2HJPA

Crystal structure of phosphonopyruvate hydrolase complex with phosphonopyruvate and mg++
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
290
structure length
283
Chain Sequence
b'MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMSTHLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTQELVRIEEFQGKIAAATAARADRDFVVIARVEALIAGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIRAAVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphonopyruvate hydrolase
publication title Structure and Kinetics of Phosphonopyruvate Hydrolase from Voriovorax sp. Pal2: New Insight into the Divergence of Catalysis within the PEP Mutase/Isocitrate Lyase Superfamily
pubmed doi rcsb
source organism Variovorax sp.
molecule tags Hydrolase
total genus 103
structure length 283
sequence length 290
ec nomenclature ec 3.11.1.3: Phosphonopyruvate hydrolase.
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2hjpA00
3EOLA 1ZLPA 1KC7A 2KX9A 4KCUA 4ROQA 4MG4A 1A3WA 1SGJA 3HQOA 4G1NA 1OY0A 1S2WA 1AQFA 2V5JA 1PKMA 3T05A 3QLLA 3E5BA 2XDFA 4FXFA 4TV6A 2G50A 2DUAA 2DIKA 3EOOA 4FXJA 1OQFA 3EOEA 4IQEA 3LG3A 4B5XA 2VGFA 1PYMA 1XG3A 3SRKA 3HQNA 2HROA 1F8IA 4DRSA 2VGIA 4IMAA 4B5VA 3OQ8A 3BJFA 1PKLA 1U5HA 4QG6A 1U5VA 1S2UA 2X0SA 3GG8A 3H6OA 3P0XA 3QV8A 3QV6A 1A5UA 3QV7A 1DQUA 2BG5A 4HYVA 1KBLA 1O5QA 3PUGA 1F3XA 1M3UA 3T0TA 1O66A 3HQPA 3QQWA 4LSBA 1A49A 2HJPA 2VGBA 2QIWA 1VBHA 2VGGA 4WJ8A 3SRDA 1DIKA 4B5SA 4QGCA 1M1BA 1UJQA 1A3XA 3ME3A 4KRZA 2HRWA 4B5WA 4L9ZA 1XG4A 1F3WA 3QV9A 2HWGA 3OYXA 4L7ZA 1JDEA 3R4IA 4IQDA 4YNGA 3KHDA 3T07A 3GQYA 2XZ9A 1F61A 3E0VA 1O68A 3FA3A 4MF4A 1MUMA 4KCWA 1IZCA 1DXFA 3EZ4A 4TV5A 3E0WA 4B5TA 1Z6KA 1DXEA 2OLSA 3FA4A 2VWSA 1ZJHA 4IP7A 3MA8A 4YJ5A 3BJTA 3QZ6A 2VWTA 2ZE3A 3KTXA 3N25A 4L9YA 4B5UA 1IGWA 1E0TA 3PP7A 2L5HA 4KCTA 2WQDA 3G2GA 3IS4A 4RPPA 2XZ7A 1S2VA 5JVLA 4B2DA 4B2DD 3OYZA 4KCVA 2V5KA 3B8IA 4HYWA 1PKNA 3I4EA 3VAVA 4JPGA 1E0UA 3U2ZA 4QG9A 1GGOA 1F8MA 1T5AA 3QTGA 3M0KA 4L80A 3M0JA 4QG8A 1VBGA 2R82A 1S2TA 2E28A 1PKYA 4KS0A 3SRFA 3GR4A 3SRHA 5TAOA 3LYEA
chains in the Genus database with same CATH superfamily
2ZQ0A 4GBDA 1AW5A 3SDOA 4AIUA 2NQ5A 3BC9A 2X0YA 3BMVA 2PLCA 5H1WA 4HN4A 3SN0A 1OG0A 2PGFA 3RRXA 4B5XA 3BW2A 2D69A 1V6TA 2ZC1A 2BB0A 1QT1A 1V4YA 4TXEA 3MCOA 3FJLA 3BAWA 4I90A 3ZWSA 3ZXWA 3DKJA 4GYJA 1LM1A 1Q13A 2HJPA 4S3BA 1N8FA 1BSLA 1PJ9A 1DTNA 1JRCA 5HPCA 1C7SA 1K9TA 2PDKA 4YNGA 5K4ZA 4BQ4A 2IPWA 3ATYA 2WNNA 4I5XA 4FB7A 2QIIA 5CEWA 3MHGA 3VDBA 4XZ9A 1H7OA 3UWQA 1TCMA 1AQ0A 2P76A 3IACA 4DZHA 4DBSA 2GUYA 4DUOA 4MKVA 3GIQA 4Q8MA 4K8GA 3GAKA 4JIHA 1C8QA 2BY1A 1S2VA 4HA0A 3UG3A 3W74A 1XXXA 1OABA 3HV8A 1SFTA 2ZUNA 7PTDA 1CLXA 3WMCA 1H51A 1WAUA 3KBVA 3WDIA 3SUUA 3KL0A 1QNPA 4M24A 4Q8NA 2EF9A 1Q6LA 3K4AA 4TQTA 5FJUA 4IXXA 4A2RA 3EWDA 1ZLPA 4JIEA 3RG6A 4IIGA 4ZTYA 1UWIA 2ZUSA 5CZJA 2W67A 4M7TA 3N18A 2XIOA 4DM1A 3DFHA 3F1QA 1N55A 3QMRA 4XX6A 1JF6A 2G3FA 3SCOA 3V36A 3CQIA 4AY8A 4JTLA 3DYOA 2B81A 4ACZB 1NWRA 5LIUX 3CC1A 3KZPA 3FW6A 1O6IA 3VCNA 3S2JA 4HT3A 3OPSA 3BSMA 5I77A 1K7FA 4PTDA 4UZUA 1MUWA 4O11A 3M07A 3V35A 2X1RA 3ME3A 4AZ5A 4HNUA 4FX6M 2A79A 3BWWA 5KZEA 4ZXOA 4H8VA 1FX6A 4GYKA 3OTRA 3TYBA 3I3BA 3CU2A 2FZNA 4WSKA 1ZU8A 4HHHA 2QCLA 3WDHA 4HMNA 4LS1A 2QHAA 2OODA 3KP0A 5A6JA 1G4SA 3AHTA 3LZ3A 1NWUA 2DZWA 2LLEA 2Y0FA 4RNFA 4PRRA 5CBBA 2VD9A 1GG0A 4W85A 3DC8A 2DUXA 3IS4A 1G01A 1FWRA 2WNWA 2YBVA 3FXYA 1SO4A 4DI8A 3GU1A 2FZDA 2WCAA 1A5MC 1VBJA 2EXOA 3GUGA 3QKZA 4B15A 3V1PA 1ISYA 4Q8QA 4YMZA 1VLIA 1BQCA 2GLKA 2BY2A 3EOLA 3LU2A 5FEXA 3MYOA 4PYSA 1JZ5A 3WBYA 4XSLA 1VH7A 4KCUA 3ITVA 5G1YA 3L9CA 1WE5A 1M7XA 4AW7A 4MDPA 3B8DA 3E5BA 3PK7A 5D9MA 1PSCA 1ZUAX 3LSBA 4FXJA 2ZUUA 2B7NA 4JQ1A 4LX4A 3KOZA 3GWQA 5CBJA 4UMCA 3REQB 1M9HA 3QEZA 2E4TA 4IUOA 3LTSA 1DWGM 3N14A 3SCRA 2FYMA 2PDUA 4GISA 1U33A 4C6QA 4GG9A 2V68A 4CEUC 4XV0A 4OU1A 2A0NA 1UPMB 3GQYA 3N4AA 3M0XA 4MWAC 3S2CA 1TMQA 5GJNA 4JTKA 5CLWA 5FL1A 4YIWA 4Y9MA 2VRQA 1ELSA 1TB3A 3R43A 4ZOBA 5HPOA 3CEUA 3PP7A 1NFBA 1UD4A 3UJRA 2WSRA 3C61A 1ZSXA 4GYFA 2NW0A 4L1WA 3CUHA 2Y5JA 3HGRA 1F5ZA 3BZJA 2E67A 5GNYA 2WJZA 3LLFA 1OSEA 1YNQA 3NL6A 2C19A 1UH4A 4WGXA 5CH9A 3W2JA 2YBUA 3ARSA 4IUGA 3VILA 3LCWA 2R6OA 4TX9A 1UIPA 2RDWA 4F2TA 2QDEA 3IJLA 4WXZA 1LDCA 4UB9A 3VGDA 2DJLA 2QUTA 4A8IA 2BVTA 1CXEA 1FP9A 5D38A 2A3EA 2PTYA 1WDPA 3C2VA 2ZVIA 3V0SA 3ARXA 5BU9A 3EWZA 2A6LA 5A8OA 1UIOA 3PY2A 3TC6A 1W0MA 1ZRQA 2BBFA 3LPPA 4NILA 5D9PA 3K4WA 5LGZA 3LY0A 1TE1A 3FJ4A 3NM1A 1EYEA 1RD5A 2PRHA 9RUBA 4J3VA 3IVTA 3B8WA 3VNZA 2VURA 2FVLA 2BHYA 1AK5A 3USBA 1I8JA 3WY1A 2VP8A 3G1DA 2F7FA 2HMCA 1XLMA 1BD0A 4C6IA 3JUGA 4XO6A 1TCDA 1FH7A 4FMVA 3G0SA 1PEZA 1VBRA 3BICA 1SJCA 1UCWA 1X1ZA 1MQQA 1Q85A 2PDMA 2BMBA 1IQ8A 5F2IA 4UTWC 1W54A 3SEPA 5FA5A 1U2YA 3RM8A 2ZUMA 1W3LA 2X1TA 1LRQA 1EOMA 4JFUA 1LLOA 1ME8A 2WYSA 4GIEA 4O15A 3BPWA 1E56A 4IPPA 4S3CA 4IT1A 1N8IA 1JUBA 2C71A 5F4SA 4V1XA 2Y4SA 5HAOA 3CO8A 2ACQA 2AL1A 3U4AA 1DV7A 3E02A 1ZL1A 4LBSA 3NIYA 3VIHA 4ZOEA 2QAPA 3VM5A 1XYZA 3WQFA 4C91A 4YTRA 2OLAA 1R87A 4JX4A 1TKKA 5BOOA 1H7WA 1ZJIA 3DUGA 2OTDA 1FTXA 2GJXB 3IV3A 3O8AA 