1KGXA

Three dimensional structure analysis of the r195q variant of human pancreatic alpha amylase
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFQLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE, PANCREATIC
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgxA01
5I6SA 6TAAA 1C90A 3CUGA 3DDFA 3EMQA 3WEZA 5JBDA 4Q7NA 4BA0A 4HMCA 3CC1A 4LXFA 2GDUA 4HU8A 1AVAA 3PZ9A 1E73M 5CQ1A 3I3EA 4PTVA 3W26A 1EO5A 3CHFA 4PBGA 1UOKA 1BTCA 4MNLA 2O9TA 2QLYA 4LGXA 1E4NA 3NSXA 3D51A 3VIOA 1PJ9A 4NRRA 2WSKA 1PZ2A 1H41A 3WUFA 2DH2A 4R27A 5A6MA 5A6AA 1B9ZA 1UR9A 1CGTA 1M53A 1KFWA 1MYRA 1V03A 3APGA 4ML4A 4ATDA 3WQ5A 3SURA 3WF1A 2XUCA 2VVSA 4D6DA 5EFFA 3W25A 2VX4A 2CITA 2FDMA 4JIEA 2OYKA 3EJRA 2ZUSA 3VOCA 1GVYA 1PX3A 1HL8A 1W1TA 2DSZA 1H5VA 1PAMA 3MS8A 2VL4A 3NDZA 1J11A 4J3WA 2CBVA 2UY3A 3S2CA 2F7PA 5M5DA 4TVCA 1SMAA 3VIFA 4MB3A 3BUIA 2X09A 2XIIA 1L8NA 1VFMA 1FA2A 1GOQA 3WKZA 1LWJA 2O9PA 2WMIB 1NOUA 2WCSA 5CSUA 1EOMA 3GNRA 2J7BA 1VRXA 3ZIZA 4D1IA 3PZGA 4JHOA 4J28A 5I0DA 1QNSA 3WNNA 2PF0A 4TOQA 4B9YA 2VR5A 4V2XA 1PX8A 4GQRA 3PZUA 1JDDA 3EJPA 2DT3A 3N12A 2FGLA 3MANA 4MB4A 1V08A 2YL8A 3THDA 3SCNA 4TXEA 1JL8A 5EMYA 5FL1A 2D3NA 3H53A 7CGTA 5BRPA 2QHAA 1KCLA 1C7TA 1GHSA 1VENA 2ZUUA 1O7DC 3VM5A 1BYBA 5D4YA 3W81A 4CN1A 1R34A 3PZVA 1R85A 2JIEA 1TQUA 2OWWA 1QOXA 3U5YA 3L2MA 2W5FA 3B9DA 3CIVA 5A3HA 1QPKA 1ZB5A 3ARPA 3WEMA 4W8LA 4L4OA 3SUVA 4Z2IA 2E9LA 2E9MA 4AD5A 4N42A 4Z2JA 3DX2A 1CXFA 1VJZA 4DWSB 1X6LA 3GNPA 1N82A 3AMGA 2CYGA 1E43A 5A8OA 4W93A 1QI2A 1JYXA 3SCQA 3W6LA 2ZX6A 3VIHA 3AS0A 2DDXA 1R75A 4MAVA 1CNVA 1W3KA 5FIPA 1UG6A 4CU7A 3U7BA 3WDJA 4AD4A 4UQDA 3JUGA 2WNWA 1RP8A 5DO8A 4HA4A 2G3MA 1CGWA 4HA3A 3VPLA 1E5NA 3RDKA 3UG4A 3SEPA 1HN1A 4Y7EA 2FH6A 4AYGA 2XJ7A 1CECA 3BAXA 4MB5A 3WY3A 1Q6CA 4PMQA 2ZWZA 1AQ0A 3OGRA 4E8DA 1U33A 4PCTA 3T2QA 5AC5A 3AMLA 1XV8A 1FH7A 3IJ9A 2XGIA 3UG3A 2F61A 4FLOA 3AQUA 3AISA 1GUVA 3HG4A 4EE9A 3OZOA 3CZSA 3TTOA 2AMGA 1ZU8A 3EMCA 5GNXA 1WZLA 2BXYA 5FCZA 3CHDA 3L4ZA 2W66A 4F79A 1ZBKA 1FHDA 3K46A 3AIBA 3UERA 1JZ8A 3W37A 1E1EA 1SFSA 2DH3A 2WZHA 4AEFA 3AZRA 1JNEA 3WQ8A 1UZ1A 4D6GA 3L4UA 4KRTA 3BAIA 1UR2A 1HVQA 3MUY1 3MV11 2D20A 4W85A 1E56A 3QHOA 3QHMA 1J18A 3AICA 1NM9A 4L4PA 4CN4A 2ZX5A 5HBFA 1QHZA 2WHMA 2ZXQA 3A4AA 3WN6A 2IXUA 2WSPA 3A4WA 2VCAA 5ECUA 4HMDA 3CGTA 1C3FA 3ZT7A 1HNYA 3QOKA 3VO0A 1BG4A 1XRVA 2GJXA 3LXBA 5FL0A 5M03A 4M82A 5HXMA 2WMHA 3CO4A 3VD4A 1Q6GA 4M80A 1M03A 2EADA 1OWQA 2GUYA 4OOZA 1OGSA 3VGDA 2VX6A 3BLPX 4D6IA 2CCRA 1HP5A 1LG1A 1TZ7A 3CZ8A 1FOBA 2WAGA 2V5CA 1CGUA 2Y2WA 3OG2A 3W29A 3W0KA 1CXHA 1KBKA 3AXHA 3N04A 4PTXA 1ZJBA 1XD0A 5HNNA 3ZJ7A 4JZ5A 1W1YA 4OBRA 3KL3A 3UETA 2MANA 2GDVA 4HZ8A 1BVNP 2XFRA 1VFFA 1GCYA 1ODZA 4J3XA 2QMKA 1G01A 1C8YA 1OT1A 2X0YA 4DUVA 1LQ0A 1RP9A 4JCLA 1JF5A 1JI2A 3BSHA 2IGTA 4W5UA 3VIPA 3BXWA 3SUUA 3W82A 1E70M 5D8WA 1V02E 3VD3A 2X1IA 2GK1B 4P7NA 2X2YA 3RIKA 5A2AA 4CU8A 1OSEA 1OGBA 4NZCA 1QWNA 1JFXA 1KGXA 1HT6A 3LRMA 3AIWA 5I23A 3ARVA 3RMEA 1FP9A 1BF2A 1CLVA 2CKSA 2VJXA 4FNQA 3GXFA 3KEHA 3CZLA 5CSYA 5I79A 3HJEA 4B15A 4MAZA 3SCVA 2UY5A 1NWUA 2BHZA 5D9OA 3GM8A 1UWSA 1R86A 1G0CA 4YHEA 1BAGA 5CGTA 2QF8A 3IANA 1I75A 2VI0A 3AZTA 3SCWA 4A3YA 3GNOA 2XHYA 4AZ6A 3T0BA 3A6OA 2G3JA 3A23A 4NZFA 2ZUWA 1DWAM 1H2JA 4S3JA 5IXEA 1QBBA 3GXMA 2ZUVA 4NF7A 4HA1A 4NZJA 1H09A 4JKLA 1J0KA 2DT2A 4Q22A 2CHNA 5A1AA 1OCQA 1LWHA 1KQZA 2DSVA 1ZBWA 1CXLA 1W3JA 1CIUA 1ESWA 4JHZA 4UQCA 5CPSA 1V3JA 4NSBA 3MV01 2ZXDA 3ARZA 1TG7A 1W1VA 1JZ3A 2D22A 1OM0A 4D6FA 3CMGA 4J3SA 1ZL1A 4RL3A 9CGTA 5D9NA 1VJSA 1V6WA 3GXDA 1WZKA 3VGFA 2Y24A 3VNYA 4XZWA 1QNOA 4ATWA 5IHSA 4AZCA 1C7SA 2ZE0A 4CD5A 2J7CA 4PMXA 4FNSA 1J12A 3N9KA 3SCPA 2CESA 2YDSA 4FNPA 5FD0A 3GBEA 1JGIA 1UD6A 3MUAA 1V0KA 3T08A 1NP2A 1V3HA 4KH2A 4ZXOA 1H3GA 3N13A 4LQ1A 2EPLX 3WMCA 3FAWA 1Q6DA 5I78A 2W62A 3CBWA 4U3CA 1G94A 1ZJAA 2WHJA 2JALA 2DEPA 4UQEA 4JL1A 5I2UA 2XVNA 1QX1A 2CHOA 3VKKA 3BVVA 1J0JA 1KR1A 1HJVA 3VD5A 4E4PA 3A24A 4P8WA 2WVVA 3CHCA 3ZJ8A 1R7AA 3WNMA 1JD7A 4GO8A 2VR4A 1VEPA 1EDGA 1HP4A 3ARQA 4B16A 2CBJA 3AHYA 1CXKA 2XM2A 1HJQA 4RE3A 4CVWA 4AZ5A 4UTFA 5A69A 4GZEA 1XYFA 3NIYA 1JZ2A 4S3KA 4DWSD 5M3WA 3OGVA 2V3GA 2WMKA 3AIQA 1BLIA 2YFNA 4AC1X 1LF1A 1LL7A 3DHPA 2G41A 1E0XA 4MNJA 2WVTA 2DT1A 3ZT6A 2VOTA 4U3AA 3AI0A 3NUKA 4UR9A 3D3AA 1OGGA 3RPMA 4OUEA 4WKAA 2QPSA 1KB3A 3N1AA 1VIWA 2ZX9A 4ZXLA 3IGUA 3HZ3A 1UA3A 3ALGA 2XN2A 4HU0A 5DF0A 4QFUA 4PMNA 2VZOA 1W3LA 4PMVA 1MVYA 1F4HA 4F9DA 2G8ZA 3WDIA 1D3CA 1QI3A 1PPIA 1XH0A 1U30A 1CPUA 2DSKA 4KGLA 1A47A 2XPKA 2FGZA 3WL1A 3NJ3A 4IUGA 3VUPA 1BYCA 1WB0A 1KGWA 3IJ8A 3QR3A 4QAWA 3TV8A 3WBEA 1HWWA 5ABFA 1KXHA 2VQTA 1B90A 3AMDA 5E70A 2TAAA 4W87A 4P8XA 3EJUA 3I3DA 2CETA 2YDRA 5A8PA 2XVKA 3O2LA 3WFZA 4QLJA 2X2HA 4P8VA 3IAQA 1KR0A 1KBBA 1KQYA 2BY2A 1V6XA 1XHGA 2XYLA 2NT1A 5KZ6A 1W9PA 2Q8XA 1KXQA 2WCGA 5A6KA 4TTGA 3ZO9A 5A8MA 4GXPA 1UA7A 2GJPA 2J78A 3AMCA 1TQVA 3OZPA 4PSPA 1GJWA 7A3HA 3FAXA 5FOOA 3OLDA 1XSJA 3T0AA 1XC6A 5I77A 1UD8A 4JFWA 2F1AA 3MMUA 2JEPA 2PWFA 3S5ZA 2X05A 1ODUA 3PBGA 4DUXA 1MFVA 2FHBA 4EK7A 