4UQBA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.68 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 135
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqbA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqbA02
2UY3A 1UHVA 1V3JA 1UA3A 3FAWA 4B3KA 2CERA 1PEZA 2DPEA 4PTMA 1H3GA 4TVDA 4HTYA 2CETA 4D6FA 1BYBA 1NOWA 4BQ5A 4ZXLA 2J7DA 1UR4A 1G9HA 1HP4A 3FAXA 1E4LA 4FF5A 3KEHA 4PTVA 4ZFMA 5A6SA 3K8KA 1MXGA 3A24A 2J4GA 3NUKA 3GXIA 5CGTA 2YL8A 4A4AA 3A6OA 5BRQA 1GQLA 5A6JA 1PX4A 1KB3A 4QLJA 3EDDA 1WO2A 5I2UA 4D6IA 3RM4A 4ML4A 5C71A 1LG1A 2XN0A 2RGMA 2VOTA 1TVNA 4CCCA 1QW9A 2FGLA 3ZMRA 3S5ZA 2WCAA 4U31A 2XIBA 3N13A 1CXFA 1TZ7A 1JYXA 3CHEA 2EABA 4UR9A 1V0MA 4DUWA 2CBJA 2PWDA 3EJSA 1Z32X 4Q7NA 5A6KA 1JZ7A 3ZJ7A 1VRXA 5FKYA 2CKSA 2OW7A 2W61A 2DT2A 1JL8A 4AEEA 2WC7A 6A3HA 3WEMA 1B3WA 2W66A 3ALGA 4PMOA 5JIWA 3IJ8A 3I3DA 3OGRA 3VMOA 1C92A 3SUWA 3KL5A 2PC8A 3GNOA 1IZJA 2ZX6A 4CN4A 3PZGA 1W3HA 4W5UA 4D1IA 1WDSA 2CBIA 4L4OA 4MTVA 3CZNA 4FNQA 4TX8A 1UQZA 3SCNA 3W27A 3WDIA 4HOXA 4MAZA 1B9ZA 5A8NA 2PWFA 4M24A 3A3HA 2XGBA 3KWXA 5GQBA 5BXPA 3WH8A 4B9YA 4CN1A 2EBNA 3WD4A 4E8DA 1ITXA 2BHZA 2UY4A 1BG4A 3FHQA 3AFBA 4KGLA 4CD4A 1PZ3A 1GQJA 3CHFA 1HL8A 2XJ7A 5CSUA 4BQ3A 2WHJA 2NT0A 2ZXQA 3AYRA 4UZUA 1MW0A 1UD4A 2PF0A 4M8UA 4XV0A 4B9ZA 1CYGA 2J62A 1KGUA 2ZE0A 5C70A 4E4PA 3BH4A 1UH4A 1SYTA 2D0HA 2BY3A 1I75A 1R34A 2J8FA 7CGTA 3AHXA 3AXHA 3EJQA 4LXFA 2OYMA 2F61A 3A5VA 3MMUA 1XRVA 1VFUA 4EKJA 3ARUA 3CPUA 5HPOA 3NDYA 2XSAA 1KXHA 4WKFA 1CGTA 1D3CA 4FLOA 2X2YA 3A4AA 4U33A 3WF0A 2ZUUA 1H09A 1OD0A 4AZ5A 4P7LA 4Z2LA 3GBEA 1B0IA 2DSVA 1FHDA 3AXXA 4HMCA 1HJSA 2EEXA 3PZ9A 2W4XA 4Z2IA 4W8BA 3WQ4A 2VC9A 3KE0A 2J7EA 3POCA 4JKMA 1WP6A 2XWDA 2PWHA 1DWAM 3WNLA 3WF3A 1JNEA 1TCMA 1AQHA 3NSMA 2D22A 2PBGA 4PCSA 2BXYA 2BFGA 5BXRA 1XSJA 2FGZA 4IUGA 5CG0A 1GVIA 1J0YA 1EO7A 3ZM8A 2PWEA 5I77A 3WBEA 3GNRA 2WVSA 3DHUA 4GQRA 1OCQA 3AHZA 4H8VA 1W1PA 3F5JA 3W37A 3AMCA 4QLLA 4MB4A 3RO8A 4U2YA 3SIMA 4CU8A 3T0DA 3VO0A 5I24A 2D1ZA 2CIPA 2GDVA 4F9DA 4EANA 2FE0A 1W9XA 5HDRA 2G4FA 3EJTA 2BHUA 1YQ2A 4E8CA 1H11A 2ALWA 3CMGA 2GSJA 4JHZA 3L2MA 2VX6A 1KCLA 2ZX8A 5HNNA 1VJZA 2GVYA 1UD8A 3GH5A 1E5JA 3WNKA 4D6GA 3TTQA 3AI0A 3VKKA 3F5LA 3WENA 3VM5A 1EQPA 3W82A 1SZNA 5DF0A 3AIWA 3VIMA 1DEDA 1E6PA 1V6UA 4MB3A 1Q6GA 3T0AA 1ODUA 4CCDA 2D23A 1H0GA 2EPMX 1GW1A 2CHNA 1V6YA 5JBFA 2XYLA 2WZHA 3BAKA 4J3UA 1E6ZA 3F5KA 1JYWA 1EOMA 2BXZA 3WF2A 5CGMA 3VDBA 4LYRA 2YA1A 4F66A 4UOZA 3WIJA 3OLIA 1B30A 5D8ZA 1Q6DA 4DO6A 5I6SA 1NP2A 3GZAA 4JL2A 1DWIM 1E43A 4PYSA 1GUVA 1W2VA 3CV5A 2VZSA 3POHA 1JYNA 1E40A 2V3FA 3WEZA 4AD1A 4OZOA 1PIFA 1DWGM 2XVNA 4CGTA 3ARWA 5D8WA 5E09A 3VNYA 3SCQA 3SURA 1TFVA 1HTYA 4GZEA 3K4DA 4MDOA 2D3NA 1LQ0A 5EFDA 1M53A 2YIHA 2O9TA 3ZR5A 2BVTA 1DWHM 1E70M 3DDGA 2G3IA 2UWFA 4W7UA 3WDQA 5JBDA 2CNCA 2VQUA 3NCOA 3PZIA 3BUBA 2NW0A 1LL6A 2OWXA 5CLTA 3AS0A 3SCWA 4AISA 2G3NA 3ECQA 5DT7A 4PRWA 2DSWA 3BLPX 5E0CA 1HKIA 4LX4A 1GVYA 4Y7EA 4ZE5A 4OIFA 1KQYA 4GO9A 3FN9A 4ZXOA 3WFLA 1RPKA 1B3ZA 4XZWA 3EMZA 4PUDA 1E0WA 4HZ6A 1XV8A 1ZL1A 1RP9A 3L2LA 3WF1A 1MW1A 1JYVA 3KLLA 4YHGA 3U7BA 2VO5A 2ZUWA 1G94A 3N15A 1VFFA 1E15A 3WFZA 1JD9A 4FNPA 4A3YA 4UNIA 3EDEA 1Y7VA 2IGTA 4X0NA 4BZYA 2J78A 4RL3A 4PMQA 1C91A 2ZUNA 1EGZA 3B9EA 3BAWA 3VIGA 4JFWA 2GFTA 3ZOAA 1KFWA 4W93A 1JFHA 3AHTA 2Y24A 4GI6A 4P7NA 5DO8A 2CPUA 5EBAA 5A3HA 4CKQA 2J47A 2V3EA 2V3GA 4UQBA 5CSYA 1UWTA 4TVUA 4JFTA 3SUSA 3AXIA 1QOXA 1V03A 4W89A 3AS3A 1CENA 4HZ8A 4HZ7A 1G5AA 1XD0A 2PB1A 5LYRA 2HISA 3K4AA 2WMJA 1E9LA 3EMCA 4DUVA 3MSDA 5E70A 5HXMA 4M56A 4HA4A 3VGFA 3HG4A 2J75A 4JZ5A 2F7QA 2BVYA 4AD2A 1J0ZA 1JDDA 2WVUA 1E5NA 2G41A 1NQ6A 1JI2A 1CXHA 5AYIA 4MNLA 3L4ZA 1ZU8A 5HOSA 2PI6A 3RILA 3S2CA 2WLYA 2GK1A 4W5ZA 1TR1A 1UR8A 2WAGA 3N9KA 3ARSA 1KR1A 4MJ4A 5E6ZA 4AD5A 3OG2A 4QFUA 1UH2A 1M03A 1L8NA 4ZEPA 3LPPA 3M6DA 2YLAA 5A2CA 4V28A 4ACZA 1XSIA 4HU0A 5IHRA 1Q6FA 2XN2A 3W53A 2O9RA 3AIUA 3CUHA 3GH4A 2Y2WA 1XHGA 1CGVA 4AYGA 4C7FA 2DDXA 5BXSA 2YDQA 4W8AA 2EO7A 2JEQA 2YBUA 5A6LA 3UG5A 2WWDA 3N11A 1HF6A 4GO8A 3DX2A 2XUCA 2JALA 2VQTA 2WKLA 2D3LA 3VGDA 3NDZA 4CU6A 4P7QA 4JHOA 1J0KA 3FY1A 3DX3A 3W28A 5BCAA 5BROA 1UR9A 3AMDA 1KCKA 4CD8A 3SCPA 1OGBA 5FCZA 1B1YA 1UG6A 3ZO9A 1PBGA 1JF6A 2ZUTA 1K9TA 3BAIA 4CCEA 1UWQA 3VD4A 3LX9A 3TTSA 1OGSA 2UY5A 3GNPA 3LRKA 2WKGA 3VX1A 1RP8A 1TE1A 2CCRA 5A6BD 4IPNB 3AS1A 2V38A 1UR0A 1QI2A 3O2LA 1KXTA 4HA1A 1I1XA 2W63A 3LXAA 1C8QA 1W9UA 5IDIA 1V6VA 3BUPA 1GQKA 1GOMA 1BF2A 5F7UA 4AIOA 3VIOA 2F2HA 3GYCA 4ACZB 4YHEA 3CGTA 2DIJA 2UY2A 1QNOA 2EPNA 3RM8A 1LF1A 2W67A 1OT1A 5AC5A 3G6LA 1H41A 4A3HA 1WDQA 5GNYA 4NZCA 1GOIA 3WN6A 5A69A 5ABEA 2WLZA 4FNTA 2WZIA 1VB9A 1RH9A 2BY2A 3OB8A 4OJYA 1J12A 5CJ5A 1FP9A 3VVGA 2C8NA 4WSKA 4XZBA 3S5YA 4NF7A 4Z2KA 3CLWA 1VEOA 4GXPA 1BQCA 5M17A 2E9LA 3MUAA 1ZBVA 4AZCA 4CD6A 2YL6A 2VR4A 5A95A 2YDSA 3T09A 3TA9A 5AY7A 2NT1A 3PBGA 2J74A 1GNXA 1LL4A 3MO4A 2Y8KA 3GXFA 1BYAA 2XSBA 1J0HA 3SCUA 4H8UA 3M7SA 4F79A 2EXOA 4JIEA 8A3HA 4KGJA 1CEOA 3QGVA 2ZUSA 5FL1A 3CZKA 4YPJA 4X9YA 1K6AA 2WNWA 2XM2A 