3OLGA

Structures of human pancreatic alpha-amylase in complex with acarviostatin iii03
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
495
structure length
495
Chain Sequence
YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 172
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3olgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3olgA01
2XM1A 1JZ7A 1DWAM 1GCYA 3U5YA 3GXTA 1DHKA 1E6NA 4JCMA 5JIWA 1LG1A 3VPLA 4CCDA 1UWIA 3ZJ7A 1TQTA 1UKSA 4P7OA 1QI3A 2D3LA 1EDQA 1X6NA 5C71A 3ARSA 3GXPA 3WELA 4JFSA 4J3VA 3SEPA 4JFVA 4HMCA 3IGUA 3AJ7A 1C91A 3VNYA 3HJEA 4OOZA 3N17A 1QX1A 1X1NA 2PWGA 1RH9A 1J0HA 2GJXB 1C7SA 5A95A 3BVVA 2BXZA 4MDOA 1UA3A 3BUIA 4L4PA 1Q6EA 4MADA 4URIA 2FDMA 4P8UA 1M53A 3GXDA 1G94A 1LG2A 2O9RA 3G6LA 3CBWA 1KXHA 2OSYA 3GNPA 1JIBA 3VILA 1UWUA 3S6TA 1EQPA 3BVUA 2VI0A 5CLTA 3ECQA 3VIKA 3LXCA 3GBDA 1E73M 3MUZ1 5BCAA 5ABEA 3ZIZA 1IT0A 1PZ3A 2WVUA 4LGXA 3ZR6A 1J0JA 3NYDA 3MKKA 1CBGA 3GDBA 2OSWA 1NARA 4AXNA 3VMPA 3DX2A 3UG4A 5FCZA 2PF0A 3BLKA 4OGZA 1WZAA 1JYNA 2CNCA 1E72M 5E09A 3KL5A 4GINA 4TTUA 1GZJA 4WIWA 3WN6A 1CLXA 1W3JA 2RGLA 3W37A 4KGLA 1R34A 1SMDA 5DO8A 3UERA 9CGTA 3VD5A 1XD1A 3TOPA 1V3IA 2WW5A 1H4PA 4J27A 4E8CA 1DWHM 3SCVA 8CGTA 4U2YA 1UKPA 1UD8A 2F7QA 2D0FA 1VENA 4LYQA 1CGWA 1AQHA 2XPKA 1D7FA 3WDHA 2V38A 4PMOA 4PMRA 4WKAA 1YQ2A 4LYRA 5A69A 2JALA 2YL6A 5ABFB 4UFHA 3AICA 2WVTA 3WDIA 3TTQA 1W9UA 3MSDA 2O92A 1E3XA 3LXBA 4AZCA 5A2BA 3F4VA 6TAAA 1J11A 4P7LA 1J0YA 2XUCA 1B31A 4JIEA 3WDRA 4UQBA 1TMQA 1W2PA 4D6IA 1MQRA 4LYPA 3RJYA 5AC5A 3TA9A 4D6CA 2WHKA 3MUAA 3KL3A 3VOCA 3AZRA 1QW8A 1XSKA 1PIGA 4ATLA 3MMDA 4A4AA 2V3FA 2WHLA 1UD3A 1HJQA 1ISXA 2BY2A 2WWCA 3M46A 2Y24A 3MUIA 5KZ6A 4U2ZA 4M81A 3AS1A 3L4WA 3RJXA 1MWOA 3BVWA 4JFWA 1J0KA 7CGTA 3WL0A 1R7AA 4ATWA 3WF1A 4MAVA 2X05A 3DHPA 2J7EA 2DT2A 3LPFA 1GJWA 5HBFA 4TX6A 3CO4A 3PHAA 3ALFA 3CZNA 3UG3A 2WLZA 3BLPX 1W32A 3T0DA 3MUY1 3OZPA 1MXGA 3FHAA 1V3JA 4DM2A 2EACA 4HZ7A 4HOZA 1GOIA 2XM2A 1WP6A 1WO2A 1V6YA 4MB3A 4PMUA 2EPOA 1JNEA 2D24A 4EAMA 3L4XA 2X2IA 4HU8A 1HL8A 4U3AA 1TG7A 3AIRA 3OA5A 1BHGA 5A3HA 3W26A 5C8BB 1XYFA 1W3LA 1JZ2A 2WMFA 5A8OA 3S5ZA 3VKKA 1QI5A 2WC3A 2ZUUA 4GQRA 5FL1A 3CZJA 1JDAA 1L8NA 4AZIA 2FGZA 1SFSA 1EA9C 4AMCA 4W8BA 5AYBA 4HZ8A 4DUVA 1C90A 4PCSA 4QCEA 2JE8A 3BGAA 5EMYA 3AMGA 3T09A 1BYBA 4K68A 1E9LA 3EDJA 1ZBWA 2F61A 4FNUA 1CXFA 1IZJA 3AHYA 5HXMA 5A6BA 4UQCA 3HG5A 5AC4A 1TQWA 4DWSD 3A24A 3CZGA 4GPNA 3F5KA 3FW6A 1NWTA 4M29A 2GDUA 3VIHA 3WH6A 2CBIA 3DDFA 1YHTA 4UZUA 1G9HA 2EPMX 4U5IA 4JKMA 1EHAA 5I24A 1E4IA 4AW7A 4AD0A 1B2YA 3VTRA 1BGGA 3NIYA 1R8LA 3WBEA 4TTGA 5ABHA 1V6XA 4Z2GA 2WSPA 3BSGA 5HDRA 2E0PA 3WSUA 3LRMA 3MS8A 4FMVA 4UQ9A 3WH8A 3S2CA 1ITXA 3GYCA 4UCFA 3DC0A 1CPUA 1J0IA 1QI0A 2EEXA 1CIUA 5ABFA 3VIFA 1XSIA 3DX4A 4GI9A 3WFZA 3CZLA 3H55A 2BVDA 2XWEA 3GTNA 4RE2A 5IHRA 1C8XA 2WZEA 3PTMA 5I79A 1HT6A 1XRVA 5A2CA 3ARTA 3W4RA 3G6MA 4UFKA 1DTUA 1OINA 1HKJA 3WD0A 2IUZA 5CJ5A 2UY5A 1K9TA 2W63A 4JAWA 3HG2A 1ODUA 1HTYA 5GPRA 3B9AA 4NI3A 1R85A 3RILA 4BZYA 2DIJA 3KZSA 4QLJA 1Q6CA 3IAPA 3CHEA 2F7RA 2VX6A 3PZNA 1EH9A 1CXLA 1KR0A 3WF3A 2ZWYA 4CN6A 8A3HA 1SZNA 1OIFA 2J8GA 1CDGA 4UFLA 1QNRA 2OYKA 2YOCA 1OIMA 1DEDA 5M5DA 2YDQA 2D0GA 3GH7A 2J78A 3RM9A 4OJYA 3WUFA 1KGXA 1HJXA 3MSGA 1P6WA 1ZU8A 4ACZA 2C7FA 2WLYA 1HVXA 3A22A 2IXUA 4P8VA 1ISVA 1TCMA 3DYPA 2VR5A 1HX0A 2WZHA 1E5JA 1QI4A 5I5RA 4Q22A 4GXPA 3TV8A 2W4XA 2J4GA 1EQCA 5ABGA 2V3DA 3QR3A 3VD7A 5A6JA 1R75A 1UKOA 3I3BA 4H8VA 2XVKA 1V3KA 2E4TA 2GJRA 2FH8A 4HOXA 3A23A 2YL9A 5GNXA 3I3DA 2W67A 3AIBA 5BXRA 1CXKA 3QOKA 3CUGA 1SYTA 2BVTA 2WBGA 1US3A 1PZ2A 1UR1A 1TA3A 3HMCA 2XN1A 2YFNA 4FF5A 5A6KA 3OZOA 1XHGA 2A3AA 5E1QA 2BXYA 3DX3A 3ARQA 2WMKA 3W6MA 4DWSB 5D8WA 4F66A 1B3VA 4NRSA 1G01A 4DWSC 2WSKA 2YBUA 3CZKA 3VMOA 1LL4A 1UWSA 3PBGA 3AI0A 4OBSA 1QBAA 3WY3A 4Q7NA 2VURA 1TVNA 2YLLA 2TAAA 5CPSA 4BQ3A 3EJRA 4D72A 4AZGA 1ZBKA 1UG6A 1V3HA 1B0IA 5JBDA 2VO5A 1VB9A 2WCGA 4CGTA 1UH2A 2PBOA 2OW6A 2WKLA 4MTVA 3ARVA 3WNNA 2DSVA 4QFUA 4CVWA 1JZ6A 2J7GA 1EXPA 2G3MA 5A6MA 3AHXA 4J3UA 2BHZA 4UOJA 3EDKA 4JL1A 2E8ZA 3VIPA 2YLAA 3L4VA 2GDVA 1E0XA 1CGXA 1BGAA 2WMGA 2PWDA 1KGUA 4HMDA 3UR8A 5DFAA 3WEOA 3NJ3A 4MDPA 3CPUA 1KQZA 4OBRA 1CYGA 3ZJKA 5HNNA 3VDBA 1CZ1A 2WPGA 1BTCA 1QVBA 1UR8A 3K8KA 3ZT6A 1K6AA 2ZX6A 4ATDA 2X1IA 3VSUA 3VD4A 4FNQA 3ARXA 2EAEA 5EFFA 1JXJA 4D6EA 2DT0A 1VJSA 3RPMA 3CV5A 2X2JA 3N12A 3SCQA 4UR9A 4PMVA 3WDPP 1E5NA 2WBKA 2W61A 1W9VA 4FLSA 2XG9A 2QV4A 2VTFA 2OSXA 2ZUMA 3APGA 2F7OA 4JFUA 2OYMA 1KXQA 1XC6A 3QGVA 3UCQA 2VOTA 2ZUNA 4DO4A 1ZS2A 3GNOA 4TVCA 3DYMA 1ISZA 3T2QA 2JF7A 1KBBA 2DH3A 5LA2A 1JI2A 2NT1A 4GO9A 3HG4A 4LPCA 1C8YA 2NSXA 4MJ2A 2Y5EA 1BYCA 4U31A 3CZEA 4D6JA 1K9FA 2XTKA 3GXNA 5CGMA 5A6SA 2E40A 4WSJA 1CGYA 1Z32X 3EDEA 4UFIA 2X0YA 1JZ4A 3AS2A 1CEOA 3D50A 1NQ6A 4U5KA 3ZSSA 4ZENA 4IISA 1G1YA 1FP8A 5D9OA 1OD0A 4EK7A 4H8UA 4QLLA 2J62A 2AOSA 4U3CA 3AHVA 7A3HA 3FAXA 6CGTA 3EBVA 3RO8A 3U7VA 3GH4A 3IJ8A 3ARWA 3VMNA 3M7SA 4AC1X 3AXIA 3VO0A 1NP0A 1C92A 3WIJA 4Y7EA 2ZX9A 4IUGA 2DH2A 4DWSA 4AZBA 2JEQA 1KBKA 1UR0A 