1Z32X

Structure-function relationships in human salivary alpha-amylase: role of aromatic residues
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENMNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Salivary alpha-amylase
publication title Structure-function relationships in human salivary alpha-amylase: Role of aromatic residues
rcsb
source organism Homo sapiens
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2005-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00128 Alpha-amylase Alpha amylase, catalytic domain
X PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1z32X02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1z32X01
1TR1A 4EAMA 3N17A 2D0GA 3PZUA 2FGZA 2W92A 3LXCA 3DX4A 1XV8A 1V6XA 2VQTA 3TOPA 2QLYA 1BYAA 2WMKA 2YL8A 3LPFA 4ZXLA 4H8HA 4BZYA 5FOOA 4AWEA 2E40A 4H8UA 3M46A 4MNMA 2DT3A 2PI6A 2ALWA 2WSPA 2OWWA 1R46A 2J7HA 3BAIA 2YA0A 3DX3A 4AIUA 3PZVA 1KCLA 1J11A 1V0LA 2XTKA 1DEDA 5CPSA 3JUGA 2J47A 4J3TA 1G0CA 1RP9A 1W9XA 3AHZA 2DH2A 3CZLA 4U3AA 5DT7A 2EADA 3SCPA 1Q6EA 1OIMA 3IJ9A 3AS0A 4JFVA 3CMJA 2QV4A 3HN3A 3IK2A 1E0XA 1BAGA 3ARUA 4V27A 1JD7A 4HU8A 2J79A 3ZOAA 3W53A 3BAJA 4PMQA 1XD0A 1CXKA 1T0OA 2WHKA 4Z2LA 4IM4A 4ZE4A 5A2AA 1BVNP 3VM5A 3BUDA 1H0IA 3VTRA 5CG0A 2PC8A 1XC6A 4AEFA 2W61A 1KFWA 4FK9A 2WVVB 1EHNA 5D9OA 1OWQA 3RM9A 3OGSA 4Z2KA 4HMCA 1AQ0A 5A1AA 3GNOA 4WKAA 4FNSA 1QI0A 1JDAA 4M82A 1E9LA 2ZX8A 3WH7A 4FLQA 4W88A 2WVVA 3FW6A 3ARWA 4E8CA 3T2QA 3UG4A 2V5DA 1V3MA 1D3CA 1W9DM 4OGZA 4Q7NA 4AZ7A 1UR0A 2VCCA 2ZUNA 1UH2A 2JF6A 1B3VA 1HKKA 5CXPA 3WNNA 2BY3A 3TTOA 1XD1A 3EJSA 3BLKA 1HKJA 3WMSA 5CJ5A 4NI3A 3VD3A 1GW1A 4XV0A 5DMYA 3VGFA 3NSXA 1JGIA 1ITXA 4F9DA 3O9NA 5EMYA 3CV5A 3WDJA 2BVTA 3VIHA 2CCRA 1AMYA 1QI2A 2OSYA 2ZXBA 1UR8A 4MNKA 4DWSA 3D4YA 2UY2A 1G1YA 1GJUA 3A4AA 3N13A 1KCKA 4ATLA 2XGBA 4KRUA 4AIEA 3DYPA 1W3JA 3OLIA 3DYMA 3PZTA 2W5FA 4FNTA 2FYVA 2Q8XA 2VX5A 2UY3A 2A3CA 3B9AA 5ECUA 1KGWA 4MDOA 5IFTA 1SZNA 1IZKA 2C0HA 3WL1A 5LA2A 4U5IA 3H53A 1W32A 4TVCA 1ODUA 4FNUA 3AHYA 2EBNA 3U7VA 1JYNA 1PX3A 3MUIA 5ABGA 1TA3A 1S46A 1EO5A 3GTNA 1EDQA 1E56A 4MAZA 3E1F1 5BXRA 4AZIA 3VIPA 3BAYA 2BY1A 2WANA 3MUY1 4B15A 4PTMA 1XCXA 2BVYA 4HU0A 4HZ8A 1DWGM 2ZUSA 5F7UA 2EJ1A 1E4NA 3GBDA 5CZKA 3G6LA 2MANA 1C93A 2FHFA 4QP0A 4TVDA 3WEMA 3WD4A 1GJWA 1H2JA 1PZ2A 2D23A 4UFKA 3CH9A 4BQ3A 3BCFA 3BMVA 1VIWA 3U5UA 5A8NA 1G01A 2F1AA 4MADA 1Q4NX 1TQVA 4PMNA 4E4PA 3W28A 2XJ7A 3AQUA 3BVTA 3LRKA 5FD0A 1UH3A 8CGTA 2CESA 1V02A 3APGA 2GJRA 4M56A 3BUBA 3CHEA 1LG1A 1KXVA 1B31A 1W1VA 3HZ3A 2JE8A 4NXKA 1CGTA 2WVTA 4LYPA 3SEPA 2JIWA 4XZWA 3OIHA 2VNCA 4UZSA 1H0GA 1UD4A 4NXSA 1YQ2A 3SCTA 2WWCA 1A3HA 1C8QA 3NDYA 1E5JA 4UFHA 3ZMRA 3L4YA 3EDJA 4FNPA 2GVYA 1OINA 2ZOXA 1OT1A 2ZUUA 4TX6A 3AFBA 4TTGA 3CUHA 5BROA 4WSJA 2EXOA 2XFFA 1UKPA 4AD1A 2VURA 5A8QA 3VIJA 3MUAA 4UOZA 4AYGA 3K8KA 1GHRA 4PTWA 6A3HA 4D72A 2YIHA 2F61A 1CPUA 2EQDA 1QNRA 3ARVA 3BVUA 1EQPA 4RL3A 3ZT5A 3A21A 2VO5A 1HJSA 4HZ6A 2XVGA 3GDBA 3L2MA 5GQBA 2VC9A 4ACYA 4Z2JA 2DPEA 2DGAA 3LXAA 3CGTA 2WMJA 5EB8A 3SCRA 2XVPA 2DSVA 5C71A 1V08A 1MQPA 1BPLB 1Q6CA 2F7QA 2YBUA 4HA4A 3EJPA 2XYLA 2DSUA 3WDPP 1RPKA 4UNIA 1HJXA 2W63A 1J0KA 1VJZA 3VX0A 2VRKA 3UEQA 3WH6A 4W5ZA 2WC3A 2ZUVA 1C8XA 2J7FA 3L4XA 3ZJKA 1JFXA 1JYXA 4PRWA 2FHBA 4NZCA 4F79A 5TD4A 2O9TA 4PSRA 3KEHA 1UH4A 1E4IA 6TAAA 2E0PA 1C8YA 5AY7A 3WFZA 3QOMA 1XSIA 3WUGA 4M8UA 1EDGA 3CUJA 1ZB5A 2OLHA 3VVGA 1KBKA 3MMWA 1E0WA 1UD2A 1WCGA 4ZFMA 3FHAA 5BXPA 4W8BA 3SUUA 4PYSA 3PHAA 3WY2A 1UYQA 1ISVA 4FLRA 1UD6A 1HVXA 4UOQA 2VVNA 1PZ3A 2DT0A 4CU7A 3WQWA 5E70A 3WH9A 1VRXA 2C8NA 1QNOA 3RCNA 4AYSA 2GSJA 3D52A 3N11A 5E0CA 1CGYA 2DT2A 2NSXA 1HIZA 2CXGA 4CVWA 1TCMA 4QCEA 3EBVA 1NM9A 3VD4A 1WO2A 1V6WA 4AD0A 2E9LA 3OA5A 3BUQA 3BVWA 3AIBA 1J0HA 4UFJA 4TTUA 5CPTA 1R85A 1CXHA 4H8VA 1PPIA 5ABEA 3WMBA 4U2YA 3RIKA 3QHNA 2GDVA 1WNOA 3VGHA 3FAXA 1MQRA 1RD6A 3AIUA 3GH7A 4C7GA 2NW0A 2E9MA 5CSYA 2PWEA 2BHUA 1UKQA 1WPCA 1O7AA 2WM0A 3DX0A 5E6YA 2DSKA 4KGJA 5A2BA 4OOZA 1FHDA 4MB5A 1K6AA 4XUYA 3AXIA 3OG2A 2PBGA 3HG3A 4F66A 4JFSA 4JFWA 4R27A 1FFQA 3WN6A 2WVUA 3ZR5A 1TG7A 2J7BA 5A2CA 5A8PA 1AQHA 3W0KA 4M29A 3WDRA 2F18A 1KWGA 3BLBA 3BAWA 4AD5A 1TQTA 3VKKA 2X2YA 4W84A 1UKTA 3T09A 1QW8A 3ZSSA 2XN2A 1V0NA 4JCLA 2AMGA 1NP0A 4D6EA 3MSDA 4GQRA 4DUVA 2ZE0A 1NP2A 4OUEA 4U5KA 4W87A 5EFFA 3NDZA 7CGTA 1ISZA 2WHMA 2BHYA 4HMDA 4JHOA 3UCQA 2BV9A 2QMKA 5CQ1A 1TQWA 2J4GA 3AHVA 1HXKA 1VFMA 1PEZA 3IAQA 3K8MA 5BRPA 2J7GA 4JAWA 3CUFA 2PB1A 4GPNA 1OSEA 4D6JA 3CZEA 1HTYA 1JD9A 3IJ8A 2WKGA 2G4FA 3LPOA 4NZJA 2GK1B 1OGGA 4BQ5A 1NH6A 4BQ2A 3WKZA 3MUZ1 2EPLX 1CLVA 4E8DA 1KR1A 2WBKA 2GK1A 2CYGA 3EJQA 2D73A 1D2KA 2WK2A 5E09A 3W26A 1CXEA 1E1EA 1E72M 1Q6DA 1WZLA 3ARYA 2D2OA 3D51A 1XYFA 1NWRA 1TVPA 3D3AA 1JZ7A 3WNPA 3UG5A 1IT0A 3DDGA 1CBGA 3QOKA 2JIEA 5A6SA 4P8UA 4PMRA 3WUEA 4BCEA 2XWDA 2WLYA 4HTYA 1HP4A 3CZ8A 1UWQA 1DWHM 1V03A 3AS3A 3DX2A 1HJWA 2J7EA 4C7DA 1H11A 2Y24A 3LXBA 2WMGA 4URIA 4UQAA 4EE9A 2D0FA 2Z1KA 3MSGA 2WHLA 5I23A 3U57A 1W2PA 2X0HA 5E9AA 5BYWA 3EDFA 3SCOA 2J75A 2Y2WA 5JBEA 1F4HA 2XHYA 2VCBA 4RE2A 3WIJA 4LXFA 3SURA 