4L1WA

Crystal structuer of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+ and progesterone
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
325
structure length
325
Chain Sequence
SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C2
total genus 119
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4l1wA00
1RY0A 4WDWA 2PF8A 2IPJA 1YNQA 4WDUA 4QX4A 4PR4A 3UZXA 2IQDA 2PFHA 2PDPA 4WDXA 4HMNA 5JH1A 4JIIX 2ACSA 2PDUA 1YE6A 1Z3NA 1C9WA 1Z9AA 3ONBA 4GIEA 3UP8A 3LNMA 1RALA 2QXWA 2INEA 1PWLA 1A80A 2PDGA 2PDLA 4DBUA 1EXBA 4LBRA 4QXIA 2PDIA 3MB9A 1MI3A 5DANA 2PDMA 1XGDA 4LB3A 4LAUA 2ACRA 3LENA 2CLPA 3LQGA 4XVDA 4R9OA 3R43A 2IPWA 3H7UA 3U2CA 5KETA 4ZFCA 4EXAA 3UZWA 3CASA 3LZ5A 4MHBA 4GQ0A 3LBOA 3ONCA 3V36A 1ZGDA 1X98A 2HVOA 1M9HA 1XJBA 4YVVA 3WBYA 3EB3A 3M4HA 4XZLX 1GVEA 2PDKA 1VBJA 2PDJA 4YS1A 2WZTA 2PDCA 3H4GA 4Q7BA 2PDHA 3R58A 4JTAA 5C7HA 4DBWA 4LAZA 4IGSA 2IS7A 4PMJA 3LUTA 5AZ1A 2FZDA 3V35A 1X97A 3FJNA 3V0TA 1AH0A 4YU1A 1PWMA 1LQAA 3BUVA 4LBSA 4YVPA 3N6QA 3F7JA 4PRTA 2HE5A 3D3FA 4NKCA 3WCZA 1RY8A 3ERPA 2HDJA 3EAUA 3T42A 1PZ0A 3DN5A 4GA8A 3RX2A 2PDQA 4IJRA 3R8HA 5AZ0A 4WGHA 5HNUA 1FRBA 1ZSXA 4DZ5A 3WBWA 1YE4A 4I5XA 4Q3MA 2PDBA 2PZNA 4HBKA 4LB4A 3LEPA 4GCAA 1X96A 5HA7A 4F40A 4GQGA 4JQ4A 2HE8A 2PDYA 3BV7A 2VDGA 3KRBA 4WRHA 3CAQA 1Z89A 2HVNA 4DBSA 1Q13A 4WEVX 3LZ3A 3FX4A 1PYFA 3DOPA 3UGRA 3VXGA 1US0A 3M64A 1QWKA 2ALRA 4JTQA 1AH4A 3LD5A 2IKIA 2ACUA 4QR6A 2IKJA 3EB4A 3H7RA 3BURA 3NTYA 5M2FX 3G5EA 4XAPA 4PUUA 2I17A 2PEVA 2PDNA 4L1XA 3RX4A 3COTA 3UYIA 2IPFA 4XZHA 1SM9A 4XZMX 4AUBA 3UZZA 2HEJA 2PDFA 1HQTA 1OG6A 2DV0A 4G5DA 4GABA 4XO6A 1JEZA 2PD5A 4L1WA 2ISFA 4RPQA 3UFYA 2PD9A 3CMFA 3R8GA 3S3GA 3LN3A 1PZ1A 2BGQA 4IJCA 3Q67A 3M0IA 4FALA 5LIXX 1YNPA 1ADSA 1EF3A 4FA3A 1MRQA 1LWIA 3CV7A 3R6IA 3GHTA 2HV5A 2IKGA 3GHRA 4QBXA 1K8CA 3C3UA 2FZ9A 4FZIA 3UWEA 2I16A 1R38A 2DUZA 1QRQA 2A79A 4XZIA 3CAVA 2IKHA 3GHSA 1XF0A 5LIYX 1VP5A 2AGTA 2R9RA 2FZ8A 4XZNX 3P2VA 4ASTA 4JIRA 1UR3M 1EL3A 1ZQ5A 4ICCX 3WBXA 3LQLA 4JQ1A 1T40A 2ACQA 2FVLA 1IHIA 1S2AA 5HNTA 5LIUX 1AH3A 4JQ2A 4XVEA 1AZ1A 3Q65A 1EKOA 4WDTA 2F2KA 2WZMA 4XO7A 4JTCA 5LIWX 4PRRA 2DUXA 4H8NA 1ZUAX 2IQ0A 3G1RA 1Z8AA 2P5NA 1MZRA 3WG6A 2J8TA 2BP1A 3O0KA 3N2TA 4OTKA 3QKZA 4H7CA 3BCJA 1T41A 3V0SA 1Q5MA 2FGBA 1S1PA 3V0UA 4JQAA 1AZ2A 3GUGA 1IEIA 4JQ3A 3MC5A 3UG8A 2NVDA 4JTDA 1S1RA 4YVXA 4GACA 4JTRA 1S2CA 4EXBA 3CV6A 3GHUA 3O3RA 2IPGA 5JH2A 3R7MA 2FZBA 4JIHA 2PDWA 2NVCA 3RX3A 2PDXA 3B3DA 2BGSA 4PUWA 3R94A 5LIKX 1J96A 4FAMA 3UZYA 1AFSA 2R24A 2INZA 1HW6A 2F38A 2C91A 4XK2A
chains in the Genus database with same CATH superfamily
4NAEB 4ACZB 4EAYA 4V33A 5EMMA 4WDWA 5KZEA 3NQBA 1UUMA 3PULA 3H23A 2YXXA 4QLJA 1R2TA 4RDWA 1H1ZA 4HMCA 1EP2A 2ACSA 2YZ5A 3C0JA 3GM8A 1UQYA 1YE6A 4XKMA 3AHXA 2R1NA 1XLKA 3W86A 4MY9A 2AQOA 1RH9A 3WF0A 2BV9A 1EXBA 4LFYA 4W8LA 5HDRA 1NF0A 4LF1A 4Q6JA 1FOBA 3A4XA 3QZ6A 4W85A 3SY5A 4GBDA 4J1OA 1A5MC 2V30A 1OWQA 2WO5A 1XD1A 3F2BA 4K37A 2UY2A 2EPMX 1HO4A 1LUCA 3L4YA 2FJUB 3UZWA 1MUWA 2X2YA 1XLHA 1EIXA 3TYBA 3LSCA 4HHLA 4MFDA 2A3LA 3LBOA 4ENLA 3SGZA 3CUXA 1XJBA 4AXNA 3BOLA 4B91A 3KS5A 4XZLX 4OV9A 5L9FA 4D6JA 2AKZA 4MY1A 4Q7BA 2PDHA 2G3FA 2YCIX 1Q2RA 1EUNA 5A8OA 3NDZA 2Z0IA 3OVGA 2XVNA 5J04A 3CH9A 3GO2A 5LNUA 3TCEA 1XH2A 4HU4A 4GGHA 2UY5A 3W38A 3CUGA 4D1JA 1Q4WA 3K1DA 2VUYA 3VUSA 5D38A 2C0AA 1J4EA 3N11A 1XV8A 5CSRA 3QSRA 5BXRA 4KWWA 1UBSA 1RZMA 4AWTA 1V6UA 4XUGA 4LAOA 1UKSA 3EDDA 4JTTA 4QJ4B 3U4FA 1JZ4A 2TPSA 4RDVA 5HNUA 1FRBA 2V6AA 1ZSXA 4ES4A 5TD4A 6REQB 1BTMA 2RHGA 3WBEA 2VEFA 1HT6A 5BU6A 3DG6A 2OWXA 2FPYA 3B9NA 4S3BA 3G2GA 4A3UA 2HPMA 3LS9A 1PX3A 3F4CA 