1KGXA

Three dimensional structure analysis of the r195q variant of human pancreatic alpha amylase
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFQLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE, PANCREATIC
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgxA01
4AC1X 3GZAA 2VZTA 3T2QA 4MAZA 4HZ7A 4U33A 2O9RA 2OW6A 1PJ9A 1Q6GA 1RP9A 3VOCA 4LQ1A 2GUYA 3BUDA 3L4TA 1ZBKA 2EPKX 3WUEA 4TVDA 2CHOA 4WLCA 4M80A 4HOZA 2ZWZA 3WMSA 1YHTA 3GXMA 2Y4SA 5I77A 3FAXA 3L4ZA 2UY4A 3HU7A 2QV4A 4MPKA 3VIIA 4KWUA 4GIAA 2VMFA 2EQDA 1NWSA 1MWOA 1NM9A 4HPHA 3RDKA 2FGLA 1OIFA 3WNKA 1PAMA 2BXYA 4XB3A 3BXWA 1DWJM 4PMZA 2E40A 1HTYA 1E55A 4AIUA 3T0AA 1B2YA 1V3HA 1W9VA 2WVSA 1M01A 1W9XA 1OSEA 2A3HA 3TOPA 5BCAA 2WNWA 1XSJA 3BAIA 2VVNA 4UZSA 1XCWA 2CERA 1H4PA 4AMWA 4Y7EA 5I79A 5E6YA 2W5FA 2X05A 1PZ3A 1LWHA 1Q6EA 3DX1A 4JFTA 3ALGA 1V08A 1HJVA 3PBGA 1BQCA 3OLGA 3ARSA 2XJ7A 1W91A 3MUIA 2D24A 3WD4A 2DH2A 5BXTA 5HPCA 2WMIA 1O7AA 1NOUA 1BF2A 1E15A 1HL8A 3A21A 5E09A 5EFFA 1FOBA 1KWGA 1G9HA 4WSJA 3MUZ1 3NSXA 1DWHM 1E70M 3SCPA 1QI5A 4PRWA 3ZSSA 4QAWA 1JF5A 3WQ6A 4GI6A 1GOMA 2CEQA 1UWIA 4HA1A 5AC4A 3VNYA 1PZ2A 4P7LA 4OGZA 3W25A 2ZUVA 2V3GA 3IJ7A 2JEQA 2ZUWA 1TFVA 1VAHA 1QVBA 1VBRA 1RP8A 3VGBA 2WVTA 1C7TA 4J3TA 2VZOA 2VNCA 2WZIA 2C8NA 2F7PA 1WCGA 2QLYA 3PZVA 3DECA 3AZTA 1J0ZA 1J9YA 1OGSA 2FH6A 1FH7A 4P8WA 1E0VA 1E6SM 3ARQA 1JDDA 3O6AA 4P7NA 1XH1A 2V5DA 4EANA 1XSKA 3IANA 4AZ7A 4GQQA 3CHCA 1WDSA 3VIKA 1MXDA 4OKDA 3AIBA 4P7OA 3KZSA 3UG4A 1P6WA 3WNMA 2WMIB 3ARWA 4QCFA 5C8BB 3VUPA 1IZKA 3WDHA 1JGIA 3PZGA 3K46A 2WXDM 4Z2GA 4GI9A 1M03A 3BC9A 2WBGA 3ZR6A 5EMYA 3OGVA 3BLBA 1ZS2A 4D6HA 3OB8A 2J7HA 1EQCA 2VTFA 3FN9A 4AXNA 1I75A 5CPQA 3SUVA 2VURA 5A1AA 3AMDA 5M03A 3MUAA 4B16A 5GNXA 1ISXA 4AW7A 4WK9A 2X8RA 1E3XA 3DDGA 3FHAA 4UFHA 1GOOA 1V0NA 1C8XA 1M7XA 1NH6A 1UA7A 2EEXA 4R27A 3W27A 3QHNA 1N82A 2DIEA 3EJSA 4D72A 2BY3A 3BAYA 2CBIA 2JFEX 1MW0A 1W3LA 2XN1A 5GPRA 3D4ZA 5BXPA 1MW2A 2GJPA 3CH9A 4U3AA 4W5ZA 2RGMA 3CZSA 1OT2A 3ZT7A 1EDQA 3CMJA 1LLOA 4JCLA 4D6FA 4J3VA 4B9YA 5D8ZA 3D3AA 1R34A 1BYAA 5HPOA 2XSAA 3AQUA 4XX6A 1GPFA 1KBBA 1AMYA 3WNLA 3CUIA 3A4AA 2J7GA 2CYGA 4EK7A 1IV8A 2WSKA 5DEZA 1V03A 2W67A 2AMGA 3D50A 2E9MA 3A4XA 3B9AA 1ISWA 3VMPA 2XIIA 3B9DA 1WZKA 4QLKA 1TUXA 1KBKA 2WHJA 5GNZA 1GVYA 3NDYA 2EABA 3L4WA 3RCNA 3SCSA 2CKSA 2D3LA 2BVYA 3W82A 1ZJBA 4F9JA 3NSNA 4JHZA 4RE4A 1R86A 2ZXDA 4PMQA 4HU8A 2O9TA 3W37A 2GJXA 1ZB5A 1JZ2A 3KL3A 3GXTA 3F5LA 4BQ2A 1V02E 4FK9A 1NP2A 3VINA 3DYPA 1I1WA 2J25A 3S2CA 4FNTA 4H7VA 2Y8KA 4AIOA 4LPCA 4GINA 1UOKA 5KZ6A 3AS1A 4L4OA 3WUFA 1BVNP 4DUVA 5C70A 3FW6A 1AQ0A 4NXKA 4HOWA 1XD0A 3PZIA 4CCDA 2FH8A 3IAPA 5AY7A 2DEPA 3DX0A 2BNJA 3SUUA 1QBAA 2CNCA 4QP0A 2V3EA 4OUEA 4P7RA 1CXIA 3AZSA 2CPUA 1UG6A 1VFFA 3WMBA 2C7FA 3QGVA 1KB3A 1JYNA 1D7FA 2F7OA 2Z1KA 3VD5A 2YA1A 3AIWA 2J78A 3W81A 1JAEA 3AISA 1EDGA 5A6JA 4CN4A 1HNYA 5D8WA 3KEHA 4XV0A 1J18A 5FL1A 1BTCA 3SCTA 1E40A 4MB4A 2DSZA 1V0KA 1BYDA 2YL8A 7CGTA 3MUY1 2WKGA 1C90A 1UWQA 1OGBA 2EXOA 2WCGA 2D1ZA 3SCVA 1GHSA 5CJ5A 1C3FA 2VX6A 3S5ZA 4DM1A 2YL6A 3EDKA 3NCOA 2WWCA 4UFKA 4ATLA 5D9NA 3WF3A 5CG0A 2J79A 3TP4A 5BXSA 4W8LA 4PCTA 2ZOXA 5JBDA 1TVPA 4DWSB 3AS3A 3CMGA 1OB0A 3N18A 4QFUA 2WMJA 5FKYA 1WNOA 4LYQA 3LRMA 4DUWA 2ZXBA 3LRKA 2YOCA 3W24A 1UA3A 3AYRA 4HMDA 3WN6A 4MDOA 2VOTA 2QPSA 3W53A 3FY1A 5A6BA 3W29A 5F7UA 4GI8A 1L0PA 4M24A 3WNPA 1CENA 3DX4A 5ECUA 3BUQA 1XCXA 4FNUA 3VX1A 2EADA 3UERA 2G4FA 1UWUA 3WY1A 5CPSA 3BVVA 1LG1A 3ZOAA 1US2A 1LL7A 2XFFA 1QNOA 2O9PA 1OGGA 1PIFA 1JZ8A 3NDZA 2X2JA 2J62A 4LYPA 1J0JA 1K9DA 1UH3A 1V3IA 2XN2A 1UKSA 4JFWA 4V2XA 1RD6A 5A3HA 1WB0A 3AXIA 3GM8A 5A6SA 1UD6A 3FAWA 2DPEA 2XGBA 3VD4A 1W9DM 4EE9A 2BV9A 4GZEA 4M56A 4BA0A 4RE3A 3CGTA 3M46A 1E1EA 4CD5A 3WEMA 3VGFA 4OJYA 1VEMA 1CXHA 3AHZA 2G3IA 5JIWA 1EDTA 2BFGA 4HU0A 1GONA 1V6YA 5FL0A 4Z2KA 1PEZA 1TQTA 3VDHA 1VEPA 1UZ1A 2E4TA 4R5EA 4CN6A 3A22A 3WH8A 4HPGA 3KL5A 2QPUA 1E6NA 3N13A 1UR9A 4X0VA 4HA4A 1KR1A 1XSIA 1QW8A 3UG3A 3ZR5A 3UETA 1GOKA 4UQDA 4CD4A 2WMHA 3GNPA 2D23A 1UD2A 1JD9A 1HJSA 3LPGA 1JZ5A 4JKKA 4CCCA 4AZ5A 4NZFA 1BG4A 2XM1A 1C7SA 2EACA 1BHGA 3AIQA 3BMVA 1PS3A 3N12A 4BF7A 3EJQA 1SMAA 4WKHA 4MNMA 2J75A 2WW5A 1S46A 3E1F1 3HMCA 2E9LA 3WQ5A 3QOKA 4BQ5A 3DYOA 3GNOA 4YHEA 2WHKA 5ABHA 1J0IA 4WKAA 2XFYA 1UR0A 3VM5A 2OSWA 4AZBA 4IISA 3D51A 2ZUSA 4U5IA 4AD2A 3EDJA 1CLXA 1JFXA 5BYWA 1V3LA 5HOSA 1JI1A 4ZE5A 4PMYA 3WL0A 2BHYA 2DSWA 2DT3A 3B8SA 1PX4A 2YFOA 1CNVA 4TUFA 4DWSA 2CHNA 2BY2A 3W0KA 2VRKA 2GK1A 2X2YA 1HXKA 1TQVA 1TR1A 4TOQA 1KXHA 1XH2A 3BLKA 4U2ZA 3PZTA 2YBTA 3MI6A 5A94A 3O2LA 4N42A 3BSGA 4PBGA 1O6IA 5CSYA 3VGGA 1CXKA 2D22A 5M5DA 1MQRA 1CXLA 1V6XA 5I78A 2YLLA 1W1YA 5C71A 1WPCA 2E9BA 4PSPA 4DM2A 3N15A 1JF6A 5A6KA 1OWQA 3WF1A 3CZGA 5JBEA 1HKIA 4J27A 4CU6A 2PF0A 4MNKA 2V3DA 3BCDA 2OWWA 1QI3A 2WC3A 1TZ7A 1HKMA 1OIMA 3GNRA 2MANA 1CPUA 2YJQA 3PTQA 4MNLA 3ARYA 1C93A 3VIGA 1H0GA 3W6MA 2YA0A 2WSPA 4UOJA 5JBFA 1NP0A 5CSUA 3VILA 1MW1A 3OGRA 1JL8A 2JIEA 2WZHA 1EXPA 5FCZA 3I3BA 3WQ4A 3T0DA 5IFPA 1XH0A 1DP0A 1R75A 1OCQA 