3OLGA

Structures of human pancreatic alpha-amylase in complex with acarviostatin iii03
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 172
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3olgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3olgA01
7TAAA 4ZENA 2VMFA 1VFOA 4HOZA 1V03A 1NARA 1JDAA 2VR5A 1UG6A 3G6MA 3WDJA 1HJQA 3CHCA 3CH9A 2EEXA 1VBRA 1C8YA 1W9DM 4PMRA 4AIOA 1VJZA 4LX4A 2J78A 4V2XA 4AEEA 4QLJA 3ZJKA 1MW0A 1FFQA 1CGYA 4OIFA 1E9LA 1BYAA 2GUYA 1GHRA 2GDVA 4FK9A 3WD4A 4OGZA 4PN2A 5FKYA 4ZXOA 3F5JA 2EBNA 3TONA 4NF7A 4CVWA 4TVDA 4AIUA 1CGVA 2E9BA 3HU7A 1GOOA 3MI6A 3VM7A 3WNNA 2JF6A 4QLLA 2ZX7A 1Y7VA 1B1YA 4U2ZA 2J7BA 4PMOA 4QCEA 1JD7A 3RJXA 1OGBA 5M03A 2WHJA 3NYDA 3SUUA 4PSRA 3RJYA 5ABFB 1X6NA 3IGUA 2Z1KA 4W8BA 1V3MA 2E8YA 4MNLA 1HL9A 3SCTA 3ZIZA 1CEOA 4GI9A 5A6SA 5HOSA 5CXPA 3TTQA 1ZS2A 5C70A 1K9TA 1JYVA 5GNYA 1E4MM 4J3TA 4EAMA 4YHGA 3W27A 1PX3A 4GIAA 4FNRA 2HVMA 3VUPA 2AMGA 1Q6EA 1GJUA 2FYVA 3MSGA 2PWEA 4AD3A 4CCDA 1J0KA 2CESA 2J77A 4F79A 4UR9A 2ZUWA 1UHVA 1PZ3A 2G3IA 3ZSTA 5KZ6A 3L4ZA 1GQKA 1O7AA 2XVNA 3IAQA 3S5ZA 2UY4A 1GOQA 3AZTA 4PTWA 1BPLB 1CLXA 1QW9A 3K8KA 4C7DA 1BGGA 1V02E 3W38A 1JXJA 4OBRA 2YL8A 5ABHA 1QI5A 2CERA 5GPRA 1RH9A 4ZE5A 3AHYA 1E73M 4OOUA 3ARRA 4PEEA 1WDQA 5EB8A 3WY4A 5A6BD 1X1NA 1C7SA 2CBUA 4AZGA 4B3LA 4Z2GA 4RE4A 2YA1A 5FCZA 1JDCA 2C8NA 2HISA 2XSBA 1FH8A 1CTNA 2QMJA 1KCLA 1E6XM 3OZPA 1KXQA 1W1TA 3ARWA 2DSUA 2C7FA 4MTVA 2OWWA 2J74A 3DX4A 5I24A 2IXUA 2OSYA 2YIHA 3VIFA 1TQTA 2XVGA 4UQBA 5E6YA 1HP4A 1EO5A 3EYPA 3WH5A 1XH2A 5CSUA 3UERA 1BHGA 4B16A 4D6DA 4YN5A 3BXWA 5I0DA 3LPFA 2ESCA 3PZUA 3RM9A 4OJYA 1E15A 1WPCA 2W66A 2WMFA 3LXBA 1C7TA 4UQDA 3BC9A 3HG2A 2RGMA 2VZUA 1US2A 5HBFA 3L4XA 4GXPA 3N15A 1EA9C 3KLLA 5AC4A 3VNZA 5A69A 1M03A 2ZUMA 1QNSA 2PWDA 3VIHA 2A3CA 4IISA 4ATWA 1R47A 4KRTA 3CHEA 4AY1A 1HVXA 4GZEA 1E6ZA 1UWTA 3MS8A 1B31A 1WP6A 2XN1A 1ITCA 3ZT5A 3T2QA 1QNOA 3VIPA 3W82A 3A24A 4H8UA 5F7UA 1W9PA 1B9ZA 3WNOA 2OSXA 4CU8A 1PPIA 3BLKA 1GPFA 2VNCA 1DWIM 2E3ZA 3KLKA 1QNPA 2F7PA 2YL6A 1F4AA 2QHAA 3WF0A 3MUZ1 4JKLA 2QPSA 5M17A 3VVGA 4IM4A 1E0XA 2CBJA 4DO6A 3SCSA 2WVTA 2CCRA 1HF6A 3SUVA 3CLWA 3RM4A 1ESWA 4RE2A 4F9JA 1KGWA 1RPKA 2JF7A 1CLVA 2WZEA 3MO4A 2EPKX 2WZIA 1RP9A 2WCGA 1ODUA 5FIPA 4HZ8A 4LXFA 4XZWA 4XZBA 1F4HA 2ZUVA 2X2JA 4HPHA 2Y2WA 5HPOA 5D9PA 4TX8A 2CPUA 4H04A 1JZ3A 3O9NA 2CITA 2VCBA 4DUWA 1KXVA 1GNXA 3A4WA 5E9AA 2WC4A 4QLKA 2EXOA 9CGTA 4HMDA 3VMPA 5HDRA 3WELA 1KR1A 1GOKA 2W61A 3A21A 1BFNA 2PBGA 2G3JA 5CZKA 3EDJA 3D3AA 4UQCA 2GFTA 1HXKA 3AS1A 1HT6A 3GBDA 3GXDA 4FLRA 1K9EA 3WF4A 2OWXA 4UFIA 1QI4A 1R33A 1E0VA 4AMCA 1UOKA 3THCA 3WUBA 4W93A 3AIQA 3MMWA 1HL8A 4ZXLA 1GVYA 6TAAA 2CHOA 3NIYA 1E72M 4X0VA 4H7VA 2A3AA 3FXYA 2DSVA 4MAVA 1JYXA 3LPGA 1ZBVA 2VT0A 3BAWA 3RILA 1XSKA 1HJUA 1UWUA 4NSBA 3DYPA 1JZ2A 4JFWA 3VIKA 2V3EA 3ZMRA 2ZX9A 1V02A 1V3LA 1EHNA 3M7SA 3BVXA 1DWHM 4TOQA 4DO4A 2PI6A 3AHZA 1CBGA 1FHDA 3T0DA 2WNWA 3KL0A 1XV8A 3D4YA 4FNPA 4JCLA 2ZX5A 5AYIA 1QI0A 1E71M 3DECA 2J7DA 1B3ZA 3LX9A 1LG2A 4EKJA 1EDQA 2O9OA 4AD4A 3IANA 2BV9A 3ECQA 4M82A 3ZJ7A 3MUIA 1CWYA 3BMVA 3OG2A 2Q8XA 1MFVA 4MB5A 4U2YA 3EJUA 1QI3A 1R7AA 1JFHA 4AXNA 3MMUA 3CV5A 1VBUA 3ARVA 4ZEPA 2G3NA 1KTCA 1XSIA 3CIVA 1KWGA 3OA5A 1IZJA 2CIPA 4URIA 4P8UA 1X6LA 1NWRA 1LJYA 3AS3A 1OGGA 1L8NA 4V27A 3LXCA 3OGRA 4P8XA 5GNXA 1GQLA 3LXAA 1OD8A 1XSJA 1H0IA 1I1XA 4MNKA 1XCWA 4UFKA 2XVKA 2PWHA 2XYLA 1UUQA 3PZGA 1NM9A 4HPGA 2W67A 1B3XA 5E0FA 4UCFA 2FGLA 3GNOA 1EHAA 3WY2A 3ARTA 1C93A 3CZEA 2ZWZA 1E6PA 3AYRA 1HWWA 4IPNB 1Q6CA 5A8MA 2WXDM 3AIRA 1H5VA 2F2HA 4P7OA 1W91A 3VMOA 3IJ8A 3ARQA 3WFZA 3EDEA 2GK1A 3PBGA 1GOMA 3LMYA 5BXSA 1OD0A 1UD3A 3EMQA 3LPOA 4WKFA 3CBWA 2EPLX 5D4YA 3M6DA 2GJPA 4AMWA 5A2BA 1J0YA 1IV8A 1FH9A 3ZT7A 2G41A 1V0LA 3VSVA 3AS0A 2W4XA 4J3WA 2WWCA 4JHOA 5ECUA 1TE1A 4PMUA 3AICA 2WHKA 3APGA 4J28A 3WH6A 1HVQA 3WQ6A 1JNEA 1CDGA 1B0IA 1VEPA 4HA4A 2D22A 3ARUA 2D23A 1J10A 4ACZB 2X1IA 1G9HA 1MQRA 1U33A 1B30A 1E6NA 1JIBA 4U5KA 5BYWA 1IZKA 1U30A 5A8NA 3EJQA 3PZ9A 1GW1A 4W84A 1ISWA 3CHDA 4E8CA 5A8PA 3AHVA 4DM2A 1E43A 4HOXA 1EDTA 1VFFA 1VEOA 4P7QA 1CXFA 4H8HA 4NXKA 4D6HA 4JCMA 2FHFA 3OGVA 4JKMA 1Q6DA 2XGBA 3AXIA 4AC1X 1ECEA 2YLAA 1EH9A 5I5RA 1WB0A 5A95A 1JZ6A 4P7RA 4AD0A 3N12A 1OIMA 3EDDA 2JE8A 3GTNA 3CZLA 4DWSB 3H54A 3WQ8A 5BROA 3RPMA 5A8QA 2DT0A 3AMLA 1W9XA 2CKSA 3WDRA 1OIFA 4AZBA 4M29A 4TVCA 3UEQA 2X05A 3VGHA 4V28A 3EDKA 3CUIA 3VDBA 5JIWA 2BNJA 3H55A 1CXEA 1DHKA 4QDMA 1WE5A 3NDZA 3VIMA 3W28A 1SYTA 3FNDA 3DYMA 1R46A 2GK1B 1UQZA 2DT2A 1UH4A 3BVVA 3ZSSA 2E8ZA 5D8ZA 4A3HA 4LYPA 4HOWA 2D24A 4ATDA 3EMZA 1AVAA 4JFUA 1E6SM 1TG7A 3VM5A 1LLOA 3WBEA 1PAMA 1KBBA 5A2AA 2ZXBA 2GJXB 1FP9A 2EABA 2DPEA 5ABFA 2BVTA 4Q7NA 4W5ZA 2VQUA 2UWFA 1BVNP 3HJEA 4M80A 3A5VA 1Q6FA 5I2UA 4FLOA 4CN1A 5BWFA 2WVSA 2XFRA 1EOMA 5DEZA 3VGDA 2O9RA 1BG9A 2J8FA 1JI2A 1HTYA 1V6YA 1V0NA 2CETA 1GCYA 4PMYA 2PB1A 5E0CA 3W25A 3AMCA 5E1QA 4UFJA 5A2CA 2F1BA 2VURA 4OOZA 5C8BB 3O6AA 1TUXA 1D3CA 4DO5A 3PZQA 2BY0A 4AZ6A 2WVVA 1R34A 1CYGA 4CUCA 3SCUA 4MB3A 3UR7A 