1KGXA

Three dimensional structure analysis of the r195q variant of human pancreatic alpha amylase
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFQLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgxA01
3RM4A 2XFRA 5IDIA 3W4RA 2NW0A 5HNNA 1EQCA 1M03A 3APGA 5CLTA 1W9VA 5LA0A 1WE5A 1B3WA 2VX6A 1CGXA 3WMBA 2XYLA 2DIEA 2F8QA 2WB5A 2YFOA 3UERA 3E1F1 4W7VA 2X05A 4P8XA 4TVDA 2VMFA 1Q6CA 3A21A 2EXOA 1U2YA 2AMGA 2F7PA 3AXXA 3D4ZA 3L4WA 3WELA 1ODZA 2ZWYA 1E0VA 4EE9A 2X1IA 3VIOA 2V3FA 3WNNA 3VDHA 1KCLA 1W9DM 4MAVA 1KB3A 3ARZA 2OWXA 3BVXA 4UQBA 4W8AA 4DM2A 3M46A 3H55A 3W6MA 4OOUA 2XVPA 4F9JA 1XH2A 2XIIA 2VI0A 2CXGA 2V3DA 3W38A 3PHAA 5BXTA 3AISA 6TAAA 4CU7A 3K8LA 3WY2A 5E0CA 3SUWA 3LX9A 3DX0A 1J12A 2WMFA 4UFHA 2WC7A 4FLOA 4W7WA 2WANA 4ZFMA 2TAAA 2BHZA 2UY5A 1NP2A 1CXLA 2WC3A 1YQ2A 3GYCA 1MQRA 3QHMA 1UKOA 5CZKA 3VSTA 1VJZA 2VZSA 1MQPA 3OLEA 3VIFA 4GKLA 2WMGA 1V6YA 1QWNA 2OSXA 4S3JA 1UYQA 3L4VA 1KCKA 3VD4A 1H11A 1GVYA 3ARXA 3IJ7A 1CDGA 5CG0A 4UR9A 5JBFA 3DECA 5A69A 4NZJA 3TTSA 4DO4A 3HG3A 3OBAA 4IUGA 4LPCA 3WD4A 1MVYA 4UOZA 1E1FA 1PS3A 4P7NA 4EAMA 1CGTA 3ZR5A 5FCZA 3CGTA 4U2YA 1NQ6A 3H53A 2CITA 3BLPX 2UY2A 2F7RA 2VOTA 3VU2A 5CSYA 1UKSA 3FAWA 3VD3A 2X2YA 3WH7A 1KQYA 4XZWA 3LRLA 1HL8A 4AZBA 4Z2KA 4JFUA 3WNKA 2WK2A 3VVGA 4BCEA 1E73M 2XWEA 4OJYA 1KGWA 5IFTA 4WK9A 1QNOA 2RGMA 2QPSA 5CXPA 2ZUTA 4BF7A 3BXWA 4TVCA 4RE2A 4MNKA 2YIHA 4NI3A 4MDOA 3VKKA 1J0ZA 2WVVB 4R27A 5BRQA 2J47A 3D5HA 1E6PA 1OD0A 1E4LA 2X0YA 3ZQ9A 2WLZA 1W9BM 1E56A 3ZR6A 5DO8A 3CZNA 2VRKA 3BAIA 3OLDA 4JFVA 3TONA 1EDQA 4PUDA 1JZ8A 3WUBA 2E8YA 5A1AA 4FLRA 3A3HA 4ATLA 1PIGA 1ZBKA 3CHDA 4WJXA 2WYSA 3UR8A 1B3ZA 1QHOA 2E8ZA 2D20A 4AZCA 1MYRA 2CIPA 4HPGA 5A2AA 4B9YA 1DP0A 2DPEA 3LXCA 2XG9A 2VZUA 3JUGA 3T2PA 4AISA 1C7SA 3WH9A 5DMYA 2OWCA 1EXPA 3QHOA 4PEEA 1CXEA 3WQ4A 2GDVA 3ALGA 4X0VA 2VTFA 1OWQA 4TTGA 2IXVA 1MW0A 2HISA 2VCCA 3SUVA 3G6LA 1E4MM 1SMAA 3IGUA 4FLQA 4JFSA 1J11A 4HMCA 4JFWA 5M3WA 2ZUSA 5GPRA 3HJEA 4DM1A 3BLKA 1P6WA 5D9NA 3WQWA 2DT0A 4ATWA 4KGJA 2VUYA 4D6EA 1H09A 1QOXA 4WKHA 5A8NA 4ACYA 2G3IA 3IANA 5DT5A 2CBIA 4W8BA 3WDPP 1W9UA 4X9YA 2OSYA 1QWUA 2PWFA 1E4IA 4PMYA 3LRKA 4KWUA 4UCFA 3WENA 1LWJA 4M8UA 2F61A 1HN1A 2Y4SA 3GXIA 4AEEA 5I0DA 3ZJ7A 3L2LA 1BYBA 5CGTA 3WMCA 2A3BA 5A3HA 3EDFA 1BFNA 2DT2A 4AD5A 1MW2A 1W2PA 1JI2A 1MFVA 1BYCA 4AZGA 1HP5A 2WMIB 5LA2A 3FAXA 2QPUA 2A3EA 1V3KA 2FHBA 2A3HA 2J79A 4J3UA 1ISVA 1UKTA 1LWHA 4D6GA 1LG2A 3SCTA 1C8YA 1KTBA 4CD4A 1RD6A 3WD1A 1OCQA 5M17A 4DWSC 3CTTA 2UY4A 4JCMA 4ML4A 3ZJ8A 2W61A 4JAWA 5GNXA 4Z2LA 1R46A 1RP8A 3AMLA 5C8BB 2EABA 1DWFM 1XV8A 1JDCA 1GJWA 4WKFA 1SFSA 4TTUA 3VILA 1KR1A 3OLGA 3OGRA 1WAWA 2J7HA 5HPCA 2WPGA 4EKJA 3BH4A 1MW3A 1CGUA 2CBJA 5ABHA 3AHTA 5I77A 4W86A 3TA9A 5IHRA 2BVDA 3BVUA 1OBAA 3AZRA 2ZOXA 4UQCA 4AD4A 3WEMA 1UWRA 1XH1A 2PBGA 2D1ZA 4M56A 3K4DA 3ZM8A 3GZAA 4GZJA 1GVIA 4JHOA 5EBAA 4JKKA 4NXKA 1PX4A 3MO4A 3EDDA 3MI6A 5DF0A 2ZX6A 1MXGA 1BQCA 4AZ7A 3K8KA 1W3HA 4HZ6A 2CNCA 1CENA 4YHGA 2Y8VA 5A2BA 1OGBA 2J8GA 4OBRA 1X6LA 2DH3A 5A94A 1XSKA 1SYTA 2WC4A 2X8RA 1G94A 2DQXA 1ZJAA 1L8NA 3KEHA 2EPKX 3ZT7A 1JYVA 1WDSA 4E2OA 2W4XA 2BFGA 1XGZA 1DTUA 1FFRA 1HJVA 3WD0A 3AICA 5EFDA 1J10A 5A8QA 1C7TA 4QLLA 3II1A 1JYWA 2ZX7A 3SEPA 3ARYA 4AWEA 1HJSA 4WLCA 2XM2A 1V3MA 1D2KA 2GFTA 4NX0A 2F2HA 1BHGA 3A24A 4H8HA 1W91A 4DUXA 4KH2A 4QLJA 1O7DC 3MUIA 4OGZA 1J0JA 2JIEA 5A6MA 2FYVA 5FOOA 4OKDA 2J75A 1WZKA 1EH9A 1UD6A 3AZSA 2PWGA 4XZBA 3MSDA 1F4AA 1BG9A 2YLLA 4GO9A 2ZUWA 2Z1KA 2GK1A 1NOWA 4QCFA 2V5CA 3DHUA 1AMYA 3WDIA 2EBNA 3UR7A 4GIAA 2ZXDA 2WMJA 3HG4A 1OGGA 4M81A 4WF7A 4HTYA 5E0FA 5A6SA 4QAWA 5E09A 2ZXQA 1DWGM 3DX3A 2FH6A 4B9ZA 3M07A 1H0IA 3ZJKA 1R33A 4FMVA 2VR5A 1JZ6A 4E8CA 2WWDA 2EO7A 3KZSA 4ZXOA 3RPMA 3WBEA 4ZE4A 2BXZA 3T0BA 1B1YA 3A47A 3OG2A 3U57A 3NSXA 5BXSA 1K9DA 2WMKA 1HT6A 2XVLA 2O9OA 3PTKA 4XB3A 4CCCA 3W0KA 5JBDA 3POCA 3AHZA 1CXHA 1ISYA 1X6NA 1HWWA 3RJXA 5M5DA 3KE0A 4J3WA 4U33A 4PCTA 2ZUVA 4OIFA 2YA1A 5DT7A 1UKQA 1TQVA 4UNIA 3AIRA 1NM9A 5C71A 2D3NA 3KL3A 2OWWA 3N18A 4UOJA 1FOBA 4W85A 3VDBA 4ACZA 1QX1A 5I24A 1VBUA 4DUVA 3NYDA 1AQ0A 1EDTA 1BAGA 1I1XA 2PWHA 4B3KA 5I6SA 3AXIA 3VIHA 4HOWA 4AD2A 3VIPA 4B3LA 3F5LA 7TAAA 4WSJA 2DSZA 4BS0A 4FNPA 2GUYA 2EPMX 4LYPA 2C8NA 5CPSA 1Q4NX 1DWAM 1H4PA 2Y8KA 1HNYA 2OSWA 4AIOA 1NP0A 4Q7NA 3LPPA 2ZX9A 1KFWA 4V2XA 4OZOA 2ZX5A 2FDMA 2Q8XA 2FE0A 2YL6A 1WZAA 1ZU8A 2AAAA 1C90A 4PMQA 2WXDM 3VMPA 4FNQA 2X0HA 3ZSTA 3SCSA 3VX1A 4BQ4A 1GOKA 1R86A 4KMQA 3NSMA 4V28A 4WIWA 1O6IA 3AFBA 5FL0A 4CN6A 4E8DA 1FH9A 3CMJA 3GXFA 4HOXA 3AS2A 1UD4A 1CXKA 1V08A 1J0IA 3B9DA 1VFFA 1EO7A 3VNZA 3M7SA 5A8PA 2UWFA 3ZOAA 3RIKA 1E71M 2F18A 5A6AA 3FY1A 2ALWA 3W29A 1MWOA 4FNUA 3SUUA 2YDSA 4CUCA 1BGGA 2YL9A 2CKSA 2YKKA 3EYPA 1XYFA 4PYSA 4JKLA 4HA3A 1V03A 3WFLA 1VB9A 1QNRA 1OIMA 3FNDA 1XHGA 1E43A 4MNLA 4LXFA 4L4PA 3EDKA 4TUFA 3O2LA 1UG6A 1QPKA 4AD1A 1QBAA 1TA3B 1US2A 2EJ1A 2YOCA 3VDAA 1QHZA 1TVNA 3WL0A 3WQ6A 1GW1A 1PZ2A 4DO6A 4ZXLA 2VZVA 3WNMA 3F5KA 4HMDA 5BWFA 3WF1A 2VRQA 5CPTA 1OGSA 3NJ3A 1W1PA 4M82A 1KGUA 