3R8RA

Transaldolase from bacillus subtilis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
212
structure length
212
Chain Sequence
MLFFVDTANIDEIREANELGILAGVTTNPSLVAKEANVSFHDRLREITDVVKGSVSAEVISLKAEEMIEEGKELAKIAPNITVKIPMTSDGLKAVRALTDLGIKTNVTLIFNANQALLAARAGATYVSPFLGRLDDIGHNGLDLISEVKQIFDIHGLDTQIIAASIRHPQHVTEAALRGAHIGTMPLKVIHALTKHPLTDKGIEQFLADWNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Transaldolase
publication title Conservation of structure and mechanism within the transaldolase enzyme family.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 75
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, P, R, T, U, V, W
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3r8rA00
2TYSA 4NX5A 1GG1A 1I2QA 3NNTA 4RCXA 1U83A 3NQ2A 4MZYA 5F1VA 1B4EA 3PVFA 2O7SA 4KFOA 4RX0A 5I3KA 4LW7A 1W5QA 2QCLA 4ZQOA 1YPFA 2GVLA 3G8EA 2DP3A 3LCXA 1OFEA 1PCWA 4NJKA 3UYCA 4JTUA 5CPMA 5F2LA 3BO9A 1TTQA 5D02A 4TR9A 2E68A 4O19A 2X1RA 4JS3A 4LVDA 3C0JA 3H53A 4M5PA 1ICSA 1EWEA 1W3TA 1R2SA 1LM1A 3TKFA 3UWZA 3HG4A 3ELFA 1TREA 3P61A 4IMCA 4O50A 2CW6A 3MO7A 1VCGA 4O54A 3TMLA 3NL3A 3KXQA 4O8RA 2B7NA 4JX4A 4Y8FA 5AHEA 1DVJA 4RR4A 3O07A 4QAIA 1FDZA 3G0SA 3RMJA 1JULA 2JGYA 4OE7A 2O7QA 4YWIA 4O52A 3IIXA 5H91A 3CC1A 3Q58A 5EYWA 2XN0A 3IRDA 4JTSA 3P62A 3M5VA 3NG3A 1T99A 1T96A 3BW2A 2QAFA 1FX6A 1GVFA 3WK0A 3VI2A 2B7PA 3Q94A 3LI0A 4U4MA 2DORA 4GXMA 1MO0A 2XN2A 2F7FA 4K6AA 4JTLA 1S5VA 4ADTA 1GVQA 5I3IA 2Y62A 1N8FA 2YW4A 3M5XA 3PAJA 3PULA 5A8GA 4EOUA 2ZRZA 3ZFHA 4O16A 5TIMA 3DHFA 1N55A 3LXCA 3C61A 4QQ3A 3GNNA 4LC8A 2QUUA 4O28A 3W07A 5G2IA 2ZRYA 4O1AA 5LNVA 2JKAA 1P4CA 1JUBA 4UIOA 5IM51 4LNYA 5AFDA 2PCQA 3HO8A 1OX4A 1RQEA 1K8ZA 4AVFA 3PM6A 1M7OA 2QCEA 1W0MA 3TAKA 3RFAA 1VC4A 1OFOA 3HOJA 4TX9A 3TC6A 1G4TA 1HG3A 4HSNA 4JTHA 3KRSA 2J9XA 3OVQA 1KV8A 3N14A 2FDSA 4ZQMA 3LCGA 4MOZA 3HPSA 3T7VA 3W7DA 3R13A 1LZOA 4GWEA 4HN4A 3FFSA 4FIRA 2W79A 4PA8A 2V82A 1LRQA 4IGHA 3BGGA 4K7VA 5HULA 3W7JA 4Z1BA 1SR9A 1OFDA 3JR2A 1FWTA 5LNSA 1C8VA 4NXKA 2EAWA 3F1QA 1Z44A 1KFBA 1WOBA 1KLZA 5A5WA 3DGRA 1OABA 3NQFA 4Z1CA 1H61A 4K8EA 2FJKA 4N9DA 3W7CA 1JUKA 2QDHA 3PSWA 5BMWA 1XC4A 4JTEA 1A5CA 3IIPA 1VS1A 1M7PA 1VCVA 3FS2A 1BEUA 3LTYA 4I7WA 1OFRA 2CU0A 2J27A 5K9XA 5TBOA 3W1UA 3NQEA 2QJGA 3UWUA 5HWJA 4A3UA 3EKLA 4AHPA 2GJLA 3FYPA 1XBVA 4ALDA 1IXNA 3LCHA 1CW2A 2WNNA 4EVZA 2QEZA 1OFQA 3N9SA 1I2PA 2C15A 1LOSA 3GDTA 3L0KA 1L9WA 2A21A 1QDSA 2X30A 2ZA3A 2C16A 2RDUA 5AYXA 2B7OA 3LV6A 1XI3A 3M16A 2BLEA 3SSJA 4FIQA 2HTMA 3LBCA 2NUWA 3PY2A 1R46A 4YXGA 4JYFA 3STFA 1KM3A 4I7VA 2V8ZA 1GWJA 1WBHA 1F5ZA 3LDVA 1VYSX 4XBSA 5LGXA 3W87A 1LBMA 3V1PA 1LP6A 3GXNA 4LV9A 2OZ0A 4AF0A 3UPBA 3ZR4A 4L4LA 3ABQA 3NDOA 5C2XA 2ALDA 3C56A 4UTIA 1JCYA 1NEYA 3GR7A 4NNAA 4JR5A 3KRZA 3C2RA 3FKKA 3U2OA 2VFGA 1QMLA 4WXYA 2NV2A 3IVSA 2HMCA 4IXXA 3NPWA 5D2XA 3NQMA 1IGSA 2FPVA 3EXTA 4P61A 3EX4A 3CPRA 1FWSA 3E12A 4BF9A 4A2RA 5KMYA 3G1YA 3G0UA 3QSRA 2X2GA 4RZ6A 4UC5A 1Q6RA 2NUYA 3BG9A 1I8JA 1W5PA 4FF7A 3MI6A 5IBXA 2J6XA 3S9YA 2J9YA 3P81A 4XQ6A 4WOZA 3O6CA 1IXPA 3SI9A 1B4KA 3C6CA 3F03K 3TIMA 5HR6A 1PCKA 3QZEA 4RXGA 3WJWA 4KWVA 4JD4A 4CNNA 4OU1A 3D0CA 3MI2A 3STCA 3FOKA 1O60A 3KVLA 4O4VA 1LORA 4AMAA 1YPIA 4DBEA 2EPHA 2E6YA 4YLWA 1K02A 2QDGA 1HFBA 3NOEA 1LLZA 1OVDA 5C6MA 4N02A 4G1KA 5CPLA 3CTLA 1OFPA 5EA9A 2QAPA 2GQ9A 3N3MA 4O14A 2Y6ZA 3UNDA 1GG0A 4MJMA 3M7WA 4ZVJA 1W1ZA 2AGKA 2ABBA 4QISA 2BX7A 1UASA 3DXIA 1Y0EA 3UD6A 3U8GA 3DKLA 3NA8A 4LOCA 4AHOA 3TQKA 4FNQA 1OF8A 2A7NA 1SW7A 4S2CA 1EA0A 4UCGA 1TCDA 3BPWA 4TMBA 1MXSA 4TO8A 5D32A 1SSGA 1TSIA 2PE4A 4JDBA 1ALDA 2Y7DA 1SU5A 3R89A 1HO1A 4AB4A 2DJLA 2RHGA 1XDLA 2CWNA 2ZFAA 2CLMA 2HS8A 4JIPA 4UFHA 1XXXA 1DHPA 4KFPA 2FQIA 2NXGA 4NZFA 2YXGA 1H1ZA 3W23A 3M1ZA 3A21A 5HINA 2WNZA 1SPQA 5G2HA 1MEHA 2Z1BA 1VZWA 3CQ0A 1EP1A 1H62A 4M7TA 1FY6A 2VEKA 3W9ZA 1XBYA 3DFSA 3KFTA 2DZPA 1XBXA 3L21A 3O63A 1JCNA 3QW4B 4FX8A 4LT9A 3BW3A 3W7PA 2R94A 1ZAHA 1MSSA 1DV7A 1W3NA 3LHUA 2GQAA 3B0PA 4NX0A 3L9CA 3NQ7A 3RLVA 3GAKA 4MFEA 2H3BA 3C3NA 1TV8A 5AC7A 4PCFA 3S0CA 2ABAA 5BNKA 3THQA 1EIXA 5J5RA 2C19A 4MLJA 1I2RA 1BTMA 1XKYA 4XUGA 2TMDA 1GYLA 3PB0A 2ZRXA 3C2OA 5D04C 2E77A 3NQCA 3S42A 1FDYA 2OX1A 3NAVA 4UTMA 3BARA 4ORMA 3LCIA 2V5BA 4LWWA 5CG7A 1B57A 1YXDA 2WOQA 3QMRA 3MBFA 1MZHA 1JQXA 2CLOA 4Z0JA 4O53A 4WY0B 2QF7A 5C5YA 2VFHA 2ZZ2A 3CB8A 4O57A 3TQ0A 2V81A 4LY8A 3OHIA 3W2NA 5LNWA 3GNDA 1QO5A 3T4CA 3O6YX 1SZGA 4JDYA 1ZY9A 4N2YA 2NZLA 2GQ8A 5CGQA 4IMGA 3HIJA 3LOTA 1RQBA 5F2MA 1OG0A 5DLCA 1BKSA 1TIMA 3IGXA 3PSVA 1KV5A 1HUVA 5DCDA 2ZRUA 2P0OA 1F7BA 1W5OA 3RNDA 1H7PA 1VH7A 4AAJA 1Z42A 4GUHA 4CNOA 1GZGA 1VHCA 1A53A 2G96A 4BI5A 4MY9A 1AMKA 5D09A 3W1QA 3ATYA 1OFAA 4WJEA 5CZJA 5FEWA 3SW6A 3S5YA 1CX9A 1O4UA 4CQ8A 3LCLA 1C9DA 3G0XA 3G1SA 1YADA 4JN6A 1ME9A 3TNOA 4JTGA 2GPTA 2V2DA 2WJZA 4UTTA 2GUUA 2NXHA 3W7NA 7TIMA 3W1RA 3AO0A 4XWUA 5HNRA 3N9RA 4HKPA 3QMTA 1GT8A 5DBUA 1YLVA 3SECA 5LHFA 4IX0A 4H6KA 4XTIA 1FQ0A 4M6VA 1KM5A 2AAMA 4NJIA 2FB3A 2FTPA 2V9DA 3YPIA 4R7JA 4M19A 3MHUA 1WX0A 1JJKA 1E51A 5D33A 4PL1A 3NZ1A 1H7XA 3PUDA 2YPIA 4H4IA 3STEA 1G6CA 3F4WA 