2FMNA

Ala177val mutant of e. coli methylenetetrahydrofolate reductase complex with ly309887
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
288
Chain Sequence
FFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGVNRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structural Perturbations in the Ala -> Val Polymorphism of Methylenetetrahydrofolate Reductase: How Binding of Folates May Protect against Inactivation
pubmed doi rcsb
source organism Escherichia coli
total genus 98
structure length 288
sequence length 293
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 2fmnA00
1ZP4A 4O8AA 3E2RA 1ZPTA 1TIWA 1TJ2A 4JNZA 1V93A 3ITGA 1ZRQA 2FMNA 3APYA 2FMOA 1B5TA 3E2SA 2FZNA 3APTA 3E2QA 2FZMA 4JNYA 1TJ0A 3IJDA 3FSUA 1ZP3A 3FSTA 1TJ1A
chains in the Genus database with same CATH superfamily
5HK4A 1E70M 4NY2A 3NCOA 3TJIA 4RZBA 4MKNA 3SUWA 2YB1A 1DIEA 2WK2A 3O05A 3II1A 3KBWA 2VI0A 3LOTA 3PVFA 1WB0A 3EWZA 1ZBVA 2PUZA 2E09A 1AJ0A 4HK7A 4C7GA 5CZKA 1PVNA 3PUGA 4MMWA 9XIAA 3R7MA 1UWSA 4RZ6A 5HANA 2ZXQA 1OM0A 3GDMA 1THFD 3GKFA 1BQCA 1J0HA 4AD2A 2W3ZA 4JFWA 4LAMA 3HGSA 3UG5A 3GQYA 3GXFA 3KHJA 4M29A 1E4LA 1CXFA 4AEFA 2PE4A 3WDIA 1XYZA 1PX8A 2ZXAA 3ZJ8A 1XV8A 4JNMA 4L65A 5K9DA 3W1UA 3QZEA 3QW4B 2D22A 1TCDA 4W8BA 3HOJA 3P67A 4GBUA 1LOSA 4RNIA 1V4YA 3K4DA 3R12A 5GPRA 4CNPA 2BLEA 1IZKA 1UW9A 1Q6CA 1SJBA 5BWFA 7ENLA 3AC0A 2WCGA 5EYWA 3PZQA 3ITYA 4FA3A 5BMXA 1OC7A 4Q8TA 2I5QA 3AYRA 3FIGA 4AZIA 1HO4A 1GTEA 2ZZ3A 3M1ZA 4DEFA 8RUCA 1DHPA 3EPNA 2C1IA 3WF0A 4XSMA 4CKQA 5AC7A 1ZGDA 4LVBA 2OEJA 1LBMA 3C2FA 4YU1A 1T7LA 2WANA 1KM4A 2YCLA 4XZIA 3AHXA 2E6AA 1OADA 3TJLA 4MSSA 1OF6A 4YCPA 2AOSA 3WF3A 4DBUA 3S2CA 3KOXA 2Z4GA 3N9RA 2OEMA 5F4WA 5FEXA 4B5SA 1HL8A 1XIGA 3OLIA 4E3VA 2J75A 1O60A 2J7HA 1EJVC 3JS3A 5TBOA 4CD7A 4D6IA 4GH3A 5DXYA 1U33A 5CAKA 4YYCA 5D32A 1FCUA 3BWWA 4INFA 4AZBA 3EX4A 1EJRC 2I14A 3VDGA 4O12A 3WY1A 3BXWA 3LCLA 3VOJA 4ZMGA 3THUA 3APTA 4A3UA 1OX4A 2HRWA 2XIIA 2BY0A 2ZVRA 1F3XA 2CERA 2A7RA 1CEOA 3ITVA 3GTNA 4JTKA 1NARA 4ZB0A 4J1OA 1ENUA 1NVMA 4L1WA 5ECUA 1C8QA 1QHZA 1DIDA 4NXKA 4KWUA 4MPKA 1I9CB 4DUWA 2FH8A 5AB3A 2H9AA 1EDQA 4J3ZA 1U5JA 4ORIA 3W7EA 3GFXA 1TPWA 1EUAA 1XC4A 3KLLA 3SADA 4GNVA 5I79A 4AZ6A 3LLDA 4G5DA 4PULA 4DBEA 1DJZA 1K4GA 1GONA 1GZ1A 2OQLA 4K37A 1QUMA 1QBBA 2DIEA 4YVPA 4DXKA 2O92A 3ABSA 4NYYA 1CB7B 4D6GA 4PTWA 3QMRA 1GEHA 3P0WA 3MBDA 1I2PA 3I4EA 2X0YA 1XYFA 2DVUA 3TC7A 4O52A 1ISXA 2HE5A 1R9ZA 1CLKA 3LPFA 4DO6A 5ENLA 3MUIA 3GW3A 5C9UA 4O13A 3TA6A 4O19A 4DYJA 3LX9A 1ZAIA 1GTHA 3AIUA 1DBTA 3CIVA 2D3LA 3VNZA 4KS0A 1DWHM 1OX6A 3TEVA 3T8QA 4ZO6A 3R0DA 5IDZA 1K8XA 2E40A 3M0VA 1ADOA 3M46A 1G4SA 2V3EA 1MZHA 3KUMA 3OQ8A 1DIOA 2VTFA 2HPMA 4RPQA 1LTDA 3G0SA 4RW3A 3RGTA 2OKOA 3NM3A 2QJGA 1UWRA 5FJOA 2GJXB 3AICA 2EBNA 3LI0A 2G97A 3CQHA 4HNOA 1A5BA 3SCNA 1HKIA 1YE4A 1ZUAX 1FHVA 4XZ9A 2D20A 1LJYA 3AZRA 5BZAA 1OGSA 5CGTA 1KQZA 4O11A 4AZHA 3UA4A 1TPUA 2R1MA 5KZDA 3OU8A 3TTOA 3W2JA 1SMDA 2YL5A 1T0OA 4LJ3A 1R3VA 2Y8VA 3CZEA 3VCNA 2ZDRA 1IHIA 1TSIA 2VO5A 3M7SA 3FJNA 1W5PA 4V15A 5G2IA 2ZDSA 4NAEA 3ONCA 5KZMA 1TTQA 4NU7A 3VKBA 2A85A 4PMDA 4LGXA 4M81A 4RDVA 4DO7A 4JHMA 1CENA 4S39A 1GKPA 4GACA 1PWLA 1KR0A 3PANA 3NO1A 2WHJA 4LFYA 4IL2A 3G1XA 3JUGA 2ZFAA 3UXIA 3BV7A 3M16A 2E3ZA 4JXCA 3KS6A 4JQ2A 3GNNA 1LWIA 1W54A 2EKGA 1US0A 4I3GA 4XUYA 1OFBA 4YPJA 2YYUA 2DIKA 4CVUA 2ZRZA 2PDJA 3T40A 2RAGA 1VRDA 3Q65A 3BCDA 4GKTA 3QPYA 5CZTA 3ZT6A 1Q6GA 5F2MA 2WMHA 4WQ6A 1Q8AA 1XH2A 3THAA 3HIJA 2Y0FA 1QPNA 3ARXA 3V7PA 2DQWA 1SZRA 3WUGA 4O4VA 2AKMA 4IIDA 2FLIA 4Q6XA 4M7SA 4GQQA 3P84A 2OOFA 2DSKA 4PCSA 4WGHA 5A6JA 4IXHA 2O9OA 3ABXA 4JQAA 3BCJA 9XIMA 1DQUA 5AOUA 3WQVA 3ZT5A 1UQZA 3E3HA 4H9XA 5D33A 2OZ8A 2WW5A 3R79A 5FJIA 1TIWA 1PIIA 3TAOA 4DQWA 3WBYA 1ONXA 5E09A 3UWUA 3MVIA 5TAOA 2PD5A 1FTXA 1AODA 4X2RA 4KEVA 3BMVA 1C8VA 1EOKA 3TTSA 3QLLA 1PJ9A 1RA5A 1RCOB 3APGA 3OIXA 3A5VA 4PEKA 1V5XA 2E0PA 4DXVA 3OZPA 3CPGA 1PHWA 3UJ2A 3W22A 3HGOA 5H8MA 4ZQPA 4FHAA 4TX9A 3UR8A 5CGMA 4G7EA 3ITLA 3W88A 3CGTA 3CAWA 4WJ8A 4WJXA 3IIOA 4C1NA 1VBJA 1F6KA 3O06A 3GIQA 3L4VA 3GC5A 1IV8A 4TV5A 3WSUA 3LHTA 4HYRA 3T0BA 1OQFA 4UTUA 2W27A 2NVDA 5CGQA 1X6NA 1SR0A 4TTUA 1XD1A 5DFAA 2PS2A 4IX0A 4GZEA 4RNJA 5CZ0A 2QXWA 1ZNNA 3M5VA 3CUIA 2IS7A 4EKJA 4M82A 2G50A 2OVLA 2PRMA 5B7YA 4ZSTA 2RDWA 4D72A 1GVSA 3B0PA 1Q4WA 5C2GA 2ZUVA 2BVDA 1E15A 1DWAM 4N9DA 4WDUA 1T8QA 3IJIA 2AL1A 4S23A 1RLCL 4OQVA 1VR6A 4FLRA 3GC2A 3ZJKA 1V0LA 2RDXA 2QF7A 5F2IA 5B80A 3ABZA 3AI0A 3ABOA 1RAKA 4NJGA 4JKLA 3LM3A 5D9MA 4NVTA 4UMCA 1NQKA 3QHMA 2DT1A 1KRAC 3KCJA 5CSSA 3V75A 4AD3A 3DFYA 2VCBA 3GFZA 1GPWA 2WJDA 1V77A 4NNAA 2GWNA 3DOPA 2ZUUA 3FV9A 3NEHA 1KLYA 3URAA 1BTMA 2ALRA 3WJZA 2YW3A 2JKPA 2D2OA 3KP0A 5A8GA 3B9AA 4AC1X 4W7UA 1OX5A 1QXLA 3N12A 3U57A 3ITXA 4O17A 2YR1A 4HU4A 2ABAA 3AYSA 3T42A 2JEPA 4C6QA 3RXZA 2CIPA 2ISSA 5C7VA 4DF0A 2PPGA 3ARTA 4G2DA 4L7ZA 5BNKA 1M04A 1V6YA 1XBYA 4DPQA 2EPMX 3BLIA 1UR3M 3WQEA 4H4IA 1DL3A 1QI5A 4BF7A 4B2DA 4BF5A 1J4EA 1KGWA 3V0UA 3R11A 1W8SA 3T55A 3IJQA 4J3TA 4UZUA 4KRUA 3W2LA 2O56A 5BU9A 3TYZA 2J8TA 