2FMNA

Ala177val mutant of e. coli methylenetetrahydrofolate reductase complex with ly309887
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
288
Chain Sequence
FFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGDLPPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGVNRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structural Perturbations in the Ala -> Val Polymorphism of Methylenetetrahydrofolate Reductase: How Binding of Folates May Protect against Inactivation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 98
structure length 288
sequence length 293
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 2fmnA00
1ZP4A 3ITGA 2FMOA 2FMNA 3FSTA 3E2SA 3E2QA 1B5TA 4JNYA 4JNZA 3APTA 1TJ2A 1ZRQA 2FZNA 4O8AA 1TJ0A 3APYA 1ZP3A 3FSUA 3IJDA 1V93A 1TIWA 1ZPTA 1TJ1A 3E2RA 2FZMA
chains in the Genus database with same CATH superfamily
1OFBA 3L4YA 3PB0A 1BVWA 1E9IA 2OO0A 2HK0A 3E9AA 3WK3A 2NLYA 1V6VA 4RNHA 1CECA 2YZRA 1C8XA 4XTDA 3K4WA 3WMSA 3PTQA 2I9UA 1AMKA 3ZJ8A 1XJBA 3WBEA 1E4NA 3MSRA 3QQWA 3GHSA 1B1YA 1QNOA 1O12A 1J0JA 5C7HA 2CYGA 2VC5A 1CPUA 4DJFD 3LXAA 1EXPA 3GDLA 1C93A 4KS0A 3RPDA 1OYAA 2I14A 1XLIA 3SSZA 4IG2B 3FHAA 3WDJA 1B2YA 2ZA3A 4RV8A 1IR2A 2ZWYA 2YCIX 1QHOA 1Z6KA 3XISA 4ZZ9A 4F79A 1XIBA 2E40A 3TZNA 1GZ1A 1FA2A 4W7UA 2WJDA 3VDAA 2WSYA 1IZJA 5A8MA 2ZUUA 2Q8ZA 1HKKA 1LP6A 1OX6A 4H01A 4W8BA 2QAFA 1ZAHA 3WFZA 3BG5A 1UD3A 1ZENA 3L0GA 3GNNA 4DIAA 2BHUA 4NG3A 4AQLA 1VB9A 5DXYA 3RJXA 3AIQA 1JCMP 1JCTA 2CCRA 1KRMA 3N9RA 2DUXA 3UYIA 3MCNA 3CMJA 1SJCA 5LIYX 4S3FA 3W84A 2XIBA 4L1WA 3TYAA 3NM1A 4YIWA 3I3DA 4H6QA 4TMBA 4CCCA 3B05A 3HZ3A 1E3ZA 1K03A 1RQBA 3PZQA 3WEZA 1OHLA 2BFGA 1PX3A 1G0CA 3IK4A 3NEHA 4A3RA 3CASA 4E38A 4CNTA 3LY0A 1GKQA 4LBUA 3M6DA 2XUCA 1XUZA 3AJXA 3FA5A 1A3XA 3S42A 3UCQA 4RKAA 3W28A 2ZICA 4NIRA 1E0XA 2X2GA 2PTWA 1YNQA 2J13A 2XGZA 2OWXA 1OF8A 1KWKA 3AQUA 2HVOA 1H09A 4R9OA 4I8DA 5EL1A 1WV2A 2PLMA 3TVAA 2RAGA 1VP5A 1KM2A 1PJ9A 3N6QA 1QASA 1C92A 4BWLA 1M53A 1TPB1 3AMCA 3P8IA 4ZQMA 2ANUA 1ZJBA 3CLMA 2Z2BA 3DBNA 1CCWB 2PP1A 1FXPA 4S3CA 4QJ4B 4PB3A 1DWAM 4B92A 3VILA 4D6FA 2BWGA 1X8FA 1HUVA 2PF0A 5TAOA 3GUWA 3GHRA 3O05A 4NZ4A 5BXPA 3PAJA 3AUOA 4L56A 3TOPA 1JFXA 1OZMA 2G4JA 4OBRA 5CJMA 4D6CA 5EYWA 2CLFA 4JIHA 4NXSA 3CPRA 2WMKA 4OTKA 3CV6A 2C16A 3Q4DA 4NAEA 2I1OA 3URAA 1GJWA 3FXGA 1RK5A 5B7ZA 3L23A 1X6UA 4A35A 4AW7A 1D3HA 4MY8A 4K6AA 3BUVA 2GQAA 4I9MA 5L6UA 5D2VA 3RLUA 4M81A 5A6BA 1ISYA 3C61A 3EOSA 4XG1A 1XIJA 4HVXA 3DHFA 1IR1A 3OQEA 1A5OC 4CQAA 3MUZ1 1RZMA 2C8NA 1PZ1A 1V0KA 2PTXA 9XIMA 6REQA 2QMKA 5BXRA 2VHLA 5BXSA 3HG4A 3UR8A 1I45A 4IISA 4OQVA 4CN1A 4H8VA 1PCKA 1M7PA 1H41A 1GOOA 3QY8A 5I3JA 3ARVA 3BAJA 4WCJA 3M5VA 1PIGA 3MPGA 3R0DA 1GKPA 2V5BA 3APYA 3W1NA 3JRKA 1M65A 1OM0A 1E3XA 1L6WA 4BI5A 3PTDA 2PWDA 3RAOA 2EO7A 3H2AA 4HSHA 2FJKA 5F2LA 1P0DA 2PEVA 1NFPA 1KBLA 1JGIA 3IIZA 2DW6A 1R8LA 2D2GA 3KTCA 1J0KA 4LNCA 3ALGA 1CLVA 3S9ZA 5G1YA 1OG6A 4X63A 1OFDA 5XIAA 1O7AA 4YL2A 4CEUC 1GZGA 4JYEA 1RH9A 2HS6A 3A24A 1QOQA 5HNRA 3UNDA 1J01A 3FN9A 3EOLA 3EKLA 4RZ4A 3FJNA 3PC0A 3K8MA 1KRBC 4GIRA 3WG6A 4WXYA 1YNYA 4AZIA 4Q8MA 1G4PA 4FOUA 4WQ6A 4RE4A 1JXJA 1JUBA 1Z42A 1ISZA 2GJXB 1FDZA 2O7SA 2Y5SA 1VS1A 1UYQA 3U8GA 3PPCA 5ABEA 2F2HA 1O60A 1FWEC 1CGUA 4RE3A 1NFGA 1XLJA 4UNKA 1JZ6A 2GSJA 3HPSA 4CQBA 3F2CA 4QNWA 2BMBA 1J6OA 3CZGA 1POJA 3TYZA 2JALA 4NY2A 3VD7A 4DPPA 5CG0A 2FPTA 1S5TA 2INFA 3GU2A 3HO8A 4JTRA 1X1ZA 1Z69A 1WDSA 2WKJA 3BPWA 4KETA 3ORWA 1JIBA 2R91A 2VFHA 1SO3A 1H5VA 2ZKMX 1JZ5A 1FVPA 4Y9NA 4XAFA 2HCVA 4XV0A 2FYMA 5C2CA 4ROQA 4GH3A 3ATYA 3VUPA 2Y7GA 4LGXA 4ONVA 4S3KA 1OFQA 1HP4A 3CUJA 1QVBA 4NHVA 3MQTA 1R9YA 3M7SA 4PEKA 3MMTA 1T41A 4LUTB 2WHKA 2UBPC 2J7CA 1EIXA 3LK6A 4GUIA 3PSVA 5BNKA 1U1JA 4MVAA 4ZQRA 3W70A 4RR4A 2XM1A 1WZKA 3B4UA 1JNEA 4RW5A 4PMNA 5AVNA 2YXGA 4L4OA 4CGTA 3QHOA 3L4XA 3MDUA 5FJJA 1R2TA 1WZLA 4KCUA 3NGFA 4DO4A 4LNYA 4DWDA 3W86A 1F7BA 2R1NA 3HM7A 5HINA 3BOFA 4Z17A 4NJIA 5REQA 3E0FA 4UTHA 1TJ2A 4W4QA 3VD5A 3STEA 4W87A 4EPKA 4FLRA 5FI8A 1KKRA 3L4ZA 5LXEA 2NWSA 3KHJA 1WKDA 4KCVA 3EEZA 1HKIA 4ZQPA 2Y5JA 1DWIM 3GQYA 3EOEA 4H83A 3IJ9A 2X7VA 4FXFA 1LG2A 3WMCA 1XIMA 2OOGA 1CTNA 3WD1A 1RAKA 3KXQA 5BRBA 5HWNA 2JKEA 3FXYA 2FMOA 4JQ1A 1UD5A 2R6OA 3PUEA 2CLHA 3G8EA 2H9AB 3K2GA 1KBJA 1X1NA 1RR2A 4FMVA 4PFHA 1TJ1A 4EOUA 5A6SA 5JIPA 4QJ1A 2ZX5A 1H7NA 2XVNA 5C71A 1G01A 1E9YB 5EU9A 2A0NA 5AYZA 4BCEA 2HNHA 2DJXA 3ARZA 1DIOA 2QGHA 4U28A 3CMFA 2IKHA 2V5JA 1GOWA 3AHVA 4D6JA 2MNRA 3AXMA 1Q8AA 3ERPA 1VENA 3MI2A 4B2DA 1ITCA 3T2OA 2HISA 3FYPA 1VFTA 4IJBA 4IP5A 3AXKA 4LAZA 1AL7A 4RNIA 8CGTA 1P4CA 3TC7A 4K8EA 4KEZA 3W7KA 5C9XA 2A3BA 5FF2A 3RF9A 4F9JA 4HKPA 4PZVA 1KV8A 3MUY1 4HJFA 3U7VA 4CKQA 1F3XA 2QJHA 3THUA 3G0UA 3H2NA 4MYAA 2GGHA 3WCZA 5MKGB 2IPGA 1HNYA 4OUEA 3NQMA 3S6DA 2D0FA 1UJPA 4PMVA 3NEVA 1TMHA 4FXSA 1D3CA 2DDXA 2VGFA 2CETA 4YTRA 5D8ZA 4NSBA 3SCWA 2WXDM 1W1YA 3RK8A 2B7QA 1LOSA 1RP9A 4O1CA 3TKFA 2CERA 4PSRA 3S9IA 2C14A 1JPDX 1R9ZA 1FKWA 3VOCA 2P10A 1M6JA 2V5LA 4LT9A 3OZYA 3MO7A 4C6KA 1TIWA 3PWIA 1PX8A 4D6EA 5E93A 1O66A 2XINA 1TWWA 1J79A 