3W3OA 3E0IA 1TYGA 3KX6A 2VC6A 3A5VA 2A7RA 3OVPA 5FEZA 5CZ0A 1O5KA 4IQLA 2ZDRA 3CIXA 3W2UA 2TPSA 1H1YA 1K8YA 3GZ3A 4X9SA 5G1YA 1JQVA 4HSOA 4MY8A 4Z1DA 2NWSA 4IPIA 4ZZ9A 3ABOA 2E6DA 4L4MA 2FPTA 3QMSA 4WX2A 2A0NA 2GJNA 3EX1A 3R8RA 3O6DA 1TTJA 2VFFA 4C1LA 4IWWA 2Y7FA 4FNSA 4FXRA 2ZA2A 2I14A 1OYBA 3TQVA 2ZTKA 4EWND 4XTDA 3L0GA 3F4NA 1SZNA 3W88A 5AHFA 1DORA 4DF2A 5AC6A 3T44A 1AW2A 1VQTA 3TAOA 4X2RA 5AHNA 5EY5A 2D73A 5K2ZA 3WJXA 1TPB1 4GNJA 2NUXA 3TE9A 1X6UA 4TMCA 5CSRA 1TTIA 2E5CA 5DY2A 1M5WA 3NQGA 5G1TA 1H7OA 1XUZA 1W5NA 2CZFA 1HL2A 3BG5A 3P5ZA 2YDAA 2JKPA 4UMAA 3LI1A 3FEMA 3TW7A 5F1UA 1YDNA 4X3ZA 5E0KA 4O4WA 4M7SA 2TRSA 4MLRA 4YMZA 4K39A 1ZENA 2ZTJA 3MP4A 4JEQA 3UY8A 4OBTA 4NQ1A 3W2LA 3P80A 2B0MA 1RR2A 1H7WA 5T26A 3FIGA 1H60A 4UFIA 5KITA 1KA9F 3G18A 4KWWA 3W7IA 4XBKA 3L5MA 2I1OA 4LRSA 1TV7A 4JYDA 3UPWA 5EMUA 3EWBX 4UTLA 4Q33A 1WBJA 1T8XA 2ZZ4A 1S5TA 1G67A 2FB2A 3TK7A 5F2GA 4A21A 3PG8A 2GVJA 3G3DA 1KM0A 5HMSA 3VE9A 3QQ1A 3W1MA 4Y9AA 1VLWA 1X1ZA 3G1XA 5D2WA 5G2WA 1U5JA 2PRMA 3O06A 1QPOA 4LVBA 2C3ZA 3BV4A 3UY7A 3G1HA 3LGEA 3PWAA 2R14A 4N4QA 1EPXA 4HHPA 4I9AA 1PVNA 4AWUA 1F2JA 4QSHA 1ZNNA 5DY3A 3I7RA 3P5YA 1ME7A 5U7SA 4UTWC 4MVAA 1W3IA 3NQ6A 3NPXA 3RU6A 4AH7A 4Y90A 3C52A 4JX6A 1XUUA 3G1AA 2A5HA 5U4NA 4AEOA 2HS6A 4LRTA 1TPC1 4OV9A 1B3OA 4JYEA 3W1PA 4OV4A 2WSQA 3AJXA 1FBAA 3LLFA 3R2GA 1KM6A 3NGJA 4O1CA 3EWXA 4FB7A 3HG2A 3LBMA 3PBYA 1QNVA 3DAQA 1S5WA 3G8RA 4LS1A 4YL2A 3SGZA 1SW3A 4MPQA 1WYIA 5F2IA 3LX9A 1ZHAA 3EXSA 1OX5A 1WDWA 4ZQRA 2Y89A 3WK2A 3B03A 4QM1A 3TXVA 2QCMA 1HTIA 3U6WA 3E9AA 2ATMA 4FNTA 3W7QA 1FCBA 5EPDA 2YZRA 1GTHA 1A5BA 1YYAA 5EKYA 3EB2A 1TPUA 1C29A 1KTCA 2VFDA 1OX6A 3DU0A 1X7FA 5KZEA 2YSWA 4MYAA 3CHVA 2W0UA 2R91A 1XFBA 4EIVA 3EX6A 1EP2A 5AOUA 2BWGA 5K9DA 4CCEA 3KOFA 1EUAA 4NNCA 1L6WA 1FWRA 3Q37A 4UMBA 4ADUA 5KZMA 3QRHA 5LHEA 2C1HA 3LB0A 4RXFA 3LRMA 1W56A 2WQPA 1SFLA 1YDVA 3PB2A 3RLUA 3MP5A 4BK9A 1WV2A 2GOUA 1P0KA 1B9BA 4OWGA 3HPXA 3ABSA 3M5ZA 3ABRA 3MI3A 3PG9A 3VFLA 2DZSA 5K3VA 4WUIA 3N2MA 2QCGA 3HGJA 4PC8A 1EUNA 3MUXA 3SY5A 3CIWA 1F74A 5LZLA 2G97A 2DZUA 5D2VA 5HUOA 4ONVA 2CFFA 2WNQA 2ZBTA 2EF9A 4NJGA 3S8HA 1YTKA 4E38A 4UFKA 3CWNA 4MFDA 1F05A 3I7QA 1J2WA 3W74A 3UXDA 2J24A 3VE7A 5AYZA 3C2VA 1SW0A 4NZJA 1J5TA 4K8HA 2ATSA 3LXBA 1UB3A 1PE1A 3W7EA 4O18A 3BVJA 3MMTA 5FESA 3E02A 3NL6A 1ZCOA 5LSMA 3GDRA 2Q3RA 4BR1A 4DPPA 4LV4A 1G4EA 4HNTA 3P8IA 4NNBA 4OHQA 3GDKA 4XZ9A 4IMEA 3UZJA 3EWYA 2UV8G 3W2KA 3PUOA 8TIMA 3HBLA 4A2SA 1DL3A 1MEWA 3TFCA 4GC4A 1J4EA 1XCFA 2A7PA 5FF3A 3HF3A 1TPWA 4S1FA 2ZYFA 4K38A 5D38A 2AQWA 3DH7A 3IGSA 3RF9A 1LOLA 3TX9A 3V75A 2Y7GA 4B5NA 1OFBA 3S5NA 4ZQNA 4N9EA 4IPJA 2QJIA 1M6JA 3B05A 1JUEA 5D05A 4JNMA 5LNUA 3CM4A 3P74A 3QYQA 1L6SA 2JKEA 4Z08A 1TJRA 2VEPA 3W7RA 1H63A 5KTLA 3MHFA 1I2NA 5I3HA 1I4NA 3DFQA 4NJJA 4UXDA 1LOQA 2J88A 3O8AA 4ORIA 1XM3A 1NFBA 2VFIA 4LVAA 3DFNA 4E0CA 3FJLA 4JTFA 4JIQA 5AHLA 4D2JA 1X1OA 3JRKA 3SZ8A 4LVGA 1K3UA 4UFLA 1QOQA 4GE8A 1DJNA 3FA5A 4QITA 3LTPA 2ZQ0A 1TRDA 5K7JA 5J5DA 1RV8A 2E6AA 2NLIA 4UTKA 3IEBA 2H6RA 1AL7A 4PL2A 1QWGA 4LS0A 3P67A 3TV8A 1YDOA 1A50A 5BOOA 3P7YA 3GB6A 4YCOA 4RKAA 5G4WA 3I65A 1EEPA 1GOXA 1KM4A 1VGAA 4QNEA 1AG1O 3W84A 3KVKA 3DENA 3LHTA 1PV8A 5CZSA 2V2HA 4AWTA 1FCUA 2CLHA 4HPJA 1EP3A 4A29A 1D3HA 3C8FA 4RZ5A 3HGRA 1R30A 5LGZA 1GYNA 2ZZ3A 4UTUA 3B4UA 2A6LA 2YFOA 3IIZA 3L67A 1OX4B 4DXVA 1T0OA 1BWKA 1FCVA 2FLIA 4RZ4A 2CZ5A 3UWVA 1P1XA 3TW6A 3B06A 1SUXA 1LRNA 5I3GA 6TIMA 3NL2A 1OYCA 1KTBA 4GBUA 4NU7A 3W85A 5D2TA 1TO3A 3A23A 4MKNA 4MUZA 1L6YA 5BMXA 2C0AA 3CLMA 3G1FA 3KHJA 5TQLA 2ZRWA 3WJYA 4NJHA 4DEFA 1H7NA 3BLFA 5G5IA 1RPXA 3WK3A 4R53A 4ICNA 1GVRA 2X1UA 4O10A 4YCPA 3KVMA 3OG3A 2VEMA 5KSWA 1ONRA 2CLEA 3G1DA 4RLIA 3QM3A 3L66A 2CLLA 3N19B 1CI1A 1QPNA 5DXYA 3NO5A 5KINA 3TA6A 2Z6IA 3HG5A 1H7RA 3QPYA 2YFNA 1F76A 2Z0IA 3W7KA 1ZAJA 1NF0A 3W1LA 1GPWA 3ZWSA 2YW3A 2X16A 5C55A 5DBTA 3NPUA 4UTJA 1NVMA 3M43A 1A5SA 5D30A 3PS7A 4UUIA 2Y63A 1ADOA 1FWNA 1IIHA 2CZEA 3T40A 3CEPA 3GXPA 4OGZA 2A6NA 4DO4A 6ALDA 1HO4A 4GRSA 3DKJA 3TXZA 4Z0SA 3USBA 3TDFA 2A1YA 4P2VA 1D3GA 4IMDA 3HPZA 2G5WA 1RD5A 2C13A 1OJXA 2IQTA 4PODA 1VLIA 2WSRA 1YXYA 4O15A 1MEIA 1GVOA 4AXKA 2V2CA 2P1FA 4HT3A 4MZ8A 4MIMA 4RV8A 4JY9A 5L9FA 5E1QA 1K7EA 4Q4KA 3A9IA 3S1VA 1IIGA 1LYXA 1WAUA 2QCDA 3OVRA 1KBJA 2JK2A 4GJ1A 4JICA 3T55A 3M0ZA 3SJ3A 1FCQA 1UCWA 3RK8A 1THFD 3L0NA 4IOTA 1UBSA 4MZ1A 1G4SA 4DF0A 1JRBA 4XKYA 3S1XA 4ZQCA 1EX5A 4WD0A 1FXPA 2Q3OA 4DF1A 3I7SA 3W1AA 1RVGA 4BI6A 1I2OA 1GTEA 4K7YA 4O17A 1KBIA 4AF0B 1S3HA 4E2DA 3L2IA 3W2MA 5D37A 3EKZA 3HMJG 1P0NA 3UWQA 4FX6M 1JRCA 3EXRA 3N34A 1I45A 1R2RA 3H55A 1PIIA 3JS3A 5F4WA 2BZNA 5AC8A 1O94A 2YGYA 3NM3A 3PR2A 3IV3A 1SO4A 3TSMA 3W1TA 1H5YA 5I3FA 2A85A 3QJAA 4EF9A 3G24A 3P60A 3TU9A 1V5XA 3UQNA 2B7QA 5C54A 2JBMA 1SSDA 2C14A 1L2UA 1LBFA 2A4AA 5FF2A 2RFGA 1LROA 2R8WA 4M6PA 1TV5A 1JCXA 4JXCA 3GVGA 1W54A 3LXAA 5MHBA 3QF0A 3NXFA 4OQVA 3PBVA 1AK5A 2ISWA 1W5MA 3QSTA 4OT7A 4LU0A 2ZRVA 2ZA1A 1TB3A 5FF7A 1LCOA 4IJBA 1IXOA 4M6QA 3L5LA 3OA3A 1R2TA 2E5DA 3IIOA 5DCEA 4PEKA 3TJXA 3G22A 4GFSA 3UZ5A 1DQWA 5FI8A 2W6RA 3SGUA 