3R8RA

Transaldolase from bacillus subtilis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
212
structure length
212
Chain Sequence
b'MLFFVDTANIDEIREANELGILAGVTTNPSLVAKEANVSFHDRLREITDVVKGSVSAEVISLKAEEMIEEGKELAKIAPNITVKIPMTSDGLKAVRALTDLGIKTNVTLIFNANQALLAARAGATYVSPFLGRLDDIGHNGLDLISEVKQIFDIHGLDTQIIAASIRHPQHVTEAALRGAHIGTMPLKVIHALTKHPLTDKGIEQFLADWNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transaldolase
publication title Conservation of structure and mechanism within the transaldolase enzyme family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 75
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, P, R, T, U, V, W
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3r8rA00
5DBTA 3MBDA 4PTNA 4MIMA 4O13A 4M6QA 3TH6A 4UFHA 2ISWA 2A7PA 4RCXA 3O05A 3W1MA 1XCFA 2CLKA 1AL8A 1LOLA 3W7IA 1ME7A 3A5FA 4UTHA 2Q3OA 5KZMA 4N6FA 5G2WA 4CCCA 4DF1A 1FDYA 4K36A 2X1UA 4DF0A 3LCXA 3STGA 5I3FA 1JQVA 5KITA 1SPQA 5K9DA 1QPOA 4YL2A 1SQ7A 4BI5A 1VC4A 4O17A 5IBXC 1JVNA 4LS2A 2E6YA 2V81A 4NJIA 1FCVA 2RDTA 5D37A 1H1ZA 4BI7A 2J88A 1MSSA 3NQDA 4BK9A 1FWWA 3LHVA 4O16A 2Y61A 1FWSA 2B7NA 4FEZA 2WO5A 3GR7A 3TJXA 4GWEA 2C13A 3GXTA 1EB3A 1WV2A 5G1TA 3UWYA 3C2EA 3P81A 5FEZA 3SSJA 1Q45A 4MY9A 1OK6A 4CCDA 1MEIA 1FX6A 1HO4A 5BNKA 4DPPA 3QF0A 3DFTA 4DPQA 3I7SA 2V2DA 3HGOA 2Q8LA 2OCZA 1TTQA 1VLWA 3B0UX 2VFEA 4UXDA 4AWTA 1KM6A 3LCFA 4NJKA 4CQ9A 4LU0A 2EF9A 3CHVA 3IVUA 4IX2A 1TPEA 1R46A 1FXPA 4O1CA 5K2ZA 3DKJA 5D38A 4HT3A 1WAUA 1TMHA 2A7RA 4AEOA 3W22A 4GUIA 5FF4A 2AQWA 4ORMA 4UMAA 3KVLA 3NQAA 1XBYA 4OE7A 1LCOA 3W70A 3LOTA 3GIYA 1FBAA 1SW0A 4KFNA 5F2IA 4DBEA 1R2TA 4R7JA 3LX9A 1FXQA 1Z41A 1O60A 4FXSA 1O4UA 1J4EA 5K4XA 3GLCA 4PCFA 5DN1A 3NQCA 4O4WA 5D30A 1S5VA 5CPLA 1W56A 4LUJA 4LS1A 1XC4A 2Z2UA 1VYSX 3O16A 1I2NA 1WDWA 1YLVA 5E0KA 3IIPA 3FS2A 5DXXA 2Q8ZA 4WXZA 4NJHA 3B4UA 2FB2A 4I7VA 3TC7A 4CNPA 1GWJA 1TPDA 3AO0A 5K9CA 5AFDA 1RVGA 1LP6A 1R47A 4WX2A 1Z42A 2ABBA 3GAKA 4UFIA 1JRCA 2ZRXA 4JDYA 5F4XA 4JN6A 4G1KA 4OGZA 3TKFA 2DORA 3A9IA 2J9ZA 3GDKA 1KM0A 2NX1A 3HF3A 2TMDA 2H6RA 2Z1BA 2ATSA 2OX1A 2YPIA 3VE7A 5I3GA 2CLFA 2I14A 4MYAA 5CPNA 1Q3NA 3GKAA 4N02A 3EWUA 1HTIA 1MEWA 4RKAA 3PC0A 4M7TA 5DLCA 1TYGA 5DBUA 1A53A 2FLIA 4HHPA 2QKFA 4JTUA 2YW3A 5C55A 3LV5A 3LGEA 4JYDA 2QDHA 5AHIA 4BWLC 2NXGA 3UWVA 3EEGA 3K30A 4ADSA 4IX0A 1LDCA 1TPWA 2C3ZA 4TU1A 5LSMA 3CIXA 3UY7A 2W6RA 2YDAA 1BEUA 3STCA 3UPBA 2DZSA 2VXNA 4PC8A 3FYPA 4UTIA 2BTMA 2E5BA 1ZJIA 3DFSA 1KFJA 1Q6OA 3QMRA 1NSJA 3NXFA 3S1XA 4KFOA 4WOZA 1AL7A 4PODA 2DZWA 3MI6A 4L4LA 1KFEA 5E1QA 3S8HA 3TCEA 1JQXA 3CWOX 1GVOA 1J5TA 3BO9A 4IPJA 4ZL1A 3CU2A 4UTKA 2G96A 4A21A 2WSQA 1F5ZA 1OYBA 1SZNA 3B04A 3O1NA 4QAIA 3BPWA 1W3TA 2DZTA 1UCWA 3S0CA 1A50A 1EWDA 3B03A 2ZRYA 2NWRA 5AYYA 5CZSA 3EKZA 3SJ3A 1EUNA 3IEBA 3KAOA 3HGSA 3JRKA 3SGZA 1JCMP 3IGXA 4UTUA 2V9DA 1XBZA 5CZTA 2E68A 4K38A 1KBIA 1KW1A 3PF3A 2QCDA 3IGUA 1GVQA 3ZWSA 1DV7A 1HUVA 3EXTA 4NVTA 3S9YA 4JNMA 3BV4A 1MXSA 3HG4A 4QITA 1Q6QA 3R13A 3PB0A 2EPHA 1AW1A 3UXAA 4XTIA 2CWNA 4GUFA 2P10A 1FWRA 3TNOA 1SZGA 3NQMA 1HO1A 3W7DA 1H7NA 3UWZA 3GKFA 2AGKA 3O07A 5EYWA 2ZDRA 2YW4A 4ZQRA 2VEPA 4Y8FA 1SW7A 2QCHA 3PS7A 1A5AA 2QCNA 3PWAA 3EX2A 4O10A 3PUOA 3L21A 3N2MA 3PBWA 4ZQNA 4S2CA 4JXCA 1IXOA 2EKCA 4Z0SA 1G7UA 3G3DA 1W8SA 1ZFJA 1KM1A 4WUIA 3NR0A 4L4MA 4LUIA 3QYQA 4Z1AA 3LCIA 1XBVA 1IXNA 4FO4A 1G69A 1W5PA 2BX7A 3L0GA 3QSTA 4QM1A 3W7CA 1TQJA 4MZ8A 5AHNA 2R91A 1ICPA 1JCJA 2QCFA 3TAKA 1UUMA 3DZ1A 2PC4A 3ATZA 4BFAA 1I2RA 1I2OA 3C4UA 2XFWA 3TQKA 3ZS4A 4LC6A 4IMEA 4JTJA 3LBCA 1SSGA 1PVNA 1T96A 1FDZA 1YTEA 2YX0A 1OYCA 3L67A 5BMWA 4DBDA 1LLZA 2QCDB 3FJ6A 3LHWA 3NA8A 3NQ2A 2C6QA 1MZHA 5F4WA 5G4EA 5U4NA 2H3BA 3UWQA 4O50A 4LVDA 3L5AA 2WKJA 2ZQ0A 1TPVA 3L2IA 3P7YA 4QIUA 1W37A 1XM3A 2VELA 4MUZA 4RV8A 7TIMA 2NX3A 3G1VA 4XZ9A 3M0ZA 5LHEA 2YYTA 1EWEA 5EA9A 3UZJA 1AK5A 3FFSA 4IQLA 1I2PA 3ABOA 1W1ZA 3LRLA 2A7NA 3PSWA 1LROA 1GTHA 4AH7A 3P74A 4K8HA 4O28A 3B8DA 1PHQA 4TX9A 3DFNA 5CPOA 2ZZ3A 2C16A 3DI1A 3SI9A 2VOMA 4JY8A 1VCFA 3VKJA 4LV4A 4X22A 3NPWA 1TRIA 4X3ZA 3UWUA 2E6DA 1OFQA 1GYLA 1NF7A 1C8VA 3MUXA 2CFFA 4DELA 1F2JA 4FF7A 1TREA 2C19A 4FX7A 1CW2A 3LRMA 3SY5A 1M7OA 4JGDA 1L2UA 4IMCA 3KVKA 1OFBA 4RXGA 3BGGA 3NVTA 1LBLA 4D2JA 4DO5A 1SFJA 4LOCA 1DJQA 4R34A 2X1SA 1VCVA 3QFEA 1A5CA 1F74A 3DHFA 2WNZA 1TPB1 1TTIA 1P0KA 5BMXA 1VR6A 1TJRA 5AC6A 5EPDA 3B0VC 5HWJA 1R2RA 4JIQA 3TMQA 1LOQA 3INPA 1TQXA 2BWGA 2CLMA 4PA8A 4LW7A 5C54A 1VGAA 2QCEA 4LTSA 1GEQA 2C1HA 3NM1A 1T8XA 1P5BA 1VRDA 1XUUA 2VEMA 3ABQA 4FIRA 3W2MA 3M5ZA 3FYOA 2V30A 4FHAA 1SU5A 2D73A 3GDTA 3CIWA 3L68A 5K3VA 3W7JA 3C52A 3A23A 4AAJA 3N2XA 3C56A 4XWUA 4J9JA 2E77A 1C9DA 4JTGA 4OQVA 1PIIA 2NUXA 4GXMA 1EPXA 1I4NA 3G1FA 4O0ZA 4JYFA 4UMBA 3AJXA 4LRTA 5D04C 2Y6ZA 4ALDA 3NL5A 1FWNA 1OABA 3CT7A 4ZMGA 1KFKA 2RH9A 3U8GA 5DCEA 3M5VA 1KM2A 2ZZ7A 1HL2A 3QM3A 3W7QA 2F84A 3PULA 3G0UA 2R14A 1GOXA 2VFHA 4K7YA 1W5MA 4UC5A 2ABAA 4YWIA 3BLFA 4M7SA 4ZQMA 3H54A 3PG9A 3TK7A 1H63A 5AHLA 3G22A 2GQ8A 4W9TA 2G5WA 1SW3A 3R5EA 3WK1A 1OJXA 1YPFA 3DH7A 1F05A 2R8WA 4YCOA 4MZ1A 3W23A 4N4PA 1H51A 2H8XA 2YYUA 