4UQBA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.68 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
390
structure length
390
Chain Sequence
b'HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
total genus 135
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqbA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqbA02
1PZ2A 1E6XM 5I23A 3GXNA 1JZ5A 1EA9C 3A47A 2W61A 2ZWYA 3W29A 2CCRA 1QBAA 3VGGA 1E72M 1F4AA 2WCGA 1C90A 5DMYA 2NW0A 4M1RA 3AJ7A 1E55A 1MW3A 1HJUA 5AY7A 4XV0A 1KBKA 2WXDM 4PTVA 3D4ZA 3GBDA 3N17A 4V28A 2XN2A 2J77A 1Q6DA 1KXTA 3GXFA 2WVVA 1PZ3A 1DWFM 1VJSA 5A6JA 2Q8XA 2IGTA 3WF1A 4OBRA 3MUY1 2XWEA 4W87A 1UD5A 1E6NA 1ODZA 3VIKA 3A4AA 3T0BA 1OGGA 5IHSA 1TQUA 2EBNA 1VIWA 3LRLA 2OWWA 5D9MA 3WD1A 1OT2A 1EH9A 2WB5A 3AMCA 3PBGA 4PUDA 2PWGA 1OGSA 2CKSA 4D6JA 1G01A 4UQ9A 4E8DA 4UZUA 4LXFA 3BAKA 3PTKA 2D3NA 1W9VA 3ARRA 1RPKA 9CGTA 2VZVA 4UFJA 1TE1A 4NZFA 4E8CA 2GDVA 1US3A 3I3DA 5AYBA 2WMKA 1VRXA 4H8HA 2ALWA 2VUYA 5DO8A 4MJ4A 4PMYA 5A6MA 5I77A 3WQ4A 5TD4A 1CEOA 4HU8A 1CGXA 1AVAA 1WPCA 2XN0A 1PX3A 4DM1A 1YQ2A 1LF1A 2WSPA 4UOZA 3BMVA 2WHJA 4MNJA 4A3YA 3ARSA 2BY2A 5EFDA 2V3DA 4ML4A 3CUIA 4AMWA 2BXZA 2XGBA 1R86A 4S3KA 2DGAA 5ECUA 1WZKA 3CUFA 3HG4A 3RM4A 1XH2A 2WNWA 1C3FA 1G9HA 3IJ8A 2Y8KA 3ARZA 4B15A 1O7DC 1GQIA 3SCOA 4Z2IA 1LWJA 1TQVA 2TAAA 1XH0A 4DO5A 1PX8A 1RH9A 1CXKA 4EKJA 3F5KA 3CZLA 3SCQA 3BLKA 3APGA 1V6YA 2WWDA 5E09A 1K9EA 1UHVA 1US2A 1UR2A 1BYCA 1WKYA 4TVCA 4OGZA 2G3IA 1NOFA 3A4WA 1R8LA 4GIAA 2BY1A 3GXPA 2CERA 2V3GA 1JYWA 3MS8A 1CXLA 3DX1A 1QWUA 1XYZA 3VX0A 1JYXA 4F8XA 1BGAA 1TZ7A 4D6CA 2BVTA 1BFNA 3L4UA 1E3ZA 3PZVA 1LL6A 3MUZ1 2WC3A 4M8UA 3ARUA 5BXTA 2ZUVA 3SUUA 4U5KA 3WEZA 4PSRA 5A8MA 1W2VA 2VJXA 1KXHA 4WSKA 1E6ZA 5I6SA 1QI2A 4HMCA 3A3HA 3CZNA 1BG9A 1NWTA 3WH7A 3AMDA 3WKZA 4CD6A 2O9PA 2IUZA 1GNXA 1AQHA 5M03A 3ZJKA 2XIIA 3CH9A 1HJQA 1MQPA 3RJXA 3VMNA 4BS0A 2VRQA 3VD3A 2XVKA 1FH7A 2PBOA 4NF7A 1Q4NX 3U57A 1W1TA 3MI6A 3MV11 1M04A 3GXMA 1KGUA 1OD0A 2HISA 3K4DA 2WANA 2V38A 4UNIA 5HBFA 2J7EA 2W4XA 5AYIA 1UUQA 3ZMRA 5C71A 5GNXA 3W26A 3A23A 1JAEA 2C8NA 4OUEA 4RE2A 1ISZA 3BSHA 1QNOA 2J7DA 3UR8A 1GHRA 1T0OA 5E1QA 1UWUA 3LX9A 6CGTA 4PMXA 3T09A 4UQBA 2WMGA 3J7HA 1E43A 1V0LA 3M46A 1JYVA 2GK1A 5DT7A 1DHKA 3PZTA 2QF8A 4PMVA 3UR7A 4HOXA 1OBAA 1VENA 2O9RA 4DUVA 4CCDA 3EDDA 1JFXA 2ZX7A 3A5VA 4H2CA 2CBJA 4DUWA 4EK7A 3GNPA 3WL0A 1E4NA 1BG4A 3GXDA 1R33A 1TQWA 3K1DA 3VKKA 2FE0A 4ATLA 3BCFA 2D0GA 2BHZA 1WP6A 2QMKA 3D52A 4IPNB 2FH8A 2CYGA 2YDRA 3MMWA 1DWJM 2DIEA 3LPPA 3TOPA 3EMQA 3MO4A 1HKJA 3FNDA 1UD2A 2BXYA 4HA1A 3EDKA 3SCTA 3TTSA 1HT6A 2EPMX 1MYRA 1QW9A 1OGBA 4J7RA 3LPFA 1HVXA 2XIBA 4IUGA 4JKKA 5ABGA 1H3GA 3EMCA 2F2HA 3WSUA 3BAYA 3AIWA 1TCMA 2A3EA 4ZFMA 1JI2A 4AYSA 2ZXBA 3DECA 4J3XA 2EAEA 3CV5A 3WNPA 1V6UA 1KXQA 4D71A 1E40A 3BAIA 3GXIA 1TFVA 1ISVA 2QLYA 3HJEA 3VD7A 4NZCA 3VSVA 4MADA 3QHOA 1J12A 3EJRA 2G3MA 4J3TA 3WUGA 2JIEA 4W84A 3BUQA 4TVUA 5LA0A 2VCCA 1KFWA 2FH6A 3VDAA 4L4PA 1FA2A 1J9YA 3S6TA 3WMBA 1MW0A 4DUXA 2NT1A 4NRSA 4EE9A 4AZBA 2WHLA 2ZXAA 2VVSA 2ZUTA 3VM5A 2CBUA 1X1NA 1HJVA 4MPKA 3EDJA 2GJXA 1LJYA 1D3CA 3EDFA 3WQ5A 3L4YA 1HXJA 3A21A 4QCEA 3LXBA 1VEMA 1QX1A 1ZU8A 4JCMA 3OB8A 3AHYA 5D4YA 2J4GA 1C92A 1JDCA 3F5LA 3BVTA 3WELA 1RD6A 1ZB5A 1TUXA 4GPNA 2X2YA 3M6DA 4HU0A 3EBVA 3ZSTA 4HZ7A 1JI1A 3PN8A 3GH7A 2VZSA 1E1FA 4YHGA 1SFSA 3DHPA 3WENA 3ECQA 5CSYA 1V3IA 4C7GA 2ZUUA 5HNNA 1J0KA 2D22A 1UR9A 3BSGA 3BXWA 1WDQA 1X6NA 1C8QA 4PTWA 3WDPP 1GOKA 1E5NA 5AC4A 1B90A 3UG3A 3EJTA 5IXEA 1FFRA 1UR0A 2GK1B 1K9FA 4AIEA 1UD3A 4ATWA 3PTMA 4A4AA 1BYAA 3CLWA 2J79A 2BY0A 2PBGA 3CHEA 5EBAA 1KCLA 4IPLA 5I3DA 1RP8A 1W3LA 3WY4A 1VBRA 2GJPA 3BLBA 2GVYA 2WC4A 3RO8A 3M7SA 2J7BA 4AIOA 1CENA 4CU6A 1GOOA 1KTBA 3WMSA 2ZUMA 4AZ7A 2XSBA 3BCDA 4WK9A 5ABHA 1ZL1A 5JUVA 4AD4A 4BQ2A 1QI4A 3AHXA 4DWSA 3AIEA 1SMAA 1B3VA 3WMCA 1Q6GA 1LWHA 4JCLA 4CN1A 3QHNA 3GZAA 1TR1A 2A3HA 1C8YA 2XPKA 2D0FA 1V02E 3LPGA 5M5DA 1CXFA 4PMOA 1QOXA 1W1VA 1ECEA 1NWUA 1V08A 1XCXA 3K8KA 1GZJA 1WZMA 1JF6A 4PCTA 2XM2A 4AD3A 1B3YA 3MU7A 4LGXA 1KB3A 1F4HA 2IXVA 1XSKA 2ZXDA 1W91A 1I75A 3H53A 2F1BA 1V6VA 2X2IA 4ZEPA 4J28A 1HWWA 1B3XA 1NM9A 5FKYA 1J11A 3DX0A 2OSYA 1UH4A 4CKQA 3UG4A 2G41A 3L4ZA 3OGRA 5D9NA 3N18A 3F5JA 1R7OA 1W3JA 3N9KA 3CHCA 2E9MA 3THDA 3CC1A 1B9ZA 2XFFA 4IISA 2CBIA 3B9EA 3VD9A 2WK2A 3VGEA 3OA5A 3NSNA 1CXEA 3BUIA 1C93A 3PZGA 3VIHA 3BMWA 1KXVA 4KRTA 3ZJ7A 3LXCA 3BC9A 1ZBWA 3DYMA 3NSMA 1LQ0A 1JYNA 4ZXOA 1OIMA 1CTNA 3VDHA 2EPNA 1WNOA 1J0HA 1JGIA 1C7SA 1NOUA 2X2JA 4AD2A 5I24A 2VZOA 3K46A 1W9PA 3L4XA 2UY3A 4DM2A 1WAWA 3VILA 1GONA 1HIZA 4PMNA 2VI0A 3CBWA 4UFLA 2UY5A 4AMXA 2VQUA 5A6AA 4HMDA 4GO9A 4A3HA 1KWGA 4KH2A 5C8BB 1BAGA 1QW8A 4LYRA 1QBBA 4AZCA 3RILA 4JFUA 1BQCA 2C0HA 3W25A 1TVPA 2B31A 1SZNA 4EANA 2CKRA 3AS0A 5A8OA 1V0MA 3VOCA 1E0XA 4JKLA 3T2QA 2G3JA 3W81A 2X05A 3UERA 2W91A 2WWCA 2YBTA 2JF7A 2PWFA 4MDOA 2F7PA 3VM7A 4NSBA 4GQQA 2ZUWA 2WYSA 5FL1A 1R34A 2AMGA 2EABA 4DWSB 2DDXA 3D5HA 5BROA 4JFSA 3A6OA 1CYGA 3POHA 4M24A 3WBAA 3OZPA 1MQRA 2JALA 4QP0A 2XUCA 1H2JA 3TTOA 