2OLHA 2ZXBA 4W5ZA 4W88A 4TOQA 2CBUA 1VFFA 3OBAA 2VC9A 4PSPA 2YA1A 1MW2A 4TVUA 1GOWA 2A3BA 1V6WA 1PEZA 1NOWA 4MJ4A 3EYPA 1QWUA 2GSJA 3QOMA 2CERA 3PN8A 4GI6A 3SIMA 2WAGA 1V0LA 3SCSA 3TP4A 2ZXAA 3MV01 1XCXA 3D5HA 1X6LA 2CYGA 2PC8A 1N82A 1EIBA 5HPOA 3FY1A 2J7DA 3L2MA 2F1AA 4J3TA 4ZXOA 1V6VA 2ESCA 3DDGA 4HPHA 1WE5A 3WENA 4TVDA 1Q6FA 3QHOA 1W2VA 1QNOA 5LA0A 1QOXA 3FN9A 3L4ZA 4UFMA 5E9AA 1CECA 2VUYA 3VX1A 4B9YA 4P8WA 4AWEA 4RE3A 2CEQA 1EO5A 4ZEPA 4PMYA 1QW9A 4JFTA 4CCCA 5I0DA 3B8SA 4PTWA 1WB0A 2OWWA 4DO6A 4NRRA 4P7RA 5I2UA 3UG5A 2F2HA 4AD1A 3BSHA 1W9DM 3A21A 4JHOA 4NX0A 1U30A 3SURA 3ALGA 3GXMA 4FNTA 1JFXA 4W86A 2VCCA 3H54A 2GVYA 1WDPA 2GK1B 2X2YA 4W7UA 1GUVA 2QLYA 3IJ7A 1E0WA 2W62A 3ZMRA 5GQBA 1CXIA 5IDIA 5JBFA 2NT0A 1Q6DA 5CLWA 4NXKA 4S3JA 3ZQ9A 1W1TA 4CU7A 1BF2A 1PAMA 4HA4A 3LXAA 3WMBA 3BMWA 2VL4A 3O6AA 3WQ8A 4XV0A 5CQ1A 4GKLA 2XN2A 4D6FA 1PX3A 3TTOA 3ARZA 1LWJA 1UWRA 1HKMA 3KEHA 4R27A 1BAGA 3EDFA 2XIIA 3AOFA 2WC4A 4JL2A 2CPUA 3GXFA 1XH2A 4HP5A 1VEMA 4NZCA 1UR4A 1Y7VA 2BY1A 4CCEA 1G5AA 4JKLA 1J10A 3VM5A 2PWEA 4Z2IA 5D4YA 4QCFA 5IXEA 2UWFA 3VM7A 3WNKA 3VSVA 4H7VA 4QDMA 3GZAA 1B30A 1OB0A 1JFHA 3T0AA 4PYSA 2VRQA 3GNRA 2OW7A 1KR1A 4HZ6A 4Z2HA 1H5VA 1EDTA 2WMHA 1HKIA 5BYWA 4ACZB 4CN4A 1HXJA 1K9DA 1J12A 4AMWA 4PTVA 2FH6A 2NW0A 4CD8A 4DO5A 4GIAA 1W1VA 2EQDA 1HNYA 4AYSA 1W9PA 3PZTA 1A47A 1PS3A 1H0GA 4UNIA 3HU7A 1RPKA 4V27A 2EJ1A 2D20A 2VRKA 3CZ8A 2XGBA 2EPNA 2WVVA 1HJVA 3K1DA 1KCKA 1HJWA 1LLOA 4W87A 1IZKA 4WLCA 2XSAA 4XB3A 1GVYA 2CBJA 1CTNA 2E9LA 3W29A 1H09A 5CPQA 1VF8A 2O9PA 2O9TA 2VX4A 2E8YA 3WF2A 4ZE4A 1BG4A 5A8PA 3PZIA 1LWHA 3GXIA 1MW0A 4Z2JA 1M04A 3LPGA 1TA3B 1UZ1A 3S5YA 3WH5A 3OLGA 1KFWA 1WZLA 4M80A 2ZICA 2VZTA 3CMGA 1MFUA 1VBRA 1GNXA 3VSTA 5CZKA 1QHOA 4AZHA 5BXSA 2D2OA 4AZ7A 1HF6A 1FH8A 3A4AA 4CKQA 2EADA 1DP0A 3LPOA 4E2OA 1HP4A 1GOKA 3ARUA 3LRLA 3AMLA 4C7FA 4CVUA 1BYAA 3KLKA 2HVMA 4X9YA 4DUWA 1PPIA 4JCLA 4UOQA 3RDKA 3DX0A 4FNPA 1B3YA 4UOZA 2WKGA 1E6PA 1UH4A 1GONA 2G3NA 2GK1A 1BPLB 4W8LA 1PX8A 1BVNP 3BVTA 3SUTA 5DEZA 1GOMA 4C7DA 1KCLA 2VRJA 1JDDA 2WCAA 3T0BA 4HMEA 4IM4A 3SCOA 3VIIA 4YN5A 4AIOA 2CBVA 1KB3A 2VCAA 3W53A 1UD2A 4CN1A 4ZE5A 1UUQA 4J28A 3AXHA 4FNRA 1GW1A 5EFDA 4EKJA 1M03A 1GQIA 2ZX5A 2VVSA 1AQ0A 3OIHA 4MNLA 4V2XA 3PZVA 3OGSA 1H3GA 4PMZA 1A3HA 5FL0A 3AXXA 2BHYA 2EBNA 4OIFA 1DWGM 3T2OA 3BUQA 3BUBA 1SR0A 3WD4A 5E6ZA 3AIWA 3SCWA 4XUYA 5FD0A 5CSUA 3A3HA 2OWCA 3WFLA 3UETA 3ZSTA 3WBAA 1QI2A 4BQ5A 4CU6A 5A1AA 2G3IA 3N11A 2WWDA 1XSJA 1RD6A 3ARPA 4KGJA 2QMJA 3CUHA 3VD9A 3MU7A 4W7VA 5I78A 3A5VA 1V03A 3AROA 2WB5A 3PZQA 1GHRA 5IHSA 5M17A 4CD7A 1UZ4A 4OZOA 1EDGA 4U33A 4MB1A 1ZBCA 2WMJA 2XSBA 3L2LA 2V5DA 1AVAA 2BY3A 3VD3A 4AD5A 2J47A 4AYGA 1GPFA 1BSIA 5TD4A 1J18A 1OWQA 2EO7A 5GNYA 3ARYA 2DEPA 3GM8A 1H49A 2DSUA 1O7AA 5M03A 1OBAA 3AS3A 4CUCA 5FOOA 1UWTA 1F4HA 1CLVA 3D51A 2ZWZA 2VZUA 5DT7A 2ZX7A 1SMAA 4MPKA 3ARRA 3EJQA 1CNVA 3AYRA 3BMVA 4ZXLA 3DYOA 3QHNA 2ZUTA 1V0MA 4XZWA 2YIHA 2X8RA 4W84A 2XIBA 3KL0A 2XYLA 1QNQA 4AIEA 5I23A 3T08A 4ZFMA 2JFEX 4Z2KA 4PMQA 2CHOA 3EJSA 1KWGA 3CMJA 4MB5A 3AMDA 1QPKA 1LQ0A 3TONA 2WVSA 1S46A 4AD4A 1FH9A 3OGRA 2IGTA 2YFOA 2VR4A 2A3HA 1ZJAA 4H2CA 3E1F1 2WANA 1US2A 3BAXA 1PJ9A 1UYQA 2CCRA 1CWYA 2G4FA 2D3NA 2V5CA 5EBAA 5CGTA 1Q4NX 4KMQA 4AEEA 1U33A 1JXKA 3VIMA 2DPEA 1G0CA 3TTYA 2FYVA 3WD3A 3WQWA 2J25A 3MANA 1V6UA 5DF0A 5LA1A 3IJ9A 5AYIA 2CXGA 1KQYA 2Y8KA 2F7PA 1GQKA 3WNOA 2W92A 1WPCA 2ZOXA 4HTYA 1ZB5A 4B15A 1UQZA 3BC9A 2FGLA 2QMKA 2FHCA 1NM9A 1UR9A 1HP5A 3CUFA 4HA3A 1J0ZA 3N9KA 2XGIA 4GZJA 2CKSA 1XV8A 4B3LA 2CITA 1JYXA 2PWHA 3F5JA 2E9BA 1EGZA 1TZ7A 1HL9A 4JHZA 1VEPA 2CESA 2DT3A 3M6DA 1JYWA 1BQCA 2X09A 4DUXA 4MB4A 2DIEA 3LX9A 1QHZA 3CGTA 1XD0A 2J7BA 2GUYA 3U7BA 3PZUA 4PN2A 2VNCA 4M82A 4AMXA 3D52A 3O2LA 4BQ4A 5D9PA 2G3JA 4F8XA 4J3WA 2DDXA 3WDJA 1UKTA 1LL7A 3MV11 1C7TA 3AFBA 2PB1A 3WH7A 2IXVA 3VDHA 4A3YA 1JAEA 3AHZA 1XH1A 3LRKA 4PMXA 3CLWA 3CHCA 2D1ZA 2WM0A 1R87A 2YJQA 1EO7A 1M7XA 4J3SA 3WF0A 2D73A 4NZFA 5CSYA 3D4YA 2VJXA 5KEZA 3ZT5A 3WUGA 4D1IA 1VJZA 5I6SA 2OWXA 4FLQA 3J7HA 2XVLA 4ML4A 1GHSA 2YDSA 1OGSA 1C3FA 3CTTA 4LXFA 3VDCA 1NWSA 1HWWA 4CD4A 4X0NA 1E70M 4PUEA 4GI8A 4WF7A 1MQPA 3SCRA 5BRPA 1H1NA 2ZUVA 3WY4A 1VFMA 4HU0A 1GORA 1O7DC 5DMYA 1C93A 3LMYA 2CIPA 1MQQA 2PWFA 2UY4A 4FK9A 3I3EA 5CG0A 2DSWA 3OG2A 1V3LA 5A6LA 1B3WA 2G8ZA 3POCA 1E4MM 3ZJ6A 1E6RA 3WQ5A 1EOKA 1FH7A 5E0CA 1OT2A 7TAAA 1M01A 4PTMA 2QHAA 3K4AA 1CXHA 2CKRA 2JIWA 4C7GA 1E6SM 3W82A 2XFRA 2XVGA 2WVVB 3ZJ8A 3VGEA 3D4ZA 2G41A 2Y8VA 1D2KA 3BAKA 1UA7A 1QNPA 3SUSA 2VZOA 3AMKA 2ZE0A 1FFQA 3WQ4A 4UZSA 1ISYA 5HOSA 4QP0A 1UQYA 1R46A 1WNOA 1KTCA 4JKKA 1L0PA 4BCEA 2VZSA 4BA0A 3SUVA 1WKYA 3LPPA 4WK9A 3BUDA 1TFVA 2VMFA 2Z1SA 1DWJM 3VUPA 3HN3A 1R33A 4PUDA 3WEMA 3W38A 4AZ5A 4GZEA 2J75A 3W0KA 1V02A 1MYRA 1K9EA 2EABA 3WNMA 3WL1A 3M07A 1V08A 4AZ6A 3FHQA 2XJ7A 1HXKA 2O9OA 3U57A 1E71M 4HA1A 2ZX8A 1B9ZA 2JF6A 3WUEA 3WH9A 1JNDA 2UY2A 1RP9A 3N1AA 5A8MA 2WC7A 1C8QA 4DM1A 3WNLA 3OGVA 3N18A 1U2YA 1UH3A 1B3ZA 1FA2A 1MW1A 2WMIA 4J3XA 1TQSA 2EPLX 5ECUA 2ALWA 1T0OA 1UD6A 