1NWSA 3VM7A 3O9NA 3WDRA 1HTYA 1JZ3A 4J3XA 2BY2A 4MB1A 4P7QA 1PBGA 2DIJA 3WNPA 3WFZA 4P7OA 3CPUA 2CPUA 5D8ZA 3VGBA 3OGVA 3K1DA 2JF6A 4CN1A 3MKKA 1W1VA 1D7FA 4TOQA 1VF8A 1HP4A 1UR4A 1IT0A 3RM8A 4UFKA 4HZ8A 1R75A 1CPUA 1AQHA 3AJ7A 1X1NA 3BLBA 1OT2A 4U2ZA 2E0PA 2VCBA 1K9EA 2WMIA 5A6BA 3WF2A 1OD8A 4J3SA 1UR1A 3SCQA 4PRWA 5JIPA 1C91A 3MSGA 1LL7A 4CVWA 1UWTA 1QI0A 2YFNA 2QMJA 3BAJA 1EIBA 3MU7A 1A3HA 2J7EA 4A3HA 3NDZA 4M80A 1GQIA 2X2JA 4MNJA 1E4NA 2E9LA 4PSRA 3PZUA 4HU8A 4MADA 3ARVA 3GM8A 4PMDA 3WY3A 1O7AA 3WQ5A 2D23A 3WD3A 3AROA 1LG1A 3MS8A 4CU6A 3VPLA 3SCNA 1KR0A 1JNDA 5HXMA 4FK9A 2D2OA 1C93A 2DH2A 4M29A 4AYGA 5D9MA 2W5FA 4MJ2A 3BUQA 3LPFA 1E1EA 1FP9A 3WY4A 5CLWA 2QLYA 1CGVA 3BSHA 3BMVA 3U5YA 2VX5A 3PZ9A 4GINA 4AXNA 1WPCA 1PX3A 3K4AA 1TR1A 2NT1A 2ZX8A 3AOFA 1IZKA 3AIBA 2YBTA 5FD0A 1UD5A 1QNPA 4UTFA 1JIBA 2J7GA 1JI1A 3BSGA 2ZUNA 1J9YA 5D9OA 1HX0A 2EPLX 2E9BA 4UFIA 2BY0A 4OBSA 4C7DA 4CN4A 4MJ4A 2WHMA 1KTCA 1KXHA 2CBVA 2JEQA 4W84A 4EANA 4HA4A 3HN3A 2J78A 3IJ8A 4C7GA 3RO8A 4N0RA 3CZGA 8A3HA 4CD6A 3WQ8A 1WZLA 3DX2A 2CERA 1AQMA 2VURA 3IJ9A 1Z32X 2WCAA 3PTQA 5A6LA 1UKPA 2W62A 2F1BA 5IHSA 1T0OA 1JFXA 2O9RA 2NT0A 1B90A 3CHEA 1W9PA 3GNOA 3EDEA 3A22A 3WD2A 4N42A 4UFJA 2Z1SA 2AOSA 4HOZA 1EOMA 3B9EA 4R5EA 1QI3A 2G8ZA 1KGXA 2XVNA 3VIMA 3S2CA 3KL5A 4UOQA 3ARTA 3W53A 3MV11 2RGLA 2JALA 3W27A 1QI2A 4GZIA 3MMDA 1FHLA 2J7BA 3WF4A 1Q6DA 3SCUA 1ITXA 1HJUA 1PX8A 4WKAA 1VEOA 2XM1A 2YL8A 1EOKA 2BVTA 1V0MA 1UQYA 1UH4A 5LYRA 1CTNA 2CHOA 1QW9A 1MFUA 4KRTA 3WDHA 3CHFA 4PMOA 1GPFA 3CZSA 2IGTA 3LXAA 1S46A 5ABFA 3UG3A 4M24A 1CEOA 3AIVA 3SCPA 1WDQA 2XUCA 2FGLA 3WF0A 1JDDA 3WUEA 4JHZA 1TZ7A 1E3ZA 2WZIA 5AYIA 2WAGA 3CV5A 4HPHA 2YBUA 3PZIA 4MB3A 1V02E 1YHTA 4X0NA 3AXHA 4CCDA 1GONA 2GVYA 1CGYA 5E70A 1CECA 1CLXA 4GQRA 3UG5A 3KL0A 2VRJA 4LYRA 4GI9A 3H54A 3WEZA 6CGTA 1BVNP 5CJ5A 2BHYA 4NRRA 1VIWA 1F4HA 4NZCA 4P7LA 1JZ2A 1EHNA 1JYNA 3THCA 3N12A 4UFMA 7A3HA 1JYXA 2Y24A 4D6DA 3MUY1 4S3KA 5E1QA 3VGDA 2XFYA 4H41A 3MUZ1 1UWIA 1W2VA 4QLKA 2FHCA 1QVBA 1B3XA 3BGAA 4F9DA 3AS3A 4BQ3A 1VEPA 1ZL1A 1B2YA 2J7DA 5ECUA 1BYDA 3KLLA 1BYAA 1UWQA 4LQ1A 3SUTA 3CUIA 1BSIA 5BYWA 2FH8A 4AIUA 3PZQA 2PF0A 2C7FA 3OB8A 3F5JA 2A3CA 1V6WA 1W32A 4Q22A 4JL1A 4W93A 5HPOA 2CHNA 3CH9A 3VDCA 3VOCA 3BCDA 4YPJA 2DT1A 4PTWA 1GOWA 1TMQA 3A5VA 5AYBA 3DX4A 1EGZA 2OW6A 1HL9A 2J7FA 2XN0A 1VEMA 2WW5A 1UOKA 4CKQA 4ZEPA 1KQZA 4H8VA 1V0NA 3FW6A 1HKMA 3D3AA 1JG9A 2D73A 5BXRA 1H2JA 2CBUA 2ZICA 4XUYA 3SCRA 2VJXA 4Z2IA 3BAXA 1V3LA 5KZ6A 2J7CA 1ZBWA 1KXVA 4UQDA 2VZOA 3F4VA 5AC4A 1TA3A 3B8SA 4CD8A 3ZMRA 1HJQA 2OYMA 1XYZA 4QDMA 4FNRA 4AZCB 2BHUA 1V0KA 2UY3A 2EQDA 1B30A 2BVYA 4PMZA 5ABEA 2G3NA 1V6UA 3WEOA 3PZOA 4GO8A 1C3FA 1KXTA 2XSBA 2OW7A 3BAKA 3W81A 2YDQA 3HG2A 2OYKA 4RL3A 4HZ7A 3DYOA 4UZUA 1V3HA 1IZJA 4CU8A 2QMKA 3WQVA 1OM0A 1GQJA 3GXNA 1PZ3A 1UZ4A 3AS1A 1LLOA 1K6AA 1GORA 1VENA 3LMYA 3MMUA 5HBFA 5I79A 4V27A 1VFUA 2D24A 4RE4A 3ZSSA 3J7HA 3AHVA 2ESCA 1WDRA 4AY1A 1R85A 1TUXA 5FL1A 1PAMA 1NARA 3K8MA 2XPKA 1TQTA 1ODUA 1B3VA 5BRPA 1W1TA 2J4GA 2Y2WA 4J3TA 3A23A 1K9TA 2ZXBA 1WO2A 2OYLA 5GNYA 1G1YA 1C8QA 4F8XA 1EO5A 4H04A 2XTKA 3AZTA 1R7OA 3EJQA 4E4PA 4MB4A 2A3AA 2O92A 3AIUA 3N15A 3NUKA 1E5JA 1KWGA 4GZEA 3VGGA 1XC6A 3FHAA 4AZ5A 3A4AA 2XWDA 2XGBA 3HG5A 4FF5A 4AD0A 4JL2A 1TG7A 3VIIA 4LX4A 3AMDA 1R8LA 4W87A 4AC1X 3DDGA 3BUIA 3CHCA 1H49A 3BCFA 5AY7A 2E9MA 3NCOA 1CLVA 4TX6A 2XN1A 3WDJA 4NZFA 4AZHA 4URIA 3CUHA 3T0AA 4AD3A 3LPGA 3RMEA 2WCSA 1V02A 4OUEA 4AIEA 1JZ4A 2YA2A 3L2MA 3VUPA 5E6ZA 3QR3A 4ATDA 2WCGA 2XGIA 4CVUA 1E6QM 2WSPA 4OOZA 1HXKA 1H3GA 1E72M 3LXBA 3T2QA 2ZE0A 3RILA 1HKJA 1W3KA 5A8MA 3DDFA 3VSUA 3AS0A 3PZMA 3GH5A 2WVVA 3D50A 1UWUA 5IXEA 1KBKA 1VFMA 4MAZA 3GBEA 2W92A 1J0HA 1XH0A 4CD5A 2G3JA 4AEFA 4Y7EA 5LA1A 4W8LA 3SIMA 5D9PA 1HJWA 4JFTA 5CGMA 3WNOA 2C0HA 3PZTA 1E3XA 3VIKA 5A6JA 3K46A 4CD7A 2GJPA 2W63A 1BF2A 1TVPA 1XD0A 4P8UA 1IV8A 4FNSA 4KGLA 3WNLA 1DWIM 3VX0A 2WMHA 3EDJA 3VO0A 3WSUA 1MW1A 1QW8A 4L4OA 3TV8A 1I1WA 2DSKA 3WBAA 2ZWZA 3ZT5A 1ZS2A 4D6JA 3WUFA 1ZJBA 3RM9A 1R87A 4UQ9A 4GPNA 1UWSA 3SCVA 1WP6A 2CKRA 3AIEA 4AMXA 4JZ5A 3ZIZA 3POHA 3SURA 3VGEA 3W24A 1UD3A 5GQBA 2EADA 3VGHA 1UASA 3IAPA 2W66A 2JEPA 1V3JA 3PZNA 5I78A 7CGTA 1NWRA 2BNJA 2VC9A 4D71A 1M04A 1Y7VA 4HP5A 1VRXA 2IUZA 3UG4A 5M03A 3LPOA 5E9AA 3WUGA 5JUVA 3OA5A 2Y5EA 1J18A 3GXMA 4H7VA 2D0FA 1UD2A 3NDYA 4FLSA 2VO5A 2W91A 4LYQA 5FKYA 3SCOA 2GK1B 3UESA 2X2IA 2CETA 1HXJA 1FHDA 1U33A 1ZBVA 2ZUMA 3GNRA 2J8FA 2EPNA 4HMEA 2X09A 3EJSA 2F1AA 3B9AA 5ABGA 4UQAA 4BA0A 3A4XA 4D1JA 1OIFA 1E0XA 3WKZA 4AMWA 3O6AA 4A4AA 2DSVA 2F7QA 2XIBA 1JD9A 3WIJA 2VZTA 1GQKA 2WHJA 3QHNA 4U31A 3VGFA 5FIPA 3U5UA 2GJXB 1CZ1A 5D4YA 4J3VA 1LL6A 3CC1A 2BS9A 1DWHM 4TXEA 2OLHA 4J28A 1WCGA 4HU0A 1UHVA 2DDXA 3PTMA 5JBEA 1QI5A 3GXTA 2QV4A 3TTYA 4U5IA 1QHPA 1JF5A 3PN8A 4ZE5A 1E55A 2NSXA 1GZJA 5EMYA 2BV9A 4P7RA 1SMDA 4PMRA 3CZLA 2D0GA 3ZO9A 1W9XA 2WZEA 3U7VA 3D4YA 4DWSB 1Q6GA 1EDGA 4IPLA 4W5UA 4A3YA 2BXYA 1LF1A 1JF6A 4BQ2A 1R34A 3S6TA 1NOUA 4ACZB 2E3ZA 3UETA 3LRMA 2WVSA 3TP4A 1XCWA 