1MXGA 2OW7A 4PMRA 4TX8A 1R7OA 4W5ZA 2D73A 2J4GA 2AAAA 1GORA 3AOFA 1NWTA 1UUQA 3CZNA 3LXCA 3LMYA 4AIEA 5E6YA 5IFPA 2V5DA 1V6VA 3TTQA 1EQCA 3BCFA 4GZIA 4M81A 2ZX7A 2EPKX 4WLCA 4HOXA 1JXKA 3LPPA 1PBGA 3ARSA 1RD6A 1XH1A 3AIEA 3WSUA 1WCGA 3WBAA 2ZXAA 2JFEX 3BAWA 1E4LA 3PZQA 5HOSA 3PZMA 1PZ3A 1VB9A 3VMNA 3ZR6A 3IK2A 4WSJA 3VMPA 4AIOA 1FH9A 3WH9A 2EAEA 2E8YA 1W9BM 2HISA 2DIEA 4UZUA 4M29A 3D4ZA 5BRQA 1KXVA 1Y7VA 3WDHA 3HG5A 1O6IA 1A3HA 3DYPA 2YFOA 1GQJA 4H41A 2YA0A 1D2KA 2WKLA 2A3BA 1Z32X 1JG9A 5AYBA 1XCXA 1UH4A 3LPGA 4AWEA 4C7FA 3B9EA 1JYWA 2BV9A 4C7GA 5TD4A 3BMVA 5CLTA 1B2YA 1WP6A 4BQ3A 2Z1SA 1TCMA 4J3UA 2WLYA 3KWXA 2X8RA 1R87A 3VMOA 1BSIA 1E15A 5HPCA 4UOQA 3AHTA 3UR7A 1EXPA 2WYSA 1JF6A 4OJYA 2XTKA 1CGXA 3BAJA 1AMYA 3KL5A 2W61A 3WFLA 3OLIA 2WC3A 1WKYA 4KRUA 4GPNA 3VU2A 3W38A 1C8QA 2WHKA 4LYQA 1TQSA 1EDTA 2C0HA 1NOFA 4H7VA 1I1WA 3D52A 1E0WA 1ITCA 1HJSA 1UQZA 3AFBA 1UD2A 4M8UA 1E6XM 3F5JA 3EDKA 2O9RA 3UR8A 2J25A 3A5VA 3KLLA 1HJWA 3F5KA 1H11A 4IM4A 4ACZA 2CPUA 4OBSA 1TVNA 3CZEA 1XCWA 2EABA 4OGZA 3TTYA 3CUHA 2E40A 4P7OA 4TVDA 4EKJA 5CJ5A 2WWDA 1E9LA 1OT2A 1W2PA 1XGZA 1TR1A 4U2YA 3WMSA 3MMWA 1TFVA 1OB0A 2DGAA 3WD4A 4WKHA 5CXPA 5CG0A 5ABHA 1VBUA 2ZXBA 5I5RA 5DEZA 3RM9A 2WBGA 4D6JA 1GQKA 1G9HA 5LYRA 1K9EA 3OBAA 2DQXA 5DT7A 5A8QA 3HG2A 1JZ5A 5E0CA 3II1A 4CCCA 1E6RA 1HKJA 2QPUA 1GZJA 1UZ4A 3A4XA 1E3ZA 2C8NA 4CD7A 3AHVA 2VT0A 1CEOA 1X1NA 4DO6A 4MJ4A 4OKDA 4GQQA 2OWCA 4GI6A 1KWGA 1F4AA 1BYAA 1E5JA 4ACYA 1TMQA 3M07A 4WJXA 4CD8A 3W6MA 1QNQA 2CERA 1BYDA 2VX7A 4WK9A 5D9MA 3RJXA 2WCAA 3LRLA 3PN8A 2W4XA 3SIMA 1NQ6A 5C71A 2WW5A 1JZ7A 3FNDA 3WY1A 3DX3A 2XVPA 1UQYA 3B8SA 3LXAA 1V6YA 1W9UA 2PI6A 2OSYA 4NXKA 2RGLA 1WPCA 3WH8A 2E4TA 4P7RA 2PWGA 4MPKA 3ECQA 3LPFA 4J3TA 4PEEA 4AD3A 1VEOA 3L4YA 4RE2A 2WM0A 2X0HA 3WF2A 4AXNA 4AZCB 1B3ZA 3GXTA 1E71M 1QI5A 3ARWA 4FNUA 2EACA 3MSGA 4TUFA 1LL4A 1IV8A 4UFHA 2W91A 2PBOA 2CIPA 5GNZA 1JNDA 4QCFA 3WD2A 1CBGA 4QP0A 5ABGA 2XFFA 3UEQA 3GDBA 2VZTA 3BVXA 1AQHA 2PWHA 5ABFB 1JYVA 1DP0A 2X2JA 1GVIA 2UY2A 4QCEA 3EJQA 4HPHA 4JKKA 2A3CA 5LA0A 2FE0A 2J77A 1GOMA 4ZE5A 4H8UA 1UKOA 3VGGA 2J7DA 1VAHA 3D50A 5BCAA 2BXZA 3VVGA 5A2BA 3VX1A 4QLLA 2CNCA 4U5KA 1K9TA 3M7SA 5IFTA 3I3BA 2F8QA 1UKTA 3IJ7A 4PTMA 5E1QA 1EIBA 3LX9A 3VTRA 2YBUA 3BC9A 3D4YA 4WKFA 5A6LA 3AHZA 3WH7A 4AD1A 3SCOA 1EOKA 4FF5A 1S46A 3HG3A 2JEQA 1MXDA 1HL9A 4DWSA 4DO4A 2VCBA 1B3VA 1V0NA 4UQ9A 3WNLA 3K8KA 1SZNA 2XVLA 1XH2A 3QHNA 3BGAA 3O9NA 7TAAA 1E6NA 2Y5EA 1KXTA 2ZICA 5BXRA 4NI3A 3BLKA 3PZTA 2IXVA 4W7UA 2BVTA 1UHVA 1OINA 1CGVA 1KGUA 4MB1A 1EQPA 1DWGM 3W4RA 1QI0A 2J8FA 5JIPA 1WDSA 1ECEA 3VIKA 4CN6A 3WQ4A 1PS3A 1RH9A 4W8AA 3L2LA 4PRWA 5EBAA 1ZBCA 3CZKA 4ZENA 3T2OA 1GONA 3WD0A 4U33A 4D71A 2BY1A 5E0FA 4UZSA 2VC9A 4OIFA 3RM4A 1HF6A 3VINA 2XSBA 2E9BA 4J7RA 1ITXA 4P7QA 1UASA 1WO2A 3GZAA 1LG2A 3WELA 1JD9A 4LPCA 4AIUA 3ZSTA 3LPOA 5I24A 1VBRA 3DYOA 3G6MA 3WENA 4UOJA 1UR0A 3HMCA 3NCOA 1HIZA 1E6PA 2VVNA 1M01A 2YIHA 2BHUA 2EEXA 5HDRA 5DT5A 2PB1A 3T09A 3ZSSA 3ARRA 2D0HA 1QW9A 2EPOA 4UCFA 3ZQ9A 5D8ZA 1V3MA 3WH5A 3VGEA 3WEOA 3FY1A 2NW0A 5LA2A 5GPRA 4Z2LA 1QBAA 3WF4A 5BXSA 1RPKA 1HVXA 4CKQA 3GH7A 1E6QM 2YA2A 3EJTA 3VSVA 4LYRA 1WZAA 3AMKA 1HTYA 3NSMA 1BHGA 2IUZA 3VGHA 1VF8A 1TA3A 3AIRA 1KCKA 1V3IA 1TUXA 1KTBA 1Q4NX 4JFUA 4H8HA 1PIGA 3MSDA 3H55A 1NWSA 3MI6A 1BGAA 3DYMA 1CLXA 4GI9A 4JFTA 2WMIA 2WXDM 4UFIA 3EJSA 5EB8A 4ATLA 1PEZA 4DUWA 4LX4A 3BAYA 3BVWA 1OD8A 4QDMA 3OLGA 1W3HA 5A6SA 3TONA 1EDQA 2Y8KA 1JZ6A 3M6DA 3ZT5A 2J7FA 3CZGA 4E2OA 1UD3A 1OD0A 1UR1A 2OSXA 1KWKA 3A21A 3BH4A 2Z1KA 1DWIM 1O7AA 4UFJA 4ZE4A 1QWUA 2VZUA 2CKRA 5A8NA 4FMVA 1PX4A 3POCA 4UFMA 2V3EA 3U5UA 2YBTA 4AD0A 2JF6A 2V38A 3N18A 3RO8A 1DTUA 1B30A 3B9AA 2WHLA 1ZS2A 2YKKA 5JIWA 3CTTA 3QOMA 1DHKA 4U2ZA 4PN2A 1H1NA 3VDCA 3IAPA 1VFUA 1EO7A 2J47A 4TTUA 2XN0A 1IZKA 3W53A 1V3KA 3N11A 2YL6A 3SUTA 4PUDA 5CPTA 3WUBA 3WQWA 2W67A 2DSUA 4PUEA 2BY3A 2YOCA 5E09A 2BVDA 5E9AA 1V3LA 1E55A 1UKSA 4UFLA 2J75A 3SCSA 1GNXA 1G1YA 4CUCA 1J0HA 2F1BA 2D0GA 3K8MA 3MO4A 3A3HA 3VD7A 2D23A 2G3IA 3WNKA 2ZOXA 5BROA 4J3VA 4AMCA 3GXPA 2WPGA 3ZR5A 2GSJA 3WD1A 4WIWA 1CGYA 4CVUA 3FXYA 3VM7A 1ISWA 3ARXA 2JIWA 4ZEPA 1HJXA 1ISZA 4AZHA 3AS1A 3WDRA 1TVPA 1OBAA 4P8UA 3BMWA 4V27A 3AS3A 3DX0A 1UWQA 3AXIA 1BGGA 2RGMA 4BCEA 1L0PA 2Y8VA 4W88A 3L4WA 3MUZ1 1VFOA 2EJ1A 1EGZA 5IDIA 4EANA 2F7QA 4BQ2A 4HOWA 1E4MM 2OSWA 2OYMA 2GFTA 3KLKA 4AEEA 1W1PA 4CGTA 1UWTA 3CLWA 2OLHA 1HKKA 1MQQA 1BPLB 2NT0A 4F66A 4B9ZA 3AZSA 5JBFA 3VX0A 4CCEA 3WNPA 2ESCA 4XX6A 2WANA 3VIJA 2VNCA 4AD2A 3TTSA 2OWXA 4M56A 1E1FA 1EHAA 3K8LA 3W28A 1MW1A 4UQBA 2XM1A 3FN9A 1QI4A 4HTYA 2BFGA 1JYNA 1FH8A 1CTNA 3N17A 4Z2GA 1GPFA 2ZUNA 4FLQA 2WVVB 1J0IA 2ZIDA 4JFVA 4MNKA 4XZBA 4BF7A 3ZM8A 4UQAA 3N15A 4HZ7A 5GQBA 1HX0A 2VMFA 1US3A 3BUBA 3AXXA 3EDJA 1UYQA 3NYDA 2VX5A 1JAEA 3FHQA 2WMFA 3A22A 4PMZA 4F8XA 3M46A 4HPGA 4Z2KA 2EPNA 2EO7A 2J7EA 4PCSA 3WY2A 4D6HA 3BUDA 4MDOA 3CUFA 1PIFA 1JDAA 3CZJA 4H2CA 1E6SM 1UD5A 3SCUA 3CUJA 2WZEA 3DX4A 4X0NA 2VRQA 4DM1A 4OOUA 3OB8A 3TOPA 2UWFA 1SR0A 3WMBA 3POHA 4W86A 