3R8RA

Transaldolase from bacillus subtilis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
212
structure length
212
Chain Sequence
MLFFVDTANIDEIREANELGILAGVTTNPSLVAKEANVSFHDRLREITDVVKGSVSAEVISLKAEEMIEEGKELAKIAPNITVKIPMTSDGLKAVRALTDLGIKTNVTLIFNANQALLAARAGATYVSPFLGRLDDIGHNGLDLISEVKQIFDIHGLDTQIIAASIRHPQHVTEAALRGAHIGTMPLKVIHALTKHPLTDKGIEQFLADWNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transaldolase
publication title Conservation of structure and mechanism within the transaldolase enzyme family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 75
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, P, R, T, U, V, W
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3r8rA00
2E6FA 3R13A 4UFLA 1KLYA 3GXNA 1RQBA 3I7QA 2YFNA 4HSOA 1KFLA 1K7XA 4MLRA 1PS9A 1F76A 4ZZ9A 2A85A 1KM5A 1VLIA 5HUPA 2EF9A 3KVMA 1R46A 1MSSA 1MZHA 4JDBA 4LS0A 3W1MA 3A23A 3G0SA 3VNDA 1J2WA 1ZAJA 2BSLA 3Q94A 1ZFJA 2FB3A 3RLUA 2VFDA 4O50A 5TQLA 3W7HA 1VGAA 1S3HA 4RJEA 1M5WA 3N2MA 1JQXA 3PUDA 3KX6A 3PULA 2QCHA 4MFDA 3KAOA 4GUHA 4O1DA 4LUIA 5AHIA 3E96A 2O7QA 1XDMA 4GBUA 3ZR4A 1LROA 3KHJA 3M6YA 1H7OA 5CPLA 2TSYA 3G0XA 2C3ZA 3H54A 4IPJA 4LUJA 1BKSA 3TC6A 1TTQA 2ZRWA 5SWUA 5HWJA 4M6QA 4IMCA 1YDOA 3LCGA 1PHWA 4FXSA 2QJHA 4TIMA 3HB9A 1WQ5A 1F6PA 1G7UA 2ABBA 3NQAA 4LV4A 2QJGA 3P84A 1GVFA 1ADOA 4XQ6A 2CLIA 4IX0A 1XBYA 3B05A 2P10A 4N9DA 1HFBA 2TPSA 1VQTA 2NX1A 1N8FA 1XKYA 1XUZA 1EPXA 3QMSA 3NQFA 5F1UA 3LHUA 3DGRA 1GVRA 1I45A 2YDAA 3GR8A 3W1RA 2EHHA 1TPFA 4CNNA 1N55A 3TSMA 1JCJA 3ZFHA 4PODA 4CNPA 4JDYA 3TQKA 1NVMA 5HWMA 1FWRA 1KFEA 4AMAA 2I14A 2B0MA 2ZZ7A 3LHYA 3EWZA 5D2VA 3G1VA 4YMZA 1CI1A 1RD5A 4XBKA 2G5WA 3TSDA 3ATYA 3IVTA 1GVOA 3QZEA 2CLMA 3CWNA 2GOUA 4JTGA 3ELFA 5FEXA 2JKPA 3NDOA 2X16A 3L21A 2FLIA 3TKFA 1PIIA 5I3KA 2JGYA 5C55A 1WA3A 1QOQA 3BO9A 2DJXA 1FWTA 2X30A 1P4CA 3PSVA 1WV2A 1XC4A 2HS8A 5HWNA 4A21A 3HGOA 1AMKA 2DZPA 3NXFA 3E02A 2PCQA 3DI1A 3G8EA 5EPDA 5G4WA 3VE9A 1JRBA 3MO7A 3NQCA 4S2CA 4ADUA 1KM3A 3B03A 5D2TA 1G7VA 4CCEA 3AJXA 3KRUA 4FIRA 3GXPA 3LCLA 2A6LA 1Z48A 1TCDA 5F1VA 3FEMA 3M5XA 3W87A 4FNRA 1K8XA 4O10A 1OX4B 3CM4A 1Z44A 3TSBA 2A7PA 2OCZA 5D33A 2YYTA 2A21A 4O28A 3W7PA 4OT7A 1YDNA 3TMQA 1DHPA 4EOUA 3G8RA 1VH7A 2TMDA 4IWWA 1KFCA 4NNBA 4UTLA 2C0AA 2V0TA 3MHUA 1Q3NA 5HR6A 3NL6A 1VS1A 5C2XA 4LS1A 5DY3A 4K7VA 5L9FA 5K4XA 5FI8A 3LOTA 3WJXA 1TB3A 2A0NA 3KOFA 4CCDA 3W7LA 1HO1A 3TFXA 4JY9A 3STFA 2ZRVA 1GOXA 4Z1AA 2QCDA 3FLUA 1TRIA 4O17A 3H53A 1X8FA 3EWUA 1G67A 3N19B 4AHQA 3PBYA 3UWUA 3EEGA 5DY2A 4ICNA 1YYAA 4UTJA 2DZWA 4FNSA 4IMEA 1ZHAA 4JTTA 3FJ6A 4RXFA 2E1DA 2NUYA 4QIUA 4NXKA 5IBXA 5CPNA 3T44A 4Z1DA 4JTKA 5CZSA 1SFLA 4HIBA 3JRKA 2A1YA 3NL2A 4K8HA 3R12A 4MKNA 5BMXA 1DJNA 5LHFA 5EA9A 5CPOA 3E12A 2QR6A 4L4MA 4MOZA 1ZAHA 1QPOA 4DF2A 3QSTA 3EWBX 5AYXA 3TA6A 2QUUA 2V82A 2WOQA 3LX9A 4NJIA 1RQEA 1I2OA 3W72A 1LLZA 3NM1A 2ZRYA 3TCEA 5LKYA 3FJLA 3L0KA 1R30A 3P5ZA 1DV7A 1NAL1 3N14A 2NWSA 1LOLA 4GJ1A 1XFBA 5C5YA 4LVGA 5HR7A 2VENA 2VXNA 3LGEA 3LI0A 5TBOA 3NPVA 5AYYA 5H2ZA 3A22A 5BMWA 3GKFA 3TMLA 3QYQA 1F2JA 1Q45A 4UFJA 3U6WA 3UXDA 4RXGA 3L0NA 3W1PA 2OZ0A 3NPWA 4YXGA 3O6YX 4GUIA 3A21A 1A5AA 3DH7A 3MI6A 3O06A 4O54A 1D9EA 1NEYA 3G22A 4EIVA 3MMTA 2C19A 2CLKA 2QCLA 4PL1A 1TPB1 4GWEA 1S5VA 5E1QA 3T7VA 1W5MA 3O16A 1KTNA 1H60A 1XXXA 2J9YA 2NUXA 5G2IA 1KTBA 4A2SA 1XBXA 3P81A 3LB0A 3W86A 1A5CA 3O6DA 2YX0A 3EXRA 2WNZA 5G1TA 4O52A 4WZHA 4NJJA 3LXCA 5K3VA 2E6YA 3PG9A 1FDJA 2YW3A 3NG3A 3LM7A 4PH6A 3W2NA 4KFNA 3LCHA 3PR2A 4RR4A 1LRQA 2QKFA 4A3UA 5AN7A 2ZA2A 4LVBA 4ZQCA 3C2FA 2DZTA 3GXTA 3NQ7A 3R2GA 3KVKA 3F03K 1P5BA 5U4NA 4IX2A 3NQVA 3IGSA 4O57A 1GG1A 3RFAA 1O95A 4FHAA 2R14A 4HPJA 4OQVA 1B4KA 2CZEA 3CLMA 4POCA 1T99A 2QDGA 3IRDA 1WXJA 1T8XA 4M6VA 4Y8FA 3IIPA 1KLZA 5DLCA 4QITA 2QF7A 3QJAA 2YSWA 1V7YA 2O7SA 1OFQA 3M9YA 5KZDA 2CWNA 1THFD 3EKLA 1XM3A 1A5SA 1IXOA 4QNEA 3KRSA 2NXGA 3OVQA 1TPEA 4Y96A 4HN4A 2VFIA 4FX6M 2B7NA 3TROA 4UIOA 1HTIA 5BRBA 1I2RA 3MUXA 3CIWA 1YLVA 4WXYA 1VYRA 5CSRA 4IXXA 1YXCA 2Y62A 4LY8A 4DO5A 1SW3A 3SY5A 1B3OA 1DVJA 1OF8A 3LV6A 3G1XA 3NQMA 3MBFA 3MP3A 4K37A 4P2VA 4O1CA 1LZOA 1M7PA 4JTLA 7TIMA 4JGDA 1C8VA 1QPNA 1KM1A 1L6WA 1UCWA 3RLVA 2RFGA 1H62A 3IVSA 1H7NA 3GDKA 4RKAA 5HULA 3OIXA 4N6EA 1ME7A 1ZNNA 3GNDA 3M41A 4FX7A 1QAPA 1PCKA 2JKAA 4PTNA 2Z6JA 3W1LA 2OT0A 1JCXA 4JTFA 1GPWA 1Z42A 4D2JA 1H1YA 2JGQA 3N34A 1M7OA 2PRMA 2TYSA 3W1NA 2W0UA 4CQ8A 3MP4A 3PUOA 3DENA 1XBZA 3BPWA 3NNTA 3EX3A 3LTPA 1WOAA 5D09A 3QFEA 2VOMA 4ORIA 3EB2A 5F4XA 1K03A 1KW1A 2WV8A 5HINA 1AW5A 4RV8A 5TIMA 4X22A 2Z2UA 3TJLA 1JVNA 1FY6A 2JK2A 4O1BA 2C18A 1YPFA 3CQ0A 3EWXA 3R8RA 3SIZA 1TRDA 2P1FA 4KKXA 1LBLA 4JR5A 4OHQA 4TMBA 3MHFA 3GVGA 4LVFA 5FF0A 4FB7A 3YPIA 1KFJA 5GVJA 4OGZA 1DOSA 2TRSA 3TXZA 4LOCA 2VELA 4QJ1A 4RK8A 3W2KA 4O8RA 5FEPA 2RH9A 4YCPA 3GR7A 3QQ1A 5K4ZA 3BLIA 3C61A 3FA5A 4M7SA 2J88A 5KINA 4IPIA 4CNOA 4DO6A 1I8JA 2R8WA 3HG3A 2WJZA 2ZFAA 2WPBA 4HPXA 2ZTKA 4TU1A 1ML1A 2Y7GA 2V2HA 4TO8A 3SECA 3L65A 3NPUA 2IQTA 3BV4A 5C6MA 2X2GA 1B9BA 4UCGA 2Y88A 3C0JA 2NUWA 4OU1A 3C2OA 1H1ZA 2G97A 4NNAA 4YL2A 4R53A 4NX0A 