4UQBA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.68 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
total genus 135
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqbA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqbA02
4R27A 1JD9A 2D2OA 4AMCA 3VIOA 1GOWA 5A94A 2WBGA 2WSPA 2YFOA 5BXRA 4J3TA 4DUXA 2WANA 2WLZA 2XSBA 3VDCA 3FY1A 1ZBKA 1E15A 1V6YA 2YL8A 2VZTA 2VR5A 3W24A 3VGHA 2CHOA 4D6FA 4H7VA 3HG4A 4W88A 1B3YA 2EPNA 3VKKA 1GHSA 2F18A 1EIBA 4AZGA 4N0RA 1C7TA 1H41A 3ZJ6A 1BF2A 3CPUA 1GQJA 1W9XA 1UQZA 3AOFA 1FHDA 3CBWA 2WCSA 3D50A 3ARSA 4DWSD 1UD8A 3UCQA 3MU7A 4AISA 2E0PA 4CN4A 4U33A 2EABA 9CGTA 2FGLA 3L4UA 4CU6A 1UQYA 2WBKA 3KWXA 1HNYA 8CGTA 1JG9A 1HJUA 2D0FA 1B3XA 4PUEA 1ODZA 1R87A 1JZ8A 1QX1A 3S6TA 4YHEA 3AIQA 1JL8A 3VILA 1ZBVA 5BROA 4Z2KA 2YLAA 3VIHA 4HMDA 3BVWA 1V0LA 3HU7A 3AHTA 3LPFA 2XPKA 2WXDM 4JIEA 4PMVA 2BHUA 3UESA 3M7SA 3AFBA 3AYSA 1Q6DA 2DSZA 3T2PA 1F4AA 3B9AA 1U30A 3W6MA 5A2BA 3A22A 3EDKA 4MB5A 1MVYA 1QOXA 1VFMA 1JZ2A 1VENA 5E0FA 3AJ7A 4UFMA 4W7VA 4ACYA 3KL5A 1IZJA 1EQCA 5FD0A 4F79A 4JL2A 2GFTA 4Z2LA 1TQWA 5IDIA 1ZJBA 3GH4A 5IFPA 1VBRA 3ZQ9A 1ISVA 2GDVA 7A3HA 1KXVA 1V6XA 3WD2A 3TA9A 1NWRA 3WF1A 2J47A 2PB1A 2YA1A 5M3WA 1QI3A 3SCRA 3QOKA 4HOWA 5JUVA 4NX0A 2ZICA 4AMXA 3L4TA 1CWYA 3AIVA 4MTVA 1V0NA 1BYAA 3VIJA 1GPFA 4CKQA 2O9OA 2YDQA 3DDGA 2GK1B 3CZKA 3OGRA 3O6AA 2CKRA 1W3KA 3TTOA 4EKJA 1UR1A 3W0KA 2J77A 4OGZA 7CGTA 1LG1A 2VRJA 3SUVA 2EADA 3TTQA 3D4YA 1BLIA 5FIPA 1QI4A 4OBSA 1LLOA 3U5YA 1W3HA 3WY1A 3OIHA 5M17A 3WMSA 2V5DA 3KZSA 1KGXA 3LPPA 1VJZA 3F5KA 2J7GA 5I3DA 1V3LA 3S5YA 4XX6A 1UR4A 3ARYA 3WEOA 2DEPA 4RE4A 1EH9A 4TUFA 1XC6A 4W5UA 5A8MA 1M53A 2O9RA 4UOJA 4J3VA 4JFUA 3GH5A 4ACZB 3WD1A 2FH8A 4CD7A 2J79A 3WH7A 1EDQA 4N42A 1C90A 2BXZA 3CZGA 1GONA 3VIKA 2GJXA 2VR4A 4GO9A 1NARA 4D6IA 4UOZA 1X6LA 2AOSA 3ARVA 5CJ5A 3CZSA 2PBOA 1UASA 2RGMA 1V3MA 1OGBA 3ALGA 3FXYA 4M81A 4FNUA 3ARRA 3MS8A 3HJEA 1TG7A 1JD7A 5CLTA 3VMNA 1H5VA 1JDDA 4OIFA 2XWEA 1MFUA 2ZUWA 4MDOA 2O9TA 1R85A 2YOCA 4GPNA 4BQ4A 2PI6A 1CENA 1WZLA 1HJQA 3TONA 4UQBA 5IHSA 2VCCA 2OSWA 3PZ9A 4UQDA 5A95A 3N1AA 3UERA 3W27A 1WDRA 4AD2A 3WIJA 4U2ZA 2NSXA 4JAWA 1ITXA 3IAQA 4HZ7A 3BUDA 1V08A 3QHOA 3RDKA 1G5AA 1WAWA 1CXKA 3FHQA 3POCA 3WEZA 3EJSA 5A6AA 3B8SA 1E6QM 4U2YA 4CD8A 1IV8A 4GI6A 1AQHA 2A3AA 3CUJA 4QAWA 1HJXA 4L4PA 1ISZA 2CYGA 2VOTA 6TAAA 2RGLA 3BLBA 4FLSA 1WNOA 2UWFA 1OWQA 1UZ4A 3WY4A 3BUBA 3WN6A 1R7AA 1BAGA 2CBJA 1JAEA 4JHOA 3IGUA 2XIBA 2Z1KA 4NSBA 3I3DA 1XH2A 4PTMA 3MUIA 3ZOAA 3GH7A 4J3UA 3BLKA 2DSWA 3H53A 3AXIA 3ZT7A 1HVQA 4HOXA 4TX8A 1GNXA 2J7DA 3PTKA 4KRTA 1FA2A 2ZUTA 2W92A 2WMIA 5A8PA 1WZKA 4JCMA 2G3MA 4RL3A 4BF7A 1CXIA 1E0VA 1E1FA 2JE8A 5I2UA 3A21A 4P7QA 6A3HA 3BH4A 2OW6A 1V3KA 5CG0A 2C8NA 4PSPA 3W25A 4PTXA 4M82A 3DX1A 3L4XA 3DX0A 4PMNA 4GIAA 3D52A 1HX0A 3SCTA 4ACZA 1H0GA 3SIMA 3WQ6A 4FNPA 4AZBA 3CH9A 4WKHA 4OKDA 1EXPA 3VTRA 3CUFA 5LA2A 1SZNA 2XVPA 1EQPA 1HKIA 3VM7A 3NSNA 4BZYA 3EDFA 4CU8A 1E6XM 1DWJM 4EANA 1E73M 1LG2A 1UKPA 3N04A 4U5IA 3DX2A 1UD3A 1PX8A 2XYLA 1DHKA 3VIGA 4PMZA 1BYBA 1NWSA 1UWSA 3T2OA 5E6YA 5LA1A 4JFWA 1W1PA 2ZX7A 3WNKA 3DDFA 4LXFA 1CXFA 2JF7A 3ARZA 3AZRA 4ZXOA 1UUQA 3S5ZA 1TVPA 2XFYA 2CKSA 5D8ZA 1XV8A 2E40A 1B90A 2VVNA 2F1BA 5E1QA 1MYRA 1OGGA 1CNVA 1OBAA 3WDPP 1MXGA 1UR0A 5HOSA 4D72A 3BUQA 2ZOXA 4AD4A 3ARUA 5LA0A 1WB0A 1B3VA 3JUGA 3VGBA 5AC4A 1ISWA 5EFDA 1GJUA 1US2A 3RPMA 1C93A 1E72M 3D51A 2GDUA 2YBUA 2XVKA 4NXSA 4D6DA 3VIMA 5FOOA 3BUPA 1HXJA 1V3IA 3WKZA 5GPRA 2WHLA 2DIJA 1KCKA 5I24A 3WMBA 4QDMA 3DECA 5CPTA 5KZ6A 3OB8A 1V03A 1HVXA 3MO4A 5D9OA 2VCAA 3AHXA 1H2JA 3LPOA 3WF3A 1PJ9A 1H4PA 1R75A 1E56A 2BFGA 3GXFA 2WVVB 1J12A 2DIEA 3CZNA 4Z2HA 3GNOA 2YJQA 1MW3A 4IPNB 4U3CA 3EJUA 1UKQA 1L8NA 3GXPA 4WSJA 4W93A 1DWIM 1LF1A 2OSYA 2ZX5A 1A3HA 1MQRA 3WFZA 2NW0A 3GNRA 5BCAA 1W91A 1QHZA 4CCDA 1D3CA 1GHRA 3NDYA 5A6BA 5DF0A 1GUVA 3AROA 4U5KA 4CUCA 4X0VA 3AIEA 4AEFA 4YPJA 3WNOA 3WELA 3HN3A 4UFJA 1E71M 3ARXA 2YIHA 1VRXA 5ECUA 1M03A 1W1YA 4L4OA 2CITA 2J25A 1TFVA 3AHZA 1CXLA 3EMZA 2PC8A 1BGAA 1RP9A 4AIUA 2A3CA 3D5HA 3ZJ8A 3MMWA 5CSYA 2DSKA 3IANA 1DWAM 4NI3A 4BQ2A 2WW5A 1BYCA 3N13A 5JIPA 4GINA 2D3NA 4D1IA 2D0GA 4H41A 4BA0A 1GW1A 1JYNA 2WKLA 1TQSA 2WHKA 1RP8A 5DT7A 1QVBA 5I79A 5EFFA 4PTWA 4AWEA 4S3JA 4JFVA 5HNNA 4W7WA 2HVMA 3L2MA 2E8ZA 5KEZA 1E5JA 3MANA 2X09A 1W9VA 3SUWA 4ZE5A 3VNZA 2Y4SA 3PZIA 1VJSA 1UR8A 2WHMA 3KLLA 1UH4A 5A8QA 3K46A 2YKKA 3PZTA 3T0BA 3H55A 1V02A 1TZ7A 4XB3A 1GQKA 1E9LA 2D24A 4WKFA 1QPKA 1KR0A 2WMJA 5GNXA 1HF6A 3ARPA 1M04A 1NWUA 1PEZA 4JZ5A 2BVYA 2UY5A 4UCFA 5M03A 3WBEA 2ZXBA 1XHGA 4UFLA 1AMYA 2DH3A 2E9LA 3H54A 4URIA 2F7OA 1WZAA 4DUVA 4HP5A 4AZCB 1XYZA 2J62A 4TX6A 1CGWA 3K8KA 1UD6A 3WUBA 5ABHA 3EJRA 2QF8A 3VVGA 5FL1A 2CPUA 4DO4A 2WAGA 3HG5A 3WQ5A 4WIWA 4AZ5A 3RO8A 3WQ8A 5ABEA 5DMYA 1QWUA 2A3BA 2XG9A 1K9DA 3AISA 1VB9A 4PBGA 4WSKA 2Z1SA 2VURA 3CHCA 2VRKA 4QLLA 2BHYA 3WQVA 2X1IA 2JALA 5CQ1A 4B16A 3DHPA 3GXTA 2D0HA 2F1AA 2XN1A 2XGBA 4W84A 4DWSB 3EDJA 3NSXA 3S2CA 3PZOA 1JAKA 3BAYA 4TVCA 1MXDA 1K6AA 3MSGA 