2HJPA

Crystal structure of phosphonopyruvate hydrolase complex with phosphonopyruvate and mg++
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
290
structure length
283
Chain Sequence
MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMSTHLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTQELVRIEEFQGKIAAATAARADRDFVVIARVEALIAGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIRAAVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphonopyruvate hydrolase
publication title Structure and Kinetics of Phosphonopyruvate Hydrolase from Voriovorax sp. Pal2: New Insight into the Divergence of Catalysis within the PEP Mutase/Isocitrate Lyase Superfamily
pubmed doi rcsb
source organism Variovorax sp.
molecule tags Hydrolase
total genus 103
structure length 283
sequence length 290
ec nomenclature ec 3.11.1.3: Phosphonopyruvate hydrolase.
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2hjpA00
3BJFA 1AQFA 1T5AA 3T0TA 1O5QA 1S2TA 1DXEA 2XDFA 1OQFA 1M3UA 3E0VA 1U5HA 4KS0A 3QTGA 3G2GA 1PKYA 3FA3A 1O66A 3IS4A 3SRKA 1A49A 1DXFA 1E0UA 2VGIA 4QG8A 1O68A 4KCVA 1S2UA 2DIKA 4YJ5A 1DIKA 2DUAA 2HRWA 4FXJA 2KX9A 2VWTA 1PYMA 4B2DD 3KHDA 1A5UA 3EOLA 4L9ZA 4IMAA 1UJQA 3M0KA 3ME3A 1S2WA 3OQ8A 3OYXA 4L7ZA 3E0WA 3VAVA 2R82A 3B8IA 1ZJHA 1XG4A 1MUMA 1PKMA 3GG8A 3EZ4A 1A3WA 2ZE3A 1JDEA 3GR4A 3P0XA 4QG6A 2V5JA 3QLLA 1VBGA 4B5XA 1M1BA 4YNGA 4B2DA 4B5TA 3MA8A 3E5BA 1SGJA 4G1NA 4FXFA 3QV6A 1OY0A 4IQEA 3SRFA 3N25A 1PKLA 3LYEA 1F61A 4B5UA 4B5SA 1A3XA 2QIWA 1GGOA 4B5VA 2G50A 4QG9A 1PKNA 4ROQA 1VBHA 3BJTA 3GQYA 4MG4A 3SRDA 4MF4A 1KBLA 3HQOA 2VGBA 3QV9A 1E0TA 2OLSA 1Z6KA 2HJPA 4JPGA 4KCWA 3FA4A 1S2VA 3M0JA 3PUGA 3H6OA 4IQDA 2BG5A 1DQUA 1F3XA 1F8MA 4HYWA 3LG3A 4IP7A 2X0SA 2VGFA 4KCUA 3EOOA 2E28A 2XZ7A 5JVLA 1F3WA 4TV6A 3R4IA 3HQNA 4WJ8A 5TAOA 4DRSA 4KCTA 2V5KA 3SRHA 3HQPA 3KTXA 3T07A 4TV5A 3QV8A 3U2ZA 2XZ9A 4RPPA 4B5WA 3OYZA 4HYVA 3I4EA 4L80A 3QV7A 1IGWA 3QQWA 1U5VA 3T05A 3PP7A 3QZ6A 1XG3A 4L9YA 2L5HA 1KC7A 1ZLPA 1F8IA 4LSBA 4QGCA 4KRZA 2VGGA 3EOEA 2HWGA 2HROA 2VWSA 1IZCA 2WQDA
chains in the Genus database with same CATH superfamily
3W2MA 4BR1A 3IK4A 8XIAA 3ITTA 3C61A 3MCNA 1F07A 3BSMA 1XLKA 5D03A 3W1TA 4FNUA 1R3TA 4O19A 3VNYA 4UNIA 2PURA 2ZX6A 2CZ5A 1FWIC 4M7SA 1P4CA 1YE6A 4AZCA 3RM9A 4UTUA 2QCMA 3LRMA 1NM9A 3A64A 3GC5A 4WY0A 4S3KA 4TU1A 1UKTA 3CMGA 3F5LA 2W6RA 2Y89A 3GUWA 1DL3A 5KETA 2G0WA 4L1GA 4O1AA 1WKFA 4IP5A 5FESA 1X1NA 3ES7A 3BOLA 4G6CA 3L4ZA 3AXIA 1FH8A 2POTA 2INEA 3LHZA 3S1WA 1OVDA 1PHWA 2W4XA 1UH4A 1GHRA 2FTPA 2OYMA 6REQB 3F2CA 4ONVA 3UWUA 5AC6A 3VFLA 3UXKA 3EWUA 1M7OA 4KCUA 1FWJC 4AD5A 3NQAA 5I7GA 3BE7A 1FXQA 2C7FA 3W23A 2VZTA 3LRLA 5CC3A 3QKEA 3W38A 4JEJA 1UW9A 4HU0A 2Z29A 4IPNB 4Z1AA 5A6BD 2WJEA 2EPOA 2A3EA 4GGBA 4Z1CA 2WVVB 5A1AA 1U1JA 4N9CA 5G4HC 4CNUA 4O0ZA 1M04A 2FIQA 3UNDA 1PV8A 1QNOA 2HROA 2VNCA 4MWAC 4E2BA 1TVPA 5EMKA 5HNTA 2D2OA 1RAKA 1X97A 4IXHA 1JUEA 3CHEA 1P0EA 1I2OA 1E51A 1BHGA 1X6UA 2BHZA 3PVFA 3CV7A 5BRQA 2FMNA 1W3KA 5K4ZA 5ABFB 2IUZA 2RDUA 3GTIA 4Q7NA 3RRAA 4JIIX 1TR1A 3GB6A 2CWNA 3GDKA 1GYNA 1TX0A 2QUNA 2CBVA 5LNRA 5CC6A 1TWIA 4KW2A 2ZVRA 2C0AA 3UGRA 1PB0A 3NZRA 1KBLA 1LLZA 5BWFA 2GK1B 2O55A 1ZCOA 2W91A 1WXJA 3M5YA 4JQ2A 1UWAA 3BZGA 6CGTA 3NYDA 4UNKA 3DEQA 4TOQA 3OGRA 2UY3A 2A21A 4I3GA 3AALA 2Y4SA 2F38A 3MMTA 1G67A 2YL9A 1LF1A 3E2VA 2RUSA 1MZRA 2O7QA 3EX2A 4PB5A 3O1NA 3MANA 5GVJA 4UFMA 1OFAA 1XIIA 4GBUA 2J7EA 3ZJ6A 1AD4A 2CWXA 3MW7A 2WC4A 3CK5A 2DZXA 1XLMA 4FR1A 4DLMA 4I6KA 2X1RA 1T5AA 1E4LA 4JIRA 5I79A 5H2ZA 5CZSA 1IYXA 1WDDA 1PKYA 3CUIA 3AWNA 3VC6A 5L9FA 3P60A 4FXJA 3B9NA 2B7NA 4GPNA 4KERA 2P3EA 3E74A 3BW3A 1K1DA 4HNVA 4GUFA 4HD5A 4MY9A 3VIGA 2V5JA 1CGVA 1KTNA 1W6TA 2ZC8A 1W5PA 4FXFA 1OT2A 3OTRA 3GYEA 4MB3A 2OLHA 4U5KA 4ZQNA 3MWCA 2BDQA 4HZ7A 2FDSA 3QOKA 1TB3A 3F5JA 2NSXA 3NVTA 1QTWA 4HMNA 1GQIA 2HVNA 3GVRA 3S0CA 1KXVA 3GO2A 3T42A 4FOKA 2A3AA 3VNLA 2XHYA 4MKVA 4O0QA 4DPPA 4GX9A 4M82A 1KM3A 3OODA 1KTBA 5D33A 3PG9A 4ERIA 1O94A 4US5D 2PSNA 4C6BA 4XZNX 4R9XA 5CGMA 3T7VA 3GY1A 4JX4A 2OZ0A 4RW5A 4DNHA 1NDWA 3L4TA 1ME7A 2WCGA 3QSRA 4W85A 4BY3A 3OLDA 2BOGX 2VOTA 1ICQA 1Q8JA 1LCOA 3I7QA 1LDCA 1V6YA 2CBUA 1UA3A 3A23A 2P50A 2I5IA 1RCOB 3EBVA 4H6EA 1GJUA 2G3MA 4G9PA 1NDZA 3NO1A 4H8NA 3H2CA 5BXRA 4RZ4A 1PL9A 2OEKA 4D6FA 2YCLB 3ORWA 1A5UA 1HNYA 2P8CA 2CLIA 4QAIA 1VFLA 4RLIA 3LCLA 3EB3A 3G77A 1UC5A 1M5WA 3F4NA 2A3BA 1IR2A 1R3RA 5FKYA 4YPJA 3QMSA 1S2AA 1RVGA 1BFNA 1MFUA 4O0KA 3SCOA 3MCOA 1P0KA 3HGOA 3GAKA 2R14A 3WK2A 2E6FA 1YPFA 1V3MA 4X3ZA 1R3VA 3TYCA 3NOYA 2ZFAA 3H6OA 3UG3A 3WQ5A 4O57A 3O7UA 1CEOA 4GWEA 4CUCA 4LC6A 3NDZA 2XVNA 4Z42C 3IV8A 1XLHA 3HIJA 1SJCA 1XCXA 2Y7FA 4UQ9A 4LBSA 4JTQA 2F61A 4XZHA 2C1GA 3WEZA 1VFHA 2TSYA 4OUEA 5HMDA 4AD0A 2XIBA 1JGMA 1AW1A 2FYMA 1HL8A 2V5DA 2ONEA 5DMLA 3UWQA 1UR2A 3MVIA 2HVOA 2BXZA 1R3QA 2FKPA 4XZLX 1OM0A 1QNRA 3WBAA 1YXDA 4LOCA 2DUZA 1TFVA 3R8HA 3S42A 3BCFA 5F2MA 2YOCA 1BYDA 2PGFA 4P8XA 1JRBA 5AN7A 1VJSA 1PIIA 2V3FA 2GQ8A 1E5NA 5KZDA 3N9KA 3TTYA 1RV8A 3VU2A 1E1CA 1LYXA 4I90A 1P7TB 3NPUA 4G1NA 3IJ9A 4K7YA 4AZ7A 4DF0A 2YCIX 1XHGA 4G2DA 1H61A 3GDBA 