1KGXA

Three dimensional structure analysis of the r195q variant of human pancreatic alpha amylase
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFQLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgxA01
2CKSA 3NDYA 2G3JA 1B30A 4JCMA 2QLYA 3ALFA 2MANA 3SCVA 3WKZA 1LL4A 2J7HA 1CENA 2WMGA 2QV4A 2DT1A 4PTMA 2OYKA 3AHTA 3TONA 5CLTA 3ZJKA 1U2YA 1E71M 5AC4A 1QW9A 1CXEA 2V3DA 3VSUA 4CD7A 1JFHA 5IFPA 2XVGA 1W32A 3WQ8A 3VX0A 4MNKA 2BVDA 1V3MA 4J3XA 4TXEA 4AWEA 1OCQA 3OGSA 1EA9C 4DO4A 1JFXA 4TTUA 3AYRA 1KBKA 2DSWA 3KWXA 4TOQA 1SR0A 1JYXA 3DX3A 1IT0A 1W3KA 1OGGA 1KWGA 5JUVA 1X1NA 3CUGA 2C0HA 1WZLA 4B9YA 4EK7A 1HKKA 1PEZA 4GKLA 1MFUA 2GUYA 2UY2A 2BXZA 2RGLA 3VIJA 2EQDA 4RE2A 2YIHA 3CZGA 5I24A 4MB1A 3UEQA 3VD4A 3CGTA 4CKQA 3ZQ9A 4AD3A 3GZAA 4FF5A 2W66A 2J25A 1WCGA 2XWEA 1O7DC 3L2MA 3THDA 1CPUA 4CN1A 4BS0A 4ACYA 1G9HA 1J0KA 2Q8XA 4XZWA 1DP0A 4CU6A 4F9JA 2EJ1A 1E1FA 2JEPA 1CDGA 4AD5A 3WUFA 4FLSA 4OBRA 4PTXA 4AD0A 4PSPA 1G94A 4CD8A 3BCDA 3CMJA 3IANA 3SUVA 2XJ7A 3PZTA 4QLJA 3OGVA 3S6TA 1EXPA 2GFTA 4PMNA 1JF6A 3KZSA 2NT1A 6A3HA 4HMCA 2G3NA 5JBEA 2V38A 2X1IA 1G5AA 1TQUA 1KQYA 1JI2A 1JDDA 2D24A 1JYNA 1B3ZA 3CTTA 4KWUA 1UOKA 2OSYA 2WCGA 2VQTA 3DX4A 1YQ2A 1BSIA 3VSTA 3VVGA 1Q4NX 4AW7A 1CBGA 1E6ZA 3ZM8A 3TOPA 4K68A 3VD5A 4GPNA 1KXTA 2WMIA 3THCA 2YFNA 1C8QA 1C90A 2EPMX 4DUXA 4AZCA 3GH5A 4J3VA 5E9AA 1BFNA 1HP5A 3AXXA 1VFMA 4GQQA 7CGTA 2VCCA 4UTFA 3T2PA 1AQMA 1QHPA 1QI0A 3E1F1 4A4AA 3W6MA 3FXYA 3OLDA 4AMXA 2V3GA 4RE3A 1K9EA 4GXPA 1NARA 1UR1A 1MYRA 4DUWA 3WNOA 3ZOAA 3SURA 3QGVA 4KMQA 3PHAA 3ZO9A 2YBTA 3ALGA 4M81A 1JNEA 4NZCA 4CU7A 3U7VA 1VBRA 3VDHA 1GOQA 1A3HA 1I1WA 3CZNA 3SIMA 2ZXBA 1EQPA 3T0DA 4JHOA 2XYLA 3N17A 2D0FA 9CGTA 4CCDA 4PMYA 4P7OA 4AEFA 2VCAA 3A23A 4HMEA 2CERA 1O7AA 3LXCA 2D3LA 3GH4A 1JD7A 3VD7A 4YN5A 3RO8A 5DT7A 4P8VA 3SCRA 1M03A 3WL1A 5A1AA 4W7VA 2XVNA 2WXDM 1QPKA 1WDSA 4JCLA 2CXGA 2Y4SA 1RH9A 2CHOA 3EJQA 2FE0A 5D8ZA 3IJ9A 2ALWA 3KL5A 1MQPA 3CZJA 1KGUA 2CYGA 2CITA 4LYRA 2ZX7A 5A6BA 3DDGA 3BVVA 3CUFA 2VZUA 3UG5A 5BXPA 1E4NA 2BVTA 1CGVA 1QI4A 3L4YA 3CUJA 4LXFA 2BVYA 5I78A 1CXHA 3TV8A 3VINA 2D20A 4HZ6A 1TMQA 2AMGA 1UD6A 3AMGA 3MS8A 2J62A 5EFDA 4X9YA 5D9NA 2WCAA 3EJSA 1V02E 1BVZA 1W1VA 2J7DA 4D71A 1V0NA 2ZUVA 3VILA 1RP9A 1VEOA 2WLZA 2A3BA 4PMXA 1OGBA 3D4ZA 4XX6A 4C7FA 2VMFA 3SCPA 3WBAA 3T0AA 2WHKA 4OZOA 4HA3A 4AZ6A 3DX0A 3CH9A 3ARXA 1UD8A 2YL9A 4XUYA 3WQWA 1DWJM 2GJRA 4AY1A 1E6PA 5KEZA 2XWDA 2ZX8A 3VGEA 2ZXAA 1D2KA 3DECA 1HWWA 4W93A 3DHUA 3WD0A 1KQZA 1NWUA 5ABFB 4S3KA 3QR3A 4D72A 3EMQA 1JZ2A 2AOSA 4NRRA 3CMGA 1W3LA 4NXKA 4DO5A 3QOMA 2XVKA 3B9DA 5M03A 3HZ3A 1HJSA 5ABGA 3N13A 2YLAA 3AHVA 2YA1A 1H09A 1LLOA 1TA3A 4R5EA 2VJXA 2G3MA 3A3HA 3FY1A 3ZJ6A 2WVTA 2YA2A 1SMDA 1U33A 4AEEA 3WD2A 1B3VA 4RE4A 3WDIA 1KGWA 2J4GA 3MUZ1 5DMYA 2BY3A 2X2YA 3AHZA 4UQEA 3VOCA 2PB1A 3GXDA 2JIWA 1GQKA 3WH8A 3LRLA 3O2LA 3WF0A 2EEXA 4UFHA 1ISXA 1H5VA 5C8BB 3KEHA 2BY1A 1PIGA 4QCFA 5GNXA 4CD6A 3AIVA 3VMNA 3BAWA 3BAYA 4JFTA 5A2AA 4GZIA 5A3HA 4AZIA 4J3TA 1R87A 3S5ZA 4J28A 4D1IA 3WD4A 1VFFA 6TAAA 1JDCA 4URIA 2UWFA 1HKJA 3K8KA 4AIOA 4YHEA 3DC0A 1HJUA 3W38A 3D52A 4FK9A 4WIWA 1QNQA 1W2VA 1UQYA 3ARYA 3VNZA 1XD1A 5FOOA 5HNNA 1ZL1A 1HL8A 3LMYA 2WMFA 3ZR6A 2EXOA 3LX9A 2A3HA 1PX8A 4R27A 1B2YA 4FNRA 1GORA 4NZJA 3NDZA 1KR0A 4PRWA 4S3JA 1EQCA 2J7FA 4WKHA 1FP8A 2CETA 1VEMA 1PAMA 3DX1A 1PJ9A 4EE9A 1BVNP 2J8GA 3D4YA 3N15A 4M8UA 3WD3A 3W24A 2JEQA 2F1BA 3AIRA 4BF7A 3CLWA 4UQBA 4AD1A 4PMUA 2XSAA 4UQ9A 1CTNA 1OM0A 2BXYA 3OBAA 5CZKA 2YJQA 3BAKA 2D0HA 1JYWA 2F18A 2WKLA 2IGTA 1OT1A 2IXUA 2E9BA 4JKKA 1FHLA 1NP0A 2CHNA 4XV0A 3A22A 2DDXA 3ARRA 4AZ7A 1CXIA 1DWIM 4JZ5A 5EFFA 1OIMA 1JG9A 3OLEA 3CHEA 4P7NA 2OW7A 3VDAA 1TCMA 4KGLA 4ACZB 1UQZA 4WLCA 3T09A 3ZJ7A 1JAKA 3AZTA 2D23A 1VIWA 2EACA 3RILA 2A3EA 1P6WA 1PX3A 1UWSA 3GYCA 4BA0A 1KBBA 3BUPA 1R86A 1QNPA 3PZNA 3K4DA 3N04A 3J7HA 1EO5A 1ZBVA 3MU7A 1C93A 4PMDA 4JAWA 4H41A 4ATWA 4Z2KA 1GNXA 2DH2A 3IGUA 3WEZA 3ARWA 3AIEA 2X2JA 3TP4A 2GJPA 4HA4A 5BWFA 2OSWA 2ZX5A 1W3HA 2ZUUA 2DSZA 1UWIA 5E0CA 2V3EA 1J0JA 3ZJ8A 4D6IA 3D50A 4UOZA 3WENA 1R7AA 4P8XA 5KZ6A 1CECA 2EPLX 3WFLA 2XG9A 2J79A 1QOXA 1X6LA 4AMWA 4Q7NA 4JHZA 1R33A 1LG2A 3VIOA 1JNDA 4NXSA 3WDQA 4J3WA 3BVUA 3ZT7A 1ZBCA 4GIAA 4AZGA 2VO5A 4H7VA 3PZOA 3WQ4A 3VIKA 1UWQA 1EDGA 1CEOA 1XSIA 1FP9A 1UA3A 2PBGA 3F5KA 4HP5A 1V3LA 2ZX9A 2E3ZA 1DWHM 1GJWA 3B8SA 3MUIA 4AISA 2WVUA 3UETA 4AYGA 4UOJA 4HOXA 1ZBWA 4CN4A 1GONA 3SCOA 2DSKA 3ARPA 1XSKA 4CN6A 5FL0A 3HG5A 3AISA 3AOFA 1X6NA 5A2CA 3VMPA 1PBGA 3GBDA 1E6NA 3ARVA 3QOKA 4BCEA 4MDPA 3CUHA 1WB0A 4AMCA 1HXKA 2ZIDA 2DT3A 2FHBA 5A6JA 1MFVA 2NW0A 4TVCA 5BCAA 3F5LA 5JBFA 1MQQA 4QLLA 1GVIA 1BQCA 3HJEA 1L8NA 3TTSA 3ZSTA 1QNOA 3EJUA 4XZBA 5D9MA 4U3AA 1GVYA 3T2OA 4UQCA 1UR2A 2CEQA 3A4WA 3WFZA 1QHZA 1WE5A 1VJZA 3F5JA 3RJYA 5A8OA 3PZUA 3K8MA 5A8MA 3WF4A 4JL2A 3VIPA 1L0PA 4JL1A 4M29A 4B16A 1B9ZA 1BPLB 3PZVA 5JIPA 2GDVA 3U57A 1JXKA 1TQTA 4EAMA 1B1YA 2WKGA 1K6AA 1O6IA 2WAGA 3B9EA 1UR0A 4D1JA 4Z2LA 1E0VA 4DWSD 3AS2A 2PWGA 5ABFA 4HOWA 3KLKA 1HNYA 