3CUGA 3PZIA 2DT1A 4PUDA 2DT3A 2WLZA 2WM0A 3AIWA 4NX0A 3GM8A 3PZMA 1UWQA 2ZX8A 2XWDA 2DSKA 3QHOA 1UD2A 3RCNA 2W63A 1HNYA 2XFFA 2EJ1A 1UR1A 4JHZA 2VZSA 3SUSA 1HKIA 1VRXA 3GXTA 1NP0A 3U7VA 4QFUA 1W9VA 2DH3A 4ZE4A 2BVYA 4W7VA 1J12A 4EK7A 1JG9A 1KXHA 3WY3A 1G01A 5AC5A 4NZFA 1NWSA 3AYSA 3T2OA 3MUY1 1N82A 4D72A 3L4UA 1KTBA 2VCCA 2WHLA 1NOUA 1MW2A 3AI0A 3WN6A 2Z1SA 3AS2A 3VD9A 4HA1A 1JZ4A 3DHUA 3N13A 4GKLA 2XVLA 4MDOA 2YDQA 5FL0A 2BHUA 4NRSA 1SR0A 1WDSA 5EFFA 2G8ZA 2ALWA 3NSMA 4KH2A 4GO9A 4W89A 4MJ4A 4PCSA 5CJ5A 3AIBA 5I77A 2ZUTA 1JAEA 2Y8VA 3OB8A 1C90A 4GQRA 2J7EA 3FAXA 4M56A 5A1AA 3PTKA 1JZ5A 1WZMA 4CN6A 5DT5A 1W2PA 1OB0A 1V0KA 5IFTA 2VX5A 4L4OA 4EANA 3A47A 4J7RA 3KEHA 2DDXA 2F8QA 4IUGA 2WMHA 4UNIA 2EPNA 3ALGA 1EQCA 3BLBA 1B3WA 3EBVA 1ZBKA 3BUBA 1JAKA 3AOFA 4AD5A 2G4FA 1UR4A 1W2VA 2J7CA 4R5EA 1J0ZA 3GYCA 4U3CA 4A3YA 1CIUA 3VTRA 2ZE0A 3CPUA 1K6AA 3HG3A 2YA0A 4TVUA 3HG4A 3HN3A 5I23A 4B3KA 3NJ3A 4M81A 2DH2A 4MJ2A 1W3KA 5I78A 3UESA 3WDQA 5CLWA 4DUVA 2O9PA 3EJSA 3AHXA 1Q6GA 2WMIA 3SIMA 4C7FA 2WW5A 1YQ2A 4D6EA 3AISA 3TOPA 1HX0A 1BF2A 8CGTA 1UR9A 3MMDA 4P8VA 3NSNA 4E2OA 1E0WA 1LL4A 2GVYA 2WCAA 2O92A 1NP2A 4W87A 1EQPA 1BG4A 2JFEX 1VFUA 2FE0A 4JAWA 4D1JA 1HJVA 1NOWA 4Z2JA 3AIUA 1D2KA 2EACA 1K9FA 1O7DC 1QBAA 1KGXA 3FAWA 3AROA 1XD0A 1AQHA 4AWEA 1UKPA 3OBAA 3VGEA 3A23A 3LRMA 5CLTA 2FHBA 2CHNA 4AYGA 4PTVA 2E9MA 3CMGA 3W81A 4HA3A 1XHGA 3IAPA 3CZGA 2BY2A 2DGAA 1KWKA 1JYWA 4K68A 3ZR6A 3VIIA 2BS9A 1PJ9A 4B9YA 1Q4NX 3SEPA 1CECA 1GORA 3A4AA 7CGTA 1UR2A 5JBEA 1UZ4A 1H41A 4AD2A 1KFWA 2YL5A 4MNMA 5IFPA 1SFSA 2F7RA 4MPKA 2XGIA 4PMDA 4CGTA 4GI8A 2OW7A 3CZ8A 4XUYA 2PWGA 2BHZA 2WKLA 3WMSA 1HJWA 1MW3A 3WDPP 4FMVA 2E40A 1VF8A 1K9DA 1US3A 5HXMA 3VINA 1WDPA 1EXPA 4J3UA 3N18A 3UG4A 5JIPA 4FLSA 1NWTA 4U3AA 1HJXA 2UY3A 4X0NA 2WHMA 2IGTA 1B3YA 1E56A 2YFNA 2D0GA 2FHCA 1ITXA 3VIGA 2XHYA 3IK2A 2DSWA 4S3JA 4AZCA 5BXRA 2ZX6A 2QLYA 4QP0A 4OZOA 1R8LA 2JALA 4C7GA 3CZKA 1IT0A 1JYNA 2GJRA 1CNVA 4U31A 1SZNA 1U2YA 3FY1A 4HMEA 1BSIA 3VMNA 5BXPA 3BAYA 2RGLA 4AZ7A 2J7HA 1MW1A 3HG5A 4XV0A 3DX3A 3CO4A 2NSXA 4MDPA 5DT7A 3EDFA 4WJXA 1XYFA 1H3GA 4WSKA 3ZOAA 4KGJA 2YOCA 4WIWA 2BVDA 2XSAA 3PTQA 1OM0A 1MXDA 1CZ1A 3DHPA 1E6QM 1V3IA 1UKTA 3KZSA 4FF5A 4GZJA 2X0HA 4ACYA 4F66A 4BS0A 1CGUA 2ZXDA 2WVUA 3T2PA 4DWSA 3SCRA 3FHQA 1LL7A 3CZJA 3VDCA 4CD8A 4FLQA 4A4AA 3MV01 1HN1A 3AIVA 4J27A 4AEFA 3NDYA 1ZBWA 4AISA 4YPJA 3VPLA 1HIZA 2J47A 2OWCA 1UKOA 1KQYA 3DX2A 1RD6A 4Q22A 1TZ7A 4N0RA 3BSHA 3VGFA 1TVNA 4D6CA 2NW0A 2YL9A 4HU8A 1BVZA 1GJWA 3TP4A 1ISVA 5LYRA 2DIEA 4HP5A 1G5AA 4FNQA 1C91A 5CQ1A 3GXIA 1L0PA 1I75A 1EO7A 2XN0A 1OBAA 3TTYA 1DEDA 3AXHA 4UZUA 3BLPX 2D3LA 4PSPA 1W1YA 5IXEA 1M53A 5BRQA 3AQUA 4MNJA 2OW6A 2GJXA 3F5KA 1WDRA 5A8OA 4JL1A 1V08A 1NOFA 2VC9A 3I3DA 1QNQA 4W86A 4CU6A 3WQ5A 5ABEA 3EJPA 3UR8A 3QGVA 2WB5A 2MANA 2VVSA 3DX0A 1CGXA 1CXLA 3WQ4A 4IPLA 3QR3A 4BQ5A 4HZ7A 4JZ5A 4Z2HA 1UWRA 3B9AA 5LA0A 2BY1A 2J4GA 3WFLA 4L4PA 3D4ZA 4UOQA 3MSDA 4B15A 2Y4SA 2EQDA 3L4TA 1MQPA 2W91A 3SURA 1GQIA 3MUAA 3M07A 3W6MA 1NWUA 1WZLA 3S5YA 5BRPA 3POCA 3VIJA 3WL1A 4PTMA 3AFBA 2J25A 3WF2A 3GDBA 1UR0A 3FW6A 5A3HA 4NI3A 1QHPA 1BAGA 1UZ1A 4CD5A 1P6WA 3BH4A 2XJ7A 1MFUA 1ISXA 5I3DA 1LQ0A 8A3HA 3L2LA 1JZ8A 2W5FA 2ZOXA 3WUFA 1DWFM 3OIHA 1J18A 3ARZA 3A6OA 2WYSA 1J11A 4D6JA 4TTGA 1FFRA 1R75A 4B9ZA 2VO5A 1XCXA 3MKKA 2YKKA 3IJ9A 5JBFA 2XVPA 1WO2A 3CUFA 3CMJA 4GZIA 1CXIA 2XUCA 1UH2A 2VX6A 1M01A 5E09A 1FP8A 4TXEA 3VNYA 1JGIA 1E4IA 1UD5A 1FA2A 3K46A 4U33A 3GZAA 3N11A 1E70M 1HJSA 1BLIA 4Z2KA 3WD0A 5LA1A 1H1NA 1W32A 3TTOA 2WSKA 1CXKA 1MYRA 2VR4A 4XX6A 3DDGA 3T0AA 1HKKA 4AZCB 2WSPA 3WNPA 3WMCA 2D2OA 1ZU8A 4HMCA 1E6RA 3K4AA 4UQ9A 4HU0A 2CXGA 2VJXA 4BCEA 5EMYA 3I3BA 4CN4A 1C8QA 2FDMA 2ZUSA 4UFHA 3WBAA 1ISZA 3CUHA 4ATLA 2A3BA 1UD4A 2GDUA 3T08A 2XFYA 2VUYA 2A3EA 3KWXA 1J0JA 3BVWA 4P8WA 2VCAA 3ARXA 4TUFA 2CNCA 1UYQA 3UETA 1JI1A 3CGTA 1YHTA 4JKKA 3GH5A 3VKKA 1PS3A 4PUEA 4W5UA 1NQ6A 3AMKA 1R86A 3T09A 4D6FA 2FH6A 4NXSA 5E70A 4YHEA 3CZSA 1DWJM 1G1YA 1BGAA 2PBOA 3D50A 4FNSA 3KL3A 2WC7A 3BMWA 2X2HA 3L4WA 1HKMA 2YLLA 1XGZA 4W88A 2CBIA 4GINA 2O9TA 1I1WA 2CEQA 1WNOA 4MB1A 1FOBA 1TQUA 1UWIA 2E4TA 1E4NA 3L4VA 1HKJA 2J79A 1H49A 3I3EA 4U5IA 3S6TA 2E9LA 1FH7A 5DO8A 3SCWA 2D0FA 3WNMA 3VIOA 3ZJ8A 2OYLA 2F1AA 1GHSA 1QVBA 2BXYA 7A3HA 5BCAA 4M8UA 3PN8A 2VVNA 3WMBA 1V6VA 3NCOA 1QOXA 1PIFA 4Z2IA 1TMQA 5HPCA 3D5HA 3OLIA 5EBAA 1WZAA 1VAHA 1R85A 4CD4A 3QOKA 4BQ4A 1WKYA 1CENA 4WK9A 1ZL1A 4AZHA 3WD3A 2BFGA 1Z32X 1M7XA 1OGSA 1V3HA 4DM1A 2NT1A 2VRKA 4OUEA 2J75A 1J01A 1H09A 3VX0A 1UA7A 3SUWA 1UQYA 1OCQA 2ZUUA 1LL6A 3ARPA 1WAWA 1V3JA 2UY2A 4WKAA 3U57A 2EPMX 1VB9A 1ZBCA 5IHSA 1J9YA 4DWSC 4W8LA 3WNLA 1G0CA 2VRQA 2ZXAA 1BYDA 1J0IA 3VGGA 4TX6A 5M3WA 5A6LA 1A3HA 1ISYA 3GH7A 1C92A 1FHLA 1W3HA 1E1EA 3ALFA 4LGXA 2YA2A 5CPSA 2V3GA 2XIBA 3DYOA 1KGUA 5IDIA 1W9UA 1XD1A 4S3KA 2X2IA 3AMDA 3UG3A 2W92A 1JXKA 3VD5A 3WDHA 3RMEA 2WVVB 4UFLA 4D6IA 4UFMA 3WSUA 1PEZA 3PZNA 3RM8A 2JIEA 4JIEA 4FNTA 1QBBA 1XC6A 1TCMA 3O2LA 3OLEA 1AQMA 2J7GA 2ZUNA 1KB3A 3OLDA 3BAIA 