1KGXA

Three dimensional structure analysis of the r195q variant of human pancreatic alpha amylase
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFQLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Probing the role of the chloride ion in the mechanism of human pancreatic alpha-amylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kgxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kgxA01
3BUIA 1GVIA 3PTQA 2AAAA 4D6CA 3DYPA 3WUEA 4W93A 3VINA 1E4LA 4PMOA 2CIPA 1ZBWA 1R46A 3AXHA 2QF8A 2XG9A 4Z2HA 4WIWA 1E6PA 1M04A 3WF1A 2OSXA 3NSNA 5GPRA 4ZEPA 3GNPA 3I3BA 4YHEA 2GFTA 4MAZA 3WF3A 3AZTA 5IFPA 2XM1A 3LRMA 1CGVA 3ARQA 1XCWA 1QHOA 1B3YA 3VD5A 5FCZA 4N42A 2OWCA 3FXYA 2XWDA 1D7FA 1BFNA 3PTKA 4CN4A 2DSVA 2IUZA 1C7TA 3AROA 4ZXOA 5C70A 4URIA 3RM8A 2ZX8A 1GJUA 1DWGM 1CBGA 4GKLA 4ACYA 3PZVA 5DT7A 1JI2A 2QHAA 3PHAA 2G3MA 1UWIA 4PN2A 4D1IA 4MNJA 3DX3A 1K9EA 2EPMX 4BQ2A 4AEEA 1UR8A 1G01A 1ZU8A 2VX7A 2ZUUA 4JFTA 4MB3A 1JZ4A 2RGMA 3W28A 4J3WA 2WBGA 4LPCA 1E72M 4TX6A 2DIEA 3GH5A 1BVNP 3OZPA 1V3LA 1GHRA 5ABFB 3GXDA 5IXEA 3BVVA 6TAAA 3BAKA 2WYSA 3W0KA 5A6SA 3KL3A 2G41A 2VZUA 5A94A 4KH2A 2E0PA 2F7RA 2BVTA 2WM0A 2WBKA 2IXVA 2J8GA 3N11A 2W61A 4PMZA 1IZKA 5BWFA 1LLOA 2Z1SA 3OB8A 1W2VA 4PMDA 4RE2A 4J3TA 1QNQA 2XPKA 4UR9A 3W26A 4HTYA 4WKAA 1JYWA 5AC5A 2ESCA 2XFFA 1JF6A 4AMWA 2UY2A 3SCNA 1JAEA 1CDGA 4B9YA 3NSMA 2J4GA 4X9YA 2VZTA 4DWSC 4QLKA 3H55A 1QOXA 4OJYA 5LYRA 5EFFA 1GQKA 5HNNA 5A8QA 5CSUA 5HPCA 3H54A 4OBSA 4PTXA 2CNCA 2WVVB 2BY0A 2XIBA 3ARVA 3T2QA 3WQWA 4PTMA 5A2AA 3WDHA 1UZ4A 2OWWA 4NRSA 3W27A 3MUY1 3AISA 1HJVA 1C8YA 2D2OA 3AMCA 1JD9A 4ZXLA 5GNXA 3WSUA 5JBEA 3A4XA 5CPSA 4EK7A 4QCEA 4MTVA 3CLWA 4UQ9A 1OIMA 1W9UA 2V3EA 4F8XA 2WPGA 3PZTA 1DWHM 3KEHA 3VOCA 2NT1A 3ZOAA 2CKRA 5FL0A 1NWRA 4D71A 1E15A 1M7XA 1OM0A 1FHLA 5KZ6A 2VURA 2PBGA 3POCA 4KWUA 3GXIA 4UZUA 3ECQA 3EDEA 1E0XA 1W91A 2NT0A 4LX4A 4GO9A 2FDMA 3EDKA 4GXPA 3ZSSA 1E0VA 3L4WA 2J25A 1BG4A 1ISZA 2VTFA 2D0HA 3SCRA 2WCAA 1R87A 3IJ8A 2G3JA 2C8NA 5EB8A 4YPJA 1RD6A 4QAWA 3OIHA 4V2XA 3VD7A 1GPFA 3S5YA 3TV8A 2YBTA 1GCYA 3D4YA 2YDRA 3CZJA 1YHTA 1E56A 3WDRA 1KBKA 4ZE5A 4AZ6A 3D5HA 4U2YA 4DM2A 4FLOA 1R75A 2D3LA 1CGYA 3OLGA 1DEDA 1K9DA 4AD2A 1H3GA 1NWUA 3BMVA 2WMHA 3VIFA 1E3ZA 1TE1A 3U5YA 4XB3A 3GDBA 4P7OA 1V0MA 4MNMA 5A95A 1KTCA 4V28A 2WMKA 1B1YA 4MNLA 1UQZA 2PWHA 3HN3A 3N13A 4UNIA 4Z2GA 1BG9A 2DQXA 2VVSA 1MW2A 1G94A 1W3JA 1V3KA 4UTFA 1JYXA 4UFKA 1UOKA 3SCQA 3K1DA 3KLKA 3WNLA 5FD0A 1BSIA 4PTWA 3BUDA 2UY3A 3SUSA 4CD5A 3AS2A 2VRJA 3WEZA 2AMGA 3CGTA 2ZUTA 3ZT6A 2JEPA 4BZYA 3GBDA 2FH8A 4E2OA 2J7EA 3PZIA 3T2OA 1LWHA 4FNQA 3GBEA 5M3WA 1U30A 4U31A 1QNPA 3DC0A 1KXVA 1KQZA 5BRPA 2J7DA 3A4WA 4W88A 1JDCA 3VMOA 1V3MA 1J0KA 4HZ6A 4MPKA 5CQ1A 5CPTA 1VBRA 3GZAA 1WZAA 1E6XM 1PBGA 1W1TA 3GXNA 5JBDA 2ZXBA 1J0YA 4MDPA 1CXEA 1BTCA 2XSAA 1CIUA 1S46A 1FH8A 5ABFA 4HMCA 2WHMA 4MJ4A 3SCOA 1KWGA 2YKKA 1JYVA 4GPNA 1E9LA 2WW5A 4HU0A 1UD6A 5DO8A 4NF7A 4P8WA 1W9XA 3VO0A 4ATWA 1E5JA 2ZICA 3WY3A 1VFOA 3LXBA 4UOJA 1MFUA 3OLDA 2NW0A 2X8RA 3EMZA 3WH8A 2IXUA 3HG2A 5CXPA 3ARUA 3QOKA 2X0HA 4ACZB 3OGSA 1R47A 3DDGA 4MB4A 2J7HA 1I1XA 1H41A 1SMDA 1B30A 3W53A 2XN2A 1R7AA 3ZJ6A 4M82A 3UR7A 3RCNA 1K9FA 1V0KA 3VM7A 1BHGA 8CGTA 2A3EA 7A3HA 3BAXA 4YHGA 1FFRA 4CD6A 5DMYA 3PZMA 3OLIA 4KGLA 2BHUA 1HXKA 1V6WA 1US2A 2QMJA 1EDQA 2Y4SA 3TTOA 2E4TA 4Q7NA 3VTRA 3D50A 1EO7A 2CBJA 3MO4A 3TONA 1HKKA 1E1EA 4M1RA 4D6GA 3VDBA 4TTUA 3NSXA 3SCVA 1R85A 3WF0A 3PZ9A 1DWAM 1JDDA 2CCRA 3VVGA 1UKOA 4P7QA 2CETA 4QFUA 2PWEA 4BS0A 1KCKA 3ZSTA 1GOQA 3DYMA 1W1PA 1XRVA 1E3XA 4W84A 1E6SM 1OT2A 1LL4A 4UFJA 5GNYA 1IZJA 1TR1A 2OWXA 3AIRA 1B2YA 4JAWA 3AXIA 3GYCA 2WWDA 2ZUMA 3DYOA 1QW8A 3ZJ7A 4JL2A 2FHBA 1GOMA 1ISXA 3L4UA 4EANA 1HX0A 1ZBKA 1WDSA 1GUVA 1MXGA 1XH2A 1V02A 4V27A 2BY1A 4U5KA 3SUTA 3OG2A 4BCEA 1QBBA 2D73A 3GTNA 4GQRA 3UETA 1UUQA 4AIOA 3T0BA 3AZRA 5CPQA 1JFXA 3WNKA 1C93A 4TVUA 4J3VA 2DH2A 2EO7A 3EJQA 4A3HA 2A3HA 3AIUA 3EDDA 4WJXA 2DT3A 3AIVA 3VIPA 2YL9A 3M6DA 3W38A 2ZXQA 2F7PA 3CV5A 4GI9A 5CG0A 5FOOA 1R86A 5ECUA 1CWYA 1BLIA 4PMYA 1H1NA 4MAVA 1VB9A 4W5UA 4GI6A 2XN0A 3MMWA 4ZENA 1J9YA 4AMXA 2JIWA 1OIFA 2JEQA 4J28A 2VRKA 1D3CA 3WDIA 1OD0A 2WNWA 1CLVA 4UZSA 1C3FA 1XV8A 3F4VA 1PZ3A 2ALWA 4B15A 5HXMA 1J0IA 2WVUA 4MB1A 1EDTA 3K8MA 2VCAA 1RP8A 2GVYA 3QHOA 1JXJA 2WZEA 3S2CA 1B9ZA 3CUFA 3AXXA 2FHCA 2C0HA 2CESA 1GHSA 1HTYA 2WKLA 2RGLA 1KXHA 4CD8A 3BCDA 3T09A 1UD3A 5ABGA 3MI6A 1ISVA 1CEOA 3WNPA 5M03A 1Y7VA 1NOWA 2ZUWA 1HKIA 3AMGA 5A1AA 5I79A 1PAMA 1ODUA 2V3DA 3VIKA 4MNKA 4XUYA 3A21A 1VIWA 2DSUA 1QI2A 1L8NA 2B31A 4M24A 1BVZA 3QGVA 2OLHA 1SMAA 3SCTA 1GQLA 4F9JA 4B3LA 1V08A 2JF6A 4PEEA 2EBNA 3QHMA 4OOUA 4AC1X 1VEPA 2WMFA 6CGTA 2VR5A 2WLZA 1VBUA 4OZOA 4ACZA 1HVQA 3GXPA 4NSBA 1E6NA 2DH3A 1VJSA 2O92A 2J47A 1LJYA 2WMJA 2WWCA 2YLAA 2E9LA 1GOKA 3AHXA 3VNYA 8A3HA 2X2IA 1UR2A 2VCBA 3CIVA 1F4AA 1ZL1A 1US3A 4AIEA 1J01A 2X09A 1JYNA 3BVWA 4QLLA 2EPLX 2BVYA 4C7FA 2J8FA 3H53A 1K6AA 4H04A 1V6XA 1DHKA 2WCSA 1V03A 1FFQA 4UCFA 1TMQA 1WDQA 1TA3B 1LG2A 1HJWA 3AIBA 4BQ3A 1HL9A 2GK1B 4GZJA 