3W82A 4B9ZA 1UYQA 4MJ2A 5ABFA 3WD3A 2CESA 1LWJA 1QHPA 1ESWA 2XVNA 3AIWA 3VGFA 3CHEA 3VUPA 1C8QA 3RJYA 2ZUMA 4XZBA 4CVUA 2X0HA 1CDGA 4E8CA 3THDA 2QLYA 1TMQA 3M6DA 1PZ3A 3O9NA 7TAAA 3ALFA 4P8UA 5CXPA 1MW1A 1JFHA 2G3NA 1UWQA 1E55A 5CSUA 1B30A 1QNOA 3OLDA 1NP2A 2YL9A 3WUEA 4J3XA 1E3XA 2YA0A 1HL8A 1FP8A 3AHVA 1DWFM 2A3HA 1M7XA 2OWXA 4D1JA 1PBGA 3IK2A 2X2HA 3FNDA 2NT0A 1J0JA 5ABGA 3GZAA 1QW8A 2WHJA 3MKKA 4QCFA 1Q6GA 3WL0A 1MQQA 1F4HA 4FNTA 2UY4A 3AZTA 4HU0A 3TTSA 4M1RA 2D73A 3EJQA 4JCLA 4AW7A 1JZ4A 3AS0A 1QHOA 4JKLA 3W26A 1VFUA 3OG2A 4GO8A 1OIMA 1V6WA 1B9ZA 3RM4A 4WK9A 5HPCA 1UD5A 2VQUA 2WNWA 3BVUA 1QNQA 2HISA 4PMYA 1V6UA 1VEOA 3VDHA 3WH5A 1UD4A 2O9PA 1J10A 3OLIA 4UR9A 2BXYA 3GXDA 4BQ3A 2XJ7A 1TE1A 4JFTA 1SMDA 3AXXA 2O92A 1KBBA 4PYSA 3U7VA 2PBGA 4PCSA 4TOQA 5HDRA 5BXSA 1MW0A 2JIEA 1HKMA 1OCQA 3VSTA 1GOKA 4GI8A 4CGTA 4XV0A 4DO6A 4OZOA 3O2LA 2VQTA 6CGTA 1UR2A 4CN1A 4H8HA 4CD5A 3AMDA 4PMDA 1DP0A 4NZFA 3N12A 3PTQA 3WMCA 1EOMA 4CD4A 2CIPA 3BC9A 1EHNA 1H49A 5IHRA 2WPGA 1B0IA 2VX6A 1QNSA 4ZFMA 2EPLX 2WMFA 4TTUA 4UFHA 1BGGA 3WF2A 1US3A 1BQCA 4M29A 4AZ6A 2VCBA 2WZEA 5A69A 1JGIA 3LX9A 3CUHA 2V3DA 1C8XA 2ZX9A 2W66A 4P7NA 4KH2A 4W86A 3K4DA 4R5EA 1ODUA 3IJ7A 3N17A 3ZT5A 1LL4A 5I5RA 1B1YA 3PZGA 3LXCA 3AIRA 1OD8A 3WUFA 1A47A 3I3EA 2GJPA 2FYVA 2F2HA 2VL4A 4AYSA 4GXPA 1HIZA 4HA1A 3A24A 5A2AA 3E1F1 4H04A 1HT6A 4FNSA 2DSUA 4Z2IA 2X0YA 5F7UA 1XH1A 1WZMA 2XHYA 1E6NA 3UR8A 3RM9A 5CPSA 2XVGA 3OZPA 2GSJA 1OM0A 4NF7A 2PWDA 2ZXQA 2DPEA 3BVVA 3T09A 4TTGA 1XCWA 1W2PA 3EMCA 1E0WA 3UG4A 2CBIA 3CHFA 1CXEA 3A3HA 2XIIA 3LRMA 2IXVA 3VD9A 1VF8A 4MNJA 3B9DA 2WSKA 1W9DM 1GORA 4FMVA 2VX5A 1KWGA 2EQDA 3WD0A 2QV4A 3WDRA 2V3EA 4PMXA 1CLXA 1QNRA 2GK1A 1DEDA 3TTYA 1OT2A 2WVSA 1WPCA 3IJ8A 1CLVA 3MMDA 4PCTA 3ARQA 5DEZA 1BVZA 1RD6A 3DYOA 4KWUA 1D7FA 3W81A 4MNKA 3T2QA 3W53A 2QMKA 3LRKA 2WZHA 3OLGA 4M24A 3GTNA 4LYPA 3T0DA 1MW2A 1E4MM 3OA5A 5AYIA 3GBDA 1UKTA 2CBVA 3CZLA 2X2IA 1CGVA 3OGSA 1K9TA 4F66A 4W89A 1XH0A 1VFOA 1XGZA 2ZUNA 4LX4A 1DTUA 3UEQA 1E5NA 3BLPX 1TA3B 3FAXA 1E6SM 1UWIA 5GQBA 2TAAA 1CGXA 2XM2A 3PZMA 3QHMA 1J01A 5A6BD 1W1TA 4E2OA 3PZUA 4HZ6A 2WC3A 4CU7A 4TVDA 4CN6A 3WDIA 1GOQA 3FHAA 3WD4A 1PX4A 4AZ7A 3AI0A 3CMJA 3QR3A 3BVXA 1UWRA 2G3JA 2OYKA 4P7RA 1B3WA 4AD3A 5C71A 1KTBA 3W37A 2DT1A 3AIBA 3PBGA 4HTYA 2EPKX 3W4RA 2D23A 2FHCA 4YN5A 1GOIA 2VZOA 3EDDA 4A3HA 2J74A 1CGYA 4IPLA 3BMVA 4A4AA 1CTNA 1FFRA 3EMQA 4WJXA 4WLCA 1JYXA 1CYGA 2UY2A 4CVWA 1O7AA 3FN9A 4KGLA 2QPUA 4M56A 4ZENA 1W1VA 2E8YA 1HTYA 4CD6A 4V27A 4HU8A 2WCGA 3MI6A 1UOKA 1PPIA 2G3IA 4PTVA 1NH6A 1KWKA 1UA3A 4IM4A 3GXIA 1J11A 2VX7A 2XN2A 4DM1A 3WDQA 1KXQA 3L4VA 2PF0A 1U33A 2ESCA 1YQ2A 1GJWA 1CGUA 4DM2A 2YA2A 3KLKA 1NOWA 2VTFA 1PIFA 4LQ1A 1JYVA 3M46A 3RCNA 2CBUA 1H11A 3BAWA 4U3AA 2EPOA 3FAWA 3VSUA 4MAVA 2F61A 5A1AA 2BV9A 2JF6A 3SEPA 4B3KA 1J0ZA 3G6LA 1WDQA 1C91A 4LGXA 4M8UA 2ALWA 4E8DA 2YL6A 4H8UA 1VFFA 3AZSA 3N18A 3GNPA 3MMUA 2VZVA 3NYDA 3EJTA 3KL0A 1SYTA 1E0XA 2W61A 5BWFA 1CIUA 1VBUA 2CCRA 3MUAA 2FE0A 2J4GA 2AMGA 3L4ZA 2YL5A 3ZJKA 4AY1A 2B31A 1GOMA 1OGSA 1O6IA 4W5ZA 2VMFA 1DWHM 3CC1A 3L4WA 1UHVA 1TA3A 4GZIA 4W8BA 3N11A 5C70A 1HXKA 4AD1A 4AZHA 2WMKA 1KXTA 4HA3A 4RE2A 2BHZA 5E0CA 3RIKA 2FHFA 4MAZA 2XN0A 1G1YA 4Z2GA 1QBAA 1HKKA 3QHNA 1JZ7A 1P6WA 2E4TA 3SCPA 5E09A 1HL9A 3LXAA 1TR1A 3CZJA 4AMWA 3U7BA 2DQXA 3SUSA 4P8WA 1C92A 2WCAA 3VD7A 1Z32X 1WP6A 1CEOA 2X2JA 4AIOA 1I1XA 4NXKA 3GXNA 2F7PA 5BXTA 1CPUA 3WSUA 1R86A 1G94A 1NQ6A 1ZJAA 1I1WA 2VZSA 1E40A 3D3AA 2BVTA 1WCGA 2XWDA 1C7SA 4EK7A 4BS0A 1XSKA 2Y8KA 1UKSA 4PEEA 3OZOA 1NM9A 2JFEX 3W38A 3AMCA 4TVUA 3VGGA 4MB3A 4D6CA 1QW9A 3KL3A 3LXBA 2W91A 3A5VA 3PTMA 4HMEA 3BSHA 3VX0A 4HOZA 1K9FA 3W6LA 1VEMA 3VDBA 3VGDA 3WH6A 3ZR6A 3F5LA 5A6KA 1JF5A 5DO8A 3GDBA 4JL1A 3NDZA 2V38A 3QGVA 1BTCA 2BY3A 4PMQA 4D71A 2CERA 2VO5A 4MPKA 1XSJA 1T0OA 4DO5A 4IUGA 2OW7A 3SCUA 3CUIA 1JDAA 1ITCA 3SCSA 2C7FA 4UZUA 1W2VA 2J75A 2BY2A 2BNJA 3A47A 2VZUA 4C7GA 2XGIA 3VPLA 1J0IA 3NUKA 3WF0A 2WVVA 3VOCA 4AC1X 4D6GA 4MNMA 1OT1A 3F4VA 4YHGA 1J9YA 3ARTA 3WFLA 4J3SA 1GQIA 5DFAA 4RE3A 3BSGA 2IXUA 1E4LA 3MUY1 1EOKA 2WMGA 1FH8A 1NOUA 3ZMRA 1HJVA 1E1EA 2GUYA 1FH7A 4D6EA 4UQCA 3BMWA 2X05A 1C8YA 1KXHA 4Z2JA 1W3LA 5HXMA 1C3FA 4B9YA 1BG4A 3L2LA 2DGAA 4GQQA 3ZO9A 1OSEA 3VGEA 3AHYA 1MQPA 3TP4A 4AD5A 1SR0A 5CLWA 2CEQA 4C7FA 3K8LA 1UH3A 1QNPA 4NRSA 4KGJA 4W7UA 4H2CA 4UQEA 1GQLA 2PWEA 1XRVA 2F7RA 3WQWA 4OOZA 2Y8VA 4UTFA 1PIGA 3BUIA 3T0AA 1PS3A 3TV8A 3K1DA 4F9JA 1LQ0A 3APGA 3VINA 3DHUA 2ZWZA 2V3FA 2EJ1A 3SCOA 5A6SA 1PX3A 3ARWA 5EMYA 5D9MA 2DSVA 1FH9A 1HN1A 1CZ1A 4JKMA 4B3LA 4WKAA 4GZJA 3EYPA 3BAJA 3VNYA 2GJXB 1W9BM 1JZ6A 4FLRA 3CLWA 3CIVA 1OB0A 3ZM8A 4E4PA 1EDGA 2J7BA 3VD3A 2J7HA 3MUZ1 2ZUUA 1QI5A 5CGMA 3WBAA 3PZVA 2VNCA 1IZKA 4OBRA 3I3BA 3VD5A 1KCLA 2GVYA 2OYMA 3WENA 1GVYA 2J7CA 1Q6CA 3WNMA 1KTCA 4UQAA 1KFWA 1X1NA 4FK9A 4KMQA 2CXGA 1CBGA 1ZS2A 2WK2A 2CHNA 3VMPA 3A23A 3AIUA 4FLOA 1UD2A 2EBNA 2WC7A 3ECQA 3AS3A 1R33A 4J3WA 1WKYA 2Y2WA 3CMGA 5A6LA 3WNLA 1ZL1A 3VD4A 4GI9A 1PZ2A 3DX4A 1QBBA 1OD0A 3BCDA 1YHTA 