4UQBA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.68 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 135
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqbA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqbA02
1M04A 2CITA 5FCZA 3N15A 4WF7A 2ZXBA 4AXNA 1VEOA 4WKFA 3D3AA 4AY1A 1TA3B 1ZU8A 3BAWA 5E70A 2X1IA 4FNQA 1KGWA 1HJVA 3NDZA 2O9RA 2Y5EA 1OIFA 2F7RA 3LXBA 4IM4A 3ARRA 3WY3A 5IFTA 8CGTA 1PS3A 2ZUMA 2WVVB 3UG3A 1E56A 3F5KA 3N04A 1WZLA 1TG7A 5JUVA 4OZOA 1SYTA 3DC0A 1OT1A 1CIUA 1VJZA 2J7CA 1E71M 3FHQA 2IXVA 1HKKA 3ALFA 5EFFA 3FHAA 1ZS2A 3LRLA 3AMDA 3WSUA 4ATWA 1TE1A 3DX2A 2DIJA 2J7BA 3BVVA 5A6BD 4U2YA 1ZBCA 4W7UA 5A6BA 4AD0A 1B30A 4TVUA 1LG1A 1X1NA 3EDDA 1J12A 3GXIA 3II1A 2QPSA 4NZJA 2VCCA 1XCWA 1BQCA 4AD5A 4F8XA 4MNJA 2VRQA 3RILA 4GXPA 2YBUA 2VCAA 2CERA 1HJQA 4CD8A 1DWIM 1WKYA 1TUXA 3KEHA 3L4WA 1O6IA 1HKIA 4J27A 3ZJ7A 3CZGA 2E8YA 2WLYA 1EO7A 1H09A 1QNPA 2JIEA 1H0GA 3PZQA 4P7NA 1C90A 2XGIA 2IGTA 3EMCA 3BC9A 2YLLA 4FNUA 1WCGA 1V0KA 5I2UA 1C92A 4MNKA 4DUWA 4RE3A 5GQBA 2FH8A 2ZUWA 1MFVA 3L4UA 3UESA 3D4ZA 2JF6A 1X6NA 3VDCA 2JE8A 4W93A 1BGGA 5DT5A 1XH1A 2A3BA 2YLAA 1E6SM 1W2PA 4J3UA 4DO5A 3RDKA 4M56A 4PYSA 2ALWA 3VU2A 4UQAA 3TA9A 3K1DA 5A8OA 3MKKA 2XTKA 1XC6A 1EIBA 4QP0A 3CZ8A 5A6AA 5HNNA 3SUTA 2FHFA 1UKSA 9CGTA 1E72M 4TXEA 3OGRA 2BY3A 3POCA 2CHNA 4UOJA 1BVNP 3HJEA 4WSKA 2WVTA 4GINA 1UG6A 2YDSA 4RE2A 1UKPA 1J9YA 4J3WA 3CHCA 2NT0A 2VQUA 4RE4A 1JF6A 4H7VA 2AOSA 5CLTA 4UQCA 1UR0A 3GXNA 3AIWA 3CH9A 1EH9A 4DM1A 3WDIA 2VZTA 3ARTA 5BYWA 1MXGA 4AEFA 3VDBA 3A24A 5M17A 2WMKA 1C8XA 2WWDA 1GZJA 5D9PA 5E09A 2BHZA 5BRQA 5GNXA 2WKLA 3AIRA 3F5LA 4PMZA 2OW7A 3WUGA 1G0CA 1BGAA 3J7HA 1GQKA 5A8NA 3QR3A 4AZIA 4D6IA 4HP5A 4AZ7A 2ZXAA 2J78A 1MW0A 5M5DA 3GBDA 1UZ1A 3NUKA 5I78A 5AYBA 5EMYA 4HPGA 5CG0A 3MV01 2F8QA 3AHZA 3BVUA 4GQRA 2TAAA 2BNJA 3K46A 1AQHA 2UWFA 4EK7A 4UFKA 1UR9A 1XHGA 3QHMA 4UQDA 3PZ9A 1QPKA 3PZVA 1JYWA 3BUBA 2CEQA 1E9LA 5C70A 1CXHA 5A94A 1E6NA 2G4FA 1U2YA 3WBAA 1FFRA 3PZIA 3VINA 2J62A 3NYDA 5AC4A 7TAAA 3D5HA 4BQ3A 1UA3A 4UR9A 3BAJA 3MUAA 2F1BA 2NW0A 5D8WA 2XYLA 1LL7A 2E9LA 1OCQA 1NM9A 3CHEA 3EJUA 4D6HA 3E1F1 5CJ5A 3U57A 5BROA 1ZBVA 1JXKA 1LLOA 2G3JA 1QW8A 4IPLA 3VGDA 4R27A 3MMWA 2W61A 2J75A 3VIJA 5EBAA 2WCGA 1MW3A 4X0NA 3ARZA 1GVIA 3L4ZA 1JNEA 2O9PA 1PIGA 1JI1A 2XM2A 4S3KA 1WPCA 5GNZA 5FL0A 1V3HA 4U5IA 3HG3A 4DWSD 2WBGA 1BPLB 4ZXOA 3ZJ6A 3VIFA 3DYOA 3WY2A 1J0YA 5LA0A 3IAPA 4DWSA 1KCKA 2XVGA 4H8UA 1UR8A 1I1WA 2YL6A 3BSGA 1L8NA 1Q6DA 1OM0A 1CEOA 4AZCB 2XUCA 4BS0A 3WDHA 1LL6A 1B3WA 2YDRA 4E2OA 3WL1A 5A6MA 2BY2A 2OYKA 3MMDA 3GM8A 1UQZA 2WC3A 4U3CA 3WF0A 4Z2HA 1C91A 1UZ4A 3WELA 4W84A 3VD9A 1V3IA 3W25A 3GH7A 3GXDA 1EGZA 2JEQA 3I3DA 4W88A 2OWWA 2DSUA 3MUZ1 4XZWA 4U33A 3WBEA 2WNWA 3VIOA 5C8BB 3TV8A 3AXXA 1B31A 4PUDA 3PTQA 3QGVA 1HF6A 3CZNA 4AWEA 3L4YA 3L2LA 2J74A 4AIEA 1B3XA 4CD6A 2Y2WA 3PZTA 2VOTA 2EO7A 5I0DA 4LGXA 4XUYA 4TX6A 2GDVA 5A6SA 1LJYA 3IANA 2JEPA 3I3BA 3ARYA 3BUDA 1VEMA 5EFDA 3VIIA 4MADA 5ABEA 5DT7A 4U3AA 2DQXA 3FAXA 2YFNA 1V0NA 1AMYA 2W63A 3AMCA 1RH9A 3AISA 2DDXA 3SCPA 3LRMA 3WD1A 2CBUA 3PZOA 3VD5A 2V3EA 4AISA 5E0CA 4K68A 5HPOA 4N42A 3PHAA 1UD4A 2X8RA 3WQWA 5IFPA 2CKRA 2ZX5A 1CBGA 4LYPA 2QLYA 2YOCA 4C7GA 4B15A 1ZJAA 3W38A 3CMGA 5FKYA 3T2OA 3U5YA 4XX6A 1KGUA 1NARA 3ZIZA 2BHUA 4MJ2A 3W29A 1MFUA 4JCLA 3CUFA 3RJXA 1CTNA 1WDQA 2DT1A 2DGAA 3AIUA 4M81A 3WMSA 3LPFA 4TX8A 1XGZA 2WZIA 3IAQA 3CBWA 2XIBA 5E6ZA 1CECA 1BFNA 2VVSA 3BVXA 3FNDA 6CGTA 3W28A 3W4RA 3WDJA 1UHVA 3VX1A 1CGYA 1UH4A 1QNRA 3EJTA 4R5EA 5CSUA 2V5CA 1GOMA 4JFWA 4NF7A 2PWDA 3IJ7A 4A4AA 1F4HA 4URIA 1KTBA 3NJ3A 4A3HA 3THCA 3W82A 3EJSA 3T2PA 3EYPA 3LX9A 4M82A 3AS1A 3A6OA 3EJRA 3UCQA 5A8PA 1J0KA 2ZE0A 1TFVA 1FHLA 1Z32X 1HN1A 4UOZA 4CN4A 5CLWA 4EANA 5ABGA 4CD7A 1O7AA 1UD2A 1V08A 4AZ5A 4D6JA 4F79A 3WF4A 4UQEA 4BQ5A 2XFYA 1PX3A 3WDRA 1CXLA 3AHVA 5CPQA 3EDFA 2ZXQA 4HA1A 1EDGA 3N11A 3KE0A 3W27A 1UR4A 1GQIA 2BFGA 4OKDA 2J7EA 3T09A 2EABA 4HTYA 3VDHA 3QOMA 4UFMA 4ZENA 3WD0A 1H1NA 1R75A 4IUGA 2J79A 1SZNA 1NP2A 2VL4A 1QI4A 3WQ5A 1A47A 1EO5A 5A6LA 1OD0A 2QF8A 3OB8A 1F4AA 1OD8A 1TVPA 2EBNA 1JD9A 2YKKA 1G01A 4BCEA 1B3ZA 2PC8A 2PB1A 4MJ4A 2XWEA 4PCTA 1NQ6A 2ZUUA 1US2A 1D2KA 2OYMA 1BYAA 5HXMA 4CU6A 4GKLA 3WH7A 2XVNA 1RD6A 1W1PA 3N12A 5A69A 4QCEA 3EDEA 2MANA 3PZMA 2J7FA 3ZM8A 2XFFA 1U30A 4FLRA 1P6WA 3BCDA 4FNRA 3GH4A 3CZSA 2OSXA 3GBEA 3EMQA 1E6XM 4M29A 4EE9A 1E6QM 1W9UA 1XYZA 4U5KA 1NWTA 3ARQA 1HL8A 3VSTA 1TQTA 3AICA 2CBJA 1R34A 3B8SA 1HKJA 4QLJA 4QAWA 4IISA 5BXTA 3WY1A 2UY3A 2VT0A 3WN6A 3ECQA 1EDTA 1GONA 2PWEA 2XJ7A 1HL9A 2VX4A 4MB3A 4Z2JA 5BXSA 4UZSA 1C93A 3WFZA 2ZUVA 1EHAA 3K8KA 3EDJA 2ZOXA 4TUFA 4JFVA 2WMGA 4MDOA 1WE5A 4LYQA 4PMRA 3ZJ8A 4PSPA 1ODUA 4M24A 2J4GA 3WH6A 1JZ5A 1BF2A 3AMLA 3K8LA 3ZQ9A 5I3DA 5AC5A 1V0MA 3WNNA 1VBRA 3CZJA 1UWQA 4JKMA 3W6LA 3F4VA 3RM8A 1US3A 3KL0A 5AYIA 1E1EA 1QHZA 4D6CA 3VIKA 3SCNA 1HNYA 3WNLA 3ALGA 3RM4A 4PMQA 3TTQA 2GFTA 3MI6A 1I1XA 1N82A 1KWKA 1HXKA 4CGTA 1R46A 4U31A 2W4XA 2BS9A 1YQ2A 4FMVA 3ARWA 3M6DA 4AYSA 1TQWA 4XZBA 