1KGXA

Three dimensional structure analysis of the r195q variant of human pancreatic alpha amylase
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFQLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgxA01
2VX4A 2GJPA 3SUWA 3WFLA 3ARQA 1UD5A 4AD2A 1KXHA 3D5HA 4DM1A 3CZKA 4W8LA 1W1TA 1PZ2A 2ZUMA 1XYZA 4UFJA 2JFEX 1BGAA 2EPNA 4MB4A 1W9BM 3AZRA 4LYRA 2DT3A 1MFVA 3K8KA 4OBSA 1XD1A 4TVUA 3T2PA 3TOPA 2UY4A 4BF7A 4N0RA 4FLSA 2BS9A 3OBAA 3IAPA 1JF5A 2J7DA 4PTMA 1EIBA 2X0YA 3N12A 3S2CA 1HJWA 1CIUA 1KGUA 3L4XA 3BGAA 4LYPA 1JIBA 2UY5A 4H04A 2XSBA 3IGUA 1W3LA 3AHZA 1KR1A 3AS3A 2WW5A 4K68A 3KL3A 3EDDA 1W2PA 1WDSA 1E43A 3CHEA 3IJ7A 3PZQA 4LPCA 2VCBA 3VDAA 5JBDA 7CGTA 1KXQA 3M07A 2GJXA 2J7BA 2XUCA 3D4ZA 3W26A 4W7WA 2XPKA 1BYDA 5ECUA 4FNUA 4DUVA 4M8UA 1L8NA 1W3HA 3EMZA 1M7XA 1TA3A 4QCFA 1VBUA 3VD9A 2D0FA 2MANA 2XN0A 1NP2A 3MS8A 1E73M 3CUJA 2WMIA 4A4AA 2PI6A 5A94A 2PWGA 3EMCA 4LGXA 1KTBA 2WVSA 4GKLA 1QHOA 3A24A 3GNRA 4MAZA 4F9JA 7A3HA 1JFXA 4D6DA 1K9DA 1WDPA 1CXHA 2V3FA 3WEOA 2D0GA 4J3VA 2BXYA 2CETA 2EEXA 3VX1A 2PF0A 3VIFA 3UG3A 3F5KA 2OSWA 2WPGA 2QLYA 1NOFA 2CITA 5I0DA 2G8ZA 3IJ8A 3WF3A 1OIFA 1RD6A 4CVUA 3BUIA 1H2JA 4W87A 2CBJA 3ZT5A 2PC8A 3GXPA 2ALWA 3KLLA 4D6IA 3WFZA 2ZUUA 3NCOA 4TX8A 3BMWA 2F1AA 1E6XM 5A2CA 2Z1KA 4EAMA 2J79A 3AXIA 1PJ9A 1EHNA 1QNSA 5M03A 3AXXA 2CERA 4CUCA 1D3CA 2EQDA 1V0KA 4ZFMA 2XVKA 2QV4A 3ARRA 4LX4A 2WBGA 3ARVA 1UG6A 2XGBA 1KQZA 3M6DA 2VRKA 4QFUA 5LA2A 2YLAA 1OD8A 1UH3A 3FAWA 4TVCA 1UYQA 3WIJA 3D3AA 1B2YA 1VEMA 4EKJA 1WAWA 1UA3A 3WN6A 3PZUA 1E70M 2AMGA 1M04A 1HX0A 3L4VA 1R47A 4MB3A 4GO8A 4OUEA 1NH6A 3RM8A 4YHEA 5E09A 3B8SA 2WLYA 3VGBA 1GVYA 4AEEA 4H8UA 3RIKA 1UH4A 2O9OA 1QNPA 1V02E 5E70A 5TD4A 3GM8A 3W81A 3VUPA 1V6UA 1H1NA 2ZXDA 4M81A 3MI6A 2GK1B 5ABFA 1TQUA 1JL8A 3QGVA 1BHGA 1GQIA 2W62A 1BYBA 2YA2A 4RE2A 1DWAM 3BAYA 1MQQA 1SYTA 1WZLA 1L0PA 2GUYA 3AMKA 1KR0A 4JIEA 3HG2A 1J9YA 1KGXA 3DX2A 2F61A 5JIPA 4PBGA 4OZOA 3RO8A 2CIPA 1OT1A 4M82A 1JI2A 4P8XA 3B9DA 4M56A 3KL5A 1PX4A 3SCRA 3O2LA 4KGJA 4JKLA 1GHSA 4P8UA 1TQSA 2F7RA 4OGZA 1V3IA 2J7GA 4D71A 4GZEA 2Q8XA 1W2VA 5D9NA 2X2YA 4GO9A 1AMYA 3SCVA 1DWIM 3CHCA 4MNLA 5I24A 3WH9A 3OLIA 4HA1A 1E4MM 1KBBA 1QI0A 1WDRA 1V6XA 3ARUA 2Y2WA 1KWKA 4UZUA 4Z2HA 4B15A 3A22A 1JD9A 3CUHA 2ZX5A 3HG3A 3PBGA 1CTNA 2EO7A 1J0HA 4E8CA 3SCQA 1IV8A 4GXPA 1VB9A 2VVNA 2FHCA 3AHXA 4FNTA 3WY4A 1CLVA 1FP8A 2JEPA 3CC1A 4V27A 3VU2A 1QNOA 3BVVA 4LXFA 3PTKA 2E3ZA 5GNXA 4AZGA 3UG5A 3VMPA 2ESCA 5BRQA 3VO0A 1UHVA 4C7FA 5IHSA 4TTGA 5AYBA 3NSMA 5CGMA 1V6VA 3W38A 4Z2LA 2BV9A 2IGTA 2EJ1A 2WVUA 1ECEA 6A3HA 4B16A 1HJQA 4WSKA 3VM7A 4ATWA 3WF2A 3BLBA 5A8QA 4ACZA 1V3HA 3WDIA 5A6MA 4U2YA 1B9ZA 4J28A 5IHRA 2BVYA 3OLGA 1CENA 1UWIA 3HU7A 5BXPA 2GJRA 4NZFA 2F7QA 3BSHA 1XV8A 1BVNP 3NJ3A 3CZEA 5GNZA 1EQCA 2VL4A 4FNSA 4F79A 2OWCA 5E0FA 4W8BA 4XZWA 1EO7A 2J47A 1TZ7A 1ZL1A 4PSPA 1C92A 1HP5A 5E6YA 1JZ6A 4QP0A 1CXFA 5E1QA 1C7TA 3OGRA 3MUZ1 2DGAA 2RGLA 4PMDA 1SMAA 2VR5A 3HJEA 3WQ8A 1ZBCA 3VD7A 2EPKX 1DTUA 3T0AA 1G5AA 4MNMA 5CZKA 2FH6A 4IISA 3EJSA 2YFOA 1VIWA 1V02A 2D3NA 5ABHA 1HIZA 3SCNA 2YA1A 4E4PA 4WF7A 3ARPA 5DO8A 1E4NA 2WWCA 3AOFA 1Q6FA 4D6EA 2YBTA 1US3A 1HKMA 1X6LA 4W5UA 3CBWA 2WMFA 1UWRA 1GPFA 3PHAA 4UFMA 4AZ7A 4HU8A 4JFUA 1TCMA 3J7HA 4J27A 2XVGA 4JFVA 4CKQA 2DT1A 1QI3A 2WAGA 2WC3A 3AHVA 2EAEA 2J8GA 3A4WA 2BY2A 2HISA 5FOOA 2AOSA 5JUVA 2FYVA 1JYNA 4AZ6A 3AMLA 1K6AA 2C8NA 5BWFA 2J62A 5A2BA 1HJSA 1G9HA 3LX9A 1UA7A 3LXCA 1GJWA 3VSUA 2GJXB 1R87A 4DWSB 1TG7A 1JYWA 4M1RA 1U2YA 2VRQA 4AWEA 3GTNA 1OSEA 4F8XA 3K4AA 4YHGA 1UASA 2D20A 2VT0A 4D6CA 4UFHA 1E4LA 1PBGA 1VENA 4GI8A 1FP9A 1UQZA 3W82A 3OZPA 3TTSA 1H4PA 5CPQA 3VTRA 1J10A 1A47A 2WBKA 1ITCA 4Z2JA 3TV8A 4OKDA 5D8ZA 5EFFA 5HXMA 4FNPA 1EO5A 4IPNB 1B3ZA 2E9BA 5CQ1A 5DF0A 4WKFA 3VIJA 3VD4A 4TUFA 1HXKA 1Q4NX 1UWUA 1CEOA 2DPEA 3T2QA 3S6TA 1DP0A 3EDEA 4PEEA 1B3XA 1JF6A 1UKSA 1DHKA 1LWJA 3GXIA 4B9ZA 3SCPA 1Q6CA 1W1PA 2YL8A 2JIEA 3AYRA 3A21A 2WSPA 4MADA 2OW6A 4P8WA 2J7FA 3WDPP 1K9TA 2DH3A 1JZ5A 4ATDA 3WNLA 3WSUA 3WUBA 2B31A 2OWXA 2G3JA 2ZXAA 3DYMA 5AYIA 3DHUA 3A4AA 2DQXA 1NQ6A 3WBEA 1B1YA 3NSXA 1VFUA 2E0PA 2ZX9A 4V2XA 3DX1A 1M03A 4AZCB 1BF2A 1E5JA 4E8DA 2GVYA 4U5KA 2WC4A 3OB8A 3CTTA 2O92A 2VQTA 8CGTA 1GOOA 3WMCA 3VNYA 1KXVA 3T0DA 1RPKA 4F66A 3ZR6A 2ZXQA 3WY2A 4AXNA 3LRLA 2WK2A 4UOJA 3BUPA 5IFTA 3RCNA 1TQVA 2XN2A 4R27A 1JYXA 4NF7A 1OD0A 4J3WA 1H0IA 2G41A 4OBRA 1DWHM 3D50A 3WH7A 3EYPA 1BAGA 4P7RA 3N18A 1J0IA 1MW0A 2YL6A 2BNJA 5FL1A 4PCTA 4DWSC 4CD6A 3K8MA 2VJXA 3RJYA 3KE0A 3A5VA 1OM0A 3DX0A 2Y8KA 1QPKA 3BAXA 4QDMA 3AIBA 1OBAA 1US2A 5LYRA 3BAWA 1FA2A 4AEFA 2DT0A 1KCLA 5CXPA 2J7HA 4UQ9A 3BCFA 2VX6A 1E0VA 2G3NA 2YBUA 1ISWA 1BGGA 3W37A 4U31A 4M24A 1HKKA 1XCXA 3VD3A 3JUGA 3W24A 4JCLA 4IUGA 3BCDA 5BROA 3MANA 4EE9A 3DDGA 1OGGA 4PMQA 3LMYA 2ZUSA 3AJ7A 1H3GA 5I2UA 1EHAA 3SUSA 1J0KA 4X0VA 1B3VA 5A8MA 4DUXA 4AMCA 3CGTA 5EB8A 2WKGA 3CPUA 5FKYA 4YPJA 4HPHA 4AD5A 1FH9A 3GNOA 4ZXOA 2NW0A 2CBUA 5JBEA 4UQEA 5A6LA 4TXEA 3T08A 4MTVA 3ZT6A 3RMEA 1GOMA 1WZAA 3VIHA 1CGVA 2EXOA 