2HJPA

Crystal structure of phosphonopyruvate hydrolase complex with phosphonopyruvate and mg++
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
290
structure length
283
Chain Sequence
MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMSTHLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTQELVRIEEFQGKIAAATAARADRDFVVIARVEALIAGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIRAAVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphonopyruvate hydrolase
publication title Structure and Kinetics of Phosphonopyruvate Hydrolase from Voriovorax sp. Pal2: New Insight into the Divergence of Catalysis within the PEP Mutase/Isocitrate Lyase Superfamily
pubmed doi rcsb
source organism Variovorax sp.
total genus 103
structure length 283
sequence length 290
ec nomenclature ec 3.11.1.3: Phosphonopyruvate hydrolase.
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2hjpA00
3EOEA 1KC7A 4QG9A 1JDEA 1S2VA 1E0UA 2XZ9A 1A5UA 2VGBA 3SRHA 3G2GA 4IP7A 1A3XA 3H6OA 3E5BA 3QTGA 4B5WA 2VGFA 4B5UA 2R82A 4IMAA 4L9YA 3N25A 4B5TA 1DIKA 3LYEA 1IZCA 1PKLA 3BJTA 2XDFA 4L7ZA 3QQWA 3PP7A 4G1NA 3GG8A 4FXJA 4B5VA 1OQFA 4QGCA 2VGIA 3B8IA 4JPGA 2L5HA 2V5JA 1IGWA 3E0VA 3QZ6A 2DIKA 2KX9A 4MG4A 3T0TA 3SRDA 3T05A 1GGOA 3KTXA 3HQOA 3SRFA 2DUAA 1DQUA 2BG5A 4KCVA 3QV9A 3QV7A 2HJPA 4QG8A 4HYWA 3PUGA 3I4EA 2HROA 3E0WA 1O5QA 3GR4A 1OY0A 4B2DD 1F61A 2QIWA 3EOOA 4MF4A 1T5AA 2X0SA 3R4IA 3OYXA 1S2WA 2HRWA 3LG3A 4DRSA 1UJQA 1SGJA 2ZE3A 1DXFA 3QV6A 1Z6KA 2VGGA 1AQFA 3FA4A 4L80A 2G50A 1F3WA 3SRKA 4HYVA 1O66A 2VWTA 3FA3A 3OQ8A 1ZLPA 3IS4A 3KHDA 3M0JA 1XG3A 2E28A 2V5KA 3T07A 1U5VA 2XZ7A 1DXEA 4KRZA 5TAOA 4B5XA 3EOLA 1PYMA 4TV5A 1ZJHA 1S2TA 3M0KA 4FXFA 4IQDA 1PKNA 4LSBA 4L9ZA 3HQNA 4YNGA 3ME3A 1XG4A 2OLSA 2VWSA 1F8MA 3MA8A 3U2ZA 2HWGA 4ROQA 4KCTA 3GQYA 3QLLA 1M3UA 1E0TA 3P0XA 1MUMA 4IQEA 5JVLA 1O68A 3OYZA 4KS0A 1S2UA 1U5HA 3QV8A 4YJ5A 1A3WA 1F3XA 4KCWA 1KBLA 1VBGA 4B2DA 3EZ4A 3BJFA 1PKMA 4RPPA 4KCUA 4QG6A 3HQPA 1A49A 4WJ8A 1F8IA 1VBHA 1M1BA 2WQDA 4TV6A 3VAVA 4B5SA 1PKYA
chains in the Genus database with same CATH superfamily
2DZPA 3WH5A 1S2VA 1V77A 2J9YA 1US3A 3MZ2A 4LGXA 1AH0A 1UA3A 4L4LA 4S3GA 3QTGA 4H83A 4X60A 3KOXA 4KWUA 1HKMA 3PK7A 2PWGA 1GORA 2CITA 3TWBA 3UZ5A 1RH9A 4C1KA 3N4FA 3CEPA 2BWGA 2ZCGA 1HGYA 3N2CA 2CYGA 3CQJA 2PFHA 6ENLA 4Z1DA 1C90A 2WMKA 3EEZA 4O18A 3L4TA 5A2AA 2Y5SA 1G9HA 3A47A 4AWEA 1BGGA 2DFAA 3AHYA 1ZBWA 2V2HA 4H9XA 1I2PA 2VCCA 1W9DM 2WKJA 1KW1A 2GGGA 1REQA 3WK2A 2VGGA 1LLZA 1C8VA 2ZUVA 3C2EA 3ONBA 3HMCA 4D6IA 1FH7A 4PCTA 3UCDA 4ORIA 1J79A 3S6TA 1N8WA 3G0XA 5FESA 3N2XA 3WUFA 6XIAA 3B9AA 3N4AA 1V93A 1F8MA 1S5TA 1KGWA 1MVYA 3BLFA 3BVJA 4PFMA 4S2CA 4WDWA 5LIUX 3RM9A 5ABEA 1VB9A 1WXJA 3RJYA 4U5IA 2IMRA 3QC0A 4CNTA 5DN1A 4CQDA 3DYOA 3S2NA 1AW2A 4ATLA 3W26A 2C1IA 1TRIA 4R9OA 2OR2A 4PULA 3WFAA 1MQPA 3D3FA 3NDOA 1P4CA 2EQDA 1JYNA 3KP0A 3T9PA 4CD8A 4C6IA 3U7VA 3ITTA 3HU7A 4LUSA 3E2SA 1HZYA 3BW2A 1A5LC 3RITA 1NVMA 3DZ1A 3BW4A 3HGSA 3U48A 3O6CA 3L7RA 2VUYA 4S39A 3WQEA 3H22A 4WY0A 1EYEA 3M46A 5EU9A 2WZHA 4LRTA 2FZMA 1XGDA 3K4DA 1OINA 2QDDA 1PIIA 3WNLA 1OJXA 2V6AA 4S38A 5F1VA 5DMNA 2NT0A 1D3GA 1FA2A 2IXUA 5CPLA 5A94A 1H7PA 3L0NA 3OA3A 1KFBA 2D22A 4IMFA 3EX3A 1TV2A 4J5NA 3W71A 1QOQA 1M01A 3H2NA 2XM2A 1JI2A 4U3CA 4GNJA 5HNTA 3DBNA 1VFOA 3VI2A 3D6NA 1EZWA 1UA7A 1HN1A 5BYWA 3V1HA 1R86A 5TIMA 3VKAA 3VNIA 4H9TA 4E4PA 1OSEA 1XQKA 2O4MA 1XYLA 3LU2A 4MY1A 1SFTA 3QHNA 1X98A 3H6OA 4I5UA 4RK8A 3V5OA 2CXGA 3AYSA 4B5WA 2C19A 4XZLX 4AY8A 3WELA 1QK0A 3GG7A 3H24A 3QR3A 4JKKA 2V68A 3GVVA 4PFHA 4JTJA 1Q2RA 1EP1A 3F4CA 2BHZA 3C0QA 2PDQA 1GVFA 3VGEA 1IT8A 2OODA 2CZ5A 4WR3A 3SY1A 1Q7QA 3PB0A 1CIUA 4LAKA 4X9YA 1UH4A 4EACA 3SUTA 3CAQA 2YBTA 4TR9A 2QEZA 2G4FA 2WAGA 1FQ0A 3C2RA 3N18A 2HV5A 4FF7A 3TLQA 4W87A 5CSSA 4F2UA 1EUNA 1OX6A 4XVEA 3A3WA 3PSWA 4KRZA 1SU5A 2X1SA 2J7GA 2ZUTA 1V6VA 3U8GA 3VKJA 3F1QA 4Q33A 4B3ZA 1NOUA 1E5JA 1HGWA 5D30A 5HWNA 5K9XA 4Q7IA 4C5YA 5IHRA 5M17A 1QNOA 5CPMA 2QLYA 2Z0IA 3DFQA 1A49A 2ALRA 2Z2BA 4HPJA 4U2ZA 4D2JA 3QMSA 1CGTA 1K7EA 4POCA 2XISA 2PDPA 1C9WA 1DIDA 4DUXA 1B3XA 4TQTA 3WFZA 1UKOA 3WNOA 4DZHA 4NAEB 3PSVA 3PZNA 1AA1B 3AC0A 5FF3A 3PR2A 2VQUA 3LTPA 1V5XA 2W61A 3FHAA 3IPWA 3CB3A 1AJ0A 3WQOA 3MUCA 4J2PA 3E12A 2ZE0A 3ELFA 3STPA 1KQZA 4GI8A 2Y89A 3HG4A 3L9CA 6REQA 2J77A 2RDWA 3WF2A 1HKVA 1X8FA 3B05A 1WOBA 2XM1A 1Q45A 4UNLA 4DWSC 3G1FA 1CT5A 1F6PA 2GVYA 2YR1A 3WH6A 1NM9A 3T78A 2WHMA 4JICA 5BMXA 3EMZA 1ITCA 4S3AA 1OZQA 3NWRA 2DW6A 3TW6A 4L6DA 3IWPA 4ECLA 4UQEA 4UQCA 4JYEA 2DU2A 2GZXA 2V30A 3L4VA 3WUGA 1SZFA 4CCZA 2WV8A 3ANYA 1UPMB 1E73M 5BWFA 2QJNA 1SZGA 5FJOA 1Z89A 4FNPA 1VRDA 4J27A 1QMLA 1XIIA 3UQNA 3SIZA 5GJMA 3AIWA 2NQHA 4RZ5A 1P0BA 3GHUA 3SCVA 3QYSA 3SN4A 4JFWA 4CN1A 3UWEA 2YLLA 5LIXX 2XU2A 2QF7A 4LBRA 3W7CA 4JIHA 2ZUNA 4XUYA 3S83A 1RBOB 4MB1A 1EC8A 3DDMA 3SZ8A 3ECQA 4ZE5A 3WK1A 1JGMA 2QCLA 4LH8A 4GG9A 2RJGA 1BKHA 2D69A 4C1NB 1ONWA 2NT1A 1VS1A 5IBXC 2BVWA 2IPFA 1QI3A 1UP3A 3EX4A 1XLHA 4HCHA 4G9PA 3QZEA 1OGSA 1OK4A 2YSWA 3TJLA 1RSCA 3OP2A 2PUZA 4IPJA 3VO0A 3P6LA 1O94A 4OV9A 1LM1A 1F76A 2F2KA 4ZMGA 