4D2JA 3N2TA 5FEXA 2VNCA 2C1GA 3R10A 4GFIA 3UETA 1XL9A 1HVXA 3IS4A 4FR1A 3B8UA 4LCQA 3A13A 2PUZA 4EVZA 1ITXA 5D37A 4XZHA 1JG9A 3CBWA 2VEIA 1DJIA 3D6NA 1Z48A 4ZOEA 2C1HA 4ZFMA 2CWXA 2OX4A 3OG3A 1KCKA 5AYIA 3QXBA 4PTNA 3VD3A 4DXXA 4GYPC 5G5IA 9XIAA 2VUNA 2J6VA 2CZVA 2D22A 1ME7A 4F48A 2XDFA 3QOMA 2O55A 5A8QA 3VKCA 3WLKX 1EC8A 4IUGA 1K8ZA 3KRBA 3BE7A 1T5AA 3TNOA 4D6GA 3ONBA 4HCLA 2GGJA 3CYJA 3NPXA 4K8GA 4ZFCA 2NVCA 4UFMA 2QPXA 5D4YA 3KWXA 1L6SA 2PRMA 1F61A 3LOTA 3OVQA 3QJAA 1C8QA 4AHPA 4GI4A 1YXDA 3TTYA 3LV5A 3B9AA 4PUKA 4Z2KA 4QSFA 4HNTA 5LNRA 4IJCA 2X42A 3M0KA 3SCPA 1RY8A 3GXIA 2V30A 4AF0A 4V28A 1BYAA 3NQVA 1IE7C 4Q4OA 5SWUA 2XVLA 3PANA 1TCDA 3WDIA 2ZUWA 3MVTA 4CN6A 2MUCA 1W56A 1E4LA 2NZLA 1TPFA 2AL2A 3PY2A 2F8QA 4O57A 3KRUA 5A6AA 1H7RA 1UQYA 2PGWA 1SSDA 3U2CA 3W00A 4U5IA 4LAKA 4Q32A 1FWGC 3SRKA 1WOAA 1EFZA 2QPSA 2YA0A 3KBNA 5JUVA 4YTSA 3UQNA 1UUQA 2XGBA 4XD3A 4H9YA 2ZE3A 1FHLA 4ZSTA 1W5QA 1PPIA 1XCWA 2J27A 4RX0A 1J0ZA 4QNEA 1SZRA 2IMRA 4NAEB 2EPLX 1QI4A 4UWMA 2Y2WA 2D2HA 4IMDA 3W76A 4DJDA 2R24A 1MXDA 5T26A 4MSSA 3W1UA 3P62A 2RUSA 1VJZA 4CNPA 2EEXA 4UNLA 5K9DA 1IGWA 1U2YA 8A3HA 2C15A 3QC3A 3RN6A 2EJ1A 3FKKA 2OR2A 2QS8A 4NI3A 2PWUA 4Q3MA 3B97A 4Q4RA 4IMGA 3KZSA 5IM51 1JCLA 4G7EA 3BLKA 1CXIA 3EMCA 3W72A 4UTWA 2VDIA 4F2BA 2VT0A 2WCGA 1H50A 1TWSA 2J25A 3T2QA 5RUBA 2XIQA 3E5BA 1RJQA 3TN5A 2EPMX 4YVPA 1SFTA 3IV3A 6REQB 4GABA 3W83A 3DC0A 4HCDA 3OHIA 2AMGA 5HJXA 4DRSA 3EZ4A 3S5YA 1S2CA 2CZFA 3GSMA 2XVPA 2HZGA 2GJLA 4RK8A 3ZXWA 2XGIA 3S5SA 1Q85A 1W9PA 4DN1A 1IZCA 2ZRZA 3GHUA 5AYXA 5FJOA 3N12A 3GTFA 2Y5EA 4JKLA 1DVJA 1NIUA 3W4RA 1LRTA 4EXAA 1OC6A 3QVQA 2PU1A 1H7XA 2B31A 3TN3A 1XC6A 4WKAA 2YCEA 1ML1A 3PZVA 4FP1A 3TWBA 1AODA 2E9MA 2QDGA 2WVUA 4NT0A 1A4MA 1VBUA 3VK5A 3H4WA 2WQPA 1R2RA 3KVLA 5IXEA 4E4UA 4UFIA 3VO0A 4H00A 4OFCA 5ABFA 2VFGA 3B8IA 2OEKA 3WMBA 1IZKA 3V4BA 4JTJA 2XVGA 1HJSA 5AOUA 2J74A 3TYCA 3WX7A 1QPKA 1N8FA 3MCOA 1SZGA 3DXIA 3USBA 1UB3A 1KC7A 1QO5A 1KV5A 3ALFA 5A2AA 4S3JA 3S46A 4LTSA 3VM5A 2O92A 1MQPA 1K7FA 1M01A 4PMUA 1D7KA 4I5RA 3DDMA 3HV9A 4Y90A 3MUCA 1PV8A 3WLHA 4MDPA 2CXEA 1JYNA 1OFAA 3K1GA 2Y62A 1QPRA 4DZIA 1EP3A 2VZOA 3I10A 4L9YA 3OIXA 3DFNA 1UHVA 1IXNA 5G1MA 4ZE5A 2YOCA 1MXSA 2ZA2A 3M5XA 1U22A 4WGHA 3MHUA 2BY2A 4NYYA 1XF0A 1L2UA 2J8GA 3OLGA 2E6DA 1WKFA 4GGHA 2FQIA 2NVAA 3EOUA 1I4NA 3JS3A 3GVRA 3TONA 4GVGA 4IQEA 4HZ6A 1Q63A 1UA3A 1XRTA 1NQ6A 4YYFA 2E8YA 2PWFA 2Q01A 5G4EA 3G0SA 3CAQA 1YRRA 1VAHA 2YFOA 2VXNA 1KTNA 1EZWA 2VUYA 1SZNA 4TR9A 4FXRA 1MDRA 5IBXA 2DUZA 4LC6A 1NAL1 4JKMA 1UH4A 3T09A 3LXBA 4GX9A 3KRZA 4N0RA 1AW1A 1XICA 3NL3A 4FNTA 3NO3A 4IIEA 1R85A 5H8UA 1C90A 3EKGA 3E38A 2GVEA 1JPIA 1TQJA 5TIMA 3QGVA 4HOXA 1EJTC 2AQOA 4LPCA 3G1RA 4UTJA 1H1ZA 1QR7A 5REQB 4AIUA 1B9ZA 5HXMA 1T96A 1XYMA 3S2CA 3VNIA 4FXJA 2O9RA 2HPMA 3THAA 4QSHA 2D0HA 4LB4A 4JIIX 4KRZA 2Q8XA 3TUUA 4INFA 3LBMA 3WJZA 2V69A 2HPIA 2ZE0A 1XBZA 3M0MA 1QPQA 2I17A 1WCGA 4TO8A 5BU6A 3DKJA 4OU1A 1THFD 4Q4PA 2DIKA 3CEUA 4JTFA 4GQ0A 2CLPA 3WUGA 2J79A 3LCWA 2PWHA 1Q4NX 1F6PA 1L9WA 4AUBA 4ZR8A 3GAKA 1D2KA 2XN1A 2Y8KA 1OYCA 3NXFA 1Q4WA 2IXUA 1XXXA 3PUOA 1M7JA 4DWSA 3PBWA 3AHYA 2PTYA 1I9CB 3LPFA 3OPSA 1OIMA 1EP2A 4I9AA 3N2XA 2PDCA 5A6LA 4JD4A 4WRHA 3CNYA 3F2BA 1TV5A 4DNHA 4NNCA 1VFMA 1HKMA 4H4IA 4IMFA 5AC8A 3O9NA 5E6ZA 4IICA 4H8UA 1Q66A 3AXIA 4ZMGA 4IGMA 4KH2A 5I3DA 1YBQA 2WSQA 2DV0A 1H0IA 3QR3A 3XIMA 4KQNA 1W5PA 4LUJA 1XYLA 2XISA 4JY8A 5C9UA 1KTBA 2WSPA 3W6MA 4XZ9A 2EKGA 3WH6A 5MF5A 2G8ZA 3N14A 3UJ2A 1V93A 1UP0A 3SJNA 4MADA 3H23A 2HJPA 2GLKA 4NRSA 3KBWA 2G3MA 1BYDA 3ARQA 3W7JA 1GOIA 4LANA 5HNUA 2PDYA 2F7FA 2WC3A 1TPC1 2Y89A 2WKGA 7A3HA 2DT1A 3NOYA 3MMUA 2NV2A 4LW7A 1BXCA 2X0YA 1PKMA 1NU5A 3NDOA 3UXDA 2Z28A 3GY1A 3WLNA 1WDPA 1BRLB 3VA8A 2V5KA 2INZA 3C2FA 3DIPA 4DBDA 1EPXA 1FWFC 2Y1HA 1O1HA 4AZGA 2ZUVA 1ZALA 5KSWA 1HJWA 1V77A 5BMXA 4WUIA 4LEQA 4KGJA 4ATWA 3IK2A 3N18A 1XLKA 4D71A 2PWGA 2WNQA 3HBLA 1CNVA 1BVNP 4ML4A 4AY1A 1O5KA 3LENA 3CB3A 3C6CA 3A5FA 2BVYA 4FOJA 1K6WA 2FIQA 2WM0A 3ABSA 1GYLA 2BG5A 3SGUA 1ADOA 2BX7A 1GNXA 1D8CA 1W1PA 4LXFA 3VNJA 3LCLA 4FX7A 1FH7A 4AD0A 5I7GA 1RQEA 2G96A 3CAVA 4B16A 1UASA 5A8PA 2V8ZA 4C5YA 1TE6A 1ZJAA 1ONXA 1OQFA 1S39A 3I65A 4OGZA 1UD4A 4MF4A 4NX5A 3NZQA 2WJZA 2J9ZA 4C6LA 3AZTA 2W79A 3BOXA 1UR1A 2AKZA 1PXGA 3TWAA 3KX6A 2HTMA 1OINA 3CC1A 3NYZA 3G1SA 2W5FA 4JTTA 3W37A 1LM1A 3MY9A 4HU3A 4FK9A 4BF9A 2XTKA 1S38A 1XLCA 5CSYA 5DCDA 3UPMA 4YPJA 1IEIA 3C2EA 5T8GA 1HKJA 4E0CA 3BVJA 2OYLA 3A4AA 1EF2A 3LSBA 4AG0A 1L6FA 4HK7A 3H70A 5BMWA 3IPWA 1F9CA 3BWWA 1W9DM 4JNMA 4GI9A 5H1WA 1EJXC 1QO2A 3V36A 1G69A 3I3BA 3ZIZA 3MO4A 4AF0B 2OCZA 3AHTA 3WFLA 5FD0A 1F2JA 1AD4A 3HQ1A 3S6TA 4DBWA 5HQMA 2J66A 3N11A 3E3HA 1R87A 1W9VA 1YW1A 2CZEA 4L4LA 3UZ5A 2AL2B 3EBVA 1R9XA 3T78A 3W2KA 3GNXA 4GY1A 2VCCA 1OC7A 1UR0A 2VEGA 4PCFA 3S2LA 3GBEA 5ENLA 4KWWA 1K9EA 4X0VA 1UJQA 1VEPA 1WZMA 2E09A 2FZMA 5D04C 3TROA 4EXBA 3CAWA 3SCQA 2BOFX 1GPFA 1NVMA 4HA0A 3CJPA 1IEQA 4LUYA 3BH4A 3E0IA 1A49A 2L5HA 3VFCA 5EGRA 3WJWA 6XIAA 4IF2A 1E0WA 1N82A 2GQ9A 3MUXA 4M7TA 5C2XA 4Q6XA 4UR9A 1I6NA 3AXHA 3R8GA 