3F1QA 3LLFA 2FJKA 2FPVA 4KFPA 4O8RA 4IJBA 3SECA 5CGQA 4RK8A 4ZZ9A 5AB3A 2ATMA 3TV8A 1GG0A 4Y6GA 1OFOA 1K3UA 2E1DA 5AC8A 2GUUA 4MLRA 1OFAA 3CM4A 4KKXA 1P4CA 5KSWA 1PE1A 3EWZA 4JDBA 4OT7A 5KZEA 4JTFA 4EWND 3N3MA 4A22A 2H90A 4WY0A 1XDLA 4XKYB 1H7RA 1XDMA 3NG3A 3EWWA 3PUDA 2ZZ2A 4AVFA 4PH6A 1LBFA 5KZDA 3EX1A 1TB3A 2A5HA 3HG5A 5D09A 3OIXA 3C0JA 4KWWA 4ICNA 1GYNA 2G97A 2CZ5A 2E5DA 1THFD 5AN7A 2CLIA 2PE4A 4NZJA 3W86A 4CQAA 4XTDA 1H7WA 3W75A 5D05A 5C2XA 4FNSA 1GT8A 3LM7A 1T0OA 3W2KA 2A1YA 2GVLA 4CQ8A 1LRQA 3MHFA 1ZCOA 3PAJA 5L6UA 2TSYA 5D2YA 3GB6A 3NM3A 4R33A 5DCDA 3DI0A 1NAL1 1FUYA 5DELA 3NQ6A 3G1AA 1K02A 3DGRA 4A3UA 2YR1A 3EWXA 3TQVA 4A2RA 5SWUA 4O12A 1KV5A 3FEMA 3RMJA 1KFCA 3O63A 3KHJA 5F1UA 2E5CA 4C1KA 4PL2A 1GG1A 2BXVA 4H6KA 4HNUA 2VFFA 1VH7A 3SW6A 3P8IA 1RV8A 3FKKA 2A2IA 1QPRA 2PRLA 4NJJA 3L9CA 4HIBA 4DQWA 4UUIA 3TR2A 1PS9A 1YTKA 1QO5A 3PG8A 4WY0B 1G6CA 5TIMA 5EL1A 1QNVA 4JICA 2C15A 3W85A 4AMAA 3GX9A 2GJLA 1YADA 2WV8A 3BG9A 2X16A 1OX4A 1EX5A 3UXDA 1QCWA 2ZTKA 2NXIA 4IMGA 5EBUA 3PSVA 3TQ0A 3DFQA 1HG3A 1EIXA 4H4IA 3CC1A 4UNLA 5K7JA 4TO8A 4JX5A 3W6YA 3LDVA 2NZLA 4O53A 2A85A 1K8XA 3G1XA 1E51A 1O94A 3M5XA 3QEZA 1K8ZA 4LT9A 1RQHA 3BW3A 1DORA 3DFOA 4LVBA 2DU2A 1JCXA 1NFBA 2VFGA 1WXJA 2ISVA 3P60A 3CEPA 5C5YA 4EOUA 1JCLA 1OF8A 1KTNA 2XN1A 4JR5A 1LOSA 4N6EA 3MW7A 4MZYA 2QCMA 4AHQA 3QSRA 2FPTA 1VJIA 2CLHA 1TPC1 1F76A 1QMLA 3UZ5A 4JTHA 3S1UA 4Z0JA 1F6KA 1AW5A 1FY6A 1ZNNA 2RFGA 4O52A 2YCEA 4WJEA 2TPSA 1ZY9A 4M6VA 1AW2A 1QPQA 3W7RA 2C18A 3TFCA 1V7YA 3M9YA 4MJZA 1X1ZA 1G4EA 2PURA 5J5RA 5AHEA 4I7WA 1TPFA 3DAQA 5LGZA 3CTLA 4E38A 5A8GA 2VFDA 3M44A 1VHCA 2X2GA 1G67A 4LVAA 2YGYA 3RFAA 5DY3A 3LRKA 1G4SA 4E2BA 3RNDA 4CNNA 3PUEA 3HPZA 1DQXA 3OA3A 3I6RA 4ORIA 1IXPA 1JUBA 1R2SA 2NUYA 2H8ZA 1L9WA 2ISSA 1OX5A 4LNYA 3C2VA 4NX0A 4JX4A 3BLIA 2YZRA 5D02A 3Q37A 3O6DA 1FWTA 2CLLA 4K7VA 5D2VA 1ALDA 1G4PA 4N9CA 5MHBA 3HB9A 3MP5A 3OVQA 2FDSA 3E9AA 4PEKA 2PRMA 4GUJA 1DJNA 4UTLA 1BTMA 1FDJA 1FQ0A 2QCGA 3LCGA 3PR2A 4FXRA 3HPSA 1O5XA 1I2QA 2ZRUA 2B4GA 1VPXA 3BW4A 4DXVA 5ABTA 2ZYFA 1K03A 2VC6A 2JKEA 1RZMA 4ONVA 1XKYA 1KFLA 4AF0A 2YXGA 3IIXA 4QQ3A 1LORA 3LB0A 4PL1A 8TIMA 3T40A 1K7EA 3M6YA 3EX6A 2J24A 1IF2A 2JBMA 4M6PA 3BVJA 5I3KA 3LLDA 1YPIA 5HWNA 1W3IA 4HSNA 2TYSA 4MYXA 3W71A 2XN0A 1OFEA 5H91A 1OFDA 2ZRWA 1QDSA 3MP4A 4K39A 2WOQA 3W7OA 3WJYA 1W5QA 3W1RA 2WSYA 1CX9A 5F4SA 3IGSA 3IV3A 4NNAA 3TC6A 2E6FA 3W2UA 4DEFA 1DHPA 3QMTA 5K4ZA 2JK2A 3HOJA 1W0MA 5FEWA 3E02A 1LRTA 1O95A 4AHPA 3FJLA 3W72A 2X1RA 3A5VA 3L0KA 3TU9A 2B7OA 1JUKA 4BF9A 3LI1A 3U6WA 1YXDA 1SO5A 2R94A 1N55A 1R30A 1SO3A 4JY9A 4OV9A 1N7KA 3VI2A 3A24A 1YDVA 1G4TA 1XFBA 2ZZ6A 2Y85A 4N9EA 3O15A 5LHFA 5AHMA 1H62A 1UASA 4OU1A 5D03A 4U28A 2OMAA 1D9EA 3I7QA 3GR8A 3PM6A 2QAPA 4O0KA 2GVJA 1RD5A 1TTPA 5G4WA 3DU0A 3TAOA 4IXXA 3W83A 5LNUA 3STFA 4A29A 3G3MA 1L6YA 3T55A 4O1BA 2DZPA 4AF0B 3NQEA 1B9BA 3LCWA 1GPWA 1ZALA 3UD6A 2GQAA 1W5NA 3MBFA 4O11A 1UUOA 3HQ1A 4HNTA 4UIOA 1X1OA 4IMDA 2NLIA 3T7VA 4O57A 1W31A 3NQ7A 4UMCA 5D2XA 1OYAA 1WX0A 5LNWA 4UFJA 1TO3A 4MKNA 4NXSA 5L9FA 3PBUA 4GFSA 5CZJA 4ADTA 3KOFA 4B5NA 2VEIA 4HSOA 2QUTA 3MYPA 1Y0EA 3F03K 4Q4KA 5CZ0A 1TPH1 5BOOA 2GJNA 4DO4A 1W5OA 3P84A 4NUWA 3NQ8A 1DKWA 3HBLA 2Z6JA 3ATYA 1TV8A 1JCNA 3OBKA 4MY1A 5LZLA 1MO0A 1GVFA 1TJPA 2NXHA 3FKRA 3M16A 2QDGA 2NV2A 3JR2A 3A21A 4GC4A 1Q6RA 1EEPA 1ZENA 4S2BA 3D0CA 1BWLA 1VLIA 4UR8A 4E0CA 2WQPA 3IRDA 4NNBA 3KRZA 5AC7A 2DZUA 3U2OA 2DJXA 1O5KA 4FIQA 1EP2A 1JJKA 1OHLA 3NZ1A 3W7HA 5T26A 1SSDA 1SZFA 4JTIA 1K8YA 2ZA2A 3W74A 1H1YA 5HINA 1H7PA 3C2OA 3NL3A 4IMFA 1IXQA 3G1DA 1KM3A 3EB2A 3GDLA 1IIGA 3E12A 4AWSA 4EVZA 1LZOA 1IGSA 4RLIA 4FNRA 3THQA 3WK0A 3NPXA 3L5MA 2FIQA 3SFKA 4IXHA 1JRBA 1IIHA 1W54A 2YFOA 2NWSA 3NAVA 4YMZA 3GZ3A 2Y89A 3N9RA 3RF9A 1RR2A 4UR7A 1VHNA 1K7FA 4AB4A 3V1PA 2E09A 1H7OA 1OVDA 1UJPA 3W7NA 1BKSA 1KBJA 4N9DA 4TR9A 3N73A 4OV4A 5LKYA 3S5YA 3R12A 4MJMA 3FA5A 2YSWA 3R89A 4IOTA 3TSMA 3IIZA 1FCQA 3UQNA 1VYRA 3M43A 3PY2A 3MMTA 1VQTA 3T78A 3VFLA 4EF8A 3W1QA 4ZQPA 1PV8A 1OX6A 2CZEA 5KMYA 1WOAA 3W7MA 3NQFA 3G24A 3ZWTA 3S6DA 1PCWA 3VCRA 3G8EA 4O18A 1A5BA 1I8JA 2BZNA 3R8RA 1DVJA 4AHOA 3TIMA 5FESA 4JTEA 4LV9A 4WY0F 1DOSA 1YDNA 4GUGA 5CPMA 1M5WA 3TDFA 3NO5A 3L5LA 1ONRA 1WOBA 2KZHA 4FNPA 3GXPA 3LXBA 5BW6A 3MI3A 3L0NA 4ADUA 4EF9A 1ICSA 1ZAIA 2V8ZA 2F7FA 3FOKA 3LTPA 4C1LA 2QCLA 3E49A 4WQ6A 4E2DA 1JUEA 4Q33A 4GJ1A 4QNWA 4OHQA 1TCDA 1YDOA 2Y7EA 2ZCGA 3USBA 3TXVA 3QMSA 5F2MA 3W1LA 3S42A 2WJZA 1F73A 3RU6A 1WA3A 3GNNA 1UBSA 4X9SA 1AMKA 3LCLA 4AXKA 1M6JA 4O4VA 1LTDA 2ALDA 3MI2A 5HMSA 5HUOA 4RR4A 3NPVA 3MYOA 1KM5A 3R2GA 3G8RA 5FF2A 3NYZA 3LHYA 1TPUA 1LYXA 4QISA 3VNDA 2NX9A 1DL3A 2CW6A 4JTSA 3P5YA 3V75A 2FFCA 5HQEA 1GTEA 3UNDA 3NZRA 4Z1DA 4S1FA 4UTTA 5HNRA 1G7VA 3CB8A 1WBJA 5FEXA 4UFKA 4JS3A 1QFEA 3HG3A 3W76A 3O06A 2ZFAA 2C14A 2YFNA 4QJ1A 2DP3A 5HR6A 3DHDA 2X1TA 5FF3A 3GVGA 4JTLA 4FX8A 4AWUA 5E93A 4K6AA 3LHZA 5HR7A 1F6PA 1YXCA 3PBYA 2JKAA 2O7SA 4UFLA 3W1UA 1S5TA 5TBOA 4LVFA 3WK3A 3E96A 1SZEA 3G1SA 4FNTA 4WZHA 3S1WA 4UTMA 3TW7A 4HPJA 3SIZA 3BLEA 1YTDA 3TX9A 3WJZA 3S5OA 3VE9A 4HNNA 