1Z32X

Structure-function relationships in human salivary alpha-amylase: role of aromatic residues
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENMNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-function relationships in human salivary alpha-amylase: Role of aromatic residues
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Salivary alpha-amylase
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2005-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00128 Alpha-amylase Alpha amylase, catalytic domain
X PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1z32X02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1z32X01
4MAZA 1HKIA 2QHAA 1FA2A 2BNJA 5D8ZA 5I77A 4PTXA 2UY5A 4GZEA 4UOZA 1KXVA 3ARPA 3EYPA 1KBBA 3CHCA 4FNSA 3WEMA 1TUXA 1Q6DA 3AI0A 4GZIA 5C70A 1CLXA 1QVBA 1M53A 2WZIA 1GCYA 2VX6A 3KLKA 4PTWA 1H11A 4RE4A 5CLTA 1HX0A 2PB1A 4W85A 3HG5A 4AD5A 2E3ZA 1BHGA 1HP5A 4AC1X 2XVNA 5IHRA 1VJSA 4TUFA 2XWEA 1ZJBA 2WVTA 4KRUA 3CZSA 4HOXA 1H49A 1IT0A 5KZ6A 4AMXA 2FGZA 5DMYA 3MI6A 2YLLA 1E56A 3ZT6A 2GFTA 3ARVA 3HG4A 1MXGA 4ACZB 2WANA 3GDBA 1UKPA 2XSAA 1LG2A 1JI1A 2CXGA 5I5RA 4W89A 4XZWA 5E1QA 3VIIA 1UOKA 3U57A 3RCNA 3UG3A 4NZFA 1OM0A 3ZT5A 4OBSA 4W7VA 2A3EA 2V38A 4MTVA 2D0GA 4MNMA 3RILA 4PUEA 3WD1A 2FHBA 2XVGA 5EBAA 2WMHA 3N9KA 1JXJA 3H54A 1JXKA 3TTQA 1EDTA 2E0PA 1A3HA 2XN2A 4AZGA 1E0WA 2OSWA 4F9DA 3VX1A 3EJRA 1US2A 3WNLA 2G3IA 4W87A 2OW6A 4BS0A 1UWSA 1PAMA 1QNSA 1FFRA 1MYRA 2BHUA 4B3KA 3AOFA 3D52A 4U33A 5AC5A 1TFVA 1XSKA 1U33A 1XC6A 2QPUA 3LX9A 2XVPA 2D3NA 2V3EA 1DWHM 1MW3A 3WH6A 1QBAA 2W4XA 5A8PA 5CPSA 3EJPA 1SMAA 3D5HA 2FE0A 2D2OA 4Z2JA 3BAIA 1BG9A 4BQ5A 3VM5A 4QDMA 1GQLA 1GOWA 1W9UA 5E09A 1V6YA 5DT7A 3RM4A 4H7VA 1A47A 1QI2A 4Z2HA 4ZE4A 4W8LA 4CU6A 5DF0A 2IXUA 2J25A 4OKDA 3AICA 2EADA 3D3AA 5IFPA 4B9ZA 5A2AA 4PBGA 1J01A 4HPHA 3AHXA 3WH9A 3UR7A 3TTYA 3VGBA 2C8NA 1R47A 4OGZA 2WMFA 3ARXA 1VFFA 1PIGA 3VNYA 3FAXA 1GQIA 2YBTA 3BUDA 3H55A 2DSWA 1J0IA 4UQEA 1GHRA 2J7BA 3VIOA 4BQ2A 1V02E 1ODUA 2Y5EA 4CKQA 4AZ6A 1E5NA 3EJQA 2G3JA 4CVUA 1I1WA 1LL4A 2XFFA 2DT0A 3QR3A 1DWFM 1K9EA 1MQQA 1CPUA 2EAEA 2WCAA 1BPLB 1JI2A 2YJQA 3VIKA 1NWSA 1XGZA 2WM0A 5HDRA 2W92A 2DH3A 1JAEA 2CIPA 1R33A 2V3DA 2F18A 1VB9A 2C7FA 1KQZA 3NDZA 3WKZA 5BYWA 4FNTA 4P7QA 3M46A 4CCDA 2JIEA 5BXSA 2D3LA 1KCKA 3K1DA 1WDPA 2BY2A 4UCFA 1E55A 2FH8A 3CZGA 3VSUA 3ZM8A 1GNXA 4R27A 1H09A 2WCSA 4C7FA 5JBEA 3GXNA 1KWKA 3VDAA 3TOPA 4HMDA 1CXFA 3T2QA 2O9OA 5IDIA 2G41A 4B15A 3EDDA 3SCUA 5DO8A 2UY3A 2X09A 1ECEA 7CGTA 1VEPA 3WUFA 2D1ZA 1HVQA 3EMCA 3AIEA 3IGUA 1TQVA 1HXJA 1PBGA 4GINA 1XH1A 3B9AA 3GNRA 2ZWYA 1V6XA 1UHVA 4IPLA 4LXFA 5BXTA 1JAKA 2AOSA 4U5IA 2ALWA 3HU7A 2EBNA 3BAXA 3LRMA 3WEZA 5A95A 4AD3A 3ZO9A 4M1RA 2WYSA 1QNRA 3LXCA 8A3HA 4HZ8A 3II1A 1XYZA 3SUSA 1XRVA 3WFZA 3ALFA 1B90A 1GW1A 4H04A 2EPLX 5ABFB 4AMCA 2VO5A 1JYNA 3WDHA 4D6IA 4DWSC 3CIVA 1E73M 1DEDA 3WD0A 4EK7A 3N11A 1W9XA 2GJXB 5I78A 4IUGA 4E8CA 2O9RA 6CGTA 4H2CA 3DDFA 1QNOA 1VF8A 3VMNA 2GJXA 4TVCA 2CEQA 1KR0A 2G8ZA 5HXMA 1MW0A 1E4MM 1E6NA 1LG1A 4HMCA 2YA2A 4ZENA 1HKJA 1CZ1A 3ARSA 4S3KA 2YFOA 3EJSA 3ZJ6A 1UQZA 3DYPA 4HMEA 1HJXA 1NWRA 4Y7EA 4PSPA 2D23A 4JKMA 4PTMA 3SCQA 1PIFA 1HT6A 1NWUA 3TA9A 3WFLA 4ACYA 5D8WA 3L4TA 3QGVA 2DSVA 1OIMA 3CUGA 3WY3A 1OT2A 3VGDA 3S2CA 1XV8A 1PZ2A 3A4WA 3L4YA 3OGRA 3B9EA 1KTBA 3BCFA 1B3XA 2GVYA 3CMGA 3SURA 9CGTA 3DHPA 1H1NA 1XYFA 3BUPA 3CZEA 1BFNA 3AXIA 1E72M 1JYVA 2CBVA 3AHYA 2YDQA 2E4TA 4JFVA 5A6SA 3VD7A 3THCA 3HMCA 4CD5A 2O92A 3GXIA 2CPUA 1UD6A 4JHZA 4J3VA 1QI5A 3FXYA 4R5EA 4W5UA 3FHAA 4PMOA 3FW6A 1FP9A 3A24A 3OB8A 2X2JA 1C90A 3F5KA 3BSGA 1EXPA 2WPGA 2WMIB 8CGTA 4X0VA 1CENA 4LGXA 4PN2A 4CU7A 2XGIA 2YOCA 4H41A 1J12A 1MQRA 2WSKA 1CYGA 2DDXA 2CERA 2O9TA 3BUIA 4KGJA 3A22A 5IXEA 3CZJA 1CGTA 5CZKA 3VDHA 3I3DA 1E6ZA 1CECA 1TA3B 3POHA 4HZ6A 1CNVA 3D4ZA 3H53A 4M80A 3AZRA 3FHQA 5C8BB 2MANA 1E15A 1Q6CA 3BVWA 1V08A 4NZJA 4AZCB 3B8SA 3DC0A 4QLJA 1EO7A 5EMYA 1V3IA 2OSYA 2NT0A 2ZWZA 1RP8A 3WF4A 3W6LA 3M07A 1ZB5A 2WHKA 2WZEA 4F8XA 1OB0A 4HU0A 1C93A 1UWRA 2PI6A 5I6SA 1PJ9A 2VUYA 3WDJA 1OGGA 3AYSA 3VD9A 1H5VA 3VSVA 1QI0A 2XTKA 4CN4A 4JFSA 4XB3A 4CD8A 4CGTA 4QFUA 3VGHA 5E6ZA 3S5YA 1KQYA 3SCPA 4LYQA 1J9YA 3PZMA 3F5JA 2WVSA 1CXKA 3AIUA 4NRSA 1JD7A 1FH9A 1ZBWA 1CGUA 4JCLA 1EDQA 2VX7A 1KGWA 3RM9A 1UKOA 2JALA 2DQXA 4P8WA 1CGWA 3WQ4A 2WLYA 3WBEA 3CPUA 2JIWA 2PWHA 4WKFA 2ZUVA 1H0GA 4DUWA 4DM1A 1QNPA 4YHGA 3WY4A 4FNUA 2W91A 1GZJA 2VI0A 4M29A 5D9OA 4Z2KA 5M5DA 2WVUA 3NSMA 3WDIA 3TP4A 3KL3A 4D6FA 1D7FA 4AY1A 1VFMA 3ZQ9A 3BAWA 4OJYA 3WD4A 1V02A 5F7UA 2FHFA 2WHJA 3VX0A 1TMQA 3BLKA 4HOWA 3SEPA 3DX0A 1LL6A 1K9DA 4W84A 4FLRA 5A2CA 2WVVB 4LQ1A 3PN8A 2WLZA 3NJ3A 3S5ZA 2J47A 2PBGA 2D0HA 2WVVA 4GI6A 3VM7A 1GHSA 1H3GA 3QHNA 1NH6A 4F9JA 2X0HA 3ARQA 1QNQA 5BWFA 3DDGA 2B31A 1J0YA 4QCEA 4TTGA 4TVUA 2EPNA 1E1FA 1KTCA 5E0FA 1WZLA 1JZ2A 4MNJA 2VT0A 1GJWA 2GJPA 4NI3A 4YPJA 1ITCA 4J3SA 1NARA 2IXVA 3BUQA 2WWDA 3SCOA 4TX6A 1XD0A 2OWWA 2XM1A 1NM9A 4RE3A 1BGAA 2BY0A 3VIFA 3SCRA 1CWYA 2XN1A 1QHOA 1TQSA 2HVMA 5A6LA 1E0VA 2VL4A 3OA5A 3WL0A 3BLPX 5CG0A 