3TXVA 3N3MA 2UV8G 2JBMA 1FX6A 3N9RA 1F7BA 5LNUA 3MYPA 3TH6A 5KTLA 2G96A 1QMLA 1LCOA 1PV8A 1JR1A 2Y6ZA 4PFMA 1VYPX 4P61A 4AVFA 4GXMA 2A4AA 3TNOA 2V5LA 4IJBA 1W3IA 3QEZA 3C6CA 4JYFA 1H7RA 3GDLA 2RDUA 1ZJIA 2ZZ6A 2CLEA 3A24A 5AC7A 1S5TA 5F4SA 4YLWA 3HJZA 3B06A 3NL3A 4C1KA 5G2HA 2NZLA 4WD0A 3TDFA 3M5YA 3TQ0A 4LT9A 4LC6A 5KZEA 2ISSA 3G1HA 4I7VA 4N9CA 1ZY9A 1G69A 5HMSA 4UFKA 3HPXA 3MP5A 2Y61A 4H4IA 1TTIA 2C13A 3GDTA 4JY8A 3CT7A 3SW6A 1FCUA 3A9IA 1GTEA 1KTCA 3WK3A 1GEQA 2X1RA 4JIPA 2ZZ1A 3IIOA 3GDRA 4NT0A 1YXYA 4QQ3A 4DEFA 1LDCA 4PA8A 3FKRA 4NU7A 3DHDA 2H8XA 1FXPA 1RR2A 2ZZ2A 3QC3A 1SO5A 4U28A 4KWWA 1EB3A 4LW7A 5D2YA 3S5ZA 3PBWA 3L0GA 5FEZA 1KFKA 2J6XA 2GUUA 3W23A 1TTPA 1TYGA 3GAKA 1EP1A 4O14A 4UXDA 4K7YA 3HGSA 2V2DA 3G24A 3NVTA 4OV4A 5D30A 4RZ6A 2A7RA 3CWOX 3HMJG 1AW2A 3O05A 3BK0A 3E0IA 3PB2A 1FWWA 2V5BA 3P5YA 1GZGA 1W56A 1GG0A 5HQEA 3S5NA 1ALDA 3DFNA 4LU0A 3BLEA 3NAVA 1ZAIA 2VFHA 3WJZA 1TPH1 3SZ8A 3LBMA 1SU5A 5D03A 3PVFA 1NF0A 4FNQA 1QPQA 3S42A 5I3GA 4FEZA 1AK5A 3W1UA 2RDTA 1RZMA 3G1FA 4E2DA 5IBXC 4UTHA 2ZA1A 3OEXA 4JX5A 4N9EA 4JEQA 2H8ZA 3A5VA 4AXKA 1UUMA 3TW7A 1WYIA 1VPXA 2FDSA 3SFKA 3BVJA 1EIXA 2NLIA 4XUGA 5LGZA 3KXQA 4DPPA 2VFFA 4LWWA 1SZFA 2CW6A 1H50A 4O1AA 2E5BA 1I2QA 3CIXA 4YWIA 3NQEA 2R91A 5LHEA 3FS2A 3DU0A 2ZRXA 4MVAA 1TPC1 2BTMA 4K39A 1VCGA 5FEWA 3A5FA 3PB0A 1W1ZA 4ADTA 1RV8A 1QNVA 3NZRA 4RX0A 1I4NA 2WSYA 5DCEA 3HBLA 3L9CA 4IQLA 4CLMA 4UTMA 5D32A 1AL8A 2CZ5A 2C6QA 2VC6A 3G1SA 3VCRA 1U5JA 2CU0A 4JTEA 3NYZA 5F2LA 2GJLA 3ANYA 4NVTA 3C56A 3NL5A 1K8ZA 2YYUA 3R5EA 4WJEA 3O07A 3EKZA 1ZALA 4E0CA 1G4PA 2Z0IA 2GPTA 3BGJA 2ISVA 3L2IA 4O4VA 4N4PA 4ONVA 2Z1BA 4LS2A 1NF7A 4O13A 1G4TA 1D3GA 1HL2A 3CEPA 5EKYA 3FYOA 3BGGA 3T40A 2QCEA 3W71A 2X1TA 2CZFA 3OBKA 2EKCA 4AWTA 1B4EA 1AG1O 4JNMA 1UBSA 2X1UA 4O15A 5G1YA 3BG9A 2ALDA 2BWGA 2HS6A 3W1TA 2WSRA 1UUOA 5AHLA 1SZEA 1SZGA 3U8GA 1K8YA 1TIMA 1KM2A 3OHIA 2YXGA 3HG2A 3UQNA 4BWLA 1YADA 2V81A 4PL2A 5F2GA 4J9JA 3B0UX 4OWGA 5KITA 3KVLA 4X9SA 1F5ZA 1LORA 1YXDA 3LXBA 2W6RA 4K6AA 1RPXA 3P80A 4Z08A 5EBUA 4LVDA 2NV1A 4UTUA 5EL1A 1IXPA 5LNSA 3B4UA 2Q8ZA 4Q33A 1W5NA 3BLFA 4MYXA 4ZL1A 1QO2A 2RKXA 4IOTA 3MW7A 2B4GA 5G4EA 2VEMA 2GVGA 1EWDA 5C54A 3NGJA 1SO3A 4UFHA 1HO4A 5H91A 4ALDA 1C9DA 3UWQA 1IXNA 2X1SA 2FPTA 3L67A 1F6KA 5A8GA 4GFSA 2XFWA 4UC5A 1VLWA 4DO4A 5T26A 4ZQRA 4MJMA 5DXYA 5D02A 3UPBA 1G4EA 2ATMA 1OFOA 4GUFA 4YCOA 1JUKA 2ZQ0A 2I1OA 1OFDA 1GQNA 1GVSA 2YFOA 4UMCA 1WX0A 4DXVA 3W7DA 2W79A 4S2BA 1ICSA 3B8DA 2V2CA 3F4NA 1TQXA 4JTHA 1SPQA 1SW0A 2ZYFA 3W6YA 4MZ1A 1OYBA 2YGYA 4FXRA 2QAPA 3M43A 4Q32A 1GWJA 3W2UA 3UXAA 1O5KA 1IF2A 4PCFA 4IGHA 3IEBA 4WY0A 3I65A 4Y90A 3TW6A 1G4SA 4TMCA 3NQGA 2WKJA 2YW4A 4UTKA 1P0NA 3DFTA 4RZ4A 5EMUA 1JCLA 1PE1A 1O4UA 2BX7A 3P60A 2Y7FA 4N9BA 1JCMP 1SW7A 1T96A 4QNWA 2NXHA 4BFAA 4R7JA 3WFAA 4NNCA 1LBMA 1PVNA 1NSJA 1G6CA 2C16A 2GQ9A 4IUOA 1M6JA 3UZJA 1K3UA 1Z41A 2FB2A 1QPRA 3O6CA 4LTSA 3WJYA 4HHPA 3LHTA 3FYPA 2VEIA 3SSJA 4PEKA 4DF1A 4EWND 3QMTA 1KA9F 5CZTA 3P67A 1R47A 1V5XA 4XTDA 3S6DA 4GE8A 4WUIA 1SR9A 2B7OA 1SFJA 3TAKA 3TX9A 4Y9AA 5F2IA 5DCDA 1ICPA 4DPQA 2EGZA 2QCDB 4M6PA 3S1WA 2OMAA 1LOQA 3GYEA 3LBCA 1ONRA 3ZWTA 2H3BA 1WBJA 3HQ1A 1L2UA 2QCCA 4RCXA 3W70A 5AOUA 1SO6A 4UR8A 1XBVA 2Q3OA 3B04A 1IGSA 4KFOA 4A2RA 2A5HA 2QDHA 3EWWA 2RHGA 1TPDA 5D2WA 3STEA 3LRMA 2FQIA 3RNDA 3MI2A 1OFEA 3TE9A 2CLHA 3C3NA 1TQJA 3PM6A 3P82A 4DELA 2YR1A 4XBSA 2Y7EA 3WK1A 1ZENA 2Y70A 3NM3A 1W37A 2ZRUA 1OFRA 3IV3A 3M7WA 1TPWA 3W7RA 2BXVA 3BARA 3QW4B 3LDVA 4UR7A 3NQ2A 3BW4A 5IM51 1EWEA 3SR7A 4GUGA 3THQA 4XKYB 5F2MA 1AW1A 1X1OA 4UTTA 3SI9A 3W7NA 4GNJA 1WOBA 1P1XA 4LRTA 1FWNA 1LRNA 3PSWA 4O19A 5CZJA 2B7QA 4K36A 2J24A 4AAJA 1J5TA 3W9ZA 1H5YA 5HNRA 4QAIA 2KZHA 1Q6RA 1VZWA 3QQ0A 3QRHA 2WNQA 3QMRA 4JTJA 2FFCA 2DZVA 3M44A 1FXQA 3RF9A 5AHMA 4NJGA 4WY0F 1LP6A 2RDWA 4H6KA 1GVQA 2D73A 4JXCA 4ZQPA 5LNRA 3EX6A 3TC7A 3S5YA 2Y85A 2JKEA 3UWYA 3Q2DA 3IGXA 1JUBA 1BWLA 4MY1A 3KFTA 2E77A 3JS3A 1DJQA 3W7KA 5AB3A 1DORA 1VCFA 3C2EA 2CLLA 3W1QA 3Q58A 2WSQA 2J27A 2Y63A 3TR2A 3UY7A 3LCWA 4AF0B 1FBAA 3CPRA 1H7PA 4FNPA 1N7KA 4UFIA 1YPIA 4JTSA 4UMAA 1KM4A 2R94A 4MY9A 4DBDA 3PBUA 3GLCA 4NJHA 3OVRA 5DCBA 4R34A 3W7IA 3S1XA 4MZ8A 4E38A 3U2OA 1ME9A 1U83A 3NQ6A 2Y7DA 1LOSA 1F05A 3D0CA 4W9TA 4CQAA 5LSMA 1J4EA 4EF8A 1H63A 1I2NA 3M5VA 1CW2A 3HG4A 4UTIA 3T55A 3HOJA 1OFBA 3C2RA 3KRZA 4FIQA 4UTWA 4PC8A 2OT1A 5U7SA 2LLEA 1GJPA 3VE7A 1S5WA 4C1LA 2CLOA 1EEPA 4FO4A 5D05A 1EP3A 4ZQOA 3LRKA 2Q8LA 3TV8A 3W76A 3QW3A 4BK9A 5E93A 2DP3A 3S5OA 5FF3A 3PC0A 1FWSA 3DFQA 3DHFA 2NX3A 3AO0A 4XZ9A 5CZ0A 3NO5A 1JRCA 3CU2A 4Z0SA 2BLEA 4OBTA 1R2RA 4LC8A 1DL3A 4TR9A 4BI6A 4R33A 5E0KA 2CLFA 2PRHA 4JN6A 4HNVA 4S1FA 1QR7A 1TTJA 1KM6A 2NV2A 1F73A 2FIQA 4Q4KA 1YDVA 1FCVA 1QFEA 5HUOA 4N4QA 1OFAA 3W1XA 2V8ZA 2NX9A 3O63A 4G1KA 1WBHA 3GZ3A 3F1QA 1JUEA 4MFEA 4ZVJA 3LCXA 3WJWA 3NEVA 2ZA3A 4O53A 1T0OA 3R89A 2BZNA 3W83A 3LV5A 2Y89A 3P61A 1Q6LA 3LLFA 1GYLA 4MLJA 4JTIA 3FKKA 1LLWA 3W7OA 3N9SA 4DQWA 3LLDA 1OX4A 3RU6A 1TJRA 4ZQMA 3W2JA 1KV5A 1GYNA 3LCFA 3NQDA 4QSHA 1O5XA 2H3DA 5AHFA 4LV9A 1VHNA 1JULA 2GVLA 3MJYA 