1Z32X

Structure-function relationships in human salivary alpha-amylase: role of aromatic residues
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENMNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Salivary alpha-amylase
publication title Structure-function relationships in human salivary alpha-amylase: Role of aromatic residues
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2005-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00128 Alpha-amylase Alpha amylase, catalytic domain
X PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1z32X02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1z32X01
4HZ7A 2WANA 2QV4A 1NOFA 1GOMA 3A47A 1C3FA 3CZGA 1QPKA 3WF2A 2X2JA 1HTYA 4FLQA 1HP5A 4DWSD 2EABA 1HJQA 4A4AA 5JBDA 4HOWA 2W62A 3DX3A 5JIWA 1TA3B 3D4YA 3AMCA 3WMSA 3SCUA 1H0GA 2G3JA 1VAHA 4J3WA 5FIPA 1GZJA 1C8QA 3K8LA 5BXSA 1X1NA 1UH3A 3WMCA 3VIJA 4AZ5A 1Q6FA 4BQ3A 3WDRA 4M1RA 1VJSA 3H53A 1WZAA 2XN0A 1XD0A 4LPCA 1DTUA 1J12A 3AJ7A 4PSRA 1CIUA 5AY7A 2XVKA 6A3HA 2JEQA 4JL2A 2VQUA 3W81A 1W1TA 3WQ6A 2GJXA 4UOZA 3ARPA 3ZJ8A 3JUGA 4QCEA 3ARTA 4E8CA 3J7HA 1EQPA 3EYPA 2WCGA 3AICA 3BAJA 3RCNA 2F2HA 4FNQA 3WD3A 3WL1A 5DMYA 3SCSA 4AISA 3BLPX 3RDKA 2ZOXA 2CBJA 4HPGA 3KL5A 3WN6A 3VGDA 4D6CA 4E2OA 1JDAA 3CIVA 4HA4A 1HKJA 3L4ZA 2ZX9A 1G9HA 1EOMA 1JYWA 4MB3A 3BMVA 4PMYA 1UR9A 2WVUA 3VIIA 5M3WA 4MNLA 3G6MA 1LWJA 1QNPA 4WJXA 5FKYA 3T2OA 4HZ6A 1O6IA 3N17A 4TTUA 2GJXB 3VVGA 1EH9A 3DX4A 4H8UA 3T0DA 1WB0A 1QHOA 3AQUA 4U5IA 3CTTA 4HPHA 2A3AA 2WK2A 3UG4A 1H3GA 4AD4A 1JZ3A 5A2AA 2X2IA 4P7NA 5HXMA 5JUVA 4PBGA 4CN6A 1GVYA 2Z1SA 1CXKA 3BAYA 3L4WA 5LA0A 3TTQA 4D6DA 3F5JA 1F4AA 1E43A 2WYSA 4PEEA 3U5YA 2O92A 1E6XM 3O6AA 3HN3A 1NM9A 4JKMA 2CERA 5D9NA 4N0RA 3WFZA 1NARA 4J3VA 3AOFA 1JGIA 2CNCA 1W1PA 4P7QA 4HMCA 4D6IA 4NSBA 2AAAA 1DHKA 3EJPA 3WQVA 3I3EA 4HTYA 1UKTA 3WH5A 2D3NA 1E4LA 4CCCA 1MXGA 5BYWA 1JZ8A 3HU7A 5A8NA 4URIA 4BA0A 2NSXA 1ZBVA 1HNYA 1UWTA 2WZEA 2V3FA 3TTYA 3LRKA 3WBEA 3A21A 2BS9A 1NOWA 1ODZA 1WO2A 3DECA 2W5FA 3AIQA 4AXNA 3RMEA 1EIBA 4MAVA 4MNJA 4OOUA 1BHGA 3RM9A 5LYRA 4EKJA 4Z2LA 2CKRA 4GZIA 1UWUA 3F5LA 3O2LA 4H04A 2ZX5A 3H55A 2VVSA 4QDMA 3HZ3A 1Q6EA 3AXXA 1I1WA 1GUVA 3PZQA 4UQCA 3A4AA 3VMOA 1MYRA 2VRKA 1MW0A 1HJUA 1V6YA 3RM4A 5A2BA 1V3KA 4HOZA 1LL4A 3AIUA 2J62A 4XZWA 3A23A 2NT1A 1WDSA 5A6MA 3NDYA 4ML4A 3VD5A 3I3DA 1F4HA 2J75A 2O9OA 3KE0A 4UFKA 4C7GA 1W9UA 4UZUA 4HA3A 3VSVA 2J7GA 3KL0A 3BVVA 2X1IA 1LQ0A 1UA7A 4FNRA 4F9JA 3WNOA 3BMWA 1B3YA 1WDPA 3WL0A 1C93A 3SEPA 4UQ9A 2XJ7A 5AC5A 3WIJA 2XTKA 2W92A 5FL0A 1US3A 2WPGA 4R5EA 3UESA 3BAKA 1H11A 1JFHA 3GYCA 8A3HA 1JFXA 3K8MA 2OWCA 1UD8A 1UASA 1UD6A 3ZO9A 4D6HA 1B3WA 3ZSTA 3EJUA 1CGYA 1E6QM 1ZJBA 2E3ZA 1E0WA 1JG9A 1VB9A 4IISA 1BPLB 4PUDA 3ZT7A 3A24A 4P7OA 3DC0A 3VSUA 2Q8XA 4D6EA 1M03A 3KWXA 4AD5A 1EO7A 4WLCA 1LLOA 4W7VA 5BXPA 2WCSA 4LQ1A 1LF1A 2WM0A 3BH4A 3E1F1 3AMLA 4CU6A 3MV11 2WHKA 1V6UA 1O7AA 4JKKA 2ZUWA 2BVYA 5I2UA 3BCDA 1ECEA 1M53A 2XM2A 1XSIA 4MPKA 4BF7A 2WLYA 2OSXA 3ARYA 2VX4A 1PAMA 5FD0A 5D9MA 1J10A 1GQKA 3A4WA 4U3AA 1ZL1A 1JI2A 1B90A 3VX0A 3EJQA 5GNZA 3ZSSA 1MQQA 4JFWA 4QLJA 1GQIA 4AWEA 3W0KA 2XVPA 5D8ZA 1WKYA 2DSWA 3VDAA 4XUYA 2W67A 3AIVA 1HN1A 4W8AA 5CG0A 3BLBA 1GOWA 3AISA 5IFTA 2JALA 1PX3A 1TQUA 2F18A 3WD1A 2CXGA 3VUPA 1NWRA 1UKQA 1QHPA 3DYOA 3N1AA 1K9DA 4J3XA 1K9FA 3FN9A 1ZJAA 1WNOA 2Y24A 3GXNA 3TP4A 3LMYA 4DWSA 1GORA 1UWQA 1BLIA 1J0KA 3BUDA 1Q4NX 1VEPA 3THDA 1BYBA 4DUWA 3WSUA 2CITA 2EACA 3PZ9A 3LX9A 3W38A 2DH3A 1L0PA 4DUVA 1HVQA 1UZ1A 4P8XA 1W2VA 3VD7A 1GONA 3UCQA 3WD4A 3SCWA 4ZFMA 2GUYA 4GQRA 2W66A 5GNYA 3KLKA 7TAAA 1TE1A 5IXEA 4P7RA 4A3HA 1TQVA 2X2YA 2QMKA 3CHCA 2E0PA 3LPPA 5HOSA 3L4YA 3VM7A 1ISVA 2VI0A 3AHXA 3WDIA 1E4IA 1VIWA 2FYVA 2YFOA 5A3HA 1JD9A 4MAZA 4DM1A 3GTNA 1KTCA 3VGEA 5E6ZA 4BQ4A 3CGTA 5A8MA 5CQ1A 5FCZA 1YHTA 2CPUA 4PTWA 2A3EA 5AYIA 3TV8A 3VIKA 2WBGA 3T0BA 1E55A 1A47A 1OD0A 3CLWA 1CECA 4MDPA 3MI6A 2XM1A 2F7PA 5BCAA 1X6NA 2ZUSA 1E4NA 2BV9A 4F8XA 1R46A 1OINA 3WF3A 1QNQA 2GK1A 5A6SA 1L8NA 1PS3A 2X09A 5LA1A 3SUWA 1BFNA 3HG4A 3SUUA 1K9EA 1X6LA 3DX1A 2V3GA 2F8QA 4D6FA 1XHGA 4AD3A 3APGA 4CGTA 4AW7A 1VF8A 2O9RA 4XX6A 1QX1A 1TG7A 3AS2A 5JBEA 3U57A 3WH6A 1JAKA 3OGRA 1PJ9A 4V2XA 2DQXA 1VFFA 1PIFA 3N11A 3ARUA 1W9VA 3MSGA 2CYGA 2YOCA 2UY2A 3TA9A 1ZU8A 3EDDA 4YHEA 1TUXA 5GNXA 2JE8A 4BQ5A 3VGBA 3IJ9A 1Q6DA 2JIEA 2YBUA 5ABHA 3DX0A 1UR2A 2EJ1A 4MTVA 2VCBA 4YN5A 2DDXA 3DHPA 5I3DA 1LG2A 4UQEA 4U3CA 3ARZA 3B9EA 4FNTA 4UOJA 1EDTA 1V3JA 3BUQA 1VFOA 2XFFA 4W8LA 1JNEA 3FHAA 2OYLA 2TAAA 3AHTA 1XCXA 2A3BA 3CHEA 3RJXA 1OIMA 3CZLA 4Q7NA 1E1FA 5A2CA 3WBAA 1YQ2A 1M01A 4AD1A 2ZICA 1KWKA 1GHSA 3WEZA 4NRRA 4C7FA 2VMFA 1E73M 2JFEX 3CZKA 3CHFA 3VIOA 1TZ7A 3BAIA 3A4XA 1V0MA 3EDKA 1TQWA 1KWGA 1AQMA 2W63A 5CPTA 1PZ2A 4JZ5A 3CUJA 2YA0A 5DEZA 2WMGA 3EJRA 1W9XA 1D3CA 3ARWA 3LPFA 1LJYA 1CXFA 1V3MA 4M56A 2Y8VA 1B30A 3ZR5A 3AZSA 4B9ZA 4NF7A 1NOUA 3AI0A 4GKLA 5FOOA 3MV01 2YLAA 4NX0A 1OT2A 3KLLA 1ISWA 4EANA 5CZKA 4EK7A 3D4ZA 4CD7A 3BSGA 1C91A 1XSKA 3F4VA 2WZHA 1QI2A 1JXKA 2XYLA 2ZUUA 2WC3A 2BNJA 1J0YA 1U33A 1JZ5A 1JYNA 3CZNA 