3WNPA 3LPPA 1HJUA 2VX5A 4TVDA 2Y4SA 2E9BA 4GQRA 3CUFA 5C71A 1UR0A 1VJZA 4D1IA 3CZKA 3OZPA 2GUYA 3GH7A 3QOMA 4ZXLA 3WH7A 4J3WA 1L8NA 4V2XA 2ZX8A 1V6WA 4N42A 3GXPA 4BA0A 4HA3A 1LF1A 1K9FA 2EACA 1HL9A 1E4NA 1W1YA 3WQVA 1QPKA 4UZUA 1PX4A 1UR2A 1HF6A 2WKGA 3KEHA 3TTOA 2DH2A 1V0MA 3IAPA 1W3HA 5FCZA 1W9VA 4HTYA 1JGIA 3DX2A 1V3JA 3W4RA 4AWEA 5FL1A 1V6VA 2ZICA 1SMDA 1E6XM 1ZBKA 1RP9A 2OLHA 2VZUA 3U5UA 1JZ3A 1L0PA 3VMPA 1OWQA 1E71M 3GNOA 3W26A 2X8RA 1ISYA 1UUQA 2BHZA 1UD8A 2VX4A 1WNOA 3VIPA 1QWNA 1GUVA 2V5DA 1EIBA 3RO8A 1RH9A 3CHDA 1NOFA 1OD8A 2UY2A 4DWSD 3N12A 3L4XA 1VFOA 3AIWA 2BV9A 4JFTA 3A23A 1PX3A 1E1EA 1OD0A 3VUPA 1J10A 4AYGA 4WJXA 2CBIA 4FLSA 5LYRA 3VIGA 2ZX5A 4JCMA 2A3BA 3VU2A 1R34A 3OG2A 4URIA 2WAGA 2C0HA 4LX4A 3EMZA 1NP2A 1SYTA 3WH8A 4ACZA 4QLLA 1NOWA 3UEQA 3GM8A 3GH5A 4MAVA 5A8QA 1H4PA 1FOBA 1BYAA 1JFXA 4UNIA 4OOUA 4AMWA 1E5JA 4KGLA 1EOMA 2WHMA 1B2YA 2XGBA 1F4HA 3I3EA 5FIPA 4AZHA 5A6JA 5LA0A 1YHTA 4MB5A 3OLGA 5E6YA 2DSZA 1B3WA 1QBBA 3WDQA 4W93A 3BAKA 2J77A 2BS9A 1EGZA 1MXDA 1E4IA 3ARTA 4MNKA 1VBRA 5D9PA 4FNPA 2G4FA 4NXSA 3CV5A 2BY1A 1GJUA 4EKJA 4C7GA 4AEFA 4NXKA 3EDEA 4UFIA 4DWSB 3BGAA 4JKLA 1CGYA 3OLIA 1F4AA 1LWJA 4P8XA 4U3AA 4Z2IA 1M03A 1HJQA 3T09A 2ZXBA 1BYCA 1E4LA 1EQPA 2X2HA 3DECA 3BCDA 1XD1A 3DHUA 3DYOA 5JIWA 4AD2A 1DP0A 1D2KA 5A3HA 1WB0A 4AIUA 1VEMA 4EE9A 1B3ZA 4GPNA 1W3LA 4BF7A 1XH2A 3UG5A 4ML4A 3W24A 1UR1A 1KWGA 3LPOA 2F1BA 1C8YA 4NZCA 1AQMA 3VDCA 2FH6A 1OBAA 3G6MA 2ZUMA 3K8MA 2VZOA 4V27A 3AZTA 4PMNA 3OLDA 1W9PA 5A8OA 3A4AA 1DWJM 1V0LA 2F2HA 2WWCA 4WLCA 3WNNA 2J8GA 1VRXA 3FAWA 4EAMA 2DSKA 1W9BM 3BH4A 2VJXA 1GOOA 2XIBA 4OUEA 1QOXA 2CYGA 3VIHA 1BAGA 3AQUA 2ZX6A 2XM2A 3RIKA 3PZIA 4B16A 2CITA 3VMOA 4A4AA 1AMYA 4DUXA 4GO8A 3ARRA 1WPCA 5EB8A 3GTNA 2YFNA 3TONA 4AIOA 1IZJA 1C8QA 1ODZA 4MB3A 1U2YA 1CGXA 4AZCA 3AMCA 1KB3A 1QW9A 1NQ6A 2WMGA 3A47A 4M81A 3UCQA 1E43A 4E4PA 3CHFA 3SUWA 5A6AA 2VOTA 3ARZA 1WO2A 2EABA 1EOKA 3RMEA 4QAWA 2XWDA 2ZXAA 5A8NA 4MDPA 3QOKA 4CCCA 4D6GA 3T0DA 1UZ4A 1K6AA 4AYSA 4RE2A 3PZNA 3ZJKA 5E9AA 2BFGA 2X2IA 2NW0A 1UD3A 4CD6A 1JZ6A 1Q6EA 1HL8A 1OSEA 1W3KA 1LWHA 1CBGA 3WL1A 2Y2WA 3WF3A 3WUEA 5LA1A 1E40A 1C8XA 4ZEPA 3W53A 3GBEA 2X1IA 1PX8A 1CXHA 5I79A 3CH9A 2VRJA 3VIMA 1WP6A 3CO4A 3DX4A 4IPNB 3O6AA 3BMWA 1H0IA 3DX3A 1BGGA 1Q4NX 2V3GA 3AIRA 2YDSA 3WENA 1JZ7A 1U30A 2WW5A 3B9DA 1E70M 2YIHA 1G1YA 1V03A 3AMGA 4PMVA 3F4VA 2GDUA 3NDYA 4E8DA 3MUAA 2VVNA 2EEXA 4P7OA 5BXRA 1KR1A 2UWFA 3EDJA 3K4DA 4KRTA 1Y7VA 2EO7A 2BHYA 4NRRA 1VIWA 4RL3A 2Z1KA 1X1NA 2E9LA 2GDVA 5CSYA 2FDMA 3WF2A 3FN9A 5BXPA 3AIVA 4PEEA 1O7AA 3AS2A 2BXYA 4PCSA 4ZE5A 4PMRA 2WC7A 4PMDA 4F79A 3HN3A 2QV4A 1BSIA 2J78A 3AMKA 2OSXA 1HP4A 2W67A 4H8UA 2XFRA 4TX8A 5HPOA 1W32A 2PWEA 1TZ7A 2DT2A 3RM8A 3W27A 1M04A 2A3HA 2BY3A 3N13A 2F8QA 3VGGA 3VD3A 1TG7A 1J18A 1R85A 2J7EA 3NCOA 4D6HA 2WK2A 2J7DA 3AS0A 4BCEA 1HVXA 2RGLA 4OBRA 1HN1A 1ESWA 3GXFA 4B9YA 3WDPP 2Z1SA 1MFVA 1CGVA 1JNDA 4AZIA 3A6OA 1KBKA 3WMCA 3OBAA 3I3BA 1GOMA 2VTFA 1I1XA 1RD6A 1LL7A 3MUY1 1ISXA 4AXNA 4U5KA 1AVAA 3UR8A 3N15A 4JHOA 4Q22A 1EDGA 3AMDA 1O7DC 3CTTA 2J74A 3PTMA 3PTQA 4FK9A 4W8AA 3WEOA 5EFFA 3IANA 4KMQA 3TV8A 2WHLA 5GQBA 3OGSA 1W2PA 3PZVA 3IK2A 1WZMA 4CN6A 3WH5A 2WC4A 4CD4A 2QF8A 3AJ7A 4D6DA 2DPEA 1G5AA 2F7QA 4U31A 1EQCA 2BVYA 2CNCA 1J11A 2J4GA 1C7SA 1ISZA 2W66A 3O2LA 3MS8A 4FF5A 3VOCA 1UWUA 3WQWA 1G01A 2XIIA 4J28A 4A3HA 4AISA 5GNYA 1V6UA 2DGAA 3BAJA 5KEZA 1BVNP 5I3DA 2CHOA 1BYBA 2FGLA 4JAWA 2GSJA 4A3YA 1B1YA 1EHAA 5ABEA 5GNXA 4PYSA 2X05A 1RPKA 2YKKA 3WD2A 3KWXA 1I75A 1M7XA 5AYIA 2JFEX 4JZ5A 5A6MA 2E40A 3S6TA 5TD4A 1FHLA 1TQUA 1PPIA 3WUBA 3UERA 3VKKA 4EANA 4PSRA 3PTKA 2ZXDA 2GK1A 3GYCA 2VMFA 1UKSA 3MSDA 2YL9A 3K8LA 2ZOXA 3ZJ8A 2WCGA 1OINA 5BROA 2D22A 2EPOA 1HJWA 2ZE0A 4MADA 5CLWA 1UH4A 2F7RA 3AHTA 4X9YA 3D51A 2OW7A 1DWGM 2Y8VA 4IM4A 1KFWA 1BQCA 1B31A 3IAQA 2D0FA 1ZBVA 1X6LA 4IISA 1B9ZA 3CUJA 1DWIM 3DX1A 5I24A 3CHEA 1QW8A 7TAAA 3W38A 1WZAA 5JIPA 1MWOA 4WF7A 2OYLA 4LPCA 1FP8A 3SIMA 1KCLA 4GQQA 1JNEA 2WNWA 2ZXQA 5EFDA 4HU8A 2E8ZA 2JF7A 3KE0A 3GBDA 2F1AA 4JFUA 5ABHA 4JL2A 5A6BD 4OZOA 5GPRA 1WE5A 1FH8A 1O6IA 3K46A 1KGXA 3L2LA 1R7OA 2VQTA 4W88A 3ARYA 3SUTA 2A3AA 3T08A 1UR9A 3KZSA 3ARWA 4YN5A 4M56A 1VFUA 5A94A 2YA1A 1QHZA 3UETA 5D9NA 2VQUA 3ZR5A 1PZ3A 1VAHA 4UQAA 1LLOA 4DWSA 4UFMA 2X0YA 3O9NA 1SR0A 1W2VA 2WB5A 4PMYA 3RDKA 4UQ9A 1IZKA 2XVKA 1C91A 3L4VA 3L4ZA 2WMJA 5M17A 3T2OA 4J27A 3W37A 2YL6A 4HZ7A 5I23A 4CD7A 4AZ5A 1V3HA 3BVUA 1B0IA 3A3HA 4XUYA 1EHNA 5HNNA 3T0AA 2PC8A 3EBVA 1B30A 4AW7A 3UG4A 3VILA 4D6JA 2BVDA 2ZUWA 2ZX9A 4OOZA 4F66A 1HTYA 3D50A 3PZQA 1UKTA 4MJ4A 1R7AA 1G94A 1XH0A 2WBGA 3A5VA 3MSGA 1BVZA 1ISVA 2ZUTA 3WSUA 3GXTA 4L4PA 3WDRA 1FH7A 2VR4A 4Z2LA 2YL5A 3LXBA 3BVVA 3PZ9A 4UOJA 1ZU8A 1W1PA 1FFQA 3U5YA 3W6MA 2J8FA 3CZNA 4W5ZA 1R87A 5CGTA 3BVTA 1R8LA 3HG2A 1CXEA 1JZ4A 1GORA 4CN1A 1GOQA 4PMUA 2XJ7A 1UYQA 1EH9A 4FLQA 5HBFA 2YL8A 4GKLA 2CCRA 1H2JA 1E6PA 2XFYA 3HJEA 4WSKA 1GVIA 5JBDA 1J0KA 5DT5A 3PZTA 3OLEA 4XX6A 2A3CA 2CETA 2FYVA 3VDBA 3JUGA 2DEPA 1JYWA 3NUKA 4E2OA 3MMDA 3WF1A 1GONA 4NX0A 3CLWA 1HIZA 5E0CA 2VC9A 5HOSA 1B3VA 