1D8WA

L-rhamnose isomerase
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
416
structure length
402
Chain Sequence
b'TQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-RHAMNOSE ISOMERASE
publication title The structure of rhamnose isomerase from Escherichia coli and its relation with xylose isomerase illustrates a change between inter and intra-subunit complementation during evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 142
structure length 402
sequence length 416
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 1999-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1d8wA00
3FVMA 4E3VA 1XYLA 2GUBA 2GYIA 4HGXA 4QE5A 1XYAA 4KW2A 1GW9A 3QXBA 1XLKA 4ZB5A 4EAYA 1I60A 4W4QA 4QDWA 2HK0A 3CNYA 3XINA 9XIMA 4GJJA 1XLLA 2QUNA 3UU0A 5C9ZA 3KBMA 6XIMA 5EMLA 4DVOA 1I6NA 2XISA 2X7VA 1DE5A 5XIMA 3VYLA 1XLAA 4US6A 5XINA 3XISA 1XIBA 4X61A 3U0HA 3AYTA 3QC0A 2NQJA 1BXCA 4QE1A 2NQHA 2QUMA 1XLEA 2GLKA 3AALA 1XLJA 5H6HA 3L23A 4X63A 1YX1A 2G4JA 4PGLA 5H1WA 5J8LA 2HCVA 5EMMA 3DBNA 1XIEA 2G0WA 2X7WA 3M0LA 4QEHA 3ITXA 3KTCA 4DUOA 3KBSA 2XINA 1XICA 6XIAA 1DE6A 2NQ9A 1XLMA 1XYCA 5XIAA 3M0YA 3TC3A 2OU4A 3AAMA 1XIMA 2GVEA 5AVHA 4HHLA 4GJIA 1K77A 1TZ9A 3VNIA 3LMZA 3C0LA 4GLEA 3CQIA 3UVAA 3ITYA 1XIDA 4PFHA 4EACA 3KCJA 3M0VA 3ITLA 8XIAA 4YTUA 2QULA 3P6LA 2HK1A 1O1HA 1A0CA 1XISA 4ZB2A 3UA3A 1XYMA 3BZJA 1A0DA 3WQOA 4A8RA 4J4KA 3KBWA 4XISA 1XYBA 4YTRA 3BWWA 3ITOA 5EMKA 1XIGA 3QYSA 3KCLA 4XSMA 4X60A 4XKMA 5B80A 3ITTA 3KBNA 3KBVA 1XLDA 2I57A 1XIIA 3M0HA 3IUIA 3NGFA 1MNZA 1XLIA 3VNJA 3DX5A 4K3ZA 3N4AA 1A0EA 4XSLA 7XIMA 1MUWA 3OBEA 3GNXA 3AYVA 3C0SA 1OADA 3KCOA 1XLHA 1XIHA 3KBJA 4A8NA 4QEEA 1XLBA 3QZAA 3VNLA 1D8WA 4QDPA 2QW5A 3VNMA 5EMJA 1DIEA 3CQKA 4YTTA 2Q02A 3IUDA 3IUHA 4G56A 4QE4A 9XIAA 2ZVRA 3BANA 5I7GA 4YTSA 3CQHA 3M0XA 4XIMA 3P14A 1QUMA 3UA4A 1QTWA 2XIMA 4A8LA 1S5MA 1XLCA 1XIJA 3UXIA 2ZDSA 3U3HA 3VNKA 5FA5A 1DXIA 2J6VA 4LNCA 4Q7IA 4ZBCA 3M0MA 8XIMA 3C0QA 4K1GA 2I56A 1QT1A 1CLKA 3CQJA 1S5NA 3BZGA 5AVNA 4OVXA 4HHMA 3XIMA 4HNOA 5B7ZA 4XIAA 4ZB0A 3CWHA 4A8IA 5TNVA 3TVAA 1XINA 1XP3A 3JU2A 1BXBA 4GQBA 1XIFA 4YTQA 5B7YA 3KWSA 1DIDA 1XLFA 3ITVA 3BDKA 1XLGA
chains in the Genus database with same CATH superfamily
1E15A 4ZQPA 4DB7A 1YXCA 3M0IA 4QGCA 2YDRA 1N8WA 3ATZA 4E2VA 2EG8A 3LHTA 4R5EA 1DVJA 2HS8A 2WSPA 5CCZA 2NW0A 3U4FA 1XBVA 5CPSA 2Z2AA 1PZ3A 4FOKA 4Y2WA 1TUXA 1JI1A 3CT7A 1YPXA 3CV2A 1E4MM 4GBUA 2GJXB 5H1WA 1LUCA 1FDZA 1E40A 3C0JA 1FWWA 3CC1A 1OYCA 3V0TA 5XIAA 1EJSC 3U5UA 2P3ZA 2Z2UA 1A50A 4HHLA 2CKSA 4XG1A 2IXVA 2QYGA 4C60A 1P1XA 1EZ2A 4JFWA 2FZDA 3W83A 1OM0A 2VELA 4GVIA 1V6XA 4HCDA 1IGSA 1QNQA 3UJEA 4B5XA 3NL6A 1HVXA 1O4UA 3VFCA 4UR9A 2DZAA 2E6FA 1JZ3A 3VNMA 2O9RA 4S39A 2NWRA 3NOEA 5CBIA 2HV5A 4ENLA 2OWWA 2CBJA 3EX2A 3BLLA 3BSHA 1XDJA 4YYCA 3R25A 3H23A 3SUTA 4JDBA 1CB2A 1XX1A 1XH2A 4H9VA 3RLGA 1CPUA 1XFBA 3ANYA 4PMUA 3A3XA 4GQBA 1L2QA 4FHAA 4GO9A 4FP1A 5AFDA 3W25A 3T78A 3EDFA 4W7UA 4CN6A 3FVMA 5DCDA 5I77A 3PC0A 2V38A 3GHUA 4DHGA 3GIQA 3DC0A 4V33A 3F4DA 3FA4A 4XVEA 3BGGA 4O4VA 1FRBA 1PAMA 4KEUA 5LA2A 1JDDA 2QEZA 4N9BA 5C5YA 4QNWA 1XGDA 1OZQA 3TKFA 3NUKA 3RU8X 4HQVA 3W84A 1GOIA 3C2EA 4OHQA 4AMAA 2E5CA 4MWAC 2WKJA 3NZQA 1PWMA 3S6OA 4QLLA 5K7JA 3NAVA 1K4GA 3B9EA 3LXCA 2CPUA 3M0VA 1BQGA 1KD0A 4KCTA 3FYPA 4PCTA 4C6DA 4JTQA 5FAJA 4PEKA 4LUTA 3BOXA 3NEHA 5DEZA 2GJRA 3GD6A 5IBXA 2YBUA 5A6MA 1POJA 1PV8A 1XIHA 5H8MA 3L4YA 5HA7A 3W71A 2FPVA 2GQ8A 4FI4A 3PAOA 2OELA 3GXTA 1IQ8A 1SSDA 1E43A 3GHRA 2OQYA 4ORIA 1OVDA 4NT0A 1W3IA 2ZVIA 1PYFA 3N6HA 3MO4A 5HJXA 1XH0A 2FJKA 4GI9A 4GH3A 3H2OA 3MS8A 2POZA 2ONEA 4I9AA 3W1LA 3K13A 2E25A 3F5JA 4LUYA 2PCQA 3CWNA 3FW6A 2AMXA 1X8FA 4AX6A 1ZNNA 3LXBA 1I0BA 1TWSA 4V27A 1US2A 2X7VA 5LHFA 5F4SA 1GJPA 3M6YA 1H62A 1HL2A 2Z0IA 4GISA 3O6YX 3RO6A 1J0ZA 3PS7A 3M0LA 1M7JA 1CDGA 3ABXA 3S5NA 4NI8A 1CECA 4LRTA 2JKPA 5GVJA 3NQAA 2J9ZA 3RJYA 3GNNA 3EKGA 2FTYA 3SFWA 5M2FX 1EZWA 3TWAA 4NKCA 2GK1B 2WBKA 3DN5A 4N9EA 2E68A 3BLDA 1Q6GA 4L1WA 3TH6A 4XKMA 1S3HA 1A5BA 5CGQA 4DJDA 1KCLA 1TMQA 4RNHA 4D72A 1DQWA 1Z6KA 3BAYA 2FZBA 3MZ2A 2J27A 5DN1A 2WKGA 4H6KA 3TYZA 3UA4A 5FEXA 3ARSA 3HJZA 3MCOA 4MHBA 4TR9A 4EXQA 1TX2A 4HYRA 3RR4A 4OVXA 2FZ9A 3SGGA 5B7ZA 1EYEA 1RBOB 5CLTA 3W74A 2ZZ1A 1GEQA 5D9OA 2B81A 3B8SA 3MWCA 2WJEA 1LROA 1B3XA 4ACZB 1LQAA 5A8GA 4DXVA 3AZSA 4EXBA 4GXWA 2VVSA 3LLXA 3VZYA 3F4WA 1GOWA 1KM2A 1PHQA 5AC8A 1XLAA 3WSUA 1UUOA 1KM5A 1EA0A 3QY8A 1S2VA 4NZ4A 5E70A 2I7GA 3VGHA 2X7WA 1WAUA 1OX4A 1NF0A 1EA9C 1TWIA 3H2FA 3VDBA 2ZTJA 5D2XA 3UVAA 3LG3A 1DPMA 2TMDA 1EUNA 4CU7A 3E2SA 4G6CA 4CQDA 3IACA 3DFPA 1M7OA 2PRLA 2VYOA 3GW0A 1MQQA 1PKNA 1YXDA 2ATSA 2Z2BA 3FDGA 6ALDA 4OBTA 3CH0A 4F0LA 1B9BA 1AL8A 2HVNA 4MJ2A 4DLFA 2ZZ2A 1AQMA 4YVPA 3BGAA 4A8LA 4LYRA 1DYSA 2W61A 3AXXA 3T2PA 1LRTA 3CUGA 3UZ5A 5I07A 1SM9A 3N6QA 2XM1A 1U1UA 3EWCA 1DL3A 1EC9A 3I3EA 3AIEA 2HDJA 1TWWA 3WK1A 1JYWA 4FXFA 2OEJA 4A3UA 5LNUA 9XIMA 3VKCA 4E38A 3OGSA 1Q45A 3NPXA 4UTKA 1NU5A 1R85A 2E67A 2OCZA 3N3TA 3ANUA 3AALA 4M8UA 1UHVA 3DYPA 1YTKA 2VM8A 3IPWA 4TX6A 2XM2A 1E1FA 3PZGA 4UNIA 