3KLLA 1V0KA 2CBVA 1GOKA 1WAWA 2FDMA 3TTSA 2W91A 4PBGA 2Y8VA 1ZU8A 2CNCA 3W24A 1Q6GA 1WKYA 2XVNA 3VIGA 2WYSA 3CZSA 3VO0A 1HL8A 1KGXA 3A22A 2XUCA 5I77A 3W37A 1B3XA 1R33A 5A8MA 4MJ2A 1WZMA 3UG3A 4JZ5A 1E43A 3MU7A 4FNQA 4HP5A 2CERA 1R34A 3BC9A 1CGVA 4IPNB 1E1FA 3S5YA 5E6ZA 5I24A 4CVUA 3WUBA 2VRJA 3ARXA 3AI0A 3VGGA 2CBJA 4GZIA 1UOKA 1H09A 2X2IA 1ESWA 2J62A 1G94A 3O2LA 3ZIZA 3D4ZA 2WBGA 2EPOA 2ZWZA 4BQ4A 2UY4A 3M6DA 5DT5A 1ISYA 2XGIA 1JF5A 3LX9A 2CEQA 2QHAA 3AMCA 4A3YA 1C91A 3NSMA 3L4TA 3VDBA 2E3ZA 2ZICA 1CLXA 3CC1A 4OBRA 3TTQA 2IXUA 2WC4A 4IPLA 4JL1A 1E4LA 1PX8A 2RGMA 3IAPA 4P7LA 2XVLA 4J3XA 5HPOA 5I6SA 2ZXQA 4DO4A 2Y8KA 4QDMA 1TUXA 3II1A 3KL5A 2B31A 3SCQA 3OGVA 3FNDA 2VL4A 4GXPA 2OW6A 3MMDA 1F4AA 3WNMA 4TX8A 1BG9A 1D7FA 1ZBWA 4B16A 3EJTA 4JHZA 1J18A 1WZKA 1B2YA 4W85A 4V2XA 3GYCA 1BQCA 1LWJA 3VGDA 4W5UA 2EPNA 3CUGA 1UZ4A 4ZEPA 1VFOA 4CGTA 2QMJA 1PX4A 4PTXA 3ZJ8A 3UERA 3SCVA 2O9PA 4X0VA 3VSVA 3VIIA 5JBFA 2PBOA 3VNYA 2PWHA 5DF0A 1B3YA 1U2YA 2D1ZA 4E2OA 1NOFA 1TMQA 1XH0A 1JYWA 3B9DA 3DECA 4W89A 3BSHA 2J74A 5BWFA 4D6DA 1UD8A 1CDGA 1C3FA 3ZR6A 4W86A 1JI2A 3WY3A 5EBAA 3AISA 1QVBA 3K4DA 3OBAA 3W6MA 1GVIA 4OKDA 3T2PA 2DT1A 2E8ZA 2BHZA 5HDRA 2DIEA 4DWSB 5JIWA 1W3KA 3NYDA 4R5EA 2PWGA 2DSWA 2WZIA 1XH1A 4PEEA 5BRQA 1NWSA 2CBUA 4DUWA 1VEPA 2QPUA 5D4YA 1VB9A 4FLSA 1H4PA 3BXWA 3ZJ7A 1E73M 4DM1A 4PMVA 3WQVA 3HG4A 5JUVA 4B9YA 1MW1A 1FFRA 3VD9A 3TONA 2J8FA 4GQQA 4N0RA 2ZX9A 4LX4A 1E71M 3MO4A 1TA3B 2EEXA 3AMLA 3RJYA 5A95A 2FGLA 3F5LA 3VIKA 1J0IA 1HVQA 1JNEA 2FHCA 4WIWA 4AZBA 1MFVA 3WQ5A 2V38A 9CGTA 3FXYA 1QNQA 1GOMA 3BAXA 1E6XM 1W91A 3RJXA 5AC5A 3RDKA 5CLWA 1HKMA 3BMWA 3WDIA 4MNLA 3UR8A 4J3WA 1UG6A 1BG4A 5GNYA 2V3GA 2A3BA 3ZO9A 1E70M 2J7CA 3VX1A 3HG2A 1CXFA 3AZRA 1P6WA 1LL6A 2DEPA 3DYOA 3U7BA 1TFVA 3AIQA 1UWSA 3DX1A 2YDSA 4ZXOA 2XN0A 4KRTA 1UR9A 2D3NA 3A4XA 4X0NA 2VT0A 1CENA 1E40A 1FOBA 3QHOA 4NSBA 1CECA 1NOUA 1EQCA 1R87A 2XPKA 2Y4SA 1OM0A 4PN2A 1BF2A 3WEZA 4W8AA 3VINA 3CLWA 3NSNA 4P7RA 2XVKA 2OW7A 3AHXA 4LYRA 1O7DC 5I78A 4LGXA 3PZNA 4AZCB 3GZAA 3AOFA 1XSJA 1TE1A 3EJRA 1W2VA 3T2OA 2YL6A 1CTNA 3KZSA 4MB1A 1UA7A 4AZCA 1ZL1A 2X0YA 3DHUA 2PF0A 3AXXA 3TA9A 1E3XA 3AJ7A 4XZBA 3SUSA 3ZJ6A 3HMCA 5E1QA 1E0VA 4PMDA 1OBAA 4CD7A 4AMCA 3MI6A 1GOWA 2VTFA 1W9BM 1MW3A 1YHTA 4P8VA 3GXPA 3VGBA 3M7SA 1V3IA 1GPFA 5D9NA 3S5ZA 1G5AA 1EOKA 3VM7A 4CN4A 2YDQA 4ML4A 1QHOA 1XYZA 1WDPA 1DTUA 1DHKA 2O9OA 4HMEA 3AROA 1XGZA 4HZ7A 1LQ0A 5M03A 1ZJAA 2YOCA 4AD3A 3D50A 2G3NA 3WBAA 1VEOA 1BVZA 4J28A 5A94A 3UETA 4OBSA 1LL7A 4JKLA 1FA2A 3F5JA 2V5CA 5FKYA 3SUWA 3GXNA 2YL5A 3BLPX 1MQQA 1MW2A 3AIEA 1V02E 5IXEA 1VBUA 4TVUA 1M03A 2VX7A 3VD5A 1SFSA 1OT2A 2J8GA 2ZX7A 2YBTA 5I3DA 1LJYA 1XCWA 3W82A 2XFYA 3L4WA 3LRLA 3CO4A 4CCEA 4P7OA 2FE0A 1RP8A 1PJ9A 1EH9A 3CIVA 1W3HA 4Z2HA 1FH7A 1V3JA 3BVXA 3J7HA 5JBDA 1ZBKA 4XB3A 2XIBA 5FL1A 3TTYA 4CD8A 1MFUA 4UQ9A 1JF6A 1MWOA 4KWUA 3PZMA 3VPLA 4GI9A 3LMYA 3BGAA 5ABFB 3BH4A 1SR0A 3K8LA 2YLAA 3MMUA 1KBBA 4NF7A 4WSKA 1E6ZA 4MAVA 1RH9A 1HKIA 1UQYA 3WFLA 4LPCA 5ABFA 1GZJA 3K46A 4W8LA 2IXVA 1KB3A 3NIYA 1JZ3A 1GOIA 2OSXA 4UQCA 3GXIA 1XH2A 3RILA 1GUVA 5A3HA 6CGTA 1IZJA 2CPUA 4D6GA 1OB0A 4EKJA 3T0BA 1AVAA 2QF8A 3CMGA 1UA3A 1O6IA 1JZ4A 2F1BA 4UFMA 1GOQA 1UWIA 4KH2A 5D9PA 4UQEA 4AEEA 1A47A 3VDCA 2BNJA 2GUYA 3VDHA 3OZOA 4CU6A 2CITA 1ZBCA 1B9ZA 1Z32X 1HT6A 3K4AA 4D1JA 1BSIA 1DP0A 4H04A 3A4WA 3PZQA 1R47A 2VX4A 2VRQA 1UR1A 3H54A 2X1IA 2NT1A 5AYIA 1CGXA 3GXDA 1NOWA 1BLIA 4HOXA 3VMPA 2GJPA 4BF7A 2WB5A 1BFNA 1AQMA 5I0DA 2OSWA 2DIJA 2WCGA 1KXTA 3GNRA 3SCUA 2J25A 2YFOA 3VNZA 1WB0A 1DWIM 1KTBA 4ZENA 1I75A 4DO6A 3TP4A 2E9BA 1CIUA 1JI1A 4U31A 4S3KA 1OD8A 3CTTA 3ZQ9A 1HWWA 3RM4A 2F7RA 1VF8A 3WD1A 2CHNA 1KGUA 5IDIA 3CPUA 5A6AA 2W66A 5A6BA 2BVDA 4QLKA 3SCWA 5FCZA 2GJXB 3PZOA 2WMIB 1CZ1A 1E15A 2C7FA 2DQXA 3MV11 1R7AA 4C7FA 1QNPA 1HJVA 1V3HA 2GJXA 3A6OA 3WNKA 1JL8A 3AIWA 2WMIA 3T0AA 3AMKA 5CGMA 4JCMA 1E55A 1W9UA 2OYKA 3DHPA 4IISA 3CUIA 2GFTA 1MYRA 2UY5A 5CPQA 3WH5A 4B9ZA 3WY1A 2X2JA 5CSUA 3K1DA 3PTKA 1DWAM 4OJYA 3CZJA 1V0MA 3RO8A 2VCAA 4X9YA 1DWFM 4YPJA 1WP6A 1OIFA 3WSUA 1UASA 4PMUA 2J77A 2DH3A 4CCDA 3DDFA 1J10A 3VUPA 2ESCA 1GORA 2O9RA 1CYGA 1OGBA 3VOCA 3CZGA 1R8LA 3ARZA 2JFEX 5BXTA 2JEQA 4W7UA 4QAWA 1K9TA 2PWDA 4AMXA 2BY2A 4FMVA 1R7OA 2J7DA 1SMDA 4PTVA 1G9HA 3HJEA 4F9JA 4HPHA 4UQBA 2FH8A 3OLGA 3WF0A 3WF4A 1HF6A 4LYQA 1X1NA 4CN1A 1GQKA 3THDA 2A3AA 2OWXA 2WPGA 3F5KA 5CLTA 2DSZA 3AYRA 1JFHA 4U3CA 1E6SM 2V3FA 1R86A 1QBBA 1UHVA 4UFIA 1J0ZA 1C7SA 4TOQA 3IGUA 3FY1A 4OZOA 2BXZA 4M81A 1HNYA 1GONA 3KL0A 3PBGA 4MDPA 3MS8A 3BUIA 3WQ4A 2EAEA 2YA1A 1JXKA 3A3HA 4MJ4A 3ARPA 3WDQA 4DUXA 3UESA 4KGLA 3PZ9A 1UR2A 2WNWA 1QHPA 2E4TA 3LPPA 2WSKA 2F7OA 4AXNA 4MTVA 3GH5A 2G3IA 3AMDA 5HXMA 2XSBA 1QW9A 1VAHA 4QLJA 4CD5A 4FNRA 3WF3A 2WZEA 4W7WA 1UQZA 4B3LA 1ODZA 1XHGA 1CGWA 4LQ1A 4PMOA 2JEPA 3B8SA 3VGEA 1HX0A 1SMAA 2WVSA 3A24A 5HOSA 2XIIA 1W3LA 4DO5A 3WENA 1W1YA 3IANA 1H41A 1JG9A 3AZSA 1DWJM 4DM2A 1KXHA 1JIBA 4ATWA 1JZ6A 4MNJA 4HPGA 1KTCA 4YHGA 1PS3A 1NWUA 4WKHA 2VR4A 2ZUTA 1GQLA 1GQIA 5E0FA 2HISA 3RPMA 3WD3A 1TVNA 2XM1A 5IHRA 4WF7A 2VZUA 