3CLWA 3B9AA 1DP0A 4Y7EA 2GUYA 5IHSA 3PTKA 1R87A 1E5JA 5HBFA 3LPGA 2DSKA 4WLCA 4JAWA 2D0GA 3M07A 4V2XA 2GJPA 3UR7A 2ZX7A 4P8XA 2W92A 1H2JA 2XN2A 3DX0A 4HA4A 3PBGA 5LYRA 1U33A 2WMJA 1BAGA 3WD3A 4Z2KA 3W26A 3VD3A 3BLKA 3MANA 4AMXA 3M46A 3VM7A 4WSJA 3AYSA 4H2CA 2CESA 4CCCA 4JFTA 4HOZA 4AZ6A 4PRWA 4YN5A 1KQZA 2UY4A 1GHRA 3W0KA 1CPUA 5D9MA 3CGTA 4QLKA 2GJXA 4W87A 1W1VA 5A6KA 1QI0A 1TR1A 4DUXA 1ZBKA 1V3LA 1OGBA 1XV8A 1Q6FA 4AZCA 1NWRA 1QI5A 4PCSA 4P8WA 1VFOA 3A5VA 4ACZB 1CXFA 2EEXA 3AIVA 3EDKA 4PBGA 1E5NA 4XV0A 3AIBA 3VGBA 3OLGA 2XM1A 2YDQA 4X0VA 3BLBA 1GOKA 4D6EA 1H49A 3BMWA 3AFBA 2Y8KA 1LF1A 2G3IA 1ISZA 1WDSA 5M3WA 2E0PA 1OIMA 3NDYA 4AZGA 4UFJA 1IV8A 2WHLA 1V6XA 2JF7A 2PWFA 3ZT6A 4ZE4A 1CGUA 1M01A 4MNMA 1LWHA 3APGA 1CGVA 1OWQA 4FLSA 2WMHA 4XB3A 1CGXA 2EQDA 3AZRA 2VR5A 4FNTA 4QLLA 1XH0A 3VNZA 1K6AA 1LQ0A 2O9OA 1BYCA 2VI0A 3VILA 1FH8A 2A3HA 2XFRA 3CZLA 2FHCA 1HVXA 2XSAA 1W3LA 2WYSA 2VRKA 2GK1B 3SCWA 3VTRA 3SCRA 3GDBA 4EKJA 2C0HA 5I79A 1SMDA 5HDRA 1TQSA 2WPGA 4QDMA 3VGGA 4PN2A 1WAWA 3BXWA 4KRTA 2WMIA 1E0VA 1GQJA 4IPNB 3HZ3A 1EQPA 1JZ6A 1JYVA 2OWCA 4U2ZA 2A3EA 4UZUA 1L0PA 3VPLA 1NOFA 4TVCA 3UETA 4PTWA 1J0ZA 2ZX6A 2XIIA 4PTVA 5A6JA 1GPFA 3BLPX 1PX4A 3MV11 4CD5A 1MWOA 1G5AA 2D22A 2VC9A 5DFAA 3RMEA 1V3KA 4L4PA 4GIAA 4D71A 2WHKA 3VSVA 3ZO9A 1GNXA 2J8FA 5A2AA 1UWTA 3OGVA 3ZT5A 1BTCA 2GSJA 2FHBA 3S2CA 4WIWA 4F9DA 4DM2A 1HP5A 2DPEA 2V38A 4PUEA 2A3AA 1MVYA 1UASA 2EPKX 1KWGA 1B3VA 5C71A 2E3ZA 1KQYA 3DECA 2CYGA 3WMBA 4PMNA 2Y24A 2VUYA 3VDAA 2J7GA 3D52A 1KBBA 1ISXA 1GOWA 1QW9A 1E43A 1Y7VA 2X0HA 2HISA 3NCOA 1VENA 2AMGA 1DWGM 4KGLA 1GQLA 5DEZA 3ZSSA 3IK2A 3T2QA 3VGFA 1W9VA 4ACYA 1BVZA 4NXSA 4KMQA 3AHYA 3WUBA 2F61A 4HMDA 1ZJBA 1ZL1A 5BCAA 5FOOA 6TAAA 2DIEA 4HMCA 1W32A 4AD1A 3AZSA 4UFLA 2BVTA 3T0DA 2WB5A 1WZAA 1E4MM 1VFFA 3ARSA 4P8UA 1Q6EA 1W3KA 4D6DA 4GZJA 4P7OA 1W9XA 2CXGA 1UOKA 3U7VA 4UQ9A 1C7TA 1E4LA 1QI2A 5I6SA 3TTYA 3CMJA 1QOXA 3WQ4A 3RCNA 1ZBWA 3PN8A 3N9KA 5ABFA 1G9HA 1C7SA 4ML4A 4PEEA 3N18A 4W7VA 4UQBA 1H3GA 3BUIA 5BRPA 1HX0A 4AD3A 4DO4A 1KXHA 1H4PA 4OBSA 1DTUA 1VAHA 3VNYA 1J10A 1EOKA 4GI8A 2X0YA 2PBGA 4H41A 5ABHA 1DEDA 2DEPA 5E9AA 4LYRA 2XWDA 1VFMA 2ZIDA 2PWHA 3KLLA 2VX5A 4B9YA 2XHYA 1IZKA 4GZEA 3DX3A 3JUGA 4PSRA 2IXUA 2WC4A 4CKQA 3WQVA 2X2IA 3SUSA 2E9MA 3T0AA 1GW1A 3LPOA 2VZOA 2D0FA 3GNRA 2OSWA 1MW2A 2V3FA 2WSKA 3GZAA 3MSGA 1FA2A 3A22A 3VMNA 2YBTA 3FW6A 1MQRA 4CN6A 4LX4A 1CNVA 3SCSA 5JBDA 1W3HA 2DSZA 3AS0A 2QMKA 2FE0A 1DWJM 2CCRA 2YFOA 2CBIA 4PMUA 3K4AA 1XSIA 3N1AA 1JFHA 2GJRA 1E55A 2E40A 5GPRA 1E0WA 3GTNA 1FHDA 3IJ8A 1E70M 1R47A 2DH3A 1C3FA 1CENA 3OZPA 1GUVA 4ACZA 1V02A 1CGWA 2GDUA 1KGXA 1BYDA 3WDQA 2VQTA 2C8NA 4GO8A 4MAZA 1UWSA 5TD4A 3DX4A 4MTVA 4L4OA 1E6PA 2ESCA 1TA3A 2EXOA 1ISYA 4W8LA 1VB9A 4JCMA 1IZJA 2BXYA 3G6LA 3OLDA 2QPUA 3UG5A 3AQUA 1IT0A 2WZEA 4Q7NA 1UKTA 3WIJA 1W9PA 4HZ8A 2NT1A 1HT6A 3VGEA 3ZT7A 1HIZA 1CLVA 3CC1A 3GNOA 4C7FA 3NSXA 2JIWA 4W5ZA 1V0LA 2RGLA 3FAWA 4MB1A 3S5YA 1D3CA 1OGGA 2CETA 1VJSA 3SEPA 1JI2A 2ZX8A 4J3XA 1FOBA 3AMGA 4WJXA 5I5RA 1TCMA 1E0XA 1B9ZA 3WMCA 3WNKA 3SCTA 2WVVA 1JFXA 3VSUA 4J3VA 4QFUA 1PBGA 3LRKA 1E4IA 2VJXA 1WO2A 1E15A 1QX1A 1CLXA 1AQMA 5A2BA 3AS2A 2WBKA 3KL5A 3WEMA 1EOMA 1QBBA 3L4XA 3OZOA 4E4PA 1W9DM 1CYGA 1HWWA 1V6WA 3A3HA 3I3EA 4BA0A 2Y8VA 2WHMA 3H53A 3AHXA 4H8VA 1UD5A 2WXDM 4OGZA 3VIPA 4PMDA 3D51A 3PZUA 1BG9A 7A3HA 2W62A 4WKAA 1GJUA 1KXQA 5A2CA 5JBEA 1WDRA 2D23A 3WQ6A 1H5VA 1SFSA 1B0IA 2DSWA 4OBRA 3POHA 1XCXA 4UOQA 2BV9A 3OA5A 1KR1A 1TVNA 3K4DA 3FY1A 1B3YA 5CXPA 4D1IA 2VZSA 3VD7A 2FH6A 5HOSA 4W8AA 3L4VA 4YHGA 1JYNA 5KZ6A 1VF8A 1MXDA 1UKOA 2XSBA 4UNIA 2PI6A 4Q22A 3A4AA 2QV4A 3TTOA 3NSMA 2X2HA 2ZUTA 2HVMA 3VOCA 4LXFA 4E8CA 3ZR5A 5JBFA 4V27A 2FDMA 2EPMX 3B9DA 1NWUA 3WH9A 1JZ7A 1HJWA 4DWSB 1JF5A 2F7PA 3EJPA 1FP8A 4MDPA 1W1YA 4GO9A 3TOPA 3DHUA 1E3XA 4FK9A 3PTMA 3A23A 4AC1X 2XG9A 3A4XA 3VKKA 7CGTA 4EAMA 4E8DA 2DT2A 2J7HA 5IHRA 2YIHA 4YPJA 3AS3A 1OBAA 1B2YA 3GNPA 3QHOA 4FLOA 3RPMA 1HXJA 1JXJA 1UYQA 3S6TA 4NX0A 2X05A 3W24A 4JKKA 3W6MA 3UG4A 4W7WA 4PTXA 5E6YA 5D9OA 5CPTA 3GXFA 8A3HA 2IUZA 5FIPA 3VD4A 5D9NA 3OLEA 4JFUA 3BAXA 2QMJA 4W85A 4AEEA 3RO8A 1JYXA 2F7QA 1QVBA 4QCFA 2WK2A 3SURA 2F2HA 5LA1A 1V02E 1R85A 5I24A 1BLIA 2WSPA 2ZUNA 1RP8A 1CZ1A 1NOWA 1WZMA 2VZVA 2VZUA 4HZ7A 3SUWA 2WLZA 1M03A 1JDAA 3EBVA 4KH2A 4X9YA 2RGMA 3UR8A 5A8MA 5M03A 2WVUA 2EPLX 4LQ1A 3GYCA 3WF1A 2GK1A 3WKZA 3ZMRA 4TTUA 1J11A 3ZOAA 3W81A 4KWUA 2WC7A 1ESWA 1KFWA 1JZ8A 3FN9A 1BYBA 2VVNA 2PF0A 1WP6A 1WZKA 1HVQA 3OIHA 3CO4A 5AY7A 4C7DA 3AZTA 4KGJA 1K9DA 3OBAA 1VRXA 5DMYA 2YL8A 2GVYA 1JDDA 2WVSA 1LL4A 3WH5A 1QWNA 3RM9A 4JHOA 1XD1A 4NZFA 1W3JA 2V5DA 3AYRA 2VO5A 1TQVA 1UWRA 1EQCA 3BMVA 3HG2A 4M8UA 1MQPA 1WDPA 3OGSA 3CTTA 3OLIA 1E6ZA 2WW5A 1KCLA 1UR1A 2X2JA 4ATLA 3VGHA 3QOKA 2V3DA 1B90A 1HJSA 3WL0A 1R7OA 1V6YA 5CQ1A 3WNOA 3RJYA 2EACA 5A95A 1R33A 4MNLA 4AZHA 2EPOA 1UD8A 3BVWA 4JHZA 3KZSA 3WDPP 3WENA 2EAEA 4W89A 2W66A 3O9NA 3CUJA 3GXMA 2W91A 1PZ2A 4WKHA 1G94A 3BAIA 1V6VA 1PIFA 5HPCA 3CUGA 4ZXLA 2WAGA 4DUVA 3ARUA 1S46A 