3OLGA

Structures of human pancreatic alpha-amylase in complex with acarviostatin iii03
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 172
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3olgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3olgA01
2CBUA 2XG9A 1C3FA 1ZBKA 1OIMA 3EDJA 3G6MA 1WCGA 1JYWA 2RGLA 2DT0A 1DWHM 1VBUA 4RE3A 3W4RA 1FFRA 1NOFA 3QGVA 2JEPA 4FNUA 4YPJA 4OKDA 3OLEA 1UR0A 3AISA 2VR5A 2YFOA 1X6NA 2E8ZA 3CGTA 1ZJAA 1JDDA 3RMEA 5I77A 4D1IA 1R46A 4D6DA 4P8VA 3NJ3A 3OZOA 2YBUA 5CSUA 1G0CA 1PZ2A 3PTKA 1R33A 4JHOA 3RCNA 3AIQA 1GOMA 1OBAA 2E0PA 2VRJA 3SCRA 3VDAA 3VD3A 4QDMA 3F4VA 1W1TA 3LXBA 4AEFA 3AHXA 5LYRA 1XSIA 3FW6A 2VX6A 4P7NA 3L4TA 3UR8A 3WQ8A 4CN6A 2W67A 1VEPA 3DYMA 4EANA 1V3HA 4PMDA 2JF7A 2XJ7A 1CENA 3MUAA 2UWFA 3BMVA 1K6AA 7CGTA 8CGTA 1B3WA 3F5LA 2OSWA 2FHCA 3CMJA 1TE1A 3BAWA 3AYRA 3U57A 1HJXA 3D51A 4AXNA 5I0DA 3OLIA 3SEPA 4PTVA 4WIWA 4AZ7A 2ZUTA 1ESWA 2ZIDA 2ZX8A 3SCOA 4LGXA 4CU6A 5E0CA 3LRMA 3MMUA 4W84A 4TTGA 3CZKA 3GZAA 1IV8A 1V3KA 1UR1A 3D4ZA 3VIMA 3VIIA 3W53A 2ZX7A 2XFYA 1J0JA 4AIEA 1QWNA 1KCLA 1E15A 5CPTA 4A3YA 1OD8A 2WSKA 3BCFA 4CD7A 1JYXA 3DECA 4W89A 4PEEA 4UQEA 4BQ2A 1PJ9A 3ZO9A 1MFVA 1VEOA 3VTRA 2DIJA 1R75A 8A3HA 2WPGA 1K9DA 1HJUA 1CEOA 4E8CA 5CPQA 2B31A 4XV0A 1FH8A 3M46A 4M1RA 3W6MA 1J0HA 2J74A 5ABFA 2WAGA 2XSAA 4B3KA 4W8LA 1QW8A 3VD4A 1PPIA 3EJQA 1KTCA 4YHGA 3L4UA 2VCAA 2D23A 3WH7A 5DMYA 4WSJA 2DH3A 2WC7A 1R87A 3DC0A 4H04A 3AIRA 3BLPX 1GOOA 2W91A 4OBSA 4W7UA 2XSBA 5GNZA 5GQBA 2WVTA 2OSXA 1QI0A 1JG9A 1C92A 4CD8A 3HN3A 1SMAA 2J4GA 3CC1A 1XGZA 1DWIM 1E9LA 1NQ6A 3QOKA 1ISYA 1TZ7A 1I75A 4ZE4A 3ARZA 2UY2A 2PWFA 2J78A 2W63A 1R7OA 1W1PA 1QWUA 2V3DA 1EHAA 4EK7A 1B1YA 1CIUA 3GXFA 4HMEA 3A23A 4D6CA 3WQVA 3PTMA 2EJ1A 5A6BA 5M17A 4ACZA 3TA9A 5A6JA 2ZUSA 1QBBA 4W85A 2WANA 3VVGA 1OT2A 4QLJA 3VGBA 1HJSA 3WH9A 3PZIA 3MSGA 3WQ4A 4AISA 2DT2A 2VVSA 3EJTA 4UR9A 2ZUVA 2QLYA 2VX4A 2BS9A 5I78A 3VIKA 1G9HA 1KBBA 1VBRA 4TVCA 1YQ2A 3LPOA 3AZSA 3ZJ6A 1EXPA 1UG6A 3OIHA 3NDYA 3POHA 1I1XA 4UQCA 2OYMA 4GO8A 4CU7A 2WZIA 1IZKA 1PZ3A 2GVYA 1QPKA 3HG2A 1CECA 2G8ZA 2CKSA 2VI0A 3AXIA 1HTYA 1RP9A 3QHOA 2W61A 4P8XA 2VR4A 1ODZA 5CG0A 3DHPA 2WBKA 1JIBA 4QFUA 1UD5A 4PUDA 5E70A 9CGTA 4H7VA 4PMNA 1E72M 2D73A 4UCFA 4Z2JA 3I3EA 5CJ5A 1PBGA 1W9PA 2ZOXA 4L4PA 2J47A 1Q6GA 1EGZA 1EDTA 4LYQA 1E6QM 4QCFA 1GQJA 2XVPA 1DWAM 2D2OA 1PS3A 5E6YA 4W86A 1W2PA 1ZB5A 2WSPA 4DM1A 2FYVA 2VJXA 3VIGA 2BVYA 4C7DA 2GK1B 2F2HA 2VOTA 1H49A 4HMCA 4HTYA 5BXPA 2XFFA 2WVSA 1NOWA 2WHKA 3S6TA 4HMDA 1JZ4A 5M3WA 1OGSA 4RL3A 2XUCA 2AOSA 1BLIA 2VZOA 1JDCA 4GKLA 5A2CA 3CH9A 2O9OA 4JKKA 2VNCA 5A69A 5I3DA 4KH2A 1H0IA 3AMLA 3AJ7A 3THCA 3VM5A 2XVLA 3SIMA 3S5ZA 1UWSA 4OOUA 3RDKA 5E9AA 1J12A 4JCLA 5E6ZA 2DEPA 3SUSA 5BRQA 3ARVA 3AMGA 3N12A 3GH7A 1V02E 4WSKA 1CGWA 1CGUA 1O7DC 2ZUWA 3RJXA 1Q6DA 3AYSA 1TCMA 2EXOA 1B3ZA 3SUVA 1S46A 2V5DA 4D6JA 4MDPA 2BY0A 4FNRA 3CHDA 2WB5A 4CGTA 3WDIA 3CZJA 3B8SA 1UHVA 2CESA 3U5UA 4ATLA 2PWGA 3WNPA 3MO4A 2DSZA 1TQWA 5F7UA 5A1AA 5HBFA 4FNPA 3TTOA 2VRQA 3WQ5A 1BGAA 1QNRA 3WD1A 4PCTA 1Q6CA 3WDHA 3AI0A 2A3AA 1IZJA 4J3WA 3WNLA 2CHOA 3VD7A 1J0YA 3I3DA 1XC6A 4HU8A 1JI1A 2XIBA 3IJ9A 5EFDA 1UKOA 1VENA 5GNYA 3MANA 3G6LA 3GDBA 4NXKA 1UZ1A 1JNEA 5A2BA 1W9BM 1UUQA 2BY3A 1H1NA 4WKAA 3CZNA 3T0BA 4ZE5A 4OIFA 5TD4A 4J7RA 1E6PA 3ZT5A 2XVNA 1DP0A 1NWSA 1SZNA 2CPUA 1GHRA 1QNOA 3S5YA 4DUVA 1N82A 2QV4A 4CD5A 1V6XA 3PZVA 3AIWA 4CU8A 1QX1A 2DH2A 3ARTA 1P6WA 5A3HA 2ALWA 3A4XA 3W82A 1TFVA 1W91A 1MQRA 1V0NA 2JFEX 1US2A 1KFWA 3ARWA 4CCDA 3W81A 2DSVA 2VC9A 3GH5A 2X0HA 1GORA 3NSMA 3RILA 1V3IA 2YDRA 2FE0A 4AY1A 2ZUUA 3AHYA 4AMWA 2F7QA 3W38A 4IPNB 4W8BA 4X9YA 4GQRA 4JCMA 1TVNA 4P7LA 4J3XA 3FN9A 1W3LA 4BS0A 2WMGA 4TUFA 3BAXA 3RM4A 2ESCA 2EPLX 3VUPA 1L0PA 2AMGA 1R85A 1E4IA 4NRRA 4DUWA 5CSYA 2EAEA 4W87A 2BV9A 3DHUA 1VAHA 3BAKA 3SCTA 2VQUA 4JIEA 3L4WA 1BVNP 3TP4A 1JGIA 3NYDA 4AIUA 3BVXA 4U3AA 3PHAA 4AYSA 4S3JA 3SCNA 3BCDA 4XUYA 4CN4A 2PF0A 2VZVA 2YFNA 1OM0A 1ZJBA 2WCAA 2WHMA 2EABA 4J3UA 3ZT6A 2D24A 3LXCA 4JFSA 4UNIA 1EDGA 4PMYA 2CCRA 3LX9A 1W3JA 5E09A 3ZR5A 3DYPA 1KB3A 4U31A 1V6VA 4P8UA 1BVZA 4CCEA 4UZUA 5GPRA 1CGTA 5D9NA 1WZLA 4PN2A 4TVDA 2YIHA 1GQKA 4F8XA 4MPKA 3VNZA 2XN1A 1UKPA 5AYBA 3A3HA 3NSXA 1F4HA 4DO4A 1KXTA 1NP2A 3VDBA 1YHTA 4OBRA 4ATDA 4R5EA 4BQ4A 4M81A 1HIZA 3OLDA 3WF4A 4S3KA 2WMKA 2GDVA 3WUGA 3BH4A 3BUIA 1EDQA 2VUYA 1C93A 5CZKA 3VX0A 4UQBA 2NSXA 3WDRA 1ZS2A 2EBNA 4YN5A 4HA1A 5AC5A 3VD9A 3CZ8A 3N1AA 1E0WA 1K9FA 1SR0A 4ZFMA 1HJQA 4AYGA 1JNDA 3D50A 3BC9A 3VMOA 1GOIA 2J8FA 2VL4A 3VIPA 1B3YA 4HA4A 1NWRA 4U5IA 1OGBA 3WN6A 4PSPA 2ZUMA 1XH1A 4UQDA 3K4AA 4ACYA 3O2LA 1LL4A 2V5CA 5DFAA 4F9DA 4M80A 1GVYA 2CHNA 3WD4A 4JKLA 1QI2A 2JIWA 3BVTA 1JL8A 4N42A 4OJYA 3HG3A 4B3LA 4Z2GA 3CUIA 3N04A 4W7WA 1VRXA 5C71A 2J7GA 3EDEA 3QHNA 3A6OA 4M8UA 2VVNA 3OA5A 1Z32X 4GIAA 1X6LA 1KBKA 1D3CA 6A3HA 4GI6A 2CYGA 4DWSC 2WMJA 2V3FA 2WC4A 3GBEA 3BAYA 4X0VA 4FF5A 4AD0A 1DWJM 1QI3A 4U2ZA 3NIYA 3WEZA 3K8MA 4N0RA 3CHFA 3WF1A 3BLBA 3HG4A 5FL1A 2ZUNA 5DT5A 1LG2A 3MS8A 1XV8A 