1D8WA

L-rhamnose isomerase
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
416
structure length
402
Chain Sequence
TQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords L-RHAMNOSE ISOMERASE
publication title The structure of rhamnose isomerase from Escherichia coli and its relation with xylose isomerase illustrates a change between inter and intra-subunit complementation during evolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 142
structure length 402
sequence length 416
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 1999-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1d8wA00
3QC0A 4XISA 3QZAA 1S5NA 1XLKA 4GQBA 4YTRA 4YTTA 4EAYA 5B80A 3AAMA 1O1HA 3ITOA 3IUDA 3OBEA 3BZJA 2I56A 3DX5A 3UXIA 3VYLA 5B7YA 3VNLA 2XISA 3QXBA 4A8RA 3C0QA 1XIHA 3KBWA 4A8LA 2NQ9A 1QTWA 1XLJA 1XYBA 2HK1A 8XIAA 1CLKA 1I60A 2HCVA 4HHMA 1XIDA 3ITTA 4PGLA 4QEEA 4J4KA 3U3HA 4X63A 9XIMA 2XINA 4K3ZA 5AVHA 3KBVA 3QYSA 1XYCA 2GLKA 4XKMA 4OVXA 4QE4A 3AYVA 4W4QA 1XIEA 3M0LA 2I57A 1XYMA 3KTCA 1OADA 4ZBCA 4HHLA 3CQIA 9XIAA 1S5MA 1MUWA 1K77A 4QE1A 1XLLA 1XYLA 4KW2A 5J8LA 1BXCA 3UU0A 2QW5A 3M0YA 1XIFA 1XIBA 5XIAA 3CWHA 3VNJA 4GJIA 2GYIA 4HNOA 3C0LA 1DE5A 4QE5A 2QULA 3M0VA 3VNMA 3UA3A 5FA5A 4YTSA 4DVOA 3ITXA 8XIMA 3ITVA 4K1GA 2QUMA 1BXBA 4QDPA 1XIGA 4QEHA 2X7VA 5EMKA 3AYTA 3TVAA 3BDKA 1XINA 6XIAA 2HK0A 1QUMA 5C9ZA 3CQKA 4G56A 3P14A 3KBMA 1A0DA 4PFHA 4ZB2A 5I7GA 6XIMA 3UVAA 4LNCA 4QDWA 3JU2A 4YTQA 7XIMA 1XLFA 4Q7IA 1XIJA 3IUHA 4A8IA 3AALA 3ITLA 1A0CA 1DIDA 1XIMA 2NQHA 3GNXA 1DIEA 3ITYA 3VNIA 3KBNA 3KBJA 3BZGA 3KCJA 3KCOA 4XSLA 1XLDA 1DE6A 4XSMA 2GUBA 2X7WA 3WQOA 3U0HA 3IUIA 4YTUA 3FVMA 3N4AA 1XLBA 4X60A 3DBNA 2Q02A 2G4JA 3CQJA 1TZ9A 2QUNA 3M0HA 3XIMA 1XLEA 3XINA 1XP3A 4X61A 1MNZA 3LMZA 1XLMA 1DXIA 4DUOA 1QT1A 2OU4A 3CNYA 1GW9A 3KWSA 4GLEA 3P6LA 2NQJA 3UA4A 2ZVRA 5EMMA 1XIIA 5XIMA 1XLHA 1XLIA 5H1WA 3C0SA 3M0XA 4US6A 1XICA 1XLGA 4EACA 1I6NA 3BANA 5EMJA 3XISA 4ZB0A 3M0MA 3KBSA 4A8NA 3KCLA 5EMLA 1XLAA 1XLCA 4HGXA 4XIAA 2G0WA 2XIMA 5AVNA 4XIMA 3CQHA 5H6HA 1YX1A 5XINA 1XYAA 2J6VA 3VNKA 5TNVA 3NGFA 3BWWA 4E3VA 1XISA 1A0EA 3L23A 4GJJA 2ZDSA 4ZB5A 5B7ZA 1D8WA 3TC3A 2GVEA
chains in the Genus database with same CATH superfamily
2FZMA 1FDZA 4ZODA 5AOUA 1JDCA 4W8BA 4ZOEA 4LF1A 1KV8A 4FXFA 3H24A 4GY7A 1D3HA 5C2XA 5DLCA 4GI4A 1S5TA 1O68A 4HCLA 5DN1A 4MUZA 4P8WA 4J3UA 3MP3A 3T0CA 2XPKA 3M0LA 1MRAA 4CNPA 4AYGA 1UUQA 3BUVA 4DX3A 1IIGA 4US5A 1B1YA 3WLQA 3U2OA 4XBKA 4NRRA 2D22A 2PP1A 3WLRA 2HE8A 3T0BA 3PJXA 1MXDA 5DEZA 3NPUA 3F4CA 3B0UX 3STGA 4KH2A 1SMDA 3PTKA 1G7VA 3G77A 4GC3A 4X9SA 1J18A 5FF3A 1UD3A 4ERGA 3DHUA 2DT2A 2Z1BA 1ICQA 5BZAA 3KBJA 2YB4A 3I7RA 5DELA 4FIQA 4UTHA 4XG1A 2GK1A 3WMSA 2GVJA 1HX0A 1U5HA 3F1QA 3GHSA 1XSIA 4CCDA 1DTNA 1TV2A 2WXDM 2RGLA 4GY0A 3RITA 2CETA 2E6DA 3PZ9A 3LNPA 3T0TA 3R43A 2TRSA 2VM8A 3E6EA 5LIKX 4WF7A 4C7FA 2B7OA 3QTPA 4YYCA 1A3XA 4PBEA 2CHRA 4DZHA 2VMFA 4I90A 2V30A 1EIBA 1PEZA 3TQ0A 4E8GA 1G0CA 4NYYA 1KFWA 5CZTA 3RU6A 5CBJA 1GTHA 4L6DA 4V1YA 2UZ9A 4AYSA 2NV2A 3HQPA 4A3RA 1EXBA 5D9OA 3UY8A 1MQRA 3MZNA 1TFVA 5FL0A 3DESA 3FHAA 3NQ2A 1O7AA 5HJYA 3L7RA 4AW7A 1J0YA 3JRKA 3TQVA 5BROA 5CPQA 1IWAA 1RLDA 2ZKMX 4J35A 2QAPA 4PB5A 1KFJA 3PP7A 1Q7MA 3CQKA 3W01A 2ZXBA 1Q6LA 3A12A 3F4DA 3GR4A 2Z29A 3H55A 3WD3A 4GBUA 2E67A 4Q22A 5FAJA 3BARA 1DIKA 4F66A 1OSEA 3CIVA 1K8ZA 2VFFA 4UTJA 3QV8A 1BYDA 2FHFA 1V51A 1VENA 3VU2A 2FHCA 1WQ5A 1ONRA 3CM4A 2J24A 4L5ZA 5DBTA 3P6LA 4TVCA 3W23A 3IS4A 4Z1AA 4U10A 1WOBA 1EZ2A 1RXOB 1RJRA 1VRDA 3KFTA 3GKFA 5K4XA 5T9BG 2HDJA 1U22A 4IIGA 1AODA 1O66A 3EWYA 1S5NA 3BSHA 4YHGA 3DI0A 1XCXA 4PE8A 3KOXA 3QXBA 3EKLA 2IKIA 3PB0A 1VEMA 2P1FA 4HA1A 8XIAA 4PGLA 4HJWA 3NM3A 2Z1XA 3VK5A 3UP8A 1N2VA 4HCHA 4RW5A 3TXVA 3CV2A 5HR7A 3CGTA 5AHLA 1UH2A 3JZUA 5EB8A 1CXIA 3FV9A 4G6CA 3OYXA 5HBFA 1BHGA 1VYSX 3TAKA 1WKEA 4W7VA 4H6RA 2PGFA 3WH7A 2A3LA 2P8CA 5E6ZA 1P1MA 2PODA 1ITCA 3MWAA 4PL1A 4UCFA 1BF6A 4TTGA 1W9XA 4MJ4A 1GYMA 1W1ZA 2ESCA 3T2QA 3WF3A 3BZGA 3FFSA 3G1XA 4B5SA 3BV4A 1O5QA 4MWAE 2A85A 2E9MA 2QMJA 2ZRZA 4X9YA 3QQWA 2OU4A 4G7EB 1I4NA 4CQBA 3GDBA 5HANA 1L6FA 2GGEA 4GHRA 4E3VA 3SCQA 5CGTA 3HG5A 3R0DA 1AH3A 2X30A 3WQGA 3U6WA 3EWCA 4KRTA 4TV5A 1R47A 1SW3A 3W29A 3O6YX 1PIIA 1TTQA 1LDCA 3T07A 3PBMA 4LB3A 4WJEA 3RILA 1KM5A 3CK5A 3WD0A 4I7WA 1W5PA 3AOFA 4KCTA 2QGHA 3AS2A 4GYKA 2DVTA 4O1BA 4WCJA 1JRBA 3BLEA 3CEUA 2J47A 1JZ3A 3GO2A 4GX9A 1VYRA 5AHEA 3BAYA 3ZVHB 3CS2A 2E09A 5IFTA 5AYYA 4C6QA 3BGAA 5G4HC 4PMDA 5HMSA 1OFOA 2C13A 5A6BA 3BK0A 4RUBA 3ZIZA 3NQVA 2NVDA 2CWXA 3QV6A 4C6JA 2YSWA 1WZMA 4JPGA 1JDAA 3VOIA 4ROPA 1VS1A 2H6RA 1CX9A 3CC1A 1PCKA 4JIHA 1X98A 3KWSA 3MDUA 3T9PA 4UFJA 3WG6A 3ARTA 2VWSA 3APGA 1JAEA 3L65A 3C3NA 2G4FA 1T96A 4IP5A 2CBVA 3W7CA 1PE1A 1MFVA 2FDSA 2PRLA 2V3FA 5H2ZA 4EAYA 4LUSA 2R14A 3SECA 3VC5A 3OTRA 4AD1A 1QNVA 3QH2A 3MMWA 2OTDA 3VINA 3UQNA 2VDIA 3TU9A 5LXXA 1V3KA 2YYUA 5AC8A 3AUOA 3C6CA 1B3VA 1XD1A 2X1TA 4GYPA 4ATWA 2A7PA 1GUVA 3WLTA 3KHDA 3OLEA 1KXVA 1Y5WA 4DXXA 3KOZA 1CPUA 4DBWA 3B9NA 4A3YA 1IEQA 4MKNA 2XVGA 1KM4A 1N8WA 3TJXA 