2VNCA 1FP9A 2OWXA 2D20A 4MPKA 2F18A 4HMEA 2ZXDA 4B9ZA 4PMOA 1PJ9A 3EMZA 1XRVA 1TQUA 1VEPA 3VIMA 2D3NA 4PMYA 1VIWA 2EPNA 1QNSA 2W5FA 4UFIA 2OW6A 1M53A 4JKLA 1QNQA 1JZ2A 1PEZA 1CXEA 1XYFA 3CHFA 2BY0A 2WANA 3VMPA 2WHJA 4UTFA 2W67A 4CCEA 1GOIA 2Z1SA 3PZNA 3ZJKA 3K8MA 1ITCA 2AAAA 5CPSA 1RPKA 4HZ6A 2UY5A 2VTFA 3CUHA 3GH5A 4M80A 2WCAA 4MB4A 1FH9A 1CDGA 1E73M 1PX8A 4ZEPA 2G8ZA 4AIUA 3WFLA 3HU7A 3BSHA 1AVAA 1DWFM 2YL9A 2XN1A 5KEZA 1EXPA 2E8ZA 2JALA 1QI3A 4GI6A 4A3YA 2XN0A 2ZUSA 4JL1A 2D0HA 3SCUA 3AXHA 4ATDA 2XVLA 1UR2A 1KXTA 3GXTA 1ISWA 4NRRA 1AQ0A 4GQQA 4TOQA 2OYLA 2UY2A 1H41A 2YL5A 3AI0A 4D6FA 4CUCA 3D4YA 2VMFA 4GPNA 1QWUA 1UA7A 3HG4A 4D1JA 5IXEA 3TONA 4AIOA 4CVWA 1HJXA 1GORA 2YA1A 1UD3A 3UERA 3T0BA 2XPKA 5DO8A 3N13A 3DDFA 2WCSA 3BH4A 2FGLA 2GJXB 4FNSA 4MAVA 1JL8A 3LPPA 3O2LA 4P7LA 4Z2LA 4FLQA 1KB3A 4F9JA 4DWSC 3MUIA 4JIEA 1QHOA 4HOWA 1PPIA 2A3CA 5CGMA 3WUFA 1K9FA 2CKSA 2WM0A 2DT3A 3AIEA 4CU7A 4CVUA 1JZ3A 1KXVA 3WQ8A 3SCQA 2ZX9A 2D3LA 4NI3A 5E1QA 1TZ7A 3HN3A 1HP4A 3ARXA 5ECUA 1BSIA 3SCVA 4TTGA 3DDGA 4J3SA 1XH2A 2E9BA 2VRJA 2BY1A 2EJ1A 1DWAM 1NH6A 4S3JA 3SCOA 4JFSA 4AMWA 1J0JA 4OIFA 2J47A 3SIMA 3BVTA 1W2VA 1OSEA 4LPCA 4UCFA 3G6MA 4ZFMA 1VFUA 1NP0A 2XVKA 1EHNA 2Z1KA 3THDA 2G3MA 3EJQA 1WNOA 1CWYA 1GCYA 3NIYA 5I23A 2X2YA 4HPHA 4D6GA 3DHPA 3QHNA 1WB0A 1M7XA 2BXZA 1ITXA 4AW7A 5ABFB 4W5UA 3MS8A 5DF0A 4J7RA 1TMQA 3VMOA 3LMYA 3PZGA 3VO0A 1V3MA 1W9BM 4DO6A 1T0OA 1NWSA 4P7QA 4AD2A 1Q6CA 1H11A 5IDIA 4PMVA 4JZ5A 1JNDA 3H54A 1C8QA 3WNMA 5FD0A 6A3HA 3VM5A 3AROA 2B31A 3BAYA 1LG2A 1UH3A 4H8HA 5GNYA 3GXPA 3MU7A 4HU0A 3RIKA 4V28A 1YHTA 1W91A 2YJQA 5LA2A 2DSVA 4BF7A 3DX1A 3OG2A 1PAMA 1O7DC 4OOZA 5E0FA 4OJYA 3BAKA 5JIPA 1JGIA 1GOQA 2ZWZA 5I77A 3KWXA 1MW1A 3M7SA 2EADA 1DHKA 3N17A 4AD4A 1A3HA 1EA9C 1CXIA 3F5JA 1HTYA 1BG4A 4OUEA 3IGUA 3U5UA 4N0RA 4P8VA 1D7FA 2Q8XA 3H55A 4CD4A 1VBUA 3CZKA 1OT2A 5D4YA 1OGSA 4NRSA 1E1FA 2VURA 5F7UA 2WZHA 3S5ZA 2PBOA 4F66A 4BQ2A 4UFHA 3WEZA 1ECEA 1LWJA 2WMFA 1W1TA 2CPUA 1K9EA 3CUIA 3IJ9A 4W86A 3BGAA 4KRUA 3WF3A 4OOUA 2BVDA 4RL3A 2VX6A 1J01A 5BXRA 4NSBA 4AMCA 4D72A 4WK9A 3DYPA 1JAKA 3A4WA 3VUPA 2D1ZA 3UEQA 1E4NA 1XD0A 2G41A 1SR0A 1QBAA 1UQYA 5FL1A 1HJUA 2E4TA 2QHAA 4AYGA 2XVPA 4TVDA 3T08A 3LXCA 3BCFA 3KLKA 2D24A 2WWCA 5A3HA 4HU8A 2DH2A 4H04A 1R86A 2BHYA 5A1AA 2FGZA 3CPUA 2BVYA 3VVGA 1R7AA 4HA3A 5CZKA 4BQ4A 1MQQA 3DYMA 3L2MA 1V6UA 3SUVA 3BUQA 5BXPA 3WD2A 2J25A 3AMKA 3A21A 4JL2A 3MO4A 4ZE5A 2NSXA 4PTMA 1KBKA 1ISVA 1J18A 2VX7A 5CSYA 1JD7A 4NZCA 3AXIA 3TTSA 2CNCA 3ZSTA 2D2OA 3A47A 4YHEA 1FH7A 1G1YA 3WY4A 1JAEA 3NSNA 1JDCA 3D50A 4CCDA 2WKGA 1UH2A 5A8QA 2F1AA 1QHPA 3AOFA 3VX0A 4FF5A 1QNOA 4CU8A 3MUY1 4B3LA 3KL3A 3BUPA 1OB0A 1UKQA 1CGTA 2Y4SA 3W37A 4FNPA 2O92A 3WH8A 3VIGA 1HKMA 3ARPA 1ZB5A 2DT0A 2XGBA 3CHDA 1UWUA 2CHOA 1K9TA 5EB8A 3VIHA 1GOOA 2F7OA 3HMCA 2C7FA 3WUEA 1UUQA 3CZEA 2JFEX 4W8BA 4Z2IA 2OLHA 4J28A 1FFQA 3LXAA 3FXYA 4MB5A 1BHGA 4B3KA 3AIQA 1H0IA 4NXKA 1X6LA 2J77A 3HG5A 1SMAA 1Q6GA 3AHTA 3SUUA 2J8GA 2D73A 2ZWYA 3B9EA 1Q4NX 1EDQA 1OINA 1UWIA 3W53A 1E40A 1E3ZA 4B16A 1J0HA 5BWFA 4CN1A 1CXKA 1GHSA 1KTCA 1JZ4A 1MYRA 5JIWA 4HOXA 1XSKA 2WMIB 2ZICA 4AZBA 1E6RA 4Z2GA 1UD6A 1ODZA 3WD4A 1JG9A 3MSDA 1PZ3A 3WF2A 2YA0A 1V3JA 2YA2A 5D8ZA 1KR0A 4GZIA 2CBVA 1C8YA 1XSJA 3CIVA 4PMXA 1V03A 1NOUA 3CV5A 3MMUA 1I75A 4GI9A 2G3NA 1B1YA 2X09A 2OSYA 3U7BA 1J0IA 4BZYA 4M1RA 1RP9A 2FYVA 1GVYA 3ARVA 1JIBA 3ZR6A 4P7RA 3WEOA 2J7DA 3L4TA 3TP4A 5CGTA 2PWGA 4J3TA 3WNPA 2O9TA 3AJ7A 2VCBA 2CIPA 2V3GA 3O6AA 1DWHM 1R8LA 2VR4A 1GJWA
chains in the Genus database with same CATH superfamily
2CITA 5FCZA 3G6JA 4KBXA 3N15A 1TJHL 1IBZA 4HQVA 4WF7A 1L7IL 3FTUA 4IMFA 4ZMGA 1QPNA 3O6KH 4QKXB 3QUML 3ZHKA 2NZ9C 3QUXD 1KYUA 2GGHA 4YO0B 4KZEL 1FVEB 3EXSA 3D3AA 2AK4D 3NFUA 5CHNA 1E8ZA 2X70A 5CBEA 2EILB 2ZTJA 2OZ4L 3MLYH 3O8XD 4KVPA 2DBLH 3QGAC 3CCHA 4XMKH 4GRSA 4AFYA 4WHTB 5DJCB 2NXZB 2FO1A 3CB8A 1NLDL 3JTBA 1YMMA 2W65B 4JGDA 1FH5H 5F8QC 1QPOA 1NICA 1KGWA 1VYPX 4FOJA 2OQJA 1T5WB 3H2PA 4MJHA 1WYJA 3LXBA 3FRPA 3OVRA 4JVPA 1BQSA 3RGBA 1MUJA 2VLJB 3N06B 1L0YA 3ULAB 4BXSV 1SZGA 3C4UA 2HPIA 4UXDA 1HEZA 1I3VA 3UG3A 3F5KA 1E56A 2OR7A 1MF2L 5LAXB 2EVIA 5IM51 4LOUC 1OQOA 1AW2A 4XPAL 5BWAA 2IDUA 3GG0A 3ARED 1DBAH 5HYSA 5DMMA 2RKXA 4C6NA 4NZUL 1HKLL 2B4CC 3V0FA 2ONEA 3CXHJ 2OJ1A 1AMKA 1F13A 3ESVF 1VJZA 4U05A 1XR9A 4P2AA 1UP3A 4MJIB 5AVWB 1TYEB 3FHQA 1E71M 4JIIX 1ZP4A 5REQB 1HKKA 1ZZMA 2ZYSA 1JGLH 1N26A 1W15A 4P5MA 2BSDA 4TNVK 1A3RH 2XZAH 3FHAA 1NDZA 2PLCA 1Y1DA 3X3GH 1AW1A 3HC0A 3L8QA 1OCWL 3T8LA 3WSUA 2B39A 4US5A 5BRZE 4ATWA 1U95A 3BPLC 2XT1B 3SPIA 4O00A 3QQXA 4U2YA 4YPGB 3B37A 3D39B 4PWKA 5FW8A 5F4WA 2YZRA 4ZSUA 3QNYB 1FRGH 4AD0A 1G7QB 5T3XD 4P2VA 3QI9A 4Y1AD 5DJ8B 1NCUA 1CB4A 1TYRA 1UM5H 4G6KH 4TVUA 5JQ9A 2GUOB 1MCPL 3QP3A 4HCFA 3DFOA 1LEIA 3P4NB 4URKA 1TE6A 1UJQA 3II1A 5KAQF 2Y61A 2JKWA 2VDLB 4JR9H 3L21A 1XCWA 2Y5TA 5A3ID 3BZGA 2WYTA 1GAFL 5IMLB 4G5ZL 3ENEA 4F8XA 3PREA 3OKNB 1EPFA 1YRKA 4MNJA 5IB5A 3O6DA 3W6YA 2VZ1A 4RBPK 4L1GA 1TITA 5FHBH 1S1RA 2FLRT 2X1WL 4LCUA 