LLLA 4OLWL 3B9AA 1V6YA 1EFXD 1UZ8B 2BW5A 5I1IH 1N8IA 2N7AA 1NAML 3GRWH 2J7DA 1J2BA 2AK4D 3D46A 2DQHH 5F89A 4MJID 4YDZA 4RZ6A 4RFEA 1YEEL 1RUQL 2CCVA 4PG2C 4ZQPA 4XRCB 3EB2A 1YEGH 4N87A 3VFOB 1A6WL 2GOKA 3TPUA 4PYGA 2FB4H 3WQWA 3P67A 4NZRH 4PJIF 1LEGA 3DBXA 1J18A 2AP2A 3IJSA 4X6DA 3V6BR 1GG1A 2GW5A 2E1WA 4B96A 1B4KA 4F57H 1W2VA 3UMNA 4XOCA 3MJWA 4XAWH 3CSBA 4S2SA 4XXCA 5D2LF 1V6XA 3U2JA 4XWGL 5I1GL 3QAQA 4DIXA 4IMKC 4KXCA 4P48A 5ALBL 4XBEH 3CQFA 3OJGA 5J04A 5DVLA 3FCTB 5I28A 4M8UA 1KM1A 4WVXA 3KBJA 1CO1A 1OVZA