1D8WA

L-rhamnose isomerase
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
416
structure length
402
Chain Sequence
TQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-RHAMNOSE ISOMERASE
publication title The structure of rhamnose isomerase from Escherichia coli and its relation with xylose isomerase illustrates a change between inter and intra-subunit complementation during evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 142
structure length 402
sequence length 416
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.14: L-rhamnose isomerase.
pdb deposition date 1999-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06134 RhaA L-rhamnose isomerase (RhaA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1d8wA00
1XLLA 3UA3A 1XINA 3BDKA 3IUIA 4HGXA 3UXIA 4OVXA 3L23A 1XIHA 4GLEA 3CQJA 3OBEA 4XIMA 3KBSA 1GW9A 1OADA 3TC3A 1XLMA 3ITVA 3VNJA 1XLFA 2QUMA 3BANA 2X7WA 3QC0A 4ZB5A 3AYVA 1XLAA 5B7ZA 4PFHA 3C0QA 5EMJA 1A0CA 4XIAA 3JU2A 5EMLA 3ITYA 3VNLA 3LMZA 4W4QA 3QZAA 1XYBA 4QE4A 5FA5A 4A8NA 4GJJA 3BWWA 4XISA 2HK0A 4QEEA 1YX1A 2OU4A 3KBJA 3GNXA 1XIFA 1D8WA 1XYLA 3FVMA 4PGLA 4QDPA 4X61A 3P6LA 4X63A 3M0YA 5XIMA 4QE5A 3IUHA 1XLJA 4QE1A 4X60A 3AALA 2J6VA 4EACA 1O1HA 3DX5A 6XIMA 5C9ZA 4HHMA 3ITTA 3WQOA 3KCOA 2ZVRA 1S5NA 4EAYA 3U3HA 4YTSA 1XYMA 5AVNA 4ZB0A 2GYIA 4YTTA 1XP3A 3M0HA 1TZ9A 1QUMA 4YTUA 3AYTA 1QTWA 1S5MA 3XIMA 1CLKA 3CWHA 5TNVA 3TVAA 1XLHA 4DVOA 3VNIA 2GVEA 1XYCA 3QYSA 1MUWA 3ITLA 3KBWA 4YTQA 3CNYA 5H1WA 2NQ9A 4HHLA 1XIGA 2NQHA 4K1GA 3QXBA 3KBNA 1BXCA 2XIMA 4A8LA 7XIMA 2NQJA 3BZJA 1XLIA 2QULA 3M0MA 4HNOA 4KW2A 3BZGA 2QUNA 1XICA 3ITOA 4E3VA 1XLEA 1XLCA 3CQIA 3UU0A 4XSMA 1XIIA 1QT1A 2HCVA 2X7VA 3U0HA 1A0EA 5B80A 2QW5A 1A0DA 5EMMA 3IUDA 1XISA 4LNCA 3CQHA 1XIDA 1MNZA 4QEHA 5EMKA 1XIEA 2ZDSA 4DUOA 4J4KA 2GUBA 5H6HA 3VNKA 9XIMA 5XINA 2XINA 3KBMA 4Q7IA 1XLDA 1I6NA 3C0SA 3P14A 3AAMA 8XIMA 2G0WA 3KCLA 3C0LA 5I7GA 5B7YA 1XIBA 1DE6A 4K3ZA 5J8LA 1XLBA 1DE5A 3CQKA 1I60A 1XLKA 2Q02A 3ITXA 3M0VA 3KCJA 3UVAA 1XIMA 2I56A 5XIAA 3UA4A 3XINA 4GJIA 2G4JA 1DXIA 6XIAA 2I57A 3DBNA 3N4AA 1XLGA 4ZB2A 3VNMA 4GQBA 2XISA 3M0LA 5AVHA 3NGFA 4XSLA 1DIDA 1XYAA 4US6A 4ZBCA 3KBVA 4A8RA 8XIAA 1DIEA 2GLKA 4QDWA 4A8IA 9XIAA 4XKMA 3KTCA 1BXBA 1K77A 4G56A 3VYLA 3KWSA 2HK1A 4YTRA 3XISA 1XIJA 3M0XA
chains in the Genus database with same CATH superfamily
1HJSA 2WM1A 2XU2A 4M29A 4A2RA 1WOAA 1RD5A 2V81A 1J0JA 4DPQA 4AZHA 4PB3A 3TYEA 4MY9A 5A8OA 4IM4A 2VVSA 1UR4A 2DZBA 2G95A 5C9RA 5D05A 4GC4A 4DI8A 4LBSA 3W2NA 4IXXA 5LKYA 4LYQA 2J88A 1TJ2A 1RCXB 4WY0B 4DBUA 1XYZA 1PX3A 1AG1O 4INFA 3DIPA 2QCCA 4G7FA 5U7SA 1VYSX 1TV5A 1O5XA 3CV1A 3GDRA 5EBAA 4TMBA 3BJTA 1TTQA 3T78A 3OZYA 1LROA 1GVFA 4AMCA 2Y6ZA 1UWUA 2WZEA 1TTPA 7CGTA 5AYIA 1Q8JA 3DI0A 4O12A 4GQQA 2ZA3A 2DZVA 2HISA 1XCXA 1C93A 3ISIX 3K4DA 2PSNA 3WNLA 1KM0A 3WZ0E 1EGVA 5CBBA 1YQ2A 3PY2A 3AMDA 1W3IA 3LENA 2VFGA 3FHAA 4R53A 5XIAA 2H6RA 4JFVA 2BFGA 3LM7A 1YXCA 1DTUA 5AC6A 4MYXA 4NNBA 1W37A 3FSUA 4GQGA 4PMQA 5I0DA 2NXHA 3OZOA 4DBWA 4HJFA 3MP4A 2QNEA 3VIMA 1UW9A 3EDDA 1H62A 4IQJA 2DH2A 1HXJA 1LT7A 4WKAA 3SY1A 4TX6A 3GBEA 3N6QA 5BXPA 4ORIA 3ITYA 1D7KA 4MKVA 4A8NA 4DIAA 1XYLA 3LTPA 1SJBA 1SO3A 2QPXA 5K9DA 4DYKA 5BOFA 3WLOA 3VZXA 3MYOA 5EYWA 4CQAA 5SWUA 5REQA 4V1XA 3DZ1A 3N18A 3W07A 1GT8A 4MJ2A 3N2XA 2YXOA 3R58A 2PWDA 1CLVA 3N17A 4PA8A 3GS6A 4QG8A 5FF3A 5I3KA 3SSJA 2DJLA 4DJFD 4IX0A 4DXXA 2WHKA 2BHYA 1S2AA 2R1PA 3H2NA 3S2NA 1ZBKA 1PZ2A 1W54A 4Z2HA 4MNLA 2YCLB 3BICA 3AIEA 4AZGA 5I2UA 2X8RA 3GWQA 3P3BA 4JL2A 5D04C 2FMOA 3PPGA 1HQTA 2NX9A 5DY2A 3RCNA 2VURA 4PTMA 1TELA 2FHFA 1NDYA 4FF5A 5FJIA 2I57A 3STFA 3SIMA 1VF8A 3QBUA 2PLMA 4EK7A 4ERIA 4TMCA 3PZTA 3UWEA 3PZNA 1CTNA 2PP3A 4Y90A 2ZUTA 2G37A 4FOUA 1JGIA 4I7UA 4CNPA 1EPXA 4AH7A 4QS5A 3HTWA 2E9MA 1NFPA 1MW0A 1YE6A 4U5IA 4FHAA 2OCZA 5CGTA 3MMDA 4PBEA 2OWWA 3SB0A 1TJRA 4D6HA 1FWNA 2A7PA 4XISA 1KV8A 3W1AA 2NV2A 5TQLA 1JVNA 2GWNA 1KRBC 4B3ZA 2AAMA 3M0HA 2ZWYA 3D6NA 1SO6A 3R25A 1DTNA 4JDBA 5CXPA 5M2FX 1V3JA 4S3GA 5AZ1A 2FVKA 2XIMA 3HM7A 3SRFA 3MMWA 2GQ8A 4L6DA 1C8VA 1C3FA 1SR0A 1UA3A 1BVNP 4JFSA 2BVDA 5CG0A 5A2CA 1EP3A 4WDWA 1JCYA 2Y5JA 2H9AA 4O10A 1KFWA 2VMFA 2QKFA 2I1OA 3DENA 2OGYA 4O17A 3HG5A 4EANA 3GTIA 3WLMA 3VMOA 5LSMA 1XYFA 4H1ZA 1AUSL 4YVVA 2IPGA 2YXGA 2YA2A 1JFHA 2ABAA 3H4GA 2V3FA 1V77A 3LNMA 4HPHA 4JKMA 3BG9A 3NOYA 2ZIDA 4Q8OA 4KKXA 4KWUA 2OR2A 3BG5A 2ALDA 4JPGA 4GXWA 2PWHA 2GGJA 3E12A 3UXIA 4RDZA 1YTDA 2VD9A 2JIWA 5CCZA 4I5RA 2YLLA 3DKLA 3UWQA 4HKPA 4NHVA 1IT0A 4BA0A 2PC8A 3BV7A 4Z1BA 3WQVA 4HK6A 3TE9A 3RPMA 1HX0A 3W29A 1I45A 5HMFA 1WKDA 2FTPA 4KCTA 3N25A 3NYZA 1EP2A 3TQVA 2PTYA 4H9MA 3NQ8A 3PK7A 3EWXA 2EKGA 1ONXA 4S3CA 3CPGA 3NDOA 1FWHC 1NDWA 3L9CA 4MJMA 1OX4A 2HPMA 4LFYA 3ZZ1A 1H7OA 2WMGA 5LXXA 2HCVA 3O0FA 2PDLA 1L6SA 4K7VA 7ODCA 1A5KC 3WX7A 3I65A 2JGYA 2CWNA 2ACQA 1XGDA 1JF6A 4H6KA 2NW0A 2ONEA 3DEQA 1DE6A 2B7NA 3W38A 3NQ2A 1N55A 4TX9A 3PAJA 3UVAA 1HW6A 1W3KA 3JUGA 3N29A 4EOUA 5M1TA 3VAVA 2XUCA 4ZBCA 5GJMA 4O14A 2Y1HA 4W88A 3RX2A 2IQ0A 3LX9A 4V27A 1JQXA 2WZIA 3G77A 4GQRA 1SZRA 3S2MA 