3CZ8A 3LXBA 1VEPA 2W61A 3T0BA 2RGMA 5D9OA 2O9PA 1JF5A 4AZHA 3GXNA 1UH3A 3BLPX 2DSUA 2VL4A 1CLXA 1J0HA 4ZE4A 2JIEA 5HOSA 2X05A 3L4UA 1JXJA 4HTYA 2WC3A 5A6AA 1E9LA 4WSKA 4UFLA 1C3FA 2E40A 3PTKA 1HJQA 4UFJA 2OYMA 5AYBA 2E9MA 1DWGM 1UKOA 1KFWA 1BYCA 1W9PA 3WH6A 1JZ3A 3GDBA 1ITXA 1TQVA 3RIKA 3ZT5A 5AC5A 2WNWA 2X0HA 1XH0A 4B15A 1Q6DA 2FHCA 3UG3A 3AI0A 1NOWA 4PMVA 2DIJA 2GK1B 4DO6A 3M07A 1GOIA 2ZUWA 2WVSA 1KTBA 2ZICA 4F8XA 6CGTA 1C8XA 3AJ7A 1V6UA 3BMVA 4OIFA 4FLOA 2PC8A 2C7FA 2YL8A 1GUVA 2B31A 4AZ5A 5A6BD 5A2BA 1VJSA 1KGXA 2OYLA 1WKYA 4IISA 1Q6FA 3NJ3A 4ZE5A 3ARTA 1UD3A 4Z2JA 1H11A 3BC9A 3II1A 2NSXA 2WM0A 4JIEA 2VUYA 3WDPP 2FDMA 2D22A 3WY3A 1H2JA 1R7OA 4P7QA 4DM1A 1ECEA 3ARSA 4M24A 3MSDA 4W88A 4GO9A 2EPOA 3U5UA 5FKYA 4B3KA 2XSBA 1MW2A 2AAAA 2VX4A 4NI3A 2FH6A 1LL7A 2TAAA 2DIEA 1BYAA 1Q6CA 4ZXLA 3W26A 1UKQA 2Y8VA 2XIBA 3UCQA 2E8YA 1E5NA 4WK9A 3WUBA 1XGZA 3RMEA 1V3KA 2XN2A 4U33A 4FLQA 4TX6A 3WUEA 1I75A 3VDBA 1Y7VA 3S5YA 3MMDA 3TTOA 3SCSA 2YDQA 4HU8A 1J01A 4V27A 1M53A 1W9BM 2VRKA 4GI8A 3W37A 4D6CA 4MPKA 3A6OA 1E56A 2BY2A 1QHOA 3FHQA 4KRTA 4HA1A 4IPLA 1V3HA 4FNPA 2XUCA 4ACZA 4PBGA 5HDRA 1VFUA 1WDRA 4BQ3A 1MWOA 4QP0A 3BMWA 1HIZA 3AMCA 3BSGA 2OSXA 5CGMA 3LXAA 4U31A 1BG9A 1CZ1A 1UZ4A 3OZPA 1XH2A 3IJ7A 5DT5A 5I2UA 2BS9A 2YA0A 2J77A 2O9OA 4PYSA 4HZ8A 3WQVA 3G6LA 1GOKA 1BTCA 5A6SA 4M80A 4U3CA 4JFWA 1RD6A 2ZUMA 1H4PA 5DEZA 3FAXA 3TA9A 3WH9A 3B9AA 4H8HA 1UR9A 2BFGA 3ARZA 1JL8A 2CPUA 1DTUA 2ZUTA 2HVMA 1W9VA 4D6HA 3RJXA 3EDKA 4MJ4A 1UH2A 2O9TA 2W92A 1ZS2A 2WC7A 2G41A 4BQ5A 1QI5A 3K46A 3VIMA 4W8AA 1HTYA 4CU8A 1OD0A 4F66A 3ZR5A 2VZVA 3VU2A 4E4PA 3VGHA 1CNVA 4MTVA 3ARUA 2VX6A 2WPGA 4OBSA 1E73M 1LF1A 1QI2A 3CUIA 4ZXOA 1D7FA 5FL1A 3K1DA 1E5JA 4CCEA 2BHUA 3EJPA 4KH2A 5LA1A 4W5UA 1OT2A 3KL0A 1NQ6A 2XHYA 4Z2IA 1WZKA 1OWQA 2CESA 3L4ZA 2VC9A 1MW3A 1GHSA 5FCZA 3SCNA 1UHVA 3VX1A 2YFOA 3GXTA 2WWCA 2X2IA 1JYVA 1UR8A 1G1YA 4LPCA 3PZIA 3VIIA 4CGTA 1UYQA 4MJ2A 2XM1A 3EYPA 4NZFA 4ZFMA 2ZWYA 4OOZA 2GJXB 4WJXA 3BUQA 1UZ1A 3GXMA 1DWFM 2ESCA 3APGA 3N11A 3PBGA 1V3JA 1CYGA 3RCNA 2XN1A 4ATLA 3A5VA 3NIYA 4QAWA 2E0PA 4M56A 2VX7A 1ZJAA 3IAPA 1J10A 5TD4A 1HJXA 3WL0A 5E6YA 3CHCA 1XD0A 1HL9A 3U7BA 4LYPA 4P8WA 1XHGA 4D6DA 5CGTA 4J3SA 7TAAA 1CWYA 3A24A 3UR7A 1AQ0A 3KL3A 2CBVA 2PWEA 1KTCA 4JFUA 1JZ5A 2E4TA 1HX0A 2OLHA 1WO2A 2Y2WA 1UH4A 3LPGA 4AIUA 4AC1X 4AD2A 3WIJA 3WMSA 1TQWA 3MV01 1GJUA 2CBUA 3CZEA 2ZXDA 1R75A 1GZJA 4PCSA 3ZMRA 1CGYA 2YDRA 2CKRA 2F1AA 1BLIA 2Y5EA 2WBGA 1QBBA 1QX1A 1MW1A 4Q22A 5JIWA 2EAEA 1EOKA 2WZIA 3NYDA 2WMKA 1GOWA 4HPHA 4TVUA 4WSJA 1OB0A 1JZ4A 1Q6EA 4MB3A 3L4TA 2WBKA 3U5YA 1B90A 3T2QA 1GCYA 2VI0A 3GH7A 3AZSA 1RPKA 4MAZA 2PI6A 2F7RA 5GQBA 1CIUA 2F7OA 5DF0A 4GO8A 2UY3A 2X0YA 1QNSA 3WH5A 1AVAA 2WHLA 2GK1A 4DWSB 3FAWA 1OSEA 3SUUA 2J7EA 5EB8A 2F7QA 1WDQA 2VQUA 3GNRA 3BAIA 4UFIA 4U2ZA 1MVYA 3UESA 3AHYA 1V08A 1E72M 1QWUA 2DT0A 2G4FA 5I79A 5M3WA 4GZJA 1UWTA 5A95A 5A6KA 2PF0A 4A3HA 3EMZA 1HVQA 3BUBA 3GXFA 1C92A 2WZEA 2QMJA 1IV8A 4W89A 1HKIA 3W82A 3HG3A 1XSJA 1NWRA 5CJ5A 3N18A 2XFFA 3WELA 3MANA 1HT6A 4H8UA 2QF8A 2YL5A 1CXFA 3CC1A 3W0KA 1PIFA 2VX5A 2JF7A 1JAEA 2VVSA 5E70A 3ZIZA 1BYBA 3AS1A 1UD5A 3PZGA 3GTNA 3CZKA 4X0NA 2WK2A 4MDOA 3WUGA 4Z2GA 4EANA 3MSGA 1V0KA 4JKLA 3ECQA 4MNJA 3EMCA 1J12A 3WF2A 4IM4A 4MB4A 3AMKA 4W7WA 2CNCA 3AIWA 5A6MA 3BUDA 1VF8A 3FHAA 3EDFA 2XPKA 2J74A 2V5DA 3BCFA 5CG0A 4F79A 5IDIA 2JFEX 3POHA 3M6DA 4QLKA 1BAGA 4NX0A 4AZBA 2JF6A 2QPSA 1PX4A 3DX2A 1E6RA 3OLIA 1ITCA 1KXHA 1GQIA 3VGGA 4GI9A 1NP2A 4LGXA 2XGIA 5ABHA 4FMVA 1ODUA 4DM2A 1GQJA 2QHAA 2WMJA 5I5RA 1V6XA 1GOMA 5GNZA 4PTVA 3EDDA 1KXQA 1E0XA 4ATDA 3WBEA 3NSXA 5CPQA 2OWWA 3GBEA 4OKDA 1R46A 4HU0A 3DDFA 2YKKA 5D8WA 1GQLA 5DO8A 1UWRA 5FIPA 1VENA 1TVPA 1U30A 2W62A 1SFSA 2X09A 1MXDA 5IXEA 2EO7A 1B3WA 4FLRA 4N42A 2Z1SA 1D3CA 1Z32X 3WDHA 5I77A 3CHDA 4JFVA 1M04A 1QBAA 4UQAA 3VIGA 3SCTA 2WHJA 4D6FA 2PBOA 2VNCA 3UR8A 3CPUA 1MQRA 1OBAA 1SMAA 4QCEA 3EDEA 3DYOA 3AS3A 3OGRA 4PUEA 1W2PA 3G6MA 3MUAA 2J75A 3MKKA 1ZB5A 1C8YA 3AYSA 1QWNA 2EADA 4AXNA 4W5ZA 2WC4A 4H8VA 2WVVB 3BVTA 4F9DA 2O92A 3AMLA 2C8NA 1XYZA 1QI3A 1CGWA 4U5IA 3W27A 5C71A 1LQ0A 1BF2A 4J7RA 4UFMA 3WNPA 3IK2A 2E8ZA 3NSNA 2VZSA 1LWHA 2XGBA 4W8BA 1UKTA 4X0VA 2W91A 2YDSA 3SUWA 2W5FA 1KB3A 4KRUA 1GPFA 2Y24A 3VGBA 1G0CA 1UR4A 4W84A 3HMCA 3W29A 2PWFA 1E6XM 3O6AA 4PMRA 4UNIA 1R34A 2DSVA 3GM8A 5FD0A 4QDMA 1S46A 4WKFA 4MAVA 3A4XA 3FNDA 1TFVA 1CXLA 5EMYA 4EKJA 5A8PA 4H2CA 3MV11 1XH1A 4JKMA 2VT0A 4NRSA 3BAXA 3CHFA 2GJXA 1FH7A 3S2CA 5GPRA 1R8LA 3M7SA 5CPTA 5JBDA 4UCFA 4HOZA 5A8NA 3QHNA 2ZOXA 5I23A 4W87A 3BLBA 3D5HA 4W86A 1W9DM 1FFQA 1TR1A 4A3YA 2J47A 3BSHA 1KWKA 5HXMA 4M82A 3BH4A 3PTQA 3W25A 1BYDA 1HN1A 1E15A 1E70M 5IHRA 3BAJA 1BHGA 1HXJA 1W1YA 3L4WA 1SYTA 1K9DA 3D51A 1H41A 4P8UA 1V6YA 3HN3A 4GZEA 2WYSA 1QNRA 4Y7EA 3BVXA 2XFRA 1XRVA 3WDRA 2CCRA 3WMCA 1JI1A 3WY2A 3VKKA 4YHGA 1WP6A 3I3BA 2BHYA 4M1RA 1BGAA 2VR4A 4U2YA 2D73A 3MO4A 1CGTA 5DFAA 3AXHA 2W4XA 2FYVA 3K4AA 3WD1A 4N0RA 1BGGA 3QHOA 5M17A 3RM4A 2J7CA 4MADA 1ODZA 5A69A 1ISWA 5IHSA 