4IPLA 1HVXA 2BHYA 2VURA 4AY1A 3GXFA 3WEMA 2JEQA 3LXBA 3UESA 2CEQA 1UD4A 1EDGA 4AZ5A 2XM1A 4PMUA 1V03A 2DSWA 3M7SA 1S46A 4WKAA 4ZEPA 1CXIA 5GQBA 2ZX7A 3LRMA 1UKPA 1DWJM 2XFFA 2YIHA 2VNCA 1HVQA 4HOWA 3LXAA 3S5YA 3CMJA 3N15A 1WO2A 3N17A 3UETA 1QWNA 1UKQA 5CPTA 1E0XA 3W29A 2XM2A 1QNQA 2JIWA 2GDVA 3GH7A 1O6IA 2CKRA 1K9FA 5I3DA 3WY3A 4BQ3A 5I5RA 1SR0A 2JE8A 1MW1A 4AZBA 2YA0A 5A8PA 4GZIA 2A3BA 1CXKA 2ZICA 2X2HA 2J25A 2WM0A 3GBEA 2J77A 5LA1A 2WMKA 4MAVA 2VRJA 3HG4A 2FHBA 4BQ2A 3CHDA 4PMYA 3G6LA 1NWTA 2BY3A 4P7QA 3WNPA 1N82A 4W85A 2VUYA 3MMWA 2FHFA 1R8LA 3D4YA 4MB5A 1YHTA 4GIAA 3KWXA 3WQWA 4U2ZA 5EMYA 1CWYA 3T09A 4M29A 1CBGA 5BRPA 1W32A 3RPMA 1BYCA 2DSKA 3BLPX 1IZKA 2WLZA 3ARSA 5E6ZA 2WMGA 1LLOA 4H8HA 3WUFA 1EQPA 1HJXA 3AROA 3BVXA 4FLOA 2PBOA 4GI9A 4Y7EA 5DMYA 4CGTA 2OW7A 3T2OA 4CCDA 1PPIA 4AIOA 1ESWA 5EBAA 1YQ2A 4WIWA 5IXEA 3AIQA 3MU7A 3IANA 3II1A 4XZBA 4PCSA 4UOZA 4D6GA 2J78A 3BUDA 4S3KA 1TUXA 3MMDA 1W9XA 1MXGA 4U5IA 3VGHA 2W4XA 2X0HA 1EGZA 3RM4A 3KZSA 4U33A 3VGGA 5JBFA 1ZJBA 2VMFA 2WB5A 3ZM8A 3NYDA 3PZMA 5CSYA 1E40A 1F4AA 4U3CA 1B0IA 1JDAA 2XIBA 1JNEA 4JL1A 3APGA 3ZR5A 3WELA 3ZOAA 5I6SA 3A6OA 1UD6A 5GNYA 3VIPA 3UERA 1FHLA 2XJ7A 3PZOA 1XC6A 2WHLA 4HA4A 2FGLA 4FNRA 4CU7A 3KLKA 1I1XA 3ZJ8A 2WVVB 3WL0A 1ZU8A 4AISA 1ZJAA 2ZX6A 4KRUA 4FK9A 1J12A 3CUIA 5C70A 3FN9A 1Z32X 1WPCA 2XYLA 3QOMA 5A8NA 3WD2A 4WSJA 3AI0A 2CESA 1V3LA 4AD1A 4NZCA 3VILA 5GPRA 2WHKA 2BFGA 2PBGA 2X8RA 2V5CA 1FFRA 3NDYA 3PZIA 5E9AA 2OYKA 1V0NA 3F5LA 4OIFA 1T0OA 4IM4A 3ALGA 5F7UA 1WCGA 1UH2A 3AHYA 4TOQA 4CU8A 4XB3A 5D8WA 5CLWA 1C90A 4BQ5A 3CZSA 4AD0A 5DFAA 2OYLA 4LQ1A 2OWWA 4KGLA 2VZVA 3RJXA 4ZE4A 3WNNA 1JDCA 3W0KA 1IT0A 3MV01 2FE0A 2VOTA 2PWEA 1AQHA 3GH4A 1DWFM 1O7AA 2VZUA 3LPFA 4YN5A 2VCAA 1Q6EA 1V3MA 3UEQA 4P8VA 3OLEA 3VIOA 3ZQ9A 1FHDA 4RE3A 1BTCA 1NWUA 1PEZA 2A3EA 1BG9A 1TQWA 4UFKA 1JDDA 1LL4A 5A2AA 2IXUA 4TTUA 1E72M 4UQDA 2NSXA 3GXDA 3CZNA 3ARYA 2JALA 5HDRA 3O9NA 3EJTA 4OOUA 5HBFA 4AMWA 4ZENA 1MFUA 1W91A 1JZ3A 2CNCA 2EPLX 1H09A 1TFVA 1E6QM 2EPMX 4AC1X 2GDUA 1V3KA 3PZNA 4CU6A 3SURA 3AS2A 1WE5A 3K46A 1NP0A 2V3EA 1CGUA 2BVDA 4AD3A 1CGXA 4AIEA 1EXPA 2CBIA 3BAIA 4PMXA 1UD3A 4Q22A 1UD2A 3BLKA 1QVBA 3VNZA 1HNYA 1H0GA 1C8YA 4GPNA 2CYGA 2ZWZA 1NOWA 2D3LA 4L4OA 1OT2A 1PAMA 5CLTA 3T0BA 1TQTA 1GQKA 4D1IA 3ALFA 1NM9A 3D52A 3A23A 2VVSA 1HTYA 2J4GA 4RE4A 3VGFA 4AMXA 1UWSA 3LPGA 1JAKA 1QWUA 3WF1A 3L2MA 2EACA 3AHTA 3VM5A 1ZBVA 3DC0A 3A4XA 2VX7A 2VO5A 3BXWA 3ZSTA 4PMNA 1ISXA 5BCAA 3VIGA 4EANA 3VMNA 4GINA 1XSJA 4HP5A 4AZHA 1K9EA 1HT6A 1CNVA 4HTYA 5AC5A 4CCEA 1CXEA 1SZNA 3L2LA 3MUIA 2RGMA 4GQQA 3L4YA 4HZ7A 3BMVA 3IJ9A 1HJUA 1M01A 4UZSA 3WD1A 3WNKA 3WENA 3W4RA 1C93A 3W6MA 3DDFA 3VDCA 2X2IA 2DEPA 1GCYA 2WANA 3LRKA 4UOQA 3ARTA 3AXHA 4PMZA 1E6RA 3SCOA 1XGZA 3MMUA 3EJPA 1VFFA 3CHFA 2ZIDA 2W92A 2ZXBA 2GFTA 2XVNA 2XVPA 1VEOA 1BPLB 1TA3B 5JIWA 2W63A 1GZJA 3OA5A 1E6SM 3AMCA 1ZBWA 3TA9A 1CECA 2UY2A 2WMIB 2PWDA 1E55A 2WHJA 1GORA 4FLQA 2WSKA 2WHMA 4HOZA 1GHRA 2V5DA 1W3KA 3CO4A 1JG9A 3F4VA 3WD0A 2GK1A 4PMVA 1XYFA 3L4TA 4PYSA 1UKTA 3ECQA 3A47A 1ISVA 5A95A 3VKKA 5AY7A 1VRXA 2ZUNA 1NOUA 3KEHA 4JKMA 4JFTA 4JKKA 4Q7NA 1BYAA 2VX5A 1E15A 1W9PA 2F2HA 2E8YA 2WZIA 9CGTA 2G3MA 1MWOA 3I3DA 4MPKA 1KBKA 2EADA 1EDQA 1R86A 1J01A 4DO6A 3EMQA 1CGYA 1W3JA 2IXVA 5DT7A 2V38A 4H41A 4GZJA 2XFRA 2O9PA 4KWUA 4QAWA 1H49A 1OGBA 1UR2A 3AIRA 2WC7A 5M17A 3SCWA 4BQ4A 2YFNA 3M46A 4JHOA 4MJ2A 1WKYA 1HP4A 3WQVA 1G94A 3ARWA 2WCSA 4PTWA 3F5JA 1ZS2A 1CYGA 1JNDA 1MQRA 2WYSA 1QHZA 1KFWA 4A3HA 2F7OA 3BVWA 2E9MA 1QX1A 1UR1A 3NSNA 2CBVA 4WLCA 4URIA 4PUDA 5EFDA 2BXZA 3OZOA 5A6BA 1V0LA 5M5DA 4AIUA 3OLDA 3L4ZA 2D23A 2VZOA 3AYSA 4CD4A 1R46A 1LF1A 1B3WA 5A8OA 2V3GA 5BXTA 1DEDA 2NT1A 3RM9A 3AZTA 2Y4SA 2VI0A 1UD8A 4KH2A 4C7GA 4D1JA 2IUZA 3WDRA 5CSUA 2F18A 3ZIZA 3WBAA 4CCCA 1Q6DA 4PMRA 5AC4A 3WDJA 5D9MA 3GYCA 1W1VA 3WQ4A 5ABFB 3FHAA 2PWFA 1KXTA 4CVWA 1J0ZA 1WZKA 2DSVA 3WDHA 1QHPA 5CGTA 1J18A 1E0WA 3G6MA 3U5YA 2WKLA 4FLRA 4UTFA 2W5FA 2YDRA 3A3HA 3GXNA 1GOIA 1CZ1A 4Z2GA 4FMVA 1BG4A 1VF8A 2DIJA 4NXSA 4NZJA 5CPSA 3POHA 3W28A 4WK9A 4Z2KA 1NWRA 4CD5A 4FF5A 3VDBA 1UZ1A 1VFMA 4UFIA 4B3KA 3E1F1 2ZUVA 3N1AA 3BH4A 3BVUA 4B3LA 3CUFA 3UR8A 1NWSA 4L4PA 3WH5A 1MQPA 2W67A 4H7VA 4HPGA 1P6WA 1C91A 4HZ6A 4A3YA 3BUBA 1W9DM 1PS3A 2J7EA 1E9LA 4W84A 5A6JA 2CHOA 5BYWA 2WZEA 4W88A 1V6YA 4RL3A 4W7UA 3VX0A 1GVIA 1C8XA 4HMDA 3BAKA 2W66A 4JHZA 3QOKA 3K1DA 1VEPA 3ZJ6A 5DEZA 1QNRA 4W8AA 3UR7A 4N42A 4U3AA 2ZWYA 1X6NA 5E0CA 1W9UA 1ZBKA 4BA0A 3BUQA 3WUEA 1HF6A 1LJYA 4HA3A 1MW2A 4JFWA 3SUVA 4PRWA 1VJZA 1UUQA 1LL7A 3S5ZA 1EOMA 4W93A 1HL8A 1UOKA 1XSIA 2F1BA 1EH9A 3U7BA 4H2CA 3B9AA 4J3XA 2X1IA 4Z2IA 3IAQA 3GXMA 4PTVA 2QMKA 2DDXA 2E8ZA 2VC9A 3FXYA 4ACZB 2XWDA 4D6HA 3EDFA 1LL6A 1HJVA 3DYOA 2A3AA 4DWSA 2CXGA 4NRSA 2D2OA 1QBBA 3DX3A 1E3XA 1M53A 2DH2A 2XSAA 3CIVA 3VGEA 3AMGA 4UQCA 1FFQA 1V6WA 4GQRA 1OGSA 1XH2A 5BXSA 1G0CA 1O7DC 2W91A 3N13A 2XTKA 4QLKA 2YKKA 4QLLA 2QPUA 2VR4A 4W86A 1CGTA 2FGZA 2Y24A 4PUEA 2EPOA 4AZIA 1XH1A 3SEPA 3SUUA 3BAJA 4MDOA 5ABEA 1LQ0A 