1ISWA 4WRHA 2WQPA 2A0NA 3BZJA 3CPUA 2OQYA 3F5KA 3F5JA 5EFFA 4GCXA 1C7SA 1V08A 3MKKA 3RGTA 3EWWA 4PCFA 1PYMA 3NCOA 1MMFA 4HSOA 1QI4A 1EC9A 3S9IA 3TUUA 2WOQA 2B0MA 3WK3A 1QNVA 5BCAA 3SDOA 1CLKA 1BKSA 1H7NA 4H3DA 4LUTB 3BTNA 3MJYA 2W6RA 3M7WA 6TAAA 2FZNA 4ROQA 2WZHA 3HV8A 3K5XA 1XWYA 1PV8A 3NTYA 4PUUA 5FF0A 2GGJA 3UWYA 1W2VA 4IMCA 2ZZ7A 1NFPA 4LUSB 3E49A 4MDOA 3WLPA 4DF0A 1L6SA 1X1NA 1OVDA 1SM9A 1W9XA 1UHVA 3ES7A 1OG6A 1K7EA 3EA3A 3T1GA 2V3EA 1XISA 3LCXA 3DYPA 4K3ZA 3H8AA 4ATWA 4C6EA 3NQ6A 5D30A 3THQA 4I6VA 4WOZA 5MHBA 3L68A 1QXLA 2VURA 3AYTA 2VELA 2NV2A 5BRBA 3H54A 5I78A 5EL1A 4DM2A 3ZQ9A 3PZVA 2E8YA 4S3FA 4WOQA 3LBMA 3UCDA 4ILSA 3WF2A 3SCRA 2FH8A 4ADTA 4EOUA 2FFIA 3P6LA 1CEOA 1EXPA 4A29A 3MMUA 2ZRUA 2X7WA 1I75A 3VIGA 1IXNA 1YBQB 1H0GA 4KRUA 2A21A 4GFSA 1Q8JA 1EJWC 2FHBA 3AIEA 2D0HA 2Z6IA 5FJIA 2QYGA 1PL9A 3GTIA 3R0UA 5T26A 1S2UA 2CBIA 1L8PA 2DH3A 3NQ7A 3K1GA 3LQLA 3UY7A 1R3VA 1KR1A 1KXTA 1SJDA 1M3UA 3PK7A 3T8QA 3PZGA 4FLQA 4Z2KA 1E72M 2PWGA 2GZXA 5A8PA 3KL3A 3Q65A 3DCPA 4QSHA 4JTKA 1GCYA 3V16A 3UNDA 4F0LA 4LRTA 2NQ9A 3OZPA 2VI0A 4ACYA 3I7QA 1UH2A 1S3TC 4GI6A 2NT1A 1BGGA 3E2RA 1DJYA 3E0FA 4RX0A 2W91A 4F2TA 3NO3A 4IUGA 2JQXA 1V6WA 3CZJA 1BRLA 3AC0A 1O12A 1S2VA 2Y5JA 5BOFA 4S39A 2WMKA 4MAVA 5REQB 1MNZA 4EPDC 5BW6A 4JR5A 3TAKA 4AYSA 3VMPA 2OSWA 2RDWA 4YVXA 4GACA 2DJLA 1QHZA 1BF2A 2XH0A 4CU7A 5E9AA 1YDVA 3II1A 1JQXA 3TNBA 2FZBA 4WJXA 5DQPA 4LV4A 3P7YA 2GVYA 4UIOA 1GOXA 2Q8LA 1W0MA 1TUFA 1LOQA 2Z1BA 3CUHA 3TFCA 2P53A 3ITCA 5C2GA 4Z1DA 2BOEX 3EMQA 4UQDA 1OFPA 1WDDA 3C0SA 1R9ZA 1G0CA 4XZ9A 3WD4A 3IAPA 4RCXA 4LAMA 3FEQA 5DBTA 2E1WA 2HROA 1DTUA 2CZDA 3L23A 2J4GA 2X42A 4DQWA 4ZE5A 1UD8A 2A3EA 1KM3A 3EPNA 4CD7A 4ICNA 4UTHA 4QAIA 5DT7A 3F4NA 4ZQPA 1IV8A 3NXFA 5EMJA 1CENA 3MWCA 3KCJA 1D9EA 2PDPA 1QI0A 5CG7A 1H49A 5AYBA 3LLFA 3WK2A 1C3FA 5CC5A 1LG2A 1Z3NA 3T0TA 3P0WA 4U10A 1SJAA 3LNMA 1MXDA 3M7SA 1RK5A 4JFSA 4WXZA 3A3XA 1B9BA 4DI8A 1VYSX 2JIWA 1FVPA 3ZXWA 3A3HA 5G4EA 3B0UX 1QNSA 4FNPA 1Z32X 1YIXA 1EJXC 1MW2A 3GNXA 5PTDA 4NIRA 3MHGA 4ZFCA 4IQEA 3M0HA 4O0QA 2WC7A 1EGVA 4RNIA 4MHBA 2X0YA 1UWTA 2WMFA 3MV01 4AMCA 3W6LA 3G1FA 5DMYA 3CJPA 4OE7A 2PDKA 1XLGA 3S1GA 3NL2A 1DEDA 3LXCA 3DFTA 3WQWA 4I6KA 3LYEA 4GO9A 1OFBA 3TTQA 4J2MA 3UCCA 2C15A 3HO8A 3GXFA 2VDIA 3VZXA 2BY3A 4HNVA 3FFSA 1QK0A 3B4UA 1GOQA 3GS6A 1CB2A 4R3UA 4M1BA 2OGJA 5C9RA 1KGWA 2GQ9A 3HPXA 4IGNA 4P8WA 4Q32A 3NQVA 3I4EA 3LM3A 1BXBA 3EWBX 1E0XA 3UG5A 2J6XA 1DWFM 2PAJA 4Q4SA 3WCZA 4IT1A 3CUJA 3RRXA 3TMLA 4HQVA 3LMZA 1CTNA 3MDUA 2OZTA 3EAUA 3HG4A 3PB2A 1DJIA 5FSEC 2EJAA 4LJ3A 5D2TA 4UTKA 1DE6A 2CZVA 2ZVIA 5AZ0A 5C6MA 3MP3A 4LX4A 4NY2A 1LYXA 1PDZA 1ZRQA 3SY8A 1NDYA 1KV8A 4LWWA 2WMIB 1KLZA 5I79A 4MMWA 4ZOEA 4HHHA 3BV7A 3AXXA 3W7KA 1ADDA 1E4LA 5C5YA 4Q7IA 4E4FA 4GYPA 1IIHA 1TB3A 3BMWA 3JU2A 3ZJ7A 1QO5A 2BSLA 3ITYA 4DBSA 4Y8EA 3UGRA 4REQB 4UTTC 3U2EA 5TBOA 5BYWA 1JAKA 1UD6A 4NILA 1FH7A 2F2HA 1D3GA 1Q8AA 1UD5A 4H01A 1HO1A 2ABBA 2POTA 3C3NA 4E2DA 1UMYA 1XLDA 1ONXA 3FV9A 1SJCA 2YDSA 3PP7A 3DEQA 1J9YA 5KZDA 3KTCA 4F48A 4XZMX 4C7FA 4HA1A 2OVLA 2HEJA 4J5NA 4DJDD 1EO5A 5CC6A 3UT0A 1ZZMA 2VFFA 3ARXA 1GONA 2ISFA 4NHVA 1OM0A 1SU5A 2PD9A 2RJGA 5BWFA 4RUBA 4JL1A 4J3ZA 5LIXX 1FWGC 1EDTA 4MZYA 1PZ3A 4NUWA 5LA2A 2ZQ0A 1HN1A 3TOYA 3FJ4A 3TXZA 4A3YA 2R14A 3CV7A 3W7OA 3NUKA 1BEUA 3GNPA 1MW0A 4Q4RA 1Y0EA 1NSJA 2C1HA 1KM2A 3C3UA 4XV0A 4IXXA 2VM8A 3N9KA 4FZIA 4K7YA 4N7QA 1YNYA 1UUOA 2HNEA 4Z1CA 2BHUA 3F2CA 4XZIA 3CHCA 4AD2A 3AIUA 1EA0A 2C1GA 4IZGA 3WQ4A 4B5NA 1C9DA 1TJ1A 4WF7A 4O1BA 2H90A 1GOKA 5DY2A 2TAAA 3L0GA 4B2DD 2OEJA 4INFA 5JU6A 5IFPA 3SRFA 3PJTA 2QDEA 4M7TA 1T40A 2JF6A 5GQBA 5JQ9A 