2Y8KA 3BSGA 4NRRA 3SCVA 2EPOA 2A3HA 1KCKA 4LPCA 4UTFA 3VX1A 3LRLA 3VILA 3WKZA 3BCDA 4CCEA 3VOCA 2WKGA 2W62A 4BQ3A 1H4PA 5FD0A 4X9YA 4JL2A 3ZT6A 3VDAA 1QWUA 1ZJAA 4BF7A 3BVUA 2WC3A 3KL5A 3CTTA 3TA9A 3CUJA 1LWHA 2X2YA 1G94A 1E4LA 1LF1A 3SCOA 1C3FA 3W24A 1TA3B 3QHNA 3UCQA 2VZVA 3T0BA 3W26A 1OINA 3VSUA 3MANA 2CKRA 4AZIA 2WAGA 4CKQA 1UH3A 3D52A 1SMDA 1WCGA 2CBVA 3AXXA 3G6LA 4D71A 1D7FA 4LQ1A 1V6XA 3WDIA 5A6JA 1QI2A 5DMYA 5CSYA 4F9DA 1JZ7A 3WQVA 1V6WA 1W1PA 5EFDA 3E1F1 1TQVA 4RE3A 2XTKA 1E1FA 3POHA 3WD2A 1PBGA 5HNNA 3S2CA 2XWEA 1H11A 3KE0A 5I6SA 2FGZA 4MAZA 4LYQA 2WBGA 1T0OA 5A6BA 3LPPA 4WKHA 2VTFA 1XH1A 3N04A 5GNZA 2YDRA 5CPQA 3WF3A 4JFTA 1HXJA 2J7FA 2OYKA 3K8LA 2PF0A 2NT0A 3WL0A 3U5UA 1EOKA 1UD8A 3BAXA 1UR8A 2V5CA 4CVUA 3EMCA 2WWDA 2IXVA 5CG0A 1B2YA 3WEMA 3W6LA 2BXZA 4W7UA 3OGSA 1JNDA 1DWAM 2YBUA 3A4XA 3WD1A 3N1AA 1H2JA 3MV11 2VL4A 3WIJA 4KRUA 1CGWA 3BUDA 1VENA 4D1IA 2QF8A 3WENA 4FNUA 4Z2LA 2QPUA 2VZTA 5C71A 1DP0A 3VGBA 2FH8A 4PMZA 4W85A 1ZB5A 1GOIA 3U7BA 3L4YA 2PC8A 2X8RA 2XIIA 3WQWA 2DSZA 3WH8A 2F61A 2QV4A 4H41A 3IJ7A 3GXFA 4CCCA 4PMQA 2XN2A 1UASA 4N42A 1KXTA 3GXPA 1PX4A 4J3SA 2WANA 1BYCA 5DFAA 4OKDA 3J7HA 2XM1A 4PTXA 3LRKA 3PHAA 4MB4A 4UOJA 3WH7A 3BUQA 3VD4A 1CGTA 3ZR5A 2YDSA 1JF5A 2VOTA 4BZYA 3GXMA 3VU2A 4M24A 5CPTA 5AY7A 4E4PA 4AIEA 1ZJBA 3VO0A 3ZJ6A 3U5YA 4D6GA 1OSEA 3EJRA 3AZSA 2ZIDA 4P7NA 2WLYA 1R7OA 3AIEA 2ZWYA 1E5JA 3BCFA 2WCSA 2ZXQA 4QCFA 4E8DA 2DEPA 6CGTA 2C0HA 3VSTA 1AMYA 3AJ7A 3L2MA 1EDGA 4GQQA 2D0HA 4GI6A 5BXTA 4NZJA 3TTSA 1PX8A 3W53A 4M1RA 1BTCA 4J3XA 3GBEA 3W29A 3GH4A 2V38A 3BGAA 1B90A 3BAJA 3AHTA 3K4DA 3WH9A 1JL8A 3B8SA 3W4RA 2V5DA 2G3MA 1SMAA 1E3XA 3DDFA 2ZICA 4JFVA 3WNKA 5ABGA 4W7WA 1W3JA 4W8AA 2CYGA 3PZTA 1TVPA 4AD1A 2BHYA 1A47A 2J62A 4PCTA 3WEZA 1MQQA 4UOZA 1QW8A 1H0GA 1QHZA 3VD3A 3OZOA 4HZ6A 4UZSA 4KGLA 3FN9A 2JEQA 2XG9A 4F8XA 1WZKA 1XRVA 4AW7A 3WUGA 1VIWA 2WBKA 2WPGA 1S46A 5FL1A 1R87A 2GSJA 1GQJA 4UQAA 4XB3A 1LG1A 1QHOA 4AZ5A 5IHRA 1B3VA 4HTYA 3WEOA 1UA3A 3K8MA 3OLGA 2D1ZA 1KBKA 2XM2A 2IUZA 2EO7A 1E55A 1V3KA 3MU7A 4P7LA 1JD9A 2TAAA 4CD6A 1RP8A 3BAKA 3K1DA 4TTUA 3D51A 3AMGA 4ACZA 1PIGA 1E5NA 1JFXA 1TQSA 1LWJA 2BY3A 2YBTA 2VQTA 3N9KA 3RDKA 3F4VA 4DWSD 2VX7A 3HMCA 2OYMA 3W37A 3AZRA 4H8VA 3BVTA 3FHAA 3ARYA 1KR0A 4PMVA 1OWQA 3QHMA 3GNPA 5CGTA 2WMKA 1E3ZA 3F5LA 1MWOA 4WLCA 3RIKA 3HZ3A 1UKQA 4EE9A 3CZNA 1UKSA 1J0HA 1V0MA 2B31A 2J8GA 4BA0A 3N17A 2VI0A 2EAEA 2OLHA 4UQEA 3M46A 2F18A 1EIBA 1ODZA 1VFMA 3UG5A 1UWSA 3PZVA 4PMXA 5TD4A 1NH6A 3SUTA 1QWNA 1KQZA 4PMNA 1C8XA 3CC1A 2F7OA 2AAAA 4WSJA 2V3DA 3GNRA 3ZQ9A 2JEPA 3WY1A 4GO8A 1TR1A 2QMKA 5I79A 1CXHA 1W3LA 1MVYA 3II1A 1GUVA 5D9NA 3H53A 1OT2A 4ML4A 5A6KA 2VX4A 4DUXA 1VEMA 2YJQA 5A6MA 5KEZA 1HP5A 3GXNA 2Y5EA 3WF1A 2E0PA 1BYBA 4JFSA 1DTUA 1TFVA 3JUGA 1PZ2A 1GONA 3SCQA 4PRWA 3A3HA 5LA2A 3ZO9A 2EADA 3A22A 1JF6A 3NSXA 4MADA 1OT1A 5D8WA 2D3NA 4GPNA 5DF0A 1UD6A 3PZOA 3DX1A 3NUKA 3BUIA 4PYSA 2WZHA 1JDDA 4LYRA 4NZCA 1E40A 2F7QA 1V6UA 4BQ2A 1M04A 1W9BM 2OSWA 1BQCA 3DC0A 3B9DA 2DQXA 2VRJA 2XPKA 3CHFA 3PTMA 3ZM8A 5A94A 3EJTA 1DWGM 4PBGA 5E6ZA 2WMJA 5D9OA 2WK2A 3VDHA 2UY5A 1CPUA 3SCPA 3VD7A 2WMGA 4CD7A 5M5DA 4KWUA 6A3HA 4KMQA 5CGMA 5AYBA 1TQWA 4H2CA 3BUPA 1MXGA 1TA3A 4WF7A 5A6AA 1W1VA 1XH0A 4AMXA 1QPKA 4Y7EA 2AOSA 2PWFA 4J3VA 3THDA 1XYZA 4CU7A 4R27A 3SCNA 4OBSA 5FOOA 3WUEA 1GVIA 2VZOA 1QNRA 3QOMA 1GZJA 3RO8A 5JBDA 4ZFMA 2YFOA 4AYSA 2WMIB 5GQBA 2V3FA 3B9EA 4QAWA 1AQ0A 2Y24A 1QX1A 2X0YA 1VJSA 5JUVA 5D9MA 2X09A 2DIJA 3TV8A 1GOWA 2JIWA 4RL3A 3W0KA 2D73A 3ARSA 2D20A 1O6IA 1EGZA
chains in the Genus database with same CATH superfamily
1TPUA 2VWEE 5H1WA 1NPNA 1V7NH 2J20A 1L2UA 1AHWB 5CWSA 1KLUB 3TBSA 4ZENA 4MZ1A 2VMFA 3DXAA 4G9FE 2ICEC 2OYPA 4MLIA 3Q8FA 2VGGA 4MGXA 1V03A 2QF7A 4ADGA 1WK0A 4UTWA 2VR5A 4YHML 5DCCA 1ZANH 2WXOA 1R9ZA 3FKRA 5FJRA 5MENE 4WI0A 2VN5A 3B0UX 3FT3A 3J07A 2EEXA 2CSPA 2ODHA 4P4RB 3GFZA 1WOBA 3JYBA 1FNSH 2QZQA 5D96C 3KNBB 1IKFH 4WNQB 1QO2A 3D85B 4MHHG 1V7MH 2QDDA 2V8MA 3AU6A 3ERPA 4OU3A 3EX3A 1X96A 3UWEA 3HE7D 2YD7A 1NDTA 5MI0C 5A16B 4A3UA 3GFXA 5JLZA 1MW0A 1BIIB 1N0XL 2IANA 5AD0A 1G9MH 2ED9A 4JQXC 3VFVB 1BKHA 3QI9B 4G7VH 4JPKH 4KOBA 2IQ9H 4EWND 4NWTL 3O3UN 3QQ3B 3EB4A 3M0HA 3ECVA 4KMTL 4MBRA 1T5XB 2QJJA 2VZ3A 4JG0L 5FAAA 1YX1A 3GIYA 2GDVA 4XWOC 3TBYB 4F1ZA 2OMWB 3B6SA 3HBZA 1M7UA 4PWHA 4PJCF 2FB2A 4LW7A 1E0UA 1DBML 2Q71A 1KCSH 3LHPL 3WS3A 3ZE0E 1A0EA 5KSBB 3N1GC 3F03K 4ZXOA 3GO1L 1TTGA 4GZ7A 1VGEL 3KM2A 3IUIA 1RJRA 4MQSB 1AR2A 1G6RH 4X7DC 4N1CA 5KVDH 1LE9A 3EEZA 2CRZA 4O2CB 4NF7A 1NBVH 1LO2H 3O4OC 2FECI 3EBAA 1U3ZA 1ICQA 3OKOA 3ESMA 4B0MM 5JPMB 3LZ5A 1WTLA 5ICYA 5CZJA 5KYUA 3ECBA 4YYFA 4YAQA 2OZTA 4UOW1 2RH9A 4JQAA 4XO6A 1GOOA 4XIAA 3EOOA 3QDGD 2ZWSA 4PJHA 5DTFA 2KX9A 3COOA 1J8HE 2VLRD 3ATFA 3HNTL 1KT2B 4ENLA 4N25A 4BQCA 5IR1B 4QRUA 3K0WA 1UM4H 4KX7A 2GITA 4JZOB 1F41A 4NQEB 3HZVA 3VACA 4K3EL 1A22B 2J7BA 4OJFL 3CBJB 4P2VA 4Q8TA 4QG8A 5BS0B 1CL7I 3U46B 5LHDA 3BJTA 3IFOA 2Z4TA 3UPRB 4Z3TA 1RAMA 2VHLA 2WHJA 3SUUA 4WD0A 4NZRH 4KX9A 5CEYA 3FQUA 3MLWH 