3SUTA 4CN4A 3H54A 1OCQA 3AIEA 2YL9A 1RP9A 3NIYA 1OINA 2OYMA 3H55A 3CV5A 4JZ5A 1EOKA 1B90A 4NSBA 3OGSA 1J11A 3TTYA 1UR8A 2DSZA 3WNMA 2F7PA 4NX0A 1JI1A 3ZT7A 2HVMA 4UR9A 5DT5A 1KTCA 3QR3A 3ZO9A 5IDIA 5I79A 3SCSA 3VIIA 4KMQA 2J8FA 5M3WA 1E4IA 2ZE0A 5HPOA 3DHPA 3WNOA 2VTFA 2AAAA 5ABGA 1GUVA 2OSXA 1UWQA 1AVAA 3CZJA 4NI3A 3PTMA 5HPCA 4B9YA 1H5VA 4C7DA 4DM2A 1QBAA 3WEZA 1BQCA 3MV11 1CPUA 2WMHA 1HWWA 4JCMA 4AZCA 3W6LA 4OOZA 3KL0A 3VVGA 1I1WA 4DO5A 1W1YA 1XH0A 3ZJKA 3PZVA 1FH8A 2D1ZA 3H53A 4AYGA 1ISZA 2OSYA 2UY3A 3AISA 1XSKA 1V08A 4LYQA 1ODUA 2WNWA 3U57A 3WMBA 4NXKA 1E3ZA 2NT0A 4H8VA 1Q6GA 5CJ5A 2XGIA 2XN1A 3MO4A 2D0HA 1UQYA 3ZJ7A 2C7FA 3AMDA 1XD0A 2WZHA 3HMCA 4ML4A 3WF0A 1JZ2A 1PIGA 5A6AA 2G4FA 2WVTA 1GQJA 4ZXLA 2W61A 1PZ3A 1B3YA 1I75A 2VQUA 1R34A 4DO4A 2DT2A 3VOCA 3HN3A 4MB1A 4F9DA 2E4TA 3ARXA 1JFHA 1B31A 3WDQA 5HOSA 2GSJA 5A69A 4AW7A 1BSIA 3GNPA 3AIUA 2D73A 3FAXA 1XCWA 5D9OA 3I3EA 1Y7VA 1W9VA 2ZUTA 1CDGA 3MKKA 3QHNA 4QCEA 3BSGA 4JL2A 2F8QA 1VJSA 3MSDA 5FIPA 1WP6A 2BHUA 3W27A 3EJQA 1BLIA 5D9PA 1R33A 3EJRA 4W7VA 1E1FA 3ZMRA 2XWEA 2E9LA 3SIMA 4D72A 2YOCA 3VINA 3CZGA 1RP8A 3EJUA 3VGDA 1HKIA 2PB1A 1ISYA 1H41A 4UQBA 1TR1A 5A6BD 1NARA 1QW9A 1JYVA 1GOQA 4W89A 1CGWA 4MDPA 2E40A 1ODZA 1JXJA 4J7RA 1PX3A 3QHMA 1EA9C 1R75A 5FL0A 3VSVA 4MNJA 1WB0A 4MJ4A 2CPUA 4D6FA 4ZE5A 2V3DA 2VZTA 2VCCA 2X2JA 5HNNA 5KZ6A 1KWGA 1TVNA 1UWTA 4PSRA 3IK2A 1UR9A 3K8LA 3L4WA 3DECA 3VIKA 1FOBA 3GH5A 1CLXA 2XFYA 1C8QA 1AQMA 2ZX8A 2G3IA 2XG9A 3GDBA 2JF6A 2PWHA 4UNIA 1CXLA 3AS0A 1UR4A 3THDA 4CD8A 3VSTA 1PX8A 1JD7A 2Z1SA 3WD3A 1HN1A 5I77A 1OB0A 2FH8A 1V0MA 1U30A 2EABA 1GOWA 1WDQA 1PIFA 3FW6A 3WY1A 1IZJA 2QPSA 3WUGA 3VD5A 1KQYA 3N11A 1AQ0A 4UQAA 4E2OA 3W25A 4CN6A 3PN8A 3WKZA 1MXDA 3WQ6A 1R7OA 1QI5A 3GBDA 2A3CA 4J3TA 3AIVA 3TP4A 2CCRA 5C71A 2BHZA 5I78A 4CD7A 1OIMA 3AICA 4BCEA 4HMEA 1E6ZA 1XRVA 3PZ9A 1VBRA 1C7SA 1E1EA 3O6AA 1A3HA 4AD4A 1LG2A 3WMSA 1GQLA 4OJYA 6CGTA 5CG0A 4WJXA 4M80A 2O9TA 1MYRA 2WWDA 4P7OA 1VAHA 3AFBA 4XX6A 3FY1A 4CN1A 2FDMA 4ACYA 3GXTA 3TTOA 1HKJA 3NDZA 3ARZA 1WZMA 1GJUA 3ZSSA 1QOXA 5C8BB 2Y5EA 6TAAA 1E71M 4R5EA 2XIIA 1F4HA 3TTQA 4UCFA 2CHNA 3VMOA 4PN2A 2A3HA 4TX6A 4JFSA 2QMJA 7TAAA 5A6KA 2BY1A 2J7CA 2Y8VA 3WQ5A 3BC9A 2WCGA 3L4UA 4HOXA 3N9KA 4DWSD 5KEZA 4GI6A 1E5NA 3FHQA 2X09A 1E6PA 3TONA 3UG4A 4BS0A 2VZSA 1UKOA 1G1YA 3VPLA 2YJQA 4ATLA 1FH7A 4W5ZA 1JGIA 3AS1A 2J75A 3OG2A 1QW8A 1JZ4A 8A3HA 2DSUA 1QI4A 1LWHA 4V28A 4X9YA 1H11A 1UR0A 2YDQA 3EDJA 2O9RA 2WMJA 4DUWA 5FCZA 5A1AA 1R85A 4EK7A 3DYPA 3VIMA 4KRTA 2QF8A 3AZSA 3MUY1 3QHOA 3CUGA 2D24A 4X0NA 3EDKA 2WVVA 1TMQA 4BZYA 4XUYA 1UZ4A 1U33A 3W53A 1WNOA 1JAEA 1E56A 2XHYA 3THCA 1J0YA 3WL1A 4S3JA 2OLHA 2DIEA 3MUAA 4J3SA 3HG5A 2BY0A 3CLWA 3HZ3A 3D51A 2EBNA 4P7LA 1X1NA 2YDSA 4XV0A 1JZ7A 3U7VA 2YL5A 5IFPA 1VFOA 4NRRA 2QHAA 3K4DA 1KB3A 4P7NA 1HXJA 4MNKA 1BFNA 3UCQA 3WF4A 3LPPA 3VDHA 1JZ8A 3SCUA 3GZAA 3MSGA 2WXDM 1LG1A 3OGVA 2ZUWA 1GOKA 3BVTA 5LA0A 2WCAA 3FNDA 3N04A 4J3UA 1XHGA 1HL9A 5D4YA 1D7FA 2CKSA 1E6NA 2XVLA 1D2KA 1V3JA 3NUKA 1JXKA 1ITXA 5A6SA 3EBVA 5A3HA 1MW3A 1BVZA 3POCA 3B9EA 4UFLA 4HU0A 2J74A 1KGWA 1SFSA 3PTQA 2TAAA 3I3BA 3WH8A 4HMCA 3PZTA 2D22A 1MVYA 4D6JA 4QLJA 1TVPA 4AYSA 4WKHA 5I23A 1SMDA 1RH9A 4HZ8A 5FD0A 1OWQA 3RDKA 4PTXA 1KCKA 3DX4A 2JF7A 4JAWA 2ZOXA 3RILA 4FNQA 2BVTA 3U5UA 1GW1A 1ZB5A 3WH6A 3CMGA 3CZ8A 1C3FA 5BXRA 1EDTA 1GONA 1J0JA 1R7AA 3AQUA 1G01A 3CH9A 2C0HA 3PZGA 1TE1A 3OIHA 4TVDA 1GNXA 1DWGM 3AIWA 2UWFA 3CZLA 3LPOA 1B30A 1QI2A 2X05A 3WD4A 2YLLA 4PMOA 3SCTA
chains in the Genus database with same CATH superfamily
3RVWC 3TO2B 4JHAH 2Q8BL 5AKSA 5DD0H 1ANUA 1Z89A 2R23A 4WFGD 3GS4A 1HILB 2ZUMA 4BRVA 4LYRA 2OX5B 1RFDH 4MPQA 4JAMA 2ADFL 2EH8H 4QTFA 3QUYC 1MFMA 2VFIA 3DK0A 2A74C 1EIBA 5JPNA 2X0YA 3S2CA 3TJEH 1OIOA 2DORA 3M8OH 2GHWB 4U1LB 2XH7A 3VDAA 3OMIB 4YFLF 2YDAA 3ZUNC 5HPMB 2Y7GA 3FT2B 1CU4L 2Z6IA 3S6CA 4HWNA 3BCJA 3NYZA 3T8XA 5A2LH 4MAUL 4YHYC 4GKZB 1F61A 4FFWC 1VBGA 2ZUQB 5D33A 4H1ZA 3ID7A 3APNA 2HKFH 3FUIA 1K9DA 3FZUC 3L5XH 4F15B 3LKRB 5T5FA 3W7PA 2CETA 3TL5A 2QQNL 4XAPA 1X7QA 3ML8A 1KEGL 1XHHA 4P4KB 1ML0A 1P1ZB 3TJXA 3BUIA 1HZHL 3WMLA 3IF1B 2ALWA 3F7YB 3I2CL 3S88L 2Y7DA 4KPHL 2PURA 3B1TA 4EPBC 1N8IA 1HXMA 5FUZL 5C09D 4FOKA 1OPOA 1S9WA 5K9JH 3DLQR 2CG9X 2VRKA 4CNTA 4FXKA 2YK1H 4ZBCA 4O4YH 3KZ8A 1M04A 3GNNA 1EDYA 1SSDA 3NMEA 4XVEA 5F9DC 1FY6A 5IHUH 1GGIL 3B3BA 2IQ0A 4DJFC 4AEEA 4KVNH 2CHXA 2DV6A 2O9OA 2RAMA 2OTPA 2DD8L 5FDWA 1X9RA 2VKZG 3HC3H 5TE6L 2QGYA 3MGOB 5ABFA 3UZVB 1GQIA 1AKJD 4ELKB 4XX5A 1KIPA 3UYPB 3KJ6H 4Z3EA 4IMLB 3VFTB 1BVLA 4Q89A 1LEIA 2VAJA 4V1DB 3F03K 1R3LB 5DJ2A 1ZA3B 2O5YH 3EHBB 4IBYA 3WJMB 2ZUQC 1MUJB 3KCJA 5B7ZA 5DMGC 3FVDA 2V9DA 4CNUA 4FABH 2X89D 4WXZA 5DK3A 3DTUB 4F15C 1KBBA 3FT0A 4UZUA 5EH1A 4K8GA 3A22A 1XF4B 5IOKA 4P4KC 5BUPA 3QDJB 2FHCA 1FWGC 2YCLB 3A0OA 4PGJA 3BLEA 3M0MA 3BKYH 4OU1A 1GPWA 4M5YH 5CZXC 2QJIA 2INEA 3PTKA 4KHTL 4AZGA 2LVEA 1UUSA 4AZUA 4X63A 4G8IA 1KXTB 4OU3A 2YPLE 5ITBH 2QZRA 1HJQA 5B4MC 1OF2A 4PRPD 1UMYA 1A2YB 4ONFH 1LE5A 5F7AA 5GJNA 