4MAVA 1OFPA 1ODZA 4CD5A 3CV7A 3O6DA 4PUWA 3NDYA 2BVDA 5E0FA 1YNPA 3KBJA 3UA3A 2PB1A 4PBEA 3MCMA 3P93A 3ITXA 3GLCA 4G7EB 2UWFA 3M5YA 2FJUB 1FWAC 3R2GA 4GISA 2HMCA 4JFTA 1ZJIA 3RX3A 1P1XA 4B9YA 4RLIA 3EWXA 1UKPA 3KOWA 5E0KA 3VABA 1C29A 3UNTA 4L7ZA 4N42A 3VGHA 4F66A 1M5WA 4JTQA 4YTQA 3PPHA 3Q67A 4AWSA 4MUZA 3L5LA 5BYWA 3AICA 2Y8VA 4P8XA 1QI2A 1QWGA 1KTCA 2YCLA 2PS2A 1WKYA 1XR2A 3W1PA 2VVNA 3F1QA 2C91A 1H11A 3I7QA 1CGWA 3AYSA 3TMLA 3S1WA 1EUAA 1L8PA 3CM4A 1JUEA 4O8RA 1Z89A 1BWKA 3M46A 4PEEA 3MSGA 4XZIA 1GONA 3EX1A 3ZJ6A 3AHXA 1UBPC 2E6YA 3UCCA 1GHRA 3WLQA 3T40A 4Q8NA 4RDWA 1XDLA 1F73A 3NQFA 3CL6A 5ABFB 3VIPA 4MB4A 1QPNA 3W6LA 3DBPA 1UZ4A 4I3GA 2FZ9A 4BQ3A 4IIBA 1ZBKA 1OYBA 4O19A 4JN7A 3I4KA 3E2QA 1W5NA 1EUNA 1P7TA 2WHMA 3GDTA 1GKRA 3QPZA 2UY2A 4EK7A 1EO5A 1O5XA 4V1XA 2ADAA 1GG1A 1XH2A 3TW6A 3LHZA 3VKBA 3AS0A 5I23A 4U33A 5KZ6A 2YDRA 1EWEA 3R94A 3WDPP 3WQ6A 1WKEA 4Y6GA 3LRKA 1KLZA 2VC6A 4BQ5A 1EJWC 1X38A 2NUYA 2FZNA 3VE9A 2NW0A 2P76A 3ZT7A 4MJ2A 1UMLA 3R4IA 2JIEA 2ZADA 4HZ7A 4GY0A 5D2XA 1YKWA 3B8WA 3N2BA 2DH3A 5HQLA 4LS1A 1XCFA 1Y5WA 5CC7A 1HQTA 3W1TA 4HMNA 2BZNA 3OODA 1ONRA 1HZYA 2YLLA 1M41A 4FNPA 2TYSA 5DRIA 3SIZA 3LV6A 3DFTA 1IWBA 2DZWA 1TX2A 3U4FA 3M07A 2NUXA 3OBEA 4IGSA 4B5NA 1LOLA 2J7DA 5DFAA 1KR0A 3LMYA 1NF7A 3WNNA 2PD5A 4Z2IA 2NQ5A 1KM0A 2YL5A 4NNAA 2Z4GA 4TOQA 1UZHA 3EX3A 5HK4A 3RGTA 5DMYA 1N55A 1UR9A 1YDOA 3KUMA 3F5KA 5GPRA 1H1YA 4AH7A 1VH7A 5CPNA 1RQHA 2J6XA 1KM1A 3CWHA 4DM2A 3DKLA 1MRQA 3WH8A 3DHUA 3C0LA 2RFGA 3BSGA 4PL2A 4V1YA 3TOYA 3AU2A 3EWUA 3EXSA 4XBJA 4S3BA 1HL2A 1O6IA 1LRNA 1TO3A 4MWAC 3W7PA 4IMAA 3GH4A 3GVQA 4DF2A 3CQIA 2CBIA 2QJJA 1E6SM 2DSVA 3G1DA 1ZZMA 1V08A 1GQIA 3HMCA 3E0LA 2POTA 2R14A 4REQA 3NQ7A 1KB3A 4LWWA 4C1KA 3CT7A 5I3FA 2E68A 4GXMA 4H6KA 1Q8JA 1L6GA 5HNTA 3ZLGA 4RJEA 3W7DA 1OFOA 1G4EA 1UMYA 2E5DA 1GJPA 1RA0A 2AAMA 3NL5A 4RDZA 5CAKA 3W71A 4LSBA 1E4MM 1SFSA 7TAAA 2CBUA 1LF1A 1IYXA 2AAAA 5A5WA 2DSUA 1YX1A 1F3WA 3E2VA 2YFNA 2QV5A 4DWSB 4FAMA 3S5OA 5I78A 4HHHA 1VFHA 1M3UA 4A3HA 1E70M 2BGQA 3CLWA 5DBUA 4AYSA 1DOSA 1MUWA 2IKGA 1Q7MA 2XIIA 5CPQA 1YBQB 4MPKA 1M03A 4V27A 1DXIA 5FSEC 1POKA 4HJWA 3GTXA 4JEJA 2WQDA 1VFOA 1WDDA 1K3UA 4B90A 2G3NA 3N2OA 4LUIA 1BF2A 1XQKA 1VHNA 3TFCA 1UG6A 2WWCA 2DUAA 5BOEA 3K30A 3M41A 2Y8UA 1DJQA 1OY0A 1AH4A 1G9HA 1IF2A 4GQGA 5AECA 4DI8A 2ZZ2A 4DNMA 4AY8A 4O54A 3B06A 3UD6A 4O1EA 1W17A 3GM8A 4R7OA 1MNZA 1MW0A 2HBXA 3PJXA 4E2DA 5I3KA 4MNKA 2XSBA 1X7IA 4XUGA 1NSJA 4UFHA 3AWOA 3KOFA 3AC0A 4NI8A 2OU4A 4UQCA 4U3CA 2V2DA 1EQPA 3W2NA 1WBJA 2JFEX 3COTA 3QW3A 4P8UA 3JR2A 1CZ1A 4OIFA 3IVTA 1ZGDA 1B3ZA 5CJ5A 4QLLA 2IQDA 4F9DA 3Q58A 1JCJA 3KHDA 1Z44A 4H7VA 1UROA 3WF4A 4AIBA 2NVDA 4ZOBA 2YGYA 2RJHA 4S3GA 3PN8A 3FSUA 4UTTC 1US2A 4AX6A 2FVLA 5FJTA 1FCVA 4WK9A 2ATMA 1W91A 2VOMA 1SO6A 3LS9A 3SFKA 4DO5A 4UMBA 5HA7A 3UZWA 2G3JA 1R3RA 4TX6A 1V7YA 4HHLA 3A47A 5LIUX 4WLCA 2F6UA 1PTAA 2VC7A 2W91A 1SW0A 4L64A 1VGAA 5G2HA 3QGAC 3R6IA 4HMDA 1PYMA 2OKOA 4QLKA 4Y9MA 1W37A 2J62A 1JYWA 2OZTA 4ERAA 3V18A 1H2JA 2HE8A 3QKEA 1UR4A 1XD1A 3TJIA 2DT0A 3W01A 2HXTA 2PC8A 4I90A 4LY8A 3H4XA 3RX4A 3ANVA 3VOJA 1XBYA 3LCFA 3RLVA 2OEJA 1UOZA 3UXIA 4R9XA 4LCSA 7XIMA 3W02A 3LLXA 4HNCA 1DP0A 3UWQA 3VMPA 2VR4A 1HN1A 4L9XA 1DJHA 4MTVA 1W2VA 3DCPA 1FTXA 4JTLA 3GG0A 3IANA 4FS9A 1Q6RA 2OOFA 1S5MA 2CHRA 2QHAA 2YIHA 3N73A 3P67A 4C6JA 2V82A 3TEVA 3AS2A 3VIJA 4TIMA 3F5LA 3MKVA 1R5YA 2VR2A 2Y7EA 3H7UA 4GQBA 3GVGA 5F2IA 4DLMA 3WDHA 2QZRA 3OVGA 2D0GA 2Q71A 2QVHA 1QATA 4UTLA 4RZ6A 1VYSX 5HNNA 4F0RA 2ZUMA 3ABZA 3QEZA 3BV7A 1K1DA 3EMQA 3QH2A 1U83A 4KPLA 3MC5A 3K4AA 4J40A 4YTUA 3HMJG 1I0DA 3MBFA 4EF8A 4AXNA 5FSDC 3ZVIA 1HL9A 3SUWA 4NNBA 3H7RA 4FF5A 2QDEA 3AIVA 3DG3A 4NJKA 5A6TC 1R7AA 1GVQA 4H1ZA 2CNCA 3TXVA 3UJEA 4Z0SA 5AN7A 3C4UA 1DV7A 1R3WA 3R58A 2OVLA 3CGTA 3TJLA 4X3ZA 3WO8A 4Q8TA 3EGJA 2YL6A 4FX6M 2IPWA 1PDYA 1OF6A 3HGSA 3SRHA 4MKNA 3D0CA 4Q4MA 5E70A 3O3RA 3ZR5A 4D6DA 3SN0A 5CZKA 3RM9A 3UR7A 3ZR6A 5AHNA 2I5IA 1S2WA 5CQ1A 2ZZ5A 3WNMA 5FF4A 1JZ3A 4JXCA 4F8XA 2OSYA 3EDFA 4LJ3A 2YLAA 3N9KA 2JQXA 4OBSA 3CIWA 3E5PA 3IJ7A 3KFTA 3BV4A 4M24A 1ZNNA 1TWIA 2PDMA 2PURA 2WWDA 1FFRA 3HN3A 1AH3A 4PMRA 4F40A 1F07A 3A6OA 2GVJA 1W1TA 4AMCA 2YCLB 4DAFA 2ZWZA 4J28A 5BZAA 5MHBA 1OGBA 1AQFA 4HN4A 2ZBTA 2P8CA 5I24A 3WQ5A 4IGHA 3N1AA 2FPYA 4UR7A 3L4UA 4H9UA 4C1NA 2E8ZA 2WYSA 3PFRA 4DYKA 4GWEA 1QUMA 5IRPA 1T0OA 1NWTA 3W7LA 4Q8VA 4WX2A 5LIKX 3VI2A 2VENA 3A64A 3LBOA 1LOQA 3KCOA 3QHMA 3SSJA 3KAOA 3KL5A 2CEQA 1A80A 3VCRA 3PJUA 3T0AA 1DORA 4QR6A 2PDLA 4H19A 3DX5A 2W61A 1KGWA 4O0QA 4K3ZA 4JFWA 2WO5A 3OZPA 3IRDA 4HA4A 4UFLA 4GRSA 3B0YA 2VQTA 2HQAA 4GH1A 1TJPA 1IEWA 2JK2A 3O6CA 1P7TB 1L2QA 3O06A 4U2ZA 4C91A 2PFHA 3OW1A 2C6QA 4GHRA 1E9ZB 3PHAA 3LBCA 3HG5A 3WEOA 3CU2A 6XIMA 1J6PA 1UP3A 3W22A 1DJZA 3PPFA 1V3JA 1V02E 3MSDA 1R47A 4GI6A 4C6QA 2YYUA 1ADDA 5FL0A 5D9NA 4PMOA 3ZO9A 2W92A 1HO1A 2FGLA 2A5HA 2OGYA 3VD4A 1XRFA 4XD5A 1W54A 3CAKA 3SEPA 4N9EA 3O8AA 4D9PA 1ZB5A 3MMDA 4HPNA 4MZ8A 1QCWA 5JQ9A 3NSMA 2X1TA 4QTGA 4B9ZA 4BK9A 1NF0A 4X2PA 1EGVA 4UQ9A 5CBJA 4GFSA 3HQOA 1DE5A 2QAPA 3B9OA 4H9TA 1XP3A 