4UOJA 1UD5A 2WXDM 4H7VA 4JIEA 2G3MA 4GZJA 4H2CA 1M7XA 3SCNA 1PIFA 3HU7A 3L4VA 4D6CA 2D20A 5FIPA 2V3DA 2UWFA 1V3LA 1V6VA 2GDUA 2VOTA 2A3HA 3RMEA 3VMOA 2IUZA 4GIAA 1NARA 4WKFA 3WQ6A 1L0PA 1FH8A 4L4PA 2VI0A 1VJSA 1CEOA 5GPRA 1WDRA 1UKOA 3QGVA 5BXSA 4D6FA 4CU8A 4PCTA 5A6BD 4OIFA 1GQJA 1I1XA 2OYMA 2ZIDA 2EACA 3CHCA 3FN9A 3VIOA 2EABA 1W9PA 2ZUMA 4P7QA 1BYDA 4ACZB 4AD2A 2X09A 1W1TA 3MANA 1UWRA 1QWUA 3WEOA 4WLCA 3CBWA 1UZ1A 4ACZA 1J0JA 5EFDA 3POHA 1NWTA 4F8XA 1US3A 3ZM8A 1GOOA 3CHDA 4NRRA 4GZEA 4AISA 1M04A 2F7PA 1JZ8A 3T08A 1VBRA 2CKRA 5HNNA 3OGRA 4UZUA 1E5NA 1BYCA 1E6PA 1FHLA 3F4VA 1SYTA 1GVYA 3RM8A 3VILA 1C90A 3PTQA 2JF7A 4AC1X 2TAAA 1J0YA 1EA9C 3AIVA 3THCA 4Z2IA 1C92A 1LLOA 1H5VA 3OZPA 4ATDA 1QNSA 3EMQA 1WZAA 2X8RA 1EIBA 4K68A 1N82A 3OB8A 1BHGA 1JDCA 1J9YA 5LA0A 1TQUA 1JAKA 5GNXA 2RGLA 1PAMA 2XN1A 4AIOA 4A4AA 3I3EA 1X6NA 3ALGA 3BSGA 2HVMA 3HG5A 3I3BA 5D8ZA 5A6KA 1ZS2A 3WELA 4JFTA 3AS1A 5GNZA 4H41A 1HXJA 3EMZA 3AZTA 2BFGA 2YKKA 5DO8A 1CXLA 4J3UA 3FHQA 2WMHA 3WF1A 1MW0A 1W1PA 3WDHA 1KWKA 1E6RA 3I3DA 2D24A 3SIMA 1ZBVA 1KXQA 3AS2A 2D0HA 1LF1A 2VZTA 2QPSA 4HA3A 3W38A 2D3LA 2CETA 3WY4A 4CKQA 2EPMX 4XX6A 2VZOA 1KQZA 1B30A 3UR7A 4PMYA 1LG2A 2VMFA 4PMZA 5I5RA 1B3WA 4GI6A 3W81A 1L8NA 3KE0A 1K9DA 5C70A 4AZHA 5IHSA 1TQSA 1BTCA 4GO9A 1Y7VA 5I79A 3W6LA 1UKSA 4GINA 4UFLA 1ITCA 1B3ZA 2WW5A 2WMFA 4W93A 3W27A 1UD3A 3OLEA 4RE4A 3B9EA 4JKMA 4IUGA 3W29A 2VX6A 2IGTA 5A8OA 4J3SA 3LPGA 1CWYA 4ZE5A 2YDRA 4M80A 1K9EA 4TXEA 2OWCA 5DFAA 1M01A 1V6YA 4EANA 3GXTA 4HOWA 3A47A 4DWSC 4MB3A 4PCSA 1Q6FA 1UUQA 3KLKA 3G6MA 4AY1A 4KMQA 1HP5A 2YLLA 1ISXA 1MXDA 1E3ZA 1EOMA 3VIMA 3U5YA 5AYBA 3MKKA 1J12A 1X6LA 5A69A 2G8ZA 1EGZA 3O6AA 3W25A 2VJXA 1HJUA 4FF5A 1OCQA 3NUKA 2XSAA 3ARRA 1QHZA 4PUDA 3N12A 4D71A 3A23A 1W9VA 3PZGA 3GXFA 4NX0A 3VU2A 3WMCA 4CUCA 2AAAA 3VMNA 3WF2A 3BCDA 2A3EA 2WCSA 1QI3A 1NQ6A 5KEZA 2YJQA 2WLZA 2PWFA 1ECEA 4MPKA 4P8XA 1QPKA 5HBFA 1BYBA 1BGGA 4CCCA 3KWXA 3ZSTA 2X05A 3S2CA 1U30A 3WL0A 3PTMA 2WC7A 2JALA 1E6NA 5JIPA 1U33A 1HN1A 2F2HA 2VZSA 7A3HA 1WE5A 4UTFA 1B90A 1KR0A 2XWEA 2WCAA 3H55A 2W67A 1LWHA 4Z2GA 4UQDA 4YHEA 3PN8A 5KZ6A 5IFPA 1FP8A 2VQUA 3VD7A 2F8QA 2O92A 3CZKA 1EO7A 1V3KA 2ZXDA 2CKSA 4DWSD 1JNDA 3VIFA 2YFNA 5DEZA 3GNPA 3OLDA 2EO7A 3ARQA 3CHFA 4J27A 3GXMA 3ECQA 4V28A 1JYVA 1QI4A 3AICA 2J78A 1E4MM 3GBEA 4RE3A 5ABHA 2G3JA 3AYSA 3WH8A 3AXHA 3KL3A 4D1IA 2VZVA 3L4ZA 4N42A 4WK9A 2CBIA 1B1YA 2W4XA 1CNVA 2YA2A 4PUEA 4EK7A 4UCFA 2XM2A 3ARTA 4TUFA 4B3KA 1WDSA 5A6JA 4BA0A 2Z1SA 3MV01 5CGTA 3NJ3A 3L2LA 4GO8A 5FL0A 3VSUA 4P7NA 2XFRA 1GCYA 1C7TA 4GI8A 1ZJBA 5C8BB 3EYPA 3GM8A 3M07A 4GKLA 2ZXAA 4U2ZA 4OOUA 3NCOA 4PMXA 4U33A 4CD4A 4L4OA 1B0IA 1ISWA 1QWNA 4JL2A 3PZIA 2VUYA 3N9KA 1CGUA 1HL9A 5HPCA 4NRSA 3POCA 1EHAA 3D5HA 2E8YA 1J01A 4W7VA 3IJ7A 4AZ6A 2VR5A 3SUVA 1UR4A 4JKKA 1UWUA 4AW7A 3N1AA 4AMWA 3ALFA 3EDDA 1JZ5A 3BUPA 4JFUA 3S6TA 2BS9A 3WBEA 4Q22A 3WUFA 5M5DA 3QR3A 2WZHA 3N15A 4UR9A 2ZUWA 1GNXA 3VSTA 1GHSA 4M1RA 4CN6A 1E6QM 3L4UA 1QOXA 2W62A 5D9MA 1MXGA 3WD0A 4HOZA 3TV8A 2FH6A 5AC4A 2ZX5A 1K9FA 1VFFA 1MVYA 4J7RA 1H3GA 5I2UA 8A3HA 2ZWYA 4QFUA 4Y7EA 1I1WA 2OYLA 2BXYA 1EDTA 1QI5A 4A3HA 7TAAA 2WKLA 3EDKA 1US2A 4CD6A 3N04A 4YN5A 1QX1A 2AOSA 5LYRA 2ZX6A 3EJUA 3WNLA 5A6MA 1XSKA 1V6UA 2WWDA 3AHTA 1M53A 2CIPA 1OD0A 2XG9A 1JAEA 4QLLA 2WHJA 4MB4A 3T0DA 4QCFA 2NT0A 1KQYA 4J3VA 1VEMA 3SCSA 3BVVA 5M3WA 2DDXA 1FP9A 1EXPA 1JXJA 1XRVA 4AD4A 3ZT6A 4BS0A 1BGAA 3LRMA 2VVSA 1PIGA 3WNOA 4FLOA 1UWTA 1H49A 2WAGA 1LL4A 4NZFA 3DC0A 3W4RA 1FH9A 2D22A 3CZNA 5A6LA 3AIRA 1QBAA 4S3JA 4D6IA 4PSPA 2EPKX 3WD2A 3EMCA 4AZ5A 3ARSA 1PBGA 3FAWA 1VENA 2CHOA 1WDQA 1H1NA 1VFUA 5M17A 3GH4A 3N18A 4P8WA 1R75A 2V3EA 3A5VA 4D6HA 1IV8A 2G41A 1TZ7A 1JDDA 2X2HA 3ZT7A 1HJQA 1OGSA 4HA1A 3VDAA 2Y5EA 2YL9A 3BAKA 3AMGA 5BCAA 3QHMA 4AZGA 5LA1A 2BY0A 3SUTA 3EDEA 1CXIA 1JZ2A 4M24A 4WJXA 5D8WA 3WQ8A
chains in the Genus database with same CATH superfamily
2FGZA 3D9AH 3QEHA 3PYCA 5G5IA 1TLKA 3DUSB 2WBJB 1W3TA 2DS4A 4HV8B 5E8PB 4NQ1A 4H01A 4G6JH 3EAKA 1SM9A 3QIWD 4OZGB 4DZ5A 2J7HA 4LL9A 5F7YC 2EG7A 4B9JA 1SO5A 3JUGA 4Q4RA 5I26A 5CINH 2B1OA 3L5AA 4NHCL 2X44D 3E8UH 4JFQB 1CK0H 3IJ9A 4ZTOH 5FF7A 4J3OF 4W81A 1ZSDB 4O28A 5IMLA 4FFYH 1FWNA 2W0FA 1J9TA 5D2LA 2V0AA 2W61A 4OZHF 2HDJA 4DJEC 1E51A 3FMGL 4IIFA 4WKAA 2FDSA 3MRHA 3F4NA 4DELA 2ZX8A 5C09A 4W88A 3BQ6A 1F61A 2FMNA 4YK4B 5B4MC 3DG6A 4NAQA 43C9B 1BZ9B 1UH2A 4TSCH 3QUYC 3PFUA 1B2WH 2LABA 2VW4A 4QY8A 1XF2A 3SRHA 3LZQA 1T89C 3HFMH 3U36B 5KANI 3C60C 4JNYA 4X7TB 3L8QA 4YHYC 3VIHA 5H94A 2IS7A 4PRIB 5CJXA 3U0PA 4OKVB 3GPSA 2PABA 25C8L 3ZWTA 3AQDA 3NJVA 2EC9U 3V7AE 4XT1C 5FAJA 4F5CE 4LPTA 3EX3A 2DWYA 5LA2A 4ZFFA 4YDLB 4TYUA 4GKOA 4C6MA 1XDJA 2OMZB 3AGWA 2YGVA 5F4XA 4DT2A 5K4XA 5SX5K 1TTBA 4IL2A 4UNTA 5FDYA 1OWWA 2OR8A 2DLGA 1A80A 4RGMB 3EXTA 2MANA 3PXLA 3K81A 1YY9C 2VGGA 5LHEA 3FU8A 1TQVA 3APCA 2PKDA 3FBKA 5FA3A 1V02A 4UTWA 3ME0A 4M56A 4GXUN 4PY7A 1NCJA 2XN9D 1INEH 3V6OA 2W0KA 3G1SA 1RFDL 2I9LA 1P0DA 2JKTM 2O61B 4YHLH 1X5LA 4HX1A 2FSDA 2GVYA 3H70A 2O5XH 2NUXA 3AFBA 4ZW6A 1U58A 4Y5VA 3HRPA 1P0KA 3APTA 3ARVA 