3VGFA 4AIEA 1K9TA 5CSUA 2DIJA 3AHZA 3SUVA 1UH3A 5JUVA 4UFLA 1CEOA 2QPSA 4M82A 6TAAA 4AD4A 1UH2A 3PHAA 4UTFA 1KGUA 1TCMA 3PBGA 1LQ0A 3DYMA 2WC3A 1ZS2A 1JFHA 2YDRA 4HA4A 2XG9A 4TTUA 1GPFA 4PMQA 4UQCA 4D72A 3WD3A 2FHCA 2ZUUA 1J0JA 2VCBA 1UQYA 1OGBA 1V0NA 1FHDA 1X6NA 4PUDA 3OZOA 3ALGA 3W82A 4QCFA 3SCSA 4M24A 4ZXOA 3PZUA 2BXZA 4H8VA 5D4YA 2WSPA 3M7SA 1QI4A 1DWAM 1GOIA 4TOQA 3WF0A 1R46A 4CCEA 3BLBA 2EPMX 3M6DA 3NSXA 4HP5A 1E3ZA 1BG4A 1PEZA 1DTUA 3WQ6A 2CBUA 5CXPA 1W9DM 3NIYA 3VD5A 4Z2GA 1OIFA 3OIHA 1WDQA 3FY1A 1GVYA 1CXLA 4WKAA 3CGTA 1J0HA 5A6BA 1W3JA 2WXDM 2W61A 1WDRA 3THDA 4FLOA 4MJ2A 2WMIA 3WMBA 3AXHA 1DHKA 1E6QM 5D9MA 4JKKA 3U7VA 3SUUA 4MDOA 1CDGA 5A6KA 4ZFMA 3UESA 3AROA 4J3UA 5GNZA 2O9PA 5IFTA 1TA3A 2ZUNA 2F7OA 2VVSA 1JF6A 3VD4A 4ATDA 1TR1A 1W1TA 1UA3A 1PS3A 1QHPA 2BVTA 2XN0A 1SZNA 3MO4A 4J3TA 2CKRA 2D73A 2OYKA 4D6EA 2WMKA 3G6LA 1V3MA 3D4YA 1VEOA 2EXOA 1NOUA 3W0KA 1OT1A 3BVXA 2OWXA 2IUZA 3LPFA 1TVPA 5CPTA 4J7RA 1JIBA 2YA0A 3IJ8A 2W62A 2ZIDA 2DT3A 1UR8A 1XCWA 1HXKA 5A69A 3RPMA 2AAAA 2GK1B 4FNQA 4UOQA 1UWQA 2CKSA 5DFAA 5AY7A 4W7WA 1Q6FA 3J7HA 3T2PA 4WK9A 1UD5A 1QWUA 4W7UA 3GXDA 1E3XA 5HPCA 4L4OA 3VIJA 1TE1A 3A4XA 4UR9A 3A21A 4N0RA 1UWTA 4GXPA 4Q7NA 2JE8A 3AS3A 4W8BA 5M03A 4PRWA 5ABFA 2EPKX 1G9HA 1UZ1A 4M8UA 3WELA 4AD0A 1KXHA 2NT1A 3FNDA 5CJ5A 5LA2A 3KLLA 4DO4A 3CUHA 3AXXA 1E6RA 1R86A 4HPGA 5E70A 3IJ9A 2XYLA 4X0NA 4P7NA 3WN6A 1XSIA 3SCTA 1SFSA 4QP0A 3OGVA 3ARUA 1T0OA 2DT1A 4PTVA 4JL1A 5ECUA 1BF2A 2XHYA 3RJYA 3VTRA 1UASA 1CIUA 1UD2A 3SCNA 2XUCA 3HZ3A 2Q8XA 4KWUA 1J0ZA 3TTSA 5A2BA 4LYRA 3PZGA 2EJ1A 5FOOA 2VRKA 2CESA 4H8HA 2IGTA 5BRPA 3EDKA 5I0DA 5CQ1A 3N17A 4DO5A 1WDSA 1YQ2A 2VR5A 1HWWA 1WCGA 3L2MA 1QI3A 3ZR6A 4HOZA 3EMQA 3SCVA 1GOKA 3WQ8A 2YBUA 1Z32X 2E9MA 3AYRA 2XVLA 3EJUA 3ZOAA 4U2ZA 1JG9A 2OYMA 1HKMA 3CMJA 3ZSSA 2VURA 2VZTA 2F61A 4UFKA 4HA1A 4GI9A 3PZOA 1UA7A 2VRQA 4ATWA 4GIAA 1E6SM 2V3FA 3BC9A 1JF5A 1JD9A 3LMYA 4P8VA 3CZ8A 1JL8A 4MB4A 4B3LA 1W1VA 3AS1A 4OIFA 4QLKA 5FKYA 1MW2A 3MMWA 4WSJA 1C3FA 1HJVA 1CLVA 3BAYA 3QHMA 4DO6A 2WBKA 2J7HA 1HNYA 2AMGA 3CZLA 1OGSA 4BZYA 5ABGA 3LRKA 1NWTA 1JDCA 4XV0A 1EA9C 1V3LA 4D71A 3WNMA 2J7FA 4P7LA 4U2YA 2E8YA 1H41A 2JEPA 4ATLA 2VZVA 1WKYA 1V0KA 2PWDA 3ZJ7A 3MKKA 5BRQA 3EDFA 2ZUSA 2W5FA 2Y8KA 1C92A 1E9LA 2D20A 4W86A 1ZJAA 1BTCA 4XZBA 4AZ7A 4U3CA 2RGMA 3ZMRA 5CGMA 2JF6A 4CU8A 3CUIA 3WQ5A 4UFHA 4P8UA 4PMZA 1C7TA 3VGEA 1D3CA 3VNZA 3RJXA 3NSNA 1GQKA 1W91A 1MQPA 1EO5A 3CBWA 3N18A 3LXAA 1WZKA 3QHOA 4FNRA 3L4UA 3LPGA 2X2YA 2OWCA 4AEEA 1G0CA 1M01A 4P7RA 3AFBA 3VO0A 3HG3A 3WY1A 2NSXA 3AMLA 3N1AA 4WIWA 4KH2A 5BCAA 3AZSA 4JFWA 2PWFA 1CTNA 1UG6A 1IV8A 2DSUA 2ESCA 4UZSA 6A3HA 4D6CA 3ZT7A 3MUIA 2PWGA 1S46A 1ITXA 3W28A 4MB1A 4UFJA 1BYDA 4PCTA 3K4AA 3POCA 5FD0A 3WMSA 4LYPA 1JYXA 7A3HA 1QX1A 3W81A 3IJ7A 1XHGA 2TAAA 2D24A 2EQDA 3WBAA 3BXWA 4JIEA 1TVNA 1OCQA 1AQ0A 2WZHA 3MUZ1 1CXIA 3MV01 2W63A 4DM2A 3BSHA 1WAWA 3KL0A 1ISWA 1VENA 1XCXA 3ZIZA 1JDDA 2G3NA 1N82A 2J75A 4MPKA 3SCWA 3VINA 4CUCA 3T0BA 3GH4A 4C7DA 3K8KA 1UR4A 3BUBA 4CVWA 2VZSA 4S3JA 1KXQA 3MANA 5DEZA 3W25A 3WUGA 2Y24A 3EJTA 5I2UA 3KL5A 3AHVA 3W29A 4DUVA 3WNKA 4UQBA 3ECQA 1UWIA 2J62A 3NYDA 4MNLA 1AQHA 2J79A 1UD4A 1TQWA 2CHNA 2QMKA 5A1AA 4K68A 5IHSA 4NF7A 4GI8A 3APGA 1KXTA 1P6WA 3ZSTA 4D1JA 2QLYA 1MW1A 1B3YA 1NP0A 2JEQA 2WKLA 2PBOA 1ZL1A 4AZBA 1XSJA 1TQTA 1V3KA 1R75A 1ZBCA 3N04A 2J7GA 2PF0A 4PMXA 2DIEA 3GXMA 2J7CA 5FL0A 5AC4A 2VNCA 3MMUA 2QMJA 1HKKA 5CPQA 1Q6GA 3F5LA 3AISA 3VPLA 5A8MA 1HJSA 4V28A 4TXEA 3WY2A 1JZ5A 4GO9A 2CBJA 2VCAA 4AD1A 3U7BA 3WIJA 2V5CA 5JBFA 3L4WA 4WKHA 1BLIA 4FMVA 3WNOA 2YLAA 4GZJA 3VSTA 2VCCA 4UQDA 3E1F1 1US3A 3GZAA 1E0XA 4NSBA 1JDAA 1LJYA 1MFUA 3MV11 5AYBA 3MU7A 3LRLA 3AIBA 2F7PA 3BMVA 3GNPA 2XPKA 4BQ4A 2ZX7A 3VVGA 3CC1A 3AIQA 2UY4A 5M3WA 2G3MA 2XSBA 1GQJA 2HISA 4J3XA 1MVYA 1VBUA 1UKQA 1JZ8A 4YHEA 4BQ3A 2GJRA
chains in the Genus database with same CATH superfamily
2QHAA 3RGVC 2BNJA 3AGWA 3T1FA 1OP5H 4PZVA 2Z0UA 1MNNA 3FA4A 4ZQMA 5IQ7L 4OIAA 5IHHA 2P3ZA 4XMLL 1P6AB 2IAND 2QQ6A 2Z8SA 2BDNH 3QUYC 2FIRT 3B7SA 4PVMA 4F7MB 1MDLA 3VZXA 3BD5A 3MROB 1NTHA 1QR4A 5JO5A 1X5KA 1S5MA 4UR9A 4UM9A 2XHNA 5AW8B 4GZIA 5C70A 3LCWA 3KWWB 1CLXA 3ABOA 4PRHD 2UZPA 4NGHL 3WQCA 3VKDA 5J13B 1UXWB 2WZIA 2LVCA 3W74A 5FO2A 2ICEA 1QOPA 4FL4B 3LBOA 3LHPL 1H9DA 4GVGA 3S34L 1H11A 4LEFA 3C5JA 3EPNA 4PTWA 2FK9A 3C6LB 3IGAB 4Y19B 2DQEH 1A3LL 5LG1A 3NCWA 3TO4C 3VI4F 4NQUA 3QXWA 5IB3A 2FX7H 4WHDA 3PQYA 5JXAH 3LZQA 1S4IA 3KBFA 4FHJA 4OZ4A 1JJKA 4IL2A 2EPHA 4ZBJA 1XLBA 4AC1X 2XVNA 4GNVA 4IGMA 2DRUA 2F54D 4HJ0C 2NY4D 3AREA 3OR6B 2XWEA 4XKYA 1G5GA 2GVJA 5IR1B 1V5XA 3B03A 4RW3A 5B8CC 1FE8L 2IKJA 5HNRA 4NP4H 5AAMC 4Z0SA 3CZSA 3ZKMC 3EGDA 4N1EA 3E0LA 3E6HB 4GNKB 3EADA 1UA6L 3QP3A 4P2RD 1IT0A 3P14A 1YMME 5EY5A 3FUEA 4I87A 5CWSB 3DH7A 2CWNA 3SFWA 1EZSA 3P4NA 2YLLA 4A6YL 2Q86B 4MA1C 3V2AR 2QJJA 3NCEB 4OD2A 3ZT6A 1V7AA 1O6TA 4YXLH 1EHLH 2Q7YA 3UOAB 2WANA 4L5FH 3GDBA 3T8LA 4ACZB 1UKPA 2XSAA 1VACB 2VR3A 5BMFL 5DFTA 5GGUA 2ID5A 4DEFA 3QI9C 1RVGA 2CXGA 5I5RA 3M8OH 3VFMB 5B38A 3ITXA 3VIIA 1UOKA 1BIHA 3PFQA 4C6FA 