3R8RA

Transaldolase from bacillus subtilis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
212
structure length
212
Chain Sequence
MLFFVDTANIDEIREANELGILAGVTTNPSLVAKEANVSFHDRLREITDVVKGSVSAEVISLKAEEMIEEGKELAKIAPNITVKIPMTSDGLKAVRALTDLGIKTNVTLIFNANQALLAARAGATYVSPFLGRLDDIGHNGLDLISEVKQIFDIHGLDTQIIAASIRHPQHVTEAALRGAHIGTMPLKVIHALTKHPLTDKGIEQFLADWNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transaldolase
publication title Conservation of structure and mechanism within the transaldolase enzyme family.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 75
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, P, R, T, U, V, W
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3r8rA00
4E2DA 3IGUA 3KFTA 5EPDA 5AB3A 3C2FA 2JKEA 1P5BA 4HT3A 3NQ7A 4JR5A 4IXXA 1JR1A 3EX1A 3GAKA 1XCFA 3NQ6A 1KV8A 3HJZA 3TQ0A 1AMKA 1YLVA 2A4AA 2FJKA 2ABBA 4DPPA 3A5VA 5LGZA 2E1DA 4A2SA 5LSMA 1ICQA 1W56A 2ZA2A 1A50A 1TPWA 1DORA 3NPVA 5FF4A 3LV5A 3DFQA 4HPXA 3FJ6A 3L67A 3IIPA 1ZCOA 4Q4KA 1QPQA 4H4IA 3GNDA 2J27A 3W9ZA 3DZ1A 4K7VA 3FEMA 3EX3A 5D03A 1EWEA 1TV5A 2AGKA 3BLEA 5I3GA 2QUUA 3C6CA 1OX4B 4BI5A 1KBIA 1RQEA 3OIXA 3O15A 4MJMA 4K36A 5HMSA 3BW3A 1XUUA 3W7MA 2CZFA 3UD6A 2WO5A 1OFOA 4JNMA 3WK2A 1KFEA 1OHLA 3LB0A 3LCIA 2ZA3A 5K9CA 1VYSX 3W70A 3BG5A 2QKFA 1JJKA 3MMTA 4BFAA 4IX0A 4NJIA 3QMSA 2VFGA 3DFSA 1F5ZA 1A5AA 1F6PA 4FNRA 3T4CA 2QCGA 3RFAA 3KX6A 3ABOA 4CNPA 5CZSA 2WKJA 2FPYA 3DFOA 3F4NA 3TC6A 3EXTA 3DFTA 3CEPA 3INPA 2Y85A 5BOOA 2CZEA 2QCNA 1M6JA 5LNVA 3UXAA 3M6YA 4ZZ9A 5L9FA 2I9EA 4YXGA 2DZWA 1W5MA 3KXQA 3C2EA 1D9EA 4IMEA 2XFWA 3CTLA 3RLUA 5G5IA 1O94A 4W9TA 1WYIA 4U4MA 4M6VA 5E93A 3B4UA 4FX8A 3GX9A 1I4NA 4WY0B 4LVGA 1AW1A 3DFNA 3W1MA 1HFBA 4FIRA 1XDLA 1NF7A 3S5OA 2A7PA 5C54A 2DJLA 2GJLA 1TV8A 4UTMA 3W73A 1R2SA 3BGGA 2C16A 3GXTA 5F4SA 3H53A 4BI7A 3LLDA 4NNCA 3L65A 3OHIA 2VXNA 4QQ3A 3T7VA 4X22A 3MYOA 3S9YA 4QM1A 3B0PA 3CPRA 3LCXA 1O60A 2ATMA 2IQTA 4ZMGA 3SW6A 2NWSA 4O14A 2F84A 3FS2A 1SO6A 3E02A 3NM3A 5EY5A 2QEZA 1G6CA 3EWBX 1WOBA 4O50A 1YPFA 3A9IA 1TPUA 2QCDB 5KZMA 4S2CA 3DHDA 3QQ0A 3AO0A 3W7QA 1SSGA 1SZNA 4TMBA 4I7UA 3EXRA 2J9XA 1PCWA 3HG3A 5E0KA 3UWQA 1I2QA 3N3MA 2ISVA 1O4UA 2CLFA 4Y8FA 1ZENA 1OFPA 4WOZA 3W83A 4O4WA 3MO7A 3B04A 1NFBA 1OYCA 4Z1DA 4D2JA 3EWXA 1A5SA 2BZNA 3W1RA 2O7QA 2QCDA 4BWLA 1O95A 4DO5A 5DLCA 1BWLA 3MJYA 1TPB1 3FIGA 4QNEA 1KM4A 3NQVA 3PB0A 3W7CA 1XBXA 3IVSA 2P1FA 5HUPA 2YSWA 4FXSA 3KVKA 1F73A 2WOQA 2JKAA 3NL3A 3W7NA 4BF9A 1Q6LA 1K7XA 4DF2A 1DJNA 4YL2A 1YXCA 4Z08A 4OQVA 3R5EA 3TMLA 1FDZA 3O1NA 3E9AA 4AWTA 1GVRA 3SSJA 2JGYA 1K7FA 3UWUA 1Z44A 2EHHA 4PEKA 1QWGA 4UTTA 4A3UA 4R33A 3B03A 1ALDA 4NZFA 2A7NA 4BI6A 2PURA 2Q3OA 3JS3A 3W7OA 3USBA 5D2VA 2X1RA 5FF7A 4RJEA 5LHEA 4AWSA 5G2HA 3WJXA 1VR6A 2CLOA 2TYSA 4WY0F 1Q6QA 4Y96A 3LDVA 1LLZA 1Y0EA 4NXKA 3OBKA 3DAQA 1KM6A 3CHVA 3M1ZA 1GG1A 3W1NA 1DVJA 1SO5A 1UJPA 4JX5A 2V5LA 3MUXA 3W2KA 4N2YA 3W75A 1C29A 3GKFA 2VFFA 3P82A 3PUDA 4PC8A 3OVPA 1ZAIA 2PRMA 1H7PA 4NU7A 1GVOA 1LM1A 4O52A 2V82A 2Y63A 3B05A 4AHQA 5CPNA 3ATZA 4GUHA 4LT9A 1SQ7A 5G1YA 3NQEA 3Q94A 4PTNA 3TMQA 1ZAHA 4EF8A 2RH9A 4UFMA 1L6YA 2GQ9A 1FUYA 2PCQA 5CPOA 2ABAA 2CFFA 3G0SA 1KFKA 3N2XA 1KM2A 2QAPA 5FF2A 1VH7A 4JTKA 3NM1A 3TSBA 3QW4B 3K30A 3OVRA 4TR9A 3QFEA 2QUVA 1R46A 3W1PA 1KM5A 1L6SA 3MP5A 2V2DA 4RZ6A 1P0NA 4GE8A 1YADA 1PHQA 4ALDA 2J88A 1JVNA 1M7OA 1YDNA 4LUJA 1M7PA 4UC5A 1AK5A 4FO4A 4NXSA 4FXRA 1DOSA 5I3HA 2Y7EA 2QAFA 4FIQA 4XZ9A 2CLHA 2E6DA 2NLIA 4O28A 3NQMA 3W72A 1KM0A 3STGA 2CW6A 3W87A 1TIMA 2B7OA 4JX6A 1XBVA 3STEA 1GTHA 1TO3A 2FDSA 3W22A 2NXIA 4KFOA 3JR2A 1KTNA 4UNKA 1OX6A 2JKPA 3HPSA 4HSNA 3T40A 4HNNA 2GVLA 2NXHA 1JRCA 1KBJA 2GUUA 2A5HA 3MI3A 5HWMA 1Q3NA 3F1QA 3P81A 3IIXA 5TBOA 3THAA 5G2WA 3UQNA 2Y88A 4HKPA 4JTSA 2B7PA 3NPXA 3LI1A 1K8XA 3P8IA 3P67A 1FCQA 3M0ZA 3LERA 4RXFA 4KWVA 4N6EA 4X3ZA 3PG8A 2DP3A 4GXMA 3G24A 4K8EA 5LNSA 1RPXA 2GJNA 3D0CA 4RZ4A 3NQDA 3T44A 3HPZA 5FI8A 3N9SA 3HB9A 5CSRA 3KAOA 4K7YA 4M6PA 3HPXA 4JTGA 2C14A 1SFJA 2ISWA 3W1AA 3FJLA 3GKAA 3SI9A 1OFEA 3LBCA 4JEQA 2X1TA 4E2BA 3C52A 4RKAA 3NGJA 2ZDRA 1MZHA 1U5JA 4RXGA 4GUFA 3PM6A 3PUEA 1NSJA 3NO5A 4O13A 3M44A 3GDKA 2WSQA 2W0UA 5EBUA 4OT7A 2GVJA 4O18A 4R53A 2ZRUA 4PL1A 4O1BA 4YMZA 4IMFA 2HSAA 3TJLA 3BVJA 3ABSA 2VENA 4QSHA 3G1AA 3GR8A 5K2ZA 2W6RA 4OBTA 3LXCA 4Z0JA 2Q3RA 1XXXA 1LLWA 1GVFA 2A1YA 1NEYA 2AQWA 2H3BA 4AF0A 3LV6A 4E0CA 4Y9AA 4GFSA 3GAYA 1ADOA 3Q2DA 4WD0A 1LBLA 5EKYA 3PF3A 4H6KA 5CG7A 4GUGA 2EPHA 3V1PA 1ZAJA 4YCPA 3TK7A 2NUXA 2VKZG 1RD5A 1SR9A 3SECA 2EF9A 1OF8A 3PR2A 2CLEA 1H61A 4HNVA 2WSRA 1VQTA 5AHLA 2C13A 5F2MA 2RFGA 1LRNA 3HGJA 3NL6A 5FF0A 2Z2UA 3P5YA 3HGOA 3HG4A 3W71A 4AB4A 1K02A 1SPQA 4OHQA 1QFEA 5J5RA 3TROA 3TQKA 5EYWA 1B3OA 4UMCA 1OVDA 1KM1A 4XKYA 3DI1A 1UASA 2ZZ4A 4RR4A 3W7PA 1OYAA 3G1YA 1Z41A 3MHUA 5LKYA 3MYPA 3U8GA 3QF0A 3B0UX 2R8WA 3PY2A 1LZOA 2OT1A 3IIOA 1MEIA 1G4SA 1ML1A 1MSSA 4GUJA 3GIYA 3UYCA 1H62A 3SIZA 4O0ZA 2B4GA 4IQLA 3BLFA 2ZZ6A 4FNUA 3R13A 2D73A 1OFQA 1EPXA 2A6NA 2V2HA 3LXBA 4IOTA 3BPWA 2XN1A 5KITA 1HO1A 5F1VA 1JULA 4NJHA 4TU1A 4A22A 1TPFA 4UR8A 1GQNA 