3PC0A 4FNRA 5AB3A 5DN1A 1JCJA 4FHAA 2RDWA 3HGSA 4CQAA 1DJQA 1JR1A 3NQDA 3HG3A 2H8ZA 3BGJA 3S6DA 3A5FA 3CEUA 1F6PA 4TIMA 3MYOA 1JCLA 4AWSA 1FUYA 3C2EA 4QIUA 2BTMA 4C1KA 3GDLA 3NEVA 3UXAA 1OYAA 3W70A 1KM2A 3IVUA 3EX3A 5CPOA 4PTNA 1VJIA 3G1VA 5K4ZA 5H2ZA 3BK0A 4WOQA 3W7HA 2Q8ZA 2YX0A 2E09A 3MP3A 2EKCA 2NXIA 3THAA 3G3MA 2QJHA 1Q6LA 5SWUA 1PHQA 4UTHA 3M9YA 2OT0A 3N73A 2RDTA 3TSBA 1K7FA 1NSJA 4O11A 3E49A 2F84A 5E93A 4IUOA 2Y61A 3WFAA 1SZFA 2QCHA 3LHVA 3LHWA 3EWWA 1N7KA 1IXQA 3EX2A 3LCWA 4A22A 3W22A 2YYTA 3S5ZA 3INPA 4ZQPA 1V7YA 1SFJA 3DFPA 1H51A 2OCZA 4AHQA 1QPQA 2VELA 1Z48A 3GKAA 4JX5A 3IVTA 3LHYA 4I7UA 5LNRA 2Y85A 4FEZA 5LKYA 4WY0A 4Q32A 2VENA 1LBLA 4O12A 5HWNA 3TCEA 3FKRA 4K36A 1R47A 3GAYA 3FJ6A 3QPZA 1K03A 1UUMA 2Y70A 1RZMA 1W8SA 3ZS4A 4GUIA 4FO4A 2QKFA 1TRIA 2QUVA 4WXZA 4LUJA 2DZVA 2WV8A 3I6RA 2OMAA 1G69A 2BSLA 3TH6A 4H3DA 5CSSA 2A2IA 3L65A 4S2BA 3M6YA 4NUWA 3UWYA 1LDCA 4FNUA 1W31A 3NPVA 1AL8A 1JVNA 3LERA 3W75A 3TSDA 3DI1A 4DPQA 4LTSA 3OIXA 4UTWA 4IXHA 3BG3A 4J9JA 4IX2A 4UNKA 1F73A 5EL1A 4JTIA 3EWUA 2WO5A 5G4EA 3W76A 3GYEA 3NVTA 3PUEA 2EHHA 1ME8A 2B4GA 1TJPA 3QC3A 2JGQA 1VYPX 1GVSA 4EF8A 5AYYA 1WOAA 5K4XA 3B0VC 4BI7A 3M44A 1BWLA 1PS9A 1YXCA 4O1BA 1O95A 4HPXA 4MYXA 2DZXA 3L68A 3W7LA 3R12A 1TTPA 4CNPA 3IIVA 3A24A 2H90A 3PF3A 2YCEA 2CZDA 1TQXA 1A5AA 2PURA 2NX1A 1QFEA 3DBPA 1G7UA 1SO6A 4QNWA 3KRUA 3O16A 5IBXC 1NAL1 4CQ9A 3GR8A 5AN7A 5HJLA 5GVJA 4N6EA 4NVTA 1GQNA 3Q2DA 4U28A 1WA3A 3LTSA 1DBTA 2V5LA 3TJLA 3VNDA 3SFKA 1D9EA 1NF7A 4GUFA 3I68A 4Y6GA 1ZAIA 1X8FA 3PBWA 2Y88A 3HQ1A 2X1SA 4O0KA 4LS2A 3GXTA 3W73A 3GLCA 2QUTA 3DZ1A 3HGOA 2NWRA 2DU2A 2TSYA 4JY8A 1KFKA 1KFEA 2ZZ6A 1G4PA 2ISVA 1OK6A 3LCFA 4R34A 1K8XA 3QQ0A 2J9ZA 3GDMA 1FDJA 3O15A 1QO2A 1UUOA 5AHMA 3HJZA 3O05A 4K37A 3BLIA 1QAPA 3DI0A 3DHDA 3KVJA 1DOSA 2CLFA 4ML9A 1SO5A 2ISSA 2QCDB 2XN1A 3FYOA 2X1TA 1IF2A 1ZJIA 2NX3A 1VCFA 3SIZA 1UJPA 3LHZA 4XKYB 1LRTA 2VKZG 3TFXA 4UFJA 1KFCA 1OHLA 4POCA 3DFTA 2QCFA 4NT0A 1H50A 3GIYA 3TROA 3B04A 4UFMA 1F6KA 4LUIA 1SZEA 2GVGA 4BFAA 5BW6A 3W1NA 3NR0A 2PRLA 2VEIA 5CPNA 1RQHA 3DFOA 3E96A 2Q8LA 2OT1A 1XL9A 3QEZA 1Q6OA 2ZCGA 1DKWA 3W2JA 3KAOA 3MYPA 5ABTA 4W9TA 3WJZA 1Q6QA 4UMCA 2FIQA 1JCMP 2QCNA 4DELA 5F4XA 3GKFA 1KFLA 3M47A 5DXXA 4PH6A 4ADSA 2DZTA 5F4SA 3GX9A 4MJZA 4WY0F 3GK0A 4GUJA 5KZDA 4NXSA 1XDMA 2E5BA 3STGA 3OEXA 3LLDA 3S1UA 1OF6A 3B8DA 3W86A 1ICQA 4RJEA 4HNUA 2VOMA 4FXSA 4X22A 2RKXA 3TUUA 2VFEA 1LTDA 1WXJA 3R5EA 1KTNA 3OBKA 3P84A 3W83A 1VRDA 2YYUA 3MW7A 3O1NA 4MY1A 4N4PA 3NQ8A 3ANYA 2QCCA 2P10A 2C18A 1VPXA 3C4UA 3PBUA 2HSAA 4HNVA 3LV5A 3MHGA 3W1XA 4BWLC 1QR7A 3CT7A 1OK4A 4IMFA 2DZWA 3CU2A 4FX7A 4N6FA 4N9CA 3ZWTA 1VYRA 2XFWA 4E2BA 4DO5A 4JTKA 2WPBA 1SO3A 2YR1A 3VKJA 1FXQA 1PHWA 2Z2UA 2Z6JA 1WQ5A 4PFMA 4N9BA 2QR6A 3M5YA 3NQVA 5HQEA 3HB9A 4LC6A 1K7XA 3MWAA 2CLIA 5DELA 1O5XA 2BXVA 5FF0A 4HNNA 3TMQA 3QH2A 3QFEA 4WQ6A 5FEPA 2I9EA 4R33A 2ZZ7A 2C6QA 3W7OA 2E1DA 2PRHA 4CLMA 2ZZ1A 1YTDA 5BRBA 1ZALA 3N2XA 2V30A 1FWWA 4HIBA 1VR6A 4DQWA 4Z1AA 4O0ZA 3SR7A 5HR7A 2FFCA 3W71A 1GJPA 2LLEA 2PC4A 4BWLA 3W7MA 3B0UX 3IGUA 1QOPA 3K30A 3LRKA 4KKXA 2H3DA 3TC7A 3ATZA 3T78A 2ZZ5A 1YTEA 5EBUA 4FNPA 3NZRA 2NV1A 3C2FA 3NM1A 2WKJA 4GUGA 4WZHA 4TU1A 4DO6A 1KFJA 4ZL1A 1TPEA 3QW3A 4CCCA 1ML1A 2E6FA 1EB3A 3BLEA 3NL5A 4O13A 1KW1A 1W37A 2OJPA 3BW4A 4Y96A 2H8XA 1GEQA 1ZFJA 4UTTC 3W6YA 1SQ7A 1TPH1 3CWOX 4O1DA 1KM1A 3W72A 3UWWA 2RH9A 3FLUA 5CZTA 3H54A 3EEGA 5D2YA 1TPFA 1Q3NA 3TR2A 3S1WA 5CKSA 2CLKA 2FPYA 1TQJA 5FF4A 1TPDA 3L5AA 3MJYA 1DQXA 1AW5A 2EGZA 5FEXA 1Q45A 3M41A 1KLYA 1QCWA 5D03A 4JGDA 1Z41A 5L6UA 3S5OA 3P8JA 4QJ1A 2G95A 4UR7A 2KZHA 4KFNA 2NX9A 5DCBA 5I3JA 2WSYA 3WJSA 1XBZA 4JTJA 3NQAA 1QPRA 1TMHA 3LRLA 2VXNA 3P82A 3EWZA 1TPVA 4LVFA 3NYZA 3A22A 2V0TA 3LM7A 3VCRA 5HWMA 2DJXA 1EWDA 1AW1A 1P5BA 2Y7EA 4DBDA 4CCDA 5AHIA 5HUPA 1VHNA 4ZMGA 3WK1A 3MBDA 4RK8A 4UR8A 3W7GA 1PL9A 1G7VA 4JTTA 1ICPA 4UNLA 1LLWA 5K9CA
chains in the Genus database with same CATH superfamily
2TYSA 4D6FA 1GG1A 3M0YA 4RCXA 3NQ2A 4A05A 4KFOA 2QUNA 3PVFA 2J7EA 1H2JA 2QCLA 1BFNA 1YPFA 4X2PA 1QUMA 3G8EA 2DP3A 3KP1A 4HCHA 3PN8A 5HOSA 1D8CA 1ZL1A 1QK0A 5D02A 3FA3A 6REQA 1ICSA 1R2SA 2G8ZA 3TKFA 2XH2A 2HE8A 3HG4A 4K8GA 2PDFA 4RZBA 3TJ4A 3RM4A 2CW6A 2FTYA 3TMLA 1E6XM 3KXQA 2J7GA 3G0SA 2INEA 1RBOB 4AIUA 1OINA 4AZHA 5JVLA 3Q58A 1DIOA 3GVVA 4RNJA 2WZMA 4F2UA 3RLGA 2J7DA 3SSZA 1S1PA 1QW7A 1DJIA 3Q94A 4U4MA 1MO0A 3MA8A 3UEQA 4HVXA 2ISFA 5I3IA 1EX1A 4DJED 5A8GA 5AZ0A 4ICCX 4EOUA 2ZRZA 1IWPA 4H9ZA 4QEHA 3ZFHA 5ECUA 2I56A 4QQ3A 3W07A 4G2DA 2HV5A 4HCLA 4ZB2A 3SGGA 1BF6A 3AHTA 3VYLA 4LNYA 4DJFA 5AFDA 3N9KA 2BVYA 2WHLA 4AVFA 5D8WA 4WSKA 3R43A 4C6QA 4TX9A 4JTHA 4HJWA 3KRSA 2EJ1A 4XUYA 3TYBA 1LZOA 4W5UA 3WG6A 1OIMA 3S2LA 2W79A 4GVIA 1LRQA 5FJJA 1SR9A 3OVGA 2J7CA 3JR2A 1FWTA 2EAWA 3M6DA 3HZ3A 4RW5A 3OO2A 3DGRA 2OKOA 4Z1CA 4DUXA 5CLWA 3PSWA 4D6EA 1PTDA 1HKIA 4HD5A 1MZRA 3IIPA 3QN3A 3UYIA 1BRLA 3LTYA 5CC5A 5TBOA 2ZC8A 3W1UA 1E71M 2QJGA 5M5DA 3EKLA 4MB3A 2PDBA 1E40A 1XIEA 3FYPA 3LCHA 4EVZA 1HL8A 1UZDA 5A6MA 1OFQA 1S2AA 2C15A 1KXTA 1L9WA 1V6WA 2A21A 1QDSA 2X30A 