4Z1BA 4FQIH 2AMXA 4E3VA 3RZCD 2H1LM 2IH1A 3K5XA 1Q6OA 3CIQA 2YQ3A 2OR9H 3VG9C 4PJ9B 4H1LB 1XUUA 2CERA 1E9PB 1F00I 1LLAA 3BYYA 2EUWA 1EHLH 1VS1A 2J24A 1TUXA 1WSST 2I60L 2WO4A 5D7LE 1HKIA 4J27A 4EXPX 2JK5B 4Y4KD 2O6EA 3RB5A 2E8YA 2ICCA 3UJEA 4O50A 2OLDA 3V5KA 1BQ5A 2APSA 4BD4A 2INFA 1OGTA 1I2QA 4PJ5B 3O2VH 3MDWA 1MAMH 2FTYA 1DUZB 5AKQA 3E6HB 2ZQKA 3TUUA 1QFHA 2P7TB 5FUZL 2WXKA 4HG4J 3QG7L 4RV3A 2ZOKA 1DVSA 4UQ3B 3BG3A 1YEWA 4UIKH 3EO1A 4B27A 1S38A 4N9EA 5FJIA 5E5UB 4ZQCA 1V0KA 4U1JA 1VC4A 4KETA 1A7BA 5H2ZA 1RQ5A 4PL2A 3LNIA 4Y9EA 1YNKH 3WU1A 4E5XA 2XA3A 1JJUA 4YHPB 5GGRB 4LV9A 1QTYT 5J9PA 3QN3A 5F1VA 1BKSA 2EHHA 1NCDH 2VJ8A 1RUPH 2DYPB 3MOAH 2BC4A 4YDIL 4CJ1A 5GJTL 2KDYA 3RFRA 4Z7WB 1X6NA 5I16A 2LLLA 2FWOB 4W93A 2H6RA 2N0KA 2A3BA 2DQFB 3LD8B 1E6SM 2NUXA 3ZLQC 2P42B 3QEGH 2IKGA 3DROA 3RDKA 5ITFB 1EP2A 4QMEA 3FONB 5I6NA 1RZGA 5J5DA 1XDLA 3CB3A 4JQVC 4JBRA 4GKSB 2DBLL 5FJTA 2X2UA 4HIBA 3TA9A 1POJA 1XRFA 2X4TA 2ZA3A 2XTKA 4QP0A 4OZGA 1VBGA 3CZ8A 4XZLX 5A6AA 5DK3A 3IJYB 4BINA 1FO0A 4M03A 2I9EA 5D55A 2FL5A 3BKML 2OCFD 3BN9C 4R0LA 5DJZB 1SZEA 1Z44A 5KTLA 2IWKA 2LGNA 3QQ1A 2Y1HA 2BY3A 1M05A 1MDTA 1XGUA 3QCUL 5C0CB 1OLZA 3FRPG 4NC2B 4WSKA 3SGJC 1JUKA 3IF1B 3CHOA 1NINA 5DJ2A 1W37A 1WBJA 4FSAA 2IAND 1UG6A 2JCCE 3M0JA 4J3WA 3CHCA 4XX1G 2R8SL 5AG8A 3HMXA 2VQUA 5FGBC 4ZUVB 1V7NL 1KBPA 1J1XH 3HAEA 3OKYA 4HGWB 3TT3L 5FDWA 5JW4Q 1H61A 1HH6B 3APCA 1ZQ5A 6TIMA 5IG7B 5E8DL 1I1AB 3VQLA 4XE5B 5DD6B 3EKZA 3BZ4A 1O94A 4C6QA 4D8ZA 3BD3A 3NRQA 1F3TA 1TR9A 2XWJB 1UR0A 3QQ3B 3W1NA 2W95A 3GXNA 4MD0A 2O5NA 4HVXA 5KINA 3CH9A 4UIMA 2WKJA 1LGVA 3ZDWA 4HKPA 3GE7A 5GIRA 2VZTA 3ARTA 4DM1A 5BYWA 1WD9A 3OPUA 3WKYA 3DERA 3QIBC 2FWUA 1IL1A 1JK8B 3H2AA 1TJIL 1A6VH 3VDBA 2GSIB 5IIEA 2XFWA 2FJSA 3OMNB 1C8XA 2VR3A 1GZJA 4NQCA 3MGOB 3WG6A 1KB5B 1OM3L 4PIBA 1T99A 5E09A 2BHZA 1MIML 5LG6A 2QCHA 5AC7A 4LASL 1PAZA 1RLBA 4PV9B 3WZ0E 4G7VL 5FO7A 2VLKE 2XG4A 2C3ZA 3F5LA 2OWWA 3BT0A 4WFHE 4B9KC 1LK3L 4FE9A 5A8NA 3DI3B 3S9YA 1M6JA 4AZ7A 2PEVA 2NXGA 3GPEA 3KOFA 1B3OA 5GRJH 2C0AA 3OQ8A 5LIYX 4I1NB 3N1MC 4ORMA 3NUKA 1UZ1A 5E9DB 5DVLA 5T3XL 3KS0H 4BKLA 2ZOKB 3NSCA 2JLPA 3PWUA 2YRLA 5EMYA 3MRHB 3SDDC 4K7PY 1WTLA 3WV0A 4HPGA 3MHGA 3TXZA 2BVPA 5T5FH 4ELKB 3ZFHA 1A6ZB 1SZRA 5ID1B 4FXKC 4EF9A 2O4MA 2TAAA 2GI0A 1OE1A 4G6MH 2IALA 5LBSL 2A83A 3LVTA 5FYLL 4YN5A 3VCLB 3FGCA 3UTZB 4BUQA 1ZHBB 3HNVH 2QVIA 4ZB5A 5SWSB 4POZD 1QPKA 3D2UA 4DKEL 1JYWA 3GBNH 3BUBA 3RVTC 1YY9C 1SBBA 1XCQA 4GG6E 4DGWC 4DKTA 4OZIF 3ZYZA 4L3ED 4M7LT 1YNTF 3W0WD 1MO0A 4JAMA 2QF7A 4YGVB 5A94A 4GVFA 2CR3A 3CO8A 5AFDA 1U2YA 2O5XH 2QEJA 3WBAA 5AKSA 1QSFE 4YL4A 3UTTE 3P84A 4PRBB 1HXMA 3L48A 3R89A 1HHIA 3Q9QA 3PZIA 3X1FA 4PGEB 3P7YA 5D4QA 3KPSE 1WAUA 3KLHD 3PYCA 1T7VA 5AC4A 1XGYL 2BP8A 5XIMA 1MEXL 1INQA 1YEHL 5EEVA 4BFAA 3SPJA 1NBYA 2XPZA 4PJ8A 4EIZC 3BAJA 1MXSA 5I3GA 4Q9QL 1DKWA 2K4AA 1NUGA 3ATEA 3T81A 3D69B 4HH8A 1M7DA 1FLTX 1OM9A 3FO9B 4LCWB 2Q87A 5A40E 3CHEA 4D6HA 3DX9B 1FSKC 2EDWA 1JPFB 1NGQH 1TR7A 3E1F1 2OG9A 1AHWC 4FQ2H 3SPHA 3U57A 5IFHL 4P57A 2JI2A 5IBLD 1D5MA 1VFTA 5EBUA 1JCYA 2UWEF 2DV0A 1G1KA 1ZNNA 2YPIA 1MQKL 4LCCB 2N1KA 2Q0ZX 5FM8A 5C08D 1PS9A 1GYUA 2YXOA 4TULH 4FFWD 4JANB 5FUOL 2I5QA 3CWGA 4X6CA 4R27A 2AITA 4DVBA 2X4QA 1RUKL 2WCGA 2YOAA 2WQWA 3LQAH 5KS9E 1L8PA 1ZT4B 1VPQA 3BDKA 4HCHA 2Y22A 1ZHKB 4Q0XL 2HG0A 2PP0A 4PCNA 4HAGA 1YXYA 3OSVA 1F02I 1MFDH 1JI1A 3NJHA 3ILEA 1I7ZA 4QKTA 1MIEL 1LM1A 4S3KA 3C2FA 4XK2A 5GNZA 4ADSA 1OAZH 2NV9A 2A1WL 3LDVA 4MIMA 4O52A 1BPLB 4GUPA 4I0PB 3ZJ6A 4DLMA 2PXYA 3BDXA 3DYOA 3TA3A 4WCYH 2FYMA 1GGBH 3LYRA 3EB2A 4JOMA 5DFVD 2K3TA 2XVGA 1C12B 4S1SH 3U46A 4JFFA 1UR8A 2OCZA 3P74A 3RITA 3RUBL 5FYKH 4GMSH 1H1YA 1K03A 3BSGA 4RIRA 1KLUA 1UOWA 2QADD 1OM0A 1RLWA 4CQBA 2BB0A 2XUCA 2IMNA 1OFEA 3EUDA 3GS6A 1UYWH 1M7JA 5L88L 1UC6A 2NY2C 1B3WA 1CE1L 5D04C 3VFCA 2AS5M 1A4KA 3A6BL 1DLFH 1DQLL 4LFHD 3WKPA 5A6MA 1T03L 3W24A 1UTDA 1ZA6A 4HEPA 4XWGH 5T5FA 1V77A 4M7SA 2WW8A 2DRUA 2KS0A 2Q3RA 3B8VA 4K36A 3TBYB 5HAOA 4ONFL 3BD5A 1AO7A 1OAXH 2FECI 4JFPA 1A5BA 3K80A 1C91A 3UD6A 4XXDB 1BXVA 4MWAE 5L2KA 4GW1B 3FQTB 5SV4A 1V3IA 5EMJA 2EKCA 2ESVD 3I3DA 2HBXA 2JEQA 3PV6A 4NM8L 1PKYA 3WFAA 1K4CA 1B4KA 1MRQA 2FJUB 3B5TA 4DTGL 2WNWA 3S8HA 2ESVA 3T3PB 2B7NA 3KOYA 1JZHA 5I76A 4M5ZH 2L04A 2DUAA 1WDAA 1XF3B 4X5LA 7XIMA 1HF6A 4XP9H 2X4QB 3PUDA 3C5XA 4WDWA 5EORH 4Z3FA 3RWCA 2W9LA 4ONFH 5D1XB 1A50A 4XI5C 3PZTA 2CBMA 2OXGB 3UPRB 1A7OH 1MCHA 4YXLL 4JTFA 3T3MB 4HPXA 1L7TL 5FO7B 5D1ZI 5I0DA 4LGXA 5AVNA 2P48B 1KY6A 5C54A 2P80D 2AJZB 3BXNA 1LEGA 4NZRH 1KRMA 1XDJA 2GDVA 2Y6ZA 5A6SA 2E5BA 3REVB 1RJQA 4IOFD 2NLIA 1IKFL 3QZWA 2AXGA 2J9XA 3BUDA 4R2GC 3L5IA 4R0LC 5DZNA 3PK7A 1UOVA 3O4LA 1E9QB 5EFDA 4UT6A 3PABB 4ZYKA 1W8OA 3HA0A 3VFRA 5DT7A 1G4TA 4S39A 2W9DH 3MRBB 2DQXA 3PUUA 1Z0NA 3CFEB 4LDEB 5T3XE 5HINA 4BELD 4KQ4L 1V0NA 5GVJA 1F3RB 1RK0A 4J40A 4GUFA 4DZHA 4B7LA 3M7WA 1X5ZA 4YNYB 3RX5A 3HMWL 3TN0A 4OM1H 1QDSA 2DDXA 3LRMA 3WD1A 2QPEB 1SJAA 3NJIA 1EO8L 2VXQH 3PZOA 3IEBA 4XAFA 4KK9C 3MV7B 5IVOA 1R5YA 1ORSA 4Z3EA 