3LBMA 5FF7A 3THAA 4P61A 3QQ0A 1S3HA 2WPBA 1KA9F 1WQ5A 1OK4A 4NNCA 2TRSA 4O1AA 1QOPA 3CLMA 4JYEA 2GQ9A 3QJAA 3ZFHA 1SUXA 3KX6A 3UPWA 4MOZA 5FI8A 4N9BA 3RLUA 3LHUA 3F4NA 4Z08A 2RKXA 3C3NA 3O8AA 4FNQA 5U7SA 3S1VA 3QH2A 2Y7GA 1X7FA 3BARA 3WJXA 4MVAA 2DZVA 3ZR4A 4RZ5A 3WK2A 2HSAA 4ZQCA 1ME8A 3G18A 3W7EA 4ML9A 5I3IA 4NJGA 3EXRA 1KLYA 2PRHA 3B0PA 1NF0A 1XBXA 2ZZ5A 2Z0IA 1LLWA 4JTTA 4U4MA 2QAFA 4RZ6A 1LM1A 4O15A 5BRBA 3W3OA 2OT0A 2CZDA 3LXCA 4XUGA 4XQ6A 3HJZA 3LHTA 3FLUA 1RPXA 3LV6A 2QJGA 3KRSA 4H3DA 3LXAA 1P0NA 3UY8A 2G95A 2DZXA 2OZ0A 4UTWA 3QPYA 5CG7A 1RQEA 4BI6A 1P1XA 3DBPA 4NQ1A 2ZA3A 3LCHA 2QJHA 2Y63A 3T4CA 3W07A 3F4WA 1U83A 1H7XA 2J9XA 1AG1O 3GNDA 4HNVA 5D2TA 5LNSA 3LTSA 1TRDA 2FB3A 3G0SA 2EAWA 5AHFA 3NPUA 1BWKA 4GE8A 1B3OA 1NEYA 1ZAJA 3W7KA 3S5NA 3EWBX 3WJSA 2HMCA 4KWVA 4BR1A 1JR1A 1SR9A 3KFTA 3SZ8A 2ZZ4A 1GZGA 3W1NA 1OX4B 2IQTA 2RDUA 3PB2A 1Q6LA 3NNTA 4MLJA 3KVMA 3L66A 1V5XA 1QAPA 5LNRA 4UTJA 1U5JA 4UNKA 1ZAHA 4I7UA 4FX6M 3W2JA 3W2LA 2A6LA 4GRSA 3NEVA 4RXFA 1SO4A 3M1ZA 3TJLA 1T99A 2DJLA 4UTTC 1KTCA 5TQLA 2ZA1A 2ZTJA 1QOQA 1B57A 3OEXA 2V82A 3LERA 1EA0A 4Y9AA 3OG3A 4LVGA 1XL9A 1JCYA 3W7LA 4O54A 1ADOA 3HG2A 3MHUA 3TSDA 3NL6A 3CQ0A 3TROA 1Z48A 4WD0A 2FQIA 5HWMA 3N14A 4N4QA 2RHGA 2ZZ1A 5HULA 3FIGA 1OG0A 3L65A 5F1VA 1GJPA 3ABSA 5CKSA 1I45A 1WYIA 4JTKA 3M47A 1B4EA 2QCCA 6TIMA 4TMBA 2CLOA 3GDRA 5I3JA 3C2RA 3NDOA 4I9AA 1TV5A 1JULA 2OJPA 3M41A 1ICQA 3M5YA 5EMUA 3HGJA 1XI3A 3NQVA 1LRNA 2B7QA 4K37A 5D2WA 3O6CA 1OF6A 1Z44A 4JIPA 4MFDA 3P61A 3A22A 4EIVA 4NU7A 4N2YA 5FEPA 4X2RA 3H55A 4HN4A 2I1OA 3W87A 1FCUA 1PCKA 3GK0A 5GVJA 1QPNA 2P0OA 2BSLA 4O1DA 2VFIA 5C6MA 2NUWA 3GYEA 2V5LA 5I3HA 4OWGA 3NOEA 4IGHA 2QF7A 3P67A 4GUHA 3RLVA 1PHWA 4CNOA 3W7GA 1LBMA 2J9YA 2V2CA 1SO6A 1OFPA 4CCEA 4LWWA 3KXQA 2EGZA 2JGQA 3W9ZA 3BG3A 5D32A 3NL2A 3B06A 3TXZA 3LI0A 4YCPA 5G2HA 1QO2A 3P62A 4TMCA 3MHGA 1KFBA 4WOQA 4MPQA 3SR7A 4Z1CA 4LY8A 2ZRVA 3BG5A 3H53A 2VKZG 4Z1BA 4JEQA 4WXYA 3PVFA 3W73A 3SGUA 4UTWC 1TTJA 1H60A 2QUVA 1D3HA 5A5WA 3IIOA 3W1XA 2JKPA 3TMLA 2GVGA 2GOUA 1A5SA 3OVRA 2V5BA 4MFEA 3HGRA 3S5ZA 3QW4B 3DENA 1VYPX 1KTBA 3G0XA 2Y62A 3GAYA 4UFMA 5KTLA 2QR6A 4IWWA 1TSIA 1VZWA 1EP1A 4OBTA 3HPXA 3IVTA 4LS0A 5K9XA 3T44A 4IPIA 5LGXA 3QZEA 1EUAA 4JX6A 4POCA 4RZ4A 4M5PA 3W2NA 4DF2A 5AYXA 2J27A 1QWGA 3TFXA 1L6SA 3G1YA 5DY2A 5FF0A 2FTPA 5HJLA 5KINA 3Q2DA 2BLEA 2X30A 1KM4A 1GVRA 2UV8G 1WBHA 3M7WA 3HIJA 3BW2A 3W84A 1K7XA 2C0AA 2CLEA 3TSBA 3TW6A 1M7PA 4HKPA 4Y96A 1YXYA 3KRUA 1UB3A 5DXYA 3QQ1A 4DO6A 1FCBA 2Z6IA 5J5DA 1ML1A 3TUUA 3ELFA 3O6YX 3RK8A 3DXIA 1XXXA 1C29A 2B7PA 2CU0A 3NGJA 2W79A 4XBKA 2P1FA 3STEA 3P8JA 3N19B 3LTYA 3W7PA 1TIMA 1D3GA 2O7QA 4M19A 3B05A 1F7BA 3WFAA 1W3NA 4YLWA 2HS8A 2I9EA 3WJWA 3OVPA 4JD4A 1XUZA 4QNEA 5AYZA 5IBXA 5H2ZA 5HUPA 1EP3A 4TIMA 3C61A 1VS1A 3HMJG 2V2HA 3HO8A 2HTMA 2OT1A 4K8EA 2A0NA 3G1HA 4GBUA 2PCQA 3P5ZA 2J6XA 5D33A 1PL9A 4HPXA 3DKLA 1H61A 1H50A 3EXSA 1X6UA 1DQWA 4IUOA 2A4AA 3I65A 5CSSA 5AOUA 5EY5A 3QW3A 3GXNA 3BGJA 3EWYA 2WSRA 3GDMA 1GQNA 2Y7FA 1HFBA 1TV7A 2RDWA 4RX0A 1S5WA 1B4KA 2Y7DA 4LC8A 3QPZA 1J2WA 2W0UA 3PBVA 2NV1A 3UWWA 4GNJA 3EX4A 1ME9A 4O14A 2FPYA 4O19A 4QSHA 1QR7A 2LLEA 3E0IA 3TA6A 2H3DA 3P80A 3I7RA 3W1AA 3TE9A 3NQGA 3MWAA 5F2GA 4YXGA 4Y90A 2A6NA 3JS3A 3QC3A 2QEZA 2XN2A 4NXKA 2WNNA 1VCGA 1X8FA 2ZBTA 5IM51 1NVMA 3ABRA 1CI1A 2VEKA 3Q58A 4NZFA 4XKYA 3QRHA 1H5YA 4NT0A 4ZVJA 2QJIA 5G1YA 2WNQA 1MEHA 1DBTA 3EKLA 4MY8A 2A21A 3C8FA 3C6CA 2V0TA 6ALDA 5G2IA 2VENA 3I68A 2ZRZA 3MO7A 3C2FA 3IIVA 4CLMA 2CZFA 4UCGA 3N9SA 3UYCA 5DCBA 4P2VA 4Q32A 2Y88A 4A2SA 1N8FA 4PFMA 1KLZA 2HS6A 3N34A 4NX5A 4XBSA 3MJYA 3EX3A 2GPTA 4LRSA 5F2LA 1YYAA 2Y70A 1GVSA 3CPRA 3W1PA 3DFPA 2Q3RA 2QUUA 3Q94A 3KVJA 3CWNA 1RQBA 2JGYA 3BK0A 4R53A 2B0MA 2AAMA 3MP3A 4ZQOA 1OFRA 5LNVA 3ANYA 3CEUA 4FB7A 5G5IA 3W1TA 4FNUA 5EKYA 2E6AA 3OHIA 3YPIA 1ZHAA 1L6WA 3W88A 5CSRA 3IVSA 4RJEA 4BWLA 2EHHA 1SFLA 1KV8A 3P82A
chains in the Genus database with same CATH superfamily
1KGXA 1PB0A 4O13A 2EPLX 1LWHA 1YNPA 2ISWA 2G3IA 2A7PA 4RCXA 3TVAA 3T05A 3W1MA 1XCFA 2IMRA 2Q71A 3LBOA 3H2CA 2X09A 4JIRA 2OSYA 2DH2A 2VO5A 4CCCA 4DF1A 2X1UA 4DF0A 3STGA 1E15A 4O0QA 3D47A 4XAZA 4YL2A 4XO6A 4QQUA 3WQWA 2V81A 2WBKA 1FCVA 3RMEA 4BY3A 4MNJA 1H1ZA 4BI7A 2XSXA 4H6EA 3LHVA 3NSMA 1FWSA 3DYMA 5JU6A 3WF3A 1GQJA 2XWEA 4FZIA 3GR7A 4IP7A 3TJXA 3UWYA 3E0LA 3NEHA 3P81A 2JEPA 5FEZA 1B2YA 3KDOA 1B1YA 2ZX8A 3WQDA 4DPPA 3QF0A 3DFTA 4DPQA 5AC4A 3I7SA 4O8AA 3GTHA 4CN6A 1OC6A 4C7DA 1VLWA 3KL3A 4UXDA 3PBGA 3LD5A 2PWFA 3LCFA 4CQ9A 2BDQA 2Y24A 1FXPA 5KETA 5IRPA 4FR1A 4M56A 4HT3A 1WAUA 1TMHA 3MVTA 1V02A 3TW9A 2HNEA 4JFWA 1IEVA 1HW6A 3NQAA 1MI3A 1XBYA 4OE7A 3PZ9A 3W70A 3DECA 2FHFA 3GIYA 1SW0A 4R7JA 1LLOA 2CIPA 2OX4A 4TX8A 3VILA 4H1ZA 3LX9A 1Z41A 4FXSA 1O4UA 3ZR6A 2A3BA 4Q8NA 5D30A 4KS0A 3R43A 4JHOA 4B90A 4LUTA 4AX7A 6ENLA 1FOBA 3IIPA 3FS2A 5DXXA 1V3LA 2Q8ZA 2E9MA 1DJWA 3QR0A 3RYSA 1TPDA 1M68A 3OLIA 1J0JA 5AVNA 3FCPA 3QOMA 4PCTA 3NSXA 4MPKA 1JYVA 4WX2A 3H26A 2ZRXA 1D8WA 4JDYA 4G1KA 2J9ZA 3W29A 3R79A 2H6RA 4CD8A 1HF6A 3GHRA 3L4YA 3V5FA 3SQLA 3OZOA 1DWHM 4H9ZA 