1BHGA 2A1YA 4TUFA 4XV0A 3CH9A 4PODA 3C0LA 4S3FA 3CQIA 4QR6A 4YTUA 2HE8A 2VFGA 1OG6A 4YLWA 2R1MA 2DZTA 4Y9PA 4JY9A 4B5VA 4GRSA 2VXNA 1ODUA 4HB7A 3S1UA 3GXDA 3ZMRA 5CKSA 4MUZA 1TVPA 5BWFA 2XWDA 3D3AA 4XSLA 4JTDA 4O1FA 2CXEA 3AIWA 1TJ2A 3K46A 4XZWA 1V51A 3ELFA 3VIIA 4AD2A 4IX0A 2ZVRA 2XJ7A 2WCSA 4RNJA 5CJNA 3ZVIA 3APTA 2OO0A 1IXNA 5EYWA 1TB3A 3G3MA 3RX3A 3CV6A 3HM7A 5KTLA 3NQFA 1YTEA 4D1IA 2G8ZA 1UH4A 3MKVA 1PCWA 4K7YA 3T42A 4CEUC 3GG8A 3S46A 4N02A 4H9TA 3L0GA 3T07A 1QK2A 2E5BA 1A49A 4W7VA 3UGRA 2P50A 1C8QA 2BVYA 1PVNA 1Q4WA 3TONA 4A3RA 1WZMA 1Q13A 3DHPA 3UZWA 4DVOA 1EO5A 3MKKA 5DXXA 1W91A 3VKAA 1R3VA 2GQAA 3USBA 1XKYA 3PNUA 4MJZA 4ZE5A 3U7VA 1ZJHA 4AVNA 1PPIA 1IEQA 3LNMA 4X63A 2FFIA 3G1HA 4A29A 2WMFA 4LOCA 3DFOA 4WK9A 3L4XA 3FXYA 2D24A 4S2BA 2OODA 4GINA 4RZBA 2D22A 4M6VA 1T0OA 1C9WA 2Z6JA 3BAKA 1TWZA 4DUWA 3DFTA 4HJFA 3PPCA 4UQEA 3D3FA 3IARA 1US0A 1PZ1A 2D3NA 5I2UA 5D9MA 2QCEA 4PBEA 1GYNA 4IJCA 1TPDA 3I65A 5A8PA 4L56A 5G4HC 3LCLA 1OCQA 3UZXA 4Z42C 1KBLA 1XJBA 2ZRWA 1R2RA 1S2CA 3B0YA 3WEZA 2MUCA 5CC7A 2Q3RA 1W9UA 2V67A 1W54A 4RR4A 1VS1A 2ACRA 1D9EA 1B3WA 1RJPA 2VWSA 4IHCA 1ZHAA 1G6CA 3TVAA 3LERA 3FA5A 3BUVA 1I75A 2XFYA 3JU2A 2Z00A 3R0DA 3VE9A 1H1ZA 1N2VA 3R10A 2E40A 4W85A 1SFTA 5EFDA 1RD6A 3T1GA 3OVQA 3R5EA 4UWMA 4US6A 4PUKA 4DWSD 2FPTA 3AIVA 2UY5A 2PDWA 1CZ1A 1KC7A 1GOKA 3VD3A 4LBRA 4XBJA 1W9XA 2QF7A 4ZMGA 2O7QA 3LRMA 4JX4A 2XN1A 4Z17A 1AFSA 3D0CA 1PTDA 2CXGA 1P0EA 3BW4A 3E02A 3OO2A 3TFXA 4KBXA 3EBVA 1XRVA 1Y5WA 4GZIA 5AHLA 2EF9A 2OT1A 1MEHA 7TIMA 2NXGA 4MZ1A 3CV1A 3IRSA 5IM51 3KXQA 1RVKA 3QMSA 5GQBA 4HTBA 2I57A 2ISWA 2X1IA 4O16A 4K1WA 3WDJA 1IE7C 2J6XA 4XD4A 4N4PA 1S5WA 1F74A 3AU2A 3GG1A 3C8FA 3CZKA 3FSUA 3MY9A 3NQCA 3GUGA 2GDQA 1OFBA 1X1ZA 5G4WA 4NZ1A 4IPIA 2WZTA 5F2GA 1TA3B 4PB3A 1GVFA 1OQFA 3WQ4A 3M9YA 5D09A 2INEA 4YTQA 3TP4A 3UG3A 4PCPA 3NM1A 2DORA 1SU5A 4NQ1A 2PGFA 4L7ZA 2Y24A 3VINA 2WMKA 3SSZA 3SECA 4AHQA 3TNBA 3JZEA 5HK4A 2IQDA 4JTUA 1RD5A 3H7VA 4HCLA 2D1ZA 1GOOA 3RU6A 1UD2A 4CNNA 3CQ0A 4AUBA 2VZOA 3VUSA 1E55A 1UROA 3LLDA 3L23A 1S1RA 1T8XA 3U48A 3RRXA 3EDJA 4QAIA 3TZFA 3AHTA 1ZGDA 3ABQA 5E1QA 3TC3A 1CW2A 2AAAA 3AU6A 2F2KA 1J0HA 3RMJA 2WK2A 4K6AA 3EOSA 4C5ZA 2ZOXA 4W93A 5EMUA 5BXRA 2JGYA 3TCEA 4YS1A 3CWOX 3P82A 2VHLA 4HZ6A 3SCUA 1MWOA 4GH1A 1TCDA 4D6CA 3AIUA 1IEIA 3NQ6A 1VBJA 4JFTA 3MQTA 1N55A 4MAZA 2D3LA 2YCLA 3QVQA 3OVPA 4X0VA 4M7SA 1H7NA 3GH4A 4B5UA 4RJEA 3PUOA 1DJQA 3V0UA 2Z7KA 4MWAB 4XTIA 5CC5A 4QJ5B 5I3KA 2ESCA 2I5IA 1H1YA 5EBAA 3DFYA 3QSTA 3C2FA 3VC6A 3QV6A 4JTJA 3W87A 1HZYA 1I2QA 1TV8A 3U2EA 3BMVA 1UH3A 1PS9A 3K1GA 2VOMA 1F5ZA 4D6IA 4F8XA 1K8CA 3K4WA 2C1HA 3FDKA 4Y8FA 4F2UA 3U0HA 1IZJA 2G3NA 4F2BA 1TVNA 2QUMA 1ZCCA 3IWPA 2F61A 3BQ5A 3QN3A 3A6OA 5CZJA 4LUSB 4UCGA 3ITXA 1H50A 1GYMA 1YDNA 1N82A 3T81A 4QJ4B 1PHWA 3MSYA 2C15A 4MWAA 2QPUA 5F2IA 2FDMA 1YLVA 1WYIA 2ZE0A 1ICPA 5CZ0A 1UKSA 1XBYA 2EG6A 1UW9A 3PJXA 4LX4A 2ZXDA 3QV7A 3VD4A 3NQ8A 2BP1A 7PTDA 4JN8A 4HYWA 4HU4A 2Y6ZA 3OLDA 1E5JA 3PPFA 4HN4A 1SPQA 1VFHA 2WVUA 1QWKA 1NFBA 2QGHA 2ZC1A 1VBGA 1JI2A 3NPUA 4FSAA 5F1VA 2OT0A 3W37A 5FJOA 1IEXA 1JDAA 3QC3A 2Z29A 3P62A 3GRIA 4NZ5A 3HIJA 4JY8A 4EE9A 3REQB 4Q4OA 5HATA 4MVAA 3RCNA 1MDLA 1XD0A 2VDIA 4U5IA 5H8PA 2Q8ZA 4IPPA 3PAJA 3ZFHA 3M6DA 2NT1A 3NDOA 3N25A 3V5FA 5ABFA 4W9TA 2V5BA 5C55A 2ZKMX 3NURA 4D8ZA 2OMAA 2AAMA 3GE7A 1NARA 2H9AB 4NAFB 2GGHA 4GACA 4JN7A 4PUUA 2W6RA 1UKOA 1MW0A 2BASA 3P80A 2ADAA 4WJ8A 3PWIA 4JPGA 2J62A 1BF2A 4GGHA 2FZ8A 3OQEA 1BYCA 2VZTA 2E1DA 2WSRA 6XIAA 1FA2A 4Y9MA 1DJZA 1K6WA 3M64A 3NQ7A 1C92A 1S2WA 4QFUA 3R2GA 2YL8A 3EXSA 4AY1A 1UBPC 1MMFA 3O05A 4R9OA 4IL2A 1KBJA 1LP6A 1W3KA 2PDNA 4X22A 1F8MA 2QCHA 2XTKA 5I78A 1U5VA 4K8GA 1I4NA 1UUQA 3LK6A 2OOGA 3QGVA 4HKPA 4G1KA 1C8YA 4B5WA 3B97A 3WJXA 3ABRA 3P14A 3VVGA 1QUMA 6REQA 1Q6EA 3WD4A 2A3AA 3VIFA 3RX4A 1JXKA 3N29A 3LLFA 3VILA 1PDYA 2JIEA 4TQTA 4PBFA 3OODA 1UMLA 3T55A 3A22A 1BPLB 1FWEC 2ZX7A 1J01A 1KV5A 4ZOEA 2RDUA 1GYLA 1HJWA 1QAPA 4MDPA 3ZSSA 2W79A 3P67A 4B3LA 2I9UA 1A5CA 2AGKA 4Q8UA 4JDYA 3IV8A 2OZ8A 4DF2A 3TJIA 3PZ9A 4FR6A 2QVNA 4CQBA 4QTGA 4R9XA 1QRQA 1VEMA 2EPKX 3RNDA 3UERA 5BW6A 1QPOA 3O6DA 3SCNA 1FWJC 2POTA 3WLJA 1ZP3A 1IWAA 4J3XA 3BVJA 4UR7A 3TSBA 1FX6A 1CWYA 1JPMA 2FTPA 1K77A 3L5MA 4XD6A 1V0MA 2XZ9A 3J7HA 1NQ6A 3IV3A 1QOPA 3LOTA 2YFNA 5GNYA 4ERIA 1EJVC 3S2JA 2WNNA 5BMXA 1K8ZA 3WJSA 2BXVA 2QR6A 1OF6A 4P7LA 3VGFA 5CSRA 3MJMA 3ME3A 2BVWA 4C1LA 4TVUA 5JBDA 1ZAHA 4KPLA 3S83A 1XC6A 4UQAA 4H1ZA 4LB4A 3LHWA 4NY2A 1MVYA 2Z1VA 4TV6A 3IANA 4DUVA 5F2LA 3H7UA 4BF7A 2FMNA 5MF5A 3JRKA 3QBUA 3QM3A 1GTEA 4NZFA 4EPKA 2DVUA 2HNEA 1V77A 1I2OA 4AU0A 4POCA 3SQLA 3UFYA 1TVLA 3A21A 4XB3A 4L64A 3EDEA 2JKAA 2XIIA 3ARWA 3GTFA 4LBSA 5LXEA 3L67A 1HN1A 5E5CA 2PWHA 3GDKA 1FFQA 1WDWA 1KO0A 2WHKA 2WNQA 4TVDA 4RZ6A 3KDOA 4LPCA 3SR7A 3S6DA 3MB9A 3MHFA 2NWSA 3TTSA 2GWGA 2Z25A 1D8CA 3S1GA 4LU0A 1FWTA 2E28A 2V5LA 7TAAA 3GG7A 3PPHA 4IISA 3N9RA 1XIMA 2PTZA 1WKEA 1F6PA 1WAWA 4QQ3A 1UR1A 2Z1SA 3FK4A 3WF3A 4DZIA 5AHEA 1EPVA 2DP3A 4RUBA 4F0HA 3AXHA 4HNNA 2QQ6A 2R91A 1JZ6A 4GKLA 1O1HA 3DIPA 3TQKA 4AZCB 