4R3UA 4AD5A 2WPBA 1DJGA 1UQZA 4H6KA 4NVTA 3VNKA 2HRWA 3EYPA 1XGEA 2CBIA 2VEGA 4KWOA 3KP1A 2OQHA 2P3EA 4H9XA 5AHEA 1R3YA 1JPKA 1OC7A 3IIXA 5CJNA 1W17A 2J7EA 3GM8A 4PMRA 1L8NA 1XBZA 4CCZA 4CQ8A 4DWDA 4QISA 4TU1A 1L2QA 4OT7A 1R2SA 4W8LA 1EB3A 4Q4QA 5LA2A 3IIOA 4NQ1A 1MEHA 3H8AA 5AFDA 3W7NA 4YPJA 3U2CA 4GJ1A 1V6VA 3MKKA 5HNNA 4Z2GA 3ZJ8A 1Q7QA 1CW2A 2V5BA 1QFEA 4JIIX 1XPYA 4JKMA 4HNOA 5JQ9A 2PUZA 5LIXX 1PKMA 1BYCA 3WF2A 4MJ4A 1V93A 5G2HA 4MLRA 2I56A 4O28A 4AIOA 1W1PA 1W1TA 4TVDA 3M7SA 3SW6A 4PEKA 1YQ2A 2AL2B 3TAKA 4N02A 2ACUA 3KXQA 1AD4A 3IVUA 1XDMA 4GIAA 4Q6JA 2IMRA 1NVMA 1NDZA 4L1XA 4LCQA 5I3GA 1FWGC 4IISA 4R7JA 3VKBA 2X1IA 4S23A 4GABA 4HSHA 4E4FA 3OGRA 4ORMA 1Z6KA 5HULA 4C6JA 3L0KA 4O17A 2PLMA 4GQBA 3UT0A 1JZ3A 3GSMA 4C6KA 2HE8A 1GG1A 1JZ2A 1IZJA 4IIBA 2GK1A 2F6KA 4D6JA 2Y63A 2Q09A 3TZFA 2J27A 4WCJA 4HYWA 4N6FA 2CKRA 2ABAA 2EJ1A 3DFOA 3AJ7A 4Y7EA 3TEVA 2V2HA 4UUIA 5EGRA 3ICJA 3A3HA 3NYZA 5DF0A 4LALA 3EX2A 3ARPA 1H61A 2PWEA 3FK4A 3GC2A 3BK0A 2QCDA 1OK6A 4RUBA 3OVQA 4PTMA 3UCQA 4DZ5A 3RO6A 1FCBA 3UVAA 2J7BA 1XFCA 4HHPA 1ZENA 4OTKA 3L66A 1V3KA 3KBSA 3CASA 1PYMA 5G2WA 4UR9A 2PA6A 3N6JA 3K5XA 1M7OA 1DJXA 3FS2A 1NWTA 4HOZA 1A5UA 1BF2A 3O2LA 3LHWA 4V15A 1KLZA 3XISA 4GACA 1JUEA 3HQPA 4CQDA 4YHGA 2J9XA 3W2LA 2VZSA 2XIBA 5FF4A 3JRKA 1EEXA 2Y70A 1CWYA 1XG4A 1YPIA 7ODCA 1WPCA 3TOPA 4HSNA 5CPLA 3LX9A 2CBJA 3CJPA 1EX1A 4P7OA 3I6RA 4PTWA 3MSYA 4I7VA 1VFTA 5FJPA 3LM3A 4QEEA 3TONA 1AODA 1U22A 3MWCA 1T8XA 1RCQA 4XK2A 3UNDA 1V0LA 4UFHA 4ACZA 3FGCB 2OSYA 2R1LA 1JCJA 1ONEA 3W72A 4WK9A 4JS3A 3B4YA 3NR0A 4I6VA 5GQBA 2IXUA 2XH2A 3EBVA 3TXZA 3LMYA 1UP2A 5AHNA 4MG4A 5AN7A 3TJ4A 4IMCA 1XLIA 1X7FA 5HBFA 3E49A 3POHA 4E8GA 4ADSA 1JZ4A 2DSZA 3EB3A 4HTYA 4IQEA 3ATZA 2WVSA 5EU9A 3ZSTA 2HVMA 1EDGA 3W53A 3W1UA 2P8BA 1GYNA 2V38A 1XLEA 1I75A 4EP8C 2D0GA 1ZS2A 1GTEA 4AY7A 2ZUVA 3BH4A 1H1ZA 3WJWA 1UKOA 4TX6A 3O16A 4AEEA 5LNVA 2G96A 3ZJKA 3VIJA 2A2IA 3IJDA 3PZ9A 6XIMA 3H23A 4M6VA 2XVPA 1O68A 5DANA 2WVVA 2VOMA 2I14A 2PP3A 1GOXA 3RCNA 4BWLC 5DT7A 3L4TA 3UJFA 3WH7A 3GDLA 5CGQA 3R94A 4NX0A 4GQRA 2Y5SA 4HU0A 3KZSA 4P8WA 2EPOA 4JYEA 8XIAA 1NJJA 4OKDA 2JF7A 2NUXA 5EL1A 4ZODA 3EX6A 3REQA 5DN1A 1WZMA 3S5ZA 4RNJA 2JF6A 3TSMA 2DGAA 2Q01A 2W3ZA 2V6AA 4I5RA 4GY7A 1EIXA 1MW2A 1FWDC 3ABZA 3DENA 2O7SA 3DCPA 4DNHA 4NNBA 2WWDA 2F2HA 1RA5A 3I4KA 3OBEA 1LOSA 3EOOA 3I6TA 4LAMA 4NZCA 4Q8OA 3HQNA 5HQEA 2UY4A 3NNTA 3TMLA 4WX2A 2X0SA 1F05A 2RGLA 2GYIA 1TR9A 5BZAA 1RCXB 1WAWA 3BLIA 1UR2A 4IP4A 1HKIA 3R7MA 1F4HA 5EMJA 5HR7A 1XSIA 1DIKA 3SN4A 1RVGA 1UWQA 1XYMA 5A95A 5BOFA 5IRPA 4ADTA 4A05A 4PUWA 1G67A 3GXTA 3V4BA 2ISFA 2A21A 3MI2A 1WBJA 2QEZA 5FF7A 3Q45A 2WM1A 2QCCA 3GFZA 2O9RA 3BZGA 2WLYA 1E0XA 2ZZ3A 1JCXA 3GG1A 2HSAA 2OYKA 1ME9A 2D2GA 2ZE3A 3U0HA 3B8SA 2QDDA 3S42A 3FCPA 5G4EA 3SCSA 2FGZA 3NG3A 4XZIA 1J2BA 3PWAA 4FX8A 3GR8A 1J5TA 4RCXA 3CAWA 5D2VA 3N6QA 1EJTC 4ICCX 2TRSA 4AHQA 4Z1YA 2DFAA 2X42A 3VIPA 2C15A 3QV8A 2QKFA 1Q2SA 2YJQA 3G5EA 3GHRA 2ZA3A 4PUNA 4G1NA 4O57A 4JEJA 4QTGA 2B4GA 2MNRA 1AH3A 4DF1A 4M1BA 1DOSA 3LXCA 4Z2IA 2JQXA 1TMHA 1XBVA 1XYCA 3VD7A 2V5DA 1VPXA 3QMTA 1ZJBA 3IRSA 1GHRA 3FJNA 3VDHA 4DF0A 1PDZA 5JBFA 2F6XA 2XYLA 2QGYA 4F8XA 3LCGA 2GZXA 2I9EA 2HEJA 2BNJA 3TNBA 3UR5A 2CLMA 4X0NA 3DESA 4WKHA 4A4AA 2H90A 4TMCA 4UBPC 2DQWA 4MY9A 3QY8A 2GUUA 5DXXA 4D1JA 4W4QA 3BLDA 2WM0A 1ADSA 2ABBA 2PE4A 1PCWA 1VKFA 3MUZ1 2AGKA 3ZLFA 1IV8A 2VJXA 3W7RA 1E6ZA 4AZCA 3TU9A 4IOTA 5MF5A 3G0XA 3RYSA 2DZXA 3S8HA 1B0IA 1TE6A 3PF3A 4KEMA 3PJXA 2WMHA 3MMDA 4HHMA 3UPWA 3QY7A 4C6FA 3LQGA 3EA3A 4OJYA 3SJ3A 1AA1B 4D6IA 2GJXA 4ZFMA 3QN3A 4EPBC 3O0KA 3ZYZA 1M04A 6ENLA 2PD5A 4LFYA 3HU7A 4AEOA 4NIRA 3VM7A 4LVGA 2D23A 3W1MA 1IT8A 3EOUA 4GH3A 3UZ5A 2ZDRA 3WFZA 2UV8G 3K1DA 2JIEA 4MIMA 3PM6A 3LCFA 4JTDA 2IQTA 3QF0A 4B3KA 1J12A 4NY2A 3UZWA 3QV7A 5JBDA 1M65A 1SW7A 9XIMA 1H7XA 3OZMA 4B16A 1YPXA 5M1TA 2ZX7A 1WZLA 3S83A 4LT9A 2YDAA 4JN7A 1C9WA 2ZA1A 3ENLA 3KRUA 2HXTA 3DHDA 2QMKA 1OT1A 3S2NA 5HNRA 4R7OA 5AYYA 2Z29A 3TH6A 1HW6A 1DHPA 1ISXA 4GE8A 4GJJA 4HGXA 1VS1A 3WX7A 3W7GA 3H2AA 4GVGA 2CLOA 5JUVA 2V5CA 1E71M 3MJYA 1KQYA 2G4FA 2DSUA 4FLRA 5KINA 3ZFHA 3SN1A 3C3UA 1ZALA 4K1WA 3W85A 1NY1A 2PZ0A 1S5MA 3T6CA 3TQ0A 2X2GA 3HGOA 3HPZA 4B3LA 2X7WA 4JIRA 3UF9A 2AL2A 3N17A 5BXRA 4K8EA 1X1OA 3NQVA 4IP5A 3GKFA 5C8BB 5JIPA 3U8GA 4ROQA 3P60A 3WL0A 1A5CA 1CGYA 4MAZA 3EEGA 2RAGA 3AZSA 1Z48A 1UC4A 4U28A 4ZSTA 1KXHA 4RX0A 5CQ1A 5I3FA 2ZTJA 3EKGA 3U5UA 4PMJA 4HQVA 4H9UA 3AI0A 1IEQA 1NH6A 2YX0A 1WKDA 3BQ6A 3CH0A 1XH2A 3RR1A 2EAWA 4JL2A 2PDXA 3CT2A 1KM0A 1QW8A 1TWSA 1Q7MA 1AQMA 2GQ8A 1HVXA 4E38A 2D2OA 1L6YA 2YW3A 4I7WA 4E2BA 1V3JA 4BZYA 4HOWA 4QBXA 3NQAA 5E0FA 1CXKA 5REQB 3KOXA 1VFFA 4DWSA 3G3DA 3UCDA 5C0QA 3KOYA 2PWUA 3QR1A 3VGFA 3WQGA 2I1OA 4UOZA 1KFKA 1X8CA 4BJHA 1LF1A 3B9DA 4A3UA 1UKSA 1TQXA 3QSTA 4CU7A 4M5PA 3URNA 2PRLA 1ITCA 3N13A 2VTFA 1R8LA 3O6AA 1KXQA 4JIQA 1OBAA 4QHRA 2OVLA 3ZS4A 1CTNA 3MP4A 4Q4PA 1YNPA 3PJWA 4C5ZA 4BF7A 1V79A 5DY2A 2QF8A 4L4MA 3LA4A 5IBXC 2XSBA 3VI2A 4QFUA 3N2BA 4XBKA 4Q4KA 4MMWA 1AQFA 1E6XM 3O6CA 1LL7A 3SBFA 3N1AA 2WVUA 1AW2A 5CZ0A 5IHSA 1EDQA 5EFFA 3LPFA 1IT7A 2VKZG 