3U7VA 2F8QA 1JIBA 1XYZA 1J0HA 3VDCA 2YLLA 2W62A 1LF1A 4ML4A 1CXLA 2FHFA 2GJRA 3ZT7A 3WIJA 1JZ2A 3AYRA 4AISA 2DPEA 2ZE0A 4JFVA 3ARYA 7CGTA 1AVAA 5CJ5A 3L4XA 3WY2A 2EADA 1W3HA 1ZBVA 1SYTA 3RMEA 5E0FA 3RILA 2X2YA 1P6WA 3AHYA 1BAGA 4PBGA 5BRQA 1UKQA 3WDPP 1NP2A 4GZIA 3ZR6A 3THCA 5E6ZA 4CD4A 1QWUA 2WKGA 1FP8A 4D6IA 3O9NA 1T0OA 1E40A 2ZUNA 1AMYA 3CZGA 3AMDA 5IDIA 1N82A 3WD4A 4NI3A 1NP0A 5C8BB 5FKYA 4CKQA 3OGVA 3AZSA 2VR4A 2CHOA 3LMYA 1QVBA 3T08A 4CCCA 4NZJA 3WDJA 2CITA 3N17A 2FH6A 4HOZA 2J75A 4PTVA 4BQ5A 5M17A 2JIEA 5E70A 3IANA 4HA4A 1UHVA 1CGWA 3HZ3A 3LRKA 3AFBA 2V5DA 1V3IA 3GXMA 1HVXA 1UG6A 3F5JA 3WEMA 1SR0A 4MJ2A 2VX4A 1XCXA 5GQBA 2VT0A 3UERA 4U3AA 2XVNA 2J7BA 1PS3A 2A3CA 3ARWA 3WL1A 3OGRA 1MQRA 3CTTA 3CHDA 3MU7A 3W6MA 3L2LA 1NH6A 1GZJA 1W9BM 4ZFMA 3UR8A 3ALFA 1ITXA 3SURA 1OD8A 4R27A 2X2JA 3AS3A 4AZ5A 2CERA 3BUPA 3VIOA 1HN1A 1OGGA 3GNRA 4X0VA 1EXPA 3LXCA 1GORA 4N0RA 1XSKA 3A4AA 5A8PA 2YFOA 2HVMA 1Q6GA 1X6NA 2AOSA 3IAPA 1LQ0A 1VAHA 2J7GA 3ZQ9A 1UD8A 3PZNA 1JZ3A 3BAJA 3I3DA 2QPUA 3BVUA 3SIMA 2BXZA 1XHGA 2VL4A 4TVDA 2D24A 3CUJA 1AQMA 3EMCA 3BSGA 2ZX6A 5BYWA 2DIJA 5I78A 2ZX9A 1KFWA 2WXDM 2GJPA 4PSPA 2O9RA 5I23A 2YDQA 4JKMA 3BVTA 1GQIA 4AXNA 1ESWA 1J0JA 2XHYA 1KQYA 4JHZA 4FK9A 2EXOA 4M8UA 4AD5A 2QLYA 3FN9A 3WN6A 2CBIA 2CBUA 3APGA 3VNZA 3L4ZA 1XSJA 1OBAA 4W8LA 4QCFA 4TTGA 3D3AA 4Z2IA 2J7FA 2WC4A 1QBAA 3AJ7A 2F2HA 2FGLA 3ALGA 1J10A 4W89A 1ODZA 2TAAA 2EQDA 2QPSA 4U3CA 1W1VA 3BAIA 1W32A 2XIIA 3AMKA 3CC1A 1U33A 2ZUSA 3RIKA 4UQCA 2WSPA 1HXJA 4D72A 3UESA 4HA1A 1MQQA 1UKSA 1VF8A 3AYSA 3EMQA 2CYGA 1MW1A 4FF5A 1W9VA 3PN8A 1EOMA 1QNRA 1Q6FA 5F7UA 1G5AA 4WK9A 4CU6A 1TG7A 1HJSA 1UKTA 1JNDA 4PMUA 1CXFA 3VIJA 3WQVA 3TOPA 1EHNA 4CVUA 1M01A 2DSKA 3NUKA 2ZWYA 2WZIA 4LYPA 1Q6CA 4AD4A 4JFUA 4CU8A 5BROA 2UWFA 3AI0A 1TA3A 4UFHA 5D9NA 4BF7A 2GK1A 1JAKA 1E4NA 4DWSD 2YL5A 3L2MA 2DT0A 4W7WA 4DWSA 1WZLA 1CNVA 3VIIA 4E8DA 2IGTA 1GJWA 4ATDA 2EPKX 2XUCA 4HPGA 1UD5A 4P7LA 1QNOA 1NOUA 3VD3A 3WFLA 1UASA 3WBEA 5I6SA 3N04A 2ZWZA 1V6UA 4AD1A 1UH3A 1SZNA 1JI1A 3ZR5A 1E6ZA 3MV01 2XVKA 4FLRA 1M03A 5HBFA 3F5LA 2CEQA 3BC9A 3HMCA 5A6MA 2YL6A 3W81A 4C7GA 2PWGA 2CPUA 3GXTA 4U2ZA 3BXWA 4QLJA 3M7SA 5LA0A 1GVYA 3WF2A 3CUIA 4W8BA 5D8WA 1EQPA 2MANA 2PBOA 3WQ4A 4GIAA 4BQ4A 1CGXA 1HL8A 1GOWA 3LPOA 4WF7A 1D2KA 3MMDA 4PUEA 1J18A 3POHA 4QDMA 1CYGA 2W4XA 1EO5A 1C8QA 1B0IA 1ISWA 3IAQA 4FNUA 2YA1A 1UD4A 5A8NA 1QPKA 4TUFA 3BLBA 1LWJA 3K4DA 5C71A 4JKKA 3CMJA 4H8HA 1Q4NX 1MYRA 5EFDA 2X1IA 3PZOA 4AYSA 4QP0A 1H0IA 3VSVA 1H0GA 1UKPA 2EPNA 4Z2JA 5I3DA 3TTQA 3IK2A 3AOFA 4BA0A 2D23A 1V3JA 2W91A 3ARPA 4HMEA 3HG3A 4IPLA 5LA2A 4RL3A 1HF6A 4NXSA 4C7DA 5BXSA 5JUVA 1QNSA 3LXAA 2ZUVA 4HZ7A 4Z2LA 2EAEA 3UG4A 5D4YA 2ZX5A 3VDAA 1I75A 1E71M 4U33A 1MWOA 2YA2A 2PB1A 2VZSA 5EBAA 1E6RA 3FAXA 1RH9A 3NDYA 1BYDA 3CZNA 3WY1A 1VFUA 2Y2WA 4UQEA 1E4IA 3VIHA 1HKJA 3WUFA 4AD0A 3A5VA 3K8LA 3W24A 2FE0A 3WQ8A 4KRUA 3WF4A 5HOSA 2WZHA 4PUDA 3RM9A 4Z2KA 2JE8A 3W37A 3PZGA 2XGBA 3TTSA 3WY4A 3QHNA 1UR4A 1PIFA 3A3HA 4XZWA 1NM9A 2EABA 3KWXA 3LRLA 1OINA 1FOBA 1V6YA 5CSYA 1B3ZA 1FH7A 3AS1A 4WKHA 1KB3A 1MW3A 1TZ7A 5BXRA 1CENA 2OW7A 3WD0A 5A8OA 5HPOA 2XJ7A 2J62A 2XWEA 1VEOA 4H8UA 3K8KA 4AIUA 3M07A 4FNSA 1H11A 2WMGA 3CH9A 2VMFA 4CUCA 5FL1A 1C91A 3CZ8A 1ZB5A 6A3HA 3WH7A 2YOCA 2JFEX 2VRQA 4S3JA 4AZCB 1J0ZA 3MUIA 2E9MA 4RE3A 2BHZA 5E0CA 3WMSA 1W9DM 3VGGA 1E73M 1H4PA 1R34A 4X0NA 1V6VA 3QR3A 3S6TA 2V38A 2V5CA 5HDRA 2F7OA 3MV11 2D22A 1XC6A 2FGZA 2Y8VA 1UH4A 1Q6EA 4L4OA 1TQSA 3WH6A 7TAAA 1JD7A 1XYFA 1Q6DA 2WMIA 4AZIA 4D6EA 1V0NA 1X6LA 4OBRA 3HG4A 3CHCA 1LG1A 4DUXA 2ZXDA 1PX4A 3ZIZA 1WNOA 1BYCA 3IJ7A 4H7VA 3T2PA 1XSIA 3VGFA 4DO4A 2CBVA 3CO4A 1B3VA 3WQ5A 1OT1A 2BXYA 2VQTA 3DX1A 1MW0A 1UWRA 1WDPA 3B9AA 4P8UA 4MB5A 1JL8A 2G3IA 1KTBA 4MDOA 1QX1A 1UWSA 3LPFA 4WSJA 5CGMA 2OW6A 3MMUA 4H41A 4YN5A 1ECEA 5I24A 3VIMA 2OYMA 3CHEA 4D6DA 1DP0A 1Z32X 4PSRA 5DT5A 1KGWA 5IHSA 4AY1A 2BY3A 3N1AA 3N18A 4Q22A 1ZJBA 1BPLB 3WEOA 5I0DA 1WZKA 1EA9C 3L4TA 3VX0A 1LL6A 3BSHA 5CGTA 1J11A 3VIGA 4AD3A 2WVTA 3VGDA 4PMQA 1VFMA 2GUYA 2YBUA 4UOZA 3I3EA 3LPGA 1CGTA 4PYSA 3UG3A 3A6OA 2WLYA 5BXTA 1PEZA 2PI6A 2EEXA 1E6QM 3SCSA 1G1YA 5D9OA 3EDFA 1M53A 3VMPA 4WKFA 4B16A 2W92A 1QHPA 1FA2A 1GONA 1CLXA 2W5FA 4GO8A 4H8VA 1H49A 2Y24A 3U7BA 4TVCA 3EJRA 2O9OA 3AIQA 4HZ8A 4XV0A 1JG9A 3BVXA 2J77A 4IPNB 3A22A 2OSWA 4D1JA 2DSZA 3DDFA 5JIPA 2J79A 1KBBA 1CTNA 3WH5A 1E4MM 4UQAA 1BYAA 1F4HA 1VRXA 1X1NA 3RJYA 3TA9A 1PX8A 1A47A 4DWSB 4W7VA 3MANA 4JCLA 3WENA 3MS8A 1JDAA 3HU7A 2X0YA 1UZ1A 4J27A 2V3GA 5D9MA 3A47A 3BH4A 3AHZA 3ARXA 3UG5A 3BLKA 3UEQA 3LX9A 3NYDA 3BUBA 4FMVA 1QHZA 1W9PA 3D4ZA 1FHDA 1JZ5A 4W87A 4CU7A 2NSXA 1UWQA 3GXFA 1KR0A 3DECA 3RO8A 1AQ0A 2GSJA 4JHOA 4HOXA 3FY1A 3SEPA 1C92A 2YJQA 4B3KA 1HP5A 3KLLA 3M46A 1HNYA 3AMLA 1HJUA 1BGAA 4H2CA 2ZX7A 3PBGA 5GNZA 5I5RA 4PMNA 3NCOA 3FHAA 1E70M 2DEPA 3EJUA 3OLEA 5FIPA 2BY2A 5EMYA 2VJXA 3VPLA 3CMGA 1TQWA 1UR0A 4A4AA 2VZVA 4JL1A 3BUQA 4DO5A 3AHTA 4AZBA 2F18A 5CLTA 4AWEA 1CGUA 1WE5A 3WDQA 3J7HA 3BAWA 1EH9A 3HG5A 2F7QA 3DHPA 1HKMA 1WDRA 4XZBA 4XX6A 