2ZE3A 4R7WA 1YRRA 5FJPA 4A29A 4U5KA 1E0UA 3ZVHA 5DCBA 5G4HC 3PBWA 1J79A 5CPSA 4PBFA 4FP1A 5J5RA 1PKLA 1H7OA 4HBKA 4LX4A 2E9LA 3O63A 1XLCA 4QSFA 2RFGA 1Q6FA 1LUCA 5EKYA 4Z2GA 1I1XA 1JZ5A 3L4WA 4UFHA 3RR4A 4I9TA 3RM9A 1LCOA 5I00A 3MDUA 1J2BA 4GIAA 4A3YA 4WDWA 1JXKA 2AKZA 1WBHA 4IH3A 1SO5A 3M0KA 4WOZA 3HU7A 2FHFA 4Q4PA 1YHTA 4X0NA 2FIQA 3W75A 3W1AA 2Z27A 4G8TA 3KOWA 3KVKA 1IEQA 1YQ2A 2Z1VA 3MI6A 3QGVA 5FF2A 3LI1A 1V6WA 1DE6A 4Z1YA 4DPPA 5EPDA 3VX1A 4Y2WA 1VLWA 3T44A 4S2BA 2DFAA 1UQYA 3PZOA 1OFOA 5I78A 1M7PA 2P8BA 1V02E 3NSMA 2FDMA 3LLFA 5A6KA 1ZCOA 4Q4MA 3NG3A 3RLUA 2OPJA 4H83A 4PGLA 3WQ6A 3A21A 3AUOA 3WLMA 1OYBA 3W25A 4MIMA 3K30A 3PJXA 3C3UA 5FF0A 2H90A 2VKZG 4WCJA 3TJ4A 3RJYA 1TV7A 3HF3A 3D3AA 3DG6A 4LB3A 5EY5A 5L9FA 2VGGA 3GY1A 2E1WA 2C7FA 4PEEA 3USBA 3L0GA 4OKDA 4TTGA 3OGRA 4BZYA 4IIHA 5BW6A 1EC8A 1UUQA 1NOWA 1IEIA 3KM8A 2F6UA 4ECLA 2FZNA 1FWCC 1XCWA 1EPXA 4LAZA 2WC3A 1JAKA 1V03A 3NOYA 1HJWA 2WVVB 5A6MA 3IGSA 2QUUA 1TB3A 1MEIA 4PYSA 2J9YA 3VD9A 3MBFA 3PSVA 1O95A 3LRKA 3CUFA 7PTDA 4H8UA 3U2CA 1N7KA 1AW2A 3D3FA 3E2QA 4H7CA 3MZ2A 2ANUA 3OVRA 4MJZA 3L4YA 3DBNA 2ZXDA 3O6CA 4MUPA 2FGBA 3WYZA 3IUHA 3TSMA 1J96A 4C1KA 2QJJA 1VPXA 1GNXA 1NWSA 1XF0A 4AH7A 3DHPA 2YDSA 2WV8A 1Q6DA 4X61A 4UQ9A 4QE4A 2IPJA 1BTCA 3BICA 3KRZA 1W2VA 3F7JA 2OOGA 2AGKA 4Q8UA 3VIOA 3KS5A 4TXEA 4JHZA 5HQLA 3S2NA 1ZLPA 2ZOXA 1MQQA 3M44A 1TVLA 1UIPA 3LM7A 1UZHA 1UD3A 1E55A 1KM2A 1RCQA 1AK5A 5G5IA 4D1JA 1HKJA 1YW1A 4BEUA 1HT6A 3AO0A 2EEXA 2OWXA 4PH6A 3S1GA 3WLJA 2WSKA 1H7WA 3GIYA 1HN1A 2PB1A 1F3EA 1Z41A 4N4PA 3B9EA 3AWOA 5CSYA 3E0WA 1A49A 1H0IA 4ZQMA 3W83A 4C6FA 4IHCA 3CMJA 3VIPA 3ANUA 2FHCA 3ZOAA 4ZTXA 4L6DA 2OR2A 1E73M 3UFYA 1LLOA 1XC6A 3SGUA 5ABFA 3IVUA 4JAWA 1A3HA 1EO7A 3S42A 4PUNA 1BHGA 4E2DA 1QTWA 4ICMA 4PUKA 1UC4A 5SWUA 3T7VA 3B4UA 5HJYA 4CN6A 2V2CA 3T78A 4LPCA 4MHBA 4PCTA 1J12A 2YGYA 1OY0A 4GXPA 3GRIA 1AQHA 1ITQA 4GI9A 5KEZA 4LYQA 2QJHA 1AMYA 3UVIA 1I6NA 5LA0A 4DELA 2Y6ZA 1VFMA 1T8XA 1HL9A 4LRSA 4PMZA 1SFJA 3QW3A 5JBEA 5JH2A 4AAJA 3GTIA 3HFYA 4CGTA 4HNTA 1E6SM 1EO5A 1HP4A 1D2KA 1QHPA 3URQA 1F9CA 3S6TA 4CNOA 4AQLA 3TYBA 4DRSA 2XM2A 3NZQA 1UR4A 2WZEA 4D6FA 4AD5A 4EE9A 4AWTA 4EXBA 3CLWA 1YNPA 1VFHA 3FJ4A 4GABA 4NAFB 3W23A 3F2CA 1BD0A 4C6BA 3W1MA 2ISWA 5XIMA 4HOZA 1KM0A 3TMLA 1VBGA 3W7LA 1G9HA 4DYKA 3OB8A 1XCFA 1WZLA 3OG3A 4Q4OA 2BASA 1XIJA 1T6MA 1RPKA 1GG1A 2RDUA 1HQTA 4PCPA 2A1YA 1KV5A 2INEA 3HMCA 1G69A 3O6AA 2E9BA 2E68A 1CBGA 1H0GA 3KBMA 3QM3A 4OBTA 3KFTA 3KRUA 5D38A 2QCFA 3SRHA 2Y7DA 4S2CA 2QKFA 4A8LA 3E12A 4MKVA 3V0TA 3GE7A 3FJ6A 2UZ9A 1GVEA 1FWHC 2VZVA 1ELSA 1WX0A 1E3ZA 1VP5A 3LTPA 3TJXA 4LVAA 1X8FA 8XIMA 2YSWA 3UG8A 1WP6A 1D8WA 3FSTA 3KP1A 1B3XA 2HSAA 2G8ZA 3BUVA 4E8CA 1NAL1 1ITCA 2J4GA 3S8HA 4ZO9A 5C5YA 2ZE0A 2DU2A 1AJZA 4PL2A 3TXZA 1FWAC 3S9IA 2B31A 1TE6A 3CASA 3M7WA 2PDPA 2YX0A 4MM1A 4GG9A 4O57A 3GDTA 1AQMA 5EBUA 4FOUA 2Y62A 3CQKA 1L6SA 3W24A 2Y63A 3EKZA 4QEHA 3BJSA 2QMJA 4FPSA 1VFSA 1R3RA 4JL2A 4X2PA 4K7YA 2CESA 4ML9A 1SYTA 3H26A 1S46A 1H09A 3DFSA 1BLIA 3DERA 1DJXA 1O94A 4NI3A 1G4TA 4MDPA 1TR1A 2ZADA 3IPWA 1EWDA 2IXUA 4XK2A 4W7VA 3PG9A 3W1LA 5C0QA 1CIUA 4KCWA 2Q02A 5JXQA 1OFPA 3Q45A 4BKNA 4ATLA 2C14A 3T8LA 3RX4A 3Q67A 3LTSA 5A6LA 1XDLA 6TIMA 3HPZA 4QLLA 2WQPA 3AHYA 1TRDA 2ABBA 1TWSA 1JL8A 2TODA 4GZ7A 3IIZA 1TUFA 3I3DA 3Q4DA 2Y5EA 4ADUA 2HPIA 4FK9A 4Z2JA 4HPNA 5GNYA 1OK6A 1GGOA 2PD9A 4H9VA 1U5HA 4UIOA 3QZ6A 4TO8A 5DLCA 4LTSA 1FP8A 2DW6A 4BWLA 6CGTA 2INFA 4C1NB 3SJ3A 3EA1A 2CETA 4H8HA 5FEPA 1UMYA 2HNHA 5CPLA 3LZ5A 1GOIA 2WB5A 3H24A 4HNCA 4LBUA 3GIPA 1SO3A 3C56A 1SZNA 3W2MA 1DYSA 1K9DA 5I3IA 1OGBA 2DVXA 2QMKA 2DZUA 2D1ZA 5CG0A 3ATZA 2IKGA 1OCJA 3T1GA 4PMNA 3IK4A 3PJWA 3ZMRA 3VNYA 2B7PA 4OUIA 1TUXA 2R9RA 4A8RA 1H4PA 1Y0EA 4Y9AA 3PZUA 2EG8A 1H61A 2YLAA 2E6FA 4JN6A 4KF1A 3QY7A 3B0UX 1H41A 3LHUA 1E4MM 2PBOA 2FB2A 5JBFA 3BC9A 4DBSA 2VELA 1BGAA 4JTQA 1C8XA 4YJ5A 3FGCA 1QWKA 4GH1A 4UFIA 3NL6A 3SURA 2BG5A 1XSKA 5CC6A 3C61A 4ZXOA 3I4KA 1X98A 3WFZA 3WG6A 2ZX6A 4RE3A 4GVFA 3GU2A 3POCA 2NV1A 4AIUA 1CGWA 2NX3A 3AS0A 4ALDA 4JYFA 3ID7A 3GS6A 5FJUA 1Q4NX 3GD6A 3R43A 4HOWA 4GLEA 2JIWA 4CQCA 3VUPA 1Y5XA 4DN1A 4L9ZA 2POZA 1ZL1A 3NIYA 3TYEA 2IKHA 2DUXA 2CBVA 4MY1A 3SY8A 3FAXA 4N9EA 4LCRA 9RUBA 4HN4A 3PWIA 3H22A 3F5KA 3VGEA 5HAOA 1IT0A 4D8AA 4GI8A 1LRNA 3O7UA 3WMBA 3W07A 1E9LA 4XZWA 2PURA 5E70A 4H2CA 3FAWA 1HFBA 3T9PA 1ODZA 5DXXA 1JNEA 2FFIA 3BAWA 4ROPA 3V5CA 4NNBA 4IG2A 3EWYA 3SUTA 5FIPA 2VC6A 2ZC8A 3QN3A 3UXKA 1X8CA 3GXIA 3GNPA 1FWGC 5I3GA 2XVGA 3S2MA 3M5XA 2JF7A 2Y5JA 1Z9AA 3RX2A 3CMGA 3IJLA 3MB9A 4U28A 1DXEA 4IP4A 2QCEA 1I4NA 4S3BA 3CM4A 3CBWA 4LUSA 1OYCA 4Y8FA 3FA5A 3MTWA 2G95A 3GSMA 1X97A 1XSIA 4UFLA 4Q4KA 3AROA 1HZYA 3OVGA 3VOGA 1W1ZA 5HWMA 3MKKA 4XD4A 5AVNA 5IOBA 4OU1A 2Y85A 4XD5A 3CL7A 5AC5A 2VYOA 4YIWA 4JTAA 1UKTA 1E6QM 3VDBA 4YTTA 4DWSA 2P53A 1B3ZA 1JUEA 1B9BA 1GOKA 3VFCA 5CQ1A 1JIBA 2PP3A 4GE8A 4LT9A 1X1OA 4PUUA 4L1XA 2BV9A 3B9NA 2V69A 1IT7A 1CXKA 4N9CA 2R6OA 4J3SA 1LL4A 2WKJA 1C91A 2P8CA 3PY2A 4EXQA 4OJYA 2JQXA 3AIBA 1ICQA 3RMJA 3UJSA 1MXDA 4AX6A 2YL9A 1CGTA 4P2VA 3RLHA 