2ZA3A 3UR5A 2C16A 1QATA 1U1UA 1XHGA 3NSXA 4XD4A 2HTMA 3H2FA 3LBCA 3PY2A 3VNMA 5FJIA 3M0MA 4I7VA 4IL2A 2OEMA 4MKVA 3AIUA 3VIKA 4XBSA 1ECQA 1LBMA 2A3EA 1GOOA 2PAJA 3CUJA 2OZ0A 1JPMA 1Q6DA 3AHZA 3F4CA 2HVOA 4CN1A 2QUMA 4GOAA 3VUSA 3V35A 3ABQA 3NDOA 3OIHA 2ALDA 5C2XA 3C56A 1NEYA 3GFZA 4NAFB 2NV2A 3GIQA 4MDOA 3IVSA 1Q8JA 2HMCA 2Z26A 3GR4A 3NPWA 2XIIA 3C86A 4P61A 3TWBA 2ZUMA 2VNCA 4A2RA 2QW5A 1UPPA 1DE5A 2X2GA 3H26A 4JHMA 4UOJA 4R5EA 3C0SA 5DANA 1W5PA 4P8XA 4JPGA 4QDMA 5IBXA 1M53A 3GU2A 3VOHA 3RX2A 3ARWA 2OODA 3C6CA 3EWDA 3TIMA 1R5YA 1LWJA 4RXGA 3WJWA 4YVVA 4C6IA 5C2GA 1EL3A 4HBKA 3D0CA 3STCA 4G7FA 1B9ZA 4L1GA 4AMAA 2WVVA 1ISWA 1GHSA 2AAAA 2QDGA 3NOEA 3UR8A 2BGQA 2WPGA 5CPLA 3NVDA 1TVLA 1QNQA 1TVPA 2Y6ZA 5AVHA 5DT7A 2NQ9A 3GBDA 1LF1A 5BXRA 2AGKA 3WO8A 2ABBA 4QISA 3B8UA 1KRAC 1UASA 3GC4A 2PDIA 5E6YA 3UJ2A 4LOCA 1V0KA 4AHOA 1SW7A 4PB4A 3E2VA 3O0FA 2FZ9A 4RE4A 4UCGA 1TCDA 3NSMA 4XAGA 3FXYA 5C9RA 5CJMA 1SSGA 1TSIA 1ALDA 2Y7DA 4PMXA 4HOWA 4XBJA 2CLPA 4AB4A 4N7QA 1XDLA 2CWNA 2ZFAA 2CLMA 4I5XA 4KFPA 2FQIA 3W23A 4QTGA 4Y9OA 5HINA 2VZSA 5G2HA 1MEHA 2Z1BA 1MRAA 4HNCA 4MG4A 3SRFA 1H62A 3WQ4A 3ARUA 3ITVA 1YIXA 3LU2A 3KFTA 1XBXA 1AZ1A 3RMEA 3K4AA 4FX8A 2FFIA 3TVAA 3BW3A 5C9ZA 5JU6A 3FDKA 3VO0A 4GLEA 3B0PA 4NX0A 3H2MA 3L9CA 2WZHA 3F4DA 1EC8A 4R85A 1TV8A 4KEUA 4PCFA 4E3VA 1KGXA 1DJYA 1W9PA 3AMCA 3SN0A 1XKYA 4DZ5A 1DEDA 2TMDA 1CXFA 3GG0A 3WL1A 3S42A 1FDYA 2OX1A 4KGJA 1BD0A 1A3HA 1AJ0A 2PP1A 3WQDA 2ZX9A 4DY1A 1YXDA 2WOQA 3WFLA 3MBFA 2E7FA 4Z0JA 2OZ8A 1JPHA 3FVDA 3NJ3A 4O53A 3DOPA 2QF7A 1YNPA 4LUSA 3TQ0A 2V81A 4LY8A 5A8PA 3EOLA 1Y65A 4FXJA 3WMBA 3T4CA 1XINA 1FVPA 2J62A 2NZLA 3VA8A 1CGTA 2GGHA 4GI8A 1H09A 1JGMA 1DWFM 1RQBA 1OG0A 1BKSA 3VM5A 1HW6A 4GQGA 1J93A 5DCDA 2ZRUA 3VGDA 3RNDA 1H7PA 1K70A 4PMNA 3ITTA 2D0FA 1AMKA 4LYQA 4DYKA 4JNZA 2PDPA 5CZJA 3LCLA 3VKKA 3OPSA 1YADA 3TNOA 3PAOA 3MUAA 1JDAA 1M68A 3GYCA 2GUUA 3PPHA 3W7NA 7TIMA 3AO0A 5DF0A 3DYOA 1XLEA 4XWUA 5HNRA 2J6VA 1XD0A 2CEQA 2BASA 1YRRA 4IX0A 2DSKA 1T5AA 1FQ0A 2EEXA 4WRHA 4NJIA 4J3ZA 3CLWA 3MHUA 3CWHA 3TNBA 3GHUA 3CZKA 4LYPA 3ID7A 4H4IA 4ZB0A 3STEA 3E0IA 3APGA 4UR9A 2VC6A 3RJXA 2AQOA 5A8QA 1CB2A 4IQLA 1L0PA 2V3GA 1ECEA 3PFMA 4MAVA 4MJ4A 4F0MA 2FHCA 4Z1DA 1UP0A 3BICA 2NWSA 3S9ZA 4IPIA 1Z32X 4ZZ9A 1EJ7L 4UZUA 2HEJA 2GJNA 1GVIA 2HXTA 1BYAA 3LEPA 2PODA 4TX8A 2PFHA 3N4EA 1OYBA 4EWND 3H6OA 4BJHA 3F4NA 4MF4A 4YTRA 4U3CA 2WANA 3P3BA 2EG8A 1JAKA 1JG9A 4F0SA 2CXGA 2RUSA 3T44A 1AW2A 1VQTA 4WR3A 2D73A 1ZBVA 1WKDA 4L6HA 2ZDSA 2X1IA 3KCOA 4MB4A 3TE9A 2D2GA 3RLHA 2WM0A 2Y24A 4W88A 2G50A 3KZPA 3C0LA 3P5ZA 2JKPA 2Z27A 1YDNA 4M24A 3OLGA 4O4WA 4YMZA 1ZENA 1XRSA 1GPFA 4JEQA 3UY8A 4NQ1A 3F2CA 1V7AA 2Q8XA 1OG6A 1QTWA 4CN4A 3FIGA 5KITA 3G18A 2PEVA 3CV2A 4XBKA 5TF0A 4JYDA 1K9EA 3EWBX 3LUTA 4WF7A 3N17A 4PTDA 4CVWA 1S5TA 2NVAA 2UBPC 4BHYA 4WDUA 3TK7A 4A21A 1EXPA 1TV4A 3G3DA 2O9RA 3B0XA 3H2NA 4GINA 1VLWA 3G1XA 5D2WA 3R58A 1XLKA 2OX4A 2PRMA 3BC9A 4ROPA 1QPOA 2PF8A 2GSJA 3WNKA 3G1HA 2QGYA 3QZ6A 4I9AA 4IISA 4S3KA 3HV8A 5A6AA 4H2CA 5XIAA 2ICSA 3M0VA 3F2DA 3WEZA 5U7SA 3WH7A 4UTWC 3NQ6A 4E3TA 4J4KA 2BVTA 1XYCA 2WMGA 4F2BA 1GCYA 3UA3A 3C52A 1R86A 2WSKA 4BF7A 1IZJA 5U4NA 1M1BA 2ESCA 4GCXA 2PGEA 4OV4A 2NQ5A 2WSQA 2AMGA 1BXNA 1KM6A 2HVNA 3NGJA 3W25A 3AYTA 2FVLA 2GSEA 3IJ8A 2X2YA 3HG2A 3LBMA 3ZM8A 4B2DD 1KXVA 1E3ZA 3B9DA 2GJRA 1JF6A 1S2CA 1S5WA 4O8AA 3HU7A 1D8WA 1F3TA 3IJ7A 1WPCA 1SW3A 3LX9A 3AXHA 1ZHAA 4U5KA 1WDWA 2Y5EA 2DVUA 3H23A 4QM1A 3TXVA 3BMVA 3RRAA 4HHMA 1EQCA 4FNTA 4KERA 5EPDA 2YZRA 1GOQA 4ZXOA 5HATA 4Z1YA 1TA3B 1Z8AA 1TPUA 1WE5A 3T8QA 3DU0A 3CHVA 1EOMA 4IMAA 2O55A 3VCCA 1JZ7A 3VKAA 4EIVA 2DUZA 1X97A 2BWGA 2ONEA 4CCEA 1XWYA 1SJCA 2C1HA 1W56A 4AX7A 4U33A 2P88A 4EAYA 1QI0A 3MP5A 5A8OA 1QU4A 4JKLA 4NY2A 3HPXA 1XQKA 4IG2A 3VFLA 4ZOAA 4TTUA 2HBXA 3N2MA 1XH1A 3HGJA 1OEPA 4LYKA 1VPYA 1EUNA 3MUXA 3SY5A 1F74A 4NZ4A 2G97A 3OA5A 5EGRA 5EU9A 5HUOA 1UD8A 3WF1A 2WNQA 5HBFA 1CLKA 6XIAA 1W2PA 4QG6A 1IWBA 2W62A 3E5BA 2GDVA 3V0SA 1IZCA 3W74A 1HZYA 1W91A 2J24A 3QOKA 3WQVA 1JDFA 4J2PA 2Z2AA 1KNWA 4PYSA 2ATSA 1L6GA 1UB3A 1C8XA 1OADA 3W7EA 2I17A 2GGIA 1PDZA 5LSMA 2HCVA 1TWIA 4QSFA 1NDWA 2WKGA 4J3XA 4NNBA 1UWSA 1EIBA 4XZ9A 2PC8A 3AUOA 3UZJA 4Z2GA 2HRWA 2REQA 2UV8G 2HNHA 2P3ZA 3N3TA 3W0KA 4YS1A 4GC4A 3R0UA 4C7GA 4G8TA 1RD6A 4S1FA 2ZYFA 4K38A 1OCNA 2AQWA 2UY3A 3SUSA 1GYMA 1P0DA 2ZUUA 4KETA 3R0DA 2QIWA 2Y7GA 4U31A 1OFBA 3AJ7A 3S5NA 3SBFA 3G6LA 3GH5A 2DV0A 1EOKA 2DIEA 2E9BA 2DT0A 2Z2BA 2PBGA 3VIOA 3RGTA 1EF3A 2V6AA 6REQB 2GWNA 2FDMA 3W7RA 3UFYA 3CZLA 2OLAA 2L5HA 3SADA 1LOQA 3IV8A 4H9UA 1NFBA 1JD9A 1EPVA 3RN6A 3DFNA 3FJLA 4LAMA 4JIQA 1X1OA 4C6JA 4LVGA 1K3UA 1QOQA 4XX6A 4PB3A 5K7JA 1XGZA 3R94A 3B9AA 5J5DA 1RV8A 2E6AA 4X9YA 2GLKA 2YA2A 1UH2A 3P67A 1A50A 3N2BA 5BOOA 1F4HA 4QDWA 3MO4A 1XYFA 4INFA 3ES8A 4DWSD 3I65A 3WLJA 2VOTA 4J40A 3GUGA 3VKCA 3VD4A 1EBGA 1SFSA 3B9OA 3BQ6A 3LD5A 3QV7A 3SCWA 1FCUA 1MDRA 1X8CA 4LNCA 4A29A 2VUYA 1D3HA 3C8FA 3PZVA 3CAVA 2D0GA 4CD8A 1P7TB 4L64A 2XVPA 1UOZA 3SB0A 2NQHA 1SUXA 1DE6A 1U30A 4QG8A 9RUBA 4NAEA 1OYCA 2PTZA 4B16A 4MKNA 1CGWA 4XZHA 1XISA 