2FMNA

Ala177val mutant of e. coli methylenetetrahydrofolate reductase complex with ly309887
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
288
Chain Sequence
FFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGVNRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structural Perturbations in the Ala -> Val Polymorphism of Methylenetetrahydrofolate Reductase: How Binding of Folates May Protect against Inactivation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 98
structure length 288
sequence length 293
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 2fmnA00
1ZRQA 2FZNA 3E2SA 1TJ2A 1TJ0A 3E2QA 1TJ1A 1ZP4A 2FMOA 2FZMA 3IJDA 1V93A 2FMNA 3FSUA 1ZP3A 1B5TA 3ITGA 1TIWA 3APTA 4JNYA 3FSTA 4JNZA 4O8AA 3E2RA 1ZPTA 3APYA
chains in the Genus database with same CATH superfamily
4PBFA 4JD4A 4K6AA 3L0KA 2FZ8A 4KQNA 2YYTA 4GJIA 1G9HA 4CQDA 3IJLA 3ABZA 2WHKA 4URIA 4IL0A 3KHJA 4JFVA 3GDMA 4ERIA 4M81A 4NI8A 3PZUA 4J3SA 3CL8A 1R9XA 4HBKA 1XDLA 4JY8A 4X2PA 5EMMA 4JICA 4KF1A 3CUJA 2FHCA 4UCGA 1X6NA 2INZA 3F4NA 4R85A 2OQYA 4FSAA 3W07A 2NVDA 4J3XA 3DHDA 5LKYA 1FDJA 3VIJA 1GHSA 5C9UA 1ZNNA 4JNMA 4CCZA 4CVUA 2ZDSA 1BEUA 2OZ8A 4L56A 3IIZA 3M0JA 1JEZA 3Q37A 2XN1A 3KUMA 3LBOA 2NWSA 1S2VA 1UJPA 3GNNA 3C8FA 3WG6A 1GPFA 3U2EA 3U5YA 4JR5A 1M41A 4KEVA 4WOZA 2VP8A 3OIHA 3FK4A 2VFFA 4YNGA 5I07A 4Q33A 3OVGA 1JG9A 2ANUA 4JFWA 1Y65A 4A8IA 1RALA 1KFKA 3CT2A 2DSZA 3AS3A 4N9EA 2PU0A 1XI3A 4YCPA 3ARTA 4M5PA 3W84A 3OYZA 2PF0A 1OWQA 1FFRA 5J8LA 1ZENA 2G97A 1GZ1A 2JQXA 1BTCA 3DG3A 3PR2A 3T05A 3W7EA 3C2FA 1RCOB 2EKCA 3WNOA 5CC7A 3GNOA 3LNPA 2FIQA 4PRRA 2J13A 2V5BA 3R12A 3RX4A 2EG8A 3ZM8A 2I5IA 1J0KA 1OHLA 3PAOA 3QSTA 1WAWA 1CTNA 4AZ6A 4LVFA 2FYMA 2NV9A 4AMAA 4GQ0A 3EPNA 1KBBA 3A6OA 5BOEA 1H49A 3HG2A 5C8BB 4GZIA 2I5QA 2J27A 3KOZA 5KZDA 1XBVA 4RNJA 1B4KA 3LCWA 4UBPC 4HVXA 3MBDA 3RILA 1PBGA 1VCGA 1TMLA 3STCA 3BW4A 3QYQA 2I7GA 2BV9A 3ID7A 3NJ3A 1K1DA 5BU6A 2QCFA 5REQA 1GQKA 3A13A 4E3TA 1AZ2A 3V5CA 2OPJA 3W71A 3WD4A 3T42A 1Q8AA 5D9OA 1IEXA 1THFD 1JL8A 5D37A 1DL3A 4JX5A 1UC5A 1MQRA 3LSCA 4O4VA 5PTDA 3SGZA 4I9MA 3D6NA 3TSDA 5XIMA 1WKFA 3OBEA 5AYIA 1N7KA 3BDKA 1UR8A 3C2EA 1UIPA 1I2QA 2ZE0A 1P4CA 2B31A 1K6WA 3STEA 1O5XA 4MJZA 3EWZA 3WQ5A 3POCA 3I68A 4LS1A 5LIWX 3MDUA 4FLRA 1VEOA 4HGXA 7REQB 3ZJKA 4AD5A 3GTNA 4GUGA 4D6DA 1FCBA 1VBRA 1C93A 3CQJA 1W32A 3AMKA 1LQAA 1Q66A 4JHMA 3SIMA 2CEQA 2B7QA 3HV9A 4WJXA 4MZYA 3BMVA 4Q4MA 1XINA 1ZFJA 1BRLB 2PWEA 5G2WA 4JTQA 1YHTA 4XTIA 2P10A 3KL0A 4JIPA 4PCNA 3KAOA 5B7ZA 3S8HA 1FCUA 4XUGA 1VR6A 1DYSA 1TV4A 3S42A 1MW0A 3GQYA 3GDLA 3NQ8A 5H8PA 5ABEA 1G0CA 1ZGDA 1Z89A 1J96A 4DQWA 4L1GA 5HR7A 4EKJA 2A3EA 4TMBA 2VX7A 3DIPA 3RCNA 3T1GA 4RJEA 2ZXQA 2HS6A 2IPGA 3I65A 1K4GA 2JFEX 3BGJA 4GGHA 2G41A 2YL9A 5DBUA 2WMIB 3R43A 3MSGA 2Y62A 3VZYA 3TONA 3KZPA 4PUUA 2A3HA 2KZHA 4UUIA 2VFHA 7ENLA 3ITCA 3OLDA 2O4QA 2PI6A 5LHFA 3WQEA 3WDQA 1P1MA 5D8WA 4DYEA 1XSJA 3H4XA 5I7GA 4FOKA 4P7OA 3BW2A 3QQWA 3S2LA 3THUA 2P3EA 1W2VA 1R2SA 1UZ4A 3T40A 5CG7A 2CLPA 2WMHA 4HNOA 2QCGA 4OTKA 4V1XA 1TX0A 4FB7A 4AEOA 2O9RA 1KLYA 4WR3A 5C7HA 4IIFA 1W54A 1V02E 3VNMA 1BVNP 3WH9A 3QN3A 4C1NB 2RHGA 1MRAA 1UR3M 3BW3A 4XAFA 1XLKA 2YA2A 4MOZA 4ZTXA 5RUBA 1X1OA 4PFHA 6XIAA 1FWCC 3LHYA 1GJWA 5LNWA 1DE6A 3IK2A 4PCTA 2HMCA 4PH6A 3QQ1A 4O1DA 5GVJA 1YADA 3PZVA 4DZIA 2DV0A 1ESWA 2DIKA 1XYBA 3UA4A 1UUMA 1XRSA 4NRRA 4MF4A 5EBUA 3MHGA 4Q4KA 4Z1DA 1PCKA 2PC8A 4S3FA 2WMFA 3E3HA 4PN2A 1UBSA 1FKXA 1A53A 1T0OA 5LSMA 2V67A 1H1YA 1RLCL 1ICQA 5D38A 1JNEA 3EWCA 3KFTA 4NG3A 3UJRA 1G94A 3PZMA 1Q65A 4K3ZA 5I0DA 3WBAA 3W26A 3GLCA 3SCNA 1E4LA 1U2YA 3LCLA 3QZAA 4KGLA 3SW6A 1EJWC 3K8KA 3WLRA 1HJWA 4YN5A 4LRTA 1W3HA 3SSZA 1UR9A 4DUWA 5K3VA 3TLQA 3PPCA 4LAZA 2CXGA 1XPYA 3FEMA 2PU1A 1S2TA 1XQKA 5KINA 4ZVJA 3NSNA 3SADA 3OA5A 4M8UA 1XRFA 3GM8A 1CIUA 1XLJA 2AKMA 1CGVA 4HK6A 3BG3A 3VA8A 2JK2A 1NTHA 4RLIA 1EHNA 3G1SA 1QUMA 2GVJA 4UTHA 1TPVA 4LCSA 5LA0A 1OYCA 2XINA 5AHNA 4GYFA 1GQJA 1GORA 2W91A 3IJDA 3DN5A 3VC5A 4BF7A 1FY6A 2BHYA 2QPSA 1EUNA 3S1VA 1O12A 2E8YA 2V3DA 3P2VA 3IGXA 3ARWA 2FFIA 3IIOA 5A5WA 2D0GA 4UTFA 4GZJA 1ISZA 3MQTA 1MRQA 3V36A 1OG6A 1V6WA 3DFNA 4MZ8A 1OM0A 4LUSB 3EEZA 1MFVA 1I45A 4JPGA 2PWHA 2VFDA 5A69A 2YDSA 1VFLA 1RH9A 4PB4A 2A4AA 2J6VA 3PBWA 1D8CA 3WO8A 1CW2A 4FEZA 1DJGA 3UWZA 4XAYA 4PUJA 1US3A 4LQ1A 3SR7A 3B05A 2HROA 1FFQA 5IOBA 5A6TC 1XYAA 1TKKA 2Q09A 3VGEA 1VBGA 2DQXA 2E8ZA 5CAHA 3FDGA 4PCFA 1R3SA 1G4PA 3N2BA 3DESA 3MSYA 1DTNA 5T9BG 1P1XA 6ENLA 3N2MA 4IGMA 4NUWA 4HZ7A 4OHQA 3I10A 4O19A 2X1IA 4C1LA 1CCWB 4UNKA 3PZOA 1HGYA 3LM3A 4LYQA 4O13A 5C55A 4DBDA 3DHUA 4J9JA 3MSRA 4UOQA 3L67A 4BFAA 6REQB 3G8RA 1LG1A 1TWDA 4GNKB 4CNPA 3KHDA 3ZS4A 3H22A 2FPVA 3LMYA 3VNKA 2INFA 2Y5SA 4DYKA 3BLEA 3L68A 2XFWA 4IMAA 4WVXA 5ABHA 3V5FA 2XU2A 4CQ9A 1OCJA 4EX4A 4N4QA 3WMLA 1LORA 3EB4A 1BTMA 4ZSTA 1SFJA 3W2JA 4E2VA 2QR6A 2KX9A 3FHQA 3BJTA 3OGRA 2JEPA 1K4HA 1WP6A 2ASHA 1YNPA 3LHUA 3OZOA 3EYPA 1K8CA 2NT1A 5HA7A 3PSVA 2CNCA 2XTKA 3STFA 5MKGB 2VL4A 3CM4A 1A47A 2RJHA 1JDCA 3AWOA 2HVNA 3PZIA 3GXPA 1XV8A 2OU4A 1HO1A 4GFIA 