1AJZA 1LOSA 1RK6A 4RE3A 1J12A 2CKRA 5AN7A 3OPSA 3GB6A 3DFTA 5H8UA 4OBSA 3BOLA 1UWUA 1JF6A 3GR7A 1VFLA 1OWQA 3EAUA 5AY7A 4TXEA 1ZBKA 1ECEA 2HS6A 1D8CA 1EH9A 3IRSA 1OJXA 4B9YA 1V77A 3SFWA 2V3GA 3WQWA 4LS0A 2OOGA 3L0KA 4HSHA 5KEZA 4UTKA 2HPMA 5K9DA 2EAWA 1JXKA 2NXGA 3B8SA 2J6XA 4PMQA 2J25A 3ITOA 4FSAA 5AKQA 4JFTA 1JG9A 3MTWA 4PRTA 3KDOA 3FAXA 1KD0A 5DXYA 1E6SM 3SGUA 2W3ZA 3WK1A 1ZJBA 1PO9A 1KFLA 3QFWA 4FNTA 2NVAA 1GKRA 1XLLA 5DCBA 4LUTB 1BXCA 1NDYA 2QJNA 4UQEA 2H3BA 4DWSA 1XUZA 2CZEA 1ODUA 1QAPA 3KOFA 3NNTA 1BQCA 3FYOA 3TJIA 3OIHA 5M03A 2EBNA 2VZOA 2UBPC 1FP8A 1FWTA 2XVNA 4JFWA 3FJLA 3N04A 1AQ0A 3UJEA 3C56A 1UR8A 4PB4A 3SB0A 1D7KA 1CIUA 4LY8A 4ADSA 1TIWA 1Y5VA 2Q3RA 1W3HA 4H7CA 3N4EA 5CGQA 1XP3A 3II1A 4H41A 4HB7A 3USBA 1VJSA 2V2CA 4ZL1A 4L64A 9CGTA 3KP1A 1C8YA 1SR9A 2DP3A 1GYNA 4KGLA 4DBSA 2D0GA 5HWJA 1V6XA 2CITA 4ZO8A 2J6VA 3RYSA 2WSQA 1S46A 4AWTA 1RD5A 4H01A 3OG2A 1P6BA 4G7FA 2X41A 4O19A 1P0BA 2PFHA 5G1YA 1EHAA 3CU2A 4ORIA 3SZ8A 2VQUA 3DKLA 1JZ6A 4F4RA 1W1IE 2OSYA 4K7YA 4XV0A 1F6PA 3SCOA 2E6YA 4CNTA 1US0A 4TU1A 5E0KA 4GMEA 1J0IA 3KVJA 2AL2B 5C9UA 2R1KA 3T0AA 2C6QA 4KT2A 3M5VA 3UJFA 1X8FA 5CSSA 1FDYA 3ANUA 5HWMA 3WIJA 3E49A 4NX0A 4ZA0A 1XINA 3NPXA 1B3XA 4IPLA 4WRHA 3B04A 3F03K 1YRRA 4QCEA 3WBAA 2Z1KA 1E5NA 2XN1A 3GXPA 1L8NA 3EWZA 2Y88A 3P8IA 2DJLA 2ZRVA 5DT7A 4AU0A 1TUXA 1W3KA 4U5IA 2OSWA 1OCNA 5F2LA 1KFBA 1R9ZA 4FX6M 4PUMA 3UWZA 3CAQA 3G6LA 1H5VA 4HMEA 2HS8A 3TTQA 3ZJ6A 5D9NA 3LXCA 1LROA 4GCAA 3Q94A 4GUIA 5C8BB 2PDBA 2VD9A 1ISZA 4AUBA 4PTNA 4HVXA 4NZ5A 1OCJA 4HN4A 5J5RA 5XINA 2OZ0A 1H63A 2F7FA 4YVVA 4FXRA 1CI1A 3AJ7A 2QF8A 2WZHA 1A4LA 3C8NA 3LERA 1BWKA 3UZZA 1P6WA 1H09A 4NZFA 4OOUA 5CQ1A 1ZBWA 3VM5A 1W2VA 3B0XA 3ALFA 2J7HA 4GABA 3K13A 2HXTA 3PBVA 1UP0A 2WC7A 4AD3A 1H7PA 3KL3A 3KM8A 2QNEA 3CASA 2FFCA 3NURA 2OYLA 4XUYA 3L5LA 3AZTA 4JN8A 1EPVA 4F8XA 4D6IA 2C18A 5LA1A 3LSCA 4RL3A 4BWLC 4F0SA 5LNVA 3GHUA 1VGAA 2BVDA 3UA3A 1AQHA 4KEZA 1HKKA 3EB3A 1ZFJA 4KEVA 2C0AA 1RA5A 2FZ8A 3OA5A 5G2IA 3ABRA 4ZO6A 3T05A 1ISWA 1JGMA 1N7KA 5K2ZA 3CIWA 5HULA 5MKGB 3LX9A 2QDHA 4JTSA 5LNUA 4K7VA 5REQB 1OD0A 4IP7A 1XLDA 4LVDA 2Q02A 1VFTA 1FHVA 4NNCA 3ES8A 4JTDA 3ZJKA 2DIKA 2W92A 3UG3A 1XWYA 1XSKA 4ZENA 1CW2A 2A6NA 3Q4DA 1TPVA 5U4NA 2J66A 4UC5A 3VKKA 2DORA 3TUUA 4LUYA 2UV8G 3CZ8A 1R0MA 3QC3A 3LTPA 1DJIA 2CLHA 1GQKA 4O1CA 4O4VA 2XFRA 3KBWA 4PMZA 2A2IA 1ZAHA 1H11A 2Z28A 4W7WA 2BHYA 4ZOBA 4D9PA 3VC6A 5GQBA 2D2JA 1SO6A 3KX6A 4RDVA 3PZMA 2ZRXA 5A8NA 2CHNA 4XAPA 3AU6A 4WY0F 4LS1A 1HN1A 1GZ1A 3M0VA 4ZEPA 4HZ8A 3UCQA 3IK2A 3OG3A 3ARVA 5CXPA 2FB2A 2NV9A 4S3FA 3ZLGA 4AX6A 2WJDA 3ARWA 2CWNA 2WMIB 5HINA 2VFGA 2Y5JA 3S2NA 4LUIA 3MS8A 2GDUA 3G1SA 4JYFA 4UNKA 1QU4A 1YDNA 1M01A 1VIWA 2CEQA 2DY3A 3WH8A 1DVJA 3WF0A 3K4WA 3K4DA 4ACZA 5JBFA 1TR9A 3A13A 4GO8A 1TPB1 3BC9A 4AZIA 3HPSA 4CCEA 3OQ8A 1UR2A 1UD6A 4GRSA 2W27A 4UUIA 2VX4A 6A3HA 3FNDA 1G4TA 5GVJA 4NZ3A 2FFIA 2PDCA 1E6QM 4AZCA 3QHNA 3RJYA 3NZQA 4JBRA 2ISSA 4IUOA 1EB3A 4RNJA 5A6MA 4EXBA 4G2DA 4PZVA 4GZIA 4DN1A 1XDMA 2WKJA 3S47A 4CN1A 1PVNA 1JXJA 1X1NA 3T40A 3NWRA 3G0UA 3OZMA 4A35A 1RQEA 4J3SA 1SGJA 1E0TA 5FA5A 2WSRA 2VGBA 4W85A 4DJDD 1IT0A 1JCLA 5DMMA 5AFDA 1JZ7A 4IG2B 3LDVA 3NVTA 2ISWA 3BQ6A 1VFSA 2Z26A 5IBXC 4H4IA 4NAFB 4LVGA 4QAIA 4J2PA 1G7UA 4CD5A 2YCLB 3EPOA 1KLYA 3GXMA 3ELFA 3W86A 4ML4A 2ACSA 4J5NA 2Y62A 3NZRA 4IGNA 1NELA 3WDIA 1M5WA 1E3XA 1XLMA 3VIFA 1W3NA 2VX5A 2YBVA 5FF4A 1V5XA 2H9AB 3VDCA 4U2YA 4LB4A 1NP2A 3VUSA 4MY8A 3OU8A 1QK2A 3TC6A 2A3BA 2DH2A 3FEQA 4FS9A 3RLUA 4HNVA 1TWSA 3SCWA 1GJPA 3OBEA 3HPFA 1DWIM 1IEIA 4HNLA 3ABXA 1KGXA 3VKCA 2DVXA 3S6DA 3W6LA 1T99A 4RNFA 3N9KA 3R58A 1XF0A 4DQWA 4P5UA 4A05A 1PDYA 2WOQA 2ZX8A 5D04C 4IFKB 3DH7A 3WLJA 4RK8A 5EPDA 3W37A 4MVAA 4JTCA 1RR2A 1UZ4A 4ZTYA 1YW1A 4PYSA 3UZWA 4C6NA 2QV4A 2G3IA 1BYAA 1ICSA 3HQOA 3PPCA 1PJ9A 1QNPA 1THFD 4Y8EA 4JFVA 3SN1A 1TWDA 3I3BA 4IFRA 2V2DA 1J0KA 1YYAA 2E0PA 3NZ1A 3FVMA 4O15A 3APTA 5FJRA 1AMKA 3QV7A 4CD7A 2GGGA 3WDJA 4DF2A 3A9IA 3KW3A 1ML1A 1V0MA 3W22A 3FDGA 1OHLA 5FD0A 1DXIA 5D2XA 3P93A 1MYRA 1HNYA 2PBOA 3EYPA 4C1NB 3BLOA 1XIIA 3V7PA 4XB3A 3MBFA 3S83A 1X38A 3TYEA 2W66A 4CKQA 1TQXA 3ZMRA 2F61A 4GJJA 3TWBA 1KKOA 2WHLA 2ISDA 4WX2A 4AZ6A 3N1AA 3A21A 1EFZA 2XN2A 1K7XA 2YIHA 2BFGA 3TH6A 5D30A 1R3VA 3VABA 3M7WA 2D2OA 3EDJA 1GZGA 3ZOAA 2VC5A 5HXMA 1DJYA 1AVAA 5K4ZA 3NYDA 4W4QA 2Q71A 4ZBCA 4O28A 3ZSTA 1QJWA 1IR1A 1YMYA 1PTDA 3UXDA 3STCA 3KVLA 1UWTA 1AL7A 4XX6A 4RDZA 3WK3A 1KM2A 3CV1A 3E96A 2R1NA 4B2DD 4R85A 2EPHA 4NYUA 5A6BD 3VDBA 3L2LA 4LCSA 3N2XA 3P0WA 3VOCA 4QXIA 3LA4A 2DV0A 3K2GA 4XAZA 4Y9PA 1UP2A 2ZTKA 2DZBA 4UQBA 4Q8WA 3K8KA 5EL1A 1HJVA 1Q2SA 1UCWA 1XQKA 1W9PA 1TRDA 1HVXA 1W1TA 4LTSA 4MZ8A 5GNZA 2Z4GA 3AHZA 1PX4A 1VHNA 2QCLA 2ZRUA 1TVNA 4PMXA 4S3GA 3RDKA 2Y61A 4LEFA 1HJUA 3WUEA 2VRKA 3LCHA 2VCBA 4QFUA 5H8MA 4ZQNA 4I6VA 3FHQA 5I0DA 3AAMA 4AMAA 2BBFA 4TIMA 1BWLA 2RFGA 2ODOA 4NJIA 4C5ZA 1XJBA 2ADAA 4PMVA 4QEEA 3R0KA 1VFUA 1UR4A 1ZU8A 1WAWA 2FTYA 1KCZA 1AG1O 2J62A 3S1WA 2CIPA 4MZYA 1XGDA 4HJFA 4OIFA 3W7GA 5M17A 3NO5A 3CWOX 4CN4A 2J7CA 2A3EA 2HQAA 3EDFA 3GXIA 