2FJFB 2EIKB 3BOLA 3SB0A 1IE7C 4U6TA 1PZCA 3C09B 1OLLA 2ADFH 1CLZL 4ZUTB 3RTQD 3SB3A 1NC2B 2FVLA 4YL2A 1MDAA 2OB3A 2A6IA 5DFVC 4ZAKA 3L23A 4I5BB 4F0LA 4N42A 1NGZB 3PHAA 4AZ8B 2CZDA 3PWPA 1NEUA 4HSQA 3TV3H 5IFPA 4F8QA 2G5RA 2F54D 2ZX5A 3QDHA 4TULL 1CBGA 4TQPA 4RDZA 3CLFL 3VCLA 4DJFC 1ZJAA 1I1YA 3DHJA 2VP8A 1DN2A 2DV6A 1YYML 1QLFA 3RTQC 3SQMA 3VXSB 4XP6L 3M88A 2J4WH 4GJ1A 1EMTH 4IIBA 4KF1A 1IAIM 3RZWA 3CUFA 2J8HA 2I5YH 4F33A 1NCBL 4ODUB 1ASPA 4CSTA 2N7BA 4EI5A 3F4WA 1CTNA 5LGJB 4QG6A 1UJ3A 4Q9QH 3FFCD 4IOSD 1LZOA 2DT1A 4GE8A 1RZGB 3KW7A 1Q0YH 2VSKB 5D1QC 3UTTB 1U5JA 3NDOA 5AZ1A 3ZKND 4M81A 4KX7A 5T1DL 1JDFA 3TYDA 2R9HD 3WMSA 2OMNA 4TX8A 4L8BB 1EYWA 3QJTB 4MSWB 3ME0A 5F0LB 3RGVA 3U9UA 5IV2B 2Z2BA 3K2GA 2DWTA 5TH2A 3BO8B 3CBWA 5E6ZA 4JX6A 1NDGA 3W73A 4UTAH 4IP7A 4G1KA 4M5PA 1CICA 1J48A 1BRLB 2A7NA 2ZG2A 5FOBA 4XZ4A 1N10A 3BPWA 2A9BA 4GLRH 5LBGA 4QO1B 1Z0MA 3FNDA 1CICD 6CGTA 3L9YA 4K07A 3W4RA 3HBZA 1FWTA 2EUZA 2X1RA 1QNRA 2NY0C 2XISA 1S7XA 4P5TD 3IGAB 3EJTA 2EDNA 4R5EA 3S3SA 3VFOA 2ZG1A 2OCJA 3PQYB 4JFWA 3C60B 4KXCA 1N5YL 4H8WC 3CJJA 3C60A 3IJ7A 3MLSH 1F4HA 2N7AA 4XAKD 1GG1A 1KCSH 5LBSH 5TFSL 4CBZA 1TJMA 2R8WA 1N7ML 3THCA 2QCDB 2PN5A 3IEAA 3E8VA 4BGLA 4QF1B 1I3RA 4BKNA 3HG1A 4PJFF 4CRPA 3LY6A 4EO5A 3SGDH 3VFSB 1B0RA 3O0LA 5T3XH 2Y5SA 5IQMA 3ARGD 3EYPA 3U4FA 3L1GA 3TA6A 4EVNB 2NX9A 2CBOA 4K3HA 3LX9A 4MNQE 3CV6A 5KSBB 3A6OA 1U8NB 5EUKA 3UCQA 2MKWA 3ZBMA 1X96A 1DJWA 3SOBH 2ZE0A 4JX5A 5DX7A 2WYZA 1Z32X 1HN1A 4K55A 1AGFB 5HJ3A 4F0MA 4XOAA 3V6FB 1WA3A 2CHXA 1HI6B 1TZIA 3E3HA 1WA2X 3PBWA 2Y9RT 3CPLA 3CZFB 3DFSA 2VDKL 3CPLB 1UD2A 2VO8A 4FI6A 5DQDH 5E4IA 2ENQA 1UFGA 2NXHA 3P0XA 1NUFA 1WUNT 1F4YH 2FWSA 2RQ8A 4QRQB 1H63A 4GMTH 2ICWI 2WTPA 2DICA 3QEQA 2VDHA 1B9BA 2VE6B 1II4E 1PX3A 4NGHL 2K78A 1MZZA 4GG6A 1A5KC 4FQ1L 1DXFA 2ITDA 4QHMA 5ESQA 1YTEA 3RLGA 4FZ8H 1CXLA 5D7LB 4AYBA 4BI6A 1SM3L 3EDFA 4K3EL 4Z95H 1G9NC 5F7YC 4BWWA 2NSOA 1F3WA 2B59A 5CEZL 3G5VB 3V0WH 3G1SA 4HPNA 3IUDA 5IQ9B 1QSFA 2PDGA 4LSBA 1NCHA 2BFGA 5FF6A 1OG6A 3IV8A 3LHPH 3GLEA 3QJUB 4ES9A 4DKAA 2R8SH 3MJYA 4NNYA 2J4WL 5H8MA 4Z7QB 1W8SA 3T09A 3VXQA 5A95A 3TA3C 2WIIA 1IBFA 5JU6A 3G5YB 4PGJA 1TYGA 3QOMA 1PVHA 5F9WC 1YEYA 2GQ9A 4Y16D 3MZ2A 1H1NA 4LCRA 3WD0A 4BZ1L 2PXYD 1HCYA 4M1GH 3FUKA 1ET7A 1KTNA 2J79A 5KYWB 2E27H 3J2PA 2VQ1A 3W9DB 2O5YL 1ROCA 4QSHA 2V63A 4IX2A 4Y1AE 3MV8E 1N6QL 5A6LA 3LQAC 3SJ3A 1KBVA 3GFXA 4UMBA 3U2SB 4RA0C 5LXGL 1UVQB 4L1HA 2X0WA 5LAXA 2YPLA 3PQYE 2DQHH 1S9YB 1DVFA 5F7EL 3QPYA 4JO1L 4F3FA 1ZS8B 4IQDA 4AWUA 2YKKA 1JWSA 4I2XB 3X1NA 5C8JA 2XTJC 1LO0H 5F21B 4ZMQA 4BCEA 3P11H 1BVOA 3TK7A 3WO8A 2QJNA 5EIIG 1KIQA 1US2A 2PDFA 2WTRB 1AI1H 3MNWB 3STZB 1IM3D 5HXMA 1AGFA 3BE1H 3BZ5A 4PW4A 5GJTH 4GKLA 4N1HB 3ECWA 3EBHA 1SMOA 2XVNA 3CVHA 4W9CC 4WNQA 3N12A 4G7EB 2XIMA 4HKBA 4ZA0A 2PD9A 2PTZA 3EDEA 4NKMA 3U4KA 5CP7B 3TCXA 4B5TA 1MRFH 2XNAB 3L5MA 5I3FA 1SJMA 2J7FA 5TE6H 4ZSOE 3KNBA 4KVNL 1ZHLA 2DQIL 2CGRL 3UJJL 3QRHA 3MRIA 4GAYB 3DGGA 5IEKB 1EJXC 4C1NA 1NAL1 2VSMB 3UWQA 1D5XB 5EUOF 4GBXB 1GZ1A 4DJMA 5AW6B 2V17H 1IGYB 4YAQB 1E6XM 1OC7A 3EMQA 3F03K 3B4YA 3T2NL 1W9UA 4U3XA 1OF8A 4F1ZA 2YCEA 1YMME 4I6VA 3VI4B 3LCWA 3TYAA 4W9TA 3UZQA 3W7GA 1ZA3B 4YS4A 3B9NA 1IAII 3BUYA 4M1CD 1M2OA 1HL8A 1XIIA 2J6WA 3VSTA 3G1YA 2I60H 1XXXA 1AY1L 4DXKA 1R3SA 2P80A 3OAWA 1UB6A 3PC0A 2CBJA 3TN5A 1IJNA 4M3KB 3CU7A 1ZP3A 1XBXA 3CMOL 1HKJA 1MHHA 4HJ0D 4YTSA 2DQDH 5ABDE 2OJPA 4QLJA 1B9KA 4E9RA 5T5NF 3Q5TA 4XWOD 3WY1A 2UY3A 2NY2D 5AYUH 2VT0A 4OVXA 1TPDA 4QIRA 2RFXA 3GSVA 4QG9A 2AAVA 2YPVL 1YEKH 1GONA 2C18A 1NC4A 1TO4A 2PWEA 3PABA 4CC4A 1EJWC 4RAVA 5DMGD 4MRCA 4JY5H 4HWEH 1BAFH 4LF1A 5BXSA 1MCFA 4UZSA 1TZZA 4PJ9C 3ARBC 2PUZA 4K8HA 3BFQG 2ZUVA 3EDJA 3VFMB 4Z0BH 5EG6C 4TUFA 4JFVA 4M43H 4OKVA 1TZIB 1WE5A 2KERA 4RZ4A 4REQA 3WN5B 4L8BA 3MLUH 4UM8B 2FVMA 4Y2WA 4GRLB 5XINA 2CLRB 3Q3GA 3CAKA 2J4GA 1JZ5A 5BOEA 2E09A 1BF2A 3BW9B 2QQNH 1WWAX 1WFNA 2GK0B 5FYKU 3PUCA 3QVQA 5I3DA 5AC5A 4PFEA 3EJZD 4JKMA 1BD2A 1VZGA 4XVUD 1YTDA 4IM8A 4TTDD 1P0DA 5EU4A 5SWZA 3VXSA 4N6RB 4DAGL 3NG5A 1ZSDB 3RU8L 4W4OC 4HIJB 4WTWA 1OAZL 3D39A 5FUCE 5B1JA 3SCNA 4B91A 2B3IA 2DMKA 1HNYA 5KVDE 2NLYA 3UXDA 3NACL 5C0DA 4M93B 1JNLL 4CMHC 4E9YA 3UFYA 3RM4A 3C2SA 1LE5A 4R7NB 2GJLA 1J8HB 4PMQA 2FD6L 3QWNA 4ZSTA 1X5KA 2Q01A 4F7EB 1ZLEA 1H1ZA 4BE5A 1EAQA 4WOQA 2NXYB 4PRID 3MI6A 4H7CA 1NGWA 4ZFZA 3FFCA 2HNEA 4A21A 3OKKB 2ESVE 3DEQA 4QF1A 3HMJG 3MOBH 1P53A 4CGTA 3TYFA 2KLRA 3RYMA 2VLKB 3F84A 1K1DA 1L6SA 3MCKB 4HIHB 2R2BA 4U31A 1KJVB 1T5KA 2O1AA 1ZV5A 4G8GE 3TYUA 3SDAD 2PRLA 1SSDA 3G2GA 3T3PF 1A1NB 1ZCRA 2JXMB 1J8RA 4AYSA 4B4HA 4G6CA 3NK4A 4KXZH 4YLWA 1GW6A 3IACA 3VE0B 1FAIL 2Z4TA 1DP0A 4O1DA 4MMXC 4N8VA 5AVRB 5IHSA 2GCYA 3L1FA 4UT9L 1R87A 3M4HA 3I6GA 5L2KD 1E5JA 4XC3H 3UC2A 3OVGA 3MTWA 2DMHA 3APTA 2QUTA 3DUUB 3CN3A 4PVNA 4R3SB 4BK5A 3T4YB 4G8FA 3ZE0E 4PCPA 5TF1H 1HO1A 2D0GA 2Y7MA 2WMIB 4DBSA 1GEHA 2QGCA 4W9HC 4XN2A 5C09D 2DJ4A 1H2JA 2FZ3B 4JM2B 1XCTA 3DX0A 4N2AA 2Q02A 1U41A 4HA4A 3NQMA 3O2WH 1E1CB 4P7QA 1LO5A 4O58H 1BAGA 4WDIA 2DZAA 