2PPFA 5SWQB 1BMGA 1LK2A 3LRSB 3OPUA 1GY1A 2X6MA 3HW7A 4HLZG 1V3MA 1RCXB 1G0YR 4MXQC 5TBOA 4WI2A 4JLRA 1ZIAA 1Z9SB 3QORA 4K1WA 1X1ZA 1SLWA 1PE1A 4LSVH 3ZIZA 5A6SA 5F3FA 3IRCA 4PJDB 3U82B 1KDIA 3GWJA 3DVGA 5CXPA 1F73A 1EZVY 3Q2VA 3VFNA 4D0CB 1JYVA 1O1HA 4TLTA 4K5PA 5IBUB 3IAGC 4A67A 1U8KB 4UM9B 1E4MM 2I60L 2NUXA 4RQQB 3W27A 4B3ZA 2ZKWA 2I85A 4GIAA 1NSJA 4A7TA 4B53A 1TPB1 4OI9A 2BVWA 3QK0A 4YSTA 3QFJD 4N85A 1C9WA 2HVMA 1T1XA 1AIFA 1Q6EA 3PBWA 1GR7A 2R29L 2Y6SC 3EJYD 1YIXA 1U3YA 4O4WA 3W2LA 3HS0C 1DO5A 4ANXA 3MC0A 2TYSA 4IP4A 2E27H 3PULA 4BQ8A 4GUIA 1I3UA 4WV1A 1I3RB 4MNQD 1RZMA 2FYVA 1MLCA 1G7QB 1MUWA 2R0KL 4WFHE 3LBCA 3WLHA 3VFTA 3MI3A 2VR7A 2J77A 4F79A 4PRIE 5MEQA 1PZ3A 2NY0B 2CLMA 4I9XA 3GO2A 3NESA 1GQKA 2FFCA 3Q2DA 3RKDC 3IAQA 3TAOA 3PJWA 3QWOB 5AOZA 3LYEA 4LBSA 4OQTL 4IQJA 5JDSB 2ISVA 2Q8BH 1PNCA 1R24B 3T1FA 1DQWA 1K2DA 3R18A 3SYOA 3BZEA 2HFFA 5TE6L 2BMBA 1BXCA 4C7DA 4LCWB 3W38A 3RBSA 4HISA 4WGWB 2ZXGA 3SKMB 1R3KA 4Z7UB 1K6QL 4PY8I 3W1RA 2ARJA 5DR5H 4B5NA 2FO4B 4ZA0A 4XNAA 4YHIB 4I8YA 3B0VC 5GPRA 1R3SA 4PRHD 5L2KE 1RH9A 1BF8A 3AHYA 2XTJE 4YDJB 1XGYL 1G9NH 2ADFL 4F7CA 1ZLUK 4KRNA 4JFQA 4UT9L 5E8NB 5CSZB 1T1YB 4PEEA 4Q56A 2ACRA 4JDTL 5E9NA 4Q6XA 1U6AL 1IL1A 2ITEA 1B0WA 4AIZA 1AE6L 2DQFA 3BZDA 1UATA 2PDXA 4UNLA 5CWSB 4JMNA 1SHSA 4XCCH 2HISA 2B3RA 1KYFA 5GIRA 3WFCH 1FH8A 1P2CA 3INPA 2GGHA 4RAVB 2AVGA 3TOYA 3EA3A 4RMSA 2ZRXA 2JK5A 2NQLA 4R33A 4TQTA 4DB7A 1PTAA 3ARWA 3LB6C 1V27A 2P10A 1DVQA 2J74A 3PY2A 3T40A 3DX4A 3IDXL 3HAEG 1FBIL 3QEQD 2Z93B 3NEEA 1X7IA 2OSYA 4PJHE 4WI0B 1NMCC 5FYJD 5HHXH 4WOZA 3VIFA 3LMJH 3OGCA 5AYQA 4AENB 5CM1A 5D37A 5E6YA 1SY6L 1EO5A 5DU7A 4ZX5A 1HP4A 3LN3A 1N5AB 3PK7A 3QJQB 3HQNA 2NVDA 4JHBA 3MODL 5I0DA 4ORIA 2ESCA 4LY4A 4HN8A 3CX2A 4P2RE 3DURB 3MA7A 1E15A 3UGUA 2XKNA 4RMUA 2NY4C 3LXBA 4FAAB 1MREH 2YQ3A 1XIWB 5DMJB 2HBVA 4Q4MA 2VZUA 4JG9A 2E1DA 5F2MA 3CXOA 3QY8A 5TDOA 5HBFA 5HYJB 2VIRA 3TYGL 1P0KA 2GHZA 4FERA 1FC1A 1LJMA 1YMME 3HBQA 4Q2ZB 3MJ7A 2FB3A 3P3UA 3B8UA 1EA9C 3KLLA 2WLLA 2ATMA 3DI0A 5EORL 4RUBA 3W2KA 5AC4A 5A69A 3K30A 4JANA 1OFRA 2NX5E 4QNEA 1Z9MA 2R8WA 2A3CA 1J48A 4I0PD 1CD9B 3JUZA 5I1KH 1D5BB 2YBRA 3O2DL 3RLVA 3WQOA 4DN3H 1MG2C 3IFPA 2C3ZA 4C47A 4KRTA 3BH9A 4AY1A 2AXFA 2JIXA 1SJHB 3PBYA 1E6ZA 2DWEA 5TDNA 3I7QA 3NQ7A 3ZR4A 4NQCD 1PKQE 2ITCA 4GQ0A 4OIAA 2DEYX 4OF0A 2VW7A 4YUEH 2BVQB 1TZ9A 4AVNA 1EJWC 3ECBB 3HC2A 2JWYA 5I0VA 2V30A 3VIPA 4PRDA 5TNVA 3MYJB 3T0TA 1B9ZA 2DPKA 1X7SA 1MLBA 5AKTA 1SNRA 5KITA 3HMXL 1I1CA 2OSXA 1E2ZA 1FP5A 4LLVA 5CILH 3ZKQD 4HUVB 2BGQA 1SHXA 3BLKA 1NGPH 4KROB 5ID1A 2JI1A 4GG6A 4GH1A 5I28A 1XLIA 4MCMA 3JV6A 4M6AA 2E3ZA 1GOFA 3CXFA 3VUAA 2X0UA 3LNFA 3P02A 1AS8A 1IC0A 3ARBC 2F7PA 3KLKA 1EAQA 3TIEA 2DWXA 4EUPH 3WTUA 4LGSB 3O3DA 4YXHH 4ERIA 1IC5L 2ZYRA 2QPSA 3QUZD 1XUZA 5M17A 3DOHA 3VVGA 1A6UL 1LK2B 3FJNA 3V4UL 3ONCA 3SPCA 3EKLA 3SCSA 3AW5A 1WFUA 1XGEA 2PDNA 1M05A 5EA9A 4K7PH 2EEFA 3W0WD 3OKDA 5K1JA 2VDLL 1L6YA 5TAOA 4F9JA 3EYSL 3V0IA 4NO5B 3WKQA 2WZEA 3MO4A 3I02B 4TL4A 3P11H 5KBMA 3WFCL 1U1UA 3WTVA 1WWBX 4WNSA 3CSPA 2XV3A 2Z2BA 4NRXA 3SDCA 2EGZA 2VFHA 5HYQB 1TCDA 5DEFB 4ZW8A 4PJ8C 3FCGA 1R1CA 2D03H 7ENLA 2XWBB 4U1MA 4PGJA 1XBZA 1G7MB 1KBGH 5ACLA 2AVFA 2PABA 2Y61A 4HA0A 4HZ8A 5IFAL 3IGFA 3LS4L 5EN2A 5HYSA 5CEZD 1WBZB 4NPKA 4DSYA 1ZTXH 5C0RH 1LRNA 1DSFH 2I16A 3K74B 1PSCA 2V6HA 1HJBC 5D9PA 3QI9C 1P5UB 1IGCL 1EXHA 3W1UA 1JZ3A 1P9MC 3D3VB 4ALAH 2KZ1B 1FIGL 2EEBA 2JELL 2K9FB 3QEHB 4OZGA 3S3DB 4DUWA 3TBTB 4IT1A 1ASPA 3A4WA 4R7JA 4WGXA 2WC4A 3ANYA 4UINL 3T0EC 1PLAA 4FQXC 5HJBA 4R34A 1GOKA 3A21A 5CZKA 1BFNA 2PBGA 2W61A 4OW6A 4OZGF 5GJTH 4CKVX 4Z7QF 1J5OH 3MSYA 5JDSA 5CPOA 4UQCA 1IR1A 5GGUA 2GFTA 4WNJA 4QLJA 3NFPB 5EOQL 3AS1A 2Z31B 3GXDA 1WCBA 5EO0B 1K9EA 1E30A 2CLVB 2MPVA 3U7YL 3VWJB 1R3KB 3BKJL 1QO5A 3B40A 5GGQH 4GW1B 4JM2C 1UM6H 4U0RB 3E6EA 3BKYH 3GEFA 4GIPD 4E36A 2AJXL 5E56A 4YHIA 3B4NA 3EZ4A 1HOCB 3MMWA 4S39A 5DXXA 1VCVA 1OLLA 3T8VA 3M1ZA 1AQKH 4X5XA 4ZK8A 1GVYA 2ATKB 1RPXA 4IFOA 4O0KA 3HI1A 2PC4A 1XGTA 3VCLA 3QPZA 2CHOA 1MAMH 4LBUA 3PCYA 4X0VA 4G9FD 2A3AA 2B8OT 4KI5C 1JGVL 3HJ0A 5D7LE 3QO1A 3KDPB 4L37A 5DEGB 3RILA 1XSKA 3DPBA 3UYOD 4AZUA 1HJUA 2QCFA 1MF2H 4NWTH 2PP0A 1JZ2A 3KVMA 4IRJD 4O02L 1L0QA 2K0RA 5J3HC 1E4XH 4PJ7F 1GHFL 2R9HC 2JK5B 3RHWK 5A3ID 1T7LA 3H3PH 1Q66A 3LQZA 3USBA 1U4EA 5IV2A 1YADA 2ZX9A 4A68A 1YEDA 1LUCA 3C8NA 1C08A 1R0AL 1OCJA 4CC4C 1X4XA 2J88A 3H2CA 4TQEL 4Y96A 5EU9A 3FB7A 3M7SA 3QWRD 2DW5A 3BVXA 5SWSD 1DWHM 2IQ0A 4TOQA 5KVFL 1JPKA 4WY0F 3S2MA 2HPMA 1WKEA 1YDPB 3RGVB 4Q6JA 3RWEB 5EA0H 2A3LA 3T0DA 2XY1A 1ZGLM 1I1AD 2CK0H 1W3NA 4PTTA 4KNUA 2LLLA 3UCDA 2OL3L 4M51A 5IB2B 4FA3A 1HIML 1F86A 2GSIB 3D0VB 3P4OB 4GBXD 4HKJA 5IMMB 5J89A 1QZ1A 2GBTA 4KXBA 1EHXA 4YXLH 1B3OA 2CR6A 1XYBA 3GKZA 2J7DA 3KPMA 3TR9A 3S88H 1NMBH 2CLFA 1TX0A 4JYEA 4DEPB 4AD4A 3ECQA 3W7LA 4CEXC 5BMXA 3KPRB 4M82A 3IS0X 5C0GA 5CD3B 3CSBA 3U7WH 5I1LB 1NIFA 1NFGA 3K2UH 5IF0B 1BLNB 2A9AA 2WLLB 2ZWKA 3F7VB 3LLXA 3DFYA 2CLIA 4MB5A 3T3MF 4GA8A 4U2YA 4LLQA 1R7AA 1JMXA 3LNIA 1BXVA 2QR0A 