2WOQA 3KBNA 2OTDA 4CNUA 4CCCA 4GZEA 2ZZ7A 4D6HA 4P7OA 2GVGA 4HU0A 3KRZA 3DKJA 4WZHA 3N11A 3W7NA 3S0CA 3W0KA 3F7JA 2RUSA 3ZT7A 1OJXA 1UOKA 4C6EA 3FLUA 1VD6A 2ZA3A 1WBJA 4NRRA 4DNHA 5LIUX 4EF9A 1RCXB 1QFEA 3LCIA 3TMQA 1YDYA 3CXOA 3GSMA 1E0VA 5HPOA 1CGXA 3P81A 1DJGA 4ZFCA 1GJUA 1EF2A 3A3WA 3LCFA 3DYMA 2QJJA 2PDXA 1UWSA 1UZDA 1I1XA 2DGAA 2XVKA 1X6NA 4G2DA 1YDVA 1ENUA 1ISXA 1GHRA 3MMUA 5I79A 1OYAA 3QR3A 4H2HA 4AWTA 4W87A 2PP1A 3W00A 2BY0A 2PDLA 2D0GA 3W22A 1TTJA 1E73M 3MUZ1 1C9DA 3WQ8A 4IUOA 1DWHM 3W1NA 2OG9A 1ISYA 3UJRA 1JD7A 4E3TA 3O9NA 3PUDA 1VYSX 1GVQA 1XBZA 4JTGA 1U22A 2Q8XA 2ACSA 4AC1X 3EMZA 1JZ5A 5D04C 3UWQA 4Q4KA 1QBAA 5A6JA 1FH8A 4LVFA 4OWGA 3VX0A 2ZXQA 4NSBA 3B0XA 1K7EA 4O0QA 3MKCA 1KFBA 1XSJA 3U8GA 1Q2SA 3SGZA 2NVCA 3M7SA 2PC8A 5DRCA 2W63A 2NX3A 3UT0A 4MSSA 3M5YA 4NG3A 1QTWA 3VKDA 4NJHA 3UXIA 3EA3A 1JEZA 4H4IA 3DENA 3EWYA 4UTWC 3CAQA 1VHNA 1OSEA 1GQNA 1K7FA 1V3LA 3BZGA 3RO8A 4CCDA 1P0KA 5FF3A 3H55A 3M4HA 1GOMA 1ZAIA 2BMBA 4CNSA 1BYAA 3INPA 4LCSA 1AZ2A 4L61A 1GQKA 5BOEA 4YWIA 4IQLA 4H8NA 1A3HA 2EJAA 1DIOA 3CK5A 3MCNA 1JUEA 1W1B1 3IIOA 1HGYA 1JCNA 1KFCA 1CGYA 1A3XA 2A6LA 3DC8A 5AYBA 4W89A 1ZFJA 4OGZA 4ZQRA 4K36A 3BAIA 3GTHA 3CIXA 3IJLA 2R1LA 1QXLA 4B92A 3TYCA 1E0UA 4J35A 4UQDA 3AIRA 2G3FA 3FKRA 1RBLA 4KCWA 1IR2A 1J18A 1NTHA 3PUEA 3IUIA 5HANA 5JU6A 3KOWA 3BLOA 5M03A 2NXIA 1HKVA 1G4SA 3ZJKA 2HBXA 4YTTA 2V5JA 1P0NA 4Z2JA 4CQ8A 3N19B 5GNZA 1WXZA 2QVHA 5IFTA 5LNVA 4XKYA 3GNOA 3NQGA 1ZQ5A 3VNZA 5FF2A 2QUVA 2V3EA 4JIQA 1OGSA 2GPTA 4BQ4A 3CT2A 1Z9AA 1A5AA 2PTDA 4FF7A 2J8FA 2EPHA 4B9YA 4JX6A 2JBMA 1CT5A 3L2LA 1M7PA 5DO8A 2CWNA 1EJ7L 1VCGA 2QCGA 4O0KA 1W1VA 3M44A 4M82A 4XZLX 4FS9A 4IIGA 5A8NA 3EX6A 2JIWA 3LPFA 2ZUUA 2CFFA 4DJDD 4JTRA 4DX3A 3ZXWA 3RK8A 2PDHA 5MKGA 4XO6A 4M80A 2REQB 1SSGA 1FTXA 3WUFA 4U10A 3WMCA 4MY1A 1XS2A 1FWDC 3M46A 1E4IA 3WFZA 6PTDA 1VZWA 2ALDA 4M24A 4F40A 1KCXA 2J7EA 3B04A 2AKZA 3P2VA 3O6AA 3TYBA 3EOUA 1Y5VA 3PJTA 4FAMA 2Q6ZA 2NVDA 1FOBA 1I9CB 1VJSA 2G97A 5BRQA 3VIKA 3AICA 1V02A 2ZDSA 5C7HA 4QJ3B 2DJLA 3GVGA 8XIMA 4UTLA 3DGBA 3P93A 4IFKB 4HK6A 2AMGA 1ZB5A 3NSMA 1MFUA 4AWSA 3DAQA 1F73A 3F2BA 4QE5A 3CZJA 3GDMA 1XLKA 2G4FA 2XIBA 3WF2A 3MT1A 4ATWA 4GJJA 4DO4A 1XF0A 4JHZA 1K3UA 3LI0A 1VPXA 7REQA 3VNYA 2XH0A 3RLUA 4JFSA 4LUIA 1PX3A 1M04A 3LUTA 1HFBA 4U31A 3I4KA 2OEKA 4OU1A 3FGCA 3PULA 3QTGA 3U2CA 4IGNA 1GOXA 4R27A 4ZENA 4TO8A 1XYCA 1RK6A 1S46A 3EMCA 3UXKA 3L4VA 2G41A 4ZO9A 1G5AA 2IKGA 2PDQA 4LYKA 4C6OA 1VBUA 1TUFA 3CUHA 3FSTA 3ITOA 1EP3A 3E0LA 2Y7EA 5T9CE 4Y6GA 3VDGA 1IZKA 3LGGA 2TODA 1H1NA 4YU1A 4C90A 1JQVA 3II1A 3R0UA 1J5SA 4I9TA 2X1RA 1W3LA 4Q8NA 1LLOA 3W1TA 3UG5A 1NFPA 4WY0A 5KETA 3AMCA 4HSHA 4CQCA 4QS5A 1TJ0A 2B31A 3T0BA 1HKJA 1ONEA 2Y61A 1M7XA 1TE6A 2LLEA 1Q8AA 2QJNA 4LV9A 1HL9A 5IDZA 2E3ZA 4A3YA 4IP7A 1AMKA 1FP8A 2QUNA 3QY7A 4IXXA 4Z1DA 4XO7A 2WCGA 1WOBA 4N0RA 4WDWA 4OIFA 2VEKA 8TIMA 3QFEA 4YCPA 5KEZA 3E3HA 4DPPA 3AIBA 4BI6A 3A12A 1EIXA 4FEZA 2NUWA 5FSEC 3UBPC 3LHVA 3PTQA 2Q01A 2R94A 2PD9A 2YW4A 3SFKA 1VFSA 5BYWA 4IMCA 2EPNA 3VOJA 1L2UA 4DBDA 3W28A 3SURA 1GHSA 5CC6A 1VC4A 4A21A 3TU9A 3TXVA 3TJXA 4OKDA 4FLOA 4PB4A 3PBMA 2NQ5A 4AEEA 4HK5A 4GD0A 3EWZA 3GU9A 4ZQOA 4F0MA 3P5YA 5HMSA 1SJCA 2IQTA 2X1TA 4YMZA 3W23A 4EAMA 1BWLA 4XBSA 4O1DA 4L6HA 3H12A 2YSWA 3ABZA 1C3FA 2J7HA 4RV8A 3AYSA 4DJEC 4NJIA 2PC4A 1JPHA 3Q45A 4C6NA 1V8EA 2WANA 4GIYA 4NYYA 3C56A 4Q4PA 3FA3A 4AC7C 1RLDA 3GNRA 1ZSXA 1NP0A 4Q4MA 3KEHA 4E3VA 3GXFA 1P48A 3H7RA 4NL1A 4W8AA 4GIRA 3OBAA 3XINA 4ZSUA 2X1SA 3LBMA 2OGYA 2YA1A 1XG3A 1FWCC 1W9PA 2WQDA 3UWEA 4AX7A 1WUFA 3W1AA 3CZEA 4BQ2A 1O5QA 3USZA 2VMFA 2E77A 4DUOA 2OLSA 3FIGA 1U1JA 1U1HA 3UJFA 1TMLA 1AQHA 3VCCA 1R9XA 2CLKA 3MP3A 1FWAC 2Z27A 4K38A 3V5CA 1JNDA 4MYAA 3WH6A 3E2VA 3WNLA 1E3XA 3G0XA 4M6QA 3AHXA 4GOAA 4ACYA 4ZOBA 2BB0A 4E2OA 2QDGA 3B4UA 2ISFA 3C2YA 3WK3A 3AIQA 4HZ8A 1SW3A 2DFAA 3OZMA 2HNHA 4C6LA 3ZT5A 4I7UA 4O8AA 3GDBA 4MLJA 3BOFA 4FX6M 4ZE4A 4HT3A 1AD1A 4BK9A 1EJUC 2X09A 3BSMA 1A4LA 1XCXA 4FIQA 3TTYA 2QIWA 2Q3OA 4LGXA 1SJBA 4O0ZA 1E3ZA 5DF0A 3HF3A 1XP3A 1Q66A 4C6FA 1E4NA 1LYXA 1E1CA 3HGSA 2QDHA 4H2CA 4XZBA 1P0DA 3WYZA 2ZFAA 4QSFA 1GKPA 3BOLA 3NGJA 1MW3A 1XQKA 4C91A 3VM7A 5HMDA 3U7BA 1OFEA 3W7PA 1ZTVA 5CBJA 4MZYA 3N73A 3EEZA 2BY3A 1ISWA 1TREA 2BOEX 1TPH1 2I1OA 3N6JA 5KMYA 3UQNA 3ITGA 4ICCX 4I5RA 1KFKA 3AOFA 3VAVA 1DQXA 5JIPA 4MGGA 1TPVA 2QZRA 4L5ZA 2WC3A 1E9YB 2PDCA 5HNNA 3S2MA 4OBSA 1NVMA 4KKXA 5HUOA 3KLLA 4B5NA 1HJXA 4GA8A 1BVZA 2O7SA 3C52A 1QATA 4XVDA 1XLBA 1N8FA 1I1WA 3CQHA 1L8PA 3EDKA 1YE6A 4QP0A 3LRLA 3F5LA 4JQ1A 2QDEA 5T26A 1S5NA 2P3EA 8RUCA 4PULA 3HG4A 4JD4A 4R7JA 5A3HA 5KZEA 3OZYA 5L9FA 1BAGA 3LHYA 1J0JA 4J3TA 2X05A 2OVLA 1QASA 3CHVA 1PWLA 1AUSL 4PFMA 4R7OA 3L4UA 4RW3A 4N9DA 4UTHA 5D38A 5XINA 3L7RA 4XUGA 4JIIX 3AS3A 3ALGA 3AZTA 2D20A 1OGBA 2NQJA 3MJYA 1KLYA 4B91A 1GZGA 4KESA 3R12A 2VENA 5TF0A 4RPQA 5HAOA 4GIEA 1V0KA 3NO5A 3AAMA 1KTNA 3GB6A 4MJMA 3CAVA 4HIBA 2J78A 2NZLA 2FVMA 3W7EA 3NZRA 3UA3A 4XQ6A 4DYKA 4DYJA 2ISSA 3LI1A 5LXXA 3PPGA 2C19A 3UWWA 5JXQA 3QKZA 3NGFA 1JIBA 3VOGA 3UP8A 3H26A 1JPIA 1B3YA 