2XZQH 1HK6A 2VLJA 2PDWA 3CZFB 2OKOA 3JUZA 4ZS7L 3LXAA 2ICES 1TE6A 5I1LB 2M2DA 5D7SL 2UVEA 4ADGA 1BPLB 2Z4TA 3QUZD 5D96B 2DSUA 3WQDA 1F02I 1BYNA 2W63A 2FGBA 5I28A 1NOAA 2EEAA 3SRKA 3TO2B 3GMRA 2ZPKH 3LNMA 2YZ1A 3U25A 5DJ8B 5CCGE 5AVVB 4F79A 3LCGA 4F2BA 2R1NA 3PM6A 4NP9A 1P5UB 4WRLA 2E3VA 3FRUA 4JN1L 2VH5H 4JTRA 4W8BA 2BS71 3DXAB 4GRLC 5DMGD 4UOQA 3NSCA 2H3NA 3N3EA 1VKXA 2G5UA 3CD4A 5F8RC 2FR4B 1HYRC 3WJWA 4IS6B 2X9YA 4DI8A 4LCWE 5AKRA 2V2WA 3D07A 3ZMNA 3BVWA 5J5RA 4XMKL 4NNPH 4DCQB 5EF3A 1TSHA 1RD6A 4FI6A 1AXSA 5DS1A 4A3UA 3SO5A 1MHHA 1RZ8A 3EF4A 4Q4QA 2IV8A 1ZVNA 4PGZA 3QZWB 4AUBA 4F66A 2DWEB 4CL7A 4DRSA 3ATZA 3RVTC 3X12B 4FP8H 3H6JA 3WDRA 2PPEA 2WOYA 3QDME 1U83A 4MWFA 4IIZA 5D8JH 4RIRA 2QCNA 3QBUA 1OQFA 1XUUA 1GTNA 4WUUE 4U5KA 1NCDH 2EKSA 4YR6B 4Q6KA 1YZZA 4AIZA 3CUFA 1KLGA 5HI4C 5EMMA 4FGMA 4BE5A 4GG6B 1WBXA 3MV7E 4E0RB 3UWEA 2GAZB 4KZDH 3DUGA 2A9ML 1K6QL 3PAJA 5D2NE 2Y7QA 4F2ME 2YJLA 5KVEH 1R38A 4E2VA 2AF2A 5LXVA 4X9SA 3KWWB 1NPNA 1I8JA 3TW7A 3UG5A 1AW5A 4RISL 2XOTA 3ZHNA 3UTZB 1F3DH 2E9GA 1DWHM 4MD4B 3MTRA 3AS3A 5KN5B 1J5CA 3GSOA 1H8OA 1H11A 4LC8A 3MSGA 5EPDA 5I23A 1KPUA 3NCXA 5JIQA 5BYWA 2J75A 3DX8A 3OJMB 3I6KA 5JQ6L 4X5WA 3D09A 1XCTB 1KBIA 2QKIC 4Q9RH 3MV8B 1QQDB 1Y0LB 4Y16D 4JMXA 1DE5A 1K5NA 4JO3L 4KFMA 2Y23A 1KN4H 2R56L 3CQ0A 5G55A 2Q02A 3WJLA 3QDJA 2NSQA 2OZ4H 1GS7A 1R2SA 5B39B 3U0WH 2DF3A 3EO1A 2X4PA 5T3XL 2IH3B 3EOLA 3GE7A 4H00A 1BWWA 1UM4H 4QRSA 1OXYA 3ITOA 4O8AA 2WW8A 2X2IA 2J62A 3OR6B 2GSIA 2WBGA 4XKMA 3SKJL 5E23A 4PYGA 2VDPL 4J3OC 3T4AA 3NSMA 3VDBA 2NQZA 1PHWA 4K0OA 4X6DA 4J12A 2IXUA 3H23A 3MT1A 4G56A 4N0UB 1W5OA 1M71A 1WGVA 5LNVA 3VFPB 3TF7C 3V0UA 1A5KC 5D2LB 1H15A 1MJ7H 3V9CA 1BG9A 5C9JB 3UTQA 5EO0A 4WI2A 2F8XC 4LT7A 3TA3B 3D0AA 1KIUA 2HUEA 1Z9NA 4Z76A 3KBFA 4W5UA 3SSZA 3CL7A 1YY8A 5GZNC 1QPQA 4ZEPA 4C1NA 4B5TA 4QXUL 2YAPA 4Z42C 3W02A 1BSLA 4FC3E 3QXWA 4L4TE 3X13A 1JPGA 4QY8B 2HPMA 5D1QA 1HUVA 2ATKB 3MXWH 2ABAA 4CQBA 7XIMA 2J74A 4ZG1A 5BWFA 2AK4E 4AIBA 5AECA 2WXQA 1DE6A 4ONHB 3IWUA 4H0GA 3B83A 5H94B 2Z4GA 3K4DA 5AOMA 3FULA 3E02A 3U0PB 4P46D 5JDSA 3LZOA 3COOA 3RFZC 2P8CA 4A35A 3P4NA 5KSAC 3MGOA 2CU9A 2DLEA 1RIHL 1MCWM 2ZRZA 4ZFFB 1UCBL 3TONA 2W38A 1OKEA 4N0RA 1PB0A 4AITA 3QQ4A 1EX5A 3SZ6A 2ROXA 3CFDA 3N0AA 4XNBA 1IXPA 4UOW1 2ARJA 3BW9A 1U41A 3GR8A 2FHCA 4WIWA 4FFWD 4RRPG 3QJHA 4G6AD 3VRIA 1MFVA 1LRQA 2WQAA 1E42A 1P0BA 1CVSC 1LMIA 5EY5A 5E1HB 3LV6A 1VPOL 3KX6A 3TWCH 3RDKA 4C1LA 3F62A 4RAVB 3LGGA 1NLDL 2J7CA 3HG2A 4LEXL 1X5JA 1LL6A 3CCHB 1ZS8A 4LNRA 3D0LB 4GMTL 5FA3B 3ME0B 4NPKA 3NEHA 3DOSA 1BD2E 3QHOA 1N7MH 2PGEA 1EQCA 1XEDA 4F7TB 4W8AA 2ITCB 4ENZA 1EMTH 2IAND 3O63A 3SQOH 4LGXA 3VNDA 4AZCB 2OMNA 4HX1B 3QTGA 2MPVA 1MNUH 3T2OA 4ZT1A 3HR5A 4P05A 1QR1B 4XZBA 3HMCA 1U58B 4CC0A 4Y5VB 4PGEA 4NJ9L 1MW3A 5CKAA 4R7VA 1D5IH 4B92A 1V3IA 5IQ9A 4FFZH 5IFAL 1CFVL 4R7LA 5C3LD 4R7DA 2PP3A 2BWQA 1J1OL 1OGAA 4HJJH 4HZ7A 3ZE0E 1OANA 4WFHD 2E6DA 3OZLA 1EP1A 3DFNA 4S1SL 4Y5YA 2ESVA 3MJ7A 3WBAA 1NCBH 4EN3C 1BXAA 1MW2A 1EFXA 2MTPA 1N6QH 3GMRB 3GUTA 4HNNA 2WB1A 3DTDA 1XCWA 1OYBA 1NF0A 3NMEA 2F6UA 3EFDL 1ZA3A 5FJRA 6FABH 4NZDA 3L4WA 4OAWB 1TETL 4NQDE 2AEOA 1GC1C 3K4ZA 3QEQB 3W7PA 3UQNA 5ADOH 5L8JB 3U1SL 4GQGA 3LD8C 1NC2D 1S9WA 3BPOC 1LDSA 5E8NB 5CD5C 2X3BA 4E36A 3CSPA 3VXQA 1U93B 4WHTA 2V2HA 2KH2B 4G8FB 4R85A 1A5FH 2HNHA 4W8LA 4WU5A 3RA7L 2X1TA 2YD6A 2OX5B 3U2ZA 2R9HC 5SWSB 6CGTA 2E1WA 4R7JA 1OB0A 4Y19B 3NL2A 3N50A 3QXBA 1EWHA 5E99H 1O6IA 5DVKA 4D2NA 3PFMA 3S3SA 1AXSB 4YJZL 2GOUA 5TQ2H 3OKKA 4G7SB 1B0RA 3PE9A 3VDHA 4PJ8B 4D7BA 3KS0H 1G7HA 4CU6A 3T6QC 2F5AL 3IARA 5C7ZA 4BY3A 3T44A 2AJYL 2MPAH 1BSIA 3ZVVA 2Q6WA 2D31B 3PZQA 1UP3A 4XVSL 3FUFA 3M1CA 3RQ3A 1KV7A 1DR9A 2AGJH 2GJPA 1AO7A 1MI3A 3CX5J 1EVUA 2XH0A 1P9MA 4AM0A 4LIQH 4ZQCA 1DZ0A 3T0XA 4HC1L 4MPQA 1JI1A 4MA7L 2GC4C 2PU1A 3BDYH 1WBXB 1ZHKA 3WD1A 4A2HA 1FKXA 5DZAA 2BVDA 4UT6H 2JGYA 3AUJA 1UWGH 3GSUB 3QZPA 2ZA3A 2QSCL 2QZQA 2GJXA 2YXXA 1JL8A 3NIGF 4UTCA 2MH4A 4LSPL 2J56A 2NY0D 2G96A 1QD0A 5I1KH 3WH5A 1D2OA 4Y0GA 4ADSA 1VSCA 3GSOB 4O51B 1V0MA 3KM2A 3QIWC 4YPJA 1H3XA 1OIFA 3I9PA 4XNYH 3LDVA 1WGOA 3GSWB 1I4NA 3UCCA 1Y1UA 1UG9A 2ACRA 3DBXA 3ARZA 3Q5OA 4XOCA 5L2KB 3N6YA 2R9RA 1K9TA 4PB3A 2DQCH 1QT1A 2PWDA 3LVEA 1L3WA 1SMDA 3B7YA 2CSPA 2PLMA 1NDVA 3P4LA 1K5NB 4UQBA 4ZQMA 1X1NA 2K7PA 4V1XA 1T5XA 1EPFA 1BP3B 2WPGA 5E8EB 4CSZA 3QDJB 2XRAH 2WXOA 3IIVA 4QLWA 5AB1A 3FY1A 1RK7A 3SPVB 3T3PF 3MYJA 1OD9A 5FM4A 2HFGL 4LS2A 4B96A 1MCJA 4GY1A 2X89A 4AEOA 2GSIB 1TTAA 1FE8L 4WV1B 2W07A 4WW2C 4OB5L 4R7OA 2FX8L 5JZ7D 1FBIH 2ZZ1A 4K7PL 2BG5A 2XSBA 4NKQB 1Z6KA 3IPFA 1BQHG 5M94B 3JTBA 4QF1A 1WIOA 2XTJE 3I9GL 4JDEB 1CZ8L 1DWJM 2GK0A 2KBGA 3SPJA 3FOLB 1E9QB 3W2LA 3UTQB 2VDRH 1F6KA 5EO0B 1KIUB 1RK1A 4AMAA 2AKMA 1YY8B 2WYIA 2FYYA 5C07E 1I8LA 4POZD 4OLUL 4YLWA 4Y1TA 4UTUA 1RUAL 5LDSA 5I82A 1RVFL 4HUVB 2VZ1A 2IUZA 2WBXA 1JPGB 3N2XA 5KYUA 4R7NA 1UKOA 1IKFH 5DWPA 4A7UA 5BXSA 5D1QB 5HYSA 4CU8A 5I1CL 3HI5H 3TVMB 5HSFA 1I1XA 3ZTJH 5I1JL 4H1LG 1KM0A 3IN0A 1B0GA 3FIGA 3LH2H 3URQA 1E1CA 1CLKA 1KLZA 4PB0L 3UC2A 3PAYA 3DOIA 4UNUA 1CI3M 5IOKA 4F58H 