2Y63A 3IVUA 3WELA 4HBKA 2DORA 3EA3A 4RPPA 5I09A 1MEWA 1YTEA 4E8GA 4HU8A 5LZLA 3V0TA 4PRWA 4IX0A 1G6CA 1ISWA 4IFRA 4MNJA 3WF1A 2EG7A 4WSKA 5BRPA 2NWRA 8XIAA 3H8AA 4PCSA 1NDWA 3PTKA 1X6LA 3ZLFA 4YWIA 2YB4A 1I75A 3BTNA 3AYRA 4H41A 3VGBA 5KZEA 1BQCA 3EAUA 4X60A 1EO7A 1DWGM 5EPDA 3LZ5A 1FP8A 3N9SA 3APTA 1UD8A 3QYQA 3BQ5A 4ZB5A 3MT1A 4ACYA 1LQAA 4GC3A 1VEOA 1PHQA 3H2FA 1CGYA 1VC4A 1UKOA 4HSNA 3MHGA 3RJYA 3C2OA 3PZ9A 3VOHA 2ZZ6A 5L9FA 4REQB 4FOKA 4WIWA 5A69A 1E1EA 1IWPA 4ADUA 3C0QA 3AI0A 4G6CA 5IHSA 1UR2A 3T0DA 5AZ1A 4HT3A 5DY3A 2VFFA 5J8LA 1LLOA 4UB9A 5CGQA 3EEGA 1TCMA 1UIOA 3M0IA 4GJ1A 4JFSA 2Y7FA 2FGZA 3O2LA 3BCDA 1RUSA 3MSYA 1H62A 1GPWA 1Q5MA 1QRQA 1VCFA 2XFYA 2XM2A 1JPKA 4J3VA 2DZVA 4U31A 4Z2GA 3DAQA 3NPWA 2GGGA 4HU0A 3LPGA 2CZ5A 3RXZA 3TIMA 4G1KA 1CLXA 1WAWA 3U9IA 5D9OA 3WQFA 3L0KA 5IFTA 3SJ3A 3VOFA 4XAYA 1A0DA 3DFQA 1NARA 5GNYA 3GC5A 2VCBA 3QPEA 3GNRA 3PJTA 5DCEA 2WPGA 2D3NA 4JL2A 2GK1A 1V6YA 1XI3A 2VGIA 4JBRA 1P0BA 5CZJA 1KA9F 3TK7A 2PC4A 4RW3A 3ZWTA 1Q6QA 5CC5A 4HA1A 3WJXA 2VFIA 1QI5A 4P5UA 1TB3A 1XDJA 4ATDA 3CZJA 3CHFA 3EWYA 3UPBA 4QM1A 1YADA 4BEQA 3QFWA 1LZOA 3RMEA 1OB0A 1O5RA 2Z1XA 4Q7NA 3W23A 1E0UA 5HUPA 3F5JA 1HGWA 2RDWA 4UCGA 3DECA 5AHIA 4ZBCA 3B8SA 3CK5A 3S1UA 3QYSA 1P0KA 3U5YA 1W1B1 2XN0A 3ZQ9A 3E1F1 5CZTA 2FDSA 1CB7B 1RXOB 4BHYA 3F7JA 5I00A 4EIVA 2F61A 2YYTA 3DFYA 3GO2A 2NQJA 1P6WA 4AZ5A 2CPUA 1IHIA 1W9UA 1KXTA 4TVDA 3GYCA 3KCLA 3LYEA 2OLHA 4G7FA 1Q13A 4UTMA 4W7VA 2P5NA 3KBMA 4GA8A 4IFOA 5JH1A 1LT8A 2IPFA 1TVPA 3I7SA 3M44A 2E5CA 5AVHA 1B31A 3UCDA 3QGKC 1FOBA 2PP3A 2ZRYA 1WXJA 4OVXA 4NRRA 4C65A 4ZVJA 1EBGA 1C8VA 1TKKA 3MYOA 5DELA 4PODA 1FWHC 1Y0EA 1GQNA 3UP8A 3CO4A 1XH1A 1CLKA 1E6ZA 4RE0A 3UG4A 1JZ7A 5AY7A 3WLLA 4N9BA 3ZVHA 5E9AA 2O56A 2VL4A 1UZDA 2TAAA 3ARPA 3U2OA 4QQ3A 2R1LA 3TAOA 4P61A 3TA9A 1YPFA 3VIFA 2WMHA 4IP7A 3U3HA 4OWGA 2UV8G 1KFWA 2UZ9A 3P5YA 2ACQA 4J3WA 2A7NA 4UZSA 4PFMA 1PWMA 4NX0A 1F3EA 4AC1X 4HPGA 1LBFA 5BRQA 2KX9A 3AZRA 1I60A 4I7UA 4AISA 2WZHA 2P53A 4O53A 1K02A 4AD3A 3WQOA 1AZ2A 2H90A 3B0XA 1Q6OA 1UKSA 3LRMA 2VRQA 3GTHA 2H8ZA 4JTEA 3NURA 2YXOA 4NZJA 3QPYA 2BHZA 5I07A 1QBBA 1JULA 1KFJA 3SQMA 1XX1A 5K3VA 3N04A 3VDGA 1UC4A 3A21A 3QY6A 5I0DA 3GXTA 5LHEA 4G5DA 3K5XA 1SW3A 4AEFA 1YPIA 3TYEA 4D8AA 3TC6A 4LS2A 1LQ2A 1QNRA 3CIXA 3TLLA 2VYOA 1KQYA 1E0VA 1IXPA 3LEPA 1RBOB 3M43A 2DQXA 1QTWA 4O1BA 4XO6A 3HPFA 5D03A 4QDWA 1K9TA 3UERA 5DT5A 1VIZA 3WNOA 4ENLA 4Z2JA 1M1BA 4Q6JA 4QAIA 3MWAA 2WSRA 4HYRA 1HP5A 1PZ3A 2Z1SA 4EPEC 2C0AA 3FJLA 4R7WA 1Y8BA 3QV8A 3NZ1A 1R2SA 3CZKA 1V6XA 3DYOA 2V3DA 3N4EA 1KWGA 2YDSA 1EB3A 1TPDA 5CC6A 1BQGA 3CV1A 1TZ9A 1PZ2A 4DB7A 1UUMA 4UBPC 5DMNA 3BXWA 3L7RA 5KINA 1F3TA 1VRXA 4O13A 4ZB2A 3KOXA 4S39A 3VDHA 3RLHA 3ARXA 3URBA 3UR2A 1GJUA 5K4ZA 2ZRXA 1EHAA 1W6TA 2Z27A 4J3SA 3FEQA 2FTPA 3PZGA 1Q7QA 2QW5A 1S46A 4UC5A 3ITLA 1TG7A 2V6AA 5C6MA 1D7FA 2OODA 4GNKB 5AHFA 4FX8A 4KCWA 2PDWA 5DO8A 4C90A 1R3SA 5AC5A 4IQJA 4Y8FA 2BBFA 4AAJA 2FTYA 1VFLA 1V8EA 4Y7EA 1GQKA 4YJ5A 4LV9A 4HB7A 1LWJA 3CUGA 4FLSA 3EOOA 1ONEA 3AHZA 3G6LA 1GK8A 5HDRA 2R8WA 4C1NB 3WQVA 3S4TA 2PDQA 4DUVA 4V2XA 1JZ2A 5D33A 1EWDA 2YSWA 3PG9A 3F03K 4ZA0A 3NO1A 4DJFA 1EJUC 3BCFA 2RDXA 4DUOA 3I6EA 3IAQA 4WJEA 3MI6A 2WAGA 1HVQA 4F0SA 2EAWA 3TFXA 3VKJA 1FWIC 3CTLA 1RK6A 2O9PA 4YHGA 3LI1A 3TLQA 4QBXA 1EIBA 1LG1A 3D5HA 2R82A 4J4KA 5DCBA 4I7VA 3UVIA 1FP9A 5FF7A 3Q45A 3ARTA 3SFWA 2DH2A 4LVBA 1LROA 5HMFA 4E5TA 3HPXA 1BFNA 1UA7A 3VDBA 3M4HA 2YW4A 1E43A 2OG9A 3ZR4A 2P8BA 4XO7A 2YXXA 4CNSA 4F0KA 2HV5A 2NX1A 3IJDA 1WXZA 1FCUA 2YPIA 4DYJA 4PUUA 3H2CA 4P2VA 3VNDA 4CD7A 9RUBA 3A9BA 3H2EA 5ECVA 5DX7A 1PE1A 2JGYA 4PE8A 3MANA 1TJRA 4GY7A 5A2CA 2C13A 4NZ3A 1X1OA 5CPMA 4JN6A 1MVYA 3PR2A 3R5EA 1SO5A 4E2OA 3W1XA 2H6RA 3LHYA 2CFFA 3NGJA 3NQEA 3VD9A 3RMJA 2NXGA 3WK0A 4JNZA 4WXZA 4BQ4A 1KQZA 4M8UA 3NL2A 5I77A 1HF6A 4HHMA 5U7SA 4ES4A 5CPSA 2Y7DA 4JNYA 5FOOA 3V7PA 3PNUA 2YDAA 3V16A 2WMIA 3H54A 4HNVA 3L2LA 1TZ7A 3FDKA 1EC7A 4AD2A 3IEBA 3W07A 4DF1A 4ZXLA 3CQ0A 3TTOA 1ITUA 5LA0A 4QEHA 2DJLA 2DVUA 3MW7A 1MW3A 2ZXDA 3GS6A 2J77A 1JL8A 4TTUA 1JVNA 2D2OA 4NAFA 3LRLA 2NQHA 2PBGA 4ZL1A 4M56A 3EDJA 1JD7A 1NDVA 1F6KA 4NJJA 1HW6A 4MFDA 1VPXA 5LNVA 1RBAA 3WLPA 1GT8A 2DU2A 1YIXA 4Q22A 3W7IA 3S1VA 4KFOA 4DZAA 4F3HA 1J5SA 2Z6IA 4JCLA 2E3ZA 1XW8A 1OX5A 2X8RA 1BVZA 4B4FA 2QJGA 3LLDA 7REQA 1LYXA 3VFLA 1HO4A 2ODOA 3IARA 3PK7A 1XKJA 3PJWA 1VBRA 1HJQA 1T99A 3STPA 6ALDA 1UWUA 2BSLA 5FF3A 4RE2A 3EPMA 3VYLA 4I9JA 3W1LA 1KM3A 1G94A 1E9LA 1YDYA 5F4XA 1UWIA 2Y0FA 5K9CA 1SYTA 2C3ZA 4AC7C 3T8LA 1DJNA 3AJ7A 2VX7A 4KEMA 1OADA 1JCYA 1I2RA 3ZT6A 3FVDA 5I3GA 4E2BA 1TX0A 1TV4A 4HA3A 4C6IA 1ZUAX 2OGJA 1K4GA 3HGRA 2OEMA 4AXKA 1PBGA 5KEZA 4X2RA 3FA3A 5TD4A 1TWZA 1E15A 3T4WA 1GCYA 4GCXA 2GK1B 5CSRA 1DPMA 3ITYA 5BCAA 1H7OA 2X1UA 1KD0A 2V9DA 3KE0A 4MLRA 3LGGA 3CUFA 3ZZ1A 3FA4A 4FB7A 4GE8A 3RLGA 4UOQA 1XSJA 5D05A 3MDWA 4QLJA 5GVJA 1HX0A 3W1MA 4QROA 1EJSC 3E96A 1ZP3A 4D1JA 1Z7AA 4TQTA 4PSPA 1J4EA 5KTLA 3ITVA 1AUSL 4Z1BA 2OYMA 3NPUA 4QDMA 4MWAD 1ITQA 3EDDA 3OA5A 3RX2A 3WBWA 4IL2A 2R1MA 4MDOA 2OT1A 4K39A 5T9CE 4EACA 4RZBA 1UIPA 