4FLSA 4QLKA 1R47A 1UWUA 2ZUTA 1QNPA 4W89A 2VRKA 3VD9A 1FFRA 2D2OA 1M7XA 3GYCA 3SCTA 1B1YA 3CV5A 4A4AA 3L4XA 1W2VA 3EDDA 5BYWA 4HMEA 5I3DA 1GQLA 4WF7A 4FK9A 3F5LA 3CH9A 3VIIA 4AMXA 1VEMA 3DECA 4GZJA 3GTNA 1GOWA 1H4PA 3QGVA 5CZKA 3W24A 4DM2A 3NDYA 1C91A 2UY4A 1DEDA 2DPEA 2ZWYA 2XGBA 4F9JA 1R8LA 4CD4A 2BVYA 1M04A 3DDGA 3CMJA 4AZ7A 2FHCA 2G4FA 1HKIA 4IPNB 4H04A 1LJYA 1J10A 1WE5A 1ISVA 3ZJKA 5D9PA 5AY7A 4LYPA 3LRKA 1UKPA 2GJRA 3AIUA 1E72M 2OW6A 1B3WA 1WDPA 2HVMA 1MW0A 3DC0A 4AMWA 2YDQA 3EDFA 2ALWA 3EBVA 1H49A 1UR4A 3U7VA 2F18A 3EYPA 4ZFMA 2Y4SA 3VNZA 4XV0A 4W7WA 1B0IA 4M1RA 4W7VA 1GOIA 2VRJA 4E8CA 1R33A 2WB5A 2WBKA 2NSXA 1E6ZA 2QV4A 3RM8A 4B3LA 2XVGA 1XSKA 1SMDA 4V28A 2E0PA 2D1ZA 2YJQA 1YQ2A 2XWDA 1BQCA 1QVBA 3ARYA 4AISA 1LLOA 3PZOA 1W91A 1LL6A 2EPMX 3RJYA 1W32A 2WC7A 1J01A 2B31A 2YL5A 1YHTA 3PTMA 4EAMA 3ARUA 5JBEA 3OGSA 5A6JA 1NOWA 4GI8A 3VSUA 2J8GA 4W8BA 3RCNA 1WDRA 4UOZA 3MKKA 4CCDA 5DMYA 2D0FA 4K68A 1UWIA 3OIHA 3VDHA 1NWRA 3AROA 4UFKA 3EDEA 4NX0A 2D24A 1QNRA 3VGBA 2VUYA 1BVZA 3BUQA 3VDBA 1WZMA 1WNOA 2BS9A 1JDCA 2CEQA 4JAWA 1BFNA 1IZJA 4DO5A 4D72A 3D5HA 2OYLA 2WKGA 4JL2A 3AIVA 1E4IA 1K9DA 1V0LA 1D7FA 5DFAA 2QMJA 1CENA 2VZSA 3F4VA 3K1DA 2J79A 1CYGA 1GW1A 1H0IA 3K4AA 3GXIA 3S5YA 1MQPA 4N0RA 3A47A 5A2CA 2YA1A 5FKYA 4JKMA 2XIBA 1B31A 1JXJA 1KTCA 1NP0A 4M24A 3U57A 1TQWA 4HZ6A 1UKQA 1GOOA 4J27A 5C70A 3PHAA 1ZBVA 1E3XA 1MQRA 3WY4A 4AW7A 1CWYA 1J0YA 4U31A 1TQTA 1UH3A 3MUIA 3ZOAA 4FLRA 4PMUA 3AS2A 1HJUA 3KL0A 1UWRA 1BG9A 1WDQA 1US2A 1TA3B 5A6BA 1T0OA 1W9XA 4GKLA 3DX1A 3WL0A 1J9YA 2WVUA 5EFDA 4AZBA 2FH8A 4MDPA 1C92A 3WUEA 3SCRA 5AC4A 1QW8A 5ABEA 4NRSA 2X2IA 4X9YA 3RILA 4FNRA 1C93A 2W92A 4TX6A 1K6AA 2XN1A 2PWEA 1J0ZA 4BZYA 4C7DA 2PWDA 4HOZA 1G5AA 4H8VA 2J7GA 3GH4A 4R5EA 4CD6A 5F7UA 2EBNA 2VZVA 3PZIA 1HKMA 1MW2A 4YN5A 3PZNA 5KEZA 3W27A 2V3DA 2O92A 3AYRA 3FHAA 1JZ4A 8CGTA 3AHXA 2F2HA 2WVSA 3TA9A 1IT0A 3T2PA 2FYVA 1ISYA 5E6ZA 4A3HA 4JFSA 3UCQA 2VURA 3BVTA 2CBIA 3HU7A 1H0GA 1NARA 3BCDA 3WDQA 1MWOA 3WUGA 3OA5A 3WNOA 4AZIA 3THCA 3BVUA 4FNTA 4URIA 5BXPA 4PMOA 1C8XA 4PMYA 2XWEA 3MU7A 4B3KA 2WZIA 3WF0A 1XD1A 4YPJA 3WQVA 1K9FA 3VIGA 2F7OA 2AOSA 2YL9A 3GXNA 1NH6A 2WLZA 1R46A 3CHEA 5BWFA 1UD4A 1SYTA 3DHUA 1E40A 4Z2HA 3VILA 3PTQA 3TP4A 2PBGA 2V3FA 2F7RA 3BAKA 2WMGA 4KWUA 1V0MA 2YLAA 3SUWA 2XSAA 3S6TA 1W9DM 2VO5A 2YLLA 2XG9A 3OLEA 5C8BB 1FHLA 1UR8A 4KMQA 4KGJA 1HXKA 5GNYA 5A94A 3UESA 4NXSA 2WK2A 1QHPA 3WDPP 1GJUA 5HPOA 1EA9C 4MNMA 4D1JA 2G3NA 1HXJA 4WSKA 4GIAA 1CXEA 3NSNA 5IHRA 1JI1A 3EMZA 5BXTA 4MADA 1DWJM 2VTFA 5JUVA 3KE0A 4GINA 1Q6EA 3G6LA 1GHRA 4MTVA 3VDAA 1CXIA 2J74A 1ISXA 4PTWA 2C7FA 1FFQA 2WMJA 2DT0A 1V6UA 4YHGA 6A3HA 2BNJA 2E8ZA 1P6WA 4GO9A 4MJ2A 3T0DA 3PTKA 1MW3A 4PSRA 1DWHM 2ZX8A 1B3XA 1WAWA 3J7HA 4XB3A 2O9OA 3H54A 4BQ5A 2WWCA 4DWSC 3VSTA 5A95A 1JAKA 2W63A 3SUSA 1W9VA 3GBDA 4BS0A 3WQ6A 1B3YA 2GK1A 2VQUA 1EHNA 2D3LA 2JE8A 3ZMRA 4P7LA 4AYSA 1GOKA 1Q6FA 4PYSA 1TE1A 2CXGA 3WIJA 1U2YA 3HN3A 3O6AA 6CGTA 2GVYA 2DIJA 3AJ7A 2JF7A 4PMDA 3VIMA 4TVUA 1XSIA 1JIBA 3FW6A 1QHOA 2VCCA 2A3EA 5CGMA 2PC8A 4D6CA 1CDGA 1MFUA 1JFHA 3E1F1 1GQIA 4AZGA 4XUYA 2ZUMA 2CBUA 1OIMA 3GH5A 2WC4A 5LA1A 4BQ4A 2A3AA 3ARTA 4RE4A 1AQMA 4IISA 1FP8A 3BUPA 4JCMA 3L4TA 4X0VA 4OZOA 3ZJ6A 1I1XA 5AYIA 1V02A 4ACZB 2GJXB 2E3ZA 4D6EA 3WH6A 8A3HA 2EQDA 2FHFA 2A3HA 3BLBA 5A6BD 3BSGA 3CPUA 2EXOA 3L4VA 4U5IA 2DSWA 1CZ1A 3KZSA 1DWFM 4CU6A 1E0VA 4IPLA 3K4DA 3UG5A 3WD3A 1EH9A 4AY1A 4UNIA 4HP5A 3ALFA 1UH2A 1XYZA 2XFYA 1OIFA 5M17A 3AYSA 1X6NA 3CUIA 2BHYA 5CPQA 3MMDA 2J7HA 4W84A 2J62A 2BY0A 5CLWA 3WF3A
chains in the Genus database with same CATH superfamily
5I6SA 3PV7A 3H4HA 1C90A 3DDFA 4M6UA 2WAQA 4N1EA 4Q7NA 4BA0A 1AQ8A 2WNNA 2GDUA 3GMQA 1AVAA 5E00B 1N3NA 4HU8A 1I1FA 3PWIA 1E73M 1NCDH 3W26A 3KS0J 3SRKA 2P5PA 3CIXA 4ZX6A 3BEWA 1GC1L 1W0VB 3ZVVA 2P5EE 4Y4HB 3SJVD 3MLSH 3A9BA 3NQ8A 3AGVA 4MS8C 4PBGA 3HAEA 2VQ1A 4K8RC 1FWRA 1JCJA 4LE8A 5FDYA 2C9UA 4RGMB 3URNA 5FM8A 1VFTA 4JHAH 3Q5TA 4BSWB 1ZJIA 2YZ5A 3P8JA 4JM0A 4L1DA 3KPOA 3V95A 4LAZA 4LGXA 3OYXA 1E4NA 2INEA 3NSXA 1U8OA 1RVFL 3D51A 4OJDH 1X9UA 3GZKA 4RH4A 4OLUL 1JWMB 1P2CA 5I02A 2UWEA 1AR1D 2GSIA 2BOCA 5CJXA 1MCSA 4AK2A 1H41A 4LSTH 2CLKA 2HT3D 3FTYA 4WKXA 3OJGA 3QTPA 3L7EA 5DJ6A 5A6MA 2AQOA 1D5MB 5A6AA 4HNCA 4FOMA 4MNHB 4IMCA 2CLMA 3QUYD 4ZS6C 3G8RA 2QYGA 1IC4L 3VE7A 4KZDH 4Z1DA 4ENLA 2IKGA 2VVSA 3R7MA 1A9BA 4JFED 4KUZL 4PJFA 4QKTA 3ETTA 4DP6X 3NWRA 2IV9A 1A2YB 4J3OC 4KKRA 4M6QA 1EGVA 2XIOA 4PV1C 3HNSH 2OYKA 1X9LA 5I3FA 1DO5A 1ZV9A 1L9OA 2ZUSA 4TV3A 3AY4C 4K5OA 5FO8B 3ERXA 1S6NA 3ITOA 4MAYB 3RYSA 1JVOA 1ZIAA 2VDOL 3QXAB 4LSPH 5GJTL 3MS8A 4GA8A 5CSSA 4QR6A 3I4EA 2HVKB 1IO4C 1MCWM 2J1YA 1QR1A 4EQ3A 2B1AL 4MXQC 4B3EA 4QNPE 1EAPB 1XEDA 1Y6MR 32C2A 4JPQA 5M2FX 4JVUA 1TQCC 2CLZA 5HR6A 2XETA 3ZGHA 4UMGA 4TVCA 2X6VA 2Z24A 4FG6C 3VIFA 1P0DA 2X09A 3BUIA 2G0KA 2R69A 3HE7D 1YAIA 3M7FB 3PCYA 5HDOA 3BZ5A 4YHML 1TSRA 1EXHA 3CWGA 3UGEA 1TUFA 2OX4A 4WHCA 2E74C 2C9XA 3C2SA 3MTXA 4GRWE 1E5ZA 3ARBB 3IMWA 4TSAL 4HDIB 2Z31C 3STLB 3SW6A 4AITA 2Z8WC 