1I2NA 3WZ0E 1DEDA 3KBNA 5D05A 5HR6A 1M3UA 2P8CA 3W02A 4JTAA 4B9YA 3HG2A 5CPQA 1GNXA 1SU5A 5TBOA 4V2XA 3UXIA 1GEQA 3FGCA 3KRZA 1C8VA 3F03K 1CX9A 3DU0A 1GHSA 1CYGA 2PDQA 2OEMA 4QROA 1PS9A 3GAYA 4GZ7A 3WLMA 5FF3A 1HTIA 1KRCC 1JDDA 3P82A 1PIGA 2ZRVA 4G7EB 3N25A 2HQAA 3KBJA 1MFVA 3E2SA 1EUAA 1VBUA 4QE4A 1EKOA 1TPB1 4UTUA 1ONWA 1ODZA 1PKNA 1XR2A 3TC3A 4CQ9A 1W2VA 4FLSA 1OIMA 4Y6GA 4HNTA 2SFPA 3QHOA 4HP5A 4R5EA 2R9RA 1PX8A 2WBKA 1P43A 1NEYA 2VR5A 2QQ6A 1RY8A 3W7CA 1BXCA 1TR1A 5HUPA 3RPMA 4H6QA 2QDGA 4Q33A 4FXFA 4KWWA 1FCUA 1FKWA 2PCEA 3EWCA 2EQDA 4IMFA 3WEMA 4Z2JA 3CV6A 2OG9A 4F48A 1QR7A 4E0CA 1V08A 4Z17A 3HV9A 3EXSA 4Q8VA 4LSBA 2WC3A 1IWAA 4O10A 3WQVA 1R2RA 1REQB 1HKVA 1X8FA 3SSJA 1HJVA 3UPBA 1ISVA 3GIPA 1KKOA 4AB4A 4QR6A 2VMFA 2FB2A 4DPPA 1NP0A 4GGBA 1XI3A 1V51A 3AQUA 1I60A 5F1UA 2V0TA 4FI4A 2I7GA 1FCVA 1PCKA 1J6PA 3WJZA 3HPXA 1WXJA 2OKOA 4C6CA 4IP7A 1XYBA 4DO7A 1N7KA 1UZHA 2ISVA 1Z41A 5HMSA 3APTA 3TTQA 3HPFA 4Y90A 1KV5A 1X97A 3CGTA 2TYSA 4KGLA 1VCGA 1OYBA 3T7VA 1L6SA 3FJ6A 4C5YA 3PVFA 1V6UA 3TQKA 3BLOA 1EXPA 2BTMA 4D72A 4WDWA 2D73A 1JL8A 3L4UA 2IXVA 5B7YA 3AMGA 1QBBA 3QLLA 1GVYA 1R9YA 5KETA 2DUAA 3WK2A 3QR0A 1W1ZA 3K2GA 3QQ1A 3D3FA 1HT6A 3UY7A 1H63A 5BXPA 1WO2A 4A3QA 5AC8A 2UBPC 4I9MA 3MTWA 4LXFA 2FZ9A 1QW7A 2DH2A 4WJEA 5FAGA 1UD8A 1QO5A 1ICPA 5CPSA 3WNMA 3STPA 8CGTA 2XISA 3FX4A 4LTSA 1W91A 1EPVA 4ZO7A 1WBHA 3CBWA 2GSHA 3OZPA 3M0LA 1KGWA 3AALA 3ABXA 4RW5A 3ELFA 5GNXA 1KFCA 1XGDA 1E9ZB 3ARWA 1C91A 1HQTA 3F2BA 1A80A 4JQ2A 4N9CA 4XZBA 3TN3A 4L9YA 3UWUA 3BMWA 1CLKA 4X9SA 1W9XA 3WFAA 1HJWA 3LEPA 2VCCA 4KF1A 1U83A 5H91A 4ES4A 3PNUA 1UP3A 1P0NA 1XC6A 3T09A 4J27A 1OFBA 1WUFA 1JVNA 3NQBA 3UWWA 2ONEA 2Y85A 3CMJA 2J62A 4HZ7A 4XIMA 4D6FA 4O8AA 2P88A 3SCQA 1K9DA 1EC7A 2JE8A 4AY1A 1F6KA 1E15A 1IWPA 4LGXA 3WCZA 1DHKA 1W5PA 3N04A 1RSCA 3TSBA 1R86A 1FWWA 5BRQA 2VFDA 4UTMA 3FYYA 3W73A 1LWJA 4AZHA 1Z7AA 5ABEA 3A3XA 3DXIA 4OGZA 2GSEA 3F4WA 5AC4A 3HOJA 2DZAA 4FNSA 1QDSA 3IK4A 5AYZA 2HS6A 3IJ8A 3N19B 4ORIA 2J77A 3C2YA 2Q3RA 4IQLA 4G1KA 3MSDA 2A4AA 2DVUA 1X96A 3GVQA 5LXXA 1BF6A 1A3XA 3R79A 4PBEA 3R4IA 3UU0A 3E6EA 3SY8A 5MKGB 4CQAA 2Y8KA 3VE7A 4S3FA 1O94A 4DWSD 2V3DA 3HTWA 1L6GA 3S1XA 1KA9F 2H9AB 1JYVA 1E4LA 1ZCCA 1AL7A 4LAUA 1IGWA 1FOBA 2I5IA 1NFGA 3BW3A 1WKEA 4QDPA 2A7RA 4TX8A 1YDYA 3EAUA 4HNLA 4HB7A 1J0ZA 3BSGA 2JKPA 5EMLA 1V7YA 1XIBA 2ODOA 2RDTA 1XIHA 3K4DA 1FWBC 4GHRA 4YWSA 4NU7A 1G69A 2GFTA 4UTIA 3RAOA 2DT3A 3CMGA 4JFWA 1EHAA 3UPMA 3QKEA 3LYEA 4XVDA 3S5OA 4H8UA 3NOYA 3M7WA 4TUFA 2ZXDA 4J3ZA 3SCWA 4RZBA 1Q4WA 2QLYA 3LRLA 1NQKA 2FH6A 3PPCA 5D37A 3T44A 5A3HA 4QSHA 5JMUA 3ITTA 1SJAA 1FFRA 3GNDA 1UKQA 4FIRA 3W7DA 3NQCA 5T91A 4PCPA 2R1MA 1EA0A 1E6PA 3GE7A 4L6DA 1DJHA 2XU2A 4C1KA 3AIEA 4MNMA 4E2DA 3S47A 3QVQA 3VNIA 4UNLA 3TFCA 2PS2A 3AMCA 1Q6QA 1WXZA 2VDGA 2E6DA 2DT1A 1LT8A 2XN0A 4CCCA 1OD8A 3FN9A 5D33A 3XIMA 5I3IA 3DGBA 1P1MA 3SAZA 3STGA 2EBNA 1N82A 1CXHA 2E9MA 2IPGA 2Z6JA 4LYKA 1S39A 3DH7A 9CGTA 3WFLA 2CITA 3KVLA 3DHUA 2OZ0A 1TPWA 3NPUA 3WLNA 2PDPA 2QCEA 2L5HA 1C92A 2BVDA 2FB3A 2A5HA 1O5KA 1Q6OA 1JYNA 1BYBA 3AIUA 2HVNA 2C8NA 1ZQ5A 4AD4A 3AWNA 2F6UA 4GBUA 1JI1A 3OHMB 5ECUA 3TYAA 5AYIA 1HJUA 1UH3A 3RN6A 3FLUA 2PDJA 1B9BA 2W4XA 5HWNA 1OY0A 3UR8A 1ZBCA 4HPGA 3WQEA 2V81A 3MV01 5REQA 4GI4A 1ALDA 1TX0A 3UY8A 1JCNA 1XDLA 4O1CA 2Y88A 3G22A 4UTJA 7XIMA 4LC8A 1XLCA 3T0TA 3OBAA 4L5ZA 3W1PA 2VT0A 3UZJA 3DI1A 3ZSSA 1UW9A 3CYJA 4WSJA 4M3PA 1ME7A 4OUIA 3MP5A 4QAIA 4YS1A 4Q7BA 2QCHA 1JCMP 1W9UA 2DU2A 3CV2A 5CAHA 2IPFA 4PFHA 3C0SA 1CPUA 1E6SM 4BCEA 2PDGA 3S46A 3E0WA 1VHNA 2BXZA 3H53A 3VC5A 3AISA 4AMAA 4FK9A 3FA4A 1UG6A 1ZBWA 2IUZA 3A21A 2J7CA 5SWUA 3LTYA 4D6EA 1GQLA 1EWEA 4BHYA 4KCVA 4JQ3A 4AWEA 1E1CB 4KFNA 3CWHA 1FWFC 3VMNA 3PBGA 1US3A 1Y5VA 3EWXA 1UPPA 2VCBA 4AZBA 2OWCA 3SQLA 3ZJ6A 3KEHA 1A5AA 1BVZA 1OFRA 4XTDA 4WDUA 4N6EA 5BXSA 3KOFA 4D1IA 3L5AA 3SI9A 5CC6A 3WIJA 5FIPA 1LOLA 2OT0A 4UMAA 4BA0A 5EPDA 1JAEA 3N15A 2YPIA 4MY8A 4HJWA 1BYAA 1GOIA 4V27A 3UCCA 3IUHA 1J4EA 3SUTA 1QHOA 3W1QA 4P7NA 1VIZA 3TMQA 4AUBA 5EMMA 5IM51 2DORA 3GDKA 4G7EA 4JD4A 4UQCA 4KRTA 5CJMA 1VEOA 3NFUA 4UQDA 1H2JA 3CZGA 3ES8A 4GVHA 4U5IA 3NVDA 4XD5A 3L68A 3RU6A 3EWBX 4AMCA 3S5NA 4X2PA 1QWKA 1OFDA 1OG6A 2YCKX 2YZ5A 3NSMA 2XN1A 5HOSA 3RX2A 3FYPA 7CGTA 1YTDA 4ML4A 3WKZA 1LG1A 4MHBA 1FWEC 2F9RA 1HGWA 2DUZA 2AGTA 4ZR8A 2C1GA 3P5ZA 4K2SA 4Q22A 1PHWA 6TAAA 1QOXA 1P6BA 4YTUA 4GQGA 4G5DA 2Z27A 3BJTA 1O7AA 3B0VC 3VPLA 3S1UA 2NLYA 2HCVA 1E0TA 1E72M 4KCTA 4P7RA 3VIGA 1AMYA 3MHUA 3W7OA 4BS0A 3BO9A 2F8QA 3TCSA 3NZQA 1NOUA 2QAFA 3OZYA 1XHGA 3YPIA 2WC7A 4UR7A 1I45A 2E8ZA 3CXOA 1REQA 3AIVA 1VHCA 4MTVA 4RKAA 4F2BA 3SURA 4IX2A 3E2RA 4JCLA 4F0RA 1OCBA 1IGSA 2BVWA 4JTQA 4N42A 4C6BA 3E2QA 4K68A 3TDFA 2J88A 4NZ1A 4ZSUA 2HROA 3W6LA 2D3LA 2CLKA 1AJ0A 1F76A 3W87A 3WMBA 3RK8A 2GDUA 5DT5A 4EIVA 5AZ0A 5D9NA 4PUJA 1XRSA 1UOZA 3NEHA 1JNDA 1XISA 4IGMA 4G2DA 3KVJA 2VGGA 1NIUA 4IJRA 1OGGA 1XUUA 3LPGA 3MUIA 1MYRA 3ZZ1A 1IEXA 3P6LA 1YLVA 3TSDA 5T9CE 3NUKA 2UY3A 1EL3A 2PDNA 4OQVA 3BLKA 3GH7A 3W81A 3F4CA 5D2TA 2WJDA 2WANA 1KBKA 4LYQA 1JYWA 4XWUA 1VYPX 3RPTA 1ONXA 1XUZA 1K6AA 5TNVA 3P0WA 