5CSUA 4HMDA 4PMZA 1VBUA 4PSRA 1UA7A 4P7RA 4DWSA 5F7UA 3WH7A 3FN9A 2VRJA 3VUPA 1FFRA 5ECUA 3AROA 1ISVA 3VMOA 3WMBA 5E1QA 2DH3A 3LPOA 2D3NA 4BQ2A 2YL6A 2X2HA 1H0IA 4CD5A 1W3JA 4FNUA 4OUEA 1LJYA 4E8CA 1PS3A 3VO0A 5E09A 4PMQA 4FNTA 2YLLA 3DYPA 1ISZA 1V6VA 2WSPA 3FW6A 3BVWA 2EPNA 3ARQA 3LRMA 3OIHA 3L2LA 3SUTA 4CCCA 1OD8A 2HISA 4NF7A 2BV9A 1T0OA 3VIHA 2J78A 4CUCA 2W63A 1FH9A 4YPJA 2XN0A 5E0FA 1RP8A 4GQRA 1J18A 3AICA 2EABA 4DWSC 5I3DA 2WLYA 4MNLA 3SUSA 3WY4A 4UOQA 1H0GA 4FNQA 3WQ5A 2A3AA 1V0MA 5A94A 1HVXA 2NT0A 3CIVA 2WZHA 1UUQA 3BUIA 5C70A 1UKPA 2D1ZA 3UG4A 1QW8A 2WSKA 3LPFA 3OZOA 1FH8A 1E43A 1V3IA 4W85A 2DPEA 4NSBA 2GDUA 2J7GA 4IPNB 3WNNA 3A47A 3VM5A 3WEOA 1ISYA 3AS0A 4UZUA 2YBUA 1TE1A 5EBAA 1PZ3A 2DQXA 3MMWA 3N9KA 2DGAA 5A8QA 4C7GA 3SCWA 3VM7A 3SEPA 1C7SA 1EGZA 2EBNA 3W28A 1B0IA 2WWDA 1CGUA 2D2OA 4ZEPA 2XVLA 4J3UA 8A3HA 2ZE0A 3UERA 3I3DA 4QFUA 5GNYA 2FH8A 1Q6GA 3WNLA 1J0YA 2XVPA 1R47A 1JDAA 4CVWA 4OJYA 4UQDA 1WZMA 3T08A 4PEEA 1TZ7A 2XFYA 3KE0A 3WF1A 1BG4A 2BY0A 2DT2A 1EDQA 3O9NA 4AD4A 1WAWA 3EBVA 3WQ6A 2JE8A 1VAHA 1I1XA 1JZ6A 2WANA 4HZ7A 3GNOA 1NH6A 1NWTA 4GI6A 3VD9A 1UD4A 1IZKA 2IXVA 1GOOA 1UASA 1V6WA 4PUDA 1OGSA 3CV5A 2O9RA 2CBIA 3BXWA 2VCBA 2VVNA 1ESWA 1EIBA 4PN2A 4UFKA 1JD9A 1TVNA 2CBJA 3DYMA 4V28A 1E4LA 4W7UA 1JZ8A 3PZ9A 4V2XA 2WB5A 4TUFA 4E8DA 2Y8KA 2OWXA 3AZRA 2WVVA 5CXPA 3MUY1 5BROA 1E0WA 3K8LA 1JGIA 3H53A 3WN6A 3AHXA 5BXTA 3BLKA 1DWAM 1DEDA 1YHTA 3SCUA 3GNPA 3PZQA 2FHFA 5HPOA 1K9TA 1JZ7A 1B31A 3A21A 3PTMA 5E6ZA 3AXIA 4TTGA 2V3FA 1B3XA 1NOUA 1R85A 2XIIA 1XYFA 3IAQA 1E4IA 5BXSA 1HJWA 4RL3A 5I0DA 4D6JA 2EPKX 4W8LA 4WKAA 5BRPA 1J11A 3AFBA 1ZBKA 5HPCA 2BHZA 1AMYA 1XCXA 1A47A 1DHKA 2ZXQA 2W67A 1KR1A 5IFTA 4U5KA 1WZAA 5BRQA 5HBFA 2WCSA 1M7XA 4MNMA 2PWHA 1JIBA 5A6LA 2V5CA 5ABEA 1W1PA 1IZJA 4FNSA 3H54A 1XCWA 2X8RA 4BQ4A 1V0LA 4TX8A 3L4VA 1EOMA 3VSVA 5CLWA 3VNYA 1UD2A 4LX4A 4DUVA 3WDJA 3EJRA 3AQUA 4J27A 3RM9A 4D6EA 1W91A 3VIFA 3AMDA 3OA5A 1US2A 3PN8A 4AYSA 2OW6A 1EHAA 1TUXA 1UKSA 3JUGA 2PWDA 3M46A 2GVYA 5AY7A 1WNOA 3EJTA 3VGFA 1C7TA 1HKMA 1XC6A 2G3IA 1SZNA 2F7PA 2F8QA 1TQSA 1H3GA 2WMIB 1EHNA 4PMOA 2VZOA 2FGZA 1E6QM 4MB5A 5BXRA 4AZCB 1E3XA 2VZTA 2JALA 3OLGA 1KXVA 3VDCA 1M01A 3WSUA 4KGJA 4UR9A 1W1TA 3OB8A 1OIFA 2E9LA 3VPLA 1GW1A 2VTFA 7A3HA 3RM8A 2XTKA 5CSYA 1N82A 2IUZA 3F4VA 1VRXA 1W9UA 2GSJA 3DHPA 2ZUNA 3VD3A 3VGDA 1K9FA 1B3YA 4CD4A 3I3EA 1V02A 1UG6A 3CO4A 1CLVA 1HJVA 1NWSA 2YOCA 4BZYA 3ZSSA 3TTQA 1PZ2A 4CVUA 1MW0A 3CZLA 5D9PA 5M5DA 3EDJA 3W81A 3MI6A 4TVDA 1HP4A 3AIUA 3QHMA 1VB9A 3W53A 4PCTA 1OINA 3WY1A 1HF6A 3SCQA 5LA0A 2WW5A 2ZWZA 4Z2HA 3WEMA 3HG2A 1EDTA 4WF7A 1C91A 1ZJBA 1WPCA 3GXIA 1NM9A 3NSMA 4HPGA 2WHMA 3HU7A 2VURA 8CGTA 2UY4A 2VOTA 1EH9A 3W6LA 1LWJA 2UY5A 1E40A 1XV8A 3L4XA 1FHDA 2XM2A 4JFSA 4E2OA 5I6SA 1FOBA 1GHRA 1VFOA 1FA2A 4LYQA 1WDPA 2VR5A 1MXGA 3W4RA 3WNMA 1E1EA 3A4AA 1V03A 1LG1A 2J8FA 2J7BA 4AIEA 2F61A 1PPIA 4C7DA 1UWUA 1J9YA 2QPUA 3H55A 1AQHA 3WNKA 2OWCA 4LQ1A 2A3CA 4H04A 1E6SM 5D4YA 2CIPA 2WMHA 3POCA 1EO7A 1F4HA 5CQ1A 1NOFA 4ZENA 1E55A 5AYIA 4UZSA 1H49A 4PTWA 3GXPA 3LPPA 4IUGA 1E3ZA 2VRQA 1CXKA 4OOUA 1TG7A 3D3AA 3PZMA 3BGAA 4L4OA 4XB3A 1J0ZA 1E4MM 2FGLA 4L4PA 3TTYA 2D0GA 3NUKA 5LYRA 2DEPA 4OGZA 3HG4A 2QMKA 3LRKA 3RDKA 1QVBA 1J0IA 4B3LA 3IJ8A 3KLLA 5LA2A 1KCKA 3ZT6A 3AIBA 3WF3A 4ML4A 1US3A 3OG2A 1CGXA 3RPMA 1W9XA 2Z1KA 3N1AA 1LL6A 3AIQA 2G8ZA 5BYWA 3NCOA 3CBWA 2F2HA 3N12A 5CPSA 1H1NA 3VTRA 2ZX6A 1TA3B 4B9ZA 1G01A 2BNJA 4P7LA 4GINA 1KCLA 2ZUSA 1ZU8A 4D6GA 3MMUA 1F4AA 3CZSA
chains in the Genus database with same CATH superfamily
4GVGA 5CIPA 5E9DA 1SW0A 3SCVA 4ZMAT 2B39A 3L5XH 4AL8C 1BXUA 1Q7ZA 1LVEA 4UNVA 3P3BA 4JPGA 1UPPA 4MNKA 1PVNA 3OGSA 4OW6A 3RNQB 3MO1B 3IDJA 3T3ME 1IT0A 2Y61A 4TQEL 4MDJA 1IFGA 2AP2A 5HI4C 3QZAA 1J2WA 4FF5A 1T0MB 1LQ2A 3CHRA 4MKMA 3P0YL 4KUCF 4BS0A 1E4WL 1JOIA 4XMKL 2MQCA 4XAFA 3VZXA 4WUUD 2ZZ2A 1DHPA 4I9TA 4QLJA 3F7YA 4PTNA 2Q76A 4GOSA 2MUCA 3TBSB 4N2GA 3C2AH 3KD4A 4EI0A 1GHFH 4XXCC 4Y88A 4FFWD 4EKXA 4E5XB 4WFFE 2E86A 3ZM8A 4YBQC 4UTTA 3ME0A 5DA0B 1C8QA 5B1KA 2YK1L 1JMZA 3AXXA 1MJ8H 4M62H 3QA3A 3FQYA 1AQMA 4QI3A 2G3FA 3QC6X 3W6MA 4YCOA 3IS4A 3R1GH 3PP7A 2X9XA 1SBSL 4NQVA 1OG6A 2I14A 1EJ7L 3K13A 2OP4H 1EJ6A 1JNEA 2B1HL 3VDHA 2FJGB 4M43H 4QRRE 3CZNA 5GGTH 3B3IB 2K8QA 4JHOA 2EDQA 5G5IA 2ITDB 4XP6L 5E4AA 3GLAA 5DS1A 3W2UA 4XH2B 5H4YA 2YD5A 3SCRA 4R7DB 1UXWA 1TJHH 1Z9LA 4PWHA 4JCLA 3SJVB 2DZVA 1WOBA 3LBMA 2ALWA 5I8CB 1KG0A 1M3UA 3V6ZB 3BVVA 1XF3A 3CUFA 2IFGA 2VZUA 4N8VB 5EBMA 1GAFH 4WUIA 4MVBC 1Y6MR 4RXGA 5T3ZL 3TV8A 5IR1B 3MRFA 3UBXA 2VL5B 4M6OH 3D2UD 1YECH 5SV4A 4R3SB 4HB7A 2PWVA 2J7DA 3NDOA 2JFCA 2A99A 4YDIL 1UZDA 2VXUH 2WWMC 2AL2B 3GI9L 1PLBA 5KANG 3BE1H 2XBDA 1REQA 3C4UA 3LD8C 3M17A 3L13A 4EIVA 4GH3A 4LVHC 1XIJA 3TVMC 1P4UA 1UIPA 3R58A 5KEZA 4HDIA 2IDTA 2OLDA 3BZJA 3GK8H 3IEAA 1D2KA 3E2RA 2Z8VC 4WTZA 3LHAA 1MFBH 1E5BA 5I02A 2AOSA 3CTLA 4EN3B 3WQEA 1VYSX 1JCNA 3GVQA 1FVCA 2R14A 1C16A 1BKHA 4H01A 4LLMB 1LLZA 2PB1A 2JIWA 1NFDE 5IOPB 3O2LA 1U8OB 3PPSA 4FQQB 1YJDH 1ORSA 