2NMSA 3F4VA 4UTJA 3MGOB 1GVYA 1HQTA 1KELL 5H4ZA 4AVKA 4AC1X 1EA9C 1T83A 3THCA 1C16B 1QNSA 1YECL 1FL6A 1XIWD 1JDCA 3BW9B 4XMZA 4CVXA 1J9YA 1HL4A 3IETA 3VRIB 3I3EA 2EH8L 5ESAB 2Q2EB 4G8AC 1X7QA 3LTSA 5JXQA 5A6KA 4N8VA 1JFQL 3WF1A 2ZCLL 3WDHA 3DTXA 1SBSH 3ERPA 3NH7H 2G0LA 3P69A 5KVFH 4ZQTA 4HA3A 3W38A 1Q6OA 2A7NA 1EEZB 4AFYA 4ZS7H 3QUZC 3CS2A 4JPKL 3TT1L 4ETYA 4WR3A 3E74A 4LEBA 1TQSA 5I79A 3W6LA 1UKSA 3K2UL 3BHBA 5PAZA 5D7KD 1NGZA 3R0DA 3UWWA 2XYBA 4Y9OA 5GS0L 4M7JL 4H0LC 1MIEL 3BPLB 5F2FA 1ACYL 4NI8A 1A25A 5DMGC 3UZQA 3HNVH 3DX9A 4F3HA 3CBRA 2ESVB 3MJ7B 4K38A 4XAWL 3EBGA 3HS9A 1MQKH 3FYPA 3SDDD 3UVIA 1W1ZA 1AGBB 1OF0A 1EFXB 1CE1H 4FF5A 4KROB 1JRCA 1FZOB 2B5IC 3QSRA 1VFLA 4S10A 3A23A 1HWHB 4B41A 4HZMA 4NX0A 1ZLSL 5HR7A 3O11B 5GRXG 4XO7A 5C3TA 1NQ6A 5HUPA 2PP7A 3L3JA 4NYYA 3QWRA 1S9WB 4OHQA 4OWGA 2X05A 5HMFA 4RGOL 3QRHA 3VXQB 4X98B 1HILB 2DMBA 1LO2L 3TC6A 3SGDH 3GSNH 2VLKD 1KR0A 4WU5B 1J5TA 1PKQE 4IOIB 2J21A 5GHWL 2F54E 2WTRA 2MOVA 4EX4A 3GNPA 3JVAA 1YDYA 4PW9A 3TBTA 1PL3A 3CXDH 4GUIA 5KINA 5LBVA 2G3JA 3AFLA 2Q86A 2H8PB 3L4ZA 4N42A 1L4IA 2XWBA 3QJFA 3GIZL 4X2PA 5EA0L 3L2LA 4M3HA 3V55A 1LO4L 3HPZA 4HS6B 1IGFH 4GI8A 2PRMA 5F7MC 4AM0B 3GB6A 1IGWA 5CCHE 3CWGA 5JPNA 3MLXH 5T3ZE 1ISWA 4JL2A 5DI8B 1KIQA 3C2AL 3ROOA 3I6LD 5I1EL 2OLDA 2E5EA 1OAQL 3NQVA 2CDGB 5C2BL 1UR4A 4Y16C 2ZOOA 5CBEA 3FQWB 1R3IH 4LEFA 4UIOA 3T0ED 1PY0A 3HHRB 1UPMB 3QR3A 1W0VB 1R5IB 4NO0D 3OG4B 3L23A 2Y85A 1GHSA 3O6YX 2GC7C 4PAZA 2HXAA 3B8IA 1NL0L 1CF8H 2NW3B 4Y7OC 1CLCA 1Z42A 5T3XH 2NUYA 5IM7B 2YUVA 3VXOB 4HBKA 2B7PA 2IQ9H 2AOSA 2R59A 3JWDC 2EP6A 3SQLA 3WNLA 3ETBF 3RPDA 1L6XA 3ASOB 4G8IA 4MB4A 3R5EA 4AAJA 2VDPH 9RUBA 4M9PA 4OLXH 2IDCA 4O12A 1RBAA 1BEYH 4TNWF 3B43A 1T5XB 1TZGH 4KKCD 3ZY7A 2DIKA 3U7YH 1UWTA 1GKOA 4EDWL 4G71B 2ONEA 5A6LA 3IXTA 2VFEA 3MYJB 3FO0L 4PSPA 1WCBB 2HLFD 3FO1B 2YSTA 4HK5A 1FNFA 2AEPH 2WLLB 3N18A 4D6HA 1LNUB 4B91A 3TMQA 3MRNA 5M1TA 1LEGA 4JQIH 5D37A 3CPRA 1JZ2A 4XRCB 2CKNA 3HO8A 1SXZA 5ICZB 1TR1A 3STZB 1Y6NR 3ZL1A 2VQTA 2QLYA 4C6JA 2WMKA 4ORIA 2X41A 2ADGB 4N7QA 4JK0D 4P46C 4MNMA 5MI0C 1WWAX 4NCC1 4JY4A 1X98A 1EJ8A 1JNHA 2H90A 5IHBA 4PFMA 1L9PA 1RK1B 4GUGA 1SYSB 4AUYA 2RDWA 5F6IB 1UBSA 1IMHC 2EADA 1KCWA 3SCPA 3ZDZE 1E0XA 2PR4H 3VQLA 1G0XA 4G6AC 3UJIH 5GRYA 5HYSB 5FGCE 1EP2A 4A22A 1B0GB 3QCUH 4ZFOB 1P2CA 1R30A 4LGPB 1NUGA 1RULH 3W7QA 1F2JA 1NIDA 2YC1A 2QQNL 5E7FA 3LEPA 2GITA 2H9GA 1K4HA 3PJSB 2YZRA 3QZAA 3FW6A 1CVRA 1C9DA 1TB3A 3G22A 2MKWA 4B3EA 4AWSA 4K37A 1FQ0A 1RA5A 2ZUNA 3OP2A 3TTOA 2QR0A 1KV8A 1ZPLA 1NDGA 4OQ1A 3MPGA 1FL6B 1E9ZB 1IEQA 2IDUA 1CL7I 5EMYA 3MKCA 1W5PA 4TU1A 3U2IA 3IETB 1THCA 2BVTA 1QI2A 5LN4A 2ZXBA 3HQOA 1X7QB 1B57A 3GSRA 2R2BA 4N8VB 4W4OA 3G0SA 2FVKA 2L04A 4Y7MA 5AVRB 5DGRA 1KGWA 2C0HA 3S3JA 4AT6A 1JYNA 3MRFB 1PX3A 2WWNA 3PNZA 1EDQA 3Q4DA 5CG7A 1KM4A 4J39A 2PN5A 4AC4A 4BZ2L 3S4TA 6TIMA 2F5BH 2DQHL 2R23B 4GSUA 3NDOA 2GBTA 3BHBB 4IG2A 1XGYL 3BI9X 1G0YR 5GGTL 3KDMA 3IGKA 1ILUA 1OFDA 3GFXA 3TN3A 2P28B 3RBSA 4MADA 2DU2A 5EDXA 2C3VA 4HK3J 1G9NC 5BU6A 2P8MB 4TS6A 4WI3A 8CGTA 2VABA 3L9BA 4DVRH 1B31A 4Z7UE 1WH0A 3C60D 4BFNA 3DX6B 4DH2A 4PJ7E 4PULA 3L4YA 4QE1A 4TUOA 2ZUUA 4B90A 4WVRA 3QMRA 2WQRA 4RDVA 4PJGA 3A12A 2AV1A 3AALA 1RD5A 2CBPA 3PSWA 1VHPA 4XB8A 3ZT5A 3FFCD 2CIKA 3WHXA 3NQCA 3L3JB 4EZMA 5ENWB 2AP2A 4M6MH 1YUHA 1KEGL 3OKNA 3QJXA 1I3UA 1J0KA 1X44A 4AGLA 2GJ6D 4L8BB 3R8BB 3DIPA 1P7QB 4J1OA 3C6LA 1MCQA 2H3DA 1FVCA 1WYIA 4PRWA 2FHBA 3WAJA 5BUGA 3QV6A 5SWQA 4HEME 3HN8A 3O7UA 1OC6A 3WLOA 1T22A 4HC1H 4ZFMA 2L8AA 2Z34A 4PYSA 4CNTA 1ZTMA 4NJJA 2IPFA 4X2RA 3WLKX 4YGVA 4L65A 3C09B 5B22A 2EDKA 1ZHLA 2EZ0D 1H6UA 2ADFL 2NY0C 3VD4A 5C0AE 5TPWL 3KLAB 4CADB 4F7CA 4XBJA 3RIKA 2H5UA 1JN6A 2E9MA 2NY4D 2GEEA 4KGJA 3CNKA 3B8VA 4R90H 3IVSA 3ROOB 1JUEA 4F27A 4PMEA 2XFXA 3E3HA 3VOFA 5ANME 1GRWA 2XQYK 4HPYH 3RLUA 1EXGA 4AENB 3MREB 4M29A 3T09A 1QW8A 1V0NA 4GAJH 3LENA 2RDUA 3DGGA 1B4RA 43CAB 5EFFA 2NYYD 4RVBA 1ISZA 4L4VD 5I76B 4Y9MA 4IPPA 3U0TA 4CQDA 1T5WA 2AV7B 1TOXA 3FB8A 1CBJA 1X5AA 2SEBA 5DJ6B 5AW1B 1CB7B 2EPLX 5JZ7C 1Z5YD 3T78A 2W9MA 2WWKT 4G8IB 2WK2A 4R4BB 1PG7W 1NMCC 2AJZB 2VD8A 5HJLA 1NCGA 3HC4L 5C0BA 3SO7A 1NANH 2D03L 2PDHA 3AXLA 4QHLA 3JBG7 3O6FD 4X83A 4LCRA 2EDNA 3SGZA 3MKVA 4MDIA 5LAXB 4MWAD 4HPNA 2O0TA 3FUEA 2FB4L 4AYFA 1CZ8H 1RZMA 3FU7B 3HAEH 4CJ0A 3BPNB 3VI3A 3GC3A 3F7JA 4ECLA 4I8DA 5E9AA 4S1RL 4UIKH 2RFXA 4OIIH 4XK2A 3VSQA 1FZJB 3VKDA 3UTTE 1Z8AA 3MBED 4I3SL 2ZG1A 1T2QL 4JQXA 4OGYH 1XUZA 3GLZA 1DKWA 1WC7B 2IFFH 4FOKA 3W37A 1OGTB 3GVVA 1YXYA 4F9PC 2QGBA 4MJ2A 2DW7A 4BGLA 1WZMA 1UWXK 4HUUB 4S39A 4WHCA 3NSJA 3H6AA 4WK4B 3WUBA 2WXGA 2IO5A 7TIMA 1JNHB 1G94A 1HC1A 3D85D 3Q1SH 5C0IA 1ICTA 3JUYA 2UY4A 1C5CH 3VNLA 4X6CE 3R1ZA 3VD0A 5IFJA 1X96A 3ZXAC 1XIWC 2B4CH 4K7PY 2RGMA 2DVTA 2WZAA 2B3IA 4WUKL 3KVQA 2KMWA 4CQCA 1CDYA 5ADPL 3W5MA 1Z9SB 2KUTA 4UTTC 5DJXA 1D7KA 4HISA 5TE7L 1J4EA 3HS0C 3U9UB 2EPHA 1JFQH 1UZ4A 4MNGB 3G3MA 1I7UA 5D38A 2OYPA 5B8CA 3MXVL 3U7WL 4OCSH 1KLYA 2YMOA 4QITA 1T6VN 4HHWA 1UM6H 1NDGB 1XH0A 1JYWA 4PWIA 1MY5A 4MAUH 2QV5A 1JVKA 1UD8A 1D5MA 3J07A 5SWZD 1SDDA 2O4QA 