4GH3A 4RNFA 2J7BA 3BLFA 2IS7A 3E0VA 1W3LA 4R53A 2JF7A 2PDNA 2VEMA 4I6VA 4NG3A 4PMUA 4RLIA 3ZIZA 1LG2A 3QM3A 7REQA 2CLLA 2F8QA 3PPGA 3CUIA 1CI1A 1W17A 2OZTA 3NO5A 3K4DA 2I5IA 3WBAA 1H7RA 1AH0A 1RA0A 3BAIA 1F07A 1ZAJA 1NF0A 3W1LA 1HJVA 1FWFC 3M43A 1E4NA 1TR1A 1WUFA 4Z2IA 1CGXA 3FA4A 3PS7A 1LJYA 1J18A 2JF6A 3EDEA 4UUIA 3CPGA 3WQOA 3HFYA 4Q6XA 2CZEA 1GVYA 3P6LA 4F48A 2A6NA 4DO4A 1LQAA 5T9BG 2HZGA 1UKPA 3TDFA 2A1YA 4XO7A 3USBA 4A4AA 2V5CA 1NQ6A 1RD5A 2UZ9A 1OJXA 4TVCA 1VLIA 1HP4A 1KR0A 5I79A 4IP4A 2P1FA 4Q8PA 1JNEA 1RCXB 4Q4KA 1Q6EA 3A9IA 1LYXA 5HDRA 4FOKA 4JTDA 2NT1A 1W9VA 4HPNA 3AICA 1THFD 1UBSA 3VIJA 4RL3A 4DF0A 3UZZA 4ZQCA 5HNUA 5CGTA 2W66A 3PNZA 3R11A 4URIA 3W1AA 4LUTA 4K7YA 1H4PA 1S3HA 4E2DA 3M0IA 3N6JA 1F3XA 4YTTA 3ITYA 4US5D 1JRCA 4Q4OA 2VDHA 3S2JA 1I45A 2QJNA 4WSHA 3WH8A 2XVLA 4YHGA 4LJ3A 1J12A 1UWIA 2BZNA 2ANUA 1NOWA 2YGYA 5AC8A 3NM3A 3IV3A 4IT1A 3TSMA 1UKTA 2RJGA 3BE7A 1K4GA 2IPFA 3WEOA 5I3FA 2FZDA 3P60A 2F6XA 2B7QA 1PX3A 4L1WA 2JBMA 2VWTA 3IANA 1L2UA 3O6AA 2RFGA 4XD3A 2WSPA 1TIWA 1KXQA 2ZC1A 4H83A 3AQUA 3W24A 4WK9A 1E1CB 4JXCA 4MTVA 1CDGA 1W54A 1IEVA 4H9TA 4PUDA 1FWEC 3PBVA 3OBAA 4WCJA 1B54A 4LU0A 1V79A 1LCOA 3ENLA 1IXOA 3E1F1 3IS4A 3ERPA 4HYRA 1C7SA 2PDCA 3ARPA 5D8ZA 2WVVB 2V63A 1PAMA 4PEKA 2IUZA 1DQWA 3K4WA 4DNMA 1E5JA 4DBUA 2Z1XA 4FHAA 4CQAA 1QBAA 4JHZA 5GQBA 3BGJA 2Y8KA 2P5NA 3S6DA 2VEGA 2XYLA 4U3AA 1VFFA 4DUVA 3B9NA 3WNOA 1PIGA 1CXEA 1E1EA 2BTMA 4C1KA 1OGSA 1MWOA 3UXAA 4PCNA 4DI8A 4YPJA 3IVUA 3WLKX 3AIBA 3TA9A 3UZWA 3G1VA 1JI1A 3B9EA 3GZAA 1A5KC 4HJFA 3B0YA 4KPLA 5C8BB 5JBFA 5SWUA 3RRXA 1PHQA 5A2CA 3F5JA 4C60A 1NSJA 5E93A 1J01A 1KXHA 1B3WA 4H8UA 1EDTA 3ALGA 3LHVA 2FZNA 3SURA 5B80A 3EWWA 1IXQA 4PMVA 3W22A 4XG1A 3S5ZA 5GNYA 1SFJA 3DFPA 4P7NA 4IIEA 2OCZA 3KBJA 3AU6A 2VELA 3GKAA 3L2LA 1OD8A 4ERGA 4CNUA 4FEZA 2VENA 1WDPA 3TCEA 1WDDA 5HXMA 3WLRA 2EPNA 3FJ6A 1V3HA 3NCOA 5XIMA 1Q2RA 4AIEA 4FO4A 1TRIA 1E73M 2OGYA 3C0QA 4DI9A 1W6TA 1ZBWA 3U7BA 2A2IA 3M6YA 1E6NA 4FNUA 1QW9A 3IJDA 3TEVA 3NPVA 3CQHA 3W75A 4AEFA 1TELA 3TSDA 4E6MA 4DPQA 4IPPA 1KRBC 2EG6A 4D8ZA 5C7HA 1K77A 3OLIA 1DWJM 4J9JA 5EL1A 4JTIA 3EWUA 2ZXBA 4RDZA 3OU8A 5G4EA 1QNPA 3UJRA 4DJFD 3VTRA 4C6OA 3HM7A 5FJTA 1I0DA 1VYPX 1YBQA 3H8AA 4TVDA 1WOAA 3MPGA 3B0VC 1AH4A 2YCJA 4G1NA 4EACA 3B40A 1WDSA 4O1BA 3H2AA 1O95A 1V02E 1RJQA 4PRWA 3ECQA 3W7LA 1TTPA 4CNPA 4LUSB 3A24A 1WB0A 1XP3A 1A5AA 3K1GA 1UD4A 4FPSA 2PURA 3RYSA 1QFEA 3KRUA 5HNNA 1NDZA 3O16A 3V0UA 4P5UA 4EPKA 1MFVA 5HJLA 2ZOXA 3BXWA 2VQTA 4KEVA 1WA3A 3BGAA 2YCLB 1QVBA 2V5LA 4PEEA 1VBUA 1RBLA 5JMUA 5A2AA 2VZVA 3I68A 4GYPC 4CQDA 3BWWA 3PBWA 3A47A 2X1SA 3WQ5A 4LS2A 4E2OA 4IIGA 1VFLA 3GTXA 4GIYA 5B7YA 5CQ1A 3HGOA 2NWRA 2JE8A 2NQZA 2FHFA 2WB5A 1UR4A 1OK6A 3LCFA 4I9JA 3QQ0A 1V8EA 1QO2A 1UUOA 4ZOEA 3GH4A 1DHKA 2XWEA 3BLIA 2WNWA 3AHXA 1O6IA 2VVSA 3KLKA 6TAAA 4NI8A 2ISSA 2QCDB 1M3UA 2X1TA 7A3HA 4LEFA 1VCFA 3SIZA 1UJPA 4QFUA 1US2A 4PCSA 2VKZG 1V3KA 1KFCA 2G3NA 1ZJHA 1MMFA 4HU0A 3OYZA 2QCFA 1GVEA 4NT0A 3TROA 3GG1A 4YTUA 3B04A 3OZPA 1SZEA 2HJPA 3NR0A 4C6EA 2GGEA 2GVYA 4HPHA 4KWUA 4FR1A 3WL0A 1JPDX 4MWAE 5FKYA 3T2PA 1RCQA 3KAOA 3JZUA 1EHAA 3W29A 3PBGA 4KCWA 3FJ4A 4W9TA 2PP0A 3WN6A 4S38A 3PHAA 4WEVX 4UMCA 3VX0A 4M82A 4X0VA 3DN5A 5DXXA 2BOFX 1XQLA 4GXWA 5F4SA 4WY0F 1XIJA 3TONA 5HJYA 1XDMA 4GVFA 3OG2A 3S1UA 1A5MC 4ZOCA 4FXSA 4X22A 4V27A 3TUUA 4I9MA 1LTDA 4FXFA 1TUFA 1CXLA 3W83A 2BHZA 3M0JA 4MY1A 1AQHA 4I90A 1A49A 4N4PA 1FWGC 4AYSA 3C4UA 2HSAA 2ZX8A 3EA2A 4JQ4A 3W1XA 2FYMA 3CT7A 2OU4A 4IMFA 1UIOA 2DZWA 4N6FA 3ZWTA 2VRQA 1UR9A 4DO5A 1OGGA 4J28A 2WPBA 2J7FA 5E09A 3QHOA 3ZT6A 2Z6JA 1WQ5A 4B5XA 1Y5VA 4PFMA 4PMOA 1OZMA 4N9BA 3M5YA 4S23A 5HQEA 1NWSA 4TUFA 3WLNA 4D1IA 3QFEA 5FEPA 1XGEA 1YTDA 2OB3A 3PTKA 3N2XA 3ISIX 1KO0A 3SR7A 3CQJA 2FFCA 3FYYA 4PTVA 3RU8X 3SCPA 2WJDA 2PC4A 4BWLA 1FTXA 3B0UX 1F4AA 5GJMA 2PU0A 3PZGA 1EGMA 5BCAA 4C7DA 2WLZA 1SGJA 1OIFA 1NWRA 4XAYA 5EBUA 2D2OA 5JH2A 4UOZA 3HN3A 2NV1A 2VURA 2PMQA 2OSWA 2OELA 2YL9A 3ABXA 4ZL1A 4CCCA 4M29A 2WMJA 1S5MA 1XLBA 1EB3A 1KW1A 1W37A 4MNJA 3BW4A 2P8BA 1U1JA 4CEXC 2QVNA 1SQ7A 3VFCA 1TPH1 1ONXA 1R3TA 1R6WA 1KM1A 4MNLA 4H8NA 2GOKA 3FLUA 3H54A 3AU2A 3EEGA 5D2YA 1Q3NA 1J11A 4PMQA 3S1WA 5CKSA 1TQJA 4OUIA 5H1WA 2PWUA 1TPDA 3L5AA 4AFYA 3LGGA 3NOYA 1QI3A 3P8JA 5IHRA 1AUSL 1GKPA 1ODZA 2KZHA 5DCBA 3BMWA 4BS0A 4C6DA 1WZKA 2WSYA 3ICJA 2G3JA 4ZGYA 3LLXA 5I06A 1W1VA 1TMHA 1XKJA 4V1YA 3EWZA 1BVNP 3CHEA 3VCRA 5HWMA 2DJXA 4GC3A 3R1ZA 4DBDA 5AHIA 3DYPA 4ZSTA 4ROQA 1E9IA 3CYVA 4PE8A 2FH8A 2ZXQA 2JEPA 3M7SA 1SMDA 3HURA 5K9CA 3ZZ1A 4NX5A 1EF2A 1U83A 3HJEA 4RX0A 2O7SA 2X8RA 1VEMA 3QTPA 4LW7A 4XKMA 3WYZA 4ZQOA 3QZAA 4CD4A 2DZBA 1RPKA 3QBUA 2GL5A 4D8AA 1OFEA 3BLPX 4JCMA 3LPGA 4W87A 3SCVA 4XZWA 5H8PA 1TTQA 4TR9A 1XLGA 2PWFA 4LVDA 4IF2A 2G41A 3TTEA 1EWEA 4EPDC 1K9TA 3UZXA 4EKJA 4HK6A 3U3HA 1X6LA 1IT8A 3BZGA 4O50A 3MO7A 3ZLFA 3NL3A 3THCA 2DUAA 2R1PA 2B7NA 4QAIA 1FDZA 1JDDA 1E6ZA 2JGYA 2O7QA 4YWIA 3IIXA 3JVAA 1KC7A 2REQB 2XN0A 1R3YA 1E0WA 4DJFC 2J47A 1T99A 3URNA 4ZB5A 1XLLA 1GVFA 2I16A 1JZ6A 3VI2A 1NIUA 4ZTXA 3SIMA 3UNTA 5JUVA 3LI0A 1OWQA 