5CZJA 4FALA 5EMJA 1OFQA 1C7SA 3UBPC 2E5DA 3VGGA 4PGLA 4F0RA 2V3FA 4JQ3A 4Q4SA 1A4MA 1L9WA 2R14A 4PMDA 3UPBA 2WLYA 1CGYA 4IJRA 4LNCA 1I4NA 1ZJIA 1W9BM 1ECQA 4LUIA 4WSKA 2E68A 3CGTA 1OG0A 2FFIA 2OZ3A 2BGSA 2CEQA 4MZ1A 5I77A 1EJUC 4XAGA 1HUVA 5IXEA 1E71M 1XRTA 1HJXA 1XUZA 1AQMA 1RD5A 4QBXA 1FWDC 2PGRA 4HKPA 4D6HA 4NNBA 1O5KA 3VD3A 4DZ5A 3I7RA 3QV7A 3FV9A 3VM7A 3GR4A 3P62A 2BGNE 3RK8A 4J9JA 3RPMA 3W72A 4EPBC 2J6VA 3EWZA 4YL2A 3UPMA 1BRLB 3NYDA 5H8PA 5GVJA 2BHUA 4M56A 1RCXB 2FKPA 4MDPA 2YJQA 3MT1A 1IEWA 2QAPA 4AISA 1EL3A 3FVMA 3G1HA 3W88A 4FF5A 2P0IA 2O92A 3WQ6A 2F9RA 3DC0A 3ZWTA 3MANA 4NAEA 2YPIA 3BOLA 4LB3A 1S2TA 4DBUA 3WBAA 3GNNA 1HP4A 2FGBA 1W8GA 4EPDC 3T8LA 3WLJA 4GIRA 4HPXA 5EMKA 1XC4A 1TVNA 5I79A 3U6WA 2MNRA 4DBWA 1GUVA 3AMDA 3JUGA 1P1XA 3LHVA 4DNHA 4UTTC 3TV8A 3MPGA 1F8IA 4Z0SA 2V9DA 1B57A 2QMKA 1XC6A 2EHHA 1WUFA 1WDWA 2VYOA 1Q13A 3CAWA 2E3ZA 1RVGA 4DN1A 4Z42C 4IP7A 3RLHA 4JQ2A 3AMKA 1KFWA 3PPHA 2X1IA 4B4FA 2PDWA 1V3KA 2IPGA 1WDSA 3IJ9A 2Z24A 4W7UA 3ES7A 3S1UA 2BZNA 1B4EA 3FLUA 3VUPA 3G6LA 5AKQA 3O16A 4K7YA 3SRDA 3GVGA 3THCA 3GVWA 4BQ4A 4DPQA 3WO8A 1O1HA 4MTVA 3KTCA 2CLKA 3WJZA 5FF2A 3BAWA 4H7ZA 3II1A 3WUBA 2E25A 5CXPA 4Q8WA 1WAUA 2NX1A 3H23A 1XLKA 3EPNA 5C6MA 1H0GA 2W5FA 1T41A 2EF9A 4LAZA 1EP2A 1SJDA 4OZOA 1DL3A 3WD3A 4MY9A 2ISSA 2VENA 3TVAA 1B5TA 2HPIA 5C9XA 5FSDC 1QI2A 3IS4A 4MVAA 1TCMA 2IKGA 4U2YA 1BTMA 1UWSA 4C6QA 3RCYA 1JR1A 3D3AA 1RD6A 5AECA 3GW3A 3LZ3A 3W74A 5H91A 5F4WA 5U4NA 1OBAA 3O7UA 3UNTA 1GVRA 3U2CA 1DWFM 1G1YA 1OFAA 5HMDA 4DJDC 3VFLA 1XH0A 3FYYA 5A6LA 4C1NA 1KBLA 1G4TA 4KESA 3GC2A 5C2GA 3AS2A 4Y96A 1PKYA 1H62A 1HO1A 2YLAA 3DHDA 1EOMA 4Z2KA 3ENLA 2WWCA 3TW9A 4Q8TA 2VURA 3C3UA 4OHQA 4WGHA 3VM5A 4RR4A 3QY6A 1U1UA 1G94A 4F2TA 2YZ5A 3AALA 3CV7A 3JU2A 4OOZA 4LFYA 3N2OA 4RNJA 3H2MA 2C15A 1A50A 1LLOA 3B9OA 1UP0A 4R9XA 1B30A 1Y5WA 1F5ZA 1UWIA 4XSMA 4WLCA 4UTUA 1PZ0A 3DFTA 3LG3A 3L5MA 3R5EA 1QJWA 3QR0A 7ENLA 2YCKX 4O19A 4YWIA 1YBQA 3VIKA 1TZ9A 3E96A 3WYZA 2WCAA 4FNQA 4D6GA 1GOKA 1QDSA 2HSAA 4JTGA 3GNRA 3T4WA 3IV3A 4Z2GA 1K6AA 4JCLA 3ZT7A 4KWSA 3AIUA 1NF0A 2OPJA 1UD3A 4EANA 2IS7A 1EXBA 3OYZA 3H12A 3QQ0A 5FEXA 1WDRA 2PWHA 3EWDA 2PWVA 3BWWA 5D9OA 3K2GA 4ADUA 4XKYB 5TNVA 1MMFA 3KOYA 3VAVA 4ERGA 1BRLA 1A5BA 4O0KA 5GJNA 1DWHM 4H6EA 1V02E 4RE0A 2BODX 4RXFA 1R6WA 3GY1A 4INFA 2FGZA 2DY3A 3T08A 3LSBA 1E5NA 1XINA 2WSYA 1AH3A 4S3KA 3M0HA 2D20A 4DJFD 2WCGA 1W1A1 3IVSA 3REQB 4ZOCA 4JTTA 2HVMA 5A2BA 1V0NA 1GOOA 3QV9A 4H4IA 5HR7A 4KWOA 4MKNA 3R6IA 5A8OA 3WBYA 3PZMA 2Y70A 3HOJA 2H9AB 2J75A 3TONA 2NQ9A 4H9VA 3CBWA 5B80A 2ZX9A 4GRSA 4FOUA 2FHBA 3MKVA 4GQBA 3DCPA 4TMCA 7REQB 3CEUA 3EB3A 3IEBA 1HKWA 4EX4A 4MHBA 2QF8A 3EOLA 2DT0A 3NZRA 1E1EA 1JUBA 3SADA 4YXGA 1NDYA 4PRTA 3TTYA 1K1DA 3V1PA 3UETA 3CUJA 2IW0A 1K9DA 1CTNA 4NJGA 4IPLA 4UC5A 3F2DA 1LQ0A 3LEPA 4DHGA 1VPQA 3ZLGA 2VOMA 3P84A 1OZMA 5C2CA 1UJPA 1CXHA 4WJEA 3FJ4A 3OLEA 4QX4A 1F05A 3SRHA 3LQLA 5I06A 4EP8C 5BXRA 4DUVA 3QGKC 1N7KA 1N2VA 2BB0A 1OC7A 3H2AA 2PSNA 4JTHA 1TPC1 3AXHA 3PANA 4JTQA 4MFEA 3WSUA 2PP1A 3M6DA 1F3TA 4QEHA 1UBSA 1F6YA 1O60A 3MVIA 2QJMA 4O4VA 4ADTA 2G3MA 3ARQA 2DSZA 1SFJA 3E0IA 3T6CA 1S2AA 2WNZA 1JXJA 4EWJA 2G0WA 1NAL1 4FHAA 3M5XA 5BRBA 2VDIA 3L66A 3CL6A 1C91A 5LA0A 1VP5A 3RMEA 4C6FA 3SSJA 4GGHA 1HX0A 2YL9A 4HZ6A 4R85A 4MKSA 1RR2A 4TMBA 5JXQA 1GONA 1U30A 3VK5A 2FJKA 4HPGA 4HQVA 4L4MA 3AOFA 3HQ1A 1UCWA 4B92A 4EAYA 1TTJA 1I9CB 4JFSA 1YLVA 4E2DA 2UV8G 1FWHC 4HN8A 3KOFA 3TXZA 1UB3A 3OB8A 3OZMA 3TTEA 3WIJA 4OGZA 2FJUB 4JDBA 1XYBA 3S1VA 1JIBA 4QJ1A 5H6HA 4XIMA 3VNJA 4AUBA 4OTKA 1VHNA 1OFOA 1JNDA 2EKGA 1BXCA 3T8QA 4HHPA 5KZ6A 4UTHA 3DHFA 1WDQA 4CU6A 4AC1X 5CJ5A 2KZHA 3LTYA 3BE7A 4MYAA 2Z1SA 1OVDA 4K1GA 1I2NA 3BQ6A 3W07A 3IGSA 2CWNA 1PZ3A 1QTWA 3IIOA 1JJKA 1C3FA 2B0MA 1WA3A 4L9XA 2Q71A 2ICSA 3C0SA 4KF1A 3WCZA 5GQBA 2PDKA 3WQVA 2ZXAA 1FCVA 4CQ8A 5HNRA 3CHFA 2HCVA 2DIJA 5AZ0A 1WXZA 1X7FA 3ABSA 4HTYA 4DAFA 4MPKA 2CLIA 3QHMA 1KRBC 3NPVA 2V2CA 4EPEC 3N2MA 3TYUA 3SY5A 4NVTA 1OY0A 4B2DD 3NYZA 4DIAA 2PDMA 1TR1A 2GUBA 3VDCA 2H8ZA 1JG9A 3UJSA 3S42A 1EGVA 3FCPA 2JKPA 4DJEC 2X09A 3WF1A 3MDWA 4XKYA 5F4SA 2R6OA 1OFDA 3WDIA 1M5WA 3AIQA 3MUAA 3O15A 2RHGA 2PRMA 4W89A 1J10A 4UMBA 2PGEA 4B5NA 2DPEA 2VZOA 1E51A 3TR9A 4JTIA 1JNEA 1CBGA 2EKCA 3IRSA 4LF1A 3WQ8A 5EA9A 3M0KA 1PUDA 1SW3A 1MUCA 4LQ1A 3B8WA 1W17A 4OU1A 1NJJA 2OLHA 3B0YA 3REQA 3K4AA 1KFEA 4IL2A 2C16A 2ZX8A 4P8WA 3GNOA 4H7VA 3WH8A 4A3YA 5D8WA 4I8YA 4GYPC 3VNDA 1GZ1A 2H9AA 3A12A 3BDKA 1QBBA 3OGRA 3IACA 4M51A 1SO3A 1FHLA 3EPOA 3A22A 2VMFA 3O05A 4HK5A 1QNPA 1GJWA 4PL2A 1SO6A 5DRCA 3TJ4A 3W7GA 3HPSA 4GIYA 3IJ6A 1KXHA 1W5PA 2PU1A 2R1NA 3S2LA 1DE6A 1U5JA 1PSCA 2G3FA 3BICA 2W27A 3C3NA 1R9YA 4TX6A 3CZLA 2ZWZA 4RPQA 1L8NA 3UXLA 3N3TA 3MCNA 3V3WA 3WEMA 3QQ1A 3QV6A 3C86A 3I3BA 2YDSA 4ALDA 4WGXA 5BZAA 2VC7A 3DUGA 3LCLA 3S9IA 1UWQA 5HANA 5C7HA 1ME9A 3NQ7A 1DXIA 1RVKA 2V5BA 5CPTA 1AW5A 1HJUA 3TKFA 4GVHA 5D33A 2QGYA 4IUGA 1OT1A 3WF0A 1PTGA 3UWZA 1UR0A 4C5ZA 7ODCA 2PLKA 3NM3A 1QVBA 2VR4A 3GIQA 3CMJA 1VH7A 3POCA 1KCLA 1S1RA 3GNDA 3ATZA 4LAOA 3M5YA 4X61A 1FDJA 4C7DA 5TD4A 2X05A 4Q8VA 1TQJA 1JEZA 4MNJA 