2BY3A 1E6SM 2VT0A 1W1YA 1H0GA 1TCMA 1C92A 1E5NA 2CESA 2PC8A 2WVUA 2VL4A 4QP0A 5I3DA 2VX7A 4F79A 3ARPA 4PTXA 3VTRA 1TE1A 4EK7A 1ECEA 3S5YA 3AHXA 4M1RA 1PJ9A 5TD4A 3FHQA 3CO4A 4Z2GA 2YJQA 3G6MA 3QOMA 1NWUA 1JXJA 3BUBA 2WM0A 3EMCA 3CBWA 2CEQA 4MTVA 4PCSA 4UQEA 5CSUA 1PPIA 4W5ZA 4PMNA 3ECQA 1UR0A 3AI0A 3TTOA 1WDPA 1WZMA 4D6IA 1UH2A 4NRSA 3WH5A 3WL1A 2D0HA 1R47A 2YLAA 2ZUUA 3WMSA 2XJ7A 3VMNA 2J77A 2EAEA 1JAEA 3SUSA 2DSUA 3EMZA 1OT1A 3OIHA 4MB5A 4UFLA 3T08A 3PZVA 4MDPA 3BVWA 3DC0A 3EBVA 4UZSA 3EJTA 3AMGA 1SR0A 4PMUA 3L4TA 1VJSA 3ARWA 1BTCA 4FNTA 4B16A 3HZ3A 1I75A 1E70M 2VX4A 3EJPA 2PWDA 1V3IA 3AQUA 1ISXA 3PZGA 1RPKA 1CWYA 3CZJA 1PEZA 2JFEX 4Z2JA 3AHYA 2WBKA 1A47A 2XVGA 3ARRA 1Q6FA 1BLIA 2GDUA 2WLYA 1JGIA 3GNPA 1RP9A 3M6DA 3KLKA 3HU7A 3N13A 2E4TA 3NSNA 5EB8A 1XCXA 3VD9A 1G5AA 3GDBA 2MANA 4PUEA 3AIQA 4PMVA 3ARSA 2DSWA 2J62A 1OSEA 2PI6A 3N04A 1JD7A 1GJUA 1JAKA 1TQSA 2WSKA 1W3LA 3I3DA 4PBGA 4QFUA 5BXPA 2CYGA 4D72A 2IXUA 4P8VA 1NOFA 3DX1A 1XD1A 1KXQA 1CYGA 1TQWA 2JF7A 3ARQA 3VINA 3I3BA 3W28A 3AYSA 5A6KA 2J74A 2ZIDA 2GSJA 1WKYA 2EPOA 3MMWA 4GI8A 3MUAA 1OB0A 3W37A 2V38A 2VVNA 4MNMA 4D6FA 1E9LA 1B9ZA 1N82A 5GNZA 3EMQA 1JDAA 5A95A 3IK2A 2XFFA 4PSPA 3WH6A 2WZHA 5DEZA 5JIWA 3IAQA 1E6NA 3KWXA 3CLWA 4JKMA 4Z2HA 3VD7A 1HKIA 1HIZA 5A8OA 1RH9A 4DWSD 5EFFA 5HOSA 1UH3A 4ZENA 4YHEA 3BVTA 2D3LA 1JFHA 2V3EA 3RCNA 3ALFA 1ITCA 1VBRA 4H2CA 3VM5A 4QCEA 2VR4A 2XHYA 2YL5A 2QF8A 1GNXA 1HKKA 1QI4A 3BMWA 3N11A 1M01A 5F7UA 5C70A 2XSAA 3GH4A 2EEXA 2O9PA 3AMCA 4U5KA 3T09A 6A3HA 1M53A 1XSIA 3CUFA 5HDRA 1BG4A 3W6LA 2XN2A 2WHKA 1UR8A 4AYSA 3MANA 4PMXA 1JNEA 4TVUA 2WKLA 3N1AA 2F7OA 1UD8A 2JE8A 1CIUA 2G41A 1JXKA 1G0CA 2WBGA 1ZBCA 1H5VA 3HMCA 1M7XA 4DO5A 1FP8A 3OGSA 2VQTA 3MV01 1H1NA 1R7AA 3L4YA 3BUDA 4W88A 2PB1A 1L0PA 3THDA 1WNOA 3RJYA 2V5DA 1VAHA 1CXIA 3CUJA 3CMGA 3A4WA 4GQQA 3AMKA 3QGVA 4AZ6A 1GOQA 3TTQA 3NIYA 1ISWA 3BVVA 1XRVA 3N9KA 4NF7A 1E40A 3L4XA 1FA2A 4RE3A 4NXSA 2E40A 4D6HA 1NWTA 3GXDA 4U3CA 5I2UA 1V6XA 2VCAA 3OZPA 3CZEA 3UCQA 3VMOA 3AYRA 1GQLA 4NSBA 1G9HA 1J0YA 2PWEA 4AW7A 1XSJA 4BQ5A 3OZOA 3D51A 1JL8A 2O9TA 2W67A 2G3MA 1NH6A 1K9FA 1QNQA 1J0KA 1GOIA 1EHAA 1E6XM 3N17A 2WVTA 1UR2A 1UUQA 2DGAA 2WNWA 3EJRA 4IISA 5KEZA 5BROA 1MXDA 1G01A 3DYPA 3BAWA 2ZXAA 5E6YA 1H41A 1FH7A 3WDQA 3GH7A 1JZ5A 1MQQA 2DEPA 3GBDA 3EJUA 2WHLA 3T0DA 1DEDA 1CBGA 2YA0A 1B3YA 4HA1A 5CPQA 2PBOA 2X2HA 4TX8A 2GJXA 1B31A 1D3CA 1AVAA 5I23A 1C8XA 4AZIA 3S5ZA 4JIEA 1BGAA 4W89A 4AMCA 2G4FA 1HJXA 4GI6A 1W3JA 2VNCA 1CGWA 2JIWA 5A2CA 3RDKA 5ABFB 4W7UA 3L4ZA 1ISZA 3CIVA 1QBBA 3QOKA 4DWSA 3CUGA 5CQ1A 5D8WA 1KBBA 5A6BD 1WB0A 1J01A 4IPNB 4B15A 3GTNA 1FH8A 5AC5A 8CGTA 1B0IA 2CCRA 3VNYA 1UA7A 2VQUA 4CCEA 1ESWA 1CXFA 3FN9A 3U7BA 4P8WA 4GXPA 2WWCA 3ARUA 4YN5A 1BVZA 3ZJ6A 1V0LA 3T2OA 4CGTA 4PTVA 1UQZA 1JZ7A 2DT3A 4DUWA 3A6OA 4U3AA 1E0WA 1QNSA 4J27A 4D6CA 4F66A 3AIWA 3W25A 2GJRA 2FGZA 4KRUA 1OINA 3WH8A 1GHSA 3UEQA 4C7FA 1Q6EA 3WF3A 4WSKA 1GOOA 1LL4A 2D22A 2V3GA 1TFVA 5BCAA 1E6ZA 1BPLB 2B31A 1E6RA 3W82A 1DHKA 2VVSA 4XV0A 2YDRA 3ZT6A 1GHRA 2XVKA 2HVMA 1HVXA 3FXYA 5IFPA 1GOMA 3W26A 3VIGA 1CNVA 3BC9A 1VFOA 1HVQA 2EACA 1FFQA 1V6VA 1LQ0A 3I3EA 4H8UA 4XX6A 3BUPA 1SZNA 3WN6A 1UA3A 1GCYA 3SCWA 3VD5A 3WY1A 4JCLA 1ZB5A 3CZKA 4PN2A 1GUVA 4BZYA 1DWJM 1E15A 1LJYA 3DYMA 4PTMA 1EQPA 2WKGA 3D52A 4K68A 2FHFA 4LGXA 3CZ8A 3TOPA 2QHAA 1UR9A 1UZ1A 3VIJA 3OLIA 1KWKA 1HF6A 4D1IA 3PBGA 4J7RA 5I5RA 1US3A 2BY1A 3GXPA 2J25A 1EA9C 1PIFA 3VSVA 3DHPA 5DFAA 4MPKA 3BAYA 1TQUA 1U30A 9CGTA 3L4UA 4IM4A
chains in the Genus database with same CATH superfamily
2YLKA 5D2NA 3QXBA 3GG1A 3QEHA 3VFNA 1QCWA 3DWTA 3AT8A 1ORQA 3WJLA 1WV7T 1EGJL 3KNBB 4NT0A 4L4VD 3UYCA 3QTPA 4N9OB 2IQ0A 2DLGA 2X05A 3ETBF 2FYYB 2DWYA 4HK3N 3FB6A 1U2YA 2EXOA 3HGSA 3L4WA 4Q8QA 5D70L 4YHNB 1JGEB 4WI4A 1GEQA 4CL7A 1TWDA 4NQDE 5C0DB 5L2KA 2OXGA 4RW3A 3K8LA 1PG7L 1KB9J 2XSKA 2E7HA 4RNRA 3LX9A 4RMQA 2E9GA 3CL7A 2Z8WC 3DV4B 7REQB 4W7WA 3G6AA 3T6ZA 3SSJA 2H41A 2NY4D 5TFSL 4IFKB 5E1AB 3QJAA 3P0GB 4S3JA 3L4VA 5E2VL 1P2CB 1H11A 2DY2A 1CBVH 2V2WB 2DS4A 4AHQA 4DO4A 2XA8H 3ZK0A 2HYMA 2GPTA 5DJ8B 4N2EA 2D7NA 4B5EA 2CITA 4HWBA 4X6BB 1E5YA 1IMHC 4Z7WB 4MXVF 2BP0B 3SDXA 4ZJ9A 4D3CL 1E73M 4KKAC 2CDFA 5KBDA 1QSEA 4M6QA 2GOUA 3BXWA 1FHNA 2BRRH 3PAOA 5BRQA 4Z8FL 2CLMA 1V79A 2ICCA 2XWJB 4KWOA 4MKSA 4RWYL 5E9DB 4QXTA 3TONA 4NNXA 1A5SA 5FJJA 4KETA 1XLAA 2PUZA 2WYSA 2C7UA 2KMWA 2PLJA 1AJ2A 3T0EC 3MSYA 3GQYA 4P5TB 2ROXA 2ADJB 4ZW5A 4HPGA 3U4EB 4IM8A 2OCCB 4H1LA 5JIIA 4G43B 2YCLA 2HRHA 1L7IL 5DMYA 3KOZA 3QHOA 4PEEA 3EW3B 4HIIB 5C9JB 4GY1A 3FO0H 4G9FB 4TTGA 1GA2A 1MW0A 2VCCA 4WWPA 1W5PA 3PUDA 1KCSH 3IGUA 1IAKA 2MHAA 1SVCP 2ZUSA 1T4WA 3HJEA 3BZFB 4N2GA 1Y0LA 3BLKA 2JKEA 4WQOA 4TVPE 4HUUA 2DT0A 1PFCA 3WUZA 2JK2A 3PP7A 3D34A 4EXBA 4FR6A 1WBZB 4G6JH 2Q3OA 4KK6D 4LY8A 2X28A 1KV7A 1G1OA 3LRKA 2AV7B 2R1YB 5D5MA 5FECB 3MVSA 3LDBC 1RH8A 1N8ZB 3SGZA 5I30H 4RETB 1OF6A 3KRSA 2HZHA 1BEYL 4HCIA 1INEH 2TRSA 2H4EA 2AF2A 4D6GA 2O26U 1RD6A 4EWJA 2VSMB 4JCMA 2PR4H 1P9MA 3VTAA 4JXCA 1LO0H 4HK0B 