2F7FA 1LUCB 1E0TA 4DX3A 4HU4A 3GHTA 2V69A 1WAWA 4QG9A 1DTNA 1XCXA 1N55A 2PLJA 4IGMA 4KF1A 3FGCA 2VEFA 2E1WA 3KM8A 1FOBA 2JKAA 4HQVA 2PDKA 4UIOA 2WWCA 1RXOB 2W5FA 2WYSA 1CGUA 2PZ0A 2TAAA 4WGHA 1AA1B 3MCNA 3WSUA 2C1GA 6ENLA 2VMFA 1W0MA 4LXFA 4H6EA 4G7EA 1VC4A 1OFOA 4LUYA 3AYRA 3OHMB 3D47A 2FGBA 2J9XA 1W9UA 1KV8A 4UQ9A 4ZQMA 1AQ0A 1QBBA 2VDIA 1O68A 3R13A 4GWEA 3RITA 3FFSA 1FH7A 4M6UA 3T2OA 4PA8A 4BKNA 1GEHA 4K7VA 2XM1A 4AY8A 3GM8A 3UWEA 2YLAA 4X0NA 4IQEA 1Z44A 1WOBA 1KLZA 2EJAA 3ZLGA 5I02A 2XH0A 1H61A 3EGJA 3W7CA 1UQZA 1VENA 5A8NA 2XZ9A 5RUBA 1ZCCA 3CZ8A 1H5VA 3I4KA 4YNGA 1XC4A 2QPUA 5HQLA 1NM9A 3UCDA 1W1B1 4I7WA 2CU0A 2J27A 5K9XA 1DWAM 2QMJA 4PMYA 1R8LA 4AHPA 3E74A 4ZO7A 4ALDA 3BAYA 4JIHA 2NT0A 4OZOA 3L4YA 3AXXA 4GVGA 3GDTA 2HDJA 2RDXA 3IGHX 3DX5A 5C9UA 2VR4A 3E5PA 2RDUA 1US3A 1R7AA 2B7OA 3LV6A 4AZBA 2ASHA 2GUBA 1X98A 2BLEA 4IGSA 4YVPA 3GW0A 3T4WA 4FIQA 2F6KA 3STFA 1KM3A 3TR9A 2BHYA 1F5ZA 3LDVA 1Q7QA 2QPSA 4CU7A 1RUSA 3NZQA 3WLOA 2QF8A 3V1PA 1LP6A 2R9RA 4LSBA 1V02A 4OTKA 1J0YA 3L7RA 1J79A 4AF0A 1VJZA 1FWDC 1P6WA 2AL2A 2IKHA 3AXKA 4GGHA 1NOFA 3C2RA 3FKKA 1DJHA 4H9MA 3NQMA 2FPVA 3WLPA 2KX9A 1ZBCA 2UWFA 3CPRA 1FWSA 1JZ2A 1AJZA 4UCFA 4BF9A 1IZKA 3G1YA 3G0UA 3ZSSA 3QSRA 2WW5A 3APTA 3BG9A 3F5LA 4KH2A 1J96A 4WOZA 3O6CA 4XAZA 3SI9A 3F03K 3PPCA 1MW3A 1PCKA 3BOFA 2P3EA 4KWVA 4JD4A 3OB8A 4CNNA 4JKMA 5AYIA 3N04A 3DERA 1D7KA 1HN1A 4DBEA 2EPHA 2E6YA 1GZ1A 1K02A 1HFBA 4L1XA 1HJQA 1LLZA 1L8PA 3BJSA 3CTLA 4WVXA 3FNDA 5EA9A 2OYKA 1TWZA 3OJGA 4C1NB 4DIAA 4MJMA 3M7WA 2MANA 3MS8A 4ZVJA 1OCJA 1W1ZA 4D1JA 4D71A 3UD6A 3U8GA 4EXBA 4H7ZA 1IEQA 1TFVA 4GYKA 4HMEA 4MWAA 1ODUA 4KCVA 1X96A 3THUA 4GZIA 1OF8A 3VDAA 4E8CA 1HJSA 3WUGA 3KTSA 2WC3A 4TMBA 1BTCA 1MXSA 3SJNA 1B3YA 4TO8A 5D32A 4A8IA 5CH9A 1X39A 2PTXA 4JDBA 1MI3A 5CBBA 4CCZA 1SU5A 4QE4A 2YDSA 2DJLA 2RHGA 1Q8AA 1UZHA 2HS8A 4JIPA 1XXXA 4NZFA 3LMZA 2R1MA 1EJRC 3BANA 1E15A 2HBVA 3CQ0A 1EP1A 3EB3A 4M7TA 4XZNX 3W9ZA 1C92A 4RDVA 3DFSA 2DZPA 1EHNA 1TVNA 1XLMA 3V5CA 1Q4NX 1MW2A 4H19A 4LB4A 3W7PA 4K68A 3LA4A 3VNZA 1FWCC 1UKSA 1W3NA 4GNKB 2GQAA 3DDMA 1POKA 4CGTA 3NQ7A 3GAKA 4MFEA 4S3DA 3DC0A 5JBDA 3S0CA 3VIIA 4K3ZA 2P76A 1NOUA 1B3VA 4JTCA 1NDYA 4GABA 2ZRXA 3C2OA 4AD4A 3NQCA 1GQLA 1H49A 4PRRA 1CPUA 1F6YA 1G9HA 2FMNA 4RDYA 3NAVA 2Z00A 4UTMA 3BARA 4PUMA 4LWWA 5CG7A 2I7GA 1FWJC 1JQXA 2CLOA 2H9AA 3TOYA 2X42A 2JEQA 2OLHA 2VFHA 1YMYA 2ZZ2A 5F7UA 4O57A 1W9XA 3W2NA 1XPYA 4V28A 5LNWA 3MZNA 1QO5A 3FN9A 3IRSA 3CB3A 1JZ4A 3BCJA 3O6YX 1ZY9A 5CGQA 4MHBA 2DVTA 3HIJA 2V3DA 5F2MA 1WCGA 3VKBA 1TIMA 4H7CA 1HUVA 3WY1A 4KBXA 1B1YA 1VH7A 1Z42A 4GUHA 4H9VA 2DGAA 4GK8A 1VHCA 3LNPA 4H1ZA 3WNNA 4IIDA 2OFJA 3RILA 5FEWA 3SW6A 3S5YA 1UQYA 3AZTA 2EPOA 5BROA 3WLSA 4JN6A 1ME9A 4LFYA 2WJZA 4UTTA 1UD2A 4QQUA 1GKQA 1EEXA 3IUDA 1JYVA 4S3GA 4HMCA 5LHFA 4LGXA 2C71A 2JFEX 4XTIA 1VPQA 4PMDA 3MKKA 3FW6A 4JN8A 2FB3A 2IKIA 2V9DA 3YPIA 3ES7A 5AC4A 5D33A 4PL1A 1O5RA 3AALA 3PUDA 1V6YA 2YPIA 4P8UA 3LNMA 1LQ0A 2DH2A 3KX6A 2PLKA 2A7RA 3OVPA 3WMLA 1AQFA 3CIXA 4REQB 5C7VA 2TPSA 1H1YA 4FSAA 1ZBKA 4YN5A 3UR7A 3QKZA 1K8YA 1CT5A 1DWHM 3VNKA 3I3BA 1JAEA 5PTDA 1EBHA 4KCUA 2FPTA 3QMSA 5C70A 4RUBA 3THDA 4Q8OA 3EX1A 3O6DA 1EYEA 4C1LA 2Y7FA 4FNSA 1EDQA 1JXKA 2ZTKA 3FJNA 4D6GA 4V33A 3S2CA 3HPAA 1IEWA 4Q8MA 2V38A 1DYSA 2IQDA 1T40A 3K8MA 1KBKA 4LYRA 2WAGA 4XZLX 3W53A 5AC6A 4DHGA 4X2RA 2WMKA 4OKDA 1TPB1 4KW2A 4TMCA 5CSRA 1M5WA 4YHEA 4CUCA 5C9XA 3URQA 4HP5A 3S46A 4E4UA 3IAPA 1XUZA 1HL2A 3ARTA 3R6IA 3R8GA 4ICMA 2EBNA 5F1UA 1OC6A 5CC6A 1PPIA 1GONA 4K39A 2J8TA 3W2LA 2XVGA 4QRNA 1VFMA 2VZOA 2B0MA 4A3RA 4UFIA 4C6PA 3QR1A 4KWWA 3W7IA 3EAUA 1XIIA 1V3IA 2W9MA 4QE1A 2I1OA 4LRSA 1TV7A 3WNLA 3UPWA 1IHIA 1HXJA 3U4FA 4M81A 2QV4A 3KL3A 3RXZA 4NKCA 3VE9A 1C8YA 4B5TA 5BXTA 3W1MA 2EXOA 3ZJKA 4H00A 1U5JA 4QJ5B 1XH2A 3WQEA 2C0HA 4LVBA 5HA7A 3H24A 4KRZA 3OQEA 3SCTA 1EPXA 3W28A 4PTWA 4AWUA 3MMUA 1F2JA 5IFPA 4V2XA 1PXGA 3WELA 1ZNNA 7TAAA 3I7RA 3LZ5A 2OWCA 1WNOA 4IFKA 1HKWA 2INFA 1W3IA 3REQA 3NPXA 4YYCA 3W6LA 4EE9A 1Q6GA 4I6KA 1US0A 3M0HA 1W1IE 4Y90A 1HKMA 1BHGA 2A5HA 1EKOA 1LQ2A 4HA4A 2HS6A 4AEOA 4F2TA 1TPC1 2XIQA 3LMYA 3W1PA 1B3OA 4GY1A 1Y7VA 3HPFA 3R2GA 5MKGA 1N2VA 4FB7A 2XFYA 3PBYA 1ADSA 3SCSA 4C91A 2CCRA 3VXGA 1TE1A 4GA8A 1WKFA 3PJUA 4JQ1A 3WIJA 2D2HA 3BJTA 2VCAA 4ZQRA 1UA3A 3BAWA 3WQ6A 1W32A 3B03A 4P8VA 3A6OA 1KD0A 1HTIA 3U6WA 3W7QA 3EWCA 3UG5A 4BA0A 1FFQA 4ZODA 1A5BA 4IIBA 1CBGA 1KTCA 3VC6A 2VFDA 2YSWA 2W0UA 2R91A 3EDKA 3GD6A 3WQ8A 1S2VA 3UVIA 2IKJA 5AOUA 5K9DA 1SVDA 4YTQA 4LBUA 1FWRA 2KAUC 5KZMA 4J3SA 4C6NA 5LHEA 4RXFA 4F0RA 2WQPA 4MB5A 3N29A 1R3RA 1SFLA 4NI3A 3FEQA 1YDVA 4WIWA 1KRCC 1P0KA 1B9BA 1WDRA 2BOEX 3ABSA 1X6NA 3M5ZA 3ABRA 3GC5A 2R1KA 3MI3A 5I07A 2UY5A 4HYWA 2DVXA 4P7LA 2E9MA 4EXAA 1U2YA 4IGNA 5LZLA 2CFFA 3ZYZA 1GQKA 4HTBA 1YTKA 4ML4A 4UFKA 2DQWA 3I7QA 3VK5A 1UWRA 3TTSA 3M0XA 1T8QA 3ZT5A 4ZO8A 4LH8A 1SW0A 1MYRA 1X7IA 4NZJA 1J5TA 2W61A 4K8HA 3LXBA 4OBRA 3FXGA 2PLCA 1POJA 5E5CA 1LL6A 3AHYA 3MMTA 3E02A 4XD5A 5E70A 1ZCOA 4YJ5A 4PGLA 2VT0A 3GDRA 3OZOA 1G4EA 4JKKA 2G4FA 3S9IA 3P8IA 4OIFA 4OHQA 4ZO6A 3T09A 3ZR5A 