4MY1A 1SU5A 4NZ3A 3UXLA 4DBEA 3PG9A 2VDHA 4JTTA 3I10A 3KP0A 1Q6GA 3PZVA 4C6JA 3LDVA 3EOSA 2FFIA 3IV3A 2VCBA 2GJXA 1L6YA 3E96A 1RPXA 3QKEA 4IF2A 1WXYA 2A3BA 3QOMA 1SFLA 5HQLA 3A6OA 4W9TA 4L4LA 2UY2A 3B9OA 1M5WA 5HNNA 2VX4A 4NF7A 1TJ0A 2Z1BA 3N2TA 3PNUA 1R9ZA 4IMFA 1U5HA 4B92A 4M6PA 2VUNA 2FDSA 4IMDA 1HP4A 4Q8NA 2ZUWA 1RY8A 4HNOA 3RX4A 3IWPA 3QFEA 4KFOA 1VBGA 4PUJA 2PCEA 1M41A 1AH4A 1K4GA 1A5SA 2WVVA 3DG7A 4GH3A 4P2VA 1RBLA 4QGCA 4KH2A 3CH0A 4LYPA 3C86A 2I5IA 2OPJA 2XJ7A 9RUBA 3NVTA 1ENUA 3F5KA 1S38A 3ANVA 1GQJA 1HKKA 2OZ0A 3LCLA 4DUXA 3VZZA 1Z7AA 3H2EA 4JIEA 3PZQA 2DUXA 1UH2A 3CZGA 5CZKA 4J1OA 4EX4A 4OGZA 4A21A 5CJNA 2Y88A 1FWFC 2DVUA 1D3GA 3CZJA 4XO6A 4XVDA 2IKJA 1Y5VA 3Q67A 4PSPA 4LJ3A 4LVFA 5FJOA 4FS9A 4K39A 4X0VA 3QC0A 1FRBA 4PFHA 3GIQA 3C0QA 3PZMA 1K02A 1K8CA 4K8EA 1EDGA 2OEJA 1UR3M 4R7WA 3UR8A 1EA0A 2DVTA 3UVIA 1O1HA 3TW9A 2GL5A 3LA4A 4Y8FA 1N82A 3LNPA 5DEZA 2BB0A 2WNWA 1ZJIA 1CXEA 1OEPA 1FFRA 3TFCA 1C9DA 4IQEA 5HK4A 4AD1A 1UMYA 3DCPA 3EWUA 4JN8A 4BZYA 2HS6A 4O4WA 1ZGDA 1VFHA 1BKSA 4GFSA 3TTEA 3AFBA 3WDIA 2XSXA 4AISA 4MAZA 1RSCA 3ZQ9A 4AD5A 1W9BM 3QGVA 1VPXA 1XLBA 1UHVA 3R89A 4GC3A 3U7VA 3M0VA 1VLIA 2O9OA 4WJ8A 3P0WA 4BF5A 4NL1A 2XFFA 1SYTA 1E71M 4LV4A 3GFXA 1DJYA 3VKCA 1MFUA 5G4HC 4AY8A 1ZP4A 1SO4A 4GZJA 2PRHA 3VIGA 3TCSA 3K2GA 4WSJA 3GNRA 3ITVA 3CASA 3WUEA 1NELA 3KFTA 1PCKA 1A0CA 4QJ1A 1E73M 2Z28A 3VKKA 3GE7A 1V4YA 4FLSA 5HQEA 3W2UA 4GUGA 1MW1A 2PWGA 2J6VA 4NZFA 4XX6A 3WSUA 4ZQMA 4AD2A 3GD6A 4JCLA 3WQOA 2FTYA 1J9YA 3UCCA 3LTYA 2Z29A 2PTDA 1E9IA 1S5MA 3MU7A 3S9ZA 1ISZA 5AFDA 1QAPA 1OYBA 2BS9A 1XLIA 3M16A 2Z27A 2OWCA 3VOIA 3AROA 3PUOA 4Z2GA 1R3WA 1W5MA 5CBIA 2D2OA 2CBJA 1W1ZA 3KDNA 5TD4A 3CIVA 2DSZA 2J7DA 1PDYA 4GH1A 5A95A 2EXOA 2X1IA 4ZA0A 4GISA 4V1YA 1O5QA 1XBZA 4PMYA 3LQLA 1DKWA 3PWGA 1OFDA 2KX9A 1F7BA 4IX2A 2EGZA 4NX5A 3CAQA 2WCAA 1QHPA 1YTEA 3NL6A 4G8TA 1UOZA 1H0GA 3HJEA 2CYGA 1XCWA 4Q4KA 1OGBA 3W2MA 3UR5A 1UC4A 2E8ZA 3WQ6A 2VCAA 1HP5A 1ZBWA 4MYAA 3CIXA 3H26A 4AX7A 4R27A 3CGTA 3TU9A 2BASA 2J8GA 4GZEA 1PBGA 1VGAA 4UC5A 3VC5A 3NO5A 2DPEA 1W91A 3DXIA 4DM2A 1A3WA 3KW3A 3LZ5A 1GKPA 3Q94A 5HPCA 1JPHA 1MMFA 2Y4SA 3VDHA 3EKGA 1Z6KA 1TTJA 3UCQA 1VS1A 3TMQA 3TWBA 4W8AA 2J78A 3WBXA 3DOPA 5LZLA 3ARSA 1UBSA 3K1GA 4QRNA 4KWVA 4NUWA 1V5XA 2P53A 2Q01A 1R9YA 2DFAA 3IUDA 1ODUA 4MPQA 2XG9A 5C2XA 1XC6A 4Y6GA 2AMXA 2Z6IA 3UJEA 2XTKA 5FAGA 3W7LA 3THUA 4P8WA 4WY0A 1HJWA 2GWGA 3RJYA 3SI9A 3L2IA 4DQWA 2CLIA 2GK1B 1S46A 3UXDA 4E2OA 2WLZA 1RCOB 4FNSA 1XPGA 1TPB1 1E72M 2EBNA 1WYIA 4L9XA 2WBKA 4NKCA 3MZNA 2KAUC 1BWLA 4WDUA 1BF2A 3CO4A 3PC0A 4G1NA 1U30A 2JF7A 2ATMA 1EL3A 1EXPA 1OFAA 4DNMA 1F8IA 3T44A 3I6TA 3GC4A 1A53A 4C6LA 2FIQA 3BXWA 3WQFA 4QE5A 3LXBA 5HR7A 3KEHA 3GVQA 1E56A 5CGMA 3J7HA 3DFNA 4M7TA 1EDTA 4QITA 1NDVA 4L1XA 2FTWA 5I77A 1J0ZA 4M5PA 4UB9A 3QPEA 1FWJC 1SFJA 1XDMA 1JZ7A 3B0UX 4BK9A 1T41A 4HHPA 3SR7A 1W3TA 7XIMA 1LLZA 4YU1A 2D2GA 5F1UA 1HO4A 3ZWTA 4H7ZA 3KUMA 2HVOA 1G4TA 1GOWA 5E9AA 7ENLA 3SUTA 5H1WA 3LEPA 2ABBA 1DOSA 3RITA 5FF0A 1EKOA 5K4ZA 3NQMA 4FF7A 3WBWA 1ECQA 3FK4A 1E15A 4W5UA 1CBGA 3MCNA 5AHNA 2WQDA 3U48A 3POCA 1Z41A 1Q7MA 3BK0A 2W3ZA 3WL1A 5H8UA 3V18A 4UR7A 7A3HA 1B30A 4WDTA 1PVNA 3KLKA 4IMCA 3EWYA 1YTKA 1TPEA 4PL1A 4J5NA 1HGYA 3LV6A 3XISA 3NURA 4QG6A 1TPFA 5CKSA 4OV4A 4LW7A 1XLFA 2ISDA 5KZDA 3TN6A 3NQ6A 1VYPX 3A3HA 4O0KA 3FJLA 5HULA 4NI3A 1D8WA 1F6KA 3IIZA 4UR9A 3M5YA 1TTIA 5DCDA 2YDQA 1DQXA 3TMLA 1X1OA 5I07A 1I1WA 1ZTVA 4HPXA 1IR2A 3LCWA 1OCBA 5I5RA 1E6QM 4WOQA 3WLTA 2OSWA 3VOFA 4ICNA 1JZ5A 2QXWA 3ABZA 4KWSA 3QXBA 2CLFA 3DAQA 4PCTA 2QR6A 4GABA 3AHTA 3HPZA 3HFYA 1E6ZA 1V6WA 1W31A 2GUBA 1I6NA 3C61A 2FPTA 3SN1A 2J27A 2XWDA 5I79A 4GX8A 5M3WA 1W3HA 3SFWA 3KVLA 1HKMA 2RAGA 3R13A 2ZUSA 4Q8WA 2BMBA 3UERA 4TO8A 3W73A 5JQ9A 2OEKA 4PB4A 4AMAA 5LIKX 4WD0A 4C6KA 4HOXA 4CU7A 5F2GA 2R1NA 3GNDA 4FP1A 3EPMA 3W7NA 1CGYA 3QF0A 4PEEA 1TPWA 5D9NA 4LC8A 3EX6A 3HGOA 3WH8A 1UJQA 2C3ZA 3TR9A 2TODA 1VFTA 3WLPA 2IKIA 1RLCL 3EEGA 4R85A 2WXDM 1G4SA 4ZB5A 3E6EA 4MPKA 5C54A 2PBGA 3BOFA 3EB4A 1X97A 6ENLA 3MBDA 4H9VA 2F7FA 1GZ1A 3FY1A 1BGGA 3BURA 2XH0A 2WZTA 3SY5A 4EACA 1B9BA 4RV8A 3GRIA 4ZOBA 3TEVA 5HMEA 3WF1A 3I4KA 3N9SA 4R5EA 4CQDA 1WPCA 5AC4A 3WD3A 1CB2A 3SCOA 1Z9AA 1TPVA 3U5YA 6A3HA 3E0LA 4FPSA 4AD3A 3ARVA 1FHDA 2F2KA 2CLHA 2ZZ4A 2VOMA 3IRDA 3EWWA 1UP2A 1J96A 2UBPC 3GC2A 3UNDA 1L8NA 4Y96A 1LCOA 2AAAA 2VT0A 1A0DA 4QEHA 3WMSA 5DRCA 4B2DD 1WKYA 4FNTA 5I7GA 3P81A 2QCFA 1M1BA 3AYSA 4R9OA 4K68A 3KCJA 2PGWA 2PDNA 3AIQA 1UWTA 1XHGA 2VR5A 2VHLA 4S23A 5DMMA 3PTKA 3S2CA 1DQWA 5BRPA 1TR9A 4US6A 2DEPA 1KTNA 3AO0A 2EPMX 1FKXA 4GIAA 1KCXA 2VZTA 4FI4A 3AIWA 1TMHA 3ABXA 1V8EA 1UG6A 4P7QA 3CWOX 4E8GA 4M6UA 1YNQA 4BS0A 4AAJA 4Q32A 3EWDA 3G0SA 2E6DA 4CCDA 1REQA 3BJFA 4Z1YA 5XIMA 3ZJ8A 1IEQA 3W24A 3GYEA 3KE0A 3S0CA 2A3CA 3RLHA 3AWOA 4LAUA 2NT1A 4JTUA 2IXUA 1R2RA 2EG7A 1EXBA 3K1DA 4JTKA 4OECA 3RUBL 3DHFA 1AH3A 4L7ZA 1XRSA 3PFRA 1P43A 5ABFB 4UXDA 2OMAA 4JX6A 2EPKX 4RNFA 4JTJA 4CQ9A 1H7PA 2OYMA 1YPIA 4WJEA 3ELFA 2ZQ0A 2VEFA 2F61A 2WC7A 4PCNA 1BAGA 4DWSC 3SM0A 3RDKA 3V3WA 1JR1A 3HPSA 3TYBA 4IFKA 2QZRA 