3WLTA 5LA1A 2HBVA 3VCCA 5I3JA 2ZA3A 4N2YA 1WZMA 1TR9A 4GACA 4ZSTA 1PWLA 4N6EA 3ABXA 3TP4A 4AF0B 3AS1A 3KOWA 4FIRA 1BGAA 2O0TA 2RGMA 3DERA 3FDKA 2QUMA 1TWDA 5DBTA 4O28A 3KUMA 3GZ3A 3CM4A 4FNTA 4B16A 4IJCA 4H8NA 1UKTA 3E3HA 1QW8A 1K8ZA 1FXPA 2DVUA 2ZDRA 4Z1BA 3EWBX 1TV7A 2X8RA 2DP3A 4H01A 4GQ0A 3NCOA 2BTMA 3LM7A 1MYRA 1MWOA 3H53A 3GTHA 3OBKA 3G22A 1J0ZA 1R2RA 4D8LA 1KBBA 5F7UA 3A3XA 4WOZA 4JTUA 3DH7A 1KKRA 1VQTA 2NQZA 3HQNA 4IFKB 4KFPA 2P50A 2VFIA 3VZXA 2ONEA 1B9ZA 3NAVA 3HMJG 4NJIA 4HNTA 1UD2A 1DHPA 3HG3A 1TX2A 1G4PA 3GU1A 4NT0A 2XHYA 2OYLA 4KCUA 4CQAA 3ERPA 3GBEA 3QSRA 3AROA 4AIOA 3U57A 4X0VA 3LRMA 2JEQA 1HG3A 2YFNA 5D2VA 4UB9A 3G2GA 4AMAA 5CG7A 3UZWA 1UWAA 1J2WA 2AAAA 1F4HA 2XDFA 3BZGA 4XAYA 1G0CA 3W27A 8XIAA 5G2WA 4GI6A 3W1PA 1Q6EA 4M81A 3T0TA 2J78A 1EC7A 1CXFA 3WLMA 1FWWA 3MP4A 1QPKA 5D04C 2ACUA 4Z1AA 2NZLA 1Q4WA 4I8DA 4KEVA 3TTOA 2P76A 4QEEA 2ZX6A 4LB4A 3JZUA 2OT0A 2EJAA 4FX6M 4LUYA 3DFNA 1X8CA 3KRBA 2NVCA 3S5SA 2DSWA 5DMYA 3HURA 4F0HA 1DWIM 2Y88A 3EA1A 2XGBA 2XIJA 1WBHA 1UR4A 3IUIA 3N6QA 4UTWA 3W1RA 1ODZA 3UF9A 1IQ8A 3GX9A 5TF0A 5HA7A 1ZJHA 4NI3A 2C6QA 2CWXA 3WZ0E 4Q3MA 3HN3A 4DJFA 2ZUWA 1MZHA 4LVFA 3GS6A 1ITXA 5C7VA 5AZ1A 1VIZA 1ONRA 3UY8A 3FS2A 3GD6A 3CUZA 1L6YA 2V82A 1E0WA 1YTKA 3LLFA 3IGUA 3SJNA 1KLYA 3FKRA 5CC7A 3PVFA 3R7MA 4GUHA 4M7SA 3DIPA 3UCQA 1BSLA 1K70A 5AVHA 4IP4A 3VE7A 3T44A 4FXJA 4UFIA 5E0FA 1NOWA 3M7WA 5H8UA 2DZTA 1ZJBA 8RUCA 1V6XA 2PAJA 3MP3A 3R89A 1NSJA 3ES8A 5B7YA 5FJPA 2J7FA 4QNEA 5C0QA 1W3HA 3MP5A 3PZQA 1P43A 3BV4A 3L21A 2QMJA 1VCGA 3WLLA 3PZUA 3B9DA 2YGYA 3V5CA 4Y8EA 3VNLA 4QJ5B 1ZQ5A 4KKXA 1QO5A 3W2JA 2C3ZA 3KM8A 4MDOA 4D6JA 4AF0A 2CZDA 5LNUA 4G6CA 2H3BA 2D2HA 3LBMA 1JRBA 8A3HA 3E1F1 3GTXA 4IGNA 3EKZA 3H8AA 2Y6ZA 1Y0EA 4JBRA 1E1FA 4O16A 2O9PA 3GXDA 3VC5A 5JH2A 2I17A 2QCDB 1BVWA 1ENUA 4FP1A 4L65A 5D2TA 4DAIA 1OCBA 2D73A 1O4UA 3LPPA 4GC4A 1QHZA 1YX1A 5HUPA 1A5UA 1B3ZA 5EGRA 2ZRVA 3NFUA 3MDUA 1ZHAA 3PZIA 3P2VA 1G69A 3HJZA 2QNEA 3BGJA 1A0EA 4HK6A 4QLLA 5RUBA 1NU5A 1JULA 1V8EA 3BAXA 4XVDA 4REQB 4IFKA 4GUFA 1BYBA 4DF0A 1DWAM 3V0UA 3RU8X 5D05A 3WY1A 3LHYA 3T0AA 5K9DA 2F38A 1Z8AA 1A5KC 4L1XA 1UWTA 4GFSA 1UJQA 5CEWA 3BSGA 1KTNA 4Y9PA 1UIOA 4ZO9A 4PA8A 3ONCA 1VF8A 2EPHA 4U28A 1V3HA 4KFNA 4Y9AA 5A5WA 4R88A 2OSWA 2RDUA 3RPTA 3R79A 3P60A 1N8IA 4HCDA 3W82A 1YNYA 1UQYA 1Q85A 2VCBA 4NILA 4B91A 6A3HA 1CWYA 2PGFA 5HXMA 3LXAA 4HGXA 3W7RA 3VGDA 3CPUA 3IIXA 1BWKA 2JGQA 3CC1A 2V38A 2J7BA 5DY3A 3W7NA 4B2DA 2YOCA 4YMZA 4FZIA 5BOFA 4US5A 4IFOA 2F6KA 1FDZA 3QF0A 4YTUA 1SJCA 4MADA 2P1FA 1W3TA 3NR0A 3DOPA 4GXWA 1W9PA 1K7FA 3QM3A 3EKLA 4F48A 3GDKA 2ZQ0A 1EB3A 1FFRA 4PMVA 3BAYA 4WF7A 1UBPC 3C2YA 1KXTA 3VIHA 3S8HA 3G77A 3CL8A 5HATA 2YW4A 4P5UA 3SN1A 3W38A 3KAOA 1F74A 3TYBA 4CLMA 3NQ2A 4NUWA 4HK7A 4JY9A 4N4QA 3LRLA 4DNMA 9XIAA 3L4WA 3CB8A 3CWHA 4GO9A 5I02A 3LERA 5EKYA 3NSXA 1X1OA 1C29A 1WBJA 1CXEA 1N55A 3NUKA 3N9KA 3NQAA 3DFPA 3KWXA 4RNHA 1SPQA 3SY8A 5IFPA 2YL5A 1HXJA 3G3DA 4CD6A 5IBXA 3GDRA 3JS3A 3U7BA 2GL5A 3GK0A 1ZBCA 2WKGA 1GQNA 4IOTA 5XINA 2C91A 2X2YA 1GZJA 2Y7FA 5EFDA 2G5WA 3WJWA 4MKVA 3N12A 1MZRA 1ONXA 1EDGA 5A6BD 2GGHA 1Y7VA 4H6QA 3NZGA 2GDUA 2QV5A 4CU8A 3O6YX 2Z1XA 5SWUA 3MHUA 3TQPA 4CNOA 3WL0A 2AAMA 1E0UA 2DT1A 1FXQA 4DF1A 2RJHA 5F2GA 1IEIA 2XVNA 2BXVA 3SDOA 3MI6A 3HJEA 2ZZ5A 4JS3A 4PTDA 4L9YA 1UW9A 3THDA 2WJFA 2OQLA 2BNJA 2UWFA 4S23A 4NRRA 3BLOA 1L6SA 2PP3A 3APTA 2PEVA 7TAAA 4KCVA 3ID7A 2PDCA 3MSRA 1F9CA 1XKJA 3FVDA 2PODA 3A3HA 4AZCA 3GIYA 3BL3A 2Z2UA 4TXEA 1WXYA 3I7QA 3HGJA 4J1OA 4CN4A 3ZMRA 2FVKA 4GMEA 3OHIA 3W7PA 1E4NA 1EFZA 2FYMA 3G1DA 4WX2A 1BFNA 3TW7A 3ZS4A 5HNNA 2QCDA 1SM9A 4Z2LA 1E3ZA 3H2OA 1CX9A 3B0PA 2PDYA 3ITCA 3WDPP 3LCWA 3Q2DA 2PTWA 4KQNA 3R0DA 1VC4A 2H6RA 4EOUA 2Z29A 1XYFA 4FMVA 4O11A 2WWDA 1ZS2A 2VZUA 3VU2A 4J3ZA 1CGVA 4D6EA 5C70A 1FWAC 2VR2A 2VP8A 3FIGA 2ISFA 3GUWA 4RDYA 4D6CA 3B0UX 2PBGA 1AMKA 4LCRA 2ZRWA 2GQ8A 1CYGA 4OVXA 2PZ0A 3ZSTA 1JZ7A 4LXFA 2XWDA 3BO9A 4GX8A 4K37A 3C2FA 4US6A 1JI1A 4O53A 2VZTA 2OXNA 5KITA 4GPNA 3C8FA 2I16A 2VVSA 2X1UA 1R87A 1Q4NX 1J93A 1U1HA 3N13A 1EWDA 1Q5MA 1V6WA 3LGGA 1YTEA 3CU2A 2BLEA 3S3GA 2DUZA 4H9YA 1OYCA 1TJ0A 3B8VA 4GI9A 4K8HA 2VL4A 4UTTA 3H7RA 3E0FA 3GR8A 4PEKA 4MNKA 1TZ7A 1DEDA 1V7AA 1B1YA 4RE3A 2WANA 1OIMA 4LW7A 1EXPA 3DKJA 3PF3A 3M0MA 1NF7A 2ALDA 1UZHA 2D2OA 3K46A 3TYAA 3KRUA 3PFMA 3SUVA 2A3LA 1G7UA 1HO4A 1FKXA 1EX5A 4B9YA 3I68A 3BXWA 4NAFB 1HJVA 4GVFA 2FZDA 1UQZA 1VYRA 3N11A 5FL1A 4MSSA 4J2MA 1L2UA 2GJLA 4AHOA 1FP9A 3NQGA 1W31A 3VOFA 3UZYA 1IEVA 2QCEA 4JN6A 4AXKA 4I7VA 2AL1A 3URAA 1JF5A 4Q6JA 1RJRA 4IICA 1GEHA 4AEOA 3DU0A 3OGVA 1GG0A 4NY2A 2XN2A 4RE4A 4S3BA 3XIMA 1SO4A 1A5MC 5GNYA 2XIOA 1QBAA 2PDJA 4EXQA 2Z28A 4NZ4A 3MUZ1 2J74A 4MPQA 3W7QA 2ZUSA 2W79A 5EMUA 2INFA 3DFOA 3LPGA 4PUJA 1M65A 3LS9A 1PJ9A 1O12A 3TOYA 1BWLA 1NQ6A 1LP6A 2DSVA 1GQKA 2VUNA 2HTMA 1SW7A 2GWGA 3A9BA 3CTTA 3NSNA 3RX4A 2C0AA 1Q7ZA 1ZAIA 1JFHA 1JPIA 2WLZA 2ZZ3A 1JZ4A 2Z7KA 3IAQA 3SIMA 3KOZA 2J62A 3B8DA 1V3LA 2G3IA 1NWTA 1XL9A 4YHGA 1AQHA 4BWLC 1LOLA 1LL7A 1LRQA 3LN3A 1Q6GA 1ZP3A 4AYSA 2FH6A 4NG3A 5K4XA 2PA6A 4FSAA 3H4GA 1IR1A 3CS2A 4D8ZA 2GVEA 3T09A 