2A0NA 5BXPA 1T1YA 2INZA 2FJUB 4PJGB 4JY4A 4ANWA 3VH8G 4GSDL 4B5UA 2FBRA 2VL4A 4IG2A 1SJAA 2EXWD 2WUBH 1ZL1A 4ODUB 3QZLA 2CBTA 4PPTA 4HV8B 2A1WH 3UPBA 3CVHA 4FEZA 1F5WA 3DG6A 3UPCA 1DL3A 4L1XA 5D7IE 3KMDA 4GXUM 1F4YL 3CBJB 3EHBC 4MY1A 2I5GA 2Y3NA 3RX7A 3F7VA 1HSBA 3KNBB 4RDYA 4F9LC 1A4BA 3OR7B 3QFJD 4ZAKB 2EC9T 3ZKQD 4QOKD 4F8QA 1JYNA 4PRTA 5ESQB 5BWFA 4YDMA 3PQYA 3FFSA 3SN4A 3VSUA 5HI4C 4MBRA 4Z3GA 4LYKA 1JYWA 4M1RA 1PJWA 1OVZA 3U1PA 1XGYL 4KERA 3L65A 4X7TA 3MLTA 1DQWA 1PBGA 3WKQA 3ILPA 2X4OB 4GSXA 3VTRA 2XZ9A 4MQTB 2X40A 3LBOA 2PDQA 1DQTA 1F2JA 3ZZ1A 3WLTA 1J1XL 5D1ZD 2B4GA 2H8ZA 4CC1A 5D5MA 1TWSA 2EINB 3FOMB 4G8TA 3ROLA 5BZDB 1F3XA 3PRZA 1UZ8A 4ZD3L 4PJ5B 5D2LE 1F4WL 4B9ZA 2FL5B 4E0RB 3RX3A 1H7RA 4YGVA 4MADA 1DUYA 2OQLA 1AD1A 3WDPP 4MNHB 4DEPB 3VQ2C 2R83A 1D3GA 4FAAB 2ZXAA 1NEZA 1NQ6A 3BUTA 4G3YH 3STLB 5I15L 3AW5A 3MRQA 4C47A 1BLNA 4AZCB 1BF2A 4PUBL 1EJOL 4IP7A 4LDLB 4PWIA 4KKBD 2F5BH 1OK6A 4PVMA 2ZOLB 4HDIB 4FX8A 4G6KL 1WUZA 5CJ8A 4UMGA 3DX7B 4ZAKC 4OD2A 4YDJB 1ZP3A 2XXMB 1N2RA 3HHSA 4S1DC 3MI3A 4DB7A 3N9GH 4EOWL 4OWGA 3JTBA 1A6UL 2DT0A 3CV2A 3BCFA 4M03A 2EIKB 3PP3K 3QXDB 2YBUA 1ISWA 2GVGA 5DLCA 2F53E 3C8NA 4UTTA 4XCYB 4B9IA 3KPSE 3VXNA 2YGNA 3TNBA 3N85H 1OGGA 2F58L 4RV8A 1F8TH 3WIHL 2HRGA 3E38A 3P4NA 4WTWA 1N3NA 3N4FA 4HNCA 1N7KA 3T08A 4MTVA 4FXGA 5JIIA 2EIZA 3P82A 3KS5A 4H4IA 3GVVA 3CFCH 3OVRA 4G8EA 2VNCA 2F2KA 1FFTB 1YKWA 3M5YA 3PFMA 4KIEA 2C1PA 3UETA 4GJJA 2OMTB 3W0WA 2UYLA 4A21A 4JRYA 3M44A 3QAZB 5FX3A 4N2EA 3HC0A 3RTQB 1ZT4A 5DEFA 2CKRA 5I3DA 3GFZA 1G6RL 3NOIA 1G4SA 4H0IA 3QDMB 5DMKA 4KDTA 3PF2A 1XIWD 1KPVB 5AHFA 3K6SA 5CIPA 4P7QA 3EG9B 3HQNA 3F83A 2AQPA 1BBJA 5DD1L 3W1AA 2NSOA 1NGWB 3KXQA 3DFNA 1ES0B 2B7DT 3B0VC 1RUKH 2A6DB 1FC1A 3GLDA 3PYCA 1O9VA 1NAMA 2CJUH 3RN6A 5AQ0A 2BOCB 2ADYA 3R58A 2E5BA 4ZUVA 4DHLA 3EYVA 3GSUA 4PL1A 5KSBA 3WFBL 2OP4H 1XINA 4OZGB 3TPKA 4U33A 2FFCA 4F0LA 5JHDB 5EU6D 4KNTA 3LHPH 2QADD 3SB3A 3HPZA 3WUWG 3J27A 4PCNA 2X4PB 5K1JA 3LNHA 3MRDB 1Z32X 3WHXB 3QAZC 1JN6A 1I1YA 3RTQC 5GPRA 3FO2B 3B0XA 3B7TA 1YY9C 3BZFB 3NIDF 4DFIA 2OT0A 4C83A 1OX4B 5D4HA 2XRAH 4CU8A 5F1NA 1W8GA 3IJEA 1OAKL 4FJYA 4X5XB 3RUGB 2OQYA 4AYFA 3MV01 4PTUB 5HULA 2BOBB 5J9PA 2AVGA 4OZIB 3LZ3A 4FFZL 4S3GA 1BQHA 4YLCA 2NSXA 5HBFA 1XGTB 3E02A 5IHZA 1YDNA 3KYMB 2W6RA 3PJTA 1UEMA 2W9EH 1JNHA 4Z3FA 4XE5B 2X5PA 5F1OB 1LMIA 3IEAA 1TT6A 3TWYA 1S5VA 5HUOA 1AOZA 1F07A 3T77A 4GPNA 3UZEA 1OT2A 3LN4A 1GWJA 3C8HA 1JCYA 1CD1B 4ZXBA 4DP4X 1KFJA 3L2MA 2EACA 3KPMB 3G6JA 1A22B 1U3JA 3IRPX 4ZYKA 4IJRA 2BSED 5BCAA 1XGQA 4ZL1A 5ILTL 4HNTA 1EAJA 1IGJB 3UZZA 3BFQG 3MJ7B 1ADQH 4UAOB 4BFRA 2WTRB 4RNRA 4HZ7A 3NQBA 1FCUA 4L4TD 3DDFA 4WNQA 3QFDA 4PMZA 4V11A 4AWJC 1ITUA 3ESMA 3KPTA 4IHOB 3M17B 1P0BA 1E6SM 1BJ1J 4EPSA 3IFLH 1RZFL 3F64A 2VAAA 1GHRA 3CO4A 5GS0L 5IQ9B 1RBLA 1SSGA 2WWKT 4IJTA 3AWOA 3DMMD 5L8KB 4JKKA 5JH1A 5EOCL 3VFNB 1ORSA 4XR8C 2Y0FA 2ZAIA 1W3TA 2BGNE 1GOHA 4GKSB 2WWMC 5DEGA 4BQ4A 1WXJA 3B03A 1SFHA 8PAZA 3ARWA 2CFFA 5IW1B 2E4FA 1QHZA 1U8HB 1UR1A 3F2DA 3STGA 4RNIA 5EMLA 1FDZA 3A9IA 3GIZH 4X4YB 5HYSA 1H3WM 1PKQE 3SI9A 2VGLM 2EE6A 1I2OA 2D23A 4JCWA 1ZHKA 2Z7KA 1H6TA 5T3XE 1B3WA 1Q6RA 3SPVB 5CJBA 2IUZA 5CSUA 2OKOA 2IH3B 5INCA 3N0AA 4X4ME 2FVKA 1W1VA 2YS4A 4NPKA 1WEJH 4G43B 4AHQA 3U5YA 2WKLA 1OQOA 3N3EA 2FT7A 1DHPA 4MJHA 4KEZA 2V2XB 5I1CL 1CFSB 1ZAIA 3W28A 1R6VA 4P4RB 5AZEH 1QBLL 4KO5A 2HNHA 3BEVA 1C8PA 2ATAA 2MPVA 3BUYB 4QE5A 3WH5A 3FT4B 3NEHA 3GG7A 2ZP8A 4ZQCA 2AJ3A 3RNDA 3EUDA 5ALBH 2F6AA 4KVCL 4OBTA 1IKFH 2UZIL 4LHUB 3DWTA 4L3CA 1JPDX 2ATKA 1L3NA 4PS3A 2CLHA 2PGWA 4LDCA 4N42A 2IKIA 4NO3A 1BZ9A 1E4HA 3HS8A 4HUVA 5DCBA 1WCBB 2F08A 4KUZH 4JFWA 1NCDH 4H25A 2V5YA 3FU5A 2R0ZH 2ABBA 3D2UB 4WW2A 2EDOA 4ACZB 3RY6A 3WBWA 1X4XA 3EFOA 5AVVB 4KXZH 1JF1B 4BUHA 4Z7QE 5G2HA 4CGUB 1KFKA 1XG4A 2HLFD 3GS6A 3QEQB 1IXPA 2AEIT 3WGUB 5MEOA 1KRAC 4I18A 3RWGA 2C9PA 5KSUB 4F7TA 2A99A 1NC2A 4MDOA 3DX8A 4L61A 3AIEA 4NLAA 3FYYA 4UTWA 3EXTA 1EOKA 4P5MA 4UR9A 1UT2A 1U42A 1N70A 2P10A 1T21A 2EDQA 4Y5YA 3FU7B 4US5A 1KPRA 2J8FA 4Q9BA 4OFYA 4TUOB 1GYNA 4QTHA 2AAAA 4W9FC 4UTBL 3NK4A 2HXAA 3E0IA 1SN2A 4GVIA 4P2AA 2B08A 3FCPA 2FSEA 2AI0H 3KL0A 3GDKA 1ZMYA 1XH0A 1RALA 2Z4QB 1Q6LA 5JHLA 3AISA 4GFXA 1AGCA 3FTSA 1E4WL 1ODUA 4LB8A 3UDWA 3OBKA 3U2CA 4AC4A 3O2DH 3VAVA 1G7HA 3AMDA 2UWEE 3CK5A 4JANA 1HJBC 1PZ3A 1B3YA 2DT2A 3NPWA 1IM3D 5CPNA 4HVXA 4FQXB 2Q8AH 4FTDA 3C3UA 4ICNA 3FFCE 4YK4B 1UB5A 4B7IA 1GC1L 3UGEA 4CAGA 3NQKA 1NCCL 1IGTA 4AQEA 4CLMA 2R9HD 1AI1H 2IOMA 4I2XE 4J3OD 4MWAA 1FZOA 4LQFL 4Q4RA 4G7QB 2F8QA 1Z6JT 2QQLH 2ACSA 4ZTXA 3APMA 3MDJA 4KOBA 1ECZA 3P2VA 3QFEA 4NQCB 3ABXA 2K9FB 5C9JA 4DP1X 2VW7A 3GDMA 2A73B 5KZCD 4W89A 1XKYA 5T5NF 3L3JA 1NY1A 1N8WA 3LSBA 2CPUA 3KYAA 3CK0H 4M7ZB 1O7SA 3HFTA 4F0RA 3G04A 4WFED 5DFVC 5IVXB 1XIFA 4BFOA 4DJMA 1RXOB 3N2JA 5HYJE 2XG9A 2PWHA 3RVTD 3VKDA 4HWZB 4QGCA 3RVVD 2VM3A 1HN1A 1U30A 1IJ9A 5J6GA 3QIWB 3WUGA 3E2VA 3IETB 8XIAA 2GKIA 5FA4B 3MJYA 1HYSC 4LESA 4NQVA 3FBQA 1QI5A 2CCRA 2BHZA 3IDIA 3IXTA 2NNAA 1OIMA 3TBYA 3QQ1A 1WBZA 