1W9DM 3BSHA 1H2JA 4K68A 2Z1SA 3D4YA 3VOCA 2VCAA 5DEZA 3VIKA 1MXDA 1B3YA 2VRJA 5A8MA 2XWEA 3EJPA 3PN8A 1JZ4A 1R7AA 3F4VA 4HPGA 2ZXAA 2J7FA 2BHYA 4U5IA 2QF8A 5LA1A 1BHGA 4PMZA 4PCTA 3WL0A 3MMDA 2ZXBA 2BY1A 1OBAA 4PMUA 1KXQA 2X0YA 2QMKA 2F7OA 4CUCA 1UD5A 3WD3A 1QNPA 3LRLA 3ARZA 2XVLA 4TXEA 5M5DA 1NWTA 3K8MA 2YA0A 4NRSA 1NARA 4AD0A 4GI8A 3EMQA 2XPKA 1E73M 4WK9A 3ZJKA 4W87A 1UR2A 1E4IA 2A3HA 3ZT5A 1YHTA 3VIPA 3WL1A 1H5VA 1XGZA 3H55A 3H53A 1JG9A 2E8ZA 3LPOA 1QPKA 2VX5A 4EE9A 1DWFM 3AS2A 4AZBA 3EJRA 1HKKA 5D9PA 3TTYA 3D3AA 4CD7A 3AIVA 2D0GA 4W7WA 5E0FA 1ISYA 2E9MA 2VT0A 4GIAA 4MNMA 3IGUA 2J79A 2EQDA 3PZMA 3MU7A 1CWYA 2YJQA 4QLKA 3VILA 3U5YA 3SUVA 4D71A 2G3JA 3W4RA 2XVKA 2PWGA 1NWSA 1PPIA 2A3EA 1NH6A 1E6NA 2J8GA 1U2YA 1FH8A 4MB5A 1HJXA 3EDKA 4HMDA 1IZKA 4P8WA 1F4HA 1MFVA 4DWSB 3MSGA 3MANA 4BQ4A 1D7FA 4B3LA 3UR8A 3S6TA 2E9BA 1LJYA 2D2OA 2WPGA 4OBRA 5FD0A 5DT5A 1BPLB 3AIRA 4HU8A 4JCLA 1E4NA 2A3CA 3VINA 5FIPA 1PS3A 2JIWA 5I0DA 1BLIA 2RGLA 1E71M 2WWCA 4AIUA 3OZPA 3EBVA 3CZ8A 1QNRA 1GORA 1C8XA 3LMYA 4NSBA 1G1YA 5E1QA 1BG9A 4HP5A 4JL1A 4R27A 3PTQA 1VFMA 4ATDA 2JE8A 1X6LA 4YN5A 4E2OA 5JIPA 2J7GA 1RD6A 2EPOA 3GBDA 4ATWA 5DMYA 4J3TA 3TV8A 3L4UA 4UOJA 4UFLA 1WDPA 3NYDA 4UQAA 1TQUA 1QW8A 1QVBA 3NSNA 3L4XA 2WSPA 1S46A 3CUJA 4XB3A 5AC4A 2F1BA 2DSUA 3MKKA 3OZOA 1CXKA 4W7VA 2OWCA 4AZ7A 4C7GA 1L0PA 3N04A 3DC0A 3HN3A 1QHPA 3WSUA 3LPGA 1V3HA 4D6CA 1VEMA 1VIWA 4PMNA 3II1A 2CHOA 1UZ4A 2B31A 1R7OA 4QAWA 1HNYA 1Q4NX 1ITCA 1BTCA 1TMQA 4XUYA 1OIFA 1QBBA 3BMVA 1B90A 5D9OA 3VIHA 5ECUA 1W9BM 3WY3A 3OGVA 2VMFA 4UCFA 1QI0A 3MUIA 4BQ2A 2J25A 4Q22A 3IANA 1BSIA 2JFEX 4TUFA 2V3DA 3LXCA 4WSJA 3WUEA 2WCGA 3D5HA 1CXLA 1NWUA 2X2HA 2OSXA 1FFQA 3UEQA 4J3XA 1GHSA 3WY2A 1AQ0A 1NP0A 2J7CA 3RJYA 1KR0A 1JIBA 5TD4A 3FW6A 2C7FA 1MYRA 1G0CA 1HT6A 1JZ2A 1PIGA 1TA3A 3SUUA 3RCNA 1K9DA 3QOMA 3VIFA 3WBAA 4DM1A 3DYPA 3BUDA 3MMWA 1R47A 3WD0A 2ZICA 1LLOA 3KZSA 1M04A 4OUEA 7TAAA 1X6NA 4M82A 4Z2HA 2XFYA 1TUXA 3CZEA 4UOQA 1BGGA 2BV9A 3OBAA 5A8QA 1MVYA 1V3LA 2OSYA 4JFSA 5ABHA 3A21A 4F8XA 3PTKA 5D9NA 1F4AA 1C93A 2YFNA 3GTNA 1XH0A 2XM1A 1HJQA 1ODZA 3SEPA 1EHAA 2D20A 4FNSA 3OGSA 4D1JA 4PMYA 2VL4A 4AZGA 3FHAA 3A4WA 1ISWA 3BGAA 3TP4A 3VUPA 4AMWA 1UWIA 3WMBA 2OSWA 4OBSA 2GK1B 3WQWA 5A6MA 1WAWA 1LL7A 3TTOA 1UQYA 1ECEA 2WBGA 1W32A 1VBRA 1UKOA 1JDAA 2A3AA 3WNOA 1JAKA 1B2YA 1A47A 5AYBA 4DWSC 1GOOA 1R33A 4WF7A 1W9VA 2CYGA 1WZAA 1UKQA 1N82A 2DEPA 3DYOA 4QDMA 5IXEA 2ZUMA 1GJUA 2GUYA 4R5EA 2ZOXA 3GXTA 1XH2A 5IFPA 2ZX9A 2DT1A 2XFFA 1M7XA 2DSZA 2EPLX 4PBGA 4W86A 2XGIA 1R8LA 3GXPA 4MPKA 3GH7A 3HG5A 2YL5A 1EDTA 1QNQA 4FK9A 3ZJ8A 3M07A 3M46A 3D50A 3WH9A 2QPUA 4HPHA 4V27A 4N0RA 3APGA 1MQQA 5BXTA 1VJSA 3DDFA 1HN1A 3DHPA 3ARQA 4MJ2A 4LYPA 4AZCB 3WEOA 3THDA 5I3DA 1MQRA 4J7RA 2F7RA 3N18A 2HVMA 2X05A 4J3SA 4H8HA 1UKSA 2X8RA 1CIUA 1V0LA 4OGZA 1UKTA 3DYMA 2AMGA 1HKMA 3WNMA 1NWRA 1HL9A 2C0HA 1CDGA 2CKRA 3T2QA 3BLKA 3D4ZA 3CUGA 3L4YA 5FOOA 4P7OA 4ATLA 3THCA 1BFNA 4OKDA 3CZSA 3VIJA 1WKYA 2WYSA 4F9JA 2QLYA 4D6EA 2F8QA 2YBTA 1BVZA 4HA3A 1DTUA 5GNZA 3VIIA 4LPCA 1H1NA 3CUFA 3U57A 1UA7A 1CLXA 5E6YA 3I3BA 1B31A 3W81A 3W6LA 3DX1A 4GQQA 1IV8A 1UKPA 3K8LA 3GM8A 4CD5A 3WNNA 4HOWA 4NZFA 2WMKA 1W91A 3SCRA 3QHNA 2FH6A 3ZSSA 1VBUA 3O9NA 1JAEA 3IK2A 2ZIDA 3A22A 3U7VA 3KLKA 4AMCA 2CESA 1EH9A 4H7VA 4AZHA 4NZJA 4V2XA 3ZIZA 1KGXA 4OOUA 1US3A 3T2PA 1E1EA 3BXWA 2F18A 2CEQA 4LQ1A 4QP0A 2WZEA 1W9PA 4J3WA 1PAMA 1VEPA 2VURA 1XSKA 1VFOA 2FHBA 4D6DA 3VGEA 4PMXA 4NXKA 1E55A 1R86A 2E40A 2VNCA 3HG2A 1QHZA 1ISVA 1W3KA 1EOKA 2YA2A 5LA2A 3WELA 2J7HA 3K46A 4FLSA 1K9FA 3B9DA 3SUTA 4U5KA 4WJXA 4W88A 1R46A 3BSGA 4H2CA 3BCFA 4W85A 2YOCA 1QBAA 2VCBA 2VVNA 1QWNA 3CMJA 2FHFA 3AMKA 3QOKA 3AMLA 2WC3A 1H0IA 2WBKA 3CZLA 1XCWA 1HXJA 1UUQA 5CLWA 2CBVA 1QI4A 1EDGA 4AXNA 4J28A 1CLVA 4UZSA 1E0XA 1JXJA 4U3AA 7A3HA 3BAYA 2CITA 1E72M 3WH7A 1FP8A 3WY4A 3AMGA 2WMGA 2DGAA 3GXNA 4M29A 4TTGA 1UZ1A 2IUZA 3CHCA 1TG7A 1J01A 4AZIA 2X09A 4UQCA 1LG2A 2PBOA 4PSPA 4JKKA 1O7DC 2VZUA 4QCEA 3RJXA 3FXYA 2VI0A 1UD6A 3W25A 3WMSA 2DQXA 2G3MA 3EJUA 2OYKA 2AOSA 3CO4A 2NSXA 4PSRA 1IT0A 1EO5A 2YL9A 3L4WA 2DSKA 2F1AA 4W84A 4PEEA 2WXDM 1B3VA 4N42A 2VRKA 3VD5A 4JKLA 1FH7A 1AVAA 2EAEA 3VD3A 3EYPA 1XYZA 2X0HA 4AEFA 1ZJAA 4U3CA 2GDUA 3QHOA 2VTFA 1EIBA 1V3MA 2Y4SA 2W5FA 2WMFA 4LGXA 2F7PA 1SMDA 1U33A 4UQDA 3IAQA 4WKHA 1JI1A 3VDHA 2AAAA 2JIEA 1PZ2A 1E6QM 1UWRA 1BGAA 1EDQA 2QHAA 1MW3A 2ZX5A 4UQ9A 3KL0A 1OM0A 4TX6A 5ABGA 5KZ6A 2E3ZA 3WDRA 4MB1A 3IJ7A 1CGYA 1J0JA 4PTXA 1NOFA 4W8LA 2VVSA 4QCFA 1EXPA 1PX8A 1SFSA 3VDCA 5A6BA 3PZQA 3RIKA 3CIVA 3WUGA 3AZRA 1E56A 3PZVA 1MQPA 1OB0A 1ZJBA 3W0KA 3SCTA 5CPSA 1KQZA 2WSKA 2O9OA 4PUEA 3G6MA 1OWQA 4CVUA 1KXVA 3WD2A 2X1IA 3ZT7A 3MV11 4AZ6A 3ALFA 1OINA 3J7HA 1CPUA 3VSUA 3BC9A 4NX0A 3WUFA 4GKLA 1TQVA 3ZJ6A 1J9YA 2XN1A 3VMPA 3VD9A 4ACYA 3PZUA 1WCGA 4JCMA 2VZOA 1HIZA 4X0VA 2DH2A 4AWEA 3DECA 2WW5A 1KWGA 4GINA 1KGWA 3B9AA 1TVPA 2OYLA 2TAAA 2WHMA 3VTRA 1MW2A 4AC1X 1JDCA 1HXKA 1JF5A 3W38A 3GXDA 2FDMA 4IM4A 1U30A 1UD3A 2YDRA 1CXEA 2IXVA 4PTWA 4DWSA 