2WVVA

Crystal structure of an alpha-l-fucosidase gh29 from bacteroides thetaiotaomicron
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE
publication title Analysis of the Reaction Coordinate of Alpha-L-Fucosidases: A Combined Structural and Quantum Mechanical Approach
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 157
structure length 438
sequence length 438
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wvvA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wvvA01
4F8XA 3APGA 3L4TA 1UD5A 1BAGA 1FOBA 8A3HA 4DWSC 5HXMA 3CZGA 3EBVA 3VVGA 4JIEA 3GXTA 3WY3A 2V5DA 2VO5A 1NP0A 3ZJ8A 4GIAA 2Q8XA 1QNRA 2Z1SA 4BF7A 1JAEA 2VOTA 4EANA 2YLAA 2XPKA 3AS1A 2ZX5A 1QI5A 5D9NA 3AHTA 3H53A 4IM4A 1J10A 1BFNA 3WBAA 3AXHA 1QWNA 3WMSA 1EIBA 3IGUA 5JBEA 4C7DA 1OGGA 1NP2A 1VFUA 2OLHA 1ZBVA 3S2CA 4MADA 2D1ZA 4RE4A 1O6IA 2CITA 3N18A 4M29A 5CG0A 3CGTA 2PWFA 2W4XA 5JIWA 4Z2IA 1HKJA 5FOOA 4GZIA 1FA2A 3VDHA 1WO2A 4BZYA 2J47A 4CD4A 2XGIA 1Q6GA 3AJ7A 2PB1A 1WZMA 4FNSA 3N9KA 3VIIA 4C7GA 3CHCA 1W1TA 1RD6A 4R27A 4JL2A 3HG3A 1TFVA 4XV0A 3VD9A 2E9LA 1XH0A 4P7OA 1OB0A 1E4NA 4KWUA 5GQBA 1CXLA 3NSXA 1JZ8A 4JHZA 2D73A 4F9DA 2ZXQA 2VNCA 3TA9A 1HVQA 4OBSA 1UASA 3BGAA 1SR0A 1PPIA 1D7FA 1VJZA 2PWHA 2VRJA 2BHYA 2E4TA 2VT0A 5IDIA 2JALA 5BWFA 3AROA 1E6ZA 1WNOA 2WK2A 1PZ2A 4P8XA 3K8MA 2RGMA 3KEHA 3GNOA 3ZMRA 4WIWA 3GH4A 3S5YA 1HJSA 1V03A 5I23A 5A3HA 2W63A 3VX1A 4URIA 1MFVA 1QVBA 4YHEA 5HNNA 2X8RA 4FNUA 1UH3A 1LL7A 2EPLX 1H0IA 1B90A 3OBAA 3LRLA 3UERA 5D9MA 2OYMA 3FHAA 3BSGA 3LMYA 4PTWA 2PWEA 5A95A 2YL8A 1XGZA 4LYRA 2GJPA 1UKSA 3NDZA 3MV01 3WY2A 4AD2A 1UYQA 2OWXA 1LL4A 1W9PA 2J7DA 4MJ2A 3M07A 5I0DA 4PSRA 5ABGA 3UG5A 1E5JA 3A4AA 4KGLA 3BCDA 2EO7A 3IK2A 1KXHA 2F7RA 2WCGA 2WYSA 4DM1A 1DTUA 4JFWA 1W9UA 2WZHA 2CERA 4PCTA 3DDGA 4P7LA 2W91A 1B31A 3BVWA 3VO0A 4W7VA 2XWEA 3PN8A 3AFBA 5KEZA 2WMFA 1HX0A 3EDDA 3QOKA 1W2PA 3LRKA 5A6SA 4UQDA 2GDUA 1C3FA 3AMKA 2GK1B 4PMXA 3MMWA 2YDRA 1HJWA 3CC1A 4PBGA 4M1RA 4B3LA 2BHZA 2VJXA 3ZR5A 1UD2A 1ZJBA 2PWDA 1G94A 3O2LA 4UR9A 3CZNA 3IJ7A 1A3HA 1QHPA 2W66A 1B9ZA 1BG9A 1QBBA 1PJ9A 1ISWA 4PMNA 3EJQA 2BY1A 1SMDA 2G8ZA 3RPMA 2XUCA 3WDIA 4Q22A 4NZJA 1AQHA 3KWXA 4HOWA 1H4PA 4AW7A 5CPQA 4AMXA 5FL0A 1DWAM 2B31A 2JE8A 3T2OA 3F4VA 2ZX7A 2DT0A 1GOIA 4HZ8A 5HPOA 1MQQA 2J7CA 2YFNA 3ZIZA 2WC4A 1V3MA 2G3JA 3N1AA 1QPKA 4IUGA 4PMUA 4UQAA 2E9BA 3LXBA 3KE0A 2XG9A 1MVYA 2D0GA 3SCSA 4OOUA 2WVVA 1E6RA 3T0DA 4CVWA 3WH7A 2FH8A 4ATWA 1KFWA 1ISXA 2WMGA 3I3BA 1CLVA 3SCWA 4AZ7A 4UFIA 2JF7A 1HIZA 2ZUSA 1UR0A 2NW0A 2VZOA 4AIEA 5D9PA 1IV8A 2XN0A 4W8LA 1UD3A 1EDTA 1H1NA 1LWJA 1HJVA 1LL6A 2HISA 1D3CA 3W37A 4P8UA 3JUGA 4GXPA 1ESWA 3RJXA 1VENA 4ACZA 3B9EA 2WBGA 1W1VA 1J11A 2XHYA 4AZIA 5HPCA 1HKIA 4CN1A 3AOFA 4TX8A 2Y24A 2J75A 2VZTA 4PTMA 4WJXA 3CZJA 2WZIA 5EFDA 2E9MA 2F2HA 4D6FA 3WUFA 1VFOA 3BUPA 2VVNA 5JUVA 2EXOA 4QAWA 1RP8A 5GPRA 4ZE5A 5KZ6A 1HJXA 2A3BA 2OW6A 1TG7A 2AMGA 2VVSA 1WZKA 3NCOA 3SUVA 3KZSA 3SUWA 5AYBA 4B9ZA 1R87A 1J18A 3F5LA 2FE0A 1XHGA 3PBGA 1R8LA 2YKKA 4W8AA 4Z2GA 3M46A 3MMDA 3QHOA 2W67A 1KGUA 4CU7A 3S5ZA 2EACA 4V27A 2HVMA 3SCPA 1UWUA 4QDMA 3MO4A 1KR0A 3ARVA 4W85A 1OCQA 3CZEA 3EJPA 1UWSA 1VFMA 3UETA 4AWEA 4DUWA 5GNYA 1MYRA 4PMYA 3HN3A 1OD0A 4H2CA 1TMQA 2BNJA 1KXVA 2DQXA 3A6OA 1V02E 3SCQA 1CGWA 1E0XA 1Q6DA 2OWWA 1B2YA 5CJ5A 3HMCA 3M7SA 4QP0A 3EMQA 3MMUA 1YHTA 2XVLA 1UQYA 2V3DA 4XX6A 3D4YA 4UFMA 4HPHA 3BAYA 2G4FA 1H2JA 1HXJA 4BQ3A 2F1BA 1OBAA 4ACYA 5C8BB 4TVDA 3F5JA 3VMPA 2QPUA 1H11A 2Y8KA 1NH6A 1OGBA 2F1AA 4J3UA 2YLLA 1QNOA 4J28A 3WNNA 3OLGA 6CGTA 1F4HA 1UR1A 5I3DA 1JYWA 4MAVA 4MTVA 4NZCA 2UY4A 3D51A 3W4RA 1XD0A 2VTFA 2FHFA 2CEQA 1FHLA 3DDFA 1BVZA 1W9XA 1HKMA 3A24A 2WLZA 3B9AA 4MDPA 2UY3A 5E09A 2CETA 2DIJA 1CNVA 1EOMA 1UA7A 4NRRA 1AVAA 1UH4A 3OLDA 5EBAA 1V3JA 3BMVA 5LYRA 4AYSA 4QLLA 1WP6A 1UKPA 1GPFA 2XM2A 4HA1A 3BLPX 3OLEA 3VGBA 3O6AA 1XSJA 4E4PA 2BY3A 3N17A 4Z2JA 1E55A 3AIQA 4WSJA 2E0PA 2BXYA 2DT2A 1TCMA 2F61A 1HJQA 1MW3A 2DT1A 2VR4A 2YBTA 4GPNA 5EMYA 4CD8A 5IHRA 5DF0A 1GOQA 1QW8A 5CXPA 1NWUA 5ABFB 1MWOA 2D24A 1E40A 2EPOA 3VD7A 4CCDA 4HOXA 3GDBA 5JBFA 2BS9A 3WQ6A 2WHJA 1UR4A 3A4WA 1KR1A 4LXFA 3VU2A 4C7FA 1VEMA 1MXGA 3HJEA 1UH2A 4ATDA 4XZBA 2VQTA 3GXPA 3BVXA 3ZT6A 4B15A 4UTFA 4MNKA 2WAGA 2O9TA 3ARUA 3EJSA 3T08A 1ISVA 3L4VA 1OINA 3FXYA 4JKKA 4W7UA 2G3NA 2C7FA 4OZOA 4H8UA 2VCBA 4RL3A 2QMKA 4CN6A 2BVYA 3DECA 1Q6FA 2UWFA 5A6MA 3ZSTA 1IZKA 1LJYA 1M7XA 4XUYA 5M5DA 3N04A 2J62A 4AMWA 1WB0A 4PMOA 1V6UA 2DH2A 5DEZA 1V6WA 1QNPA 1HXKA 4N42A 2X2YA 5A69A 2F7OA 3EDFA 1E6SM 5A6KA 3RDKA 4MAZA 3IANA 1QWUA 1C7TA 1BQCA 2F7QA 5FL1A 1GJUA 4H8VA 4FK9A 2DGAA 3BSHA 2PC8A 4H04A 4ZENA 5FIPA 4IPLA 2FGZA 3EDJA 3FW6A 3VM7A 1G01A 3NDYA 4ACZB 4FNQA 5A2AA 4Z2LA 2O9PA 1WZLA 5TD4A 2FHCA 3AI0A 3PZIA 5GNXA 2EJ1A 1OT2A 1CGXA 1E6PA 2V3GA 4CU8A 1J0HA 1VEPA 2GJXB 3WKZA 5M03A 1JZ5A 1VBUA 3OGRA 4M56A 1CXEA 2WPGA 3U5YA 4QCFA 3WNOA 3WH6A 4GZJA 3SCUA 1VF8A 1NOUA 1GOMA 3TP4A 2CXGA 4OIFA 4XB3A 4V28A 4WKAA 1RP9A 2GUYA 4OGZA 5M17A 3WNKA 1DWHM 1J0IA 1OWQA 4AZ6A 1J01A 1KCKA 2CBVA 3VTRA 1PIFA 1CLXA 