3OLGA

Structures of human pancreatic alpha-amylase in complex with acarviostatin iii03
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
495
structure length
495
Chain Sequence
b'YSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Structures of human pancreatic alpha-amylase in complex with acarviostatins: Implications for drug design against type II diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 172
structure length 495
sequence length 495
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3olgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3olgA01
2JFEX 5A6SA 5A6BD 3DDGA 1H4PA 1OB0A 1W9DM 2OLHA 2WVVA 1TQSA 3BVTA 1J12A 1QNSA 4FLRA 2W62A 3CUFA 2WNWA 2JIEA 4JFTA 5D8ZA 4EANA 3UG4A 3T09A 2UWFA 1W9VA 3VTRA 5A3HA 4W7VA 5D8WA 2EACA 3GTNA 2EPLX 3AQUA 3CUGA 3WEOA 1HJVA 1MQRA 3ZIZA 1I1WA 2CXGA 2GJPA 4ZEPA 3FXYA 2BV9A 3CZEA 2WAGA 3L4YA 2EPNA 5CQ1A 4AZBA 1E6NA 1JDDA 4GO9A 4MJ4A 1C3FA 3PZTA 3NJ3A 4R27A 3U57A 1CYGA 1W3KA 1D3CA 2VQTA 4DM1A 2X2JA 1EO5A 1W1YA 4M80A 1GZJA 3WDJA 2VJXA 3U7BA 3VIMA 5ABHA 4JFUA 5GNYA 3QHNA 4GO8A 3AHTA 2WBGA 4XZBA 4JKLA 4WSJA 1E40A 1GHRA 2JE8A 1QBAA 4D71A 2WYSA 2J7GA 1X6LA 2ZOXA 5BXRA 2CHNA 2WHKA 2WLZA 3QHOA 3OGSA 3RPMA 5ABGA 3MSDA 3DHPA 3D3AA 2X8RA 4HMCA 1R34A 1QW9A 4PMDA 3OZOA 3BAKA 4B9YA 4OUEA 1V6VA 4W84A 4AZHA 5BCAA 2BNJA 3WNMA 1NP0A 4AZCB 2VRKA 3I3BA 3WF3A 3A4XA 3ZJKA 1UR2A 1CLXA 3BVVA 2JF6A 2UY2A 1GOOA 3AIVA 3PTMA 5A2AA 4UQCA 1V02E 3MMUA 1OIFA 1O7AA 1LJYA 3BVWA 4CU8A 4P7QA 1HL9A 4YPJA 3LPOA 2IGTA 1GQJA 3VD3A 3AZTA 2XIBA 1EOMA 1OINA 2O9TA 5A6BA 3M7SA 1XH1A 3EDEA 1HP5A 2VX4A 3DX2A 2XGIA 4CN4A 4HMDA 2D0HA 1ESWA 3BLBA 3H54A 3ZJ7A 1H09A 1UKPA 1R46A 1OT1A 4NI3A 2DGAA 1XH0A 5GPRA 1UKQA 3JUGA 1AMYA 4NF7A 1B0IA 1TUXA 1KBKA 4QLJA 4NZCA 2YKKA 3VIKA 3WH8A 1ZU8A 1BAGA 2O9PA 4HA1A 1R86A 3VDHA 3VM7A 4CU7A 1UH4A 3BGAA 2FYVA 2XN1A 2WC7A 5A8PA 1GCYA 3OG2A 5ABFB 2VZTA 5FOOA 3ZT6A 1BSIA 1KTBA 1VIWA 3L2MA 1LG2A 3D52A 1FH7A 3A4AA 1J18A 2GDUA 3NUKA 3VUPA 2EBNA 3AZRA 1ISZA 2A3AA 4BQ5A 3VGFA 2WM0A 1CLVA 3PZ9A 2VZOA 3AIWA 3SCTA 2VX5A 5D4YA 4MDOA 1HJSA 3EDKA 1H1NA 4H8HA 5IXEA 3AHZA 1VRXA 2YJQA 3RILA 4PMNA 1E4IA 1FP8A 5EFDA 4FK9A 1TMQA 3B9EA 3RM8A 3O2LA 4IM4A 1ZS2A 1CEOA 1I1XA 1U30A 2EQDA 1AQHA 2VURA 4J27A 3UCQA 1Q6EA 3IAPA 1WDRA 1JZ2A 1TQTA 1GOKA 3E1F1 2GUYA 2EAEA 2F7QA 2WKGA 3LXAA 3VSVA 4P7NA 4U3CA 3TP4A 1KBBA 1EHAA 3SCSA 3AMGA 2VUYA 2EADA 1ISYA 5D9PA 1CZ1A 3ALGA 2WHMA 1BVNP 3BUDA 1E43A 3OGVA 1W9XA 4F79A 2G3JA 1HKJA 7CGTA 3RO8A 2RGMA 4GINA 3KZSA 4QCFA 4XB3A 2ZX5A 1CWYA 1C8YA 1D2KA 3VNZA 3AJ7A 3MO4A 2XHYA 4L4OA 9CGTA 2E40A 5ECUA 4RE3A 1XV8A 1FHLA 1JNEA 3TTOA 4W8AA 1JD9A 1UWUA 5CPQA 1JZ6A 3KL5A 2X0YA 4ZE4A 2VVNA 2VX6A 4JFWA 3QHMA 3VU2A 4JZ5A 4PTWA 3B8SA 1TQUA 4P7OA 5JIPA 4GI8A 3WELA 2WHJA 1KCKA 4HP5A 3O9NA 1LWJA 3L4TA 4MNKA 5KEZA 1EHNA 1M04A 4AMCA 4E8CA 3AIEA 3WD3A 2V3FA 2QV4A 3IK2A 1FH8A 4FNTA 3CC1A 1UQYA 2BS9A 1UZ1A 1BQCA 1XD1A 1V6UA 5I6SA 3IAQA 4PSRA 2W63A 1VBUA 1UD5A 3AMLA 3DDFA 1ISWA 3CPUA 2Z1SA 4D6CA 4AZCA 1CENA 3IJ8A 3WDPP 1TE1A 1UOKA 4PCTA 4M8UA 5M03A 1PBGA 3T2QA 4MNMA 1FFQA 1JYVA 1EH9A 3SUWA 3VM5A 1B9ZA 4CD7A 1UD8A 2V3GA 2YDSA 1H41A 3WDIA 4CD4A 3ZOAA 5LYRA 2GFTA 3T2OA 1BG9A 4C7FA 2CBUA 4GIAA 4HOXA 2EO7A 3LMYA 2X05A 1NOUA 1TA3A 1VEOA 4FLQA 4CD8A 4XX6A 3EJUA 1WP6A 8A3HA 1W3HA 4D6JA 4CCDA 3SURA 1A3HA 5LA1A 4GZIA 3W6LA 4NXKA 2O9RA 4Q7NA 4B16A 3HZ3A 4U2ZA 3SCOA 2OYLA 1W3LA 3AS2A 4JKKA 1ZJAA 1HVXA 3OLEA 1V02A 2WBKA 3CMJA 3SUUA 1SMAA 4AD2A 2NW0A 3WD1A 3WNOA 2CITA 1PPIA 3OGRA 2QMKA 2WMIB 3CZSA 1R75A 4B15A 1JYNA 3OZPA 1NWUA 4JHZA 1TQVA 4W7WA 1QOXA 4GZEA 4MPKA 4WKHA 1TZ7A 1IT0A 1T0OA 3GZAA 1G5AA 4AXNA 4OIFA 1UWQA 4W88A 1E1EA 2YBUA 1BYCA 1XYFA 1BYBA 3WH5A 2WZIA 4Z2HA 7TAAA 2D0FA 3CUIA 4H7VA 1CGVA 1WE5A 2GJRA 4TVUA 3CO4A 1LL4A 4MB4A 3GNPA 5KZ6A 5E6ZA 1GONA 1Y7VA 3CTTA 3WY4A 2DEPA 2VX7A 1BGGA 4OOZA 4OKDA 1HX0A 2PWGA 3WF2A 1XHGA 2F1AA 3RCNA 2FGLA 3EJPA 4M82A 2ZXDA 2D3LA 1JNDA 2E0PA 2WVSA 1W32A 3GH7A 4WKFA 1KGUA 3AHVA 1K9TA 4J3TA 2GJXB 1QPKA 1YQ2A 1S46A 3TTSA 3GNRA 3VMPA 4P8VA 4ATLA 3PZNA 3M46A 2XPKA 2W5FA 2DH3A 4P8UA 3PHAA 3THCA 1X1NA 5CPTA 4CD5A 4N42A 5DEZA 2NT1A 5DT5A 2VMFA 1E0XA 2DT1A 2GVYA 5HDRA 1E55A 1RPKA 3HG5A 1N82A 1UH3A 1V3MA 3VIIA 3DHUA 3VX1A 4BQ4A 1OGBA 2J7CA 2PC8A 1R85A 2BY0A 5A6LA 1DWIM 1HKIA 1Q4NX 5DO8A 2E8YA 1CGYA 3WFLA 2BHYA 4JL1A 2WMHA 5AC5A 3K46A 2YDRA 3UG3A 3VMOA 1OM0A 1F4HA 4D1JA 1UR1A 4R5EA 3PZMA 3LPGA 1UH2A 3L4WA 2CBJA 4CKQA 2YA2A 1C8QA 4H41A 4PMVA 2GSJA 2A3CA 2VNCA 1J01A 4UZUA 3CZKA 5EB8A 2PWHA 2CEQA 2YL9A 1MW1A 1DWJM 3ARZA 5D9OA 4ZXOA 2AAAA 2WCSA 5E0CA 1UD2A 3W24A 4AIEA 4ACZB 1VBRA 2XFRA 4C7GA 1ZJBA 4PTMA 3ZJ6A 1BHGA 4DO4A 3S6TA 3T0BA 4Z2GA 3IGUA 4D72A 4TTGA 1TQWA 5BRPA 3SIMA 1UD3A 1G0CA 3WIJA 2ZUTA 2IXVA 4HMEA 3BXWA 5TD4A 5AYIA 1UZ4A 2B31A 3VIGA 1OBAA 4J3XA 3D5HA 1ECEA 2CBVA 1WZAA 4UR9A 1HL8A 3WN6A 3VIJA 5AC4A 2F2HA 2XN2A 4PUDA 2D23A 2X0HA 1HVQA 1V03A 1BVZA 3SCQA 3GXIA 4TX6A 3WSUA 3AXHA 3BUPA 4ZE5A 3WUEA 3MV01 2XVGA 4QAWA 3AS0A 4DUWA 3FN9A 3OLDA 3DX4A 1UR0A 3ARWA 2D24A 4MAZA 2EPKX 1E9LA 1PIFA 1JF5A 1UWIA 