1EC8A 2GQ3A 4F0MA 3STEA 1BD0A 4JTCA 5LIWX 3AS3A 3OBEA 7ENLA 3WDIA 2REQB 4OBRA 1OG0A 1Q63A 1JCLA 4FR6A 4S3AA 2WJZA 3OG3A 1DWJM 1NM9A 2Z26A 3WIJA 4IM4A 1OGBA 3WH6A 5EBAA 3GDBA 4JIQA 3CL6A 3THCA 4H41A 2VNCA 1L0PA 1TWIA 1VS1A 3H21A 1GVSA 3O3RA 3HTWA 2VGBA 1VPYA 2BB0A 3BSHA 3ELFA 4XISA 1YDYA 4OVXA 1XGEA 4EVZA 2OWWA 2DVXA 1TFVA 1A5SA 5BWAA 3JVAA 4PB5A 1P4CA 4CEUC 3AMLA 5KINA 4BY3A 1WZKA 5AVNA 4PUWA 1EZ2A 2ZA3A 2BOFX 3IGXA 5DCBA 1H51A 1TE6A 2VC5A 2QPSA 1EX5A 2NWRA 3FHQA 1VBUA 5F7UA 4F0HA 4NJJA 5D9NA 3TYZA 4CQ8A 5BZAA 5AYXA 1UJQA 1TPWA 1HW6A 1HJXA 1YEYA 4NJHA 1B3XA 4MNJA 2EG8A 1TZ9A 1PIFA 5HMEA 4PUEA 2DZUA 4QX4A 3BDKA 1XLFA 3E5PA 1V4YA 4AZIA 5CG0A 1A47A 1O5XA 2BHYA 2ZOXA 4ZTXA 3SN1A 3W71A 3VOFA 3VE7A 1NQKA 3V5OA 7PTDA 3GXDA 4N02A 2D73A 2EPKX 4GQBA 5AHIA 3LCIA 1TV5A 1WX0A 1QBAA 3L2MA 2XVLA 4AD3A 4UFIA 4PCPA 1C8VA 1I45A 1EA9C 4LSBA 3M9YA 4FHAA 3LQGA 4J4KA 2YCJA 3A9BA 2IPWA 3GH5A 3U2CA 2GWGA 4EXAA 1ITQA 5ECUA 1H7PA 1RA0A 4EF8A 1W8GA 3AS1A 1CDGA 1TPVA 4YS1A 3G3MA 1K4HA 2NXIA 3IVSA 1KRBC 1AJ2A 3ZS4A 3M0VA 3VNZA 4IGSA 1NWUA 1Q65A 4KGJA 1ZBCA 4PZVA 4YJ5A 3UF9A 5K9XA 3ZM8A 2H8ZA 1M7JA 5DRCA 1E71M 2Z2UA 4M19A 2D2JA 4O12A 3M44A 3NM3A 2VMFA 4TVDA 3OHMB 2ZE0A 4QE4A 3TTEA 2HE5A 3E0VA 3NNTA 3FS2A 4NG3A 3NOYA 3NOEA 2XFRA 4D1IA 4DXVA 3ATYA 1J93A 4KFOA 1B90A 4LBUA 7A3HA 4K2SA 1KXQA 4YTQA 1BGAA 1T5AA 2WWDA 3B8TA 2D0GA 1OY0A 4PUDA 2JEPA 1W1A1 1OSEA 3UBPC 4I5XA 4TX9A 2B4GA 1RLCL 3CNYA 2GGEA 1AUSL 2J8FA 3SUTA 3TR9A 1NF7A 4GQGA 1GHSA 3NIYA 1E9YB 3CQJA 1GJWA 4HJFA 4IMEA 2PODA 4P8VA 4NX5A 4B3KA 3S5NA 2A3BA 5FA5A 1JXJA 3QBUA 1ME9A 4TV5A 3PANA 4GJ1A 5CPSA 1PYFA 2GVJA 1US0A 3OIHA 5E0CA 2NLIA 5DCEA 4ML9A 4ORIA 5CJMA 3C56A 1A3XA 1Q3NA 3KDNA 4XZWA 3I68A 2DZAA 3B0XA 3LCWA 1HTIA 3BQ5A 2CZEA 2C71A 5LGZA 4QEHA 5M2FX 4DUOA 2DSUA 4Z17A 1EJ7L 5U4NA 2XINA 3QV6A 1PXGA 2PEVA 4I90A 4HPGA 5E0KA 3VGHA 3MO7A 4AIEA 3ALGA 3GW0A 3CTLA 1OFQA 5IFTA 2IPFA 4LUYA 2Z7KA 3OGVA 4IICA 4L5ZA 1GZ1A 2JGYA 4H6RA 5HQEA 1BYCA 1XIDA 3EWUA 3GFXA 4G5DA 1O66A 1CZ1A 3HFTA 4UFKA 2EG7A 1UP0A 4CLMA 3VMOA 2DSVA 4KWSA 1B5TA 1UH4A 3WJYA 1I4NA 4JYDA 2ZVRA 2BGQA 3QQ0A 5I09A 4WSKA 4HD5A 4TVUA 1BF6A 4UFJA 3ICJA 3S8HA 1B3YA 3HGJA 2Q02A 3LXBA 2WJFA 1UR0A 1VC4A 3BSMA 1IXOA 3NG3A 4S2CA 3WLOA 1PBGA 3W70A 4AU0A 1W91A 4TX6A 1TPH1 1KBBA 3VIMA 4HKPA 2IKHA 3EMZA 3GH7A 3ZYZA 3S2JA 4JX6A 2R9RA 1JRBA 1G7UA 1O60A 1IYXA 2BOGX 1FWFC 4IJBA 2V5DA 4Z2HA 4BK9A 5C7VA 3G8EA 2NSOA 4E8CA 3TH6A 1IXQA 4XD5A 3R0DA 1TTJA 3TR2A 2VC6A 1EL3A 3RMJA 4HOZA 3EYPA 1XI3A 3C2FA 5A2BA 1UC4A 1ME8A 4B5WA 3AS0A 4FNTA 3T0AA 4EWND 2J7BA 2DIKA 1XIBA 4FI4A 2QJIA 2E8ZA 2INFA 3T0DA 3A4WA 3WYZA 4QDMA 1J01A 3N2XA 2X41A 2E3ZA 4NRSA 5JBEA 4G7EA 4K8GA 3VGFA 4DIAA 3TSDA 1LG1A 3UPMA 5K2ZA 3SRDA 1F76A 3WLQA 4RL3A 4ZE4A 3MYPA 4AZGA 2P0OA 3RR1A 5HNRA 1JZ6A 1DHPA 3BG3A 1UZHA 4ZVJA 4K1GA 2OFJA 3MC5A 4ZTYA 4GZEA 1W3LA 3HQNA 3MTWA 4BWLA 3KBNA 5D02A 3GVGA 5CKSA 2PWFA 1W37A 1NAL1 2E68A 5EY5A 2EBNA 2XVGA 2Z1WA 2DH2A 3SSZA 4B4HA 3IJ6A 3O06A 1KTNA 4JFTA 3PC0A 1BWKA 4IFOA 3LA4A 2PDWA 3AMKA 3QV7A 2PDXA 4U5IA 3B3DA 1KM4A 3LV5A 1US2A 4MIMA 5BRPA 4LYPA 4MJMA 3W7NA 1R2SA 3AYVA 1E6XM 5AFDA 1OHLA 3NZGA 2GJXB 3OQEA 4HZMA 5HAOA 2NWSA 5I02A 4YCOA 3C86A 4WCJA 4JPGA 4US5A 1B30A 2UBPC 3GXTA 4H8UA 1QATA 2GOKA 3WUFA 2HQAA 2C14A 1FWIC 1PHQA 1HJQA 1ISZA 2DORA 2PLKA 3BAYA 1V51A 4MM1A 4IL0A 3MW7A 4MYAA 2ZZ1A 4L6DA 2YL9A 4HVXA 4Z1BA 1I0BA 4A22A 1RALA 2CLFA 4LOCA 3QFWA 1LBLA 2ISDA 3QXBA 5EFDA 1U2YA 2J7FA 4LBRA 4WKHA 1OIMA 2WNZA 1YPFA 2OGYA 3RUBL 1MI3A 4O50A 1KRMA 4FLSA 3KOXA 3LHVA 3GDLA 1IR2A 2ZX6A 4LAUA 3TYEA 4PUNA 3HMJG 3DHFA 3PB0A 4GISA 4H6QA 1IXPA 3R43A 1F3WA 1GEQA 