3UZZA 4WCJA 1SUXA 1E55A 3C5QA 5JVLA 1JD7A 3EOSA 5AHFA 3W81A 4Q8NA 3HV8A 1DPMA 1I1XA 2BOFX 2CZVA 1PCWA 4LALA 4GFIA 2WM1A 4OV4A 1T0OA 4H7CA 3PBMA 4I9TA 2P8CA 2Z1BA 4NL1A 3VNKA 1O95A 5XIAA 4MUPA 4O0QA 2HXUA 4JQ4A 4F0LA 5ABTA 3O0KA 4WOQA 1BLIA 3L2LA 3R58A 4DF2A 5F2LA 4LRSA 3K4WA 2DJXA 5LGXA 3A4AA 1TV4A 1UUOA 1DIKA 1EC9A 1WYIA 2ZTJA 4C90A 4MGGA 3O07A 2BX7A 3TYZA 3MWCA 2IKJA 3EPMA 3T05A 1ZNNA 2O4QA 3UJEA 1UR1A 3BARA 4IQJA 1BXBA 1P6WA 4QRNA 3GXMA 4CGTA 2DVTA 3EBVA 2ZUMA 4KEMA 2DGAA 4GC3A 2QCFA 2PE4A 3ZO9A 2INZA 4S2BA 1FVPA 3MO4A 1H1ZA 3QHOA 1ONEA 1GOMA 2DJLA 2DW7A 1RBAA 1J01A 1M7PA 1NP0A 4HYVA 2W6RA 4MIMA 3MS8A 1J11A 1J6PA 2E28A 3H4WA 3C2OA 2Y2WA 3CIXA 2F84A 3I4KA 1E9YB 4H41A 3QOMA 2HISA 3E49A 4V15A 1R7AA 2RUSA 2OLSA 5I24A 3MA8A 5I03A 1KFJA 4KEZA 5L6UA 1B0IA 2G41A 2WMHA 5HMSA 4C7FA 4GHRA 2QXWA 3M5ZA 2F6UA 4C7GA 1KM0A 1HT6A 2WPGA 3S9ZA 4AHQA 3ZJKA 2POTA 1C8XA 4NASA 3PBVA 2VEFA 2VZVA 1L6GA 4QDMA 3IJDA 5LIYX 1GQIA 3COTA 3CQ0A 3N25A 4IL0A 3FA5A 3VMOA 4NAFA 1FWSA 2CKRA 3R12A 3NQEA 2J8FA 2QT3A 1T6MA 3QH2A 2WZTA 4QXIA 5AOUA 3LK6A 4NNCA 1LZOA 3IJIA 4L1GA 1DXFA 1EX1A 1ZENA 3SO7A 2Z1WA 2CZFA 3GE7A 3P80A 2Z1VA 3DFSA 2ZXBA 4KWWA 5FEWA 3IIPA 1ZLPA 3NSMA 2YCEA 3MC5A 1AUSL 4YVXA 2P3ZA 1J6OA 1UROA 1M7XA 3RM8A 2VHLA 2OYMA 7TIMA 4DYEA 1PKNA 3T0CA 2DUXA 4FK9A 4YWSA 1UKQA 5CBBA 4FIQA 1IEQA 3W1XA 3CLWA 3CWOX 3KL0A 1VFTA 5JBFA 4JNYA 3BC9A 1OC5A 3HGOA 5FL0A 1SR9A 2Y8VA 4ORMA 1V51A 1S5VA 3FXGA 1NDVA 3W7LA 1W1PA 4MFDA 3DG6A 4B5SA 2OWXA 3W7IA 4AIBA 3ICJA 4HVXA 5CG0A 3RU6A 4NZ5A 1H4PA 1PVNA 1R0MA 2E8YA 5BXPA 2XIMA 2WM0A 4LTSA 3TAKA 1YDNA 3NVTA 4AWUA 2ZRYA 5FJJA 3N2BA 4RDVA 5T91A 2QZRA 4AZ6A 4H8VA 2GGEA 3AHXA 5D38A 5A8PA 1PYFA 1EQPA 4JAWA 4UFHA 1G4EA 5BRQA 2GJNA 4Q22A 1X38A 1IZJA 1XJBA 4IMGA 5G4HC 3LD5A 1IR2A 3TX9A 4F9DA 1E9ZB 3GTNA 4DBDA 1VZWA 2QVNA 4XV0A 1BF6A 1DV7A 5BWAA 3RJXA 3TAOA 4RZBA 2VD9A 5BOEA 5A6BA 4P7NA 4ACZB 2XG9A 1Z7AA 2J66A 4DVOA 4PBEA 5BCAA 1OK6A 4TX9A 3S2MA 3WD2A 2A4AA 3GH4A 3GVQA 4CEXC 2BXZA 1BEUA 1M9HA 3QKZA 3W9ZA 4AC7C 3NOEA 2ZUUA 2XZ7A 2V5CA 4QDWA 4PMXA 4IISA 4DLFA 2XYLA 4L9ZA 1PEZA 1HNYA 1Q6FA 3VZZA 3RDKA 5AYIA 3ZM8A 3CO8A 4G7EB 3MUY1 2G96A 3RO8A 4HN4A 5REQA 1ISXA 5MHBA 3AIRA 4NZCA 1JCMP 1B9BA 3UA3A 3NXLA 1QWKA 1V6UA 4C60A 4YIWA 3AI0A 1W9XA 1OM0A 2BY0A 2YKKA 1H09A 4O0ZA 3UNDA 1EH9A 4E3TA 4Z2IA 1OIFA 1HVQA 3U5UA 5DCBA 3GC5A 3SFKA 3BOXA 4HMNA 3F4VA 5KINA 4NHVA 4UQAA 3VOIA 1J5TA 1VJSA 2E5BA 3D0CA 2A3BA 1K9FA 2ATSA 3L0GA 5LNVA 3BG9A 2VX5A 1UR9A 4KFOA 4DI9A 1XBZA 4TTUA 4M1RA 2A6NA 3TN5A 2IPWA 2PDBA 4WSJA 3BLEA 5DMLA 1B3YA 1MQRA 2X0SA 3FJLA 3EWCA 4CCEA 3LHWA 3AMLA 2H8XA 1H49A 4J4KA 3TFCA 1XIHA 5LNRA 3AYVA 1DVJA 3CZEA 4UBPC 5DRIA 1WKDA 4MJ4A 3P74A 4BZYA 1GW1A 3IVUA 3C61A 1NP2A 5AHIA 1EDQA 1EZ2A 4E4FA 3HPFA 1W8SA 3SCOA 4RCXA 1BWVA 3MI3A 4ZO7A 3TQVA 4PODA 2EG7A 5D2YA 3YPIA 1SJAA 3RYSA 1FHVA 3L4YA 4DO7A 1ZCOA 4KT2A 1GNXA 4HU3A 4ZBCA 2QDEA 3PTKA 4LANA 4P8XA 1MI3A 3BH4A 1MXSA 3CUGA 2A5HA 2GJXB 2D2JA 5JMUA 1ZL1A 2DT2A 4M1BA 1G67A 3NG3A 3P3BA 3POHA 3EX1A 3RR4A 4NJJA 3FX4A 1RA0A 3ALFA 9RUBA 3A24A 4M8UA 3TTQA 4AH7A 5CAKA 1BVZA 3N73A 3V35A 2WVSA 3DI1A 4EK7A 4HA3A 1G01A 4ICCX 1M68A 3KFTA 2DZBA 4E2VA 1GWJA 1F6KA 2WKLA 4M6PA 4U5KA 1LWJA 5CSRA 2VX7A 1VFUA 3L68A 3PFRA 1S1PA 1A5SA 3AMGA 4A22A 4O13A 5LA2A 1SGJA 4ZQPA 2X41A 1FWNA 2PLMA 3WLKX 1IXQA 4L80A 1FHUA 1A5OC 5HAOA 2PDUA 4HSOA 2YBUA 3L4ZA 1NFGA 4GIEA 5DANA 2WJZA 3AQUA 1CLVA 2R94A 3WQ5A 1MXDA 1Z42A 4ONVA 1MRAA 4Q8UA 1O5RA 3PG8A 4AZHA 3W2LA 5E9XA 1PE1A 3AWNA 1W5QA 1GKRA 1CENA 1XFBA 3NPXA 1US2A 3VIJA 4BF5A 3B97A 4IIBA 1PCKA 3BMVA 3GG1A 4QQ3A 1VBJA 1KFLA 4K36A 4AMCA 3V7PA 2J47A 2ZC1A 1QR7A 1I2RA 1LQAA 1UKSA 1H5YA 2PPGA 4XAFA 2Z25A 5AHLA 2CETA 2BMBA 4IXXA 2X42A 5D8ZA 2JF6A 3NGFA 1IIHA 4ACZA 2QUNA 5D02A 2CLMA 2R82A 4JNMA 5ECUA 2I14A 5K3VA 1TX0A 4RW3A 4B5VA 4JX5A 4PUNA 3UR5A 2OOFA 4L5ZA 1JUEA 3HM7A 4OKDA 2OZ0A 4TVDA 4FB7A 3IVTA 3N14A 3VGBA 1CZ1A 3B8TA 1KWKA 3GU2A 4CNPA 3EXRA 4WEVX 3G1XA 1NWRA 4YTRA 1V0KA 3RMJA 3ZT5A 4G7EA 1WZAA 2CERA 4Q4KA 4PCSA 4DM1A 2CW6A 4U3AA 4WY0B 1VYSX 3NDYA 3QMRA 2WJEA 3G1SA 4KMQA 3MKKA 5I6SA 5FCZA 1PDZA 4PB4A 2LLEA 4GX9A 4H1ZA 3L4XA 2VT0A 5AC5A 3M0IA 3KCLA 2GWNA 3EYPA 4L56A 4PMQA 4JFUA 2HWGA 5C54A 2A1YA 3HO8A 1TG7A 3ZVHB 3MB9A 4PSPA 4AZBA 3BG5A 3T4CA 4K1WA 4W9TA 4Z1YA 3QR1A 4WY0F 2WHKA 2WSPA 1EGMA 4HD5A 2EG6A 2R1KA 4E3VA 3NQFA 4WDTA 1EIBA 5LGZA 5CQ1A 1QNRA 1YEYA 1XDMA 2VDGA 4UR7A 4F3HA 1K4GA 3QSTA 2J88A 3OHMB 4GWEA 1WKYA 5M03A 1J96A 4D72A 4HNUA 1OC6A 3OODA 4GCXA 2GVLA 3SSZA 3CK5A 2W91A 2P3EA 2ON3A 4C6JA 4OECA 4ZQNA 5A8GA 4AWTA 2DDXA 4ZQMA 4UFJA 2WNWA 2YXXA 2QIWA 3VIGA 5K9CA 3ABOA 3AS3A 2E09A 3T2PA 2DVXA 1QNVA 2QULA 1GJUA 3VDAA 4E2OA 2Z7GA 3IIZA 3G8RA 4I5RA 2GJXA 1QPNA 1XM3A 4AVNA 3ABRA 4MWAC 2HQAA 2Y4SA 1H7XA 1H3GA 2A85A 3SGGA 2ZKMX 2YA1A 1GZGA 2HE8A 2HE5A 4C65A 3L65A 2JEPA 1VHCA 3S1WA 1TELA 5AHEA 4RV8A 4LNYA 1R3YA 2JFEX 3QLLA 3FEMA 2ZICA 8XIMA 3NZ1A 1FWIC 3FDGA 3B0XA 2VELA 3WJSA 4RJEA 1ICSA 3IJ7A 3CZGA 1YPXA 4ES4A 1F73A 3UPWA 1KO0A 1GCYA 3GXTA 2E7FA 3DEQA 2ZRXA 1W2PA 4FXSA 1LTDA 1V3MA 4GQQA 4DBEA 1JRCA 4HNLA 4BF9A 3SGUA 3LA4A 3R1ZA 