2HK0A 1JF6A 2Q6ZA 4GBDA 2FFIA 1MEWA 3G1RA 1A53A 4M1BA 4HHPA 2XGZA 3VC5A 5C55A 3UXKA 4JYDA 2QDHA 4WSHA 2YBVA 3K30A 4ADSA 4F0SA 2PTZA 1TPWA 2GVYA 1IWAA 2DQWA 3ALFA 1E4MM 2RJHA 2YDAA 1BEUA 3F2DA 4LGXA 4B3LA 1WDPA 1ZJIA 1VB9A 1Q6OA 1A5MC 4UZUA 5I03A 4Q4SA 2XTKA 1F4HA 1IT7A 1H09A 2XGIA 1S2WA 3BLLA 5A3HA 3ARPA 4JN7A 2XZ9A 3TCEA 1EC8A 3ARWA 2DPEA 5E6ZA 2PEVA 4RDYA 4X2PA 2PDBA 2G3MA 1OYBA 1S3TC 3AXKA 2NWRA 2VZTA 1YEYA 4RE3A 5CZSA 3TONA 1S2UA 1DQUA 3SGZA 3N4FA 3GS6A 4WDTA 1C7TA 2V9DA 3AQUA 5XIMA 3PF3A 4GACA 3IGUA 3EOEA 1DPMA 4JNMA 4NI8A 7PTDA 3HG4A 3II1A 2XM1A 3PB0A 4PR4A 1ZUAX 2ZDSA 3UXAA 4YN5A 1EX1A 3UJ2A 1FWRA 3LPGA 5EMJA 3QV8A 1H7NA 1DEDA 2D24A 2AGKA 3ANUA 5CAHA 2XSBA 2CWXA 1XD0A 4E2VA 2YDRA 5C2CA 2J25A 1FHDA 3EX2A 2ZX9A 5IFTA 4JKLA 4EWJA 3PUOA 3L21A 4JXCA 4PRTA 3BAYA 4C6NA 3G3DA 3WDPP 1KM1A 3NR0A 4LUIA 3QYQA 3LCIA 2YDQA 1G69A 5REQB 4GMEA 4NAEA 3FK4A 5HAOA 3AMKA 3GQYA 2CESA 3EPOA 5AHNA 2QCFA 4YHGA 3TAKA 4WVXA 1TUXA 2PC4A 3WLHA 3TQKA 1P6CA 4W8LA 1WAWA 5BOEA 4J7RA 1H4PA 3L67A 4IHCA 3IUIA 2C6QA 2GGEA 5F4WA 5G4EA 5U4NA 4UTFA 2HBVA 2XIMA 2OLHA 5AYIA 3SSZA 2GGHA 5CBIA 4GZEA 3K46A 2WC7A 1UR1A 1G1YA 2X7VA 4M80A 2FGZA 2NX3A 4XZ9A 3CQKA 4NAFB 3WH7A 1HXJA 2CLPA 2ZE0A 4AXNA 1RAKA 1XLGA 1GTHA 1LF1A 2PMQA 4LAZA 5EGRA 1RHCA 3COTA 4A8RA 1XKJA 2ZZ3A 1TZ7A 4LCSA 3GXMA 2WJFA 1Q7ZA 2P3EA 4Q8PA 4ZXLA 1X7IA 2OYMA 3TLQA 1KBBA 5A2CA 1TRIA 2XH2A 4ZTXA 1OFQA 2UY4A 3SB0A 3MUXA 4XAGA 1TREA 4FX7A 1V93A 3LRMA 2PWGA 4HU4A 3V16A 4JGDA 1L2UA 1S2VA 3KVKA 1OFBA 3AAMA 2UZ9A 4RXGA 2X40A 1CBGA 3VOCA 3IAQA 1J5SA 5GJNA 4IP5A 3TJ4A 1T5AA 1VCVA 3BJFA 4RDWA 3QFEA 5DFAA 1A5OC 4DRSA 3UR2A 4GJIA 3DHFA 4AUBA 1JNEA 1TTIA 1P6BA 1P0KA 1VR6A 1TJRA 5AC6A 3B0VC 5HWJA 4JIQA 3K2GA 1LOQA 1H5VA 3ITYA 4TQTA 1RLCL 5CC3A 5FD0A 4PA8A 4FOKA 4RW3A 4LW7A 4BQ4A 4JHMA 5C54A 3NM1A 1T8XA 2BXYA 1VRDA 3K5XA 1VFLA 2YL5A 1UR0A 1EOKA 3HZ3A 3M5ZA 1V3KA 4L5ZA 3RLGA 4B4HA 4F79A 4ZO9A 4HHHA 4J2MA 3L68A 5K3VA 2BV9A 5CJNA 3W7JA 4AAJA 3R94A 1XLEA 4DI9A 2VD8A 2E77A 3D5HA 2I56A 2DQXA 3B9AA 4PMXA 1HT6A 4GXMA 5A8MA 4S3KA 3VYLA 3CPGA 3G1FA 4JYFA 3AJXA 4Q7BA 2J13A 2ASHA 5M17A 1FWNA 4GQBA 3U8GA 1XJBA 1S1PA 3W7QA 4J1OA 1HP4A 2ABAA 4F66A 4YWIA 2CITA 4BZYA 4M7SA 4ZQMA 3VNZA 1K9EA 2DUZA 3G22A 3A3WA 3WK1A 3CUIA 1OJXA 3E0WA 1F05A 1EOMA 4YCOA 4DAIA 4MZ1A 3W23A 1EQCA 3ECQA 1ISWA 4PYSA 2RGMA 4GCXA 4HOXA 1OFOA 3TQPA 2E1DA 3T6CA 2O9PA 3R0DA 1OFAA 3PZIA 1P4CA 3TTEA 4JDBA 4IIDA 4OT7A 4EWND 3N3MA 4A22A 2WSKA 4WY0A 2QQ6A 3NG3A 2X2YA 4F8XA 2PLJA 4AVFA 4PH6A 3EX1A 2C7FA 3PJTA 4J27A 3QTPA 4HJFA 1MYRA 3ITTA 2G97A 3WZ0E 2CZ5A 2WZTA 2YBTA 2PE4A 4Z1YA 1CGUA 3W86A 4CQDA 1TWZA 4M51A 4FNSA 2Y1HA 3LM7A 2A1YA 3QN3A 4CN1A 1PKMA 2OQHA 1QW9A 3GB6A 4Q4RA 4R33A 2V3EA 5DCDA 3DI0A 3MCMA 1NAL1 1K02A 1HN1A 3SURA 1B3VA 5SWUA 1CNVA 3CASA 3RMJA 3TA9A 3WLTA 1OT1A 4GY0A 2QULA 4B3KA 3LNMA 2FKPA 3U48A 1B5TA 4JQ1A 4DM2A 4JL2A 3SW6A 3FKKA 2NQ5A 2PRLA 3C8NA 1MFVA 4DQWA 4XIAA 1PS9A 4Y7EA 3CZLA 3SCUA 1G6CA 1QNVA 3PZTA 4JICA 1K77A 4A05A 2X16A 1YBQA 3GTIA 4REQA 1R5YA 1EX5A 2FH8A 3UXDA 1TVLA 2NXIA 4IMGA 3PSVA 4H4IA 1ZJBA 3WH6A 4UNLA 3AYTA 3W6YA 3F4CA 2HK1A 4B5XA 3DFOA 1JCXA 3SCRA 1G9HA 2VFGA 9RUBA 2ISVA 1NELA 2P8CA 2YL8A 2OEJA 4DNMA 1O5QA 3AISA 4DZAA 5CJ5A 3MW7A 3PFRA 4AHQA 1HL8A 3VOIA 1VF8A 5AECA 1J0IA 1VJIA 4KWSA 3S1UA 3CUFA 4Z0JA 1R3TA 5CG0A 1ADSA 1JYXA 2ZWZA 2YCEA 2VC9A 2TPSA 1ZBCA 1GW9A 1NDYA 4CEUC 3LS9A 1C8QA 1MVYA 1QPQA 1RBLA 3M9YA 4HNOA 4EAYA 4MKSA 1X1ZA 2XU2A 3DOPA 3XINA 5C9UA 2O0TA 4MNKA 4DN1A 1SMAA 4GK8A 3VZZA 3UG3A 3WD0A 3AWNA 3M44A 3DCPA 1VHCA 3GO2A 2VYOA 2YGYA 4ERIA 3OYZA 3W53A 2VCAA 1E70M 3T42A 4JKMA 2HV5A 3HPZA 3OA3A 5EMMA 4XG1A 2UBPC 3W25A 2NUYA 1OX5A 1HKIA 3URNA 3APTA 1XH1A 1PBGA 1VFHA 3C2VA 4P8VA 4WKFA 3OGVA 3DGBA 1V6VA 4D72A 3Q37A 4JN8A 2B31A 2DIKA 4KEUA 3BAIA 2PDLA 2ZVRA 3SIMA 4I8DA 4AY7A 2Z7GA 2J7GA 1G4PA 3AXHA 3HB9A 3QY7A 4AD5A 1UMYA 4AD3A 3ARYA 1WDRA 4QGCA 4J3XA 3AU6A 3E9AA 4PEKA 5ECUA 7REQB 4B5UA 2CERA 1PWLA 2PRMA 1AZ2A 5A8QA 1FDJA 4PMOA 3R8GA 3PR2A 3Q45A 1MRQA 4FXRA 1UZHA 1I2QA 3BW4A 4DXVA 5ABTA 1WZMA 1AFSA 4ONVA 1RLDA 4DHGA 4AF0A 3N2CA 1CB2A 1ZS2A 2GJRA 5DMYA 3OBAA 4K3ZA 3K13A 5FCZA 1IF2A 5CC7A 5DT7A 4MYXA 1OFEA 1OFDA 2WWCA 3IUDA 4B9YA 3CJPA 3WJYA 5BOFA 1N2VA 3ARSA 3TC6A 1DHPA 1NQKA 1J10A 1Q6CA 4J4KA 1B30A 2JK2A 2HPIA 5FEWA 2XYLA 2P5NA 3L4VA 1QNPA 2ACUA 3FJLA 2Z1WA 2V3GA 5JBEA 1U1UA 3O0KA 4JTRA 2R94A 1CXHA 3A24A 4H9YA 1LL4A 3GG0A 3F5JA 3VIKA 2Y85A 1EL3A 1GHRA 4N9EA 3H4GA 1R0MA 2VR2A 2QHAA 4QCFA 4OU1A 4FSAA 5CPSA 2OMAA 3I7QA 1WZAA 3W28A 3PM6A 2XIBA 3SUWA 3W83A 4AC1X 1Q4WA 3G3MA 4O1BA 4LB4A 1PDZA 3M46A 2AL1A 3DYPA 4GZJA 1UROA 3UD6A 4HNTA 9XIAA 3CT2A 2I17A 2WK2A 1QNRA 1XYFA 4Q8UA 4O57A 3A3XA 3EKGA 3ZR5A 2X42A 1PYFA 4KW2A 2PI6A 1NDWA 7ODCA 1Q13A 3ZT5A 2QUTA 1Y0EA 3F03K 4Q4KA 3UA4A 2GJNA 4DO4A 1OQFA 1W1B1 1W5OA 4ES4A 3NQ8A 4FF5A 1DKWA 4PE8A 3PAOA 4P7RA 3SCSA 3OBKA 4U2ZA 1GVFA 2NXHA 3Q67A 1IGWA 3FKRA 4DXXA 3GU1A 1Q6RA 1EEPA 4NZ3A 4S2BA 4LALA 4UR8A 4NNBA 2DZUA 1O5KA 3N04A 1EP2A 5GNYA 3NZ1A 3W7HA 3T0AA 1SZFA 4QTGA 5M1TA 2JFEX 5HINA 1H7PA 1FFQA 3HN3A 1KM3A 1IIGA 2PTDA 