4LAOA 3U9IA 4LDOB 4AE1A 1RI8A 4HCFA 3UFYA 2DT1A 5AAWA 4C58B 4U6VH 1HE8A 5HYEA 4GBXA 1FGVH 2R2BB 3P5ZA 5DJAA 3REQA 3MLZL 4JE0A 4BK9A 3MWCA 1L9RA 5ABZA 1YXDA 4XWUA 4F0HA 3CBJB 4A6YL 3ES6B 4LAKA 3WS6A 3IK4A 3PWAA 4PYHA 1ZP4A 4K9EL 3MACH 4RGND 4J4PD 3RR1A 3SDDC 3OQEA 3E6HB 3QQXA 1FG2B 2HVOA 3TYGL 4JRYA 4G6CA 4MZIA 1VLWA 5GRVL 4PTDA 4X4KA 1QRKA 3TYUA 3CHOA 3QV9A 1QBLH 3JW7A 3F6IA 4E9WA 1F86A 3BVDB 2V9DA 4UV4L 4RX0A 4NWTH 4DKTA 1QCWA 3LCLA 1KN2L 3W7CA 5I1HH 3AZRA 1IM9B 1KPRA 3C4UA 4DZ8B 5GS3A 1R3JB 1JK9B 3US0A 1CT8A 1I7RB 3DX1A 4K5NA 4WGWB 1FOBA 4NENA 3GHTA 4PN2A 2XZCL 3GNML 4EPDC 3TCEA 4Z0SA 1RR2A 2OG9A 1UENA 4NC1E 3WIFA 1ZTXL 4QRRA 2X0YA 3RY6A 1RLWA 3UFIA 1H6FA 4K8RD 4PJGB 3KPQA 4P8VA 3AG3B 1JZGA 3M16A 1D5BB 3PV6B 4PMFA 5KSAD 3CIXA 4YXHL 2CIKB 3NFSL 4ODVH 4G83A 4FE9A 3NQEA 1TCDA 4DLFA 1W8OA 1NQBA 1VQTA 1VEOA 1R19A 4J28A 3OKNB 4NT0A 4OBSA 1LL7A 1KG0A 2J66A 2PTTB 2DKSA 4QHPA 1X9RA 1G4MA 4IBSA 4KVNH 2CK0L 5CP3H 1WXJA 3OR7A 3C6LB 1L7TH 1XRTA 3FUDA 1PWLA 4LV9A 5KETA 4JRXD 3W82A 4RV8A 1CC3A 1JPMA 1PJ9A 2PDYA 1IC5H 2YS4A 5EORL 4ZW8A 5AUMB 5JOPE 1USQA 4P2RD 5HD8D 5E8DH 5JMOC 5ABFB 3T0EC 4XVJL 2VXQH 1QAPA 1E8ZA 2WUBL 5KBKA 5DWUL 5KOMC 3MRLB 2OSXA 1C8VA 5AOLA 3NRQA 2OCCB 2AAVA 1OB1B 3MY9A 5D1XC 2NQCA 3OJVC 3QZ6A 5LBGA 4D6GA 2GPZA 2BVUA 2DMGA 1GJIA 2ALAA 4H8WH 4X6BA 3VG9C 1Q45A 3F8UB 1NBYA 5IM51 2AXGA 3EUDA 3MC0A 4G8GA 1WAEA 2H9AA 5K7JA 1XBRA 2R2HA 2BNJA 2NX1A 1TKKA 5C3IA 3D08A 4Z6AT 1TR9A 2XV0A 3ME3A 4GCAA 4RDWA 3NACH 3NL5A 4KY2A 4IBTA 2EVJA 1EHKB 4FTVE 1U8LB 4IUOA 1R47A 1XGPB 4KKCC 4EI5A 2V2TA 4MJZA 1EZUA 4Z7NF 3HMXH 3U0TB 1CD1A 2CGYA 3WEXB 3WN5C 1UW9A 5EG6C 4P2QA 4QYOA 1QSVA 1KM3A 4GQ9H 5CPNA 4R96A 2YD1A 3CTTA 3TYEA 5CD5D 5A16B 2XXGA 1I7ZA 3T2NL 5FCZA 2DN7A 2I1OA 4H26A 1KB5B 4IRJD 2DQXA 5C0BB 3PJLA 3AXLB 2P49B 4QHLB 4Z0XA 1U8IB 2RHGA 4JCMA 3TJXA 1FPTL 1W9UA 4IISA 2GFTA 5BRZE 2DVXA 4M1GL 3N40F 4YYFA 4IMLA 5C0CE 4KCWA 4MXWL 2CRMA 3VI3B 3WFHB 1US0A 2ITDB 4XNAA 3UJJL 3VOCA 1HH9B 3GBLA 8TIMA 2OGYA 3O4LD 4D9PA 1R5WA 2P5NA 4RJEA 3S2LA 2A3AA 4YSDA 3CSFA 4FL4B 2PTDA 2OMYA 4UWQB 1KCUL 4R53A 3O05A 4IHCA 1REIA 4M81A 1AL7A 4L80A 1SUHA 2ICEC 1YTDA 2UZPA 3G0UA 4H9ZA 4WGXA 3D12B 4HNUA 5C0IB 3FOMA 1XIIA 3D05A 2WNWA 1QHPA 5GZOD 2F7OA 2OZ3A 2PCYA 1G6CA 3CFCH 3D0VA 3G5XB 2R0ZH 1X3DA 1PWMA 4B3LA 1TFHA 3VGEA 5J8OA 5BV7L 2VWTA 2BZDA 3WENA 1O4UA 2IAMA 4GZ7A 3QRBA 2Z31D 2JCCA 4W70A 3ZHLA 1MAML 5DJXB 3SZKC 1T20A 4DGUA 3DFOA 2L0DA 1I7UB 5FOBB 3RLSA 1EWDA 3BZGA 2A3HA 4HPXA 5FF4A 2VFIA 4CNIA 3ARDB 5BJTA 1WQ5A 1AW2A 5I1IL 2Y7DA 5KSBA 4GUOA 5K39A 1D5MB 2NWSA 1SDDB 1U3HC 1QJWA 1M2VA 1LXMA 3VIOA 4OF5A 3LQMA 3ZBMA 2EINB 1XPYA 1QWUA 2VP8A 1DBJH 4QNEA 3VFTA 1UZ1A 2AHIA 5FF3A 1NWTA 3PDOA 4F8XA 5DJAB 4PY8I 4J35A 3EYVA 2PYED 2CKRA 4AHPA 1XLAA 3IRDA 3DGBA 3RWFA 3VILA 3RNQB 3EYUH 4IX2A 3QDGB 1MY7A 3YPIA 1H5VA 3MGTA 3S8FB 2X8RA 4K68A 3URNA 5CILL 1TQUA 3CK0H 2J9YA 3QVAA 3GINA 3MROB 2AEQL 2PF6A 4QUOA 5FM5O 5HGAA 5K59E 2M26A 5DHVA 5DO8A 3Q9PA 4GPVA 1KPRB 1LQSR 2Z9TA 1LP9B 5CO1A 1OFQA 4Z7VE 4QD2E 3CSYA 3K72A 1EKOA 3NCFB 4S1QL 3W81A 1L8NA 3R8GA 2GYIA 1J1PH 4YNYB 3JZYA 4MBRA 3MUUA 1K9DA 4IOSA 1KCVL 4LSRH 4RFOH 2HG0A 2RGSA 5EYWA 4QRRB 4DN4L 4YVNA 4QDPA 2TRSA 1C5BL 1LDCA 3PCYA 1SGJA 1T7XA 4JFHE 3FCPA 4AY1A 1MOEA 2QEZA 3EA2A 1JCYA 1MCOL 2VW6A 5I73B 1S7SA 3VXRB 5AYBA 3MKKA 1KO0A 1X6LA 7PAZA 2DP3A 1AQ8A 4DZAA 2EZ0C 4HSOA 4L8DA 5KJRL 3RBGA 1S3HA 2OMWA 4YFLF 1QKZH 2JKWA 4QX4A 5EZJB 3LTVA 2XSAA 4LSUL 4GLRI 4EZLA 5GRJH 4D71A 1R3VA 2FTPA 1BQSA 1OX6A 5F8QC 2AAAA 1BZ7B 3VG0L 2NY4C 4CNSA 2W79A 4KMTL 2XZ7A 4KZEH 5HNUA 2PWFA 2A6IA 3WKNA 4P8XA 1BYBA 1CFNB 2IH9A 2CPCA 3FQUB 4LCCB 3BKJL 3Q8AA 4CCCA 5DT1H 2Q9OA 2DMKA 2HEJA 2YK1H 4JTAA 4PR5B 2AXWA 2VITA 4PJIE 1B90A 1TG8A 3NM3A 3A4EA 2NYYC 3E0GA 1CLOL 2BSBA 3II2A 3VNMA 2E7CA 3X11A 1FP8A 2ZRUA 5F9JB 3PHOB 3VD7A 4YVXA 5EU6D 1XIMA 2VDMB 1KFJA 4X6BB 2OJZL 4PZVA 1NBYB 2AXGB 4HJGA 2X0WA 2X70B 4KPHH 4LSTH 1DQIA 4Z3EA 4GP5B 4EAEA 5IVZA 3LV3B 2OFQA 2XLLA 3O6FC 4DJFA 3HC4H 2EYSB 3RX2A 3FXIC 4TUFA 2V2TB 2A7BA 4MWAC 4JZJC 4QR7A 3MB9A 4P7NA 4X4YB 4YIWA 3EADA 4QJ3B 3VGAC 1IM3B 3RLHA 2WXIA 4P2QB 4QYOB 4B5WA 4KS0A 3BDKA 2VUYA 2IW0A 3FT0A 3DTUB 3MBEC 4IOTA 3SUVA 4LF3A 3U4EB 1I7ZB 4HS3A 4F0KA 4AW7A 4XP6H 2WYZA 2WZPD 1Y07A 4H26B 3HLKA 4O0KA 2QCGA 1DQTA 1P1ZB 5M5DA 3GRIA 1T2QH 1MHEA 2YSWA 3L4UA 3K2MC 2YRZA 1MXGA 1AGEB 3T5WA 3UJTL 1B6UA 1O5DT 4GH3A 4UUJA 1YDPB 4IMLB 5J1AA 4LHUB 1QX1A 1ZLWK 4ZMWA 5JPMC 2L7JA 5LYRA 3H1ZA 2WWDA 1CJYA 5I19L 2FEEI 3R10A 2XG9A 1TRIA 2AKRA 1D9KB 2IDFA 2GUBA 3H7BA 5AVZB 3R6IA 1R5WB 4ZX3A 4CA4A 1NFDE 2AJXH 1KV5A 4FLOA 1A3QA 5FGBA 4NZFA 4AEHL 2XUWA 1GAFL 5HYFA 4O02A 4PRPD 1UT2A 3SDYL 4P59H 2F68X 4WEUD 1NAKH 4CBZA 2LW3A 3PAUA 3QHTC 5I6NA 3DUHA 5TE7H 5AB3A 1S9YA 4XOAA 2XKSA 1FCVA 3SY5A 3ZK0A 4DXKA 5F1IA 2WMPA 1HZKA 3KBMA 1M57B 4GUJA 3WFEL 3KBVA 3FJ4A 4AZGA 2HX7A 3QEHB 3U7WH 3KD4A 4KK9D 4OV4A 1UA6L 2FQIA 3DX4A 2EUWA 4ELMF 4HHAA 3G04A 1HWGB 4MDRA 4KKAD 4XE0A 5I2IA 2E40A 3MJ8A 3CQPA 4D8LA 4N87A 2JCCB 1KBLA 4KHTL 2DUAA 1JPSL 1WKFA 5IFHH 1T20B 1E27A 4AK1A 1RP9A 4F15B 2AFNA 1W9XA 2XICA 