4C6LA 5ECVA 4G7FA 1IEXA 4YCOA 1KBJA 2WYSA 4P7QA 5I09A 3ITGA 4JTSA 3R8RA 3SRFA 4PB5A 2BS9A 1BG4A 2F7FA 3OU8A 4JX4A 3BLDA 2HROA 2Y7GA 3OO2A 4O1BA 5CC5A 1V02A 1QWGA 5AYZA 4I90A 1UOKA 4FXRA 5LZLA 2EPLX 4OUEA 1E6SM 4RL3A 3IJQA 2YX0A 2JE8A 1KNWA 5FJIA 4Q4PA 3TZFA 6REQB 3QLDA 4CVUA 2E5CA 1SR0A 2FIQA 1JQXA 1LF1A 4HSNA 3IRDA 3PWIA 3F7JA 5L9FA 4M29A 3IUHA 4YTSA 3OVQA 3C4UA 4ZXOA 2ISWA 1EF3A 4B15A 1RK5A 2E1WA 1XLCA 1LCOA 2OTDA 2VRKA 1RA5A 2O9RA 2BGQA 4HU8A 1JYVA 1V3JA 3VGFA 2W3ZA 4X63A 4HNCA 1GOIA 1YNQA 3O2LA 1XIJA 1TA3B 1HQTA 1IF2A 1EO5A 4KGJA 2OCZA 3EXSA 1I0BA 3NPUA 3U0HA 4JHOA 5E9AA 4Y8FA 3UW6A 5CKSA 2EG8A 4QG9A 3P7YA 1BG9A 4QR6A 1YE4A 2JKEA 4QSHA 1EJXC 1NWUA 1PBGA 1JVNA 5PTDA 3CIWA 1VGAA 2OFJA 4Y9MA 3VKDA 1VR6A 3WNMA 3BSHA 2CXEA 1QPOA 4IQLA 1ME7A 5D37A 4NXKA 1L6FA 4ZO8A 2FTWA 4UXDA 4MYXA 3SI9A 3W02A 1TO3A 2OX4A 1X1NA 2NWRA 4IG2B 2VC9A 1UOZA 4NU7A 1F61A 1LBMA 3FAWA 1FBAA 3DENA 4GJIA 4MNLA 1XLFA 4XO7A 1HL8A 3ZVHA 4UFMA 2CBJA 2PP0A 1YQ2A 1YPFA 3VCNA 2Z26A 1M7JA 3CIVA 1ISZA 2QPXA 1QOXA 1TVLA 1AMYA 3VYLA 5EBAA 4J3UA 4IX2A 3ITOA 1QHOA 5BU9A 2WMIA 2ZWYA 5IDZA 1O66A 1TFVA 1PL9A 1VRXA 1EBGA 2TRSA 4IWWA 1TJRA 4O4WA 5C9ZA 3LXBA 5JBDA 1EPXA 4LUTB 2G3NA 1V3IA 3L12A 4BJHA 4CKQA 1H5VA 3DESA 2WNQA 4LCSA 5I23A 1X6LA 3RGTA 4RE2A 5JBEA 5I3KA 1JPMA 1R9XA 1GTHA 2NQLA 4W5ZA 5CSUA 3THUA 4QLJA 3UWQA 4XBJA 3CZJA 4NZ3A 4O14A 2OKOA 1JXKA 2P10A 3TDFA 4QQUA 3PUOA 4KRUA 3T0BA 4NQ1A 1R3TA 4M0XA 3CV1A 2VFFA 3DHUA 3VKBA 1E70M 4YJ5A 3N15A 3ISIX 1LRNA 1R2TA 4XZMX 3W1LA 3AXMA 3UWUA 4P7OA 2YL6A 3ORWA 4XBSA 4HYRA 4E8GA 1B31A 3WQFA 2NLIA 4A2SA 2W0UA 5H8MA 5G1MA 1TREA 2OEMA 4QGCA 1NARA 1T8QA 1H1NA 1LOSA 1BHGA 2J7DA 1FTXA 4ZTXA 2XTKA 3ZOAA 2E8ZA 9XIMA 5DX7A 1H50A 3SW6A 4B3KA 1XV8A 3ITYA 3N4EA 4ASTA 4EIVA 4GD0A 5EMYA 4EF8A 1YADA 3T55A 2PC4A 3PPGA 1CECA 1YW1A 4CU7A 3SCTA 4LS2A 5LIWX 1KGXA 1JDAA 1GOXA 5G5IA 3E0LA 1X6NA 1UZDA 1Z41A 2OQHA 2C0HA 1BPLB 1U5VA 3PAOA 2XN1A 3U9IA 3BSMA 3LDVA 5IRPA 1W1IE 2BVTA 1E6ZA 1GVSA 3OVGA 3OIXA 1R8LA 1M6JA 3VOJA 1CGUA 4PSRA 3P0XA 4LVGA 1AFSA 1GPFA 4N9CA 2Q6ZA 2REQB 3GKFA 4XZIA 4HJFA 2HS8A 1BQGA 2I1OA 5G4EA 3TH6A 3VD4A 4JHZA 1J5SA 2AQOA 5EY5A 3CYVA 1IXPA 1XIMA 4XQ6A 5KSWA 4QTGA 3LB0A 2ZBTA 1KM1A 2A21A 4JL1A 2PDFA 5D4YA 2PURA 2Z6IA 3SCSA 3EDDA 3VCRA 4PBGA 1K4HA 3PC0A 3L4UA 2NSXA 3TN3A 3IJ8A 4IZGA 3GKAA 3QRHA 1K8XA 1XIBA 1YE6A 1KV5A 3M1ZA 2R24A 2Z4GA 1XQLA 3MYPA 3BG3A 1S3TC 1ZAJA 1XUUA 2WB5A 1SSDA 1TA3A 3LNMA 3K8MA 3FA4A 4K38A 5E6ZA 5FOOA 1P48A 4LC6A 3SCQA 2Y7DA 4GYFA 4F0KA 1LL4A 3UYIA 2E9BA 4AD0A 1ME8A 3WH9A 4PZVA 4HIBA 3WKZA 3MMWA 3CMGA 4PUUA 5CZ0A 5HJYA 4JYFA 1ICQA 2BSLA 4HT3A 3VC6A 2ZZ6A 3W29A 4OFCA 2TODA 2X7VA 4FS9A 1H51A 1GYMA 4ZFMA 4IG2A 2V5LA 2QUTA 2A79A 3W7OA 1XX1A 2WVTA 3TC7A 1SFLA 3U4AA 1DORA 4E0CA 1P7TB 2UY2A 4R3UA 1BD0A 4TX8A 3GNXA 4NP7A 1MUWA 1UYQA 2WHLA 2XH4A 3W28A 1VD6A 1PKLA 1VEMA 1OABA 1ZJAA 3GU9A 4KIEA 1EJSC 4GQRA 3WQGA 4LUTA 4S3EA 3VOHA 1UASA 3TLLA 3KX6A 3UP8A 4J3WA 1MW1A 4L6OA 2V67A 1A80A 5D09A 2YL8A 1WE5A 3KBVA 4IXHA 4QISA 3RG6A 2C1HA 6TAAA 2B7PA 3O9NA 4JDYA 1N8FA 4WQ6A 3PPFA 3GAKA 3PY2A 4NX5A 4WDXA 5HPOA 4CNNA 3MCMA 3TSBA 3VD9A 4WJXA 1HIZA 3ATYA 2RH9A 4UTMA 1OF8A 4ZQOA 1JCNA 3IAPA 3F5KA 5BMWA 1SW0A 1YBQB 3MMDA 1Q66A 4NYUA 2ADAA 4BQ5A 4BHYA 4CUCA 2QJHA 3H2CA 3LM3A 1PXGA 4LBSA 4ZB0A 1XLJA 3T0DA 1UMYA 5HJXA 1O68A 4PUMA 3MSGA 1KQYA 3KHJA 4A21A 3UR7A 4F0MA 1RQHA 1KC7A 2CLFA 5DFAA 3G6MA 3WMBA 4P8VA 2GOUA 1AD1A 1UH3A 4GZJA 1XFCA 3L2IA 1SMDA 4X2PA 3QVQA 1OGGA 1POJA 3B8IA 4UQ9A 1RLDA 1TMQA 5TBOA 3UXDA 1P0EA 5DLCA 1XPGA 4A3UA 1XDLA 3L23A 2YDRA 1JPKA 4XZBA 1LWIA 1K77A 4YLWA 1GQLA 3URNA 2REQA 2B7OA 4N6FA 4W5UA 4PBFA 3CWNA 3LOTA 2J24A 4O50A 4MMWA 1DJYA 3VIOA 3VDHA 5HINA 2E6DA 3SUWA 1SQ7A 2DORA 3QKEA 3R43A 3RIKA 3VX0A 6PTDA 4MZ8A 1YTDA 1QW7A 1XG4A 3MV11 3MV01 3AAMA 3LI0A 3UGRA 5AB3A 1ALDA 4LCQA 1H7NA 1XYMA 1OYBA 4J7RA 4LVBA 1VBGA 1VLIA 5J8LA 1AK5A 1NOFA 4LY4A 4QE4A 3B04A 2JBMA 3KWSA 3DN5A 1TPWA 1DJIA 2XN0A 2PMQA 3GAYA 1MW0A 3UERA 1CLXA 4L4PA 2Z1KA 4GI4A 1DQWA 1GOWA 2IQ0A 3N04A 4PMUA 1PHWA 3XISA 1J18A 4GH1A 4CD7A 3QQWA 4EF9A 3ARWA 2BV9A 1CNVA 2V5JA 3TC3A 3TC6A 2OELA 2WSKA 1I60A 4F66A 3W7EA 3BLLA 5K7JA 5FF4A 2BG5A 2GQ3A 3ARPA 3KBNA 3BCJA 1BVNP 4FO4A 4FNSA 4AB4A 2HJPA 1Q8AA 3PUGA 3E74A 1VPXA 1H63A 1IE7C 2PDIA 2PC8A 1XCXA 4IPNB 5HPCA 3CAKA 5BOOA 4GINA 2PI6A 4JTRA 1JDCA 2GK1B 3ZZ1A 4TTGA 4V28A 1ZAHA 5HQLA 2OG9A 1H1YA 3CT2A 1Z69A 2FPTA 1P7TA 4GZ7A 2FB2A 4DX3A 1VEOA 4AYGA 1Q6RA 2VM8A 4AX6A 3PUEA 4TV5A 3WNKA 1I8JA 2C14A 4CVWA 1DJQA 1IZKA 2B81A 3JR2A 3PULA 2JIWA 3OVRA 3WQ4A 2IUZA 3WF4A 1EJVC 1RPXA 1MUMA 4Q4RA 5CBIA 3W00A 3W3OA 5C9UA 1GVIA 2GDVA 2QCHA 3HQPA 4XZWA 2WQDA 5EL1A 1OD8A 3FJNA 4NI8A 3OBEA 3GH5A 3TIMA 4GYKA 1XD0A 1YMYA 1MEIA 4HMDA 4I7UA 4W93A 3F4DA 2EBNA 1WUEA 3UG5A 4PYSA 5KMYA 2CLPA 3WL1A 4FLSA 1PTDA 1KV8A 1JAEA 1IGWA 4FEZA 2TSYA 4MG4A 2AQVA 3T2OA 3M07A 3SECA 4PUEA 4ILSA 3PM6A 2WZEA 5IFTA 5CPOA 1A5AA 5T9BG 1XISA 2ZXDA 4JKLA 4XD3A 4WSHA 4JN8A 3P8IA 4AIUA 3GWQA 2J9XA 3GR7A 2QS8A 2ATMA 2OWCA 4UTLA 4IIGA 3C52A 1NQKA 2XPKA 5CPSA 4BR1A 4C6BA 2KAUC 4BI7A 3KZSA 4PEEA 2YZRA 2HS6A 4IGSA 5HMEA 