3VX1A 4BWLC 4W7VA 1YQ2A 5K7JA 3H7VA 1PB0A 4MB3A 4YVVA 2R82A 3QMSA 3L21A 3KVKA 3M4HA 3G1SA 1A49A 1GVEA 4TMBA 1TCDA 1J0IA 3MY9A 3CBWA 1P0KA 2BTMA 1TV3A 1BAGA 4EPBC 4AD4A 4UOJA 4A8NA 4O0ZA 2FVKA 3FJNA 4WJEA 1V0NA 2Y63A 3FA5A 3VYLA 5FEXA 2E09A 3RCNA 4F79A 2HPIA 3G6MA 4E4UA 2WMGA 3EX3A 4L9ZA 3SSJA 2PZ0A 3W1QA 3R13A 4GI9A 1JD9A 3QPYA 1GVRA 4AVFA 2XH2A 3W87A 2DUAA 1UOZA 2QUUA 3AIRA 2CPUA 3QY8A 2ZUVA 2P50A 1VD6A 3BW2A 3O15A 3HPZA 3GNDA 1GOIA 3ARPA 5IDZA 4ATDA 1E6QM 2C6QA 2FJKA 4CD5A 1AMKA 1WYIA 2VT0A 3GLCA 2PP1A 3LEPA 5D32A 1UKTA 4H19A 3SCUA 4LGXA 4F2BA 5H1WA 4JEJA 2F6KA 4U33A 4M1RA 2RGLA 4J3XA 1W1B1 1ZCOA 1R86A 1O6IA 3VDCA 3EXTA 4NRRA 1OGGA 2D2HA 1FWRA 1J12A 4GZJA 2D3NA 1GPFA 2V3FA 3ARZA 3NFUA 3M43A 1EBHA 2E28A 3O1NA 3R79A 3T2QA 1PPIA 3T7VA 5JXQA 3LD5A 4IPJA 4MJZA 1Q6FA 2Y7FA 2C13A 2P3EA 1VBRA 3VNDA 1XYFA 1B3OA 2FPVA 2V2HA 1DIKA 1XLCA 2CERA 4AZ5A 3KL5A 3MP4A 4OQVA 4FXRA 1TR9A 1DQXA 2JKAA 2J74A 1AK5A 1ITCA 3QJAA 1XLIA 4DF2A 3S1WA 4EE9A 2ATSA 4LXFA 3M41A 3RLGA 2YA2A 3CAKA 1G1YA 1D7KA 3JS3A 4U28A 2YFNA 4RE2A 1WAUA 1XBXA 5EGRA 4DYEA 1XYBA 3EPOA 1ZPTA 4HHPA 2XGIA 1YTKA 3WLJA 3Q67A 3LPOA 3M0IA 4FALA 4UUIA 1WB0A 5CZSA 2V5LA 3N2MA 1XCXA 4AEFA 1XRTA 4BI5A 3TV8A 5CBIA 4CCDA 2POZA 1ME7A 1XSKA 1OX6A 1T7LA 1W5PA 4ZCWA 4LUJA 3ZWSA 4AX6A 1I60A 3S2MA 1ICQA 1GQIA 1K8CA 4WHBA 3A22A 4D6HA 4E3TA 2FPTA 1DQUA 6A3HA 3GHSA 3DI1A 2Z25A 3I6EA 2WZIA 4J3TA 3Q94A 3KCOA 3SB0A 3CL8A 5E5CA 1JNDA 3CL7A 2W79A 4UFLA 4I7UA 1XYMA 2P8CA 1R30A 5HMFA 3NPUA 3K30A 3LRKA 4ZO7A 1CXIA 4DY1A 2CLIA 3WMCA 4HN8A 1SO4A 3EX1A 3TP4A 3MCMA 1W8SA 3UG3A 3C2VA 2UZ9A 2PTXA 2VFGA 5FEWA 3NPXA 3ORWA 2YW4A 4OECA 1K8ZA 4BI6A 1CECA 1P0EA 3URNA 3ZR5A 4YNGA 1A5UA 1B0IA 3PTDA 5BXPA 3W1UA 2RKXA 4O4VA 4F66A 4C6KA 2RDXA 1SR9A 1CGXA 4O19A 3ITVA 5JMUA 3W2LA 2PI6A 4I8DA 2VR2A 2IW0A 2YBTA 1JL8A 3CZEA 1OK6A 5CEWA 3WDJA 4DVOA 1B3VA 2J8TA 2C16A 4HNCA 3NQDA 4N9EA 5FACA 3TYCA 3LMYA 2ZZ2A 3T44A 3NQEA 1ZJIA 3CEPA 4D9PA 4GINA 1IEIA 1JI1A 3MS8A 3AFBA 4IQJA 4EXQA 3BSGA 1XSJA 4WSJA 1VRDA 5JUVA 3PY2A 3BARA 2WBKA 2ZZ3A 3C0LA 4HTYA 4QG6A 2DFAA 1M7OA 1JULA 5AYIA 2VC9A 2QLYA 3VIHA 4R27A 3IS4A 1XLMA 3AICA 3H12A 2O9RA 2J24A 5EMUA 3UEQA 1H4PA 1Q6OA 2ZXAA 4HZ8A 4UB9A 4W5ZA 3W84A 2G97A 5CC3A 5D8WA 5F4WA 1DV7A 3IUHA 4XSMA 5G2WA 5LA0A 1DPMA 4JNZA 3O6CA 1OX5A 2ABAA 4S3CA 1FX6A 3PG9A 1SFLA 1L2QA 4CD4A 1KTCA 2X1IA 1B4EA 1R6WA 4DX3A 1VEOA 3IJ7A 2JEQA 4GLEA 3QR0A 4MWAE 4ATLA 3TTOA 2O92A 4LEFA 3GYEA 1BSIA 4F8XA 7TIMA 1PIGA 3NQCA 4L4PA 3KS6A 2ZDSA 3BMXA 4DBDA 2VX6A 5CAKA 3L67A 5MKGA 4YCPA 3G77A 4GIEA 2WVTA 3PUOA 4Z0SA 3KOFA 1W1ZA 3QC3A 4CU8A 3H22A 3ID7A 3TYUA 3MT1A 2WSQA 4NT0A 1VPXA 4FLRA 1VENA 3FXYA 5T9CE 4HA0A 3BV4A 1F3EA 4K7VA 1W1PA 1MUMA 1HKIA 3ZVHB 4B3LA 3LGDA 4IXHA 1OD0A 3PN8A 3SQLA 4EP8C 3EKLA 1X98A 4Q4QA 3C2EA 4AEOA 3U7VA 1F07A 1R46A 1VBJA 4S3EA 1OEPA 1EC7A 4GD0A 4GXWA 3C8FA 3NGFA 4UFHA 3G0UA 3GNRA 5IHRA 2W61A 2XSAA 1Q66A 2VKZG 1A3HA 4G1NA 4UTIA 1H1YA 5BNKA 1JRCA 2QPUA 4IMDA 3QH2A 3A13A 3O9NA 3G24A 1TMQA 1VKFA 3UCQA 5CSYA 3S46A 4AZCA 1UQZA 3BUVA 4WSHA 1NDZA 2WMHA 1UZ1A 1KQZA 3N6QA 3MO4A 3AROA 5AC4A 4CNPA 1G4TA 3PG8A 4LEQA 5GPRA 1VAHA 4NKCA 3T0CA 2R91A 2ZKMX 2E67A 5HJLA 3VX0A 4BEUA 1J0KA 1QNPA 1O5RA 5D03A 1FHUA 4KEMA 3AZSA 4GNKB 1RCQA 1RJRA 1GPWA 4YHEA 1UWRA 3QVQA 2QCNA 3SRKA 2WSYA 1V8EA 4YN5A 3B9EA 3HPAA 3T08A 4V27A 3VNYA 1WP6A 2ZX5A 3W24A 3ZJ8A 1FUYA 1SZGA 4IPPA 1M41A 4H83A 3V1HA 4JQ4A 4B5TA 1RPXA 5HJYA 3TX9A 3KRBA 3V3WA 3H2EA 5E93A 1N2VA 4Y9PA 3S0CA 3KP0A 3AALA 2BZNA 1H5YA 5D33A 4C6DA 2QV5A 1EH9A 2CZ5A 1P6WA 3E3HA 3A5FA 3DGRA 1XLBA 3R11A 1J0HA 1EQCA 1AMYA 3WEOA 2QAPA 4DM1A 3W6MA 2G3NA 2WAGA 4J3WA 