3M1ZA 3LI1A 1P0KA 3QF0A 3VFLA 3M16A 1OJXA 3W7JA 5D37A 1K7EA 4IMGA 1R2SA 3PBVA 4JIQA 3BG5A 3HGJA 5A5WA 2GQAA 3PUEA 2AAMA 2VFGA 1R2TA 4AB4A 2ZCGA 4NQ1A 4OV9A 3C8FA 5BW6A 3IIXA 3L5LA 1OHLA 4BWLC 1RVGA 3NPXA 3CTLA 1XDLA 3W1AA 4MIMA 4HNTA 3UNDA 3F4WA 3HPSA 4CCCA 5BOOA 5FF4A 4O4WA 4E2BA 4FF7A 4WQ6A 4AH7A 4O12A 3DZ1A 2WQPA 4HKPA 1SQ7A 1I2PA 2CFFA 5I3JA 4NXSA 1L9WA 3LHZA 4MJZA 1VJIA 2G95A 6TIMA 1X6UA 5FESA 5LNVA 5I3IA 4FNUA 4UNLA 3CEUA 1OYAA 5FF7A 1FCBA 3N2XA 3NZ1A 1IXQA 1UASA 5D04C 3P74A 1WDWA 3CHVA 3JR2A 4KFPA 1XI3A 2V30A 1QDSA 1L6YA 3I6RA 3DKLA 3EX4A 1PHQA 3STGA 1XCFA 4QM1A 3QPZA 4NJKA 4XWUA 1ZCOA 3FIGA 5I3FA 4IMDA 5KSWA 3PY2A 1VYSX 1QO5A 1A50A 1JQVA 4TX9A 2XN1A 1W8SA 2PC4A 3C2VA 3EXSA 3LTYA 4GRSA 4JYEA 5L6UA 4MPQA 4KWVA 3UWVA 3UWZA 1D3HA 5G5IA 1VCVA 1LBFA 1OFPA 4LNYA 5DELA 3DXIA 3GDMA 4HNNA 1TREA 1OX6A 5DBUA 5CG7A 2VEPA 1QOPA 3P7YA 5D2XA 4U4MA 3P62A 1H61A 3UZ5A 5BNKA 1EUAA 3LERA 1W0MA 4NUWA 3NOEA 4JD4A 2F84A 4JX6A 3SGUA 2A2IA 3TUUA 1LYXA 2I9EA 4ORMA 3OVPA 3L68A 1W5OA 3LCIA 2E6AA 1PCWA 5AC8A 3ABSA 4AEOA 3TU9A 3W22A 4IMFA 1H7XA 1A53A 2AGKA 3W73A 4BR1A 5K9CA 1JJKA 1VR6A 3C4UA 3S1UA 3W7QA 3G1DA 1W31A 4I7WA 1OF6A 4MYAA 5AHNA 4NZJA 2ATSA 3EX1A 3L5MA 1GT8A 1W54A 3S1VA 1RQHA 3G3DA 2Q3RA 2ISWA 3PG8A 2E6DA 3BW2A 2QCMA 1JCYA 3TIMA 4H3DA 1FUYA 1FDZA 5F4WA 3UY8A 3PF3A 4ZQNA 2WO5A 2GJNA 3ABRA 4JYDA 2VEKA 3T78A 1IIGA 3MHGA 3W2MA 1Q6OA 4X2RA 5KMYA 1W3TA 3M0ZA 4X3ZA 4ML9A 4MUZA 5DN1A 4JTUA 2A7NA 1KFBA 5I3HA 4IXHA 3STCA 1DBTA 3UYCA 1AL7A 4EF9A 3DFSA 3L5AA 5KZMA 4HT3A 3DFPA 3NR0A 4HSNA 8TIMA 2YPIA 2C14A 3N73A 1ME8A 4UNKA 1KV8A 4WOZA 1EX5A 3GX9A 3V75A 1KM0A 2WNNA 2DORA 2DJLA 4ADSA 4LVAA 4GC4A 1KBJA 2VFEA 3I7SA 3IIZA 3BW3A 2FJKA 4I7UA 2PURA 1TPUA 2NXIA 3QPYA 3QSRA 3DI0A 3GK0A 4XKYA 4UTTC 1BEUA 3EXTA 3ABQA 3DAQA 1LM1A 3WK2A 1MEHA 4Y6GA 2QCNA 3HO8A 2EAWA 3W3OA 2QCFA 3S9YA 1YTKA 2QCGA 2C15A 1BWKA 2E68A 1TV5A 2A6NA 4Z1BA 3DFOA 1PL9A 3SJ3A 1OABA 3TAOA 3GKAA 4GUJA 3L66A 4EVZA 5EY5A 3LHWA 3WJSA 1DQXA 1HG3A 3M47A 1OVDA 3K30A 3W88A 2DZUA 1W3NA 3O8AA 2QUTA 5K9DA 2V9DA 3P8JA 3B0PA 4K8EA 2CZDA 4NX5A 1SO4A 1TO3A 2ZZ4A 1VHCA 3FFSA 3IGUA 3UPWA 5LNWA 1E51A 5K7JA 1EA0A 3W75A 3LHVA 3IVUA 4M7TA 2FTPA 3O1NA 3DBPA 3O15A 3W7MA 5FF2A 2E5CA 4AF0A 2Z6IA 1EP2A 1Q6QA 2OJPA 1B57A 3MWAA 1SUXA 3VKJA 1LRTA 2NWRA 1O94A 1X7FA 2E5DA 3M5ZA 1X1ZA 1IIHA 4DBEA 5D38A 4QISA 4HNUA 6ALDA 3INPA 1JCNA 4DF0A 4WXZA 5CGQA 1HUVA 3EX2A 1H51A 3T4CA 3DKJA 4UTWC 2YZRA 3HGRA 4WOQA 1OG0A 3LRLA 3HF3A 3W7GA 1K02A 1K7FA 3UWWA 4NZFA 1MXSA 1TMHA 3B0VC 2ABAA 4RLIA 4AWSA 4O0ZA 2FPVA 1Y0EA 2PRLA 1L6SA 1FDYA 2ZBTA 3SGZA 3GAYA 4M5PA 1FCQA 4BF9A 2B7PA 3C52A 4LRSA 4XTIA 3OA3A 1VRDA 4JX4A 3GB6A 3MBDA 1ICQA 3THAA 5DXXA 4RZ5A 1F74A 3CC1A 5HJLA 2H90A 1OK6A 1QWGA 1DKWA 1DQWA 1XUUA 3E49A 1MEIA 3S8HA 3MI3A 4Z1CA 1W5QA 2H6RA 4CQ9A 3OG3A 1CX9A 1VC4A 3RK8A 2OX1A 1O60A 1KBIA 3TK7A 3PAJA 1OYCA 1YTDA 2E09A 3FOKA 2C1HA 1QCWA 5CSSA 2ZZ3A 4FX8A 3G1AA 5CKSA 4JICA 4Z0JA 1BTMA 2XN2A 1MO0A 1SSGA 3QM3A 4UFMA 3I7RA 3TQVA 4N2YA 1XL9A 4MY8A 4O18A 2FPYA 5CPMA 2ZRZA 4WX2A 2J9XA 1WAUA 2YCEA 3H55A 4AWUA 3NQ8A 3ATZA 3IIVA 5K2ZA 4MZYA 2P0OA 1H7WA 1TJPA 2J9ZA 4L4LA 3ABOA 2ZDRA 3W74A 3EWYA 3MYOA 2DU2A 1LTDA 3BG3A 3ZWSA 5LGXA 3QH2A 4WY0B 3Q37A 3W7CA 3UD6A 2EPHA 4AHOA 3TJXA 5G2WA 4JS3A 4OE7A 5ABTA 2QAFA 3HG5A 3S0CA 3USBA 1NFBA 3CB8A 2XN0A 5DBTA 1SSDA 1OX5A 5AYZA 2GVJA 4BI7A 1TPVA 4N6FA 1C29A 4N02A 3KVJA 1MEWA 3E9AA 2ZTJA 3RMJA 3HIJA 5LZLA 3GNNA 4UMBA 3G18A 3W2LA 5MHBA 4BI5A 3G0UA 1OK4A 2HSAA 2GQ8A 2ZZ5A 5AC6A 2DZSA 1FQ0A 2F7FA 3HPZA 4M19A 2VKZG 4AHPA 3TFCA 3I68A 1W5PA 1YTEA 3PWAA 2PE4A 1TV7A 3P8IA 3W84A 4O11A 3W85A 3G3MA 4O0KA 4B5NA 3G1YA 3WK0A 3GIYA 5J5RA 3VI2A 1EUNA 4UUIA 4I9AA 2HTMA 2QEZA 3W7EA 1TSIA 2AQWA 2QJIA 5K9XA 5AHEA 3PS7A 3NA8A 3W07A 3LTSA 4A29A 4A22A 3LXAA 3ZS4A 5EYWA 2HMCA 2QUVA 4ZMGA 1TV8A 1UB3A 5J5DA 1SZNA 4K38A 2DZXA 4O16A 1GTHA 5AFDA 3V1PA 1UJPA 4FNTA 1A5BA
chains in the Genus database with same CATH superfamily
3CO8A 3FHQA 1DJGA 5DX7A 2PPGA 1T5AA 6XIAA 2WMFA 3I7QA 2YFNA 4MLRA 3WDJA 1KM5A 4FS9A 3VDHA 2GYIA 3W1MA 3HURA 1DEDA 3A23A 3G0SA 3PZQA 4JQ4A 4H6RA 3Q94A 1ZFJA 3RLUA 2VFDA 5M03A 3OPSA 3CV2A 4RJEA 3II1A 4J40A 5I00A 1M5WA 1X8CA 2I9UA 2HWGA 2WHMA 4AXNA 3VDBA 3KX6A 3PULA 8RUCA 1SMDA 4MFDA 2OVLA 1D7KA 1W1B1 3M6YA 5JIPA 1H7OA 4LYPA 4IPJA 4U2YA 1DWIM 4WSHA 3TC6A 1EGZA 3IJDA 4UQCA 2ZRWA 5T8GA 1YDOA 3KTSA 2FMNA 2WZMA 3H2OA 4TIMA 3G2GA 1WQ5A 3UXLA 1G7UA 1UPPA 4CD7A 1ADOA 3AMKA 3VOHA 4FAMA 1ECEA 2CLIA 1XH1A 4IX0A 3WFZA 3V36A 1UR2A 3B05A 1HFBA 2ALRA 1NDWA 1XKYA 5F1UA 3QMSA 4L7ZA 1K9FA 3FA4A 2BVTA 3LG3A 2EPKX 3L4YA 3EPOA 2J7HA 3W1RA 1TPFA 4QS5A 1BVWA 5BU9A 4Q3MA 3ZFHA 3N12A 3WDIA 3EPMA 3LHYA 5D2VA 2Z1KA 1N8WA 1XF0A 4A3QA 1S38A 4GVFA 3TSDA 3IVTA 3QZEA 2CLMA 3F4DA 1MVYA 2GOUA 2IXVA 3ELFA 5FEXA 2JKPA 2X16A 3L21A 1PIIA 4DYKA 1J0JA 5FOOA 2JGYA 3OO2A 3NYDA 4RPPA 4V2XA 4JIRA 2WHJA 3LN3A 5HWNA 3HGOA 2DZPA 1QRQA 4UQAA 3G8EA 5EPDA 4W5UA 3KDOA 4XBJA 4PZVA 1P1MA 3VE9A 4YTTA 4S2CA 4ADUA 5XIMA 2GQ3A 3CYVA 3KRUA 5BCAA 3PZNA 4B5SA 2A6LA 5FJJA 5HNNA 1Z48A 4KF1A 1OX4B 4EXBA 1Z44A 