3L4UA 2PWDA 3U5UA 4B9ZA 1KXQA 4NX0A 4ZXOA 3ARVA 4H8UA 5D9OA 1J0KA 3VD7A 1CDGA 2VC9A 2GSJA 3WIJA 1QI4A 3QR3A 3L2MA 4ZE4A 4E8CA 3IGUA 4GQRA 3WDIA 2WLZA 1XD1A 4RL3A 3HG4A 2O9OA 3WL1A 2F2HA 1B90A 3WDPP 1H09A 1QNPA 2DT2A 2EJ1A 2QMJA 1OD0A 1B3YA 2Y5EA 3WF4A 2JEPA 1F4AA 2FHBA 3AMCA 1NOFA 5IXEA 4UQCA 1KWKA 1KCKA 3CHEA 2ZX9A 1K9EA 2GK1B 3BUBA 3N9KA 4GZJA 4PUDA 4U5KA 4M8UA 2VZSA 1W2PA 1H11A 3AROA 3AXXA 4Q22A 1W32A 2VX5A 1GJUA 3ARRA 3WUGA 1GQKA 1CLVA 4U3CA 4P8UA 3DX3A 5D9MA 3D4YA 1W1PA 2UY5A 1KFWA 4W84A 3PTMA 1Q6CA 4M81A 4MJ4A 2Q8XA 1UD8A 1GOWA 2IXUA 1PIGA 2PC8A 4ML4A 2DSUA 4S3JA 1JZ6A 3LXAA 4IUGA 3ZT5A 2EPLX 5I6SA 1JIBA 3HG3A 3U57A 3LPOA 2ZUMA 1E72M 1KXTA 3KL0A 3WNOA 3CZNA 1FH9A 1K6AA 1EH9A 1JXKA 2ZXAA 2VR4A 4TTGA 1G94A 1XHGA 1AQMA 3WY3A 2J4GA 3AHVA 4FNPA 4U2YA 1E9LA 2FHFA 4GZIA 4CU8A 5LA2A 1GQIA 2JF6A 2ZX7A 4PCSA 4FLOA 4HZ8A 4WJXA 4A3HA 1V0MA 3VD3A 1FHDA 2WBKA 2XFRA 3CUGA 4WIWA 4NRRA 1NOWA 3FNDA 3WD3A 2VX4A 3ARUA 2YDSA 3AIEA 1X6NA 4GXPA 2J7BA 1R7AA 3EMQA 1VFOA 4MB1A 2RGLA 4WF7A 2AAAA 1R7OA 3WDRA 2YBUA 1G01A 4CVWA 1LG2A 3PZQA 1WP6A 3UCQA 5DF0A 2WLYA 3VIPA 2QMKA 3PHAA 4DO5A 1QHZA 1D2KA 1E43A 1TQWA 2CKRA 4V27A 3EJTA 3GBEA 2BY1A 2WK2A 1MQQA 3VSTA 2YDQA 3AIVA 3K1DA 3VU2A 3UESA 4W88A 3SUSA 1K9TA 3WBEA 3T0BA 3HZ3A 3OLIA 1FH8A 3EBVA 1XYFA 3KWXA 2D2OA 1HL9A 3RJYA 3RM4A 1GQLA 1VJSA 3G6MA 2OYLA 4JL2A 1E5NA 1UWRA 5A6BD 1E6QM 2BXZA 5E0CA 1L8NA 2X0YA 3WQVA 3VTRA 1NWUA 2DGAA 3I3DA 3AXHA 3A24A 3ZJ8A 2F1BA 3PZOA 4UFMA 1HWWA 2W4XA 5ABGA 4OBSA 1F4HA 3GYCA 1CTNA 5A2BA 2VL4A 4PMVA 3VSVA 3MANA 3L2LA 1UUQA 4HTYA 5D4YA 2DDXA 5GQBA 4TVCA 2J7EA 1BGAA 4J28A 3WY4A 4D6JA 1HXJA 1BFNA 1DHKA 1H49A 1MFUA 1WZAA 3CHFA 1TG7A 2FE0A 2YLAA 2BY0A 1JD7A 1UR1A 2XGIA 2XWDA 3KLLA 3BGAA 2ZX5A 3THDA 1QWUA 4TVUA 4WSKA 3RJXA 3WFLA 1R85A 4CVUA 3K4DA 4RE2A 4ACZB 3FXYA 2ZX6A 1LQ0A 3QOMA 2WMKA 3AI0A 6CGTA 3RM9A 2IUZA 1V02A 2EO7A 1LF1A 1KCLA 3AJ7A 3AS2A 4FMVA 1ISVA 4MTVA 1H5VA 2G3NA 3EDFA 4F66A 4JZ5A 3BUPA 4NF7A 3M6DA 4AD3A 3VIMA 1ITXA 1HP4A 2OWXA 4AD5A 3BLPX 2V5CA 3DDFA 2DSVA 4AD1A 4PTXA 1HN1A 4NZJA 4UTFA 3A6OA 1C8YA 1SMDA 2NSXA 4W5UA 2GDVA 3SCOA 4KRUA 2X2IA 1E4NA 5FIPA 4J3WA 1JG9A 4PYSA 2CBUA 1HX0A 3WNNA 3N17A 2HVMA 4UZUA 4Z2LA 5ABFB 3IAQA 4ZENA 2IXVA 3U7VA 3T08A 1V3KA 1UWSA 1JAKA 4UFJA 3WD2A 5HDRA 2GVYA 2PB1A 3WD1A 3WELA 2X0HA 5A8PA 3K8LA 3SCWA 2E8YA 1ESWA 4A3YA 2PWEA 3BCFA 2YDRA 3WH9A 2XTKA 4CCEA 1GZJA 3K8KA 1KGUA 1T0OA 5BROA 3SCRA 1WDRA 2B31A 1QW9A 4GO8A 1PX3A 1HJWA 1EHAA 1E1FA 3WQWA 2A3CA 3A5VA 3WKZA 3LXBA 4JFUA 3VM7A 1PBGA 4W87A 2D73A 3DC0A 2G41A 1JFHA 3LX9A 2OYKA 5HNNA 1E0WA 1VEOA 1UKPA 1OINA 3CTTA 1AQHA 1UZ4A 4MNJA 4AD4A 1D3CA 4JCMA 2OWCA 2ZICA 3ZO9A 1H2JA 1QOXA 2XM2A 2F7RA 2EBNA 1M53A 2JE8A 1TQUA 3BVTA 5TD4A 3MKKA 4LYRA 3VIOA 1B9ZA 3F5KA 2CITA 2BVTA 3ARPA 3POHA 3MSDA 5ABFA 4NI3A 3BH4A 3ZQ9A 3NIYA 3WY2A 3TTQA 3VIFA 3AOFA 4WKFA 5I2UA 1UR8A 3CBWA 4D6IA 1OM0A 1H41A 1W1TA 2GJXB 1HKJA 3QHMA 4CD6A 1GVIA 2VUYA 3BAJA 3SEPA 4JL1A 3SCNA 1ITCA 5I24A 4UQ9A 3BAXA 2WC4A 3VO0A 1US3A 5D9PA 5BXRA 3S6TA 1NWRA 2E3ZA 2NT0A 3ARXA 1C8QA 4GO9A 1QI0A 1PPIA 1J01A 5CXPA 3LPFA 1VBUA 3NJ3A 5A95A 2WANA 1BG9A 5AYIA 1R46A 2AOSA 2W63A 3HG2A 4ZFMA 2UY2A 1Y7VA 1TVNA 1KGWA 4AEEA 3GXPA 1FFRA 1X6LA 1WE5A 2WVUA 4BCEA 1EQPA 1SYTA 1U2YA 2IGTA 4QLJA 4PN2A 1KTBA 2FHCA 1E6PA 4F79A 4AD0A 1UR2A 3AICA 1CGWA 4J3SA 4UQEA 1BYCA 3VNZA 3AIRA 4JFSA 1QNQA 1MQPA 3ZMRA 3NSMA 3EJUA 3CZ8A 1TCMA 5CZKA 4AISA 2ZE0A 4MADA 1WAWA 1B30A 4M1RA 3H54A 2CXGA 2WZEA 2DSKA 1JZ4A 3GXNA 5A8NA 1V6UA 1B3WA 3HG5A 3QHOA 4CGTA 1EOKA 3T2OA 4KGJA 3CC1A 3WDJA 1XYZA 2J74A 2CIPA 1B3XA 3B9EA 3IJ9A 2ZX8A 1WDQA 2OW7A 3UEQA 2OSYA 2JALA 3WH5A 4KRTA 2VO5A 2WHMA 1BGGA 5E0FA 1DWIM 3ZJKA 5I23A 4W85A 3VSUA 2XWEA 1EHNA 1CZ1A 3DHPA 2WHLA 1SR0A 4P8XA 4TX6A 2XG9A 3VMNA 4V28A 4GKLA 3IK2A 1E4LA 3VGDA 3SCQA 1E73M 3AIUA 2EPMX 5A2AA 1QHPA 3U7BA 3WUBA 3WQ8A 4H8HA 1KTCA 4M29A 1GHRA 4NSBA 1MVYA 4CUCA 4U31A 2FDMA 2Y8VA 2WMFA 3F4VA 4HMCA 3A3HA 3UG5A 4FNRA 2J7DA 2X09A 2F18A 3EJPA 5ABEA 3OA5A 1LL4A 2V38A 1SZNA 1J11A 3PZUA 1Q4NX 4W86A 3HJEA 2WWDA 2VR5A 3N11A 1YQ2A 5E70A 4JIEA 2FGZA 3VDAA 2VRJA 3DHUA 2ZXQA 2XVPA 2F7QA 5AC5A 3GTNA 4ATDA 4W89A 1GJWA 3EJRA 3D52A 2F8QA 1NARA 3UR7A 4ZEPA 1W9PA 3POCA 4W7UA 3RMEA 5KEZA 1FHLA 2WCAA 2VZVA 3TV8A 3WDQA 4MJ2A 2G3MA 3GXDA 1V3JA 3CPUA 4C7GA 4UCFA 1W1VA 4LGXA 5CPTA 3O9NA 4JKMA 2V3FA 4HOXA 1FFQA 5EBAA 4HA3A 4PTVA 3TA9A 2W62A 3VKKA 4XZBA 3K8MA 1SFSA 4D1JA 2J8FA 1UQZA 4AWEA 1ODUA 1CEOA 1EO7A 3ZJ7A 4IPLA 5I3DA 4DWSC 1KGXA 1DTUA 2DH3A 2PI6A 4K68A 4MB5A 2D0FA 3ARZA 3W26A 2ESCA 3OLEA 4D6EA 5M3WA 3THCA 4FF5A 1VRXA 2VQUA 5LYRA 3RILA 3CUJA 4PMUA 3OLDA 5CGMA 5DT5A 5A8OA 1JZ3A 1CGYA 4OBRA 3WBAA 4W7VA 4NXSA 3UR8A 2DIJA 5EB8A 3SUTA 3F5JA 1JI2A 4C7DA 2VI0A 3BAKA 2C0HA 3PZMA 2ZUUA 1R33A 3KE0A 4CKQA 6TAAA 4B15A 1E3ZA 3WENA 4YHGA 3EMZA 4PMOA 4P8VA 4UNIA 5IFTA 4YN5A 4PTWA 1W3HA 3WEZA 2CBJA 4PMRA 3VDBA 1DWFM 3A47A 2OYMA 1DWGM 4AYGA 2DQXA 3OG2A 3ZM8A 2F1AA 4ATWA 4X0NA 1U30A 3RO8A 1E5JA 3AFBA 4TX8A 2WC7A 2DT0A 2J8GA 2W91A 4AIEA 5EFDA 1BLIA 3AS0A 