2QDEA 2QQ6A 3P6LA 4PMJA 2VGBA 5DY2A 5F4WA 3STPA 3UXLA 1T0OA 4TX9A 1BLIA 2ZTKA 1UP2A 1OC5A 3CZGA 3VO0A 2BS9A 3HURA 5D2TA 4O52A 2VVSA 1DV7A 4JHMA 5CPMA 4BCEA 3D3FA 1K6AA 3P82A 3WL0A 2ZX8A 1ENUA 3REQB 4HYVA 5HXMA 2NV1A 3KBSA 1V03A 3H21A 3N6JA 1UBPC 1C8XA 1SZFA 5CZTA 3I6RA 3RIKA 1N8WA 3SCVA 2OQYA 3LTYA 3NEVA 3ZO9A 3BJFA 3VYLA 2I57A 4XAGA 1NDVA 4UOJA 3RPTA 3TV8A 4IPLA 4JTDA 4B9ZA 2PC4A 1BQCA 1F73A 4P61A 1WE5A 3KCJA 3VK5A 3TH6A 5K2ZA 1UQYA 3AMLA 3I3DA 1UD5A 1X7IA 3AYSA 3WNLA 2OR2A 2YL8A 5A6AA 4B5XA 2NVAA 4E2OA 1FWFC 3SGUA 1QW7A 1YEYA 4ACZB 4D6DA 3VM5A 2CLMA 3C3NA 6ENLA 3GU9A 4XG1A 4S2CA 3THAA 4GHRA 3G8RA 3TC7A 1J0KA 4QG9A 2PWGA 2HPIA 1X7FA 5I06A 2X09A 1XIJA 2DJXA 3KOXA 5DBTA 1OFOA 2C15A 3WFZA 2FGLA 4IP7A 4D6CA 2GJXA 2XWDA 4Q6XA 4AWSA 4Z2IA 2PTDA 3R7MA 5BZAA 3L5LA 3II1A 4D6EA 1Z41A 1W3NA 2ZXQA 2OZ3A 4DUXA 3MQTA 5A6SA 4LB3A 1A5KC 5DO8A 3Q94A 2DSKA 4Q8WA 4XZMX 3G3DA 4BI7A 3WO8A 4DQWA 2FVLA 3FLUA 5FAJA 1DEDA 4TTUA 4JTIA 3DKJA 5FA5A 2E5DA 4XKMA 2DW7A 3HQ1A 3W6MA 4NHVA 5TNVA 2EPHA 3DDMA 3AC0A 3I7RA 4YTQA 1EGMA 3G2GA 1KFWA 1IT7A 2ZRZA 3LGEA 2FFCA 1KR1A 4A8NA 3W00A 1CB2A 4JD4A 3NUKA 4XTIA 1BQGA 2Q8XA 3FSTA 1K9TA 4RX0A 3VMNA 2AMXA 3GH4A 1H11A 1PYFA 2D3NA 3FXYA 3ZS4A 1CYGA 4DUWA 3W83A 3OW1A 3SW6A 3SUSA 2HXUA 7TAAA 3VD5A 1UZ1A 4LAZA 3N25A 1VFOA 1LP6A 5CZ0A 4TQTA 4INFA 3M0VA 3DYMA 1W5MA 4WDTA 4FZIA 3GQYA 1J6OA 2HNEA 3K8MA 5E9XA 4HBKA 2FGZA 1XLDA 2Z2AA 3BG9A 3PAJA 4QLKA 1AL7A 4LFYA 4JZ5A 4PMQA 3WFAA 2IQ0A 2CZEA 1CW2A 4FA3A 4GNJA 1ZZMA 2FHFA 5IBXA 1J10A 3LUTA 2V5LA 2CW6A 2NX3A 2PDPA 1FHUA 3CZEA 1OSEA 2Y1HA 3CYJA 2H8ZA 2CLEA 1PSCA 2QGHA 5FI8A 3AUOA 4EPKA 4PE8A 3W73A 6REQA 3VGDA 2C6QA 3EA3A 1W3TA 1TIWA 1ZPTA 2VC9A 3WK1A 2QPUA 4V15A 1MUCA 3M0YA 3GDLA 1S2TA 2O4QA 3KUMA 4WHBA 1S46A 1ICSA 2E9BA 3MSYA 4NU7A 1GK8A 1H50A 4IIHA 3N2XA 4OV9A 3I4KA 4R34A 3KEHA 4IPIA 4CD6A 1DJXA 1W1IE 3VNDA 3QZAA 2DP3A 3CB8A 3E0WA 1V0KA 3CIWA 2Y5EA 3KVMA 3OU8A 2OT1A 2O9TA 4KWVA 4C6MA 1TV8A 1LQ2A 1M03A 2VKZG 3AROA 1EJRC 1H49A 3HFYA 2P8BA 1NWUA 2YA0A 3W24A 1SZGA 4PBFA 1H4PA 1A3XA 2HK1A 3AS0A 3OB8A 1O6IA 1AJ0A 1ZRQA 2OLSA 5HANA 3ITLA 4GO9A 4ML4A 4IICA 4CNNA 2OGJA 4LCQA 1M7PA 3C56A 5IDZA 1D9EA 3NWRA 1SQ7A 4QLLA 5HJXA 2R91A 2V5KA 3CMJA 4J2PA 4B5WA 1BF6A 1LWHA 2A4AA 1J93A 3UPBA 1QMLA 4Y2WA 3B9DA 4AD4A 4M80A 1GOQA 2GK1A 5CG0A 3FEQA 1NP2A 2DFAA 3E96A 4YCPA 2D73A 4HOXA 2GGIA 3BUVA 2AGKA 1OC7A 2OB3A 3AHTA 5D05A 3W7MA 2F9RA 2PE4A 1HL9A 4S39A 3ABRA 4YYCA 2X1TA 3F03K 4HU8A 1NWSA 1TX2A 3QGVA 3KOZA 4W9TA 5HULA 4NY2A 3LCIA 5HQLA 3P61A 1FP8A 1HVXA 4EPBC 4IMEA 4EANA 4UXDA 3RFAA 3PBVA 1ZGDA 1XC4A 3NZQA 1WQ5A 1Y0EA 2ZRWA 2Y63A 1ITUA 3MA8A 2V82A 1B30A 3OHMB 2W27A 4IZGA 3UP8A 1FH9A 1PKNA 4YWIA 4O13A 1KQZA 2IKIA 1HKKA 1G9HA 1UYQA 2WZTA 5AC7A 4H3DA 1TZ9A 4RDYA 2DZVA 3A4JA 1KBBA 1W9VA 4LNYA 4A2RA 3T78A 3DGBA 3EKGA 4JQ4A 1XDMA 1S5NA 2I16A 4OKDA 2OX1A 1UUOA 1X39A 1H7PA 5E93A 1M01A 3HQPA 4MNKA 5FJJA 4UIOA 5JBEA 3U7BA 4RNFA 3DG6A 5BU9A 1KFJA 2BB0A 3WJSA 2Z7KA 1A5MC 2ABAA 1R30A 3EMZA 1GOOA 1MQPA 2GVYA 1IZCA 3BAXA 1Q6QA 4EWND 3GUGA 4FLQA 1W1TA 4MDPA 3EX3A 1QATA 5IXEA 2VHLA 4WXYA 4W5UA 1RALA 3W7HA 3WUGA 3PM6A 3SQSA 1V4YA 3EXSA 3GG1A 5DBUA 3BH4A 2WANA 3H53A 2X05A 5F2IA 2CNCA 3QGAC 3SECA 2ISSA 2KZHA 2PDMA 3MP5A 4JR5A 3PAOA 4KFPA 1YYAA 2J24A 1J6PA 1T8XA 5A3HA 2BGNE 4Q8PA 3O16A 4DM2A 3V5OA 1JZ5A 3CL6A 2YCLA 3PTQA 1VBHA 3BJTA 4V27A 4FS9A 4M3PA 3O6CA 3FHAA 1ZUAX 4JOMA 1FWHC 4I5XA 3U0HA 2CESA 1C7SA 3WDJA 4RDWA 3NFUA 3JRKA 3QR3A 2PTYA 2TPSA 1XQKA 3IGXA 4QHRA 4TVDA 3TN3A 5FJRA 3MJMA 2VRQA 4O4WA 2QCFA 1BRLB 2OSXA 3TFCA 3O6YX 4PULA 2JIWA 4DPQA 3UY7A 1VYSX 1BSLA 3E2RA 3G1AA 1OJXA 2V8ZA 1I8JA 1K4GA 3AYVA 1X1ZA 2QJNA 4ZO9A 1E3XA 4HN4A 4HNNA 2VO5A 1XLBA 3TSBA 1FBAA 4RV3A 4AF0B 1Q6FA 3B4YA 1TTJA 1OQFA 1QDSA 1UZHA 3APTA 1ZBKA 4IUGA 1YHTA 2YXOA 3QBUA 4J27A 1O68A 3BAYA 3QQ1A 2INZA 4A3HA 3T44A 3EA2A 4N6EA 1HN1A 3MBFA 1JPDX 1I2PA 3P0XA 3F2BA 2GJLA 5K9XA 4QSHA 5J04A 1Q6CA 5ABTA 3A3WA 2QIWA 1EJWC 3GXPA 4DVOA 4IP4A 4FIQA 4N02A 5B80A 2PDIA 3U48A 1F9CA 4MTVA 2ZRVA 3M0XA 3N14A 5ABHA 3CZJA 1LZOA 3PZMA 2WAGA 2GQAA 3RCNA 3HPSA 1BSIA 5AYXA 3K5XA 2WLZA 1Q13A 3F1QA 2DPEA 1E15A 1CECA 2PGRA 2XZ9A 3GDTA 4B3KA 4US6A 2YGYA 4NAEB 3GWQA 5BWAA 3LRKA 1VJIA 3PNZA 3QPEA 2W92A 3Q58A 2HV5A 5F4SA 2YXXA 1KNWA 4AVFA 2BVTA 8CGTA 4GFIA 2MANA 4H7ZA 1YTEA 4C6PA 4C6FA 5CJ5A 1SO6A 3L5AA 5AOUA 3G0UA 3URAA 4XKYA 1RD6A 4PMUA 5J8LA 3JZUA 3NIYA 4MSSA 3QPYA 4P7RA 3U2CA 5AYZA 5D2YA 1A4MA 4YTRA 3WBEA 4JGDA 1SJDA 3VKKA 1HO4A 2PRHA 1E73M 4ZO7A 2HTMA 1YKWA 5HWMA 2XGZA 2O56A 2BSLA 3MY9A 4C7GA 3CLWA 2QAFA 2GSHA 3BWWA 2PA6A 4O1FA 4GCXA 1XH0A 5D2VA 3W6YA 4F8XA 1J4EA 1TVLA 3N73A 4R9OA 4R33A 4EXBA 4YXGA 1J12A 4B15A 3DXIA 1K8ZA 1T99A 3B0VC 3WSUA 1WZKA 4NYYA 1F74A 3U2ZA 5D02A 4CQ8A 2NQ5A 1KM5A 2E6AA 1VHCA 1JVNA 4A4AA 2QEZA 4E0CA 4HB7A 3UETA 3EMQA 1SR9A 1JPIA 3T08A 3NQGA 3ALGA 1B3ZA 4GC3A 1H5VA 1KW1A 1LG2A 3TOPA 4G56A 1NJJA 3TN6A 3N4EA 3URBA 1SR0A 5BYWA 4S23A 3GG7A 1XFBA 1GOXA 4WVXA 4E8CA 3AAMA 3JU2A 1UHVA 3WZ0E 1CCWB 5GQBA 3N2OA 2DSZA 4MYAA 3KBVA 2QZRA 3AXHA 1KV5A 4H9XA 3KAOA 1LT7A 1EF3A 3M0LA 5D9NA 4DJFA 1AODA 3LHTA 3G1DA 