3HG4A 4HU8A 3FHQA 5CQ1A 1HNYA 3PZUA 4PMQA 3TTYA 4Q7NA 4NF7A 3T09A 3VMNA 3WFZA 7CGTA 1F4AA 1DHKA 3W26A 1GJWA 3VILA 1UZ1A 1UD4A 9CGTA 5A6LA 2ZUTA 4AZHA 2PWGA 4EAMA 3MU7A 2WHMA 3WH5A 3QHMA 3MI6A 2MANA 3WL1A 3SCRA 5A1AA 1E3ZA 4J27A 7TAAA 3L4YA 4W93A 1PIGA 3AS2A 5CSYA 4YPJA 1C90A 3VDAA 4OJYA 1GQKA 2FGLA 2BVTA 4JKMA 5A94A 1DWJM 2CHOA 3LPOA 3CZ8A 1EA9C 1NM9A 1XYZA 2NT1A 2GVYA 1JDCA 3ARTA 3A22A 1JF5A 1BSIA 1QX1A 2RGLA 1QHZA 1ZBKA 4U5KA 1PS3A 1T0OA 3ARSA 4PTXA 3VKKA 1PBGA 3I3EA 1PAMA 1UQZA 4LQ1A 4CD6A 5I2UA 1XH1A 1CECA 2C8NA 1BG4A 3ZO9A 3GH7A 4CN4A 1V0NA 2ALWA 4UCFA 3AXXA 4QLKA 3PZTA 4BS0A 2XIBA 2ZUUA 1E3XA 5C71A 4OKDA 2W62A 2VX7A 2G3MA 1VRXA 1GHRA 4F9JA 2CYGA 1HKKA 1QOXA 3G6LA 3VNYA 2J7HA 3EJUA 4FLRA 3S6TA 3SIMA 1R7OA 1QNQA 2AOSA 1VB9A 4WF7A 3WD1A 4UQCA 4DO6A 3CLWA 2WCSA 2DPEA 5E70A 5A8MA 3WD4A 1R7AA 4E8CA 4LYPA 2WBKA 4MNJA 3WEZA 1V0MA 4JCLA 4BA0A 1BLIA 4J3VA 3A4XA 1B3XA 1GOWA 3WDQA 1TQSA 3PZVA 4E2OA 3CUFA 1CPUA 3CUJA 3ZJKA 3EMZA 1ITXA 4F79A 5CZKA 1ODZA 2VZVA 2X09A 3BUQA 3MKKA 4AIUA 4W7WA 2VZUA 1BYCA 4NSBA 2BY0A 5D9OA 1JD7A 1P6WA 1SZNA 3CZKA 3AHYA 4J7RA 1TQWA 4W88A 2DSWA 4KRUA 3VSUA 2Y4SA 1LQ0A 4UFLA 1XSIA 5CPTA 2OWCA 4BCEA 3BUIA 3AQUA 2X2IA 2VUYA 1VEOA 1CTNA 2YA1A 5HOSA 2A3EA 3WDRA 2NT0A 1PZ3A 3CUGA 3ZJ6A 2WC7A 1CWYA 3CV5A 4B9YA 3WF2A 1UR2A 2V38A 2VQUA 4CCCA 1H49A 3VGEA 1U2YA 1EXPA 4N0RA 3BXWA 1B3VA 1GVYA 1TA3A 1XCXA 1LG2A 4U3AA 1H3GA 1H09A 4MB4A 4P8VA 3AIUA 3DX2A 1GOOA 2DSZA 1OD8A 5E1QA 4UFJA 4ATLA 1E15A 3WELA 1JZ7A 2G3IA 2YDSA 1V0LA 4P7NA 2UY2A 1MW2A 3PZOA 3WN6A 1NWTA 3MANA 4WK9A 1OGSA 3ARRA 4ML4A 3BVTA 3IAPA 4Z2KA 1YQ2A 1R33A 1CYGA 4M82A 1ZJAA 3H54A 2YBUA 2CKSA 2WSPA 5DO8A 4TTGA 1WDQA 4AYGA 1AMYA 2XVNA 3GNRA 4DWSD 4PMRA 3BVVA 3MSDA 3O9NA 1VAHA 5CGMA 2JEQA 1KGXA 3LPPA 1V3KA 1HN1A 5AYIA 2J7GA 1GW1A 4U5IA 3RCNA 1HT6A 3CHEA 1EO7A 4GQRA 1CXHA 4ZXOA 1FP9A 3GXDA 1IT0A 2ZUVA 3EMCA 3QOMA 4W86A 1G5AA 3POHA 1DWFM 3CMGA 4DUXA 5D8WA 5E9AA 2BVDA 3VSVA 2XWDA 1UD8A 4F66A 4UQ9A 1NWRA 1KQZA 2C0HA 2WMIA 1U30A 3ARWA 1US2A 2Y5EA 3PTKA 1B3YA 3WY4A 4AD5A 3GBEA 3AICA 3ALFA 3W28A 1G9HA 1W9BM 2ZUWA 4PMZA 3AHXA 2QV4A 4RE2A 1MW0A 1NQ6A 3VOCA 2VR5A 2D0HA 2NSXA 2O9OA 2CBUA 4P7QA 3A3HA 3U5UA 5BYWA 2UY5A 3VIKA 3AS3A 3WEMA 1E71M 4LX4A 3BVUA 4TVUA 4OOZA 3ECQA 4U3CA 3AZTA 4ZXLA 2GSJA 1V02A 1J0JA 2D20A 3FN9A 4PMVA 3ALGA 4NX0A 5I79A 2ZOXA 3BMWA 1W3LA 4GKLA 3AXIA 1E43A 3RILA 2WSKA 3B9DA 5I77A 3WFLA 3EJTA 1JNEA 2WMKA 3RM4A 2GDVA 1KXQA 3OZPA 5ABHA 1DEDA 1B3ZA 4W8BA 5AY7A 3BUDA 2JIWA 4DO5A 3SUSA 4YN5A 3DHPA 3T0BA 1E6XM 4IISA 3DX1A 1GQLA 2O9RA 2WZEA 3TV8A 4DM2A 2VX5A 5A6BA 1N82A 4FLQA 5BXPA 5I6SA 1ISZA 1C8XA 1K9DA 2IUZA 2XVGA 4AD0A 3ARYA 3PHAA 4P8WA 4AXNA 1W9VA 1WAWA 5CSUA 1V0KA 2J77A 5LA1A 4W87A 1V3LA 2D3LA 1R75A 3VIGA 4GI6A 5JBDA 3WF1A 3PZ9A 1G1YA 3OZOA 2EPKX 4JFTA 3SCNA 2JFEX 2TAAA 4A4AA 4CUCA 4ZEPA 1BYAA 3WDPP 2D2OA 3AHVA 4PUDA 3BH4A 2J74A 3CMJA 5LA0A 1AQMA 2VI0A 2WXDM 3BLBA 1W3HA 4PSPA 3AIWA 4CD5A 1LG1A 4PYSA 3ZM8A 2XYLA 1E72M 1UD6A 6A3HA 5F7UA 4K68A 2YFOA 1OIMA 2WB5A 4H7VA 2ZUMA 5CPSA 4UQBA 1SYTA 5IFPA 2J25A 4LYQA 1E0WA 1JL8A 1I75A 2FH6A 4UOZA 3T2QA 4HA4A 1CXIA 1WDRA 3N15A 1C7SA 3WH8A 4W84A 3UR7A 2WLYA 1ITCA 1TVPA 2W61A 1HWWA 2AAAA 4HZ7A 5DT7A 2YA2A 1TQTA 1E9LA 1I1XA 3HG2A 3UESA 1ZBWA 4KH2A 1BYBA 3OA5A 4EE9A 3HZ3A 3BAKA 3II1A 4YHGA 1TA3B 4NXSA 1KCLA 3AISA 2E8YA 3GZAA 5I78A 3A21A 4D6JA 1CBGA 2D22A 4JFVA 3WMBA 1FFQA 4PEEA 1GQJA 2VMFA 5A8QA 3HG5A 1IZJA 4EK7A 2WANA 2EBNA 4CD7A 3W25A 3W24A 2WW5A 1UWRA 4AZBA 1WZAA 2XJ7A 2J7BA 1UUQA 3ARQA 3GBDA 3D50A 1UG6A 4J3XA 3U7VA 1OT1A 2YL9A 3MUY1 4MPKA 4H41A 1UWQA 4WKFA 1JZ4A 1UKOA 1HL9A 3WMCA 2WKLA 3B8SA 4AEEA 4U31A 1LWHA 2A3HA 1ECEA 3AHZA 4GZEA 2WVVB 4X0NA 5ECUA 1BPLB 4U33A 3PTMA 3L4UA 3WF4A 3K8KA 4NZFA 1XV8A 2VL4A 3T2PA 1TZ7A 1W2VA 5ABEA 1XD1A 2JF6A 2J8FA 2GK1A 4BQ5A 3WDHA 1KTCA 2DSUA 1X6NA 3D4ZA 1NARA 8CGTA 3CH9A 2WMHA 3LPGA 2W5FA 3WF3A 4GO8A 3WD0A 1UR9A 3VIHA 1HJUA 4JAWA 2WVTA 3GNPA 4S3JA 3TTOA 4QLJA 5HBFA 1BYDA 1EHNA 1CGTA 1VIWA 3EDEA 1UWTA 2DSKA 3WH9A 3BAIA 3PZGA 3RM8A 2FYVA 3LPFA 3NIYA 2CHNA 1CXFA 1EOKA 1V08A 1WCGA 5FKYA 1JDAA 5A6BD 3M6DA 3NUKA 1W32A 3W53A 5I5RA 4M81A 3AYRA 2YIHA 2DT3A 2WMJA 5IHSA 1JZ3A 1EH9A 1CGYA 1J0KA 2VURA 4WKHA 5M3WA 4TVCA 3DX3A 1OSEA 2J79A 1BVNP 4PTVA 4MNLA 4RE3A 1MFUA 1E0VA 2QMJA 1E5NA 3ZR6A 4L4OA 3I3DA 3WNPA 4XZWA 3SURA 2CESA 5IFTA 3DYPA 4AZGA 1BF2A 2WVSA 3WENA 3RIKA 1VFFA 4ZFMA 1W3KA 2IXUA 4JCMA 2E3ZA 3GM8A 3E1F1 3GTNA 2VCCA 2X1IA 3CHDA 4GI8A 4DUVA 4V2XA 4BQ2A 1S46A 2EABA 2VRKA 5D8ZA 1AQ0A 3WD2A 2CBIA 2GJRA 3DYMA 2WCAA 1W1PA 4CCEA 1FH8A 5DFAA 5AC4A 3U57A 1JZ2A 3WEOA 3SUTA 3AMCA 3AZSA 5A2CA 4AMCA 1JD9A 3W38A 3CBWA 3EDKA 3NYDA 3K4AA 4D6EA 1FH7A 4UNIA 2XIIA 4EKJA 5E0FA 3D3AA 2ZXAA 1GONA 5BCAA 3K46A 4FNPA 3W81A 2CPUA 1TQUA 1EDQA 3A5VA 1E70M 2PI6A 5E0CA 4TOQA 3VD3A 1ZL1A 1US3A 1XYFA 2WM0A 1FP8A 2EPNA 2VX4A 2CCRA 1E56A 3N13A 1NWSA 2ZXDA 2X0YA 3WQ8A 1KXTA 4J3WA 4MNMA 3VIOA 2VCAA 2VX6A 4DWSA 4NXKA 5DMYA 4HOZA 3THCA 3UCQA 3SEPA 3W29A 4HMDA 2BV9A 1B30A 2DIEA 1X6LA 1XC6A 1EGZA 1RH9A 2JEPA 4KGJA 5EB8A 1HF6A 