1XIIA 4GNVA 3TEVA 2F58H 4O1EA 3NRQA 2LLNA 1VFFA 2E68A 4U6XA 2BIIA 2KDYA 1BXCA 2AMUA 3FYEB 1KYOJ 3VXPB 1ECZA 4UTHA 2ABBA 1QNQA 1BKSA 4PB0L 4O54A 2INFA 5AAWA 3DTXB 3LXUX 1OO2A 3QFJA 4KXBA 1FP8A 5G4MA 1VEMA 3RZCA 3N4AA 1N68A 3XINA 5KSAB 1YE6A 3P0XA 5AW2B 3N15A 4TQTA 1F05A 4BF7A 1XLDA 3P2TA 3VXQB 2I9TB 2ARJB 2EE9A 2D0HA 2AI0L 2IXUA 3O2DL 3MCMA 3RGVD 2ZONA 4HCRH 4M3JA 1XH3A 2Y7DA 4GBXC 1C1EL 4TUKL 5IG7A 3RWFB 4CQDA 1JJUA 5SWSA 3VQMA 1UWSA 2A4ZA 1R86A 3BQ5A 3NFPB 4OF3A 3B7TA 3N04A 1P9MA 2PXYB 3AIEA 4IIBA 4GQ0A 1PB0A 4TNWK 2HVOA 2DSZA 1NSNL 1OF8A 3V4VA 3O9WD 4MMWA 2X1QA 1N2VA 1IC5L 1AGFB 1UZ8A 2VLKD 3KTXA 4XNYL 5TF1L 3W7JA 4ILSA 4FEIA 4KX7A 1R0MA 1N26A 1KCUL 1QSVA 1XSIA 4Z7AA 5I5MA 5HHMD 4RX4D 4AISA 4LCCA 2ZYIA 1RQHA 4YHIB 2ZOUA 4Q2ZB 2UY6B 3NJLA 3P1VA 2VDPH 3QUMB 1UCTA 1WB0A 5HYEA 3ZKSD 2NW0A 2AQOA 3LGDA 2EYRA 4FQ1L 3I10A 2P47B 2QQQA 1HHKA 4KNSA 4RNRA 4JGUA 1QNOA 4XZBA 4YVPA 1TT6A 4Z7WA 4KI5C 2YJLA 1IAIM 2X2GA 1X5GA 2OYPA 3X3FH 1XL6A 1G67A 1IRAY 4L8CB 2WKGA 4F3HA 3CVDA 4D8PA 1UR0A 4WR3A 5C0CD 4GAJL 3T04D 3D3FA 3KGTA 3ULSA 5CIPH 1NC4D 3LXBA 4IGMA 2QR6A 3BLPX 4GRWF 1MZYA 3FOKA 1KT2A 1UA6L 1OAUL 4UDTB 1E9LA 4P5TA 1EMTL 1T4WA 4NO0B 2Y06H 3GR8A 3VAVA 3LHPL 2Z1XA 4HUKB 1OM9A 2V63A 2WJ5A 1O60A 2KLTA 1FUNA 2DWYA 3R0UA 2X0HA 5EEUA 1XH0A 3AM8C 3FCSB 4PLKD 1F2JA 2OMWA 4ZUTA 4U1NA 1PD6A 3M9YA 2NY2C 1MLCB 6CGTA 2VDMB 1YPZA 4RGND 4B9PA 1TZZA 4F2TA 4RFEB 1MCHA 1VJSA 2ZZ3A 5I3IA 5J6SA 4FAAB 3ARTA 3MMEB 3B56A 1H11A 1MHCA 4QITA 1VGAA 4P2YA 4YXLL 3EF7A 4RETB 3PY9A 4F9LC 3WY3A 4P7QA 2B1AH 2ZCHL 5DQJB 3W07A 3KJ4B 3U7WL 3W57A 1J8HD 4MG4A 2V2WB 3U5UA 5FKYA 2W1NA 1YEKH 4PWFA 2VX4A 1CBVH 5H2BA 1UBPC 1TWWA 1Q6CA 4P3WA 1EPFA 3GLZA 2WXNA 2Y8VA 3H2NA 3OSKA 4HISA 3L66A 2E8YA 2GK2A 4JFZL 4HNTA 2YEZB 4Q8PA 1A4JB 4A55A 2G4JA 3TTOA 1AYRA 4PRHA 1KFKA 4GRLD 4OZFB 1M6OA 4N8PA 3MYJB 1F8TL 4OLZL 2RMNA 3A6OA 4I8DA 2ZA2A 2BDNL 1NBZA 4RWYL 4J3OD 4OCNC 5C97A 3WOVA 3QTPA 4G2DA 3AYVA 5EZOL 2C15A 4X7TB 4KITB 1MWAB 1L6WA 3W7HA 3QQDB 4MAYB 5LIWX 3TN3A 1S9VB 4Z42C 2P5WD 4LRTA 5DCEA 4W8AA 3D08A 3SGDH 1JHLL 1U8CA 4ZD3L 3QDAA 3L3GB 4QXUH 2WPGA 3W3OA 3QE5A 3D07A 5FYJD 4N0FA 3DOHA 2GJ6E 1ACCA 3EJPA 5LA1A 2ZP0T 1WDDA 2OZ8A 1GK8A 1FYTA 1JYVA 3P60A 1KC5H 2EYSB 4MRBA 4HZ1A 2D2JA 2IAMB 3GS6A 3T0EE 5EDSA 4JY6A 2UZYA 3SYAA 1YVLA 5CBEA 4WHTB 1ZHBB 3RCNA 5F21B 3DIVA 3A5VA 3IEBA 4X9HA 3SQMA 3TCLB 3IAPA 5HVFB 4ZG1A 4MYAA 4NC1E 3BWSA 3KR3H 4U1IB 1LYXA 2Q9OA 3K80A 1VHCA 1AQ0A 4ZO9A 1CICA 3UC0H 4MQXD 1JZ5A 4YL9A 4NIYE 5HPMA 3QDMA 4LB3A 2YR1A 4MS6A 2CRMA 3ARDA 1R3KA 3O4OC 3SY0B 4IDJH 4NO2A 4HVXA 1PG7L 1CDBA 3ISRA 5EO9B 1TREA 4HXAL 4PGCB 2KL6A 3LN5B 1G7JA 2Y25A 5A8GA 3PWVB 4CNIB 4BE6A 3TIEA 1M2VA 3M0YA 2WZ0A 1AUSL 1UOLA 1R5WB 3EOBB 4M1BA 5DF0A 4G9DB 1H6EA 3SSZA 4OD3H 4IIEA 1M1SA 2VQUA 4IJTA 4TLSA 5G1YA 3KHQA 4CQ9A 1T6WA 5HHOD 1RU9H 5DGRA 2DY3A 1VGKB 4GZJA 1UWTA 3S1GA 1UOZA 3O06A 1U5HA 2ZSWA 5LNVA 1ADQA 4DZAA 4BRVA 5IM7A 3SBWC 1OZMA 4H8UA 3LKOB 2F8OA 3CC1A 5D70H 2BVOA 4K3GA 3ZIZA 2ZFAA 4FPSA 2WXLA 2XA3A 5LNWA 3ECVA 4EANA 2AQQA 4UM8B 3FO9B 3IN2A 3A4EA 2EUZA 1R9FA 2YN3A 3AMKA 4LSTH 2WQSA 2EGZA 4MZYA 5A6MA 3NG5A 3W1QA 2Y1ZA 4OECA 4YHMH 3LZ5A 4DBEA 3SKJH 4J8RA 3MV7D 1KXHA 4R90L 3P74A 4PUWA 3SPVA 3AU1B 4E41D 4XBMA 2PDXA 2C9QA 1CB4A 1V6XA 3V4VH 3NK3A 3MHGA 2UZ9A 1QUNB 5CPQA 4W70A 1RAMA 2AKRB 3NZGA 1FG2B 2PZNA 5D2YA 3B2MA 2EDKA 2QV5A 1Z32X 1TPVA 3LN9A 5FW8A 4NQQA 5AOKA 4PJCB 5DRWA 3SCTA 2WXFA 5GRZA 1UMYA 3UD6A 5DD0H 3AS3A 5BMFH 4A7SA 1B0GB 5HJDA 1ZB5A 1QWNA 3BQUD 3TYGL 4YDKL 1B54A 4IP5A 2PF8A 1ME9A 4DLMA 3TF7C 4GXUN 2EP6A 4Z0SA 4Z7IA 3W75A 4GJJA 4GG6E 2BHFA 5TJWK 1GTNA 2ARJQ 4FI8A 3MCKB 1I3RA 3CVHL 4M7LH 1GPFA 2XGZA 2V2HA 3G6JE 4JFEE 1K8DA 2CKBB 4AQ8C 2BNQD 5AL0A 4UINL 3OZKA 4FQIL 3L1OL 3WLRA 4XBJA 4R4FL 1XH1A 1WS8A 2NYZA 2GABA 5CPTA 3X3GL 1MCDA 4H00A 4PR5A 2E6JA 1KJ3L 3CFEB 1X5JA 3BSHA 4OFKA 3GBLA 2PLMA 1MLBB 1ZLPA 1BYDA 1HN1A 3QPXH 1W1YA 1OW0A 3NVTA 3ECWA 2WZTA 4KU1A 1QR7A 5E2UL 2G5UA 5I00A 3CHPA 4KVCL 1E9IA 1E4HA 1PU0A 4J1UA 5BQ7A 2OV0A 1E9PB 2V17H 2I5YL 3JTSA 4I9WD 3S3PA 3FO1B 1MEXH 5HYSA 4NRZA 4X5XB 2R2BB 5IESL 5BXFB 4WWOA 1GH7A 2J1ZA 2PP3A 3SDXE 2IMNA 2CLVB 2GIYA 5B39B 4MA8L 5ACMA 1SUHA 3NN8A 3PAVA 4H9YA 4AIZA 1ISWA 3GG7A 4DZIA 1JPTL 2D7QA 4UNKA 2ED8A 2A6JA 2E9WA 3KXFE 5EN3A 2AZAA 3TF4A 5E5RB 5TDPB 1Q72H 1FFOA 4MNQD 4KJPD 3RA7L 4PI2A 3JWDH 2KDGA 4WO4B 4O5LL 4XQ6A 4DKEH 3ATDA 5G4WA 1C08A 4PWGA 3RVWD 2OKOA 2XN0A 4BQ6A 4QRPE 4X4ZA 2OB3A 4W6XB 1TITA 4FNQA 4JGMA 1LWIA 3VXNB 3ZBMA 4XVJL 5C8JA 1WHPA 5CILH 3RPDA 1CGSH 1OAJA 3UG4A 3USZA 3GMPB 5DLMH 3DRQB 1E43A 4C6OA 2DPEA 5MENA 5EU7E 3VM5A 4IRJA 1YMMA 3AS0A 1IGTB 5BMXA 4LLVB 1DFBH 1HXYA 4QJ1A 3NSDA 2KC0A 3O81A 4HNOA 2OJZH 5AL8A 3NL3A 2H6UA 1I7RA 3TV3H 2ABAA 1JPIA 4PLKC 4X4YB 4FLHA 3WF1A 3OKOB 4OGXH 3EBVA 5HY9A 4RGNC 3B6SA 3MREA 1V6WA 5DHYA 4QRQB 1KV5A 2IS7A 1NBVL 2H1LM 4DH2A 2ESVD 2OMTA 2X0VA 1DQJB 4G71B 1ZT7A 1XF5A 1DDHA 4UB0L 4ZAKB 4R2GB 1AA1B 2J6VA 3V0EA 1L2QA 1YEJH 1AH0A 3BLKA 5G4HC 4LCWB 5HPOA 5DEGA 4TQPA 1BQRA 4MNHA 4M0XA 