1TTPA 3R89A 3HQ1A 3M47A 3G0XA 3UY8A 1MEWA 3DKJA 3LRKA 4YLWA 3GK0A 1ME8A 1R30A 2QF7A 3N9RA 3OA3A 5HINA 4RZ5A 3NQAA 4NQ1A 3PS7A 1JCYA 2EGZA 4GWEA 1EUAA 1TRIA 5AHEA 1XBYA 4M19A 3TE9A 5AHIA 3W2UA 2RDWA 3S1WA 3L5MA 4O16A 5CZJA 3TV8A 1VHCA 5CGQA 3I65A 4HN4A 1SZGA 1VCGA 2JBMA 3MWAA 5DXYA 3LHTA 2HMCA 2J24A 5FEPA 3G1VA 3SGZA 4XTIA 4RCXA 2H3DA 1DHPA 1GWJA 2BSLA 1CI1A 2E68A 3LLFA 2Z6JA 5K9DA 4JY9A 4I9AA 3PSWA 3P60A 1W3TA 1DKWA 4JICA 1SO4A 3MHGA 4HSOA 2A7RA 4E38A 1KV5A 1UUMA 1K3UA 5D05A 5F4WA 4P2VA 2CLMA 4JN6A 2BWGA 3DFPA 5T26A 3P7YA 3LTYA 4K38A 2OMAA 3HG2A 3NEVA 3G1XA 5KSWA 1OF6A 2NX3A 2A21A 1PE1A 1OX4A 3NPWA 4AMAA 3ZS4A 4M5PA 3L0KA 2EAWA 3PBVA 4UMBA 2YXGA 3DI0A 3G8RA 2ZRZA 1GT8A 3FA5A 4OWGA 4JTLA 4FNQA 5KTLA 2ZZ1A 2CZ5A 3TR2A 2CLKA 4UTJA 2FQIA 3W7EA 4J9JA 1W5OA 4JTHA 1OYBA 2Y7DA 2FB2A 3EWYA 3CWOX 2JGQA 2DZVA 1LCOA 4BK9A 4Q33A 5A5WA 5HJLA 5TQLA 2ZTKA 5DN1A 4FNTA 3LXAA 2ZA1A 3NR0A 3UZJA 1BKSA 2Y70A 3VNDA 1FCBA 1VPXA 3A21A 2B0MA 2OZ0A 5D37A 3PUOA 3L68A 3C56A 2BTMA 4M7TA 4UTHA 1FWSA 1VCVA 4WXYA 1W0MA 3I7QA 3GDTA 2KZHA 3MI6A 3WJSA 1G69A 1ONRA 3LHVA 1GYNA 3W74A 5I3IA 4PCFA 4UTTC 3BG9A 4WY0A 2I1OA 1U83A 4O57A 3WFAA 1TJPA 1V5XA 3PVFA 2Q8LA 1TQJA 4DEFA 3LCHA 3IVTA 4XQ6A 3LCGA 4AEOA 3C8FA 1FWRA 3G1SA 1TTQA 3O8AA 3TA6A 4ZQPA 1J2WA 4DBDA 3DHFA 4M6QA 1ZNNA 1GVQA 5K9XA 4JTUA 1QPOA 3IGSA 2DJXA 3W1QA 4UFJA 4OV4A 3FKRA 5CZ0A 4ZVJA 2BLEA 3BG3A 3AJXA 4N9DA 5EA9A 3EX2A 4X9SA 3LTSA 3U2OA 3KRZA 3TSMA 5I3KA 3LTPA 2E6AA 4UNLA 1I2NA 5H91A 4LVFA 5C2XA 1ZJIA 3O6CA 2HS8A 2YCEA 1B4KA 3NQ8A 1KA9F 4UTWA 1SO3A 3MI2A 3M5YA 4KFPA 3UZ5A 4MOZA 5KZDA 1FXPA 3UWWA 2J9YA 1X1ZA 2NXGA 3CT7A 5HWNA 2C1HA 5EL1A 1H1YA 3P84A 1EIXA 4XBSA 3H55A 3NXFA 5K4XA 1I45A 4FNPA 1OX5A 2VEIA 3CC1A 3QRHA 3FFSA 4NUWA 3ANYA 4O1AA 5EMUA 5J5DA 3M9YA 3MHFA 4MFEA 3EXSA 3NAVA 4ZQRA 5C5YA 1RQBA 3PWAA 1YXDA 3BK0A 2QCHA 3MW7A 3W7GA 5LNUA 1XM3A 2CU0A 1K8YA 2H8ZA 2J9ZA 2WPBA 1RV8A 4JY8A 3DU0A 1FWTA 3GLCA 3PBYA 4IGHA 2X1UA 4LS0A 1TPEA 4MY1A 2YZRA 1I2RA 3CQ0A 1ZALA 2A85A 1SUXA 3LM7A 4Y90A 2RHGA 4L4MA 4IMGA 2YGYA 5D09A 5E1QA 2E6FA 4A29A 3SY5A 5IBXC 1YDVA 1KM3A 1A5CA 3CIXA 4TO8A 3O06A 3EX6A 2FPTA 3VKJA 3IV3A 4UXDA 3C4UA 5AYZA 3PSVA 1P0KA 1VLWA 4DQWA 1UBSA 3W7LA 1L9WA 2QCCA 3IVUA 3QJAA 5D2TA 3TXVA 3C2RA 5HULA 4LUIA 4JYFA 4FEZA 4FNSA 3B06A 1H63A 4LS1A 1GTEA 3NDOA 3ZR4A 1H60A 3E0IA 2RDTA 5FF3A 2VEKA 2WNNA 4ZQNA 3S1VA 4XWUA 2QCLA 4R7JA 3QSTA 4JS3A 3C2VA 1W37A 1QNVA 3NOEA 2QCFA 5F2LA 3S0CA 2ZRWA 1YTKA 3L21A 1A53A 3G0UA 2WV8A 4PL2A 1YDOA 4AHOA 2ZZ7A 3EX4A 1JCLA 4AVFA 1LORA 3KVMA 1JCXA 3L66A 7TIMA 3FYPA 2QCMA 1F05A 2OJPA 1SW7A 1LDCA 5D33A 3G1HA 3MP4A 5K3VA 2QR6A 2XN0A 3VCRA 2ZZ5A 1TPH1 2P10A 4GJ1A 1DL3A 5BRBA 4HNUA 4K39A 4LU0A 3W1LA 3VE7A 4O54A 1VS1A 1QPNA 3UPWA 3TC7A 4DELA 5KMYA 2GOUA 2YPIA 1PIIA 3PC0A 1EEPA 1A5BA 2VELA 1W5QA 3YPIA 2VC6A 4GC4A 1X8FA 2VFIA 3JRKA 1VYPX 2C18A 3S5ZA 4LWWA 2BX7A 1G67A 1W54A 4NVTA 1PS9A 3MP3A 1O5XA 1SW3A 5KZEA 1PL9A 3F4WA 1MEHA 3M5XA 4LC6A 4N4QA 2QDHA 3QMTA 1ZY9A 4O10A 3ZWTA 4IXHA 3ZWSA 5D38A 2E09A 4XTDA 3NZ1A 3EKZA 1ICPA 4HPJA 3F03K 3HO8A 3TJXA 1T99A 5G4EA 4DXVA 4LTSA 4QJ1A 1GEQA 4MZYA 4O0KA 5DCEA 1NVMA 2C6QA 3QYQA 3WK0A 2FB3A 5BMXA 3GXNA 2ZYFA 2V30A 2Y7GA 4BR1A 1WAUA 4AAJA 3P74A 3TKFA 4AHPA 6ALDA 4ICNA 1FDJA 2Z1BA 1KFCA 4UUIA 3B8DA 3B0VC 3M41A 3ELFA 1OABA 1N55A 3ABRA 2VOMA 3LCWA 1TQXA 3I68A 2G96A 3UY7A 2QDGA 3OEXA 2G97A 1R47A 2G5WA 4S2BA 3GVGA 1MO0A 5DBUA 4O8RA 5G1TA 1IXNA 2NX9A 4JGDA 1JUBA 3P5ZA 3S1UA 3NG3A 3P80A 4MZ8A 2ZRYA 4MLJA 2V0TA 4JTIA 4UCGA 4KFNA 1QO5A 3STFA 1D3HA 3PB2A 5IM51 1TREA 4TIMA 4ZQCA 3I7RA 5DBTA 3RMJA 5AN7A 4NX0A 2A0NA 3CWNA 4LRSA 1L2UA 3MBDA 5F4XA 3EWWA 5DCDA 1DQXA 3S6DA 2OX1A 4TX9A 1QR7A 1H7OA 4OGZA 2E6YA 1T96A 2FPVA 4QISA 3R12A 1T0OA 1VC4A 4LOCA 4O53A 3HMJG 4JTEA 3O16A 1XBZA 2WSYA 1W3IA 3LBMA 3RU6A 3QPZA 4HNTA 5D04C 2PRLA 2DZSA 3G3MA 1KFJA 3O63A 3GDMA 4EWND 3TNOA 4MIMA 4ADTA 3W76A 1KLYA 4B5NA 1G4TA 3W7RA 3GDLA 4NJJA 3KVJA 2QUTA 1VHNA 5CZTA 4AH7A 4LVAA 5LHFA 1YTEA 4LW7A 4O15A 5D30A 4POCA 3QMRA 1F76A 3NPUA 1W8SA 2VFDA 5U4NA 1FDYA 1TCDA 1EP2A 4I7WA 2E5CA 1IIGA 2VFEA 1EB3A 3LHUA 4WXZA 5AOUA 1F2JA 3N73A 1WV2A 1JQXA 2B7NA 1I8JA 2Q8ZA 5AC6A 3BGJA 3LHYA 2R94A 2B7QA 3G1DA 1HUVA 3WK1A 4K6AA 3WK3A 3IIVA 4Z1CA 3RK8A 1T8XA 1X1OA 1EUNA 3O07A 4OV9A 1F6KA 3FOKA 1LOLA 3GNNA 2X16A 3DBPA 4DF1A 3ZFHA 2YDAA 4MUZA 1GPWA 3BW2A 5BNKA 1AW5A 2NWRA 1P1XA 3O6YX 2PRHA 4NNAA 1TJRA 3QPYA 5CKSA 1N8FA 1QPRA 3RLVA 2ZZ3A 4I7VA 1GJPA 4LRTA 1XDMA 4ML9A 2GPTA 2GVGA 2TSYA 3FYOA 4ADUA 3SJ3A 3W86A 3PAJA 5DY2A 3BW4A 1RQHA 2DU2A 2R91A 4H3DA 3TFXA 1K8ZA 5I3JA 4DF0A 3H54A 1DBTA 4Z0SA 3TFCA 1QCWA 3W2MA 3W85A 3E12A 2HS6A 2P0OA 3GR7A 4DPQA 3E49A 3G8EA 4KWWA 1B4EA 1M5WA 5FEZA 3ATYA 1LBFA 4JX4A 4FX6M 1EA0A 2GQ8A 3LHZA 4OU1A 1WXJA 3VFLA 3EB2A 3WJWA 1N7KA 2F7FA 3NQFA 2ZRXA 1FCVA 4UFHA 1TPVA 3LOTA 3C2OA 3UWYA 4PA8A 5DCBA 2FTPA 3W2NA 4UR7A 3W88A 2J6XA 4TMCA 3RNDA 3O6DA 2QJHA 3GZ3A 1ME9A 4OE7A 1GG0A 4Y6GA 3TW7A 4LY8A 3DENA 3IEBA 3CEUA 3L9CA 4JD4A 3KOFA 1KFLA 1G7VA 1TPDA 4UFIA 1I2PA 2AAMA 1VRDA 1G4EA 3M5ZA 5AFDA 2QJIA 1W5PA 3CM4A 3NVTA 4NX5A 