1WZMA 2BY0A 4PBGA 4FLOA 4D71A 3BAIA 4W8AA 3BUPA 2D22A 2WK2A 3PTQA 2J7FA 4XZBA 4OOUA 4UQDA 4BQ2A 4IPLA 3T2PA 3PZ9A 1H0IA 3JUGA 1GQJA 1JGIA 5E70A 2V3GA 4J7RA 1GJUA 1J9YA 2W5FA 3AS0A 4WKFA 4D6DA 3HZ3A 1JZ3A 3K8MA 3SUUA 1GQLA 3GH5A 1ISWA 1HJSA 3DECA 2AMGA 2YBTA 3OLDA 2Y4SA 2J79A 3BCDA 3EJUA 3WKZA 3ZOAA 3HG3A 3WD2A 1JD7A 3DX1A 4LX4A 4PTXA 1QNSA 3WY2A 1I1WA 1TUXA 2YL8A 1E6XM 3K8LA 4KRUA 4MNKA 4PMNA 2QPSA 3WY1A 4YHGA 4PEEA 3EMCA 3AMCA 3WQVA 4UQAA 1CXEA 1E4LA 2A3CA 1JG9A 2ZUSA 2MANA 1OSEA 4S3KA 1E3ZA 1WCGA 1ITCA 3WUBA 5JBEA 3UR7A 1WDRA 1E0VA 2V3EA 4NZJA 5CXPA 3WMCA 1NOUA 2BHUA 5F7UA 1Q6GA 3AZTA 3VIGA 3W25A 4FLRA 2WHMA 4AD3A 3EJTA 3BXWA 3VNZA 5GNZA 3VGGA 1ESWA 3ZM8A 3ZR5A 4ACYA 3WNPA 3KE0A 1NWUA 2VVNA 4F9DA 1PX4A 1JZ8A 1UKQA 4CU8A 1TQVA 1GOOA 1E43A 4WJXA 1MVYA 1KWKA 3N15A 5JUVA 2XVPA 3A4XA 1UASA 5A8NA 1W3HA 4PMDA 1JL8A 1V0KA 3RM8A 1R86A 1H2JA 1OGBA 2WZIA 4GZIA 4OKDA 1J01A 2GJXA 3CHDA 2FHBA 1R7OA 5BWFA 3KWXA 1VBUA 2XWDA 3MMWA 5BXPA 4M56A 2Z1KA 4F9JA 2J74A 2YA0A 3CZSA 3CUIA 3WMSA 1UOKA 3A6OA 5I3DA 1JDCA 1JF5A 4HPGA 4D6HA 1NOFA 1ECEA 4A3HA 3MI6A 4AISA 1TVPA 2W66A 1V0NA 3MO4A 4H04A 3CIVA 4YHEA 1JAKA 3GBEA 2X0HA 3NDYA 3B9EA 1NP2A 1E6QM 4RE4A 5A94A 2GFTA 2HISA 3BCFA 1W1YA 5M3WA 1AQMA 1XCWA 1WZKA 1VEOA 3OB8A 4NXSA 4AIUA 1AMYA 3BAJA 2A3EA 4CD5A 4B3KA 3EDDA 3CUJA 4QAWA 5E0FA 3SUWA 3W81A 4M24A 2YKKA 4M1RA 3WEZA 3THCA 3AQUA 2F8QA 4D1JA 1BLIA 2B31A 3VGHA 1KTBA 4L4OA 4N42A 5D9NA 1QWNA 3BLBA 3SCTA 3VINA 4MNMA 4TXEA 4F79A 5I77A 1RP8A 3FAWA 1D3CA 2FE0A 2QPUA 1LF1A 2VX7A 2F1BA 2EPKX 3B9DA 1OD8A 1UD5A 2J77A 1HN1A 4AD2A 1NH6A 4P8XA 1CGUA 2DT1A 3AIQA 4NSBA 2WYSA 1BVZA 1W3KA 1W1PA 2VZVA 1F4AA 3NUKA 5JIPA 3EMZA 3H53A 3O9NA 2VT0A 4P7NA 3NCOA 4X0VA 4MNJA 1TQUA 3DHUA 2BNJA 2E3ZA 2VQTA 2XN0A 2PBGA 4N0RA 5IFPA 5FIPA 1V3MA 1VRXA 2AAAA 3ZO9A 1JYVA 1ODZA 3W27A 1JI1A 3W6LA 1W91A 2J8FA 4LQ1A 4MAZA 1KGWA 2EXOA 1B3XA 1LL6A 2ZIDA 1GOQA 2DGAA 2VCBA 4HOWA 2DQXA 2WHJA 4IPNB 3VGFA 1H41A 3MMUA 4W85A 4W5UA 1KXVA 4WSKA 1ZBVA 1EOMA 3N13A 3BAWA 3CHFA 1E1EA 1MW3A 4JZ5A 1CENA 4TUFA 4KRTA 2WCSA 1VFUA 2FHFA 2W91A 1I1XA 1QBBA 1MXDA 2YL5A 3AISA 2D0HA 1DWFM 4KWUA 3U5UA 1EHNA 3CC1A 5A2AA 5EB8A 3PTKA 1OGGA 2JEPA 1BFNA 1UD4A 1OCQA 1XGZA 5BRQA 2YDRA 2XHYA 3UESA 3NDZA 3OLEA 1E40A 1I75A 3KLLA 3AIVA 4QLKA 1O6IA 3IK2A 4PSRA 2GJPA 1FHLA 2WNWA 3K46A 3L4YA 1KXTA 4E4PA 5HPCA 4AEFA 4TX8A 3SCNA 3TTSA 2J7CA 4XX6A 4RL3A 1FFRA 5D8ZA 4Z2LA 2BFGA 1W9BM 4D6GA 3EJPA 4GO8A 3WDQA 5BXTA 1VFOA 1E6ZA 5D9MA 1CGVA 3A4WA 4W93A 5CPTA 3AZSA 3VGDA 4PCTA 1UWQA 3VDAA 4E8DA 3L4UA 2C0HA 2J7HA 4H41A 3VGBA 1V02E 5FKYA 3RMEA 1HIZA 1PIFA 3A47A 3THDA 4B9ZA 5C70A 1TE1A 5A8QA 1FOBA 3ZT7A 2BV9A 3PZMA 4R5EA 2CETA 4YPJA 1WAWA 3IAQA 1JD9A 1DWIM 2VQUA 3EMQA 1UHVA 2XVNA 4UFJA 1GVIA 3L4TA 3WQ6A 4OUEA 1JF6A 1XYZA 2BS9A 4EE9A 1NWRA 1PBGA 2DSKA 3FNDA 5A6AA 2X2HA 1ZJBA 2BVYA 3POHA 3AIEA 3NSNA 5E6YA 1E15A 1HVQA 3N04A 2ZXQA 4KH2A 2RGMA 1HKKA 5A6BD 1TR1A 2DSZA 2WXDM 3PZGA 3PZOA 3WD1A 3AYSA 1E1FA 3BAYA 2PI6A 2Y2WA 3WF4A 1QHPA 2WMIB 4BS0A 2YA2A 3UEQA 1E4NA 4PRWA 4BF7A 3RCNA 1E55A 1E56A 1FHDA 5AY7A 5BROA 3VIOA 2E9MA 2C8NA 3SCUA 3SCPA 3AHTA 1WDSA 1BG9A 1B1YA 3RM4A 4WKHA 1JZ5A 4W89A 4H8HA 2CHNA 3BVXA 3VVGA 1VAHA 4AY1A 3VX0A 4UQEA 3QHMA 3OLIA 3RIKA 5LYRA 3NSMA 1BYDA 3D3AA 3IANA 3K4DA 1B90A 1XH0A 2D23A 2VX5A 3II1A 4AZCB 1MFVA 3FXYA 1HJUA 4UTFA 5IFTA 4B16A 2OYLA 1CGTA 4CD6A 4EANA 2Q8XA 4V28A 3VU2A 3BH4A 3NSXA 1OM0A 3F5LA 2ZUWA 6A3HA 1W9XA 2XFFA 3AIUA 1R47A 4FNSA 2XFYA 4M8UA 3W28A 1FP9A 5DT5A 3W24A 3CH9A 3VIJA 1IV8A 1LJYA 1VIWA 1OT1A 1ZL1A 2QF8A 1H11A 1UR2A 1WDQA 4NF7A 4P7QA 4W7WA 2JIEA 2F18A 2UY3A 4GQQA 2ZXDA
chains in the Genus database with same CATH superfamily
4GT0A 4TV5A 3UZVA 4PCFA 3Q1SH 3PYCA 3NOIA 5JLZB 2FTAA 4QI3A 5KG9A 1RVKA 1E6NA 3BP6B 5LNWA 3QJZA 4MA3B 5MEOB 3ZW3A 3U4EA 2BP8B 4JFSA 4I7UA 5AN7A 4LE8A 2A6LA 4JFXA 4AL8L 2J20A 1A7NL 2V69A 3BW9A 5D2WA 5EULV 3MMEA 1W8GA 2J2ZB 2MRYA 2NNAA 4L37A 1SF3A 5DVLA 3KGUA 1Q6EA 3KPSB 1D9KA 4HFUL 4JUTA 1TVLA 1VGEL 5IF0B 2VR9A 3QO1B 1MJUH 5F2MA 1RERA 5J12B 1M6OB 4ONGH 4WDIB 3GBDA 3MSPA 3G5YA 2OSWA 3VMPA 5FCZA 5KMYA 1TETH 5ANHA 4MA7H 4QAIA 3KL5A 4KEZA 3V0JA 5GRUL 3NM3A 5C9KA 3A13A 3N6JA 3C12A 5ERWA 3WXVH 3EH5B 5GGSY 1X5ZA 3S3JA 5DD1H 2QVKA 2JCCA 1TWWA 3TEZA 3P8JA 3RTLA 4U2YA 2XH0A 1CGWA 5IVXF 3WDHA 2PMQA 2YUXA 1FYTE 3DX5A 3WDIA 3TU6A 4G8TA 3HC3H 5F7FA 4PJAB 2V0AA 1E3XA 5A2BA 1FSKB 1EGJH 1IWPA 2QQQA 4U0QB 1G0DA 2WHKA 3KL3A 4J1UA 3JZEA 1DJYA 4IHOB 4Z0JA 3VFRA 5ADOH 4K3HA 4UDTA 5IHUL 4GSQA 1QPQA 3MLYH 4XAGA 1HSBA 1AHWB 4K9EL 3M46A 3HVDA 5HGAA 1YQVL 2GGIA 4NX5A 3BVWA 2NY6B 5CGYD 1BQHA 1SRDA 7CGTA 3P02A 7FABH 5D9SB 1MRQA 3QGKC 3FTUA 1DYSA 4KXAA 4C4BA 1GJIA 1FPTH 2MQCA 1V7ML 4K7PX 3FHAA 1L7TH 2KH2B 4M5TA 2BOLA 3X1NA 3G22A 3IDYC 3L3HB 3P81A 4JGDA 1W3LA 3NM1A 2HT3D 4PP1D 2ZUUA 3N2OA 3LS4L 2QZ5A 1A22B 4QCEA 1KRMA 4HNTA 1GZPA 5G2WA 2TRHA 4P3CH 2HUEA 4C56D 3CHPA 4YTUA 2QJIA 4ZUSA 4QNPF 1SJXA 4JN7A 3MRRB 2CNYA 2ZCHH 3VRIA 1OK6A 2E09A 5IZ7A 4MBRA 1DZBA 2H26A 4YX2L 3KYOB 4FMVA 4N3TA 4EQ3A 3VFGH 2J4WH 1X8CA 