1J0JA 4JZ5A 2D24A 4D72A 3AMGA 5DT5A 4CVUA 2O92A 4OBSA 4V27A 4W5UA 4U31A 3U7VA 4HMEA 4TTUA 4U2ZA 4CD7A 4ACZA 3VGBA 1MXDA 1E4LA 3WL1A 2XWDA 4P7QA 3CZ8A 2V5DA 4B3KA 4J3SA 2Y2WA 2WMIA 4J3WA 3AROA 4CGTA 1G5AA 3VSTA 1JG9A 1M7XA 2W66A 5A1AA 1B31A 1SR0A 1WE5A 2VX7A 1PEZA 1H49A 5A2BA 3WDJA 1XHGA 3OIHA 3THCA 4E4PA 2XSAA 5CXPA 1O6IA 2DT0A 1UWTA 2ZX9A 3TV8A 1TQSA 2VZUA 3CHFA 5A6BA 1ZJBA 4B9ZA 1DWGM 4J3UA 3SEPA 4XZWA 2ZX8A 4AZHA 1W3HA 4C7DA 1GORA 3ARWA 3VDCA 4UQDA 3AXHA 3S5ZA 3AIUA 1DP0A 2VMFA 1JD7A 2EQDA 4D6IA 3FY1A 1UOKA 1BSIA 4QLLA 4R5EA 1CGYA 1JZ2A 1ZBVA 4PN2A 4MTVA 2YOCA 1EHAA 1B30A 1OB0A 3ALFA 3DC0A 2ZXQA 5A8PA 2E40A 4YHEA 3AYRA 3O6AA 5IFTA 2OW7A 4M56A 2A3CA 4MDPA 1NP2A 1D2KA 1TA3B 3L2LA 2YKKA 1A47A 2WCAA 3VMOA 2XM1A 2EJ1A 1EGZA 4PBGA 2OLHA 1DWHM 3IAPA 2VQTA 1XV8A 1GOWA 1CBGA 2YLAA 1RP9A 5LA2A 1HP5A 2PWDA 2EACA 3OLGA 4X0NA 2OW6A 4HOWA 1W1YA 2WZEA 1PJ9A 1NWRA 1CGUA 2JEQA 1Y7VA 5E6ZA 3H54A 1G1YA 5E70A 3WD2A 3SURA 1HTYA 4B9YA 5CPQA 1GUVA 1VFOA 4GI6A 2Z1KA 3ALGA 1XCWA 4CU8A 2CESA 2WVVB 6TAAA 2DH2A 3M07A 4UCFA 4FNRA 1EQCA 1PPIA 3PZ9A 1GJUA 1XC6A 1HJSA 1LLOA 2XVGA 3AOFA 3WY3A 4H8VA 1R85A 2WM0A 4URIA 4W5ZA 3W6LA 1BVNP 1VEOA 1VJZA 2C7FA 1CGWA 4X9YA 2JF6A 3NJ3A 3MV01 1WZLA 4GXPA 4PTXA 4KGJA 2XVPA 1J18A 1XSIA 1JL8A 1FFQA 2HVMA 1QNSA 1KGXA 3AHZA 4W93A 1CGVA 3VINA 5EMYA 4NZJA 3GNRA 1FOBA 2WBGA 4U5IA 1EOKA 2EPKX 3U5UA 4AW7A 4P8XA 4HZ6A 3U5YA 5F7UA 2WLZA 1PAMA 3N15A 4L4OA 4LQ1A 4F66A 3CZJA 2FHFA 3IK2A 4JIEA 4AD1A 3KL5A 1HF6A 2J7HA 3CHDA 4JL1A 3GDBA 2UY4A 4DWSC 2WMFA 3AHVA 1W3KA 2DT2A 1UA7A 2PC8A 4Q22A 3MANA 2BVDA 4WJXA 2D0HA 4JFTA 3E1F1 2Y24A 2WW5A 5JBEA 1ZS2A 1NH6A 4PMRA 1CGTA 4AEEA 2MANA 2BY3A 1JXJA 1V3KA 1LL4A 2XFYA 2YL5A 3WUFA 3ZQ9A 4HP5A 1UWIA 3ZIZA 1I1XA 1XD1A 1ZBKA 4TOQA 3SIMA 4PMQA 3AHTA 4EAMA 1D7FA 2WVSA 4RE4A 3VNYA 4QLJA 3SCVA 3AXIA 2AAAA 4PUEA 1CZ1A 1JDAA 1JNEA 4AEFA 1QHOA 3CIVA 8CGTA 2E9LA 3QHMA 5I0DA 5CZKA 1K6AA 5CPSA 1JZ8A 4E2OA 4WKAA 1V3MA 2XFRA 3OBAA 1V02A 3K4AA 5JBDA 2E8ZA 3OGSA 1FP8A 1KGWA 1QPKA 3TONA 2O9TA 4LYQA 3WY2A 4MB5A 4AIUA 2WHKA 3DX3A 2XG9A 3VIJA 3KE0A 1UKQA 3SCNA 3ZJ6A 5HOSA 2WMJA 3UCQA 3O9NA 1N82A 1E15A 1E56A 1JAKA 4PSPA 6A3HA 3NIYA 4KGLA 1E3XA 2BV9A 4S3JA 5EFFA 1K9TA 3SCUA 3AXXA 2DIJA 1OM0A 4CD5A 3NCOA 3A4XA 2A3AA 1CWYA 1UWQA 1HP4A 2ZOXA 1C7TA 1FP9A 4GI8A 1G94A 1V03A 1XSJA 4UFHA 3ZT6A 4RE3A 3BLPX 3B8SA 2Y4SA 3KL0A 3QOKA 3ZT5A 4C7FA 3SUWA 1W32A 2W92A 1QI5A 3POCA 3VNZA 3WUBA 3QR3A 1H09A 1GOMA 3VD5A 5AC5A 2J47A 4AZIA 5CLTA 1GOQA 1KR1A 2ZICA 4GZIA 2DSZA 4ATDA 1BVZA 2VT0A 3ZO9A 3EJUA 3WDHA 1PIGA 1XH1A 2BNJA 3DX4A 2IXUA 3VTRA 3PZUA 3LXAA 2CIPA 3VIPA 4AD0A 3AIQA 1I1WA 3EJPA 4LYPA 1WO2A 1H0IA 3GH4A 4YN5A 4H04A 3GBEA 4QDMA 4XX6A 3MUIA 3TP4A 3WNOA 3CZSA 2X0HA 1J0YA 4Z2LA 3UG5A 3VIGA 2E8YA 3I3EA 5BYWA 2VVNA 1TQTA 2Y5EA 1W9BM 3QOMA 3WFZA 1UQZA 4IM4A 3VIOA 4ZE4A 5LA1A 3GNOA 5A6LA 2ZUSA 1LG1A 3EDEA 3BAWA 3BUDA 2VR5A 3WF4A 3OLDA 1S46A 3AMLA 4B16A 3AIBA 4JFVA 5BRQA 3BGAA 2RGMA 2DSUA 4GZJA 2E9BA 3W82A 5A94A 4TTGA 4UFIA 5ABFA 3ZSSA 4J27A 4HA3A 4BA0A 4ZENA 5E9AA 4BQ4A 5BWFA 5HPCA 2EO7A 4Q7NA 3PHAA 1V0KA 3CPUA 1GVIA 5CLWA 2WPGA 1QHPA 2FYVA 5BXRA 1UD8A 2X09A 2V3EA 5HXMA 3PZQA 3IANA 3W27A 1FHLA 3AI0A 4U2YA 3B9AA 4W8LA 3MSGA 1CECA 5CGTA 3RMEA 5CJ5A 3VGDA 5HDRA 3EJSA 3W38A 2F7QA 1EQPA 2G8ZA 1BF2A 3I3BA 4P8UA 1EHNA 3EMZA 3HN3A 3VIFA 1PBGA 4FLQA 3WY1A 4MNMA 3BH4A 2J7CA 3MSDA 2OYMA 3OG2A 2NSXA 3NYDA 4GI9A 3A22A 1MQQA 1MWOA 2YIHA 1E0WA 3ARTA 1B1YA 5DFAA 3T0DA 4NRRA 3L4VA 2Y8VA 2E0PA 4OZOA 2RGLA 1XRVA 1E71M 2GJXB 1KR0A 2XTKA 2GJRA 4D6HA 3CZEA 2DT1A 4MAZA 5A95A 4BQ5A 1C8XA 2O9OA 1R47A 4FNQA 3UESA 1KQZA 1V3JA 1AMYA 3DHUA 1ZBCA 2DSVA 4UQEA 4CCCA 4P8WA 1V3HA 4AZGA 3RCNA 4FLOA 1JXKA 2F61A 4MJ2A 3CZGA 1BLIA 4JKMA 3RDKA 1NARA 1MW1A 2GSJA 3GM8A 1O7AA 2YLLA 1BHGA 4TXEA 2ZIDA 4X0VA 2CHOA 5D9OA 2JFEX 3FHQA 3PZOA 3AIRA 2W62A 4JFWA 4F9DA 5GNYA 2PWHA 5HPOA 3VSUA 1OD8A 1UR8A 4CU7A 1MVYA 1Q6CA 2ZX5A 2F18A 4GKLA 4GZEA 4XUYA 1EO5A 3AS1A 1FH9A 1WDSA 5LYRA 5I79A 5JIWA 4QCFA 2YDSA 3CMGA 2YFOA 3NSXA 3ARPA 3ARXA 2F7OA 7A3HA 3GH5A 3L2MA 3SUSA 3WNKA 2DPEA 1WCGA 2EPLX 5BXPA 1KCKA 4KRUA 2BS9A 3QGVA 1MW2A 5JBFA 4PYSA 1SMDA 1CPUA 4AC1X 2NT0A 3IAQA 4GO8A 1HNYA 2D2OA 2W63A 3AS2A 3VX1A 1ESWA 5A8NA 4CN6A 3KEHA 1GQLA 1HKMA 1NP0A 2XN1A 5A8QA 1H4PA 1H5VA 2DSKA 3AFBA 5ABFB 4OOZA 1CNVA 2QHAA 1J0ZA 4W8AA 5CPTA 2PWEA 1JZ7A 1R7AA 4RL3A 1V6XA 2WSKA 4XZBA 2YBUA 3WF2A 5CGMA 3CUGA 3WEMA 3FAWA 1L0PA 1DWAM 3TA9A 2OSXA 4V2XA 3WDQA 2BVYA 3WNLA 7CGTA 1JFHA 1W9DM 2VRKA 7TAAA 3HG3A 3DYPA 2CEQA 1CDGA 4AD5A 3W0KA 2QMJA 4D1IA 2OSWA 1UD4A 2WVUA 1VB9A 4LPCA 2F1AA 4W7WA 1ISYA 2YL9A 2FHCA 2XYLA 4UFKA 1E0VA 1JDDA 2EEXA 1E1EA 1EDGA 3F4VA 2X8RA 1UKPA 1ISWA 2V5CA 5DF0A 3OLEA 1V0NA 4W8BA 3DDFA 1VBUA 8A3HA 4CD8A 1HKKA 1KQYA 4MNKA 5ABEA 3ZM8A 2DH3A 4WIWA 1E6RA 3WH8A 1UD6A 1QI3A 2OWCA 4U3CA 4FLSA 4D6DA 3N1AA 2WLYA 2DT3A 4H41A 4PCSA 5KZ6A 1QNPA 1EIBA 4UOQA 1E6QM 3SCRA 1NWSA 2YL6A 4WKFA 1IV8A 5GNZA 1PS3A 3WIJA 1R75A 4PEEA 2D3LA 4Z2HA 4AZ5A 2A3BA 3OGVA 1R87A 3ZOAA 1NQ6A 2VR4A 3S2CA 2CHNA 4M81A 1DWIM 