3U8GA 4BS0A 1GVOA 3A21A 1XUZA 2C1HA 4EWJA 4IFKB 1WDSA 2HPMA 2WV8A 1IXQA 1J01A 3T81A 2OJPA 3WH5A 3EPMA 4LCSA 2DY3A 4DY1A 1UB3A 5GNYA 2AKZA 3RN6A 4YNGA 1S3HA 1WDWA 3B8VA 2V9DA 2G3JA 5A6MA 3W2LA 4GINA 3KRSA 1J5TA 3WN6A 3GXDA 1FDJA 1TG7A 3UESA 5EFDA 3LQGA 4XTDA 3THQA 1TPH1 4E3TA 4MY8A 1RP9A 1K3UA 3MV01 4LU0A 4O8RA 5LKYA 1JYNA 2RH9A 4PYSA 3R2GA 5D9OA 4A8RA 3Q65A 1Z9AA 4HSNA 1H1ZA 1FCUA 1R0MA 5BRPA 1Q66A 4YYFA 3TYEA 1KGUA 1LT8A 1QPKA 5LIXX 4NZ1A 3V75A 3BC9A 5AHMA 1DJQA 2VELA 1HGWA 1V3LA 3ARRA 1V0MA 2QUUA 4DWSB 1TTIA 2ZX7A 1UR9A 4MNMA 1ZLPA 3E12A 3S46A 3T09A 5C9UA 3BK0A 2Z00A 4MHBA 4KBXA 1GYMA 1AQFA 1PIGA 2IKJA 4KGJA 1BXBA 1NQKA 4DJED 4F2UA 3RITA 2GDUA 5HMSA 1ZJBA 4PL1A 3MP4A 3SRKA 1A49A 4I9JA 4J40A 2NQLA 2ADAA 5CGTA 2XIMA 3PZGA 4F0HA 5EFFA 3ZZ1A 3LK6A 3QHNA 3ZMRA 4JTSA 3N4FA 3P5ZA 4JQ1A 3C2FA 3GIPA 4W87A 1G4TA 5A8QA 2DT2A 1F3TA 2MUCA 3ISIX 4IQJA 3I7SA 3GC4A 1DE5A 3HFTA 4Y7EA 3LD5A 1UP3A 3XIMA 1QFEA 3OBEA 1TWDA 1QHOA 6TIMA 4AHPA 2POZA 4FLOA 1UASA 1EC7A 3SIMA 5C7HA 3R6IA 1HJUA 1OCQA 4B9YA 3I6TA 3CIXA 3WQPA 1IHIA 2QCLA 4B4HA 3CAVA 1HJQA 1TVNA 5AVHA 1QOXA 5BOOA 2PDLA 1EDTA 2G3IA 3AHXA 4S3GA 1NU5A 3BCJA 3TIMA 1A5NC 3QYSA 3UR2A 4CU7A 4PZVA 3GS6A 3GBDA 3TKFA 3NURA 5TQLA 3UW6A 2D23A 4BF9A 3TSMA 4PEEA 3CIVA 1XH1A 3T4WA 3I65A 4G8TA 1G4EA 4JTJA 3FJLA 3QM3A 1YIXA 1X6LA 4HHPA 4LF1A 4C6LA 5A6BA 3LSBA 2WPGA 3ITXA 3Q2DA 2YDSA 4RZ5A 4AY1A 2BZNA 3VIOA 4MFEA 4RV8A 3GKFA 3TZNA 9XIMA 5F1VA 1D3CA 4YS1A 3IJQA 4HQVA 2CLPA 4XD6A 4FLRA 3TSDA 2Z1XA 1JNDA 5BU6A 1JUBA 1E6NA 3NOEA 3B03A 1MMFA 3UZ5A 4O28A 2IQTA 2XH2A 1H7NA 3GDRA 4Q8NA 1XP3A 5GPRA 3ZOAA 1N82A 1W3HA 1UP0A 4JKMA 2YCEA 1QCWA 5MF5A 3NQDA 1R9YA 3K4WA 4C1KA 1HFBA 4QSFA 4CQAA 3OZMA 3INPA 2QULA 1Q6DA 1HVQA 4JX6A 2YDAA 3NXLA 3TR9A 3SDOA 3EDJA 5E09A 4J9JA 2CU0A 3TJ4A 4K1GA 4NJHA 4ERAA 3KRUA 4C6EA 2AMGA 4NG3A 3FX4A 3HGSA 1QUMA 3KTSA 4HNUA 4HKPA 3NR0A 5E1QA 1BTMA 1KA9F 3W81A 1ELSA 1NF0A 1I9CB 2Z7GA 4QGCA 1KCKA 4PTNA 1GOKA 3B8WA 1W9PA 2E4TA 4DX3A 3FYPA 2GVEA 5GNZA 5C6MA 1SZNA 3IAPA 1NDYA 2YFNA 3T40A 2PU1A 3T0BA 3GNRA 3FEMA 5FCZA 5JBDA 3GLCA 2BV9A 2V0TA 1ESWA 1Y5XA 3W86A 2XINA 4XAPA 2VM8A 4M7TA 1CT5A 4LBUA 3A4XA 3TN5A 2OKTA 3UZYA 1KFCA 4E5TA 1E6ZA 4QDPA 4AX7A 1ZTVA 1B1YA 1QNQA 1E0WA 2ESCA 3TXVA 4XISA 4LUIA 2P1FA 4KGLA 3F2DA 4XAFA 4Y9AA 2WMKA 1SW0A 1T40A 4KETA 3WLQA 7PTDA 3QJAA 4B91A 1A5OC 2G3NA 1R7OA 1MRQA 3NDYA 1PX4A 2A1YA 2QCNA 3B0YA 4QP0A 3IJIA 1EB3A 3SJ3A 2EPLX 1AZ2A 4JTTA 3DERA 1DJNA 3M64A 2VFEA 1RZMA 3SO7A 1ZL1A 4MZYA 5EU9A 1TV3A 4ZQRA 4IIDA 3CUXA 3H2EA 3GE7A 3GSMA 4ZOBA 5CPOA 3FKKA 3C0LA 4US5A 1S2CA 1H41A 4XUGA 4D6JA 3L68A 3IVTA 4WZHA 3S6DA 1O5QA 3H12A 2CZDA 2ZUVA 3BJSA 4QJ4B 3FDKA 4QDMA 1BRLA 3P67A 2R1KA 4JYDA 1SPQA 4U28A 1GG0A 5CH9A 1DIKA 1PYMA 4H01A 1V79A 1XSKA 2YXGA 4QJ1A 1YBQB 3ME3A 5AFDA 4FO4A 3TN4A 1OZQA 4RE3A 5FSDC 3O0FA 4QROA 5I3HA 4RUBA 1G0CA 4X0VA 1UD8A 3NSXA 2YJQA 5CGQA 3DG3A 3E5BA 1ZBCA 4HZ6A 1PWMA 4DAIA 1GNXA 1RJRA 3TVAA 4ADUA 3UCCA 5DRCA 2HS6A 3M4HA 3VA8A 1LG1A 5FJOA 3W1LA 3GH7A 1JG9A 3UR7A 4GA8A 2GQ3A 3FCPA 1GKRA 4H83A 2WM0A 5J5DA 2FJUB 4IM4A 2PLKA 2PCQA 4DO5A 4UQCA 2VFGA 2BVYA 1O1ZA 4AISA 3CO8A 1IXNA 2PEVA 2PC8A 2DIEA 3SRHA 1FRBA 1WBHA 5IBXC 2PU0A 3ZWTA 3K4AA 1TYGA 1UQZA 4NAFB 3U7VA 3SCRA 4IJRA 2VZSA 5KZMA 4RJEA 4M29A 3M5VA 3W7IA 1E56A 3SGGA 1F6YA 1SW3A 4UTKA 4HCDA 3GVVA 1LRQA 2WM1A 4XQ6A 3QW3A 4NAEA 1EL3A 4LS2A 3MSDA 4PUNA 4YHEA 2I1OA 1GQKA 5KEZA 3FSUA 4IIBA 3FV9A 3WLNA 2GVLA 3ARSA 4DM1A 3CAKA 3BMVA 3EWDA 4KRUA 3BARA 3N18A 2R82A 2X0YA 2AQOA 2PB1A 2DZBA 1EKOA 3GR4A 1RUSA 2XIQA 4DN1A 2Y24A 3G1FA 1QI4A 4LYKA 3SSJA 2QF8A 4X61A 3CHFA 3UYIA 1XR2A 1DJZA 1PZ2A 3TFXA 3W2UA 1TIMA 1E43A 1XYCA 3GNDA 2OQHA 3WLIA 4XZ9A 4YTSA 4E4UA 3AZSA 2FDMA 3G18A 1EDQA 1L0PA 1BWVA 4Y90A 3AYRA 2DU2A 3LCGA 3FVDA 1IWBA 3WD4A 3NO5A 3GD6A 1X6NA 4OBSA 3WELA 1RH9A 2OOGA 1ZBWA 3C8NA 2ZQ0A 2YSWA 4FI4A 4QAWA 3STGA 2YBTA 4PH6A 4DZAA 1I45A 1I2NA 3ARUA 5IDIA 2PDXA 2P0OA 2EF9A 1XIFA 5SWUA 2VGGA 2VFHA 1GZGA 3F4VA 4W4QA 1V6UA 4UR7A 3R10A 1JD7A 2W66A 3ECQA 1XRVA 5DN1A 6PTDA 1PJ9A 4GBDA 1TV4A 5CSUA 4MIMA 3VNIA 2HSAA 3LX9A 3S6TA 1EIBA 1WXYA 3EDDA 2E3ZA 1DJWA 4XSLA 5I3JA 2W0UA 5EBAA 1QNVA 3OG2A 3TCEA 3GFXA 4KRTA 3H2MA 4KWSA 4A6GA 4N9EA 3KLLA 1UD6A 1ZJHA 4IL0A 4UCFA 4ASTA 3UPMA 1KRBC 3VXGA 4LY8A 1K7EA 5ENLA 1ALDA 1XIEA 5LA0A 1RSCA 2HCVA 3K30A 4IQEA 1YX1A 2CITA 3SBFA 2DH2A 2RFGA 3URQA 2BXVA 4J5NA 2W67A 3LM3A 3FVMA 4I5RA 4IFKA 4OWGA 4GVGA 1JZ6A 1WXZA 4D9PA 1O7AA 1JCLA 3UD6A 4DXKA 1C7TA 1CDGA 3W6LA 3PY2A 1JZ7A 4E8DA 1Y65A 2OQLA 3GZAA 1HX0A 3CHDA 3CGTA 4W8BA 3R5EA 1A47A 3GTFA 1PBGA 3WQDA 5DY3A 5D32A 4E8GA 4KESA 2Y2WA 2ZADA 4MADA 2HNHA 1I2QA 5AYBA 5CSRA 2NXHA 5BNKA 1QXLA 3DC8A 3CHVA 1GKPA 4ZZ9A 4P8UA 4I7WA 3USZA 3V18A 2Q3RA 4O15A 1A80A 1JDDA 1RK6A 1S5MA 2OODA 2P5NA 1YDVA 3BGJA 2JF7A 1JUKA 4LVFA 3A3HA 1NWTA 4H00A 3UNTA 3PSVA 4JEQA 1IR1A 4H9YA 3ICJA 3THCA 2E68A 4WOQA 1GTHA 1OINA 1FA2A 2FTYA 3L4YA 2W79A 3SEPA 1M9HA 3K8KA 3SRFA 2O92A 1D7FA 2WJZA 1ZHAA 3OBKA 3SUVA 4URIA 4C1NB 3KE0A 4QITA 3ZQ9A 2QW5A 5EGRA 1NARA 1RJQA 4AD2A 4C6KA 4DZHA 2JEQA 4JNZA 2ZX9A 5RUBA 3S2NA 3S47A 1OYBA 4QCFA 1CTNA 3CUGA 