4Y1AA 3EWZA 3QQNA 3H6JA 3PZ9A 5HDOA 5BRZB 1FVEB 4EUPB 4OGAC 3FXGA 3QWRA 1KBLA 4FQXC 4BFGA 2FLMA 4D8PB 2AAMA 4OGYH 5AVQB 1PLGL 1T0NA 3GKAA 5CJMA 2IQTA 3OZ9L 1HKJA 4Q33A 4YZFF 1GJUA 5KVEL 1G9NH 4LF3B 1YZZA 4P57A 3HUJE 5AOKA 1V7MH 5IB3B 1S2EA 1ASQA 3GSNH 4PN2A 3KDOA 2ZXGA 3UZQA 1S2UA 5IOBA 5U4NA 1VCBC 3PLYA 4UV7L 4EIVA 1MCRA 2IG2H 2UBPC 1D5BA 4E3TA 5DC9B 2Y5TA 2Q2LA 3ILDA 1MQ8A 1L9OA 2VZSA 3NFNB 4M7ZC 4JPQA 4ATLA 1IC5L 5HHVH 1WC7B 2XWRA 4WEUD 2XC8A 5TAOA 1JZ4A 3RJDA 5LKYA 4V28A 3T4YA 1C9WA 3U2JA 1M3IA 5A1AA 4R0LA 4Q52A 4Z0XA 1EC8A 3VIMA 3MUY1 3QHOA 2WQAA 4JFFA 4X6CB 1OZMA 5TJWK 1E3FA 4GVFA 2YSTA 3R8QA 2R1KA 4N25A 3V5KB 5A6IA 3QIWC 4NL1A 1BOGA 3KXFB 4IX2A 3UTSA 3WJJA 3HCVA 1TU2B 2PMZA 2DQEH 3TN5A 3YPIA 3AUVA 4O18A 1CE6B 5C0CD 4UV4L 4N2GA 1XR2A 2J3SA 4HUWA 2BRRL 1HXJA 3E1ZA 1V10A 3T3PE 4BWWA 2Y07H 3WEXA 3QXUA 2NXIA 3O11B 3ZHNA 3ABKB 4K1WA 3BPCA 3WO3B 4FX5A 3NUKA 4M3JA 2FJFB 3MNZB 1EWEA 4TUJB 5MENA 2G37A 1JWSB 3UH8A 1ZWIA 2VWEC 3A6BL 2FK9A 1OWQA 5FD0A 4PTXA 4R3SA 3C6LB 4FNQA 3EOSA 2ZWSA 4TQEL 1V8HA 3EFDH 1EDTA 4UT7L 2VC2L 5LQBH 4JG1H 4EN3B 2GQAA 2JLLA 5I6XB 5JMOC 2ACUA 3SCTA 3CSFA 1BFSA 3V6OA 3O8XB 4I48B 4L6HA 3W9EB 2CR0A 4JTDA 2DT3A 5C6MA 4PJ7A 1IM9B 2MFNA 1W0MA 5FUCE 4CQ9A 4KC3B 4FLSA 3OBAA 1GZPB 3IAPA 4RBPK 4A37A 5LCVA 1WD9A 1QATA 2QELA 4P5SA 1X9LA 4H04A 2XSBA 3AS3A 4DN4H 4S1SH 2OA9A 3PZQA 4PRHB 4FR1A 2P44B 5ERWB 4GW5B 5I75B 4W6YB 5CGBA 1QLRA 4XXCC 4D8OA 4C6CA 2V7NB 3QG7H 3EA2A 4NUJB 3MS8A 3ABSA 2FLBT 3RITA 3NH7L 1ZVSB 3LQZB 4Y16D 5F89B 4AGLA 3N43F 1ICTA 3CZUB 1E27B 2AAVA 1WDPA 4EI5D 4AVIA 1YMMA 2R2CA 5AB0A 5F0JB 3OMZA 4HETA 3P69A 1HDMA 2VM4A 1REIA 4WTZG 2Y63A 5HI3D 2V82A 1ILUA 2UY6B 3QQ0A 3RHWK 2QF7A 4YR6A 4EN3C 4PJDF 5DHVB 1ZANL 1TPVA 5I6XC 4LVNB 3F58L 3O8XC 1U5HA 2WXJA 5KG9A 2QV4A 3E9AA 3HM7A 1UH3A 3SGDH 3U0HA 1KG0A 2O5NA 3GG8A 3HNSL 4N9GB 4MNGA 3WFEL 3LS9A 3EWXA 3LCLA 4BQCA 4YHEA 2HRLA 1ZENA 1ADQA 1VFAB 4ZTPL 2FECL 4TQ8A 3RIKA 1MCPH 4XT1C 5DTFB 2F53A 1AE6H 4YUEH 4Y96A 1V6UA 1QFOA 2WO4A 3USBA 1FORL 4M81A 3QGVA 2AQ3A 2W62A 3LNEA 4C6JA 2FPTA 3MUCA 4F7EA 5I75C 1J9YA 2WLMA 1Y6KR 2A6KA 2F74A 3RO8A 3ILEA 5CNHA 4M56A 5AZ0A 4BXVA 3U0TA 3J2PA 1OFPA 3GSXA 3FCBA 3NN8B 4LS0A 4AYBA 4L18A 3PQYE 1KD0A 2J7GA 3GMQA 2YCIX 4FS0A 3GTIA 1BZ7A 2QDDA 3OGCB 1JVKA 2GK0A 4X61A 3X3GL 3ATFA 1DBBL 1SBSL 2HDJA 2DEYX 4TL5A 1KWKA 3TBTB 2QDEA 2ZXCA 2XDHA 2EO7A 3OYXA 3FTXA 3DSNB 3EB3A 2EYTA 3I6EA 2YXOA 3ILQD 2GPTA 1K4DB 4LVNC 3IVUA 2IH1B 4HUKB 3F12B 3EO0B 5ETUA 3DU0A 2DLGA 1SYSA 3L3IB 4J5VA 5CGYD 4A6YL 2XTJD 3QWNA 2YAHA 3LBMA 2R4RL 5A6MA 3OLGA 1E8XA 1J5HA 4RV3A 5DUJA 1OFAA 4R84A 2FGWH 4BWTA 3MXVH 4UTMA 1T83C 4ZQKA 3OKEB 2OLDA 5EV7A 1A7PH 4BD4A 4I8DA 2XWBB 3F7RA 5E6YA 4KRMB 4WI6A 4KBXA 3LKSA 1PZSA 3WLWC 2HJFB 5KJRL 4PMDA 4UM9D 3LRSA 3QQXA 3BT2H 4PJ9D 3QSKB 1YDPB 4ZFFA 4MA3B 3DPBB 2JELH 3SCNA 1UWGH 5D2NA 2QDHA 2NXYB 5E24E 3DHJA 1BZQK 3QRGH 1IO4C 1OFOA 3FULA 1NGQL 1JPGB 3FCTA 2YBTA 2GLKA 3OIXA 3UL4A 4FN0A 5C09A 2CK0H 5LHFA 2C9SA 3LCFA 1TCMA 1I0BA 3WO8A 2NW2A 1IGIL 2RDTA 4ZK8A 3FK3A 2BOLA 5E6RB 3ZFHA 1D5MA 2P5EB 3MBED 1FO0B 2J9YA 4KKNA 2Z31D 4DGVH 3P80A 2EC9U 4KRNA 1UA7A 3QH3B 3LXCA 2VELA 1MRCH 4D0BA 3MODH 1SY6L 1WUNT 1A9VA 4HS6A 4GQBA 2V8MA 4IDLA 1PD1A 4K7PX 4G59C 4BFAA 2R15A 3AG3B 1Q9LA 1F6LL 4DZ8A 4HYTB 1IQWH 1H4PA 3RWEA 1ITCA 1S8DB 3HQOA 1Z0MA 4FNPA 2QHRL 4R4FL 5I66A 1B3ZA 2V0AA 2VP8A 2TODA 1CEOA 1UM6H 1CICA 3MLZL 4YNYA 3O0KA 4A3QA 4TTDD 3KYNA 2QEZA 1TPWA 1PD6A 1RH8A 3FK4A 2GUOB 3NAAH 3O9WB 3ZX1A 5BNXD 3AUOA 1P0KA 3OGOE 2OCFD 1JEZA 4OECA 3OC5A 4FZEL 1E2VA 4Z7VE 5F7MC 2POZA 2X89A 3P74A 3FQNA 4TVSa 4R33A 2CO6B 2AJYH 3W0WE 1YYMH 1F13A 2K8QA 3W2NA 4PJIE 4L3FA 1L0QA 2GVYA 2NXYC 1MSSA 4PYHA 5DEJA 4DELA 3B56A 5T3ZD 1GOOA 5E2WL 3VNYA 3ARGA 3G5WA 5CWSB 4F66A 4GEJA 3RNKA 3LRLA 4UOJA 4D94A 3BMXA 3IKKA 1NCOA 3W7IA 5F1IB 2FEDD 1PDKB 1S7RB 3ZE2E 2J4WL 3DV6B 3WD5L 3NCWA 3G1HA 2APVA 2D7PA 1W0WA 2CUMA 1FWNA 2NX3A 3MLYH 1QPKA 3AU6A 1T1ZB 4HNVA 4AL8L 2I60L 4ICWA 2VE6B 3EOBB 5LYRA 3BAWA 2HUEA 2I24N 1A5OC 2NSQA 4ODHH 2J6VA 3TASA 5EDXA 2G3NA 1KOAA 1W17A 3HI6H 1HQ4B 2YAMA 5C0RH 4FD0A 4D2JA 1C8VA 3MLXH 2EDBA 1WISA 2UXGA 2WO2B 4R2GD 4UIMB 3ULUL 3LMYA 5K2ZA 1DR9A 5IG7B 1B3VA 5A8MA 1QUNB 1U91B 5HWJA 3CPUA 1DZ0A 3O9WC 3WLNA 4GUPA 3VOGA 2EUXA 1NIEA 3ZDWA 1JUFB 3VJ6B 1WZAA 3TYBA 2BHYA 4TNWF 3GXFA 1YEKL 4PVNA 1SGKA 2CEQA 1UD4A 4NAMA 1Q9OA 4Y4KA 1V03A 4I1PA 3A12A 3IPWA 4ZEPA 1NGYA 1YVLA 3RL1B 4XWOC 1S3KL 5IOPA 3FSAA 4K8RL 4QO1B 3KG5A 3CASA 5ESAA 1NM4A 1HH9A 1K7FA 5ITFB 4OQTA 1A4AA 1K6WA 2QVNA 4XP4L 1QNQA 2JIWA 2VDPL 1ZK5A 2W38A 5LBSH 5DJCB 1HWGB 4P3CL 1K9FA 3T2LA 3LRHA 4J3OH 3KBJA 2A7BA 4I8YA 4U3SB 3P9LA 1INEL 4BKLA 1N82A 3OJ2C 3N2BA 4NO0A 3TVMA 4X4MA 5FGSA 3KWXA 1UWXH 3MUGA 3RPMA 4I0KA 2DSKA 3BLPX 1GYAA 3ZS4A 3H3PL 3WJLC 4Y0GA 4BFIB 4ODSH 3U36B 1OLZA 1CLZH 3HS0A 3WFHA 4G82A 3DGDA 3EYUH 2B1HH 2XCMC 4RMVA 1MEXL 2ZADA 3R12A 4HJ0D 3IJDA 5I30H 3GSNA 5MERB 4HH9A 1RSYA 3RF9A 4U5IA 3QTGA 2Y7MA 3ZU8A 3RPIA 1W5MA 3G6JE 1NQBA 2PCPB 2J57A 4E9QA 1JVOA 5HI5D 4WY0B 4A8NA 