2OT1A 5HYJD 4GKTA 4RGOL 3ZKXB 5E99L 3VD3A 4YO0A 3BG9A 4GQBA 4XP1L 3VABA 1N68A 3U0TB 3U48A 3VM7A 4LY8A 4JPQA 3S0CA 4HHPA 2VL5B 3AYSA 2FVKA 2A2IA 4HOZA 5DHXB 1VHNA 4TUOA 1CI1A 8TIMA 2W0UA 2ATKB 2DM7A 5D93B 4MNGA 1UXSA 3AWFA 3K6SA 1FWWA 3T0CA 1GHRA 2KZ1B 3B2PA 1G1CA 2FZDA 4U6HB 1BSLA 5DY2A 3MLWL 3ARBB 2VXVH 1SDAB 1LO3H 3DIVA 1BECA 1GYAA 4M6UA 1WFIA 1KEML 1F90H 4YSEA 1S7RB 3DOIA 3RX7A 1S78C 5A6KA 1BF8A 5DLLA 1IM9A 5T8GA 5EEZA 4RGMB 5JIIA 2P5PA 3UZVB 5EO0B 1V3LA 2Y6SC 1S3KH 3DGDA 3NEOA 4V33A 4WZ9A 4QE4A 4RETB 1ZA6B 1NM4A 1INQB 2UWEA 5DMIH 3UJIH 4JHWH 1VFOA 3O6FB 3SPCA 5CCKL 1T6MA 3KS6A 3LMZA 4M0XA 4BWTA 2K1MA 4S2BA 2ZDRA 2KYIA 3MA9L 2EEXA 2VMJA 3VKCA 5JORA 3ROLB 4EZMA 1XLKA 4NNCA 1UBSA 2TSBA 4OD3H 1UQSA 3GRWH 5E2VH 5F44A 5IG7A 5CEZE 1NEZB 1R3IH 4K1GA 5ADPH 1ZVYA 2WXMA 2A6DA 3BLBA 2Z8WC 3L5WA 1GOKA 7PTDA 1CLKA 5HHOB 1H49A 2FIKA 1XBYA 4KOCA 4FJZA 4Y5XB 5CC7A 3GSNA 4I3RH 5DD0L 3MWCA 4EAEA 1LO3L 2VXVL 3SIKA 3KPPB 3ZYJA 2Y8KA 2M1KA 1UENA 1HH9B 2JFCA 1XGEA 1UC4A 2HE5A 2V5JA 3MA7B 2VDKB 3MP4A 3N4FA 3UIZA 2WMPB 3WMPA 3HE7D 1T96A 4A1RA 5J13C 2G3IA 2VITA 2Y5JA 4LBRA 3QJSB 4LF3B 4XHJC 1RZFH 4JM2C 1O75A 3G6JF 4GKZB 5DMKA 4XO6A 2EEFA 4U1GC 3BLLA 3UNDA 5C5YA 5M3WA 3R8RA 5AALA 1BAWA 1U83A 4AZGA 2AJUH 3SDCB 3KPNB 4UINH 4ZMLA 5PAZA 5DC9B 1VKFA 5HHQA 1HIML 4K71B 3DN5A 2J1YA 3TESA 2IQ9H 4FD0A 1IV8A 4GYJA 4G8EB 4HWBL 3UGXA 5A2FA 3FPYA 1KTLA 1CGUA 2PD5A 5CIPH 2XPGA 4FJ6A 1BFOA 4N0UA 1LWHA 2NY1C 3OZKA 4PM1A 5I74B 1S9XA 2VELA 3JTTA 1W3NA 3VD0A 4XB3A 4XHJD 4KTDL 3HV8A 3TPKA 3G7TA 1E30A 3UOAB 1CGXA 4KI1A 5I75C 3ZTJG 3AZRA 5IDZA 2WN3A 4BZ2L 1Q2SA 5CINL 5IW1B 3VNZA 1LQ0A 2FO8A 2W0PA 4YUEH 2O9OA 1U92A 4R7DB 4XMXA 5FF4A 3B0XA 5AG9A 4JEJA 4KKCC 4H0LC 1D5ZB 4YDVA 4IW4C 5F9OH 2ZZ3A 5D2LB 2RQEA 5I18L 2HCVA 3DRTA 4ZFFB 2XFRA 1W1IE 3FF8A 2FZNA 1FAIH 5DJAB 1VP5A 1BIHA 3MRDB 1W3LA 2XSAA 3CEUA 2Q3XA 3FQWA 1RALA 2CW6A 4QCIB 3B0UX 1MJ7L 4OI7A 2HT3D 2ZXWB 3SCRA 3PJNA 4UQ3A 1FNGB 2VDRL 4EOWH 1RUPL 3B2UD 1XF0A 1F86A 3TA3B 3CBRA 5J12C 5JUEL 3PSVA 3HG1D 1W6LA 4OAWA 1A1MA 4G71B 1C9WA 1RA5A 1TPUA 3WLSA 5CGBA 1K3ZA 1G4EA 5CILH 5DC4B 7ODCA 1RURL 3US9A 3GZ3A 3VB9A 1Q1JL 3FH5A 3UC0H 1Z3RA 3EWBX 2WV8A 4LGSB 4HISA 5CBIA 3HZ3A 1EQPA 5EF1A 1ONXA 3TZVB 2NW3B 3EUUA 4IGBC 1YJDH 1UACL 5FUZH 3VI3B 5HYJE 3K4WA 2BDNL 4BZ1A 4D8LA 7ENLA 2P5EA 4N3UA 2AL1A 5BRZB 4EACA 4WY7L 4RZ5A 3KYAA 5M94B 3IMSA 4IU2B 2LAGB 32C2B 2DUXA 3VPLA 2B15A 5TQ2L 2Z1VA 1JGVL 4OR1A 5I1DB 3UETA 1CFMA 2ZOLB 4PV9A 1UW9A 4AYDC 3IIXA 4WEUD 2NNAA 2QQNL 3QEUA 4PTVA 4QRPD 3NURA 3BLPX 2SEBB 5LG1A 2ERJC 3VOIA 2XV3A 1R0AH 4KFMA 4KWSA 4WGHA 5F1UA 1MWOA 4B5NA 1G5AA 3U2CA 1D5MB 3CSFA 1XGRA 4JLRA 1MEHA 3W2LA 5D7SL 4PCKA 2Y06H 4L0ZA 3RMEA 1PY0A 3P4LA 2IWEA 1IGJB 4NPJA 3WKMH 5IOKA 4G82A 3TJXA 3U4BL 4D71A 4G5ZH 1BAFL 5B3JF 1BD2D 4RMRA 4XO8A 4HNCA 5I82A 3BH8A 3C3NA 3EOEA 5CO1A 4ZO7A 5EU5A 4GBXC 3VSVA 1XT5A 2WHKA 1E65A 3EYQC 3W1XA 2BLEA 2ZZ2A 3IDMA 1TYJA 3OKDA 4ELMF 2BNQD 3APFA 2J6EL 4MMZA 5KOVC 2NY1D 1ZE3C 3M0VA 5DGRA 4OCSH 1PO9A 3PWGA 5DQJA 3I74A 2WMPA 3SHSA 4Z7WF 2Y25A 1NKOA 3G04B 1AXTH 4OBTA 1ML0A 4WIWA 1HKVA 3A67L 2J1KA 2ZAHA 5AWNH 1ZTXE 2OJZH 1X5AA 3IM1A 4HK3J 4Y2OB 5E8OA 1HP5A 2Q3AA 5M1TA 2DPEA 5EZLB 3FJ4A 3EOBB 4NQED 2AZUA 4DETA 3GMQB 5HHPB 4JY4A 2Z24A 1OF0A 4LSVH 4ZG1A 1MVYA 5JOPE 2A3AA 3FSVA 3HAEG 5I74C 4OZIE 2EEDA 5B8CC 2D2GA 3Q45A 4O4VA 2DP3A 2ZZ5A 3LKNB 4C6MA 1TZAA 3GI8L 2QDWA 5C71A 1D5IL 3OZLA 2GFBA 5GSVB 1HKLH 2D2CC 3DV6A 4Y2DC 4ANVA 3B7SA 4HFWA 4PWGA 2CYGA 2HH0L 4PMNA 3LCIA 4KVNH 2VUYA 4FXKA 3S37X 5DJAA 1KBBA 5LHFA 1DQKA 4I77L 3ZDXB 3I7QA 1EDHA 2CRZA 3ZE1E 4BKLB 2HG5B 1Z7AA 1E43A 5F3FA 4DZBB 2X0HA 3CMFA 1D5ZA 2HISA 3GU1A 4ZUWB 2FZBA 4KMTL 1WBXB 2OMXA 3QY7A 3S2MA 2R1PA 2XIJA 1GQLA 3NVTA 4OUUB 5DEZA 3ZSSA 3DA0A 5DJ0A 5K9OA 4NKCA 3OG6B 2IDCA 4JFFE 4QRRD 2K45A 5DHVA 3AHYA 3NQVA 1TF4A 4GEJA 2OU4A 1LO0L 4ECNA 1GPOH 1TPVA 4DI9A 5LIWX 4IRSA 4IBWA 2DQTL 4HIXH 4OCXH 4R90L 2FR4B 3IVKA 1TPH1 6TAAA 2DIEA 4HMCA 2ZJSL 4JNMA 1W32A 4JRLA 4A3QA 4PUBH 1R1CA 4RDBA 5DD6A 3AZSA 5F1SA 1TV2A 4LNRB 4UFLA 3LEYL 3T77A 1YEEL 5JW4M 3QEHB 4WJG3 4YLBA 2DQGH 3COTA 1HDMA 4HGWA 32C2A 1WZAA 4PREB 4R5XA 4D9LL 5CC6A 2VR7A 5JIHA 1YADA 2VEKA 1RH8A 1E4MM 1VFFA 4P8UA 1RJYB 1HKFA 2APFA 4M6ML 3QQWA 4WI9A 4GZJA 2CXGA 1UOLA 2DTMH 4YBLC 2G2RA 1O5DT 4A2LA 5J4MA 1MUCA 3BE7A 3PY2A 3FH8A 4BFKA 3H2FA 1P1MA 4GQ9L 3NWRA 3TURA 1NQKA 5EZLA 5LNGA 3RCNA 4XC1H 3IJSA 1F3XA 1H9VA 4KJQC 3V0SA 1KA9F 4GRWB 5J3HC 3CDYA 4E41B 3PN8A 4Z7OF 2VRAA 1OAQL 5IBXC 1UQSB 1QBLL 1J86A 4N8VB 1SM3H 1HC1A 3L0NA 4MFDA 4ML4A 2EXTA 3P9LA 4NPYB 1GHFH 3TSBA 3IN2A 4QCIA 3CASA 1YEGH 3BKJH 4AVNA 1HYSC 4AD3A 2KLSA 4DPAX 4DO4A 2AKMA 3BZFA 2QCEA 1OTTD 2X4NB 3IDMB 1A7NL 1VAHA 4B7IA 4KCTA 2M2DA 4GI8A 4OJFH 3OZYA 4XVTH 4GYPA 4C4BA 4H41A 1D5BA 5B1BB 2J9ZA 4PUJA 4A8IA 5SWUA 1DEDA 1Y6NR 1Q1PA 2OEKA 5E9AA 3S7GA 5HA7A 3GZQA 3JWNG 1K8IA 2O6FA 2D7MA 3IPFA 3QUXB 4FTVB 4L5FL 2OGYA 5JPNC 1I8JA 4ZFGH 1NDVA 2P5NA 4GZEA 3TWCH 2WXIA 1OCOB 5DQPA 1U8PB 3BTNA 3OYXA 3EJYC 2OXHB 4AT6A 3WTXA 3T0EC 3RRAA 2I9LB 