4UQBA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.68 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
total genus 135
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqbA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqbA02
1JAKA 4YHEA 3VSUA 3MV01 4P8WA 3LXAA 4J28A 4BZYA 2J7FA 1V08A 1DWFM 4WIWA 1PS3A 2GUYA 4J3WA 3U7VA 1CBGA 3OLDA 1WCGA 5BXPA 3S2CA 1D2KA 2EJ1A 2DT1A 5I78A 3GXNA 2YA2A 4PUDA 4DWSD 5DFAA 1LLOA 3F5KA 3DDGA 4FLSA 2XSAA 1EIBA 5LA2A 3LXCA 4CD4A 4MNKA 4XB3A 3AIVA 4HZ7A 1JIBA 4KWUA 5JIPA 1FHLA 1QNPA 4UFHA 5JBEA 3THCA 5D9OA 5CSYA 3EJSA 5KZ6A 4L4OA 1B31A 4D1JA 5CGMA 2V3GA 3TTOA 1UOKA 1OCQA 1PAMA 4AY1A 1HP5A 3CC1A 3WUEA 1MW0A 3OA5A 5A8PA 2WCSA 1H11A 4P7LA 3UEQA 3WQ4A 3CUJA 3BAIA 1UH2A 1WO2A 4EAMA 2JEQA 1QW9A 1CENA 3T2PA 1V3IA 1I75A 3M07A 3AS0A 3WQ8A 2DT0A 3VIHA 1ZU8A 3T0AA 3UERA 4N0RA 4WSJA 2AAAA 1QNQA 3WUGA 3FHQA 4CD5A 3NDYA 2WBGA 5A3HA 4W93A 4BQ5A 2E40A 3WNKA 1JYNA 3N17A 3BGAA 5CZKA 2DH2A 3AMDA 1ESWA 4S3KA 2JF7A 4HZ8A 1J10A 1J01A 1E6XM 1JFXA 5CQ1A 4PBGA 4WK9A 4GZIA 1JZ3A 3M7SA 1ISZA 3AYSA 3SUTA 4FNTA 1E4MM 3VIIA 1T0OA 1M04A 3T08A 3O9NA 2FDMA 3MUZ1 1GQJA 4LYQA 4GINA 4U3CA 1V0MA 4PSPA 3VGFA 3WH8A 4LXFA 5HBFA 2XFFA 3BVXA 1CLXA 4KGLA 3AS3A 1KCLA 1QI3A 2VRKA 2X09A 4NSBA 5D9PA 2YIHA 4PMRA 4H2CA 1VF8A 1E15A 3PTKA 4OJYA 2E8YA 2OWCA 4W87A 1BTCA 4IPLA 3W82A 4X0VA 4XZWA 4YHGA 4BA0A 4UFMA 3F5LA 1JI1A 3AXHA 4WSKA 6TAAA 3AMLA 1QI0A 4TX8A 1CECA 2Y2WA 1GQIA 1JYWA 4FF5A 4MB1A 1C90A 1H4PA 5DEZA 1UHVA 4AD5A 3K8MA 2E3ZA 4NRRA 4QFUA 3VINA 4AIEA 4GQQA 4MB5A 1XCXA 1XCWA 1UR2A 5C8BB 4DWSA 3OLIA 1JZ5A 1JF5A 3BUQA 4S3JA 4ATDA 3U5YA 1CXFA 1UYQA 3W25A 2CYGA 3PZGA 4CD6A 2X1IA 4UOJA 1DHKA 3OB8A 2ZX8A 1ZJAA 2W63A 2X2IA 1UH4A 4GXPA 3EYPA 1TZ7A 4JHOA 1B3WA 4W7WA 2OLHA 2A3HA 2DIJA 1JZ8A 3WY2A 4M24A 1J9YA 1ZBVA 2ZUNA 1UWSA 2BS9A 3DX3A 1WDQA 5M17A 3VGBA 1XYZA 4M1RA 3CZLA 1UZ1A 4RE3A 4J3SA 5LA0A 1XD1A 5E1QA 4Q22A 3DX4A 2J77A 2YKKA 3MMDA 2XVGA 3CUFA 2X2HA 1QNSA 4D72A 1OD8A 1CTNA 3OGRA 4CD8A 1UWIA 3SEPA 1QHPA 4PMDA 1DEDA 2ZX5A 1WKYA 3SCQA 1XH0A 2RGLA 1CYGA 3BAWA 5GPRA 5BCAA 1UWQA 1FOBA 2OYLA 1BVNP 3SUWA 3HG5A 1JXJA 4P7OA 3WQWA 2E0PA 1TA3B 4QLLA 1US2A 4XX6A 2AOSA 5GNXA 5A6MA 1EDQA 1HJQA 4JCMA 3HG3A 5TD4A 2PC8A 4CCDA 3RM9A 4B16A 1PX4A 1V6YA 4PUEA 3DX2A 3VNYA 1HWWA 5ABFB 3PZ9A 4W86A 1TE1A 4OKDA 1B2YA 1KBBA 1HNYA 3KLLA 3AI0A 3CHEA 1TQVA 4MADA 4UQCA 1FP9A 3WMCA 1C7TA 4NI3A 1V6WA 2BHUA 3PZTA 3QHNA 3K4AA 1UR8A 2D0FA 3FAWA 3THDA 1HN1A 4UOQA 1JD9A 2BVTA 1UD2A 3VX0A 3KZSA 2J7EA 3WH9A 2D3NA 2OW7A 1EDTA 4UQ9A 2AMGA 3UETA 3TV8A 1V3HA 2WVVB 3ZT6A 4HMEA 2WZEA 1M01A 3SCSA 2ZX9A 3WELA 5HXMA 1PX8A 1PIFA 4MDOA 1H0GA 3VKKA 1BSIA 2XM1A 5JUVA 4PRWA 3AXIA 1OWQA 2OYKA 1UWUA 3SCRA 3WH6A 4HTYA 1H3GA 3D4ZA 2Y24A 1GZJA 2GJRA 4CVUA 2ZXDA 2DSWA 3AHZA 2ZUVA 3VIJA 2X8RA 1E6RA 3VM7A 1E1EA 1B1YA 4TVDA 2XUCA 3S5ZA 4EE9A 3B9EA 4CVWA 1UD6A 3BCDA 3EDJA 1BAGA 1IZKA 1O7AA 1RH9A 3MV11 1XSIA 4Z2KA 4L4PA 3VIOA 1CLVA 3SCUA 2JIWA 4HOZA 3EJQA 4UQEA 1AQMA 3HZ3A 4MPKA 1BG4A 2VCBA 3RMEA 2DSZA 2VC9A 2NT0A 2G3MA 5JIWA 4GO9A 1NP2A 3M46A 4AYGA 3DHUA 4MDPA 2CXGA 3ZT7A 2XN0A 2YOCA 1W9XA 2EPKX 1UUQA 1XC6A 1K9DA 4KH2A 2CIPA 2EPNA 1VAHA 1QNOA 1V02E 1ISWA 2YL5A 1ZL1A 2E8ZA 2F7PA 2XG9A 3A6OA 3QGVA 1U2YA 3VTRA 1TR1A 3EDEA 3HG4A 1US3A 4ZEPA 1KTBA 3N13A 1JDAA 3W0KA 1TFVA 1E72M 1MW2A 2QV4A 3DC0A 2CITA 3F4VA 4GPNA 4E8CA 5AC5A 2QMKA 1MVYA 1R86A 2J47A 1E6QM 1JGIA 3IJ8A 1UQZA 3RM8A 5CPTA 3DX0A 5A6AA 3W38A 4FNRA 5I23A 1SMAA 2X2YA 1HVXA 1E5NA 1QBAA 3RPMA 4AZGA 2QLYA 3MMUA 1IT0A 2J25A 1BLIA 3FAXA 4A3HA 1NP0A 2XVPA 3AHTA 3VILA 3WDJA 3LXBA 4AZCA 2NW0A 4OIFA 1UR9A 3ARVA 2XHYA 1R34A 3PZIA 1BPLB 3WEMA 3AYRA 4JKMA 2F2HA 5CLWA 5A1AA 1JZ2A 3GBDA 1GOKA 1R7AA 3ARRA 3AISA 5AYBA 4D6GA 4J3VA 4C7FA 4HU0A 5M3WA 4PCSA 1VRXA 1W1YA 1JDCA 1QW8A 1WNOA 1CEOA 5HDRA 2GVYA 4JFUA 2GK1B 3VGEA 2WM0A 1U30A 3WNOA 4AD3A 1MW3A 2XGIA 1KXQA 1CIUA 3VMPA 1LF1A 2WWCA 3WKZA 1GHSA 1OIMA 1KWGA 2X2JA 4NZCA 3MKKA 1JXKA 4E4PA 2UY2A 4BCEA 2XYLA 2FHCA 1CXEA 4TTGA 2ZUMA 1TVPA 2GDUA 2DH3A 1OBAA 4QDMA 1MFVA 1G0CA 1OB0A 4RL3A 1QNRA 1ITXA 1MQRA 1HIZA 1UZ4A 1E40A 1XSKA 1KGWA 3GXPA 2WC3A 5FL0A 3B8SA 3I3DA 1R8LA 3EMCA 3AROA 4WKAA 2WC7A 3M6DA 4J3XA 2BFGA 1BYDA 4J3TA 2D3LA 1TQSA 3SUVA 3BVUA 4R5EA 3D4YA 3WEZA 2V5DA 4JFTA 3WD3A 5BXTA 3CTTA 1NWUA 2GJPA 2ZUWA 3AZTA 4QP0A 2YA1A 5A2CA 3PTMA 1WPCA 2Y5EA 2JEPA 3AJ7A 5FCZA 3K46A 2DIEA 2ZIDA 1W3LA 1XH1A 2VQUA 1QI2A 5ABEA 2CEQA 3BMWA 1AQ0A 3W53A 2V3EA 5BXSA 2XSBA 2YJQA 5A2AA 2WC4A 1E56A 3POCA 4DO4A 3WL1A 2Z1KA 4PMUA 1WZLA 3WQ5A 2PI6A 3GYCA 4ACYA 3AOFA 3T0BA 3TTYA 3ARSA 4LYRA 7TAAA 5IFTA 4FMVA 5FL1A 3KL5A 1ODUA 5A6LA 2G3JA 3BUPA 1U33A 3VPLA 1VEMA 3WDPP 1VFMA 1UKPA 1C8XA 4GI9A 2BY3A 1I1XA 4GKLA 3L4YA 4FLRA 3AXXA 2QMJA 1ISYA 1GORA 1E71M 1VENA 2OWWA 4ZFMA 1HJXA 3IAQA 2ZXAA 2W91A 1EQPA 2B31A 2XIBA 3WFLA 3WH7A 2VNCA 4PMOA 1JNDA 4AMXA 1Z32X 1EA9C 4B9YA 1Q6CA 1UWTA 4W88A 1V0NA 4B9ZA 3EDDA 1V3JA 5I6SA 4OBSA 2WVSA 5I79A 2FHBA 2VOTA 4CN4A 1JZ6A 3W27A 4YPJA 2G41A 3L4VA 5IHRA 3WEOA 4AMCA 2VZTA 3CHDA 5I0DA 