5GGSA 3IS0X 3F01A 3US9A 3LTSA 4TTUA 3VXOA 5ABAA 5C3LD 4DI8A 3IV8A 4G5ZL 3WS3A 1QACA 4UQCA 4AD4A 1UWRA 3W0WA 4O02A 3DMMB 2OXHB 3KPRE 3DAQA 4GZJA 3V4UH 1QO5A 4S1FA 1FI8C 2IBBA 1AQ8A 2AK4D 1I8LA 2CNCA 4JTIA 3LIZA 2PPAA 1I8KA 1H3PH 2X8RA 4OFQA 1ZJAA 1JPEA 3NCWA 3D0LB 3KCWA 1XGZA 1QLRA 5EU4A 3P5YA 1PIIA 1L6ZA 2FT8A 2QGCA 3A5FA 5KN5B 4OIIL 3SE4A 2MFNA 4KH2A 1NEZG 3OZLA 4B5WA 1BQGA 2BK8A 3OKOA 1G6VK 4PJFB 1RIVH 1F4AA 2COVD 4F58H 2ZUWA 2Z1KA 4N5ED 1JXGA 4I18A 4NM8L 2JXMA 4MUPA 4HSCX 4M81A 3QEGL 2GL5A 4HZAA 1I1AD 2K4AA 2YHGA 5DTFB 4MAYB 4B9ZA 4XPGH 3LLDA 1IC7L 2QUTA 3EYUL 3PIQB 3EGDA 4Y7OC 2QEJA 3KWSA 5LNWA 2NY7H 1ZT7B 3H12A 3KLHD 1YE4A 3K2KA 1VGEH 4NHCH 2LQRA 2WZ5A 5KOVC 1DO6A 3VA2C 3WE1A 4BFJA 3L1OH 2I24N 1H0DA 2VDKL 4O1EA 1Y6KR 5KVGE 2P5WB 2VLLB 3H56A 3UNDA 4L3AA 4R8WL 1CWVA 4JGMA 3LOWA 4KXAA 2Y62A 1ZZMA 4YHZH 3VNLA 1N8IA 4JM2F 3WSQH 3GBMH 4U1LA 5DZPA 3WFDH 3CFIC 3AXIA 2VC2L 5DSCA 5HYQB 4FRWA 3QORB 1L7TL 2OMAA 1P6BA 2XG4B 1HJCA 3OKKA 3DENA 2Q8XA 5E5LA 1SOXA 1NIEA 1QABA 2ITFA 1AR1B 3RYMA 4YE4L 1O6IA 3SKNA 4O1BA 2FSDA 5GRJL 2CO3A 3QUZC 3K6SA 5GS0C 3TT1L 1ZY9A 2ALWA 3BH9A 3NO3A 1A65A 3W29A 2CW6A 3AW5A 4DHGA 1W80A 5L4JA 2CKSA 1AQKL 1XYFA 5C0IB 4XXCA 4ODVL 4PE8A 3TVMA 3WLOA 1UG6A 3ULUF 3LEVL 4Q14A 1EZLA 4JTRA 2O6EA 1XUUA 4QLWA 1QLEB 4PJ8A 4Q56A 1CDIA 2HKFL 1T83C 3UNTA 3AITA 3H1ZA 4KUZL 5DJ2A 1G7VA 4P7QA 3B2PA 1YX1A 3MCKB 1MIEL 3BW2A 3TJ4A 3CPRA 3CFJB 4WVXA 1IGYB 2JGYA 5C6WH 4OCLC 3MAWA 3M43A 1SO4A 5D30A 5J3HD 4CC4C 1ITUA 2JFCA 3WTTA 5A16B 1RU9L 4ZTPL 3MU7A 3MR9A 3FSZA 2DWSA 1LRNA 3EG9A 3QO0B 1VPXA 2VM8A 3R6IA 4LSVH 4QX4A 3GM8A 5EA0H 5C2CA 4I8YA 3ZZSA 4JFYB 4XKYA 5KVEE 1JNDA 2WXNA 1C93A 4IRSB 4K8HA 2X4RB 2G60L 3H2AA 3QI9A 1OCWH 5JTWA 1KM5A 2O5ZH 4NO0B 3BZ5A 3U5YA 2XZCH 5HHVH 3S3BB 4NKMA 1HNFA 1YAIA 4AQAB 1T1YA 3BSGA 4JAMB 5D9OA 4BSWA 1JNJA 4F0HA 3SKOB 3IGXA 4G9DB 2NXHA 3HCVB 1E9IA 4LEXL 4LNVA 1AGBA 5F6IC 4K8GA 5AKRA 1GC1C 2W62A 2Q02A 5FJRA 4ERSH 3CFEB 3MVTA 5CMAB 4YMZA 3VOJA 4JQXC 3FU8A 1RCQA 4PBXA 5K5YA 1E1CB 4M5ZH 4LOEA 3S2CA 1TIUA 3L1GA 1MN4A 1KGIA 4FYRA 2A6KA 3T2NL 3Q6GL 3UWUA 4HFUL 3MV8E 3CXDH 5DD5H 4HC1A 4XXWA 1EOKA 4XAPA 5LYRA 4JYFA 5F96H 4FA3A 1V7YA 3AQZA 2VD9A 3O3DB 3V0IA 3S88H 5KANG 4CAGA 3MV9B 4Z3GA 5DZAA 1S46A 3NFNA 4RSVA 1YMHB 3QF0A 5KBNC 3FO9B 1TZ7A 4R5VA 3CIXA 2A6NA 2WXHA 4ROQA 2CO1A 3MLXL 3MHZA 1M4KA 4ALAL 4RAUA 2W88A 5CFAA 4N2CA 1NFIA 2W27A 2HFGL 2K45A 3OMIB 3H54A 3QC0A 1T1ZA 5ISZD 1AANA 2OS7A 1TPFA 3CFCH 3T6XA 4Q9CA 3O6CA 1IKFL 2YQ3A 4NI8A 2XFYA 3MUZ1 2AGKA 3WQGA 3D3FA 2F74A 5JPNB 5IJVA 4RKAA 1ZL1A 4HKBA 1DFBH 4XN1A 4ACTA 3PZQA 5BQ7A 3I6GA 4PTDA 2PF0A 4G3YH 3WUWB 3VRIA 4LEFA 4Q22A 4YFLF 2F6UA 1A5CA 4XCEB 3AREA 4IGBC 4HIHB 3W7DA 4Z7NF 4PREB 5AYBA 4B5NA 4UDUB 3QUKB 1CW2A 4PLNC 1USZA 1F3DH 1P7QD 4Z7VB 1AACA 4KJYA 3OD3A 2D73A 3LN4B 1Q0YL 3IGFA 5HQLA 2ZWNA 1JRHI 2J7CA 2K6ZA 1T21B 1ZBWA 4PCPA 2H3NB 4JB9L 4GG6F 2P1YA 3KNBA 4Q8NA 2PDMA 1GS6X 1TFPA 3GO1L 4N0CD 3B8YA 5ALBL 4EZJA 4U0RB 1XDTT 2BVYA 4X6EB 2FYYA 3HC0B 3V4VA 3LHAA 3UPRA 2GIXA 1PYFA 4YHNA 3TYEA 1EEQA 2GBVA 8XIMA 4LAKA 1PZ3A 3T71A 3CQFA 3GY1A 1NAL1 4Q6IA 4XVEA 1R85A 4LOFA 1NARA 1GYUA 4M6VA 4N2AA 1FWRA 5AAMA 1DBKH 2H3KA 3DV4A 3WL9A 5C1MB 1ZTVA 1NKOA 3KG5A 4LLYA 3P11H 1E4WL 5DJ6B 3QFJE 5CO1A 1ACCA 3SQMA 1LEKB 4E4PA 4IFKA 3HPFA 1EBHA 5FOBB 1I45A 3NACH 3STFA 4RESB 2XWDA 1P2CA 1VHNA 4RXGA 3M5YA 3PPGA 1YMME 1GPOL 4LX4A 1YY9C 1OSPL 2D4FA 3TYDA 1XHHA 5MI0B 3QG6B 1OAZH 1Q6OA 4TX6A 5FW6A 1EL3A 3VQ2C 4NZFA 5INCB 2OYPA 1EJWC 4HJJL 4N90E 1OAKH 4EIGB 3MKCA 3GXUB 1A53A 3P0YL 3HC2A 4MA3B 2VDLB 4NP4H 1U8KA 5AC7A 4HZLA 5IV2A 3P77B 1KBKA 5IXEA 2ICEB 1XH0A 4X5WA 1TWZA 2XWJA 3LN9A 3SGEI 5EZPA 5A6IA 3OC5A 5E9DA 2B4GA 2QVHA 2I1OA 4WXZA 3TSBA 1OHLA 5JDJA 4IKJA 2V81A 3TIMA 4KGLA 2ADJA 1O66A 3ZKQD 2QVTA 1FCBA 3PWLA 3WUFA 3BQVA 2ZUQC 4MNQD 4YN3A 1WP6A 5EH1A 1PTAA 1MRFL 4HIIA 5C9JA 3S5LA 3B9KB 4LRSA 2EADA 1KV5A 4XNUL 2PO6C 2IDFA 1NWRA 1E65A 3NZ8A 4L6HA 1ASPA 1RXLA 5KSAD 4QD2E 2Q3RA 1HILB 5I6XB 4P46C 5HD8D 5BZAA 4X63A 4K8RD 4A6YH 4Q9RL 1MNUH 4CBPA 3KVMA 1WZ1L 1VH7A 3V6OE 2R1YA 5FECA 2FZBA 3V0FA 3MRBB 3RRAA 4R7WA 1HS6A 3L9CA 2XXFA 4UQAA 4FFZA 1E0XA 5JXEA 1I4NA 2VDGA 1W0VB 2MPAH 2XN9D 3BP4B 3VGFA 3MUCA 2J57A 4WCYL 3FIGA 4M7ZB 3E3HA 5XINA 4FG6C 2OLHA 1YVLA 1B6UA 4C65A 5B21A 2PGWA 3KEDA 4DGIH 3FT2B 2IQAB 2BV9A 4AQEB 1KPVB 4TN9A 3GU2A 1RCYA 2ZNWA 1DVJA 1T66C 1EDGA 5D4HA 2GWNA 2NY6B 1UJ3B 4CADB 4K23L 3UZWA 3S6TA 3FKUS 2WYTA 1CDJA 5IHBA 1NBVL 5DO2C 4XTIA 5IMMB 2CESA 1DORA 2PDLA 4M7LL 3ZS4A 3WV0A 4LLDA 3GM0A 4ZQRA 4LHUA 3THML 2NZ9C 5TD4A 1TPXC 3HS9A 5IW1B 2VLRD 1ITBB 3U0WH 5GS0H 5HDBE 4PJXB 1UENA 3EMCA 3HE6D 2Z64C 1SO6A 2O6FA 4JKNA 3LHVA 4OZFH 4WKXA 3RY4A 4TSBL 3X12A 5ANHA 4PJFA 3O9WD 5HHNA 3VMNA 4JJOA 4NNBA 3T0ED 1OT1A 3LSOB 3T08A 3H42H 4Y5VB 1IR2A 3NGBC 5CNHA 3L4TA 5DTFA 1A5FH 2EKSB 5GGSY 3CSGA 1QD0A 4HWEL 3B06A 5EZIH 1YADA 3NGFA 4UQ2A 3SDDC 5BJTB 3PZGA 3QDJE 2BCMA 2JFEX 4I48B 4X7SL 1XLHA 3AHYA 2OKMA 4F1ZA 4BDVB 5F7MC 3WFHA 3OG3A 4R83A 3IVKB 1YSOA 1N3NB 2UUDK 2ZYIA 1DBBH 