3HR5B 2CM6A 3QNYA 1LMKA 4YUEH 5IFHL 1EAPA 2YD7A 5FHBL 3EX6A 2RJMA 1I9CB 1PFCA 1CQYA 3ROOB 3LS5L 1Q6QA 1ZLWH 3SYQA 1K4GA 3AFBA 3L16A 2FR4B 4L6HA 5CZJA 2REQB 2V5CA 3QUXA 3B9KA 5C0JA 3CXDL 4J3OC 1QFEA 3BG9A 4WK2B 1PLAA 4HBKA 1DQKA 5F44A 4ONVA 3AABA 1XKYA 1OARL 5CLWA 4HH8A 3D3VB 1CDYA 4DIAA 1UKSA 4LUJA 5AY7A 3MUXA 3L3JB 1FWSA 3PBUA 4ZNEE 1E3XA 4AK2A 4RZ6A 1CF8H 2WNKA 5KW9H 4L7ZA 1M01A 5F7FA 4HCDA 4WK0B 1GPWA 4YDVB 5I1KH 2FIKB 1HO1A 4HS3A 1G7LA 1BD2E 3VGDA 4Q8VA 4M5ZH 4UMAA 1G6RA 1RZJL 4DZBA 1A0QH 2X7LA 4QQUA 1VPYA 3GJEB 3T6QC 3IPFA 3LGGA 1ID5I 4Y4FA 2E1DA 3S5LG 4N9DA 4DX3A 3SBQA 4V1DA 1PNDA 3WLNA 4G70B 4YK4C 3FJLA 1IM3B 1EDTA 2AXHA 5HUPA 3B2PA 3LKNB 8CGTA 3G8RA 4FMFA 4PRIA 5T33L 1XLIA 3FU8A 1TIUA 4IGBA 4NAJA 3UZZA 4BE5A 3NPSC 3BJFA 4QISA 4GUOA 4PJAA 1PPIA 1F6AB 1ACXA 3EWXA 2OWCA 1AXSA 5D4YA 4RCXA 3SDDB 2HBVA 1EO7A 4MQXC 2XHNA 4Z7OE 2FWOA 4L23A 3VWJD 4L3FA 3EEZA 1L0XA 1HCVA 5IQNA 4M61B 5FM5M 3PJUA 2APXA 2QDGA 3C6LC 3OGOE 3KOFA 1Q9KA 3JTTB 2QMKA 3LRKA 5DMKA 3IDYB 4GP4B 4S2SA 4R4ND 2E1WA 5F3FA 5ANHA 7REQB 5RUBA 1RUAH 1LL6A 2VZ3A 4LF3A 1L9NA 4CMHB 5BYWA 4KETA 4BHYA 1TKWA 3BZ4B 2A7NA 5IVZA 2O5YH 6ENLA 1Q63A 2N56A 3ES6B 4JPWL 5HGAB 3NFUA 2F9BT 3DGGA 4L5ZA 1CENA 2HVNA 5F1IA 4TSBH 5AC4A 3BW2A 4LU5L 5IFPA 2JCCF 3G1SA 2DQIH 4QHNB 1N7ML 2VDOB 2YYUA 1JFXA 4O12A 2AK4A 1KN2H 2DLFL 2DSWA 1JYXA 4CADB 2OLSA 1SQ2N 4LSSL 1PL3A 4B9YA 1NDMA 5I17B 2CLOA 4DOHE 3OKDA 2QS8A 3VVWA 3ARFA 3ZW3A 3VIJA 5JMRA 4YZWA 3NQ6A 3SM0A 4ES4A 2J8UF 2Q8XA 3QUKB 3MZ2A 4YFLF 2VC2L 1WIPA 3U0PA 2PFHA 5GZNA 3IANA 2JJTC 2XJ7A 2CHWA 3V4PA 3LKRA 4MXQD 4JN2B 3P40A 2WZPA 3OC5A 4LEOA 2VMEA 4KWUA 3NR0A 4KKQA 3PGDB 4DPBX 3DZ1A 3SDOA 4HJJH 4L6DA 3HC0A 2BW4A 4GPNA 1AGDB 4A7QA 2EPMX 2RACA 1VFMA 2VCCA 4IKNA 4P23D 4ZS7H 2RGSA 1RUMH 1IL1B 2YBTA 2FD6H 1PTAA 5I1CH 2OQYA 1L0YA 1H5YA 2E7BA 4AG0A 3BWWA 1LDPH 2PYEA 5C2BH 2DQJH 1YQVL 3UAFA 3UIZA 2D3LA 4NYUA 1KKOA 3VD7A 3LERA 3WK1A 5IY5B 1OX4A 3NBNA 5EF2A 3JV4B 1O9WA 4LUYA 4BSWB 4OTXL 2CHOA 3EJQA 4LLQA 2K70A 4S1SH 3MRHA 3QRGH 3QQWA 3V0FA 5LKYA 3QZ6A 5TE6L 3CN2A 1POJA 1CXHA 1FH5H 2PDIA 4HZ6A 3RHWK 4YBLC 3MT1A 4M6AA 2VLRE 4MKTA 4KKXA 5DVLA 5C09B 3VILA 2ICEA 5JUEL 4Y2DD 3WBAA 2GSIA 4N0UA 1IGCH 15C8H 2VXQL 4X8GA 2EILB 4GYPA 1WYJA 2I26N 1KW1A 3AWFA 5H8UA 1G5GA 5AYXA 1TTCA 4KY1H 5FECB 3EOOA 3ILPA 1KQZA 5ABFB 1HSBB 1RURL 1W3LA 4HD9A 5K33A 2QR0B 3SKOB 1H09A 5BZAA 5J6GA 1V79A 2FZ3A 1U95B 2NY4B 4A37A 4AEEA 4HVBA 4RE4A 3KYKH 1VFAA 3MUZ1 2HXUA 3GXDA 4KJPC 5G4EA 2NXYD 4RZ4A 1RJYA 4CD6A 4NOBA 2CIIB 2QKIA 3QZEA 3BAYA 1QLRB 3IDGB 4F1ZA 1OIOA 4JFQA 4JRYD 3LZFL 1UMLA 2QULA 3OKMA 3PDOA 3RVWC 3WD4A 5D1QC 3HHMA 3RTQB 5DZNA 3RLHA 3EH2A 1RZKH 1N64H 1TLKA 5XIMA 1HKJA 3B8YA 4R7OA 1BF5A 2AXFA 4YHEA 1ZTXH 3P4LA 5C07D 5JQ9A 4DF2A 3RJQB 3QPZA 1QMLA 1QK0A 5DJXB 2EXOA 2PP7A 2GQ9A 3QXBA 4XPGL 4KKAD 3TSDA 2J7FA 4LDOB 1HOCA 1JZGA 3LV3B 4PJEA 1PE1A 2UYLA 3AREA 3BEVB 4BJLA 2PDMA 5KSUA 5KSVB 3FQRB 3WEXB 3SY8A 3LZPA 3D4GA 1I8MA 5K9DA 4YTRA 5CD5D 4LVDA 2IBZX 2NLJB 4G8FA 1R3SA 1D5BA 1KTKE 5ECJE 3OLEA 5J7CC 1BWVA 4C4KO 4Y9AA 1T1ZB 3ZJ7A 4N7QA 5AVUB 5HWMA 1KGCD 4QRAA 5B8CC 1BFOB 5A2LH 4DVOA 3RIFK 3KOYA 4WIQA 1P6FA 1TQBC 2BM3A 4JDYA 4DB7A 5AC7A 1MRCH 3OZ9L 2X4NA 4G56A 2B9BA 2V5KA 3T1FA 1Y1DA 3NEOA 4GKOA 4U7SA 3J27A 2ZOOA 3TP4A 1G9EA 1RVFH 2WY3B 5E8DH 4G83A 3WENA 2E56A 2EINB 1HHHB 3VIOA 4GSDH 4RISH 4GGBA 3NH7L 5CR8A 3TBWA 1YY8B 1AGEB 1G1CA 1RK1A 4U3SB 1B57A 1EDGA 1HIMH 1CE6A 4QF1B 3UETA 4JGDA 4R8WH 5I73B 4JDZA 2O6CA 4QOKE 1QQDB 1TFHA 1DN2A 4NEHB 5B38B 4IOSD 3K71B 3NABH 4BCEA 4YBQD 3JYBA 2I60H 1GJPA 2PPCA 4ZMXA 5TE7H 2Y1HA 3CVIH 2J8UB 2Y1YA 3LUTA 5GGRA 3C0JA 2JQAA 1S9YB 2TRHA 2IADB 1VBJA 3ASNB 4JL2A 3HQPA 1EC9A 3SY1A 1JULA 3L68A 3V0IA 5GS0H 2BOBB 4LVEA 3N9GL 5EUOA 1OFDA 1P4LB 4R85A 3TC7A 3KBSA 2XOTA 3VFTA 1PFOA 4DWSD 5AZEH 4HKXB 4HOWA 1EP1A 3T0BA 3Q3GA 3TBTA 3FC8A 2RGMA 1X5FA 2DZXA 3L65A 4WJ8A 4E9QA 2DSUA 3W02A 3VOFA 3TLRA 5HOSA 4XBPA 1S2UA 2H9GA 2WC3A 1THFD 4WSKA 3D0LB 4UFLA 3M5YA 4GYKA 1IU1A 1ZVSA 5C7HA 2ZCZA 4MVBD 3NWRA 2KBGA 4KV5F 1F11A 1KFWA 4GRWE 2Z6IA 4S1DC 2JKPA 3WH6A 3NL2A 2F53D 4RMBA 4BFNA 1PTDA 4EEEA 4OD1H 3GHEH 1OJXA 4LEQA 1IGJB 2WWMD 3SPHA 3IMTA 2O61A 2XRAH 2CLZB 4I7VA 2ZUWA 1AD0A 4IIQA 4Z7VA 5T8IA 4LKXA 5FKAA 4ZFOB 2P45B 4IISA 4JVUA 1I2NA 2WM0A 1KA9F 4ZMPA 3ETBF 3WDPP 3V4PH 4DM1A 3C60A 4FXFA 3QUYA 3MSDA 5FLVA 2EPOA 2LTQB 3FB7A 4KQ0A 5CEZL 4IU3A 1AKPA 4R4NC 4Y1AD 4M9PA 1XISA 5BV7L 2JGYA 3GSXA 4XO4A 5AVYB 5J11B 3UCQA 3DMMB 3IU3A 3QWOA 4KX9A 4US5A 4CDHA 2XN2A 1MHHB 4PM1A 3WUEA 2SEBB 1OTUD 3SCSA 2GI7A 5HYJE 3VWKB 1CR9H 4NO5A 3HG0A 2ICCA 4ZI8A 3HCVA 4WU5B 4KRTA 4US6A 1SOSA 3D39A 4LPYA 4QP0A 3T4AA 1KM2A 2O5ZH 1BG9A 1LP9B 4UNUA 4E2DA 3GO1H 4HG4J 1U6AL 2VWEC 5AHNA 2NXZB 4WFGD 5EPMA 3G6LA 1RY0A 1JCMP 4P06A 4DY1A 2OK0H 2OMYA 4M80A 5I09A 1TJIL 2ZUMA 3W7EA 2V68A 5AW5B 2QCDB 2CPUA 4A2MA 1DVSA 2L5HA 1PBYA 3O2DA 1SZEA 2W92A 1QSFA 2WJEA 1W0WA 5D5MA 3Q1EA 3PSWA 3KPQA 3LCGA 1A50A 1YRKA 3HQ1A 1SOQA 3SQSA 1NJ9A 4OLXH 5ADOL 3RPKA 4IRSA 3GC4A 2GTWB 3EG9B 1ILUA 4I18B 