1G7HB 4ZO9A 2W0UA 3EB4A 2PR4H 3L1EA 4ZAKC 3WFDL 1X5GA 3ETBF 4O5LL 1P4CA 2PTTB 2ED8A 4M1DL 4X5WB 1S8DB 5DJXA 5FB8B 4JGJA 3ZT5A 1OM0A 4OBSA 1Z6KA 4HNOA 5DQPA 1ZD6A 2BRRL 4NO0A 3EBGA 4EZJA 4I1PA 2BOGX 4PR4A 3H9SB 1NC4A 4I3SL 2PODA 3B43A 4BFNA 2V38A 4MTVA 2VDGA 3O41B 2ESVA 2NX5D 2BIOA 2QTEA 3MUGB 1TYRA 4KUZL 4AH2B 2EUXA 5BVPL 2PO6B 4IF2A 5JR1H 1AXTL 1RZIB 4E36A 1OK4A 1JXJA 4U1GC 3M7FB 3H54A 2UZYA 4X7CC 3TA3C 4HWBL 3FQTA 3IDGB 4IEFA 1JXKA 4XHJD 3STFA 3IRPX 4N0FB 1HEJC 1HSAA 4G1KA 1RSCA 3IUIA 1J1OH 4PJAF 3MNMA 1IFHH 3P11H 1V5JA 3L5WB 3S3SA 4YUEH 3IE4A 2QCHA 2OB3A 1DL7H 1FL5A 2QGHA 5FJIA 5FM8A 1US2A 3EJRA 3BPWA 4N9GA 2CBOA 2QAPA 5IQ9B 1QEXA 2HJFA 4PB0H 4EVZA 2BERA 1UWSA 3MXVH 3F03K 2IADB 5BOPA 2OX5A 2XNAB 3HFFA 4HLZH 1BF8A 3BZJA 2EVFA 2XISA 3HGJA 3IDNA 5CU5A 3D52A 4TV3A 3U2CA 3FYEB 4ONGL 1XC6A 2EDQA 4FFWC 1XIIA 2MTPA 5FYKH 2XVPA 2D3NA 4YDJA 1DUYA 1A0QH 3CV6A 3LKRB 5DN1A 1MW3A 4XMZA 1QBAA 4OJFL 3L0NA 3G2GA 5HA7A 6FABL 3EJPA 1QRKA 3V4PL 1SMAA 5JPMA 3D5HA 2FE0A 1CC3A 2FGWH 4KO5A 3ZWSA 4ZSOA 1W5QA 4DK5A 2H32A 3BAIA 4NKQB 3QC0A 3SI9A 2WXOA 3NCJL 4BQ5A 3MJ9L 5SWQA 4E0RA 1CF1A 4P5MB 1EKOA 4YLQT 3MLTB 2QIWA 4DELA 3PQYD 3MGTA 4OD3L 2ORBH 1MYRA 1IGIH 1GOWA 1AACA 5DD5H 3DGGA 5TDNA 3MU3A 4AIBA 2ADJA 1IEBB 1FNEB 1TF4A 3ZUCA 3EHBB 3RM4A 5JQ9A 1TQBC 5DZLA 3HHMA 1XFBA 3VI4B 2F58L 3UTTB 4EWND 3HE6D 1OO2A 3GC4A 4MOZA 3VTTA 3CIWA 3QEQE 2DZPA 4AB4A 1RK0A 3NO5A 5F1VA 1CDHA 4L64A 1QI2A 4Z2HA 2WYTA 2YZ5A 5KTEL 1XF1A 3K5SA 2FTAA 4LEOB 5F9WC 3V5DA 1RCQA 4RDZA 3STLB 3U9UA 3JWNH 4BDVA 3LKPA 3S8FB 3W88A 5IVXF 1EXHA 5I3JA 1ZHLB 4E9LA 5D7LE 3AG4B 1E6JH 1QFWH 1FL3A 1EHXA 2PPFA 2CDEB 1F73A 3AICA 4DO7A 4PJIF 5FJUA 5IFPA 4KEMA 4X4ME 5A2AA 3JV4B 1EEQA 2VW6A 5JPNC 3CB3A 3WAKA 5BPPA 5CD3B 2V9DA 4OFQA 1IAII 3F4WA 2AEPH 4H9VA 1BOGA 4IRSD 2EAWA 1OF0A 2NNFA 3V10A 1ZXKA 5M7QA 5L6UA 1L6SA 3W71A 2C8NA 1R47A 4DBDA 4NNYB 4JTTA 3RDJA 4MA8L 1ZT1A 2G5WA 4I48B 1GQIA 4NUQA 5HYFA 1OFAA 1BVLB 1HTIA 5E24E 5HJLA 3D12B 1T1YB 2QVFB 2YRLA 4PJXE 4QTIH 1P0KA 3P8IA 4QJ5B 5ANME 2CLRB 5FYLD 1HWHB 3LKRA 1NCWH 2XZCL 3H55A 5CSGA 3PK7A 3PVFA 3RVVD 1J0IA 1MJUL 1F00I 3HBQA 4RMSA 4UQEA 4JYDA 4BQ2A 1F3JB 2YAHA 3PHOB 4RWYH 4CKQA 1OQXA 3VTMA 3PHQA 5FCUH 2HX9A 4LSSH 1Z3NA 5KYWA 2XWCA 1I7TA 1FYHB 3EJQA 5B21A 1KM2A 3SR7A 5JHLL 5F4SA 3DBPA 3S47A 1RY8A 3DROB 4WZ9A 1LL4A 1TSRA 5AFAA 1RPQA 1KO0A 4QRRA 1DJXA 1M1SA 1DWFM 1VR6A 2V9QA 2GSHA 5CG7A 2EAEA 3O81A 4I2XB 2IOMA 3CVHA 3VXUE 3EEZA 5LIUX 4RGND 5BRZA 2I07B 4DFHA 3CNYA 5IW6A 2D7MA 3VIKA 2HRPH 4LV4A 1FIGL 1XGZA 5HDRA 4GIEA 1YEFL 1NIBA 2I5YH 1BD0A 4WY0A 3VNLA 1P1ZB 1NFDB 2F18A 1SJHB 2C7FA 3KCPB 5A43C 2XXFA 1KFAL 1BMZA 2R69L 2PRHA 3CQJA 4I77H 2NUXA 3NDZA 4XO7A 3WKZA 5E9DE 1GYUA 4P7QA 1P4LA 4DAFA 4CCDA 4QLWA 2IQTA 3ILPB 2JIEA 5M95B 5I30L 5IJVB 3EX2A 2YXMA 1G7VA 2P8BA 4QQUA 3BW4A 3K2IA 2WO4A 3HR5B 3OTTA 4RNRB 4YWGH 2C5DC 3KDOA 4WCJA 4K8RL 4O8RA 1WBXA 3T0EA 3CZGA 3GU9A 4DTGL 3ZM8A 4N2OA 5CBBA 3SPHA 2H26A 1GNXA 3S1WA 3W7OA 5C0BB 3WN5C 3RHGA 1HKLL 2HRLA 2L7JA 4KRLB 4FOKA 3MNZA 4IJ3C 2EGZA 4O4VA 1X5ZA 4JGMA 3TLQA 1L6XA 3VDAA 2JVUA 1IAIL 1INEH 1O9ZA 2XSXA 2YXWA 1CXFA 3T2QA 2NOYA 2XX1A 5IDIA 3CK0H 2EVIA 3BKYL 1YXDA 3H2OA 1NCOA 2PU0A 2H8PB 4B15A 4LDLB 4PJ7F 4PJFA 4XCFL 1X5MA 1QFWM 1CK0L 4BCXA 3P30H 4L37B 1KM3A 4PWHA 3QJQB 5MERB 3BJSA 3CTLA 4XZHA 2CO7B 5A16A 1VEPA 1ECEA 2XN9A 1L9TA 3PWPA 1MIML 4KCUA 1JPFB 1XLAA 4A7TA 2ATMA 2DBJA 1TQVA 3R1GH 1OM3H 3ULUE 1XR9A 5I0VA 1GIGH 1A6ZB 1H7WA 4XZMX 3KBPA 3O6FC 2HLFD 1UHVA 4GAJH 4FADA 1VPXA 3P60A 2O26U 5CKSA 2NY5H 4I4WA 4LBEB 5AVQB 5K4ZA 5J12B 4XHJC 2G3FA 4YDKL 4GUJA 3ANYA 4U5IA 4P5TB 4ISVB 1PDYA 4RLDA 2Z1XA 2EBNA 3UCCA 2HPTA 4N8CL 4PTDA 4QY8A 5A95A 1AK5A 3ZO9A 6PCYA 2WYSA 1P7BA 4GSQA 1RUKL 4YL9A 3EFDL 3IVKB 1QNRA 2C3ZA 3EKLA 2IH3B 3W2DL 4MNGA 8A3HA 4I1RA 2XZCH 3WFZA 1Z42A 3LG3A 3RL1A 1F7BA 5T1KB 1GW1A 2EXYC 3Q3GA 2EPLX 5IP4A 5EUOB 4I0PC 1GHFL 4LGPB 2XDFA 5CZRA 2VO5A 1F6KA 4S2CA 3U2OA 3BDYL 2GTZB 2NUPB 3VFNA 3RX4A 4GW5A 4DWSC 1NUFA 3V0VA 3GB7A 1G1CA 2FNBA 2NY0B 2UX6A 1TTGA 1RZFH 1URLA 2Z91A 1I8LA 4BZ1L 4TQHA 3TWYA 3MOAL 3DOSA 3RX8A 4IUOA 4E8CA 1R17A 2BVPB 3NIFF 3OQRA 3FC8A 2HVNA 2X40A 4R26L 1TJGH 3DDFA 3MWCA 4QWWC 1Q85A 4PGJA 1G84A 3VMNA 2GJXA 4JDEA 4JS3A 1Q7QA 2CEQA 2W95A 3T42A 1B4RA 1CE1H 3UXFA 3Q48A 1F97A 4KY1L 4XB8A 1E4MM 4DHLA 1J9QA 1HYRC 2VLJE 1LG1A 3NYKA 4GACA 2VITB 2V2TA 1D2OA 4TRPH 5B7YA 4CVXA 4ZFGL 1EPXA 5DRXA 5ID1A 4GG6B 1JUEA 3EKGA 3C86A 2WUBH 3HN5A 5T1MB 1T83C 3FFOA 4Z1YA 2GT9B 2EO1A 2YFOA 3PSWA 4WTZG 4IH3A 1YEYA 2MOVA 2X4SA 2P88A 2VAJA 4I4WB 2ZBTA 4QEGA 3O05A 3JSSA 4HDIA 4RMBA 4TV5A 2H47C 3IARA 2BP5M 1DBTA 4Z77A 5J04A 3GBML 3UVIA 4C1LA 4KROD 1FPTL 1RXOB 3L5LA 2P5ED 3N2BA 2FSEB 3FPXA 1M4KA 1XGTB 1WFMA 3RNKA 1BQRA 2PXYA 3RP1A 1V51A 1XT5A 3W2KA 3K6SB 3VGDA 4LCCB 3FBKA 3NURA 1PZ2A 1ILUA 3QJFB 5T1LA 3Q3GB 3L4YA 4UT6H 3UGXA 2BNRA 2H3BA 5G4WA 4AW4A 4Y5XB 3VFGL 1YAIA 2YPKB 4NCC1 5D70L 3RUBL 4G3YL 1IGYB 3HF3A 2WNKA 4Z7AA 3PSVA 4TSBH 1H1NA 3KFTA 1QLEL 2AI0H 4GY7A 3QGKC 2UWEA 1JOIA 4P2YA 4Z3HA 4N9BA 1BFNA 1MJ8H 2RR3A 2W07A 4F5CE 1ZT7A 5DS8B 1BD2E 3PJSA 1JYVA 