3ZMRA 2VCCA 2OSYA 1CPUA 1CXLA 3BSHA 3MSDA 2YA1A 3CZSA 2XM1A 2EPOA 1KQZA 2F1BA 2XYLA 1JFXA 2WWCA 3QOMA 2WKGA 4FLOA 3IGUA 2ZXAA 5I5RA 1UH2A 1BYAA 4W88A 2X2YA 5JBFA 4OOZA 3BAIA 1UD6A 1RP8A 1BYBA 2W4XA 4M82A 3T08A 1HXKA 2D0GA 3H53A 1WB0A 3DX4A 6CGTA 1D2KA 4B9ZA 3EJSA 4XZBA 4QLKA 2FGZA 2BFGA 4FLRA 1UR4A 1C8YA 3VINA 1LL7A 3WIJA 3ZSSA 4CVUA 1LG1A 4ZXLA 2Y4SA 3BAJA 5HNNA 4ZENA 4OGZA 2XGIA 4MB1A 2GUYA 1M53A 4LYPA 1EIBA 3EMZA 4DWSA 1QW9A 5D8ZA 1KGUA 5BCAA 5C70A 1JDAA 4MDOA 3AHVA 2V3GA 2WZEA 3DX2A 3WKZA 4KGJA 1VFFA 3VDCA 6TAAA 4AEEA 2WXDM 3SUTA 2VT0A 3WF3A 2Y2WA 1CBGA 1ZBCA 2XWDA 1ZL1A 1CLXA 3CUHA 1LF1A 4QAWA 3VO0A 3UG3A 4UZSA 3SCVA 4AZGA 4PMQA 5ECUA 4PMXA 2CIPA 3IANA 3NCOA 4ML4A 2A3EA 2XTKA 4D6GA 2XIIA 1MWOA 1C8XA 3CZGA 2D22A 1MYRA 1HKIA 4PCSA 4NSBA 5FOOA 3KE0A 3VGDA 3KWXA 1V6WA 3LPGA 1BYCA 1B30A 2OW7A 1J01A 1C7TA 1HL9A 1U30A 2XN0A 2X2HA 2WNWA 2PB1A 1C8QA 4BCEA 2Q8XA 4WKFA 4X0NA 3EYPA 2GSJA 3WENA 3GH4A 3IJ8A 3WFLA 3WNMA 1CGYA 5I24A 1HF6A 1AQMA 1X1NA 3AIUA 3HU7A 3APGA 2WYSA 2E4TA 3GM8A 3VGHA 3T2QA 2IUZA 5ABHA 1BSIA 4JL1A 5D9MA 3WUEA 3D4YA 4EE9A 3HZ3A 3RM9A 2V3EA 4WF7A 3PZQA 4JZ5A 4RE4A 5A6BD 4W7VA 2Y24A 3W27A 4AD1A 1BTCA 3OG2A 4LQ1A 1E0VA 4HOXA 1EOKA 2E3ZA 1J0KA 3K8KA 1QNSA 1QHZA 3FAXA 3SUWA 1GQIA 4CUCA 5JBEA 4J3VA 5JIWA 5LA1A 3AROA 1A3HA 1OWQA 4BF7A 3CPUA 2F18A 3VGFA 5I6SA 2GJRA 1JZ8A 1XCWA 3T0AA 1KGXA 2XVKA 3UCQA 1EQPA 1RD6A 2C7FA 1UR9A 3M07A 1R8LA 4DUXA 3WEOA 1GJWA 1UA7A 3DDFA 2CERA 4F66A 3J7HA 2GFTA 3K46A 2E9BA 1XHGA 3MUIA 1GONA 1VF8A 2VX7A 4P7RA 3IAQA 3KLKA 1ITCA 3PZUA 3WMSA 5BWFA 3AHZA 2PBOA 3RO8A 1E4NA 1W9XA 5CLWA 1GOQA 3MV11 4A3HA 3DDGA 3UESA 4AZHA 1WP6A 5A6MA 3WY1A 2EQDA 2ZXDA 1GW1A 1CZ1A 3A21A 1E6NA 3M7SA 2DT3A 1OSEA 4M29A 4UFIA 4Z2LA 1OT1A 1HVQA 1NP0A 3VD5A 1EQCA 2ZWZA 3VX1A 4E2OA 1UWUA 1E6RA 4WLCA 3F5KA 1ZBVA 1F4AA 1AVAA 4CKQA 5D4YA 3OBAA 4AZBA 1T0OA 2QMJA 1GVIA 1QNPA 1G1YA 1B9ZA 4B15A 3SCSA 1PAMA 3WY3A 1E56A 1XYFA 3EDDA 3BSGA 4PUEA 4XX6A 1JYNA 1QI4A 4QCEA 1MW2A 3D52A 5EB8A 3CZLA 1TA3B 3KZSA 1KTBA 1KQYA 4MNKA 3ZJKA 4EKJA 2BVTA 3KL3A 3GXDA 1PX8A 1KWGA 1OIFA 4FMVA 3SCWA 3T2OA 4TVUA 4AZCB 4MAZA 4E8DA 1H5VA 1AQ0A 1NWUA 4PYSA 1UWQA 4P7QA 2RGMA 3WF2A 3WUFA 3VGEA 1O6IA 1G5AA 3L4XA 5DO8A 1KR0A 2W66A 1FP8A 2CBIA 4H8UA 4TOQA 5DT7A 1E3ZA 1L8NA 2O9TA 4AW7A 4J27A 1FHDA 1Y7VA 3ARUA 1XD1A 1W2VA 1TQUA 3THDA 3FHQA 1OGGA 2GJXB 2NW0A 3VIFA 3VDHA 4GI8A 1R34A 2ZX5A 3LXAA 1R86A 2DGAA 1M03A 3VGGA 4GZJA 3HJEA 3KL0A 2FGLA 3POCA 3GXIA 1C91A 1BGGA 3N17A 5IFPA 1GUVA 2VTFA 1NM9A 1UASA 1VB9A 4BA0A 2WVVA 1FA2A 1LWJA 2FH6A 3DX0A 2DDXA 3EJUA 5ABEA 1VFMA 5A6AA 2ZXBA 2G3NA 2AAAA 3BXWA 1JFHA 1JF5A 1HKKA 2G4FA 2JEQA 4JFUA 1D7FA 3ZM8A 2E9MA 1ISXA 3U7BA 1J11A 3AXXA 3WQWA 1BG9A 3WDPP 2YL9A 4WKHA 4M56A 3T2PA 1WNOA 3VKKA 1QHPA 1QI5A 3CHEA 4KWUA 2HISA 4DM2A 1U33A 1VFOA 3ALFA 1PX4A 4DWSB 1HN1A 2BHUA 2C0HA 3FNDA 3JUGA 3N13A 1SFSA 2PC8A 4W93A 3CMGA 3MKKA 4EAMA 1FHLA 1VJZA 1UA3A 2WMIB 4PBGA 4KRTA 2X0YA 1LQ0A 1WZAA 3CUFA 3MUZ1 4GXPA 2JALA 4H8HA 1JF6A 1IT0A 2C8NA 4HZ7A 1HT6A 4IUGA 1CNVA 3VM7A 2VO5A 3CUJA 2F7RA 1BPLB 2FDMA 3W6LA 4DO5A 2EPMX 1CTNA 3BGAA 3LRKA 1VEMA 2DT1A 1NARA 4E4PA 5IFTA 4JFWA 4W5ZA 1FFQA 3PZTA 2MANA 5D8WA 2WKLA 1NWTA 3ZSTA 2G3JA 2WMFA 3E1F1 2WZHA 4JL2A 2DSKA 3BUQA 3AOFA 3AZTA 2A3HA 1MFUA 3TOPA 3A24A 4LXFA 4AZ6A 4UOQA 1J0ZA 2OW6A 3L2LA 4AD2A 3W29A 3WNOA 3MMWA 1PIGA 4MB5A 1GJUA 4MJ4A 3WL0A 4MNLA 2CITA 1CXIA 3CIVA 4GINA 3ZT7A 3A47A 2JE8A 4QLLA 3WQ6A 1HKJA 1PEZA 2WCSA 1JD7A 2CEQA 1HXJA 5DEZA 2XM2A 2YDSA 1US3A 1HJWA 2EO7A 3WH8A 3OGRA 1UQZA 3W28A 1BG4A 1GOWA 2BHZA 1XH0A 3BUBA 2FHBA 3FXYA 2YLLA 1W9DM 4GO9A 4PMRA 4UFJA 1TQTA 1J9YA 2EADA 3W24A 4JKMA 3OB8A 4D72A 2BY2A 4D6HA 1CDGA 1J18A 1KR1A 5CQ1A 3DX1A 5JIPA 1TR1A 1J0IA 2VQTA 4BQ5A 2HVMA 4OUEA 2WMHA 4D6FA 2WM0A 4D6IA 4C7GA 1UQYA 4KGLA 3ZOAA 5A6LA 3AMKA 4H2CA 1HP4A 5JUVA 2Z1SA 3ZIZA 2BHYA 3GNOA 4V2XA 3VOCA 1TMQA 3ARPA 3CZEA 4HOWA 1GCYA 1UWIA 3PZOA 1HKMA 2J7HA 3B9EA 1DHKA 1B2YA 3VMNA 1V0MA 1HNYA 4AZ5A 4LPCA 4IPLA 3N11A 3AS3A 3LPFA 3ARQA 1W1VA 2X8RA 2UY4A 1NH6A 2XGBA 1R47A 3FAWA 3HMCA 1E0XA 3WH6A 3RJYA 1UD8A 2VZSA 1JZ3A 4F79A 1CLVA 3WUBA 3T0DA 4L4OA 5HPOA 5HDRA 3ZR6A 4R27A 2VMFA 3L4ZA 5AYIA 4MAVA 3GYCA 4UQAA 5KEZA 2YA0A 5A2AA 3TTYA 3O6AA 5FKYA 7A3HA 5LA0A 2A3BA 1J10A 3AMDA 1H41A 4IISA 1EO7A 4CVWA 3WD0A 2VRKA 1E73M 2XN2A 1V3JA 2J8GA 5M03A 1H0GA 2O9RA 1U2YA 1MVYA 3ALGA 1UOKA 4ZXOA 1V0KA 2OWWA 3DYOA 3SUUA 5I2UA 3BVVA 4GQQA 2PI6A 4HA3A 4MJ2A 4WK9A 1HWWA 1WZMA 4P8WA 1B3XA 1JAKA 4BQ3A 4MTVA 5IHRA 4AZCA 3AS1A 2FHFA 1ISWA 4CCCA 1SMDA 3SCQA 1M04A 4HPGA 3WDJA 1E70M 3WY2A 1V6UA 2WHJA 1OINA 1ITXA 2E8YA 1UD2A 2ZXQA 5KZ6A 3AICA 1WDQA 3A4WA 4FNTA 1JXKA 3FHAA 2NT1A 3VSUA 2WBGA 1C90A 4GPNA 5DF0A 5BXRA 2BY1A 3K1DA 2GJXA 3A4AA 3N15A 1DWGM 4M24A 4A4AA 3AS0A 3IAPA 5BROA 4Z2IA 5CPSA 1E6SM 1GOKA 1GZJA 1UR8A 2BVDA 2WVUA 2DIEA 3H55A 1C7SA 3PN8A 2WVVB 3TTQA 4HZ8A 3L4VA 2G41A 3VSVA 1GHSA 4ZEPA 1MQPA 3PTQA 5IDIA 1TG7A 3NSNA 4DO6A 2XFRA 1K9EA 3MMDA 3ARXA 5LA2A 2F1AA 4H8VA 4ATWA 3IJ7A 3PZGA 3ARYA 3O9NA 1JAEA 1JI2A 4ACZB 