3N25A 1R38A 3TSBA 5TF0A 2A7PA 4GIAA 2YYTA 5BRPA 7ENLA 1IEWA 3VD5A 2Q71A 4TVCA 1YDNA 3TMQA 1DHPA 4KMQA 2ZADA 1VH7A 4IWWA 3EMQA 4HYVA 1VS1A 1RLDA 2BVWA 5C2XA 5L9FA 4K7VA 3LOTA 3WJXA 1LQAA 2V5CA 4KERA 2QVNA 1HKMA 2XIBA 1QNRA 3W7LA 4QCEA 3KDNA 3TFXA 3ABZA 1Y5VA 2WZEA 4Q4SA 2XU2A 1O12A 5AZ0A 1K9TA 3MMDA 1TRIA 3EWUA 5A6AA 1GW1A 1R9XA 1PX8A 1DTUA 3UWUA 2XIOA 3EEGA 3BLKA 2PTXA 1US0A 3U0HA 4IMEA 1ZHAA 3L4UA 2BASA 4JTTA 4EPDC 4C6QA 3IAQA 2XH2A 4Q8PA 2BOFX 2NUYA 4QIUA 3VOCA 1EA9C 3IJ6A 4Z1DA 1CB2A 3IS4A 1QTWA 3WMSA 1SFLA 4HIBA 3JRKA 2A1YA 3NL2A 4K8HA 3QN3A 5XINA 5BMXA 2VC5A 2PB1A 2WKLA 3QSTA 1KRMA 4A8NA 3WBEA 4DLFA 5AYXA 3TA6A 2QUUA 4L1XA 1EF2A 3R94A 1OQFA 4U2ZA 2EO7A 1M7XA 1W9VA 3L0KA 1AZ2A 1F61A 2ZE3A 3A9BA 1UIOA 2PTDA 3VNZA 2PP0A 3AYSA 1B3XA 2XGZA 3QQWA 1Q8JA 4LVGA 2VXNA 4R88A 1Z8AA 3LI0A 3LGEA 4GHRA 3GWQA 4H9ZA 2HNHA 1MQQA 3B9NA 4Z17A 1Q45A 2OZ0A 1W1VA 3MUCA 4YXGA 4IPPA 4O54A 1A5AA 3MI6A 1JG9A 1OCJA 3MMTA 4V1XA 4GWEA 3WLJA 1I1XA 1S5VA 3O16A 1KTNA 1XXXA 4XAPA 5G2IA 3CYJA 3CUJA 1IZJA 1UD8A 3BAXA 3LB0A 3W86A 1A5CA 1V0MA 1W1IE 2EBNA 4ZOEA 4WZHA 4NJJA 1E9LA 2Y8UA 5C9ZA 5K3VA 2V5DA 3LM7A 4PH6A 2Q02A 4HN8A 3OTRA 4KEMA 4FOJA 5FSDC 1C8XA 1KGWA 1L0PA 4ZQCA 4KS0A 1KNWA 1NM9A 1OINA 3AYVA 2UY2A 3TYBA 1G1YA 3KVKA 1GOWA 2BS9A 4W5ZA 2R14A 4OQVA 4C7GA 4L80A 3CLMA 3AHZA 2QDGA 3O9NA 3SCSA 1T8XA 5M17A 4M6VA 4AZ6A 3GD6A 4LBSA 1BYCA 3TW9A 1AODA 4DWDA 4IQJA 4EE9A 1EJXC 2YSWA 2J7EA 4JHOA 2PP3A 1FOBA 3M9YA 5KZDA 2CWNA 4PUNA 2DVXA 4ERIA 1VRXA 2NXGA 1TPEA 3WNNA 4CD5A 4LUSB 5M1TA 4C5YA 4GMEA 2VFIA 4FX6M 3AS0A 4I6VA 5BRBA 4PMNA 1SJBA 3QHOA 5M3WA 1Q6DA 2SFPA 2FH8A 5KZ6A 3G1XA 2XVKA 5BXSA 4AYGA 4XX6A 1ELSA 3QPEA 1L6WA 1QASA 3IVSA 5DMLA 4IMAA 3H8AA 3V4BA 4XIAA 3OIXA 4N6EA 2E8ZA 4FLRA 2IW0A 4D8ZA 1PCKA 4PTNA 2QYGA 1UD4A 2XFRA 4UOJA 4XZWA 5EB8A 4L9ZA 4QG8A 3KBJA 1VBHA 2QJJA 3W1NA 3BTNA 3MP4A 4P5UA 3NNTA 2HVOA 3C8NA 2YCIX 3LTPA 4PMUA 1WOAA 3QFEA 3VD9A 3CNYA 4BZYA 1H49A 4DO7A 5A6BA 2WV8A 4D6GA 4G9PA 1FWEC 3U9IA 4X22A 3TJLA 3VGEA 1FY6A 3V35A 1AQ0A 1MI3A 1BGAA 3SIZA 2VOTA 4OOUA 4BEUA 2XM1A 4JR5A 3BGAA 4LVFA 2WC3A 1M3UA 4AD5A 1KFJA 3TXZA 1XYMA 4QJ1A 3VC6A 3EOOA 3IK2A 1GCYA 3QQ1A 3M46A 4V33A 4OECA 4IP7A 4NRSA 3QBUA 2CXEA 2J88A 3PFMA 1S5MA 3N9KA 2Q01A 1JXKA 1UR1A 1I8JA 2QJNA 3IJ9A 1E40A 2WJZA 2IMRA 2WPBA 1NELA 4HPXA 2ICSA 2VCAA 1RP8A 4RL3A 2YCLB 4DJED 1ML1A 2BGSA 4AISA 2ANUA 3L65A 4AEFA 1PSCA 4JQ2A 2X2GA 2CHRA 2DGAA 1S2VA 5HQLA 2Y88A 3C0JA 2NUWA 3MQTA 3MDUA 4R53A 3TXVA 4Y2WA 1TV3A 2JBMA 1FX6A 2BP1A 2G96A 3UVIA 3GG7A 4J1OA 4C6NA 3ABXA 2FHBA 5D8ZA 3QOKA 1VYPX 1VBGA 4P61A 4AVFA 4NI8A 1GOKA 4IJBA 1W3IA 3QEZA 1XR2A 3C0QA 1ZJIA 3WDPP 3IUHA 2WZHA 4BA0A 3FDKA 1CNVA 1ODZA 3NSXA 2PSNA 4QHRA 5G2HA 1GVYA 5XIAA 3UJRA 1CGUA 4QLKA 2ZX6A 4LT9A 3CV7A 3KRBA 4KW2A 1ZY9A 1VFMA 3WH9A 1G69A 4AU0A 3HPXA 4H4IA 2C13A 4YPJA 1GTEA 1KTCA 4IFOA 1GEQA 2X1RA 1J01A 3CZJA 2DY3A 3IIOA 4QQ3A 1XYBA 3AIRA 4NU7A 4PCTA 3CT2A 1FXPA 3FGCB 4U28A 3QY7A 2VRQA 3PBWA 4Q8UA 2X40A 5FEZA 2J6XA 3W23A 2ZX7A 2XSAA 1MYRA 4UXDA 4FLQA 4QBXA 2V2DA 4GH1A 2VYOA 3NVTA 3N1AA 4FPSA 1J11A 4RZ6A 4MB4A 3HMJG 2ZUUA 3O05A 2V5BA 4LSBA 4XV0A 3DFNA 3BLEA 4DVOA 4W86A 3VM7A 2OB3A 4QP0A 3BE7A 3LBMA 1LWHA 5D03A 3PVFA 1H0IA 4FNQA 1AK5A 2RDTA 2E4TA 3G1FA 4J3SA 5IBXC 2BDQA 4H6QA 3OJGA 2FHFA 3WF1A 4TUFA 2F9RA 3RGTA 3ANUA 3N6JA 1V8EA 3F4VA 5E6YA 1UW9A 3TW7A 3FW6A 4UOZA 4AWEA 1EIXA 2NLIA 4XUGA 2VFFA 4LWWA 4O1AA 3WQ8A 2QV5A 4DWSA 2R91A 1CDGA 1QBBA 2BTMA 1NDVA 3CWHA 1VCGA 3IJ8A 2VI0A 3UA3A 1WB0A 1RY0A 1BSIA 4ADTA 2UBPC 3FV9A 1RV8A 1TZ9A 3OLIA 4RX0A 5A8PA 2UZ9A 2WSYA 3RX4A 5DCEA 3HBLA 5E5CA 3I10A 5D32A 2OG9A 3FSUA 4LALA 4E4PA 1HZYA 3RMEA 2INFA 2OO6A 1L2QA 4JTEA 4HZ6A 3NYZA 4AW7A 3ANYA 4NVTA 3C56A 3NL5A 4Q6JA 3B8TA 1ADDA 1LF1A 2C0HA 1M04A 4G8TA 4Q4PA 4AIEA 4A8RA 3L2IA 4ONVA 3PJXA 4LS2A 1NF7A 3G77A 1G4TA 1E1FA 2RJGA 3M0KA 1XX1A 3WF0A 1XRVA 4GYKA 7REQB 1OIMA 2EKCA 1BPLB 3BV7A 2X1UA 3MWCA 2BWGA 3W1TA 2WSRA 1SZGA 1KM2A 3OHIA 2YXGA 2DUAA 1J2BA 4WGXA 3UQNA 1YADA 2V81A 5F2GA 5A6KA 3B0UX 1V6UA 1YE4A 2DSZA 2AKZA 3H2FA 4QJ3B 1EJUC 1F5ZA 3P93A 1OY0A 3LXBA 5DEZA 4K6AA 1RPXA 3P80A 2UY3A 4HJFA 3UPMA 3ARSA 2MUCA 1BQGA 2OU4A 4QX4A 3B4UA 2Q8ZA 4EXQA 1W5NA 1R8LA 1QO2A 4XSMA 3WLPA 3TYEA 2B4GA 3GFYA 5G4EA 1LG2A 1GVIA 3NCOA 3T0DA 4LUYA 5C54A 1SO3A 3VIIA 1U22A 3GU9A 4UFHA 2YB1A 4XVDA 5H91A 4ALDA 2YCKX 4B5TA 1F6KA 5A8GA 1VLWA 1TVPA 4MJMA 5DXYA 4ERAA 5C9XA 1E0XA 4AZ5A 3BLOA 4GUFA 4YCOA 3H4WA 4UNIA 2GGGA 1GVSA 1H09A 3N15A 4IIFA 4JCMA 4UMCA 3W7DA 4R85A 4J27A 2VDHA 3A4XA 3I4EA 2I17A 3F4NA 1EJWC 1SPQA 1QNPA 4LF2A 2DH3A 1UR8A 2HVNA 2YGYA 4FXRA 2QAPA 3HPFA 3GM8A 4PCFA 4IGHA 4WY0A 2PWDA 5E6ZA 1C8QA 2WKJA 1EGMA 3CXOA 1PE1A 5HOSA 1WNOA 4QNWA 3VOGA 1RCOB 4BFAA 4LFYA 3WFAA 1HL8A 1P0EA 1A5NC 1PVNA 1NSJA 4I5XA 4F0LA 1Z32X 3VDAA 2YLLA 2OQLA 1QPRA 3AHYA 2QQ6A 3SSJA 1KA9F 1UMYA 4PB4A 4WUIA 3N6HA 1SFJA 2E28A 1KFWA 4DPQA 1FWBC 5A2BA 2PTZA 3GYCA 4V27A 3S1WA 2WLYA 1NJJA 2A3EA 1PXGA 3W82A 2H3BA 2QCCA 4RCXA 3W70A 5AOUA 3WF3A 1PBGA 1XBVA 2Q3OA 4KFOA 3UETA 4PUUA 2QDHA 3XIMA 1TPDA 1KQZA 1V6YA 1BXNA 3LRMA 2FQIA 1OFEA 1B0IA 