1J18A 5D9PA 1HP5A 3UR7A 2PWGA 3ZJ7A 4P7OA 2ZX8A 4AZCA 2DT3A 2VRQA 2JEPA 1RH9A 2V3GA 1H3GA 1QWNA 1HKJA 3CGTA 5D9NA 4PMRA 4UQ9A 5BRPA 1UA7A 3BXWA 1H1NA 2ZIDA 1R7OA 5TD4A 4FNQA 4DUWA 3AMLA 1R47A 2WWDA 1JZ5A 5CPQA 3WH9A 1ZBWA 5EBAA 4OJYA 4DWSA 4J27A 5DT5A 1SMAA 4EE9A 3L4YA 4ML4A 1Q6EA 1G01A 4IISA 4K68A 4ATDA 1GVIA 3CO4A 3F5JA 4MJ4A 2WMIB 1CECA 4HZ8A 1UWUA 1K9EA 5BYWA 3UETA 2DT2A 1QI0A 4OOUA 3W28A 2XTKA 3BAIA 2WM0A 1XYFA 1V3JA 4ATWA 2GJRA 1UZ1A 3SCNA 2W63A 4PUDA 3WL1A 3A6OA 2X2YA 4ZEPA 3RJXA 2EO7A 5A2CA 1B31A 3OLEA 1JNDA 3RM8A 5I78A 1TUXA 3AXHA 3WUGA 3U57A 5IXEA 2OWCA 1V02E 3II1A 3A4AA 4P8XA 1Q4NX 3GBEA 1ISXA 1E4NA 2OYLA 1LL6A 2D1ZA 1S46A 4UOQA 1E6RA 3MV11 2MANA 4QFUA 4A3YA 1AQMA 5AY7A 4HPHA 1EA9C 3WEMA 3J7HA 1G9HA 1ZB5A 4CCEA 3TOPA 2ZXDA 3N9KA 2W5FA 4ZXLA 3LPGA 3D4ZA 1R8LA 3HMCA 5CGTA 4NZJA 4D6JA 1L0PA 4J28A 4HPGA 5A8OA 2FDMA 4MADA 1CGTA 1WDPA 5I0DA 3BVTA 1KGUA 1EDTA 5E9AA 4UNIA 2J78A 3IJ9A 3WNNA 2WLYA 4HA4A 3HZ3A 3N15A 1J0KA 3IAPA 3VIPA 4HMCA 3OBAA 2VVSA 3AICA 3MSDA 5LYRA 2QPSA 1KR1A 2WWCA 4D6HA 1HP4A 2ZE0A 2XFRA 1ECEA 1TVNA 2BY0A 1B2YA 2VI0A 3VMOA 1W9UA 1V0KA 2CETA 3UG5A 2G8ZA 1FHLA 4CCCA 5IFTA 5BRQA 2OWWA 3SCVA 4FLQA 2ZUVA 1KBKA 1W32A 4U31A 3VX1A 3KE0A 4FF5A 2FGZA 1TQVA 5D8WA 1XD1A 2EXOA 3AMGA 4V2XA 1JDCA 3NJ3A 1KGWA 3WQ4A 4AZIA 4W87A 2QHAA 4UFIA 4AYGA 2WMHA 4GQRA 2WVTA 3HG3A 4JKKA 5FKYA 1BG9A 4LPCA 4DWSC 1G0CA 3MV01 5GNYA 1VEPA 3FW6A 3ZT6A 1E4IA 1W9PA 1WE5A 3BAKA 3VU2A 1H09A 2G4FA 4GZEA 2G41A 5HPOA 4W8LA 4ATLA 4WF7A 3POHA 2EEXA 2BS9A 1V6VA 4BCEA 1DWGM 3CUGA 5M5DA 1LWHA 3AS1A 1UKOA 3EBVA 2YLLA 5I77A 4PSRA 2V5CA 4AIEA 4S3KA 4MB1A 1XCXA 1Q6FA 4B15A 2XFFA 3LMYA 1KQZA 5I23A 5E6ZA 1J0YA 4QCEA 1J0HA 2D20A 5JBFA 2ZXAA 1V0MA 3VO0A 5AYBA 1NOFA 5BXPA 3NIYA 1TCMA 3LRLA 1H0IA 5FL0A 3SCWA 3WF4A 5C8BB 4W85A 3CV5A 1RPKA 4J7RA 3A4XA 3THCA 4H8VA 3SUUA 4UZSA 2UY3A 1SFSA 4W8AA 3AYRA 2EAEA 4XZWA 2XVLA 4X9YA 1NWTA 3AMKA 3ZIZA 4UFKA 1BFNA 1GZJA 2WC4A 4LYQA 3OGVA 1FP9A 1W3JA 2VC9A 2VUYA 2YDSA 4AD0A 3G6MA 1R34A 1TQTA 4JHZA 2JIWA 3U5UA 4XUYA 2J7FA 4PMOA 2Y5EA 1EO5A 4FNRA 2F7QA 5A8NA 4F9DA 1JZ3A 1Y7VA 3DX3A 5E70A 2W67A 4TXEA 2OSXA 1HJSA 3PZQA 3NSMA 3DC0A 3SUTA 1QI2A 4KRUA 3WY3A 1XSIA 1OIFA 3DYPA 3BCFA 2DT0A 2Q8XA 3VDAA 5A6JA 1BSIA 1EHAA 3GXMA 3CZEA 1LJYA 3GM8A 3CZ8A 2ZUSA 4Q22A 3BGAA 1UG6A 2DDXA 4OUEA 4PN2A 2ZX6A 1KB3A 1ZBCA 2JEQA 2NT1A 2IUZA 3GYCA 2J8GA 4ZE4A 4PRWA 2Y24A 2AAAA 1E6ZA 4P8VA 4V28A 3CHDA 1V3HA 1BPLB 3PZNA 5A3HA 1WDSA 3SURA 1AQ0A 1E43A 4AEEA 2F8QA 3AS2A 3K8MA 8A3HA 1MFVA 2VJXA 1JI2A 1JF6A 1E3ZA 2XSAA 4MB4A 4AXNA 1BHGA 2BY1A 3KEHA 1UR9A 3WDJA 5FCZA 2BVDA 5EB8A 5D4YA 2YDRA 2WYSA 5JBEA 1B3ZA 3SCQA 3HG2A 3AQUA 2W62A 2XUCA 1JXKA 1IT0A 3UG3A 3ZR5A 4MNLA 5CZKA 2EPMX 5JBDA 4Y7EA 1JI1A 4C7DA 4Q7NA 2W4XA 4NRRA 1OINA 2EACA 4EAMA 1UH2A 5GNZA 4LYRA 1BVNP 2QMJA 3RILA 1NP0A 1I75A 4PMUA 1FOBA 4F8XA 3T08A 1U2YA 2D3LA 1JNEA 2XM1A 3ZSTA 5JIWA 1N82A 3K4AA 2YFNA 2E9MA 1R46A 2ZWYA 2X8RA 4BQ5A 1ZU8A 2DH2A 1MWOA 4X0NA 2CNCA 3QOMA 2WZIA 2FHBA 1M01A 1HJWA 3ZSSA 2E9BA 3DYMA 5ABFB 4QLKA 2C0HA 5I6SA 2FH6A 2D22A 3PN8A 2WVUA 1JIBA 1E6PA 3BAXA 5HBFA 1E70M 2VT0A 4JFSA 3B9EA 2J7EA 2PWFA 1EO7A 1JFXA 1X6NA 3M07A 1ISYA 1UWTA 5A6MA 1EGZA 1GCYA 2PWHA 1O7DC 2OLHA 5AC5A 2IGTA 3VIIA 3W29A 1CXHA 3EJPA 2A3EA 1AVAA 4P7LA 2WKGA 1VAHA 2J8FA 3NCOA 1HWWA 4QLJA 2VX4A 4QP0A 2E3ZA 3EDEA 4M80A 4GKLA 4NZCA 3CTTA 3RMEA 1JXJA 3VM5A 4MDPA 2WB5A 1BYDA 3WH8A 1FFQA 3VSVA 3PHAA 1LL7A 1PAMA 2YBTA 3WNPA 1WO2A 1XD0A 1KQYA 1VIWA 1TQUA 3VIFA 3WY2A 3WDHA 3A4WA 1D2KA 1JYWA 1GOOA
chains in the Genus database with same CATH superfamily
1NAKL 3FEQA 5A94A 2ODIA 3D0VA 3QI9B 1NBQA 3MCLL 1DBML 4XE0A 4UT6A 5C0RH 2WSQA 4HK7A 4KVNL 4IQEA 5GS0C 4L3EA 1EIBA 1VKFA 1Y5VA 2R1YB 1TJIH 2E1DA 3O6FA 3LMJH 1LORA 3CFBB 1XG4A 3U6RB 5LBSH 1TETH 2YZRA 3X1GA 2VDMB 5BOEA 4IM8A 4HJWA 3K81A 4S1FA 2E6QA 3D1MC 3ARFA 1Z8AA 3S3JA 1RIVH 4JVUA 1A21A 2H6RA 4HG4J 2OLSA 4U6YB 1AH0A 1MQKH 2HX8A 3LPFA 4NWUH 4B95C 3MRQB 1W1A1 4P2OC 4Q7BA 1AS6A 4YHLH 4LPTA 1TTRA 2R1LA 2J6EA 4DJMA 1LUCA 2VABA 2EDKA 5C0JA 1IR2A 4OFIA 3PJSB 3QHZL 2MPAL 5DVNA 1Z66A 3VXRD 4JL2A 1V4YA 1JGLL 3B2VL 1U83A 4EPBC 3ZQ9A 3F2BA 1HHIA 3EWZA 1OHZA 5EOQH 3NQ2A 4QAIA 3V6OC 4E3TA 1J2BA 1JHKH 4R3SA 3R4RA 1DOSA 3AYVA 3UO8B 2C9AA 1E30A 2PXYB 2TSYA 3V0VA 3WJLC 3KYNA 3O6AA 3S4SG 4B0MM 5AL8A 5E8EA 5EU4A 4JQIA 4ZAKD 2IO5A 5CG7A 2I27N 3P0VL 3RCYA 1OG6A 1XC6A 2ATSA 2EVJA 2CLFA 2Y22A 4UT7L 3GH5A 1OSYA 4EZJA 1IM3D 4L8CA 1GONA 1QG3A 1X6LA 4O02B 2HLAB 4CCZA 4LVAA 2E9GA 5LGZA 3FXYA 3P2DA 2EZ0C 4GRLA 1H1YA 4OCWH 1GC1C 4LQFL 4H0HB 1L0QA 1A7RH 2N0MA 2V17H 1GYCA 4DI8A 4JPVH 4Y8EA 3RTQB 7PAZA 3W83A 4Z3JA 2JKWA 1YXDA 1HXMB 4YAQB 4FFWD 3JWDC 2I5YL 1XIDA 5CFHA 1WDRA 4GH3A 4N3UA 3BGMA 4PJDF 2O5XH 4RDVA 2R9HC 1BM3H 1O5XA 5D8JH 1NAMH 3UP6A 1ACYL 1ZLDA 3KXFB 4ZXBA 1N8IA 3AFLA 3QE5A 2VOTA 4GAYA 2PP9A 4YHOL 3GBML 2C3WA 3NCXA 3BLBA 3TZVB 2NMSA 3DSFH 4EZKA 1R7AA 3SO5A 2ZKXA 3PTDA 1ZHBB 3HC4H 4E41A 4JRWA 4PGLA 1Q9WB 5DXXA 3ATEA 2FBRA 3C60A 2VB5A 5AALA 2XPGA 3C5ZB 3KRUA 1JHTB 1NC4B 