1FP9A 5M1TA 4AY7A 3QYSA 8TIMA 1DL3A 1XW8A 4AC7C 3VDGA 1MEWA 1S1RA 3TFCA 1J4EA 2A7PA 3RAOA 2XSBA 1NWUA 2ZUVA 4YU1A 5FF3A 3U5UA 1TPWA 1DIKA 4P7OA 3UXKA 2C8NA 3RF9A 3V75A 1VFTA 4XAFA 3A3XA 2I57A 3S83A 4N9EA 1M6JA 5D05A 1ITCA 2BP1A 3QYQA 3LPOA 4Z08A 1NJJA 5C71A 4DBSA 4NJJA 4UXDA 2J88A 3O8AA 4ORIA 4R9XA 1F9CA 4IP5A 3SCQA 4DN1A 3E0WA 4JTFA 3ZJ8A 3GY1A 4HCDA 5AHLA 3BSMA 1VF8A 5CBJA 3MJMA 4UFLA 2OSYA 4GE8A 1R9ZA 3LTPA 2ZQ0A 4KRTA 1BYCA 4TVUA 4UTKA 1AL7A 1U33A 2CBVA 4PL2A 4M1RA 3H2EA 3WDQA 3FVMA 3SUWA 2WMIB 5LXXA 4L5ZA 4BQ5A 4RKAA 3N25A 1Z69A 1G01A 3GSMA 1GOXA 2VX5A 1KCXA 3RHGA 5HPOA 3Q65A 4GX8A 1EP3A 2HK0A 1VB9A 4N0RA 1XH0A 4W89A 3GS6A 4RZ5A 1PEZA 5LGZA 1XRTA 4QDPA 2A6LA 1N8WA 1UD3A 2YFOA 4C7FA 3L67A 3NO3A 2XH4A 4NRRA 4OECA 3VOIA 2WCAA 2CZ5A 3UWVA 5DQPA 3TW6A 4ES4A 4GI9A 1JXJA 3NL2A 1KTBA 4GBUA 3W85A 1EZWA 4K1WA 1OD0A 5TQLA 2ZRWA 3ARQA 3WJYA 3FDGA 1H7NA 4MAZA 2WJEA 1RPXA 1BQCA 4A8NA 4YCPA 4HMDA 5KSWA 3OZYA 4XD6A 5KINA 3TA6A 5IHSA 2A3CA 1H11A 2YFNA 3T8LA 3CMGA 3W7KA 2Z1WA 3ZWSA 2YW3A 2X16A 5C55A 2XIMA 3R10A 1NVMA 2DSZA 3AMDA 3VNIA 1PSCA 4DAFA 5EMYA 1WZAA 7CGTA 1IIHA 3CXOA 3T40A 5KETA 3QV9A 3DKJA 3TXZA 2XDFA 4H8VA 4Z0SA 3MUIA 4FLRA 1D3GA 1ITQA 3MV01 2G5WA 2C13A 2OKTA 4ZCWA 2ZUSA 4KEZA 1M7JA 2IQTA 3WLIA 3CGTA 4O15A 4PBFA 1MEIA 4AXKA 4U5IA 2VWSA 5L9FA 5E1QA 3VDBA 2V68A 2XHYA 2JK2A 4GJ1A 5HQMA 3CIVA 3M0ZA 3SJ3A 3TTYA 4LX4A 1VRXA 2CESA 1UCWA 4EPBC 4MZ1A 1G4SA 3S1XA 3DG6A 4A8RA 1OCBA 1PIFA 1FXPA 1D7FA 4DF1A 2FHBA 5A95A 1I2OA 4O17A 4PULA 4AF0B 1O5QA 3W2MA 4W7WA 3EKZA 4LB3A 3UWQA 4IPNB 3H55A 1JZ3A 3MSYA 4L6DA 2ZIDA 3WQGA 3JS3A 1CLXA 2QNEA 3OW1A 3TP4A 4AU0A 3N1AA 2XVNA 1SO4A 3W1TA 1DXIA 1ZJAA 1FHVA 2A85A 3QJAA 2VGBA 3TU9A 1V5XA 3CV7A 1DJWA 4UQEA 3QV6A 4XSMA 2C14A 2A4AA 2DZAA 4FI4A 2NSOA 4IIHA 3PZNA 3W6MA 4TV6A 2DY3A 4QJ3B 1BKHA 5I03A 3UR2A 3WH6A 1KQZA 3DC8A 1KGWA 2FGZA 5MHBA 3QF0A 3NXFA 2P8CA 4OT7A 2ZRVA 1BPLB 1TB3A 3UJSA 5FF7A 1RP9A 4S3BA 3AYSA 2WKLA 3LQGA 3UW6A 5DCEA 3TJXA 1NU5A 4GFSA 3AMKA 3MSDA 3PC0A 4FNRA 5I2UA 5I23A 2C7FA 5AB3A 4HZ7A 1J0KA 6PTDA 5A6SA 1XRFA 2ALRA 1W2VA 8CGTA 1XGDA 1F6PA 3MYOA 1JCLA 1KKOA 4AWSA 3C2EA 3CH0A 5LIUX 4QIUA 2YXXA 4KIEA 3NEVA 3ZXWA 1OYAA 5AC5A 1UC5A 1VD6A 3KRBA 1XJBA 4MWAB 5CPOA 4J35A 1BG9A 3EMQA 4L7ZA 1EYWA 2PCEA 4KEMA 1DTUA 1RH9A 3QFWA 3VOGA 2RDTA 3ARYA 3TSBA 1T6MA 2F84A 3S6TA 4D6DA 1KRMA 4IUOA 2Y61A 3WFAA 3LHWA 3GRIA 3LCWA 2YYTA 1D2KA 3TTQA 1U5HA 4ZQPA 2XZ7A 2Y5JA 4NZ1A 3LHYA 3VGHA 5BOEA 4WY0A 4Q32A 1KCLA 2GK1A 1LBLA 3AWNA 4O12A 4Z2KA 3COTA 2Y70A 1W8SA 4XK2A 1JZ8A 3D46A 2QUVA 4WXZA 2DZVA 4QE5A 1EJSC 4DVOA 1E55A 1Q13A 1AD4A 1J0IA 2IQ0A 3L65A 4S2BA 4UB9A 1KFWA 5E0CA 1ISZA 1YPXA 1UUQA 4JIIX 3U4AA 3QR0A 5CAHA 5E9XA 3CHDA 5AKQA 4UTWA 1J6PA 2CNCA 2CBIA 5JBEA 4IX2A 4J1OA 4Z2HA 4TQTA 1Q5MA 2ZICA 2WO5A 3W76A 3NVTA 3PUEA 1G1YA 2EHHA 1CENA 1DP0A 1ME8A 4R27A 4L9XA 3E6EA 3WMSA 5K4XA 3PTDA 1BWLA 4UQBA 1YXCA 3BSGA 3CPUA 4HPXA 5IFTA 3CO4A 5KEZA 1T41A 2DZXA 3L68A 1NFGA 1HGWA 3R12A 3AIQA 2YCEA 2NX1A 2E40A 3DBPA 4NYYA 1G7UA 4QR6A 1QW8A 1KKRA 4CQ9A 3I3EA 4N6EA 3TYUA 3Q2DA 2XJ7A 3GBEA 5FJRA 5M3WA 4GI6A 3SFKA 2PDMA 1NF7A 3T0BA 2NQLA 1V08A 1X8FA 2QQ6A 4GIRA 3L4XA 4HGXA 3W73A 4PMJA 4CNTA 1XIBA 2QUTA 1EC9A 1SYTA 3DZ1A 2TSYA 4JY8A 4IHCA 2CERA 1C3FA 2HE5A 1BLIA 1KFKA 1KFEA 1G4PA 4R34A 4GKTA 1K8XA 1EO5A 2OO6A 3S47A 5A8MA 4IH3A 4ML9A 3O3RA 4AD5A 2XN1A 2DT1A 3FAWA 1OY0A 4W7UA 4Y9PA 3LSBA 3UA4A 1PZ1A 4XKYB 1LRTA 3TFXA 4UFJA 1J5SA 4JZ5A 3VILA 1H50A 3GIYA 4WJXA 1F6KA 4GIAA 4LUIA 4BFAA 2D2JA 2VEIA 2Q8LA 3WH9A 5DX7A 1BG4A 2OT1A 1E9ZB 4NSBA 4KRUA 3K8KA 4IQDA 3BCFA 3VGFA 2WJFA 7ODCA 3MYPA 1OZQA 2BG5A 2ZE3A 3WJZA 4GJJA 1VEPA 2CWXA 4DELA 3M47A 2PWEA 4ADSA 5GJNA 2NVDA 3IUIA 2O4QA 2O9PA 1G5AA 5KZDA 1OGBA 3N2CA 1I1WA 2XIBA 3A12A 3EBVA 3CYJA 2F2HA 4GO9A 1OF6A 3ONBA 3B8DA 3MDWA 3D3AA 3EDJA 2VFEA 1GOMA 3SY1A 3BLOA 3OBKA 5JIPA 1A80A 1VRDA 1E4IA 3AMLA 3TN4A 3NQ8A 3ANYA 5DMYA 2OYMA 1S2WA 2VC5A 1SJAA 3WBXA 1MFUA 1PKLA 3R25A 4BQ2A 3KUMA 2BDQA 5MF5A 3WD4A 4R3UA 4BWLC 1QR7A 1OK4A 3CU2A 4FX7A 2G3MA 2BB0A 3VKJA 3N4FA 1PHWA 2ZX7A 5EB8A 3HB9A 2VCCA 2A79A 4Q8VA 3QH2A 2I9EA 4R33A 1ZPTA 4GBDA 3W7OA 2E1DA 4CLMA 5BRBA 4HA0A 3PZTA 1ZALA 2V30A 1FWWA 1R0MA 1PO9A 4J7RA 4MWAD 4DQWA 1ENUA 4Z1AA 2VGGA 5CPTA 1TX0A 3ZT7A 2E8ZA 3W71A 5IOBA 1GJPA 2PDXA 4YYFA 3PZQA 4CN6A 1TJ1A 3MVTA 3QXBA 1KQYA 2DPEA 4PUKA 3V7PA 3BQ5A 4KKXA 3ATZA 1MQRA 3URAA 3MZ2A 3SRKA 3ABZA 1YDYA 3B8TA 2I9UA 4IFKB 3NM1A 2WKJA 4GQ0A 4GUGA 4TU1A 2HQAA 1AD1A 4DO6A 4L61A 1KFJA 1YEYA 1TPEA 5CBIA 3QW3A 1R3SA 1ML1A 2DIJA 2OJPA 1XYBA 1XIGA 1RJPA 1UROA 3TYEA 1MUCA 3CWOX 5MKGB 2RGMA 3W72A 1TPFA 2WZTA 3MKCA 2XFFA 2X0SA 4JAWA 4B9ZA 5FF4A 1AW5A 2EGZA 3WD0A 3M41A 4DJEC 3PJTA 4JGDA 4NP7A 4QJ1A 1S2TA 2G95A 3ME3A 4UR7A 4Q4MA 1WZMA 2WM1A 1E6SM 1UA7A 3WJSA 1XBZA 4JTJA 3NQAA 1QPRA 2VXNA 1V4YA 3EA3A 1KCKA 4MSSA 1TPVA 2V5JA 2OWWA 4Q4PA 3NYZA 4JEJA 1YQ2A 1EWDA 4ZMGA 2J8FA 2QDEA 4UR8A 4HTYA 2J66A 4NZCA 1PL9A 4JTTA 1ICPA 3KWSA 1TX2A 4UNLA 1UMLA 4PUJA 2P53A 4TX6A 3NNTA 1C90A 1B4EA 5F1VA 5I3KA 3VGGA 1W5QA 4A6GA 3L4UA 4D6HA 3NIYA 4PSRA 2GVLA 3W82A 3PP7A 3LCXA 