4UMAA 4UFLA 4MYAA 4PODA 2ALDA 3SFKA 1QAPA 1CW2A 1JCNA 3P61A 3DGRA 1OFDA 1UB3A 4O4VA 2E77A 2NX1A 3A23A 3Q58A 3TW6A 3S5NA 1OJXA 4FX7A 4MPQA 4FHAA 2VEPA 1XL9A 4WUIA 2C3ZA 1AL7A 4HIBA 3HIJA 3P8JA 3FLUA 5F1UA 3W23A 1R2TA 1C8VA 3GYEA 4LV9A 3EKLA 4UTWC 2OCZA 1AL8A 3SGUA 1C9DA 2NV1A 4MJZA 4BWLC 1E51A 1OK6A 5F2GA 3KRSA 3STCA 1BWKA 3NQCA 1GOXA 1FX6A 2WJZA 2XN2A 3QC3A 3L5LA 3UWVA 1YPIA 2YW3A 1TSIA 3HGRA 3EWZA 2V81A 5HNRA 4AWUA 1H5YA 2WNZA 4JYEA 4C1KA 2BXVA 3M7WA 1OFRA 3BARA 4MLRA 1YYAA 4CNOA 2TRSA 1FQ0A 4EOUA 4YWIA 5C6MA 1LP6A 1ZHAA 4S1FA 4JDBA 4JTJA 5DELA 4CCEA 3W84A 2ZTJA 1L6WA 3KVLA 2YYTA 4CNNA 2CWNA 3HG5A 3G3DA 2ZFAA 3LI0A 3CLMA 3W1TA 4M7SA 1V7YA 4O12A 3QSRA 6TIMA 4FF7A 3GXPA 4MZ1A 3SR7A 1P4CA 2EKCA 3L0NA 2YX0A 3A24A 3DH7A 3TCEA 3Q37A 1MXSA 3HBLA 4LV4A 3TU9A 1H51A 1RR2A 1XUZA 3LCLA 4P61A 4QIUA 2ATSA 1VGAA 3PULA 4XUGA 5D32A 2NUWA 3W7KA 4XBKA 2H6RA 3RF9A 1B9BA 1YXYA 4UTKA 3NYZA 4K8HA 1J4EA 1TPC1 1AW2A 3VI2A 1QMLA 2CZDA 2C0AA 4ZL1A 1LBMA 4ZQOA 2W79A 1H7NA 3S5YA 1KW1A 4HHPA 3N2MA 3QQ1A 4LVDA 4U28A 5G2IA 4O11A 1UUOA 4A2RA 3QH2A 4A21A 4CQ8A 2TMDA 1TTJA 4CQAA 5LNWA 1SU5A 1WDWA 4ORMA 5H2ZA 3BO9A 1XI3A 1OFAA 3OG3A 5CPLA 1S5VA 5ABTA 2RKXA 1G7UA 3TX9A 3MBFA 2X1SA 5AYXA 1YTDA 4Z1AA 4ADSA 1EP1A 1JRBA 3W6YA 1IIHA 1RZMA 2UV8G 3R2GA 4UTUA 3L5AA 1JCJA 2A2IA 2CLLA 3FKKA 3NZRA 3BLIA 4JIQA 1W3NA 1LYXA 4WX2A 3G18A 1H7XA 3W1UA 4LS2A 4IMDA 5K4ZA 3CB8A 1VZWA 2DZTA 4MVAA 1FXQA 3W7IA 1H7WA 2H90A 2ZQ0A 2E5DA 1JUKA 2VEMA 3L2IA 2H8XA 1HL2A 2ZBTA 4IWWA 5HR6A 1LROA 3T78A 4LC8A 4KKXA 2V9DA 4R34A 1Q45A 1WOAA 2DZXA 3GB6A 4UFKA 1FY6A 2X2GA 5FEWA 4ORIA 4LNYA 1Z42A 4JIPA 1Q6RA 4L4LA 1XKYA 4N9CA 1OK4A 3I6RA 4O17A 2WQPA 4ZQMA 4CQ9A 1TYGA 1EP3A 3S1XA 1I2OA 3W2JA 5AHMA 1JQVA 3G1FA 3TAKA 5AHNA 3S42A 4MY8A 1TMHA 3W7HA 1VCFA 3LCFA 3SZ8A 5FESA 3N14A 1VJIA 3S8HA 1GZGA 4IPJA 1EX5A 4QITA 5DY3A 5I3FA 1IXPA 1LTDA 3QW3A 1TTIA 3W1XA 4N9EA 3UPBA 3I7SA 1KTBA 2Y7FA 1LRTA 5D2XA 3THQA 1JCMP 3C3NA 5L6UA 1QOQA 1SSDA 3LX9A 3A22A 3W7JA 3GDRA 2G95A 4Q32A 4N4PA 2JK2A 1Q6OA 3NNTA 1W31A 1CX9A 5KINA 3M43A 1LOSA 3G22A 4IPIA 2ZCGA 1VYRA 4CLMA 1K03A 4N6FA 5HQEA 5BMWA 1F7BA 1F74A 3HGSA 4JYDA 4RLIA 1THFD 2LLEA 1B57A 1TV7A 1OFBA 1KFBA 5AYYA 1HO4A 2PC4A 1FWWA 3IGXA 4RX0A 1PV8A 1WA3A 3W7DA 2NUYA 4NJKA 3UXDA 4Z1BA 3TUUA 3IRDA 1WQ5A 2R14A 1LRQA 1KLZA 4X2RA 2QJGA 1PCKA 4GNJA 4WZHA 1IGSA 5IBXA 3NQGA 2FFCA 1XFBA 2GQAA 2ZZ2A 3LHWA 4PH6A 1X6UA 1LOQA 3PBUA 3N19B 1J5TA 5MHBA 4RV8A 1NAL1 4JTTA 1ICSA 3LRLA 3VE9A 1QDSA 4YCOA 1NF0A 3NQ2A 4UTIA 4GRSA 1XC4A 3OVQA 4QNWA 4IUOA 4NZJA 3LGEA 1W1ZA 3DKLA 4MFDA 2NZLA 3P62A 1IXOA 4O19A 3V75A 5G4WA 4NNBA 2C15A 4DO6A 3U6WA 5SWUA 1ZFJA 4O1CA 3NL2A 4EVZA 2PE4A 1H7RA 3TSDA 2ISSA 2YYUA 3WJZA 2A6LA 5U7SA 3HF3A 1DV7A 3TDFA 2WNQA 5LZLA 5A8GA 1S5TA 2YFOA 4UIOA 3QM3A 5HWJA 4LVBA 1AG1O 2YFNA 4WJEA 4EF9A 2VFHA 2V2CA 1S3HA 2ZRVA 4IMCA 4G1KA 4IJBA 4PFMA 1IXQA 1KTCA 3C0JA 5FEXA 2V8ZA 4QAIA 1OG0A 3TQVA 3L0GA 4CCCA 3TAOA 4JDYA 4MKNA 1ME7A 1K7EA 4MY9A 3N34A 1PVNA 1FBAA 1H1ZA 4MYXA 5C55A 3IIZA 2YR1A 2Y6ZA 2X30A 3UWZA 4UTLA 1GYLA 4WOQA 4RK8A 5CPMA 3DXIA 2HTMA 3A5FA 3M5VA 2I14A 3HOJA 2TPSA 3O05A 1SZFA 4AF0B 1JUEA 3W2LA 1O5KA 1W5NA 3TIMA 3M16A 1BEUA 1FCUA 2O7SA 4DO4A 3NL5A 1BTMA 3ABQA 2C19A 5AC7A 1H50A 4CCDA 2E5BA 1SFLA 3BV4A 1IF2A 1VLIA 5DXXA 3E96A 3KRUA 3TH6A 3LRMA 4DBEA 1DJQA 4GBUA 3R8RA 4JTFA 5K7JA 1WBJA 5CSSA 3EEGA 2NV2A 1WBHA 2Y61A 2DORA 5F2IA 4XKYB 5TIMA 3TXZA 1HG3A 1EWDA 3KHJA 5LGXA 1PHWA 2Y62A 3T55A 5HR7A 3PG9A 4ONVA 4GUIA 2FLIA 2RDUA 1S5WA 4N9BA 2CLIA 2Y89A 3PBWA 4C1LA 4O1DA 4NJGA 5D2WA 2Z6IA 1SW0A 1HTIA 1FWNA 2QCEA 3QZEA 1TRDA 1TB3A 4K37A 5LNRA 3C61A 3W3OA 2DZPA 1G4PA 2V5BA 3EWUA 4FB7A 4IX2A 3CIWA 3W07A 2FIQA 5AHFA 1Z48A 5D02A 1QO2A 4AXKA 3WJYA 3CU2A 4JXCA 2OT0A 3NA8A 2Z0IA 5BW6A 4EIVA 1WX0A 1R2RA 4N02A 2DZUA 1D3GA 3QEZA 1X7FA 5HUOA 3UNDA 1GVSA 1SZEA 1UCWA 4WQ6A 8TIMA 4NT0A 1DQWA 5AC8A 1RVGA 2YW4A 5D2YA 5GVJA 1QOPA
chains in the Genus database with same CATH superfamily
2HDJA 5ECUA 3W82A 1M01A 2BS9A 3KFTA 4JIHA 2C71A 3BLOA 2WB5A 1ZB5A 3C2FA 1P5BA 4ZOAA 3GAKA 1XCFA 1GJWA 3DYOA 2E1WA 4IUGA 2A4AA 4DPPA 4YTRA 3A5VA 5HMDA 1OSEA 1PDZA 4A2SA 4XZNX 2ZA2A 2GK1A 4CVWA 2WC7A 1TPWA 4M81A 1GHRA 3PZOA 2WZIA 1DORA 5HJXA 2JF7A 2PDUA 3F4CA 3GXMA 5FF4A 2FVKA 3WQOA 1ZBVA 3ZJ6A 4XZMX 4UQAA 4DJDA 4IISA 5PTDA 1ZCOA 1DWHM 3GBEA 3GD6A 2IPJA 4H4IA 3UZWA 5IDZA 3GNDA 3AXKA 3WQ5A 2J27A 3KTXA 5TAOA 3DZ1A 3GHRA 1CT5A 4H04A 3ISIX 2W5FA 3BLEA 4JEJA 4DJDD 3BW3A 1XUUA 3UBPC 1Q4NX 1HKWA 4I9TA 2WZMA 3B40A 1OHLA 5GJNA 3OU8A 1VYSX 3DDMA 2NQHA 5FKYA 4TTUA 1JJKA 3MMTA 5AECA 3VDHA 3AXXA 4GNKB 2VQTA 3VIMA 3WLQA 5GJPA 4XZBA 3TC6A 3DFTA 3VOJA 5JU6A 4Y8EA 4D9PA 5AC4A 4EX4A 4X9YA 4G6CA 4IG2A 2DZWA 3HQNA 3C2EA 2XFWA 3CTLA 4UCFA 4L4PA 1US3A 5G5IA 3A6OA 4W9TA 5FL1A 1F3WA 3RX3A 4U4MA 4B5TA 5CG0A 3B9OA 1V3HA 4WY0B 4IFOA 3DFNA 2BY1A 3LMYA 4FIRA 2A7PA 3KL5A 2GJLA 1BF2A 4XK2A 4UTMA 3W73A 1WDPA 3BGGA 2C16A 3ZM8A 4GYPC 2WLZA 3EWCA 3CPUA 3OHIA 3FYYA 4QQ3A 4X22A 3NSMA 3AIBA 4QM1A 3B0PA 4JFVA 1GOMA 3SW6A 4RE4A 4O14A 2XWDA 2F84A 3H4GA 3FS2A 5EY5A 1QI5A 1JF5A 1RH9A 4HQVA 