4Z08A 4W84A 3QYQA 4XZ9A 3RF9A 3ZWSA 1TWSA 3TOPA 1U5HA 1W1YA 4QNWA 3TU9A 2PDHA 4RV3A 2Y5JA 4Z2JA 3M5VA 3R8GA 3QTPA 1K8CA 4WDUA 2O56A 3FSTA 1EJTC 5MKGB 2QUUA 2FZ9A 1SZEA 3B9NA 3NVDA 3AU6A 4JIRA 5DMMA 3CV6A 2X0YA 4C6KA 2WQPA 1ITUA 4LPCA 3O8AA 2WNNA 2VFHA 3W1TA 4DXKA 2HNEA 3T40A 2ABBA 3W4RA 4FLOA 2ODOA 3VX1A 4WRHA 2F2HA 4BQ3A 2FDSA 3GNPA 2DUAA 3UZJA 2NXIA 4H6RA 2Q09A 3UA4A 3KL3A 3VZYA 4HMEA 2EEXA 2CESA 4AEFA 2QPUA 3JVAA 5HNUA 5AC4A 1R47A 1YHTA 1VYPX 3W7HA 3A13A 1ZB5A 1TIWA 1JZ5A 4LC8A 3KS5A 2VWTA 1U22A 1H41A 3SCUA 4AHPA 1NY1A 1AH4A 4N7QA 4E8DA 4Q32A 3OVPA 1C7TA 5AN7A 3HG2A 2Z2AA 3SQMA 1GPWA 4J3VA 3WD4A 4L1WA 1RCQA 1X96A 3ARUA 1K9TA 2F6XA 2PRLA 1I1WA 1ML1A 2D24A 3AXIA 4ADSA 3IK2A 1TPB1 1H7OA 1QOPA 3W6MA 3N1AA 5BNKA 2Y8UA 4HHMA 5HBFA 1A3WA 1H7RA 2CZEA 5A6AA 5ABFB 2FTYA 5JUVA 1LL6A 5D2WA 2G37A 5A2CA 1ZFJA 1UD8A 2GK1A 4OQVA 2Y24A 4HBKA 3W6LA 2A7PA 1TB3A 1P0KA 4KH2A 1MNZA 4LOCA 3F5LA 5XIMA 3P5ZA 4M19A 1TYGA 3DECA 3GXNA 1YIXA 3LBOA 1RLCL 4PRRA 1US0A 5EMLA 1AZ2A 3AS0A 4QSFA 3UG4A 2VFGA 3FYOA 3QGVA 1JFXA 1IIGA 3NURA 4OOUA 3LGEA 1YDVA 3BAKA 4MWAB 1W5MA 5E5CA 2PWDA 4OE7A 3KW3A 4I7WA 2QVHA 2E4TA 4OBTA 3UWVA 1G6CA 1JAKA 4HB7A 4KIRA 4I5XA 1H60A 3G1YA 1RQBA 4GUIA 3FA3A 3A5FA 5AC6A 2VEPA 3GC4A 1EJRC 3SGZA 5E93A 3QPZA 4JKMA 1F3EA 3IANA 4R7OA 4BI6A 1XCWA 5IDIA 3VIMA 1JYXA 3W70A 4A3HA 3S9YA 1XLEA 3MTWA 4LV4A 4LS0A 4J40A 4AVFA 2A3EA 1H61A 4NJHA 2PU0A 3W22A 3AYRA 4LV9A 4YTQA 3TJXA 3TROA 4C6EA 4IIDA 3WNPA 4BS0A 2DV0A 1UUQA 2YFOA 5FAJA 4Q8PA 3BZJA 1CI1A 3GDLA 3LX9A 3LPOA 5LNSA 2VD8A 3ARYA 1GHSA 2QJIA 2VRJA 3LMYA 4R33A 5I3GA 4MUZA 1DQXA 4X9SA 3DYMA 3SBFA 1UR2A 1CB7B 4US5D 4DWSD 4GYJA 2TAAA 3NQBA 2W9MA 4UZUA 5A3HA 1OQFA 4NYYA 2NV1A 2HBXA 4AZGA 1DJNA 1FX6A 2AGKA 4JIQA 4IMEA 3QFEA 1EUAA 2POZA 2G8ZA 3OA5A 3G1AA 4HYWA 1G4SA 1GJPA 3LNPA 1PX3A 1LLWA 3EGJA 3T42A 1J9YA 1O5XA 3LUTA 3I6TA 3VXGA 3C6CA 3KRSA 3M0VA 2VX6A 1SFSA 3P67A 5AVNA 3FFSA 1TTIA 4AD4A 1DJXA 1YYAA 4FLRA 1PDYA 5MKGA 3H4XA 1UWRA 3TZNA 3IGHX 2CNCA 2W4XA 4H9ZA 1W6TA 3WBEA 1K6WA 1JYWA 4E6MA 5TAOA 3IGXA 1PTAA 2DZWA 5G1YA 5LYRA 4PMRA 2F61A 4FXFA 3CQHA 1I2QA 1XF0A 2DZXA 3NPWA 4JZ5A 3NEVA 4KCTA 4C6NA 4A05A 3F4WA 2CKSA 1XLAA 4NKCA 3WDHA 3CJPA 3I3DA 4CEUC 1ZBVA 4O10A 1V6YA 2BY2A 4Y6GA 4K6AA 4IIEA 1DWGM 4TU1A 3CQKA 5G4WA 3DGBA 5EB8A 4GABA 4GIAA 1UR3M 3EWWA 1TE1A 1X6UA 5IM51 2GSEA 3W83A 1MO0A 4Y90A 5DT5A 1E72M 1Q6QA 1UD6A 3KLLA 4MM1A 4C6PA 2PDLA 1Q6LA 4Q8OA 3CUIA 2I5GA 1ELSA 4A8IA 2YCLB 3STEA 1U83A 5HJLA 1BKSA 3H2EA 2PB1A 4L64A 1EO7A 1MQQA 3M4HA 1ICPA 3W1UA 4GQGA 4FA3A 1PB0A 5I3IA 1WZLA 1J4EA 1J8VA 4DRSA 3UU0A 1Z6KA 4GOAA 4AQLA 3AICA 3H26A 5ABFA 2TYSA 2OZ8A 4L6HA 1RJPA 3W1NA 4UTWC 1VBUA 1PO9A 3MSDA 4GA8A 5I0DA 2FDMA 4YTTA 2OO6A 2D0FA 1R30A 4LBUA 5E0CA 4DJFC 4JFTA 1Z9AA 4RKAA 1Q6CA 1RHCA 3ANVA 3GHSA 4Q4OA 4W4QA 3EB2A 2QIIA 3CUHA 3W1QA 1CW2A 4HP5A 4HTBA 4BKNA 4JYDA 3KZPA 2DEPA 4D71A 3N34A 1V0LA 4DZIA 1R3VA 4KCWA 5CH9A 2C71A 3PJWA 3BJFA 4E38A 3GHTA 4MWAA 3LBCA 2OMAA 1J2BA 4KWVA 1RP8A 1OCNA 1QXLA 3QY8A 3L67A 3W7KA 1IWBA 2BHYA 3KBWA 4QCEA 3B9EA 2J8TA 2NQ5A 3UT0A 3PZVA 3I3EA 2JF7A 1DOSA 3CT7A 1GEQA 2I57A 3KCJA 2XSAA 1T96A 4N02A 3E0VA 2BFGA 1WX0A 3P0WA 3UZXA 4S3CA 1B3OA 4ML4A 2XFYA 1M03A 2VR5A 1SJBA 2E9MA 3TQKA 2XFRA 1VBRA 4LVDA 4PTVA 5DY2A 2EXOA 3AXKA 4EPKA 1EQCA 4UMCA 4CNSA 3HFTA 1TPFA 3SRKA 4PB3A 1FWTA 3FAXA 5F2MA 5F1UA 3EDEA 4JN7A 3SCPA 2X2GA 1JF6A 1V4YA 4PMOA 3R10A 3L0KA 1A0DA 1XBVA 3RM4A 2YW3A 3AISA 3EXTA 1FWGC 3UJFA 5CC3A 1ISWA 1D8CA 2R9RA 2ZFAA 4MOZA 3WX7A 2P88A 1KGUA 3QY7A 2GGIA 3ZJ7A 5EBUA 4UNIA 3TNOA 3IIVA 4ZE4A 1IWPA 1XLBA 4PTWA 4PL1A 4V27A 3G0UA 1POKA 1FH9A 2IKHA 1IT7A 2PS2A 3T7VA 5DCEA 3UVAA 2AKMA 3MVTA 1WKFA 5E70A 5HK4A 4S3DA 3BMWA 1E6NA 3H7UA 5BU6A 2HVOA 2GLKA 4ROPA 3WFLA 2WVVB 5AY7A 2O55A 1VFMA 4DWSB 1THFD 4ICNA 4JIPA 5JU6A 1GYLA 3TSDA 3F2CA 2NUYA 3NOYA 4AZIA 3TA9A 2PD9A 3ARTA 1RJQA 1XBXA 3NQDA 4YPJA 5FF7A 3LCXA 4Z2HA 3KEHA 3ZIZA 7CGTA 1PS9A 3E0WA 3NNTA 3EOOA 3OPSA 4FNUA 4N9EA 1OFRA 3CH0A 1KA9F 4DJDD 3O06A 2E0PA 3FNDA 3OBAA 2Y85A 1UC5A 1TPH1 4NXSA 2ZX7A 2BP1A 2BY1A 1E56A 1O7AA 4PCFA 1MRQA 3FGCB 2B4GA 4DYJA 1LG2A 4KRTA 1QI5A 3FKKA 4Q8QA 3WH7A 3CASA 1UH2A 1E9LA 4DBSA 1D2KA 1F7BA 3VD7A 3MUXA 1EA0A 1Q65A 4PR4A 4ROQA 2XUCA 1XS2A 5CGMA 1QATA 3VA8A 2YCLA 3GG0A 3MSYA 3STGA 5I00A 3F2BA 1AQ0A 4JTEA 3R94A 4FR6A 1BSIA 4CQCA 3VDBA 3BOFA 1L8PA 4GLEA 4D6FA 3MYOA 3KVLA 5FAGA 1TQXA 1HFBA 3DHPA 4F79A 1WDDA 3W75A 3BK0A 4G1KA 1KRMA 1LYXA 2NXGA 2V3GA 9CGTA 3W37A 3FSUA 4NF7A 3QC3A 4XD5A 1JCYA 1JL8A 1QT1A 1S46A 4IGHA 5D9PA 5KETA 3RO6A 5I2UA 3TFXA 4ZSUA 3ZR6A 4IX0A 4H8UA 4C6MA 3AZRA 4MJZA 1EDTA 3EMCA 5FF0A 3LTSA 5A95A 3H54A 5LXXA 1K3UA 5TQLA 1A0CA 1B4KA 4AZCB 3Q58A 4QJ4B 3CPRA 3TYEA 4M80A 1XGEA 3EMQA 4DO5A 4N9BA 5CLTA 3C2VA 4TO8A 3M6YA 4I6KA 1MDRA 4AD5A 2C8NA 4PCPA 3P93A 2E40A 4B5XA 4O15A 5AHMA 2E9LA 2NUWA 5M2FX 3AZSA 1CCWB 1C9DA 1R9ZA 1RALA 4IHCA 1DJZA 4FR1A 3UXIA 1IXOA 1W9VA 4R7WA 1D7KA 4M7TA 3FW6A 5K2ZA 3FK4A 1A5NC 5FD0A 3MU7A 2OKTA 4TIMA 5G2IA 3DFHA 1TE6A 1U2YA 3CUXA 4JGDA 1A3XA 2H90A 1P0NA 4GISA 1HF6A 3LYEA 1W0MA 3M16A 1B2YA 4ATDA 5LHFA 2YCJA 2H3DA 2INEA 4M82A 