3NEHA 1YEYA 3VM7A 3QY8A 4RXGA 3U4AA 1ISWA 1T0OA 3ARXA 1KCKA 4PMDA 1LDCA 3N34A 1KM1A 4IPIA 2B81A 2XPKA 3AS2A 2YL6A 2BVYA 3LHTA 3A3XA 1E6XM 1K7FA 3G1YA 1RBOB 2DIKA 4AB4A 5EU9A 4L6HA 3A4XA 2JKPA 4JKKA 1RK6A 3T55A 3ONCA 4AQLA 3WIJA 4JOMA 3FFSA 2DSUA 3U2CA 2VWTA 1AK5A 2W9MA 2CXEA 1XBVA 4X9SA 3LXCA 3FXGA 4DWDA 3CYVA 4GXPA 5K9CA 3HB9A 2YFOA 2WW5A 1EUNA 5DXXA 1KB3A 4S2CA 3SRKA 2FVLA 3ES8A 3PULA 2V67A 5AVNA 3APYA 1KTBA 1QW7A 1TYGA 2X1RA 4B5NA 3K30A 3N9KA 4H9ZA 1OX6A 4E2VA 2XSAA 2RGMA 2ZRXA 4LB3A 2Y0FA 4QX4A 3A12A 3CMJA 4DJEC 1QNRA 4YJ5A 4DYEA 4IISA 1MWOA 1KC7A 4Q7NA 3KS5A 1B57A 2CWXA 1RAKA 3C0JA 4L4MA 3IGXA 3VIOA 1FWTA 1WE5A 3VD9A 4S3BA 1LG1A 5A6SA 1EBGA 1W1IE 3CQKA 3WLSA 1GYMA 1GUVA 4ACZB 4EAMA 6XIAA 2O4QA 2G8ZA 3AS0A 4QSFA 2XN0A 1H7RA 1IHIA 5DANA 3VCRA 2Z4GA 2DW7A 5FJPA 4QJ4B 2VGFA 3QC3A 2PF0A 4IMEA 1EGMA 1XUZA 2YDRA 4GBDA 3GLCA 5AECA 3R8HA 5JIPA 3VGHA 4MWAD 2PPGA 4DY1A 3LMZA 4BHYA 4LANA 4RK8A 2A2IA 2OLSA 3CM4A 3L0NA 4C7FA 3E3HA 2HEJA 3FEQA 4I8YA 4JTAA 1EWEA 4X63A 3MCMA 2X2GA 1OFPA 4BCEA 4DJDA 1OG6A 4CQBA 3DFYA 2CLOA 1A5OC 2D24A 3GFYA 4GACA 3NFUA 5DXYA 3MHGA 1KBJA 2EEXA 1JGMA 1MUCA 4FOKA 1S39A 3G8RA 1KKRA 2GVEA 1GVSA 4J3VA 4ZTXA 4AZIA 3M6DA 1K9EA 4KGJA 2YB4A 4WSKA 1W1VA 5LIYX 2QPUA 4GX9A 4GI9A 4CD8A 3WKZA 4XUGA 4C6MA 4WKHA 2YJQA 4XTIA 3SIZA 1RALA 2O4MA 2QDDA 2PWFA 2QCEA 4GA8A 5HWJA 4K37A 1B3WA 2I56A 2YR1A 3EOEA 4KRZA 1UWIA 5AN7A 1G4PA 1E1FA 4MY8A 3NYDA 5EY5A 4TTUA 2AKZA 5CZ0A 4C5ZA 4HU8A 1SJDA 4W87A 3IGSA 1M7OA 1A5LC 5DMYA 3PAOA 4OE7A 3UY7A 3HN3A 1RVGA 5A6AA 4EF9A 4LAMA 2FPYA 1EX5A 5LGXA 3MJYA 1WP6A 1GOIA 2V5JA 4LVBA 3ZOAA 4PZVA 3TOYA 4HNTA 1V03A 3RX3A 4LS2A 3QR3A 2R24A 2ZC1A 4NX0A 3B0XA 2BOFX 1WKEA 3CBWA 3TTYA 1DORA 3FHQA 1QI3A 1P4CA 1BTMA 2P10A 3B8SA 1S5NA 4EAYA 3A4AA 3RNDA 2ZRWA 1SGJA 5HMSA 1LUCB 1CLKA 4FXFA 1G5AA 2DSWA 1FA2A 4O0QA 2ISWA 2X16A 2CCRA 1DXEA 1VH7A 4UWMA 1EOKA 3R8RA 4E8DA 4XAPA 3VIKA 2NQJA 3R0UA 3S2JA 2C1GA 3A24A 1XFCA 3UWWA 1W6TA 3E0WA 4F0RA 5CC3A 3E5PA 2R1LA 1JD9A 5EMMA 5M03A 3IPWA 3OZPA 2CHRA 5H6HA 4GZIA 3CUHA 3AAMA 2WV8A 3LGDA 5JBEA 1M01A 1P0EA 4C1NB 1LLOA 2VVNA 1QI4A 4M7SA 3NZRA 1GCYA 2ZZ7A 2OT0A 4IP7A 1MDLA 2WSPA 3MVTA 1H63A 1GTHA 2CPUA 3RCYA 3I7RA 2GLKA 5D9PA 2ANUA 4WK9A 2YLAA 2BHUA 1OC7A 3WFZA 4V15A 1SVDA 3EX4A 3EZ4A 2B4GA 3O63A 4UTWC 4IIFA 4HCHA 2A7RA 1PJ9A 4IT1A 4DLMA 1OIFA 3GHRA 3LGGA 4HQVA 4LH8A 1KA9F 4TUFA 4QS6A 4X9YA 1DJIA 3LI0A 4GCXA 2BVTA 2AL1A 3MUAA 3MO4A 2VFIA 2PDGA 2V3GA 4IJRA 3T8LA 4FR6A 1YNPA 4D6FA 1F73A 4HTBA 3LPPA 1Q45A 3E02A 2GK1A 2R14A 4ZE4A 4LV9A 2HBXA 2QV5A 4LUYA 5CJMA 3ATZA 2R1KA 4BQ5A 5KETA 4JL1A 3NO3A 2W0UA 4RW3A 3EDFA 3CQHA 4ADSA 3NIYA 9XIMA 1HKWA 3M7SA 1PUDA 3VCCA 3R43A 1DIKA 4Z42C 4DUWA 5LIXX 1TZ7A 2X2YA 1ZCCA 3MKCA 3S9IA 3VCNA 1PTDA 2Z2UA 3TKFA 3WQPA 1E0VA 3VNMA 3WN6A 3S5OA 1PWLA 3STEA 3CWNA 1VIWA 3QQWA 3M5VA 3DG6A 3POHA 4A8IA 3NJ3A 2DVXA 1K8ZA 4JGDA 3B40A 2FGBA 4TTGA 4OV9A 3C2RA 3LK6A 1WA3A 1PTGA 5CSYA 4XAGA 4DJFC 1VIZA 4Q3MA 1FH9A 3M0IA 4FR1A 4JR5A 1UD6A 5HOSA 2VC9A 3LBCA 1UWSA 3W7RA 3D47A 2J7EA 1XUUA 1PZ1A 3FGCB 3T4CA 3OIXA 5A94A 3AXIA 3ITTA 4PCFA 4E3TA 3HQPA 1R38A 4G9PA 1GVOA 1XGZA 5G2HA 1V08A 3H55A 1S3HA 2EO7A 1FKWA 3ZT5A 1NVMA 3BO9A 1HIZA 2ATSA 2HTMA 1V3LA 3OA3A 2HS8A 3LV5A 1DEDA 2QCDB 5JUVA 1L6WA 2J7HA 2PDKA 5A6BA 3VIFA 4DHGA 4OT7A 2F6UA 3KRBA 5LNRA 4GYPC 3WDJA 4REQA 5A6JA 3D3FA 4IPPA 1BKHA 1J4EA 4UTMA 1TIMA 3THCA 1EF3A 4GZ7A 3L4UA 5BROA 1B2YA 3NXFA 4JIRA 1WZMA 4KF1A 2VC6A 3W22A 2HNHA 1FDJA 4XB3A 3L12A 1M7PA 3MI2A 2Z2BA 3OYXA 3R12A 3W87A 4Z2IA 3G0XA 1M03A 4KEMA 3H2CA 1JCTA 3LSBA 2ACSA 4LY8A 3QW4B 1HKJA 3ENLA 5CH9A 5LHFA 1P6WA 4QDPA 5FF7A 4PB5A 1GPWA 3MC5A 5MF5A 2PURA 4B5WA 1E9ZB 4NJGA 1E4NA 1R9XA 1T40A 5EA9A 4QNEA 3AXKA 3T2QA 4EWND 4AZ5A 1TWDA 1OZMA 4PMUA 1UASA 3IACA 3HQOA 4GFIA 1IXOA 3T0TA 2DIJA 4JD4A 1BXCA 1XS2A 5AYBA 5IBXA 2PDYA 1GEHA 4IHCA 1B0IA 5AC7A 1IEXA 1XQKA 3DFTA 3AXHA 1YMYA 1YXDA 3NXLA 4HOWA 4HHHA 4O54A 1S2TA 1UIPA 3CUZA 5BW6A 4A22A 3E74A 3RR4A 5DBUA 3W1MA 1UH4A 3QW3A 3RGTA 1OCNA 2FPVA 1FWCC 5DELA 4NP7A 1S2WA 2VRQA 3P7YA 1AD4A 1R47A 4Z2JA 2E5CA 3TZNA 1LJYA 4LXFA 1FP8A 4AWEA 3RCMA 3AIVA 4QR6A 3W7CA 1K3UA 3EB3A 1UKOA 1XD1A 2VZSA 2V3DA 3L4YA 3W72A 5KZMA 5HQMA 4W93A 3DI1A 3HV9A 4V28A 1M6JA 4GGHA 3GU1A 3A21A 2FHCA 3GDTA 4O16A 1VPQA 2C1IA 1HKIA 4ZO9A 3SQMA 1YBQB 2NX1A 4WF7A 3WG6A 2WCSA 4IGMA 1UZ1A 4BEQA 2OOFA 3W3OA 4YTTA 3LCHA 3HMCA 4B5XA 1MI3A 1JDDA 1F05A 1KGXA 3MHUA 3KDOA 2Y63A 3ITLA 5EBUA 4F48A 3HV8A 4AVNA 3S5ZA 4WGHA 2BHZA 1LTDA 2Y62A 3C2YA 1R85A 1N8WA 3G6MA 3CQIA 1VAHA 3MI3A 3GXFA 3IVSA 4IGSA 4OUIA 5IDZA 3KCLA 1SZEA 4M1RA 5C0QA 1QPOA 4N9DA 2CXGA 3LHWA 3VKJA 2VX5A 3DH7A 1LORA 3WO8A 2QF7A 1GVRA 3NA8A 1E5JA 4KBXA 4ONVA 4NAEB 4FNUA 3HPXA 3TYAA 4H9YA 1A5BA 3OG2A 3U2OA 1HJVA 4QCFA 2GUYA 4ZO8A 3AU2A 3GH5A 1K77A 4YIWA 2PF8A 4JHOA 1KD0A 2PDMA 1Y0EA 1U5JA 2BODX 3EEZA 5C8BB 1VP5A 4JN6A 2VD8A 1D7FA 5LIUX 1DJNA 5CPTA 2VFDA 5ABFA 4YLWA 4GE8A 1TKKA 2TPSA 4UNLA 4GXMA 1JZ6A 1OGSA 3CZKA 3IUHA 1S1PA 1Z32X 3NQDA 4QE1A 1VRXA 3S1WA 4UQDA 1P1MA 3GK0A 2ZFAA 4FO4A 3RM4A 2QT3A 3IAQA 3N9RA 4Q7BA 5EMYA 2WKJA 3O9NA 1ME8A 