1TUXA 2YBTA 3WF2A 3AS3A 3DEQA 4CN4A 4ZTXA 1JRCA 3L0NA 4AVOA 2C1IA 4S3EA 5J5DA 1JQXA 4MZ1A 4CUCA 4Y96A 4PBFA 2XSXA 5HMDA 3NDZA 1OFEA 4H6RA 1WO2A 2NV9A 2WMGA 4XBKA 3SY8A 4CCEA 2QF7A 3FX4A 2WHJA 3KL0A 3G1AA 5D2WA 4KEVA 1FX6A 2PI6A 3E6EA 1BEUA 2BASA 4IGNA 5A8GA 1K70A 3FW6A 1TRDA 2PF8A 3K4DA 3HF3A 5C8BB 2BY1A 2Z1WA 4CNNA 3SO7A 3ZLHA 3PFMA 1F6YA 3O1NA 3P0WA 2RDTA 5ECUA 4C6DA 5JBDA 3G77A 3FIGA 2CHNA 4HD5A 3ZVHB 4JIEA 3IVSA 3WQEA 4F0HA 3DFHA 1VLIA 3RUBL 4MNMA 2CKRA 4DO7A 2POZA 4DX3A 3M47A 5AC4A 4CU6A 2PDXA 2ZX6A 4Q7BA 5BWFA 3W53A 1XPYA 4IJRA 1KM6A 4GINA 3P8JA 2DIJA 4B5WA 5IDIA 2WSKA 1B3WA 1W3TA 3PP7A 4MY1A 1VBGA 4XAZA 2E6AA 4M29A 1GYNA 4C6CA 3KM8A 4S38A 5LNSA 4WY0F 3W25A 1EJ7L 1JF6A 3KOYA 1KFKA 4F2TA 3B9NA 4YCPA 1P0NA 2VELA 3T55A 5BXTA 3AIRA 1XG4A 4S2BA 1AZ1A 4QDPA 2E25A 3GH7A 4XQ6A 3QF0A 2G50A 5D02A 1SJAA 3ICJA 5T91A 1KCLA 4XD6A 3W88A 2IS7A 2VDGA 3BAWA 3UJRA 1CEOA 2EJAA 2YA1A 4AY7A 4GX8A 5ABTA 1JUKA 1S3TC 4JTGA 2XIJA 3FS2A 3P80A 3G1YA 5HOSA 2OMAA 4JEQA 3IV8A 3CT2A 1AA1B 4NZ5A 1M9HA 2ISVA 2CLOA 4GZJA 4B15A 3TJ4A 3HU7A 4MKSA 2P88A 3TCEA 5HANA 2X40A 3O63A 3GIQA 3LZ3A 4AVFA 3SUVA 1D9EA 2E77A 3KDNA 2PDKA 1ICPA 1XYFA 5EKYA 3UWYA 3SAZA 1R3QA 1DHPA 3FY1A 3NSNA 3UFYA 3IWPA 1UC5A 2GUUA 3ISIX 1MZHA 2Z00A 3F4DA 4HMCA 3O0FA 4WR3A 1KR1A 4OV9A 4AYGA 1KBBA 3NVTA 4EPDC 2ZTJA 4RNJA 3WDRA 5K4XA 2RKXA 3AIUA 3H55A 5HWJA 1RA5A 1O1ZA 3LHTA 4WF7A 1JYVA 3LM3A 1A47A 5DY2A 3UBPC 3UJFA 2FHCA 2INEA 1XC4A 1Q45A 4O14A 3S2NA 3NSXA 4PH6A 4E4FA 2XH7A 4EX4A 1DBTA 2JF6A 2QF8A 4P7RA 3EXTA 1GGOA 3KBSA 1EDTA 3HG3A 1GORA 1DWHM 4PL1A 3LI0A 3SADA 4ZGYA 1F4AA 4GACA 2QCMA 3G0XA 3GR8A 3E2RA 2QCLA 3A4WA 4WJXA 3QM3A 3RPTA 1W5OA 1O68A 2WHLA 4RDVA 1XRSA 1BF6A 2JEQA 3OJGA 2ZQ0A 1XFBA 4DJDC 2E1DA 1A3WA 3F2DA 3EPOA 4TXEA 2ZOXA 5G2WA 4WOZA 3VDCA 1W2PA 2VEKA 5AKQA 3P61A 3QC0A 2FB2A 2GYIA 2SFPA 1TTQA 2VWSA 4EE9A 2QJIA 4UTWC 5HPOA 1XLLA 4DY1A 1XIIA 5DLCA 3MV01 2QCGA 4K1GA 2QCDA 4IMEA 4JTAA 1X39A 3ABOA 2GQ8A 3K46A 5CPLA 1Q6EA 2ACUA 1CXLA 5GNXA 3EWWA 1A5UA 4PMQA 3VC6A 4KMQA 3JU2A 4O28A 4LQ1A 3VZZA 2G3FA 3IUHA 2PP0A 4DBSA 2J7BA 3UWZA 3VX1A 2EPNA 3L67A 4XVEA 4R85A 3THCA 3NNTA 5J5RA 3SY1A 1ZU8A 1RD6A 4FA3A 2OXNA 3N6HA 1OEPA 4WKFA 2AOSA 2XH4A 2WPBA 3WSUA 2ZZ1A 3G3DA 4JX4A 5A3HA 2VGBA 2YX0A 2GZXA 2CC0A 3AZSA 3L5MA 1MXGA 3DH7A 5B80A 1QJWA 2V0TA 3TAKA 3UPWA 2ISDA 1AW5A 3KDOA 2OWCA 1MFUA 4AIOA 3GXFA 1FWTA 1ZBWA 2PWEA 5EA9A 5HULA 4MHBA 4HOZA 2A85A 3DUGA 1C91A 4ERIA 4JCMA 1JYXA 1PCWA 3SRDA 4CQDA 4GI8A 4UCFA 2NUWA 1TPEA 1CI1A 4BF5A 5EBAA 4JS3A 4DLFA 4DHGA 2IW0A 3LPPA 1OVDA 5I2UA 2IQ0A 1FUYA 5CPTA 4FIRA 1LWHA 2FVKA 3EB3A 3AIBA 1AQMA 1MMFA 2ZXBA 3BW4A 5BWAA 3FDGA 4YU1A 2ISSA 2QIIA 2XN2A 3D46A 2XWEA 2PODA 2WMIB 4B3LA 1FWRA 3NQ8A 3LGEA 4ZQOA 2ZXQA 4QRNA 1IWAA 4Z42C 3FNDA 4CEXC 1G67A 4UMCA 4IL0A 4W89A 2I57A 4HYVA 4LRSA 4RL3A 3UGVA 3FV9A 4QS6A 3P5ZA 3KRSA 2XFRA 1EH9A 4QISA 4NAFB 4XK2A 4A3UA 1R3YA 3HIJA 5A6MA 3LCXA 4EWND 4DUWA 3HURA 1W9BM 5FESA 3LQLA 1S2AA 5C9ZA 2XVKA 1BHGA 1ME8A 4EKJA 4GPNA 3NR0A 4QCFA 1FXQA 3NJ3A 4QHRA 3TXZA 2ZRWA 4AZBA 1Z8AA 3OYZA 3G24A 3ES7A 4IUOA 4ACZA 7REQB 1Q6CA 1XHGA 1QHPA 4LV4A 5D9MA 1V02A 3QTGA 2VC9A 1G4TA 1H4PA 2DFAA 3BJFA 2NQ9A 1UWTA 4JQ3A 4L80A 4WDXA 5D38A 2VD9A 2ZUSA 4MIMA 1B4KA 4JTDA 1S1PA 4QG8A 4Q8OA 1B90A 4AD4A 4XZWA 1BG4A 4GUFA 4OV4A 1LL4A 1PX4A 2DSKA 3VTRA 5CBIA 3WL0A 4Q7IA 1XIHA 4D1IA 3CHDA 1K9FA 3AFBA 1VLWA 4QG6A 1ZY9A 1B9BA 4Z2LA 1KFLA 2WNNA 4IXHA 5FIPA 4WVXA 3S3GA 1E6XM 1DXEA 4QEEA 3DHPA 4LOCA 1GOXA 2GGEA 1H1NA 2ASHA 1A0EA 4EAYA 1N8WA 4QE4A 3CPGA 2DZTA 3RDKA 4DUXA 3WEMA 2DZXA 3SBFA 4FLQA 3TSMA 3NG3A 3VZYA 3CQHA 1B3XA 2B4GA 3QKZA 3UVAA 4C6MA 1EX1A 3GNDA 1SMDA 5CCZA 1RLDA 1VF8A 3A23A 1KXHA 2PE4A 3HQNA 3TH6A 1E1FA 1T8QA 3T0TA 2I5QA 1XINA 4LAUA 1KFCA 1LTDA 3HFTA 1CGTA 1FDYA 1WA3A 1ODUA 3DHDA 3OVRA 3IJQA 1K8YA 2OO6A 3M0ZA 4QFUA 4JIQA 3WF3A 5CG7A 2HXUA 1TREA 2Y6ZA 2VKZG 4LX4A 3UJSA 2PZNA 3SUTA 3MMWA 1SSGA 4HIBA 1RVGA 4ZEPA 4PTWA 5FJUA 1US3A 2HK1A 4QE1A 2VD8A 1LQ0A 1K77A 2A7PA 3PB2A 3M9YA 3VNMA 1VR6A 3UXAA 1ZPTA 4MYXA 3GNOA 4Z08A 1O4UA 4NU7A 1CBGA 4ZO8A 9CGTA 4QAWA 4W5ZA 5B7YA 4GXPA 4M1RA 4XSMA 1H61A 1JAEA 4QITA 5DF0A 1XISA 1C7TA 1V79A 3QMRA 3B0PA 3HFYA 1YYAA 1KNWA 3S6OA 1QW9A 1E1CA 3T08A 3WD3A 3ABXA 3QSRA 3ARWA 3IGUA 4JQAA 3UT0A 4PTMA 4LB3A 2NLIA 4LUSA 3KP1A 1BWVA 1ZRQA 4FF7A 1IT0A 4NASA 1W9XA 3M6YA 1DJYA 2EQDA 1Q2RA 1IXOA 3BW3A 4O1AA 3L2MA 2Z29A 3HGOA 3W38A 1TV8A 1RBLA 2R9RA 4CD4A 4XIAA 2QPUA 4HTBA 4CD6A 2Q09A 2YCKX 3ZJ7A 3WQDA 3B04A 2GVLA 4M82A 2CLIA 2PBOA 4ZQNA 2A6NA 3QV9A 2YB1A 1JAKA 2HVNA 5GJNA 4IZGA 3WY1A 3R43A 3CMGA 2HDJA 1FH8A 6A3HA 4HTYA 3OQ8A 1DQXA 3G18A 5H6HA 3NZGA 4ICNA 2ZCGA 2FZ8A 3F4WA 1SZFA 1W32A 3TW9A 2PA6A 1H3GA 3MP5A 3O6AA 2PDIA 3MVIA 1E73M 2EG8A 3NPVA 4ROPA 2OSWA 5H8PA 4L1XA 4OE7A 4PMDA 1RJPA 4MM1A 2CHOA 1EBHA 4RDYA 3H24A 4DJEA 2GVYA 2WVSA 4F4RA 1SO4A 1VFSA 3TX9A 2VCAA 1PHWA 1MWOA 2AGTA 3ZSTA 4N6EA 3VMNA 1UPPA 4YS1A 3EX6A 3I6RA 3V35A 3L65A 2H8XA 1DL3A 1T8XA 1U5VA 4IX2A 2V5CA 3BJSA 5C54A 1FHUA 4J3UA 2DZSA 3ID7A 3DI1A 1BGGA 2WVTA 1PZ0A 4KRUA 1OX4A 4DEFA 3SN1A 5CBBA 1TR1A 