1E5YA 1NUDA 3AHYA 4LLVB 5I3IA 4AYFA 4YHKL 3DUSA 1A5MC 3EO9H 4D9LH 1OJXA 4Y16D 4AU0A 1HJBC 1NGZA 3QUGA 4B2DA 2YMXL 3RWHA 3HMCA 1FVPA 1W0VB 3ZW3A 2IXQA 2PDMA 4IMFA 2AL2A 4EPDC 3IIXA 1F2QA 4TUKH 4BFIB 1RURH 2CPUA 1G7LB 1UD6A 1LTXA 3RBGA 3TF4A 4FG4A 3DX7B 2VUNA 3STCA 4H9ZA 2VSDA 3Q13A 2AK1L 1IEIA 2DAVA 1G9EA 4R5EA 3CNKA 2YD1A 3A67H 2ZCLH 1ITBB 2R0ZH 4W5UA 4K7FA 5TDPA 4DVOA 5DRXB 5ID1B 4PMOA 5B3NA 3FW6A 1WHPA 3OL2A 4GP4B 3A24A 1MQ8A 4MMXB 5DLML 1FP9A 1K4GA 3NFSH 2V82A 3OB8A 3D47A 4AGQA 2BIIA 1YN7B 2NY7H 3S0PA 1O1ZA 3NPUA 4HJ0D 8CGTA 4GUPA 2WQDA 1ZE3C 4X63A 5DMMA 4CU7A 2QCFA 4P4RA 1EK3A 5HI5D 1DSFL 3N34A 3FZUD 5IROC 5D09A 2CERA 1FFOA 4HU2A 2OZ0A 2ISFA 3BUIA 4C4KT 4X2PA 4XE5B 1WS7A 3OWEA 4NJAH 4OGAD 2RHGA 1KACB 3QDJE 1XGYH 4XBEL 3WIHH 3CZJA 3QFJA 2OCJA 3BG5A 4J3OD 3ULVC 3F7RA 4IX0A 1TJMA 2JQAA 1NCDL 2NY6C 4C8XA 1XO8A 4M7KL 4PY7A 4X4ZA 3G6JA 3SQBB 2NR6A 4J4KA 3TUUA 4F93B 4LRIC 5HHXL 5C0IB 3KH4A 2D69A 5K9QG 4OQ1A 4M80A 3LMJH 4S0TD 2G5RA 1NDGB 3QQ1A 1TVHB 4FABL 4GA8A 2Q1EA 3VE7A 5K59F 1V08A 3NT0A 3FJ6A 4N4PA 1QZ1A 1NEZA 4FXTA 3RTQC 1J1PL 3VXRA 4DT2A 3WLSA 4G43B 1CE6B 2L7QA 4NNXA 3M07A 3NGJA 2OMZA 4ABQA 4HALA 2OLSA 5MHSE 3M9YA 1FFTB 1ODAA 3M7OA 3OHXC 4H26B 5KVGL 4L18A 1IEQA 2UY6A 3DO7A 1PHQA 1JGEB 4WI5A 1T5AA 1IBGL 4UM9B 3IT8D 1XS2A 2NY5C 3B05A 2WKJA 1IM9B 2ATKA 1DO6A 3G6AB 1UWRA 1BVWA 2PI6A 1AS6A 4JY5L 5BZDA 5JZ7D 3WFBH 5DSCB 1PJ9A 1UZGA 1CF8H 2OKOA 4YSAA 4YAQA 3DG3A 4H9YA 4LUJA 1BQKA 3AYSA 1H5VA 4BSVA 4DPPA 4CJ1A 1YRKA 3G5WA 1UC5A 1MCEA 3FQ1A 8FABA 3HURA 5EUOF 2AXHA 4RFNB 1Q9OA 2P8LB 4JFSA 4KKBC 1F2JA 2WSDA 4CD8A 4CGTA 5PCYA 4M5ZL 5IK3A 3ZVHB 1FVDB 2I85A 5DJCB 1FBIH 1T7LA 4NO3A 5H6HA 1NBYA 3EGSA 2BX7A 3FBQA 2OLDA 3QEUA 4Y1AB 1B9KA 1AAJA 4HWZB 3KBHE 3TN6A 2AXFA 1D2PA 2P3YA 1J9YA 3F5JA 3EGDB 3MJ9A 3PZMA 4LUSB 3SY5A 4N9OB 3TZFA 4G6KH 4M6MH 4PWIA 4DJFA 2M83A 4Y5XC 1KGCD 4JM2D 3RY4A 4NRSA 1PTAA 3HE6A 2R83A 4P59L 1IEAB 1ET8A 4HPYH 4Y16C 2OP4H 3LOTA 4X6FA 4LCCC 4OCXL 4YE0A 3RG1C 5CJQL 2QSCH 1KGWA 3F85A 2Q3ZA 4AWJC 3FT2B 2DQXA 3DX5A 3R7QA 2X1TA 3EB2A 1CGWA 3A6BH 4AQZA 5E00B 2JKEA 2HKHH 4W4OA 4DUOA 5CZXC 3ZMNA 3RBSA 3UAFA 2ZUVA 3WHE0 4DUWA 3ROLA 4LPUA 4OF7A 5C92A 3FH5A 4LOVA 1GCFA 1LBFA 1IM9D 1EBAA 1MLCB 1KM1A 2GY5A 1BZ8A 3MLZL 1GZJA 2ZRWA 2CLLA 2B59B 3DK2A 4WDXA 5IREA 3LHYA 1CD0A 3EH3B 1AA1B 2NW2B 1MF2H 1SRDA 1LOSA 3NZUA 2WVUA 5AVNA 3K0YA 4DP5X 4F7KA 1DQIA 2H1XA 3NSMA 3Q44A 1GYWA 3HE6C 5FA3B 4AIXA 3KL3A 4X2RA 3FK3A 4P2QB 4Y5YC 3C6EA 3CQKA 4Y9BA 3CL7A 2V33A 4HH9B 4N85A 1NEYA 3BAWA 4OJYA 5D2NE 1KV7A 3BUVA 1VLXA 4GUGA 3ZVIA 2AJXH 5FECA 5CEYA 1Q8JA 1Q94B 3CN0A 3Q7JA 1L6PA 1EO8H 3OKEB 1IM3B 3G0SA 1OP3H 1MCRA 3QAZC 1IAKB 1XCTB 2AMUA 4PRNA 1NSJA 1PCWA 3HM7A 1E0UA 3GZKA 3SSZA 5A2CA 3Q5TA 5IFHL 2R0WH 4E6MA 2PLCA 2IKGA 1RJYB 1PDKA 4IDJL 2CFFA 3W22A 3DIPA 1ZCOA 4GI6A 3D69B 4Q8BA 2ITCA 4HWZA 3WFEH 3VM7A 2IQ0A 1B9BA 3CPLB 5LG6A 1Q66A 2C16A 5JHLA 4FP8L 3QHNA 4CQAA 2OX5B 3PG2A 4HG4J 1FCUA 1YE6A 3QIWC 1PD6A 4F9JA 2VDOB 4WWID 4YCPA 5BWFA 3TBTA 2CU0A 2B31A 3H56A 4Y2OA 4XO5A 5DT1L 1JZHA 5EO9A 3BSZH 1EEYA 2IAMA 3L23A 4AITA 3OGOE 1T20B 4QG9A 3LGDA 4AEHH 3FT2A 2Z2UA 5JPNB 4ZUSB 4WQOA 1D3GA 4ZXBD 2ACQA 2CK0L 1I0DA 2ZCKL 1TFHA 3I6KB 3RKDD 3UTTA 2DTSA 5BRZE 1X4XA 5L4MA 1KFKA 1GJWA 2QQNH 5DMGC 2MCAA 3GHSA 2FQGA 3ZL4H 2EEAA 1MLCA 2IDQA 4ORZC 2DJXA 5CO1A 1ITCA 3KJ4C 5CSRA 3Q05A 3EZ4A 3C56A 3MGTB 4HS8L 2ITFA 5CHNB 3CVHH 1UWGL 3RK8A 3TWCH 3BUQA 2VLRD 4F7CB 1ZGLP 1EAOA 2WWDA 4OLWH 1H15B 4NAFB 4PODA 3SCOA 4LAUA 2J8UF 2HFTA 3VI4A 2BZNA 4A37A 3WTWA 3G8RA 2E75C 2VMEA 3EFOA 4G9FE 4WVXA 1I3UA 2FPYA 1SM3L 4JRYE 1SFLA 2QCDB 4UB0H 1T0MB 3QULA 3VKBA 1S7WB 3VYLA 1HSBB 2BY0A 2VH5L 1CD1A 1FH5H 4ETQA 3N0PB 4J5NA 3SCRA 1CWYA 3NIGB 4M5YL 5D71L 5I1IH 1TRIA 4QISA 3MBXL 1TQSA 1F9CA 3T3PB 2DDQH 3HR6A 1ES0B 2PP7A 1POJA 3BQUB 4XN8A 4NKCA 3OA5A 1MCSA 3EF7A 4NKOA 4MPQA 1RBAA 5G2HA 2FO4B 4LHUB 5D96C 3WN5B 1OAQH 5D93B 3SN1A 4KRMB 1XF2A 5IVOA 4TQ8A 2ZSVA 3GHBL 4NJ9H 1RIUH 3CFKA 4HK0B 3S35L 1MRAA 2V17H 5JHDD 5CG0A 3O2DH 5DLLA 1RU9L 1JN6B 4YTRA 3WNPA 3PUDA 2RMNA 5DJZB 2ZC8A 3DROA 1HJUA 1PG7H 4LDEB 4O2FA 1Z69A 2DM7A 1EGJA 1T20A 4ZPVB 2E9BA 3DETC 2BZ7A 3UTTD 3OQEA 2GJJA 3Q8CA 2WQVA 3MC0A 4OCLC 3UTPD 4ZUSA 4NN6B 5IFAL 1K3IA 1N55A 3ZS4A 4ZFFB 5L88L 4D1IA 4A2MA 5C7XH 5HVHC 1ME7A 2P3EA 3WLHA 4G8GA 2O5YL 4NKDB 5DFVD 1R5WB 3RUGE 3TNMA 3DO4A 3RLVA 3MRFA 2CLKA 4LSVL 2ZX8A 4XR8C 3MRCB 2QZ5A 3QNYB 3RA7L 1CFTA 4KVCH 4KITB 2VABB 3GXPA 3GZOA 1TITA 3PFUA 4U1GB 1EJTC 3BPCB 1T0NB 1P4LB 2VXTL 4K15A 1U95B 4J4PA 4JDVB 2XKNB 3T4YA 3VFSB 1DYSA 5TH2B 1WWCA 4IRJC 5D2NC 4GYFA 3A4EA 4FZEH 2Z9TA 2DKSA 4NQDD 4UDTB 4XOAA 1P4BH 1KIRA 3GMNA 3IMSA 3ITYA 3E2HC 4P23C 4F3HA 4ZAKD 4M6OL 4QD2E 4UQ3A 3U30C 1QPKA 2OULB 4ENZA 1OV8A 4PV8A 3O9WA 4HJ1A 3MSRA 1SJHA 4KETA 4Z42C 3EOUA 2HCZX 5CIPH 4NJHA 3X3FH 3RZCD 3USBA 3WS6A 1XGRB 3D85B 4F20A 3VFTA 4R7VA 4NQVA 4HTYA 5AOJA 3B34A 2CO6B 2G30A 3P0GB 3U4EA 3DX2A 2AQQA 3BQUA 3W4RA 5KYXB 3DUHA 1AH3A 2H7WA 1T83A 5FL1A 1IGIL 1UGNA 2CLVA 2HJLA 4UZGA 5HHNA 2CSPA 4JTUA 4NOBA 3ZE2B 5CNHA 4MA1B 3TAOA 4MSSA 3DFHA 2VZUA 4EJ1C 2GGGA 