3IGUA 3VUPA 1X8CA 3TTOA 1VPQA 2E5BA 4P7NA 2E6FA 4N6FA 2I9UA 2BTMA 2G96A 4PBFA 5K9CA 2PI6A 3B8VA 1PSCA 4L6HA 3GG8A 1E6PA 3ITXA 3L67A 4B16A 1PL9A 2UY3A 3HGOA 1UIPA 3CPUA 2RJGA 5HPCA 2CCRA 4PULA 5M3WA 1NDWA 4A8IA 1XIMA 2PRHA 3QKEA 4KCWA 2O4MA 4TX6A 3W7DA 4F40A 3AICA 1E40A 3VNIA 2GOKA 2R82A 2WKGA 4J40A 1XRTA 5I3IA 4ZFCA 1CT5A 3G8RA 3HB9A 3IIXA 3IAQA 4LYKA 3A64A 1L6SA 3WMLA 4HHPA 3KTSA 1EQCA 3VTRA 1JD7A 4HOWA 4NT0A 1GQJA 1YBQA 3C0SA 3TQPA 5KZMA 3H70A 4F0RA 4ZB0A 2XIMA 1RQBA 1CGUA 1EC9A 5CC3A 3TCSA 4KIRA 1UKQA 1U1JA 1LZOA 4I5XA 3KS6A 3A23A 4F0MA 4NI8A 1W91A 4I8DA 5LKYA 2OGYA 1QHZA 3TV8A 4LVBA 4O14A 3W1UA 3G1AA 4QE4A 3B05A 2VYOA 3WK2A 5EMUA 1V02A 5AB3A 3PZOA 4RE2A 3WQ6A 4FLSA 3WH6A 1PV8A 1FWJC 4AIUA 4EANA 2DPEA 3SJ3A 1NH6A 1S2CA 3IRDA 1DHKA 1VEPA 3E38A 2X1IA 4Z2LA 3KP0A 3U4FA 1Q3NA 5CCZA 4M19A 1A5AA 3RX4A 3KVKA 1H60A 1W9VA 3ITLA 4AD4A 1B5TA 4OTKA 5CSUA 2GQ8A 3MO7A 2PDIA 1Q2RA 3LG3A 3LS9A 2Y8UA 1W9DM 5HA7A 1LG1A 1X6NA 2WNQA 3BVJA 3UR8A 5HQEA 1XLHA 1XFCA 1FX6A 2C3ZA 4H7ZA 3FY1A 1Y7VA 3T09A 3VFCA 4J3WA 2D73A 3VDGA 1TTJA 1CECA 3R25A 4M7TA 3GC5A 4R9XA 3QGAC 5ABFB 4IJBA 3WFAA 4LT9A 2XHYA 3C86A 1XPYA 3F7JA 4ALDA 4XD5A 3HGSA 2KAUC 1K8XA 2G37A 3ZQ9A 2HK1A 1I45A 1PS9A 3I6TA 4XD6A 9XIMA 4DO7A 1IR2A 1OF8A 2FHBA 2FVLA 2HNEA 5C9XA 2VUNA 3BW2A 4OQVA 2ZICA 4M80A 1Z3NA 4AG0A 4KERA 1E4NA 4I9JA 1XG4A 2V5LA 1FHUA 2VVSA 5AC4A 1SO3A 3ZR6A 4LX4A 3JUGA 4H8HA 4IOTA 4WKAA 2V2HA 5G4EA 5C54A 4MB3A 4E8CA 5A8GA 1W56A 8RUCA 3EOSA 1BYCA 3EB4A 2GJPA 4GZ7A 4OUIA 1CGVA 3MMTA 3C2FA 4C6EA 4ZR8A 3CUGA 2OT0A 4JXCA 1B4EA 1GONA 3IJIA 1UROA 1GVOA 3SR7A 3V5CA 3AIQA 3UZJA 1XG3A 3M0XA 1NOUA 4CNNA 1KTCA 3NPWA 2PC8A 4LSBA 1X7IA 2RKXA 3VIMA 4XVDA 1F3TA 4YTSA 3TX9A 4JNYA 3L4WA 4GH3A 3DECA 4IGSA 4TTUA 5D37A 1SQ7A 4LAUA 2PDKA 3VZZA 3RHGA 1KRBC 4V2XA 5KMYA 1PCWA 5FJIA 4JX6A 3R4IA 4H1ZA 2BZNA 5I77A 2XZ7A 3N6HA 4BJHA 1KM3A 3I65A 3TTYA 2WQDA 5FSDC 5LA2A 5JVLA 5BXPA 4PCSA 3TEVA 2HMCA 2XH2A 1ITQA 3FX4A 4GE8A 4I9MA 2EGZA 2E3ZA 2QULA 2YXXA 3HTWA 1HW6A 4ILSA 3BV7A 3NM1A 4LBRA 1US3A 3O6DA 3O6CA 4Y2WA 4N9EA 3BAKA 3RK8A 1A0DA 1K4GA 2XIOA 5TQLA 4QIUA 4I5RA 1Q6OA 5EFFA 1U5JA 2OO0A 2P3ZA 1M03A 2B4GA 2Y4SA 4XZBA 3UZ5A 1M7JA 1TELA 4UNIA 3W1AA 1MI3A 1J5TA 1UOZA 1PTAA 3QW4B 1GK8A 2VVNA 1FQ0A 1MNZA 3LMZA 3RIKA 4B3ZA 4IMDA 1OFRA 3FJ4A 2RDWA 4XO6A 3UWYA 1R6WA 1W2PA 3ZYZA 4TVDA 2WKLA 1DYSA 3G22A 3LBMA 1VFOA 3N29A 3GXTA 4ADUA 4B5VA 2VC7A 4QGCA 2J88A 2NVCA 1DBTA 4D72A 4YU1A 5C70A 1KM0A 1V3MA 2IPJA 2JEQA 4H00A 2C14A 1OYAA 1T8XA 4AXNA 3F2CA 1VEOA 3RX3A 1FVPA 3PAJA 4NIRA 3ONBA 5F2IA 4C6OA 2WK2A 2V9DA 1UIOA 2PDFA 2BMBA 2ZA2A 2EKGA 2POTA 3TKFA 1OQFA 2VRQA 3LCLA 3BPWA 3N2CA 3LXAA 3VNMA 4Q32A 3LV6A 1SJCA 4C6KA 2J9XA 5AZ1A 2NT0A 5LNRA 5HJLA 1RVKA 3DEQA 4QEHA 1Q6FA 2Z1WA 3BDKA 2QS8A 3LPPA 2E40A 2PLKA 3PANA 1UA7A 5BMXA 1QK0A 3TAOA 5C2CA 6XIMA 2WVUA 2V5JA 4RXFA 4GOAA 4GUFA 5E5CA 2WCSA 1JCTA 2CHOA 5EMYA 2CZDA 4JHZA 1EJ7L 3C4UA 5D2YA 4O11A 2OPJA 2FKPA 2Z27A 2X0SA 3I6EA 2PCEA 1B9BA 4BI7A 2ANUA 2B31A 2REQB 5JXQA 3TR2A 5DY2A 1UWIA 3HURA 2VR4A 3OHMB 2AAMA 2NUXA 4AY1A 5CPLA 2D69A 4CQDA 1E9ZB 1HJWA 3WZ0E 4P7LA 4OFCA 1JCNA 4QROA 3AMCA 4TMBA 1JIBA 1RVGA 4EPDC 2Z1SA 3AS1A 1XYAA 1XH0A 3W7JA 1AQFA 3HV8A 3PSVA 2DT3A 1UC4A 2X2GA 1VJIA 2XU2A 1KQYA 2HCVA 3ITTA 5ECUA 4IISA 3D6NA 4XVEA 4B5XA 2ZXDA 1EO5A 4JNZA 4L6OA 2OLAA 2INEA 3AYVA 2D23A 3TWAA 3IGSA 5LHEA 3N2TA 5BU9A 4DUWA 3GYEA 3PZTA 2LLEA 4MGGA 1OG6A 4M6PA 1P0KA 1W1YA 4YYFA 1MXGA 4JTLA 3W2LA 3WQ4A 4JQAA 2CBUA 1SZFA 5TD4A 3V1HA 3GTXA 4JICA 2Z00A 1YXCA 2VX6A 4X3ZA 3E0WA 4FLQA 1JJKA 3R7MA 3M5ZA 5BRBA 2VTFA 4NF7A 3WNKA 1OX6A 4LEQA 1ZJIA 4GISA 3U57A 4AIEA 1WDPA 4LC8A 2GUBA 1TMLA 3OB8A 4N2YA 1TMHA 3SIMA 1TV4A 2OXNA 3U48A 4AD2A 3DHDA 3EWWA 4MOZA 5FJJA 4MLJA 4JTUA 1B90A 3WNMA 1M6JA 2Y63A 5I5RA 5DFAA 1WB0A 5DQPA 3WF4A 2PTZA 3P7YA 1W3TA 5EMLA 3GIYA 1UWAA 3EMCA 3TOYA 2QF7A 2H8XA 1XI3A 2D3NA 2V6AA 3QPYA 1PTGA 1UD2A 4CVUA 2I56A 1F4HA 5I79A 4LC6A 4QS6A 1E4LA 1OFPA 5D38A 4MWAD 1M68A 1H1ZA 4MWAC 4A8RA 2Y2WA 3TDFA 2X1UA 1TPWA 1IXQA 2Y7FA 1E0VA 4YXGA 4QSHA 3OLDA 1GQLA 4O1DA 5A6KA 1BKSA 1J4EA 5XIAA 1EA9C 3JS3A 3T81A 2WMFA 4N6EA 4H19A 3ZWSA 5TAOA 3TSBA 2DZPA 2E8YA 1LQAA 1DJNA 2OWXA 2QUMA 1HP4A 4ASTA 4EKJA 4DELA 3G8EA 1OFQA 1QMLA 3LCGA 5J5DA 3VA8A 4Y9AA 1XDLA 1H51A 3ZT7A 5LIYX 3GR8A 3HG4A 3ZLHA 3PZIA 5G1TA 3KAOA 1HXJA 5I3FA 2HBVA 1LBFA 5C9RA 3CNYA 4Z0JA 1YADA 3GNRA 2X42A 3WF2A 3W73A 1IEXA 2I1OA 2F8QA 1S39A 5D4YA 5F1UA 5AC7A 4XIAA 1CCWB 3EKGA 3NA8A 3KVMA 3S6TA 2A3CA 5I24A 4GQQA 3SDOA 3GVRA 2XIJA 4D6FA 3MCNA 4EPEC 1D3CA 1IQ8A 1XIHA 4AIOA 1UH4A 2XSAA 2WMJA 3CAWA 2NQ9A 5FJPA 3CH9A 4WSHA 1NF0A 4D6CA 1R3SA 5D2TA 1QHPA 1QW7A 2Y8VA 3GFYA 3IV3A 5CEWA 1XCWA 3GD6A 3WL1A 5CSRA 5JBDA 4IPNB 2EG8A 1W1VA 2FPVA 4MTVA 5BOEA 3HJEA 1F61A 1JCJA 3KEHA 3VKAA 1F8MA 3AYRA 4J3ZA 3H54A 1EC7A 2FIQA 4U33A 1NWTA 3TONA 3CB3A 2V5BA 2OCZA 2VHLA 4QBXA 5EBAA 3KBNA 4LS2A 1S1PA 3NQAA 5A3HA 3NOEA 3SRHA 3CHVA 2FDMA 5CSYA 1UKPA 3WQEA 1D9EA 3N15A 3GQYA 2BXYA 5HAOA 3CMJA 4OOZA 4YMZA 4QQ3A 1WPCA 3HMJG 3QY7A 3DYMA 4UFKA 1QI0A 4QP0A 2BP1A 1TX0A 2JGQA 3M6YA 