4U33A 4AWSA 2P53A 2GUBA 3CZ8A 2V67A 1UR2A 3OIHA 3NPXA 2VUYA 1TG7A 4IXHA 3ZJ7A 4V28A 2G8ZA 3TJIA 3WL0A 3CUZA 2JALA 2NWSA 1E6XM 2JQXA 4HPGA 4RNHA 1S1RA 4UR7A 1OGGA 2E09A 2PLMA 3D46A 2PTXA 4N9DA 2A3LA 1UHVA 3R1ZA 5DO8A 3R12A 2C79A 2XIJA 3IIZA 1FCQA 1XW8A 3M43A 4HU3A 3PY2A 3MMTA 1VQTA 3VFLA 3PZQA 3NOYA 3W1QA 1PV8A 1OX6A 2CZEA 2E0PA 4L9XA 2OZ8A 5FSEC 2POZA 3W7MA 3NQFA 3G24A 4AHOA 1N8IA 1ZB5A 4WY0F 1DOSA 4KIEA 3RHGA 2VD9A 3G6MA 1XLMA 4AZIA 2VCCA 2ADAA 4MUPA 2W66A 1NDZA 1WOBA 3I10A 5I06A 1BYAA 1KXQA 2W27A 4KCVA 4QJ4B 3LXBA 4A3HA 2V8ZA 1Y5VA 5A6SA 2Z7KA 3XIMA 2WMJA 3IARA 4D6JA 4C6KA 2FDMA 1JUEA 1K9FA 4Q33A 5BWAA 4OHQA 3VKKA 1KXHA 4W8BA 3W1LA 4YYFA 2ZOXA 4CU7A 3M0YA 1XLLA 1F73A 3T09A 1NOFA 3ITVA 1UBSA 1AMKA 3LCLA 4F9JA 4O4VA 3DG7A 2ALDA 1VEMA 3CAWA 3ZVHA 1KM5A 3G8RA 5FF2A 2PDGA 3G6LA 3HQOA 4XVEA 4ATLA 3KOXA 3U9IA 3N9KA 2VHLA 3VMPA 2QPUA 1CDGA 3BOFA 4AZHA 3O6AA 2ZXDA 3V0SA 5HNRA 5HOSA 3NYDA 4KGLA 1R8LA 1Z32X 4MADA 1QFEA 3HG3A 3W76A 4AFYA 3O06A 1BQGA 3V35A 3O2LA 2ZFAA 4QJ1A 2DP3A 4HVXA 2OPJA 4PTVA 3S83A 2BGSA 3MMUA 1CGXA 3HJEA 2J47A 5HR7A 3IANA 2OZ3A 2JKAA 2O7SA 1G0CA 2DGAA 2NQ9A 1BG4A 3A47A 2Z1SA 4LVFA 3E96A 3AYSA 1E4IA 2R6OA 4WZHA 1A4MA 3P0WA 1XLKA 1CIUA 4DYKA 4GA8A 4J35A 3TW7A 4HPJA 1WPCA 4GKTA 1E3XA 3B4YA 4HNNA 5H1WA 5FF7A 1EJTC 3THAA 2GL5A 2UY2A 1R3VA 3G77A 3QQ0A 2BASA 1WQ5A 1TJ2A 1EDTA 1QOPA 4N7QA 3ONBA 2WQDA 4PCNA 3ZFHA 1BLIA 2J79A 4UR9A 3RLUA 3ITGA 2J75A 4Z08A 5U7SA 1JXJA 1F8MA 2VDGA 3GNXA 2HBXA 1ISZA 4MVAA 3NIYA 3G18A 3W7EA 5I3IA 4PB4A 5EMLA 3EXRA 3VNYA 2CBIA 2ZZ5A 4LAUA 5DQPA 1Q8JA 3AHYA 2EG8A 4L80A 1E6ZA 2BG5A 3M0JA 5I00A 3WMLA 3QLDA 3LXCA 3HJZA 1RPXA 3AS1A 1F3XA 4HHLA 3TYUA 3KRSA 3H2NA 4AEFA 3UY8A 2G95A 4ROQA 3USZA 1E6PA 1QHPA 1W1IE 2TAAA 1TR1A 1P1XA 3DBPA 2EPNA 3WDQA 3RX3A 3F4WA 1U83A 3WUBA 2J9XA 5HDRA 2VRQA 4HNVA 4OOUA 2FB3A 3G0SA 3V5OA 3NPUA 4H01A 1NEYA 1ZAJA 4QE4A 1XQLA 8XIAA 4LEQA 5IOBA 1GCYA 4J5NA 3PB2A 3NNTA 3WBXA 3KVMA 4FLSA 1E72M 3LGGA 4UNKA 4H7VA 3W2JA 4XZWA 1JYNA 1DWGM 1HKVA 3TZNA 2YXOA 1GYMA 3S9IA 1HJQA 1SO4A 1T99A 4UTTC 1PUDA 4OVXA 4MB3A 2ZA1A 3MUAA 1ZTVA 2FZ8A 1V3MA 2HE5A 4XISA 1PKNA 1CT5A 3FX4A 3OG3A 1V6TA 3VGFA 3VM7A 1XL9A 3VDGA 1ADOA 4GISA 3VMOA 3NL6A 3E6EA 3GXDA 4KEVA 1E4NA 4ZFMA 2REQA 3I4EA 4KPLA 2ZZ1A 3L65A 1V79A 5F1VA 5BU9A 3CV6A 3JVAA 1I45A 2OO6A 1E1CB 4C6MA 4FLOA 5REQA 3KDNA 3A4WA 2WANA 1Q6DA 2QCCA 2WM0A 2CLOA 5I3JA 4H7ZA 1BG9A 3NDOA 4I9AA 4D6FA 1TV5A 2OG9A 4JFVA 1I0DA 3M5YA 4HA3A 1XI3A 1E6RA 1QI2A 2QV4A 4K37A 3O6CA 1OF6A 3WKZA 3E0FA 3A22A 4EIVA 4DJFC 4NU7A 3QYSA 3H55A 2I1OA 2IKHA 1FCUA 4GYPC 4JL1A 4CGTA 3V36A 1ITCA 1QPNA 2P0OA 3A4AA 1MNZA 2V5LA 4GUHA 1X1NA 1XIEA 1LQAA 4HYVA 4R3UA 3W7GA 3T0DA 1LBMA 3QV9A 1OFPA 4CCEA 4UOQA 1GKQA 2F6XA 3BH4A 5I3DA 4S38A 1X97A 5D32A 1US2A 5G2HA 1UP2A 3MHGA 4E3VA 1P7TA 3VCCA 1XLAA 3SR7A 4Z1CA 2ZRVA 3BG5A 4Z1BA 1NFPA 4KH2A 3KM8A 4LF2A 4WXYA 3W73A 1AJ2A 1H60A 1D3HA 2QUVA 1S5MA 3KP1A 4ZO6A 5A5WA 3URAA 4AZ6A 1K6WA 2ZVIA 3W1XA 3TMLA 4H8VA 3CWHA 1DJHA 2V5BA 3S5ZA 4WRHA 3FVDA 4PUNA 4YYCA 3AIVA 4IWWA 2WMHA 4N42A 1WUEA 3MSRA 4OBTA 3HPXA 5LGXA 4JX6A 4J3UA 4RZ4A 4DWSB 3ENLA 2J27A 1QWGA 3TFXA 2IXVA 2X0YA 4QS5A 4MG4A 4MB5A 5HJLA 5KINA 4IT1A 1K4GA 2X30A 1XGEA 2CBUA 3GHSA 4W7VA 2FJUB 4YTQA 3W84A 2C0AA 4C1NA 1VFOA 1IEQA 1M7PA 2OVLA 3VIGA 4QEEA 1YXYA 1UB3A 4YVXA 4FA3A 5J5DA 3UJRA 1IWPA 3ELFA 1XXXA 1EA9C 4GG9A 3N18A 1EZ2A 2W79A 1QNSA 4CD7A 2WLYA 2BY0A 3W7PA 1D3GA 4KMQA 5I77A 3B0YA 1FWJC 3ARRA 3WJWA 1XGZA 4YTSA 5AYZA 5IBXA 3UW6A 1XRSA 2NLYA 3HMJG 2OT1A 5GJMA 4B5TA 3BLPX 5D33A 4HPXA 2O9RA 3DKLA 4HMNA 1X6UA 4HZ8A 3WIJA 4RNFA 2NT1A 5CSSA 4EPEC 1ZZMA 3S3GA 1H3GA 1GQNA 2Y7FA 3K1GA 3MSDA 2RDWA 1B4KA 3WNNA 2Y7DA 4LC8A 4K1GA 1NFGA 1J2WA 4D6GA 1RVKA 2AOSA 3LMZA 2NV1A 3HM7A 2VRKA 1ME9A 4OOZA 3CNYA 2LLEA 3TA6A 2V5CA 3GC5A 3P80A 4RW5A 4EKJA 3KTXA 3AICA 3DC0A 2A6NA 1J0ZA 3AHXA 2PWEA 2WNNA 2NSOA 2ZBTA 1NVMA 3Q58A 1EHAA 2ON3A 3QRHA 4KWUA 2QJIA 2VEFA 1GNXA 3IJDA 1OADA 4LYRA 1V03A 3VGEA 1WKFA 1XV8A 3MO7A 2CZFA 1DWIM 4IJRA 4W86A 5DRCA 3CO8A 2CZVA 4QDWA 5DCBA 2P88A 3D3AA 1IZKA 1JDCA 4Q32A 1Z9AA 4NYYA 4A2SA 2X0HA 5TD4A 3GYCA 4C6PA 3GTXA 1UA3A 3MJYA 1XP3A 3F4DA 4LRSA 3EOUA 4IGNA 3CPRA 3DFPA 2GK1B 1D3CA 3KVJA 3CWNA 2XVPA 5I7GA 3H6OA 4R53A 2AAMA 3MP3A 2A3CA 4FB7A 3GWQA 2E6AA 2JIWA 3YPIA 3AALA 1ZBKA 1FWGC 4US5D 2Q8XA 2EHHA 4FAMA 4JTDA 3AMCA 5DBTA 3MBDA 1VBRA 4XX6A 4UFHA 3MS8A 1UD8A 1ECEA 1FP9A 4PMNA 1EIBA 2YBUA 1ZPTA 3R58A 4TV5A 4PBGA 5I3FA 1JI1A 1SPQA 1OCBA 5K9DA 1QPOA 3N3TA 1SQ7A 4LS2A 4CVUA 2I16A 4B5SA 2RDTA 4Z2IA 2J88A 1AQHA 4O16A 2NW0A 2DW6A 4FEZA 1M9HA 3TYZA 4ZE5A 2C13A 1ZCCA 3QTGA 2G50A 1WDQA 3UFYA 2ZIDA 4CCDA 4RDVA 1MEIA 1FX6A 3VOJA 1XWYA 3ABZA 4AZGA 1FVPA 1OSEA 2OCZA 3CIVA 4TX6A 3VUSA 4LU0A 3UZWA 3QBUA 4E8DA 3N17A 1R46A 4O1CA 3ES7A 1HJXA 3A3HA 5H8UA 2Z1XA 3CUJA 2O9TA 3PPGA 5CXPA 1T8QA 3IACA 3QGAC 1EYWA 3HFYA 2AQWA 2AMGA 1LCOA 2WHLA 4KFNA 3LZ5A 2YIHA 1MW1A 1KRCC 1U1HA 1Z8AA 1R2TA 3T9PA 3BCJA 1QJWA 1O60A 4G7FA 2BB0A 4PCFA 5HANA 4XUYA 3NQCA 4PUMA 2V6AA 4LUJA 3HA1A 1VYSX 2F38A 3VIOA 5BRQA 1WDWA 3QKZA 5PTDA 5D9NA 1V0MA 3G2GA 4WXZA 