3EYPA 5BROA 2X05A 3QGVA 1ZU8A 1JYXA 1UKQA 2BY2A 3AYSA 1KQYA 1EDGA 1A47A 2Z1KA 3CUHA 3GYCA 7A3HA 3IJ9A 3VDBA 1J0YA 3LX9A 1TVNA 3OLIA 1R46A 3WF0A 2EADA 1EO5A 4AZCA 4LPCA 3U7BA 3WUBA 3A47A 3VGFA 2OYKA 1E1FA 3IAQA 3ARZA 1HL8A 2DSVA 2XFRA 4GINA 4QCEA 2XN1A 3AS0A 3VGHA 1V3HA 4UZUA 1VJSA 2J8GA 3W6MA 1JYVA 2PBOA 2E8ZA 4TUFA 3CHFA 3ZQ9A 1CZ1A 2V3EA 2X2JA 1CGUA 1LF1A 3WD3A 3BLKA 2EAEA 2ZICA 1M03A 3VGDA 1R86A 3ZJ7A 3D52A 3SCOA 5BRQA 2X0HA 3EJRA 2F7PA 3LXAA 3KLLA 2QF8A 1MQRA 1V6VA 3ZSSA 3AIBA 2FHBA 3W6LA 4TTUA 1QW9A 1G0CA 2VC9A 4Y7EA 4D6HA 4GO9A 4CKQA 1GVIA 3FY1A 3MS8A 2V5CA 3MUZ1 4M24A 2ZWZA 4FNTA 3UEQA 3TTSA 1GNXA 3WUGA 1JAKA 3BCFA 1JI2A 1KWKA 4D1IA 1D2KA 4AD4A 1PX4A 1KGWA 1H0GA 2FDMA 2ZWYA 1PX8A 4MB1A 4JZ5A 3NJ3A 2XTKA 4UZSA 2OYLA 2D0FA 1UZ4A 2WWCA 2O92A 2XFYA 1GCYA 1FFRA 3L4XA 4NI3A 1JNDA 4LGXA 1SFSA 1TR1A 4HA3A 2DH3A 1Z32X 2ZE0A 2ZUNA 4HPGA 1Y7VA 3UR8A 4B16A 5FCZA 4OUEA 3L4ZA 1B1YA 1KBKA 3ZT5A 3GXIA 1H41A 1JFXA 3BAXA 3BUBA 4M8UA 3PTQA 1XCWA 2CNCA 2J78A 2J7EA 3QR3A 4B3KA 5ABFA 3VD5A 3T0AA 1EHAA 2CBJA 4FLOA 4ZE4A 1E4MM 4MB3A 1GQIA 5A8NA 1JF6A 1WDSA 4JL1A 5A8PA 1C92A 2CKRA 1FH9A 2EPMX 3AIEA 3WQ4A 3GXNA 1FHDA 2G41A 3AZRA 4AY1A 1JXJA 2OSXA 5C70A 4W5ZA 2F18A 3DYOA 1ZB5A 5A6AA 4FF5A 4D6CA 4Z2HA 1I1WA 1NOWA 2XVPA 2CIPA 3KL0A 3IJ8A 4TX6A 3SUUA 1MXDA 1R47A 1JGIA 1NOFA 1K9EA 2D23A 4P7RA 3WY1A 4JFSA 3BAJA 2F8QA 1KTBA 3F5KA 1XSKA 1BGAA 4D72A 5AC5A 2OSYA 4J3SA 1CDGA 5IXEA 1L8NA 2YA0A 3CTTA 4MB5A 1QI4A 2JIEA 3AMLA 1GUVA 3NSNA 1UA3A 1BHGA 2WWDA 1W1YA 4H8HA 3UG4A 1OM0A 3WDJA 3QHNA 2PF0A 1R85A 1M01A 4TXEA 3WQWA 1B3WA 1R34A 1GHSA 3BC9A 1X1NA 4D6IA 4MJ4A 1C8QA 3VSTA 1K9FA 2V3FA 4UQEA 1HP5A 1GORA 4X9YA 3KL3A 3L4WA 2Y2WA 3PZNA 2XVKA 3TOPA 4HZ6A 3VDCA 2YOCA 4HMCA 3VINA 4AD3A 2XM1A 5BRPA 2EQDA 3DX4A 4D6GA 2XFFA 2YL6A 4MDOA 2IGTA 3N12A 1WDPA 1E1EA 1QNSA 1JXKA 3WQVA 2ZX8A 3MUAA 1DP0A 3RO8A 3CIVA 5CGTA 3AIVA 4GI9A 4GQQA 2GJXA 3OB8A 6TAAA 4FLSA 4DWSB 5BXSA 2WVUA 3BAWA 2QPSA 3WNMA 3VNZA 5CLTA 3POCA 1Q4NX 5EFFA 4A3HA 4DO4A 1V6YA 4UFKA 1J0ZA 3SCTA 3CPUA 2X2HA 4R5EA 4J3TA 1HTYA 2ZIDA 1ZS2A 1MQPA 3RM9A 5A2BA 4AZ5A 3OIHA 1UR8A 1JZ6A 1UKTA 3UG3A 2WNWA 3FAWA 3W27A 2DDXA 4OBRA 4FMVA 1KBBA 1K6AA 4IPNB 3GXFA 4AZCB 3TONA 1CENA 1KB3A 1WPCA 1K9TA 1ZBCA 3NSMA 1UHVA 3AIRA 1HP4A 5HDRA 2YL5A 4PN2A 1C8YA 1SMAA 3OGVA 3VD4A 3D5HA 5BXRA 3TTQA 2ZXBA 4QFUA 1W3JA 1V3IA 1LLOA 4JHOA 4WLCA 3WBEA 4W5UA 4CU6A 3K4DA 2W92A 1ISYA 1MW1A 3FAXA 3LRMA 3SCVA 4AISA 4JKLA 4PMDA 4U2YA 3K1DA 4WSKA 1QBAA 4W89A 1E4IA 1TQVA 1UOKA 1E6NA 1CEOA 4HU0A 5D4YA 3RMEA 3H55A 1E73M 4PUEA 1TE1A 1JI1A 3VIJA 2WKGA 3RJYA 3WUEA 2XSAA 1BGGA 3PZMA 3W0KA 2BFGA 1HVXA 1H5VA 1TUXA 4KRTA 1CGVA 2BXZA 5E6ZA 3FNDA 1QI3A 3VPLA 1J9YA 1O7AA 2VZSA 1DWIM 3VIFA 2WC3A 4FNRA 3VX0A 2WHLA 3AMGA 4CGTA 3VIPA 3OGSA 3DX0A 3WL0A 1QI0A 3J7HA 1XRVA 4X0VA 1O7DC 5GNZA 4U2ZA 4AC1X 4UFHA 2WHKA 3WNLA 1U33A 2A3CA 1EQCA 3GH5A 1Q6EA 1GOKA 3CO4A 4UOJA 1ODUA 2EEXA 2E40A 4AIOA 3WIJA 1B0IA 2BHUA 2ZX6A 3HU7A 3PZQA 1OIFA 1CXKA 1W91A 3VMOA 1GZJA 4HP5A 1RPKA 5LA2A 3ZT7A 3CUIA 4PRWA 1QHOA 2VRQA 2GFTA 3DC0A 1KWGA 2D3NA 4PCSA 5DT5A 4A3YA 2OSWA 2XGBA 1C93A 2Y8VA 3KLKA 1JFHA 1EQPA 3ARPA 4HMEA 4L4PA 1PX3A 1Q6CA 4JFUA 2XN2A 1QI2A 3OG2A 1V6XA 2J4GA 3N11A 2YDQA 5E6YA 3MSGA 3MV11 2PBGA 3L2LA 4D6DA 4BQ4A 3WSUA 1L0PA 3L2MA 5BXTA 1DWGM 5A6JA 3GXMA 1JDDA 3ARXA 2DEPA 5A8OA 1WE5A 2IXVA 1M04A 3AMDA 4CVUA 1WKYA 2ZX9A 1PEZA 3G6MA 4E8DA 5FD0A 4S3KA 4M80A 5JIPA 1W9DM 3CZSA 4D1JA 2QLYA 3WQ5A 3K8LA 1JG9A 1BTCA 3VIMA 1E4LA 2OW7A 1JIBA 4KMQA 2QHAA 3VGGA 5CLWA 2ESCA 3LXCA 2YJQA 3W82A 4AEFA 1J12A 3VUPA 3KL5A 3ZOAA 1UWIA 1VBRA 5I24A 1M53A 3A23A 3MUIA 3DHUA 4AD1A 4D71A 4NRSA 4UOQA 1XH2A 4HTYA 1CIUA 1E6QM 2WMIB 3THDA 3VM5A 1C91A 3CZLA 2XSBA 1JYNA 2A3AA 2J7FA
chains in the Genus database with same CATH superfamily
3AREC 3L4TA 1YDNA 1FOBA 5AW2B 1MZZA 2YRPA 3TSMA 1BIIA 4HSNA 5L88H 3OR7A 1AMKA 3R8BB 3IBOA 1ZZMA 5D72H 4QRPD 2ZX5A 3H2OA 4BH8B 5T1KD 5I8EA 3W7EA 3QV8A 3CXDH 3AGVA 2NQCA 4U1GB 3SQBB 4QRBA 1AXTL 4HNLA 4JFDB 4P5TB 5EBWB 4GQBA 4HHHA 2HJKA 2GFBB 1MHHB 4WWKD 3B4UA 1ONQB 4KPHH 3NMEA 5T8GA 5FOOA 3VFOB 2E7MA 3OJVC 4ZUVB 1RQBA 4NZTH 4B0MB 1OF2A 4NC1C 3ARBA 2GTZA 1R3KB 1SF3A 4K1GA 2QDDA 2J8UA 4KWUA 3IVKB 1Q1PA 2ANUA 3OKYA 2CU9A 3QWRD 5L6UA 1ZHKB 1SR0A 3SE3A 4GIOA 2QV2A 2QNEA 1A4JB 3QRFM 5C1MB 3AROA 1EFZA 3FZUC 1M7OA 4YTTA 1H6FA 4AY0A 2Z6JA 1NWOA 5DMGD 1V03A 1KEGL 2M2DA 2A9CA 2DPKA 1IGWA 4Y9OA 5DD0L 1KNOB 3BSGA 3RX3A 5F4WA 4HS3A 3A3WA 2HWZL 3VKDA 5J6GA 4ZI8A 3CFJB 1OFQA 2LR4A 1EHKB 2MCMA 4WW2B 3OSVA 4XAZA 2G5RA 3F58L 3IJIA 3BCDA 3M43A 2ATMA 4JDEA 4DEPC 5LIXX 1W9UA 4AYMC 4LRSA 1QZ1A 2HZHA 1I82A 3V0FA 1WQ5A 1AZVA 1DQUA 3SW6A 3VUSA 4N1EA 2FJHB 3S3DB 4LCQA 3STPA 2CPCA 4N8VB 2J43A 2FYMA 4Z95H 4CQ9A 4YTUA 5DEGA 4PMEA 4HAFA 1ZJBA 1OTTC 1AXTH 1DVSA 3O2LA 3MV9E 3LQAL 4DVOA 1IJNA 2MUCA 3PANA 2G5BA 4LVEA 4ZMYA 3EJQA 5FA5A 4G80B 4KO9A 3UNDA 5FA3B 4IS6B 5LIYX 1MFDL 5FDWA 1NSJA 5FEBA 3VI4E 3IFOA 4A04A 4IPPA 7FABL 4JTEA 2W65B 1QNVA 5ESAB 4N8UA 4BQ8A 4LYKA 3PJSB 4UQAA 3QC5X 4HPXA 3LXBA 2YK1L 3NPUA 5E2WL 