4D8ZA 2WAGA 2BSLA 1BSIA 2E77A 4JIIX 3FXYA 3WX7A 1A80A 4S23A 4D6DA 3QW3A 3IVUA 4YL2A 1R85A 3DGBA 1GOQA 2Y5SA 2FTWA 1E9LA 4JQ4A 1XRSA 3EMZA 1MQQA 4WVXA 4K8HA 3NDOA 3VPLA 3LTYA 1TPFA 2BGQA 4GJ1A 4Z1DA 2DSWA 3ZR4A 3BOFA 1UMLA 5GNYA 3F2BA 2V5CA 2VR5A 4PTXA 2BY0A 1O60A 2DZSA 3R5EA 1FH9A 2OYMA 1V4YA 2ZUSA 3TXZA 1Z48A 1FCVA 1E0UA 1O12A 4S2CA 1SVDA 4GVHA 2CBJA 1NFGA 1XIGA 2CESA 3M1ZA 3IIVA 3B8WA 4UZSA 3LPFA 3QOMA 2DW7A 3B3DA 3E0LA 2GVYA 2OR2A 5A6LA 2E4TA 1AH0A 1MUMA 4UQCA 5I06A 1C3FA 3SSZA 2NQHA 3CL6A 3QRHA 3IJLA 2PTWA 5I6SA 2VELA 3MSRA 1CNVA 1EP3A 2AMGA 3UWEA 4BF5A 2D2GA 1NM9A 2O7QA 1KXTA 5BW6A 4P7OA 2JK2A 1KCKA 4PUNA 1R86A 3Q2DA 5D32A 4J7RA 2I5IA 5D2VA 1U30A 4HGXA 4IJCA 4XIMA 5E09A 3W82A 1Q7ZA 1B3WA 1XISA 1LF1A 3BCFA 3M5XA 4MDPA 4YTRA 2XSBA 1V7AA 1Q6RA 1EZWA 1OBAA 1AUSL 5CGMA 3UETA 3WQVA 4LUTA 1OIFA 4B5UA 3O1NA 1I2OA 2HSAA 2RDXA 4KMQA 4PEEA 2TODA 1LUCB 4OGZA 1YNYA 3URAA 1M04A 3AWOA 4BI6A 2OSXA 4ZE5A 4XD4A 2ZX5A 3TMQA 3VGFA 3C52A 3O05A 1LTDA 5DMNA 3RU8X 3ONCA 3S5OA 3U2CA 4C1LA 3LQGA 1VKFA 4UR7A 4EWND 4H6KA 4MFEA 4PCPA 1UBPC 4GIAA 1IWPA 7PTDA 1HO1A 1IT7A 1JULA 3N17A 6XIAA 1H7OA 1DWAM 2FB3A 3P8JA 4Q8MA 5LYRA 4O0ZA 1BVZA 5ENLA 1VCFA 2Z7KA 1YNQA 1PPIA 1FWSA 4ORMA 3GW3A 2NXIA 1BRLA 1UMYA 3DU0A 4IQJA 1A3WA 3LTSA 2YL5A 1J11A 4KBXA 1BG9A 1K4HA 1BLIA 2QPUA 3G1HA 3PWIA 4HOXA 4N9CA 2PF0A 3LYEA 3NL5A 3I7QA 4Q7BA 5BMWA 2Y7GA 4KWUA 4C5YA 3WD2A 3QMTA 3N9SA 1KBJA 3M0JA 4MAZA 4I3GA 4U3CA 3VKDA 3CQHA 1H50A 1ADSA 3E1F1 4Q8UA 4L80A 3NGFA 3SUTA 1IYXA 4IIBA 3RRAA 3BOXA 4DBDA 2F6KA 1W5OA 3IPWA 3NQ6A 3UYCA 4EXQA 1BKHA 3HPAA 2G3FA 4NASA 3CPRA 1PKLA 4GYJA 2GK1B 5I78A 5A2AA 1E3ZA 1GYLA 3URNA 3UEQA 4E0CA 1TYGA 2D3LA 4Y7EA 1R3WA 2Z2UA 5CPNA 4PMRA 2VURA 4MY1A 1MMFA 4Q8VA 3UZXA 3K5XA 2IKHA 3W24A 2OO6A 3UU0A 1GTEA 4K39A 3VNJA 4IJRA 1RY8A 3E5BA 3SCPA 3VFLA 1SJDA 5HNUA 1GOMA 4NUWA 3VIOA 4P61A 2GJNA 3W7NA 1V6UA 2WCGA 4HIBA 3WJYA 4WGXA 5A8OA 2Q3OA 4JL1A 1UA3A 3B97A 1MO0A 1TA3B 1BEUA 6TIMA 1UZDA 3NYZA 2D20A 3B40A 1GQNA 4HU3A 4Z42C 2E1WA 2G4JA 2DZTA 1VCGA 1LLZA 3VOFA 4HZMA 2RHGA 1C91A 1M41A 3DGRA 2YZ5A 1A5CA 1OINA 3W6YA 3S2JA 4PUUA 1DQWA 1OYCA 2ASHA 3LK6A 1TX2A 1POJA 3VNKA 3ENLA 3O16A 3LOTA 4FR6A 2HTMA 4E2DA 4HN8A 2W0UA 4PTMA 1YE6A 2ZZ5A 4OUEA 2JKPA 2AKZA 4NP7A 3WKZA 4NX5A 4WQ6A 2BODX 4JTHA 2QJHA 3FA4A 4GGHA 5DRCA 3BAXA 2R1LA 4O57A 4HU4A 1XYMA 4M6QA 1GOOA 1PHWA 3EKZA 2D0FA 2IQTA 1LORA 2OG9A 1R7AA 1FXPA 3FCPA 2QW5A 3RFAA 1SZEA 3UNDA 2ZXAA 4XTDA 3AMGA 3C8FA 2H3DA 2GGIA 4M3PA 3GG7A 4C7DA 3EGJA 3ZS4A 3M43A 4MNLA 3DC0A 4BKNA 2EJAA 1VF8A 3P14A 1X7FA 1GPFA 5HQMA 3NXFA 4Q4OA 2OLHA 3CT2A 2J7FA 5AYXA 3PBYA 2JKEA 3NGJA 3V35A 5DXXA 1TVPA 2YKKA 4N9BA 3CQJA 5I2UA 3QR0A 3RXZA 1XLEA 4DPPA 4A2RA 1R87A 2E6AA 4QSFA 1JGIA 3O8AA 3L4YA 1YIXA 3GE7A 4E4FA 1LYXA 2FMNA 1SJBA 3W9ZA 2V69A 4X2PA 4QCFA 3C2YA 3EOUA 3I3EA 4MDOA 2CLIA 5C0QA 1MWOA 3AIWA 3MI6A 1Q8JA 1OC7A 1YDYA 3A3WA 1YKWA 3IJQA 4PUDA 5CJ5A 4E6MA 2CLEA 1DPMA 4MLRA 3MBDA 3GH4A 4YHEA 3Q58A 1WYIA 4HK7A 2FH6A 1JDFA 1FWAC 4WJ8A 2YA2A 3LRMA 4H9UA 4R7OA 4M1BA 3RO8A 3WN6A 3EA2A 4JIRA 4MJ2A 5BNKA 4N02A 2Z24A 4E2OA 1V6WA 4B92A 2UWFA 1XIFA 1BQGA 2FPTA 2TSYA 3V3WA 2WMIA 3TTSA 2Y0FA 3AIRA 4XZHA 4WR3A 3T8LA 2P88A 3LPOA 3I7SA 4P2VA 3UNTA 2XDFA 4FPSA 3UPBA 5A8PA 6TAAA 1I2PA 1Y65A 4L61A 2XVLA 1GJWA 3H26A 3H4WA 4BI5A 3EXSA 4F3HA 1WUEA 1LLOA 3LXBA 3TK7A 3W7RA 5IDIA 4WSJA 4J3TA 4Z1BA 1JCXA 1R5YA 1JZ8A 3TN4A 1HGWA 5ABEA 4JHOA 4H2HA 4JX5A 1PBGA 4W8LA 1F2JA 2JGYA 4GFSA 3CJPA 1DJQA 2IQDA 1FA2A 1ESWA 3UY7A 3LBOA 4EOUA 2G95A 3AUJA 4EPBC 2VUYA 2UY5A 1EYWA 3SI9A 3GDLA 5HNTA 1MUCA 4MM1A 5CPTA 2I14A 5I07A 2A5HA 1DIOA 2JF6A 4B5TA 5AHMA 3OEXA 3WLNA 2WSKA 4QG8A 1KRCC 2VP8A 3AU2A 1OADA 4LRTA 1EJTC 4MG4A 2YXOA 3A5FA 3NZPA 1DJWA 4GA8A 3N4FA 3ORWA 1V0LA 4LU0A 3HBLA 4IG2A 2NLYA 4IPPA 3HGRA 4NAFA 2Z0IA 1H0IA 2PDQA 1OC6A 4LUSB 2YCLA 3UT0A 2J27A 2JF7A 1V3JA 4PC8A 1EYEA 2CLKA 2TYSA 4GUGA 4M5PA 2A3HA 4OV4A 1ZRQA 3B8UA 4JY8A 4HPJA 3ITCA 1IXPA 3O07A 1VFMA 3L2IA 4F0HA 1BD0A 3K4AA 4YVPA 2OWCA 3ARRA 2O9TA 3B9OA 3W87A 4BR1A 5CPOA 1QXLA 4OE7A 5DCEA 5K9XA 4I9TA 3WFLA 3PTQA 2I5QA 3I4KA 1GG1A 3XISA 3WJZA 4RKAA 4O4WA 4O10A 3T2PA 1GQIA 1NAL1 3HOJA 3V4BA 4LYPA 1XLCA 2DUAA 4FF7A 2X09A 4EVZA 1GORA 1XHGA 1UR0A 4XAFA 3GIPA 2G97A 4WDWA 3QR3A 4C6DA 1OVDA 3T8QA 5BWFA 3VOJA 3T44A 4MB1A 3CIXA 3P3BA 1T41A 1QOXA 2DDXA 2C0HA 4GI9A 5AHNA 4HZ7A 4DYJA 5H8PA 2QLYA 4Q8NA 4W8AA 4PH6A 1OF6A 2OGJA 2NLIA 3FEMA 3CUZA 2PTXA 4B5WA 1CLVA 1JAKA 4WY0B 3LMYA 3L21A 3S1UA 3C0LA 1BGAA 3RCMA 3W1MA 4OJYA 3GH5A 4CUCA 3S0CA 1E56A 3E12A 4DB7A 3DKJA 4Y6GA 3PUEA 1XDJA 3LCXA 4C60A 3IJ6A 3S6OA 4C1NA 8TIMA 1KR0A 3GVGA 3U0HA 3UWUA 2ZZ7A 3AHTA 1BVNP 2ONEA 5I09A 1G67A 2YYTA 3CV7A 4IQLA 4FNUA 4DWSB 4UMAA 2FZ9A 4CGTA 4TX8A 3DUGA 3M0MA 4DLFA 5D09A 4NJGA 2SFPA 2VL4A 4KFNA 2OKTA 1GOXA 4MUPA 1TV7A 3S1XA 2C19A 1EGZA 3QEZA 3N73A 3LPGA 2BV9A 3TFCA 2P10A 1SFSA 4D8AA 6ENLA 2DZVA 5A6AA 1VR6A 3CHCA 1VBGA 3MCMA 4QRNA 1BG4A 3THCA 2JEPA 1QO5A 5D05A 4PMYA 4K3ZA 3QYSA 4JTFA 3S2CA 2QJMA 3N2MA 1RPXA 3CH0A 2ALDA 1YTKA 3T2OA 4YIWA 4UFLA 3KZPA 1HUVA 5BXRA 3UW6A 4P8XA 