3OLGA

Structures of human pancreatic alpha-amylase in complex with acarviostatin iii03
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes.
pubmed doi rcsb
source organism Homo sapiens
total genus 172
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3olgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3olgA01
3SUSA 3QOMA 2XVKA 3NYDA 2WHLA 1JZ6A 1KWGA 1UR8A 1E9LA 7A3HA 3FY1A 4LPCA 2G4FA 1JL8A 1OBAA 3ALFA 4HOZA 2CBVA 2D24A 2VX6A 2PWGA 2CXGA 3HMCA 4AD5A 1HJVA 3VDHA 1C8QA 1E15A 2YA1A 4NXKA 3PZNA 2WSKA 1GQLA 2X2IA 1VFMA 3WL0A 2IUZA 2E4TA 4GINA 5I77A 4K68A 3PZUA 2VI0A 5BYWA 2OW7A 1C8XA 1JFHA 3K4DA 3WF1A 2ZX9A 4FNRA 4E8CA 1HP4A 4W88A 3WMBA 1HJWA 4WLCA 4PCTA 2FGLA 5CLWA 2F1BA 5TD4A 5I2UA 2XM1A 4KRTA 1W9BM 4MAVA 4DUVA 3W27A 4TVDA 2XIBA 3UETA 4JZ5A 4U5IA 4AZ7A 1JDCA 2Z1SA 5DMYA 4AIUA 4NRSA 1IV8A 1UR4A 1EHNA 3POHA 4W8BA 3LRMA 5JBEA 2J7GA 4W86A 1BFNA 1U33A 4Q22A 5ABFB 1JZ4A 1GQKA 2ZIDA 4GZIA 5AYIA 3AHTA 5I79A 4JL1A 3CLWA 2QMJA 4AZCB 1GQIA 1WO2A 4FLRA 1VFFA 3N11A 3W6MA 5ABGA 4R5EA 3WKZA 1JAEA 3ZR6A 3DDFA 2EPLX 3HG2A 5I3DA 3A22A 3LRLA 3SCPA 5CPTA 1TVNA 4ATDA 5CGMA 4PN2A 1SMAA 3WY1A 4AYSA 3FNDA 3OGSA 2WSPA 1J01A 3ARRA 1UZ4A 1AMYA 1NH6A 5I6SA 2D2OA 4UR9A 1GW1A 2FGZA 5A8MA 3S6TA 1E6XM 1OGBA 2GUYA 4HPGA 3WD3A 3BGAA 2GJPA 2WNWA 1PPIA 3GH7A 2D3NA 4AD0A 2ZX8A 2Y4SA 3RCNA 1JAKA 3U57A 2YKKA 1H09A 3MV01 4AZ6A 2EQDA 1Q6DA 2PC8A 1QI5A 2XPKA 2Y24A 3A5VA 5A2CA 1FH9A 4IUGA 2J7DA 3WUFA 2WANA 1V3JA 1ZS2A 3VGHA 3EDJA 3B9AA 3CHDA 4GO9A 1E6ZA 4OBRA 1WB0A 1W9XA 3BAIA 4CU7A 3L4YA 1VIWA 4IPNB 1BHGA 2NSXA 3MUY1 1QWNA 1UWIA 1BPLB 1EXPA 3CUHA 4ATWA 1E4NA 2EPOA 2YOCA 4CN4A 1UWQA 3VD4A 3OBAA 3VIKA 2X2HA 1GNXA 4DO5A 1V6WA 3W82A 4ACZB 1CTNA 1CGXA 2ZUVA 2QPUA 1R85A 5E1QA 3NDYA 2WVVA 3UG3A 5E6ZA 2GSJA 4AYGA 5A2AA 3TP4A 1EQCA 3QGVA 3LXBA 1C8YA 1OB0A 2VTFA 1W2PA 2AMGA 1EQPA 4CN1A 1K9FA 3BCDA 4MJ4A 1SYTA 2FE0A 1OGSA 2DH2A 3ZOAA 5CPSA 3DECA 1OD0A 1W9PA 5CSYA 3PZMA 3SUUA 1HJSA 3FW6A 4PMNA 1J9YA 1XYZA 5ABHA 2XFRA 2CPUA 4W87A 2VZUA 1QNRA 2V5DA 1LWJA 4C7FA 1PIGA 3D51A 1BG4A 2QPSA 3GYCA 3VSVA 3AZSA 2CYGA 4ACYA 3UERA 3QHOA 5E9AA 1VEPA 3WF3A 3GNRA 1QW9A 1J0KA 4HMDA 3AHZA 2Q8XA 3N04A 4AD2A 3K8MA 1TUXA 1K9TA 1FH7A 4M82A 1XH2A 1HN1A 2EXOA 1UH3A 1X1NA 2WHJA 3HG5A 3WBEA 4B16A 2PB1A 5F7UA 1SZNA 1ODZA 1C7SA 3U5YA 2YFNA 3CZEA 1ISWA 2HVMA 2WZIA 5EB8A 3VM7A 4H2CA 1C91A 4CD4A 1E6QM 2YIHA 3PZGA 2OSYA 4NF7A 2J77A 3TA9A 3DDGA 3PZQA 1E73M 3THCA 1UG6A 2ZUNA 3WDIA 3CHCA 1PBGA 3L4TA 1Z32X 4X9YA 4WJXA 1TA3A 1W2VA 2ZXBA 4OUEA 2J25A 2PWEA 3AHXA 4JL2A 5E0FA 1FH8A 1QBAA 2W63A 3G6MA 2VZTA 3AZTA 2WYSA 2VRJA 1J0IA 1A47A 3RIKA 2IXVA 4LXFA 3ARPA 2WWDA 2O9PA 1E6NA 5A6SA 3VIFA 5IFPA 2WKGA 5E09A 1Q4NX 5A6MA 5EMYA 2X2YA 3WUEA 4FNQA 2ZXDA 5DT5A 4KH2A 4CD5A 3DX1A 2E40A 1AQ0A 2YL5A 2VRQA 4UZUA 5BXPA 3LXCA 3ARQA 1JDAA 4CGTA 1ISZA 2ZX5A 3GXFA 2UY3A 2DT2A 2BXZA 1R87A 1EGZA 1UQYA 3WNLA 4S3KA 4TX6A 1VBRA 2J7FA 4J7RA 2XGBA 4F8XA 2ZE0A 2FDMA 3KZSA 3VX0A 1TQSA 1I75A 3I3DA 4J3UA 1DWFM 2WLZA 4ZFMA 4F79A 4QDMA 2W66A 1V0LA 2DPEA 4D1JA 4B3KA 2BVYA 1PIFA 1G1YA 4J3XA 2A3AA 1UKQA 1BLIA 4OBSA 3UR7A 3QR3A 1KGWA 3ARZA 3K4AA 4XZBA 3EDFA 1UD2A 2GK1A 4YHEA 5A3HA 1N82A 2CITA 2D0GA 4CD7A 1J0JA 5C71A 2D23A 3M46A 4C7GA 1MYRA 2XUCA 1LG2A 1JXKA 2F18A 3GXNA 2GDUA 4ATLA 1HL9A 3PZOA 1CXLA 3FHQA 5EFFA 3MKKA 1E0VA 5CPQA 3EJSA 1R46A 3EJPA 3NCOA 4PMDA 4FNSA 1T0OA 1V3MA 3AIEA 3OZOA 2PBOA 2WCGA 3BLPX 3PBGA 1PZ2A 2WB5A 2D20A 4UOZA 1E71M 2WM0A 3ZIZA 1Y7VA 1CXIA 3DX3A 1J10A 1KGUA 3APGA 3K46A 4AMXA 4LYQA 3L2LA 2XFFA 2XVLA 3SIMA 1HX0A 1FHLA 3BVWA 1RPKA 1CXHA 3FAXA 3OB8A 2QF8A 2QV4A 3AIBA 4CCCA 3GXIA 1UD4A 3I3BA 3ARTA 2WHKA 1MW2A 1O7DC 3NDZA 3MSDA 3LRKA 5E6YA 1JD9A 4BQ2A 3BUQA 1OM0A 4ZE4A 1ITCA 4FK9A 1WZAA 2FHCA 2RGMA 2CKSA 2UY2A 1R7AA 3EJRA 2OWXA 1PZ3A 2UY4A 3UG5A 3LPPA 1V6VA 3N13A 3AMLA 3K8LA 1E5NA 3W0KA 4X0VA 3FN9A 1G94A 3HU7A 2FYVA 3BLKA 2JE8A 2WWCA 3VGFA 3MSGA 1OSEA 2OSXA 1GOOA 4W5ZA 1DTUA 1CIUA 3IJ7A 3TOPA 3CZGA 3WH6A 3A21A 4U2ZA 2E3ZA 1EOMA 3SUVA 5A8PA 2VVSA 3CZKA 3CBWA 1GJUA 3T0DA 1R8LA 1CEOA 1H11A 1SMDA 4UOQA 3VM5A 5ABFA 4D6HA 4PCSA 2J74A 5CXPA 2EPMX 2J75A 2QMKA 4AZCA 2CBIA 2J78A 3AHYA 1R34A 4ZEPA 3ZT7A 3UCQA 1H1NA 3GM8A 3VILA 2E9BA 4D1IA 2BS9A 3VGEA 3OGVA 4WSKA 1KFWA 2WVTA 3AXXA 3W26A 1VJSA 1WZLA 4M80A 1CPUA 1V3KA 2G3IA 4DO6A 1DWAM 2PWFA 1UWTA 3AIWA 1QNQA 4XUYA 4ML4A 3S2CA 3CTTA 3ARUA 3ZJ6A 8A3HA 2YLLA 1W1YA 3AXHA 2F7QA 1WDRA 3IAPA 4MB4A 2JF6A 1BTCA 3U5UA 4CU8A 3AIVA 2DIEA 2YFOA 5BROA 4Z2HA 3CV5A 4HMCA 2WMHA 3MMDA 4AXNA 5A8QA 2VZSA 2A3BA 2BY1A 4FNUA 2O9TA 2WMFA 3DHUA 1F4HA 1HXKA 4U2YA 2XTKA 1AVAA 4FLQA 2VR4A 1WE5A 4RL3A 1UH2A 4NZFA 2WVSA 1H0GA 2J8GA 1PS3A 4YHGA 3WEZA 4EAMA 1HJXA 2AOSA 5JBDA 4J27A 1B3VA 3WNMA 1TR1A 2VL4A 4WKHA 1M53A 4CD6A 3DX0A 2F1AA 3W81A 4D6GA 5JIPA 3WMCA 3AMKA 2OYLA 1EDGA 1QBBA 3N18A 1UUQA 4M56A 4E4PA 4B15A 3BMVA 3ECQA 1OGGA 4PSPA 2WK2A 1R86A 1HTYA 2XHYA 4UOJA 4ACZA 2CBJA 5GNZA 4KRUA 5BRPA 2OLHA 1E6SM 1UWRA 2VCBA 1UASA 5CZKA 1FOBA 1H2JA 3BCFA 3BXWA 4QLLA 3WN6A 1CDGA 1GOMA 4FF5A 5AC5A 5JIWA 3OIHA 