3H4WA 5TBOA 1F8MA 1H1NA 4Y9MA 1WAUA 1SO3A 2VL4A 4R5EA 2B0MA 4ZXOA 1TCDA 3BAJA 1AH4A 2PDKA 3M7SA 5TAOA 4D1IA 3IIXA 1UKSA 2WVUA 3VC5A 1B9BA 2YBVA 3QZEA 3NQFA 4GUIA 2XVGA 3B05A 4YL2A 4L4LA 3WBXA 3OZYA 4CGTA 3AXXA 3KLKA 3TX9A 1W9UA 3GHSA 4F0SA 4I7VA 3GHTA 2FH8A 1SFJA 3P14A 3DYOA 2WJFA 4ZXLA 1ONRA 4BJHA 3S4TA 2BVDA 2CLOA 2ZUNA 1H3GA 4F0LA 1XBYA 4DJDA 4MYXA 1O60A 2V2HA 2OVLA 4RE4A 1EP2A 1H09A 2HEJA 4WD0A 4H9MA 1S2WA 2WWCA 3AZTA 3KWSA 1CXEA 2REQA 3RJXA 1GVRA 1GEQA 4CQDA 1CXKA 4PSPA 4NI8A 1WUFA 2V2CA 1XI3A 4CNOA 5IM51 4QISA 1TRIA 1Z3NA 1FDZA 5G4WA 1AG1O 2PP1A 8A3HA 3HQOA 1RY0A 2UY4A 5C2XA 4X22A 1S2VA 2JBMA 2X0HA 4UTFA 2YDRA 1UBSA 4LYQA 3V1PA 2V69A 4Z1YA 1JYXA 4H41A 3WF2A 5HR6A 1H5YA 1KXTA 4O1EA 1U30A 1C8VA 1Q5MA 2Z24A 4XO7A 1Y5WA 3L65A 3TWBA 3J7HA 4AUBA 3N29A 2CIPA 1OEPA 1ADOA 3W26A 3MV11 4I8DA 2E6YA 3UJ2A 3VUSA 1E4MM 1E5JA 1HG3A 1EO5A 4NNAA 5I3DA 3O06A 1LROA 2WOQA 4GQ0A 3WQWA 3BLIA 3MS8A 4X60A 3QOMA 3RILA 4LWWA 5BRBA 3UJFA 3KRBA 4P7QA 3UVIA 1FWNA 3XINA 4X9YA 2NX9A 2WCAA 1MDLA 4HOWA 2GFTA 2CETA 4P5UA 2X8RA 1KBIA 3WBYA 5HJYA 2YX0A 4IH3A 3WLJA 4R7JA 3WCZA 1ZP3A 4PFHA 5HNRA 4U3CA 1UUQA 3MTWA 1EOKA 3S83A 2RGLA 3AIBA 4L4MA 8XIMA 1OYCA 2J8GA 2X41A 4FX8A 1THFD 3F5KA 4QCEA 2XVLA 4IGSA 3WQ4A 4J28A 3N1AA 3COTA 3PZOA 1PVNA 1UR4A 2Z0IA 4K6AA 4C6CA 4CCZA 3O8AA 2WO5A 2HMCA 3R13A 4FXRA 1AQHA 3VCNA 4FLSA 4OTKA 2OYKA 3WJXA 4B5VA 4Q8TA 3DI0A 2J27A 4C7DA 1E1EA 3ENLA 4I5UA 1FWBC 3SUUA 3T9PA 5CEWA 4GFSA 4HYWA 3L7RA 3UVAA 1NEYA 1XIBA 4Q4QA 4XIAA 4HMCA 4A05A 1HKJA 3ARXA 1F4AA 3MJYA 3QQWA 1XICA 4NX0A 4GIAA 5H1WA 5C9ZA 1VRXA 4MVAA 4YHGA 1M7JA 2I5GA 3AMGA 2ZVIA 4MWAB 4AIUA 4FSAA 1MEHA 4CCEA 4IQLA 1DWGM 1DXEA 2O0TA 5H8MA 4DYKA 4JY9A 1EJXC 4QNWA 1KLYA 5BW6A 3W7CA 4ROPA 1ZY9A 2GLKA 3CTLA 4MUZA 3WQ8A 1VBJA 1IXOA 2OU4A 4DJFC 1H7XA 1ZAIA 2F6UA 1UJQA 3M6YA 1RK5A 4WKAA 3C0SA 2ZUMA 5E9AA 1QR7A 4ECLA 5AC8A 5CQ1A 4YIWA 1DWAM 4CVUA 2G95A 1ISXA 4E4FA 2QCEA 3JUGA 1OIMA 2VEKA 3N6QA 3U5YA 4PMVA 1K9DA 4MJ4A 4IFRA 1RPXA 2QGYA 2H9AB 1XIDA 2XSAA 1YBQA 2QCDB 3ABXA 2OFJA 1REQB 3KVLA 3WLKX 4JTFA 5D09A 1XRSA 3HPXA 3AFBA 3P0WA 4CNSA 9CGTA 1LJYA 2XFWA 2C16A 1M65A 1KXQA 2VGFA 5U7SA 4FNSA 4Z0SA 4O11A 3L9CA 2CLKA 2J7CA 4Q4OA 3CC1A 5LA1A 2E8YA 1V3IA 4HK7A 5A2BA 4DO7A 1K70A 1AQMA 2WW5A 1UMYA 2H3BA 3O15A 4CQBA 3BLDA 5GNXA 3C0QA 1JAEA 3C0JA 1B4KA 3ZLHA 2BGSA 3D3AA 2VWSA 3MKVA 1JCYA 4BI6A 1L9WA 1I2RA 2YL6A 3H70A 1U5JA 4CU6A 4RW3A 3PB2A 4Q7BA 4R7OA 4QQ3A 4UR8A 4Z2HA 1G69A 4H9VA 1DWFM 4OT7A 1K7XA 4PSRA 4IMAA 1A0EA 1E9LA 1XV8A 1FHLA 1RXOB 4XWUA 1NH6A 3EEZA 4UMBA 3CZKA 2GJPA 2J7BA 1E6PA 1RPKA 1Q8AA 5CLTA 2O7SA 3ANVA 3ARVA 1OF6A 1ZJAA 3VGGA 3DFOA 4U2YA 1TJ2A 5G2WA 2Y7DA 3PZQA 3DU0A 4LF2A 1UPMB 5M2FX 2C18A 3VDAA 4KEMA 3G1SA 1VCGA 3RF9A 2AGTA 3CUZA 1FUYA 2YLLA 1FWGC 3BO9A 2R24A 4FB7A 1NQ6A 1OX4B 5AY7A 3CZ8A 1N8IA 3TWAA 3THUA 1JI1A 4FNPA 1H2JA 3PBYA 2DSVA 2CZFA 3I10A 4UQDA 3TOYA 1X8FA 3GTXA 3PULA 2EXOA 2D2JA 3KOWA 3N15A 4HMEA 4AVNA 1XLCA 2A79A 2QR6A 3QC0A 4C90A 1ECQA 2XSXA 1LUCB 2VCCA 1IEIA 3MU7A 3DBNA 1BGAA 4JXCA 4LGXA 4M56A 4EOUA 3VX1A 4ZFCA 1JZ3A 1LM1A 1D3HA 4GCAA 3PZ9A 4AZBA 1OWQA 1WNOA 4A21A 4J3SA 4R88A 3W7EA 5B7ZA 3FJNA 4PMNA 1SJBA 3ZLFA 1ONEA 2XH0A 3UWEA 2Y8UA 3NVDA 1O12A 2A3HA 1UR1A 2HK0A 5LGZA 4UFKA 1NWRA 2OZTA 2OTDA 2WMGA 1DIEA 2DZWA 4F79A 3E0IA 3ARWA 4J4KA 5T9BG 2FLIA 4F0RA 3JW7A 4KWWA 4O54A 4R27A 3JVAA 5DCDA 5E5CA 5C9RA 2DSWA 3T2QA 1E3ZA 4LV9A 1YE4A 3KDNA 4ZL1A 1WV2A 2QIIA 3UQNA 3GRIA 4P7LA 1OX5A 2IPFA 4AWEA 3UWVA 3OO2A 1ZB5A 3NM1A 3MUY1 3PZUA 3MI2A 4F0MA 2G50A 2Q71A 4MLJA 3RO8A 3UF9A 2CHNA 3V0SA 4C5YA 4MF4A 2PWHA 5DFAA 4JAWA 3OEXA 3EGJA 3KBNA 2ISVA 3IIZA 4F2BA 4HCLA 2YCKX 3UEQA 3TYUA 5AC5A 3SUTA 3TQKA 4F2TA 5D9PA 1TV5A 5HWNA 4NL1A 2E1DA 4KMQA 1UIOA 1RCQA 4OOZA 5M03A 2PLMA 1K9EA 2A7RA 4QQUA 3SIZA 1XBVA 1H51A 2TMDA 2WMJA 1BVNP 1WCGA 3DFTA 3WUBA 4C6OA 2WZIA 3WKZA 1M7XA 3T05A 2NQHA 5HQMA 4KEUA 3QKZA 1LOSA 3K46A 1FWAC 4XZBA 4Q8VA 4UZUA 1TV2A 1VPYA 1HKIA 2WVTA 1JFHA 3W25A 2B31A 3SURA 3T2PA 2BGQA 4N42A 3W7RA 1OG6A 2RAGA 1Z48A 1AJZA 3VD3A 2C79A 4C65A 2VRKA 3MUCA 4NT0A 3CTTA 3PFMA 1J0HA 2AAMA 3DHFA 2DVTA 4L6HA 1W5QA 1SUXA 4QE4A 2J6VA 5GJMA 2NVCA 5DRIA 1J2BA 5JBFA 4HA3A 3RGTA 4Q8UA 1J0YA 4DI9A 1TJ1A 1MXSA 1K77A 4PR4A 3PUEA 1FTXA 3KOYA 2VTFA 1WKDA 2BHUA 4R3UA 5DMYA 1TTPA 3IARA 3C2EA 4PTXA 3VDCA 3SCQA 4QXIA 3MC5A 2PDUA 4ZFMA 2NQZA 4L6DA 4Q4MA 3LPFA 4ENLA 2DZPA 3V7PA 1UKQA 3M44A 1HJWA 2XVKA 2EJ1A 3VOHA 4O53A 2FGBA 3BPWA 4GYPA 3G1VA 2D3LA 2PTWA 4ORIA 1H0GA 4PBGA 5D4YA 3TUUA 1W37A 2NXIA 3CAWA 3GR8A 2FMOA 1CIUA 3S6OA 3BTNA 1W1ZA 1PIFA 2WQDA 4U2ZA 1JEZA 1YW1A 2JFEX 3OZPA 3ZT5A 3TU9A 4GX8A 4NZ3A 1GEHA 5LHFA 2FPTA 3P3BA 5EMLA 2VYOA 2VC5A 1CLKA 4TX6A 3T0DA 2A2IA 4HOZA 5I02A 1UD3A 4DJEA 1Q2SA 1F6KA 2XFFA 5LIKX 2PF8A 1ME8A 3IUIA 2DV0A 3F4WA 4RL3A 2Y6ZA 4ZQOA 2Y5JA 2GL5A 3H7VA 4QE5A 1AH3A 4MZ8A 4FMVA 3IIOA 2VQTA 2I56A 1P1XA 2IQDA 1W2VA 3RO6A 4NASA 3VMOA 5HUOA 3L0GA 4UQBA 2D69A 4LANA 4BWLA 4CN1A 3NQBA 1BYBA 4JIHA 4HZMA 5JIPA 4JICA 3CMFA 1Z6KA 2J78A 1XYMA 3APGA 4AD3A 2INFA 3IEBA 2CKRA 1ZALA 1MW1A 3IWPA 4B3ZA 4NUWA 3HMCA 3A47A 4K38A 1KFLA 4PODA 4LCRA 2VFFA 1DJIA 