1DWJM 4UQDA 4J3SA 2A3AA 2BHYA 3VX1A 2WHJA 1CZ1A 1QWNA 3ARTA 1LL7A 5A6LA 1UH2A 2YIHA 4E4PA 3RM4A 1WB0A 4WSKA 5DF0A 4D6FA 2CXGA 2HISA 1TUXA 4AZCA 3PTMA 2O9PA 2WHKA 3SCWA 4HA3A 3OA5A 4FNPA 2XYLA 3CUGA 3VSTA 3CBWA 2DT1A 2VI0A 2DDXA 3ZJ8A 3WD3A 4P8XA 3JUGA 1VEMA 3S5ZA 4J3UA 1EHAA 3WELA 1E5NA 3AIEA 1OGSA 1XD0A 3LPPA 1UR1A 1H09A 1C90A 4P7NA 2UY5A 3VMNA 3ZMRA 3UCQA 3WNNA 1EIBA 2VUYA 4LYQA 3ARSA 4EE9A 1WPCA 1WCGA 2X05A 5BCAA 5TD4A 9CGTA 3B8SA 3WBAA 5JIWA 1KXTA 1B3WA 1VENA 2GDUA 1A3HA 1B90A 1U2YA 4R5EA 3DX2A 3T0AA 1MFVA 4A3YA 1KGXA 3CPUA 4HP5A 5A6KA 4JFSA 4AYGA 3DX0A 3HJEA 4LQ1A 5JBFA 2XVGA 1QW9A 3FHQA 2GJXB 3AQUA 1GW1A 3F5KA 5I2UA 1KGUA 2PF0A 2WK2A 4FNRA 3N9KA 1QI4A 3VDHA 3WNMA 3W29A 4M81A 1G9HA 3IGUA 2WSKA 1EGZA 5DFAA 1H2JA 1JXKA 3FNDA 3MUAA 3A24A 1OGBA 3L4YA 4GI8A 4RE4A 1C7SA 3WQ6A 4CVWA 3ARRA 1JZ6A 2D3NA 1CXIA 5DEZA 4AZGA 4PMXA 3SUVA 3MSGA 1PX3A 4CN1A 2BFGA 2XVPA 1UWTA 5IFTA 1KR1A 2O9TA 3CHFA 3B9DA 2EACA 4M29A 4JKLA 2ZIDA 4GZEA 4DUWA 4FLSA 4J7RA 1WZMA 5ABHA 3WD1A 5I77A 2QMKA 4S3KA 3W25A 4CN6A 4NRRA 3THDA 4EAMA 5A2BA 4PCSA 2YDSA 1H5VA 1NWTA 1OB0A 5M5DA 3BCFA 3NDZA 4E8CA 4OKDA 4IM4A 5A6AA 5IHRA 2WMIB 4AEFA 2VX5A 5AYIA 3VD9A 2YA0A 2D1ZA 4K68A 1R8LA 3AICA 4AMCA 3KL0A 2WB5A 3GH7A 1QI0A 2GDVA 3K4AA 2WANA 1ISYA 1E1FA 3SCUA 4F79A 2XFRA 4D6JA 1K9TA 1UYQA 1RPKA 2FYVA 4W8AA 3VM5A 1PIGA 1HIZA 3PZUA 4FLQA 1KWKA 1IT0A 1L0PA 4HOWA 4UFIA 3DX4A 3WUGA 4CGTA 2PC8A 5D9PA 3WKZA 3CZSA 4GQQA 3BMWA 1UR9A 2EPOA 1JZ8A 4P8VA 4NX0A 1XD1A 2DSWA 4CD7A 4W85A 3SCPA 3WNOA 1PPIA 3KL5A 3VGBA 3EJSA 2JALA 4WLCA 2WCGA 1UQYA 2ZOXA 3N12A 2E40A 3WMCA 3ZM8A 3TP4A 3VUPA 3T0DA 4D6HA 3NJ3A 3U57A 2XN1A 3GNOA 2VX6A 4DM1A 1V3HA 3CZLA 4LXFA 3VGEA 4NZCA 3MUZ1 5AYBA 3EBVA 3SUWA 2DT2A 1HP4A 1TVPA 2YL8A 5A69A 3CZEA 1R33A 2D20A 4W7UA 1V02E 3KZSA 4AZ7A 3EJPA 2WHLA 2D0FA 2YFNA 1JNEA 4JIEA 5A2CA 3EJTA 3MKKA 2Z1KA 1JZ7A 2VNCA 2WAGA 4JZ5A 4OOZA 1GOIA 4L4PA 3W6LA 1TCMA 1DTUA 4IUGA 4PMRA 2G3NA 2W67A 4MADA 2XTKA 3E1F1 5D8ZA 3AS0A 4FNTA 2WVVA 2W66A 4DUVA 1R7OA 1CECA 3N15A 4JFWA 1UWUA 3WH9A 4NZFA 4CCDA 3BLPX 1EQCA 4IISA 2C7FA 1BQCA 3CZKA 1WP6A 1E55A 1GQJA 3QOMA 1HJQA 2BS9A 2J7CA 2V3FA 3GM8A 4Y7EA 4OGZA 2PWDA 5E9AA 1JFHA 2CKSA 2VVNA 4OIFA 3FAWA 2WVSA 4TXEA 4AZHA 5A6JA 2OSYA 4AW7A 3WD2A 1HJXA 3WUBA 1VFFA 1W3KA 2XFYA 2G8ZA 1NARA 4GINA 2D0GA 5A3HA 1BGGA 3VD4A 3SUUA 3D52A 3RJXA 4F9DA 1DWIM 3G6LA 1UA7A 5A8MA 2XGIA 1J12A 3FW6A 2VC9A 4W5ZA 1CPUA 1CXHA 1GOOA 1NWSA 1B31A 3W4RA 5BXPA 1TVNA 3WMBA 2E8YA 3VKKA 4EKJA 2GJXA 2F1BA 4B9ZA 1SFSA 1MVYA 3B9EA 3VGHA 1HT6A 4KGJA 3ZT5A 1E0WA 1XH0A 2QV4A 2E3ZA 1KXQA 3W82A 1IV8A 4NXKA 1RP9A 1TQVA 1W1YA 3BAYA 1ZBCA 2F61A 4HPHA 1V0LA 4PRWA 3II1A 2BV9A 3PZQA 4KRTA 2XVLA 5E1QA 4U5IA 3KE0A 5E09A 2JF7A 1UA3A 2E9BA 2E8ZA 1ITCA 4LGXA 1OSEA 2Y5EA 3IJ9A 2VO5A 2F1AA 4W86A 3EDJA 3L4VA 3A23A 2XM2A 1O7AA 5A6BD 3TTYA 4TOQA 2EJ1A 5A6BA 1YQ2A 3RDKA 5CLWA 4PMVA 4ATLA 3VILA 3ZJKA 1NOFA 4UOQA 2BNJA 4TX8A 4KMQA 1GNXA 1NQ6A 3WFZA 2XSBA 4HMDA 3AHVA 2VOTA 3AIWA 3U5UA 3K46A 1XGZA 1AQHA 4UFMA 5ABEA 4UQBA 1ZS2A 1BYBA 5KEZA 4J3XA 2CHNA 3DHUA 1MXDA 1FH9A 2J74A 1KCLA 1B3XA 1C8XA 3O2LA 1W3LA 4LYRA 1OCQA 4CCEA 4ZE4A 4P7RA 1QI5A 1CXKA 1ZJAA 1EOKA 2VQUA 1JGIA 3BGAA 2ZXAA 3VU2A 1EDGA 3CUHA 2UY4A 5CZKA 1VJZA 3GH4A 2A3BA 1QI3A 3RPMA 3O6AA 4M56A 3D51A 1MQPA 1PJ9A 1UD2A 2G4FA 2OYKA 3WL0A 2WC7A 2W63A 2OYLA 3ZO9A 1O7DC 1PZ2A 3G6MA 3OZOA 4UFLA 1G0CA 2J78A 1TFVA 1WO2A 2VZOA 4F66A 5AY7A 3EYPA 1WKYA 1E43A 1FP9A 1JF5A 1DWFM 2VCCA 2Q8XA 1TQUA 1WAWA 4M80A 1I1WA 4DO6A 4JCMA 3MSDA 2X2HA 4OUEA 4HU8A 1TQTA 3VSUA 1BF2A 1W2PA 1O6IA 3ARZA 2BVDA 2WC3A 2DGAA 2Y8KA 1HWWA 3OBAA 5LA1A 5AC4A 1XH1A 4PCTA 1OWQA 2PWFA 5E6YA 3NIYA
chains in the Genus database with same CATH superfamily
2ETWA 2J6VA 2O72A 3ZZ1A 3OXSA 2OFQA 2ISFA 1F74A 1E4LA 1W6TA 3V5DA 1T2XA 1E6PA 3FK4A 1PG7L 1L9PA 5IFPA 2IV9A 3CQQA 4WGVB 1I2QA 1SMOA 1IM3A 3EYVA 2GJ6B 4JANA 1F6PA 2IUZA 3LD5A 4URIA 5TIMA 1XGYH 1CBGA 5DCBA 2RFXB 4D9LH 3NPSC 4FTVE 3E8VA 3CN2A 3AO0A 4LPCA 1AIZA 2DIEA 2X4TA 4NN5C 3W0WE 5AW8B 3T3PE 4L05A 6TAAA 2UYLA 4KS0A 3DXIA 1PDZA 1IGYA 2J8GA 3VH8G 1L0QA 1KENL 3BQ6A 1EJTC 2C1HA 4KV5E 2WOQA 1YEEH 2ERJB 1O5DT 4OKVA 1TTBA 1QRNA 5LBVA 3X2QB 4PWHA 2HRWA 3MLXL 2Z64C 2APSA 4JG0H 5BRZE 4HNNA 1AW1A 5IBUG 1M7PA 5HJDA 5I18L 4RDBA 4FHAA 4PTXA 4Y7MA 4M48L 2N1TE 3H22A 1E9OA 4KITB 3JWNH 3HLAA 4QXUL 1N26A 3A4XA 1SZFA 3VNJA 4DYEA 1DJGA 1P9MC 2H6OA 1JCMP 1Q72L 5E6IB 4MA8H 1AO7B 1SY6A 2YAQA 4B9PA 2WIIB 5KZ6A 3QZ6A 2G3ZA 4JDYA 5EUKA 4HXBL 1M7UA 5DQ9B 2NT0A 4N7QA 1TR7A 3TA3A 1ASPA 5CBAA 4JQXA 1UT1A 2HFTA 2ZAGA 3GSWB 3GTFA 4P5TB 2Y7DA 4YPJA 1JE6A 1KIRA 1KC7A 4CNPA 2A4AA 3R8QA 3GEWB 4OLYL 3D4YA 3DV4B 1CR9L 1NJ9A 4FFWD 4XNXL 3L5IA 4F57L 4GFXA 1SXNA 1NAKL 3PWUB 5AKRA 1XYCA 4NQEA 1CGYA 4GUPB 1AD0A 1SN2A 2WMHA 1WT5A 1OEPA 2VXQL 3GZ3A 4MMXA 5K1NA 4CNIB 3O7UA 2AJ3A 2OXHA 4B0MM 3N13A 2GEQA 4P59H 4PFHA 1W3JA 4UTBL 4R7DA 2XINA 3ETBF 3CAWA 2JNZA 5HGHA 3ABLB 5FACA 1XX1A 1UVQB 2E5DA 3H9SB 3BYTA 5DRNB 5GS0C 2YKLL 4ONVA 4IBQA 5TK2A 2VWEE 3UNTA 4DEUA 4TNWF 3FU3A 2QEZA 5KAQG 1JDCA 5D02A 