2WVVB 5HJXA 2CW6A 4S1FA 2XH0A 3N12A 2P3EA 3SGZA 2WYSA 2A0NA 4NXSA 3CMFA 4HMNA 3ABQA 3HZ3A 1ELSA 2OJPA 4PFHA 2OQHA 2WSPA 1FKWA 4Q8PA 3I3DA 3R2GA 1QHOA 1A0CA 2QCCA 3WLSA 2PF8A 1UOKA 4B15A 3VKBA 3MUY1 4J3XA 2XWEA 1RALA 2XIQA 3UJ2A 1YQ2A 2O9PA 4XBJA 3WQCA 1ISVA 3T08A 4HNTA 6REQB 3BLDA 4ML9A 3V5OA 2TAAA 1DQXA 3CAKA 1Q6GA 1JEZA 2QQ6A 4DM1A 4K2SA 4K1WA 1TKKA 4B5NA 1KM6A 2JIWA 1XRVA 3M0KA 2GGJA 3QZAA 2WPGA 3SQMA 4FX7A 4GI6A 3CZLA 1FWCC 2X40A 1CB2A 3VGBA 3EOOA 3NQFA 5FJOA 3NCOA 5E70A 5D03A 3R12A 2YBTA 3AI0A 4Q4KA 3ZM8A 3EX4A 3LCWA 3W7QA 1TVLA 4KCUA 4UTIA 1QW9A 4LUJA 5KZEA 3N19B 1E1CA 4DJDA 3UJSA 1V93A 2AQVA 1RLCL 1T40A 2O0TA 4Y9OA 1GWJA 1TQJA 2IPWA 2V3DA 2ACUA 1DJHA 4IGMA 5LXEA 1VRXA 1QI2A 2DW6A 2NSOA 3HO8A 1M9HA 1AK5A 4OU1A 1OX4B 5EMKA 5IBXA 1UH3A 7TAAA 3KBMA 1L2UA 3G1DA 3H4XA 1K03A 4JKKA 3ZWTA 1CZ1A 1HJQA 3QZEA 1XIJA 2VC6A 4A29A 4AHOA 5FOOA 1JPHA 4IM4A 1LL7A 3PJTA 4LH8A 2PGEA 3H2AA 4BFAA 3UWWA 3FOKA 1F5ZA 2PWDA 2BASA 1RA0A 1Z6KA 4TX9A 4PMJA 3RPDA 1WDRA 3CUJA 4ERAA 4IICA 1MVYA 3STPA 3QR1A 1H3GA 3MA8A 5PTDA 3WQ5A 4GC4A 1FWWA 3TYBA 4KWSA 4KFPA 3THUA 2VFIA 4D6EA 1LG2A 1GVIA 3PK7A 1RD6A 2PU1A 5HQLA 1LT7A 2CXGA 1FWNA 1LRNA 1CYGA 2FPYA 1TG7A 2J7EA 2YCIX 4EF9A 2Y5EA 7REQB 1E6RA 1M3UA 1ZTVA 3AXMA 1GVFA 1Z44A 3VZXA 1EUAA 1M1BA 1DTUA 4F48A 1DJXA 4GG9A 4V1XA 4NKCA 4RZ4A 4V15A 4B4FA 3L4UA 3SCUA 1VBJA 1JQVA 2Z6JA 2Y7DA 3B06A 1R3TA 3VIGA 4IF2A 1H41A 2Y6ZA 4YWSA 3TR9A 3VXGA 3K46A 2QKFA 2R9RA 1EEXA 3DYOA 3AIUA 3VO0A 4K37A 1CXEA 3W2MA 4HNCA 1ITXA 4LQ1A 3LBCA 3BLPX 2PPGA 3PUOA 1A5NC 5EA9A 3GAYA 3W83A 5AC6A 4LCRA 1UKOA 2GWNA 5A2BA 2YB1A 3L4TA 3UVAA 4LNYA 1PKMA 4RW3A 4XD3A 3WD4A 1JR1A 2GWGA 1KWKA 2OZTA 2GDVA 1TCMA 4IHCA 3LUTA 4YTUA 3N4AA 4XZIA 5E1QA 2QV5A 2HNHA 3S9ZA 1HF6A 3DFNA 2ZRYA 1SFLA 3OVQA 3VIHA 5SWUA 1UW9A 1RBOB 3CL7A 3TJLA 1UASA 2OYKA 5DX7A 5ABFA 1NOFA 5A95A 2J7BA 4IGHA 4JTTA 2WSYA 4AZHA 4A8NA 4H8UA 1Q66A 1ZBCA 3VCRA 2PLMA 1Z42A 3ZT5A 2VJXA 3S9IA 2WC3A 4M6VA 4PEKA 2HVNA 5FEPA 3NQMA 4Q4SA 3R1ZA 3JW7A 2BOEX 5CJNA 1H5YA 2XVKA 4UZUA 4RDWA 3K8LA 3KTXA 3C2VA 4L9ZA 2CZFA 3GXFA 4HHLA 4ACZB 4TUFA 4PTDA 5J8LA 2XH4A 3NZGA 4B2DA 3CWHA 5JH2A 1J6PA 3CYVA 4ZCWA 3CLMA 4RLIA 3R8HA 1GNXA 3GTIA 2J7DA 1SSDA 5CC7A 1KFEA 3GXNA 4A4AA 3AYTA 4JL2A 4Q8QA 1LQ0A 1KCLA 5CG0A 3CAVA 3LHZA 3NSMA 3ZSSA 5L9FA 5RUBA 2BHUA 1WBHA 3GIQA 1DOSA 3CMGA 1NWRA 3E02A 4J9JA 3R10A 3F5KA 4GY1A 2PRMA 4UOJA 1IT8A 2CZVA 1EDTA 3H4GA 3N25A 2YGYA 2WBGA 3UA4A 3DI1A 4JYEA 3PG9A 4LFYA 4HD5A 4XWUA 1FKXA 4K8EA 4ZQCA 3A3HA 1JI1A 1G4PA 4NZ4A 3LENA 1JVNA 3SUWA 4H3DA 1F8IA 3MT1A 3BJTA 3E0FA 1R2SA 3M64A 1XC6A 3DAQA 2W61A 3MV11 3KRZA 1K9DA 2GFTA 4YPJA 3QBUA 2BG5A 3ALGA 1K9EA 2P8BA 4NAEB 2DZUA 3VMPA 1RK5A 2FQIA 3MHUA 1QI4A 2J8FA 5IHRA 4CQ9A 4JTIA 1A4MA 4RJEA 1W17A 1A5SA 2ZTJA 3RPTA 1MQPA 4UMBA 1RP8A 3RM8A 3PG8A 3Q65A 4ERIA 5F1VA 3TQKA 3L9CA 3QTGA 5C7VA 2MNRA 3QQ1A 7CGTA 1LCOA 3O2LA 3L2MA 4PA8A 3SGGA 4RV8A 3W74A 5A69A 2W62A 4L1GA 5ABGA 4J2MA 4WKHA 1R46A 3RR1A 4GQRA 2PMQA 2ZX6A 4GGBA 1A5UA 3H53A 1LRQA 3NPVA 4MYAA 1ZP3A 1UYQA 3LZ3A 1OX5A 1TWZA 1V3LA 2YDQA 3MZ2A 2PDMA 3WNPA 4DRSA 3BMVA 4NG3A 3O6AA 2YW3A 2KX9A 1PYFA 4IPJA 1W37A 3PHAA 3VI2A 1H2JA 3KOWA 3VIIA 1US2A 5ABTA 4UQAA 4CCCA 2R94A 1AMYA 1QNOA 1NFPA 1XYZA 3EWUA 2OZ3A 5CZSA 2VENA 3LRLA 2P0OA 3M9YA 3DG6A 1KTNA 3TN6A 3CQIA 4IH3A 1MW2A 3T7VA 5K7JA 2OELA 4YN5A 1WDDA 5CAKA 4HYRA 1KRAC 3MMDA 3E0VA 3W0KA 1C9DA 1DHPA 3GG1A 2JALA 1CENA 3PSWA 3LHYA 2QIWA 4QDPA 1YHTA 4AZGA 3VD4A 1WDQA 2PBGA 3QY6A 1ZSXA 1JDEA 1KXQA 1E73M 2REQA 1JUBA 5FEXA 5I02A 3GWQA 3RMEA 1B3YA 3V0UA 1FWHC 1SZNA 3VIJA 2Z6IA 2QDDA 5BWAA 1NQKA 4LBUA 4E8DA 4MNKA 3VMOA 4YLWA 5BYWA 3G6MA 4LGXA 3LQLA 1SZRA 3A3XA 5E9AA 4CQAA 1SZGA 4UFHA 2FH8A 2WHKA 4HMDA 1J5SA 2ZADA 4W86A 2A79A 2HISA 3QV9A 3WK0A 3GH7A 3IWPA 4W5UA 4RPQA 4U2ZA 1XLKA 2NUYA 4HTBA 1XGZA 3Q67A 1FWBC 2AMXA 3GNNA 1JYNA 1V0NA 3WJSA 3SEPA 1WXJA 3OHIA 3ARYA 1C8VA 4MPKA 3SCVA 4KW2A 1TPDA 3BQ5A 4FMVA 1YXDA 1G01A 2ZCGA 4C6CA 4HNOA 3PBGA 2XGZA 2A6LA 4MFDA 4GIRA 5BU6A 2E8ZA 1R9XA 1VIZA 4HPXA 2P5NA 4W84A 2VEPA 1MEIA 2BGSA 4DO6A 2GL5A 4HNUA 5A6JA 1Q6EA 4WK9A 1UD4A 5FSEC 4JQ2A 3NR0A 3QLLA 3QZ6A 2Y70A 1B0IA 1DE6A 2WMGA 1W8SA 1KBLA 1VZWA 4O52A 4TVUA 2GZXA 2ACRA 4UXDA 3FGCA 1RBLA 4ADTA 3DXIA 5LSMA 4GCXA 1XBVA 2YL8A 3T4WA 1P7TA 1ONEA 2GJXA 1H61A 3PR2A 1NOWA 2DVUA 4Y90A 1JYWA 2A7RA 4M7SA 1K70A 1QFEA 4KKXA 2G3NA 2XN0A 4GZJA 2IS7A 3E2VA 4QJ3B 4X63A 3GX9A 2JKAA 5FF2A 1XYCA 4M0XA 5FL1A 4UOZA 3W2JA 5A8MA 2CFFA 2QDEA 3NQDA 3RCNA 4CCZA 4H9VA 5AZ0A 5GJNA 1BTMA 2EQDA 3W28A 1PDZA 1Q6DA 1VB9A 2C1GA 4HU0A 2XIBA 3OQEA 3W7PA 4M24A 1C29A 3F5JA 3AJXA 5HR6A 1EDGA 1GJUA 4JY9A 3QGVA 1WP6A 1ZGDA 2B7NA 5E0FA 3TTEA 4JTKA 1F6KA 4RZBA 2VFEA 2W91A 3CYJA 4JIQA 4AHQA 3M4HA 1C92A 3O0FA 3FYYA 2RAGA 2GGHA 3FSUA 2A21A 4RV3A 4XAYA 2A7NA 3THDA 1ISXA 1WXYA 3XINA 4IUGA 5CJMA 3T4CA 1UR3M 2WVSA 4XZNX 4XK2A 4XAGA 3W1LA 5I3KA 3BANA 2O7SA 3AROA 2VOTA 1YNPA 3LV5A 2G0WA 5LNSA 3KRUA 4ZXOA 3TA6A 3N14A 2GVEA 1FP9A 4W93A 3WENA 4YS1A 3I10A 3BAIA 4PUJA 3ARSA 3RG6A 3M6DA 5EYWA 4H6EA 3IIZA 1K6AA 1MW1A 1NJJA 5DANA 3E9AA 3BAJA 