4NVTA 4EX4A 3VD7A 3SN4A 5FJUA 5C55A 2ZZ6A 3MSGA 1DTUA 1WP6A 3OOQA 1E9IA 2YW3A 2Z1BA 2QCGA 3NJ3A 3P84A 3WNPA 1QOQA 3FY1A 3PBGA 4DI8A 3G1XA 1IIGA 5I2UA 1NIUA 1A5SA 4GXMA 4C6JA 3MHFA 2EHHA 3B0XA 5LNWA 4B4FA 5EB8A 5LYRA 3M6DA 4LT9A 3H2AA 3PB0A 3MI6A 3RRXA 1S39A 1AFSA 4GUGA 3VZZA 1VBGA 1CNVA 4CD4A 1ML1A 1MW3A 2ON3A 1G6CA 3VKJA 1OT1A 1U2YA 2OO0A 2FH6A 2WNZA 1TUXA 5IHRA 1JDAA 1DQWA 1YADA 2YPIA 3ID7A 2C19A 3MHGA 4JIQA 5TIMA 2VX7A 2FZ9A 2QMJA 1B3WA 1GJPA 2JEPA 4AWUA 3IGSA 1KV8A 3GM8A 1TA3B 5KITA 4S38A 2OCZA 1E6RA 2J79A 2YB4A 4TV5A 2Z2BA 1KCXA 1X98A 1MRAA 3NL5A 5CAHA 3ZJ7A 3S5OA 4LX4A 4CKQA 1C3FA 4S3EA 2V2DA 4J3XA 4WR3A 4D72A 3CHCA 1CPUA 2V68A 3ZWSA 2Y5SA 2CBIA 3ITOA 2PWDA 4HHMA 4A8IA 2X1UA 3EWBX 5AKQA 5CC7A 2XFYA 1A4LA 3MMWA 4B3LA 1QNSA 2VR5A 4A8LA 5DX7A 4JCLA 3EWZA 1M3UA 5A94A 1ODZA 4OV4A 1VFMA 5CBBA 3OLIA 5CPSA 1R3WA 4QTGA 3BLOA 1FXPA 1L6SA 3EOLA 3KCLA 3KVKA 2RKXA 4PMOA 2VURA 2JKAA 4ZGYA 5HA7A 2PLCA 1CBGA 3PTMA 3SY8A 4CD8A 1TO3A 3W87A 3IUHA 5AHEA 1CGYA 1IV8A 5DF0A 3IGUA 1V6XA 3BMXA 3PUDA 3MUIA 3P7YA 4HJWA 4C6DA 3FJ4A 4OOUA 4H9ZA 1OBAA 3SFKA 1VYRA 3GFYA 4XVDA 5MKGB 2WZMA 1XYLA 3W1MA 3WD0A 1B90A 4GI6A 1ZSXA 3O63A 2PDBA 1RQHA 2XZ7A 1R8LA 1N7KA 2CFFA 4MAVA 3DFYA 1JPHA 2H9AA 1Z32X 1A0DA 1JPKA 5EMJA 3DENA 1U1UA 1WDQA 1GONA 4WLCA 3PPFA 3HZ3A 1OYAA 2NW0A 3FGCB 3ZVHB 3GIQA 3GK0A 2EJAA 2YDQA 3RCYA 3M5ZA 4UTLA 3W85A 3NGFA 1R38A 2PUZA 4MUPA 3LS9A 2X42A 3GR7A 4ZR8A 4Y9OA 3S2CA 3WJYA 5FAGA 3TJXA 3CQIA 4EAYA 2ICSA 1UD4A 3RDKA 1W2PA 1DWHM 1RY8A 3AOFA 3WLOA 3DFNA 3FN9A 2YA1A 4MM1A 1XINA 3P8JA 3TR2A 4UBPC 4MAZA 1P6BA 4EF9A 4PFMA 1GGOA 2DH3A 4L56A 3WNMA 1GPWA 4DELA 4H9UA 5D2WA 4ADSA 4P2VA 1R5YA 1ZCCA 1Q6LA 1LL7A 2PDNA 3TK7A 2YLAA 4PUJA 3RX2A 2NT0A 1ITQA 4WDXA 5EY5A 3U6WA 4BA0A 3GXMA 2FB3A 3LZ5A 1VP5A 3O3RA 4TV6A 4WKHA 3QLDA 3U2EA 1KM4A 3QV8A 4XV0A 1EX1A 5CPQA 2QPSA 2Z1SA 3GTHA 1ZQ5A 4O12A 3DHUA 3LXCA 2E09A 3LCWA 1WKEA 2ZA2A 4NJKA 2SFPA 3NA8A 1AD1A 4GGHA 7REQA 5H8PA 4XAZA 2HWGA 2NZLA 2BASA 1W1B1 1TMLA 1HJVA 1MEWA 4IIFA 2GJNA 4LNCA 1LUCA 1UUMA 4AFYA 4QS5A 4JQ3A 4UFJA 1GYLA 2GGJA 4CN6A 4F0KA 5G1YA 1ME9A 4TMCA 3ARPA 3E0LA 4WSJA 3SN0A 3P5YA 3ABSA 2JK2A 4YVPA 4NSBA 1EYEA 1R2SA 1HKMA 2R94A 4UFHA 2GSEA 4G1KA 2O4MA 1FY6A 4QNEA 4HZ8A 3GG8A 3PG8A 4HMDA 1V5XA 1BG4A 4HU4A 3UJRA 1G7VA 3HJZA 1S5VA 1FFRA 4FP1A 3V5FA 1SGJA 2NQ9A 3LYEA 2V3GA 2PCEA 2FPVA 3R1ZA 1TQXA 5HPOA 3EAUA 3NQEA 2UWFA 2WNNA 3ARTA 2R1MA 2NUXA 4H6RA 3O05A 3AHVA 1CGUA 4Z2JA 1VFUA 3DFHA 5DCBA 4XVEA 1XBZA 1EEXA 4CEXC 3AMKA 1I4NA 1WPCA 3LM7A 1PUDA 4DZIA 2RGMA 1AQ0A 3LOTA 3LENA 1DJHA 2J8FA 4N9BA 3WENA 3QF0A 3AHZA 3KHJA 3PPGA 3RPMA 3MDUA 3ZLGA 6XIAA 3A24A 4KKXA 1XLAA 3TC3A 1SSGA 1BYCA 2Z25A 1W32A 2BBFA 4JTAA 4ALDA 3W53A 1SYTA 2GZXA 3VVGA 3TLLA 4LYRA 2VX4A 3WNNA 2GJRA 3NQVA 5BROA 3BURA 2ACSA 1XH2A 2QJGA 4DAFA 1UROA 1Z8AA 4Z1DA 4FHAA 1AUSL 4WY0B 3G1HA 4M6PA 1FHVA 3H55A 4HPJA 3PS7A 1TPVA 1ECEA 4CCDA 2XWEA 4AMCA 3EEGA 1OX6A 1V0NA 3HB9A 5C9XA 2WKLA 1LOQA 2CLFA 1P0BA 3OVRA 1UH2A 5BOFA 4DIAA 2ZXBA 1NVMA 4XK2A 2E9LA 4N7QA 3DECA 4HP5A 4EKJA 1JI2A 2OGYA 1W1YA 3N2BA 5D8ZA 4DBUA 1BEUA 4MFDA 2PZ0A 3AS3A 2EBNA 2NWRA 4JL2A 3ABQA 2PWUA 5F1UA 3A22A 4C91A 3OVGA 2WCSA 5LA2A 1ISZA 2J62A 3SCUA 1SSDA 2AQVA 3IGHX 4FR6A 4W88A 3HG5A 3L23A 3OHIA 2OEJA 3AHYA 4K2SA 3MWAA 2WJDA 3M43A 1EJTC 4UFLA 4IG2A 2RDXA 3TAOA 1RQBA 3W28A 3ITYA 5M17A 2WWDA 1X38A 1VC4A 4AIEA 4D6HA 4MJMA 1YDYA 4WSKA 3QH2A 2GUUA 1DXFA 3W1PA 3L4XA 3GW0A 1DHPA 4BK9A 1A0CA 1B57A 1RD5A 1VHNA 3FA5A 1FKXA 1KM6A 1UJPA 1JCJA 4F66A 3N11A 5F4XA 3VE7A 3AXKA 5G2HA 4JTCA 3DX5A 1JDEA 1XL9A 3E2QA 2TRSA 3A5FA 2XM1A 4ZEPA 3VD4A 4LRSA 1AW5A 2I17A 3P62A 1QASA 3NPXA 3B97A 4AC1X 1FWTA 2VZOA 1OGGA 1VRDA 4MG4A 3OA3A 3FW6A 3LMZA 4GQRA 4MDOA 4BF5A 2YW4A 2HJPA 3NPWA 2VUYA 1V3HA 1CXLA 4IQDA 3E02A 2ACRA 4OVXA 4AZ5A 3MP3A 3B9AA 1TWSA 4QEHA 1UWIA 3HPAA 4DHGA 4ZB2A 4DWSD 4Z2LA 1AL8A 4OQVA 3JS3A 1MYRA 3G0XA 3MMUA 1XYFA 2NV9A 1RLDA 2E0PA 2J8TA 4JQAA 4LUTB 4JKLA 4NZCA 1PEZA 1VBRA 4FX6M 4DF1A 1XYAA 3L2LA 4RXFA 2VP8A 3MT1A 1DHKA 4FNQA 5FF2A 2PDWA 1E9ZB 5CZKA 3K2GA 4NZJA 1ICPA 5H6HA 4AWTA 1GZJA 1QHZA 3TAKA 1O66A 4GY0A 2W61A 4LYPA 3AIQA 4IJBA 2DIKA 3LXAA 2PPGA 3VIPA 5K7JA 2EAWA 2VZVA 3W2KA 1KFKA 1YMYA 3IV3A 4BHYA 3VZYA 3AZRA 4NJIA 2WK2A 2HE5A 4HSOA 3W1AA 2VQUA 2NLIA 2Q6ZA 4D2JA 2VEPA 4TTGA 2W63A 3RX4A 4J7RA 4ZODA 2BFGA 4IJCA 1RLCL 2ZE0A 3QQ0A 3SB0A 4LALA 2ISFA 1U83A 1A50A 4HIBA 2ZYFA 4KCWA 1SO4A 3RUBL 2C91A 4ZSUA 1TREA 1Q2RA 2BLEA 3PPHA 1M6JA 1ZNNA 3WIJA 3QRHA 5LIYX 3WNOA 3WF0A 1ZAJA 1TWWA 3KS6A 1SMAA 2TYSA 4GYKA 4DJDD 2J9XA 3B9EA 3IJLA 1R2TA 1V7YA 3QC3A 4KQNA 1P48A 5F2LA 3RU6A 2TODA 2PF0A 3AS1A 4YVXA 1H1YA 1UR0A 4JNMA 2WVVA 3HA1A 4MPKA 4ACYA 3MO4A 1CGTA 4D1JA 3KZSA 4GACA 1TA3A 2EG7A 4UTWA 4AD1A 5XIMA 3WQCA 1ZS2A 5CCZA 7CGTA 3JZEA 1VZWA 3USBA 2J88A 1MQRA 5H91A 5EPDA 4K1WA 3EWYA 3CQHA 3I6EA 4LH8A 2VC6A 3KFTA 3UT0A 1K6WA 4KCVA 1XX1A 3ZJ8A 3N13A 4AC7C 2KX9A 1XDJA 4DNMA 2E7FA 2WHLA 1EF2A 3WLHA 3RNDA 4YTTA 1P0DA 4DLFA 1MUMA 1DOSA 4AAJA 5HNNA 1UC4A 5ABFA 5D37A 4GH3A 3BAKA 2QF7A 2ZXDA 1HGYA 1B0IA 3U5UA 3LEPA 3DOPA 1PTAA 3CEPA 4HSHA 3TXZA 5FJTA 1R6WA 2ODOA 3H4XA 