4UQBA

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.68 a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
total genus 135
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uqbA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uqbA02
4WKFA 2OSXA 1FHDA 4PCSA 2WANA 1JGIA 4MADA 3CMGA 4FMVA 1M53A 2ZXQA 3CTTA 3WUFA 2V3FA 3AIBA 4AD1A 3WQVA 4AIUA 1UD2A 3KL0A 3CUIA 2YFOA 2CETA 2D20A 3GXDA 2J7DA 5A3HA 2CERA 4N0RA 5ABGA 3W6MA 2XJ7A 2XM2A 3BVXA 3QOMA 4CKQA 2DT2A 4FLRA 1KXTA 3AIRA 1VBRA 4M80A 1WZMA 1J12A 5CPTA 1H3GA 2GJRA 1JYWA 5DF0A 1ECEA 3GM8A 4CCEA 4IPLA 3ZSSA 2CCRA 3A4XA 3VSTA 2WVSA 3MUAA 3CBWA 2WMIB 4AD0A 1X6LA 3WNLA 2XPKA 4UCFA 1E70M 1MQQA 2VX4A 3POCA 3CUHA 1TCMA 2WXDM 5A8OA 2XIIA 3T09A 3VINA 5GPRA 3U5YA 3BC9A 3QR3A 3NDZA 2WK2A 3WDHA 3WD1A 3BAWA 3WMCA 4C7GA 1EDGA 4FLOA 1DWAM 1GW1A 2G3JA 3AS1A 1BSIA 2NT1A 3WEMA 5A8MA 4AC1X 1S46A 2WSKA 3VDBA 2GDUA 3FY1A 1BG9A 2V5CA 3M6DA 5LA0A 1UR2A 4OGZA 3ARQA 1RPKA 1A3HA 2BHYA 1UUQA 3VD4A 1GOQA 2ZUTA 2V3GA 3WIJA 1BYAA 1UQYA 1H11A 5BXPA 5A69A 1IZKA 1UKQA 2OSWA 2GJPA 1JZ8A 3A5VA 3WDJA 1W1TA 4MTVA 1CYGA 3G6LA 3WUGA 3VIFA 3WUEA 1TZ7A 5I3DA 4PEEA 2CKSA 3GH5A 1HJSA 3HG2A 1JYNA 4J3SA 3UR7A 4WJXA 1SFSA 5LA2A 4GQQA 3MMUA 3VO0A 1TVPA 2EPMX 1W3HA 2AMGA 3B9DA 4PMYA 2Q8XA 1VEOA 4NZJA 4EKJA 2Y24A 4Z2GA 1XYZA 2EO7A 1UR4A 2ZXDA 2YDQA 3T2OA 2WAGA 3MUY1 1QI0A 2WZIA 4AZ7A 3BAXA 2JE8A 5D8ZA 1HVXA 4MDPA 4B3KA 2WNWA 1GOKA 2OWXA 1JFXA 4MAZA 4AZIA 4PTXA 1K9FA 1QHOA 1QNRA 2J47A 3O9NA 1J0JA 1XSJA 4MNMA 1JZ7A 3MSGA 1LWHA 2VO5A 2XWDA 5M5DA 4B9ZA 1O7AA 3WEZA 2C7FA 5GNYA 1H41A 1CWYA 2QMKA 2V38A 1CGTA 5E0CA 4UQ9A 2W5FA 1BPLB 1JNEA 4RE3A 2PWHA 4CCCA 1UR0A 1E5NA 3ZT6A 1CDGA 1W1PA 3AIQA 1LLOA 3WY4A 1TQUA 5BCAA 4KRTA 4HOWA 1PPIA 1LG1A 3UESA 4PUDA 3VMOA 4HA4A 3CZJA 4W7UA 4ATLA 1VFOA 1UR8A 2DSVA 2BY2A 2FDMA 2YOCA 5E09A 2VZOA 1GPFA 4HOZA 1HTYA 3VU2A 2WVTA 1BTCA 1C8XA 4DM2A 1PZ2A 1HT6A 4TTGA 1ODUA 4M24A 3RILA 1C93A 2IUZA 1BVZA 4PMVA 5D9NA 4AYSA 1LF1A 2W63A 4QDMA 4QLLA 3MKKA 4L4OA 5EB8A 4W93A 4RL3A 3EYPA 3GXIA 3TTYA 3AHZA 3AHYA 1E72M 3GXNA 1WKYA 1B31A 5CLWA 1J18A 2VURA 3FHQA 4W7VA 1EHAA 4A4AA 2WW5A 1UD3A 2VJXA 3SCPA 3NSNA 1B3VA 3SUUA 1VBUA 4U3AA 2V3EA 1ZBCA 1HJQA 2GVYA 4DWSB 2GUYA 1PX4A 3OZPA 2BVYA 5M3WA 4QAWA 1OSEA 3VIPA 2NSXA 1W9DM 1GORA 1OD8A 4AZ5A 5FCZA 4GI8A 4M56A 1E6QM 3NIYA 5LA1A 1WZLA 5CGMA 2EBNA 3OLDA 3WQ8A 1VB9A 1L0PA 2F1BA 5GNZA 3AYRA 4UFKA 1AVAA 2ZUNA 1TQWA 3RJYA 4A3YA 3HN3A 3MSDA 1PEZA 2OW7A 4H8UA 5JIPA 2RGLA 3IAPA 2PB1A 5A6KA 4AMCA 2ZE0A 3GH7A 1J0ZA 3AIWA 4P8UA 2XVGA 4XZWA 4W5UA 5BXSA 2FE0A 1JYVA 1ZJBA 1FHLA 1ZJAA 1J11A 2VT0A 5M17A 3BVUA 3WDIA 5I6SA 1OB0A 3VILA 3W37A 3AZSA 3D3AA 2WPGA 3E1F1 2WHKA 1E40A 1LG2A 1UD4A 1JD7A 4J3UA 1JDAA 1E5JA 4UFHA 2VRQA 1EO7A 2WZEA 4GO9A 1PX8A 3L4WA 1UWQA 1ITCA 4PMQA 4QCEA 5JBEA 1DWJM 1QI4A 1OBAA 2C8NA 6A3HA 2J74A 1ZS2A 2QLYA 4CN1A 4AEEA 2BHZA 2XGIA 4KGJA 3WF1A 2OSYA 1CBGA 1FA2A 4MNJA 1BVNP 2A3BA 2FYVA 1CEOA 4GZIA 3BLPX 3SCQA 2VOTA 1BFNA 3N13A 1UKTA 2NT0A 1ZBWA 1EIBA 2VUYA 3WBAA 4KWUA 3L2LA 5I79A 3PZGA 7A3HA 1KXVA 1L8NA 3DX2A 3WELA 2O9OA 2WHJA 8A3HA 2WVVB 3FAWA 2WBGA 3ALGA 4MNKA 1KQZA 4PMNA 1E0XA 1W1YA 1WDSA 4R5EA 3RM8A 4PMUA 1JNDA 1V6UA 1CZ1A 1E6PA 4WIWA 5HPOA 1W9BM 3UERA 2DEPA 3MS8A 1G94A 2HISA 3N15A 2VTFA 5CZKA 1W2VA 5A6SA 1NARA 5A6JA 1WCGA 4M1RA 5ABFB 3KL3A 5D9OA 3EJUA 2EABA 2VCBA 3II1A 3BSGA 1MQRA 3DYOA 4QLKA 4TVUA 2GFTA 3FN9A 2D0HA 4CD5A 4J3TA 3ZO9A 3WNMA 5JIWA 3ALFA 4ZENA 4CGTA 3TTOA 1U30A 5AY7A 2ZXBA 3A4AA 1K9TA 5JUVA 3AMKA 1I1WA 5A6LA 4KGLA 3CZGA 4DWSA 1OWQA 5E6YA 2E0PA 3EDDA 3FXYA 3AJ7A 1RH9A 3KLLA 3ZR5A 1EHNA 1V3LA 3HG3A 3GH4A 3KL5A 1TMQA 1LQ0A 1UQZA 2JIWA 1UKOA 1OD0A 3BUPA 4V27A 4MJ2A 5DMYA 1E71M 3VIMA 1NOWA 5HDRA 1JD9A 1IV8A 1WB0A 7TAAA 3U7VA 3CLWA 3PHAA 4U3CA 2BNJA 1G9HA 4OJYA 4WKHA 2YA2A 2DGAA 4P8XA 3EJSA 3LRLA 2W67A 3KEHA 2FHBA 2JFEX 4J3VA 1R8LA 1HJVA 1GQLA 4TVDA 4HU8A 3W25A 4V2XA 3ARVA 3A6OA 3WH6A 4UNIA 5A94A 2DDXA 2QMJA 2EEXA 4UQCA 2VVNA 3IANA 1NM9A 5E70A 4CUCA 2OYKA 4P8VA 1UWUA 1QW9A 2QF8A 2BXYA 2YL6A 3DHUA 1EO5A 3CHCA 4MB5A 2WC4A 5DEZA 1OCQA 1KXQA 4HU0A 1QW8A 3AICA 1NWTA 2F18A 3DC0A 1KTCA 3VGDA 4DWSD 1WNOA 3WH8A 4LYQA 1UA3A 1JIBA 2CHNA 1CXFA 3CH9A 4XZBA 1LL6A 4D6DA 2E9BA 1KWGA 4TX6A 3CHEA 1E4NA 4XUYA 3VOCA 4ACZB 3WQ4A 1CTNA 4CCDA 1PZ3A 1CIUA 1V0LA 3HU7A 3WSUA 1ZB5A 3ZJ6A 1J10A 4GO8A 3VMNA 4LYPA 5M03A 3AQUA 3IGUA 3GXMA 1FH8A 1R46A 3OGSA 4F9JA 3EJRA 4X9YA 5DT7A 1U33A 2GK1A 3ARZA 4EAMA 4TVCA 1CLXA 4WSJA 5FKYA 3UG4A 4H7VA 1C91A 1KB3A 1CENA 1FFRA 2BVTA 4JL1A 5C8BB 3HMCA 3N12A 2D73A 1JF6A 4PMXA 1E6RA 1LL7A 4CU8A 4IUGA 1JAKA 3AZTA 4PMRA 1B0IA 3VD3A 3IJ9A 3F5KA 1JZ6A 3WN6A 3MUZ1 3OGRA 2YBUA 1U2YA 1UZ1A 3VGEA 3AI0A 1HN1A 4MPKA 5ABFA 4HP5A 5I0DA 1HIZA 2X2JA 4ZE5A 1XRVA 4CU7A 3AMLA 1UD8A 5CG0A 2CIPA 2F7QA 1NH6A 4CN4A 4AISA 4GQRA 3CZLA 3ZJ8A 3T2QA 4HTYA 4N42A 2PWGA 2VZSA 4EE9A 2OYMA 1GOOA 1QHZA 5FL0A 4UR9A 1UASA 1QPKA 2ZUMA 4ZFMA 4AZGA 3SUWA 5F7UA 1W9PA 4AY1A 3VGHA 5I23A 4YHEA 2G3IA 2UY3A 2XN1A 5BROA 1J0KA 5FOOA 2CXGA 3AXIA 1TQTA 1OGSA 4W7WA 