5HMEA 3G1YA 3L0GA 1E5JA 4JX4A 4DY1A 4IIHA 4QJ4B 9XIAA 2OOFA 2ZUUA 1I2RA 1A5LC 3MVIA 2QCHA 4FP1A 3CHEA 2RGMA 4DJED 1V8EA 5FI8A 3LLDA 5CKSA 3T6CA 1A53A 2WCAA 3O3RA 3BCJA 1VFFA 4PSPA 1KNWA 5KITA 1XV8A 4I5UA 4AC7C 1XRFA 3WL0A 2V81A 3W27A 3EEGA 4UIOA 3PWGA 3QSRA 4OT7A 3AHYA 1F3WA 2RDTA 4BEUA 2ZX7A 1E6NA 3ITYA 3OBKA 4AF0B 1H4PA 3KCOA 3QOKA 1CEOA 1TJPA 1P48A 1QVBA 1GOKA 4DI8A 1CB7B 4URIA 4WD0A 3WLMA 3EXTA 1FCBA 2VGGA 4ZQRA 3ZXWA 1GW9A 2QAFA 4GLEA 2W6RA 4F2TA 1SJAA 4YNGA 3LN3A 4LAOA 2G8ZA 4HSNA 1IWBA 5EGRA 2YDAA 1UUMA 1Z7AA 4TO8A 2WO5A 2R6OA 1VD6A 4O18A 4IXHA 2VO5A 3V75A 1F74A 3CUIA 4JN7A 2PD5A 4IFOA 3SSJA 3CZGA 3CPGA 1EGMA 1HKWA 3AO0A 3OO2A 4JGDA 1C90A 1TV5A 4EXAA 1W1B1 3G1FA 4IL0A 5FJTA 2XINA 3OZPA 3VX1A 4DJDC 2XJ7A 4ZOCA 2FTPA 2FVKA 3GDRA 3B8TA 2GVGA 1E15A 4NU7A 1A49A 3CUXA 1J8VA 1VFHA 4ENLA 1NTHA 4FK9A 3JVAA 4J27A 1I9CB 3KLKA 3FAWA 1QPKA 1MDRA 4H6QA 4TOQA 3WBYA 3LD5A 1NVMA 2OQLA 1Z32X 1QASA 3ECQA 3H2MA 1G9HA 1YDVA 4AC1X 3EA1A 1NDZA 1DIEA 1W3JA 3OA3A 4CD8A 2QCNA 3W7MA 1S5WA 4M81A 4JTQA 1H49A 2EPKX 4ICCX 1X6LA 4GVGA 3L4ZA 1ZQ5A 2J13A 3SY8A 5FAGA 1EXPA 4UR8A 1JNEA 2JIEA 5JIWA 4MY9A 3U4AA 1VBRA 5C7HA 3ZJ7A 4US6A 1IF2A 3TYUA 4LY4A 3WDQA 5I3DA 3HPZA 4L1XA 4MWAA 5KETA 4ZOAA 3LU2A 3PZNA 4O0QA 5T9CE 4IX2A 4AY7A 1L8PA 2VCAA 3PPHA 4R3UA 4REQB 4A3HA 1BXNA 3GHTA 2DIEA 3T0DA 1AW1A 3MWCA 3ZJ8A 3TOPA 3H7VA 4FNRA 4DZIA 2OKOA 3GDMA 1IXNA 4AFYA 2F2KA 4JR5A 4A8LA 4DPQA 5I03A 1C9WA 1J10A 1P0DA 4KEUA 3ANVA 4CQCA 1WKYA 3IGHX 3ZZ1A 2VKZG 4D6JA 2GLKA 2H90A 3MU7A 3GHRA 4S3AA 3BE7A 1D3GA 4LALA 4Y96A 3OYZA 1A5MC 1EEPA 3PJWA 1G1YA 1XKYA 3VE7A 4K38A 1QNSA 4DJFD 4ES4A 1DJGA 1FCQA 2WPBA 4DJFC 1G5AA 3K1GA 4DYKA 2YA1A 1AW5A 4H9MA 1J0HA 2XM2A 1T8QA 2X7VA 1WXZA 5KZDA 3VD9A 2V67A 1QO2A 3JU2A 4BQ3A 3QJAA 4UTFA 3W7LA 2HBXA 2XVPA 3HN3A 5LHFA 4FHAA 1O5KA 2QUNA 4KIEA 1O5XA 4X61A 1XR2A 3VCNA 2OLSA 4I6KA 4GKTA 5BCAA 4JDYA 4FLOA 1P5BA 2ON3A 5HMDA 1XLGA 4PCFA 3EX1A 1K02A 2YL9A 2VFDA 1R38A 1GG0A 1OT2A 1R30A 3ABOA 1FWRA 2ABBA 3GDTA 4QHRA 5FESA 5AVNA 5DMLA 1ZB5A 1UP3A 2W9MA 3PZGA 4ACYA 3E0IA 3L4VA 1TRIA 2ZZ3A 4IMFA 2G5WA 3EZ4A 1JI2A 4ZE4A 4LOCA 3R8GA 1CWYA 1KRMA 3UPWA 1E4IA 5DRIA 1I2NA 4WIWA 4E4UA 4D1IA 3DN5A 3MPGA 4INFA 3PTDA 4M8UA 3GC4A 5A8QA 5E0CA 2QCDB 3M7SA 3DG3A 1ZPTA 3W1PA 5FF0A 4H2CA 4W88A 4L1WA 4NJJA 3W88A 4LCQA 3EWBX 4OKDA 4J28A 3SRDA 2R1PA 3UWQA 1QOQA 2J78A 4Q4RA 1TA3A 3BLLA 3W26A 2UY4A 4NJKA 3LLXA 3DC8A 2ZRWA 4V27A 1YTDA 1SPQA 1XX1A 3ERPA 4ZQMA 2C71A 3OZYA 2Q8LA 4QITA 1ISYA 5F4WA 2ABAA 3MP4A 3NDYA 1YE4A 3EDDA 3WQFA 1XLBA 4IMEA 3IV8A 4GNVA 1F3EA 4X0NA 1QCWA 3HQ1A 3VD7A 4KF1A 2XG9A 2C8NA 1F05A 1M53A 4MNMA 4AD0A 4JNMA 5IDZA 3W84A 4C6BA 3AQUA 3WH5A 1UQYA 5G2WA 4AEEA 5AC5A 4WHBA 3BZJA 2X1SA 1C8XA 3DX5A 5L6UA 4B91A 5B7YA 4K68A 4O1AA 2GQAA 4A6GA 1JUEA 1SSGA 4UTWA 2ZX9A 2Y7EA 4HMCA 3NQ8A 1W9UA 2B7PA 2VEKA 4FLRA 3W53A 4Z2HA 1F4AA 1PHQA 1RY0A 8XIMA 3BG5A 1DL3A 1UQZA 4LV4A 5D8ZA 2VX7A 4AQLA 1Q13A 4QJ1A 2WZEA 2ZUMA 2F2HA 1HKJA 3EXRA 5LIUX 4WDUA 2OMAA 2VZTA 5M2FX 3GLCA 3SRKA 3SADA 4GUHA 4M29A 1GPWA 3WQPA 3REQA 1F7BA 3NSNA 1SW0A 1C7TA 3FXGA 1OFBA 4U4MA 5FF7A 3LHTA 3NXLA 4HNNA 1OFDA 4JIEA 1XLIA 4L65A 4GPNA 4G1KA 4YWIA 5EMJA 3V0SA 2BNJA 3RLHA 2WM1A 1KXHA 4B3LA 1N55A 7ODCA 3UXLA 5B7ZA 2FYMA 4BK9A 3QC0A 3VX0A 4AD5A 3EDEA 5C6MA 4OWGA 2YL6A 2E25A 1REQB 3NDZA 4G8TA 3WEMA 3RR4A 1Y0EA 4F9JA 1QTWA 1XYBA 4PBGA 2YR1A 3QY8A 1O95A 3PPGA 2IXUA 5AVHA 2GSHA 3G24A 2R24A 4K36A 3DZ1A 1YEYA 2BY3A 2VNCA 2YW4A 3P5ZA 1PB0A 3PWAA 1GT8A 2FLIA 4B9ZA 1UZHA 1VCVA 4E2BA 4JAWA 2YCEA 1G69A 1XCFA 1ZBVA 3S5NA 4ZQOA 4DYEA 3PNZA 4AWUA 1TPC1 1P43A 3VDAA 2ZUWA 1P6CA 1HGYA 3F4WA 1KBIA 3FW6A 1L6YA 4PRRA 2CKSA 3IJ8A 3LGGA 4X60A 2QUTA 4UFMA 3SCTA 4NHVA 3W7HA 1WZAA 1I75A 3PZVA 3CB8A 3HU7A 3AC0A 4GI8A 3W7EA 5EMMA 1AQMA 3H7RA 2PEVA 3IVTA 4C6MA 2CLPA 1FWDC 3QKZA 3W00A 1RP9A 3SCNA 1Q7QA 4KRUA 4H83A 2QHAA 5I23A 1A0EA 4W89A 1F76A 1R3RA 1XL9A 3KL0A 2YFOA 1HL8A 4J3VA 4OZOA 4LYQA 2ZE3A 2PUZA 3EWXA 3TP4A 2V68A 3S42A 2GUUA 1NQ6A 1XIDA 3B9AA 5E93A 3C2OA 1Z8AA 2DFAA 3KBVA 4KS0A 1R8LA 2E68A 5D9PA 1OABA 3S8HA 3FSTA 5LIWX 1MUWA 5FKYA 4GIYA 1CGTA 1VP5A 1TCDA 4DM2A 3VOHA 3N13A 1LWHA 2QMKA 1B2YA 1F07A 1JDDA 2PZ0A 3G5EA 3HM7A 2CBIA 1SYTA 2PTDA 1D7FA 3SBFA 4EWJA 2EJ1A 4FXSA 3C2EA 3EDKA 4O12A 4AZ7A 1DIDA 5JIPA 1J2BA 1H1YA 5T91A 3TYCA 1OK6A 3JZEA 3SRFA 3FJ6A 1LP6A 1FHDA 3KRSA 3DIPA 3S2LA 4D8LA 4CU7A 4ICNA 2AGTA 3QPZA 2CYGA 1V03A 3KE0A 3NVDA 4PTVA 2BX7A 4FNPA 2NXHA 4L4OA 4GXMA 4RCXA 1EQPA 1KFCA 3M07A 3H2FA 2NX3A 4XBSA 2Z2BA 3IJ9A 4QR6A 3LM3A 5D2WA 4Y8FA 1E72M 1DKWA 4PUEA 2GQ9A 4EF8A 4DAIA 2ZDSA 4DO5A 2VC9A 3FLUA 4KPLA 3AMDA 3P84A 3TNBA 5I00A 3DG7A 3IIOA 4C65A 3FIGA 3FK4A 2FVMA 1S2TA 3G18A 2I17A 3D3FA 3GRIA 1IV8A 4WY0A 4F79A 2WWCA 3W85A 3TW6A 1Q4WA 1NY1A 4E3TA 3E5PA 4C7GA 3FN9A 5CLTA 1R2TA 1MFUA 1OZMA 5HNRA 3G3MA 3H7UA 1Y5XA 3VGHA 1S5VA 4LANA 5FEWA 4JQ1A 3UGVA 1W3IA 3VGDA 1MW0A 5DF0A 3H22A 4AZ5A 2DJXA 1XQLA 3WEOA 4DHGA 3USZA 5C71A 1SFJA 1LRTA 2VR2A 4HA0A 3SN0A 4JQ3A 3AXIA 3OIXA 1CDGA 3EA3A 5JH1A 3NQGA 2Y8KA 4C6PA 4FALA 3IEBA 4DBUA 4OV9A 3AYSA 4MF4A 1FBAA 