2X42A 3E0FA 5LXEA 4O50A 3EMZA 3A9IA 2ZVRA 2QCDB 5KZMA 2JEQA 3PK7A 3DHDA 3CHDA 5LXXA 2E40A 3K1DA 3POCA 3KDOA 4YVVA 2QMJA 3UCQA 1O4UA 1M7JA 1ZL1A 1WZAA 1ZENA 3PWGA 1KO0A 4WOZA 2GL5A 3W83A 3MO7A 4KEMA 4NYUA 1LUCA 2BGSA 1E70M 4D2JA 5HATA 3EWXA 3T09A 3W1RA 1H4PA 2O9OA 3PJUA 3QGAC 1BWLA 3FIGA 3PB0A 1XBXA 3IVSA 3QZAA 5HUPA 1MWOA 3M64A 2WOQA 1DTUA 3W7NA 2XJ7A 3WQ6A 3ZVHB 4OQVA 3R5EA 3TMLA 1B54A 1DJGA 3E9AA 3ARUA 2HE5A 1K7FA 4QEEA 3M0IA 2F61A 1WE5A 3SUVA 4R33A 3B03A 2PURA 1E0WA 2VCAA 4B5UA 2Z2BA 4CNTA 4AWSA 3PBMA 4HCHA 2XSAA 4DWSB 3VO0A 1SM9A 1VR6A 3M0KA 1J6OA 4WY0F 4ZSUA 4GKTA 1IR2A 3DAQA 2INEA 4NKCA 1KM6A 3CMGA 3RRXA 5G4HC 1DE5A 1SO5A 2Q71A 1GVIA 3W2KA 3W75A 3VUSA 3P82A 1A0CA 3OVPA 4PSRA 1A5OC 4PCSA 4O52A 2QV4A 2Y63A 1EYWA 4LT9A 5G1YA 1S2UA 3WD1A 1ZAHA 4UFMA 3S2MA 1NWUA 2EJAA 1E5NA 3B8VA 1QWKA 5FF2A 1QTWA 4L7ZA 3NM1A 2Y8UA 4DWDA 4W7WA 4QEHA 4GYJA 3QFEA 5A6AA 1PDYA 3MP5A 3OHMB 4QJ5B 4J3ZA 1OINA 2ZXDA 5T8GA 4HHLA 2J88A 1JVNA 1OB0A 3K13A 3U3HA 1EKOA 4LUJA 1BQGA 4UC5A 2OLAA 1DOSA 3O3RA 2E6DA 4HHMA 1KM0A 1AZ1A 3T2OA 3UJSA 4NI8A 3H7UA 1XBVA 4PCNA 3STEA 3GH4A 1ELSA 3VOHA 2ZUWA 4HNNA 2GVLA 2NXHA 1JRCA 1KBJA 2DVTA 3MI3A 3MWCA 1Q3NA 3VK5A 4PTMA 3IIXA 1PAMA 5FAJA 1XPYA 3NPXA 4GZ7A 3PANA 1DJHA 2Q09A 4Q8WA 2YL9A 3P67A 4CU8A 3M0ZA 1SR0A 3LERA 1NDVA 3KOYA 4JOMA 1U22A 5BXTA 4Q4MA 3LD5A 2VP8A 1FHLA 3SCPA 1A3WA 3D0CA 3DEQA 3T44A 2J8TA 3HPZA 3MUY1 3N9SA 3HB9A 5CSRA 3M0JA 1OZMA 4LNCA 4HZ8A 2C14A 4FLRA 3PUGA 1V4YA 1SFJA 4E8CA 1MNZA 4F9DA 5CLWA 3AAMA 1K4HA 4ZENA 3SI9A 3F4DA 1LWIA 1RA0A 1UR4A 4IT1A 4AMCA 1VRXA 4JEQA 4E2BA 1U5JA 4GC3A 4GUFA 4U10A 1NSJA 3BOFA 2WSQA 3WEMA 2PDCA 2D22A 5EBUA 1JNEA 4O1BA 1FHUA 4C90A 4YMZA 1S2AA 3CUHA 3GO2A 3GR4A 1AH3A 3ABSA 1AH0A 4FALA 4LAOA 2PDGA 5K2ZA 3WQ4A 1XXXA 1LL7A 1LLWA 4JHOA 5D9MA 5AZ1A 1EC8A 4AD5A 1NEYA 2AQWA 2H3BA 4E2OA 2F6KA 4AF0A 1VEMA 4E0CA 4GFSA 4HBKA 2PDHA 4PUJA 4F79A 4MM1A 1ADOA 4WD0A 2ZXAA 5M3WA 1WNOA 1XCXA 1TKKA 2VKZG 3VZYA 2CLEA 1H61A 3VKCA 4JL2A 2GSEA 5F2MA 3F5JA 5FF0A 3HGOA 4JTCA 1K02A 3VGFA 2WJFA 4OHQA 4MWAB 5J5RA 5A95A 3TROA 4A8IA 4UMCA 1OVDA 3A12A 3B9EA 1DIEA 2WHKA 2XIBA 3DI1A 5HJYA 3W7PA 1S1PA 2W27A 3MYPA 3AFBA 1KRMA 1UZ4A 3C2YA 2IKIA 3PY2A 1F3TA 3VC6A 4GUJA 3GIYA 4V2XA 3BLFA 2POTA 3R13A 1EPXA 2A6NA 2V2HA 3BC9A 4CCZA 8XIAA 3BPWA 3EB4A 4CEUC 1MYRA 3FJ4A 2HISA 1PTGA 2XH0A 3AICA 1JPDX 1MEWA 3I3EA 4IH3A 4YLWA 1ESWA 4BA0A 1ME8A 4YVXA 4RZ5A 5CJ5A 3HV8A 4W88A 3PS7A 1R87A 3TQPA 2OB3A 1TRIA 3W26A 4M82A 2PFHA 2OOFA 3W29A 3W2UA 4F0SA 4XO7A 4IPPA 5CZJA 4JFSA 3SRFA 2Y1HA 4LSBA 1MI3A 1VCGA 3VCCA 3LHTA 1NDWA 3DFHA 4XTIA 1GVEA 3OO2A 4DBSA 1RAKA 1CI1A 2OG9A 4NI3A 4JY9A 4M0XA 1QHOA 1RVKA 4HSHA 3BJFA 1EL3A 3IJQA 4R85A 1UUMA 3AXHA 1K3UA 6A3HA 2BGNE 2REQB 5T26A 2ASHA 3PPHA 1R3VA 3XINA 4G7EA 1EEXA 3HG2A 1MUWA 3NEVA 2GFTA 1OG6A 1OADA 2C0HA 1OF6A 3WMCA 2ACRA 2NX3A 2ZX7A 1OX4A 5AY7A 3E2SA 5CPTA 3G77A 4M5PA 1V6XA 2EAWA 1Q2RA 2BOEX 2Y2WA 1NFPA 3BGAA 3BWWA 3UNTA 2YDSA 2YXGA 3DI0A 1MQQA 3O0FA 4JTLA 2WJEA 5J8LA 2ZZ1A 4LGXA 2FQIA 2XTKA 4J9JA 1K4GA 5KZ6A 3CWOX 2D23A 2DZVA 3U2ZA 4BK9A 1AJ0A 2ZTKA 5FJRA 5DN1A 1UROA 4FNTA 3LXAA 2DH2A 2ZA1A 1DJZA 3NR0A 1EF2A 3E5BA 3UZJA 4MUPA 1BKSA 5HNTA 3L4YA 3ZJ8A 2IW0A 2OZ0A 1VFFA 1Q6GA 4X0NA 4V28A 2AMGA 2BTMA 2F38A 3ZJ7A 1D8CA 1W0MA 1JPKA 2OFJA 1TZZA 3RILA 2EPKX 3U2CA 3WJSA 3L4UA 4C6IA 1GYNA 3HJEA 3W74A 3R6IA 1CNVA 3NQBA 4UTTC 4O57A 2Q8LA 3EMQA 1M41A 1Q6CA 1K9TA 3C8FA 1FWRA 1X38A 2MUCA 5BOEA 3AHYA 2ZE0A 3TTSA 3I3DA 2J77A 3U0HA 2QJNA 1GVQA 5K9XA 3AOFA 3IGSA 1HKMA 2HEJA 2DDXA 1S5NA 4JQ4A 4XX6A 3TTEA 4PMUA 3W0KA 2BLEA 3PHAA 4W85A 4D6DA 5IRPA 1BXBA 1FWBC 5EA9A 4X9SA 3KRZA 1TX0A 3BQ6A 5H91A 5I5RA 5BROA 3AIUA 2P0IA 2OQYA 3AZTA 4GGHA 4UTWA 4DHGA 2WHJA 4KFPA 3UZ5A 1JYVA 5KZDA 5REQB 1MZRA 2BVYA 2NXGA 5HWNA 3P84A 2PDNA 4XBSA 1DP0A 1UQZA 3QKZA 4REQA 5IOBA 2ZICA 3GXDA 3T0CA 4GH1A 4NUWA 2VEIA 1X7IA 5J5DA 3ANYA 5EMUA 1CB7B 4MFEA 2PZNA 1UZDA 4IF2A 3W00A 1Q66A 4JIIX 3OJGA 1J0KA 5LNUA 1K8YA 3KLKA 4JY8A 4IGHA 1OEPA 4MY1A 4LYRA 5A6JA 2W63A 2QIIA 3CQ0A 1NY1A 5DEZA 2IPWA 3LNPA 2RHGA 4L4MA 2BY0A 1A3XA 1E1EA 1A4MA 2E6FA 4A29A 2CERA 4OECA 1DJWA 3KHDA 5IBXC 2VC9A 1W3HA 1EDGA 1KM3A 1ENUA 3T8QA 3W38A 3O06A 1BPLB 3CK5A 4NIRA 1IEVA 3VKJA 2VGBA 2J7CA 1XRFA 3W7LA 1TA3B 2YJQA 1L9WA 2QCCA 3QJAA 4EWJA 4US5A 3C2RA 4QJ3B 1XLGA 2FMNA 3ZQ9A 2ZX6A 1W3KA 3E0IA 2RDTA 4JFUA 1RHCA 4OOUA 2E25A 1E1FA 3RR4A 3QOMA 2C91A 3QSTA 2D0GA 3B4YA 1F6YA 5E70A 3NOEA 3I6TA 1Q85A 3VOCA 3CAVA 1YTKA 2VD8A 1A53A 4C6OA 2HJPA 1MMFA 4US5D 1ECQA 3FGCB 3LNMA 3EX4A 4GG9A 3GVQA 4FSAA 1JCXA 1IEQA 1K6WA 4I8YA 3FYPA 6PTDA 1UJQA 2QCMA 3ONCA 1ISXA 4BZYA 3V36A 4IZGA 3UR8A 5K3VA 3PZVA 2XN0A 4CN6A 2P10A 1MQRA 3VGEA 1L6FA 3OZMA 4DJFC 1X6NA 3KS6A 5KMYA 1SYTA 5E0FA 4GYKA 3FCPA 1Y5WA 2OZTA 4QG8A 1A5BA 2NT0A 2VELA 1DXFA 3URAA 1VYPX 4IP4A 1W54A 4NVTA 1PS9A 2AGTA 4HA1A 1O5XA 1YPXA 1PL9A 3F4WA 4UWMA 1PO9A 3M5XA 4LC6A 4OTKA 1OC5A 3QMTA 1UR9A 1JDEA 1B3YA 2AQOA 2E09A 4XTDA 3NZ1A 5JBFA 2FKPA 4HPJA 3F03K 1R3QA 3TJXA 5A6BA 4L61A 1DJYA 1XR2A 5G4EA 3UG8A 4MZYA 4O0KA 3DC8A 1HL9A 2PWFA 1ZLPA 1E0TA 2FB3A 4H9XA 2E9MA 