4KRTA 1UQYA 3SCVA 2XIIA 1J0IA 2D23A 2VT0A 2WHLA 4V2XA 3VU2A 1NQ6A 4JL1A 1CXKA 3CHFA 3MMWA 5AC4A 2VCAA 3II1A 3A21A 4Z2LA 2WHJA 1LL6A 3VD7A 3EDFA 3PZNA 2W92A 1B0IA 3AIEA 3VDCA 4PTMA 1FFRA 2YDRA 1AQHA 1QHZA 2V38A 4UFLA 5FOOA 4U2YA 4NZFA 3N15A 3BUIA 2EADA 3GXTA 2E9BA 2YFNA 2WMIA 2ZICA 4M56A 4DWSC 3WBAA 1ISVA 1J0YA 1ZB5A 2WCGA 1BYCA 2OSWA 2D2OA 2TAAA 4U5IA 1E6SM 3W81A 3ZOAA 2WMKA 4V27A 1GOWA 1PX3A 1CGVA 2ESCA 2QHAA 2VJXA 3HU7A 3DDFA 3BLPX 8A3HA 1H49A 4X0NA 1HP4A 1G01A 1EGZA 3SCOA 2OYMA 3O6AA 1CGXA 1EDGA 5A6BD 1HVQA 2EAEA 3QHMA 4W5ZA 3SURA 3G6MA 3LPOA 2BHZA 1NOWA 4GQRA 3W24A 2PWHA 3TOPA 1OINA 2X0YA 1FH9A 3U5UA 4UFJA 1VFUA 1BVZA 1DWJM 1X6NA 1B30A 1ISXA 1GQKA 2XPKA 1EHAA 5CG0A 2G3NA 3L4XA 1QOXA 3TP4A 3I3EA 3N18A 2BXYA 2BV9A 2BY2A 2XN2A 5JBFA 1KCKA 4JL2A 1MYRA 1UD3A 2W62A 1BFNA 3GBEA 2VURA 2PWGA 4D6EA 2D1ZA 1KB3A 3IANA 3A47A 1HF6A 3WF1A 3ZMRA 2F61A 1GOOA 5M03A 3LPPA 4HMDA 2CBIA 3PHAA 2F18A 3NYDA 2WKGA 3MSDA 3MANA 1C3FA 1EOMA 1BHGA 3A23A 1CGWA 5E9AA 2EBNA 1EQCA 3OLGA 2O9OA 2ZXBA 4H04A 1V03A 2YL6A 1ECEA 1TCMA 4E8DA 4HU8A 1MQPA 2FGLA 1E0XA 1UR1A 5HNNA 4QLJA 3HMCA 2WLYA 4CGTA 3VD3A 3GXIA 1KFWA 2EPLX 2ZE0A 2Y4SA 3PZQA 4AD2A 5LYRA 3CV5A 3ZT5A 3W6LA 8CGTA 1UD8A 3N11A 2ALWA 1K9FA 1D3CA 3NIYA 4D6JA 2J7DA 1UA7A 4P7RA 3GXDA 1GJUA 4AZHA 5DF0A 5DT7A 3NUKA 2WANA 3IAPA 3OBAA 3CPUA 2DSVA 2WMFA 4JCLA 4E2OA 1C8YA 1B3VA 1M7XA 2JIEA 4GO8A 2QF8A 1HTYA 4W85A 1Q6DA 2XVLA 4HMCA 1J12A 1IZJA 1V0KA 5BYWA 1PPIA 1NOUA 3CMJA 3EBVA 4NRSA 4TXEA 1Q4NX 5F7UA 1ZBKA 4QAWA 1OIFA 3EJUA 4UQBA 1UKQA 3T2OA 3CBWA 3BCFA 4CN1A 5CSUA 1Q6FA 4D6FA 3POHA 5BRQA 5C70A 1JYVA 3EDKA 4WKFA 3WDRA 3OZOA 3KWXA 5ABGA 3W29A 2PBGA 3E1F1 2PWEA 2CNCA 3GNPA 3UR8A 1V3LA 3RIKA 2DPEA 2F7RA 3AIUA 3BSGA 3LPFA 4WLCA 1KQZA 2X05A 2A3CA 1HKJA 4PCTA 2FGZA 3D51A 3RILA 1JFHA 1NWSA 1E0VA 2J75A 1JZ7A 3GTNA 2E9LA 4BQ4A 4MJ4A 2NT1A 4OOUA 1UD5A 3A24A 3T0DA 3KL3A 4MNLA 5GQBA 1BG9A 3RJXA 3ALGA 2XN1A 2VO5A 4TUFA 1C91A 1SR0A 2ZXQA 3DYOA 7CGTA 4MAZA 1F4HA 4FNQA 3J7HA 3U57A 4AWEA 4HOWA 5IXEA 3AFBA 3PN8A 4JHZA 1E5JA 3RM4A 4YN5A 2WK2A 1L8NA 4DUWA 1C7SA 4ZE5A 4PTWA 2J7CA 3BUBA 3WQ6A 1EHNA 2EEXA 3BVVA 4FK9A 1MQQA 1WDSA 4W7UA 2A3EA 4NZJA 1MW1A 5A8NA 1ODZA 4DUXA 1TA3A 3WF0A 4PTVA 1CXLA 1B90A 4CU7A 4PMQA 4FLQA 3VIKA 1OM0A 1EOKA 3N9KA 1E73M 2WKLA 2YFOA 4D6HA 1NM9A 3UCQA 4TOQA 4AZCB 2DSKA 3I3BA 1EH9A 1RPKA 4PSRA 3L2LA 4OGZA 3PZUA 2J79A 5A2BA 2XJ7A 3SUSA 3GH5A 2VX6A 1KTCA 3VD5A 3OGVA 3AS2A 1FHDA 3SUUA 3BVTA 1GHRA 3VGGA 1N82A 3SCTA 1K9TA 1XV8A 5AYIA 5E0CA 3NDZA 1K9EA 3MI6A 4XV0A 4XUYA 1KR0A 3WDQA 3CUIA 3GH4A 5LA1A 3BUDA 4OOZA 3WD0A 1H1NA 1FH7A 3K8KA 4MB3A 1B3ZA 1LWHA 4P8XA 5EBAA 3WUFA 2EPOA 4A4AA 3A4XA 2WMGA 2CCRA 1GONA 4NF7A 1JG9A 1DWIM 1C92A 5A8MA 3A22A 4P7QA 3HN3A 2HISA 5I2UA 3SCNA 1BQCA 3CZEA 1DP0A 1JZ4A 4JFSA 4QCFA 2CBVA 3D50A 2BY1A 1S46A 3H54A 3K4DA 3DYPA 3CIVA 1ITCA 3ARZA 3AZRA 3VIPA 3HJEA 4GI8A 4IPNB 4AISA 4D6IA 2VQTA 3L4UA 2GJXA 4LYPA 3HG2A 2WZHA 4WKHA 5E0FA 4JFVA 2G8ZA 4PMVA 4OZOA 1FFQA 3ZSTA 2DT2A 3ARPA 4Z2IA 1W2PA 5D9MA 5IFPA 4FNUA 2DT3A 1KXVA 3CZ8A 5CPQA 2CERA 4UTFA 5CGTA 1HXJA 2Q8XA 3BC9A 1BGAA 1QI5A 2EQDA 2VTFA 3IGUA 4BQ3A 5I77A 1TQTA 3BXWA 4UQDA 2ZUTA 2MANA 1E4LA 1ZBWA 1SFSA 2WVTA 3W28A 3GZAA 1HJVA 1JD7A 4OBRA 1DTUA 3VMNA 2WHKA 1ZBCA 3D3AA 3VUPA 1HJWA 3MUY1 2E4TA 3LRMA 6CGTA 3T2QA 1E0WA 4BS0A 3EJRA 3ECQA 4JKLA 3WN6A 4PEEA 2ZX7A 3WF3A 2WVUA 1TUXA 2EPMX 4CN6A 3CO4A 3CUGA 3CZNA 4UZUA 2Y8KA 2VVNA 3CMGA 3GH7A 4HPHA 2VX4A 2YLLA 1R87A 3L4WA 2WCAA 2YL8A 4AW7A 3H55A 5E6YA 1J18A 3MS8A 4U2ZA 1G5AA 4J27A 1GOQA 4UNIA 1LJYA 4U3AA 2DQXA 2DEPA 2VZOA 1WB0A 1V3MA 2J62A 5GNZA 3LRLA 3KLKA 3BLBA 2OSXA 4JZ5A 1K6AA 3RDKA 1W9UA 1VJSA 4BQ2A 5BWFA 4HA4A 3TTSA 4UQAA 3NJ3A 4Q7NA 2CKSA 2EACA 3BLKA 3VD9A 3PZVA 1HT6A 4GIAA 2UY4A 3FXYA 2WSKA 2X0HA 4X9YA 3FNDA 1J0HA 3ZJ8A 3NSXA 1M53A 1C8QA 1NWTA 2F7OA 3CZSA 2XVNA 3KL0A 4WF7A 4MJ2A 1UG6A 4AZ6A 2YDQA 2WB5A 5KEZA 4W84A 1G94A 1G1YA 1E3XA 1UWRA 1BGGA 1XHGA 2O9TA 3D5HA 4W8AA 3UG4A 4LPCA 4CU8A 3VOCA 5C71A 5EB8A 3TTQA 3LMYA 4UCFA 2JE8A 2IXVA 2PWFA 3WY1A 3ARUA 2WMJA 1NARA 3EJTA 1SMDA 4XZBA 2O9RA 1JYXA 3EMQA 3SCWA 1WP6A 4H7VA 1GOMA 1R75A 7A3HA 1VJZA 1OT2A 2O92A 2J7HA 4D71A 2W61A 2F1BA 3PTQA 3WDIA 1OGBA 3LX9A 2DDXA 2WHMA 4UR9A 4RE2A 1E43A 3NCOA 2WBKA 4MAVA 2VZUA 1LL7A 4AD0A 1WE5A 1WZAA 3WFZA 1PBGA 3SCPA 4WJXA 1VIWA 1QWUA 1CXHA 1J11A 1YQ2A 5CPSA 4MNJA 4ZXLA 1X6LA 2JFEX 4ACZA 1H0IA 2UY5A 2QPSA 1D7FA 1EO7A 2VUYA 4FNSA 4TVCA 2CKRA 2O9PA 3BMVA 4W8BA 1W1VA 3IJ9A 1GOIA 1W9DM 1LQ0A 3VIGA 5E6ZA 2Z1SA 3A4AA 1CWYA 2FYVA 4ZXOA 3W4RA 2VR4A 3A4WA 1TMQA 3ZR5A 4PMZA 3EJPA 4AIOA 4PMYA 3ZSSA 3L4TA 1R46A 1MXDA 2CPUA 1CPUA 4D6DA 5E09A 3WY4A 4ATWA 3ZO9A 3FHAA 1CGYA 1OD0A 1UKSA 2D73A 1V0LA 3VM5A 1H5VA 4PMXA 1R7OA 4AYSA 1MFUA 1P6WA 2WYSA 1XYFA 3AMCA 3K1DA 1GVYA 4W5UA 2BHYA 1XSJA 3WF4A 3PZMA 2ZOXA 1AVAA 3QOKA 3IK2A 3QOMA 4N42A 4DM2A 2E9MA 2WSPA 2GFTA 3ARYA 2DSUA 1IV8A 2D0GA 4JFWA 2D0HA 1LWJA 1O7DC 3LRKA 1W1TA 4DWSB 2Y8VA 3ALFA 5FIPA 4AEFA 3K8LA 1OGGA 3VX1A 5IDIA 4U5KA 1UR0A 4UFKA 3ZJ6A 1DWHM 1FP8A 3NSNA 