1NC2B 1AOZA 1SHMA 5EEWA 3WUWA 1EO8L 2YR3A 4OLYL 1ZK5A 4JTUA 4QDGA 1EDTA 1RUPH 2B7DT 3C2AH 3RIFK 2GAZB 5AHIA 1N7KA 4IDJH 4JO5A 4M62L 3GIVA 4P61A 4HAKA 2NSOA 1ENUA 5HPCA 3MRBA 3VWJC 4ZUTB 2VZTA 35C8H 2QT6A 4GACA 2VDLL 3FB6A 4K7PX 2EXOA 1Q9WB 3GTVA 3CHVA 2GUBA 1CX9A 4PCNA 4H4NA 4X7EC 3PG9A 5G1MA 2NZ9D 4OU3A 2Y1HA 2EUXA 4LCYB 5EU6B 3M6YA 3QI9A 5AW0B 4HGXA 3CN0A 4IJCA 3MO4A 2F38A 3WJWA 5SWZB 4PMYA 2ICCA 3S5SA 4GY1A 1OX6A 2FIQA 9XIAA 2I5IA 2VIRB 3W56A 4GOSA 5CJ5A 2GZXA 1UUMA 2XVLA 1EL3A 1NCWL 4N2FA 1Z5YD 4UFMA 3GMRB 4HPHA 2YGYA 1YPZA 2E7DA 1OBAA 1Z3GL 4PTUA 3FH5A 4ORGB 1FG2A 3LDBB 2RH9A 2R69L 4DXVA 3CFCH 1B3IA 2X2GA 4HLEA 1MJJB 5AAPA 1AO7B 3AY4C 3I6TA 2QJJA 3ZU8A 1GA2A 3IDGA 2YXFA 1LXMA 4MDPA 4BUGA 4QNPE 1OAUH 1TV7A 5ICZA 2J88A 1T80A 3OLDA 2G4GA 1RZKC 1PTAA 1JFQH 1GPFA 1V6TA 4DAGH 4C4BA 2EKJA 4WO4D 2CA3A 5FJIA 5EMKA 1SXAA 1NAMH 5JPMB 5FACA 3EXRA 2GC4C 1ZFJA 3GO1H 4P2RB 2UY7A 3P77B 3QZWG 3G6JE 2L0DA 2W94A 2HKFL 4XB7A 2K8QA 3TBVB 4XPFH 5J11B 3KRZA 5FW6A 3FRPA 3C8NA 3IFPB 4JVUA 5KZMA 1A7NH 4I48A 2P50A 4ZO7A 4BK8A 4M5ZL 1DEEA 5ISZD 1ISVA 2PETA 3E3QE 3BIKA 3S5LA 3K1GA 2LFGA 3FO2B 2I24N 1CICD 4A21A 3HCVA 1ZSXA 3DECA 5CP3A 5A6MA 5BMXA 3SOTA 2Z35A 4IU2A 4XUYA 3N04A 5FUOL 1K5NA 4CQDA 3P4OB 4Z7UB 3H2CA 4MDJA 4PS3A 8FABB 4JREC 1D7DA 3RWEB 3WD5H 5JOEA 5GGRB 4KZDH 3VA2C 3U9PL 3LBMA 2APVA 2WUBH 3EDJA 3R0NA 5J57B 4D7PA 4Z2LA 1QLRB 4ZO8A 1E9PB 2EJ1A 1IF2A 1UZHA 1QTPA 2R69H 3RZCD 4DNHA 5BMFH 4E9SA 2PD9A 3KP1A 2WBJB 4D8OA 1IEBB 4OGZA 3MGTB 1OAXH 1SF5A 1EEQA 3CVIH 5L4JA 1LGVA 3HG1D 3HG4A 4CEXC 5DS1A 3HPSA 1X5LA 1S2EA 3BJFA 3HPJB 5D1QB 1YJDL 1WIUA 1F4AA 4HSQA 1GJWA 4GUHA 3K2IA 1XG3A 2PWGA 1IGTB 1NC4A 4IMLB 1X5IA 3MI6A 3NM1A 1RVGA 3SDOA 3GRWL 1H1YA 1QWHA 2XNAA 3AS2A 1GGIH 2CDGB 2FB4L 2J9YA 4MMXA 1X7TA 5GRWA 3R0KA 1DWJM 1SN0A 5BZWB 5FO7A 1YHPA 2A77L 2IFGA 3E74A 4C56B 3F7YB 2A6JB 4KFNA 3ARTA 4LVHC 1ZTVA 1RSCA 3G04B 4U5KA 3T55A 3LNFA 4GXUM 3BP6B 5DD1L 2C3ZA 1AFSA 1SBBA 3WK1A 2WAQA 4K94C 5DA4A 2QTEA 1E6OL 3CPGA 2W62A 3P4NA 2CFFA 1DHPA 4O51A 2DQUH 2CYGA 3VNJA 2YD9A 4DKEH 5FECB 4JGDA 3TUUA 1DO6A 3DGCR 3EBHA 4P3CL 5EU6E 2PDXA 1YEGH 4P3WA 4DO6A 3HI5L 1T0NB 2DPEA 3PJLA 4FQIH 4KKAC 1Y5XA 5SWZE 3L1FA 2CJUL 2V2HA 3WLOA 4XZLX 4LSSH 3MAWA 2UXVA 4WQ6A 3ZJKA 3B3IB 5IP4A 4I18C 4F79A 2OKTA 4A8NA 1TPXB 3O4LA 4IPIA 2R94A 4N6RB 3LOTA 3UZQB 1XYLA 2W0PA 1BF8A 5DJDB 5KBPA 5LG6A 2DL2A 4YDMA 1KCUH 2BNRA 1AO7E 1ZVSB 1CTNA 4YK4B 4XBPA 4QHMA 3M0JA 4EI6B 3JV6B 3BZGA 5GRJH 5LDUA 5H8DA 3FLUA 3KYNA 1EXPA 3BXWA 4FTVD 1INEH 3SPVA 4BWWA 2NY0C 3LAFA 3KW3A 3VQMA 3PFRA 2FB4H 3R13A 5IT2L 2VABB 1E67A 2BVOB 4WEBH 3EYVA 2O4QA 2L4OA 4XMLL 2WXQA 3FO1B 1HFBA 1E8WA 2CKSA 3HGJA 4NZ3A 4DJFA 1AMYA 4BJLA 5BRBA 3GNRA 3FCTB 4MQXC 3FRUB 3RIAK 1JPTL 1RA0A 5D7LB 2QFPA 3LSOB 1FNSL 2CHWA 4D9LH 4GQRA 1FP9A 4YAQA 3XINA 4HSOA 2JH2A 1PD6A 2XWDA 4CNOA 2PGWA 4BQBA 2H6PB 4K55A 3CV2A 1W8NA 2FLIA 3G5EA 3QWOB 2P5WA 5DHYA 2R24A 2VN7A 2GTWA 3MW7A 3TR2A 3WCYA 2XH0A 5TPWH 4FI8A 4JANB 1P2CB 1VYRA 1DSFH 1M7IB 1AC0A 3AS3A 4B95C 4JNZA 4PW4A 3KHDA 3DJTA 2GSJA 4UAOC 2PO6C 1OCNA 3OR6A 3DG6A 2QKIC 2V2DA 1U6AL 3D05A 1MCDA 5HA7A 4I1NB 4MAYC 1BWVA 2CH8A 1E6XM 3DPDA 2WZEA 2PDQA 4FALA 1XX1A 2Y7QA 1NDZA 4UTAA 3S1XA 4AD0A 3IM1A 3JUZA 4HXAH 5D1QE 4JTKA 3AO0A 2OKMA 3BQUA 2EH7L 3VIGA 3K6SB 4JDVB 2YD4A 1CLYH 1BQLL 1UZ8A 3NK3A 5IJDC 5EMMA 3LBOA 4J8RA 1R24B 4EZMA 4PUDA 4GUFA 2D7OA 1KPVB 1RULL 3BH4A 5LA0A 5AOJA 1R3QA 5GIRA 5T3ZH 2ADGB 5I28A 4P9MH 3HC4H 2HTLC 4K68A 2CGRH 3ARGD 3TJPA 4C56E 5LHDA 4CILA 3B2MA 1GYUA 5KMYA 3UR7A 2Y5TB 2YA2A 1TQTA 4OFYD 1MKFA 5DD3H 1VGEL 4NENB 2UWEE 2GC7C 3GZ3A 3RHGA 4P04A 2UBPC 3WTXA 2RHEA 4D6JA 2D22A 4PEEA 2VMFA 4DQOH 3F84A 3OL2A 2PPCA 3RX9A 1NGXA 1UXSA 4J3XA 5DJYB 4OZHF 2BOGX 2OCCB 4HJ1A 1P5VB 4AVHA 4HKZB 3T1GA 3D2UB 3BHBB 3DVIA 4PJEF 5I6PA 1E1CB 5C0BA 1JWUB 1CBVL 1QBMH 3TSBA 5EUOF 3CHRA 8CGTA 3N2OA 2MPAH 3VIHA 5D70H 1RV6X 3C6EA 2X42A 3GSUB 4I1RA 4XMXA 3T8XB 1RFDH 3MLRL 1G43A 3BJ91 1TE6A 4XN5A 5A6BD 1A49A 1T83A 3NUKA 4X6DA 2X4QB 4X8CA 4M81A 2DT3A 4LV9A 4YE0A 2AEOA 3G0SA 1P4BH 1S7QB 4TL4A 3R1ZA 2J79A 3N1PC 1SZGA 3L5HA 2YN5A 3QXUA 4QM1A 4R6UA 1BWMA 4TNWK 3L5WB 4PS4H 4XHJD 1BQLH 5IHUL 4IL0A 1VPQA 2IQAA 2MCPH 4YYCA 3GU2A 4ICNA 2GJRA 1T1WB 3MRFA 4M1CC 3O6FB 5I74C 2Z0UA 3RA7H 3H7BB 4FJYA 4KO6A 4AVOA 3W38A 1AHMA 3RPIA 3QYCA 3W39A 5KBMA 3V3WA 5F3FA 3VFTA 5E93A 3UPRB 1X5JA 4TUKL 2VCOA 3GJFK 4GKZB 4X5PA 4G1KA 2FGWL 5D7LE 3EXSA 4ZYKB 3BPOB 1XYFA 5F2FA 1JTPA 3LVEA 3WQ8A 1KXTA 1M65A 5IR1A 4NXKA 3O81A 3KPQB 3SKJL 1X6LA 3TNNB 5HYJA 3TROA 2FEEI 3JWOL 2PW2B 4GRLC 2OYPA 2K6ZA 1PLAA 3M7FB 1KJVA 4RRPG 3PUUA 3LX9A 4FL4B 1R46A 1RZIB 3U7BA 2HLEB 3PFUA 4G72B 1WA0X 4H19A 4MIMA 1EAPB 2XXGA 2DKSA 4RAVB 3W6MA 2YBRA 1JYVA 3JXAA 4TUFA 4XNQA 4FFVC 2E7CA 3ZQ9A 1CZ1A 1KCSL 5TE4L 1LNUB 1LF1A 1NCIA 3BLKA 4BZ2L 2IAAC 5K93A 3LUTA 4PJ8D 3HE7A 4HV8A 3HB3D 1G4EA 4ODXB 1GJIA 4F5CE 1N6VA 4XZIA 3RF9A 3LTYA 2FZ3B 1TTAA 4KKCD 4U1MA 4H9VA 2VFHA 4QGYA 3MS8A 5GJNA 3CLEL 2K4AA 4YHLH 1KWKA 2PCXA 3IDJB 5AALA 1H0GA 3OC8A 4MB1A 2XTKA 2D0FA 2GKIA 4KH9A 1MCQA 4RQQA 