4WAFA 3QEHA 2PD5A 4ZXOA 2FLBT 1DIKA 1C9DA 1NQ6A 2XHYA 1W1B1 2CESA 3CX2A 1Y5VA 4N9GB 3OHIA 1ZA6A 4ZOCA 4QTHA 5INDB 4YAQA 5ENLA 3COOA 5EU6A 4HGMA 2DZPA 1EB3A 2LLEA 3MOBH 1CYGA 4WW2A 5C6WH 5JDSB 1MI5A 1QEWA 4P23C 3CFDB 2D03L 1A6PA 5LGJA 3ANUA 1P0BA 3MRKA 3MCLH 1CW2A 3ITVA 2CHDA 3IFPB 4J3SA 4M02A 2AXGA 5INCA 4A22A 4CVZA 3WFEL 5LAXB 3F7RA 1NEUA 4JY5H 5FFLA 2QZRA 4PRAB 4AQ1B 1BXBA 1G4MA 4J6IA 4JO1H 4P5KB 4KO5A 1LTDA 1BX2B 2ERJC 1AS6A 4I3SL 4P2QD 2DW6A 4RZCB 1EJVC 1OHLA 3L3KA 1QOQA 5CSSA 3L4TA 4QO1A 2TSBA 4DW2L 4YDJA 4ZXBA 3ORWA 3AZSA 2PI6A 5BVJA 3BOFA 1PZUB 3TYAA 1DLHB 1XMEB 4NQEA 2J7EA 1NIUA 5EB8A 4QKTA 4U2ZA 4KI5D 2X6MA 3W7OA 1WUFA 3MNWA 1M68A 3OBEA 1V5XA 3EMZA 4GC4A 4LCWE 1IV8A 3B7YA 1IQWL 1QR1B 1EEUA 3PNZA 2Z31C 4F9PC 1CXFA 4FR1A 5LXGL 2PEVA 4WRHA 3GDLA 4TQEH 4P04A 3IWVA 3LY0A 1LEGB 4E0RB 4N8CL 1UB6A 3CU7A 3T4CA 4X98B 3VTMA 5KJ4A 3KYNA 3P0YH 3P3SA 1A5NC 2YPVL 1A0EA 1OD7A 4XX1E 5C0BA 4NP9A 2ADYA 3RITA 1WKEA 1E4WH 4XMKH 3ZN6A 3DFNA 2Z27A 2PURA 5LCVL 5GGQL 4LGXA 5CWSB 2NY2D 3GC3A 4HHGA 3BTNA 3P0GB 4ZMLA 3B03A 1E0XA 1E6JL 2INZA 1IXOA 4J3OG 4G43A 4ANXA 2X4RA 5IW6B 3NCMA 1MXDA 3ARGC 5IXEA 2EO7A 4KKCC 4JN1L 3WTWA 2YK1H 4F2UA 1M9WA 4YH6A 3NQ2A 3HLAB 4Q6JA 2N1TE 4IHOB 1XQLA 1RXOB 1ELSA 1TJRA 2FJUB 1A5MC 1SBSH 2GAZA 5E03A 3WO8A 4KKAC 4F9DA 4IFKA 2BNUB 3TFBA 2Q6ZA 3PWJB 1E4KC 1QI3A 2PDQA 2B1HH 5I5IA 4P48A 1PGRB 1EBPA 4J7RA 3OX8A 4EUPA 5HNRA 4XP6H 2KUTA 3NZHL 2R1YB 3I02A 3I7QA 3NNTA 2YSWA 4KFNA 4C6CA 4G42A 2W91A 2JBMA 5CD5C 1WWBX 4A2EA 1G0CA 4W84A 3GM8A 4GSUA 1S46A 4C56D 4K8EA 3U4FA 4ICNA 2A9ML 4OF6A 1ZS8B 2ZZ7A 2CUMA 3VNJA 2J20A 3WN5B 4XVSL 2J12B 5KVGL 4A1RA 4UCFA 4QE1A 5EOTB 5T3ZH 5I76A 1SFLA 4PRBB 3V0TA 2VDKB 2VE6B 4H9TA 4X6CE 5DYOA 4Q4IA 4YDIH 3GI9H 1E15A 7PTDA 3L4WA 5TTRA 3ZGHA 5GZOA 3V0DA 4GLRI 3ZVHB 2PW1B 4Q8UA 2Y69B 3HE7B 4UTBL 5B1JC 3Q8EA 3ZK0A 4ZO7A 5DDHB 1DVXA 3NA4A 5CF3A 1NEPA 2VENA 5F7NC 1HHIB 5I1AB 2OTDA 3MLXL 4XPAL 2BMBA 4AIBA 1F02I 4OD2B 2K9FB 5JW3H 3FN9A 5EUKB 3ZYIA 1QATA 1T6VN 1ZE3C 5I74C 2WBJB 1JK9B 1L5GA 5JHMA 4XXWA 4CD5A 4JVPA 4K2UL 1YN7B 2QUNA 3O8XC 2R94A 4MFDA 4L3EA 4GAAA 5C7XL 3LRMA 4AW4A 3PFMA 4TO8A 3IVTA 4XGZA 3IF1B 2GSMB 4LIQE 3QHFL 2J78A 4N22A 4W6YB 1J05B 4ZTYA 5G4NA 4DWSC 4PB0H 4PD4K 3HZYB 2JKEA 2C9XA 1MCKA 2HE8A 5I9QB 2D1ZA 4U1LB 3RDTB 5GS1B 2VDLB 4N2NA 4HPXA 4Q6IC 4CQAA 2DGAA 3CASA 3VM7A 4JNYA 5T26A 3W28A 2IC2A 1G7PA 2JJSA 3SJNA 2AI0H 3VVVA 3WNLA 1JDAA 3O2DH 5JHDB 2XN9A 3EHBD 2NRDA 1XGUB 1H63A 4TUKH 4HNUA 1IZKA 1COBA 3BL3A 1ESOA 2FO4A 2QCCA 4JTGA 2R51A 2O9RA 1G6CA 4P59L 4G1EA 2Q2EB 4RVBA 2CDFA 4GFXA 2WB5A 4H8NA 5HVWA 2C3VB 3H42L 4L9XA 3U4EA 1NSNH 1K9TA 3BISA 1IC5H 1GY2A 4TTGA 4XNYH 3INOA 3KDOA 5TF1H 4RQQA 4QXIA 1OTUC 2FVNA 4I85A 3NQEA 3N91A 3PIQA 4D6JA 3WK3A 1FZMB 1KCUH 3QZOA 1VCGA 1HCZA 1TX0A 4I4WA 5DC2A 3BO8B 4AOFA 1WGOA 1UB5A 2F15A 3GSMA 1NTHA 4FNSA 3O45B 1JTOA 3O6KL 3UZWA 2F8IA 1JK8B 1Q6OA 3FZUC 3TEZA 3TC3A 4FQ1H 3EYQC 3RM9A 1UTDA 1LQSR 1XWVA 1TQXA 4HYTB 1ZSDB 3P30L 1IVLA 1EHAA 1WNOA 1XC6A 4PJ7B 1EHNA 3CVHA 2E59A 5FGRA 1ZTMA 4KGJA 1E8ZA 2YPKB 5LXEA 2IGLA 4FX6M 1EA0A 3ABQA 5F3HB 2PR9A 4YLQT 4QRSB 1VFSA 4GAJH 3VUSA 4PBDA 3P2VA 3VJ6A 4G1KA 4LLUB 5IQ9B 4F0HA 1ONWA 3T77A 1TTFA 4ERIA 1OWRM 5MHSD 2G2NA 3HC3L 1UA6H 1OAUH 3UQNA 2DMKA 2WW5A 1EMTH 4YC2B 4Y16B 2ZYSA 3LHPH 4K71C 4MWAD 2CU9A 3HPXA 4JFSA 5HVHB 4F2BA 2VR5A 4C7DA 4ODHL 3CK5A 1UWUA 1A4KB 1B88A 4RAVA 2IAAC 5JR1L 1KEGL 3DVFA 1W3TA 4YXLH 4ZO8A 1I1AC 2ZA1A 4X9GA 3R8BB 1YEDA 5LDUA 2ZCHH 5AB2A 5LYRA 3U7WH 4CMMB 3P3YA 1XW8A 3EJYD 3RDKA 4R7JA 1F8MA 3C09B 4D0BA 2NX5D 1FFPB 3FF7A 5CC6A 4QAMB 3UACA 4JFZH 4IMKC 2Z1KA 4FHJA 4POUB 3I75B 1JV2B 1K6WA 2Z7KA 2Z1BA 3ZQXA 1CLOL 2JIXD 2C34A 2BNJA 2W27A 3AO0A 3DPBB 3MMUA 1F8TH 2XYBA 3M5XA 4OLZH 1FWRA 3QORB 4LOVA 4IWWA 1C5BL 5DXWA 2BDNH 5I0ZA 3TN4A 4RWYH 3AHTA 1S5HB 4UDUB 2NWSA 1E71M 4S1QL 5CSRA 3ONBA 5IMKA 1QLFA 3WQPA 1LEKB 2HCVA 5GSVA 3H22A 1R1CA 4EUPH 5FJRA 3U2SB 2R29A 4XMWA 4AYID 3OO2A 5EZOH 2ALDA 4N02A 3OHMB 3DX3A 3EO1A 3APMA 3V4LA 3D06A 2JCCE 3US1A 1PEZA 1HKKA 2ENQA 1XBYA 5GRUL 3H3BC 5ITFA 2WXIA 3OPZL 4RE2A 1ZLDA 3JUYA 2DWEB 4PWEA 4AD3A 4PJCF 2CGYA 3ULUD 4KZDL 3K30A 3CFCL 1J0KA 1JHLH 4ZD3H 1WA1X 4MHHI 2EJ1A 3X1NA 1XLJA 4FLSA 2Q01A 3VI4B 1LQAA 2VN6A 4G9FE 4IBUA 3UCRA 4YFEA 4NU7A 3S6TA 4PMNA 4LUIA 2J8UE 5U7SA 4YZFE 3TJXA 3PWPD 1VYPX 2YCKX 2V30A 3GEWB 3N40P 5FOBB 3ZU8A 4JNZA 4GB9A 3S37L 3UTSD 2VLJA 2JB6B 1J79A 2BOCA 4AITA 4GKSA 5EMUA 4G5ZL 3E1F1 1NM4A 3NA9L 4HWZA 1NARA 4LVFA 1UR1A 4XWOD 3WNOA 5CZVL 2TSYA 3B0UX 1USZA 4XRCA 4JY8A 3DURB 3A6BL 2G0WA 2OQHA 3VFNA 1FCCA 2LW3A 2YS4A 2ZXBA 3RKDC 3T0DA 4YGAB 1EEZB 1DJIA 1I9IL 2BS71 3DG3A 1IBHA 1PG7H 1O7AA 3LXCA 1R5IB 3IDMB 3NURA 1WCBA 3RO8A 4HXAH 3BFWA 2PRLA 2HJFB 3RY4A 1VADA 3ULVF 5F7DA 3IJ9A 1XR8A 1MQPA 5TAOA 4JQXC 5A6BA 2Y6TE 5J0BA 3IDIB 1HCYA 1E4NA 1CGVA 1NOAA 4WOZA 1XXFC 4M6NL 4B2DA 2FJHA 3NPUA 3ILEA 3S97C 4B5EA 5D9NA 4QRNA 3PC0A 2VQ1B 2BVQA 2ZUVA 3H2AA 4GUGA 1N19A 4NG3A 1I8LA 4FTVB 4Y9BA 1DQTA 1TYEB 5F8RC 4HA3A 1TNNA 3O7UA 3CH9A 2ROXA 5KSBA 4PGEB 