3S5SA 1GPWA 1VF8A 3USZA 4JNYA 2W79A 2WJFA 2FB2A 3LBMA 4JQ4A 2NX9A 2C1GA 2PBGA 3CJPA 2B7OA 4XK2A 3ARYA 4AWUA 3KS5A 4M51A 4EWND 1M6JA 1UJQA 1FP8A 2OT1A 3P62A 3VFCA 1K3UA 3UCQA 1RVGA 5EB8A 1I0BA 2JKPA 2ZKMX 4N0RA 3A3HA 1HW6A 4UTTC 1S5TA 4DF1A 2D0FA 1NDYA 4IP4A 1KCXA 2FJKA 4ZZ9A 4HPGA 1BVWA 3RU8X 4A6GA 3GHRA 4Q7NA 1T6MA 3BURA 1R87A 2EJAA 4B4FA 3CNYA 3GW3A 4CN4A 5HMFA 1Q5MA 1CGWA 5BNKA 3IJIA 4XZIA 1UQZA 4P7QA 3WNLA 4JFUA 3AC0A 1OGGA 4H6EA 1GZJA 1XISA 1PCWA 4O0KA 4K38A 2NX3A 3STPA 3DCPA 3BJSA 4NT0A 2Y63A 1POJA 2OTDA 1QNQA 1KFWA 2QUNA 5G2HA 2DY3A 3AISA 3KOYA 1NFPA 2WQPA 3EB2A 4O8AA 3UXAA 1QI2A 2A5HA 2BX7A 2PDMA 4HNNA 1BF6A 3L4UA 3M4HA 4RDZA 2J75A 3QFEA 5DCBA 1RK5A 1W9DM 2VT0A 5K9CA 2R6OA 3M7SA 4LSBA 7PTDA 4XKMA 5I00A 3H8AA 5H8UA 3FN9A 2YZ5A 3FGCA 4MB5A 3MHFA 2Y5JA 3F5LA 3TWBA 1RJQA 2FTWA 3E0WA 4V15A 5AZ0A 3UZYA 1YE4A 2JEQA 3ARQA 1E4MM 1EIXA 1CXKA 3GIQA 1F6YA 3VIIA 1ZBCA 2E3ZA 2YPIA 3M0XA 3PULA 3JRKA 1O68A 2GLKA 2Z2BA 2G4JA 1YEYA 4S3EA 3NEVA 4Z2HA 2HE5A 4I90A 4HT3A 3M5VA 3U4AA 1J79A 2XH2A 1NQ6A 4RNIA 4L4LA 4TTGA 2GPTA 5AHLA 3CZ8A 4DIAA 5C2GA 3FW6A 4XZBA 1F3EA 1JF6A 4AQLA 1XQLA 4WDTA 1C7SA 1IEQA 2ZZ1A 3UJFA 4JHOA 2V5CA 1WYIA 3VZXA 5TF0A 3AZTA 3D47A 3K4WA 1VIWA 3EEGA 3KRUA 1NELA 3G0UA 3VMNA 2Z1WA 4YIWA 3B9EA 4Q6JA 2GSJA 1VCVA 2Z1XA 2XVNA 4LUTA 2ALDA 3GR4A 3GDBA 3LTSA 3V16A 4DXXA 2YCLA 3P7YA 2A1YA 4PODA 1QW9A 2V69A 4LV4A 3R8GA 3URBA 4IIEA 4YTUA 2X05A 4W85A 3VNYA 3NM3A 1TVPA 2FZNA 1E73M 1D2KA 3Q67A 2J77A 1D3CA 4I5XA 1UB3A 3RCMA 4GH1A 4ZR8A 1JD9A 3KW3A 3T2QA 5IRPA 1W3TA 2JBMA 3HN3A 4AYSA 3W22A 1AQ0A 4HNTA 1HFBA 4TMCA 3VD7A 2ZX9A 2QUVA 1AG1O 1RD5A 4WJEA 3TYCA 1TFVA 4UTUA 2WVTA 4UTWC 3W1UA 4J3TA 4S2CA 3BMWA 1ZB5A 4N6FA 3AIRA 4GHRA 3OTRA 3TTQA 4B3ZA 4KFPA 1E40A 1VJZA 3CK5A 3AS0A 5BU9A 1TE1A 3VIMA 4XWUA 4EACA 4JYEA 3QXBA 3W02A 3NVDA 3L4XA 4FLQA 4MJ4A 4HHHA 5BRBA 1BSLA 3ALGA 3NZQA 1XGEA 1GOKA 2D2GA 3QM3A 2YCJA 1DJWA 3EOOA 4US6A 3NM1A 4JTEA 4D2JA 4UFMA 4GBUA 4Y90A 3HU7A 3ZO9A 3AUJA 3PN8A 4MJMA 1V79A 4JTTA 1P6WA 3QOKA 3E49A 4XKYA 4QEHA 2R24A 1REQA 1F8IA 3ATZA 2WXDM 3BAWA 1JAKA 1HJVA 4Z2KA 3QV8A 3GC4A 2NXGA 3MC5A 2WPGA 4R5EA 1QNRA 5CC3A 4AU0A 4D8ZA 1XC6A 4CNOA 3QC3A 3R79A 1Y5VA 5M17A 1PIFA 3F2BA 3LZ5A 1DTUA 2D1ZA 5EPDA 1ITCA 2HRWA 1J9YA 2C1HA 3PVFA 4MYAA 1V77A 4IH3A 5DCEA 4W7VA 2WNQA 4PCSA 3VVGA 3OHIA 3AICA 5REQB 3M5YA 4O1CA 3G1AA 2QDEA 4UQEA 1K7EA 1JFHA 4ES4A 4JQ1A 2PGWA 5BOFA 4U3AA 3TFCA 3DHPA 3NQMA 3R8HA 3OPSA 1RPKA 4EPKA 3W7PA 2HDJA 4Z1AA 1ZP4A 4JTFA 4QSFA 2QJJA 5LNRA 4QFUA 1FWAC 3W24A 2Z29A 3O07A 1R46A 3NXFA 1C7TA 3VU2A 1GVOA 3I6TA 5CQ1A 3DFPA 3PG8A 1U22A 5HOSA 2BODX 4NX0A 3TXVA 2WOQA 2NUYA 1M7PA 3DC0A 8XIMA 1X6UA 4G7EA 2CZFA 4MGGA 4UTLA 4QITA 5AHEA 4UTKA 2VQUA 3C61A 3CQ0A 4Q3MA 3P93A 1US0A 4O17A 2XSXA 2ZE3A 5HXMA 8RUCA 4J7RA 3P81A 1NOUA 3DKJA 2YBTA 4JIHA 1H7NA 4AX7A 3IAPA 3U9IA 1YXYA 3E38A 4HPXA 3INPA 3B8WA 4WUIA 5LNSA 3VE9A 4DVOA 3RK8A 1GW1A 2ZA1A 4ROPA 1SJCA 5AYYA 2W63A 1WDWA 3IJ8A 3OZPA 2QCEA 3LLFA 3GVGA 1UH3A 1W1B1 1H7OA 1UUOA 4MVAA 1W1A1 3L4ZA 4YVPA 4GYKA 1YW1A 5I09A 4FF5A 1GG1A 4JKKA 1R86A 4CQCA 1MNSA 1FWGC 3NO3A 1R7OA 2CHRA 3DGBA 4CLMA 1CXIA 1NF7A 2DSUA 4YHEA 3ZR5A 4GQRA 2G95A 4REQA 1RY8A 3TTSA 3WLKX 4CUCA 3JZUA 1ME9A 1UD8A 3P61A 5TD4A 3QYSA 1ZPTA 3P67A 3I6EA 4EAYA 3VGGA 2CPUA 2YFNA 2E0PA 4JQ3A 3BG5A 3RUBL 4HU3A 1FWSA 2A85A 3QGKC 2FGBA 5FJPA 4DJFD 2XVPA 4NXKA 3W53A 1FRBA 4LYRA 5MHBA 1X8CA 2VX4A 3CL6A 4HK5A 3S47A 4UFKA 4C6FA 2G3JA 3GNDA 1KWKA 4AY7A 1J8VA 1AFSA 4PMNA 1VH7A 1Z44A 4ZODA 3L4YA 2X7WA 3LBCA 2I56A 3OA3A 4GUJA 5C9WA 2OYKA 3G18A 4FR1A 1EGZA 5FA5A 3ARSA 3FCPA 4HD5A 4FAMA 1XLGA 4FXSA 4GNVA 2RDWA 3EPOA 3SN1A 3WLIA 3CEUA 4LUIA 3DZ1A 1FWFC 1LQ0A 5LA1A 3V4BA 2PDLA 2E77A 1BLIA 4WY0F 4DO5A 2A7PA 4I5UA 3GU1A 4YL2A 1OCNA 5IM51 5IHSA 5FEWA 3W6MA 1E3ZA 1R5YA 5CC5A 1EP3A 4E2DA 2OO0A 4R27A 1LOSA 1XD1A 4AVFA 5FF7A 3N17A 1MVYA 3TZFA 2PUZA 1I75A 3L4TA 4P8VA 1FHDA 3NSMA 3BO9A 4PTMA 2PDWA 1UPMB 1NSJA 4PA8A 5CC6A 3S83A 3ZZ1A 3NPWA 1FWNA 3QHMA 5LHEA 5BXRA 3PB0A 4MZ1A 1LWHA 3TV8A 3QEZA 3LU2A 5HQMA 2PTXA 1WUFA 2A7NA 1F3WA 4Y9AA 4J2MA 3GY1A 1KXQA 1JGMA 1BXCA 3VOGA 1XYMA 1LCOA 2BVYA 1YPFA 2DW6A 1G01A 3SCVA 2Z6IA 2XFFA 2G4FA 2HXUA 3EBVA 5JBFA 2W66A 1B0IA 2QMJA 4F0RA 3W87A 2NXIA 1TPDA 3LI0A 1YX1A 4A29A 3HGSA 3WBXA 1RHCA 4CN1A 3I7SA 2ZFAA 1YQ2A 3FVMA 4MB1A 3V1PA 4JHZA 2PODA 1XF0A 1FWIC 1MQPA 3P8IA 2W0UA 5E6ZA 1PO9A 3DX5A 3VNZA 1JCNA 2WCGA 2YCKX 4AXNA 4A8LA 4E4FA 3CB3A 1DV7A 5DXYA 5C0QA 1QK0A 1HQTA 3OOQA 5G4EA 5A8OA 1JDAA 3EKLA 1VCFA 4NJKA 1ZBWA 4ZMGA 3CHEA 1PKLA 2VX5A 2E28A 3RG6A 1JYWA 4MNLA 4N7QA 7CGTA 1QI5A 4JTIA 4CNTA 3UYIA 3LMZA 1VHNA 4ZA0A 2WSKA 1VEMA 4IZGA 4M1RA 4IFOA 2TSYA 3NQGA 2NV1A 3VX1A 3TSMA 4FZIA 3OLEA 2LLEA 1D8WA 4PUEA 3E2QA 1H0GA 2J78A 2FZMA 3FA5A 4KCWA 1RA0A 4FX7A 3GG0A 1EA0A 4UQCA 3LCGA 3AHVA 3CMGA 3PUGA 2OKTA 4S3CA 1QK2A 2VQTA 1V4YA 1JZ6A 1MI3A 2V6AA 2PCQA 1H62A 4GIEA 3PUEA 3QMRA 4HOZA 2GQ9A 3XISA 5AC6A 4M6UA 1M5WA 5IDIA 3TEVA 4M3PA 4PSPA 1PKYA 1DWHM 1A50A 5BMXA 1B30A 3RJYA 1BAGA 4ORIA 5FACA 2A3AA 4NNBA 4UQBA 4P7RA 3HOJA 1IGWA 4QJ1A 2PLKA 1RQHA 