4W86A 4WK9A 1I1XA 1XV8A 1D2KA 2VX6A 1QI3A 4CD4A 2D3NA 2IXVA 3AS3A 2E4TA 4DUXA 3ARUA 1NOUA 2YLLA 4D1JA 1RD6A 2BV9A 1TFVA 4TX8A 1ZU8A 2PWEA 5JBDA 2WMHA 5ABEA 3WEOA 1ZBKA 2OYLA 3W24A 1CXIA 3SCWA 4U33A 1MQPA 4JFTA 3QHMA 3ZSTA 3WKZA 3AXXA 3FHAA 1MW3A 3CZEA 2CHOA 3D50A 5LYRA 1G5AA 4UOQA 1QVBA 1OT1A 4IISA 4PTVA 3VIHA 2ZWZA 3APGA 3QGVA 3A21A 3BMWA 4D6EA 4FNUA 3UEQA 4B16A 4ATDA 1CGUA 2E9MA 1W9VA 1JI2A 3KWXA 3OG2A 1MXGA 4JIEA 5IFPA 3CC1A 1R47A 2AOSA 1MW0A 1AQHA 1XYFA 2C0HA 1ISVA 2YL5A 4M29A 1NOFA 3RO8A 2CESA 3LRKA 2ESCA 2CNCA 1B30A 4GXPA 1XHGA 3B8SA 1E4MM 1KGXA 2FHCA 2XVPA 1MFVA 3VPLA 3CUFA 1V03A 1WZKA 3WDRA 3ZIZA 5IXEA 1QNQA 2F1AA 3WH9A 4AD3A 3TONA 3W28A 3ARYA 1Y7VA 1NP0A 3W26A 2XIBA 3AMGA 1HJWA 3PTKA 3PN8A 3RCNA 1B3XA 1HKMA 2VX7A 2YA0A 2J7BA 5DT5A 4D71A 3RM4A 2J7GA 3SUSA 2XM1A 4TOQA 3DHPA 1H2JA 3ARTA 4Q22A 2ZUSA 1R7AA 1ISZA 1E4IA 4LX4A 3VGBA 1CLVA 1ISYA 3ARPA 2ZX7A 2VC9A 3DDFA 5CXPA 4MB1A 5TD4A 1R86A 1W2PA 4D72A 4PN2A 2PWFA 1WDPA 1H4PA 3TOPA 1ISXA 3ZOAA 2X0HA 3TP4A 2WSPA 3G6MA 2G3MA 3S6TA 2XFYA 2YJQA 4GI6A 1QOXA 3J7HA 4BA0A 2WCGA 3T08A 2Y4SA 1PS3A 2GSJA 3PZIA 3CZKA 1N82A 4AWEA 1YHTA 4NRSA 2CKRA 4ZEPA 3H53A 5CSYA 4UOJA 1V6XA 5A6AA 2XN2A 1BQCA 1T0OA 3NYDA 3ARRA 1B9ZA 5E6ZA 4Z2JA 3BXWA 2VQUA 3DX0A 3LXAA 5ECUA 3ZM8A 4BQ3A 1SMAA 1BF2A 1E0WA 4CU6A 1V08A 3LPGA 4XB3A 1B90A 3EJQA 2E3ZA 3WQWA 3A23A 2WHLA 3TTQA 1XCXA 2D1ZA 2WMIA 3GBEA 1E1EA 1R33A 4IPNB 3FW6A 3OZOA 2X1IA 4JFUA 2Z1SA 1HXKA 2J77A 3OB8A 3WFLA 3GYCA 4MB4A 3WF3A 3KZSA 1W3KA 3UG5A 5I77A 2EACA 2FH8A 2X0YA 3OA5A 1Q6CA 2X2HA 3RDKA 1QBBA 5BYWA 1JDCA 1ITXA 3M7SA 4PMDA 2VZVA 2WMKA 5A2AA 1TVNA 4FF5A 4Z2IA 4HZ6A 4UQEA 2J79A 1GUVA 2ZX9A 2XWEA 2Y2WA 4U2YA 3SCVA 3HG5A 2X09A 4P8WA 2WMGA 4AZCB 4E2OA 2XFRA 3IAQA 1W9XA 2F8QA 4UQAA 1Q6GA 1JDDA 5A8PA 1QI2A 3BAYA 1VIWA 2J7CA 4GKLA 3VDAA 1Q6EA 1NWSA 3T0DA 1E4LA 1XH1A 3DX3A 5EMYA 4U5KA 1RP8A 2JF6A 2DSZA 3K4DA 2QPSA 3HJEA 4HOXA 2YLAA 3W81A 2A3HA 1V0MA 3VSVA 2YL8A 2CBIA 3VIKA 4E8CA 1QBAA 1Q4NX 1EOKA 3M46A 4CVUA 4TUFA 1KCLA 4JHOA 3S2CA 5E1QA 1OINA 4D6JA 1C8QA 3GXPA 4Z2HA 1V3KA 2QV4A 1E9LA 2GJXB 2VZUA 1O6IA 4PCTA 1FOBA 3SCOA 2ZX5A 1UA7A 3PBGA 3PZQA 1D3CA 3B9EA 8CGTA 1E6ZA 2VNCA 4GI9A 1HF6A 2XTKA 4F79A 1GQJA 1LL4A 4Y7EA 2E8YA 3H54A 3HG4A 5BWFA 4BQ5A 4JFVA 1UWSA 2UY2A 1A47A 4PUEA 3L4XA 1TQSA 3IJ7A 3WNKA 2X2YA 4MB3A 1JXKA 4GIAA 3T0AA 1PIFA 4FLQA 1KXHA 2XSBA 2YIHA 5I2UA 3A24A 1HJXA 2D24A 3W53A 3VTRA 4OOUA 2G3NA 4EANA 2DSWA 4XV0A 1W3LA 1WDRA 4FNTA 1KCKA 1VFUA 3THCA 1GJUA 4AIOA 4AMXA 1CGVA 1KTBA 2F7OA 5KEZA 2D23A 1K9EA 1DWFM 2CYGA 4OUEA 4JL2A 1J01A 2ZOXA 4EK7A 1M04A 2DH2A 4LPCA 2YKKA 4AW7A 2EPNA 3S5YA 1TA3B 4AEFA 4GINA 1BGGA 1R7OA 2DQXA 4UFLA 1YQ2A 4JHZA 2VQTA 3WD3A 5ABHA 2X05A 3WENA 3JUGA 4ZE4A 2W4XA 2V3DA 2O9TA 3U57A 3VIIA 4U2ZA 1CXEA 1XH0A 3LX9A 2BFGA 3GZAA 3AHTA 1HKKA 1Q6DA 5GNXA 2J25A 1PIGA 3GNRA 1J0YA 3VD7A 1AQ0A 1NWUA 4MNLA 3K8LA 1CGXA 2J75A 1B1YA 1EGZA 2EQDA 3CIVA 3N11A 3K1DA 1UWRA 4QFUA 1M01A 2BS9A 5D9MA 3WDQA 1XSIA 4AZCA 1OT2A 4NX0A 3BVTA 4PRWA 3CMJA 3BSHA 2RGMA 1US3A 2VR4A 5KZ6A 4HA1A 3SUVA 3H55A 4X0VA 1ODZA 4C7FA 3VD5A 1PJ9A 1MWOA 4NZFA 4W88A 2MANA 1J0HA 2F7RA 3BUQA 4AZBA 2XSAA 3SUTA 4FNPA 1HL8A 1W1VA 1ESWA 4KRUA 4OIFA 1KWKA 1VEMA 2EPKX 1CGYA 3CV5A 3CUGA 3CGTA 3BVWA 4M8UA 3L4ZA 2PI6A 1X6NA 1VENA 1XCWA 2E9LA 1WP6A 1KFWA 2GJXA 3D51A 2HVMA 2FGZA 3SIMA 4C7DA 1FP8A 2WKLA 3PZNA 4BCEA 1QX1A 2CBJA 1JFHA 1V3IA 1W3JA 1V6VA 2B31A 3NSMA 1WE5A 4GZEA 3N9KA 4NSBA 5CQ1A 1I75A 3AZRA 3SCTA 3VIOA 1BGAA 1H09A 3SCUA 3IK2A 1HJUA 3AYSA 2DIJA 3ARSA 3BLKA 4FNQA 3MU7A 4CD7A 4B9YA 4J27A 3CZ8A 4UQDA 1KR1A 1AMYA 2CITA 4HZ7A 1UR9A 2J78A 1GHRA 3DX1A 3BGAA 3L4VA 1VEPA 3EDEA 1QNPA 1KGWA 2VI0A 1E3ZA 4DUWA 2OWWA 4Z2KA 2DSKA 4ATWA 2NW0A 4LXFA 9CGTA 3BMVA 4UFJA 1C7TA 1JZ3A 4HA3A 5CPSA 1KBKA 1E15A 1WDQA 1F4HA 4ZXLA 3F4VA 2J7FA 2W92A 3WUBA 1HKJA 2VL4A 1V6YA 3CO4A 4HPHA 3K8MA 5DFAA 2E8ZA 4IM4A 4DO6A 3PZVA 1TR1A 4Q7NA 4AYGA 3I3DA 4GPNA 1WPCA 4W89A 2WVVA 2UY4A 5BXRA 2G8ZA 1CNVA 4JFSA 4LYRA 3BVVA 1UWTA 2UY5A 1E55A 5A6BD 1K6AA 4JFWA 1EDQA 5AC4A 3MV11 2D0FA 4DO4A 1R87A 5GQBA 5A95A 3UCQA 1R34A 1QNOA 3D5HA 3POHA 4A3HA 3BCDA 3OBAA 3UR8A 2ZUVA 1X1NA 3VSUA 1H0GA 2CPUA 1H1NA 4WF7A 4JKKA 5AC5A 2PBGA 3WH5A 3GDBA 1VAHA 4JZ5A 4V28A 2IXUA 1JZ2A 4BQ4A 1UZ4A 3RMEA 1KR0A 2OWCA 2JALA 5HPCA 2XG9A 3UG3A 4UFIA 1CPUA 2JF7A 1AQMA 1VJZA 4QLJA 2FHFA 3AIUA 1XGZA 2WB5A 1C3FA 1CECA 4AMWA 3L4YA 2A3CA 1UG6A 4AD4A 1E0VA 2D3LA 2YBTA 4UZSA 5A6MA 1MYRA 2G4FA 2WWCA 4PSPA 4PMZA 3LXBA 2VMFA 3GXTA 3WQ6A 5EFFA 1TG7A 5HNNA 2E40A 2YDRA 3ZT7A 2O9PA 1M03A 4D6CA 2ALWA 2BXZA 1CGWA 3DECA 4CVWA 4E4PA 1TUXA 4M81A 1JZ5A 3GNOA 3NJ3A 4K68A 4ZXOA 1H5VA 1HXJA 4RE4A 3MUIA 4UQBA 1E1FA 3WF0A 1KGUA 3RJXA 1VF8A 3VX1A 3PZMA 3QOKA 4S3JA 4XX6A 2J7HA 4BF7A 2OW6A 2XVNA 1SYTA 3PZUA 2D0GA 2VZTA 4FK9A 1P6WA 3N04A 5BRQA 5AYBA 3UETA 1C7SA 1GNXA 2WMFA 4ACZA 2PC8A 3RIKA 1FFQA 3BUIA 4MAVA 1GOWA 4DM1A 2WBKA 4UTFA 1EQCA 3BCFA 2O92A 2FGLA 4H2CA 4ACYA 3WDPP 3EDJA 4TTUA 2VR5A 2EAEA 4H04A 3WD4A 4KMQA 3FNDA 1W9UA 3RM9A 3W27A 1UYQA 4GZJA 4PTWA 