4NZ5A 3GS4A 3CAWA 3CLFL 1U4FA 2XWBB 4NAFA 3JT2A 3ZIZA 2YPIA 3NCJH 2OP4L 4GSRA 4P2CG 3EG9A 3O6KL 4C57C 2PF0A 4ZXBD 2GQ8A 2EE2A 5B39B 2VR5A 2JB5H 4V2XA 2WTRA 1YXDA 3X1FA 4GXVL 3HC0A 3QPQC 2DY2A 1EJSC 1I7ZA 2DT3A 3DAQA 2OTUA 4Y4KC 1XIHA 2GJNA 1MRQA 2RUSA 1HG3A 4QXTA 4NVTA 3MPGA 1U8JA 3EZ8A 5BO1H 5DK2A 4CNIB 2B20A 4TNGA 5C0FA 4TXEA 1KOAA 5EMYA 1WSST 3VXNA 2FDSA 1PHWA 1S8DB 5I5IA 5DN1A 3H53A 4GFSA 3QV6A 1GH7A 3P0YH 2XPYA 4PRHA 1OZMA 3UYPA 2VDKH 4P59L 3RLHA 4ERSL 3RCYA 4ABWA 1WWWX 3RZCB 2WN3A 1S9VA 3FYEB 3ARFB 3CFQA 5H94B 3TA3D 1BYBA 1UW9A 2AKZA 1VCAA 3DESA 3MBFA 5TF0A 4PWKA 2K3TA 2V2WA 4Z1AA 1EJFA 4K1WA 3I4KA 3BEWB 5IBUB 1MUCA 2TSBA 4HT1L 1R9YA 1UEMA 1UG9A 2VQ1B 2QDGA 1R34A 4YZFE 3NABL 2H9GA 4Y9GA 1M05A 3LOWA 4MXWL 4ODVL 4U1GB 1AR1C 4LRNL 4ETQB 3APCA 1BWVA 3EWCA 3L21A 2JIEA 4MD4A 3P0WA 4L6DA 5I3JA 2A9DA 3FFDB 5I0VA 1TRDA 4S1RH 5EOQH 1UBSA 4I5UA 3U5YA 5AVWB 5ITBL 1FWSA 1Q3NA 2W5FA 2Q7YB 4AXWB 2R29L 1JPFA 2GHZA 3D25B 3NN8B 5KOMC 4AEIH 1JWMA 1P2CB 4JO4L 3DEQA 1P4LA 4W8LA 3RVVD 2B2XH 4L4OA 1LK2A 4KMLB 3BTNA 2OK0L 5F2IA 3HUJA 4Z2IA 2P88A 3ISYA 3GTHA 1JK8A 1H3VA 5BNXD 2E9MA 3N44F 1AG1O 2X0SA 3U4EB 2YARA 1NBZB 1GYLA 2C1GA 2YPLA 1R3LB 4HNNA 4C4BA 1MAML 1PL3A 1TJIH 1G5GA 3TA3C 4FQCL 2RQEA 3CHRA 4JO3H 5JOFB 3GNPA 1OAYH 3PYCA 5HI3C 3M0ZA 1G9NL 3GVWA 2H32B 1LDSA 5LWYH 5D37A 3BGGA 4YQXH 5AZ1A 2O72A 4Q4RA 3NCYS 3W6LA 5CEXA 2ZX6A 1EF2A 3GG1A 4FHBD 5D7SH 2EVHA 2J3SA 5AAMA 1OSZA 1R75A 4IW4C 1JPHA 3TBSA 1W3KA 3P67A 5FIPA 2CZVA 5FEXA 5FEWA 2B4CC 3WDJA 4AD4A 2BOBB 3V6FB 4FXRA 3OWRA 3V0WH 4EVNA 3QHTC 3URQA 4FD0A 3SCMA 4MZ8A 3WTSA 3TSDA 3NJLA 1S9XB 4H40A 2VLRA 4XCNA 3V0GA 4G7QB 5B8CA 4URKA 3BLOA 3HHSA 4FFZA 3WLHA 3SKJL 3GM0A 2Z3FA 4GCXA 4L1GA 4BDVA 2A0LD 4MMYA 1OWWA 1UADC 3HGSA 4QXWA 1GGCL 2X9YA 4KBPA 3EXJA 1A5OC 1VYRA 4JFEE 1PG7X 3C0QA 3ZR4A 4K0OA 4ONVA 2EIEA 1RZ8A 3CV6A 2AERT 2NZLA 1HN1A 4Y7EA 4G8EB 1H3PH 4I8DA 5L2KB 4AYGA 4U6HA 2XJ7A 3O3DA 3V4PA 1EHLH 3S88L 5DJ8A 3TNMA 4F0KA 1LO5A 3AM8A 3OR7A 3ZTNH 4JPWL 4C58B 4OKVB 1N12A 4N2DA 1U3NA 1U33A 3CHOA 1TO3A 1EDHA 4LLYA 1DSYA 1F58L 4Q9RL 3BWZA 2DPKA 3EIFA 5D7LB 2CKBB 3TN4A 1TPB1 2EXTA 1FFOB 2RJMA 3ZZQA 4JO5A 3QAZC 1FC2D 3AMLA 1XV8A 3CAVA 3KOYA 2C4FT 3MU3A 5DZ9A 2XWTB 3LZ3A 5C0BD 4ORMA 3U0HA 3V4VL 1BAFL 5T1LD 2NYKA 3IJ9A 4RZKA 1G9MC 1K85A 1UM4L 3QUGA 3H2AA 4WR3A 3GKAA 1CCZA 1IWPA 2X2UA 3QI9A 3U36A 3AISA 4ILSA 5GS1B 1AXTL 3HG4A 5TDNB 1ZFJA 3QEQA 3TT3H 3TTOA 1OHZA 3APFA 1E2WA 2AMGA 2NY7H 4HKBB 1JV5B 4OAWA 5AYTA 1ZU8A 3FUNA 1NSJA 5F9OL 1BZEA 4M6MH 1FL6B 2VR7A 4NY2A 4PJXF 4HWBA 4G6AC 3DG3A 3GMRA 4P07A 4JRYB 3I7QA 5E4IA 2XQBL 1TTPA 2DZBA 3AUJA 2QSCH 2UZPA 5TK4A 4OV5B 4U49A 1BEXA 4X7FC 3PP3H 5FA4B 4AXWA 1J8KA 4CCZA 3IDNA 1GW9A 1IBBA 1E1EA 1P4LB 1OO2A 2B9BA 3B8UA 5GRXG 2JTDA 2UX7A 4B60A 1TLKA 2ITCA 1IM9B 2DQFB 5JHAA 1L9WA 3DI0A 1ZHLB 4BH8B 4EOUA 1QUPA 5HI3D 2VLLA 3GJFK 4HC1H 3FA3A 4GX9A 1F6AA 3GDRA 4PODA 1U1UA 4KO6A 1KD0A 1UCBL 3PLYA 1YBQA 2DP3A 1I4NA 4ICMA 5LN4A 4E68A 3MUY1 1HVQA 1F3JB 1YC7A 1HDMA 3QZWA 2E28A 4CQ8A 2A83A 4W9DC 2DV0A 4ZQOA 3UY8A 3QP3A 3RXZA 4LSUL 3AICA 1NM9A 5KVMC 4A2DA 2DIKA 4Z23A 3NIFB 4FJZA 1V05A 3L5JA 1DJQA 1U3HB 1QHZA 2X28A 4RIRA 3A4AA 1BVLB 3WLKX 3WN6A 1QSFB 2WSPA 3V7MA 4YHIB 2DBLL 1YPZF 1NZRA 4LSQL 3P3SA 4P2RB 2PGFA 3AABA 4EPKA 3UPMA 3CGTA 2E6AA 5DK0A 5F7LB 3APMA 3HFTA 4DZHA 3CQJA 3ZT7A 1WD9A 4WXZA 1TU2B 1IM3A 3HI6H 3QOKA 3QJQB 3VO0A 5FL0A 2HRPH 4F2FA 1ONEA 3LY6A 1G7IA 1XLGA 5ESAA 3SYOA 1EIXA 5F1UA 1RULH 4HMNA 1H0DA 5IIEA 2VLRB 3WJZA 3DX6B 2H1PH 5FM4A 2QL1A 4KJYA 5KVGE 5HXMA 5T3XL 1S9YA 5K93A 1MNSA 3VD4A 4MMYB 3CO4A 5LIWX 2HJKA 5K9CA 2UY7A 1NDMB 3GSXB 4BZ1L 3WJLA 5I0ZA 2C9RA 1EC9A 1YY9D 4EPDC 1B3IA 2ZCKL 5L8LB 2NZ9C 1QR4A 2HV5A 1X8CA 3IGSA 3IIVA 4F27A 4K7VA 1WEJL 4ELDA 4XVDA 5TE6H 2J9YA 2NQ9A 1XWYA 4MRCA 4YC2C 3DTXB 5IF0A 4Z7VE 1NGXB 4DGUA 3IRSA 3LD8C 4AHPA 1KBKA 3AXHA 3N04A 1CQYA 4Z8FL 1KRAC 2LTQC 4F1ZA 3LY0A 4DBDA 3V8OA 3HMXH 4JE0A 3FGCA 2MANA 3X13A 4HKXB 3ZIMA 3CH0A 4K94H 5KYYB 1G7MB 3TYZA 3PP4L 3M0IA 3GMQB 1BVNP 5TF1L 3B3IA 2QMKA 1R24B 1WZ1H 1T1YB 2W0KA 3L3OB 3BRFA 5D2LB 2GG1A 2VSKB 3PPEA 1DYZA 1SYVA 3RFRA 3VFVB 4NDMA 3R0UA 4AM0B 1I2NA 1OB1B 4JCLA 2NZ9D 4XNAA 3BFQG 1UXLA 1KBGL 2V5TA 1EBGA 3F64A 3VI3E 1EL3A 3TYAA 3VIPA 4I48A 3F7LA 1E70M 3IWVA 1QR7A 2ZOKA 3PIQA 5DD6B 3KS0H 3VD3A 1OCZB 1CURA 3R0NA 1TV8A 1KPRA 2GK1B 2X1IA 4NO2A 1U8MB 3LKRB 4QHKI 4DP5X 4K8EA 4NQCA 5D1QD 4H1LB 4CU8A 4XRCA 2APVA 1DQIA 2V67A 4NZCA 4Y9PA 4KTGA 4CVXB 2V82A 2VLKD 5E8NB 3W1MA 4CEXC 2BOCB 4O1CA 2WO4A 4N4YB 3S36L 4HCFA 4N02A 5LIYX 1XIEA 3IU3A 4DGYL 2VELA 3L7EB 3UC0H 4NO3A 4C4UA 2J6EA 3ARVA 3AIWA 3E8UH 25C8L 4G71B 4K4KA 4ODBD 1FP9A 1EP3A 4MF4A 1CLVA 3BQUD 2VJXA 4N2HA 2CKSA 2QJJA 1E4XL 2UBPC 1DIDA 3GVVA 4JNMA 5IDZA 4HHWA 5DWPA 5BV7C 4F7EB 2W81C 1ZOXA 2WOYA 3BPNB 3QZWB 3OHIA 1F02I 2E9GA 2WINA 4WHDA 4FXLA 3BWWA 1MRFL 1D7CA 2Q1EA 1SEQH 4R5EA 3HJEA 4WDTA 3DI3B 3MYJA 1KM6A 4O19A 5DUBB 4P4KD 3P0YL 1VRSA 4LCCA 2E7HA 3PWNA 4GXUN 3SZKC 4JXCA 3SCVA 4L3FA 2CIKB 4X99B 5DC9B 1KYDA 1B4RA 1F7BA 5KUMA 1MRAA 