1QPXA 1F73A 3V9FA 2WQUA 2DKSA 1DUYA 4HUUB 4M03A 1E4WL 2B0MA 4I5XA 4HF5L 2X7WA 1I2NA 4XO8A 4OCLC 3KPPB 4RE2A 3MUUA 3PTMA 4J1OA 4X8JA 1B4EA 1XIWD 5FESA 1HKJA 2DMGA 2P8MB 2NVAA 4WXZA 2VM3A 1JNHB 2AQSA 4C6CA 2X4SA 3RILA 1RCXB 3W84A 1TKWB 4QLJA 3T2NH 4PWGA 4HJ0D 3KBEA 5CGYC 4P5MB 4KZCA 4QGTA 1OIFA 3TR2A 3W7JA 3UTZB 4R4FL 1XT5A 1ADWA 3TO2A 4N1HB 1F86A 3GNMH 1VRSA 2NY1D 4M62L 1X96A 3D2TA 3FTZA 4ONFH 4LSTH 2IXUA 4DW2H 1NWOA 4JYEA 3ZWSA 5IBTH 1R75A 2HT3C 1JE6A 4HOXA 4PP1C 3KOXA 3MBXL 2XN9B 1WKFA 3IKCA 5BXRA 4FP1A 3UWZA 1MUMA 3CUGA 1LK3L 1WAUA 3GIYA 1SW0A 4LMQE 1S7VA 4YGVA 3B05A 1EA0A 4P2QB 4LAUA 5DXYA 1XBRA 1N8OE 5DUMH 4YDNA 5E5RB 4DP9X 1EFXD 1KJ2B 4GG6E 3QQ4B 4W4NA 2FL5B 5ANMB 3L0GA 1BBJA 5BUGA 3HHSB 5HJBA 1BD2E 2EH8H 4D72A 3UAAA 4YZFF 1ZP4A 3SY8A 2Z35A 2X70B 4KRPD 1EDYA 4JS3A 1AJ7L 1QNVA 5F7AA 3FRUB 4HPXA 2XZQL 1PQZB 3QIUA 4G59C 4M6PA 3MMTA 4PH8A 4E36A 5IRPA 1TCRB 3QVQA 4ZQMA 4B3ZA 3WS6A 3KYNA 3ZJKA 1Q8JA 4GUHA 4ZQCA 4K7PH 3VXMA 4PJAF 5B38G 1JNNH 2VN5A 3K13A 1ZWIA 1V51A 5HYQB 1XL6A 3ZZLA 3ARXA 2HH0L 4J2PA 5H37G 1DEEA 4FZEL 4FQJH 2V2HA 4HX1B 4G7QB 3VFUB 4HJ0C 3SE6A 4BBWA 5IMKA 3SGDH 2XG9A 1U91A 2ZUMA 3A12A 5TBOA 2CALA 3MLXH 1K6WA 2ZUNA 3FULA 3GNOA 1XQ4A 3IV8A 2NY1C 2BRRL 2CJTA 1IGTA 3HG4A 3JTBA 3RQ3A 3QUXA 3P4NB 1JPST 2X9ZA 4UT7L 5IVNA 3HKZA 4FQQB 2DICA 2INEA 3VFOB 4LALA 3AS2A 1EJFA 1PZ5A 1NQ6A 2QIWA 3RCYA 1D6VL 5BZDA 2PEVA 2HKAA 2F5AH 4QLLA 1C5DA 1JPKA 2VEGA 2YYTA 1KGCE 3U7VA 4PJHB 1R3KB 3VO0A 1V7NH 2ZX9A 1GVQA 2JEQA 2WAHA 3KCLA 4O0KA 3GTXA 3MRBA 1Q13A 2QW5A 3JR2A 1W1ZA 1EAOA 3EX2A 3NQFA 1MW2A 5DRNB 2Z26A 4IXXA 4U4MA 5KYYB 3IRZA 1UT1A 5ID1A 3ULVH 1MUWA 4JN8A 1Y6MR 3C87A 4UIKL 4OUUB 1GXEA 2BP0A 4GW4B 2JWYA 4J3TA 3G6DL 4FIQA 1GZ1A 2VWTA 1JS4A 2EC9T 2QKIB 3EA1A 5CPMA 4ZX4A 3D30A 1MHCA 4GISA 1VRDA 3W2LA 3DOPA 4XUGA 4DKEL 4DKFH 3VKAA 4JGJA 4AV0A 4LNRA 2B14A 4JHOA 5ESQA 2Z1XA 3UEZA 4X6DB 3S47A 1WDPA 2Y88A 3ABKB 4LGPB 4OCSH 4CMHB 1MCBA 3GLEA 4Y5XA 4G9PA 1NFDA 2ZOTA 3A4DA 3O81A 4BR1A 3EO9H 3LEXB 3ZWTA 1KV8A 4EOWL 3CDZB 4HWBL 3PG2A 3TYBA 5TE6L 4X80L 2KMWA 5CQ1A 4IBWA 4LLYB 5CJBA 2FZ8A 1UWRA 3TNOA 4IGSA 1ACZA 3KEHA 2K70A 1EUUA 4I9WE 4AVNA 2O4EA 2CPUA 4WNJA 3C8NA 4MMZC 5HK4A 1G5AA 5CH9A 1WWAX 2VEPA 4EI5B 3VSVA 2QADB 1IBBA 1QEXA 5E2VL 3GZAA 4G6JL 2FIKB 2HJPA 3BSZL 1U8HA 2IADB 2W07B 2OW7A 5HUOA 3GRWH 2GJJA 2WBJB 3MNWB 5AVWB 5BYWA 1E42A 3WLBA 1GPOH 4XMVA 1J12A 1S2UA 5D38A 4DI8A 1TJXA 3HGJA 1RPQA 1PS3A 5T3ZL 2HCZX 4L3CB 1A5AA 4MCZB 4PRPB 3BRDA 1HJVA 2Q09A 3UTTB 1JZEA 3N3EA 3OZ9L 4KX7A 2JNZA 3NCYP 2NRDA 5PTDA 2O9TA 2E8YA 2XPYA 1SJHB 2YAQA 5C97A 5L88H 3S9YA 3S5YA 3PWAA 1WZLA 1PU0A 2ACQA 1CLYH 2VZTA 1MPAH 3TAKA 4X7CC 4XWGH 1U3NA 2G96A 5JIQA 1FH8A 4QG9A 1F3XA 4AK2A 4E2OA 2B4GA 2VLJD 5CD3A 3ETSA 4DB7A 1JV2A 3DX0A 4BF5A 2RTTA 1D5XB 4KKNA 2WKGA 1E6PA 4LAJH 3WYRA 5L8LB 4KXZH 1RK6A 1FLRH 1LTDA 4TSCH 3TNNA 5KBDA 4LUIA 1U9KA 1C16B 1JDDA 3V4PH 5D70H 1MCIA 1ILSA 3SYPA 4HIBA 2XETA 3ZLQC 4NAMA 2PGEA 1G9ML 4EKJA 2V5RA 5ESVB 3OIHA 4IXHA 3MRIA 3PZVA 2QCEA 5FL0A 1EAPB 3MUJA 1S7TA 3PUOA 3MTXA 3D3VE 5DQ9B 3W01A 3RYSA 4IJTA 4WWKB 4MD0A 4JDEB 1DVJA 2FUQA 2AQRA 2C9PA 2N1KA 4O1BA 2UV3A 4ZL1A 3HC0A 4AVFA 2XSBA 2FQFA 4LSRL 4XNXL 5DJAB 2RFXB 3FQWB 3BWAB 2OKTA 3L66A 3ZLHA 1UWXK 4PJHF 4UTUA 1AFVL 3C56A 4JW3A 1FNFA 3CUXA 4D8AA 3AS3A 1OBAA 1TU2A 2BINA 5IEKA 1S5WA 2APFA 2PPDA 4EDWL 1GHFH 4NQCB 1PLGL 2CBQA 2UZIH 3HAEA 3BXNB 5IW6A 1RZ8B 3RAOA 1WUNT 2XIBA 2CA4A 2EHHA 4AIEA 3BE1H 2NW2A 3UZWA 2QLVB 1X98A 3PJTA 4PMQA 1EJSC 3V5KB 4JO8A 1DBAH 4GSUA 3ZTEA 4WNSA 4LIQL 2F6XA 3VXSB 1U95A 2ZSWA 3VA6A 3G6JE 3BAXA 3UJ2A 1CWYA 1X3DA 2D3NA 5REQA 3FUFA 2ZPKL 4N1CA 1MXSA 5ACMA 2FYVA 4HJJL 4RK8A 3S37X 3WLNA 1QBLL 4ZS7H 4X6DF 1WPCA 1FWBC 3KTSA 1FH2A 2I9LA 4Y1AD 2CKSA 3GE7A 4NNPL 3M6DA 3W2DL 2BSRA 1IXPA 2Y85A 4LCCC 1S7RA 3DIFB 4IS6B 3T6VA 2VSCA 4YGAB 4FQLL 2BVQB 2VNCA 4BQ4A 3HKFA 4YDVA 5LO7A 3FSUA 2NTFB 1XGTA 1NEZA 2AJVL 4R0LC 5D8JH 5DZLA 1QACA 1C7TA 3NJHA 1ELSA 5I3KA 3QRGH 2RQEA 3CLWA 2D1ZA 3LD8B 3K2GA 3CJPA 2ODHA 1BBDH 1S5HA 3PG9A 2D73A 5D1QD 2H1XA 4G11A 4JRXA 4KJPD 1A6TB 3STFA 3LRHA 1XCQA 2CHWA 1QPRA 1EGMA 3GZ3A 3U48A 2FLRT 2H0FA 4E4FA 1H1NA 3D8MA 3STZA 2J88A 2F1EA 1KCXA 2CIPA 4ZSOA 5GJTL 3ALXA 3I3EA 4LB3A 1CO1A 3GVRA 4NQEE 3SBQA 3D39B 4Q74A 43CAA 4RGNB 1FCQA 1NCUA 3EWCA 4UTLA 3HGSA 5LXGL 3RK8A 4LBUA 1ISYA 1BQLL 4HB7A 2CFFA 1HI6B 2R0KL 1AACA 4AQOA 4H3DA 1P4UA 4I6KA 2ZVIA 1SGJA 2VMFA 4N9BA 3EFOB 3ZE2B 2ZX8A 3LZNA 3WH9A 1JNDA 3N1AA 3T07A 3N18A 4XVTL 3MFGB 3QJSB 4L1DA 4DVBA 1UD6A 1TF4A 2LU4A 5BXFA 4F8LA 2VAAA 2EKSA 5CEZD 3E1ZA 5E70A 4J7RA 1DJQA 1BAFH 4NRZA 4D6DA 3DGCR 3IGSA 3RPIB 3UJSA 1ISWA 5DTFA 1UB6A 1TG8A 3Q67A 3ZOAA 3BDXA 1EJ8A 6REQA 5D1QC 5FM5O 3EOOA 1JD7A 3H7BB 1MH5B 2A9CA 4KJPC 4HNUA 2Q7YA 3QQ1A 4ZAKB 4AX7A 1UGKA 3L6FA 3ZR4A 4EPDC 3TU9A 3V4PB 5HYFA 1E3ZA 4DP7X 1WDRA 4KVCH 4O0ZA 4PBVC 2BHUA 3GBML 4M02A 3EJTA 4UT9H 3S37H 1B3JA 3R10A 3V0HA 1JZ8A 1LE9A 2VMJA 4B5SA 4JFQA 1MY7A 3GTFA 2DQUL 1KACB 3QORA 3ULAB 3CM4A 3PWVA 4B53A 3QPXH 3MMWA 4Z8FL 4L9YA 2GQ3A 2B4CC 1SO6A 5DJYA 5EA0H 1B0GA 