5E2WH 3FSOA 1OWWA 4MA7H 1GJUA 1MI5E 4ZSUA 3FSVA 4D8ZA 4YZFF 3UPBA 4DEUA 4PJEB 3NVDA 1AZNA 3FJNA 3P30H 3PAYA 4DKEH 4UNUA 3RPDA 1QTYT 4DERA 2XFFA 2A79A 1E6NA 5HYQA 3VD7A 4PUNA 1J1XL 4WI0B 4K8RL 2XG4A 3NN8B 2PXYB 4XG1A 4GQPH 4W9JC 3QYQA 4YDJB 3QR1A 4FO4A 5BPPA 1MLBA 3N2BA 3WJJA 4K94L 3BFOA 1XSIA 2NR6C 5KVMC 2IBZX 3THQA 3XISA 1KRAC 3MANA 1TV2A 4FPSA 4TVUA 3INUL 2BX7A 3ME3A 2CM5A 3L7RA 4DLFA 4RCXA 2UV3A 1JXKA 1CU4H 3ULAB 2WBGA 5EMJA 3QFGA 2BCKB 5LNUA 4HEPG 3UADA 3BVJA 3OWEA 2N1TE 1GC1H 1AUSL 1MHEA 1OE1A 4WEEA 1J86A 1SOQA 3N29A 1WNOA 1JBJA 1XPGA 1UXWB 4NKCA 2CR3A 1LQ2A 4X4YB 4GAGL 2UZ9A 1PJWA 1E9OA 5DCCA 3JWNH 4L37B 4J4PD 2VCAA 1N0LA 3I6TA 3LS5L 2NQJA 4Z0XB 1LP9E 2CRYA 2W95A 3AG1B 4DZ5A 1RBAA 4Z77A 2VDRB 1J0YA 1N26A 4PJ9C 4FFVD 5EB9A 3C5ZD 5DUBB 4I3SL 3R94A 1K4CB 3T8VA 1GOIA 4HXBL 2XKUA 1IT9L 2IANB 5TBOA 3DRTB 1UZDA 3UYPB 3I7QA 1I2NA 1ZJHA 3D33A 1FH7A 2ZOLB 3S1GA 2DW5A 5DK0B 1MQQA 1GGBL 1MPAH 2GUOA 4LGRB 1N64H 2RDUA 1T8XA 3GMOB 1QPNA 1IEHA 1M1XB 4PD4K 2B9BA 4ZAKA 2N0MA 4BZ1A 2P7TB 4H4IA 4JRXE 3RU8L 5HI4C 3W56A 4GW4B 3SY1A 4ZS7H 1W3JA 3IJLA 1POJA 1TQCB 4OZFG 1RAMA 5D8WA 2DI7A 4ODWB 1RFDH 5HGGS 4IRSA 2KZWA 2HN7B 1F2QA 2FMNA 1NWPA 4NO0A 2WM1A 3SFKA 4GXPA 3TWBA 1BVZA 1T04B 3LNGA 4EF3A 5T5NF 4CGTA 4ORIA 1O5RA 1JNHA 2DT3A 3GU1A 1QNZH 4F66A 2GJRA 3V6BR 4AQAA 4U1IB 4CNIB 1LO4H 3X1FA 1N59A 1B4EA 5BCAA 4QOKA 3SKOA 4UB0H 3W82A 4G9DA 3HCVA 2P8PA 3KWWA 4BA8A 4B2DA 4DVBB 2QV2A 1H3UA 1HVQA 4LIQH 1LQAA 5LHDA 5FGRA 2OZ4A 3HZMB 3W72A 4QJ3B 3ARBB 3V6FA 1A4KB 4QYOB 1ZB5A 2FL5B 1VD6A 4NCDA 4IH3A 5ID1B 4G9PA 4PTMA 3CFEA 5E99L 4LGXA 2F8IA 1EX1A 2QHAA 5EO1A 4BFRA 3QZAA 2YPLD 3KYKL 3SBFA 3NAAH 3TWAA 3VXRD 4JN2B 3EJJX 3BOXA 1GKOA 4IM4A 1ZANL 3G18A 5AALA 1PCKA 3HMXA 3G8EA 1F1GA 4IP4A 3AVEA 3T1FA 1LILA 2CWRA 4RWHA 5K9KA 4QXUL 3W2KA 3CSYA 1NINA 4AQ1C 2VDQB 3MFFB 5EMMA 4P8XA 1T1WB 3MV9A 4LPUA 4HCDA 3VDHA 4JANB 1O94A 3NPSB 5I09A 1GCFA 1PZCA 2O0TA 3FO9A 4IMCA 2DF3A 3PTDA 3SE6A 2YD6A 2RB8A 3MRNB 3TBSB 3PG8A 3EWDA 4CW1B 4PCYA 1MCSA 1J12A 5CAHA 3N55A 1M71A 3X13A 2TAAA 5D71L 2NPLX 2R0KL 1YQ2A 3T05A 2RJMA 1R3VA 1ZCOA 4DVRH 3QXTA 2C19A 2H45A 1YEFL 1R38A 3CFQA 3FQXB 5LXGH 4PJHE 5EOCJ 3PY2A 3FYYA 1CFQB 3JWNG 1OPGH 3B5HA 4GYKA 1KOAA 4DP0X 1GVYA 1GZQB 2J88H 3VGAC 4H2HA 2NY0B 2QL1A 3L8QA 2P5EB 5AB2A 2PTWA 2XBTA 2X2YA 2X4NB 3IVUA 2GTQA 3VVGA 3G24A 3L45A 3TNMA 3UCCA 4UDUA 2AJZB 2FZDA 3KXFB 2YUXA 4Z7VA 4C1NA 4FQXC 2FQFA 4O1DA 3LKSA 3M0LA 2E8YA 2H3NA 3E2QA 2E8ZA 4JM2A 2BIMA 1U58B 4F0SA 3NCYP 3L5XL 3GHRA 3G5XA 4KO6A 4LCRA 4X4KA 3PGDB 4U6XB 2BVEA 4XCFH 2DJUA 1Q8JA 1R3WA 2HH0H 3ZHDA 2FX9L 2NY5C 4HHGA 1H62A 3NESA 3CU1A 1ADQH 4XPBL 4MZ3A 2AL2B 2QEZA 5DVNA 4H5SA 3TC9A 2F5AL 5ITBH 5I3IA 1J11A 4HMCA 4JFWA 5CCHE 2VGBA 3CHXA 1KBPA 5F0LB 5C09D 1HUVA 3C8KA 1QOXA 1LEKA 4ACYA 5DT5A 2W60B 3J2PA 3KW3A 4LU5H 2YN3A 1UZ6E 3MJ8A 4YEEA 2MKLC 3INOA 5C0FB 3B8VA 3T3PB 2X3CA 1PUDA 3GLAA 2J2ZA 5J0BA 3GG7A 3N42F 1ISVA 5DRZB 5INCA 4CD4A 1AQFA 3T4AB 4DWSC 4JDTH 2KHAA 5EU7E 1RP8A 3EOTH 5TK4A 3WQOA 4G7EB 5FESA 1H7NA 4WKFA 5IT2H 3HC3H 4GABA 2X4TB 4WHCA 3PWGA 3OHXC 2FO1A 4GSDH 5C0BB 1S7RA 2ZXWB 4OFIA 4H9VA 3PG9A 1FYTD 3HKFA 2Z93A 3EAUA 3P77A 3NXLA 2ICEA 1A1NA 4MAUL 4AXKA 3KGSA 1PX4A 1TEYA 5H1WA 4I13B 4O2FB 2O72A 1U5HA 1F13A 4XPAH 3QRLA 4ZUVB 4L56A 3UTSD 4O4YH 1DN2A 4PRIB 1DTUA 1I6NA 2EEFA 5EFDA 1K8YA 3B9KA 1BAFH 3G5ZB 5IB2A 3G3MA 3MKGA 3EEZA 3DU0A 3MACL 4YX2L 2DW7A 1GG0A 2BASA 4FTVD 2VN5A 2VAJA 1HILA 5HHOB 2F1EA 1VACB 4OKDA 3RKPA 4Z1CA 2FWOB 4ZR8A 5KYNA 4PJ7B 1TETL 4FNLH 4NNPH 2V33A 4OF8A 4PB9L 4L3CB 2E1WA 4I4WB 1QRND 1FQ9C 1XLMA 4WF7A 2UZXB 4LVOB 5A6SA 3WTVA 3O2WL 4LSDA 4ZBCA 2EO7A 4FJ6A 4K2UH 1W0VA 1F58L 1A6ZB 1Q7MA 9XIAA 4OKVA 5GGVL 3PAZA 1LD9B 4ZZFA 4MCZB 4HW6A 3ZTCC 4ZYKB 3S98A 3MRKA 3TJEH 1U8PB 3FT2A 3FOMA 1QASA 2GGHA 1KPVA 2VYRE 4QR6A 2V37A 5HGAB 2EICA 5T8GA 4LEQA 5B7YA 1KF9B 4CADA 2PP9A 2UWEB 1FOBA 4X6FA 3LMJL 1YY9D 2E6JA 4Q8UA 1NGZB 3PNZA 2YD4A 4BGDA 3T3MF 4YQXL 1EF2A 4QRSB 4BK5C 4HNOA 4A7QA 2E7LA 1KYDA 3FRPB 4AIOA 1MFBH 3DSFH 4MZ1A 2ZX5A 2UV8G 1OAXH 2AAAA 2RJHA 4YYFA 4M6MH 5AVTB 4L8CB 4CSZA 2PYFA 3SZ6A 2J6XA 1M9WA 5REQB 5EEWA 4CN6A 1DIKA 1S2AA 4LSPH 2ZVIA 3WFEL 4Y5VA 2V0AA 5D2VA 5DU7A 3G5EA 2PWUA 3HPSA 4QHPA 4XZ4A 5IM7B 1JF1A 4Q4QA 4QXGL 3GRIA 2ISWA 3FA3A 4U6HB 4GOAA 4XPTL 1QPKA 2CKBB 2YB4A 4PVMA 4AD1A 2AITA 4PGBB 1E0TA 4UV7H 2FBJL 4BDVA 4H8WH 4HMDA 2VRQA 1C9DA 1RIUL 1KIRB 3HPXA 2QCFA 3ZE1F 1V55B 3KTCA 4NGHL 2HTKD 1BD2B 2ZKWA 4GQ0A 1QUNB 3TBYB 3VSQA 2A21A 3TV3L 4XAFA 2CPUA 1YNPA 3VRJB 2W1NA 3A4DA 2OG9A 2CAKA 4ODHL 5T5FL 1L9PA 4ZMWA 3BLBA 2E0PA 3V5DB 1S1RA 3URNA 4PRHE 3PBYA 1EIBA 1A3HA 3ME0B 1IE7C 3LCIA 4CCZA 3NN8A 1DE4A 4GG6A 1A6VH 1OGTB 3KVJA 3NDZA 3KRUA 3MYOA 3ZE0E 4HU8A 4J6RH 3GSUB 2PDNA 1V93A 5C9KA 4QISA 2AERT 1GTFA 1TTJA 1LE5A 4JUTA 1T66D 1I7RA 4A7SA 1EUUA 5CZTA 2DBLH 1MQKH 1U4FA 5LXXA 1OVZA 1YDNA 2CNYA 3BK0A 5BOFA 2VX5A 3EWZA 5I8CA 4E9YA 2WLNA 2BCKA 4OGXL 1PX3A 3F4CA 4PLJD 1IGJA 2BGNE 5CPLA 5IWLC 3GIZL 3UZYA 4PBFA 3UZZA 2B8OT 1T5XA 5FO7B 3WLQA 2DDQH 5JQ6H 4Q4MA 