3LXBA 1CNVA 2WHLA 3AICA 3BAXA 3ZSTA 3VNZA 5GPRA 2ZUVA 5BYWA 4FNUA 1I1WA 1W3JA 4LYQA 3QHMA 4P8VA 1NOUA 4JAWA 3W26A 1J18A 1V02E 3N1AA 4MAVA 4NRRA 2E4TA 4JFVA 3VGHA 3OLDA 1E0VA 1GHRA 2Y8VA 2YLLA 2WVTA 3IJ9A 4EK7A 2BVDA 2ZWYA 1OSEA 1JFXA 5JBEA 3WMCA 1NM9A 1UOKA 5KEZA 1ZBWA 2VX7A 1E6RA 2WVVB 3OIHA 3WDPP 3O6AA 1E1FA 2X2IA 5D9MA 1C90A 4AY1A 4AIEA 5IHSA 1HJUA 5ABFA 2Q8XA 1OD8A 3ARYA 2WB5A 4D6JA 2IXUA 4BF7A 4HMEA 3AZSA 4M80A 1WNOA 1QHOA 1CGUA 3BCDA 2BS9A 3W6MA 2E8YA 1OIMA 1FFRA 3WH6A 8CGTA 5HPCA 1XC6A 5LA0A 3ZT6A 4GZIA 2FH8A 2DH3A 4P7RA 3ZQ9A 3CUIA 1QI5A 5A8PA 1OT2A 5EMYA 1FOBA 5CPTA 4CN6A 2VX4A 1GPFA 1HJVA 2G8ZA 5I79A 4JFUA 4MNKA 1V3IA 1GONA 5D4YA 4HOZA 3WY1A 2W62A 1TQWA 1WE5A 3PZTA 9CGTA 1HWWA 3VSTA 2XHYA 3AROA 2GJXB 2FYVA 2D0FA 1O6IA 2JEPA 5CXPA 4M1RA 2DT0A 3ARPA 3BUIA 3B8SA 5CPQA 1XCXA 1CZ1A 1UWUA 2OW6A 4TVCA 2O92A 3UERA 3H54A 1P6WA 1FHLA 1H4PA 2JF6A 5I78A 3SCOA 1CGXA 2D24A 1V0NA 3T0BA 3W24A 1HVQA 4TOQA 1CTNA 5CQ1A 4DWSD 1ESWA 5ABFB 1EA9C 4ZENA 1QI3A 4WIWA 1J11A 1UYQA 1TQSA 1J0IA 3AHVA 4PMRA 5FL0A 4DUXA 2BNJA 2QV4A 3WNPA 4UFIA 1HX0A 4B16A 2ZXDA 4S3KA 3CH9A 1W1TA 3MUZ1 3N12A 4ZE4A 2EJ1A 3WKZA 2XVPA 4UFHA 1GOKA 3EDJA 1ZB5A 5EFFA 5A8OA 3NIYA 2Y5EA 4KRTA 1JZ5A 3WUBA 5GNXA 1JGIA 2OLHA 1W1VA 3TOPA 4WLCA 4B15A 4RE3A 4FMVA 1G01A 1XD1A 4CU7A 6CGTA 4J27A 3EDFA 2GJPA 3FNDA 3A47A 1E6XM 1O7AA 1XYFA 1CECA 1D2KA 5CZKA 1WZMA 2XTKA 5HBFA 2GJXA 3HMCA 4IPLA 5A2AA 5A94A 1R87A 1QWUA 3IAPA 1GCYA 3GDBA 1SMAA 2WC4A 4OOZA 1EQCA 4DO4A 1R75A 1A3HA 2VRQA 1HJWA 3VGBA 3LPFA 1GJWA 1KTCA 2XG9A 3KL3A 3RMEA 3BMWA 3MUY1 1LWJA 2EADA 3VMNA 4IISA 3WD1A 3AZTA 1HVXA 4DO5A 3DX4A 3HU7A 4KRUA 5IFTA 1HP5A 1ZBKA 4TTUA 4XX6A 1E3ZA 1KWKA 4DM2A 2VZTA 5I23A 1JZ8A 2A3BA 1X1NA 4URIA 3GXMA 4BS0A 3HJEA 4PMDA 2W92A 3AYSA 1BVNP 4AYSA 1VF8A 1KBBA 1GQIA 5A2BA 1WZKA 2YFOA 3CTTA 2WMIB 3HZ3A 1JZ6A 3WH5A 4UTFA 3DX0A 1SR0A 3VU2A 3VSVA 1JZ3A 3N17A 2QPSA 3ZR6A 4H41A 5DFAA 1T0OA 2WMHA 3U5UA 1BAGA 2W91A 1JNDA 1MFUA 4UFJA 1C3FA 2YKKA 2Z1KA 4EAMA 1C7TA 4NI3A 3NSXA 3VD7A 3OA5A 3T2OA 3VPLA 3RM9A 1TA3B 1BYDA 2J7BA 4J3VA 1DWJM 1LWHA 3BVVA 3L4VA 4KWUA 4KH2A 4CVWA 3BUQA 1H49A 2ZX7A 1GOWA 3ARRA 2WHKA 1FH9A 1HKJA 5I5RA 1W2PA 1E3XA 2WANA 1M01A 2QMJA 1C7SA 2JF7A 4NXSA 4P8UA 5M03A 3ARXA 2CBUA 2XIIA 4BCEA 4P8XA 4AMXA 4MADA 1W1YA 2V5CA 1V6WA 2DT3A 1XH1A 4FLRA 1MWOA 6TAAA 4Z2GA 1WDRA 3CC1A 3AOFA 3ARVA 3UESA 2WM0A 3CHDA 1V6XA 3RPMA 2V5DA 3UG4A 1V02A 3BAJA 3VM7A 1W3LA 2ESCA 1US2A 3AJ7A 1PX3A 1CBGA 1E4MM 4WKAA 1K9EA 3OLGA 4GI9A 3WDJA 4AW7A 4H04A 5E9AA 5EB8A 1GZJA 4UFMA 4C7DA 4FLQA 2VR5A 1DP0A 1JD7A 1KTBA 1V3KA 1V0KA 3AISA 1QX1A 4Z2JA 1C8YA 4PN2A 3D51A 3OLEA 3A4XA 3K1DA 1UASA 3BVUA 3L4TA 4BA0A 2MANA 1TQTA 2WCSA 3BVTA 4AD4A 3WQ5A 1VAHA 3LRMA 2VJXA 1OGGA 3A23A 5BWFA 1WPCA 2D73A 1AMYA 2OWWA 4AD3A 1AQMA 4RE4A 3SCSA 4UQEA 3AIBA 1J10A 2BY0A 1ZBCA 3CBWA 2E0PA 3NJ3A 3UETA 1KBKA 4D6HA 3RDKA 2X2JA 4M81A 3JUGA 1UR1A 2O9PA 1Q6EA 1WB0A 1E6SM 4UFKA 1GOQA 2WMIA 2DIEA 3AIQA 2WK2A 4GPNA 2EACA 1CXIA 3BVXA 3VGGA 3PHAA 3HG3A 4MNJA 4RE2A 5A6AA 3MV01 3CZJA 3MS8A 1Q6CA 3WQ6A 3VDAA 3TONA 3D52A 1ISXA 3PZNA 3PTMA 4PMVA 4GZJA 3T08A 2XVGA 5A1AA 3UR7A 2XFRA 3UCQA 2J77A 3ARTA 1B3XA 3WF4A 2EPKX 3E1F1 4MDPA 3BVWA 4L4PA 3SCVA 1EHNA 3WQVA 4D72A 2FHCA 1UD2A 3W29A 3WQ8A 3WDHA 2CXGA 5BRPA 1PJ9A 3MI6A 2VUYA 5JUVA 1R85A 3AHYA 3BLBA 3I3EA 4S3JA 5C8BB 1BYCA 2ZWZA 1FA2A 3PZOA 1WZLA 3CZGA 1ZS2A 2VCCA 2WVVA 3VX0A 1VENA 3AIEA 1JXKA 4KMQA 3AQUA 4U2ZA 5M3WA 3UG3A 1DHKA 1V08A 2VZVA 2GJRA 1QNSA 1CGWA 1UH3A 4FNRA 1UWSA 3QR3A 1ISZA
chains in the Genus database with same CATH superfamily
3KS0J 4JG1H 3EZ4A 3DUHA 3FAWA 1IEAB 2F9BT 3NDYE 1EHXA 3HC3H 3U0TA 3WLBB 1G9ML 1U8LA 2PDKA 5SV4A 2XV0A 2IANE 1A6UH 2ZKXA 4V1DD 2CETA 3HS8A 3EG9A 2ZRUA 1PLGH 4K5MA 3VXME 2CZEA 2QQLH 2FQEA 3KLHC 4N5UA 4M43L 2J7DA 1UR4A 4W9JC 1A3WA 4GBUA 2IPKB 1RALA 4QRPE 4HFWB 5T3XL 5IJCC 1BWWA 4O02B 3KVQA 4FQCL 4ZFMA 1AQKL 3CDFA 2OFJA 4HSHA 2PRHA 2V5MA 2Y6ZA 3K8KA 3LS5L 1MXGA 5ID1A 4HALA 5J1AB 2J4GA 2MCMA 2R69L 4ANUA 3HC4H 1H8OA 3NUKA 4NQQA 1AODA 4XTIA 3MBXL 3CFDA 4KX9A 4U1KB 3UBHA 4A4AA 1KIUB 4PRPE 1EUAA 3Q9QA 2CBPA 1R3YA 3C8DA 3VXNA 5IVXA 3SKJL 4Y5XA 5A6JA 4LW7A 4U4BA 2HJFA 2PCXA 4EI5D 3MLXL 4RKAA 4JFFD 3O6ML 4G6KH 3BZ4A 1IT7A 3LPWA 9XIMA 1ZZMA 3EDDA 1BIIB 4QRPB 2H32H 2VC2B 1WO2A 3SOBL 3MZ2A 2FX8H 4BZ1H 1GVFA 1V54B 3KM1A 4AVJA 5F7HA 1G7HB 2BJML 2I85A 2W60B 5I3KA 2O93L 3R4RA 2XN0A 2RGMA 3RVTC 3QQ1A 2VLJA 2XH0A 3B3IA 3M7FB 2FGLA 4OM0L 4QHMB 2PYFA 3S5ZA 2WCAA 1ZE3H 2XIBA 5BUAA 4WKXA 4E3TA 3PHOB 5G2HA 1OZUA 1XIHA 4ZD3L 3CHEA 5CC5A 2A3TA 2X0VA 4B9JA 2AL2B 2RDWA 4XAFA 3A9BA 4DUWA 1VKXA 3NCMA 4N2EA 4IOFC 3ILEA 4YXLL 2PWDA 4PS4H 5BVJA 2O61A 4R26L 2C3VB 4G8AC 1M7PA 1VJIA 3IYLW 3STBA 1G4MA 1RUMH 3O8XB 3IJYA 3OC5A 4JFED 3TVMC 1K7FA 1SGJA 2V7NA 5AC6A 1A1OB 2OX1A 1DUYA 3SD5A 4B3VA 2KS0A 2WOQA 4AWTA 2WTRB 3MKVA 3TJHD 1VRXA 3FN3A 5DR5H 2CKSA 4B5SA 4PJHF 3UNDA 1KCBA 1OAYL 3DJTA 3DURA 3FYEB 3ILQC 3H3BC 5GGRB 3VYNA 1E4JA 4AEEA 3T0XA 2WOYA 3QZWG 4YHPA 5F70A 1MSPA 4JFFA 5ISZE 3E2RA 3A6CL 5C08D 