2WAGA 1EO5A 1MW3A 2G3JA 1HWWA 5I78A 3TONA 1VBUA 2BY3A 3LX9A 3W37A 1E5JA 4S3JA 2AAAA 4WIWA 2VZOA 4MJ2A 5LA1A 5D4YA 2V38A 3BAXA 1D3CA 3W24A 1ODUA 2D0HA 3BAJA 2ZUWA 5KEZA 1TZ7A 2EEXA 3DX2A 5HBFA 3CZJA 4AMWA 1GHRA 1B1YA 5CSUA 1TQTA 4UNIA 2FHFA 3VGBA 5HPCA 1QOXA 1R75A 2D22A 2JALA 2JIWA 2F7RA 2VZVA 4GZJA 2DSZA 3IAQA 1U2YA 2XWDA 4JCLA 3MMWA 1VEOA 3BAYA 3VMNA 5DFAA 1VRXA 4QAWA 1FFRA 3CUFA 4HZ7A 1OT2A 1XSJA 3N1AA 1C92A 2YA2A 1ZB5A 2VT0A 1C7TA 4H8UA 1NWSA 5BXSA 5A6BD 3T0BA 5EFDA 4D71A 1XCXA 2BNJA 1XH0A 1QW8A 4W84A 3ZJ7A 5D9OA 1JI2A 4PBGA 3TV8A 2CIPA 4PTWA 3BAWA 3F5LA 3VDAA 4BZYA 3BC9A 2B31A 3G6LA 2J7EA 3OLIA 6CGTA 1UR9A 4P8XA 2GJXB 2WBKA 4FLOA 3HN3A 4P8VA 4FNPA 1WCGA 3IGUA 3GBEA 1QWUA 1DHKA 1XCWA 2J7HA 1GZJA 2ZXQA 4CKQA 2XJ7A 1EOKA 1JG9A 3H53A 3VKKA 1VF8A 2EPKX 1UYQA 1W9DM 5A1AA 1KTCA 5JBFA 3OA5A 1ISVA 1IZJA 3PZTA 4DWSB 4DM1A 5I24A 1P6WA 3A47A 3ZJKA 1E4IA 1KGXA 1CECA 3CZSA 1L8NA 1E43A 2VUYA 3OLGA 5CLTA 1A3HA 1NOWA 4EANA 4DM2A 3VIIA 1QVBA 2WC3A 3QHNA 3CZ8A 3PZVA 4BCEA 1XRVA 3WQ8A 3D3AA 3MI6A 6TAAA 3VSTA 2WMKA 5FD0A 4KGLA 3AIQA 3GBDA 1W3LA 1VENA 4E2OA 1W9VA 1TE1A 4JFUA 1GJWA 1KXTA 4LX4A 4J3SA 3A4XA 1V6UA 3LPFA 3T09A 4DUWA 2EBNA 1JYXA 2XN0A 1W3KA 5KZ6A 2W91A 3W25A 1CLVA 1B30A 4H41A 5GNXA 4ZXLA 4AD1A 2ZUMA 4OZOA 3VIJA 3F4VA 3TTYA 4A3YA 1WNOA 3POCA 2A3EA 5D9MA 1X6NA 1E1EA 1SR0A 3VIOA 1E3ZA 3SCUA 4JCMA 2MANA 3PTKA 3T2OA 1L0PA 3A23A 3IJ9A 1C90A 1MQQA 2ZXAA 3A6OA 4LGXA 1MXGA 4HTYA 1TFVA 3TTQA 2XN2A 2VX7A 4JAWA 3WY3A 3A3HA 1PJ9A 1JDDA 2YBUA 1QI2A 1MVYA 3IK2A 1OD8A 1LQ0A 3FHAA 1W91A 3ARVA 4IPLA 1DWJM 5CQ1A 2YDRA 2VRKA 3UR8A 1W1PA 1ZL1A 4JKKA 3ZO9A 4RE3A 2WVUA 4CCEA 1UQZA 2W61A 1VFOA 1E0WA 2OWCA 1LG1A 3CHFA 2XM2A 4UQCA 4AD4A 1ZBWA 3WQWA 4W5UA 1B31A 1UH4A 2J7BA 4M1RA 5IHRA 4ZENA 4JKMA 2BFGA 3SCVA 3LXAA 4W8AA 3E1F1 3AS2A 5GQBA 3WDPP 1BYDA 3WH5A 2YBTA 3VIHA 3AQUA 4Y7EA 1WPCA 3NIYA 4U31A 1LJYA 3GDBA 2BHUA 1GOKA 5IHSA 3WMSA 1WZMA 1E0XA 3WD2A 4J3TA 4PUDA 2DT1A 1VB9A 1GUVA 3EMCA 4Z2LA 2PWHA 4XZWA 4UFKA 4HU0A 2F8QA 2GJRA 3KLLA 1CXKA 3WDQA 1HVXA 4MDPA 1B3XA 3D50A 3VOCA 1KR1A 1BAGA 2DSVA 3NSXA 4HZ6A 4Z2JA 4DUXA 1BGAA 4H7VA 4XB3A 1W1VA 5D9PA 1JXJA 2J4GA 1CGVA 2WZEA 5HPOA 1K9EA 2X05A 4L4PA 3VDCA 4HPHA 1B9ZA 4BQ3A 2WPGA 4H8VA 5LA0A 5ABEA 3BVXA 1OIFA 4LYRA 3ALGA 4P7LA 4NXSA 2V5CA 2X09A 3NUKA 4URIA 5I23A 1RD6A 2DGAA 1FP8A 1O7AA 1M7XA 3L4WA 2BHYA 4BQ5A 3T0AA 1CNVA 3SCNA 2JF7A 1EIBA 4GI9A 5I0DA 1RP9A 3WQ4A 3SCOA 4W93A 4PRWA 4MB3A 1JF6A 1RP8A 2YLAA 1QHZA 4MTVA 1V3LA 3BUBA 3ZSTA 3SCTA 1LF1A 1C3FA 3SUTA 3L4XA 1J0ZA 1UWUA 5FIPA 3L4ZA 3WUBA 3ZMRA 3RMEA 2GVYA 1IT0A 2Y8VA 1NP2A 4NX0A 1GOQA 4GQRA 1QNOA 4GQQA 4FLSA 4B3LA 1E70M 1KXQA 3PZIA 3W28A 2X0HA 3VMOA 3CHEA 2BV9A 5EBAA 1UOKA 1HNYA 3M6DA 2G41A 5D8ZA 1PX4A 1UA3A 1XD1A 2BVDA 4A3HA 1B0IA 3ARXA 3W29A 4JHOA 4PUEA 1UKPA 2W67A 1TG7A 1ZBKA 4Z2KA 1JYVA 4BS0A 4J3VA 5C70A 3EJQA 3HG3A 2XYLA 1B3ZA 2WW5A 1HIZA 4HOXA 3VIMA 1CGUA 1B2YA 2CNCA 2YL6A 4NZCA 3B8SA 3LPGA 3AI0A 3VU2A 4N0RA 3VVGA 2DEPA 4MNMA 4F9JA 3GZAA 6A3HA 1DWIM 1EO7A 1PEZA 2WHMA 3CUGA 3AIUA 2O92A 1Q6EA 4M8UA 3PN8A 3WDHA 4HU8A 1BG9A 1HP5A 1XC6A 1JF5A 4AIEA 3PZ9A 3CUIA 2X2JA 8CGTA 2DSWA 2WMIB 1UD3A 3K1DA 1KWKA 1UD6A 1PX3A 1B3WA 3WQ6A 3KWXA 1LL7A 3KL3A 7TAAA 1BSIA 2XFYA 1QHPA 1JIBA 4AZBA 1NM9A 5HXMA 1QNPA 2J47A 4UQDA 2WCSA 3SEPA 3S5YA 3II1A 2WMJA 5C8BB 1U30A 2ALWA 3AYSA 2DQXA 1J18A 4WKAA 3GH5A 5FOOA 3VDBA 3NSNA 4B9ZA 1J12A 3AMCA 1KBBA 1UWSA 2WZHA 3WH9A 2XWEA 5A94A 4X0NA 2VCCA 1BGGA 4RE2A 1TQVA 3WY2A 1B3YA 4CD8A 1W1TA 4B9YA 1MFUA 5M5DA 1HKIA 1VAHA 3MU7A 1BF2A 4OJYA 1KB3A 4W89A 4AY1A 2O9OA 3WF2A 1LWHA 4D6DA 1G01A 4BF7A 2ZUSA 1W3HA 1QI4A 3W38A 1GOWA 1CXFA 3WD4A 5M3WA 4ZE5A 1MQRA 3QHMA 1DWHM 2E9MA 4WSJA 4AZGA 4XV0A 4PEEA 1W32A 1GVYA 3FXYA 9CGTA 4EE9A 3AMGA 4TXEA 3OG2A 4P7NA 3CZNA 1V0NA 3S5ZA 3BVVA 2WMGA 1R47A 1NWTA 5CG0A 1E6RA 4UZSA 2CBUA 4MDOA 1MW0A 4UQBA 1HKJA 2O9RA 3CUJA 4TX8A 2GJXA 1QI0A 5A6LA 1CWYA 3F5KA 3AS3A 4EKJA 4M81A 5JUVA 2C7FA 4E8DA 5A69A 3EBVA 3SCSA 1ECEA 1MW1A 1R33A 1MXDA 1HL8A 1O6IA 1TVPA 2DDXA 3GXPA 4UCFA 3MV11 1ZU8A 3DC0A 4DWSA 3LPOA 2VQTA 4MAZA 3WENA 1GONA 1D2KA 3GH4A 4TVUA 2J8FA 3EDKA 4PMOA 4CCDA 1BYAA 4TTUA 1V08A 1GPFA 3VGDA 1K9DA 2Y2WA 1SFSA 3EDDA 1UKTA 1BQCA 1V3HA 1HF6A 1V6YA 1F4AA 2C0HA 1KQYA 2CETA 1HVQA 1EH9A 1JYNA 1QX1A 5DEZA 1QNSA 3GTNA 1H49A 3EYPA 4PMVA 4Z2GA 4KGJA 2OW6A 4UFIA 4UFJA 4QP0A 1WZKA 4AZ5A 1ZBCA 4UFHA 3OGRA 1QI3A 3D5HA 5DF0A 4P7OA 4XX6A 3WFZA 3B9DA 3IANA 2YJQA 2Y5EA 2WCAA 1NWUA 7CGTA 3W4RA 3OLEA 1TMQA 3FAWA 3H54A 2VOTA 3TTSA 3PTMA 1EHAA 3WNPA 1JGIA 3ZQ9A 1E4MM 2W5FA 2YDSA 3U7VA 3BVTA 1XHGA 3ZT5A 1M04A 2VC9A 2W62A 1H41A 4AIOA 2X8RA 1ESWA 3RPMA 2BXYA 1E1FA 3ZM8A 1UA7A 4U33A 1BVZA 3EJUA 3CZLA 5BRQA 1MFVA 4HA4A 3O6AA 5A6KA 3SCWA 3HJEA 3GXTA 3THDA 2ZWYA 3BUDA 3T08A 5IXEA 2VX4A 4MADA 4W7WA 1FA2A 5M17A 2V3FA 3PHAA 1CLXA 3CGTA 4OIFA 1NARA 1WP6A 1YQ2A 2EACA 1E3XA 3ARYA 2JEPA 2VCAA 1FHDA 3AIRA 4AZIA 3VD9A 3CMJA 3WDRA 4PMRA 2OSWA 4AW7A 1US3A 4D6FA 2D3LA 4F9DA 2ZICA 3AMDA 2DH3A 2BHZA 3AYRA 2XVPA 5GNYA 3ZT6A 5HOSA 1KQZA 3ARSA 1CGYA 