2F8OA 2H32A 4U1JA 4M7JL 4MUZA 1GAFL 3KLHC 4M7KH 2XSAA 5C0BE 2UZ9A 4AXKA 2WHMA 1E9LA 1F7BA 1NFAA 2RAGA 3D3VE 3MJ8A 4XPGL 3VO0A 2DVTA 3WY3A 3AUJA 5EEZA 2J9ZA 1T7VA 4PI0A 5G4HC 1O5QA 2NW0A 2YSSA 3UJSA 4NPYB 4G8TA 4CNNA 3KCWA 3MJ6A 1S9WA 8CGTA 2A6JB 3VI4A 4AQEA 1UM4L 1S7XA 2LU5A 2V2XA 3D06A 3OG3A 1NDZA 3IFNH 3TN0D 4FEMA 2CBJA 2IJ0C 5C55A 1CVRA 1A5AA 1TJHL 4Q7IA 1ZA6A 4KJPC 1YKWA 4J23A 5IHLB 3U4KA 3LKSA 3FT4B 5J11B 5H8PA 3K72A 1RZGA 2YEZB 1PKMA 4M7ZC 3O0RL 2AK4B 4GS7C 3SGUA 1BOGB 1P0BA 3RFZA 2EE6A 3I65A 2FR4B 1GOMA 3P9WB 1U95B 2ENSA 5CFAA 1QXLA 3NOEA 4KWWA 1DQMH 3TBYB 4GFTB 3QCTL 4GRWF 1RURL 2PDMA 5KVFL 1C9WA 1XGQA 3WTYA 1SVCP 2GIXA 1MQKL 2LLLA 4PG9A 3LYEA 5I03A 4XC3H 2P1YA 3T3MF 3L7FA 4WDXA 4JDZA 2I85A 4F80A 2NR6A 4PJ8B 1UWFA 3GRGA 2DM2A 5DTFB 1NFIB 4LEOA 3GHEH 1J0IA 1UA6H 4UTAH 4ILDA 4UT7L 2CESA 1GHSA 3EAKA 2HTKC 4N8PA 2SODB 3ASNB 1CEOA 1Y7VA 5CSSA 1UIPA 1AQKL 3EA2A 5H35A 3OJMB 4EVNB 5TF1L 1DQLH 4NQUA 3FQUA 1F6YA 4APQD 4ZMTA 2VR5A 5LBSL 2D7TH 4N5UA 4OZOA 4K3EL 1S39A 4NM8H 1W0WB 3DFOA 2PYED 1X44A 4HCHA 5IB1A 1FZKB 4G2DA 1AR1B 2WMJA 3D05A 1W54A 4MKSA 1ZLPA 1SVBA 4LVOC 2PLMA 4S2SB 1BQLH 3KPQB 5LG6A 3IJHA 1H5BB 4BFJA 2X09A 5BV7C 4C7FA 2J8FA 1V6XA 1YNLL 5IT2H 4N5ED 3TBTB 3EYFB 1LG2A 3SE3C 2EDHA 2PWVA 4YHNA 2G97A 3BE1L 2ESVD 4PRNB 1JIBA 3SBPA 4QT5B 2YD8A 3G1HA 1KFAH 5DFVD 3FFCB 4BZ2A 4ML4A 3T4YA 3AYRA 3ME0B 3M0ZA 3QUZC 4IIQB 1S7RA 2K7QA 5HUOA 2P5EE 1GT8A 2X2YA 1P6WA 1DJWA 4K7PY 1N4XL 2Q5BA 3V0JA 2I9LA 4ES9A 3O81A 2QUNA 4JPWH 2WKGA 1FP8A 2A7RA 5DJZA 1UXSA 3D08A 1NP0A 4ZW5A 2HTLC 4O1FA 3G18A 4XP1L 3NAAH 3IIXA 4N8CL 4YPGB 4PRIA 3RE0A 1KA9F 3AG3B 4KJQC 3RN6A 3BOFA 1I3GL 3BSMA 3CSGA 3SIZA 1SR0A 4KTYA 4CEXC 2ZZ3A 2J7BA 2K45A 5F7EH 2HFFB 1DE4A 2DZAA 4DPQA 1ZVHA 3LI0A 1MHCA 4JQ2A 3MLRL 1J05A 5D6DA 2P46B 3T0XA 4XAWL 2QUTA 4X0VA 4DK5A 5BZAA 3L1FA 3QDGB 3KYNB 4XZHA 2Y22A 2P5NA 3F6IA 4MD5A 4S1FA 5KTLA 2P43B 4OWGA 1PNDA 1UGKA 3UX9B 3BSGA 3V4LA 2FX7L 1QRQA 3QW9A 3V4PL 3VFTB 5T5NG 4G9PA 5HI5C 2AQ3A 3LCYA 2WJFA 4XAKD 3FF8A 3G3LA 4TNWK 4W70A 4AD5A 4FFVD 3V6OE 2RUSA 2H0PA 2Z00A 2WWOA 3AB0C 2QJMA 3VNZA 1E0OB 4FQIH 4UMCA 4UR8A 2CALA 3H2QA 3MTWA 4IJ3B 1K4DB 3D47A 1J10A 1GC1L 5F9OL 4L3EE 3RZCA 4JFQA 3JWNE 2GLKA 1Q45A 2CJTA 3EOOA 5CZXD 1MQQA 2IG2L 3VFUB 1TWIA 1NGYB 3HRZA 3R7RA 1G5AA 1SM9A 4WK9A 3PWLB 4GUOA 2DLHA 2JKWA 3FDWA 4PMUA 4NZ4A 3S4TA 2PE4A 3ELQA 2VDKL 1YEWA 4TXVB 1DXFA 3C9NA 4XQ6A 5AEAA 3GDLA 2AQ1A 5DLML 2JXMB 4MFDA 4IKNA 4RAVA 2DVXA 1RZ8B 2IADB 2FIQA 1FCQA 1TZOA 2J6EA 1UASA 4R2GB 1SZNA 2UXVA 1XIFA 2Z7WA 5DVOA 5DJYB 2EINB 2NX5A 2PWGA 2XIMA 1VGAA 1L9OA 4Q9RL 3CBKB 4QRNA 4OLWL 5FPIA 4BKLA 4MYXA 4W8BA 1FO0L 1U8QB 3RVXD 2OL3L 2P3YA 1J18A 1C8QA 4AGMA 1OAXH 1FFOB 4KZCA 5FUCC 3OA3A 1UM6L 3KYKH 5IJVB 4R3SA 1J93A 4KO7A 2A6DB 4EDWH 4M6UA 3ZR4A 4XPHL 2GWNA 4G9DB 4IGBB 5BXSA 3RX5A 5DO2D 1JGEB 1YY9C 4BI6A 1HUVA 1MWOA 2WYZA 1RZKL 1MMFA 4DSYA 3OKNB 1KYDA 3ZDXF 3UJ2A 3WEXB 2FE0A 2EIBA 2P8MA 3M7FB 3RM9A 1GKOA 3MQTA 2FO4B 3ZE2F 2XGBA 3S2NA 3GS6A 1I4FB 4PHZA 4WIQA 2FJGB 5I6MA 2WW8A 4M1CC 1XL6A 2Z0UA 4YDVB 3UZWA 1B3ZA 3BSZH 3AS1A 3GIZH 2FL5A 1AJ7L 4Q14A 1ZE3C 2E1DA 3M5XA 4H1LB 1PLBA 2WMGA 2VWTA 2WWNA 1J5IA 3ZL4H 4HULB 1COBA 4XMWA 5I9QC 3E0IA 3O1NA 3IACA 4PB5A 3ABZA 4QTIH 5JIHA 3ZL2A 5FA3B 3T5WA 4YL4A 2DW7A 3PL6B 1XYMA 1JVLA 4PJAB 5F7NC 2WQVA 3P0YH 2RKXA 5D2LE 4HW6A 1G9MC 1Q6DA 5HY9B 1G69A 4U1IB 4ZZ9A 1UXLA 4L8SC 5AVXB 2YAMA 1L7TH 4A2DA 2XU2A 4U7SA 1R3LA 2BXYA 4FALA 2NQDA 4OGXH 5LHFA 3PIQB 2CCWA 2B20A 4J6RH 4PJDF 4JO2H 5I19H 4LDOB 4YN5A 4QTHB 1LO0L 1Y0LA 5DFWH 3EF7A 1IKFH 4DJED 1Z9NA 4L1HA 4IBVA 1JUBA 1KIUB 1MWAH 3RR4A 3RUGA 1E5YA 4RMSA 3FSTA 2OMWA 4KNSA 2W3ZA 5C0FB 5DD3L 1G1YA 4YAQA 4XNUL 1F4YH 1O9VA 3DXAD 4IWWA 5DD5L 2HG5A 1J1XL 3RL1B 2DZSA 3U7BA 3WKNA 3NPZB 3EXSA 1NC2A 3OKLB 3TEUA 2E6QA 3KPTA 4Q8TA 4EPDC 4RSVA 2B1AH 1E42A 4AY8A 3L0GA 1OF6A 1Y6NR 5F1KC 5SX4H 2E56A 4CVXB 2LT9A 2OZ0A 3BH4A 1CFSA 3UG5A 3NJJA 3AXMA 5E4OA 2FJSA 4XVSL 3DESA 2NSXA 1SZRA 4ZDHA 4LC6A 5DLCA 1A0DA 2RA1A 1B88A 3HUJF 3S96B 5HDOA 3P73B 3LCIA 2XSKA 4LYKA 3CFCH 4KTDL 1BGAA 1E6JH 1CFNA 1GY2A 1CDJA 5FIPA 3KW8A 2BVEA 1LYQA 3SDAD 4JPQA 4FA6A 1JBJA 3H7BB 4CQAA 3UZYA 3V4VH 1HKMA 1ZA3B 1WDRA 4DBDA 4ODXB 2KAUC 3TX9A 4QQUA 1TWSA 4RFEB 5IK3A 2R23A 4RMUA 1VA9A 4XD4A 2LV4A 5DF0A 3DBSA 5IBXA 2XVBA 4HALA 5E1AB 4UIKL 3CHSA 2H1XA 3VWKC 2VXVL 3PP4H 1IWPA 3WD3A 2R9RA 3P4MA 4QAIA 5FGCE 4PU2A 1MXSA 3S1WA 4N0CD 3IF1B 3QDJD 1Q66A 3C5XA 3NIGE 5KSWA 1NBVH 3V55A 4FZEH 2VUYA 3HC3H 4BCZA 4F4RA 4OU1A 4DF1A 3RGVD 5TD4A 2ANUA 5C7HA 5I2IA 5D6CB 4GPVA 2PAJA 3CFKA 1C5CH 2XWBB 1X6UA 1NMAH 5J6GB 3T0AA 3M1CA 4RMWA 2NY5C 2L8AA 3MCOA 1CL7H 5IMMB 3MI3A 1A1MB 3VZYA 3U6XS 8PAZA 4WHYH 5ESQA 3LD8C 2WY3B 4QKTA 3QQ9C 1MHHB 3UWEA 1F4XL 4WWOA 3ML8A 2VEFA 5D5MA 1C7SA 4LUIA 1OOWA 4Z7WB 5T5FA 4GG6A 3NIFB 4X5XA 1HKFA 2P5WB 2XJKA 1X5FA 1GYMA 3HPSA 2Z9TA 1S9VB 5CEYB 3HI6H 4E9WA 5I77A 4M3JA 2NUPB 2X38A 3ULUL 5B1JA 2VGLM 4Z0SA 3IUIA 4M5YL 2YA0A 1RLWA 4G80A 1LUCB 5FA4B 4V11A 3ZDYE 4GHRA 1F02I 4BR1A 2ZXEB 4P8QA 4W8AA 3GDTA 3LLFA 1F97A 1AQDA 3L3HB 