1OD0A 1YBQB 4HP5A 4TXEA 1Q6CA 3WH9A 4RL3A 3MV11 2PDIA 2J25A 3SRKA 3UW6A 2QDDA 1JCMP 1AK5A 3CPGA 4PUDA 4I3GA 4B4FA 3W4RA 1MRAA 1ZJIA 1TX0A 3AFBA 3M5XA 2J8TA 4UTWA 2YL5A 2F38A 3U9IA 1JVNA 1YQ2A 3IIVA 1EQCA 4DI9A 3OGRA 3L65A 2ZUTA 3WEOA 1YIXA 5G5IA 1V7YA 3LYEA 4L6OA 1U5HA 3D6NA 4V2XA 4MWAD 1XLLA 3ONCA 5E6ZA 2VJXA 4KWWA 2WNZA 2IPWA 1XIBA 1GVEA 4WGXA 1V4YA 4KIRA 4UCFA 1PJ9A 4AD5A 2W27A 4HOZA 1TV2A 3LGEA 1QW7A 1JFXA 1B90A 3URNA 3FJ6A 5FJRA 3EYPA 1CLVA 2NQ9A 1ZAJA 4LC6A 4WX2A 3ZVHA 3P74A 3U5YA 4D9PA 4MKVA 1JPDX 2O0TA 3T09A 2DSUA 3QOKA 2Z1WA 4BF5A 4PMRA 4CUCA 4CN1A 3GS6A 5AZ0A 1BGAA 2W5FA 2J24A 2GVLA 1PYMA 1Q85A 1RY0A 4Q6JA 3QYSA 4XSMA 2WMJA 2QIIA 4P8WA 3W1MA 3F5KA 1QJWA 2MANA 3GAKA 3F03K 1B2YA 4QEEA 3CHEA 1HJQA 3PY2A 4PYSA 1ALDA 1KRBC 1FXQA 5AKQA 3VDCA 2Y89A 2D2GA 2XIMA 4IIEA 1EJWC 1K1DA 2BODX 3H4GA 2ZRUA 2RDWA 3OIXA 3MMWA 2X0HA 1W6TA 3LN3A 4RDVA 1LTDA 4U4MA 4EOUA 2V82A 4Y9NA 1AODA 4IXHA 1YHTA 3VOIA 1JYVA 1UR9A 2R1KA 2VP8A 5IFPA 1UH2A 2JK2A 1A4MA 1W32A 4JL1A 4JQ2A 4QNEA 2VZVA 6XIMA 5BU9A 2BY1A 4DWSA 4X0NA 5HULA 3H8AA 4KETA 1H7WA 2ZA1A 5CG7A 3WLRA 4HNVA 4E8GA 1QNSA 4CU8A 1SZNA 4R85A 4JX5A 2OU4A 3VDAA 2H8XA 2EPMX 9CGTA 1MSSA 3G1RA 3NM3A 1RJQA 5AYZA 1EBGA 2C16A 4V1YA 1FBAA 3SQMA 1TJ1A 1MZRA 3ES7A 2CLLA 1B3VA 2IPFA 4KGLA 1LL4A 5HQLA 4CN4A 3ARYA 1UD3A 4WQ6A 2PMQA 5HOSA 2JEQA 2YCJA 3GNXA 3B0UX 3TYDA 3DZ1A 3Q2DA 4JTIA 4BS0A 1PKMA 5CXPA 1Q8JA 5FIPA 5LIWX 1YNYA 3RPTA 1O68A 1OK4A 3KZSA 2V0TA 3EWXA 4X9YA 1JYXA 1TG7A 5CPNA 1ZY9A 4Q8MA 4HCHA 3MCMA 2OZ3A 1EXBA 4JTKA 5C0QA 5AY7A 2DEPA 1VFMA 1XLGA 3V16A 2FJUB 1MUCA 2GSEA 1LWJA 3RR1A 2QJMA 4ZL1A 2CLOA 1CIUA 1R9ZA 2WWCA 1UC4A 1DJWA 4Q4SA 4X61A 4Y90A 4ZO8A 3UJSA 5JQ9A 2GLKA 1SR9A 1FHVA 4HOXA 3L5LA 4JKKA 4Q4RA 4AD1A 4NXSA 1Z3NA 2TYSA 5I3HA 2C3ZA 3UR2A 1EHAA 2XU2A 2W0UA 2DH2A 1GQJA 3UY8A 4QHRA 5K9XA 3EKZA 4EK7A 3PR2A 4H9MA 3VK5A 1JCJA 2GGIA 1O1ZA 3WG6A 4GXMA 1MEIA 1JAKA 2PWEA 1QWGA 3ITTA 2PRMA 1B57A 3C2OA 1U33A 2ZQ0A 1WDRA 4MNLA 2YJQA 1VB9A 1D8WA 2H6RA 6A3HA 1OT1A 4QE4A 3TAKA 3WNOA 3FXGA 3WJYA 3GG0A 2DIEA 2IKHA 1EXPA 3AYRA 3QMRA 2YIHA 2F6XA 1FWIC 3T0DA 3GXPA 1AZ1A 1Q5MA 3MUY1 2VR4A 1QBBA 2WVVB 3BAWA 1WO2A 3TX9A 1LOQA 1K8YA 2DVXA 3UVIA 4JHMA 4LXFA 1VP5A 4HNCA 3AWOA 3IGHX 2UZ9A 2A0NA 4UTTC 4H6RA 2OYMA 5HPCA 3DG3A 4JCMA 3UPBA 3RUBL 4C6QA 3BLPX 4JYEA 1YX1A 3THQA 4JAWA 5REQA 5C9XA 1TPWA 3CEPA 3IEBA 4QLKA 4AHPA 2DSZA 3CHDA 3H2CA 2J7CA 2QNEA 2XG9A 4XZIA 2CKRA 4KIEA 1X98A 3UETA 4J5NA 4HPNA 4DY1A 1OG0A 4NUWA 3NA8A 1HVQA 1F7BA 2CLFA 4FNPA 2VL4A 2ZRZA 3C2VA 7XIMA 1E71M 1ZBVA 1LCOA 3AJXA 1OFOA 2OB3A 1KQZA 2E9LA 3ORWA 1B3ZA 1X7FA 4JHOA 3PBGA 2VEGA 1JFHA 1VFOA 1L8NA 3ALFA 4ZCWA 3DEQA 2ZRXA 3M43A 2Y88A 1EDGA 4M6UA 2WYSA 4JNMA 4HHMA 4JTLA 2XIJA 2GQ3A 3UD6A 2XUCA 4Q7BA 5F1UA 4DZHA 3KZPA 4E8DA 1REQB 4PBGA 2B7PA 4PSPA 4ZB5A 4IMEA 3O3RA 1Z8AA 2GOUA 4AZBA 1P7TB 3UF9A 3LTSA 3MYPA 2RKXA 1DE5A 1OINA 3P0XA 4Q22A 5FJJA 3P7YA 2EEXA 4D1JA 1P6WA 5IRPA 1JPKA 1TE1A 3UNTA 2NSXA 2QCDB 3W76A 5FESA 3E0FA 2Y63A 4G7EB 3VMNA 3T7VA 3WLLA 3W6MA 5FEWA 1HUVA 1PKYA 2YCEA 4AISA 1GG0A 4REQA 4ADUA 1UWRA 2DIKA 1ISZA 3CGTA 3ARXA 3ZS4A 3GXMA 4M6PA 1VH7A 3KW3A 1ZL1A 2XVLA 3BARA 4R3UA 1VGAA 3IJIA 1Z69A 3WNMA 3PWGA 4ROPA 1XM3A 3KBJA 4M29A 3P8IA 1CXIA 3PM6A 1LQ0A 3W2LA 1WPCA 1UWTA 2DUZA 4KEMA 2ZICA 8A3HA 3EGJA 3FY1A 2TRSA 4K7VA 3N15A 1MQPA 1V3IA 3BCDA 1S2UA 4R53A 1GTHA 4L4OA 4H6EA 2WSKA 2VX7A 3PJWA 4IX2A 5AYXA 1F05A 2W62A 3WJWA 5CBBA 1SQ7A 3POHA 1E5NA 4RZ4A 3A47A 5KZDA 5I5RA 2E0PA 3SCOA 4B15A 2V63A 3VABA 2OO6A 3I10A 2J7DA 3KOFA 3N4EA 3SCRA 1SO6A 4HK7A 2Z1KA 3PBYA 3K30A 3LCXA 5E0CA 4B90A 3UWYA 4G8TA 3G6MA 4Z0JA 2GDVA 3W86A 3G22A 4L1XA 4UFKA 3PP7A 1XLJA 2I5GA 2A7NA 5FJTA 2G0WA 3UGVA 1V3HA 1XRTA 2Y8UA 4RLIA 3H2MA 5TQLA 4MYXA 4PL1A 5D32A 1R3YA 3GDTA 3RMEA 2GJLA 3VOCA 5M17A 5ENLA 1DTUA 3AO0A 3GZ3A 1NDZA 1XYBA 4X60A 2HTMA 1XR2A 3PANA 3WELA 1KTBA 3KL0A 3MP4A 2YXOA 3CZ8A 3QLLA 3R4IA 4LT9A 3FJ4A 3CM4A 4BCEA 3VGGA 1BEUA 3N17A 2FZNA 2XSXA 5A2AA 2QHAA 1VRDA 3ARQA 2PWUA 3GH5A 4RKAA 3TXZA 2Z6IA 4MADA 5C71A 3KLKA 5D02A 3LXAA 3B0VC 2BGSA 3SCPA 3R0KA 2VT0A 3MMTA 3HPZA 3GZAA 2G96A 3N13A 1C91A 1XINA 2CZFA 3KHDA 4PMQA 4PTDA 1EIBA 2QT3A 2PAJA 3SJNA 1BQCA 3G24A 3UZJA 3S2LA 3HPFA 3AUJA 4BWLC 1UPPA 4MG4A 4NZJA 5FL0A 5ABHA 4ZA0A 4C5YA 3OZPA 2V8ZA 5MHBA 3IVUA 1YEYA 2ZDRA 5HQMA 1GVIA 4IG2B 2NQHA 4QISA 1CXHA 4LS1A 1L6YA 2GSJA 3NNTA 4A3HA 5A95A 1DJHA 1QDSA 3QV8A 1RZMA 4ONVA 3QSRA 4PC8A 5HBFA 5DX7A 3THUA 3G18A 1HKMA 3WEMA 1NWUA 1DWGM 3JVAA 3HB9A 1GK8A 4E4FA 4NAEA 1FWGC 3OTRA 4GUFA 3TW7A 1KFLA 3NDYA 1IGWA 3C61A 4CD8A 2BOFX 3ZR5A 1LBFA 1ICSA 4BY3A 5J5DA 4MAVA 3M1ZA 5C9RA 4NJJA 4RE0A 1Y5XA 1IIGA 4FLSA 4QLJA 1EJTC 1Q63A 1G4TA 4OV9A 3CIVA 4W8BA 3VD9A 1Q7ZA 4AYGA 4M51A 1RCQA 1FFRA 1UP3A 3A9BA 4TX9A 2CLPA 3PWAA 1J6OA 4D6EA 2FDSA 3MA8A 5E9XA 3QW4B 1K9DA 2ZUMA 1W2VA 5K3VA 2R9RA 3NR0A 2CHNA 4LYPA 5G1MA 4HPXA 4UUIA 4Z0SA 4C7GA 2H8ZA 3TSMA 4ML4A 4PCNA 5B7YA 3B4YA 2CLIA 3ONBA 3WDQA 2WWDA 4W7WA 4ZBCA 2CBVA 3WQFA 3WBXA 2YL9A 2D69A 4LB3A 3UNDA 3W3OA 3GVRA 3BSGA 1XXXA 1FY6A 1I6NA 3E38A 1KR0A 2PRHA 4J9JA 3AYTA 