2IMRA 4WDTA 3P74A 3TKFA 3VIHA 3NZQA 1GQJA 3B8DA 3B0VC 4HPNA 1OABA 1N55A 1GHSA 4WEVX 1TQXA 4JIEA 2GYIA 4L5ZA 4LPCA 3ZR5A 5A6BD 1PB0A 4FK9A 3C5QA 1E0XA 3NG3A 3S9ZA 4MZ8A 2ZRYA 4MLJA 4JTIA 4YYCA 3STFA 4Q8OA 2CWXA 2QS8A 3AZRA 4NX0A 1W9PA 3TTOA 4UQEA 5DFAA 3CWNA 3UYIA 1L2UA 5A6TC 4BF5A 2OX1A 2HNHA 4E6MA 4KERA 1VFOA 1FFQA 1HKKA 1VBJA 3LPFA 4GKLA 1H7OA 1T96A 5IHRA 2J78A 4QR6A 3HMJG 2WMIB 4G8TA 1XBZA 1J18A 3LBMA 4C6CA 4HNTA 3N15A 2DZSA 2QUMA 1QI3A 3GQYA 4ADTA 1KLYA 2R1MA 3W7RA 4UQDA 1VHNA 1HP4A 4LVAA 1FH9A 1YTEA 1M03A 1GZ1A 2I5QA 2Y5JA 3QMRA 1F76A 1TCDA 4I7WA 3WLMA 2VFEA 3Q45A 4WXZA 1F2JA 2ACUA 3P3BA 2E4TA 2Q8ZA 5AC6A 3QVQA 2R94A 3GVWA 4PMJA 3VINA 4PFHA 4YTSA 5EBAA 3AMCA 4K6AA 4KS0A 4Z1CA 1BYCA 3ITCA 1LWJA 1EUNA 3S4TA 4OKDA 1F6KA 3APGA 4DF1A 3BW2A 1P1XA 4RPQA 1V77A 3WQPA 1ONXA 4NNAA 3QPYA 1QPRA 2GK1B 3B3DA 4I7VA 1GJPA 4ADUA 3SJ3A 1KQZA 1J79A 3WZ0E 4I9JA 3RM4A 2Q02A 1LL6A 1QCWA 1ZRQA 4INFA 3WBEA 2HS6A 1H0GA 3XISA 1B3ZA 3N18A 3E49A 3G8EA 2WMHA 1V6TA 3EGJA 2FTYA 1B4EA 1M5WA 5CEWA 3SCWA 2EBNA 1V51A 1LBFA 4NILA 4JX4A 2O9PA 3U5UA 3A4WA 3VNLA 3NQFA 3LOTA 4H9MA 5AYBA 5DCBA 3FY1A 4J4KA 4L64A 3RNDA 4PYSA 1ME9A 3TW7A 3LPOA 1XQLA 1TZ7A 3DENA 3QYSA 2J74A 1TFVA 1G4EA 3M5ZA 3WNOA 1CWYA 4NX5A 1V8EA 4S3FA 2XZ9A 4MYAA 4WGXA 4LXFA 3OQEA 4K2SA 5E5CA 1QAPA 5J04A 4CD6A 2E77A 1EO7A 3S5NA 1UWQA 3B8UA 1XL9A 4WUIA 3N12A 1UZHA 2XFRA 3AI0A 2J13A 1O7AA 1V0LA 1GPFA 3W23A 3CL6A 4IG2B 1FH7A 3DIPA 2VVSA 1XLBA 3CS2A 1QPKA 4AISA 2EQDA 4LV9A 3EKLA 3KCJA 2W61A 2FVLA 1E51A 5F2GA 3KRSA 1KNWA 3STCA 3ERPA 3W4RA 3L5LA 1OCNA 3S2JA 3VNMA 4A3RA 1N8IA 3EWZA 5D8ZA 5HNRA 1KQYA 1H5YA 2WM0A 4JYEA 3N6JA 3KBJA 2TRSA 4TQTA 4EOUA 1UD8A 5EB8A 3QR0A 4XZIA 5FD0A 3H2EA 1BYDA 4QCEA 1WKFA 4WKHA 4JDBA 3HURA 5DELA 2PODA 3KVLA 3HG5A 3G3DA 3QHOA 1XLIA 1V7YA 1XGEA 4J1OA 1P4CA 3NWRA 2BHYA 3L0NA 2FFIA 1KXVA 3DH7A 4GVIA 3Q37A 1MXSA 5I6SA 3TU9A 1XG3A 5EU9A 1EJ7L 3LCLA 1E0VA 2ATSA 2NUWA 4MB4A 4XUGA 5JIWA 2H6RA 3RF9A 3AIRA 4UTKA 3FXGA 4IIEA 4CD7A 5LA0A 1I6NA 1E40A 4UBPC 1LUCB 3RLHA 1J93A 1XLEA 4EPBC 1LBMA 8RUCA 1ZUAX 4ZQOA 1NELA 2WC4A 3E0WA 3N2MA 4AWEA 3MVTA 4YTUA 3OLIA 4U28A 4A21A 2TMDA 4MG4A 4CQAA 1WDWA 3A3HA 4ORMA 5H2ZA 1AD4A 4HJWA 3RXZA 1OFAA 2J75A 2AL1A 3MBFA 2X1SA 4UQ9A 5AYXA 3BH4A 4Z1AA 2J8GA 4ES4A 1IIHA 2ZXBA 4IIHA 3QGKC 4KRTA 3L5AA 4UOJA 4ERAA 2WVUA 2CLLA 3NZRA 4AIOA 4JIQA 3BJSA 4WX2A 4LS2A 3GG0A 3CB8A 1QXLA 1VZWA 1FXQA 3OP2A 2VMFA 5CSYA 2VEMA 4A6GA 1HL2A 4IWWA 4PUDA 4S3KA 3T78A 4KKXA 2XVGA 4DN1A 2W66A 4IGSA 1WOAA 1FY6A 4ORIA 4LNYA 4GY0A 1Z42A 1JYXA 4JIPA 1GOKA 4N9CA 4W7UA 4O17A 1VPYA 1N8WA 2XH2A 4XZLX 3JUGA 3S1XA 3TA9A 3IJLA 9XIAA 4JFWA 4MY8A 1HT6A 3OZYA 1BKHA 2EXOA 3UR2A 3RGTA 3M0LA 2WSKA 3QKEA 2R9RA 3N14A 1VJIA 3S8HA 4IPJA 1EX5A 5I3FA 1IXPA 1C9WA 1LTDA 3EPOA 5C9UA 3KEHA 3A13A 1B30A 3QOKA 2R1PA 1EF3A 2G4FA 3BV7A 3I7SA 1KTBA 3G2GA 2Y7FA 5D2XA 4UR9A 2XHYA 3LN3A 3THQA 3C3NA 4DNMA 1SSDA 3TZNA 2GUBA 3B97A 1Q6FA 3SCTA 4JKLA 3NNTA 4D1IA 1CX9A 3BAJA 3VGHA 4IPIA 5GJMA 4J5NA 1K03A 2OYLA 4XD4A 1F7BA 1F74A 3CH9A 1U5HA 5A8QA 1OFBA 3LUTA 3VZXA 2PP0A 4RX0A 1WA3A 3PZIA 2PGEA 4NJKA 4Q7BA 2OSXA 5A6MA 4PBFA 3CWHA 1H11A 3WBWA 3UJEA 1ITQA 3NXLA 4F0HA 4X2RA 2VZTA 2QJGA 3TN3A 2YA0A 2ZZ2A 4PH6A 1X6UA 4AX7A 5C7HA 1UKTA 5XIMA 1NDYA 1VB9A 4URIA 4ML4A 1ICSA 3OGSA 4NRRA 4GRSA 1XC4A 4B5XA 2W9MA 3LGEA 2HZGA 3DKLA 4MFDA 2NZLA 4O19A 2C15A 3U6WA 4XSLA 2QGYA 2NQLA 2P8BA 1L8PA 4W86A 2WHMA 2VT0A 2VTFA 1Q7MA 1RBOB 3MB9A 2CHOA 3TDFA 5A8GA 1T8QA 4XV0A 2EJ1A 3F2BA 3EWDA 5HWJA 4WJEA 3WLIA 2ZRVA 1GQKA 3WH5A 1YNYA 6XIAA 3KOWA 1BQCA 1RCQA 1YEYA 5FEXA 4RW5A 1OG0A 1PYMA 2VYOA 2XU2A 2YCLA 4JDYA 4MKNA 1ME7A 2F9RA 4D6HA 4MY9A 1H1ZA 4L9YA 4K8GA 2X09A 2IS7A 4L4OA 1VEPA 4RK8A 3HA1A 4G1NA 1MDRA 2HTMA 2OO6A 2I14A 3PTMA 3FHAA 1IYXA 1UH2A 3O05A 4AF0B 1JUEA 1K8CA 3VD5A 3CV6A 3TIMA 3M16A 1E3XA 1GONA 2ALRA 4DO4A 3WFLA 2XVNA 4US6A 4AD0A 5AC7A 1V79A 1SFLA 1AA1B 3VM7A 2GVEA 3TH6A 4DBEA 1DJQA 2WVVA 5K7JA 1XLDA 1F8MA 3LG3A 4GI6A 5CSSA 1ZS2A 3W24A 3ARSA 3IARA 1YBQA 2WMKA 2DORA 3K4AA 2YCJA 1J5SA 4FLOA 1PHWA 5HR7A 2NLYA 1BVZA 3UG5A 3A3WA 2ZX5A 1V3JA 3WMSA 4C1LA 3C0SA 1CGUA 1H41A 3VKAA 3QZEA 3MTWA 1TB3A 3DYMA 4Y9PA 4K37A 7CGTA 1CGXA 3ALGA 1RY8A 4ZCWA 2DT1A 3S9IA 4AVNA 3A9BA 3S3GA 1QNPA 3S1GA 2V5BA 2VHLA 3L4XA 1W2PA 2FIQA 1Y5VA 4H00A 5JH2A 3NA8A 1JXKA 4ZODA 3M0VA 5AC5A 1KBKA 3BDKA 3PWIA 4WCJA 4ZXLA 1SFTA 4F0LA 3CLWA 3UNDA 5C2GA 1IWPA 1B90A 1UCWA 1OD8A 4NZ4A 1WDQA 1RVGA 2NV9A 4KW2A 2YW4A 4GO8A 1E4MM 3IGUA 4JQ3A 5FCZA 3TYBA 3KE0A 1X1NA 4HT3A 3WF1A 3FN9A 2YLAA 1V3IA 2FJKA 4A8LA 1P48A 4U5IA 5A2BA 1QBBA 4F66A 2QPUA 1V6UA 2PF0A 3LV5A 3DFQA 3FA3A 5JMUA 3FJ6A 3IIPA 1MDLA 3WLPA 3RX2A 3UG4A 3WG6A 2VWTA 3TLLA 5E09A 1YNQA 1QPQA 5CBBA 1PKLA 3NOYA 3BAYA 4G7EB 2PGRA 2OQHA 3P0XA 3U9IA 4K7VA 3FEMA 1CXFA 4GVHA 1OX4B 4BI5A 2Z1KA 1KBIA 2IKJA 4H7ZA 4MJMA 1EYEA 2CZFA 2WO5A 1OFOA 1W17A 1PPIA 3V5FA 3DOPA 4JNMA 3LB0A 3LCIA 2ZA3A 2Q6ZA 1T40A 4ACYA 2PWHA 2GSHA 2PU0A 1IEWA 4IX0A 3CUXA 3MU7A 3QMSA 1F5ZA 4X2PA 1F6PA 3RAOA 4JZ5A 4PTVA 3CEPA 4HPHA 5BOOA 2CZEA 1EC9A 5LNVA 4Q22A 5DX7A 3R10A 1V3MA 1YE6A 2WMGA 2I9EA 