3K7UA 2OCJA 5IB4B 1E67A 2YCJA 5D7LA 5JW5B 1NBZB 4MA8L 3ZTEA 1DBKL 1M3JA 4MPQA 3LN5B 4FQQA 3O6LL 4GIPD 5EC2A 2NY1C 1SSDA 3IJ8A 5AYTA 4JY5H 1F5ZA 2R59A 1OC6A 4QY8A 1HJCA 3U36B 2ZXWB 1KJ3H 5U4NA 4PCNA 3DJSA 3FQ2A 3C8KB 1IZJA 1LDCA 2VJ8A 2YAPA 2QDVA 4NBYB 5CO1A 4ZUVB 4AEIH 2YBVA 3EWXA 4FXSA 4MTVA 2WSRA 1INDH 1HSBA 3CZNA 4WUUD 1ACYH 1T7YA 4PRIA 5SWQA 3IJSA 4NQEA 1DL7L 5L0QB 1UQZA 5BMWA 2F1EA 4LU5L 4ZO9A 4J12A 5EF2A 2CJUL 1S3RA 2P4AB 1GGBL 3GMQB 4R83A 5F7KC 1AO7E 4A55A 4XMZA 2OEJA 1BM3L 2Y85A 4M24A 2NLYA 5C08B 3GI9H 4JICA 2NZ1A 3GO1L 2XG5B 2F7FA 5GQBA 3AXMA 1UZDA 3WH8A 2CGRH 2EBNA 1JGLH 4IIQA 1HW6A 1WXJA 4HWZA 4UQ2B 4KVNH 1L9QA 3IRPX 4YDKH 3RAJH 5D1ZC 2Y0SA 3QXAA 4XD6A 3IEBA 4PBFA 2PDWA 4B0MB 5FW8A 1P0SE 5T26A 2I9LB 1ZHAA 1XHHA 3FHQA 4KGLA 1R3LB 5D7LD 5KYWA 2XWRA 1PZ3A 1GQJA 3BN3B 3CHFA 1HL8A 2X1QA 5BU6A 3N2JA 1TJ0A 1NLBL 3HPFA 1ZJIA 1KIRA 2Y7QB 3FSOA 3RVXC 1QO2A 1N67A 4YYFA 4G5ZL 1MW0A 3N0PB 4K7FB 1UD4A 2PF0A 1U0QA 2BP3A 3ALWA 2FCBA 2P8BA 3G0SA 4B9ZA 1CYGA 3DVGA 1NSNH 2J62A 4LLWB 5C70A 4O1BA 1BVWA 3GLEA 4V1YA 3DZ1A 3E2VA 3QORD 4P49A 3HNVL 5B1CA 4GCAA 1GPOL 2A7RA 4JTIA 3CHXA 3T0ED 5BS0E 1I75A 2XISA 3G08B 1OGTA 1R34A 2XKNA 2OJZL 3SRKA 3TBSB 3AHXA 4BD4A 2G50A 4KO5A 4X7EC 4XHJD 4LXFA 3KHDA 3QDGB 3HR5A 1ZV5A 4FXTA 8PAZA 1U8KB 3QM3A 3H2CA 1TQBC 4HPXA 1BEYL 4FQXB 5GRWA 1HJBC 3SQBB 3AB0C 2W88A 5F89B 5FYJU 1BTMA 3HM7A 1GQNA 1INEL 1VFUA 3GWJA 5FYLD 3D46A 3GKFA 4I5RA 1QP1A 1VLXA 1F90H 1TUFA 2QPEB 4Y8FA 2CCWA 1F3JB 3KWUA 2PZNA 5AOLA 1SJHB 4M1GH 4WKFA 3UTSD 3NQGA 5DVLA 2NNCA 4EZKA 4JHMA 1AC0A 5I1AA 4GG6E 4HDIB 1I9EA 4MQTB 4AX3A 4L9YA 1VCVA 5IM7B 2RCSH 3Q1SL 5GGVL 3AWOA 4Z2LA 4P7LA 3ENLA 4X8CA 3TSDA 1QYGH 3W5NA 4IRJB 4MF4A 1W1TA 1B0IA 3TJXA 4IKLA 1FHDA 4HMCA 5L88L 2D7TL 4M4RA 4Z2IA 4DQWA 1JPEA 1KJ3L 3X3GH 2I9TB 2ENPA 2DQUH 3QFEA 3UGUA 1IAKB 3KE0A 2VR8A 1MZYA 1F6AA 5E9DE 2IMRA 2PWHA 1D5BB 4PUJA 3TV3L 2V68A 4GK8A 4WWPA 2X4PA 3VABA 3TYGL 2B16A 2YR3A 3H4HA 1MOEA 4OQTL 4PJGB 1L6YA 5E2WL 5ESQB 4ENZA 2E27L 2WY3B 2AJYL 1U93B 4GRWF 4LBAA 4Q9BA 5HHME 1EP2A 3EB2A 1WXYA 3UA3A 2G3ZA 3IKCB 1IFHH 1A6WH 4PCSA 3ITYA 3R06B 3G6JA 4ZMQA 1XSJA 4NEHB 3WLPA 4YR6A 2IVFC 3MLYH 3WLMA 5EU5B 3TN0C 5E08H 1NDGA 4AH2B 1GVIA 3AT9A 1J0YA 5I9QC 1A4KB 4PULA 3DPBB 2FGWL 4HJTA 3TIDB 2A38A 4OFYD 5C55A 1U3HA 1RK6A 4RFNC 3WJSA 1OCQA 3EGDB 4GQRA 3RL2B 1SW3A 3UJFA 1H0DA 2CUHA 5BOEA 3KR3L 1NIEA 2NY3B 5AVQB 2PP7A 1S7UA 4WHCA 5IVXE 2BWGA 4IOFD 4MB4A 5AOZA 1CE6B 1I3RA 4OSUL 4ZQNA 4S1QH 5E0QA 3G3LA 4RJEA 4MLSA 4IJCA 4C1KA 1Y1DA 4JRYD 4PRRA 3LQGA 1J8HE 3W9ZA 3QXWA 5D05A 2NX5D 2NYYD 3X3FH 3T4YA 2AQ3A 2G30A 5FM5O 1RBLA 5D38A 5FF3A 3UR2A 4N0YL 4PJAF 4WDXA 3OIXA 2NNRA 3P93A 3T44A 4JN1H 3O6MH 2FT6A 3FUMA 4G6KL 2BHUA 3GVVA 2AXGB 2R29L 3LTYA 3KH4A 4N1CA 1OM3H 3GPSA 2PE4A 2P8LA 4QRPA 2EIZB 2ZNXA 3I7SA 5HHPA 3GSNA 4K2UL 1CDUA 3WNIA 2XXCB 2NUPA 4FFWD 4O58L 4H26B 3TBBA 4ZL1A 2F54E 1ZLPA 5IVXB 2HXUA 4WIQA 3SKNA 3GH5A 3BTNA 3WNKA 5K9XA 5C0AB 1BAFL 3VFTB 3ZVVA 1XCQA 2VXNA 3P0WA 4HQVA 4X6BB 3W1UA 4O5LL 4XRCB 3VM5A 5G4NA 1EQPA 5BQ7A 3JU2A 4DJDC 1MFMA 3QP3A 4KKCD 1S3KL 4PR5A 5SWSE 5GJMA 3DSFH 1MFAL 5F7FA 4RDVA 4I1RA 1GTFA 1WBHA 4UILL 3VIMA 4MVBC 1NUDA 1YY9D 3QZLA 4X9IA 1ANUA 4HFUH 1L9PA 1ODUA 4JPVL 3PQYD 4XNYL 2OO0A 4CCDA 4WW1A 5JHDD 2F38A 5IREA 5DS8B 1YMHA 1JBJA 4HQQL 2EPMX 1XFBA 2ATPB 1YNQA 4GP8B 3F7KA 4LEEA 3S5LG 3UIZA 5ES4B 2CHNA 4GAAA 3EFFA 2XZQL 5LLIC 2FB3A 3UYRL 2HPTA 1LE5B 1GMIA 2B9BA 1UBSA 2GVJA 2R0LL 2XYLA 2IGLA 3BAKA 4J3UA 5CUSL 3UYPB 1RIHL 1SVZA 1JYWA 1R5WA 3GMLA 5C6MA 3QWOA 1IUZA 4MGXA 5H37A 4RNIA 3S46A 4F66A 1UM4H 4TUOA 3ZW3A 4JW3A 3H4WA 3H9SA 1T8QA 3WFBL 2LABA 3OLIA 1S9WA 1IGCH 3LSBA 1HE8A 2CZ5A 4GLEA 5I6SA 3B9NA 2G9HB 4IP5A 4GACA 2H9GA 2OJZH 3GZAA 3T1GA 3DX9A 5I82A 3T42A 1ZHLA 4JS7A 3CPRA 3PG9A 3A64A 3LIZA 1GG0A 4AGQA 4P5TA 3RQ3A 1KTLA 2VDRB 3CV5A 3CO8A 3F2CA 1KYUA 1JYNA 4MFEA 3UXLA 3UWVA 4HX1A 2L0DA 1JCLA 2Y7EA 3HNSH 2VDRL 1PIFA 4XO8A 1TZZA 3II3A 2BLEA 3WG6A 3B2PA 4CGTA 3M86A 3ARWA 3F7QA 4WI3A 2H8PA 2C71A 3I6GA 4ZO7A 2Y7DA 2P5WB 1JJUA 5E09A 2QZRA 1EWEA 2SEBA 2V2TA 4GZEA 1ZEAL 2P46B 4J4PD 1QEWA 1K8XA 4ZZ9A 3B9KA 3NQIA 1M53A 2Y7QA 5EU4A 4XCCL 3OGCB 4PI2A 3FT2A 3QMSA 1TVBB 4OCWH 1HQRB 3DDGA 1DPMA 1DVYA 4GW1A 2G3IA 4W7UA 1P0DA 3VH8G 2I9LA 2E5CA 2ACSA 3UDWC 4APXB 4A22A 1GCFA 3BUBA 2XXFA 3DIFA 3FO9B 4XC3H 5IF0A 4KQ0A 3DI1A 4MMZC 3SCWA 3B8TA 2QCMA 3MJWA 4ERSH 1BREA 4JIHA 4U49A 4P5TD 1I8UA 1U3HD 3RPDA 3MODL 4WCYL 2WLLB 4G6JL 5E0CA 3QIUD 2WXLA 1POKA 4L1WA 4N26A 2FZ3B 1B0RA 4WFHD 3L3OC 4Z7VF 5I6OA 1VCBC 1TIWA 4YIWA 4JTHA 5F72S 5FUOL 4W4NA 4OIFA 4PVLA 2E6QA 2PN5A 3ZJAA 5K1VA 1KQYA 4M8QA 4K2UH 1KMGA 3FN9A 4N90D 4TNWK 1Z9OA 4ZXOA 1LLWA 3B2DC 1TR9A 3WFLA 4P5UA 5E93A 3ENEA 3UABA 4OLXH 5JIIA 4Z9KB 2HNEA 3DGRA 1SJHA 4NKCA 2FR4B 1MFCL 3UC2A 3UTTB 4FXGA 4MD4B 4UINL 1FDYA 4A39A 1QBMH 3EYVB 3LK6A 3HTLX 1ZL1A 4X6CF 3DDMA 4NQXA 4OGYL 1RULH 1X9QA 3F04A 4LOVA 3F2LA 1JYVA 4Q9QL 4IXXA 3ARDB 4O02H 1V55B 3STLB 3W7EA 4YSDA 3SCMD 4N2IA 3SE3C 4WEEA 4FN0A 4LPTA 4G3YL 4LVDA 3KDNA 2ZUWA 1J1XL 