3WD3A 1FQ0A 4S1FA 1CGTA 3C6CA 2WHJA 3B8UA 1JJKA 2J7FA 5DMYA 1NU5A 1EXBA 1ZBKA 2ISWA 2VFFA 2Y62A 3RMEA 4Y8EA 4P8XA 4I7UA 1QI0A 1G9HA 2NXIA 1GW1A 6TIMA 4AAJA 1K8CA 3UFYA 1SW0A 3PPGA 1B31A 4UQEA 5AVNA 4DRSA 3KLKA 4RZ4A 3BJFA 4PSRA 2Y7GA 4PUKA 1KFLA 3UZYA 2QYGA 4EWJA 4Q4OA 2WAGA 4F9DA 3W7EA 1U1HA 2W5FA 1XINA 1SVDA 1VFOA 3IV8A 2ZA2A 1CB2A 5FSEC 1TYGA 2ASHA 3VNLA 4YN5A 3UXAA 4U31A 4DVOA 4B91A 4NJJA 3AICA 5C70A 5K2ZA 2OWXA 3OQEA 5IFTA 4FEZA 3EDJA 4ATLA 4JKKA 2ZADA 2GUBA 3RPDA 1GKRA 2OQYA 3VTRA 2QR6A 3QJAA 5TD4A 1UC5A 2O4QA 3WUFA 3Q4DA 2ALRA 3JZUA 3KOWA 3CWOX 1J0JA 2HPMA 4PMVA 2J8FA 4Z08A 1RJQA 3QXBA 3STFA 3VA8A 4DX3A 5CBIA 4PMZA 3W84A 4K8HA 1QNOA 4PCFA 1MQPA 5BOEA 3U2EA 2PDHA 4K36A 1RV8A 1UD2A 1A47A 3FDGA 4ZQRA 3WELA 3VXGA 3N9KA 1XL9A 3CYVA 3TYEA 3GDRA 5L6UA 1HL8A 1BVNP 1VCFA 4CU8A 1XRTA 4UNIA 3OBKA 5MKGA 3EOEA 1SFLA 3VKDA 3ZLGA 3UA3A 1JQVA 2NVAA 1VPQA 5HWJA 2R94A 2PGEA 4RDVA 1K7XA 2HBXA 3TJXA 4DXXA 3GG7A 1XRVA 3STEA 2WMIA 5HK4A 1R3SA 3BUVA 4JTIA 4ZOCA 2Z1VA 4LWWA 5C2GA 1NFPA 4UZSA 1TTPA 5ABGA 3LCIA 3TYDA 3SB0A 3BURA 4EE9A 3BVJA 1K7EA 1NOFA 1XCWA 2PU0A 3DFSA 3ONBA 3PZUA 4S3DA 2B0MA 3NQMA 1QCWA 3THCA 1TO3A 3N9SA 3P7YA 1QPNA 1SYTA 3DFPA 4B5NA 1H50A 2FFCA 1CZ1A 5JIWA 5IDZA 3RHGA 2A7PA 1XWYA 1K8XA 4MYAA 3GDBA 1LORA 3W83A 4ZE5A 1XX1A 1WUEA 4J35A 5I23A 5LNWA 1EA9C 4DELA 4AISA 3WN6A 2ZVRA 3LSCA 5EMYA 2WXDM 3C86A 3ZMRA 3HPAA 2AMGA 4PC8A 4LV9A 1KRBC 3GFXA 4UWMA 4MFDA 2Y5EA 3NSNA 1JEZA 4GUHA 3MBDA 4XD6A 1S2TA 3N4EA 3SRFA 1K9FA 1RVKA 2BS9A 1ZP4A 2NXHA 4O4VA 6XIAA 4YCOA 3W1LA 4HCLA 1CGUA 3PN8A 3QYQA 3DEQA 2BGQA 1VQTA 2YB1A 2B7PA 4B4HA 3JU2A 3UZXA 5EKYA 3M16A 1IYXA 1WOBA 3ZM8A 4J9JA 1O5XA 3UNTA 3GFYA 1MEWA 3KWSA 3EB4A 2PTWA 1VPYA 2XTKA 3GTHA 2BY0A 2DVXA 1YXYA 3ARVA 1OGSA 2IW0A 4MDOA 4N0RA 1TV2A 2KZHA 2I5GA 1BWLA 1W37A 5CZKA 5LA1A 4YTSA 4HNVA 1QI4A 5A2CA 4AD2A 5A6BA 3ZJ7A 1RD6A 2PZNA 2NV2A 5LHEA 3KRSA 1JZ7A 3T4CA 4PMXA 4I9JA 3VD4A 3PPHA 3VGHA 3WEOA 4X3ZA 1RALA 2OR2A 4RK8A 1GOMA 2XVKA 4KRUA 2WQPA 5I03A 5AB3A 1OK4A 3TA6A 3B40A 3AYRA 8XIMA 1AH4A 1A4LA 4EANA 4LQ1A 4QG9A 3TIMA 2GVLA 3SSZA 2XFRA 1XIGA 1GZGA 3L4YA 2G37A 4GKTA 1MUCA 3DHFA 4UC5A 4Z1DA 5D02A 1OFAA 1RLCL 3CS2A 2Z24A 3MDUA 2VUNA 3C0QA 2FJKA 4H1ZA 4LY8A 3A4XA 3OOQA 1E3XA 2JIWA 2FJUB 1F74A 1IEVA 5E70A 3COTA 3AYSA 4PCTA 3UG4A 4DWSC 1RK6A 1XG3A 2Z28A 3H4XA 1QPOA 4AVFA 3FDKA 1KGXA 2ANUA 3QZAA 3R0UA 3VOHA 2YDRA 1U1UA 4NJHA 4NT0A 1GVFA 5CKSA 5A6AA 4P8UA 2WO5A 1XQKA 3ZT6A 4ML9A 4DZAA 2EPKX 3QRHA 3APYA 3LHUA 1E1CA 4OHQA 4LH8A 4WLCA 4OFCA 1DQWA 3NL2A 4EXBA 4CQBA 3UVIA 4D2JA 5HJYA 2XZ9A 1EDTA 4GVIA 4MZ8A 2XWEA 2PDYA 2O7QA 3EGJA 2D22A 5LGXA 1UQYA 3BLLA 1HXJA 2QJJA 4MWAE 4MFEA 2DSVA 4X63A 3POCA 3CIWA 1EJ7L 5G2IA 4MNLA 3WH9A 4KGJA 2GOKA 2NQ9A 5E1QA 1ZCOA 4EAMA 1LBLA 2MUCA 4OIFA 3PZMA 5LIKX 5AC6A 3VAVA 3KCLA 1MXDA 3GXIA 1SUXA 4NAFB 5CZTA 1RQHA 4R34A 3NQ6A 3ARTA 2EPMX 5B7ZA 2A1YA 3EDEA 3E2VA 3PBMA 4QDWA 3BLEA 3ZR5A 3AU6A 4PTNA 1QNSA 4NX5A 1AJZA 5HMFA 4WKAA 4N9BA 2X41A 4D6HA 6CGTA 4I5UA 2FMOA 1LG2A 1VIWA 4IG2B 4C65A 2AKZA 1IWBA 3H70A 2VI0A 1SFJA 3T0AA 1AG1O 4HVXA 1M53A 1KCZA 4IIFA 1EP2A 1R3VA 3SRKA 2WV8A 2XH0A 3RJYA 3WQOA 2ATSA 1RLDA 4QG6A 5A69A 3W75A 3PZNA 3KS5A 2PWDA 3WNNA 1WB0A 1YW1A 4FNUA 1LRNA 2XPKA 3LLXA 4E3VA 2GPTA 1GVSA 4F0MA 3CZLA 2R1KA 3AHXA 3VX0A 4ZO9A 3HPSA 1VLWA 3OA5A 4TMBA 3LLDA 3F4VA 3V18A 4GX8A 5FJRA 2IKIA 2VQTA 5DCEA 4IX0A 3QY6A 1EPXA 3T0CA 4Q8WA 3BGAA 3HFYA 3C52A 2BV9A 3LPOA 4LRSA 1A4MA 4LF1A 5I02A 2J79A 3PAOA 3D47A 1R0MA 3TP4A 1VZWA 2E28A 4H01A 4WDTA 5F4WA 1PB0A 1UWAA 5CGMA 1XH0A 3F2DA 4BF9A 4F9JA 4JX5A 3GZ3A 2PFHA 2YB4A 4GA8A 2XFFA 2EO7A 2QJIA 3W7LA 4QJ1A 2NV1A 5BMWA 1H1YA 4L1GA 3QYSA 3CLMA 4CU6A 4CVUA 1EJWC 4XISA 4MVAA 4L65A 3O63A 1W1B1 3P61A 4LB4A 3WUGA 1J0KA 3R13A 1GVQA 1M7PA 1D2KA 3CL7A 1K03A 3WLQA 1VFLA 5FJTA 3FEQA 2I9UA 1L2UA 3G8RA 1VENA 4G6CA 4XAZA 1IE7C 3CAQA 1MNZA 4NYUA 4JBRA 2Z2BA 1VJIA 2ZRXA 1W9DM 1NWSA 3RITA 3DHPA 3AS1A 4H9ZA 4ENLA 2PWGA 1HL2A 4WEVX 5E9XA 3MZ2A 2E6YA 3PAJA 4DEFA 3STCA 5HQLA 1TVLA 2WSPA 2DT0A 1HF6A 3M0JA 3BG9A 4NI8A 4YVXA 1CECA 3FXGA 5TAOA 4Y2WA 3BOXA 1W5QA 5CSUA 1KD0A 2XFYA 3H2CA 3PZVA 3DDMA 3UXKA 2VUYA 2CZVA 4RR4A 4GVFA 1TIWA 1EJXC 3AO0A 1GQKA 4EF8A 2OO0A 3EPOA 1JI2A 1D7FA 2G50A 1V77A 2FTPA 4HPNA 2A6NA 1W5MA 3GXPA 4ASTA 3UG5A 4QX4A 4PH6A 1VB9A 3IAQA 1BGGA 2PC4A 4J3XA 1R7AA 4Z2HA 1LRTA 1Z32X 1QHPA 1LYXA 4WDXA 3VD5A 2Q02A 2AQVA 3PZTA 3E96A 2E68A 1BKSA 1XRFA 3HG5A 1E55A 3PUOA 4LYRA 4B5SA 2DJXA 4LUSB 4XD4A 3T8QA 1Y5WA 4O16A 4DJED 1TJPA 2WZTA 5C9RA 3UWZA 3MO4A 4LNYA 5CXPA 1BWKA 5C9ZA 2A85A 2E9BA 1L6FA 1MXGA 4QEHA 1CDGA 2J66A 5EB8A 5D09A 5BU6A 2YKKA 4Z42C 3AXXA 4OWGA 2INEA 3ONCA 2DZTA 2HDJA 3Q37A 1OYCA 5DXYA 3M0ZA 3WF0A 2CBUA 3LI1A 3DI0A 3GHTA 1QPKA 4B92A 4AFYA 3LHVA 4H00A 4LUTB 4UTKA 2J47A 2WW5A 3NQDA 4XG1A 4M8UA 2IKJA 3BGJA 3K8KA 2GK1B 3LZ5A 2V2DA 1UBSA 3KWXA 1DWAM 3AMDA 1E9YB 1XD1A 2W9MA 4F4RA 5IDIA 4CLMA 1ZB5A 3EXRA 1UB3A 1UJPA 2OFJA 2PDFA 4O4WA 3MHFA 1MWOA 4U3AA 1E51A 2NQHA 3BOLA 3EDFA 4PRTA 5AECA 3IGXA 2NXGA 1KO0A 2QCDB 4LB3A 1SM9A 3VU2A 2NX3A 5IBXA 3GXFA 4JKLA 3UR7A 3DG6A 4UTTC 3H6OA 4C60A 3L4WA 1VYRA 3F5KA 