3KXQA 1D9EA 2VZOA 5AZ0A 2FH6A 2RJHA 3BLLA 5E93A 1XH0A 2ISFA 2XINA 1I4NA 1HFBA 1R3TA 3S5OA 2AKMA 1TV8A 5CPQA 1R2SA 1XRTA 4GZEA 3N29A 5GNXA 3T7VA 3CTTA 2OSYA 1XIDA 5HBFA 2ZX9A 4TX8A 2OWXA 3EBVA 1W8GA 3IRSA 1W1TA 3NM3A 3BLPX 3E1F1 1REQB 3EWBX 2PBOA 1Q65A 4PUMA 4CQCA 1TPUA 4DJEC 1JZ6A 4MKVA 3ARVA 1UR2A 3QQ0A 3TJIA 1W1B1 3RCNA 4A3QA 4TMBA 4I7UA 3E6EA 2HROA 2J9XA 3HG3A 1QNOA 4NY2A 1I2QA 3MDUA 4Y9NA 4Y8FA 5B7ZA 1OFPA 2Z7KA 4REQB 4BJHA 5BRPA 1NFBA 1YDYA 4Z1DA 3MKCA 2A3EA 2VD9A 3PPCA 1A5SA 2JEPA 1WCGA 2QCDA 4BWLA 4J3UA 4B5SA 2GOKA 4IIDA 1TPB1 3TZFA 4BQ4A 3CAWA 3W7CA 2X2YA 1S3TC 2BY3A 8A3HA 4FXSA 4QS5A 2JKAA 3CUZA 4EXQA 4BF9A 5M2FX 1BHGA 4H8HA 2WK2A 4B5WA 4LANA 4IIGA 2PDKA 1GVRA 3IUHA 4DYEA 4F2BA 1XISA 1Z44A 2EHHA 4WSJA 3E2QA 4UTTA 1XSJA 2OODA 3THCA 1PUDA 1UD3A 4NZFA 1JZ8A 4H2CA 3JS3A 3ITYA 3W7OA 3ZIZA 1CEOA 5D2VA 5CBIA 3T8LA 3ZVHA 5JBDA 5G2HA 1PKYA 2TYSA 3ZVIA 1Q6QA 3MV11 5A6LA 1LLZA 2R24A 4NXKA 2PZ0A 1WXZA 6REQA 3W1NA 1HZYA 4N2YA 1FWHC 1QW7A 1C29A 3GKFA 4PC8A 1XLMA 1DIKA 2W62A 1D7FA 1ONWA 4U2ZA 4AHQA 1EQCA 4GUHA 4L1XA 3GXIA 4JTAA 4DM2A 1ITUA 4HOXA 5BRQA 4PTWA 3Q94A 4ATLA 2RH9A 2E9LA 5JUVA 2NSOA 3SCNA 2GQ9A 1FUYA 5CPOA 2H9AB 1QHPA 2Y5SA 4JTKA 3AUOA 1GNXA 2VRKA 3QW4B 4I5UA 2CLPA 2FH8A 2CKSA 1R46A 2Z1XA 3SN0A 2ODOA 4GMEA 3UR7A 3V35A 1AQ0A 4DRSA 1KM5A 5CGMA 3LK6A 2IKHA 4IPLA 4GE8A 1YADA 2PEVA 2Z1VA 1TE1A 4DLFA 1AZ2A 1TR9A 3PZNA 5I3HA 2MANA 3WQDA 2CLHA 4P7RA 4WRHA 1EJRC 1P1MA 2D20A 2B7OA 4JX6A 2FDSA 1R0MA 4I6KA 2WVSA 1KTNA 4UNKA 2JKPA 1VIWA 3HPSA 4R3UA 2KAUC 3E74A 3BURA 5HWMA 4XD3A 3F1QA 3P81A 4YYFA 3THAA 5G2WA 3IACA 1IEIA 3LI1A 1K8XA 4L9ZA 1EHNA 4KWVA 2A3LA 2DSWA 2DP3A 4GXMA 3G24A 4K8EA 1E1CA 7XIMA 5LNSA 4H8NA 3BQ5A 2GJNA 3NQDA 2VZVA 1DXEA 4NRSA 1X96A 4RDVA 5AVHA 2DV0A 4LFYA 4DBUA 3KAOA 4M6PA 3HPXA 2Q01A 4PULA 1JZ2A 1JAEA 1O66A 2HBVA 3MA8A 1D3CA 3SDOA 1WDDA 3FJNA 1XIGA 1OFEA 3FAWA 2J62A 4NYYA 4XO6A 3DERA 2I57A 4AYSA 1MZHA 1KKRA 1JZ3A 1X97A 2PDWA 3PUEA 3NO5A 4O13A 2I56A 3GDKA 5E6ZA 3RYSA 4O18A 4R53A 4KCUA 4PL1A 3Q67A 3WUGA 5T91A 3WQWA 3SGGA 2IXUA 3R11A 3PNUA 1M65A 2Q3RA 5ABEA 4Y7EA 2MNRA 1KXHA 1RK6A 2A1YA 1V6WA 5IFTA 2VWSA 3GTXA 1GEHA 3GAYA 3PF3A 2EPHA 3V1PA 3FDGA 4YCPA 1MFVA 3TK7A 1SR9A 2EF9A 3NSNA 4Q8NA 3PR2A 1J0ZA 5FAGA 4HNVA 4GOAA 2WSRA 1W3LA 2C13A 2OR2A 1LRNA 2VC7A 3NL6A 3P5YA 4AB4A 1M53A 2OLHA 4B91A 1DJXA 1WB0A 4RR4A 2G41A 1OYAA 1EXPA 4Z2GA 2R8WA 3QGVA 3BAWA 3IIOA 3WH7A 1P6BA 1ML1A 4ERIA 2FVMA 1UKOA 1C8YA 3CZKA 3UYCA 4KMQA 4O0ZA 4MWAA 2B4GA 4IQLA 1XYLA 4FNUA 2G4JA 4ASTA 4NF7A 1HJVA 1JULA 4PZVA 3AZSA 4A22A 2GGHA 5CGTA 4HZ6A 4QSFA 2WAGA 3BTNA 3MSDA 3VIOA 4D6JA 1TTPA 1FHVA 3R89A 3G0XA 3UP8A 2YB1A 2PLKA 2QF7A 3V5OA 3PFRA 5HINA 2I16A 2GGIA 5A2AA 4MWAD 1NM9A 1EHAA 4L1GA 2YBTA 5BU6A 1WKDA 4GWEA 1EUAA 5AHEA 3VOFA 4M19A 1TG7A 3S1WA 1B1YA 4HZ7A 4W84A 1EJVC 1UKQA 2RDXA 5CGQA 2EG7A 1LQ0A 3QZ6A 1SZGA 1NTHA 1VP5A 1T6MA 4GIAA 3SGZA 2WW5A 4RCXA 2H3DA 1SVDA 2BSLA 4QDWA 3VVGA 3MDWA 3PTQA 5K9DA 4I9AA 1XGZA 1W3TA 1HL8A 3MHGA 5I0DA 2XIQA 4HSOA 1VFLA 2PAJA 2BY2A 5B7YA 1VD6A 3QC0A 2O4MA 5A3HA 3DFPA 4LYKA 3OB8A 4QG6A 1OIMA 4K38A 4HCLA 5JQ9A 1HGYA 4XKMA 4AQLA 1XC6A 3HFYA 3A64A 1PKMA 5A6SA 4IQJA 4AZGA 3IGHX 4ZA0A 4HA4A 1Q5MA 1XLCA 4GCAA 2REQA 5I77A 2G8ZA 4GZJA 3BJTA 3FA5A 2VI0A 1OGGA 2CZ5A 3V7PA 3SCQA 2Y4SA 3EA2A 3LYEA 4JTHA 2Y7DA 2FB2A 4FXFA 1QOXA 2JGQA 3VMPA 1JD7A 1FWAC 1F4AA 3DX5A 1YX1A 2D2GA 3H2OA 2FZMA 3VM5A 1KRAC 4DUWA 2C1GA 1XH1A 3BL3A 2HNEA 3PUOA 3C56A 4UTHA 1VCVA 1HNYA 4WXYA 3GDTA 1XP3A 3RU8X 3MI6A 1BSIA 3LHVA 4WKFA 4HOWA 4JBRA 1IE7C 1UUQA 1M9HA 1TJPA 1V5XA 1G01A 3H2CA 1TQJA 3GTIA 3LCHA 4XQ6A 2VGFA 1NU5A 1TTQA 3IJ6A 4AU0A 4DBDA 2DUXA 4JTUA 3L2LA 3C86A 1L6GA 3MSGA 4EXBA 2XVKA 4UFJA 1ISVA 2INZA 4OFCA 2R1KA 4IIFA 2ZUUA 1SJDA 4ZVJA 4AY1A 3QXBA 3AJXA 4N9DA 1FP9A 3VD7A 3L7RA 1U5VA 3UJ2A 4MJ4A 3TSMA 4B9ZA 1I2NA 4FOKA 3O6CA 2YXOA 3RO6A 3LQGA 1VIZA 4JCLA 3NYDA 1MQPA 3GDBA 1SO3A 3MI2A 4QE1A 3WQFA 4M24A 2POZA 1DWFM 1RCXB 3UWWA 3MO4A 4ZTXA 2WZTA 1KXTA 3LU2A 5EL1A 1HIZA 3WQEA 2VEGA 4MB5A 1SGJA 2X41A 3H55A 1CXEA 3DHPA 3SRDA 1I45A 4ZO6A 4QLKA 1FVPA 1UPMB 3QRHA 1VBUA 2W92A 5AKQA 3RJYA 2RUSA 3EXSA 3AIQA 4ZQRA 3POHA 5C5YA 4GQBA 4DBWA 3UVAA 3EDJA 1XM3A 1PKNA 2WPBA 1VAHA 2H8ZA 5REQA 1JDCA 4DAFA 2YZRA 4PRWA 4WHBA 3MPGA 1SUXA 3LM7A 3HQOA 2VL4A 3DFYA 4FLQA 5RUBA 3LZ3A 3CUGA 4B4HA 5D09A 4XIMA 4J40A 5E1QA 3P0WA 3QR1A 3K2GA 4NZCA 4GQRA 4MF4A 3CYVA 3NDZA 1A5CA 1EZ2A 4JFTA 4JQAA 1BLIA 1A5KC 3EX6A 4R7OA 2FPTA 3IV3A 4UXDA 3C4UA 3VA8A 3OGVA 3B8IA 1P0KA 1VLWA 3AQUA 4RV3A 3NGFA 3QTGA 3U4FA 1WAWA 5HULA 4JYFA 4FNSA 4C5YA 3B06A 4GNVA 3NDOA 2P88A 1E0UA 3ZO9A 3HPAA 5HOSA 4G7FA 5FF3A 3V1HA 2OGYA 4R7JA 1BVWA 3N2BA 3C2VA 2DEPA 4JAWA 3TNBA 3FV9A 1IV8A 2QCFA 3S0CA 1TA3A 3FW6A 3L21A 2ZUNA 2P76A 3BUVA 4ZEPA 3KVMA 1Z3NA 3L66A 7TIMA 1LQ2A 2OOGA 3D6NA 1RD6A 5D33A 4KWOA 3MP4A 2QR6A 1TPH1 3HTWA 3CZEA 1PZ0A 4H1ZA 4KF1A 5BRBA 3W1LA 3VE7A 1XRSA 1VS1A 1QPNA 3UPWA 3TC7A 2GOUA 1QUMA 1IWBA 3PC0A 2V3DA 4LQ1A 2BB0A 1XD1A 2VC6A 3YPIA 3ITTA 1X8FA 4TOQA 4V1XA 3S5ZA 3V3WA 1G67A 3RHGA 2XIIA 2XGIA 1SW3A 2QV5A 3ZLGA 3ARRA 3REQA 1ZY9A 