4I9JA 4UOZA 4MWAD 3DKLA 3SCWA 1WQ5A 2OMAA 1QNSA 1XW8A 5HJXA 1J6OA 1TZZA 7TIMA 3W28A 4KPLA 3KBMA 4PUMA 1PX8A 3TN5A 4IJRA 5A6JA 2VEFA 2GJNA 4M80A 1H50A 3TW7A 4O53A 2HTMA 4BI5A 3VKKA 3K13A 3MVTA 5AECA 1VBUA 1OFBA 1PSCA 3THAA 1ODZA 3PM6A 2YYUA 1FTXA 5LYRA 5D32A 4MPKA 2Q71A 3LM7A 1Q4NX 1S2WA 2ZUWA 3GBEA 4YTRA 1V6XA 1V08A 1OIMA 2ZX5A 3Q2DA 3W83A 2CLIA 3S1XA 1FWTA 1JYNA 1BFNA 3WD0A 3UWQA 2Y8KA 1U5HA 2NUWA 1J18A 3JU2A 4L6OA 3CV2A 1QBAA 2ISSA 5DFAA 3PBVA 4A3HA 2D23A 2V5LA 2A3BA 3EMCA 4ZE5A 3ZJ6A 2WNWA 3Q94A 1ITQA 4B5XA 1EWDA 4GOAA 1JZ8A 3SUUA 1XX1A 2VMFA 1V7YA 4X2RA 2OQHA 4DZ5A 1BKHA 5C9XA 2VO5A 3MV01 3ZVIA 3D5HA 2EPNA 3UYCA 3DEQA 2PGRA 3QPYA 1ML1A 3MKVA 3KBVA 1KD0A 1C90A 3L5MA 4IXHA 3PBYA 4LAUA 3S9IA 5G2IA 2EKGA 3VOCA 4W5ZA 3G1RA 4JTJA 1LBLA 4X63A 4Y9NA 3B8UA 3V7PA 4HYWA 3O6YX 3FJ4A 1FWRA 4IQEA 3S5ZA 3KTXA 3WH7A 4ML4A 1GTHA 2WZTA 3FJLA 3AIEA 2GJRA 4Z1BA 1FHVA 2F38A 2X16A 3TXZA 1EB3A 3P82A 1DJNA 1PIIA 4BY3A 1JPHA 4PRTA 4GGBA 4TV6A 1Q3NA 3WBEA 3SRFA 3MW7A 4EWJA 3FEQA 3R8RA 1TQXA 5XINA 3DG7A 2A3CA 2H8ZA 4MYXA 1J0ZA 2P0IA 1SR9A 1A5AA 1QPNA 1DJYA 2E5CA 3AXXA 4HJWA 3PB2A 1FH9A 3VKJA 1E6ZA 3QOMA 3W1AA 4X22A 3WMSA 4EF9A 3ZT7A 4XD6A 3EDEA 3FNDA 3ITTA 2CW6A 3FGCB 4U10A 5LA2A 3VIHA 5CPMA 4R34A 1W3JA 3TC3A 4W8BA 1OFAA 3FLUA 1MYRA 1YNYA 1GQNA 5DMMA 1S3HA 2O0TA 1UA3A 4IQLA 4H6KA 1KCLA 1FX6A 3UXIA 1ISYA 4CEUC 2D20A 3LPOA 2VEGA 2ZX7A 3LI1A 1Q2RA 1RXOB 4WX2A 3RLGA 2BTMA 4HIBA 1K8XA 3QF0A 3NVTA 1JF5A 2C1IA 2OWXA 1R85A 1HUVA 1OY0A 2VOTA 1O5RA 4XD5A 2GDQA 3GXFA 3AIWA 3AXIA 4M1BA 3LHZA 5C6MA 3UQNA 5HMEA 3E1F1 4DM1A 3CWHA 2VRQA 2BHUA 1DJIA 4F2UA 1A5SA 2OLHA 2QDGA 2CZVA 4DWDA 3B9DA 2PDCA 3TQVA 5CBIA 3G1YA 1EJSC 4B2DA 1BHGA 3WJXA 3TE9A 2CBJA 2XIOA 2W3ZA 4FI4A 4L64A 2XSAA 3V18A 3IANA 4LUTB 3RFAA 4DELA 4NJIA 2YCLB 2XG9A 1QAPA 1W5PA 4AB4A 2CBIA 2OB3A 3VAVA 3T2OA 3QKZA 4MDPA 3WEZA 1AH3A 3BLIA 3DFYA 4HU8A 1PX3A 3AXMA 3EX3A 5DRIA 4OGZA 3DECA 3QBUA 2YL6A 4EXBA 3JVAA 2BHZA 3FAWA 2J62A 2F8QA 1ZJIA 4F0LA 4GINA 2E9LA 3E0VA 2PZ0A 2QJHA 2DEPA 4H8HA 5IXEA 5FJJA 5EFDA 5CGQA 1KRBC 1XSKA 3WELA 1B31A 4CCDA 4FOUA 4XZWA 1ZRQA 1LF1A 2WMGA 4AZ5A 2GOUA 4NHVA 5CJMA 3BUVA 4JIQA 1VHCA 4FALA 3D3AA 2DZTA 2VHLA 2P8CA 4AWSA 2OZ3A 4I7WA 4XSLA 1MXSA 3TR9A 5T91A 1AVAA 3GNXA 8A3HA 1R0MA 4GJ1A 4IJBA 4Q8VA 1BYBA 5F4SA 1EOMA 2WKGA 3VDHA 1JGIA 3VPLA 4Q8WA 4TX9A 2PRLA 3GC5A 1OD0A 3PBUA 4CQAA 3MJMA 3W9ZA 3EPMA 3QGVA 3OGSA 3MTWA 1E1EA 3W7LA 3T09A 4TXEA 3L4WA 2CLFA 3DU0A 4DJFC 4E8DA 4XKYB 3OLGA 1DKWA 4P8WA 2HJPA 1PZ1A 2OZ0A 5E6YA 2PWGA 4DWSC 1REQB 2WV8A 3GG8A 2C13A 3PS7A 3CIWA 3UZZA 1SSGA 1K9DA 4W8LA 3AS1A 1GJPA 1K8YA 4Q8OA 3AHTA 4IQJA 2TAAA 2OX4A 2Y4SA 3RRAA 1NDWA 1JXKA 3UETA 4A4AA 3HQPA 1DVJA 4KW2A 3N2TA 5IBXA 5TQLA 2XFRA 1MXDA 3W85A 3THDA 2V8ZA 4NZCA 1A3HA 3UG4A 3W81A 4DUXA 1DJXA 1LLZA 3QV7A 3KXQA 4TVCA 3U3HA 3LLDA 4PFMA 2TPSA 4ZL1A 4LTSA 5I77A 4O57A 2HPIA 3W2LA 3RJXA 3SI9A 4Q8PA 1R3WA 3NZ1A 1OFQA 2A6NA 3GW0A 4ZB2A 2VEKA 1M3UA 3B3DA 1ADDA 3B03A 4GY7A 1FWHC 4KCTA 3C4UA 4DJFA 2WMKA 4AZCA 4LXFA 4W5UA 1TIWA 3HV8A 4HSOA 2X0YA 1V6YA 3W01A 3MS8A 3NO5A 1VJIA 3EDKA 5JU6A 2PD9A 5BRQA 5D03A 1TJ1A 1XLCA 4HCHA 3DYPA 3ZSTA 1V8EA 4R88A 6ALDA 3IUHA 4NYYA 4G7EB 4Y6GA 2IW0A 4FHAA 4QG9A 9CGTA 1UP3A 3OZMA 3BANA 1YPXA 3CS2A 4F2BA 2XHYA 3WF4A 3G1HA 4E8GA 2EPLX 3SEPA 3VZZA 1XLMA 4AFYA 1W1VA 4QQUA 1MNZA 2PP3A 1ZJAA 1TCDA 2J8TA 1LOLA 5G1TA 4J3VA 2VI0A 3OODA 3BK0A 4GUHA 2BMBA 1S5WA 1XS2A 1C91A 4F9JA 2E5BA 1WUEA 1VFOA 1HJXA 2J6XA 3BZGA 4GWEA 4PBEA 3VD9A 3W7MA 1A3WA 3WNMA 1LTDA 1UD3A 1ZY9A 4BCEA 2OFJA 3MKKA 4XBSA 3WYZA 3NDZA 3EAUA 1UQYA 2BOGX 4FOJA 5K7JA 3T4WA 1FUYA 1TTJA 4DAIA 4DJDC 3BAIA 1AJZA 1CGYA 3LHWA 4HMDA 1DWGM 1C3FA 4REQB 1W9XA 2PDKA 3CEPA 2YSWA 1VLWA 4K36A 4TX8A 1ISXA 1EGMA 2BVWA 1C8VA 1E4IA 2QJIA 5I6SA 3WEOA 1Q6LA 4YHGA 1QW7A 4HMNA 2PDUA 3A5FA 1DIEA 1H0IA 1ICSA 1LOQA 2NQ9A 1TWZA 4GX8A 1MW3A 1I1XA 2ZTJA 2QPXA 3N2OA 4R33A 1EJ7L 1UWAA 4JZ5A 1M7JA 1JZ7A 5GNXA 5EFFA 2HEJA 1M7XA 1ZUAX 5ECUA 3M9YA 4B9YA 1VYPX 2OZTA 3MHUA 4LB4A 4LH8A 4D6GA 5EYWA 1EPXA 3IIVA 5AB3A 1G67A 2VEMA 4QTGA 3WIJA 5A8GA 4W4QA 4JS3A 3PJWA 4R9XA 1QHPA 2PB1A 1XIJA 3UWUA 2ZX6A 3VNIA 3TAOA 3N18A 1UYQA 1PVNA 4ORMA 2J7HA 3J7HA 3O0FA 4NASA 3LK6A 4U33A 1EOKA 1EF3A 3TU9A 3XIMA 4MDOA 1LL6A 4HNLA 3FFSA 2B4GA 2ZICA 3NQEA 1XR2A 4G2DA 4GG9A 3DG6A 4EAMA 4IXXA 1HP5A 3WJZA 4F0HA 1M68A 2J7GA 3W88A 3A47A 4N9DA 1GEQA 2DZVA 4Z0JA 2VGBA 5FJUA 2W92A 2X0HA 3CBWA 3TN6A 1AL8A 4OKDA 3MB9A 1XKYA 3GR8A 3H55A 1ZQ5A 1X39A 4UNIA 4AHPA 4C6JA 1U5VA 4OV9A 1JUKA 3EA2A 3C2RA 3EWXA 4EXAA 3IPWA 4PMZA 1KXHA 1F76A 3SJNA 3EX4A 1KKOA 4A3YA 3WF0A 2F6KA 4F4RA 5BRPA 1KGXA 3BAYA 2QV4A 2VFIA 4ZQCA 1HIZA 1XKJA 4WEVX 4O52A 3T55A 4MWAA 1IWPA 3THQA 2ZTKA 3BV7A 4PEKA 9RUBA 3C8NA 3CUIA 4TVUA 3U48A 4X0VA 3VKCA 4C6BA 2CESA 3W25A 4D6FA 1IXPA 1UG6A 4CQ8A 3A9BA 5KZMA 1QI4A 2W27A 4FNPA 2Q3OA 1SGJA 1UMYA 4OIFA 4WQ6A 4G5DA 4PGLA 1QDSA 1KXVA 1XRVA 3BMXA 3CIVA 1XL9A 5C2XA 3WNPA 2VWTA 3W1PA 2RKXA 5LIKX 4O10A 3LV5A 5A6BD 3NG3A 1CEOA 4OBTA 4C6PA 3KWSA 1OBAA 3ZSSA 4Q4PA 3S2NA 4FO4A 1F05A 3FSTA 5SWUA 5G1YA 3F4CA 4A21A 