4PMUA 3UR7A 3AS2A 1XSJA 1WDSA 5BXTA 2OWXA 1WAWA 3LPPA 1WKYA 4CD4A 4BZYA 1RPKA 1OCQA 1HVXA 2QF8A 4OZOA 2EPNA 2J7FA 4FLSA 4UOZA 5IHSA 4K68A 1Q6EA 3UEQA 1KXQA 3PZMA 4V27A 1BF2A 3NUKA 4NZJA 3W25A 2YJQA 3WD2A 2JF6A 1BYDA 4F9JA 3GXPA 1FH7A 1ODUA 1UR2A 3BUDA 4TX8A 3AIVA 3VMPA 3GXTA 5A8PA 3S2CA 1HL8A 2J7DA 2VZUA 1M7XA 3WF0A 3AHTA 4NZFA 3MUY1 4UQ9A 1DWFM 4GZEA 3U5YA 3WMCA 1WDPA 5CXPA 2PWDA 3N9KA 1EO5A 1VIWA 2UY5A 3WEMA 1VJSA 1DEDA 1E43A 1TQVA 4AMCA 3WY4A 1WE5A 3T09A 5E1QA 3VILA 4AMXA 1TA3A 1UH3A 5A95A 3WDQA 2WLYA 2XVGA 2EACA 3ECQA 4AC1X 4QP0A 1KCKA 2ZE0A 1JZ7A 1W9UA 2TAAA 1LL6A 3RPMA 1XCXA 1W1YA 4J28A 1G94A 4D1JA 2O92A 2G3IA 4LX4A 3GXNA 3I3BA 1FP9A 2E9LA 4Q22A 4UFMA 2BXZA 1BHGA 3WH5A 2XHYA 4DWSD 4JFVA 1JZ5A 1V02A 1OD0A 5IXEA 4MB4A 3CUGA 3WL1A 4FLQA 3M6DA 1DTUA 1UKSA 3SURA 5A8NA 1UWRA 1CXFA 2ZX9A 3HG5A 1V03A 1HP5A 1KGWA 1EOMA 1LJYA 2CNCA 5A6KA 1E1FA 3KLLA 3TV8A 4GZIA 1MQQA 4C7FA 2X2IA 3N18A 3AXHA 1UZ4A 3CTTA 2WK2A 5CGTA 3ARSA 2QHAA 3AIBA 1EH9A 2YDQA 2YOCA 2E40A 3ZQ9A 1QVBA 1XRVA 1TVPA 2DQXA 3AMCA 2XWEA 5FCZA 3H54A 3WFZA 4FNQA 3CBWA 5AY7A 1W32A 1E4LA 2BXYA 1UKTA 3QHMA 2EEXA 3B9DA 4HU0A 3WBAA 2Z1KA 5E0FA 3EMQA 1JZ2A 2D1ZA 2OLHA 3OGVA 4PRWA 4TX6A 1UD3A 1O7AA 3D3AA 3UG4A 1E6ZA 1CGXA 3EBVA 2PWEA 5HXMA 1B31A 3AIEA 1Q6FA 2D3LA 2X09A 2Y5EA 2J77A 1MW1A 2DSUA 3VNYA 2OYKA 4AIOA 2J62A 1BFNA 3AFBA 1MXGA 4HP5A 1QNQA 5M5DA 2WMIA 3UETA 2ZWYA 2D0FA 3SCUA 1JD9A 4U5KA 1XSKA 5EFFA 5FIPA 1WZKA 4J3TA 2PBGA 1XH2A 4NXSA 3LRLA 1WDRA 4PMZA 1ECEA 2Y8KA 4KMQA 4D71A 2V38A 2YA2A 1JYVA 3UG5A 1H3GA 4PMVA 3WNNA 1CXKA 4W5UA 3VU2A 2VCBA 1BQCA 1B90A 4XB3A 2YL8A 1UWTA 2IGTA 1K9TA 1UH4A 4TXEA 2FH8A 1MXDA 5EMYA 1H11A 3ZJ8A 1JZ6A 1CGVA 3TTSA 4B16A 2YLAA 5A8OA 4KRUA 4MNMA 1H09A 3RM8A 1E5JA 5CGMA 1AQHA 5GNXA 2X05A 4UFLA 1UD4A 2CETA 2DPEA 1QBAA 2IXVA 3GNPA 2EPKX 2UY3A 1Q4NX 3VPLA 4PTWA 4Q7NA 1JXJA 4NRSA 1V3LA 1KXHA 2D20A 4PTMA 1FH9A 5ABFB 2F7OA 4UOJA 2W62A 3CO4A 3VIOA 4D6EA 3GTNA 2J75A 4GI9A 1FOBA 4AZIA 2J79A 1TQSA 2WCGA 1CWYA 2WWDA 1WPCA 2CKRA 3BVWA 1ISZA 3GXMA 3KL5A 2ZICA 4U2YA 5I23A 3B9AA 3VSTA 4U33A 1W3KA 2CBVA 3VIJA 2O9PA 2G3MA 4LYRA 4V28A 1AMYA 2J7BA 2F8QA 7TAAA 4HPHA 3EDFA 4CN1A 2W92A 2CBJA 3RIKA 2ZX6A 1E4MM 1PIFA 3CHCA 1OB0A 2QMKA 3W37A 5ABGA 4AD4A 3ARRA 4JAWA 1XD0A 2WW5A 3W0KA 3MV01 1RH9A 1H2JA 4J3SA 4NZCA 4IM4A 1G01A 3AZRA 2W5FA 4Y7EA 4MNJA 3CV5A 3ZJ7A 1I1WA 3OGSA 1ZU8A 3A5VA 1CYGA 3WMBA 4H41A 4UTFA 4PMOA 4MB3A 3GNRA 1E71M 3WBEA 1QHOA 1B0IA 2YKKA 2GJPA 1MW3A 2OYLA 1E5NA 5A8MA 3BUPA 1V0LA 1PX3A 4HZ6A 3UERA 1H4PA 4B9YA 3W26A 2VZTA 3OLGA 2CXGA 2D3NA 1KXVA 3KEHA 5BXSA 4NX0A 2JIEA 2VX5A 1GNXA 3BMWA 3BLKA 2VURA 4NI3A 4NF7A 1BAGA 4HOZA 1W9VA 4PTXA 1R7AA 5HOSA 2WLZA 1KWKA 3WD3A 4AD3A 1E40A 2X1IA 1EHNA 4P7OA 5AC4A 3U7VA 3IK2A 1CXHA 2YBTA 3L4YA 3A22A 1E6XM 1TUXA 3EMCA 4UFHA 3LMYA 3K8LA 3VIHA 5FL0A 1E55A 3MU7A 1MW0A 3NDZA 1E1EA 1ZBWA 3D5HA 5D9PA 4TTUA 3II1A 4FK9A 4JFTA 3PZNA 3MI6A 2F61A 2YL5A 1VFUA 1V08A 1V6YA 5A94A 2IXUA 1EA9C 1ISVA 1HX0A 4Z2KA 2QPUA 1XYZA 2PWHA 5FD0A 5BRPA 4JHZA 2X2JA 4URIA 1LWHA 1B3VA 1UKQA 2J7CA 2D0HA 2F7PA 2J25A 5A6SA 3WSUA 2QPSA 5C8BB 2BNJA 2WC3A 3WELA 4U3CA 2DSWA 3EJPA 5BYWA 4Z2HA 3BVUA 3CLWA 4FNSA 3DX3A 5D9OA 1HJVA 4CD6A 2GK1A 4AWEA 2NT0A 3EJRA 1UYQA 1WO2A 3OZPA 2YL6A 5A8QA 3F5JA 3FY1A 1A47A 3SCPA 4UFKA 4W8AA 3PBGA 4YHEA 4AD5A 5HPCA 1M01A 1LLOA 2OWCA 2J7EA 5I79A 3GBDA 1W3HA 3TONA 4WJXA 3L2MA 1QOXA 5CLTA 3WNKA 2XPKA 2A3CA 3QR3A 1GPFA 4RE2A 3K4DA 3EDKA 4PSRA 4MADA 2GDUA 5JBDA 1GQLA 1SYTA 2Y8VA 1NOUA 1CXEA 1E3XA 5EBAA 3PZ9A 1V3MA 2WHLA 4XZWA 3AQUA
chains in the Genus database with same CATH superfamily
2CBUA 4KHTH 3N6JA 4N0UE 4BR1A 5A3IC 3K6SA 3VB9A 3UWQA 1L9SA 1ZBKA 3JYCA 1OGTB 5FYKE 5FF0A 3NPSC 4MS8D 1SY6A 2ZXWB 4K3JH 4L5FH 2DT0A 1FFRA 1NOFA 2GJ6E 4FIQA 4V1XA 3SCMA 3WTWA 3APNA 4FNUA 3DO7B 5E8NA 2BSTA 4G8FB 4Q7DA 4HOMA 2JB6B 4RIRB 1F73A 2ADGB 3RUGB 2VR5A 3AISA 3OO2A 3IKCB 1YDPA 2ZAHA 2E8ZA 4FI7A 2WXQA 5H2BB 1BTMA 1L6WA 2WBJA 4F15B 2J1XA 5AENA 1OF2B 1JDDA 1GYMA 2X38A 2HQAA 4D1IA 4E3TA 3JZUA 1TRIA 1TPUA 4HBCH 3NJ3A 2JKJA 1OGPA 5I3FA 1QFPA 2XXGA 2V9TA 4D3CL 1AUSL 4JHOA 2DQDH 1M1XA 5EPDA 1GOMA 3L9CA 3SCRA 2FPTA 5IEHB 1C5DB 5TDOA 4WI3A 1KF9B 4K3JL 4L5FL 2JQMA 1W1TA 1IGSA 2YCLA 3UWEA 3MREA 5I5JA 1DANU 1PCSA 3AHXA 3SRFA 3QCTH 3BURA 3FW6A 1EXUA 2F84A 2VX6A 4JJ5A 1A6ZB 2PTVA 2FT7A 1R9XA 1BZDA 3TH3T 3ZN6A 1EC7A 2F7IA 3HG1D 2QL1A 4M3KB 5DCDA 1P4IL 1YNTB 4RBPK 5CWSB 4YLCA 1F6KA 4M7TA 5D2XA 2VXTL 2WWKO 2VDRH 1AH3A 2XJ7A 5DURB 1K6AA 4FYSA 3O4OC 5GRUL 4A8NA 3OR7B 7CGTA 2QV2A 1TR9A 3FJ4A 1B3WA 3F5LA 3LBCA 1U36A 3B5GA 3GYRA 4N8CL 3ANUA 4IIHA 3O7UA 2V0AA 3IVSA 1D7KA 4OKVB 1ANUA 5L9DH 2VQ4A 4MNGB 1VBGA 3U57A 1HJXA 5BZWA 2JK5B 4FCAA 3D2TA 2BOCA 1USQA 4GSQA 4EUPH 2DIAA 3EPMA 2G5BA 3UZQA 5A3ID 3SCMC 3EO9H 1B9BA 3TO4C 3W84A 2ZUTA 1I7UB 4MJIA 4AZ7A 2W9EL 3ITCA 5I00A 4CU6A 1U3NA 1XR9B 3DFYA 4RWYL 1CO1A 2BBFA 3G9AB 3RWHB 4UXDA 4W84A 3GKAA 2Z1BA 3CZKA 3MLUH 4QNPE 3GZAA 2CKBH 3W1QA 1DL3A 2YMXL 5CCHE 3D4ZA 4GRLB 1EMTL 5D1QC 2YC1B 1SO4A 2RQ8A 1UR1A 3BG3A 3HJZA 