3RTQB 3EZ8A 3T77A 4WV1C 3T77B 2NW2A 1OCWH 4DK5A 3KPLB 5B4MC 5IFHH 3N15A 4JTDA 1E15A 2V9UA 3HA0A 4Y7OC 5MP6L 2YS4A 5M95B 3CX2A 5TH2B 5C7VA 1U8IA 2QKIB 2H0JA 2K1MA 2FT7A 3KXFA 3L13A 1NTDA 4WKZA 3EDEA 5E2TH 5MEOB 2IGTA 1YTDA 1B9KA 4BZYA 3U9IA 3KYKL 4PMQA 9XIAA 4PJXA 1A6WL 3ELQA 2VEPA 3IV3A 1EGZA 5GRJL 3E2QA 3M0JA 3SKUD 1GYLA 2FTYA 1MJ8H 4ODHH 1NCJA 3NN8B 2JTYA 4TLTA 1CFVL 2HH0L 15C8H 1MO0A 3H2PA 3QHTC 1Z9MA 1LHZA 4NP9A 1FFNB 1I7ZB 1WHOA 2H1LM 2VXQL 3ZOAA 3IDYC 1F6PA 43CAA 3RP1A 3S47A 3DLQR 1GEHA 5D96C 4A35A 1JFHA 4L2LA 1FO0H 1H8SA 1N2RB 3MHGA 2V7HA 3L5WA 5JA9A 5FF7A 3HHMA 2A6IB 3JV6A 5EPMB 1MWAA 4LCWA 3BSMA 5I76A 2HJKA 1ZT1B 2ZWLT 4CVXA 4N5EC 1A7NH 3VXSD 4E0RA 5CSYA 4PJGE 3U1SL 5JU6A 1ECYA 3GMMB 2HX9A 4GLRI 4IQEA 2DRUA 3UNTA 4NRYB 3MNWB 3Q6GL 3EYOB 5DQDH 5KVFL 4D94A 2NOYA 1HEJC 2WLNA 4NJKA 3B2UD 1KXTB 3VFPA 2WMPB 5DHYA 1BMZA 4PRIB 5ID0B 1QOXA 3E5PA 2B1OA 3NL2A 3ARGB 1R30A 2NNAA 3SE6A 1W31A 3WQFA 3D06A 3T3MF 2QCGA 2BLFA 5E94A 1U8HB 3V5KB 2X12A 3ZRCC 1NMCC 4YSSA 3MOBL 1G5AA 4JZJA 4OIBA 5E4IA 3HHSB 4PRPD 4Q6IC 3K4AA 3PHSA 1QFWM 3T8XA 4F7CA 1E9LA 2VGGA 1PKNA 3HRZA 1ND0B 2Q7YA 2KUTA 3AGWA 3VAEA 2B7OA 1X5FA 4DUVA 1BQLH 4BFOA 4B5NA 3ARED 4H2AA 4UQ3B 4BF5A 2FL5B 1NBZA 4XZ4A 3LHTA 2H90A 3ZKSD 4HWUA 2E28A 1LO4L 3MR9B 1HDMA 3R79A 1GKPA 1AZRA 2J56A 2BVYA 4IJTA 2J5LB 3THMH 3U3HA 1COBA 3PWPD 1HHHB 4GOSA 4QYOB 4QHNA 1XG4A 2W0FA 2WVUA 2WGNB 5F97E 2ADIA 4I5BB 2O5ZL 4F3FB 3ZPDA 4ZX5A 5D4JA 4DW2H 2PRLA 2W9EL 1VGKB 3FFCB 1XX1A 2OPJA 2IPGA 1HH6A 2K7PA 4UDTB 5DELA 2VLMD 3OC8A 3L4ZA 4PU2A 2WLYA 5I75B 3Q94A 3GAYA 2WAGA 2O1AA 1GOFA 1J87A 3ARSA 4XBMA 4QEHA 2ZT9C 3NZSA 5GZNC 5KZMA 3OL2A 5AW0B 4LDLB 2VAAB 1RSCA 2AK4E 1SFLA 2GWGA 3UXDA 2J55A 3QIUA 4G9FB 3VG9B 5I6KA 3TPUA 5E8DL 4N9GA 5BZDB 1M03A 4GGHA 4HNOA 1WG3A 5EZLB 1LQSR 5CCGE 4LY4A 1ETJA 4HU4A 4V28A 5SX5K 2AJ3A 1XH3B 3DUUA 1IGIH 2XN2A 4FEIA 1OP3H 4PY7A 3W53A 4Z7UA 4DK6A 5MEPA 4Y0GA 1C9DA 2CLMA 2F8IA 3DFNA 2Y2WA 1U1JA 3F6LA 2WLJA 4DEUA 3ME0A 2B08A 1F56A 3ME0B 3PWLA 4H20L 5BJTA 3CFDB 4QWWC 5EU6A 1ZXQA 3JZ7A 5BXSA 4W8AA 2F6XA 5E7BA 2UY7A 3ES8A 5G4EA 2F9RA 3FU7A 3FV9A 2HMIC 4N1EA 2QJIA 3N11A 4GO8A 4QOKE 4YIQA 3B8WA 5D7IF 3ZZSA 2JALA 4XKYA 3SI9A 3F7JA 1ZK5A 1TTUA 2P76A 4F2FA 4NRZB 4NN7C 4CU6A 4HK0A 5JXAL 4P7QA 5DJAA 1ZVSB 4JHOA 1IMHC 2ZZUT 4BCYA 2FJSA 1UWEL 3FY1A 1V7ML 4QTGA 4O8RA 5DUPL 1FCVA 3QJRB 3W28A 3GZQA 4MS8C 4O51B 3TWYA 3TFKD 1CDBA 1WYJA 4H8QA 3CYVA 2X42A 3WO4B 4GXVL 1OAYH 4G2DA 2Z93A 1OGBA 4FQJH 1NOAA 5AWNH 3S8FB 3BWUF 3MOAH 4IMLA 3HMWL 1HQ4A 1BEXA 1I1AD 4GBXA 3LZLA 4A21A 2F19H 1J9CT 4JHBA 3QC3A 3RFRA 1RUML 4ZMTA 4QD2E 1FPTL 3HFML 1ADQL 3QKEA 2GEQA 3EO0A 1RCQA 3TFBA 2QT6A 1QKZL 1B0GA 2G4EA 1JUKA 3V5HA 4JX4A 3TTSA 1OGSA 4G7SB 2JKTM 1CYWA 1MNUH 3DVNA 1US0A 3GIQA 3QYSA 4J8QA 2IGFL 1DVFC 5LJYH 3TBWA 1KEMH 4XVJH 1OP5H 5D1QB 4EOWL 3UOAB 2WKGA 4QHKI 1H50A 2PO6C 3DHMA 4TQPA 5J13C 4E9YA 3D9AL 1A9EB 3O4LD 3BDXA 4KRPD 4ZUUA 3RG1C 3LY6A 1IEVA 4FIQA 5AHMA 2CCRA 3THUA 5CN2A 3TZFA 4X6DA 2HZGA 2PPAA 1RQBA 3TT3H 3WLQA 3CSGA 1ONEA 4AL8C 4X4YB 1QI2A 2PUZA 3FOKA 5GSVB 4PJAE 2BOFX 3O2LA 4G1EB 4HA1A 1CFVH 1KLGA 2FSEB 2HH0H 4Z3HA 2VWTA 3EWZA 4L3EA 1UGKA 5D2NC 4J1OA 4U7SA 1TOXA 2ZZ6A 3BVJA 4BGDA 5IDIA 5C0IA 3MY9A 3BUPA 5CINH 1G9EA 1P5UC 1T66C 2B0SH 2XBTA 2JCCB 3ES6B 4LPYA 5H4YA 1DBMH 2ZCHH 5F7UA 1P7HL 2AQOA 2E7BA 1K70A 3DMMD 1I60A 5D2VA 1F1DA 5LGKA 2A9MH 2F2HA 4NPYA 5D7IE 1LL1A 4ACZB 4HC1H 4OCSL 1DQJB 3FQRB 3ZIMA 2QBWA 2IPTH 5FB8B 1IJ9A 2Y7LA 4QTHB 4LDCA 3UZQB 3FIGA 1Y8BA 1ELSA 4GVHA 3IGFA 5K1NA 1V6TA 4UM9D 2HFEA 2W67A 2ZRWA 1OT1A 3KR3H 4GHRA 3LVTA 4LARH 4CC4A 1QNIA 3RZCA 1U5JA 2PDQA 3T8QA 4A3HA 5CZXD 4I9JA 3KS6A 4OLWL 4NZCA 3UPMA 1DE4B 1U6AL 1PDZA 3DEQA 5E5MA 1KY7A 4AHQA 3S3SA 2CRZA 2P47B 3V5DA 1I45A 4HS8L 4OZIA 3V6OA 4MA1B 3GK8H 3D07A 1YBQB 1VPOL 3F58H 3B1UA 2WZAA 3MOBH 1R3HA 2P42B 2NZLA 4E41B 1EJOL 1RH9A 3TQ0A 4OJYA 5E4AA 3GR7A 1MUCA 3VVGA 2VQ4A 3P54A 4QHUA 1IAOB 1F2JA 4HK3J 2A0NA 3CPGA 4R4NC 3GHTA 4KY1L 1SJMA 3VZYA 2WCPA 1U3JA 1VERA 3LEVL 2ZRXA 4RCAA 2WNGA 4Z2KA 1NCAL 3P3RA 1GGIH 2OZ4L 2WKJA 3VOFA 3CLWA 1VEOA 2ARJA 3HB9A 3B2XA 2AL1A 4GXPA 3PGDB 4L8DA 1ACZA 2OEMA 3MQTA 5IK3B 3UWYA 4ABVA 2CIIB 3QC5X 2X4NA 3MRQA 1AS8A 4ONHB 1V5XA 4CD6A 2YL6A 4IMKA 4R8WH 2ISWA 4OFVA 4JXCA 4ZX6A 4LDOB 5A95A 2YDSA 2ZC8A 3TA9A 3KGTA 1UP3A 4FXRA 5AY7A 3GLZA 4MJID 5J6HB 2DZTA 4UNTA 1BF8A 4RZBA 4X8JA 2J74A 3G08A 3DTXA 3UO1H 4UT7H 1LL4A 1YXDA 3PBGA 1FNSH 2P1YA 3MGTB 3QPYA 4K9EL 2VP8A 4PJIB 2ZSWB 2ZSWA 2LAAA 3ABGA 1A4MA 4KTDL 1XF5B 3CL6A 1URLA 4I4WB 1BYAA 3S35X 2V7NB 3LI1A 5DJDA 3NEOA 4R4BB 3M7SA 4L56A 5GZOC 4UT6A 4HDIA 4EUPA 4KX7A 5EH1A 3FBQA 2PXYA 2XWCA 1IGIL 4AWUA 2ZKYA 4L3AA 5GSRA 1DJZA 3U46A 4XP6L 3H4XA 2WZ5A 2XXGA 3PJSA 2B4CL 1K85A 2E77A 1G1CA 3IPEA 1CLOL 1H6EA 1A7PL 4X9YA 5CLZA 1VYPX 3L9CA 2P44B 3TA3B 3NIGF 4L1LA 4WK0B 4U3SB 3HNTH 4N86A 5DJ2A 1WDDA 3G1SA 3QZEA 5GGTH 1W9DM 4WWKC 1VFTA 4LOEA 2J57A 5ILTL 1K3IA 3W83A 2DQCH 1Y65A 3IACA 4UDUB 4GUGA 3ICJA 5DEZA 3WIFA 3OYZA 3VIKA 1MXDA 3QUZD 4XPGL 3HC0A 1OX4B 3K0WA 2Q8AL 