1A3XA 1HDMA 4HOWA 2Z7ZA 5AOZA 1T5XB 3BDKA 4OQTA 2GSHA 5D9PA 3B8VA 3BMWA 1U83A 1FVCB 4JX0A 2QELA 2DSWA 4JCWA 5L8LB 5ECVA 2POZA 1X97A 4NBYB 1T8QA 4AG4H 5TDPB 1RK6A 2FPTA 4D6HA 3MLSL 2NYYD 2NY0C 2XBDA 1SNRA 4K7PL 1QFEA 5TH2A 4DY1A 2AXFA 5AYBA 4I9JA 2PTVA 3L3IB 4Y9BA 1RBLA 3VXQA 1EPVA 3IMSA 3N29A 3BH9A 4M5PA 4JZ5A 4JIRA 4OFQA 1TCMA 3BOXA 4D8AA 2PPCA 3DV6B 4C6PA 1DTUA 2BASA 5EU6D 4YHKH 5AW5B 3N15A 4X4MA 4I8YA 2WWMD 1EQCA 3IDGB 3PHSA 2YXFA 1M7IA 1UWEH 3LBCA 3NL2A 4HFWB 1J9TA 1QSEA 1F58H 2Q3ZA 5E6ID 1BD2A 2XFGB 1X8CA 1I8KA 1NOLA 2X4SB 4DBSA 2BVOA 4O4YL 4OVUA 4ZW8A 4KQ0A 3T2LA 1IMHC 2QKIC 2R2HA 1ZVSA 1D9KC 3ULSB 1I9IH 4GKNB 1T1XA 3FW6A 2NY3B 2XWTA 1CXHA 4ZFOB 2FJUB 5G1YA 4K7VA 2Z4TA 5BUAA 2VR7A 3HI1A 4K23L 2LTQB 4B9ZA 4RAUB 3T4AB 2V2WB 1T20A 4J2QA 3D39E 1IV8A 3RVUD 2B39A 5IB4B 5E1QA 2YD6A 2L7QA 3O0KA 3K6OA 3ULUD 3X12A 2EDBA 3UGXA 3HAEB 1ETA1 5F3FA 2D31B 4P5MB 5JQ6L 1TJIL 1WDAA 2WXNA 1XLIA 4DJFD 5HGAA 3N9RA 1E67A 3P61A 3RR1A 3BKCH 4HUUA 3DK0A 3SJNA 1TUFA 4UQBA 3S48A 5CEXA 1ZJIA 2EIEA 2QR0B 4ROPA 1YPZF 3UYRH 3EYSL 3TZVC 3FF7A 4ZD3H 3TWAA 2VR8A 3LKOA 5JPNB 1XG4A 1MAML 1JGIA 2ZXAA 1N6QL 3SBRA 1OGAD 3MV8A 1OE1A 3RMJA 5T1MB 2W63A 2H8PA 5E99L 5I02A 5EBLA 2UV3A 4H20H 1TFVA 2YPKB 4YCPA 3L5LA 1WFMA 2O5NA 3KAAA 4TS6A 5FGBC 4LMQI 3SDDC 4GI4A 2Z1XA 1VLWA 2DGAA 4C6DA 1WAAE 4ZL1A 4MJ5B 1GVIA 1XG3A 2G75A 4X4YA 3VINA 2CLRA 3MMEA 2ENYA 1IE7C 4LWWA 3O8XD 4ADJA 3CQFA 1UM5H 5D1QE 1LM8V 1ULVA 4ETYA 1QT1A 2FNBA 2WOYA 4MA7L 3QH2A 4LHUG 1FX6A 3GNML 1IGIL 1H1ZA 4MMYA 3KVJA 5E94B 2F68X 2AF2A 2XWDA 3KPOA 2E09A 5IMLA 3AVEA 1DUZB 3HPAA 3ARGD 1WA3A 4KO5A 3PHAA 2VLRD 1ZIAA 2WXGA 5MERA 1XZWA 2OR9L 3UTQB 3A67L 3WUWB 5L6YH 2AK4D 3GH5A 3PBVA 5GJTH 3KLAA 1V3LA 1V4YA 1MPAH 1RIHH 2BSTA 4FXKB 3L9YA 2MH4A 2HWGA 4UUJA 5B3SB 2YAOA 4UQIM 3ULVE 3KBJA 3D69B 5BWFA 5IVZA 4PMDA 4S0TD 3MTRA 2C79A 4XPFH 3KBEA 3CMFA 4UC5A 5JH1A 1T2QH 3W83A 1OAQL 4LCYB 1IC0A 4KW2A 1VGEH 5LYRA 3KPMB 3MRHB 1NVMA 1NFDB 3EO0A 5A40E 3MLVL 4OBSA 15C8L 3K81A 4MWFA 4EZLA 3BFQG 4RPPA 3HE6D 1TOXA 3PP3H 5M95B 3OAWA 1HJVA 3TYEA 4FIRA 4EK7A 2BC4A 3TIDB 4QCEA 3MV9A 1W9UA 4UIOA 3FTGA 2Z8SA 1GEHA 2GTWB 3GZKA 2CO1A 3SJVE 2NSMA 3JSSA 3OPZL 1E15A 4C6CA 1WK0A 1NEYA 3RG6A 5C9RA 1X9UA 1RALA 5ABDE 1FIGL 1ISZA 3GMNA 3SE3A 3TAKA 2C8NA 1EFZA 4DZAA 1PKNA 3OIHA 4V2XA 1E0TA 5BO0D 4ZI8A 3TH2T 4L8DB 2X3AA 1C5DA 4W6WB 4DM2A 2FMNA 2ZDRA 3MUGA 2EJAA 5GS1C 1G43A 4N0UE 2WMKA 1BG9A 5FX3A 2I14A 5JA9A 2CBOA 2MKLC 2ASHA 3SCQA 3B7RL 3SUSA 5J7CC 4BRJA 1HZHH 4RGNC 3VXSE 4WO4D 3SGJA 4FQHB 3UCRA 3LZ3A 4KX9A 4W9TA 4UM8B 5M3WA 1G9NH 5AG9A 5F2IA 4ZUUB 4IQEA 1KCVH 4URKA 3QUMH 4PLKD 2J7DA 3LOWA 2LLGA 1V3MA 1ZGLB 5DUBB 4Y19E 4PJFE 1TPXC 3VH8B 5ENWB 1W1TA 4WI6A 1DQJB 3LHTA 1CFVH 4HUNB 1JYVA 2OA9A 4XP5L 5FKPA 1AXTH 1JK8B 4ATWA 4PN6A 4APQB 1B0RB 4FJ6A 4OD3H 4AQ1A 3BAEH 5IBUB 4ERSL 2X8RA 3QOKA 1TNMA 1FWXA 4Q6KA 1YEIH 1MCBA 1KNWA 1B30A 3ECWA 3G5VB 4HJTA 2PYEB 4A8RA 4DBUA 3KWVA 4UNKA 4LFYA 1TJ0A 2VDQL 3M44A 5TDOA 4GP4B 1ORQA 5AAWC 1LT8A 1EZLA 4Y4FA 1HXKA 4XMUA 4TLSA 3VFGL 3HHMA 1UB3A 4RZ6A 4KERA 4O8AA 1O6VA 4LSTH 2CDFA 4IMKC 3L5MA 5EU7C 3V0DA 3VDBA 4FFYH 2ESVB 3S47A 32C2B 4HGWB 3OPSA 4LO9A 3HM7A 2A6KB 3WMQA 2DI9A 4O9HL 2QZ5A 4C6EA 4Q6IA 3UBXG 4KDTC 2O4QA 2FO8A 4NP4L 3ZSTA 5CLZA 4W84A 1QKZH 1E6SM 2A9NL 2HRPL 1FYTE 2B77A 2WZTA 1CD9B 2Z7GA 3AIRA 2QTEA 1RJYB 1MJ7H 3GYCA 4JAWA 4X7EC 3BEWB 5CEWA 4OLUL 5I3IA 2EDKA 3L66A 4LUJA 3PWIA 4NUPA 5JW5A 4V27A 1FKXA 3DGRA 1F3JA 1RIUL 3SUTA 3QHZL 3H7LA 5I1CH 4MBOA 4U6VH 4O02H 5INDB 2NZLA 2IH3B 1JFXA 5HAOA 3FMGL 1MFDL 3DGGA 2OLAA 2Q2LA 1OFEA 4WJXA 4JFOB 2YL9A 2H9AA 2PF8A 3L21A 2HWZL 2ONEA 2HK1A 1KJVA 4B3EA 4ZENA 3FJTA 1E5CA 4P2RE 1YNTA 4XO3A 2AV1A 1W0VB 4HKBB 4MM1A 4NQDD 4MB1A 2GVYA 2ZRUA 3URNA 3WL9A 2HX9A 1YDPB 3LNEA 3V0VB 4YXGA 1KPUB 1C9DA 2QCLA 3D2UD 3W5MA 4WR3A 5HHOA 3CFEB 1EXBA 1L8NA 3WU1A 4F9JA 3G5XB 3N43B 4S3CA 3ROOB 4IS6B 4C56A 1AYRA 1A4KA 1ZP3A 1K8IA 1MCOL 1F8MA 3L9CA 1E6NA 5IMKA 1FWAC 3Q37A 3NO5A 2Z35A 4WU7A 1RQHA 5DXXA 1H3PH 4NBXB 2O92A 3HMWH 4C8XA 5ICZA 5C9ZA 4N2GA 2X2IA 2XY1A 4JX6A 3WXWH 3YPIA 3CIVA 4HNTA 5EO0A 3HC4H 4MDJB 4E2BA 2DPKA 2DQ6A 4NKDA 1F73A 4N2NA 4N9BA 4RGMB 2H3NB 4N0FA 2VEKA 1W72H 3U7VA 1RQBA 3R5EA 3NZPA 5E2JA 5A43C 2PF6A 5F6IB 2GJRA 1JZ2A 4N6RB 1FE8H 4RGOH 4AV4A 3WFHA 3MFFA 4XC1L 1S9XA 1ANUA 2VELA 4S1SL 1GHFL 4XTRC 5FDYA 2OMZA 1WFTA 4X60A 4GZIA 4CD4A 2YCLB 4D6IA 4X6CA 1E40A 2DWEB 3CZGA 2DQWA 2DI7A 2ZUQC 5C8BB 1DJZA 3LMYA 1KB5B 1N8IA 4L29B 3RVVC 1EHLH 4LBAA 2XZAH 1U3NA 2E74C 5I1GH 2QIIA 4MJ6B 2WXKA 4JFPB 5F1UA 1D7CA 1QO2A 4MJ2A 5C09A 5KVDE 1XCXA 5GQBA 3NZQA 5C7VA 5KETA 1T0PB 1Q7MA 2PDXA 4LOFA 1QZ1A 3OGRA 3IB4A 2BNQE 2ITDB 4XH2A 1ITXA 4GZ7A 4GVGA 5DN1A 3UIZA 1OD8A 2ITCB 4AZ5A 5E23A 2CERA 2AQQA 3D6GA 3EOYG 4JKPH 4PJ7F 5D2NC 1XSKA 3OKDA 2UXTA 3V4PB 2D69A 2VDMH 4WNSA 1ZPUA 4CC4A 2C9QA 2R56H 5C0AE 2J7GA 3VXPB 3HBQA 2QPUA 3BVUA 4L9LB 1SDDB 3V0GA 2G4JA 4M8RA 4GGHA 3LHVA 3TYZA 2ZX9A 1BBJA 3WKQA 1E3FA 3CB3A 3L6FB 1QSFE 1P4LA 4F7MB 2ARJB 4KKZA 3M0HA 1IHIA 1XI3A 1ZAHA 4BEUA 5JH2A 4F2MB 3OHMB 9PCYA 2INFA 