1FH9A 3UJFA 3E2RA 3B9OA 3TC7A 4FPSA 1ISYA 1VEPA 3AO0A 5K9CA 4GY7A 4P7QA 1LP6A 4K8GA 4R88A 1MW2A 5F4XA 3O3RA 3LN3A 3TKFA 3A9IA 3VIIA 1JDEA 1KM0A 2NX1A 3S2NA 4OBRA 3VUPA 2Z1BA 7REQA 2ESCA 4P8UA 3VE7A 5I3GA 5FA5A 1Q3NA 1FHUA 1KQYA 3GKAA 1HVQA 1CXKA 4AWEA 1UH3A 4A4AA 1HTIA 3S2MA 4RKAA 4M7TA 2FLIA 1N8WA 2QKFA 2YW3A 3LV5A 3LGEA 5AHIA 4BWLC 2GJXB 2NXGA 3HU7A 3JUGA 5F7UA 5LIWX 4IX0A 2W67A 4GQGA 4EE9A 2W6RA 1GONA 3STCA 3UPBA 1W32A 4PC8A 4UTIA 4JQ4A 1ADDA 4QCEA 3I3BA 1KFJA 3NXFA 4KFOA 2V68A 4IGSA 5J04A 1KFEA 4GX9A 3NSNA 1JZ4A 3F5KA 3O9NA 1KWGA 1GVOA 4IPJA 3CU2A 2HCVA 5IHSA 3GNOA 4A21A 1XD1A 3BLKA 3O1NA 2D20A 2FHCA 1UCWA 3B03A 3W38A 5IDZA 5AYYA 3IEBA 3ARZA 3HGSA 3KBMA 3IGXA 1J0KA 3ALGA 1MUWA 1J96A 1W17A 1XBZA 4K38A 3V0UA 1EBHA 2QCDA 1DV7A 4G7EB 4NVTA 4H6QA 1VBHA 3GH7A 3BANA 4QITA 3CZGA 1Q6QA 4D9PA 2CWNA 4JEJA 3AYRA 4GUFA 2P10A 1MXGA 2GGIA 3TNOA 3NQMA 3W7DA 1WB0A 3UWZA 3GKFA 2PTWA 2YW4A 2P8BA 2VEPA 1SFTA 3IJLA 2QCHA 9XIMA 3NCOA 3WH9A 4GYFA 5AY7A 1A5AA 2QCNA 3PWAA 1BXBA 3N12A 4HN8A 4O10A 1NP0A 4H2HA 3M4HA 1UWAA 4J3VA 1IXOA 2EKCA 2VGGA 5DMLA 5LYRA 3EOSA 3C3UA 4FO4A 1IXNA 1Q6GA 2BX7A 5A6BA 1Z7AA 2E8YA 3N2OA 1AQ0A 3H8AA 2R91A 1ZQ5A 1KCLA 3DZ1A 3ATZA 1I2RA 2WZHA 2XFWA 4I90A 3ZS4A 4QX4A 4LC6A 4A6GA 2BY3A 1T96A 1FDZA 4LBSA 4E3TA 3FJ6A 3NA8A 3NQ2A 1CB7B 4UOJA 2BFGA 2ICSA 4LVDA 3L5AA 2PDWA 3L2IA 1EO7A 4Q4OA 2MUCA 3P7YA 1VAHA 1ISXA 2VDHA 3L23A 1NU5A 4ZE4A 2RJGA 1EWEA 4PMJA 4NF7A 3ABOA 1V02E 3N1AA 2A7NA 2Z24A 1ZBVA 4C6QA 4Z2KA 3B8DA 4A3QA 3SI9A 4JY8A 3VKJA 1BYCA 2ZUSA 4F0LA 5CZKA 1UD6A 4JQAA 4QLJA 3AIRA 3UWUA 2PDUA 4UWMA 3WD2A 1C8VA 1KC7A 5A6MA 4WGXA 2C19A 2H9AB 4CEXC 4Z42C 2G4JA 4IMCA 1FKWA 3B8UA 4DO5A 5I6SA 1E0UA 3CK5A 1GQIA 1UYQA 4R34A 1QBAA 4IG2A 3ITOA 3SY1A 3T07A 4RDZA 1IZJA 1F74A 2WNZA 3UR7A 1D7FA 4KESA 4B16A 2WBGA 2PBGA 5MKGA 3TMQA 3TN4A 2BWGA 2CLMA 3IK2A 2BOFX 4LTSA 1RY8A 1Q5MA 1Q6FA 4XZHA 3URQA 4WJXA 3NQBA 3W2MA 5C9RA 1NIUA 2D3NA 1E0VA 3OVGA 4IIFA 3L4ZA 1CXEA 4LH8A 3WUEA 3LMYA 4Q8TA 2D73A 3OP2A 3GDTA 3CIWA 2UWFA 2J4GA 2Z2AA 3C56A 1EJRC 3N2XA 4XWUA 3DHUA 4J9JA 1C9DA 4OQVA 1PIIA 1Q66A 2NUXA 4GXPA 1CLVA 1R3QA 5TAOA 4O0ZA 4UMBA 3CH0A 4AISA 5D04C 4NHVA 2CNCA 4GPNA 3NL5A 1FHLA 2OGJA 4ZMGA 1QW8A 1VD6A 1M1BA 5DCEA 3M5VA 2OU4A 1KM2A 3L2MA 3QM3A 3J7HA 4XD6A 2F84A 4CNUA 1DJGA 1XCXA 4H8HA 3BLFA 1DE6A 3PG9A 5AHLA 2GQ8A 1AH3A 4W9TA 1SW3A 2EPMX 5AZ0A 1R3SA 2NVDA 3CO4A 2AQVA 4N4PA 2H8XA 2YYUA 3F1QA 4EANA 4KFPA 3SECA 3U3HA 2ATMA 3U0HA 1GG0A 2AMXA 4WLCA 3H24A 1LUCB 1OC5A 4Q8OA 5AC8A 2OXNA 3SCNA 3AMGA 4KKXA 1I9CB 1PE1A 3EWZA 4I8YA 3RPMA 3BLOA 2PF0A 1TELA 2H90A 3EAUA 1JZ5A 4XKYB 1L0PA 2E8ZA 1XDMA 3FSTA 4JFTA 2HVMA 3VM5A 2EG7A 3WG6A 1EF2A 3OIXA 3C0JA 4ICNA 2QNEA 1GYNA 1Q4NX 2QJJA 1B0IA 1THFD 2CLIA 2Y5JA 1SVDA 4CQBA 4CQAA 4XTDA 3S1GA 1H7WA 2DT2A 1I6NA 1T0OA 4JTCA 3W2KA 2GVLA 4CQ8A 1CWYA 2AGTA 2TSYA 4AY1A 3GBEA 5DELA 1GW1A 3WEZA 1CCWB 4A3UA 3TQVA 4MGGA 1FWBC 1KV5A 3FEMA 3MUY1 1BHGA 3KW3A 3CZJA 3U57A 4RE2A 1RPKA 3WD3A 4HMEA 1OM0A 4PL2A 4CD6A 5JBDA 4NIRA 3UP8A 3WX7A 2OKOA 3LG3A 3P8IA 1RJRA 3TTYA 1QPRA 4IQEA 3DN5A 1SZRA 4BS0A 4HIBA 4UUIA 3TR2A 1YTKA 1QO5A 3GU9A 4ZODA 4DJFA 4WY0B 5TIMA 1VFFA 5JH2A 4J28A 3EDDA 3GX9A 2VX6A 1P43A 1YADA 3BG9A 3W26A 1HJVA 1Q6EA 3ZT7A 3W82A 4LNCA 2G0WA 5B80A 3EPNA 2ALRA 4IQJA 1OC7A 4L6HA 4O53A 1K8XA 1WKEA 3RM4A 3E5BA 1V51A 4HA1A 1O94A 3R4IA 3M5XA 3APYA 3GUWA 4PUEA 3BW3A 4JKKA 3P60A 2QMKA 3BWWA 5I78A 1LOSA 3CMJA 4FOJA 2J78A 1GQLA 2QLYA 1XYLA 3CAVA 4AIEA 4ZOCA 2X8RA 4L1WA 1F76A 2GYIA 2G3JA 3TWBA 3R10A 4JTHA 4MMWA 1EC7A 3HPAA 1FY6A 2YZ5A 1VENA 3O0FA 5JIWA 5A6BD 1W2PA 1E1CA 1XICA 2PD5A 2XFYA 4WJEA 3BAJA 2OLAA 4GGBA 4K68A 1O6IA 5B7ZA 3EA3A 3W7RA 3TFCA 1V7YA 1J8VA 3OU8A 1E40A 5CQ1A 2DZAA 4KIRA 1IWBA 1J01A 4Q8QA 3VGHA 1YBQB 4REQB 1T6MA 2OO0A 3AIUA 3S4TA 1OGBA 5DY3A 3VAVA 2WVVA 3SN1A 4ZO7A 3RNDA 2PGWA 4TUFA 1RD6A 4ORIA 1A5KC 1IXPA 1Y65A 3KWSA 4QBXA 2GUYA 3MANA 1L9WA 1US3A 3WO8A 2W5FA 5CH9A 4JAWA 4P7LA 4NX0A 3BLIA 2YZRA 3U4AA 1FWTA 1D7KA 1TJ1A 4K7VA 4J40A 2WC4A 4N9CA 5MHBA 1XLFA 3MP5A 1QHZA 2ZX5A 3OVQA 3MDWA 2FDSA 4GUJA 2G3NA 4UTLA 1BTMA 1FQ0A 3ZM8A 1UWTA 1HZYA 1XIBA 3LCGA 4FXFA 3HPSA 1O5XA 2B4GA 3D6NA 3H70A 1WXZA 1RZMA 4E5TA 1XKYA 1IYXA 3VIJA 4HCHA 2W4XA 3IIXA 1PZ0A 1LORA 3LB0A 3SRFA 4PL1A 8TIMA 3T40A 2ZUVA 2J24A 2JBMA 1UWIA 3GUGA 4GINA 3LLDA 3T8QA 1YPIA 5HWNA 3QGVA 4HSNA 1T7LA 4DWSA 3MP4A 4K39A 4PUKA 2W61A 3W7OA 2YLAA 1X6LA 3URBA 3IGSA 4NNAA 4TTGA 2PCEA 1G5AA 2R82A 3QMTA 2NQHA 3VC6A 1W0MA 3KLKA 3L0KA 4BF9A 1PWMA 4CQCA 3NZGA 4AVNA 1SO5A 5IFPA 1GOIA 1R30A 1SO3A 4OV9A 4C7GA 1N7KA 5JBFA 4JTQA 3WDHA 1YDVA 3FGCA 4ENLA 1M53A 3U2EA 3KBVA 1JPKA 3T4WA 4U28A 1V3JA 1UKSA 1D9EA 3HPFA 3E0VA 3GR8A 5FJPA 3UEQA 4DAFA 2QAPA 4O0KA 2GVJA 5G4WA 3IPWA 3DU0A 3TAOA 4NI3A 5LNUA 2ACRA 3BSMA 4AF0B 1XIDA 3LCWA 1KCKA 2WCGA 2WMKA 3QY6A 1ZALA 3BZGA 3GU2A 3A6OA 2GQAA 2R24A 3VNKA 2FVMA 1HJUA 3FSUA 1MUMA 4GVFA 3RO8A 4UIOA 3FAXA 1X1OA 4IMDA 3AC0A 3I6EA 4B5VA 4JIIX 2D69A 2F6UA 3NQ7A 4NY2A 4UMCA 3I6TA 1OYAA 4UFJA 3VGDA 1XLIA 5LA0A 2D0HA 4MKNA 1J18A 2YJQA 3OB8A 5L9FA 2KX9A 4ADTA 4B5NA 3RO6A 1ENUA 5CZ0A 