5DT7A 4TXEA 4FLQA 4E8DA 4BZYA 2YL5A 5BWFA 3AMGA 1BYBA 4W93A 2GDUA 1Q6DA 2OLHA 3VMOA 3MU7A 3PZ9A 3WH7A 4F8XA 4X9YA 1UYQA 4D1IA 2BS9A 3W28A 3MMUA 3TTOA 3MMWA 3L4XA 5LA1A 2WMGA 2ZIDA 5E1QA 2A3AA 2WYSA 1K9FA 3GXFA 2VX7A 2D0GA 3TONA 1ISZA 2G3JA 4B3LA 2Z1SA 4AYSA 2W92A 1B0IA 1WO2A 4PMDA 3AHXA 3BVXA 3CUFA 2XSBA 3MS8A 2VVSA 2EAEA 3TTYA 2CETA 1BVZA 2DT1A 3RM8A 2ZWYA 1ZU8A 2J7FA 2W66A 2PWHA 4PEEA 1LL6A 2QHAA 3VGHA 4NRSA 1XV8A 1V6WA 1UASA 5AYBA 1CBGA 4BQ4A 3WF0A 3OGSA 1V0LA 2VJXA 2WM0A 4AZGA 1CXEA 2VT0A 1HIZA 4H41A 3BVWA 4MDPA 1J0YA 2QF8A 2XVNA 4Z2IA 1NWTA 1WKYA 1QX1A 4BQ3A 3EDDA 1I1XA 1EIBA 3HN3A 2A3BA 1UH4A 1E71M 1RPKA 4QDMA 1X1NA 4A4AA 1H0IA 5FD0A 4UOZA 3AZRA 2YFNA 3MV11 5A8QA 4W7WA 4H8VA 4HP5A 1V6VA 4D6DA 3N04A 3SUWA 2J7CA 1QHOA 4FNQA 3SURA 3WSUA 4P7QA 1JYXA 4EKJA 3PTKA 3CZEA 4URIA 1O7DC 2WVVA 1JNDA 1VB9A 4UQBA 5A6LA 3II1A 1W3JA 2J47A 1WZMA 1HP5A 1U33A 1E4IA 2JF7A 2NT1A 2XHYA 3LXCA 1UKQA 4FLRA 1IZJA 4IM4A 4UFIA 1Z32X 1CIUA 2UY3A 1HVQA 3OZOA 2PBOA 3SCUA 4MAVA 1E0XA 1E6ZA 5IDIA 3CZJA 1AVAA 4B3KA 4J3UA 4CD8A 1PX8A 3I3EA 2CCRA 1XC6A 3FHQA 3EYPA 3VIHA 1UKOA 3CUHA 4UFLA 2PWGA 1QI2A 1Q6FA 3MV01 3GH5A 1W9BM 4D6CA 4F9DA 3ZT6A 2YKKA 4CU7A 1W9UA 1KQZA 1J0HA 4C7FA 5DMYA 1ISYA 5BRPA 8CGTA 3WF2A 1EOMA 5IHRA 4CN1A 1A47A 1C92A 4ZXLA 1CGUA 5HXMA 1MW3A 1CYGA 4H2CA 1FP8A 3W6LA 4W8BA 5CLTA 3WEOA 3A23A 1J12A 5E6ZA 1GOIA 1E56A 1UWTA 7TAAA 3H55A 1JNEA 3VPLA 1FP9A 3N1AA 1E6RA 1GUVA 3LRLA 1WDPA 5I5RA 1B31A 1EA9C 3AMLA 3JUGA 4D71A 1QNRA 3L4VA 1RH9A 1E6XM 1V3MA 1GNXA 2D3NA 1OD8A 2XYLA 1ZL1A 4KH2A 4DWSD 3M07A 3PN8A 4HMEA 4AZ6A 3DYMA 1WZLA 3VGEA 1UR4A 2X2HA 1HKKA 1VJZA 1UD5A 4GPNA 3WMCA 3BSHA 1JZ7A 3CZLA 5DFAA 3CHDA 3CLWA 5A6AA 1QPKA 3WFZA 2XN0A 3RPMA 2WCSA 3NUKA 3CV5A 2UWFA 4OOUA 1UQYA 1LWJA 1C91A 4FNSA 4BS0A 4IPNB 2PWFA 1VIWA 2YA2A 3K4AA 4XZWA 4EAMA 1JYWA 4AZHA 5M17A 2XVGA 2XIBA 2FYVA 1ODZA 5E9AA 1VENA 2WPGA 2Y2WA 2ZUNA 4DUXA 2GJRA 4L4PA 4YPJA 5HBFA 1BAGA 3GBDA 4QCEA 4UOQA 3G6LA 1DEDA 1GOQA 1GW1A 2O92A 3AMKA 3U5YA 3ZJ6A 3NYDA 1W3KA 1KQYA 4OOZA 3OBAA 5CQ1A 3TTSA 1JXJA 4XUYA 1UD3A 1W2VA 4AMCA 4JHOA 4TTUA 1VFUA 3BMWA 1HJQA 4N0RA 2PBGA 2VCBA 3BAWA 3OIHA 4JKLA 3MO4A 3ZSTA 3S5YA 1TA3A 4E4PA 1XGZA 1ECEA 3VIJA 4AZCA 3M7SA 2G8ZA 1CXFA 1QBBA 1B3VA 1DWAM 6A3HA 4ACZA 1CECA 3VVGA 3IJ8A 1ZBVA 1B1YA 4DO6A 5FOOA 1R87A 2WKLA 3VDCA 3W4RA 3CZKA 2WVVB 2VQTA 3GH7A 1HVXA 3PZNA 3ALFA 1H3GA 1HT6A 3EDEA 5BRQA 1HJXA 3AHTA 3GXIA 4Z2JA 3L4YA 5IHSA 2XUCA 5A8MA 3BUIA 2W61A 2HISA 3AHYA 1A3HA 1MXGA 3T09A 1ZJAA 3D5HA 1QWNA 1BSIA 2X1IA 1CWYA 2BHUA 3VD9A 1BPLB 1JYVA 3W38A 1KXVA 3KLKA 4S3KA 5A69A 4FLSA 5LA0A 2VCAA 2ALWA 1J10A 4OIFA 3WD0A 4HZ6A 4Z2HA 1B3ZA 2VCCA 9CGTA 1E4MM 2VRQA 3AYSA 4AY1A 4LX4A 1CGTA 4DO4A 1QNSA 4M82A 3APGA 8A3HA 1GCYA 1CGVA 1HF6A 1XRVA 4PMNA 1OBAA 5JIPA 1GORA 1MFVA 1LJYA 4OZOA 2CESA 2JIWA 2XPKA 1CGXA 4AZIA 1EO5A 2OSXA 3BVUA 4PMXA 2XVKA 4QLLA 3A4WA 2VZUA 4Q7NA 2YL9A 2WB5A 3RIKA 1ZBCA 2BHZA 5GNYA 5CGTA 1IT0A 3OZPA 3MMDA 5CLWA 2TAAA 4E2OA 5I0DA 1UKTA 4ACYA 1NQ6A 1VF8A 4AEFA 4PUEA 1TE1A 1ZBWA 1VFMA 2XVLA 2E0PA 4PSRA 3ZIZA 4PTMA 1UH2A 2EPOA 3CO4A 3MSGA 2A3EA 1G1YA 2EPNA 1FA2A 5JUVA 2NW0A 1OT1A 2D0HA 4UR9A 3EMCA 2J77A 3LPPA 2WAGA 7A3HA 2E8ZA 4CD7A 4NZCA 4UQAA 4MB3A 3H53A 4JAWA 4J7RA 3T2PA 3J7HA 3CIVA 3LMYA 1UHVA 3WH6A 3ECQA 1EGZA 1UD4A 2BVDA 3DX2A 1R47A 2F61A 4AMXA 4LXFA 4W8AA 1GQJA 1M04A 4KGLA 5A6MA 2GFTA 2ZUTA 3VX0A 5DO8A 5A2CA 1TMQA 3GDBA 4J3XA 3SIMA 4KMQA 3ARTA 4H04A 1MYRA 1TQSA 4JFVA 1KR0A 2D20A 1JDCA 1R8LA 1TA3B 2Y24A 3GH4A 1G5AA 1HJUA 1G0CA 4AZCB 2YIHA 1H1NA 2CBVA 1JDAA 4D6GA
chains in the Genus database with same CATH superfamily
1T1XB 2NYYD 2Y6TE 4YDLC 4YXKL 4E9VA 2PD5A 3E9UA 3UTZB 2X0SA 2WBJC 1EZUA 1ZA3B 5LXGH 5FLUA 1M68A 5K5YA 4D8LA 4HZ7A 4Z76B 1E4WL 3ZDZE 4QRSB 4I7VA 3AWGA 5DD3H 1D3HA 4K3EH 3AUVA 1U95A 5I8CA 4ODTH 2OW6A 4HD9A 3H2FA 4PP2A 2HRPH 4LLVA 4FFYL 2WWMC 3NIGE 3SKMA 2YAFA 1XF2B 3TZVA 4REQB 1XGPA 2X12A 4W4NA 3OW1A 1W0VB 5BS0A 1TOXA 4TVDA 3MCLL 5I03A 3LKNB 4AVFA 3Q3GB 2ODHA 2ZWZA 1YHTA 2DQ6A 3R06B 3GXMA 1K6WA 1R3KB 1OB1A 3WBYA 1GW0A 2K4WA 4FQLH 1KO0A 3VH8A 2JF1A 2NY3D 3V6FA 2XBDA 3TYCA 4KPHL 3AG2B 3SOBL 2O61B 1N2RB 2EQDA 2PRHA 3D5OF 1MWAA 1WV7T 1HZHH 3QUZC 2E7FA 1F74A 2FYYA 1TTCA 4UWMA 2CZVA 6ALDA 2K4AA 2IOOA 1J86A 1A5OC 2P46B 4DCQA 1DWJM 2A77L 3U7AA 4RDVA 3RY5A 4BXSV 1MNZA 2E40A 2Y63A 4ECLA 1WZ1H 2GJZB 1IBYA 1LO3L 4PIBA 4L05A 4LASL 3U4EB 4DGVL 2B8OT 2X4OA 4DKEH 4MYXA 1DQKA 1PD0A 2V17L 5DZLA 3N6HA 3NIGB 1TLMA 1G6RH 1SDDA 1NGPL 3NA9H 3V0WH 4OLZH 2A9NL 1RPUA 3EB4A 2DVUA 3SHSA 2A3HA 1X5MA 2L8AA 4L9LB 1TZHB 5KOMC 1OLLA 1UACH 2JJUA 4JN2A 3BAIA 5EZJB 5GRUL 1ZLWK 4JO2L 4JO5A 5TDOB 2VVNA 1MCIA 1BEYH 2HXAA 5CN2A 3X11B 1XCWA 1JP5A 1EX5A 2G3FA 2DJSA 2WXOA 4A7TA 3ITXA 1UYWH 3PWNB 1PZSA 2Y8UA 3FTUA 4M43L 3UY8A 3WDRA 4CNUA 4NKMA 1KPUB 2XI9A 4PJ8A 5H1WA 5KTEL 2UBPC 5J6GA 1MHCA 1BZ8A 2YD5A 4LF3B 2HMCA 1IEQA 4LLMB 5EIIG 1UT2A 2VFDA 3PHQB 1S6NA 3HAEA 1Q6EA 1OTTC 3DX1A 4TVPH 3O16A 4PJEF 2WXJA 1F41A 2MOGA 3RY6A 5T3XD 3SRFA 4KNQA 4DBSA 5K1NA 2WBJD 1H9DA 3V4BA 