4O10A 4IXHA 4PMZA 4GJJA 3EA1A 2ZX8A 3ZMRA 3EYPA 4XD6A 2OQLA 3SIMA 1F3EA 1S38A 4H83A 1T99A 3CV1A 4DXVA 4LTSA 2PDFA 4QJ1A 3THUA 3H26A 2OEJA 1UD5A 2YCLB 5CSUA 3U4AA 3GXNA 4BR1A 2Y7GA 4UB9A 6ALDA 3TTYA 4UUIA 3M41A 1ZGDA 2BDQA 3TR9A 4CGTA 1HF6A 1NFGA 1F07A 3UY7A 3W81A 2QDGA 2G5WA 4S2BA 2W91A 1WDSA 5DBUA 3MUAA 4O8RA 4MAVA 5G1TA 2QT3A 1KRBC 2ADAA 3ID7A 2G0WA 4JGDA 4AZIA 1JUBA 1UIPA 3P80A 1JXJA 3PZMA 1EGVA 2ZADA 5DMLA 2V0TA 4C1NB 4GPNA 1MW0A 5IM51 1TREA 4DYJA 5DBTA 1M3UA 5AN7A 1XD0A 2A0NA 2WVVB 1ODUA 3GBDA 4LRSA 1W9VA 5I02A 3H21A 2R82A 2PMQA 3S6DA 1YBQB 4A3YA 4TX9A 3GVRA 3DCPA 5C9RA 4GACA 2FPVA 2VZSA 3R12A 1VC4A 2CXGA 4O53A 5HNUA 1WPCA 1HQTA 2WSYA 3KP0A 5E9AA 3GFZA 3IV8A 2PRLA 3O63A 1KFJA 2VR2A 2XUCA 3GDMA 2QMKA 2B81A 1DIDA 4B5NA 4ZO8A 3HMCA 3TJ4A 4PMRA 5LHFA 7A3HA 3STPA 3JW7A 1PZ1A 5U4NA 3WLTA 4NAFA 1FDYA 2PDPA 1ZBKA 1JYWA 3WH9A 2E5CA 1G94A 1EB3A 3LHUA 4JKMA 4PMQA 5AYIA 3LHYA 2DSVA 3VXGA 2W3ZA 1CLKA 1VFTA 3GG7A 4J3VA 4AXNA 2B7QA 4UQBA 2VQUA 4KIRA 2V63A 3CZJA 4U31A 5DF0A 4HA3A 1T8XA 1X1OA 3O07A 5HK4A 1LOLA 4IFKA 4ILSA 1GOIA 1E6PA 3AJ7A 3WFZA 3ZFHA 4MUZA 5CC3A 2J47A 2IXVA 3O6YX 4GX8A 2CPUA 4JTDA 1TJRA 1RK5A 2HVNA 2GPTA 3QLLA 3CBWA 2TSYA 3V16A 4D72A 2XSXA 3PAJA 3PPFA 4ACZB 4AZBA 2R91A 3TFXA 4DM1A 2EPNA 5I3JA 5HMEA 4DF0A 1DBTA 3MZ2A 1VFSA 3W2MA 3W85A 3E12A 4P8XA 1PXGA 3BANA 3GR7A 4KQNA 4TTGA 3RMEA 2D2OA 3BZGA 3ATYA 1VF8A 5CLTA 2GQ8A 3LHZA 3EB2A 1KCXA 2V3FA 1TWWA 3VDCA 2ZRXA 3IJDA 1TPVA 3B8WA 3UZYA 3QQWA 1EJTC 2FTPA 5KEZA 2ZDSA 4RZBA 4Z2JA 3T81A 3N04A 3F2CA 4OE7A 2W67A 1R6WA 4Y6GA 4PTDA 3WLLA 2QW5A 3ORWA 3TYUA 2X7WA 1XIHA 1TPDA 2XGBA 2BXZA 5AFDA 2JIWA 3H8AA 3CM4A 1W5PA 3S2LA 1E73M 2YCIX 1UBPC 2Z27A 1XRVA 2ALDA 4HTBA 3HN3A 4O4VA 2GDUA 3P61A 1UB3A 2D0HA 2NX1A 3A23A 1JPMA 3WH8A 1H2JA 4MPQA 4FHAA 2VEPA 1Z6KA 3GUWA 4WSHA 1O68A 2BGQA 3P8JA 1HJXA 1BG4A 4K3ZA 5BZAA 1R8LA 2BHZA 4HPGA 2D2HA 2GWGA 2C7FA 1R2TA 4V27A 4XAFA 4P8UA 1GQIA 3SGUA 1C9DA 1OK6A 1EXBA 1GOXA 2WJZA 3MS8A 5BXSA 3UWVA 1E6NA 3B8TA 1UZ1A 4H8UA 2EKGA 2WNZA 3RDKA 4IIBA 4AG0A 2BXVA 4CNOA 3R8GA 2OVLA 4FF5A 5C6MA 4GZIA 1NWRA 1KWGA 4L1WA 1C8XA 3S2CA 1UH3A 3H2NA 1ECEA 4JTJA 1NARA 2ZTJA 3ZLHA 1B3VA 2CWNA 3DECA 4Q8QA 4AY7A 1A3HA 1IGWA 2DUZA 3W1TA 4M7SA 4B2DA 3MQTA 3WLJA 1QU4A 1TV4A 1BF6A 2YX0A 2IQDA 3A24A 1JAKA 3TCEA 3HBLA 3KBVA 4Y9OA 1RR2A 1XUZA 3V0TA 4P61A 1AQHA 1VGAA 1KC7A 3W7KA 4GQQA 4XBKA 4C6DA 4DXXA 1XH2A 1YXYA 1XYAA 3WQ8A 3FHQA 5GPRA 1NOWA 4QDMA 4ZL1A 4S3AA 4S38A 4B2DD 4IMAA 1FOBA 3RN6A 4F40A 2W79A 3W37A 2BMBA 3CAQA 5HPOA 3N9KA 1DE6A 3QQ1A 4LVDA 2B31A 4O11A 1UUOA 3QH2A 2QHAA 4CQ8A 1JEZA 1V93A 1TTJA 4W5ZA 5LNWA 4O8AA 5CPLA 1S5VA 3B0XA 1BAGA 5I09A 4BQ3A 4ADSA 1A49A 3WUFA 1JRBA 4Z2HA 1FA2A 2UV8G 1XQKA 3UVIA 4ZB0A 1EBHA 3R2GA 4DZHA 1MW1A 5DO8A 4F2TA 3AHZA 5ENLA 2BXYA 3FKKA 1W3NA 2YZ5A 3FSUA 3URNA 1LYXA 1VKFA 3W1UA 1S2CA 1HKJA 5K4ZA 5E9XA 3AROA 2QYGA 1GOOA 3RM8A 4GO9A 5C9XA 3AIWA 2ZQ0A 1JUKA 2C1IA 2H8XA 2Z24A 2ZBTA 1UOKA 5A6KA 1J8VA 3WDJA 1LROA 3O6AA 4LC8A 1HJWA 5CC5A 1XIBA 6REQB 4UFKA 2D0FA 2WQPA 1DIOA 4HU4A 4CQ9A 1Q4WA 4NSBA 2OELA 4GGBA 1QATA 1R85A 3COTA 3T42A 1VCFA 2XH4A 3LCFA 3GM8A 3F2DA 1NOFA 3CPGA 1RUSA 1UWTA 3S6OA 4NL1A 2QUNA 2W4XA 1VBRA 2XM2A 4D8AA 2WCGA 3V0SA 1XIEA 1E55A 4QITA 1UWSA 4LBUA 3LY0A 3VYLA 4BEQA 1TTIA 3RPMA 1TWZA 4N9EA 3WYZA 2V5DA 5CAKA 2QPSA 3BXWA 3OA5A 3OVGA 5TNVA 1XCWA 2XFFA 3GZAA 1JCMP 1QOQA 3AIVA 3R4IA 3NSXA 1CLVA 4E4FA 3W7JA 3TN5A 3ENLA 2ZUVA 1Q6OA 1PJ9A 4KETA 1LOSA 1RCOB 3K46A 1XYCA 3MMUA 1QK2A 4N6FA 5BMWA 1CCWB 3H2AA 3HGSA 5CH9A 2G50A 3DESA 2LLEA 1TV7A 1KFBA 1HO4A 2P3EA 2BVWA 1PV8A 3AYSA 4TVCA 5HMFA 3MC5A 3I10A 3N2OA 3IRDA 1XLFA 3CO4A 2PLJA 4W8LA 1TVNA 1KLZA 1CECA 1T7LA 1PCKA 4WZHA 2VDHA 4PUKA 3NQGA 1XFBA 4EAMA 1MNSA 1YIXA 2AOSA 1J5TA 1SFSA 3VX0A 4UTIA 4O1FA 3OVQA 1E1CB 3SUSA 2WWDA 1J2BA 3P62A 5G4WA 4M1RA 3NL2A 3RPDA 2FZ8A 2E7FA 1H7RA 3TSDA 4H2HA 5H1WA 4YIWA 3WJZA 1W91A 2OYKA 2PSNA 4AYGA 2YFOA 4UIOA 3QM3A 1AG1O 3AYVA 1EDTA 2VFHA 3KWXA 4CQDA 2NVDA 1IXQA 1KTCA 4YHGA 2V8ZA 4LAKA 4MDOA 3TQVA 3L0GA 4HOZA 5FA5A 1XKJA 4PMOA 1E71M 1PVNA 1JPIA 3BAKA 3IIZA 2YR1A 2XFYA 2Y6ZA 1XPGA 1XLJA 4UTLA 1P7TA 4NP7A 1I0BA 3A5FA 5G1MA 1AQFA 4IM4A 5CPSA 3PN8A 5DRIA 3W2LA 1F61A 1NDZA 1FCUA 2XZ7A 1TJ1A 2DQXA 3ABQA 1RLCL 1E15A 3VMOA 3IJ9A 5DXXA 3KRUA 3LRMA 4OOZA 4C6KA 4GBUA 4Q4PA 4LF2A 1K77A 2GGEA 2NV2A 3RLGA 4ROPA 3WQVA 5BCAA 3ES7A 5TIMA 1EWDA 3T55A 1AQMA 4GUIA 1E56A 3PBWA 3VCNA 3RIKA 3JU2A 5HAOA 4B4FA 1HP5A 3T05A 5AHFA 3G5EA 1Z48A 1K6AA 4J35A 3CT2A 4MADA 2PDXA 1WX0A 2PP3A 3S47A 5T9BG 1U1HA 1X7FA 5HUOA 1GVSA 1Z89A 5AC8A 2QQ6A 4HNLA 4QQUA 5D2YA 4GIRA 1O1ZA 4ZO9A 5EPDA 5AB3A 2Z26A 4E8GA 2JKEA 1W9XA 3NQ7A 1AVAA 3CXOA 3EX1A 4PMYA 3FX4A 1KV8A 1AMKA 2FGZA 1FH8A 3R58A 3VDGA 4NG3A 2PDLA 4AZ5A 5DMYA 2E1DA 5LSMA 1C7SA 1IT0A 1ICQA 4XD5A 1W56A 3ITXA 4M80A 4HPXA 5ECVA 1JI2A 3H22A 4QDPA 1P0DA 2EPOA 1DTNA 5I24A 3MSYA 4Q4KA 1VBGA 3AALA 1M1BA 4ZSTA 4UOQA 3ZYZA 5GNZA 1P0EA 1IEXA 3HQPA 3W9ZA 4HYWA 3EX3A 1PZ3A 5I3GA 1BXCA 2QUUA 1RQEA 3L4TA 2F8QA 3O15A 2D69A 3O2LA 3CASA 5HMSA 3CZLA 3GNPA 3W7MA 4QAWA 3MUCA 3WH6A 3WK2A 1KFEA 5JH1A 