1MFUA 4UTFA 1BG4A 7CGTA 5IHRA 1N82A 5I77A 4UZSA 3T09A 1B1YA 3UETA 4LXFA 1RD6A 2XVGA 2VL4A 3AS1A 4PRWA 1E5JA 1W9DM 2YA2A 1EA9C 4QCFA 4ZENA 3POHA 1BVZA 2VT0A 2EPLX 1E70M 3L4VA 3U5UA 1SFSA 4NZJA 3RO8A 1HP4A 3PZIA 4PTVA 1KBBA 1KXVA 3WNLA 4H2CA 4X0NA 3DYMA 3WEOA 1EGZA 4OOZA 1KXQA 4F66A 2X2HA 2VO5A 1C7SA 1D2KA 2WW5A 1KFWA 2WMHA 3G6LA 4E8DA 1FH7A 5E0FA 3SCNA 3UR7A 5EBAA 2VTFA 1FOBA 4ZE4A 1DWJM 1GOKA 4OBRA 3WY3A 3UG3A 2DT3A 1GOQA 4ZXOA 1JIBA 4OKDA 3SURA 4MADA 3VSTA 3NSXA 1HKMA 2EBNA 4W7UA 3WH8A 1HL8A 2V5CA 2F61A 2Y2WA 1E56A 1E5NA 2YDSA 3NUKA 4W87A 2VRQA 4UFIA 2MANA 1H0IA 2CHOA 4AZIA 1B3XA 2XSBA 1PPIA 2J8GA 1D7FA 1SYTA 3BLKA 2DT0A 4LYPA 4YHGA 1QWUA 1K6AA 2BHUA 1R8LA 5I23A 1KCKA 3EMZA 5KEZA 4CD8A 3IGUA 1VEMA 3ALGA 2V3DA 1JI1A 1W3HA 3LRMA 4P8VA 4CVWA 1BYDA 3OBAA 5BROA 2VURA 5CLWA 1OT1A 1R87A 2YLLA 3CPUA 4M29A 2X05A 4Z2HA 2IXVA 2WNWA 2J7EA 4P7LA 2NW0A 2OWWA 4ATLA 3MMDA 5E0CA 2CHNA 2OLHA 1DP0A 3N15A 3GNOA 1VFUA 1UD5A 4PMDA 3MMUA 2CBIA 1IT0A 1FFQA 1G5AA 3HG5A 1BQCA 1V0NA 4ATDA 3GXFA 4AD0A 1H41A 1MW1A 1VEOA 4GI9A 2G3IA 5HPOA 1IV8A 1V0LA 5A6AA 1KR1A 3BAXA 4FLOA 4P8WA 4KWUA 2XWEA 3NSNA 4UFJA 2PWDA 1K9TA 4D1IA 2XVLA 1QVBA 1EDGA 5BXRA 5E9AA 1XV8A 1PZ3A 5JBFA 1JF5A 3MUY1 1BTCA 4D72A 3N9KA 2FE0A 3BVXA 3ECQA 3GBDA 3IJ7A 1UQZA 3PZVA 3SCQA 3VIGA 2WC7A 4M82A 4WSJA 7A3HA 4ATWA 2E40A 3UEQA 1UUQA 3GXDA 3VILA 5A6JA 5E6YA 2FH6A 4AMCA 5A94A 1E6RA 3IAQA 2VX6A 3N12A 4GIAA 3QHOA 3VIPA 1QI4A 3EDEA 4KMQA 1E72M 4GO8A 4HU8A 2D20A 2XG9A 4TOQA 1XSJA 4OJYA 3VGHA 1BAGA 4JFSA 1HJXA 4PUEA 5GPRA 3VIFA 1B3ZA 1QBBA 1E3ZA 1R47A 1B3VA 1W9BM 5CSYA 4TTGA 4PMOA 2VZSA 4W84A 1V3IA 4UFHA 3W82A 1JDCA 4TVCA 3AXIA 5I0DA 3D5HA 3UG5A 1UD3A 3ZIZA 4E4PA 4FK9A 3AHZA 4IUGA 5HNNA 1W3JA 1W3KA 4MJ2A 3SCOA 3U7VA 3HG2A 3ZMRA 3WF1A 1CLVA 3SCVA 3CV5A 1S46A 4K68A 2XFRA 4UR9A 1QWNA 4JAWA 5A8OA 2YJQA 4AYGA 2WCAA 1MW3A 1AQHA 4WSKA 2OW6A 1BF2A 1UZ4A 2WLZA 5A6BD 3GM8A 4Z2JA 9CGTA 3THCA 2VZVA 1XH1A 5EB8A 1TCMA 4W7WA 4B3KA 4R27A 3MMWA 2E9MA 4DM2A 1H5VA 4IPNB 3WY4A 3W28A 1JF6A 2DSKA 2VZUA 5IDIA 3BUPA 1DWHM 3BUIA 3VMNA 1NP2A 1BG9A 1CDGA 4PMQA 1G0CA 2ZXBA 3EDJA 4DWSC 2WMIA 3CBWA 4WF7A 2D0HA 2UY4A 1IZKA 1CXEA 5DO8A 5BRQA 2VRJA 5EFFA 2PBGA 5E70A 1E0VA 1FP9A 1V6XA 2YFNA 3OLEA 2VUYA 1QHZA 3ZJKA 3MKKA 2V3EA 8CGTA 4J7RA 1O7DC 4H41A 1NQ6A 4W85A 5I78A 1JXJA 3DHUA 2DSVA 4NZFA 1CGTA 1CTNA 2ZXQA 2ZUMA 3EMQA 4RL3A 2F7QA 1CNVA 1KXHA 5M03A 3QHNA 2VR4A 3OLDA 4FNSA 3UR8A 2G4FA 3T08A 2Y4SA 1JDDA 2IXUA 1VFMA 5A6LA 3AMKA 3RILA 2ZX7A 2C7FA 3QHMA 4OBSA 1UOKA 2XHYA 1G01A 1GPFA 2FHFA 2YKKA 1TVNA 2O9TA 1XRVA 3DDGA 2VX5A 3BXWA 1I75A 1M7XA 2QPUA 3WDQA 3VIHA 2YL8A 2ZXAA 1OGGA 4CVUA 1BYCA 1H1NA 3ZT5A 2ZX6A 1WDQA 3CHDA 1CPUA 4JFTA 4ZE5A 3II1A 3IK2A 2FGZA 1GOIA 3S2CA 2VC9A 3N13A 2WHMA 5CPQA 3IJ8A 4UCFA 4DO6A 4M8UA 1LG1A 3TOPA 4CUCA 4C7DA 1DWFM 4QP0A 1UQYA 2D1ZA 4KRTA 4LYQA 3WUFA 3K8KA 1E6ZA 1OGBA 2YDQA 2XGIA 3WF0A 1BGGA 5DT7A 2JEPA 4AZHA 2BY0A 5EMYA 3B8SA 3CZEA 2WBKA 3AXHA 5E1QA 3D51A 5FL1A 3LPGA 1KGUA 3AIBA 1SMAA 3QGVA 3VDCA 6TAAA 3BCFA 3N04A 3ZQ9A 2F7OA 2PF0A 2JIWA 4AMXA 4U33A 3BAWA 2WZIA 4UFMA 1JYXA 3MSDA 2G3NA 4MJ4A 4AY1A 2CKSA 3W26A 4DWSB 4XV0A 2WVTA 1ZS2A 3WQ5A 3VD4A 3PZNA 1WPCA 1QNOA 3ALFA 3WF4A 1ISYA 2D24A 3OZOA 3SCRA 5HDRA 2W61A 4J3TA 3LXBA 3TTSA 3OZPA 1V6VA 3K4DA 1MFVA 5KZ6A 2DEPA 3L4UA 1JYVA 5IFPA 1SMDA 1KQZA 2ZUTA 3LXAA 1GNXA 3M7SA 4U2ZA 1E9LA 3F5KA 5CJ5A 3W37A 2ALWA 1NP0A 3PZOA 2J7DA 1BVNP 1B2YA 2WHLA 3NCOA 1IZJA 4JFVA 1XYFA 2J4GA 4WK9A 1QW8A 1W3LA 1SZNA 3HJEA 3WNKA 2W91A 3PZTA 3VKKA 4B3LA 3HMCA 2CIPA 1QI5A 1LWHA 1HVXA 2GK1B 2BY2A 2J25A 1UD4A 2D0FA 2EPMX 3A3HA 5CSUA 1MW2A 2QMJA 5I79A 1ESWA 2DPEA 1UR4A 1WAWA 3FXYA 4X0VA 1ZB5A 3SIMA 5CPSA 1E6PA 4HMDA 4FNUA 2DIJA 4JCLA 1CENA 1VJZA 5HPCA 1MVYA 2OSWA 1FHLA 2BFGA 3FNDA 2CCRA 1J0ZA 4HP5A 2EPOA 1GQJA 4AZBA 1UH2A 5F7UA 1RPKA 3WDHA 2V38A 2WKLA 1EXPA 1R33A 1E4MM 4B16A 3SCPA 3WQ8A 3HG3A 1JZ4A 5GQBA 3A6OA 1EOKA 4JHOA 2YL9A 1ITXA 4JFUA 3CUFA 3WUBA 1HT6A 1JD7A 3VGGA 1VBUA 3EMCA 2G41A 1GQLA 3D52A 2EPNA 2WSPA 4EAMA 1XD1A 2WVSA 3GXIA 4PSPA 1HX0A 3AYRA 1Q6GA 4MNKA 2ZX8A 1MQPA 1MXDA 2XUCA 3GH4A 2VR5A 3PTMA 1PEZA 2XIBA 4UQDA 4IM4A 1SR0A 4NZCA 3WY1A 5I24A 2WWCA 1TA3A 3BVTA 4QFUA 4BS0A 3BGAA 4W88A 1ZBCA 1KB3A 3T0AA 3AS0A 1XGZA 1TR1A 1TVPA 1UWRA 3VIMA 2E9LA 2D3LA 1V03A 3A22A 5D4YA 3GXTA 3VMPA 1XYZA 3GXPA 2GVYA 2BXYA 2VZOA 2VOTA 1E6NA 1WP6A 1WZMA 3VTRA 3K1DA 1H2JA 4GINA 1KR0A 3S6TA 4FLRA 1FP8A 1UG6A 3EJTA 4GZJA 1QNSA 2Z1KA 4WKHA 4TVDA 1BSIA 1W2PA 1R7AA 4AZGA 4U31A 2UY5A 1W1VA 1EHNA 2AOSA 1R85A 1GHRA 1EDQA 1UKPA 1QW9A 1V3LA 1V02A 2NT0A 3AHVA 3SCTA 5D9PA 2RGMA 5AYBA 3CZ8A 4B9YA 4GZEA 3CZSA 1FA2A 5ABEA 2D23A 2X8RA 2DIEA 1AVAA 1TQSA 2IGTA 3D3AA 3RIKA 1KXTA 5A8PA 1BYAA 3VD3A 2E9BA 1H09A 1AMYA 3W4RA 2WMFA 1HJWA 2EPKX 3WDPP 1JZ6A 1V6WA 4AZ6A 2J47A 4TUFA 2VJXA 4TX8A 1XH2A 2GJRA 3KZSA 5DT5A 2ZIDA 4CN4A 3W29A 5E09A 1C90A 4KGJA 4Z2IA 4D71A 4AC1X 1UR0A 2D22A 4CU8A 3WH9A 1Y7VA 4U2YA 4AIEA 2YIHA 4MDOA 3WMBA 3BC9A 5BXTA 3LXCA 2UWFA 2PB1A 2WSKA 2J77A 1ISXA 2X0HA 2YA1A 1W32A 2W4XA 3KEHA 3WELA 1LL6A 2EO7A 2DT2A 1CXLA 4BZYA 2J8FA 3FHQA 