3KEHA 1QX1A 1UASA 3ARWA 1UH3A 3BAKA 5EFDA 1WDPA 4QCEA 3WMSA 4QLKA 2XGBA 5BXRA 5A95A 4M8UA 1Q6GA 1LG2A 4MTVA 2VCCA 2BVDA 3WD1A 1PJ9A 3WNNA 3OLEA 3DHPA 4U31A 3AHXA 4C7DA 4B3LA 4FNPA 1WZMA 1ZJBA 1E4IA 1V6XA 1QBBA 2DGAA 2C0HA 1QWNA 4HA1A 1V02A 1KR1A 3UR7A 1E6PA 3BH4A 1CZ1A 4Z2HA 1Y7VA 1RD6A 5EMYA 5EFFA 4R27A 4JAWA 3OZPA 5HOSA 1PEZA 1RP9A 2ZUUA 1CGUA 2ZWYA 3VIMA 1HL8A 2XWEA 2WLZA 1JI2A 1FH8A 5A8OA 3WD2A 1GPFA 1W32A 1BYBA 4MNMA 3UG3A 4PYSA 2A3AA 5DMYA 2VI0A 3WL0A 3N12A 3RJYA 4HP5A 2VZSA 1NH6A 3TA9A 4AC1X 5D9NA 5I3DA 9CGTA 5FD0A 2J7BA 4J7RA 2WZIA 1HKKA 3ARQA 4BF7A 5JBDA 4ML4A 1OT1A 2JALA 3AMKA 1V6VA 2W67A 2IUZA 1JF6A 1W2VA 1QI4A 1GJWA 3VDBA 3WENA 1W9BM 3IJ7A 1X1NA 3AS1A 1LG1A 1J0JA 4EK7A 2FHFA 4H41A 3ARTA 1CDGA 2QPUA 3L2MA 4TVUA 3VO0A 5I5RA 2FH8A 2PBOA 5HPOA 1G9HA 2XWDA 3FY1A 2D22A 2CBUA 3WUBA 1BYAA 1DWAM 4CUCA 3QHOA 2VMFA 1JDDA 3BAYA 4AIUA 1W3HA 3W26A 2F8QA 3BSHA 1YHTA 4AD4A 1V3KA 2XFRA 1W3JA 3AICA 1WDRA 3S6TA 3W6MA 1UKOA 2ZWZA 1L0PA 4HPGA 3TONA 5A6BA 2YA0A 2EO7A 2XM2A 1R47A 2JF6A 1UA3A 2WPGA 1QVBA 4DUVA 2PF0A 2CHOA 3N04A 1FA2A 5HPCA 4H8VA 4EANA 4H8HA 3SIMA 6A3HA 4W89A 5CJ5A 3ZJ7A 3WNMA 1SYTA 1E9LA 1VB9A 2VR5A 1W3KA 1W1PA 3VSVA 2FE0A 1MWOA 3AIRA 3WSUA 4URIA 3GXFA 1DWGM 3VGDA 2PWDA 3AZSA 3CGTA 3A3HA 4AD1A 3H53A 2A3BA 4KGJA 2NSXA 3VSTA 2XTKA 1B9ZA 2WNWA 1PZ2A 4K68A 3A5VA 1E70M 4IISA 3AIWA 3AQUA 1KWKA 4W7VA 4HA3A 4H8UA 4F79A 3B9AA 1KGUA 3QR3A 4P7NA 4ZENA 1W9VA 2ZUSA 3VGHA 3L4ZA 2J74A 2VZVA 1NWRA 3VDHA 1JL8A 4F66A 2YDSA 1R85A 3ARXA 3CUHA 1SZNA 2HVMA 5CXPA 2F7QA 4ATLA 2J78A 4M81A 1GQLA 2J4GA 2W4XA 5ABFA 3LPGA 4A3YA 3OG2A 1UD4A 3WF2A 1W9PA 3O2LA 3WNPA 1QPKA 3ZM8A 1B3XA 3CH9A 3BAJA 1J0KA 4Z2JA 4DO5A 3DYMA 1GW1A 2GJXB 2C8NA 3WY3A 4CU6A 2V5CA 1XH2A 3OIHA 1F4AA 5A69A 4JKKA 3CZJA 3CLWA 2OWXA 2FH6A 3WBEA 2C7FA 5D4YA 1XGZA 1RP8A 2GSJA 1A47A 2WWDA 3DECA 4D6CA 5I24A 1O6IA 1VFFA 3F5JA 4LGXA 2WVVA 5M5DA 1KXHA 3ZIZA 5AY7A 2VL4A 1HKMA 5BROA 1H41A 1VEPA 3U7BA 1XD0A 2UY3A 4GZEA 1VFOA 3EMZA 1PZ3A 3WD4A 2EABA 1WZKA 2CETA 2EXOA 2G4FA 5A6JA 1KBKA 3CZGA 2PB1A 3GM8A 3T09A 4M82A 3S5YA 5A6SA 3GDBA 1H2JA 5ECUA 4MB4A 4FLOA 1J0ZA 4B15A 3DX1A 4HOXA 4UFIA 1GCYA 1E3ZA 1HJUA 1KQYA 3VVGA 1W91A 5A6KA 4DO6A 3AHVA 3NSMA 3UESA 1KXTA 3D52A 1E55A 1E6NA 4D1IA 1EO5A 1AMYA 4EKJA 1UKTA 3CHCA 1XRVA 4AZ5A 2G3IA 2WW5A 3WNLA 4W8LA 2J7GA 3AHYA 3PZOA 2YLAA 3GNRA 4Y7EA 1TQUA 3WDHA 3FN9A 3MU7A 2RGMA 4NX0A 2BY0A 5CLTA 5GNYA 4F9JA 3BVWA 3VD4A 3MUAA 1E1FA 5A8QA 1BF2A 3BAXA 1OGSA 4M29A 5BRPA 3W37A 1E6ZA 4F9DA 4NXKA 4AXNA 1ZS2A 2OSYA 4GI6A 4ZE4A 2YL9A 2V3FA 2ZX6A 1CXIA 4Z2GA 5DT5A 1I1WA 1VEOA 4M80A 1UR4A 1HJSA 5FKYA 3GXMA 3VDAA 1JAEA 2BXZA 2BVYA 4IM4A 4P8UA 3VMOA 2OW6A 2YBTA 1JNEA 2D20A 1V6UA 4KRUA 4CCEA 1OSEA 1TQWA 4J3UA 5A94A 3ZQ9A 2CBJA 1WAWA 4HZ6A 2IGTA 2D24A 2XVKA 4KMQA 3AMGA 4JIEA 5E70A 1LL4A 4CCCA 1GVIA 4P8VA 4CD7A 3VIFA 3ZJKA 3AIBA 2VX5A 2W5FA 4RE4A 3GNOA 3OGSA 1HL9A 1HKIA 1R33A 2CHNA 3AIQA 4UOZA 2VRQA 2BNJA 4LX4A 1TG7A 5D8WA 2J8FA 3N1AA 2J8GA 3WQVA 3RCNA 2F1AA 2VRJA 3ZR6A 3UG5A 1E4NA 4TTUA 5DO8A 4U33A 1Q6EA 4F8XA 4AEEA 4V28A 3FW6A 1B3YA 1GNXA 4LQ1A 1HX0A 5ABHA 1CGTA 3APGA 3MUIA 2VX7A 3WMBA 1MXGA 3VNZA 2WAGA 4ACZB 4NXSA 4AZ7A 2XFYA 3KE0A 4GZJA 2GK1A 3CZKA 1KGXA 2WXDM 4OUEA 3WIJA 4B3KA 3JUGA 2V3DA 3WH5A 4IUGA 5D8ZA 2W66A 4PN2A 1H09A 4AZBA 1QHOA 1CNVA 2CESA 2WMHA 5IHSA 4C7GA 3MO4A 4PTXA 3PBGA 1VBUA 2WMIB 1PIGA 4AMWA 1GUVA 4CKQA 1C93A 1VBRA 3RO8A 3G6LA 1EXPA 3B9DA 4TX6A 4DM1A 4UZSA 1HXKA 1A3HA 2YBUA 2UWFA 1TVNA 4AZIA 1NOFA 4PMNA 2VVSA 1M03A 2GDVA 3MSGA 2IXUA
chains in the Genus database with same CATH superfamily
5CMAB 3MV01 3WUWG 1OCZB 1SM3L 3VXMD 1R5VB 1DJIA 4PUDA 3M1BB 4BM7A 1L7IL 1Q94A 3LXCA 1I3GH 4H0IA 5IQ7H 4ODTH 4I9WD 1F3DJ 4OCXL 3VXPA 1MUMA 5MP6H 2DLEA 3W83A 5CSYA 2WMPA 3EJSA 2XZQL 1WIPA 4LVOB 4NJHA 1Y6MR 3KNBA 3LYRA 4HJFA 1UOKA 3CK5A 1P9MA 4HX1B 4RFNC 4P7LA 3UEQA 1FVPA 3RKDC 3UFIA 4GBXB 3D46A 4U05A 4HYRA 1Z7AA 5G1TA 3OPZH 2QVHA 1OQOA 3CN3A 5CP7B 1KC7A 4W93A 5FK9A 3CVDA 2HRPL 2P3ZA 5D2YA 4HD9A 1AXIB 1J10A 4F2BA 1F5WA 5AKRA 4WK9A 3JVGC 2L04A 2G9HA 2F53A 5AN7A 5DGQA 3T08A 3QJHB 4UTBL 1WXJA 5GJSH 1FVDB 4UANA 5L9DL 1P1MA 3VGFA 4YZFE 4BI6A 4GABA 1QSVA 3M0XA 1I0BA 2VRKA 4X3ZA 5C9UA 1A3RH 4NSBA 2Y6ZA 1ERNA 2YIHA 4H2CA 5HYQB 2ED7A 5KYNA 3JR2A 3NIFE 2NQ3A 4BKLB 4A29A 4XAKD 1U92B 3SBWC 5HQLA 2QSVA 3NDOA 4GEIA 1SHXA 2KI6A 3EX6A 5DD1H 4APXB 1YJDL 3HPXA 3EOBA 2E3ZA 3WLTA 3O6YX 3NACH 4LQFH 2NYKA 4IRSA 1MIEL 1FL6B 2QCEA 5IVXB 3CFKB 2OXGA 5JPNC 2I5YH 3LEXA 4M61B 1MNNA 2WXKA 5LGXA 1WK0A 2G5RA 4M5TA 1JHKH 2P88A 1SUJA 1OW0C 3SRFA 4E5TA 2IADA 3MRKA 2WXPA 3HNVH 6REQB 3GHRA 1YUKB 4HZLB 3BJTA 3MOQA 4G9DB 4N85A 4XAFA 3ZTNL 2V0TA 4ODVH 1K6QH 1A1MA 2RGLA 4Y5VA 5FYJD 1M2VA 2OYLA 3P81A 1US2A 2AOSA 3SDYL 1HJQA 5TD4A 4CCDA 3VNYA 4HWBH 4ISVA 3PZ9A 4P5TD 2B2XL 5DMIH 1BVLA 3BP7B 1AKJA 5I00A 2GABA 5EOTB 5ANMA 1VKXB 3G8EA 3GNXA 3AU6A 2F6XA 1EDTA 2FWSA 4UBDC 1Z6JT 4FI7A 1EZSA 1Z44A 3VE0A 3B0UX 2UWEB 3SZ6A 3ZYOA 1LCOA 4MMYB 1UIOA 5LHEA 3GNDA 3DEQA 1TKKA 1HHIA 2OKTA 2KDYA 1HJBC 2J88H 