1ZBKA 1WDPA 3C3NA 1TQJA 3K4WA 4DELA 1R6WA 1XLCA 3DHUA 1ZENA 3B9AA 3DYPA 3R11A 3DFYA 3M7WA 4H8VA 2BXVA 3LDVA 2VCCA 3SR7A 4GUGA 1XYCA 2REQB 5F2MA 1S46A 1KWGA 4GI8A 3SI9A 3NEHA 4DJFD 5CBJA 4LRTA 3KL3A 4O19A 3W9ZA 4WSKA 3WIJA 3N13A 3AS3A 4UOQA 1UUQA 2WNQA 2FFCA 1GUVA 1CLXA 3M44A 3RF9A 4Q7NA 4LY4A 1LP6A 4WY0F 2PBOA 4B2DD 5DMYA 3EX6A 5CGMA 3A13A 3S5YA 3PZUA 1XLAA 1ONWA 2Y85A 4LYRA 3UWYA 4DJDC 3HQPA 3W81A 3C2EA 4TOQA 4PCSA 5AYBA 2WSQA 3VOFA 3NO1A 3PP7A 4HJWA 2BB0A 3TYAA 4PMZA 1JI2A 1H7PA 5IHRA 1YPIA 1KM4A 3B9OA 1US3A 5HQMA 5H1WA 3VZZA 1U83A 3LK6A 4QROA 1LOSA 1F05A 3D0CA 1TJ2A 3FHAA 1U1HA 4W9TA 1A0DA 2GOKA 3M5VA 1CW2A 3T55A 3GBEA 5CLTA 1HKWA 2J8FA 4ENLA 7ODCA 2OT1A 3M6DA 2QXWA 4C1LA 2CLOA 2VWTA 4V1YA 3ARXA 1ONXA 5FF3A 1VPQA 3DFQA 2NX3A 2DT0A 3AO0A 3WEOA 4HK7A 4QSFA 4ZO9A 3WQCA 1JRCA 1W9XA 1M65A 3SCPA 2IKHA 3VGHA 4LC8A 1ZSXA 3AUJA 5C71A 2D3LA 4OVXA 2VZVA 2NV2A 3BCDA 4YVPA 2PDLA 1U5VA 3F4CA 5LA0A 1IT8A 3KOWA 2F6XA 3GZ3A 3JW7A 1XDJA 5GJMA 3WJWA 1XIIA 1DWFM 3DECA 2ZA3A 1T0OA 2BZNA 2YDRA 3LV5A 3SUUA 2Y89A 1Q6LA 3GSMA 3LLFA 2VGIA 3W7OA 4TVDA 3N9SA 3NZQA 3WQOA 3UF9A 5AYIA 1JNDA 4H04A 3UYIA 1B1YA 2FZMA 1V02E 4QSHA 3SY1A 1O5XA 3LD5A 3CL7A 1PKNA 2D2OA 4PN2A 3WUEA 3MJYA 1KRAC 3VFLA 3MPGA 1FWDC 5D37A 4IMGA 1R2SA 4PTXA 4B4FA 5I07A 2O9TA 1I0DA 2VFGA 4PRTA 4NAEA 4CGTA 2F38A 3KCOA 4OV9A 3N3TA 4JTDA 1D3CA 2XZ9A 3WD3A 2WW5A 2X2YA 4IISA 4GXPA 4YTUA 4JHZA 2NW0A 2POTA 3F4WA 1C9WA 3HPSA 1ZL1A 4DZIA 1BXCA 4DIAA 1Q66A 4GJIA 1XGDA 3LS9A 4HKPA 1K70A 3IGHX 3QV7A 4MJZA 5CC6A 1X6UA 5FESA 3KW3A 1EQCA 2XFFA 3MB9A 3CEUA 4PCPA 1J0IA 1FCBA 3NZ1A 3VX1A 1IWPA 1IXQA 4IG2A 1SYTA 3IUIA 2V30A 3I6RA 3EX4A 3WLMA 3QTGA 4QM1A 2YIHA 4CNUA 1J0KA 4IMDA 3G1RA 5KSWA 3PY2A 1VYSX 4H8HA 3WMLA 2PC4A 3C2VA 3SCNA 4GQRA 4GRSA 1TE1A 2OELA 4HA3A 4KWVA 3UWVA 3UWZA 1VCVA 3PZTA 1JDFA 5CG7A 2VEPA 1V0NA 3AXXA 5D2XA 5BNKA 4JNZA 4QTGA 4YTSA 1TV2A 2CESA 3AFBA 4JX6A 2WZIA 4HA0A 3UR8A 4XAGA 1W5OA 3GG8A 1FP8A 1XYZA 3IJLA 1MW1A 1NOWA 5AC8A 4MHBA 3ABSA 2WQDA 2UWFA 3TU9A 3W22A 1ZJHA 3AIBA 4BJHA 4BKNA 2ACQA 3TYZA 5HA7A 1LWJA 1VR6A 3C4UA 4AZCB 2QUMA 2QPSA 4R27A 1KRBC 3VGGA 3CJPA 4G1NA 2FGBA 3EX1A 2BGQA 2OLHA 4JL2A 1GQKA 1GT8A 2XSXA 1RQHA 3LNPA 1VPYA 4CU7A 1KB3A 4MKSA 1V0LA 1KWKA 1CXFA 4QG6A 2Z28A 3ZIZA 2QCMA 1JCYA 1LL4A 4P7LA 4GXWA 3MCOA 4H3DA 3TIMA 1FUYA 4LPCA 5F4WA 3GQYA 4B9ZA 3ABRA 4JYDA 2VEKA 5BROA 4PTDA 2CBVA 3T78A 3MHGA 5LIWX 2A3BA 3URAA 5CCZA 2ZWYA 2O9RA 4CNSA 2WJFA 3N2BA 4HU4A 3M0ZA 2A7NA 1MW0A 3E0LA 1JPMA 3WL1A 3TZNA 1Y7VA 1O66A 3GXDA 1XIDA 2QGHA 4F4RA 2OYLA 4HSNA 8TIMA 1EX5A 2OO0A 4H2CA 1XWYA 3B9DA 4Q8OA 1Z7AA 2EPNA 2DORA 2DJLA 3A3HA 1D8WA 4LVAA 4GQ0A 3KE0A 4YWSA 1EDGA 1BLIA 3IIZA 3CASA 5GNZA 3GH4A 3MMWA 4I7UA 4Y8EA 3AOFA 1E6NA 3WQ6A 2PURA 1TPUA 2D69A 4ERGA 4W89A 3GK0A 3EOUA 2Y5EA 3CUIA 1BRLA 1MEHA 4Y6GA 3REQB 2QCNA 3ZJ6A 2QCGA 2E68A 3CK5A 2DUZA 1OABA 3L66A 1VEMA 1JIBA 4Y7EA 3SY8A 1C93A 1HG3A 3OZYA 3WMBA 1GOIA 5A6MA 5DQPA 3O8AA 3PZIA 4YVXA 4DBUA 2V9DA 4NX5A 3T8LA 1TO3A 3FFSA 5LNWA 1HKVA 2X09A 3WEZA 2W3ZA 3H4GA 1EA0A 3LHVA 5LIKX 1BVNP 2J75A 3JU2A 3UJFA 3DBPA 4F2UA 2E5CA 2P0IA 2Z6IA 1EP2A 3LSBA 2OJPA 1SUXA 3VKJA 1LRTA 4IIEA 1O94A 2ZUWA 1MZRA 4DJEC 2YXXA 4E8GA 2Y4SA 4HNUA 6ALDA 2PDYA 4HA1A 1VAHA 1QNOA 1ISWA 4UTWC 2YZRA 4ZGYA 1KGUA 2YDSA 3HF3A 1JPIA 1ESWA 3SB0A 4D6HA 3VMOA 1TMHA 5EFDA 2ABAA 3U3HA 4O0ZA 1EC9A 1UKOA 2FPVA 2NSOA 2PRLA 7TAAA 1FDYA 1XLGA 4ZR8A 3SGZA 2BXZA 4LAOA 1FCQA 4CU8A 3HV9A 4AVNA 4HZ8A 5FAGA 2GLKA 1W32A 2QF8A 3S2MA 3URNA 3MBDA 1ICQA 5JBEA 4BS0A 5DXXA 2WWDA 4RZ5A 3M0HA 5HJLA 3LMZA 4US5D 3F7JA 3VGBA 3S8HA 3MI3A 5HNTA 4MDOA 2YDQA 1XLKA 2OX1A 2VR4A 1CGWA 3PAJA 1OYCA 1REQB 1R5YA 2C1HA 4X60A 5CSSA 4FX8A 4YHEA 1NQKA 2XN2A 1WUEA 4MPKA 4AD0A 3VIHA 1NIUA 3TQVA 1GK8A 4C91A 4GGBA 4AZGA 3G6LA 3NQ8A 2RJHA 3H7VA 4XZLX 1QVBA 2P0OA 1TJPA 2J9ZA 1VKFA 2GDUA 4AIBA 2ZDRA 1FHUA 4CD6A 1MXGA 3AIEA 1DHKA 3QH2A 4ZOCA 4QLLA 3UD6A 2EPHA 4P8VA 5G2WA 4JS3A 1GKRA 1X6LA 1O1HA 4OE7A 3TOPA 1XLIA 1FHLA 2WVUA 4BQ3A 2WM1A 3WDRA 5FA5A 2ODOA 4WJXA 1SSDA 5I0DA 2GGEA 4QRNA 4N6FA 1I1WA 3KVJA 4JHMA 3ONCA 4QE4A 5BU6A 4W7VA 3E9AA 4C6EA 1H0GA 4J2PA 5MHBA 1KD0A 1MNSA 2EPMX 3GZAA 2HSAA 4XD4A 1YNPA 2DZSA 4AX6A 1FQ0A 2FVMA 4K3ZA 1P6BA 2F7FA 4IP5A 3HV8A 3LY0A 2VKZG 3E74A 4Q4OA 3ZO9A 1YTEA 1TV7A 3P8IA 3L4XA 3G3MA 1WZLA 1XH2A 1XLMA 4B5NA 4YU1A 3A4AA 3THCA 4UUIA 4I9AA 1TA3A 2QEZA 1HKKA 1HT6A 1TSIA 2O9PA 2AQWA 2QJIA 1HGYA 3W07A 4A22A 4PTWA 3TLLA 5H8UA 3AS1A 2KAUC 3K46A 2HMCA 3QZ6A 5J5DA 1SZNA 3CHFA 4O16A 5HDRA 5AFDA 1GQIA 1A5BA 2E6FA 3GXNA 3VD3A 1B3VA 1PS9A 3BSHA 4KWOA 2OGJA 2A85A 3EB4A 2O9OA 1KKRA 2EF9A 1R46A 3S4TA 1MZHA 2XVLA 1RK5A 2R82A 3HFYA 4JTRA 2BSLA 2FB3A 1PDYA 3W7HA 1VGAA 3SCOA 1B30A 3K1GA 5A2CA 2VUYA 3N2MA 1JQXA 4D9PA 1LQ0A 1YNYA 3A3XA 2QCHA 2GWNA 4IPNB 3SCRA 1AH3A 1TWIA 4YTQA 4LBUA 4BQ5A 4F40A 2X0SA 1OC7A 1XDMA 1PAMA 5CPLA 3G0XA 3WUBA 2D1ZA 4LUJA 1BKSA 2ZX9A 4MM1A 1Q7QA 1TTQA 5SWUA 5HWJA 4IMCA 2QS8A 1KBLA 1LJYA 1PHWA 4FXSA 1CZ1A 2PC8A 1VENA 2OOFA 3T2PA 2HK0A 4FLSA 4W7UA 1PTAA 4D71A 2WVVB 2QJGA 2VVNA 4HTBA 3E0FA 1TUXA 2YA2A 1VIWA 1XBYA 4N9DA 2TPSA 