4PMVA 1ISZA 4UOQA 3VO0A 2PWGA 4PMXA 1EQCA 4H8HA 3K4AA 5ABFA 1LL7A 2CETA 4S3KA 4TXEA 1JL8A 2J79A 3EDFA 4Q22A 4UQBA 4J27A 2D73A 3MUIA 4GQQA 1WDRA 4HU0A 1Q6CA 2BY3A 4Y7EA 4PTMA 4U5KA 5C8BB 1G1YA 4PCTA 2J7HA 3ZOAA 2J7FA 2E8YA 5M5DA 3VDBA 1BGAA 1FH9A 3DYPA 1J11A 1UR8A 1OB0A 2PC8A 3MUAA 3BSHA 1UKSA 2OWXA 2YL6A 2BVDA 4CU7A 4L4PA 1J18A 3CZJA 3VD9A 4Z2GA 4W86A 1QI3A 3W24A 4NXKA 2VCCA 2WVVA 3DDFA 1B31A 1H49A 1HF6A 5C70A 1UKOA 1NH6A 3EJSA 3ZJ7A 1UH4A 3VNZA 4OUEA 2ZUNA 3AIWA 3TTOA 2VNCA 3WQ4A 1OGSA 1OM0A 2PWFA 3S5ZA 3VM5A 4J28A 5ABFB 1QNRA 3CMJA 1GOOA 1H4PA 4D1JA 4LGXA 3N18A 1U2YA 1J9YA 1J01A 4F79A 1GCYA 3BVWA 2WB5A 2ZWZA 4XB3A 1OSEA 2QF8A 4B15A 3VPLA 3RPMA 1CBGA 2UY3A 2QPSA 3NDZA 4OZOA 3AS3A 1EO5A 2GSJA 3FAXA 4V27A 2EEXA 4QLLA 2FGLA 2WVVB 1JAEA 3FAWA 1OWQA 1CZ1A 3OA5A 3WUEA 1RP8A 2PWEA 1QBAA 1UR1A 3IANA 3TONA 2J74A 4AMWA 4H8VA 3NIYA 2CBUA 4ZEPA 3ARSA 4FF5A 4ACYA 2XPKA 3GZAA 3IAPA 3CC1A 5HBFA 3A5VA 5ECUA 2G3MA 1RP9A 1E1EA 5A6KA 1I1XA 4GI8A 3VNYA 1DWIM 3M07A 3VU2A 3GNPA 4JHZA 3WNMA 1WZLA 5LA2A 4GXPA 1M04A 2IUZA 1E3XA 1OCQA 4H7VA 1HKKA 1OBAA 3PZUA 3PHAA 1PX8A 3GDBA 1R86A 2YL5A 4PN2A 1T0OA 1HXJA 2WMKA 4AEFA 4DUXA 2B31A 1PX4A 4HZ8A 2VQTA 3AMGA 4FMVA 5CGTA 3SUVA 4EE9A 1V3HA 1C92A 1JNDA 3ARVA 1UD2A 4W93A 1CGXA 1KTBA 5TD4A 2Y5EA 4ZXLA 3M6DA 1XCWA 1CYGA 1U30A 1C7TA 2GFTA 4PCSA 1GJWA 2WC4A 2EADA 3SUTA 1GW1A 2JF7A 3GXMA 1J0HA 2DT1A 3AHYA 1C8YA 1KCLA 3BUBA 5C71A 3WQWA 3ARXA 2WXDM 3T2PA 2WMJA 1UYQA 4PMRA 5IHSA 1NWTA 2XVNA 2OYKA 3OLIA 1R7OA 1W1YA 3CMGA 4L4OA 1ZBKA 1XH0A 1MQRA 5A95A 1OD8A 3ZT6A 1W9PA 4BCEA 4AZ7A 3KL3A 2XSAA 3WENA 1E6SM 4RE2A 2J78A 3PTKA 2F7RA 5M17A 1G94A 1MWOA 4DO4A 1CEOA 3M46A 4AEEA 1GJUA 1UHVA 2JF6A 4TVUA 3PTQA 2WMIB 1E0XA 4WKAA 2AMGA 4GO9A 2OYMA 1CLXA 1WE5A 2X0YA 2F1AA 3T2QA 2ZUVA 4CCEA 1QOXA 2WHJA 3NSMA 2FH8A 4LYRA 4W89A 5EFDA 1US2A 1V0KA 3LPOA 3WDJA 4JIEA 3WKZA 2OSYA 3EBVA 4X9YA 3CO4A 1DWAM 1AQ0A 3UERA 5ABGA 2V5DA 4HOXA 2DSZA 4S3JA 3QR3A 3K46A 3VOCA 3OGSA 4CKQA 3AYSA 3PBGA 1TFVA 3OLGA 4WKFA 2EXOA 1QI0A 4CD6A 5I5RA 3U7BA 5BWFA 1ODUA 2DGAA 4PTXA 2VVNA 3OB8A 2ESCA 4ACZA 2XN2A 2PI6A 4AIUA 4JKLA 1NWUA 3W6LA 2GDVA 5A69A 3FY1A 2ZWYA 2FDMA 3AIEA 2ZE0A 4N42A 3AZTA 6CGTA 3W53A 3WFLA 4LX4A 1VRXA 1CXIA 4NI3A 1DWGM 4PMNA 1E40A 3BVUA 4J3SA 3WNPA 1ZBWA 4P8UA 3D50A 3B9DA 5D8WA 2ZXDA 2A3CA 4AIOA 3MU7A 2E4TA 3VX1A 1VENA 1FFRA 4W8BA 4DO5A 4A3YA 2BHZA 3WEMA 4JCMA 1NWSA 1PBGA 1HKIA 4RE3A 5CXPA 2PBOA 4MB1A 4KGLA 5DF0A 1B0IA 3WD2A 1CGWA 4MB4A 3I3BA 1UWIA 4J3UA 3MANA 2VCAA 3NYDA 3PZMA 1UWSA 3MUZ1 4ACZB 2YDRA 1J0IA 2C0HA 4WIWA 2D0GA 4PMZA 3WY2A 1CGVA 2VX7A 3AROA 3ARRA 3GH7A 4JL1A 4NXSA 1HIZA 1UA3A 4GI6A 1PIGA 2OW7A 2J7CA 3CUGA 1CWYA 2CESA 2BHYA 3OIHA 1R34A 1ITCA 4NRSA 4FNPA 4UQAA 4PYSA 1DEDA 4TX6A 2HVMA 2QLYA 1GVIA 2E8ZA 3L2MA 4AYSA 3WNNA 4D6JA 2CBVA 2EQDA 1HL9A 4PMUA 5A1AA 5CGMA 3L2LA 1TMQA 4IPLA 3ZJ6A 3H54A 3SUSA 4KH2A 3CH9A 1P6WA 3NJ3A 2WAGA 1V02E 3RM8A 4XZBA 3OG2A 3GNRA 2PWHA 4CN1A 4W5ZA 3WUGA 3QOKA 3ZM8A 1EHAA 2HISA 3AZRA 1KBKA 1KGWA 4AZCA 1TQTA 4QLKA 5DFAA 1CGUA 3W6MA 2GDUA 2VZTA 4OIFA 3OGVA 5JIPA 4OGZA 1XC6A 1JZ7A 2CEQA 4F9DA 5BRPA 1FHDA 3POCA 4QAWA 1HJSA 4CD5A 2WKGA 2BY1A 3WH7A 4V28A 1KQYA 2BVTA 1VBRA 2A3HA 1RH9A 3WD0A 5AC4A 3ZR6A 2DSUA 4UNIA 1A3HA 4GPNA 1JZ2A 1C8XA 2XIIA 1E15A 1KGXA 2XFYA 4CD4A 2C8NA 1HJVA 3B9AA 4KRUA 4YPJA 3ARQA 4D6GA 3VINA 2F1BA 4M24A 1FH8A 3PZGA 3FW6A 3CUIA 1HXKA 3L4XA 4HA1A 3W27A 2WWDA 4M81A 4Z2KA 1Z32X 3VGFA 2O9PA 2J7BA 5D9OA 1OIFA 3VDHA 3O9NA 4W5UA 4AZCB 3LRLA 1HWWA 2FHCA 1B9ZA 2YBTA 3AIRA 3MS8A 4FLSA 2D2OA 2G8ZA 3AFBA 2BXZA 2DH2A 4RE4A 5A8QA 4HMEA 4AD2A 1WCGA 4MNMA 2XGBA 1R75A 1WZKA 1CXHA 5A6BA 3QOMA 2XN1A 3RJYA 3GH5A 4CCDA 4UFLA 3L4TA 1V08A 2GJPA 5I6SA 5CLTA 1E71M 3CUHA 3S5YA 1W91A 4BQ2A 3W25A 2Y8KA 3PN8A 1J0JA 2RGLA 3GBEA 4MB5A 3AMDA 4M80A 2XWDA 2QHAA 2EAEA 3MO4A 2FHBA 3DX2A
chains in the Genus database with same CATH superfamily
1SSDA 2IQ9L 2E59A 1C5CH 4A4AA 3B0UX 2NQ9A 2FZDA 1OF2B 2FBJH 3QISA 3QJFB 2DV6A 5DT1H 4GRLD 1VJSA 3QFGA 3HPAA 1DUZA 2QEJA 4OU3A 1MJUH 3QQ3B 5D2XA 3QUZB 2VXUH 1PL3A 4NJ9H 3CQJA 5ENLA 4AVJA 1HESA 1S9XA 4PJAE 1AKJA 2VDOH 4XXDB 2HE5A 2JF1A 3S9DB 3NDYE 1B4EA 3WL1A 1U8HB 4MUZA 3CVIL 3WLPA 3RTQB 2DEYX 2CLZA 1T2JA 4OZGF 4J12A 2C7UB 3L4ZA 3W73A 1I1FB 5LNWA 2KZ1B 3BICA 1OAUL 4XZ9A 5J1AB 1H8LA 4BXSV 3NESA 1J5SA 1NM4A 5LGJB 3LS4L 3FB8B 1RUKH 3G6MA 5IROD 5KYWB 3VFSB 4TTUA 2H9AA 1KY7A 3UYPA 5I1HL 3GD1C 3DGBA 4ZOBA 4AD4A 2XQ0A 3OVPA 1CXKA 3CPRA 1YZZA 5AVYB 3B6SB 5LA0A 2DBLH 2DQUH 3ONCA 2O92A 3O6AA 1MCBA 4HZMA 3WFZA 5BJTA 4NJAL 4IIHA 3BVNB 3CVHL 3VRJA 3UC0L 1FO0H 1H5BC 4ZFOA 4CSZA 3BPOC 1S9YA 2OMAA 2WZEA 2HNHA 3ARBD 2A7NA 4EKXA 3N43F 4NZTH 4R3SA 1D5MA 4KI5C 1TJGH 5DHDA 3G3LA 2UZYB 4N4QA 1V6YA 3RM4A 3EHBD 4EP8C 4FMFA 2O6DA 5BOOA 2ADAA 2CR0A 3HR5B 2FECI 4QXGL 4UFKA 1MAML 2J7GA 3L7FB 5DJ0B 1OW0C 4E5XB 4KUZH 3TVAA 4ZBJA 1BD2B 1RZJL 5H4ZA 3WL0A 3KOXA 1FZMB 1Z9SA 4B9KC 3KOFA 2YD7A 5AC5A 1FHUA 2W92A 2WNQA 3WG7B 3UESA 3IRDA 5F0MB 4ML9A 3CFEB 2LR4A 3TNMB 4E4UA 3DGCR 2QJDA 4HX1B 3G04B 4K2UL 3B8IA 1DSYA 2GJJA 5TE7H 4PLKD 4AV5A 5E2TH 5IUSA 3RX4A 