4KRZA 4JTGA 3WENA 1ZCCA 4MPQA 2DPEA 3WF1A 1R2RA 2WWDA 4POCA 2YB1A 5G1MA 1GZGA 1OSEA 3UPBA 1HVXA 2NXHA 1G4EA 3GVQA 5E5CA 1XGZA 4QS6A 4NQ1A 1JR1A 2ZADA 3NZRA 1AQHA 3CV7A 4YJ5A 1BQCA 1K7FA 3KCLA 1LWJA 1XJBA 2PURA 1UR1A 5KITA 4CD4A 2B7NA 4UB9A 4AD0A 4CNNA 3GFZA 6XIMA 2QDDA 4L4MA 2G3IA 4QAWA 1TE6A 1DXEA 1UD6A 1F73A 3IVTA 4RXFA 3RO6A 3TK7A 4DLMA 1Y5XA 1EUAA 2F2HA 4I9TA 2VGFA 3QKEA 2E40A 3P5ZA 2ACSA 5CSUA 4P5UA 1BXBA 2O4MA 5IHRA 4R7OA 2QGHA 2QJMA 3IGUA 3DBPA 4S1FA 3W00A 1MXGA 5EMLA 1PWLA 1TTIA 1KQZA 3QPEA 4BWLA 1R6WA 4IMGA 3AZSA 1LJYA 3WNKA 1EJTC 3PWGA 4ZQPA 3MO4A 1WAUA 2G5WA 2C8NA 1NDZA 2WSQA 4FLOA 3NQDA 3VGFA 4KRTA 1JYXA 1JI2A 1U1UA 1W8GA 1L2UA 4XBJA 4ENLA 3GC2A 2BOFX 2PF8A 2V38A 2NQZA 3B8DA 1O7AA 4ZB0A 4C6OA 3IS4A 5EMJA 2X1UA 1GKPA 4QLKA 3O8AA 1R38A 4BR1A 1JCTA 1MDLA 3A9IA 8CGTA 4YLWA 4DJEC 2PDBA 4ZE4A 4JDYA 1L8PA 3AJXA 3RX3A 1P7TA 2NSOA 3ZR4A 2DZBA 1AL7A 1YPIA 4B4HA 3ISIX 4H7CA 1ITXA 1ECQA 5J5DA 5KZEA 1TYGA 4WSHA 3FYPA 4H9VA 4AD1A 3BAJA 4CCCA 3O6AA 2QHAA 3IGSA 4P8XA 4XQ6A 3UP8A 1VEPA 3NIYA 1XFCA 2V81A 4QE5A 2OT0A 3S6OA 4MHBA 3BGGA 2REQA 4M19A 2EPKX 1FHLA 3P3BA 4NAEA 1QFEA 3FHAA 3NZGA 4UFLA 1E5NA 1F7BA 1RJPA 4J28A 4WKFA 2WMJA 3HMCA 4WXYA 3HBLA 3ORWA 2WCSA 1EIBA 3VABA 4LCQA 1WV2A 3N1AA 2AL2A 2RUSA 2PD5A 4EIVA 2MNRA 1FA2A 5JMUA 1HL9A 3SRHA 1OADA 2XSBA 4DB7A 1Q6OA 3WLTA 4QROA 3PNUA 4P8UA 1R9ZA 3WQVA 3GIYA 3N3TA 3GDKA 3GXTA 1Q7MA 2IPJA 1HXJA 2I9EA 4LRSA 2VD8A 4YXGA 1IZJA 4DJEA 3QHOA 4PUDA 3TA6A 4YYFA 4AVNA 3ZOAA 5LNVA 3HTWA 1ADOA 1JPMA 2YBVA 1B2YA 3CHDA 4A3UA 3RMJA 5JBEA 4GYPA 3UGVA 3ELFA 4ADTA 3LOTA 1TX2A 2UBPC 1Q45A 3LGEA 2A79A 5M2FX 1KM2A 1E9ZB 1Q85A 3OU8A 1P0EA 3NDYA 3NQBA 2EBNA 2RFGA 3BLPX 3SY1A 3IJ6A 1VBJA 1F61A 1WKDA 3L65A 3TUUA 1GWJA 4JTAA 4QG8A 1QWKA 1TO3A 3EDDA 2ZUMA 5EMYA 3C52A 5FEXA 4IM4A 3LXCA 4TR9A 3W29A 1EXBA 4JNZA 4CU8A 3ITVA 4M7SA 3RPDA 3W1NA 4KEZA 4PMYA 2GUBA 3WK1A 4K68A 3VDGA 1OB0A 5G5IA 5HNTA 3C0QA 4FXJA 3BAKA 4RKAA 3TAKA 4B5UA 3NURA 4GXMA 4RCXA 2E25A 4MB3A 3PG9A 2BGQA 1VRDA 3TVAA 4Z1CA 3W7RA 4N02A 4IIGA 4DUOA 4Q8NA 2GYIA 3EX1A 4I8DA 2QVNA 2BBFA 4FIRA 3WKZA 3PPGA 4F8XA 4EVZA 2ZRUA 1KV5A 2EXOA 1PYMA 1UUQA 3ABXA 4F48A 4OFCA 2JALA 3TW9A 4C6NA 1IWBA 5DCDA 3VIPA 1E9YB 1GQLA 2ZXAA 4C6DA 4XZLX 3E96A 3PPFA 3MCNA 5CSRA 2WHJA 3W7NA 1U1HA 3C86A 3AJ7A 1EGVA 3HG3A 3G6MA 5K4ZA 5EMUA 1A5UA 5J5RA 2X1SA 1E6XM 3DOPA 1AJ0A 5C7VA 2JKAA 4FIQA 3LENA 2YX0A 1J6PA 3S46A 2BZNA 3WLJA 3DFOA 4FR6A 3W1MA 4LX4A 1ZZMA 1C9DA 2GGHA 1N8FA 3CHCA 3WLHA 1V5XA 2DZSA 5D2TA 2WQDA 1LLOA 4KCVA 5HR6A 4GVIA 3GWQA 3GH5A 1VFTA 5HPCA 2NVAA 1D3GA 2BNJA 5I78A 2NQLA 1QHZA 5HBFA 1GVEA 2B81A 1GOXA 3BQ5A 4ATWA 4TOQA 2QULA 4RPPA 1KM0A 3CASA 3I3BA 1V93A 4P7LA 1NM9A 1KTCA 1GOOA 4L80A 3WDIA 5AC8A 5CSYA 3OIXA 1YE6A 2PA6A 3ES7A 3WJSA 3VCNA 3P84A 1EBGA 4IPLA 1LRNA 2I17A 3CZEA 1E0XA 1FBAA 1XLHA 1RBLA 3BCFA 4RXGA 2ACQA 3P60A 3RMEA 3PUDA 1ONRA 4HPJA 3IIPA 4JTKA 3REQA 4AVOA 4BQ5A 2J7CA 4PTNA 1E55A 2P0OA 1LP6A 1CGTA 2XGBA 4GI9A 3IUIA 1OX6A 2Y88A 1L6FA 3U6WA 3NYZA 3VKDA 3QVQA 2BP1A 1CENA 4L61A 3SDOA 3PNZA 2CZEA 3WLOA 3AMDA 1JCLA 1MUWA 3A4JA 5HMSA 3IVUA 2DT0A 3TP4A 3BPWA 3IJ7A 4U2YA 3AI0A 1IF2A 2Q8ZA 4TX6A 4JTLA 4DYJA 5FSDC 3HG5A 5AFDA 4TU1A 3FKKA 1IE7C 2XWEA 1B5TA 1JULA 2CBVA 1GK8A 4UMCA 4AUBA 4HNUA 4EF8A 1UPPA 3W37A 1CDGA 2AMGA 4CU7A 5CGTA 3VCRA 1ODUA 2X2GA 2HXTA 3IK4A 4A8RA 4N2YA 5CSSA 3DUGA 3VFLA 2ISDA 3VOJA 5A1AA 4AZCB 2CIPA 2NV2A 1F07A 3WFLA 1ZL1A 1XBZA 2R82A 5GJNA 3SSJA 3IV3A 2FTYA 4JTSA 3HPXA 4GBDA 2YKKA 1ITUA 4J3ZA 4UCFA 3BG9A 3RM9A 4GNJA 3M1ZA 5LXXA 5AHMA 4NP7A 4E3VA 4ZQRA 3W76A 1TSIA 1DXIA 4DUVA 1OQFA 2P50A 2J9YA 1QPKA 5KMYA 3D0CA 2CKSA 3UZWA 1T7LA 3WL0A 4W88A 1SFSA 4DBUA 4OV4A 5T8GA 4C90A 1KM5A 1PTAA 1XM3A 4CCEA 3RPTA 3QMTA 1JDDA 1VB9A 4J5NA 4Q22A 3QC0A 2AAAA 1E1CB 6TIMA 5IFTA 1K7XA 2J74A 1V3LA 3GD6A 1XFBA 2GJXA 1YDNA 3CAVA 3O2LA 3TYUA 1K03A 1I2RA 4XO6A 5JUVA 3VD4A 1U5JA 4H00A 3WLNA 2POTA 4RE2A 4NILA 5F7UA 1KFCA 3VCCA 3EA1A 4RDWA 5DBTA 3UG5A 1MZRA 4IHCA 4C6IA 2JF6A 4HHLA 3KOXA 4B91A 4LEQA 1A4LA 1PZ0A 4GK8A 4PTWA 2CWNA 3RF9A 3VE7A 4NKCA 1ALDA 2DZXA 4MLJA 4RZ5A 5GQBA 4ML9A 4G1KA 2V5KA 5D05A 3WJYA 1XIEA 3TOYA 3TKFA 3RIKA 3LS9A 3BTNA 2ON3A 3WH8A 1FHUA 2I5GA 2X0SA 5D2VA 1B57A 1YXCA 4H83A 1F9CA 5E1QA 4HYVA 1I9CB 1Q6EA 4UR9A 3UVIA 1UMLA 3P74A 3UZ5A 1G5AA 1Y5WA 2VVSA 4QNEA 2BFGA 3B8TA 4JYDA 3K1DA 1TWWA 3Q4DA 4UOJA 3T78A 1EQPA 4DX3A 4FLSA 5A8QA 1ZTVA 2BXZA 1F74A 1JPIA 2ZRXA 1DQUA 1J01A 4GI6A 5A6BA 3AO0A 1V3HA 2G50A 5DF0A 2GZXA 2ZCGA 2MUCA 2ESCA 2Y89A 3W7DA 1EJUC 4F0SA 1UASA 3EOSA 1HGWA 3PWIA 1QWGA 2V63A 1Q8JA 3PC0A 2AQVA 4GE8A 5BWFA 3F2CA 1I0DA 3MUZ1 2VC6A 4YWIA 3OB8A 3W4RA 4E38A 2DU2A 2C7FA 5M1TA 4KIRA 1UZHA 4XZMX 3GK0A 2GWNA 2OQLA 3W75A 5CZSA 4QE4A 3CLWA 4IX0A 1O5QA 4KGJA 4WXZA 3T9PA 4ZOCA 1YIXA 2DIJA 5GJPA 3U7VA 5I24A 2WJZA 2VCCA 2CXEA 1RJRA 4QJ3B 1QOQA 4RK8A 1E3XA 3G6LA 1OEPA 2FJUB 4OVXA 3H54A 3GXDA 5EKYA 3VNDA 1QVBA 1KCKA 3EWYA 2YDRA 2OWCA 2VGIA 1RD6A 9XIMA 1HO4A 3HG4A 3M0MA 1GVSA 3TYAA 2QQ6A 1NP0A 3MUCA 2C0HA 2X30A 2WJEA 1V0MA 3NPVA 4X9YA 2KAUC 3WUGA 2GL5A 1KB3A 3RM8A 3O7UA 4MWAB 