2W63A 4UTIA 3PTMA 5KZMA 3RXZA 3LXCA 1V7YA 3W53A 3QBUA 3OLDA 1YPIA 3KRZA 2I5QA 1V0MA 1IWAA 1J0KA 1X7IA 3QPEA 4PC8A 1D8WA 3ZR5A 2QHAA 3EWYA 5FACA 4GBDA 4Y7EA 4C91A 1XYAA 3SN0A 3MZNA 3CAVA 3BLKA 1JUKA 3LCIA 1CB2A 3JZEA 3STFA 3VILA 1RY0A 2WJDA 1Q8JA 1Z3NA 1W91A 4LYPA 3SEPA 3K1DA 1F07A 3VGHA 2J7HA 1XR2A 2Y1HA 2WVVA 2A3HA 4DWSA 2I9UA 5DEZA 2Q3OA 2Z6JA 2CHNA 2NV2A 3MO7A 3N9SA 4P61A 4GNKB 3WLSA 3PTDA 4Q4QA 5D2XA 3SQLA 2J4GA 3MMTA 2VCAA 5I78A 1VJZA 1UC4A 2PTYA 2R1PA 3LCFA 3DGRA 3LCGA 3ZSSA 2PF8A 3PG9A 3EOEA 4A8RA 1JDEA 3RUBL 5HDRA 1QI4A 3WDJA 1QAPA 4EWND 3WLPA 2I56A 1PX8A 4DY1A 2ZX5A 2CPUA 1MW2A 4ZVJA 3FGCA 2CIPA 3OZOA 3OEXA 4R53A 3DFYA 3K5XA 1U1JA 1S5WA 1UUMA 2A7NA 3AUOA 1PX4A 3WLHA 5CZSA 2FB3A 2PGWA 4K8EA 4ZB5A 3UWYA 2QYGA 4EAMA 1W37A 3SQSA 4B9ZA 1TMLA 1E6PA 1LG1A 3E38A 1UR8A 4QP0A 4ZFCA 3GVRA 3S1GA 1KXVA 4GH3A 1TPEA 1ZCCA 4RDWA 3N6JA 4C6OA 4MY8A 3G24A 5FKYA 4MLRA 1TUXA 1TPDA 4L4OA 5MF5A 3ZLFA 1Q63A 4D1IA 4EKJA 1R2SA 1EHAA 3VOCA 4DWDA 2IQDA 1E6XM 4ZEPA 1KXQA 4GGBA 4ZQRA 6TIMA 3SURA 1EP3A 5HMFA 1E6QM 4R34A 2J6XA 2FMNA 4W7WA 3VVGA 4XISA 4Q4MA 4F0SA 2FZ8A 1NFPA 4DJED 4O1DA 2VNCA 3VNMA 3OOQA 2WXDM 4PRWA 5AFDA 2DQXA 3RNDA 4DZAA 3PJUA 1D9EA 2VVNA 1VKFA 7A3HA 4GJJA 3GG8A 4Z0JA 2VGIA 4AY7A 5AYBA 2GOKA 1MDLA 4WUIA 1TV5A 3WQPA 4FI4A 1Y5XA 4XIAA 1J0IA 5A8QA 2C1GA 4LT9A 2TPSA 3DYPA 3AIBA 4W8BA 1QRQA 1AL7A 3R2GA 2ZOXA 3WLNA 2VXNA 3LRKA 1ESWA 1P0DA 3HPZA 1HJQA 4JTCA 3UD6A 3PB2A 2JGYA 2VX4A 4A8LA 4MB3A 1F3WA 4AX7A 1T99A 1OCQA 2CBIA 2A0NA 2PLCA 1VFFA 3I7SA 3VIPA 1FCQA 1A53A 4QCFA 3UY7A 5JIPA 1W3JA 1LUCB 4IPPA 4J3SA 4Q6XA 4UQDA 4ZCWA 3VDGA 2P8BA 4O1EA 4AXNA 1W5NA 2NWSA 1R3RA 3GM8A 1FWEC 4UUIA 1K03A 1LWHA 1OT2A 4UOJA 3WBXA 3Q37A 3WMSA 3PBGA 8CGTA 4JD4A 1I45A 3VPLA 4D9PA 3E9AA 4MAZA 2W67A 3S5NA 4M24A 3M0ZA 3CZKA 1MW3A 2RAGA 2PTDA 3H70A 3AXXA 4HU0A 3O6DA 4JCMA 3TN6A 2NQJA 4IMAA 3URQA 2GFTA 3THQA 5ENLA 4KERA 3S1XA 2XVPA 1W32A 4YN5A 1OF6A 3AUJA 4AFYA 3ZJ6A 1W1TA 3P81A 1NIUA 2QKFA 2YA0A 4OBRA 2D0HA 3BTNA 2GUUA 1PPIA 4ZL1A 2PCQA 3G1VA 2DQWA 2GVJA 4HNNA 3B8SA 2IXVA 2WMGA 4IM4A 3A4JA 4ZOBA 1LORA 3MHGA 3THAA 3NM1A 4GY0A 1KKOA 1XLLA 2AKZA 4Y9NA 2OEJA 2R8WA 1UP2A 1Y5VA 1TJ2A 4NSBA 3TQ0A 1XRVA 2PD5A 1WPCA 1HKIA 1KM4A 2VO5A 3V18A 4KPLA 4AY1A 1QPRA 4O1AA 2YYTA 1DKWA 1VEPA 4P7LA 3SM0A 2DH3A 1JZ3A 3E2QA 3R8HA 4NX0A 2GPTA 2JIEA 1X1ZA 3DG7A 5CPNA 3I10A 4KS0A 8TIMA 2JQXA 3PZOA 3K13A 3PPCA 4RPPA 3PUDA 4DJDA 2BOEX 1EYWA 2ZVRA 3ITVA 1V08A 2DZVA 3ITXA 4A29A 3R13A 1MNSA 1LDCA 3KBMA 3NXFA 1EGZA 1LOQA 2FVLA 1MFVA 4LS1A 1HW6A 4URIA 2J9ZA 1E40A 3KVKA 5FEPA 4FAMA 4P2VA 3QW3A 3HTWA 2FHFA 1XDJA 2GGJA 3UFYA 3V36A 1GVQA 3KTXA 4ZODA 3ALGA 2D0GA 3BW3A 2CCRA 2ANUA 3U5YA 3Q94A 2MUCA 4JEQA 3KE0A 2NVDA 3UXAA 4O8RA 4NIRA 1XHGA 3FHQA 5H1WA 4MF4A 4JEJA 4HHLA 7XIMA 4MWAE 1KCXA 2V0TA 1PZ2A 4RZ4A 4PMJA 3TE9A 1HJWA 3RRAA 4UIOA 3O6AA 1GW9A 1XYCA 1VFSA 4KEUA 3QGAC 1XBYA 3L5AA 2G50A 4WIWA 4ICMA 3V75A 1AJ2A 1GT8A 1XI3A 2PTZA 3W87A 3NO5A 3KDNA 4TOQA 4TVCA 2QQ6A 3D46A 4RX0A 2J7CA 1ITQA 1RUSA 2V3DA 5A6JA 3DX5A 4MB5A 1A47A 3WJXA 5FIPA 2VJXA 4QFUA 3A21A 1NWSA 4J3TA 1TKKA 4H8HA 4XD4A 1VENA 5A8MA 4GXMA 4ACYA 1EF2A 4X0NA 3EDFA 1OFBA 1VBHA 1JPDX 4EE9A 4TV6A 2CC0A 5D9NA 5CPQA 3LMZA 3RAOA 4JIIX 5REQB 4DLMA 4IGMA 4O1CA 5DQPA 3VFCA 4O17A 2YDQA 4LYKA 3MJMA 1JDDA 1EIXA 3XINA 3APGA 1KFKA 1OG6A 3G8EA 2AGTA 4XX6A 5LKYA 4DUWA 4RW5A 4Y9OA 4AIEA 2PWFA 3WN6A 4HA1A 3F03K 1XSKA 4V2XA 2B7NA 4BY3A 1LUCA 2PDNA 1KLZA 1O5QA 3MW7A 1AG1O 1CXKA 1XLIA 3LV6A 3M64A 2Q8LA 4AAJA 2D2GA 4F2BA 1XIDA 2OVLA 3B06A 1R38A 4UTFA 2Z00A 4FOJA 2W66A 1FHDA 2EO7A 1R5YA 4ZENA 3ARXA 2QJGA 1KB3A 2VKZG 5BROA 3NL5A 2YB1A 1UMLA 3NGJA 3GFXA 2V5DA 2BVDA 1AZ1A 1DBTA 4DYKA 2XH7A 2VWSA 2HVNA 1GVYA 1BAGA 1DIOA 1OHLA 3ZYZA 6CGTA 3N6HA 1M04A 3FJ6A 1W9UA 3MWAA 2VC6A 4K3ZA 1L2QA 3DI0A 1EBHA 1K7XA 1XRFA 4MAVA 3WG6A 1Q6DA 3GW0A 3SCWA 1P6CA 3RN6A 3OGSA 3S0CA 4B90A 2VGBA 3NL6A 1HKKA 5A6TC 3E5BA 4I3GA 4JTDA 2OT1A 1XLGA 3BANA 1S2CA 3HF3A 4ZTYA 3W85A 3PAJA 1KFCA 3GDMA 2QCCA 4XK2A 4U4MA 3HA1A 3BCFA 1HL9A 4DELA 3I4EA 3QJAA 3LV5A 3U3HA 3RPDA 3GHRA 1ADSA 3LSCA 2J13A 3OYXA 3W23A 7REQA 3T1GA 5A6KA 1J12A 2CHOA 4FLQA 1SZRA 1ZALA 5I3FA 2QAFA 4A3QA 1IGSA 2C79A 2PDGA 5HWMA 4NZ1A 1ZU8A 3QFWA 4AZ7A 3UJ2A 4F9JA 3NA8A 4A2RA 5M3WA 1HTIA 1GKQA 3CYJA 2ISDA 2BVYA 1K02A 4QHRA 2ZYFA 1DJGA 3WEZA 4CCCA 3A4XA 4ZR8A 2ABAA 4DO6A 4M6VA 4E4UA 4DXVA 1VJIA 4S3JA 4D6DA 1KTCA 3VIFA 1NDZA 4JL2A 2JALA 5G1TA 3OG3A 2CU0A 4IMDA 4LJ3A 4GCAA 1UPPA 3TCEA 2F8QA 1RQEA 4O52A 1H11A 3UJRA 1M41A 2OWWA 3NQVA 1XYZA 2WC3A 4ERAA 3WLQA 3CMFA 3LHZA 3OIHA 3LQGA 1PIGA 3GTIA 3SJ3A 2BBFA 3TJIA 1IXNA 2XINA 4D8AA 4WVXA 1Q6OA 2ZTKA 2EAWA 4HZMA 5LHEA 2XFWA 4TVUA 1VFHA 2OB3A 2GDQA 3LCHA 4QE1A 2KX9A 3U4FA 3USBA 4GKTA 2X30A 4QS6A 4O54A 3B3DA 1TJPA 4IUOA 4U33A 3RCNA 4I9AA 2ASHA 5J5RA 4PUWA 1JQVA 1JD9A 5B7ZA 4PTMA 3SB0A 3NQCA 4M6QA 1QUMA 5C5YA 1KWGA 1EOKA 3GFYA 3QW4B 1RPKA 5IHSA 3HB9A 4I9JA 4DJEA 4K7VA 4G56A 5C9WA 3SFWA 3OQ8A 4LYQA 3BPWA 5FA5A 2WZIA 3UVIA 1J0JA 1GQJA 2WMJA 2ZADA 1RK6A 1FCUA 1RP9A 3W0KA 4C6DA 3EKGA 2Q02A 3BMXA 1HJSA 1TV8A 3D5HA 3C0LA 1XLMA 4DUOA 2BDQA 2RDTA 5I5RA 2NSOA 