2RJHA 2UVEA 5D9OA 1WBYB 4L9LB 2QF8A 1QSFA 3IANA 1ZT4B 3PHSA 4N2YA 2C3VB 3QHZL 1ZK5A 4YHNB 5E24E 2OQLA 3AZTA 1MJ8H 4C91A 4HPYL 1URIA 3HPLB 4X42A 3TJHD 4A3YA 3GNOA 4AZ6A 5EWIH 2CLRA 3DGGB 3KPRA 4G59C 3FSAA 5FKPB 1M2VA 3BUYB 4YJZL 1O5RA 4UTHA 5LNUA 3BGFB 3RWCB 1NDWA 4ZPVB 2BVEA 3EX6A 4DAGL 3N4EA 2DQ6A 4NYYA 1YZZA 1OCWH 2ZUVA 3EYUL 3T1GA 1NIBA 4GAGL 5DGRA 3P2TA 1H5BB 3FC8A 1S9YB 4OD2B 2JJWA 3D07A 1J0KA 2CIIB 3DJZA 3G04B 5MI0B 5CGBA 1WDWA 4HG4J 4PJBF 5A1AA 3C56A 1LWHA 1VCBC 4KI1A 1KQZA 1ROCA 1GMEA 4URTB 3BZ4A 1I8MA 3BN3B 3KPSE 1ZBWA 1CXLA 2EIZB 4PRIB 1ZP3A 1ESWA 4ERGA 4CNUA 1XLMA 4KERA 1LP9E 2VZ1A 5MERB 2P8PB 3S37X 4OVXA 1XGDA 1SGKA 1I4FA 3OB0H 4RK8A 4QO1A 3WFBL 2AEPH 2DLEA 3C2AH 3MV01 3QDGB 3ARZA 1I3GH 1IEBA 2WHVA 3SN6N 1IE7C 3BKML 4BXSV 2FGWL 4KXAA 5HQLA 1CDYA 3RL1B 4HS3A 1AKJD 3MRGA 4LRIA 4I18A 5J7CC 5EGRA 3TZVC 5D9SB 2WWNA 1WCBA 4S0HA 4J3SA 4KUCD 2PGEA 4GO6B 3N0AA 1WA0X 3WTYA 2YPLE 3ML9A 4PRDB 2VXTH 4RGMC 5I1AA 4F5CE 2VWEE 1RUQL 2XQ0A 2KQNA 4XNUL 1V6WA 3VAVA 1HQRB 2WXJA 3HCVB 3MV7B 3QJTB 4PWHA 2PDHA 2DKMA 5CINL 2R56H 4ATWA 2OOGA 4AXKA 3EWDA 3Q6GL 3W7QA 1FWGC 1SYVB 4FQ1L 3KBSA 3RFZB 4PMXA 1HIMH 1ZSHA 5CUSL 3SCPA 1PWMA 2YDSA 5FD0A 3DXIA 3HS9A 4L4VE 3WX7A 2AQNA 3CFJB 3L2IA 1VBGA 1V0KA 5EUOF 1HH6B 4O18A 3LHWA 3ULUD 4JX6A 4ZXOA 3ES7A 3KTSA 5CPSA 1GHFL 3TQKA 2ZUXA 1LE5B 2VR3A 2NY3C 3D25A 4LQ1A 3WN5C 4KV5F 1GVRA 1R38A 2EPLX 3HN8A 3P73A 4JHAL 4Q6IB 4RMUA 4TLUA 4XNMB 5IQOA 1GMIA 4MZRA 3QRHA 3FAWA 3GQFA 2QHRH 3BUTA 1F3XA 2ZYFA 5I78A 4UV7H 3L5MA 2C9QA 3ES8A 3OC5A 3LEXA 3UZZA 2Q20A 3HS0C 1ZJAA 2W1NA 4HQQL 2RH0A 2YPLB 4L5FE 4PJAB 4X8CA 1A6AB 1EKOA 5DVOA 4ZQTA 3MT1A 4MSSA 1WUEA 2G9KA 3U46A 2Z31B 1YYML 2O5NA 3SQBB 4HJTA 2CHOA 3VKKA 2WXKA 3WJJC 3BVVA 3EA1A 1DN0A 4Y2DD 1LBFA 4I9WE 3LSCA 3QQDA 4KHXL 2XFGB 3SY0A 5I3GA 4NKQB 5CMAB 5F7KC 4QRPD 1KR1A 3KXQA 5D5MB 3ESNA 3VD5A 5F1SA 3KR3H 4D9LL 4IFRA 1JVKA 4B5ZA 2EG7A 2WVVA 3GSRB 3ZJ8A 4WUUD 2Y2TA 3OV6A 4PVMA 4YHNA 4QTHB 4BHUI 1IVTA 3TJ4A 1OALA 4WTXA 2DY3A 3L66A 3V6FA 4Y8FA 1IEAA 3JWNG 1S5HA 2AJUL 1K8DB 1HP4A 5D7IA 4X6FA 1TV5A 5C54A 1ZLDA 2N7SA 2V33A 1CT8B 5J12C 1KIPB 2CAKA 1OP5K 4JFFA 1JRHI 4KC3B 5EC1A 2VWTA 3D18A 3NZGA 1TT6A 2ATPA 4RE3A 2ZVRA 2CIIA 3UJIL 4CVWA 3UBGA 3BH8B 1V55B 1UVQA 4GVFA 2W0FB 3PQYD 3WLLA 4C1NA 1M7UA 2CG9X 2E7CA 1M7DB 4PBDA 5M95B 1EF3A 4PEKA 1I8MB 3KYAA 4C6QA 4UAOB 4NPKA 1JZ2A 3MRNA 1OCBA 4DWSD 1RLCL 5MERA 2NW2B 3KRSA 4RAUA 2L04A 3F2CA 4KJPC 1BLIA 3V4PB 4AC1X 2R0LL 1LF1A 4OZIF 4DEWA 2I25N 2FVKA 3K6FA 3CQ0A 3CQHA 3RL1A 3FJLA 2Z7WA 4MHHI 2FWUA 4IGNA 3MRGB 5AL8A 3SGDH 2WAHA 1BAWA 2YGVA 3ROOA 2ED6A 3STPA 5JTWA 3RF9A 1YYCA 4Q6KA 1G1OA 2WKJA 3B0VC 1E8YA 3FOLA 1MMFA 4PLJC 4U3AA 4C90A 4DJEC 2QLVB 4PJEF 3RAJH 1XRFA 1EEZB 4YNYB 4Y16B 5HGHB 4UR9A 3ZUCA 4ZUSA 1OGGA 4UV4L 1Z0MA 4X6CF 4WKAA 2DLGA 3PRZA 3W2UA 3NQIA 2C0AA 4NIRA 2YXFA 1OFQA 3O8AA 4KCVA 2IPTL 5I3KA 1G0XA 4F4RA 1EUUA 3WJXA 4AVFA 1T1WA 2FBOJ 3DVNA 2MKWA 4PRHD 4B3ZA 3MCLL 1YMHB 4A7QA 3BG3A 3FF8A 3G1SA 2ZOWA 5AOZA 4HU0A 1FFNA 4BE6A 1UZ6E 3V75A 2LU4A 3LKPB 2HUEA 3RIFF 1FL6A 2VZOA 3AC0A 3T6VA 5HDQL 4LRTA 1NCBH 1FWEC 5I1CL 4OF5A 1MRCL 3QYCA 2HJLB 3RVTC 4HW6A 4K23H 4MAYC 5FA4A 1ZLWK 3V2AR 4B27A 4AWJC 4S1SH 3EH2A 1KM2A 3MO1A 4FADA 1CPUA 2I1OA 1KELH 2NUPB 2NXYB 2X1RA 3BRDA 1EZWA 1CLCA 3VXMA 2FGZA 3MSPA 3THAA 4WAFA 1I1AB 3MUJA 1RJPA 3NJ3A 1BYCA 4PLKC 1CU4L 2PW1A 1W5NA 1ZTVA 2QQLL 1EFXD 4XHJC 2W9EL 4OT1L 2X7VA 2VC7A 3D2UD 2A21A 4NJHA 3WBEA 4LUYA 1HWWA 4EI5D 4DI8A 5ABFA 2P10A 1D5BB 4LOUC 2CKBL 3ULVL 3HF3A 2EILB 3D6GA 1DN0B 5G1YA 3DFPA 4NQEB 4OU3A 5E70A 4R7OA 2O6CA 5CKGA 1Y18A 1U3HA 3N19B 3UIZA 5B7FA 2ZTKA 4F2EA 1G4MA 1HHGA 1AH1A 1L6FA 2F54A 5F3HB 4JMXA 5F97E 3SOBL 4NIKB 4X9HA 3T4YA 1UPPA 5GGVY 2YDRA 1WWCA 2OJZL 3OAUH 6REQB 3K3QA 4AM0Q 3BDYH 2X2HA 3UMNA 1FO0B 3MGAA 4Q0XH 1R3JA 3ULVF 3GHBL 5IW6A 4N0UE 3NGBB 3VXSB 1AFSA 2BY2A 4OM0L 5E6IB 4Q9RH 5EIQA 5I9QC 4NAMA 1IHIA 3RZWA 1V6XA 1XHGA 1G67A 4ZFQA 4KWOA 2AQVA 5A3IC 1E27B 3DK2A 1ICTA 1WD8A 3PQYA 4HAGA 4XWOC 5DO2D 3WTTA 3M0LA 4TTGA 2WCGA 5HHMD 5ACMA 5MI0C 3ZO9A 3BE7A 4N9OB 5ACZB 3DFNA 3M1CA 2HJKB 3CHXA 3D0AA 4GXPA 2B39A 1UA7A 4G6AD 5HDBE 2TSAA 1U21A 3PL6B 4WTQA 2GJPA 3Q5OA 1L9SA 3I6GA 1TQVA 3QFGA 5J3HC 5EUOB 3AG4B 1BXVA 4P4RB 5C6WH 3MLYH 1ZGLM 3MZNA 3TJEL 2BMKA 3KXFA 4HUCA 3WLWD 4NQTA 5FOOA 2VITA 43C9B 1VFAB 2ED8A 3WHXA 2A74A 1UD8A 5KZCB 1MFAH 5I77A 5HHOD 4TTDC 4L4TB 4R5XA 3F85A 4PL2A 5ERWB 3LI1A 3OOQA 4P06A 3MMUA 3ZXWA 4F0HA 3Q8CA 4ZTEA 5T1DH 3IFOB 3ROOB 4ZPTB 3PBGA 4G1KA 1QG3A 2PTDA 4PRAA 2P4AB 4KRPB 3LV6A 4GC3A 1MFVA 4L9XA 4RNHA 4X9SA 1Q1PA 4GY4A 3WIIL 3FU7A 5EF0A 3B9KA 3V52H 4YNYA 4EK7A 3UQNA 4XI5D 4Y0GA 2OR8A 2AJZA 3NSYA 4XBSA 1U92B 4CDHA 2D73A 3F6LA 2PR9A 2PXYA 4YO0B 3NESA 1NWTA 1UUQA 4XBJA 3W9ZA 3LXCA 2NDGA 3LHPL 2QVTA 1T1YA 7PCYA 5KJRL 3S1UA 1RJQA 2GEQA 4Z7WE 2M83A 1KENL 4KVNH 1EQCA 1KB9J 3WCZA 3BHBA 1OB1A 3ECVA 2IEPA 5FFLA 1NM4A 2ZX7A 1ILUA 2I9EA 3PU7A 4KDTA 3GSUA 4HU4A 4M81A 1M71A 3FFOA 3V6ZB 4RMBA 1B6UA 1MFAL 1SN2A 3NIDE 4KJQD 3S48A 2CCWA 4APXA 4YHYB 3D2UB 5I2IB 4Z1BA 