2WMJA 3EDDA 1VEPA 5HOSA 4CVWA 2W66A 1GOQA 1VFOA 3EMQA 3AYRA 1MVYA 5CLWA 2YL8A 1EDGA 4W8BA 1RP8A 2AOSA 1PIGA 1DP0A 2F7OA 1HF6A 3EDJA 1RP9A 2WVTA 2VO5A 2C8NA 2WMIA 2ZXQA 1DWHM 2EJ1A 1WDPA 4IPNB 1CBGA 4AD3A 5HBFA 4D6HA 3GXNA 1M01A 1V0LA 2ZUMA 3DYPA 1R7OA 5LA0A 5BYWA 3W38A 5A69A 1A47A 1J0KA 5I5RA 2D22A 1PZ2A 1JG9A 3BVUA 3DX1A 2BVDA 1OT2A 1HN1A 3WQWA 4OBSA 5FL0A 1J11A 2VCBA 4AD0A 1MQPA 1NWTA 4KH2A 4TXEA 2DT0A 2YFNA 5A6JA 1VFFA 3N13A 3LRLA 4D6FA 1ITXA 4NZJA 1JAKA 1V6WA 3AICA 1M03A 4UQDA 2CIPA 4FLSA 1NOWA 5HPOA 2J7HA 3WMSA 3AS1A 2GJXA 1UYQA 4GQQA 3WQ4A 1ODUA 1M7XA 1WZMA 1W9BM 4CGTA 1DEDA 2WVUA 4D6IA 2CKSA 1F4AA 4OJYA 1HP4A 1QHZA 3FNDA 5I77A 2ZX8A 3N18A 4U5KA 2F18A 3ZSSA 1W1TA 1XCWA 3WD0A 1R7AA 1JDCA 1HJUA 3RMEA 1HIZA 1UWRA 3F5KA 1W3JA 4MNLA 2DT3A 1V08A 1BGAA 1QI2A 4TVDA 3LX9A 4PMXA 3KL0A 5JBEA 2AMGA 4B9ZA 3UR8A 1L0PA 3AYSA 3DX0A 3F5LA 3BAYA 3BLPX 4LYPA 4ZFMA 1QWUA 3WEZA 3AOFA 2OW6A 4AZ7A 3EJRA 1IV8A 3BAJA 4OZOA 2XVPA 3MANA 2FHCA 1ODZA 4X9YA 1GNXA 5CPSA 4F8XA 2VZUA 4U31A 3EDFA 3PTKA 2WPGA 1LWHA 3AIBA 3MV11 3T2PA 5I23A 1M53A 4J7RA 3UR7A 4ACZA 4F66A 5A6AA 3RM4A 1U2YA 4D6GA 3LPPA 3WY2A 2XUCA 2CERA 4AMWA 1UQZA 3GXFA 3VINA 2WMFA 1OD8A 2XN0A 2XSBA 2BXZA 2MANA 1MW2A 3AFBA 4S3JA 3W4RA 1HWWA 2PI6A 5IHRA 3EMCA 4OBRA 1QHOA 3U7VA 3W0KA 1LF1A 3WEMA 1MFUA 4W7UA 5FCZA 2WZHA 2CNCA 1H3GA 4D6EA 1OCQA 1UKTA 3WNKA 2E9BA 3W53A 3ARUA 3VD5A 4E4PA 1R47A 4AMXA 3CGTA 2CBIA 3POCA 5AYBA 1GOWA 3BSGA 4CD6A 2V5CA 2X1IA 2VTFA 4H8VA 4UFMA 1XGZA 3WF4A 1Q6DA 3WUFA 4IUGA 4X0NA 4TUFA 1C90A 4BQ3A 2C7FA 2J74A 4MNJA 3CIVA 2VCAA 2WK2A 2G8ZA 3WY1A 3NYDA 1VAHA 1W2VA 2BY3A 2WHLA 1PEZA 2Y4SA 2J75A 4UQ9A 2XWDA 1HXKA 5E6YA 3TONA 1R87A 4AISA 1UWSA 1GJUA 1E4NA 1V0KA 3QOKA 3RJXA 1C8XA 3GDBA 1UG6A 4LPCA 3BVXA 8CGTA 1CPUA 4JHOA 2WB5A 1Q6CA 5A8NA 3OIHA 4FNQA 3U5UA 2WANA 2J78A 3L2LA 3VIOA 5I78A 3VKKA 3HG2A 3D51A 3WH9A 4MB1A 1BYAA 4WJXA 1FA2A 2UY3A 4MB5A 4P8WA 4JL2A 2VR5A 2DPEA 2XFFA 4EK7A 1NP2A 1G01A 3DYMA 3HG4A 3WMCA 5HPCA 5C71A 7A3HA 1V3KA 3A23A 4AWEA 4HA3A 3VIHA 1CXEA 1JDAA 1KB3A 2OYKA 4CCEA 4AZ6A 5JBDA 5GQBA 4KGLA 2CKRA 3A47A 3AIUA 4JFSA 1DWAM 1UR9A 6CGTA 1BFNA 3F5JA 3N17A 3LPFA 1XSJA 4CCCA 1E3XA 2D73A 3ZM8A 1CXFA 3G6LA 1YHTA 1OSEA 1E6PA 1E72M 4OOUA 3K8MA 1QHPA 3MUIA 5ABEA 1B30A 2GDVA 4RE4A 4HU8A 3ZR5A 1SZNA 3K1DA 3ZT5A 2F7PA 1QBBA 3GBEA 2D1ZA 4U3AA 2DSKA 1CTNA 3K8LA 4NRSA 4E8DA 3VX0A 3I3EA 3FAWA 1B3ZA 3OLGA 3HG3A 1B90A 2OW7A 2PWDA 1E6SM 1HTYA 3CMGA 1IZJA 1B1YA 1KXQA 2OSYA 1B3XA 4UFLA 2WC4A 2FH6A 1SMDA 2FGZA 3BLKA 1QNRA 3OLIA 3GH4A 1EOKA 1W9UA 3A24A 2YIHA 4AW7A 3AMCA 4EKJA 4PMOA 3PZGA 2XVKA 1JD7A 3QGVA 4ACYA 4LYRA 1PX4A 3SCVA 2TAAA 1VF8A 2OWXA 1JZ5A 2XVNA 4BQ2A 1H0GA 1UUQA 3AIRA 1CGUA 5A8OA 4WF7A 2JALA 3DC0A 5E1QA 1V6XA 1U33A 3UERA 2XJ7A 4W5UA 1PZ3A 1SYTA 1KWGA 1OGSA 1HKMA 3CZJA 1W9PA 2BFGA 2ZUVA 3KEHA 1J0IA 3AMKA 3CV5A 1ISXA 5ABFA 1UHVA 4UQEA 1VENA 5HNNA 5D9NA 4J3WA 1NARA 3DECA 4M1RA 2VI0A 1ZBKA 2GK1B 4FNUA 3ZJ8A 4U2YA 5F7UA 1ZBWA 1H2JA 3W28A 4QLLA 4PMUA 1CGTA 3H53A 1H0IA 1US2A 1QNQA 2WVVB 2VR4A 4NRRA 5EFFA 2QLYA 1UASA 1HKKA 4EAMA 3IJ9A 1JYWA 3M6DA 4J3SA 4P7RA 3CZGA 2PB1A 3KL3A 2XIIA 4QFUA 1QNOA 1KGXA 2DDXA 1OD0A 1KQYA 4JCMA 1CXKA 1L8NA 5I2UA 4WK9A 2OWWA 1ZB5A 3KWXA 2C0HA 3WUGA 4HTYA 5I79A 4B3LA 1JZ7A 1NOFA 5FKYA 5A1AA 4IPLA 3AIQA 4D1IA 3N04A 4WLCA 1BPLB 3UESA 3KLKA 4FF5A 3NDYA 2PF0A 4CU6A 2X2YA 3VDCA 3CHFA 2G3MA 1SR0A 1QI0A 3SCNA 2YLAA 3HMCA 3WNNA 1KXTA 3N1AA 1UA3A 1BG4A 2XFYA 1E70M 1V3LA 3VD9A 3FHQA 6TAAA 4S3KA 1UA7A 3D4YA 3AS3A 2WCGA 4XV0A 1TG7A 1XD0A 3A6OA 3MUZ1 3BCDA 4WIWA 3NDZA 1KFWA 4N0RA 3J7HA 3EBVA 5FL1A 4DWSB 1JXJA 4AZ5A 3S5ZA 4Z2JA 3EJQA 2ZX6A 3AISA 4UFKA 1E15A 1CIUA 1E0WA 1KXHA 4UQBA 3PZOA 3FW6A 4P8XA 3ZO9A 4YN5A 4DM2A 5CJ5A 5E0FA 4PRWA 5BROA 3MUY1 1CECA 2ESCA 1JIBA 1CGWA 2O9OA 3APGA 3BMVA 3WDRA 1EA9C 3ZT7A 5A2CA 2BHZA 1VEMA 4MDPA 3BUBA 3SUVA 3WQ8A 1MW3A 1E6XM 3ARVA 3CHCA 4LGXA 2ZXBA 5A6KA 2X2HA 4OGZA 1EXPA 1DWGM 1P6WA 3VIPA 1NWSA 2J25A 3WF0A 1WAWA 1HNYA 4W87A 1O7DC 2ZE0A 2XYLA 5IFPA 2UY5A 1AQMA 1HJXA 4AZIA 4GZJA 3UETA 1XCXA 3VIFA 2A3BA 2HVMA 2J7EA 3VMNA 2XSAA 2PBOA 3NSMA 3N12A 2WMKA 5C8BB 2FHFA 5BXPA 1Q6GA 4PUEA 3AHYA 1JAEA 2J77A 1QI5A 1J9YA 2IXUA 3I3DA 2X2IA 2YOCA 4L4PA 3MMWA 1BYDA 2OSXA 4Y7EA 2DH2A 3PZIA 1B3WA 2VVSA 3IANA 2D0GA 2CYGA 1E71M 4BZYA 2VRQA 1TCMA 1FP9A 1JFHA 1GQKA 3EJTA 4DWSD 3GBDA 5JBFA 5FIPA 1HJWA 3WKZA 1JI2A 3CUJA 4HU0A 2DSWA 1WDSA 3S2CA 3UG5A 3CUHA 3THDA 5BWFA 3PZVA 1BTCA 1K9DA 3WBAA 3II1A 5BRQA 2D3NA 5JIWA 3AROA 3RDKA 1E56A 5M17A 4GPNA 3NIYA 4P7LA 4AYSA 3A21A 4MAVA 2GK1A 3W6MA 5I3DA 4Q22A 2JIWA 3VGEA 3WL0A 4XUYA 4FNSA 1BF2A 4AYGA 1Q6FA 4AIUA 4AZGA 5I0DA 1XRVA 4AD5A 3N9KA 3VOCA 4MTVA 2Y5EA 2WC3A 3AXXA 1JXKA 1VB9A 4J28A 4FMVA 2E9MA 3TA9A 5EBAA 1EO7A 1XC6A 1JFXA 1JGIA 2YFOA 2OWCA 2ZWZA 1FFRA 1K6AA 3D50A 3MI6A 2QMJA 3IJ7A 3PZQA 2WW5A 3S5YA 2NSXA 2W91A 1GUVA 4PMZA 1E4LA 3TV8A 3SCUA 3CHDA 1GVYA 4QDMA 3L4XA 1V6YA 4PTXA 4HOWA 1OGGA 4UOJA 3MKKA 1UR8A 1KGWA 2OYMA 5E70A 5JUVA 1QI4A 5A2BA 1QX1A 1VFUA 3BUQA 1UKOA 4ZENA 3W26A 5LA2A 1KCLA 4CN1A 4FLOA 3CH9A 4PMRA 1TVPA 2XVLA 