1S6NA 3VXNA 3ZVVA 1E71M 1X7IA 2YX0A 3N4AA 5GVJA 4JRXA 2GPZA 6XIMA 1LP9B 2P10A 4LSQL 3T4AA 4RFOL 3QN3A 1A65A 3W26A 2VD8A 2X8RA 2IDTA 1UUQA 4ZPVA 4S3BA 2X42A 2VX4A 1WNOA 2Q76A 4X9HA 4NPJA 3WUWG 4PBVC 1A1OA 4HJJH 4YL4A 3KDMB 4Y4FA 1QWNA 4ZTEA 4R0LA 5GSRA 15C8H 4KV5E 4B5EA 5REQA 1FNGB 3TCEA 1YNKL 1KCSH 3OZKA 5TE7L 1E65A 4S39A 2E6YA 4QOKB 1NSNH 2BO0A 3QORA 4MKNA 1IBBA 3VTAA 1U91B 2CRYA 4HCRL 4Q33A 4O0KA 2YB1A 4JFTA 3A23A 3AXLB 4I0PA 1H7PA 2V2XB 1J10A 1MFDL 3P02A 4I9WE 3E7JA 3I6EA 1NBZA 4WJXA 4FXSA 3ILQC 2CBIA 3EJYC 2QTVA 3C8KA 3GZQA 5FAGA 3VIGA 5ITBL 4F9PC 3PTDA 2AJVH 2IJ0C 4JCMA 4S1RL 5CSBA 2F74B 5LBSH 1HILB 3TJEH 2VXQH 1P5BA 5CC3A 3MO1B 2FWSA 3WLBA 4S38A 5EOCJ 3OG2A 4URIA 2QPDB 4ODHL 2OTWB 4PUBL 4R97B 3VFNB 5GZOC 3FT0A 1E4WL 4DIXA 2J24A 3NZQA 4J40A 4ACZA 3SO3C 1NOWA 3WJJC 4F40A 2EO9A 3QPQC 4HC1H 4NQVB 1WXJA 2AVFA 2CO6A 3MVSA 3RZCC 3U4EB 2VEFA 1C12B 5DD0H 3NQBA 3WFCL 3QIWD 1DN2A 2WIMA 4GSRA 1GGYA 1N7MH 4LGSB 1BYAA 1JFXA 1H4PA 3LK6A 4PUKA 4PRBA 3CAFA 3SRHA 2CUAA 2B08A 3GSVA 1KY7A 4OOUA 3L5XH 4XP4H 3FQUA 5KVFL 4KGLA 3EPOA 3M0MA 4MMZB 2DYSB 2WHMA 2VITA 1MG3C 4O9HH 4U0QB 2V2TB 5A6JA 2HN7B 1IBDA 3HBZA 4QOKD 3EA3A 1PGRB 1YHTA 4JIHA 1O12A 3OLGA 3DXIA 3JXAA 1K2DB 3MGAA 4JDEB 1B3WA 1QBBA 4G9DA 1FUYA 3ID7A 2XRAL 3D05A 2J77A 1OFPA 2AEQL 5DXWA 4IEFB 4XAYA 3JV6B 1KA9F 1LT8A 4GAYA 3OB0H 4X3ZA 3GB6A 3V4UH 4AKOA 2HBVA 1WBZA 4JPQA 2V68A 1FH5L 3E8UH 4L5ZA 2MIZA 4NXSA 4DPQA 2POZA 4ZQNA 5CCKL 3MDJA 1PVHA 2GT9A 2NV1A 4YIWA 5GGTL 1HI6A 2R1WA 1EX0A 3QG6B 2HT2C 2OMUB 1PLCA 1U8MA 4ZB0A 5EOQH 5JHAA 4MAYA 1R9FA 1OGAE 1BQLH 4N2EA 4NUJA 4BK5A 1XR8B 4N22A 4N20A 5D4QA 3BGAA 4JKLA 4JZNB 3OLIA 1F4AA 4LVDA 4X98A 4JQXA 1RV6X 1JMXA 4CILA 1IC7H 1SBSL 1GGIL 4CMHB 3RNDA 4FA6A 1U8LB 2MCPL 1IZCA 4IGBB 4Q9RH 5DEFA 2NW3B 2NDFA 1HJQA 1BYCA 1GKEA 3T77A 1OAZH 3H9HB 4HLEA 3O45B 3DHUA 1XD1A 3OKKB 5FHAL 3HOJA 2C3VA 1D2KA 1FNHA 4JW3A 1ACZA 4NDMA 4K23L 4YLBA 2BNRB 3ITTA 2CIKA 4XVOA 5AKQA 4GIYA 25C8H 2A9ML 1JMZA 3MROA 3VI3E 1B3ZA 4GPNA 4DWDA 1FL6A 3OKNA 5IBTH 4NNAA 4FAMA 2X1QA 1CLYH 4HHGA 1U3HD 3UG5A 3FFCA 3ZQXA 5FK9B 1BXNA 1E4KC 7ENLA 2F1BA 3RL2B 1C8YA 4C6QA 3ES6A 4S11A 5AOUA 3PJSB 2VXSH 4GXFA 1AZ2A 1KLFB 5GIRA 5J5RA 5D1ZI 2FH6A 4A63A 4L8SA 5DRZB 4B0MB 4F57H 2C13A 1GAFH 1ADQL 1HH9B 4NO0D 3CLMA 4HT3A 4N7QA 1GPOL 1W6LA 2XQBL 4V27A 4HJIA 4PMNA 1F45A 5A8OA 2WTPA 1S9XB 4JPWL 2J44A 2O6EA 1QZNA 4M62H 3DFOA 4GJIA 1A64A 4KWVA 2F2HA 4Q4KA 3WNNA 1LOQA 1A22B 1TETH 4Y4FC 1W9BM 3SO7A 4CNSA 1Y1DA 4OUEA 4IKIA 4XKYB 1PCKA 4JVWA 2IH9A 1A1NB 3B3IB 5HHPA 4L4TB 3MV9E 2KLTA 1EJVC 2ZX6A 1FL3B 1XLEA 1P43A 1XYLA 1B2WL 1YRRA 4KK9D 2YS4A 3DFTA 1Q9LA 5F70A 4X5PA 3PZIA 1YEJH 3GSNL 4HWEH 1NGPH 1YMYA 4KPLA 5HINA 5LKYA 5CILH 2DJ4A 5IVZA 3UJJH 3MRBA 4KO7A 4DUXA 4N8VA 1GC1C 4GO8A 1BOGB 3ARRA 1AOHA 3P5YA 4QR6A 2EDWA 5D7SL 1NMAH 5HNUA 5I06A 1LXMA 4RZ4A 3TA3B 2VKWA 4R26H 3I7QA 1ZT1B 1EFXB 2PN5A 2WQWA 4OIIL 3MCKB 1ODZA 4XB7A 3FTGA 1K4HA 5CAYB 1A5AA 1EERB 4DSYA 3HI1A 5D7IE 1IWBA 3PWGA 4AZCA 5DO2D 5IKCA 1XISA 4N6RB 2OZ4L 3MBWB 3WS6C 1YPZE 3O45A 5DFWH 1CTMA 4G8FB 4LOEA 3RPIB 2WY3B 3MV7E 1AZBA 1WBYB 2XA8H 5BS0B 2J1WA 4GMSL 5A6AA 5HK4A 2VOTA 2WIIB 4LB4A 4QCIA 1FWRA 4PJ6A 4NO0B 5J6GB 4MAUH 1ECQA 4OFIA 4AD5A 3UJRA 1LGVA 1CZ8H 1D5BB 1F61A 2VLRA 1QNZH 1GVOA 3D9AH 2PPGA 3Q2CA 3WE6A 1P0NA 5TE6H 3GMOB 5F7YC 5JPMC 1A3WA 2JGYA 3LZLA 4MX7B 3TJHC 3KR3H 2VLJD 1H5BB 4DKTA 4OCYH 4YHYB 3PZNA 1KBWA 3O11A 4YAQB 3R8BB 3OVQA 4DXKA 3IRSA 1KV3A 4XNZC 5KSBE 1QO2A 3DVNA 1G9MC 1UD3A 2JNZA 4HHMA 1L7IL 1NFAA 1TJHL 3MJ8A 5DJ6A 4ZXBA 4L4TE 2IH8A 5D9SB 1NEZG 1F2XK 1I1YA 3ABKB 4CD6A 4M6NH 1QLFA 5AYXA 2V7HB 5CD5D 1J93A 4MSWB 1QACA 2ADGA 5DQ9B 3D39D 1LWHA 1VCAA 1G9NC 4AEHL 3LSCA 1GKPA 2ZVRA 1AZCA 3B7YA 3FTVA 4GUCA 5GS0D 2BVQA 4H4IA 1C8XA 2V81A 2YGQA 5CP7A 3EOAA 3W53A 1GGOA 2O56A 1MUJB 1Y0LB 3IDNB 3COOA 1PX8A 5I79A 1G7JA 4GUIA 1AG1O 1SXNA 1TV3A 1QOKA 3MRHA 1DXIA 5LNWA 3SQLA 1YTEA 4FL4C 5EPMB 3TA3A 3F1QA 1Q1JH 3QZOA 5PAZA 1OB1A 5I5IA 5L9DL 5FM5M 1BGGA 2AXFB 2PD9A 2R0KH 3BQUD 2V3GA 3UMTA 2YDSA 4P3CH 4WO4A 2C9VA 5ESAA 1JZ7A 4BGDA 1J5CA 1DQUA 5KJRH 3SDDA 2H32B 3G3MA 3GSMA 3GLCA 3ELQA 3KPQB 4G8FA 4HIJB 3RPIA 1H9VA 3ZLGA 1RLBA 3NQIA 3X3GL 1G1YA 2B59A 4JPWH 4X6FB 3U2JA 2GL5A 4ZFMA 5DQDH 3QUYB 1CDCA 4NZ3A 4PJXF 3VJ6B 2QR0B 4BZ1H 1JVOA 3NDYA 3O07A 4ZAKA 2VVNA 3BN3B 1K4DA 4HQQH 1BRLB 3EAUA 5BXRA 5CGYD 3RJOA 4YBLB 3JRKA 3QC3A 4JPVH 2UWFA 2TMDA 4IMGA 1QBLH 1Y7VA 5I8KL 5FECB 3QI9A 2HA1A 4L65A 1RLWA 5I2IA 1SEQL 5C0ND 4OTXH 1GGBH 4JHVA 4MJ5B 5E8PA 4F3FA 3DDMA 4RL3A 4L1TA 4OAWB 2ADFH 4R4FL 1R6VA 4BDVB 2E9LA 3QDJD 2FDMA 1JCNA 3K0WA 3C6SA 4PJXB 4WXZA 4MASA 4PEEA 4CQ8A 3RIAF 1E5AA 2VR9A 2XWTB 3FRUA 3AS2A 3OF6A 4JTJA 2IWKA 3DTXA 2BXYA 5AAMA 4EI6A 4Z7NF 4PCSA 1RPUA 4GKTA 4ZE5A 2IAMC 3NACH 5EDSA 1NGQL 4XQ6A 3VYNA 4IGHA 2WZTA 3EOAB 5MEPA 1ZEAL 3UZQB 2PWUA 3DFYA 3M0XA 2OSXA 4LIQE 4MG4A 3LZFH 5DMLA 4H8UA 2CPCA 1Y6KR 4HUUA 1RMFH 4O2EA 5CPLA 1TZ7A 1BXCA 4JY6B 3DCPA 3H4GA 4JGDA 4JTFA 1OB1B 4A67A 3RM8A 3W27A 4NZRH 4Z7WB 5C9JA 2VXUH 4Q8UA 5KYUA 5HHOA 2F8QA 4NYUA 4FB7A 2PW1B 5E9DB 4FP1A 2KKQA 4MYXA 1HQRB 1QFPA 