1CXHA 1TV8A 2DSUA 5FIPA 2YDSA 1OT1A 1E1EA 5IRPA 2DSZA 1P0NA 3IK4A 1QR7A 4MKSA 1FCUA 3QFEA 4AIBA 4EP8C 1TE6A 3CT7A 3P2VA 4AWEA 1MNSA 2EPOA 4N4PA 1EDQA 1H62A 4O13A 3TROA 1EF2A 1FOBA 1UR1A 1M7XA 3U2EA 3QM3A 1VPYA 3M0ZA 4KWVA 1V02E 3VKJA 5JQ9A 1XSJA 4ZXLA 2E9BA 2VZSA 3MUZ1 1KWGA 5HUOA 4AISA 3DERA 2VQTA 1BRLB 1TSIA 2RJHA 1RJQA 3LZ5A 2BWGA 2WVVA 3CO4A 5BXTA 4LAZA 1YTEA 3TSDA 3MDWA 2D24A 4KGJA 1QWGA 3N34A 1VJZA 1Z69A 1ONWA 4HSOA 3HQNA 3W1NA 3MC5A 4I7UA 4A3UA 2XIIA 4PMUA 4CEXC 5IM51 3PZQA 3LGDA 1CGWA 2DUZA 2Q09A 1WKFA 3BURA 4JDBA 4DZAA 2Z25A 1MZHA 1J2WA 5M1TA 4CD6A 3TYZA 6REQA 4L4LA 2OX1A 4ZTXA 2YFNA 1PWMA 3ICJA 1EX5A 1UB3A 4KCVA 3K1DA 3WLPA 2EF9A 3DFSA 3BMXA 1UWSA 3MMUA 3V18A 3GZ3A 1OY0A 5EFDA 2QR6A 4ZSUA 5GNXA 4WKFA 2GPTA 4BF9A 2FMOA 2EG6A 1A3HA 3GNDA 3DOPA 3BW4A 3VILA 2EPMX 5TNVA 2O4QA 3CL8A 2JBMA 4CQ8A 3IUDA 4AVFA 4MPQA 3W25A 2WJFA 1U1UA 3OVGA 4AY8A 3G3DA 4IL2A 5A6SA 3UR2A 2WJZA 5D9MA 3ARUA 3C0QA 4GX8A 4E4PA 5HUPA 1AJ2A 4QNWA 6ALDA 1WV2A 1V0KA 2FZBA 4HPNA 5G5IA 3VAVA 3I4EA 1OX4A 1O4UA 1NSJA 3AFBA 2PAJA 3OVPA 3G1RA 5LNWA 2ATSA 1GHRA 2QPXA 3QSTA 2ZZ2A 3R94A 2VXNA 2CLFA 3CV6A 1DWJM 3M46A 3BMWA 5CC5A 3RX2A 2DT1A 3FYPA 3LI1A 2QJIA 3ATYA 4PMNA 1SR0A 2X0YA 3CLWA 1KV5A 2PDLA 3MI3A 4GACA 4GINA 4QDWA 1GVQA 2QDGA 3GW0A 4Y9NA 4E5TA 4P7RA 4JHMA 4NSBA 1NU5A 1QNQA 2PLCA 4WGHA 3B9DA 4R5EA 1HVQA 1JRCA 4CNUA 3W81A 1NARA 1YXYA 2R91A 3R6IA 1WDSA 4LW7A 2J4GA 2WZIA 4Q6XA 4B3KA 3GFXA 1YDOA 4ROQA 1NWUA 2ZVRA 1UKTA 4BA0A 3LI0A 2QVHA 4IPIA 7REQA 3LNMA 3KWXA 1TJ0A 2GSJA 4DNHA 3T55A 3GKAA 2X2YA 4ZGYA 4XKYB 3UXKA 4N0RA 1QDSA 1X39A 3TC7A 6CGTA 4LVAA 1RZMA 4S2BA 1PWLA 1RUSA 4KRZA 4H9TA 3MW7A 4H04A 4PL2A 3TN5A 3HFTA 2DIJA 2VDHA 3P81A 3ANYA 2P53A 4O54A 2WLZA 4R9OA 4FAMA 3UF9A 1Q85A 4PRWA 1BAGA 4G7EA 1M7PA 1DQUA 1MEHA 4DEFA 4Z17A 3V0TA 1I0BA 1H0GA 4US5D 1EGVA 3VMNA 4TMCA 4JTRA 1EKOA 4NZJA 2GJRA 5F2GA 5HATA 3A22A 4UMCA 2CXEA 4CLMA 3OW1A 2D2HA 5A5WA 2X16A 3A4JA 1ZUAX 1RCOB 3RM4A 1IEVA 4ECLA 3IUIA 4WXYA 2GDQA 4LV9A 1TZ9A 3AIEA 3ITGA 1MW3A 5A94A 1JYXA 2V63A 4UTUA 5TF0A 4L9XA 2B0MA 1KB3A 1QRQA 3L68A 3WDHA 3S1GA 1ZCOA 1TPUA 4MJMA 1KR1A 9RUBA 4UTTA 5HWNA 1Z9AA 1D2KA 1XBXA 1AD1A 2G3MA 4M82A 5IFPA 3RRXA 3MY9A 5H6HA 4CNOA 3MP5A 1V7YA 4WSKA 1YPXA 1WA3A 3TW9A 1O94A 3UFYA 5G1MA 3AS3A 3ZVHA 2QCGA 3M0IA 2F38A 1JD9A 1EP1A 1BGGA 1KFKA 1TTPA 4OBRA 1K8CA 1I1XA 1I1WA 7TIMA 3MSDA 3C3UA 1E4MM 1GVEA 1ODZA 3DHPA 3O0KA 4QLKA 2Y24A 2E1DA 3AZRA 3ARPA 4H9XA 4TQTA 3W76A 4XZWA 3IIPA 4EPKA 3OJGA 3DFOA 2PDGA 1CGYA 5KSWA 3WD1A 4F2BA 2DQXA 4GQGA 3S9YA 4NJHA 1JZ5A 4A3QA 1HL2A 2BOFX 1LQ2A 2PLJA 3AALA 4Y9MA 1ADDA 1K7EA 1EJRC 2PD9A 3STFA 1DXEA 4XSLA 3BGGA 3W02A 3PJUA 1GOWA 3GTFA 2WW5A 1SMAA 4JFUA 4HYWA 4Z08A 2BY2A 1S2WA 4DUOA 1FWGC 2PWHA 3D46A 2W67A 3W70A 3VDHA 3RN6A 3L4XA 5FJUA 4RZ5A 3WF1A 1A5BA 3KBSA 3A24A 3NO3A 3FA5A 2WBKA 1P0EA 4PCTA 3CWNA 4WZHA 4J1OA 1QPNA 4HQVA 1I0DA 3DFQA 1Q63A 2X8RA 1JPIA 4MMWA 3TC3A 4DLMA 2PURA 4NAEA 4L4PA 3QYQA 4QX4A 1E9YB 1V6TA 4BS0A 3KRBA 5IOBA 3BSGA 2PA6A 2WZTA 4U31A 1ITUA 2VI0A 3SAZA 2C1HA 3B4YA 5LZLA 3BG3A 4BQ5A 4UTWC 2G3JA 1CLKA 2PWUA 2CNCA 1AL8A 3BLKA 4D6HA 3KTCA 1JCMP 1MEWA 5M5DA 3MUXA 3UJRA 2I7GA 2GOUA 3P67A 2ZUTA 2BXZA 2GYIA 4LJ3A 4H8NA 5TBOA 3A4WA 1AH4A 2J9YA 4W7UA 1X1OA 4FOKA 3PAOA 2J75A 3ARXA 4QG6A 1GVRA 1DWFM 1W5MA 4JIPA 4C6IA 5C9ZA 5CC6A 1FFRA 1XLFA 4AAJA 3C61A 1N8IA 1TPEA 1HJXA 3DFHA 2XM1A 3PUDA 2QT3A 4QISA 4MZ1A 2QCMA 2ZDRA 1X97A 3MUIA 1BFNA 4M56A 1XC4A 2AGKA 5HDRA 2NX1A 4WLCA 2UY2A 5ECVA 4CVWA 3BXWA 1DXFA 4E38A 2P50A 3BTNA 3SY5A 2RH9A 2YCJA 4S3CA 2INZA 2V3EA 1GW1A 2L5HA 3QGKC 3DDMA 5LIXX 4G5DA 1DV7A 3WNOA 3B0YA 4LXFA 3A4XA 4HYVA 1G94A 2HVMA 1OFEA 1XLJA 3WJWA 5CBBA 4ATDA 4J4KA 4D6GA 3RO6A 2IKJA 3SUVA 4WJXA 4O53A 1XIEA 2F84A 3E3HA 4BCEA 1OC5A 3QPEA 2IXVA 1OEPA 4QE1A 5DBUA 4OBTA 3I6RA 3SQLA 3BCDA 3S1VA 2BS9A 1OFAA 4ZSTA 3MO4A 3RLGA 3VGEA 2WNZA 2X1RA 4W87A 3QMRA 3PVFA 5T8GA 2YDRA 3V1PA 1A5OC 3CUHA 4UQDA 4RR4A 2PP3A 3P62A 1UWRA 1W5NA 3W71A 4H9ZA 4ATLA 4TR9A 1YPIA 4HBKA 4R53A 3WNLA 3PBWA 2PZNA 1F9CA 2P76A 5C5YA 2FGLA 5F2MA 2WNWA 4PR4A 3NOYA 3SM0A 1ZAIA 3O7UA 4RE4A 2PB1A 3AXXA 2DT0A 5E6YA 1WBJA 3IACA 3VD3A 3PFMA 2PDNA 3FKRA 3MKCA 4HK5A 5AHIA 1MDLA 2GQ3A 1S3HA 2ZBTA 4WDXA 3H2EA 5C9WA 3B8IA 2H8ZA 3G0SA 4K8GA 1L9WA 3TE9A 2XYLA 1U83A 1WX0A 1LLWA 1ZHAA 3VNDA 3DBPA 1TREA 5FCZA 1QT1A 1WO2A 4MKVA 1S3TC 8A3HA 4QQUA 1UUOA 2NQJA 3V16A 3RJXA 4JN6A 5XIMA 4F0KA 1LWJA 1XICA 4K6AA 1I6NA 1WNOA 2AL2A 2PDUA 2NUWA 4GIEA 3Q45A 4HP5A 1FHLA 3CHFA 4Z2IA 1VH7A 2QUUA 3L0NA 2IMRA 3IJDA 4S3BA 3VNZA 3H12A 3GS6A 2DH3A 2ZWZA 3NEHA 3SCSA 3DCPA 4GQBA 4XUGA 2PDPA 1SUXA 2VRJA 4Z2JA 1OB0A 2AL1A 3MYOA 2Q8ZA 3BLFA 5EBUA 2IKGA 3POCA 3NTYA 3BL3A 3UD6A 7A3HA 1LT8A 1E71M 5TIMA 4OVXA 1IEWA 3AXKA 3VM7A 3OLIA 1K77A 3EX3A 3THQA 2A3AA 1FXQA 2PDHA 1EOKA 4BY3A 1UR9A 1GVSA 1RSCA 3IJ7A 4CD4A 3PS7A 1NFBA 4H9YA 4GYPC 3KUMA 4B90A 1V3HA 1KW1A 2QXWA 1J0JA 1HO4A 2FZDA 2FGZA 3W4RA 3L5MA 1MXSA 3GNXA 1EJSC 2PWEA 1HIZA 5CPSA 3PF3A 2QVNA 1V08A 2YBUA 3O15A 2WWDA 4PFMA 3TNOA 3LCFA 2W63A 1E1CB 4AEFA 4GWEA 2QUVA 1GKPA 2I5GA 2VEGA 2ZA1A 