1XC6A 4ZOCA 1YW1A 4DBEA 3LHYA 4NASA 2RJHA 1H7WA 4HB7A 1JPIA 3TEVA 1U5HA 1GKQA 3ABXA 3AIQA 3K8MA 4JCMA 1NOFA 2FGZA 4KS0A 4L1XA 2BG5A 1UD3A 4AD0A 1EJSC 4YPJA 2QCDA 3W01A 3TN5A 1KM1A 3SCTA 3BLPX 1VYPX 3NSMA 3A23A 3DUGA 1UR8A 3NYZA 3FJLA 2C8NA 2NZLA 4L1WA 3VFCA 5HUOA 1WCGA 3IIXA 3M5VA 4N9DA 2XDFA 1UASA 2V5JA 2Z7GA 3QRHA 3IV8A 3LGEA 2Z00A 1PZ1A 2OKOA 4IJCA 1R3TA 2ZYFA 3GR4A 1F05A 1ZBWA 3CWNA 3RG6A 4Q8VA 2FLIA 4DJDC 2YGYA 4G8TA 1V3HA 1VJIA 1Q6DA 3LI1A 3SURA 2ZUTA 1W5OA 3MMWA 3IJQA 3B03A 4R7WA 3GHRA 4QBXA 5HWNA 4ZR8A 4AZ7A 2GJLA 2H8XA 2ZUMA 1DIEA 4PTWA 3KW3A 1OFEA 4YXGA 1CWYA 3W72A 3I6RA 4KWOA 2AGTA 2GGHA 3URBA 1I0DA 3U3HA 3H26A 1U83A 4Y90A 1Q6RA 2G3IA 2XYLA 4JIRA 2DVTA 3DYOA 4O18A 1E0VA 5DX7A 3BZGA 3KRZA 3UNTA 1EWDA 3AWNA 3UW6A 1U1JA 2R8WA 3ZSTA 4GWEA 3TJLA 3EX2A 1TE1A 4IMGA 3WZ0E 2X40A 4JQ1A 4UWMA 3AIWA 1OZQA 4D6FA 4O1EA 3D3AA 1ZJHA 2PGWA 5AN7A 1GT8A 3SRHA 2XG9A 1Z69A 4NI8A 4P7OA 3DI0A 3KVMA 3R5EA 4G9PA 3KRSA 3VKDA 1Z8AA 4B5XA 1MZRA 4JTLA 3AOFA 1RUSA 4L61A 3BMVA 3QGAC 1TUXA 3VKAA 2P3ZA 3QKZA 1B9ZA 3NJ3A 5B80A 5I0DA 4WGXA 1QOXA 3G1YA 5IOBA 1V3JA 1KWKA 1ZP3A 3NL6A 2WLYA 4A6GA 1VFHA 3MSDA 4V28A 2NVDA 3GBEA 3KHDA 4DB7A 4GVIA 2D23A 1MO0A 3T4CA 2VRKA 3VO0A 1RK6A 1RD6A 1UYQA 3UXDA 2CBUA 1B3WA 1J0YA 2CW6A 2WM0A 1NIUA 1IZJA 4O16A 3W7CA 4EPEC 3LSBA 3CLMA 4LQ1A 3BLOA 5AC5A 3APYA 3NR0A 4WY0A 3RLVA 2Z1SA 3PJXA 1A5AA 2OSXA 4MLJA 4FLOA 4IWWA 3UR2A 4XK2A 2Z1XA 1DORA 4YIWA 4ML4A 1R3QA 1FWJC 2GGIA 3OA5A 3B4YA 1JZ2A 1LRQA 3RO8A 3R25A 3A3WA 3STCA 1AW5A 4UTJA 4LPCA 2O9OA 1YDNA 1C9WA 4M81A 1F4AA 4Z2GA 5LNRA 1FWAC 1UW9A 1TELA 5G1MA 4XIMA 3VIJA 3BK0A 1LORA 2PDLA 4DZIA 5C9ZA 2V5KA 3E0IA 1WA3A 4ZSUA 3OLIA 3W7EA 1JJKA 3F5LA 4LB3A 2ACRA 4KEVA 3NQGA 1JR1A 1G4EA 1NDWA 4XVDA 3CIWA 4P7QA 5BMXA 1G94A 1J8VA 1RQHA 2P10A 4M5PA 3VINA 3CASA 4P61A 4JTHA 3PR2A 2ZUSA 4IQLA 2WW5A 4WR3A 3VE9A 4YWIA 2QVHA 4DZAA 5FKYA 1V02A 4L9YA 1QWGA 2PDJA 2JKEA 3BCDA 4ZQCA 3OZOA 1GYLA 3R58A 1V6VA 4JY8A 4NZCA 3UU0A 1KV5A 4MTVA 4RDZA 2EF9A 2D0FA 1FDZA 4DXKA 3MZ2A 3IPWA 2WYSA 3B8DA 1KW1A 3V0TA 1XKYA 3SI9A 1AW1A 4ZBCA 3L4TA 1HGWA 1GOWA 1VFFA 4DI9A 1VFSA 3QQ1A 4A21A 4NJIA 4N42A 1CXFA 1PZ0A 2OZ3A 3G1HA 2WCAA 3N73A 2QCLA 3IK2A 4W9TA 2XHYA 3MVTA 4MNLA 3PZOA 2PF0A 3HGOA 4AVOA 4G7FA 1S5MA 3ARQA 3N25A 5EKYA 4IGHA 2EXOA 2WB5A 5DFAA 3ZLHA 2YA1A 1PIIA 1S5TA 4ZXOA 3KVLA 1HIZA 2PDYA 3W22A 1S5VA 3RCMA 2GQ8A 4UXDA 2PCQA 4QJ5B 3WQVA 4M6QA 4ERGA 1KB3A 3H24A 1YRRA 4S1FA 2HVNA 1J79A 3CV1A 4HN4A 3URQA 1NOUA 1OFRA 4FNSA 1OX4A 2J9ZA 2HBVA 4JFWA 3KBJA 1CLXA 3U2ZA 4A4AA 4RV8A 2GJNA 4O0KA 3GG7A 3W00A 3A5VA 2ALRA 3W29A 3IJ8A 3KOYA 1OFDA 2XJ7A 3RXZA 3DKLA 1OCBA 1FDJA 4KCUA 4QM1A 5ABGA 5KTLA 3RMEA 4Z42C 3KHJA 1EWEA 1JFXA 5ABHA 5DMLA 3AMDA 3P80A 3W75A 3SO7A 1P0BA 4HU3A 4I9TA 3UWUA 2VGFA 3E2SA 4FO4A 4O28A 2PGEA 3R10A 2JE8A 1VB9A 3CK5A 1FHVA 3A64A 4JKMA 2DV0A 4GJIA 4ZODA 4HPHA 4XO6A 3RR4A 1EEPA 1TWSA 5J5RA 2DIJA 4BHYA 2OQHA 4NU7A 1VEMA 4PL1A 4NYUA 3QOMA 2OYKA 4PN2A 3U2OA 1J11A 1X8FA 1L6WA 1XCFA 2VZTA 3DG3A 1V3MA 4UQBA 2Z27A 3DFSA 3WQCA 4RK8A 1TPB1 2G96A 2PMQA 2BVWA 3IIZA 1UA3A 3MHFA 1OYAA 1P7TA 1NVMA 2VENA 2HBXA 3FAXA 3JRKA 1EZWA 2FTYA 1PX4A 3L7RA 3ALFA 4UQEA 4CNOA 1F3TA 1X6UA 4ZMGA 4RPPA 1E0TA 3CT7A 3LPGA 4IL2A 5I3JA 1SZEA 4KERA 1ZY9A 1TPUA 2ISVA 5T8GA 3FXGA 1DJNA 3GD6A 1DJQA 4ICCX 1KO0A 1P0NA 2VRQA 1ZLPA 4UTMA 3OP2A 5I3IA 4OWGA 4B5SA 1W9BM 3LHUA 1VFMA 1S2AA 5CAHA 3OG2A 5EU9A 1TA3A 1EGZA 4C7DA 3VOJA 5C0QA 4E2BA 4ZA0A 2JKPA 2F2KA 4XO7A 3V4BA 1RXOB 3H53A 5FJJA 2PURA 4H8NA 1KD0A 5A2CA 4HU0A 1Q7MA 3VIKA 5RUBA 1NWRA 1XIEA 2F61A 4HK6A 4HK7A 4Y6GA 3P8IA 1WO2A 1N7KA 3JZEA 1T8QA 4K68A 4K6AA 3CQIA 3V0SA 