5M17A 4GCAA 3UYCA 4JTUA 5CPMA 5F2LA 3IJIA 4CEUC 1N8IA 2X1RA 3C0JA 3H53A 4M5PA 4GQQA 4RNHA 1XSKA 1LM1A 3ELFA 4KQNA 4ZOBA 1O7AA 3ANVA 3QY6A 2XFRA 3AS3A 5I77A 3FHAA 4O54A 1CYGA 4JX4A 1DVJA 4ZE4A 3O07A 4HNOA 2BGSA 3TYCA 3RMJA 4RNIA 3S5SA 4PN2A 4OE7A 3CASA 5H91A 3CC1A 3VZYA 2YA1A 4IQJA 5EYWA 3IRDA 3V18A 4JTSA 3P2VA 3M5VA 4DWSB 1CXHA 2GWGA 2DORA 2XN2A 3VIPA 4ADTA 1S5VA 4F0HA 2Y62A 4XB3A 3PULA 3PAJA 4IIFA 2HPMA 2J25A 4B5VA 4O16A 3TLQA 5TIMA 4Z2LA 3GNNA 3MDUA 4LC8A 5G2IA 2ZRYA 4O1AA 4HN8A 5LNVA 1LT7A 4GHRA 9XIAA 1M03A 4Q22A 3SDOA 5IM51 4W86A 1R7OA 4H01A 1CGVA 3HO8A 1OX4A 3CQIA 5REQB 1RQEA 1K8ZA 3ZJ6A 1EQPA 2QCEA 3RFAA 4Y2WA 3WDIA 1NDVA 4AZ5A 1SR0A 2WBKA 3QKEA 1G4TA 1HG3A 4CQCA 1FH8A 3OVQA 4C90A 4DZHA 3TTOA 4KGLA 4F4RA 3RM9A 4HN4A 3U9IA 1QHOA 4FIRA 2XUCA 3WLQA 2RAGA 3BGGA 4E4PA 3W7JA 2YBUA 4Z1BA 5AY7A 1OFDA 5LNSA 1C8VA 3F1QA 3ZVHA 1KFBA 1XYAA 1OABA 4K8EA 2FJKA 3GE7A 2I5GA 4N9DA 4S3AA 1JUKA 4L4PA 2QDHA 5EMKA 4YTSA 1EJUC 3NYDA 3WZ0E 1M7PA 3FS2A 4H41A 2FTWA 2ZE0A 2HISA 3CMJA 1OFRA 4LALA 3R8HA 3NQEA 1FWAC 3UWUA 5HWJA 1XIHA 2GJLA 1IXNA 2WNNA 5C2CA 1QJWA 1BVWA 3UJFA 3L0KA 1V93A 1DQUA 5AYXA 1Q6CA 1XI3A 1UD5A 3WUFA 2BXZA 3SSJA 1E6PA 1UD6A 1R46A 3II1A 3W81A 2RGLA 1UHVA 4Q8NA 3ONCA 3W87A 1L2QA 1E9LA 3GXNA 3AISA 3UPBA 5D4YA 1K9FA 3M64A 4FZIA 3VIGA 3DHUA 2FVKA 3SUTA 3ZJ7A 1JCYA 3AWOA 4NNAA 3U2OA 2VFGA 1QMLA 2VYOA 4WXYA 5A6BA 1EXBA 3R7MA 4IXXA 4B9YA 4HU8A 1IGSA 3EXTA 3EX4A 2R82A 2QS8A 1H0IA 3KW3A 1Y8BA 2BV9A 4OOZA 4QGCA 5KMYA 1G94A 1FHLA 2AOSA 3W37A 3H4GA 4UC5A 1Q6RA 2NUYA 1EJTC 2ACUA 3MI6A 2EG7A 2J6XA 3S9YA 3KBNA 1RK6A 2DW7A 1IXPA 1E43A 1B4KA 1XLJA 3RG6A 4L4OA 2EPMX 1GQIA 2PGFA 5HR6A 1I0BA 1FHDA 4OU1A 4GYPA 3MI2A 1O60A 4O4VA 1LORA 2BNJA 1YPIA 4XVDA 3IPWA 2BGNE 1OVDA 5C6MA 4AXNA 4N02A 4R88A 2DT3A 3VOCA 1HJXA 3E2SA 1RJRA 3WH5A 2BX7A 4KT2A 4JFUA 4NRSA 4Q4QA 2X40A 3DXIA 5CGMA 3U57A 3AOFA 4R9OA 3V0TA 4Q7NA 2W4XA 2XGBA 1TMLA 2F2KA 3BV7A 3TQKA 4H8HA 2XGIA 3KEHA 2YKKA 4S2CA 4GNVA 3DYMA 1NELA 1BQGA 3A64A 4JIRA 2HK1A 1LLOA 3R89A 1E4LA 1ISYA 3HQNA 4AD3A 3SUUA 1DHPA 2YXGA 1H1ZA 2XVKA 3VGEA 4F8XA 4H6QA 2WNZA 2D24A 4L80A 2GJXA 1JZ5A 1VZWA 4J3TA 1YE6A 3HFTA 2EPLX 1FY6A 4W93A 1ZQ5A 2UY2A 5TNVA 2X41A 3BSHA 1XLCA 2P0IA 4DXXA 5JXQA 3N18A 3O63A 3QW4B 3P14A 5ENLA 2OQLA 4OOUA 2R94A 3MTWA 1ZAHA 3NDZA 2QZRA 3RLVA 2I5QA 3QV8A 3NGFA 1UBPC 3GU9A 3C3NA 5HMDA 1GOKA 4LBRA 2ABAA 1EIXA 5J5RA 4B3KA 2C19A 3B8IA 5BRPA 4MLJA 1BTMA 4XUGA 1GYLA 1SJDA 1A0CA 1LWHA 3PB0A 3SCNA 3WF0A 1TA3A 5D04C 2E77A 5E6ZA 3TYDA 3WCZA 2J78A 4HB7A 3PJXA 1Z7AA 4QXIA 4HU3A 3WBWA 3LCIA 3KTCA 4GD0A 2V5BA 4F0LA 1B57A 3AC0A 3L23A 3QMRA 3WLMA 5CC3A 4WY0B 2GK1B 5C5YA 1IR2A 3VNJA 5J04A 3OHIA 5FJPA 4CD6A 3E0LA 1BXCA 4JDYA 1A5OC 1V3LA 1CCWB 1B90A 1KCZA 3LOTA 4IJRA 3RR1A 2Z7KA 5FJUA 4PUEA 2POZA 3IGXA 4AMCA 3A3HA 1KV5A 3PSVA 2GUYA 4AD1A 1F7BA 2DSVA 1W5OA 1BRLB 3WQWA 4Q6JA 3UT0A 4AAJA 1PZ2A 1A53A 2G96A 4BI5A 4MY9A 5D09A 3W1QA 1MW1A 9XIMA 4AWEA 3F5KA 3G0XA 3G1SA 1TJ0A 1WUEA 1MRQA 4JTGA 4UZSA 1PB0A 2GPTA 2V2DA 4YVXA 2A3LA 1A0DA 3EMCA 3W1RA 3A4XA 2GYIA 2CXEA 3N11A 3AI0A 4HKPA 4A3HA 1GT8A 1E6RA 1YLVA 4XZMX 2CZVA 1LL4A 4KIRA 2XG9A 3SECA 3W27A 3TZFA 1EO7A 1M41A 3V5FA 4H6KA 5JIWA 4M6VA 1KM5A 2AAMA 5FSDC 3QR3A 4R7JA 3AHVA 4UQCA 4LQ1A 2O9TA 1E51A 3DUGA 1H7XA 3UG8A 3RX3A 4L65A 1UZ1A 3VPLA 1TYGA 1IR1A 3A5VA 5FEZA 4ATDA 3G77A 1O5KA 2PWVA 3W2UA 1JGIA 4H9YA 2E67A 4QAWA 2ACRA 4DB7A 4KWSA 5EMLA 5A6LA 4MY8A 4J27A 4AZGA 5DEZA 3VMNA 3ABOA 2E6DA 4WX2A 4AEEA 3H70A 3L12A 1MDLA 3WBYA 4IWWA 4AIOA 2AGTA 3HA1A 3F7JA 1HNYA 1E72M 1JPIA 3ITLA 6CGTA 3G1RA 1W1PA 3GNPA 5I0DA 4B3LA 3AS0A 5AHFA 1DORA 3FX4A 2VGFA 4DF2A 3VMPA 5K2ZA 1IT7A 2NUXA 1X6UA 1W3JA 1TTIA 3U7VA 3L4VA 5DY2A 1J2BA 3NQGA 4NZ3A 1W5NA 3B3DA 3WLLA 1FH9A 2CZFA 2W63A 4UMAA 4ZFCA 3USZA 3MVIA 4M7SA 4MLRA 2ZTJA 4OBTA 4M51A 3P80A 1RK5A 2ZXDA 2IXUA 3VMOA 1ZP4A 1RR2A 4KMQA 4ATWA 3NEHA 1KA9F 1W3KA 1P7TA 3ARRA 4AYGA 1R87A 1TWWA 3KS6A 5EMUA 3E38A 4EANA 1WBJA 2ZUWA 4P7RA 1W1TA 1MXDA 5F2GA 4U2YA 3PG8A 2GVJA 4ZFMA 1KM0A 3UERA 1V3MA 5HMSA 4BY3A 4Y9AA 1X1ZA 3A4AA 4WKHA 3R4IA 3SAZA 4Q8UA 2HROA 2C3ZA 2D69A 3BV4A 4CU8A 4ZTYA 4MPKA 3LGEA 2R14A 4HHPA 2GDQA 1PVNA 1PX8A 1GW1A 4QSHA 2YBVA 4FK9A 1L6FA 2Y1HA 5DY3A 3CHFA 3FSTA 1ZSXA 3P5YA 2QIIA 4MVAA 3RDKA 2SFPA 5LIXX 2PWHA 1UOKA 3RU6A 3VNYA 4AH7A 1XUUA 1QNSA 4LRTA 4JYEA 1LL7A 1A3WA 1M9HA 4R7WA 1HF6A 1OQFA 1R38A 1K4HA 1QNVA 4UBPC 4GVHA 3P0WA 2GQ3A 4K2SA 1PZ0A 3G8RA 4LS1A 4MKSA 4ASTA 1XYZA 3FHQA 3WK2A 1EZ2A 4QP0A 4EAMA 3FK4A 2QCMA 3IWPA 1ZB5A 3RO6A 3E9AA 1U1HA 1FCBA 4JQ3A 4M3PA 3LG3A 4GQRA 1YYAA 1UH3A 3EB2A 1C29A 1UP2A 3V3WA 4B4HA 1OX6A 4MYAA 3LN3A 5HMFA 1NP2A 3EX6A 2HWGA 3PTQA 4EWJA 1EP2A 1TZ7A 3SRDA 4L6OA 1AMYA 1EUAA 4NNCA 1L6WA 4ADUA 4C6CA 3QRHA 3T42A 2Q09A 1PKMA 2JALA 2NQJA 4D9PA 1R85A 4PZVA 2GOUA 4OWGA 5C9WA 4C5YA 3N13A 2ZKMX 3H21A 4FR6A 4W7VA 4WUIA 4DZIA 5I24A 1UP3A 3GXMA 4C6LA 3EZ4A 4ONVA 1JFHA 3WDHA 2ZBTA 5FOOA 4DWSC 2J8GA 3S8HA 3AUJA 4E38A 1NY1A 1F05A 1E1CA 4D72A 1EJVC 3C2VA 1D3CA 1P6CA 1PX4A 2J77A 1PE1A 3BVJA 2PI6A 5FESA 3NL6A 4FA3A 2YOCA 2QVHA 4BR1A 4DPPA 2FZMA 3ZR6A 3NO1A