1Y6KR 3BQ5A 3LCIA 4JO5A 3W53A 4HKZA 4OUIA 2NQ9A 2ZX7A 4JFOB 2K8QA 1PZAA 1NJJA 3ZZQA 3G5VB 3SBWA 1QWNA 2CZNA 4PRIE 5E8OA 1ZLVK 4A3YA 1UEYA 2UY6A 2IPUK 4RAVB 4HLEA 3GSOA 2EVFA 1OD8A 2BK8A 1Z89A 3BVNA 3DECA 1HUVA 2OAAA 3N91A 4LVOC 1PJ9A 3H3PL 3QDGA 5I1GH 3OZLA 5KN5B 1R30A 3H23A 1VEOA 4JHMA 1R75A 2H2PC 3D46A 3NZ8B 5AW6B 1FFOA 2GUOA 2HSAA 3BXNA 4JTAA 2F53E 3E49A 3KBFA 4M0XA 4Y90A 4E8CA 4F2TA 4PUUA 1D3GA 4PLKC 1HE7A 2J88H 3QYCA 4NQDA 4Z5RA 3HR6A 5CH9A 5I75B 4P2RE 2J74A 5ABFA 3UAJA 5MHSD 4XPBL 2VN5A 4LLWB 1OE3A 2C9QA 2XV0A 3EYQD 2AQNA 2ZG1A 2P24B 4NSKB 4RMSA 5CM1A 3W2MA 2GBUA 2OK0H 6PCYA 1ZDSA 2FBJL 4UAOC 4S3CA 3EJQA 2MQGA 2OZTA 4W9LC 5L4IA 2V5YA 2P26A 5TNVA 2FECL 3MNWA 5MENB 1YBQA 1DBML 3K7UA 3BYYA 5EA0H 5L6YL 1G4EA 2FJHB 4AYEC 2YCKX 3SN6N 1TV8A 3GHRA 1UCBL 1AYRA 1RHHB 4YSSA 4ZMNA 3WQPA 3VE9A 2WC7A 3DC0A 5D96B 4FR1A 1WK0A 5H4ZA 5JOEA 1GOOA 2LAGB 3HMWH 2DAVA 1N6QL 2DLIA 2WP3T 2A79A 2HT2D 2WXKA 3GMPA 2ADFL 2KPNA 3OX8A 4DEPB 4PJDA 3ZKMC 2YK1H 3ARFB 4J2XA 4EP8C 4BY3A 1RA5A 2XSBA 5EMJA 3X11A 1OABA 4LSRL 3QR0A 3MSPA 4OJAA 1I8LA 5F70A 1BMZA 3PHQB 4AZUA 5GQBA 3NURA 1FWXA 2ENJA 4XC3L 1JG9A 4OLXH 5E8PA 5JO5A 5A2KH 1OTUC 1IF2A 4XAWH 3S1WA 1AGFB 1SMAA 1OK4A 3QJQB 3V4VB 4QO1A 2F8VA 5AB9A 3TBWA 1FPTH 5KVDL 2V8ZA 3GU1A 5FM5O 1AP2B 5CINL 1MCRA 4EACA 1N6VA 2GY7B 1J4EA 3FQRB 1P7TA 2ADIA 5GZOD 5AOKA 3PWVB 1FRGH 5HHOD 5C07E 3T6WA 1E9LA 3CHVA 3MTXA 1NQ6A 4N6FA 1HILB 3A5FA 2WXHA 1ISYA 2R94A 4JG1L 5KAQG 4GQ9L 4G6MH 3ONBA 1RZJL 3MJ9L 3TESA 5LBVA 1UWFA 3UDWA 2YRLA 3MXWL 2JKWA 3Q45A 2PWFA 1YDPB 1RZ8A 1EEQA 3SR7A 4UYPA 2VDPB 1DXEA 4FJYA 1TV5A 3L13A 3ISIX 1RUKH 5EY5A 1GK8A 3CC5B 5AYQA 2QVNA 4ZTOL 4Z7AA 4HNCA 1OKEA 1EGJL 5E0KA 2BC4A 1EFXD 4KKLD 1QPOA 1UGNA 3V52L 1OFEA 3GXFA 1KN2L 3FQ1A 4N0UA 5E2WH 5K39A 3VRJB 2HBVA 2QCDB 5A6BA 4LL1A 2R29L 1VACB 3QEQD 1I2PA 1ZZMA 3EX3A 4ACZA 4ICXA 1NUNB 3VVGA 2WLMA 4PBVC 1XZWA 4NLAA 4LHUA 3KVQA 4UTAH 3OG6B 3ELQA 3C5SA 4BH8B 1XX1A 2CPCA 3QPYA 1KFAH 4K7PL 2PS2A 2OR7A 4DYJA 1GC1H 4Q6XA 3U8GA 4K7VA 4A2MA 1W5QA 4IMLB 1ZUAX 1XXDC 4HTBA 2Y6SD 1UJPA 4OVVA 3RU8H 3C2OA 4NQVA 4H7ZA 3BPOB 1ZCOA 4AISA 1JHLL 1EJ6A 2PA6A 2FEDC 4GXFA 4LH8A 4AE1A 1S7SB 2C9SA 2YQGA 4GFIA 2VVSA 1K3ZA 1WC7A 3EJTA 4G1EA 4P3CH 3TIEB 4XZ9A 3U2OA 2ZUVA 4IF2A 3QARA 3P82A 5I09A 5G5DB 2NUWA 3THMH 3S3SA 1K8CA 2G75A 1M7IB 5D7IF 2VR8A 3GINA 4DLMA 4MXQD 4E2VA 4G9DA 4P2OC 2NXIA 1EXPA 3ZJ6A 1KFAL 4PJAB 5C0ND 4DHLA 3QWNA 4PJBE 2N0KA 1D5IH 3LEXB 3SIZA 2EIDA 5IK3B 4K2SA 1PTZA 5GGSA 2PDKA 1T7YA 3DTXB 1E2WA 1BXNA 3DX6B 1V7MH 2FT8A 2Q86A 8FABB 1PZ3A 2XG4A 4N0FA 4QHLB 4MQ7A 2NX5B 2IG2H 3OHIA 3VJ6B 3Q05A 2EDYA 4Z0JA 2FLRT 2CKSA 2VI0A 4PJ5D 5G2WA 4TSBH 1IBHA 1HTYA 4XO4A 4CSZA 4BWTA 3N1GC 2OKTA 3R11A 3UBXB 1NIUA 4K5LA 1YTEA 2VXQA 3IPBA 1A5FH 4U1SA 3KVMA 2VR4A 3KPNB 3QIWC 3VFUA 2FKPA 1IGJB 1HQRB 1I3GL 3PIQA 2DWDB 1NCUA 3KYOB 4KJQD 4N0YL 4F7EB 2UY6B 2RH9A 3LV3B 3KLAB 5I1IL 5F93C 3WJJC 5E70A 5KN5A 4H7VA 4XWGL 5BOZG 5KYNA 1X5GA 5BVPL 1XQKA 4YHOH 3GI8L 4Z2JA 3FT4B 1FFPB 1FGNH 2D9CA 3I3EA 3ROOA 3IMRA 3SBRA 1W9PA 3WJWA 3MW7A 2ZOXA 4MA7L 3T40A 2XTLA 1KZQA 4JUTA 1TNMA 3QJTB 35C8H 3LDBC 4PH6A 4X4ME 1DJZA 2PO6D 2XGZA 1E6QM 3B8WA 5F1UA 1GQNA 4QCFA 1G0YR 3SYOA 4JREB 3DLQR 1DWAM 2D2OA 1GQJA 3ZL2A 2NPLX 3MLZL 3TNOA 1UXWB 2Z6FA 4N0YH 2DBLH 1CI3M 3R89A 1ZJIA 5I1JH 3RTQA 1JPGB 2VJXA 3NIGE 5DHVB 2NY4D 1AJ2A 2NZIA 1FGVH 3OC8A 4Q6IB 4G6AC 5IVZB 3PJUA 1XF4A 2BVYA 3MBEA 1HH6B 1EJSC 4XKYB 3D85B 2E47A 4AK2A 5C8JA 2JIXB 4DP7X 3QSRA 2VDMH 1KYFA 4HTYA 4FNLL 4UNVA 1L6GA 5AZEL 5BXPA 4NZ1A 1LEGB 1SO6A 4LLDB 2XFFA 4MHBA 1YN7B 2HT4C 1A3QA 5K9XA 1G7HA 3L0KA 1G6VK 2IPKB 5TQLA 4CAGA 4LL9A 1XKJA 2HMIC 3TO2B 3MYJB 3EWBX 3QXAB 5IFJB 5TK2A 3RU6A 3G1VA 1XAUA 2Z31B 1RZFL 4Z7QB 4RL3A 4UTTC 2VZOA 1BLIA 2V5BA 3KXQA 4FA3A 3KJ6H 1JVKA 4GKLA 2PPFA 3H7RA 2GYIA 4IQEA 3TNBA 5JZ7D 2O9OA 4MLIA 3TA3A 4C65A 1UXSA 2DMKA 3NCJL 1UM5L 5A69A 2A74C 1RZMA 3MODL 4LT7A 5CJOH 5KSAC 1VCVA 3HIJA 3NL2A 3UNTA 3FTSA 5F7HA 1UA6H 2NUTB 5K7JA 3TWYA 3GUWA 3ARBB 4Z7OE 2YB4A 1JOIA 2QPFA 4R5XA 4FQJH 4OOUA 4ILDA 3T04D 3RDKA 2J1YA 4IP7A 5E9AA 5CSRA 1XCQB 1J12A 1ECYA 1DN0A 1VSCA 5F7YC 2C7UA 3L45A 1QMLA 5GZNC 4W9JC 2DEPA 5I0VA 1RHCA 3FU6A 3D25A 3ARVA 4GP8B 5DUJA 1OIOA 3AMGA 1WAAE 1Z41A 2NVDA 1O9VA 5C9ZA 3ZKXC 4Y4HC 3CJJA 3ABLB 1F8TL 1CGWA 2PYEE 1TWSA 4LB3A 3RJXA 3JTBA 4MNQD 5FFLA 4NP9A 2GGJA 2YGPA 3MWAA 5EU5B 3BEWA 4XVUD 4XXDB 1TJ1A 4Q8NA 3VNLA 4IRJD 2X1PA 3SUVA 5A43C 2QR0A 2YOAA 3NCMA 5KJRH 2V5DA 4L3CA 1QUNB 4OF8A 2FTPA 1D2OA 4NJIA 4ZSOE 1QLFA 5I75C 1LILA 2AKRB 4JDZB 3R7MA 3SOTA 4HWUA 5TE7H 4KKZA 4X8JA 1JZFA 3OJDB 3CZJA 4Q7BA 4YTQA 4S1DD 5GGVH 5HP5A 3W75A 5FCUH 1A7RH 1QA9B 1YLBB 4R9XA 3U2SB 4YDNA 4Q14A 4UC5A 1KNOB 4W9KC 3LS9A 3U5UA 2AEWA 1T40A 4OUOA 3AYTA 2NY0D 3VXRD 4HK7A 2UX7A 2XXFA 3U0TB 3I85A 2DSZA 5A1AA 5LDSA 3L0NA 4HXBH 3QR1A 4WGWB 1I4FA 5LCVH 4AEHH 4I0KA 2V9UA 2CH8A 2XZZA 3KTCA 3NQFA 3AWNA 3CX5K 2VR7A 4IOFC 1LLZA 3MLVH 3NJGA 1E27A 3CFCL 3VKDA 3UPCA 1YJDH 5HYJD 4D0DB 2WQUA 2XJKA 1NGZB 1WF5A 1BFTA 3QDJD 3V4LA 2YMTA 5HHPB 1IEWA 2ZYIA 