1TR1A 2BDNL 1Y7VA 4LIQH 3TBYB 5JQ6L 1EZVX 4EVZA 2OJEB 4N6FA 3FHEA 2A9NH 4CKVX 4LUTB 4ADJA 5EZIL 3HRPA 2A7NA 1WDSA 4NYYA 3FCUB 1L7TL 4JG0L 1RZ8A 2FNBA 3F4DA 4XSMA 2QCGA 1ASOA 5HDQH 1QRNA 1NFDB 2Q8LA 4D6CA 4Y19A 4Z2HA 4AKQA 1H15A 2ZP9A 5CZVL 4MKMA 3C60A 1FX6A 1U83A 1G9NC 3L7EB 4RKAA 4WIQA 2WQVA 5IXEA 1L8NA 2YA0A 2H9GB 1QI4A 1PCSA 2E27L 1PY9A 1XLBA 2A1YA 3D09A 2QDEA 3I65A 1GZGA 1PG7W 2AVFA 4POYA 1ET5A 1LRQA 3VSTA 4GEIA 1DVFD 2PYEA 2YXMA 4JHBA 1F6KA 2W07B 3VDCA 4LSPL 1AJ7H 1BM3H 2I27N 3L3OB 3RDTC 2B1AL 1VHCA 5J6HB 1I7RB 4IXXA 1QR7A 1WDPA 3MREB 2QQKH 1OTSD 1EUNA 1FSKB 3T7VA 3OB8A 1AD9B 1PJWA 4G6ML 4OI9A 2QR6A 4M1GH 1KCZA 3KPOA 4Z3HA 3L23A 5EO0A 4UFKA 3WBWA 2IANB 1OPOA 3W27A 4N0UA 3W2DL 4ZSTA 3NTCL 4JFDA 4P5TA 5EBWA 2BP5M 1ZCCA 1OAJA 1K3ZA 2GFBA 4GS7C 5FS5A 1ONQA 2LHAA 4C83B 4G8IB 2CO7A 3VFOA 2BDNH 4G6FB 2OCJA 4P2VA 3TTQA 4ZUVA 5JQ6H 5MEOB 4JHOA 3MRLB 5AAWA 3OG4B 3WV0A 2L7JA 3U1SL 3NJLA 5SX4H 3ATZA 3RBSA 1R3KA 1S5MA 3TYBA 3D2TA 1ZGLM 5I0WA 4M93B 2IDUA 2P1YA 4JG0H 1PSKH 2CZDA 3IETB 3IVKA 2YSTA 4KU1A 4O02H 2DQFB 3UTTE 5CSZB 3NPVA 1A4JA 3OJMB 1KBPA 1O5KA 5CZVH 1CGVA 4KIEA 1TWDA 1RVFL 4OZIB 2VZSA 1SLVA 3Q48A 1XEUA 3I84A 3FOKA 5DO2C 3B8VA 5EOCL 3GC2A 5D03A 4OZ4B 3DRTA 4LKXB 3SDCC 1Q6EA 2L3BA 3V95A 1OIFA 4GFTB 1TV5A 3T0EB 2I25N 4LSPH 4WW2A 3P4LA 4A3YA 2OSWA 3V0SA 5HY9B 3PWLA 4JEQA 1R5WA 4CMHB 5BXTA 1IARB 3APNA 1JGEA 2DWXA 3M9YA 2GDQA 5I1CH 4G7EA 3AMDA 3DZ1A 3RPKA 2H26B 3IWVA 4P57B 1SXZA 4N8VA 1W9DM 1B0RB 2BMKB 4W68A 2ADAA 4LAZA 5HDBF 5LCVH 2Z8SA 2DKUA 3EYUH 4H1ZA 2DBLH 4NJGA 2PTDA 1ET8A 4TMPA 5TE6L 4G80A 3THDA 5FA3A 1C12B 1CFMA 1CG9B 4IS6A 4E4UA 1PKQE 3CZGA 2W65A 4UIKH 3KLHC 3BZJA 4UIMA 3SD5A 2QADB 4YFLI 3GC4A 4H4IA 2DEXX 4KTGA 4XBKA 4UI2A 1OGGA 4UR7A 1OW0A 1PO9A 3LCIA 2EEAA 5D2YA 2DQTL 3CV6A 3AG4B 1NFIA 2VDNL 1Y0LB 4BZYA 2GAZA 5D1ZI 1CFQB 4QNEA 1F4XH 3S8FB 2UZYA 4AEHL 4PFMA 4XOAA 5G4OA 4ZUTA 1I3RB 1I7ZB 5EU7C 3BARA 1J05A 1C1EL 1OB0A 5BZDB 1Q9WA 5L4FA 3E6EA 1R2TA 2ZXQA 2VNCA 3C6LD 4A2LA 4UTCA 3SDAD 5FKAB 5JXAL 1BGXH 2H0EA 2VQ1B 1PZ2A 4C90A 2YCKX 3C2VA 2QZ5A 1FFOB 4J3OD 5JZ7C 5A3HA 1CZ8L 2VGFA 4QITA 2QQ6A 1QQDB 1IT8A 1BZOA 1WUNT 3A6CH 3RFZB 1HZKA 4IMAA 2VIRA 3LMYA 5TE6H 3RY6A 3B2VL 2GJPA 3ZVVA 2Q8ZA 2HS6A 3GMRA 2PR4H 1S3HA 4DIAA 1Q9OA 4IRSB 1PKYA 4ZXBC 4I5XA 1G84A 1RZFL 3MP5A 4JN1H 2R0KH 1MJJA 1DTUA 1URZA 4JFWA 2WZHA 4Q8UA 2W91A 1N59B 4IGBD 1FFPB 3VXME 2XWEA 1FO0L 1HX0A 5A6SA 1TYJA 1C3FA 3NCJL 5CIPH 3ABXA 4WWNA 1NF7A 3WFCH 4CSPA 2NY4B 3DBXB 3P9MB 2PWDA 2Y7FA 1A0DA 4G82A 1DV7A 5BUPA 1ISWA 4PMNA 1CCWB 4GVGA 4ZUUB 4P2RA 3RPMA 4LFHG 1LTDA 1BJ1H 2JJSA 1AW5A 5CPQA 4R0LB 1LILA 3GXUB 4DFHA 2ZX7A 5L9FA 1EBGA 4E2BA 2PF8A 5L2KE 4HT1H 5JH1A 3W2LA 5D04C 5KSBF 5C0ND 3M5ZA 4NHVA 3T0EE 2DQJH 5EU4A 1QOQA 1BQSA 3MYPA 3NFSH 5B38B 5MI0C 1NDYA 1HKLL 2HH0L 3P4OA 4UFIA 4Z7UA 2E25A 2QHRL 5PTDA 4NJ9L 4YSCA 1OT4A 5D2XA 2IPFA 1J1PL 4KI5F 1NKOA 4KK8C 3LLFA 3SRDA 5F96L 4Q8OA 4BFNA 3CT7A 3FCGA 4UDUB 1E9PA 3V6OC 2Y24A 3MOAL 3AG1B 4JO4L 3KWVA 3V4PB 1QO5A 3BUPA 3TMLA 5JUVA 4U0QB 4MNQD 4WDUA 3KPMB 5AW5B 1IEBA 1IT9L 2UV8G 5AYBA 2A6KB 4MWFB 4NT6A 2YKKA 5F7EH 1WF5A 3OKDB 2Z0IA 4HN8A 4X7CC 3MMDA 3GMOB 3B1UA 3S6OA 4REQB 3Q45A 1KIQA 2IXQB 1W0VB 3HPJA 1U8NB 3ECBB 3HR6A 3UETA 12E8H 3HN3A 5C2UB 5JH2A 1REQA 2WXLA 3M0IA 4IMLA 1P6FA 1MQKL 3FXIC 5D1ZB 3M7SA 4BD4A 2WZPA 2MTPA 5XINA 2CDGA 4FQ2L 3BAYA 1D5RA 1Y6NR 5E51A 4UT9L 1UFUA 3BESR 3MUGB 2LU3A 2F1AA 4QRRD 1ZSDB 2GWGA 5CCJA 1WH0A 2Q5BA 4W9ZA 4MTVA 4DX3A 2ADJB 4JQXC 2HFGL 5I76B 2QXWA 3B8IA 3WE6B 5IGXL 3BP6A 1WBYB 3BGJA 1YMMD 3Q2VA 4EAEA 4N9EA 3QQWA 5B1BB 1KPRB 4E4PA 3N17A 4XX1G 3OKMB 4RLIA 1RU9L 4W9TA 4PJ5D 5FECA 4NJ9H 2IV8A 3LQAC 4GPNA 5IHRA 3PWJA 1BXUA 2X38A 1XB6A 1AACA 3I7QA 3UYRL 3NAAL 4HHGA 5T1LD 1T0NA 3SQOH 4C6NA 4GG6F 4X6CB 4LXFA 4PH6A 2FUQA 3MOAH 1IEVA 4CADB 3ULVF 1RERA 3VWKD 5IZ7A 3QBUA 1OKEA 3B43A 4MNKA 2R29H 2WAGA 3B3IA 3EJSA 1CURA 1VERA 3S88H 4W7UA 3K13A 1Q63A 1ACXA 3UMTA 4G8EA 5FX3A 2VCBA 5FHAL 3UZQA 5C8JB 1W6WA 1ZTXL 1MY5A 2VXUL 2CKBL 2NNRA 2F2KA 1AHWC 1V6WA 1QNPA 1ZVSA 3DJ9A 2X2YA 3APYA 4HIPA 3EDFA 4W6XB 4CVZA 1TTFA 4EI6A 4FZ8L 1RQHA 1T4KA 3VRJB 1NBCA 3MJGX 3BSHA 1B3JA 1F1GA 4YDKL 2IAMD 1HFUA 3VM7A 1G01A 5CILL 4JFHD 3QHZL 2J27A 2UXTA 1OT2A 4QXGH 2R23A 3RWGA 3DWTA 4FQXD 1IGFH 3FO1A 3N44F 3B0PA 1ETA1 4ELMA 5HHVL 4ZMVA 3ECVA 3FCTA 1GVRA 2XIJA 4X0KB 5J13C 5ABAA 3PZUA 3FYPA 3EAKA 1JVLA 3VABA 3GLZA 5K59E 2XWCA 3MBEC 5A3ID 2ZUTA 2CJ3A 3F6IA 4YLBA 3WH5A 3MRHB 2OP4H 1ICSA 2HMCA 3I9PA 1U9KA 1QK0A 2X1QA 3UYRH 3DVGB 5D93B 3SOBH 3WEXA 2HMIC 3BD4A 2OVLA 2OV0A 1M7IA 1ZPTA 2JELH 1B54A 5AVVB 4HFWB 1A9BB 3M8OH 1BSIA 3QUXB 1FWAC 4XP9L 4XCCH 1LRNA 1PWLA 1PBGA 1NAKL 4MJIB 5CJXC 1IIHA 2AKRA 3QWNA 3TYCA 1G6RH 5IFAH 1E3XA 3ZDYF 1TSHA 5GGRY 4C4KT 2CR0A 3GRGA 3G1XA 2G3MA 4GAGH 1BSLA 3SGJA 1OTUD 3EH5B 1ZHBB 3THAA 1I1CA 1S7RA 4FZ8H 3V5FA 1WC7B 1B4EA 4MSWA 1NIFA 3QRGH 2DMKA 3VTMA 3N1MC 4UQCA 4HIBA 1LQAA 1GZPB 1RSYA 4B7LA 3K6SA 3T8LA 3NIDB 4ZAKD 1OQFA 1M6UA 2DLIA 4J5NA 3QEHB 2XJLA 3CUJA 4L8DB 5C9JA 1KPVA 4FP1A 2A83B 3MKKA 1PXGA 4I2XE 2ADGA 4W7WA 