1K7EA 4KI5C 1YEWA 1FY6A 3MRCB 3TW7A 2R1KA 2G2PA 3MHZA 2C3VB 2YPLA 2RR3A 4PP2B 5H37G 2FQDA 4YGAB 5TK2A 3VVVA 4G2DA 5BXTA 4MZ1A 4NWUH 1OSYA 4QGCA 1GZPB 1F7BA 3KRUA 3V36A 1V55B 3NO5A 3T0EC 3RN6A 3E6EA 5EBMA 2EDLA 3TT1L 1FA4A 4LRIA 1CDUA 4P2RE 4S1DC 5ACZB 5ID1B 1E15A 4LP4A 5B1JC 5BUPA 1FOBA 4JFYB 2OOGA 1KWGA 3MUZ1 4XPFL 1SJHA 3IDYB 3BW9A 1KCZA 3NSXA 5EPMB 3HZYB 5KVDL 1QI5A 3P3TA 2FMNA 1D8CA 4K7PY 2CKNA 4PRWA 1NC2A 5HUOA 4JNYA 1U58B 3ABZA 4MAYB 5HQMA 1H3VA 4L3CA 5E23A 4AXWA 4C83A 1X1OA 4HB7A 3EXJA 3E6HA 5IIEB 4UQ2A 1JPKA 1LCOA 4HA1A 1UWIA 3MJWA 3PDOB 4X0KB 4JD4A 4XWOC 3TO4A 2MNRA 1LP9E 1S5WA 4X4YA 4KROB 4NN6C 4F20A 4LCSA 3VRLF 3NQGA 3T4AB 4AEHH 4W6WB 4OGZA 3W25A 4FQCL 2WZ6A 1EGJH 4LDEB 1PD1A 4WDIB 2V37A 4KO5A 1DFXA 1YYLL 3IJ7A 3O3EA 2Z7ZA 5F7EL 2JEQA 4NO0B 3N9GL 5FB8A 1P1ZB 2B1HL 1TFVA 1QVBA 1IIIA 3GSOA 4AK2A 4FOKA 1OP5H 1YHPA 4WGKA 3VGBA 1VH7A 3B8VA 4ZB0A 3NTCL 3C9NA 3LCFA 2CCLA 2VZOA 3CBJB 4X4XA 3LQGA 5E0KA 2C8NA 3HAEH 3IETB 4KVCH 3CAQA 2F7PA 3U8GA 5IB3A 4RDWA 1XF4A 3KCPA 4NC0B 1RLDA 4X7DC 3PZVA 3K3QA 3G6JB 1I1FB 3DURA 3PAUA 2QEZA 3LCLA 4GFSA 3UW6A 1UG9A 5IW1A 3SDXA 5AW2B 3T8MA 2P44B 5D2XA 2YOAA 3T8QA 1PCSA 1Q5MA 4MA8L 3VG9C 4MSSA 3FB8B 2VC2L 4QOKE 2AF2A 2GSGA 5KAQF 2J88A 5JYLA 1R3RA 1WT5A 3KVJA 2XA8L 1NFIB 4HUCA 1NQBA 4M7SA 1XSKA 4WR3A 5TF1H 4NHUB 1RK1B 3VB8A 4OTKA 3UR5A 2L0DA 4ZTXA 4CC1A 4X61A 5D30A 4MX7B 5AG8A 4HXBL 5D2NE 4UTWA 4P7OA 4AQ1A 1I31A 1XBYA 1A4AA 6FABL 1YJDH 1P6WA 3PQYA 5MI0C 5TPWH 3UGXA 1UWEH 3HA1A 4LSPL 3DUUA 1AK5A 5ITBL 2FJHB 3WDHA 1TTAA 2A74B 1SXCA 1XGYH 1NKRA 5KSAB 4DB7A 1MWAH 2CDFA 3STLB 1L7IH 3QH3B 1OGPA 2WXDM 3TO2A 3O06A 5HVWA 2UXTA 4MZIA 1ZHBB 4GMTL 5DEFB 5FYLD 3KMDA 1QKZL 3BLBA 3FZUD 4FCAA 1ZS2A 1KIQA 1OXYA 5C0ND 1FVPA 2YSSA 3H2MA 4XKMA 1JK9A 1CFVL 3QY6A 3LMJL 2VTFA 1MLCB 1W31A 1WJ3A 1E6OH 3DIFA 4G9DB 5EZOL 4JO3H 3X13B 5LDSA 5D2VA 4LSVL 1NDYA 4JX0A 5IF0B 2HJKB 3E0LA 3T9WA 1G7MB 3I2CL 1SYVB 1ZIBA 2PDNA 4N0CD 2VURA 3NQCA 5A1AA 2P5ED 3DI0A 2VW4A 4MY8A 3UBFA 3SGZA 1F97A 4K8RC 3UF9A 3CK0H 3CVBA 4PG2A 4DZIA 4AW7A 3D9AH 3FT0A 1R5VB 4AEIL 5CPMA 4KQ4H 5J5EA 4ZFQA 1V7AA 1S5NA 5SV3A 1S9XA 5F7YC 3PXHA 2CA4A 1UBSA 4UFHA 3WQDA 3V7MA 1GOOA 1V0NA 1MFBH 1C8XA 4G8GA 1J5HA 4LHQB 1HXYB 1QLRB 5KSBF 3IWPA 2WXLA 1KOAA 5DBTA 4NQDE 5EWIH 3W27A 3LSOA 2FB3A 3QHNA 3UXLA 1ECQA 3EJSA 1GY1A 1YY8B 4WRLA 4XC1H 4ZS6C 5LCVL 3RWFB 5AAPA 3BAYA 3GZAA 3BO8A 1W3LA 1S7TB 3X14B 1QO3A 5BXPA 2RCSL 5ISZA 4MNGA 2GJPA 3FFOA 1JPFA 3CH9A 2RGMA 3CZSA 4KDWA 4W5ZA 1NCUA 3OKOB 3ZT7A 1EPVA 4B9FA 1LLOA 4JCLA 5BPPA 1KBIA 2EIEA 3RK8A 5D8ZA 3D3AA 3HC3L 1R34A 3VWKD 3PFRA 1LO2L 3OTTA 4LSQH 2G4JA 1SVDA 3KXFB 3AQUA 1KG0B 2E6JA 4I9WE 4G6CA 4PJGA 3UACA 3GHBH 4NOFA 3L3KB 3FQRA 3QCTL 4L4MA 1E1CA 4LB3A 3NQVA 4F2ME 3D39B 3FX4A 3IRZA 5I6LA 2WSKA 4TL4A 2XG5A 4Y4FB 4OSUH 4MASA 4XP6L 2EYRB 3WFEL 3N42F 2OZTA 4F24A 4Q32A 2FK9A 2QSQA 4XMVA 5F7KC 3UAJC 5LIWX 1SHXA 2P24A 3QUMH 4P05A 2E9MA 3GNNA 3LSBA 3W86A 4DKFL 4FQPA 4IS6B 2ZG2A 4IJRA 2X6VA 2V5TA 3L1OH 5BW6A 2RMNA 4ZX5A 5AG9A 4RNJA 4QLKA 1O68A 3KHOA 2OL3A 2OSLB 1NEZA 2J8UA 1TUXA 1YBQB 4BSJA 1DIDA 3O6DA 3E6HB 4AY7A 3QCUH 1J1OH 5I6OA 2QF7A 3QUKA 2VDPH 2A7NA 4Y8DC 2GTWA 3U1SL 1O5KA 3MA7A 4J8QA 2OJZL 1O95A 2ATKA 3L95A 5LGHH 2EABA 3PP3H 1OAYL 1AYRA 2R0WL 2WNGA 5EBLB 3GR8A 1T99A 5AVNA 3RIFF 3WLNA 1YYAA 3RCNA 1CB7B 2XUWA 4UTCA 3GWQA 2FEJA 2CIIB 4U0RC 3D2UA 1MREH 1P0BA 2R69H 2ENYA 4U4BA 3I6TA 3DVNA 1WWCA 1S8DA 3NABL 2D3LA 4F8TA 1RQEA 1U21A 2EXSA 4HJ1A 4M93C 4Q56A 2QCDA 1ZJBA 3KS6A 3KTCA 4F9JA 4DZAA 3NSNA 3D2UD 2P53A 3KRBA 4GIEA 4DWDA 4RDYA 4GRLB 2ZXDA 1AP2A 3LS5H 3THQA 1V8EA 5AOKA 4B2DD 2O9TA 2PO6C 3IS0X 5E08H 2WJEA 4NBXB 1HH6B 1I7RA 2IFFL 4LY4A 4M61A 3KL3A 3GXTA 2L4OA 3K2UH 3IXAB 3W9ZA 4WJ5B 1T89C 1NP2A 3S2NA 1NWPA 3TU9A 3T8XA 2EUVA 1CU4L 4AVKA 1NDMB 3UZQA 4YR6A 5JO5B 3TCXA 4CD4A 5BOEA 2W9DH 3S2CA 4TYUA 4FNTA 3ERPA 3OWEA 1PE1A 1XCQB 4CSTA 4IIQB 4DVOA 4EXBA 1K4DB 3ESNA 1RZKH 3NSCA 5EO1B 1IGYB 4LPCA 3D25A 3DGDA 4XN5A 4Y89A 2EDWA 1RK1A 1BVNP 3ATDA 3M1CA 3NFPA 1OZUA 3IU3A 5C70A 3UQNA 1MG2C 3FW6A 4IRJD 1R0AL 1ZGLA 2REQB 2V9DA 3BE7A 4OF8A 2ABAA 4BIKA 1BOGA 1NC4B 1WICA 4NXKA 4HOWA 2W0FB 1FZMB 3PZIA 3E96A 2EDDA 4M8VA 1VKFA 5HGDA 1B4EA 4M6OH 1X5JA 2HA1A 3H42H 2WBJB 2KZKA 4LH8A 2BJMH 1T5WA 5HWNA 1M71B 5F9OH 5PAZA 2RAMA 3FH7A 2BWGA 1NDZA 2BNJA 2ICEB 1DQUA 4HSNA 4PRIE 5FO8A 4W9DC 2EZ0C 4QP0A 1K6QH 1T0MB 3HFYA 1OQFA 4Z7OB 4UR8A 4P7RA 4NUGL 3AZSA 2IALA 2XIDA 1TO3A 4BFOA 4L8CA 1N0XH 1U1HA 3MPCA 2ZJSH 1I7ZA 3FQXB 3FT3B 1CLYH 4UT6L 4ZFOB 4MZ3A 3DXAD 3UJIH 2DKUA 1MEWA 3BZEA 5LA0A 2DEWX 4GXVH 2XQYG 1T3FA 4FG2A 4XPGL 2H90A 1KB3A 1JYNA 4LB4A 4HT1L 4K3DH 3WD5H 5K9JH 5EMMA 2Z1KA 1AO7B 1FYHB 2YA1A 1E30A 2G37A 3NXLA 3OGCA 4I1RA 3ZW3A 2XQYK 5E99H 2NNAA 1KLZA 1KBWA 4DQOL 5MEOB 4AX7A 4DKDC 2X44D 4MAYD 3VSQA 3CUPB 1LVEA 1ZTXH 1G7VA 1RZFL 4IPJA 2ESVD 4XV0A 4ZX3A 2K8QA 3JXAA 1A4JA 4P61A 4YGVB 1X5ZA 1BTCA 3ZL4H 5I07A 4PJDE 3F58L 4PGLA 1X44A 4I88A 5DHMC 4AYFB 1AJZA 4EI5B 4MLRA 3B0VC 4MD5B 4YSPA 4GG6F 3PULA 3ZYOA 4LSSH 1SM9A 5ICZB 3VCCA 5DMMA 