1WAWA 3BUDA 4M82A 3BAKA 4P7RA 2F7PA 3W82A 2CEQA 1EA9C 1C90A 2WLZA 1PAMA 3W29A 2WKGA 5FD0A 4NXSA 1E3XA 1PBGA 5A2BA 3K8KA 3K4AA 3IJ8A 2XVLA 6CGTA 3AXHA 3O6AA 4FNRA 1NWRA 3WMSA 5C71A 3NCOA 1HWWA 3WY2A 4W8AA 3DDGA 6TAAA 2W62A 4NRRA 2WMJA 3TTSA 2JEPA 3EDKA 2ZX8A 1JYXA 1G01A 3OLIA 3AS2A 1V0NA 4D1IA 3VM5A 3A22A 3SCRA 1SZNA 5CJ5A 4P7OA 1DEDA 1QI5A 1HL9A 4OBSA 2JIEA 3OGVA 4YPJA 4P7QA 1DTUA 3HZ3A 1XC6A 4D6IA 1BYBA 2V5DA 1E6NA 4LQ1A 5I24A 3CHFA 4WLCA 3WD2A 1EQPA 4NI3A 1IT0A 3SEPA 3VUPA 2UWFA 1MW1A 3W0KA 3PZOA 3LXCA 1E56A 2J62A 1FP9A 1E43A 3GTNA 3VDCA 3BAJA 1US2A 1MW2A 1GJWA 2WHMA 5A1AA 4U31A 2VRKA 4JAWA 2F2HA 3WMBA 3WBEA 1NQ6A 3EMZA 1HP5A 2WM0A 2XN0A 2BY3A 4YN5A 3N17A 4PBGA 4P7LA 1VFMA 3M07A 5A2CA 3MV01 1R85A 5IHSA 5D4YA 4DWSC 3CHDA 2XFFA 1UKSA 3EMQA 3RPMA 2VX5A 4KH2A 1B3YA 1V02A 2XVKA 3B9AA 1OM0A 3PZ9A 4NZCA 3AMDA 1J0IA 3WNPA 1ZBVA 4J3XA 1XD1A 1M7XA 1DP0A 4MJ4A 3OLEA 4PTMA 2QPUA 1XSKA 1GVIA 4RE2A 1QWNA 4HMDA 3D52A 4YHGA 2WZHA 5IHRA 3BAIA 4AZ6A 1MXDA 2ZXAA 4QCFA 2Y8VA 4FLSA 4URIA 4JKLA 5E9AA 2PWDA 5DO8A 3WF4A 3VD9A 3EJPA 3A3HA 2F61A 3VGFA 3A47A 2X2IA 1UOKA 1WZAA 4F9DA 3DX4A 4W87A 1W32A 2W66A 5EBAA 1OIMA 1V0KA 3AMCA 1E6SM 3L4UA 1TE1A 5I78A 3W38A 3AIVA 4ML4A 4OBRA 2WCSA 4D6GA 1GQIA 4PSRA 3LPFA 1GZJA 1NP2A 2A3EA 3ZJ7A 3WD0A 3BLBA 4BQ2A 1B3WA 4UZUA 1ZL1A 5CSUA 5A8QA 1UWIA 4AIEA 3AISA 2BVDA 2ZICA 1GVYA 1GOMA 5BXTA 1GOIA 3PTQA 1OGBA 4BZYA 4W84A 1EXPA 5IDIA 4X0NA 3ZQ9A 1V3HA 2YDSA 3I3EA 4HMCA 3WNOA 3CUJA 2DT3A 3ZT5A 4CD6A 1RP9A 1HKIA 1G0CA 4CN6A 3A4WA 5IFTA 3VGGA 3N1AA 4D6HA 3VVGA 1JZ4A 5FL1A 3FAXA 1H0IA 4LGXA 4DUVA 5A8NA 1BLIA 3GXFA 4PMOA 2EJ1A 1VFFA 4R27A 3AIEA 2WWDA 3F5JA 2VVSA 4J7RA 3MO4A 3AHVA 2VCAA 1JI1A 2BY1A 1PX3A 1FH7A 3PZTA 1E73M 5E0FA 1BHGA 1UD6A 3AS0A 4TXEA 5JBFA 1F4AA 4F66A 4AD5A 3LPPA 3LRMA 4HZ8A 1VJSA 1KBBA 3MMWA 1BG4A 1K9DA 1Q6FA 3TV8A 1BYCA 1DWHM 1KQYA 5BRPA 2VCCA 2GK1B 5CPQA 1O7DC 2DPEA 3LPOA 4BS0A 3VNYA 2WYSA 1D7FA 1UR1A 3WL0A 4JCLA 2X8RA 1TQVA 2YL9A 4JKMA 1ISWA 2ZX6A 3WY3A 4MDOA 3WNNA 1JAEA 4CD8A 1UH2A 2WC7A 4OOZA 3D4ZA 1GCYA 2G41A 2EPOA 2DH3A 4J3WA 3PTMA 4H41A 2J8GA 4W85A 3MI6A 1XD0A 1UKPA 3ARXA 3WFZA 1GONA 3OLGA 4NXKA 2EPLX 2XUCA 1HVQA 1UH3A 3N18A 2YFNA 4U5IA 1V6WA 3WF2A 5HXMA 3WH7A 1EDTA 3OIHA 4B3LA 5C70A 3VIJA 2J8FA 1Z32X 4HPGA 3ECQA 4Z2LA 2PF0A 1HX0A 4UOZA 4HMEA 2DT1A 2A3AA 1HP4A 3D4YA 3ZJKA 3GNPA 3CZNA 4H8VA 3DYMA 3MANA 3GBDA 1B3ZA 1OGGA 3AROA 3SCNA 1DWGM 4L4PA 2IGTA 1XH2A 4AD2A 4AZHA 2D22A 5A6BA 3I3BA 1JF5A 1FH9A 4WKAA 1CXHA 1G1YA 2BY0A 5EFDA 3EDFA 3TA9A 3KLKA 3VDHA 1JL8A 3ZMRA 3NSXA 4W8BA 2EXOA 1C8YA 3AHXA 3W6LA 1UH4A 1H49A 4OKDA 3ARWA 2PBOA 4NF7A 2DSUA 4FNSA 4PYSA 1JXJA 2CBVA 4W5ZA 2WVUA 5HOSA 3EJTA 1VRXA 1HNYA 3L2MA 4S3KA 1WO2A 1LJYA 1CXKA 3F5LA 2ZWYA 3CPUA 3AOFA 2J7EA 2W61A 3U5UA 3QHOA 3EBVA 1QHPA 1GHSA 1CXLA 4H8HA 1R75A 2WCAA 1SR0A 1V02E 1MFUA 3WY1A 2ZUUA 3O2LA 4B15A 1C92A 5CLTA 2BHUA 2EADA 2WC3A 2OLHA 5AYIA 3L4TA 3VIGA 3VM7A 2FH6A 2Y5EA 1UD5A 2O9RA 4W8LA 1EH9A 2GDVA 5FIPA 3VMPA 3BUBA 1W91A 1B2YA 3ZR6A 3AFBA 4UFMA 1QWUA 1DHKA 4JCMA 1MVYA 1V3MA 5CGTA 2TAAA 2XHYA 2YA1A 4P7NA 4J28A 2VRJA 4OZOA 1TA3A 1DWIM 3MMDA 4DO5A 5D9PA 4AXNA 2CBUA 2W91A 3WL1A 1IZJA 1LWJA 1UHVA 2QHAA 3SURA 1SMDA 2AAAA 3QHNA 3KE0A 3DYPA 1J9YA 4WSKA 1GQKA 1QNSA 3SCSA 2DIEA 4QP0A 3THDA 1OIFA 5HBFA 2ZUWA 2WLYA 4F8XA 3T2PA 1EOMA 1BYDA 2DT0A 4D6FA 3EMCA 3VNZA 3T0BA 3LMYA 3W4RA 2J4GA 3VX0A 2XGBA 2XYLA 2Y8KA 5D8WA 7CGTA 3NUKA 4E8DA 3VKKA 3BH4A 3WQ5A 1BAGA 3NDYA 2Z1KA 1V3JA 3U7BA 3CZSA 2D2OA 2JEQA 3K46A 1JG9A 1E6XM 3S5ZA 2ZIDA 5I5RA
chains in the Genus database with same CATH superfamily
2O5ZH 1VFBB 3SDCC 2CWRA 4NN7B 1VBGA 4TUJB 1A7NL 1SJDA 3SRFA 5G4OA 1O9WA 3TN6A 5DS8B 2EEFA 2J7DA 1FDYA 3FSWA 4N6RB 3ZVHA 3IMVA 3O0LA 3CFJB 1WZMA 5C9WA 5DRNA 4KDTA 3HE6A 3MPGA 5BUPA 3FCSB 1O6SB 1OY3B 4O13A 3VSTA 3FKRA 5INDA 2CLFA 1CLZL 1RUPH 2ZTBA 2VX4A 2OZNA 4JO4H 3FH7A 2XIIA 3C2EA 3MLSL 3FKKA 2G3JA 1K72A 3RX5A 5AW6B 3FY1A 1BG9A 1KENH 1JEZA 4QCIB 4EIZC 5EA0L 1P1VA 5T5FH 4XXCA 3FYOA 1J96A 1IC4H 3GB7B 5I3DA 4LSPH 2PCXA 4NQCD 1XLLA 4E0RB 5J3HC 2VLRB 3I10A 3W7EA 4JM2C 4MFHA 3L54A 2EIZA 3MMTA 2AMGA 3VFSB 2OLDA 1RCXB 3IT8D 3QUYC 2F5BL 3APCA 1BXUA 2ZKXA 4J8RA 2CHZA 5JW5B 4INFA 4LU5L 3E2HC 4PTXA 1FXPA 3QNXA 3RVVD 5HNUA 1BD2B 2Z34A 3VFTA 1GGTA 2TRSA 1O7AA 2C7FA 3EXSA 4UINH 4WW1B 4B9FA 4I6KA 1E5ZA 4J4PC 3SGEH 2EINB 2NY7L 1Z42A 2P53A 3LQAC 3HO8A 3I9PA 1X1ZA 4NN5B 3SDDA 2G2NA 1N64L 3DX9B 2O0TA 4K3HA 3W2DH 4P5SA 1N0LB 4ATLA 1UR8A 4ZUVA 5FF0A 4RISH 2ZCKL 3LB6D 3ITVA 4JBRA 1MREH 4HPOL 4H3DA 4UB9A 5I17B 1MUMA 4QS5A 1EUAA 4NQDD 5T8IA 4KTGA 3UAJD 2VURA 1EHAA 3F85A 3P9MA 3TA6A 3TO4B 2GVYA 2BVYA 3TJEL 1GORA 2W94A 2YXVA 2BXVA 2FX7L 1JPFB 2F1BA 1NCOA 5J89A 1B4EA 2IC2A 4RFNB 3HN3A 3MUGB 4PMFA 2OQLA 4XVSL 3MLRL 4EUPG 3ZDXB 1KIQA 2MKWA 1FHLA 2CO7A 2VT0A 2NDFA 2PLJA 4WO4C 5E2VH 3W22A 3WQOA 1E40A 1SF3A 3S9IA 4R7WA 3NG3A 4UFHA 4AF0A 3CFDA 4F7MA 2JK5A 4LESA 3T6CA 1DN0A 1T22B 2WZEA 2XTJD 1THCA 1ITCA 2C8NA 2W9LA 4C6KA 4CNOA 3ECVA 4KGJA 3WF1A 4TYUA 4GZIA 2PPFA 2VSKB 3SCQA 3NZUA 