3MV11 3TIMA 1O1ZA 1J9YA 1WZAA 4I6VA 3MS8A 5LNSA 1Y7VA 2I9UA 1E9ZB 3AXMA 1YX1A 4GISA 4JNYA 4V1YA 1EBGA 3FEQA 4HU3A 3R8RA 4H9UA 4IGSA 3UG3A 3D6NA 4JDBA 1UR2A 1XRTA 2UWFA 2HEJA 4REQA 4N02A 2WM1A 3EKGA 3GR4A 1KFLA 2ZRUA 4O54A 4XAYA 4LWWA 3WH9A 4Q8OA 4JYEA 3RPTA 4MZ1A 3FJLA 3WFAA 3HQNA 1GQKA 1V3KA 1ZJAA 3E0FA 3OHMB 1QU4A 3WUFA 3THDA 2E5BA 1R2SA 4GI6A 5KITA 3GXMA 4JTTA 2PDBA 1F3TA 1XIBA 2XGZA 3E96A 1HGWA 2PWVA 1DOSA 4FI4A 3D47A 2G3FA 4PB4A 4WKAA 5I6SA 2OZ3A 1BYDA 4EPEC 3QC3A 3LTYA 1WV2A 1G1YA 3WLSA 5CLWA 4PCNA 1FVPA 3PR2A 2OQYA 5CC5A 4GGHA 3UT0A 1OD8A 3SGZA 3PTKA 2PZ0A 2A6LA 4GWEA 4FAMA 3DN5A 2PWEA 1GQNA 1ZHAA 2ZX8A 3WLHA 3RR1A 5FESA 3M41A 3WIJA 4O1FA 2QW5A 4AF0B 3CHEA 5CH9A 1C8YA 4KQNA 4BY3A 3IJ6A 4A3QA 3DX5A 3CWHA 1RBLA 4X63A 1A5UA 3Q58A 5CBJA 1TTIA 1F73A 2ZVIA 4MADA 1W91A 3A3HA 5CG7A 3H55A 3OZYA 8XIAA 1FWFC 1R5YA 4NRSA 3I7RA 1JYXA 5D2YA 4BA0A 3GHRA 3DCPA 3EWXA 4GBDA 3VXGA 5LNWA 4ZCWA 3VFLA 4UUIA 2GJLA 3EBVA 3IJ7A 1XBXA 4F2UA 3T07A 4KWWA 3TCEA 3ZR5A 5D03A 5AFDA 4Z2LA 1KCKA 2FJUB 4MUZA 1VPQA 4H00A 4JIPA 3TTQA 4A3RA 3DXIA 1RV8A 1Y8BA 4JTFA 1L6FA 3VMOA 2DZPA 3EOSA 4MY8A 7TIMA 1HP5A 1LLWA 4E2OA 2R14A 1J0ZA 3I68A 2DPEA 1A5SA 1SW0A 1J8VA 4P61A 3ARQA 5BMWA 2E5CA 4PB5A 2QUVA 3MANA 3WF1A 4QJ5B 3C2RA 1LF1A 3TONA 3CT2A 1E1EA 3MUCA 1WDPA 4D71A 3VD7A 2HJPA 2VFFA 4BQ5A 1R46A 1TMLA 1R8LA 1JG9A 4Y9PA 4KWOA 2BGNE 3FLUA 6A3HA 3H53A 3V5OA 3PG8A 2D2JA 4YVVA 4B92A 4IMAA 4UQAA 1A5CA 2WJFA 4O10A 4XIAA 1BRLA 2J6XA 3T2QA 5D37A 3K1DA 2PAJA 3WMLA 4I9JA 2NT0A 1HKVA 4JR5A 2REQA 4XTIA 4BJHA 5DT5A 4YYFA 1PE1A 2DZBA 2FYMA 3WEZA 2WLZA 3QH2A 1XM3A 2HK1A 1SGJA 2PDYA 4IICA 4K8GA 4GUHA 1ECQA 3E6EA 3E0IA 4GX8A 4BFAA 3THQA 2IPGA 3S5ZA 3WK2A 1C90A 3EYPA 1V3MA 4UTJA 3W7NA 2R24A 2VP8A 1F7BA 3RU8X 1KRCC 3L4ZA 3O2LA 4RKAA 2YOCA 3G18A 4QAWA 3T0AA 4GJ1A 3REQA 1LT7A 4UTLA 1VENA 4GQBA 4Y9NA 3UWEA 3INPA 4C6KA 3UPMA 1NSJA 3K13A 1B0IA 1SSGA 1EJWC 2WCAA 5EMKA 3CQ0A 4IFKB 1QPQA 2V5CA 4M1RA 4WR3A 3L5LA 6XIAA 3MMDA 2OYLA 5FKYA 1UZ4A 2G4JA 4TX6A 1MSSA 1YBQB 1I0BA 1Q7QA 1KA9F 1EIBA 1GWJA 1LDCA 3DHDA 3LNMA 4Q33A 1Q45A 5C9XA 1QI3A 6XIMA 1I45A 4JIEA 3QYSA 4DZHA 3GXNA 4KWVA 3UWYA 3C6CA 5EBAA 1P6WA 1JZ7A 3U6WA 3ONBA 3PK7A 3DFTA 3VIGA 4IXXA 1H1ZA 5AZ1A 3NUKA 2FB3A 2ZUWA 1ZS2A 3QSRA 1RJRA 1TZ9A 3A24A 4QE5A 4HSNA 7ODCA 4XB3A 4A6GA 4MWAD 1C9DA 3WLNA 4XAZA 4ZQCA 4IGMA 4QFUA 4V33A 3GXDA 1I8JA 2E6DA 3CV7A 4DLFA 2PDCA 3N13A 4WY0F 3NDZA 1TE1A 4LCSA 2R1NA 4NP7A 2PDQA 3KBSA 1M01A 1UKQA 1E1CA 1J93A 3CQIA 2CYGA 4ZGYA 4QROA 1BXNA 1QNVA 5FCZA 4ZO8A 2P5NA 2DT0A 5I3KA 1JZ3A 2J7BA 2XIQA 1OFEA 4R85A 3HN3A 4DB7A 1SJAA 4GQGA 4O0ZA 3LDVA 2VRJA 3CWNA 4LS0A 2XIJA 1KXVA 1Q8JA 4GINA 1PYFA 1H49A 2OGJA 1XW8A 3DHFA 5LZLA 1R3TA 4I5XA 3TOYA 3VZXA 4Z2HA 4C6LA 1EGVA 2YZRA 1ZB5A 3SB0A 3B8WA 2FZ8A 4J35A 3CS2A 3DESA 3WL0A 3FYYA 3PAJA 3AXXA 2ATMA 2VEIA 3R4IA 2WMKA 3AS1A 1Z48A 2NXIA 4F48A 3S47A 4RZ5A 5K3VA 1GW9A 3QMTA 3E74A 1Z89A 4DAFA 3PBVA 3FHAA 4Z1CA 3P80A 3CPUA 2PRHA 3C3NA 3O16A 1A0DA 2FJKA 5LKYA 4ICNA 1T96A 2UY4A 3BGAA 4P7QA 3JRKA 3PNUA 3IIXA 3HBLA 2PDNA 3NL2A 3CYVA 4YVXA 3WJXA 6TAAA 2DSZA 4HTBA 2W6RA 2GVJA 4M6UA 2NSXA 4F0RA 3IVTA 5EMLA 1B90A 5H8PA 3HZ3A 1QO2A 3ES7A 1Q2RA 1DHKA 3USZA 3FGCB 3PNZA 1FWJC 3WQGA 3CWOX 2CLPA 4MAVA 2EPKX 3LMZA 4O4WA 3L4XA 3EB3A 4J7RA 4DJED 3PJUA 4D8LA 2GQAA 5JH1A 2ZZ2A 3DYPA 1DP0A 4U2YA 1BG4A 1GYLA 5CJNA 3GU1A 3MUXA 2J7DA 3LG3A 2VENA 2ZC1A 1W9DM 2RHGA 5LIUX 3QGKC 3S1WA 4GO8A 1ICSA 3OVQA 5AHEA 2QV5A 2QDDA 2VUYA 5LNUA 3N4EA 1R3YA 4IOTA 2QCMA 4CD5A 1A0EA 1G94A 2I57A 2O7SA 3NA8A 3EWDA 5AZ0A 4HHMA 4O18A 1C93A 2F2KA 1FKWA 2NUWA 1E4IA 1CYGA 1VH7A 1RJPA 2QV4A 3L68A 3FEMA 2HBXA 4HA0A 1XPGA 1JUBA 1EHNA 3SFKA 4E8GA 2CLOA 2DVTA 2D0GA 2WZMA 3VMPA 2BGQA 4ZQOA 4R7OA 2ODOA 3QC0A 5I24A 5FAGA 4IG2B 5IBXC 4NUWA 1W1YA 1NOUA 1UJQA 1E6NA 1EA9C 3MT1A 1L0PA 1X38A 4AY1A 3N9SA 4OV4A 1VS1A 3ORWA 3UF9A 2OEKA 3FDGA 1AMKA 1ADSA 2MNRA 4XZLX 1ZZMA 4A35A 2VCCA 1W1B1 4C65A 4HCDA 3G8RA 3EWBX 2X8RA 2GUBA 3XINA 5LXEA 7REQB 2WMIB 2I9EA 4NI8A 2KZHA 1FBAA 2X16A 3VKAA 3FVMA 1W5OA 1AW1A 5FD0A 3UA3A 3WNLA 5I09A 1JF5A 3T05A 2OZ0A 1OIFA 3L21A 1YDYA 1FHLA 4AHOA 2QDEA 4ATDA 1GVOA 2F2HA 1QVBA 1YIXA 1S3HA 4H9YA 1WAWA 3SFWA 3W82A 5KETA 2H6RA 4YTQA 2ZTKA 3H2MA 4LUJA 4R27A 3MO7A 4WF7A 1TPC1 4H1ZA 3ZQ9A 2X7VA 3UESA 3DI1A 1KB3A 1Q3NA 1WYIA 5I23A 3NM1A 4JY9A 3SUUA 3C2VA 1TCMA 3G3DA 3OBEA 3WZ0E 3VA8A 3UG4A 3W7PA 1TMHA 2VX5A 5FA5A 2HTMA 1XDJA 3WNKA 1AZ2A 3FDKA 3QV8A 3W4RA 5HUPA 3MP5A 2FKPA 3G5EA 3SECA 3VO0A 3KZPA 3WJWA 3HQ1A 3VYLA 3A4WA 3RILA 4US6A 4V27A 4FR1A 2ICSA 3TUUA 2JIEA 5FEZA 3TZFA 3W29A 2XIMA 1PDYA 2WKGA 5LIXX 1WUEA 3QHOA 4QJ1A 1F6YA 4N9BA 5TNVA 2BGSA 2XIOA 4HMEA 4UNIA 3GG7A 4Y96A 3UGVA 3G1RA 4P8VA 5AVHA 1J0KA 1EC7A 4I5RA 1ITXA 4MWAA 1MWOA 3QQ1A 4MDOA 1BKSA 3LSBA 1TYGA 2XJ7A 1JDAA 3BGJA 2H8ZA 2EJAA 4DX3A 3ZZ1A 4H8NA 5DF0A 1V0KA 3GUGA 4O1BA 1G5AA 1A4LA 4MZYA 4CQ9A 1P0EA 4GGBA 3WUBA 1ZJBA 4WZHA 3TW7A 4TVCA 3SN4A 2RKXA 3A5FA 3SCWA 1NOFA 1N8FA 3HJZA 2Z26A 2EPHA 4RE2A 3LEPA 3LV6A 1FXQA 1EZ2A 2OO0A 2HBVA 3WD4A 1K9TA 1XYBA 1IT8A 5DY2A 1M7OA 3P6LA 4F0MA 