5AB3A 3CASA 4PTXA 4PMNA 4X98B 1REQB 1S2EA 1GKPA 2NZ1A 4A7TA 4F2MA 4JPQA 5AVYB 3UNDA 2GT9A 4HG4K 1GJPA 3GVQA 2XTLA 1GGTA 2BP5M 5IKCA 3MX0B 3NGFA 2W07A 1Z6KA 2DJ4A 3VIGA 1UWSA 4I8YA 1JV5B 3US1A 2HA1A 4O18A 3PQYD 1KIUB 5D7KD 1EK3A 4O9HH 3DGBA 2R0LL 2H9AA 2LLEA 4JIRA 1XZ0A 4D9LL 1F90L 5HDOA 4D72A 1F4YH 3V5FA 4QXIA 1E4XL 5F6HJ 3ARUA 1ZAGA 3ZDXB 4KK9C 4Q9RL 4QRTB 4NN7C 2A74A 4XZLX 5C2GA 3HI6H 4GUGA 2XIOA 1FL6A 3WIIL 2B3RA 5HGBB 2CHXA 2H6OA 3LRGA 5I3KA 4JG1L 2DL9A 4FFVD 2O61A 1ZNNA 5I0XA 3LB0A 5E9DD 5CJOH 2VCAA 5IFAL 4ODWA 5E94A 4XZ9A 3BG9A 4UU9A 3UTQB 3K7UA 3IMSA 5ANME 3LS4H 1A3QA 1VGKA 1ZIBA 1U2HA 3CIXA 5I3GA 2YD6A 4S3EA 3FDWA 1FBIH 1QLEL 4YGAB 4ZX6A 1PZDA 1GVQA 4N20A 3CPLB 4CUCA 3FZUC 3LEXA 4M6NH 3FFOA 4QRQB 3WJJA 2EUXA 2CO6B 2WLHA 3SO3C 2IQ9L 1W1YA 3JZUA 1JNJA 2YWYA 3B8UA 4Q33A 1UFGA 2BODX 4WJG3 3MHFA 3ECBB 4BJLA 5G4EA 3R2GA 3EGXB 5JW4Q 3UWQA 4EQ2A 2C6QA 1VPOL 3UF9A 4LHJB 4WHYG 3MRNA 3FO0L 4EI6A 1P43A 4JFEB 1A14L 3EXSA 4M93B 3U4EB 5A40E 1F42A 4P2RD 1QVBA 5I79A 2FJFB 4QTFA 5F3FA 4J5VA 4PTDA 4ZE5A 2Y25A 2WKOF 5D2LF 2PWUA 1TZ7A 2NX1A 4RV3A 1PVHA 4UAHA 2CJTA 1TMHA 2OL3L 4PJ5D 3N34A 3OKNB 1O9VA 1G6RH 3PPHA 4J4KA 1I7RA 3TA3D 3D18B 3D07A 1XYZA 2J62A 4L9XA 2VC2L 5GRVK 1MNUL 2OMUB 3Q6GL 3WQ5A 4I3GA 1TJRA 2ADFL 3BLLA 4IIQB 4RETB 4RX0A 2QGEA 4GUQA 4QTHB 3Q8FA 2XGBA 1V10A 2FT8A 3T0EA 3IS4A 4RFNB 5KYYA 5JHAA 2IPTL 4K4KA 4GK8A 1X8CA 3DDMA 2VDNH 4ZQNA 2IDCA 2FO4A 1KIQA 2P24A 3MI2A 1NC2D 3BWWA 3EYSH 3I6LE 2HCVA 1IWBA 3BE7A 2EXYC 3SJ3A 3UIZA 1NCAL 2MCPL 3TBSA 2DTML 2E6PA 4DJED 4BM7A 2UY6A 2WM1A 4OZFB 5CN1A 2PPCA 2WNKA 3UWVA 1BREA 3O2VH 2J5LC 2XZ7A 3FNDA 3TNMA 5ABGA 1Q6GA 5C09A 4OFYA 1MQQA 1GVEA 1VCBC 3P0WA 5F4WA 3LUTA 4W4QA 3T4AA 1A3LL 1OIMA 1DVYA 3RM4A 4Q8VA 1R3HA 3PV6B 2BSDA 2HISA 2R59A 2XQBL 2GTQA 4IS6A 2EYSB 4XMUA 4GG6E 1T8XA 4Y5VC 4K2SA 5FEZA 4U0RC 5EBLB 1TE1A 2OG9A 3RQ3A 2ICES 4NQCA 3LOWA 5IVXF 5CAYB 4MYWB 5KW9H 4MGGA 5FYLE 1GOKA 4TNVK 4P4RA 4H8HA 1KEGL 2HK0A 5EO9B 5IHRA 3EA2A 3ABZA 4KI5F 4UFHA 2FO8A 3DV4A 3MLVH 3OF6A 5CBJA 3CUHA 1T04A 3GHUA 4X5QA 3X13A 4YUEH 3GRGA 1YN7A 4WDIA 4APXB 3WE6B 4PJBF 1DLFH 4YSDA 2OQHA 1XCTA 1YYMH 3BKMH 1D9KA 3E2VA 3NAAH 5MI0C 3V9EA 2EXWC 1U4FA 2ZXQA 3BVVA 4BUHA 4Y4FA 3D12B 1FV1B 3P14A 1FWNA 4N24A 1W9DM 5HHPB 2DMBA 3GC3A 2D7TH 1B4JL 5D1XE 4WJ5A 4NHVA 4ODTL 4JHMA 5ALCH 4KWUA 4XN4A 1OFQA 3ULVF 3BFOA 4F5CE 3OJ2C 2XXCB 3LKOB 1IEAB 4P46A 4PLNC 3PDGA 4NZ5A 1SYVA 2FX9L 2PYEA 4PGBB 4DSYA 2DWSA 3KPQA 1U8IB 1J48A 1GS8A 3VI2A 3VQ1C 4IOFD 4CA4A 1GIGL 1OAZH 2WXJA 3QR2A 1E5NA 2NQLA 3N2CA 3FAXA 3L3HA 3O6LL 4ZX5A 4LSDA 3JVAA 3N42B 3T2NH 2IOMA 3A4EA 1WDDA 5MERA 2B4CC 4LHQB 4YWGH 1INEL 3WDIA 3GZKA 4JRYD 4S39A 4F33B 2OYKA 4P7RA 1B3WA 3HTLX 1DIOA 1FX6A 4QJ3B 2MCG1 1Q94A 1D2PA 1ZQ5A 4K3HA 4BZ1H 4CVWA 5IQ9A 2DY2A 1EZWA 4NI8A 3QJHB 3NG3A 5K9KB 4RZ4A 2ADJA 5E9NA 3FO9B 1I9EA 2BRRL 3WTVA 5FFOA 2HTLC 4Y2DD 5FKAB 4C90A 4F37F 1U8CA 4AIZB 4YEFA 3RL2B 2AC0A 2EYRA 4NAQA 5GGVH 2XQYK 1RHHA 1OTSC 3UCRA 2Z3FA 1H11A 1KGIA 2DDQL 4JO8A 2FCBA 1H5BC 4M9PA 5A1AA 4HC1L 4H9ZA 4APQC 3G6LA 1C91A 3SSGA 4Z7QE 3QS3A 1RZKH 1MCCA 3EJTA 2YUWA 4X4ZA 3QSTA 4IGBB 3HVNA 1S2CA 3MUAA 4LRIA 2C15A 1GOMA 4PGEA 4PJXF 4NBZB 3R7RA 2NSQA 1XDJA 3CTLA 2O5YH 1Q8MA 3N11A 5H2BB 4DEFA 1USQA 4YTQA 4XOCA 2VDIA 1RIUL 1X96A 5EZOL 5F2FA 1IBHA 3CZJA 4DP5X 4PRHE 4TV5A 1Z32X 1RCOB 4WJKB 3RHWK 2CGRH 3MLSH 4UT9H 4EDXB 1IE5A 4LSTL 1DL3A 5TF0A 5DMLA 3SGEI 1LWRA 1YAIA 1UKSA 3LLDA 2VWEC 2DFAA 3W38A 2O5NA 3RZCC 5I5MA 3QHFL 5INCA 4ONVA 3ELFA 4N4PA 3WXVL 4PP2B 3NFPB 2I17A 4CVZB 3MGOB 4Q89A 3ZL4H 3LKPA 5EU6D 4KK6D 1BTCA 2BBFA 3LN3A 5DHYA 2Y1ZA 1RCXB 4DTGL 2Z29A 3T1GA 2BY2A 3WIFB 2EAWA 3IDNB 2JB5H 4YDIL 4L1DA 2WVVA 4AC1X 4O54A 3DCPA 4PJ9B 1LP9E 1QO2A 4GMSL 4M3JA 1VPYA 4Z6AT 1I9CB 4HZMA 1VZGA 1NOUA 1TJGL 4Y9AA 2R2EA 3UTSB 1ETZA 4LKCB 1NBZB 2IAMC 1HU8A 3S1WA 5F2LA 3ID7A 1YBQB 1UVQB 5HVHB 1BZ8A 4I7ZC 1C16A 2XH2A 2HVJA 4K8RL 1PIGA 1JPTH 3L5XH 1Q0YH 3QZ6A 3AAZB 4PJ8D 4M1DH 2HPIA 2H26A 4KNSA 1HZHL 1MY7A 1G4PA 4XAWL 4GW4A 3ARGD 4QAMB 4IKKA 5L7XH 3OU8A 2JSFA 3SKJH 1SOQA 1HH6B 3EADA 3DIVA 4L2LA 1NSNH 4Z7QB 1GVYA 2BO0A 3VTTA 4WDWA 1S3TC 2IFFH 1D5IL 3CWGA 4XBEL 3P5ZA 1Y6MR 3VQ2C 3AIUA 1H7WA 1UD2A 2R2BA 1J96A 2DIBA 4M3PA 4MMZC 2WBJB 1DVQA 4DEUA 1BDYA 3M7FB 1FNHA 2LV4A 5C7VA 3W7JA 1VACA 5BW7A 1YHTA 4KFZC 3UR7A 3RGHA 4KPHH 1HJBC 2IG2H 2ENPA 4MDIB 1M7UA 1K85A 5BRPA 5DEFA 3NXLA 4XN1A 1N18A 2ODOA 3IIXA 1R47A 3ISWA 1FNSH 3ZUNC 4FR1A 1G4SA 3TOYA 3S9DB 2GLKA 4JFDD 1ACZA 5HD8D 1GVFA 2EKCA 4JN2B 2QUMA 1K9EA 5KTLA 4A39A 2DT2A 3UGVA 2KL6A 1IILE 1Y5WA 5IB1B 4RQQB 1DJWA 2EPHA 4ZUSB 2YO3A 3A4AA 4AC2A 3DV6A 2FFCA 1E6RA 3SDCC 2WWOA 5JHDD 1S9WA 3QUXC 3LPGA 4YEEA 5I74B 2FDMA 1CGTA 4DW2L 3V4VA 3TF7C 2OXHA 2J78A 5D71H 2PP1A 1K4DB 4NASA 1TENA 5E4IA 3E8UL 1K4CB 3RKDC 3O15A 4X63A 1KR1A 2CUAA 4NDMB 1TVNA 2BY0A 1B2YA 4NM4H 4TL5A 2VDML 5D1QB 4NQ1A 4U6HA 2B39A 1F61A 2BZNA 1MFCL 5FLVA 4FLQA 4JMXA 1T03H 1BZ7A 5AYTA 3MC0A 3PWLB 2H2SC 3HR6A 3ZJAA 4JFOA 3OOQA 1PE1A 2DBJA 3V1HA 1DQIA 4LCSA 1H3XA 4Q4QA 4OFKA 1NUFA 3BCJA 