1JHKL 1G9NH 3FU9A 5D9OA 2INEA 4N5EC 5GSRB 4KRUA 3GG8A 4UFLA 4L1XA 3KDMB 2VN3A 1QWKA 1SOXA 4PRID 2B16A 1PY0A 4QPEA 3ZTCC 2NXIA 1I3GL 3F2BA 1J93A 3HMWL 1LG2A 5IFHL 1P0KA 4UT7L 1EHXA 1V10A 2VC2B 4PWEA 2HXAA 2HFEB 1DYSA 1UJ3C 2LT9A 1CK0H 3ZRSA 3W6YA 2CBOA 4MA7H 3VJ6B 1ZLDA 2Q8AL 4LB4A 5C0QA 4YVVA 1P5VA 4HKZA 3D2UA 4FO4A 3BHBA 4P46C 1IL1A 5F9WC 3BVVA 4PB9L 1G5GA 4DJMA 3O9NA 5EPMA 1AIFB 1CVRA 4JMNA 3UWUA 1PQZB 4QT5A 4IHOB 1XDJA 3CHEA 3VNLA 2CBPA 1IT0A 2OT1A 5E56A 1QMLA 4W86A 1MUMA 1YJDC 1H3VA 1EEUA 4V1XA 2Q3AA 3LIUA 3GSUA 2NW3B 2X70B 1PTZA 4LLQB 2NY3B 3T4YB 3S2NA 5KBNC 1K4HA 2PLCA 2A0LD 2UXFA 1MRDH 1F90L 4B9GA 4JNYA 1YTDA 1RUKH 4JB9H 1X7QB 3OF6A 3L5WA 1UIPA 4HCRA 3BVUA 4YIWA 1T6MA 3V1PA 2FBOJ 4KUCF 1F2JA 4OOZA 1OAZH 1MCPL 4U3CA 3M7WA 3O6FA 1ZWIB 1K6WA 1S7VB 2P48B 2QVNA 4Y4FD 2X1RA 3GW3A 1UEMA 4ZMLA 1JGLH 1NCCH 3TV3L 4NKCA 3ZLHA 3ATYA 2LLNA 4GKZA 4AVIA 1C8XA 4ZYKA 1K9DA 1VCVA 4B5XA 2C13A 4H20H 3VOJA 2OL3B 5HTSA 4E41B 3HNVH 5A2FA 1J1OH 3X13B 3BRFA 3NWRA 2NXYC 4RSVA 1R75A 1Q90A 4D3CH 3KPQA 3GC3A 4ECLA 5FYKE 4YBQD 4GI6A 1QVOB 3TNNA 2WXGA 4I8YA 2PW2A 3W7HA 3SCNA 1S9WB 4EAYA 3MV9B 1CLOL 4K15A 4ZPTB 4A2DA 1V54B 3CG8A 3WK3A 1RZIA 4PB9H 4PYSA 4XP5H 2GQ8A 4NP9A 4H7VA 2ZUMA 4LS1A 3VI4B 3KVDD 4N2EA 4KMTL 3UJRA 4Y0GA 3OHIA 1I75A 2AJZA 4R4FH 1R17A 3N15A 1C7SA 2YD8A 1F74A 2W61A 1HWWA 1LNUA 4ACTA 3BAKA 4RMUA 3R8QA 4PG9A 1CBGA 1V5XA 3N9RA 4WFFD 4RBPH 1IZJA 4P2QB 2IGFH 3CM4A 2EBNA 5K7JA 4QS5A 1WZAA 5E4EB 3M45A 4DOHE 3F4WA 3D50A 4PGCA 4LPYA 4L18A 3MUY1 4MPKA 1KB5B 5H35B 2WKLA 1HKVA 4O11A 3R0UA 2D7MA 4YBHA 3IDJA 1OCJA 1S4IA 2WP3O 1TZGL 1YYMH 2VRAA 3QCVL 4QG8A 3C5SB 3SBFA 3NIDE 4NHUA 5HR7A 2WMHA 1TZHA 4N2MA 4YNGA 1FKXA 3WF3A 3KLQA 3TMQA 2OJEA 5EN3A 3TV3H 5DK0A 4W9EC 4YBLC 1VKXA 4QRTA 4GJ1A 2YYUA 3DX8B 1U36A 4AMAA 1DBBL 1KMGA 4LUTA 5ES4B 3HS0A 4YHML 4JGUA 4JZOB 3TCXA 4ICXA 5GRZA 1YEWA 6PTDA 1I1AB 1ONEA 4WKHA 1NIEA 3DJZA 1MNUL 1XR2A 1SJEA 1NFDA 4HYRA 4HA0A 5DQDH 4GH3A 4P2OD 5KAQG 4JO2H 3BJLA 3EWDA 4W9GC 4Y1SA 4OV4A 4YGVB 3L7EA 4HB7A 3QCUL 4XPBH 2PZNA 2H9GA 5D2VA 1W1PA 1E5YA 3R19A 3E02A 3MROB 3AU0A 3GUTB 1JCJA 1MHCA 1A4CA 4KMTH 3OQEA 5LDSA 3IJEB 4UNIA 3UZZA 5LBSA 4D0DB 3RE0A 3BLEA 3ZRCC 1YUHB 5E1IA 2W07A 4JTTA 3RGHA 3TZVC 4LRTA 4I0PD 1BVWA 1ZL1A 1A6AB 5F9JA 4LRIA 4LSRL 3MREA 3QKZA 1KM6A 5FCUL 3PTDA 4UTHA 3IB4A 1AD9A 1FAIL 4QF1A 2YXWA 5IDZA 4A6YL 1JHLH 2EUZA 4MA1B 3O05A 4IFKB 3OGOE 4G3YH 2IANA 2YW4A 2OQLA 1FDLH 3ZZ1A 3KWWB 2FDSA 1IE4A 3PJXA 3WF0A 3E7JA 1VBJA 1DVJA 3MLYH 2ZKWA 3G6JB 2GJLA 1NFBA 1F3DJ 3ARZA 2ZAHA 3TWBA 3SKOB 3JBG7 1KGYE 4PL2A 2J8GA 1HG3A 5F7FA 3SO7A 4O17A 3MRLA 3UXLA 5KVDE 2UVEA 4JTQA 1O5QA 1DBBH 3WD3A 3FT3B 3LH2H 1E4HA 3IMRA 3L8QA 2IMNA 4AVJA 4Q8TA 2C9SA 2DQFA 4CC4A 4IBSA 1AK5A 1MQRA 2FHBA 3IGAB 4RAUB 1QW9A 5I3FA 2ZWLT 3E2HB 3T77A 4NEHB 4XC1L 3KBJA 4RGOL 4E41E 1BD2E 2YAQA 3MODL 1FYHB 4B3VA 2EDKA 2BODX 4DPBX 2WKJA 2RBLA 1B1YA 5IHLB 3H0TA 3C8KB 1XCWA 2J78A 5IIEB 5LN4A 5AZEL 1RUSA 1RJPA 1JUBA 5E9DE 5HY9A 1MPAL 3F7JA 2J9ZA 5C2BL 4PRNB 1U8CB 3QZLA 1FAIH 2HPOA 4Y4HC 1MXDA 5XIAA 1JGIA 5IVXF 2BPBA 2NY2D 4JFSA 4P57A 1X5XA 1P0SE 3V0TA 1QATA 2BMKA 1XF4B 1XRFA 1IE5A 4P2QE 4CBPA 2WWDA 2PDKA 1F7BA 1KEGH 1B3WA 5F1UA 5DXYA 3C6CA 5JHDD 3CDFA 1A6WL 1IKNC 1K9FA 2DWDB 2V3FA 2X28A 5DD0H 1R5VB 2HWZH 3VI3B 4R34A 5EBLA 1VHPA 1CLZL 3F58H 1N55A 4WHTB 2H45A 4E5XB 3GS6A 3WLSA 5A2BA 1JZ6A 4PRTA 3C5QA 3TF4A 2R91A 2DDXA 1GS7A 5IHZA 5KYYA 1QRQA 3D39D 5ICYB 2RH0A 4NERA 3S1VA 4PIBA 4KC3B 1G4MA 1HU8A 1TLMA 5JO5A 5T5NF 3LQAH 4H9ZA 5FESA 3NIGF 5IW6B 5DURD 2PDNA 4E38A 3K1DA 4K8GA 4ZUSA 2WN3A 4WSKA 1MFDH 1QBAA 4KTDL 5BZDA 1F2XK 4LLUB 2EZ0D 4Z7OF 4GQPH 7FABH 3QIWC 3N3EA 3SKUD 3RMEA 3S96B 3VIJA 3RJYA 2R9HD 5FKAA 3N25A 3G3LA 4DP5X 3I9AA 5DD5L 3Q4DA 1NFPA 2F7IA 1SJAA 4M4RB 4KRTA 2H9AB 3Q44A 2AQ2A 2P5ED 1YXCA 4AY8A 4NUQA 1IWBA 1YVLA 2YK1H 3TN0D 4K5PA 2GBUA 1XRVA 5E2WH 2XWXA 3TWYA 4LESA 4IOIB 1IAII 1EO8H 4XXWA 4OLYH 4NJAL 3U2EA 3N2BA 4PRWA 1OCBA 3BVNB 1OK0A 1K4GA 2WW8A 3SRKA 4M62H 1TCRB 4Y16C 4KOBA 2J4GA 3DUHA 2GI7A 2BNUB 5A6JA 4XNMA 2ZNXA 2VDLH 1N59A 4HK3J 4PWJA 2FQIA 5IM7B 4FMFA 4YSPA 3QPEA 2PDUA 2CGZA 3WLBB 3P9MA 3LKOB 2HRWA 2Z65C 5GS2H 2P52A 4AEFA 2X10A 1HINL 1XXFC 3TEZA 4NZUL 4RBPK 5L7XL 2HKHL 3D0LB 2QKSA 5LAPA 2DUZA 4ZUUA 3H7UA 1C91A 4PREB 3HRZC 2XKNB 2WZTA 3V6FB 1P7TB 2J7FA 4XAGA 4R0LA 1VPOL 4JKPL 1PV8A 3NEXA 5MENE 3APGA 1BAGA 8A3HA 4XN7A 3VVGA 1H7XA 3ZKQD 1ZLPA 2Z2UA 4WY0B 1NCWH 4HNTA 1FFNA 4KJWD 4LGSB 2WYHA 4ZFZB 4FERA 1EEZB 1BECA 3TYFB 5EF0A 4TNVF 2MJWA 1Z3GH 3P3RA 2YPLD 3QE5A 4OF8A 4BFOA 1C5CL 3QGKC 4JR5A 2YPVA 3LHWA 3WN5C 1U3HB 3VFSA 1FGNL 2Q3ZA 4QTFA 3U7AA 3G0UA 1HH9B 1OWRM 4ES8A 3G3DA 1NANI 5B38A 4IICA 3O2DA 4MJ5B 2OLHA 3V7PA 1YNTB 5A43C 2QJHA 3R7MA 4WOZA 3C2YA 1AGEB 4U6YB 5C08A 4LCCA 2D7QA 1FA2A 4LVNB 1FG9C 3CHPA 1S5TA 1MCCA 5A6IA 1DCLA 2DQMA 4UDUA 3HG3A 2V8ZA 3V4PA 1XL9A 1QUPA 2HKFH 4JR9L 1TX2A 1Y07A 2D73A 5DHDA 3KPMA 1OJXA 4OM1L 3N6QA 4OBSA 4ZW8A 5F6IB 2A6KA 3AFLA 2BHYA 4XMVA 4PV9B 4M5ZH 2EYRB 2ITFA 2XZZA 1UJPA 3VI3E 1WITA 4ML9A 2IXQA 4D9QE 4X5XB 1W0VA 2X1SA 4URIA 