4GQBA 1YRRA 4LTSA 1PZ1A 1VFFA 4FAMA 3TTEA 3FYOA 1OFDA 2A6LA 4AIOA 1TTQA 5J5RA 2OPJA 4E6MA 1J0ZA 4LVDA 4AMAA 1BD0A 2ZZ1A 1DVJA 2PODA 5FEPA 3BCDA 3IVSA 4OJYA 2ZA1A 3TW6A 1DXIA 4WJ8A 2ZZ2A 3GZ3A 4J1OA 3W9ZA 1YDOA 4F9JA 1QW8A 4GZJA 5MKGA 2QMKA 5AHNA 1IGWA 4LY4A 4GISA 1P6WA 1NFBA 3CU2A 5DXYA 1YPXA 2C14A 3DG7A 1FVPA 4HA0A 3OIXA 1HF6A 3V16A 2H90A 1E4IA 3CPRA 4IF2A 1T41A 4MLRA 4M1RA 4WY0F 1G7UA 3MYOA 4L65A 3PNUA 1EYWA 3DYPA 1MWOA 3ONCA 1AK5A 2HRWA 3IJ6A 2XIIA 3ZVHA 2Q8ZA 3NQ6A 3Q37A 1DBTA 4DUVA 1XCFA 5JH1A 3EOUA 3DFQA 3EKZA 3WK0A 5LSMA 3EKLA 4PTDA 1OFEA 1PDYA 5HQEA 1BVWA 1G4PA 1S5WA 3VMPA 3T8LA 4JS3A 1EA9C 2XYLA 3U57A 1GOMA 4RR4A 2BMBA 1HP5A 1EWEA 3FA4A 9RUBA 2WMIB 1XLIA 5JU6A 5ECVA 3W1RA 5C2CA 1XD0A 3BOFA 4LUSB 3PJWA 4ES4A 4UUIA 4DBSA 3EDFA 3T4CA 1CENA 4GYPC 4HHLA 2HXTA 1V3KA 1MNZA 1U5VA 3TROA 1KFEA 1KGXA 4LVAA 1KC7A 1XGDA 2VEGA 3LXBA 4Z0JA 3CM4A 3NL6A 3SCNA 1GWJA 5CAKA 4OECA 3V4BA 3STCA 1B4EA 1W1PA 1V77A 1MFVA 3HF3A 3QHMA 4IGMA 3UPWA 2X2GA 4FOJA 1RVKA 3SGZA 4L5ZA 1O4UA 2FFIA 1EJVC 3IJ7A 1MXGA 1I6NA 1XIHA 2XM2A 4DJEC 2NWSA 1XG4A 3N12A 2VFDA 2WBGA 2FB2A 1W5NA 3UJSA 2QDDA 2QKFA 4AX6A 1UKPA 2RDTA 5DXXA 2WSQA 4AXKA 2Y8VA 3M7WA 4XB3A 2XN0A 1GQJA 1BAGA 3QR0A 2E8ZA 5LIUX 3TYBA 4O1DA 3RXZA 4BWLC 1AW2A 2ZRXA 2J66A 1R87A 1NFPA 4GABA 2Y7EA 2PMQA 4E2DA 5K3VA 4IOTA 1SW7A 2YR1A 3W70A 1UD2A 3PUGA 3BQ6A 2R6OA 1F3XA 1G4SA 3W37A 2W62A 1ISVA 1J96A 4NF7A 5JVLA 2OT0A 5FEWA 3GNPA 1VB9A 2WSPA 4AW7A 3W72A 1OFPA 2XN2A 4L80A 5DCEA 5DT5A 1W56A 4LPCA 3Q4DA 3BICA 4HPHA 3C52A 1IGSA 4MKNA 5LXEA 3IVUA 2L5HA 1OB0A 3SADA 4L4PA 3R94A 2PD9A 5FF7A 3W0KA 5DELA 4HVXA 1BKSA 4MB4A 4LEQA 2ZZ3A 1UZDA 4HNLA 3GH5A 4ZVJA 2PP0A 3N6HA 1EWDA 1IEWA 2PFHA 4Q8OA 5CSSA 4CCCA 3UWYA 2LLEA 2VWTA 1VH7A 3KHDA 4KWUA 4V1YA 3MUZ1 1RJPA 1ISYA 4BZYA 4RE0A 1S5TA 3KBWA 5LHEA 2PWFA 1P7TA 3SM0A 4I7UA 1FCVA 1JF5A 1SFTA 2A3CA 1GVYA 2VI0A 1PKLA 1C8YA 1ONWA 1B3VA 1KTCA 2NLYA 2XFRA 3PUOA 4ZE4A 4N2YA 4JTHA 3WUFA 1ADDA 1HJSA 1EXBA 3L4WA 2QJMA 4JN7A 2OO6A 1Q7ZA 1S1PA 3QVQA 1RCXB 2DZTA 4M5PA 4GKTA 4UMAA 2ZICA 2Z26A 1TR9A 3OZOA 3HM7A 4DYJA 4GXWA 4KCTA 5HJLA 2CKSA 4UMCA 2VDHA 3PTKA 2CERA 3REQA 5I07A 2VD9A 3V1HA 1YQ2A 3VTRA 3A4AA 4X2PA 3QXBA 3U2OA 1VEMA 4HA1A 3VABA 1F8IA 1MQQA 3C2YA 1T96A 4WX2A 2WBKA 5LZLA 1R9ZA 1L8PA 1DJGA 4K37A 4EIVA 2CYGA 1HJXA 1PX8A 1WDPA 2XISA 4PCFA 3VFCA 3S5NA 1XFCA 1C9WA 3VNZA 3WBWA 1NELA 3AJXA 2B4GA 3NCOA 4GG9A 3N9SA 1W1VA 4Z08A 1O5KA 1AMYA 2ISWA 4O4VA 3AUJA 3UZWA 3B0UX 3THDA 3NL2A 4UTMA 5E0FA 3VKBA 2VT0A 1BF2A 4ACZA 1SVDA 1TPDA 1Q85A 1VYPX 1OY0A 1FHDA 5KMYA 1OADA 1VLWA 4D6GA 1E71M 2XH7A 4LRTA 5HINA 3UGVA 2O9OA 3G5EA 1XGZA 5XIAA 4TR9A 3M0JA 3P74A 1DQUA 3M9YA 4FPSA 5LGXA 2W3ZA 5B7YA 1OGSA 2Z27A 3OG3A 3CV1A 1U1HA 4FF7A 4DRSA 1WZMA 1T6MA 4OFCA 3ITGA 1OGBA 4AEFA 1DYSA 1W3JA 2D20A 2VMFA 4DWDA 5AZ0A 3EOSA 4O1CA 3NGJA 3TYAA 3N17A 4UTJA 1FWWA 3S1UA 3VOCA 4EXQA 4WK9A 4ATDA 3HV9A 4OU1A 3NO3A 1TSIA 3AIWA 1Z42A 1KRAC 5L6UA 2Z28A 5FF3A 5FL0A 3MYPA 3UR5A 2WB5A 1YNPA 4I6VA 3CS2A 1FWSA 3R0DA 4LUTA 1ONXA 3ZM8A 2Z4GA 2PAJA 1JXJA 1DKWA 4W86A 4FNTA 3M1ZA 3GHUA 4FOUA 3OLEA 4Q4SA 5HAOA 5I24A 4NZ4A 1TE6A 2VUNA 1SJAA 4WDUA 3PTDA 1CGXA 1EFZA 3R8RA 2QDGA 1V08A 5HR7A 4J3UA 2FZ8A 3LA4A 2VFIA 3EDKA 1KCLA 1LBFA 3QHOA 2PS2A 2ALRA 4HK6A 3PWGA 1IXPA 1KB3A 3TW9A 4K36A 2Q3OA 2FPYA 3CASA 3CQ0A 4L1XA 3EOOA 4XO6A 4LAMA 7ENLA 3HGRA 3HJEA 4H6QA 3IJDA 5DANA 3G6MA 3WQFA 1DIDA 3ZT6A 2DDXA 1UKOA 1XLLA 4S1FA 3Q45A 3AS2A 1PX3A 1VLIA 6TAAA 3PP7A 5G4EA 1JF6A 3A9IA 3ARZA 4GD0A 2Q8LA 4ZCWA 2VR4A 1DWIM 3CNYA 4HN8A 4LSBA 3GVWA 3TZFA 3ES8A 3VX0A 3LI0A 2OKOA 1IZKA 1W3IA 3QY8A 3AMDA 3H2OA 4BFAA 3W1UA 2ZZ4A 1CLXA 3SY5A 2Y88A 3QFEA 2VX6A 4QG8A 3RJYA 4CD5A 4J35A 1QI2A 4F40A 3WDIA 4FXSA 2G96A 4NX5A 4F4RA 5IRPA 5F2GA 1SFSA 3DI1A 5AHIA 1UR3M 4MB1A 1W8GA 1Q63A 3PJTA 3NZPA 4PRWA 5IOBA 1HW6A 5HUPA 5PTDA 3BLPX 3W29A 4UQAA 5A6KA 4YVVA 3TJIA 2WNWA 2Y62A 1W9DM 1XKJA 4M8UA 4JKKA 2FZDA 1FWEC 3VI2A 4R7WA 3STFA 1FWCC 2J7FA 3WMLA 2J74A 4PUUA 4YWSA 3ABZA 3PWAA 4V28A 1CXFA 3E38A 4XBSA 3EX1A 4FALA 2WZHA 1PPIA 2PDQA 1QK0A 4MPQA 1Q6RA 3WDQA 4DO6A 4WEVX 1TMHA 4PMYA 1XLGA 3HBLA 1SO5A 1NAL1 5G2IA 3NEHA 3O6DA 3W7GA 3VIFA 3CXOA 1B31A 4MB5A 3FIGA 9XIAA 3E6EA 1S38A 1M53A 3AJ7A 1M68A 4JNYA 3LPGA 2PDGA 5I0DA 3WG6A 2H6RA 4XD5A 2VDGA 2ZWZA 3MZNA 3R0UA 4IMCA 3H26A 4JTUA 4X2RA 4AG0A 3WQGA 2PD5A 2NV2A 4B2DD 3NZGA 3S2JA 5I00A 1CLVA 1Y8BA 4OBRA 3EZ4A 2ZXAA 4EACA 3WF3A 2OMAA 1YTDA 1SM9A 5T91A 4LC8A 2OLAA 3IANA 2XH4A 3EB2A 1GPFA 3M0MA 4GYFA 1KRCC 5T8GA 3MUAA 4F3HA 2G37A 1EOMA 2DJLA 3TYZA 4HNOA 3BGAA 1ISWA 2HDJA 4ATLA 4PTMA 4GK8A 1EIXA 4JYFA 2J9ZA 4QIUA 1F76A 3ITVA 1QPOA 3KTXA 5FF0A 2EKGA 2JGQA 3L4VA 1HUVA 2CLLA 5JH2A 3QR1A 1HQTA 4MWAD 4B90A 2E25A 2WLYA 2WMIA 1ZFJA 2Z1KA 3WLLA 4GVHA 4O1BA 2DVXA 2EPMX 4CEUC 3PBMA 1P1MA 1JCTA 3R8GA 4LUSA 3PJXA 2I14A 1NOUA 4REQB 2VXNA 3GNNA 1O95A 4Q4KA 2XSBA 4XKYB 3OGVA 3AISA 5KZEA 7XIMA 2CC0A 2DGAA 2UV8G 1XYBA 3HU7A 4J3WA 3LGGA 2UY2A 2PDCA 3WF4A 5A8GA 4MNLA 1VPXA 1VF8A 4XAYA 3UG8A 3CV2A 3U3HA 2E9MA 3KX6A 4UCGA 1WKYA 4O8AA 4E3VA 1LL6A 3PK7A 2C13A 1VEPA 4Q7IA 4ZOEA 2I9EA 4EVZA 3UXDA 4GZ7A 3UA4A 