5LXVA 2O5XL 1BYDA 5DVLA 2Y0SA 1RCXB 7CGTA 4FD0A 1G6CA 2CJUH 3EGDB 3MSRA 4AGPA 3IIVA 4ADSA 1DSFH 3S1XA 3TZVC 5KBNC 3HMWH 2YCEA 3VG0L 1LILA 3MA9H 4Q9BA 3KRZA 1WCBB 3CHRA 5KBPA 3IGFA 5TQ0L 1M1BA 1WFTA 1H0DA 3F85A 3T4AC 2YXOA 2A73B 5A43C 3L5MA 3KJ4B 2A0LC 2V81A 1HINL 1Z5HA 3DVFA 1CD1B 5CJ5A 4H1LH 1C3FA 2OFJA 3GZ3A 3LZQA 5I0VA 3TYFB 3FO1B 2YL6A 3RGHA 4DM1A 3AABA 5AHMA 4RAVB 3S0PA 1JRHH 5AW7B 4EJ1C 4UFKA 4IKIA 1GZHA 4U1KA 5D9NA 3WF3A 5F93C 4WQOA 4E5XB 1GS8A 3MBFA 3TP4A 4RFEB 2PP0A 4NQCB 4QYOA 3UTSB 2BIPA 3E5PA 4W8LA 1Q4WA 4PCTA 2BVPB 1UJQA 3C3NA 2FTWA 1YC8A 3DX5A 2GCYB 3IXTB 3T0EE 5IEHB 3O8XB 2Q87A 1NJ9B 2KZHA 3QI9B 5I02A 1FWNA 3RX5A 1PQZB 3SY5A 2NOYA 4LVOB 4NGHL 4YO0B 5EORH 4C56B 4ZX6A 1FNAA 2FQFA 4HUXA 4LLUB 2WMJA 1XCQA 2FATL 4GXWA 1FP5A 2GFBB 1MJUH 3MP3A 4AMCA 2YKLL 2X53A 3SDCD 3GSNB 4DP4X 2QQ6A 1MH5A 3GPSA 3DFOA 4P4KB 4ZW6A 1YEJL 5GRJL 1ZGLB 2FAUA 5I18H 4PTNA 1LEKB 3WN6A 4GYFA 2V7HA 4YN3A 5F7FA 4Y4FA 3Q2CA 1M6JA 3W53A 3MBED 3FY1A 5C0CB 4K7FB 3UZXA 3CL6A 2ISWA 2GAZB 3OAZK 2APTA 5BOZG 1L0PA 1K77A 3JWOL 4Y7MA 4HJGA 4WGVB 4X8JA 1JJUA 1I9RH 1G0YR 4DZ8B 5HMFA 5D70L 1SDAB 5IBUB 1CENA 5J8LA 5ECUA 4QRRA 1XCXA 1HILA 3MBWA 3R1ZA 1ECYA 3VX1A 1XW8A 3I68A 5GGQH 3ABRA 1UWUA 3BDXA 2ZP9A 1SFDA 2QPDB 2WWKT 3SRDA 4Z7VA 3CFCH 4JFEE 4GVGA 4NDMA 1LL7A 2XFFA 1QNOA 5KVEL 2E9WA 3N3TA 5LLIC 3VXQA 5GZOC 1QPNA 2CLHA 2PTVA 1QNVA 4KO6A 3NDZA 2J62A 4F0HA 5E2JA 2ATKB 4ODVL 1U8LB 2FECI 4JY5H 4PJ5E 2FWUA 2HJKA 2ZT9C 4LCWD 4IOIB 3AADB 4PY8I 3D0AA 1K9DA 2GSHA 3HB3D 4PRAB 3SW6A 2VXUH 4HDIB 1HQ4B 4KO7A 4WNSA 5EU7E 3KVKA 5JMUA 1V3IA 2FZ8A 2HUEA 2XN2A 4P46A 3M7OA 3DNKA 4HUUA 3WD2A 3EFDH 4OGAC 3PVFA 4PVLA 4V2XA 5A3HA 3F7VB 1BYPA 1NCBL 3U30C 3HLAA 5E56A 4I18C 3TIDB 3VD4A 1IGWA 2DPEA 1J05B 3HB3B 5FF4A 4KV5F 5ESQA 4EIVA 5DMKB 4EE9A 3FQWA 5DJCA 4QHLA 6PCYA 4GZEA 5HJBA 3ATZA 3DGBA 4TR9A 1HEHC 4PUBL 4OB5H 1LLZA 1RFDL 4ZX4A 3OVQA 4OLUL 5EZIH 1LM1A 1OGTA 3VGFA 5CG7A 3QNZB 4AHOA 1CXHA 3CFJB 4KI5E 4G8FB 3KPRD 3T6ZA 3V4VA 1R0MA 3PG2A 2XIMA 1QYGL 2EIMB 3V5DA 3C2VA 1EDTA 1OCZB 2Z31A 3FN0L 4AJWA 5IT2L 1OTUC 3OF6D 1QLEB 2DLGA 2NW3A 1QBLH 3RNKB 5KS9F 3MO7A 4HU0A 5B7EA 2IAAC 4F2BA 1A5FH 4D0CA 2AW2A 5I73C 2EECA 1QDSA 3S34H 2XZQL 3PY2A 3WFAA 3KXFD 1NMCB 1SOXA 1YNTA 2ICEA 1JQXA 9RUBA 1YNQA 3VDHA 3B5GA 4HFWA 3EX4A 1TSRA 3Q6FA 1FNHA 3SADA 3EX3A 4H20L 1JEZA 4OJFH 4MCNA 2FWOB 5AVUB 1A5LC 4WHYG 5FDWA 1GIGL 3E3QE 3TT1H 2WGNB 3UP6A 5JXAH 3DOIA 5DDHA 1DJQA 3FFSA 1MPAL 4DP8X 4U6YA 4HPGA 3KOFA 1BQHA 1E6NA 3LH2L 1O12A 4H9UA 1NUDA 2W38A 3FB6B 3Q8AA 1FYTA 1P2CA 3MRCA 2C3HA 4AY8A 5KSUA 4X0VA 1KR1A 5IW6A 5D7KE 5DC9B 2SFPA 5HNTA 4QQUA 3RX4A 2TMDA 4GS7C 1K8CA 3DSNA 3I85A 3LPGA 1JD9A 3QO1A 1HJSA 2C5DC 2D23A 2OQYA 4M19A 3UAAA 4JQ3A 4J1OA 7REQA 4C6JA 3VFTB 4CCCA 4AZ5A 4NZFA 3QDGB 3TEXA 3SDYL 4A6GA 5IHWA 1RALA 2XWTA 1F90L 2CJTA 4HKJB 2QDEA 3BMVA 4WJKB 2GWGA 3BARA 3PV7A 4RISH 2LFGA 3H4HA 4BF7A 2WB7A 3WJJA 3HZKA 2VLKE 1SMAA 5C0GB 5FAGA 4AM0B 3AJXA 1QU4A 5T1KD 2YAMA 3WE6A 4I2XE 5DD0H 3UBXI 1GS6X 1DJSA 4V11A 3MLWL 1G9NL 1Z42A 1HQRB 2G95A 4PC8A 3G5XB 4L1HA 5I0ZA 3KX6A 5E08L 3TM6A 3MRDA 4ZPTB 2E9LA 2ZADA 1XEDA 1MI5B 1X96A 2PPGA 4JMNA 4Y5XA 2XIQA 3DTDA 3WQ5A 4XVUD 2VUKA 3QOKA 5IVNA 3ZLHA 5HMEA 3GFXA 1IFGA 1PAZA 4IRZA 3GIZH 4AG4H 4YHEA 3TZFA 3TYGL 4I13B 4X8JB 1KPRB 1GOHA 4PJCE 1RY0A 2PO6D 4I8DA 2AKZA 5D2LB 2YCIX 3KYKH 5EEZA 1DVJA 1H3UA 4JM4L 2XFYA 2XYBA 2GQAA 2OSWA 3BHBA 1X3DA 3VWKB 5CEXA 3EXRA 5F2MA 3SGUA 5C9JA 3KOYA 2MH4A 3RVUD 1E5ZA 3I50L 3LLDA 4UTIA 2CU0A 1A5AA 4LNVA 2PZNA 4AWTA 3MACL 3UA4A 2VLLA 3LH9A 4DN4H 4LKCB 1CLXA 4U05A 4ADIA 2CHZA 2YGNA 4WV1C 1OOAA 4FN0A 4OVVA 2R23A 1EV2E 4OZFA 5HOSA 4JKPL 1JI1A 4M7LL 1D9KB 3N50A 4I3RL 4PGBB 5DA0B 4KITB 5D2WA 3B8SA 1PX4A 5BOJA 1MEIA 1QBMH 3KYMA 1QNIA 5DRWB 4YXLL 4DJDA 2A2IA 5HPMB 2CCVA 2CHNA 4CNIA 1B4JL 3RLGA 4DNMA 3PJSA 2BY2A 2DLEA 3HRPA 4L29B 4AQ1C 3OTRA 1J8RA 3NPSC 4JFFA 3GIQA 3TXZA 3EOBA 4LU0A 1MELA 1TQVA 3SCWA 3H2EA 7XIMA 1KIUB 1KXHA 3LCWA 5C0BD 1AR1D 3G5VB 4KZ0A 4U2ZA 3DV4A 3WJLA 5C0JB 3W7PA 1RZ8B 2PYFB 3MI6A 4NJAH 5A94A 2AP2A 3KXFA 4S1DD 5EUOB 3O2LA 1A3LL 3O45A 3SE4C 5KS9E 4YVPA 2QKFA 5FA4B 3MCLH 1O6IA 4HHMA 1BAFH 3S3PA 3FTZA 2WXQA 4TIMA 1W3TA 1QSFB 3VGGA 1CXKA 5GS0H 1MUCA 2ISVA 3GKFA 3IDYC 1V6XA 4U1GC 4A22A 4IX2A 5CBJA 1E5AA 32C2B 3QFJB 1WKFA 4ELMA 1G0XA 3E2HC 3GSWB 5J6SA 1C8PA 4WIQA 4HFWB 4BUHA 2G3XA 3FYIB 1W15A 1KPVA 4GSQA 4OTXH 4PS4H 5A6KA 3FGCA 4BH8A 1RAMA 3EOOA 4GOSA 5GRZA 2HFGL 1SQMA 5FUCC 3BGGA 3S2MA 1E5BA 3CS2A 4MNKA 2NQJA 3QTGA 1DLFL 2V3DA 2VDOL 4FFZL 3WLWC 1ADQL 5EEVA 4WEBL 1QI3A 1PZ5A 5KSVB 3RDTC 4FXJA 5D38A 3SRHA 1CTOA 2ETWA 4LVNC 3MOAH 3K1GA 3A64A 2V6AA 3AU2A 4I5UA 3W6MA 3EOTL 4I77L 3TCLA 4PJBE 5CFAA 4ZQRA 1R30A 5IBUG 3B2PA 1QSFE 2QQNH 4UOJA 1L2UA 5REQA 4XC1L 3VILA 5AVYB 5DGRA 1S2TA 3OGRA 1QSEB 4XOAA 3B04A 3QC3A 2R7EA 2EXWC 4PFHA 4ERIA 3OF6A 3WUWA 1U4FA 4GMSH 3EWYA 5TQ0H 1EXPA 5BRZD 3I3BA 4XMTA 1FO0L 5CR1A 3GUGA 3BTNA 1JQVA 3QJVB 4IMDA 5JDJA 1AQ8A 3TN6A 3HI5L 1TQBC 3B6SA 2PWDA 2R1YA 3LZFL 2D31A 5DJAB 1C9DA 2A85A 5CILL 1HSBB 2QCMA 