1J18A 3VMOA 1V0MA 2EKGA 3IK2A 2PBGA 3AUJA 1Q6EA 3VABA 2JK2A 1UWUA 2VYOA 4AHPA 3DAQA 4HA1A 1W5OA 3KX6A 1JGIA 2FTWA 5CSSA 3Q65A 3ZOAA 2VENA 3R58A 1BG4A 4LV4A 4I9TA 4M51A 3CUIA 1UMLA 3IJIA 3MJMA 4J3UA 4N4QA 3H26A 2NQLA 3N2TA 3Q94A 2I16A 2YL5A 3V0UA 2J8TA 3GVVA 1Q6CA 3M47A 3VC6A 3ZVHB 2HZGA 4HU8A 2BGNE 2GGIA 4JTRA 4NZ5A 5HDRA 3OYZA 3SUWA 1AQHA 2Q6ZA 4QJ5B 3AS3A 1E0UA 2Q8XA 4AC7C 3U2ZA 4NKCA 5FI8A 4M0XA 1EGVA 1Z44A 4EWND 3R2GA 2WSYA 5FF2A 4UQBA 1MSSA 3WQCA 1FHDA 4CD5A 1CNVA 1S5TA 1JDAA 5IOBA 1UZ1A 2Z7KA 1CT5A 4US5D 1BTMA 3MSRA 4WJXA 3C3NA 1OWQA 4Y9AA 3URBA 2TMDA 4XAGA 3W6YA 4HJFA 4HMDA 2VM8A 4NASA 1H0GA 2UY5A 1OZMA 4A22A 2GJRA 3A12A 1JD7A 3P0XA 3TXVA 3CK5A 1ISWA 1XDJA 4RNHA 3VOJA 3A9BA 3QHNA 5LNRA 1XICA 4JAWA 1OCJA 3UD6A 3W28A 1NM9A 4MB5A 1LQ2A 2Y89A 4ZZ9A 3VIMA 3GK0A 1E40A 1W9BM 1FH9A 4GJIA 1JD9A 3VKAA 1P0EA 4URIA 4GZEA 4REQB 3W23A 4N9DA 4NI3A 1S2AA 4J3SA 4ZB5A 1H62A 3I10A 4NUWA 4BR1A 2J78A 3RRAA 5K9DA 4MGGA 1OFEA 2O55A 5BXTA 2RJGA 5D30A 1ITXA 2WVVB 3M41A 2GOUA 1Y0EA 4KPLA 3NJ3A 2KAUC 3G3MA 4Q8PA 1BLIA 3RLUA 2FZBA 4A8LA 3MQTA 3RIKA 3W37A 1JDCA 3AZTA 3WF1A 3UG8A 4R27A 4R85A 2CWXA 3R25A 4QJ4B 4IJBA 3M6DA 1HJSA 3A22A 1POJA 3GNOA 2ZKMX 4E5TA 3JZEA 5ABFB 3DYMA 1R3TA 5CSYA 3B9OA 2CIPA 4DIAA 2DIEA 3PBYA 3W2UA 5FACA 1OX4B 2NSOA 4FNPA 3ZR6A 5JBEA 2XIMA 4QCEA 5BYWA 2AAAA 2DY3A 2CHRA 3B9NA 3ZT5A 4IIHA 3HB9A 1XKYA 1S5VA 2R91A 1PYFA 2OCZA 4D6GA 1QHZA 2Q8ZA 3SCPA 3KRBA 4MNJA 1UR4A 4PGLA 2QIWA 2X16A 2NV9A 4L9ZA 4NAFA 4HMEA 4HCDA 3KBWA 3WBWA 1SZNA 3A4AA 1TRDA 2EPLX 4F0HA 4TV5A 4DO5A 3T4WA 5EYWA 4PSPA 1CCWB 4XTIA 3OW1A 4DYEA 1OVDA 1A5KC 4IG2A 5LNSA 3MYPA 3WNPA 1DE5A 4JTEA 3CTLA 2JKAA 4IL2A 3LBMA 1XBYA 1LTDA 5DRIA 1FH8A 3WEZA 2ACSA 2Z25A 2ZE0A 3F5LA 1ZJAA 3F5JA 1KB3A 5HATA 3GDMA 4QITA 1RBLA 4J2PA 3IIPA 3P2VA 3ALGA 5JU6A 3AS0A 2VX5A 2PODA 1K9EA 2Z26A 3UR2A 5E0CA 3VNDA 1FRBA 2PAJA 4L4LA 4N9EA 5HWMA 4WVXA 4FALA 3E74A 4OZOA 2OELA 3T8LA 1B4KA 4MJZA 1D8CA 3GB6A 3MU7A 4LCSA 3W1XA 1UUOA 5I3HA 3WH5A 4O50A 2E0PA 2QJGA 3GG8A 3N3MA 4QE1A 2NSXA 3M1ZA 3L4XA 4LYPA 1JZ8A 5I79A 1VRXA 5A8NA 3O1NA 3QGAC 2VL4A 1AH0A 1HKWA 1A5OC 4NAEB 4HYRA 2PWHA 4GWEA 4LAOA 1Z89A 1FWCC 4F0LA 3AWOA 1NSJA 3BOFA 2VX6A 3FA5A 5D32A 4YTQA 1D8WA 2YCIX 4KERA 2Y24A 4GC4A 1DXEA 4UTLA 2QXWA 1KCXA 3LHTA 2CLLA 2QDHA 1KFBA 4IIDA 4S39A 4NSBA 4HSOA 2GDVA 7A3HA 3W38A 1GZ1A 2YA0A 1SPQA 4QM1A 1E43A 1MRAA 1UUMA 2OX4A 2VFIA 2DSKA 4WY0F 3VNJA 3C0LA 3TYUA 1OGBA 4AZCB 4GLEA 1DJIA 3SM0A 2PGWA 4JYFA 1VBGA 3N6HA 3QW3A 4GX9A 2P5NA 4PL2A 5ABTA 3CV1A 1VJSA 4Y9OA 3GVGA 3FOKA 4UQAA 1XLBA 3V5FA 3F7JA 2KX9A 2D2JA 4OUEA 3ITYA 4AF0B 4FZIA 1W3IA 2ATMA 1KBIA 5M17A 3VGBA 3FYOA 5FESA 4KKXA 5FJJA 3OZOA 3WBEA 3CIVA 4ZE4A 3NTYA 2NZLA 2YYUA 1F8IA 1E73M 4WF7A 3FEMA 3I7RA 3GW3A 3L65A 5M5DA 1IIHA 3L12A 1XIMA 3LOTA 3U2OA 1ECEA 5DFAA 3GBEA 1Q7ZA 4IGNA 1QK0A 2FVMA 1DKWA 1S5WA 5RUBA 1IT0A 3NZPA 2VGBA 3PTQA 3KUMA 4ZO8A 1XLKA 1GOKA 1UJQA 1F3TA 3N11A 4JXCA 3SGGA 1EC9A 2VVSA 4E3TA 2HV5A 2I17A 4O8RA 2DV0A 4E2VA 1UWRA 1YPFA 2XGIA 4QXIA 4BFAA 3PWIA 3FAXA 1V0KA 3E0FA 3MY9A 2X1SA 3W2MA 1CIUA 5ECVA 1X6UA 3BLPX 4ZVJA 4IJCA 1GCYA 1G0CA 1QI2A 4HNCA 3PTKA 3M0HA 3GO2A 4H83A 3QC0A 1S38A 2QPUA 1Q65A 3B4UA 2GVGA 1IXNA 4GC3A 3G1VA 4A8RA 3W22A 2J7HA 2PC8A 4CCDA 1K70A 3G1HA 1TA3B 2C1IA 1VJZA 1TFVA 4M29A 3EMCA 2ZRZA 1TJ2A 3IAPA 2ZUTA 4LUSA 3E9AA 4KFPA 3HBLA 3KTSA 1XC4A 3CIXA 1S1PA 4ZBCA 4E2OA 3W29A 3AAMA 4HA4A 5D4YA 2ZZ5A 2AQOA 1J6OA 3GTNA 4MWAD 2VGIA 1OYAA 2VEPA 1TPUA 3F4NA 4WGHA 1P6WA 4S3JA 3E38A 4H7ZA 1G7VA 1XSKA 1SO3A 2BG5A 2YFOA 5KMYA 4JY8A 1EBGA 1B57A 2ZRYA 4LUTA 3ZR4A 1ADDA 3EPNA 2PB1A 2PDLA 2XM2A 3W7PA 5E9AA 1CI1A 5C55A 1QUMA 4B5WA 3GU9A 3KAOA 3U57A 3GVWA 1MRQA 2P0OA 3WMLA 1UH2A 1KWGA 4W5ZA 3U48A 4S3AA 2VEFA 2J13A 4AU0A 4JNZA 2EPNA 3U9IA 1IXOA 1JG9A 2YLLA 1UYQA 4NZ4A 4HZMA 1TTJA 3RFAA 1Q6GA 3P5YA 2ISSA 4UCFA 3QZ6A 4S2BA 4DWSB 1GVRA 3M5XA 2CLPA 1F6YA 3WLPA 1UA7A 3KHJA 1XLHA 4L9XA 5AC5A 1XYLA 3W7QA 3UBPC 3N2OA 3UXLA 1JCLA 2YGYA 4PMYA 3W86A 1LOQA 1E0VA 2IS7A 2GVEA 3LXAA 3UW6A 3WDJA 2YFNA 4XZNX 1KLYA 3UQNA 1HO4A 2ZFAA 2FKPA 3PJTA 1TZ7A 1OINA 1J96A 4EVZA 4J3TA 4GO8A 4AHOA 1V03A 3W76A 4NXSA 1EUNA 3CHDA 2PGRA 5ENLA 3D3AA 6ALDA 1DWHM 5DEZA 3OU8A 2J9YA 3VYLA 1WCGA 3TW7A 3ZVHA 5CG7A 3BAYA 4KEUA 2PWVA 4H9VA 3L2LA 4IICA 1XKJA 3SRDA 1RP9A 2XG9A 4M19A 4JTUA 2W6RA 4NRSA 1W3JA 3AOFA 4MYXA 4LVAA 3LB0A 4ALDA 4CNSA 1TUXA 1WDWA 2PU1A 1UOKA 1FCQA 3WNKA 1PZ1A 5CG0A 2XGZA 3ITXA 5E5CA 2XIJA 3M5VA 1UWSA 3I3EA 4QE5A 1MW1A 3PB2A 2ZXBA 2W91A 2CLFA 3CL8A 1AZ1A 2G97A 1PIIA 3G18A 3OLDA 3NZRA 1OIFA 3EMZA 3I7SA 1PVNA 2E3ZA 4P61A 3ARYA 1TWDA 3ARUA 3ANVA 4UQ9A 2WKLA 2NLIA 1LUCB 4H3DA 1H11A 3M9YA 1V5XA 1XIEA 4ZTXA 4WSHA 4LBUA 3WDQA 2P3ZA 2D3NA 5AOUA 2Y7DA 3HZ3A 3VKJA 4ICNA 5BRPA 3EWWA 4IPJA 1GONA 4REQA 5KZMA 2ZX9A 1DYSA 1W1A1 2BSLA 3PFMA 4WOZA 3T81A 1S1RA 4EACA 1KBLA 1FHUA 3ZLHA 2INZA 3M0IA 3WYZA 2OSXA 4Q7NA 2CYGA 1V02E 2BY3A 5FEWA 1NF7A 2EJAA 2OT1A 1IIGA 1KTCA 1P0KA 5C9UA 2G3MA 2NVDA 4OBSA 4AZGA 1FFQA 4A35A 1A5SA 4FA3A 4NHVA 4KESA 1CLVA 5XIAA 4GNVA 5C2XA 1B30A 1F61A 3UYCA 1O1ZA 1US2A 3WQ4A 5ABFA 1YEYA 3H2OA 2QULA 1V6WA 3VIOA 1ZFJA 