2DZXA 4JIIX 4LS1A 4JXCA 1ITXA 2WHMA 3UGRA 3GTXA 2WJFA 1XLHA 2WJZA 3I4EA 2GOKA 4O0ZA 1EJ7L 4XBKA 1MSSA 3LLDA 3NZPA 3F2DA 4Z1AA 1CGVA 5KITA 3WBYA 4RPPA 3LHZA 3VI2A 2HBVA 3VUPA 5DX7A 2ASHA 3PZGA 1ELSA 4Y7EA 1JPMA 3KBMA 3LM3A 3W6MA 2IKGA 4UIOA 2CBVA 2HZGA 1XIBA 4B9YA 1WO2A 3AC0A 1G94A 1FWWA 4QLLA 1G6CA 3DBNA 1XLGA 3S47A 2POZA 3M0LA 2NZLA 3W1NA 1O6IA 4RV3A 3ABQA 2INEA 1OYAA 4B15A 1KM2A 3VYLA 1HKVA 2JBMA 1MQRA 4HMEA 3USZA 2X40A 3BW4A 1QW8A 2TMDA 3KBSA 2CITA 2OYKA 2E68A 1HZYA 2HPIA 3N14A 1G0CA 5C6MA 1YPXA 3C2OA 4LUJA 3ZR4A 4HPJA 4KRTA 1WAUA 3VMNA 3L2MA 5LA1A 3WDPP 1T99A 2Z7GA 4IQLA 4X22A 4C1KA 4C1LA 3P0XA 3A64A 4PUKA 3TLLA 3CMGA 4CNTA 1LBMA 1KBIA 4C6FA 3AIUA 4X3ZA 2DY3A 4L1GA 3NG3A 1EIBA 2DT1A 1VLWA 3CUJA 4UQEA 3VIIA 3W71A 3OLIA 3O8AA 4DJFA 1AQHA 2J25A 5KMYA 3MSGA 2FZDA 2Q6ZA 3PJTA 4JHMA 2E77A 3QLDA 3QV8A 1VBRA 4PCPA 3W02A 1K9FA 2DQXA 1MNSA 1PZ3A 2J62A 1RJRA 1DHKA 4K1WA 3UEQA 2OODA 2PDWA 4WUIA 2Q02A 2V30A 2WMJA 2GGEA 5ECUA 1KWKA 1NF0A 1TSIA 3DHPA 1N8IA 2W67A 5I3FA 3TQKA 2GSHA 2J13A 5C70A 3VE7A 3NQVA 5LNUA 2IW0A 2DP3A 2ZUVA 3ABOA 4ZVJA 4BF9A 1SMAA 4G56A 4D6CA 4D1JA 3FVDA 1TIWA 4U4MA 4DM1A 1TWIA 4L9YA 3RU6A 3FDGA 1M9HA 3P74A 1H4PA 4Z2LA 4AIEA 1A49A 2QCLA 3GIPA 5I3HA 2Y2WA 1JYXA 2DSVA 3WH9A 1JDAA 3L5LA 4BWLC 3FA5A 4LSBA 5H8MA 1QBAA 1ME9A 1BRLA 4MDOA 4UTUA 4NASA 4XZ9A 3SDOA 5FKYA 3CL7A 1XIGA 3P80A 1PHQA 2OG9A 4LY4A 3KBNA 3QSRA 5EB8A 2D2JA 5CLWA 3MB9A 1W1A1 4XD6A 2OZ3A 1QNPA 3L66A 5E93A 3JS3A 1K6AA 1IXNA 1VCFA 3FDKA 3DDMA 1HUVA 3UWUA 4LRSA 1I2RA 4L65A 2NQ5A 1OABA 5AKQA 4F0HA 3AHZA 2I9UA 2Q3RA 1PCWA 3C5QA 3XINA 1BG9A 2GJLA 3MUZ1 4PTDA 5FF4A 2REQB 4W8LA 4H41A 2H90A 3M47A 3BOLA 3IJ8A 3H4WA 1NSJA 1LUCA 4OVXA 3DKJA 3H8AA 5D8WA 1POKA 2NSOA 4PULA 3DG3A 4I8DA 1TV3A 4W4QA 4PH6A 3NNTA 2HV5A 3B8VA 1AFSA 2YKKA 3QVQA 3W26A 3W00A 1OZQA 3MSDA 4CKQA 4O11A 1ZAJA 3LPFA 3V36A 4J3ZA 4EXQA 1LT8A 2Z1XA 3UJRA 3ZXWA 2Z1VA 4PMNA 4RZ6A 1SM9A 3TROA 2GSJA 5F2MA 3LSCA 2VUYA 2R8WA 4C1NA 4CN4A 4HD5A 3A9IA 4HTYA 2QJJA 3GXTA 4Q4PA 1KNWA 2YGYA 3M9YA 2B7OA 3SJNA 3KXQA 1BYBA 3I68A 1VHNA 1PO9A 1C8QA 1ONWA 4LOCA 3BZJA 2DUAA 1BPLB 5K9XA 1WBHA 3WLNA 1XLEA 1EJSC 5A8MA 2QIWA 3GUWA 4G6CA 1KGUA 1TPUA 2E67A 4CEXC 4U10A 3FA4A 4FXJA 3VMPA 1NEYA 1ZALA 3HIJA 4AF0B 2MANA 4MUPA 4ICMA 1W0MA 2GDUA 1J0HA 1PYFA 4GI8A 3EDEA 3FJ4A 3EB2A 1GHSA 1VKFA 4H8UA 4FXRA 3W88A 2J8TA 1DIOA 1DXIA 1FDYA 5DY3A 1I2QA 1A5UA 1AVAA 3AHXA 2PGRA 3R0DA 3HGJA 5GNYA 4PMOA 3QSTA 5U4NA 3D46A 1ZBCA 3M44A 1F6YA 2IS7A 3FJ6A 3JZUA 5DT5A 1TB3A 4PMRA 4L80A 4ERGA 3QHOA 1V0KA 3TA9A 1TUXA 1PHWA 5AYXA 1EPVA 2VR4A 2YBTA 5D9MA 2V6AA 3B05A 1QWGA 3QEZA 1SFTA 2OELA 4CVWA 3LMYA 3OP2A 5HDRA 5PTDA 4A4AA 2V2HA 2ODOA 3NOEA 2PMQA 4UTFA 3AJ7A 1OK6A 3QTGA 3CUXA 1WCGA 1K03A 1J10A 4D6DA 3MP3A 1H5VA 4UFKA 3P8JA 3LYEA 4AZCA 4CD4A 4JTIA 3RO8A 1GYNA 3UPBA 3PBGA 4QFUA 4AG0A 3UY8A 4GI4A 2QVNA 3C3UA 5HINA 1G7UA 1MZRA 2H8XA 4KEUA 3VNKA 3VOGA 3FAWA 1E6NA 4V33A 4LTSA 2TAAA 4NZ5A 1KXVA 4U2YA 4W85A 3IANA 4N0RA 3SFKA 4XZMX 3SUVA 3VNYA 1FY6A 1JD7A 5CG7A 2A3EA 3FGCA 3UYCA 2VYOA 3RRAA 2BWGA 3ZFHA 4DO6A 3GG8A 3EMZA 4WGXA 1X7IA 2X05A 3UZYA 4YNGA 3UW6A 4RDWA 4QJ3B 2GGHA 4DO4A 2X0HA 2CHNA 1ALDA 2PDFA 1M65A 2PC4A 1V3KA 4O1BA 4R3UA 4YHGA 5I24A 4UUIA 3LTSA 1H5YA 2QCDA 4HJWA 3S4TA 4FLOA 3G8EA 4WSHA 3TUUA 4IOTA 3RMEA 1BSLA 2ZVRA 1W32A 1RV8A 1XP3A 2HJPA 2C8NA 3OGSA 3EMCA 1QO2A 1ADSA 4UCGA 1QPKA 2BY2A 3ONBA 3VNIA 4A3QA 4CN6A 4NQ1A 4QNWA 3FAXA 1JF5A 3IIVA 3QPYA 4K8HA 1PE1A 2I5GA 1XICA 4F4RA 2RDTA 1RVKA 4MWAB 4XD3A 4JY8A 1NWSA 1WB0A 4E2BA 1HNYA 3IV8A 3N19B 1UR1A 4CU6A 2GQAA 2UWFA 4JIPA 4AHOA 4DPPA 1DJGA 2NT0A 4JNZA 1QVBA 1F6PA 1FCVA 1GNXA 2XIBA 3OTRA 4JTEA 1OBAA 1NF7A 5F7UA 2ISFA 4NZ1A 2INFA 4RDVA 4GRSA 4EWJA 1P0DA 4RNHA 1DPMA 3W1XA 3BMVA 3G18A 1KQZA 1L9WA 3GO2A 1WZAA 4NZJA 3GH7A 3TA6A 5D33A 4EPEC 2XVKA 3FSTA 1CCWB 4AYSA 2DZAA 1TX2A 1RK5A 3MUIA 5CC5A 3MMUA 4Q4QA 4MSSA 3VD4A 1FH7A 1BYCA 1GPFA 1EHNA 3N4EA 4AIBA 1KFEA 2OU4A 4GOAA 4AXNA 5C5YA 3G1RA 5LNVA 2V5DA 3L4VA 1I8JA 1GOOA 3A3WA 3LS9A 4S1FA 1XDLA 3GTHA 3F2BA 1WOBA 4A6GA 3GW0A 4Q4SA 1UKPA 4FAMA 4K1GA 3PJUA 4Z0SA 3U6WA 3G1XA 5IHRA 3EX2A 2QJNA 2FVMA 4JS3A 1I2PA 2CBIA 4A3HA 1WZKA 1IR1A 4OBTA 2BP1A 3WDQA 2KZHA 3PBMA 3TIMA 4Z17A 1SZFA 3V75A 5KTLA 4EP8C 3MQTA 1J93A 4BWLA 3ITXA 4BR1A 3L21A 1V93A 1WAWA 4GJIA 2D2HA 1WV2A 1UD8A 5A8NA 1A5CA 2JK2A 3D0CA 5C9WA 4U3CA 2V2DA 4DRSA 2J7GA 4AXKA 3W37A 1KM6A 3IARA 1ML1A 1IV8A 2E6FA 5D8ZA 1OHLA 2E3ZA 3WLHA 4LU0A 1O60A 1HT6A 3P84A 5BYWA 2JF6A 1H51A 3G1SA 3ZT7A 2C13A 3GNXA 2FQIA 4XAYA 3H6OA 4DF2A 2J75A 1DWIM 3TQPA 1D2KA 4FNQA 2OXNA 2WJDA 4K8GA 3VGBA 1XDJA 2V38A 2MNRA 1GOXA 1SO5A 5A6TC 5D38A 1KM4A 5HNRA 3QH2A 3TH6A 2ZZ1A 1OCJA 4RE3A 4CQCA 4NG3A 3ABSA 3QM3A 3GVWA 2WPBA 3GXIA 4U31A 4UTIA 7REQB 1B3XA 2BX7A 3W25A 1LBFA 1WDWA 3VDAA 4I7VA 4H4IA 1VJZA 2WMIA 8XIMA 1P0KA 1V79A 2D23A 3VNDA 3GHTA 2C0AA 3NDZA 4D8LA 2BNJA 1B54A 3PZOA 3I7QA 1YDVA 1QHOA 4WHBA 4Q6XA 1E1CB 2VI0A 3RLUA 2QDEA 3GXMA 4Q6JA 4C6IA 5C71A 3KZSA 1AZ1A 1OJXA 1QMLA 3H2FA 1W2PA 1PAMA 4UZSA 4CCEA 1E40A 5CPSA 4HGXA 4H6EA 5I09A 4GLEA 4XIMA 5ABGA 2EPOA 1GQNA 1Q6EA 1UWQA 