3HZKA 5EBWA 5SWUA 4MSWA 1EJRC 3QIUD 4PS4L 1EJXC 1SDAB 3MKGA 3IFNH 2G41A 4W8LA 32C2A 3OHXC 1GAFH 3CSYA 1OVZA 2YPKB 1JRBA 2V37A 4R7LA 1UKOA 4Z95H 4P5RA 1FLRL 2QJIA 3K3QA 2JWYA 1QSFD 1HEZA 1V0MA 5FF2A 5CN2A 3WF4A 4HBKA 3D39E 3WTYA 4OR1A 3P02A 3N41F 3NQCA 3QQDB 1NWPA 1JRHH 4X9YA 4MIMA 3ZIZA 2QSVA 3FCTA 4UFKA 4DPCX 5IQLA 3P54A 4FXLA 4B5EA 4C1KA 4PJEE 1RUMH 2BSBA 4Y2OB 4B2DD 5JIKA 3FTUA 1OCWL 4EXPX 2OT1A 3AWFA 3HHSA 4NJIA 4TXEA 2GEEA 3OJDA 1VBHA 3FFDA 5FGBA 4DJFA 4DP0X 4QXGH 4D9RD 4Q22A 4M7JL 1DPMA 4O02L 1XGRB 3WTSA 2GBAA 1X7IA 4X6BB 2PDLA 1FHGA 2X4RA 3BW3A 3AS2A 1UCTA 1MFVA 5JMOC 1JF6A 1IFHL 3QYCA 1LEIB 2ZXEB 4R9HA 3FOLB 2VZ3A 5D4YA 3MP3A 4EVZA 4LP4A 4JRXA 1RQEA 4UTAH 1EMTL 4MNGE 2BX5A 5GHWL 4EAMA 2ZDSA 2DQGL 3IPEA 1TJHH 3Q05A 1U3YA 3TW7A 4HBCL 1R2TA 3IJSA 4NZDA 4PIBA 5ICYB 5IQOA 3ZSSA 2OLAA 5ABFB 1FZJB 1AC0A 1VGEL 3VI4B 1KZQA 5IMMA 2C0HA 4PFEA 1UP3A 5DMIL 3PFUA 2VT0A 1GOHA 4O51B 3STBA 4L4TA 4DQWA 4C4KT 1GCYA 2PWHA 1BLNB 4GBXD 2F74A 2BJMH 4HWEH 1B2WH 1JUBA 3JVFC 1NCBL 1ETA1 4XNXL 4A8RA 3VOGA 2VX4A 3NIFB 2Y6TE 2EVIA 1XXXA 3MJMA 3DOSB 2ESVE 1HSBA 4LKXB 3HNSL 4K3DL 1AL8A 4G7VL 3TT3H 2PYFB 3WK2A 5L6YL 2NY6C 4GX9A 3GMRA 3S83A 3OG4B 1BZQK 1KYUA 3V0SA 4YOKA 3L1OH 1E15A 3QXAA 4H9YA 4NRZA 3S2JA 4I6KA 2A0LD 3QDAA 4Q4EA 3I10A 3COOA 3GDKA 3PBVA 3Q43A 1ITBB 1XLFA 1JS4A 1FN4A 5BW6A 1CDHA 3FN0H 3VXOB 2AJUL 3APFA 1D7CA 4N0YH 5J1SC 4M61B 5HSFA 1Z41A 5F97E 4BZ2H 3RWCB 1MEHA 1XUZA 1F45A 2WBKA 1ODZA 2NY3B 4ZZ9A 1WFUA 2WBWB 4KDVA 4GYBA 4KKCC 2HJKB 5B3JF 4WWKB 5CLZA 5CP3A 2ED6A 4Q8OA 2H6PB 4ZS6D 3ZTNH 3DVIA 3CNYA 2VH5H 4BFJA 4Z7OE 4NU7A 3QXDA 3EXTA 1MI3A 4B3ZA 3J2PA 2VXUH 4MNGB 1AR2A 5TGBA 3I75A 3IXAA 2ROXA 2FPYA 3E0IA 4Y2WA 1TQWA 2QQKH 1OL0A 2OMZB 5KYUB 4LUJA 1AQFA 3KLHC 3TA9A 2Z92B 2B16A 2JKXA 4I0PD 2HUEA 1Z2KA 3HZMA 4OT7A 4EPDC 3VFTB 4CVXB 2UWEB 3QUKB 2EP6A 2RJHA 4NC2B 2A7PA 1QFWI 2XN9E 3CZKA 1CICD 1T5WA 4WV1C 5FIPA 3MRBA 3UQNA 3OGOE 4TNVF 4G8TA 4LSPL 1JCTA 4LLMA 4N0CD 3H4GA 3U9IA 3M0LA 5KJRH 4RMUA 1ZA3A 2FH8A 1P1VA 3G5YB 3ECUA 4K7PH 3NGJA 2ESVB 3IK4A 3UZEA 4OZIF 4HNOA 4UOZA 3B1UA 5C2XA 3ARVA 3TCLA 1FL5B 4S1SH 4DPPA 4MCZA 1AYOA 4CKVX 3OTTA 4D0DB 4P04A 3HFYA 1LQ2A 1U8KB 3U36B 2PI6A 4FFYH 5D7IE 1UB3A 4IBQA 4JY6A 3URAA 4LEQA 4I89A 4M6OH 2TYSA 1XB3A 3GIQA 1KXVC 1FORH 3T3MF 3QHOA 3A9IA 1T5AA 4JTCA 2UY7B 1UMLA 1F41A 2XBDA 2Y36H 4K5OA 1QZ1A 2CYGA 1AG0A 3MRFB 3DRTB 2K6WA 1I2NA 4DVBB 1BAGA 3V4UL 1R5YA 4KK8C 5DHVA 4B97A 2YD5A 1U8MA 3P4MB 1O1HA 1PZBA 2VR9A 2HRHA 4PPTA 2EXSA 4G2AA 4KRTA 4XCFL 5I0ZA 5BVJA 5CEZL 3CVHA 4PSPA 5E8OA 3ROOB 4XBGA 3W9DB 5C07E 4W9JC 2N1TE 3GFZA 4AZBA 4YSAA 1YYCA 3SODB 3CFQA 2PW2A 4HGXA 2FZ3A 1E6XM 1DWJM 1SN5A 5IMKA 1XBRA 5FUCE 43C9B 1A02N 3LHPL 1NWSA 2R4SL 2ZPKH 1MI5E 2JF7A 4EAYA 3S5ZA 4LHUB 4JM2D 4PB0L 2V0TA 1WWAX 1S7XB 1AA1B 1I82A 2BNRE 4PB5A 3PNWB 4LANA 3FMGL 4JTLA 4W6WB 3BVDB 3SD2A 2V4LA 1VHNA 1F3DJ 2PUZA 3JUGA 3PWPD 1E50A 3ROLB 3FQ2A 1IGTA 4ONFH 4BGDA 2R69H 4MVAA 5LCVL 3MVTA 2X28A 4J2MA 1X5AA 2XVKA 4D6DA 3QUHA 1QWKA 3SY0B 4HDIA 3EOOA 3HNTH 4IOSA 5EF1A 4O1CA 1O5RA 3QQWA 4X6EA 2DJXA 2VGLM 4XAYA 1PJ9A 1PSCA 1T1YA 2OMYA 3MBXH 3NZGA 2YGOA 5T3ZH 1MW3A 3IGSA 5JHLA 3S8WA 3B56A 2PDIA 3X1NA 3UVAA 3VXUD 4HSOA 4IP4A 1OG0A 3W0WA 2MHAB 3DOIA 3TASA 1GUVA 3KBEA 5C0AB 5DJCB 1H8OA 1PVNA 1YNLL 2FIKA 3V52H 1M03A 5TH2A 2PTTB 3Q2NA 1PCWA 2J25A 1YNTB 5LB1A 2YAQA 1AH1A 4G7FA 1RP9A 1KCUH 3D5HA 3VZYA 2I16A 3M0KA 2OJZH 5EA9A 5E08H 1ZSHA 1EO8H 3NA8A 3RO6A 1SGJA 4CJ1A 4Y4HB 1I8IB 1GGBH 3JWNC 1P7KB 4L1BA 5E6IA 3TO4A 2YLHA 5EFFA 3V9CA 4AWEA 1TPDA 1S9VA 4ZQPA 2X4SB 2ZAGA 5C07B 3E6EA 4DBDA 1UH4A 5CPLA 2NCEA 3SKUD 4N5UA 4PB3A 4Z76A 2GSHA 2YXOA 1FCVA 2JJTC 4HHAB 1U95B 1FZKB 3MJ8B 1HDMB 2BVYA 5KZDA 1SM9A 4UFLA 5LXGH 4XBKA 4G9FB 2AQRA 1QNZL 1G7PA 4AI7A 4RXGA 4MYAA 1FGVL 2GIXA 4AZCB 1EAPB 3IGKA 1UD6A 4AV4A 3WUBA 2E7LC 1F1DA 1PTAA 3PGDB 3RFZC 3WTUA 3FKKA 2A2QT 5F4XA 5AWNH 5HQEA 3DMMA 3FT0A 4P3CL 4WSKA 5FYLL 2BNRB 2ZTJA 5DZJA 1J5OL 3S97C 5F9JB 4PW9A 3M5XA 1AGBB 3NQVA 2DZEA 4JQ3A 4WI3A 4BWTA 2YJLA 1AZNA 3L5WA 3PREA 4YTUA 3TR9A 3PZOA 1JNNL 3SZKC 3RVVC 2VDKL 3F7YB 1GZQB 2BMKB 5D5MF 4MJ2A 4GIEA 5DCCA 3F58H 1BQLH 1QHPA 3RJYA 1RUQL 2X0HA 2K0RA 2RMNA 1CDGA 2OJEB 5EWIL 1JWUB 4Q8PA 1R3IL 4PLJC 1JCVA 3DI0A 1OANA 1Q13A 3EHBC 3ALFA 3VXPB 3GG0A 2G3NA 1JPGA 2RUSA 3WUEA 1G7JB 2JB6B 4PWHA 4MZ3A 5AOKA 4CMMA 2A9DA 3CAKA 2QEJA 3M1ZA 4JFPB 2UY4A 3NZ8A 1ZHAA 4LF1A 3QH2A 4B0MB 3SDAD 1KLUB 1P0SE 3O3EB 1IAIH 3U9PH 1F4WH 4AQEB 2MQ3A 2P48B 4MNQD 5EIIB 4F8LA 4G5ZH 1RBLA 5FWQA 3Q2WA 1SN0A 3W9EA 4YXHH 1W0VA 3SJVE 3S35L 5I3FA 2YGNA 3HQOA 1GZHC 1IM9D 3PBWA 1LMIA 4X4KA 1N68A 5DJDA 4R7DB 3MUJA 3WMCA 4Q6IA 1YEGL 3NK3A 3CUPB 1FJ1A 3DWTA 4QOKA 1XAKA 4NUGL 1PIIA 2ACUA 3FYOA 1BGGA 5I73C 1KTLB 3BDYL 3ULVH 4KWSA 4W9KC 3PJNA 5CFAA 2F7IA 3L4CA 4M3KB 3B9NA 4MCYB 4OM0L 3ZT5A 5DHMC 4OAWA 3KFTA 3T3PE 4LCRA 2XU9A 3PHQA 4KQ4H 3MZGB 4GABA 5GGQL 2CLOA 5IROA 1USZA 3U2ZA 2I5QA 5A2AA 4KOCA 4EOUA 1P4LA 2B0MA 4LVNB 5GS1B 4FQHA 3T0TA 4B7LA 2PE4A 3F7JA 1IXOA 4U1MA 3HE7A 2ICEC 3UG4A 4ICMA 3IGHX 2A1WL 