4EN2A 1GY2A 1T0NA 2PETA 1PWMA 4ZO6A 1MAMH 5I5IA 1L6ZA 4K7VA 3TH4T 3W5MA 4QGYA 2C3HA 1A1MA 3ABLB 2VSKB 3TFKC 5JHDA 3F4VA 2VO8A 5HPMB 3IAGC 4FG6D 2J7FA 2EDFA 4P2RE 2YXGA 1ADOA 1L5GA 7FABL 5LA1A 4Y9MA 2QZ5A 4I13B 4RNRA 5EFIB 2WNZA 4TNEA 4DJFD 3SQSA 3MMDA 5CLYA 3G1FA 2FWSA 3M0MA 3ZE1E 1GZQB 2V2WA 5MENA 4Q8MA 2AK1L 4MLIA 1VS1A 1UD5A 3AU1A 4F80A 1EXUB 5HHVH 3RJDA 3HG1E 4N2NA 4AC2A 5C0EB 1U22A 1G0YR 3WD3A 4M9OA 4JTGA 1EGJH 1P6AB 5D6CA 2I25N 2HT4D 2HK0A 4Q3MA 4F0RA 3WJZA 1AXIB 2QQQA 1ZY9A 5JMUA 2DOCA 1LILA 2XVLA 4TXEA 4L9DA 1NWTA 3K8MA 1Q63A 1NMCB 1DJHA 4GI8A 4HSCX 4DN3H 5C7XH 8TIMA 3BRFA 1D6VL 3IB4A 2XN9E 3PP4H 3QUZA 3WFEL 3EX4A 3QIWD 3WLBA 2D9CA 1FO0B 3UTSB 5MHSE 1OD9A 5ISZA 4BWTA 3HGJA 2AKMA 4I0PC 4NUPA 4PY7B 3KW7A 5AVZB 4FQHB 3NA8A 1R3KB 4W87A 3F6IA 3ZT5A 1YHTA 4QSFA 3OX8A 3ATAA 1S3KH 3ECWA 3FDWA 4FFZA 5CCJA 1IIGA 3HPLB 5F1IB 4GVIA 3NZUA 1R17A 2XH2A 3CL8A 3QWRD 1Q9LA 5EMKA 1PLCA 2N3JA 3MGAA 3WUWG 1QDSA 2FB2A 4G1KA 4S1RH 5K9QI 5IW1B 4KY2A 3MO1A 3MMEA 3JS3A 5E5RB 1DWFM 3NCEB 4YHIA 3ABOA 2K6ZA 2WN3A 2WSDA 4XT1C 5CFAA 4MUZA 5C5YA 1U42A 1ZPTA 3IVKA 4XNAA 1FV1B 3D3AA 4LF3A 4CD7A 5BQ7B 1Q0EA 3AABA 1EXBA 1G7HA 3L9YA 2X1WL 3B6SA 2D0GA 5D7JB 4C83B 1HO1A 3P82A 2V5RA 4M0XA 1ISYA 2E9MA 4N2OA 1L9OA 1TF4A 3C5JB 4NQUA 2CHXA 5HDBB 4FABH 4UV4L 3NGFA 4OGYH 1QMUA 3R19A 3MRMB 1PDKA 2EQDA 1M3IA 1NDMA 3QTPA 1IT9L 2IPJA 4AEHL 4G6AD 4MYXA 1KBVA 3W7MA 2W9LA 3MPCA 4EPKA 2YJQA 1FWWA 4QLKA 5CSRA 3D39D 5EOQH 3BT0A 1FDLH 1G9NH 2C1IA 4D71A 5AN7A 5BVJB 4AQOA 1OP4A 2VFEA 2Z7WA 3W4RA 5FDYA 4YO0A 1N55A 1U95B 2DIKA 1FH8A 1TPEA 2ICWJ 3OQ3B 4MB5A 1WT5C 5IMLA 2PTDA 3VVWA 2QGBA 3ALPA 4OVXA 5L2KB 4E5XG 2GQAA 5LG6A 1F4HA 3FX4A 3PBVA 4L5FH 4N0CC 3MSGA 4DWSB 2JKAA 3AXLA 1IQWH 4FERA 3UX9B 4DPCX 4R5VA 5LDUA 5DHVB 3MANA 1RY7B 4D8LA 3MJ9A 1ZUAX 4BQ4A 4Y2NA 4L1XA 5KUMA 4LBUA 3BKJL 5ICZA 3S6TA 1JCMP 2EYTA 4G7YL 4OBRA 4YSPA 5IB5B 5D33A 1RLCL 2CGYA 4M4PA 3QZNA 4Y4KB 5KJ4A 3V4VB 3B0PA 3QF0A 1H3VA 1T5XB 5CGYD 1OG0A 1BPLB 3GFZA 4JCLA 3QFJB 3X1BA 4ZUWA 3IIPA 4DRSA 1MRAA 1HCVA 4UQ3A 2X4TB 3U2SB 3RZCB 2EPHA 1RZ7L 3D39A 3I2CL 4EMZA 3QMRA 4GW5B 2CH8A 3DOHA 1UZGA 4G9FE 4KKAC 3B8IA 5I0DA 1MAKA 2ADFL 3K6SA 1KENH 4YDJB 1E71M 4J4KA 2WWCA 2OULB 2DQEH 1TSHA 2YUWA 5C2BL 1Q9KB 4J3OD 3E6HA 1HIMH 5HY9B 4DZ5A 1NCGA 2APXA 4BUHA 2J8TA 3KBNA 3CVCA 3U0WH 4PB0L 1BA9A 4S3DA 1L0QA 1O5RA 3Q8FA 2CBMA 2VGBA 2PCFB 1TIUA 1KY6A 2I24N 3TXVA 3T8MA 3O06A 5AAMC 1HINH 4ZMGA 1QZ1A 1MPAH 4DXVA 2UX7A 2JWYA 2VMDA 4R27A 4DJFA 1VFMA 2ZOKA 4TV6A 2W0FB 4HC1A 4LSRL 2JE8A 1G84A 4PR4A 2IQ9H 4WHYG 4GRWE 4YWSA 4AW4A 3WKMH 3IXAB 2CLRA 3IUIA 5CD3B 1E9ZB 3DKLA 4B5WA 2FL5A 4ZMPA 1OF2A 4KTEL 2J7GA 4X3ZA 5KYYA 4FKEA 5DMYA 5HYQB 2CZFA 4J3TA 4KETA 1MAML 1X7SA 3QQ3B 2EXYC 3EYFB 2GKIA 1WDPA 3Q5YA 2BP0B 1TKKA 1X3DA 1TQUA 1QW8A 3ULAB 3IIXA 2WSPA 1B4LA 3GPEA 3WBWA 4XB3A 1RIUL 3TEYA 4AIZB 2B3IA 4QRQA 4GIOA 4N8UA 3RKDD 4AEHH 4HUCA 3Q2DA 4Z76A 5AZEL 3VTAA 1D9KB 4AL8H 3FTGB 4R3UA 1GMEA 2OWCA 4OY9A 4P5TC 3X17A 4C7GA 1M4KA 4ZT1A 2A7BA 4L9LB 4JE4B 3GU9A 1P84K 1PVHA 2W81C 1L0PA 3N04A 4M02A 1A3RL 4HKJB 4L29A 4CCZA 1OTTC 4O2FA 3CFKB 3E8UH 1MEXH 2ZWKA 1YNPA 2VLLA 3PWNA 4IRSB 4JKPL 4GPVA 4K8RC 5GS1C 3LD8B 3SN4A 3CAFA 2JKIS 4TNVF 3NJFA 4ZNCD 2B4GA 2CHOA 5JQIB 3UXFA 5KW9L 1UZ4A 1Y5XA 4RSYA 3QULA 3BOXA 2Z7ZA 1AD0B 4NRZA 3MI3A 5IHWA 4YDIL 2PPGA 2JGYA 3CH8A 3RFAA 2FO8A 1ITCA 1S9WB 4WW2A 3WJLA 4BUQA 2RDXA 1G4PA 2F08A 5EO9B 2HS6A 2EIKB 4DAIA 4X9HA 3JZEA 2CBTA 3IIVA 1A65A 1TMQA 4QM1A 1NWPA 3EHBC 3GFUA 2DQMA 3VXQB 3I9GL 1OIFA 5DK0B 1P53A 2PXYC 5M94B 1UXMA 1B90A 1YG9A 3PL6A 3U6XA 2Z2AA 3GVGA 4NJJA 4UTKA 2P5EE 3LDBB 5DD0L 3R8HA 3GSXB 5ECUA 2B59A 3DI3B 1W9BM 2CU0A 3UR5A 5T1MB 2VMFA 1UEMA 5BRBA 1LXMA 2J25A 4PJEE 2ZVIA 5FJJA 4X6DB 1M5WA 3C60C 1KM0A 4H1ZA 3UD6A 1TPXB 4TUFA 1PZ0A 2B1AH 5GGRY 2V3DA 4JQ4A 2DD8H 4JAMA 3D5HA 2ZF9A 1NKRA 1S5IH 1OSPH 2DZPA 4QO1B 5IBXA 4A8IA 1FFQA 4IMCA 1P4BH 3WQPA 3MV9B 4XZUB 2HA1A 4FCAA 1TU2B 4FQLH 4Y4FA 1G7UA 4OBTA 4LESA 3MA8A 5D9SA 3VWKC 3TWCH 3X14A 1H5BA 4BH7A 3KPPA 1XLAA 2VELA 4LCUA 5FJRA 1TTFA 1HT6A 3FEMA 2EDLA 2NY6C 3IN2A 4U1LB 5DD6B 5FYKD 4DM1A 2AEOA 2J21A 3TCTA 3MMWA 3DXAD 1HQTA 3HMXH 2YXMA 2PYEE 3HOGA 4CMMB 4F8PA 2WLLA 3GRBA 4L9ZA 1LLOA 3VUAA 5C0CB 2FIKB 2GC4C 4AQZA 5T1KB 4ELMA 1HZKA 3GTHA 4NAFA 3K5RA 4YHYB 1O12A 2OEKA 1W16A 3OBAA 2BV9A 5JZ7D 3GQFA 3PYCA 1NCDH 1MVYA 1V3LA 4PJEB 3V5DB 2OSYA 3MWAA 3RTLA 3TAOA 2DJUA 3CMOH 2KQNA 3S83A 2ITDA 5LXGH 3N4AA 3PWVB 1Z3RA 1JGEB 2WMPA 2R23A 4PB0H 2BXVA 1OZMA 4HJ0D 1ZU8A 4X2UA 5KANI 4H83A 3VI2A 3W71A 4DF2A 1JCKA 1P4LA 3UYIA 2H26A 4DHLA 4ZMXA 5C0AA 3ISYA 5L88H 4D0CA 1C93A 2YFNA 3FDGA 3CFMA 3BVDB 3GTNA 3RPBA 3D1MC 4X5XA 3NQVA 3KCPB 4PWHA 2ROYA 1BFSA 2VXTH 4JX0A 5F7WC 1LK3H 3X12B 1Y07A 1G6RH 1EHAA 2IBZX 4ZOBA 3FGCB 2OLAA 3FGCA 1I85C 4HIXH 3C5JA 2XFXA 5HJBA 1HXMA 4ZFFB 5JIKA 1S7VA 4J3BA 4NUJB 4BINA 4Q4IA 4M62L 3C2VA 4DYJA 1ONWA 2ZJSH 2Q8BH 1X5HA 2B7QA 3W7GA 1OL0A 3LH8A 3OZLA 4GQPH 4PMYA 3FHAA 4LGRB 5AAWA 3A4WA 4AZGA 4QOKA 3BP5B 5I1IL 3KXFD 3LGEA 3UP8A 4EIUA 1XXDC 1UWIA 1FWXA 