2WWCA 2ZUNA 4PSPA 1JL8A 2PBGA 3BMWA 1G94A 1V3HA 2G41A 1HXJA 3RJYA 3PZUA 3PBGA 1MXGA 3WH6A 4JAWA 1GORA 1MW0A 3VNYA 1JZ3A 3A4WA 2FHBA 3VGDA 2BHUA 3OB8A 1E3ZA 1J0ZA 1WCGA 3WMBA 2EEXA 1ZL1A 4NSBA 3POHA 3SCWA 3PTQA 4DWSA 4F9DA 2Y8KA 3WD4A 3T08A 1NQ6A 1J0HA 4TTUA 3D4ZA 1US3A 3VPLA 1GJWA 4W93A 2VCCA 3WFZA 1QW8A 3A22A 2OSWA 3MSGA 3WY3A 3WUBA 2DIEA 3NSXA 4UNIA 3VGGA 4X0VA 1E5NA 2DSUA 5DF0A 1I75A 3M07A 3GXMA 4DUVA 5DT7A 4K68A 2ZIDA 4A4AA 4U33A 3VGBA 1FOBA 2VZSA 4LX4A 2DT2A 4TOQA 2DSZA 1G9HA 3TTYA 3LXBA 4PN2A 1C7SA 1TA3B 4W89A 3ARPA 5CZKA 2WWDA 3SCPA 2WZEA 1C7TA 3CZ8A 3OBAA 4KRTA 3VVGA 3MMDA 1H5VA 1RD6A 4UFHA 2W61A 1QVBA 3MUAA 1KQZA 3WNPA 2A3HA 4GI6A 1CXIA 2QPSA 2WSKA 1E73M 3OA5A 1UKSA 2VZVA 5CGTA 1KTCA 3KE0A 3GYCA 4ATWA 3W37A 2YL5A 1CNVA 2BXYA 2CPUA 3O6AA 2XWEA 4GI9A 1WPCA 3BCFA 1VJSA 2W4XA 4LYQA 3TOPA 2O92A 1DTUA 1W1PA 2WXDM 4HZ6A 2W67A 1JF6A 3WNLA 2V5DA 3CLWA 5D9MA 2ALWA 3HU7A 2VRJA 3ARSA 4PMYA 4M24A 2BY1A 1E0VA 1CXLA 3VSTA 4W86A 2VC9A 1V0MA 2CCRA 5CLTA 1TVNA 4U5IA 1Z32X 1KXVA 2UY4A 1VFMA 1E6QM 3SUSA 3LRMA 4DUXA 4PCSA 2VT0A 1CXHA 4HOZA 1B3YA 1K9EA 1AQ0A 3EYPA 1G1YA 5A6MA 2Y8VA 3VD7A 1EQPA 2DIJA 1GOIA 1SFSA 4UFIA 1E6RA 4BA0A 2F1BA 3T0DA 1C91A 3RM9A 1GPFA 4WSKA 4IISA 5CGMA 3A3HA 2V3DA 2FDMA 2XG9A 4MJ2A 3PN8A 3U5YA 4D6DA 4LXFA 4KWUA 3ARTA 2ZICA 1B3VA 3LXCA 2QPUA 2J8GA 4RE2A 5CXPA 4JKMA 3MS8A 4BF7A 2Z1KA 4Z2LA 1CDGA 2J79A 4J3VA 4AD4A 1PX3A 1R33A 3CZLA 4HZ8A 2E9LA 3B9AA 1WZKA 2F61A 1KWKA 4PTVA 2J4GA 2XGBA 4FNRA 3N15A 2EXOA 1LG1A 5E09A 2ZX7A 4M29A 3FY1A 1E1FA 2WMGA 1EDQA 4UTFA 2J8FA 1W2PA 1UR4A 3WL1A 3KLLA 4NX0A 2QF8A 4W5ZA 3K8KA 3VDBA 4NXSA 2BY2A 1UD6A 1MFVA 1DWFM 1H49A 3GNOA 2WLYA 5A8MA 1V0NA 3SEPA 1AVAA 2E8ZA 2FE0A 3F4VA 1H11A 3DYOA 1R8LA 2YA1A 4JIEA 4PEEA 1QWNA 1NH6A 4CUCA 4TVCA 1J0YA 1FHDA 3WD2A 1VJZA 2Y24A 3LRKA 3FAXA 4W85A 4H2CA 4FNPA 1GHSA 4YHGA 5CSYA 1XSKA 1QNPA 2A3EA 3W27A 5IDIA 1ISVA 2G3NA 1TR1A 1XYZA 3AMDA 3FHAA 1GW1A 3CZNA 5DFAA 3WBEA 4AC1X 4GXPA 2ZUUA 4M56A 4DO6A 1EQCA 3GXTA 4H8UA 1JZ8A 2Y2WA 2PWFA 1UWTA 2YA0A 5E9AA 3GXDA 2G4FA 4GQRA 3VO0A 3ECQA 4CN6A 3BAWA 4QLKA 4UFJA 1RH9A 2J7BA 3RIKA 3WF1A 5A95A 1BLIA 1KR0A 1NM9A 1UD4A 4PYSA 6A3HA 3N11A 5FD0A 4URIA 2FH8A 1W1VA 4QP0A 2XM1A 2RGLA 5M3WA 4YHEA 4C7DA 3VGHA 1WKYA 2HISA 1XH2A 3GH5A 4ZXLA 3AZSA 2J62A 1PJ9A 4V2XA 1W91A 1ZBCA 4CVUA 2BVYA 4GKLA 3EJSA 4MB3A 4TX8A 1E4MM 4F9JA 3VILA 2DSVA 1LLOA 4RL3A 3BAIA 4DWSC 5DMYA 1C93A 1JZ4A 3H55A 2JF7A 1NWRA 3WH7A 3BAXA 1ITCA 3AXIA 5CG0A 2XM2A 1XSIA 1GQLA 4ML4A 1DHKA 2D2OA 4HA4A 4AEFA 4ATDA 3BC9A 4UCFA 4MADA 2JEPA 2NT0A 4UOZA 2G3IA 1IZKA 1FH9A 4Z2KA 3QR3A 1WZLA 1E5JA 4UZSA 2PWEA 3T0AA 4M81A 1JI1A 3NCOA 3ZR6A 4W8LA 1B31A 4NZFA 2DQXA 4BS0A 1PX8A 1PAMA 4PBGA 4HPHA 4AD1A 5GNZA 1J10A 2YL6A 4Z2IA 5BXSA 3W29A 2QHAA 1MWOA 2CETA 1B2YA 1J0JA 3EMZA 3ALFA 1LL7A 5C70A 3NSNA 2J7FA 2VQUA 3W25A 3ARYA 3ZSTA 2YDQA 4E2OA 4JCLA 3UEQA 2ZX9A 4V28A 2J7DA 3BH4A 1E6ZA 3MU7A 3GXPA 3AHXA 1GVIA 3VD4A 5AY7A 3VDAA 3QOMA 3WDHA 5EMYA 2EPMX 2E3ZA 4UQAA 2CHOA 1X6NA 3B9DA 4UOQA 3ARQA 2CESA 1LL6A 5M5DA 2WSPA 2VOTA 3TTQA 1PS3A 4KMQA 1D7FA 1GQIA 2WCAA 2V3EA 2JEQA 3ARRA 1EDTA 3K4AA 1WB0A 1EIBA 3CBWA 1MYRA 4AEEA 3L4VA 1OIMA 1TFVA 2EPOA 4KGJA 4PMQA 3WQ5A 2YLLA 4B3KA 1O6IA 2E4TA 3K4DA 3SCRA 2ZUSA 2ZUWA 5I24A 3L4UA 1WO2A 1WNOA 3AI0A 5HXMA 2V38A 1V3JA 4LQ1A 4KRUA 3VSUA 1KR1A 3G6MA 5CSUA 4QCEA 2F8QA 2EABA 2XTKA 1V3IA 3WQVA 2ZWYA 1MXDA 1LQ0A 1CGXA 3ZMRA 1JYXA 5A94A 5IHSA 2BVTA 2W92A 3WDQA 2IUZA 5IFTA 4HZ7A 4J3UA 1QI3A 2VL4A 5GNXA 2X09A 4A3HA 2Q8XA 4HPGA 3GM8A 3WQ6A 2D20A 5BXTA 1WDQA 1HJQA 3L4ZA 3CHEA 3BSHA 3W81A 1HT6A 2WKLA 4AY1A 3ARXA 2F7RA 3DX3A 4A3YA 1EGZA 4V27A 5A8QA 3HJEA 4H04A 4XZWA 1OWQA 3ZQ9A 4WKAA 3A5VA 4JFVA 1MQQA 3WENA 1GOMA 4DO5A 4BCEA 1C92A 2YBTA 2J47A 2ZXAA 3W82A 3HN3A 3SUTA 1K9FA 4AIOA 1ZBVA 4EE9A 3BUIA
chains in the Genus database with same CATH superfamily
3QI9C 1OB0A 3W86A 4PH8A 1PKQB 1J12A 4FSAA 2V2WB 2ID5A 4M7TA 3F62A 4QHRA 5JO5B 2I5QA 4XB7A 2DD8H 3VCNA 5DD5L 5CHNA 5F2FA 3WKML 1EJ7L 5GSVA 3DI2B 4ZEPA 1IAOA 1W37A 5JYLA 1JDDA 4JHWL 2VW6A 3HC3L 3C5JA 3LKRB 1JUFB 4GUGA 3TE9A 3QZOA 3CZFA 4NRXB 5G1YA 4LV4A 2FJHB 5F1NA 3EW3B 2W94A 1FH2A 2ZCLH 2UVFA 4PRBB 3TLLA 2R2EA 1GTFA 1KTLB 1UR3M 3RITA 4GBXA 3JTTA 5G2IA 4XIMA 3UO8B 2BNUA 3OZOA 2JJTA 1TETL 2YUXA 4EIVA 3TIMA 5JDSA 5EU3B 4F7KA 3WLLA 3L1FA 3BQ5A 1WX0A 4Y9FA 1HILB 4LTSA 1O1ZA 2VR8A 4B91A 1CFVH 3WKNA 3MRBB 3IJQA 2ICWB 1YEEL 2H2PD 5IOBA 2CLHA 4HV8B 3SE8H 1XH0A 4NF7A 3W7CA 4B0MM 3S3BB 1I45A 2AJXH 1TZ8A 4NZCA 2UUDH 4GMSH 4QHNA 3L3KA 5C55A 4BCXA 4CU7A 3H2AA 2L4OA 4GIEA 4GUIA 5A8PA 1QSFD 2ERJC 5E2TL 3MLYL 1XG4A 3OKNA 2FIKA 4DI9A 1BSIA 4WU5B 1OF0A 1MI5D 3HS0B 3TAKA 4GYKA 4GXVH 5CSBA 2VDLB 3AZRA 1AXTL 2GSEA 1X5AA 4BQ5A 3OU8A 2XOTA 3KBVA 5IJCC 1OM3H 3K74B 2CLKA 3OR7B 3FQRA 3EDKA 1GYLA 3QDGE 3W2UA 5AYUL 3KBEA 5LCVH 3E8UL 5BW7A 5M1TA 2QDWA 2WMPB 4U3HA 4LPWA 2B0MA 1DSYA 1SM3L 3CCHA 4OCWH 1A3LH 4K23L 4HCGA 1LE9A 1EHAA 3OKMA 1J5OH 1EDYA 3FCBA 4P46C 5AL0A 3FN0H 4GINA 3KZSA 5DRZA 4PUBL 3H7BA 5FYKD 4F8NA 5F2GA 5A16B 4Z3EA 2WOQA 4MNGA 3VFTA 4HXAL 3EX4A 4QRUB 1YYAA 