4M1DH 4MLIA 2XDHA 1YCSA 3ARDA 3FCUB 5IFAH 1B1YA 4DVRL 4BZ1A 4H19A 4IJ3B 3ZHNA 1O7AA 4OLUL 4I1PA 1KN4L 5E9DE 2LTQC 3BQUC 1BEYH 1F4XH 5HPMB 3ASWA 2NT0A 4QJ3B 2W07B 3I02A 2CXEA 1B4JL 1W5PA 2G4JA 4QHMB 4JPWL 1S9YA 4LGPB 2XN0A 2V63A 1YYCA 2EPKX 4G82A 3ULUD 1JP5A 4NJ9H 1N2VA 1V02E 2MUCA 4ELKA 2YL5A 1DO5A 3PV7A 4PRPB 3AU0A 2VDQB 3JV6B 4JTFA 2CIKA 5C0JB 1NMCB 4J12A 4DF2A 5AHEA 2YCEA 5FO7B 3UG8A 3OR6B 3TE9A 4N2IA 2WO4A 1YPZB 1B9BA 4JTKA 1N8IA 2OEMA 3V4PH 1HVXA 4KVNL 4AZGA 2L7EA 2QLYA 4WEUD 5E8PB 4A21A 4DQOL 2IH3A 3U2SB 5BUAA 3VILA 4NCC1 1LWRA 1HH6B 2GUOA 2NY3B 4WFFE 1Y6KR 3DX7B 4KQ4L 3RVVD 2BSEA 1YC7A 4UTWC 4Q0XL 1XZ0A 1ICTA 1XFBA 2KL6A 4QHLB 4XXCC 4WWPA 6PTDA 2B59A 4AD3A 4NN7C 1LF1A 4PRAA 1KRBC 3U30C 1OE2A 2NXYB 4ABQA 1NCBH 3IJIA 4FXLA 5J04A 3N40P 1U1UA 4QDMA 5D7IF 4PHXA 4PJHF 3LH2L 3MCNA 2WLLB 4A37A 1IQWL 4PJ8C 1YNQA 2W9EL 4OUIA 3BQ6A 5EF0A 3E2QA 2YAQA 3GVQA 3M6DA 4OUUB 2DV0A 2BFGA 1PHQA 2XRAH 2DAVA 4NKCA 1OYAA 4FOKA 2WXGA 5FB8A 1K2DB 3JWNG 4JDVA 2C1HA 4PH6A 4O8RA 3LS4H 3UO1L 5ABEA 1QACA 1QWGA 1YDPA 2IAMA 2ZJSL 4LB3A 1TV8A 5HGAA 3ICJA 5FACA 1WZLA 2BOCA 4ACYA 3MZNA 1S9XB 1MCSA 5FL1A 5CAYB 3NGFA 3W2KA 1G1KA 3WO8A 1KJVA 2C7UB 2VSKB 5SWZE 1B0WA 4LT9A 1FWAC 2ZP8A 4W9HC 1TIMA 1TQBC 4GUPA 3EJCA 5EU4A 2W91A 2QBWA 2Z00A 4AMXA 1WAAE 1DSFL 4IQHA 1V0NA 2PGRA 4H26A 4PJCA 1FNLA 2H9AB 2QNEA 4WUUB 4YHKL 3WLMA 1VA9A 1JF1A 5DVMA 2VM4A 4WWKD 2WHLA 4FAMA 2RCSL 1O68A 2I1OA 4ZAKD 4PGBA 5IJBC 3PM6A 2A0NA 3BT0A 1B0IA 4KUZL 2UY7B 4DK6A 4CNIB 4ENZA 5FOOA 2OMZA 2EADA 2FTWA 1ZHNA 2TAAA 5JDSB 1PX3A 4IDLA 2PGEA 3IN0A 2K8MA 4XP1L 8A3HA 2QT3A 2EDYA 4JN1L 4Y1TA 3JTTB 1N8OE 1MY5A 3WD5H 3M1BA 1CFNB 4ZMWA 3D6GA 2X0YA 1LJMA 3WL9B 4YSQA 3MRGB 3MO7A 4RQQB 4GMTH 5AW9B 4LFHG 3CQPA 3FMGL 1QOXA 3TP4A 3ZPDA 5ECJE 5B4MC 2XN2A 3LNHA 3RWDA 4HX1A 2VURA 2CDEA 3CQIA 1I1YB 4NZDA 3BGFB 2ZKYA 3EYSL 4QHKJ 4GBXA 2DM3A 5DHVA 1MRQA 3OEXA 4M6OL 1QBMH 4F15C 2GEQA 3A23A 3II2A 2XFXA 2KHAA 1TIWA 2VKZG 3L65A 4HWZB 4GAFB 5F2GA 2FIKA 5CP7A 1V03A 5F97E 4IQEA 5CBJA 8FABA 5C0RH 1UR1A 4ELDA 4PGDB 1KFWA 1Z89A 4GXWA 1XIEA 3VH8B 3SQOH 2XKSA 5C0IA 1Y0EA 3W6LA 4PCNA 1A7QH 3LM3A 5ICZB 4LDLB 4D6JA 4HLJA 5KS9A 1AY1L 3GFYA 4AVJA 4DNMA 4MBRA 4IUOA 1KTNA 2FRGP 5HYQA 4W85A 3DO7A 3QRFM 3KCJA 1DQUA 3IXAA 1PPIA 2A5UA 1LEGB 4NP4L 2GQAA 1FWWA 2Z7ZA 4FLHA 3UZYA 4CN1A 4M1CD 3M88A 4APXA 1LYXA 4O02H 4ES8A 3WDRA 4ZUSB 5HYSA 1E42A 3TKFA 5ABGA 5MHSD 5HYJE 1P4BL 5TQ2L 3UR8A 3ELQA 3DGGA 1V3LA 2DQCH 3QCUH 3LPFA 1JBJA 1THAA 3KOYA 3THUA 1OP4A 3EOEA 3O81A 3FCBA 5LZLA 1N19A 3UAJD 4YWGL 1A8ZA 5F7DB 3JXAA 4TRPL 2JKRM 6REQA 1U58A 1EEZB 3FO0H 3OKNB 2FPYA 1F8TL 3BD3A 4HZLA 4NRXB 3BPNB 4ZD3H 1MWAB 4G6KH 4YIQA 1GPWA 3B40A 2NUWA 3AXLB 3BVVA 3K2IA 3P11L 5DJ8A 3T0XA 2WO5A 4C65A 3EG9B 4KKRA 3G1SA 5FS5A 2IW0A 2R24A 3ALPA 4R7XA 4BF5A 4FLQA 4NZ8A 3IU4H 3N9KA 1GZQB 1JZGA 1HZYA 3O41A 4HU3A 3BGMB 4BKTC 5K93A 4IMFA 3WUWA 4Z77A 5T1LD 2VFIA 2HJKB 3BP7A 2VW4A 4C90A 1QPQA 3L68A 3NDZA 4UIKH 2WXLA 1JNNH 4KJQD 2K6YA 1TWZA 4OCWH 1FH7A 2ESVD 4KX9A 2UWEA 3S2MA 4MMYA 4P4KB 3PQYD 5EBAA 4UT6A 4P8XA 4RLDA 5G4HC 3QC0A 1JG9A 5HJ3B 4NO5A 3SCNA 2ZRVA 3CZEA 5AHLA 3RAJH 1OGAE 3CZUB 3H54A 2BY1A 4JHWH 3T8XA 1H63A 3NA9H 3CIVA 3KHJA 3VIPA 1UVQA 3HJEA 2BSDA 3DJRA 3QXVA 3QJSB 4IMCA 3V9CA 3P0YH 4LPVA 1FFQA 3EH3B 4K2UL 5CPQA 2QDDA 1XTMA 3QORB 3T3MB 2F15A 4QHMA 3BXWA 2CWNA 4IS6A 4MNGA 4RAHA 1Q1JH 1HJWA 1HHGB 3LRMA 3T2QA 5A6IA 5IESH 2F6UA 2R23A 4M9OA 3L9YA 4BK5C 5GZNA 5KVFH 5AAPA 3MUHL 3E5BA 2IBZX 2VVNA 4XWGL 4BUHA 1XICA 3IFLH 2I7SA 3CVIH 3R0DA 2WSDA 5E8PA 1ONEA 2VN4A 5ADPH 3U2SA 4BV1A 1SYVA 4LSDA 2VZOA 1V3MA 3DX7A 2PDPA 2EG8A 5CJXC 1FDYA 3HPFA 3E5PA 5I66B 4UMBA 2F53D 1HT6A 2UY4A 3IARA 2JXMB 4R33A 2X0HA 3KBJA 5F6IB 4IHBA 4G8FB 2RR3A 5E0QA 4KWSA 3RPBA 5L7XH 2DZEA 1FVEB 3LS5H 1FTXA 2WB5A 3QDJB 4QG9A 4LARL 4W8AA 4CU8A 3EKGA 2O9TA 1W5MA 2HNHA 2IXVA 2WLLA 2WMJA 3UTTD 4B60A 4NM8H 4FXRA 2CHWA 1N7KA 2JVUA 4H7VA 1VJZA 4H44C 4OUUA 5CEWA 4YAQB 1YMYA 2F1BA 4M19A 2ISVA 3LX9A 5DD0H 5I3KA 1XL4A 4POZD 1KZQA 2FSEB 5CN2A 3GU2A 4I77L 3MV8B 3QC6X 4M3JA 2VLJD 2VM3A 1FYTD 3NABH 3DXAB 1QVOB 1S2TA 5M1TA 3PP3H 3PBMA 4D0CB 3QUXB 3QIWB 1WEJH 4FA3A 2CPUA 1ZS8B 4N2NA 3RWIB 1RK5A 3DX9B 5I07A 2DD8H 1GA2A 4IH3A 3MA7A 1OL0A 4X4XA 2PR4L 3A5FA 3PUUA 2MKLC 2WBXA 3HJ0A 3VXMB 5C7XL 1C1EL 5F4SA 5AYTA 4R6UA 5B1AB 2PXYC 2MCMA 4JQXA 5FHBL 3NL2A 2H9AA 2R9HC 5EFDA 3S36H 1AKJD 2EVGA 5BXRA 3ABSA 1Q6GA 4NAFA 2D2JA 3S3CB 3V6ZA 1BQUA 3MP5A 4I1RA 3AHXA 2DLFH 4AJYV 3OBKA 2UY7A 4PGCB 4GAYA 5LGHH 1IT7A 4PRDA 3DBNA 3FN0L 4R90L 4LW7A 2MNRA 2XSXA 3CN4A 3JZUA 5AB0A 3LKNB 4O50A 2O6CA 5JHLL 1BYBA 4Z3JA 1PFOA 3ARDD 12E8L 2VI0A 2E5EA 3TIEA 4LUYA 5J12B 3OA3A 4PRIE 4YDIH 4S2SB 2D4FA 4L23A 4PUNA 1CFNA 4KKBD 1WYJA 2VGLM 5H2BA 2AQ3A 3WL9A 3MREB 2ZYIA 4Z7QB 3MRGA 4RQQA 1N68A 3TASA 2FHFA 1MCRA 3L2MA 2IIJA 1N5AA 3VG0H 2B7DT 2TODA 2XWDA 1SFLA 4MQXD 2X5PA 1SYSA 1J5HA 5KTLA 4LH8A 3AQZA 1OF6A 2ROYA 2YSWA 3W26A 4GGHA 3BSHA 3MJMA 4TPRL 1AW5A 3UXDA 3TN6A 5A6BA 3KHOA 4HWZA 1AZNA 4MMZB 4CNOA 3OC8A 4F1SA 1AR2A 4ORGA 3QAZC 5BXFB 