1GVIA 3D4ZA 2QHAA 4V2XA 4P7QA 2VQUA 3WIJA 4JIEA 1J0HA 2YA0A 4CVWA 3WQ5A 2G3NA 2G3MA 2V3GA 3VX1A 1XD0A 1AQMA 2NW0A 5AC4A 2ZUUA 4AD3A 4QCEA 1WDQA 4JHZA 1EDTA 1OWQA 1V02A 4UFMA 2ESCA 4HP5A 1XGZA 1LLOA 5HDRA 4QLKA 5AY7A 4H04A 1JD7A 3T2QA 1DWGM 3CMGA 3B9EA 4RE4A 2OYKA 3VIGA 4UQAA 2FH6A 3WEMA 1US2A 3CIVA 3IJ8A 1TQUA 1WKYA 1D7FA 3UESA 2IXUA 1TCMA 3MMUA 1YHTA 4JFWA 2BY0A 3WNNA 2WXDM 4AISA 2IGTA 3M07A 5A2BA 1M01A 4PMZA 4L4OA 3UEQA 1JZ2A 3SCQA 3KLKA 1NOUA 2D73A 2D0FA 1MWOA 2W4XA 3RJXA 4EK7A 1HKMA 3WQVA 2HISA 1I1XA 2ZX6A 2PI6A 4NSBA 4P7RA 5BXRA 1JZ5A 4ZXOA 1XV8A 4D6CA 1V02E 5FL0A 4AEEA 1KBKA 1IZKA 4GXPA 1CGWA 5GPRA 4MB1A 4DWSC 5DO8A 3MUIA 1B90A 3F5JA 1BYBA 2CCRA 1UR0A 3N17A 2TAAA 3O9NA 3GXMA 1CGTA 2Y8KA 2XG9A 4TOQA 1UD8A 2BVTA 5M03A 5BCAA 3VUPA 4J28A 4AZHA 2VJXA 2ZOXA 2JEQA 3RJYA 4DWSD 5A6JA 1Q6CA 3CH9A 2A3HA 2WBGA 3BMWA 4MNLA 2EABA 1UD5A 1JNEA 1FP9A 5E70A 3BLBA 4PTXA 3AZRA 1CXEA 5E0CA 1H3GA 2ZWZA 3L4VA 2PF0A 1UHVA 3PTQA 5DT7A 4OKDA 4PSRA 1K6AA 5A8OA 3N15A 3DX4A 5LA2A 3BH4A 1NQ6A 2XVGA 1H5VA 3WY4A 2W92A 3K8KA 3SCRA 4UQ9A 3RDKA 1E56A 2E9LA 4M24A 3WBAA 2X0YA 4JFVA 1ITXA 5A6AA 4AC1X 5IFTA 4UQEA 1JI1A 1QHOA 5A8NA 1HJQA 5AYBA 3W6LA 3TTOA 2DSUA 1S46A 2WMIA 1UKSA 4GI6A 4J3WA 3JUGA 4HA1A 4OGZA 3GNPA 3WH7A 3BSHA 1V3IA 4U3AA 3LMYA 4KMQA 2UY5A 1OT1A 2X1IA 2VNCA 4V28A 1E55A 2VO5A 4JFSA 3VPLA 1RH9A 3WF0A 3DHPA 2JFEX 1C93A 2DT0A 1GORA 3VNZA 4NZJA 4BQ4A 4IM4A 1G0CA 4M29A 2GFTA 3AS0A 3MANA 3WDJA 3HG4A 4FNTA 2CERA 3VD5A 4N42A 1ISYA 4CU6A 4OOUA 5LYRA 4HZ8A 1KCLA 3L4UA 2QLYA 1E6PA 3CO4A 3D4YA 1LL4A 3NJ3A 1XSKA 3ZR5A 3GNOA 3RM9A 4QLJA 1CBGA 1JNDA 4MPKA 4MNJA 1UR1A 2BY2A 5D8WA 1CENA 1BYCA 5CGTA 2JIEA 4AWEA 1GCYA 4MNKA 1W9UA 4W7VA 4UTFA 3KE0A 2A3CA 4PMYA 3A24A 1V03A 1G9HA 1WAWA 3WD0A 3L2MA 2V3DA 2ZUTA 3AOFA 1R7OA 2PBGA 1UZ1A 3WL1A 1AQHA 4GZEA 4D6IA 2EADA 4GPNA 2J79A 2OYMA 1W3JA 4NI3A 2FH8A 3BUIA 3OZPA 1OCQA 4QFUA 2WC7A 2UWFA 2F7OA 4TVCA 1ZJBA 3N9KA 1QPKA 4H8HA 2C8NA 1E40A 4PMUA 3AHVA 2WVVB 2DIJA 4GIAA 3W53A 1UKOA 1NWRA 2WC4A 2V3EA 1VEMA 2DT3A 4NRRA 5HNNA 1EA9C 3RM4A 1HJUA 2EO7A 3EMZA 4GI8A 4DO4A 5IDIA 4CUCA 3RO8A 1X6LA 2XSBA 4R27A 1HT6A 3AROA 4WF7A 1DP0A 4CVUA 4PMQA 1GOIA 3N12A 5D9NA 3VIPA 2FHBA 2PWDA 4P8WA 4KWUA 1ZJAA 1J11A 4HMEA 3MUAA 3WF4A 4D6JA 2VMFA 3MO4A 3BAKA 4D6EA 2E0PA 3D52A 3VTRA 4U3CA 4D72A 1CYGA 5A95A 3HZ3A 3WEOA 1WDPA 3GXDA 3NSMA 5CJ5A 1KCKA 1FFQA 3WFLA 3WNOA 2NT0A 4W7UA 4PTVA 4YN5A 2XSAA 4F66A 5ECUA 3A4AA 2J62A 2XVNA 3BSGA 2F2HA 4JKLA 1E4LA 4OOZA 5I5RA 4PMXA 3J7HA 4MB5A 5A6BA 3WELA 1V0MA 4PYSA 3QOKA 4GKLA 1HKKA 2RGLA 1M03A 3T2PA 2XGIA 2F7PA 4WK9A 1H4PA 1Q6FA 3MS8A 3WH8A 4CN6A 2WLYA 1TA3B 2J7CA 4WKFA 3BUPA 1OIMA 3UG4A 2GDVA 2EJ1A 1KXHA 2YL9A 3DYMA 1LL6A 3DYOA 3WNKA 4PTMA 3ZSSA 3WUGA 1XSIA 1MQPA 3H55A 1XYFA 1E72M 1DEDA 1ZBVA 2CEQA 2YDQA 3ZJ8A 3CPUA 1NOFA 4JFTA 3I3EA 1KR0A 1Q6GA 1JFXA 4TUFA 3ARWA 2EPNA 3A4WA 1NP0A 3KL0A 4FMVA 1HXJA 1XH1A 1JYWA 3EMQA 3WSUA 3M7SA 2EAEA 4Z2IA 1KXVA 1V6XA 3EJTA 1JZ7A 4YPJA 2XIIA 4W85A 2OWWA 3VMPA 4GO8A 2G8ZA 4A4AA 2F61A 2VX5A 1OINA 3SUWA 1UR2A 1KTBA 2ZX7A 2YL8A 2VVNA 4C7DA 2NT1A 1H0IA 1I1WA 3AS1A 3CC1A 3KL5A 1V0KA 5FCZA 1JZ8A 4V27A 2D1ZA 3DYPA 5BWFA 4AMCA 4AEFA 3RM8A 2GK1B 2WKLA 3WD1A 1BVNP 4LYPA 3AICA 4W8LA 3AISA 4Q7NA 2CESA 4BA0A 3RILA 2VR5A 2DSKA 3VNYA 1G5AA 5FL1A 2XN1A 3AFBA 3AJ7A 3VINA 4U5KA 2E8ZA 4LQ1A 4P8UA 2CHOA 4IISA 3VSUA 3EDEA 1VFUA 4UFLA 3AXIA 4HA3A 4TTGA 1GQJA 3O2LA 1EDQA 3BVUA 3VD7A 2VURA 3VO0A 5BXTA 1JZ3A 3MUZ1 4QCFA 3U7BA 3VD3A 1GHSA 4HOWA 3SURA 1PX8A 1CZ1A 2CHNA 3VGGA 2E8YA 1J0YA 3OLDA 1VJZA 1WDSA 2CKRA 2Z1KA 5FKYA 1ISXA 1TQWA 3KEHA 1PAMA
chains in the Genus database with same CATH superfamily
2EYSA 4IRSA 1A14L 1E9LA 2X4UB 1EJFA 2G4FA 3I2CL 3GM0A 1CDYA 1X5JA 4XVTL 2ODOA 4RKAA 4B5UA 5D1QC 1RULH 3PZNA 1TZIB 4XWOC 1G6RA 4PJAE 2HMID 3MRDA 2A99A 1Z8AA 1KLFA 5KJRL 2VI0A 3BWUC 5EOCH 3TT1L 2VLJE 2QQKH 4YBLC 4E8CA 4G6JH 1OPGL 4GKZA 3B8IA 2HLFC 4KCVA 4HBQA 3W0WE 4Z3TA 5FYLH 4QOKA 4OFKA 3QW9A 2XFXA 1LTDA 5I1KH 2Z1BA 3CH8A 2HXAA 3POHA 5IHBA 2F68X 3QJSB 1XB6A 3ZVHB 2G95A 5F7DB 1OYBA 4FF9A 1N68A 3JVFC 3N4EA 1Y0EA 4P2YA 5C0DA 4IGSA 3QIUD 1VZIA 3U9UB 3P2BA 4AW4A 4NZUH 1HTIA 5C0IA 4EF9A 1NDWA 3RNDA 4HUVA 4AF0B 1J1PL 2DQHH 2MH4A 5C0QA 3GH7A 2D3NA 4AD0A 4PBFA 2H41A 3NQ8A 1WF5A 4ZPTA 1V3JA 3LNHA 3QIWA 3IDYC 1GTFA 4L5FE 2F7FA 1NU5A 3B9AA 1YLVA 1XZ0B 1FJ1B 3N06B 4LCWE 3WLMA 2CPCA 3UJSA 1PTGA 2EIEA 1DL7L 2E9IA 2FX8H 4ABUA 4ACZB 1NF0A 1CTNA 2YEZB 3IDNB 3FONA 5MEQB 2F58H 3UG3A 1MQKL 4UTTA 4C60A 1I1YA 4I90A 5FKPB 3FHEA 4ZO8A 2WTOA 1V51A 4MSSA 2ARJA 2XY1A 2R23B 2A79A 3QUYC 1Q9KA 1CR9H 4WU7B 3BQ6A 4G83A 2GWNA 3RUGB 2V5DA 3ZDWA 3VSVA 4ACYA 2EKGA 1N6QH 3EGSA 5DVOA 4GCAA 4I9AA 1K85A 3QH3B 2CDGA 4M48H 1GYMA 4C56D 3ZE1B 3EYQD 4WY0A 3US9A 4EDWL 2ZPKL 5IEKB 2GTZA 4HJJL 1F4WH 3THCA 1VHNA 1VCBC 2ZXWB 3TIDB 1MI5B 2I9EA 4JGMA 4OUEA 3N9GL 3TXAA 4PWJA 4HHPA 1KPUB 5D5MF 3NYZA 3IFLH 3IVSA 1BBDL 5IVXB 5I1DA 1RA5A 1MVUB 3S1XA 4KH2A 1C29A 4FQCH 3I9IA 1DJYA 4Y8FA 2XWZA 4L3CA 4YWSA 5DUPH 3BJFA 3SDAD 4Z0JA 3AWFA 2I9UA 2DZEA 4MAYB 