3CQ0A 4Z7VA 2XIBA 4MJ6A 1D9EA 1UKOA 5EU4B 3VFWB 1GHFH 3FU8A 4A55A 2ANUA 4ICWA 4NXKA 3ANVA 1IAIH 1IJNA 3ZXAC 2DVUA 1DQIA 1I8UA 2BP3A 1MREH 1XTLA 4BI7A 2X4NB 1Z6KA 5A2BA 2E6YA 3CIXA 5C08E 1YEGL 3CYJA 4L1XA 5AVSB 1MY7A 2BRRL 3GDCA 2Q86B 8FABA 4W4OA 5LGKA 3VJ6A 3CE1A 1Y5VA 1UUQA 3ARED 3ABRA 2UXFA 4R5TA 3AB0C 4O5LH 1CICB 2XETA 5B22A 5EUOB 5ABDE 1GYWA 5IV2A 1BYPA 4NN5B 2YPVA 4OIFA 3LM3A 4ZE5A 1AZBA 4J7RA 4M7LL 4Z7UB 5I1DB 4FR6A 1IM3B 2B2XL 5ISZE 3VOJA 1KBGH 1SZNA 3DUUA 2CPUA 5C9XA 4Z78B 5BQ7B 3X1FA 1QNOA 3FS2A 2W88A 1E90A 4HUXA 2L7JA 1NMCB 4E9XA 2HVNA 2QV4A 2DZVA 4XVDA 1S7UB 4KQ3L 4JEQA 2WQ8A 1Q2SA 5BVJA 1XCTB 3BOVA 4ZOCA 1H7RA 3QM3A 4NUJA 1J8HA 2CSPA 2X0WA 3MA8A 5BMWA 2HH0H 1TJXA 2E4FA 4R2GC 4U4IA 3VWKC 4APQD 4MLRA 4PJ9B 4BA8A 1H1ZA 3MNVB 1SN5A 1DQQA 1RQ5A 4MXQC 5AW1B 2R91A 1ES0B 2YLKA 3TBCA 2JFEX 2ZRUA 4WFHE 1DQMH 4YL9A 1GYLA 3WGVB 4NX5A 3WJYA 4PGCB 3D09A 3PY9A 4JN2A 4NQDB 2RD0A 3MLTA 4X6CF 3NSMA 1JPGA 3K1KC 4ODVH 1Q1JL 4WWKD 2YDRA 1G69A 4AY1A 4NQCA 4AMWA 2F7QA 3QO1A 5ESVA 3ZLQC 5EH1A 1A5AA 2NY5H 3PVFA 4PN6A 4IPNB 4W8BA 5EU3B 4MHHI 3WD5H 3ECWA 4LLDA 3OV6A 3PFRA 4QISA 3D2UB 1WFMA 1QFUH 1UVQB 4GQRA 3CVIH 2OQJA 4AM0B 3M5ZA 1BD2D 1SOSA 2MHAB 1YUKB 5DMGD 1O4UA 4HBCL 4IBWA 1TU2B 2B14A 3MP3A 3INUL 2C9RA 2WMGA 3TFCA 4NI6A 3BAXA 3RM4A 3VA6A 5HHNB 1U8JB 2HVJA 1R5WB 3M7FB 5FF6A 2DQJH 1B0RB 2MFNA 2YUXA 2EPLX 3NM1A 4MWAC 5GSVB 5CEYB 3D39A 3PGDB 5E2VL 2WZPD 2DEYX 4A68A 4Y5YB 1R85A 1S2TA 2HVOA 2ESVD 2EAEA 3STZB 3HCVA 3Q43A 4HIHB 3FQWA 5ICZB 3PHQA 1VAHA 4H25B 3LLDA 2J6EL 3BAKA 5BOPA 1P0KA 4FQ2H 4B3ZA 1QR4A 3L4WA 1FE8H 1BVNP 2L04A 3B7RL 3NRQA 1JGIA 1NMCC 2C7UB 4QJ3B 2L3BA 3RY4A 1L9WA 2EG7A 4QXIA 3RZCC 2A2IA 1NCAL 5LG6A 5K4ZA 3PHAA 2DWTA 3EG9A 4BRJA 2DQHL 3QDMB 4NYLB 2Z2UA 3M47A 4XAYA 1AQDA 1NGXA 5IBUG 4XUYA 3DHFA 3PWNB 2YPVL 3O11A 4LIQH 4Q4QA 2PP0A 4CN4A 4NM4L 4XXDA 1SJDA 2PF0A 2Y7GA 4B91A 4F3HA 1NAL1 2G5RA 3G5ZB 1OM0A 1D7BA 3ORWA 2LU4A 3RL1B 5LA2A 5BOFA 4DP2X 3H8AA 1MLBB 4IMCA 2G97A 5D71L 2EABA 4JDZA 3LEPA 1L5GA 1CDCA 1CB4A 1WBZA 4RSYA 1MPAL 1UXMA 3ET9F 4OJDH 4WUKL 4YO0A 1TTQA 3T44A 4JFSA 4PMYA 1EDGA 4IOTA 2CCRA 5FECA 2DZAA 3IBEA 4LALA 4PV9B 1ACZA 2BVQB 1RY7B 1AXIB 5D5MF 5ALCL 2WLJA 3GVQA 4KU1A 5HQMA 1RZPA 2OJEA 5EUOF 4GMEA 1O66A 1F9CA 3TR9A 2LQRA 4WKZB 2HFTA 5FOBA 1UOVA 1Y1DA 5MEQB 4IKIA 1OW0A 2YIHA 2VLKD 4RDYA 4TVDA 3QEUA 2WWMD 1UKPA 4OVUA 4IG2A 3A3HA 5T9CE 1NEZG 3NSXA 5MI0C 2R2BB 3BZFA 1XI3A 4J8QA 2UV3A 4JG9A 4XWOC 5AYUH 1F4HA 4DO4A 2YYUA 3RRAA 4X83A 1U6AL 3EFFB 4HIIB 5B3JE 3ZRSA 1V05A 1UC5A 2R24A 5FUZL 1WTGT 5EDSA 5D32A 4OBRA 2W9MA 2NDGA 1WGVA 4I0PB 3ZYOA 4APXB 1FXPA 2XWZA 1HIZA 2PW2A 4PRIB 2EDKA 2R1YA 4DHGA 1KB9K 2F5BH 4DGWC 4YU1A 3MO1B 2HTLD 1KIPB 5G1YA 4JE4B 2I69A 5I6XC 5IBLD 1UURA 2OK0L 3LB6D 2VUYA 1M9SA 3VX0A 2NSXA 3GJFH 1EBAA 2EBNA 4Z0BH 2NLIA 2IEPA 5EG6C 1CVSC 4AH2B 5HYSG 3SDDB 4NNAA 4ODXA 4RZ4A 5HR6A 5C0CD 1NBVL 4OJFL 2IDSA 2A0LC 3CCHA 3P40A 4PJAA 2H0FA 2KS0A 1MFCL 1FCUA 4DZ5A 4HPOH 2B0MA 2PO6B 2AV7A 1XUUA 4FXFA 4N2AA 2PAJA 4X6CA 3MTWA 1ZP4A 3MR9A 3MRPA 1SGKA 5DMIL 3P77A 3S2AA 4AYGA 3NCBB 1KLUA 3UR2A 3VYLA 3S2MA 4PGEB 1NWRA 4U5IA 4AKPA 1OGBA 4US5D 4LSVL 1N3NA 1KB5L 1GTNA 4U1SB 3QQNA 4BZ1H 5INDB 4G7RB 1OCJA 1JNLH 1XCTA 2BFVL 1K6QH 3L5WB 4TNWF 5CEZH 4J35A 1XXFC 3L5MA 3RITA 4J3OH 3V6BR 2XCMC 5BMFH 2WBWB 4LCVA 5DFAA 4RMRA 4K9EC 4ACPA 2FBRA 4PJCE 5CZXD 3UBHA 1S5NA 4DJEC 2CHNA 2ACUA 1TEYA 4UNUA 1E0TA 1JGUH 2J5LC 3QIUA 4G8GB 1A3RH 1L9RA 4IOIB 5JW4R 3IV8A 2ICCA 8RUCA 1EVTC 2C5DC 1JL8A 4JN2B 3MGTA 1SZGA 4L1DA 3OF6D 4ELMF 2GGHA 1M2VB 4P5TA 3GVGA 4OCSL 4WGXA 3IDJB 3UJSA 1WAEA 1RIVH 1QTPA 3BUYB 1RJPA 1KYUA 3N04A 3OHMB 4JVWA 3RNQB 4DZ8A 2VN3A 2X1SA 4XD5A 3TU9A 4GABA 4PMFA 4BFIB 4M8UA 5D2VA 1KT2B 2VVNA 4GUIA 1Z5LB 3MLPA 4TVSa 4GIAA 4KI1A 1X6LA 4KCVA 2WB7A 3MNDA 5I6LA 4GRLD 1IU1A 1I82A 4JO4L 3TN6A 3OKNB 4PUKA 2IPTH 2BP1A 3WJLC 5AQ0A 4B4FA 1MAML 1NAKH 5BS0B 1NIDA 3M64A 1MCEA 1HL5A 2BS71 1AK5A 4FF5A 3SGDH 3ESNA 4WJ5A 1WAPA 3KDNA 4AD0A 5LKNA 5FF6B 1JTPA 1YPZA 4OFKA 5CEYA 3L3GA 4G7SB 1YPZE 1G6RL 4FI8A 4AIXA 3K8MA 5FA4B 4JG5A 2JKAA 1CTOA 3SQBA 4AVOA 3HG4A 3KOWA 2ENSA 4WCJA 1XV8A 1XYLA 4YUEH 1G9ML 4FXRA 5D38A 3KWWB 1DBAH 3BSHA 4X7FC 4Q9BA 1FVDA 2BIOA 4AQ8C 3W00A 3MLSH 6ENLA 1JWUA 4MXVE 1KCXA 2YA1A 3X2QB 4WEBL 1KQZA 3NESA 2F1BA 3ZDYF 5G4OA 1KTKE 4YWGH 4FHJA 3QOMA 1T1ZB 3LNGA 1J5DA 5AOJA 3NDYE 4BFEA 1VFTA 3SDYH 2VUOA 4PS4L 4TIMA 5JOFB 5L7XH 3IGUA 4IDJH 5AOMA 1AR1B 1F3EA 4HFWB 1Q9OB 2ZXAA 1XLHA 3DZ1A 5I3JA 1SJEA 3MHUA 4URKA 4RRPA 2YPKA 5I5RA 1BVLB 4J12A 5I06A 2DQMA 1WBZB 2NQ3A 3FSTA 5E7FA 1Q0EA 3THUA 5DD5L 5JBFA 2AJXL 1XF2A 2H1LM 3PANA 4OLZH 1JNHA 4XRCB 4YXGA 4ELDA 5BRBA 1FC2D 4MQXD 1FZMA 1I31A 4KFPA 1DQKA 3R0MA 4I7ZC 4PBDA 5L2KB 1JUBA 3WFDH 5JYMA 1NOAA 2XPYA 2D0GA 4MQSB 3BOXA 3R1GL 2UWEA 1WB0A 4TSBL 1D2KA 3BTNA 1RV6X 4B9ZA 1IT9L 1G4RA 5ANMB 4XZBA 3ZL4H 2VZ1A 4CNTA 3DG3A 5CD3B 4EVNA 1UR4A 1C8YA 1GKOA 3VINA 2Z4QA 3B83A 2PDGA 2HRPL 1B6DA 3V16A 5JW3L 1XGUA 3L67A 1XCFA 3S98A 3NBNA 3TPUB 1P1MA 2Y6TE 3U36B 1HWGB 4UZGA 4DIXA 3EYSH 3LK6A 