1FXQA 1Z3NA 1H3GA 2NQ5A 2OXNA 4IIDA 2H6RA 2OG9A 1DORA 4KKXA 4NIRA 5CEWA 1QO2A 4BF9A 3EWWA 5LGZA 4RPQA 5DMLA 4WF7A 1QMLA 2D69A 3KVMA 2PGFA 4LEFA 2GGGA 2Z2UA 3BCJA 3JZEA 4M0XA 3MUXA 4J1OA 4RDYA 4RDVA 5DY3A 1PIGA 1UBPC 4H7ZA 3UXLA 2BDQA 2C71A 4IPJA 4PZVA 3LTPA 3KBWA 2OGYA 1CXLA 4V33A 2QCNA 1KFBA 1N2VA 4LNCA 4K39A 2PMQA 3UCDA 3GH7A 5AY7A 1MSSA 4H9TA 2AMXA 1Z7AA 4XIMA 5EU9A 5I3JA 4AZGA 1KTNA 1LT7A 2OSWA 2F61A 3KCJA 3RCYA 4MKSA 4Z17A 5FIPA 3K46A 1L9WA 1L6SA 2HBXA 5T9CE 4NXSA 2CYGA 4CVWA 3KBSA 4KWSA 4GX9A 3VX0A 3PZQA 1PHQA 4EP8C 4UTJA 3UVAA 2C18A 2XISA 1CECA 1J0IA 1KA9F 3N4AA 1CLVA 2QCMA 1OGSA 5E0CA 1HJQA 2GQ8A 2Z1BA 3C0LA 3CLMA 3ERPA 3EA3A 1EX1A 3VUPA 1JPDX 3B97A 3E74A 1IZCA 3GVWA 3KM8A 4PB5A 2WW5A 4V28A 3AAMA 4RE3A 3WK2A 4N4PA 3T6CA 1WZMA 2YXGA 1Y7VA 1J0YA 1VAHA 3TIMA 4XZNX 4FS9A 5TAOA 3G5EA 2QUTA 3ICJA 4JTRA 2GUYA 3H7UA 4W8AA 4GLEA 2JGQA 4L9ZA 3EOEA 1ECEA 3E5PA 2ACUA 3WH5A 3K5XA 2QCDA 1K9FA 1DPMA 2EO7A 5DELA 3W1RA 3G1FA 5HATA 3L5AA 1UW9A 4LCRA 4U5IA 1KCZA 4I7VA 3TQ0A 1RQBA 3UERA 1PTGA 4L9XA 2IKHA 5LZLA 2WNZA 3SCSA 5HJYA 3EXRA 4LS2A 3QJAA 4RUBA 2NQHA 1S1RA 3SCUA 4QDWA 3A3WA 1XYFA 2C15A 1LM1A 1W6TA 3CYJA 4LYKA 5CBBA 3CUZA 5GPRA 2VZSA 3IUDA 2WC3A 3H23A 4MNMA 1C9WA 1Q6GA 2BY0A 3MY9A 4JKLA 1LDCA 3IRDA 3NOEA 2Z27A 1UKQA 4HZMA 3GYCA 1UHVA 1AMKA 3LLXA 2WSRA 3W7JA 8XIAA 4RW5A 2QVHA 1HKKA 3IEBA 1P7TB 3VIFA 2NLYA 4TV5A 3GXNA 1KGUA 4JN6A 5A8MA 2CITA 2JE8A 3SECA 2XVKA 5DMNA 3VOHA 1RR2A 1TV8A 1KRMA 1KBJA 2J88A 4D6CA 5CH9A 3ECQA 4C5YA 2GQAA 5AZ1A 3U2CA 3KTCA 3ZLGA 4Z2IA 1FXPA 2DUXA 2REQB 2XJ7A 1BXNA 4S3JA 3VOFA 4NAEB 1UWQA 1L6YA 2C91A 1UOZA 4YYCA 1E6SM 4IGNA 3N4EA 1NF0A 3DFTA 3GTIA 3KVJA 3L66A 2WPBA 5HPOA 3TMQA 2AL2B 3OQ8A 4ZGYA 3W73A 4BQ2A 3QR3A 1PEZA 4IIBA 1W8SA 3EX6A 5D9PA 4JOMA 2D22A 1DWAM 2IXVA 3K4DA 3ONCA 4UR8A 1UR2A 5I2UA 4XIAA 1BVZA 3BVJA 1GCYA 3GSMA 4RZ4A 3W6LA 4FXFA 3BL3A 1ONEA 3CPGA 5U7SA 3A5VA 2BB0A 4O11A 4PL1A 3A64A 3H2EA 4FX8A 4MSSA 2ZC8A 2CERA 2GFTA 4INFA 4Z42C 4QJ4B 1X38A 2Z00A 3RXZA 4CU6A 1VFSA 2J7DA 4ZENA 3SFKA 1TCMA 3QR1A 4GRSA 1XG3A 2WC7A 2CLMA 3RU6A 1H63A 1PX4A 4ATDA 2V68A 4JFTA 1RY0A 3OJGA 1OC6A 4OUEA 1YXDA 2G0WA 2X40A 3W82A 3GKFA 4Q8MA 4M6VA 3S2CA 4Q4SA 3H7VA 5D09A 2FFCA 1C8XA 5A2AA 1BYAA 3GVVA 3PBGA 1QI0A 4IPNB 5A3HA 4DBEA 2V3FA 1RV8A 2CC0A 5JBDA 3AZRA 1MFUA 1CI1A 1YTKA 1IGSA 2ZYFA 1UD5A 2P1FA 3W0KA 2P53A 3GNRA 1IT7A 4XG1A 2FH8A 3N25A 3WX7A 1QPOA 2UY3A 2QS8A 4B15A 1CWYA 1PDZA 5H91A 3CV6A 1LL7A 2YL8A 1X8FA 4AZIA 4AEEA 1F6KA 1NWSA 3F1QA 4JEJA 3CUFA 3I4EA 2ALRA 2VDIA 3ZIZA 4GACA 4NF7A 5BOOA 1MDRA 2ZC1A 2AQOA 3TDFA 1LT8A 4QP0A 3T2PA 2DUZA 5GJMA 2GDVA 1KR1A 1IXOA 2JGYA 4AD2A 4E6MA 5A6KA 2EPMX 2FHBA 2UZ9A 3EB3A 1NARA 1UD2A 2RH9A 4ROQA 6CGTA 1LBMA 2E6FA 3P6LA 3K8LA 2OYMA 2OLAA 2VR2A 5FI8A 4WGXA 3DFHA 5DY2A 3U5UA 1JZ2A 2JIEA 1AA1B 3AROA 1AQMA 2DZAA 1KW1A 2IKJA 3I7QA 4TVDA 3HJEA 5A2BA 2VRKA 3WD3A 5F1VA 2VR5A 1PAMA 2H3DA 4AZHA 1X7FA 3C56A 3IJQA 1VIZA 2WKJA 1FWEC 2OGJA 5BXPA 1IZKA 3W7KA 4ZQOA 3KDNA 2PDQA 4QX4A 2W5FA 5HQLA 1CGUA 1GOMA 1OFEA 1JCXA 1RBOB 3VUSA 1B3WA 1T40A 2VDHA 2SFPA 4LAMA 1E43A 3ANYA 4PUNA 4ZTYA 2ZRVA 2V5JA 1D9EA 4O15A 1Z48A 3ZVHA 4B90A 3UWEA 4O18A 3CTTA 4ILSA 1H61A 4UTTA 2J8FA 3K30A 4BA0A 4GPNA 3REQB 1I8JA 2PC4A 4HPNA 4ZO9A 1W5OA 3AS2A 4CD5A 1KFLA 3FX4A 2O9PA 4QISA 4DLFA 3S3GA 5JQ9A 1GOIA 1V6UA 1LROA 4ZQMA 1O5KA 1E72M 1UWIA 4B5WA 4HMCA 5D30A 2FQIA 1UH4A 3O6DA 1J11A 3L2MA 4F66A 1RPXA 2PDYA 1F3TA 5HAOA 4OOZA 1EWEA 3AHZA 1KTBA 5AYXA 3ZQ9A 1QHOA 2CFFA 2IQTA 1EX5A 4Y7EA 5LIUX 4FNUA 1Q6DA 2PTYA 2Y8VA 3WDPP 2ZZ2A 4FPSA 3ZXWA 1OIFA 3KRZA 3O16A 4PMDA 3LG3A 3PZ9A 1AMYA 3TYDA 3GO2A 5ABFB 2VD9A 4J3WA 1OF8A 3E2RA 6REQA 3WQOA 2FVLA 2OKOA 4JXCA 1TTQA 2E67A 4U2ZA 3UEQA 4CD6A 2PE4A 1AH4A 3U0HA 4QIUA 4M29A 1B3YA 1JQVA 1J12A 2G3NA 3RDKA 3TJ4A 2PTZA 4W86A 5AKQA 4YPJA 8TIMA 1JYVA 1V3IA 4H8NA 1LRTA 2WHLA 1NAL1 4US5D 1P0KA 1XICA 2AGKA 1PZ2A 1W9PA 4DY1A 3W7HA 1HKMA 3BLKA 2ISWA 4KWOA 1AK5A 1JXJA 2V9DA 4E2OA 5C2CA 3QTPA 5HJLA 3TROA 4C7FA 4Q32A 4C6QA 2JKEA 2QEZA 1XGDA 1HX0A 1J2WA 2DSVA 1EC7A 1XP3A 4GC3A 3F03K 4DBWA 3ZJ8A 4L1WA 1YKWA 3FXGA 4QAIA 1WDPA 5T26A 3UWYA 3QGAC 3P0WA 3W27A 1CYGA 1O6IA 4KEUA 6PTDA 2GJXB 4L1XA 2BXYA 3LUTA 1V6TA 1J4EA 1CLKA 1BD0A 3IARA 1UCWA 3FS2A 4UWMA 4JGDA 1XIDA 1XWYA 1EL3A 1C8YA 4CD8A 2D3NA 1K02A 1UKPA 1RSCA 4RZBA 2EG6A 4KRUA 6TAAA 3R5EA 2RDXA 2F9RA 3EOUA 3F5KA 4GUIA 2GJPA 2R1KA 4E4UA 1KLZA 4MLRA 1FH7A 4AD4A 3ZR6A 3A3XA 2E1DA 2XWDA 1VBHA 3UJSA 1BKSA 3DXIA 4V27A 3LPGA 3WDRA 4O0ZA 2ZRWA 2RGMA 2PWFA 4NVTA 4AIBA 5AHIA 3TC6A 3COTA 1T8XA 3QW3A 1V03A 4UTIA 1DHKA 5HK4A 3WK3A 1TV3A 2DVTA 1VS1A 4LF2A 5H6HA 2J47A 5CKSA 4MNJA 5C5YA 1OCQA 2JIWA 2DSWA 4B2DD 1EXPA 4L6HA 4UTWA 2FMOA 1TV5A 2Y6ZA 1E70M 1TV2A 1N8IA 4ERAA 3UBPC 2IMRA 3L21A 4L9YA 3N6QA 3HIJA 4UQDA 1CXFA 1US2A 4NNAA 1KBIA 4S39A 1SR0A 3HGRA 1XDJA 3KEHA 4IJCA 3H2MA 1E15A 4XTDA 4JYFA 1CBGA 1WCGA 2CLLA 2J4GA 3OGVA 2ZUUA 4NZ4A 2J25A 2ZX8A 4P2VA 3TTOA 4LBSA 3G77A 4HA1A 1CPUA 1HJUA 2X1TA 4IPPA 3UNDA 2ZZ3A 5CZJA 2OLSA 4H2CA 2VEPA 3D46A 2VTFA 2OOFA 2O55A 2XVLA 3OQEA 3CQKA 1B1YA 2DVUA 