2GK1A 4XWUA 1JI1A 1EQPA 3OLEA 4NYUA 4DYEA 3DAQA 1ZJIA 3M6YA 4BI5A 1OINA 2WVSA 4FOKA 4IMDA 1OJXA 1NDVA 4FNSA 1EJSC 2O7QA 3NQEA 4QNWA 1XRFA 5HINA 3HQOA 2Z29A 4JBRA 3B97A 3VE9A 1TQXA 3KCOA 1KRMA 3N19B 2KX9A 4I7VA 3BQ6A 1R6WA 8TIMA 2GGGA 4UMAA 2ATSA 3CEUA 2QPUA 3UWWA 1TPB1 4BF9A 3MI2A 1UR0A 3L5MA 1UBSA 3TSDA 2VR5A 3BDKA 4LCQA 3NR0A 1K8CA 1SW3A 1FCBA 1VBUA 1F3WA 3EAUA 5BCAA 3G1HA 1MDRA 2C19A 1CW2A 1N2VA 3KOYA 1KTBA 2WO5A 1X6UA 3W53A 5MF5A 5CBBA 3B40A 1EYWA 4HZMA 3RCNA 4U2ZA 4XKYA 4AZ7A 1MXSA 2VEKA 3E2VA 3K2GA 5I02A 4AVNA 2E8ZA 5CJMA 4DWDA 4Y9MA 5T8GA 4JTRA 3SBFA 4I7UA 1N8IA 4Z2KA 3W7GA 1H5YA 2A6NA 1XFCA 2WZHA 4O28A 1LL6A 1W56A 5CPQA 5A8MA 4FLOA 1A4MA 1MDLA 2W9MA 4DJEA 1UUOA 3LCXA 4LSBA 1LBLA 2WYSA 1PDZA 1HXJA 3GAYA 4AZCB 4P8XA 4HA3A 1LWHA 3SGGA 4KEMA 4CCZA 4GOAA 2BHYA 3GNDA 4HK5A 4ONVA 1PO9A 1YYAA 4UFJA 1K4HA 1CDGA 2E5DA 2BTMA 2XU2A 3PZ9A 2Y8UA 3U4AA 2YIHA 1MO0A 1WXZA 4B5NA 2F8QA 3IGHX 1RUSA 2FMOA 4Q4QA 4QXIA 3SR7A 2CFFA 4O1EA 2HROA 4RUBA 1QOPA 1OCQA 5A1AA 4FIQA 2YPIA 3VNMA 4OOZA 2QCCA 4EOUA 1PWMA 3HB9A 3EOLA 2VEGA 2CLLA 1K77A 2GOKA 3MCNA 5FJTA 1XWYA 2X2GA 4YN5A 4PRWA 5K4ZA 2C8NA 1MI3A 2O0TA 3LMYA 4CNSA 4GY1A 3S5YA 2YDAA 2PWFA 3ARYA 3GG8A 4DM2A 2HMCA 3GZAA 3M43A 1Q66A 4IP5A 2NWSA 2REQB 4TMCA 4D6DA 4RK8A 6ALDA 4NKCA 4IISA 2D24A 4W84A 1PPIA 4I8YA 3KW3A 3NQAA 3SIZA 3H4WA 1JQXA 3R0KA 2XINA 1SZEA 2QJIA 2B7OA 3D46A 2A7PA 1MYRA 3CPRA 3CUXA 3BLKA 3VINA 1TFVA 3QKZA 5AY7A 3QBUA 1DJGA 4MB1A 3MVTA 1JD7A 2FDSA 2PGRA 3B05A 2AMXA 4EAMA 4RXFA 2WQDA 4EWND 1XIEA 1HX0A 3LU2A 4GUGA 3DI0A 3WH6A 1JVNA 4AD0A 4FZIA 1BG9A 5CAHA 2QCDA 4BHYA 1Q6QA 2JF6A 5HA7A 4H7VA 3VGDA 3OJGA 4XAFA 5HR6A 3N04A 2XSBA 2Y5SA 1DWIM 2P76A 1HJSA 2Q8XA 4TIMA 4KEZA 4R53A 1QATA 3P5ZA 3MUZ1 5FACA 3K1GA 4Y7EA 4BQ4A 1Q6EA 5JIWA 6REQB 1LYXA 2WWCA 2OELA 5BRBA 3SCTA 4LY8A 4GVIA 5A5WA 1QNPA 4MNLA 4LUYA 4S3AA 4AEEA 4RX0A 4GPNA 1W2PA 5HXMA 1RH9A 1JGMA 2VC9A 5CPTA 4X0VA 2J9ZA 2OX1A 3VOCA 1J18A 2D73A 2O4QA 5C54A 4Z1DA 3GKAA 3LPOA 3PBGA 1ZBCA 2XH4A 4HSOA 3GC4A 3OEXA 2ZRXA 4B5XA 1MQRA 3IUDA 4UTTC 2PC4A 3W87A 1GOMA 3F2BA 2OT1A 3K4AA 3TX9A 1TELA 3VOIA 5HMEA 4RCXA 3EPOA 4JDYA 2NQ9A 4KGJA 3LQLA 3LHVA 2X40A 1OCNA 2AGTA 4HCHA 3ZVIA 3LENA 5AECA 1JDFA 4E2VA 3RX3A 4ZZ9A 3QY6A 1OC6A 4HZ8A 2HE8A 4MYAA 1W6TA 2MUCA 4UTKA 1ISWA 3KVLA 3PFRA 2OLSA 1ZAJA 3QVQA 4YS1A 1EGZA 2GSEA 1FRBA 2Z0IA 1P5BA 4WY0B 3HG2A 3BOLA 1REQA 1SQ7A 2WSRA 1G4PA 1FDJA 1WKFA 3WX7A 4O53A 2BVWA 1DWFM 3OPSA 3PSWA 1DQXA 3DC0A 3C0LA 3STGA 4S3GA 3H2OA 3WEOA 5FF4A 1RLDA 3MMUA 3QKEA 1EF2A 3KVMA 4PMRA 4DUOA 1KM1A 5A2BA 4AIOA 1FH7A 3EWCA 1Q65A 3NVDA 1AD4A 3C2YA 1QOQA 5A2CA 4F2TA 3R8GA 1GW1A 3WH8A 1LRQA 4IF2A 1B54A 1GK8A 1QOXA 1AVAA 4UTWC 4E6MA 1N55A 3L2LA 4RE4A 5DCDA 3GG0A 1MW3A 3WK0A 3FS2A 3PTQA 3VABA 3TU9A 3B8DA 4L61A 4JIQA 5M17A 1V7YA 1BYAA 5FEWA 5EA9A 3LPGA 1KW1A 4FMVA 2XVNA 4RDWA 3DFQA 3NZRA 4E8DA 2SFPA 3O3RA 1KBKA 4JTGA 1JZ6A 1IZJA 2FVLA 2YL6A 2JBMA 4PSRA 1LZOA 3DEQA 3I6RA 2CXEA 1GUVA 3EB4A 4RPPA 5E6ZA 1H60A 4FEZA 2OLHA 3F03K 2NT1A 3BPWA 1W9UA 4JTCA 4QAIA 1CWYA 5K9XA 1QK2A 5A6TC 4NASA 2O4MA 4CD8A 1TG7A 4Q8NA 1NH6A 1AQ0A 2NXGA 1VPYA 1K7XA 3W1PA 4BQ3A 2GQ8A 3CB8A 5I3HA 1EF3A 2DW7A 3ZR6A 5LA1A 1X1NA 4PUJA 4IIGA 1R3QA 1UH2A 4O1AA 5CC7A 2BNJA 2FPVA 2ZYFA 1AQFA 1LQ0A 2PDKA 2B0MA 3EX3A 3PAOA 2W62A 5DMLA 5JMUA 2V6AA 4ZQRA 1VFTA 2GSHA 4NHVA 4EACA 1CXEA 4JS3A 1ZALA 4B16A 5HOSA 3CUZA 4JFVA 3EWWA 1PKMA 1H1YA 1RQEA 3O6DA 4JHOA 4L9YA 4LANA 4DF1A 4UZSA 5DRCA 1PBGA 1KBIA 3LHWA 3F4DA 2Z1KA 4QDPA 1KTCA 5HJXA 3KL0A 2VWSA 3H4GA 2VXNA 3LK6A 1D7FA 1FWWA 3SN0A 1OG6A 1VFLA 5DO8A 3GM8A 3UNTA 3MUAA 4AYGA 2CBIA 2L5HA 1VFUA 3HPFA 5K7JA 3M0LA 3GR8A 2QS8A 2YDQA 1ZRQA 1VQTA 3PZVA 1K7EA 1XIDA 3WKZA 3BJTA 1L6YA 3RF9A 2OO6A 2VQTA 3DIPA 3RO8A 3OG2A 1P0KA 2PLKA 3V1PA 3CZGA 3I3EA 1GVQA 4PMOA 2Q8LA 1RZMA 4A22A 3KBJA 4GQ0A 4ZL1A 1CGYA 3VDHA 3CIWA 3J7HA 3NJ3A 3GH4A 4RDZA 2E8YA 3A47A 4OBSA 5IDIA 4MTVA 3ITCA 1DORA 3F1QA 3VKJA 5E6YA 1K6AA 4P7NA 4IUOA 4XZHA 2OT0A 3MCMA 2GLKA 3SZ8A 3PB0A 3DKLA 1FQ0A 1BF6A 1QW7A 4HZ6A 4ZR8A 5A3HA 1NEYA 5I07A 3A9IA 5DBTA 3S9ZA 4HPHA 2XVPA 1BKHA 4OHQA 5EL1A 2R8WA 4ZB5A 1CGUA 3WLIA 3BO9A 4QIUA 1W8GA 3VGBA 3NQVA 2NX9A 4FF5A 3GDKA 3E5PA 3PUEA 4FNTA 5CC3A 4JFTA 3HJEA 4LF1A 2R1LA 1XUZA 5TIMA 1AG1O 3WLOA 4TOQA 1ADDA 1U5VA 3DFNA 1HJVA 4CVWA 5F2GA 4S3CA 3CYJA 2X09A 4KCUA 1F5ZA 1BEUA 1GHSA 3EMZA 1EJ7L 3AHTA 4PCFA 1V08A 3LBOA 1XICA 3K46A 4LAKA 1F8MA 1H62A 2X30A 3MO4A 3MSGA 4FLSA 1ESWA 4XG1A 1GOXA 1V79A 4HJFA 4W5ZA 3WH5A 3N11A 1V0MA 2CWXA 1I0DA 1RD5A 1PUDA 1UD5A 4P7LA 4XAGA 1F74A 1NQ6A 3WDHA 4ZXLA 2XPKA 4C6PA 1JQVA 3W81A 1UD4A 3EDEA 2ZWZA 3QLDA 2PLMA 2ZA2A 4K8EA 4UQEA 4AEOA 3S5OA 2QR6A 4PC8A 1TV2A 4WRHA 4H6RA 3NYDA 4MY9A 4CUCA 3UPWA 3C0SA 1VYPX 3UP8A 3G1VA 4LS1A 3NTYA 3O15A 1S2UA 3FSUA 4MVAA 3N2XA 3UQNA 2Z24A 3VIIA 3V3WA 3F4WA 3AISA 2I5IA 3B0VC 4JCMA 3W1XA 2NV2A 1UP0A 2CPUA 2XFFA 4W9TA 1AH0A 2FQIA 4CN1A 1ZJHA 2V63A 3FFSA 2GK1B 3PBYA 4F4RA 3UERA 3L2MA 1XISA 4RDYA 3TTEA 2J47A 1EP2A 3L2IA 3BGGA 4TVUA 2JE8A 3PTMA 4LQ1A 3VE7A 1US2A 1XGDA 2DZAA 3NSXA 4Z08A 2ZUNA 4FX6M 4MYXA 5A8NA 