3V4PL 1MPAH 5DJYA 1MHPH 3LH8A 5DURB 3ZE1B 1VZWA 2WC4A 3QRLA 4TNEA 3SUSA 5LNVA 1G9NL 1U3HB 1FFPB 3H6JA 2ED8A 1WAWA 2E9MA 2IKHA 4OGXL 2IPFA 3CH1A 3ESOA 3SYQA 1NMCC 3YPIA 3BUVA 2WSKA 3LZ5A 2YBVA 4S1QL 3H22A 4IOSA 4AITA 3LZRA 3BVNA 1E90A 3A22A 3AWEA 3FQ2A 3MU3A 4D9QE 1EF2A 2HWZL 1CFTB 2UX7A 3VMNA 5I0VA 2I16A 1SFLA 2YBTA 4TX9A 5FAJA 5G2IA 4XNZB 4HUXA 4XVSH 4K3DH 4F58H 4DBUA 3L3GA 3VFUA 4M1BA 1KCSL 1MQRA 4CN6A 1DVQA 1OK8A 1U42A 4U1HA 4CDHA 1SHSA 5IMMA 4Y9MA 3SCSA 5BNXD 2ZUQB 2PF8A 4HWZA 5FSEC 4XBPB 4A8RA 1HTIA 4S1FA 3W71A 3BIKB 4HCRL 1NCCL 2NX5E 4XVEA 4ERIA 4DXXA 3V0GA 2YFOA 2DPKA 1A7RH 1TCRB 2BP0B 2R23A 4Z0SA 5ESAA 3W22A 5LZLA 4O02H 1UMLA 1LK2A 5I8CA 2CNYA 1P7TB 5B3JE 2JK5A 5JDJA 1JFHA 2QHRL 3H2QA 2NQ9A 1E55A 1M5WA 3G5ZA 4ECLA 3UQNA 4J2MA 4GUGA 3GTNA 2ACQA 4AY8A 4OJFL 1EJFA 2HE8A 4NT6A 2AERT 2XTJE 4BQBA 4PRHB 1C3FA 4KEVA 3UWUA 4R9HA 3SPVB 4MKVA 2QLVB 5HDQL 3URBA 3LQMA 1DDHA 1N55A 3OBEA 3KYOA 3UTSE 4F9LA 2ADGA 3TBTB 1CGWA 1KGXA 4ZD3L 3VQMA 2C8NA 4IK7A 4L8SC 5F7HA 3BLIA 2HJKA 1AACA 1IQDB 2QL1A 5JXAL 1V93A 1OAQH 4MAZA 1F4WH 4PJIF 4Y1AB 2R1MA 4P5RA 4ORZC 2Z31A 2XWCA 2GPZA 1NCBH 1LP9F 3CFJB 5GGQH 3UGRA 3VH8A 2X0VA 1KUMA 2EXOA 1ISYA 1ZLUK 3RFZB 1PVNA 2CLZA 1DV7A 2INEA 1UT9A 1DORA 3G6LA 1AKJD 3EOYG 2JVUA 1WUEA 3AQUA 2GAZA 1IT0A 2WZEA 3K2IA 1XF5B 4F7EA 3PL6D 5FF0A 2VHLA 5LXXA 1AD0A 5I02A 3NOIA 2YXMA 3PWNA 4JM4L 1CDJA 4LU5L 1HT6A 3VGEA 4LBEB 1A5UA 1HIZA 1JFQH 3NAAL 5KSWA 5G4NA 4PJIA 1BFOB 2YX0A 2ZSVA 4FI8A 5IFJA 2NQLA 1XTMA 1B5TA 3DXAA 1CLVA 4X6DE 4Z1PA 4MS8D 4UAOB 3U36B 4WY0F 3BAEH 1YNQA 1KB9J 5JZ7D 4MWAD 4LOCA 4DQWA 4KWWA 3V4BA 1KTDA 5CP7A 2R4RL 2IDQA 1CLZH 3MUGA 1VJSA 4GYPC 1WBZB 3P8JA 2ZX8A 4J3XA 3F7VA 3N42B 4F2MA 5KSAA 4LUTA 1E0XA 1JCKA 3KYMA 5TBOA 1B9ZA 3LQGA 1EO8H 2VXQL 3WNKA 4F48A 1FLRL 1G6RH 1N67A 4XAWL 4XBEL 5E2WH 1JFXA 4PJ5D 3TH6A 1PBGA 1ETA1 3UCDA 4E6MA 1JV2B 1MVFA 3N2JA 1MNNA 3BKCL 2XN9B 5HR6A 2XN9A 3MBXH 3WTSA 3HHSB 2TRYA 1HE7A 4XP4L 1RFDL 1QX1A 2I5IA 1NFAA 2IGLA 3AS2A 4ODHL 2E86A 1U1HA 4PS3A 3M1ZA 4PJCB 2DLFL 3WEMA 1EOMA 3TS8A 3CQFA 4PJCA 1HW6A 2AQQA 1QBBA 2YWZA 3RTQA 4N86A 1HJCA 4L9ZA 3VXUA 4K9EC 2O55A 2PLTA 2PP8A 3FMGH 1WUZA 1I1FB 4D2JA 4NZRL 4YWIA 3A3HA 5TQ0L 4UI2A 1UZGA 3C87A 2EC8A 4LAJH 1FVEA 2YAOA 1X5MA 1UJ3C 3R4DA 3NNTA 1OAYL 4ZQPA 3CLMA 4LDOB 2R9HC 3SPGA 1BD0A 1DUYA 1ND0B 4OGZA 1KJVA 4IICA 5B8CA 3FB6A 2HVBA 4Z1AA 4QRSB 1VFBA 4LRNH 4PMDA 3NEXA 4JREC 2CMRL 1CT8A 2AW2A 1TV4A 7A3HA 2YW4A 5FV1L 2WKOA 3VI4A 4WKAA 4QOKB 4C90A 3U7WL 2I7OA 1CF8L 1CFTA 1QFWH 2CJ3A 1XR8B 1JUEA 1KXQA 2DLEA 2OJZL 4TVPH 3QO0B 1OP3H 3E9TA 5A2CA 2OOFA 1XO8A 3HGSA 4PB4A 5JBEA 1LUCA 3RXZA 1E7VA 3RY6C 1AXTL 3EFOA 1JZDC 1QWHA 2BSSA 4HZLA 3HG1E 3V4PB 3IFOA 3X3FL 5T1MB 5T8IA 3CT2A 3UZZA 3W39A 2IKIA 2R9RA 1IBDA 4G5AA 4AX3A 1M71A 2E6QA 3S3DB 4MJ5B 3K4DA 3SDYL 4QITA 3HRPA 2UZIH 3UXKA 1XRSA 1B3YA 3TU9A 4NKMB 5CXPA 4D1IA 1GL4B 4ZDHB 5DUPL 1SPDA 3AYVA 3BL3A 1YDPB 3L3KB 3KWVA 4NZTH 4M6NH 2VYRE 3WNJA 2YMXH 2QIWA 1IO4C 4JZNB 3L4VA 3N44B 3N19B 4XTDA 4YHGA 5F2FA 4M6AA 2B3RA 1AOZA 1F97A 1YA5A 4MNHB 2XX1A 1I1AD 5DTFB 5GHWH 4OV5B 4YHZL 4HZAA 3R8BB 3OHXB 1VF8A 5KZ6A 4JJOA 4L4TA 1MXDA 5GS0H 4R85A 1UKOA 4R88A 1QO5A 1MY7A 2YPKB 2JIXD 5DDHA 1JVOA 4CSSA 3A4AA 3CE1A 4OZFB 1TPB1 5CPOA 4HQQH 4FNLH 3TOYA 3K91A 1HL4A 1ZLVK 5A43C 4E8CA 2FEDD 3ZR5A 1HQ4A 2PNDA 3GB7A 2FDMA 1RI8A 1E9OA 3IU3B 5E9NA 4AYEC 3TDFA 3P3TA 5TQ2H 3LNMA 3P3RA 4XWOC 4M7ZC 5C0RH 2YGQA 4G6AD 1I9IH 3EJPA 1FP8A 4L80A 1G6RB 1H8SA 1NFBA 4MDPA 4PMEA 3IB4A 3VE9A 2NQJA 3ULSA 1JPTH 3BIKA 1DBBH 4LCYB 4EI5C 3L6FB 4UUIA 1MIEH 2K6ZA 2ZP8A 5I1AA 2E6FA 4IPIA 1CIDA 4PTUB 3RWDA 2Z2AA 3SBRA 1A14H 4NBYB 5KSAB 4LQFH 1S8DA 2FKPA 3EHBC 1PKOA 4Q0XH 3I65A 3GQFA 3LV5A 3CHQA 4EIUA 1SDDA 3LQAL 3A4XA 3VKKA 4FQXD 4YHOH 7CGTA 1MSPA 3GD6A 4DY1A 1NBVL 1RU9L 4ZW6A 3W85A 5A7EA 1KN2L 5ENLA 4EAMA 4E42A 4E8DA 3BLFA 4EUPG 2R39A 4UTBL 4IKKA 2AXWA 4I18A 3BIAX 1WFTA 3CDGA 4I85A 4UU9B 4XPBL 3K7UA 5ESQB 5JO5B 2QS8A 4AEHH 2FSDA 5CZXC 4OIIH 3ZE0F 2KT6A 2F19H 3JVGA 2JV6A 1B2YA 1XF1A 3QAZC 4GAJH 4YHIB 3GNPA 3QHFL 3W9EA 5I07A 1M7OA 1KLFB 2EDDA 2VC2B 2EE0A 3PIQA 1BYPA 4HUCA 3TJEL 1CCWB 3OA3A 3RPMA 3S35L 1SR9A 4G8GD 4HSNA 3S6TA 4FTVA 4PJ5E 2J1ZA 5EY5A 1BV8A 2WLIB 4JKKA 4LNYA 3GHBH 3U1QA 3V0JA 3B8WA 4L3EB 3W6MA 1MQ8A 1Q0XL 1XGYH 2JK2A 2H6PA 5E6YA 5L8LB 1JCLA 4JFHD 1CD1A 3GXFA 4YEFA 5HMEA 8A3HA 5GS2H 3GC5A 2XFGB 1BQUA 5FIPA 3USZA 3IMBA 1PNDA 3OLEA 1DDHB 2ANUA 3BAXA 4G6FD 5FA4A 3NPWA 4ZBCA 2HRPL 1HYRC 4QHRA 3FBQA 2F1EA 1PG7H 2HXAA 4JO2L 3FJ6A 4W85A 4DAIA 3EYVB 1FI8C 3P77A 4HSAC 4I3SH 2NQ3A 4MYWB 4QTIL 1QVBA 4Q97A 2JBMA 1A3LL 3KAOA 1EFXB 4X8GA 2F2HA 4PV1C 1RHFA 1BLIA 5FEXA 1MEIA 3QW4B 2IPTH 1HL2A 1F2XK 2ZUNA 2A6JB 1WZMA 3VI3E 3UMTA 5ESAB 5AEAA 3OAZH 4AV4A 4PLKC 3OZMA 1KJ2A 3SUWA 2H7WA 3HNVL 1M03A 4X9YA 3LNPA 4HS8L 3TJIA 2Z25A 3ZWTA 1TEFA 3JVAA 4RAUB 4ZXBB 4M5YL 1B6UA 2NUPA 3GS7A 3GYCA 3VOGA 1PHWA 4Q4KA 4KTEL 1BWWA 5DD0H 5IESH 4IJBA 4YBLB 2PRHA 5CD3B 4XB7A 1PMYA 2JQAA 3VXRB 1KLZA 3TNMB 2NRDA 2VAJA 4NCDA 3W81A 3GNDA 3K1GA 3S1GA 4NKOA 