1CYXA 4ERAA 4Y2LA 5I19H 5EWIH 5HI5C 3FCPA 4L8CA 4JR9H 5B80A 2QSVA 1BVWA 1ACCA 1SN2A 4S1DC 4R7DB 5HY9A 4APXA 1U8MB 1OLZA 1JQXA 3LNIA 3C61A 4RGOH 3QQ1A 2FT6A 5H94B 3ASNB 4KFMA 1KRMA 3UJ2A 2QELA 1HQ4A 2WO3B 3B05A 1KGUA 3V8OA 3LBOA 5C70A 1JDAA 3ZU8A 1XIFA 4MDOA 2ZOOA 3CSTA 4HSQA 1GXEA 4HIEB 3ZXWA 3H56A 3MUJA 5BS0D 2A9ML 3DX2A 2RDUA 4LCWB 2LOEA 3D05A 3LHTA 1MCPH 2Z91B 4NAQA 4B3VA 4O1AA 4HNNA 1U22A 1QWKA 5TH2A 3O16A 5KBKA 2WSRA 3WL9B 4QHKI 4AEEA 3N4AA 3IS1X 4KKAD 4GNJA 2OZ4H 3NP3A 3H4FA 2VT0A 4PLNC 3WF3A 4OWGA 2XZCL 2XWDA 2PO6A 3RWCA 4AJVA 1CLXA 3NEXA 1TZAA 4XCFL 3MACH 3UBXG 2CR6A 1TWWA 4QAWA 1K6QL 3VO0A 1M57B 2OCFD 1XZ0B 3P30H 4YTUA 5DVNA 3SCVA 1LO2H 4AZGA 4FG0A 5C1MB 3BLDA 5ECUA 3O63A 5CAHA 1S3HA 4PMXA 2CK0H 3V0GA 4V1YA 4Y1AE 3BKJL 3N1MC 2VDOH 3Q8FA 4PG2A 3HOGA 1KJVA 4U6VH 2OEMA 3NCOA 2ERJC 4PW9A 3EXJA 3TMLA 1K8IB 1I7TA 3APMA 2XTKA 2MCAA 4Z7UA 1HKWA 1MWOA 1DL7H 3QQ9C 1JBJA 1P0DA 4L29A 3MUCA 4PGLA 3THQA 3CZGA 2D22A 4H1LH 3MFGB 4OV5A 1F11A 1MYRA 3EOSA 3U0PA 4Q58C 3TWAA 5F21B 5JLZB 4NUMA 1XLCA 3B40A 4Y8FA 1TJMA 7PAZA 3VD1A 1M65A 5FOOA 1HCZA 2DQTL 3FUJA 1S7UA 4PLJC 2HWZH 1KELH 4X6DE 5MEND 2VC2L 2WQDA 4PJGA 3L6FA 3BPWA 1DUZA 5EZIL 5E08L 5C07A 1B30A 3GKWL 3F2CA 3MOAH 1INQB 3CH8A 3HKZA 3UTTD 5SWQB 2CK0L 3LZFH 2X2HA 1COBA 1E5BA 2PB1A 4KIRA 5HNRA 3ETSA 1UXLA 4LPXA 4JFQA 3WLQA 4JTHA 1AZVA 1JCTA 1O1HA 1A80A 1NSJA 4PTXA 1MCJA 5CBAB 4JHVA 4Z3GA 2CR0A 1XLGA 4WJEA 5KJRL 1FY6A 1UYWH 1VFSA 4MKVA 2UWEF 2VLLA 5CGYC 5A6TC 1BF6A 2PD5A 4Z3JA 4HJ1A 3E38A 2BJML 5FDWB 3BP7A 4NQCB 3GH4A 2CLIA 1PY4A 3U4AA 1AL8A 3RWJA 5F2GA 2J9ZA 1XLFA 3S36L 2VC2H 2XPZA 3WNMA 2BSEA 4U1JA 4GYJA 5C9WA 4ZFGL 4LEFA 4XVSH 3VFMB 5AW5B 1S7TB 3A3XA 4NO2A 4PGDA 4ZMPA 3KGSA 5ICYA 4GKSA 3CLMA 2IUZA 1D5MA 3SO7A 1BSIA 1KTDB 1FL6B 3UAJD 1HJCA 5DELA 4QWWC 3E2QA 3IDXH 3QDAA 5DVMA 4RE4A 5A6BD 2Y88A 2Y24A 4WU7B 4JTSA 3VK5A 2H8XA 2GSIA 4Q9QL 1HHHB 1U8QA 3ZDWA 2YAHA 4QCIA 4BKSC 1N0XH 4R7VA 3OG2A 1DSFH 4F7PB 1U1JA 4R83A 4TNFA 2WAQA 3AQYA 4HOXA 3HA0A 2JKXA 1PYMA 2O93L 2NNAA 1QNSA 1P7HL 3EG9B 1QHZA 5BOOA 3L3HA 1W37A 2BX7A 1FAIH 3R12A 5I02A 4N2YA 3FAXA 2Y36H 3KYKH 5GZNA 4ZOEA 5DMNA 4NT6B 1F6AB 1MI5E 1QSEA 5JBEA 1XF2B 1E6OH 1TKWB 2B77A 4LCIL 4J3VA 4UYQA 5CP7A 3TEWA 4TMCA 4I77H 5C9UA 1N5YH 3HN5A 3FYIB 2AJUH 3EJZC 2WP3O 3FTWA 1A3HA 4G7YL 3SKNB 1JCYA 1OWQA 5DHMC 1YAIA 1FWJC 1G7IA 3G5YA 2PWVA 1XAKA 4W86A 1SFJA 2EH8L 5EU6E 3N9SA 3W39A 3T81A 4HHGA 2YD5A 4CVXB 3MJYA 1NLDL 4KO9A 4FALA 5C08D 4CMHB 2PODA 4TULL 4PTUA 3VH8A 5ITFB 2JV6A 1R8LA 4HSNA 4U1KB 4RLIA 2WO5A 4DUXA 5ILTH 2YSWA 1SHSA 1XGRB 4PRDA 3BW3A 3W1LA 1VBJA 5CBEB 2CERA 4F66A 3J7HA 1S7VB 4LSSH 3WEXB 4DP5X 2GFTA 3UCCA 1PDKB 1SLWA 5I07A 3GT6A 4DGYH 4HKXB 1BM7A 5EIQA 2H6PB 1IQ8A 2A6NA 1FBAA 5BZDA 3K81A 1JVLA 5HYJE 1EP1A 3H2WA 4PR5A 3CWNA 2CG9X 4N90D 3RA7H 3GNXA 2QVKA 3N85H 2BODX 2QGYA 4IG2B 3WMSA 3IPEA 4KKLC 4Z7NE 5BXFA 5DD3H 4F91B 3AHZA 4OECA 2PBOA 1W72L 1S2WA 4JZNA 3WIHH 1QEWA 4XO6A 4HIEA 4Z23A 1W9XA 4DX3A 3B3DA 1VGEH 3PHOB 4HJTA 5KYWA 3UW6A 2Z91A 1B3IA 5TPWH 3DDGA 4L7ZA 5JIQA 2EUWA 1WP6A 1AZZC 2EVGA 1A7QH 3YPIA 1A4AA 3OKOB 3BKJH 4UB0H 5B1JA 2YR1A 3G1DA 2QT3A 3OYXA 2YD2A 2F19H 1MRDH 2ALRA 4Z2LA 2R1XB 2KDYA 1QW7A 1WISA 3N42F 3QXTA 3FKRA 4LKXA 4NKQB 1HVQA 4YVXA 5E93A 4AH2A 4OCRL 2EO1A 3X12A 1TKKA 2IC2A 4L4TB 1Z9PA 2XN9D 4UV4H 4LEOB 3BLLA 1E4KA 1QG3A 3IJ6A 1A3XA 1UWUA 3L3OA 2EUZA 1Q9WA 4C47A 5DJCB 4R88A 3VDGA 2P7TB 4I48A 1XBVA 1M7UA 3F5KA 1NTHA 1JHKH 1ICTA 2WXFA 3MRKA 3OBAA 1WWCA 4J3OC 4MRCA 2QMJA 5TQ2H 3MNMA 3RVXC 3LVEA 5KANI 3EBGA 4MMWA 2QJDA 3G5WA 1QNPA 3GLCA 1G1YA 3MRRB 3T2LA 4LVAA 4G42A 4H13C 1NSNH 1U8HA 3AY4A 2ZOKA 3I50H 1UZGA 4LQFL 3L23A 1N3NB 4OQTH 3IRPX 1RLCL 3WY3A 3TM6A 4EBQH 3LHYA 3LG3A 2QVIA 2ZUQC 4K3ZA 4LAMA 3QPEA 2O5YH 1HO4A 4HV8B 4MA1B 3JTTB 1FNHA 4N2FA 1Z1WA 3QIWB 3PM6A 1QI4A 1MW2A 3ITTA 4H0GA 2PXYD 1B0WA 2V8LA 3CZLA 3UGVA 2MCMA 2YWYA 1CT8A 3P4MB 3FB7B 1KQYA 3CH1A 2C34A 4GFSA 1MFAH 5F7EH 5FGBC 2VLLB 4BKLB 4EKJA 2Q02A 1BWKA 3G1YA 4M9PA 3G04A 2X6MA 5I2IB 3KL3A 1RL1A 1OAJA 1PX8A 3GXDA 3HLAA 1KOAA 1YSOA 4EEEA 1AR1C 2W38A 4FMVA 2HZGA 5AB2A 4PTDA 3F2LA 4Q8OA 3GGWB 3EEGA 2DYRB 3QE5A 4QGYA 4PJHE 1MSSA 5SV3A 3DFNA 4XBJA 2A9BA 3ECVA 4YCOA 3H7UA 4OGAD 4LB4A 1R2TA 4F7KA 3HNTH 3GDMA 1KLGB 4NO2B 4PGDB 1UACL 2Y0SA 1U2HA 3QWRD 4M3HA 5DJXB 2W66A 5FHBH 1KCZA 4NI8A 3WLLA 5T8GA 1FP8A 3EX1A 1NEUA 1HW6A 1WVZA 4CMMB 5AECA 5DSCB 3LZPA 2CIKA 1JQVA 3WN5B 1XYAA 4ANWA 3Q6FB 3R10A 5CSSA 1S9YA 2L7EA 5DT7A 1J1XL 1TFHA 5T1MB 4D9QE 3IRCA 2H2PD 4PJEE 3VE7A 4NWTH 1ZVHA 3CG8A 1L8NA 2SEBB 2O9TA 2R0KH 1E5YA 3HNVH 3CFJB 4FERA 4PJ8B 1VLWA 4LAUA 5LGYA 4KRPB 4YQXL 3A6BH 3KWWA 4WFEE 4G43A 3FHQA 1WZ1H 4KO7A 4P5RA 3CXHJ 4GKZA 3LI0A 3VIFA 2F53D 2MKWA 4ZCWA 4LCYB 32C2B 4JM2C 5FAAA 3T6VA 3ARGC 5TFSH 2NXZC 5FO8A 5D1QD 2C1IA 3B8TA 2WBXA 4N5EC 5GGTA 2EXSA 1AKPA 2FO8A 1M03A 2O26U 3VGGA 4A2LA 2DQDL 2F9RA 3KDMA 4Y9PA 2PDIA 4IPPA 3VWJB 1QPPA 4J3ZA 4E3VA 1Q38A 2PTUA 3POCA 4PGBB 1NFDE 4F92B 5I71B 1C91A 1RIUH 4MAYB 3W1RA 3G5YB 4ZS6C 1ZA6A 5DRWB 5JW4N 1NFDA 4OCLC 5FR3A 