4NJKA 4CEXC 5I3JA 1YMYA 1JFXA 4YJ5A 4X22A 1V3MA 4PCSA 2C18A 3UJ2A 4LUJA 1OX4A 2VFGA 2WQDA 1KQZA 2Y7FA 4JIPA 4AZ6A 1S3HA 4IMGA 1QNVA 3GNPA 1R2TA 8RUCA 3GIYA 2BWGA 3BMXA 1TTIA 2GGHA 3W26A 1B2YA 1Z9AA 4BF5A 4FF7A 4TIMA 1EX5A 1YADA 3KL3A 3H7RA 2OB3A 5C54A 5F2GA 2NX1A 1O12A 1CEOA 1NELA 2Q3OA 5DX7A 1I1XA 4M6PA 4TOQA 5I3DA 1TJRA 2W79A 4LRTA 4LAKA 1I2QA 1WXYA 4Q6XA 1EJVC 3R5EA 4IMAA 3DBPA 2VDHA 3W00A 3KDNA 1X6NA 3NPWA 3VX1A 6REQB 3OVGA 4L6HA 2H3DA 2BDQA 1DWJM 4ZQCA 4PCNA 1KXVA 3KE0A 1RHCA 1A5LC 4HPXA 1FVPA 2R8WA 2QJNA 2TAAA 1HFBA 4YLWA 5D03A 3VD3A 4HNNA 4IQDA 4K7VA 2XM1A 3ZT7A 1MO0A 2E9LA 4K37A 3H4GA 2X30A 4HTBA 4BI7A 1K3UA 3ANUA 4QLJA 3LD5A 4O0KA 3DFTA 1NTHA 2BOEX 1D3HA 2O4MA 4GZJA 1E4MM 3LMZA 3FFSA 2FFIA 5CGTA 2ISDA 4YCPA 1M7JA 1UKPA 2VHLA 4KT2A 3TR2A 4CNNA 2E6FA 3THDA 1AD1A 1Z42A 2OZ8A 1TZZA 3G1XA 4D6CA 1B3ZA 1K02A 3QLDA 3RR4A 2CNCA 3NPXA 1QPQA 3ISIX 4O1DA 5J5DA 3C2RA 2J7DA 3PB0A 3OGSA 1EYWA 3B0YA 1OM0A 4NAEA 3UESA 3O15A 3VFCA 1VGAA 3L4ZA 1CB7B 5BMXA 1J10A 2ZWZA 4X9YA 4XZMX 1QATA 3LG3A 3WF3A 5E93A 2OX1A 1SSDA 1Y65A 5T9BG 3NURA 3W1NA 1MQRA 2HK1A 2Z1BA 4GUFA 4M1RA 3GYEA 2E1DA 2X40A 3W01A 4H6EA 2CERA 4Q3MA 3A9IA 4PL1A 5E09A 2NUWA 3FY1A 3SQMA 1PV8A 1T96A 4D8LA 1GOWA 4AD1A 4O54A 2PDCA 1X38A 2B7OA 3ES7A 1UWTA 3M5ZA 4C6DA 5EBUA 1LL4A 3GX9A 2X0HA 3M0VA 2V3GA 4GXWA 1PZ2A 3TAOA 2OPJA 2ZZ7A 1E1FA 3O07A 4JNMA 3ZWTA 8A3HA 4AF0A 4I6KA 4ECLA 3PSVA 1LP6A 1B3WA 1T8QA 1EH9A 1P0BA 1RPKA 2QCFA 3ARRA 1BGAA 3VUPA 4R7WA 2VOTA 1G7UA 2A7NA 4TVCA 1I1WA 4XQ6A 4JY9A 3TWBA 3NQ7A 1ESWA 3GD6A 3B0XA 1NDWA 2V2CA 4QS6A 5FJIA 5I7GA 1OCNA 4K3ZA 1W3TA 3CUXA 3IJ6A 3OIXA 1A0CA 2XVGA 2WC4A 4E4UA 3H22A 3P8IA 3VVGA 1BXNA 8TIMA 5DO8A 2E6AA 3SADA 1EC8A 4CNPA 4O1FA 2D24A 3CUJA 3AC0A 2QZRA 3G8EA 4DQWA 4UFLA 1SZEA 3BCJA 1JYXA 3CZKA 4GUIA 2NWRA 1VYSX 1B1YA 4NL1A 1NOWA 1VFMA 5AHMA 1QK2A 1EO7A 4UOQA 3NVTA 3MKCA 3U4FA 2X1UA 2ZWYA 1TA3A 3BTNA 1ML1A 2P10A 1ITUA 1KTBA 2CXGA 4WHBA 1AJ2A 5A2BA 4WKFA 5A1AA 2FPTA 4LVBA 4QCFA 1JQXA 3CUGA 1KR0A 4CD7A 5M03A 2FPVA 3T42A 1G6CA 3DFYA 3S6DA 5K7JA 3DFQA 4IMDA 3AYVA 3SFWA 2PTDA 3IJQA 1G1YA 2WHMA 3LENA 3GR4A 2J24A 1W1VA 1TVNA 2YA2A 1W3NA 3C8FA 3M64A 2HE5A 3WD4A 5KEZA 3VIFA 2XHYA 3ALFA 2OQLA 1G94A 3AZRA 5D2WA 4I9AA 1JFHA 3ZVIA 1R5YA 4XBSA 3QZEA 1OQFA 4ZOAA 1AFSA 2WMGA 4L4PA 3L7RA 1GVEA 3LHZA 3IIVA 1EQPA 4C6LA 4CCEA 3WQ8A 4EPKA 1A50A 2V30A 2REQB 4MSSA 4ZXLA 1DQUA 3KL5A 1POKA 5CPOA 3VMPA 1SZFA 3O9NA 3PBUA 4O13A 3O7UA 3PTMA 3P62A 3ARZA 4PMQA 4ATWA 3S1VA 4CD6A 4HA3A 3TROA 5A6LA 4HD5A 4PFMA 6PTDA 5H8PA 2IKHA 3O3RA 3B9AA 4PUDA 5J04A 1NARA 1UZ4A 1UR9A 1FHVA 2Z4GA 4FOJA 2C7FA 1TWIA 4D6DA 1L8PA 3NM3A 1FHLA 1WDRA 5A8PA 2NX9A 4MKSA 3PULA 3GRIA 4C1NB 3O05A 3FHAA 4H9TA 4AYSA 3W7KA 3VUSA 4PB4A 4FPSA 3SGUA 1MI3A 4FF5A 3W1TA 4GIRA 2YSWA 1PKYA 3BV4A 3DOPA 1V02A 5CPTA 4F66A 1HP4A 1U30A 3M5YA 3PJUA 3OP2A 3TX9A 3H12A 1ZAIA 3SZ8A 3EOSA 3H2MA 5HQMA 2XDFA 1QPRA 3GR7A 1XGZA 1QXLA 1MEIA 3G24A 2WK2A 3DIPA 2J7GA 3E12A 4Y9NA 4U10A 1S2CA 4KFOA 2D20A 3QBUA 1LROA 1UD3A 3B05A 2PTZA 4PUEA 1XH1A 5C9XA 6A3HA 3MP3A 1R85A 2QCNA 3C2FA 3LCHA 1VBHA 1E5JA 1FWNA 1BAGA 4IIEA 1XD0A 1LUCA 3UWYA 3WD2A 1TG7A 1XSJA 2VVNA 3VD9A 2BZNA 3H24A 1B3OA 3L23A 3I3DA 4XKMA 2W62A 2DP3A 4HKPA 1YNYA 1ZZMA 3UP8A 3EA2A 3B9EA 3FHQA 4H41A 2E09A 3H2NA 2HS8A 3G1RA 3BANA 2PEVA 4FXSA 3A5VA 4WD0A 4DM2A 3G0UA 3W24A 4S38A 1X1NA 2WZMA 2PMQA 1VEMA 3IANA 1Q8AA 4MM1A 3THUA 3DECA 2YXXA 4S3EA 4JTGA 1W32A 1EJSC 2PP1A 4JOMA 4NZJA 4UXDA 3THAA 4KS0A 2MANA 3S5YA 5FEZA 3BAXA 3GU2A 5F1VA 4CQCA 4D8ZA 3LDVA 1DL3A 3A3WA 1HUVA 4XUGA 3LRMA 3W82A 1V6YA 3MMTA 1VC4A 5HJXA 3UJSA 1L9WA 1XS2A 4INFA 1LQ0A 5E6YA 3TKFA 5DLCA 2DPEA 4H9MA 3W2NA 1O95A 1WA3A 3W7HA 4LANA 1V7AA 2YCJA 1JPDX 4IFKA 4C6PA 3XINA 4DLFA 3NQEA 3R11A 2O56A 4O1EA 4CGTA 1XIJA 4Q4MA 4BI6A 2BLEA 1UROA 3A24A 2GSJA 4GCXA 3BCFA 3CPUA 1UMYA 2W92A 1F7BA 1CENA 2V8ZA 3RO8A 3LNPA 2E40A 4GKLA 1C3FA 1W3KA 2AKMA 4I3GA 3QPZA 1F73A 2ZX8A 1J8VA 2VWTA 1W5NA 1VR6A 2FQIA 1AMKA 1YHTA 3ZIZA 5GPRA 3OLGA 3CEPA 4N2YA 2V5KA 1OC5A 1SJBA 6REQA 4GI6A 3UZZA 4L6OA 5A8GA 1ICQA 1ICSA 4IGHA 2QJHA 3OO2A 5TQLA 3WQDA 1JR1A 1E70M 5C7VA 1GEHA 4PMOA 4WIWA 3L5LA 4L56A 3MUAA 1WZKA 2QNEA 2FHFA 3H7UA 1KM1A 1FXPA 3WUBA 3EEZA 3ECQA 3QH2A 2HTMA 4D9PA 4JGDA 2IQDA 2I5QA 3UYIA 2OKTA 1JXKA 4WY0A 4GIYA 1JRBA 2VNCA 4W86A 2YR1A 7REQB 1ZHAA 1Q4NX 2ZC8A 4JTJA 2BHUA 2VQUA 1PL9A 1XYAA 1O66A 1RY0A 3QQWA 4FX7A 1F4AA 4W87A 4K7YA 3OLIA 4LF2A 4PMDA 3EDKA 5FF0A 3IVSA 3LBCA 1QO2A 1SMDA 2QJMA 1JCYA 3TE9A 4CUCA 4AWSA 5CJ5A 1I6NA 4GFIA 2WOQA 1Q66A 4ZB2A 3T40A 3URQA 4JZ5A 1EBHA 3ARQA 1KCKA 5BRBA 1DBTA 4FSAA 4HOXA 4BKNA 2YOCA 2AAMA 3CPGA 1YX1A 5IFPA 3VIIA 1GJUA 4GYPC 4GI8A 3WD0A 3N73A 2CHNA 3AUOA 1DXIA 2O92A 4DO4A 2YW4A 3B3DA 3CZ8A 1YE6A 2YXGA 3MC5A 3V1HA 2JGQA 2XFWA 3NA8A 1S3TC 4ICMA 3VNYA 4JR5A 3KCOA 3SIMA 2R1NA 3CQHA 3CUFA 1E0WA 4PA8A 4UFMA 4JN6A 3V5CA 5T26A 1TV4A 1F3XA 3QC3A 4H2CA 1J0YA 1V3LA 1SFSA 2FHCA 2DZPA 1Z69A 4UTTA 4GPNA 5DY3A 3GNRA 3L2MA 3KW3A 1HNYA 2Y7EA 4KMQA 4V28A 1QNRA 2WMIB 4DJFA 3GXDA 3P3BA 4C6NA 1TPDA 3JVAA 2HBVA 3E0VA 2JBMA 4W93A 4GO9A 1WNOA 3WBAA 5AKQA 2EEXA 4ROPA 3WH6A 