4J4PA 3ZKMD 4XPGL 2V33A 2ALRA 4AMAA 2APXA 2R39A 3U2OA 1QRNA 1FZMA 4PMXA 3QJVB 2HMIC 2EIDA 3RUGB 3IXTA 3D9AH 3X3FH 3IJ8A 3STLA 3NQMA 4G70B 3DFTA 1A7OH 4HS8L 1CGSL 2NR6D 1D7FA 4FYRA 5KVGH 3V7AG 4F7EB 1HWGB 4HT1L 3T0DA 3BN3B 3E6HB 3C2AH 4Q32A 4ZMVA 4RAUA 1SVZA 1K9TA 3NRFA 3H2CA 1N3NB 1KIPA 2Q2LA 3WO4B 4RK8A 2R29A 5KTEH 2HKHL 4G8AC 3B8VA 1X9LA 1KACB 1E6SM 2XXFA 3NOYA 4BK9A 4ODBD 1UWEH 2R2HB 2Z35A 3LBCA 3M41A 1POKA 3GMOB 4X3ZA 5SWZB 1OCNA 3TNBA 2DLFL 1MJJB 3QJUB 2VSKB 2F6UA 1I3RA 3ZYOA 3PWNA 4I9XA 3WEXB 4WLCA 5FO7A 1OTUD 4LS1A 1JYXA 1WAAA 1XRFA 3SJVB 2X7LA 5KZCD 4X6CF 3I4EA 3V2AR 3EO9L 4QO1B 1K2DB 2JIXD 1UOKA 4EVNA 1I8JA 3CXHJ 2H0JA 5GRJL 1A65A 4HFUL 2E1WA 1PV8A 3S3PA 3MXVL 4WW1B 1EGJL 3BVNB 5JZ7D 1F1AA 1PW3A 4PRIA 4YVPA 3FAWA 4JM0A 2W9LA 1IGFH 4RNJA 2F61A 4RMBA 3T3PB 3DFHA 3QPZA 4L1WA 3VFNA 1E27B 2BIPA 4PGJA 1BG1A 2YAPA 3BXNA 3GNPA 2VSMB 3H24A 1M9HA 4E5XG 3UADA 2YL5A 3L4ZA 4K5MA 3HAEA 3M5ZA 3BLOA 1INDL 2GQ8A 4F8PA 5JXQA 3VD0A 1KXTA 4HA3A 3UYPB 1XR8A 4YZFE 2EYTA 2N4IA 2XN0A 1RSCA 5HQLA 1AXTL 1ETJA 1FE8H 4X5WA 5F88B 1C92A 3C2FA 4JUTA 4U49A 2IKIA 1PL9A 4DELA 1I1XA 3FB7A 4G1EA 3GXNA 3OVGA 3FTWA 3WLQA 2G37A 2LABA 3TH3T 5IQ7H 3ZL2A 4LDEB 2AXFA 1WCGA 3KZPA 2J4WH 2F84A 2NLJA 3W07A 2ZG1A 3QJFB 5EU3A 3N4FA 1BRLA 4MB3A 4OUUB 3NJKA 2FGWL 4U3HA 2DVUA 1E6OL 3VDBA 4XO3A 1DXIA 2COVD 1YRKA 1R3YA 5KBKA 3F2LA 2FUTA 5F7DB 4N2YA 3QIWC 1JERA 1L9OA 43CAB 3G1AA 3VOCA 5FS5A 2YPLA 1J9YA 3B8YA 4YX2L 1MHEA 2J8UA 1ZCOA 4JN1L 2P49B 4UANA 4HXBL 4HA0A 3FT3A 2AEPL 3S36L 1L6YA 2XV2A 1WBYA 4AL8H 3RY5A 1BFVL 4R4FH 4B9YA 4HEME 4ICXA 1YY9D 3BYYA 3N4AA 2ZCKL 5DVKA 1QNPA 2VJ0A 1XRVA 1IVLA 5FJPA 3QDGB 1JZEA 5IG7A 5GIRB 3BUIA 5AVUB 3AU2A 5DS8B 4M9OA 3APGA 4M3HA 3QSKB 3QQ9D 3B40A 2XYCA 4OLVH 5A8GA 5A6SA 4UWQB 1AGDB 1XQKA 3NPXA 3WD5H 2PPAA 1YCSA 2JELH 5T5NG 1KFGA 1WITA 2NY2C 3L7EB 4DGUA 5H4ZA 3QCUL 1NLDH 2J7BA 4KW2A 3VD3A 3V1PA 1XIIA 5CJ8A 2E25A 2VNCA 2VFDA 4G6AC 4PUKA 3SDYL 1XZWA 4F8NA 1K8IB 3FB6A 3LD5A 3GMQB 4UQAA 1HS6A 2PKDA 2PCQA 2ALAA 1NCUA 3CXHK 2WK2A 3VMPA 1ZGDA 3N85H 3QEQE 4J9JA 1KBGH 3W2NA 3MWAA 2BDNL 4C6OA 3EXRA 4N0UA 1ZHNB 1I1FA 4HUWB 3HFFA 1DKWA 4PRNB 4JW3A 3I7SA 4GYKA 3MACH 5DD6B 2Y85A 1OP5H 3D6NA 4XOAA 3EYOA 4PUUA 4CQDA 1X5MA 4ZQCA 4IX0A 2C4XA 2YGVA 3ZE0F 4DUWA 5D7KE 5TFSH 5CBAB 5AKTA 3MRLA 2JKIS 1ZBWA 4ZZKA 4JK0D 5EBAA 3E6FB 1SMAA 1V5XA 1G01A 5CNHA 4O2CB 4ATDA 4KKZA 2JJSC 4UV4H 1TZHA 4U1GC 4ZEPA 5U4NA 2SEBB 3KWTA 4O58L 3BI9X 1V7YA 2IV8A 5E9DE 1KCZA 5IIEB 2ILLA 4IKLA 4BDVA 2QNEA 1JUFB 5C0FB 5EZPA 4I7WA 4JFZH 4QRPA 3WAJA 1TVHA 2IALB 3VXSE 2GABA 5K9JL 2VITB 3RZWA 4MD4B 5T1DH 5I1LB 1OP5K 4ACPA 2HJLB 3AICA 2HP4A 4NCC1 5CSZB 2VEGA 4PG2C 1ECEA 3KRSA 4DGVL 4F24A 1Q7QA 4OV9A 2Z2AA 3SCVA 1OEZW 2FR4A 1YPIA 1TQVA 5A2LH 5B8CB 3TFCA 4M0XA 3L9RA 4JTTA 3TWCH 1TMCB 3ENEA 2GCYA 1B4LA 3QFDA 4JDBA 5LDSA 1R0AL 2P10A 4JANA 4KUZH 1T4KA 4NQED 4P2RE 3OXSA 1DN2A 1UA6L 2G4FA 1MSSA 1K8DB 1GK8A 1XFBA 1V6VA 3QEQB 5D55A 1KN2H 4DXKA 1T20B 4Z7VE 1XCXA 3ZE1F 2GW5A 1Q6FA 4A05A 1J0YA 2ATPA 4KHXH 4FX5A 3PJUA 5JBFA 4MD0B 1SHSA 2YPVA 2WD0A 3WZ0E 4NO5A 4PJ5E 3FA4A 1N26A 3SUUA 4PW3A 1S38A 3HBQA 4XNUL 2CU9A 3B9KA 1CCZA 2VXVH 3TKFA 1MRDH 2WC4A 1HHJB 1NFDE 4EF9A 1A5LC 5C08A 5FYKE 4M7LL 1RMFL 2R0ZH 4NS0A 3VOIA 2WY3B 3B0PA 3LEPA 4R8WH 3MYJA 2K70A 4PTNA 1YNKH 5I1KH 5AB0A 4OLXH 3G8RA 1BECA 4WDUA 1H15A 4B5ZA 3CX2A 8FABA 2FPTA 5A6JA 3OVRA 1OM3L 3AB0C 2ZX6A 5IBUG 3TN0A 1GW0A 4X9IA 1V8HA 4KETA 1XIMA 4KRMB 1JNHA 4EIGB 1COBA 4FDWA 1BFOB 4Q8MA 1XC4A 4F3FA 1VFBA 3NP4A 3WDJA 3VXSB 2GQAA 3TH6A 3SPVA 3CEUA 4Z0BL 1M7PA 3UG3A 4RMTA 5DK0A 1NCTA 2OMTA 3KYOB 1M57B 1CYWA 3SN6N 2YXXA 2O7QA 1K5NB 5GSRB 3BTNA 4C56A 4UNTA 1JNEA 3ZSTA 1CDCA 5AOMA 1YEDA 3HB3B 3LN4A 1JZGA 3QQ4A 3NEEA 1NMAL 2IADA 4TULL 2WGNB 1WFJA 1FP5A 4ELMF 2XNAB 1HINH 3DUGA 5BMXA 4KTDL 1JFXA 5ADPH 3O3UN 1WXYA 1JDFA 3BPOC 4LAMA 1R6VA 1TFPA 2OJ1A 3VZZA 3ITTA 4A6YA 1OCOB 5IHBA 4HKPA 5GGSY 2F58L 4DP7X 2O30A 1R5VB 3SAZA 4WXYA 3BKCL 3VM5A 1BYDA 5CHNB 1P1XA 5AHNA 3S0PA 2LU5A 3C6LA 3JV6B 1VR6A 3DPDA 4O2EA 2Q8AL 5T1LA 2Y2YA 1BFTA 4J3TA 1V6YA 1C1EH 3BQUA 4Q8WA 1OP3H 3A3WA 2P88A 5IJCC 1X4XA 4AZGA 3KPNA 2HBXA 1ZZMA 4M7KL 1JVKA 4LRSA 2WCSA 1ZXQA 5IY5B 4K2UL 4JAMA 4YK4C 4CN4A 4MA1B 3V5OA 4KZCA 3LIZH 4UMAA 1QQDB 2WTPA 2MKLC 4YGVB 3SCMC 2Y7QA 2EGZA 2PCFA 2AXHA 3TW6A 1WVZA 1QX1A 3Q8EA 4BSVB 2XKSA 3UW6A 5BROA 5DYOA 3NN8B 1ZHKA 1CFMA 1QVOB 3WCYA 3RHGA 2BP0B 3AFBA 3BOLA 4GFTB 2Z7GA 4V11A 4LO9A 1P1ZB 2G4JA 1H7PA 4KNTA 4ZMLA 5ANMB 2PC4A 4UBDD 3GSVB 2OBGA 1HYSD 5ESQB 3NFNB 2EH7L 3QKEA 1AJ2A 4ANUA 3GHEH 5IFPA 4KV5E 4WI6A 4KO6A 1OP3K 2DQIL 2NYYD 4JEQA 1G9NL 4HAFA 2CLHA 4J2QA 4JFXA 3TEVA 1J8KA 5HYJE 2WWKT 4FI6A 5ESAB 3WTTA 4HETA 1T21A 3S96B 1KM5A 4MHHG 1AD1A 5JUVA 2VDQH 3O0RL 4N8CL 5GS0H 1BF5A 3Q1EA 4JD4A 4NKOA 1A3RL 4Q6JA 1W5OA 4S1RL 1AHWB 3HV8A 2O6EA 2CKRA 3TTOA 3W0KA 4JCWA 3MUUA 2FQIA 2Q3OA 3O6FC 1QUPA 2H4EA 3WY1A 4GIPD 4OJDH 2R1WB 1TPB1 4NZ4A 5I3DA 4F0MA 5TDPA 2R27A 4RE4A 2ZRZA 4J3VA 4PJFE 3AITA 2OZ4A 1KJ2B 4K55A 1R3TA 3ARFC 1MRFL 4WU5A 3DFOA 1NANH 2JKJA 