2CBJA 4MTVA 5FJOA 4YS1A 3WEZA 4LX4A 1PX3A 1EDQA 2GDVA 2O55A 3SUWA 4I3GA 4NJIA 5F7UA 2ZVIA 3I3BA 4ZOCA 4FI4A 3DFSA 3T2QA 1BYBA 1ZJHA 4FNRA 2QCGA 4IHCA 3RFAA 3KX6A 1BVNP 3ABOA 5CZSA 3TN6A 1W9DM 3R1ZA 3L23A 2FPYA 3DFOA 3F4NA 3EXTA 3UETA 1MVYA 4YJ5A 3VKDA 1J6PA 3B9NA 1MW3A 7PTDA 2Y85A 2QCNA 1M6JA 1JG9A 3UXAA 4X61A 4R88A 4AC1X 3QV7A 5L9FA 1UD4A 5LIXX 4UNIA 4IMEA 4C6NA 2DFAA 1B3XA 2AL2A 4GXPA 3EDEA 1WZLA 4LYQA 1FWFC 4X63A 1JDFA 3TYEA 4LVGA 1TWSA 4L6OA 5C54A 2FZBA 3MKKA 1ISWA 3GXTA 1V7AA 3H53A 3LLDA 2ON3A 3M0XA 1LL4A 2VXNA 4ZE5A 3V5CA 3S9YA 3CPRA 1Q7ZA 2ATMA 4AUBA 1E6XM 2NWSA 1BFNA 3OPSA 3WMBA 3E02A 4HN8A 1Q63A 3EPNA 1VJZA 1WOBA 3U7VA 3WF4A 1KGUA 5HNNA 2O9TA 4LH8A 4AIBA 1JI1A 1XJBA 3W7QA 1SSGA 3E3HA 4PUEA 3UCDA 3VGBA 5E0KA 2E9BA 3K8MA 1PIFA 3UPMA 4CD5A 2PWDA 1YQ2A 3CQJA 4Q8TA 1REQA 1UR1A 3B04A 4LBSA 3EPMA 2IKGA 2V67A 4AIEA 3GC4A 3WELA 2ZIDA 4CEXC 2O7QA 1O95A 4DO5A 2DPEA 3GNOA 3MJYA 3ARWA 2DZBA 1LWHA 1KM4A 1PTDA 3WIJA 3EOOA 1UHVA 5LIUX 2P1FA 3B9AA 5XIAA 1KD0A 1F73A 1TR1A 2VR4A 4E4UA 1W1A1 1I75A 1V02E 4N0RA 1XSIA 4YL2A 2JALA 4C6FA 1XGDA 4AWTA 3SSJA 2JGYA 2ICSA 3UWUA 3WF0A 1OD0A 1XYFA 1E4LA 1ITCA 3WN6A 3DGBA 2EEXA 3TTQA 1WUFA 2A7NA 4XB3A 2Q3OA 3WBXA 1Z8AA 3OW1A 4AFYA 3NO3A 1E43A 3N11A 3DG7A 2WYSA 4LUSA 3WJXA 5CXPA 1Q6DA 4LYPA 2CYGA 4UZSA 3OBKA 3GYCA 2DIJA 2I9UA 3CHVA 1NWSA 3M1ZA 1QW8A 1GG1A 2GJRA 1QASA 1UJPA 4JX5A 2V5LA 3KW3A 3MUXA 2V38A 1OCBA 4K1GA 2VFFA 3KS5A 3PUDA 1J0HA 1M68A 4QG9A 2PRMA 4NU7A 1GVOA 1LM1A 3GH5A 1E9ZB 2P50A 1J96A 4IL2A 3TP4A 3S5SA 2Y8VA 3NQEA 3KBMA 4PTNA 1MXGA 2HK1A 2PCQA 2ABAA 2BG5A 3QPEA 1Y8BA 3N2XA 4TXEA 3CHCA 1VH7A 3TSBA 5FACA 3K30A 3OVRA 4TR9A 4D6IA 2QUVA 1YKWA 2RGMA 2RAGA 3W1PA 4H41A 1L6SA 4RZ6A 4DIAA 1NWTA 2G3IA 4MWAE 3ITGA 1PHQA 2H9AA 4AY8A 1M7OA 3KL3A 1M7PA 2D24A 4RE0A 4ZOEA 1AK5A 4FO4A 5BU9A 2GGGA 2J7GA 4FXRA 3WO8A 3REQB 5BYWA 2OWWA 4WKAA 4Q8UA 4XZ9A 1NIUA 1UR3M 4O28A 3W72A 3NQMA 2G3MA 2XIMA 2DZAA 3W87A 1YRRA 3UJRA 3CL8A 1AJ2A 1UA3A 1GTHA 4DX3A 4DI8A 3JR2A 2ZWZA 3KCLA 2BOGX 4WJXA 3WNMA 1US0A 3D46A 1E6ZA 3CNYA 2GUUA 2A5HA 5D8WA 2ZUMA 5E0CA 4LUTA 1E6RA 3UQNA 2Y88A 4HKPA 2B7PA 3C0QA 3ZOAA 1Q6EA 4Q7IA 3P8IA 4X0VA 3GE7A 3AS3A 3RM9A 4AZ7A 4N6EA 2QDDA 1ADSA 1RPXA 4RZ4A 4Q4OA 1FWEC 3R79A 1X39A 4K7YA 1A0EA 4KBXA 5LA2A 4JTGA 3QY8A 4LCSA 2CETA 3ALFA 1TELA 2TODA 2DY3A 5I00A 3AS2A 3FJLA 3TN4A 2OKOA 3DN5A 3TWAA 3O7UA 4DXKA 4LCQA 1EJUC 3LBCA 2WBKA 4V15A 2DVXA 3LLXA 3C52A 4LAUA 3NGJA 5FJPA 2ZWYA 2VX6A 1GQLA 1FWGC 3SUTA 2W0UA 3MMDA 4OT7A 2GVJA 4P7LA 5CC7A 4DNHA 4IMFA 3TJLA 3BVJA 4Q4SA 3PJXA 4XVEA 3PJWA 2VENA 1AJZA 4NZ1A 4QSHA 5A8MA 5LA1A 3GR8A 5A8NA 3BOXA 3T4WA 2W6RA 1CGYA 5DMMA 4Z0JA 1J11A 2NSXA 2NVCA 3CHEA 1S39A 4NAFB 5FJUA 2PPGA 5HXMA 3LV6A 5DT5A 4Y9AA 4H19A 4A35A 4WSKA 3Q2DA 4H6KA 5CG7A 3OIHA 4GUGA 1ZAJA 1BRLB 1X6LA 3ZT7A 4S3DA 2BASA 2NUXA 3VNIA 3FNDA 1MUMA 2YL8A 4AZCB 4C91A 1OF8A 3OQ8A 1TWDA 2DT0A 5AHLA 2V6AA 1H3GA 3RITA 3W71A 1SPQA 3WCZA 1QFEA 4U33A 3ME3A 3TQKA 4CD8A 4Q4RA 5EYWA 1B3OA 3NO1A 1C91A 5I7GA 4IFKB 4XKYA 3BSGA 2ZZ4A 2UY3A 3CZGA 3G1YA 1Z41A 3H7RA 3L2MA 1OM0A 3MHUA 5LKYA 3QF0A 4J28A 7ODCA 5LYRA 2E8YA 1Q2SA 2CBUA 3IS4A 4I90A 4JN7A 2C8NA 1MSSA 1A5MC 3APTA 3SIZA 2OZ3A 2ZZ6A 2D73A 4AEFA 4IOTA 3NVDA 2VCCA 2DSUA 4J7RA 2XN1A 5F1VA 3GTHA 4TU1A 3VIGA 5BWAA 1CTNA 4UR8A 1XLAA 1GQNA 4IQEA 3HQ1A 3U57A 3M47A 3UY8A 4D71A 3LRKA 4RNJA 5IDIA 3P6LA 3GK0A 2G37A 4B16A 1R30A 1CB2A 3JZEA 1U1JA 3G6MA 5LIWX 1C3FA 3QR3A 1XICA 1GCYA 4NQ1A 1ZQ5A 3ARQA 1IQ8A 3APYA 3KL0A 4C65A 3EEZA 2UZ9A 2WNWA 2RDWA 1K9DA 4EXAA 3TV8A 1VHCA 3IANA 3I65A 3KTCA 2JBMA 5DXYA 1W1YA 5FEPA 3G1VA 4KRUA 1U1UA 4F48A 3H6OA 1E4NA 1DHPA 1GWJA 1R3SA 3BMWA 3N17A 2E68A 3LLFA 3WBYA 2Z6JA 3VD9A 2Z2AA 3PSWA 3P60A 4B92A 1DKWA 3WNPA 4JICA 1SO4A 4GA8A 4HNCA 4ZE4A 4GVFA 2QVNA 5D05A 5F4WA 4XAYA 1WUEA 2CLMA 4HMNA 2XWEA 4JN6A 2BWGA 1OT1A 3KP1A 3P7YA 3FK4A 1IHIA 3ZLFA 1XSKA 4S39A 1MW2A 1PE1A 1XW8A 3NPWA 4AMAA 1S1RA 3L0KA 1RBLA 3H4WA 3PBVA 4UMBA 2ZRZA 2VR5A 5KTLA 2YOCA 4FNQA 1FRBA 3ZJKA 4MHBA 3TR2A 1UKPA 2CLKA 1XS2A 4UTJA 1W5OA 4PRRA 3EWYA 1LCOA 1ITXA 4B5VA 1CYGA 5FSEC 1R9ZA 3ONBA 3KZSA 3RRAA 5ABHA 1MXDA 3BSMA 3SQSA 4FPSA 4AZ6A 2Y70A 1FCBA 1VPXA 2B0MA 4MNJA 4EP8C 1QI4A 4CNUA 4M7TA 3CUJA 3WF2A 4PUNA 3I7QA 2GJPA 4KEZA 3BCDA 4IPNB 1ONRA 3W01A 1MRQA 2P53A 4PCFA 3BG9A 2I1OA 3WLKX 2CZVA 3PVFA 3GXFA 1ZBWA 3UXIA 4DEFA 3IVTA 3SN4A 3QN3A 1P6CA 3G1SA 3O8AA 3O9NA 4ZQPA 3NCOA 2PWUA 3DHFA 4M6QA 4P8VA 4V33A 2VEFA 3W1QA 5DQPA 4OV4A 1O5QA 2VURA 2J4GA 3LM3A 5CZ0A 4ZB5A 1UOZA 1TZ9A 3S46A 3CV2A 3ZR6A 1IWAA 5I3KA 3LTPA 2E6AA 4DVOA 4UNLA 3CGTA 3R43A 4K68A 4LVFA 5C2XA 4MAZA 1ZJIA 2HS8A 2YCEA 4C60A 1B4KA 2YL5A 4IJRA 3F5KA 4MNLA 3AISA 3M5YA 3WD4A 4MOZA 4LAMA 3MZNA 3VFCA 3H12A 3CQKA 3CT7A 3O0KA 2C1HA 4U5KA 3NXFA 5K4XA 1EPVA 4FNPA 3GU9A 3GW0A 4DYKA 3PP7A 2GQ3A 3FFSA 1VJSA 3H4XA 3M9YA 3URQA 3MHFA 1XF0A 1EFZA 3FVDA 4Z42C 1V0KA 4IFRA 3H2FA 2CU0A 5JXQA 2VJXA 3DU0A 2VNCA 2X1UA 2GGJA 1TPEA 3IWPA 4OUIA 4BCEA 3D47A 4PB3A 4GYPA 4Y90A 1C90A 1TWIA 4Q7NA 2YGYA 3AUJA 1I1WA 4AIUA 4M8UA 4JNYA 3SY5A 1YDVA 1EJXC 2FGLA 1FKWA 4RDZA 2KX9A 2PF8A 1RXOB