1PG7W 3PIQB 1W6WA 4U7KA 4X9FA 2DWYA 4IU3B 1S7VB 4LU0A 5C55A 1P53A 4AQ8C 3OJ2C 2DWEB 5TDNB 3QKEA 5JMOC 1Z0NA 2HJFB 3DLQR 3KRSA 3PP3H 3MODH 2G3NA 3NIDE 4G9FA 3F85A 4ZEPA 2D3JA 1KTCA 3EYUH 2BVQA 1M71B 5I3JA 3Q0HA 1NGQH 1SDAB 4QTFA 2VN7A 5SV4A 4I8DA 4GKOA 3U1QA 4UM8B 2OMVA 4KKLC 4MMZC 4RRPM 4KETA 1YY9C 3S96B 1OGGA 4V27A 3C6SA 4JGJA 1GH7A 4I77H 2Z7UA 5IHZA 4HQVA 5I1HH 3TX9A 1WGOA 2NUPA 4L9DA 3X3GL 1PQZB 3ZWTA 2HZGA 3LN5A 3NPVA 1UM6L 4AX7A 2OL3A 3L5HA 5E6IB 1KPVA 5K59F 3GIVB 1KACB 1GQLA 1XSJA 1I1XA 1OD8A 3QPKA 4TX9A 3NJLA 2C7UB 4JW3A 3TN3A 3V0AC 2OLSA 5L0QB 4ZZFA 3STLA 5C0FB 2XVKA 2BSSA 4EOWL 4OJEH 5L9FA 2PWHA 2WQUA 3PL6B 1UUQA 4Z7AA 4HCFA 4IK6A 4IBUA 2AKRB 1B3XA 5C07D 1FZKB 3LH2H 1XG3A 3URQA 1C8VA 4H1LA 3SSJA 2CO1A 4Z77A 3ZDXE 4Q6YA 2ED7A 3JZ7A 3KG5A 4LARL 3V6OC 4HBQA 3DHDA 4DX3A 4N2FA 4XX1E 5E1GA 5A8MA 1BQHA 4BFJA 3AYRA 4P5UA 3AIRA 1JGUH 2YRZA 1HYSC 1H5VA 2Q8BL 2W9MA 1WC7A 4IU2A 2JKXA 1ZS8A 4BFEA 1FAKT 3OYZA 1IAII 2O6EA 4K9EH 1HQ4B 3S35L 3FPXA 4NZTL 3PJSA 4Y5YC 4MKNA 1TV4A 3IGSA 2HTLD 3FZUC 2UUDK 4L6OA 1Q0EA 2L7JA 5EEXA 1UZGA 1ZIBA 3L3KA 3G5YA 4UR8A 3M1CA 2IBBA 1GOMA 1S3KL 3W00A 2OX1A 1VADA 1OD0A 4JEJA 1UD3A 5BXSA 5D09A 1OKEA 1N5YH 3EMQA 4DJEA 2VDQB 3SDAD 4QEEA 4GP5B 4WKFA 2EPLX 1DVFC 3M6DA 5DURD 1O95A 3MJ9A 4AMWA 1R6WA 5EU4A 1J0YA 1WWWX 1OP5K 1IV8A 3F00A 3GUGA 2DP3A 1FFPA 1OV8A 1R19A 4HXBH 3N85H 4EI5D 1EDHA 3F4NA 3U0WH 4LEFA 2X5PA 5ECUA 3UTQB 5MEOB 4MHBA 2QGEA 1SJMA 4PY7A 1ADWA 4AJVA 4FRWA 3R8QA 1AQDA 3MBWB 2PETA 4JRLA 5EOCL 1M3IA 3APGA 2NQCA 3RCYA 1E65A 1UZ8B 4IOSA 1LL1A 3HAEH 2XH0A 4FFYH 4ZX3A 3CT7A 1JNEA 5C07A 4DT2A 4I7VA 1CICA 4RAUB 3BPOC 2B0SH 3C56A 3NQFA 1Q6LA 5E9XA 1HSBB 1LO4L 3QXTA 4LHUB 2DOCA 5AWNH 3WFHB 1HINH 2HE8A 1L6WA 3MFGB 2VFIA 4PS3A 3HUJE 4H8WL 4IPPA 5L4FA 3QFGA 1MQRA 3PBMA 3RR4A 2OTPA 3KYNA 4P3CH 1B30A 1E6NA 1XLGA 2JCWA 3FT0A 3ARDC 3IGXA 1PWLA 5L6YL 2JQXA 5JPNA 3LZPA 4ZW6A 4M6VA 1U30A 1NAKH 4D9QD 1BBJA 5JR1L 4R7NB 2LFEA 4L3EE 4XAWL 5DRNA 4GUJA 5G1TA 4UIMA 4S1RL 1KFAL 1OSZB 1GW1A 5HY9B 5I1GH 2BP1A 1GGBH 5A8PA 4Y1SA 5J6GB 3AHVA 1C08B 3LZ3A 5BXFA 5DWPA 3U6RB 2PDIA 3ITOA 4Z7VF 4L6HA 4DM2A 1G7HA 3GTFA 3XINA 4HOXA 2VXSH 1KM6A 1VFFA 3CL7A 1JHTB 4IJRA 2YXOA 3DC8A 1FL3A 1LEIB 1XQKA 2WSRA 3FEMA 3HR5B 4NXKA 3O8XA 1RA5A 4DOHE 3OGVA 1ACXA 1ZRQA 2I17A 3WOVA 1YLBB 2YMTA 4JKMA 4EVNA 3MMEB 3TO2B 1Q6DA 3NAVA 2IANE 5C0DA 3KPSA 5AHLA 3CU7A 4GJ1A 3VZYA 3UAJD 4L5FH 2AFNA 3Q1SL 3LKPB 3LZLA 1HE7A 5FO2A 2AQ2A 4ZOBA 4LRSA 4AC1X 5DD0H 4NAJA 4GUCA 3MDWA 3SBFA 3Q5YA 4JHUA 1O5KA 2QKIB 1MSPA 1WB0A 4YVVA 1OWWA 4H1LH 4O13A 4KQ3H 3TYZA 4KDVA 5DRXB 5IEKB 4AD0A 4IMFA 2J5WA 5AVVB 3S42A 2WXGA 1DJZA 3AXMA 2I5QA 4LSRH 1C16A 3EDDA 3WEBA 3S3GA 4YDMA 2JE8A 5H2BA 2NTFB 4YTQA 2PDLA 2UZ9A 2X9WA 5I76B 3RU6A 5AZEL 4U1HB 4QOKB 2VMEA 4PJ7A 5IVXE 2REQA 1IFRA 3LSBA 1AHKA 2AK4A 4JY4A 5AYUH 3CQJA 1CURA 4FYTA 1ONRA 1TWIA 5DY3A 1FFNA 3WDRA 4DHGA 3G2GA 1JK8B 4M29A 3H9SE 1IAIH 1W0VB 3CVDA 4XNXL 3PBUA 3SQLA 4AZBA 4JRYD 4TVCA 5BRBA 5FK9A 2GJLA 5C5YA 2F5BL 4XPGL 4V28A 4MAYD 2XFXA 4XG1A 1KBLA 5FYJH 3P81A 5JIWA 2BNJA 4GSQA 5AW7B 3ZL4L 5FJIA 4BI6A 4J2QA 2XWTA 5GGSB 1L8PA 5IVNA 2DQGL 3H2FA 3TQPA 2P42B 2RFXA 5KS9E 1P1XA 3DYMA 2X42A 3K3QA 4JG1H 2OL3B 3BVVA 1EYEA 1AHMA 1UQZA 2DT2A 3QRHA 2XT1B 4HCDA 4UMBA 1KTDB 3O0RL 5E99L 4QITA 1U93B 3O6CA 4LYPA 2F8VA 1AGDB 1RR2A 5LBVA 3EMZA 3HI5L 1B9BA 3QS2A 2XIQA 5TGBA 1IT8A 2Q2EB 4OV4A 2N7AA 4GW5A 4PRPD 2MCG1 1E6SM 3PL6A 5JXAL 4R7DB 1MJ7H 3PFUA 4DHLA 1RZ7H 4KKCD 3QQNA 3TESA 2BNRB 1CE6B 5D7HA 3BFOA 4A7UA 3WBEA 4WTWA 1L6ZA 5IMKA 3SQBA 4XXCA 1KBBA 5CGYC 4OVVA 4F0MA 1OTTC 1TIWA 2C13A 1I1RA 5JW4N 3FKKA 3FK4A 1MFDH 1TIUA 5H91A 4C5YA 3WXVH 4C1NB 2D7TL 2KZWA 2R2EA 4ZOAA 4JX5A 3TYDA 4BKNA 5ABFA 3HHSB 4Q7NA 1FCBA 3LN4A 4HYRA 4X50A 4NKMB 2GIYA 4F3FB 4JBSA 5IB4A 1NCDH 4ANKA 3HQOA 4I48A 2CU9A 1HQ4A 2VXSL 4M5TA 3V0GA 5LXGL 2UV3A 4M80A 3W1XA 3BK0A 5I2UA 3R4IA 4HIBA 4WGHA 3TCXA 2WVSA 2XETA 2YD5A 1OGAA 2O4QA 3TW6A 3S4TA 2G37A 3O2DH 5B3SB 1EOMA 3VGDA 4YGAB 1MCEA 2DRUA 4DAGH 1QFUH 3XISA 1BG9A 3PGFL 3X2QB 3O3AA 4FQ1H 4XE5B 1ZUAX 2EXYD 2WWKO 1V6YA 1V0NA 2W07B 1GCYA 1QTWA 1AH4A 2V5LA 3UNDA 3W25A 4B5WA 1WISA 4GXUN 2LW3A 1TJIH 4MYWB 4UFJA 2G50A 1EX5A 4OZGE 1GKEA 2F1BA 5A2CA 1ELSA 4OOZA 5B3NA 3G6AA 4MXQD 1IEVA 5HAOA 4WJKB 5C8BB 1D3CA 5CG0A 2WQXA 1O5PA 1MVUA 1RXLA 1TPDA 4MMYA 2XZCL 1DN2A 2WVVA 4CUCA 4H6EA 4YIQA 3FQTB 2ZCHL 1XFPA 4DGYL 2QVMA 4J3OG 3UR7A 1T6BX 3RA7H 2Y7DA 3CUGA 3EB3A 5DVPA 3PZIA 4ZQRA 2DT1A 4JIPA 4PUWA 3VFUB 4H9MA 1CLZH 3UBXI 2VEGA 3V36A 3CUXA 4CNOA 3VRIA 3GM8A 4XOCA 2C19A 1K6QH 4U0QB 3TXAA 2JB6A 2HLFD 4QXTB 4KDWA 3RWIB 3FCSA 1V5JA 5I03A 1AZRA 2DSKA 1BOGB 1VPOL 5J11C 1U8QB 1CFTB 1HNYA 3W01A 4EI5C 3FFDB 1Z6KA 3F4WA 3ZL4H 1UR1A 1PL3A 4MY9A 2AQ1A 1N8IA 3S2JA 2VZSA 3F2DA 4OB5L 2VDRL 2DVTA 2NY2C 5IBTL 4AQEB 4PJ7E 3UZWA 2PR4H 2O5YH 3GMMB 3U2SA 1W37A 4LS2A 2BOBA 4D2JA 4AL8C 1NP0A 1NGZA 2I9TA 5BRZB 1P4BL 5GGTA 5EZOH 4F8LA 3V4PB 3CN3A 1FUNA 3BI9X 4PP2B 1OSZA 1JRHH 3CZFA 1HILA 4QHLA 5HI5C 4A6YL 5JDJA 1RK6A 3SN6N 4ZE4A 5F7NC 1KC7A 2PDMA 