3CH9A 2VWSA 1ZJHA 2J9ZA 2PDBA 2CKSA 4JICA 5FJOA 3G1FA 2CU0A 4D8AA 4Q4RA 4NP7A 4F0KA 1QMLA 5K4XA 2YCLB 3QQ0A 4M81A 2W27A 4F2UA 1BTCA 5F2LA 1RR2A 3W7MA 3IARA 3S6OA 5AC7A 2OZ3A 2VEMA 2OSWA 3G77A 1DJWA 2RKXA 3CQKA 4Z1AA 1GVIA 5GVJA 1UR8A 1DIOA 4AX7A 1V0NA 1GW9A 4XZHA 2TODA 4KW2A 4PZVA 4LC6A 4IHCA 3QW4B 3GH4A 4PRWA 4HYVA 3RGTA 2VR2A 5G4HC 5DMMA 1JGMA 3NO5A 2CLHA 2QUNA 3S3GA 2GJLA 5G1TA 3NQGA 3VDAA 3W88A 4FXRA 1PDYA 5A6TC 2FTYA 1TPVA 3QV9A 1RH9A 1PXGA 2Q71A 4X60A 3RXZA 4AXNA 5FAJA 3AXMA 4AD0A 1Q6RA 4EF9A 1CGWA 5AHIA 4LEFA 3C2OA 3K8MA 1OFPA 2Y1HA 4O19A 3TLLA 4ZGYA 1HVQA 4A8NA 3AU2A 3TTOA 1KR1A 3MW7A 3DERA 3AIBA 3APGA 3MSGA 2C6QA 3C4UA 4LEQA 4B2DA 3CUZA 3I4EA 5C9WA 3QMSA 4TTGA 3N29A 2XIIA 1QVBA 5G4WA 3ABRA 3KDOA 5IXEA 2REQA 2XVLA 3PSWA 3QPEA 2QV4A 1DIEA 3B0UX 4PUUA 5L9FA 1XQLA 4G8TA 1H41A 4Q7IA 4HK6A 4AZ7A 3N34A 3RLGA 1N2VA 3UEQA 4XSMA 1O4UA 4YYFA 1YDNA 4BQ2A 4QRNA 1EGMA 4HBKA 2G3NA 1KFEA 2EGZA 3ID7A 4DXVA 3R1ZA 3UWVA 4TO8A 2JFEX 3J7HA 1ZP3A 1J93A 3G1YA 3HG4A 1W56A 2WCGA 1XJBA 1W31A 1MVYA 3PUGA 1EFZA 4FAMA 3LGDA 4JHMA 4LCRA 4C1NA 3V16A 2WKJA 1BQGA 2PF8A 2X7VA 4JTCA 4CNTA 3KS6A 3EKZA 2CCRA 3EX4A 1JDEA 3TW6A 3D5HA 4MJMA 2BP1A 3MZNA 4AEFA 2HPIA 3M6YA 3SECA 1LZOA 2VD8A 1DVJA 3M44A 2BGSA 1FWSA 1PZ0A 4PBFA 4W9TA 3WLSA 4X2RA 3SY5A 2O9PA 3N2CA 4RJEA 3N2XA 3LV5A 4W8AA 4FOKA 4JCMA 2WKGA 5HNUA 2X8RA 1ECQA 3BAKA 5H8UA 1HN1A 3E5PA 2PURA 2GGJA 1DJNA 4K6AA 4LW7A 1DJZA 1RUSA 5A94A 2RFGA 3SRHA 5C71A 1K1DA 5A6SA 3LCXA 1EHNA 4CKQA 3PC0A 3LQLA 2BFGA 1E1EA 2CZEA 4EXQA 4M82A 4ZB0A 3GLCA 3USZA 3PG8A 4DF2A 3NWRA 4LU0A 3I65A 2CZFA 3WQWA 2XWDA 3OJGA 3NYDA 4PN2A 4HZ8A 1MXSA 3TA9A 1TTQA 4Z1BA 3TTSA 3NGFA 4EOUA 3UETA 4KEZA 2HK0A 3W25A 4PEEA 1BKHA 3UXDA 2QF7A 3V75A 1Q45A 2WNZA 3MB9A 4LVDA 4U33A 1GOQA 1D3CA 1OADA 2J74A 3ORWA 1A0DA 1GJWA 2HISA 3MV11 2DH3A 3GYCA 1NP2A 3T78A 3A23A 3RDKA 1BSIA 2CETA 2OGJA 3PZOA 4FLOA 1FDYA 2D1ZA 5K9CA 2ICSA 4A3YA 1YTKA 3VGEA 1M68A 4JQ4A 2WVTA 2FMNA 4GXMA 3KTXA 3GVRA 1EP1A 4H8NA 1XLAA 4PUMA 2WSQA 3ABSA 3FKRA 3R8HA 1QNQA 4BEQA 1TV3A 1C93A 2QW5A 1WV2A 3AXHA 2WMFA 3WDPP 3QTGA 3LTPA 4HK7A 2G3JA 3SUSA 3NXLA 4Y8FA 4F3HA 1XLGA 1Z8AA 5KITA 3NDOA 1YDOA 3R6IA 4DYJA 3W27A 1LLZA 4UFIA 3OGVA 2RDUA 3SCUA 1H5YA 2ZZ2A 1WQ5A 4AVNA 3NXFA 3T08A 1LCOA 3AIRA 2WZIA 4DJDA 4MY1A 3ERPA 1W8SA 3TJIA 3CHFA 3A47A 4LUYA 3QSRA 1H60A 1U5VA 4RLIA 4I8DA 2PTXA 1F6PA 4QSFA 1DE6A 1EIBA 4QAWA 1VFHA 1I4NA 1QWGA 3MS8A 3N4FA 2DT2A 3CQJA 5GNZA 3PANA 4US6A 1ADOA 1LBMA 2YDQA 4DJFD 4ZEPA 4K1GA 5BNKA 2CBVA 3L0NA 1D9EA 3BG3A 3GXNA 1QU4A 3WUEA 1GVOA 3WK1A 1UD6A 2CLEA 3FA3A 1IHIA 4KCWA 4DBUA 4EPEC 1GPWA 2NVCA 2V5LA 2EG7A 3S4TA 2A3HA 3BXWA 3WQ5A 1OB0A 4ADUA 1UUQA 4ZCWA 3AIQA 3VKCA 1RZMA 1BXBA 1PHQA 3EMQA 5I00A 4C1LA 1A5BA 4FNRA 2YBTA 7REQA 4RE2A 3U7BA 3ZQ9A 1SSGA 4OOUA 3S9ZA 2P0IA 3WSUA 1T0OA 2VC6A 4IFOA 1Y7VA 2GGGA 3TVAA 5E0KA 1ITQA 4NNCA 2D0HA 2V67A 1PTDA 1SQ7A 1DPMA 4CVWA 1ZAJA 1CBGA 3FNDA 4MB3A 3H7VA 1H1NA 4J7RA 2W61A 3MVIA 1RPXA 1U5HA 4R53A 2NQZA 5LYRA 3V5OA 2YL6A 5AZ1A 2UY2A 4MKNA 2C0HA 1V3HA 3UJEA 3CHCA 5MHBA 2WMJA 1P0DA 1SR9A 2ZZ4A 2CXEA 2XIQA 1JDFA 3VOCA 2R14A 4WJ8A 2ZXQA 3T2QA 4RZ5A 4RDYA 1VCVA 1FA2A 1K8ZA 5HJLA 2INFA 1WP6A 4H19A 3NZGA 1Q63A 3WNOA 1PO9A 4WR3A 2YYTA 3EZ4A 1U1JA 3BAJA 1R3RA 4NYYA 3VDCA 3TN5A 3MUCA 2VX4A 4HU4A 1P5BA 1TIMA 3B0PA 5I06A 2WLZA 4E8DA 2GVYA 4B2DD 4CN1A 1T5AA 3WLRA 5KSWA 1NDVA 3E0LA 3IJ9A 4UOJA 4ATDA 3ZO9A 1FWIC 3ITGA 4CN6A 4AD3A 3W9ZA 2XGBA 3QR3A 4MZ1A 1G4EA 2ZICA 3FVMA 3IRDA 2GGEA 3L67A 4NJGA 3AHVA 5C7HA 3SCVA 3U6WA 4KH2A 3LXBA 1W3HA 2PDWA 4CNOA 3M0YA 3P8JA 4RPQA 4H04A 3AXIA 2QS8A 2WJEA 1H49A 1W1IE 3MKVA 4ZQNA 2C0AA 3MDWA 2W0UA 2BX7A 3VINA 1P1XA 3OEXA 3R10A 5A5WA 3GNXA 1A49A 1NF0A 4ONVA 3RLVA 2YCLA 1NAL1 1H7PA 3PPFA 2FGLA 5EMKA 1J0IA 3AMLA 4JHZA 4H8HA 3T07A 3TQPA 4WXYA 2RUSA 3SQSA 1AUSL 5LNUA 2Z1XA 1F07A 4PMNA 1HGYA 1Q6FA 2YDSA 1XBXA 1QOPA 1PE1A 1J5SA 5A8QA 2WSKA 3MA8A 1DP0A 2DW7A 4TVUA 1I2OA 3KLLA 1TWZA 2J75A 3F4DA 4DYKA 2HXUA 4HN8A 3BL3A 3BV7A 3WJSA 4DBEA 3O06A 4ZL1A 3EX1A 3WLLA 4DAFA 2A3CA 1FDZA 2BXVA 3PWGA 1GQIA 4ZQMA 4M80A 4KIRA 4PBGA 1LWIA 1QI3A 4EAYA 2WZHA 1HZYA 3SGZA 3HMCA 5AVHA 4MB1A 2PP0A 3WLKX 5I09A 3Q58A 1OX6A 2QGHA 7ENLA 1KM5A 2P1FA 4GZIA 2V5JA 2FH8A 3GG0A 4CN4A 3ANYA 3BW4A 1TMLA 3TFXA 2IKGA 1MZHA 4DJEA 3TV8A 4LVFA 1VAHA 3QGVA 2OXNA 2JGYA 5A6KA 4H4IA 3WLJA 4J28A 5CLTA 2Z1SA 2P50A 1F3EA 1TJ1A 3NZ1A 4Z1CA 3N2MA 2CWNA 4HCHA 4YYCA 4MWAB 3FVDA 4EKJA 4J5NA 4DO6A 5D2YA 1PAMA 2GQ9A 4ZO6A 4J1OA 3TJLA 3MMWA 2EG6A 2WHLA 3KHDA 2BHZA 3UGRA 3CHVA 4O0ZA 3PUDA 4QNWA 3DG7A 3NOEA 3ITLA 1GYLA 3IJ7A 1TREA 1E4NA 1GKQA 4B5UA 2ZBTA 1WYIA 3GZAA 3V7PA 3O6DA 2C13A 4GGHA 4AXKA 1TPH1 3H2EA 4PMUA 2NUYA 3CO4A 2QMJA 1ZGDA 4BQ5A 4DUWA 5M3WA 3CTTA 4IH3A 3JW7A 4QLKA 4F40A 2VEKA 3PZQA 3MMUA 1RAKA 2XJ7A 2Y61A 2D0FA 4FS9A 1OX5A 4IPIA 4EX4A 4BEUA 1KV8A 1PUDA 5BWAA 2CEQA 5HUOA 1H4PA 1TELA 4JYDA 3GKAA 2PD9A 3NAVA 1TUFA 4JN8A 4R88A 4OV9A 1LJYA 4DJDD 1IXPA 3CM4A 2IPJA 1WDSA 5TF0A 4KQNA 4XZLX 3QPYA 1TV5A 1FP8A 2ZCGA 2DW6A 3L4VA 2F38A 3WDRA 3R89A 3QOMA 4AVOA 5JH2A 5D8WA 4DNMA 4LJ3A 3OODA 1HP5A 4H9YA 3GC4A 2QVHA 2RDXA 2R24A 1RK5A 