2ESCA 1UR1A 1VAHA 1VFFA 3W53A 2E4TA 4UZSA 1OCQA 2PB1A 1EDQA 3KLKA 1QI0A 1UWRA 3WQVA 2WMHA 3HG2A 4K68A 1ITXA 2JEPA 5C70A 1HX0A 4PMZA 1UYQA 4WLCA 4W7VA 4AZCB 4PTMA 4W86A 1JF5A 2VO5A 5I2UA 2GDUA 2XGIA 2DQXA 1E4IA 5D8ZA 3AZRA 4PMDA 4N42A 5A6KA 2ZWZA 2D1ZA 2QPSA 1EOMA 2YDQA 2VCAA 1IZKA 3CZKA 4W89A 3KWXA 3VGHA 3ARVA 4UR9A 3VIIA 3VIMA 5D9PA 1CXHA 1VFMA 1WZAA 2VNCA 1LG2A 2X0YA 3PTQA 4HTYA 4TX8A 2OYLA 4QFUA 3GXTA 1ISXA 2UWFA 1UKTA 1HXKA 3VUPA 4OJYA 1AQ0A 3BVUA 3MMDA 2VX4A 1HKIA 3RM8A 3VGFA 2VURA 2X2HA 1FH8A 3MMUA 1OT1A 1JZ6A 2FGZA 4P8VA 3JUGA 3CGTA 1PX4A 1KBBA 3B9DA 5BXSA 3ARQA 3W28A 3W24A 2D20A 1CLXA 1PIFA 2BHUA 4DO4A 1MFVA 1H1NA 4Y7EA 3CUJA 1GJWA 2VZTA 1HJXA 3OLIA 2EXOA 3AQUA 4D6GA 1GVYA 4ACZB 1XYFA 5I5RA 3VPLA 3WNNA 5FOOA 3VVGA 5KEZA 3AZSA 2WMIB 3N12A 5BCAA 1W9UA 1JZ4A 1UWSA 1FHDA 1VEPA 2V3FA 2J8GA 1UKOA 2XVNA 4MB4A 1ZJAA 1UQYA 3AIVA 4W7UA 1EO7A 4QLKA 1VFUA 3L4WA 1CXIA 4R27A 4UOJA 4UQCA 1H41A 1UASA 1NOWA 3BUPA 3GYCA 2VRJA 3WQ8A 5JIPA 4DWSD 4UTFA 1V3LA 4JL2A 2E3ZA 2VC9A 4JHZA 4FNUA 1JZ3A 3WBEA 4BCEA 4JAWA 1GHSA 4BZYA 1ITCA 1KTCA 5M17A 1E73M 3MUAA 5CG0A 2J8FA 4CN4A 3KZSA 3T0AA 3HMCA 3T2PA 1TVNA 1IT0A 5FCZA 1UG6A 1OIFA 2WBKA 1E6SM 2DEPA 2QPUA 3T2OA 3TTYA 2D23A 2F8QA 1HVQA 2W5FA 4YPJA 4PMUA 1YHTA 2WCSA 4KMQA 4FF5A 1P6WA 3K8LA 2OYKA 1XGZA 2WZIA 4ZXLA 3WH9A 2F7RA 1UH3A 5FD0A 3WQ6A 4WSJA 5FL0A 1W2PA 5GPRA 1WDRA 2FDMA 4HPHA 4P7NA 2CPUA 1Q6EA 4HZ8A 3SCPA 1U33A 4CVWA 2JIWA 3D50A 1E4MM 3WDIA 1UZ1A 4HOZA 4TUFA 4XB3A 2BHYA 2GUYA 2ZUNA 3ZJ8A 2YL8A 3WFLA 3AMKA 1GPFA 3WF3A 2FHBA 5EB8A 3W6MA 4MAVA 3IJ9A 2J7GA 1IZJA 3DX2A 4Z2KA 4DO6A 1E9LA 1H0GA 1GQJA 5IFPA 2VOTA 4AMCA 1EXPA 3BAJA 2WZHA 2YJQA 5CSUA 3S5YA 4CD4A 3AICA 3FAXA 3BVWA 4B3LA 1UR4A 4WKHA 4FNTA 1QVBA 5E6YA 3WUEA 2Z1SA 1J0IA 2J78A 3U7BA 3EJQA 4OOUA 1BYDA 1UA3A 1UZ4A 2CBVA 3K8MA 3D4YA 4NXKA 3PZIA 4ACYA 2XJ7A 4KWUA 3ZT7A 2VCBA 3NDZA 2J7FA 1GOIA 5E0CA 3DYOA 2UY2A 4UQAA 2G4FA 2FGLA 1OWQA 1UH2A 5I78A 1B2YA 2AOSA 3A24A 4D6EA 1VF8A 1V6WA 3IJ7A 3AZTA 2CITA 2CXGA 4FNSA 2EPOA 3RPMA 3FW6A 3UEQA 1M03A 3BAXA 3HU7A 3WD3A 4U3AA 3II1A 3N04A 4CUCA 4W85A 4MNLA 3WEOA 4PRWA 1LL7A 2EADA 4BF7A 4N0RA 4W88A 2XHYA 4D6FA 2BFGA 4MB1A 4H8UA 2J25A 1WDPA 3WDRA 4MB3A 3ZR5A 2PI6A 3VU2A 1HL9A 4GQRA 5IDIA 1JNDA 3WD4A 1MFUA 4FMVA 2ZE0A 3T08A 4CCEA 3ARYA 1DTUA 3L4TA 4OKDA 3SCWA 3N11A 3BUBA 2OWXA 1HN1A 3WF0A 2J74A 1E5JA 4NX0A 2WC7A 1BGGA 3EYPA 3AS3A 1M53A 4F79A 4TX6A 4AWEA 3CTTA 1EDTA 4P7RA 3O2LA 2J62A 4Z2JA 1L8NA 1ODUA 4UFMA 5A69A 5BRPA 1Z32X 1WB0A 2CETA 4Z2GA 1W9XA 4AZ6A 4BQ3A 1B0IA 2W67A 4AYGA 3VD4A 3LPOA 1GW1A 5A6BD 1MXGA 3CMJA 2YA1A 4AXNA 3SCSA 5IHRA 3WH6A 5CQ1A 3WNMA 1C91A 5FIPA 4TVDA 4P7OA 1W1PA 1M01A 1HL8A 1BYBA 3AISA 3BVXA 1BTCA 3RJYA 3W4RA 2YA2A 4D1JA 3RIKA 3IGUA 5E0FA 4F9JA 3NDYA 4HPGA 4WF7A 3WD0A 3VMPA 1BPLB 3FHAA 1KWKA 1OINA 4GINA 2GFTA 3PZMA 3AYSA 3VDBA 4M29A 5GQBA 1UKSA 4ZE5A 3LRKA 3FN9A 4FNPA 1HJWA 1A3HA 1J01A 1TMQA 3HZ3A 1CIUA 2G3NA 2VX6A 2VTFA 4AISA 1QWNA 4J3VA 3LRMA 4HA4A 3W37A 4OIFA 3ZR6A 3KLLA 3FXYA 2DSWA 3BVVA 2WVTA 3VO0A 1B3WA 2CNCA 2VL4A 1U30A 1QNQA 3N13A 3D3AA 3OZOA 1JD9A 3KL3A 4AY1A 1E70M 2YA0A 2JE8A 2ZX6A 3GTNA 1R46A 1CLVA 3H55A 3DDGA 4JHOA 1QNRA 3MKKA 3WH5A 2X1IA 1XD0A 4P7LA 2PF0A 1Q6FA 3SUVA 5DEZA 3WN6A 1QHZA 1SYTA 2QV4A 5A6SA 3PZNA 2WAGA 3G6MA 4M82A 1X6LA 1H11A 2VX5A 3HG5A 3G6LA 3TTQA 5A2CA 4H7VA 4QAWA 4FK9A 1TG7A 5A3HA 3CO4A 1U2YA 1AQMA 3RM9A 3NUKA 5M3WA 2J75A 1G0CA 4FLRA 4U33A 3UETA 2YFNA 4NXSA 2WHMA 3SUTA 1B3ZA 1DEDA 1OSEA 1GCYA 5A2AA 1TA3A 3D51A 1JIBA 2WKGA 1GQKA 2XVLA 3LMYA 4LX4A 5D8WA 3CUHA 1E6PA 1K9DA 1J10A 4NI3A 4M80A 2WKLA 3WQWA 2D73A
chains in the Genus database with same CATH superfamily
2Q20A 3STPA 2KS0A 3GSVB 4FQJL 2W61A 4QUOA 1PD6A 5GRXG 4AVKA 1PE1A 5DMIL 1XUZA 3UJ2A 4MKNA 5JOPD 2WXDM 3O6LL 1TV7A 4WI3A 4JE4B 3W7LA 3M0ZA 3BD4A 1JUBA 4NWTL 3WF1A 2PW2B 4TUKH 4W87A 2N56A 4YL2A 1JGLH 3DRTB 4N8VA 3GDLA 1TQUA 3HE7B 5HYEA 5J9PA 1QVOB 2OR9H 2WB5A 2ODIA 2ZJSL 1G01A 4E8DA 3LDVA 3ZHFA 4IUOA 1R9ZA 1SFJA 5AW7B 1IAOA 4PJXE 4PRAA 4MJ6A 3NQMA 3W0WA 1IC4H 4MS8C 3FCUB 5DSCB 1E3FA 3C4UA 4XI5D 5F7LB 1IAII 1CGXA 4XNAA 1YQ2A 1LF1A 2CC0A 2OTWA 2BY2A 5AVTB 4QRPA 4KDWA 2DLFL 5T1DL 1XH2A 1HS6A 4M7KH 1SJDA 3DMMB 5D7IF 2DLEA 4DO5A 4QEEA 4XAYA 1KIQA 4IPJA 5E09A 3AALA 4KI5C 1QMUA 1VZIA 4OGZA 2G30A 2HVJB 2BY1A 3STBA 3EO9H 4DK3A 1IFHH 3RFRA 4WX2A 1F3DJ 2I5YL 3C5ZD 2W65A 5DJAA 4XXCA 4JMNA 1KXHA 5MP6H 1UMLA 4Z9KB 4RAUA 1G7IA 1VZWA 1JV5B 3W5MA 3KM8A 4F0SA 5B3NA 4LSSL 5GS3A 5I5JA 1AHWB 1HJQA 3F7YA 3INPA 2R1KA 4JTLA 4XN9A 3M43A 2PDYA 2Z7KA 1XLBA 3U57A 4LIQL 1U58B 1DCEA 5AVQB 3W7CA 5JPNC 5L0QB 3PJTA 3GINA 1ITUA 3O45A 4PJ5D 4L9ZA 2IGFL 4B5NA 5KSUB 1OCWH 3TA6A 1FH2A 4N2DA 2NY7H 3LGGA 3BV4A 3ME0A 4AH2A 1P1MA 2WTPA 5DJ2A 3HC0B 3DENA 1DZ0A 3OXSA 2ZX7A 2D7PA 1X7SA 2X3BA 2EUZA 2V2WA 3HC4H 4DUWA 1TQWA 3EOTL 1FFOB 3PJNA 3OKYA 2AQOA 4C4UA 3BH9A 3W11C 1ALDA 3Q2DA 3QDMA 3QEUA 2ZF8A 3QY8A 3STZB 3VXRE 5ABGA 2V5LA 3SDAD 5FGCE 32C2B 3TUUA 3QBUA 1RZIB 5EULV 3MXVL 1V6UA 1TFVA 3OG4B 5BO1L 3HJEA 3LQLA 4IRJB 4MY8A 3T4YA 3OYZA 