5KITA 3IJLA 3ARUA 3UY7A 3NL6A 3BLPX 2YDQA 3IAPA 2J75A 1LL7A 4PUMA 4CD8A 3R89A 1VCVA 1ZHAA 1DQWA 3BAXA 3A4XA 1XYZA 3DYMA 3AAMA 2J7HA 5EB8A 5ABGA 1NEYA 3T1GA 1RY0A 5DT7A 2G95A 3DESA 2ALRA 2CLKA 3ARRA 2JE8A 2V2CA 1JEZA 1U1UA 2J9XA 5A95A 4RXFA 4YNGA 3PTMA 3M0XA 5CAHA 3WBXA 2Z6JA 3TQPA 2GUBA 2ACSA 4AHQA 3C0SA 2X05A 3B03A 3KP0A 3W29A 2OTDA 3TQ0A 3BLFA 1PB0A 5ABHA 2VQUA 2VR5A 4O1DA 3UZYA 4ZXOA 1MSSA 3TYUA 4HCHA 1EOKA 2B7OA 4CU7A 3ZOAA 4QCEA 4JAWA 2W4XA 4MB3A 1PAMA 4V33A 2QXWA 5JVLA 2WBGA 3THDA 3E02A 4OJYA 1EGZA 1WB0A 4C6FA 1PVNA 3ZMRA 4I9TA 3BGGA 3MJMA 4UOJA 4GO9A 2VZSA 4DQWA 1AJ2A 3PPGA 2Q3OA 4O17A 3W7OA 4GIAA 1FWCC 4A2RA 1GOKA 1ECQA 1T6MA 3N3MA 4P7OA 4OECA 4QP0A 4LYKA 1W1ZA 1RVKA 1ZP4A 1VBJA 3F4CA 4A3QA 1SPQA 2CIPA 3IIXA 3MU7A 2IQTA 1E40A 3SRFA 2C7FA 3EA2A 1IIHA 2Z25A 2NX3A 1ESWA 3OTRA 1XDMA 1E0TA 1KRAC 1RV8A 2XFWA 4UIOA 4AZHA 4B5UA 4ZO7A 1GVYA 3M0YA 1VRDA 2F2KA 4LC8A 2D1ZA 4Y9PA 4Q4KA 2EGZA 2RH9A 2YCJA 2QYGA 4YVVA 2QCDB 4IOTA 1A5LC 4WDWA 4GUHA 3DG6A 4MAZA 1EJRC 4IIDA 1E71M 3IIPA 2DZPA 1IT8A 4LY4A 4DBEA 3H53A 1QNSA 8XIMA 4DI9A 1R30A 1K7XA 3C56A 2ZA1A 3CH9A 1GQLA 1EZ2A 4HPJA 2FB3A 3J7HA 1R38A 1F5ZA 3DI0A 1QNVA 3LNPA 5AHLA 4PMXA 4G8TA 1MW2A 1KGUA 2XHYA 1X98A 2VVSA 2ZC1A 4XZBA 2HWGA 1EEPA 4P7NA 2OLSA 3STGA 5CKSA 2C79A 3FOKA 4MGGA 1RD5A 1E56A 2Y88A 3QHNA 1DJXA 4PCPA 2PAJA 4M6VA 1TV2A 5EMLA 4ZENA 1IEXA 3NZPA 4NZ1A 3V75A 3INPA 1XIDA 2D24A 3AMLA 1BKHA 3GHTA 4C6OA 3GK0A 3BANA 3WMLA 3GBDA 1W3LA 4WDTA 4EXQA 3SURA 4LAMA 4UOZA 4FNRA 1KXVA 4NL1A 4XUYA 3W87A 4AX7A 3DOPA 3UWUA 4FNUA 3CHVA 3E12A 4ALDA 3SQSA 1UPMB 3PZNA 3BSMA 2E67A 4O11A 5JBFA 2AGKA 5LGXA 2OSXA 1EYWA 4MFEA 4FPSA 4LS0A 3CH0A 2YZ5A 3AALA 4OBTA 4XWUA 2VZVA 2W3ZA 1OABA 2VMFA 3TZFA 4HGXA 4XX6A 1VEMA 1YTDA 3FYOA 3W1QA 3UWWA 3ANYA 3WYZA 2ATSA 3P14A 3TTQA 4BFAA 3BMXA 3KOZA 1QK2A 2J47A 3S83A 1BSIA 5A6BD 1ME9A 3L4WA 4J3TA 1E5JA 2PU0A 4H7ZA 4XKYA 3WQ4A 3VCNA 1XYAA 1CXHA 3U7BA 4M0XA 1P0EA 2FTWA 2FMNA 3N19B 1OD0A 1BPLB 3CWNA 4EPBC 1MQQA 1TVLA 4JQ2A 1YDNA 4X61A 3RU8X 1KCZA 1I2OA 2JGQA 4ZSUA 4AD1A 3W1RA 2XFFA 3U5UA 3TN4A 1ZBVA 4S1FA 4GVFA 3VNLA 1KLYA 5DMMA 4ACZB 1JNDA 1QI3A 2VRKA 4KT2A 3RO6A 2QGYA 5FAGA 1I0BA 4UTIA 1DJWA 4WEVX 1I8JA 3RCNA 3CYVA 1V5XA 1PKLA 1EYEA 1HXJA 3GW3A 2WV8A 3VMOA 3D47A 5D09A 3PBYA 1C3FA 3W2LA 4LRTA 2PTDA 4JHZA 3VKDA 4W86A 2PDHA 4W85A 3K13A 4R3UA 3FK4A 4WY0A 1BYCA 2AKMA 3AUJA 2Q6ZA 4TV5A 3VIIA 1ISXA 4JZ5A 3VIKA 4JIRA 4EAMA 2PZ0A 3WL1A 3WJYA 4KKXA 1GG0A 4DXKA 2GSHA 1V6TA 4S2CA 1QXLA 2TRSA 3KCJA 4KFPA 4HHPA 3LU2A 4XISA 4CU8A 1FHDA 2OZ8A 4H9VA 1XIEA 5AYBA 2E0PA 3M7WA 1G4SA 3BO9A 4HOWA 3URQA 2R1KA 4IT1A 2X16A 1GVFA 2B7PA 3CB8A 2A3HA 3S8HA 1TSIA 3DERA 1F05A 2PTZA 3PF3A 4L1GA 4L65A 4PUJA 4UFKA 1SZEA 3RRAA 3GWQA 1NJJA 2OELA 5K7JA 3WK2A 2YL9A 1OCNA 3HG2A 4XVDA 5CSSA 5C9WA 6TIMA 2XZ7A 1Z32X 1W1VA 4R88A 4MOZA 4GZ7A 4TX9A 3MUAA 3A3WA 4JFUA 5PTDA 3U57A 2CLEA 5FCZA 1R3VA 4AEOA 1OG0A 5HMEA 1VFFA 5C5YA 2JKAA 2PDNA 2F38A 3S9YA 1XD0A 1ALDA 1EX5A 2ZUTA 4I6VA 2QCFA 3GUGA 3ZS4A 3W2MA 4W8LA 4IFKA 4NZCA 1AVAA 1EKOA 3GXDA 1XUUA 2W67A 1FHVA 1FQ0A 1RJRA 1WNOA 4GC4A 1TRIA 4IP4A 1AFSA 1OCBA 4MPQA 2GJRA 4EP8C 3SW6A 1XLDA 1H51A 3VC5A 4DZHA 3HQPA 3BURA 1G7VA 4UTFA 3WUEA 2G4FA 2Z1BA 1D8WA 4C6PA 1E1CB 4D8LA 5JU6A 1G5AA 1GHSA 5AZ0A 4J3ZA 5AYYA 4LUSB 3W27A 1CXKA 1A5CA 1T40A 1DWFM 3CQJA 2Q02A 5FJPA 4FSAA 3FKRA 2P50A 1RP8A 5CH9A 3QLDA 3LERA 2QQ6A 1J2WA 1VQTA 1BGAA 3LTSA 4GMEA 1JFHA 3S5ZA 3E0WA 2Y61A 1QPOA 4JTIA 2QJMA 1GVEA 3MKKA 4D72A 3NQCA 1DTNA 3BAYA 3TP4A 3CUIA 1A0CA 1JCNA 4AVNA 1OZQA 3T8QA 5FL1A 6TAAA 1TPWA 2WOQA 3C2YA 4A8LA 4GBUA 3OOQA 3WLRA 1KM5A 1J12A 4IIFA 4JTUA 1I1WA 3PBVA 4MWAE 1E55A 2FHBA 2W63A 3B40A 3SR7A 2XYLA 5HAOA 2VP8A 3LN3A 3RR1A 5LA1A 1QNQA 3G2GA 4Q4SA 4A8RA 2PRLA 3PM6A 4GK8A 3L5AA 1VIWA 1ZSXA 3SCRA 3TTEA 3OGRA 3FLUA 2ZTKA 3GYEA 4Q4QA 4PULA 3NOEA 3CIVA 1B3OA 3WUBA 3VNZA 4B4HA 3M0LA 1ZAIA 3AYTA 3N2CA 3U2ZA 2XWDA 1KW1A 2JKPA 3SN4A 2RHGA 2HROA 1RHCA 3W81A 3S2MA 1QOPA 3EX4A 2CKSA 3FSTA 4PGLA 2GGIA 1BXNA 3BZGA 2GOKA 1DIEA 3NA8A 4F0LA 4V15A 1BRLA 4B2DD 1PIFA 1DYSA 3PSWA 1OX4B 1CXFA 2P1FA 4RV3A 4O18A 3MWCA 3TSDA 1X97A 3LHUA 5CZSA 1J96A 4KWOA 2OQYA 3PZMA 1J2BA 3NM3A 3IJIA 3LG3A 3NVDA 3GU9A 2I56A 4L6HA 1Z3NA 1LORA 3WNPA 2BVWA 2XIOA 2OWWA 5E1QA 2G97A 3C8FA 4UQDA 1ZL1A 3RYSA 4F2UA 3FJ4A 4N4QA 1UUOA 2E1WA 2X0HA 1LCOA 4N4PA 1EPVA 1J9YA 4IPIA 1DEDA 5IFPA 3W73A 4Z1YA 1K6AA 3JZUA 3VOGA 2PDGA 1XPGA 3N17A 4N9CA 4AZ7A 4MG4A 1M7OA 4W84A 2PGRA 2NXHA 2WJFA 3H21A 4C6BA 2PCQA 3K8LA 2QMJA 3BDKA 3BLLA 5T9BG 5I3IA 4E6MA 1JPHA 3KS5A 4H7CA 1R86A 1TIMA 1AD1A 3L68A 2Y70A 3MZNA 2ON3A 3N29A 1PO9A 2FHFA 1NTHA 4DF0A 4O10A 4CCDA 3MYPA 3I3EA 4J5NA 2PDUA 1PL9A 2E5BA 4M7SA 1IV8A 1V4YA 2A2IA 4O4VA 2OPJA 3GAYA 1E72M 2A4AA 3ENLA 2QUTA 1C7SA 4XAGA 3GFXA 2V3FA 3GKFA 4A3YA 4ICCX 4BEUA 3WKZA 3NO5A 4G9PA 4YTTA 3KZPA 5E0CA 5HWMA 4NF7A 2BXVA 4PA8A 1DKWA 3TNBA 1CXEA 2WC7A 4HZ8A 1KRCC 1V3MA 1HG3A 1LUCA 1BLIA 3BSHA 4DBUA 4Z1AA 2ALDA 2A3LA 3W7GA 1Y5XA 1XLAA 1UW9A 4XZMX 4H9ZA 1K4HA 3BICA 3B8TA 4UMAA 2UY5A 5LIWX 2GDUA 5KMYA 4O16A 2BB0A 1ZBCA 3WBAA 3REQA 