4E9XA 4AYFB 1ED3B 3ZYZA 2VR4A 3WFEH 3RI5F 1D6EB 3GZ3A 3HUJA 5KS9A 3V10A 3VXQB 4X2RA 3CFUA 3QQ3B 4M81A 3RLVA 3U9UA 2DQWA 1BMZA 4C6MA 3DGRA 4RX4A 3T1FA 1ONEA 2KDGA 1JD7A 3TVMD 5BRZD 1NFAA 5DZPA 4Q8NA 1MLCB 5DQJB 2L7UA 3CPRA 3UC2A 2OR9L 5DS1A 5IHSA 2MFNA 5LG6A 1L7TH 3GI8L 3UERA 3UA4A 3E38A 1RIHL 5C0IA 2B77A 5KBNC 1P69B 1IGJB 1UC6A 1WAWA 3RL1A 4QAWA 1AYRA 2X5PA 5DUMH 3MWCA 3LQZA 4XPFL 1A66A 1N59A 1N64L 2J88L 3QDMA 4HK5A 5G5DA 3ZGIA 5CINL 1IFRA 4PTMA 3ABSA 2NY1D 3GH7A 3UXFA 3BQVA 1HKFA 4QGYA 2W6RA 4WU7B 5CH9A 4JQAA 1FYTA 1F86A 3ZKQD 6A3HA 4W4OA 3BSZL 4S3BA 2Q09A 2YZ8A 4FQ1L 2XHNA 3LTPA 1SZNA 1GC1H 5HYJB 2PP3A 1RVGA 3W71A 3BH9B 4F91B 5MENE 4GRLC 2DQHL 1P4BL 3JWDH 3WBWA 5ITFA 4B9JA 3QW3A 1R17A 3U0WL 3T2OA 5FCUH 4GG6B 2LFEA 3WNKA 4HPYH 5MEQB 1ZENA 5I75B 1REIA 4ZW7A 1W72B 1JK8B 3ZTJG 4Q56A 2VZ1A 2PP8A 4K36A 4GVIA 3ZZQA 3N25A 3TA6A 2V8MA 5B38A 4DZ8A 2CJ3A 2ZOXA 4XAZA 4PJCE 3KDMB 5TDOA 4ZXBC 1UQSA 2HT4D 4TV3A 3QY8A 4FQJH 1BGXH 3RVXC 4IRZH 1B54A 4XIMA 5HI5D 1V3IA 2JJWA 3OQRA 1KCKA 2D9QB 4JGJA 4BF9A 3BJ91 3A9BA 3ZZSA 1VPXA 3WF3A 4P4KA 3VFRB 1R24A 3C60C 1KRBC 3ELQA 4L3CA 2XY2A 1WTGT 5BZAA 3CL7A 3NCYS 1R1CA 5IMLB 2WNXA 1S3KL 3AY4A 1G7QB 3MXWL 3LTYA 4UQIM 1MVUA 4N2FA 4KJYB 3OPZL 4YXLH 4UUJA 1H9DA 3MROB 2NYZA 1MFAH 1TTQA 3UDWA 1YE4A 1ZVSB 4AC4A 3WYZA 5D1XB 2PCYA 2A6DA 1GS6X 3DUSA 3NR0A 4L5FH 5TQ2H 4GMTL 3SDCD 1MMFA 3BZFA 5TPWH 1D9EA 2WKLA 5DUBB 4L37B 5DURD 4JFDE 2V2DA 2Z64C 5D1ZD 4K3GA 3TVAA 5HNNA 2CKNA 3F05A 1KYDA 2A74C 4MMXA 5AKVA 1W1B1 1WX0A 1AZRA 4I7VA 3VFUB 1A5FL 1J8RA 4IT1A 2I9LB 4XB3A 3INPA 3K4WA 2X9WA 4LPXA 1U1JA 5IB3B 3SY1A 3W3BA 3GDRA 3LDBB 2KZKA 4NJAH 3FU7A 5JHDE 5MENB 3S5LG 5KSAD 2E9LA 4BWWA 2FZNA 5A7BA 1GA2A 2F7OA 4YHYC 4DUVA 1LXMA 5FKPA 2L0DA 5ENLA 3VRIB 3I7RA 5CEYA 1TPVA 1VB9A 4ZMNA 3QTGA 4NO0D 2H47C 1BD2A 3IVKA 1HNFA 3ARDD 4YSTA 2XN1A 1IGWA 5IBTL 5CJNA 3BZEA 3WJJC 2YXWA 1JOIA 3UJTH 1K8YA 1CQKA 5CPMA 4TOYL 4DKEH 4WD0A 1J8HA 3TJEL 4ZPTB 3Q94A 3B2XA 3ARGB 3QH3A 4KX7A 2F54D 4M6MH 2ZUMA 1JGUH 5IJBC 5T3ZD 5LJYH 2PF6A 4EIVA 4WVRA 2Q7YA 4XO5A 3THDA 2QLYA 5MEPB 3UBXG 2NXHA 4Y5YC 2P7TB 4AIXA 1ND0A 1ZGLB 4AAJA 1NP2A 2JI1A 4FG6D 2DZWA 4Y4KD 5A16B 5IVZB 3PDOB 4TN9A 3BV7A 1SO5A 1XF2B 1QSFE 4WEMB 4FMKA 4RZ6A 2AITA 3VXGA 2D73A 5LZLA 1BJ8A 1I1CA 5F4SA 3OG2A 4GO8A 1O5DT 3FRPB 1UD5A 5DK2A 2KZ1B 5HHOE 2XXMB 3ISIX 2C9XA 3O9WD 1UD4A 4PRHB 2J3SA 4WHTA 1KB5H 4L8BB 3E2RA 4KQ3L 2ZAHA 2OSLA 5T3XL 1E9QB 4PREB 4HKBB 5FO8B 4PYSA 5HDRA 4LCIL 4LSRH 1KFAH 4GI8A 4CGTA 3CM4A 3T0EC 4ILDA 2HKFL 5M94B 3JTTB 1H49A 2QL1A 2WPGA 2IF7A 3M0IA 3CNKA 5HWNA 4E9YA 3TJ4A 5LNWA 2QGDA 5FK9B 3FKUS 3LZLA 1NFBA 3ZWTA 1ORSA 4GW5B 4M62L 1OK4A 2Y7DA 1FAKT 1LP9B 1IEBA 2GJPA 4I9WD 2V7NB 1Z3GH 1N5AB 2DSUA 2I26N 4M19A 5E1AA 1KTRL 1FG2A 1UROA 2V63A 5GGSA 3QCVH 2DQUH 3ALWA 4DBSA 1M6OB 5GJTH 4NF7A 4EAEA 4AGLA 3I74A 3T4AC 3HN5A 1PKNA 3UYRH 1YECH 5EU5A 4QHNB 2B2XL 3V4PH 3MQIA 2WSKA 3DVGA 4Y16D 3VVWA 2HPTA 2ERJC 3QR0A 1EJ7L 1HCYA 2V3EA 1E1CB 4KI5D 4M5ZL 1E9OA 1A4JB 2NW3A 4AGOA 5HANA 3MBEA 5EO1B 5DJXA 4ODUA 3THAA 4JGDA 2DQJL 3L3IB 3ZKNC 3D25B 2QCLA 5DZAA 3LGDA 2QMKA 4PA8A 4FABH 4MAYA 4YDMA 3G3DA 5HNRA 4P23D 2HT2C 1UCWA 3PFQA 5FJRA 4A66A 2AZAA 5PCYA 1QSFB 3HR5B 3BJFA 3G1YA 2GB2A 4KO9A 4HIHB 4XNYH 1XBYA 3QORB 1Z48A 4HZ6A 5F2MA 2WC3A 1PG7H 3HE6B 1BQHG 5HHOB 1L2UA 1A7PH 4IBTA 3M88A 2XY1A 3MLTB 5ICXB 1KTBA 2DT1A 4HTYA 1FTXA 2VWTA 1JTOA 4MHHI 4FXKB 1D9KC 3IJQA 2J21A 1YMHB 3JV4A 3Q67A 2KH2B 3LTVA 2V2WB 3VFMA 3WLOA 4N7QA 2QPUA 3P4OA 1ACXA 3ULSA 4GISA 2EC9U 3GS7A 2C4FU 2YUXA 3MLWL 4Y4FC 3ULVD 3PL6B 4I88A 2G3IA 3TJHC 1AGEB 2C91A 4AF0B 5I8KH 2DYPD 1JPEA 1Z5YD 3LAFA 4KRZA 4DM2A 4EPEC 4Y5XB 4P2VA 5FJJA 3KLHD 4HIQA 5E4OA 1TO4A 1WKDA 5BZWB 1C5BH 3IETB 1Q9OB 3E2HC 4P46C 4E4UA 1A4LA 4FX7A 4M8UA 4CDHA 4P99A 2Z1PA 3I2CH 4C4KO 1LDCA 4L8SB 2B4CH 1NMBL 2DQCL 2PDFA 4MF4A 1UM6H 2QR0B 3TTEA 1OSZB 1OD9A 3GLDA 4RE2A 3C0QA 1LO4L 4BFFA 5K7JA 5C9JA 5GRYA 2E4TA 4E5XA 4Y1AD 5AVWB 1YEJH 3A13A 1IGYB 4RXFA 5CCJA 3BW9B 3DVFA 3R1GH 1CPUA 2VZSA 3L3DA 3RG1C 2Y8KA 1XLAA 3NRQA 2WN3A 2JFEX 4YSSA 2X0SA 2BFVH 1WZ1H 3VKJA 3W6LA 4IMLA 3F5LA 4NP7A 3GDBA 3KDOA 4NYLB 4ANWA 2X4OA 1JDAA 4TM9A 4JY4A 2CFFA 3DVNA 1TUPA 3ULUC 4HHLA 4I48B 3MLPA 2Y63A 1ASOA 1RLWA 3D39B 2E7FA 3V0TA 5BQDA 1N6QH 1LBMA 3EO0A 5C97A 4YHGA 1KIRB 2CUHA 3FCUB 4RE3A 7FABH 2GUYA 2IOIA 1XF0A 1VC4A 3QULB 4LRIC 4PJEB 5JR1H 3UNTA 4UTBL 3ZO9A 1I2PA 1LO0H 5LBVA 5FA4A 3DGGA 1AR1B 4RJEA 4MS8D 4NRSA 4DX3A 3JUZA 3HPZA 1GGCH 1OTTD 1PGRB 4CW1B 3MLUL 2AJYL 2EDXA 3ZDZE 1T41A 1GTHA 2UZXA 3VCRA 4XC3L 3EJYC 2WQXA 1G69A 4TQTA 2YD4A 4JKMA 2P5WA 4B3LA 4YVNA 3N2BA 3ORJA 1RUPL 2DUXA 3PIQA 4PV1C 4LH8A 4CMHC 4NGHL 5J4MA 3RWEB 1BQ5A 3W84A 1S8DB 4HNVA 4ZO9A 3V0HA 3N6HA 3VD5A 3RWDB 1VD6A 3WLKX 4OF5A 2GVGA 2XKNB 4HCRL 5AHEA 5E8NB 3HMJG 1TIWA 1XYLA 1L5GA 3FF7A 2WJ5A 1XINA 1SHXA 3WNLA 3VD4A 1MVFA 4I0PB 4P5KA 1GKQA 3TWBA 4EI5D 3ZKSD 2QAFA 1VZWA 3ZJ7A 1ZGLM 3I6EA 4IOTA 2V5JA 1IGSA 1FO0A 5JXEA 1OGTA 2EEFA 9XIAA 4D94A 4JEJA 5DJ6B 2AHIA 3HKZA 4JG0H 5PAZA 1KEML 2ONEA 5AVQB 4F1ZA 1QWGA 