1TPH1 5BOOA 4NRRA 1ZBWA 1RP8A 5CAKA 4XD3A 3AHZA 2Z6JA 1SGJA 1QOXA 3R7MA 2PZNA 2W91A 3M16A 2NV2A 1F4AA 1ZLPA 1KRBC 4H83A 1XHGA 3OGSA 1G01A 3D0CA 1BWLA 2VI0A 3MKVA 3OA5A 2PP1A 4PTDA 4IMAA 5AC7A 4CCZA 4EPBC 3U2OA 3GG7A 4S3FA 4QROA 4Y8EA 2IS7A 4HA4A 1JJKA 4KQNA 1DIKA 2EBNA 1OHLA 1MQQA 4PUUA 5T26A 1SSDA 2D23A 2WHJA 4JTIA 1U33A 1E73M 2ZA2A 3C2OA 2VEGA 4IMFA 1IXQA 3G1DA 4GI6A 1XLJA 4PSRA 3E12A 1JL8A 1UP3A 2A3EA 4F9DA 3UVIA 4AIOA 2FIQA 1UC4A 1IIHA 3B40A 3UG5A 6XIAA 1CLXA 3NAVA 4KCWA 2Y89A 1RR2A 1HQTA 1K7FA 4AB4A 1JD7A 4B3ZA 1OVDA 3VOGA 3C0LA 3AIBA 4G56A 2GK1A 3W7NA 1V4YA 1KBJA 3S5YA 4GNVA 3VVGA 4F48A 3CS2A 3FA5A 4QS6A 2YSWA 5DT5A 4I9JA 3TSMA 4AZCB 4MJ2A 1VYRA 3GW0A 4MJ4A 4EF8A 3B9EA 3SFWA 2ZKMX 2Y2WA 2Z29A 5FJOA 1FWAC 1E0XA 1PCWA 4J3ZA 4DJFD 3VCRA 3G8EA 4KGJA 3ZJKA 1A5BA 4HTBA 4KEMA 1LWIA 3TIMA 3KHDA 3CXOA 2C0HA 5LIUX 2WLZA 4GUGA 5CPMA 1M5WA 4PB3A 4LANA 2GWNA 2A79A 3H7VA 4FNPA 3PK7A 1UWQA 3PPFA 3L0NA 1DXEA 1ICSA 2F7FA 3FOKA 4C1LA 4DWDA 1QUMA 3E49A 4MNLA 4D6IA 4GJ1A 1TCDA 1YDOA 1KRAC 3USBA 3R6IA 4L4OA 4NZ1A 3REQA 5BU6A 2EO7A 3WBWA 3GHTA 3E2QA 4RE4A 2XZ7A 1P6WA 4UQDA 4X9SA 2D0FA 4C6BA 1F3WA 4RZBA 3WEOA 3QZAA 1EXPA 1A3WA 1PTGA 2QPSA 4RR4A 3NPVA 4MB4A 2VZVA 1ZJHA 2VGFA 3LHYA 1LYXA 4QISA 1F6YA 2IQ0A 1ZP3A 1DL3A 5E70A 4ACZA 5A2AA 3P5YA 1UMLA 4MWAB 5HQEA 3B9DA 3UNDA 1UA7A 2NVAA 4Z1DA 1G7VA 1VJSA 1WBJA 4GIAA 2Z25A 4E8CA 3SRDA 1D8CA 4U5IA 3RU8X 2C14A 2GSHA 3AFBA 4Z2GA 5BWFA 3DHDA 3SAZA 2X1TA 5FF3A 3GVGA 4GVGA 3CPUA 1I75A 2VR5A 4FX8A 5E93A 4TOQA 4MSSA 1V6UA 4MF4A 1LT8A 3EYPA 4UFLA 2Y8VA 3WK3A 1SZEA 2PC8A 3S1WA 3CHEA 3WL1A 4I5UA 3L4WA 3RM8A 3NWRA 3BLEA 1KCZA 1FWDC 3T8LA 4XD5A 4ZFCA 2BXZA 2PDIA 3ONCA 1ONWA 1JYWA 4C6CA 2CBVA 1WUFA 4P61A 4S3CA 1JXKA 2WPBA 1NQ6A 1OK4A 3A64A 1XLHA 3ZVHB 3UWEA 2HQAA 5HBFA 3KX6A 3UPWA 3KZPA 1IQ8A 5FI8A 3WLOA 4CN4A 3TYAA 3ABXA 2RKXA 1MFUA 3C3NA 1Y7VA 3VU2A 4DJDA 1PPIA 4ZCWA 1M04A 1LG2A 2GJXA 4RZ5A 4ZQCA 3O7UA 3XISA 3W6MA 2G3FA 2ZUWA 3SCTA 4K1WA 1BF2A 3BDKA 2C8NA 3B0PA 4I9MA 1LLWA 4DWSD 2QF8A 4JTTA 4U4MA 1LM1A 1RY0A 4O15A 4PRRA 1W1TA 3LM3A 3DG6A 3LQGA 2QJGA 2OZ0A 4UTWA 1QHOA 2PUZA 3D3FA 3WUGA 4FLRA 3ZO9A 4NQ1A 2ZA3A 3LCHA 4HD5A 2DT1A 3F2BA 3T4CA 1C9WA 1GPFA 5D9OA 3PZUA 2EAWA 3KBNA 3S9ZA 1I0BA 3UG8A 1B3OA 3W7KA 4LAMA 1EGZA 3EWBX 3MUCA 1SMDA 2CKSA 3CBWA 2HMCA 1TWSA 5LIYX 4B2DA 1OX4B 2IQTA 4D1JA 4I9TA 4G7EA 4MLJA 1FWHC 1EJ7L 3SCVA 4UTJA 4WF7A 1HVXA 3BOLA 3APGA 3W2LA 3PNZA 2P50A 4GRSA 1XG4A 1QTWA 3AS0A 3M1ZA 1TVPA 2GDUA 5TQLA 1N82A 1S2AA 2EPOA 4Y9AA 3UJEA 4LVGA 3MHUA 3TSDA 1XC6A 2DT0A 3RRAA 1TCMA 2QJNA 2OSXA 4N4QA 2RHGA 1RALA 4Q7IA 3BMVA 3WD1A 3UNTA 1JF5A 3PP7A 3ABSA 5CKSA 3SO7A 4GJJA 2WMIA 4XAPA 1PZ1A 3M47A 3PZOA 6TIMA 4ILSA 4B15A 2OJPA 3GDBA 1ICQA 2WVTA 2PDKA 1E6SM 4K2SA 3L2LA 1TJ0A 4L9YA 2YKKA 3C86A 1MW3A 3B8WA 4JIPA 4MFDA 3P61A 2OGYA 3P93A 1V3IA 4RPPA 3JZEA 4L56A 1AJ0A 1UD4A 1VP5A 4JPGA 3VD3A 1ODZA 3KCOA 5GVJA 4Q8MA 2VFIA 5C6MA 2OB3A 3P67A 1PHWA 3GNPA 1XIFA 5C8BB 4PGLA 3ZXWA 3WQEA 4XBJA 2EGZA 1XRFA 2F9RA 3BG3A 3NL2A 3ZSTA 3TXZA 3LI0A 4YCPA 3NVDA 3T0CA 3RAOA 4HYWA 3KP0A 4MPQA 2REQB 4PEEA 2WXDM 1BSLA 3AIEA 3QQWA 2FGLA 4JEQA 3ZLHA 2XHYA 1S39A 3IIOA 4HP5A 4AQLA 1EC9A 2OOGA 2H9AA 2GOUA 2J7CA 3OVRA 2J7FA 4MFEA 3HGRA 5HNNA 3QW4B 5HMEA 3G0XA 3GXIA 2Y62A 3GAYA 3CMFA 2QR6A 4YJ5A 4INFA 2QXWA 1QXLA 1VFTA 3VCNA 1F3TA 3IVTA 4LS0A 5K9XA 3T44A 2DSKA 4AIBA 2YXXA 4W4QA 3IJQA 3W2NA 1RUSA 3RPTA 2YCLA 5DY2A 5G1MA 2FTPA 3GR4A 4W7WA 1OCNA 1WZLA 2PDCA 4GI8A 4IZGA 1GVRA 2UV8G 3HIJA 3DX5A 2RAGA 1M65A 3TSBA 3TW6A 1OEPA 3M64A 1OWQA 3WY1A 4LSBA 4DO6A 2Z6IA 1ML1A 3H2OA 4ACYA 4GI9A 3TUUA 3O6YX 3CAKA 1MUCA 1GVIA 3P6LA 3DXIA 1C29A 1P7TB 1JZ2A 2OEKA 3NGJA 2CU0A 2P1FA 4ZGYA 3P8JA 4HOZA 1CENA 3LTYA 3CYJA 4Q6JA 3B05A 4GC3A 1REQA 1W3NA 2HS8A 3W00A 4B4FA 2I9EA 4HK6A 1OT2A 4RE0A 3TZFA 4GOAA 5H2ZA 1TMQA 3ARTA 4Q4MA 4RV3A 4TIMA 5H6HA 1VS1A 2HTMA 3DYOA 1RH9A 2A0NA 4GBUA 4K8EA 3S6TA 4C65A 3P5ZA 1H61A 2DSUA 4D8LA 1R87A 5BROA 2DSWA 2E28A 4GIYA 2ISFA 4M0XA 2WZMA 3LGDA 1DQWA 2A4AA 2O4QA 3H2EA 3QW3A 4IM4A 1DTNA 3BGJA 2OELA 4KRTA 2GSEA 4B5WA 1TVNA 1XRTA 3MB9A 2VP8A 1BGAA 2Y5SA 1HFBA 1TV7A 2QVNA 4PBEA 4C1NB 4W87A 3SCPA 1UR9A 4GNJA 4O14A 4KCTA 1LUCA 2EG6A 3B0XA 4GZIA 2XFRA 4MB1A 5F2GA 4Y90A 5HA7A 3N6HA 4NXKA 3AMLA 1X8FA 4XB3A 3N4AA 3AMDA 4XKYA 3G5EA 5AC5A 4ZVJA 5G1YA 2PGRA 3EKLA 4MY8A 2J8TA 4P7NA 1DIDA 1UZ4A 2VENA 1CGVA 3CV1A 3C2FA 2PSNA 3S2LA 4HPNA 2HNHA 3WFLA 3FDKA 2CBJA 4Y9OA 2J62A 5E6YA 2Y88A 2R1PA 2UY3A 2R9RA 1OIFA 3N34A 4DBWA 4YPJA 4Q7NA 5F2LA 4G1NA 5HJXA 2YDSA 1RQBA 3R25A 3VOFA 2Y8KA 3WCZA 3WNPA 4ZQOA 2OYLA 3CEUA 4LYKA 3S2CA 3SGGA 1KD0A 3W1TA 2PWUA 1PX8A 3B3DA 3OHIA 5CSRA 1L6WA 3TP4A 3LPPA 2WVSA 4PMUA 3IVSA 3R0UA 4IGMA 1KV8A 4RL3A 5IHRA 4PTNA 3EB4A 2Q09A 2ZUNA 4Q4PA 1E6QM 3SUSA 3IJ7A 3O05A 1RK5A 2CLKA 4F2UA 1AL8A 1ME7A 3A5FA 4B2DD 4UTHA 4C6LA 1W2VA 5KZMA 4N6FA 5G2WA 4K36A 5HNUA 2WW5A 1SR0A 4DYEA 4IP4A 4C6DA 1XLBA 2QGHA 5XIAA 2BVYA 3WDJA 5A8OA 4BI5A 1M7XA 5IBXC 2PODA 2BOEX 3WMSA 1OZMA 3RCYA 4WJ8A 2Z2BA 3NQDA 4L7ZA 2Y61A 1VRXA 2PDNA 2WO5A 3V5CA 4DIAA 3GXTA 3VDBA 2XUCA 1WV2A 4J3WA 3C2EA 