3X1BA 5HGDB 1USQA 2BWIA 1QLEH 4QRPE 5JIPA 2WHJA 2GQ9A 1EZ2A 1FH8A 1T0MB 4XE0A 4G11A 2YEZA 1V6UA 4N2NA 4HUKB 4WOQA 1GG0A 3ZIYA 2GGIA 3ULVL 4ZCWA 1ROWA 3C2AL 2DZAA 4ZTOL 5ADPL 5I1HL 3T2QA 3SUWA 1C5BH 2ICWI 4NYUA 1MWAH 5FX3A 4IFKA 4GW4B 5EZJA 3SO7A 3Q9QA 4XMKL 2G96A 2YD6A 4UTAA 4UDUB 4LAZA 4CCDA 3EHBD 4DCQB 4H6QA 1ONQA 1YPZE 4I88A 1WBHA 3W6LA 3SCOA 4KWVA 2WKOA 4G1EB 1AGBB 1SMAA 1AG0A 4XMWA 1YADA 3TEWA 2VW4A 2APFA 3K91A 2X40A 4JR9L 4TUJA 2HPMA 4KJYA 2AI0L 5D2NE 3P0VL 1O5XA 5F6IB 4ISVB 1ZPUA 1V8HA 1WS7A 3OZ9L 1KC7A 4H7VA 1H5BB 4PJCE 3A4FA 1LL4A 5KZ6A 2ED8A 2A74C 2RR3A 1E5UI 3MV8A 5IVXA 2HKAA 4ZFOL 3ZLHA 4X6DB 1UOVA 4R84A 4AUYA 1AUSL 3M0HA 1FFOB 5DO2D 5EBWA 3TVMA 2Z6FA 3C6EA 1K9TA 4J3TA 4XPGL 1I0BA 2D2GA 1N0XH 3THCA 4QSHA 3A4JA 5I17B 1R3TA 2YGPA 1C1EH 3V9EA 3A3YB 1AXSB 4XOBA 4YWSA 4V1DB 1C9WA 1E55A 3WIHA 1UH3A 5C0BE 2JELL 4JL1A 3N3EA 3KOWA 1S5IL 3ITYA 2X4SA 4B9IA 1JGDB 5DK0A 3IRZA 3QO0B 3GWQA 3QEQE 5EL1A 2BVWA 1A9BA 1CD0A 3JWDH 4CCZA 3CVIH 4C6LA 1RJLA 4Y5VB 4ZXOA 1KB9K 1TKWB 1JVLA 4LUSA 1EJSC 3HE7C 2ZE3A 4BH7B 1NCCL 2C1PA 4P4KC 2NX5D 4NIYE 1M7PA 1UPMB 2IXVA 3H4FA 2ON3A 4A8IA 2CGRL 3D39E 1AD9A 3T78A 4WDIB 3T8VA 5AB2A 3APTA 2C9PA 4I8YA 4H4IA 1DXEA 4XXCC 2YD0A 1V03A 2IAND 2CDFA 5AWNL 3SIKA 1OOAA 1D9EA 3RLSA 4LC6A 4OZHE 2D24A 2QDEA 2ED6A 2UX6A 1MIEL 1FZJA 3K5SA 5DU7A 2L3BA 1JHLH 4QY8A 4ZDHA 3VFWA 4B95C 5E1AB 3SBPA 2C8NA 1W72L 3KVPA 1CBGA 4AD3A 3T71A 2D69A 3GXNA 1AJ7L 2WUBL 1MCIA 3NQIA 1H6UA 3DXAE 3GJFB 3GRBA 2BSTA 2QQ6A 4IGMA 5A69A 3SJVA 2D22A 3NIGE 1XGPA 5HJLA 1DOSA 3B7UX 4BELD 2XKNB 1UB3A 3BVJA 4JDYA 2YD8A 3HNVH 2ZOLB 3AG4B 4YSOA 3DCPA 1FIGH 5DC2A 5C3LD 2CDGB 4NEHB 3V5KA 5D6DC 4A21A 3LV5A 3MV7B 1V7ML 4J3ZA 1DIOA 1AQ8A 2VXUH 2MSPA 4M1BA 1MCWM 2FVKA 1U41A 1QSEE 4Y1AA 5KZEA 1BLNA 3N18A 1S78C 1S2VA 1G7MB 2YZ5A 3NCMA 1ZANL 5D2VA 4RRPA 3GIZH 1TVHA 4LLQB 2V33A 1PG7H 4JTJA 4JK0D 4IDJH 3BQVA 3W9EB 2VC7A 5KSWA 4XBEH 5I6OA 3N73A 2DQEH 3E2HB 5JUEH 2PP9A 4HLEA 1QASA 4I0PA 1MWAB 1P7KA 4O51A 4OZOA 4NN6B 4JQVC 1OGAD 2ACUA 1CD1B 3ARGD 3T2PA 4LCCB 4IG2A 4ZPVB 3IYLW 1IR2A 2XUCA 2CLMA 4ZOAA 5T33H 2NUWA 3GQYA 2WMFA 4HGKC 5H37G 3GZPA 4R7OA 5GS0C 2X70A 1IGCL 3TNMA 2YJLA 3R10A 4HGMA 1HHIA 1BXVA 4U1SA 4PS3A 2WZHA 3FO9B 4OGAD 3GMRB 3DLQR 3WNKA 3ARUA 3UACA 4Q8MA 1G7HB 2BSCA 2CBIA 3IF1B 4HQQL 4Y4FA 4KXDA 4NO0D 3U83A 4HHHA 2E6DA 1V10A 4W9EC 1KIPB 3F01A 2WLKA 3TBWB 2G0LA 3ABRA 3CIVA 3O1NA 5AVTB 1S5HB 4JGDA 4OFVA 5ANMA 3VFVA 1BZEA 3QPKA 1E30A 1C8XA 4LPCA 4ZX5A 4M6OL 2AJYL 2WB5A 5INDA 3KJ6L 3QG7H 3OIHA 4IRZL 3U5UA 2O1AA 4IP4A 3E2SA 1QRQA 4G6ML 4JL2A 5C9WA 1NP2A 3MCMA 1PL9A 4R0LB 3RVWD 5DQJA 2R1WB 4IK7A 4AEIL 4WTZA 1G6CA 2CKRA 3F58H 3GSWB 2WTRA 1I7UB 5ADOL 5G4EA 2B9AA 6CGTA 4OV6F 4XVUD 1UB6B 2KPNA 5LQBH 2NWRA 3CK0L 1DE4B 2D3VA 1IIHA 1ND0A 4UDTA 5IB5B 3MUIA 2DJLA 3QQNA 4GX8A 4QNPE 5FAJA 1C16A 1M3JA 3CT2A 3VFOA 4WDWA 3C8DA 2EUWA 3BARA 3T07A 3X14B 4FXKA 3LHYA 3L3IB 1UM6H 1W0MA 1EZSA 4RGOH 4LSVL 4L29B 1MSSA 2HLFD 1HJCA 1IR1A 2Y62A 4PLOB 3I6TA 3C6LA 1XLHA 4PRAA 1VCAA 3QZAA 5AW4B 5EMKA 35C8L 2XVKA 4YGVA 1YIXA 5JPMC 3SCVA 4NQSB 4QXTA 1MLCB 1OZMA 4R4NC 4WZHA 4AVNA 1Q1PA 4PJXA 1YYMH 4JNMA 1HSBA 1A4BA 1CGUA 1U3JA 2JALA 5E1QA 4XNUL 4DP0X 5TNVA 1MFBL 4PVLA 1INQB 3S36H 2E27H 2BIIA 4Q56A 2YBRA 4JFOA 3LD8B 1DVYA 3TPUB 1I1FA 5EU6A 4A2DA 1WBJA 3BH9B 3RWJA 5GJMA 3OAUH 5E51A 3D06A 1A0QL 5F7UA 1YA5A 3LKPB 1RZ7L 4LRTA 4U6YB 2F53D 2PU1A 3QJVB 1XF2A 2A9NH 5DZJA 4WI0A 3MUJA 3C0SA 2XVBA 4XCCL 3CUXA 2P7TB 3MACL 3SYPA 4B5SA 4ZI8A 1P48A 4H7ZA 5TE7L 2C0HA 3UXFA 2ZRZA 1KYFA 4N0YH 1R5YA 4N0CC 1B4JH 4PL2A 5J56B 4O1EA 4WO4C 2B1AL 4C6EA 3MRHA 4K37A 4B60A 5D1ZC 2G3MA 3UTQA 3L08A 3WNNA 5HYSG 2X4PB 3TBSA 3K81A 4WGXA 3BRFA 2Y1YA 1UXWA 3R4IA 1M2OA 1O6SB 3FQ2A 3KPOB 4M7LL 4LAMA 1JGVH 4L3ED 4CQCA 3KPQA 2CKBA 5IG7B 1CDYA 3QG6B 1RULL 2DQJH 4X6CE 1T21A 1E0WA 4H9XA 3F64A 3DHDA 4ZFZA 3H2MA 3CAKA 2NUTA 1YTKA 1PLGH 1MPAH 2I27N 3BUBA 1HXMB 4CQ8A 1E6XM 1ODAA 3TBVB 3MVSA 3O6YX 3SGUA 3NK4A 4BR1A 3K6SA 2NY0B 3F6JA 3U2EA 4Z42C 1HJXA 4U10A 1IE7C 5HY9A 2LU5A 3ABGA 4PFHA 4HBCH 2V9QA 4UT7H 4NO2A 2PO6C 3UR2A 1Z3RA 4YDJA 1ZDSA 4U4MA 4FP1A 2PYEA 1SLXA 2EXWC 1T83A 2A4AA 5D6CA 4HS6A 4I2XE 3DK2A 4NUGH 2WCPA 3GBDA 4NP4H 5EUOB 3B34A 1ZGLM 1WDSA 4MJ6A 1IMHC 3RDKA 4MMXA 3GMQA 3NTCH 4P7LA 3A21A 1LOSA 3GMLB 3W6MA 1M5WA 3SGZA 1IGTB 2ZPKH 5I3DA 1VPOH 1Q45A 1UJPA 1NBVL 1IM9A 3TQ0A 2BP8B 1XXXA 3AWOA 4J28A 4IYKA 4F91B 4R2GD 1OO2A 2KLTA 3P4LA 5TPWL 3NH7H 1I9EA 3K72A 2FZ9A 1V6YA 4OM0L 3FOMB 3NQAA 3FTZA 3C8KA 4XXWA 4QHKJ 4JFDD 3ECBA 1LQ2A 3FFOA 1KCLA 3MGOB 3ABZA 5KWYC 3G6JA 4CL7A 4LEBA 3WHXB 1I2NA 3H9HB 4ERGA 1JPDX 3VGDA 2Q01A 5DXWA 4OM1L 5EUOF 1N5YH 4NOBA 4RNHA 2BLFA 1ZL1A 4O18A 2AQWA 1XYMA 5TH2B 3LDVA 4DP4X 1GZGA 2EF9A 1E67A 3OIXA 1WF5A 4DFIA 1OY3B 5GJTL 1KCSL 3D6GA 2GI7A 1F58L 5T1MA 4XRCB 3CBJB 4X0VA 1I75A 5CBBA 3ISWA 5ERWB 4Q8VA 4WWKA 3FOKA 4PB0H 4GY4A 4TOQA 3QFJB 4FFYA 3VRJB 3B8VA 4ODTH 4W89A 3ARFB 1LDPH 5DHEA 3PBWA 2OI9B 3TN5A 1ICPA 1H5VA 3L7EB 1XB6A 3IS0X 1FORL 4QEHA 4P2CG 4PUMA 5LXEA 1CICD 4QAMB 5FO2A 3WNPA 3TA6A 4HCDA 2PUQT 4BF9A 2DMKA 4JPIA 