4JFFE 4NQCD 2VR8A 1NAMB 4Y4FA 4UT6H 4BSVA 3NIDF 2YD0A 3II3A 4CQ8A 4POZD 5LN8A 1NTHA 3NQ2A 1VYPX 4FJ6A 3U30B 1US0A 1KLUB 3UTTB 5HJXA 3BDYH 4KTGA 2O6PA 4FXGB 1KJ3L 4WKZA 3F7KA 3REQB 2B77A 1OYAA 4EXKA 1QPNA 4Y9CA 2ZRVA 4K37A 3GH7A 4Z0SA 1F56A 2RCSL 3V0WH 4R7XA 1DIDA 4I5RA 1VKFA 3VH8A 4L4JA 1PTAA 1ZHAA 4MZ2A 3CHRA 2IADA 3NVQA 4QR6A 2EH8L 3N6HA 3O0FA 1RZJC 4KJYB 1K3IA 1NIFA 3MACL 1X3DA 2GK1B 4MD0A 5HK4A 2Z1WA 2QGHA 3L3JA 1QA9B 1UB5A 1KCLA 1TTAA 4O9HH 5IT2H 2I60L 1KZQA 3RTLA 3WKYA 4X6DB 4B5TA 3JV5A 2RH0A 3TT3L 2O5YH 3QGAC 5ABHA 3MNZB 1W0WB 4XPFH 3WLOA 3LRHA 2EKGA 1B3VA 1NANH 1SW0A 2B2XL 1RUKH 3GIVA 3DFYA 4DJFA 3UZJA 5FYLD 4PMOA 2GVJA 1S2EA 3E0VA 4PB0H 1WZMA 4GGBA 3LM3A 3ARFA 1L8PA 5I30L 4UIMB 5FO8B 1S3TC 3CMOH 3TEUA 3GMRB 4D0CA 4U1SA 3L4ZA 4GRWH 4DFHA 3V9EA 4L8CB 1T1WB 3MGTB 1DPMA 3QFJA 2QJIA 1W3JA 2RJGA 2IC2A 3QC3A 1YO4A 4V1DE 4GH1A 3B37A 3OAUL 2F5BL 1OWRM 5BVJB 4Z7UB 1C93A 4JFEA 4HPJA 1ZUAX 4OZGF 4ZMNA 1SDAB 2J4WL 1MEXH 1NOUA 3WNJA 3AB0B 5JUEH 4XXCC 4Q7BA 2XZCH 4M9OA 4OLEA 3GS0A 1W9PA 3HBZA 3UTQA 1GK8A 3ARGC 3VXNA 4HJGB 2H41A 4ZYKB 1RZKH 4JEJA 4AIZB 4AGQA 1BGXH 3ARED 1KWGA 3GMOA 3WIHL 5JHBA 2OZ3A 4A2LA 4Z7WA 4ELKA 3PYCA 1I9RL 3C2SA 3AS0A 4FFZA 3VOCA 2QDDA 1Z2KA 3TIEB 5F4WA 4XNUH 2WBXA 4HHGA 3GC3A 1HI6A 4L3EE 4IP5A 3U2SA 2Y1YA 4NWUH 4K7PX 1R34A 4FQCL 2V82A 4I89A 2DDXA 1LP9A 3POHA 4M24A 4QNWA 1QCWA 4MMXA 5TDPA 2DZPA 1L6GA 5DMMA 4OCSH 4FGMA 2G9KA 2CWNA 4OBSA 4NJAH 4U31A 4Y7MA 4LO9A 3ZDXE 2F53E 3OKDA 3CZ8A 2AJSH 2FTYA 1A49A 3UTZA 4QXTB 3VTTA 1ACZA 1IXOA 5A1AA 3FOKA 4GB9A 3DROB 1IGCL 4I3RH 1MRDH 4O4YH 1WDWA 4O0QA 5EMUA 2MMXA 4HVXA 3U2IA 4J3UA 1ADQH 3SEPA 2EUVA 3WLKX 1JTOA 4LVHB 2VXUL 2UX6A 2VXSH 1POKA 3URBA 5J5RA 3DXAE 2V7HB 2MNRA 1EHAA 4MA3A 4Z3EA 2C1PB 4S3BA 1TYRA 4PS8A 4DP7X 2KLTA 4P06A 4QM1A 2DKMA 4YHOH 2D31A 1FDLH 4XMVA 3CNYA 4Z3IA 3OMNB 4GISA 4Z7WF 5T1LD 3UGVA 5IM7A 1DBBH 1XDLA 3R43A 4K8RC 2CRZA 1OYCA 1W80A 4PB9H 1YYML 2EDMA 5CJQH 1REIA 4Q8QA 4HOWA 2WZEA 4QHLA 3HS9A 3FFCA 1TCRA 3V75A 5DLML 4GUIA 1NKGA 1JGVH 2C6QA 3H54A 1UT2A 5E70A 1GTFA 4JX0A 4QRFA 3L3IB 1TJIL 1IIKA 2CESA 1FBIL 1LP9F 2GFBA 2R2HA 3R7QA 1B0WA 1YDPA 4Y88A 3WQCA 2VDIA 1NELA 4ICNA 1J18A 1KGXA 1T8XA 1MNSA 4HKJA 5D04C 1L3WA 4QWWC 4C6DA 3X11B 1YEDA 5CAKA 1MDRA 4H01A 1ZT4A 2XPYA 2A1WH 3VFMA 1PAMA 4JPKH 4ETYA 3S5SA 2XZAL 3MNVA 3H6OA 4FABL 4TQTA 4GW5A 4BDVA 1KENH 1XBRA 4F2BA 4LHJB 1TQJA 1CT8A 2P43B 3RO6A 4DJFC 1T22B 5E6ID 4H0IA 4JQ4A 1SVDA 4PY7B 4JQIL 2YLHA 3ZIZA 5BZDA 1PYFA 5IHUH 2V6AA 3ARFC 5L4FA 4L48A 4EAMA 5BOOA 1VCGA 3H9ZA 2AAAA 3GWQA 5IQ7L 1KM2A 1HCFX 5IBLC 3ROOB 2OULB 4ZNCD 2DMBA 5I1AA 3O3BA 1I9CB 3GNML 4FPSA 1KGWA 1QPKA 1P4BH 4L6OA 2VLRE 1BD2D 1TVLA 4PJGE 3T81A 1GGYA 1LD9B 4Z77A 1OAYL 4KUZH 3D1MC 1GTNA 1IAMA 4X6CE 1JAKA 3NIYA 3RHWK 5C6PB 3SQBB 2O0TA 5AOZA 4PRNA 3M0KA 1CWYA 5AOKA 4EP8C 5ACZB 5D96C 3DSNB 4NG3A 1A4BA 4AYBA 3QR3A 1HKLL 1LNUA 3R58A 4OZIA 4O5LH 4QOKE 2WQPA 3BVNA 4ZUVA 2AGJL 3ANVA 5EO1A 5E5LA 3WDHA 4AQEB 2QT6A 4LY8A 3P2BA 4FQJH 3AWOA 2VWTA 3IN0A 3APNA 1A7RL 4PV1C 4Y5YB 3N34A 4QDMA 4O2CB 4MWFB 4HU4A 3MSPA 4MMXC 3V95A 5JO5B 1RZQA 3UXLA 2Y5EA 1MCWW 1SXCA 2ZUSA 3KCLA 1T66C 2ZKHH 1LDCA 5K1JA 1EPFA 4LEXL 3MTXA 5GZOA 5AB9A 2ZJSH 2JKEA 1AD0A 1HSBA 3WJXA 5GS2H 4TTGA 1K7XA 5ABFA 4P4KD 4LSRL 3DUGA 5BWFA 1GSMA 3C8HA 4NKMB 3SYPA 2DZSA 5CLWA 4MHBA 5BOZG 3BP4B 3L1OH 4F7EA 1KCWA 3O6KH 3I6GA 3U1SH 4Z78B 4W8LA 2YN3A 3VGDA 2A6DA 3ZLHA 2DLFH 3BHBB 3F84A 5H4YA 1J5DA 3QUZA 1Q65A 5T1DH 4HJIA 4A7TA 2QXWA 5IWLA 3ARTA 3G9AB 4NRRA 1E71M 4LL9A 4YDIL 2ZDSA 2ZP9A 1HO4A 1ITBB 4OZIF 2VEIA 4AZGA 1TJGH 3OGCA 3JU2A 1M9WA 4Z95L 3B8DA 4GVFA 2FQGA 4UBDC 4TXEA 1BKHA 4WRLA 1F00I 2I5YH 2FLMA 1A7QL 4OAWB 4CQCA 3IPWA 2VZ1A 3VSUA 2I57A 4O50A 3ABQA 3KYNB 5LAXB 2N4IA 4I7UA 2ZP0T 4K5OA 4QRUB 4XBEL 4BSJA 1ZLUH 3VFSA 4LSSH 3P0GB 2QDVA 4RMVA 2PTWA 4KK6C 4JKPL 4TS6A 4ANWA 3UL4A 3NSDA 4WDXA 3V1HA 3DUUB 1THCA 2EDDA 3F6JA 4ILDA 4KXCA 5IBUB 3S48A 5JMUA 2XLLA 5F0PB 4I6KA 1LJMA 2PWEA 2NVDA 3VI3A 1JVKA 4DEUA 4L64A 4G1EB 3OEXA 4N9OB 4DWDA 2AJ3B 2XYCA 3LEYL 1UZ6E 3V4VB 4G8AC 2DQDL 2XN9E 3ZE2F 4JANA 3GU9A 3KPQA 3WDQA 4HDIB 2WWOA 3LK6A 4PJDA 3P3RA 5FKPB 3PXHA 1E8YA 2ADAA 5G2HA 4M9PA 1E0VA 4XD3A 4IOFD 2DP3A 1EDGA 5DWUH 3N5AA 2O61A 3V3WA 3GK0A 5DC9B 2QGDA 1MCKA 4OFCA 3TFKC 3FUFA 3HG0A 1QAWA 2WWMD 4N9BA 3TFXA 5EBUA 1W3NA 3TO2B 2PCFB 1I2QA 1UIOA 4WKFA 5I15H 5T3XH 2DAVA 3MXVH 4G43A 4M6OH 4AXWA 3ULVH 1DWIM 3LIUA 4FQIL 5BO1H 1KM6A 5C09A 2F58L 3O6ML 1UWRA 1X7FA 1CFQA 1E5BA 2FJFA 3W2NA 2XG5B 1A02N 3KNBB 3FUDA 1Z9OA 4A7UA 2DOCA 3MV9B 1IGYA 2ATKB 1BYOA 3VGHA 4PJ8B 3X1BA 4PS7A 1XGTA 2YXFA 2OYLA 3FJ6A 1AQ0A 2R2CA 4UM9A 3HUJE 3LNEA 5DRXA 5D7LB 3TJIA 1J88A 2QT3A 2P52A 1OT1A 4S1DC 1QXLA 2BZNA 1H3TA 5EIVA 1EKOA 3L3GA 4QPEA 3PWGA 3FQTA 3AUWB 4MD5A 2IPWA 4MZ1A 2BHUA 3I2CL 4PJDF 1ONWA 3HZMB 2R15A 4WV1C 3MACH 4JTAA 2VZTA 5D7HA 1DQIA 1VBGA 3QIWA 3IGAB 4PRRA 1BV8A 3WAJA 3AZSA 5GZOC 3VNLA 3LCGA 1BECA 3HZVA 2VC7A 1FHDA 5KS9B 2VM8A 1IIIA 4QDWA 3L7FB 1UKOA 2DJXA 4IGBD 1ZJAA 3MBXL 4UOJA 1YLVA 5E1GA 5TDNB 1TTPA 5HA7A 4C6OA 2FEEL 