2CLIA 4YIQB 2HG0A 3SQOL 2VYRE 4S3KA 3O0RH 2ZZ7A 2ZCKH 4FJYA 4V2CB 4WEEA 1YADA 3KPRE 4WFGE 1V6TA 4ZQOA 3B7SA 3QZ6A 2WLZA 4Q97A 4QDMA 2W66A 2WWOA 1GW6A 4D1JA 5BXFB 4TLUA 1XR8A 5G2NA 4WVXA 4PREB 2P0IA 4UTWA 5LGXA 4HSQA 5I06A 4PBEA 4XPHH 1FCVA 1D9KB 2OJEB 3A6CH 4CNSA 5D2NE 1NCDL 3QSRA 4GH3A 2OPJA 1S2TA 4DPCX 3HZYA 3T3PF 4IXXA 3VFRA 4HAKA 5H8PA 4PMDA 5HHPA 4FQXA 4Y1AE 1S7VA 4AWUA 5EFIA 3ZIZA 3DX3A 5KMYA 3NFNB 3TZVC 4AMXA 3PAOA 2A6KA 1JNNH 4DPRA 4G9FA 3KS0J 1QNVA 4RMVA 5AZ2L 2HEJA 1AXIB 3MSDA 3ZKSD 3E2RA 1WZAA 4TNVF 4RDWA 3REQB 2DWDB 2YD4A 1T6BX 3LBOA 2XXMB 3NL6A 2CGYA 1DTUA 1GVSA 5IW1B 4XUGA 1FWRA 3F6JA 1LEIB 3VXPA 1R8LA 1CW2A 5CGQA 1M41A 1DQTA 4PJDE 2BFVL 3OHXC 3I7QA 5CXPA 2J75A 4I77H 4IBQA 1R3KA 5HMFA 3KFTA 1NQBA 1SJXA 2BS9A 1IAIL 4XUYA 5D71L 3CTTA 3OYZA 4FC3E 2JF6A 1RZFL 2GK0A 4H3DA 3K13A 3GGWA 5D2YA 4JM2C 1X38A 5IY5B 2OTDA 1RFDL 1MCSA 3NQAA 3RE0A 1XSOA 4Z7UF 1VPQA 2D7TH 2AOSA 2QSQA 1B3VA 1E5CA 4F80A 1AOHA 4B95C 3DXAD 3EYVB 5FFGA 1J48A 4Z1AA 2A85A 4R3SA 5C0GA 4QQUA 1HSAB 5C0AA 4U6YB 4YL9A 3ESUF 4QJ5B 2AQSA 3V0TA 4NT0A 1HOCA 1TV2A 4N2IA 1KNWA 1UWRA 2NQ3A 1CT8B 4OLEA 4YE4L 5C3IA 2IQDA 2VDNH 1LO0L 3TA4D 4WO4A 1WWWX 3TFKC 2IQ9H 5D7IE 1SF3A 4R97B 1EO5A 2PLKA 2ZCLH 3DJSA 4YSAA 3L3GA 4MJ2A 5FESA 1XI3A 4DPAX 1AO7E 4H5SB 4M1CC 4PLKC 4AMWA 4MYWB 4IBUA 4HETA 1E1CB 3PWLA 1EF3A 3ESMA 4BM7A 3OKDB 4L3EE 2J2ZB 3IAQA 3QW3A 3LTVA 1T83C 4AT6A 3CFMA 4IP7A 2GKIA 3ESPA 4HZ7A 3SDXF 4H8UA 4Q9CA 4KFMA 1YNQA 3V4UH 2VDRB 2BNJA 1XH0A 3B1TA 4WI9A 1JN6B 4CMHB 3IUIA 4BUQA 2QDDA 2B31A 2J7EA 3QF0A 1OAYL 1IXNA 3ZTNL 3ES7A 3VKKA 3RLSA 2OLDA 3EH1A 2K45A 2ZJSL 3U79A 2JLPA 4LEXL 5BOEA 3LLFA 4G7FA 4ES4A 5INDB 4Q6XA 4GBUA 5DMKB 1PZ0A 3HG1A 2WMKA 5CBAB 2E7LA 1G4PA 4KAQL 2J6EL 3FTZA 2UZXB 1KLZA 3LPFA 1QPPA 1ZSHA 5KZ6A 5IR1A 1B30A 3HIZA 3W2NA 5E4EB 2ZUMA 2MQ3A 4ADIA 4XVTH 1KTDB 1AE6L 1KTNA 5IBXA 2GW5A 2YRBA 4GG6F 1NEZA 3U30C 3FA3A 4KX7A 1MQQA 1BXUA 2FZDA 5DQJA 3TAKA 4WUKH 5KJRH 1DPMA 2J6VA 4PB5A 1OPGH 1TMLA 5G5DA 1LEGA 4BFEA 1QLEB 3CK5A 3GDLA 1XRFA 5E9DA 3OZMA 2XFXB 5C9JB 1RJYA 1E0WA 2R1MA 3LPWA 4S1DD 2BVQB 2QVNA 3OQ8A 2C3WA 3RK8A 3UBXA 5DI8A 4ZQRA 3RX4A 2Q3AA 1GRWA 3HJ0A 4LNYA 5CGYD 4GAAA 2BP0B 5DK2B 4D0BB 2B9AA 3FUHA 3LKQA 4JN8A 4B91A 4XVSL 2HTKC 1UURA 2MQ0A 5GRZA 4OLZL 5EF0A 3ABSA 5KTLA 1CU4H 3LEPA 3NWRA 4HPHA 3VA2C 3C60C 2I5GA 2ZA2A 4R90L 3LIZL 4HPOL 3ULUH 2X09A 3GQFA 2VAJA 1JNJA 1WAAE 2YZ8A 4P04A 1O7AA 3QIWB 2Y8UA 2NUPB 4IHOA 5KSBE 3RYSA 1V3LA 4AX7A 5D33A 4NT6A 1DL7H 3MFGB 4NL1A 4NX0A 1ZLPA 1R3QA 4U05A 4IJ3B 5DTFB 3FONB 3ZKNC 4ZTXA 2DZXA 1URZA 2WQAA 2R69L 4NJIA 4DYKA 1HWGB 1KOAA 4J5NA 3OG6B 4JHMA 2V2CA 3QR2A 4OFYD 3OR7A 2BASA 1P5VA 4R5VA 2WW5A 1A53A 2GT9B 1NCWL 3VIMA 4L1WA 4O10A 3GZQA 2VSKB 3B8SA 4U7SA 3NSDA 3MJWA 5I28A 3VVGA 1IEXA 3TN6A 1MCWW 2WHMA 1IRAY 5HHOB 3WMPA 5GZOD 4NPYA 2Z7KA 4FD0A 4JY6A 4GNJA 4FCHA 3S35X 5JORB 3NPZB 5F89B 8CGTA 3K1DA 2EDKA 3OJDA 2ZDSA 1L6ZA 2B2XL 2CDFB 5IK3A 2RDUA 4EDWH 4MWAB 4AZBA 3NEOA 2ZPKH 4HJJH 3N19B 2GTZB 3P81A 5HXMA 1E9OA 4IDLA 4JJOA 5C8BB 5ANMB 2Y63A 3MRIB 1U8NB 3N9GH 2O6FA 3GH5A 1KYFA 2CJSA 3UYCA 2FEEI 2OT0A 2WOQA 4ZVJA 3QPEA 5F3BB 3WH9A 3FK3A 1F90H 4YNGA 4CRPA 1A5FL 3G3LA 3WKML 2QVMA 3ULVC 2OU4A 3ULSB 1BF2A 3L9CA 1FDYA 1EZWA 2DJLA 5IP4A 4U1SB 1R9XA 3VXOA 4ZX6A 1RD5A 1IZCA 4FFVC 5DJ2B 3BISA 1V0NA 5ID1B 4BEIA 2CBUA 4NZ4A 3OZLA 4JTKA 4FTVD 3WMLA 3JV4A 1F3DH 4I9WE 2P45B 2NYKA 5FS5A 4L4VD 4XVEA 3K5RA 4Z0XA 2B5IC 4PJ5E 2XN9E 3SCSA 2G4JA 3MP5A 1DQML 4PFEA 2AJYH 1A4KB 1Z48A 3MV11 2F2KA 5ACMA 4N7QA 1AW2A 3UPRB 1MQ8A 4PJCB 1AXSA 2GTWA 4ODVL 1NCDH 4DJEA 1DSYA 3HZYB 3FUDA 4LY8A 1S7VB 4X6EB 5EFIB 2AQQA 4Q6IC 4Q8BA 2X9YA 2PPEA 1EAPA 2KI6A 1GYLA 1ET7A 2A6KB 3DETD 3RX8A 2V7HA 3NEXA 3HI5L 2R2EA 4XAZA 2FLMA 5C8JB 3W4RA 4XTRC 3WNPA 3RGVD 3WD5L 2YDSA 2XT1B 4LW7A 4LLAA 2MRYA 3GG0A 3BVJA 3ARBA 5AYYA 1NAMB 1NCOA 2Y61A 2NQHA 3UR5A 5BRQA 4JTTA 1TXKA 1Q63A 2GOUA 3GXTA 3BUDA 4GXVL 4I18A 4PTDA 4MADA 1FA2A 4C83A 3DUUB 4GISA 4U7KA 4V1DD 4OJDH 1TEFA 3QWOB 2EEAA 2EXWD 1AYOA 1IC4H 1MRFL 3WDRA 3G1VA 4ZW3A 2ZICA 2BHZA 5LDUA 4KO6A 2XVPA 4PJ7A 3EKLA 1PVNA 2X40A 2ASHA 3HFFA 1R3KB 3ARSA 4L8DA 3LM3A 3P0XA 3WQ5A 4QTGA 3VXSA 1XD0A 2HJPA 2PU1A 4I4WA 5D71H 5JPMC 2HB0A 5F6IC 1C9SA 4Q56A 1RZFH 1HH9A 2ATAA 4RW5A 5HANA 4MKSA 1YPZA 1JCNA 1UWAA 3GYRA 3MMUA 4BQBA 1RFDH 4OLWL 3NQKA 4DZHA 1I3GH 5A2BA 5E23A 2Y6TE 1E2WA 4QIUA 4N4PA 1HKMA 4IPJA 1WA3A 2WQVA 1GZHC 4AOFA 4P7RA 5XIAA 1JZ5A 1XINA 3LN3A 1TENA 1I60A 4PMFA 1P0EA 5C0GB 1YMHA 1LD9B 4MMYA 5GPRA 4JREB 1SJAA 5DO8A 3MUIA 4X6FB 3QUZD 5KSAD 3ZL4L 1Y0LB 2HE8A 4KKXA 3SOBL 3FPXA 4MD5B 3F8UB 4YE4H 4K8EA 2YZRA 4WO4B 3M0ZA 1U1HA 2JEQA 4U1LB 3W87A 3K30A 3AXLB 4E41A 3SD2A 3MNVB 1OABA 3M1BA 3R18A 3BPOC 5IHHA 1DIOA 1UHVA 4P46C 2Z7UA 4URTB 4FF7A 3L3GB 5SWSD 4NQCE 2F53B 3WY4A 1ALDA 5I16A 3GYEA 5FF2A 4Y4KB 5A6TC 3VOIA 3PCYA 5TTRA 3Q06A 1YE6A 2O7QA 4H00A 4A3QA 1KY7A 5DR5L 4E42B 1PDZA 2CHWA 3ESVF 4LDCA 1P7TB 2P8LA 3FQ4A 2Z31D 3MCYA 4KMQA 3RWEA 3SODB 2UY5A 1M6OA 1TQCB 2ZC1A 3L5IA 4BFGA 1TZGH 5DK0B 3VNZA 2J20A 4DELA 1G0CA 3W2DH 3H2MA 