1NOFA 4NJGA 1XSIA 3W7RA 3GVWA 3IJ9A 3SRDA 2C71A 4Q8PA 3GK0A 4GK8A 4I8DA 5CEWA 3V36A 4HYVA 3DHUA 5BNKA 2PS2A 2DUAA 3PFRA 3UYIA 2GJXA 5LSMA 2OX1A 3TLLA 4E4PA 1JYNA 1OGGA 1WUEA 5DCBA 4LYQA 1XISA 2QUUA 5EMYA 1AH3A 1CGUA 2V5KA 4GYKA 5K9DA 4M81A 3WQWA 9RUBA 3V0SA 3OLGA 2AL2B 1AL7A 1XLHA 4MTVA 1YPIA 4LVDA 1DIEA 1KLZA 1ZLPA 1T5AA 4GYPC 1SMDA 2OKOA 2C79A 3ES8A 1MRQA 1CYGA 2V68A 4MY9A 3GDRA 2GOKA 1FWHC 4WD0A 4G7FA 3UCQA 3LZ3A 1GUVA 5FEZA 1KKRA 1DEDA 3LGDA 1KNWA 3TV8A 3WCZA 3T2QA 2PLJA 4ADTA 3TYAA 2DIJA 3THDA 4R33A 1OFAA 3W38A 2J4GA 1G69A 4O1CA 2OQHA 3RGTA 1UZ1A 4KWSA 1J6PA 4OE7A 3ZZ1A 1EB3A 4YHEA 1XLEA 1JCYA 1NDWA 4I7VA 5J5RA 3BG9A 5A2CA 2FGBA 3KAOA 4PSRA 2RDTA 4TTGA 3CUIA 4Q3MA 3T44A 1S5TA 3W2UA 4H83A 4HMNA 4HSOA 5DMLA 4F0RA 5LGZA 2FH6A 2Y4SA 3WLQA 1RQEA 4L6DA 4FNTA 4Z1CA 3S9IA 4C1NB 3GW3A 4EWJA 4PE8A 3DBPA 5HQEA 3NSNA 2QKFA 4NI3A 3SB0A 3GLCA 4J3WA 3VOFA 4N9CA 3HO8A 1A5NC 1OFDA 1E6XM 4IMFA 2XFWA 1JAEA 3C0SA 4AY8A 3B9AA 3E74A 2DZPA 2O92A 2ZX6A 5M1TA 3JW7A 2C13A 2QCLA 3U4AA 3S5ZA 1V93A 2Y1HA 4W84A 5CH9A 3WMSA 4UB9A 4WXYA 3GXIA 2BXYA 3A5VA 1X96A 1KRMA 1ZJBA 4XAPA 3DHFA 3N9SA 3P0WA 4WIWA 1AMYA 3IIPA 3W7IA 1SZRA 2V5DA 1OY0A 4XAFA 3URBA 4IMDA 1FWRA 3FJLA 3CO8A 4IPLA 2VR5A 3C2RA 3WFLA 3L9CA 4U3CA 1BGGA 3HG3A 4I90A 1HTIA 2W9MA 4AZ6A 2GFTA 2YYTA 1XUZA 5CPOA 4QE1A 1OF8A 4YVVA 3LDVA 5HWMA 1KGXA 2G5WA 4JR5A 2PUZA 3GVQA 3QV9A 4UC5A 1XICA 3MV01 4Q33A 3MVIA 1JJKA 2XH2A 2CBUA 5AVHA 4O28A 1HJUA 4LRSA 1JUKA 2A3HA 3OLEA 1NIUA 3W82A 2PDGA 1E9LA 5IDIA 3VIJA 3PB2A 1UD6A 3LCHA 2ZZ4A 2NV2A 3A24A 3KVJA 4XISA 4KWUA 1YNQA 3QPZA 4GKTA 3PZNA 1VF8A 4JYFA 5B80A 2PP3A 1XD1A 5G1YA 1EJXC 3B3DA 3VCNA 4YN5A 1WDPA 3G1FA 2GK1A 2WJFA 1CX9A 1OWQA 3LCWA 2P0IA 4XWUA 3AMDA 3Q94A 1V08A 3T9PA 5D33A 2SFPA 2BHYA 2Z4GA 2VQUA 3KRSA 3FCPA 2YGYA 2X0YA 4EXAA 4W5ZA 2GWNA 4OECA 3QQ0A 3KX6A 4WHBA 3GIPA 3RM8A 2AKMA 2ZYFA 2DT3A 3FHAA 3OQ8A 4I6KA 1JUBA 3V75A 4KW2A 4P5UA 1O94A 1VEOA 4R88A 1ADSA 1E0TA 3MW7A 4O50A 1ZZMA 3AXMA 3H21A 1VIZA 2E9BA 4UTTA 1DHKA 2INFA 1X39A 1V3KA 4NP7A 4QG9A 4ACZA 4IICA 4BFAA 4RNIA 4HPGA 3KWXA 4AVOA 2O4QA 1MXDA 4MJ4A 1F3EA 4YXGA 3CMFA 1JG9A 1D3HA 3QMTA 3T40A 4OZOA 4E4UA 4K68A 1YTDA 1QK0A 5KITA 3W7QA 3TOYA 5I0DA 1XYMA 2XYLA 4N7QA 3OYZA 3CPUA 3ERPA 1QW8A 3KP0A 1Q3NA 4JKMA 3RN6A 4EKJA 3WO8A 5U7SA 4W5UA 3ABSA 3BL3A 3K4DA 3IUHA 4JEJA 5I7GA 2D0FA 3GC2A 3BV7A 4IZGA 4N2YA 4LUJA 3QLDA 3E49A 2VUNA 4S3JA 4QRNA 4AD4A 5AHNA 1OD8A 1CLKA 1KBKA 3S5YA 5EFFA 2VO5A 2INZA 1F8IA 3B9NA 1RBAA 3W27A 3NQMA 3S8HA 3VMPA 2V2HA 2E8ZA 4MMWA 3C6CA 1VFFA 5EB8A 5ABEA 5HMFA 2QXWA 1W3TA 2GGGA 1W3NA 3L5AA 2F6UA 4GX9A 2HPIA 4N42A 3WDPP 3ISIX 5G1TA 3UPMA 3C3UA 2CIPA 4WXZA 5D05A 3S9ZA 4K2SA 4JEQA 3WQCA 5CC3A 1OX5A 3COTA 3P84A 3T4WA 4C6IA 5HWNA 4GPNA 3CZGA 1P6CA 4YL2A 3S47A 2WLYA 2A5HA 3BTNA 2FB3A 1F4AA 3CS2A 4WKAA 1Q6LA 1YE4A 1NF7A 1WDQA 4LV4A 3KHJA 3WNNA 4O14A 4PRWA 2WHMA 4D6DA 4KGJA 1PSCA 4IMGA 3L4WA 3N2MA 2FZMA 2GQ9A 1A5SA 9XIAA 3ZWTA 3I7SA 1O6IA 3HQOA 3M5ZA 3CAKA 3VDHA 1BKHA 3EPMA 1DXIA 5DMYA 3V1PA 4G9PA 5F7UA 2WZEA 5A2BA 1J9YA 3O0KA 3V18A 1IYXA 3ITCA 3OVGA 1GZ1A 1TQJA 1I2NA 3S1XA 3EXTA 1T40A 4AF0B 2ZUNA 1I60A 4LAMA 3W7DA 1R38A 3TTEA 3ZWSA 1B31A 2PDYA 4HJWA 1R3SA 4D8AA 3DFQA 2W92A 4CVWA 1QVBA 3GR8A 2VEPA 3RM4A 4GUHA 1UKTA 3EMQA 2CZVA 3EWUA 4J3SA 4GHRA 3WLTA 4EF8A 3GM8A 3GAYA 1X6UA 4RZ5A 5CJ5A 4Z1BA 3W1RA 1T96A 4WLCA 2Y5JA 2PTYA 4AY7A 1VRXA 3SCTA 4LW7A 2HVMA 5AHFA 4WY0F 3T05A 2CERA 3WF0A 2B7QA 3S6TA 1WZLA 1G4PA 3SY1A 4D8LA 4ROQA 4DYEA 4AZIA 2OKTA 1MZHA 3DX5A 4NF7A 3STFA 5FACA 3W02A 4EIVA 1FDJA 1J0KA 2G3IA 3F4CA 1GVYA 3MC5A 3TZNA 3WUGA 1WCGA 3VTRA 3APGA 4J2MA 2QJGA 4R7WA 4B4HA 5FA5A 1I45A 3K8KA 4LVGA 4IM4A 3H4XA 3WL1A 1V03A 2OYLA 4HPJA 4HN8A 1VLWA 1TWDA 3L0NA 3UZYA 2Y7GA 1G94A 4RE4A 4AMCA 2VZUA 4Z2IA 3W7OA 2OZTA 4F48A 3ARZA 3P8JA 1B4KA 1DXEA 4QITA 1KXQA 5BRPA 3VMOA 4BWLA 4NNBA 3CUFA 1NY1A 4IQDA 4JGDA 4YNGA 1EEPA 3B9DA 5D4YA 1HGWA 2ZZ6A 3OA3A 1J4EA 4NU7A 2P88A 3KRBA 4GX8A 4QBXA 3IGXA 3MU7A 5C2GA 3EB4A 5LA1A 1ADDA 3PTMA 4IIHA 5I24A 1XRFA 3TN5A 3BAJA 1ML1A 1TZ9A 4KH2A 3IRDA 2FB2A 1MW2A 3L68A 1JGMA 3LHUA 1XDLA 4C65A 1CXKA 2IPJA 4FNUA 3G8EA 5EMKA 1UASA 1D3GA 1OK6A 1R5YA 4MIMA 3M7WA 4DEFA 3VNJA 2DPEA 2QPSA 3FOKA 1W1A1 2JALA 2YOCA 3MUIA 3TDFA 4E2DA 3MMDA 1F3WA 1ZU8A 3MP5A 1PIFA 1J8VA 4LAOA 2Y0FA 2F6KA 4K1GA 2PU0A 1XRSA 2XFRA 2P0OA 3IK2A 3VX1A 2PE4A 4JTEA 2R6OA 3W2JA 4A8IA 3GQYA 4FPSA 2UV8G 4MKSA 1BVWA 3E2QA 5AC6A 1UMYA 1XUUA 4L4LA 3V7PA 2EQDA 4JIHA 4GBDA 3ZJ6A 1J10A 1KXTA 1TA3A 2ZA2A 1C8XA 2WO5A 2HK0A 4N6EA 3VC5A 2IUZA 5AYIA 4J3UA 2IKJA 1ADOA 4GIAA 2OOFA 4AXNA 1Z41A 2X1UA 3HPXA 4IMAA 1BXCA 4X2RA 1PZ2A 3KL5A 1EYWA 3DFSA 1E6SM 4DBWA 2PZ0A 1FCQA 6TIMA 3M0KA 4UMCA 2C8NA 7A3HA 2Y2WA 3MDWA 3G0SA 3KTSA 5AECA 3P60A 2W67A 3ITYA 1UR0A 2EKCA 3W1UA 3P6LA 4JTSA 4AHOA 4DN1A 3KBWA 4GVFA 1R8LA 1XIGA 3SIMA 3L12A 4Q7NA 4JQAA 3GX9A 1JF5A 1G9HA 1MNZA 1E72M 1HKWA 4DBEA 2VI0A 3BLKA 1GT8A 2WZIA 4LVAA 2H3DA 4H8UA 1E6QM 1IIHA 4EVZA 4GYPA 4CD5A 5A6TC 5AZ1A 5TD4A 2QMJA 4CCZA 4L9YA 3U3HA 3WDIA 2WMIB 3S5SA 3S9YA 1RLCL 3VIPA 1DJNA 2VFFA 4KT2A 5D2TA 