3L45A 3GSQA 2ZOOA 3KOZA 3WMBA 2AV1A 4IIFA 2TSYA 1DLFH 3D0LA 4HWBA 3S4SB 2GK1B 1FL5A 3ZTNH 5H8UA 4HEMA 1FZOA 4KXZI 4YHLL 4DWHA 2XVBA 5HVHC 3HQNA 4JVPA 5CN1A 5B3JF 1PYWB 2MCPL 2PXYB 2R56L 4NUGH 5FEPA 3IDJB 3IJLA 1LP9E 4NERA 3WTUA 1TTPA 4ZD3H 1UKOA 4X4KA 1VBRA 3CV6A 4HLJA 3EX1A 2BGQA 2A3AA 3VXUA 1KXVC 1LK2A 1FQ0A 1A47A 4IJRA 2EH7L 3K6OA 3C09C 3KLAB 1GOOA 1HYSD 1KZQA 1U8LB 1FI8C 3ZE0F 4BJHA 3HE7A 2CYGA 1WZAA 3RKPA 4LCWD 4M1DL 4Z3IA 2M2DA 2NNXA 4WO4B 3X1EA 4ABUA 2W9DL 1ZVHA 5JO5A 2CKBL 4QDMA 1GJUA 1TNNA 4PLKC 4CVZB 1ZCCA 3CFEA 1KM3A 3RO6A 1PZ5A 1TKWB 2A9AA 3TF4A 3U2ZA 2NPLX 5FFOA 2VDNL 5IBUB 1AH4A 3K72B 4HT3A 3RWEA 3HAEA 5F3BA 1AQ8A 4HNCA 3CU7A 2P1FA 2XFFA 3FVDA 4OHQA 1MPAL 3M7OA 3M1CA 4ANKA 5T33L 4KZDH 1DBAH 2BHFA 1IC4L 3GUGA 4JFEE 5JA8B 2VKXA 1CQYA 3U25A 1R8LA 1S1RA 3PTDA 5T3ZE 1IHIA 1XL6A 1J1OH 3RWCA 1NCCL 4N4QA 2VDMH 3D2UB 1F11A 1GAFL 3SIZA 1H5BC 2DYSB 1PZDA 2JKPA 2F58L 2R1WA 1ES0B 1H6UA 3T1WA 4DF1A 5BZWA 5IV2B 4XP5H 3PAVA 1EF2A 4DI9A 4W4OA 3R13A 2AQ2A 3UAJC 4MJ5A 1DL7H 1KJ2H 1UOLA 1AJZA 3D50A 4PJ9B 4I88A 4O10A 4ORIA 3MJMA 1L7TL 1M7OA 1J86A 3I6SA 1QZNA 4HPHA 2DLTA 1KBWA 2ON3A 4DN1A 5B39G 3K0YA 3EH2A 1KRCC 1HN1A 4Z8FL 5MKGA 3VXRB 2X7WA 2HWZH 5AL0A 1NMAH 2JB6A 2DKSA 2YPIA 2BERA 1S6NA 1XGUA 4L8SC 5DR5L 4RWYL 2YCLA 2RJGA 4LNCA 5D8JH 3KDOA 1I3GH 2V9QA 1DQJA 3FQRA 1I0BA 1UKSA 2X8RA 3KBPA 4F15C 4DAFA 1UKTA 3QNZA 3DYMA 2AMGA 3TO2A 5M1TA 3DNKA 4H7CA 4FYSA 3UW6A 3ES6A 3V6OE 1QPNA 3BO9A 1XG3A 4HGMA 3V1PA 5HWNA 2QUTA 4JRXD 5LBSA 4FLHA 1CDGA 1A3XA 2WXQA 3GJFK 3M4HA 1PU0A 4BSVA 4JG0L 2IMMA 5DYFA 3CUGA 3VVVA 5EU5A 2DJXA 3RUGB 4YLCA 5D7LE 2VWEC 3JWNC 3UY7A 1C1EH 4CSZA 4GXUM 4P2CG 1SO4A 3P3TA 4OKDA 4NQCA 3GIVA 1FWNA 3B0VC 3TTEA 3VIJA 1AGDB 2FX8L 3BUYB 4GKSA 4Y5XC 5DYOA 1H7OA 5FACA 5AC7A 5H2ZA 5E8OB 2LR4A 4EN3D 5EF0A 2L7EA 4HA3A 4LIQE 4R53A 2NTFA 4CMHC 5GNZA 3LA4A 4IMEA 1FVPA 5CSZB 1E4XL 3VIIA 1JXGA 5F88B 5FB8A 1NFDB 2B5IB 5E9DB 3TEUA 1FC2D 3D09A 3VWJD 1H9DA 2IQDA 1VACB 1XQKA 3DARA 4NKOB 4V1XA 5E6YA 4PBEA 3SW6A 4M7SA 4RGND 2P9RA 3D0CA 1H15A 2WQRA 3P3YA 1B31A 1K8CA 2VLRA 1KFLA 2VLRB 1C12A 2YAHA 3RVWC 2QF7A 4PJCE 3W6LA 5IZ7A 3GG0A 3MVSA 3GM8A 4BKLB 3CC5B 4HOWA 5BUPA 5DMKB 3ARFA 1J6OA 1UKPA 2WMKA 3PB0A 2QJHA 3TYDA 1NAKL 3SCRA 3VKJA 5A8GA 2VDGA 3VUSA 3ZSSA 3R8BB 2OX4A 4GC4A 1VBUA 1J5SA 1U21A 3RR1A 5DK2B 3VTTA 5KSVB 3MV8E 3KLKA 1U9KA 1I1AA 3MRQB 5EBUA 4KVPA 3LCLA 1WFTA 4RMWA 5E6IC 3BYYA 2IG2H 2TRSA 1QSFA 3H0TB 4MJZA 5HBBA 2CESA 2CM5A 1JRHL 3HZMA 4ASTA 3W1PA 3QAQA 5D4IA 2ZPKL 2FZ9A 5GGVY 3TEVA 4NZJA 4IKIA 1OEZW 3TBWB 1KGXA 3V4PB 1XBRA 1GYAA 3ZIZA 5B80A 3NSCA 1US3A 3I10A 3T2PA 4ZUWB 4ZXBB 5MI0B 2QJMA 1F18A 3RDTA 2V81A 3SGDI 4AZUA 1TJPA 3QN3A 4MD5B 2MOQA 1IZCA 2BIPA 2CEQA 5C6TL 4R0LB 1DLFL 1GVOA 1M7UA 4FEZA 1HCYA 3CQQA 3KNBB 1WA2X 2WTRA 4HKBB 5DZNA 5EUOF 5SV3A 3W0WB 3MCMA 5CP3H 3RLVA 1V7NL 2LLNA 3BE1L 1BZ7A 5D1XB 1HFUA 2J72A 2K78A 5B1KA 1Q2RA 4MMYB 2EDTA 4P2RA 3E0FA 5EA0L 2H1XA 4X50A 1J1PL 4MOZA 2E9WA 3D3VB 4F8TA 4KJPD 5TDNB 4E5XB 3QHFL 1C16B 1C16A 3WJJA 3D0VA 2GY7B 3FN0H 4QY8B 3CYJA 5AUMB 2E40A 4BSWB 4PMXA 2VNCA 3HG2A 1ISVA 5I0XA 1XRTA 2RAGA 4MXVF 2OXNA 4JFEA 4K7PH 5HGAB 4EEEA 1XYBA 4RRPG 4XPTH 3WELA 3D30A 1QLRB 3LZFH 1EXHA 4HIXL 4KMTH 3T4AC 1IR1A 1NCCH 2BZCA 1HH6B 3B9DA 4UDTA 2RH9A 2XIQA 3KYOA 3IMWA 4ZX4A 5KYYB 1T03L 4WUKH 1GJPA 4GH1A 3Q9PA 5GJSH 4WJXA 5ECVA 4W88A 4AJYV 3U7YL 5C08A 4KZDL 1G67A 3ZE1B 3H9HB 4G8GE 4NYYA 4W85A 5F71A 4LLVA 5ALCL 1SJCA 2VISB 3KCPA 4KPHH 4RGNC 2YN3A 4H4IA 3B37A 2ICEA 5DZVA 1XIWD 2NYKA 2IH1B 1QWNA 3CJJA 3VK5A 1VFLA 4LF2A 1HZHH 1M7DB 2HG5B 4Q14A 2FEDC 1S8DA 2VR3A 3IJEA 5CC6A 1FBAA 1Q94B 4L8BB 4I89A 5ESVA 1F86A 3WN5B 1EBGA 4BGLA 3LIZH 4Y1AA 1H0IA 4PFMA 3MUGA 1SUHA 4KUCF 3ERPA 1MLCB 3ZVIA 3RWJA 5FAGA 1FLRH 3LMJH 4L65A 1U3NA 4LZKA 4QQUA 1MCOH 1S9VA 3LHAA 1QLFB 2NZIA 3BW2A 5ISZB 2E6JA 3D18A 1CB4A 5IJDC 4UQIM 4FMFA 3VXPB 5JOPE 2Z28A 2KPWA 3FU0A 5DUML 3KPSD 3GSUB 3SE9H 5BO1H 4YTUA 1N0LB 3B4NA 2IOOA 4UTAA 3W1RA 4ZNEA 2F53A 3QUMH 4KAQH 1EUNA 3SDDC 5FSEC 2WMGA 3GXNA 5G1YA 1TX0A 4MX7B 1JPSL 3UPCA 3ATYA 2J44A 4HIJB 4GSDL 4M29A 4PAZA 1D8CA 5JUEH 1R0AL 3ZIYA 2C26A 2XWBB 1KF9B 2YKLL 3W7LA 4MNGB 2QEJA 5AVTB 3DVIA 4KERA 4ONHA 3TH6A 4P4KC 2G37A 2IUZA 1TG7A 1Q9WA 3VXRD 4QE4A 4LIQH 4DP2X 1JULA 3L9RB 3UCRA 3LBOA 4IPIA 4MSSA 5IDZA 1LG2A 2PBOA 3EOOA 4PSPA 1GZ1A 3EX6A 1AJ7H 1QUMA 1YEIH 3MJ6A 4HH9B 1CGSH 3CIWA 3FF7A 4BI6A 1UD6A 1RSYA 1PLAA 4RGMB 3WMSA 3KAAA 2DQXA 1F3XA 3C5ZA 3TX4A 3ULSB 4OZIE 2KC0A 3N43F 5ICXB 2EVJA 1A5BA 1U95A 1IT0A 2E7CA 2YL9A 1EO5A 1NGPH 2UXTA 1IBGH 3LMZA 1XCTB 2HMID 3K6NA 1G4EA 5H8PA 2VWSA 1KTKE 4F33A 3CVHH 1B3VA 2Y9RT 3WN5C 2FTAA 4N42A 3VD5A 1ORQA 1K8YA 3HC0B 4MZIA 4ELME 1PY0A 1DHPA 3LZRA 4MKTA 4XP4H 4Z78B 1Z6KA 3EYPA 1VFSA 3EGXA 4AEFA 4U3CA 5GZND 2OXGA 3ARBB 4JLRA 3U7WH 4CQAA 2VTFA 1NFKA 1PLBA 2OMBA 1EIBA 2Y4SA 3T9WA 2W5FA 2I5QA 2F7PA 3PNWA 1SMDA 4UQDA 12E8L 1N9PA 32C2A 4P57B 2X4PB 3NEXA 3N1MC 1PZ1A 4WKHA 3QHZH 1JUFA 1AXSA 2FT8A 4ZPTB 3KHOA 3RWFB 5I30H 3IIZA 3PPGA 3XINA 4XMPL 2E7LA 5B1JC 1E6QM 