1GCFA 1BFNA 5FM5M 4NKQB 2VXSL 4TNVF 4QHMA 3DX2A 2WHJA 4MNKA 3RURA 4JFOB 2IFFH 3IJYA 4G42A 2QHLA 2V30A 4ELKB 2VABB 3TASA 1GW6A 3KL3A 3ZGIA 1FO0B 4Y4FD 3MHUA 3NIFE 1S5VA 2WM1A 3DVGA 4IGBA 2VFHA 2TPSA 1P84J 4PFHA 2ZXBA 1I1WA 3T4AC 2BS71 3QPXL 2BC4A 5FYKD 4RFOL 3ZR5A 3MV8E 2IH3B 3GH4A 1UKOA 4V27A 2Y9RT 3W57A 2Y89A 4Z0BH 1XFPA 4X5RA 2VXQH 5I8OH 4ES9A 3VNIA 3UNDA 2DGAA 3KEHA 1GTHA 2MHAA 4NQCB 4CSPA 4V1DD 1R8LA 1GQLA 3KVDD 3FS2A 1HINH 4RNRA 5H8DA 3LRGA 4XPTH 1JWUB 3QIUA 3PDGA 1EUUA 1NCHA 5DXWA 2DLGA 1Y0LB 2FLRT 1JIBA 2NPLX 3CH9A 1YE6A 3UJFA 4N2BA 4UAOC 2IKJA 3FQ4A 3LBOA 3PE9A 4JFXB 3IJEB 1G7PA 1ROCA 3GXMA 3OGSA 2AJXL 1AANA 1S9VA 2DBJA 4IGHA 1RQEA 4N8UA 5FV1L 4YK4C 1TTGA 4EUPB 2BVTA 2OFQA 3HMCA 4QDGA 1RQ5A 1G4EA 4GS7B 2C16A 3VXQB 4QISA 3GKWL 5DD3L 1WIUA 3MZGB 3Q2NA 4HOMA 4IT1A 4EDWL 1IVLA 3QEUB 4O02B 1IILE 4LF3A 3P4LA 2X4SA 2Y88A 5MEPA 4HW6A 1RD5A 4JPGA 4TVPH 2FZBA 4XD6A 1S7RA 1BBDH 5I1HH 1UD8A 3RLSA 4NFCA 1U8LB 5EDSA 2HCVA 5LNDA 1QHZA 3GTXA 2WXKA 4AY1A 1EEPA 5B39G 2G3IA 3G5EA 4GSDL 5C07E 3SJ3A 4LHJB 4DKAA 4MTMA 1SOSA 2BP3A 5F4SA 1E5CA 1BFVL 4LNRB 3P60A 3OR7A 2VLJA 2H8PB 1TKKA 1NANH 2FEJA 1D5MA 1H6EA 3O6KL 1EK3A 3VG9B 4LOVA 4TULH 2I25N 3P73A 1CXIA 3MRLA 4M3JA 4AQ1B 2B1AH 1W0WB 1EAPB 2R29A 2FPTA 1MW3A 1FVDA 4M1CC 1JHKL 3RAJH 1G6CA 3KOXA 3D50A 1C08B 2EDDA 1EJXC 3BLFA 5ABZA 3WD5L 1G5AA 4XPBL 1BXXA 3ULVH 3APGA 5AZEH 4H4IA 1O7SA 2GGHA 4ALDA 2ESCA 4I2XA 2X53A 1YMMD 2FJGB 5GGRB 1ZAHA 2EKJA 4JIQA 8TIMA 3IYLW 3CUFA 2A2QT 4NO3A 5EC1A 1QLFB 4S3EA 3WH9A 4HFWB 4JFDD 4FHAA 2IG2H 4Q56A 1KIUB 4PGEA 2RJGA 3SUSA 2R2CA 5H2ZA 1B4JL 3TYUA 1VGEL 1E4IA 4PL1A 3ARPA 3KP1A 5EU6B 2BMKB 4AG0A 3R8QA 3TQ0A 5C0JB 1PKLA 2BVOA 4J40A 2X0HA 4MXWH 4QRSB 1L0YA 4HVBA 1KXQE 3HF3A 5DUPL 1OL0A 1B9BA 3L1OH 4P9HL 1K8IA 3QJHB 4AWEA 3BLEA 3MTWA 4OZFG 4N6RA 4F7TA 3SGKC 3WFEL 4QRRD 3CFJA 3QWQB 4BDVB 5EU3B 4QHLA 3HW7A 1O6SA 4WEBH 3ZVIA 2D1ZA 3K6SB 3GBEA 4GACA 4V1DB 3FW6A 4IOFC 3UXDA 5KSAC 3IKKA 2J77A 4U6VL 4LLDB 2J3SA 3JWOH 3GRBA 4ERIA 3ATYA 2BVWA 1LQSR 5I7GA 1RSYA 1Z41A 5B39B 3V6FB 4ZUUB 1FNHA 4PJ7E 1TJ2A 4HIQA 1NMAL 3B9KB 1ADDA 3R4IA 2YRLA 1L9NA 5C7HA 1JDDA 2K4AA 3S35H 4OLZH 4ZQKA 5I8CA 1O5PA 4GKLA 3ORWA 3C8FA 2L4OA 1DBJL 3DX3A 2Y1HA 3GB7A 3I4KA 5KVFL 2VN3A 4Y9PA 1K8YA 1KB5B 1VFHA 3W81A 4MMYB 2CBIA 1N55A 4JPWH 2VLRA 4KUCF 4TRPL 3FUDA 3MLTB 4PC8A 1C8QA 3VFSA 4ZD3H 2DYRB 4PCTA 1Q90A 4ANWA 3KCOA 4GYBA 2VR3A 2Y72A 3QFEA 4UM9A 4ZR8A 4NZ4A 1BD2A 4XN7A 4P5TC 5D33A 4DVBA 2YIHA 3UTQA 5I2UA 4QHKI 2R6OA 4WW1A 3CQ0A 2ZTKA 5DO2D 2Z4QB 3BXNA 1D3HA 4XV0A 4QHUB 1KCKA 2YLHA 4RZ4A 2BSSB 3IFLH 5DD5H 3MACH 2BIIA 5GGQL 2ZOXA 5I18H 4EK7A 5I30H 4ZXBD 4BEUA 1TA3B 2J9ZA 4BWWA 3HG0A 3MCKA 4EI6B 1BEYL 3WENA 2Y5JA 3AXKA 2O9TA 4MD5B 4QY8B 1T7ZA 1RLWA 4LUTA 1A4KA 4KI5E 5GS2D 4H9VA 4XE0A 2ABBA 4LVFA 1QT1A 3F04A 1YECH 2AK1L 4G8GA 4KKNA 3TO4A 4YO0B 1DIDA 2OZ4L 1LYQA 3WDQA 3I9AA 5CIPB 3AG2B 4OZFB 3WCZA 4OZGE 1T66C 5KZCD 2FTYA 1SXAA 1U3HC 3OQ3B 4PG2C 4TL4A 1Q0XH 2WB7A 2PGRA 1J0HA 4FNPA 1YMMB 3ABGA 3MFFB 4XP1L 3QFWA 1N59B 4QEEA 2QSTA 3HMJG 3TTEA 2IBBA 1I9JL 4KFPA 5I6XB 3TWCH 4IPJA 4PI0A 4YFLF 2GVEA 3D51A 2AQPA 1NL0H 4NL1A 2PO6C 1QX1A 4UANA 4KFMA 1WE5A 2DZBA 3MNDA 5CJOL 1M65A 1MZYA 4GQBA 1W3NA 4L4TB 1TYGA 3ULVC 4P57B 3IKCB 2TYSA 3WAJA 1IZCA 4HKXB 2W80C 2E1DA 4FABL 1TZ8A 4PRBB 4DP2X 5H37A 5JNYB 3FT2B 1U5HA 2MQ0A 1WDQA 4ZXLA 1A3WA 1XIEA 1BQUA 1ZIAA 3DUSA 4U1SB 3V0HA 1XQKA 1OC5A 2A0LD 1TTUA 5GJTL 4S0TD 5HYQB 3LTYA 4W89A 4WUUE 3RO6A 4BWLA 4WJ8A 2J4WH 3UPWA 1LM8V 3T0ED 2QKIA 1XO8A 4HSQA 4ELKA 2B0SL 1MCBA 3U2SB 2JKPA 3RHGA 4TV6A 1U58B 4UTCA 1FO0A 2H6RA 5GQBA 2R4SL 2FZ3B 1DANT 3MJ9A 1GKQA 1KA9F 2AJZB 1B3OA 2V81A 3SGUA 1MEXL 5AC5A 4V28A 3LN3A 4JPKL 3RDTC 3FTWA 5HPCA 2PCEA 4OCXL 1G7JB 3HC3H 5KUMA 2PLCA 4FMKA 2GUOB 1H3TA 1CECA 1R38A 2IS7A 4KQ3L 4ERSH 4U1IB 3RNQB 2UX7A 1UWGH 5EZOH 4R7NB 1JCNA 5C1MB 4M61B 3BRDA 1RIVL 2YAHA 2LTQB 2F9RA 1Q2SA 2QZ5A 3B2XA 2HMID 3JWOC 1HHKB 2QQKL 3RK8A 1Y0LA 2XZCH 3KH4A 4Z42C 3RIKA 2PDYA 2VKZG 3LQAL 2CRMA 1CQKA 1FDZA 5FW6A 4M6AA 4JFXA 1UUSA 4OIIH 3CAQA 3VQLA 2F9BT 1S5HB 4H04A 3FNDA 3ITLA 3BG9A 1IEQA 4W9KC 1PDYA 3EYVB 5DMIH 5D04C 4KVCL 3TYFA 3BG3A 1S5TA 5B38G 2HQAA 2OZ8A 3K4AA 1WUZA 3UBPC 1FFNA 3BDYL 5IWLA 3NCOA 4HBKA 4JQ3A 1U1JA 4WWKC 3O9WB 2W62A 1U8LA 4DK5A 4QXIA 1GGOA 5G4WA 3DUHA 3O4LA 3A22A 5C2GA 3U7WL 1CT5A 3QWOB 1WXYA 3OGVA 1XC6A 5H35B 4LNRA 2HFTA 2OP4L 3QWRD 2R0ZH 2ADJA 4P3CH 3CBRA 4GH1A 4DQOH 4MA3B 1UP0A 3TC6A 5ECJE 4D8ZA 5EZJB 2VRKA 4JAWA 3NO1A 3H4XA 3SRKA 4JPQA 4URKA 3ZKSD 3W02A 1O4UA 1UGKA 2F5AH 4KK5D 4DWSC 2Y6SC 3Q06A 4BEQA 5GGRY 4ASTA 3WLSA 5EORH 1JK8B 1MFMA 2QPUA 2WO3B 1XSKA 1KJ2L 3E9TA 4Y6GA 2JF1A 4PUNA 5GGRA 3SZ8A 1JPTL 1M7OA 3V1HA 1NLDL 4FS0A 2YN5A 2GQ3A 4Y5YC 1HCZA 4LVOC 4TSBL 3UPMA 3AMCA 2V67A 4HFWA 3L4UA 1GKRA 1MHCB 5LG6A 1KIUA 5C3IA 2WCSA 3RKDD 4JB9H 3OKOB 4M5YH 4GSXA 2HTLC 5FF2A 3TQVA 4IX2A 2C9VA 3EOAA 2FL5B 3T2NL 3KBSA 3AISA 1A7NH 1S1PA 1QUMA 5EU6A 2HXTA 2X12A 2BMKA 1IL1A 2CH8A 1YE4A 3OMIB 3OTRA 4QRSA 4O16A 4MLSA 4C6FA 5HJYA 3TJ4A 2VVSA 3WUZA 4BDVA 