4IF2A 2HDJA 4GYKA 1FHUA 4MZ2A 1BM7A 1OTSC 5I1IH 2VRAA 3O6KH 4HH9A 2BW5A 2GJJA 2VC2L 3ZJ7A 3HG1E 2BSED 4JFZL 4X50A 1DJWA 3VSVA 1ADDA 3HHSB 4UTKA 1TO5A 5HA7A 4LCCA 4URIA 1MJUL 2I60H 4JFPB 5BV7H 1K4HA 4K68A 4IISA 1SF5A 1ALDA 1NUDA 4P57B 2WXRA 4KV5F 1RPUA 3EBGA 3LXUX 1LEGA 2XYCA 1ADQH 1XH3B 1XMWA 4L1GA 3H22A 4PCPA 1HW6A 5ABFA 4XXDB 3KOXA 4P5TB 3LCWA 3QJXA 1GW1A 1A3LH 5ACLA 3RWFA 1T3FA 1RP8A 5DZJA 5CIPB 1KXHA 3ZIZA 2HWZL 3V52L 1BYOA 3QULB 4R5XA 3C08H 2C3VB 5F7DA 4FIQA 4GKSB 2OCFD 4NQEE 3TDFA 2PCYA 4NRXA 2ZUYA 4F27A 3W73A 3SADA 1MWAA 3COOA 3W07A 3EAUA 1R2SA 5GZOA 1SVDA 4ABVA 2HTLD 2D7OA 1OF8A 5JQ6L 1U8QB 5AW5B 3RX2A 1TWWA 2HE8A 2J7GA 2OL3B 4HEPG 1RULL 3BGMA 2WHVA 5HHMD 2UZXB 3EADA 4WDTA 4YJZL 2HJKA 3ORWA 1OG6A 3TLRA 1R3IH 3W7KA 4TQHA 4CMHC 1DKWA 1I1WA 2IDQA 1IC4L 2VAAB 3MRFA 1BQSA 3VMOA 1AR1D 3VI2A 3HZMB 2Z25A 1OFBA 3MYJB 2VXVH 3C3UA 1A2YA 4OI7A 4UTLA 4V33A 1QPNA 3WLLA 4AX7A 4JIEA 4GG6B 4GIEA 2OMUA 4XKYB 5DUJA 3LD8B 2X1PA 4HUKB 4ZB0A 1FBIL 3O2DH 4AQ8C 1Q6QA 4CA4A 1BQHG 3N1AA 2DFAA 2YPLE 3PABA 1GXEA 1B3YA 4EQ3A 4IXHA 1JK8B 2CUHA 3VNZA 2WAGA 4RLIA 3QORA 4Y1AA 4NU7A 3AU2A 4XN7A 4JR9H 2JKPA 4YN3A 2Y7MA 3WH5A 5L4FA 4F48A 1WF5A 2YAFA 4ABWA 3KCLA 4F7KA 3EOLA 4PWGA 1PIGA 4IK6A 1EP2A 2CGRH 1S7UB 4PRRA 5L2KD 1IGFH 1HXKA 1WISA 3FA5A 4F8LA 1UXSB 1WQ5A 3TBCA 2MOVA 2UY6A 3EOTL 5CJNA 5C07B 3MRMB 3MQTA 3K2GA 5IOPB 2FEEL 2YO3A 4K3EL 4LCUB 4UFHA 5I66A 2KLSA 5CGMA 3TAOA 1SJHB 1US0A 2JXMA 1MNUL 4PG2C 4G7RB 3DPBA 2KQNA 3ARGC 4HJ0D 4G8FA 1NCCH 4AHQA 4LBSA 1FVEA 1TYEB 4F7PB 4XMLL 5KG9A 3QDJA 3W72A 3AS0A 1UPMB 4F0HA 2CR6A 4OD3L 5E2TL 4FA8A 2KS0A 4A6YL 3PYCA 3Q48A 4V1DB 4AV5A 4YS1A 2VXTH 2FNBA 2XT1B 4N68A 4Y9CA 4BD4A 1BZ8A 1ZENA 4N28A 1ZAJA 4F0LA 3CMOH 2WLMA 2PRHA 1PZSA 4YAQA 2JF7A 3OQEA 1E6XM 5TPWH 1JFXA 1U22A 4OLZL 5CEXB 4YOKA 1AQKH 4WWKB 2FSEA 1ID5I 4U1HB 3MV8A 4LYQA 2DYRB 3W2DL 4ZAKB 4ZMNA 3DXAA 1QVOA 5D9PA 4RWYL 5TQ0H 3QUXA 1K4CB 1ZS8A 4B9JA 3DX9A 4PJXB 4QXGL 1JI1A 4TSBL 3CSFA 2Y5QA 1F4YH 3QZAA 4C83A 3L9EA 3ZK0A 4FKHA 2GB2A 2FJUB 3HS0C 3HKFA 4PIBA 4QFUA 2FDBP 3BKCL 2B9BA 3VXMA 4DYKA 3U5YA 4NUGL 2HG5B 2YXVA 5C0DB 1UH4A 1F74A 1WBZB 2ED8A 3WY2A 4XOCA 1J9YA 2MCPL 1PJWA 1ZY9A 3KRSA 2Q3ZA 3CLFL 1XYZA 2CBTA 5BUPA 2AJZB 4KRPC 4MASA 3GX9A 3S5LG 4M43H 1HOCA 1BG1A 4PGCA 4P2RE 5I28A 5FI8A 3V1HA 1C8PA 1Q0XL 1O6SB 5GPRA 4XISA 3IJQA 4HA0A 1BVNP 4MXQD 1AH0A 4D0BA 2I57A 3TW7A 4G9FE 1W6TA 5GNXA 3FBKA 4NZ4A 2C79A 1Z3GL 3HGSA 2XINA 4ZMVA 5CPOA 5IDZA 1KLZA 4GX9A 1XL9A 3N85L 1I9RH 1H6UA 3MWAA 3PZTA 3MCYA 5TDOA 4KXDA 4DGVL 1HN1A 3RVTC 3BCJA 3L08A 4R53A 3DX8A 4E5XG 1X5GA 1XT5A 1GYCA 5EKYA 4I89A 5JHAA 3EB4A 3AGVA 4F20A 4Z7VE 4ODXB 2GBAA 4C60A 3BYYA 4GXUM 5MI0C 2EIZB 4DUOA 5HVGB 4WJEA 2DW6A 4XCEA 2YEQA 2ZADA 1KCUL 5GRWA 3HMWH 2ZUVA 1TWIA 4X7FC 3LVTA 3SYPA 4OTXL 5DZAA 3V4LA 1BAGA 3W1TA 4MMZA 4L6OA 5E2VL 2QZ5A 4UNKA 2V9UA 3KBVA 3MJGX 5GGQH 3SB0A 4PV8B 1KFLA 5E6RB 4NFDA 5JIWA 2TYSA 1PSCA 2HK0A 4EX4A 3U8GA 3DHUA 3E6FB 4Q4PA 1YE6A 3QPQD 5L6YL 3QS2A 3G5VB 3UYCA 5KANG 5F70A 2PP9A 3QZMA 4N9DA 3CL7A 3HI6H 4QXUL 3WS3B 4ONFL 3KRUA 1HILB 2QV4A 4PA8A 2WTPA 3NEOA 2J47A 3V7PA 2BLEA 4P57A 4IKKA 1M6JA 2K7QA 5I23A 1XH3A 1WC7A 4Q8MA 2J25A 1O7DE 4XOBA 1P5VB 1NCUA 4AZCA 4P5TA 5DYOB 4OIFA 3ARVA 4X6EA 2B4CH 2F2HA 2GTZA 3CQ0A 4G7VL 4UTBA 1R9YA 3GBDA 3KP1A 1BWLA 4KKLC 4YFLF 3THQA 5AC7A 1QW8A 4W4OC 5HDRA 2GWNA 3PS7A 2ESVB 2EUWA 3QA3B 5CIPA 4Z1AA 3P02A 3PQYB 2FGBA 3Q6GL 4NQ1A 3QULA 4GKSA 3MNDA 3S5LB 1TG8A 2Z91B 1MNZA 4GNKB 3FQYA 3EMCA 3T3PB 2VXSL 5FOBA 2OZ4H 1U8QA 1GYNA 3AQXA 4JFTA 3WD3A 4IGMA 1IIIA 2C9QA 1A0QH 4MQ7A 1Q94B 4EWND 1IE4A 1KB9K 3PTMA 3AJ7A 1GWJA 1S7RB 4RMSA 4MCZA 3PG2A 3VXPB 3O4OB 5FF7A 4IBYA 3WXWH 4OVVA 2WMPB 2XSBA 5J6HA 2DQ6A 5AVWB 2WKJA 4Y2DD 3KNBB 1JGUL 4HHWA 4KWWA 2VAAA 3T0BA 1XLMA 3HZMA 1ODUA 3MYJA 2R0KL 4XGZA 3L4YA 3ULAB 4XCCL 1E71M 4XKYA 3TSMA 4JEQA 3ZMEA 2ZXAA 2XIBA 1H51A 1JNDA 1BW8A 4B9YA 3J2PA 4PY8J 5FK9B 1CG9A 4TF4A 3H9SA 4YPJA 5IHRA 2F53B 2AJUL 1W5OA 2DKSA 1JK8A 4LRIA 3W2NA 4EBQL 2YPVL 3IVKA 1F73A 4QMEA 2VELA 2WHJA 1IWAA 1N6VA 3E0GA 4FXTA 3MBDA 2XTJB 5T91A 2DQDL 4O0KA 2FO1A 3VNKA 4FJZA 3UTTB 4DWSC 1NL0H 3HURA 1DQML 4RV3A 3OVRA 5EMUA 1P43A 4HKXA 4ZTOH 3EOBB 1MCWW 4X0NA 2E74C 4NKMB 1UW9A 1EGZA 4I7VA 2OYMA 5A6BD 1HVQA 2O72A 2I69A 3QR1A 3LPOA 4LSUH 4AXKA 2VR6A 3MRMA 5IOPA 2CCWA 5JZ7D 4NC0B 1YMHA 5L4IA 1FYTB 1QO3B 4UXDA 2G3NA 3LZ3A 4HPJA 3T55A 2OS7A 3FCPA 3KYOB 1SJHA 3WTSA 4LPWA 4NKOA 2IWEA 5IKCB 3UO8B 3TN3A 3C2AH 4PJDF 5JW4R 4NQDE 2AJXL 2ATMA 3NYDA 1A1MB 3D0LA 3MSDA 1M2VB 5ISZE 4HJTA 2ICSA 4TR9A 4X4KA 4DK5A 3MRPA 4N2AA 5D1QC 4JFOA 3RIAF 4ISVB 3W7JA 2XPGA 1H15A 1Z8AA 5E7FA 4DO7A 1T8XA 5CEXA 1BVLB 5LYRA 3S1VA 1AKJB 4OZIF 4QUOA 2BSLA 4HEPA 3W3BA 1MQKH 4WWKA 3N11A 3BZ4A 3OKDA 4U1HA 4HCDA 2HKHH 5JYLA 5ANMB 3O0LA 1UA7A 5FKAA 4HWUA 1GJUA 4ZAKA 5DT7A 1QT1A 4XIAA 3VE0B 4E2OA 3DV6A 3L0GA 1GKOA 1IZJA 4JG9A 4NAQA 4IP5A 1H1YA 2Z26A 1HHIB 2WQAA 2QJNA 3GHSA 4PJXA 2A4EA 4QAWA 3QHFH 4C6FA 4XNAA 4M5ZH 4U0QB 2AC0A 3BCFA 1MFDL 3VW3L 4RNFA 1JZIA 3QXBA 3ARDB 5DJ6A 2BP0A 3HC2A 