3WLIA 1J2BA 2V2WA 3ZHFA 2F53B 3MPGA 2QGEA 4RNIA 3MRLA 1CU4H 3K6OA 4BA0A 1FA2A 1UMLA 2ASHA 4M5YL 4CNIB 1RIHH 2HPOA 4P2RB 1LWRA 1WZ1L 1YEEH 2V2XA 5F7LB 2JI2A 2Y85A 4CQ9A 2ALAA 3BDBA 3FQ4A 2DVTA 2GW5A 4KKNA 4CBZA 2R1NA 1MCHA 2N1KA 1IC5H 1S7VA 3WEXA 5JHMA 2QFPA 2WM1A 4S1RL 1GEQA 4JFZL 3TLLA 3EYFA 3TJLA 4MBOA 1VHNA 4AL8L 3DJRA 2Y89A 4YHMH 3BZEB 1TSIA 4JFUA 3ZM8A 3RB5A 4B53A 4K3EH 3U7BA 3R5EA 4OGYH 3AXXA 5J8LA 3FU7B 4HWBL 2X9ZA 3M5VA 3WDPP 3KS0H 1DEEA 3BJ91 2YL9A 4G6ML 4MJJA 3MHZA 1WBXA 1EZLA 3Q8AA 3T2PA 1QHPA 3CQFA 4WIQA 1PL3A 3OVPA 1U33A 3B2VH 3LSOB 4JY5L 2CJ3A 3ZS4A 3FQTA 1VFOA 1Z9OA 1RR2A 4H2HA 4N8UA 4ODTL 4JFEB 3EH5B 4R7DA 1PX4A 4Y19D 4F57H 4Z7WE 12E8H 1HN1A 2BHUA 4YFEA 3JUGA 2AJSL 3TK7A 5JH1A 4UV4L 5CCJA 1EANA 3IDYC 1Z69A 1DE4A 1KXTB 1KO0A 5J6SA 5D2LE 4U1LB 3PNZA 1OAXH 1VFAB 4UTLA 2OS7A 3QRGH 3H3KA 1FCBA 2VKZG 1U8OB 2VB5A 4HU2A 3NVQA 4PBGA 1M4KA 2X0YA 4JFED 3CBJB 4Y7OC 3MP5A 3BDYH 3L5AA 2VC2B 4YC2C 5H8UA 2Z3FA 1B57A 3CDGA 3ZUNC 1BZQK 5DJCA 4PLKD 5CPMA 3CHSA 4A6YB 4MS8C 1AGDB 4QYOA 4ADJA 3G8RA 1NAMA 4H8HA 3DETC 1VYPX 5FJOA 4KY1H 1HT6A 4B3EA 3EWDA 3MMTA 4ZX4A 5KW9H 1AKJA 4KTEH 4YSEA 4HGKC 1M1SA 4LSPL 5GGRB 3E5PA 4Y1TA 2A6DB 5K3VA 3R8GA 1SZFA 5KZEA 3PQYD 3O3AA 3DRQA 1LDCA 3V0VA 2EIBA 2C9PA 2D7NA 3JTTA 1F11B 1L6YA 2XNAA 5IHUL 3UZEC 2OA9A 4FADA 1MO0A 1WT5C 2DT1A 2PWUA 3HC0B 3EGJA 3TYAA 5JVLA 1EF2A 2FPYA 3D39D 1NARA 3UTSD 4P61A 2X2GA 1G6RA 4JFWA 3L6FB 3H9SE 2ZBTA 4W5ZA 5F3FA 4NRYA 4JNZA 5E94B 1GGBH 1GTHA 2J66A 1EJRC 1JJKA 1XR8B 1OTSC 3E1F1 2JJTC 3QNYB 1X5AA 4C1NB 3WGUB 3QNFA 2DSKA 4ZZFA 4AHPA 3KM1A 3HFYA 3TOPA 2JLLA 3EO1B 3IF1A 3E12A 5KMYA 1XRSA 1EEYB 3A24A 3SOBL 4JO1H 1MCNA 4AZ6A 3P73A 1O12A 3L2LA 1RU9H 4B90A 2XJLA 3W29A 4MGGA 4GS7C 4UMGA 1IXNA 1UFGA 5IBUB 4WD0A 5C7XL 1P6CA 2EDDA 2YMXH 4A6YH 3BP7B 4J2PA 1XIIA 1I1AA 3BQUA 3KH4A 4XODA 3U82B 4WUUE 1GVFA 2AGTA 5K2ZA 2BSRA 4NZ4A 2PUZA 2WZ6A 1EUUA 4PJDE 4YBQC 4UMAA 5H37G 5DZVA 3WL0A 2AS5M 2XWCA 2CITA 4XBEH 3CIVA 2BCKB 2MQ3A 7FABH 2MOQA 4ZO9A 5JPMA 2BNQD 1IGYB 2AP2A 1OP3H 5KS9A 5D2TA 5IWLC 4QLLA 5T3ZH 4MKTA 3MBFA 5ICYB 1RSYA 2REQB 4HMNA 1YQVL 4PJ8A 1OADA 3QEHB 4UUIA 2KZWA 4UTBH 1JD7A 3LN4B 3GU9A 4ZFFA 4LBEB 4XMXA 4XNUH 2YDSA 4IWWA 1C08A 1ZT1A 2ZF9A 5FO9A 3ZVHA 3AFLA 3JWNC 4OE7A 3NT0A 5CHNA 1NCBH 3VFGL 3W7QA 1X5LA 1YMHA 4HEMA 4R0LB 4JG0H 1UQZA 1XIBA 3B0YA 4NKMA 3DCPA 3URAA 1BG4A 2I5IA 4QXGL 1TR7A 1OARL 1K5WA 1GOWA 1J5TA 1URZA 2PW1B 2R0WL 4WY0F 3ESMA 3FXYA 3BV7A 4PMRA 4E0CA 1TQTA 1RIHL 4TQ8A 2EADA 1J9YA 2DY3A 2P10A 3S5NA 3WLMA 4LSTL 5DC9B 3F00A 5JHDA 2QPXA 3EZ4A 3L3HB 3PK7A 3BQVA 5T3ZL 1UWGH 3CFEB 5E9DD 4LPUA 4YHNB 3TYGH 3U4EA 4FKEA 1CDGA 5DY3A 1A6AB 1G7JA 1QSEB 1YQVH 1QMUA 1G7VA 3V5KB 5CQ1A 3NGBC 3DX1A 3HI5H 3F85A 4TF4A 1TR1A 1E2ZA 2VQTA 4BCXA 3CAWA 4BQ5A 4I2XE 1W3NA 2UY7B 3CFMA 2R56L 3DXAE 1G5GA 1JTOA 3FFCD 4HH8A 4N5ED 3MRJA 4X5QA 4XC1H 5DFWH 4BH7A 3U0WH 8PAZA 3QZPA 2DI7A 4LNYA 4PB3A 4XG1A 3S8GB 1K8DB 5EBWB 2AVGA 1IQWL 1J9RA 4UQ3A 1MFEL 4R96A 5CKGA 4S10A 5DR5L 4AVHA 2YXGA 4C7GA 2CLMA 5I1JL 3JU2A 3BZEA 4JQIH 4TQPA 5C0EA 4GG6B 5HHOE 2QR6A 3AREA 2J6VA 3CL8A 5EFIA 4I1RA 4JGMA 5FCSH 4ZX5A 3UVAA 2N4IA 1W0WB 3KDPB 4UT7L 2B7NA 1JUFA 5CBEA 4AX3A 1AJ7H 4GIPD 3O45A 2L0DA 3N0AA 4K7PX 1T96A 1H5BB 3H22A 4PAZA 1K70A 3NXFA 2HT3C 2OMYA 1GZHA 1VCAA 2R0LL 3OJMB 4HKXA 4HWEH 5FPIA 2P0IA 3NZRA 4NAFB 2Z7KA 3CZEA 1MUJB 3X1NA 1IEQA 4YXHL 1R87A 4Z1DA 4LSUL 4MCNA 4M03A 3PWPD 1HKMA 5KYYB 4LOCA 4DKTA 1HNYA 2EIMB 4ODHH 2GGIA 5DK2A 1QVOB 4LPCA 3T6ZA 1TELA 5DR5H 3IJYB 3W85A 2EDWA 3KPTA 4F8LA 3AS3A 1RUAL 2OL3L 3FQXB 3LPFA 3U9WA 3T71A 1J6OA 4LB8A 5EN2A 3UAEA 4P99A 1WDDA 3W9DB 3V0DA 3CFNA 1JERA 3HE6A 1TO4A 3C6EA 2XRAH 1LK3H 1LMIA 2VHLA 2CO2A 3HMCA 4ZQTA 1E0XA 3WTUA 4M1GL 3PGCA 5GSRA 3FOKA 1JZ3A 3VYOA 1D5XA 1QO5A 4WVRA 3V6ZB 3W0WE 3LBMA 1I2NA 2K7QA 3OKKA 4HUCA 1QKZL 2CHDA 2YUVA 1MNZA 3WUBA 3Q13A 3L1GA 4C6MA 1PY9A 4HXBL 3C3NA 4URIA 5HDRA 4YPGB 4KKXA 4O0ZA 1JK9B 5C0AE 1CD0A 1S2AA 2ZYFA 2P47B 1ZLSH 3C52A 4PCFA 4FI6A 5D2WA 5F7FA 1MRQA 1D9KD 2HNHA 2AJVL 3FO1A 4DNHA 4HWZA 3K1GA 3LQZB 4HHPA 3QG7H 2IAMB 1BA9A 1FNEB 2HBXA 4AB4A 1F00I 3FUNA 5LNWA 5CLYA 4R7OA 3IUIA 2PRLA 3VKAA 5D5MA 2WB1A 4WRLA 4E5TA 2YA0A 3IDIA 5KTEL 1S2EA 3PS6A 4NL1A 1X5JA 1JV5A 2C14A 3NO1A 4NUQA 1L6PA 4R90H 3O6AA 3B9NA 1A64A 1DBJL 1FZJB 4G42B 5LA0A 3MC5A 3KHDA 1H41A 4IISA 4DJFC 1RZKC 1I1CA 5E56A 4L65A 4CVWA 3HC3H 4BFKA 1WUFA 1A1OB 2XSXA 4M6ML 3PJXA 4X6FA 5LNGA 1E73M 1OVDA 4FNLH 2XN2A 1MNUH 3K0WA 4M1DH 5M03A 1H0GA 2Y36L 3KYKL 2XY2A 4PRPA 3RZCB 4P8QA 2FJFA 1MVYA 3OPUA 1U5HA 2X7LB 1UOKA 2DZBA 4JB9L 4ZXOA 1FAIL 4NQTA 2Q7NA 2PCXA 4LLYA 1DQLH 3AJXA 3MX0A 3GAKA 2BOBB 4GQQA 1A5MC 4GUPA 4DZAA 4XNYH 3FB7A 3RR4A 1SZRA 4M9OA 3WSQL 4P8WA 3SAZA 1E6JL 4BFJA 1UB6B 4PWKA 4R9OA 4ZXBA 4IGSA 2NZ1A 1IVTA 1C5CL 4IS6B 5IJDC 5F0PB 3MBWA 5F2FA 5HD8D 4Z7WB 4F2EA 4XVJL 2FLBT 3C2AH 1HCYA 4HPGA 4AX6A 1E70M 3TO4A 2E6PA 3VFGH 4J1UB 5I1IH 1UQSB 3TYUA 5DJXA 4GZIA 2OG9A 2BG5A 4DWHA 3GY1A 5AEAA 5HINA 1M71A 1BYOA 3QIUC 4WDIA 4JQVA 2ZCHH 5CP3H 1IYXA 2Y1VA 4LBEA 4RNRB 2A3LA 