1T1YB 1CLZH 4NWUL 5B38B 3DROA 2ZXGA 5AHLA 3SKOB 2XFWA 5AVTB 3MLSH 4Z7NB 4LSTL 1E0TA 1M42A 4O14A 2BP1A 2YSSB 4LLDA 2BOBB 3AU0A 2DW6A 4FI8A 1T6MA 4QT5B 4MQSB 3N25A 1O9VA 3D0CA 4HU4A 1QFOA 3TAKA 3G1XA 2N4IA 1AQKL 4E4FA 2EPOA 3ROLB 3NOYA 4ZUUA 5EA0H 3B9KA 2H26B 3ARXA 3B0PA 5F6IC 1K03A 3OYXA 3VWJC 2NXYD 1QPQA 1AO7E 3OIHA 4US6A 1YIXA 3ZW3A 4HPGA 3HFYA 5FSEC 3ZE1F 1GOGA 1KB5A 3BGFC 2F5BH 4MMYA 3L3IB 4HUMB 5CEYB 2ADFH 4ANUA 3ZJKA 3MLTA 4W68A 3DYMA 1OK4A 4N26A 2H32H 1B3ZA 4LU5H 4J12A 3OHIA 3I3BA 3THUA 4AQ8A 3I6SA 3Q67A 2CNYA 5DHMC 4HLZG 4Z1BA 2UZYB 2YHGA 3WLOA 4OKDA 4RVBA 4OWGA 4MX7B 4XO4A 4JG5A 1NGQL 2PBOA 4PYSA 5D1ZD 1Y5VA 2NY7H 2ATPB 3CV7A 1N67A 3UH8A 4UNUA 3LHWA 4LC6A 1N64H 4GVIA 4AW4A 5L88L 2YMOA 2R59A 4QHUA 4YHPA 2OLHA 4JJ5A 3VM7A 2ZCKH 1ZQ5A 2BSSA 5HULA 4XIAA 3MV7B 2B7NA 5E8DL 5FGBA 1TA3A 3MMDA 3S88L 4AXNA 3FA4A 4EI6A 3L7EB 3MV9E 1GIGL 3CK0L 3KYMB 4F33B 4EN3A 4GBXD 1PCWA 3MMEA 1BXAA 3W4RA 4F0RA 3TJEH 2OI9B 2XWZA 4O2FB 1ZWIB 2XIQA 2FX7H 4YO0A 5TK4A 1EBGA 5I0XA 4JN2B 1ILSA 4WOZA 3J07A 2I57A 4XVSH 3MLRH 1JGIA 1XKJA 3GW3A 3D87B 1YEHL 3NEXA 1YNKL 3MFFA 4AJVA 5G4HC 5D1QC 4OIAA 2CERA 1AKPA 3V5HA 1PSCA 1HXMB 4CKQA 3DNKA 1X38A 1CYXA 1U8PB 3YPIA 4PRTA 3ZJAA 5DVLA 1PD6A 1HOEA 1ORQA 4JVPA 4N2AA 2YPLD 5F7AA 3MUAA 2WMIB 3IKCA 3NQEA 4Y4KC 4HKXA 5AAPA 5IMLB 3SKMA 3GR7A 2AK4E 1K8DA 3IWVA 2VXSH 4PRBA 5JNYA 3FT2A 2WK2A 3VXME 3I84A 3P9WB 1EDGA 5AYXA 5D9SB 4FLOA 2KMWA 1A3QA 3Q8BA 5A8MA 1CWVA 4XVOA 4MVAA 2VFGA 2VW6A 4AJWA 3CB3A 1U8CA 4WV1C 2QJIA 1RPKA 1SFHA 1EV2E 4KAQH 3WIJA 1IZKA 2FEDC 1RZFL 3U2SA 4OZIB 5G2WA 2XG4B 5T3XL 2VP8A 4HGMA 1J88A 3QPXH 3UD6A 2V7NB 3QW4B 5EGRA 4RFOH 1F6PA 1SXNA 1PCXA 1UR4A 2ZXDA 3V2AR 4F0KA 4WHCA 3SB3A 5HI3D 4M6QA 3K91A 1G7JA 3QUHA 1GG1A 4XN2A 4C1LA 1JZGA 2P8LA 1RVGA 3RNQA 3LLDA 4OFQA 3T81A 2NQLA 4XMPL 1NFDB 5L0QC 2FD6L 4WK2B 1QEWB 4R7NA 1L6GA 1SGKA 4HZ1A 2HBXA 3BO9A 1PU0A 3HR6A 2ZADA 4HA4A 4V1XA 1DIOA 5EG6C 4G2AA 5FHBL 1N6UA 4Q6IB 4DM2A 4UF7C 5D7SL 4ZMQA 3AU1A 3UBXG 4KRPC 4MNQD 5D1ZB 3DVNA 3MC0A 3WTXA 1XXDC 5CLWA 2DZSA 5ID1B 2B0MA 4W7VA 2WW5A 1Z3NA 1HJBC 3GKWH 4YHIB 5DD3H 43C9B 4U3AA 3NM3A 1TPH1 5KVEL 4EDWH 2ZUXA 2DFAA 3VK5A 1E6QM 3CDGA 4O4WA 4TX9A 3EH1A 1NUNB 4HJ1A 4FP8L 4C6MA 4JR5A 4J2QA 4E9WA 2GLKA 1BBDL 5I1HL 4M6NL 3G1RA 4BQ9A 3SDAC 4POUB 43CAB 3TVMD 3O9WA 3QFDB 3AIWA 4QI3A 1SXCA 1ZJAA 3NZ8A 5M17A 4GSDH 2VLJE 4FKKA 1K3ZA 5CJQL 4KIEA 5ABAA 4GB9A 1BFVH 4J3UA 4LAQL 4J3ZA 2VDKB 3ZN6A 4JGNA 5AAMC 5KYWA 2IDTA 4YR6A 3O6KH 4KRMB 5ICYA 3AQZA 5F7MC 3VFWB 2LVEA 1EX1A 5FECB 4AKOA 4AWTA 1FQ0A 1YEJL 5C0CD 4MA3A 4CN1A 3TBTB 3M1ZA 2J20A 1MG3C 2NY2C 2BFVL 2G9HB 3OKEB 4GFSA 2GEQA 2FYVA 2B1AL 1JHKH 3RBSA 3KRSA 1BVLB 3WD5H 4AKPA 4XPBH 4DQWA 5H4ZA 5J1AB 1L8NA 4I2XE 8A3HA 1WAUA 3IARA 2DM2A 3KYKL 1BQHB 4U4MA 5E24E 3FT0A 1JNDA 6REQA 1TZZA 1JK8A 5F8RC 3NCYP 2ITFA 2DQFB 4D8OA 4HJTA 2RALA 1I8LA 1MOEA 1FZKB 5BU6A 3V36A 1I2PA 3FXYA 4NJJA 1CLKA 4X98A 3FQTB 3VKDA 4A04A 1OK6A 2HEJA 3NPVA 3HG3A 2WD0A 4M6VA 4LSSL 1TMQA 1AZZC 3PFMA 1B4JH 5MEQB 1VGEH 2WIMA 3SYOA 3MGTB 3OKOA 3H70A 4P4KC 2FL5A 3FQUB 4BUQA 1P4UA 1WTLA 3EJSA 5FF3A 2KS0A 3NN8A 3BVNB 4UTLA 3STLA 5DUPH 2PKDA 3F58H 4HISA 5CPOA 3UBXB 4P9HH 3RGTA 3WH6A 4KK9C 4UQ2B 1B6DA 3UF9A 2DDXA 5I3JA 4UQCA 4FA7B 3WFEH 1QW9A 5IOPB 1TPB1 4TV3A 1KXQA 3AICA 1ZV9A 4MCNA 2OTUA 2CLOA 4O8AA 3WU1A 3B2UD 1T1YA 4DAGH 4XN8A 4PD4K 3MCG1 1ZALA 1NDGB 4WVRA 3L7RA 5B38A 4U6VH 1G1KA 4U1LA 1BX2B 5HDOA 3SKOA 3SE9H 4NFBA 3KOZA 1VGAA 2YSSA 2XV3A 5C8BB 2BOBA 1ZXKA 4QT5A 2B16A 3UT0A 3ESUF 1NMAH 3F5KA 3SE4C 5J06A 3DX5A 3ROLA 2KQMA 1OHLA 2NSMA 1V7AA 3BLIA 3S35L 4KJQC 4OLZL 2F7QA 1H6UA 4PJ7A 5KVFH 4MNQB 4AISA 4TRPH 3K6FA 4WNQB 1GTFA 4JX5A 1UASA 1H7NA 2GDQA 1AO7B 5CEYA 1CICC 4ZOEA 1FQ9C 2EYTB 4W7WA 3AG3B 3RPKA 2PXYC 4IBWA 1QI3A 4V2CB 1NCDL 4A7UA 1QZ1A 2FTAA 1R5IA 3JYBA 1YNQA 3AZUA 3OVRA 1XGTB 2PWEA 1ZAGA 2KZWA 3TVMB 5KJRL 3STCA 4JTAA 3TA3A 3REVB 1MQPA 2VYOA 4NC1C 5KWYC 1TU2B 4YVUA 2ZZ7A 1CD1B 4FEZA 4AQZA 4DZ8B 5GGQH 4RGND 2ZWZA 1TX0A 4WIQA 2VIRB 4ROQA 1YNTF 5FJPA 1BEYH 1DJHA 3MV7A 4M29A 5C0CB 3L7EA 1JQVA 5CZXD 2XVPA 1DFBL 1F5WA 3FFCE 4LAZA 3KYMA 2YW4A 2VDLB 2OZ4H 4KXCA 2WIIA 1F97A 5D2LF 4O2FA 1ZWIA 1Y7VA 4ORGB 1XC4A 3ZDXE 3APMA 1P2CB 3DHPA 3FSVA 3KHDA 3FUIA 5FEWA 3OTTA 3WTUA 1NUDA 1I9JH 4OZGA 3KS0J 2PWFA 3ILDA 3DHMA 3QN3A 5D6DA 3TP4A 3TWCL 1X5ZA 4HKZB 2GTZB 4GH3A 4LSVL 3MNMA 4DTGL 3FB7B 3T08A 4PUMA 1NL0L 2WINB 2RA1A 4YSCA 3VI4B 3TT1L 3G24A 1BQCA 5CJOH 1LM1A 4UV7H 1U8PA 1OF2B 5ECUA 3C9NA 3QG6B 3URBA 2J8OA 2WQAA 4Z7WF 1YEIL 5AFDA 2X0SA 3MNWB 2GQAA 5EU4B 5I1GH 4FABH 2WMIA 4S11A 3ZE2B 1IIIA 4UNTA 2PP3A 1U3YA 5IMLA 4JFUA 3EKLA 4KVPA 3OL2A 4I87A 2L7JA 3OIXA 2GYSA 4EI5C 5GJTH 3DIFB 4XAZA 3UEZA 3DX8A 4MG4A 1JWMB 1AXSA 2AQOA 2WMKA 3VXMB 1Y6KR 4L23A 3HHSA 3MNVB 1PBYA 4REQB 4G1EB 3KDMA 5EZIL 1I9IH 4YZFE 2B0SH 4F9LA 1OFQA 1TV8A 1KELL 2E3VA 2E7HA 4DT2A 3HPZA 2R4SH 4WUUA 1S9KC 4GY4A 1N26A 2ZRZA 1E4LA 3FRUB 4OZIA 3FQXB 2XG4A 3L0GA 1JVLA 1OX4A 2DSZA 4M51A 3BDBA 2YL8A 4JPKH 4D6JA 3G5WA 1E9LA 5C6TL 4P9HC 3MZNA 2W3ZA 5AOZA 4QTIL 