1KXQA 3C2EA 3WLQA 1H7XA 3RJXA 4TVDA 4POCA 2D20A 2GZXA 1M7JA 2QCNA 3CH9A 3CTLA 2R9RA 3KAOA 3K13A 2GVYA 3H2MA 3URNA 1THFD 4ZENA 1TVLA 1Q6QA 2Y24A 1TRIA 2JKAA 2J9ZA 2VWSA 1NY1A 3DERA 1QUMA 3A13A 3IK2A 4HSOA 3DECA 1IEIA 2GJPA 4PCSA 2EQDA 5CPQA 2DSKA 1IGSA 4QSHA 2YBUA 4C60A 3KRSA 2Y7EA 1KW1A 1AL7A 4W86A 5LYRA 1VRDA 1SJAA 2I5QA 1XXXA 4JYDA 3EA2A 1GG0A 4QG9A 1OD8A 3TONA 3VABA 1OX5A 4LUTB 3GXNA 4UMAA 1E6PA 1S1RA 4DYJA 2O92A 6REQB 3LGEA 1V0LA 4PUUA 2QGHA 2YDSA 2ZRZA 3FV9A 3T1GA 3WBAA 4UR8A 5AVHA 5G2IA 3U8GA 3AIRA 3R1ZA 3VIJA 1OFOA 3IEBA 1DIEA 5EMUA 3OODA 3VDGA 1IZJA 3T7VA 1TG7A 4Q8UA 5D2VA 1XCFA 2FB2A 1F3WA 3SCUA 3WJXA 1DWHM 1I75A 4NT0A 1X38A 4IMGA 3TX9A 2GVLA 1R3SA 4TIMA 4D6IA 2PU1A 2XGIA 1U1UA 1F9CA 3TYZA 5LNWA 4RE4A 3ALFA 3M7WA 3LHYA 5BNKA 3C4UA 3RMJA 1AW1A 1P0BA 3THDA 3CV2A 5CBJA 2EPHA 1FWGC 2Y8VA 3CV6A 3WF3A 4O52A 1W1PA 1XYMA 4HPNA 4B90A 2XHYA 1R3TA 2E7FA 2WKLA 1V7AA 3E2RA 3LPOA 4R88A 3T0CA 3WQDA 3QFWA 3W7HA 3MY9A 3LU2A 3OQEA 2C91A 1N7KA 1PIFA 2EAWA 5MKGB 2HDJA 2VQTA 4ALDA 3B8TA 2C6QA 2VGGA 2E0PA 5HNUA 3KS6A 1FHVA 3W70A 3PSVA 3W2LA 1R2SA 3RN6A 3DN5A 1FWSA 3V1HA 1Y65A 3UZJA 4KESA 3TK7A 2A21A 1UQYA 2ON3A 4FB7A 4PFMA 1S2CA 1XQLA 3NQFA 3WDRA 2QPSA 3URQA 5A2AA 3W7GA 4HCDA 2F38A 2R91A 4L61A 3B9AA 2Z2AA 1WDDA 3O0KA 3MW7A 4MFDA 3W75A 3KOYA 2BXYA 3QZAA 1JQVA 1U83A 3CJPA 2DJXA 1DJXA 1XIFA 5LA0A 1FP9A 4HMCA 2P50A 3MUXA 2P0OA 3UPWA 3RXZA 2D0HA 2WSYA 4JTHA 3O6YX 1EX1A 1FBAA 3AICA 4MM1A 4PL2A 1JJKA 1TZ9A 3FCPA 5T91A 5BU9A 4GVHA 2FGLA 5I03A 3LHVA 4JTRA 2VEIA 2NV9A 3KOFA 3TW7A 4M1BA 3HJZA 3I3DA 2INZA 2BZNA 2AL2B 1RQBA 2EG8A 1QO5A 3C6CA 4EE9A 1B90A 2DZUA 3KHDA 1QNQA 1W8GA 3TSMA 2ZX8A 2E5BA 5A8GA 1WDQA 4OTKA 3P5ZA 2DT0A 3BLDA 3PUEA 4B2DA 3ZLGA 2V5LA 6TAAA 4RKAA 1YDOA 2ESCA 3K46A 3WK3A 1RUSA 3CHEA 4QAIA 4K2SA 3M46A 1A80A 5JH2A 1XM3A 4IFRA 3SUUA 1NOWA 3TXZA 4ACYA 5IM51 3QLLA 1B9ZA 3WMCA 3N3MA 5FEZA 1S5VA 3TC3A 4Y9NA 3MMTA 1CX9A 1C8XA 3KL0A 3UZXA 2C79A 3E0VA 4C65A 1R8LA 3W2KA 4I7WA 4HNVA 4XBJA 4AF0A 1ITUA 3NPWA 3N04A 2W91A 2PB1A 5AC5A 3WK1A 1FVPA 3EXRA 1IEVA 3WF2A 4BJHA 1X6NA 3WMBA 3CIWA 2ZXDA 2CZDA 2VKZG 4DAIA 1XW8A 1O12A 3TJIA 2ZC8A 3NQGA 4H8HA 3NR0A 3OQ8A 1OQFA 4K7YA 4LUSB 1SQ7A 2DT2A 1HJQA 1Y5XA 5D09A 2A7NA 1PKMA 1A5NC 4MIMA 4JNYA 1ZSXA 2GVJA 3R10A 1DWJM 3WQCA 5K2ZA 4QBXA 5J8LA 4H04A 4TX8A 2PDXA 2F2HA 2Z1WA 3CEUA 1XLKA 3M1ZA 1ZJHA 3L2LA 5FF2A 4UQ9A 2A3HA 1K9TA 4QDMA 4C6BA 2RJHA 3U5UA 4DLFA 3SCPA 1QI5A 3CL8A 3PP7A 2I7GA 1IWBA 2EJAA 5FIPA 3GKFA 3VX1A 2RKXA 3QRHA 3E0IA 1OSEA 1XIJA 4W8BA 3PWIA 4D8ZA 3ZO9A 2J8FA 1NH6A 2ZCGA 1AMYA 3OLGA 2W79A 4ROQA 1JI1A 4RZ4A 3GVVA 3PTMA 1OT2A 2J74A 3L65A 1YRRA 4BQ4A 4QP0A 4DAFA 3UJSA 3RR1A 3EXTA 4URIA 3G3MA 1QNSA 4ZQRA 2MUCA 2OJPA 3R94A 2QCHA 3LB0A 1EEXA 3SQSA 1K8XA 3GVRA 3KTXA 2OX1A 1BTCA 3WLLA 5IRPA 5TNVA 3TVAA 1W1TA 2PZNA 1RD6A 3QV9A 1JZ3A 3T8QA 4G7EA 3W28A 1EIXA 2ZUNA 3WK2A 4AEFA 3W85A 4C6QA 3CUIA 5C2GA 2CNCA 5AHEA 1TFVA 5BWAA 1J8VA 1LQAA 5FESA 1HJUA 2B31A 4UMCA 1CLXA 3FN9A 1WNOA 4MVAA 4N42A 3C0LA 3B8DA 2BLEA 1H09A 3CPRA 4KRUA 4GY7A 2C71A 2O56A 4JTGA 3VC6A 5F2LA 3W1RA 1QATA 2XN1A 3B4YA 3DHUA 1T8XA 4A8RA 4WXZA 4MWAE 4JTFA 4NU7A 4IGHA 1H49A 2HK1A 1O95A 1TPDA 2NUXA 2PI6A 1KM3A 4QCEA 4GG9A 1OK4A 4J9JA 2WVTA 5JIWA 1Q5MA 3AMKA 4YVXA 4KQNA 3GVGA 1XLAA 2X09A 4TVCA 1BVZA 1Z48A 1SW0A 1OF6A 3CPUA 1QOQA 4M81A 4MWAA 3VXGA 5C9XA 1UMLA 2VEGA 4XZLX 2FHBA 3OPSA 2WSQA 4AHQA 3VKBA 2D22A 3U3HA 2QQ6A 2ACUA 4YYFA 1CYGA 3UWVA 4B3LA 1RPKA 3TCEA 4UCFA 1ITQA 1YNYA 3M0MA 1TPC1 4HZ8A 3WUBA 5BMXA 2PTXA 3QPZA 5EL1A 3VVGA 2PDBA 4KFNA 3R8GA 2GUUA 4E5TA 5B80A 2VX6A 4Q8PA 4R7OA 2WWDA 3NQBA 2V69A 1VQTA 3K8KA 4HZ7A 4UMBA 3V1PA 1WUEA 1I60A 2PWEA 6ALDA 2VEPA 1UR2A 1KR0A 1W9VA 4WRHA 1IGWA 1KXTA 4ICCX 5K4XA 2FZMA 4RLIA 1RA5A 3BH4A 3O6AA 4KCUA 3DGBA 1TR1A 4HB7A 4GUJA 1UYQA 2J4GA 1OC6A 3GBDA 2OX4A 4U28A 4FMVA 1RP8A 1W3LA 4IIBA 2E5DA 1LLWA 3VDBA 4BQ3A 2CESA 2ISSA 2PLCA 5C2CA 2XIOA 2UY3A 2OQYA 4PE8A 3JU2A 2ZZ5A 4ML9A 1XJBA 2Q3OA 3ZT6A 4XKYB 2XZ9A 4MJZA 4GYJA 3CU2A 4P8VA 5G4WA 1KV5A 4IIGA 5IFPA 1Q6OA 2RDUA 4B16A 5C9ZA 3IVUA 2WOQA 3DFHA 1BLIA 4CU8A 5E0FA 1K70A 2ZTKA 4W7WA 1JCNA 5CSSA 4XZNX 3KHJA 4RZBA 3C2VA 1K7XA 2D1ZA 4HA4A 4GCAA 4FA3A 2CHOA 1UZ4A 2V5BA 3AZRA 4EPDC 3PZUA 5BCAA 2YXXA 2FB3A 1Z3NA 2NWSA 4H83A 2WZMA 4HK5A 3IGHX 3M64A 4MNKA 4JTCA 1RXOB 4L64A 1V6VA 4JN7A 4Y9AA 4PMJA 4KERA 1P7TA 1QR7A 2WCGA 2GFTA 3TJ4A 3AISA 3MV11 3W6LA 3W83A 1DWFM 2YIHA 1ODZA 4LAKA 4XD4A 3EGJA 5E1QA 1EOMA 5HUOA 1UKSA 2GDQA 2XVPA 3DUGA 3QKZA 2WPGA 8RUCA 3T4WA 3WJYA 1VYRA 3HQNA 3A4JA 2WANA 1XG3A 4KMQA 5LHEA 1OFEA 1C90A 3ARRA 2HK0A 4AIOA 1KCZA 4JDYA 1OD0A 4AEEA 3OJGA 3PHAA 3OA5A 2A1YA 2PDPA 2D0FA 4M80A 4H6QA 3N15A 4J2PA 3UP8A 1AJ2A 2BGQA 1ZPTA 3W81A 1F3TA 2XGBA 4DWSD 2RH9A 3OW1A 1XSKA 3EWCA 2TYSA 2PDCA 5CZSA 4QM1A 1E1CA 2WVSA 4BY3A 4B4FA 4ZO7A 1ZJBA 2PA6A 4P8XA 3MYPA 4NZCA 3VD5A 2GOUA 1OIMA 4ROPA 3S3GA 1XIDA 2YDAA 2G96A 2QJMA 2VEKA 4L4PA 3UG3A 1OGGA 3FS2A 3N73A 3LXAA 4XTDA 5LGZA 1XIMA 2OQHA 4A3UA 3Q4DA 3UA4A 2PLJA 2XFWA 1AW5A 1HG3A 4AY7A 2W5FA 2XISA 3DESA 4XSLA 3H7VA 3TN5A 1YW1A 2VEMA 4TOQA 2OOGA 5JXQA 3EPOA 