1XQKA 1EDHA 2GFTA 3NIGF 3EWUA 1TRDA 5GGSA 5LN4A 4ZXBD 3USBA 5CEZD 5H1WA 4Y16C 2X7LA 2VUOA 2APWA 2FO8A 1MIML 3ZRSA 3Q5YA 3LKNB 4NBXB 1HINL 4R2GC 3LMZA 1HG3A 4MPKA 4OUUB 4X8GA 3NGFA 2WZ5A 1BM7A 2DIKA 1G7UA 4CL7A 2ZKMX 2YCKX 3B0VC 3B8YA 4BFNA 3VOHA 3VC6A 4WGWB 1JRBA 4YFDB 5C0JB 1GS7A 2OYMA 1R5IA 4XP4L 4KAQH 3FRPB 1P4CA 6FABL 3A0OA 2J6EH 3H9YA 1EXBA 1AHWC 3HNVH 4P2RA 1A7OH 2CC0A 1NFIA 5IR1B 2OK0L 2BBFA 3RDJA 4MZYA 3FEQA 4NBZB 4B50A 1AE6H 2YUWA 1HZLA 2GPZA 4XCCH 1W8OA 1M7UA 1J11A 4LSQL 3UWVA 4NUJA 1W31A 5JNYB 3UZ5A 3D52A 3VTRA 2BWGA 5CZJA 1GKQA 3GXDA 2JJTC 1QR4A 4Z77B 2EINB 1LROA 5ECUA 2ZZ6A 5CAHA 5JQ9A 2Z25A 3O3BA 3BVDB 4G6KL 4AFYA 1KZYA 4B9PA 1FNGB 4IKIA 5TH2B 3QDJB 2YL9A 5HI4C 1MMFA 2VDNB 1XSIA 4QNPE 4KPHL 3V9FA 3MXWH 5EEUA 4Y1TA 1AACA 2E76C 4XVSH 1KFBA 3GI8L 3QSTA 3PNUA 1EFQA 3GUTA 4TUFA 3ZRCC 3A4WA 4OLZH 5IVOA 3ZHKA 1YHPA 4TSAL 4NWUL 5D1ZA 2F7IA 4FXSA 2RD0A 1TO3A 3PP3K 4JY5L 4R90H 3LIZH 5AFDA 2F61A 5DDHA 3BJSA 4JQ3A 1RK6A 2NT1A 1IIKA 3CAFA 1TQXA 5JHDE 1EFXD 1JZ8A 4IHOB 3WQFA 5BWFA 1KPVB 1J5DA 2AC0A 3QW4B 4NT6B 1OHQA 4O8RA 3UJRA 1GK8A 4YC2C 3RHGA 3VINA 4E9LA 3CD4A 3QYCA 1J8HB 3E0GA 3NIDB 3ZE0B 1CDHA 1GHSA 3SW6A 4FALA 2R69H 2IOOA 4LKCA 1S9WB 3H2CA 1MEXL 3W7DA 1F3RB 3QOMA 1JZ6A 2JIXA 3FKKA 4FB7A 3ZIMA 1H7PA 3S8HA 1NIUA 1JL8A 3S98A 2CXGA 4AD5A 3UAJD 1Y07A 5SWZA 3LDVA 3F4NA 3E9UA 4I0KA 4NPYB 1A9VA 3UIZA 2FZ8A 5I77A 2J6EA 3F58H 4ONFL 3WJYA 1LJMA 2B2XH 5IK3B 3LH9A 1QTSA 3KYKL 5SX5K 4PCTA 4Q8VA 1DBBL 1M05A 2VDRL 1RKRA 3OAWA 4NZRL 4L1XA 3HE7B 3GUWA 5IJVB 2CIKA 1U3NA 2XZZA 3JTTA 3H9SA 4RFEA 4ZQKA 1U8LA 2NZ1A 1A5FH 3VFPA 1ZRUA 1IJNA 3ZL2A 1L6YA 4FLRA 3CPGA 3U6WA 1PZ5B 1OSYA 1K8CA 2FATL 1KZQA 5ABGA 1ZA6A 3WKZA 4D7PA 3DDFA 1DSWA 1YVLA 2IVFC 5FAGA 3MBED 4HN8A 3SE8L 4KK8D 1G84A 2AVGA 3BUTA 1LO3L 4ZBJA 3WJLA 1AQ8A 4IGBB 3FN0L 1IU1A 3OJMB 2BVUA 4PJ6A 3SRHA 3VXTB 4JR5A 3QPYA 2ATKA 2ATPA 4Z0XB 4XNQA 3BGAA 3CMOH 4XN5A 1DQMH 1MUCA 2FIQA 4HDIB 4G70B 1H09A 3SJVD 2C14A 2XPKA 4IUGA 4GRLC 2HK0A 2J7DA 3QZLA 2ZG2A 1MJUL 4NZ3A 4ODVH 2B16A 3TYFA 1Z44A 3TASA 2Q2LA 1ORSA 4K3EL 4KIEA 1K4CB 1G0XA 4Y8DC 1TDQA 4M1GL 4KI5D 2OX5A 3QDGA 3LIZA 1I85A 1P5UA 1RLCL 4QGCA 5JPNA 1W8EA 2X2GA 4BKLA 4URKA 2R15A 3VH8A 1K77A 3W83A 3QGVA 4HT3A 1QLEL 3HI5H 5A3IC 1HYSD 4QHLA 2OMNA 1RQ5A 4ZFQA 4LDEB 3WD5H 3O41A 5H2BA 2XFRA 4ZUWA 4A6YH 1JTTA 4OM0L 3UERA 3PFMA 4M5PA 3M88A 1J0KA 4AD2A 4DK5A 2PLCA 3QXVA 4GXVH 1HS6A 3QJRB 2R69A 4MX7A 3HG5A 3ZYIA 1SZNA 3GSMA 4FX6M 3OSVA 2WZIA 2OKOA 1JCTA 1MRFH 2GQ8A 3S34L 4DN3L 1UB3A 1KELL 2ZUNA 5HGGS 1PBGA 4KK9D 4L4TD 2CZEA 3UWUA 4R7XA 3EOUA 3B2DC 1QBAA 2NXYD 5HYJE 3C3NA 1G7JB 2DAVA 3JWOH 2WYSA 1Z9OA 3VWJA 2BB0A 3RZCD 1S9YB 3BQUD 4P05A 2W38A 5M95B 4I4WB 1I6NA 5HMDA 4B97A 3DX1A 3DG3A 1CTOA 3ZDZB 4IHBA 3ONCA 1ZAJA 3LCFA 1HH9B 5DN1A 4K7PH 5C09B 5DK3A 1S39A 4RFNB 3MQTA 3WNLA 3BOLA 4KH9A 4OLWH 2W60B 3I3DA 2HBXA 4DQOL 4FZEL 1HHIB 1EPFA 4QRPB 5ABZA 1F97A 1G1YA 3T40A 2KZBA 2KC0A 3C56A 1R3RA 5ANHA 5T1KA 1UD2A 2GK1A 2DLHA 1FIEA 2ZADA 1FZMB 3LI1A 3UTPD 2VMEA 3UZJA 3QI9C 3OSKA 3S9DB 2YARA 3LXUX 5B39G 2KAUC 3SOBH 4BWLA 4O2EB 1R46A 1H6FA 3QBTB 2JMRA 4FNSA 5FF0A 2AQ1A 3AIEA 1OSPL 3PBGA 3GY1A 2PCQA 4M5ZL 4B4FA 3QQWA 4JFDB 4JTAA 3DUHA 1FF5A 3JXAA 2X4UA 1XR9A 4F37F 1CXHA 5I16B 2H2PC 1ITUA 1UD4A 4PVMA 4G6FD 4NC1E 4BJHA 1TZIA 1RULL 4Q4MA 3VZYA 1SY6L 5DR5H 2UY4A 1D7BA 4UDUA 3L1FA 5EOCL 2LW3A 2QQKL 2A4EA 1Z5HA 2P8LB 1G94A 3C09B 1ECZA 1DHPA 4LAZA 5DLCA 2E5EA 3PRZA 4NGHL 1DQKA 1TPEA 3ZHDA 5FYLL 3QDMD 4W4QA 1T80A 3CFBB 1MHCB 2ZZ5A 3AYVA 4WFFE 3SR7A 1IKNC 2AJXL 3TN0B 4A6YA 5BRZE 3ZVHA 1MIMH 2IADB 2V7NB 5F7DA 4JYEA 5L2KD 1MJJB 4C4UA 2NX5E 1HINH 1THFD 3ZT7A 1DN2A 1H1NA 2Z7WA 4JGUA 3KPQA 1QPNA 4NIRA 1LLZA 4GY4A 1CPUA 1W5OA 4IMDA 3U9UA 3MVTA 3S2CA 4KV5F 4NZUL 4F15C 4DETA 3IAPA 4H9XA 4PV8A 1ETA1 2VRAA 3L6FB 3U1PA 3LZNA 4PJ9C 2DBLL 2XWTB 4ANKA 4XP4H 2A3BA 1FBAA 6FABH 1X39A 3ZXAC 3G7TA 2B7OA 2QUMA 3IJIA 2ZSVB 4P2RB 2J8GA 2NX3A 4AG0A 2WUBH 2OK0H 5H94B 1ZJHA 5IROD 3AWOA 3KUMA 2PMQA 3NACL 1XZ0A 1FJ1A 4YXLH 1T66C 1TELA 4NPJA 4APQD 1G9NC 2PCEA 1OGGA 4NP4L 2ZXEB 4NUJB 1N55A 3L17A 4ACZA 1NAML 1ENUA 2YEZA 1E6SM 3IDNA 1E5ZA 5DFWH 1FOBA 1H2JA 4PY8I 5FKPA 1A4LA 4QHKJ 3U4KA 3TM6A 1R3HA 2R23A 4TF4A 3L67A 2A3TA 2E6QA 1E5JA 4WU7A 4G6KH 3RUGA 3AWGA 3VXRE 2GHZA 3UYIA 4WIWA 4ONGL 4AUJA 4ENED 4HG4K 2BIQA 5EZLB 2ACRA 2Z24A 1X9RA 3MWAA 1U2HA 2VLKB 1N6QL 1H3UA 4S11A 3FTXA 3VGBA 4KPHH 1IFRA 2XWDA 3QH3A 3BAYA 3FFCE 5EDSA 4NU7A 1ZB5A 3W3OA 5IEKA 1F4WL 4E68A 3TIDA 1MI5A 4TSAH 2Y9RT 4NWUH 5D1ZB 1QW8A 3ID7A 1J9CT 1GC1C 4JY5H 4KKNA 3BKJL 1KPUA 3BC9A 1A9EB 3ASOB 3V5FA 3IFLL 5IVXA 2WBKA 1RZ7L 4P8VA 3OB0K 3C2EA 3UH8A 5EIIB 5C2UB 3DX7A 1NC2D 3L21A 1P6FA 4UMGA 3STCA 4NOFA 4O0QA 1Z9NA 1ISVA 4QJ4B 4MAYA 3AREA 1XB3A 4MA8H 4YIQA 2OJZH 4GRWE 2ZCKL 4RR4A 2ATSA 4Z7VE 1TUFA 4BCEA 2WCPA 2JI2A 3D3AA 5BXFA 4N90E 4KCTA 1L9MA 4D9QE 5J89A 1MEXH 1W9VA 3CV6A 1V6UA 4DXXA 3WBYA 2JIXB 3TQVA 4XB8A 1N5YL 1OCRB 1D9KA 4GYFA 2OJEA 2CKBH 1YUKB 2A4CA 4NN7C 1BVWA 2QV2A 3BZEB 1CO1A 1MG2C 1TLMA 3OBEA 1K8ZA 4N0YL 2IH8A 1PJ9A 