2NX1A 3V7PA 4UQBA 2V38A 1V3JA 2DW6A 1XJBA 2MANA 2FTYA 3GR8A 1GJWA 3H2CA 4US6A 3KHDA 3T4WA 3M0LA 5CPTA 3DERA 5TAOA 4JDYA 2QV4A 3IJ7A 1OCNA 3ZJ8A 4FXJA 3EWZA 3E3HA 4A3YA 1E9ZB 3G1VA 1CI1A 3WF2A 3ATYA 1VD6A 4A05A 3GC2A 1CB7B 4JTGA 1GQJA 1AQHA 3NDOA 2VHLA 4F3HA 5BXTA 2VZUA 5M2FX 2OXNA 1J0ZA 1QBAA 2OWWA 3ITYA 3SUSA 1WV2A 1EFZA 3QKEA 3WBWA 3NXFA 2PCQA 3DI1A 2C79A 4JAWA 4RDWA 4N0RA 1KM3A 1S3TC 5D2TA 3S5SA 3QC0A 4CUCA 1QHPA 1WKEA 3AJXA 4KQNA 4FIRA 3S2NA 1JDDA 1ZCCA 1CGTA 3UZYA 1TCDA 5F1VA 3FEMA 3W87A 1K8XA 5DFAA 1SFSA 1A0CA 3VIFA 4NI3A 4PRRA 1Z69A 2OCZA 4O28A 5E09A 2DIEA 5I02A 3G8RA 4C1NA 2TMDA 2WVTA 3M07A 2C0AA 3BAWA 2AQOA 5E9AA 3NL6A 1OT2A 1W3KA 2WSPA 4ACZA 3V0SA 1TE6A 1U33A 2A3CA 1TB3A 3P0WA 4GI9A 1QI5A 3POHA 1OZMA 1HO1A 9RUBA 4JY9A 3PPGA 1GOXA 1VBUA 1EC8A 3FLUA 1EJ7L 4AQLA 3H53A 3RILA 4U5KA 3LQLA 1G67A 3N19B 3ZMRA 3PBYA 1W17A 4ICNA 2YL8A 4FNSA 2FGZA 3AMGA 2BHUA 3WQPA 1XG3A 3CL6A 3FJ6A 2P5NA 4NXKA 1AQMA 5IBXA 5CPNA 3PZGA 4E3TA 4HOXA 4MNMA 5CZSA 4KT2A 4MKNA 5CAKA 1J12A 1E9YB 3B3DA 4DXXA 4K68A 3PWIA 4L4MA 2X8RA 4MOZA 4R3UA 3AICA 1XLJA 4DNHA 3S9ZA 2V82A 2IS7A 3UERA 1I2OA 1LLZA 3TCEA 1DYSA 1UKPA 3DUGA 1R30A 3B8WA 1EYWA 1KXQA 3V1HA 2NWSA 4WSJA 4GIRA 5C5YA 5HR7A 2VENA 3AHVA 5CLWA 5TBOA 5H2ZA 4J5NA 3I6TA 2AMGA 3WD1A 1IZKA 3GKFA 3QYQA 1F2JA 4UFJA 3U7VA 1JAKA 3L0NA 1UP0A 4G7EB 1UWUA 1V6WA 3LUTA 2CIPA 4GUIA 3O06A 4ZO6A 3T05A 2H9AB 2JF6A 4EIVA 2BVDA 2QCLA 3O6AA 1RY8A 1TVLA 3T7VA 4LANA 1H60A 2NUXA 2ZUVA 4WKAA 1KTBA 1CGVA 4A2SA 3KOYA 3O6DA 4WJ8A 2CETA 3LXCA 1L8NA 4HK5A 3RO8A 2E6YA 4OKDA 5I03A 3OZMA 2YW3A 3W2NA 1SZRA 2Z7KA 4HCHA 2QUNA 2DIKA 5AN7A 4YVVA 2YKKA 2NQJA 2DZTA 3GXTA 3NQ7A 3NDZA 4WKFA 3ZR6A 1SR0A 1P5BA 5DMMA 5U4NA 1GKQA 1E1CA 3IGSA 4O57A 4U10A 1TV4A 2J47A 1XFCA 3T1GA 4XAZA 1B4KA 2GK1A 2CZEA 4POCA 1XD0A 1WXJA 1UP2A 1X6NA 4KESA 3ERPA 5DLCA 4C5ZA 4A4AA 1V7YA 4FR1A 2O7SA 1GYMA 1A5SA 1IXOA 3T6CA 1OT1A 4Y96A 2ZVIA 3SDOA 2B7NA 4UIOA 5MKGB 3MVIA 4JEJA 4XZNX 3CIWA 4WXYA 2PUZA 4IXXA 4DO5A 3NFUA 5JBDA 2INZA 3SY5A 1MW2A 1DVJA 1XIGA 3FSTA 3MBFA 4L6HA 1FWFC 7TIMA 1M7PA 1FWHC 3RLVA 1H62A 3KP1A 4IZGA 1C92A 2CBIA 1FKWA 2O4MA 3ZLFA 3GUWA 2XM2A 3SUVA 3GNDA 3M41A 1QU4A 4GH3A 3TR9A 1EHNA 2C1GA 4J3TA 4ZO8A 3C3UA 4JTFA 1GPWA 3PN8A 4D2JA 2JALA 4KETA 1UOKA 1M7OA 2PRMA 1UC4A 2YXOA 2QZRA 3MV01 3DENA 1XBZA 4PMYA 4AD3A 4FZIA 2PDNA 1PKYA 4OUEA 4B5VA 4ZOAA 5HATA 4G5DA 4REQB 2VOMA 2PDJA 3RPMA 3EB2A 4F0HA 4AZ7A 1TWZA 1DPMA 5HINA 1AW5A 4RV8A 4FP1A 2J4GA 3H21A 5RUBA 3VYLA 4W7WA 2JK2A 4O1BA 4GQBA 2C18A 3WYZA 1CXKA 3EWXA 3R8RA 4MB1A 4OJYA 1DJWA 2F2KA 4KKXA 3GXIA 3AQUA 4JKKA 1Q8AA 3GTHA 5FF0A 1UKQA 1TMQA 3UU0A 4C7FA 4FB7A 3YPIA 3SFWA 4OGZA 1DOSA 4LOCA 4YTRA 5A6BD 5FEPA 5I3DA 4YCPA 1EBGA 1RUSA 2DSWA 3B9EA 2PMQA 2WJEA 4M7SA 5KINA 4M8UA 1TELA 1GONA 4OUIA 4CNOA 4EP8C 3WD2A 1BQCA 2O4QA 3VA8A 1ITQA 5C6MA 4JIIX 1VP5A 4GQQA 3AALA 4OU1A 4YL2A 3GW3A 4NX0A 4D1IA 1P7TA 1BFNA 3N9RA 3VABA 4YIWA 1ZUAX 4UR9A 3CH9A 3CMFA 3DX5A 4MMWA 4F9DA 4GXMA 2WNWA 3A47A 2XVNA 3C6CA 2RDUA 3GDLA 3DEQA 5AC7A 4YLWA 3HJZA 3WQGA 2XGIA 2JFEX 3R1ZA 2YA0A 2ZUNA 1UA7A 4WD0A 1SJAA 3M5YA 1ZPTA 1IR1A 3DHPA 2ISSA 1A5OC 5KZEA 3G1HA 2JIWA 4I7VA 1XLDA 5HMSA 2QMJA 6REQA 2Y61A 1TTIA 1Z3NA 5ABFA 1JD7A 3SW6A 1O5RA 3V5CA 4J3XA 2FDMA 3QLDA 3NO3A 3WK3A 3TN5A 1XGEA 4NT0A 1YXYA 3QR3A 4DEFA 1LDCA 4PA8A 3FKRA 4DJDA 4ICCX 3GXMA 1K4GA 1SO5A 2PWHA 4KWWA 4LB3A 1TTPA 5KETA 4S3BA 4D6FA 3FVMA 2VC9A 5HAOA 3G24A 2VEGA 4OV4A 5D30A 3O0FA 3VXGA 3LNMA 2A7RA 5LA2A 3CWOX 1HXJA 5HK4A 2PDMA 4KRUA 3IJIA 1CWYA 1FWWA 1GZGA 2WCSA 4I6KA 4GYPC 1IGWA 4A3HA 1RALA 1ALDA 5CJMA 1AVAA 2YBVA 3A4WA 4L65A 3T2OA 2NT1A 4AIUA 2JE8A 4F48A 3U48A 3DG7A 5I3GA 3S42A 4E2DA 3W1UA 4UTHA 4N9EA 2QMKA 3ZLGA 3AXIA 4PSRA 4AXKA 1UUMA 1E9IA 3LGDA 2R1LA 2EXOA 2FDSA 3ITCA 4AY1A 4DPPA 5C8BB 2PODA 1CLVA 2CW6A 4KIEA 5C7VA 2AAAA 3BL3A 4B90A 4HB7A 3H22A 2DZAA 3DU0A 2ZRXA 1TPC1 4B4HA 4J35A 4K39A 1GJUA 3EYPA 1J93A 2VRKA 5CPQA 4BY3A 3PZVA 3VGDA 4H00A 3WBXA 3BJSA 4LXFA 4XB3A 1CXLA 1DJHA 4IQLA 4UTMA 3TTOA 1AL8A 2C6QA 1KXHA 1U5JA 4DWSD 2GJLA 1FVPA 2G3JA 1R0MA 4S3FA 1K8ZA 4WJEA 3R5EA 3O07A 3JZEA 1JPHA 1JZ4A 1AJ0A 1S39A 2Z0IA 2ISVA 4N4PA 2Z1BA 2W4XA 4O13A 1GZ1A 4J4KA 1HIZA 3CEPA 2A3AA 2QCEA 2CZFA 1XINA 4AWTA 3QV8A 3PNZA 1Z89A 4O15A 5G1YA 1QI4A 5AHLA 4XKMA 3PJWA 4A8LA 1C7TA 2PWGA 1NU5A 1O1ZA 5G1MA 2E67A 4DY1A 1HX0A 1OC5A 3V5FA 3WLLA 1LORA 1YXDA 5AKQA 1A0EA 5EBUA 4IIHA 4MDPA 4L61A 4UTUA 1E72M 1RCXB 4Q8TA 4GZEA 3W53A 4Q33A 1UZDA 4IOTA 1OM0A 3AAMA 4M1BA 3FYYA 3MW7A 4U31A 4IG2B 3OG2A 1YKWA 2GVGA 3BZJA 3BQ5A 3WH6A 4Z2GA 1X98A 4M6UA 2FPTA 3QKZA 3ORWA 4GFSA 2XFWA 2HQAA 5T26A 1NH6A 5B7ZA 3RCYA 2OODA 1NARA 4UQEA 3W29A 3QOMA 2FZBA 4HYRA 2OX4A 5FJTA 4HOWA 4KWUA 1HJQA 2I5IA 1ICSA 3B8DA 1E0TA 5AVHA 1SW0A 2ZYFA 4MADA 4J3UA 4RPQA 2HCVA 3UP8A 2OYMA 3W2UA 3CPUA 3UXAA 3ISIX 1IF2A 3W25A 4CQCA 3C86A 3VNMA 4Y90A 3ZVIA 1G4SA 1UBPC 3NQGA 2YW4A 4KWSA 1P0NA 3CUHA 3AMDA 3BCJA 4ZB0A 3MCMA 3P60A 2UY4A 4N9BA 4IPLA 1SW7A 1LUCB 1QHOA 2NXHA 2WHLA 1G6CA 2C16A 4CN1A 2CHNA 3NXLA 1M6JA 2EEXA 1Z41A 1PKMA 4C6OA 4ACYA 4X63A 4Z2KA 3WJYA 3LHTA 2CZVA 4DF1A 