3P11L 4MDIA 1P5UC 4NN7B 3KJ4C 1XLMA 2E77A 3SBWC 4MYAA 1A4LA 2YPIA 3IB4A 1KPVB 4RRPM 2J8HA 5I1CL 1YXDA 3PBMA 4ASTA 1AQMA 3S5SA 3N50A 2E7MA 4V33A 2A3EA 4TIMA 4CD5A 4KKAD 4WO4A 2BK8A 4G8IA 3WEZA 2H6PB 5AC6A 3IWVA 3MBEB 3ULVF 1I7UA 3MDWA 4AV4A 4GFXA 4FHBD 4IGHA 8TIMA 3DWTA 2CLHA 1BIIB 2EPKX 3NYZA 2AEPH 3BD4A 4IU2B 1NC2A 1WLHA 1CGUA 1UW9A 3QDHA 1D5ZB 4ZOEA 3W7KA 5ICZA 1W1PA 1YA5A 3VE0B 1ADOA 4GRLB 2ONEA 3WS3B 1V3MA 2AAAA 3KCPB 4F7PA 3PREA 4HCRA 1MFCH 4MNGE 3RX2A 4NP4L 3I6GA 1AW5A 2F38A 5TK2A 1IQWL 4R7DB 2C4FU 1RJZB 4P5SA 3U9PH 2VN7A 3D87B 1SW3A 1EBGA 4W4QA 1JGUL 5A7BA 1U8MA 2JCWA 1I6NA 4NQXB 3WAKA 4P5RA 3US1A 3RZCA 2G30A 4NERA 4LNYA 1OG0A 4QHPA 2QVMA 3FVMA 1K02A 5DD3H 3I2CL 3PTKA 1H3UA 1TUPA 1ZIBA 1OCQA 1WUZA 1LO4L 1RLBA 3NIGB 4INFA 5H2BA 4KMLB 4ESKA 2VH5H 5E95B 4BZ2H 4FQXA 4H1LA 1AGCB 1FL5A 3TXZA 5FI8A 4PJEF 1INDL 1ET8A 4GO8A 4V2CB 5F96L 5HWNA 1SFTA 3K3QA 3QZLA 2CW6A 3FV9A 4MQSB 1QFWM 3AZSA 4H41A 1PIFA 1HE8A 4KKAC 5C70A 5DYOA 4HBKA 3H2OA 3BOVA 4K0OA 1FOBA 3BGMB 3KPSD 3ZE2F 3DVGB 4ADGA 1IEQA 3BJ91 4A2EA 5JHDA 3OXRB 1AXSB 4WO0A 3UP6A 3EMQA 1GVIA 5AQ0A 3O41B 1KJMB 2OTUB 2P5EA 4BK5C 4G3YH 1P9MC 4HYTB 3N04A 1DANT 4MS6A 1SOXA 1TR1A 4PFHA 4Y9NA 2P50A 3H6OA 4JDVB 1HHGA 1OWRM 3ZJAA 3KNBA 2Z31A 3ETBF 1F4YL 3QBTB 3RU8X 1SVCP 3WLSA 5KJ4A 2MKWA 5I19H 2VDRL 2ARJB 1Z7AA 5D2LE 4CQ8A 5HQMA 2D69A 3H3PH 1L3NA 4S3DA 3FTWA 4R7LA 4Q14A 4Z3IA 1X38A 1O7DE 3IANA 5GS0L 3VAVA 1JHTA 4DLFA 3HLAA 4YR6B 1CGTA 1F13A 4JTJA 2OEMA 1RIVH 2A4EA 3PWNB 1OM0A 5FEBA 4EXKA 5KW9L 1R47A 4M7ZC 3W28A 2Q10A 3TVAA 3ASNB 3JWDH 2HRPH 4R9XA 1DBMH 5AC7A 2HK0A 5SWQA 1AP2B 4XTRD 2UY3A 2CDEA 4OD3H 3FYOA 3NA8A 1XS2A 4F7CB 4CVXB 4MAYA 2NY6D 4EWJA 3BEWA 1GGBH 5C71A 4XMXA 4D0DB 4KHXH 3G1DA 3GRIA 3A0OA 4G9FB 4AXWA 1C91A 1DJIA 2GTZB 3IS1X 2EE3A 4GD0A 2CRMA 3QDMA 2FBJL 4JGNA 2BXZA 4LSSH 5I3HA 1LRQA 4MJZA 3TBTB 5EOTB 2OSYA 4XAWL 3GNPA 1LXMA 5LNEA 4MCYB 2Z0IA 5J12C 2PYFB 1EQPA 1U1UA 2EDMA 2VI0A 5H35B 1H62A 3T0WA 5JR1L 4NIKB 4PJBB 4XZHA 3ZE0E 1A0DA 4WXYA 3MKKA 4PJ5E 4NL1A 4OLXH 2OZNA 4HK3N 2DUXA 2YQBA 1CLXA 3TROA 2VLRD 1B6UA 3MUGA 3C2FA 4PD4J 4JO1H 3TASA 4AKPA 3SGEH 1UD8A 3GI8L 3ARDA 4HIXL 1Z9LA 2D0FA 3VFNA 4KBXA 3HTLX 3M1BA 3TQPA 1QTPA 1UB5A 4KESA 1CD0A 5TK4A 2E25A 1CD9B 1X7SA 3E3HA 4RW3A 4QR7A 2JI1A 1FSKC 2HLEB 2DZPA 3I75B 3IJLA 2DW7A 3KXFE 1MVUA 2XV2A 1AW2A 5I17B 1J5HA 1CL7I 3SGZA 4TQ8A 2CDFA 1WEJL 3KPOB 3VUAA 4XTRC 2HKHH 1A5NC 1AHWC 3V4VL 1MWOA 4ZFQA 2VE6A 2WKOA 2NY6C 2PP3A 3WTVA 4MQXD 2OJZH 1J5IA 2X53A 3NDZE 1TFHA 4YXLL 5DUJA 3IDGB 3OX8B 4NBXB 3GFXA 2AEOA 3NIGF 1W32A 1V3JA 2VL5A 1ROCA 2UV8G 4GMSL 5ECGA 2R1LA 4LBSA 4PJDE 2X2IA 5GSVB 2RACA 3W26A 3GHUA 1WBXA 2WMFA 2WNGA 1OCNA 4FFVD 2XN9D 3RU8H 2I5QA 1XBYA 5TFSL 4N0YH 2ZCKH 3PLYA 3BZEA 3TESA 4AKOA 2F84A 3UXAA 4DKAA 3IVUA 4JPGA 3TO4D 1DXFA 3P3SA 4P2QD 3WH6A 5FYJD 3FONB 3DDFA 4IGMA 5C09D 3GLAA 1DBBL 4JKMA 2C3XA 3N55A 2MSPA 4XVJH 2QVTA 2FVMA 3I7QA 4Z2GA 3MS8A 4JLRB 3DFYA 2OXHB 3C8KA 1HH9A 4LCYB 3NURA 1HFBA 2JK2A 4ZSTA 3APTA 3UJIL 1OZTG 3FB7A 4RX4A 4X4YA 3RUBL 4XIMA 5BZAA 2WB7A 2BIIA 3CLEH 3UAFA 1U3ZA 2JJSA 1L0QA 1AQFA 4L3EB 4E5XG 2AJXL 2FZDA 3QULB 2O72A 2VWEC 2V37A 3VWJD 2ZRUA 3PE9A 4KKPA 3F64A 1KR0A 3P0VH 3WBDA 2PR4L 2WTOA 2X42A 4ERGA 3WHXA 2OYKA 2AGJL 1MCLA 3RYMA 3QR1A 2FB4L 3N2MA 2C7FA 1O68A 4Z3HA 3EYUH 1EJRC 3QIBB 3IEBA 5FF4A 1M6JA 3NWRA 3QFGA 3QW9A 4PUNA 2WP3O 3OD3A 3KYKL 4C6OA 1MOEA 3WZ0E 3TJLA 1GZGA 4FFVC 3QOKA 3M88A 1KJVB 4O1DA 2NSQA 4C6FA 1THAA 4IDJH 1PZ2A 2FJHA 3UJFA 1PKQA 4L1LA 4ODXB 5JPNB 5GJSL 4MX7A 4NRSA 5CFHA 2HP4A 1TV7A 2OU4A 4YH6A 1DQLL 2GCYA 4PJBF 3IPFA 2BVPA 5DJDB 1QBAA 4N4QA 1ZDQA 3EJYC 1HIMH 5DJ2A 4LVNC 3OQRA 2ESVB 3DUGA 2YD5A 3SQMA 2BOEX 5AHFA 4NZTL 2WMPB 1LQAA 5JORB 1UP2A 4NU7A 4Z77A 1EXPA 5A6MA 5G4EA 5EIQA 1XCFA 4JKNA 1MFMA 3LS5H 5EGRA 3TH6A 4E2VA 3M47A 1PL9A 5DC0A 2J12B 5HGDB 4LH8A 1L6FA 3QJXA 4JFPA 2WPGA 1KV7A 4F7TA 3AGVA 2GOKA 4N25A 2O5ZL 4ODSH 5DRCA 4S1QH 5CGQA 3VD4A 4RISH 2PCFB 4XHJD 3CV5A 1ADQA 3WDPP 1E5NA 3U4AA 2LE9A 1TZOA 2A6KA 3N2JA 5FEZA 4QTHB 4QF1B 1Y6KR 3ARFA 3HFFA 5L9DL 3LIUA 4YHIB 3R7MA 4ODVL 1T2QH 2NT1A 4Z7NE 5CSGA 4D7PA 2XTKA 4NT0A 1T41A 1T5XB 1CEOA 2VFFA 1ECQA 3MV8E 3KPLB 4NEHB 4BINA 2GUUA 3APFA 1OD0A 4ODBD 2R27A 5GIRB 4EI5D 2QADD 4J4PD 4U3CA 4R5VA 3GH4A 1DVXA 2WBJD 4PC8A 3U9IA 2UZYA 3MLVH 4GUPB 4RGMB 1MQ8A 2E3VA 5LKNA 1VPOL 3MRCA 1TZAA 4RMVA 4W88A 1I4NA 2CUAA 1TIUA 5DUBB 3EUUA 2A3BA 1BKSA 4PRPD 1PEZA 2GSJA 2ZYRA 1AI1H 3UTTD 4HJSA 1BFOA 3KVDD 1X6LA 4B95C 5C9RA 4XN1A 1OLZA 1NMBL 3QEQB 5C2UB 3EX6A 2MIZA 2HJKA 3NIFE 5LA0A 3L4ZA 2ALRA 1KTRL 2QKIC 2IPJA 1XR9A 4ZMTA 1TJ0A 1X1ZA 4M7KL 3MRNB 3XIMA 3PJLA 2HLAB 1FHGA 1E30A 1KYOK 2IDSA 5T1KA 3LHAA 4FNTA 5E8PA 1G7MA 3NMEA 1R3JA 4RA0C 2VC6A 2IANA 4CMHC 1CXIA 1DCEA 1SZGA 1U3HB 4XHJC 4JB9H 4OZFB 1P4BL 3UVIA 3ATDA 4GY0A 4PP2B 5F7LB 4QXUL 1M05A 3NL6A 3ARZA 1J5DA 3I6EA 3IFLH 1YNPA 2CKBH 1T1WB 1LO3L 4MSWB 3C5JB 1YEFH 4P2OA 5GJNA 3GXFA 4MA1B 4HPYL 2TSYA 4O17A 5FHAL 5CC6A 4JZNB 4E0RB 1S9WB 3TCLB 3HI5H 1MHEA 2FJFB 4EI5C 2QADC 3SCMA 3ESPA 1LZOA 1N0XL 2K9FB 2J71A 