8CGTA 3AU6A 4NQCE 4KQ3H 3D08A 2V5KA 1EEUA 1TJ1A 3QJZA 3EPOA 3I6LD 1MCQA 3B8UA 4H6KA 4YGAB 4PBWD 4AXWA 3VGAC 5ICZB 3TKFA 2R23B 1NEZG 3M47A 1LO4L 1HJXA 3WQGA 1QTWA 4EXAA 4YC2C 2YZ1A 1RIVH 2DZEA 2WLJA 2DYPD 2P1YA 4JREC 2ZT9C 2YK1L 3AQXA 4ICXA 2F7OA 3VA2C 1QK2A 1DWFM 2HLFD 2QQKH 3X14A 1JTPA 4NAJA 3K6IA 3U2OA 4H00A 4Q8WA 1MHPL 1YQ2A 5HNRA 3BVJA 4DPAX 5DJZA 1FWEC 1IEVA 2Y85A 2X7WA 4ZE4A 2EDYA 5ERWB 2IMNA 1ROWA 3RGVB 4XMWA 5ID1A 5GNXA 3JZ7A 5HGAB 3FOKA 5IHZB 3R4RA 4MQXD 2EH8H 2EDBA 3BMXA 43C9A 4RGNB 1DJXA 1JWSB 1EKOA 1XSIA 2V82A 3BSHA 5KZ6A 3ES6B 4Z7UE 3QZEA 3BDYH 4PV1C 2NY1B 3MA9L 5LNRA 1VESA 1W1VA 1VPOL 2R15A 2BNQD 3PJSB 4JLRB 4JTKA 3QFDA 3L4ZA 4IKNA 3ZPDA 5D7JD 3U7WH 1ZP4A 2IH9A 4FXKB 4Y9MA 3SIMA 1G7HB 1E7VA 5M95B 3C6LB 2XH2A 4ZYKB 2A9CA 5HHMB 3NSMA 4AX7A 2OP4H 3K81A 2R0ZL 3BLKA 1WKDA 2POTA 2J6VA 1GHRA 1SHXA 1JQXA 5FECA 3ARED 5AW2B 2G9HA 3OKEA 5K9QI 4QRQB 5L6YL 4HA3A 1BGXL 3PBMA 3DBNA 1JV2A 3EZ4A 2F5AL 5J1AA 3CBJB 1D8WA 3MO7A 1LROA 3II2A 5D7IB 1BQHA 5EORL 3NTYA 3RGBA 1JJUA 3RPTA 1KJ2H 2CLHA 3AY4C 1K6AA 2DP3A 1SDDB 4GOSA 5AKRA 4BWTA 2R1KA 4FZEL 1JPTH 1NLDH 1FYTD 1PSKL 1SOXA 4A3HA 4XVDA 1SN2A 3B8DA 1G43A 4P23D 3P67A 2D2HA 3PHSA 1O1ZA 1NEZB 5FJUA 1KFAL 1FZKA 4HJSA 1GSKA 5AAWC 5EU6E 1CT8B 4K5OA 2FDSA 3KBMA 4L6HA 1XF0A 4ZFOA 3MCMA 4JO3L 3SRHA 4P2YA 3T2NH 1C3FA 3TSMA 3MGTA 1AL8A 1K7EA 5RUBA 5KTLA 2G4FA 3U1SL 4D9QD 2YBRA 2YCKX 3FQUA 1A9EA 2F53D 3QY8A 3BVNA 5FDWB 5CAYB 4CMHC 3UBXA 3IRDA 4E4PA 3FT4A 2JV6A 4UQ2A 3GUWA 4JE0A 4WTQA 3HE7C 3MBFA 2PP1A 1MRCL 3MNZA 2PE4A 1NU5A 5E1IA 1I45A 1BQSA 1MMFA 3TLRA 4V1DE 3ZTDC 2D0GA 2ZA2A 1IEXA 4NWUH 2P0OA 1P5UC 2NMSA 3F2LA 3P3RA 5GS1B 2H3NA 1AMXA 2PC8A 2FVKA 3MCYA 1I1YB 1NDGA 4LSTH 1GOWA 1RV8A 3S3DB 4KKZA 2AGTA 1I4FA 2HNHA 1TF4A 1OYBA 3WOVA 2FGLA 3GS6A 4K3EH 3EDJA 4HAFA 2EAEA 1PFCA 4XX5A 4KMQA 2OELA 3BV7A 2YDAA 1AQKH 4V11A 4CVZB 1A5BA 4JTTA 3ZKXB 2VE6A 1M2VA 4JX0A 4S3AA 1IE4A 2FBJL 1A66A 4PCYA 4CNNA 2V2WA 4YSQA 3N85L 4MXQC 1T40A 4MZRA 3F01A 5FWRA 4WNQA 2Z4GA 2ADFL 3ZTJG 1ADQL 1AO7A 2A74A 4L8DB 3C2VA 3Q6GL 4ZMVA 4FMFA 1QI5A 1W1A1 2J27A 2Z2UA 5AVHA 1DTUA 3FT1A 5ENLA 3P9LA 4LQ1A 1MW1A 1VLWA 1NGQH 4U1KB 2QKSA 1XGTA 4LCWD 4JFPB 3QJFB 4LCCC 3REVA 3EMZA 5L88H 5L4FA 2BY3A 1RQBA 1W37A 4U6XB 3WCYA 5ESAB 1N68A 1Q6RA 1BJMA 3QUXA 1TU2A 2Y7GA 3LN5B 1CD1A 1WT5C 5I3GA 4KTDL 2PDPA 1V4YA 2VIRA 1B3YA 5E8DH 2XVKA 3B9AA 3S88H 4ADGA 2IWEA 3KAAA 2X1PA 2GOKA 5EH1A 6ENLA 1GVIA 1AS8A 4MDJB 4IMKA 1EFXD 1GIGH 3CK0H 4YHGA 1CG9B 4XOAA 4MMXA 1ZLPA 1I1AA 2IADA 5DDHB 4JKLA 4YS4A 3EJPA 1M7IB 3MV9A 3TZFA 1TSHA 4ELDA 3FFCB 3EWWA 1F3RB 4PGDB 1YMME 3G1AA 5I71C 4ORIA 1A7RH 2Z6JA 4NT6A 3VXSD 4LEEA 4ORGA 2CHWA 3QI9D 3PPEA 3UZVA 3ME0B 1P2CA 1GY1A 5REQA 6PTDA 2P48B 1UWIA 1YEHH 4AIEA 4AY7A 1YNKH 4DPQA 5FFLA 2FFIA 2QXWA 2O6FA 1RCQA 4RDQG 5FX3A 2TSYA 4HT1H 4AK1A 4N2IA 4P23B 3CO8A 1C5BL 3SOBL 4OQTA 3I6EA 4HKZA 4PRHD 3FB7A 4F4RA 2OFJA 4CBPA 4L4TE 2WINA 3IACA 1NZRA 4DJEA 1BLIA 3NIDB 1GY2A 1Z0NA 4CVXB 1LJMA 2HUEA 1LOLA 3MYJA 1TJXA 3QG6A 5E0FA 3MNWA 3DWTA 5EU4A 2F53B 3QRLA 3N44F 5HY9B 2YD3A 2G0KA 3T6QC 5CPQA 2DPEA 1W3TA 4OLWL 2FZ9A 2GTQA 5IFJB 1WXZA 4NJAL 2AEPL 2AK4A 2WXLA 2P45B 1JWMA 3VXMA 5DHVH 1EXUA 3TIEA 4KAQL 3RNKB 3MNVA 4REQA 3H7LA 4GG6F 4W85A 1RZFH 1PHWA 1OQFA 2CUMA 1A6PA 1DVYA 2FWOB 4WX2A 3G8RA 1G6VK 5T3XH 5ITBL 1UH3A 2HLAA 2XQ0A 2DMGA 1ZLVH 1WFMA 1R3QA 1RI8A 3FRUA 3VIJA 2J8FA 1AZUA 4D3CL 5BPPA 4EXQA 2PF0A 4ADSA 2ARWA 3QUKB 1T2XA 4UT6A 1KLGB 4F40A 3WS6A 3K30A 4QXTB 1EXHA 3TN4A 4AD2A 4PHXA 4NO5A 3ZL4H 3CLEH 3TS8A 5LIWX 1EZWA 2VXTH 2MJWA 5JW4N 3ARBD 4KXZH 4E2DA 1ZDQA 3EGXB 4LLMB 5JXED 4XMPH 3O3DB 1P6AB 4N0CC 2FD6H 35C8L 5FF7A 2WVUA 4YHKL 3EJTA 3P2BA 5ICZA 1U8KA 3MREB 4KV5F 1OWRM 5CC3A 4UBDC 2E7LA 3SCMC 4HWZB 5FHBH 1UD5A 2O9RA 2V8MA 1ENUA 2VDNB 2LOEA 3BUBA 4ZO8A 4UFMA 2PF6A 2GY7B 5D7SH 4J23A 3ZHKA 5IQ9B 3UVIA 5CGTA 1EFZA 2FMOA 1DWIM 4RMWA 4DO5A 1MHHB 2QHAA 2PC4A 4LALA 3NBNA 3RGVA 5KVEH 4M3PA 4F7CB 4JNMA 5HGAA 3VX0A 3N34A 4YTQA 2AXHA 3BFQG 2BNRD 3NUKA 1K70A 3QSTA 1JWSA 4FP8H 1GZ1A 2DM7A 4WW2B 1QRQA 5I73C 3NDYA 1NSNL 4U1MB 2JQZA 5LBSA 4AV0A 3ES6A 4M6NH 3K46A 1KTNA 1E6XM 4NQDB 1SRDA 1EFXB 4Z7UB 4YXHH 3KCJA 3NGFA 3W1UA 4ZFZA 2NY4C 1XF3B 5HDLA 1CF8H 5CJQH 4N0RA 2FQDA 4FXKA 5SX4I 4KJPC 1IXQA 4LAQH 4NZ1A 5GGVY 3C12A 2E09A 1J12A 3C6LA 3F7LA 2Y1ZA 4ZYKA 1PTDA 4A7QA 3QI9B 4AZ8B 3MKGA 1EL3A 2I5GA 1F1AA 4IPLA 1YEJH 2QL1A 4XBSA 4I9MA 2CIKA 4LLYB 4XAPA 2BFVH 2B39A 2J44A 4HWEL 2PD9A 4O58L 2K70A 3W5NA 4HJ0C 3GJFB 4PRHB 2C3GA 4QRQA 3E9AA 1PW3A 3S83A 1C9WA 1XB8A 3KYKH 4JOMA 2XTJB 1S2VA 4G5DA 4LPWA 5F1NB 3VRLE 4K3ZA 4K7PY 1JPDX 1KGJA 3CVHL 4Q52A 1SDDA 1XTLA 3L0KA 1A4BA 2ZYFA 1KV5A 1RJQA 1VIZA 4RRPG 3FEMA 4WJKB 2VDQB 4RAUB 3T0EE 2X2UA 4ES4A 1VZWA 4LSSH 4JZOB 5GGSB 1XIWC 4JYFA 1CT8A 1QI0A 2ICES 2WO5A 1KV3A 1TQXA 4Q9BA 4Y4FB 1VFBA 3T0WA 5DCDA 2CSPA 1QHOA 4WY0B 4TUJA 2J47A 5GSVB 4HS8H 2ZD0A 3M0HA 2GITB 5FYLD 5DS8A 3F58L 1T5WB 1UWXH 4UQ9A 1BPLB 4DZHA 3L2IA 2IF7A 1B54A 4EE2A 3FGCB 3FUHA 2PDKA 1FHNA 1SUJA 3FCSA 4LRIA 3WK0A 4YPGB 5JW4Q 3BQVA 4Z7NE 