3VACA 3WBEA 5T9CE 4G82A 1RSCA 2P5WA 3MOAL 4F5CE 2ADGA 2BIHA 2XTJE 1CE1L 1BZDA 3O3DB 5FCZA 3QUZC 4XN5A 5IWLC 1PHQA 3PJLA 3TTYA 4YPGA 4AVFA 2R59A 2CCWA 3K8LA 1G9ML 1S9YB 5EU7C 2Z93B 3H85A 4HPHA 4R96B 1DVQA 1IE4A 1T04B 2M1KA 4QXIA 3AUOA 5GZND 4MZRA 2F5BH 3PGDA 4WW2B 4Q8VA 1KCZA 2QPFA 4RFNC 3N2CA 1M56B 3GRWA 1OGPA 2BH0A 1MREL 5DXYA 1IBGL 3IJ9A 2J4WH 4PHXA 4M5ZH 1QLEB 4ZODA 4YWIA 2YQ2A 4XVTH 3O63A 5HHOD 3BW2A 3V0TA 3MCKA 1WCBA 3PBUA 3VXOA 3PJSB 2ADFL 4GK8A 3DJSA 1AW1A 2OL3A 3NDZA 3QZWG 3FFDB 2Y7QB 3K2IA 3KHOA 2G4FA 1P53A 5TH2B 1K5WA 5B7FA 4FOJA 1V6WA 1KPVA 2PGRA 2NXZB 2CUAA 5DD5L 1CDHA 4GT0A 5AW3B 1PW3A 4CUCA 4GT7A 1QNZH 4BF7A 5LG6A 4D6FA 5CILL 4N6QA 5C0BD 5C07E 4JDTL 3CVHA 4YYFA 2J71A 2XISA 3TVMD 5D70L 5KN5B 5D1ZB 4XP1L 4XVSH 3T08A 2GQ8A 1NC4B 3NEHA 3WTTA 3FONA 1HN1A 2YZ1A 3NN8A 4H1LA 3T4CA 3PV7A 1NDZA 4AWEA 4LALA 5BZWA 2PLKA 4XMZA 3BOXA 2BXVA 1JPKA 1Z42A 1JV2A 4ZZFA 1URIA 1RXOB 1UJTA 3PABB 1IGCH 1JZHA 3O2VH 5I8OH 2H2PD 3KJ6H 4TVDA 3DPDA 4L3CB 4DK5A 1AHKA 1WXJA 3MJYA 4KPLA 3RL1B 3P84A 4RMTA 4JDZB 2AERT 4YBQD 4ALAC 5EC2A 4AF0B 5EZOL 4ZE5A 2D3VA 5C08D 3S6CA 1HJWA 1KXQE 2A2QT 4G56A 1A2YA 2FX7L 3MCMA 5PTDA 2PE4A 5SWZD 3V6FB 3CU2A 1XZWA 3EEGA 3NK3A 3RIAF 1YYMH 1TJXA 4LBUA 3DDGA 1XGYL 4RGMB 3QWNA 1L9RA 5H35B 3UP8A 2DL2A 1Q9KA 5F89B 2QSCL 3W73A 5EEVA 4K94H 2F54E 2QV4A 4Y1AB 3PZNA 3OR6B 2QCGA 1TJIH 4M82A 1PZDA 1USZA 4MJIB 4N0CD 4MMWA 3QUXC 3MYJA 3PL6A 2YXWA 3QUXD 3NUKA 3D2UB 5J6HB 3QNYB 1B3ZA 2ADIB 2JB5L 3QIWC 2NZ1A 2XVLA 5LIXX 4RIRB 5D8WA 4PRID 5L8JB 1T2QH 3WQWA 5CM1A 1JZ5A 1GPOL 2ZAHA 3PGCB 3M6YA 4U7MA 3QA3B 2OX4A 1AYOA 1BBDH 3PAYA 4ZUTB 2FYMA 1I53A 3AWNA 3EWXA 4FABH 2CM5A 2FVKA 2DM7A 1PJWA 4N86A 1RLWA 5HI5C 2J88H 3W22A 1P7TA 4OT7A 4WGWB 4PWFA 3NJKA 2C1GA 3QIBB 2QCMA 4JQIH 1OGGA 2EUXA 4HS3A 1VIWA 1ESOA 5J8LA 3AMCA 1QFEA 2OMAA 1HHIA 1IF2A 4UZUA 1FXQA 5IQ7H 2H7WA 3KM2A 4MLIA 2IGLA 2PABA 1UP3A 1TE1A 5F9WC 3BICA 4JFOA 1PLGL 4HCRH 5AYBA 2CHXA 2GGEA 3GNMH 1SW7A 4FQQA 3TL5A 3SCMB 5I0YA 4TUJA 5C0FB 2V63A 3HAEG 4HWZA 1C5BH 5EF1A 5AWNL 4KKAC 3CUIA 5D2NB 4Q9QH 5DK3A 3BDKA 1P84K 1O7DC 3PP3K 1JWMA 5C0CE 4BEQA 1PX8A 3BRDA 2VXTL 4NYLA 3KCWA 3O6FB 1SOSA 3PG8A 5E9DA 9XIMA 4Z18A 5KG9B 3FSAA 4B92A 2F9RA 4TVCA 3LLDA 4HV8A 2D7TH 4AENA 2CNYA 1RAMA 4O0ZA 3UQNA 1BGAA 2RKXA 4X8JA 2BVTA 4Y4HD 3W76A 3VXTA 1IKOP 3DX5A 1YEEL 4JX4A 5BXTA 3SO5A 3BO8A 3LRSB 3VFVA 3BKCL 5D2VA 1FCBA 3L2IA 3VXME 3C0SA 1FORL 2X88A 1G1CA 3W7DA 2CIKB 2JI1A 4AEHL 5I1DA 5B21A 5MERB 3ULUF 3ZHNA 4ONOA 3M0LA 2V33A 4QRRB 1WDDA 4HYTB 2DZWA 3FRPB 4MBOA 4PBEA 5KBKA 4L8BA 5HNTA 4ZFZA 2NXIA 4WAFA 3G0XA 3CDFA 4E9VA 1BA9A 1SJCA 4RLIA 4BHYA 2EDWA 4LESA 3TYDA 3Q8BA 1RJLB 4BQBA 4ZO8A 4IQHA 3VDGA 2W88A 1D5XA 4WU7B 1T1YA 1ISZA 1K8ZA 1NCWH 3HPZA 5CJOH 3WMPA 1HIMH 3L9BA 1AXSA 4TUKL 4MNGE 3PWPB 3QAZB 4GXWA 1DHKA 3CC5B 1JGLL 5AYXA 4GQ9L 4RNHA 5IEKA 3L0NA 3H8NA 4DPBX 1IBBA 4N28A 2OR9L 1R33A 2XZZA 1SY6H 1X38A 1H7RA 1UP2A 4LCWB 4YDIH 1DFXA 1B6DA 1ME7A 1HKJA 3LNIA 3OHMB 1IC4L 3OO2A 4V1XA 3ZUNC 3S4TA 2F2HA 3G5ZA 1U6AH 1JBJA 4Z95H 4L3FA 1JPIA 2YGVA 4J4PA 3G3DA 1FC2D 2EDOA 4S0SD 4CA4A 4RGND 1UENA 3QXAB 3CL7A 5FF0A 3KOFA 4RMRA 3DETC 1Z3RA 4J3TA 4PD4J 5CBAA 1PGRB 4N8CH 4P2RD 4M7KL 1KT2B 4NNXB 5LIWX 3IJQA 5EIIB 4YSPA 4E0RB 4MPKA 6PAZA 4PJAB 3IARA 3FXIC 4WEVX 4IKKA 1LOLA 4NIYE 3VNDA 5I73C 3JT0A 1J9TA 3DFPA 4YHGA 5CZXD 2VC2B 1M5WA 2Q2LA 2FLIA 5FJUA 4KKLD 5A5WA 1F73A 2EVJA 2IANA 1WBXA 2ISVA 3HCVB 2JIXD 3ARDB 3V4PA 2DQDH 4YNGA 3KS0H 1L9WA 1EWDA 3ULUD 5GSVB 3R25A 3CLWA 3WFAA 3ELAT 2W0LA 4XN4A 3RO8A 1P43A 3SDCD 1KLZA 2I07B 3Q7JA 5IK3B 4YDNA 1ZL1A 3LOTA 4IU3B 5D5MF 1LMIA 1OCWL 4JRLA 3M0MA 1XYAA 2VLKA 1ZTVA 2NY7L 3PWNB 1GG0A 1C8YA 2XPKA 3FV9A 2P1YA 4DP4X 1NWUA 3TBYA 4AD3A 1R3RA 1Q9OA 3M64A 4HK6A 2F58H 4O10A 5I16A 2R1PA 4PBVC 2NY0D 3ESMA 4BHUA 3AITA 1SVCP 3JR2A 3VQLA 1FHGA 4LOUD 4PV8B 3HQ1A 3TJXA 4L7ZA 2V2TB 2EKSB 5JHAA 2EPNA 2EDRA 2OXHB 3HLAB 2X2JA 1S7RB 4WO4B 2EG6A 3MLYH 4QAIA 1QBLH 2XFXA 4PMNA 4OI8A 2V2HA 3CBWA 3ZYZA 3N29A 2GSEA 5HVHB 1XZ0A 1BAGA 3I2CH 5FA3B 1KEML 4ZW7A 1MAJA 3MRKB 4S0TD 2E6YA 1PZSA 4HGKC 3BDYL 4TVPH 4OF5A 4HSNA 1FC1A 2E6JA 1EL3A 1HL4A 4ENED 2OZ0A 3ZZLA 3GHSA 3QH3A 3UPRB 3DX6A 4GIRA 3V0WL 4X7FC 5I5MA 3MODH 4FXKA 4DWSB 2KDYA 5LUMA 2YCKX 2HPTA 5DK0A 1O94A 3F62A 3X1NA 1P1ZA 1H2JA 4OHQA 3T6VA 3QZOA 3GI9H 3BP7B 4CVUA 4V27A 3TESA 4O19A 4L37B 4MNQE 4O9HL 5BRZE 5IT2L 1RZGB 2B15A 4FALA 4YFLI 4POYA 3GHRA 3HOJA 2O5YL 3GTXA 4JD4A 3ASWA 1II4E 3FO2A 4R84A 1AQKL 4GAYA 4EI5B 4XPFL 3ROLB 2PUZA 3T0EA 1DWGM 4J4PC 4JQVA 4LCCA 4WQ6A 2X4NA 1XGPA 1IBGH 1JPEA 4H4NA 4PB0L 1KM1A 5A16B 1E2WA 3S37H 5H8PA 1XIWB 1SEBA 4FHAA 2G5BB 3MFFA 3CMOL 3LV3B 1JNHA 4YHNA 4ELDA 3K74B 4IIFA 5BQDA 2CJUH 2GJ6E 3M1OA 1RP9A 5FKAB 1TO5A 4G7YH 2H32A 1LLZA 3C09C 4X22A 1PJ9A 4JQ2A 1TTFA 1A9EA 2GB2A 5DD5H 1MEXL 1AR1D 4PMEA 3DOHA 2XZCL 1WKEA 1FN4A 1SJVA 4PY8I 5CILH 2AKRB 4QRBA 1RZKL 1MY5A 4XXDB 1BGXL 4NSKB 5D70H 4GX8A 3OMIB 1HSAA 2HVMA 4C58B 2Q8AH 1V93A 4N9GA 4N9EA 4XVUC 2WBGA 4KTEH 4F0HA 3T8LA 4HZ6A 2XXFA 2PPFA 3PCYA 4XNUL 5FGBC 3GBLA 2BMBA 3I4EA 