3EKZA 1UROA 1TZZA 1OY0A 3U7BA 4YVPA 5H91A 3L4TA 4XBSA 2ZKMX 3MJMA 1UKTA 1JNDA 1YDNA 1GQIA 1JI2A 4PUDA 3AXMA 2QF8A 2YCIX 3GTFA 2WKGA 4DJED 1TE6A 3HPAA 1XLJA 3I7SA 2A4AA 1KM5A 1AJZA 3OHIA 4B3KA 1PIIA 4L9ZA 3U2ZA 1H1YA 4TXEA 4YTSA 6REQA 2ISVA 3QGAC 4AVOA 4UOJA 4S2BA 4R9XA 1GWJA 4IP5A 3TNBA 3CHFA 3EBVA 1DWAM 1AQ0A 4RZ5A 4DJDC 3WLIA 3W7JA 5CZTA 4MFEA 1JEZA 4PMVA 2DUZA 3IK4A 3MSRA 1U5VA 4Z08A 1PKYA 1T5AA 4FLRA 2QW5A 2V68A 3WUGA 3TYDA 2DZSA 3H54A 3RM9A 1VZWA 3AU6A 1XFBA 2FKPA 3CTTA 3OZMA 5CEWA 1E3XA 1NQ6A 2VGIA 2PP0A 3PZ9A 4GIRA 2QUUA 3V5FA 1YLVA 4O50A 4NJJA 2A0NA 3M41A 3W82A 4KS0A 1XYAA 3GHSA 2BSLA 1LWIA 2YCLA 4HZ6A 1E3ZA 1IYXA 3G1DA 2BXZA 3VIHA 1OCQA 4HPGA 1Q7ZA 3VD7A 3OOQA 1JAKA 3O15A 5IDIA 2DZTA 3MKKA 1R3RA 3H23A 3BAKA 4HNLA 1D3CA 2Y7DA 2GJRA 4U33A 4DXVA 1Z8AA 3NQCA 1YX1A 4RJEA 5MKGA 4J7RA 3BSMA 3W7MA 5A6MA 3DYMA 1LL6A 3BAXA 3CHVA 3NEVA 2GYIA 1G69A 4N6EA 4E6MA 4F0KA 3CAWA 1RHCA 3CWHA 4CD5A 1GTEA 1KFLA 1NAL1 1GQKA 3ZLHA 3WJZA 2WB5A 3BLOA 5I02A 1AH0A 3WQEA 1XF0A 2QUNA 1PPIA 3N2MA 1S3TC 3NL3A 3CYJA 2XWEA 4N9EA 4JQ3A 1K6WA 5HJXA 3LN3A 2WMHA 1ONEA 5L6UA 3LLXA 4H6RA 3SAZA 3NL2A 2OO6A 4IIEA 3UCDA 5I00A 4MB1A 5J5DA 4P7LA 5G4EA 2O7SA 2QVHA 3OHMB 1SSGA 2W63A 1AD1A 4ATDA 4YWIA 1KFBA 5HJYA 3JZEA 2PDQA 1XD0A 3PJXA 1JPIA 5JVLA 3SGZA 2Y85A 2AKMA 4J3WA 1JNEA 1V51A 3WENA 1XH2A 1JCMP 1JAEA 3WCZA 3KWSA 1ECEA 1VJIA 4IUGA 1XIHA 1CZ1A 3VK5A 1U2YA 2HMCA 4JIQA 1OADA 3TSBA 2G3IA 3UXKA 4CEUC 2ZX7A 1UUQA 4UNIA 4GBUA 1ISXA 4AWSA 3ANUA 4CD6A 3VE9A 3T05A 3PG8A 4F79A 4Q8TA 4C90A 1O4UA 1Q66A 4CCZA 1XH0A 1EJXC 2X1TA 4IUOA 4PC8A 1TV2A 3S2LA 4RXFA 3ARWA 4E2DA 3A23A 1EB3A 2P1FA 2JFEX 3O06A 2V63A 4YHEA 3WUFA 1FCBA 3AQUA 3EOOA 4S3DA 2CW6A 3V5OA 4O13A 3BLKA 2C19A 3G1VA 2ZRYA 5BRBA 1JZ4A 2JEQA 1IXPA 1KLYA 1CB7B 4YCOA 3REQB 3M6YA 2FZ8A 3S6TA 1BEUA 1E1EA 4YYCA 3NZGA 5EFDA 1ZS2A 2O7QA 2YZ5A 4L56A 2XSBA 4UTTC 1POJA 1RP9A 1Q2RA 4P7NA 1V6YA 1YIXA 3G6LA 2ZZ2A 4UFLA 3PSWA 4N2YA 1X8CA 1CXKA 4WDXA 3ZVHB 2YX0A 3VZYA 1Q85A 1FH8A 4NVTA 2IQDA 4ML4A 3HG2A 3R0KA 1K4HA 3TYUA 4D6GA 4DN1A 4OKDA 2WSRA 4Y2WA 2FH6A 4OOZA 2PRMA 3DFSA 3WMLA 3DHDA 4LUSA 5D32A 1UP3A 5D2YA 5A5WA 3VNLA 4A05A 1D8CA 5D37A 4ATLA 1TV8A 1GZJA 4X60A 2NVDA 2PU0A 4QLKA 2YL8A 3BLLA 1E4MM 3Q65A 5G1YA 3KL3A 3LRKA 3RRXA 4AFYA 4W7VA 2R82A 4L5ZA 2PGFA 2YW4A 4QIUA 1X6UA 2F9RA 3ERPA 3WBEA 4LUIA 2AQOA 4YTQA 3KBWA 4GINA 3CNYA 4ZQOA 2UY4A 3W27A 2WNQA 2ZYFA 2CEQA 2XIIA 4FSAA 4E3VA 4WXYA 1VBJA 5C7HA 2DW6A 1KRMA 4F2TA 3H12A 4RW5A 3U9IA 4NRSA 3IIXA 1Q63A 2YL9A 2Q71A 1UD3A 3PF3A 3ZVIA 2XH2A 4CVUA 5A2BA 3K8LA 1R3VA 3WLJA 1UBPC 3LLFA 1T8QA 4ZXLA 2EG6A 4I90A 4P7OA 3DC8A 3QV7A 3W1LA 2WBGA 4RNJA 3GNPA 4GKTA 3B9NA 4GMEA 2CZEA 2PWVA 3SN4A 3TNOA 1UUMA 4E8CA 4IWWA 1XGEA 4UOZA 5F4XA 1G4EA 1VEOA 5HR6A 3BE7A 5A8PA 1Q13A 4DEFA 1GVYA 2D69A 2VZOA 2WYSA 1UWAA 5E6YA 4ASTA 3AWNA 5FAJA 2HE8A 3VILA 4FIQA 3FIGA 1QPRA 2JE8A 3UJ2A 3O05A 5DMNA 4AWUA 1IIGA 3L5AA 4GO9A 3S8HA 1LG2A 3BGAA 2Z26A 1BG4A 1X96A 3T81A 1JZ8A 3GG1A 3HFTA 4PRTA 1CXIA 5D03A 3NSXA 3P2VA 4QHRA 4W5ZA 3B8IA 4IICA 2EF9A 3WFLA 3GX9A 4A3RA 2UZ9A 1PIGA 3DGRA 1OWQA 1AA1B 2HXUA 3HOJA 2PS2A 3MBFA 4Q4MA 3I6EA 5EGRA 1SZNA 2HE5A 4O1FA 1JXKA 3EDJA 4MHBA 3BSGA 2CLPA 4XZBA 4WR3A 1JYNA 1F8MA 4MZ1A 1TCDA 4EPBC 4O57A 5CAKA 2XH4A 4HT3A 3STCA 1U1JA 1B3OA 5B7YA 1CENA 3VU2A 5IBXC 3BW2A 5DRIA 3U4FA 1KTCA 4HN8A 1W5QA 4OWGA 3RPDA 3VFLA 2J9YA 1UR0A 3WNKA 2PODA 4F66A 4US5D 1KLZA 3M0ZA 2V5KA 3SO7A 5JMUA 3PUDA 3K4WA 5D2WA 1RA0A 3GXDA 1HJXA 3OBEA 3S42A 4Z0JA 5F1VA 3HZ3A 1XLMA 2Z1KA 3PBWA 1ZQ5A 1HO1A 3A47A 4C6NA 3GDKA 4HYWA 4AZ6A 4F0SA 2R94A 4MJ4A 1TPH1 2ADAA 4PTWA 2V82A 1US0A 2RGLA 3B3DA 3AALA 1TE1A 1VENA 2GJNA 3ZIZA 2OLHA 4GVGA 3P82A 3AMCA 1RQHA 5FL1A 1E6SM 4NY2A 1KBLA 4ZB0A 3IGUA 2OSYA 5HXMA 1TVNA 4EKJA 4ZQCA 3OGRA 1E0XA 3LY0A 3VGGA 4O1CA 5LNSA 3PN8A 1IXQA 1OF8A 1XLCA 4YL2A 2NVAA 4AX6A 4XD5A 3TP4A 2D3LA 1PS9A 2QUTA 3GAYA 4KIRA 3G2GA 1YADA 5AYZA 1ONRA 5E0KA 5K3VA 3F5LA 1E4IA 3PVFA 4XKYA 2P3EA 1V3IA 1W56A 4LVDA 4PR4A 4JTSA 1REQB 4I9JA 2A3LA 1F5ZA 4DXKA 4DB7A 4YWSA 1E51A 3BQ5A 4PMZA 4DO5A 4QDWA 1TREA 1EWDA 1CNVA 3F4VA 1IIHA 3M0XA 4IIHA 1XINA 3NPXA 2D73A 2YBVA 5HWMA 1UPPA 2XIQA 3F4CA 3K5XA 5FA5A 4JX4A 4PGLA 4RL3A 1NWRA 3HO8A 1SFSA 1UR8A 2O0TA 1TQJA 5FEWA 1Z42A 2VRKA 3KCOA 2DIEA 3S5NA 4GIEA 3WF4A 1QK2A 4GYFA 4PODA 3H21A 1QTWA 3OBAA 1HFBA 3AUJA 4IFKB 1YPFA 1R2TA 1QNVA 4J3SA 3P8IA 3DYOA 3AS1A 4NAFB 2BOGX 3CEPA 4AZ7A 3B0YA 2ZX5A 1WUFA 5CAHA 1MQPA 3M5ZA 4DZAA 1CGWA 5TBOA 4YCPA 1KFCA 1Y5WA 4GKLA 4AZBA 2NX3A 2ALRA 3GDMA 1Q65A 1DP0A 4FZIA 2XINA 2D3NA 3C0SA 3QQ0A 1W9DM 1N2VA 3RIKA 1GEQA 4K6AA 3IS4A 2O9TA 2V8ZA 3MTWA 3WD1A 3UWYA 3URAA 1IT7A 3E2QA 5I3IA 4Q22A 3HQ1A 2E8YA 2JKEA 1ZNNA 3GZAA 4L6OA 3STPA 5A8QA 2DH3A 3M07A 4KIEA 2XVGA 4GO8A 1YYAA 1GW9A 1P0NA 3SGUA 4JAWA 3SN0A 1W3NA 3W7DA 4IJBA 1EP1A 2EPNA 2FJKA 3FJNA 2ZICA 5D4YA 3FNDA 4PBGA 5RUBA 3N3TA 4OHQA 4P7RA 1B3VA 2XFRA 1TWWA 4UTTA 1BWKA 1LQ0A 2ZXQA 5F4SA 3C52A 4F2UA 6XIMA 2BTMA 4QTGA 4IJCA 1FDZA 1A3XA 4MTVA 3QY6A 2E09A 1IZCA 1J18A 1Q2SA 4HOZA 5LXEA 1EBHA 4PUMA 1EC8A 3ATYA 3H2AA 2PCQA 3JVAA 3K4AA 2NUYA 