4HOZA 4DAGL 4XNYL 4TTGA 5F2LA 2FZNA 2WQPA 1FL3B 3O2DA 1I1YA 3V5KB 3AHZA 4GO6B 2OTDA 1DV7A 5E5MB 3SE9L 4MD4B 4LOUC 3L3JB 4FX5A 3D30A 3AU2A 3BE7A 2A4EA 2FB3A 3UXIA 4GSQA 4QCIA 3NIYA 4DSYA 5CZRA 3N55A 1UB5B 4QYOB 1T20B 4WFGD 3D46A 4I9TA 2VC7A 3C0LA 2F6XA 4U7KA 4E0RA 3ARGD 2DLEA 4P8UA 4C57C 5IESL 4EACA 3TCXA 4A2EA 2QS8A 3TBBA 2BNRB 4B7IA 2Y62A 4CLMA 4ENED 4LVAA 4XMKL 4L8DA 2CZFA 1E5JA 1C8VA 1NCDH 5JW5A 1MNNA 1OIOA 1R3LB 4EXKA 4DP1X 4QE1A 5JTWA 4WHTB 1PCKA 1AACA 3KTSA 3S37L 5KJRH 3IU3B 3AGVA 1ZS2A 4FI4A 2VM4A 2YGPA 4PH8A 4AEEA 1GGYA 4OLXL 2JLLA 5HDBE 2UXVA 4JFPA 3LERA 2A3BA 5IHBA 2XT1B 2WJZA 3PWUB 2A7PA 1ZBWA 4ZMNA 3DX9A 3MV7E 4U6XA 4PJAF 5ESAA 1AH1A 1N0LA 4HEPG 2XDFA 3LN5A 3T5WA 1KQZA 3GGWB 2Z0BA 1IKNA 4PVMA 3D85D 5I17A 1I1FB 3WIIL 3GIYA 5A6JA 3WFDL 2WLHA 1DFBH 4MDJA 3BSGA 3I02B 1WAAF 4GMTL 3ALFA 1CFVL 3WLPA 5AY7A 3A4AA 5D71L 3AMKA 5DDHA 4AJ0A 3CZGA 3R7QA 3AWOA 5FA4B 1M7IA 4YMPA 2GPTA 3FFCA 1OFOA 4J3OH 4RGOL 1JPFA 4ZOAA 3OGOE 3BUPA 4LFYA 3MUGA 3K0YA 3EG9B 2MNUA 3U1QA 2XACC 2VISB 1UQSB 2HRGA 3MJ7B 3R06B 4LSVH 4J3VA 2Q1EA 4DTGH 2X10A 4JFDB 4YXKL 2AJUL 3TT1H 1RVKA 2A6NA 3I6TA 2E1WA 1T22A 3HIZA 1BVWA 4UV7L 2C4XA 1ZAJA 1YEIH 4FHJA 4E9LA 4X83A 3VOCA 4MFDA 4TQHA 5I1GL 1XGEA 5FF4A 3WSUA 4E3TA 1L3NA 1J1XH 2XYBA 1JERA 2NCMA 3AQUA 3N2JA 5JPNC 1CLXA 4QRRB 1JNNH 2YUWA 3RB7A 5HYEA 5IFJA 4A7VA 4JFOA 5EZIH 4XC3L 4OZIE 1A22B 4MMZB 1I9IL 1GW0A 1KELH 5LCVA 3RNKA 2VABA 3VCNA 3T3PF 3G18A 5CO1A 2Z2AA 2FWOA 4CU7A 3MSYA 3WLHA 3UCCA 3JS3A 4CN4A 3F2CA 2HKFL 4GISA 5C0ND 3NJGA 3HPJB 2VZSA 4GP4B 5KSBF 5DCEA 4HH9B 2Z4TA 1QPKA 5AHMA 4MKVA 5C6TH 3RI5K 3P81A 2IH3A 3EGJA 3QUKA 4QTIH 3JU2A 1KCXA 4W86A 2XIOA 1XV8A 2A5HA 3Q0HA 1NFDE 3DKLA 2R27A 3ARUA 2OOGA 3N41B 3B7YA 2INZA 1RL1A 5DMKB 1EGMA 4NQCA 3R7RA 3UZXA 4ZO9A 1LO4H 1UUOA 3QQ9C 2NY6C 2FT6A 2E6YA 2YD9A 3QJQB 3C60D 1J5HA 4C5YA 3SGJC 1JWUA 4GRMB 2YK1H 2RBLA 3NFUA 2QCHA 5EMLA 3UJSA 1G4TA 2NUTB 3CXHJ 1MHPH 5LSMA 5IQ9A 4YWGL 3VNDA 3IJEA 2BMBA 3T9PA 2CNCA 4YVVA 4EDXB 1B30A 1XHGA 1MHHA 2C26A 3UMTA 5JHBA 3VPLA 4EUPA 4FR1A 3UTPD 1HQTA 4C91A 2EH8L 3VXQA 4PULA 4F7CA 1V8HA 4ZAKD 1SJBA 1KCZA 1WKEA 4ZXBB 3QEUA 4O02A 4QNEA 1IT7A 3TSDA 3D85B 3E80A 3N0AA 3RM4A 4WW2A 4KX7A 3M5XA 3MA9H 1H2JA 2KZBA 2I5YL 5PCYA 1VPOH 3U0WL 1MO0A 1I2RA 2ZX7A 2VC9A 3KBEA 3KVQA 2O55A 1J1OL 4JFYB 3LN4B 3UAJA 4Z7UA 5EEVA 4NNCA 4RK8A 3KLHD 2QGEA 2A6DB 3ABRA 1LMKA 4GLRI 2FO1A 4HIEB 5KZCB 3BYTA 5DD1L 2WQRA 1ZA6B 1P0KA 4TOYL 1EF3A 2Y1VA 1W6WA 3Q5OA 2H8PA 1J5TA 1E0WA 3W2NA 4QG9A 3QUMB 1U36A 4HUUB 1U1HA 1F9CA 1JPST 4X9IA 1DORA 2AAMA 5L6YH 2IOMA 4MNGB 3OZOA 4AQ1A 1BGXH 1W0WA 1HXKA 1U91B 4L1TA 1EAPA 2DD8H 1C08A 4ZO6A 3T9WA 4PRNB 4NSKB 1ITXA 4Z2IA 4HZ6A 1WA3A 5AVYB 1K3UA 2VZ1A 4J3OC 5KSUB 5DCCA 4FZEH 2FJGA 5A8PA 3H1ZA 1VIWA 1PSKH 1XSOA 1Z7AA 3VDAA 4C4KO 1GZHA 2YLAA 1KFAH 1QLFA 3H24A 4K94L 4P9ML 2KPNA 3A4DA 3L3HB 2C34A 2V5RA 5CILL 4JO3H 4ETQB 3T0EB 2JI1A 2DAVA 1XGDA 3KDOA 2PPGA 4A8IA 3TOYA 4PLOB 3ITGA 3BPNC 1IEIA 3U1SH 5EV7A 4Y4FA 3DSFL 3BO8B 5C0JA 3D33A 5GSVA 5B8CB 2X88A 3H9ZA 5AW8B 3IJ7A 1KNOB 4CDGC 3ECBB 4JRXD 2GITA 2EO1A 1T5WA 3CFTA 3QJHA 4Q7DA 4KW2A 4AYFB 2G3NA 4NLAA 5ESQB 1MRCH 2O72A 3LIZL 3VNLA 4QRUB 3FGCA 4AIOA 1CGVA 2XZZA 5EU3A 4HNUA 2MIZA 2RB8A 1A0QL 5EZPA 2J88H 3BARA 1IIHA 3K6SA 4V1DA 3S8FB 3W7PA 3IRZA 5IMOB 2EDEA 1FL3A 3OAZH 4UTJA 3C60B 4K3EL 9PCYA 5G5DB 3AHTA 2RJMA 2OBGA 4KNQA 3ELFA 4NY2A 1AQ0A 2OQYA 3L3JA 5B39A 3V6FA 1OZUA 1XYAA 2BS9A 5D9MA 1UM4L 2J7LA 1T03L 4MNQE 1OT2A 2A9NL 2XY2A 4TV5A 3B34A 3IPFA 1UB5A 4AWSA 1OK0A 2FBJH 1ODZA 4QYOA 1T20A 4C83B 3PBVA 3N85H 1KWKA 3QKZA 5C9ZA 3BVWA 3DTXB 1ADQH 5F0JB 4UOW0 5CCJA 3Q6GH 4C7DA 1NQBA 3TCEA 4C6BA 4N4PA 4G7VL 2DKUA 3L2NA 3OHXC 1V6VA 2B31A 3TNOA 2E7FA 3RVXC 2RH0A 3QSKB 1R3LA 4CD7A 5I0ZA 3Q13A 3MLYL 4XBKA 4EPDC 4I89A 3DRTB 3OAYH 3QV8A 2BOFX 3IU3A 2VI0A 5BUAA 2DSKA 4AOFA 1LLZA 1GR7A 1FWIC 4EZKA 2Z4QA 5CPSA 1KBKA 3Q9QA 2X28A 4XPFL 3PWUA 2P50A 5HDBB 1OE1A 4KTDH 4YCOA 4RRPA 2R2BB 5C0CE 1FIGH 1WPCA 4HU2A 4GY0A 2BSLA 3NZRA 3GGWA 4I1RA 1QAPA 3KJ6L 2QZRA 3C5XA 2VDML 2HK1A 4K7FB 4MSWB 2H9AB 3UAFA 1EA0A 4MD5A 4QY8A 2MTPA 1XXXA 2QCDB 5DK0B 3ZIYA 3C6EA 4JHBA 3V0SA 3UABA 3ZS4A 7REQB 3ELAT 2DJSA 5CC7A 3TFBA 4Q74A 1TJIL 4Q9QL 3GDBA 4BE6A 5FA4A 4B9KC 1VKXB 5CIPA 4OZFA 3RMEA 1A7RL 1EWDA 3M5YA 5EKYA 1XF2B 4AD4A 1YMMA 3GX9A 1N59A 3VB9A 3COTA 4HT1L 2SODB 1C5BH 3VI4E 1UQSA 1QHQA 3SOBH 5HNNA 3KPLB 1QFWL 5XIMA 2XV0A 3MJ7A 3R06A 5K4XA 2QFPA 4JFDA 4ZBCA 2CA3A 2ZXEB 4ENLA 3TCTA 3BUTA 2WOQA 3QG7L 5B3JF 4FSAA 4JNZA 4X9GA 3RJXA 4HSAC 3ZE2E 4FQPA 4XC1L 4L4TA 4P57A 4LUIA 3RVTD 2J5LB 2XWBB 1RZMA 3BUIA 1A4CA 4JRXB 4S38A 4OLWH 3BCFA 4X7SL 1UWAA 4NJAH 2AEPH 4U1SA 5BMFL 4YU1A 3R43A 4QRRA 5HYQA 3QXWA 1G84A 1QWHA 1WAWA 3BAKA 2F7PA 3D3VD 1GL4B 3INUL 5HDWA 4IH3A 4FGMA 5ITBH 4G6ML 1U58A 2WTOA 3O6AA 4WY7L 2FZ3A 3BWUC 4WKZB 4D3CH 2JEPA 1AOZA 2AJZA 3U7YL 4F2BA 5D1ZI 4I0PC 3HPJA 1HEZB 1XRSA 2PDIA 3SJVD 3U0HA 4HH9A 1O5KA 1XRTA 4F2TA 2X7LB 3DIDA 1F1GA 3ZL4L 3CLEL 4GAAA 2GUOA 5HWJA 4NKCA 1E6OL 2VXTL 4PZVA 4HEPA 2NXYB 4U1IA 4XBEL 