4M9PA 1X7IA 3HAEG 4BSVA 4WK4B 2HXUA 4XSLA 3EBGA 1OVDA 3BDKA 2L7QA 3ILEA 1TTAA 3PWPA 1CFVL 1J10A 3G9VA 1URZA 1ETZB 3LEVH 3F3HA 7ODCA 2ID5A 3MBEB 3FOKA 3P4OB 1E7UA 1JRCA 4MAYC 4NG3A 4W8AA 4FDWA 5E4EB 5DJXA 3R13A 4D9RD 5AVQB 4H9MA 5MF5A 4AHPA 1US0A 4FERA 1HCZA 4NB7A 3PG2A 1GMEA 4U1HB 3THDA 4PVMA 4FA3A 3T8XB 3V0VB 2QUTA 1UZ1A 1OY0A 3VGAC 2QDDA 3GDKA 4P2VA 3E5PA 3I6GA 4K9EL 1FKXA 4JQ4A 2X2YA 3BO8B 4DJFA 4XUGA 3PB2A 3HB3C 3KRBA 2NMSA 2Y8UA 1JGUL 2H1XA 4LBEB 5ANME 2OFQA 1DXEA 1GL4B 5E6ZA 2CZFA 3KRZA 1PL9A 4JG9A 4PTWA 3F01A 5AYIA 3TT3H 2WBGA 2IG2L 1XAKA 1X9LA 3WLBB 4QROA 4EI0A 4OFQA 3RU6A 2CA3A 1AGFA 2E5CA 3SDAA 1WAAA 4Y9AA 3LDBC 1P84K 4JFEE 3ZTNL 1FBIL 1TG7A 3O45B 4B5ZA 3FA4A 2GITB 2IWEA 1P5VA 4NT6B 4WO4D 2BJML 3RO6A 1QRNA 1P6FA 3D9AL 1ZU8A 5JOPD 3F85A 4NN6C 5BS0D 1BZ9B 4WD0A 3EDDA 3CH0A 3HVNA 3PWIA 1EO8L 2R69H 1HWGB 3WEXA 4P48A 3PB0A 3JV5A 1XF3B 1S2AA 3OBKA 3CAFA 4W8LA 3UYOD 3FHAA 3DDMA 1CZ8H 3P9LB 1OIMA 3CLFH 5EKYA 3EIFA 3TWCL 1PZ1A 2ZICA 4AQEA 1BVKB 4KO7A 1D5IL 1GHSA 5MKGB 2PDLA 2X1UA 2G4EA 2JFEX 2Z2UA 4CMHC 2ZXEB 1V0MA 3EO0B 4ODSL 5CP3A 2WOBA 2W63A 2QQKH 1TRIA 1XGYL 4KZCA 3X3FH 5IW6A 2FYYA 5INDA 2Q8ZA 3SO5A 1LO4L 3RR1A 3VI3A 4A22A 1Z5HA 4FQIL 4I7VA 2FJKA 3E2HB 2EF9A 5PTDA 1OARH 4EANA 3VFOB 4HJ1A 2A6JA 3RHWF 4U0RC 1HEHC 4TV5A 2ZD0A 3TN3A 4J4PD 4R2GD 2CLMA 1DBML 2YR3A 2R0WL 5KN5B 3IU4H 5HHOA 5I77A 4UZSA 1B1YA 4PRWA 3VRIB 4S3DA 4XPBH 3OAZK 4LCYA 4LYKA 1U8PA 3MDWA 2WV8A 3IPWA 3T6WA 1CK0H 3WNLA 4H2CA 3EX2A 4PS8A 3V1PA 2JKSA 2X2HA 2G5BA 2X4TB 4GD0A 4KV5F 1N6QL 2HUHA 3VXRE 3JXAA 3T6QC 1ZA6A 5EBAA 1PNDA 5DRIA 1Q38A 3NSYA 2XFGB 2AW2A 1V55B 4ELKB 1MUMA 4F2MA 4EOUA 1BXNA 1HKMA 5L8KB 1NGYB 3OQ8A 3PL6A 1EP1A 3NJLA 3HMXA 3VXPB 4OHQA 5JIIA 1EMTL 4K7PX 5ICYB 1EXBA 3P2TA 2CD0A 1JCXA 4HIQA 1PPIA 4TUOA 4DFIA 4JFXA 3ILDA 1ACCA 2GWGA 3R8QA 1R8LA 1XG4A 5DXXA 5D1ZA 2HVOA 4PB5A 3U46A 3KLSA 1GZGA 5B1AB 4CVWA 3Q1SL 4E41D 1TIWA 1IAIL 3HFMH 2PO6B 3RAJH 2YLLA 4PLOB 5FI8A 4P7LA 2H1LM 4ATLA 3TIEB 2FB4L 1JGEA 2CHNA 1UZ6F 2CUMA 1GIGL 2RAGA 1DV7A 4KIRA 2ZZUT 4PV9B 2WSDA 5H35B 1UD5A 3RDJA 1A1MA 4MFHA 2ARJA 1G5AA 4HBCH 1MEHA 5EU4A 4ETQB 1MW1A 1OAKH 5BMFL 3LZOA 4GI9A 5HPOA 2WXMA 3LN4B 2FLBT 3DFQA 3TYEA 4ZUSB 3H7UA 3KPLB 1PHWA 1RV6X 3KM8A 4M7TA 5CPOA 1UJ3C 5DRZB 4Z7UA 3BT0A 1Z44A 5I0XA 4GSRA 1RIVH 2VDNB 2WLKA 1DE4B 3OWEA 1UUQA 5C0BE 1EA0A 4AGLA 4Q74A 3IK4A 3QHOA 2EG8A 1V5JA 1V7AA 3JT2A 2WCPA 3AU6A 4U28A 4N0YL 3X13A 3VE9A 4OJYA 3TJ4A 2Z1BA 3W2KA 1V54B 4ALAL 4WY0F 1V3IA 2PYED 3G6JE 1IE4A 1SN0A 2B3IA 4X42A 4ORZC 1INQB 2F53A 1CLVA 1E4KC 5D2NE 4IIQB 1TXKA 3STZB 4XGZA 2OW6A 1U21A 3VWJD 4I9AA 3C6LD 1I8IB 4U6VL 5F44A 2A4AA 2DJLA 4I6VA 1MSPA 4PCFA 1BF8A 1HQRB 3TK7A 4QR6A 3F04A 1XF5A 4JKPH 5K4ZA 3D2TA 2ZP9A 1G9NL 4KFMA 3SM0A 1XFBA 3R25A 3MBFA 1VQTA 3QEHB 3O6KL 2FVLA 2CNYA 5C0DB 1X5GA 5F9JA 3G3DA 4TVPE 1MFNA 3VFWA 4FXRA 3HGOA 4YWGL 4G70B 5SWSA 3NIFE 4F93B 5E94A 1ONXA 4QRSB 2AEQH 3VOGA 2C7FA 3QUXD 2N59A 4IBLT 3GTHA 4MWAC 3HNSH 1IBZA 4W9KC 1KTLA 1MPAH 4XNMA 2P24A 4H6RA 4KK5C 1I75A 1KYAA 2UVFA 1IO4C 3II3A 5SWQB 3QEQE 3NG5A 1RKRA 3MRHA 3PBMA 2P5EB 3SFKA 2EYRA 4B5VA 1KFGA 4XD3A 3UP8A 5MEQA 5HWNA 3DG3A 4LYQA 3D25B 4QRUA 4KQ4H 1LWIA 1I7ZA 3OAUH 2G5RA 2YD1A 3F6IA 4LP4A 1I9IH 3V0EA 3PRZA 3BJSA 1SMAA 3BCFA 3DPBA 4PRHB 2E6JA 1FCCA 5CSBA 3IMVA 3MSDA 3WJJA 3EYVA 4TLTA 3PNRB 3WQGA 4FXFA 2NZLA 4CC1A 4XZNX 3GMOA 5IBUG 1KCZA 2X12A 1BFTA 3PWLA 4AV0A 2C9XA 4HN8A 3FB7B 4GSDL 5CBAA 3O6FC 1OP5K 2DP3A 4HD9A 5F2MA 4BM7A 3OZPA 3GC5A 2JCCB 1FL5A 3DO7B 1MJ7H 3V9CA 4XT1C 5MHSE 1PKOA 3M7SA 1A5OC 2BOBA 2J7DA 1B2YA 2CLFA 3W72A 5C9KA 1YMYA 2HT3D 2GBUA 3BFQG 3TO2A 3OOQA 2XXFA 3E38A 4HSCX 5HQLA 1OCWH 4LEBA 3BUTA 5GRYA 3W9EA 4DZ8B 3P0WA 2ZXGA 4LB4A 2DPEA 5I18L 3BKCL 4L4TE 2VR9A 4L4VB 4HMDA 1XLIA 3AVEA 4FNUA 3ZIYA 3VD1A 5GRXG 3NZQA 2ZZ1A 4DAFA 4AX3A 4H3DA 2QUNA 3AWFA 4HWUA 2EPOA 4K15A 3HAEH 4G42A 3IN0A 3KZ8A 4UNLA 3OMNB 1EJSC 4B16A 4MJIA 3QDGB 1RZQA 4HH9A 5DJAB 4Y9OA 1T0PB 2C3VB 1ZTMA 3IWPA 2AJVL 4HC1H 4Z7QE 1VBUA 1R5WB 2PP8A 4PJDA 2G41A 4JG1L 3D52A 1UFUA 3IVTA 3AYRA 2REQA 1T21A 4IM4A 3AQDA 1AXIB 1NIAA 4GP8B 1AI1L 3WY1A 4XXCC 1TWWA 3EH2A 1Q4WA 4P23C 1ZBCA 2DJXA 1FRGL 4TOYL 5IEHA 4M5YH 1KB5B 1E4HA 2AQWA 1V03A 3GXTA 1MJJA 3PPEA 3HZMA 2D4FA 3V4PA 1KR0A 2FYMA 1CF1A 1WBHA 1TVHB 2HLFC 2VSCA 1FFPB 2VR3A 3IDXL 1ICPA 3MV9B 1F86A 4QJ1A 3WFDH 2VL5B 1W1VA 5FDWB 2Q6WA 5DQDH 3VK5A 3S36L 1RCOB 4NJHA 4R97B 5JQ9A 3NABH 5L88L 1FL6B 2ZF8A 3GSWA 3M41A 2WLLA 3LAFA 3D3AA 4HWZA 5CAYB 1G6RH 3WS3B 1M65A 4LUIA 1G67A 1MOEA 2JJUA 1MNUL 3N6YA 3ILPB 1C90A 1VPQA 1XLGA 3TVMA 1Y7VA 3W2JA 2OR9L 4Y19B 2PB1A 3LHVA 4GBDA 3LN3A 4I0KA 2BOGX 1HI6A 3WELA 1LL6A 3JU2A 5G1MA 4BZYA 1EJUC 4BZ1L 4NQXB 4XNYL 4NLHA 3F7VA 3SGGA 2VDRH 4Y2LA 3K4AA 2HJLA 3ABLB 4QCIA 4JDYA 3CHPA 4XKYB 2NQJA 3NQDA 4TNFA 1B6DA 1M2OA 1Z9AA 4WW2B 3NJJA 4WDUA 1CG9B 2ADGA 1SXZA 4CCZA 2J13A 3MLZH 2XJLA 5D96B 5AZEL 2H3XC 4Z77A 3C8FA 4ABWA 5EU6E 2ZWNA 5BQ7B 3KHDA 4G9DB 1UZHA 4NQCD 2EDWA 4FC3E 1RBLA 3EOBB 1ADWA 5C0GA 3NL2A 4QIUA 2BTMA 4OUEA 5FYKD 4F7PA 3VUSA 5KVGE 3CMJA 1E2VA 2PW2A 5E8NB 5I07A 5HYJE 3BVWA 1U8MB 