4QS5A 5H2ZA 3BGAA 3OB8A 4C6NA 1FWSA 1Q6DA 1MO0A 3SECA 2CU0A 3NAVA 2YL8A 4GVHA 3W7RA 1W3NA 4L4PA 4JTKA 1NOFA 1VD6A 2WM1A 4ASTA 1WYIA 3USZA 4NJGA 1UH2A 3S1XA 4LF1A 2GWGA 1AK5A 1PWLA 3TQKA 1PTGA 5A1AA 4M5PA 1FKXA 5GQBA 4M19A 3EXRA 1WAUA 4FALA 3N6JA 1BAGA 3THQA 2R94A 3PULA 4CNOA 3FVMA 1X6NA 1LWIA 4Y2WA 1GQJA 3VGEA 3EX2A 4O4WA 2DVTA 1BG9A 1AJ0A 1A3HA 4Q8WA 4JTCA 3V3WA 3SIMA 4JGDA 1NFBA 3OIHA 3NTYA 1XSIA 1GW9A 4PCTA 3C52A 1A5AA 1P6BA 2I16A 4DXVA 2DT3A 2VJXA 4GZEA 3VM7A 1WUFA 1XLMA 3CL7A 1SJDA 3OLEA 3VNKA 2CBJA 3V1PA 1JPMA 1B0IA 1V3IA 4DJDD 3WQPA 3C8NA 3KVMA 5D30A 2ISWA 3VE7A 2B7NA 4LCRA 2V2HA 3ZT5A 1NP2A 5HJYA 1OBAA 4YN5A 1EF3A 3GKAA 3UG8A 3TQVA 4ZO9A 3E0VA 3P7YA 3ECQA 4XKYB 1REQA 3CL8A 2FGBA 1QW7A 3DENA 1QW8A 4XZNX 3STFA 1VJSA 1M7XA 1K7EA 2O0TA 1YMYA 4XB3A 1GTHA 3PG8A 2WZMA 1R7OA 2ABBA 4P8WA 4GQQA 2WMFA 4J1OA 5FEPA 3VPLA 3KEHA 1J93A 4EANA 4AMAA 3TA6A 5JXQA 2Z2AA 1A50A 4GYPA 4XKMA 2V3EA 2ZDSA 4MY9A 2YKKA 2QDHA 1YTKA 1M04A 1MFVA 4IPLA 3B9EA 1ZS2A 3MZ2A 3N2MA 1DWJM 3UF9A 2EHHA 5FAJA 1JI2A 5I5RA 2ZZ3A 2XH2A 1B3VA 5LNWA 1J18A 2YR1A 1CT5A 2DZUA 2V81A 3WDQA 1UH3A 2WC4A 4NZFA 2LLEA 1A5KC 4B3ZA 4WY0B 4BF7A 2QCHA 2B81A 1P48A 4GD0A 2FH6A 2Z1KA 1HJXA 3V1HA 3L21A 4LALA 3GIYA 4UQAA 3EDKA 1XH0A 1XLGA 3WN6A 1RSCA 2W62A 2QLYA 3AMKA 3UWEA 3RITA 1QMLA 1WXYA 2ZVIA 1EQCA 3KTSA 3PAOA 4QG9A 3GG7A 3EWZA 4YXGA 5CGTA 1UR8A 1AQHA 3RNDA 3EB2A 3RG6A 5DEZA 3W7NA 2C0HA 3CUXA 1RCXB 4UTUA 1EC9A 5JIWA 3LNMA 2CESA 3GXNA 2PLJA 1XIFA 2J7GA 3P2VA 3DG7A 1Z41A 2AQVA 1XLBA 5CLWA 1OK6A 3F4NA 1W3JA 1IXQA 4KWSA 3QMTA 3QZEA 3HV8A 1R6WA 3P81A 3MUIA 4JICA 4ZO6A 3SCTA 5J04A 3IRSA 1QFEA 3C86A 5EMMA 4AZCA 1NELA 7ENLA 3V5OA 1UD6A 2HEJA 2A3CA 2VFEA 3CO8A 2VI0A 4AEEA 4M6PA 3P60A 1G1YA 4UQEA 2Z0IA 4N2YA 3TV8A 3LCIA 2BV9A 2BGSA 4KW2A 1XCXA 4BKNA 4IFKB 5F1UA 3C2RA 4L61A 4R34A 4US6A 4MJZA 1W1IE 1LBMA 1JZ4A 3VGDA 3U0HA 3NFUA 3O0KA 1UWRA 1MEHA 1TTJA 3V5CA 5H8MA 1LL6A 1B3YA 3WLOA 3UR5A 5IHRA 4RNFA 3WQWA 1JDCA 3R8RA 3PWGA 3S1GA 3LPOA 3W75A 4MLJA 2WW5A 3SCOA 4IHCA 4HNNA 3G1HA 4F0MA 5EMUA 1H49A 1EL3A 2J8FA 4CQCA 3OZOA 5FEZA 4DJED 2PPGA 2UY3A 1TA3A 2E9BA 2ISFA 5IDZA 1VHCA 1EA0A 1R46A 3NWRA 1A5NC 3G22A 5AHMA 1B30A 1SQ7A 3GTNA 1BYBA 4IM4A 3TR2A 1LDCA 3Q2DA 1FCQA 3CZ8A 4WSJA 4ZCWA 3B0VC 2ZUNA 1Q6FA 4QX4A 3QSTA 4K36A 1S2TA 2GDQA 3BC9A 3QTPA 4NVTA 3VXGA 3TU9A 1ZCOA 4IPNB 4NUWA 2TMDA 1JJKA 1F76A 3CHEA 3UZJA 4YMZA 3G8RA 4X9SA 4TU1A 4GJJA 1F4HA 2ZFAA 4GIYA 1WDWA 1Q65A 4N6FA 1MW1A 5C2GA 4O0ZA 1WOBA 3CWOX 2KZHA 1W8GA 1FH9A 3WD4A 1Y7VA 1H7WA 3FJ6A 2EF9A 3NZRA 4WD0A 8TIMA 1Q6LA 3K1DA 1P6CA 4K7VA 1OSEA 1NWUA 2PCEA 2VDHA 4DWSD 4HNUA 3KLKA 5LGZA 1EXBA 4O1FA 1ZCCA 3RILA 5HQEA 5AHEA 2CLLA 5A94A 4MUPA 3ZJKA 2ACRA 3RO8A 5BOOA 2DT2A 2VEFA 4KGLA 3C3UA 1MUMA 4WSHA 4GCAA 5LKYA 3C3NA 3ZFHA 4K7YA 4K8HA 3GC2A 3GD6A 4IMCA 2J7EA 5TF0A 2QCCA 1ZLPA 4O52A 3LCHA 2YBUA 3AYVA 1O5QA 4A8NA 4OUIA 4JR5A 5K9XA 2QCEA 4CVWA 3LB0A 2A3EA 3BW2A 2BNJA 2JF7A 4PCNA 4KWUA 1E51A 4HYWA 2NXIA 1QDSA 1UWQA 2QUNA 1B5TA 3G1VA 4PMZA 3LQGA 3VKAA 3DC8A 2PD9A 2JBMA 5LNUA 4GG9A 3W2JA 5D2TA 2VEMA 1OGSA 1SW7A 3G3MA 3GG8A 5BROA 3RCYA 1HTIA 2PLCA 4LBSA 3L12A 1CB2A 1NDYA 4UTKA 4K38A 1TE1A 4GVIA 3W85A 2HRWA 2CBVA 1GYMA 3WQ8A 3W7CA 1AH0A 4K2SA 1OGGA 3PZTA 1S5WA 3A12A 1BTCA 2G41A 1S5VA 2E7FA 3JZEA 3KL3A 5I3HA 5I03A 1VZWA 4Q8QA 1FBAA 3PUDA 2I9EA 3ITGA 5BOFA 3S0CA 5I79A 3PUGA 4JKKA 4GUJA 3O15A 1U5HA 3KTXA 2NV1A 4HNOA 2D2JA 4W88A 2A79A 4ICMA 4P8VA 4E4PA 2TSYA 4MJ4A 4PUDA 4L5ZA 3Q94A 1V51A 1E6QM 4US5A 4AFYA 2ZX9A 2EG6A 4WOQA 3U48A 1VPYA 1S2UA 4MJMA 3ABQA 3M0JA 2VX4A 4FLOA 3WIJA 1W3IA 1JDEA 3RM4A 1V0NA 2D73A 1I2QA 1KBIA 4C7GA 1SFJA 3NQGA 2WNZA 1MRAA 2ESCA 4CNUA 1FFQA 4NQ1A 1QI0A 1GTEA 2NSXA 3OGVA 3UZZA 5G1TA 2DPEA 5HR7A 4JOMA 3ABRA 3RR4A 3JVAA 2OJPA 3UY8A 4UNIA 1LUCB 3T2PA 4KEUA 1ZTVA 7ODCA 3NQBA 3S47A 4NP7A 3WH7A 3L2IA 2NT0A 4LU0A 2OZ0A 1W0MA 2X1SA 1KO0A 4D6HA 4TVCA 2EKCA 2F84A 3V5FA 1YDVA 5CC3A 1BTMA 3REQB 1WPCA 3RM8A 3W7HA 2A6LA 3VU2A 2FZDA 3BMVA 4X22A 3N15A 4OT7A 1EA9C 1OJXA 5HJLA 2V38A 3KS6A 2DY3A 4IQDA 2FVMA 3MI3A 4LYRA 2QDDA 1BXBA 5C55A 1PS9A 2IKJA 4XTIA 3H12A 3A3XA 3AMDA 4LAOA 4JX5A 3T4CA 1E6RA 1LLWA 3R25A 4G2DA 2UY4A 3B8VA 4BS0A 4M80A 1FDJA 4H8HA 4Z0JA 4DJFC 2VZUA 4X9YA 2BLEA 4UR8A 4C7DA 3SB0A 1VYPX 2YA2A 2QVNA 3BCJA 5C9RA 3LMZA 1TMLA 3GFZA 4S3AA 4N9DA 3G5EA 3W2UA 1FWJC 2X7WA 1SGJA 3PVFA 4LVDA 4BI7A 4L4MA 3AMGA 4K1WA 2DEPA 1J0IA 4YLWA 3WQCA 4L9ZA 3PZOA 4DYEA 1UD2A 4PB4A 2DGAA 4HQVA 1WDQA 4OOZA 1KCXA 4IH3A 4LVAA 3DN5A 1LRQA 4H6EA 3ZWSA 2IXVA 4JHOA 3GE7A 2CLMA 2WB5A 3UWVA 5LA2A 1AG1O 4E3TA 3CPUA 3EA1A 2XU2A 1NDZA 2OX1A 3BAIA 2XPKA 3LLFA 5EMYA 2OKTA 1QWKA 5C70A 1DIKA 1XLHA 3AOFA 4I6KA 4S3DA 1C8YA 3TW7A 2J4GA 1DQUA 5E5CA 3PBGA 7TIMA 5TBOA 1GW1A 1REQB 3QQ1A 3M5ZA 1XLEA 1PDZA 2QUUA 3FCPA 1XBVA 5G4HC 3UZXA 1OWQA 2OQHA 4QJ5B 4ORMA 3OGSA 2H3DA 1X8CA 2ABAA 3T42A 3WH9A 4GNVA 2WLZA 4U2YA 1LBLA 2WNWA 4C6EA 3W7MA 5G2IA 2CZDA 3ARSA 3SUUA 3MP3A 4C7FA 5KETA 1K8XA 3DYPA 2BS9A 4I5UA 5U4NA 1EGMA 3LM7A 4PRTA 2O7QA 4E8CA 3ITTA 1VCGA 1XGDA 4TV6A 4JY9A 2V68A 3GDMA 1GVOA 2OZ3A 3B0UX 2C19A 3E2SA 