4KWUA 2CHWA 4MXVE 1UIOA 4H0GA 2NX5B 2DORA 1EF3A 5DR5L 5D2LA 4AKPA 1RJRA 3BN9D 1Z5YD 3GS4A 3T42A 4U3HA 3TL5A 1A21A 1AZZC 3QORB 4QXUH 2PCPA 4NHUA 4TV5A 4FFZH 2X6VA 3W3BA 5E08L 4GT0A 5J11B 2J3SA 4P4RA 3QULB 4Q2ZB 1RHCA 1HVQA 4QISA 2ZZ1A 4FOKA 4ZQRA 4GNJA 3LKOB 1TJIH 3V5DA 1WAAA 5GGTH 3VWJA 3PU7A 4PGBB 4PRDB 1XAUA 4Q7BA 3TJ4A 1R9XA 1N2VA 4OM0H 4EMZA 2H2SD 2VDOL 4LP4A 3H8AA 2YL8A 2BK8A 3FH7A 3QDGB 1A7PH 5DWUH 5A5WA 1JV5A 4F27A 5DRXA 3CVBA 3VFTA 1KQYA 3WH5A 4Z7QF 2P28B 3TX9A 4JTRA 1W3JA 3HR5B 3X17A 4AQ1B 4PG9B 3WS6A 4K7PX 2CAKA 3EOBA 2VLMD 3DOSA 4IXXA 1MQPA 1ITBB 1M1XA 4FPSA 1W0VA 3OGSA 4BDVA 4HIEA 2HFFB 5T1LA 2F53A 3F5WA 3KM8A 3NQEA 1P7QB 2PPFA 4DSYA 4K8GA 3CTTA 3R7QA 4BSJA 1ME7A 3KH3A 1HILB 2WNZA 4R3UA 2NNCA 1EYEA 3IJSB 4WK4B 3OLIA 3BWAA 4NS0A 4WTZG 5IQ7H 3ZRFC 3BRDA 4XTIA 4IQEA 4POUB 4NJKA 1OIOA 5CJBA 1GXEA 4ATLA 2CDFA 3VGHA 4QXGL 4KQ3L 2AJXH 3S9ZA 1GTFA 5D2TA 4YXHL 3WL0A 1XQKA 3ZX1A 1SYVA 3DFNA 3MN8A 4N2FA 4EX4A 4Y4HD 3WNOA 3G5YA 3F7JA 1FDJA 2WJ7A 4MHHI 4DGVH 1R33A 4L4VB 1Q0XH 5D96B 1XLMA 1MCWM 1G87A 3QWRD 3UO8B 1H5YA 4HMNA 1UZ8B 4G3YH 4JHZA 3BH8B 4DJED 4Z1DA 1SEBB 2MKLC 3PWLA 4ZW3A 4UT9H 4O15A 3KZSA 2K4WA 3TC3A 2JKIS 3B4NA 1NBCA 1IJ9A 4E0CA 4R53A 2W66A 4NO3B 1ADSA 4Z7UF 3R8GA 1S2VA 3AXMA 3GXMA 5JHLA 3V9EA 2QKIB 4OIIL 4Z42C 4AEHL 3NQFA 2V7HB 1PZ2A 4WKHA 3JWDC 2X4SB 2BW5A 3BAIA 4LEXH 5E5CA 4O10A 5F0JB 2X7WA 6PTDA 4MNGB 2ZPKL 4UT6H 2KC0A 4RW3A 3K1KC 1BYNA 2O56A 3QIBB 2R1XB 3MV8A 1E8XA 1F3DJ 4IFKB 4R4NC 2J8UF 4U28A 1HO4A 4IT1A 3APDA 4KK8D 6FABH 1YYLH 5ISZB 4HMEA 4AYID 3WTYA 4JPWH 3AWOA 3BGGA 2H1PL 1US0A 4N3TA 1TSHA 1MRDH 2J44A 3QG7H 2YD8A 2OKOA 4PMOA 4OJAA 5EKYA 5F9DC 4AE0A 5AYYA 1TQUA 2C1GA 4A6GA 2F8OA 3QDJB 3VIMA 3UVIA 2H6OA 2KMWA 4Y2NA 1UWXK 1KIUA 2F74B 3HE6D 5KG9B 1HWGB 3L0GA 2POZA 4BJLA 2YXWA 2OEMA 2H3XC 1ZGLB 4YQXL 4MDJB 3DBPA 1IWPA 2W5FA 4JFYA 4ZMOA 1M53A 2R69L 1HCFX 5IR1B 2R0KL 4YZWA 3NESA 3S3BB 1Q85A 5CSZA 4WK2B 1JTTA 1QSVA 1A1OB 2B4CH 4LVHC 4NWUL 4TNWK 1MH5A 5D7JC 3UP8A 5FGSA 2C71A 2ENJA 1C16B 1Q72H 2F8IA 3RWJB 2W67A 2MFNA 1GOIA 3PZNA 3RWJA 2XICA 1D5RA 4WUUD 2RDTA 2M26A 4LOVA 2VERA 3OJVC 5EC2A 2PP1A 3WTVA 5AHIA 3W9ZA 1RPKA 1NFDF 1WTGT 4JPVL 2R2CA 3GGWB 4FXLA 5HY9A 4EKXA 4DN3L 1G4PA 2ZRWA 4GKNA 3UP6A 1VZHA 3NM1A 3GH5A 3OZ9H 5HYJA 3OXRA 1F11B 4LIQH 5KN5A 1A9BB 3QLDA 3TSMA 5T1JA 3L45A 4G6KL 5G1YA 3N6HA 1ONQA 4KQ0A 4Z17A 1Q9LB 2W9EL 4OZHE 2HVOA 1Y07A 1BD2E 4Q9BA 4EZLA 4U6HA 4ZCWA 2BNRD 5DA4A 1A5CA 3N9GL 1NFDA 4AMKL 1AVAA 3VNLA 3R0DA 1QOKA 2SEBA 4A38A 2YL9A 2XN1A 1JHKL 2X4PB 3GMPA 4WW1A 4XVOA 4NJAL 5F6IC 3ULUC 3EOTH 4YR6A 3W56A 3ZDXE 2REQB 3M44A 3V79C 4GRLC 4F0HA 2JALA 3IDXL 4Q14A 4KZDH 3K6OA 4WOZA 1O12A 1TZHA 2XN0A 3EJZC 1IM9D 2ERJB 3F12A 4EI0A 5D2XA 4R7WA 2NUWA 1G7HB 4QD2E 1EBPA 2R1WA 1GIGL 5HWNA 1UR2A 1ONWA 3RWHB 4IMCA 4HKZB 1MREL 1NIAA 3QEQD 3BVJA 4HGXA 3UWEA 1A64A 3JZ7A 4GQQA 4TOQA 3THAA 3JV6B 5I6OA 1YC8A 3FQTA 3DX9A 2WQAA 4GRWF 3X1GA 3O07A 3GPSA 3I6RA 4DIAA 1X8FA 3IV3A 4PYGA 2IPKB 2NTFA 2H32B 1AO7B 1QWUA 4GIRA 1UA7A 3ABMB 3TLLA 4JJ5A 2A6DB 3L5WB 3PFMA 3HG4A 1EQWA 3CFDB 5IXEA 3D0LB 5EBWA 2ZRYA 1KCRL 4CVWA 1NMBH 4OAWB 3ETTA 1D7DA 5FGCB 4RFNB 3WD5H 1HJXA 1GZQA 1JQVA 4RMSA 2DMGA 1UD3A 3ARDA 2F08A 2VISB 4MD5B 1FGVL 4Z76A 2F9RA 3KTCA 3T0BA 2DZBA 4PY8J 2XPKA 4XPFH 5DO8A 5FR3A 2FYYB 1U8IA 1XIHA 3N13A 2WCSA 1KJMB 3COOA 4LS2A 2CUHA 1EERB 3RCMA 1M9WA 5FA3A 3U0HA 1IXPA 1YNTA 1RZQA 2YS4A 2WLLA 5F9AC 4BA8A 1C8VA 3B7YA 3P1VA 4DK3A 1XVSA 3R2GA 4U49A 4YX2H 3LMJL 3MTXA 1BTMA 1F6FB 2BSLA 3ULUE 3O2LA 4WU5B 3BUYB 4ETQA 3BSZH 4EJ1C 4Z7NF 3BAEL 5DFWH 1TJHH 5MI0C 2XLLA 1KIUB 2F74A 1P1ZB 5KG9A 4DF1A 2V9RA 4OFQA 4F9JA 4GD0A 4DWSC 1GOFA 2WQ8A 2QR0A 3WIAA 3ZL4L 1PPIA 1KF9B 1EJUC 2WUCH 2KQNA 1EEXA 4W81A 2P43B 3DOSB 5IJBC 3DO3A 2YJLA 3LPWA 4WCJA 2WB1A 2OCCB 3WSQL 2ZX9A 4HUUB 4A6YA 3DGGB 3DJSA 5IEKA 3HN3A 1SO5A 1KRCC 3QR0A 4Z78B 2XNAA 1AYOA 4JFED 2Q6WB 5GGQL 4Y19E 3PF3A 5B80A 4FG2A 3MZGB 4NKIL 2GVJA 2KLTA 4KXAA 2J8OA 5F9JB 1CFBA 1CBVH 4PN6A 3GKWH 4X9IA 3FN0L 1J0JA 3I75A 3UROR 1NU5A 3WQOA 1P0NA 4YU1A 2JQZA 4XN8A 4YSSA 5C55A 3DK0A 1TQJA 1I3GH 1R9ZA 3HPXA 3RG6A 4TNGA 3ZIMA 3B03A 4J2PA 4U3SB 4APQB 2FMNA 3G6MA 3ZXAC 1RJPA 4ZFMA 1VFUA 4GSXA 4LLVA 5J6HB 2VXSL 1I0BA 1Z48A 4WY0A 3LCGA 1EHNA 2H3NA 4RISH 4M4RB 1E5BA 3NL6A 1INEL 5IEHA 1AFSA 1E2WA 3KXFB 4G1MA 3EJQA 1H8OA 4U6VL 3GLZA 4QLWA 3MI3A 3OMAB 4O02L 2ZF8A 5EUOB 4C6DA 3QH2A 3AACA 3U2SA 5BXFB 4OF3A 1WHOA 3SOBL 4PGEA 1LD9B 3F6IA 3LM7A 4D6GA 3F7LA 3DHPA 3QHNA 3RFZC 1WB0A 1M7XA 1E9YB 1ITXA 2HA1A 4LLDA 2MCMA 4AW7A 4Q4RA 3MUUA 3VMOA 2Q10A 3PZGA 3B7RL 1JBJA 5F1OB 1MAJA 1AP2B 4N87A 1W9BM 2EXWC 2PP7A 1W0WA 4PAZA 2VLJD 3RGVC 1GY1A 4YHLH 4BQ9A 1N7MH 2ZZ6A 4IRJA 3TNBA 2XHNA 1JPSL 4XTRC 1PU0A 3S35X 4S1DD 3FQNB 1OARH 2AK4E 1Q6CA 1P84K 4DFHA 1LO2L 4RX4D 5E2JA 3QW3A 5J5RA 4HT1L 4H8PA 1I7TB 5F6HJ 4OFYA 1RA0A 3E5BA 1AC0A 1FL3A 5T33L 2LW3A 2QGDA 1RHHA 1MPAL 5D2VA 1C8QA 3WNMA 3P5ZA 3AT8A 2BVPB 3BGMB 3MRIB 4GAYA 1ZHLB 1RK1B 1THAA 1T7LA 1DQMH 1K4GA 1UH3A 4C83B 3T6XA 2IFGA 5J11C 4EUPB 3FYOA 3MU7A 3P4MA <