4GXVH 1PBGA 3GDLA 5KOVC 2ZCLL 3EAKA 4HUUA 2FVLA 3F7JA 2OL3L 5HMDA 5H91A 4YTUA 4GUFA 3WLBB 1WCGA 1SQMA 3N2BA 3BLLA 3C0SA 3BAWA 4FLHA 1SFJA 3PM6A 4N8VG 3O6KH 4DQWA 4NPJA 3ABGA 4NP4L 1BIHA 2XH7A 4YVVA 4MCNA 4WSJA 2PWUA 3HE6D 2PYED 3CFCH 2ZZ1A 2XSKA 1T41A 1XRSA 5TQ2L 1PL9A 1I7TA 3WUZA 2QUTA 3BXNA 3T2LA 3L3DA 4XIMA 4Z7UF 3HMJG 1H7RA 4XVTH 1U58A 1L6GA 2J44A 3DMMC 1V7MH 4KKLC 3SN4A 4NQEA 4CGUB 3HG5A 1JZEA 4LCCB 1FWTA 4Z6AT 1A7NH 2YA0A 1AH3A 4O02L 5FO7B 1P53A 2AKMA 2BLFA 1OF2B 1Z32X 3EYVA 3M1BA 4MNQB 2HLAA 4YDNA 4YXHL 4GAGH 4FA3A 4DLMA 5KVGL 2C3VA 3ZDYF 2OKMA 1XCXA 1UH4A 3QDGD 1J6OA 3IK4A 4P4KB 2GYSA 5IHHA 2YCLB 3CPGA 3EOOA 4HPJA 2NV1A 1JYWA 3WMLA 2DIBA 3UBXB 3GXUB 2Q8LA 4KKZA 2BO0A 2YW3A 4H5SA 2Z6FA 4WW2B 3VXSA 3C8FA 4NRXB 3LS5H 1GEQA 2Z1SA 1BZ7B 2VXQH 3L48A 1QYGH 4J3UA 4RGNE 5JPNC 2KQMA 1N70A 2OKTA 2HCVA 3N6HA 4FX8A 4B5UA 2RFGA 2J6WA 1SOSA 2MH4A 1EO8L 1E9OB 1CFBA 4MJIA 4AI7A 2X8RA 3E6EA 4S3AA 3W7EA 2ZQKA 3Q2DA 3NG3A 3NCMA 4RX4D 4IPJA 4YL2A 2X3CA 4OJCA 2YXGA 1BSIA 2QDWA 2Z35A 3FTWA 1YPIA 2GSGA 4GY0A 2Z7YA 3K2MC 3T4AC 3BESR 3HLAB 3I6GB 1EXPA 1HKLH 4PCKA 3RWGA 1F4XL 5BW6A 4HXAL 2BNUA 5ICXA 2EDMA 4Q9CA 3G18A 4KZEL 2HRWA 1AMYA 1TTGA 1YDOA 4JTCA 3OLIA 5HI4D 3S4SB 3QDJD 1ZXQA 4P5TB 4JFFD 1JNJA 3VW3L 3VU2A 1F6YA 3D7PA 1I53A 2UZXB 1AGEB 1SRDA 4PVNA 5SX4I 1P5UA 1Z9SA 1EDTA 2UV8G 3GK0A 2I9LB 4NHUA 3NPSC 4XO3A 4ZPTA 4EJ1C 2X2GA 3AFBA 4ZFOA 3M16A 4NQDB 3GLAA 3VWJC 3DHMA 1UD2A 4IJCA 1FHVA 2KHAA 4R3SA 3F5JA 2O9RA 1ZVHA 3LQAC 3UR8A 5C08D 2ZJSL 4Y16C 1XF5B 1NANH 4M62L 3S3SA 3A5VA 4Z3FA 3E2VA 5BS0B 1HXYA 4OCLC 2WUBH 3IVSA 2R9HD 4GNKB 3WKML 1GKQA 5FESA 1MREH 3ATFA 4G1NA 4JHUA 4LVFA 1AC6A 3F5KA 2GFBB 1I85C 2J43A 2DLHA 4EWJA 4I3SL 1XIJA 3IFLL 3BGMA 3EYFA 2CPUA 4NQQA 4OBSA 3MRKB 3B97A 4DUOA 1TVNA 1NAKH 1XCWA 4I3GA 4A68A 4E42B 2EABA 4O4YH 1DE6A 3GO2A 4OCWH 4NASA 4OGZA 5D71H 4Q4KA 4AQ1C 3HNSL 3VG0L 3SPJA 1XH3A 4ADIA 3CUHA 5C7XL 5F7MC 4YLBA 4P7OA 3OPSA 1M71B 2EXYC 3PP4H 5EIIG 5HGAB 3V6ZA 4Q97A 5CEZL 3DJTA 3GMPB 2FIQA 5C07E 4TUJA 4YWGL 3TBBA 2NY0B 4XTRC 1HH6A 4KZDL 2PDXA 3GZQA 4ODSL 1YNTB 5F4WA 3QG7L 1XGZA 5I82A 1LE5A 1TR1A 2PDFA 5E9DD 5SWUA 1N9PA 2JCCB 4Z7NE 4X2PA 2ZKHH 3P73B 4Q6IA 5IQLA 5E94B 1S7WB 2NQCA 4PTDA 5BOJA 1OV8A 4W6XB 3WD4A 3JWDL 3S5LG 4JFZH 3TROA 5FPIA 1VBUA 1ZHKA 2QPDB 3C6LC 4UINH 4U1SA 5I5RA 5DEZA 3LEXB 5FWQA 5FF7A 2HRLA 1R5IB 3ESUF 1E67A 3DMMA 3O6FB 4WJ5B 4D6JA 2NPLX 3NEVA 1G7JB 1Z1WA 2EDEA 3P30L 1FVCB 2ZKHL 2Z31A 5AALA 5D4JA 2IANB 4RE0A 3QCVH 5DT7A 4J3OG 5A8QA 4FQJH 3HG2A 2BLEA 2QV5A 3SCMD 3O6FC 1JZ5A 2WLKA 3MV9A 5FYLE 2GQAA 1UUSA 3SY0B 3DUUB 1GZJA 1UGKA 1A3LL 3TZVD 5FO7A 2YSSA 3GR7A 1M9HA 3JW7A 3NL3A 2C8NA 4HPOH 5C09D 5F72S 1Q94A 5DX7A 5HINA 2RFXA 4QLRA 1QOQA 4P4KA 1KPUA 4KHXH 1TWZA 4LDEB 1F73A 1YNLL 3UBXA 4MJ4A 1F9CA 2E1WA 2YPKB 2BVOA 1L2QA 4UR7A 4KY2A 4PJ5D 4UILH 5D7IB 3O2WH 1WOBA 4L56A 4E2BA 3QS2A 3BFOA 1L6XA 3LGGA 5KZEA 3G5ZA 2DTSA 2NQ3A 5EC1B 1BYAA 4ACYA 3FUJA 1E9OA 1TMQA 4I88A 2Q8AH 3UOAB 5C0EB 1A2YA 1X8FA 2ZPKH 2CLLA 2J71A 1IGJA 3U9WA 1IEXA 5JQIB 1RPQA 5KSAA 2W0FA 2BSSA 2R4SL 4WJXA 4C1NB 3JXAA 3W39A 2ODIA 4KK8D 1RR2A 2X6MA 3OKMB 2GSGB 4XE0A 1G4SA 1AOHA 2AL2B 4WK9A 4D2JA 4ZBJA 1XF3A 3V3WA 2QGHA 4OLZH 1JBJA 3GHRA 2BWDA 3DIVA 1L9QA 2BNUB 3QJOA 3QHFH 2YBRA 3QCUH 5E9DA 5ICXB 3LG3A 3LRLA 3PN8A 1AAJA 1EXGA 1MUMA 4ODTL 12E8H 1KLGB 2PYEE 3MJ6A 1IBGL 3Q8BA 4A2GA 4GRWH 5E8PA 2X4UB 1LORA 4HETA 4ZOEA 1YC8A 3JV0A 1JDEA 3HE7A 5C71A 3D30A 3R89A 3DOSA 4LLDA 1N64L 2O5YH 4FFZH 4XP1L 4ZFOB 1TCRA 1MI5D 3V5HA 2ENYA 1JZ7A 3DX3A 2XVPA 1DQJA 5BJTA 3MRLB 4ODSH 3UAAA 4NC1E 4U1JB 2AP2A 5LGKA 1UQYA 4IOIB 5T1LB 4WDUA 5BS0A 1V6YA 1JS4A 1HZHL 1TNMA 4KNTA 4H26B 3QFDB 3VWKD 5F1KC 3BKJL 4MWFB 2AHIA 2PI6A 4NXKA 4M6OH 1T2JA 4XG1A 3B2VL 1D8CA 1EEXA 3BJ91 5D2NE 2RGLA 2AQ2A 4NPYB 4O17A 2X5PA 2PLTA 3IBOA 4A6YH 3KUMA 2ODHA 3X3FL 2OV0A 3HN5A 3QZWG 2E5BA 3GPEA 1FFNB 3GEWB 2WXHA 4GT7A 4MPKA 1OAXH 3GBMH 3ECQA 5B3JE 2VUNA 2NY5C 5J9PA 1G4EA 3IEBA 2F7IA 2NY1B 2VDRB 2XUWA 1J7VR 1KJVB 1ICPA 1MHEA 4RE2A 2ZOUA 1NUFA 3GC2A 1WBZA 2OX5A 3VXOA 4L65A 4WW2F 5IRPA 4UYPA 2UY6B 3CH8A 3MNVA 5BRZA 1B3ZA 1O5PA 2EF9A 5L6UA 1E71M 4LUIA 3QH2A 3BPLB 5HNUA 3ARWA 1JXDA 1UC6A 2EACA 2QPFA 4PJAE 2PCEA 2WLLA 2Z0IA 1BQKA 2W91A 3UYPB 2FWOB 2HTLC 4H9YA 1FNAA 1MG3C 2KBGA 3LB6D 2GPTA 5GJNA 2E47A 2YBGA 2L8AA 4IIHA 4MKNA 4XN8A 2E6JA 1N2RA 3HRZC 5DXYA 1VPQA 1KT2B 2ADJB 2Y06H 1CBGA 3IJHA 5T3ZE 4P61A 3LQAL 4QP0A 4WDWA 5ABGA 3GDBA 2BZDA 3QO0B 2DEYX 3BVXA 5ABFB 4UIKL 5G4EA 2K4WA 4PJ5B 1SM9A 2H9GB 4ZJ9A 1XGQB 3KHDA 1X5JA 3V55A 3MODH 4NBZB 4UDUB 4AGOA 4ZR8A 4DGIH 4JKKA 2L7UA 2SEBA 1JGDB 1QLRA 1XJBA 3UAJD 3WXWL 2PTXA 1RIVL 2XJKA 1FHUA 2Y7QB 2PP9A 1U91B 1QO3A 3JTSB 4J1UB 4KKCD 1ZCRA 5HVHB 1EJOL 1FUYA 3LB0A 4ZMZA 2GJ6E 2Y23A 2J7DA 2H3NA 2RFXB 3STZB 3VTTA 3TIEA 4B9CA 3E3HA 4JN6A 3TO4D 2PO6C 3EYQC 1NCAL 3KVKA 2EIKB 5A2BA 2V5YA 2WZ5A 2DLFH 5TNVA 3FQWA 5HGDB 5FCSH 1YEIH 1NBZA 3CSPA 4UM9A 3RR1A 1KIRB 3V5FA 1YN7A 5KUKA 2CLVA 2QKIA 1WHOA 1XQKA 2OL3B 2D7OA 1J4EA 2PLMA 1FXQA 2FYYA 1CF8H 5DRWB 1TR9A 3LS9A 