5EMUA 4HPJA 1P48A 1YBQB 3VDGA 5LZLA 1U5JA 5DBTA 1H5VA 3CZJA 3VCRA 4MADA 2ZRWA 4R33A 4FHAA 2VFHA 1O5RA 3ABQA 1NDYA 4Q32A 4AQLA 4B5TA 4Q4SA 3PTDA 4O1AA 4O18A 1H3GA 3PG9A 2BASA 4Z2LA 1CXLA 3PS7A 1OF8A 5FEPA 3QOKA 1KBBA 1IR1A 4TTUA 5AYXA 2VRKA 4US5A 1XCFA 2WB5A 4FP1A 2FZMA 2QVNA 5BWFA 3KCJA 3T9PA 5I78A 4XKYB 2F2KA 4A3HA 1PWMA 3PR2A 2IQ0A 4JTSA 2YLAA 1JUKA 1FY6A 1JAKA 2PWFA 3N3TA 3F2CA 3WG6A 4Z0SA 1M03A 3PBVA 3D0CA 1UR0A 1HO1A 3HQOA 1RJRA 4AWUA 1S2WA 5KZDA 1WX0A 1J01A 2GQ3A 1UP0A 2CW6A 4YHEA 2CC0A 1G4TA 2VZTA 3WK3A 1DTUA 2E5CA 3TUUA 2C16A 7TAAA 3GTXA 1WZAA 4C7FA 3DBNA 4POCA 3NEVA 1FWHC 2PLJA 1XYFA 3BJSA 5DCDA 3W07A 3RF9A 1YYAA 1IF2A 3CLWA 4AX6A 1CXFA 4WUIA 4PB5A 4L7ZA 4DN1A 2Q8LA 3V3WA 3DFNA 1MW3A 1EGZA 2JEPA 2XUCA 3B8VA 3FSUA 4Z2KA 1IZCA 2WNQA 2TSYA 2Z1KA 2FHBA 4KWUA 1K4GA 1MFUA 5FL0A 3R8GA 1AZ2A 4GMEA 1L0PA 3TCEA 3EWUA 1VFUA 1GOOA 4IF2A 4C6OA 5DMNA 3II1A 4UCGA 1QASA 5LIYX 3W2KA 5KZ6A 2H6RA 2WMKA 3FKKA 4WOQA 4GFSA 4N4PA 4OE7A 2ACRA 3QHMA 4CD4A 2PLKA 1BPLB 2WHKA 4QG8A 3C56A 3M0MA 4RE0A 5DBUA 1XIIA 1OCQA 4LUIA 2V3EA 4MNKA 3DGRA 4OV4A 2XH4A 1JIBA 3UWEA 2EG8A 3BQ5A 2G5WA 1IEIA 1GYMA 4JFTA 4DLMA 3AS2A 1V8EA 3GY1A 4B5VA 3IGUA 2OO6A 1K6WA 3SCNA 4DI9A 4C6EA 1TWWA 4RDZA 5M2FX 1J2WA 4DHGA 3RX3A 1EZWA 4S2CA 4JQAA 1DWIM 5E6ZA 3VGGA 2J8GA 5EA9A 4GH1A 5I6SA 4MUPA 1AL8A 4YL2A 1RBOB 1EJUC 5U4NA 2POZA 1OJXA 4PODA 1RP8A 2JKEA 2I57A 2PCQA 2A3AA 3MWAA 4YTTA 1ONRA 1E6QM 1B3VA 4ZQPA 1ZY9A 1F2JA 1BEUA 1OFQA 3W3OA 1MW0A 3E1F1 2Z7GA 1TSIA 1R47A 3NSXA 1A53A 3LK6A 1MZRA 3W7JA 3EKLA 3MT1A 3T2OA 1B3XA 4YWIA 2OEKA 2RJHA 2YA1A 2V3FA 3M0KA 4NXKA 1GKPA 5EFDA 2VC5A 2WZEA 4S3KA 1YE4A 3QFEA 3GNNA 3LM7A 1WKYA 1LBFA 3S2MA 2QV5A 3BGGA 2B31A 3HGJA 2PBOA 2W63A 4RXGA 3VK5A 1P4CA 3WNLA 2GQAA 4GY0A 4NG3A 4X61A 3Q67A 3M4HA 4BQ3A 4RL3A 2GJPA 3EB2A 5FCZA 3KM8A 1MDRA 4LS2A 4WQ6A 3P74A 2OYMA 1SZRA 2E5BA 4W8BA 1KM2A 3OIHA 1BFNA 4PTVA 3VO0A 1W1YA 1VEPA 2X09A 4Y96A 1OFOA 3GXMA 1EZ2A 3TZNA 4IQJA 3S0CA 3HM7A 2D2HA 5A8MA 1Q3NA 3OYXA 2VZOA 1THFD 3GHSA 2YXOA 2Y6ZA 5C6MA 5ABHA 4WZHA 2FGBA 5FD0A 1P6CA 4MPQA 4AG0A 1AVAA 1YXDA 4KBXA 2J6XA 3OA3A 1R6WA 4MB4A 3SO7A 3NPVA 1LQAA 2QCMA 3K30A 3ITCA 2ZX5A 1XLLA 3DN5A 3HG3A 1LL6A 3EXTA 1JULA 2P53A 4DUVA 5LIWX 5CPNA 1RCOB 3KFTA 4U2YA 5BCAA 1GGOA 1F8MA 2VXNA 3B97A 5DCBA 1R7OA 1UR1A 2GJNA 4GQQA 4AH7A 1B4EA 2GWGA 5D04C 5GJMA 4CD8A 1PTGA 1DORA 1N8WA 4DJFC 3MUXA 4JNYA 1XLDA 1UD5A 4Q8UA 5KTLA 4U5KA 3CB3A 4WRHA 2FPYA 2OMAA 2OWWA 5CPMA 3NQ2A 1WKFA 4P7LA 1YXCA 3P80A 3S9IA 3CT7A 5DQPA 3TK7A 1WOAA 3L5MA 3LHYA 3AFBA 1C7TA 3MPGA 4RE4A 3VFLA 4A2SA 3EPMA 3W7IA 2GL5A 3TQVA 4OBRA 2PSNA 4PR4A 5F7UA 4JTFA 1UKTA 4X0VA 5LSMA 4JL1A 1F3WA 1M01A 5EBAA 1GJPA 1KBJA 1E6RA 4AZIA 1TV7A 3PFRA 5HMEA 4CNUA 2DVTA 3H4WA 4IMEA 4XD3A 4B9ZA 3WBXA 1XM3A 3QGKC 3QFWA 1GTHA 4QJ3B 3H2FA 1QTWA 5HNTA 1GT8A 5JVLA 4D71A 3B8IA 3I7QA 3CZEA 3UA4A 1X6LA 4W84A 1W8GA 2V63A 3BG5A 3CWNA 1H0IA 2NQJA 3PZIA 1DQXA 4PB3A 4JDYA 1QJWA 1DJYA 3A4JA 4HHLA 4MWAA 1HX0A 4XBJA 2RH9A 4QIUA 3BE7A 3L2IA 1JCTA 3W1RA 3JR2A 1NQ6A 3TR9A 5HMDA 4MLJA 4ILSA 1RXOB 2VC9A 4G9PA 1XIDA 1SW3A 2VC7A 3QTPA 3AYTA 4XAFA 2W66A 3VKKA 1V3IA 3WD1A 4IZGA 3A13A 2EHHA 2CZ5A 1Q2RA 4E8CA 2DQXA 4C90A 2QPSA 1C90A 2H8XA 3P93A 1ZNNA 3INPA 4IPLA 4DUXA 2RHGA 4W89A 4W7VA 2ON3A 3R0KA 2OJPA 3U3HA 4DZIA 3WQ6A 3WLHA 4ZENA 4AIEA 3KBMA 2DEPA 1P7TB 2TPSA 1B5TA 3P14A 3GH5A 2EPHA 4M56A 2WWCA 2OLSA 1L6WA 4GUGA 3A6OA 1SO5A 4IGSA 1M41A 3LBOA 3SIZA 4KETA 4DB7A 4B4FA 4A6GA 3HMJG 3IUDA 3LV6A 2GDQA 5XIMA 5PTDA 1JPHA 4P5UA 1E9IA 3CNYA 3VOGA 3FAWA 4NZFA 1OHLA 1YIXA 1VP5A 3CHEA 4LAZA 4FR6A 1SZGA 2DZBA 3NO3A 2PPGA 1YBQA 2QPXA 3VZYA 1V6XA 2OU4A 3BLFA 1EEPA 1BRLB 1T7LA 4JDBA 1LLWA 2RGMA 1GQNA 4O52A 5CSRA 4FNTA 4UTWA 3O0FA 1BWVA 3CB8A 1OF6A 4QP0A 4FO4A 5CC3A 5FOOA 5H2ZA 3VOFA 5HA7A 1VRDA 4FIQA 3C8NA 4RZ6A 4BY3A 1Q8JA 3IIZA 5CZSA 5T8GA 3TTEA 3KVMA 3HN3A 3SR7A 3S5SA 2JALA 4O53A 5AY7A 3LI0A 1TX2A 5CAKA 3DYPA 5A2AA 4HK5A 4UFJA 5J5RA 4XKYA 1BYDA 3OVPA 1ZPTA 2O9OA 1C8XA 4YVVA 3TOYA 4G56A 2OLHA 1MUMA 2Y8VA 1H7NA 1LWHA 1HKJA 4OOZA 1J79A 4GK8A 3HJZA 4QQUA 2VCAA 4YXGA 2VEIA 3VZXA 1G5AA 1XLJA 3N9RA 4NNAA 3P67A 3PNZA 4HZ6A 2QUUA 4GQ0A 3O6YX 2XN2A 1RQEA 4RV3A 3WQPA 1PTAA 3GW0A 4M6QA 5I5RA 1XF0A 3OG2A 5AYBA 4MPKA 1SJDA 1B54A 1EP3A 4O1BA 4QS5A 1W9VA 1OC6A 4V33A 1KM6A 4GYPA 5I0DA 3W4RA 2YL8A 4C7GA 4DXKA 1KW1A 3OVRA 1C8YA 3I6EA 5CC7A 1ENUA 4NF7A 1TZ9A 3OQ8A 1JPMA 1VD6A 1I0BA 1S2UA 3CQ0A 2ZZ1A 3DZ1A 4HMCA 1TQJA 4NZ3A 4E4PA 3ITOA 1FUYA 2ZZ6A 4UTHA 1FBAA 2YL9A 5BW6A 2Y2WA 3A5FA 3HF3A 4NJIA 3MANA 1IZKA 4XVEA 4GNJA 2YZRA 2OEJA 2E5DA 2VZUA 2E7FA 3C0JA 3P81A 3H54A 2E1WA 4QLLA 1GQJA 2O0TA 3WLIA 3W70A 4K39A 4O14A 3WLTA 3JS3A 1DXFA 4UNKA 1OD0A 1E3ZA 1C29A 3TW9A 3PHAA 3AIWA 2BXYA 1W6TA 1YKWA 4DBWA 1ISZA 4LS0A 1GWJA 1F9CA 4A3RA 4DJDC 5D2XA 5F4XA 1KWKA 3IWPA 2PF0A 1FWAC 4GD0A 3MBFA 2WPGA 1SMAA 5HINA 3EDDA 4ZMGA 3MVTA 3NQ8A 4UR8A 2Z6IA 4L61A 1BG9A 1LT7A 2R82A 1KKRA 3AHZA 2CLIA 5LKYA 1GPFA 2AQWA 1ODUA 4BI5A 1CXIA 2B7QA 3E0IA 3RJXA 3HO8A 4GUJA 3HURA 3TTYA 4LY4A 3EWYA 5H6HA 3TWAA 1SR0A 2C14A 4LPCA 3CPRA 4TV6A 3K8LA 5GJPA 2Z2UA 1XPGA 1T99A 3DX5A 4J40A 5K3VA