4MUPA 3WMBA 3GRIA 4ADUA 1ZAJA 2ZZ6A 3RYSA 2Y8UA 4DBSA 3N19B 3K1GA 2WSPA 4HTBA 5TBOA 1F2JA 1OG0A 3QRHA 2ZVIA 1TPC1 3AYSA 3CC1A 1Q13A 3NQAA 5CLWA 1L0PA 3BGAA 4GI4A 4NX5A 1RQEA 3ES8A 2BLEA 3TQPA 1E0WA 2B0MA 1S46A 3WFZA 3VGBA 5IFPA 1G1YA 2ZVRA 2TMDA 3RLVA 3N34A 1XYLA 4NYUA 1R2TA 5E09A 5K4XA 3T0DA 3BJFA 3BARA 4M6PA 3ZLFA 1FWBC 4R7JA 1QR7A 3NR0A 1OVDA 1TIMA 1LQ2A 1U83A 4Q8QA 1KXTA 5B7YA 3AWNA 4O54A 3G2GA 5FEZA 1HVQA 3A22A 3N12A 4HU0A 4AF0A 5CBJA 3P80A 2XIBA 1WE5A 3DENA 4KFOA 4HOXA 3P0XA 4DXVA 3ABRA 3FVDA 1XLEA 5D8ZA 3UF9A 3U4FA 2YCEA 5FF4A 1TELA 5BCAA 1BPLB 3B0PA 3GAYA 2GVGA 3QH2A 3NQCA 3VIOA 4RV3A 4B9ZA 4PMXA 4H04A 4JX6A 3W2KA 4TQTA 3HGOA 4GO9A 1KM3A 3F4DA 5HUPA 4GA8A 1NWTA 3M16A 1SM9A 3LPFA 1J5SA 4AIUA 2ABBA 3GUWA 2A2IA 1UWTA 3L0GA 3GTXA 4HHMA 4MIMA 4FA3A 3VD5A 4LOCA 2WK2A 3TNOA 1OK4A 4K8HA 3C2OA 2ZRYA 3T8QA 1YYAA 3I7RA 4V1YA 4EPBC 3LSBA 4S3GA 1IT8A 1I2PA 2VOMA 3L2LA 2ZBTA 3S9YA 3P14A 4YVVA 2CLKA 2OSXA 4DEFA 2ZXBA 5FCZA 3E02A 4DWSD 1DXFA 4I9AA 1QO5A 3G0XA 3B0UX 3T0TA 1KNWA 5A2CA 3DYMA 3W7CA 4HQVA 3WQ6A 4NJJA 4ZOAA 3LA4A 3H70A 1PKNA 3MYOA 3F4VA 3CQIA 1Q7QA 1H1ZA 4PTDA 3SY5A 3N04A 3RR4A 3LGGA 3VMOA 2W4XA 1B3XA 3M64A 4L4PA 3KS6A 3CO8A 3LY0A 4G9PA 1JIBA 2FH6A 2YA1A 1U30A 3TN4A 5DMYA 4IMCA 1QJWA 1E51A 4GQBA 4S3AA 1IXNA 1W31A 2V2DA 1S2UA 2AQWA 3KTSA 4A05A 1IQ8A 2RDTA 2YDQA 2QCDB 1FCQA 2Y1HA 4GVGA 4A22A 3BE7A 3EKZA 4XD3A 5I03A 1L2QA 3R89A 4PUKA 3M0IA 4ACZA 1CLXA 4LW7A 3R25A 3AIBA 1DWIM 3MP5A 2VRJA 4MAVA 5M3WA 4AY8A 1J10A 3W23A 3UR8A 1UZDA 4WZHA 3TCSA 3OW1A 1ISVA 1EEXA 1E1FA 1X1NA 2DZUA 2Z28A 4AXKA 1TZ9A 3FY1A 3GAKA 4JTCA 2ATMA 3SCTA 3GTFA 2ZA3A 3BH4A 4K7VA 2Q8LA 3P8JA 3HFTA 3KVKA 3SCPA 2NT0A 2VUYA 4HMEA 1KV8A 2PDJA 3IRSA 1T41A 1JCYA 2ODOA 5U4NA 4IMFA 4UMAA 2DW7A 3UT0A 4S3BA 3H2OA 3QV9A 3U2ZA 3TYEA 3S5NA 1XUZA 3BLFA 3SO7A 2WCAA 1XG4A 1OJXA 3B40A 1IWAA 3C2VA 4GKLA 4LBUA 5BYWA 4A2SA 4AIEA 3QZEA 4K7YA 2DORA 2WZEA 1VENA 5CZTA 1M1BA 5L6UA 1IHIA 2PGEA 1S2CA 1HL2A 1HL8A 3ZWSA 2Q3RA 2Z6JA 3CAWA 3CH9A 4RE4A 1M04A 4FXRA 1LWIA 4C6LA 2WYSA 3BOXA 5JIPA 3HM7A 1XXXA 1EDQA 2QAFA 1TVNA 2Q02A 3APTA 1HZYA 4PRWA 1WA3A 1PB0A 1QNVA 2IPFA 1Z41A 5HANA 4WDXA 3WQGA 2DDXA 4YMZA 3PF3A 1L8NA 3WY1A 4DJDD 1UR4A 1UZ1A 1P43A 2CWXA 2CZDA 2DT3A 3GU9A 1E6QM 2Q6ZA 3URQA 4NY2A 2YXXA 1TA3A 3E9AA 2FGLA 3QY8A 2X41A 4W7WA 2IS7A 4I6VA 1FKWA 3ANUA 4O50A 2ATSA 4IMEA 5DXXA 3YPIA 1TPH1 2V5DA 1IXQA 1TB3A 3QV6A 3EDJA 1IR2A 2WKLA 3WLSA 4XVDA 3UR7A 4JN8A 4KS0A 3XINA 5F2MA 4HU4A 4OJYA 3H24A 3TFXA 5FKYA 2VC5A 4KCUA 2EF9A 2Y7GA 3H26A 1LUCA 1N82A 3LRMA 3NCOA 3ITYA 2VELA 4LVDA 2YGYA 4F40A 3BSMA 1SZRA 3THCA 4MY9A 1E6RA 2ZOXA 2EGZA 4DO7A 1QI3A 5JVLA 3GU2A 2ZUSA 3NUKA 3M44A 2BWGA 4AX6A 1TWIA 1XIFA 3CIXA 1O95A 1OCBA 1NWUA 4OBSA 3W7OA 1EYEA 3BZJA 5D4YA 2HZGA 1VQTA 4BEQA 3AMLA 4LVGA 4Z2GA 4WHBA 3HPAA 4KWWA 1NJJA 1XIBA 3NZPA 3LPPA 4H3DA 1ZBVA 4GY0A 1ZBKA 2PRMA 2ZUNA 1W91A 3PANA 1Z42A 4BI6A 2OO6A 4MFDA 3WF2A 5ABGA 1TPUA 2QCLA 3OBAA 3HGJA 3NPUA 4AIOA 4BF5A 4LU0A 4RV8A 4AAJA 5MF5A 1UC4A 3JUGA 2POZA 4UC5A 1QXLA 2PDXA 1ZAIA 3OVQA 3LX9A 2DT1A 3CZGA 2AL1A 4EANA 3AXHA 1W9VA 3M47A 3DERA 4IX2A 4QRNA 4HZ8A 1A4MA 4DAFA 1J93A 4J2PA 3SAZA 2XN0A 2BVTA 1XYCA 3D3FA 1KRCC 2YLAA 3EX2A 3VNJA 1EPVA 3UY7A 3R2GA 5AHFA 2V2HA 3MDWA 4FMVA 2R1PA 2C3ZA 4HOWA 2DJLA 1ZP3A 3H4GA 4KETA 4HN4A 4B92A 3SCQA 1X1ZA 4XSMA 1MUCA 1R3QA 4J27A 5K9DA 4XX6A 1W1IE 4E4PA 3HB9A 2FDMA 2O9TA 2OOGA 3CUGA 4MTVA 3UCCA 4OWGA 4PTVA 1XDMA 3H6OA 3TR2A 3QMSA 5HQEA 4MG4A 2Z1SA 1I6NA 1BSIA 1A0CA 3LN3A 4US5A 1ZJHA 5HWNA 2ZZ7A 4GIAA 1O94A 1PV8A 3LERA 4EPEC 2TYSA 4KBXA 2H90A 2EPHA 5EMKA 2Z25A 1QU4A 3C2YA 4KT2A 3R6IA 1HF6A 2PDPA 1G6CA 2IXUA 2D73A 1Z69A 2BY2A 3N9RA 1T99A 1UOKA 4LYPA 4O28A 5I3FA 4GMEA 1S5MA 1KBKA 2PDGA 3BOLA 3GBDA 3SIZA 3UR2A 3ZVHB 1MEWA 4GC4A 4GJJA 4IT1A 1OYAA 3U8GA 2XVGA 1EJXC 2J9XA 3G3DA 3KWXA 4EPDC 4M24A 4ACYA 4PL2A 4D6EA 1EO5A 2QMKA 3LCXA 1XHGA 3KRSA 1HT6A 5CPQA 1VP5A 3TJLA 3NXLA 4KMQA 2CCRA 2EPOA 1VYSX 1H09A 2VYOA 1SJAA 3PJUA 2D3LA 3QY7A 2NWRA 3WQ8A 4JN7A 3CAKA 4B3LA 3T4CA 1B4EA 2ZWYA 3EKGA 4DRSA 3GZ3A 4AWEA 1SO4A 1A5BA 1CB7B 4R9OA 2HVMA 4HZ6A 3ALFA 3CB8A 5KETA 3WD1A 2R14A 3L2IA 3L12A 3HFYA 3R1ZA 4EK7A 1RCXB 3NL2A 1B54A 4Q8TA 2Z0IA 2ZWZA 1KC7A 3MYPA 2F6XA 1PZ3A 1SUXA 3SUSA 1NOFA 1SVDA 2QIIA 1ZU8A 3WN6A 2RDUA 3LQLA 3BICA 3NGJA 2GDUA 3SGGA 4PMRA 2HK1A 1JI1A 3GH4A 4AMCA 1RP9A 2X09A 4H4IA 2EJ1A 4AG0A 2I1OA 4QCEA 1QOXA 1D7FA 3OG2A 1H60A 3WLLA 3TJXA 3N9SA 4J4KA 2AOSA 4K8GA 4HA4A 1F5ZA 3GIPA 3Q65A 3CHFA 3M43A 2HCVA 2YR1A 3WK0A 4QEEA 4TIMA 4A35A 4LALA 4PTXA 1U33A 3UPWA 2D2OA 2GVYA 4S3KA 5CAKA 2DP3A 1UP0A 4ZB5A 4IPIA 1A80A 2O56A 4IGHA 4DJED 3A23A 4QR6A 4E8CA 1TJPA 3FYOA 4HKPA 4H9ZA 3L0NA 4NU7A 5E0KA 2VCAA 7A3HA 5JH2A 1LZOA 3SJ3A 2GVLA 5DANA 3TYZA 5DO8A 4GCXA 5FF2A 2ADAA 4HB7A 2JF7A 5A8PA 3NAVA 3O06A 5XIAA 3CH0A 5BXTA 4CNSA 1Y8BA 3FA4A 4MB4A 1IR1A 1B9ZA 4JTHA 1DQWA 3QLLA 3IV8A 1IYXA 4MWAE 4MY8A 3MZNA 4PCPA 1S5NA 5CXPA 1Q63A 4LNYA 3EOLA 3TCEA 4WSKA 4KH2A 5DN1A 1NIUA 1EDTA 4OE7A 3NA8A 1QRQA 2V2CA 3F4WA 3NTYA 3ARRA 4GO8A 1GTEA 1WNOA 1P6BA 5ECVA 4IFKA 1KFEA 4JTUA 