3HC2A 3GS4A 2WBJC 5TE7L 4ANKA 4BKNA 5L6YH 1NOLA 1FL3A 4GIAA 4OF8A 1HNYA 2XQYG 2FRGP 1BF8A 4QEGA 4ORIA 2C1IA 2VXNA 5LN4A 1F4XL 2AQPA 1M04A 5I1AB 1TA3B 5DHVH 1U8LB 3M1ZA 3HMXA 4WTXA 1HKFA 5F4WA 1QR7A 3MRJB 4LOFA 4ILDA 1GNXA 4FYRA 1E6OH 2ILLA 5MEPA 1QUNA 1UXSA 4K71B 3IDJB 1QRNA 1DP0A 5HYJA 2H8PA 5FUCC 1LGVA 3VXSD 4Y4HB 3EYFB 1WK0A 3UWQA 4ZNEA 3BLIA 4MHHI 1IGJA 4WOQA 3W1RA 3IU4H 5HPMB 3E9TA 4BWLC 3REQA 2YAFA 3EBHA 4PB0L 2VRJA 4DJMA 4RH4A 3VIIA 3H1ZA 1GS8A 2YCLB 4PG2A 4HUXB 1MRCH 2NCMA 1A80A 3SGJC 3NQBA 5IFAL 2DVXA 4N0FA 3PTDA 3QZWA 4LQFL 1HH6A 3BTNA 1IKFH 1FE8L 3C08H 5C9UA 3NTCL 1ACYL 3HFTA 2XA8H 3RP1A 1TPC1 2Z8RA 3FU7B 4UINL 1X4XA 5MHBA 2R6OA 4TRPL 1TTRA 1G7IA 5I1IL 1R9ZA 1I0BA 4E41B 3TC9A 1FNSH 3W56A 1GYCA 1EDGA 2UY7A 2Z7KA 2ADIA 5TD4A 4NKOB 1BXXA 4CADB 4QG8A 1UURA 3PP4L 5E1HB 4K2UL 1E0TA 3E02A 2AV7A 1H60A 3VSQA 4HEPA 5CEXB 5H6HA 4PMJA 3WG6A 4AQLA 1P5VB 4L4VD 3GLZA 4F1ZA 3O3AA 1PCWA 5EOQL 2I5GA 3CQQA 4BWTA 3U46B 2PDBA 4WFED 1IBGL 1ZT4A 2EUZA 5XINA 3D39D 5SWSA 4LFHG 3QMTA 4AD4A 2FR4A 2VR4A 1KBGH 3FQRB 4EDXB 5D7LB 4YVPA 5EBAA 1SZFA 1AGEA 3BW3A 5F1NB 3IJ9A 4FJYA 1S7QB 1KN4L 5CZVH 3RTQA 4L6HA 2DL2A 3CVIL 2OZ3A 1XUZA 2QNEA 4C90A 1LEIA 4Z78A 2DBLL 3BC9A 4QRRA 3ZZ1A 1NM9A 2ZZ1A 1GT8A 1WCBA 1KD0A 4XCYB 5HVGB 1T22B 4XCEA 2L7JA 4AF0A 2XNAB 3OSKA 2H7WA 5C2BL 4JN1H 4QD2E 4LP4A 5EBLA 2NZ1A 2VUOA 5JW4R 4ERSL 3RX4A 5E2WL 3PZUA 4KAQL 1ES0B 2FZ3B 1WGVA 4Q8WA 4GVHA 3UZ5A 4AXKA 3AU6A 1QOKA 3UYPB 2WPBA 4XO7A 4I85A 2LLEA 4W70A 1JUFA 2B1HL 1JUKA 3P2DA 3EX3A 3H9SE 1Q4WA 3TWBA 1OFPA 2XVLA 2YDSA 1A2YA 1OX4A 4ZAKD 2DDQH 1CE6B 1NWSA 4TPRH 1EZWA 4XVDA 1KZYA 1FVDA 4XMWA 4X63A 4A3UA 2DWDB 4NJGA 4AQEB 4G7YH 4F8OA 4KTEL 3VTAA 4PRAA 5HNRA 2UY4A 3TBVB 2EDTA 4EZLA 4XGZA 4HKZA 1OHQA 4DYEA 3H22A 4WI9A 2O1AA 2R23B 4GSRA 4V1DA 3DUHA 5ES4B 3PL6A 4GXFA 1R0MA 4GOAA 3BPOB 2G60L 3GGWA 3CSYB 1QNPA 4GW5B 3SUSA 4PWFA 3KGSA 1BXVA 1HAWA 2BP1A 2VITB 3C8FA 3G1SA 1BX2A 3NQMA 4NAFA 1FY6A 5D1XA 2VZSA 4ZODA 1I8KA 5T1DL 5DMKA 3SUVA 3TE9A 3WJZA 1CD1A 3RIFK 1MLBB 5CU5A 4YO0B 1X7IA 3A9IA 3PV6B 2R82A 4B96A 4IQEA 3ZTJH 3RDJA 2XJ7A 1RK7A 4QSHA 3DSFL 4DEFA 4KIRA 5EF0A 3CB8A 2HPMA 3WNLA 2IQ9L 1HZLA 3N3MA 5EN2A 5DHVB 5C2XA 3BWWA 5FWQA 5C0IA 1IZCA 3MBED 3GJFH 4IPLA 3JUGA 4GE8A 3GSQA 1YW1A 1A3WA 3K6DA 1RUAH 4WKFA 4IH3A 1IAIH 2KUTA 2XKSA 3HZYB 1RZKH 4OD2B 3PPHA 4WTWA 4X8GA 3LI0A 2XH7A 2PTTB 1KLGA 3HOJA 4PTXA 2NZLA 4RKAA 1CCZA 2VJ8A 3QYQA 2RAGA 4GRLD 2Z8VC 4O02A 2PLJA 4ZAKC 1MCOL 3IEAA 2A3CA 2ZUSA 4N8CL 2QVNA 1MKFA 3ABRA 3C6LB 5J1TC 3CEPA 4YMZA 1H61A 4JGUA 4YWIA 3THML 1Z5LB 3KPRE 5DVPA 3L0NA 1GC1L 3SRFA 1NWUA 2VVNA 1S5TA 2W94A 4P23B 3SDCA 3S0CA 4CU8A 1KLFA 4QXTA 2P5WD 3RFZC 3TJIA 1GRWA 4RNRA 1V0KA 4PY7A 1J01A 4OKDA 4D94A 2K9UA 3GHBH 4HHPA 2VXSL 2XWDA 3CX5K 4AQAB 5LB1A 2UX7A 4Y19A 4IG2A 2NX5B 4HPGA 4WQOA 1O94A 2PUQT 1RY8A 1FGNL 4NN7C 4U6YB 1J4EA 4WUUD 1BWWA 5BS0A 1PE1A 3T5WA 2EEBA 5E00A 1JN6A 1YVLA 2CDGA 1NP2A 1E6QM 2NUTA 4XSMA 5KSAA 3O11B 4R26L 1P0NA 3SJVB 3OB8A 4D7BA 4NPKA 3HA1A 5BO1L 1M7UA 2CLVB 1Q0XL 5IT2H 4CQ9A 2Q02A 3IVKB 5EZPA 1BLIA 3MBEC 4Y2LA 1AHMA 3FJNA 3FQXA 4U7KA 1VC4A 1AZCA 2FE0A 3B9DA 4K1WA 5FSDC 1HN1A 3HPZA 1NH6A 2DT1A 2QGEA 4XVOA 2BM3A 2WYSA 5HHQB 2DEWX 2P26A 3O9NA 2GJZA 5D1ZA 4P7NA 4JPKH 3SADA 3FTSA 2E3ZA 3L12A 4TUJB 4GRLC 5FIPA 1QWKA 1VRXA 3STCA 3W27A 1UWGH 1GSKA 4LTSA 4XMPH 4F57L 4L05A 4KO5A 3S3GA 2PWUA 2IH1A 1YEGL 1UEYA 3N6QA 4UT6H 8XIMA 3UXIA 2UYLA 2WUCL 5FAJA 5GS1C 2P5NA 3NOEA 3JWNG 4GUOA 1GOHA 2YS4A 2BWDA 2UBPC 2QCHA 3FN0L 4MVBD 1MW3A 3VFTA 3SE4C 1FFOA 5FAAA 4C65A 4LRNL 3X1FA 3DIPA 1I1XA 4X5XB 3E74A 1DE5A 4U3SB 4I9MA 2X9WA 1OB1A 3CC1A 1EBHA 1BFNA 3Q5OA 4ZYKA 3WJXA 4REQA 5BRQA 4L9LA 4N8UA 3FU8A 2ARWA 2GJPA 3TZVA 5CCKL 1FG2A 4A2FA 3UC0L 2J7CA 5HVWA 3CQHA 4Z2LA 2BFGA 3PWJB 4ABUA 3EJPA 1XBDA 3LLFA 4G9FD 3DXAE 3VDAA 3CVDA 4M8RA 4WKZA 2WINA 1BGXL 3L4UA 3G5ZB 5D7IB 5EOCJ 2HA1A 2BOCA 2V2WB 4A8LA 4IQJA 3GHSA 4HWEH 3IWPA 2J73A 1H63A 5I15H 1UHVA 2EDXA 4QY8A 3LM7A 2EP6A 5F9WC 1PBGA 1XGYH 5A6AA 3ZL1A 3JTSA 2OTWA 3DRTB 1LE5A 4XVSL 1Q9WA 5E4AA 1SY6H 4HK0B 1M9SA 4DGYL 1I85A 1WKDA 1ZAGA 3V0IA 2WLIA 4O53A 4PRWA 2J5WA 3MODL 4BF7A 3NN8B 3LHUA 1E8WA 5GGUB 1W72L 5IJKA 1PHQA 5D96B 4CLMA 4NT6B 3SCUA 2CZEA 3E5BA 3HZKB 3BT2L 3TMQA 5F3BA 2Q5BA 3TN0B 4JJ5B 2YPLB 1BYDA 4A7GA 2CRZA 1B90A 1U1JA 2D23A 3II1A 4MVBC 5JHMA 2FNWA 1EJ7L 1XJBA 1VZGA 2Q8XA 2VMCA 1TJHH 4WJEA 3VCLB 4P4RA 3TYEA 3EYSL 3R8HA 1PIIA 1H11A 5E6IB 2ZXDA 3GSOB 1R24B 3VZXA 4I2XA 4WZ9A 1N59A 1MCSA 4PS4H 1X6NA 2CQVA 5D4QA 2XISA 2ZKYA 5JQ6L 1AZ2A 3HJEA 2PWGA 3ARGA 1C7SA 5AOMA 3QDJB 4H6EA 4OGYH 2IPTL 2QQNH 1UA3A 3H70A 4XD6A 3CBWA 4ZNCD 4ZUWB 3MRGA 4YHLH 1G4PA 3PQYB 4N26A 4HCGA 3R8GA 2A4CA 1YAZA 3PSVA 3FOLA 1R3YA 2QGYA 5JH2A 2VLMD 4GYBA 1D7DA 1IM9B 4QT5A 5EPMA 4ORMA 4WIWA 3QWQB 2KHAA 7ENLA 2FLMA 3MO1B 3VNKA 5DO8A 1D5MA 3ROOA 1MCEA 5FGCE 1XD1A 1BSLA 5AYUH 1R30A 3BHBA 4ZG1A 4NC1C 1Z3GH 1CLKA 4ZS6D 3G2GA 1NIUA 3O6KH 2QDVA 2YARA 4YNGA 3SCVA 4Q52A 2XPKA 4HGWA 4LEOA 1Q7QA 2DLIA 4MD4A 1FWCC 3LEVL 3MSDA 2GAZA 5IEHB 4DEWA 1T20A 2YGQA 5L4FA 