4ZL1A 2F8QA 2FGBA 4CQBA 4O15A 5J8LA 3WH9A 1GYNA 4EWJA 1GVOA 2CLHA 1FWWA 3UG8A 2GDQA 3WQ8A 1X8CA 1GJUA 2ZC1A 1KCKA 4DJEA 3GKAA 3BG9A 4U4MA 5JH2A 3WNMA 3WNKA 5DELA 5F2MA 4HZ7A 1CXKA 4PMDA 3W76A 1F4HA 2OODA 4GUHA 1KCLA 1N8FA 2YW3A 3R94A 3ZO9A 4WUIA 1DWGM 1A0EA 4FAMA 2Z1KA 3UZYA 4RKAA 3TMQA 1FHLA 3D47A 3K4DA 4G56A 1UD4A 1Z44A 2QF7A 3CO8A 4GIAA 4AWSA 2NXHA 1W9PA 2QAFA 3W2MA 4CNSA 1TKKA 2WHKA 5A6LA 2IPJA 1VFTA 4ZOAA 5HWJA 1CGUA 3KLLA 4ACZA 3TA9A 4H2HA 4FOJA 4GVFA 2OT0A 1MEWA 3LV6A 5D9OA 2OLSA 4QDWA 3ARWA 3JZUA 3I3EA 1QDSA 3O07A 2BXVA 2VWTA 2H3DA 2FB2A 3I7SA 2O9PA 2INEA 1QASA 1VPQA 1F74A 2PTZA 2F84A 1JDFA 1GEHA 3CHDA 3F4WA 2B7PA 5DANA 3GR7A 4GNVA 2D3LA 2PRHA 4DO4A 4NNBA 3W1RA 4BQ5A 3FA3A 3V7PA 2CLPA 2HTMA 3W9ZA 1HKKA 4M8UA 5CH9A 4GYJA 1EJTC 5KETA 2W92A 1P1MA 3SGGA 1WXJA 5IHSA 1FCUA 4WY0F 1Z41A 4ZOBA 1HG3A 1HJWA 3DERA 2PGRA 4IIFA 1E1CB 1B31A 1KFKA 1P7TB 3W02A 1IEQA 2GYIA 2G37A 1ISVA 1KBKA 4JTJA 2NX3A 4TIMA 1DXFA 4IMAA 1E43A 4IPLA 3KBWA 1PO9A 3A4AA 2VL4A 2AKMA 3VM5A 4C6QA 3TROA 5C9XA 1PWMA 1UWUA 3GTHA 5F4SA 2A7RA 2DDXA 4XSLA 2XUCA 3WSUA 2QUMA 3GTFA 4PBFA 3T2OA 3E5BA 3CZ8A 5CPNA 4MZ8A 3RM8A 1A5BA 2HDJA 1E5JA 3N12A 3LK6A 2ZADA 3P84A 2I9UA 2VEMA 3CB3A 2QMJA 3WQ5A 4O54A 6CGTA 4IJRA 5HANA 1FDYA 1XG3A 1Z7AA 2GWNA 5ENLA 1NH6A 3KX6A 4I9AA 1E9IA 2Y2WA 4L65A 3SW6A 2NQJA 2FZMA 3N4EA 5DT5A 2QGHA 4P7NA 3P14A 5KEZA 1BKHA 1HNYA 1TTPA 3ITGA 3BVJA 3RILA 2XIBA 1ECQA 3WUEA 1JFHA 3LTYA 4UMBA 4PC8A 5CPMA 4PMYA 3OYZA 1VCVA 4U2YA 5D2XA 3ITLA 4Q4KA 1RPKA 1XDMA 1X39A 3KBMA 3A12A 3H7RA 2OZ0A 1E15A 1KKRA 3GNOA 4LS2A 1UP2A 3DKJA 2E5CA 1A5NC 3Q2DA 5M1TA 1L6FA 3ZT6A 1EOMA 2QNEA 4H6EA 1HQTA 5EPDA 5A6BA 4MSSA 2FB3A 4QLLA 3PBUA 3PBGA 3PWGA 3W07A 1JEZA 3MSRA 1QPNA 2BWGA 1LQ2A 4H7VA 4RPQA 2PS2A 1UWSA 4KWVA 3WO8A 1DJGA 3W0KA 2YCEA 5D2YA 4KKXA 3EEGA 4K8EA 1C8XA 1MYRA 3IV3A 1UZ4A 1ADSA 5LXEA 1IEVA 4L80A 4OV4A 2YSWA 3QSTA 4XBJA 4XB3A 1GW9A 2FYMA 5HQMA 1CIUA 3BH4A 1TX2A 3CHVA 4PFHA 3SECA 1GJPA 1TMHA 3NYDA 1H60A 1PVNA 3CZGA 1POJA 3FDKA 2PP3A 1WXZA 3QF0A 4IG2A 3PJUA 3EOLA 5BXTA 2CWXA 2DEPA 3IANA 3OODA 2OO6A 4MY8A 2EO7A 4C6MA 4DNHA 1W3KA 3AXKA 1FWBC 2WJEA 1JYXA 2FTWA 5A94A 1V3LA 4ZQRA 1POKA 5T91A 3EB2A 1QCWA 3WBXA 4X2PA 4LVGA 1QPOA 4Q4PA 2ACQA 1GW1A 1IHIA 2VX7A 4BF5A 2NV9A 3QPEA 4WXYA 1X7IA 1AVAA 2V2DA 5AHEA 4N4QA 5JBDA 3IVTA 4CU6A 2ZA1A 4HHMA 3G1RA 4UTUA 1S3HA 2Y6ZA 2B7NA 4D6CA 1A5CA 3KLKA 1YXDA 4OTKA 4AFYA 4C7GA 5C2XA 1B3ZA 1SPQA 1T41A 3UA4A 1HKMA 5B7YA 3SCQA 2RH9A 3OW1A 4AAJA 1A53A 1TCMA 2H9AB 4I5RA 2CXGA 2PUZA 2FQIA 3UJFA 3MMDA 4M3PA 3NEHA 3KWSA 1KCZA 1JNEA 1DYSA 3W2JA 4EXBA 1OK4A 1AQFA 2VQUA 4PMUA 3HQPA 1M65A 4D6GA 2C3ZA 2V2CA 3WMLA 1G01A 5GJMA 4MNMA 1UP3A 2HWGA 4C6LA 3KOZA 3W7IA 3TWBA 2MNRA 1HX0A 1IT0A 7REQB 1RAKA 2WLZA 3KUMA 1J96A 2WKLA 2YDQA 2YA0A 2YZRA 4AZHA 5CBJA 4WK9A 2YYUA 3GKFA 1UD2A 4FNRA 2J78A 3W82A 2RAGA 3WLHA 2R24A 2WVUA 1UKQA 1VFOA 2ZZ5A 1AQMA 3T07A 4X0NA 5EMLA 2RDUA 1ESWA 1UIOA 3TU9A 2OOGA 2ZWYA 2Y8KA 1E70M 3WF4A 3N6JA 3U5UA 1UC5A 3UERA 5JH1A 1RP9A 4M0XA 1E1CA 1W1VA 1ISXA 3GXIA 2IXUA 3WLRA 1RP8A 4D2JA 1IEXA 3AO0A 1XM3A 1TRDA 1XPGA 2NV1A 4B15A 2QPXA 1EJRC 2YL6A 3V1PA 1UPMB 1G67A 1U30A 5AC6A 4B5VA 3BJSA 3OVPA 4FNQA 3GU9A 2BXZA 4RV3A 1H7XA 1VH7A 2HXTA 3U57A 3ANUA 3FSTA 1Y5WA 1V3KA 2HSAA 5F2LA 2ISWA 4GQ0A 3ONCA 3V36A 4H8HA 4AIOA 2HVOA 4PB4A 5JIWA 1FKXA 1BFNA 2CWNA 2I5GA 3G1VA 3FNDA 4DUWA 1VIZA 4F0SA 2CETA 4MYXA 2PDCA 1XIGA 3QPZA 4JTAA 1Q7QA 3VKBA 4LAZA 3FEMA 1QNOA 1KFEA 2VD9A 4MWAD 1AA1B 1JYWA 2FH6A 2ZXQA 2VEIA 3LUTA 4IGMA 3LHWA 2B81A 1BLIA 2X7VA 5LNWA 3L4VA 4W86A 5DEZA 1XPYA 1EGMA 3C2RA 4YVPA 4PTMA 3O2LA 4OUIA 3OJGA 4PRTA 3DC0A 2DZWA 