2EVIA 4G6CA 1TJIL 1JDAA 5HHME 4XC3H 2H8XA 4TMBA 3ZR5A 4U1HA 3C5QA 2DYPA 3V79C 2ARJQ 2OS7A 3I9GL 4HS8L 2X1SA 4O12A 2WVVB 3WNIA 4HIQA 3UBGA 2CR6A 4Y8EA 4JHVA 2VEKA 4Y4HD 5ICYA 4PP1D 1J12A 3HIJA 4YOKA 4NZCA 2EC8A 3QFWA 2BFGA 4NQQA 3BKJL 1BRLA 1VGEL 2K45A 1WHOA 2X8RA 3WLRA 1O5PA 2FJHA 4IMAA 2WM1A 3FQ2A 1OK0A 4LWWA 1B6DA 3AHYA 3OAYH 2W80C 2PE4A 4N4PA 1C90A 1ZHLA 3T0EB 3GBNH 5BRBA 3U46B 4LARL 1O9ZA 5EIIG 1N5YH 1A4CA 1QQDA 4QMEA 2VR6A 3UEQA 3PFUA 2HNEA 2A3EA 2ZD0A 2M83A 4WK4B 3PP4L 1E72M 4UQDA 4NP4L 2ZA3A 4FEMA 1S9XA 4HT1L 4YHNB 4AVKA 4UR8A 1JNNL 3J07A 5IV2A 4H2AA 2CNCA 2P5WA 3IMSA 1HZLA 5FS5A 4BH7A 4H9XA 1CX9A 1QLEL 4AIEA 3MV7E 3GF8A 5AW5B 3SE3A 1UD3A 4JG0H 4HNUA 4MGXA 3DG7A 5D09A 1UWYA 4OGXL 4PJEE 2VWTA 1O1ZA 1PAMA 1XIWA 5CLTA 4LC6A 1GQKA 3ALFA 3D52A 5HGHB 3QORA 3WF1A 4XPHH 3RIAF 3VI4A 3VNLA 4OIBA 3VM5A 1VJIA 3BJLA 4J5NA 3GM0A 4IPPA 5EU4B 1MAKA 3VMNA 4H8WC 2AQ1A 1Z44A 2N0MA 2UWEA 3O4LB 4YQXL 3CAWA 4RGNE 3T65A 1CXEA 5AB3A 3CFKA 4L3EE 3CDZB 1ECYA 3G5XB 3WNKA 1E51A 1XYLA 1DJSA 3ARTA 1AGDA 4GG9A 2X4QA 5I1EH 4E41D 4PG9A 4XPFH 4XNXH 4IDJH 4XNUH 5JIWA 4Z7NE 3NZQA 1I53A 1OSYA 3L3GA 4JO1L 1EUAA 3D12B 1RHFA 4KFZC 3L3KA 1AXTH 3EGDB 4PJBF 4WEMB 2EF9A 3A47A 3TU6A 1MJUL 4Q6YA 1F97A 2H1PL 2O30A 3GSRA 1FZMA 1JCXA 3O2WL 5D7SL 2BCKA 1BYAA 2WZIA 3I3DA 2LVCA 1Y07A 4CW1A 3ZKMD 1W3JA 1HL2A 2Y36L 2V38A 1THCA 2H9GA 4JJ5B 2K4AA 5AB2A 2KZWA 1CR9L 5HYJA 4LEFA 4MJ2A 4MAYA 3UBXI 2WYSA 3SBPA 4GQPH 1AY1L 1Z9AA 1W8SA 3RFAA 4OV9A 3VI3F 2P46B 3W22A 3DVNA 4P5KB 1I9IH 4TULH 2H47C 4RUBA 3QCUH 1DEDA 2GAZA 3CSTA 2NQ3A 4G7RB 1Y5WA 4WGXA 1E6OH 4E6MA 4R90H 1TJ0A 4GIRA 3O15A 5CEZL 5CGTA 4EWND 5K9KA 3HBPA 4TNVK 3QJFA 4O5LL 2NTSP 4FP8L 5IMKB 4LKXB 1W1ZA 3HIZA 4GUCA 1KN4L 4DX3A 2J8UB 3D08A 3QPXL 3E1F1 3BVUA 1AJZA 5I8CA 5TQ0H 2WV8A 3BUBA 3Q6GH 4DK6A 4IU3A 5C5YA 1W9DM 1V8EA 3ABQA 1ENUA 1A3RH 3G3MA 1PSKL 3GHBH 3O63A 4MCZB 4Z7WA 4G1EA 1OVDA 5HSFA 3D39A 1QA9B 4Z9KB 3G6DH 5KUKA 4UT9H 1MLCB 4X9IA 5JIQA 3G1RA 4HFWA 5LNRA 1T4KA 2GZXA 4FOMA 4ZO7A 3P61A 4MWAE 4NQDA 2XSXA 4OY9A 1S9KC 4J1OA 3QB7C 3VE7A 4ADUA 4LCCA 3H8NA 4C6KA 4LAUA 4POCA 3AU1A 1E3XA 2GJ6B 4RJEA 4GMTH 2PP1A 1YNYA 2XY1A 4UT6L 1RUPL 1OGSA 2ZSVA 1Z3GL 2AERT 1J05B 4ZCWA 3BZ5A 2QPUA 2X4RA 3R18A 4JZJB 5DHXB 1GW9A 1OCNA 2IPGA 4MXWH 1UWEH 3G08A 1I1FB 2YGQA 3HAEG 1OFQA 4WI7A 5I5IA 3PP3H 4UTAH 1OINA 5KSVA 3H55A 3T6ZA 4NQEB 4AGOA 2XV6B 1JI1A 3MHUA 3WG6A 3GZ3A 1F3JB 4KMTL 3GQYA 2EDXA 3RWHA 4R7DA 3I6KA 4APXA 2ODIA 5F6HJ 4JVWA 4F48A 1P7QD 5DLMH 1SJHA 5DJ0B 4H20H 5H94B 3IBOA 4L9DA 4Y1AE 3LENA 1RJZA 4X4ZA 2D1ZA 1I3UA 3QPEA 1XSKA 5EDSA 4XCEB 4HX1B 4MFEA 2Y25A 5FO7A 3KOWA 4XPTH 2N7BA 5T1DH 2E6QA 3TV3L 1ELSA 1P84J 1UOLA 3WK2A 1PNCA 4BH8B 5EO0B 4ML4A 4QUOA 1IAOB 3SDDB 3TN6A 1RZGA 1ZVYA 2YD8A 1NTHA 5AD0A 4S3FA 3T44A 1NEPA 1YPIA 3TC3A 4DKFH 2K6ZA 1NF7A 4XX1E 3NFUA 1CG9B 3O3BA 4UDUB 2AS5M 3D0VB 1HHIB 2ICEB 1PZ1A 2KHAA 3SPIA 1CDGA 5F6HI 3EKCA 4EBQH 3W27A 1EAQA 3B5TA 5I03A 2OTWB 4W7VA 4JZJC 2NX5D 5T3XL 4XMKH 1I0DA 4NYLA 2QYGA 3CZGA 2YMTA 3DV4A 1D8WA 3M7FB 4K3EH 4Z1PA 1L7IH 1Q7ZA 3GRWA 3SOTA 1PZBA 4HZAA 3VZXA 1LEKB 4JFFE 4ORIA 5AVRB 1MRDL 5KZ6A 1MCOL 1DVTA 1ZK9A 4AGPA 4OLYL 3UTSE 3ITGA 5ESVA 3CU1A 2JF6A 1ECQA 5D9SA 3VXQA 4LVHB 3LEXA 5FF6B 4TOYL 3N11A 5HQMA 1NC4A 5IMOB 3WQ6A 2XWXA 1R7OA 2E9WA 5C71A 1SDDB 3KWWA 2HCZX 3I50L 3GLZA 5JMUA 4AUJA 1XLBA 3SDDC 3JZYA 5MENE 1EGJL 4O10A 4XCCH 4XKYB 4Q8QA 1Z69A 1KB5H 1GQLA 6CGTA 4WJXA 1DLHB 1AGEA 4M80A 3TWCL 2Y7OA 4KEVA 3H7VA 4KJPC 2ICEC 3QCVH 4KQNA 2BBFA 1Q8JA 3H7BB 5J89A 1IYXA 3MKVA 2PWVA 4WKZB 1A65A 1E65A 4AVNA 1O9WA 1YNPA 4S38A 4UMBA 3S9ZA 5AHEA 1EAPA 5GRUL 5T3ZH 2OMZB 3M47A 2CHNA 2Q6WB 1H60A 2QDGA 2YZRA 4KMLB 2BY1A 4PFHA 3NCXA 2NMSA 1OHLA 2AJXL 3V6OE 4IXXA 3XIMA 4GI6A 3FFOA 1E5NA 2EILB 1E6PA 1TTRA 4GFIA 3KWUA 3HN5A 3E8UL 1IT8A 2DQDL 4ELMF 3S1UA 4M1DL 5GS2D 3FTVA 5CSZB 4RSYA 4PJ7E 1N55A 4N8VB 4R9XA 4WHYH 2GW5A 4IIZA 3SJVD 3UBXB 5I3FA 1MCHA 3UAAA 5AYYA 3GMRB 4GBXD 2DQUH 1UR0A 4DUWA 2O9RA 2X9WA 5F7DA 1B4RA 4X6EA 4PY7B 2L8AA 4X0NA 4M62H 1Z48A 4LVHC 1GKOA 4R5XA 3BDKA 5GHWL 1QSEE 3FU8A 3MNMA 5AVZB 1PG7X 2OK0H 3VXOA 4GP4B 2OSLB 4UNTA 4NZUH 1UGKA 1ML1A 3NQ8A 4YXHH 4P7NA 3QJAA 3ZTCC 3EPNA 3NQMA 2EDJA 4JFEA 1FN4B 3RZWA 1JZ8A 5KTLA 1OADA 43C9B 2Y85A 3C5XA 4HYRA 4LLUB 1YMME 3UJIH 3WHE1 3VFLA 3XISA 1ZIBA 4C6LA 4PUNA 5F7NC 4JN1L 3UP8A 3JVGC 1BFVL 3PZTA 2D22A 1EVUA 1MWAB 1TZHA 3QUHA 4XPBL 1MHHB 2HVKA 4NZ8A 1UT1A 2NY0D 4LE8A 3RDKA 4M00A 3X12B 3FB7B 2BVTA 1MLBB 4ONHB 2Y6TE 4YHPA 3PZGA 2EG8A 2DICA 1KENH 2R94A 3KGSA 1LT7A 1NDMA 4MNGE 2VLJB 2KUTA 3P0WA 3S3JA 3SUWA 2DBLL 2XKNB 5FYKU 2XWTB 1B0GB 1VF5C 2PS2A 2FWOA 3BSMA 4GKNB 3MOBL 2YBVA 3RL2B 4MB4A 3UT0A 4XBPA 1MFVA 3K8KA 5HQEA 4HLEA 4MJMA 2VDOL 3R0NA 2VXNA 1P4IL 1WFUA 2BJMH 4REQB 3NR0A 4DXVA 2WKOA 1FWWA 4KFOA 3W26A 2IGFH 4WFGE 2OTDA 5GRYA 4N3TA 1C5CL 1M7XA 4GRMB 5JXAL 4Z7VA 2SEBB 5A94A 3EMCA 2FEEL 1T0MA 3GNRA 4MAZA 4G80B 4PJIA 2VDNL 4MCMA 1H6UA 2ZE3A 4NIRA 4DBDA 1AA1B 4XNMA 2XH2A 3WF3A 2NRDA 3KEDA 4X6BB 3N1GC 3TA3B 3V9CA 3ZT5A 5GGVH 2P8CA 4CQCA 