1KBLA 4UTAH 3KW7A 4YL4A 1ZHKB 1VFBB 3TQPA 1NY1A 4FQPA 2DM7A 4LAQH 4YHYC 1VFLA 3LKQA 4Y2LA 3ZUCA 5D38A 3D9AH 4L37A 3E96A 3G1DA 4B5XA 4NUQA 2FMOA 5FA3A 1KZQA 4MJIB 1UT2A 3UJEA 1X7FA 3ZHLA 3RY5A 5LCVA 3RY6A 3ISYA 3HR5B 1HGYA 3EYSL 4L1SA 4GW1B 4ZMNA 3UYPA 1DN0A 3KPPB 2HUHA 3SDDD 2ZOLA 5H8UA 2P3YA 1SY6L 3U9WA 4Z7WF 2FO4A 3GMOA 3MP3A 1Q4WA 3LCYA 3NIFB 2VDNH 4HIQA 1U1JA 1KC5H 4Y8DC 4GW4A 4PMOA 2B5IC 2CJUH 1T3FA 1QSFA 4HNNA 1CEOA 1SNRA 3R18A 2EPHA 3SOTA 3M1ZA 3HVDA 2CRZA 4EUPB 1MQ8A 3T9PA 3PZIA 2J9XA 4K8EA 1NUNB 2JI1A 4X6CB 3W87A 4X0NA 1GONA 1CGYA 4HH9A 1ONXA 1A3RH 4Q9QL 3NJIA 4NN7C 1T0NA 1F4HA 2PTTB 4QT5B 1WISA 4AT6B 4UFMA 3KBHE 4U1IA 5I6NA 1MFAH 3WJYA 4K07A 2VW4A 1Q65A 4NQCE 3IWVA 1OVDA 3H2MA 3CAVA 3NWRA 1MCOL 4RX0A 3NQ2A 3VRLE 3UWZA 3KCPA 4LQ1A 5E4OA 2G5RA 3EKGA 5BYWA 5H94B 3ARBA 3GRBA 1A4KA 2ATAA 4JFDB 2FL5A 4QGCA 1DLHB 3FU3A 3IU3B 2CLZB 3OF6A 4ETQB 4WR3A 4BZ2H 4JYDA 4PFEA 1SJEA 1VRDA 5EG6C 4PR5B 2XIDA 3P0VL 5KJ4A 2F6KA 1VS1A 3BG5A 2ZICA 1KYOK 1IB5A 1UIOA 4G8GE 3FUHA 5CJQL 3RWDB 5EMKA 1RZ7L 1IM9A 2UBPC 2NY5H 5BV7H 2XKNB 4JQ2A 3GO2A 1IBHA 2CO7B 5DUMH 1G7PB 2OYMA 4F15B 2UY3A 1K8IA 1Z9PA 1MZYA 5ABEA 3PZOA 1C3FA 2R8SH 4JREC 4H9UA 5DQJB 3QZWB 3ECWA 4K15A 3G1HA 1I9EA 4JANA 3DVNB 3V75A 3P74A 5E8EB 4ZNEE 4UTTA 4MLIA 4FXGB 3S97C 3H8AA 5KETA 4IJRA 2CIIA 2J1ZA 3LZFL 4U3HA 2OL3H 4NC1C 1JVKA 2J4GA 5I15L 3EFOA 3R11A 1F56A 4A3UA 1OJXA 1YG9A 2ASHA 4KRLB 5F9WB 1YNYA 3JYBA 3FQXA 3V7PA 4TSAH 1XC6A 1ZVHA 3A4AA 2BNRD 1U1HA 1UJQA 1A4JB 5HWNA 3OVQA 3LNMA 1OTTC 4Y4HB 5HVFB 1TG7A 3HTLX 4F57L 4PJFF 5XIAA 1A2YB 5B1JC 3GPEA 5F3HA 5J56B 1MCPH 1R5IA 4J12A 5IG7B 5B38G 2H0PA 2X53A 4D9QD 1B5TA 1IGCH 3TEVA 2WSPA 1S8DB 4OOZA 2AJZA 5F9OH 3Q8AA 5HJ3B 3CJJA 5AVWB 1Z69A 3C0SA 4DJEA 3BQUB 4WEBL 3MGAA 1FWIC 5CJOH 5TPWL 3FK3A 1JK9A 4HCRL 3W9EA 3U7AA 2GJPA 4FFTA 5I1DB 3FJLA 1H8NA 1AKJD 4UT6H 4L1BA 1XD0A 3V0TA 3CXFA 1PLGL 3N34A 3URBA 2NX9A 4W6YB 1YLVA 1GYWA 1M1BA 1I1WA 3NIDB 1B2WH 4P5MB 4NZ1A 5SWSB 4ODUB 5HYSG 2PPCA 1KJ3L 3SCVA 4DN4H 4GIEA 3POHA 1WT5C 1UD3A 5DURB 2IBZY 3NQCA 7CGTA 1MJJA 2AL2A 3PK7A 1A25A 3SE3C 4MD4B 5KJRL 1JPSH 4G1KA 1FGNL 3WUGA 5JUVA 5EU6B 1E0UA 1TB3A 4FFYL 4FLSA 3OPZH 4DQAA 1P5UC 1X3DA 2V9RA 3GJEB 1KXQE 4U6YA 1A3LH 3LCFA 2CBQA 5CAKA 3NSDA 2C4FU 4HNLA 3ALXA 3LUTA 2FX8H 3MRQB 5C9WA 4E41B 4C6NA 1F90L 1KPRB 5JOPE 2AQPA 3CC1A 1T89A 4QRPB 1OADA 5JBEA 5AW2B 4K4KA 4IMLA 2ZPKL 1X9UA 1OM3H 1RQ5A 5C0JB 5D1ZB 1CE1H 5F7KC 4OZIB 4FXKB 2WXJA 1NEUA 5IROC 1KB5H 2HPTA 3FN0L 1NMBL 4YDIL 4OCWH 4O2FA 3Q1EA 4S2CA 2LTQB 1GGIL 2PC8A 1JPTH 5GS2D 1QQDA 2HRLA 1EEUA 3OHMB 1ZP4A 3REVB 3U30B 4LUSB 4BKNA 3CO4A 1L3NA 4FHBD 3MBXH 3NT0A 3HA0A 3G5ZA 2IWEA 2MCG1 1R30A 3BUBA 4MTVA 4DP1X 4Z95H 1PPIA 1UWYA 1WZMA 1JERA 4BEUA 1YZZA 3TBVA 4P23B 3WMSA 5M7QA 1SYSB 4UC5A 2FWOA 1VZWA 4PJ7A 3H9SE 4U1GB 3W5MA 4UFLA 5D37A 3CN4A 4L3CA 4R53A 2P47B 5JW3H 3AXKA 1RLDA 1P48A 1BM7A 1CFVL 4FNTA 1OP9A 3HZ3A 3QRBA 1CDUA 3VFMB 3R12A 5JUEL 2VX4A 1R6WA 1GGOA 2KX9A 1EWHA 4JN6A 3OJDA 3L08A 5ILTH 1JHTB 3QZNA 4KK9D 3WMLA 1R5VB 1LD9A 1TVBB 4X8CA 4ZYKA 1P4UA 5LKYA 2MANA 4PUEA 5TDPB 5U7SA 1U3HB 1AZUA 5G4HC 2DSWA 3EOYG 2Y7MA 2ZA1A 3U1QA 4Z1YA 5T8IA 1WAAF 2LAAA 2YZ5A 1JZHA 4PBGA 4QFUA 4OLZL 4D72A 3FFDA 8XIAA 4LB8A 2IXUA 4J35A 5A6KA 2UWEA 1A7QH 1IE5A 3VXSD 1N19A 1ZTXE 3NOYA 4WI8A 1YDPB 2JQAA 1YE6A 1Q9OB 4I89A 4XP5L 3GSNL 3WH6A 4QRSA 4XP4L 1PDKB 1UZ8B 4LCWE 4DWSD 3DFYA 43C9B 1NCCL 1VLWA 2UZYA 1EZSA 3DBXA 4IGNA 1WXJA 4C4BA 1FUNA 1EJSC 4RE0A 2PP3A 1EAJA 4NJAL 5SX4H 2R1LA 1PKYA 1T99A 1B4JH 5CPMA 1TZOA 5JQIB 1UA6L 2R29L 1NF0A 3GDTA 4PI0A 4R7DB 3TFCA 5REQA 1UD8A 3FT0A 4O17A 4FF9A 4ZFQA 5SWZD 1NIBA 5C0RH 4KKPA 4PV9B 5D96B 1D3GA 3MP4A 2G5WA 5IM7A 3UIZA 1FZOB 4Y1SA 3M6YA 4KJQC 5D7JB 5I2UA 2CKBA 4FHKA 4HSAC 4TUOB 4Z76B 9XIMA 1F3JA 2CGRH 1F2JA 3PWUA 4BQ5A 1I9JH 3UMTA 4GEJA 2O9TA 4I7VA 1KIRA 2J5LB 1JGMA 4E2VA 4NHUA 4QDWA 3DOHA 2MNUA 4QXVA 2ZYFA 4BWWA 1MXDA 3VRJA 1XJBA 3UZXA 4YUEH 2GT9B 1R24B 3N73A 3QRHA 1XINA 2FCBA 2GGEA 4IIQA 1DVSA 3OX8B 3V5DA 2FWSA 2F5BH 3JV4A 1HWGB 1UG9A 2XFXA 3C2RA 4JIEA 1OGTA 4S1SL 2ISFA 1E27A 4Z7VF 2JIWA 5AC5A 3JV6B 1B0IA 4ES9A 5IGXL 4LNYA 5EUOE 4GQBA 3IKCB 4NQDB 5DJYB 4UR7A 1TJHH 1V0LA 1WUFA 3UC2A 1I9CB 2LV4A 3CDGA 4XC3L 3P14A 2ETWA 5C2UB 1DQML 2EDLA 2OLDA 1XICA 3C6SB 1VFBA 1LEGB 2HVMA 4KQ4L 3DX5A 2EVJA 4MS6A 4M6PA 2RFXB 4UM8B 2CLVA 2H6PB 1D7KA 4LLQA 3F85A 4MJIA 1J5CA 3CZKA 1YYMH 4B9GA 4YHML 2FJHB 2J73A 3LHPL 3WNJA 4ETYA 1CFNA 3LM7A 3KPPA 1G7HB 2IKGA 3CVHB 1UC6A 4YMPA 1V54B 2YPKB 2Q20A 1KCUL 4AQZA 2KAUC 1M03A 4JO2L 4OLWL 2XINA 2DIEA 2DQGH 4WZ9A 4DBDA 3C86A 1YHPA 5AHMA 4XCCH 3TWCL 2VDOL 1HI6B 2OWXA 5D1ZI 3RVXD 2YC1B 4PW9A 4AYFB 3C2EA 4C83A 3PHAA 1HWHB 1OP4A 3FCTB 5EULV 4JTTA 1NP2A 2PTTA 1O7SA 2CG9X 3TL5A 2O7QA 3CBKB 1L9TA 2C15A 5ABTA 4XOAA 5KTEH 4APXA 4ORMA 1FQ0A 2ZOOA 5E8PA 4IUOA 2HG5A 3NQGA 2A1WL 3BOFA 1OY3B 2HE5A 2KH2B 3W7EA 4BFIB 5A69A 2ALAA 3QYMA 5H94A 5E08H 3WD4A 4LPCA 4DB7A 5L9DH 2GIYA 1K02A 1NPJA 1Z44A 1Z89A 4LNRB 1BEUA 3R13A 1TX0A 4PV8B 4LVAA 5T3XH 2DV0A 1GHFL 2CLZA 2CWXA 