3APGA 1H62A 2GQ8A 3L1OH 3IPEA 1PCXA 4WQOA 3BK0A 3KPSA 4PGCB 3BW9B 3FO2A 3GKZA 4XMKH 4LANA 1DE6A 3TYGL 2XIIA 3FUIA 1FLTX 3H42H 1ACYH 3SE6A 4Q8NA 3G5ZB 2GHZA 2XRAH 3M1ZA 1R0AH 2WQDA 3MCYA 4LZKA 2Y72A 2VDKB 2CHRA 4CU6A 2DQHL 3Q2CA 1UKTA 1W5OA 2J2ZB 2BNUB 4ETQA 4BV1A 3DG6A 4N3UA 1TA3A 3ITYA 2J73A 3WLWC 4O1BA 2QYGA 3BVNA 4JN7A 4GKOA 3ASWA 2QVNA 4QXTA 3TO4B 4JRXA 1IC4H 1B0GA 2DW5A 2FTPA 1M7OA 2WSQA 1NANH 3MRKB 4XI5C 4ERAA 2A2IA 3VWKA 1RVFL 4S1RL 4Z7QE 5HDBB 3VD3A 3WV0A 4XN1A 4H9UA 5JMRA 5D1XD 2HBXA 4L61A 4Y88A 1L3NA 1FDJA 2WQAA 1FO0B 4Y16D 1E5AA 3WJSA 2OL3B 5IESL 2X9XA 2IQAA 2BGNE 5CHNB 4PEKA 4QLJA 2JKPA 5LA0A 2P4AB 3CUIA 2GHWB 2JJTC 4M4RA 1WFOA 4WF7A 1H8NA 4QDMA 3DXAB 2CBPA 1S7SA 4M1GL 2W4XA 2OS7A 1KN4L 1EO5A 4JN2B 4ZQMA 5FO9B 2LU4A 4JDTL 4NVTA 3BLBA 3K4DA 2VABB 1V54B 3PZOA 5J1AA 4ERGA 2MCPH 3UADA 3AOFA 3GJEA 3VFLA 2WB7A 1TKWA 5AAMA 5E2VH 4MKNA 4HMEA 4IPLA 4WWPA 4TSAH 1A5LC 5CG7A 3R8BB 4XBEL 4GBUA 1NLDL 1XM3A 3QFWA 2VZSA 1Q8JA 4H9VA 3DARA 2ZG1A 3VIHA 5F96H 4HU2A 4CQDA 4XP4L 1C12A 8FABB 1INDH 1YEJL 2M8XA 4XZWA 2WWKT 3FDKA 1FH7A 3CQPA 2DWXA 4U3SB 1QRKA 3SDAB 1EEYB 3D2TA 5HVWA 2Z8WC 1TENA 3NQ6A 1VFAA 2B59B 4P2QD 1QLEL 3WK3A 2ZXGA 3SKUD 3TNOA 2FDSA 2TPSA 3H6OA 3AJXA 1FHGA 1R19A 1EHXA 3N44B 3O2DL 4FQ2L 3U9PH 4G8EB 2WZ0A 3EXJA 1E65A 2XH0A 1NTDA 4TO8A 1YBQA 1UWAA 1BMZA 1NBYB 5HDRA 3E2HB 4HVBA 2CUMA 4ZMNA 4HUWB 1QCWA 3PHOA 5AB2A 4Y4HB 5E8OA 4JZJC 1T6VN 4JW3A 5DMIH 2O5ZH 3CHCA 5EWIH 5I15H 1A9EB 2ZXDA 3ZIZA 1OWWA 3N4FA 1S3RA 2CBVA 4JJOA 3RGVB 1C8PA 1R5YA 6REQB 4HNUA 4LGPB 3OVUB 4UV4H 3RP1A 5I24A 2AGTA 1KFGA 1FNSL 1DBKH 3LI1A 1ZJBA 2E7MA 1EVUA 5I0DA 3NPXA 1WLHA 3T6QC 1CC3A 4KQNA 2YBUA 5E1IA 4LRTA 3EB4A 2IOIA 3FQWB 2WLJA 4LLYA 1I2NA 1QA9B 3M0XA 4HK0B 1NCHA 3NPWA 3EDFA 2JTDA 4WKFA 5L88L 4WNQB 4X7CC 4GIRA 3K30A 3Q6FA 2IDSA 2KYIA 1BFVH 1OCBA 4IPNB 4A7UA 4RQQA 1G7MA 5IDZA 4MY1A 1VCVA 4M61A 2HMIC 3L3GB 2VD8A 1ENUA 3HU7A 5J13C 2V3GA 1DBBL 4TPRL 5T3XH 1U8JA 1ETB1 3KG5A 3DLQR 4NO0D 5BOZG 1XF3A 4Q2ZA 3UU0A 4I5BA 2DI8A 2KPWA 1OVDA 1TT6A 9RUBA 3F65A 3ZWTA 4ZO7A 4YK4B 2R4RL 2JQXA 4AYID 4HQQH 3LLDA 5JLZA 1YMMA 4PMNA 3TZVA 2NY3D 1U9KA 1F90L 1F3EA 4LF3A 1SXZA 3MJ9L 5I6PA 4N26A 2PKDA 2W8CA 3WDQA 2FB4H 3KXFB 1TYJA 4UQDA 1EO8L 1WAEA 3QPKA 1GIGL 3ZXWA 5ITBL 1NC4B 5T33H 2FQIA 3OAZH 4GJTB 3FUDA 4IIFA 2WBXA 2BX7A 5FGBA 4XWOD 4K8EA 3AUOA 3B03A 4I0CC 5EU6B 2UUDH 4OCLC 2Y69B 2DKUA 1E5NA 1CT5A 2PW2B 1V93A 1X7FA 4XBGB 1JXGA 3Q4DA 4IBUA 4M6ML 1AANA 1ZTXE 4BQ6A 4CW1B 4LYQA 4J9JA 1U92A 2H2SD 5IM7B 4AIZB 5IHZB 1OZMA 1H19A 3B1UA 1Y07A 5D4QA 4LLWA 5GXBB 5ERWA 5D7LD 2XXMB 4DCQB 5A6KA 4DI9A 4WRHA 2DWYA 4BFIA 2VLLA 1QW9A 1TTCA 4XB8A 3QXBA 1U8NB 4Z7NF 1CICC 3E8UL 1MCNA 1HQ4B 1F5ZA 1JXKA 1S7VB 1OGBA 3E0LA 3ARRA 2QVKA 4MQXD 3TPKA 4KKAD 1NFKA 3MSGA 4HTBA 1TTFA 4NGHH 4M29A 1LYXA 5CJQL 2O0TA 2W1NA 2X4OA 3IFOB 4WFFD 4YNYB 3N6QA 4IL0A 5DVNA 3WO4C 4EAMA 5DJCA 4JJHA 4H0IA 4X98B 1SPDA 3DUUA 4KFOA 1BEUA 3IU4L 3DTXA 5E7BA 2WN3A 5E0KA 1PZSA 2FEEI 3P11H 3QUYC 3H3BC 2PO6C 3OAUL 4D7BA 3E6HA 2QV2A 5H8MA 3VC5A 1PIGA 1MZHA 3SHSA 3OXRB 5ID1A 3L12A 4YHML 2GCYB 3UC0L 1OGAB 4HH9A 5F70A 2VMDA 3WBYA 3C08L 2QCCA 1HKVA 3WZ0E 5A2JH 3U2SA 3PG8A 1Q8MA 1NAMH 3LCXA 3VUPA 2WLMA 1PBYA 2H1LM 4PRPD 2HVJB 3QEGH 3T2NH 4NT0A 2Y7LA 3IJYA 2X1XR 3UWWA 1AG6A 3EBVA 4H8WL 1BLNB 1ZLSL 2VM8A 4K3JL 5TPWH 4LBEB 3O8XB 3KOZA 4S3BA 1PDKB 1RJRA 3KM2A 4IM8A 2W66A 3BLIA 2CW6A 5DJ8A 1FFPB 3F64A 2WV3A 5T1KA 1BQCA 2J7CA 5DHVH 3ARGB 5CZRA 4TXEA 2VLRB 1NEZA 3NGJA 2PCFB 3S37X 5DK0A 1T1YB 3NEOA 3V6ZA 1YQVL 3P14A 1N64H 2PLKA 3KTXA 1D6VH 4JB9H 4N9GB 2Q6WA 1A5BA 2IWEA 4O28A 2Z4QA 3TVMD 1WUNT 4G9FD 3ARDB 3ATBA 4EKJA 4YL9A 4GJ1A 2VFIA 4RPQA 4IDJH 2IS7A 3OKOA 4PR4A 4JJ5A 2B3IA 2QV4A 4V1YA 1YNPA 3BAYA 4S0SD 2WXIA 5L2KE 4EAYA 2AKMA 4BHYA 3SOBH 5E2TL 3TYAA 5JMOC 4LRSA 1ITCA 1CURA 4MQTB 2VDLB 1QFUL 1YQ2A 3EOSA 2ZONA 1UENA 3HE6B 3HG1E 5MEOA 4PJCB 1NOFA 2BNJA 4NUGH 1GNXA 1QR1A 3N3MA 4NN6B 2VOTA 3B5HA 1OQFA 1LD9A 1XH3A 4JQAA 4MUPA 1W8OA 2BP1A 3BO8B 3GMOA 4UMGA 1KCLA 4G42B 4WAFA 3A9BA 2WLKA 3H3KA 4MAUL 3CPLA 2YDAA 5BRBA 3D3FA 5GHWL 2IQTA 2UXFA 2NZ9C 2UZXB 4TRPL 4IMAA 3D09A 3BZFA 1FVDB 4BSVA 3N50A 5JO5B 5DK2B 5AB1A 3WL0A 2NQJA 1EGJL 3IDXH 3P40A 3EO9L 1G0CA 4LAKA 1GL4B 1A64A 3IXTB 3PF3A 1E43A 1TPFA 2Q8XA 2ORBH 4YS1A 3FL7A 1BVOA 4B3VA 3DMMB 1VFSA 2J88L 1O6IA 5JHMA 5JPMB 4G72B 3D0LA 4KDTA 3LSOB 1WD8A 2Y8KA 2VDRB 2GJJA 3DYPA 4M8QA 4CJ1A 3UJIL 3W01A 2AABL 3Q9QA 5I5JA 1R46A 3AXHA 1XP3A 1KTRL 2IBZY 5GS2D 2X4UB 1XCQB 2FYYA 1S7TB 2IALB 4U0RC 4X9SA 2CO7A 1QHOA 1NSJA 2OWCA 1D7FA 4WO4B 1SM3H 3NEHA 5D7HA 3DBNA 4GP8B 4NBZB 3SKMA 1R5VB 3OZYA 2HJPA 3PPHA 1D5XB 1G01A 4NHUB 1ZU8A 4V33A 3VXNB 2ZUUA 4G8IA 3W28A 1S9KC 4HPOH 2EUXA 1KRBC 1S2UA 3TURA 3BG9A 5IY5B 2G41A 3OGCB 2QQNL 3I9PA 4OCRL 5I06A 2NY6C 5EC1A 3BW2A 4ODUA 5I1KH 2CD0A 4ZPVB 1T6WA 1GA2A 2A9ML 4ANVA 3RIFK 4LVDA 5GSRA 4DWSC 1W8EA 5E51A 3GDMA 4XZ9A 1O6TA 1VCAA 4IIEA 4KXAA 2YEVB 2ENQA 3SGDI 3ARVA 1KB5L 4MWAD 3KJ6L 2V7HB 1UZ4A 1XF2B 1G6RA 4NRSA 3AISA 3E1ZA 5I75B 1JD9A 2AMUA 3V6OC 5DQJB 3MLWL 1D5BA 1UACL 4JFEA 