1J1XH 3GIVB 5B4MC 1KTCA 1ZSHA 1KFGA 4DKDC 1OAQL 4P5MA 4W6YB 1J88A 3CLWA 4PWGA 5BNKA 1KIQB 2XYBA 2VRJA 2OR2A 3EZJB 4GUFA 5E08L 3D18A 5T5NG 2X1XR 3RUGB 3OXRA 3GHPA 1KBIA 4K3GA 5GHWL 5DLML 1KXVA 3OAYK 3RWCB 3LRMA 1VZHA 4G80B 5K9QG 1AQ0A 4S38A 4NKMA 1FWAC 1DSWA 1K02A 2AABL 5AENA 1DO5A 3CIAA 4GW1A 1NCAL 4X9SA 3GTVA 5E9DA 4HCRA 2VYRE 5E4EC 4DBUA 1F45A 2PCEA 3B9AA 4FNRA 3O6KH 4Q8UA 2Q20A 4G7YH 1LG1A 2ZX7A 1RY7B 1KJ3H 1U3ZA 1DJIA 5CCJA 2WQVA 4NM8H 3GFZA 5IROD 3DYOA 1JPKA 5I1IH 3AWNA 5IVOA 4TVCA 2R14A 4JOMA 4PU2A 3RUGF 2WSYA 1BZQK 4DJFC 5F7MC 1SBSL 4G8IB 2J1XA 2PDNA 5ESAB 3FEMA 3NZUA 4XP4H 2CU0A 4PWJA 4OF6A 3GMPB 2EUVA 4I77L 3T2NL 2O5ZH 4IJBA 5I1JH 2VM4A 3ECQA 4LL9A 4GAAA 1KRCC 3RIKA 5A95A 4JTKA 3SE6A 4FEZA 1NLDL 1UVQB 4GNJA 5J5EA 4URIA 2Q8LA 4FS0A 2WLNA 2CLRA 1VPYA 1UZDA 1B4TA 3GH5A 2EVHA 1E4HA 4H83A 1PJ9A 4NO5A 4LHJB 4NOFA 4LP5A 3EJSA 2GEQA 4Z7WB 4PI2A 5DS8B 2Y6ZA 2XT1B 4F9JA 2OULB 5I9QC 1I7ZB 1C93A 3UPMA 4F3FB 1PD1A 2CUMA 3LHVA 2GVLA 1DHKA 4P2OD 2G95A 5DZVA 1PZCA 1QFWI 2J1WA 5PCYA 1FX6A 3BSZA 5I8OH 3MNVB 3P3TA 1I60A 1KKOA 4WR3A 1RHHB 1AGEA 3PWPD 3V0HA 1IEVA 2J88L 5KVGL 2D7NA 4AUJA 1B31A 3H70A 3MLSL 2VOMA 4Z2IA 1LP9B 1ZAIA 5I1LA 5HI5C 4JDTL 5J89A 5DC0A 3C3UA 2P3EA 3VFNB 5AVHA 4N9GA 2XC8A 2KERA 5ACZA 3SGEH 3PPEA 3NIFE 1MFAH 5FCSH 5IJDC 1MJ7L 3O4LA 4B2DA 1WTGT 3HV8A 5IJKA 2EXSA 2ZYHA 3FJTA 1YNKL 1GOHA 3KYKH 3MDWA 2P48B 5C0JB 5FF6B 1CFNA 1WIOA 4RAVB 3CVHL 4N5UA 1OIMA 1TFVA 4AEHL 3K80A 1G0DA 3QEHB 3BP5A 2NY4D 3WN5B 4AGOA 4MCYB 5D1QB 3KHJA 1CGXA 4RVBA 1GYUA 3CL8A 2CZVA 4OLYL 2VH5H 3MPCA 4B96A 4Y16C 4HZ7A 5GNXA 3QN3A 3Q6FA 3BQUB 1WDQA 4KO5A 2H9AA 1MCPH 1NIAA 3CHXA 2NQDA 1MCOH 2YGVA 1KN4L 3QV7A 5KMYA 3EOAA 2C79A 4OVVA 2MPVA 2YCEA 1CUOA 4PJ8B 4XZLX 2ENQA 1MH5B 2HP4A 4R9OA 3WENA 4G5DA 1J05A 3QZLA 2VR7A 2OVLA 2PRLA 3EXRA 4C1KA 1P6CA 3KAOA 2MOVA 5DN1A 2ZRYA 1JK8B 3PAOA 5JXAL 1JNLH 2ROYA 4ZW8A 3NQMA 4HJSA 1Z9MA 1HAWA 4EP8C 5EPMB 1ICSA 5KJ4A 3WEOA 2CLLA 2RCSL 4D0CA 4KZ0A 3CIXA 3WK2A 1JPIA 2JCCA 1EFZA 2OTPA 2QCEA 4OI9A 3ZDYF 2RH0A 4DKAA 1ORSB 3MP5A 1I2PA 4JIPA 1WEJH 4M62L 4LLMA 5ABHA 3M47A 1GHRA 4D71A 5EOTB 2Y07L 3UP6A 3EUDA 4I0KA 1K3IA 2E1DA 4ZQNA 2V8MA 1RVFL 4P2RB 3RBSA 5HGHB 2XA8L 3URBA 1VHNA 4NQTA 1XM3A 1XEDA 3NNTA 4YJ5A 3N44F 4WFFE 3LNPA 1NP0A 3BVVA 1NLBL 2JF6A 3AAZA 3KD4A 1EUNA 4CU8A 1MEHA 3PJXA 1B6UA 2ZSWA 1HL9A 3RNKA 5HJDA 3G9VA 4J6IA 4BXVA 4PRHA 3NJXA 3D1MC 2FNBA 4Q2ZA 4ZUSA 1Z9SB 3W6YA 3T0VA 2GCYB 2O30A 1DJZA 2Z1XA 3IE4A 4WXZA 2FEDD 1E1CA 1JS4A 1AD0B 5ECGA 4XNYL 1X6UA 1P2CA 4R96B 1KGCE 3UT0A 1E4JA 2ISDA 4GKSB 2Y1AA 1GAFL 4NZUH 3WXWH 3DRTA 3OW1A 2TRHA 2QSCL 3MYPA 3RX7A 1PTAA 1QJWA 5JW3H 4HJIA 3TBCA 4UNLA 1JK9B 3FXIC 2PRMA 2ALRA 4FF7A 4YE0A 4U7MA 3MNWB 3T42A 2YQGA 3VNIA 1A7OH 5D4JA 3Q48A 4X0KA 3MI2A 2YPVA 1YC7A 3Q5OA 1HSAB 3ASNB 3QMSA 2EADA 1ISYA 4XO5A 4YZWA 5CZJA 3BFOA 2CLFA 3GB7B 7CGTA 1T5XB 1QFOA 3QQ3B 3QZWA 5GRJL 3QUKA 4ZJ9A 2ZX5A 3VB8A 4JM2D 1UB5A 4AIXA 1B3OA 5AHEA 2XHYA 1MIML 4IOIA 3QY8A 3DTXA 2J8UE 5CPQA 1FGNL 1NAMA 4XCYA 4YXLL 4HKZA 3RRQA 5AZUA 3G18A 2D8KA 3SBRA 3I4EA 4PTWA 2PDJA 3DSFH 5JVLA 3OO2A 4HP5A 5HI4D 4HJ0D 4OVUA 1ZHKA 3BN3B 3DIPA 2X9ZA 4RXFA 3VC6A 2BS9A 4DXXA 1O95A 1UZ1A 1BQCA 4AM0Q 1MDLA 4N2FA 4X6FA 4G9FB 3VKAA 3NCXA 1X44A 1SMOA 3B1UA 4AL8C 3R06A 3D2TA 1FFQA 3REWA 4F58L 1FYTD 1WVZA 3UTTD 5I1AB 5J6GA 2Y5TB 1S6NA 1I1YA 4P59L 2D7TH 1I9IL 1F02I 3JV0A 4GX9A 3V0SA 4UUIA 4LDCA 1MFDL 1L9RA 4Q4MA 1VKXA 4G8GD 5CCHE 4H9MA 4NXKA 4XO4A 1N8WA 1F76A 1SJVA 4MS8C 1FL5A 4KKAD 2XJKA 3UXKA 2QMKA 4XP9L 4RMRA 2GC4C 4ZMAT 3SPHA 2FQDA 3PWAA 2FSEB 2OGJA 5ISZE 5AFDA 3G1DA 1XYAA 3VXNB 1WIPA 5D7LA 4L9ZA 1RK7A 3WY4A 1YXCA 4OFDA 4CVXA 5H2BB 5J6SA 3CJJA 2IPTL 5LJYH 5LIXX 3DERA 1JNDA 2E0PA 2ZOOA 2VGGA 1I8MA 1BAFL 4Z0BH 3W5MA 2E47A 5L9DL 1AJ0A 1RHFA 3EOTL 4CNTA 5E2WL 2V0AA 1JRBA 3M46A 3TBTA 4XNZB 3SYCA 3ROLB 2NYYD 5D93B 5DT5A 1D5XA 3UJJH 1E0XA 4DNMA 3EXSA 4JANA 4IMDA 5HYEA 1IT9H 1Y65A 3O3AA 3VD0A 4Y5YB 4NQEA 2W07B 4I48B 2DLIA 5C0CB 5F44A 1DJXA 4D1JA 1CZ8H 4IKJA 5D5MF 1Z69A 2OJZL 2Z0BA 4EUPH 3VTTA 4KHXL 3T04D 5E8PA 1SJDA 1R3QA 2ESVD 2O0TA 4UZUA 3ILPA 4ZMOA 1BQRA 3JT2A 3MYJB 5TDNB 3R0KA 1VBRA 2PPCA 3NOYA 1OW0C 3CFUA 5ILTL 4RMTA 3V6OE 1NCJA 4DO4A 1SUJA 1J1PL 3FCUB 2QCNA 3SIMA 2FWOB 2X9XA 2BNQE 2PGFA 1OBAA 5EORH 1T5AA 3UCDA 1IBFA 1WZAA 2LOEA 1EXUB 1NIBA 2R7EA 4CC1A 2VC2B 5A7EA 3IMWA 1J8VA 3GXIA 3WUEA 2VEPA 2DBLL 4XTIA 3DZ1A 4Q9BA 2C1OA 5I6XC 4DO7A 4F2FA 2G50A 1UWIA 1PV8A 1X97A 4X5XA 3V1HA 1RP8A 2AOSA 1PIGA 1QVOA 4XP1L 3TUUA 2ZXQA 2MCG1 4D6HA 3WFBH 8TIMA 4AQAB 5CC7A 4GS7C 3T77A 4RNJA 5BU6A 4NQCB 2EP6A 4GT0A 3D3VB 1OT2A 1TIMA 3FYIB 3WQWA 3D6NA 5KANG 1R9YA 5CF3A 4U1GB 1P1ZA 3LZPA 3RNQA 4M1CD 5EBMA 2EDOA 4G6AD 5KINA 3WO8A 5C07D 1JAKA 1M03A 1WBYB 1NFBA 4OV5A 5GZNC 4MNQA 4CGTA 2VDNH 3B2VH 2O61B 4P5RA 3EOLA 1QPXA 5DZAA 3DGDA 3Q43A 3UTSA 3LGEA 1F4AA 4HN8A 2OXGA 1OFAA 3N6QA 3IETB 4EF9A 1HJUA 4QJ4B 4OTXH 2Q71A 4HAKA 4WTQA 3K4ZA 2P8CA 1H6EA 2CO3A 3LEYH 1U8OB 4MQXD 3BFWA 1NTDA 5DJDA 4ELMF 1R5IB 3MREA 5JBEA 1VGEH 1L0PA 4HFWA 4MKTA 2MUCA 1WGVA 3PHQB 3F5LA 2DZPA 3BLPX 3QUZC 4OU1A 2FL5A 