1YTDA 2MEJB 2KHAA 3HQ1A 3LXCA 35C8H 4PJIF 4YHKH 1E43A 3W1RA 5DMKA 1CJYA 1U8JB 1FAKT 3NGJA 4HTBA 3V95A 1T41A 3JBG7 3WBEA 4M61A 4PIRF 1W6TA 2HPTA 3DFPA 3ATBA 5K9DA 4GRMA 3RXZA 3DSNB 4L37B 3S9ZA 3VG0L 2BGSA 1FGVL 3VA8A 4AGNA 1HHKA 1WDWA 1M41A 4K9JA 1ZV5A 4G9DB 2ZF9A 2OTPA 1T96A 2NUTA 2DJLA 5KZDA 4ES8A 1XVSA 1CD8A 5ECGA 4OT7A 3UZQB 4RGNE 5FGCB 2Y8VA 1CI3M 1S5HA 2IPUG 1TTPA 3NDYE 1GTEA 9XIAA 4MUPA 3WF4A 1WZAA 2DWYA 4TKWA 5DU7A 3AALA 3EYVA 4BSWB 4R34A 5EBAA 2E7DA 2Z25A 1NSNH 4FRWA 4ZXBA 3SDXE 3DKJA 4PJHB 4Z1CA 3A5FA 4JY9A 3NVDA 1ZV2A 2HX9A 5CR8A 1IXOA 1P9MC 1N2RB 4YXHL 1MAML 3X1GA 3FOLB 4GBXB 2FUQA 3FQYA 5HHME 1CF8L 3EWDA 1FKWA 2G4GA 2A6DA 2Q6ZA 3QWOA 4CN6A 2X1RA 4QXGL 2A9DA 5DC4B 4HIEA 4YHYC 4AENB 3EFDL 4P46C 3N1FC 5H35A 3F5JA 1ZA6A 4HLEA 3X1FA 4YH6A 4K2SA 3FTGB 3IFOB 1P53A 1LRTA 5EZJA 3ASNB 5EBLB 4HWEH 1MJ7L 4O58H 1Q6FA 5A6TC 5D7IE 1O7DC 1U91A 3M0ZA 3LPOA 3UBXI 1I8UA 5GS0H 3HHRB 1DJIA 3FTZA 1D7FA 3CB8A 4FDWA 2NV1A 3R8RA 2YPLB 4DB7A 3UJ2A 3EH3B 3CVHH 4Q4EA 1DIKA 4I85A 2NX3A 1IAKB 5KSUA 4U05A 5I00A 4R4FL 4F1SA 3VVWA 1H63A 1A3XA 4GQZA 1PDZA 5GSRB 4QOKD 3U48A 3RWDB 3PS7A 2ITCB 1H3VA 5HANA 5AZ1A 1MHCA 1H7RA 3IBOA 4ETQA 3T0EA 3D3VB 4YNYB 4J39A 3P2DA 4NQSB 1GOXA 5CUSL 1S6NA 1R3JB 1D7BA 4DHGA 4HYWA 3QQ0A 1C8YA 5GIRB 4HS8L 3ISYA 5C9KA 1EBHA 2F6AA 1RQHA 4Q9RL 5B8CA 4NF7A 2RQ8A 3TLLA 1KNOA 3SJVB 5CP3A 3R11A 5DQ9B 2W61A 3G04B 5H2BB 1GHSA 4IBSA 3O2LA 3I6LE 4H88H 2ZKHL 3VIGA 3X1BA 1LRQA 3W1QA 5FIPA 1TENA 3RCYA 4XNYH 2OL3L 5H6HA 1NFPA 3W7IA 4DP4X 2YA1A 1M4KA 5TDNB 4G1NA 3V6OE 3A6CH 1JJKA 5IMOA 3W74A 4Y9FA 5G5DA 4B5XA 3SADA 4B3VA 4JFED 3U6RB 1Q2RA 3C2AL 4GABA 2YD7A 3G77A 2WXJA 4YHNB 4NUMA 4RAHA 5AECA 2DTSA 1KFKA 3BH4A 2H26A 1AC0A 1TO4A 2V4LA 2B4CH 5I03A 3DGGB 2J1KA 5CD5C 5IESH 3IMSA 3SBWA 3GEWB 3QH2A 3L3IA 4NCC1 2WHVA 4DKEL 2WNQA 2CD0A 4XMKH 4R3SB 1XDLA 2NV9A 2D2CC 2VWSA 4LDCA 5IVXB 1W56A 3SKNB 4L4JA 2BNQE 3CFQA 1ZIBA 4HNOA 1KLFB 1H3GA 4AHQA 2UZYA 3TJXA 3S37H 2YCLB 4MX7A 3CBWA 2VGGA 2ATSA 3CE1A 4OLXH 4UCFA 3QV6A 2X7VA 2ATPA 1RPUA 3V9CA 2V7HB 4QHNB 5GPRA 3GZQA 3WDHA 1E65A 3WMCA 3MRIB 3WEMA 3L9CA 3MW7A 2Z3FA 2R2BA 2FIRT 3APTA 4DBSA 3QWRA 3WIIH 3RZCD 4OFPA 1GOQA 3WFDH 3E6FB 2BOGX 5BRZD 4K7FA 4MSWA 2H9AA 4X5PA 3WUGA 2O7SA 4GMTH 2FLMA 2HTMA 1CFVH 4F33A 5D71H 5GGTL 2C1PB 3BN9C 2A9ML 3TESA 7REQA 1ULVA 1YEDB 4HUKB 5SWSD 3GEFA 1JTOA 4JDVB 2BWDA 4RGOH 2WOYA 3EGSB 4GQ9H 3L4CA 4JN2A 3M16A 4HB7A 4MBRA 5KVGL 3WMLA 3RWJB 1JUEA 1K9FA 3W7RA 4DLMA 1SLUA 4FS9A 4G1KA 1UBPC 3R12A 2RMNA 4PFMA 3NIDE 3EX6A 2LHAA 4YXKH 2AJUH 2GG1A 2QMKA 4QOKB 2GVGA 1JNEA 4IWWA 1HXMA 1E5NA 1DQUA 1EJVC 3JVGA 1N8FA 1CDGA 2OMWB 4A8NA 4FQLL 1XL6A 5I66B 4D9QE 3LZ5A 3UESA 3QXUA 2F53E 4K7PX 5GS0C 1G67A 4DX3A 5DMMA 4YDKL 2BY2A 4DXXA 1SJCA 1IUZA 5E09A 2XBZA 4OKVB 2IPWA 2HNEA 3DOPA 2NX5D 1J1XL 4M24A 1HHJB 3NM1A 1F58L 3QXTA 4W93A 1QWKA 5CKSA 3I74A 4AUJA 1XDMA 5D9SA 4ETYA 4AQEB 3QS3A 4Q32A 1AHWC 1GC1L 1JNNL 3NSNA 2A73B 4XC3H 2V8LA 5I76B 1HJQA 3ZDZF 3O8XD 4I5RA 3CG8A 1H5BB 2QTVA 1F3WA 3QFGA 1BOGB 5CGMA 4L2YA 3CM4A 3GMRB 3VWKD 5GNZA 4O2EB 2OK0L 4A3YA 2HKFH 5JIPA 4N1CA 4IYKA 5I75B 1OGAD 4XXDB 3QZNA 2VWTA 2V7NA 3T77B 3DTDA 4WKZA 1JYVA 5HVGB 1NDMB 1HEZA 2J5WA 5CSGA 3IMBA 3WEXB 3O3EB 1P1ZB 3F1QA 2X4NB 3WSQL 1ZLVK 2NV2A 1BZ7B 3QR1A 3QDAA 1X9LA 4PMQA 4N3TA 1H6FA 1UADC 2HRPL 1ZLWH 4GUCA 1NFDA 4PJ9C 3CPLB 2J13A 4MNJA 3RHWF 3TN5A 1QEWA 2WWOA 2XJKA 2F19L 3BAEL 1KXVA 5F9DC 3OYZA 3QLLA 4H6RA 4FQ2L 4I6VA 2I07B 4DOHB 4LCWE 1IGJB 4R5EA 4KESA 4Q6IA 1NGXB 1W9BM 4YWGH 4G9DA 2ZJSL 3T0VA 3X17A 3DOIA 4XVEA 3FCBA 5JO5B 5D1ZA 2DZUA 5L8JB 1MQRA 4H4NA 2B4CC 2VW4A 2EE2A 5C7ZA 4J3TA 4OECA 5LBVA 3EWUA 4YHIA 1E4HA 1X7SA 5CEZD 5DJDB 3AJ7A 4NQDE 1BIIB 4YVPA 4BSWA 5FJJA 1I1CA 1FNFA 3CCHB 4OV5B 4Y8DC 3RY5A 3U9IA 5AW0B 2I5YH 3RZCB 3U0WH 5HDRA 1XLDA 5BRZB 1J1OH 3SDXB 2CO1A 4BELD 43CAA 5E9DD 4D0BB 2QBWA 2J8TA 3FOLA 1SVZA 4QXWA 4GBXA 1LYXA 3PGFL 3NCCB 4NP9A 2QF7A 4LLQB 5DD1H 3BSMA 4TOYH 3DHUA 2VDRB 4XISA 5FJIA 1LT8A 2NNAB 1V27A 3VFWA 4AENA 3SZ6A 3ITTA 1WNOA 4GX9A 4PRHE 1VFAB 3O6YX 3TBTA 3IFOA 3HBLA 4EIVA 4TNGA 1E4XI 4IMAA 3IGUA 1DVFD 1R46A 2XTJE 1BVLA 2DD8L 1WFIA 3B3DA 4HJWA 1U2HA 4WDTA 3JTTB 2X44D 3NQ2A 1DJGA 2X87A 1T83C 3WN6A 2YPLA 4V2BA 1K5NB 3VGEA 3AI0A 4MPKA 5BMWA 2NX5B 2DQFA 2HSAA 4XUGA 1XRVA 3V9FA 5F7EL 4O12A 2W07B 4K94H 4HTYA 4DPPA 4P9MH 4GYPC 4UR9A 4PP1D 5CILH 3FQTA 3ABLB 3RWDA 2ITCA 4MIMA 1J0KA 4I0CC 2AL1A 5MEQA 4Y8AA 1GS7A 3E6HB 3DSFH 5FYKE 4JTGA 3VWKB 3N06B 3W2MA 4KXBA 1R3JA 4YBLB 4TX8A 4LKCB 1LEIB 5GIRA 4KWOA 4KERA 3ZU8A 3TYZA 2WMHA 2XKNB 3S5LG 1OAJA 2OYLA 2VSDA 3U30C 2C15A 1JZFA 1VERA 3LIZH 4FFYH 4GRWB 3KPPB 5DQ9A 5IOPA 3NK3A 3G04A 3BPLC 1A0QH 5E6IC 3QY6A 4D6EA 3TJHD 4KDWA 2J88L 4OUIA 1UUMA 2A0NA 1UWXK 3CNKA 4JYDA 2B20A 3CHXA 1MW0A 4PJBF 4HC1A 1NOFA 3TW7A 4IMGA 1BX2A 4DGYL 3VH8G 5LXEA 3BH9B 4MCZB 1TE6A 4XMTA 2DYPB 1OX5A 2G2RB 1U95B 3SPVB 4GQ0A 4QGCA 4GLEA 4MHBA 4QGTA 3PUCA 2WP3O 4M6ML 1IIGA 3WDRA 5CGBA 3WYZA 3QEQD 1UM4H 1T03H 1YEWA 1F8TL 2F1AA 1A5OC 2R8WA 2A9NH 2J6EH 4KROC 4W70A 4KZEL 1GS8A 1E1CB