4PC8A 3NO1A 2ZXDA 2NLIA 2XZ9A 2VR4A 2CETA 1V02A 2GK1A 1MUMA 4XISA 3SUTA 1XLLA 3ENLA 2GOKA 2WHMA 3AFBA 1W0MA 3CV1A 3WJWA 4Y9PA 4CKQA 3DI0A 5F2GA 1W1YA 2PDFA 1FOBA 4CGTA 1HJSA 1O1HA 1YBQA 2PWVA 1RK6A 3TA9A 4QG6A 3VC6A 3UG8A 2PDIA 3CMFA 3B4UA 5DX7A 2VZOA 1PKMA 1V0NA 1W3IA 2PLJA 1YDYA 1NY1A 1UP2A 3WQCA 3APYA 4CN6A 1FQ0A 3S2JA 1VFUA 3EGJA 1L6GA 1WDSA 4Q4QA 3GDRA 3SURA 1WOAA 1TUFA 3F5JA 4WOQA 4AC1X 4ZQNA 4BHYA 4OU1A 4BK9A 1AZ1A 4OQVA 1WBJA 1GUVA 3WQ4A 4X3ZA 1WPCA 4JAWA 3NQVA 3VINA 1TREA 4H9UA 1ME7A 2CHOA 4H9MA 1DWFM 2A3LA 4JY9A 4DWSA 4QBXA 3W86A 2OX1A 3C5QA 3NL3A 5FJOA 1IEWA 3E6EA 3SB0A 1SO3A 5FEPA 5EBAA 2FZDA 4K1WA 1XBXA 3AOFA 4GD0A 4LJ3A 2HV5A 3BV4A 4QDPA 3O6CA 4GQGA 4ZFMA 3K4AA 3CTLA 2PBOA 2WZMA 3MA8A 4PBGA 4DN1A 1ZLPA 2FPTA 1DBTA 3EZ4A 4AH7A 3T81A 4HYRA 1VFHA 3S6DA 4YTQA 4DNHA 3WF3A 3LQGA 1F6PA 2CBUA 4AYGA 4ZO7A 3CGTA 3B9NA 1TR9A 4YWSA 4OECA 3U2OA 1G7UA 4XD4A 4AISA 4AF0B 1RBAA 1ONWA 3PWAA 3JS3A 1A3XA 1NFGA 2E6AA 2Q01A 2PTDA 1X97A 3HPSA 1UH2A 4ZOEA 4E2BA 4JL2A 2DT2A 3LGDA 3OYXA 5DQPA 5D9NA 3VD3A 4D8LA 1TVLA 2FZ9A 4X60A 4PR4A 3L5LA 4NZ1A 3O9NA 2CKRA 2C79A 4QQ3A 2D24A 2OWWA 1TR1A 4CNUA 1E9LA 3NYDA 1M01A 3A12A 4JQAA 3V0TA 2GVEA 4ALDA 4Y9OA 5E9XA 2XGIA 5BROA 4HSNA 1V7AA 2WB5A 1SZEA 3V3WA 2R91A 1NDVA 2B7PA 1KWGA 5BMWA 3MMWA 2GGEA 3GNPA 1BQGA 4QHRA 3H4WA 1OZQA 4N9BA 2YCIX 1IEVA 2P8BA 5CPOA 3UW6A 4TO8A 1RZMA 1JJKA 4X61A 5DEZA 4IISA 2BS9A 5HNNA 2DZPA 2PTWA 2FKPA 2PWUA 3PP7A 1ZAHA 1GVRA 3G1XA 2WANA 2VXNA 4JCMA 3ITOA 1A5CA 1C8QA 4UZSA 1UKTA 1Z9AA 1SSDA 3L7RA 4PB3A 3S0CA 3BCDA 5FF0A 4RL3A 2PLCA 1A5LC 3S5YA 2ZIDA 4GISA 3HPZA 3ZLHA 4NJHA 5E93A 4ZXLA 3KVLA 3PPHA 2BGNE 3F2DA 1VGAA 2VFEA 3KP0A 1KM6A 4R7WA 4J40A 4A2RA 2QCCA 5D2XA 4C6EA 3B8VA 4DJDA 7XIMA 5CGMA 3MZ2A 2PEVA 4O16A 3MANA 1E0UA 3ATYA 5HULA 3TX9A 4IQDA 2FDSA 3QY6A 2H9AA 4DI8A 4WK9A 3DAQA 4KERA 1LRQA 1ENUA 1OABA 4WD0A 4K1GA 3A4XA 1AW2A 4O4WA 3TSBA 1NEYA 2XGZA 4L7ZA 2IQ0A 4ZBCA 1SZFA 4ACZB 3ONBA 1LYXA 1QT1A 5AOUA 4LY8A 1YTEA 1Q6FA 4UR7A 4A8NA 1BGAA 4LC6A 1PL9A 4ERGA 1AJ2A 4V2XA 1XCXA 4MAZA 1PTDA 1TWSA 1V3JA 2VC9A 4A3QA 3CPRA 4NL1A 2WC4A 4I3GA 1FWJC 3O0KA 1BWKA 2Z7GA 2UY5A 2YW3A 5FSEC 4YTTA 3S1GA 1A5NC 3VDBA 4TUFA 2OSYA 3N9KA 1ISWA 2WVVA 3GHTA 2BY3A 1TV7A 3VK5A 5GNZA 3KOFA 3WQFA 2ZUVA 2WSYA 4C6MA 4B3KA 1K6AA 2FPYA 3NL6A 3WSUA 2IKGA 2VZUA 4D71A 3CWNA 4H1ZA 1XRTA 3UNTA 1F4HA 1NOWA 1VC4A 1OINA 3NL5A 4IP7A 4HP5A 4GYJA 3EMQA 4LVAA 1WZKA 3MSDA 3FV9A 4QS5A 1X98A 1GOWA 1TZ7A 2PP1A 3OVPA 1B90A 4K8EA 1W2PA 2ONEA 2Y7DA 1SPQA 3AYVA 4PMJA 1RCQA 3GTHA 4XBKA 3M41A 2PDNA 4DO6A 2W9MA 2NQJA 4LUYA 1CGXA 1XLFA 4Y9MA 2R9RA 3GG1A 3R0UA 3QZ6A 4L65A 3BAXA 4Q7IA 5E0FA 4S2BA 4QM1A 2PZNA 2J7BA 2ICSA 1RAKA 1IIGA 3VKBA 3WZ0E 2QV5A 2QW5A 4WKHA 2FGZA 2I57A 4QJ5B 2NW0A 3MMUA 4W9TA 3B06A 2GUUA 4GY1A 1ELSA 3UA3A 1WDDA 1X6LA 5DLCA 1QATA 4Z1YA 3DC8A 6A3HA 1TA3B 1A0DA 4XUYA 3W2UA 1DP0A 3TLLA 3LXBA 4O14A 1EFZA 1GOQA 1JCJA 2C16A 2G3MA 4CD7A 2Q8XA 1KRAC 2PS2A 4KFNA 2HQAA 3OZYA 1PHWA 2XN2A 1P0BA 4LS0A 1EKOA 1ADSA 2QXWA 3KL3A 2HE8A 3ZFHA 3VGDA 3URAA 4B5VA 1OD8A 3FXYA 1LUCB 3MKCA 3GDTA 4AW7A 4WRHA 3WL1A 3VM7A 2NUXA 3TH6A 3PBMA 1H51A 1MO0A 2HNEA 3HJZA 4X9SA 2DIEA 5CPTA 1H7RA 2F7FA 3NWRA 5HUOA 1I4NA 2DSKA 3RNDA 3DH7A 2FVMA 3VIKA 1TRIA 2VCBA 4RZ6A 2OCZA 1CX9A 4RR4A 1H11A 3RITA 4N42A 3OLIA 4G6CA 3AALA 3WNNA 4F0KA 2F84A 3LXAA 3F7JA 2HBVA 3QSRA 3UPMA 1K70A 4AHQA 2EAWA 1TJ2A 3AYRA 4NJGA 3WBYA 3HQ1A 1JUEA 3PK7A 1K77A 4IL2A 1BGGA 3PUOA 3VM5A 3BC9A 3NDOA 3MI6A 2XUCA 1NVMA 5I02A 1VZWA 5FJRA 2W6RA 2HK0A 2A6LA 2OEJA 4HA3A 3WUEA 1PXGA 1PJ9A 1UA7A 2DGAA 2IPWA 1XCWA 3H2AA 4PSRA 4C5ZA 1XSIA 2VC7A 1WKEA 1BWLA 4IFRA 2G37A 4D8AA 3FJNA 2P88A 4MM1A 4NSBA 4BEUA 4S23A 4ONVA 1W37A 2XIMA 1MMFA 4UMBA 4JIIX 1SZNA 4DHGA 1Q2SA 3SUWA 1OX4A 1ONXA 4P7NA 3WDJA 1VRXA 3TNBA 3P5YA 1SW0A 1YTDA 4LAKA 5G4HC 1YNQA 3VNLA 1LLWA 1J2BA 5AC4A 1CB2A 3C0SA 4D6HA 4JCLA 4ASTA 1EH9A 1OYBA 1XIMA 1B3OA 3W1TA 1RA5A 2EQDA 4B16A 1NFBA 4J35A 1JNDA 3FKRA 5AYZA 3QW4B 4Q4OA 3HO8A 1FP9A 5A6MA 4Z0SA 1OT1A 2G8ZA 1XD0A 2MANA 1MW1A 3C3UA 4RNFA 4C6KA 3S1WA 1LBFA 5HMDA 2W67A 3VKAA 2D2JA 4ZXOA 4E5TA 4C7DA 1JDEA 3IAQA 3LZ3A 4UNLA 4OOUA 1DQXA 3RX2A 2WAGA 3O63A 1C29A 1SQ7A 4UXDA 4ADSA 1HKWA 3W7QA 3VILA 4JTDA 3ITLA 4WKAA 4AWTA 1FVPA 1QW8A 1OT2A 1W1PA 4ZCWA 1Z8AA 3GXIA 3FA3A 1FH8A 3DFQA 4B5TA 3N4FA 3O3RA 3WUFA 2GGJA 3LB0A 1ICPA 3W70A 2F2KA 3AIQA 4MUZA 2BSLA 4GABA 4NAFA 3JW7A 4FNTA 4H9XA 3VTRA 1RUSA 1NP2A 4N9CA 1TJRA 1BG4A 1R3VA 4Z08A 4U31A 4Y8EA 3V1HA 2DH3A 3C0JA 1TMHA 5TIMA 5FD0A 4WY0A 2ISFA 2IUZA 4ZOBA 1JZ4A 3U7BA 4D6IA 3QFWA 1FWDC 4IG2A 5EL1A 3PTQA 2YIHA 4JL1A 2E1WA 5I3DA 4GVFA 2NX1A 5HNRA 5DRCA 3SCRA 5F4XA 4DNMA 2YBUA 4R3UA 4O0QA 4JQ2A 3MI3A 3CXOA 4FNRA 4PYSA 2QGYA 1EC8A 1SO5A 3B4YA 2PRHA 3NSXA 3PJTA 3EWUA 2O7SA 3O05A 5HINA 2VM8A 2BASA 1SZGA 3TZNA 4AZBA 3HF3A 1GT8A 3UJEA 5TNVA 4F2TA 4Z2LA 5AC5A 3PJXA 3PFRA 4GKTA 1E0TA 3AU6A 1YDOA 4BZYA 3FIGA 2AGTA 3M0LA 3VDCA 2PDHA 4KWVA 4XVEA 5KZ6A 1E5JA 2UWFA 2Y2WA 3UG3A 1PWMA 1XLBA 4GQQA 1FDZA 5J04A 3GKAA 3LD5A 3UWVA 4XAZA 1XLDA 3LRLA 1OGBA 1W3LA 4AY1A 1W9UA 3KBNA 