3QV8A 3PN8A 5A6MA 1WDPA 3W7MA 1KD0A 5EYWA 2PBOA 3QOKA 1HP5A 1A3HA 1GYNA 2JK2A 5JQ9A 1KRCC 4GYPA 1ZPTA 1QK2A 3PBWA 3FY1A 3TCSA 2CLLA 3APYA 4PN2A 4H04A 2Q8ZA 4PH6A 1QNSA 2V81A 1Q2SA 3W01A 3CHVA 5HOSA 1GGOA 1XWYA 4BFAA 1BYDA 2RDXA 3K1GA 1I2OA 2XVLA 1UZ1A 4V1XA 1EWEA 2HMCA 4CCDA 1R46A 4F40A 4PCNA 1FWRA 1C8QA 3MHFA 4OIFA 1WOAA 1W3LA 3WQDA 4BCEA 4LY8A 6XIMA 2IQTA 2VZSA 4YU1A 1BTCA 2OSYA 2CFFA 3BCDA 4XUGA 2NVAA 1DE5A 1ODUA 5I3HA 4F4RA 4JQAA 3Q65A 5T26A 4WXYA 4MLJA 3PTQA 3KCOA 5KZEA 1NEYA 3Q67A 2XJ7A 2BOGX 3ARZA 4UR9A 3W1AA 2EPNA 2P5NA 2ZDSA 2VC5A 1JCTA 3VMNA 1XP3A 2X40A 3KXQA 4JOMA 2D3NA 3EZ4A 5DXXA 1D3HA 5HULA 3C0JA 3MJYA 2UY4A 2V63A 3LENA 5GNXA 4DPPA 4UFLA 1S3HA 3RLVA 4AWSA 1T40A 3BV7A 1J0HA 3LGDA 3TSMA 3GXPA 1LBLA 3URBA 4H9MA 4QITA 3BLPX 3L2MA 3PBYA 3S2JA 3P5YA 1MXGA 2DIKA 1G5AA 4WKFA 4JTKA 3LLXA 4GBUA 4MZYA 4FX7A 4FNRA 1XPYA 3R0UA 3EA2A 3NO1A 2PLJA 3TMLA 1NDWA 1P6BA 1XCFA 3HIJA 3T2QA 4U31A 3NQMA 1NFBA 1AQFA 1MSSA 1MEWA 3TR2A 4A3RA 5EFFA 1E3XA 1MEHA 3KBJA 2ACRA 5C9RA 3ZFHA 4K2SA 3W2MA 1XRSA 1YXDA 1EJ7L 3USZA 1BYCA 5AYXA 4WK9A 1WCGA 1GOQA 1OB0A 1CLKA 2XWEA 2J7EA 7PTDA 3NO3A 4RLIA 1S38A 1GHRA 1AL8A 1W3KA 3WENA 3S2CA 1FRBA 4MNMA 3UWWA 3HV9A 1PKMA 2J27A 1E4LA 3WMCA 3EDJA 5FI8A 3G3MA 4K8GA 3RILA 4QS5A 5M5DA 3EX6A 4NJKA 2GVGA 1FOBA 3WD0A 1YRRA 1QW9A 5U7SA 1SSGA 3WK3A 3VKCA 5JIWA 3AHVA 4B4HA 4EVZA 5K4ZA 1FFQA 1I0DA 4H9UA 3A4WA 3SAZA 4H00A 2NW0A 2AL2B 2X1TA 2FLIA 3EOUA 3PS7A 4AG0A 2ZRUA 1VFLA 2FHCA 2Y61A 2YXOA 2VFEA 1FWCC 2A2IA 3FN9A 4LAMA 2ZZ7A 6ALDA 5J5DA 2FZBA 2X7WA 3LHTA 2G95A 3W84A 4UOQA 2Q3RA 4HJWA 3MY9A 4YYCA 1R3SA 4N9DA 1BQCA 4PTNA 2V8ZA 5DBUA 3GDTA 4N4PA 2C13A 4FOKA 3RR1A 2R1LA 4UQBA 2RGLA 1FH8A 4YS1A 3TYDA 2CBVA 2MANA 3U2OA 2PWUA 4B3LA 4Z1CA 4O12A 2EJ1A 4D1JA 3K8LA 2WMIB 4G2DA 2DH2A 3QEZA 1LJYA 3UCCA 4E5TA 3O3RA 3GQYA 4X22A 1PHQA 1E0TA 2WCSA 3VMPA 1UZ4A 1AVAA 2YXGA 3TK7A 5LIKX 4TUFA 2C18A 4QLKA 1ZZMA 2VTFA 1EPVA 4IF2A 2O7QA 3CZ8A 4O1FA 1SO5A 4XD6A 1ZP4A 3S5OA 2QUVA 3KL5A 3MQTA 1QI0A 3W2KA 2HEJA 2WSRA 2NX9A 1V79A 4HHHA 1TPUA 4Y2WA 2IPJA 2FPYA 3GFZA 3LY0A 4GZIA 2YA2A 4ZOAA 3VKKA 2QDHA 3R25A 3WNNA 1KM2A 4HPNA 4JPGA 1TWZA 1YXCA 3HQOA 4JY8A 5FJRA 4GUGA 3WJYA 5I3DA 1GK8A 2BASA 1I6NA 1ISYA 5D03A 2HDJA 1VIWA 2G97A 4K68A 4JHMA 2FGLA 3WUEA 1DTUA 2VFDA 3UESA 4ZB2A 3WF3A 1K9EA 2J8GA 1Z32X 5BXTA 2V3EA 2XIQA 3ZQ9A 2EPKX 3GH7A 4UR8A 1E4MM 1TSIA 4Q7NA 5CLWA 4J35A 1RXOB 3RX2A 2J25A 4KW2A 1EA9C 4HU4A 4AVOA 1G7VA 1KBKA 1W1VA 4QAIA 3BAIA 1B3VA 3NQ8A 1DXEA 4W8AA 3VOGA 3ZR4A 4W7VA 2WW5A 3KTSA 1AODA 3UGVA 2HPMA 2PDXA 3GYCA 3EX2A 4BEQA 3FEQA 4M3PA 2OO0A 2OEKA 2PCEA 5LSMA 2OJPA 3A9IA 1ZTVA 5J04A 3VINA 1XSJA 1H2JA 5T8GA 4CNUA 2GJRA 3O63A 2ZIDA 3UG3A 5F2IA 3F5JA 4KBXA 1CEOA 3LI1A 1QPQA 2XZ9A 3UYCA 1VPYA 3WLRA 1RAKA 2Y8KA 2I5IA 4ENLA 2A7RA 3AWOA 3A23A 2E6YA 2PZNA 4HMCA 1DJHA 4UFKA 1GG1A 3Q45A 1OFEA 2FH8A 3HPAA 4QIUA 1XH2A 3TUUA 1HVXA 4ML9A 2ZZ4A 1TTQA 3OQEA 4G5DA 4XWUA 4XAZA 1O1ZA 2R91A 4V33A 3DAQA 1R7OA 3QPYA 3G1RA 4JX6A 4WZHA 4H3DA 4AD2A 4IIHA 2VEGA 4GK8A 2I9EA 3BGAA 5KEZA 3CHCA 1PIFA 5CGQA 1ZRQA 1I75A 1E6RA 1WKEA 3KDOA 3DXIA 5AHNA 3CTLA 4XTDA 1IV8A 3U2ZA 1M7OA 2AL2A 5CGTA 3IV8A 4U10A 1KR1A 4XB3A 1KM3A 3DC8A 1LQ2A 4Q8MA 3QXBA 5M1TA 2Z27A 3NL2A 2O9OA 2O7SA 4YVPA 3AO0A 4FX8A 3EAUA 4KGLA 2ZA2A 3I6RA 2HK1A 1RZMA 5CJMA 3TTSA 1FY6A 2SFPA 3OZYA 4REQA 2IKIA 5D9MA 2AOSA 2UZ9A 1FWJC 1UIPA 2ESCA 3DKLA 3TEVA 4H19A 4HNOA 2L5HA 3QZ6A 2ISVA 4JTAA 3VUSA 2FTPA 3JRKA 3P61A 3D47A 1DQUA 3M43A 2OOGA 2VEMA 1FWFC 3LPFA 3S46A 1W1ZA 4J28A 3N29A 3VTRA 5LNWA 2WC4A 3MUIA 5HWJA 3W24A 3E5PA 1JPHA 5JH1A 2X16A 3R4IA 3SCNA 3GBDA 4S3FA 1D7FA 3BURA 4JTLA 2WMFA 4I6VA 3S47A 4ATWA 4RXGA 4Z17A 4EXBA 2VI0A 3ARRA 5CAHA 2VRQA 3M44A 1XW8A 1E0XA 2ZZ2A 3IJLA 3PBUA 4LUJA 5EMMA 2ZC8A 3KVJA 4XKMA 1W3IA 3M47A 1JZ2A 1OGBA 1L6WA 2XIBA 2Y63A 1ZSXA 5GJPA 1PAMA 1RBLA 4GE8A 3SUUA 3IARA 3J7HA 1M3UA 1YDOA 1L0PA 4P7RA 3CHDA 2GUYA 3B40A 3HPXA 4GY1A 1LROA 1NH6A 3NEHA 4MB4A 2YB4A 2XIIA 4AD3A 4UWMA 2V2DA 1EHNA 3AJ7A 1F2JA 4PE8A 2HNHA 1XSIA 2XGZA 1C93A 1W56A 3PJTA 5IOBA 4CN6A 5H2ZA 4ZQCA 1RCOB 4PUKA 3WQWA 3AIVA 2XH2A 3GO2A 4O57A 1UD4A 2GYIA 3V0SA 3BGGA 1LT7A 1A4LA 4CQBA 1TVPA 1UD5A 3CLMA 4GZEA 4W86A 1XIGA 1BYAA 1BF2A 2EGZA 3R0KA 5KTLA 2CLEA 4HA0A 2J79A 3UG8A 4YHEA 4CD4A 1FP8A 2P0OA 4JTFA 1E1CB 2QGHA 3O1NA 1YNPA 3MI2A 3RLUA 4WD0A 5E09A 2ZZ1A 2A3AA 1XIFA 3M0JA 2PF0A 1E0VA 2Y0FA 3CXOA 4HZ7A 4HOXA 3OLIA 4IP5A 3T07A 4R27A 1XD1A 2O9TA 4N42A 3N3MA 1B3WA 2FPVA 3PZTA 1IT0A 3VNYA 3SR7A 4QAWA 2AQWA 3W73A 3ABQA 2B31A 2XVGA 3N17A 2EPOA 2XGIA 3PWGA 1F3XA 5A1AA 1WAWA 3W76A 4OT7A 1VCFA 4HOZA 1YDYA 1FWBC 4XAPA 3MCOA 1M1BA 1BXNA 4HCLA 1WO2A 3CHEA 4XTIA 5DT7A 3H2FA 5DO8A 3DG3A 2YDAA 3TA6A 1E15A 4HNVA 2QCMA 1Q3NA 2DZSA 3PP7A 4UZSA 4XO6A 3V16A 1TUFA 2NXHA 4QE5A 5DXYA 3AIEA 4ERIA 2CLHA 1XXXA 1KBIA 3ARVA 2ZA1A 4L61A 1QNQA 5LXEA 1N82A 1KCKA 5FEZA 2E6FA 1IYXA 2VDHA 1XLDA 4QM1A 1QFEA 3NDZA 3BQ5A 1X97A 3CNYA 3BAJA 1J0YA 3TXVA 5AYYA 1S39A 4IH3A 1UHVA 5EPDA 3U2EA 5CBJA 1Z48A 4DB7A 4W88A 3KHDA 2FMOA 1KR0A 1WB0A 2OQYA 3C56A 4H2CA 2RKXA 3EWUA 1TMHA 2P53A 2OZTA 2X1RA 1AJZA 1QU4A 2YCIX 2G4JA