2WLJA 4HUUA 1DBAH 1JG9A 3IN0A 3UEZA 2I9LA 1AD0B 2YSSB 1SMOA 1G01A 3F5WA 1G7HB 1GGIL 1TB3A 4PW9A 3C61A 3Q94A 3W02A 4LVFA 4L4VB 5KOMC 3UYRH 5KTEH 1A3WA 4C90A 1JCLA 3ISIX 1V05A 2ZC1A 1N82A 5HI5D 3KPSE 5IB3B 3RL2A 3S1VA 3L4UA 4LFHG 1RSYA 1S7XB 3PG2A 4FQIL 5D72H 3BVNB 4EVNB 1MXSA 2PDPA 1K4CB 1NA8A 2WHLA 4GRLD 4XD6A 2YRPA 1LMIA 4OT1L 2OKOA 2FUTA 1PD1A 2A9CA 5CINL 4LLYA 2H32A 4H20H 2FIKA 3UO1H 4A8NA 3R7QA 2WXLA 1S5IL 1S5WA 3QULB 5E1IA 1TZIB 2BHUA 4RV3A 2DEXX 5FL0A 1IBGH 2HT4D 1WDSA 5EFFA 2ALWA 3NSMA 4C6OA 4HWEL 4IBLT 2PURA 4OCLC 4ZDHB 1Y65A 1AR1C 3QY6A 1CDUA 1TF4A 3L5LA 3M0JA 3CWOX 4ABQA 2VLKB 4ZPVA 4JEGB 2ZUTA 3UR5A 2XA8H 4M7KL 1H7NA 2Y7SA 1OO2A 2HNEA 4FIRA 4UBDD 2Y8VA 3CM4A 3Q67A 4AV4A 4GQRA 3KZPA 5C2CA 1ZAJA 2OQJB 3JBG7 5FK9B 1OSYA 4OZIB 2V4LA 4L61A 2JKSA 5IVZA 1FVDA 4Z78B 3PTKA 4HGWB 4JFZL 2JKAA 4Y9BA 2XZCH 1Y1DA 1BIIA 4Z0BH 3W70A 3SCMD 3P84A 1YECL 2XWTB 2ZCHH 5GGSA 1MJ8L 4G8FA 4DGYH 1OFAA 2F19L 4AVFA 1T83A 2VX5A 4PV9B 3HMXH 4PRAA 3PXHA 2XKUA 5EMUA 3BPOB 2DDXA 3KWSA 1HKVA 1F6LL 4Z8FH 4D8OA 4MJMA 4S38A 4MNHB 4NQCA 5DD6B 4KIEA 3ALGA 5K3VA 3MLSH 2ABBA 2FWSA 4EJ1C 1TVBB 4ERSL 1B3WA 1WSST 2Q01A 2Y07L 4TR9A 3ZIMA 1JAKA 1TV7A 5B1AB 3AQXA 1AZUA 3P40A 1XYAA 3J8F7 4AD5A 3BD5A 3OB0H 4F57H 1O1ZA 1A7QL 2DQIL 1POJA 2G4FA 1JWUB 4XVJL 3ZDXF 1OHQA 2J7CA 1SM9A 4QJ4B 3NCJL 1NCUA 1LE9B 3QC0A 2OL3H 4DW2H 5DRZA 3IDGA 2HX8A 1GPWA 3VTRA 4A2SA 3C5XA 2DM2A 4C1NA 5DMMA 1NCBH 3HHMA 3HLAB 4FHBD 1F0LA 3TBWA 4PJHB 3FOLB 5DTFB 4TVUA 3Q06A 3RWCA 4R96B 1IEBB 5I23A 1MJJA 4B3KA 3MV7E 1EPVA 3UWVA 4ELMF 3TWBA 3DI3B 5JIMA 4CMHC 4KEMA 3O05A 4N02A 4MJ2A 1YPFA 3UTOA 3ZUCA 1F4WH 4Z08A 5I66B 3TEWA 5B7YA 4JRFA 5CBEA 1A5MC 1MY7A 4TM9A 4WHCA 4G8TA 3H4GA 4DEWA 3M43A 3RFZB 1CO1A 2J6EA 3O3AB 1TLKA 3EXTA 3NRPA 4IOFC 1UM5H 4MJID 3V6ZA 1Q6GA 3ATZA 4PYHA 3QIWC 3ZZSA 5CR1A 2PP3A 2NX3A 1YQ2A 3CHVA 3MKGA 3VW3L 2AV7A 1ORQA 4LBEB 1UJTA 4GGHA 1J5CA 1S2UA 5DN1A 1AIZA 1UFGA 5CU9A 1Y07A 2MUCA 3MMDA 3VFNB 1XR8B 4D0CA 2HH0L 5IIEB 4J40A 3S83A 2WTPA 4CEUC 2PLKA 2EDRA 1QQDB 5JHDD 4XMLL 3X1FA 3ARBB 3MACH 2DQUL 2E56A 4Q9CA 1LILA 5F2LA 1ZLSL 1DZ0A 5HK4A 4WQOA 3VRIB 1PZSA 2GVYA 1FYTE 1A4MA 5TK2A 3QJOA 1K7EA 2WCAA 3U1PA 2O92A 4XISA 4J8RA 3E2RA 5CMAA 3LMZA 3HUJF 3IDNB 2H45A 1QSFE 2LABA 4G6ML 3PQYA 4OUOA 5DS1A 5AW0B 2OR9L 4XMKL 2WBJD 3G3LA 2FL5A 3GMRB 3PLYA 4PJ9A 2EUZA 4HDIA 3VOJA 3S35X 1K9FA 4UBPC 1AZCA 1ILUA 1K85A 3AUWB 4OD2B 3TA3C 1T0MA 1IBFA 1IGSA 1X38A 2Q02A 4UC5A 3FH5A 1QHQA 3AROA 1IFHL 1XD0A 3Q8BA 4NN7B 2MNWA 1NELA 3FULA 2XNAA 4QRTA 2C15A 4AWEA 4QHUB 3V4PA 3NQEA 3ME0A 1T5AA 4KTYA 1AZVA 4KQ3L 1HILB 3OBAA 4QHLB 3REWA 1U22A 2J66A 4UTBL 1H15B 4MNGE 2CLPA 4ZQCA 1N6VA 4HA3A 3NYKA 1UURA 3W6YA 2AITA 3CN2A 3CZGA 4LJ3A 2DDQL 1LEGB 1NGYA 2BY2A 4PWJA 5I74C 3GU9A 2PMQA 2DGAA 4NQSB 1W8OA 2IWEA 3JWOC 3UP8A 4K68A 3VIIA 5T3XL 1SEQL 1KYUA 5HGHA 4ZMQA 2BFVH 1QSED 4DBEA 3RIAF 3ZDZF 2WTOA 4HJEA 4MWAB 4WGVB 1K4CA 2IJ0C 2UZYA 3L3JA 3T0EB 3PFMA 1A4CA 3GIZL 3QS3A 2VLJA 1J9QA 2X89A 3N9GL 1TX2A 4DYJA 4QAMB 3O4LB 4M6OH 1IL1B 4ZO7A 4L9XA 4KPHL 2HT2D 4PMDA 5IJKC 1UA6L 2A6NA 5E4AA 4BFIA 4KJWC 4PJ8A 3HG1B 4CGTA 1BQ5A 5CF3A 2GVJA 2YRBA 5CEZE 5FDWA 2WYIA 4AC2A 4GCXA 1ZLEA 4QISA 4TVDA 4XUYA 4PS7A 2HE5A 3LLFA 4PS4H 2DORA 3QEUA 3BV7A 3QA3B 2WOQA 4BFAA 1U8IB 2EIEA 2ZZ1A 1HJWA 2Z29A 3GSUB 3EPOA 3I4EA 1MW3A 1SYVB 2KQMA 4D7BA 4XSLA 3SGJC 3E2SA 2KERA 1NOAA 1LO4H 1ZDSA 4BFKA 3GJEA 1IR2A 4TOYL 5I8KH 2E40A 2H3NB 5D2NE 3Q5TA 1K9DA 2QVHA 1JUEA 1US3A 3MV9B 3QQ9C 2XPGB 1NC2A 4UDUA 5DDHB 3SE4A 5ENWA 2QUVA 3VINA 4BF5A 4HGWA 2Q10A 1EXPA 2BOEX 2ZXWB 3UG4A 3QAQA 4A3RA 1KCXA 5JIPA 3H85A 4ISVB 4G8FB 2A74A 3DX6A 4J23A 1HJXA 2Z1BA 3I6LD 1L4IA 3N14A 5HQEA 2IGTA 2ITDB 1AW5A 1E56A 2WHMA 3EAUA 3BN9C 1NCDL 2AZUA 3A6BL 4MZ8A 4BR1A 1NUNB 4H8PA 5F96L 1QMLA 4EOUA 4AY0A 1DJIA 1GWJA 4GYPA 1TVBA 4JD4A 2XWRA 4R3UA 3K6SA 4AWSA 3ARGA 2LU4A 4C7GA 5T5NG 1CI5A 1E9IA 2W80C 5EU5B 5IOPB 5D7JC 2H47C 1HYSD 3IFPB 2YPLB 3RNKA 1MUJB 1CNVA 5EL1A 2BP8A 4N2DA 3HOJA 4U31A 3K71A 1U2YA 3L3IB 3AWNA 3FY1A 2VCOA 3B37A 3CDZB 2QGDA 1NCAL 1ZEAH 2DZVA 3LENA 4R4BA 4AW4A 3ZYOA 1G1CA 3BAYA 4E41D 2IH3B 3M1BA 1MW1A 3T04D 2J7HA 3QCTL 1C5CL 3PWPA 3E0LA 4MTMA 3REVA 4XV0A 3PQYE 4JG0H 3DX3A 1W5NA 3CBKB 3QVAA 3FTZA 2A79A 3P4NB 5BQDA 1F3DH 1KJVA 2DLGA 3LY6A 3DO3A 4B7IA 4K6AA 4GKNB 4WJXA 1I7UB 5IHLB 3ZOAA 4KGJA 1FPTL 1G6VK 1PSKL 4FCHA 4WIWA 4PTDA 5HHNA 2AQ3A 2NXHA 4G43B 3K0YA 4AWJC 4HSQA 3G0XA 2YXVA 1UEMA 1D8WA 2EYSB 4PG9A 3AUOA 2CW6A 3CQ0A 3DHPA 3TC6A 5DX7A 4Q7DA 3NNTA 4QM1A 1S9XA 1NC2D 4HKXA 2FSEA 3ZKSD 3MRMA 3MI2A 5KJ7E 3V4VA 4P48A 3OQ8A 1YAZA 3ATYA 1GC1C 4YLCA 3C0QA 4P23A 4ACYA 1PYWA 1CL7H 2KMWA 3LG3A 5BU9A 4XD5A 4LT7A 3LDBB 3FHQA 3BQ5A 3MRNB 3KRZA 5LA0A 3VDCA 1LL7A 3RL1A 4FLQA 5EBGA 2F7IA 4PHZA 7ODCA 1U8MA 3CFDA 1XW8A 4NHCL 4DZHA 1BFTA 2R2HA 4PVLA 5I1CH 3R12A 3RGBA 4B3EA 1SXCA 3ZDYE 5JH1A 2PCPA 5D4JA 1JXGA 1E6JH 3L3OC 4M5ZL 3SYAA 2DMHA 1RIUH 2XZAH 2DQEH 4FMKA 1RZQA 1KQYA 3QDMB 1DORA 3M5XA 4Q22A 3N44B 2X1WL 1QEWA 3T4AA 3VGFA 4NYLB 5LNRA 4M7ZC 4TNGA 3IDUA 4O00A 4PRIB 4P9MH 