5GZOD 3F2LA 1ZIBA 4TNEA 2CNCA 3CLEL 1BQHA 2A9MH 3D51A 2Z29A 1KYAA 4KFZC 3I02B 2XZ7A 4MJ4A 1WBZA 1IBGH 2XC8A 9PCYA 4TUFA 1TTAA 5J56B 4X4ZA 3RNQA 4ELKB 1F4HA 2AJZA 4MXVF 4JTAA 4YHLH 1UADC 2FWLB 2CIKB 4PTWA 5D1XD 3HN8A 4KU1A 1O6SA 2ZRUA 1UQSB 3MLUL 1P4LB 1BZDA 2AGJL 3WF0A 1Q9OA 2MTPA 5A5WA 4UTCA 1UCBH 2BM3A 4URTB 1ME8A 1NM9A 5IT2L 1OD9A 1URLA 1TJXA 1RPKA 4RMUA 3W39B 5I5IA 4MY9A 4OGZA 2EXWD 5HDLA 1LOLA 2DLIA 4P23C 4Y2OB 4PVBA 3MA8A 5D33A 2Z9TA 4ZFGL 1XV8A 4RFOL 5HUOA 1H50A 4N4PA 5E0CA 2NVCA 1S5HB 2Q20A 3PRZA 2QKIA 2B08A 3BUDA 4OOZA 4P06A 3R1ZA 4PRAB 5XIMA 2F19H 3KVKA 4NWUH 4F5CA 2QELA 2H1XA 1ZPLA 5F0JB 4NF7A 2DQGL 3UOAB 1H6TA 3R0UA 3KFTA 1CF8L 3COTA 3FFOA 1EMTL 4K8RH 4CDHA 3OJMB 3TJXA 4KTYA 1VFSA 5JUEL 2CBVA 2G3ZA 1GVRA 3E1ZA 3MLVH 3CAFA 1EJ8A 2R1MA 3W9ZA 2OJEA 4AHOA 3NJXA 3B2UD 4KQ3H 5E0FA 5FB8B 2O61B 3CN1A 2GGJA 2JB6A 3UTPE 4Q8TA 1HXJA 4C6NA 4YCPA 1YDPB 3UAJA 4BQ3A 3ZHFA 5EUOE 4OFCA 4XNMB 5ESVB 3U2EA 3G5VA 4DT2A 1DTUA 1ZK5A 1NCOA 3DBXA 2BOCB 1ZBCA 3WS3A 1QAWA 3MUY1 2E4TA 6CGTA 3ECQA 3N2XA 1WOBA 3JV5A 4LL9A 3ERPA 4CN6A 3LRGA 3UW6A 1KJVB 4DF9A 3GH7A 4XPAL 1PEWA 3PHQA 4YBHA 3KX6A 4WO4C 4G70B 5EU4B 1M7PA 4X7SL 1VLXA 5HHMB 3BPLB 4FS0A 5DYOA 5D1QE 4O0ZA 5T1LA 1V77A 3C60D 3LRLA 3P14A 3GSVB 1JF1B 4M7ZC 4Y19A 3PUDA 4KY1H 3LK6A 4L1BA 4ERGA 4FNLH 1AR1B 4U6YA 2F7OA 3AUOA 3H3PH 5EZJA 5DY3A 1FNAA 1UG6A 4QLRA 5KEZA 1G94A 1SFDA 1J86A 3APYA 2Z0IA 3D5HA 3GIQA 1T5WA 2Y85A 3VOCA 3S5LA 4UCFA 1BAWA 5JDJA 3GMRB 2G95A 1ZHNB 3W7CA 3STGA 1JZFA 3V10A 4ZZ9A 4WI6A 4RPQA 3IMWA 2YXOA 1WZAA 1Z5HA 1VIWA 1OX6A 1TPXC 1H0IA 1PIIA 3DKHA 4TQTA 1S7RA 5AVZB 2BK8A 3EGXA 3DMMC 4M5PA 3PAVA 3UJJL 4NY2A 4JQ3A 2FYVA 5F6HJ 4E5XA 2NQCA 4YHOL 3RWDB 1OB1B 4UNLA 5I6OA 3QT2A 2CDEB 5L2KB 3IIPA 2NSMA 3RUGE 2JCCE 5DHVB 1P6WA 1LP6A 1D6VL 3AMCA 1IFHH 2BHYA 43C9B 2IQ9H 3QOKA 3A4EA 3IK2A 4YVXA 3I7QA 2E9MA 3VXUD 2XFXB 3DFSA 4BK4A 3UXFA 3K13A 2FIKB 2Q6ZA 2IGFH 2WW8A 4W9ZA 4A6GA 3REVA 1UR0A 3ZJ6A 3APMA 8FABB 3S88L 1JGEA 1DWHM 2PPEA 4RBPH 3T04D 1UH3A 5C0IB 3X14B 1H3TA 4YNYA 5E24E 4FQ2H 4NGHH 5D7IB 4M8UA 3U2JA 4QRUA 1HAWA 3B8DA 5KS9B 1KBIA 3F65A 2XSKA 1PJ9A 1KOAA 2YQBA 1QATA 1PG7L 4L5FE 3DO7B 1W0WA 3G6JE 3IXAB 1UOLA 5CCHE 4F9LC 4MJ6A 2CU0A 3UTTA 1YY9D 1ADOA 2NCEA 1TENA 3OZPA 5HOSA 3PWVA 3NCJH 5AW0B 3THAA 3S4TA 5A8OA 4KKCC 4YLBA 1IQ8A 3KM8A 2A3AA 4Z7UF 4NKMA 1KLFB 2XI9A 5HYSB 2IQDA 3H21A 2W60B 1NH6A 2OXNA 3SKJL 3DGGB 2WZIA 4QHRA 4BF7A 5HYEA 1OT1A 4K71C 4N9GA 2VLJA 4NRZA 2CA3A 3ZHLA 1NOLA 3FT2A 1FYTA 3ETTA 1QO3A 3QR2A 3SE9H 2YCJA 4YXKH 2GTQA 4PE8A 3KYOA 4H8WC 4X7EC 2QPUA 3K6SA 1U58B 4W9DC 2HVKB 5IKCA 3T8QA 1PZCA 2VMFA 3VXNA 4W9EC 2OMBA 4YIQB 4JRYE 4G7SB 4AD4A 5B7ZA 5DJ8B 2OLSA 3QCTH 3W88A 4KNSA 3MRDA 1G4EA 2AQRA 5DK2A 5I0YA 2QFRA 4RMVA 5D72L 3O41B 3R4IA 4PTNA 3N43B 3BW4A 3LEVL 4Q6IC 2W0FB 3UBGA 3SD5A 3WUWB 4UILH 1G6RB 4NWTH 4Y7OC 4Z77B 1FXQA 5E1AB 2YMXL 1RQBA 4E6MA 1OTUD 4JQ4A 3AIRA 1YLVA 4RMBA 5ABAA 1S2VA 3ARFC 1KCXA 1NICA 4IP7A 4GW4A 2JQXA 5CEYA 1DL7L 4YHPA 2DL2A 2NY2C 3P2BA 2X6VA 2PTTA 3N4FA 5XIAA 3T6QC 4TLKA 2G2RA 1ETJA 4NO5B 1Y07A 4HUXA 3ARXA 1YMME 3BGGA 5GS1C 1R5YA 3T8XB 2HX8A 1W9PA 3FJLA 1B3XA 1UVQB 3BAJA 1XGQA 1I1AD 2C8NA 1QD0A 4KFOA 4QRQA 3VWJC 3SE8H 3WBEA 1XGZA 2BS8A 5G2WA 4D6CA 4C6LA 5I24A 3TQKA 5IMMA 6FABL 4IG2B 4QY8A 2IPFA 3WBXA 1J9QA 2GQ8A 5HNUA 2CBOA 4ADSA 3TO2B 4IS6B 4MNGB 1S2EA 2WQDA 1HKMA 3NA4A 3PK7A 2EXOA 2R23B 3GM8A 5LAPA 1UWGL 1P0DA 2AP2A 1GYAA 3VZXA 4O2FB 2OZTA 2QUNA 4RMRA 2AHIA 1GJPA 1UQSA 1HJUA 1P4LA 4TUKL 4YQXH 4OJDH 3FJ4A 3MSPA 4MHHI 3IMRA 5C6TH 3GI9L 1GGIH 1UBSA 5J6GA 3GW0A 1CTMA 3C8FA 2QIWA 1SYVB 2W0LA 3W39A 4WW2F 3HCVA 2Z6JA 5GS3A 2F2KA 3WUZA 4Y2OA 1PVHA 3H9SD 4DKFL 1S5HA 4GQBA 1HL4A 3B83A 2VGIA 4XVEA 1S2WA 3TT1H 4IKLA 4IM4A 2HKFH 2D20A 3FTYA 4X9BA 5BZDB 5IESL 2L7JA 4RKAA 2XVKA 1EJRC 1JZDC 4DGWC 4PYHA 5TDPA 3NGBC 4OLVH 3B2VL 3VFOB 3UZ5A 5JHLA 4NIRA 2A83A 4PQXA 1NMBH 3VKBA 3ID7A 3B8UA 3O3UN 1TG7A 3U36B 3RX5A 2OGJA 1W6LA 2C1GA 5F9JA 1NBVL 2O61A 1PU0A 3RO6A 4HJIA 1T4KA 4JQAA 2G0WA 4DP2X 1ADWA 2XH7A 2Y62A 4BF9A 3ZE2E 5A3ID 4XNMA 5ESVA 4RK8A 4IMLB 1A7BA 4NDMB 3O6LL 3TPKA 4UNUA 5C0FB 3MA7B 1XBVA 3BG3A 4X4XB 1GKEA 3SGGA 3LNPA 1R3QA 2GDVA 4YK4B 1JAKA 1JWMB 1L9SA 1A4CA 4WV1A 1NCTA 3LXAA 4YH6A 4ALAC 5KYXA 2W59A 1HK6A 4HUCA 4NJGA 4AWJC 3U4BH 4LSRL 5F7BA 4U1LB 4XVJL 1J88A 4GRWF 5LA2A 3N50A 4XD5A 4FC3E 3U2ZA 2Z34A 1JPTH 1QNPA 1Z69A 1OCRB 4GRLC 3GSVA 4I9XA 3MBFA 4YC2C 4Y2DB 3QQ9C 4NAFB 3RIAK 1HP5A 3VGAB 4RXGA 3TCXA 4QM1A 3V6ZB 5I15H 1H11A 3GIYA 3PNRB 4Q4SA 4LF3A 2JEQA 1RIVL 4GAYB 4YHIA 3BPCA 1U9KA 3LMJL 4PRDB 4M6NH 3HI5L 4J23A 4JQVC 3AYTA 3GMRA 2X87A 2BIPA 4NZUH 1JFQL 2Y7FA 3H7UA 1G9MC 4QNPE 4G7YH 3WK0A 3DNKA 3QLDA 4G6CA 2FWOB 2PEVA 4FI4A 4S3KA 4RDZA 3TIEB 4JTUA 2DQHH 3UPCA 1OM3H 4GK8A 4FNTA 4BWUA 5AOJA 5KTEL 1ID2A 2H26A 2K3TA 5FHAH 2AQQA 5H2BB 2JTYA 4UB0L 1YTDA 4L3ED 3ZJAA 2PD9A 1RZKC 1OEPA 4LSVL 1ONRA 3NYKA 5H4ZA 1N5AB 2R27A 1OB1A 4RZKA 5L2KA 1SYSB 1KFBA 3RTQC 2GJ6D 1REIA 5C2GA 5IQ9A 1KIRA 43C9A 3RFRA 2L7QA 1UHVA 2PA6A 5IMOA 4A8IA 1XF2A 3KM1A 3K5XA 