3DERA 3GKFA 3G1XA 3GC5A 5HMEA 2DJXA 5ECVA 3OBKA 4MFEA 3E6EA 2DZBA 3QXBA 1DWFM 4KFOA 1Y65A 1WXJA 1LWHA 1QU4A 2EHHA 4J28A 1PDZA 4RPPA 3N04A 5K4XA 1KGWA 2NV1A 3OHIA 3CLMA 2CYGA 4ZXOA 5K4ZA 2HVOA 4K37A 4S2CA 1VPYA 2BLEA 3KTCA 1Q4NX 3AHYA 4IFRA 1ME8A 3B8WA 4P7NA 1LORA 1NJJA 3CMGA 3O15A 3UXLA 1X6LA 4QX4A 4LUSA 4DI8A 4FX8A 3HFYA 4DQWA 1M53A 4JIEA 2V6AA 1SFJA 3CHFA 3WQOA 1RV8A 1LLWA 1EOKA 3OG3A 2XSAA 5C7VA 2O9PA 1F61A 1NH6A 2PLCA 1H2JA 1OABA 2F8QA 2VRJA 3LS9A 4DJED 1TIMA 1WZAA 1P0BA 2PA6A 2WSQA 2HSAA 3A9IA 1LBLA 2PTXA 1ITCA 3C3NA 3EOEA 3NDZA 4JTTA 3O8AA 3HJEA 3QYQA 2H90A 5I3DA 3W1QA 1BYDA 1TKKA 4S3BA 5E93A 2PGRA 1CXLA 2XGIA 1IEVA 2GUUA 3WN6A 2YYUA 1NOWA 3C5QA 1RALA 3H6OA 4GI4A 1V6YA 5I6SA 4LBUA 5C8BB 1JZ2A 1HG3A 1QI4A 4QSHA 3REQA 4BA0A 1H4PA 2AGTA 4J40A 3KBMA 1QI3A 4BEQA 5FD0A 1IF2A 3I68A 3SUSA 2RFGA 1L6FA 3W73A 2KZHA 1BRLB 5FF4A 3PG8A 3WF4A 1W1TA 2HJPA 2H9AA 3QPEA 1JULA 4IJRA 4NAFA 5CQ1A 5TBOA 3AWNA 3LPOA 3CL7A 3WBWA 1C29A 4HA4A 3A3HA 5HR6A 3W7HA 2R82A 5DFAA 4HBKA 1B4EA 1J12A 2EBNA 3WNKA 2OQLA 4EPBC 1MXGA 2FVKA 4GQQA 3BJTA 4KQNA 1CI1A 1J2BA 1TELA 3W7JA 4IFOA 1W3JA 3F1QA 1XYZA 3NL2A 4B16A 3QKEA 1TV3A 4E8CA 1W5OA 3IJ7A 2G3JA 1XCFA 4OT7A 3QGKC 1RH9A 5ECUA 1U30A 1IHIA 3GXNA 4AB4A 1NSJA 2JF6A 4NX5A 1GW1A 4AG0A 4KRUA 2X0SA 1YYAA 3W24A 1WKFA 3IAQA 1EP2A 2WBGA 4ERAA 3NG3A 3O06A 1UQYA 3MO7A 4Z2HA 4H9UA 2DZWA 1R7AA 1LUCB 1S39A 1WDDA 4UOZA 4H9XA 2WJZA 5LNRA 5HNTA 5EGRA 4MB3A 2FPYA 3R43A 2F2HA 1T8QA 4WCJA 4CNPA 2VCCA 3T0AA 4FF5A 4UFLA 3KM8A 2ZUWA 2X42A 3T8LA 2DZVA 1O5XA 4A35A 1S2AA 4MDOA 5BROA 2Y70A 3M0YA 1L6WA 2WM0A 4GLEA 1XIDA 4OUEA 3NL3A 5M5DA 4DJFC 1IT7A 1GPFA 4B3ZA 4NVTA 1B3OA 3LCGA 4O13A 5BXSA 4QM1A 3OGVA 3UR8A 3T2OA 3R8HA 3BMXA 3GYEA 1UA7A 1LG2A 4FIRA 4H9ZA 1V0LA 3NXLA 3ZJ7A 3DG7A 3TN3A 1BSLA 1KA9F 4NX0A 3N2XA 5A6KA 2CLHA 3NSXA 1S5MA 4FALA 1G01A 3FS2A 2PWDA 2PURA 4W8LA 4NIRA 5D9PA 5JMUA 1GWJA 3W88A 2J75A 3CUXA 1D2KA 3SY5A 4PTNA 1WBHA 2J79A 3BV4A 2OSWA 1NELA 3ARVA 4C6JA 5J04A 2ASHA 3RYSA 1ZBWA 3W1PA 4BR1A 3VE7A 4GE8A 2O4MA 3APYA 1LOSA 1ICQA 3RCYA 4CKQA 4DO6A 1EJRC 5D03A 4UZSA 4X2PA 3GR7A 1FCUA 4ZTXA 3WQ5A 2EKGA 4KMQA 4PMOA 3WUEA 4IQJA 3LPPA 1H7OA 1T6MA 3C86A 4LUTB 1KM6A 1TJRA 2QAFA 3VNIA 4BHYA 1BXNA 2WB5A 5LGXA 1R0MA 3KTXA 1LQ2A 3GR4A 2PPGA 1W1YA 3QHMA 3UZZA 3VGBA 5HXMA 3K8LA 4LVBA 4ZEPA 1KM3A 5JIWA 3BC9A 1R9YA 3OVRA 5RUBA 3I3DA 3OBEA 1ZPTA 3NZGA 3STPA 1JRCA 3VIHA 3QFWA 3LNPA 4TVCA 3PF3A 4AZCA 3ZR6A 1V7AA 1TR1A 1H63A 4ZO6A 4QG8A 1P5BA 1HKKA 2YCIX 2F7FA 2BGNE 3NEVA 1LT7A 4D6FA 5AVNA 3QHOA 2I14A 1HF6A 3CU2A 3IGSA 3QPYA 1OC6A 1VFUA 2PDMA 4DPQA 5TNVA 2CESA 3NO1A 2X40A 4HVXA 1OBAA 3AXIA 4UFJA 2Q71A 1PTAA 1S1PA 3AHVA 2O56A 4WR3A 1SGJA 4BEUA 2WVTA 1U2YA 3PB0A 5C2XA 1TZZA 4OBRA 2QCCA 3DI1A 5H6HA 4GQ0A 4H7ZA 2PDKA 2DV0A 3PFMA 2NV9A 3ARUA 3L4TA 4O10A 1HP5A 2QCMA 3ARTA 1W9VA 2YBTA 2BBFA 4O19A 2HE5A 4ZOCA 3KOXA 1QOQA 1F07A 2F84A 4RNFA 3R7MA 3B8TA 1RP9A 2GSHA 2V69A 2I17A 4S3KA 2PWGA 1JDCA 4PUEA 2VFEA 4QG6A 4MPQA 4W86A 5G2IA 2NXHA 1J2WA 4BZYA 4S3GA 4IF2A 5CZTA 1JCLA 1UPMB 1G4EA 1H51A 1H3GA 2VC9A 4LCRA 1TTIA 3W1XA 4Q32A 4N6FA 1QHPA 1EO7A 1SO4A 5JH2A 3IJ6A 3WLPA 2VGIA 2A3BA 1MQRA 4PMNA 2IS7A 5BXPA 3FNDA 1BTCA 5GJNA 3LV5A 3SN4A 3KWSA 3MI2A 2OR2A 5CGMA 4JTHA 1JDEA 3SCSA 2CETA 5A6BA 4WGHA 5CZKA 3A23A 4U28A 3ZT6A 5ABTA 4NHVA 2YDSA 1EFZA 1OX4B 4LF2A 2YLLA 1UB3A 4UNKA 2ZWYA 5ABGA 3T0CA 4KCVA 2EXOA 4I8YA 4AIEA 3KOYA 1JZ7A 3IVTA 3NVDA 2FKPA 3TCSA 1HKIA 1SMAA 2I16A 3G8RA 3W01A 3SUVA 3LY0A 2VFIA 4Q8OA 4ZOAA 4WUIA 1RPKA 3PSVA 3AS0A 3VNDA 3SRFA 2BX7A 2YW3A 3VU2A 1Q65A 1R3RA 4Y7EA 5BRBA 4PFHA 2UWFA 4A6GA 3EPNA 1KRAC 4C7DA 1VBHA 3P5ZA 1XPGA 4UOJA 2OGJA 4EPDC 5CJMA 5AYYA 1Z44A 1UR8A 4KS0A 1QHZA 3CTTA 2RH9A 1W0MA 1BSIA 4F79A 3NWRA 3SO7A 4B5TA 2X2GA 4XTDA 3QEZA 4J27A 2PWVA 1A5OC 2FVLA 5A5WA 5IHSA 1UR2A 2X16A 1IZCA 1D7FA 1UP2A 4G56A 3PBWA 1Q6RA 3GH7A 1XI3A 3JS3A 3IJQA 3VUPA 3E5PA 5D8WA 3WD2A 5JVLA 2QPXA 3RPDA 2J6VA 1DXFA 3A4WA 3TW6A 3H2NA 4XD5A 4U3AA 2OZ0A 3U6WA 3OP2A 1KBIA 4YWSA 3UY7A 2VD8A 4DXKA 4OJYA 3TYUA 3UCCA 3R13A 1CGTA 1V3MA 5I3IA 3K2GA 3UPWA 3THCA 5E6YA 3UG8A 3QZEA 1UKPA 4ICNA 4DZ5A 3T0TA 2WSYA 2V3FA 4ZGYA 3HGRA 4IH3A 2DW6A 2QV5A 4GI8A 2OWCA 3Q4DA 1Q6OA 5XIMA 3BURA 3XISA 4UR8A 3GHSA 2Z1BA 3HQNA 4FOJA 3LBOA 4GYJA 4GJ1A 4S3CA 4UIOA 4RDZA 1QPKA 2E1WA 2VDHA 1XWYA 3E0VA 3SI9A 5BMWA 4ICMA 3SEPA 1H7RA 2PFHA 5DELA 4WSKA 1RAKA 4FXJA 3B0PA 2D0HA 4ZQMA 5AC7A 1VYRA 4YVXA 4LS0A 4O15A 4ZB2A 4LAUA 2CZ5A 3TA6A 4IGHA 4AIBA 1QO2A 5AOUA 1E6PA 3IIXA 3G1VA 4Q6XA 3RX2A 1EDQA 3S3GA 3HZ3A 4DXXA 2Y8KA 2REQA 2GJPA 1Z89A 3VIMA 1KFJA 1MUWA 3FHQA 3VZXA 1ZUAX 1TRDA 3TC7A 2TSYA 1VYPX 3H24A 4U33A 2PCEA 4J3VA 5A8MA 3CHCA 3BW2A 1Y8BA 2GVYA 2HROA 1J79A 1YADA 4CCEA 2WHLA 3RRAA 4PUWA 3MDUA 3EPOA 5A69A 2EG7A 5DBUA 2D73A 1FCBA 3W2MA 2CZEA 1X8CA 2NUYA 4M56A 1RQBA 4G5DA 3RDKA 2OSXA 4ZFMA 3SCQA 1XV8A 1Y0EA 3M5VA 3CO4A 3V5OA 4IFKA 3S1WA 1MXSA 4PEEA 3GUWA 5FJUA 1ZS2A 3T4CA 2P76A 2VR2A 3QOMA 5T8GA 3QC0A 2YX0A 2VTFA 2BSLA 2DDXA 1R2TA 4HHHA 1P43A 1R2SA 3PBUA 1V6UA 1DWJM 2HS6A 2XINA 1MYRA 4JFVA 2B4GA 2OPJA 3MYOA 3AS1A 