2PTWA 5I2UA 3H7RA 3JR2A 1XYCA 1CB2A 4DJDA 1V51A 2PWDA 4GIYA 2X41A 3B8VA 3JU2A 2P88A 4LUTB 4B5WA 4O15A 4B90A 2FZDA 1RVKA 1R87A 3P14A 2QAFA 3WLRA 5ABHA 4QSHA 1L6WA 5MKGB 1V3HA 4IMEA 3BOFA 3BW2A 4CU6A 2Z2AA 2Y7GA 5CXPA 3KX6A 1OFRA 4Q8QA 1HVQA 3MKCA 2XSXA 3PTDA 1TO3A 2W79A 4LW7A 4J28A 3NL5A 4J3WA 3B3DA 3WH7A 5CZSA 4EPBC 3QQ0A 5XIAA 1FDYA 3BJFA 3URBA 2A5HA 4Q8WA 3BH4A 1SR9A 2DH3A 1QJWA 3DFPA 4LVGA 4O0QA 1XPYA 1R7OA 4RL3A 3F4VA 4IUGA 4IJRA 4W88A 4X9SA 2OG9A 2EXOA 3MKVA 3GW0A 4W8AA 4IZGA 3GH7A 2GVEA 4EF8A 4GUIA 3ZFHA 4CQAA 1YE6A 1EDTA 1L2UA 1UR9A 3WELA 4P5UA 2YLLA 1V3LA 4J2PA 2WNQA 2JGYA 4EPDC 3GG1A 3B06A 3ZJ7A 1GOWA 2AAAA 1V3JA 3STEA 3FK4A 3GH5A 4AMAA 2GDUA 4B4HA 4JZ5A 4C6JA 4HZ7A 4BS0A 3AHVA 4IQDA 3UZYA 4NQ1A 1XXXA 3WJYA 1H5VA 1H7RA 2VOTA 1DJQA 5AHIA 2UY5A 3PB2A 3VGHA 2PEVA 3NVTA 4ACZB 4QTGA 4A2SA 5FJRA 2C1GA 5DX7A 2W92A 4Q4RA 3TQ0A 1TPVA 2X1TA 3BURA 1XH0A 3N6JA 1XRSA 3M4HA 3UEQA 1MUWA 3MWAA 3KOZA 4M51A 1PTDA 3UBPC 3P60A 2W91A 1K8ZA 3S9YA 2OODA 4MB3A 3SEPA 3I65A 5HNNA 4O1DA 4G1NA 1SMAA 1E72M 1AW5A 3GXTA 5KTLA 1VYSX 3BQ5A 4V28A 1GZJA 1DJHA 1WNOA 1Z32X 4QDWA 3VZYA 1CT5A 1V02A 3SIMA 4DNHA 1YNYA 3RAOA 4S3JA 1YDNA 1FHDA 1LG1A 4AW7A 1FFRA 3G2GA 3G0XA 4G1KA 3W7OA 3VOFA 3H2NA 1RA0A 4C5YA 3VNIA 1QO5A 3KEHA 3ERPA 2ESCA 3VD3A 4J27A 1UJPA 4IMFA 3RN6A 4C7FA 3EDJA 2WZTA 3GB6A 3RCMA 1AL7A 1JD9A 4LAUA 2GJNA 4S38A 4WXZA 5IHSA 3LLXA 4OUEA 1WOAA 4M19A 4IPNB 4KIEA 3IWPA 3SW6A 2J13A 1Z3NA 1RR2A 2C0HA 3CHDA 2V0TA 3FOKA 3S1UA 4U5IA 4DO5A 4CQ8A 3RJXA 1PL9A 3WO8A 4AMCA 3DBPA 3WK3A 2BOFX 3DENA 1TJ2A 1U30A 3NXFA 1QFEA 1AZ1A 3N2TA 4KPLA 5DANA 4IMGA 2ZUTA 1MEWA 3IJDA 2J6VA 1YTDA 4OE7A 4YMZA 3BLLA 2R1KA 3SO7A 1GHRA 1K1DA 1R3SA 1EB3A 4WIWA 3QV6A 3TNBA 1BVNP 2YCKX 4ATWA 4HHLA 1V8EA 4XISA 3IUIA 3C86A 1MNZA 1MXGA 5HMDA 2OYKA 2V5BA 2TMDA 1J2WA 2V8ZA 3AMKA 3RPDA 3F2DA 2CZ5A 4QQ3A 3RRXA 2BOEX 4S1FA 3WF2A 4ZB2A 2BVYA 3GO2A 4YWSA 1TA3B 3NWRA 4KERA 5T9BG 2CLIA 4XVDA 4ERGA 5AN7A 3NPXA 1E43A 3THCA 1Z42A 1LWJA 2VR2A 3SUVA 1QPOA 1MW0A 2PGEA 4H6EA 2PGFA 2AL2B 1YADA 3FCPA 2DIJA 1MW2A 2VFHA 1JPKA 1TJRA 5BROA 5FF3A 1M65A 3WQCA 1DJWA 5A8PA 4ZE4A 3DFOA 2AQOA 2NQ5A 1BQGA 3O1NA 3W1NA 1S5VA 5HPCA 3H2FA 4R88A 4FALA 4M7TA 2QAPA 1MZRA 4PMYA 1B3VA 5A8OA 1J5TA 1HO1A 2NSOA 2IW0A 5D04C 4H9ZA 1K3UA 4FS9A 4PMQA 2Y7FA 3G6LA 2GWGA 1DXFA 1MRQA 4D8ZA 4E0CA 2BHUA 3APYA 1U1JA 1L6GA 1E40A 1SVDA 3QTPA 4HP5A 3H7VA 4AWSA 1VFOA 4IMCA 1J01A 1P4CA 3UYCA 3B4YA 4H7ZA 2GPTA 4JN7A 3STPA 3GYEA 4HNLA 3CC1A 4MLJA 4XO6A 2OX4A 4A8IA 1W5QA 2G3NA 3KLKA 4LEFA 1HG3A 2CZEA 3RM4A 2YXOA 1ZP3A 3OZMA 1IZCA 2V3FA 5HJLA 3LCHA 2Y70A 4HJWA 1FWIC 2PI6A 3EEGA 5REQA 2ZTJA 3P7YA 5MHBA 1ISYA 2Q71A 5M03A 1W1TA 5C9RA 3SCRA 2OTDA 2EGZA 4DJFC 1TVPA 3NQDA 1QI4A 1GQIA 1XX1A 1GKRA 1QWGA 1W3HA 2TPSA 3BLOA 3URNA 1A80A 2P1FA 1V6VA 4Q4SA 1EX5A 1P7TB 4ZOAA 3IJ9A 1E6ZA 1UA7A 2CU0A 5A8QA 3WQ5A 3R94A 2C79A 1ZY9A 1LRTA 1ZAHA 1D8CA 2VC5A 3MJMA 3DYOA 2GJXA 3ANYA 3SUSA 1R9XA 1DE5A 2CBUA 3W74A 1BWVA 3WLKX 1O1HA 2BX7A 4QP0A 1DPMA 5E9XA 1TX2A 5C7HA 4I9AA 4GA8A 4GMEA 3ABQA 3UXLA 4AU0A 4M6PA 4GY0A 4MNJA 1XL9A 1YNQA 1LQ2A 4ADTA 2WJZA 3SRDA 3XIMA 2V81A 3VIHA 1M6JA 2J62A 3TWBA 4O8RA 1W0MA 3QRHA 4XZNX 1EZWA 2HDJA 4GI4A 3SCQA 3S2JA 3V1HA 3W6YA 2CITA 3SSJA 1TMQA 4WVXA 1W37A 4R3UA 2W67A 3G1FA 3U5YA 3M0HA 1A5NC 1M03A 1EBHA 3GUWA 3L4UA 3ARRA 4GRSA 5H8UA 4O8AA 4LY4A 4MB5A 3OQEA 3CAQA 3I7QA 1NFPA 3SQSA 3JZEA 4QE1A 1PCKA 4IPIA 2HWGA 3R13A 4QHRA 2PDIA 4ZOCA 1MQPA 4B9YA 4IQLA 1BSLA 2BP1A 3Q94A 4YNGA 3AOFA 3MY9A 4PB3A 4IIEA 3A12A 1MMFA 2WCSA 3N6HA 3QF0A 3PS7A 4YCOA 5DEZA 5I03A 2NUXA 3V0SA 1U2YA 1KRBC 3E1F1 5JU6A 3IGXA 3WQOA 2QCHA 1UA3A 3RCYA 5JUVA 1M9HA 4HB7A 4BEQA 1GEQA 4NRRA 4FF7A 4AIBA 1HJQA 4PFMA 3HGJA 2IQTA 5F4XA 5L6UA 5PTDA 2Z28A 4LOCA 4TX8A 4GKLA 4Q3MA 3KWSA 2VD9A 2YCLB 3L4TA 5I7GA 3PPFA 4AD4A 1HL2A 2J8GA 2ZZ7A 3O9NA 4F9JA 4DIAA 3C2OA 1W3JA 1ECEA 2IQDA 2NWRA 5DMNA 3U5UA 4HTYA 3BAYA 1W3NA 2YFOA 3K5XA 1PTAA 3NQGA 3UGRA 3M6DA 3BW3A 2EPOA 3BVJA 1PB0A 2V9DA 2FZBA 3BANA 1QW8A 3CHVA 1JZ4A 4GVHA 4IJCA 3VKCA 3KDOA 4QM1A 3KE0A 4QS5A 1R2RA 4OT7A 3MHUA 1NWRA 2G5WA 3BAIA 4L56A 1TREA 1VEPA 1WDDA 3TROA 3RRAA 1FWDC 1UWQA 1E6PA 3GDBA 3TK7A 3W27A 4O16A 1S1PA 1YLVA 1CECA 4ZOBA 3ZM8A 5JQ9A 1OX4B 4JTDA 3QFEA 3LRLA 1A3XA 3S2LA 2EQDA 2UV8G 5KSWA 1OBAA 2YCJA 2YCEA 3MZNA 3A4AA 3N4AA 1KBJA 4DJFD 1UWIA 1EYEA 1HJXA 4KMQA 5EGRA 4AHQA 4NZ1A 3GDLA 1TV8A 5FSDC 1W3KA 1U22A 3V18A 2E6YA 2H9AB 3SJNA 4D6JA 4D6HA 1KM6A 3HGRA 1UH4A 4M8UA 2RGLA 3UJRA 1XR2A 3UJEA 2PDHA 1RALA 5FF7A 3VGFA 4PMXA 1KWGA 3VILA 2PCQA 3OLDA 5DQPA 1BGGA 3SN1A 2DJXA 4LC6A 4UOJA 5HR7A 1B1YA 4HNVA 3SI9A 1S1RA 3EPMA 4J40A 2F38A 2F6KA 3EKLA 1WOBA 5TQLA 3FXGA 2CHOA 2PDUA 1Z8AA 1L2QA 2D0FA 2V67A 1OC5A 2J74A 3GXPA 4OECA 1HKKA 4MOZA 1RQBA 1XQLA 4HT3A 3OW1A 3F4NA 4A3HA 2ALDA 1PYMA 3N29A 3NQBA 5GNXA 5D2VA 4L5ZA 2VX6A 3M47A 1S2VA 1FY6A 4F0KA 4FX7A 2I16A 4CQBA 1TRIA 3W7JA 3S6DA 1UKOA 2VVSA 4PTXA 1JPIA 2Q01A 1M53A 4UOQA 4H01A 3IEBA 3L12A 3W72A 1QHOA 5CPMA 1VRXA 1H1NA 1JRCA 3VNKA 4A05A 1YPFA 2EAWA 2FPTA 2ON3A 3DC8A 3LERA 3EDFA 1I2OA 4UXDA 2QYGA 3AXIA 