4XB3A 1G7JB 1XLDA 4S3AA 4QISA 3NL5A 2FBRA 1T6BX 3NDZA 4F8OA 3AS3A 2G9HA 3FAXA 2B5IB 3CLEH 1Z89A 3CVIH 2FLIA 4UILH 1VBHA 1UR1A 3ABKB 2P5WB 2AZUA 2CE6A 3LZNA 1U5HA 3IAPA 1C5BL 5C5YA 1UZ8B 4PRPE 1N0XH 3PGDB 3M86A 4MZYA 3LS4H 1KUMA 3VU2A 1EJ8A 3W9DA 5MHBA 4WI4A 2V82A 1M04A 5EUOE 4FG6D 2DW6A 1UQSA 3MRCA 3G5YA 3VFVB 2WMKA 4PJ9D 3LERA 2CPCA 1I7RB 2D3JA 1RV8A 2OM5A 1J8VA 4BEUA 5T1LD 1EZUA 2Y5EA 1S2WA 4OCSL 5HHMD 3LNIA 1U30A 2WC4A 4RNRA 3CS2A 3GXMA 3T0EB 1Y0LA 1DEEB 3UC0H 4YFEA 2NY1D 2EDTA 3OLIA 2RCSL 1D7CA 1BTMA 5DJYB 4XIMA 5IVXA 3TLQA 1FWTA 4PBDA 3WENA 1ZIBA 3ATZA 3J07A 1XO8A 5K7JA 1ZHNA 3QLDA 5F1OB 1Q94A 5IHUH 1H5BB 2WMIB 2C1OB 2YAMA 3REQB 3BQVA 4N9EA 3BPOB 4H9YA 3QB7C 2EKSB 1JGDB 1K6QL 2ZUVA 3RWHB 1P2CB 1GAFL 5IFHL 3IRPX 1U8CA 4XBPA 4HJ0C 1U9KA 3KW3A 3EBVA 1MAMH 3W5NA 5IB3B 2VLJA 1RK1B 1RZJH 4FN0A 3WNJA 4QRRD 3NQAA 1BZ8A 4HCRL 4ZDHB 4Y1TA 4X9IA 3ESOA 1I6NA 2XN2A 1RIUL 2AXJA 3W6LA 2Q7YB 1R24B 2VELA 2PXYA 4HJJL 1ZZMA 1CMOA 4JY9A 3ULVF 4XR8C 3RY6A 1OAQH 4PP2B 1CUOA 1FIGL 4K2UH 3W7JA 1T41A 5D7KD 3D50A 3WLTA 5DHXB 5K4XA 3NSDA 2L0DA 5IB1B 5MEOB 1PCWA 4RRPA 4M1DH 1A1OA 3SRKA 2X40A 1BVOA 3CQFA 4EVZA 3F7RA 5CZJA 4KGLA 5D9SA 4AXKA 1TSIA 1KM4A 3QHTC 4JHAL 1HHHB 1I2OA 4LPTA 4RH4A 3UTPD 1XGRB 4PCPA 4PCYA 1L0YA 2X42A 1POKA 2PGWA 4HBKA 5DBTA 3LDVA 4FNPA 5D1XA 1H8OA 1OB1A 1IF2A 4EF8A 4IQLA 3T9PA 2AHIA 4YNYA 5LG1A 4N9CA 3NJ3A 1DLHB 2PWHA 4H9TA 4W5ZA 2YX0A 1L9OA 4MAYB 3PQYD 2TMDA 2B39A 2PLCA 4C6LA 4K9EH 4KJYB 3EGDA 1GR7A 1UMYA 2LVCA 1JGUH 1IBFA 1TJIH 1QG3A 1J86A 1RH9A 4XAZA 4XO9A 2OXHA 4HXAH 3IDGA 1UZDA 5EUKB 3VGAB 4XD5A 2P44B 2IG2H 4CEUC 1FNLA 2Z65C 3DXIA 4P2YA 2GPZA 3HB3B 4XOBA 3S5NA 3HS0C 3UYRH 5HDBF 1S39A 4FLSA 3WFCL 5G4WA 1ZAIA 1FBIH 2YSTA 2BJMH 5A8QA 3D9AH 2V5KA 5F6IC 1MUWA 5AHLA 1CXHA 5C08A 4E9WA 3LDBB 1NFIB 5I1IL 1EO8H 2BIQA 5CLTA 2UY7A 4D0DA 2EAEA 3SKNB 2YAFA 3CVBA 2WNXA 3DX6B 4LNYA 4IU3A 4F48A 3DSFL 3D0AA 3WF2A 2C79A 1PGRB 4NN6B 2G4GA 1JCTA 3TWCH 2C34A 3THML 2K4AA 5ETUB 1JULA 4N0UE 1D5IH 2DQEL 4UNUA 2J9XA 1AZVA 1OGPA 3KGTA 1MZHA 5BXSA 1X1NA 2C3WA 1X38A 1Z41A 4JRXB 1U6AL 4XIAA 5J0BA 5JR1H 2N1TE 1XGYH 1LO4H 1ZLSL 4QDGA 3GMLA 4FQIH 3X2QB 1LNUA 5C7XH 4AYFA 3F7QA 3WLJA 2QGBA 2ZWSA 4HUWB 1J8HD 4Q6KA 5IBLD 5C2UB 5HJGA 3L9RA 4HVXA 3GKAA 3WD3A 5EBWA 3RWIA 4CLMA 1LLZA 3BLPX 4LSQL 5D2WA 3RDKA 2R0WH 2CBJA 5EV7A 2NZ9C 4WOQA 4G6ML 3VGDA 2IV9A 4HT1L 3BH8A 4IGMA 1PUDA 2MMXA 4PUMA 1WV7T 4Q9CA 3H23A 1TYRA 4MB3A 5IMKA 2BCKA 4U0RB 1HKVA 4L0YA 5IZ7A 7ENLA 2JMRA 4N28A 4A55A 3GUTA 3CPLA 1L6XA 4XH2A 3VVGA 3WQDA 5IJKA 4YE0A 3CTTA 1N6QH 3BHBB 1EIXA 2FX9H 4P46C 1JZ3A 2KKQA 3IMRA 4MA3B 1HSBB 3VXMA 5GZNC 4DP1X 2DMHA 5C9JB 1YYML 4ZQKA 1E43A 4ADGA 4ZT1A 4X9BA 4JKMA 4D8PA 3B05A 4KO9A 3S4SG 4KMLB 1YY9D 3B7YA 4NSBA 2ZRWA 1ORSA 3DRQA 1LK3H 1LQSR 3MZGB 4CCCA 4Z7OB 1JZ8A 4RFEA 1DQDH 3FTSA 4QXVA 2LAGB 2LU4A 1GOFA 3AU1A 2ZUQC 3MBEC 3Q6FB 1UWUA 3F5LA 2XNAB 4L18A 3HZ3A 3JBG7 3BD3A 3H3KA 4YHMH 3PZQA 2Q20A 3KHJA 1MW0A 1VESA 3QI9A 3E0VA 3KP0A 3NZSA 3QXBA 2FB4H 3WJMB 1YEJL 3SDXF 2O9OA 1F6YA 4U4MA 1V77A 4I48A 3LCFA 3T4YB 1DVJA 4LLDA 2Z8RA 1RJQA 2A83A 1XLKA 1PE1A 1JPSH 4KESA 5IM7A 2BGNE 3GHUA 3GC4A 3NA4A 4P2RE 5I5JA 5KBNC 3WIJA 1YA5A 4A8LA 3ZE0F 4LT9A 3MUCA 4LSTL 2PS2A 3TZNA 3BFWA 2AK1L 2VDPB 5KSVA 3W1PA 4PUDA 3OHXA 3WLWD 1FNHA 4ODUB 4NQVB 3TV3L 1UUMA 3GGWB 1V6UA 2PCQA 2YWYA 2YN3A 3PANA 4ZO8A 2XM2A 2VX4A 4XMPL 4MNQD 1T2XA 3D33A 4FFYL 2R1XB 4JFDD 1KM0A 4YBLC 4FA8A 2Z93A 4HK0B 5T1KD 5REQB 1ZHBB 3ZE1F 3NRFA 2J8UF 4N6EA 3B5HA 4UTWA 3O4OC 3H4HA 5HJ3A 1S9VB 1OWWA 3LCLA 4XZLX 1PLGH 4JFZL 3UJIH 1P0NA 4U6VH 3AXMA 1E28B 1W2VA 3K30A 3KPSD 5CR1A 1SDAB 4A66A 5D5ME 2O7SA 3GTTA 1E9PB 3MNWA 2ZVRA 1K4DB 4DNMA 3QDJB 4PJEB 1G9NH 4LARL 1DANT 3CIAA 4C6MA 5D03A 4S0TD 4WU7A 2OZ3A 3GWQA 4F15C 5HYSA 1GGBH 3F7YA 5K2ZA 1E55A 1A47A 2PD5A 4KITB 5EZLB 4X6CE 1Q9WB 3VYOA 5A3ID 4RA3A 5DD3H 1A0QL 1YDPA 4DUOA 3NJIA 4WNQB 1PSKL 3C5ZA 1JNLL 1P53A 1QX1A 1KCXA 2PTDA 3WH6A 2Y6SD 1IUZA 1NAMB 4CQ8A 3ABOA 2GCYA 4LLMA 1QOKA 1KRBC 4GIYA 3FN3A 1XIBA 5K9OB 3HMWL 4MTVA 4MWAB 4X6EA 1MRAA 4U3CA 1XLCA 2I26N 1P7QB 4Z76A 3AUJA 5AKTA 4P2QE 1EGMA 3MN8A 3CHEA 2DORA 1EGJL 1CLOL 1YDOA 1VGEL 1X39A 2ODOA 3GMNA 4BWLC 1VGAA 1JXDA 2B7NA 4PE8A 3WEBA 3CZKA 2OP4H 4QG9A 3OR6A 5KW9H 2W65A 4XBEL 3Q5OA 2BSED 4HVBA 1UROA 4XHJD 4GSDH 1ZLVH 3SJVD 3ZBMA 4PTDA 2VN5A 3TN0B 4QSHA 2APWA 3FO2B 1OT2A 3SR7A 3UZWA 1ISWA 3R79A 2PO6C 2AGKA 4JR9L 4JFFB 4CD7A 2IKJA 1TEYA 2OPCA 1T6WA 4ZD3H 2OMTB 2ZUUA 3O6FB 2YGQA 4S3FA 1BG4A 3GO1L 4M43H 3QHZL 5I1LA 4BFJA 3QZEA 3ZVHB 3SPVA 1EGVA 4ACPA 1T7VA 3L4VA 4YFLI 1P0SE 3U5UA 3T2NH 3PPSA 1MHHA 3RIFF 2DVXA 4N4PA 1RK0A 4HZLB 4IRZH 4RVBA 4UTCA 2VJ0A 3ISIX 1YCSA 1AQFA 1GHFL 1SXAA 2G2RB 1ZLUK 2FR4B 2ZQKA 1M7DA 1KN4L 4ZXOA 2I9LB 1KCWA 1JIBA 3V5KB 1L7IL 1NKGA 1WFMA 4K4KA 2R9HD 1TJPA 1CLZL 4ZUVA 4DGIL 2YDSA 2AJVH 4UFIA 1NGXA 3QPYA 3T77B 3SZ6A 5DJ8B 4JDBA 2YZRA 3FT2A 1SYTA 5DEFA 3QWRD 3UXAA 1SNRA 3E3HA 1V10A 4IBWA 1EFQA 5IV2A 4NZRL 5T3ZE 5KAQG 3DMMC 5BU6A 1C9DA 5FECB 2B59A 1OCCB 3BP7A 3FSZA 1QYGL 1OT1A 1R87A 4F27A 3D3VE 1FRGH 1DP0A 2VUOA 2AEWA 5TH2B 1J1XH 3VQMA 