5F2FA 3RWFB 3OC8A 3PZTA 1M1XA 1X7TA 4LRNL 1PLAA 4FFZL 1SOXA 3CVDA 1YADA 5CJNA 2O4EA 4EI5C 1N8WA 2QSVA 5E9NA 3JWNC 2VWSA 1U93B 3QW3A 2ACRA 3POCA 4CCZA 2SEBB 2GJZB 1W91A 5BU6A 4GO9A 5KJ7E 4FKKA 5DX7A 4H9TA 2R29H 3ZE0F 4A6YH 1OG0A 1R87A 1OC7A 4XAYA 4WUUA 1CW2A 2FT7A 4ZUWA 2XN9E 4V15A 3CFBA 5FM8A 3MGTA 2PW1B 5HR6A 4NKIH 5TQ2L 3K6SA 3IJSB 1I1AD 4QRTB 1BJ1H 3ITXA 1CB4A 3ALWA 3M1BA 3IDJA 3MBEC 4TV3A 4JFFD 1FORL 5IM51 1KGCD 5FI8A 2FEEL 4PB4A 3SODB 2OX1A 4MGXA 5JZ7C 3WNLA 3BQUA 5G2WA 3IKKA 2EIDA 4LU5H 4GMSL 3UO1L 2K6ZA 3GJFB 1CT8A 5GGTL 3TNMB 3BP7B 1ROWA 2FH8A 3KOWA 3RWHB 1FWWA 4NQDB 4MA1C 5IQLA 1KQZA 4HS3A 3QC6X 1NQKA 5DJXA 2FJFB 7XIMA 4ANXA 5IQOA 3FU9A 5AOIA 2AK1H 3NA4A 4MPKA 3ZVHB 3G1DA 4KK5D 3WJLA 2FZNA 1Z9LA 3D2UB 5F3HA 3DCPA 4H7CA 1RUAH 1WEJL 3HLKA 4NF7A 2D03L 3NVTA 1DBMH 1GYWA 4LAOA 3ILPB 3QM3A 3LRGA 3FU6A 5DEFB 3EMZA 5CXPA 1JHLH 2VP8A 2VDQB 4ENEC 1ZT4B 3QKZA 1I1XA 4QQ3A 2ZCKH 5FO7B 3MRNA 3NYKA 3JWDH 5EN3A 2A3EA 4DUOA 1GVSA 4YHGA 1S78D 4X3ZA 2OQYA 1AACA 1NM4A 1SYSA 3TGXA 4DJDD 4K94L 2Q02A 2GL5A 1KOAA 2IPTH 1KIQB 2A73B 5AVUB 3TTOA 1TQBC 4KX7A 5C2CA 3I6GA 1E5UI 4B95C 5I5IA 2J27A 3B8DA 3UZVB 2PWUA 1G7QA 3V6FA 1R85A 2WGXA 4X6FB 2C0AA 2P49B 2BIPA 2XQYG 1A6AB 3EFDH 1ZGDA 1NCWH 5DMMA 2GBTA 2V9DA 4PS8A 3CSBA 4JFZH 3I7SA 1SFJA 5LKYA 2ZKMX 3ABXA 4BUGA 4R83A 3PQYE 3LHZA 1R24B 4FI4A 4ELMF 2Q10A 4HT3A 4AYFA 5L9DL 5I5MA 2C91A 1UWGH 4M9OA 3FGCB 5EEXA 3CWHA 1YPFA 1I7TA 1IQ8A 5TE6H 4LCUA 4GT7A 1O66A 3GKAA 4XN4A 1XPYA 3P82A 2B0SL 4IJBA 3USZA 1BQHG 3PABA 5AVWB 2BVWA 1XB6A 5IBTH 1CI3M 1R86A 5AAPA 4FO4A 2WSYA 1X5JA 1BAFH 3T0ED 2N1KA 4UT6A 3V95A 3MR9B 1J9YA 4AMXA 3WDIA 1N5AB 1ETZA 4JRYA 4POZD 1DL7L 1DJQA 5C9JB 5EHFA 3TBBA 3N9SA 5F44A 2VCAA 5JORB 2K4AA 4MDIA 2V2DA 4Y4KC 5IQ7H 2EYRB 4GAJL 3TO4D 1H6TA 1UD3A 1XIDA 3PAYA 5H37A 1EX0A 2IAAC 1YN7A 3OBKA 5HNUA 2DIBA 5EFIA 3QWRD 5CJMA 3D4GA 3VIKA 1IR2A 2GK0A 1BVZA 1IC7L 4L9DA 1IQDB 2CDGA 1FV1A 3L3KA 3C4UA 4PLNC 2AANA 3BIKB 4M5ZH 1MZZA 1VBUA 4ZUVA 2BMKA 3MO1A 2DBLL 1HVQA 2PYFB 4KWVA 3Q8BA 1JOIA 1KNOA 3H9HA 1AXIB 3X3FH 2J47A 3QJHA 1OTTC 3QFJA 5D33A 2P24A 2B8OT 4G7EA 4A6GA 4YTTA 3FS9A 1F4AA 2QGCA 4NWUH 1A1NB 1NEPA 4PJXB 4UAHA 3S42A 1MZRA 4HCDA 1K6AA 1Q94B 4MJHA 3BD3A 5KITA 5EGRA 2KMWA 4GBXC 3MP5A 3KLSA 3CN3A 4WY0A 1WA2X 2YYUA 4WJ5A 4TLKA 1ZCCA 4Z77A 5EA0L 5CAHA 2XFXA 4DP0X 4G7FA 1R3JB 3O6KH 1JWUA 5AFAA 1AVAA 4RWHA 5FGSA 2IPKB 2BOGX 2Z28A 4XZUB 5D1XB 4O10A 5D04C 1AKJD 3CFTA 1HQRA 2FZ3B 4XCCL 3SRDA 1A5SA 3C0LA 3IJEB 3QJTB 3F4NA 1GOFA 4Y16B 3LKPA 1P6AB 3H4GA 4YJZL 5DD1H 1ECZA 4NI3A 1FHUA 1A21A 5L0QB 3QJZA 5LHDA 1P5UB 4FYSA 3WDJA 5K9CA 4CQCA 3MLTB 4JO4H 1GEQA 3OF6A 4XNQB 4NHCL 2ZZ6A 4HA4A 1CGWA 1PW3A 3K0WA 4PBEA 4QNEA 1UG6A 4NUQA 3F5JA 1Q9WA 4CQ8A 4KKBC 4KK9D 1BQUA 2NY1D 5U4NA 4CGUB 4Q4KA 3VZXA 5D2TA 3AG1B 4ZX5A 2ZAIA 3O05A 5EUOE 4Y4HD 1PVNA 3UYPA 2QCDA 1AXSB 3FT0A 3B2MA 1WHOA 2R69A 2FVNA 2WLLB 4A2HA 4YQXH 1J5OH 5KSBE 4ZFQA 2Y5TB 3LN5A 3TJHD 5BYWA 4NRYB 2R0KH 3O11A 4PSPA 1ZHNB 3R06B 1SFLA 2MOVA 1H6UA 4XVTH 2XHYA 1XR9B 3CB8A 4O51A 2EXOA 3O6MH 4H1ZA 1F6AA 3LGGA 1IGTB 3L4ZA 2ZFAA 1ORSB 5AENA 4P2QB 1WJ3A 1IBDA 1X5AA 5AOUA 4I87A 3CC1A 4MAYD 1EUNA 2IFFH 4IFKB 2CYGA 1MCQA 1MCRA 5DHYB 3UBPC 1KFEA 4WCYH 2YR1A 4CVUA 1G4SA 1W56A 1HE8A 1MIEL 3MV7D 4UFHA 2QGBA 1PZUB 3L2MA 4MG4A 3P1VA 1K03A 3A3WA 3R10A 4ZTPL 3DJZA 2DLGA 3RNDA 4LVHB 3FU7A 4YHIB 4XMTA 2XUCA 4LCWD 1BCIA 3R1GL 3NDYE 5FM4A 1LXMA 1UUMA 4FLRA 4AZ8A 5E08H 1P9MA 3HMCA 1J7VR 2QIWA 4Z76B 3JUYA 4L37B 4IICA 4YXKH 2KL6A 1BYNA 3KXFD 4M5TA 1J86A 2Z91A 4IRZA 2ZF8A 4PUEA 3L9BA 5F9JA 4NIKB 1MREL 2BSLA 1KEMH 1NC4D 1MDAA 3CH1B 2YWZA 2Q8BL 3P80A 2PR4L 1MYRA 3RPIA 3QQDB 2QT3A 4UTWC 3QNFA 1WFNA 4EI6A 7FABL 1C5BH 3QGKC 2B4CH 4QUOA 3G5YB 4G43A 4QSFA 4XVOA 1EAOA 5DRZA 3QRFM 3WO8A 5BPPA 5D4YA 5DJDA 4PV8A 3QPQD 3N4AA 4NO0B 4DQOL 1I8UA 5JOFB 4RZCA 4UWQB 3QCVH 3WUFA 3SCMC 1JCYA 1IVLA 4YIQA 4P0DA 5HOSA 1BYOA 2Y61A 3DX5A 3FQTB 5EZOL 3THQA 1NUDA 2OMAA 3QG7L 2H3DA 2X3BA 3BPLB 4UT9H 2PO6A 1HL2A 2XDFA 1XLLA 1QLEB 4PGEB 1OINA 3TUUA 2CK0H 4DVRL 4DKAA 1EJVC 2CKBA 4GRWB 4OV5A 3ERXA 4LSPH 5ETUB 1I7UB 4DAIA 4FNSA 4CUCA 5K39B 4JTEA 1RUPH 3X1BA 2Q76B 3NXLA 3WH7A 3FYYA 3MRLB 4QS5A 3NVQA 4GQPH 3T3MB 4XO9A 1PV8A 4Q8BA 5K9JH 2JKNA 1W9DM 3UAFA 2R94A 4LHJB 1SUXA 1IXNA 2NY4C 4BBWA 3THMH 3WK0A 2TSAA 4L1BA 2VDLL 3TBCA 3B37A 4P5UA 4PS4H 3VQ2C 3HN8A 1QASA 4WI9A 3REQB 1BM7A 4X6EB 3JW7A 1NGZA 1LE5B 1CGSH 3LG3A 1VPOL 1GKPA 3FJ4A 5D1QC 1GGBL 3KW7A 1N8FA 5DXYA 5D7LB 3OHXB 1J8VA 4R97C 1BOYA 2VLME 1RMFH 1W17A 5TNVA 4YDJB 1HSBA 4FA8A 2EYTA 4CBPA 1AK5A 2OM5A 4KJYA 5EEUA 5HDLA 4IBYA 4OU3A 4HPYH 3NN8B 3QXVA 1BVWA 3B2PA 2WSRA 1SEQH 1DFBH 2IH1B 3NP4A 3SCSA 3QEUA 2R6OA 4I4WB 4YC2C 1CLXA 3NJVA 3P3RA 2Y3NA 2QHRH 3U4AA 2VDRL 1Z9AA 4IQJA 3B6SA 4PUUA 3WYZA 3CSYA 3ULVC 3S4SG 3ILQC 3VUAA 2DMHA 3H9ZA 5ESVA 3LLXA 3PPFA 3GBLA 3RHGA 4CADB 3OR7A 3IMRA 5I16A 3WLLA 4Y9GA 3KDPB 1A47A 1XL9A 2BWQA 5L9FA 2BSCA 2V5JA 2IANE 3EH1A 3B9VA 3FB6B 2LOEA 2Z31D 1X5IA 5J57B 4GKTA 3BUBA 1OYBA 3T55A 4GIPD 5LGHH 1PTDA 4BXSV 1UUNA 3EGXB 4OZIF 6FABH 1SBSL 