1US3A 4RW5A 1Z7AA 1RA0A 3F4NA 5D2YA 1LRNA 3MTWA 4S3DA 1Q2RA 2XVNA 3QGAC 4WDTA 3GYCA 5I00A 4AXKA 3AMGA 1QPRA 2PEVA 4P2VA 2YLAA 4QS6A 4P61A 1E6RA 4KRZA 3FEQA 4JZ5A 4O53A 4OFCA 2ODOA 3CQKA 1W17A 3WF1A 2P5NA 1V02E 4FO4A 1E0WA 3GDLA 4LEFA 3GBDA 4XZNX 3GIYA 7CGTA 3S5OA 4K8EA 5A8OA 2HWGA 2ICSA 3TOPA 1OFPA 3S4TA 1CENA 2YXXA 4Z2KA 3ITVA 4HSNA 4IL0A 2R24A 2OX4A 3W2KA 4UFHA 3TR9A 3CEUA 3ARRA 2W91A 3W72A 5H8UA 1EGVA 4I6VA 2PLKA 4L1GA 3EOLA 5H91A 3H4WA 3G2GA 3U2OA 5BWAA 3WLSA 5JUVA 4LWWA 5AHMA 3RILA 3TROA 2YBVA 1E6ZA 4U5KA 4S38A 1Z48A 4QXIA 3N2BA 3TE9A 5CPQA 1DTNA 3I7RA 3AJ7A 2ZWZA 1SZEA 3E1F1 1V3JA 3MUCA 1SVDA 4GJIA 1I0DA 3BG3A 4WKHA 1NQKA 3CYJA 1K4HA 5FKYA 3NTYA 3SW6A 1E0XA 1CXEA 5EL1A 3EX4A 3AS2A 1OCNA 4RDYA 1EX5A 1OCJA 3KUMA 3ZJ8A 4AFYA 1UWUA 2WMHA 4GQGA 5EMJA 1M5WA 4O12A 4C1KA 6ENLA 2J77A 3QHNA 1AJ0A 2PDPA 1A5KC 3SN0A 1KV8A 1EWEA 3M0JA 1NDVA 3OZOA 3EX1A 1TZ7A 2ZXBA 1E9ZB 4JN6A 1AG1O 2BOGX 4M5PA 1KCZA 2VUYA 3K1DA 4PTWA 1H11A 4UOQA 4Y9OA 4IJBA 3B05A 3L2IA 3MHUA 5D8ZA 4RDWA 1GW9A 3CJPA 4IIFA 2D23A 4CQ9A 5CGTA 3ZM8A 3C8NA 2ACQA 4CD6A 1AW5A 5FAGA 3EWWA 3KVMA 3VM5A 1JF6A 1ITQA 1XKJA 2D2OA 4HD5A 1R6WA 1UD5A 1XIEA 3NQVA 3ZLFA 4ORMA 1ZALA 4P7RA 2V9DA 3TR2A 2YXGA 3ZSTA 1LJYA 2GDUA 3MUXA 2IMRA 3EDDA 5AC5A 1QI0A 4WJXA 4YHGA 1UIOA 4DZAA 2HK1A 1DWIM 4DJFA 2YCLB 3QQ1A 4V15A 4LQ1A 3WLOA 4HZ7A 2MNRA 3FVDA 1XG4A 2E7FA 2DZSA 3RITA 5D2VA 1TV7A 4GCAA 1W9BM 1MO0A 1WB0A 1FQ0A 2TAAA 3BANA 5FCZA 5A6SA 3LTPA 1TJPA 4PRRA 5GNXA 1W1IE 3LQGA 1WX0A 1PIGA 2BTMA 2GZXA 3DDMA 2BHZA 1PKLA 4NNAA 3W81A 4JNZA 1SZGA 3ATYA 4ZB0A 3URQA 3WH5A 3GFXA 1VIWA 1C7TA 2YB4A 3SUWA 2O9OA 1S3TC 3SBFA 3KDNA 4I7WA 2X30A 3W75A 3PBVA 4GC4A 3P3BA 5HDRA 4LEQA 1L6GA 3OW1A 3RG6A 1MUMA 1O60A 4ATDA 2NT0A 4BKNA 1F6YA 3VZZA 4QIUA 4UTMA 5LIKX 1YXYA 2CU0A 1WXYA 2WXDM 2ATMA 4G1NA 1I2RA 2BV9A 1ZP4A 2VC6A 1TV5A 4MKNA 3E12A 3B8DA 1E6NA 4P8XA 3EAUA 4PUNA 4O11A 1ME7A 1Q7MA 4Y8EA 4JIPA 2Y85A 5EKYA 1VEPA 1D3CA 4JQ4A 4AD0A 2RAGA 4Q4QA 1ECEA 3UJ2A 3OPSA 1EUAA 2A2IA 3TUUA 4J4KA 2C1IA 5HINA 3ZYZA 3WY1A 1IXQA 3TFCA 4CEXC 4HU3A 4B3KA 3WH8A 3EWBX 4IP5A 1PEZA 1A0EA 2VOTA 2FFCA 1XL9A 6TAAA 2VEMA 4R34A 5KSWA 3PN8A 4QDPA 5CPLA 1MEWA 3TA9A 7ODCA 2C1GA 2B7NA 1G0CA 4A05A 1O12A 1K7XA 2OFJA 3FJNA 4Z2LA 5G4EA 3M0MA 4CU6A 3NIYA 1SUXA 3UWVA 2I56A 4PTVA 1QPNA 3U2ZA 1GJWA 5ABFB 1XFCA 3VKBA 4E6MA 3TAOA 4US5A 1PZ0A 4Q8QA 2Q09A 3CUZA 4YPJA 5PTDA 3RFAA 1B5TA 2CHRA 3O7UA 4LAZA 3SRHA 2BS9A 2D2JA 1RCOB 5C70A 1QNPA 4Z1YA 1F76A 4UTUA 1EEXA 4EP8C 4IIDA 5U4NA 3WKZA 3MSDA 4A2RA 1SFLA 4A3QA 1UA3A 3L21A 3BK0A 3E0IA 3LZ5A 1TFVA 2VZSA 4F4RA 4LNYA 1Z32X 4UFIA 3A4XA 3ITLA 4D6GA 5FOOA 2QULA 2IKIA 1A0DA 3LD5A 1KM0A 2OEMA 3KCLA 1TYGA 3Q58A 3JR2A 1VJZA 4MZ8A 1RP8A 1MI3A 6REQB 2WW5A 4UBPC 2J13A 4UTJA 3AYVA 2W4XA 3PZIA 1VFLA 5F4XA 5CPTA 3IK4A 1OT2A 2JFEX 1VBRA 5E9AA 3DI0A 2DQWA 3PZOA 2XH4A 1AQ0A 4CQAA 3CB3A 1YBQA 1HT6A 1NP2A 3R1ZA 3WQPA 4UTIA 3TN6A 5F4WA 1CTNA 3C0QA 3S42A 4QCEA 1QT1A 2C0HA 2CITA 3DESA 2ZX9A 1W31A 3PZTA 1XIFA 3AMLA 2L5HA 2C18A 2VRKA 4PMJA 2VEFA 1BD0A 3DXIA 2VRQA 3OU8A 3UG4A 2DY3A 4UFMA 1A80A 4J3ZA 4IOTA 4ZQCA 3O0FA 3RLVA 4PR4A 3NJ3A 2XN2A 5EMLA 3HU7A 1Z42A 1P6BA 2WAGA 5E0FA 4ZTYA 1M3UA 3WLNA 4P7QA 3BICA 2PODA 1VHCA 5DANA 4GFSA 2D2HA 1DJIA 2J7BA 3TMLA 2X8RA 4RXGA 2WNWA 1R47A 2DUXA 1U5JA 1H61A 3GBEA 3I4EA 2VURA 4IPJA 3R8GA 1TV4A 5A8QA 2A6NA 1WQ5A 1NAL1 4DO7A 5DY3A 1VR6A 1TRIA 1F3XA 5CZSA 3MANA 3M0HA 4MM1A 1S5VA 5E0KA 5LIYX 4U2ZA 3W7MA 3TW9A 3SIZA 5CAKA 4D71A 2XIOA 4DAFA 2J8GA 4DO5A 4NZCA 1ZBCA 3YPIA 3N2CA 4YTSA 4IT1A 1UBSA 3DOPA 1ZENA 4KERA 2E6YA 4LNCA 2DZUA 1E9IA 4S3EA 2JEPA 2WHJA 2W3ZA 1H7PA 3DCPA 3K5XA 3T08A 4FB7A 1PXGA 5JBEA 1A5UA 1WNOA 1J96A 2QJHA 1EGMA 4P8VA 3QJAA 3PJUA 1OCBA 3F4VA 3N3MA 4GGBA 2WZHA 4V28A 1N7KA 4O17A 4CLMA 4GY0A 5L6UA 1JNEA 2GYIA 2JKEA 1JGIA 1OFRA 5CAHA 4JFUA 1ME9A 4HA3A 2XPKA 3CNYA 2AQVA 3HOJA 2R14A 4OQVA 3LBCA 3TQ0A 2Q8LA 5FJIA 1LG1A 4WSJA 1TSIA 1UWIA 3IAPA 1DV7A 1CNVA 2WJDA 2HEJA 3N1AA 3AUOA 1RA5A 4PGLA 1EP1A 3BW3A 3R94A 5EMMA 4KEVA 4PMXA 4L9XA 4LF1A 2O9TA 4FNRA 3FYOA 3N12A 5LYRA 4XK2A 4ERGA 1VFTA 5G2HA 2GGJA 1BG4A 3NQBA 3I6TA 4B2DA 2JE8A 3KVLA 3DYOA 3SY8A 3ICJA 3HMCA 1LL6A 2BGQA 3DUGA 2E4TA 4HZMA 3KBVA 1A47A 4CNTA 3S1VA 1QCWA 2VKZG 1RVGA 4CVUA 1TTQA 3TJLA 1NWSA 1A53A 4H00A 2E9MA 4KWOA 4RV3A 4GFIA 1FUYA 3LM7A 4AVFA 2XHYA 1EQPA 4JOMA 2OJPA 3F2DA 4MB4A 8CGTA 3VD7A 3O2LA 1W8SA 3U57A 1GPWA 4AIUA 3PZVA 4GG9A 4AEFA 3W53A 3KS5A 1BTMA 2J88A 1HX0A 1DORA 3BPWA 3QR1A 4LCQA 3W6YA 4XIAA 2J66A 3NL5A 2GJNA 3TN4A 4AW7A 1RXOB 1AH0A 3OJGA 3N34A 4FXSA 3VKJA 3WQVA 4URIA 4LTSA 2YDQA 5I06A 3W70A 1HP4A 1GZJA 4H7CA 4L65A 2C0AA 1TPEA 1RQHA 3W2NA 1ISVA 1QNOA 3PVFA 1LM1A 3TEVA 3CIWA 3HN3A 2CEQA 1SW7A 3L0KA 2YB1A 4H04A 3HA1A 2Y5EA 3WFAA 3C4UA 4UNLA 2YDAA 2YA0A 3R89A 4ML9A 3DFHA 3WIJA 1GKQA 1SJAA 3AHZA 1QW9A 3BAXA 3VOHA 2YCKX 3HQ1A 2BZNA 5CLWA 5BCAA 4WF7A 3KCJA 2CWXA 4GNKB 2FLIA 2UY2A 2ZIDA 4IGSA 1IEWA 4XAZA 3BWWA 1OB0A 5DMMA 2CLMA 1GKRA 3QH2A 4HPHA 3KOZA 4YJ5A 3PZMA 1H60A 2OXNA 1J93A 3H53A 3EKLA 1KB3A 2HZGA 4NXKA 3CPRA 2WQPA 4YIWA 3STEA 1UD4A 1NEYA 