3OJDA 1WAEA 4NWUL 1EJOH 4CC1A 5KOVC 3NZQA 1W3KA 2DT2A 4WJXA 4JTFA 4WTQA 3LQAC 3R0KA 5LAPA 3UBXI 1U8CA 2V69A 2YUVA 2RFXA 2QCNA 4ZR8A 1AFVH 2GCYB 3KDOA 2G3XA 1CGTA 4PCFA 2ONEA 3O81A 4B9CA 1LL4A 2VAAA 2J73A 4YHKH 4OCSL 4NJAL 2DEYX 2J13A 1KFKA 4XZNX 3ABSA 3SCVA 4PUEA 2IJ0C 1JDAA 2C13A 5DVKA 1PL3A 2OMTB 8CGTA 2YAMA 2AJSL 4LBEB 1YLBB 3CVIH 4S1FA 4WKAA 1FP8A 1KM3A 2XFWA 4I13B 3DVNB 5D1QB 4KQ0A 4I3RL 2K78A 2VEMA 4O4YL 4PGEB 1LORA 1JQVA 1M41A 2YPLD 1XG4A 4MJ5B 1S38A 1CR9H 2VXSL 2QSCH 4FULA 4APQC 2BP0A 2A85A 4HALA 1UWQA 4JFPB 1C7TA 4D9RE 1EGVA 4K2UH 3LZ5A 3BLPX 3NZ1A 4MJJA 1UOLA 3MFGB 1NM4A 3T7VA 4C7FA 2W92A 1WA0X 3U2EA 4YZFF 3QJHA 3STLB 2E9JA 2J47A 5ICUA 1DBBL 4GZIA 5HYQB 3BSZH 2VEFA 2MUCA 4PB9L 4Z7QB 2HS8A 5CJQL 3LHUA 1O5PA 3L3OA 3B2UC 4BCZA 4TSCH 3VTRA 3C5ZA 3PZUA 4JO2H 3CHQA 4DOHB 2DMHA 4FXKC 1WO2A 3GH4A 5CLZA 3FK3A 3C60B 3S1WA 2X0HA 2OELA 2AW2A 5KSVB 5I1HL 5AG8A 2BVPB 3IJHA 4WGHA 3E0LA 1I3VA 1M7IA 1PFCA 4ZE4A 2IFFH 5D55A 5IQNA 4UMGA 3S2LA 2CO1A 1FH5H 3KXFE 3QQNA 3K6SA 1EWHA 3G5VA 1NDGA 1DJYA 2PO6B 3F5WB 2VP8A 1FTXA 1QSFD 1E5AA 4PJ5A 2A1WL 3ZSSA 3VI2A 4M6UA 5EEXA 4U3XA 4CLMA 4JPKL 2EO7A 4JG0L 4Z7OE 5JW4M 1GVIA 1I2OA 3SY1A 1E9QB 4EACA 2R2BA 1KENL 3D46A 3T0EC 4YAQA 3AI0A 3GGWB 4LCCC 2HX7A 3Q1SH 3W38A 2IMMA 2DUZA 5AWNH 1EZVX 2W0KA 5AOMA 2OB3A 2QVKA 1LT7A 1KNOB 1MWOA 5JHMA 4Z0JA 4B9JA 4J8RA 2VXTH 4ODUA 2Y8VA 4CSPA 4HPXA 3WIFB 2F8VA 3DGGA 5IIEB 1KQZA 5CJMA 3WLPA 3RCNA 2X89D 1P4BL 1MW1A 5EZLB 1H0DA 4X3ZA 2ZYRA 1PSCA 2CHOA 5FDYA 2X0UA 3U48A 4KUZL 2V81A 1YRRA 1YEEH 3L16A 4J40A 1ZSDB 3QUKB 2DW7A 3BH8B 3BKCH 1RQ5A 4NQCA 4TF4A 1FORH 4XVOA 5LGJA 3AS1A 1OF8A 4AEHH 3O9WC 3I6TA 1S8DA 4PGJA 1L9TA 1P84J 5AAMC 3CPLA 5GGSB 3EKLA 3O9WD 1L9QA 5CZVH 5C3IA 1RL1A 1WKFA 3RHGA 1FF5A 3N2MA 3B3IA 3CPGA 2C7UA 3MRFA 3SPGA 1YEHH 5AEAA 1S9KC 2Y7LA 4R7OA 2BODX 3MTRA 3H7VA 1JZ7A 3EB2A 4YFLF 1SXAA 1VGEH 3PWJA 1T0MA 5B80A 4ZJ9A 3QO1A 5E2WH 1WYIA 4HIEA 5H2BA 4DETA 3HG3A 1I9JH 2BZDA 2IW0A 4MDRA 4NN5C 2JQXA 3Q4DA 4GQ9H 2YL9A 2ZKHL 4P3WA 4Y2DC 3D48R 5CUSH 5F3HB 1MI5E 1Z5LA 4LJ3A 1ISWA 4Y2DD 1UC4A 4W8BA 1VBUA 1JGMA 4HXBH 4Y5XA 4MY1A 3SBWC 4TNVF 3VWKC 3PIQB 4XI5C 2N1TE 3VWKD 1MEHA 3K2MC 1QNPA 3L1OL 5I6KA 3O6KL 1XIGA 3R11A 1E1CB 5F7MC 3U1SL 3SE3A 2O4MA 3GHTA 3ZOAA 2E56A 3H2WA 3RX4A 2Z8SA 1UR1A 1B4RA 1D9KB 1PIIA 3VKDA 3QPXH 2PB1A 1G4EA 2H9GA 3CFKA 4RX0A 3TC3A 2RIKA 4YDLB 4X42A 1ECYA 3BIKA 4GKSB 4JQ3A 3CFJA 3HKZA 2AQTA 4BI5A 1FWIC 2VO5A 2GDUA 5LGYA 1CIDA 2NVCA 4LH8A 5AOLA 1OL0A 3MLWL 3TJEL 4X99A 3TYAA 1TJGL 1OAUH 1BVWA 1VFMA 4ZQMA 3L3OC 3IS0X 1CE6A 2VLJE 1UM5H 3C5ZC 4KRPD 3CH8A 2FPVA 4MUZA 3E9AA 3BVUA 2J55A 1RZMA 2FSDA 1D5ZA 4B5UA 4KOCA 1RK5A 1M6OB 2X2HA 4I6VA 3R8GA 1N8FA 3HGSA 1L3NA 2ZUYA 2NOYA 3I9AA 4IG2B 3ARGA 3MRGA 3W24A 5FSDC 3AREA 1HJXA 5MI0B 3KW7A 1HZKA 4XCYA 4OLZH 1YPZE 5I3GA 5IFJA 4HIIB 3LRGA 4UDTB 3SYQA 4AYID 4EPDC 1IFRA 3PHOB 1BQHG 3D6NA 2XH0A 1UQYA 3AIVA 3X3GL 2BX5A 1NU5A 2J56A 1NOWA 3BUPA 2ED7A 2VRJA 2NW3B 2VABB 4ATTA 5CPLA 5CJNA 5HP5A 4CJ1A 1LWIA 1G87A 4YH6A 4BQ8A 4WK2B 3CQIA 3LBMA 1QATA 2PYED 3T0AA 3HC3L 1UWAA 4HIHA 4N90E 4PI0A 4O13A 1KC7A 2DZVA 5EOTB 5I8CA 1F0LA 4PREB 2D23A 1D6EA 3N19B 5BZXA 2WCSA 3V2AR 5DWUL 5GPRA 4JDVB 5DJDB 4LEBA 1KN2L 2VW7A 3MX0A 1VLWA 4HZ8A 1XRTA 2Y6ZA 4OD3H 4CVWA 1B0RB 4HOZA 4FOKA 2GUYA 3SDAC 3WFLA 4YSDA 4NQDD 1VRSA 1A1NB 3WFHA 5EB8A 1GYMA 5I15L 4MA8H 5T3XL 3QAQA 5INDA 1GQJA 4M6OL 2X1RA 3ULVL 4Q52A 3DVGA 4CD4A 3EFOA 1A6PA 1G1KA 1BIIA 3V0HA 4MMZA 5EU3B 4IJRA 4IQLA 5TDOB 1Z1WA 4POZC 1KEMH 3QF0A 1GOGA 1GOIA 1XIJA 3DUHA 3PGFH 4GSQA 2Q86A 3CU1A 3BOLA 4JTSA 4FXLA 4TVSa 5BMXA 2NV9A 2WXOA 1TTJA 5MEPB 4B0MM 3NM3A 4MAUH 5LJYH 4OWGA 2CKNA 2G75B 4OZGA 3P81A 1WFNA 4AIBA 1GJPA 3WDRA 3Q5OA 3UYCA 3FTZA 3V55A 3NJMA 2IBZY 4IDJH 2A38A 4F8LA 3L4TA 3SCWA 1U9KA 1NA8A 3NIGE 2YD9A 4MBRA 1BGGA 2C9RA 4Y5XC 3QYNA 2SODB 2QTEA 3KCOA 3V5DB 3SI9A 3DN5A 2NUWA 2WXGA 3RF9A 1AQKH 1I1AD 2Z31D 5G2IA 3WNMA 4U1IB 3SE3C 4G9PA 3AISA 3W4RA 1QG3A 2CU0A 4GS7C 3NJIA 5E6IA 1TETL 3FQNB 3GSXA 1RSFA 4S11A 2Z65C 1Z9SB 2EICA 5F1UA 4NM4L 2OODA 4L4VB 1B54A 4LDOB 1E2VA 5E2JA 1WIPA 5EZPA 3MJ9A 3G6JF 3ZR6A 3MWAA 3N13A 3OZOA 3FQUA 1SQ7A 5HGHB 4P5SA 3UGXA 4G70B 1RVKA 3GC2A 1BD2A 4FYTA 3QORB 1T7ZA 2VHLA 1KELH 2FFCA 4P7LA 4H5SB 4WOQA 3WS6C 1Q6FA 3SUVA 2Z1VA 5F7EH 2VFEA 1XLMA 4M5ZL 4O1DA 2XKSA 4GQGA 5LIKX 4DZAA 4XVTL 2E6AA 3O3RA 1IBYA 4NQQA 4O57A 2G60H 3V5HA 3AREC 3ATDA 4E41D 4AQ1B 4PJBB 1DJWA 2OPCA 1N59A 4XC3L 2YBGA 1E6XM 3QM3A 2YAPA 3IKCB 3HG1B 2PP8A 3JWNE 3AJ7A 4Q4IA 4HVBA 1KBKA 1QNZL 1IEBA 3UH8A 4L1TA 2XN2A 4U3HA 1CFVH 2FL5A 5DS8B 1D3GA 1JP5A 3N43B 4JLRA 4LLVB 3VIKA 3Q67A 3C6LB 4EMZA 2NY6B 4XVSL 2CHDA 1ND0A 5DS2A 3LN9A 5JH1A 3OOQA 4P9HL 4Q8UA 4NN7C 4LVDA 4BQCA 2A9NH 1ET7A 5CIPB 3HPLA 4PUNA 3I6SA 3AM8A 4MJ4A 1JXDA 1S6NA 3SO7A 2RMNA 1BTMA 1NZRA 4KNQA 3GKAA 3MUHL 3O2VL 5I8OL 3G8EA 4DM1A 4LF3A 2DB8A 3KJ6L 5E08L 3A13A 4A3YA 1BDYA 1EGJA 1TZGH 3CL6A 3ZDYB 4WI4A 4GE8A 4S3KA 5F8RC 1ASQA 3AZUA 3DIVA 3TV3L 4LSTH 4B15A 3IKKA 1OPOA 4MMZC 1GTHA 3FA4A 1TV8A 4K3JH 4I2XE 1FZMA 3ME3A 3WLWD 2I14A 