1U8NA 3ECBA 2UWEB 4ONHB 1TTBA 5FUOH 1ZV2A 3MACL 4MMZB 1VA9A 1JZDC 5LO7A 1N0XL 3WY2A 4JKPH 3D4GA 3U9PH 4LLVB 4JPIB 3GF8A 1E6JL 4Z1CA 5D7SL 5DC2A 1KXHA 3HZKB 4C57C 5BVPL 3RGTA 5TF1L 1JJUA 1KACB 5EC2B 2VDKB 4A2SA 1SJCA 3MN8A 3WE1A 3PN8A 1J8RA 1LLWA 4HIJA 4LTSA 1OE2A 3E0FA 1KPRA 3F6LA 3MMWA 2WXIA 3OKMA 1BREA 2AEWA 3BGMB 4NKIL 4WI0B 2W9DL 3VRLF 3Q7JA 1YJDH 2CO4A 4IBWA 4JJHA 4MYAA 2OPJA 2V5MA 5FEWA 2NNAB 4AMXA 3T2OA 4I6VA 4X6CA 2NX5D 3GRWH 3U2IA 4Y1AE 1DIEA 5HJYA 5F3HB 1IT7A 3O8XC 3DHMA 4B41A 1U5VA 2V5RA 3SI9A 1U3YA 4FDWA 4IUGA 2A77H 5IBLD 5FM4A 5C8JA 4PRHD 1MVYA 3MBWB 1QCWA 4CVWA 3BGGA 4WGVB 5DD1H 2WMGA 4AZ7A 4YC2B 3MJYA 4KKQA 2MQ0A 1YSOA 5E4OA 4UYQA 3QFDB 2SEBA 1WKEA 1SOKA 1E6OH 1EA0A 2C14A 2AZUA 3VRJA 5DJAA 2VFGA 1R6WA 1ZT4B 3W7RA 3HUJE 2DI7A 3TVMA 1L2UA 5B1CA 4P3CH 1E7UA 1SN5A 2J13A 3UNTA 4B3ZA 4FCHA 3TE9A 2CCLA 1XLLA 3HI5H 3ABZA 1HJXA 5D2NC 2CJUH 5IUCA 1ZV9A 2FE0A 3D48R 1FUYA 5I9QC 2BASA 2ZCHL 4F9LA 2W67A 1KGUA 1MHPL 2GGIA 1PFOA 3JWNE 4X2UA 2JKJA 5TQLA 2FK9A 3HR5B 2JFCA 2K7PA 5SWQB 1HUVA 5AL0A 2EYTA 3C5JB 5A2KH 4DJDD 4ENZA 4RRPM 4OZGF 3GNML 3I6SA 5CEXB 2CJTA 3MNWA 4Q89A 4JHMA 3VMPA 1JGUL 2R1WA 4PE8A 3FUDA 4HFWA 1TPH1 2UY4A 3CZFB 5IT2H 5AYYA 1HKMA 4XMLH 3B9AA 4FXJA 4OW6A 5C0JB 4MJIA 1WS8A 3PUCA 4Z7NF 4X7FC 4W4OC 1TV8A 3VXUE 1YEHL 3T40A 4AYSA 5ESQA 3S3SA 1PZSA 1JPTH 3G1AA 4UTTA 4WK2B 4AM0B 3AIQA 1FNSH 1M9HA 3WLLA 4U0RC 3IDXL 2PPAA 1ZHBA 4GMTL 4BWLA 2Y6SC 1WC7A 1NWUA 4BWTA 3SRFA 3VD7A 1VCAA 3MRMA 3UEZA 3A4WA 4KCTA 1B6UA 2R1YB 4FFZA 2XQYG 1MXGA 3HJEA 1MJ8L 3K71B 3VKBA 3SO3C 1FCVA 2O9TA 3SN4A 4YSSA 3MCLL 2UX6A 4PWFA 2UWFA 3VFWA 2QPEB 3R2GA 4DP1X 4OFKA 1V6UA 4EN3B 3PHOB 3KDMA 2APFA 4G71B 1ZA6B 3S3BB 2HFTA 1C7TA 1U6AH 1G0XA 5FL1A 5B1JC 2NY6D 4FFTA 3NJHA 2CKNA 1E8XA 1OADA 1HIML 4PD4K 1LUCB 3W9EB 1TKKA 5FYLD 3E12A 3R0DA 4UV7L 1LRTA 1CGXA 4IK7A 2CNYA 3FQWB 3W7JA 3BP4B 3CVCA 3O16A 3TP4A 2EKGA 5U7SA 2EH7H 1XLJA 3BVJA 2F54E 1BTMA 2C1IA 4I9WD 4F0SA 4AZ6A 5HBBA 1AIFA 2I26N 3W7IA 1PQZA 4KKLD 4IHOA 3PULA 1LQBC 1RULH 3MV7B 4L64A 3RTQD 3LTSA 3NIFE 2ODOA 3T09A 4G7YL 3ARDB 1XI3A 1DHKA 4UCGA 4E9QA 3DURA 3W11C 4M8QA 3QUMA 1A0QL 2X70A 3IVTA 4LLQA 3T4YA 5FB8B 1ECZA 3ULVL 3GW0A 4HWBL 3UTTB 5EU5B 5I75B 1YIXA 5KOMC 4W93A 5J0BA 4ERSL 5T3XE 1FHNA 1BZ7B 1G9EA 1VGEH 1WUZA 3U46B 3NEOA 5LVEA 4EI5C 1KT2B 4Y7OC 3A22A 1MCBA 3NSJA 2OTWB 2EXYC 2OZTA 2RGLA 1ZP3A 3IJHA 2R56L 1EJXC 5I0VA 3IUHA 2NXGA 1JK8B 1H3XA 1BG4A 1H3WM 1XQ4A 1S7VA 3AXXA 2DI9A 4UTWC 1J6PA 1VBGA 5C71A 5DRCA 1CBVH 3TH4T 4XBGA 2QJMA 1D5IL 3VYLA 2KQNA 1RHFA 3B8WA 3S36X 3D5OF 5EZOL 1BKHA 3VNYA 1AKJD 1KYAA 3IGSA 5IM51 4RMSA 1U2HA 4FLRA 4IMKA 3S6TA 4W9JC 1NKGA 5IOKA 3MLRH 4PJXE 3FFCB 4MNJA 5AYQA 4GUIA 4Z17A 4RV3A 5EF3A 3V0AC 5DDHB 1BLIA 2YQ2A 1GOWA 1QVOA 4XTIA 5KVGL 2PS2A 1ITXA 3MV9A 4XO4A 4H0GA 4ZPTA 4M8VA 4O19A 1NCGA 2L7EA 3R4DA 3NQ6A 5IHUH 3BN9C 2BY0A 2VLMD 3D3VB 5H2ZA 4MWAD 4TNGA 3A0OA 1PKQB 3VI4A 2NY1C 1ZA3B 1T2JA 5FYJL 2DVUA 3CUGA 1A0QH 1CWYA 3RJOA 3C8DA 3PWVB 3V6ZB 1AJ0A 1MLCB 3DGGA 3ZE0B 2ITDB 3VGEA 4N0RA 4ANWA 3O6DA 5DA0B 1EQWA 5JQIB 4L5FE 4UFJA 5LGKA 4TUKH 3WELA 3T8QA 3DC8A 1DVXA 1VJIA 2FGWH 4L4TD 1V0LA 3NL2A 1EZLA 5AW1B 4BRVA 4X3ZA 3GMPB 5H35A 4M82A 1TG8A 3TBBA 4A22A 4FB7A 2DYPD 1L0XA 4F58L 3SKJH 2ZAIA 2E7BA 4PMRA 3JWOH 3V10A 3W02A 5HYIA 5CGMA 5AYXA 2BIMA 4ZOEA 3C5SA 4U5IA 1J5IA 4ZXOA 2ROYA 3QOMA 4B7IA 1DWFM 2V8LA 3SJVB 1KRCC 1MEHA 4DUXA 1JGDB 1WUFA 3H23A 3DX8A 5G4NA 1GWJA 4APQB 1B3YA 5JQ9A 3TH2T 3GBEA 3OO2A 1VADA 4JZOA 2DZEA 2QQNL 1I1AA 1BX2B 1KCSH 5IB1B 1PZUB 1JNHB 5TE4H 2QV4A 1KLUB 4BZ2H 2XQBL 5IEHB 4P7QA 2QAPA 3I75B 4YGVA 1F8TL 4OV9A 2JB5L 1KM0A 4ZXLA 2FATL 2W9LA 3MP4A 4BH8A 2FEDD 1RQEA 1A6TB 1GVEA 3CLEH 3MROA 3SQBA 1MDLA 1H0DB 2GDVA 3OZPA 1JPSL 1XO8A 4N2GA 3IJEA 3BUDA 1TSRA 1MHHA 1YUHA 3NPSB 1KLFB 3O3EB 4ECNA 1ISZA 2HX9A 2VISB 3PPEA 4KHXL 5E1GA 1FVDB 2XVGA 1KRBC 3MV7E 2Z1VA 3VXMB 4P8WA 1URLA 1V0KA 2ZA3A 5EZIH 1L9OA 5SX5H 3RI5K 3EOSA 1L7TH 5D7KE 2OMTB 2CBTA 3PZ9A 1Z9MA 4UWQB 1ZHKA 1NEZB 3S0PA 1I4FB 4F58H 2TSYA 2N1KA 4Z18A 3KWWA 4Y88A 4N4QA 2ZOUA 2X6MA 5CCZA 3G6JA 2VLKE 4GCAA 3CAWA 5E9XA 3HE6B 2WZ5A 2XTSA 2R2EB 3W3OA 2E27H 4UOZA 3R1GL 4LOVA 3AXLB 3HQPA 4FKHA 4HZ7A 1KNOA 5L2KB 2HJLB 3CFJA 3L7RA 3KAAA 2EE2A 2QQNH 3V6BR 4FI7A 3EHBC 2B1AH 1HHGB 4EK7A 5HI5D 1LEKB 1EJWC 3NO3A 3GK0A 1J8SA 4KDTC 4RAUA 4H41A 1RBLA 1OP4A 4G6MH 5K9KB 4Q32A 2QIWA 2WVVB 3VACA 5HGDB 3ZKND 2FJHA 4D9RE 2VM3A 3TN6A 3FFCE 3NABL 1E8YA 4MDRA 2Q01A 1F6AB 3PJNA 1NARA 3CH9A 3TF7C 3W2DH 3NTCH 4JAWA 3LI1A 4A68A 1BYDA 1CGTA 4KTEL 3WH9A 3PZGA 1F02I 2DLEA 1V08A 4YTRA 5EMJA 2XH4A 3D3VE 3ZXWA 2PPDA 1Y8BA 3U1SH 2GJ6D 4OBTA 4PRNA 1OSEA 2IOMA 1EEPA 1D5XB 4MNLA 1E0VA 4J3OF 5ESAA 4XVDA 1JJKA 1P1XA 2CESA 5AHMA 4O00A 4KY1L 4JVWA 3UBXG 1BF2A 4IKKA 3ZE0E 4L61A 3RIKA 3TCEA 3S6CA 1E2WA 3PJSA 4IGNA 2VXTL 1XF4A 4R4ND 1ZVYA 1F6PA 4TV6A 4A7GA 1Z9SB 3MLUL 1RVFH 2IADB 1U8QB 3H4XA 1NC2A 1P48A 1PWMA 4GQZA 5EOCH 2OT0A 1GYWA 3QUZD 4HEPA 3KCOA 1NDGB 3CC5B 2GLKA 1QPNA 1EDQA 2CO1A 3FU6A 4FQHB 1R5VA 4FG6C 2BRRL 3BJTA 3H9SD 3MRDB 15C8L 2ICEC 3C3NA 1UC4A 1L9MA 