1UKTA 1ETZA 3IJ7A 1ACYL 4HIQA 5E1QA 2BSSB 5I0YA 2PR4H 1TPWA 3I02B 2H90A 3W1TA 4WD0A 1NEUA 4UQIM 3VFOA 4FQXC 4POYA 4PFHA 3TQ0A 2AGJL 2HPOA 3VXUD 5D09A 2YBUA 1T2QL 3BOVA 2SODB 3IDGB 3D4YA 3QA3A 1FZJB 4YUEH 5TE7H 2GJJA 5D7JC 3RVTD 5BZWB 1XYBA 2R14A 2BMKB 1SN5A 3KXFB 1RZQA 1JVNA 3CFCL 2QJGA 1S46A 4KJQC 4PP2A 3T44A 3CQQA 4OLYL 2I56A 1BXAA 1X96A 1PO9A 4F2TA 5DRCA 1PEWA 3T0WA 4YGVB 4LS2A 2VCBA 2HFFB 3WNLA 3SQLA 2OFQA 5J1AB 1SZNA 5DC2A 2R2CA 3OG6B 4JO4H 2XVLA 4AENA 4Q6IC 5LAPA 1NIFA 3GI8H 3FFCD 4PY8I 3ZKSD 2P3YA 1NFAA 3QHNA 3NIFF 4Z78A 5F7EH 3JRKA 1H7WA 2IOOA 4HJ0C 1WFJA 3RGVA 1BXNA 4S1RL 5EOQL 1E6NA 1TJHL 1U92A 4NI3A 1LEGB 3HBLA 2OXHB 2BOEX 3ABSA 2PXYB 4YO0A 3PZTA 5D2WA 1AA1B 3N6YA 3B8VA 4M1GL 4HIHA 1H60A 3ILDA 1A21A 1ZSDA 3RUGA 4UOW1 3V6OA 1HQTA 1P6BA 1S9WA 1U3HD 1CO1A 4C5ZA 5IW1A 2H47C 3BWUF 1ZEAH 1WDSA 1ECEA 2Y5JA 2W07A 3LCYA 2HP4A 5D1QC 3WQ4A 4OKVA 3P4NA 3VXOB 4YDKH 3L2LA 2PDCA 1FX6A 4QNWA 4Y1TA 1ZBCA 4ZW5A 1T2XA 1VC4A 3AFLA 2PCXA 4HUUB 2VN6A 3PWLA 3GJFB 5DD0L 3T2OA 5KN5B 5HYSB 1A5SA 1FFOA 4ALDA 2BY1A 5E0FA 2A73A 3JZEA 5GRWA 3RM4A 2WQSA 3F01A 4EUPG 4O0KA 4YIWA 2NMSA 5TH2A 3I9GL 3G6DL 5DHDA 4J7RA 4NM8L 3HB9A 5LXEA 1VERA 1WO2A 3TYUA 4L48A 4OQTH 4XZNX 1XBDA 4ZW3A 4EDWH 1VBRA 1NJ9B 3DFTA 2YWZA 3G6MA 3LN5A 4HD9A 3IYLW 4JRXA 1R19A 3T78A 1OARH 1UR0A 3HI6L 1O95A 4KRMB 2KMWA 3EEGA 1RZGB 3NCOA 4W1TA 1E6PA 4PJBE 4UDUA 4JIQA 1M01A 2YIHA 5GVJA 4B53A 3V0DA 3ME0A 1Q8MA 3IKCA 1S5NA 4ZODA 4XBEH 1JV2A 3QDJA 3CB3A 4JQ1A 4E3TA 2HZGA 1EBPA 3IGKA 1ORSA 2P42B 4EZJA 2EUVA 2R1KA 3RWFB 1T5WA 2EPOA 4ZGYA 5G4OA 3WLSA 1G0DA 4Z1YA 4BI5A 3ZQ9A 2LHAA 2NQ5A 4BF9A 1QJWA 3H4GA 2LLNA 5XIAA 4UM9D 1SW3A 4FFYH 4R7DB 2G2PA 3BDYL 5D93C 3VGEA 1E6JL 2VKXA 2L5HA 4IBLT 4N28A 3X1EA 2EG6A 4WV1C 3ZKND 1DUYB 4ABVA 5LA2A 1ETZB 3KRUA 1DLFH 3NK3A 5IHZB 2IVFC 3FQUA 3I02A 3LH2L 4DZBB 2Z35B 1BFVL 4E9VA 1NDYA 5FO8A 1HVXA 3B2UD 4P9ML 4JDBA 3GH7A 1FL3A 2R27A 4RDQG 2WV8A 2YUVA 1I2OA 2XY2A 4GRLB 1PDYA 3VSVA 4LYRA 3NFNA 4WK2B 4XZ4A 3BDXA 3V0TA 3VOGA 5D2NA 2WLHA 1CICC 1HTYA 3NSMA 3N91A 2SFPA 5DK0B 3LNEA 4KAQH 5DCDA 2V17H 3GLEA 1Q4NX 1IEHA 2IJ0C 3PFUA 4JFUA 4H8HA 1G7IB 5MKGB 3W75A 4P3DA 3H55A 1H0DB 3CVHH 1BZOA 5CPMA 2V5RA 2OYPA 3B83A 4UTCA 3DERA 3DYMA 4KJYB 3C2EA 5J11B 1E5YA 2PCYA 3ARBA 1UM4H 2IWFA 1XF4B 3IBEA 4GI9A 2D03H 4Z78B 5J06A 1XM3A 3EJSA 4X8JA 2NY2D 2LAGB 1NFIB 1HOEA 3HI1B 3MV8B 4QD2E 3LEYL 4QF1A 3RNQA 4LVNC 4DUWA 1A8ZA 1HYSC 1KV3A 2VO8A 1DFBL 2R4SH 4N6QA 3BGMB 4LEOB 3CL7A 3IUHA 4NQXA 3CDZA 4Z3HA 3G5XA 3I7RA 5T3XD 2F08A 3M6DA 1EJ6A 1ZTMA 3HVNA 1R30A 3VYNA 4JN2A 5D8JL 4XPFH 4FTVD 4E2OA 2EDHA 3EB2A 1OD0A 4M8QA 2G4EA 1UOVA 2YD9A 5B7YA 5LGYA 4I2XB 2J8UF 2HRHA 1T89C 4NKIH 1HINL 1O5DT 4OF8A 4YSSA 1GVFA 1S7WA 3TQVA 2VZUA 2A73B 2CKRA 4OGXL 4FMVA 4D0DA 2NOYA 2EKGA 4OZ4B 3W88A 2K6ZA 3POCA 4GBXB 3CDGB 2GEEA 3O2DA 4M8VA 2XJLA 3F83A 5CHNA 3N25A 4PGCA 4U1HB 2VDMH 3TN0D 1R5IA 1XHHA 3UW6A 4HSHA 4US5D 2PDGA 5BMWA 3NTYA 3LMZA 4OF6A 1U3YA 3QWQB 5IM7A 2XINA 1HSBB 3TYFA 3NDOA 5D2LA 5LBGA 3LN5B 4Y8DC 2PS2A 1E28B 1B30A 4DYJA 5JW5A 1W37A 3ANUA 2JI2A 1RU9L 4C59B 1UZ8A 4RV3A 5D04C 5GGVH 5IHLB 1ECYA 2KZWA 3IJIA 1ZS2A 3MV9E 4KK8C 3MUUA 5I30L 4YCPA 2B7OA 4NFDA 2YMXL 3CEUA 4K9EL 1QK2A 4H7CA 4O2CA 4ZQCA 1KFAL 2OM5A 3CXFA 5ISZD 3BK0A 1HXMB 1OSPH 3NL6A 2BS71 4RFNB 4H1LA 1I8JA 1MUWA 4LTSA 2Y63A 1A4CA 1Q9OA 2F6UA 4Z7UE 1XBVA 2AJUH 1FV1B 3HUJB 3GX9A 5BQDA 4GK8A 3M8OL 5J89A 4A04A 1VFUA 1BTMA 5AYYA 2Z8VC 3FT3A 1DVQA 5CFAA 2K9UA 1UT2A 2ZSWA 3RNKB 4A63A 4H8QA 4KWSA 2ZFAA 1XL4A 1CLYH 2XN0A 4DN4H 5SX5H 1OEPA 2EG8A 3N11A 5DFTA 1LWIA 2YL6A 4LVGA 5D71L 3L9YA 3MLVH 2NY6C 5DS1A 5DLLA 5EDSA 2Y85A 4PUDA 5CPTA 2X89A 3TBWA 2W67A 1MCOH 1UP0A 2DSUA 1IBYA 4YS4A 1EUNA 3F2DA 2EDLA 2VL5B 3BG9A 3PWNB 1YYMH 1XGRB 1O60A 1OZUA 1G1YA 3DIFA 4RR4A 4Z7WB 2D0GA 1BPVA 3VYLA 1T7LA 1RIHL 2LR4A 2G3IA 4Z1PA 4ZZ9A 5IJKC 3O7UA 2V2CA 5HI5C 3S2AA 4IPPA 1ES0A 1WFTA 1CWVA 3NQ7A 1IQDB 5H35A 2WBJC 4NKCA 3TAKA 1VADB 3NRFA 2J20A 2OJPA 3L6FA 4HT1H 4E9TA 4ES4A 4IRZL 1CF8L 1S9XA 3JZYA 3W0WD 3ZR5A 2DM4A 3K5XA 5ICUA 3SQSA 3QY6A 3TNNB 3SBWC 1CGYA 3N55A 4BDVB 1EJTC 3TT1L 3C09B 2QADB 3P74A 1NFIA 3HI1A 5F8QC 2BFVH 4MWFA 1K77A 4Q8MA 4F1SA 3FXYA 2GW5A 3VM7A 4A29A 1UB5B 3ARXA 2R59A 5FWRA 3MRBA 4FQ1H 4TS6A 4NPYA 5F9DC 3P5ZA 2OLSA 3BP7A 4ZEPA 5L88H 4U28A 4H01A 3WLRA 1QPOA 4UTKA 2AJYL 4PCPA 4HBCH 1XTLA 1T04B 1IBZA 3CIAA 4PS7A 2AXHA 2YXOA 4UTMA 2WUCH 3C6LD 5TDPA 3HV9A 3NQ2A 4LAUA 2CLPA 4TV6A 1CK0H 3OAZH 5CCJA 4ZTXA 4MJIE 3TO4C 1FIEA 1QT1A 2WP3T 5EZLB 2CKBA 3AS3A 3LQAH 1W5PA 3DX0A 3BMXA 3P3BA 3ARDA 1HHJA 2AJVH 1RV8A 3PVFA 3R58A 1KACB 2O6EA 3AXIA 4TQEL 4YXHH 4AY8A 3LCFA 5IW3A 4FIQA 4MTVA 4A3RA 3CLFH 3W7CA 5GRUL 3SDCB 1Q63A 2VAAB 1RLWA 3IRPX 3KHOA 4ACTA 3L4WA 2G3ZA 43CAA 1IGMH 3Q06A 4ZTYA 2QT3A 3U36B 4POUB 4ZSOA 1PYFA 1IUZA 3SGJA 4PJ8D 4XMKL 2FX8L 3MUZ1 3BGJA 3QO0A 1MWAB 1GG1A 5IDIA 1AD9A 2C14A 4BQ2A 4HOWA 1A3RH 1O1HA 5D1ZB 1E4MM 4B5XA 1FWCC 1DBAL 1EP1A 4FTDA 3KLKA 1ET5A 3LCGA 4L1TA 3KDPB 1DQQA 2YSTA 2YXWA 1Q1JH 3DTDA 4R0LB 3ZRCC 4JEQA 4CGTA 3V35A 2Q0ZX 