3I6EA 1PWMA 3WTYA 4B5WA 1J6OA 1CVSC 1PZCA 1NFPA 2CZ5A 4ZTXA 1H41A 4P23B 3CH1B 4L1XA 2WP3O 3PFUA 1MNNA 1N5AB 4MMZA 3O3EA 5HGAA 2JKWA 1UVQB 1QWHA 5E9AA 5JBFA 1UUSA 1IGTA 1LE5B 4OZHA 1BTCA 1WSST 2YMTA 3UZZA 2XTSA 2PCPB 5K39A 4UIMB 1GPOH 5K9XA 3NBNA 2VLLB 4HHWA 3IJ7A 4HNLA 4LSRL 1MNUH 2ZSVA 3D2UB 3LQAL 2W27A 5AKQA 4HHPA 1L5GB 2RH9A 3NPXA 4Y1AD 3N12A 3IU3B 3G1FA 2R9RA 4N8VG 3O2DL 4BWWA 2DM4A 3CXFA 1E6OL 3BZEB 4BZ1H 3ES7A 4FFWD 1WZ1L 2IH1B 1XX9C 1B9KA 5FJIA 4WKXA 4WJG3 3UJFA 3LG3A 5DVKA 4FK9A 5HVFB 4P2OA 3FQYA 3ZRCC 1G0DA 3KDMB 2QAFA 5LQBH 4YVXA 3Q6GL 1KYUA 1Y0EA 5A6BD 1ZLEA 1XWYA 5A2FA 3KPNB 4DM2A 4GRWE 4GRMB 1T7WA 1EEPA 4IH3A 4DK5A 4F92B 1BG9A 1BXUA 2BX7A 2ZXBA 2JGYA 5IJCC 3V55A 4HNUA 5DMIL 2CNZA 4U0QB 1CD8A 1QHZA 1VCGA 3MKKA 5E1AB 2IAAC 2QT6A 1ZPLA 2DSVA 4MM1A 3UPRB 1GXEA 2ZXQA 4NIRA 3VOJA 3LS9A 4NEHB 4DP8X 3HG1D 1BX2A 2TRHA 3FGCB 5C54A 2Z9TA 4P9HL 2PDBA 4DW2L 2FLRT 2ZX7A 1U42A 4X5WA 4NQEA 2JJWA 2R23A 4GHRA 4UDUA 4MQ7B 2GBVA 2HB0A 1AO7D 3CQPA 3T1WA 1F3WA 4N2EA 3GX9A 3P8JA 3WDQA 3I10A 3H9HB 3ZZQA 5KSBE 2H0PA 3BGGA 4P2CG 1KV8A 3S2CA 2FWOA 4C7DA 3A6BH 4QP0A 1UQYA 3MODL 4GRLA 4AQLA 3OBEA 2XUWA 4X7FC 5KVDH 1LP9B 3L1FA 5KS9B 3TQVA 1R5VA 4KY1H 3ZQ9A 3HZVB 2OV0A 3R7MA 2RCSH 1AKPA 5D1QC 3APDA 4HPOL 4U6TA 4AY1A 3JTSB 1IEWA 5CCHE 3KBEA 4EQ2A 5D4IA 4LOUC 3CSYA 3VKJA 4KCTA 3WQ5A 4PBXA 3RWCA 1FZJB 1YPXA 1XBRA 3M0MA 4Z3IA 4N2IA 1F73A 2DQIL 5C8JA 4MNHA 3MNDA 4DN4H 1OP9A 3FK3A 5IFHH 5IROA 1TENA 1Q9LA 4KXAA 3V0AC 4E2DA 2OGJA 4GIOA 1PKQA 3RWFB 1VACB 4Y5XC 1RIUH 2QMJA 1ZE3H 1GTHA 5GISL 3G1VA 1NC2B 1WAWA 5C2CA 2JB5H 1RCQA 2R1MA 1IC4L 1FIGH 3UPAA 3EXJA 4KU1A 5IQNA 2DMCA 2FTPA 1VJZA 3V5FA 5FF3A 1UEMA 6REQA 1DE6A 3LTPA 2RKXA 4AZBA 3ARBA 1JV2A 1F3JA 3S7GA 1RQHA 2YEQA 2Q7AA 3QCUL 1IT8A 3VXUB 2BIMA 1VKXA 2V5SA 2IQ0A 4PHZA 2VDLH 3VQLA 4N7QA 2DJMA 1RAKA 2DYPA 4G8TA 5AW3B 2BLFA 1FFOA 2C4FU 1M9WA 3UYCA 1FC1A 2VUNA 1RCYA 4AEHL 1FFNA 4ICMA 1U93B 3G5VA 5BXFA 4FABL 2ZBTA 1SO3A 2OOFA 4R53A 1IIIA 3US1A 2CH8A 4MYWB 5FA3B 3T0AA 3O0RH 5DS8A 1UWRA 1OM9A 1Y65A 2H6PB 2G97A 1AQDA 1TWZA 1GVEA 2XG5B 3SBFA 1KBJA 1LBFA 4DK6A 4NZ5A 1ONEA 3W7EA 4W6YB 2F84A 5ISZB 1HK6A 4FFZH 3FJ6A 1W2PA 3S8HA 1OP3H 3JV6B 4AZGA 3EOUA 4GUIA 1U22A 5DUPL 1QR1A 4KAQH 2WZPD 4Y16D 1FVPA 1FHGA 5T5FA 2IADA 3B9KD 3Q13A 4B9YA 4OGAC 1AXTH 2WXGA 1HOEA 3VOFA 1SUHA 4NP7A 2B5IC 1H09A 3RYMA 2MQCA 1U95B 4YR6B 2VM9A 3L3DB 4PJ8B 2HN7A 2CWRA 2DB8A 5E09A 4S3CA 4D71A 1XX1A 2NQ5A 4I9MA 4WWOA 3U0WL 2Z7UA 2X0HA 5DMGC 2YK1L 3EOAA 1YN7B 2FQEA 2PCFA 1FSKC 5L2KD 3GMPA 1PAZA 4GUPB 3HS0B 4LCUB 1ISZA 4JB9L 4XCEA 1BZOA 4DKTA 5I1IH 4CQ9A 3W1LA 4K7VA 2W0PA 3RTLA 2WO5A 3QWOA 5F96L 3MUAA 3AGWA 5F6IB 2Q7NA 4QNWA 5CZTA 3MRMB 4O54A 4Z2GA 1L6GA 3SN1A 3V6ZA 3THMH 2DQEH 4FQPA 3T0EC 1MDTA 3ULAB 2X6BA 3BEWA 1NSJA 1CIDA 1Q90A 1U8KA 2RFXA 2QKFA 3HPLA 3NCYS 1AANA 3DARA 3H3BC 1U6AH 4QS5A 1AMXA 1UM5L 4GACA 5I7GA 4WK0B 2VDNL 2WSRA 2QVKA 3BWUC 1V7ML 3P30H 3T7VA 5HGDA 3OZKA 3GNDA 4B15A 3HC4L 5JW3L 4QKTA 3TESA 3NMEA 1WCBB 4HIEA 1QTSA 4BRVA 4WO4A 6ENLA 5BS0A 1A4LA 4LSQH 2ZTBA 3GAKA 4MWFB 1IEQA 4G6MH 4OCLC 4HT1H 4AMWA 4RDWA 2L5HA 1QR4A 1T1ZB 4KCUA 3I7QA 4CJ0A 1EJ7L 2UY6A 3GLDA 5HUOA 1OL0A 4JQXC 3DVNA 4YXHL 4H1LB 2DKSA 4PJCE 4NP4H 1CFQB 4MAUL 3I50L 3OM3B 4HCGA 3CSTA 2QPEB 1XRTA 4FMVA 4X0KA 4EE9A 1PU0A 1UC4A 3ARVA 5I1JL 3G3MA 1C9SA 4PREB 1ME8A 3FU7B 3QIWB 3EZ8A 2EADA 2XI9A 4DAGL 1PD1A 2CK0H 3CK5A 2AXGB 1BIHA 4P46B 1R7OA 5AZUA 5BOPA 1NBYB 5E6SB 1NGZA 1YMMD 1Q6QA 3QFJD 3TBSB 4MZ1A 3NCXA 5MENE 3KZPA 3AYVA 2Z1XA 4J4PA 4KHXL 4OZ4A 1V8EA 5AW8B 2EIEA 4WFGE 2Y6TE 3M46A 1OK0A 1A2YB 5IB5A 3AM8C 1JPFA 1EEYA 3BLFA 4JX4A 1MKFA 1R0AL 3CBRA 5BOZG 4HNNA 4KDTA 3KPOB 4W89A 1BOYA 4JIEA 2ZUQB 4WENB 3MGTB 4YSUA 3MV7B 4M62L 5GGVH 1M6JA 5LBGA 5HHNB 2FX8L 4GQBA 4OVXA 1Q6OA 5TBOA 3ZWTA 4LV9A 1QU4A 5I0YA 2QFRA 4L8SC 2FT7A 4F8NA 2J55A 2AK1H 1T83A 1PFCA 3BVUA 1B9BA 4U1KB 5KBMA 2UX7A 3GK8H 2A3CA 2G4JA 2PP0A 2QQLH 3LUTA 2BHZA 1WT5A 3ZE2E 3D85D 1WBYB 3TV3H 1LMIA 4MB1A 1LRNA 5DI8A 4WUUE 1JE6A 4E41A 2E4FA 4WFEE 4XMPH 2WYZA 1ZJIA 4GYKA 4ACZB 5DTFA 5KJRL 4TNWF 3WY2A 1VFAA 3GH7A 3REVB 2ZP8A 3SDOA 3U4EB 2L7UA 3KWSA 2VO8A 3SJNA 3MVTA 3K1GA 3QSRA 3FT1A 3ES6B 5HI3C 5JMUA 5A1AA 5CGMA 4MKSA 3FQNA 1MCCA 3ZXWA 2O5NA 1VHPA 3RZCC 3O0FA 1YTKA 3SCMC 3VI4A 3S88L 4G11A 3E0FA 4YBLB 3C5JA 1KGJA 4PJGB 1TVDA 1PDYA 4MMYA 4PJIF 2CMRL 4QLKA 3FDWA 4Z1CA 5HVWA 3QN3A 1N64L 5LHEA 1VADA 3NCYP 1RZKL 2Z7GA 5T3XH 4L29A 4MZ8A 1HQTA 3O4OB 3BP5A 4LARH 4LPYA 4G9FD 2DY2A 2QIWA 3ATYA 4JNYA 3WO3B 3B9AA 4X9SA 5TQ0H 2D2GA 1DIDA 4XN5A 3KNBB 5CINL 3DJRA 2PC4A 1UWXK 2PCYA 4ZL1A 3O9NA 2PYEA 2YBTA 1XR8A 4GG9A 4N0CD 1OFAA 1FNGA 1PSKH 2G37A 3QJXA 4F15B 1ID5I 4YL9A 4ETYA 3CN0A 4O19A 2BP3A 3VYPA 2C19A 3UZEA 3LKPA 3MMTA 3T8LA 4G59C 3L4TA 1E1CA 3C6LA 3GYEA 3W25A 3PN8A 4FALA 1YRRA 3GBEA 2CDGA 2NR6C 3QZWB 5I8CB 4EUPA 3HUJA 3RUGF 1QT1A 3O8XD 1NDTA 5GGSY 5FFLA 1Z6KA 3BD5A 3CC5B 5JBDA 1TDQA 1GZJA 3SBWA 3FFCD 5KOMC 4XBEH 4YSDA 4LSVL 2YAEA 3SQBA 1SGKA 1A4KA 1W72A 3R18A 4A7TA 4KROD 2GI7A 1J12A 5CIPB 1QLRA 3UTZB 3QUXA 3FCSB 4R9XA 5E5RB 3EFOB 1H3UA 4E8CA 3TW9A 4YHKH 