2O9RA 1K1DA 3SIZA 2YLLA 5C55A 1FH7A 2PU0A 2OQYA 3MVTA 1EA0A 2WJEA 3GNPA 4E2VA 4IP4A 2YJQA 2NT1A 1ZJHA 1XXXA 1B31A 4EACA 1PZ2A 3EX6A 2AQOA 3GC2A 3PM6A 1QW8A 4O1EA 3B8DA 2OVLA 3BWWA 3TYAA 1TZZA 2HE5A 1KBBA 4EE9A 4BQ2A 3SFKA 3HIJA 3U2ZA 1O1ZA 4HK6A 1M65A 3GK0A 5AHFA 5GJMA 1Z41A 2WMKA 3B03A 1BYBA 3RMJA 3VNLA 3CO8A 4IMCA 3OODA 4Q4QA 2QZRA 5MKGA 2J7GA 4WXZA 1JZ2A 4AEOA 1AJ0A 5CZ0A 1XBYA 5REQA 3H2NA 2PDJA 4S38A 2NQLA 1HKMA 1U5VA 3WDPP 5IHSA 1HKIA 1PXGA 4R7WA 3A4AA 4V33A 3M0YA 1XIBA 3ABSA 4QE5A 2CLOA 4N9DA 5JU6A 3KL5A 3UESA 3VIKA 3A5VA 4DWSD 1AFSA 1SO4A 4DWSC 2CLMA 1JPMA 3CZEA 2NW0A 4C1KA 4ZB2A 1Z89A 3EBVA 3S4TA 3DYPA 3ZFHA 3NL3A 3KLLA 4NZ1A 1WDWA 5CZKA 4NI3A 3NJ3A 4YJ5A 1OK4A 4GD0A 2NZLA 2VCCA 1UC5A 4L56A 2NQZA 3HG3A 4FNQA 1SW7A 5GPRA 1ONXA 1E0WA 5DMYA 1K9TA 3WO8A 3PUGA 1POKA 1GEQA 3BO9A 3KXQA 5DT5A 4JTAA 1EO7A 1Q4NX 4PMOA 4DNMA 1VLWA 4UCGA 3A47A 3CUFA 1LM1A 3POHA 3GYCA 4QM1A 3TJ4A 2HV5A 1UJQA 2FZNA 2PDYA 4O8AA 1WZKA 3B4UA 3NSXA 1KO0A 5LGZA 1CXKA 1T5AA 3PZUA 1JCYA 3LSBA 1T7LA 4RPPA 1ME7A 4GQ0A 4KWWA 4EK7A 2WLYA 4GH1A 4AX7A 1VBHA 2W5FA 3GUGA 3CZKA 1PZ3A 1V3IA 1H7NA 3CEPA 2NSXA 3CXOA 4H7VA 1G4SA 1W5QA 4Z2KA 4W5ZA 2E5CA 1QPQA 3CHDA 3QHOA 3G0XA 4C91A 3F4NA 4QNEA 4HZ6A 4IT1A 1TUFA 3M44A 4ZVJA 4PTWA 2PP0A 3BAWA 2ZZ4A 4H8VA 3W6MA 1V79A 1H7RA 4AVOA 3ATZA 3SN4A 3OGSA 4AF0A 2GSEA 3NAVA 4U3AA 1ME9A 5J04A 2BVWA 3P5YA 4FF5A 4R88A 3P0XA 2A4AA 2QCEA 1J93A 4IMGA 2XFFA 3LGEA 1IGSA 2HEJA 8CGTA 2WANA 1TJ2A 2C79A 4IX0A 2VEIA 4HCDA 3W75A 1KQZA 3DBNA 3MI2A 3WLIA 1EWEA 4P7QA 3LLFA 1JNDA 4JKLA 5H91A 1HZYA 2IPGA 1J6OA 1EJVC 2VT0A 3WSUA 4BZYA 4U28A 1X96A 5I3JA 3P82A 2TMDA 2PGWA 3WUGA 3UZYA 1IZKA 4DI9A 2WB5A 3NQBA 1TO3A 2GUYA 2JQXA 1NIUA 3PTMA 1O1HA 3BSMA 4O17A 4UWMA 1EPXA 1M7OA 4JTEA 3UXAA 4DAFA 3QMSA 4D71A 1B4KA 1TE1A 4S3KA 1XUUA 3QVQA 4JYDA 3SJNA 4XKMA 3LEPA 4G9PA 2V82A 3QF0A 3EMQA 4O8RA 3W1RA 1KCXA 4MJZA 1J79A 1QI5A 2B7QA 5JBEA 3OLGA 1X6UA 2H9AA 3RNDA 4DVOA 2PE4A 5HOSA 3B0PA 3WLLA 2ZE0A 3TVAA 2WC4A 3ARQA 2V38A 4AVNA 2PDXA 3F5LA 5CG7A 2EEXA 1VC4A 4GKLA 3S5YA 3PNUA 1IHIA 4X22A 4BF7A 3NL2A 2X7WA 2C7FA 1OZQA 4JEJA 4GNJA 3P61A 1LL6A 1JZ4A 4JFSA 5F4SA 3W07A 3MSYA 4UFIA 1W31A 4JOMA 1VAHA 4MB5A 3VVGA 3MUAA 4D1JA 4IFKA 4REQA 2ZA3A 3BLIA 2A1YA 5BOFA 1IE7C 4WUIA 1EL3A 2E5DA 3OGVA 1UKSA 4Q3MA 4JCMA 4IXXA 4MAVA 3R0UA 2HZGA 5KZ6A 4F9DA 3QQ0A 3GU9A 3STEA 2DQWA 5MHBA 1RQHA 3CTLA 3D0CA 1NEYA 3MJYA 1XPGA 3EOLA 3W7IA 3VCCA 4XQ6A 3L5AA 3N3TA 4N42A 1XYLA 4IWWA 4UTMA 1R9YA 4AH7A 1X1ZA 1J0ZA 5BXSA 2PSNA 2OZ8A 1GZJA 4S3DA 4FX8A 2QEZA 2VEMA 2D0HA 1HL9A 1KM1A 3C0JA 2BY1A 3NQEA 4ZFMA 4HA3A 5AECA 1S2VA 3F4VA 2DUXA 1JF5A 1FUYA 3E2SA 1W9BM 3W7OA 4IMAA 4NY2A 1JQXA 1EHNA 1FWEC 1L0PA 2PTYA 4MB4A 3WQDA 1FDJA 1OD8A 3HJZA 3LB0A 1H7XA 3NIYA 3MQTA 1TMQA 2JE8A 1QPOA 3TMLA 4HOZA 1U1HA 3NQCA 4C6FA 4UTTC 2AQWA 3BH4A 2C15A 3UERA 3IGXA 5DO8A 4MNJA 1UZ1A 1BPLB 4PB3A 4R27A 1E0XA 3WY1A 4PUKA 5LA0A 1LL4A 2CLLA 1TJRA 1JYVA 2XFWA 3FS2A 1AW2A 3O63A 3R11A 3IARA 2QCDA 1K7FA 4ONVA 4QDMA 4WOZA 4UNLA 3TCEA 1T0OA 1JL8A 2HJPA 4HHMA 3GXDA 2C16A 1GOIA 2NQ5A 1RBAA 3TSMA 2WHJA 2WNNA 4JD4A 1KC7A 4DJEA 1ECQA 4FEZA 4WOQA 4DBEA 1FY6A 2G50A 2MUCA 4GXPA 1PZ1A 1W1PA 3GNOA 1EF3A 3LRKA 4OECA 3NFUA 3DENA 3OZOA 4YVXA 2PGRA 1AZ2A 3BJFA 4RE0A 3AIBA 3KHJA 2IQ0A 4K1GA 1BXBA 4HU8A 4QG9A 1KLZA 3NEVA 5F7UA 1S2UA 1F73A 3ZO9A 1B54A 4FB7A 3WNNA 3R8RA 2HXUA 4NNAA 1Y8BA 3W72A 1LOLA 3KCJA 2VDGA 4NRSA 2PWVA 2FJKA 1B3OA 4U5KA 2XGIA 3WLKX 3PBUA 2E28A 3WMCA 5CH9A 4JZ5A 3ES7A 4ZMGA 3PY2A 1Q8AA 4PN2A 4YCOA 3O9NA 1AA1B 3SO7A 5AYIA 3L12A 2VGFA 3MHGA 3HPXA 3HMCA 3T78A 4DZ5A 1XW8A 1HTIA 4QLJA 1C8QA 1JPDX 1JPKA 2J8GA 3MKKA 3INPA 3D5HA 2CERA 3AMKA 6PTDA 2WHMA 1WE5A 1DWHM 3U5YA 5JUVA 4IZGA 4BHYA 2GJLA 2C1IA 3H8AA 4IIFA 4X2RA 5A6TC 4LAKA 1TJ1A 3NUKA 4X0VA 4P8UA 3H21A 3COTA 3FGCB 1E70M 3PB2A 1IZJA 3SURA 1RPKA 5G4WA 1VQTA 3MANA 4GXWA 1EC8A 3EB2A 1P7TB 2G41A 2TPSA 2GJXB 2YXGA 2DSVA 1W1A1 2XUCA 1DORA 1BWVA 3AZSA 1OYBA 1OCBA 5I7GA 4LVFA 3PPFA 4LNCA 3MB9A 3W7KA 4F2UA 2CPUA 1UPMB 5CBIA 1XM3A 1JFXA 2E7FA 3L66A 3RCYA 1W6TA 1E55A 1SO5A 1H7WA 3UCCA 3PN8A 3W2UA 3WLOA 1V6YA 1FRBA 2Y85A 2DSKA 4TV6A 1ICPA 1F3XA 2OX4A 4FOUA 3W1TA 4AHPA 2PWFA 4NXKA 5C2GA 3OGRA 5KTLA 2INFA 4DF0A 2Y89A 3YPIA 1REQA 3ISIX 3QLDA 1YX1A 1ZLPA 3D3AA 4ZB5A 4CEUC 4A2SA 3D47A 4KQNA 2JFEX 1PX3A 3GY1A 4I7VA 4LWWA 1FH8A 1ZNNA 3EPMA 3SUUA 2VFHA 3HFYA 4L4MA 4HHHA 3UG4A 1C7SA 3NG3A 3WUBA 4DJFA 1UHVA 1UG6A 3GDKA 2OEJA 1I8JA 1L2QA 3FVDA 1ZCCA 1CGXA 1VPXA 4GNKB 4OHQA 1PKYA 3A6OA 3W1QA 1PUDA 1PKNA 1ZY9A 4AB4A 2WVTA 4MHBA 1BF2A 4GFIA 3N3MA 1EJUC 3CBWA 3ARZA 1OGBA 1QUMA 4G56A 1E43A 2OFJA 3GZAA 2F9RA 2J9ZA 1Q6CA 3FA3A 1QBBA 1XBZA 3S5SA 2ZOXA 2BVYA 3LHVA 4GBDA 5HK4A 4GUJA 3S5ZA 1K8YA 3UWVA 1XS2A 4AZBA 5I3GA 5DCDA 3N11A 3U7VA 3AHXA 3QHMA 1JFHA 2RDUA 1TZ7A 3BGJA 3GAKA 1HJSA 1QBAA 3P80A 2D1ZA 2Q6ZA 2QYGA 3GM8A 4YCPA 1LOQA 1S38A 1QPRA 1B30A 1HKVA 3SY1A 3RM9A 1K3UA 3Q37A 4L9YA 4O50A 3T1GA 1UPPA 1CLXA 3GVQA 4FIRA 1B57A 1R7OA 4R34A 4JTJA 1N8FA 4RNHA 3CQ0A 1R2RA 4NQ1A 3AXHA 4PUWA 4LPCA 1XD0A 1AD4A 2BGNE 3W2KA 1LBMA 1FTXA 1G6CA 1CX