4GRSA 4TO8A 5LGXA 3D9AH 3FYEB 5B3SB 4ZS7L 2Q8BH 1RVFL 5KITA 3DROA 1WDQA 2JXMB 2QEZA 1E6JH 5KUMA 1CD1B 1NGYB 1W8OA 4NRXA 4PMJA 3NJVA 2J73A 2QJGA 3DSNA 2MOVA 2Y7DA 1SXSA 3GD1C 3FHAA 4Z7UE 5J11C 4I5RA 1F1AA 1ZGLM 2WBGA 4M7ZB 5BNKA 1C90A 5J9PA 2QKIA 4FXLA 2QLVB 2G2RB 1FF5A 4IHOB 4GKZB 1HHKB 3A4AA 4UB0L 5HDQL 3EO9L 1A65A 4A4AA 4RAUB 4G1MB 3KFTA 1R3KB 2EKCA 3HFTA 5FO8B 4K8HA 1ETJA 1KCRH 1U8PA 3UZJA 4EI6A 5BZXA 3VFOB 3V5DB 5CPSA 1DDHA 4K3DH 2AQ3A 1E6SM 3FCGA 3FX4A 3WK3A 4I18C 4KZ0A 5K59E 3VWJA 4GMSL 3KX6A 1XGDA 4NP7A 3VFSB 1A1NB 2ZTBA 5GRJL 1IGFH 4QDPA 5EBWA 3JW7A 4NJKA 3S35H 3MRLB 3QVQA 4H0IA 4I9WE 1TPFA 3WLBB 4DW2L 5AZ1A 5AFDA 2YRPA 5E6UB 1KC5L 1PEWA 4OFYA 4PJ7F 4FFVD 2YLHA 3HPJA 4HZ8A 4EQ2A 3SE8H 1AO7E 3I9PA 4WI2A 4JJHA 4XO9A 5MEOB 4XVTL 3QVAA 4KXCA 3OB0K 4EBQL 4XCCH 1TG7A 3NA4A 3UAJC 3OAUL 4GSXA 4DO6A 1RALA 3UG8A 1LP9F 2AXFA 2EYTA 3WO3B 4JFDA 4XNMB 3FU7A 3QDGE 3IJ7A 3S35X 3HFML 1BXBA 2DWXA 1K1DA 4JFFA 1KRBC 2DKSA 4I2XA 2J88A 3PZGA 1P2CA 3T3ME 4U1HB 1UJ3B 2CA3A 4ZTOH 1LRNA 1GIGH 3I84A 3IT8D 3V9FA 3O9NA 3OKDB 1JAEA 2ZXGA 2JQXA 3GBLA 4WEUD 1KULA 3CZUB 3NIGB 1XH3A 1S5IL 3D3VB 1DJSA 4EE2A 1A5LC 4AKQA 3GRIA 3UR7A 2ON3A 5AG9A 1K3IA 2PTTA 4JGUA 5E0QA 4DKFH 2JCCF 4PCPA 2NZ9C 1TVDA 3CLEH 5GRVL 3TN4A 5LBSA 4IOFD 3FT3A 4XCCL 5AVVB 4LOFA 5L7XL 1OM9A 2DF3A 4C56B 4I3GA 4WENB 4Y96A 3LPPA 4Y2OA 1N0XL 1WKYA 3DERA 1PWMA 3ABKB 5MEPA 4CD4A 4KJYA 5AVQB 1EJUC 3BYTA 4PB9L 4XCNB 4KEZA 5T3ZE 2NY0C 3AXLA 1OCQA 3HW7A 2WQSA 3MU3A 2J9YA 3LY0A 4AGNA 1N8FA 1ZMYA 3GNDA 3RX8A 2QF8A 3CNKA 4ZZKA 4OZOA 5C97A 3GR4A 3PUEA 1IM9B 4FLSA 3UJJL 1MMFA 1NAMB 4Z7OB 4AG4H 2R69L 1T6VN 3IDIB 4LP5A 3QYSA 1JV5B 3VZYA 3MV9E 5D9SA 1AHMA 1DVQA 2HLAB 3GRBA 2IVFC 3HHSB 4V27A 1L6ZA 3G1XA 5GGRA 3QZEA 2ICEB 2X7WA 3CVDA 3NUKA 2WAHA 3A6BL 4E41B 1E9OA 2MRYA 5L0QC 4S3AA 3WD2A 4PRNB 4XN1A 2CUHA 4LLQA 3ZBMA 2VEKA 5K4XA 5BZWB 3IWPA 4NN6C 4P59H 1ODUA 2CGYA 3RPIA 3W70A 9PCYA 1JJUA 1ZPTA 2YGQA 2A6LA 1WJ3A 5J13C 1F7BA 3GXTA 1RD5A 4C6BA 3QZOA 5A8PA 4QXVA 3W27A 2GHZA 5ELIA 1YEIL 3SQLA 4L4JA 4LLYB 3RYMA 2EC8A 3VXMB 4XNQB 2J4WH 3EXRA 3LZ5A 4GHRA 4GZEA 3WMCA 3W6YA 5AHMA 2PTZA 4WY7H 4Q8QA 2PWDA 2R69H 2UY5A 4PCYA 3BW9A 4IP5A 2R27A 2ED7A 3PAVA 1OWWA 1ZXKA 3GZQA 5DXWA 2XOTA 1TQVA 3FT9A 2QVMA 1H0DA 1LP9E 2CJTA 3IJEB 1NCTA 4KKAC 5C0IA 5IROD 2Y1HA 2ZADA 1ED3B 4MBRA 1XTMA 5E1QA 2KKQA 4FEZA 2VM8A 2OP4L 1TUPA 3VILA 4G5ZH 1UH3A 1MCPL 3HMXH 2ZCHL 4GACA 4FFWD 4UNKA 3CPRA 5H91A 4QOKE 4QGCA 1J1PL 2ZSWB 1RY8A 2EPHA 3T0EE 4LUIA 1XC4A 3I75B 5HYFA 1KCKA 1NDVA 3NZGA 4YE0A 1DVXA 4U6YA 4D0BA 1W9UA 1YX1A 3DDMA 5GGQH 2TAAA 2J8UE 5E9NA 3NZ8A 1XCXA 2YEQA 2ZWSA 3ESPA 4TS6A 3QH2A 1X7TA 4PJ9C 3VFNA 4FHKA 4LU5L 4RFNC 2J3SA 1EFQA 1W6LA 3P2DA 4XN8A 2DU2A 1PLGH 2BVPB 5F7AA 4J28A 2IOOA 1K03A 1G94A 2VDOL 4B0MB 3H9ZA 1JCNA 3B43A 3ZKSD 9XIMA 2VKWA 3QORA 1ME7A 3DN5A 4E5XB 3LLFA 4YVVA 1J8SA 2KBGA 5DZNA 4DP4X 3W2KA 3NRFA 5DHXB 2AI0L 2E6QA 5I76A 4I7VA 4UFMA 5KOVC 5CJBA 5HHOA 2PRMA 2X1TA 1AO7D 1F2XK 4NERA 1CBJA 3CAFA 1Z5HA 1R3KA 4DEUA 2HPMA 2V5TA 3ZTDC 5J89A 3ITLA 3WH5A 3V5DA 4HA0A 2XHYA 4GNKB 2DV0A 1H3UA 4Y19B 5EZOL 1FWDC 1AY1L 1QRNB 3S34H 2R9RA 3TA6A 3RWFB 5EU7E 1FG9C 3Q5TA 3E2HC 4UM9B 4O19A 4Q9RL 4GXUN 4WI6A 5ADPL 3UTQA 1Q9LB 1WIPA 1D5BA 5K9DA 3MODH 5CJOL 3M6DA 4TQTA 1W1IE 3CK0L 3O2VL 2DOCA 2ZKWA 4NBYB 4JXCA 2GSGB 3MKGA 3LH9A 4Q0XH 2WXNA 2NCEA 3UF9A 4Z0XA 1V03A 5F8QC 3PREA 1LJYA 5A6KA 4X4ZA 3O6DA 3EYOA 3GHEL 1E1FA 3BWUF 1U6AH 4QHUA 1GZGA 4LMQE 1YNQA 4YXKL 2CWRA 4DH2A 3Q0HA 4KTEL 5D2NE 3BRGC 1RBAA 3N18A 3W3OA 5BPPA 5ABTA 1BLNB 4RFOL 3MCKB 4L8SB 4PP1D 1FDZA 1A7NH 2WK2A 1SM9A 3N2TA 5CGTA 3S36H 5C9RA 4WEBH 1AR2A 2YD9A 4ALAL 4EMZA 2VLKE 1YTDA 3CMOL 4EDWL 2YDQA 3PWVA 3ULVH 2YOCA 5EEUA 4I8YA 2LLEA 5C0EB 3QRLA 3ZQ9A 2VISA 1QVBA 2IXQA 4OAWA 4JFDB 1CG9A 1TVPA 3MI2A 5EPMB 1W0WA 1XMEB 1F90H 2FTAA 2CIIA 4DKAA 3RNKA 3FQ2A 3HNTL 3NCWA 5CILH 3PXJA 4HK0A 1LEIA 3UJIH 3H54A 3H70A 3D0VB 3ZTCC 3PF3A 4JR9L 1OGTA 4FNQA 3CFDB 3CBWA 1EZSA 4NWUH 4PJCF 5ACMA 5AY7A 4BIKA 4Q32A 3QS2A 3JUYA 4NN6B 2OMBA 4XSLA 4AVNA 1EXBA 1HZYA 3WBAA 1JZ2A 4WY0B 3SCMB 4G8IB 3NXLA 4FA6A 3DJSA 2GGEA 2NVAA 4LLUB 3R0UA 3FA3A 1QO3A 3FT3B 1FV1A 5DJZA 3PPFA 4PRWA 3LN3A 4I7UA 2DV6A 1K85A 4GRLC 5D1QB 1T7VA 4NBZB 1RAKA 1FCGA 1TOXA 4D9LL 1JRHH 2OQYA 2QGDA 5HXMA 4HCHA 5SWZD 1QTYT 1JULA 4O1BA 2OMUA 3SE3C 2GSMB 1ZY9A 2Q5BA 4WFFE 4YOKA 3AXLB 3U6RA 3V0AC 1I53A 1NGQL 3WFEL 1WYIA 2X09A 1H7OA 4FMFA 5I66B 3O8XB 2OXNA 3IUDA 2PP3A 2DSUA 1GPWA 4XCFH 1FZKB 5IEHA 1KPUA 5HYQB 1Q63A 2EF9A 2IG2L 3DKHA 4J6IA 3MV9B 1QNQA 1LO2L 3QZ6A 5SWSA 2JB5H 5M5DA 2ICES 4G6CA 1NMAL 3DX9B 4GOSA 2VDPL 4KK6C 4RGOL 2AL2A 5CZXC 1L6XA 5C7HA 5IQ9B 1QEXA 5CS7A 4U5KA 4G1EB 5EFFA 3KS5A 2J1KA 3C8HA 3P9LB 4JFHE 4IQJA 4J3TA 3IIXA 2R23A 5G5DA 3RN6A 2Z7YA 3G6DL 4M1CD 2GJ6A 4OD1H 1XH2A 2EEDA 2G75B 4LSSL 5TE6H 5C9JB 2ZOUA 4JFYB 3WQCA 4NXSA 4I9AA 4WNJA 1UPMB 1NGQH 3LRLA 3Q3GB 4PD4K 3D39E 4GUOA 1I3RA 1WDRA 2JBMA 2D2HA 1TYEB 2INEA 3VXMA 2CDGB 5E03A 3UG5A 3STEA 3VGAB 3OJGA 4AWTA 1L3NA 1JWMA 2DQUH 1WTLA 5D7KE 3V4VL 3UMNA 6FABH