4JTIA 1TG7A 1EF2A 2WANA 1D8WA 5D2WA 2PTYA 3BJFA 5FJUA 1VF8A 2HMCA 1QNRA 1BG4A 3REQA 3S6OA 1RR2A 3H4XA 4NAEA 1RQEA 5DXXA 2O56A 4GZIA 4GYPC 4QITA 2Y88A 4KH2A 1UB3A 4J35A 1AW2A 4Q3MA 2PZNA 4GKLA 4R85A 4HBKA 1Y5VA 5CSSA 3WEMA 1OT2A 1P6CA 4GXMA 3VPLA 1R3SA 4H9ZA 3SBFA 4GHRA 2X30A 1X96A 4MWAC 3UA3A 4J27A 4NXSA 4LVDA 5TAOA 2VZVA 4OT7A 4UTFA 3GW3A 4W5UA 3WN6A 5IBXA 4V2XA 3NAVA 4CQCA 5JBFA 4NX0A 4O1AA 3PJWA 1S5NA 1KM5A 1XW8A 4HOWA 3ABQA 1XYLA 1L6YA 5MF5A 5A8NA 4MZ1A 3RK8A 4DJEC 3W88A 1LJYA 2WSKA 4FP1A 4WD0A 1OYBA 1L9WA 4TR9A 3CO4A 3MDWA 3BAIA 3UWZA 1FCQA 2PLMA 3VNJA 2BNJA 2I17A 4GJJA 4AD1A 4ERIA 3HZ3A 2P8BA 2OOFA 1CXEA 2PDNA 4EIVA 3AZRA 3DGBA 1SVDA 5D8ZA 1ADOA 1VBHA 1JDAA 3G0XA 4UQCA 2PD5A 3B97A 5HULA 3RJXA 4B9ZA 3DG7A 4GI4A 3ARVA 5A1AA 2YL8A 4P2VA 2OYLA 3R8GA 1MUCA 3CMGA 1ZAIA 4B9YA 1TPFA 1XC4A 1YNPA 3EOEA 4AH7A 1PEZA 3CUFA 2FHCA 3VDGA 3M0ZA 2EHHA 3BLIA 2V82A 1EP1A 1QOQA 2HV5A 4I5UA 1E3XA 3VKKA 1A3WA 1QW9A 3BANA 1K70A 2QMKA 1DBTA 3E96A 3FSUA 5FESA 1TJPA 4AEEA 4B2DA 5H2ZA 1EDQA 4DF1A 4O4WA 1HXJA 3BWWA 3VILA 1XRVA 2HK1A 2OU4A 3P2VA 4GOAA 3L0KA 3DFNA 2Y61A 5DY3A 3KRUA 3UJ2A 3VCRA 4JTUA 1O5QA 1UH3A 3M46A 3N4AA 3HPFA 2G4FA 1FTXA 4NZFA 3GVQA 4C91A 2EG6A 2XIJA 1REQA 2XGZA 2PBGA 3SCPA 3WF3A 1Q85A 6PTDA 3N29A 3NPVA 3P0XA 8A3HA 1K7FA 3MUZ1 3UWWA 1R8LA 4ROPA 4FXSA 1X6NA 4DO5A 4J2PA 3T4WA 4C60A 3MUCA 2Y70A 3DYMA 5LNVA 1N8IA 4EAMA 2ZC8A 1QU4A 4KCVA 3BCJA 3QTGA 1KM6A 4PTXA 1CXLA 2W9MA 3STGA 4KIEA 2ZCGA 4E4PA 3CPRA 3MV11 4FB7A 2BY1A 4JQ3A 4E8DA 1TSIA 3RPTA 4UMAA 1JGMA 3QHMA 1TV4A 3CS2A 3WLLA 1ZALA 3RLHA 3W53A 3SFKA 1J5TA 3HGSA 1CGYA 4XBSA 4O1DA 3GHUA 1M5WA 1QVBA 1OGSA 3R7MA 2I7GA 4DJFA 3M0MA 1GZGA 1YMYA 3PZNA 1SW7A 4AWUA 1JF6A 4CCCA 2R1PA 3H2MA 1NP2A 3MUY1 9XIMA 5I23A 1SFSA 4PL2A 1OCNA 3B0YA 1BWVA 3IJIA 1BXCA 3WLTA 4H8VA 4BEQA 3A24A 2C0HA 1FP8A 3AIVA 3CGTA 3GUWA 1FBAA 1QR7A 3OPSA 4LVFA 3RPDA 4Z08A 4WDXA 4GC4A 1QFEA 1FWDC 1BHGA 2WNWA 2GLKA 3RU8X 3EWXA 4AW7A 1IEWA 3WUBA 2ZDRA 5A5WA 2PWUA 3KXQA 5FJTA 2J6VA 3RPMA 1NARA 2WNNA 2VR4A 3OB8A 3DX5A 3SZ8A 3N14A 4OIFA 3UWQA 4B5UA 3HQ1A 4DJFC 5DXYA 3S9ZA 2WVSA 3OOQA 3OU8A 1RJQA 4QCFA 3DZ1A 4I3GA 5FF4A 1ITXA 2ESCA 3LENA 4IIDA 2W63A 3VC6A 2UV8G 4R9OA 1VR6A 1EHAA 4GK8A 4C6CA 1E9LA 2P0IA 3TJXA 4GUGA 1JCXA 3EOSA 4WLCA 1PHWA 4IP5A 4HTBA 3XIMA 1UROA 1XKJA 1KRAC 4MWAA 2GVLA 1W3IA 3P74A 4A8LA 1TO3A 3GVVA 2QUNA 3EZ4A 1CX9A 2BY2A 4DBWA 1YKWA 3DBPA 4XD3A 1DWIM 1C91A 4YTUA 3ES8A 3FJ6A 4ZFMA 1F9CA 2IS7A 4UCGA 3TZFA 2FZDA 2WBGA 2ZRWA 3V35A 1J6OA 2AL2A 1UR1A 3KE0A 4US5D 2JGQA 2HS8A 4P8XA 1CXHA 1E55A 3MSYA 4ZB0A 1GTHA 4RW3A 3W7JA 1C7TA 2ZE3A 4MF4A 9CGTA 4N0RA 5C54A 2ZZ6A 2X09A 1Q4NX 1X38A 1M7XA 3OO2A 3GDKA 5CZKA 1FA2A 5CPLA 1V6YA 2X1TA 4LCRA 3GVRA 3DN5A 2HVMA 4PODA 3S6DA 1K8YA 4KCWA 5A6MA 2PDQA 3VNKA 3AXMA 1TX0A 3LHTA 5FJRA 3W1TA 3M0JA 3PZMA 1EEXA 2PDBA 4IP7A 2Z24A 2ISSA 2CLEA 3MCNA 5HK4A 4A35A 4PE8A 4IX2A 3HMCA 5H8UA 2Y5EA 2VDGA 1C8YA 4DZHA 4QE5A 5E6ZA 1GVYA 4B92A 4H04A 1H09A 4NI3A 2PU0A 4LNCA 3LZ3A 4G6CA 1V77A 4OJYA 4HP5A 3FIGA 2VX5A 3O6AA 1TPEA 2GUUA 4B16A 5DCDA 2J88A 1QI2A 1XP3A 3LM7A 1U1UA 4PEEA 4BR1A 4LH8A 2FVMA 2D69A 3IRDA 2CBVA 2X1UA 2AOSA 3BURA 2V68A 4F9DA 3TYAA 1UG6A 1KGUA 1T0OA 1R0MA 3LGGA 4IIGA 4ZB5A 1LL4A 1J18A 1OFOA 4JIPA 1JAEA 1H7OA 3G1DA 1H7RA 1HJVA 3P93A 4S3KA 5G5IA 4AB4A 3UXIA 4FX7A 3TFXA 2FHFA 4JKLA 1YPIA 1SO6A 5BRQA 3N15A 2DQXA 4U31A 5HMSA 1GZJA 1PJ9A 4H1ZA 4JN8A 1XFCA 2A85A 1WQ5A 1EYEA 4R53A 4KGLA 3GTNA 1Z42A 3VM7A 1X1OA 5E09A 2GK1B 3CMFA 2QR6A 3LN3A 3PBYA 5K3VA 1Z48A 1SZRA 1ODUA 3UD6A 4JTEA 3DENA 4ERAA 2VGGA 3P5YA 3AU6A 1HVXA 2DW6A 3B06A 4PMOA 2W5FA 4V1YA 3BAJA 2PC8A 3IVUA 1FCVA 