2P76A 4ATLA 1AD4A 2YZRA 2ZQ0A 1NH6A 5DT5A 2DFAA 5C54A 3DYOA 1JD7A 3PZGA 3G1DA 1KM4A 2Z1KA 3LTYA 3H7RA 1C92A 2D2HA 4UQ9A 3MI2A 1KM1A 4ZEPA 1KBLA 4XZ9A 2ZA2A 3AUOA 5CJNA 4HN8A 2XIJA 3T44A 2E7FA 1KQYA 3ZWTA 3MJYA 1W1ZA 1A5OC 4ICCX 2VUNA 3AMGA 1HKJA 2V82A 1XH2A 2PSNA 4F79A 1Q6CA 5CJ5A 5HWJA 2Z4GA 1MWOA 1KFJA 4H6QA 2YB4A 4QLLA 1XLAA 5FF3A 4Y2WA 1EA9C 2BGSA 4G8TA 4BQ3A 4IF2A 3MBFA 3GVRA 3N15A 5BW6A 3UFYA 4EE9A 3POHA 1P6CA 5G4WA 5CG0A 4Q6XA 3VYLA 4IFKB 1MEHA 2ZUTA 1R30A 4LF1A 3CPUA 4DXKA 1GJUA 2GK1B 5F2LA 3N73A 1PS9A 2CLOA 5E70A 2DJXA 2E4TA 1I2NA 2CLEA 4MADA 4LC8A 3T7VA 3TN3A 5C9RA 3BLOA 3ARUA 3N11A 4F3HA 5LIYX 1GYMA 3R0KA 3E0IA 2DQWA 3STGA 5JIWA 4E0CA 3WBWA 3M0ZA 4U4MA 1YBQB 3W2MA 1FDYA 5JH1A 1GONA 5A6LA 3SQSA 1E4NA 2O7QA 2Y7EA 3HPFA 4UTMA 1EF2A 2QCHA 2BVDA 3MO7A 2XFYA 4LBRA 2VGGA 1QPRA 2I16A 3TWAA 3KL5A 2XYLA 4KIEA 1AD1A 3W74A 3SN0A 2QDHA 3GB6A 5D33A 3A4AA 5AVHA 3KLLA 4X0NA 4K37A 3NEHA 3UWWA 5JXQA 1JRCA 3II1A 4MKVA 1HNYA 1GNXA 1TUXA 2PAJA 2X8RA 5AC7A 3ABQA 3MUAA 3BQ6A 4U28A 3N13A 4G1NA 2RAGA 3WLMA 4DWSB 2QNEA 3LV6A 3RR1A 2FHFA 3RAOA 3W38A 4M82A 4OUIA 1G7VA 1GGOA 1B3VA 3CUXA 4BI7A 2E6YA 1W17A 1K9TA 3BOFA 1GQIA 1S2AA 4LANA 1HTIA 3ZYZA 3H12A 3FSUA 3VDAA 1GW9A 2D0HA 2OR2A 3M0KA 2PP0A 4BQ4A 2YA0A 1CXEA 5ABTA 3SY8A 3R58A 1JZ5A 1AUSL 2YDAA 5HDRA 1VKFA 4IMDA 3WUBA 3MMTA 1S5VA 2L5HA 4QLJA 4HCLA 1SO6A 2P5NA 1AH0A 2WJDA 3H2NA 1F8MA 4HNVA 1H41A 2EHHA 4C65A 3AHXA 4PUWA 2A7RA 4U5KA 4I6KA 1U1JA 3N6HA 2I14A 1I2OA 3MU7A 4C7GA 4IUGA 3ME3A 2QJGA 4U3CA 3GFXA 1OFOA 3ABSA 1V3MA 3T08A 1G4TA 3SQLA 4MNKA 4D6JA 5KEZA 1DOSA 3BSGA 4K2SA 3K8MA 4H41A 1GKQA 2VEIA 4WIWA 5FESA 3NFUA 2YL5A 4LAOA 4QGCA 3QHNA 5IBXC 3ARXA 2E68A 4UQAA 3S1UA 2HWGA 1J0JA 4AC7C 3FAXA 4W87A 3M46A 4Z2JA 3NNTA 1EZWA 4RX0A 3WFAA 5I3KA 1RLDA 3WQDA 5A6AA 2BXVA 1A49A 4HHPA 4QXIA 1KGWA 1EP2A 3UXDA 4ECLA 2YW4A 1TQJA 1IT0A 3ITGA 3OO2A 2VENA 2GWGA 4IP5A 3ABOA 3I6RA 1L6WA 5AN7A 1N8WA 3WEMA 2WBGA 4KWUA 3MCMA 1TPFA 1H2JA 2X7VA 1J5TA 5EA9A 3R0DA 5CPLA 2J24A 3R94A 2OODA 1E0VA 2V30A 5BWAA 3N6JA 1KO0A 4FK9A 4HJFA 3UESA 3DHFA 4UFIA 3LDVA 9XIAA 5FAJA 1DIKA 4WLCA 2VURA 1JDFA 4OT7A 1WB0A 2XDFA 1WOBA 2V3EA 2Y61A 1K8ZA 3LRKA 2WVUA 3UR5A 5F2IA 2ACRA 4IUOA 3G3MA 3E2VA 3SRKA 4XZHA 1H5YA 5FJTA 5FL0A 2W62A 3H2FA 4UZUA 4LT9A 3NOYA 4D1JA 1Z32X 4GH3A 2H9AB 3PTDA 4GUFA 2GGIA 1AW1A 3R10A 1E6PA 3V0SA 1DJZA 1A5MC 1BG9A 1VFMA 1Q6QA 2DH2A 3SBFA 4MY1A 1EDGA 5FAGA 3OP2A 2XH7A 4Y96A 3PY2A 1LL4A 1XPGA 1UR0A 4JX4A 2G96A 1YDVA 1R9YA 2C6QA 2X1RA 1UKOA 4DO4A 3PFMA 4LWWA 4D72A 1R47A 2VVNA 2ZZ4A 1P5BA 3MP4A 3HMJG 3KE0A 3KOWA 7ODCA 1UROA 2R8WA 3HQOA 3CHVA 1W9BM 3B0YA 4BKNA 2GSEA 3GYEA 1DWJM 4AZ7A 3DI1A 1EP1A 2E6DA 4JDBA 5ENLA 2EG7A 4R53A 5EGRA 3WLQA 1GHRA 2HVOA 4I5RA 3WDHA 1W3NA 3M0VA 2PCEA 4LFYA 4QE1A 1POKA 1DJHA 2WNNA 1XBYA 1SFLA 2OEMA 2PFHA 3UY8A 3UD6A 3WD2A 1EBHA 4PE8A 2WVVB 4L5ZA 4ZO6A 3MPGA 4HPHA 1PE1A 3GFYA 5FOOA 4GVHA 4W93A 4P61A 4UIOA 2E09A 3R13A 2AKZA 1VD6A 4IICA 1O60A 5BZAA 1SW7A 3E0LA 3NQ2A 4O1BA 5CZ0A 4HCDA 4GZEA 1E56A 3EWBX 1EC9A 1DIOA 2J7EA 1ZS2A 3PHAA 3H2CA 3C3NA 2HNHA 1A5KC 2XIQA 3T0BA 1E1CA 3LCHA 1WZLA 4GCAA 1GG0A 1VPXA 2DUAA 3VIGA 4DF2A 4WDUA 2VDGA 1ZALA 4BJHA 2FB3A 4LPCA 4C1KA 4PMOA 2VZTA 2QF7A 3TJIA 3OHMB 3HZ3A 2PWDA 4Q8UA 3MMDA 1H5VA 4AHOA 3BLDA 3M0YA 4IIHA 3G1VA 5K9XA 5LIXX 3B8IA 4MJ2A 3RLHA 5B80A 1GYLA 1T96A 2X2YA 1WXJA 1W5QA 5FJIA 2QAPA 4EOUA 1B3ZA 4QSHA 4WGHA 1S39A 4YTSA 3CU2A 4GIRA 3RLUA 5A8NA 1AQFA 3SM0A 3TW6A 4NI3A 1VYRA 2Z1VA 2TODA 5D02A 2QYGA 4W89A 3KLKA 2QLYA 3DDMA 2RJGA 2C14A 3SGUA 3UXKA 4LVBA 3EDFA 3TMLA 4W84A 3G24A 1O4UA 1VPYA 1D7KA 4C6CA 5I5RA 3PZNA 3SN4A 2J79A 3VI2A 5I79A 1XLIA 1GVIA 3L4VA 1S38A 1BYDA 4UFJA 1RP8A 1HN1A 4PULA 2Z26A 3S9ZA 2AAMA 3DBNA 1QASA 3O15A 5CPSA 1PDYA 3S2MA 3W2NA 1JQXA 1GVYA 4DPPA 1CNVA 2DZWA 4GXPA 3N2CA 2YOCA 4H9YA 5LGXA 5CPNA 3M5ZA 2V3GA 2X42A 1V51A 2VJXA 3MCOA 1CZ1A 3KCOA 1XH0A 1SW3A 3E12A 4GIYA 3GZAA 5K2ZA 1EJVC 4YU1A 3WCZA 3LCIA 1J0HA 3B0XA 3L9CA 4XB3A 1JPKA 3TTEA 1T5AA 2VWSA 3CYVA 1D3HA 4ZSUA 4MWAC 2HPMA 2V0TA 2WO5A 1BWVA 2DVXA 3U57A 1PYFA 2QJNA 4IOTA 3QTGA 1YLVA 2W61A 3KZSA 1LG2A 3SQMA 4XAPA 5M5DA 2WVSA 3SFWA 1TPEA 4N6EA 2HSAA 3T0CA 3TQKA 3AU2A 2H3BA 5A95A 1OC5A 3CT7A 4LUJA 1R7AA 4NZ5A 7REQA 1V6VA 3MP3A 1TPB1 1HKIA 5LXEA 2NZLA 2WWCA 2WBKA 4HA0A 1RVKA 3V5OA 4Y8FA 4RW3A 3EXSA 1HG3A 4FP1A 7TAAA 3QLDA 2OYLA 5CZKA 3W1LA 4PMUA 3VO0A 1E6NA 1BRLA 1JAEA 3B9AA 3MUY1 4DF0A 4S38A 3QQ0A 3M0HA 2CHNA 1H4PA 4NZJA 5I3IA 2INEA 3WLPA 3PZTA 5IDZA 1OX4B 3NQFA 3B0VC 1KR0A 1OX5A 2O9OA 3AQUA 3W7GA 5FL1A 1NU5A 3MWAA 2WM1A 3APGA 1SU5A 3B04A 1DIDA 3W7IA 1PUDA 3T07A 5A6SA 2J7FA 2BY1A 1SJDA 1SMDA 4CEXC 1EO7A 2PPGA 3ARZA 2QZRA 1CXHA 1G4SA 3E2SA 3CMJA 1Z6KA 1YMYA 4ZO8A 3IIXA 1V0KA 4H6RA 3V0UA 2WMIA 3GUGA 4B5SA 1KKRA 2XZ7A 3MVIA 1ZJBA 2FLIA 2J9ZA 2GSHA 1FWWA 3R7MA 2QT3A 4BWLC 5L9FA 3GHSA 5AVNA 1W3KA 3G8EA 3LYEA 4O1EA 3URNA 3KP1A 1JFXA 3UGRA 2G3FA 3KBJA 4O12A 1H7WA 1M53A 3PTMA 1S1PA 5M03A 2GQ3A 1F4AA 5H2ZA 3CO4A 4FNSA 3QPZA 5HNUA 3R4IA 2Y24A 2Z7KA 1NQKA 1OK6A 2ZDRA 3W72A 1TRDA 1JUBA 3IGHX 5DT7A 1W5NA 3C6CA 2E9MA