2QR6A 4PM1A 5EBUA 3PFMA 3QKZA 4ZXOA 3JV6A 1RR2A 3KD4A 3BP6A 2WMPB 1GT8A 3VD7A 4HLZH 7FABH 3UYCA 3WIFB 4X9HA 1XBDA 4XWUA 2GSJA 3UTSD 2HCZX 4FFTA 1XLLA 4YC2B 4H9VA 4UQ3B 3E8UL 3Q44A 3ABGA 1Y6NR 4POYA 4ZE4A 1A1MB 3S1GA 3UJFA 3IGUA 5CSZA 2JIXD 5C08D 3UXDA 4BI7A 1OCWH 4M6AA 5F1NA 1VGEL 5HI5D 3SGDI 1JHTB 3FU0A 2WLZA 4WFHD 4QOKA 5AVVB 3GINA 3F3HA 1KNOA 1QSEE 1CZ8H 3HG4A 4PJAF 1SVCP 1PTAA 3SN4A 5HJ3A 3FXGA 2YYUA 2YD9A 1A4BA 1B90A 2B77A 4XPFH 3TN0C 1D2PA 1Y6KR 1GJIA 3O6FA 3P0YH 5HDBF 1XLJA 2DT2A 1ZA6B 4Y2LA 3CC5A 1P4LB 3NDOA 1AHMA 2IQDA 4LEXL 5ELIA 4LLUA 3V4PH 5ITBH 4G7FA 2FHBA 4JX5A 3HKZA 1VD6A 4ES9A 3N3EA 5JHDD 1NTHA 3LMZA 3S35L 1FQ9C 4HK3N 4EVNA 1K9EA 4FTDA 4L6DA 3BN3B 3OC5A 2M8XA 2FJGA 1XTLA 3N55A 1XIJA 4I9MA 4YBLB 2VZSA 3LV3A 4WY7L 1U8MA 3IGKA 3G3DA 1ZXKA 3MRMA 3AROA 1H11A 3AXXA 2NRDA 4U6XB 1LEIB 4HOMA 4OM0H 1K70A 2Y7GA 4IOSA 3R8QA 4Q9RH 3R7MA 2QKSA 3ARRA 4MCYB 1XWVA 4NYLA 5H4YA 4OY9A 5A2LH 3VYNA 3DAQA 3QN3A 3WUGA 3R11A 2DBJA 1XAKA 3LTVA 4D0BB 3MRJA 1Y65A 4U3CA 1C16B 2I9EA 4R7WA 3DX3A 4M7JL 4ZOCA 2VKXA 1JPMA 1Y5VA 1W1A1 2MKLC 2QTEA 1N5AB 3A4JA 4JFZH 2J5WA 1J5OL 4ZW8A 2AJSL 2J8UF 1DQDL 4MJ4A 5BUAA 2EKGA 3U6WA 2YGYA 3E38A 3GQYA 3ME0A 2IXUA 1N2RA 1CUOA 4K5LA 4XPAH 2Y7EA 3ASOB 2J1XA 3KBHE 4HG4J 1MRCL 1QNZH 2OPCA 3RNDA 1JZ6A 4IUGA 5I6SA 3GGWB 1NGPH 3V0WL 3TBSA 4H9MA 1KXTA 2O6CA 4EXKA 5CBAB 3KL0A 1HHJB 1RUAL 1TMCB 3CZNA 4P59L 3CFDB 1X4YA 2G60L 4PGEA 4K36A 3NIFF 3GI9H 1UIPA 4L9ZA 1XGPB 2ZXAA 4RGOL 4HNNA 5LGJA 1G94A 1UT9A 5DXXA 1I7UB 5FIEA 2VRAA 4ENED 2ANUA 4CDGC 2V9QA 1ENUA 4KKLC 5H8DA 4CDHA 5AVSB 3Q6GH 2BSTA 3H2QA 2ALDA 2FHFA 1KTNA 4R4ND 1R1CA 4WKXA 1F58H 1G69A 4U1IB 2WQPA 4YTSA 2GG1A 2JF6A 3NJLA 1DLHA 4PCSA 1L3WA 1TR7A 3TCSA 2BSEA 1T7ZA 3ISRA 3N14A 1UATA 4N4QA 3JWOC 4M3KB 1A1OA 2I24N 3TBWA 1OO2A 1P4IH 4QTFA 1PLCA 1GYWA 3CUGA 3ZLQC 5FWQA 2XFRA 3CMOH 2QS8A 2BIHA 3FC8A 4HT1H 3WD5L 5K9JL 3KWSA 4MIMA 3N40P 4IBLT 4NRRA 1CFVH 3EJZD 3WD3A 3V0EA 2C4XA 3ARUA 3NJXA 2VX4A 1I1AD 4FQLL 4OZ4A 1VSCA 3IMBA 5BQDA 3WLPA 3AG3B 2XQ0A 4PYGA 1EEYB 4BZ2L 3NIFE 4EEEA 5AHNA 3MGTA 1XQLA 3EXTA 2J7BA 3RVWD 4PMJA 1U3YA 3ZTEA 3PR2A 1VFOA 2R0ZL 4MAUL 3KR3L 2IAMC 5DJ6B 1KJMB 4WF7A 3BQ5A 1VADB 4PLKD 4R2GC 1YW1A 4AT6A 3BT2L 4WV1B 1I1AC 4LLWA 4OAWA 5CLZA 4AJ0A 3L48A 4CVWA 1CL7H 1N4XH 4M1DH 3O4LE 5C07D 5IGXH 4GG6E 2DUZA 3N42B 4N0CC 1WP6A 5FHBH 2NXHA 1AD4A 4P9ML 2V2WB 2WLYA 4P46C 3UNDA 4X9GA 5L88L 4DO5A 3D0CA 3MRGB 3MRLA 1UT1A 2Y7DA 1E9OB 4MZ2A 4OVUA 1E43A 1T1WA 2G2RB 2R29H 4OFDA 4Z9KB 4HKJA 4FRWA 1NAMB 3M5YA 5TE4L 2QQLH 3VU2A 3NM3A 4AG4L 3UESA 5K4ZA 4HUWB 4DP9X 3SUSA 2JK2A 1I9EA 1K9TA 1LO3H 3RKDD 4N1CA 1GY2A 5DYFA 1TYEB 2YAPA 3LD8B 1O60A 4PRPA 3HZ3A 5KG9B 1XYFA 3NQKA 4JM4H 3C61A 4NQQA 4Z17A 3RQ3A 4BK8A 3PPGA 5GGRY 3QC5X 3WCZA 5G1MA 4ZPTA 1A9BA 3P5YA 3AYTA 3NAAL 3RM4A 1TYRA 2BSDA 4HNVA 5LKYA 4IOIA 3QPZA 3U6RB 1DVUA 4MCMA 3LUTA 4LLDB 1PTDA 2VE6B 4GAJH 4JL2A 5KBDA 3B0PA 4Q8QA 1S7QB 4FYSA 1C5CL 1E6QM 2Z35B 5I76B 5E0CA 2H3DA 5IM51 1I8MB 2ACQA 3SKOA 3UIYA 4CVZA 2HFFA 3VTRA 1JHLL 5F7AA 1NWUA 3TZVB 2E1WA 1U8CB 4Q6IB 4AUUA 4GUGA 3DVNB 4PRHA 1ZNNA 4HC1L 3A24A 4OIIH 4M02A 3UTTE 5HYJD 1XXFC 2Z93B 3PF2A 3PZOA 3DRTB 3QZWG 5EOCH 1AH3A 4WO4A 3AQZA 3FSAA 3QLLA 2W4XA 4JK0D 5ABGA 3U82B 3KUMA 2NQ9A 1F4HA 1G7LA 2CO3A 3F4CA 3P4OB 4NI6A 1MJUL 5C2UB 2UY6B 5BXFB 1VPQA 4OGQC 4BH7A 2VN3A 4G42A 2MQGA 3KYMB 4XD6A 3TBTB 1YPZF 4WW1A 1HOCA 2Z92B 5IJCC 3MUUA 4RFEA 3WFHA 3MTWA 1QZNA 4K37A 4B3ZA 5C9XA 4MXWL 5FCUL 3PSVA 2Y7MA 3O41A 1MJJB 2VWTA 4X2RA 4RA3A 3ERXA 2PO6B 4U6HA 5L2KA 3QXWA 3BWAB 5TPWL 4AJVA 4YSRA 5DVOA 2CCWA 1SLUA 2WN2A 3CHFA 3F6JA 4KIRA 3OP2A 5B1JA 1TG7A 1MXSA 1HCYA 3WLQA 4N5UA 2X4UB 2FZ3B 3CSFA 5H94B 1T20B 4NHCH 5SWZE 3RZCC 5J06A 5JOFA 4NBZB 3MCKA 2CH8A 5IQLA 4IFKA 1JD7A 4A2EA 4K3ZA 5GJMA 5BS0D 4LC8A 3JWDC 3FKKA 2VABB 5JW5A 4UT6A 3KLLA 4MMZA 2YD1A 3ZL1A 3UJIL 2PC4A 3OHXB 5LIYX 5GZNC 4ERSL 4JTQA 3WQPA 1Q8MA 2Z4QA 2EINB 3V0UA 3WFLA 3BDKA 2Y7QA 3KPMA 2DLIA 3CIQA 1B0WA 3E9TA 4LARL 3VOHA 4EUPH 2V68A 3V10A 2OCZA 1ZMYA 5D03A 3DBSA 1R3JA 4XO9A 3BWWA 4IZGA 1HI6B 1WF5A 4CVUA 4JDYA 4OECA 5AVTB 4XD4A 3EFDL 3PJTA 3U1PA 3VI4E 5EOTB 2FDBP 2AXFA 2JB6B 2B4CL 2IPFA 3OPSA 3MLYH 4PCPA 1G9EA 1AC6A 1PDZA 1V02A 5DU7A 3T77B 3N34A 1VKXB 1ZV5A 4S3AA 2UYLB 5HJLA 4QR6A 2J6VA 3UU0A 4LLQA 4QDWA 4XAWL 2KL6A 8FABA 4JS7A 1WBZB 4PRDA 2OMZA 5KWYC 5SWZB 4LK4A 3ZUCA 1XP3A 2Z8SA 2CM6A 2AKMA 2G3NA 2Y6SC 2CWNA 2E67A 1N9PA 3EDFA 4EI5D 2EG6A 4IBYA 4IT1A 4NPKA 5GS0C 3W1PA 4C6QA 4F66A 3KBJA 3V0FA 2QJNA 2PDMA 4AD3A 2E59A 1HP4A 1BEYL 4P07A 1EC7A 3L7RA 4AD5A 1BQUA 3CU1A 1Y18A 3WEXA 4XQ6A 2XU2A 2AQSA 3FO2B 5CLXA 5JA9A 4WJEA 2CO7B 2XZ7A 2R1PA 2PWVA 5ID0B 1UM5L 1GZQA 4OLXH 5EU6D 4R8WL 3EGSB 5I8EA 2JCCE 4OGXL 1C8YA 1BXBA 1OIOA 1SMDA 5IHUL 2OX1A 4ICXA 3FQNA 3US9A 2AQTA 4Y4HB 1T7LA 4R9HA 4YEEA 3USBA 4NLHA 3BYTA 5ECGA 3LM3A 1MPAH 5A2IH 3GDRA 3TA3C 5ADOH 4GMEA 1XHHA 3PQYD 2VDKB 3UPAA 3HEIB 1MUWA 2V0TA 3FZUC 2F8OA 3P0YL 4XN1A 1PD6A 1LMIA 3CWNA 1G9MC 1JZGA 1XX9C 2HX7A 1E3FA 4K55A 3FFCA 2BSTB 4N2KA 1XBZA 1P9MC 1F3JB 4OKVB 