1DJHA 4KPLA 4PS4L 2Y5TA 4P2OA 1JF1B 1BPLB 4KVPA 2PRMA 2NQHA 3E6FA 5CBBA 4U05A 3VC6A 2JKAA 1KNOA 3EYSH 4TUKL 2WW8A 2MNRA 3RLSA 4QJ3B 1XR9B 4KHTL 2OO6A 3G0UA 5EZJB 2ZSWB 3RNKA 4XX6A 5I6MA 3QSKB 4ZOAA 1YBQB 4AD2A 1JWUA 4PS8A 3MMTA 1ZVNA 5GSRB 2OWXA 2OL3A 4ZMWA 4XN1A 3FQRA 1YEJL 2A83B 2D2JA 2FYYB 4KVNL 1MW1A 3W28A 3UZEC 3ECUA 4I9JA 3C5SB 1HEZB 5DRZA 4F8PA 3TX4A 4MD0A 1SEQL 2GTZA 3B2XA 4HTYA 1N5AB 1O6SA 4QHNB 1JYNA 4IJTA 4DN1A 3N17A 4RIRB 4GY7A 1GPFA 2WBJA 4XKMA 3DI1A 2ZUNA 3HTLX 1MF2L 4Z7WA 1O6TA 2WVVB 3GSRA 4TPRL 2WSYA 3BWAA 4AMKL 2ZIDA 3OX8A 4AYFA 5HVFB 4JFVA 5CD5D 2AL1A 1VCGA 1OD9A 4B5WA 2WZAA 6FABH 4GGBA 2A74C 5BVPH 4S3FA 4HKPA 2HFFA 3ZM8A 2A9AA 4FKEA 3QQ1A 2VDOB 3KWUA 2CFFA 2OGYA 1YYLL 1BOGA 3HA0A 1HX0A 4IQHA 4ACPA 1FFPB 4K8RD 5IEHA 4PRNA 3OVQA 4X4XA 5BUPA 3U1PA 1PZCA 5CCKL 4YZFF 1HO1A 1LOQA 5EIVA 1UWXK 2VX5A 4R6UA 3G5VA 1LOSA 1XFBA 2WMFA 3UTSB 3MRNB 4DF0A 4XD6A 4YAQB 3PFMA 2PCFA 3KW8A 2AS5M 3WGUB 2EO7A 2EPNA 3WL9A 2FJSA 4G7EB 4HPGA 1BW8A 4XPGL 2J7EA 1F4YH 3FOMA 4YBLB 3B7SA 3ZWTA 3A67L 2HJPA 2E9IA 4NL1A 2FEEI 5CSBA 1FJ1B 2R9HC 1E6SM 3C6EA 3TZVB 4LCYA 1V8HA 4W9ZA 1VA9A 3ZUNC 3TDFA 4U6VH 2WQXA 5CU9A 2KLTA 3GJFA 5EZIL 3SCUA 3CUJA 1J1PH 3HQOA 1OSPL 2FTWA 1DQLH 2YAHA 2FPVA 5CNHA 2VRQA 1RZPA 4POZD 4OOUA 5DVLA 3OC8A 4HS8L 4P57B 1FE8H 4Q6YA 4ZUSB 4KRPD 4PFEA 3T1FB 3W0WE 1SR0A 4N0UA 5TH2B 4RQQB 1KULA 3TTEA 1H6UA 4OJFH 2VAAA 5AOLA 4C54A 3TPKA 1A7PH 1ZDSA 2QZRA 2VRKA 4I4WA 3V6OC 5FUOL 3A4DA 4KO9A 5ITFA 5DRXA 1EQWA 1SMOA 3D3VD 1MWAA 4L18A 1VZHA 3COOA 3LRGA 1M7XA 3H2PA 5E99H 3FU0A 5D1ZA 3CV5A 2YW4A 2QSCL 2C9PA 2Z7UA 3F12A 5D4HA 1VKXB 2QJHA 1NBQA 5L7XH 3PIQB 1VS1A 1LO0H 5KINA 4GW4A 4M8RA 4NO2B 2P3EA 4YHPB 1X98A 1AP2A 1U83A 1ZVSA 4TO8A 5BYWA 1PNCA 5JR1L 4Q7IA 5JOPD 3IJLA 5I3DA 2PTUA 2J88L 5DHEA 4ZK8A 3X14B 3EZ4A 3CQFA 3IWUA 2Q8BL 5D5MF 5EC2A 5IK3B 4WF7A 4FK9A 3VI3F 1FNFA 5HHXH 4YDMA 3WCYA 1LBLA 4BEQA 1OAZL 1I1AA 4AMXA 2E67A 1QLFA 2PPEA 5C7ZA 3TWYA 3NOYA 4YVPA 2PW1B 1QZNA 1GYCA 2HXAA 3R19A 3W73A 1TZIA 4P3CL 1H4PA 2I60L 3O6DA 1HILB 2FSDA 2YZ8A 4F7EA 5E51A 5KW9H 3NDYA 3TFKC 1VGKB 2UZYA 3IMRA 1C91A 1RSCA 1W54A 4XX1E 3SE3C 3S5OA 2XYBA 2R7EB 5ETUA 5DRZB 1KFLA 4LEXL 5DUBA 4WO4C 2DOCA 1XB8A 2JQZA 4PWGA 5LBSA 1U8KB 1V0LA 2CW6A 2GYIA 1OAQH 2MCG1 1R8LA 1PZAA 2F0CA 2ZKXA 3BYYA 4MQSB 4KZEH 3QAZB 3EO9H 2NUTA 1OOWA 1QRKA 1Y6KR 4TSBH 3B9KD 3OWEA 4F9LC 2OODA 4XPBH 3V0VB 4XMLH 2R15A 1HKIA 1TWIA 2V30A 4IPNB 4LANA 1D9KB 4D0BA 2YLHA 5AUMB 2CLRB 3DGGA 4Q2ZA 5G4HC 1L7TL 5FKPA 2X6CA 3LRKA 2EH7H 1FIGL 1E72M 4NCC2 3QQ9C 2J8UB 2OW6A 4PBVC 3SDXB 1B3WA 4A3QA 1MW0A 3DC0A 4AMWA 4WV1A 2YDQA 2OI9B 4AUYA 1QYGL 4X8JB 4EOWH 3U7AA 1XW8A 3EBVA 4K7YA 4JNYA 4A7TA 1YDYA 4UU9B 4ZNCD 1UR4A 2ESVE 2ROXA 1ZY9A 5KSAD 3VNZA 4BSVA 3QUYB 3EYPA 2IF7A 3BP4B 5DGQA 4M1RA 4W7VA 1F3RB 1X7SA 5J6GA 3W7HA 3DHFA 5IB4A 4C6JA 1JPKA 4EUPA 2K4AA 2G37A 3LEPA 3VOFA 3CSGA 3OODA 5CZTA 4E8CA 8XIAA 3VNKA 1J1PL 3G9AB 1NIEA 4L4TA 5IG7A 2CRYA 4OM1L 3V5DB 4UZGA 3UXKA 2EEBA 2OQJA 4TNVK 4NP7A 3B5GA 3LNPA 4HNUA 2P8BA 3A4FA 3RM8A 3TZVA 4LLUB 1XSKA 4HKZB 1G9NH 4I2XA 4ONHA 3OKKB 1SMDA 2G3XA 3QIUB 4JFFE 2D1ZA 5C09A 4V28A 5FECA 2QQKL 3KJ4B 4P57A 3H9YA 4YSCA 4WY0F 1AL8A 2D7QA 4PGCB 4U1HA 5SWZD 4B9GA 5B8CC 1JK9A 5MEND 3VKCA 1P6CA 5DD1L 3IGFA 4AV4A 2AQPA 2IAND 4YDVA 1T4KA 3PDOA 4R2GC 3ARGB 1W32A 4PJGE 3MLWL 4U1NA 2YL5A 1VFSA 1SBBA 1YHTA 4EAYA 4J2QA 1PNDA 3RFZA 3HBPA 1NC4D 4IBWA 1DQWA 4H8NA 1UZ8B 3CT2A 2ZE3A 4R4BA 3OGSA 1VGEL 3TN0B 5C3TA 4KT2A 5A6JA 4F8QA 5I09A 2JKJA 1LGVA 5F89A 1M4KA 4L3CA 3T4AA 3ITXA 1AQFA 2BCKB 3QIWD 3Q58A 2MCMA 4XTDA 1JSYA 1JZIA 1MFDL 3HFML 4W8BA 1MLBB 2NW3A 4UOZA 4AG4L 1VIZA 1Z69A 3I7SA 4OD3H 5DUPH 4Z1CA 2QR0B 5DD0H 1V10A 3DX9A 5FO2A 1MEXL 4XNMA 2Z93A 5D7HA 3UZEA 1PG7H 5AENA 4AMKH 1GHFH 1ME8A 4K68A 3MBED 2MCPL 3VDHA 4GFTB 4NX0A 1XRTA 2IPFA 2FJGB 3KRBA 3L13A 5F9AC 3BZJA 1EEPA 1BVZA 2Z0UA 3BUQA 2H8PB 3B2UC 4AYBA 4ERSH 3ABQA 2MCPH 2VM9A 3WIIH 5CUSH 1JDCA 3C75A 2ZWSA 3BOFA 2VC2L 2ACRA 5C0CA 2RH9A 1NOAA 5ETUB 3NQAA 1FQ0A 1OHQA 5A2IH 3O16A 3L7RA 4R90L 4QOKA 1UXWA 5EBLA 4C56B 1E4IA 1M68A 2EDOA 1XGRA 3HJ0A 1WJ3A 1JNNL 2B5IC 2BINA 2QTVA 4UWQB 5DFAA 2CZNA 1B5TA 4D2NA 3QIUC 2N59A 2NYZA 4X9BA 1FI8C 3QUML 4XODA 4AZ8A 4WK0B 1M3UA 3DUHA 3F4VA 2QELA 1MJJB 1UA6H 4JY6A 4EO5A 1CYGA 2VDNH 1TLMA 3D5OF 3Q13A 4WEBH 1VLXA 3RDTB 4WO4D 2V5JA 4DXKA 2BGNE 1CFTA 3ULVE 1UT1A 1ZA6A 2GGEA 4N9EA 1IQDA 5KYXA 2Z2AA 5AC8A 3OKNB 2B2XL 3ZU8A 2HH0L 3N85H 3RWHB 5IQNA 4Q9QH 5E9XA 3LCHA 5U4NA 4LCSA 1TV3A 5FKYA 1UJ3B 1WVZA 1ZLWH 3VFGL 3OQEA 4ELMF 3BPNC 2BSEA 2QQKH 3NA9H 4JM4H 2X12A 2X4TB 4AJWA 4ZB5A 4RW3A 2Z1WA 3BH8A 1ACXA 3H7BB 4KDVA 1HGYA 1NP0A 1A4JA 5I8OL 2E5EA 2BWGA 4BI7A 2FO8A 4UU9A 4BF5A 4LUTA 2FIKB 2J2ZA 5IHUH 3VFSB 3E96A 4LF2A 4MYXA 1RJLA 2X3AA 4IU3B 1E3XA 1WA3A 1KBLA 4NNAA 4FQIH 2A79A 3G5EA 2OZ8A 3WY4A 2WY3B 4P2OD 4XWOD 1CWYA 5IB4B 1SO6A 2IBBA 1TEFA 2FLIA 3HA1A 4F37K 4C6EA 3ZDWA 5J13C 3S4SA 5F4SA 3BKYH 4F7CB 4GBXC 1AMKA 4LHUA 1Q38A 4FLRA 3VFNA 1AGEA 4PMUA 3AW5A 3AS2A 3RPDA 1HJUA 3D4GA 3NZPA 4PB4A 3VD1A 1P6FA 3KPMB