5EPMB 3GXPA 1RH8A 2CERA 5EO0A 3VX0A 3AGVA 1XF1A 4D6CA 4TQIA 1BFNA 4AT6A 3W7MA 3BWAA 5L7XH 1J9CT 2W1NA 1S7TB 4HK3J 1W2VA 4K94L 3A3HA 3HIJA 4JZOB 5F0LB 2P1FA 2ICEA 3WKZA 4MKVA 4ZDHA 4JRYD 5I1HH 2J9ZA 5MEQB 2ZYFA 1S9XA 4BS0A 3FCSA 4BINA 2PGWA 1XLLA 1JGEA 1LP6A 1W1TA 3HJZA 4EN2A 3MNDA 3EO0A 1T2QL 3K2GA 4N85A 2WANA 4KK9C 5HQEA 3O05A 1BEYL 4A8RA 4OCNC 1BBDL 4WQOA 1KKOA 4KK9D 4JG0H 4O18A 2C8NA 3TZNA 2KDGA 1L5GB 1SJEB 3UR8A 5E1QA 5ISZB 2JH2A 6CGTA 3P77B 3L3HA 3W7OA 3MU3A 3P3YA 2J88L 2ENJA 5E6IC 4LCQA 2BLFA 2O9RA 4IOIA 3U7AA 4UT9H 1G4PA 3MQTA 2FE0A 2WUCH 5HUOA 1A1OB 2CYGA 4BFNA 4UYPA 2XU2A 2XCMC 1PFOA 4HCRL 5EMMA 4QGTA 1E2ZA 4DVBB 3PXLA 4XQ6A 3VGAB 3ZE1F 2VDQH 3BAEH 5CEYB 4I5XA 2GIMA 1DQKA 3PPFA 3EPMA 1C5BL 4D71A 4XODA 3GS7A 2NLYA 1T4WA 4Q9QL 2IVFC 1ZV2A 3BUQA 4H13C 4P04A 4A37A 2FH6A 1SN5A 2PD9A 5EUKA 1LEIB 2K8QA 1W8EA 2GJXA 3C0LA 4FZ8H 2XJKA 4URTB 3S5LB 2FB3A 4XO6A 4JCMA 3TBSA 2D7TL 5HHMB 1OQXA 4G1MA 5HYJB 1SXZA 4PJIB 4IMEA 4QHPA 3T0CA 4HULB 1Z66A 2GKIA 5CSYA 3ABZA 2E6PA 3UNDA 4I3GA 4EVNB 3KBJA 2ZXGA 1E5NA 3TN0D 5AC4A 2ZWLT 1JUEA 2FZ3A 5ID1A 5MEOB 5EWIH 1S7VB 4O02B 3LY6A 4U1JB 1O5QA 4WV1A 4ZMAT 1H61A 1W3LA 3WY4A 1I0DA 3GMQB 1NFKA 2HT2D 2L8AA 4ZMQA 5JNYA 5IVZB 2OP4H 1YE6A 4IGBA 5GSRB 4P4KC 3WL9B 3AM8C 1B3JA 3AIEA 1NCWL 4CN1A 4X5QA 2JJSC 1SLWA 5CJOL 1HIML 1OHQA 4EDXA 3GZOA 1IGTB 3MCG1 1V02E 3OSKA 5ECVA 1TMHA 2VMJA 4GUPB 1S5TA 5REQA 2XM2A 2NLJB 1JWSB 2H9AB 3VI4B 3SGGA 1XLJA 5E03A 2MSPA 4Z1CA 4GLRI 4IW4C 1J96A 1KTJA 1SY6L 2EXSA 5GVJA 2G41A 2OX5B 4F8PA 4KWVA 3J2PA 3B9VA 1U0QA 4JM0A 3O6CA 5DVNA 2Z0UA 5T1MA 4AQ8A 2X1PA 1TTRA 3MLWH 5ALBH 3FJTA 3TJEH 4ABQA 3G22A 5GZNA 5ACMA 1GWJA 1N5AA 1U6AL 4GP8B 3U0HA 1ZBWA 2Y1ZA 5SWQB 1KBLA 4ZXOA 5FHBL 3H22A 5DJ6B 4FHKA 4FYRA 3O2WH 3S42A 4QR7A 2EYRB 3VYNA 3MUUA 1XF5B 3KWSA 2ICEC 1WWWX 5HHOA 4QF1A 4N8CL 2WYZA 2HJKA 3VRIB 4KH2A 2DMCA 1T3FA 3X14A 2G3JA 5CZRA 2GGGA 4M1GH 4L3AA 4EI0A 3EO1A 4C5ZA 3X3GH 4NSBA 4AVHA 5KSBF 1KV8A 4U0QB 5HMFA 1SHXA 4KV5F 5D2LB 3CQQA 5C0BA 1CYGA 4XUGA 5KVFE 5E4OA 1WD9A 2B7OA 4KTDH 4HWUA 3TVMA 3LCFA 4E2BA 4H9UA 2IPJA 3M86A 3HC3H 1AZVA 4O52A 5CWSB 4IQEA 4N8PA 4U2ZA 1XX9C 1KRBC 3B6SA 2IPKB 4IOFC 2CXKA 1J2BA 4J3WA 5SWSE 5C2XA 4M1BA 4L0PB 1KN2H 1E9IA 4N0FA 1WV7T 4PRPA 3K91A 3HAEH 4LF2A 2GK2A 1QRKA 4I5BA 2V0TA 2WWMC 5I1LA 3RTQB 4QITA 3TV8A 1TQSA 4L4TD 3GEWB 3CBKB 4XX1E 3IFOB 2VGGA 3CZUB 4XRCA 3RX9A 2ZD0A 1MZHA 2VB5A 3QZEA 4U1MA 4GUGA 5DBTA 2Q6WA 3RVTD 3SW6A 2XV6B 2PU0A 2E75C 5A40E 2G0LA 2Z7UA 3L95A 2YKKA 5SWZA 4K23H 1R3WA 3VE0B 3IGFA 3PVFA 1FNAA 3F03K 4DJED 1E7VA 3VH8G 3GAYA 1LO5B 3UROR 1Y1UA 4LFHD 4KWOA 4ML9A 4BQ9A 3SRDA 4M5YH 4HCHA 4R4ND 1YRKA 4JEQA 1JRCA 1KXTB 3OZ9H 2YSSA 3MLYL 1QBLL 4TLUA 1GJUA 1XC6A 1E51A 3ITGA 3MV8B 4Y19B 3N25A 3QUXA 4LSPH 3WG7B 5D7LE 1MWAA 2C3ZA 3X1EA 2A6KA 4PU2A 5ESAA 2Q87A 5EMYA 3LLFA 4PWHA 4FD0A 4PRIA 1CFNB 4S1SH 4P8XA 2NX5B 5B38B 4TVPL 3IETB 4AB4A 4IGBC 2G9HA 1XMEB 2VDRH 2J7HA 5HWNA 5C86A 3EPNA 3MODL 3K3QA 4U6YB 1MHCB 3MANA 2BVDA 5CPOA 3E1F1 1U8JB 4B3VA 2JLLA 2YSWA 5AW4B 1QHQA 2DTSA 2WQDA 3QNFA 3GI9L 1TETH 1MVUB 1TX2A 2DLTA 1QUNB 3E80A 4NM4H 5I76A 3HI1A 1ZDQA 5IMOB 1X4XA 4EPEC 4AQ8C 3WHXA 5HGDA 3P74A 5DQ9A 3RGVD 3RY4A 5DLLA 5GZNC 3S8WA 2POZA 4F80A 3NCFB 1IJ9A 5FLVA 3N42F 4DVOA 3BG5A 3U8GA 4ZO6A 2WM1A 1X1ZA 3O4LB 5EZIH 4HUXA 1QABA 2DIJA 5CP7B 1OM0A 3TTEA 4NPYA 3WLSA 2HX9A 3S3JA 4X5WA 3S37L 4GI8A 7FABH 2QV2A 5LVEA 2W27A 1U8OB 2EYSB 4RZ5A 4N5ED 2NQDA 5I19H 3WYZA 2O26U 4GG8B 1Z0MA 4FQXD 2WNQA 1FQ9C 5JYLA 2CJUL 4HSAC 3PDGA 4FRWA 12E8H 4XC3H 4GKNB 4Y4HA 4G7YL 5IFAH 4FADA 2CIPA 1BSLA 3QCTH 4AM0Q 1P4LA 1P7HL 1HNFA 2INFA 5JOFA 4XMPH 1AUSL 3L3KA 1XKYA 1LK2B 4IMAA 3TVMC 3UG5A 3I3EA 1AS7A 4A6YL 4ZMTA 1WH0A 1LG1A 1AJZA 3MRNB 2OSLB 1AACA 5L2KE 5BOEA 3LV6A 3SOBH 4P9HH 3OLDA 2Q8AL 1EMTL 4L4LA 4KTEL 5JMOC 4B16A 1U8IA 3TAKA 3R6IA 1AZ1A 2YKLH 2J3SA 3NPUA 4GFTB 4Y2LA 5HPCA 3BPLC 3HE6B 5AFAA 2FYVA 5CEZH 1EJOL 5LBSA 2H2PC 3B9AA 5LKYA 3IPEA 5ABDE 4W6YB 1AFVL 4PS3A 5E08H 3LB6D 3KYAA 4FLQA 3NT0A 5EH1A 4YHKL 1EVTC 3ILQD 4PAZA 4YBQC 1M7UA 3M1ZA 4R0LA 3KPLB 4YHMH 3TV3H 3N2JA 3WXVH 2N1KA 1DXIA 2N7SA 4G6FB 5HQMA 4HSQA 3CVIL 1KYDA 1KJ2A 1DJIA 5MHSE 3QUMH 4FLOA 3VK5A 3L21A 3GTTA 3N1QC 1MLBA 3GE7A 4QY8B 2AFNA 5K5YA 2E7MA 4RDZA 2N0KA 4P5RA 1MI3A 3PPEA 5EZJB 3IU3A 3K6OA 1CR9L 3KPOA 3CFDB 4N0CC 4P2RA 3C3NA 4B5EA 3GZKA 2WO4A 5IVXB 2ACSA 5LYRA 4K2UL 3OTRA 5IMLB 4BEUA 3DXIA 1A3ZA 4B9IA 3B34A 3F12B 4PW4A 5JBFA 3EHBB 3R0NA 2H3XC 4Y4KB 3IAQA 1YC8A 1HJCA 3BSZL 5A8NA 3IGLA 3KEHA 4XO3A 1FNHA 4TSCL 5ESVA 4JO2L 1BEYH 7ODCA 5F21B 1IR2A 3UPBA 2PLTA 3QCVH 1UBSA 2OR7A 1HILA 3WF2A 4GBDA 3TA9A 2WXRA 2JIXA 2BVYA 3EOYG 1GGCL 2CDGA 4GNVA 2WVUA 2O56A 4F48A 2IFFL 1FH5L 1QFWM 3BKML 3O3AA 4C47A 5DF0A 3S9IA 3SDCA 1KQYA 3IIOA 1F6LL 3S3CB 4MNKA 3LKRB 5IDZA 4X5XB 4NDMA 4ZPVB 1BWWA 5C92A 2H26A 4Y7OC 3CUPA 1FCUA 1MFEL 1IV8A 4PEEA 4C57C 2A3BA 1OZUA 3Q1SL 2NYZA 3NG5A 2B0SH 2YD5A 3BLLA 2E4TA 3PUUA 3BI9X 1OCQA 4XISA 3MMEB 3SDXE 3HG2A 4JRFA 4UILH 4HUCA 2JEPA 2X41A 3KW8A 4PMZA 4B27A 2O4EA 1JTPA 1O68A 4I9MA 5KYXB 2ZKYA 