4O12A 3NFNA 3KYKH 1LBMA 3DX8A 5PAZA 1W91A 1DBBH 3PWIA 1UG9A 2VDRH 1M05B 2VRKA 3WIAA 3NVTA 4HFUL 4NZRH 3HHSB 4R4BB 3EG9B 1ZJIA 1UMYA 1ZHKB 5E2TH 4ZENA 4HNCA 4NJJA 3REQA 4ZQKB 4KTDH 2DWDA 3NGBC 3K1KC 3WH5A 3HLKA 1WPCA 2FATH 2A83B 3GS0A 2DT1A 1VB9A 1ZLWK 3BP6A 5GS3A 3SE8H 2NQCA 2WQSA 1MFCH 1LO3H 2OZTA 3NSXA 8XIAA 3FN0H 4L0PB 4H7VA 3D87B 1P2CB 3VNIA 3BLLA 1R2SA 2OJPA 4RLIA 4AQLA 4YFLF 2NW3A 1MKFA 1OTSC 3JUYA 4XBKA 2V5CA 1BJ1H 4ZTYA 2PPCA 1RD6A 4TUUA 3NZGA 4LU0A 4YSSA 4JFEA 2UXGA 2FKPA 1N18A 3AWNA 2C13A 4K3EH 2NTSP 1UWUA 4LEOB 5T3ZD 1NP2A 1GOQA 2E09A 1KEML 4M1GH 2CWXA 1IUZA 4GE8A 5FB8B 4Y9GA 2PDPA 5F9OL 1DTNA 3SZ6A 1QLEH 2D7TL 5T26A 4ICCX 1BD2E 5A7BA 1EJRC 3EYVA 1B3ZA 4LUIA 3O41B 1HSAA 4U6YA 5H2BB 2Z65C 5FF7A 3NL2A 3KWVA 4OM0H 4K8HA 1CT8A 5AAPA 4FFYL 2VDNL 4D8OA 3L95B 2QGYA 4AU0A 3U83A 5MKGB 3PZ9A 3CUIA 2Z7GA 4Z7NE 2DFAA 3E6HB 4I7VA 3FKUS 2EPHA 2ZCLL 4I1PA 1AQKL 3D48R 1EXHA 1BSIA 3S34H 3QIBC 4DN3H 4S3CA 1Z9AA 1LM8V 5C07D 4ZUUB 2CKBA 4TQHA 3ZKMD 2YR3A 4WU5B 2R9RA 1R5VB 4H5SA 3G1DA 5B7ZA 4QR7A 2CMRH 3Q13A 3B06A 1EEZB 1K8IB 1UB6B 3H8AA 2RFGA 2VFHA 1E1CA 1UWSA 3DFNA 3MHGA 3OKDA 2J2ZA 4N2CA 2VCCA 4AEIL 1OAKL 3WQOA 3RGHA 3I6GB 5T5NG 4OJYA 3MV7E 3CU7A 4LLDB 3L5WB 1CXFA 1TITA 2E9MA 1JN6A 2WY3B 1ADQL 4AM0B 3ZLQC 4EE9A 4WGHA 5JW4R 2PA6A 3OG2A 3HURA 4DQOH 4FZEH 4YCPA 3K2MC 5JUVA 3MRMB 3GS7A 3GLZA 5F9DC 1VGAA 3M47A 5T1KB 4UCFA 4WY0F 4G11A 1DVFC 2ZRUA 5EOTA 3WENA 3H6AA 4IBSA 1E4HA 3KBNA 4HIQA 3NPUA 1FXPA 3UZEA 5INDA 5BVPL 5DMKA 4HQVA 5LCVH 4LC8A 1HVQA 1CYWA 2Z4TA 1AAJA 4M5ZH 3GTNA 3HB3D 3P62A 5AVHA 3UIYA 3TNNB 5AKQA 1XR9B 2X9XA 3D5HA 4XX6A 5GHWL 4MZ2A 1KTDA 4WFEE 5CFHA 5DS1A 4PU2A 3CT2A 1G7IB 1KCZA 3MCG1 3RWHB 3ZQ9A 2BW4A 3ETSA 1SY6H 4WUKL 4FQXD 4UDUB 4M51A 5FW6A 1WVZA 3JWDL 1JMXA 5AVNA 3QE5A 4E4FA 4F2EA 3OYXA 4NGHH 5E6SB 1UWXH 3CNYA 5C9JA 2YPLB 3MLTA 5DD3L 4OIFA 3B5TA 5JOPE 2BVQA 1S3KH 4PMRA 1B88A 2EH7L 4RMUA 1Q94B 2AJXH 5D37A 3PAJA 2V5RA 4A6YB 3HZMB 3QEHB 2BP0A 3W1LA 5DK2A 1DVYA 2W80C 1U5HA 1UOWA 5HOSA 4IJCA 3EWWA 3KPQB 5LAXB 3R8RA 1T7ZA 3BLDA 4D0BA 2C9RA 2G3NA 5B1CA 1EZSA 3T2LA 1DANU 3T6WA 2QKFA 2ESCA 1IE4A 2BMBA 4LHUG 3CMGA 4PV8B 5AVWB 5C9WA 4FFWD 3IPEA 1PTZA 2DBLH 4P06A 1KFJA 1CU4L 3LQAC 1ADOA 5J5RA 1JERA 1WC7B 3JYCA 4KKBD 3QV6A 3WNIA 3WNNA 3ULUL 2LU5A 2WXDM 4J3OC 3CN2A 2A9DA 4CDHA 4IRJD 2NUPA 3V0EA 3NACH 3S3BB 2ZX6A 2Z7YA 5KSVB 4HUXB 3STLB 1EZUA 5HHME 4A8RA 1RV6X 3GR7A 2CCRA 3V18A 4NP4H 2ZYIA 4O8AA 2R94A 3O9NA 2CHDA 1SDDB 3GXMA 1NAMH 2Y8KA 2XG9A 4K39A 5DTFA 3U9WA 3DFOA 1V7AA 1RH8A 2OCJA 3ZQWA 1PNCA 4MLRA 4F24A 4BCZA 4AVHA 8XIMA 4YNYA 1QKZH 3NM1A 2EABA 1GZPB 1R3HB 1PG7X 2PF0A 1DCLA 4OKDA 2GT9A 2JJWA 2GGEA 2MNJB 4ONGH 4MNHA 1GPOL 2K9UA 3B7TA 1BZOA 5A6AA 1WWCA 4AC1X 1TJHH 5HHOA 5LCVA 5A8NA 2APFA 3RNKB 5AYBA 3D6GA 5JORA 5F89A 2YPVH 3BSHA 2CDFA 4Z0SA 2WD0A 4MWAA 4LRSA 1OOAA 2VO5A 2BSLA 4OSUH 3WTSA 5ANMA 2PRLA 3MRIA 1U8NA 4GFXA 4B9GA 3BKJH 3WDJA 1UBSA 5F3BA 4CU6A 3KDNA 1F90L 4ZK8A 1KCLA 1SW7A 1SY6A 1RZ7H 1TTPA 5TDNB 2IH3A 3DX7B 1XSKA 2NQLA 2NVDA 3ULSA 4OFCA 1XBZA 4UR7A 2YCJA 3DU0A 4U1SA 4G1KA 1CENA 1ME7A 4AXWB 5E9NA 3U4EB 4QAIA 3AREB 5FLUA 2WZMA 4K9JA 2E6DA 1D6EB 5DJ2A 3W7MA 3GWJA 5ID1A 4Z1YA 3AOFA 3RTLA 1U42A 4XBJA 1AYRA 4ZGYA 1U91A 3BUIA 2O7SA 2VDMB 2D7QA 3T3MF 1E40A 4R7OA 1A4KA 1M71B 2AJYL 3NSCA 3NJJA 4QNEA 1CBJA 1N5YH 4NRRA 3UPRA 4JX6A 4PJCA 2J9YA 4P23B 1YEEL 5JZ7C 2Y0FA 4OY9A 5I30L 3UZZA 4WF7A 4CVUA 3LS5H 1OANA 4GD0A 3CSPA 2GJ6B 3VIPA 4X6EA 3N55A 5DD5L 4N0YH 2KT6A 3MO4A 3RPIB 4RZ4A 4FO4A 5GS0C 4LPVA 3DX8B 5EBUA 1FWGC 2ERJC 5C8JA 4HFUH 2Y5QA 3MZGB 3N3TA 3K74B 3WI9A 1M03A 3HO8A 4YWIA 4LSPH 2EC8A 4FIQA 1LL1A 1NAMA 4LAKA 3LEVL 5F3HA 1X5YA 3STFA 5IB2B 3OQEA 2O5YH 1QEWB 1RZJH 2O93L 4OUIA 1XYFA 3AGVA 4XODA 5J5EA 4JRFA 4PYGA 3BP6B 4RX0A 5I1CH 2Z6IA 2ED9A 1WUFA 3DUUA 4IOFC 1R3LB 2KLSA 1KR0A 3F7YB 5E9DD 3QWOA 1IC4L 4RDBA 1BIIB 2LAAA 5E56A 3F6LA 5DVMA 3D39E 1IXPA 3B7RL 4Z6AT 5KVFE 3IPWA 2XIIA 4X5LA 4RQQB 4A3RA 4EN2A 2MCG1 2EDMA 5G2WA 2FBOJ 2NW3B 5CD5C 3AG1B 3SUWA 5AB9A 3KL5A 2YPVA 4JFEB 2V82A 3K6OA 4Q7NA 4GVFA 2HN7B 3KDPB 1DUZB 4GPVA 2E75C 1UCTA 1KEMH 4XXDB 4KHTH 3PWNB 5HULA 2EIDA 1I3GL 1MEWA 1LO2L 3PPSA 5F9OH 2ZZ4A 1NWOA 4HOWA 2XJKA 4PB3A 3OKLB 3N40F 2X4PB 2WO4A 4OJAA 4F0HA 4GIOA 3WUWB 2YZ5A 2HMIC 2HJKB 1LD9A 2I1OA 2H6PB 4HIJB 3A13A 3S36H 4X6FA 4BFOA 3NRFA 1OARL 4ZZFA 3LLDA 4FG4A 1Y0LA 4MD5A 4FFYH 5BO1L 4JOMA 1PZDA 1VADA 1E15A 1VBJA 4MS8C 2ISDA 4NUPA 4U1LA 5C0BE 3AXLA 1C8XA 3MNVA 2P28B 3HA0A 3IAGC 1AQKH 3KBFA 2ZF9A 1LO4H 1HP4A 2OMAA 2F53A 5DBTA 3B4YA 2CKBB 4Y4KA 3ZDYF 3L08A 4L05A 3TN3A 4W86A 3QIUC 5DZ9A 4AEIH 1OAKH 5F72S 4E42A 4LUTB 5DXWA 3OVQA 4B6ZA 1P7TA 3IIZA 1WBJA 3HG2A 4BI5A 2XWBB 5KVEH 2R4SL 3VXMD 1TZGL 5DK0A 1I8UA 4PCKA 1EGVA 3W2DL 1ADQH 1JVOA 3BLOA 3OG3A 3R89A 2DKMA 3BX7C 3RU8X 2HVOA 3D9AL 2DMCA 2H26A 3UC0L 4ES8A 1JV2B 2FTAA 3LKNA 1OGBA 2KKQA 3EGXB 5IHZA 4F9LC 2QJDA 3MV01 4OUUA 4I3GA 4TMCA 1N8OE 5EOTB 4IX0A 5LGKA 1QSED 3IMUA 5JOFB 1JXFA 1DO5A 2QCMA 4JTFA 4UIMB 2VEPA 4PRID 1XIEA 3RR1A 5BVPH 3NA8A 3LBCA 4QT5B 5C0JA 2Q76B 