4QEEA 4US6A 4DY1A 3VFGH 4GLRI 1R85A 4OF8A 1NFDE 4XMLH 5LBSA 3ESVF 3CWNA 3UWUA 1MEIA 3WK2A 2PGRA 1XWVA 4HVXA 4OGXH 3QUYA 1KXTB 1VJIA 4IMLA 4M62L 3IIPA 3GUTA 5I3FA 2R9HD 1HN1A 5IB2B 3IS0X 3TU9A 2FEEL 4QNPF 4PULA 1AXSB 5FM4A 5GS1B 5GRVL 1PIIA 1UMLA 2NUWA 3KPSE 5DWPA 3WDPP 1YYMH 1XCQA 3MTWA 5EZLB 1SGJA 1CGVA 2NY3C 4HXBL 4M1CD 2O4QA 4EXKA 2V2CA 4NERA 3QZBA 3L5IA 4LCUB 2WWNA 3H3BC 3QZPA 1GL4B 3I3BA 4MLSA 5IMMA 3K1GA 4EI5D 2AKMA 2EVJA 2HSAA 3NA8A 2ZCHH 3NZHH 4LZKA 3FYYA 1AE6L 1T5KA 5TQLA 4HCIA 5C08B 4Y7OC 4M5PA 5DMNA 3OYZA 1O66A 1LL7A 1I8JA 1GC1H 3G5XA 1GPWA 1VC4A 4B91A 4JEQA 5HUOA 2FJHA 1AVAA 1G7QB 2FAUA 2BOLA 2WXLA 3HLKA 4HN4A 1H50A 4JHOA 2Y06H 4QR7A 2DQCH 4Q22A 4CL7A 1V55B 1YIXA 5F6IC 3HBPA 4LBAA 1EDGA 4I3RL 4N90D 2EDLA 4Z23A 3C5QA 4S3DA 1EAPA 2RTTA 3GIZH 4Y5XA 1O7DC 3C2RA 3LMJL 4CW1A 3UD6A 3UBXI 1K8IB 1G43A 3II2A 1S9WB 3DHDA 3TJ4A 1CYWA 3APNA 3PTQA 1HOEA 4JJOA 2GZXA 5DJ2B 5I1CH 4IIBA 5J6SA 1QKZH 3S4TA 3IANA 3GDTA 5D7IB 2BFVH 3UBXB 5KZEA 4KUCF 1AW5A 2DLHA 1J79A 4NKDA 3OZ9L 3PZVA 5AVVB 3IK2A 3JT0A 1A5SA 1UP0A 2A6LA 4ZTYA 4AT6A 3CLFH 4LSUL 3Q8AA 1UJQA 3RWEA 4G80B 2OJPA 1YAZA 4L05A 4BZ2H 3KS6A 3IJHB 3QRHA 2DPEA 3QUZB 4H6EA 3P9LA 5KBDA 2QVTA 2HP4A 5HQLA 2OXHB 5MKGA 3EKCA 4JDVA 4C6BA 1EUUA 5TH2A 5JVLA 1T6VN 1DQDL 1X4YA 4XD5A 1MF2L 5I0DA 2BCKB 4S3AA 5IBUB 5CINL 1KJ2L 2W66A 3O2LA 3PUCA 2I7OA 4XMKH 3MS8A 1T6WA 2VN7A 4PI0A 4RDVA 2IBBA 3BP5A 4KXDA 1UWUA 1FZKA 5BWAA 3FCTA 4X5XA 3V4VL 3REQA 5FKPA 2DGAA 1SSGA 1NJ9A 3IDUA 3RTQA 3IMRA 3VFSA 1TJIH 2ZYHA 4OI9A 2K7QA 3C9NA 4PJAB 5BO1L 4BH7A 2PDBA 2VP8A 3G1VA 2DMKA 4KZCA 3U7YH 4JAWA 5F2LA 4H25A 1B1YA 1BMWA 3QDGB 2WKOA 3Q0HA 4UMGA 3DRTB 4JBSA 5CKGA 4YIQB 1EHAA 2X3BA 4QHPA 5DUBA 3PBVA 5BMWA 1UATA 1C5CH 4PUMA 3H3KA 5ABEA 2OMXA 3WLOA 1FWEC 4UOW0 5GNXA 2ADAA 4S1DD 3KOYA 4A22A 4QROA 4R7NB 4HXAH 3DOSB 4QRRE 1QEWA 4JIPA 1JE6A 2X3CA 3WXVL 3ZWTA 1FKWA 5I09A 1G7PB 5B3JE 2J88L 4CADB 1ZJIA 1L6GA 4YXKL 3G6JE 4FTVD 2NVCA 3I7SA 5AYIA 1E4XI 2PDUA 3BZGA 1IVTA 1XYBA 3Q67A 4U4BA 4RAVB 2E40A 4PRRA 4FOJA 4I0KA 5KS9E 3GVGA 3MHFA 2PCFA 8XIMA 2PYEA 4B3VA 5TD4A 1FHLA 3ME0B 3D0AA 2ZZ4A 3LENA 4XXDB 2H0PA 2X4UB 3TW6A 2VSMB 3NCXA 4R4ND 1L6ZA 1B3OA 1ET5A 4XP1L 3OKMA 3I10A 4EANA 3QQNA 1CMOA 2ZXDA 4RDQF 1SXBA 3MLVH 3KPMB 3GKZA 3TEXA 1Z7AA 4N9GB 2R29L 2V5RA 2RKXA 4W9DC 1UKSA 4ZFZB 2YL9A 4FRWA 3K8LA 4NQSA 2WBXA 3LI1A 3ZJ8A 3W1AA 4EKXA 1GEHA 3TCXA 1XP3A 2YJLA 1BXXA 3T0CA 3VOIA 2NY0C 1V79A 43CAA 1DVFA 4PMQA 1M7IB 1HWGB 2VQ4A 1UH4A 1CCZA 2X4TA 4NKMB 2VLLB 2FKPA 4AQ1B 3AWOA 1HHGA 2A2IA 3MREA 1OHQA 3G6JF 4GQPH 5L4FA 1DWGM 2W59A 2APFA 3B2MA 4PGCB 4O1AA 5E7FA 1B31A 1E27A 3PNWA 1XL4A 2AC0A 3MHZA 1X6LA 2X0SA 3RDTD 4IISA 1MCWW 3V9FA 1G4SA 2XPYA 3MSPA 4JJ5A 1OYAA 1F8IA 5JOPE 4EDWL 4XSMA 1MWOA 3D18A 3TC6A 4WF7A 5D1XB 2OYLA 2D03H 2JQZA 3HMXH 3L5JA 3V6BR 3TPKA 4GQQA 3PAZA 1JPGB 3T1GA 2V0TA 3AG2B 1MCWM 1W72L 5H8UA 2Y7DA 3QZEA 4ERAA 4NWTH 2DEYX 5KBKA 2MPAH 3MCYA 3IJYB 4OGYH 4U28A 4XP6H 5L2KB 5EMJA 1HH6A 4R9HA 1FIEA 2E8ZA 3QZLA 2JF7A 1RK0B 3QJHA 3N4EA 1PZ1A 2GIYA 2AL2B 3EB3A 3GJFB 3QT2A 1KYDA 5C0GB 1FDYA 1D9KD 1UZ8B 5L8LB 4H4NA 2F1AA 3JV6A 5D7JB 2H6RA 2H9GB 3D3VE 1LO2L 3MRGB 3OXSB 3TN0A 2P52A 2REQB 3I4KA 4OZOA 5FFOA 1SLXA 1FFNB 4TNWK 4P2QA 4B4FA 1LVEA 1A4BA 1JPTH 3OAWA 1XRFA 3K46A 4Z7UE 1O6IA 4TQTA 3QG6A 3H2FA 3I50L 4WTQA 5FGSA 1HFUA 1ACYH 4JHAH 1O6SB 4DN4H 3D4CA 4Q7DA 4XMPL 1SVCP 5ITFB 5FJTA 3F7PC 3OKEA 3VH8G 4JY8A 5C09A 3SUTA 3THAA 1U4FA 4FG2A 3ENEA 3H2EA 5LCVA 4ZMAT 2X1OA 4GGHA 3WJLA 4ADUA 1ICSA 4IJRA 1RZJL 5GGVH 4XP5H 3FTSA 3UWEA 1R6WA 2XGZA 3DPBB 1A25A 2YA1A 3FU3A 2CNZA 2R4SH 4XXCC 1DVFD 2BNRE 5FGRA 5AB3A 3QNZB 3EZ8A 4XOBA 2KHAA 3CN4A 1NBQA 1UB5A 1GVQA 12E8H 3NRQA 1UM4L 2QKIA 3R79A 2ZKHL 1XR8A 3D5OF 5C8JB 5I1GH 1LLOA 2EDBA 2J4WH 4H8WC 3SQOL 4DWSA 3HNVH 1YX1A 3HPFA 3E0IA 1OAXL 4MXQD 1RUPH 2X0YA 1SR0A 3D3VB 3C60D 2HEJA 4PMYA 1AH1A 3RDKA 4BV1A 3QY6A 3PBWA 3US9A 1KENL 5LBGA 4XCYB 3OU8A 2F08A 4OZHE 3L4VA 1ASPA 4WWPA 1ND0A 3L4ZA 5KTLA 4NDMB 5E2WH 1OCRB 1CVSC 2PCYA 3QFDB 3W0WE 5E5RB 3PJNA 4HCRH 3W37A 2FO1A 4XPBL 3QJHB 1AD0A 4RVBA 4HZ7A 2VR7A 3GPSA 3N5AA 3Q8FA 4E5XG 4IS6A 4CD7A 3CFMA 4UMSA 5F7WC 2Z0BA 1HDMA 1J4EA 4AZ5A 4L4LA 1U3HA 2WJ5A 5HNNA 1ADDA 3AYVA 4G7EB 1FCVA 4HJJL 2PC8A 4FZEL 2RFGA 2PRMA 2W80C 4PQXA 2BC4B 4M6UA 5LGZA 3DOHA 3KYNA 3RJQB 1T3FB 2DN7A 3PGFL 3RWFA 1GZPA 3CN1A 2P8LA 4Y5VC 1MAML 3WJLC 5K9JH 2Q0ZX 3O0LA 2DB8A 4ELMB 3BRFA 3P67A 4HPXA 3LIZA 4MJ4A 4KZDL 1M3JA 1K6QL 1XF3A 1MFCH 1XH0A 3J27A 5EWIH 3RDTB 2WBGA 3W85A 3RIFK 5IHLB 4QO1A 5IQ7H 2HZGA 2YEQA 2IW0A 3WIAA 1BVZA 4W68A 1QCWA 5GHWL 4AH7A 3VQ1C 3EBAA 3LNFA 4PB9L 1JQXA 4Q0XL 1W6TA 2VC2L 1PYMA 2VR4A 1G7MA 4PJ9C 3RWGB 3WN5A 1IE7C 4R8WL 3MOBL 1IEVA 3HGOA 3W7MA 5JQ6L 2PW2B 1WBYA 4AIZB 2I9UA 1XB8A 2ZSVB 5BQ7A 5IMKB 3WFAA 2AAVA 3DV4A 5CCHE 2FCBA 3V4LA 5F9WB 1ZU8A 3E12A 3FONB 3UTSD 1T4KB 5M1TA 1QPQA 5E00A 4DJEA 2R2HA 3D48R 3U25A 5D2VA 5BMXA 4UQ2A 3PWNB 4NQCA 2CQVA 3VFVA 1YN6A 2JB6B 1GW0A 3GMRA 5G5DA 3BW9A 3IDJA 1KDIA 4QXGL 3L0GA 2GBUA 1TQBB 4IIDA 5CGTA 2BOCB 1JZ4A 1G4TA 4INFA 3HZKA 2GYSA 3MR9A 2Y7EA 2FNWA 5JOEA 3MYZA 