3I3BA 2BHYA 4NKCA 3EA1A 3E0FA 2ACQA 4M0XA 4CNPA 1QBBA 1FKWA 3MVTA 2QV4A 3R43A 4NILA 2EPKX 1H63A 1HTIA 2A3LA 2PRMA 4UOZA 4ZO6A 4AHOA 4AZIA 2R1LA 4GKLA 1B3YA 4ZQCA 3TTOA 2X7WA 4Q6JA 1E55A 1XSJA 1V02A 3FYYA 2KAUC 1X8CA 3VPLA 3FS2A 4ZTYA 2DZSA 1Q45A 4L9YA 1UWUA 2WKGA 5REQB 1B2YA 3AIUA 3B40A 4GNKB 1C9DA 2RDWA 1FCQA 1W5OA 2D0FA 3T0TA 4PCTA 4AF0A 1L6YA 3HPZA 3E1F1 3UY8A 2AKMA 1E0UA 2J7GA 3O2LA 3B8SA 1VFTA 4QBXA 2QCCA 1BXCA 2RHGA 2Z6JA 3VIHA 3EB4A 2VEMA 4L9ZA 2QUMA 5FEZA 4ICMA 4L7ZA 1XISA 2Y61A 5ECUA 2NXGA 1UZ4A 1PKMA 2FVKA 3BW4A 4CQ9A 4FIRA 1WAWA 1VGAA 2GGGA 3BDKA 4H9TA 4IFOA 3WY1A 3T55A 1JR1A 3UZXA 3WJWA 1AZ1A 1SZRA 2V63A 2XUCA 2E67A 1I0DA 3B8DA 4GYJA 2QV5A 3SRDA 3PZTA 3CBWA 1P0NA 2IPGA 3W71A 3M46A 3WD3A 1QPNA 3RX3A 1LORA 3WX7A 4BF7A 3S5SA 1MNSA 3DC0A 3H8AA 3NQ2A 1W1A1 1WUEA 1G94A 1GUVA 4YU1A 3IACA 1HIZA 3BMWA 2QUTA 1J0JA 2V5CA 5EYWA 2A6NA 3HV8A 2ZUTA 2WMFA 1PCWA 4AZGA 1Q65A 4AYSA 4X0NA 2QXWA 3QZ6A 2P88A 2XPKA 5C7VA 3W07A 2PRLA 4JX5A 4PTVA 1POKA 3ZR5A 4L9XA 3VGFA 4GUHA 3EOEA 5AECA 4UTWC 1RBAA 4HHHA 1QBAA 1JZ8A 3WD1A 1V51A 4HGXA 1GZ1A 1QI3A 2XDFA 1WO2A 1J2WA 2G4JA 2X16A 2CXGA 3B8UA 3CUJA 5CBJA 3TLQA 4HCHA 3O6AA 2WPBA 1E72M 5T26A 1S1RA 1TV7A 1JCXA 2PWEA 3ERPA 2HS8A 4IIEA 1KKRA 2Y0FA 4J3TA 1EQCA 1XQLA 3NQMA 1E6XM 1GOWA 4ZOAA 2J25A 3WFLA 4E38A 3LLFA 1FQ0A 4LAOA 1MW2A 4LQ1A 3NL3A 3TA6A 4W8AA 5E70A 3KZPA 4AXNA 3RMEA 4CQCA 4PEKA 2WHJA 1BWLA 2Z2UA 1R2RA 1PAMA 1Z69A 4ZQMA 1XRFA 1Q6OA 3I3EA 3A13A 4OZOA 3ATYA 4KH2A 1EHAA 3OLGA 4A29A 3WDHA 1HKWA 4AEEA 4G5DA 1JRCA 5G5IA 3C8FA 3W2JA 3B0PA 1C29A 3BLFA 1U33A 3RU8X 3NDOA 3CB3A 2VZUA 4RNIA 2D24A 2VJXA 3ELFA 4GNVA 1EJ7L 2C71A 2IKGA 4A3QA 3C3UA 1IWAA 3WF1A 4IWWA 1W54A 3GKAA 1VIWA 2FHCA 3Q67A 4MMWA 4JFTA 1V02E 1MXDA 2IMRA 4PBEA 3TMQA 3TMLA 4ML9A 5A95A 1R86A 3ABOA 2OWXA 2YB1A 5CSYA 2JQXA 3BOXA 3LERA 3S2LA 3VDHA 2DORA 3U4FA 3D6NA 1JCMP 3EMCA 4AYGA 1VENA 4UB9A 3KS5A 2BNJA 3QYQA 4JN8A 3AU2A 1JZ2A 1TPEA 3T0CA 4NJGA 1PWLA 5FJPA 1K8CA 4UWMA 2Z6IA 4WIWA 2CHOA 3H54A 3GXTA 3AXMA 4FEZA 3PR2A 5H8UA 3NAVA 1UCWA 2P76A 3D0CA 3WDRA 1B5TA 1F7BA 4S3CA 3GC2A 1TZ7A 3M0HA 1SZEA 3AU6A 3L4UA 3BAWA 1YNYA 2HZGA 3F4DA 3QPZA 1XF0A 4M81A 3BAIA 1VCFA 4WXZA 4XD3A 1VD6A 3IRDA 2ZC1A 4NYUA 5EL1A 2FZBA 1B54A 3I4EA 5BMXA 3N9RA 3T6CA 1PS9A 1XG3A 4WOZA 4IPPA 2X40A 4NRRA 3RYSA 4DWSA 3ATZA 3B3DA 2QAPA 5CPNA 3VIMA 1QW9A 4M6QA 5C70A 4ZSTA 4EK7A 2PZNA 3SAZA 3QW4B 1QI5A 2VC7A 1US3A 4GJ1A 2QUVA 1KWGA 4POCA 2PI6A 1JQVA 5HDRA 4MNJA 1A5BA 4I9TA 2F8QA 1EGZA 3CV6A 3W02A 1I1XA 4XUYA 2ZUSA 4HK5A 1TJPA 4ZB0A 4J3ZA 1KXHA 4KT2A 3E3HA 4P7NA 1I0BA 4TMBA 3GNOA 3BSHA 4O50A 4JL1A 1FDYA 2QJIA 3AQUA 2V38A 2X1IA 4G7EB 5HOSA 3BSGA 3TC6A 5HMFA 4TO8A 3W1NA 2QVHA 4DBDA 5GJPA 2J75A 3WLPA 3LBCA 3OBAA 2PLJA 3SY1A 4NNBA 4GZEA 2OZ8A 1VCVA 1NY1A 5A8PA 5KINA 4H8HA 3BLEA 4QEEA 3M07A 1JDCA 3VKAA 2JALA 4O18A 1UA7A 4K8HA 1KCZA 5E6YA 1L2UA 2EGZA 2EQDA 2F2KA 1GW1A 2YL5A 3F4CA 3GDMA 1KQYA 4HNCA 3BL3A 6ALDA 2IPWA 4C6NA 2C0HA 3QV7A 4O17A 3WDPP 3DKLA 1IT8A 3E5PA 1Q4NX 1UG6A 4YLWA 3F7JA 1VFSA 3LHUA 4RPQA 2XIJA 3WH9A 4UZSA 3NPVA 3UBPC 5EKYA 2WSRA 3D5HA 1GVFA 3UG5A 4EPDC 3LDVA 1CB7B 1UOKA 3GXFA 1MSSA 1RP8A 1LOLA 3RLHA 2GUBA 3W7DA 4D8ZA 5CJMA 3VNKA 2UBPC 3R25A 5A69A 5M5DA 3PC0A 2WSYA 3V3WA 1VAHA 1ODUA 4NZ5A 3MMDA 4JDBA 1EEPA 4RCXA 5A8NA 1WZAA 4XX6A 3B06A 4GI8A 3ZFHA 4C6QA 2XIOA 2YYUA 3FHQA 3K13A 2WMHA 2GQ9A 2PGEA 3AI0A 1EC9A 1KFBA 2D0GA 2QCHA 5EMUA 1GJWA 3QN3A 3SCPA 2TAAA 1XS2A 1NSJA 2WYSA 3HG2A 5T9CE 1OC6A 1A5CA 4XBJA 1RA0A 1HKVA 3OVQA 4DBEA 1OD8A 3DHDA 1V7AA 1K9FA 3LG3A 4LJ3A 3AWOA 4UTIA 1JGIA 3AIRA 4W7UA 3O0KA 4IIGA 2VEFA 5A5WA 3W4RA 1XXXA 1AVAA 5AVNA 2GDVA 3EXRA 3KWXA 1ZU8A 2Y85A 1W31A 2R8WA 2PTZA 3VGBA 3EYPA 2NQJA 1W3LA 5JIWA 3G24A 2HISA 1IQ8A 3CH9A 1W91A 1BXNA 4R53A 4PGLA 3R12A 2PP3A 3M47A 3L66A 1D2KA 4QRNA 3GU1A 3N2MA 4LVBA 4ICNA 3WH7A 1XD1A 2PDJA 3UERA 4KPLA 2ABBA 3EPOA 3BW2A 1HP4A 4Z2KA 2GOKA 2V6AA 1JJKA 3RR4A 2BODX 2JKEA 1LQAA 5DMMA 3TCSA 1N8FA 4D6IA 3RCMA 3PF3A 1PZ3A 3L2MA 4GO8A 4GY7A 2ZE3A 1Y7VA 3W01A 1JFXA 3G3MA 3L0NA 4REQA 1R3YA 3GXIA 3G8EA 1KD0A 1IEXA 2ATSA 4JDYA 4LEFA 3S9YA 1H7WA 5C0QA 1U22A 1XIMA 5AZ1A 4BQ4A 1XLEA 1JD9A 4M24A 1PXGA 1JAKA 3P80A 3GYCA 4M51A 4W84A 3GW3A 2YIHA 5C8BB 3W22A 1VJZA 4LBRA 1TCMA 2VOMA 3WYZA 3TP4A 1IE7C 4JY8A 3LZ3A 1H60A 4J2MA 2GPTA 1POJA 4AIBA 3S8HA 4RDVA 1AMKA 3HGJA 4Y6GA 3UG4A 3EDEA 2NUWA 3H2NA 3R79A 4D8AA 4RNHA 2Y70A 5CG7A 5EA9A 4TIMA 1AJ2A 4W89A 1OD0A 4CLMA 1J11A 2Y8KA 2JKPA 2E1WA 4ZOCA 3VKCA 5I3FA 2DEPA 3WQOA 3S1GA 1TWZA 1ZENA 4C60A 3FA3A 1K8YA 4L64A 3RR1A 3TTQA 3EPNA 3UZZA 2DUAA 4Y96A 2EG8A 4QM1A 5REQA 3VCRA 3TEVA 3UZJA 3TW7A 4L61A 3TQPA 3IJ8A 4GXPA 3S1XA 1ZAHA 2YYTA 2XJ7A 5XINA 1QJWA 2AL1A 3KVJA 4YN5A 5HWJA 4A3RA 2IW0A 3STEA 3GX9A 2ZWYA 2IKHA 1KM2A 2VEIA 1V0LA 1GQNA 3D46A 1XGEA 2J77A 4RZ6A 5FF4A 4OGZA 3M0IA 3QGKC 4JIEA 1F05A 5JXQA 1X1OA 4MY1A 1ZJIA 3R4IA 2ZBTA 1JL8A 1XW8A 4LVGA 2NSOA 4MKSA 2R9RA 3W7LA 3SQMA 1JNEA 3W75A 4NAFA 4O14A 1Q4WA 4GI4A 4S3JA 4D71A 3L5MA 1P43A 2V3DA 3VKDA 3DUGA 1L6GA 2OSWA 1A5AA 1J0IA 4U10A 2VVNA 1C8QA 4QDWA 4FK9A 4UNLA 1D7KA 2BOFX 2J7DA 3GNXA 1QO5A 4OIFA 5DEZA 1KO0A 