3BAJA 3TA3A 4P0DA 1F74A 1XEUA 1P84J 1NEZG 1TTCA 3MP5A 4JY4B 2OZ4H 2OKMA 1YNTA 1A5SA 4JO3L 1KXTB 1R3SA 4UTBA 3C6SA 4NX5A 1QUPA 3D39B 1UJQA 3BQUA 3VIIA 2BERA 5FKYA 2YBVA 3HIZA 3DX4A 1CTMA 3T0DA 2YCLB 4Z7IA 1QLEB 5HI5D 1H3GA 2X6UA 1GHFH 3ECBA 3EYQD 3WE1A 4LFYA 1JFQL 4QM1A 4Z0XA 1ONQB 5DO2D 2Y7LA 5C09E 1KN4H 1HXMA 4B9IA 1PFOA 1ODAA 3ATFA 4H88H 1L7IH 1F18A 4FLHA 3R19A 1JGIA 2CNCA 2V17L 5K59E 4MUPA 3TM6A 1CLZH 1HG3A 2FKPA 1IKOP 1FVDA 4XAYA 1AH3A 4JTTA 5CUSL 2NSXA 5C6TL 1FPTH 3CX2A 3LN5A 1W3TA 4UTAL 2D2CC 5TF1L 3DECA 4NZRH 3BW9B 1VBGA 3RM9A 3DGRA 2BASA 3PUUA 5AFAA 3A4AA 3UO1H 2YRPA 4PG9B 4F3FA 3GVVA 2OBGA 4ZUWB 1IQ8A 1LEKA 1MIEL 25C8L 4C7GA 2PP9A 3WBDA 3BVVA 3DMMB 3QEUA 3NQGA 3FN0H 4L65A 1FXPA 3ZL1A 2ZUYA 3F2BA 4YHYC 4NQDB 4UOW0 3DCPA 5FHAH 3UWQA 4QXTB 1JFHA 4RMVA 4A3RA 3IFNL 2EE0A 3L9EA 3OVUB 4LSRH 5FK9B 4Z7WB 1TVBB 1BPLB 3LQAH 4WKZB 1JWUB 2XTJD 2FTAA 3VSUA 4FZIA 4GAYB 3OO2A 1QTYT 1WC7A 1X7FA 3E1ZA 1TU2B 2GGJA 1WUNT 4EO5A 2XCMC 1E6OH 4OZGA 4UB9A 2L3BA 5FD0A 2WJZA 15C8L 2EDHA 1OTTD 4DBEA 5GNZA 1X5HA 2Q86B 1GQIA 4JHWL 2DSWA 1JV5A 2JI2A 4IYKA 2NY5C 5KSWA 5I66A 1MCDA 3ZZLA 3SOBH 4L8DB 5T1MB 1IGJB 3SKOA 2VEGA 2Q3RA 3F83A 2Y24A 1WNOA 3GXNA 2B16A 1I0BA 3TZFA 5AC6A 3BUDA 1WYJA 4N9BA 3LX9A 3W38A 3OKLB 2LLEA 1BZQK 4BUHA 4NYUA 3RURA 3L5LA 4YCOA 2WSQA 2D03H 5IXEA 1EXUA 5IREA 1K3UA 4AM0Q 5DMIH 1E4IA 5D05A 2EXSA 4IKIA 2D2JA 2DKMA 2H32B 5J5DA 3C75A 3P0VL 3TN0C 5FCZA 3NZUA 1Z5LA 3L68A 1OD0A 4PJBE 1CQYA 3EJCA 4GIRA 1E4NA 1EJ6A 4WDWA 1FQ9C 4GXVH 1M7JA 4FYTA 4E9LA 3GB7B 2INEA 5LXGH 4P9HH 4L7ZA 4X2PA 2Z92A 1QWGA 4GW1A 3B97A 5B8CA 1JF1A 2FEEL 5FEZA 5F8RC 3PNWA 2RH0A 1J5TA 3TA9A 4NQCA 1S7RB 4YX2H 4XC1H 1FG9C 3N6QA 2A6DA 4R33A 2ESVD 3DHPA 3MODH 1S8DA 4B91A 3N1PC 4UOJA 1KJVB 3QEGL 4A68A 8RUCA 2Y70A 5ACMA 2ITDA 1DOSA 2OL3L 1TUFA 3MUHL 3QDMB 2XIQA 3NGJA 4LALA 5GS1C 1LO5A 2FCBA 1CT5A 2BNQD 1NMCC 3I02B 5AKVA 2WMGA 1E42A 1WK0A 3HE6D 3P80A 4I5XA 3MLSH 1V3MA 3PTDA 3ZTDC 1WKFA 2DQIH 3FS2A 5ITFB 3PPFA 5DRWA 3MV01 5D1QB 2XFXB 4LLWB 3N34A 1GZPA 4O50A 5EMUA 5HK4A 3LEXA 3VOIA 2IH3B 1JYNA 3VFUB 3GIQA 3TN5A 4P5TC 7CGTA 4ZS6D 4X7TB 2XXMB 3FT0A 2ICSA 1NC4B 3RX2A 2WXQA 1HZLA 3KPRD 1OAXL 5T1LA 3ZYIA 2JKEA 1HZKA 3RO8A 1HP4A 2Y3AA 4WVXA 3TQPA 2WWNA 1NGQL 4NKOB 5EN2A 4H00A 3U2IA 5EIQA 4GC3A 4H9ZA 4EIBA 4NUGL 3V52H 3L6FA 4Y5XB 3U0HA 4DZAA 3ZTJG 1S7VA 4LHUB 3QCUH 1IB5A 3S37L 4OGYL 1MFBH 3B04A 3RAOA 3N42B 4Z0BL 4C56E 2V2DA 4AZIA 5MEPA 2OR8A 1W3IA 5CILL 4AEHH 4PJ5D 4R7LA 3WKYA 1H60A 3ALGA 3ZO0A 5EMJA 5BROA 5AQ0A 4UMSA 4QRRA 2Q2LA 32C2B 3EX1A 3U9UA 1NOAA 2EICA 3VB9A 3SBQA 4ABVA 4RIRA 3WHXB 3I75B 3K2MC 4PMDA 2L04A 3KLHD 2JGQA 3TCEA 4XP5L 2H6UA 2G3IA 2IQ9H 4DKDC 2HT4D 3W02A 2YD4A 3PM6A 2BVOA 4PY7B 3G6JF 3AITA 4WR3A 4PV1C 1V51A 5A6TC 3OAZH 2WZ0A 5I6NA 2V68A 1PG7L 2FE0A 3OGCA 3ECQA 4FL4C 1OOWA 1NCAL 3GSVA 8PAZA 1BBJA 4GX8A 1E5ZA 7A3HA 4PTNA 4AQ8A 3V6OC 1MNZA 3B83A 2DQWA 3GXDA 3Q2VA 4KKCC 4QRPE 4ZRGA 1IAII 4P3CL 5DJCA 4NYYA 2YK1H 4AB4A 1I31A 2V2TB 3VGHA 3DBXB 4IRJD 2F7FA 4XNDA 4YVVA 3GQFA 2PW1A 3PQYA 4TVCA 4NO3B 1NF0A 5E00A 1R3YA 2BGSA 3PWVA 4GFXA 2BVPB 1HS6A 4UTLA 1OAUH 4HJEA 4HUUB 3HG2A 3LKNB 3RG6A 1FSKB 1P1VA 1HEJC 4JAWA 4WI2A 5I06A 5A8OA 4ELMB 4A37A 2WLZA 1E3FA 5BW6A 5I1HH 1PJWA 2QSTA 1F45A 3C86A 4N1HB 2Y5TA 2DI8A 1BXBA 3BUPA 4QKXB 3C0LA 5JHLA 3CBWA 1M1SA 2IBZX 4NJAH 2CO3A 3IFOA 5DURB 1TZIB 2VXVL 1FP9A 3CVHH 3DJTA 5FGCB 4F91B 3HC4H 5JW3H 1FVCB 4LVFA 3BP4B 4QWWD 2C1IA 5I78A 2J21A 5H2BA 4BK5A 1LE9A 2YBRA 1N59A 4GH7B 5M03A 5HYQB 2BSSB 4O51A 4KRNA 5DJDB 3DAQA 5G5DA 3H2MA 3KS6A 4JRLA 4ECNA 2Y4SA 2Z64C 3OKNB 2H7WA 5HI4D 1CF8L 4DP0X 1BMWA 2C14A 3SYOA 3MU3A 1ZT7A 3NJGA 3CHOA 1UOKA 3LJ3A 3O11B 4APQB 5CR8A 2IPFA 1KFBA 5E8EA 4KDWA 1YAZA 3BXWA 4QXGH 2ZXAA 4O00A 3BGJA 3CHDA 3CFDA 4S1FA 1HJCA 5I1JH 2BSRA 1V27A 1G5GA 3M0XA 2JEPA 3GHPA 1P7TA 5H8MA 2WBKA 4LQFL 4J35A 5FL1A 1TZOA 2IBBA 3ZU8A 4PC8A 2R0ZL 3TX4A 1BDYA 1DQWA 1FIEA 1VCBC 1AR2A 1J8HA 4LLUB 5CSZB 3BJLA 4OVVA 2BVQA 4DP9X 2C1PA 3BK0A 2Y1AA 5F9DC 2COVD 4KHXH 5K1VA 3HE7D 5IHHA 3R4RA 4LFHD 4PJ7B 3RIAK 1JPGA 4HLZG 4WY0A 4F1ZA 2W61A 4L9LB 2W9DL 2C6QA 1BWWA 1CFVH 2M1KA 3FB6B 2A9DA 3KD4A 3ML8A 1UB5B 3MCMA 3NCOA 4JFVA 1L2QA 4LEOA 2VXQL 1H3WM 3UA3A 1W3LA 2OMYB 3GVQA 1A5KC 4N6FA 3UXKA 3FTXA 1O7SA 3QG7L 2X3CA 1W8NA 3BAEL 3RVVD 2IPJA 4Z3FA 4X7SL 1HW6A 4HEPA 1K8DB 2AVGA 1ZB5A 5DVMA 4JAMA 2WN3A 5ADOL 2O26U 1OYCA 3GMQA 1WXYA 2BK8A 4ZR8A 4C6IA 1BKHA 1JQVA 1E30A 4LLYB 4HP5A 3ABXA 4PJ8C 5CHNB 4L8SB 5F7UA 3T3PB 2G0LA 1XGTA 3G0SA 4NI8A 1JWMB 1PKMA 2NDFA 1LTXA 1WIPA 4RZCB 2MOGA 5KJRH 3N5AA 4Y2DD 4OR1A 3NRPA 1XD1A 1I1AC 2IANB 3OODA 4PSPA 1G7QB 3M0IA 3O3BB 4XTRC 3ZTNH 4Q8UA 4ZSOB 5F21B 3LB6C 5FR3A 5E1HB 2ZUXA 4IHOA 1KB3A 1DSWA 3FU6A 3MUGA 1OP5H 3ENEA 2P3YA 3LHAA 5HBBA 3VMPA 5DCBA 4FQ1L 1BEUA 4YHPB 3CHVA 3Q2LA 1TQJA 1H2JA 5D2TA 1RZKH 3QG6B 2VOMA 3RPKA 3HNTL 5DMLA 5C0IA 1NWPA 1G0XA 5J11B 3RZCB 3SCMB 2AOSA 1R85A 1V3LA 4NRYA 4WW1B 4DERA 1ASOA 1Y5VA 1PZAA 2ZKHL 3C4UA 1PCKA 2Y63A 5D9PA 1WTLA 4TQHA 2RGMA 3CZ8A 2AMXA 3N6JA 2CO6A 4ODSH 5CINH 2A3LA 4OCXL 1A6AB 5CD5D 3M0JA 3T1FB 2Q3OA 3ASOB 4AZ6A 