3C2SA 1KTLB 2D7QA 3FQWB 3MLYL 4OZGF 4WUUD 2XJ7A 2ZAHA 3UJIH 1EH9A 4OE7A 2WLMA 3GQYA 3L9EA 5DJ8A 3UA4A 3AQXA 2FQIA 1QLFB 2PCXA 3U1SH 3WE6B 1J2BA 1MCQA 3GFZA 3V6OE 1CU4L 2YO3A 4NN6C 3PAUA 4XAKE 4ZX3A 3OAZH 4NUGL 1TU2B 7FABH 1AD1A 2PWVA 4KCTA 1F11A 1KYOK 1LZOA 1H2JA 3VOHA 1ILSA 4ZTOH 4HUNB 1CL7L 3FDGA 2J71A 3PZTA 3KLHC 3KYNB 4KQNA 4WEBL 5CJMA 1RSFA 3E80A 3UZZA 4XX6A 4LAMA 3I6RA 1UM6L 1IILE 2CETA 2BIPA 2AV1A 4NUMA 4PCKA 2ZYIA 3FFDB 3QYSA 5D04C 3LDBC 4M51A 4ZK8A 1VCFA 3TVAA 3VDBA 1AODA 3IV8A 2NLJB 1RVKA 3LPWA 1AHKA 1E28A 3D85A 2ZUXA 3NFNB 4HGKC 3OMAB 4JIQA 2HT3C 3MV8A 3KS0H 4PD4J 4YFEA 2XY2A 3MMDA 4IHOB 1QO3A 3B5HA 3DAQA 5DMJB 2UWEE 3C2VA 1GONA 3MXWH 3CLWA 3E9UA 4DBWA 5T26A 4N28A 1G7JB 4XMUA 3AT9A 2DIKA 4LANA 4OY9A 1DJZA 4UTTA 4PLNC 1A21A 4GYJA 3O6YX 3VGFA 4AIEA 4AY7A 4P2QD 3DV4B 2XDHA 1USZA 3N43B 2JWYA 3ML8A 4K3EL 4XWGH 5ADPL 2Z6IA 3TCSA 4KI5F 4HAGA 2H6PB 1TDQA 2H2SC 2KQNA 2YD3A 1K4DB 3CVBA 5TDOA 5EF2A 5BRBA 2JB6A 1BKSA 2NY1C 1CEOA 2EKCA 3QE5A 2DMBA 5IV2B 4IG2A 2YZ1A 3NSJA 5JXAL 3ORWA 1JPEA 5CHNA 1Q1PA 2ARWA 1KGUA 1QUPA 2HVJA 4FHBD 4HDIB 4WEEA 3WLLA 2XQYA 3UPRB 4ZOBA 2DLFL 2EXTA 3BZEA 1OAUL 4KQ3L 2IMNA 3H9SD 2GGHA 3GO1L 4P4KB 3U0TB 3TE9A 2BOBA 3RX5A 3LRGA 2C9XA 4KUCD 1GZQA 2EYRB 2DQUL 4M1CC 3VFUB 5KUMA 1KW1A 4D72A 5AC7A 5D4JA 4X7TB 1KCRH 3CHOA 2G9HA 3GKWH 3IYLW 4IRJB 3NQDA 2ALDA 3ZO0A 2XG5B 1X6NA 3FQNB 1OGBA 1FHDA 4KRNA 4KTDH 3JVFC 4NAJA 4Y9FA 1V0NA 2EG7A 3MO1A 3NEHA 5JTWA 3TFKD 4KHTL 5J5EA 5XIAA 4Y8DC 1LHZA 2MCPH 3KTCA 4M24A 5KSAB 1AGBA 4YDLC 3BIKA 3HC0A 3VFPB 3BHBB 4HS3A 5AAWC 3S1GA 3DJZA 4MJIB 5HVHB 3UPWA 4TOQA 4KTEH 5HHMD 3C09C 1R46A 4U1IB 1PWMA 3BLBA 4AYFB 1X5IA 3NSXA 1GWJA 1QO3B 2A85A 3CXOA 2COQA 4B6ZA 1XXXA 3CWHA 2UY7A 3QH3B 4KI5C 4WTXA 3VWKA 5BZXA 4B5ZA 3RCMA 4PRBB 4BFFA 5JMOC 1ONXA 4B5SA 2E9JA 3RPTA 1CLZL 3MPCA 4JCWA 3HFTA 1JSYA 2F54A 2Q6WA 1K8YA 3GSOA 2FZ3B 4PIBA 4DQOH 1I2PA 2GQHA 1KJ2A 3CIQA 3FQRB 4ENED 1FUNA 5J13C 1RAKA 2RH9A 4WY7H 4O50A 1IQDA 4ONFL 3ASNB 2A6DB 4PS7A 1CDJA 4W70A 2PYED 4TIMA 1NA8A 4WKAA 4CQ9A 2GSIB 4PJDA 2JB5H 4NQDE 4RRPA 3SOBH 1J8RA 1VFHA 4U6VL 4O12A 25C8L 2A9MH 4LCWB 3SDDD 3BTNA 4G9DB 3GI9H 3D39E 3O3DB 3Q2WA 4FLOA 4MJ2A 4TLKA 3FOMA 1IFHL 3WJYA 2ZOKB 1G4EA 4GY0A 2XTSA 4AQOA 1HEHC 1DHKA 1PG7X 4G42A 5I75B 5IMMB 1UACH 4G1EB 5H35B 3JTSB 1U8JA 5ISZB 5E2TL 5IEHA 1PYWA 2VLKB 1KCUH 5E5MB 4X0KB 3IU3A 4PMFA 3AROA 5B4MD 4Y9MA 1JK8B 1LDPL 5KSAD 4J3UA 1JPMA 1J87A 5GNZA 4EIVA 2ZTKA 5M5DA 5DVKA 3UBFA 1KGYE 1W0WA 4PY7B 5D7SH 3SQBA 2VVSA 3AUWB 4HCLA 2DYPD 3FQNA 1IC4H 4DVBA 1XIWB 1OP9A 3VD4A 3R13A 2NY2D 4TF4A 3D39A 1FHGA 3NABH 4A55A 4UI2A 2PSNA 1Q63A 5C0IA 1HHIB 4LMQE 1PS3A 4Z3EA 1I1AD 1F4XH 4DGIL 4OCNC 1MJ7L 1XGUB 4YSRA 1NBVL 2BVTA 3T65A 4JFDD 4N0YH 4XOEA 3ZDXE 1NVMA 1T40A 5DEFB 1AQFA 4J3TA 3NIDE 3ENLA 2NXYC 4IOFC 4HYWA 4HIEA 3I02A 1WFIA 2JJSA 4D6EA 1AD9A 4QJ3B 5C6TL 1GG0A 2BWGA 2ROYA 1J8HE 2AP2A 3D4YA 1SSDA 3TVMD 4Y0GA 3I85A 4NC1E 4YO0A 1WUZA 2ZT9C 4MRCA 4YDIH 4RFNC 3P4MB 4MAUL 3X11B 4AC2A 3VXMD 4AKPA 4NZUH 3W0KA 3QPXH 2NMSA 2IUZA 3QPZA 2ZWSA 1KNWA 2UY6B 5JZ7C 5T3ZD 1JIBA 1J7VR 2R8WA 1X98A 1YECL 3P9LB 3E5BA 1WWBX 5KVEE 2DT3A 4NAEB 1W80A 5F7DB 4GQBA 4QI3A 3G5YB 5IBUG 3CHQA 4JRYA 5DQDL 5I8CA 3INPA 4R0LB 4G5DA 3RPMA 3FN0H 2AAAA 4LC8A 2KERA 3OKYA 4PG2C 1UWQA 4UOQA 5FYKU 1B88A 3EOBA 4CNNA 2WXRA 2VXNA 1A9EB 1CB4A 2YAMA 4X6DF 1Q6FA 2PDGA 2V8LA 2FJFB 5DZVA 5EULV 2V6HA 4KK8D 1N8FA 1OIOA 4GRWH 4XN4A 5C08D 3SKMB 2MNUA 1NJ9B 3GXDA 4OF5A 3VCRA 2PETA 2UXGA 1RZPA 3RTQB 3UBPC 2Y36L 3N1QC 2VDHA 5IEHB 1A6PA 2ZFAA 2VLKA 5E5MA 3ARGB 1ACXA 1BXVA 4AVKA 4XPAL 2DVTA 1Q9LB 4WDWA 4N0RA 4KFZC 2ED7A 2VDML 1KNOB 3L7RA 3WLBB 1FDJA 4H9MA 4LVHC 3DRTA 3A4JA 4E4UA 5AC4A 5T5FH 2JE8A 2IDFA 3W72A 2YOAA 4M48H 2Y7LA 3FU8A 4LLDA 3WI9A 3BKMH 1IGSA 4B9KC 1WX0A 4I7WA 4K07A 2ICWB 4F5CA 4RBPK 4PJAA 1MHCA 3D08A 3O6ML 1G9HA 1MHEB 2NY3B 2WBJA 3CFUA 3QQ9C 5FUCC 5ICXB 3VA2C 1F07A 3VDGA 1ONQB 3S5LB 3PDGA 4U6XB 1I9JH 1KXHA 5TGBB 3H3PL 4KRPB 4WWKB 3C52A 1PJWA 3FNDA 3CFNA 4OUUA 4JHMA 3RX2A 4HIEB 3HTLX 3LBMA 4DO4A 1VBHA 5F72S 1E6RA 1E42A 4GSDL 1IGCL 2N1KA 1GW6A 2H1PH 2PCFB 5E70A 2EE3A 3LLXA 2FATL 2XYLA 2PYEB 3RN6A 3K2KA 3N50A 3WN6A 1VGEL 2JI1A 5FYKD 4IU3A 2R2EB 3TN3A 4HQQL 2OQHA 1YYML 3WCZA 4QP0A 4H44C 4N2IA 4KNTA 1G7PA 2QEJA 4JL1A 3BLLA 3TT1H 4CBPA 1FDLH 4X99B 5I8KH 1WYJA 1LORA 3IK4A 3VTRA 2A79A 1PY0A 4YN3A 4ZL1A 4EE9A 1JUKA 4Q9BA 4OGXL 3ZZ1A 2MWCA 2GGJA 1SNRA 1T7VA 5FA4A 4KWUA 1J0ZA 1OW0A 3QRLA 5HR6A 1X7SA 3Q1SH 3PUGA 4Y1SA 3V4BA 3EX6A 2EJ1A 1YEIH 2FQEA 3MFFB 1USQA 4IRZH 4P0DA 1L8PA 3LLDA 1WAPA 2VLLA 2IGTA 2DM4A 2CALA 3EDKA 1P2CA 3RFRA 3SJVD 2MNRA 3LQZA 3N17A 3GG0A 5I71B 2A9NH 2NY2B 2C9PA 1WDSA 1KF9B 1TYJA 2G5BB 2V9UA 1T7WA 1XINA 2JKTM 4PAZA 3IJSA 1IKFH 1KD0A 3PPCA 1I1AB 1YPIA 3EMQA 4HOZA 1D5ZB 4W1TA 2YQ3A 3WQ8A 3VB8A 5IBLC 1Z66A 3ZK0A 1Z32X 1DPMA 1HKLH 3A13A 2B5IC 2RFXA 3RVUC 5HBBA 5FO9A 2XVLA 3EJUA 2JCCA 2JXMA 3LNIA 4U2ZA 2Q7YB 1JG9A 2DZSA 4XTIA 4DXXA 3TQ0A 4B27A 3W7DA 1I1FA 4HB7A 3OJDA 3AWNA 1MHEA 3RVWD 4XAKD 2AERT 2R0WL 3OG6B 3B97A 2NX5E 2OL3L 2RACA 5DK0A 5DZ9A 2Z26A 4H88L 5D1ZA 1UFGA 1FWNA