1YBQA 3QMTA 3P67A 5DF0A 4XTDA 3S6DA 4GE8A 1UH2A 1SR9A 1XKJA 1WAWA 5BZAA 3ALGA 5F2IA 1UJQA 2EGZA 2QCDB 3HN3A 4M6PA 3U4AA 2OMAA 2ISDA 1R3WA 2G3MA 3E5PA 1LOQA 4R9OA 3LBCA 1OGGA 1ONRA 2WCAA 1ONEA 1HJXA 1L2UA 3QFWA 2HDJA 3BLPX 1WCGA 4NAFB 2RHGA 1WPCA 2TAAA 5D2WA 3SRDA 3UBPC 2GVEA 3FXGA 3OGRA 5FJOA 3RNDA 3MI2A 2CLHA 3PM6A 3GRIA 3CUGA 4XBSA 5ECUA 4B16A 3SCWA 3VKKA 2VZOA 4QR6A 1E56A 1UKSA 2ZRUA 1OFRA 3UGVA 2FGLA 4XSLA 3THQA 3H2AA 4AUBA 3GR4A 2J7DA 3KS5A 2ZOXA 3MU7A 2X42A 1X1OA 2XHYA 3W7NA 1ITXA 1FWNA 3GHRA 1EX1A 5CZJA 1EJSC 2B7QA 4K36A 2J24A 4FSAA 1J5TA 1H5YA 4HMDA 1E0UA 4NY2A 1K8CA 2VX4A 3QRHA 2F8QA 2I56A 3W37A 4W8LA 1H41A 3PTMA 2DZVA 4MNLA 3ZSSA 1FXQA 4NJGA 2RDWA 4I9MA 1NDZA 1CGXA 2WMKA 5A2AA 4ZQPA 5LNRA 1PX3A 3T81A 5T9BG 2DQWA 3Q2DA 3CZKA 4NL1A 1VCFA 3ZLHA 1PUDA 3VVGA 8A3HA 3BSMA 3O2LA 1B90A 4IGNA 1D2KA 1XSIA 3AMCA 3I3BA 2J27A 3PUGA 4H9YA 3CMGA 3UXIA 3U57A 4DM2A 1FBAA 3CPRA 3A4JA 4H01A 1N7KA 1XG4A 4INFA 1W9UA 2F2HA 4DBSA 4XIMA 1UD6A 2G37A 4DBDA 3PBUA 3MVTA 5DCBA 4E38A 1MRQA 3RJXA 4WR3A 4FXFA 2P76A 3NQ6A 2Y7DA 4GZJA 4GC3A 5LSMA 4EF8A 1UKTA 3LPPA 3HG4A 2P53A 3HOJA 4UTWA 5GNXA 4KCTA 2PDCA 4Z2IA 3UZZA 5FAJA 2OOGA 3SUTA 4FO4A 3LRKA 2Q8LA 3TV8A 1H2JA 3SCQA 3W76A 3QW3A 1S1RA 4ZA0A 1FWSA 2HBXA 3NO5A 4DRSA 5IOBA 1VJSA 1UR3M 4Z42C 3MSDA 1DL3A 2D0HA 3VKBA 1C7SA 4P8UA 4BI6A 1EQPA 3V18A 4FMVA 5KEZA 4TX6A 2PRHA 4JN6A 3ECQA 4HNVA 1QR7A 1KM6A 3BANA 4JNYA 3W1XA 3RLGA 3L4WA 4JN7A 2JF7A 1Q4NX 1WBHA 3F1QA 3LCXA 1R3RA 2GSHA 3N2CA 3MTWA 1R7AA 4M1RA 2HVMA 3GE7A 3GG0A 4ZXLA 1GYLA 4MLJA 1JYVA 4DQWA 4AZHA 1M01A 4DZAA 3GTXA 3LLDA 3WELA 1OX4A 2GJXB 3MCNA 4BCEA 1LLOA 4GACA 1E6QM 3NQDA 5CXPA 5CPSA 1WZKA 3QF0A 4W85A 3BOFA 1JNEA 1OJXA 3W7JA 4JIQA 3LZ5A 4GJJA 3PUEA 2AAMA 2P8CA 2RAGA 1R2TA 4YYCA 4XZMX 4L56A 1DJXA 1EO5A 3IIXA 3MSGA 4C6FA 4BWLC 3KBMA 4MG4A 4M56A 3CTLA 3UR5A 2AL2B 1UA3A 4F9JA 3UNDA 1JZ6A 1U1UA 2Q6ZA 1OB0A 2OYKA 4AH7A 1MQPA 5A95A 3CTTA 4C7DA 1YIXA 1SQ7A 4TV6A 4B5XA 4QAWA 4YHGA 1L9WA 3AROA 1AFSA 3ARQA 2CBUA 4PTMA 1VJIA 2Y0FA 2G95A 4PMVA 4FNUA 4UNLA 2QIIA 3N2XA 2NQZA 3RG6A 2G8ZA 3P74A 1DWGM 3JR2A 2BODX 2R1KA 1NOUA 3GNRA 1QDSA 1X39A 3DKLA 2ASHA 4ZCWA 1KRCC 2F6KA 8XIAA 3CPGA 4XWUA 1QO5A 3TTEA 1OBAA 4TX9A 1LQ2A 2IKJA 5FL0A 4GVGA 1BYAA 3LTYA 4JYEA 4YN5A 2VDGA 1D3HA 3U2CA 3WLOA 3VUPA 1LBFA 1YX1A 2V5JA 4LNYA 4LAZA 1CXIA 1TREA 5DBUA 2BY1A 4CEXC 4U4MA 3JUGA 1E1EA 1E3XA 3P62A 3UZ5A 3GC4A 1EUAA 3LERA 4E2OA 4GYFA 3ANVA 4M24A 4JD4A 4PMOA 2E40A 3RLHA 3SGUA 3W24A 1G94A 2Z29A 1HF6A 4EK7A 3OLEA 3MC5A 5CJNA 3TUUA 4OZOA 2I9EA 3LCIA 1PCWA 5C9WA 3TN4A 4IMFA 1H7XA 2AGKA 4A8IA 3U5UA 1ZJAA 3W7QA 1W31A 2C7FA 4MYAA 1IV8A 4NZJA 2VR2A 4HHHA 1R3QA 1CGYA 3S1VA 2NQ9A 3VKAA 2Q3RA 3M4HA 2C71A 3CZ8A 4DNMA 2J77A 3UY8A 3BMXA 2WO5A 4TX8A 3S46A 1VFOA 1IIGA 4X2RA 5KMYA 3BQ6A 5EFFA 2WKGA 1IYXA 5DN1A 4R7WA 2DVUA 1KFBA 5I3HA 2DUXA 3TYDA 1QI0A 1EJVC 4HGXA 1AL7A 4EF9A 2Y5SA 1WZAA 2G3FA 5KZMA 3WFLA 3NR0A 2E25A 3IAPA 6A3HA 2C14A 2X0HA 1ME8A 3FJ4A 4WOZA 1C3FA 4LUTA 3VINA 3WH8A 2NT0A 2OEJA 3H7RA 4DAFA 4ADSA 4GK8A 3AIUA 4GC4A 1KBJA 1PZ2A 1XPGA 4PBEA 1XH0A 3VPLA 4WDUA 1NP0A 2PDPA 1RBAA 2R6OA 4UTTC 1BEUA 3EXTA 4PYSA 3DAQA 3M0MA 4XG1A 4IM4A 1OC6A 1U5HA 3MKCA 2G3NA 1YTKA 2C15A 4DI9A 2DW7A 1T6MA 1TV5A 2A6NA 3DFOA 4F79A 3SJ3A 2ZUTA 2G4JA 1WDSA 2X1IA 3DYMA 1KGXA 4EVZA 5EY5A 4L1GA 3B97A 3WJSA 4DXKA 3PPFA 1IWAA 3K30A 3W88A 2VUNA 4PULA 3QY6A 1RBOB 1ISXA 1NQ6A 5HANA 4K8EA 3CUFA 2ZZ4A 2BOGX 1VHCA 1TR1A 3WLTA 3UPWA 4IQEA 3RXZA 3W75A 1V77A 1ZBVA 3MUZ1 2WANA 4NRRA 4GY7A 4AF0A 4D8AA 4ACZB 3WQ5A 2OKOA 2W9MA 3DIPA 2NWRA 1QW9A 2WSKA 2E5DA 1IIHA 1UYQA 3INPA 1AH0A 5LIYX 4HA4A 2IQDA 2W27A 3K4DA 3WEMA 4WXZA 3WLNA 1HUVA 1H51A 4Y9NA 2Q8XA 1F9CA 2FZ8A 4CN4A 3VNYA 1MRAA 2W63A 4KPLA 4WOQA 1XYAA 2HROA 4WGHA 4IL2A 3UWWA 3RPTA 2XVPA 3B0VC 3P3BA 5E9XA 5HMFA 3AWNA 2FZNA 1Y0EA 2D2HA 4QE1A 1L6SA 4LAUA 4PEEA 2V5KA 4M5PA 4HTYA 2B7PA 3GS6A 4LRSA 4XTIA 1Q63A 3RM9A 2DZBA 3GB6A 4NYUA 3MSYA 2QULA 1OK6A 2OWXA 1DQWA 2CERA 1K4HA 4ZO7A 2H6RA 2QDEA 4CU6A 3RK8A 4B2DA 3NIYA 1KBIA 3TK7A 2Q09A 1YTDA 2E09A 3FOKA 1I9CB 2YA1A 1XIJA 1MO0A 1SSGA 3I7RA 1OIFA 5DO8A 1W3JA 4N2YA 5CGTA 5CPMA 4S3KA 2ZRZA 4WX2A 4LEQA 2J9XA 1WAUA 2XJ7A 3CAWA 5J8LA 1HJSA 3PWGA 3ATZA 1Y65A 4MZYA 1H7WA 4L4LA 1Q7ZA 1AH4A 1B5TA 4RV3A 5H8PA 3CQIA 1P43A 3KBNA 1T40A 1LTDA 9XIAA 5LGXA 5AZ1A 2J7BA 2E8YA 3Q37A 2BV9A 4GLEA 1VJZA 3FGCA 1XIFA 3NSMA 3LGGA 3N4EA 3K1DA 2HE8A 4RZBA 3HG5A 3S47A 3CB8A 2XN0A 3GTIA 4H8NA 5AYZA 2WCGA 2GVJA 3N29A 1TPVA 1S2CA 1MEWA 1V7AA 1N8IA 3P0XA 4UMBA 1T7LA 3AXHA 3R6IA 1AD4A 2XSBA 2ZZ5A 5A1AA 2G4FA 1E1CB 3N2OA 3HPZA 3VDCA 4M3PA 3WY1A 4AHPA 1WKDA 4KEZA 1SGJA 1W9BM 1S2WA 8XIMA 4O0KA 3WK0A 3C5QA 5J5RA 5E70A 4FF5A 3AIVA 3R0UA 3OP2A 2Z1WA 1J9YA 4A29A 1ZJBA 4WEVX 4ZMGA 1WKFA 4XO6A 1XGZA 4K38A 1DJIA 3V1PA 3H12A 1UJPA 3R13A 3U4FA 4UFLA 4CN6A 1E5NA 3Q67A 1KLYA 1C90A 5E0FA 4HSOA 4EAYA 1F76A 1VLIA 3KVMA 1GOQA 3WO8A 1P0BA 3VNDA 1ZAJA 3N04A 4LYKA 4QJ5B 1YE6A 5FKYA 5LIXX 3ITLA 2HXUA 4B3ZA 3KAOA 4CKQA 3QVQA 4F0MA 4IIBA 1XS2A 1F8IA 5EGRA 1LROA 2YOCA 3N17A 1RAKA 3QHMA 1E5JA 2TSYA 3UG8A 3ZSTA 2C3ZA 5T91A 