5CS7A 3SJVE 5DMYA 4AWJC 3QJUB 4WHTA 4L3CB 2Q7NA 3BIBX 1J8VA 5DRWB 4PYHA 3HF3A 4KGJA 4E5XA 2YD6A 1KM2A 4DGIL 4A2RA 4QSFA 3C5ZD 3FTYA 3OLIA 4XKMA 4LCYA 5EU6A 1V51A 3OXSB 4QY8B 3QFJD 4EPSA 1H9VA 2D9QB 3BWZA 5ABZA 4JNXA 4NM8L 5SWZA 4NLHA 4PEKA 3GLEA 4NB7A 2EDXA 3IGLA 4OQTA 3HA1A 4QTIL 4NUGL 4H2HA 2N0MA 4LLUA 4W6WB 5CZXC 5DELA 3UTSD 4ORGA 1CMOA 3PDDA 2QF8A 3S96A 2POTA 1EERB 3IKCB 1AO7A 1UFGA 2EF9A 3O3AB 1HGYA 4M4RA 1AAJA 4WV1B 2ALDA 4X80L 3WUGA 2VXTH 4JZ5A 1FWDC 4OLZL 1NY1A 4M7TA 2X7LB 1SFSA 1KCWA 4IOIA 4JX4A 1JGVL 3MV8E 5I09A 4F7KA 2DQTH 3BVNA 5JPMA 5E6RB 4B3KA 2VDNH 1FWGC 2CBJA 3P77A 4FLOA 2ARWA 2HLFD 2VDQL 3IFNL 1O60A 4GRWE 3TBVA 4AEHH 4A8LA 3BD5A 3SQSA 3D34A 3IFPA 2BNUA 3QPQC 2KYIA 1C1EH 1K6QL 2PXYB 2EDWA 4LB3A 5D33A 2NCMA 3MZNA 1J48A 3VXRD 2F8XC 5J1AB 3FO2A 5IM7A 5I6MA 1O5XA 3LZLA 5JXAH 1TPB1 4MB5A 1ZHLB 1BHGA 5JPNC 1ZHAA 3CSPA 3P0GB 3UG4A 2BLFA 1R85A 3NEEA 4ZBCA 3WLMA 3D0LA 4EWJA 1CZ8H 3NL3A 3VFVB 5AQ0A 1A6ZB 3BK0A 4U3HA 8FABA 4ESKA 2XKNA 3RWEA 1HP5A 1P7TA 3ZHDA 5GGRA 1CD9B 5E5UB 3T0VA 3L95B 4ZJ9A 1MAJA 5CR1A 3B2VH 2EQDA 4WY0A 4BFFA 3M1BB 4ERIA 1WWWX 3PHSA 3N12A 1QLRA 2B1HL 1I2NA 3TYFA 5ESVB 3QIUB 3TA3C 3B97A 4YH6A 3O63A 1RZFH 3GBML 3C52A 3F2CA 4GBXD 2A74B 3QULB 2ZXWB 2JJTC 5DYFA 2WBJA 5M1TA 1BJ8A 4DO4A 3MGTA 3USBA 4NFBA 2ATKB 5TQ2L 2IH3B 3MJ7B 1DDTA 3M0XA 4MJ5A 1YNTA 1FO0H 2X12A 3HJZA 1OG0A 4KRZA 3MO7A 1WPCA 4EWND 3NCJH 2XISA 1KBLA 1AGEA 1CT8B 4MHBA 5D1QA 1TQJA 4U6YA 4PN2A 1SMAA 3OG3A 3V0GA 3IE4A 1DFXA 5TIMA 1IGTA 5DRXB 2W92A 4JRLA 1ISYA 1MW1A 2DZAA 1TVHB 3BDXA 3EOAB 4I2XB 1WBHA 3Q3GB 3Q6FB 4W89A 3ONCA 5JXEC 4BR1A 2C1GA 2C9QA 4HCFA 2WYIA 1OXYA 2XN9D 4HU0A 5BZWA 4C56A 3F7YA 2A6JA 3T1FB 1FL5B 1D3HA 3OZYA 4PV9A 5K9QI 2EYRA 1TUXA 4PN6A 1WCQA 3G04A 3IIXA 1TV4A 2QR0B 3OKEB 1DQIA 4PL1A 4X5XA 1DWIM 2VFEA 2QPFA 2UWEA 1O7DC 4TKWA 3FUKA 3QSRA 1HKLH 5HHOD 2OMYB 2YN3A 2HNEA 2HH0H 3QG6B 4AIOA 3IWPA 3M17B 5SX5K 4MMZA 2QHRH 5GS1B 1X1ZA 5DCBA 1O0VA 3STLB 2ZZ3A 1XW8A 1J1PH 1Z5HA 3KLKA 2A9ML 5F96H 4N8PA 3HHRB 1QI2A 4J9JA 3N11A 3W22A 2B1HH 3HZKA 3VXTB 3D9AL 4POZC 3JSSA 3L2LA 1L0PA 4JO4H 1I85A 4M6ML 2F6AA 5T9CE 2DEPA 3LERA 3QY7A 1KDIA 1JTOA 5PAZA 1EANA 1IT9H 5JIPA 4Y2DC 4N6RA 3GU9A 1CD8A 5DK2B 5ADPL 3SECA 2VR8A 3JRKA 1JIBA 4OAWB 3BGMA 5DJDA 2FZ8A 4IFRA 2YJQA 2CBMA 2JB6B 1AGDB 2VL5B 3NO5A 3JV6A 1JYNA 2NNAA 4NLAA 1MQKH 3EBVA 5DR5L 3H85A 2Y5QA 4MTMA 4GIAA 1T5WB 1MCIA 4M43L 2GT9B 4FQ2H 5MEPB 2VABA 2BVOA 4UT9H 1PD1A 1IEHA 1U8LB 1J5DA 2A1WL 2HFGH 2VW6A 5HGGS 5IJBC 3ZVIA 3WBAA 3FRUA 4IOFD 4J2QA 5IGXH 5D7LA 3LSOA 3LMJL 4G7RB 4MZ3A 4NO5B 5AVRB 4H9MA 5CGYC 4GUQA 2IF7A 1A5LC 1RU9H 2VO8A 3RURA 1TB3A 1SZFA 1DZBA 3PY9A 3UC2A 2H6PA 2JCWA 3T3PF 3QWOA 3FU7B 5DEFB 4F48A 2KERA 3B2DC 3KBSA 2GIXA 1XXXA 2GIMA 2CW6A 2E9LA 3NAAH 1TZOA 1YEJL 4PJDF 1MOEA 3QEGL 1RCYA 4JANA 1P2CA 2PYFB 3IXAB 1HVQA 3FSTA 1UASA 1IYXA 4J8QA 3BZFB 3C5XA 3X2QB 2VDPB 1ETB1 2XQYK 1WNOA 2XX1A 5D7JC 1NKRA 1DIOA 5FHAH 3FT4B 3OD3A 1ZTXH 1GW0A 3NP4A 4TF4A 3BV7A 2NQ9A 2VXUH 1B88A 2CKBH 4E42B 3HR5A 4AXKA 4MF4A 5K5YA 2CLZB 3K91A 5SWQA 6FABL 2QZQA 3A4EA 4F5CA 4RGNB 2NQLA 1HOCB 4DOHB 1S1PA 4GKNB 4YE4L 4N0FB 4CNSA 4F2UA 4YDLC 5CEXA 5DBUA 1OFEA 4YDKH 4PSRA 4QGCA 4GG9A 5CILH 4MAUL 2UVFA 5EYWA 3QHZH 1X5MA 4DKTA 1I9IL 4IRJB 3PS7A 1VACB 1H1ZA 4WTQA 1GAFL 1WYIA 1L6SA 4JDVA 1MFEL 4DAFA 4QXWA 3TXZA 4K23L 5C0JA 2NSMA 4PUWA 1R24A 5HHVH 4OLUL 5DLML 5C3IA 1NUGA 3M0LA 4PLNC 2YDRA 4LBRA 3DETD 3CEUA 2IFFL 3OGCB 2IJ0C 3LMJH 1A6UL 3NK4A 6REQB 2W66A 3K2KA 2I85A 1KYFA 2AQSA 1P53A 4LDLB 2HWGA 1MUCA 2Y5TA 5CEZL 3FJLA 1ED3B 3S8GB 3B40A 1GYMA 1JULA 4NENA 4YDJB 2R1YA 2ZYSA 3ARBD 4DETA 3T4AB 4IHBA 1GOIA 4OD1L 5K9OB 2YFNA 1YDVA 4TRPL 5DJYA 2DWEB 5EKYA 4ODBD 4DEWA 3AACA 1T7WA 3UW6A 4XP9H 1E1CA 1M1SA 1JWUA 4ENED 5IQ7L 1NAKH 4XXCC 1JPMA 1YY8B 2CO2A 3I3BA 5CJOL 3V0EA 1TWIA 1WX0A 4LVOC 5GZOC 1EPFA 5FHBL 1XM3A 1J8KA 2ZUSA 3S37L 2D3VA 1P69B 6FABH 3WLHA 4Z3EA 2HISA 4P8UA 3T8XA 2VR7A 4Z3JA 5CD3B 4UV4L 3W9EA 4AZIA 1T2XA 3PABB 4GXMA 4ALDA 4G1MB 2X4QA 3FQWA 2B1OA 5FLUA 3RCYA 4P5RA 1H6UA 4ALAL 4XN4A 1S7QA 5K1JA 1TJXA 2H1XA 3VE7A 1UBPC 4JFEB 1A3WA 2DYSB 1A7RL 4OLUH 2CALA 4XB8A 1T1WA 2WLNA 4RETB 5FR3A 4L4JA 1JHKH 3SCPA 4H01A 1CF8L 1EP2A 1OCQA 1HEHC 3SDXE 3H7BA 3CL7A 2H2PD 4KITB 3TEYA 3E9UA 3UTPE 3WFBL 4GSQA 3PP4L 2IQ0A 2EICA 2BNJA 1KXVA 5FB8A 1MCKA 4I9XA 4LEEA 3WZ0E 3UTTA 2YD7A 3G3MA 5KVFL 4QP0A 1YHTA 2V3DA 3UPRA 4F24A 1JTTA 3UZJA 4S38A 1I3GH 5D6CB 4UQ3B 3HMWH 1BZ7A 5IFHH 4UT7H 2F8VA 2O0TA 1BD2B 1KT2A 2EG6A 1G7QB 3EB4A 3WBXA 2VTFA 2Q8AH 3FPYA 3S3CB 4X5LA 1JRHI 2CETA 2FX8L 4Q14A 2Z7GA 3CHQA 3FMGL 4HKBB 3OZMA 5IQ7H 2XZCL 4P59L 2GW5A 2OULB 5E9DB 4HISA 4D2JA 1LD9B 2F61A 1Q72L 4ANVA 1EAPA 2VR4A 4RAVA 3LI0A 4DBWA 4U1JB 4LSVL 2HFFB 3SY1A 4I9TA 3CFQA 4C1KA 1UR3M 1HOEA 3EUDA 5DDHA 3B0XA 3T78A 4G83A 1QAWA 4ODXA 4HUUB 3MJWA 1F90H 4RGNE 1EZWA 3F7VB 3T0XA 1XBVA 5I71C 2PLJA 1YNLL 2FZ3A 1A3RL 2BNQD 4A35A 3LJ3A 4RL3A 3BFWA 3BTNA 3LN3A 1PKQA 4F40A 1IZKA 1MCPH 2O55A 5DEZA 1ZA3A 3O9WC 3TCTA 3IRPX 1QWUA 3TBYA 3PP4H 3E2QA 3V6ZA 1AR1D 4Y5YC 3FW6A 4GNVA 2IPKB 5E8EB