3MRPA 4WW2F 1A3WA 2PDQA 1VHNA 3W3BA 1UZ6E 1AHKA 2CO7A 3THML 3G5ZA 5F72S 2VDGA 4RGNC 4J4PC 3IK2A 4WO4D 5BJTB 4AL8H 5IMLB 3UZWA 3ZOAA 5HR6A 2W0FB 2PP9A 4HD9A 4HCRH 1T0OA 4ICNA 4LQFH 5KSBB 2LU7A 4IM4A 2HWZL 3QMTA 3RXZA 3TYGH 3F4DA 2APFA 3VXMA 3MRHB 5C09B 4OZIF 5CJBA 1DJYA 3GBNL 3MSRA 2TODA 1FI8C 2ZZ3A 4N0CD 4TQIA 2DI8A 2R69L 1KN2H 1T41A 5LB1A 1W9DM 4HSHA 1XF2B 3H2OA 4RDYA 1IAMA 3U46A 1XZ0A 3WNNA 3R18A 3FTZA 1NGXA 5KVMC 3EJSA 4UM9D 5BNKA 1AHMA 2DZUA 3M0YA 1GW1A 2G5WA 2HXUA 3NK4A 4H5SA 4F9DA 2F8VA 3HPFA 4I5RA 4K8RC 4DWSA 1RPUA 1G1YA 3VC6A 5G2IA 4NQXA 4G6ML 1VLXA 5HGAB 2R1LA 2XGBA 3V9FA 3PDDA 3I68A 2JBMA 5DU7A 5EIQA 2WP3T 3TYFA 1P6BA 1Z9MA 3KP0A 2EVHA 4DI9A 2FZ9A 3N40P 4U5IA 2HTMA 3CVIL 2BGQA 4FXLA 4H9YA 1J9RA 4GBUA 5I30L 1DLFL 2XY2A 2P7TA 3S42A 3LOTA 2VUKA 4P3CH 3B05A 4PJXE 3ESUF 4YDKL 4E3VA 5FFOA 2JB6A 1QSFD 1ZEAH 3W1ZA 2ICWI 1T66D 3RU8H 2FX7L 4PY7B 4XZIA 1EF3A 1GZPA 5BWAA 4K3JH 2I9LB 4YL2A 5HD8C 1XTLA 4X42A 4B9IA 3LHPL 2AJUL 2E6YA 4HIJA 1RIVL 1IJ9A 1G4TA 2Y25A 3DH7A 2ZOXA 3H12A 4QOKE 3RJDA 2FX9L 5A5WA 3W1LA 1ITQA 5EBGA 2DZSA 4BGDA 2VLJB 4ROQA 4AX3A 2PDXA 2NOYA 4UTHA 1PAZA 4CC4A 1A9VA 2K9FB 3GJEA 5EB8A 1G9MC 3PWJA 1YQVL 4FRWA 1A3RL 3U2JA 1WA0X 1KCBA 3I6GA 4QRBA 3GRWA 1GA2A 2VITB 3FKUS 1Z9OA 2WUCH 1JYXA 4NZCA 2G2NA 3X11B 1K8ZA 3FRUB 3M0ZA 2YXWA 3QOMA 1EDGA 2CHZA 2H3NB 3SY0A 3PHAA 1VKXB 4IRJC 1PZ3A 4TQ8A 2DT0A 5E70A 3QORD 3SSJA 5IVZB 3H3PH 2V2WB 4N2FA 2VXNA 4C54A 2CLMA 3DIFA 1CGYA 4XIAA 4BZ1L 5T3ZH 4ZFZA 2QUUA 1E67A 2ENYA 1SM3L 2V2CA 2E9LA 3O41A 1IX2A 4O54A 2OMUA 3KXFD 1CXHA 3CFTA 1S9KC 1IU1A 2WB7A 1MHHB 1RZ8B 3SYOA 3VGHA 1AQFA 1MQRA 1WS7A 4XP5H 1JBJA 1TJ1A 2PBGA 5AHNA 3QZMA 4OT7A 1Q0XL 4MWFB 1MI5E 4LF3B 1B4EA 5CM1A 3QCVH 5IMMA 2HK1A 4RIRB 4K73A 3F12A 1KTLA 4O57A 1ONXA 3LKSA 3A6CH 1RSCA 1HKLH 1YC8A 1MHEB 4XOBA 2EKSB 2AK1H 4ONGH 4CJ1A 4NZ4A 1ILSA 1EJUC 3PF3A 5DURD 4AIZB 1KLGB 7CGTA 4JHOA 2BV9A 3HNTL 3S3CB 2J4GA 4PPTA 1Q9LA 4BFIA 4UUJB 5LBSL 3KBSA 3UH8A 3W0WA 1NMAH 3HI1A 3FYOA 1BVNT 4UBPC 2NX3A 4H19A 4JFPA 2BP8A 2Y7QB 3PU7A 5D03A 4PC8A 4M6AA 4MLRA 5GZOC 1IC4L 1TV5A 3KUMA 3G6JA 4RX4D 4Y6GA 3ZL4L 3N4EA 4XD6A 2WQDA 4N6EA 3F64A 5T5FH 4BR1A 3D51A 4XD5A 1MZHA 4Q6IA 3FLUA 1CBGA 2JIEA 2XWDA 4M6NL 2IH1A 1F8MA 3BIAX 2VO8A 2Z31C 1KPUB 3KVDD 3VYPA 2VD9A 3LNIA 3DX8B 3I6KB 3WLSA 4X5WB 5JUEL 3RCYA 1MCIA 5IKCA 5I16A 5AFDA 1IIIA 4NHCH 4RE2A 2ENPA 5BOPA 2CBVA 1WAWA 5BQ7A 2VWEC 5F1IB 2WMPB 2FDMA 1G1KA 3TTSA 2F53D 3IJ6A 2XWCA 5LGZA 3QZBA 3EO1B 2X4PB 2E7HA 4Y8FA 3TBSA 3STCA 2JTYA 3B0YA 4QRSB 4HHAB 2AGKA 4RAHA 3FMGH 1BQLL 4O11A 3MU7A 4FNQA 3MJ8B 4JGNA 3S5YA 4CRPA 3AI0A 3A5FA 1YEGL 2G5BA 3T4AB 2F84A 3GMQA 1E27B 4C6KA 2C19A 3RVWD 4X6DB 3NP4A 1ZCRA 3MRPB 1Z3GL 2ADIA 2DTML 4QRPD 2CO7B 3G5ZB 5F1UA 1GEQA 4HCHA 2XDHA 1M71B 3W1PA 1GVSA 2LTQB 2AQQA 4ETQA 1SYVA 2C9PA 3BG3A 3W2UA 3LI0A 1H15B 3BLIA 1S7UA 3KL5A 1AANA 3G1RA 4ORGA 3L95A 5CILH 1JK8A 1GYVA 2IF7A 25C8H 4Z76B 4TX8A 5FYKU 4XX1E 2WJZA 3PL6D 2RDTA 4JHZA 1P53A 4V2XA 4C1NB 2NVAA 2OZ0A 1SJXA 3X13B 1WFUA 4DK3A 4HJSA 1OEZW 4UTAA 1XZ0B 4HZLA 2J5LC 4N4QA 1AGFA 1NOFA 5F88A 4W89A 1PCSA 2BTMA 4D6DA 1C3FA 2CUMA 4UXDA 5JDSB 5D7IE 4PTNA 4DWSB 5JIWA 4F48A 5EZIL 5KANG 2V2DA 3C0QA 3P4NB 2G95A 4MLSA 2FL5A 4NILA 3W9EA 4TV6A 3QQ4B 3CFDB 1EXBA 1THAA 4PHXA 1V77A 1RFDH 3VD9A 2ARJB 5SWUA 2Q8LA 4WQOA 3QJHB 3MO4A 4PJHF 5TFSL 4HTBA 1E0UA 3QC5X 4ICCX 1EVTC 2PW1A 4NPYA 2XWTA 1GGUA 3WQ5A 1BZDA 3HZYA 3QCTL 5BOJA 3IRSA 1QFWI 2JB6B 3RRQA 4F0RA 1ZS8B 1BG4A 2GWNA 1MREL 4RK8A 4LNRB 1ZTXE 5GSVA 3DOSB 3AIQA 4LKCA 1IGSA 4N5EC 1UC6A 2YDSA 4RRPM 5D7SH 2MEJB 1GZPB 3I10A 1R3QA 4WAFA 4C60A 4KO9A 2H7WA 3F85A 5F1OB 2QGDA 3B3DA 3GZAA 4I89A 3AOFA 3HR5B 3DVIA 3VVWA 4JTLA 4PGEB 3NPSB 4N2HA 2BZCA 3SUSA 5IQ9B 2XWZA 4AMCA 4GP8B 1GYUA 4DW2L 4R7DB 4JN1H 4H7CA 2DFAA 5HMEA 4JVWA 1OGAB 2PZ0A 1ADOA 4IIHA 3ISRA 4ERIA 3QISA 4Y5YB 3GJEB 1OV8A 1DQQA 1ZJAA 4HWBL 4X7DC 4L7ZA 3GUTB 3F5JA 5JHDE 3VXUD 4GB9A 3BUYA 1ZA3B 3VD5A 4XMKH 3CEPA 5G4EA 1A4MA 4RDQF 4FJ6A 5E2JA 2H26A 3VWJD 2XPZA 1N4XL 3GSVA 3ABOA 4WHTB 3SY0B 3TTYA 4YBLC 4K1GA 1BVWA 3IKKA 3GMOA 1URZA 1YN7A 4NF7A 1VCGA 1L9SA 3VXSD 3WFLA 1GOIA 4BSVA 3DIFB 4PJDA 3KBHE 3SN0A 4ZFZB 3HBGA 1O5PA 2DY2A 4LPUA 3MPCA 2OMUB 3CMGA 4JO5A 3TFCA 3OKKB 4BD4A 4X5LA 1GOQA 1B0RB 3NOYA 1G7HB 2A9MH 1K6QH 1O68A 1SLXA 3N5AA 4N9OB 1NIFA 2R82A 4D2JA 2Q6WB 1BD0A 3F12B 1HEHC 5MHSE 4RISH 5HWJA 4V1DA 2VRQA 1AO7B 3LQZA 3GXDA 4BF7A 2FO8A 5F7HA 3GG7A 4R33A 3IPWA 1OOWA 4N2LA 4B2DD 2B1AL 4OLEA 1NCNA 4BFIB 1GAFH 1PW3A 4DO6A 2JKXA 5E94A 1ZHKB 5F2LA 5JQ6H 4S2BA 2F08A 4FEZA 2WZTA 4NUQA 5J7CC 3CMOL 2A0NA 3SKNA 2NUPA 2GJXB 4JO3H 3QY8A 2R56H 2HK0A 3KRSA 1YRRA 1H7WA 3DROA 1IWBA 3O9WC 1MCBA 4DP0X 4KK9C 1F5ZA 5D1XD 4XCNA 1SF3A 3HFYA 3MNWA 2E7LA 3O1NA 4KKAC 4LVNC 5K3VA 4U4IA 1FHGA 1U3ZA 3F7LA 1H9DA 3C2OA 3DBXB 3RUGE 3SKJH 3CASA 3HE7D 4H20L 4OV5A 2A4ZA 4FFTA 3BH8A 3DV4A 4XN5A 3KPOA 2J7DA 1PZAA 4WO4C 5C2GA 1VZHA 2XC8A 4HYVA 4MFEA 3QUML 4LS1A 4EWJA 4EAYA 1M4KA 2VGBA 5FYJU 1TV3A 5F44A 3MVTA 1U8MA 3QPXL 3IGUA 4TNGA 4UT7L 2BWIA 4DJEA 3JYCA 3VQ1C 3LLFA 3ZQXA 4MDPA 1LUCA 4N0CC 2W07B 3QDMD 1UGNA 