5KBLA 3TBBA 4XUYA 1DWJM 3BPOB 3K2KA 1A6WL 5MERB 4HCHA 1P4IL 3IGAA 2K1MA 4L1DA 1NIFA 1O5RA 4ROQA 1QSEA 4S3KA 4M5YL 1KFAL 4ZDHA 4NRRA 4ZB2A 3E6FB 4NXKA 3DXAA 1XF2A 3C5ZB 2FQGA 4WW1A 4OM0L 4XAZA 3F6JA 2QQLL 2YA2A 1FBAA 3FMGL 4G1MB 4R90H 3HFML 5DMYA 1LK3L 3V0GA 5L2KB 3WLQA 5CSZA 2Y5SA 3QZMA 3L21A 4GS7B 3GDTA 2QQKL 4Y5YB 3AIVA 3ZTNL 3SBPA 3T8QA 5FJJA 1RQ5A 1R87A 3MBWB 1UGNA 4KDTC 3GINA 3LI0A 4JRWA 2JB5L 4AZ8B 4D1IA 4W9TA 4L8BA 6TAAA 4OUIA 3TLQA 1YJDC 4RGMC 1XUZA 2X4UA 3C6LD 4V11A 4MMZA 4PYGA 2MPVA 3ARYA 2W0FB 4DT2A 3TYGH 3BOXA 4YDKH 5DUBB 3ZLHA 3B0YA 5DSCA 2I27N 2HVJB 1V05A 1PAMA 4PJDA 2PP8A 2J8GA 2R2EA 4KRNA 2LABA 3DBPA 4F24A 1O6TA 2VKXA 5C0GB 3G3LA 3HNTL 3CVHH 2X1WL 4JHUA 2ZZ6A 4GQ9L 1DANT 2YGYA 3EHBC 2XIMA 4JPKL 4UINH 2C1GA 2DDXA 1DWIM 4FQIH 1B4JL 5GS3A 1ZIAA 2VM8A 3L1OH 3CHEA 2CDGA 2YAPA 4R4FH 2HRPL 5DX7A 4BFGA 4ACZB 4H0HB 4FX5A 2P8LA 1AIFA 4NB7A 3X3GH 3QO1A 3G5YB 1RIUL 1QHQA 2Z35A 3VXSA 1KJ3H 4HIPA 3PZNA 1VIZA 3SPGA 1I1YB 4NPKA 2BX5A 1S8DA 4H41A 4ATWA 1GNXA 1JCJA 3IGUA 3BCJA 4MMXB 3CH0A 2OQJB 4DI9A 1W3HA 1DO6A 3OP2A 3PNRB 4KXDA 3H2MA 4PJFA 4HGXA 1JRBA 4ZPTA 4CNTA 2GEEA 5E2UH 2IH8A 3C5JB 4AENA 4KVCH 3V6BR 1LG2A 4ZTXA 4BHUI 4Y8DC 4GIAA 3U9PL 2OKTA 2I5YH 1IE7C 3PZOA 3WQ4A 4IDLA 5DZ9A 2PBGA 5IESH 2OMZB 3SE4C 4N2DA 3B8SA 4U1MB 2WVUA 4AV0A 4AYBA 4JQ4A 1QRNA 4GT0A 3E2QA 4MA8H 3AACA 1JPTH 4YL2A 2CRZA 2DT3A 1UADC 1XIWD 4E2VA 2UY7B 3QQ1A 3F5LA 3TSMA 1MQQA 5HATA 4U28A 3WTUA 3TCTA 1NIDA 3RA7H 2BB0A 4NIKB 5HGBA 2ALRA 5K9KB 4NYLA 2CEQA 2QJNA 1ULVA 2CLRB 1JXDA 2E7LA 4O5LH 2J6WA 3CLEL 3MI3A 1NCGA 4MWFA 3IIPA 1KFEA 4X99A 3IJDA 5BJTB 2P44B 1U8PB 4H6RA 1U8QA 4NERA 2PWGA 3LM3A 2APTA 3DARA 4XVJH 3Q9PA 1S7TB 4PGDA 4NKIL 5A6IA 2EKCA 1GZHC 3PAZA 1SXSA 2VXQA 4R7XA 2PLCA 4ZPVB 3WU1A 4Y4KB 1U3NA 4MWAC 3HG1D 5AYYA 5AC5A 4WFHE 4OI8A 3GG1A 4KV5E 2N01B 2YO3A 4WI5A 3IXAB 2MOQA 2GSGB 3V95A 1RVKA 2DQGL 2DYRB 2R0KL 3ATFA 1P84K 3TN0A 1AO7A 1QO3A 1K5NB 1NBVH 1AYOA 3TZVB 4U6VL 4Z2JA 3IGHX 4UB0H 2ZKHL 2VUYA 1I85C 2I25N 4ZMYA 4G7EA 3H2FA 3EJYC 1S9XA 3CPLA 3NCJL 2WQXA 2CBQA 4ISVA 1BWKA 4AQZA 3OZYA 1PZAA 3EYVB 4NENB 3UTPE 4N24A 1RSFA 3EOUA 3WLBB 2FX8L 1PWLA 5IFHH 4XAGA 5FHBH 4U33A 4WDUA 5AVRB 3HRZB 4LGRB 1J01A 3LS5H 4LBEA 1W9BM 2ED7A 4MPKA 3UYCA 1QRKA 3ULAB 4JPIA 3OWRA 3ARBA 2DZSA 3NIDB 4PBGA 3O3BA 4IM8A 5HDRA 3CXDH 1WS7A 5D1QD 1W8OA 3RNKA 2AVGA 4JVWA 1OARH 5JW5B 4DJED 4G80A 3NDZE 2BS9A 2YA0A 1YDPA 1YUHA 1Q8MA 3IMBA 1TQCC 4JY4A 4M8RA 2MKLC 2VH5H 5CM1A 3QNZA 1WWAX 1T20A 3VFCA 2BFGA 3T5WA 4LASL 3WJLA 4DVBB 2YSSA 2RH0A 4GAFB 5IW1B 4TUOB 3SRFA 2O9TA 3S1XA 1Q0YL 3QH3A 3CAKA 3ULUC 2Y7MA 2R29L 5AVTB 1DEEA 1MRFL 2QJGA 3UNTA 3B4NA 1RZJH 3STLA 1CNVA 1FDLL 3QEQD 1GXEA 4MKSA 4BH8A 4JTHA 3I4EA 2WLLA 4IMLA 2WZ6A 5ACZB 1EC7A 3CWNA 2B5IB 1MW3A 5FCZA 1O4UA 4JG5A 4GUQA 1AZNA 2H1PL 2AJUL 3FHEA 3APGA 3ZTCC 4QLWA 1IMHC 2P24A 5T33H 2X4OB 6PTDA 3T6ZA 2G30A 3P2BA 4HIEA 1AC6A 4XWOC 5ISZB 2GQHA 4LYPA 1BF8A 2DS4A 4EF8A 3SJVE 2NMSA 3P77B 3KP1A 1XS2A 1AZVA 2P48B 3BGMA 6TIMA 2UXGA 3K6NA 4JIRA 1GRWA 1A3RL 4XO7A 4AGLA 3W22A 1IEWA 2WOQA 5LUMA 3DERA 1TJXA 1X96A 1EWHA 3G1XA 2Z0UA 1NGYA 1OPGL 5E4OA 1VH7A 3M8OL 3VCNA 1XR2A 4HPHA 1P1XA 3D0CA 1A4BA 5JHDE 3URAA 1KJ2B 1R3JA 3MRNB 3C5SB 4HX1B 3UIYA 3G9VA 4HKJA 3VFVB 4OGQC 4P99A 3CV2A 2C3HA 3NRPA 3QDJA 3AAZA 4JPWH 3WFHB 1SJEB 3BAIA 1NMAH 4JIIX 1MG2C 4WX2A 4TVPD 1WFOA 4HHHA 3PL6A 8TIMA 1E72M 3UP8A 5AAWC 1YLBB 4LU5H 3IACA 4NNXA 5LXVA 1NWRA 1C5CL 3F5WA 5BWAA 1TCDA 1N7MH 3NPXA 3FB8B 2DLFH 4G8GA 5C0AB 4W6WB 3HS9A 1UD5A 2VGFA 4DCQB 4LSSH 4X0NA 4MDOA 5I75C 1DUYB 1R19A 2CR6A 3ECQA 1J12A 5DMNA 1ADQH 2DZUA 4IM4A 3F84A 4MB4A 4W7WA 3FFCD 2UXVA 3BUDA 3H6AA 1WFIA 4X8JA 2Y63A 4BWWA 5F7WC 4JX5A 2PCPA 4S1DD 2VMDA 1IFRA 3EPOA 3SIKA 3WIFB 1ITCA 2VC2H 3KS6A 4FQLL 5BUPA 4GI9A 4DN4L 5ERWB 5FUOL 4IEFB 1WBYB 1OFBA 2FL5A 1GQNA 3HI1B 1SUJA 3FH5A 4PJ5D 5BVPL 1WAAF 2W9MA 4NN6B 3EDDA 5F7EL 4R96A 3FRPB 1UWRA 5FIPA 1VENA 1U30A 2IANA 4IX2A 4N42A 1OT4A 1B3WA 1VPQA 1T5KA 3VRLF 1M04A 7ODCA 4Y19D 4NP4L 4UTCA 2VNCA 2CCVA 1MQRA 4LHQB 1NIBA 1XIBA 1VZWA 5AAPA 4F5CE 1W3NA 5ABTA 2CR0A 2NY6B 2IWGA 5EN2A 4HWEL 2DYPB 3BVTA 3DBXA 2ZVIA 1TV7A 5EO1B 2DF3A 1PY9A 4HWUA 4OVVA 4S3DA 4FB7A 2FUTA 3NSNA 5E6ID 1YQVH 2B8OT 1DJXA 4NOFA 4JLRB 3GMLA 1R2SA 4EF3A 3NGJA 1XRSA 3ONCA 2JI3A 4PMRA 3P62A 4OTXH 3PV6B 2H90A 3L54A 1CFQA 3MV11 4O0KA 3EWCA 2OZ0A 3CH1B 3M7SA 1RJZA 5D37A 4HOZA 5TE6H 2J66A 2GSEA 3UGUA 3TYEA 4MA3B 1EFXA 3CFNA 1N0LB 2D7OA 2H3XC 1SFHA 1KGJA 3EH5B 4JRLA 5HXMA 5JUEH 5IHRA 4H1LG 2VXQH 5F6HJ 1QNRA 2HRGA 2QLVB 2CCWA 3EYOA 2WBWB 4LP5A 2WXGA 2XH0A 5BU6A 4KTEL 1N8IA 3MLTB 3K91A 3R12A 2R0ZL 1W80A 2H0JA 2VN3A 3R0NA 3HGRA 1BGAA 1U9KA 1RURH 3TEYA 2OJEA 3MRBB 3DV4B 1T21B 3K4AA 3TO4B 4A8IA 1NF7A 5JPNA 4MGXA 3FL7A 2AQ1A 1OP9A 3DVGB 2Z93B 1Y6NR 1XIWC 4GLRH 4Z95L 4F7TA 4Y5VB 3US9A 4JDVB 1JPFA 3E02A 1W54A 3OKEB 2IALB 3GMRA 4APXB 4OUEA 2AEWA 4HJEA 1K8IB 2Z2AA 1NCOA 3CUPA 4S3EA 3L5HA 1KYUA 4YGVA 5L4JA 2WSPA 1XGPA 4A05A 3LZFH 3C75A 2ZYFA 1KB9J 2Y7LA 3JWDC 5I8EA 3VFOA 1NUDA 3IE9A 3RUGF 1O6VA 