5IW1B 2XGIA 2CXEA 3AZRA 3S1GA 4RQQB 4TQPA 3QRHA 1C29A 1SJMA 1IZKA 2QL1A 4OFYD 4W89A 3S4SB 3G08B 1NGYA 4UR9A 4Y4HC 3GVQA 2HFEB 4ZOCA 3E3QC 1UKTA 4UF7C 2BNRE 3K6NA 2H6PA 4EXBA 2AQWA 1JN6A 4IHBA 4MCYA 4ZMPA 1JZ6A 3QJVB 2TPSA 3LIZA 5ITFA 4H00A 5JYMA 3DFSA 4DSYA 2TRYA 2XETA 3BP5A 1D6VH 4JGMA 1ZXQA 5CZVL 3G5WA 1ZFJA 3AJXA 2OLAA 5FOOA 2NNXA 1H6FA 1IVTA 3CX5K 5EORH 1P5UB 4KT2A 2QPXA 4D0BA 4ONHB 2NX9A 3UGRA 4NJJA 3GVVA 5CR8A 2BCKB 2C3GA 4R3SA 1YEHL 4PJ9B 3GLAA 3ITOA 3E9TA 4JL2A 4FF9A 4O17A 4JHZA 1VGEL 2DBJA 3RWHA 4BK5A 1L9MA 1SFTA 1DJSA 4KWWA 5E2WL 4K7FB 4NQUA 3T2PA 2CR3A 4NP7A 4U1HA 1IT0A 1I9JL 4R0LC 2A5UA 2RDWA 2GSHA 2F8QA 5IKCA 5CUSL 1OK6A 3OHIA 1XB6A 2XVBA 4JXCA 4PMJA 4HXBL 5TJWK 4LQFH 2ZZ1A 4BZ2A 3MP5A 2KQNA 2AQPA 1AP2B 3ORWA 1MCHA 1R30A 2DQ6A 1I31A 3BL3A 4NAQA 2YWYA 5D5MA 3ABGA 1IXPA 1WAAE 3QK0A 4YIQA 4WUUD 2HCZX 4NRYA 1N7KA 5FHBH 4RGNC 2H0PA 2WZHA 2BOBB 3AICA 5C0DB 3HV8A 1Y8BA 3QPXL 4J9JA 4FNTA 3RPIB 4H6RA 4IKJA 3SZ6A 4XO7A 3ZE0F 3IMBA 5CSZA 4N2NA 2CIIB 3QEQE 4ORGA 4YSAA 2I26N 4D6EA 2E7DA 2ETWA 1OAUL 2I9LB 3NQ7A 3TCEA 5C9XA 5GS0C 4FNSA 2A6LA 1UM5L 3HU7A 4U3AA 5GS0D 3TPUA 4W85A 5CZXC 3WJMA 4NU7A 4PJ7E 1ZJHA 3DK2A 3WG6A 3PUOA 4KKLC 4HFWA 1WOAA 3TBWB 3ZR5A 5EFIA 2FDSA 4XNZC 3YPIA 2QUMA 3ULUC 3DV6B 1EC9A 4EVZA 2AXGA 4ODWA 4OZFG 3I9PA 1DEEA 4OLZL 4WOZA 4JDEA 3SDCC 4DZBA 5DEGB 1WC7A 4HKBA 4IJTA 5BOPA 3W83A 1NCCH 2ZA3A 5FECB 5A69A 5I82A 3EXJA 2GPTA 5FGBA 2VM3A 1MMFA 2Z6JA 4Y9FA 1SFDA 5A6BD 3SCSA 3SAZA 3FB5A 3D05A 2NCEA 2YA2A 1EP3A 5IR1B 1VPOH 1ZGLB 3ILPA 4YHZH 2VZ3A 4CQBA 2Q7NA 4NNYA 2R4SH 4I7VA 4XP6H 5F7NC 3RNKA 4P5KB 3WJLC 1S9WA 1AJ0A 4L9XA 1XPYA 2VX6A 1D5IH 2NY0C 3EYFB 3IAGC 5CR1A 3VCLA 2ZVIA 5HHXH 1TQXA 1VBHA 4WDIA 1OX4B 4NJIA 2FT7A 1A5OC 4OD3L 4LOUC 1E70M 3MCLH 1FWWA 3GTNA 1R46A 3FO9B 4ZTPH 1ZAIA 1M9SA 1DDTA 3FUKA 3MKKA 1Q6LA 2A6JA 2PDGA 4ZUWB 2YPLA 4MA8L 5H8DA 4M3PA 3PY2A 2R27A 4GBXC 1IL1A 5HPMB 3IJIA 4GBXD 4Z23A 4APQA 2P7TB 1SBBA 5HYSB 2J75A 5K9KB 3G1XA 1KEGH 2I9EA 4PUUA 4DN3H 1FI8C 3CUHA 3PQYB 2YMTA 3PGFL 3QEZA 4M4RB 2ZWYA 2CCRA 1QBAA 4ENEC 3GSRA 4IIQC 1BZOA 1F4AA 1AH1A 4QYAA 3CXFA 3BZGA 4RAVA 4MAUL 4BK8A 2J44A 2ALRA 5T1JA 1INQB 3B1TA 2C3XA 3ZBMA 4BK5C 2EIKB 1XS2A 4YXGA 3C08L 3ZKND 1KUMA 3T0BA 5FESA 1FDJA 4IDJL 4WR3A 3KG5A 5IOPB 4E9YA 3B5HA 1XF4B 4WHYG 4LXFA 5F7KC 2ITDB 2Z4TA 4NZRH 1BXNA 1QSFA 1YVLA 1VFSA 4Z7VB 4YSRA 4RV8A 2JVUA 3BEWB 4OJCA 3N41F 2IAMD 4IS6B 4OJAA 4PGDB 2NZIA 3EGDB 2JTDA 5CINL 1BJ1H 4R4BA 2ENQA 1EEQA 4KWSA 2WHJA 4TNWF 4I18C 1O4UA 1I1FB 4OF6A 3IFLH 3P73A 4XNBA 1XISA 3ARZA 4EKJA 3LKOB 3BLKA 4LVNC 1T6WA 1D5MB 2QGYA 2W07B 2XA3A 3LN5B 2Y5SA 3W56A 2YGOA 4ODTH 4GIAA 4LHUA 3RDTB 3ZXAC 5FW7A 3T77A 4Q58C 5FF4A 1DSWA 5CN2A 1OP3H 2ZUVA 1KELL 3ES6B 4PSRA 3WV0A 3O41B 1G7HB 5F7EL 1AR1C 4HD9A 3LM7A 1E6ZA 4GRLB 4D0DB 1LQ2A 1NWTA 2AHIA 2OQJB 5DFTA 1GKRA 4H1LG 5JDJA 4GA8A 1F4WH 5DHYB 2G60L 5BJTA 4X60A 1IU1A 3QJFA 4A6YH 1XIDA 3O9WA 3DX9A 2R8SH 5AAMA 1Q4NX 3LH9A 4C6JA 1EMTH 1GZ1A 1AI1H 1A6AA 3FOMA 2HISA 5XINA 4PULA 1V7AA 3PUGA 1UM4H 3PANA 2KBGA 1UUQA 5C71A 2LU5A 5E1AB 4XB7A 3L45A 2R1WA 2AVFA 1UYWL 4XP5H 3T09A 1CFVL 4O58H 4X8XA 4YTTA 4HOXA 2V2CA 4E3VA 3BIBX 1JFXA 3K2UH 3TPKA 4I5UA 4ICMA 1SW3A 2QQLL 3GX9A 1HL2A 3GB7A 3EOAB 3NJVA 4Y2DA 1K8CA 3IXTB 1KFAH 3MMWA 1DWJM 2A9NL 2FWUA 3R4DA 4RMBA 4NAEA 3SBWA 5JHLH 3VWKA 4ZFMA 4B2DD 1F8IA 3FT1A 3IGXA 3NIFF 3M1BA 1NPJA 2Z28A 2OI9B 1REQB 1TZGL 1T5XB 3IGKA 3LAFA 5D1QE 3VSVA 2NY1B 3EJRA 1G9EA 4KY2A 3OHXC 3B2DC 4W84A 3CL8A 2G0WA 4F27A 4LSTL 5EF2A 3SKNA 2CDEB 4AZBA 2X4QB 3MLVH 2OMWB 3CN1A 3LNPA 3QZ6A 1I7RA 4K3JL 1QPQA 3QTPA 4OCXH 3LCHA 4F2FA 1TEFA 2RDXA 1W0MA 2PCYA 4O2EA 1QX1A 3SN6N 3OB8A 1P5VB 1G6RH 3W2MA 3L81A 1ZB5A 3M6DA 3N4AA 2XWBB 3N73A 5DA4A 2DWEA 2K8MA 5L7XL 4NO5B 1SFSA 5AYQA 1SOXA 3OAZK 2F6AA 2CNZA 1EJWC 4Q6IA 4Z7QE 1GOFA 3BXWA 1M68A 5EN2B 3MSYA 2F8OA 4IK7A 4CDGC 1FFRA 2ED8A 1BX2A 4AC7C 4A4AA 1GGCH 3RLUA 3G5YB 2EDBA 2GJPA 3BKMH 4XN8A 3H9HA 4CQ9A 1YEYA 4A7VA 3H9SE 1GOOA 3K7UA 4NQEE 3TCLB 2ZUMA 2BWDA 5ECJE 5JUVA 3UZWA 1X5IA 5CHNA 4LEFA 4KX7A 2UUDK 2J1YA 3N6YA 1Q6GA 4LB8A 4LRNL 4MCNA 1DL7H 3RWFA 1MFEH 5E9XA 5GJSH 4QQ3A 3T04D 1OE2A 4N3TA 5F6HJ 3GKFA 5ANHA 3LOWA 3T3ME 3CIAA 3SDDB 4UUJA 1KB3A 3THAA 5GGRB 3K5RA 2GT9B 1N2RB 4UT9L 1NM9A 1J11A 1ADOA 2WUCL 3UG4A 4DEPB 1BVOA 2E9MA 4OZ4A 3CC1A 5KYUA 1ZHLB 1EAPA 3ITTA 2CBIA 1N3NB 2V67A 4NUJB 5JQ9A 1SDYA 4PJEF 3BO9A 3UJEA 2VDQL 4KRTA 3LKPA 3BAEL 4NQDA 2ZOLA 3SDAA 3I75B 2FJUB 3OVUB 5EHFA 1U8MB 1HQ4A 2ZG3A 3TN4A 3E0FA 4BKSC 1GONA 5AB1A 3NOYA 4FI6A 1SJHB 4P3DA 2X6CA 4R2GD 1ZD6A 4KRMB 2HXUA 2JBMA 4A3HA 2P5EE 5HI3C 3OB0H 3SKJL 2YXOA 1EO8L 1VACA 1WBYB 5HI3D 4FZ8L 3OZMA 1GSKA 1TT6A 3F8UB 3CSYB 5F9OH 5E93A 2Y7NA 1Q0YL 1A6TA 1JRHI 3GF8A 4JTTA 4KF1A 4DGVL 1SLVA 1JZGA 1A5LC 3I6KB 2H8PA 2BP3A 4JHUA 1BOGB 4YTRA 1H15B 5EWIL 4AJVA 5DHVA 2FSEA 4KCVA 4MWAB 2XWDA 2R2EA 4I0CC 3UBXA 2NYKA 3A4DA 4G8IB 1KTLB 3B40A 2FQEA 1B31A 5B39B 5DD6A 2OP4L 1DO5A 2OOFA 4FNLH 3TROA 4NO0D 1T5AA 4ZQCA 2XSAA 1O6IA 3GSUB 2VZUA 1I1AA 2Z31A 1DE4A 1UA6H 1GORA 3QRLA 4LUSB 3AXHA 3R06B