4HU8A 2GJ6E 1BVZA 5J3HD 1GJWA 3WJJC 1QSEE 2IDQA 1AUSL 4YSSA 4HP5A 1G5AA 3UWUA 4LT9A 2NY1D 4FNQA 4HIQA 4S2SA 4BXVA 3JTSB 1C91A 5CQ1A 4ZD3L 1NANI 2XN9B 1XMEB 1ZTXE 2XN0A 4OFYA 3KRUA 1XCQB 4LV9A 3T6CA 2J8UB 5FYLE 1A1OB 3FT4A 5F96H 2VISA 5T1MB 2VZ1A 3FSAA 3DXIA 3LEPA 4HKZA 2D3LA 4YZFF 4KK9D 2I26N 3D09A 4NS0A 3M17A 4QHKJ 4YVUA 2R29H 5I1GL 4QS5A 5JUEL 3HFMH 4JKPL 4MNJA 4K71C 3D0LB 3F5KA 1WDRA 1H5BC 1VF5C 2HWZH 4LVNC 4ENED 1NOFA 3T6XA 4A2HA 1TV3A 4IG2A 2LGNA 3QHTC 5HGHB 1QNQA 1OX5A 3L2IA 3SY5A 5I7GA 3K5RA 3FFCD 4HCRH 1HNGA 3K5SA 4C1LA 1AZBA 2OG9A 3PWJA 3VYOA 5IRPA 2VLJB 4AX6A 2NY2D 3IETB 4N68A 4WY0B 2RH0A 5ABEA 1KTLA 3EJPA 3MCLL 3SY0A 3RVVD 5A2IH 1X8CA 4K5MA 4EUPA 4C4KO 1F2JA 4F9LA 1QRNB 4LCCB 1OB1A 3DA0A 4PJ8B 3SUWA 1CYWA 3Q2CA 3QR3A 2CNYA 2P8MB 2ENQA 2OCCB 4W1TA 1QSVA 1EXUB 3VH8A 4GRMA 5FO7A 3FS9A 4BQ5A 1GGUA 4PB5A 1ETA1 3QJFA 4J1UB 2OXGA 3D4GA 2CGRH 2QQ6A 3V0UA 3DV4B 4I9WE 3LB0A 4N0UA 5L0QC 4QRPA 1ODAA 4EMZA 2LU7A 2WLHA 3U6XS 3B9AA 3VNIA 1SYVA 4GXVL 3D4ZA 1P1ZB 1S7RB 2C9SA 1QA9A 5D7JA 3W72A 3MBEB 3U9IA 3SE9H 1H7XA 5BW6A 4XNQB 1U58A 4QHPA 4EDWH 4DN1A 4QROA 4ESKA 3UAFA 3VC6A 1IGML 1KBJA 4JTCA 5JO5B 3GNNA 1BQGA 2DLFL 5DT1H 4L18A 3CUPB 4UT6A 1RSCA 3OAUH 3B05A 2E7HA 2HRPL 1W0YT 3S5YA 5BVJB 4K8GA 1T5WA 2NX5A 3CFBB 4ODWA 5DFTA 1Q7ZA 3VIJA 4HIEA 5CGYD 3OJGA 5CG7A 3GDBA 3RWHB 1AJZA 2BOFX 3HUJA 1QBMH 5DK3A 3BH4A 1EFZA 2VAAA 4U1SA 1OC6A 3L3HB 3VGAC 3DGCR 4W9FC 4JRYA 1IGCH 2UYLB 4EXKA 3UYRL 4LUSB 4MCNA 4I18C 4OR1A 3DNKA 2C1GA 4POZD 1JZ8A 4QJ3B 1LQ0A 5C7VA 2W5FA 2NLJA 2ZZ2A 3KXQA 1J8HD 3H42H 9XIMA 5ESAA 1CF8L 2OJPA 3ARZA 1H51A 1TSRA 4K3JL 4IRSC 2FUQA 1JRCA 3ULAB 4F0LA 1M7OA 3SQOH 3ZKMC 4D6JA 1WAAE 3TS8A 5EEVA 3O3BB 4B9ZA 2QKIC 2VO5A 1KYAA 1AD9A 1UWGH 2FX8H 1A7RH 2YKKA 2OZ8A 3GLZA 4KOCA 4YHLL 4G7RB 2DV0A 2WGXA 3ZZQA 2HH0H 1XVSA 3V4VL 1CUOA 2D31B 4R97B 5FUZH 3H0TA 1T99A 3EWWA 5LNWA 3HRZB 2CZ5A 5GZOD 2NRDA 2Y63A 1XXDC 1FWGC 4GAYA 4FR1A 1A3ZA 5LZLA 1ZANL 5B4MC 1ZVYA 1Q63A 6ALDA 1TV8A 2VX6A 3KCLA 3LOWA 1C5DA 2P5ED 3VNYA 2QELA 2DJ4A 1NGWA 4HPOL 1FA2A 4LSPL 3EOLA 3RZWA 4LYKA 4U4MA 3ZN6A 3V52H 2OA9A 1INQA 3QG6A 2BW5A 4BZ2A 1YDNA 2IVFC 4YDLC 3STZA 3NVDA 3UAEA 2DQTH 5LXEA 3QLLA 3TVAA 2AJVL 3EOTH 5A43C 1HXMB 1CT8B 4FSAA 1MYRA 4O1CA 2Z0BA 5DK0A 1XDLA 4XX6A 1IJNA 4O53A 1IEAA 4M00A 2KI6A 3PWPE 3SDXB 5L4MA 4MA1B 1HKKA 4IKLA 3IWUA 4OV5A 4I9MA 1N2VA 3TZFA 3UYIA 5F97E 2OGJA 5FYKH 2ZOLA 1T2QH 3VFSB 1TQXA 3W2NA 2FPYA 3BHBB 3WMCA 2KC0A 5TE7H 3ITCA 3B3IB 1AK5A 1XLFA 2GVEA 1J8HA 3EJYC 3EYOA 1Z7AA 2DY3A 1EVTC 7FABL 4PH6A 2CXGA 5E2TL 2VJXA 2QSTA 5D1XD 1R3TA 3CQHA 2PXYB 1TEGA 2IH9A 1BXXA 3KXFA 4O4YL 1A5AA 4NZ1A 4BCEA 2YGPA 1MFAL 4XHJD 5E1AA 5DJ8A 1K8CA 5F9OL 3B3DA 3H24A 3ZXWA 3T9WA 4S2SB 2XX1A 3DU0A 3QIBC 3MA9H 4LRNH 4OD3L 5KUKA 2QQLL 4GO6B 1FZMA 5EU4B 4UFHA 3WBAA 1FWAC 2W27A 3BDKA 3SJ3A 2VISB 5DC2A 3BWUF 4XMUA 5DJ0A 4A2LA 4BFNA 5GJNA 4ATLA 2POTA 3KPLB 3DXAD 5I8EB 1PZUB 1EMTH 1N70A 1PBYA 4X5WA 3V7AE 2XFYA 4W9TA 2VUYA 1MQKL 1MCIA 1PTZA 2MSPA 3QJHB 2F53D 4CJ0A 2A3EA 5EBWA 3GTIA 2A1WL 1GW9A 3IS4A 3X1BA 4PRNB 4REQB 1FLRL 1SY6H 2POZA 1JPGB 4DJMA 4IBYA 3DFTA 2R2BA 4BHYA 2VGBA 1IAOB 3B1TA 3T8MA 3QMTA 3B97A 1UCTA 4R83A 3S2AA 4LVGA 1OALA 1SJCA 1D7CA 5CCHE 4GRWF 1CVRA 3W2DH 5ALCL 4ORMA 4Q6IA 3CGTA 2X30A 1EJOH 1NAKL 4GIOA 4IBZA 4YXKH 2WSDA 4JX0A 1AR1D 3I84A 3P69A 5D7IE 4PUEA 2VERN 2VLRE 3U0PA 4TXVB 3OWEA 3ASNB 1HG3A 4GVGA 4Z1AA 5JPNB 5J5RA 5F9JB 3DHMA 5E70A 1DWJM 4CNTA 2HB0A 2GKIA 1SN0A 3ZTJH 4R7NA 2EIDA 2PBOA 1XF1A 3W7HA 2QSCH 4FNSA 3L9RA 4K0OA 4R4FL 3QJFB 3RBGA 3H2AA 3ISWA 3P82A 3GSMA 1KNOB 4JYDA 1TKWB 1HHGB 3NACH 1Q6OA 4Z18A 3BMWA 1S7SA 5D7SL 3NQIA 1IGTB 1IT9H 3F7JA 3OTTA 3G5VB 2AEPL 3P0GB 4MNQE 4Y4HD 1NGXA 3GXUB 1NC4D 1QA9B 4M6NH 4QXUH 1YNPA 1XGZA 4EZKA 3BO9A 5B39A 2BIIA 5EFIA 1OAXL 2R51A 4XNQA 1ZAGA 3U0HA 1ZP3A 1XBVA 1JGVH 3AQZA 4MNGA 3ZE1E 1WNOA 2UBPC 3IMTA 3I6EA 3W2MA 1VKXA 2E4TA 1UWIA 4QQUA 1NLBH 3GMLB 3E6FB 1H49A 5CJXC 1P6BA 3LM7A 2IAMB 2BZDA 3I9AA 4CQAA 4Z76B 1DZBA 1I2RA 4NSKB 5IFJA 2H8PA 3LNEA 5LNSA 2Y7EA 3WNMA 2E3VA 1NFPA 1UWEH 2VC2B 4YO0A 1R0AH 4N6RA 3C87A 2BXYA 3VFMB 1QP1A 7A3HA 1LO2L 3BZ5A 4XPHL 5TJWK 4P2OD 5C0CD 4X63A 5I1DA 3IEAA 4FTVB 3NURA 4QD2E 3VXUE 3JU2A 3EWCA 4MFDA 3NK4A 1V6VA 2ICWI 3WMBA 2R4RH 1PIFA 1I9JL 4DQWA 3G5WA 4PJ7B 3WN5A 5F4WA 3H9SA 3M0KA 4HHLA 1S9WB 3QC5X 1GYLA 5FEZA 1A3RL 1DJWA 1E8XA 4N0FB 4KEZA 3BWWA 3NCJH 3OLIA 4MSWA 5DUPL 3UC2A 4QRSB 4A39A 4Y9NA 5C6TL 1R85A 4CD4A 3QOKA 1WKYA 5K9CA 1I8LA 4N2NA 2ZCKH 4A6YB 4WK9A 3FUIA 3WQGA 2HLAA 4FGMA 4Z3JA 4OY9A 2BFGA 3UXDA 3HRZA 1MQKH 3WQDA 2B14A 2YEZB 1EZSA 3RHWF 3APDA 3EYVB 5IREA 1WXJA 5MHBA 4HSAC 3S0PA 2CDGB 1J01A 3GHPA 1H09A 2PS2A 5F1UA 4JHMA 4UNKA 5AUMA 2VW4A 1JCYA 3FSUA 1OCQA 5L8LB 3DGBA 5D55A 4H19A 3MRKA 1LL6A 4GW5B 4ZAKD 1YXDA 1V3JA 3SPIA 4G2DA 4LESA 2ZTKA 4PMJA 3GZQA 4WKAA 3ZDXB 1DJSA 3HS9A 1U5HA 3P0WA 1SUXA 5L6UA 5HQMA 1CT8A 1CLCA 1HK6A 1J9YA 4DWSC 1G0CA 3KFTA 4AMAA 4S1RH 2X70A 1HXYB 1IXQA 1XB6A 2YZRA 5ACZA 3L12A 3LNMA 1DQML 2VDPL 3OMAB 4E2VA 2QEZA 4K7FA 5AVQB 1J0IA 4YFLF 