2MJWA 4UILL 1VKXA 5C0CA 1CDHA 4YSRA 3IIVA 3T6CA 2J79A 3NPSB 3SBQA 1WXZA 1KIQB 2YGPA 4QS6A 2ZJSL 4Y9GA 4W9EC 3LNPA 4PR4A 2XGBA 3BO8A 4FXTA 4NP9A 3R25A 3D3AA 1B2YA 4EKJA 1FX6A 2JXMB 3E0LA 1JWMA 2QVIA 4NVTA 2XU2A 4FFVD 2VITA 4GO8A 4QM1A 1XCQA 3B8SA 1EZSA 3G0XA 3TYGH 5C0ND 4H8UA 5KVDL 3RWIB 4ZOEA 5D2NE 3GM8A 3FDGA 1J2WA 2YA2A 1NL0L 3RX5A 4NM8L 3AMKA 5C09E 4AENB 1WOAA 1CWVA 4Z7UA 1QYGL 3ARBB 1I7TB 5CBAA 3RZCB 1DXEA 2O55A 4UTKA 1ZIAA 3GQFA 4K73A 4JVUA 4UWMA 3SY8A 2AJZA 2X4SA 4M4RB 1W1B1 2W60B 1CDYA 4S3AA 2D7QA 4FP1A 5T5FL 5H1WA 3CHCA 1S78C 3MO1B 4K23L 2J6EH 4K94C 3KLDA 4UB9A 2XKSA 1ZJIA 4U6XB 4B15A 1VZHA 2QVTA 4IF2A 3SSJA 3ESVF 3TA3C 4GXPA 2VVNA 4I85A 5IJBC 3TIEA 3FFDA 3STZB 4LRIC 3EB2A 2XZAH 5I1DA 3NPSC 4YIQA 1RLWA 3VO0A 4TTGA 4NKMA 1INDL 2IGTA 2WVUA 2Z2UA 5IR1B 5BVJB 3BQUA 4APQD 1XUUA 3FQXA 1CENA 4WEBH 3H6OA 2PRMA 4I5BB 4IFKA 1OSPH 2OCCB 5DJYA 4FNLL 5GZND 3DSFH 1BEYL 1UZ6F 3C2EA 4B5XA 1E5UI 2IDSA 5C0EA 3OGRA 2H9AA 2DGAA 5GZOD 2H2PD 1R3WA 4JDBA 1U3HA 3ARBC 4JKPL 3RZCC 3EJSA 5FHAH 3IGSA 2D3NA 4DVRL 1HIZA 2YA1A 3ZL1A 4GBUA 2Q6ZA 4PUKA 4IGBD 1AR1D 3QJZA 2HP4A 3M4HA 4UUIA 2OJEB 4MKNA 3W02A 2JIXD 3MJ8B 3Q9PA 4FOJA 3SCMD 4FZIA 2WAGA 5FOOA 5JUVA 4JZOB 2FYVA 4GT7A 2YRLA 3S5LG 1GTFA 2A9NH 4RA0C 1I6NA 1FKWA 2QAFA 4TO8A 1QSFB 3PV6A 4N8CL 5IJCC 3MA9L 2HE8A 4RSVA 5FIEA 5GJMA 4XMLL 5ICUA 5F7HA 5I0WA 4G9FD 2IPWA 4RAUA 3PJSA 1ZS8A 5T1LD 3MCKA 1MCWW 3G0UA 2W65B 4JFDD 5EF1A 2GGHA 4LKCB 3GSQA 4F20A 2V2WB 3CVBA 5IDZA 4HJIA 4P2CG 2Z65C 1ZTXH 2OZ8A 4IU2B 2JIEA 2NY3D 1HEZB 2OW6A 3EADA 2VERA 5T5NG 4GABA 4Q6KA 3GB7B 1RLCL 3CVHL 3ECUA 4KWVA 1S2CA 3IJLA 1PKYA 2R1NA 2C79A 4UTAA 5LDSA 2DZVA 3DHUA 1HL5A 5A16B 5FEWA 3DX6A 4LH8A 4PLJC 3MRBB 3M1BA 1RZIA 4AK2A 2DQTH 3MV7A 2O92A 4PJ8A 5FHBH 1ADOA 4F37F 5C08D 4RCAA 2H6RA 4NC1C 4PJEA 3QR1A 1R24B 1WFOA 4M9PA 3N50A 1IEAA 1ZLEA 1IIKA 4OLXL 4GHRA 4L4MA 1MNNA 3AJXA 4LAJH 5JR1L 3NIGF 2AABH 5A2FA 4FI7A 2J21A 1NDVA 1TPEA 4G5ZH 1DQVA 2H26B 1X4ZA 1ET5A 4XN1A 1S2TA 4UQ9A 5EBWA 4L3EA 3ME0A 2GT9A 1D2OA 3X1FA 3LKNB 3P77B 4Y5XB 3JZ7A 2F54B 3ARFA 4JGMA 5CD5D 3AXMA 1DDHA 4MJZA 3OHXB 1WBHA 4YHOL 1HKWA 2X1PA 3CGTA 3W1PA 3V4VH 4U1IA 3VZZA 3WTYA 1PL3A 1KLGA 2XBDA 3EYSH 1CBVL 1CGVA 5DD6B 1E4XL 4MQXC 3RVUD 4R96A 3D85B 3A6CH 3DH7A 3MBEA 4RLIA 1HOEA 4PH8A 1LXMA 3BJTA 3KOYA 4EQ2A 3PNZA 2C5DC 5EORH 3JW7A 2HAZA 1HNGA 4XMWA 1WO2A 2G0WA 2GDVA 2JVUA 3GH7A 2WZ5A 2E9GA 3WLKX 3UZXA 4LEOB 1I8JA 3C56A 4ZT1A 2Y22A 4BSVB 3H7UA 1TV8A 4KRPD 2A3BA 2WUCL 3LHVA 5FGCE 4GXWA 4PW4A 2J77A 4FQQA 2OBGA 3EYOA 3C60B 3DIDA 4TSCL 2P5WE 5B38G 3CZFB 1KB5A 1W6LA 1CBGA 5EOTB 4Y5XC 1KTLA 4MMYA 1MN4A 1NMBH 4KBPA 4K3GA 4MXVE 2AW2A 3CIQA 4H8HA 3AXLA 3ISRA 3CFJA 3CWHA 3UTQB 2BNRD 3PJLA 4RZCB 3OHXC 2WBJB 1D6VH 5DMJB 2QR0B 3TGXA 1FP5A 4RMTA 2HA1A 5EBAA 4XAGA 3PDOA 1QR1B 1E2WA 1M3JA 1M2VB 2RJHA 4IL0A 3BUDA 3N44F 3MMDA 3QUXD 3VI4E 3VGHA 3V5CA 1EGZA 1AYRA 1DIEA 4XWUA 1RZ7L 4BHUA 5JIHA 1JNEA 4PULA 4RMUA 3SKNA 3PGFH 4P5TA 4HJGA 4GVGA 1C29A 3R19A 4PS4H 1SHSA 3USZA 2DZUA 4H6KA 2CA3A 3UGRA 1THAA 2PTTB 5F4XA 4XVJL 4UOW1 1OFBA 1B0RB 1O60A 4N6EA 2YRZA 4WI0B 2NUPB 1JGUL 3Q4DA 1I3GL 2H32H 3F5LA 5JXQA 5BZXA 4QHKJ 3V4PH 4GS7B 2A38A 5D1XD 5EU6E 3MLRL 5DFAA 5KN5B 2OWWA 5JOFA 4D8LA 1NPUA 2FE0A 2WLHA 3C60C 2WAHA 2EDYA 2VXTL 3MP5A 3LPFA 3MR9B 2VCAA 2FRGP 1BF5A 3V4BA 1X97A 5CAKA 4U10A 1YTDA 2CIKA 1XIDA 3MROB 2Q10A 4IOSD 1PEZA 5GS2H 3U9WA 2HTMA 3O6KH 4DJDC 2FVNA 4ZENA 5LXEA 2EYRA 4JUSA 1WK0A 4R8WL 1VRSA 2B16A 3MC5A 3VXMD 2WBJC 1E6QM 4M7KH 3VXPB 1I1AD 4XMPH 5EB9A 4HKPA 4IUOA 3MYJB 1SJDA 2BVDA 4L1WA 5E7FA 2X41A 4NQSA 2F8XC 1ZDQA 4QHKI 2HUHA 5HA7A 2EE2A 4EE2A 2R27A 4CNIA 1JPST 3I02B 1P0DA 3PWUB 5AW6B 1QFUL 3ZE1F 4HCLA 4PJAF 2NOYA 1GGTA 3K7UA 2VX7A 4PMNA 3D05A 5F3HB 5BQDA 3VIGA 1A49A 4X6DF 1GZHA 4IRSB 4XN4A 5I2IB 4ZFGH 5TQ2H 4GS7C 2WANA 1DIOA 3AITA 5C7HA 2KZ1B 2PCXA 4RAVB 3UVAA 1C5DB 3NTCH 3TNNA 3AQDA 4GUQA 3FQTA 4IBSA 1LWIA 4WHBA 4Q6IA 1R2SA 1AGBB 3HTLX 1NAL1 2XA3A 4NENB 4Z7WE 1W3KA 4HHPA 3EJJX 4AHPA 5ID0A 4QHNA 3LI1A 3D39E 1G7JB 3FT9A 5E8EA 1O68A 1XFPA 1OARL 3OKDB 3EH1A 3IIPA 1UACL 1NCHA 2F2HA 2XN9D 4A2FA 4YXKL 3A9BA 2JJTA 1C5BH 4DO6A 4NQDE 2DDQL 2IXVA 4KWWA 5DT7A 4NHVA 1H15B 1BQRA 3H22A 3SCWA 1F4XL 1CYGA 4EX4A 4CCZA 4RK8A 3SJNA 3VOHA 1A6AB 1OXYA 5HHQB 1TJ2A 5AAPA 3S36X 4ORZC 5ISZB 1V0LA 4JQVC 6REQA 4A8IA 3AYSA 3BHBB 4HG4J 3LB6D 5BXTA 5FJRA 1UD8A 3LN5B 4IRSC 4XCNB 3VFPB 5K69A 4WGWB 5JVLA 2ICSA 4I4WB 4ZTOH 2EXYD 1T5WB 3DI0A 3IFNH 4FQIH 4BSJA 1K6QH 4YTQA 2R1XA 2VR8A 4NBZB 1UGNA 2N0KA 4NXSA 3TZVB 2XOTA 3AY4A 3IWVA 5HJ3A 5D38A 5BVPL 5BNKA 5AC8A 4IS6A 3QUKB 4Y4FB 2Q86B 2L7JA 2OMXA 5FF7A 4H1LG 2CZFA 1PS3A 4W88A 3SDCD 1V6YA 4RL3A 1HWHB 3ANVA 1EXUB 4NUQA 5EU9A 3QW9A 3DI1A 3R7RA 2HBVA 3FJ6A 4GC3A 1KIRB 5SWZB 2DTSA 1L0YA 3B9AA 2XQ0A 4J3XA 5J6HB 5DXWA 4S2BA 2ODOA 3IAQA 2PPDA 3RGBA 1FG2B 3FXYA 5E2UL 3TCSA 1QSEA 4E41A 3V6ZB 3UAJA 2WIIA 4LRNL 4QY8B 4C5YA 5CJXA 1KV8A 1V6WA 4M7LH 5DRIA 1X5IA 4LVAA 3BOFA 1ZVHA 3BPOB 4NEHB 3HC4L 2DYSB 4FQ1L 5HDQH 3SE4C 1EXHA 2EPOA 2GSGA 3QNXA 2OO6A 4LSQL 