4AZ7A 2VSCA 3MANA 7TIMA 3T8MA 3LNEA 5CPSA 4L4VB 4K8RD 4XGZA 3G1AA 3RX2A 4PJHB 1P4IH 3R1ZA 5AOJA 4WQOA 4HIJA 3W7QA 5BVJA 3A4DA 4NHCH 3BZFA 5IHRA 4P3DB 5LXVA 3KYOA 4APQC 4G70B 3OHXA 4AY8A 4N68A 3G5YA 1EYWA 5FGRA 5IWLC 3MRKA 3ABLB 3MA7A 1DYSA 3NYKA 3QNZA 1P4CA 1MCWW 4CD6A 2GIYA 3B3BA 4UFMA 3DVIA 1GVSA 5DHYB 3TO2A 1F1DA 3R2GA 3FQXA 1Q6DA 3WUFA 1T80A 3NZHH 3LLFA 2OZTA 5DHMC 4M8RA 3LHPH 5ITBL 2O6FA 1QTYT 3O6FC 5ECJE 3TL5A 1TJXA 3MV9B 2BFVL 3FQNA 3DEQA 4MUPA 4C6QA 1P5UA 3LCWA 4ONOA 6PTDA 1HL5A 3HG2A 1S7RB 3U2ZA 4MB5A 1J9RA 2UY3A 3FFCE 3T3MB 2G2RB 4PUUA 4BHYA 4OH2A 1TV4A 1NL0L 4O50A 4HK6A 2Y5QA 4HWEL 3H9SE 3NM3A 2I9TA 2ZOKA 2NNAA 4RV8A 4M4RA 4G2AA 4LV9A 4O5LH 3EYSH 3DFTA 4AHPA 4GP8B 3KYNB 3IPFA 2R1KA 1QLFB 2NY5C 3QUYD 3I50H 4P05A 2YN5A 4NZ1A 5KTEH 4YE4H 1KCZA 4D9QD 4NKDA 1CTNA 4E8DA 3QIWD 2ZRXA 4J3OC 1B3ZA 1SOQA 4Y2DC 1JGLL 3UC0H 1EHLL 4Z08A 3GH4A 3A24A 2GUOB 4NWTL 4OSUL 4S0TD 1Z7AA 4KFNA 4JUSA 4FFWD 3AGVA 1WUZA 3UBXG 3RWHA 1X7QB 2YPLE 4Q6JA 3B83A 2QFPA 3DX8A 1TPH1 5IT2H 2P24A 3RGTA 1Z0MA 4Z5RB 5GGTA 2QQKL 5D2NC 1JEZA 4L6DA 1TYEB 2CUIA 4MDJA 1HKMA 3CZJA 5AHLA 1FH5H 2ZNXA 5ITFB 3SBWC 2YXMA 2Q7YB 3D0LA 3TO4C 3LIZA 5ALBL 5CZ0A 1EEYA 4DGUA 1OOWA 3T4YA 2VWEE 2VP8A 4I7WA 4Y19A 3MRMA 4LOCA 4M9PA 2FJSA 1JN6B 3GTTA 3TJHC 2XZCL 3UWUA 2VDLH 2M8XA 3CQPA 2AV1A 3VXTB 4B4HA 3WLWC 2CGYA 2CDEA 5BWAA 1OAUH 5I79A 2D3JA 1FCVA 4HUXA 1GZ1A 1KM4A 1BFVH 4E0CA 4OE7A 3KEDA 1OB1B 1YNTB 3OX8B 1EMTH 2X2YA 4JQIH 4BQ9A 4FHBD 4OQ1A 5A7BA 4YX2L 4YHZL 1E70M 3QDGA 4S3KA 1JV2B 2E7CA 2IMMA 4MMYB 1EEZB 4AXWB 4OZGB 4DBDA 2VLKA 4EWND 4FALA 1TQCB 4NRYA 5I1DB 3JWNH 2Q6WA 1JGUH 3RYSA 2I24N 2HBXA 5MENE 3NPSC 3BMVA 3NBNA 3E12A 3X12B 4HNUA 3OR6B 1U92A 1IQWL 4MQTB 2X2HA 5C08E 2J25A 4G8EA 4M3KB 3S4SB 1QR4A 2XSAA 1S7SB 3QR2A 4I5BA 1J5SA 4R4BA 2OQJB 3RR4A 3N12A 5T1KB 5AW7B 3TJEL 4L1XA 2J1ZA 3VWKB 1X5GA 4EDWL 2WWMD 4BWTA 2OSXA 4XMXA 5IFAL 5F9WB 1NEZA 4MY1A 1HZKA 1XR8A 4WOZA 4P9HL 3UG5A 1RLDA 4I9JA 2IFGA 3WBAA 3LMZA 2A9DA 4JRYD 1RQHA 4KRLB 2C18A 4UTJA 4ZOBA 4N86A 1NCOA 4RSYA 3GUWA 2N59A 2NV9A 3MRQA 1JGIA 3FBQA 4L56A 1E5ZA 5L2JB 1D3HA 3H2NA 3QPEA 1TJHL 5C3TA 1IGML 5IW1B 3IV8A 3PG9A 3M8OH 1E2WA 3MPGA 4XXDB 1ET8A 4F37K 4PHXA 3NJVA 1NGWB 4D9RD 5LA2A 2JKWA 4TV5A 1ZLVK 3VE0B 5IJBC 1JL8A 2PBGA 1FL3A 1I7TB 1LUCA 4R97C 3OKLB 5SWQB 3BEWB 4WW1A 3BUTA 4WY7H 5G2WA 3RLHA 5TQ2H 1ZCCA 1U93A 1RA5A 2ZCLL 4FC3E 5JIHA 4F0HA 2DIEA 3W1LA 1JZJA 1E5NA 4V2BA 1H3PH 1YMMD 1Z9NA 3Q1SH 1FOBA 3T05A 2VN4A 3OA3A 4HHWA 4DN4H 5CN2A 5CZVL 3FT9A 1M71A 1CLZH 4BFEA 5CCKL 1TIWA 2WZEA 3MMDA 1TLMA 4B9JA 4LJ3A 1TRIA 1NKGA 4XMLL 5D72H 1L9WA 4AVJA 1WBZA 2G5WA 3ZKXC 2PD5A 4MZRA 4PRPB 4HK0B 1R3LB 4ATWA 3ECUA 4ZQMA 1FFPA 4GMSL 2CBOA 4K9EH 2F9RA 2IQ0A 4MA3B 4PUKA 1F90H 4Y9OA 4PE8A 3VI4E 3QDAA 3PFRA 3WHE1 4Z7OE 3M43A 3IJDA 2HUEA 1BJ8A 1XPYA 4GXVL 2R0LL 2PDPA 4HX1B 3X1NA 1NDMA 1BXBA 4NZDA 3GJFH 2GC7C 5T3XE 4Z23A 4H8QA 5IZ7A 4IBZA 1DBMH 3T0DA 4RMWA 1GPFA 1F3TA 3I02B 1LMIA 2FZ8A 4KK8D 5LCVL 5AB3A 4LXFA 2QT3A 4L3CA 1WQVT 1EZUA 3TM6A 1BBDH 4OCWL 3E6FB 2R24A 5LUMA 3DGRA 1AD1A 1J5OL 2EXOA 5J12B 4MG4A 2Z64C 1IC7H 3L17A 3LPWA 3FN0L 3QI9A 4KKRA 5C2CA 2XG5A 4GG6A 2AITA 3VA6A 5IBUG 2G3FA 1H11A 3FQTB 3HFMH 2HXAA 1MZRA 4Q97A 3FZUC 5J6HA 4PUJA 4AAJA 2GHWB 1V93A 4YVPA 1FNHA 3BPCA 2OM5A 3MLPA 2DTML 3ATEA 3D85A 3CHRA 3NJJA 3TA3A 2FT6A 5DFVD 4LAKA 3LCLA 4A8RA 4NUPA 3DHMA 5BMFH 3VD2A 1B88A 1C5BL 1KR0A 3RE0A 3BKMH 4X63A 1QK2A 3EJZC 3BOVA 2PTVA 5AC8A 4QP0A 4M3HA 1A80A 1M3UA 5I2IA 3BP4A 3GMOA 2G75A 4MXVE 4CVUA 4CA4A 4D8OA 4BDVA 3BGMA 4UBDC 4MY8A 5EEYA 3JVFC 3H55A 4W4NA 3VFUA 4EOUA 2AGKA 5EO0A 2K7PA 1YN6A 2B20A 3IACA 5EC2A 4LT9A 1OC6A 3IXAA 32C2A 1S5VA 3OQ3B 4UMGA 2DM4A 4W8LA 4B5EA 3B06A 5LBSA 2FTPA 2FPVA 4BS0A 4FQLL 4AHOA 4S0HA 5MKGB 4IRJB 4JRXE 1MUJB 1TVBA 3S5LG 5K9OA 1GL4B 3UWZA 4GUPA 5C70A 3N4FA 2VC6A 2ZSVA 4OD2A 3QQ9D 1R24B 2P5WA 2ZX9A 5LSMA 2PETA 3GXPA 5HYQB 1TQBC 3MQTA 4ICCX 2VLME 1N0XL 3IEAA 4IX0A 3WDHA 5EMYA 1UIPA 1M05B 1F3JB 2E3ZA 1DQWA 4X4MA 4WKZB 2VGFA 3DARA 3FH5A 5D70H 4HUUA 5M5DA 5KVFH 5F72S 2V3EA 1KBGH 4KGJA 2O6PA 2WLJA 1I3RB 4O2EA 1OZQA 2F08A 4OZIE 3SCRA 1KJ2B 4TLKA 3VSUA 3T6CA 2AK4B 3FKUS 1LQ0A 4X6DF 4I4WA 4P46A 4FA8A 4PJ9C 5IHSA 2FYYB 5HHOA 4M7JH 1EAPB 4RWYH 2BOGX 5IFTA 3CVIL 4A3HA 2Q8XA 5E8NB 4L6HA 4AWTA 4KCTA 4F9PC 3OKEA 4TVPH 4TMCA 2C3VA 4KS0A 5L2KD 2F7RA 5TF0A 4C5YA 3KNBB 4C1LA 3QSKB 4M8QA 4ORMA 2I25N 3E6HA 4JFVA 4MNHB 4PJ5A 1IC1A 2WLIB 3OBKA 3HC2A 3HVNA 2WZ0A 5F7DA 1KV7A 2EYRB 3GS7A 4M6NH 3TJXA 4YO0A 4BRJA 5BO1H 2W5PA 5I3HA 4YMPA 4RPPA 2CC0A 1W17A 2EH7L 3RHGA 4W7VA 1JHLL 4HWBH 3GTNA 3V5DB 1HGWA 1Z9PA 2OR7A 2FX7H 3VXMA 5AZ1A 5HI3D 4ZMXA 1E6NA 1RIVH 5EEUA 1S3TC 4MVBD 1UG9A 4HS3A 2VQTA 1EP1A 3P3SA 1GZJA 2G5RA 1A4JB 2E74C 3EYOA 5F3FA 3M17A 1WXZA 2QUNA 1J9QA 3ILEA 1S9XB 3HNVL 4PR5A 2F68X 3F5WB 4HJJH 2UXVA 4A39A 4JVPA 3T0ED 1DE5A 5CO1A 3VNLA 4W84A 3PGCA 2DQWA 4GAJH 4FXGC 2SODB 5DURD 5XINA 1GA2A 3QDJD 3TWCL 5LXGH 2A74A 5IHWA 3PG2A 3G6DH 3NO5A 1HE7A 1N6QL 1GZHC 1LO3H 2YCJA 5B7EA 1OINA 4ALAH 5L4IA 3EDEA 4MHHG 2VXSH 3EYUH 2PDMA 4KO6A 5C0GA 4IDJL 4XBEL 