5DK2B 3TA9A 4YHKL 4D6CA 1UJ3B 4US5A 1BFVH 4LSUL 1P4LA 4WDWA 5I71B 1PZDA 3P0YH 3BVJA 3UABA 3GSRA 1YJDH 1GL4B 2Y9RT 3U0HA 2WHLA 1ISXA 1IQDB 3HPJB 3MQTA 3T8VA 4YL4A 3JBG7 2Y3AA 1TV8A 4GRMA 2ENSA 4GAFB 5TPWL 3GMPA 3UG3A 2VFDA 3BLPX 3TPKA 1FH5L 4XCNA 4Z18A 4HU2A 2EACA 1A5KC 3QIBD 4EAMA 1HL8A 3Q7JA 4POYA 2SFPA 4N2FA 2AVFA 1UUOA 1D5BA 3V18A 1MO0A 4WW1B 2JELL 5IMOA 4E9QA 1ONQA 4NHCL 3G08A 4U49A 1L8NA 4AZIA 2I24N 4KZDL 4AY8A 5D7IF 3B40A 1DFBH 5B39G 4IEFA 2P52A 4U1JB 1ZTXL 1G7PB 1KLYA 1W1IE 3PC0A 2CLIA 3WLHA 3IXTB 2H0EA 2OZ4A 1T21B 4RZCA 4KUZL 2ZZ5A 3Q6FB 5FGBC 1S5VA 4DN4L 3QG6A 4YDKH 1YEEL 4A04A 2JJTC 1IAIM 4ZS6C 1V6XA 3UTPD 5KVDL 1QFWH 4FR6A 1KGJA 4F0RA 1SDDB 4NC0B 3GYCA 1OOAA 1E2WA 4JTFA 5AHNA 1PWLA 4Y9PA 2YD6A 3SGKA 3OL2A 3ZDZE 1G7JA 3H26A 3SPHA 2R9RA 4GI9A 2NLIA 2VM8A 1L9OA 4XWOD 4HS8L 1HT6A 4YDZA 1ZA6B 3W7HA 1RULH 2K0RA 3ME0A 5BV7L 2V0TA 3WD0A 2H3XC 4OAWA 4TNGA 2YEZA 1VESA 4HIJB 2CPCA 3GSXB 4H88H 1BQUA 3MROB 5EORH 1YDPA 2YR3A 4P9ML 3R12A 2C9UA 3CIXA 2D0GA 3U36B 1HJXA 2OCCB 5F97E 1YUHA 1LDPH 5FYKL 2D2JA 4FQCH 5B1JA 2VR5A 1HX0A 2WZHA 5HHNB 4ERIA 3QIBC 3HE6B 2Z8WC 3MREA 3UTQB 3GSWA 2E56A 4QJ3B 4X60A 3TN4A 3TSMA 5JPMA 3NFUA 2YL9A 1IFHH 1O6SA 4BHYA 4UV4H 2ZT9C 2GQ9A 1AO7D 4V11A 4F2FA 1R6WA 5E1QA 4ETQA 3T81A 3DX3A 2HJLA 1B3VA 4X99B 1SPQA 4JFXB 4JDYA 4GT7A 5JPNC 5D33A 5TTRA 5KSBB 1WF5A 5C9ZA 3JWDC 4C6KA 5DZJA 2F8VA 2NNAB 1C12A 1IIKA 1K5NA 5J9PB 3MRHA 2AQVA 4X4XA 1DQVA 4OIAA 4HETA 5JIDA 4OZIE 1PV8A 1RIUL 5AB9A 3TVMA 3EJRA 5FFGA 2WCGA 4NJAH 2YK1L 4DOHB 3CVHL 3G5YB 3QEQD 1RH8A 3AHXA 1JEZA 5I2IB 3EDKA 2DN7A 3VIPA 4J6RL 2E7LC 3MV7E 4P2RD 3L1OH 4XWOC 2QT3A 4X3ZA 1F6AB 4OT1H 3UZQA 3W00A 2MFNA 2OQYA 4RFEA 2XBZA 5FM8A 1CZ1A 5F1KC 3V6ZA 3V9EA 5HDLA 4JG5A 4YSAA 3VH8G 2CZVA 2ZX6A 2DLTA 2R7EA 1WT5C 3MUCA 2JB6B 3DFNA 4Q8UA 2BZNA 1KRCC 4GCAA 1YEDB 3PHOB 2OSXA 2CLMA 1BZ8A 3EYVA 2P24A 2PD5A 1W0WA 4AY7A 1HJBC 4DPPA 2PWVA 3UCQA 2A9ML 2EE0A 4LY8A 1OC7A 2DH3A 3FU5A 4J1UB 4GBUA 3VFRB 3GXNA 4UDTB 4RFNB 3D50A 1OYCA 3ZSSA 3BWUC 1HSAA 3CSFA 4LSQL 4U6HB 2J62A 1BQHB 5I6KA 3AHVA 1EWEA 2A83A 4YXHH 1VFHA 12E8L 2VHLA 3M7SA 3UA4A 2WJ5A 3FT3B 3Q58A 1UR0A 2EEFA 4XKYA 3WK2A 3NAAH 5FO2A 2R15A 3OKDA 5I8KL 3VCNA 3QPYA 4AGPA 4F7EB 4TOYH 4NQSA 4LCWA 2ATKA 4PJGA 2PPFA 3PN8A 4G8GE 2N3JA 2E28A 3TP4A 4DGIH 1LRNA 2PC8A 5DBUA 3OG4B 4PJEB 1GZPB 3NFPA 3LSBA 1Q6FA 5IOKA 3T77A 3MV9A 4WSGA 1FFTB 4ZUSB 4RE3A 1IYXA 4Y88A 4PMYA 5HWMA 1KIUB 4NRRA 3VRIB 5K59F 3UCCA 4Y4HD 1GGCL 5EUOE 3ZZQA 4IMDA 4W86A 3QB7C 1XMEB 2ATAA 1A5BA 4DY1A 5DLLA 1CFMA 3CTLA 4Y9GA 1VFBB 1Q6DA 1DUYB 1EZVX 4S3JA 4CU7A 2Z1PA 1U3HC 2HYMA 5DX7A 1AQDB 3L8QA 2DQMA 2VL4A 1CF8H 1BP3B 3BOLA 4X8JB 1L5GA 4YTQA 1KB9J 5EIIB 5FJJA 2XJKA 2ZONA 2PRMA 1FWIC 1NBVH 2X4SB 4D3CH 5C92A 4MA1C 3IE9A 3V0WH 5JHLH 4Z2IA 2O5YH 3JRKA 2NLJB 1ANUA 2MUCA 2I7GA 3ZQXA 4JQAA 3MCG1 5BPPA 3V6OE 4FEZA 5GHWL 1R5WA 3OO2A 2CA3A 1KR1A 3TO2B 5CN3A 3M7WA 3V1PA 4HIEB 2AC0A 4E41D 3H7VA 2E6PA 1IXQA 5ACZB 2PF6A 4OGAD 3I6LE 5KUKA 3VXUE 1A47A 2QYGA 1T0NA 1RPKA 2IQTA 4Q8MA 3NG3A 3QDAA 4P4KA 1USZA 5CBEA 3K5XA 1UA6H 2WVVA 5LIXX 4ZXBD 3IKCB 3UJJH 2A74A 5KSBF 2VKZG 8RUCA 5ESAB 1SFLA 3GHPA 1DL3A 3RPDA 2E9LA 1XLCA 4K3GA 3PZIA 3E2SA 1G4RA 1T04B 2CBTA 4I77H 4O0QA 5CCGE 1C08A 4YVNA 4AZHA 4TQIA 5F9JA 3SGUA 4K71C 2YBVA 1MJ7L 3HMWL 2OK0L 3RNQA 3VOIA 2OR7A 4Y4HC 4B9GA 5D7LD 3SY0A 1B3YA 4GI4A 4XNBA 4PY8I 2GY5A 1BPLB 3NPWA 1PX8A 1TEFA 2Z35B 2BGQA 4JRYE 4OV5A 5C6PB 5AECA 4OFPA 4HUWB 1XYMA 2Z92A 3TA3D 1L6XA 2R94A 5IW1A 1CVSC 2GY7B 4PCYA 2Q9OA 4Z3JA 1WIOA 3CL7A 5LGKA 5IB3B 4JM2A 4WEVX 3WJSA 2TRSA 3MA9H 3VXMB 4ODUA 4AJ0A 4MJ5A 4GQ9H 1IR2A 2N7SA 1XO8A 2RBLA 1Q9OB 1XF3B 1QPPA 1OFQA 4Q56A 1DEEB 5LSMA 4G80B 1QSFA 1MFEH 4NM8L 1UM4L 3QIWB 1LDSA 3QHFL 3QZNA 1R5IA 2Y23A 1Q0YL 3QRLA 1FXPA 2JKJA 2AXWA 3QCVL 3OZMA 3PPGA 4OGAC 4NM4L 4BRJA 3TIEB 4LF2A 2BX7A 2XRAH 4TLUA 3W1XA 1QLRA 1GYMA 1H49A 2FDSA 5I03A 5BZDB 4ZXBC 5FOOA 4UB0H 5L6UA 4X6CE 5I1HH 3V0VB 2YBRB 1XIFA 5J8LA 1MY5A 3TBBA 4FX8A 4YWGH 4PGJA 4IRJA 1Z48A 1K4CA 2ZDRA 3KLAA 4PRBB 5MHSD 1U8NB 1Y18A 4OZGE 4KNQA 2VDMH 2Y06H 3E0IA 1UYQA 2MNWA 3IKKA 3T4AA 3OVQA 3TKFA 3AM8C 2I17A 3GO1L 4IIEA 2CXGA 1VYSX 4R7XA 3TA3C 1XQLA 3ZL4L 3LHPH 3QV6A 2ZOXA 4B15A 2FYYA 3O4LE 2AJUL 5CKAA 4GRWE 3MRFA 4HC1L 4IIFA 4S3EA 1J0ZA 2NZIA 5DVMA 3WAJA 4B3LA 4E38A 1JYXA 2WV3A 4FKKA 5F0JB 5KVEH 4XOAA 1HL9A 1XRFA 1JK8B 4LNRB 4HXAL 3SB0A 1XZ0B 5AKVA 2NR6A 5A2FA 4K23H 4JTCA 2EG6A 1NFDB 4WU7A 3OHIA 1WAEA 2I60H 5LHDA 3D52A 5K69A 5KITA 2GSEA 1IBZA 2LQRA 3PHQA 3DJRA 1JAEA 1E1CB 1VH7A 4AWUA 5KVFL 3IPBA 5F93C 4XZLX 2KZKA 1GKRA 4N2GA 1PZCA 5CJOL 3JWNE 3G0UA 3P9MB 2E9IA 1DQDL 1JFQH 4UM9A 3GQYA 4I13B 5BRPA 1YNLH 3AC0A 1U8HB 2WLNA 4NO2B 1J8HB 3P73B 3SM0A 1WQVT 2NUPB 3PDDA 2PWFA 5J6SA 4R88A 2DSWA 4ZMXA 3ZJ6A 5BRZB 1AD9A 1CI5A 4P23D 4M1CD 1CXHA 2CKRA 4LCRA 3W82A 1QPOA 2XWJB 4CRPA 2VRAA 2YXFA 4U0RB 3VGEA 3GDMA 3I85A 1VPYA 3BPOC 4F2TA 1UA7A 3M43A 4BIKA 3LOWA 1JVOA 1R46A 4DHGA 4WK0B 3K0YA 3C3NA 1OSZA 4HV8B 2NX5D 1Z1WA 2IBGA 5ISZA 1XGQA 1TZIA 4FALA 5GXBB 2EH7H 3F83A 4H1ZA 4I0PB 1IF2A 