1AD0A 4PBDA 3NPVA 4QXUH 4JX5A 1XHHA 3HA0A 4WVXA 3E9TA 2W60A 5AVYB 4QF1B 1PY9A 2CDEA 1T89A 2IBZX 4PI0A 5B1AB 1YIXA 4I5UA 1SYVB 1SBBA 2GK0B 4Y9BA 3L95B 4XNZB 4JUSA 2ODHA 1PS3A 1VYSX 3Q05A 3BLFA 1TEGA 4WKHA 2FYYB 3Q8CA 4BHUA 1H3TA 1TVNA 1V7NL 4LLWA 4U49A 1KYUA 1RIHH 1A7NL 5I75C 1UCBH 4CSTA 3OPZL 5KYUB 1KLUA 4R7NB 4GIAA 3FSUA 4HZLB 4KFZC 5A6BD 4TTDD 4NN5C 2A83A 4XC1L 1VPOH 2ZIDA 1TPC1 4TOYL 4PHZA 1EBPA 1E1CB 3TMLA 1J2BA 3W7JA 4FA8A 5FO7A 2ZZUT 3BG5A 1W1TA 1NLDH 4YDKH 4GACA 1Y5WA 1T66C 2PDBA 3LCHA 4LEXH 1DBBL 1NCAL 2Z24A 3TPUA 4GZEA 1OFBA 2FL5B 4GMTH 1KYAA 3FQRA 3W9EB 3F3HA 3U48A 3WSQL 4JQ2A 5LDUA 2PCEA 3QI9D 4IFRA 4JIRA 2E6AA 1BWLA 4H9VA 3VXGA 4CVXB 5K1JA 3GG0A 1FGNL 3EUUA 1TSIA 1P7TA 2AJUH 2ED6A 2XWTB 2D8KA 1M5WA 1S4IA 1PAMA 1RIVH 4DEPB 1TPVA 3VFGL 1AZCA 1ZLVH 3HZYB 4NJ9H 3DTXB 1G1OA 2YQ3A 1GPWA 4H41A 5IFAH 1CFVH 1MW0A 2AERT 3TR9A 5JA8B 1J1OH 3S5LA 4KAQL 5GGSA 4S1SH 4XZMX 1NGQL 1ML0A 1U3HD 2CDFA 2B8OT 4BDVA 4AU0A 5FK9A 4AIXA 1NGZB 2FTAA 1OZMA 3EFDH 2J6XA 1QOQA 1TETH 1MEIA 1OPGL 2BW5A 3IJHA 1ND0A 3GXTA 3U1SH 3UZQB 4L3ED 1A50A 1VRSA 4LUTA 4YBHA 4KMQA 3VUAA 3DX9B 4IBYA 1TZHA 1VBJA 3GU2A 1EHXA 1EOMA 3QORC 3TNOA 1DQQB 3U9PL 2FVNA 3RA7H 3O6AA 1Z6JT 3L3OC 1RK5A 3NUKA 4LSVL 3GR7A 3ARRA 2NLJA 1RJPA 1AJ7L 3VFMA 1KD0A 3T42A 1MEXL 3LIZA 2JKJA 3QG7L 1P0EA 4X3ZA 4B3ZA 3N73A 4E41E 3ZTDC 3DGCR 4LOVA 2F5AH 1BGGA 3GHPA 2LV4A 1LO3L 5BXFA 3GMOB 2AJYH 3U4KA 1Q0XH 1RCYA 5JW4Q 4XVSH 3PFRA 5I0YA 4PS8A 1R3TA 4H9TA 4EVNA 4W9FC 1SVBA 4BSVB 4ANKA 4PJDB 3I74A 4U1KA 1QFHA 2H47C 3B7UX 2WTRB 1S5IL 1FUNA 2F8QA 4RPPA 3KEDA 3HNTH 4YHZL 1F74A 3TBTB 4MA7H 1OE1A 3NGFA 3ECQA 2E56A 2Q86B 3E0VA 5AW6B 4JS3A 1HSBA 3IV3A 2QSCH 3AYSA 1WA3A 2XWBB 3QJFB 3WJSA 3A67L 4A55A 2G37A 1KJ3L 4KTGA 4LSPH 4EK7A 4UCFA 4WJ5A 4V1DB 3IS0X 4R3UA 2E47A 4CEXC 3LQZB 4F24A 1UB3A 5JPNB 3MLYL 2OQHA 4XO6A 1TJIL 4M6NH 1KIQB 2KAUC 1FDJA 1B0IA 4PVNA 5I9QC 5J1SC 4JZNA 1QWNA 1TTJA 2UWEF 5JUEH 5HJ3A 1AG0A 2QKIA 5CBEB 4MJJA 1MCSA 3POCA 3UP6A 4W7VA 3IJ7A 1DIKA 3B97A 3SKNB 2QDHA 3W7EA 2NUPB 1HGWA 3MFGB 2MNRA 2BS9A 4OIAA 4LF2A 3OVRA 1GGCL 4CN6A 4RFEA 3EJCA 2B7NA 4G8TA 3K2IA 3BESR 5A2KH 3WO4C 2ZWYA 2HFGH 1I1WA 3BZFA 1TTQA 4EF9A 2ICSA 2BIPA 4JICA 1FE8H 2BHFA 1XYLA 4IQJA 3RVWC 2NXYB 4OB5H 2FX8H 4C65A 3Q2CA 1NUNB 4K7PH 3M64A 1NMBL 2ISDA 5I15L 4QLLA 3UBGA 3SIKA 3CWNA 1IEWA 1TPH1 3LHYA 4OZHA 3I9GH 3ZT6A 1VBHA 3FA4A 3IXTB 1H49A 4CW1A 4I48A 1H5BC 2EDHA 1CN4A 1U8MB 3PL6C 4MSWA 1SJCA 1OCCB 3WD2A 3TIEA 3RGHA 1PBGA 3QKEA 5GZNA 2B14A 4OLUH 1RUAH 1W0YT 3MRNB 1LEGB 1RVFH 3V18A 2G41A 4WD0A 3IJEA 2CDEB 2FBJL 4J2MA 5LA1A 5I1CH 4BF9A 5I1JH 5LCVA 3TDFA 5FUCC 4YHYB 1XV8A 6REQA 5AD0A 1BYAA 2RH9A 4EWND 3OHIA 4UAOC 2GGIA 4JY4B 3C08L 1Z5LA 5I5IA 3BL3A 5CIPH 4PB0H 2DV6A 2PI6A 5EZIH 4F8OA 3BISA 2OWWA 1B9BA 4M9OA 1MSPA 2OCJA 3V4VA 4JFFD 5DUBA 3H2EA 1MPAL 1RK0A 1KELH 4Y2WA 1YECH 1ASQA 3AS0A 4JFVA 4QPEA 3O2DA 2H0JA 1CXKA 4Q8WA 2EH8H 1P2CB 4I4WA 1NTDA 5A2AA 1R0MA 2YC1B 1QPXA 2GITB 2H9GB 4P2OD 2HPOA 3QCTH 2ZCLH 4Z2KA 4WUIA 1XMWA 4K1WA 1UUMA 5E6UB 1WBZA 1TYEB 3N1MC 4EIUA 3FQRB 3QHZL 4Z3GA 3SZ8A 2QR0B 4UINL 4JPKH 3X1BA 4FMFA 1YRKA 3TT1H 3GKFA 1S39A 4IIEA 2B4CC 3PGFL 3WMSA 3O06A 3VGFA 2WSRA 3LA4A 4BBWA 3K2UH 4HWUA 4QTHA 3EOOA 3GSRB 2BGNE 3A3XA 3S3GA 5LIKX 4UUIA 3H4FA 3C5SA 5GS0H 1QWGA 1WS8A 4M7JH 1F42A 2V5KA 2A4AA 2OM5A 1MIEH 1J6OA 4AT6B 2W5FA 3S9IA 3K30A 4PJ5A 1ACYH 3S5LB 2XTJD 5C08E 5F9WC 2Z0UA 1F4XL 4XAWH 3WLBA 4AZIA 3HC2A 3BAYA 4PS4L 5D1ZA 4EN3A 4IG2B 3RWHA 2Y7EA 5J04A 3EGSA 3JSSA 1AH0A 3THUA 3KDMB 4JQAA 5FK9B 3WEMA 4X7CC 4UFKA 5EOCJ 1ZLSH 2C3VB 3I6SA 4PRHD 3IS4A 3VWJC 1AK5A 1GMIA 2J1XA 3NZ8A 2VABB 3N42F 3FX4A 4DAGL 4XO9A 5BZXA 4LUTB 3BUTA 1RU9L 4RGOH 1OSYA 4FG4A 3TEVA 4BCYA 3SEPA 1LO2H 2HLAA 4UZSA 1FVDA 4TUOB 3ZGHA 3SCTA 3UP8A 4POCA 2Y1AA 3LHUA 1YPZE 3VI4F 4I0PD 4TTGA 4FSAA 3GY1A 3BGGA 2AV1B 4YH6A 5GHWH 2NLJB 3E8VA 2XG4A 4NQSA 1XIFA 2X9ZA 3WHXB 2YEZA 4GS7C 3E2VA 1SW0A 1YUHB 3TC3A 1S3KL 5BXFB 3OB0H 5DS2A 3MHFA 3PWPD 3GIZH 4YTRA 1FVCB 3UEQA 4EVNB 5EA0H 1LO4H 1TCRA 1PG7L 5SWQB 4U1KB 5IF0A 1T22B 1PUDA 1AD9A 4DERA 2IPJA 3C2AH 2DJSA 1E4XI 5I1EH 3CG8A 1OAQH 5C2BH 5H2BA 4DOHB 3MKGA 2PPDA 4YGVB 5PTDA 1POKA 4PI2A 3P73A 1ZHLB 1QNOA 4O13A 1FXPA 3BFQG 2XXFA 4WJ5B 4ZX4A 4CVWA 1NL0H 4F7CB 2EE0A 2WY3B 3GMPA 4PJAE 4F8PA 3QDHA 1KTNA 1JN6B 4TTUA 3QIWA 2VL5A 2NTSP 2J9XA 3QS3A 3HI6L 2ITFA 1V5JA 2MMXA 3HE7C 5T1MA 2FNBA 3HJ0A 4J8RA 3V79C 4C47A 4Y1SA 2IMRA 2XFXB 2QKIB 2GIXA 3KPPA 1D3HA 3FCUB 5J8LA 4G1NA 3T3MF 4G42A 3DGGB 4QE4A 5CBJA 1OCJA 1K8CA 5TH2A 3EPOA 4K2SA 4FTDA 4EDWH 1T5WB 3FB8B 3N2BA 3H22A 1K8IA 2SEBB 5EMUA 4H8WC 2PB1A 3FO0H 4Z18A 4JX0A 2A85A 4XGZA 1HTYA 4X6EA 2WKGA 3BZFB 4PV8A 4MMZC 3ZDYE 4ICXA 4E8DA 4Z3HA 1J9QA 1B4LA 2I60L 2NXZD 2D73A 4WJ8A 5HYIA 4U3XA 1FCUA 4MDIB 4LVOC 3R1GL 2B59A 1BXVA 4X4MA 1JMXA 5CGYD 3L81A 2Z00A 4AYFB 5DJ0A 1ME7A 5D2NC 2A77L 2J7EA 2GB2A 5DMNA 1MUCA 2RFXB 5IW3A 3S48A 1DQDL 4MYWB 1IXOA 4MSWB 4F2EA 4IL0A 1DJZA 3PIQA 2PZNA 3PG8A 2YZ8A 5JBEA 4QGYA 4X9HA 2J27A 3ATYA 3IJEB 5E51A 4FXTA 1XGRA 5EOCL 1LBFA 3VIGA 4TTDC 1SN5A 5T3ZD 4M62L 4C4KO 6REQB 1ZGLP 2QQNH 4BKTC