5KINA 4O1EA 3RAOA 4M3PA 1IXOA 1JXJA 4HA1A 4OTKA 4TMCA 1GORA 5M3WA 4P8UA 3F2CA 1UG6A 1W5QA 3WNPA 4GVHA 3NYDA 1EOMA 1EBHA 3R8RA 4GXPA 4TIMA 2ON3A 4NILA 1UQZA 1QO5A 4ASTA 4IGMA 2FGLA 4FK9A 4LJ3A 3LSCA 3POCA 4JXCA 2XZ7A 2RDXA 4PL2A 3W7LA 3GC4A 2VQTA 4Y96A 3V1HA 5LZLA 3URAA 1C93A 1SO3A 2IQ0A 1TPFA 4F3HA 2XISA 2WVVA 1LDCA 3UYCA 2VC5A 4UQ9A 1TIWA 1CGWA 1EF3A 1A5LC 4AEOA 1QR7A 3W85A 1E4LA 4RXFA 3PSWA 5FF0A 1SW0A 1XQLA 2EJ1A 4DNMA 5LA0A 1IWPA 3AROA 2E6AA 4LH8A 3UWUA 4LS2A 3O07A 4E0CA 1C90A 2I9EA 1UR3M 3RHGA 2Y5SA 3HV8A 3ZLGA 4LY4A 1OX6A 2RGLA 2G37A 1TQXA 2E09A 4DJEA 3RF9A 4DF1A 4L4MA 3BLIA 4XKYB 1HO4A 4Q8TA 4Z1AA 3OLIA 1MFVA 1OEPA 1UUMA 4DAIA 4S1FA 5JH1A 2PBGA 4XD3A 1IV8A 1XH1A 4INFA 1KR1A 1G7VA 5DQPA 3PZQA 3E96A 1ITXA 2DSWA 4MNMA 1TMHA 3STGA 4UQCA 1K9EA 4PTMA 3BDKA 4PCFA 1O5RA 3O63A 2QLYA 3D5HA 2CZDA 1W56A 1QPQA 2BXZA 1OIMA 2HISA 1REQA 5TIMA 3TTQA 3VKKA 1KFEA 1M03A 3G1DA 5MKGB 2GL5A 1POKA 5HNRA 4AYSA 1P7TA 1JCXA 1F9CA 2VNCA 4JTCA 1UC5A 2BWGA 5D9NA 3OEXA 1M01A 4NASA 1RY8A 3L2MA 1LL7A 4DWSC 3LMZA 4RE2A 4GYFA 5C2CA 2O55A 2RJGA 2QCDA 4ZODA 2PDBA 3DGRA 8XIAA 1XCWA 4OUIA 1FDYA 3EXRA 1BWKA 4MY8A 4G7EA 4RE3A 1XLDA 3K4AA 4XZ9A 4K39A 4GMEA 3SADA 1UJQA 4LALA 1UZ4A 4GUJA 3M07A 3VPLA 2CBIA 3ECQA 5GPRA 5KZMA 2XWEA 2WV8A 5LKYA 1B9ZA 2QGYA 1XGZA 1OFQA 4X3ZA 3NCOA 4OOUA 5A6BD 2PDUA 1PBGA 3CAWA 2OYKA 4FLRA 1WDSA 2XH7A 1H0IA 3RIKA 1KGUA 2J7GA 3UEQA 3XIMA 3H22A 1SFSA 1ESWA 4BI7A 3O16A 1GONA 1XHGA 2H3BA 3G6LA 7REQB 1OC7A 4PTXA 4F2TA 4B5SA 4M1RA 1L6SA 2FIQA 4I9MA 4JYDA 3PG9A 1G7UA 4MB1A 4Z08A 4FA3A 3I6RA 3FGCB 3UU0A 4PZVA 3SAZA 1RR2A 3FN9A 4UXDA 1F2JA 4TU1A 2XVPA 3WD3A 2ZE3A 3WBAA 4QDMA 5C9WA 4XZHA 4QEHA 2NVAA 4GO8A 2C6QA 2HPMA 4K8HA 3JUGA 3GU2A 3G1AA 1VAHA 2BHUA 2Z1XA 4DELA 1V6TA 4NJKA 2J47A 2DT1A 1E51A 3BLFA 1XIIA 1GCYA 1EL3A 1G67A 3TJ4A 1WZKA 4WY0B 1CCWB 1OADA 1ONXA 4HMEA 3ZIZA 1XW8A 2YFOA 4IIBA 4L4PA 1LT8A 2Y7DA 3WJZA 3E0WA 3N2OA 4PMZA 4CNOA 3WMLA 1JZ4A 3ZO9A 2CC0A 2VCAA 4JS3A 3GNDA 4AH7A 4HHPA 4MUPA 4DIAA 3W7CA 4KFNA 2CW6A 1TO3A 2RJHA 2WMGA 3VGDA 3NZPA 1J0YA 4EANA 1F4HA 1GQIA 1XPYA 1EX1A 3TYEA 1LLZA 2WKLA 1KWGA 3WDRA 3E2RA 1NM9A 1W5MA 2BVDA 2GUBA 3OHMB 3GNPA 2GGEA 4WRHA 3UESA 3DU0A 4PA8A 3SCVA 2Y7FA 1E70M 5EY5A 3EEGA 1B30A 1ZBKA 3G0UA 2DZXA 3I7QA 1R3WA 3GWQA 4HOWA 2J7FA 5DLCA 1AD4A 4WEVX 2AL1A 3GFZA 3A5FA 3CL8A 4IG2A 1DHPA 3LHZA 4GY1A 4WKFA 4LC8A 4H41A 2PB1A 1BFNA 1KW1A 3B8VA 2RHGA 4AZ5A 4ZSTA 1ZJAA 3EWDA 3GTIA 3QZ6A 1WKYA 1W37A 1W3HA 4H01A 4O18A 2FQIA 3CBWA 4LSBA 3HPAA 2IXUA 4XAGA 1UJPA 2VFDA 2VCBA 3EB2A 1EDTA 3WL0A 1Y7VA 4B9ZA 1UCWA 1J11A 1M6JA 4EWND 3B06A 4BI5A 2DH3A 4AWUA 1OHLA 2ZCGA 4YYFA 5K2ZA 5C9UA 5EPDA 5A94A 3B8IA 1WE5A 2ZX8A 4C6PA 1F6KA 4HA0A 4F9DA 5I3FA 2WC7A 4H7VA 1ECQA 4F9JA 1DIKA 2VX5A 1VQTA 1JL8A 1EKOA 3WZ0E 4UTFA 4JTAA 1FKWA 5CG0A 4O4WA 4C6BA 4F66A 2C14A 3W26A 1K8XA 3V3WA 4XAYA 4PUMA 5T91A 4I5XA 1DKWA 3E5BA 3LTYA 2V5CA 5LHEA 3SSJA 4DBUA 5E09A 4C6CA 4FLQA 4GC3A 3UCDA 2ZZ5A 4FXRA 4EPEC 3UR5A 4H3DA 4LFYA 1K9FA 3PNZA 2QUTA 2XGZA 2WVSA 1EWDA 2B7OA 5DXYA 5I3GA 2PD5A 1A3WA 3CV7A 4DF0A 1H09A 5HNUA 2CNCA 4IUGA 1RHCA 3TIMA 5FJPA 1DWAM 1K70A 5C6MA 1W1PA 2P53A 2C7FA 4KRTA 2ISVA 1QI5A 3QZAA 1C7SA 3SM0A 2VWTA 2QJIA 3RLHA 4MNKA 4WDXA 3A13A 3NOYA 3JZUA 5I23A 3NXFA 2AL2A 2A4AA 3FV9A 3AC0A 1BVNP 1E1CB 1KRCC 1H41A 4U2YA 1UP0A 1BKSA 3CWHA 3NYZA 4GI6A 3GY1A 4A22A 1C8VA 2UY4A 3B8UA 1DJYA 2FHCA 2DSVA 4HGXA 3WLHA 3CMJA 4XBKA 1FHLA 3NQEA 4FNSA 4A4AA 4WOQA 3OB8A 3TTOA 4ALDA 4JIRA 2YZ5A 2QCNA 4PRTA 1R7OA 5C54A 1FHDA 3DH7A 1THFD 1R87A 3CZLA 1GEHA 5J8LA 4TTUA 2E6DA 3EB3A 3ID7A 3W07A 1XLMA 3ARPA 2GVEA 4QJ1A 4O54A 2PSNA 4PH6A 2OWXA 3TSDA 4ATLA 3UWZA 3LSBA 4MNJA 5KZ6A 3MI3A 1X7IA 4YTRA 2TPSA 4QCFA 4CD7A 3D46A 1I8JA 4ZXLA 2VVNA 3FFSA 4ILSA 1S38A 3FKKA 2XFFA 4FR1A 2WM1A 4K3ZA 4L9ZA 2AQWA 4QAWA 1UR4A 4C1NA 1YW1A 3H2EA 2UBPC 2VC7A 1JDFA 3V4BA 2ANUA 1T7LA 1CBGA 1SYTA 4N4QA 1U83A 2VX4A 1UWAA 3VFLA 1R3QA 3CQJA 2E8YA 1VCFA 3HG2A 2E5DA 5GJPA 3VIGA 1XLFA 2A7PA 4MF4A 4WSHA 4OV4A 3CL6A 1LWIA 1P1MA 2BVTA 2GUYA 2ZX5A 1VKFA 4F0SA 2FH8A 2BNJA 4H9YA 3RXZA 3MHGA 1KKOA 4DM1A 2J9XA 4ZR8A 1FWNA 2BDQA 4HMCA 2WPGA 4XZMX 2A3CA 3BJFA 1W5NA 4DJFD 4E5TA 3KRUA 1X1OA 1MDRA 3RPMA 4NRSA 1PB0A 1X1NA 1BG9A 4M19A 2A85A 2A7RA 4M1BA 3ZOAA 1HQTA 3DFNA 1NWTA 1RPXA 4DWDA 3ANVA 1AJ2A 1HL8A 2XGBA 3O6CA 3ENLA 3IVSA 4UMAA 2HRWA 4O52A 3AISA 3TWBA 2OSYA 4M0XA 5BXTA 1KWKA 3THAA 5IOBA 1V79A 3W29A 3H70A 3RJXA 1GVOA 3MVTA 1XC4A 2ACUA 3N9KA 2Z7GA 2Q02A 2JF7A 2A3EA 1YPFA 1MNSA 1UKQA 4H6QA 3WBEA 3VD5A 3UR7A 1XIJA 3VNKA 1AJZA 5FSDC 1YRRA 4M7TA 2G50A 4C6KA 4XX6A 3S2CA 2KX9A 1LRQA 1T41A 1TCMA 3FAWA 1O95A 4CGTA 1AW2A 2ZADA 1XDMA 4FNQA 3A64A 1YDOA 3CASA 4UQBA 3GKAA 4Q8VA 1EH9A 2A21A 2UY3A 1TPC1 1GVRA 3HBLA 3Q37A 3VGEA 2NLIA 5HR7A 1GNXA 3N4FA 1IWBA 2X2YA 3MBFA 1EGZA 3AMKA 1YMYA 3GHTA 1M41A 1JRBA 3OG2A 3ZVHB 5HUPA 2ZZ3A 2P1FA 3LPGA 2EPLX 3H54A 5IXEA 5SWUA 2HCVA 3TQPA 1K6AA 3DECA 1TPUA 4FX7A 4JBRA 5CSSA 5A6AA 1EHNA 2PF0A 1GVSA 1FH7A 1ITUA 4S3AA 1NDYA 2ZUVA 5CSYA 5I3JA 4L80A 4EACA 4HTYA 4ZO7A 3WBYA 3KS6A 3Q67A 3AI0A 3GVVA 4DLMA 2QF8