2AEPL 4TQPA 5SX4I 3FRPA 4YMPA 5C9RA 2P0OA 2H8ZA 5FECB 5FJJA 1KLGA 3OBAA 1SW0A 3HNVL 5ECJE 1A7OL 3S2NA 2RTTA 4DESA 5FAAA 4GJ1A 3FDGA 5GHWH 1PZBA 3NBNA 4IYKA 1OGSA 2DY2A 5D05A 3PZMA 4XCCL 1J9YA 2VWEE 1LWJA 5IBLD 4KX8A 3SYOA 3FTGA 5JVLA 5JNYA 4QDWA 3VXGA 3T0ED 2GL5A 3EYQC 3JWDH 3R12A 3K8MA 1NSJA 1MCPL 2BX7A 4G8IB 4Z77A 5JR1H 2ZOLA 2V5LA 5DD3H 3MLTB 4MQXC 4X9FA 4UT9L 3E80A 4I9TA 3PZGA 3BGFC 3CAQA 2X42A 2EH7H 1FNGA 5TH2A 2ZXBA 2OMZB 4AQZA 15C8L 1USZA 1KF9B 3QDJA 4MMXC 3EKCA 4XN7A 5E0FA 4FFYA 5AVUB 3G6MA 1A47A 3HFML 3SDAC 2WWDA 4UZGA 3MXWL 3ZKXB 3HF3A 3IJYB 1MUWA 2JKJA 1I8MB 1B5TA 2Z9TA 3GXFA 1R87A 5TE6L 2IWKA 3PAYA 4X61A 3QQ0A 1KSRA 3LEYL 4UCGA 1A4CA 1DWFM 5B80A 4YVUA 3QYSA 4DP2X 4WXYA 1ZLUH 1MNUL 3UR7A 2RALA 3ARZA 4KPLA 2EECA 4YHLL 1KPVA 2WQXA 5MENB 2FMNA 2CLEA 4CD7A 4HB7A 1J0JA 3WLLA 2Y7SA 4M7KL 4ZTOH 3M46A 5CILL 1ADQA 4DIAA 5DA4A 4XPGL 1YG9A 1QPOA 3KJ4C 1R3SA 1J8HA 4PJ7F 5DCBA 5F7MC 3FL7A 5C0ND 4LOCA 2FEDD 3OZOA 2XTJB 4YNYB 2WCGA 1XDMA 1S9WA 3MRRA 1BXBA 4XWGH 2JTYA 1GEQA 4DP0X 3SGDH 4MNHB 1A3RH 3HS0C 1GPOH 2IDSA 3D0LB 5JQIB 4XO6A 1YPZF 4IFKB 4ZMQA 4UV7H 3QZBA 3P9MB 4KXZI 2NY6D 2HJLB 3LRKA 1WFTA 4C6FA 3O9WB 3F58L 3C5ZA 3LPPA 3TO4A 4L4MA 3W0KA 4MXQC 4X0VA 2VXTL 2E5DA 2FYVA 4PBVC 4X7CC 3UTSD 2RUSA 2DEWX 2HT4C 1XBRA 1WHPA 4TS6A 3HE7A 4E3TA 5IJVA 1TZAA 3LSCA 4TO8A 4OV5B 3VNKA 3KVKA 5HA7A 3HEIB 4ASTA 2NDGA 3MV9D 4D3CH 5A8GA 2IH3B 1PZ5A 2GABA 1ECQA 2CSPA 3B04A 2FWOB 3O7UA 3OQRA 1MEIA 4WSKA 3N3MA 2AXFB 3GFYA 3QMRA 1UWTA 2J1ZA 2HYMA 4MRCA 1OYCA 4FQ1L 3IARA 4IGBA 3FOLB 1I45A 4HU4A 4H8PA 3VXTA 4AXNA 1U91B 2VXSL 1F0LA 3OXRB 3CMOL 4QR6A 4HDIA 4RL3A 1WE5A 4ODTH 3IIVA 2POTA 1XGEA 3P77B 1YEEH 5FYKH 2BZNA 5I30H 4CD6A 2NXZB 2F1AA 5J06A 3LD8C 4AITA 1K4CA 2VDHA 3IJLA 5DD5H 2H0EA 5GJSH 2X2UA 1ZK5A 5AYUH 5BU6A 3OPZL 3ZYZA 4NUGL 2KQMA 1ED3A 1HCVA 4KQ3L 2XKUA 3HVNA 3P5YA 5L0QB 1NIEA 1CDIA 2G3JA 4XMTA 3TONA 2BY3A 2LFGA 5CPNA 4G5AA 1A2YB 4AJ0A 1K7FA 5C6TH 5LA1A 4Y2OB 4A6YL 2P3EA 1EGMA 2WKJA 3DX2A 3LENA 3LEVH 5F3HB 1CT5A 2HCVA 2ED6A 3PL6B 4L37B 2YHGA 3NZ8B 3FCPA 3R0MA 3ZZQA 2VT0A 1PCWA 1JDFA 3CS2A 5GJNA 3WK0A 1G7JA 4BZYA 3JWOL 5CN1A 5DHVB 1H5BB 5LGJB 1S9YA 3GBEA 2VE6A 3D2UD 4ODUA 1OP3H 1J5TA 2OLSA 1KJMB 3G5ZA 4K7PL 5I24A 5C09A 1RL1A 2XIJA 4I5RA 4F7PA 3W2UA 1M7OA 4EANA 5C86A 2W60A 2IPGA 1LO2H 5D1XB 2XSXA 1JCKA 1HHIA 4QRPA 4CAGA 3DX9B 2Y7DA 1DLHB 2UV3A 3AU2A 2O56A 2PSNA 4JG1L 2OXGB 1OVZA 2C3XA 1FZMA 2XN0A 1W3KA 3L3OA 2QQQA 3R0DA 4GRMB 4K8GA 3IXTB 1OARH 4N4QA 4A68A 4LDLB 3D3FA 4PVNA 5BO1H 2NZIA 4O2EA 1VADB 2V81A 3VIOA 1E3ZA 5IQNA 3SCUA 1H3XA 3WS6C 4JAWA 4ZTPL 4S1DC 4JFDA 4A2LA 2YBUA 2DICA 5DA0B 3G24A 1UEYA 5C08E 4JIIX 1VRDA 2AQRA 5CGYC 4KMLB 4AD4A 4AKQA 3BAEL 5IHRA 3A3XA 4JKMA 4I5UA 2Q7AA 4GS7B 3PFQA 4P9MH 2I5IA 5G55A 1QRKA 2E9GA 2X4QB 1GOKA 4DLFA 4EO5A 2R4SH 4PUDA 4FA7B 3APCA 3SN1A 3UA3A 2VD8A 3PDDA 1ZGLP 3CFBA 4HZ6A 1MHCA 3RR4A 3D9AH 4QE1A 2QADB 2H26B 3UC0H 3TN0A 1PKMA 2WZEA 3HZKB 2IADA 2V7NA 4M9OA 1MJJA 4AI7A 3H9SD 3CAKA 2VDML 4H20L 2OZ4H 5ABEA 5IHZB 4WW2C 4O54A 4OFVA 4OZFB 4IU2B 5I23A 5D7JB 1W17A 3ZMNA 1FP8A 1EV2E 2BC4B 4ERAA 4Z7OF 2WXFA 1NDGB 1RP8A 1WG3A 1AR1B 3SCTA 3L6FA 1LXMA 4OF7A 1J0ZA 4IIZA 3UXFA 2AEPH 5KN5B 2XWTA 3ZMRA 3VD1A 1IT0A 3O63A 4TQ8A 1AGBB 1KLGB 1CG9B 4NQDA 3FB5B 3ARGB 2BV9A 3KHOA 2YS4A 2WNQA 2ZSVA 2WUBL 5F2MA 5H94A 1UZ6E 4FI8A 5DGQA 1IO4C 5GRJL 1AZNA 1H3TA 4YXLL 1D6VL 4BS0A 5FO8B 3EO0B 2ZBTA 4O02B 5GZOC 5DJYB 4K5LA 1ZXKA 1SM3H 4LCYB 2YL6A 3FTGB 2F9BT 1RBAA 3KWSA 1TR9A 4GA8A 1KW1A 4XN2A 1MCPH 1PXGA 1BG9A 2B20A 1JF5A 2CLLA 5FV1L 1B4KA 2ZOLB 3D8MA 2MUCA 5B8CB 4WJEA 1LL7A 4UT9H 2XFYA 3ZDXF 1NM9A 4UQDA 2DJXA 5EZLA 2DQXA 1J2WA 4FHKA 15C8H 2XQYG 2VLKA 4PD4J 4GBXA 3HFMH 4HKPA 1Q45A 1G7MA 4RE2A 3AU0A 4K3DL 1FZKB 5M5DA 4I1RA 1FVPA 4XPBL 5E5RB 3DUSB 3L7FB 4LO9A 3P8IA 1QO5A 1KLYA 4E2VA 2DZUA 1W3HA 3ITTA 3W85A 2H3DA 5TE6H 2XBDA 9CGTA 4NIKB 1CYXA 2WXPA 4TXEA 3S5ZA 3LEYH 4WK0B 1A9EA 5L9FA 3TJIA 5D7LB 4W6WB 1F2XK 5EIIA 4DKEL 1MNUH 4GKSB 1UUNA 4YHLH 1R3IL 3QNZB 3FXIC 4V2BA 4DZAA 4KRNA 4MAZA 4LVEA 4Q4QA 4M7KH 5CILH 2FQIA 1U58B 4MA8L 2OJZL 4XPGH 1GPFA 4N26A 4PJ8B 2YBRB 4FEMA 3F7VA 1CD0A 2YAFA 4DXVA 4FADA 1ACXA 1H19A 4AM0Q 1XC4A 4FXKC 3MRRB 3KRSA 5DZPA 3ITLA 4HVBA 2BSBA 4RNIA 1WZKA 1YN6B 4PVBA 4F8OA 4WI0B 2DWTA 1QI3A 5DF0A 2K7QA 4P7OA 3E3QE 2CKBL 4KO5A 4LLMA 3BZEA 2V8LA 3SYAA 4U1NB 1FQ0A 2YUZA 2V5YA 2W62A 3LKOB 1GYWA 1AKPA 5JIQA 3LTSA 3B9VA 3C5ZB 5HWJA 3RIFF 3TO4B 2EXWC 2VXTH 4YLQT 3O6AA 3W7LA 2ZWYA 2DQJH 4W7WA 2XXCB 3HHSA 4R4BA 3C5QA 4FAAB 3EG9A 4Y2WA 1W15A 1FC2D 2W0UA 1ZHKA 3E9AA 5E2TL 3PU7A 3QY6A 4KTDL 4Q7DA 1UM4L 4I9XA 5GNYA 3WQPA 4PV9B 2NVAA 3UPMA 1OAQL 2A83A 1IE5A 2W79A 1W37A 1TEGA 3T55A 4P7QA 1G0DA 4JIEA 1ZT7B 1NFDB 1M1XA 5HR7A 1MFCL 1EDTA 1V02A 3MUGA 4QLKA 4FQ1H 4UT9A 3JWNC 4XAGA 3CTLA 1P2CA 1QFPA 4AK1A 4XCEB 3WTWA 2VXSH 4Q8UA 2P5WE 5IJCC 2FZNA 4LF1A 1O1HA 2FLRT 5F0LB 2IGTA 3HE6B 4Y9CA 4AY7A 4Z1PA 5CCGE 1DSFL 1XFPA 1JNHB 3QUZC 5KSAC 4LVNC 1LP9E 1CDJA 3IRPX 1NBZB 4JHUA 2ZUQC 4LEOA 1Q6OA 3SQLA 1A66A 1BYBA 4AL8L 1UR0A 4RNRB 5FB8A 