1OCQA 4Z1AA 4HK0A 2YSWA 4TU1A 3BD4A 3VUAA 3TZVC 3MVSA 5LN4A 4X98A 4IOIA 4X7SH 4ERSH 4YHKL 2IXQB 4Y4FC 1FV1A 1D9EA 3MMEA 1I2NA 3BEWB 4OTXL 3BLIA 3QNYA 3VTMA 1R3HB 4OFDA 1ZZMA 3ISWA 4KKLD 4NNAA 5CZRA 2C1GA 4AYGA 5DMIL 3JWNE 2VC2B 1NMAH 3UFYA 3SW6A 4IJCA 5D4JA 1G5GA 3HZKA 1XD0A 4RWYH 1CGSL 1N7MH 4O2FB 2ABAA 4OI7A 1ZGLA 1AO7B 4I1NB 3APCA 1BIHA 5FKAA 1GPOL 3CLEH 4KJWC 1H63A 2VFHA 4NNPH 2M26A 4AW7A 4X8CA 3CAQA 1XQLA 4QHLA 3R4DA 5REQA 1JDEA 3DIPA 4HUUB 1WP6A 3BPOC 2ZAHA 4IKLA 4IPIA 2F6KA 1ROCA 3P3YA 2VEPA 2I5YH 3ABZA 4ES8A 2IPKB 4HGMA 2Q9OA 1GZGA 2H41A 1RP8A 4XP5H 1TCRA 5F2FA 2JFCA 2DIKA 4TNWK 3Q6FA 1LP6A 1NARA 4X80L 3IGAA 4IQJA 4S3EA 1M41A 4EZLA 4JM2F 2A85A 1M7DA 2LT9A 7PTDA 2EG7A 3PPHA 2ZPKH 3R43A 3GVRA 3ZKXB 3G3DA 3DC8A 2BVWA 3KBHE 1RAKA 4L65A 3ABOA 4Z1CA 5JHLL 1S5IL 4F5CE 3OPZL 1H3UA 4CD8A 2EECA 2JJSC 4JFEE 1LUCB 2AEWA 5IB2A 2ARJB 1OP4A 1XIGA 1AC6A 1LO5A 1OV8A 3L95B 2A21A 2IQ9H 1F3DJ 4MLRA 3QYSA 2QQKH 4EOUA 2OXNA 5HHOB 3L1GA 3C61A 3Q5YA 1XGRA 2OOFA 1JPHA 1F58L 1PY0A 4P7OA 3T07A 4GLRI 1PVHA 4ZNCD 4N68A 3MACH 5AW2B 4DFHA 3P5ZA 3GHUA 1W0VB 4NU7A 3NACH 4N9BA 4QYOA 4TX6A 2H5UA 2AQVA 2XXGA 5J1SC 5FV2A 2YPVH 4BKTC 2Y8VA 4MJJA 12E8H 3V4VA 4POZC 3DIFB 1JV2B 3QYMA 1HG3A 5H2BB 3MRLB 3IIOA 2PGFA 1UB6B 1OY0A 4RMSA 1QLFA 1IAIH 3BH9B 2FJGA 4F9PC 4W5ZA 2QSQA 4MKMA 2YKLL 3ZKXC 2NY1C 1RCXB 4ASTA 2NXGA 1QRKA 3NCJH 4JTFA 1AKJA 2Q76B 5JOPE 3QKZA 4KRTA 4MSSA 3ZDXF 4L9ZA 3E6HA 2WJ5A 2QUNA 2AGTA 4QLWA 3CE1A 3JXAA 3GYRA 3W53A 2XHYA 3D2TA 3A67H 2DIEA 2Q20A 2X28A 3RP1A 4JNYA 3AB0B 3HE6B 3TAKA 1P5UB 1X5XA 1DVJA 5AAMA 1L0XA 5GSVB 3U6RA 1MDRA 1FNAA 4W9LC 3W2JA 3MRGB 3ROOA 1PHWA 2XZQL 4GG8B 4Z95L 1RJYB 1IX2A 1D2KA 4NZTH 1S7TB 4JOMA 3SE8L 1WYIA 3DOIA 2XPZA 4KKAC 4NT6B 1WDWA 2PYFA 3Q2WA 4QRRB 2IPTH 3US1A 8FABB 5FB8B 8RUCA 1MVYA 4HJEA 3CQJA 1L9RA 4PQXA 5C0CE 4DZAA 3DX4A 1GY2A 4IGNA 4LASH 4PRPA 2GC7C 4Z3HA 3IGLA 4LOFA 3M6YA 4IRZH 2HKHL 2HTLC 1M2OA 4KTYA 5FSDC 2VD8A 4OCWL 1DJWA 1ZCRA 1MZYA 1XGUA 1B30A 3O2DA 2PW2A 3B2MA 3S37X 1IGWA 5M2FX 2LHAA 2IADA 1W3IA 3G1YA 3FYOA 3ARQA 1CL7L 3ABGA 1GJPA 3S4SG 4PG2A 3JV6B 4EEEA 4MRBA 4W81A 2KL6A 4HLJA 4N0RA 4KEMA 1J5SA 3WQCA 4AC7C 1LJMA 1JF5A 2J7DA 1OT4A 4Z7UE 2H32A 3LQAL 3AB0C 2QKSA 3HE6C 2KYIA 1P5UC 3V4PA 4LYPA 1AZBA 1YJDL 1W3LA 2GQ8A 3QFJA 4V33A 3AWEA 4R7NA 2CKBH 4WU5B 4QOKA 1QXLA 5IQOA 3IEBA 1L9WA 3UZJA 5L2JB 3CMFA 4DUVA 4HHWA 2RALA 2VEMA 4WU7A 4L0PB 3OAUL 3SJVA 3RI5F 1Q66A 2CLZA 3BGMA 4GBXA 2Y7FA 3KDNA 3FB5A 4PJXB 1TZ9A 3BP5B 5KJ7E 1OTSD 2D0GA 5D1ZA 1KCSL 4CNPA 5CILL 4IIGA 3BPWA 4RW3A 4AQ1A 4LBEA 4W87A 2OI9B 3TIDA 3DO4A 1F90L 4M6VA 2QVFB 5HGAA 3K30A 4HUMB 3K2GA 2C16A 5E94B 1G4TA 3VI2A 4RE0A 3EKLA 1AXSA 1XLFA 2INFA 4FYRA 5E08L 3AREB 1ACYL 4MASA 1ZAHA 4OVUA 3BOVA 3MFGB 1Q6QA 5ACZA 5LCVL 1KJ3H 4YHIA 2EUWA 3ZL4H 2PDYA 1UH4A 5K3VA 4XZUA 4N0UA 1IR2A 2ADAA 5E70A 3TW9A 4QXTA 5IVZB 1LZOA 2ZXDA 3BRDA 3FQ4A 3TW6A 3T7VA 4XBGB 2Q02A 3BAYA 2FZMA 1SYTA 2GUYA 3ATZA 3HG2A 4ZDHB 3BZ4A 3FDKA 4MKSA 3ECBB 2VXQH 2W3ZA 3B4YA 1OE1A 1HQRA 2ZCKH 1BGXH 3P5YA 1KKRA 3ETBF 3ZWTA 4DOHB 3DFOA 3DOSA 5I5MA 4E5XB 3OSVA 5CLXA 1YW1A 2XX1A 3LBCA 1WF5A 1PGRB 1JVLA 5DSCB 5HMDA 4S3CA 3X14B 1JD9A 2B4CL 2PEVA 5IGXH 4UIKL 4LAZA 3AHXA 2OI9C 5T8GA 4JRXD 4WZ9A 5FPIA 2V5BA 2HT2C 1S7VA 4C58B 5GNXA 4C7FA 1X5AA 5C0DB 4Z2LA 2BV9A 3QIUB 1PYFA 4MMWA 3X11B 3AREC 3BLBA 1ZHBB 2Z28A 3NJIA 3EAUA 3ZKNC 2BVYA 2YN5A 1R5WA 4GG6A 3QZMA 3HV8A 4GQZA 3T3ME 3HNTL 1XGPB 4AL8C 2VDLH 3FYEB 2J47A 4XZWA 1UCTA 5INDB 1M6OA 2EJAA 3GC3A 4YL2A 1SMAA 2VR5A 1WGVA 2D4DA 5CBEB 3QC0A 3QQ3A 2CD0A 3MV8B 3THUA 3MA7A 4GXMA 2FPYA 2AXWA 2XTJE 3H12A 3ULUC 5AYUL 4XNQB 5LWYH 4WVRA 3BRFA 4BE5A 4HXBH 3CU2A 5IB4A 4XCFL 3G5YB 3KM2A 5HVFB 3TYCA 1IAKB 1GVRA 2EAEA 4BZ1H 3ZDYB 4G2DA 2Z27A 5EYWA 3KBPA 3N41B 1PNDA 1BF6A 3ULVF 3IXAA 3LX9A 1A6TA 4NOFA 4XN7A 1R87A 1QRNB 1TG7A 1G1OA 3IDXH 1TPDA 2ZZ4A 1F3EA 1UXSB 4HZLA 4LGPB 4F8XA 1JRHL 1HFBA 2I5IA 3ATDA 2A4EA 3P60A 1FP9A 1UQZA 2BMKB 1FYTD 3S5OA 1J10A 1XZ0B 3IJQA 1ICSA 3QIUC 4YVUA 5CSRA 4ZFOB 1K03A 5CEXB 2W0KA 1OGAD 5EU6A 3DXIA 2XUWA 3U25A 3QJRB 5TIMA 2AKMA 4YVNA 2H3KA 4DQAA 4FJ6A 2HN7B 3PWLA 1DHKA 3RWCA 3VXGA 4RIRA 1WBXA 4O51B 4Q7BA 4KWSA 1FNEA 4WX2A 3CVIL 3TQ0A 4PBVC 5GJSH 4G5AA 1E9OA 2H0JA 2NWRA 4BQBA 1INQB 4L8BA 1W8NA 1J8HD 1OAUH 5HDBF 1T99A 4NY2A 1AW5A 4E9TA 1NA8A 4K9JA 4P3DA 4Y9NA 4OR1A 3UMNA 1U95B 2JKTM 2WK2A 4JO4L 5DQPA 1G87A 3N3TA 4OAWB 4BWLC 3G9VA 4RDBA 4R27A 4XO8A 3E3QE 3HR5A 2OG9A 2RJGA 3CCHB 1IL1A 1EJUC 2ZG1A 3STCA 4WV1A 5HWNA 1XR8A 2FR4B 3BAXA 3MBDA 1US2A 3S7GA 4XN8A 1Y6MR 1KCLA 2NY5H 1IC4L 3U0WH 4DH2A 1CT5A 5T3ZE 4J2PA 3L9CA 1X5GA 3FC8A 2GSIA 1Q0EA 3ARDD 1FZJA 1MJ7L 3B2VL 4C6NA 4PGBB 4BZ2L 2K7QA 3QBUA 3RAJL 1NDGB 2NLJA 5IEHB 4JX0A 1RUMH 1A4JA 3GVWA 3FT3B 2BSEA 1CB7B 1E9QB 4PREB 3KYOB 4JIPA 4ZXOA 2K3TA 1HFUA 4NWUH 1GOMA 2D7NA 3WEMA 3NZ1A 3CHSA 5IKCB 3GHRA 1S46A 5GQBA 5FYLD 1KFEA 4L4TA 4ALAL 3TT1H 3N2MA 3S9IA 2YD6A 2Z93B 1CFQB 4NUPA 2ED6A 5CZVL 3SFKA 3MRJB 1QWNA 1A0QH 5T1LA 5EF2A 5F1UA 4LPUA 4NUWA 1S9YA 3PIQB 4LV9A 4GH3A 5HR7A 1TJRA