2AP2A 4C6EA 4ETQA 4OJYA 4W70A 4WO0A 4MQSB 4KJWD 3UTZB 2FB3A 4LEEA 4KZEH 3W86A 2VLJA 5D1XC 1E6PA 1OD0A 4XVJH 5ETUB 4WI6A 3BAIA 4X80L 1EV2E 1ZBKA 4DPCX 4XVUD 5CZVL 1YA5A 3JW7A 1V7NL 3Q8CA 4WCJA 1RA0A 4NZUH 4O28A 3DVNA 1O6VA 3JWNC 3IKKA 1I1CA 1CDHA 3BGGA 1B3JA 1VGKB 4NP9A 1U93B 2XA8L 1X6UA 4RGNE 5M3WA 3WKPA 4OJFH 1VCGA 3RJDA 1WX0A 4JX6A 1CYXA 4X5QA 3MJGX 4RDWA 4BFGA 3APMA 1VBJA 4IIZA 1E4IA 4PMYA 2HB0A 5I8KH 4KWUA 3OJVC 4PJXF 5IESL 3VXME 3AABA 4Y4HA 1BFNA 1QFWH 4JHAL 1MFVA 1M42A 2V2HA 1A2YA 1N2RA 2CK0L 4HIXH 2DZSA 4CMMB 2A3TA 2YAOA 1HHHB 1LG2A 1UIPA 4R9OA 4BSJA 3LY0A 1LOLA 2EZ0D 3CTTA 4TQTA 5DHVA 4NJHA 4CVXB 1INDL 2H7WA 5HJ3A 5JQHC 1WAWA 3M4HA 3RHWK 2J7HA 4DEPB 3DXAD 5LQBH 3BQUA 4LSTH 5I77A 2TRHA 4FSAA 2OR9H 5F4SA 1KCSL 4U1MB 1MFDH 3QXVA 2CPCA 4F7MA 4OTKA 4KQ0A 1HQTA 4H20H 2LAGB 5HY9B 5I1DA 1U3NA 2DYPB 1MXGA 2C3WA 4AZ7A 5MEPB 4LJ3A 1AE6H 3NFUA 3MHGA 1RXOB 2QQ6A 4PJEF 5SWSA 1JZGA 4ODUA 4R85A 5FLVA 3MLUH 2O7SA 5A8QA 5DMGC 4OV5A 4GVFA 2WYZA 4XMTA 1LLAA 3SEPA 5CINH 1QTWA 1I31A 3DIVA 1U6AH 3ULSB 1ZHBA 1SXAA 3A24A 4H8HA 1JUBA 1YNKL 3VD1A 3E3QE 4P05A 2ENSA 4Y1AD 5EU6A 1AGFB 1CF8L 4P2QB 5D33A 1FWHC 1M41A 2PR4L 3MSDA 4OVXA 1KCRL 2QCNA 3A12A 2YLLA 2V5CA 3DHUA 3WDIA 4N8VB 2X4SB 3MRGB 1SN0A 1IC4L 3NSFA 2C79A 1UGNA 1E9ZB 5AAWC 4B92A 2FH6A 1JGEA 1DVZA 5LGHH 2H47C 5EV7A 3V4UL 1AGEB 2FIQA 3MRQA 4E8CA 3DSNB 1KPRA 2BSSB 2EH8L 3EXSA 5C0DA 3RWHB 4KVCH 1UOVA 4FYQA 3NSXA 4QRPA 2WMKA 5KWYC 4GAJH 3NNTA 7REQA 1NGYB 1QUPA 4WO4D 1ISYA 5D1ZA 4KCTA 1VESA 1AO7D 4OZIA 5E1AA 3JSSA 3MNMA 4FXKA 2JTYA 1TQVA 4C56B 1FHVA 3KBSA 5IQLA 1OTTD 4P3CH 5D7SL 2V2WA 1FXPA 4IP5A 4X9SA 2IDTA 3V1PA 3MLZH 3QZEA 4JFED 3VIHA 3JZEA 5DJ8A 4F58L 1X5IA 4PI2A 1ONEA 3S35X 4X6BA 1HH6B 1F02I 4Z7WA 2ZONA 2BP0A 2Z65C 2F8OA 2NYZA 3S83A 1H4PA 2REQB 4Q7NA 1Y5XA 3MJMA 3K4WA 4S39A 2WIIB 3FCUB 4XPGL 4OZOA 1J8HE 2YL6A 4LHQB 1W2KT 4UT9A 1TLKA 2JQMA 1WYIA 4EN3D 4MRBA 4KMQA 1NCAH 1EK3A 1FH9A 3R89A 4NHCL 2HMID 3U9IA 5CJBA 4KK5D 5DRCA 3P9MB 2CO6B 5CG7A 3NZUA 5GRWA 3ROLB 4P5TA 2XIMA 4C6MA 2WINB 2PPFA 5A7BA 3U4EA 4G43A 3S36L 3VFMA 4HS3B 3GQFA 4YHZL 1OGAD 1VRSA 5KUKA 1HL4A 4G9FA 2EH7H 3G1XA 3GU9A 1NJJA 1R5VA 3Q7JA 3VQ1C 3MSPA 1TVBA 1YXDA 1A8ZA 4EXAA 3BZFA 1EBGA 1U3HA 5JR1L 1HIML 3B2XA 1KGUA 1W5OA 1H3XA 1WBZA 4XN4A 5F0JB 1BZ7B 3V6ZB 4F2EA 4XZHA 2AV7A 3MZTA 3C60C 2P46B 5CZ0A 4PHZA 1W16A 1GYNA 2IAMB 1N8ZA 3P2TA 2X2GA 3MRRB 2PA6A 2N7BA 1WFJA 2XV0A 1GRWA 3MV8B 2BB0A 5HHME 3BEWB 4HKXB 1A64A 1G67A 4QY8B 2J7EA 5AFAA 5J11B 4D8PB 1UJPA 4OI7A 4HK0A 5JXAH 3W00A 2YGVA 3CZFB 3X1GA 4N2YA 2CZ5A 1CQYA 5HXMA 1IKNC 2DH2A 5IROD 3B0UX 3DMMA 2OXHA 2VR3A 5L2JB 3UACA 4PJ5E 1BD0A 2DFAA 1OTSC 1NAKH 5DMKB 5FO9B 2INEA 1WPCA 2Z2UA 3N1FC 2JF1A 1CL7I 4QROA 3G1SA 3LTYA 3U6WA 5K4ZA 4KKAD 3H6AA 3D0LA 5FYKH 1XLLA 4GUJA 3RBGA 1JMXA 2JEQA 1RUQL 4NO3B 3HN3A 1YEYA 1OCZB 3BGFB 2ATMA 1B3OA 4OB5L 4KQ3H 4X4ZA 5F7EH 3U1SH 4TUOA 3CZGA 5J12C 5KN5A 4F40A 1OAUL 4PL2A 2BIOA 4B5VA 3ABMB 2X89D 5HJYA 5IVNA 1I3RB 3ELFA 4UNKA 1B90A 2DIAA 3Q2LA 5EA0L 3H9YA 2ZKXA 4R5EA 2J44A 2HDJA 1HAWA 5K9CA 3LGEA 4MAYA 3OHIA 3KW8A 2TMDA 3MV11 1OCWL 3PIQA 2DMKA 2KQNA 1ITXA 4PHXA 1UCWA 1W0WB 3F83A 1ZT7A 3HGRA 3PUOA 2ZOKB 1FPTH 1RK1B 5JOFB 1W8GA 2WSYA 1WH0A 3MYPA 5J04A 3TASA 2IFFH 3ABKB 4WDXA 2NSOA 1YNTB 4FJYA 2P5WA 4OUOA 2VLLA 4W9DC 3JV6A 3UWWA 1CIDA 5EL1A 4Y8EA 4KDWA 4GSUA 5MEND 4NQDA 3PM6A 1B3IA 1F3WA 5DJYA 4RDVA 1RZKH 3WJZA 2BGQA 4ERSL 4BWLC 3THCA 3QORA 3I9PA 4N6RB 3GW0A 3QFJB 4HBCH 3IBEA 1BXNA 2A1YA 2F15A 1ZV2A 1S2EA 5JOEA 2RFXA 3LHYA 1ACZA 4N2KA 2H6PA 2FH8A 2FQIA 5EC2B 2CJTA 1YMMB 1ME9A 3PHOB 3DX9B 5IKCB 4Y5XB 3KHQA 1Z5HA 4ADTA 3IIOA 4Y4KC 4D8AA 3QG7L 4G11A 4IOSD 1N2VA 2P8BA 4Y90A 3CUPB 5I28A 4NM4H 3T3PF 5HYJD 3MDUA 4LE8A 1V0NA 3ILQC 5C0IA 1HHIB 4ZTOL 2E74C 2WZPD 1KXVA 2TODA 4JG1H 4JE0A 4Z3TA 3KTSA 4LVNB 4BINA 3M1BB 5JHDD 4H44C 3FPYA 2XZ7A 4QDMA 2AK1H 4EI5B 1WSST 1MCFA 2HJPA 2XSBA 2FJUB 3OAWA 3SQLA 1J1OH 1LDPH 4UZUA 3E49A 1HI6A 1SHXA 2BP3A 3LZ3A 3MCKA 3LMYA 2VXQA 4H8WC 3CFJA 4P9HC 3CLMA 2LT9A 1A1OB 1KM0A 1IGYA 3FCTA 1J93A 3B1UA 3Q3GB 3C0JA 1FDLH 5A16A 3B0VC 3Q13A 4KWWA 1E5JA 4A55A 4GKZB 3QO0A 3HG5A 4DGYH 1ZMYA 4UTWC 2NY2C 5FF0A 2QQNL 2DMHA 2JKJA 2ZYHA 1ICPA 4JFYA 1R8LA 3W5NA 3ZY7A 2E9MA 3TEWA 2AJUL 4LANA 1RPXA 5AVZB 1CI3M 1T6MA 2X4RA 3NAVA 4LNRA 4PJ7F 4UQIM 4IJ3C 1V02A 1XR2A 3K3QA 4RISH 1XS2A 3QR2A 2UYLB 3NCJL 1DQVA 3UTZA 4DJFA 3DIPA 2Z7YA 2PYED 3ORWA 4JAMA 1WRFA 1WAAA 1WK0A 1J9TA 1S7QB 2AEOA 1M3IA 2YRLA 3P11L 2OA9A 3BWUC 4L4TD 1F3EA 3FO1B 1XF2B 4L4OA 3QUZD 1RAKA 3NACL 5GS0D 2LU4A 3P82A 2CBOA 5CMAA 2UWEF 7FABH 1J05B 2ZJSL 3ZIZA 4WUUE 1DXIA 3W24A 1U93A 1E1CA 5BRZD 1RLWA 1E6OH 1U8IB 1OAZL 4FXSA 3P4MB 4O53A 1UJTA 4WDIB 2CLHA 4L0PB 5AB3A 2DJLA 5B7ZA 4TS6A 1OAKL 1KIPB 2WZMA 4RMBA 1A3ZA 3QHFH 3O3DA 4WKZB 2CETA 1F6AB 2X1UA 2ZUMA 3W1QA 5KYYB 1S7XB 2X09A 5HBBA 1MCHA 2WV3A 4WWOA 1EAOA 3GIQA 1ZCCA 1RUSA 1YMHA 3ML8A 1IC1A 1SFLA 1QUMA 1QRKA 2VWSA 1X5AA 1K3IA 1OYCA 4AF0B 3I9IA 4CMMA 4U31A 3QDJB 1HHHA 2FWLB 2P1FA 3GI8H 1R3QA 3C6LB 1WCGA 1GMEA 2MEJB 3LD8C 