3VFGH 3TZVD 2WZPA 1AHWC 2XV2A 4XP5L 1BQSA 5ECJE 2ITFA 3BHBA 4KKXA 4NOFA 5C3LD 1Z9PA 3N43B 4XXWC 4Q8UA 5GJMA 2X4QA 2DFAA 5F8QC 4Z7WB 4MF4A 1A3HA 3MJ9H 1OGAB 3T2NL 1ORSB 1C92A 1VFHA 3EUDA 4XPBL 4OTXL 3SGUA 1AQ8A 1E1EA 3IJ6A 2H6PA 4X60A 1A4BA 3ZFHA 3QV8A 4JAWA 5CPSA 4L8SA 4Y2OB 5E1AB 2V3GA 1PMYA 1GTNA 4FEZA 4M1GH 2XIBA 4AQLA 4QYAA 3CXHK 4QMEA 3QYNA 2DICA 2C9RA 1OD9A 1FG2B 3VXNA 3LKSB 1QK2A 1W9UA 2Y2TA 1XD1A 1VJIA 4JJOA 3O8AA 3PJLA 3FTXA 4QT5A 3AMDA 1UJQA 1IB5A 4NPYB 1A7NL 1UWFA 4MJ6A 1R3JA 4BH7A 4YTTA 5KTLA 3OODA 2VLLA 2WVVB 4KDTC 4X6FB 5KZCB 4UFMA 1PEZA 2G95A 4BYHA 3KDMA 3UTTE 4TMBA 3PDOA 4I89A 4RDWA 4UUJA 1RQBA 3RFZC 2ZZ6A 2JIEA 4YBHA 4JIEA 3G5XA 1RHCA 5C54A 3CVIH 3L5WA 1JPSL 4Q33A 3O2LA 2J88L 1T89C 2LTQB 2NY3D 1X5AA 3LERA 4WVXA 5DZOA 4XC1H 2JJUA 2WPBA 3RVTD 2DZWA 1P7TB 4Q14A 1DSWA 2ICEA 3O2VH 1BVLB 4NRRA 1EAJA 3JWOH 4YCPA 1KMGA 4KTDL 1XIJA 2Z91B 3B3BA 3KLAA 4NUQA 4UTWC 4WJ5A 1KCKA 5DVOA 1BD0A 3NXLA 3VX1A 3MRQA 3C2YA 4YXGA 1HKLH 1T04B 1PWMA 2R1YA 3VILA 2IMMA 5BS0E 4YHYB 4GK8A 3DKLA 4G59C 4O1AA 4FTDA 1GGIH 2WKGA 1VIZA 2CHZA 4Q74A 3G3DA 2FJHA 3WS6A 5CUSL 4O02B 4X9YA 5KTEL 2X4TB 4YTRA 2YXMA 4WFFD 3MMTA 3KPNA 3THAA 4GFXA 3N4AA 4LNVA 2DKMA 5IFAH 4P2YA 1KC5L 2GFBA 2EDNA 2NZ9C 3EWZA 4XKYA 2OU4A 2UX6A 4TNVK 1MZZA 4JN8A 4WK2B 3NPSB 2WCPA 4JB9H 3EJJX 1YW1A 1A0DA 1N2RB 2J7LA 3U2JA 1LQ2A 1GOXA 1M7PA 1HQRB 2VMJA 4M43H 1G94A 5B39B 4J9JA 4L1WA 3QUXD 3KPPA 3AQDA 5K2ZA 3SCOA 2AQNA 2A6DB 4PTUA 3KTCA 5CP3H 1JRHI 2PA6A 1ERNA 2P5WB 4YLWA 3F83A 1WQ5A 5F2IA 4BH8B 1OINA 1OHZA 3VSUA 2AK1H 5C6WH 4HTBA 3BW9A 2FEEI 1MFMA 4I77L 1W31A 2ORBH 2VEMA 2Z7GA 2AL2B 1GGBL 1GYCA 3P4LA 2XJLA 2WB1A 4CKQA 1UH3A 2VXUH 3I85A 4OAWA 4WFGD 3FN3A 1O6VA 5EPMA 2HCZX 1WTGT 2BP0A 4F0KA 3E5PA 1VYRA 5D7SH 4CC4A 2A7RA 4WDWA 1J2BA 3F7YB 1YYAA 1F8MA 3OJDB 3R7RA 5IBLC 4RFEA 4V1DE 4D8ZA 2AEWA 5ABTA 3H9SB 3MVSA 5LIUX 4PJ9C 4HCRL 3SYCA 2R1XB 2G3XA 3E80A 4ODVL 4Y7MA 1OGTA 5F89B 3ZE2B 4D94A 1L0XA 2C4XA 2J72A 2BWDA 2AJVH 2E9WA 2H26B 3EOTL 3R0KA 2CDFB 4PCNA 1BJMA 2E7CA 2OPCA 4LU5H 5B38G 3HA1A 5EFDA 4Q0XH 1IAIM 4AEIH 4ATTA 1XPGA 3POHA 4MZIA 1E1FA 2IMNA 4C56D 2X4OA 2O56A 1PBGA 5I6KA 1U95A 2YGVA 4B5XA 3OXSB 4PY8J 1D5RA 2GUOB 3BN3B 1H11A 2FZNA 1A1MB 2QS8A 5I6SA 3DTXA 2PDKA 2WBGA 4LYQA 4XQ6A 4Y4KD 4WJ8A 2J2ZA 5L2JB 2E6QA 2G9KA 1XRSA 4LSBA 5A6BA 1PW3A 2VXQL 3PGDB 4YNYB 4MWAE 5D1ZB 3WQCA 3RDJA 4ONHB 5J1AB 1Q7QA 3B06A 4PWGA 3T0EE 3ZJ8A 5E5MA 1T0NB 2CLRB 4PG2C 5SX4I 4Z6AT 1EQWA 3FU7B 5KVFH 2KAUC 3FJ6A 2JQAA 1MNUH 3NSDA 3PUGA 2H3DA 3VQ2C 2NT0A 2CAKA 5H94A 4CNIA 4YMPA 5JNYA 3Q8AA 1S7WA 1BZ9A 1I2OA 1EOKA 1PCWA 3D0CA 2PR4L 4OCRL 4PRBA 1QABA 1JHLL 2PDYA 3OPZL 2DQJH 3BAXA 3P1VA 4XVOA 3RKDD 3ONBA 1UR8A 3ZPDA 2VWSA 4N86A 4EIGB 1IIIA 2QVTA 5GS1C 2CNZA 5E0QA 2APTA 3EMCA 1RU9L 2E5EA 2VDRB 5AVRB 3RGVC 1W56A 1XL9A 2CO3A 5JW4Q 2IXVA 4HWZB 1B2YA 4PJGE 1J79A 1DQQA 1WBXB 4KCUA 4UTLA 2F08A 4FXSA 4LCVA 4GYKA 4LGPB 1KM2A 3ARDA 4IBQA 3SE3A 5JORA 4F2BA 3ATEA 3HPAA 2A4CA 2BWIA 2MQCA 4W4OC 1F6PA 1WOAA 2XZ9A 4HPNA 2CKBH 3OMIB 1KA9F 1WT5A 3TV3H 1ORSA 1OG0A 3R25A 4HK0B 2PPGA 3OC8A 3N1AA 2YCIX 1VD6A 4H0GA 3FOKA 4JTLA 2DAVA 3AM8C 1T89A 3MV11 3RCMA 4F92B 3TBYA 1G4SA 2HBXA 3WQFA 2PZNA 3CMOL 3PUEA 4JTTA 5F1KC 1OTUC 2MOVA 4KRUA 5T8GA 3EZJB 3EUUA 3SOTA 4HEPA 4JFDE 5DUJA 1RJLA 3VXNB 5EN3A 1FG2A 2QF8A 5IFHH 4E5XG 4F7KA 2ADAA 1A7PH 2KUTA 2Y7QB 3D2TA 2E6YA 2QPUA 2O6PA 2VZTA 4XMLH 4Y7OC 4B9PA 3QO0B 4Y4KA 1E5UI 5D5MF 2Y1ZA 5DQJA 3EA2A 4PRTA 4F48A 2FH8A 3FU6A 5E6SB 1HH6B 5ENLA 3KYKH 2PTXA 1XR8A 2AEQL 4X6FA 1U5JA 3C2EA 3FO2A 1GOIA 1D7BA 2H9GB 3KDMB 3N9RA 3QARA 1PKQB 2W38A 3WQWA 2D2HA 2Y89A 3ARBA 2VDNH 4OZHE 1YEHL 1MAML 1KTRL 3WH8A 4NZUH 3EGXA 2F61A 1PKMA 1B4LA 3IVKA 3IJ7A 2V6AA 1DUYA 4HFWA 5DMLA 3EGDA 2CG9X 3VI4B 5C07E 3PDDA 2G97A 2H7WA 5I3IA 4MY8A 1NBQA 2H0JA 3DUSA 1Q8MA 3LH2L 4AGQA 2GB2A 5DC0A 4CRPA 4FG4A 1YZZA 3BD4A 4BGDA 3SUSA 4WWNA 1CF1A 2WANA 1I7RA 2B7DT 4N2YA 3JWDH 3IFOB 3GSVB 1WT5C 3VE0B 5BV7H 4QLRA 3MRQB 1E0OB 3UPRA 3GB7B 1ZA3A 4L1DA 2VC6A 4OD2A 3WHE1 4AQ1B 1MWAB 1F5ZA 1SR9A 2CZVA 1P0NA 1CGSH 8TIMA 2J55A 2PTVA 1T1ZB 3MLVL 4UOJA 3R0DA 3WH7A 3WLQA 3BUQA 3VD4A 4CNSA 2JXMB 1CGTA 5ADOL 4XMTA 1S3TC 3KPNB 4J8QA 4WHYG 2R6OA 5HVGB 5CFHA 4BZYA 3J27A 4AKPA 1FDJA 1II4E 3RVTC 5D38A 4C5ZA 3VO0A 3RX5A 1BFVH 1AC0A 3U5YA 4NJHA 1S3RA 3FU8A 3O6FA 4NQSA 1OSEA 4S3FA 3T44A 2DY2A 1E2WA 4RQQA 3VD0A 3LRHA 1CVSC 3V6BR 2B4CL 2AJSL 4P7NA 3QNXA 2BSEA 1QZNA 4QEHA 3AIEA 5JIKA 2D2CC 5HP5A 3T0EA 3BCFA 3K5XA 3ZRFC 1RUPL 2VM4A 1DCEA 1P7QA 4HJ0C 1BWLA 2VQ1B 2HMID 2V5RA 2DEPA 4E5TA 6CGTA 3P14A 4ALAC 4P04A 4MA8L 3PREA 4ETQB 1NDVA 1Z9OA 5CGBA 5I6NA 1I9IH 2C1PB 3L2MA 4L0YA 2AGTA 4GAFB 5KYNA 3HG1A 4LLMB 4NZJA 3D06A 5EOCH 2K7QA 3TTSA 3M0IA 3U2OA 3D3VE 2NY4D 3W53A 1BTCA 1D9KD 3O1NA 1SJXA 4YWGL 3BANA 3GH4A 2FTAA 4RE0A 2E67A 1Q90A 3GBML 3I6TA 1BD2E 1MRDL 4G2AA 3NQCA 4JM4L 1KENL 1SQ7A 5AOKA 3K4DA 1TZGL 2IPFA 4PUNA 1JL8A 3N4FA 3CUZA 4JN2A 2P3EA 1TNNA 4PUBH 5FUCE 2CDFA 4JFOA 5E51A 3WD5H 5HSFA 4ZMGA 1ICTA 4P3CL 1TJRA 4FIQA 3HPJB 4JFVA 5BO1L 3WMPA 3WNKA