3R8RA 3QEQE 1JF5A 2AEPL 3CN0A 4ORGB 4N25A 3UR2A 1ZGLM 3UJSA 1MY7A 4BYHA 1QSFD 1VLIA 2IQ0A 2EIDA 4HH9B 4OGXL 4XMPL 3X14A 5H2ZA 4AQAB 4JUTA 5G4OA 1ZBVA 5D7IA 3P73B 5DJCB 3HNSL 4PJHA 5PAZA 4M1RA 4LCCB 2C3WA 3PJUA 3PWUB 1I7RB 3T6WA 1QNSA 1SDDB 1XQKA 1VGEH 2DTML 3P8IA 3UGVA 5IHUH 2V37A 4KOCA 4QD2E 2PWUA 3WQWA 2O6EA 1PZBA 5F9OH 5XINA 5ERWA 4I87A 1PX4A 4K36A 3JUZA 2G2PA 1FE8H 5ABFB 1W31A 1YYMH 1KLFA 2W60A 1FH5L 1TQVA 3LNDA 2HXUA 3EPMA 1SLUA 4KAQL 1HYSD 2WUBH 1BBDH 3SY6A 2BHUA 3W84A 1ET8A 5AC6A 3RWFB 1P7KB 1RSYA 3H2CA 1T3FB 5AVTB 5DFVC 2GDQA 2JJTA 3MDWA 5FR3A 4JFXB 4OU1A 1PIFA 5DK0B 4L9YA 2B0SH 1OWQA 5D05A 4F2FA 1BZOA 2HVKA 2HJPA 2CUMA 5DSCB 3Q2NA 4J5NA 3DJ9A 1SVZA 2MPVA 2IDTA 3EOUA 2ZXDA 1RJYB 3STCA 3QISA 2QYGA 2NYZA 4PW4A 5IB2A 3DI2B 4JDEA 3MV11 2LVEA 3HB3B 3HUJF 4UM9D 1GR7A 5I1KH 2PYEE 2W0FA 4B5WA 5EZOL 1G6RA 1IHIA 2HT3D 4LSPH 5E1AA 3WMPA 2A6IA 5LIUX 1EZUA 4Y19D 2VR7A 3VTRA 1RHCA 4AY7A 2KLTA 1TFVA 4IIEA 5D1XB 3MRFB 3O6FD 5I6KA 2ZCKL 3EBHA 3F4VA 1A2YB 3SDCC 2QMKA 4ADIA 2PTXA 4A6YA 5DZOA 1INQB 3C86A 3QHZH 3NK3A 4GOAA 3ATFA 2OMUB 2CNZA 1VP5A 1WZ1L 3ZWTA 2X2YA 5BOFA 4LOFA 3RPMA 5LXEA 3QEHA 1PAZA 2E9IA 3B5TA 3CV2A 3I6EA 5EMJA 3S34L 1AXTL 1NP0A 2D7PA 3SD2A 3AYRA 5DY2A 2VDPL 1EF2A 3PABB 5FJIA 2PGFA 4B91A 3REQB 4YSRA 1D8WA 5GRVK 1WAUA 5IBXA 1ZVNA 4J3VA 1IZCA 3F7KA 4PCSA 4C4KO 5D09A 4YGAB 1WNOA 2RA1A 4Y1AB 1QSEE 4IG2A 4PRHD 5EOQH 3F7PC 5CCKL 4NZCA 2BFVH 3TO2A 2VWTA 3L3GA 1CXEA 1DQXA 2DH3A 4Y4KD 3MV7A 4JPKL 4EIZC 3L45A 1BXAA 4RL3A 3CFCL 1G7JA 5D71H 2YZRA 4O2FA 3SE3A 5I0ZA 2B7QA 5G1YA 4E38A 1S3RA 4BWTA 1YPXA 5H94A 2GJPA 3V0EA 1EQWA 2UY6B 3AWOA 1CDJA 5HJDA 2GPTA 2LAAA 5D6DC 2V7NA 2Y9RT 2I9EA 4ELME 5T3XL 2GIYA 3QYCA 2CALA 2V3EA 4ZMYA 4JHBA 4BIKA 2L4OA 1RI8A 4TLTA 4WI3A 1E8YA 2CJTA 4EN3D 3VI3E 2PI6A 2QVTA 4CQ9A 3DPBB 4GFIA 3GHPA 1YRRA 3OC5A 5T5FL 2BNUB 4O18A 5GRVL 1A66A 2PDWA 2FBJH 1NUGA 5BZDA 5KG9B 3KPQB 4W9FC 3TW9A 2CCVA 4AYID 3VC5A 1BWVA 3VFOA 3F2DA 1Z5YD 1W72H 1JGDA 4A2MA 2X40A 3DKJA 1Z32X 4Q33A 5CD3A 1AHWB 1UWTA 5DJZA 3B9NA 5IEHB 3U36A 1DANT 3C60B 1ZE3H 2DZTA 2OJ1A 2UXTA 5CFHA 1NQ6A 3LI1A 4HJWA 3SCMA 5ABDE 2OODA 5JXQA 2LFEA 4DSYA 5JQ9A 2OOFA 4QITA 1JPHA 4HSOA 1U8MA 4HNLA 5EL1A 4IMLA 2P45B 4NDMA 4FQLL 5C97A 5CGYD 1ZP4A 5C0FA 1ISVA 4HHPA 2D2OA 4XMUA 1MI5E 3LHPH 3H24A 1JWMA 4C83B 3V0GA 3IDUA 2A77H 2PTWA 3UGEA 3GDMA 1LLAA 3QHMA 1TFHA 4W5ZA 3U9WA 3N1MC 2XH4A 4U1LA 3FZUC 3BLFA 3F12A 5T3XD 1XDMA 1GQKA 4GQ9H 3QXUA 3BE1L 3ATYA 3E12A 3PJTA 4S2BA 4Y2DA 4I3RH 1ONQA 4NCC2 2RBLA 3AADB 4N1CA 4R3UA 4N20A 2E86A 2IMMA 2W62A 2W9DL 4XTIA 3DFPA 5TQ0L 2D1ZA 1HOCB 4XWOD 1GOOA 1WA0X 1F3TA 4JNMA 2QCGA 3VXUB 4GGBA 3HZKB 2PAJA 4ANWA 4D0BB 3TYAA 1P6CA 1WXYA 4X5PA 3GUGA 1LOQA 3O16A 5F3HA 2YSTA 2FWOA 3LZLA 4H9MA 2I26N 4BKSC 5L8KB 1A5UA 1CE1H 5TDOB 1FKWA 4HEME 4MSWB 5IM51 1M7DA 3DX8B 2VDKH 3NUKA 5AECA 3IAPA 3MRNB 4GXVH 5BOJA 4GO8A 2G2NA 5KVDH 4M43L 3TWCL 4IIQC 2ZA3A 3GSUB 1IAKA 3R8BB 1BWKA 1YHPA 2ZP9A 4HQQH 1RH8A 2GJZA 1RMFH 1FL3A 5F7UA 2N59A 3NJHA 4XNUH 4DQWA 4XCEB 2AQTA 4C55A 2V5BA 3SO3B 1NGQH 4ZODA 4Z18A 4KROC 1RUSA 3VWKA 3KVJA 1I60A 1HKJA 3UA3A 3FH5A 4M8RA 4OVXA 4AQAA 5J3HC 3RJXA 3P73A 2JB5H 5DJCA 4FQPA 3PWUA 1I7RA 3F85A 1YY8B 1I8AA 1SDDA 3Q2LA 4GP5B 4N6FA 1F6KA 1EVTC 5EOCJ 4B5NA 3H42L 2A2QT 3AG2B 1KNOA 1BQGA 2W9LA 3D12B 2A3EA 4BWLC 1WC7B 2KQMA 1NLDL 3C8DA 3LQAC 2WKLA 4D9LL 4KXAA 3BXNB 2VFGA 4AZCB 3PUCA 3L2LA 5D8JH 4X6EB 4L3AA 3T07A 4OM1L 1J1OL 5AZEL 3SDXE 2GTZB 4JO3H 1TU2A 2JKIS 2YPVA 1FHDA 3CIXA 4DYEA 4KJYA 1P7KA 3EH1A 2RDTA 3ANVA 4A55A 4KK8D 2RD0A 1V7NL 3IAGC 4AQZA 4J6RH 3WD0A 1CK0H 3NOYA 1K72A 4HF5H 1RUPL 2PETA 3NSYA 4JFXA 4ZB2A 3WCZA 5DK0A 3A4XA 2QDHA 3WO4C 4P7QA 3OZYA 5DSCA 1WRFA 3TR2A 1YEGH 2QUTA 5EH1A 1A3XA 3V4VH 1S7XA 1RJYA 2NXHA 5FOBB 8TIMA 1ET5A 2A74C 4JGDA 4MD5B 2FJHB 3F01A 3FO2A 4GYPA 1F76A 3H6JA 1T1XB 3SJ3A 3G77A 4MQ7B 1FSKB 5D9MA 1XXXA 3DRTA 3GQFA 2W95A 4FNUA 2DT3A 1RLDA 1PLCA 4GSUA 1TTFA 4MCZB 4B9GA 2FX9H 5J6HB 4BDVA 3EFOB 1WDDA 5K1VA 3GDTA 5DTFA 5D1XA 4XE0A 2OI9B 3NFUA 3N2TA 3LBMA 4PEEA 2B39A 3F8UB 4BELD 3GLCA 4FFYL 4PJ9C 3NAAH 1E8ZA 3FUKA 3EH4B 4XGZB 5FSEC 1INQA 1OK6A 4QTIH 4XD4A 3MI3A 3MRCA 3H55A 4MDRA 1FY6A 3EO9L 3K5SA 3QH3A 4HETA 2EG7A 3OVUB 1XCFA 1CG9B 4HWNA 2J62A 3HM7A 4UT7H 3H9SB 2IBGA 1ICSA 3OXSA 4FYSA 3GZOA 3REQA 2WQRA 2B16A 3IVKB 3M4HA 2WSKA 4KO7A 2PDYA 4HZ1A 1G9NC 1T2QL 1GMEA 4B5SA 2XVNA 3T8VA 2DZBA 1O5XA 4W84A 4OUOA 3QQ1A 3T40A 2FGWH 1OVZA 1ZD6A 2BJMH 3Q01A 4U7SA 1W80A 5CINL 3IFPB 5I5MA 1V5XA 4DJDC 4JK0D 4A68A 3DI1A 1TCRA 5ELIA 4HKXB 2FIQA 1UACH 3C2YA 5DMGC 4JN6A 1QKZH 4KI5F 1IWPA 4QXWA 1QWUA 3EGDB 4H8NA 2CUAA 3WSQH 1EJFA 4U3SA 1YMHB 2JKLA 1VJIA 1WWWX 2X7WA 2D9QB 1HCVA 1NC2D 4FABL 3RK8A 5BW6A 3L4TA 3WXVH 1MXDA 1HO1A 5DMKB 3V6OC 4D6DA 1KBLA 4EUPH 2NY0C 2BNUA 4NKOB 2WJ5A 4XCFH 3P9LA 1FHGA 3LCLA 4RGND 3KPQA 1FXPA 5EU6E 3D0LB 1L5GA 2AQPA 2BH0A 1F58H 5BU6A 5J7CC 1KV3A 1O7DC 4I90A 3TEYA 3MRPB 1OGGA 3VX1A 4JFOB 1AHWA 3W1ZA 1Q7MA 1VCVA 3SPHA 2XPGB 5IEHA 1JE6A 1CU4H 3C60A 2XWTA 1H15B 1GG0A 4UQ3A 4KESA 4JFEE 3UT0A 3BZ4B 