4JFDA 2GJRA 3RNKB 4X4ZA 1FCUA 2JK5A 1KN2L 2WSKA 3VTAA 3EEZA 3MB9A 1PQZB 2YXWA 4MJ6A 2OQJB 1A7NL 3IVKB 1DBMH 4PJFE 1JK8A 3EDFA 4ZO6A 3M0YA 2F8VA 1F58L 4HUMB 2J7HA 3IDMB 3DYPA 3KPSA 5DLCA 2I1OA 2YL6A 1CDCA 4LEXL 2X44D 1RJPA 5IMLB 3UTSA 3QIWC 1A6WL 4H01A 5D6DC 2JIXB 2W60B 3H8NA 5PCYA 1DJGA 1K70A 4RPPA 1TJ1A 3FJ4A 1OM0A 2F1EA 4LSVH 4GY0A 2GSIA 4J8RB 4O4YL 3WYRA 1ZPTA 1ZDSA 2P3ZA 1D5ZB 3W0WE 4PRNA 4LLQA 4IT1A 2QF8A 1EMTH 2EZ0D 4LSDA 5IQ9A 5I1AB 3D06A 1AGCA 4L64A 5L4FA 4LUSB 2YAOA 3C08L 4JO3H 3N0AA 3Q1SH 4Y5VB 5BRZB 1ZT1A 3QH2A 1IAIH 2YGOA 5JUEL 4XRCB 3HC0A 1E1EA 3R0DA 4UBPC 5I6LA 2BBFA 4QHRA 3EYUL 1GIGH 3AQZA 2AJSL 4G5ZL 4H7VA 2YUWA 4QAMB 1BOGA 1NCTA 3F2CA 4DUXA 5BMFH 3EZ4A 3CV1A 5E2JA 4DKAA 3NOEA 4JFED 2NYYD 3ZTJH 1SF3A 1IGWA 4EN3D 3M6DA 4CGUB 4LWWA 2ACRA 2WQDA 4IX2A 3A64A 2PN5A 1J0HA 2DT1A 2V17H 1WBZB 3SJVA 1KCLA 2EEBA 4TLUA 3WQWA 3JRKA 5IHSA 4PMRA 3S1XA 1D7BA 2CLRA 1QAPA 5HGHB 2XT1B 2V4LA 1Q13A 5C6TH 3R06B 4DP4X 4JIIX 1D2PA 3FL7A 4NHCL 2XSAA 4UTAH 4ZQMA 4JJ5B 1XB8A 1CE6B 4N0YH 4Z7NB 2OU4A 3DJSA 1CLXA 1WE5A 4X99B 4HFUL 1GTFA 4LEEA 3MRNB 3NFNB 4LASL 4ALAH 4PI0A 1I3GL 3WDJA 4Y9GA 25C8H 4J3ZA 4PGDB 1YPZE 4Q4QA 1NCGA 5B38A 3MRDA 2LVEA 4GVFA 2H6RA 4IKLA 1KPRA 4NO0D 4ABQA 3QO0A 4EI5D 5CU5A 2PI6A 4ZK8A 4JKLA 4UF7C 1NWUA 2ZWYA 1REQA 4GXWA 4N42A 4PZVA 4XNXL 3VXNB 1DWGM 4NI3A 2QCFA 1JNHB 3H9SE 4YHYB 4MA8L 1L9PA 2Y7QB 3QWRA 4B27A 1LQAA 4MVAA 1DN0B 3T3MB 1B0IA 3O6KH 3VCLA 3NO5A 2VCAA 2EDRA 1FWNA 4G7YL 5DD1L 1FGNL 3DRTB 3MUZ1 3BLOA 3ZDYB 4WIWA 4PMZA 1MI5D 4YWGH 4JHWH 2BS8A 1EZ2A 2INFA 3HLKA 1S5HB 3CIQA 3E0GA 4M8QB 4KWOA 3SO7A 4QO1A 2NNAB 4X4YB 2Z8WC 3CQIA 2ISVA 3B2UD 4KZEL 1YN6A 3OJVC 3KR3L 4IFOA 2WAGA 2FT8A 3MRLA 4Q2ZB 3GK0A 4G2AA 1ZSDB 3GUFA 4PRAA 3W6MA 4Z17A 3MRQA 2VZTA 4AQZA 2HV5A 1R30A 4ODTL 4AKOA 2NY7L 1VH7A 3EB4A 3H7LA 2BY1A 4ZSTA 1M6OB 1RU9L 5FEWA 4G7EA 4H25B 2O61B 5LNUA 1C8XA 3U0TB 3L0GA 4CD4A 4P2AA 3UAJD 4JVPA 2F0CA 4EACA 3TYFB 3L4XA 3CB8A 3CSGA 4L3EE 5E08L 3KX6A 5DRNA 2O9PA 1BAFL 3WLRA 5HD8C 1I8JA 1B9ZA 2FHCA 4LLVB 4IBUA 2D2OA 5M94B 1G7HB 4LBSA 2KL6A 4S1DD 2WWMC 1V7NL 1OALA 1ZLPA 1KNOB 3QIBD 1K77A 1Q9KB 1WCGA 1EJVC 5ESAA 5A6BA 3AG4B 3HA0A 3BPLB 2P43B 5FCSH 4W9JC 2KERA 4N0FA 3BW4A 5C0BD 2X89D 3P4NB 3FUHA 1NTDA 5I3HA 4P5KB 2X2JA 4JQIL 4Z0JA 5I18H 3BKCH 3EBAA 4YWIA 4DWSD 4YN3A 2YZ1A 2OL3H 3WX7A 1POJA 4GQPH 5I26A 3M17B 2V2XA 2IKHA 1RLDA 1M42A 2HXAA 3CU7A 3HG1A 4UM9A 1DTUA 4N2MA 1HILB 1J05B 1ES0B 3VG9B 4HLZH 2VGLM 3GSMA 3LTVA 4DXVA 1Q66A 5F7LB 5GS1B 1AO7A 4JG1H 1NMCB 1EQPA 3DGDA 3WTXA 4A7GF 5I6OA 1JCYA 4UOW1 3WN6A 1AI1H 5HGBB 1ORQA 5TDPA 3ZVIA 3PF3A 1FRBA 5HVHC 2YR1A 3IRCA 1TVLA 4PMYA 5ICUA 4BA8A 4TOYH 1ZS8B 1MRQA 3P74A 2E76C 1B0WA 2Y69B 3FSTA 4WJXA 4YCPA 1MLBA 5C07B 4LU0A 5JPNA 4PS3A 2EO9A 3TXAA 3C8NA 2AC0A 4P5TB 4TVPD 4M5TA 1LL1A 1W37A 3QYCA 3IDXH 1DVZA 3BD4A 3X12A 5DK0A 1A3QA 2LFGA 2X28A 5JUVA 1GVYA 4KRPD 3L1OL 1F4AA 2JELL 3S36H 3DBPA 1F11A 2X4RA 3RL2A 2DMKA 4OGYH 5L88H 2V0AA 2Z0BA 4XCYB 3PWAA 2FJUB 4Q6IA 1QSEE 4Z0BH 2PZNA 3LQZA 4C54A 3WQVA 4OI7A 3M4HA 1UKTA 2AV7B 3QEQD 3QNZA 5CJMA 4Q9QL 5H94A 3S2MA 3JVGA 1NOWA 3CZFA 2B7OA 3VFLA 2OR9H 1WO2A 3WFEL 3USZA 4M7JL 4NM4L 4MAVA 1ZWIA 1SXSA 1O9VA 4US5D 1M9HA 2VC2B 4JFPA 4B7IA 4XNYH 5DJ6A 2BP0A 1EBPA 4AIXA 1F3RB 2E47A 4IOIB 2EIKB 3B8TA 4F7EA 3U0PB 2HFEA 3QQ1A 3UJEA 2NT1A 2OT0A 2J9YA 3S5LA 4MJ5B 3TFKD 1RHFA 5E5LA 4XP5H 1T03L 4C59B 1IEVA 4EXKA 1UA7A 1T80A 4R26L 5AZEH 3DVFA 3WUWA 4GKNA 2DD8L 2RUSA 4I6KA 1WDPA 3EAKA 1XYAA 1U8QA 3N6HA 4X6FB 1OEZW 1PZDA 2I25N 5I3GA 4YHNB 5D2LE 4CQDA 4W9FC 5MHSD 1U8JB 4H7ZA 1G4PA 1H11A 4KEUA 8A3HA 5GGUB 2EDNA 1PG7H 2WMPA 5C0EA 3ZO9A 1TQXA 1NCAH 5H4YA 3MYZA 1YNKL 1I45A 4LCVA 3DC0A 1M03A 3KWXA 1LF1A 4J3OC 2XYBA 3E1F1 2B3RA 3FRUB 2WHKA 1MEXL 1O7AA 4GSXA 4PHXA 5FOJA 4XAKE 1EBGA 4FL4B 1U3HD 3ARYA 4L4TD 4XP9L 3B8DA 4LCSA 2J1KA 4TN9A 2VDIA 4XPFL 2LOEA 3MMEB 3SE3C 4AWEA 1M7OA 4BQ8A 1C5BH 1Q8JA 4WRHA 3CL8A 1ALDA 1U91B 1HXYB 1UKQA 1MLCB 3CHRA 1D5XB 1KJ2B 1BYOA 2QYGA 5G4OA 4KKBC 3OKMA 3JZ7A 1G84A 2FWLB 1FWSA 4IMEA 2DH3A 1DCEA 3MJYA 5IOKA 3VXSE 3KLKA 2E56A 3ZZ1A 4OCSH 2E0PA 1HHIA 2MHAA 3VW3L 3BV4A 3P67A 2VXVH 4YXKL 3G1XA 2AP2A 3HS9A 5BW7A 2AKZA 2PTWA 3N3EA 3VIKA 4KKNA 3PG8A 3CLWA 5L2KA 1R46A 3W1XA 4EJ1C 2GK1A 4G5AA 4J2MA 2V7HB 4WX2A 4U1LA 1ZHKB 4NO5B 1A4JB 1GH7A 1XHGA 2C1GA 3P14A 4JLRB 3SDXA 1ZK5A 3KDOA 1K6QH 1PJ9A 1GAFH 4ZPVA 2GTWB 3RLGA 3MLVL 4S3BA 1TJRA 4K1GA 2WINA 4JREC 4XD4A 1VFHA 3G8EA 3F65A 4Y9NA 4BFKA 3QW4B 1IC5L 1RY7B 1LG2A 4GKOA 4HCRH 1NIBA 2FQGA 4O5LL 3WG6A 5CAHA 1JNEA 4AY7A 4FHAA 2OYLA 3AHTA 3GDRA 2XN9B 4LQFH 4OE7A 4HJJH 4NKCA 2LLLA 4LS1A 2R0ZH 2Y2YA 4C4UA 4ZUTB 4HPYL 1I85C 3GYRA 4C7FA 3AACA 3K91A 6XIMA 4XXWA 4Q7BA 2F54B 3GI8L 4JTIA 5INCB 2EIDA 4JZ5A 2ZE3A 2EKGA 3QUYD 3KGRA 4RGMB 3EJRA 4Q4RA 4XPGL 1FNAA 3KYNB 1AG0A 3ETTA 4D8AA 4M56A 4WJEA 1D9EA 3DKHA 4LSBA 2DWEB 4JHAH 1NBQA 4ORGB 5TIMA 4NUWA 1MCNA 1KLUA 1QEWA 2J8UA 2J2ZA 2YOAA 2VXQH 2Z91A 1IEBB 5D7LE 1KM1A 5IHRA 4KFNA 1E5JA 3AC0A 3BAEH 2WTRB 3O9WC 1DDTA 4D9QE 4Y2WA 1N0LA 2EDJA 4O2EA 4X7SH 3W2LA 3KRUA 1SFSA 4GG8B 4ZB2A 2DQGL 2ZYSA 4C5ZA