3MRJB 2NXYD 5GPRA 5DUMH 3NGBB 2OR8A 2Q2EB 3KHOA 2YKKA 2LLLA 1T04B 2MPAH 3H9YA 3F65A 3MT1A 2XWTB 2XTJE 3PFQA 4OKVA 1NFIB 2W59A 3OWRA 4O4WA 3L5IA 2Q8AL 3PUOA 3GSRA 2YPIA 4ALDA 3PWNB 5T33L 1S39A 5GGQH 1LLZA 2PD9A 3NUKA 1ISZA 2QKIC 2FECL 2EIZA 3PBMA 4EN3C 4GAGH 4IJ3B 3SCTA 1K85A 1YAIA 4MDOA 4UMSA 1Z5HA 3AHZA 5DI8A 3DRQA 4FK9A 1T89A 1B0WA 3HE7A 4FF9A 5LNWA 1IFHH 3DU0A 2XWXA 2E25A 2DQIL 4XAYA 5HMFA 4XZ4A 3V4VB 5CEZH 1EXHA 3ALGA 4TQ8A 5HGBA 4XXCA 3B3IA 1XIWB 3FF8A 3RO8A 4GXWA 3ULUD 4BRVA 3HQ1A 4GSDH 3UROR 1CFBA 2PR9A 1FAKT 2NX1A 5EPDA 3KPRE 3UFYA 2OMTA 3CN0A 2BBFA 3QNYB 5DWUL 2HXTA 1ANUA 4P7OA 4MAYC 4LHQB 1FWDC 3BH8B 1NA8A 3EH1A 4G9PA 4P2QB 2VM9A 2C9AA 4K8RL 3NGFA 3F58L 3KLAA 1I9JH 3ZTNL 4AW4A 3CPUA 4H88H 4H9UA 5LQBL 4NUWA 2GZXA 4KZDL 1XTMA 1PNCA 1ONEA 2Q02A 1B9ZA 4LGSB 1UD8A 1LO4L 1PU0A 4HEPG 4PVMA 4ZQTA 2GFTA 2OTDA 3PL6B 3F00A 2MH4A 1QO2A 1A8ZA 5D6DA 3ZDXB 3S9YA 2CBPA 3KW7A 1CI1A 1UM6L 4NSKB 3OKKB 5D7JD 4ZSOB 8A3HA 4RGOL 4CNIA 3SURA 5DY2A 2J6EL 4DVOA 3SPJA 1C12A 1JCNA 4E4UA 1TZOA 4MJIA 2GWGA 3SDXB 3BG3A 3VXUD 3Q44A 2Z31D 3K13A 3RFRA 3DUUA 1JYNA 3W2LA 4YDVA 3PBVA 3FCGA 1YYML 5AKQA 5GGRB 3B8UA 4AXNA 1PE1A 3WEBA 4XB8A 3KWWB 3C6CA 2H6PB 1BYBA 4L4TA 3HB3D 1CGVA 1PY9A 1BD2A 2XXFA 4Q8PA 4RZCB 4JQVA 4KMLB 1HX0A 3OAUL 1QFWH 1B3JA 5FFLA 3SM0A 3EB3A 2LU4A 1YQ2A 1S46A 4OUUA 5FW7A 2A9NL 4AZUA 2XPKA 5I74B 2DH3A 1J1OH 3B9OA 2FIRT 4I3SH 3IDUA 2OEKA 3BE1L 3OVPA 3LKSB 2VFEA 5FF7A 1RPKA 1N82A 4LHUD 3NRQA 3HUJA 2DZUA 4CVZA 5DBUA 1V6TA 5FECA 3MRCB 1B4JL 2BHYA 4KJPD 4U7KA 2WMHA 3K46A 2NR6D 3MZ2A 1A50A 4A55A 4PJDB 3QUML 2VXQH 3EYQC 2H6UA 4OR1A 3BLIA 2QFRA 1LNUB 2UZYB 1C8QA 5BJTA 1VFSA 3TJIA 2A3CA 4F0RA 3GYRA 4HVBA 2CEQA 1JGVL 3A9IA 4NN5B 4BUQA 4K5OA 3QDMA 3FCSB 1QRKA 5SWZE 5JOPD 2DQJL 1TV5A 2EYSB 4B7LA 1IBZA 5AW1B 5GZOC 1PLGL 3ARBB 1MPAL 5CSSA 3D5HA 4X8GA 3IBEA 4JZJB 1HVQA 1NCUA 4PP1D 1K7EA 1K70A 3LNFA 2XVGA 3P4NA 4L0ZA 1R3IH 1EFXA 4N8VG 1GC1H 1UJ3C 3LQAH 4HBCL 1BWWA 5CSRA 4UT7L 3FB8B 2WIIA 2WUCH 1WQ5A 2VLJD 5IHHA 3UWYA 1A0EA 3LNMA 2WVTA 2EICA 3W56A 1NFDE 1IB5A 5CJ8A 5HUPA 1OX4A 4NUGL 1DVJA 2GJ6A 3PM6A 4NP4L 1JG9A 1P7HL 5AB0A 4HC1H 4O4VA 2WTPA 5JPMA 2IFFL 5KBDA 1A3RL 5HJXA 1PLCA 3UVIA 4D6FA 3PWJA 1VPOL 2D2CC 5DD3L 2CIPA 4IS6A 5FK9B 3L95A 3IIOA 3YPIA 3DMMC 3HBLA 3T4WA 2PYFB 3IJLA 4IOFC 3LRSB 3R8HA 3G8EA 4WI3A 2OKMA 3OKYA 2WWKT 1TPDA 3WLPA 3ZSSA 2JJSC 2EZ0D 1VLXA 5IQOA 4XAKD 3Q0HA 3KWVA 2FATL 1W3JA 2VQ1A 3NH7L 3ARED 2NVAA 2OTWB 2ICEB 3ES6A 1H0DA 2AMGA 4B9ZA 2H47C 2X42A 2E7FA 2BVPA 1BQHG 4N6RB 5C9RA 3AOFA 2E86A 4KVNL 4UB9A 2A4EA 3V4PL 4X9YA 3MKVA 3L9BA 4F27A 2VZUA 1MFMA 2A1YA 1ZV2A 2Y89A 3RWIB 2XI9A 3HG1B 2ATKB 5CJXA 3DJZA 1RVGA 4WO4A 3DOIA 4EXBA 3C12A 1JZIA 5D1ZA 4NX5A 2XN0A 1XSOA 1OQFA 2BXZA 1XS2A 1AZ1A 1X5HA 3W4RA 4Y4HC 2FDSA 2C0AA 4BFAA 4G8FB 3PE9A 1X5XA 4PTDA 3LCYA 3CSBA 3OOQA 3IIPA 2TRSA 4U1HA 3NDYE 3PWUB 2PTTB 4GWEA 3WF4A 4X0NA 4TUFA 4F57L 5LBVA 1R3WA 4DIAA 5FW8A 2R23A 3TDFA 4HN4A 4LB8A 2EE6A 3EO0A 1T40A 1WFOA 1TO5A 4G3YH 3H6JA 3V75A 4JHOA 2F54E 3BGFB 5DJ8A 4LALA 5J4MA 1FA2A 2PO6A 3QCTH 1P7TB 1Q9LB 1FI8C 1KELH 1A5AA 4OVXA 3QJZA 4HA3A 1CXEA 1JDAA 3EOBB 1KB3A 4ZK8A 1KFCA 1XGQA 4ZB0A 3SCMD 4MJJA 1K8IA 2D2HA 3LPFA 1CFMA 1EJXC 5C2XA 4OOUA 3GVGA 3STFA 4MGGA 4JQ4A 1A6UH 5GIRA 2H8ZA 5EKYA 5EOCH 3AUOA 2QSTA 2ZNWA 4GQPH 3RMJA 2XWJB 1Q0XH 4DTGH 3V95A 2NOYA 3KOYA 4Z0JA 3O6KL 1HTYA 4G7YL 1OARL 2P8MA 4RLDA 1KJ3L 1EOKA 1IBBA 2OMUA 4FQXB 2H3NA 1HWGB 3QHFL 1VFAB 5HHME 3E96A 4KI5E 1VZWA 2UY6B 5I1IL 3QBUA 1N6VA 3CX5J 1DFBH 4YH6A 4MQ7A 1DL3A 5C0AE 1Z8AA 4WD0A 3HMXA 5L4JA 4IIFA 4K2UH 5ENLA 3CXFA 2ZUVA 4DEPC 2Y7EA 5CU5A 5ABFA 1IE4A 3O8XB 3OC5A 2AQRA 4LH8A 4PMUA 1US2A 2WVVB 4AJWA 3WI9A 4WDXA 3M6DA 3GS6A 5I2UA 3ZBMA 1IEQA 1DVQA 2H1LM 3X1EA 4AZ8B 1DUZA 5IIEA 1NMBH 3RCYA 4RFNB 4XSLA 1Y07A 3AIQA 3DSNA 5DYOB 3UESA 2Y3NA 2QUUA 1S7VB 2H6RA 4YEFA 1B9KA 3N1AA 1KXTA 1BG4A 3MRPA 3FUFA 3VD9A 3TBBA 1S2CA 1ED3B 3A6OA 2YRZA 2ENPA 5JORB 3HHSB 5FA3A 4XNAA 3KBHE 4HJUA 4EI5C 2KDGA 4AZ5A 1AOHA 4RGMC 1CIUA 1G84A 4ZTXA 4DM2A 3V6OC 2X9WA 2I26N 4KK6C 3ZHDA 3FU6A 1VEMA 4HH8A 4DEWA 4Z7WF 3IUDA 4M5YH 4YVVA 4L4JA 2DI7A 2ICSA 1VDGA 1EXPA 3S3PA 2JKAA 2J5LB 4ODUB 1EGJA 3W7OA 4MWAD 1M2VA 3Q3GB 1AQMA 2AXJA 5AG8A 4DPRA 2Y7FA 2YBVA 3FK4A 2YARA 1ZAHA 3KYKL 4BYHA 2CRIA 4I87A 4LVDA 3Q65A 2GGGA 4QRRA 4L61A 4HK5A 4S2SB 5FA4B 3LD5A 2V63A 1LP9F 4YWGH 5KOMC 2UZXB 4DAFA 2D0GA 4JFHD 4BZYA 5DRIA 1TCMA 4PRIB 3TEUA 5FIPA 2VH5L 3VWJC 2CXKA 4E5XA 1ZGLA 2EG7A 4W9FC 1BM3L 2JF1A 2V2XA 3D2UA 2ZA3A 3W76A 4FZ8H 2QYGA 3QQXA 3LEPA 3MFFA 3EEZA 3O3BA 4NQVA 1TCRA 3P9MA 25C8H 3K2GA 4MAUL 3CDZB 5G4NA 3D7PA 1XGDA 2LLNA 3G5XA 2X5PA 3OGCA 4K94C 4W9TA 4MA7L 4PMZA 1E4LA 4ZAKA 1GVYA 1PXGA 5CZRA 1OGGA 4UOJA 1AC6A 2OYMA 4N2YA 4F7PA 2ENYA 2FB4L 3LV6A 5D33A 2NCEA 1TVPA 4O11A 3B9NA 1S3RA 5A40E 1ACXA 1EWDA 1KC5H 1OSPH 3QUGA 1V3HA 4UTIA 3SQMA 1OD9A 3PZUA 1TRDA 3FB5A 3ZJAA 3A4WA 5KVEH 4MZIA 3GG7A 5FOJA 3BMXA 2FZ3B 5JOEA 4L9YA 2DQCH 1P5VB 4NN7C 4GQZA 4W93A 2JI2A 4GY0A 5DEGA 1RZJL 1NMCB 3NOEA 2AXFA 2ZRWA 3S3SA 5DRCA 4A4AA 1NBYA 2VDKH 4LX4A 3T3PB 4JNXA 2BS8A 1XBRA 