3OKDB 5A95A 5FKAB 3BANA 3D47A 3KTXA 3OLEA 1NFDE 1K7EA 1YAIA 3BRGC 3DV6B 1KR1A 3BH4A 2OCZA 2FVLA 4LCWE 1KM5A 25C8H 3X3FH 4A8LA 2WLZA 4MNQE 3SDOA 3D85D 1W32A 1C5CL 5DELA 5DJ6B 2KZWA 3AFLA 2BP0B 1WWCA 3RX3A 4UUJA 3KLQA 1RZJL 5D70H 1BJ1H 3M43A 1BQHB 1I2PA 3BDYL 5DT1H 2X6MA 4TSAL 1OQXA 1GJWA 4JO1L 1HJCA 1J0JA 3LZFL 3NBNA 2FJKA 1M7JA 1H0DA 3IXTA 1BEUA 3RNQB 1LO3H 5B1CA 5HPOA 4H9TA 1BWWA 3PANA 4ZBJA 4PCFA 3T9WA 4EI5D 4MMWA 4IRZL 1DWAM 2GJ6B 3EYVA 3H2FA 1YHTA 2VXQH 1UA6L 3W6MA 3VXUA 1OF0A 3HZKA 1RK1A 1KEMH 1Q9OB 4X98A 3GHTA 2EUVA 4D3CL 5BRZE 5CZRA 2X1OA 3T4AC 1BM3H 4HS3A 1MLBA 1QSFB 1MRFL 5HDBF 1OWWA 5MERA 4RCAA 3SIMA 2NY4D 1XLJA 1D2PA 1X5XA 4N90E 3VQLA 3QUZD 3I4KA 4RNJA 1RJQA 5F1KC 3D3VD 1A5KC 1MWOA 3CT7A 1IBGL 4MSWA 1KELL 5DXXA 2QKIB 1XAKA 4M00A 3MRNA 3PBVA 4AUBA 2Q3XA 3T1GA 4C54A 4BHYA 2WQSA 1A7PL 1RBLA 2XCMC 4W7VA 4S1DC 5EGRA 3GSUA 4XHJC 2ZOLA 4OKVB 3SECA 1Q72L 4E42A 3WG6A 1IEAA 1AC6A 3MV7D 4YDMA 3VDHA 4ATLA 1OWRM 1XIDA 4QSFA 1WCQA 1W15A 4PRBB 1SXNA 3FS9A 3O0KA 2MRYA 2OJEB 4G8TA 4YE4L 3HG0A 2PP7A 1PZ0A 2JB6B 1KEGH 1W54A 1F8IA 5JA8B 1XF0A 1S5TA 4QYAA 5AY7A 2YW4A 5C7VA 4DK3A 2P3YA 1U21A 5KWYC 2KX9A 3U7BA 1KCVH 2OBGA 1VZIA 4OM0H 3FU3A 5F7MC 3DBXB 4GZEA 3EH5B 4KOBA 1PZ3A 1YY8A 3NEEA 1WZKA 1B4EA 2CETA 3V6OE 2O26U 1A5MC 4OZFH 1TQXA 3EGSA 2HWGA 3GDBA 4LEXL 4YS4A 3PHQB 4LRTA 4LVNB 4IBZA 2YS4A 2VZ1A 3MNWA 2ACQA 4PV9B 3PZOA 3BXNA 3WDHA 4AIZA 5T1LB 1EC9A 1PGRB 2ARJB 2D7NA 4FQXC 3U7WL 1R24B 4Y19B 1J93A 4YMPA 1S1PA 2IBBA 2HMIC 1VEOA 5ANHA 4K94C 2Y6SD 1JAEA 3SCMD 4U6YB 2OW6A 5EZJB 5AFAA 4N5EC 2AK4E 2E5DA 4PWIA 1T5WB 3AITA 1I7TB 5B3JF 4CCCA 3SOBL 1GVIA 4BK8A 3DOSB 1E51A 4C6JA 3KGRA 4X2UA 2ETWA 1EAOA 3FV9A 4LUSA 1EJXC 2ZDRA 5FGBA 2AEIT 4UMCA 4YVUA 3QMSA 1I1AA 1NLBH 4WFEE 4MD5A 1DEEA 2FJHA 4LQ1A 1T1XA 2IH8A 3E8UH 1R3JA 3V35A 4RZCB 1MXGA 1S7SB 5MKGB 3N40F 1H5BC 4KW2A 3MRQB 3EGXB 2YKLH 4PRHB 5TE7H 4R5VA 3V8CA 1PZAA 4U4BA 1H09A 4Y4KB 3EFOA 4WHYH 4JE0A 3CH1A 4E5XB 3IN2A 4E9SA 3Q06A 3D18B 3K2UL 1I8LC 5EA9A 2IDUA 3UYRH 4DJFC 1RZFL 2HXTA 3V0JA 1DWFM 2HH0H 2X0VA 4US6A 3GPEA 3ME0A 3FHEA 3GXNA 3CNKA 1ZIAA 1YNKH 2Y3AA 5HP5A 3REVB 5IJVB 8XIMA 2Z65C 2G97A 1JGEB 5FJJA 4Z1PA 2FB4H 2NNCA 3NJJA 3KWTA 3LZOA 1I3GL 5IQ7L 4ODTL 4YNYB 1A14H 5ENLA 2XETA 1T7XA 4EN3B 3VKAA 1BVKB 5MP6L 3W70A 4QRUB 1TTGA 2NX3A 3HLAA 1AC0A 2P0IA 3UBPC 2A0LC 1E5YA 3QPEA 4C4KT 1ZU8A 2C9UA 5DC2A 1W0WB 4RGMC 4MJ6B 2NW2B 1GT8A 3RDTC 5DC0A 3PWVB 1S7TB 2C34A 4YLCA 3PIQB 3RVWC 4HLZG 5I0WA 1KCSH 3IFPA 3HB9A 3OPZL 3WMLA 2VDPB 5BW7C 1TXKA 4IU3A 3VWKD 3RXZA 3V9FA 4XNYH 1T0OA 3L3IA 3EGDA 3WLOA 3QI9C 3O9NA 3BYTA 2FDMA 5DUBA 4N9GB 5JOFB 2VLJB 4NRZB 4JOMA 4GINA 3FT2B 3ZW3A 5LHDA 2Q2LA 4F93B 3BVXA 5GJSL 1P7HL 5LN4A 4MPQA 1Z5LA 1MEWA 4LUTA 1A3RL 3K6SB 5DMKA 3CT2A 2VR8A 5FF3A 2J1YA 2DVUA 3S46A 4WSKA 3VXNB 1CECA 4OY9A 2I27N 2R2HB 4IPPA 4PJFF 3MRDB 3KCOA 3V3WA 5DK2B 5I75C 2QGDA 3QM3A 5DD1L 1QFOA 3U1QA 4AU0A 4S3JA 2FQGA 1EEYB 3NACL 4UTTA 3TR9A 4LQFL 1A6AA 2X1IA 4UOJA 4PB0H 4ZUWA 3VACA 4AQ1C 3QUYC 4PJ7F 5PTDA 1W1ZA 1B3WA 5F89B 4DVBA 1TO3A 5HHQA 2I5YL 3W5NA 3OYZA 3CU2A 1IT9H 4PMEA 2LE9A 4GC3A 4Q22A 1JHKL 4GW4B 5CEYB 4L8SC 2XVGA 3HPAA 4YHPB 3HNVL 4CD8A 4HJ1A 1UWIA 4WEVX 1QHPA 2PTTB 3GG0A 1OP9A 4PJGF 3S97C 4ML9A 2G2RB 4OCMC 3F6LA 3UZJA 4ODVL 2E0PA 4P59H 1K6QL 3CSPA 3THMH 4HUXB 2AKMA 3KVQA 4PMFA 5D4QA 2H45A 1WV2A 4W86A 4NLHA 2W79A 2CO4A 2ZUQC 4HWBL 1G7VA 1XGQB 2R2EA 4B3ZA 3JWOC 3EWYA 3QHNA 4I5XA 4QRQB 1UR8A 1UM5H 5DMIL 3DTUB 4L3EA 1Z9PA 2J7EA 1X9QA 1GW6A 1T5KA 4MD4A 3VFTB 5IMMB 4QY8B 1WFOA 2MSPA 1PTZA 2ZSWA 1PX8A 1UUSA 4MDOA 3EZ4A 4GNVA 1KKOA 3V0WH 4KZ0A 4S11A 3AXIA 5FEBA 3IM1A 3WH6A 2Z2BA 4B53A 4Q9QH 4AMKH 1TREA 2GJ6A 1H3GA 3N2JA 1GZJA 4PBDA 2PURA 4KFNA 2J88L 4M1DL 1TUPA 2D03H 1OG0A 4GSDH 3WKPA 4QT5B 4LOEA 3BCDA 5IFAL 1SOQA 2FB2A 2ZAGA 4YDNA 3FT4B 1PKLA 9RUBA 2ZZ3A 1JUKA 2GHWB 3RLUA 5J6GB 1QSFA 3RMEA 1ME9A 3HCVB 4GO9A 1R3SA 1BEYL 1F4XL 4XP9H 4XKMA 3O45A 1DO6A 5J8OA 2W8CA 1L6YA 2NX9A 1YN6A 4Q4QA 3FT1A 2E8ZA 4P2QE 4ZEPA 1INEH 2HROA 3N13A 4NNYA 4NJ9L 2H32A 3KDNA 2WOBA 4X60A 3ETSA 4M4PA 4ALDA 3OB0H 4Z7UB 1OFRA 4OKVA 4X9HA 1EJOH 2NQJA 5TDPB 5E6ID 2A83B 2KPNA 4A3HA 3V4PL 2NQHA 4U7MA 2NW0A 5FFOA 5A43C 4PRBA 2P43B 1WFIA 3WEMA 1SZFA 4Z7NF 3FKRA 5A1AA 2YHGA 5F9JB 1JZ2A 4JGMA 2CIIB 4MZ3A 1T4KB 3KBPA 2ZD0A 3DTXA 4PJDA 3JTBA 3WNOA 1EUAA 2DI8A 2AJ3A 3OKYA 3V0AC 4ZQKA 3KJ4C 1ICQA 5D4JA 32C2A 4WI8A 1VD6A 4QGCA 4NPJA 5J13B 1NCBL 1SGKA 1QNRA 3W11C 4FTVD 3O3RA 1NGYA 1SN5A 4LP4A 1YN7B 1T40A 4IOTA 3TNMA 1DIOA 5HI5D 1OSZB 3QIUC 3BLOA 4WV1B 4OZIA 5KYXB 5HJBA 3SUVA 3TS8A 4R5EA 3AT0A 1J6OA 2XRAL 4KMLB 3QPKA 3NIGE 4UM9A 4PV9A 2O7SA 3MGOA 4G80A 2DIEA 3KGUA 1LRTA 2VC2B 1T96A 4J40A 2ARJA 4HHAA 4PS3A 5IJCC 2VEGA 3P5YA 3LS4L 1R24A 1NDMB 4HNCA 1KM2A 2DL9A 1XBDA 4H20H 3DXIA 2Q8BH 1IFGA 1E9QA 5FLVA 3LERA 3O6FA 4LF3B 4WWID 4YHIB 4UV4H 3BPCB 4GJJA 3GO1H 1E50A 1TNMA 1I7TA 2QMJA 1GORA 3Q8BA 2ZVRA 5F2IA 3TJHC 2YGVA 1S78C 2WZ0A 3DOSA 5T1MB 4QRPE 4N8VG 1BQ5A 3WH7A 2VNCA 3BN9C 4E9RA 2QW5A 4NP9A 1RBAA 1JGVH 4JJHA 2Z7UA 5HDQH 4Z1YA