1JV2B 2F7IA 4IMGA 4Z95L 1TJIH 2VDIA 5J5DA 3CIWA 3I6SA 1IILE 5C0BE 4FXKA 3FT9A 1E9OA 4BQ2A 1JGIA 1EEZA 4HSHA 1N18A 4H9YA 4IRZA 3UTSA 3DECA 3SW6A 4OI7A 3W1UA 2J6EL 3BV4A 7PTDA 4DLMA 2O4QA 3NCJL 5L2KE 1KO0A 4GSXA 4P59H 2Q86B 2JQMA 1YBQB 2C18A 5D2YA 1JSYA 1DKWA 2OEKA 1QTYT 5JW5A 1IEBB 4N2HA 5D6CB 1CXEA 2BSSB 4XXCC 1KENL 4MD0B 3UR7A 3G0SA 1Y6NR 2V3EA 4AQ1A 3WMCA 3LKSA 3C6LC 5AWNL 1IBYA 4X5PA 1M68A 1O6VA 4GAGH 4AD3A 4DXVA 1JPSL 2I32A 3CC5A 4A05A 3VFCA 4DAIA 4LCIH 4MSSA 1ZLUH 4P23C 4M1CC 4F7KA 4FFTA 1OC5A 3CZUB 1HHKA 3TIMA 3GDRA 2QCNA 4QHUB 3UIZA 4P5TB 5IEKB 2WZIA 2ZC8A 2D7NA 3UGUA 1Z3NA 3EPOA 3Q2LA 4XN2A 4NQQA 3QFJE 5IW6B 5JXED 3K2UL 3A6OA 1C5CL 1ZLWH 3ITGA 3ZDWA 1XGPB 2NW2B 4AEHL 1N68A 3L5WA 2EDFA 3GNDA 1L4IA 2W66A 2H1PL 1JAKA 1MJJB 3M44A 4AEIH 5J89A 1ENUA 4ROQA 2NNXA 4UQ3A 5T3XH 2ZSWB 1MCQA 3B2UD 1WZKA 1XF5A 1AMYA 3SOBL 5REQB 1R5YA 3S35L 2FX8L 3O3UN 2IIJA 4KFNA 2YEQA 3EJYD 3U0PA 5AB2A 2C1HA 3AB0B 4YPGA 4JQ2A 5EG6C 2ZVRA 5F0MB 4HCRH 4IKNA 3H4XA 4YTRA 5FA3A 5AHEA 2X4OB 4AD2A 2CHDA 4Y5YA 1NFDF 4BFFA 3DJTA 2VDMB 3JWOL 3LUTA 3EZJB 1JGLL 4QRNA 4G8EB 3NCOA 2CAKA 5FJTA 3Q6GL 1ERNA 4G42A 1FYTA 1RURL 4M93B 3CMOH 1NEZB 2Z91A 2DI8A 4MHHG 1XF4A 4X9HA 3LH9A 4GKTA 4HZLB 3TN0D 1H0DA 4XE0A 4K3JL 4WSKA 1S5HB 3ES6A 1BQGA 1QFOA 4TQEL 4U1LA 2QGCA 1E1EA 1W0VA 5F44A 4NJKA 1VFUA 5JW3H 4LGRB 3QJAA 3YPIA 1JTTA 3HRZB 3MRDA 5ABAA 4KWUA 1IU1A 1SXSA 4AZ8A 3FS9A 3QUZA 2REQB 5E6ID 4ZFZA 4ZSOB 5I1GL 5JXEC 3AIVA 2NQ5A 3PGCA 5HNTA 2APWA 4PPTA 4HK6A 4PB4A 4OSUH 1Y1DA 1A9EB 3PABA 1RBLA 3SCNA 3B37A 2CGRH 3REWB 3L5XH 1A5CA 3U2IA 3B2UC 2OMUB 4QHKJ 1V02E 1OAYH 5HHPB 3QDJD 3L17A 4LAMA 3S34L 4KRMB 3SPJA 3MC0A 3HVNA 3TWYA 2HG5A 2EYTA 4UBDD 2CLZA 5JQHC 4TUKL 1GGUA 3FNDA 2OJEB 1JWUB 1CYWA 3NSNA 1E15A 1ZHKA 1HK6A 5F1SA 1KB5H 3H9HA 4XN9A 1IM9D 3BWSA 4ODTH 1TPXB 3GPSA 2W88A 4XRCB 1L6WA 4IICA 1FZOA 4P0DA 4Y4KB 3B0XA 3UYOD 3KYMA 5CJQL 5C3LD 2EKSB 3NGFA 5DRXA 4R7NA 5D96C 2R8SH 4DP5X 1CD8A 4KFMA 1MCWW 3BVXA 1UB6B 3TN0C 5BVJA 3K4DA 2DTMH 6REQB 3FXYA 3FF7A 2OCJA 1H51A 1DFXA 1C1EH 4JPWL 5DZPA 4BFBD 2CO7B 5C6MA 4JICA 1TUFA 5D2TA 2XFYA 3W24A 5E4EB 5DMLA 1NFAA 4JTUA 4PB9L 3W7MA 4QITA 1I60A 3R94A 1KBPA 1QG3A 1RZKC 5E6IC 5I7GA 3L3DB 3LZ5A 4DNHA 1AS8A 4H2AA 4APQB 3P77A 4LCVA 5GS2H 5FYLL 4L5ZA 3IGFA 4BYHA 2J1ZA 2B3RA 4B0MM 2XZCL 4FFYL 4F8NA 4Z7OE 2B1AH 2FDMA 1NA8A 1M53A 2BVOA 4JIIX 2LAAA 4R34A 3RY5A 2R56L 4MDIB 1ZDSA 4UBDC 2DWTA 5DHXB 2WP3T 3NQEA 5DD5L 2VP8A 2G0WA 3MUZ1 4NNYB 2XTJB 2J55A 4Z7IA 4GG6A 5AD0B 4TUOA 2H2PD 1ZSDA 1I9JL 2HWGA 1AH1A 3FJ4A 1JYNA 4IKJA 1BD2A 4I9AA 1SR9A 3WN6A 1IX2A 4WO4B 1W3JA 3C2SA 2DMCA 2HVKA 3WIIL 3MNMA 1I7UB 5FS5A 2PPEA 6XIAA 3X1EA 4BFKA 8CGTA 2G5RA 5B3JF 1XBXA 2I9EA 3PXLA 4WHDA 2GQAA 4F7MB 2X38A 1JHLH 3DN5A 4FFZH 3L68A 1X44A 5AZ2L 5ICZB 4XMZA 2F0CA 1J11A 4H83A 5BZWB 4P7LA 2XUCA 1B31A 5F72S 5ACLA 2EINB 1MQRA 5TE4L 3N1GC 4XPHL 1O1ZA 3PJSA 3MUAA 4JQXC 1CLZL 4P2YA 2NUYA 1UJ3C 3W7OA 5BOFA 3T7VA 2WN2A 4IMEA 2R2EB 5I71C 1OP5K 1D8CA 2BY2A 4OHQA 1K77A 5CMAA 1JXFA 2YB1A 4JFWA 3HIZA 2ZOLB 5KVGL 4WWKD 2J6WA 4UR7A 4J3ZA 1U8MB 3JQOB 1K8DA 2IAMB 1OSPH 3FK4A 3MUY1 4O4YL 4K1GA 3PDOA 1DDHA 3RZCB 4I48A 4HZ7A 1OAXL 2J1KA 5DCBA 2OXGA 2ZJSL 3HE6D 3B7UX 5C7XH 1QI5A 5FL1A 1U83A 1JDAA 3MYOA 1PAZA 2FGZA 4AMCA 4FOUA 2IALB 1DE6A 2HS8A 5EC1A 4NQCD 4XPAH 3NL3A 4FNUA 1IZJA 5DVKA 1PLAA 4XO4A 2H2PC 3M0HA 3LKPA 1IC4H 3WLOA 2GGGA 2MEJB 4PZVA 4LLDA 3H7RA 1B2YA 2VXUL 4PTDA 3BEVB 3VK5A 2R39A 3II2A 4KFZC 5JHDB 2FQDA 5FLUA 4YHZH 3U6RB 1B4KA 1UACH 4ABVA 2ADGB 2BC4B 1HEHC 2P5EB 5DMGD 3EX4A 3ALPA 5CWSB 1TPDA 2O56A 3NQVA 5J8OA 5LGHL 4CMMA 1KPRA 3SBFA 4V15A 1WAAF 2A6IB 4JFEE 3ULVD 4N6RA 4AI7A 4X0KA 4JFYA 2Y5TA 5J5EA 3KVJA 3SJ3A 2DIJA 2H32A 3W74A 1E4JA 1BIHA 1R3IH 2FJGA 4A35A 3IJEA 1KB5B 5H8UA 3OKKA 1UR3M 1EXBA 4WWKC 4EMZA 4F37F 2J8GA 2DD8H 1SOQA 3TUUA 3AUOA 3TFCA 3B5GA 3RM9A 4ACZA 2WLYA 1D6EA 2HB0A 3IN0A 4H9TA 5J1SC 3LRSB 3LGEA 1EQCA 3HE6C 3HQNA 2JLLA 4LYKA 3GVVA 2E4TA 1NGZA 4YOKA 4GJJA 5TQ2L 2UZ9A 3CXDH 4H6QA 1R3RA 3OZOA 3VFSA 1NSJA 2GTQA 1NAML 3H3KA 3X12A 4IK6A 5IBUB 4GH1A 5T5FL 2BRQA 5JA8B 1TITA 4RGND 1TZHB 5E08L 5E8OA 1FZKA 2WOQA 1PG7H 5IV2A 1UZ6F 3IT8D 3W1ZA 5CPSA 3MP4A 3LBMA 1S6NA 1AG0A 2DSVA 5DMGC 2Q6WA 4A2DA 2J7GA 4HGMA 2HVNA 1ADQH 4P61A 1BVLA 2E8ZA 2ZC1A 1NBQA 3RWDA 1KGUA 3M16A 3WKML 4MDPA 1ZKAA 5IQ9B 3ULVC 3E6FA 1EKOA 3W1MA 3E6HA 1LO2H 1F6PA 2NWRA 4IJ3B 3NFNB 3Q2CA 3VFNB 1VJSA 3VRJA 1U6AL 2WUBH 4PMVA 3T4YA 5DZNA 4IKKA 3UBXB 2OYMA 1KEGH 3D3VA 3LD8C 1Y0LA 4N2KA 3B1TA 1C8YA 4YE0A 4RZBA 1BYCA 4D6JA 1DBJH 2VEIA 4CC0A 4ZMZA 2KAUC 2J9ZA 3GT6A 2IFFL 4B92A 2VE6B 2GC4C 4GY4A 2Z7YA 1TPH1 2E5CA 2YW3A 1TZ9A 2C1GA 2Z1VA 1VF5C 1C92A 4Y7EA 2CKBB 5GJPA 4AZBA 2H9AA 3QA3B 2XH2A 4LASL 4MWAE 4PV9A 1VFFA 4RGNC 3QKEA 4WNQA 4LSPL 1NOWA 1A4JA 5DCCA 4GO6B 4MQ7A 1IRAY 3QBUA 3IIZA 2ZXAA 2FWOA 3T2LA 1N82A 3IFPB 5C1MB 3BZEB 2UY6A 2HE5A 3QNZA 2YC1A 3OXSA 3KOWA 3U2JA 3FQ1A 4ENEC 3G6JA 3TSDA 1RZFL 3CWGA 2O61B 3QO0A 4PTWA 2IJ0C 1WB0A 1JZJA 2OWWA 3C2YA 1YMYA 1FIGH 3T42A 4NUJA 1S7UA 4NHUA 1QAWA 2N4IA 1IC5H 4H9VA 4NQVA</