4NT6B 2CW6A 2QQQA 5FHBH 3I02A 1OAXH 3PWPE 4NHCL 2Q86B 1QI0A 3R25A 4WY0F 1BOGA 1QSZA 4FQXB 2XZAL 4WZHA 2O93L 1OW0A 3EWWA 1H6FA 3S4SA 3WUGA 5DWUL 2GTWA 3UU0A 4RE0A 4U1NB 3A5FA 2PDQA 1MREH 1S46A 1V7MH 1ZK9A 1RZFL 3W1TA 1JXDA 2A6KA 4I13B 1IEHA 5FYKL 3GG1A 2IH1B 3RU6A 3WTWA 4Y96A 4MASA 3BVTA 3MLYH 4ORGB 4FTVD 4HJ1A 2WLYA 1P5VB 2GJLA 2VOMA 3MRPB 5D7JA 5LGJB 3IDJB 1AHKA 2WTRB 1HP4A 2ZE0A 5ACZB 4KIEA 5SX4I 4Y0GA 3V5CA 4AX7A 3ZDZB 4OCLC 2XWTA 2ZDRA 4KAQH 4ZSTA 2JGYA 3KE0A 1NUDA 2ORBL 2ZYIA 2HVKA 2EXOA 1MCEA 3DX7A 4MA7H 2PTDA 7REQB 1WT5A 4FFZH 2YARA 1I9JH 3ASWA 5E99H 1A1MB 2FLRT 2BNQA 2G9HB 2WVTA 5CM1A 3L1EA 3L3KB 1AZCA 4BFOA 1Q3NA 1S7SA 3QYMA 3BAKA 2QTEA 1H09A 4PS3A 1BAFL 3GZPA 4Z7OB 2ETWA 3H0TA 4WF7A 3UBXI 1QOPA 4YLBA 4AEHH 4HD9A 3W7KA 4KXCA 1CFVL 2E5BA 1LLZA 3VA6A 4X7TA 4GLRH 1H0IA 3BW4A 1HKWA 3DXAA 3W74A 5IK3B 2FB2A 1ZSDA 3PWIA 1SLVA 4OLZL 2DW6A 1E67A 2X1UA 1WXJA 3EPNA 1S9XB 3NSYA 1XIWA 2Y6SC 1D5RA 1G4MA 4LYQA 1DQTA 3GKAA 4FN0A 2PTXA 1ZT7A 2XN9B 2Y5EA 3U9WA 3OYXA 3FNKA 1EWHA 3EGSB 2P26A 3GMLA 2EXTA 2WJZA 3TNNA 4QG6A 3CFJA 1EHLH 5F1IB 2J71A 5E8PA 3KS5A 1KRMA 3QV6A 5EZIL 1KJ2L 2ZOTA 4EWND 3II3A 3VNIA 2RGSA 3EOYG 3HZVA 4XXCA 2OVLA 4I2XA 3VGAB 4L29A 4ROPA 4ZE4A 2J8GA 4PRWA 3FSZA 2HFEB 3BIBX 2DM2A 3IKCA 1FH5L 1E43A 1NGWA 1JWMA 2CU0A 5F0MB 3KG5A 2VXQH 1NTDA 3KEHA 3M47A 1U5HA 4PY8I 3QIBB 2WJFA 2YDRA 3GJFB 4A04A 3IDXL 2FMNA 4AJ0A 3NYKA 2DICA 4WKXA 5D9SA 5D7IB 4IEFA 5FM4A 4JEGB 3ONBA 1OK0A 4PMUA 3OZKA 1ID2A 3HTWA 5D02A 4D8AA 1E5CA 2C13A 3TQKA 3BPLC 4IFOA 4MNQE 1BOYA 2W0FA 4XP4L 4EN3D 3KPSD 4LNCA 1P2CA 3SFKA 1XGYH 4ETQB 2JVUA 2FH6A 4OGQC 5CS7A 5HATA 4F57L 1D6VL 5E6SB 1RK5A 4CNIB 2X89D 1TTPA 2P5EE 1MJ7H 1CXHA 4G6KH 5LGYA 5FGBC 4ES4A 1TZGL 3TXZA 4DJFC 3UA3A 4NSKB 3G5ZB 1KCRH 5GJMA 1WOBA 5KVFH 4HPJA 4WW2A 3DG6A 3CG8A 4E2VA 4O5LL 1JXJA 1NJJA 4GXVH 1J5TA 1BVLB 3VCLA 4U1HB 2AQTA 1WO2A 1F3DH 2C3VA 4JZJB 1X7QA 4HPOH 1DVTA 2JH2A 2JQAA 4JFFD 4R27A 1SYSB 4DQOH 5SWSD 1GVSA 4UV7H 4DUXA 2WLZA 2OX5A 1ZWIB 1IEQA 1WIUA 3IE9A 1S7WA 1W72L 2Q76B 1MI5B 4HTBA 4GKZA 1GQJA 4X99A 3HFML 5JW5A 3S5OA 1QDSA 1FHDA 2VEIA 5AOIA 4YNYB 4LBSA 3FQRA 3NIDE 1C12B 4JDVB 4LCQA 4H26A 1X5YA 5IEKB 4JO1L 4CU6A 5DJ2A 2LFGA 3L1GA 3EB3A 4PUEA 1OB1B 2W65A 3QFEA 5LKNA 4ZCWA 1KB9J 1GT8A 3BVWA 3PB2A 4M02A 2EDLA 3B37A 3G5VB 3UAEA 5JQIB 4ZUWB 2NSOA 3URNA 3MO1A 3T2PA 3IPFA 1X4YA 1ONRA 2B1AL 4J6IA 3QUYA 4ZBCA 4NP9A 4LOUD 4PBXA 4NT0A 3V4BA 4S3FA 3LCFA 2OTDA 1A8JH 4EUPB 5AUMA 3RNKA 4WK4B 1AJZA 4E0CA 3WN5A 1VBGA 4RFOL 5CIPA 2XINA 1S7UA 3K71A 3GRWH 1KFEA 3RWGB 1V6XA 4DF1A 3WD2A 5CWSB 3FUMA 3WF1A 6REQB 3IV3A 1QI3A 5JO5B 2AKRA 3AT0A 2VC7A 5F1VA 4TMBA 1QOQA 4K39A 1GSKA 2DM3A 2GBTA 5CZTA 3HG1A 1BYAA 2NW2A 3IUDA 4OCYL 4C4BA 2YQBA 2Y7FA 4JO4H 1TQCB 1MAJA 1M7JA 4BFKA 1QR1A 5M17A 3OIHA 1ZS8A 2P5EB 5EEWA 2QKIA 3LN5B 2WZAA 3OJMB 1IQWL 2KI6A 1F9CA 1GVRA 3FXGA 4XCCL 2O9RA 1G6RB 2HBVA 3TT1H 1G7VA 1WKEA 4IOIB 5FF6A 3MCKB 1F3RB 3BZGA 3OSVA 4HJJL 2OULB 3SBRA 3FULA 3OWEA 4XNZC 1MWAH 4W9CC 2RGMA 4PHZA 3RI5K 5DLCA 4OGXH 4M4RB 5IB2B 3LZ5A 3GSRA 2C9QA 4HUUB 1ROCA 2A9NH 4MA3A 1JHLH 3REVB 4NQSB 4GCAA 5I1IL 1QTPA 3X17A 1IGML 1SDDB 2YOCA 1FA4A 3B03A 1JQXA 2XV3A 1BYPA 4JX5A 5DFVC 2LT9A 3UJIH 3QB7C 1IAMA 1KW1A 2FEDC 4HZ7A 2VDNB 2QDVA 3NIDB 3NPVA 3QEUB 3QDJD 2CUMA 4PUBL 3ETSA 5DQ9B 1TTFA 1Q0XH 2DI7A 4DAFA 3UZWA 2G2PA 4MA8H 4A55A 2AJXH 4A8LA 4JPWL 3SO7A 1MRCH 1XH2A 3MUIA 3LCGA 1MCIA 4XP6L 4DN3H 1SFLA 3ZTEA 4IRSD 3H53A 5IHHA 3T4CA 4E0RA 3PTKA 4DI9A 2NQHA 5DZ9A 4TQHA 4XP9L 2DMHA 4G6FB 4OVXA 5GJSH 3NTYA 3F04A 3W25A 4F2TA 2QIIA 4L61A 4JO5A 1R3LA 2Z1XA 1ZTVA 3UZEC 5GS0D 4FNPA 2R0WH 1JNLH 4ELDA 1WBXA 2XVPA 4IL2A 3VM7A 2DU2A 1TSRA 4OQVA 1G9ML 4PGDA 1QTSA 3P8IA 1LG2A 3TBVA 3RNQA 3KZ8A 4LIQE 4RDZA 3QJRB 4PMZA 3RDTB 2CO7A 2JI3A 5AZ2L 4JTDA 2CLIA 1AGFB 1P7BA 3TBYB 1CXFA 4OB5H 1CLYH 3ARZA 4MJ6B 1TVPA 3LH8A 1BEUA 4HK3N 4LARH 1MYRA 2L7JA 3WDPP 4P2OD 2UXTA 3GSNA 3CQKA 2PO6B 5KYXA 1J1PH 1I2OA 3PUEA 1B3VA 3IDYB 4HX1B 5ISZD 5MKGB 4G6JH 4N87A 3QO1B 4GFIA 1HXJA 4JDZB 1QSVA 3LKNB 5GJPA 3LGGA 5I24A 1U8PB 1KCVL 1TTCA 2AV1A 5IV2B 2E9WA 2A9CA 4UM9D 1TR7A 1HKVA 1H4PA 1NLBL 5LXXA 4LBAA 2XA8H 5DVMA 2XZZA 1L8NA 3P82A 2RFXA 3LQMA 1R2RA 4IU2A 3RLGA 5LIWX 4JMNA 1KTDB 5HYSG 3SYPA 4AK2A 4F7PB 3PUDA 1KT2A 3VXRE 3QZWG 3EUUA 1R9XA 4P5MA 3SPJA 3R6IA 3OJGA 5ETUB 2ZKHH 3DEQA 4OQTA 3CCHB 3LKSA 1R3RA 1TIUA 2PC8A 3X3GH 2F8VA 4KCTA 3O3AA 1N7ML 4XR8C 1D7KA 1EB3A 1BYCA 4GBUA 2D0GA 3N40P 1TQSA 1I1YB 2R8SL 3LNFA 1BXAA 4DPBX 2EZ0D 3GSOA 5AW1B 2GG1A 1UXWA 2X88A 3WBDA 2QF7A 3L9EA 3PZIA 3KLLA 4KRPB 5A8QA 2YKKA 3U2SA 3DKLA 4ZSUA 1FPTL 4Y9NA 4BSWA 1HF6A 3GKZA 3AG4B 2R9HD 1EP3A 3PAUA 2NUPA 4URIA 3LERA 2OJPA 1WZAA 1RK0A 1NBVH 4PR5A 1L8PA 3EYUL 3NEHA 4D0BA 1KENL 2BZDA 1W16A 4Z78A 3RX3A 3GPEA 1OCJA 3WQ8A 1V55B 4YNGA 3D09A 3DLQR 4N1EA 1T8QA 2X1IA 4H5SA 5IOBA 4HK0A 1MLBA 1EVUA 1R9ZA 2OXGB 3CQJA 2NDGA 4IF2A 1DN0B 1T89A 2Y7GA 1GL4B 1WC7B 2H2PC 4IJRA 1MXDA 1B5TA 4EBQL 1OAKH 1T7XA 1SJAA 3WLHA 1IL1A 2NWSA 4HZLA 3ZHNA 3JWNH 3QY7A 1LNUB 2OODA 1TX2A 2RAMA 9RUBA 2H6UA