1AUSL 1R38A 3MA8A 4W7WA 3OA3A 4KH2A 3ZJ6A 3RLGA 1JUKA 3C8NA 1UC5A 3B8IA 2ZXBA 1XFBA 4UR7A 1O68A 3ALGA 1V93A 5C9WA 2TYSA 3TA9A 2JKAA 3MW7A 2PWHA 1O4UA 1C7SA 1X96A 4RV3A 1O66A 1VJIA 1PEZA 1WDWA 3W70A 1TWIA 3G1DA 1NWTA 3QHNA 2YBTA 4NAEB 5HQMA 3GX9A 4YTSA 1IEVA 4IPPA 2C3ZA 2WSYA 2VZUA 2FTYA 1UD6A 3L67A 1GVFA 3NQCA 2JKEA 2J9XA 2OKTA 4K36A 3M9YA 3QR1A 1OD0A 1GPFA 1EFZA 3LNPA 1KXHA 4N0RA 5EMUA 2VZOA 1OABA 3W2UA 3A4JA 3N6QA 3PC0A 1KCZA 2VFDA 3S5NA 4DNMA 4P7OA 4AB4A 2XWDA 3C0QA 1EH9A 1M3UA 4S3DA 1R3WA 4GZIA 3LN3A 1PX3A 3EMCA 2BMBA 3ZIZA 4N4QA 1MNSA 3QQWA 1Z44A 1B4KA 4TV6A 4E4PA 4QJ4B 3KRSA 3VIKA 3ES8A 1OFDA 3EZ4A 4MFEA 4LYPA 1BYCA 1ONEA 3NGFA 1KM3A 4DUXA 3AIRA 2OSXA 3BG3A 1JYWA 3ITOA 4JIHA 1G7VA 1PZ0A 1B57A 2WXDM 4CNTA 4PE8A 1ZTVA 2BZNA 4UQBA 3S4TA 1UR1A 3TLQA 1MW1A 2BHZA 3HG5A 3KTSA 4JICA 2PTZA 2DJLA 3VMNA 3ARZA 3RK8A 1B4EA 4OBRA 1GJPA 1T5AA 4H2HA 2BVTA 5EFDA 4C1LA 1KFKA 4ROQA 1WPCA 1J0IA 2G4FA 3WQ4A 4QR6A 3I6EA 5F4SA 5GVJA 3FYOA 2HVMA 3U3HA 3SCPA 5LXXA 3U7VA 1H51A 1X6LA 4NSBA 4HMDA 5ABEA 3AU2A 3EOEA 5JBDA 3E38A 1PAMA 5KZEA 1XLLA 4N6EA 1NFBA 1A5KC 1Q7MA 3S1VA 4K1GA 4JX4A 3IACA 2ZBTA 3VOHA 2ZWYA 3TTYA 2Y2WA 3E5BA 4I5UA 3NPUA 3GBEA 5J5DA 1C7TA 2ZZ6A 1EEPA 1B2YA 4GYJA 4N7QA 2DUAA 3LCGA 3RM8A 4QCFA 1KWKA 4F40A 2WVVA 1Q85A 1P1MA 3IJ8A 3M64A 1V6UA 3EEZA 1YTKA 4G7EB 1PZ3A 1XBVA 4KW2A 4ZFCA 1XCXA 4PN2A 1A0CA 3WD2A 3ECQA 4KGLA 4C6DA 1X7FA 3HPXA 3U9IA 2VRKA 1QPRA 1K8YA 1GJWA 5AHNA 3QZAA 2E9MA 3AXKA 1XLIA 1DKWA 1MRAA 1W3LA 4B15A 4J3UA 4LYKA 4W8LA 1SZGA 5IM51 2CW6A 3DYMA 3FHQA 3GVQA 5H1WA 5FL1A 4NZ4A 3LSCA 1E3XA 3KWXA 1TJ0A 1PS9A 3P74A 3E9AA 3RPMA 1XIHA 2A3AA 4DJFA 3GYCA 4K8HA 2CBJA 2ZA3A 2QIIA 4MKSA 1TX0A 3B0YA 3MP4A 4W93A 2OWWA 2V3GA 4LUIA 4EXAA 4WGXA 1TV4A 1G4EA 3OOQA 1PZ1A 3EX6A 4GCXA 4KCTA 1P0NA 2Z7KA 2PZNA 2QUNA 3LCIA 1I2RA 8A3HA 4GVGA 4Z17A 2CKRA 3HPAA 4OZOA 4EANA 1GYNA 3DFHA 4K39A 1E4NA 1AH4A 2PDFA 3WQPA 1VJZA 3D0CA 1W9PA 2FVMA 1F05A 1SFLA 4Y6GA 4JQ4A 5IFTA 4TUFA 3LD5A 2NX1A 1X39A 4M6QA 2ZZ4A 1NP2A 1AD1A 3BG9A 3LBCA 2J78A 3BLPX 4AD1A 4UTIA 4U3AA 1XRVA 1EC9A 1S2TA 1XLDA 2VM8A 2VFIA 4K7VA 4YWIA 3P82A 4IT1A 4L4LA 4IP7A 5REQB 2YCIX 5CEWA 1S2CA 3CH9A 4QISA 4Q8VA 3TFXA 3VDCA 4A8NA 1ITUA 1H50A 1IYXA 1QBAA 2W0UA 3ITTA 1BPLB 5H91A 1LG2A 4UNLA 2Z1BA 4BR1A 2VJXA 2WHMA 4WOQA 4JPGA 3NYZA 4LC8A 3L5AA 4QCEA 3GTXA 3LCWA 4EX4A 3GZ3A 1EUNA 3ZVHB 3O6YX 3W3OA 4G56A 4RXGA 3CB3A 1X7IA 3WEMA 4IX2A 1UZ1A 4B2DD 1J0YA 1H11A 1AA1B 3PUDA 1W32A 1H2JA 1LUCB 4LAOA 4NAFA 4MAZA 3MV01 3LPPA 4C6MA 3FKRA 3TYAA 5CKSA 4JFSA 4H9TA 2EJ1A 3I10A 1KBLA 3NQ8A 4US5D 2CHNA 4JKMA 1TJPA 5D9OA 4JTUA 2RJHA 4WLCA 3SAZA 1OZMA 3EA2A 4LB4A 1RY0A 2WPGA 2NZLA 3EWUA 1QPKA 3LHYA 4B4FA 4ERIA 5BRQA 3ANVA 4YHGA 3MSRA 1GKQA 3V4BA 3EXSA 4E5TA 3L65A 3RHGA 2ZQ0A 1ZBWA 4RNFA 5BXRA 2PDLA 4GJIA 5ABGA 3P0XA 4JX5A 4ORMA 4O0KA 3EMQA 1FX6A 4K1WA 3G77A 3VPLA 4QX4A 5CBIA 2PWUA 2Y7EA 1KCLA 2X1IA 3ENLA 3IAQA 1E9YB 4HCLA 4L6HA 4GYFA 4NJIA 5G1YA 1O5RA 1PXGA 4QITA 2QJMA 3KHDA 4R9XA 3UD6A 2PDGA 2EG6A 3YPIA 1WBJA 4AXNA 5XINA 3PPCA 1LBFA 2OU4A 3RYSA 3L66A 1D9EA 3L9CA 3AMDA 5AYIA 3S5SA 2C15A 5DELA 1WCGA 3BZGA 1KGXA 2G96A 3W01A 3TN4A 2IPWA 4U3CA 3W7IA 4CNNA 1KKRA 4HK6A 3CV2A 2IKJA 2GSJA 4P7RA 3RITA 4POCA 1HVXA 4IJBA 1TZ7A 3VNDA 1RVGA 2J88A 2RUSA 1LLZA 1U1UA 5K2ZA 3AU6A 3CLMA 3WNPA 5BWAA 3BV4A 5LA2A 5BXTA 4IGHA 3GTFA 2GJRA 2ACUA 2GOUA 4I9MA 3MWCA 4PBGA 4NNCA 3WFLA 1XBZA 5HMFA 2B7QA 1XIIA 5F7UA 3OO2A 3TN3A 5I3FA 5HPOA 3UETA 3QV9A 4AZ5A 3CTTA 4H8VA 5KINA 3B03A 2ZUMA 1EPVA 1LM1A 1FFQA 2BWGA 2E1DA 3KBVA 4LV4A 3A3WA 3AMCA 4MJ2A 1DXIA 3H23A 1RP8A 3CL8A 5T91A 3U8GA 4OV9A 1UKSA 2WAGA 2WMFA 1CPUA 4JTLA 4X60A 5D05A 1W31A 5G4WA 3UXAA 1JFXA 1V6XA 4J3XA 1VFFA 4HIBA 2X42A 5BOFA 2XVKA 3OBAA 3T6CA 1E5NA 4H3DA 1KFEA 5IRPA 3W7MA 3P5YA 4ZE5A 3PP7A 1K7FA 4TMBA 5DY3A 1U1HA 1JYVA 1V6TA 3ME3A 3TLLA 1GQJA 2VFGA 3AALA 2XH7A 4ICCX 3DUGA 1X1ZA 5LHEA 1QK0A 3TH6A 3HPSA 4WDXA 1AFSA 3BMXA 1D3CA 4AUBA 1WZMA 2VDGA 3BAXA 4FXSA 1ME7A 3OGVA 2NQZA 3GDRA 4WDTA 4Q22A 3NNTA 3OVPA 3NDOA 1WKEA 3LV5A 4AXKA 4QS6A 4DO4A 3PUOA 2GUUA 3N1AA 3R2GA 2UY3A 4XZBA 1IGWA 3ZSTA 3QR0A 3N2CA 5LGZA 2PU1A 1RD6A 1W1IE 5ABFB 1QDSA 2XSAA 4E38A 4RR4A 3CUHA 2DZSA 2BXVA 4GUJA 4JTIA 1SPQA 2Y89A 3MSYA 3E02A 3K8LA 3I7SA 5IXEA 4AWEA 3VM5A 2IQ0A 1PIFA 3TYDA 5EB8A 1BYBA 4QJ3B 3U4FA 1JPDX 3LUTA 2ONEA 1P1XA 3TC3A 1XJBA 2X2YA 1OGGA 2HS6A 2C16A 4M5PA 2CEQA 1XG4A 5C2XA 3UYIA 2F6XA 1XLFA 1IEXA 2QQ6A 4QDMA 1F6PA 5DT7A 3H12A 3H21A 1BVZA 1GVYA 2OFJA 2ACSA 2WVTA 4BWLC 3VNJA 1NIUA 1IWPA 1Y5WA 4B91A 4CCDA 3IAPA 3DH7A 1XQKA 2V5JA 4L4PA 1SFSA 4AVOA 1IWAA 3CK5A 4LU0A 2WC4A 1BFNA 1GJUA 4JY8A 1IIGA 2OSYA 2GGEA 3N14A 4XD3A 4HMCA 4Z42C 4Q6JA 5EMJA 5LIKX 3TYCA 4TQTA 2A3BA 3UJFA 1G67A 5C6MA 1ZENA 1XKJA 1NDZA 4AHPA 1RHCA 2JEQA 2PA6A 3KBNA 3VCRA 2VFEA 3TCSA 2ZZ5A 2UY2A 3WLTA 4B5TA 4US5A 2BSLA 4L6OA 3W6MA 3HURA 3CU2A 3R6IA 3AQUA 1UROA 2J77A 1DIKA 4E4UA 4DZIA 3GVRA 1UWAA 1PIGA 4JNZA 2Y88A 4FNUA 5G2WA 3UZXA 3BLDA 4BCEA 3O0FA 3BTNA 4CCCA 4FXRA 2I1OA 2GZXA 3TVAA 1UASA 1S5TA 3L0NA 1F76A 3O0KA 3UR7A 2BDQA 2TSYA 2W63A 3ABRA 