3IAQA 2IXVA 3O0LA 3SY0B 3V4PL 4DEPC 2C3XA 2VEKA 2O26U 5SX4I 4WGXA 1JAKA 2R2HB 2VDLH 2I5IA 1EKOA 5ACMA 4HKXB 3RP1A 3EOLA 4XVDA 2V7NA 3VXRA 2ZCGA 3K0WA 3F2LA 3MJ9A 3S4TA 2ZZ6A 3W2JA 1QG3A 3WELA 5A8PA 2WO2B 4U1KB 4U4IA 3NURA 3CTLA 4WZHA 5CJQH 1UM4L 3D34A 3U36B 4L9DA 5DJ8B 5LAXB 3ZL2A 1CQKA 2E8YA 4P5TC 5I19H 3Q13A 3P61A 1N7ML 4A3YA 2HVBA 1X39A 1GYNA 2FUQA 4MD4A 3WF1A 4ZUWA 2FQEA 1KGUA 2XIOA 5DD6A 3SCRA 3K4ZA 4W9ZA 2HDJA 3WYRA 5DVMA 5AHFA 3QIBA 1ME9A 2ADGB 3LRGA 1JV5A 1PX3A 1F5WA 4QTHA 1I53A 4J35A 3IN2A 2ITCB 1YN7A 2QQQA 2HTMA 1JGEA 5FLVA 2R4SL 2MSPA 3A5VA 3TIEA 3UJRA 4Z7OE 2OTUB 3LXBA 3H9HA 3ZE1E 1HC1A 2DZBA 3SY8A 1ULVA 5BZXA 3VM7A 2VLRA 3G5ZA 4FA6A 3S4SB 2JKLA 3D18A 3ISIX 3QZOA 7REQB 4FQQB 1BMZA 3DC0A 4TQEL 3M0YA 3MVTA 4UMAA 5LNVA 2OZ4L 1W0VA 3VXUB 2GTWB 2VXUL 1F1DA 1JDEA 1JFHA 1FIGL 5AYYA 3AUWB 1US0A 2DQMA 2QV2A 2EG7A 4IHOA 1OHQA 1WAAE 3HUJA 5CJOH 1E0WA 5C0AA 4XNQA 3BRGC 1H62A 1OINA 4L3AA 3WUWB 1UZ4A 4K38A 3QZ6A 4P3CH 4I48A 3CM4A 1D3CA 4KRZA 4Q8UA 3ML8A 2OWCA 1U3HB 4XNDA 1ZT7B 4G7VL 1H2JA 3WSQH 1HK6A 1OQOA 3KNBA 4X5XB 3KCLA 3LQZA 5FX3A 2EBNA 3TNOA 1LQBC 3ECBB 3ZTJG 3F12B 2CR6A 5ECJE 5CZTA 4FFVC 5DD1L 5TD4A 5L8JB 4Z1BA 2LU7A 2XC8A 4JM2F 5FDYA 2UV3A 3G5YA 1XYCA 1K4DA 2VDMH 5EO1A 1MMFA 2CITA 2Y7FA 1MCKA 3POHA 3PJNA 4QX4A 1QAPA 5ABFA 1TVDA 3GNML 5ISZD 3PPEA 3N2BA 3TTQA 1MUJA 1G1CA 1K3UA 2HT2C 3VUSA 3S8HA 3ZGIA 4JDZA 3V9CA 4I0KA 2KAUC 4JIPA 3EFFB 3V0TA 2QGHA 3GRGA 4OJFL 4GT7A 3S2JA 1EHXA 3SJVD 4AM0Q 1K6QL 1W1TA 3WBWA 3PSWA 4N86A 1L7IL 3QULB 4LPYA 3G6JF 4O1CA 1GVIA 3TSDA 1XGRB 2VUYA 4FXGC 3VC6A 4JUSA 5ABTA 1N59A 1SHSA 3SEPA 5TIMA 4AV4A 4AEOA 1CLYL 1BM3H 4UT6H 2EVJA 3DARA 3JZYA 4ODTL 3LSCA 2ZNXA 1LO0L 3SCNA 4MQ7B 5I24A 4N5EC 2RDWA 3WJMA 1SO4A 1QR1A 2K6YA 2XRAL 4QHMB 3T7VA 3BAXA 2BMBA 4OZGF 2CFFA 3NWRA 1RIVL 3DVIA 4XBEL 1QRQA 1PU0A 1JPFB 4A63A 2DLHA 5C0JA 1GEQA 5D9PA 3W72A 3MJ8A 3TT3H 3LN4A 2DWXA 4TULH 3L13A 4XNMB 5LJYH 5FK9A 1NWRA 3S6TA 4I6KA 4GUPB 2E3ZA 5HNUA 5CZVH 1KB5H 2IPKB 3QUKB 4YZWA 3HNSH 3O2VL 1MDLA 2JKIS 5LNSA 2AJZB 5HYSA 5KZDA 2Z4QB 1Z0MA 1VGKA 3DUSB 2C71A 4GO9A 3HBGA 3SQMA 5KSBE 1AFSA 4U1HB 3U9UA 5E9DB 4TQIA 1R3IL 3AG4B 2OMXA 3LPFA 1XCFA 3IGSA 3NJ3A 5K9XA 2DYPA 3GFZA 1JFQH 1RFDH 2A6JB 4JRYB 4K7FA 2CLIA 2WANA 2PPEA 1AO7A 2FPTA 4IU2A 2APVA 1L6YA 5F89A 2NQ3A 3U9PH 4EXQA 1K3IA 3ABXA 1X5YA 1NCJA 3LNDA 1ZGLP 3KBNA 4GQ9H 1KPVB 5CAHA 1G4PA 2HKAA 2W63A 1OAUH 4MAYA 1I1CA 3FT3A 4MJ6B 2OMAA 1A53A 1Y7VA 2GVEA 3G0SA 5I8EB 3JYBA 1ZSHA 5L9DL 4P8QA 1R3HA 2CO1A 4GRMB 4XCYA 5DHVA 3FT4B 4JDVA 5E2WH 2PCFA 3V0AC 4P2OA 3GLDA 2NLIA 4G5DA 2WVUA 1LLWA 3VD1A 4N2NA 1UB6A 2NXGA 1Z9MA 2EEDA 1ZHLB 3R19A 3RZCA 3S9ZA 3ARDB 3V5FA 3MFGB 5D4HA 4XZLX 3N1PC 1IFRA 1VPYA 2AL2A 5C9RA 4U0QB 4CKVX 3L2IA 1DJYA 2JIXA 3EADA 5C08A 4QLJA 3G0XA 3R06A 5PCYA 1TPEA 1KTBA 5DWPA 2ZZ3A 3W7EA 3RG1C 3QWOB 2FHCA 1E6PA 2X30A 4F79A 3J27A 3KVLA 1KC7A 4DEUA 3B5TA 1CGWA 1YNPA 4G1MA 1LQAA 3TYFA 2B7NA 1K8IA 4HCFA 4Y4FC 5E94B 3WBAA 2PXYC 1PZAA 3OV6A 4YLQT 2DY2A 5J3HD 5EPDA 4C5YA 1THCA 2H32H 4IIQC 3OKNB 2A73A 5LQBH 1AHWA 1XF3B 3LRSB 3U25A 2XWBA 4JO8A 1MQPA 4S3CA 5G1YA 1ZKAA 4PRIB 5AYUH 1A02N 1A3RL 2FSEA 3CZ8A 1W2KT 4AISA 4X63A 4Q8PA 3PB0A 5DUMH 2R23B 3MRBB 4MADA 4GVIA 2OMVB 3M86A 3DIDA 1B30A 1MNNA 4UB0H 3DVGA 2G75A 3GKWL 3G22A 5C2XA 4X50A 2Z2AA 3H54A 3MLRL 3QFJE 1TZ8A 4BEUA 1XKJA 4NKIL 4K71C 1IU1A 2WZEA 2QADD 3JWDL 4CNIB 4JY8A 5K4XA 1KLGB 1M7IB 2QSCH 1EXGA 4JM2A 3RVXC 4P23C 4HGKC 4AYDC 3MLTA 5EUOF 1A3XA 3R0DA 3FOKA 3X11A 1B3WA 3M6YA 3HG5A 5BW7A 3O07A 3QHOA 5J11C 4X5RA 1NGYB 4AE1A 4CGTA 3ONCA 3D09A 3EEZA 1E9IA 1KD0A 1XYZA 3RGVD 4ZXBC 3THAA 2B4CH 2EC9T 4FIQA 4PJ6A 3DG7A 4JFZL 1B3XA 3EF4A 1NGWB 3H9YA 2P0OA 1QASA 1TRDA 3GSNA 3AO0A 2VH5L 3UWZA 3UEQA 2DMGA 4HGMA 1OD9A 3ASNB 1CFQB 4X5QA 2OTDA 3WH5A 4KRTA 1MRCH 1QNZL 2A6JA 4R0LC 5CEZE 1YXYA 4Z3IA 3KWTA 2FQGA 4MJIB 4FXGB 4ELDA 4PJBF 1K8YA 1R3JB 5AVQB 3V9FA 1HINH 4W85A 1MZHA 3W6YA 3QI9A 4TLSA 3QZAA 3GRIA 3FCTB 3L16A 1EHNA 2R1LA 3H4WA 3VK5A 4N90D 4PGDB 4BK5A 4F57H 4Y4FD 2P5WB 3WIAA 1D6VH 2DQIH 4Q74A 4HCGA 5ANMA 1YYLH 4O02A 4HIQA 2EXTA 1GGIL 2I14A 2P3ZA 1ACYH 2QVHA 2VZ3A 5CKSA 3T65A 5FJJA 3FRUB 3P54A 3HHRB 3O9WD 4HPYL 2XZ9A 2IIJA 2DQUL 3U9IA 2UZYB 1BQRA 4RX0A 4BJHA 4PI2A 4BWLA 3DUSA 1U8HA 4LIQL 3VJ6A 1XF2A 3R8BB 1LQ2A 3PL6D 4MSWB 3QW9A 3X1EA 1FFPB 1UMYA 5F9WB 3AIUA 5DHEA 1C29A 4Z42C 5JXQA 1I8MA 3SRKA 3UABA 3U0TA 5CGQA 1UZ6E 1ITUA 4L0YA 3TDFA 4KK6C 1RCQA 2JKTM 3DI2B 4H8HA 2DZVA 1TJHH 5GZOA 3GR7A 5B8CA 4E38A 5BRBA 1EBAA 3V5KA 3M0LA 1M7DA 2VXVL 1MVYA 4WHTA 1A4KA 3APFA 1ELSA 4NQDD 1MFDL 5CEZL 4F37K 1L4IA 4U31A 1TTIA 4LCWA 1EHKB 3F4VA 1QLRA 3A3HA 3MRQB 4DKFH 5ADPL 1CFNB 3ULAB 4F91B 4WXZA 5ABEA 4KKCD 3RNKA 4XBSA 3J07A 2OMVA 3TBYB 2AQQA 3KPSE 5LHDA 4S39A 2BX7A 1Q4NX 5CCHE 1OALA 1M5WA 3CFJA 3V4VB 2DUAA 5ENLA 3N11A 2ZSVB 4WWOA 1X5FA 1FWJC 1SW0A 2ZDRA 1PWMA 4O1BA 3BPNC 5I1JL 3TA3B 1FGVL 1XFPA 4QG8A 5ESQB 5IOPA 2VERN 4RAUB 3GIPA 4FNLL 2YEQA 2HK0A 3EWBX 1U8PB 5FYLL 2V2HA 4WO4C 3GTNA 4GSRA 4ATDA 1GJWA 1OGTB 2CLPA 5C86A 4Q6JA 3RF9A 1KPUA 