1BQCA 3VA8A 2HQAA 4DZIA 3MANA 2CLEA 2F8QA 4JEJA 4O15A 3N2BA 2VGBA 3BLFA 4C6DA 3F7JA 3FA3A 3ZMRA 1J0YA 1V6TA 4YN5A 4BI7A 4QROA 2NWRA 3JR2A 4LF2A 1SW7A 3SCRA 2WHJA 1GJUA 4B91A 3CB8A 2QJIA 3CK5A 5C55A 4GQBA 3OO2A 4ZQPA 4HSHA 3KBVA 1EZ2A 2Z1SA 1Z69A 3EXSA 1ZZMA 1H50A 1H7NA 9CGTA 1UD4A 3KOZA 3QZ6A 3NDYA 3SQLA 1MXDA 4C91A 1JL8A 3TJXA 1L8PA 3L4ZA 1NTHA 2WK2A 4AC1X 4P5UA 3JRKA 2YCKX 4AW7A 4S39A 1Y7VA 1JIBA 1JULA 1JDCA 2P0IA 2ZXAA 2DZWA 4OU1A 1C9WA 1SZGA 2WQPA 1F74A 4GUIA 4GY1A 4S3KA 3MHFA 3S9YA 3ZJKA 3S5YA 3GB6A 1F61A 4F0MA 4WY0F 1DJHA 4M24A 5KSWA 1FOBA 4B5SA 5BMWA 3HG4A 5IOBA 4GK8A 4G5DA 8TIMA 1GYLA 3GIYA 1X7FA 3QR0A 1B3ZA 2AOSA 3UG8A 1Q6DA 2P3ZA 3THQA 2ZX9A 3NZQA 4O8AA 1IWAA 2C0HA 4UTLA 4ADUA 2AQVA 3ZSSA 3CAKA 3GHUA 2VDIA 1Y8BA 4GIYA 1H1ZA 4QQ3A 4QLJA 2PE4A 4CNOA 4JHZA 1XISA 3GNNA 5EMKA 4HVXA 1QRQA 4PMXA 3O1NA 3A9BA 3APGA 1RBAA 4XV0A 1MRAA 2VTFA 3BGGA 1EC9A 5TF0A 4B5UA 4KCWA 1VHCA 3PS7A 1EGZA 2RUSA 3G5EA 3N4AA 3KVMA 4MLJA 1DJWA 1TQXA 3NPUA 3QN3A 1YDYA 4ZSUA 5BRQA 2GSEA 2CLLA 3EYPA 1PKNA 2Z7KA 2XYLA 4ILSA 3ZR6A 3A4WA 3LCIA 1MFVA 1AMKA 1J12A 4MKNA 5K7JA 4D9PA 4IXHA 2C7FA 3TTOA 3MKVA 4ZQNA 4J3UA 5A69A 3NO1A 2HVNA 4AYGA 4RDYA 1L2QA 1EO5A 4ZXOA 2AQWA 1K7EA 2DQWA 4OBSA 1FTXA 5HMDA 3T2OA 2VDGA 1UD5A 1MUMA 2EKCA 1VFSA 1WDSA 4NIRA 4U2ZA 3BAJA 2WO5A 2NXIA 2IPJA 4XZWA 2D0GA 1FXPA 2G41A 1S2UA 3BLEA 4AVFA 3ZM8A 2BBFA 3E49A 4Q8VA 3T0DA 4HHLA 2NQHA 1LOSA 4LBRA 3G1FA 2OWXA 1TRDA 4JYEA 2G3FA 2YCJA 1Q3NA 3KL5A 2O9RA 2V3EA 1NWUA 2PFHA 3S6DA 2PWUA 4DUOA 4HCLA 1NFBA 3II1A 3LHUA 3GFZA 4MGGA 3TTSA 3TXVA 3GZ3A 1JFXA 2RHGA 3PTQA 4ZMGA 1UD2A 1C7TA 3W0KA 3ZLFA 4NNCA 4RNIA 1H11A 3PBUA 4W89A 4IG2B 4L4OA 1ME7A 3TC6A 3S6OA 5C9UA 1CXHA 4B4HA 1JRBA 2J77A 1CDGA 3RAOA 1JYVA 1VBUA 2QV4A 3VINA 2ZWZA 4ZGYA 3MP5A 3BANA 4LYRA 3SCSA 3GW3A 1FWIC 3NAVA 5EMLA 3M0JA 4RE2A 1EZWA 3LG3A 2AGTA 3P62A 5DBTA 3R11A 3REQA 2P88A 2DZPA 1KR1A 1SR9A 5DCEA 4GYKA 2W6RA 4J27A 3GUGA 3PFMA 3B9EA 3UGVA 1EQCA 3B9DA 4I5XA 3H22A 2QCGA 4E0CA 1QHZA 3FKKA 3OVRA 3QR1A 4KPLA 2VFEA 2BG5A 3ZVHA 2OVLA 4GY0A 1W8SA 4MB3A 1O5KA 2OZTA 1QXLA 4OIFA 1W1YA 1IWPA 4PTVA 1PX8A 5JU6A 4C5YA 1DJQA 2XFYA 3SGGA 2NLYA 3MDWA 3W4RA 2YL5A 4M19A 2Y5EA 3NCOA 4HSNA 2G4JA 5CC7A 3UG4A 5T8GA 2B7PA 4DWSB 1QU4A 1R46A 3KX6A 1NM9A 1E43A 4DUVA 4I3GA 4KEZA 4LRTA 1LRTA 5F4WA 2BY3A 2J24A 1K1DA 3S83A 4KEVA 1ZLPA 2ZTJA 3R79A 3R7MA 1UZHA 4H2CA 3O6CA 3R5EA 1G9HA 2P5NA 4JFTA 5CZJA 4O1EA 3RLGA 1PDZA 1XBYA 3WH7A 1K9DA 4KWOA 1KGWA 1QNOA 2DGAA 1EHAA 1Q4WA 3S1VA 2OKTA 4CQ8A 4UZUA 1YKWA 4O1DA 1UWRA 4IIDA 5G2WA 3QTPA 2UV8G 2O9PA 1ZJAA 2PBOA 3L68A 2CU0A 3DU0A 4C6PA 3KOWA 3KZPA 1V6XA 2Y8UA 3GY1A 3B06A 4REQB 3XIMA 3ZWSA 1EJUC 1Q8AA 5FCZA 1YHTA 4JQAA 1D9EA 3ARQA 3UG5A 3IIPA 2QYGA 3PNZA 3GTNA 1QOPA 2QJHA 1OYCA 2H3DA 3AJXA 1CI1A 3QOKA 2L5HA 1HL2A 1NOFA 1U22A 5G1TA 3RG6A 2XGZA 1XIEA 1KXHA 3LZ3A 3TLQA 1EFZA 4MADA 2X1SA 4GNKB 5GJPA 1E70M 1SUXA 4MG4A 1EQPA 4QJ5B 4MMWA 1WKFA 3L5MA 3AHYA 2OEMA 1AJ0A 1TJPA 3ARUA 3G1HA 2PDJA 1R3YA 2RFGA 4GVFA 1G1YA 5DN1A 1RY0A 4AWTA 1HVXA 4FLQA 3VKDA 1MDRA 1OFQA 3TV8A 5DMLA 4YTRA 3BDKA 3QMSA 3U2EA 3P5YA 1X8FA 5CGQA 2X42A 4KWWA 1LBLA 1VFOA 5CC6A 3WQWA 4XVEA 4ACZA 3GM8A 1DL3A 1OB0A 1ADDA 2Y89A 3OVPA 4LALA 2XVLA 3ECQA 4FEZA 4TV6A 4W84A 5FI8A 4J28A 1RJQA 4E4FA 3BAWA 1MVYA 3QGKC 3M0KA 4HU4A 1Q6RA 4IPNB 3OGVA 3QY7A 2NXGA 1E4LA 1MEWA 4DVOA 3A5FA 3KWXA 2R1MA 4PUNA 2CIPA 2J7FA 4WX2A 2IPWA 3WY1A 1JCJA 3TN4A 3WFAA 3DYPA 4Y9MA 1LRNA 4GUHA 4GJ1A 3WLRA 3PANA 1IE7C 1KBKA 1E55A 3P67A 3MS8A 1TMLA 1XSJA 5JBFA 2C1HA 3SRDA 1AQMA 3B97A 1M53A 3D5HA 3G3DA 1R7OA 4HIBA 4HZMA 1X6LA 4IL0A 1KQYA 2W62A 1CPUA 5AHFA 3W7QA 3N13A 3INPA 4PTXA 1VFMA 3PBVA 2CERA 2A85A 3NVDA 2H8ZA 5AYYA 3KVJA 8XIAA 3FX4A 4IZGA 3O16A 4B5VA 1I2NA 2WMKA 4ECLA 4UQBA 1GOQA 2FZ9A 1VFLA 4FK9A 4H8NA 3BLPX 3C56A 2TRSA 1AZ2A 1I4NA 3AZSA 1R6WA 1ZCOA 1OC5A 4JZ5A 3GG0A 3SCTA 1VFFA 1XYBA 4M82A 4GJJA 4XAZA 4JICA 2CKRA 1Q6CA 3PWAA 1P48A 3GDLA 3SCNA 5DO8A 4JFUA 2CFFA 1F4AA 1LF1A 4YPJA 1DHPA 2J9XA 1EF2A 4Y8EA 1XSIA 2IQTA 2QDHA 4PBFA 1QW9A 4F8XA 4H8VA 1C91A 1ZP3A 3EX1A 3BTNA 3MT1A 3HA1A 2Y7GA 5I3JA 4CLMA 4UNKA 1MW3A 2YCEA 3QJAA 3H24A 5EFFA 3EMQA 3PTDA 3BVJA 4Q7IA 2WNZA 4UTHA 4PUEA 3FW6A 5C7VA 1TWZA 4M0XA 2ZVIA 3THAA 2XM1A 2VC7A 1WZLA 3PM6A 5IXEA 1JPKA 1M04A 2QUVA 1DV7A 3ITCA 5HBFA 3USBA 3NGFA 5DQPA 3NZ1A 3GAKA 1LOQA 1XPYA 5HA7A 1TA3B 5A3HA 1MO0A 2PZ0A 3UESA 2JEPA 3EAUA 5CSUA 1CT5A 4N6FA 3QMTA 4NAFA 3RPTA 5ABTA 1GKQA 4QE4A 4E4PA 3EKLA 3KBJA 4ZFCA 4J3XA 3D3AA 3MCOA 2ZA2A 3W9ZA 2TSYA 4FX6M 4OBRA 3GR8A 1L0PA 2VFFA 4JKLA 3ORWA 3CLWA 2BV9A 1ESWA 2VP8A 1XV8A 4D71A 3KRZA 4HA1A 4JBRA 4I6KA 1C7SA 3TFXA 3A22A 3QYSA 3MUCA 4UBPC 5T9BG 5H8PA 1W1B1 3N2CA 5FJJA 4A8LA 3W7PA 5JBDA 1Z44A 3QV6A 2CZVA 1EJRC 1Q6LA 2VM8A 1W2VA 5CPOA 4S38A 1NARA 3IJQA 3CXOA 3W1QA 1J11A 2FFCA 3O2LA 3UJFA 4X2RA 3VOCA 3U0HA 1EDQA 5D9OA 3W23A 4IH3A 4I9MA 5G5IA 1OVDA 4F9JA 4FIRA 1VBHA 3N4FA 4HP5A 1UB3A 4ZR8A 1G67A 2B7QA 4LQ1A 1UH3A 2NUWA 1PEZA 1CEOA 1IZKA 4JCMA 3MWCA 1BYDA 3R6IA 2YFNA 3W84A 3IAPA 4HU0A 4I9TA 4ENLA 3M43A 3BW3A 2JGQA 1JDEA 3BQ6A 1PV8A 1QI2A 2QEZA 4D2JA 4KGLA 