2ZX5A 3VOFA 2BOEX 4CD7A 1EPXA 4GE8A 1NF7A 1CI1A 3C86A 2BY2A 2WZEA 1R85A 1WDRA 4UQEA 2XN1A 3OQ8A 4D8LA 4HPXA 3VGEA 1O1HA 2GVJA 4TUFA 3N2TA 4K7VA 3EWXA 3IK2A 2FJKA 3WLRA 4FF5A 5CZJA 3IUDA 1XRTA 3W88A 3FOKA 3TNOA 4WGHA 4NIRA 2QDHA 5LNVA 3WJZA 3VILA 4AQLA 5E0KA 1MO0A 3HOJA 1LRTA 2O9RA 4H2CA 3SUWA 1V8EA 4J3VA 1I1WA 1H62A 1RQEA 2VCBA 1JYVA 1IT0A 3DESA 3TYDA 3DGRA 2X7VA 3C2OA 4CU8A 3T0AA 3H23A 3W7QA 4U5IA 3LLDA 1Q6EA 3C2RA 1QPRA 4IT1A 1VBUA 1FP9A 3T8QA 5D04C 1EXPA 3SCTA 1GG1A 1JPMA 1RBLA 2AOSA 4K8GA 3VM7A 2B81A 3BGGA 1CZ1A 3IAQA 4RK8A 4JFVA 2XTKA 3NTYA 4Q8QA 3CH0A 1D3GA 1JXKA 2J9YA 3NQ7A 3N3TA 3EWCA 2QJJA 3GVQA 2IXUA 3OQEA 3LGDA 1KM1A 4LS0A 2REQB 1A5LC 3G0SA 1TKKA 4Q22A 4LXFA 4ATWA 1M1BA 5IHSA 4EXAA 3EX6A 1QO2A 1KKOA 4E4PA 1FFQA 3TONA 4LB4A 3WNKA 1EUNA 4LS1A 1MVYA 3CUHA 3UA3A 4IGNA 3SJNA 1JDFA 1E9YB 3LMYA 3LBOA 3IRSA 2JF6A 1KR0A 1AA1B 1A3HA 8RUCA 4GC4A 4PUWA 1BYAA 4JPGA 1ITXA 2UY5A 3S9IA 4OBTA 3IIVA 1OHLA 3VDGA 2NUYA 1EX5A 3WH6A 1CWYA 2W9MA 2EKCA 1D8WA 5KSWA 3LN3A 4W7WA 4KWOA 4QJ5B 4QX4A 2FVMA 5HPCA 1J18A 5FOOA 3PHAA 1WOBA 1R3SA 1W9BM 3NNTA 1PDZA 4YMZA 4DF2A 5I78A 4IMDA 3WD2A 3P2VA 3SN1A 1XPYA 2DQWA 2WKJA 3E49A 1YLVA 3DIPA 2OELA 5I6SA 3WL1A 4UFIA 2J13A 3HO8A 4Q32A 1IF2A 2GUYA 3D47A 1S2UA 3ANYA 3R11A 3LSCA 1EHNA 2PDFA 4NI3A 4WCJA 3V5CA 3VAVA 2UZ9A 1WOAA 3WMBA 3T2OA 1V93A 3G6LA 2WQPA 1TJ0A 1QK2A 1EZ2A 2E6DA 5FIPA 4UTTA 5KTLA 3UJEA 1B3OA 3QV6A 5I09A 4V1XA 1F61A 1F4HA 5HNUA 1O5RA 4ZBCA 4GIEA 3RLUA 4C1NA 2ZIDA 1ZP4A 1F6PA 3QV9A 1BGGA 1OCJA 2XU2A 3DAQA 2CLHA 2ZUUA 2AL2B 3L12A 2OEMA 3GFZA 5D8WA 4S2BA 3W1XA 4G7EA 1NFGA 1Q6GA 2DQXA 4L4OA 1BPLB 1GT8A 5FL1A 4ZO8A 1DQXA 2WC3A 2Z1VA 5TF0A 3HMJG 3LQLA 4PCNA 3CO4A 1UMLA 3POHA 4FNRA 1XM3A 1GCYA 1GQLA 1K03A 1OK4A 1H7OA 2ZKMX 1R47A 2WHMA 2QPXA 1FH7A 3L2IA 1J9YA 4GH1A 4CNTA 2BVWA 1UWQA 4UOQA 1EZWA 2WSKA 3FK4A 1T8QA 2ZDSA 4U31A 3I68A 4PUKA 3QTGA 1X96A 1E6QM 2QT3A 1MW0A 1XJBA 3H22A 3KL3A 4AHQA 4CN4A 4QLJA 4H1ZA 5E6ZA 4IX2A 2DZAA 3LCFA 1K8XA 4PL2A 4NRSA 4KIRA 2ASHA 2ACUA 3SCWA 3WK3A 4Z17A 4RDZA 3HG4A 1EPVA 4RE2A 1K4HA 2FZNA 2FHBA 2V3EA 1QOPA 1V6VA 4WGXA 4U33A 1XIGA 2B7PA 5C2GA 2QLYA 5C71A 3O9NA 2Q09A 1I60A 1B9ZA 3FAWA 4PC8A 3KDOA 1R7AA 3GAYA 1EO7A 4JTLA 3VE9A 3LHVA 1BVZA 1V6WA 4WSHA 4MJZA 3KW3A 1EUAA 1QT1A 1KM0A 3CWNA 1OF8A 3O07A 4IMGA 4L6OA 1OK6A 4HJFA 2HVMA 4HA4A 1E70M 3B04A 3VIJA 1QRQA 4JFWA 5MHBA 2Q02A 1KLZA 4DO4A 1TPWA 3V0TA 1SFLA 3N2CA 1YXCA 4GUJA 1ITCA 5I3KA 2F6XA 3UWZA 2Y7GA 3CWOX 3TNBA 1C93A 2C8NA 1PO9A 2OYLA 3PWIA 4O16A 1KBJA 2HBXA 4NJJA 4Q33A 4ZQPA 1NOFA 2CZVA 1EBHA 4PTWA 4H19A 4GQGA 3SFWA 4B2DA 4KIEA 4LAKA 4H7CA 5FEXA 4W5ZA 4AB4A 4HPGA 3CPGA 3CJPA 4Y8EA 4X63A 4A3YA 3C6CA 3T1GA 4BEQA 3BZJA 2QJHA 4PUMA 3DH7A 4LAUA 5D2XA 2X2YA 2ANUA 3LY0A 4W93A 3ZT7A 3KOFA 1VIZA 2G8ZA 2OXNA 1HT6A 3LCHA 3URNA 2DT1A 1UWTA 3C2VA 4WJXA 1UWSA 1O5XA 4ILSA 4NXSA 3VIIA 5KZ6A 1YXYA 1HXJA 3ZXWA 3SCSA 1H7RA 2QNEA 4DXXA 1TRDA 2I7GA 4N0RA 4JTRA 4MWAA 3RAOA 4AY8A 4TX8A 2Q01A 3OVPA 3ONBA 3BV4A 2VENA 3LHYA 4P8VA 4BEUA 5I3GA 2CHRA 4KFOA 3JR2A 3NZ1A 1ZBVA 3N34A 3BG3A 2WXDM 4NZFA 4GVFA 1F3EA 2J6XA 2IS7A 3KP1A 4C7FA 4L1WA 4WJEA 3M41A 1A3WA 1FX6A 1UOZA 1AH0A 4BQ2A 1VPQA 3CWHA 3WH8A 3AIEA 4GJJA 2C1IA 4TVUA 2F2HA 4B5SA 4IHCA 3VGHA 1VQTA 2B7OA 4IPJA 1QAPA 2BY3A 5BMWA 3LB0A 1E0TA 2QCDA 1J8VA 5A6LA 1REQA 2A7PA 2F6KA 1G01A 1OCBA 4JTEA 4ICCX 1MI3A 2RJGA 3M5XA 5EMMA 4ZENA 1C90A 4K39A 4WUIA 3LNPA 1F3WA 3FKRA 1EJUC 4U4MA 3B4UA 1PE1A 4QFUA 3NM3A 3DFSA 3GHRA 3B8TA 4H8UA 1SMDA 3CL8A 4NXKA 4PRRA 3U4AA 4XIMA 1BTCA 4AEOA 4BI5A 3M0ZA 4BQ3A 4DWSC 4B16A 5G1TA 3DCPA 4BKNA 2WNQA 5I5RA 1CXIA 1DORA 5M3WA 1GVSA 1DIOA 2AAAA 1UWRA 3MB9A 1U5HA 3VUPA 4QE1A 1N2VA 1QWKA 7A3HA 1XCWA 2A85A 3HG3A 3MKCA 5K9CA 4I9MA 3POCA 4Z2GA 5BCAA 3RK8A 3MI3A 3WMCA 1R46A 3NG3A 4NP7A 3UFYA 1E1FA 1Q3NA 1TQJA 2ZA3A 5C9WA 4JHOA 3L0KA 1QU4A 3LNMA 3H4GA 4XBKA 2J7HA 1TJRA 2NVDA 1NTHA 2EG6A 3H24A 4B5TA 2YZ5A 1DWJM 3WEOA 4HT3A 2DUXA 3FJ6A 1YNQA 3AIVA 1D8CA 2ISDA 4EP8C 1OX4A 1RBOB 1JZ4A 4DXVA 3L21A 3OPSA 4HYRA 2X1SA 2JIEA 3LU2A 4GRSA 4DUOA 3N4AA 2YZRA 4WQ6A 4TXEA 4PB3A 3W74A 3C4UA 3G1YA 3GBEA 4KEZA 3KL0A 1TMQA 5C5YA 2ALDA 3R89A 5HATA 1TPFA 2PWVA 5AYIA 4V33A 3VOJA 4DJDC 3MCMA 1BWKA 3IIPA 4FX7A 3RG6A 2YA2A 3CZLA 3OJGA 1MZHA 2PBOA 3GVGA 3MSRA 3QMTA 1EP1A 1QNPA 3P81A 2R1PA 3WLSA 4EPEC 3WQEA 1JULA 3LTPA 2VGIA 5CC5A 2GWGA 3BG5A 4AZ6A 1GKQA 1V6TA 5DLCA 3PFRA 1LWIA 4PRTA 2D2GA 2GDQA 3EXTA 3V36A 3ZR4A 4QG6A 3QFWA 2P3ZA 4MWAE 2DSUA 3P8IA 1XLFA 2D2HA 8TIMA 3VIKA 3N19B 1L2QA 4RXGA 4AU0A 5G1MA 4F9DA 1GHSA 3DZ1A 3W2NA 5LNSA 3TJLA 2CXEA 3UXAA 2OX4A 4N6FA 2GSJA 3ARYA 4BQ5A 3OP2A 1WZLA 4GZIA 5A8OA 4XSMA 4S3BA 2BG5A 3LCXA 3S2MA 5AHLA 2F7FA 3CT2A 2ATMA 1UPPA 4S3FA 3UXIA 4DYEA 3UCDA 2DZUA 1J79A 4G7FA 1LBMA 3K1DA 4NNCA 3OGSA 4OE7A 1US2A 4IXXA 5I3IA 3FNDA 4RPPA 4N9DA 3A6OA 1PTGA 1LWJA 4GIYA 2E5BA 2CBJA 3TE9A 5DT7A 1XPGA 1BKHA 3RMJA 4IL2A 4AZCB 2O9PA 1JYWA 3U9IA 3N04A 1FWRA 3TDFA 4PB4A 4P8WA 3LTSA 2GVGA 3PN8A 3A4WA 1EH9A 5ABGA 5CKSA 3SI9A 1B3XA 3VZXA 4E2VA 4M1BA 2NT1A 4C6IA 1N55A 3PZIA 2QYGA 3CLMA 1XWYA 1Z89A 3M0KA 4AVOA 1OIFA 3HN3A 1PTDA 4OUIA 2WHKA 4MOZA 3NSMA