2FVKA 1HP5A 4ZB0A 2WJDA 3AMLA 1LMIA 2FT6A 2ZX7A 1DIKA 1E5ZA 4C47A 1A7QH 5KW9L 5EMYA 4L80A 4OTKA 3UD6A 4PRPB 3ARDD 3BUQA 4AWEA 5CZSA 1JGMA 2FTYA 1EH9A 4UM9B 5CN3A 3HG5A 3VUSA 2X4RA 1KV7A 2JI3A 2X9ZA 2A3AA 4QRUB 4KX8A 2X28A 1AD9B 3OZKA 3WJMB 2YIHA 2V5TA 3G6AA 4LF1A 4GMTH 4O19A 5DUMH 2PDPA 4Z1PA 4HA3A 4J2XA 2OEKA 1POJA 2QDEA 3LH2H 1VZHA 3PWPD 3EWXA 5TGBA 4OD2B 3KWUA 2ATKB 4FULA 1K8DB 3JUGA 3RYSA 5EZIH 3HR6A 3S5ZA 2Z26A 2DM4A 4L4VA 3U25A 2Y7MA 2ZYIA 1HHGA 2A77L 4MNGA 3INUH 2W0KA 2HPIA 1FRGL 4S1QH 1JWMA 1EIBA 5CP3A 5FV1L 2NW3B 3FRUB 2CU9A 4AVNA 1L9MA 3RG1C 1DPMA 2F54B 3U0PA 4LPWA 4MLIA 3W87A 2I5YH 4WDIB 3D6NA 2G3XA 1JZFA 3TVMB 4G9FB 2FEJA 2YD0A 3KNBA 4FP1A 3DRTB 1JR1A 5E9XA 4L8BB 3CDZB 3IGUA 1QVOA 3DMMD 4GI8A 4LF2A 2BHFA 1JZ6A 4DPAX 3CN0A 4DI8A 1FVEA 1MCHA 2JWYA 3QUZA 1UWTA 4P4RB 2BCKA 2EACA 2EXWD 2C3XA 2WXMA 3FKRA 3KGTA 2BVPB 1FL6A 5AYIA 4OLXH 2WKOA 5G5DA 1F45A 1X5LA 2VFFA 5KS9E 3H21A 3SKOB 3TTEA 3G2GA 4YTQA 2Y70A 4Q89A 4FQXC 1TV8A 3WKZA 4GQQA 5DRWA 4Z3HA 3NCMA 4R96A 1TVBA 4QJ5B 2I24N 2ZKWA 4HYRA 3VGBA 2WUBL 1U3ZA 1R1CA 5EF1A 2ON3A 4DFIA 2AV7A 1S5NA 3OKKB 5LO7A 3MUZ1 1AMXA 2HP4A 3TT3H 3U4BH 1HGYA 3SUWA 3FEMA 4NZTH 3ITLA 1I7RB 2OXGB 3UTSD 3WIAA 3CVHA 1FY6A 3DFTA 3GVVA 3H24A 5K7JA 1PQZB 2XYBA 5J12B 2NTFB 3E1F1 2WVVA 4DZBB 1R2TA 4L64A 4JFWA 2HT2D 5FF3A 2C3VA 4P05A 4JRWA 3CFMA 3L5AA 7TIMA 1EFXA 1GGYA 2VVNA 1ZLEA 3E3QE 4AZHA 2EH8H 3NYZA 4HK7A 2QULA 1E9QB 2XFYA 1P4IH 1R5WB 2AZUA 2H26A 4GE8A 3NDOA 3ZE2B 1OTSD 5B22A 3EYQC 2PDGA 1QFWL 1Q65A 1TU2B 1JCVA 1FFNA 3NQ7A 3VCRA 1HI6B 4OCXL 3GG1A 3CWNA 4KGJA 1TO4A 3W82A 2IQ0A 3OMNB 3QEQE 1TJPA 1T22B 4C4KT 1AGEA 5IB2A 3R0NA 2AXHA 1J8SA 2A5UA 5AHLA 3ZS4A 1Z48A 4LHUD 3RDKA 4MWAB 5KYYA 2NSOA 3N55A 5HHPB 3VXME 4XRCA 3JWOL 1VGKA 4TX8A 3WFZA 2HZGA 4LV9A 3GSVA 4FTDA 3KBWA 1FNEA 5GISH 5FOJA 2CHNA 4R0LC 4PJIF 3O4LD 1R2RA 2NV9A 2XA8H 5FHAL 4E41E 1Q9LA 4EPSA 3PPCA 3ANVA 1ZHBA 2MQ3A 2OYLA 3QNYA 3NQGA 3EW3B 1AZBA 1I9JH 2ZYHA 2WBJC 1E50A 4A39A 1A3LH 2J55A 1UBSA 3PDOB 5JQHC 1J6OA 9XIMA 2WAHA 3K71B 4IOIB 4JFYA 1HJBC 1I1AB 4F5CA 4ZXBC 1N5YH 1HAUA 2QFPA 3KHJA 2R7EA 2AAAA 5GRZA 4JFFB 3QULB 4PJ5D 2CNYA 1OF2B 4Z2HA 4B2DA 3ISWA 2E9WA 5GPRA 3KCLA 5H94B 3S36H 3I3BA 1IAIL 3OAYH 1OZQA 1R6VA 5FUZH 4F8QA 3G6JA 4ERIA 5IQMA 4ZSTA 2AP2A 3ECBA 5FCZA 4ZQKA 4NJAH 1KMGA 5ANME 4CN4A 2CLZB 1VKFA 2Y1AA 3MLZL 4JG1L 3ZVVA 2VUNA 4PRTA 4OZ4A 5CD5C 3PZVA 2QHAA 4TOYL 1TMHA 5EOTA 4B3ZA 3UTPD 2Q3OA 3NGBC 2B5IC 2VQ1B 2ISSA 2DQTL 1M2VB 4J3WA 1VACA 3M5YA 2ATPA 2BRQA 4G6AC 3W2DL 4Y5YC 2HJKB 2VZUA 4HX1A 2OMNA 5F7DB 4EVZA 3F2CA 2W9EH 4HWBL 2XKNB 3EFFB 4M62L 4P2VA 3WN5B 1HKLH 3C60D 3GUTB 1KBIA 4HT1H 2VDIA 3GRWL 4FEIA 4L8SA 4HJIA 3W84A 2AEQL 3R4RA 3QA3A 1E5BA 5SWZE 1EZUA 5JDSA 1CUOA 2V9TA 5EDSA 1A4BA 1AZZC 2VR2A 5EF3A 2OULB 1DBJL 1JPFA 3MB9A 1P7KA 4DGVL 5CINH 4GW1B 2E9IA 4ZXLA 1XGRB 5HP5A 1CU4H 4MTVA 4GSDH 3HMXH 5BZDA 1AGFA 4DVBB 2F5BL 5B80A 1DN2A 3K6FA 5CJOL 4KAQL 3BZDA 1NWRA 3Q9PA 2GJ6E 5AD0B 4KZ0A 4HHWA 1YECL 2X5PA 4UZUA 3DTDA 3MNZA 2HT4D 5C2BL 1TZGH 1MRDH 2A83A 3HBGA 1ZQ5A 4QI3A 1FGVH 2WCAA 4AL8C 4UIMB 5FJRA 1KN2H 3UPCA 3DERA 3NABH 1KPRA 3AACA 3DKLA 4X99B 5FF2A 1LTDA 3IGAA 2R1XB 3CZJA 3RRQA 3MODH 3UXAA 2LLNA 2QSCL 3RHWK 7REQA 5DMKA 1CB7B 3OLGA 4RMTA 2NX9A 3RTQC 1E27A 4XB3A 3QZMA 1ONWA 3C8NA 4V28A 3MA9H 5G4EA 2DRUA 2VRAA 4ONOA 1CIDA 2PWHA 2EEDA 4RESB 4V2CB 4AJ0A 2JCCA 2JKLA 2GSIA 2BLEA 1JJKA 1DJNA 1JYXA 4EI0A 3BDYL 3T0EB 1HIMH 3BUDA 3CFQA 4KMTL 4GEJA 2KZWA 4XO7A 2ZC1A 3HZVB 5DC4B 3S7GA 5FFOA 4HVXA 3F6JA 1E4WL 3T2OA 1CDIA 2ARWA 3VXRA 1QNPA 4OZHE 2ZOKB 5BRPA 3TEZA 1AO7E 4S39A 5F2LA 1NMBH 1J0KA 5HVHB 1ITQA 4WFEE 2AEWA 4MD0B 4PG2C 2Q86B 1BTCA 3SCOA 2WW5A 3U0WH 3CT2A 4NQVA 3OVGA 1MCWM 3AXLB 3W9EA 2D4FA 1HHKB 3QUXD 4YO0A 1VH7A 2J4WL 3S8FB 5B1AB 5EN2A 4A04A 3MX0A 4MVBD 4BH8B 3EFOB 2X2GA 2BW4A 3K6NA 2ADJB 1IGFL 4RNRB 1PKQE 4REQA 3TE9A 4KVPA 4Z7UF 3TIEA 3HS0C 4XP6L 1E28A 1KYOJ 5IROC 4Z42C 4YMZA 3QRBA 4JGDA 2W95A 3P6LA 1L8PA 4K3GA 1XLGA 1TQCC 1IM9D 5I6OA 3THAA 4EXQA 4M43L 4XPBL 3H9SE 4YLBA 5A7BA 1GS6X 1ES0B 4N8VA 5I73B 1W1PA 5DRIA 4AWTA 2H8XA 3M9YA 1B2YA 2NUXA 3PS7A 4OI9A 1AKJB 4G5ZH 3O2WL 4GUJA 1VBJA 4LBRA 1J1PL 4QGCA 3IMWA 3M7OA 4RWYH 3P69A 2IF7A 4Y5XC 3DVNB 4PJ6A 4JDBA 4GVIA 4HXAL 2BY1A 5AVVB 3SYAA 3RNQA 2WYHA 1QBBA 3JZ7A 3TOYA 1H50A 4A2MA 1BGXH 4I1NB 2PODA 3CT7A 2DZEA 3Q44A 2A3HA 1KPVB 2BMBA 4XMLL 2YBRA 1IE4A 4AYMC 3MXWH 1FNHA 4ZQTA 5LJYH 2D8KA 2NY1B 3IAGC 1ET5A 2QADD 1A14L 2OK0H 5J5RA 1EA0A 2F9BT 4H1LH 1D3CA 1WKEA 3OGOE 4A7SA 3VFNB 3LQZB 3F4VA 2BIIA 1W1B1 5DJAB 3PJUA 2WZEA 3S2CA 1AGDA 1B9ZA 4H4IA 3QQ3B 3BHBA 5I66A 1KV3A 3NACL 1HILB 4CD8A 2NYKA 3WNPA 5M03A 1MLBB 4UTWA 4OCYH 3NCJH 4J3OC 1O4UA 4WV1C 1DJIA 1TJGL 4MLRA 2W9MA 2DSUA 3QPXH 2QZQA 4YX2L 5TE4H 4E9QA 2PP1A 1V7AA 1V08A 2OEMA 2B14A 3JBG7 5GJNA 1VEPA 3FB8A 2FSEA 5E6UB 2J8UE 1IFRA 2WXQA 4FRWA 3VQMA 4M1DH 3UACA 1RVGA 5SWSA 5IQ9A 1Z3RA 3T9PA 4G3YH 4IRJD 5LKNA 2V2HA 4TMCA 3ZJAA 1RULH 1A50A 2DB8A 4OUIA 4AFYA 4MAYB 2QKIA 5C0EA 1D9KA 1GOKA 4XO8A 2BZDA 1DQIA 1JPSL 2XWJB 1B2WL 4I3SL 1L9SA 4MJIA 5JIKA