4I6KA 4ADSA 3ZS4A 2Y8KA 3BARA 4PZVA 3W7DA 4LV9A 3DG3A 7CGTA 2YW4A 1ZU8A 3IV3A 4XO7A 5KMYA 1A3WA 3W86A 5AHLA 2QIWA 2WZIA 2F61A 4QG6A 1KTNA 5D2TA 3W2KA 3WK1A 1QNRA 1IXQA 1KLZA 4XBKA 4NT0A 4UTFA 4Q7IA 1SUXA 1FWTA 4OIFA 4HGXA 3QGAC 4GYKA 3UW6A 4GD0A 1PHQA 1QNSA 3WBEA 5EMMA 1JCYA 4PTDA 1K9EA 4GYPC 2JFEX 3PBUA 3BK0A 1TPEA 4G6CA 5J04A 4M1BA 2DV0A 3A6OA 4LBRA 3UCDA 2OJPA 1BSIA 4DLMA 5J8LA 1VHCA 3K8MA 2R1PA 3PZGA 5AKQA 3TQPA 3MMWA 4JKKA 2XVLA 3TYUA 4IQJA 3B9DA 3NQMA 1UHVA 2VVNA 5C9ZA 8CGTA 2EHHA 3ATYA 3ZWSA 4DWSC 2YKKA 4GCAA 1EXBA 1IEWA 2YB4A 3EXTA 2G41A 3W38A 1W5NA 1KNWA 1VCVA 4NIRA 3RG6A 3M0YA 4L4MA 1MEHA 4HPJA 2V2HA 2PF0A 4M6VA 4X3ZA 3IS4A 4H41A 4WUIA 5GNZA 2XH2A 4W85A 4MB4A 4UMBA 5AYZA 3VM7A 2QCGA 4NX0A 3SY1A 4HVXA 4RV8A 3A23A 1NM9A 4RJEA 5K4XA 4PUEA 3GU9A 1IIHA 2DZXA 4MJMA 4IIBA 3Q2DA 3ZLFA 2QVNA 3FA4A 4L80A 4KRTA 4LALA 2NQJA 4HYWA 4CD6A 4AF0A 2VMFA 2WNNA 3K4WA 4C5ZA 4IFRA 4I8DA 4W87A 1EQCA 1WAUA 3BAKA 2CKSA 2G3JA 2PU0A 4DBDA 1XH1A 3FY1A 1VIWA 2VHLA 4P8UA 2C91A 3GVWA 5FJJA 4KCVA 1UPPA 2D2HA 4JGDA 2CLHA 3EX2A 2GUYA 3KZSA 1P6CA 1ZSXA 2V38A 4Y90A 2DZVA 3VK5A 1O12A 5BRPA 1NTHA 1A47A 3E2SA 1W1VA 3H2CA 1B9ZA 3TE9A 2V5KA 4PRTA 2YA0A 1OHLA 2V30A 3T4WA 4S3KA 4C6NA 2PFHA 2G3IA 1H7XA 1FXPA 1FOBA 5HNTA 2XFRA 1A50A 2YFNA 3R10A 3S46A 3OZOA 3I3BA 5CLTA 3RMEA 3T2PA 2OWCA 1YXCA 4ZOEA 1D3HA 3GVVA 3NQ6A 1LQAA 2IXVA 1P0BA 2GVGA 4ZBCA 2DDXA 1RXOB 2BB0A 4HHHA 3N3TA 1PV8A 3WBXA 5HATA 3PM6A 4WHBA 2VL4A 1XS2A 2DGAA 1DWGM 2I7GA 3E49A 3PPHA 4A21A 4NZ3A 2PRLA 2I17A 5A6BD 3U0HA 2FVKA 3AMGA 1ISZA 2PLCA 4YTRA 1RBOB 4DZ5A 2YL8A 3GBDA 3VCCA 4R7JA 1EWEA 2QHAA 2V68A 4GXWA 4MPQA 2V5DA 1F61A 4IPLA 1GQLA 2D3NA 4LUSB 4D6EA 1SFTA 3A64A 3WCZA 1B30A 3NQ2A 1GCYA 1JPMA 2FTPA 2W66A 1FWSA 4GO9A 2XGIA 1F07A 5LNRA 1P43A 2WJEA 1IE7C 5HQEA 3MP3A 3PZIA 1SW7A 3W00A 4QRNA 1DJYA 1SJCA 3MSDA 4R33A 1KQYA 3MHFA 4JIRA 3W02A 4M80A 3LS9A 4ZENA 3G1YA 1OFAA 1CLVA 3NL3A 4DWSB 2PP0A 4NZ5A 2WNZA 3HG4A 1W9XA 2YZ5A 5DN1A 1W9BM 4KBXA 2ASHA 1TPFA 4OFCA 3P61A 2X1SA 5LGXA 1DTNA 4FR6A 4ZA0A 1SSDA 5CJ5A 5I77A 4DWSD 2BY3A 4PTNA 1US3A 1NJJA 4AX7A 3WDRA 2NLIA 3NDYA 4FNRA 2DH2A 2GGHA 1XLEA 1UIOA 3W7HA 4FB7A 3W9ZA 4YHEA 3BSMA 1ZPTA 1DJNA 3B9OA 4NJKA 1XG3A 4IFKA 1JF6A 3HV9A 3TC6A 2Z1WA 1NDWA 1P48A 2XDFA 4ZFMA 4URIA 4AG0A 1T40A 4UCFA 3AZSA 4OOUA 4UCGA 4C6IA 1KO0A 4AZGA 2XN2A 1G7UA 4H04A 3P93A 1YBQA 4DAIA 2RJGA 2ZZ1A 2VC7A 1FH8A 3HO8A 5C71A 2RH9A 3UZJA 1TV5A 4NJHA 1JCMP 4QBXA 4REQB 3AS2A 4UBPC 4C91A 4H6QA 2XN0A 1P0DA 4PMUA 3CZLA 4IM4A 4H9MA 5E5CA 4HPGA 1YXYA 3UCCA 3RO6A 3TFCA 3T81A 3TP4A 2PLJA 2OMAA 3RUBL 1HKMA 1JPHA 1S38A 4JTEA 1G01A 1R30A 1WXJA 1BWKA 4PMVA 2XIBA 4E2BA 1OSEA 2HISA 5GQBA 1YTEA 2FZ9A 5AC4A 3QMSA 3N15A 3NPVA 3MUY1 1VJSA 3OIHA 2VX4A 1EXPA 4ZODA 1PZ2A 1S5NA 3G6MA 3EX1A 3DGRA 2YA2A 1QAPA 2DP3A 1L8PA 3W1TA 4F2BA 3VTRA 2VCAA 5A94A 1EP3A 1Z6KA 1OG0A 1UB3A 4NILA 2BXYA 2QPSA 1IGSA 3HV8A 3PULA 1MFVA 3UY7A 4PTVA 3W7RA 4NZJA 2QULA 3M5ZA 3I6TA 3UNDA 3WNNA 1EL3A 3V5FA 1POJA 4FX8A 5AHFA 1RK6A 1JAEA 5ABTA 1RPXA 2FPYA 3C4UA 2IPFA 3PZTA 4MF4A 1XLAA 4JCLA 1LORA 2IMRA 4MLRA 4HKPA 2XFYA 1JCLA 2WLYA 2VZTA 2ZX5A 1JI2A 5RUBA 3U2OA 2GYIA 4MJ4A 2GGIA 3W7QA 3T0DA 2PMQA 1MVYA 1TKKA 5BYWA 5FOOA 1EA0A 4ACYA 1HTIA 3CO8A 4RNHA 2A3LA 3ISIX 1DTUA 2LLEA 3N25A 1W17A 3ZXWA 5B7ZA 2DORA 4NL1A 3N2OA 2VDHA 3WL1A 4WD0A 3DHUA 4PBEA 3M0JA 4FNPA 3M07A 2XISA 5EU9A 3WJSA 4KWSA 3WD1A 4AC7C 3MU7A 1NP0A 1Z69A 1NU5A 4WXYA 4LRTA 1VBHA 2Z1SA 5JVLA 5ECVA 1E71M 4A2RA 3GNOA 3E0LA 3HA1A 2FGLA 5A2AA 4NZFA 3QV7A 3GHUA 4HU0A 5I3JA 5LNVA 4PODA 4DF2A 4IL0A 3T2OA 1K6WA 2Q3OA 1UD2A 2CHRA 4Q7NA 5T26A 1D3GA 3NOEA 5CZJA 3S6OA 4DZAA 2WBGA 2VUNA 4JIIX 7TAAA 2C1HA 3TN6A 3N3MA 1EJTC 3N34A 1V0NA 2D69A 3PWAA 1VAHA 2B7NA 4MZ8A 1RCXB 3UCQA 3H6OA 4WSHA 3N4FA 6ENLA 1BRLB 1JNDA 4UOZA 2J66A 1OCBA 3OLGA 3N17A 4KETA 2VURA 5F1UA 5A6BA 1VHNA 1XLGA 2NVAA 3TQVA 1JDEA 1JCXA 1FHUA 1I2NA 2OSWA 2NUYA 2G3MA 1L8NA 4GNKB 2HVOA 4KESA 3UR5A 1FH9A 3PWGA 1GT8A 3KDNA 1JR1A 2W4XA 5DCEA 3U48A 1XGEA 3P8JA 4EF9A 1K03A 4QLJA 2CWNA 2ZCGA 2C13A 2WPBA 2Y61A 5E0FA 4GIRA 3EDKA 3WQFA 3ZLGA 1U83A 4ENLA 1W3IA 4MNKA 3K8KA 4KIRA 1EJXC 4GYPA 4WX2A 7REQA 2WMIA 4MGGA 4HQVA 1Q13A 1TZZA 2RGMA 3SQMA 3REQB 1E1FA 1UP2A 1QCWA 2VX7A 4EPKA 4WSKA 3AIWA 4XAPA 4S3EA 1QI0A 1UKPA 5LIYX 3TKFA 3QJAA 2V5LA 1BAGA 2WVUA 3MHGA 1EOMA 4J2MA 3CZKA 1UUMA 3NQFA 4XX6A 1AJ2A 3COTA 5D2WA 3RU6A 4JX6A 3PPGA 4HPXA 4Z2IA 2EO7A 3UZ5A 4KFPA 3BZJA 1ONWA 3OYZA 4ZQNA 2FHBA 6PTDA 2QUTA 1MUCA 3WN6A 2E4TA 4J9JA 1GOOA 2VGBA 1M7JA 4QNEA 1ALDA 4FOJA 2O9PA 2VNCA 3NZPA 1ZBKA 2OYMA 2VGFA 2QDGA 3QOMA 2WHLA 2XM1A 3R0UA 3WENA 1JRBA 5CCZA 4GQRA 5E0KA 3GLCA 1WDSA 1DWJM 4XQ6A 5E9AA 1M41A 1VGAA 3P2VA 3TWAA 2VEFA 3ARUA 1FWEC 3S83A 1E1CB 1KM5A 2ACRA 1BVWA 1WKYA 4NX5A 3W85A 3AAMA 4QGCA 3TV8A 3WLQA 4EP8C 2GQ9A 1VYRA 1H7PA 1E56A 1ISVA 2VRQA 4GC3A 2E67A 1UG6A 1VKFA 4FNQA 2WMJA 3VVGA 1CI1A 3LGDA 3ALFA 2AAMA 3NEVA 2O9TA 3AWNA 1KR1A 3MCOA 3ZYZA 4XBJA 4EVZA 4MFDA 2PTDA 3CL6A 4RZ4A 4U10A 2Z2BA 2NLYA 4B3LA 1R0MA 1EP1A 2E28A 3AYTA 4JQ1A 1E0VA 3NO3A 4XVEA 1IXOA 4TU1A 3VC6A 3W84A 