3OEXA 4JFOA 2A3AA 5A94A 4M7ZC 2N0KA 3F58L 4YVUA 1UUQA 2ZCGA 3JXAA 3QCUL 2VR7A 4XPGH 3I6GB 4BFBD 5SX4I 3OZOA 4QHUB 1S5NA 3M1BA 1K4DA 3HAEA 3WEOA 4BK5A 4ZS6C 4DTGL 3RGVB 1OP3K 5EBAA 1SOXA 3A9BA 3N9KA 4IBTA 1TMCB 4KROB 1KFLA 5HMFA 1OAYL 5I8KL 4RA0C 3GHSA 1JWMB 4N90E 2R8WA 1LT7A 4YHNA 3KE0A 2F68X 2A6DA 1LMIA 2P49B 4C6IA 5HR6A 1F5WA 3NPZB 3MPGA 4EIZC 2L7JA 2D2GA 5F2MA 2V7HB 2HE5A 2Z31D 2CO7A 3FQUA 3KTCA 2YPVA 3BXWA 3MYZA 1UXMA 1QPRA 4P46C 1E27A 5LCVA 4FG6C 3RVUC 2J4WL 3OZ9H 4NAFB 2N7AA 3WI9A 3AZRA 3R8HA 2HX8A 3TN6A 1JGIA 4PV8B 1LP9F 4XNQB 4WV1B 4GHRA 3K3QA 3NOEA 5HHMB 4JIHA 3RX3A 4PFMA 4L9LB 4K8HA 3G1DA 1Y0EA 1NOUA 1R85A 4YHZL 3CK0L 3MV8B 4EIGB 3UAEA 3NH7H 3HBZA 4RMUA 1ZY9A 2ICWJ 4PHZA 4MA1B 2EKJA 1YNTB 1VJIA 3Q1SL 1W0VB 1J8RA 1XCXA 5IFTA 3APNA 1NJJA 3B83A 4HK3J 4PP2A 4A63A 1XCWA 3NL6A 3HF3A 3ARGD 4HK7A 4DJEC 3QO0A 4MFEA 4KKCD 3BIKB 2PUZA 1GYUA 2WOYA 1G1OA 3NAAL 4JX0A 5ICYA 3IRDA 5TDOA 4KCWA 5E8EB 5AVQB 5E1IA 2WXQA 4AZCB 1H8SA 25C8L 4RDZA 3CZFB 1CYWA 3BZEB 5IHHA 1XBXA 2IUZA 3N9GH 8RUCA 4F8NA 4GK8A 5HHNA 5EU3B 4DEWA 4JTSA 4UAOB 5I6NA 4XVOA 1A80A 4BZYA 4N28A 1IJ9A 3QI9A 5CBAA 3W81A 2XQ0A 3UFIA 3QHMA 3GSQA 4K5LA 1OINA 4Z7UA 3WY1A 1KO0A 3FCTA 4Z2HA 5KZEA 1G6RH 1MZZA 1OAQL 2X4SA 5CC5A 4S0HA 4UTBA 3L6FB 4HPGA 3X14A 2Z0IA 3K6SA 3TIDA 1EH9A 1D9KA 1LWJA 5EL1A 3KG5A 4LYQA 4EOWL 3U4BL 3I7SA 3D47A 1U2HA 1Q9WA 4A3RA 4GSRA 2GI0A 3LQZB 5D02A 2FQDA 1RCXB 2WMHA 3PUOA 4GZ7A 1HH9A 5KN5B 1NOFA 3K5SA 4PHXA 1KMGA 3QZBA 1N4XL 1UC4A 3QMTA 3D3AA 3GBML 5KS9A 3MUGB 1QVBA 3TEXA 4J4KA 4FL4C 5CEZH 3NJJA 4GT7A 4QS5A 1GTHA 5BV7H 2P8MA 4RRPA 4LUTB 5DZOA 3TNMB 3CFUA 1RK5A 4M3KB 3N1AA 2J43A 5BZWB 2ILLA 3DFPA 4B9ZA 1IT8A 3KPRB 1KCLA 4FADA 1Z3RA 3HI5L 3WBXA 2ZRUA 3OGCA 3FO2B 3O8XD 4Y5XB 3UJTL 1MCPL 4KQ3L 3D18A 1PCSA 3PAOA 1BWMA 3OQ3B 3F1QA 2WXOA 4WKZA 1U6AH 1JFHA 4N2MA 1V3MA 4LF2A 1KIPA 4TTUA 1TJIH 4KXZI 1AE6L 4HKZB 2OX1A 5T8GA 3C56A 1MFUA 5C0NC 4YSOA 3CZGA 3NGFA 1PTZA 4KO6A 4N2YA 2GYIA 3H3PL 2LR4A 1JCYA 4NRYA 3PHSA 5ADOH 2OMBA 5EZPA 1G7VA 4YLCA 4GVHA 3NTCL 3QK0A 4LP8A 2CLPA 4PJCE 2X44D 3RUGB 2GFTA 4XBEL 3DBNA 1AR2A 5B7ZA 2GK0A 4MSSA 1DJZA 2OCZA 2D24A 1XT5A 3A3YB 1B3ZA 1YBQA 3W39A 1WSST 4L4TA 4ZX6A 3OD3A 5GJTL 1OW0C 1OF2A 3P9LB 1E6ZA 4EQ2A 1PYWA 1L8PA 3TXZA 4JRXD 5LGXA 1SJAA 2B59B 4AXWB 2D03H 1PDZA 3RWIA 4W9JC 4IBQA 4PTTA 4DUWA 2K78A 5DQ9B 1LILA 2BSEA 3OXRB 3WFEH 5DHVA 4K38A 1L7TL 2PF6A 4DBWA 5E6IC 5FV2A 4B3EA 5AW8B 3NCYS 4K39A 1D7CA 4FZ8L 4KK5D 4N6EA 3UPAA 4I3SH 2I16A 1BVWA 1FQ9C 1AK5A 4XVDA 2Z4QB 3LEPA 3LRGA 3FZUD 4DW2H 3EYQD 2CITA 4IBVA 2NV2A 4K7PL 3EPNA 1I8UA 1MFCL 4Y4HB 3ZFHA 3ULVE 3G18A 2VGLM 2D20A 2QSTA 1HDMA 4XCYA 2J62A 4WJEA 4O8RA 2J5LB 4ADGA 3MRCA 3HAEH 2VFIA 1V8EA 1JPSL 3D87B 3QG7L 2X2UA 4AM0A 1LE5B 1IQWH 1E9QA 5BPPA 3OKNA 5JDJA 4IRJC 3SN1A 4H8QA 4FXGB 4L29B 5LXGH 3PS6A 2BNRA 3KBMA 4QS6A 1HWWA 4N8CH 3E9UA 1ZJIA 3P9MB 2FPYA 4ZJ9A 2VLLB 3B4YA 3MJ8A 4GW5A 3Q2NA 3EYSL 4PUUA 4ETQB 2VXTL 5DJ0A 4U1JB 5IB1A 1H0DA 3P4MA 3CL6A 2YPVH 4QHRA 1D5XB 3FB6A 4L1GA 2SODB 5LCVH 3R18A 2X1OA 5GGQH 5I1EL 3W0WA 5A2KH 3V52L 3CIWA 3NSYA 3T6WA 1N2RB 4EE2A 3TR2A 1E6JH 4C59B 1N8FA 3V0AC 3RK8A 3G22A 1DUZB 2OELA 1L9MA 4H25A 2CBOA 4KJQC 4YFDB 5D7LA 3WTSA 1EXBA 3LSCA 4CSPA 1I1AD 4JN1H 3FTZA 4QMEA 2Z8WC 2NYKA 4LOUC 2OR8A 4HJSA 4FK9A 2HFEA 5C0RL 1RI8A 5ITBL 3DENA 1XYMA 5FOOA 5HNNA 2XETA 1RZKC 2GL5A 1R17A 2DMBA 3ROLA 4AWTA 3U36A 2OLAA 4PRWA 3JVGA 5GSRA 1TYGA 1PJ9A 4X0KA 3LTPA 3WEBA 1RCQA 2FB3A 1FCUA 4Y2LA 3BPNB 4PY7B 1O7DE 2JEQA 2V7NB 3NZHH 4M8QA 4UTJA 5HJGA 4UQ9A 2ZSVA 1P7HL 1OM0A 4O4WA 2BXYA 1BYOA 4HJIA 2IKIA 5C0IA 2A6KB 4JKKA 1HXMA 3N2TA 2BCKA 1J9SA 2IWKA 2QDWA 2A9MH 5I3FA 3O11B 1RPQA 2BP8A 1EUNA 2MHAA 1N7KA 1W0MA 2XZ9A 4XVSH 5DY3A 1CFTB 5KVGH 4YDLB 1HILB 3GHUA 4GQBA 4BA0A 3PWUA 3D6NA 2G75A 4F7MA 4QJ5B 1RHFA 5BS0B 3MJWA 4JAWA 3UTQA 4Z2KA 1U93B 1VBGA 2VYRE 4HA4A 2BRQA 2OSWA 3DU0A 1CE1L 1ZK5A 2WZAA 3MBEB 2BGSA 2EDNA 5D2XA 3D50A 4XNMA 5KZ6A 4WTZG 5CFAA 4HMNA 4TNEA 4C60A 4IBWA 4UTBH 4PJ7F 2XFWA 4FA8A 3D3VE 4H7VA 5D7SL 1INQB 2FB4L 1FP9A 4NQ1A 1O5KA 4JCWA 2VFEA 1EJSC 2RDWA 3SRDA 3D0VB 4EPBC 5REQA 3ARPA 2ZRVA 1P0KA 3AISA 3MLXH 4XPAH 2VITB 2WSQA 3WG6A 2IOIA 4HFUL 4BSVA 1GOFA 3EBGA 4I1PA 2CBMA 3SO7A 4PWJA 4K2UH 3T2OA 2AXWA 5C0AE 1P1VA 4YLBA 2J55A 5D6CB 5C7XH 3SDCA 3TCSA 1MZRA 4C5ZA 4FF7A 2QBWA 3QHFH 2J8HA 4MDIA 3RKDD 1JXKA 3PHOA 3KJ6L 1DTNA 1H6UA 1XAKA 3DC8A 5D2NB 2FMNA 4ZQNA 3F00A 5GS0C 4DKDC 4OIBA 5DR5L 4B50A 1MUMA 5G1TA 1HKFA 2XXFA 3WBYA 2H2PC 3GQFA 4O2CB 4LKCA 5B3NA 2XFXA 3L4UA 2DFAA 2XWTA 4JN8A 4BM7A 4I7UA 4XD6A 3AGWA 1V27A 3IS0X 5FI8A 3AWNA 2CGZA 4R5VA 1OGAA 3U6RB 1ITXA 3T4YB 4G7YL 3ZT5A 2R0WL 2NW2A 2HWGA 1UT2A 3W23A 4C1NB 4MJ5B 1AJ2A 1TZAA 2D3JA 4GUIA 1KJMB 4JFXA 1C8XA 1U83A 3BPWA 3TW9A 1IT9L 4HKBA 4OF8A 3S37X 2N7BA 1KGXA 1WKYA 4P59H 1NC2B 4ZW6A 4ZE5A 2WTPA 3WXVL 5JOPD 3RIAF 2XQYG 1D5MB 5H4ZA 3U2ZA 2YRZA 4RZKA 3H42H 2E09A 1OP3H 1BZ9A 3O3DA 4JE0A 1NCDL 2G2RB 4DF9A 2CBPA 4HU4A 3NZ8A 2EKSA 3TAOA 1DN0A 4WK9A 2FJSA 3RTLA 4OLWL 1UQSA 2G0LA 3DRTA 3JR2A 3S5YA 5HGGS