1JK9B 3OPZH 4QM1A 1TPFA 4K3ZA 1LDSA 4Z7WA 4NUGH 2BVTA 1ED3B 1AODA 4AZHA 4JO3H 2OLAA 1WICA 1W0WB 1DVTA 3S6OA 4KQ3H 1ZHAA 3IIPA 2QZQA 4ANVA 3I6RA 2J71A 3STZB 5I6LA 2YAEA 2VC7A 1K6AA 1EVUA 3PSWA 4NZ5A 2W92A 1ILUA 4RAVB 1ITXA 4WI4A 2Z31C 2XWJA 1PFCA 4TV5A 4KF1A 1QHOA 3L95A 5MKGA 3E6HA 1EMTH 5EO0B 3GNPA 3GDRA 4S2SA 3DCPA 5EEWA 4PRPD 3WL9B 1FYHB 4M9PA 3VKDA 4ZUUA 5I07A 4WU5A 3CBKB 1R5VA 3GHUA 3K5SA 2BVWA 2KS0A 2CMRL 3P2TA 1EEZA 1K8IA 1UB6A 4N42A 4UTIA 4JPWH 3TXVA 4GXUN 4U6VL 4MMZC 4W9LC 2VFDA 3I6GA 2VE6B 4ALAC 4ODUB 5G1MA 3V1HA 3MI2A 4HAFA 2PF8A 4NVTA 4KO9A 3OGOE 4WNSA 4LLDA 3SE4C 3L5WA 3G5ZB 4NN6B 3RUGF 3TSBA 1W9UA 3HOGA 4HSNA 3H42L 1PZCA 4AM0A 1PCXA 1CTMA 4F7PB 5FLVA 1BFOB 4WZHA 4GZEA 2HTMA 4GPNA 2J79A 3MRMA 3OZPA 2Z8RA 2C4XA 3BFQG 4XNZC 3RU6A 3VRLF 1IC7L 1TEYA 3ZE1F 4JG1H 2P7TB 4MXVF 3L3OB 3VVWA 3ZHFA 3O2WL 1GOGA 1MREL 2EEBA 4KETA 4JHWL 2V17L 2GGGA 1AL8A 4MDIA 5I1EH 5LCVL 1A0DA 1TETH 4KWUA 4LK4A 3NCFB 2L0DA 5IVXF 4K1WA 1GY2A 3BAKA 4ZTPH 3FOMB 3NSMA 3TNNA 4F7KA 2NT0A 1OW0C 4XMPH 3RTQB 5H2ZA 2ZAGA 4O28A 4EACA 1G7IA 3RWHA 3BAEH 2HZHA 4K71B 2F6KA 3QZMA 2TSAA 2K78A 4I2XB 2Y1ZA 2G2RA 4OR1A 2GY5A 4Y90A 1ZY9A 1H61A 2ICES 4NO5A 2YPLA 1H7WA 3ZJ8A 4WKXA 2J66A 1FHUA 3IDUA 2D31B 1S3KL 1WKDA 1GWJA 4Y7MA 1CBVH 2NRDA 1Q94A 4ZMLA 1A6TB 3DBNA 3HZMA 1VIZA 3KH3A 3QEHA 5DVPA 2VDMH 4H20H 2QHRH 1K4GA 3RIAF 5LAXA 1HKLH 1UR2A 4UYPA 1XW8A 2AVFA 1GR7A 1G7PB 4JW3A 4AQEB 1FTXA 4LS1A 4TX9A 3SI9A 2HNHA 1KM0A 4Y4FD 3FO0L 4UT6L 5K9QG 4OCLC 3N73A 2VSDA 3RILA 1H0DB 4K9EC 2QDEA 1XTMA 1G43A 3P14A 3S47A 2NY0C 1WC7A 4NQDB 4Y96A 2CGRL 3MUZ1 2YXGA 1OPOA 1ZOXA 3H85A 4R6UA 3RUBL 2PR4L 3SURA 1MLBB 5K59F 5GRJH 2FZMA 2KDYA 1AI1L 3WK1A 4JLRA 3TCXA 1D6VH 4A7UA 5KSVA 3UAJC 4NAFA 2C1PB 2LVEA 1KWGA 4HUXA 3STLA 4MPQA 2D2CC 5I8CA 2UX7A 4CBZA 4XBPB 3LEXB 2NWSA 4B41A 4JEJA 1SDDA 4DZIA 3ZLHA 4G9DB 3WUZA 1GQLA 2X2IA 1QKZL 2BCKA 3ATBA 3LRHA 3MSRA 1GZPA 3LKRB 2EUWA 1WWBX 1TV7A 4XMUA 2FGLA 5CSBA 4ILSA 2ALDA 1QO3B 1PKQE 2DIAA 4K55A 4AAJA 3HGRA 1BYPA 3LHTA 1TJHL 4GBXB 4XQ6A 3RNKA 2ITEA 2ZIDA 1G7MB 2OMWA 4K3DH 2YPVL 4TNVK 2E7DA 3M5VA 4XPBH 1SJDA 4R5EA 3L5MA 4HWEL 3CVHH 1H50A 1TV4A 3D0CA 3S3DB 3MJ8B 2PLJA 4OSUL 1NMCB 5L4MA 1QYGL 4PHZA 3QC3A 4BFBD 2D4FA 2MFNA 3Q5OA 3VXNB 4AEHL 2CRYA 3ZN6A 3RB7A 4NN5B 1TQBC 5AVXB 4Z17A 1OQXA 2Q8BL 5JQHC 4NC2B 4XNXH 1A6WL 4H88H 5TDNA 4S10A 4DKEH 3LCLA 3WD3A 4NRZB 2WNWA 3EWYA 2FCBA 1J88A 3SPGA 4MY1A 1R3IH 1JAKA 4NHVA 2DZSA 3CC5A 3PPHA 4AXWA 2AXHA 5A2CA 2WYZA 1JUFB 2WANA 3D2TA 3U4EA 4A2SA 1D6EA 4KI5C 1NCGA 4OBRA 1WB0A 4GIRA 3UR2A 4LJ3A 1VIWA 3C0QA 3F7VB 2YXVA 2ON3A 4L9DA 1HYSC 5BVJA 1XGRB 4DO5A 4IOSA 1Z42A 2ZUVA 1WXZA 5C2CA 1M71A 3VI4E 1GVEA 1EQCA 4P23A 3WLIA 1OB0A 4WTZA 4PY8J 4LLMB 4D0DB 3LS5L 2DH2A 1OD0A 3UQNA 5DJ6B 4DEPB 2GJ6A 4BF9A 2EDHA 1ADWA 3RPIA 4FYQA 2PMZA 4X6DE 1RQEA 4NNAA 1OTTD 4GX8A 5JIDA 4JHVA 4FSAA 3KLHD 1XH2A 4KK9C 3UMNA 4IRSD 2EXOA 1UH3A 4HH9B 2VN6A 5KYXB 4DVBA 1C7SA 3CZEA 2NXYC 2VZ3A 4I8DA 1E6QM 4IW4C 4FG6C 3RZCC 1K3IA 4O00A 3BQUC 3R4IA 4LSPL 1UM4H 3EF4A 2PWEA 1E2ZA 1UXWB 3IS4A 5IB2A 1OAQH 2B77A 5CWSB 2O5YL 1QEWA 1RR2A 1A5BA 1RZJL 2O4EA 3PNRB 3R4DA 2IXVA 4LXFA 2B0MA 2ITDA 1M1XB 4LVFA 5EMYA 5I1CL 1GAFH 5FX3A 4ZT1A 1R3LA 3MUGB 3P3YA 3F7YA 1L2QA 2EDEA 4QOKD 3G04B 1BIIA 1C5BL 1IR2A 1ISZA 1THCA 4A7VA 2I9LB 4RQQA 2YCIX 1HO1A 3F5WB 1EWEA 1FG2A 1S1PA 4FHAA 1Y5VA 5EIQA 2Z35B 2DLFL 3OWEA 5BZDB 4B3KA 1DSFH 4R9HA 4QROA 2R0KH 1BLIA 2OZ0A 4Z08A 1VHPA 3CVHA 5A3HA 4O02L 4O1DA 2HN7A 1DUZA 4N6QA 4OCMC 1TWDA 4AMAA 5BV7B 4OFIA 4XXDA 4ADJA 4AL8H 3PZOA 4KHTL 4PL2A 2O4MA 3PWNA 4FR6A 4Z7WB 5DMJB 3LBMA 3J8F7 4FQHB 3BXNB 4ONOA 1U41A 3T07A 3OKLA 5DO2D 4PLOB 1E71M 4HNTA 3QIWD 2X4PA 3WUWA 3HMWL 3FA4A 5BW7A 2HJKA 4S3FA 2H6PA 4HIJA 1KN2L 3S36L 3LHZA 3EH5B 1RPKA 4EI5C 3AIBA 2GPTA 4IMLA 5HGBB 1FHGA 2XWJB 5DD6B 1P69B 4GJIA 4QRNA 7PAZA 3NXLA 5D1QE 4B96A 5DZNA 5AC6A 2QGDA 4CSSA 5CO1A 1V54B 1HJCA 1C8VA 2MEJB 1U3ZA 3S2AA 1LO4L 4S2SB 3U3HA 1WXYA 1MCFA 3UAFA 2OMVB 2AERT 5ACZB 1SQMA 1U2CA 2VW6A 3U2JA 2E3ZA 3IUHA 3CZKA 2NX9A 2J8UB 4UOQA 3V8OA 4L3FA 3RFZB 4U6VH 3SGGA 1PB0A 4LUTA 4NZ1A 3VRIB 4EI6B 2XWBA 2H2SC 4R8WL 5KVEL 4QRQB 4ZS6D 4DO6A 3H42H 2DZAA 3KEDA 5D93B 2F7QA 1CVRA 3CDYA 3U5UA 1OCZB 2I7OA 2YFOA 3CV5A 5IROC 3MMDA 1JV2A 4PRBB 4LARH 5GSVA 1TPDA 1RHHB 3EGXA 1IC7H 1UH2A 2DQ6A 4NB7A 1I9EA 5DVLA 3JVGC 5SV3A 1PS3A 4APQC 4NJ9L 2B59B 5JOFA 1I9IH 2GVJA 3DENA 5GS2H 1H1YA 5G4OA 4UIMA 3O2WH 5FYLD 1MREH 3QMTA 4WKHA 3P0GB 5EO9A 4JHWH 4QT5A 1AFVL 3WMCA 2V17H 3WAKA 4MDIB 2Q76A 1A5LC 2XHNA 4M56A 4E4PA 4CILA 3KG5A 2NLYA 3ECQA 5FECA 5KSUB 4N8VG 2PGEA 3SGEH 5H4YA 4JQXC 5T33L 5ICXA 4QG6A 4QTHB 5CZKA 1I7RB 2VGGA 2X1RA 3SYPA 4BE5A 4JX0A 3AQYA 4Y19E 4ENEC 2NQZA 4QGYA 2AJ3B 5K9KB 2QJIA 1WFOA 3BE7A 1PF3A 3BZ4B 4QXTB 3V6OA 1KIRB 1W6WA 3EWCA 3VCCA 4D9RE 5AB3A 1TZ7A 5DMMA 3AO0A 2G2RB 3RX7A 1GHRA 4G8IA 1V7NH 1B0GB 4DK6A 2JALA 2F7RA 4GJTB 5JR1L 4OI8A 1ITQA 4LSSL 1CL7I 4EVZA 4NO5B 4CEUC 4PJCF 4G9FD 3IDMB 3NVQA 2YA2A 2F8VA 1QATA 1KTRL 1XCXA 5KYUB 4YLWA 2CQVA 3N2XA 2OMZA 2G60H 5BMFL 1KCSL 3G5WA 3IJS