5CJXC 3BOLA 4GBXC 1OAXH 1OM3L 3MRHA 1FCCA 3GSNL 5MKGB 4C65A 4YDLB 1Q6QA 1FL5B 1QFOA 4ZEPA 1W9PA 1YEKH 5D7JA 4W7UA 2OO0A 1KW1A 3RMEA 4OIBA 4KT2A 1J5SA 1KJ2B 4PRPE 4Q33A 4OUUA 3KOWA 4LAMA 2ROYA 3K2UL 4HV8B 1KXVC 1BV8A 1IT8A 1AS6A 2HV5A 1JVNA 4BYHA 4R3SB 4C55A 1X7IA 1TX0A 1E5CA 3UBXG 1V3JA 2P1FA 3CPUA 3T71A 1MFBL 2Z6IA 4CSPA 4JY6A 3VZXA 4DJFC 1HEJC 2VM3A 3VRJB 1NCAH 3C2AL 3GUFA 4FDWA 4YPGA 4LGXA 1U8LA 3WEAA 5CPTA 1ZY9A 1UXMA 4JKMA 4N2LA 2YMXL 3QI9C 4HOXA 4IOFD 4DP6X 4JTRA 3S4SA 3RWGB 5BUGA 1BAWA 2BNRD 2HS8A 3EA2A 1BGXL 2NUWA 4HA3A 2PW2A 2GT9B 1NDGA 2AJZA 5HYSB 1B3OA 4BFAA 1IQWH 2XZAH 2YGPA 3S96B 4WWKB 1X9RA 4AHPA 1CE6B 1M2VA 2DYPD 4OJCA 3WBDA 1ONQA 2DQFB 4YQXL 1SFSA 3WJLC 2J8FA 1OPGH 4JKWA 2HE5A 1S2EA 3NDYE 4Y4HC 3FTGA 1ZGLM 1XLCA 1QD0A 3OHXC 2Y89A 2ZWNA 3F7YA 3ZJ7A 2LV4A 1N64L 1NCTA 1OGAB 4BE5A 1A4LA 1IWBA 1TJ1A 1ZAIA 3T44A 3AW5A 4DWSC 1A5MC 2WKOF 2MQ3A 3MLZH 3WKML 2PI6A 4NZ8A 4FPSA 1IQDA 5D8JL 4ZAKC 4G72B 4XVTL 4E5TA 2X6AA 3ZWTA 4NJ9L 1J79A 5TJWK 3OLEA 5H91A 3L3JB 4FXFA 1IYXA 5KYWB 4N4PA 1AZUA 5FEWA 5FYJH 4R7NA 1KM6A 3THCA 4LKCA 2ZA1A 1XZ0B 3NYZA 3WLTA 2YXGA 3FN3A 3CUJA 1YEDB 3GHBL 3OLDA 3VNLA 3C8DA 3ZY7A 5A8OA 3DROA 1CGYA 4E41E 2XV6B 2H1PH 2ZZ1A 2AXGB 3MKVA 3N9SA 5E6IB 4IRSB 4P49A 4GRWF 2DIJA 1FYTD 4PHZA 5GXBB 5IB5A 4HTYA 4WCYH 4HS6B 2VGLM 2FDSA 3F5JA 4C7DA 5FM4A 3T05A 2I27N 4I0CC 1A6PA 4OV5B 3UOAB 4X6CF 3HS0B 1GVRA 2YWZA 3DEQA 3URAA 1FNLA 2QFRA 2ZUUA 1DVZA 1YEEL 4POZD 6TAAA 1OY3B 3IJEA 1LZOA 1ZLDA 3QUYB 4B15A 3WENA 3LAFA 5ANHA 4GYBA 3QZEA 1KRMA 4YHIA 2E1DA 4M5YH 1FCVA 5D09A 1YAZA 3NA9L 3SB0A 2WXFA 3W7OA 4XPAL 2NCEA 4PMEA 5G5DA 2Z0BA 2VLKD 2XXMB 3GTFA 2X1XR 2N7BA 4L18A 4Q4SA 1T4KA 3DK2A 5HJYA 1BKSA 1AODA 3MGTB 3QVQA 4XT1C 1UZ8A 3QZPA 1DCEA 2QQLL 2CK0L 4YHOH 1U30A 1MG3C 1TPXC 2DQCH 3MODH 4E9WA 3L5JA 3RJOA 2NQHA 3PBYA 3RO8A 1UCTA 4PR4A 4GH3A 1T1YB 1QVOA 3GBLA 3ISWA 3WXWL 3AFBA 4TX8A 1MHEB 3CO8A 3KFTA 1AC0A 1QSFA 2I60L 2J8GA 5HHME 2W91A 1IAIH 4GGBA 3TFKD 4P5TA 5EFDA 1AL8A 1BLIA 3BSZL 1AZNA 4MJHA 1WCQA 4E9RA 2J9YA 1Z9SB 4E9QA 4HZMA 3DI1A 4U1NB 4YDMA 5DHVH 4GQ0A 5HULA 3TLLA 2Z4GA 3DUGA 3ML9A 2B4GA 4XWGL 5BWFA 4JBSA 1DN0A 2XPGB 3P9MA 3ZRSA 5IJDC 5JMRA 2QVKA 1BYBA 2AJXL 4XO7A 5FKPB 3SJ3A 3GRBA 2VC7A 1ORQA 4G6MH 4DP0X 3OXRB 1L9OA 5CF3A 4BFKA 5ESVB 5IQ7H 3BKJH 2OLHA 3P77A 3PZ9A 4F8XA 4IDJH 2PYED 3GC2A 4ZUVA 2ZG1A 4NGHH 1IGIL 3RL1A 4D1IA 3QYSA 3PAOA 4LLVB 1TUPA 3OAYK 3RGTA 3RXZA 3YPIA 4A05A 4D8ZA 2I5YL 2IH3A 4N9GA 2OZ8A 5DFVC 1S2UA 4ZSTA 5LA1A 2XNAA 4EBQL 3NQ2A 4E42A 2WHVA 1IKFL 4LNRB 2IBBA 1U6AH 2A3AA 4BBWA 1P7QB 3GZQA 4XMUA 2HTLD 3CXHK 2H6OA 4UB0L 4L29A 4L2LA 2D0GA 3TONA 1ISZA 1C08B 2G3JA 2VX7A 3BAEH 3FT9A 4UDUA 2UZPA 2PU0A 4KKXA 4N9CA 3VACA 2J56A 3AGWA 3CFKA 2PSNA 1IGYA 1KCBA 3RKDC 3CBRA 4JM2C 2YR1A 1D5RA 3AHXA 3KPPB 1N18A 1YXCA 2AI0H 2A6NA 4GW5B 3KBPA 5B39A 1DJHA 2KC0A 3AY4A 5HSFA 3RFZB 4R7OA 2VVSA 2BHFA 3MUGB 4N8CH 2EAEA 1V79A 1BOGB 4GCAA 2HT4D 3MOQA 3T3ME 3W7RA 4N2BA 1II4E 2VQ4A 1GC1L 2LW3A 1L6GA 4TV6A 2LTQB 5AKRA 2QCGA 3RM8A 4GSUA 2HLEB 1XIWB 3H22A 1BVWA 1D7DA 3EZ8A 3VD2A 4IIQA 1MOEA 4PEEA 1LL6A 1K8DA 3KDPB 4U49A 1AQFA 2QHAA 4NRSA 5IOPB 1LTDA 2HKFL 3CL8A 3E02A 4Q4QA 1CI3M 2PXYA 3F2BA 3MI3A 3NCJL 5B22A 4L4JA 5T3XL 1EDYA 5IQ9B 4EWND 1CBGA 3FK4A 3Q45A 3SFWA 2E6AA 4WI9A 1N5YL 3V5CA 3B0UX 3WF0A 5IVXF 1B0GA 3OGSA 2VJXA 4GFXA 4LDOB 5FF2A 3T6CA 4CQDA 5CILH 3UZVA 3L9RA 5IMMA 4RESB 3TN0A 3DV4B 1VDGA 2D03H 1VS1A 2VXTL 4IF2A 2VABA 1YJDC 2OLDA 4I5XA 2ZVIA 3MLYL 4LVAA 1WZ1L 3PBMA 5LIXX 1FE8H 1DQDH 2XVNA 3SDAD 2NR6D 3CCHB 5HD8D 3TFKC 1NWTA 1WKYA 2I07B 1QX1A 4LSSL 5JNYA 1BLNB 4BQ3A 3EEGA 1I1XA 4NKDA 1O1ZA 5ALBH 2JJTC 1E27B 4HS8L 1CFSA 1EEUA 4IKNA 1T6MA 2NY2B 4BQCA 2Z91A 3C2EA 2CJUL 4PU2A 1PWLA 4DP1X 1Q0YH 3ABLB 1S2CA 5J1AB 2E6FA 3AZRA 4F7EB 4YO0A 1WUNT 3TZVD 4CQCA 4PR5A 5A8QA 9PCYA 4PV1C 4K7YA 1HYSD 4GRWB 4O1FA 4HP5A 5JH1A 3N04A 2GQHA 4KUCF 1DJGA 2NX9A 3SUWA 1QHOA 1CTMA 4LHUD 3NCWA 1AR2A 1KYDA 2IKGA 2PPAA 3U46A 2O4MA 4P2OB 1DJNA 4NZUH 4YU1A 4P7QA 3ZKND 1JYXA 5D7LE 3I75B 1IEBA 4TUJB 4FHJA 5HYSG 5MP6L 2ACRA 3W7HA 1XGQB 4GKTA 4PHXA 3ABSA 2E7LC 1VB9A 2I9LB 3VI3A 4UQBA 1W3JA 3DROB 4GX8A 1WZMA 2FATH 3N4EA 2Q3OA 2APXA 3OHMB 3W39A 2R0KH 1IX2A 4QHLB 2GEQA 5JQ9A 1HIMH 1IZJA 5KAQG 5KETA 2BW5A 1GZQB 5I18L 4GX9A 1FDLL 3L3JA 2UY3A 5FI8A 3OZOA 3PDOA 3TBWB 4RNHA 2QT6A 1K5NB 5AB1A 1V7YA 3KPOA 2FIRT 3N1MC 1H15A 4IBQA 3RAJL 4N9DA 3P4OA 1L3NA 4B3KA 2GUUA 1IAII 2I7SA 3GBML 3DFYA 3OU8A 3HZMA 3CPGA 4QRFA 1XC6A 4PRNB 2CLKA 4JQ1A 1I8IB 1O9ZA 2DMKA 3E0WA 1BX2A 1XIWD 2HH0H 4LCCA 3WLIA 4OZIB 4PJXF 1NLBH 1WA3A 3MV7E 2CMRH 4J4PD 1KCRH 3GMMA 1B0GB 1ADQH 2EIDA 2YKKA 5TFSH 1JFQL 3QQDA 1E9ZB 3HPZA 1A1NB 3B4YA 3JWNC 2PGWA 4JRXA 2PDQA 3NVTA 3WLRA 3MRPB 4K8RD 5GJSH 3MOAL 4QD2E 2R14A 4ONOA 5GGQL 1WT5C 3WN5C 15C8H 5JTWA 3M0KA 1L6ZA 4P5KB 8CGTA 2Z7GA 2ROXA 5HDBB 1JMZA 5KZMA 1AQKH 5IHRA 4KRLB 5HR7A 2DJUA 2B3IA 3WZ0E 1PKOA 5DLLA 1CGUA 4MD4B 2IJ0C 1EEPA 2EP6A 4H2CA 2C9XA 2OQHA 4R3SA 2Y85A 4LBUA 1FP8A 1FNSH 1E7UA 2YR3A 4BZ1L 1GHFH 1QQDB 3L5XL 4MLSA 2HT3D 4B97A 4NNPH