5EBAA 1U22A 3SSJA 1B54A 5I5RA 3MY9A 4IIGA 5ABGA 1UR4A 4PMQA 1HO4A 5BNKA 2ZC1A 3MUIA 1TTQA 2V5JA 4GH1A 3UERA 3B0UX 1DJIA 5E9XA 1B90A 3N25A 3BLDA 2EF9A 3P2VA 3WBEA 6XIMA 1E1FA 3W37A 1FWCC 4AEOA 3W22A 2F8QA 1WZKA 1EDQA 4ORMA 4HQVA 1EYEA 3KVLA 4ZB2A 2QUMA 4R5EA 1BYDA 3LOTA 3NUKA 2HROA 3PTDA 3UZXA 4DBEA 1M7JA 4QXIA 5K4XA 3GLCA 5DN1A 4URIA 1S5VA 2PBOA 3WF0A 2J6VA 3ZT6A 4H8UA 4NZCA 2Z2UA 2OQLA 4YS1A 3O16A 1WCGA 4YHEA 3FNDA 1YLVA 4S23A 3VD4A 1I1WA 3VABA 4NJHA 1XSKA 3B4UA 1ITUA 4I7VA 2FVKA 4PN2A 5AFDA 4G6CA 3B8SA 1R47A 1R6WA 1Z42A 2ABBA 2J66A 3GAKA 4UFIA 1WE5A 2DUAA 2I7GA 5CPTA 2UY5A 1XLCA 3FDGA 4JN6A 2PDPA 2XINA 3GDKA 1NP2A 1H1NA 3ID7A 3MU7A 2TMDA 2GOKA 2ATSA 3QHMA 4J3SA 3N6QA 2OX1A 1IT0A 3KS5A 2YPIA 2FZNA 1KR0A 4MTVA 4N02A 1E0TA 3QHOA 4NG3A 5DLCA 2XPKA 1TYGA 5DBUA 2PP0A 3ZJ8A 4EX4A 2W9MA 4XSLA 4Q6XA 1JFHA 1R3RA 3EEGA 3UETA 3L4TA 4ZBCA 1LDCA 2HXUA 2IXUA 5LSMA 3CIXA 1JNDA 8RUCA 4U3AA 2VXNA 3FYPA 2E5BA 2EJ1A 3QMRA 1NSJA 3PZGA 5HXMA 4WOZA 1AL7A 4PODA 3KCLA 3MI6A 4L4LA 1JZ3A 2X7WA 3FXYA 3TWAA 4WR3A 3S8HA 1H41A 4B91A 4ZL1A 1A80A 4UTKA 2G96A 1OD0A 4PB5A 1F5ZA 1H2JA 1E9LA 3B04A 4QAIA 2DZTA 3OBEA 1A50A 1F07A 5I02A 4NZ5A 2E7FA 3VX0A 3GG8A 1EUNA 3KAOA 4X9YA 3JRKA 3KOYA 1JCMP 2O56A 1AH0A 3GXFA 3UPMA 1NJJA 5CZTA 3UCQA 1IR1A 4QP0A 1VBJA 4ZR8A 1HKKA 1KW1A 4AD1A 1HUVA 3SN4A 2QYGA 5MF5A 3S9YA 1EJSC 1MXSA 4QFUA 3E3HA 3R13A 9CGTA 1TFVA 3N4EA 5AYBA 4LF1A 3SUVA 4AX6A 1JG9A 1FRBA 1SZGA 1HO1A 3O07A 5EYWA 4ZQRA 4Y8FA 3FW6A 1SW7A 4AD0A 4FLQA 2ISDA 2P76A 1E0WA 4ZQNA 4TVDA 3H4XA 4Z0SA 3CHCA 1WKYA 1G7UA 4IFKB 4LXFA 4Q8VA 4DLFA 1W8SA 4QRNA 4L4MA 1W5PA 3L0GA 2CKRA 4G5DA 4I6VA 4QM1A 3W7CA 1TQJA 1JFXA 4C90A 1ICPA 1JCJA 4E4UA 1UUMA 1I2OA 1Q85A 5CLWA 4AD2A 4IMEA 4JQ2A 4JTJA 3LBCA 3L4UA 1SSGA 2NQJA 1PVNA 2YX0A 1OYCA 3IS4A 1F9CA 4DBDA 2QCDB 3LHWA 2AAAA 1MZHA 4GNKB 1RSCA 1Y5XA 2H3BA 4JNYA 3EDJA 1LT7A 3UWQA 5HJYA 4O50A 3FHAA 2WKJA 4LCRA 1TPVA 5HQMA 2I9UA 1H0GA 4AD4A 4QIUA 1CGYA 2VELA 1UW9A 2Y5EA 4MUZA 4RV8A 7TIMA 1UKOA 4CUCA 3M0ZA 1QI0A 1WDDA 3UZJA 4ZA0A 1W1ZA 1M3UA 1LROA 4AH7A 3EEZA 2Z27A 4O28A 4TX9A 1PHQA 5CPOA 3BMXA 2C16A 3DI1A 6TAAA 2VOMA 3JU2A 4HOWA 1XS2A 3GVWA 3WNLA 4H9TA 4LV4A 4ZB0A 4C6IA 4X22A 4KWOA 3NPWA 2E6DA 1MXDA 4W8AA 3OODA 1GYLA 1QATA 3CUXA 4LPCA 4AZCA 4IL2A 2CFFA 4DUOA 4DELA 1F2JA 4L65A 4FF7A 3KCJA 4RPQA 1L2QA 4P8XA 3GVRA 2PGEA 1UJQA 4L4PA 2FTYA 4LCQA 5DRIA 3NVTA 1LBLA 3EB3A 4D2JA 1SFJA 1PXGA 1ELSA 2BGQA 4C6EA 2BMBA 1DJQA 5E0CA 1MW0A 2X1SA 3GFXA 1VKFA 4FS9A 3AUOA 2DIJA 1TPB1 2ZE3A 4R9OA 5BMXA 3CL6A 2W63A 1R2RA 4C6OA 3AXXA 3INPA 2G4FA 3WLJA 1W3JA 1GEQA 2C1HA 3OJGA 4XZBA 2I5IA 3S6OA 1XUUA 2VEMA 2GJPA 3TLLA 2R1MA 3ABQA 1MZRA 3TN3A 1AH4A 2E4TA 2V30A 2FZMA 1SU5A 1U2YA 4LUYA 2O9OA 1XGDA 1KR1A 1Q63A 4BEUA 3A23A 3ISIX 4GQQA 4H2CA 1BVNP 1PYMA 3WSUA 1EQPA 2BNJA 5M3WA 1EPXA 4MWAA 1I4NA 4GI4A 3UA3A 3M0LA 2GVEA 2E3ZA 1BXCA 1E3ZA 2VVSA 4JIEA 2Y6ZA 1OABA 1KBKA 4LB3A 1HL2A 1E9ZB 3PULA 4IG2B 4K7YA 3VK5A 1EJWC 4LX4A 3H54A 5ABHA 2BBFA 1H63A 1CTNA 1GJUA 1HP5A 2G5WA 3R5EA 4Z17A 1YPFA 5MKGB 1K8CA 3DH7A 3QFWA 2W92A 4LEFA 3JW7A 3PTQA 2X1IA 1H51A 2PP3A 2VUNA 5DEZA 2FJKA 2DH3A 2VT0A 4O8RA 5IXEA 1SJCA 4RK8A 3DFYA 5FL1A 5AB3A 1X8CA 4Y6GA 1RJQA 2GUUA 2G41A 1TA3A 4MKVA 5KSWA 3DBNA 1OIMA 1UIPA 1V3HA 5I0DA 4JTFA 1WXYA 5LA2A 8CGTA 5CGTA 3RR1A 4D6DA 1W3LA 1H7RA 3BSGA 2VNCA 3UBPC 3PZMA 4ATDA 2GZXA 1LBFA 5KZDA 6REQA 4I3GA 1TB3A 3CQHA 2A5HA 3HG5A 3PZNA 5D09A 1O5RA 4MNMA 4UZSA 2E5DA 4OKDA 3T2OA 5CSUA 4QJ3B 4Q8WA 3W75A 4NKCA 1S5NA 1GT8A 5ENLA 5J8LA 1YMYA 1LRQA 3PAJA 3OPSA 5D2YA 1UD2A 3NM3A 3DUGA 1FUYA 1XLDA 1PZ2A 1BWVA 2YR1A 4HU0A 4A2RA 1NTHA 1PAMA 1TE1A 5A8PA 2HVOA 1KFCA 4EPKA 3AUJA 4EAMA 5ABEA 4C1KA 1Z69A 2BXVA 4Q3MA 4HNUA 3EA1A 2Z26A 4B92A 1BYBA 3PBMA 1QBBA 1RV8A 4V27A 4PMVA 2RDXA 4NJJA 1PX3A 2Y0FA 1UQYA 2EKGA 2C15A 3W85A 1XYAA 3THCA 1RP9A 3TTQA 2GJLA 1SYTA 1RCXB 1OX4A 4PTWA 3PHAA 1QCWA 4ICMA 1W9BM 3GE7A 5EBUA 4DVOA 3R11A 2FMNA 2ONEA 3LENA 3DFQA 1TV4A 1HG3A 1EIXA 3CC1A 3AXIA 4JX5A 1O68A 1RCQA 3LDVA 2XH0A 3THDA 1UWRA 2NZLA 2A85A 4AZBA 3G1XA 1OBAA 2HXTA 4S3GA 3TN6A 1S2TA 2ANUA 1TWIA 1KGUA 1K8ZA 3QEZA 4LT9A 1RQHA 1DORA 2ZADA 1GOMA 2QDDA 2QGYA 5M5DA 4DUXA 3AROA 1WXJA 4QE1A 5C5YA 1JCLA 1P0DA 2XN1A 4JR5A 4J3TA 1E1EA 5FJIA 3K1DA 1JI2A 4MZYA 1NOUA 3POHA 4IJCA 1FKXA 4Z2HA 4YVPA 1QMLA 4GQ0A 2PDJA 4DJEC 5I23A 1F6KA 1AW5A 1HL9A 1M03A 1SJDA 2RFGA 4O52A 4KT2A 1Z89A 1ZY9A 4M6VA 1B3YA 1R9YA 3IGHX 1AW2A 2C18A 4MJZA 2BVWA 1G4EA 2EXOA 2PURA 5J5RA 3BICA 1W1PA 5AHEA 1E5NA 3DAQA 5LGZA 3CTLA 2INEA 5EB8A 5A8GA 2VFDA 2PDFA 1XPYA 1DTUA 1VPQA 2Z4GA 1CPUA 1G67A 2VZUA 4LVAA 2E9BA 3RFAA 3K4DA 3ZLGA 2EQDA 1NDVA 1G4SA 4E2BA 2OLSA 1P48A 1QK2A 2WCAA 4CNNA 3PUEA 4TVCA 1DQXA 1UKTA 1J6PA 4GX8A 1JAKA 2PPGA 3CH9A 2VRJA 1KXTA 4UQ9A 2VM8A 2FZDA 3UCCA 4A3RA 1NWTA 2XIQA 3CL8A 1L8NA 1Z3NA 4JX4A 3SDOA 3GHUA 2CPUA 4C6FA 3MUZ1 1ALDA 2DW7A 5C70A 1KKOA 1EGVA 2DVUA 3NDYA 4XIMA 1SFSA 3A4XA 4A3YA 1DJNA 2PAJA 2ZXQA 3WLPA 2QCGA 2WWDA 2J7DA 3IAPA 4GD0A 1GKPA 1K03A 1TX0A 1FP8A 3UGRA 2ZXAA 5JMUA 3M0HA 1IEIA 3E74A 4QQ3A 4V1YA 2CHOA 2VR4A 2WPGA 3EX6A 4M6PA 3GH5A 3BVJA