3AWGA 3GRGA 3E9AA 1SN5A 1A3RH 2D31B 3QQWA 1R6WA 4DQOL 3MKGA 3N50A 4MAUL 1W0YT 2D7QA 3V4BA 3HC4L 4BHUI 3M1BA 1MW3A 3F12A 3EBIA 3QRBA 5H35B 3GWQA 5FECA 4O4YL 5JW3L 3BQ6A 1LMIA 4K3JH 3HGSA 4FQLL 3W2NA 3QB7C 2V8LA 4LVEA 4PJ9C 1EUTA 5F21B 4MB1A 3PG2A 3IGHX 2R1YB 4V1DA 5GGSA 1RQ5A 3MRDB 1JZGA 3FYPA 3OW1A 4LANA 3OJ2C 4DGIH 2D4DA 3UPBA 4XO3A 5C09E 1H5BB 3HBGA 3AU0A 3VDCA 5I1CH 5KSUB 1SFSA 4MZ1A 5A6BA 3LTPA 3S34H 1J4EA 2VR7A 4F4RA 1VLWA 3T8XB 4F7CB 3BFQG 4X98B 4DT2A 2I5YH 3RIFK 5DJXA 1XLBA 4Y9BA 3WUGA 5CU5A 4WQOA 1NCBH 5DD0H 1XBZA 4QG8A 4NIRA 4ZOCA 3SYOA 3ARGA 1ZJBA 2LTQC 3EW3B 3NAAH 4XP1H 2FYYA 2X4SB 1IAOA 4LO9A 4OJDH 4ZBJA 3UH8A 5B8CC 1U83A 3TYEA 3D4CA 3DRQB 4Z7QE 1WFMA 1ET7A 3UADA 3G6MA 4WU7B 4PWGA 2DQGH 1NBYA 5T5NF 4F2MB 4Q6XA 1XDLA 5DJ6A 2X1IA 5DJ6B 5AEAA 3MV11 3PXLA 5HDOA 2DORA 5D04C 2G2RB 1HKVA 3C61A 5I7GA 3ALFA 4ELKB 4AEOA 1OINA 2CC0A 2YOAA 2F8OA 3RY4A 4AE0A 5E99H 3VSUA 1ZJHA 3BC9A 4XOCA 1I2NA 3KCLA 3HQOA 1XF0A 4M5SA 4A2DA 1TQVA 2GG1A 9RUBA 1PKYA 4NVTA 2X2GA 2XWZA 2XN1A 4K1WA 1NGXB 4MRBA 5F8QC 4RMSA 3BPWA 3N6HA 3VMPA 4MQXC 3C09B 4QTFA 1VP5A 3JQOB 3KPQA 4F93B 1ZIAA 2I5IA 1WCGA 3UJ2A 4ACYA 4JCMA 2VZOA 5A6IA 1HIZA 1WUZA 5IEKA 2DH2A 1DKWA 1RK1A 4G59C 4GUPA 1A3QA 3L21A 2WW5A 2XT1B 4IP4A 4JQXA 3CSFA 1BZOA 3F7LA 4GINA 4U6HA 5E2JA 1LGVA 5EZIL 2A0LD 5GRZA 4F9JA 1MW2A 3HNSL 4AC1X 1RZJL 1JDCA 2UX6A 1WZ1H 2FDMA 3SQRA 1KIQB 3HBPA 4PGLA 1U30A 4DFHA 1HGYA 5DLMH 3CHOA 3U7AA 1CXEA 4XP9L 4JY8A 4DWSA 2P24A 4L48A 4A29A 5K69A 3B97A 3MRLA 3HAEB 4JMNA 1AQFA 4JFQA 3P1VA 4G8GA 2G9HA 1WCBA 4AKOA 4BXSV 4DTGL 3V79C 1A6ZB 3GTVA 3UTTA 1YXCA 2B0MA 4R9XA 2AQWA 3OO2A 3QHMA 1YYML 3K71B 1NOUA 3ZE2E 2R1XA 1AL7A 5IVZB 3BDKA 3FTUA 4BZ1L 1BVLB 4DHGA 3AQDA 4RFEB 3WQDA 3CFEB 4F0KA 3SPVB 4NRRA 1YUHB 4QAIA 1A50A 1G87A 1X5AA 2A1WH 5DQ9B 4EI5C 2FO1A 1E0VA 2C19A 2Y8VA 3I7RA 4ACZA 2B15A 5DWUL 4TLUA 4MCMA 1R0MA 2OCCB 3KPPB 4ROPA 1UC5A 5ANMB 2CO4A 3QI9C 3VXUD 4NIKB 4JZ5A 5D1XC 1OFQA 4HWNA 1UWFA 3VFUB 3FUIA 2BIMA 4HHAA 4QSHA 1QBLH 3ATDA 3N2OA 4ATTA 5F0PB 1D5XB 2QV2A 5C07A 1HH9B 4JE0A 5BNXD 4IBWA 1S7XB 3OB0H 1E6RA 1V51A 2YPKA 4YBHA 3QORA 3II2A 3OIHA 3WDPP 5AKTA 4M6ML 1YLVA 3O6AA 2RDUA 5D4HA 2FVMA 1W3TA 5IOBA 4LP5A 3TFXA 1DQTA 4Z0JA 4FHJA 4FDWA 3ECUA 4K5NA 4KRZA 4GAGL 3PP4L 1OFPA 4AY1A 4FQXD 5IHSA 4P2YA 4UUJA 1KV3A 1VZIA 3ARYA 5CJBA 4BE5A 1UUSA 3GIZH 4HZMA 1NANI 4DZBB 3AZSA 2C4FU 4G8EB 1QHOA 3MV8B 3QGAC 3BCDA 2BS9A 3UJIH 5D2NA 4F2EA 3TJLA 3OPZL 1NFDF 3FB5A 4J23A 4FPSA 3S34L 2EE2A 1MHEB 1E28A 3UBFA 1WOAA 1A4CA 1SZEA 1WUNT 4FMKA 1G9NL 3PSWA 4R88A 1BOYA 2GK0B 4PGEB 8CGTA 1AH1A 2Q7AA 2NY5H 3SBQA 4BM7A 3UJJL 4JO8A 1FNEB 3LKSB 2QDHA 1F8TH 3HIZA 1YNLH 5LO7A 2GSIB 3JRKA 3RX3A 1FYTE 3C5SB 3QAZC 3CUIA 5CC3A 2A74C 5AD0A 1DQXA 4HAKA 5I6XB 1CG9A 3HB3B 5EMYA 7TIMA 2GSEA 2AXFA 4IRSC 3A9IA 4CN6A 3NT0A 5CPTA 1GTHA 3DX7B 5DRZA 3RTQA 2PCPA 1GPFA 2BG5A 5LBVA 5BW7C 3GF8A 4D9RD 1NUFA 1R5IA 3L5HA 4JFUA 4HKPA 3KTXA 3ZDXE 1GONA 1T6MA 2I27N 1GGCH 4XK2A 3VI3E 4QRRA 9CGTA 1J5DA 3VSTA 5DXYA 3TFCA 3RDTB 1R19A 3D85A 1TJIH 5DC9B 4HGXA 1T7XA 1DBAL 4TULL 2BSSA 2XDHA 3HKZA 3SGDH 3ARPA 2DUXA 2P8CA 3KVMA 3M7WA 1J9QA 4H9TA 3W2LA 3FTVA 4DGUA 4E2VA 2YAQA 3HZMB 4M7KL 4ZFOA 5I28A 4OZHA 5DANA 1ONXA 1E9OA 4TVCA 2GIXA 2AQ1A 2XZCL 3BJ91 4QO1A 3IJHA 3T6XA 2NY4C 4HU2A 2O92A 2PP3A 3BJFA 5I78A 5JMRA 2JLLA 2FZMA 3PP7A 1GYCA 3DTDA 1I9CB 3MBDA 3TBYB 3SCOA 3EXSA 1NVMA 2OZ3A 3IPWA 5DJDB 1O75A 4AQ1C 4CVXB 4EDWL 1ZT1A 3KVKA 3TN6A 1LNUB 4ZS7L 1NTHA 3GT6A 1ZS8A 3LNHA 4Z3TA 3O63A 2XTLA 2F0CA 4F7KA 4PJHA 1TWSA 1IIKA 4DWSD 5FKAB 3MW7A 4N0UB 4GXUN 1BD2B 3VXTB 1AHWB 1OALA 2WQPA 4GUIA 1QI3A 5G4HC 1J11A 2R4RH 4FQ2L 3QW9A 4GY0A 3E6FB 3N25A 1GHFH 2WBJD 5A2IH 5L4JA 4I9WE 4EO5A 3RPKA 3VOHA 1P5VB 1TZ8A 4IIQC 4UFIA 1ILUA 1GSMA 4H8WH 5AUMA 4B16A 3U9WA 1N4XH 2GFBA 5FK9B 2R29H 2HXAA 3FONB 3CT2A 4S3KA 3SQMA 3T1FA 3NURA 3ZTJG 3W1ZA 5FEWA 4I3SL 3MLVL 4M7LT 3RURA 5DURD 2F6UA 3ES7A 3F05A 3P73B 3QUYB 4NKIH 4XH2A 4I0KA 3FRUA 4LSVH 4PJFA 3S36H 3QRHA 1W72H 3MFFA 2EDRA 3Q2VA 5I1DB 4LAQL 3R8GA 4YGAB 4MJ5B 1PVNA 3MO7A 5D72H 3HCVA 5ENLA 3CLEH 3DGGB 3FCSB 3LS4H 4YC2C 3KPNA 3QRGH 1KM5A 1Q3NA 1XLFA 5GNXA 4HPNA 1L0YA 4J8RB 4HNVA 3GSRB 4KTGA 5L9DH 3GC4A 3WQGA 3D2UA 1KELH 3MV8D 2EVGA 3G22A 4JTKA 1RMFL 4WI4A 2MCG1 2Y1ZA 5REQB 2CDFA 4FMVA 1JEZA 1NPJA 4ZAKB 1XR8B 4P23C 4WOZA 4ADUA 2Z7YA 6CGTA 3PQYA 4LSRH 3Q2NA 2GJPA 5DEFB 1QR1A 2JK5A 4JO3L 4G9DA 5DQJB 2HFTA 1R24A 1WWBX 2JVUA 1XYFA 2R6OA 4NQCB 1DJYA 2ZCZA 2ODIA 5CD3A 1GR7A 1CECA 4I7VA 3MRIB 2XFGB 2JELH 3QXAB 4PYGA 1E0TA 3HMCA 1MY5A 4ZYKA 4OV6F 5CGYC 1V7YA 1J8VA 1KGYE 4FI6A 1EPFA 4OF6A 4ES8A 5A94A 3H9SE 2A74A 4UILH 3T3ME 4BSVB 1QWUA 1F8MA 1PD6A 1KN2H 1Q72H 3GDBA 4FQCH 1AGFA 3HAEG 4HXAH 4R8WL 4X9FA 4ZFZA 2WC4A 1PBYA 2EKSB 4ZTEA 2EKSA 2E46A 4JTQA 4J1UA 2BVPB 1KTDA 3QDMB 5I3FA 3P0YL 3P4MB 3VXUB 2QLVB 3EWBX 1SVDA 4IS6B 3M45A 4WK4B 4C6MA 3AREC 3ULVL 1VA9A 3ZDYF 4C56D 1PZSA 1WTGT 3E8VA 1KTCA 1RK0B 5GRVK 2BCMA 5GHWL 4K9JA 3GEWB 2XG9A 4GRWB 5KYUA 3VMNA 2A73A 1T83A 3BWAA 3PV6B 4CW1A 1Z0NA 5K9OB 3VRIA 3E2SA <