4L4OA 2DT2A 4LNYA 2CZVA 1R2TA 3AIQA 1TIMA 4WKHA 2ACQA 4BQ2A 2GJPA 1FWNA 4CU8A 2J7EA 1OF8A 4J4KA 3WBWA 4BI6A 1IF2A 1T41A 3LXAA 5AC8A 1IQ8A 3CJPA 4HOXA 5IBXA 4HHPA 2P0OA 5C70A 3A13A 2ZX7A 4GY7A 9CGTA 5DMYA 2D2GA 4ZEPA 2FMNA 1WDRA 3V35A 4Z0JA 3PZMA 5E93A 3VD5A 1LL7A 1KCXA 3LHZA 4NXSA 3MPGA 2AQVA 4XBSA 4RLIA 4DI9A 3ICJA 4KT2A 4JEQA 3H7UA 4MWAC 1JULA 2Z25A 3S3GA 3ARVA 3TR9A 1XLHA 2P50A 2POTA 3MDWA 1WKDA 7A3HA 4EAYA 3W37A 3PZNA 3WNMA 2OQHA 3EB2A 2ISVA 3N73A 1K9FA 2DZTA 4UTHA 1P6BA 2HQAA 2QT3A 2J24A 1O5XA 4E4FA 3M5YA 2JALA 3CHCA 3DECA 4DBWA 2PDXA 1CZ1A 4L1GA 5A95A 2AQWA 1XUUA 3IGUA 4DHGA 2YBUA 3Q37A 4C6CA 3XISA 4JN8A 1EDGA 4M24A 3KTXA 1YDOA 4U31A 2WM0A 1B31A 4UB9A 3GFYA 3P3BA 1EX1A 4AZCA 3TW6A 4MG4A 2F9RA 1XP3A 3KOFA 3PFMA 3HFTA 4ZVJA 1GZGA 2G0WA 3KL5A 2CLMA 2BOGX 4HD5A 1HF6A 3IARA 5F2LA 2ZUSA 1XD0A 5FL0A 4AVFA 3ZSSA 3ITGA 3AYVA 4FIRA 2DUZA 2IUZA 3STCA 3BCFA 3PN8A 3CZ8A 4S3FA 3W1RA 2HNEA 4CN4A 4IQEA 4ZTYA 2PGWA 3FYPA 1YPIA 1E51A 1S5WA 3S1XA 5IFPA 1JCNA 2IKIA 1KD0A 3MJYA 2NV9A 2WSQA 2NXHA 5BXPA 3L0KA 4F0SA 1KV8A 3KRBA 5CPOA 1RSCA 1SJDA 2GFTA 3EXRA 3B8UA 3B8TA 1J11A 5H6HA 4ERAA 3VIMA 2O55A 5M3WA 1V3IA 2QEZA 1E0TA 2OXNA 4EWJA 1VF8A 4JTHA 2VEMA 1FWBC 2XGBA 4G9PA 2Z00A 1QNOA 5D09A 1RP9A 4DJEC 1UZDA 3BL3A 4GK8A 4E3TA 2A4AA 2X0SA 4GX9A 2ZICA 3DDMA 1N82A 4GXMA 1UWUA 1OEPA 1BWLA 1Q7ZA 1ODUA 1F4AA 2I56A 4ZO7A 4YLWA 1WQ5A 1Q63A 4DXXA 5AHMA 2X1UA 4K2SA 4PL1A 3TW9A 4HN8A 4KKXA 3H8AA 3IANA 1Q2SA 3AFBA 1EEXA 1C92A 4F3HA 3WDJA 3JZUA 5LYRA 1WXYA 3R8HA 3OODA 3LYEA 2C6QA 2HK0A 1R7AA 5CSRA 4UFKA 3TQKA 4HNUA 3C2EA 4OVXA 6REQA 2Z6IA 1UBPC 1ICPA 1UMLA 1PX4A 5D8WA 1TTJA 4B5VA 2Q09A 4OTKA 4DVOA 1YMYA 4LVFA 3MYOA 3A4XA 3HMJG 2YJQA 1SO6A 3UU0A 4PR4A 2Z7GA 1QASA 2BY1A 1FCQA 4PMJA 4MWAB 1JEZA 4C6EA 2YXGA 3LGEA 3A3XA 5HMSA 1KFJA 3KVJA 4Q32A 4HYVA 4YL2A 2DY3A 3TNOA 3W1QA 4ES4A 2D23A 3U2EA 3SCUA 4FLQA 4HA1A 1B3YA 3UXDA 5G1MA 5M5DA 3NGJA 3WNOA 3R89A 3S0CA 1DV7A 1XYMA 3VIJA 1W5MA 1FKXA 3VI2A 3H2EA 1DVJA 4K38A 5GJMA 2WOQA 5AC6A 4O14A 4D9PA 2OCZA 3MI3A 1YEYA 1JXJA 1S2AA 3CV1A 1QW9A 3AUJA 4WY0A 2A2IA 2BBFA 2X0HA 3DKJA 1RY8A 3VDAA 1QMLA 3ARWA 1FCVA 5I06A 2GDQA 3ARPA 3IRSA 2VT0A 3V36A 5BOOA 4HU8A 1F4HA 1FUYA 4W89A 2OB3A 2CLEA 1OWQA 3FW6A 4M0XA 3O8AA 5BU6A 2BFGA 4ML4A 4UTMA 1O5QA 4W4QA 1HNYA 1E6XM 3T0CA 3TSBA 1CXLA 1TWDA 1SO4A 3PF3A 3W76A 2ISDA 2DSVA 3M0IA 3OP2A 3AIVA 4QEEA 2Y24A 3DZ1A 1TR9A 5M2FX 3HG3A 1KXQA 1NDYA 4N42A 1KGUA 3IRDA 4EK7A 3BMWA 1UOKA 2WWDA 2P10A 2BS9A 2PCEA 4KFOA 5HDRA 3KXQA 4R34A 3KCLA 4BI7A 3NO5A 5AYXA 2J8FA 4XKYB 2CZFA 1RBAA 3LGGA 4Q8PA 1CGVA 4XD6A 1OVDA 3VD4A 2WHKA 2A3CA 1JYNA 2GGJA 3AJ7A 2A0NA 3AIEA 3GWQA 4R9OA 4CNUA 4F0LA 4JEJA 3NFUA 1J10A 2QDHA 2XYLA 3WQWA 4QG9A 1LROA 2ISFA 3BLFA 1HGYA 4N2YA 4LH8A 4UQDA 1UP3A 3GNXA 3UPBA 5EMYA 1M1BA 2HS8A 1HUVA 3EGJA 4PRRA 2ZIDA 5D02A 2XN1A 5G4EA 1Y65A 2B4GA 1VCGA 1YXDA 2XH0A 1A53A 1EIXA 2J25A 5U7SA 3OYXA 2NQLA 4Y8EA 3H4XA 3LB0A 1TPH1 3W2NA 3BE7A 5IHRA 2FFCA 5D30A 4M3PA 4FO4A 1UH3A 1VIZA 3ZT7A 4C7DA 2Y1HA 3WLPA 2GL5A 3TR2A 1V7AA 3G1AA 2XZ9A 2CCRA 1A5OC 3HM7A 2HXTA 3W6LA 3ELFA 3NXLA 3F4CA 1BXBA 2H3BA 1XLJA 4NZCA 1UPMB 3EDDA 4FSAA 3LQGA 3KL3A 4UC5A 2QLYA 1KKOA 3L23A 4L9XA 3NURA 1ME8A 5FAJA 2QCNA 1KFBA 1KFCA 1Z7AA 4DI8A 1OB0A 1RK5A 2DEPA 1OK4A 3G1SA 4CCEA 1XLMA 2Z2UA 1NWUA 1VCFA 5HWJA 1CNVA 4V1XA 3G8EA 1IWBA 1IR1A 2QGHA 4UTTA 2ZX9A 3OHIA 3AJXA 5A6AA 1KXTA 1E6RA 3WDPP 4LEQA 3LY0A 1Q5MA 4KFNA 4U33A 2Q6ZA 3CHFA 3L7RA 5D9NA 4ZSUA 4CU7A 5HWNA 1WDQA 3VKDA 5FI8A 2PC8A 1J6OA 3SDOA 1SM9A 3SM0A 5DBUA 1K02A 1LOQA 1HIZA 3C0JA 4JQ3A 3PHAA 3R58A 2QCLA 4F79A 2QCDB 5LSMA 5LHFA 4L64A 3HTWA 5M1TA 3WDQA 1GVIA 2J7CA 1UWTA 4YTUA 1J5SA 1YKWA 3VU2A 2BODX 3C8FA 1TWZA 1R9YA 3BW4A 4AWUA 1ME9A 2A7NA 5HNUA 2VOMA 3F5LA 4DM1A 3QXBA 3TOPA 2PTYA 1XGZA 4LF2A 3MYPA 4H6KA 4AYSA 3FXYA 3LXCA 1O7AA 2DSWA 3G3MA 2Z1XA 3F5JA 4GNJA 1OT1A 2AMGA 1O6IA 2J7GA 1W1PA 5HUOA 1AH3A 3CAKA 1VZWA 4YXGA 1Q6LA 2OGYA 4W86A 2CNCA 5KZ6A 2WKLA 1KFWA 4UTWA 3N2MA 3DGBA 1BF2A 1W9VA 3P81A 5E0CA 2VEPA 3W28A 3WMCA 1VC4A 1QRQA 1JJKA 4CQDA 4R5EA 3BG5A 3GHTA 4C6OA 4WEVX 2XUCA 3LCFA 3NZ1A 1HW6A 2HVNA 2TAAA 4XKMA 3NZGA 1NF7A 3WF4A 1EGMA 3FA3A 2VR4A 1TWWA 1E9IA 3AS3A 1A5MC 5AYBA 5D8ZA 5LIWX 3NPWA 4V2XA 3CQJA 2DT3A 2ZRYA 2Q8ZA 1EHAA 3ZLHA 3E0VA 4A4AA 3N9KA 5TD4A 4B9ZA 1Y5VA 1REQB 3RIKA 3AZTA 4NJJA 4KEUA 4C60A 3GNRA 3T0TA 4D2JA 3LXBA 1QT1A 2BY2A 1CTNA 2VQUA 4PUWA 3M0XA 3BSHA 3AHZA 2NW0A 5U4NA 5C2CA 5HBFA 2C0AA 3OA5A 2MANA 2HZGA 1NY1A 4IFOA 3OGSA 1WUFA 1DJIA 1JGIA 1UCWA 3EA3A 1XINA 1FWRA 5CSUA 2PBGA 1Q6OA 4AISA 1CXHA 1VB9A 3VZZA 1VEMA 3GAKA 1I75A 1S5MA 1WZKA 1I60A 2Q3RA 4UWMA 4Z1BA 1NELA 2NVCA 2GDVA 1R85A 1UD8A 1RQHA 2PDWA 1T99A 1C3FA 3OBKA 1XHGA 3V16A 1WA3A 1YPXA 1QR7A 1C29A 1KC7A 1EKOA 1ONRA 4G7FA 2E77A 3QPEA 1QI2A 1G0CA 2YA1A 1JFHA 4ILSA 3WUEA 2XWEA 3HQPA 3CV6A 4TR9A 3RDKA 4LUTA 4D1IA 1FP9A 2GVLA 2HCVA 4HSHA 2JK2A 1XSJA 3G0UA 2QGYA 3RLVA 2X05A 4JOMA 2P3EA 4M56A 5MKGA 2WSPA 4QLKA 2QPXA 2EPNA 4LVDA 1R86A 4Z0SA 4GUFA 1TV3A 3QYQA 3QSTA 3VIFA 2QZRA 3GVGA 1OT2A 2ZKMX 2YBVA 2I5GA 4GZJA 2O9RA 4Q8MA 2WNWA