2C8NA 4E3VA 5FJRA 5AY7A 1PIGA 2XGBA 4RE3A 7REQA 1J6OA 3LCGA 1P48A 4CQBA 3VU2A 5HJYA 1M03A 3BICA 1N82A 2QJHA 3WLSA 1NWUA 4XK2A 1LWIA 2WMIB 4S38A 3WKZA 2G50A 4LV4A 3LU2A 1NFGA 1E6XM 2ZUMA 4XQ6A 1Q85A 3BXWA 3SN0A 5IXEA 1VQTA 1N8FA 1XUZA 3COTA 3NQFA 4AY7A 3VC5A 4PUDA 3LHUA 3DGRA 3OZPA 2V67A 4QJ4B 4U33A 1I45A 3PJTA 3SQLA 4F2TA 1B2YA 2QW5A 4UZSA 3CUZA 4CNNA 3RM4A 4J2MA 5FJIA 1I60A 1C91A 1JCJA 4GD0A 4PODA 3TQKA 4PSPA 1G5AA 1NVMA 5HWMA 1FWRA 4PB5A 1KFEA 2ZXAA 2I14A 3AXKA 1UD5A 3DN5A 1E71M 3ARWA 4YMZA 1RD5A 4MGGA 1JZ2A 2G5WA 1DJYA 4W87A 1GVOA 1BGGA 1UIPA 5CQ1A 1PPIA 3PZ9A 2E0PA 4JKMA 2FLIA 4GIEA 4KGJA 3ZQ9A 4HVXA 2XTKA 1E4IA 1LT7A 4GO8A 4CEUC 3BO9A 2VJXA 2DJXA 2X30A 4XISA 3PSVA 5B80A 1J8VA 4C6PA 2HS8A 3EKGA 1XLLA 4FALA 3F2CA 1V08A 2DSKA 5G4HC 5G4WA 5A69A 2VQUA 3MO7A 3NQCA 1UP3A 2L5HA 3UZXA 3KP0A 2PF8A 1GQLA 4CCEA 4NP7A 1JZ7A 1M68A 4V15A 4HNLA 4MWAC 3GXPA 3LCLA 1RSCA 4FNRA 1UQYA 5ABFB 1FFRA 1KXTA 3CM4A 3DBNA 3H24A 3AHTA 1DXEA 4P7NA 5D33A 5DT5A 3EA3A 3W7PA 4EKJA 1VBRA 3EOSA 2O92A 4EOUA 4WLCA 4NNBA 4UTLA 1B3WA 2V0TA 3MHUA 1Q3NA 2OSWA 1HP5A 1F4HA 2J25A 5K4XA 3N18A 5FI8A 3TTQA 3KL5A 4I5RA 2I16A 4LX4A 5I23A 1K6WA 3FAXA 2YL6A 1TZ7A 2DSUA 9XIMA 4LB4A 3WNOA 3N4FA 1ITCA 4AHQA 3UR7A 4GYPA 3D3AA 1NOFA 4I9TA 4DUVA 3NOYA 5DY2A 4HU0A 2YBTA 1S5NA 4UTJA 2DZWA 3TTSA 1T8QA 4RXFA 2E1DA 4HMNA 1Q6CA 4GABA 4C6CA 2DV0A 4JTKA 4B5WA 1XLBA 1XHGA 1B3YA 1DJNA 5LHFA 3I3DA 1VFUA 2IQ0A 1KKOA 3E12A 2BY0A 5TNVA 4E8DA 3TP4A 3EWBX 5DMNA 1A5LC 2Z25A 2REQA 3NURA 1B9ZA 3LX9A 2PDGA 3NM1A 2ZRYA 5LKYA 1KBBA 1JYXA 3FJLA 1FWAC 3WNKA 4EWJA 3R8HA 1E55A 4NKCA 2GWGA 3EZ4A 3N14A 3ITOA 1LOLA 4GJ1A 2HNEA 1IEVA 3RRAA 3USZA 1XP3A 1KCKA 5AYYA 2VRJA 1ITUA 5BMWA 1A5KC 3TMLA 1JPKA 3U6WA 3NPWA 1DXIA 3W02A 5CSYA 2PDKA 3W28A 4KH2A 3CO4A 4ZSUA 2DPEA 3A21A 3DH7A 1QOXA 3I3EA 4RUBA 1D9EA 1NEYA 3G22A 2ONEA 2CLKA 1EH9A 4PL1A 3BLLA 5E1QA 4GNKB 2PU0A 3OB8A 1XRFA 2J9YA 4LQ1A 5FL1A 3P81A 3AZSA 4DBWA 2Z1VA 2YX0A 3EXRA 2WNZA 5G1TA 1EOMA 4O52A 3LM3A 4J7RA 3PG9A 1FDJA 5LXXA 5I5RA 1B31A 4JFVA 3WNPA 3V0UA 4KFNA 4ZODA 2QHAA 2YB4A 4JBRA 5FCZA 1LRQA 4A3UA 3EDKA 4W88A 1XLFA 3WF4A 3FJNA 3R2GA 3F03K 5BOFA 4IX2A 2DH2A 3NQVA 1W1PA 2HRWA 3OODA 1ZRQA 4F0RA 2FH6A 1O95A 4FHAA 4HPJA 1A3HA 1A3WA 1T99A 4F8XA 4D72A 1TX0A 3E2RA 4Y8FA 5AVNA 3UR2A 4H7VA 1Q6FA 2Z4GA 3QXBA 3T8QA 1R3YA 1OFQA 1THFD 3EKLA 2CKSA 1TX2A 3S2JA 4MB3A 4HN4A 3CZGA 4LH8A 2ZWZA 3O7UA 1HTIA 1R3SA 1I2RA 3MUXA 3MY9A 7PTDA 1YLVA 2PDQA 5FACA 1YXCA 4RNHA 1FWGC 1JXJA 1B3OA 2HISA 1ZZMA 2VR5A 5JH1A 1OF8A 3GIPA 3S83A 1J0YA 3NQMA 5D9NA 3MP3A 4K37A 4P2VA 4JFTA 4PUMA 2BG5A 3GNOA 4MNKA 1KM1A 1UCWA 4AD2A 5I2UA 4IJCA 1H7NA 2GSEA 3CLWA 5HULA 3AC0A 1ME7A 1ZNNA 4JPGA 2ISFA 3WQVA 1QAPA 1W1YA 2JKAA 2XIJA 3R0DA 2NVDA 3EMCA 5EU9A 3VGFA 2X0YA 3RUBL 3AISA 5I7GA 2TYSA 4BF7A 4CQ8A 3ZT5A 5FJPA 3BPWA 1EXBA 1UROA 1CT5A 1F3EA 4XZHA 3WDQA 5D09A 1QI3A 1LL7A 2PTWA 2VDIA 4ORIA 2QGYA 5F4XA 1VEOA 3C0SA 1K03A 4G6CA 5TIMA 4KBXA 2AMXA 2Z2UA 2ZIDA 1JVNA 2MNRA 4IIGA 3WQEA 5JMUA 3UCCA 1YPFA 1XICA 4YS1A 1TRDA 1JGIA 1PDZA 1YBQB 4OHQA 4TMBA 4HD5A 2HPMA 3I6EA 1R87A 5GVJA 2BVYA 3WDHA 3TEVA 4JN8A 4RE4A 3W2KA 2RH9A 5CC5A 2VO5A 3E1F1 3NWRA 3BLIA 3C61A 2PWFA 4IPIA 5EMMA 1RP9A 2WLZA 2I5QA 1WDQA 2R8WA 4J3VA 3HG3A 5FSEC 1BKHA 4ROPA 2ZTKA 3WENA 3UESA 3CH0A 4JTQA 2EPOA 4M51A 4TU1A 1BTCA 4NZ5A 3VNJA 2PCEA 3GTNA 3KTXA 3MO4A 3NPUA 2IQTA 3BV4A 4C6JA 1NWRA 3VTRA 3AUOA 4QCFA 2D22A 1B9BA 1Q13A 4B15A 4UCGA 1H1ZA 4NNAA 2A79A 2UV8G 1KO0A 3MYPA 1EEXA 2WVSA 1QMLA 1JR1A 1CIUA 3KOZA 2Y6ZA 4PFMA 1BYBA 2HE5A 4LYQA 4J28A 3BAKA 3TNOA 3KLLA 3ES8A 4ZOBA 4JYFA 1H7RA 2ZZ6A 3ZVHB 3CL8A 3A24A 1S5TA 5F4SA 4AD1A 4DN1A 4RW3A 3B06A 3SUWA 3EA2A 3THUA 4O1EA 5HXMA 1NP2A 3B0YA 3NL3A 4C1KA 1PWLA 3TDFA 2PI6A 4NF7A 4LC6A 4N9CA 3THDA 4G56A 4UFKA 1DE6A 1IEXA 3RCMA 2G3IA 4JY8A 3CT7A 4S3AA 1Z9AA 3A9IA 2YJQA 4AZCA 3E6EA 4JIPA 2ZZ1A 1OGBA 1ZQ5A 1TJ0A 3DGBA 5BXPA 1M7JA 4B9YA 4OTKA 1EF3A 2ZZ2A 3QC3A 3CBWA 2WJDA 4S3EA 1IWBA 1POKA 1EJTC 1QK0A 1EB3A 4LW7A 3M0YA 3S5ZA 3E0WA 3L0GA 1BG4A 2GUUA 2Y2WA 1X96A 3GAKA 1WKYA 3HPAA 4K7YA 3HGSA 5A6JA 4AD4A 4GIYA 3WBYA 1CENA 2J7CA 3BK0A 3KOXA 1W56A 2ON3A 4DJDD 4L4OA 5DRIA 1E6ZA 1GG0A 2P50A 1TWSA 4Z1YA 3TN3A 1JDAA 1VF8A 5HQEA 4LU0A 4S23A 3NAVA 2Z00A 2VFHA 2IPGA 3T42A 1UZ1A 1SU5A 3T0TA 4QQUA 4FK9A 1NF0A 1QPQA 4FEZA 3GNPA 5C70A 2BNJA 3GH5A 4JX5A 4DZ5A 4JEQA 3R43A 2GFTA 4F66A 1HVQA 3BVJA 4PRWA 3KXQA 2PDBA 1SZFA 2XWDA 3CHDA 1JI1A 1H50A 4IFKA 2EJ1A 2E5BA 1I2QA 3CUXA 3EDJA 1DIOA 1OCBA 2HPIA 5LHEA 3FS2A 2CWXA 1RLCL 4I9JA 4LGXA 1W1ZA 4KIRA 2WBGA 3REQA 4WDXA 3AXMA 2PGWA 3NZRA 3FDGA 4UCFA 1I4NA 3AHXA 1ADSA 1MDRA 3VAVA 3WL0A 4TXEA 2CZ5A 4GINA 3G1SA 1O68A 2WB5A 1HL9A 2CU0A 2IUZA 2D3NA 5GJNA 2WAGA 4HU8A 1QT1A 2GDQA 3PZMA 4Y9OA 2YYUA 1Q4WA 2E7FA 2TODA 3EKZA 1ZALA 2DT2A 2D23A 2GPTA 3BGJA 3AIQA 4O4VA 1XYFA 1HL2A 2V3GA 5JQ9A 3EMZA 1DWAM 4IGMA 4AC1X 5C0QA 2R1NA 5CC3A 3W71A 2X1TA 3GIQA 1S2AA 1J18A 3OBKA 4PGLA 4HNOA 3BG9A 1PJ9A 2ALDA 4XO7A 2XYLA 1FP9A 1F3XA 4MB5A 2EJAA 1K8YA 1TIMA 1IHIA 1DIKA 1OGSA 3HG2A 3HU7A 4BWLA 4PL2A 5HPOA 4J9JA 1V3LA 3GTFA 3BAIA 3IANA 5KITA