3JZUA 2WXFA 4UIMB 1RIHH 4XPHH 2ZRVA 2ZXCA 3HM7A 2DWYA 3ZHKA 3PQYD 1I3VA 4HIXH 4Q8BA 5EYWA 3ESUF 4GI6A 2IKHA 2X2GA 4PB9H 2WSKA 2OMYA 4UILH 1FV1B 3ZU8A 3I65A 2UUDK 2VC2H 5E2VH 4TS6A 3S0CA 2I9LB 1CNVA 4XZNX 2XWEA 4EN2A 1WPCA 2RA1A 2ZJSL 1A6WH 4PJEA 1WT5C 3GMMB 4UU9A 2DVXA 4BH8A 2W88A 3BK0A 1HI6B 2EG8A 1SRDA 3BICA 5HMEA 4OCSH 3BV4A 3SQSA 3M0YA 3SPCA 4NZUL 3WXWL 4PJBA 1LO0H 2JB6A 2QCFA 4PCSA 5AOIA 3BD4A 2WNQA 3QVQA 5JW3L 1XHHA 4Y16A 2EDBA 4BSVB 4GVHA 2LFGA 1JZGA 3F7KA 4KESA 1UT1A 1V5JA 4FQPA 1BQGA 3RDTB 3TGXA 5T5FL 2RJMA 5DMKB 2D9CA 3LCIA 1A7OL 3ZE0B 1BZ9B 4JKMA 2JKPA 2X1UA 1XL9A 5AG9A 5G2NA 4Z2LA 4ENED 3G08A 2R39A 2WGXA 4ADJA 4EIZC 3VZZA 3RWGA 3MO1A 1DQKA 4LVNC 3O2DH 3IDJB 4OJFH 2WMGA 2KUTA 3QJQB 5EC1A 5MF5A 4BJLA 2AGTA 5SWUA 4J4PA 5HATA 3WL9A 4AMKH 4G42A 3WXVH 3WLBA 1V0NA 1FHGA 4BA8A 5CLZA 4XVDA 2XH0A 1FG9C 4JIEA 1F6AB 5A3ID 3PFMA 4HKJA 4NJGA 2DQFB 3UJTL 4LUTB 2ZUYA 3DSFL 1P0SE 2QR0B 3EFFA 3FHEA 1PCSA 5FPIA 3LOTA 3LRHA 4MCZA 2VXTH 4CMHC 4AC1X 3KBWA 1EQCA 4JPQA 2CO6A 4DZ8B 4C6MA 3FU9A 2OO0A 3U4BH 2XQBH 2QKFA 3GXDA 3OF6D 4CN6A 3BAWA 4XMUA 2COQA 1XLEA 1E2ZA 5B8CB 3BVNB 2D7TL 4PVBA 2VWEC 3UY7A 5HYJA 3O63A 4CEXC 4BK8A 5DCEA 1XIDA 4KTEH 2GJLA 5EEXA 4LNYA 1J8RA 4DPQA 1JGEA 2C26A 2WXGA 1AQDB 2DSVA 2DI8A 5CJQH 2OJEB 2Z8RA 4C56B 2XM2A 3KWSA 2D2OA 5L6YL 2OTUB 5HHPA 1NAKL 4W6WB 3QWNA 3G1YA 1CO1A 1PKOA 1IZKA 1YTDA 1Q13A 4UB0H 3ULUL 5CD3B 2CWRA 1K1DA 4YL4A 2C3XA 2V82A 2O7QA 4OCNC 3CHPA 12E8H 2QXWA 2XCMC 1HEJC 4WEUD 4PY7A 3S1XA 2GJZB 3U9UB 4LRIC 1CN4A 1XLCA 2KZWA 1GY1A 3EWUA 3C60B 1AKJD 2DZTA 2BOBA 1I1RA 4H8WH 1N59A 3VDAA 4DKFH 5L88H 4X7EC 3L3JB 1KOAA 2A6IA 3TOYA 3VXSA 3JYBA 2DZBA 1F5WA 1K7XA 1FO0L 5ENWA 1IT9L 4JDEB 2WWKO 2VDKB 3KBMA 2YD9A 5MERB 1O6IA 3QV8A 3LZRA 1CZ8L 1L6ZA 3MJ7B 3MC5A 2FWUA 1JYXA 4GJJA 5C1MB 2ITDB 3VXRE 3ZZSA 4LAQH 2RQEA 3A64A 4O19A 2VL4A 2X09A 5KYYB 3BW2A 1H7XA 4HZLB 4NQQA 3P9LA 5AAWC 5SX5H 1KFLA 3ZN6A 2ATMA 1TB3A 4TUOA 4TL5A 4PGDA 1HT6A 3TAOA 4DY1A 4MRCA 3SYOA 3DX3A 1RUQH 2Z1VA 3B2UC 4PJIA 3M16A 5AZEL 4H04A 2QNEA 2IPKB 2VD8A 5EORL 3I10A 3PJSB 4WI9A 5TGBB 1KJVB 2XIMA 3SY1A 1K9FA 2E9IA 1DQQB 4KZEL 1XXDC 4IQEA 4RFEA 1W9DM 2JIXB 2R27A 4BZ2H 1TPXC 1BZ7B 2Q76A 4OZFB 1CS6A 4LB4A 3TCLA 1NGXA 4TPRH 3UAFA 3HA0A 3WCZA 4OUIA 1G7IB 1MVFA 4H0GA 2OCCB 3JWOC 2BV9A 3C09B 4KO9A 4CDGC 1GYNA 5HTSA 1AR1B 1VCFA 1Z7JA 4NNYA 3APYA 4DM1A 1BXCA 1JVNA 4JN8A 3WDJA 4K5PA 1BRLA 4JFUA 3W7GA 3QHNA 1KNOB 3AHTA 2WBGA 2X4RB 4HS8H 2MCMA 4JAMB 1CFQB 5HR7A 4JTGA 3GNXA 3HRZB 1B4LA 4AZHA 5BCAA 4JTDA 3I3BA 3WF3A 1QEWA 3PAUA 1DQTA 2VDNL 3B2VL 1EZVX 3TN0C 1WA0X 3PTMA 3L0GA 4KROC 4PJ7E 2V2CA 1F6YA 2Q0ZX 4MA1B 3GDMA 3IJHB 1SHWA 3IMUA 1UJTA 2WBJB 5F7EH 2HTKC 3DX2A 1VIZA 4HMDA 1T8XA 3NCJH 2HJFB 3BLBA 3L9CA 4PIRF 1T0NB 3GSXB 1KTNA 4DF0A 1VGEL 2DGAA 2ORBH 2XDHA 4OB5H 5CSZB 3UAJC 1N5AA 1JBJA 4EVNB 1LM8V 3LZQA 1Q2RA 1YDPA 4HKXA 4BE6A 3ZL4H 5BVPH 1IL1B 4JX4A 1X7FA 4XG1A 3IUHA 3N4AA 2A6DB 4YLWA 5I16A 4NHCL 5EBGA 3VGFA 3C4UA 4UTBA 5FO9A 3F7YB 4L5FE 3T6VA 4BQBA 3GRWH 1JPTH 3MBEC 4RW5A 3APFA 3EX1A 1TMQA 2C3HA 2YD7A 4IM4A 1JERA 1OW0A 3AADB 3GSVB 2CLVB 4QT5A 4JFPA 3ZKNC 2UZIL 1H19A 3IAPA 3EEGA 3S2MA 1GKQA 2XN9E 3QR1A 1MF2H 3QFJD 4WEBL 2K7QA 2NNRA 1GS6X 2VELA 1KBBA 1K4DB 3MXWH 5GGVH 3LHPL 4NZ3A 2WHMA 4M5PA 4PJHF 1E43A 5D2XA 2VUNA 4GXFA 2H2SC 1EZLA 4YHKH 3ZLQC 5EEZA 3LQLA 2QAPA 5BZAA 3L9YA 1D2KA 3LYEA 4FA3A 4WDUA 1OCJA 4W8AA 3P4MB 1UXLA 1NC4D 1JZ6A 4L3AA 5CEWA 2RJHA 2W9DH 3ISRA 4UT9H 1KCBA 1P6BA 1TQUA 2WZ5A 6ALDA 4JY5H 4JFFB 2V7HA 3TV3H 4ZUUB 3CC1A 5F9AC 4TULL 3WTTA 3PNWB 3ESOA 2KDYA 3FF7A 3IJ8A 4OU3A 1UOKA 1T1WA 1Q6LA 3EYSL 1PBGA 1EZVY 3KTSA 3V0UA 3ZZ1A 1F3DJ 4AK1A 5HR6A 4CD4A 2CH8A 3I50L 1KDIA 5JNYB 3UZ5A 2B5IB 1UBPC 5KTEL 4XOEA 3SDCD 3UZQA 5GZNA 4OECA 3TCSA 1T7ZA 3T3MF 3KOFA 3I9AA 1A3HA 1U8HA 4Q7NA 1I4FA 4FG6C 3KPSB 2E7BA 3UXDA 4XMZA 3LQGA 3DN5A 4NIRA 2BGQA 1OABA 1SFDA 4P5KA 1G4MA 4LIQE 4BZ1H 1A1MB 3GIQA 3ORJA 2YAOA 3F85A 2BCKA 1G5AA 4LSTH 1KB5H 4R7NB 4X9BA 3RB5A 2WZIA 3UF9A 4PAZA 4BBWA 1VH7A 4TVUA 4ZFCA 1V5XA 1B4EA 3GNPA 1AE6L 2Z35B 3RLGA 3SQLA 4HF5L 5AW0B 3FRPG 1BV8A 4X22A 3EJPA 3SPVA 3VFGL 1YNLL 4KFZC 3VMPA 5GRZA 2BW5A 3IVTA 4ZPTA 2VDLL 4APQA 5GGSA 3EH4B 3KCOA 5JMOC 4PMEA 3VI4A 5D09A 5IWLA 1RY8A 4LANA 1OAUL 2E6YA 4BQ4A 3D4CA 4AGLA 1Z48A 5F1OB 1CGYA 2H5UA 4NASA 3MSRA 4JREB 1BFVL 1DPMA 1CB2A 1FWBC 4JQIL 5DRXA 4S2CA 3O6FA 3S37H 3MR9A 3GHBH 3TZVC 5GRVL 4XMPH 2LW3A 1J6PA 4LUYA 2AMUA 1ZLWH 4DPBX 2EUXA 2RTTA 4F2MB 3D87B 3N85H 4LL4A 1H3WM 5IV2A 1QRND 3IGUA 1LP6A 1PYWB 4TV3A 1LK3H 3VXQA 1JGUL 3MCLH 2WZPA 4LPUA 3WIJA 3ARDD 1M6OA 1LO5B 4LLVB 4QRPA 2VLRD 3QIBC 2Z4GA 2JKLA 3TFKD 2D23A 3BP7B 4ZE5A 1YNTF 3ITXA 1O12A 5LGHL 3NCYS 2PP1A 1BVLA 1Q6RA 1AH0A 5TAOA 4PJFE 2AF2A 3KAAA 4JFXB 1S7WA 3CWNA 2HPIA 1VFOA 4KV5E 5CAYB 1CCWB 3ULVE 2YL8A 4W8BA 3L9RA 4PLNC 4OZGF 2PGWA 4GAYA 4GOAA 3RDJA 1FCGA 3ZW3A 4Y2DA 3GC5A 5ID0B 5ICYA 4NUMA 2DZWA 3EA3A 2XISA 1X8FA 3V6FB 3LKQB 1QPRA 1YPZA 3FFDB 2A73B 1IXNA 5D8JH 4G5ZH 4P23C 5C09D 4AEOA 4JG9A 2CR3A 1RJRA 5E00A 4O28A 1TMCB 3MRFA 3NO1A 5EO1B 3AS1A 5D2NA 2X0VA 5HDQH 3CE1A 3N2J