4I8YA 2TPSA 1V03A 3KVJA 1WX0A 2G37A 2G5WA 2NX9A 2PWVA 3QBUA 1V0MA 4ZTYA 2OFJA 2QV4A 4A22A 4CLMA 1NQKA 3KLLA 2RGMA 3LSCA 5C0QA 2QUVA 1XG3A 3QZAA 3SCNA 1W3KA 3P82A 3GR7A 3SY5A 1UWAA 4TTGA 3AWNA 1C9WA 3CUHA 2ICSA 3NUKA 3IJ8A 3Q65A 4JIPA 2W6RA 3ITCA 4W7WA 1CGXA 4E3VA 3PBUA 4FI4A 3GRIA 4X0NA 4RZ5A 3PZUA 4BWLC 4HPXA 1VYRA 3IACA 1ENUA 2AMXA 3P84A 1ICSA 1KXQA 1XS2A 5E9XA 3LDVA 5M03A 2OLAA 1JR1A 3WFAA 4Q33A 2ZZ7A 4GBDA 3ZM8A 3HJEA 3T44A 3CXOA 3WLSA 4IQLA 2DSWA 2F6KA 2WCSA 4KESA 3B8DA 1XIGA 3WENA 2GOUA 3H4GA 5CSUA 4A6GA 1EP1A 4S23A 3S2JA 3T7VA 2DIEA 1WZAA 1MQRA 3WK1A 1XKYA 4WGXA 2RDUA 5HBFA 4GLEA 2GFTA 3WNKA 3LGDA 1U5JA 1F8IA 2A3AA 3B4YA 2DZAA 1TJ0A 3CEPA 5EMJA 2X30A 1UKQA 4JDBA 4GGBA 3OZMA 4J7RA 2FDMA 4ATLA 3VNYA 1DXFA 1V6UA 1XGEA 3EPNA 3GB6A 5FA5A 3L66A 2ZRVA 2DVXA 1WDRA 3QV6A 1MUCA 3BL3A 3AIEA 3EWCA 1XLFA 4NKCA 1DJGA 3H2MA 4AZCB 3APGA 2GJPA 2O9OA 2WLYA 1KFEA 1V7AA 3OLDA 4LYPA 2VFDA 3CUZA 1FRBA 3CHCA 2BHYA 3SZ8A 5BW6A 2E28A 4B3KA 1FCBA 1ZFJA 3MHFA 4TMCA 1NP0A 2OYKA 3LHVA 4J2PA 3LX9A 4E2VA 4QE5A 1IEVA 2IPJA 4MNLA 3FGCA 2EBNA 3BZJA 1TWDA 2WCAA 1DIDA 2C18A 3BG9A 4FO4A 1PSCA 3NIYA 2GQ3A 2PDFA 4IIHA 4HNLA 1TELA 3W74A 3SCSA 2G0WA 5FACA 1TZZA 2E6FA 3TR9A 1TA3B 1OFRA 1WQ5A 1KBKA 3I6TA 1V0LA 3TN6A 4XBSA 1HJUA 3R79A 5CEWA 2QCNA 4DO6A 3B9DA 4D8ZA 4GXWA 4BI6A 3OA3A 2J24A 1WP6A 2A21A 1W1A1 4PTDA 3WD0A 5DRCA 4H8NA 1EHNA 1PEZA 2BTMA 2NQLA 3ARYA 4H9MA 4TVUA 1XRVA 3UW6A 3GR4A 2VX6A 1O94A 2X1RA 1AQ0A 1U1HA 4XSLA 3QR1A 1YPXA 4JL1A 3GVVA 4GYJA 3GH5A 4CQ8A 1D3GA 3C0JA 2PMQA 2Z1VA 3EWBX 3NQDA 1HJVA 3A4JA 4HU4A 3N25A 3W7QA 2NT1A 3BLOA 1R0MA 5A6JA 3R0UA 3TC3A 4AHOA 2ZXAA 3GZ3A 4PB5A 2PRHA 3DFSA 3BAKA 4DM1A 2RJGA 2Z7GA 1ISVA 1XWYA 2V63A 1A4LA 3VAVA 5AC6A 3GU1A 3LXCA 3DFOA 1UKTA 3UG3A 4AZ6A 2VTFA 1JRBA 4ML9A 2CITA 5M17A 1CIUA 1I2NA 3H7VA 3QFEA 3GTIA 3DFPA 3KW3A 3EWDA 1X7FA 2DW7A 3DU0A 2GDVA 2NSOA 4JTSA 2WBKA 4KF1A 2GVGA 4O0KA 2D69A 2OQLA 5JH2A 3OU8A 4Y9OA 3NQAA 3SQLA 2PGFA 2BP1A 2ZDRA 3EDEA 1US0A 2CXGA 3CZEA 3P6LA 1FY6A 3UESA 1J8VA 4LYQA 5CXPA 3SCVA 4OKDA 2VURA 3VZXA 3KBVA 5EBUA 3T0BA 1AMYA 4W9TA 3PBMA 3VIGA 2FPVA 5K2ZA 3T0CA 3U4AA 3ATZA 4B5SA 4IIGA 3AISA 3FYYA 1CW2A 2WKLA 4U3AA 3BMWA 3WUFA 1PUDA 5C7VA 4NYUA 1JCXA 3W0KA 1E5NA 4NXKA 3LD5A 4C60A 1ELSA 4O12A 5BU9A 1B4EA 1H7PA 4A2SA 4HZMA 5FF0A 2HBVA 3TSBA 1MI3A 2OB3A 2ZIDA 1VJIA 4B91A 1V6WA 1QNPA 1HT6A 1KGXA 1HFBA 1YQ2A 3W7EA 2ONEA 4HSOA 1MYRA 4UUIA 2ZC8A 4MB5A 4QJ3B 3TYDA 2VWTA 4PUNA 1S3HA 5F2MA 4PBGA 4YYCA 3UU0A 3W24A 1KKOA 5CZ0A 3M64A 3QOKA 3QR0A 4O50A 4MMWA 4J2MA 3H26A 4WZHA 2C71A 2Y24A 4BR1A 2MANA 4W93A 5EFFA 4MWAA 4IWWA 2EPKX 4URIA 3BARA 1KM4A 1QK0A 3A22A 2B0MA 1CX9A 1Y5VA 4GO8A 5TNVA 2H3BA 4Y8EA 2J8TA 1TPVA 5DBTA 4AWEA 1OT1A 1YLVA 3IIVA 3OBAA 3WNLA 3LTPA 5EFDA 3H2OA 3VIHA 3HA1A 4IXXA 3VKKA 1VBHA 5CGMA 2PDJA 1P5BA 3MP4A 4CVUA 4O8AA 3O6YX 3DZ1A 4IPPA 2GL5A 4I7WA 3OP2A 3BQ6A 1EOMA 3BLEA 1FWNA 1J5TA 3S5NA 3T9PA 1DTUA 2A1YA 4XIMA 5HATA 1A5BA 4A05A 5HUOA 4KWVA 1R3TA 2JIWA 3EB4A 4JN8A 5A8OA 1QBAA 4GJIA 1N2VA 3CV2A 1NWRA 1SFLA 2AQWA 4Q8PA 4N02A 3A9IA 1VFUA 2X1IA 1SU5A 4KRTA 2J78A 4Z1CA 4ZE4A 2OT0A 3IGHX 1CDGA 4H2HA 4ADSA 3P74A 1JDDA 3WD2A 1F74A 3GX9A 4MKVA 4LF2A 1FWBC 2Z26A 2O4MA 2QNEA 1A5SA 4C1LA 4G1NA 1VPQA 3E74A 4A4AA 1Q6GA 2REQA 5DN1A 3D3AA 3R7MA 3BG3A 4GYKA 1Q3NA 3MS8A 2G3IA 3BGJA 3OLIA 4LEFA 4B5VA 3LUTA 1PKNA 4PMYA 3G6MA 1XV8A 2EXOA 2WMJA 4I5XA 1TFVA 3UYCA 1OC5A 4W5UA 7CGTA 2Q8LA 1J0HA 1ZAJA 4XD4A 2WVVA 4DELA 3F4VA 2Y4SA 3W1AA 3I4EA 1BKSA 2I5GA 3VGFA 3IUDA 2GPTA 3OVPA 4M6QA 2VOTA 1RLCL 4W8AA 3SDOA 5LXXA 3SGZA 5JBEA 4PR4A 3MBDA 4FZIA 1GVSA 3UXKA 5DANA 3TJXA 3SUSA 1TV7A 4NJHA 1TUFA 2D20A 4PN2A 1GEHA 3MB9A 5F4WA 4FNSA 3HJZA 4POCA 1K9DA 3U2EA 6CGTA 3WBYA 1ICQA 4AD5A 1JD9A 4GKTA 5D9PA 3WF0A 1JDFA 4R33A 1XYBA 5LHFA 1RPKA 4QQUA 4WKHA 2BGNE 5IOBA 3MV11 3M0VA 4J9JA 3OHMB 5F2GA 1NH6A 1TR9A 3V0SA 1ZJHA 4GOAA 3RRXA 1IT7A 3STCA 3LTYA 1NWSA 3VX0A 4ECLA 1SUXA 1I1XA 3POHA 4GNJA 4PTXA 1YXYA 2NQZA 1CWYA 1LT7A 2WANA 1SR9A 1G7UA 4BQ2A 3T81A 1NM9A 3CZLA 2XSAA 2EPHA 4UTTA 3HGJA 3ELFA 3AS1A 3UA4A 3SM0A 3B3DA 2GSEA 5JMUA 1QOXA 2F9RA 1U30A 3L4VA 4PTVA 1A53A 5AFDA 1UR3M 1QU4A 4BA0A 3L9CA 4LFYA 4TX8A 1YE4A 5AB3A 1JZ8A 3AU6A 1SMAA 3AROA 3RFAA 4HMEA 4FNQA 1BD0A 5GJPA 2ZVRA 4A29A 4Z2HA 1OT2A 1PIIA 1UP2A 2AL1A 3HPAA 2D23A 4A8IA 3MA8A 1XQLA 4Y9AA 1XYCA 2BY3A 4GZIA 3PNZA 5A8NA 4AWTA 4EF9A 4CQ9A 1EDQA 1JDAA 2QIWA 2QKFA 3AXXA 1KFBA 1RPXA 4ZOCA 1F8MA 1SM9A 2QR6A 1JF5A 1FWWA 2VRJA 4B5XA 4R5EA 2WZTA 1SVDA 3FFSA 3R12A 5LYRA 1AL8A 3BLIA 2O9TA 4IG2A 3SI9A 3KVKA 4E8DA 1VKFA 2E9LA 4BY3A 5EMKA 3II1A 1E6NA 1YE6A 1SJBA 4GQRA 1WE5A 1H60A 5M5DA 3XINA 3TMQA 4DPQA 1BWLA 4UFJA 3CTTA 5CJNA 4KIRA 4YHEA 1HL8A 5KZDA 4Q8UA 3R0KA 2WJEA 5F1VA 4AIEA 2J88A 3HOJA 3LA4A 2IUZA 4L6OA 1YXCA 1TMQA 1EEXA 4LH8A 2J7FA 1PKYA 3K8KA 5FEWA 3JW7A 2HS8A 2ZX7A 5XINA 2XIMA 5GJMA 2FFIA 5G4WA 5GNZA 4J27A 2Z7KA 3VIOA 3HTWA 7PTDA 3GNPA 2O4QA 4JX6A 2CW6A 1W8SA 2WZIA 4MZYA 1HKWA 3UGRA 3RHGA 4P7LA 1FWDC 1HKVA 1H0GA 1YEYA 2DSZA 2F6XA 4B5TA 2BVTA 3GVWA 4HK5A 3ZYZA 2A7RA 3ANUA 5FKYA 5F7UA 5DQPA 3BJTA 1JGMA