4J35A 1FWDC 1MW2A 1I9CB 1BSIA 3W7OA 3C2FA 1EYEA 4IPJA 3LUTA 3QMRA 4LC6A 2NQZA 1UPMB 4AEOA 2XN2A 2OT1A 1B1YA 1ZFJA 3L4XA 1O94A 4YMZA 1B31A 4H9TA 1OINA 1PSCA 1LYXA 2QAFA 3F4NA 2GPTA 1LWJA 1W9PA 4MKSA 3GR7A 5BWFA 4DNHA 2GGIA 1JG9A 2A6NA 4M51A 3TC7A 3MUY1 2W66A 2IXVA 1AODA 1VD6A 1AQFA 3VX0A 1H41A 5E9XA 4YS1A 5BXRA 2WC3A 3GNOA 2X1UA 3COTA 4IQDA 3ARZA 3IJIA 1XC4A 4BEUA 2W27A 3LD5A 4F40A 1MNZA 3SECA 2P8BA 1UCWA 3SW6A 4QQUA 4O4VA 3T0AA 1E0UA 4LCSA 1FFQA 2GQ3A 1US3A 3BJSA 4UFMA 4MB5A 3MV01 5LIWX 1B3YA 2CBUA 2QHAA 4Q8QA 1E9LA 4GHRA 1E9YB 1FWAC 2FDMA 1G7VA 1LL4A 1U33A 2ZXBA 5FL0A 1BHGA 3TW6A 3ZJ6A 4UTKA 1GQLA 1AL8A 1BRLB 3Q2DA 4UTJA 3CMFA 2R6OA 3LCFA 1CGXA 3E0FA 3EWZA 5J5RA 4UFHA 3ES7A 1FUYA 4HNUA 1QBBA 1LRQA 2ZUMA 2FYMA 1HGWA 4FALA 4ZOAA 3TYCA 1KFKA 3AS3A 1HTIA 3M0YA 3JW7A 4LX4A 1W5PA 1R0MA 4C6OA 2E1WA 2I9EA 2F6KA 4O19A 1EJTC 4XO7A 1XX1A 2QJGA 4DBDA 1JUKA 1TX0A 4L1WA 3UD6A 1RH9A 4PYSA 4U5KA 3B8UA 4NYYA 2PUZA 4ZODA 3PUGA 1LWHA 2IUZA 2HWGA 1EUAA 1A3HA 4JX5A 4KW2A 4W7UA 3WL0A 3BCDA 2GVGA 3L4WA 3DC0A 1P6BA 3QQ1A 2VQUA 5KEZA 3L7RA 1JZ2A 2E6YA 1H0IA 3IVTA 4H9XA 2V9DA 1O7AA 1D3HA 3NPVA 2IMRA 1RZMA 1KBBA 3SRHA 4I6VA 4RR4A 3CT7A 4Z1DA 1PXGA 3CZEA 1ZAIA 1FQ0A 1UA7A 3R4IA 2Y70A 1R30A 2J66A 1TUFA 2OZ8A 1VFUA 4YXGA 1VC4A 1A4MA 3WF0A 1T96A 1XRFA 3PPFA 4TR9A 4NYUA 4V2XA 4Q4OA 4Q8MA 1C92A 3IUIA 1A5AA 1HVQA 3ANYA 5CQ1A 4WLCA 3W1PA 2G4FA 3TOPA 4UFIA 3RLVA 5E0CA 4D8AA 3NL5A 3V7PA 3MA8A 3SCVA 1GJWA 4QEEA 4MOZA 1MYRA 4MUZA 4LCRA 1OFBA 3WDHA 3MVIA 2VZUA 2E4TA 1HF6A 2QGYA 3QHMA 3UR2A 4IGNA 1WDRA 1YXYA 2DV0A 3UNTA 4C7GA 3CUGA 3SY8A 1H3GA 4LYKA 3T08A 3RILA 1X98A 5FSEC 4LBUA 1B5TA 2FZBA 1FX6A 3EOLA 2PDHA 4CNUA 1RQEA 2NVCA 4OOUA 4M3PA 2QULA 4ES4A 3UPMA 1A4LA 4HNNA 4AUBA 4IG2A 5BXTA 1ZB5A 5AY7A 1A0EA 4GNVA 1KO0A 2W4XA 1YBQA 3ZSTA 1H1NA 4F2BA 1V0NA 2FZNA 3E5BA 4RUBA 1J2BA 3GQYA 4H00A 4HNCA 2ACRA 5ABHA 3VM5A 2OYLA 3ZR5A 1CWYA 2CLKA 4JQ4A 1ICPA 3H2OA 1LL7A 2YYUA 2HXTA 4H7CA 6PTDA 3FLUA 4ADTA 4BI6A 3S46A 1SMDA 1UOKA 3IJ7A 1NIUA 4LNCA 4P8UA 1LP6A 5I6SA 4XZHA 3NWRA 3W1TA 4LVGA 3M5XA 4J40A 4XAFA 3E9AA 4G1KA 4C6EA 4H7VA 3TZFA 2UY5A 4H2HA 4AZCB 4UQAA 1UIOA 2E9BA 3I3EA 1AW2A 4LWWA 3ARTA 2G50A 1N8FA 1J79A 4H9UA 4NAEA 4HA3A 1RR2A 4JTLA 4A29A 1KKOA 3F1QA 4MZYA 4PUWA 4PSRA 1C8YA 3H53A 2PD9A 2POTA 2Y7FA 4XWUA 1XKJA 3SURA 5AOUA 4WEVX 1QJWA 1SPQA 3BAIA 4B9ZA 4NILA 5FACA 2OGJA 3FOKA 1XI3A 2VELA 1PWMA 1OG0A 2ZUUA 4DWSA 1SW3A 2WSKA 1K8YA 1UP0A 2G3JA 1ZL1A 1US2A 1W17A 3DFOA 5AHMA 3OYZA 1VEMA 1TCMA 3OVGA 1T7LA 2QCMA 2C14A 3E38A 2G5WA 3P14A 5HAOA 2OSXA 3AZTA 3WJWA 3WQ8A 2Q8ZA 2WNNA 3WELA 8A3HA 3BCJA 4AY1A 1VPYA 1BXNA 3TSDA 4EVZA 2VX7A 3M4HA 1B4EA 3NTYA 1QPQA 4UQCA 3W2JA 1WXJA 3KTCA 2X30A 4QAWA 5M17A 5XINA 2XVNA 3LI1A 4LNYA 1NWTA 2ZRUA 1E6RA 3UXAA 3QHNA 2G97A 3G1AA 3WQGA 4IMAA 5B7ZA 1TV7A 2WMFA 5FSDC 1EO7A 5BOOA 1PYMA 4ORMA 2C18A 2XH7A 3MZ2A 3WD4A 4CGTA 4NI8A 4ZFMA 5GJNA 1ICQA 3WNOA 3YPIA 4DJEA 3DX5A 4Q4RA 4H3DA 2WVUA 1JDFA 4S3AA 2VC5A 4G2DA 3KP1A 5E5CA 1A5MC 1FHUA 3AYRA 1V3MA 1J0IA 4MWAC 3AOFA 3RF9A 4QXIA 3RK8A 1GHRA 1X1NA 3SUSA 5CSRA 3B0PA 4FX8A 2C16A 2OO0A 3TDFA 2DORA 3VO0A 2F6XA 1NQKA 4XZIA 1XH1A 3GH4A 4XSMA 3RYSA 4GUFA 1H7WA 4R33A 2A3AA 1GOMA 2AGKA 4GQ0A 4DBSA 3S1XA 2LLEA 1M68A 4N02A 2H3BA 2ZE0A 3EA1A 4KETA 2E1DA 1W3JA 4B5TA 1DBTA 5ABEA 4LCQA 1PZ0A 4N4QA 3AHVA 1VCGA 1CGTA 4F3HA 1E0TA 1W9UA 2G3MA 1UUOA 4LF1A 1OT1A 2X0YA 4JQ1A 4DZHA 1I0BA 1DIDA 1JUBA 3IJDA 4DI9A 5CJ5A 2BGNE 4IFOA 3APTA 3W6YA 4O18A 3UA3A 3NQ7A 3NM1A 3TTQA 1O1ZA 4MAVA 2YYTA 1JCLA 3EDKA 3N12A 1Z89A 3VNJA 2FGZA 2VCCA 4QISA 3PZIA 1NDZA 1P1XA 2VENA 3UZ5A 2XZ7A 3FYPA 3ID7A 2ZRVA 1QASA 2VJXA 3H70A 3HMJG 5I06A 3BOXA 3KLLA 4M6VA 1F76A 2Z0IA 3P6LA 3BMXA 3Q45A 3U57A 2VRJA 2XIJA 2W92A 3WEMA 1R7AA 3UFYA 1J01A 1TJ1A 2CC0A 4KCVA 2FMNA 1UZDA 1X1ZA 8CGTA 3TR2A 1LQ2A 3OLEA 2ZBTA 3WK0A 2HSAA 3RO6A 4UFJA 1U1HA 3ARPA 1GK8A 1IF2A 1LM1A 5HATA 2Q09A 5GNXA 3VGFA 3BZGA 5M5DA 2WWCA 1RCQA 2CKSA 2Y8KA 2ZX6A 1L6FA 2GGGA 1QT1A 4NSBA 4PN2A 3PJWA 3VGDA 3VOJA 3TAKA 2C15A 2BXVA 2CZFA 1UR9A 5HUPA 1GVQA 2NLIA 1J6PA 1R87A 5A1AA 1GKRA 3B4UA 3B0VC 1UQZA 4X2PA 2X41A 3GKAA 2WC4A 5D2XA 3UF9A 3BPWA 3RHGA 1L2UA 1BD0A 1QCWA 4J2MA 4WZHA 2HRWA 5EPDA 1J2WA 3NUKA 1FHLA 2PDIA 4BKNA 3G24A 1BXBA 2JQXA 3O07A 1FCQA 1GZGA 4M8UA 2YSWA 4OQVA 2GDVA 4D6JA 2EHHA 3CHDA 1NU5A 3L23A 3BLIA 4F0LA 1QPNA 3T6CA 3WNMA 3W1UA 5FJUA 3CZ8A 1GVIA 3F5JA 3VDCA 2I17A 5ECVA 4CD7A 3DBPA 4WCJA 3VIPA 3GSMA 3IRSA 1ZHAA 1J5SA 2REQA 4ZOEA 1IQ8A 1CGUA 1UJPA 3N6JA 2GQ9A 3W53A 2WMIB 5I23A 4XK2A 5KZEA 3NSNA 3AYTA 1CECA 3E1F1 2YW3A 2Z24A 4A35A 4PRWA 1GJPA 5FD0A 4Y9PA 2BY1A 2PTZA 5FEXA 3FKRA 5FEPA 5CLTA 1TA3A 2JIEA 4R34A 5BZAA 1CXLA 2IPFA 4IL2A 3TAOA 1SSDA 2ZDSA 5CPNA 3L0KA 3T09A 3W86A 3WEZA 1NJJA 4HYVA 4R7JA 1ISYA 4LAZA 1QOXA 2G3NA 3HURA 1XR2A 4PTNA 2ZOXA 4MDPA 4XG1A 2F84A 1S2VA 2YA1A 4A3YA 4UTWA 3UR7A 4PRRA 3W7IA 3GU9A 1DXFA 3VNZA 2I14A 4DO7A 2BY0A 5EKYA 3VD3A 1EC7A 4WOZA 4D1IA 4DF0A 2V0TA 5LA2A 1DJZA 2VOTA 1MEIA 4HYRA 1WBJA 4H01A 2ZE3A 3SCQA 4DZ5A 1B4KA 1DWGM 2QMKA 3FYOA 3N11A 3I6RA 5I3GA 3AXXA 2X7WA 3CO8A 1V0MA 4XUYA 3ITGA 1BQGA<