2AEQL 4XZ9A 3UBPC 2NTFB 4P7RA 2GITB 1E50A 1TTCA 1MI5B 1WXYA 5JPNA 4U1MA 1ZRUA 2PTVA 4MUZA 3LRMA 3O4LB 1NTDA 2VXNA 4I9WD 5HY9A 4OJEH 1KFAH 1Q0XL 4JUSA 3GMQB 2WB1A 4A6YL 3WUWA 5I3DA 1VFTA 1TE1A 5DMJB 1HFBA 4XCEA 4M1RA 4HIHA 2G37A 4PREA 4NY2A 1S9VB 3RZWA 4UNTA 3QUKA 4FQJL 3ULSA 5HQEA 4FDWA 4J4KA 3EYFB 1DUYB 1M7JA 3LN4A 4MQTB 3N9GL 3LZOA 4G8AC 1BVWA 2YLAA 1RUKL 2Q8ZA 5I3KA 4P2QA 1T21A 2J77A 2EAEA 1JAEA 2OJ1A 3OIHA 4RDQF 4IXHA 3IGSA 3VCCA 1A7OH 2V68A 4N8VA 2X4SA 1FG2B 1GGTA 4X6EA 3MLWH 4L1TA 5I3HA 3HC0A 4ONVA 3NL2A 4MJHA 2ZG3A 5DK2B 1AGEA 3DUSB 2APFA 4Y9CA 5BV7C 5D6DA 3VA6A 3VI3E 5F9DC 2PDGA 3L7FB 2V7NB 3WJWA 3T6QC 1W72L 1NGYA 1J5SA 4MLSA 3T1GA 2Y7LA 4YGAB 5DJ6A 1NAMH 1NDVA 2I56A 5GS0L 2GI7A 3TW6A 4FZEL 4TPRL 1TPUA 5FOBA 1OSZB 3NR0A 4C56A 1EJTC 4NSKB 4E9WA 2A74B 3LQMA 4Q8WA 3NP4A 4MNMA 3UAFA 2UY6B 3IK2A 4OLUH 3QG6A 1F5ZA 4NPKA 3QPXH 1N18A 1XX1A 1RBLA 2YARA 3NPXA 2REQA 2MNWA 5LXEA 1A5FL 2PDCA 4JRXB 2GCYB 3BDYH 3AXMA 3N11A 5C70A 1V5XA 4MA3A 3TZNA 4MZYA 4U5KA 3JWOL 1BRLB 4E36A 3BPLC 2NSQA 3O6MH 3N1AA 3NIFF 1F42A 2G41A 1DBBL 2A99A 2CO6A 3E0FA 1GSKA 1UQSB 2EC9U 4MA7L 3L1EA 1BWMA 1NKGA 3ROLA 5T1LD 1L0PA 2WINA 4IGBD 4OTXH 4MYAA 3QGVA 1GOQA 1Q8AA 4HS3A 3N3MA 4DKEL 4S1QH 4N8PA 4X6CF 4LPYA 5HVGB 4R90H 2BSED 1G9HA 4O16A 4H6QA 5PAZA 1Z41A 3SBRA 4RFNB 1AR2A 1JL8A 4M48H 3ANVA 3TNOA 5D2LE 2PD5A 4ZMZA 2A9BA 2R69L 1BZ7A 2AQRA 1SFHA 3VFRB 3MRBA 2CDGB 2IAMA 3GH7A 1GMIA 2PLTA 3DHFA 3WLMA 5J6SA 3BP4A 4OW6A 1CU4L 4IXXA 2DQUL 2YRBA 5K3VA 4HKXA 3KOFA 4MD5B 2OK0L 2GG1A 3FCPA 2IQAA 3RLGA 4AQEA 3H7BB 3VTMA 1WLHA 2WUCH 3HHRB 2WMPB 4B15A 1UJ3A 1AZBA 4G71B 4L18A 3QB7C 3AWOA 4KKRA 4P5UA 4Q7BA 2GDQA 2YRZA 1XRFA 5IMMA 5EEVA 1UQZA 3PWNB 2XHNA 1E0WA 1QNSA 2HJLB 2CZVA 2ZC1A 1Q6EA 3CMFA 5JPMC 4R4FH 3O3AB 1E6ZA 1UPPA 1O0VA 5IW1A 4PJHB 4GIOA 4NO3A 4ISVB 4PJXA 2NQ5A 2EACA 3ASWA 1MHHB 2LU3A 3KWVA 1SZNA 4LSQL 4OQTA 2WZTA 4NKIL 4JFPB 2Z27A 3O2VH 3WY1A 3WGUB 1BDYA 2BXVA 1MJ8L 3LV6A 3V8OA 4MKVA 3LSOA 1UZ1A 4RA3A 4PMJA 4J7RA 4P2OB 3MJ9A 3QNXB 2EKSA 2OFQA 3QK0A 2IOMA 4BK4A 1K7FA 1CD1B 5BJTA 4M19A 4ECNA 4N2MA 2PO6D 1F5WA 4DRSA 4I48A 4NO2B 1W0WA 5CLTA 4YE0A 3GBNH 2DRUA 1B88A 4P46D 3IVKA 2DTMH 1N3NA 1LO4L 1QMUA 1N0XH 4MMXB 4P9HH 1IYXA 4ZSOE 3L9EA 2DJ4A 4U4BA 1LUCB 2J12B 4HV8B 2V3FA 4IT1A 1YNTA 4PJEA 3K7UA 1F0LA 4LIQL 5AHIA 1LE9B 2WHVA 3K1KC 4YWIA 2QKSA 1H9VA 4J8RB 1X9QA 3OKDB 2OO6A 4HTBA 4Q7DA 1J8SA 3NIDF 3K6FA 3WEBA 2BMKB 2Z91B 4FG6D 4XN2A 1MQPA 4IMFA 4WI0A 1LQSR 1ZEAH 4J2XA 4GCXA 4L3EE 3E02A 3NAAL 2PXYA 4PUBH 1UYQA 2A6IB 4WWID 2V8LA 5KZCB 3VD4A 1P0SE 5IJKC 4YDJA 4DWDA 3KVQA 3QQ1A 5F89B 3SPHA 1A6PA 4OH2A 4IBZA 2VEKA 1SFJA 1S2WA 1A02N 2Y7GA 2B15A 4WHYH 2WQUA 1CGTA 5JYMA 1AH0A 4FA7B 4Y5XA 3ONBA 1FE8L 5DO2D 5EBGA 4LCYB 1H50A 2PLCA 4TL5A 3AQYA 3HB3B 2Y7NA 4ODTH 3QUMH 1TV8A 2VISB 2BERA 3U6RB 3MREB 1KJMB 3SN0A 4BF7A 3DUUB 2Y5JA 4JZJC 4RE2A 6FABH 2NZ9D 2ZA2A 4O13A 1GJPA 2VLKD 2ERJC 1UXWA 2R83A 4WGVB 2J47A 1Z3NA 4X4YA 1AZCA 1BA9A 5H4YA 3K5SA 4NWUL 1TYRA 1SZGA 1A14L 4ZUSB 2ZZ2A 3CV6A 3TU6A 4Z0XA 3M1BA 5EEYA 4G8TA 1HINL 4HWZB 3BLLA 5DUBA 5LXGL 2DPEA 4DKDC 4OZIF 3UZEC 3TYUA 4NAMA 7ENLA 1IGMH 1OPGL 1K4CA 2O93L 2OWCA 3B8WA 3PLYA 3FPXA 2IANA 3DRTA 3EB2A 1EC7A 4TNFA 3T4CA 3CBJB 4OFKA 4LF2A 5DK0A 4JFSA 3ZX1A 2VH5L 3N6YA 4PWHA 1M1XA 3GZ3A 4DI9A 5EDSA 1E9YB 3V18A 5CC5A 2XH4A 3D0AA 2Z8RA 2R9HC 2P7TA 3LQLA 1VLXA 1TENA 3ZE2E 2WJZA 4QM1A 4UCFA 4M93C 5I0DA 3TFKC 5E6IB 1OM9A 3HS0C 4OJCA 1PXGA 3LBMA 1AW2A 2C6QA 4ODWA 4AZGA 2PTYA 1V3KA 2HN7A 4DY1A 2HWGA 1UKTA 4X7DC 4D8OA 1OB1B 3GLDA 5E2UL 4KFOA 4X9HA 1T04A 5CCJA 2F54D 2O55A 4GRWE 1T40A 1O12A 3OGRA 4CNIA 3ULVF 5HPCA 4EKJA 1D2OA 3ESVF 5E2TL 5ALCH 1XIWB 3MODH 4XOEA 5ITBL 4DVBA 1GVIA 2DB8A 4N20A 4EP8C 2NR6D 4U10A 1F76A 3Q2WA 1TMHA 2ZNXA 3HZMA 1Q72H 4QYOA 3D30A 3QDMD 2PPGA 1HAUA 5ID1A 4HKPA 5C07D 3PJTA 4QLLA 5E00B 4ZZ9A 3U2JA 1KJ2B 4G7FA 4JO4L 1U8IA 4H2AA 4JN2A 4UBDC 1G6RH 3GNNA 1EMTL 4DAGH 3R19A 3RZCB 1J8KA 1EDYA 1TX2A 4JDTL 1QPRA 4UM9B 1KIPA 4JPWL 2BSRB 4PJ9D 2NMSA 2WXLA 4QCFA 4GXMA 3HC3L 1UEYA 4WKZA 1Q66A 2J56A 4LVGA 4GIAA 2EVGA 3MFFA 3HHMA 2CM6A 3VOGA 7PTDA 5KYYA 3DUHA 1KB9K 1S7XA 1T1WA 2CNZA 2Y63A 3BPNC 4WHYG 1G5GA 4HGKC 3M07A 3VXUE 3DHMA 2ZP0T 4N5UA 2DLIA 5LB1A 1HTIA 3MRNA 1JR1A 3TBSA 4U1KB 3BTNA 4CW1A 2Y7DA 4O4YL 4AUYA 4B0MB 2GWGA 3PTKA 3FFCE 4PJIE 3ITTA 3CWOX 1JNLH 1U0QA 4KDTC 1HWWA 3R10A 4IS6B 3IMSA 1BAFL 5HI4D 3BZJA 1XLJA 1CFQA 3DN5A 1DZBA 3I85A 3VDBA 1J2WA 1GZQA 1VBUA 3V8CA 3O4LA 1OP3H 1TJ1A 1I8IB 4KI1A 4Q4KA 5AB0A 1IEIA 3GMQA 4YDMA 2W0UA 4AEHH 3TQVA 3RDJA 2P5EA 5JQ9A 2FJKA 1R17A 1XEDA 2E27L 1HCVA 2X4NA 1MHPL 4LYPA 1M2OA 4MNHB 4AITA 1MEXL 4PRHB 1BOYA 2FE0A 4G42B 4BUQA 3KXFA 5EIIG 1H19A 3FTXA 3ZE0B 4K2UL 3EYFA 1U95B 1W1IE 3FU9A 2EG6A 3VX1A 3HG1D 4OCXL 4O00A 1HO4A 1V08A 1OK6A 3HBLA 3JT2A 3VOHA 3AWFA 1U58A 1FG2A 1IEBB 5E95B 3GINA 2V5SA 5I1AB 1QR1B 2XYCA 3PGDA 2XQ0A 4U6XA 4LSSH 3OPSA 3QPEA 3NZHL 3ITLA 3WFLA 3ITCA 1JFQL 1ZAIA 1VZGA 4A3RA 4MNLA 1TJMA 4TUFA 3JZ7A 3SDYL 4ODBD 43CAB 4N1HB 3S46A 3L7FA 1RZQA 3O0FA 2DUAA 2YR1A