1HKVA 3TLQA 5C2CA 3PTMA 2OX4A 4CGTA 1EP3A 3TQ0A 3N04A 3BO9A 1QRQA 3Q58A 1KBLA 1HKJA 5K4ZA 3WD3A 3VOGA 3HG3A 1RSCA 1Z6KA 1XIMA 4DO7A 1RCXB 1VP5A 4KEZA 1IF2A 4S3DA 4ZZ9A 3PM6A 3N6HA 3I4KA 4TOQA 3FN9A 4X3ZA 2CC0A 4IFRA 1A5KC 2XH4A 1JDCA 2WQDA 4QDPA 4TTGA 3S5ZA 5SWUA 3AAMA 1DP0A 3WK0A 4C6PA 1W3NA 1OX4B 2XU2A 3ITOA 3GC2A 1YADA 3HG2A 3D6NA 4WZHA 4GMEA 1H62A 5I3GA 4PMVA 4MKVA 3EX4A 4O10A 4J7RA 2WZMA 3GH4A 4PFMA 1GVQA 3WH5A 2I5QA 5FEPA 4PRRA 3IUDA 3FYOA 4K38A 1JVNA 3GIQA 4HT3A 3ZFHA 5D4YA 2WCSA 4C5ZA 3WG6A 3BGAA 4UOZA 3MBFA 1LCOA 1FWSA 1VIWA 3T6CA 4E5TA 2Z29A 3TC3A 2X0HA 3S5YA 1NFGA 4RE3A 2QDDA 1TYGA 5I3FA 4JQAA 1WZAA 4MNKA 3TA6A 2Y0FA 2BASA 1S2CA 3WH8A 5CJNA 1MSSA 1OC6A 4PCTA 2YB4A 4TO8A 4YMZA 4GIRA 3MMTA 2QUTA 3OLDA 3QHNA 3RX3A 1SSDA 3W3OA 2CESA 3GSMA 4BF9A 2Z4GA 2V3GA 4ADUA 4DWSB 1G69A 2UY3A 4AC7C 1R2RA 2VR5A 2QIWA 1DJZA 3LPPA 5FAGA 2DQWA 3TQPA 1FQ0A 2XM1A 5KMYA 3QLLA 3DESA 4CCZA 2HXUA 1U22A 2GSEA 1Q6EA 4JYEA 2G50A 2ZTJA 4FR1A 1HP4A 2C91A 3A21A 1JDEA 2PF8A 1X1ZA 3USZA 3TJIA 1GQLA 4L7ZA 2IQDA 1RBLA 4UC5A 4E6MA 2GVGA 5F4XA 2CLLA 4IPNB 4LF2A 4Q33A 4I7WA 1PSCA 2WC4A 4QHRA 5GJPA 2Y24A 3O05A 3DAQA 2ZX7A 1H61A 4X60A 2F6UA 2QXWA 1WBHA 2NT0A 1PWLA 1VHCA 4I9MA 3PNZA 4UTWC 1E40A 3AMCA 3E02A 4E2VA 4ECLA 4G1KA 1T96A 1WXYA 1I1XA 3LBCA 4Q8OA 2EKGA 4M6PA 4ZENA 1CGWA 2ZIDA 3K13A 1E56A 3ENLA 2PPGA 4UTLA 3L4WA 4MLRA 3H7UA 1E0WA 2DJXA 4GUIA 5FEZA 2CLOA 3QV8A 3RN6A 3PFRA 3TW9A 1E5NA 2WK2A 3EB3A 3TYDA 3MKCA 3S2CA 4ZGYA 1A50A 2X8RA 2X16A 2WSRA 5AB3A 2Y8VA 5TNVA 2E40A 4AZ6A 2VGIA 1KWGA 3L5LA 3SCNA 5EBUA 2AL1A 4JNMA 3DHUA 1E6RA 1R85A 2YIHA 1ZCCA 3WLSA 1W32A 2VHLA 3GR8A 3KFTA 3R8RA 4CNUA 4JICA 3FOKA 3LCFA 1EIBA 4LBSA 3DC8A 1THFD 3VKJA 4MB5A 2Y1HA 3LCHA 4HCDA 2ZTKA 3CT2A 2G95A 3D3FA 1QHPA 1MDLA 3G6LA 1J2BA 2CHRA 2BLEA 2E6FA 1RCOB 1K6WA 3QZAA 2A3CA 4LS0A 5CBBA 4HCHA 4PSRA 1QHOA 5G2HA 3W25A 3DFHA 1WDQA 4KRZA 4JIEA 4OBTA 1E51A 3O6DA 5CPTA 4PYSA 3CLWA 4H9MA 1V7AA 3E2QA 3TAOA 2AQWA 3H2OA 3LI0A 2H9AA 2ZXBA 4N2YA 4PTVA 5E1QA 4F40A 2J79A 3ZVIA 3VOCA 3T2PA 4NNAA 4HGXA 4U3AA 3NWRA 3DFQA 5M3WA 1HL8A 1XG4A 4MB4A 4JTSA 1J6PA 4N4PA 4HYVA 2YCLB 1DOSA 3QM3A 3BGJA 3NPWA 4N9CA 2Z6JA 2BVDA 1O1ZA 3J7HA 4XTDA 2C18A 4CN1A 2BVYA 4MOZA 3CPGA 2IKJA 2WPBA 1TVPA 4HYRA 1ZAHA 4ALDA 4Z0JA 2QCDB 4N6EA 1ODZA 1XDLA 2CKRA 4QEEA 1FH9A 3WL1A 3W7MA 4L4LA 5TF0A 1PUDA 3BC9A 2J66A 1AODA 4AISA 2D2GA 2DP3A 3NURA 4AHOA 3UGVA 4AUBA 1ALDA 2PDFA 5A6AA 2W66A 4UCFA 3DXIA 3EXSA 3ARUA 1WPCA 4JNYA 5F2GA 4D8LA 3DFOA 3THDA 4CCEA 1TVLA 3UFYA 4M7SA 3TE9A 2DZTA 3FVDA 4QFUA 1O1HA 3OVRA 2QGYA 1XFBA 4H6KA 3WQ6A 4WX2A 1R9XA 3ZSSA 1EF3A 4NYYA 3IIOA 3QQWA 5D04C 9XIAA 3R6IA 2XTKA 3KBSA 5ABFA 1MQPA 3L9CA 5E9XA 2QQ6A 4X22A 1P0DA 5XIMA 4M6VA 1BG9A 3W85A 2YLLA 2I16A 1KC7A 5GVJA 4W89A 4XAFA 3SN0A 4IX0A 3TDFA 3TTSA 7REQA 1I1WA 1UUQA 2BHZA 3D5HA 4XZNX 2BXYA 5I3HA 2TMDA 3S5SA 4IISA 3EDKA 4Q8QA 1UKOA 1V6XA 1O68A 1O7AA 3IUIA 1XBYA 3HURA 4GH3A 3GNNA 1KGXA 1CW2A 3PZQA 5DN1A 1WBJA 3QLDA 1PE1A 4NNCA 1QTWA 1Q45A 1TQJA 4JKKA 5JIPA 4YYFA 3KOWA 1NU5A 4NQ1A 5FJOA 1VCGA 5D37A 1AH3A 3VTRA 4Y9AA 2VVSA 3SGUA 3B9DA 4A3RA 5H91A 1S39A 1EHNA 3SCWA 4HA4A 2R6OA 2EPNA 3LHZA 2WC3A 3DFPA 1DWHM 1UIPA 1R7OA 1QW7A 4Y2WA 4FXFA 1XDJA 3EOUA 2E5BA 3H55A 3HM7A 5EMYA 4BCEA 3G1AA 1EPVA 4LCQA 1ITUA 1VFUA 3NM1A 2QUVA 3ZZ1A 3PUDA 1KKOA 4E8GA 4Q6XA 3M0LA 4FNUA 1JPMA 1UCWA 3NQFA 3WKZA 4GY7A 3ZR4A 3N9RA 4O14A 4NAFA 3EXRA 4NZ4A 1FWNA 4HCLA 4NSBA 4LVBA 3CB8A 4R5EA 2RDTA 3HU7A 2XSBA 3OVQA 3DH7A 2Q71A 3W83A 3F4DA 2J7HA 1G4SA 3THUA 1P1XA 1R3RA 4NF7A 2NVCA 1TREA 1F8IA 5AHNA 2EEXA 1NTHA 5A8QA 2V5BA 2Y4SA 4O8AA 4XD6A 3FGCA 3ZIZA 4DNMA 4NL1A 4L9XA 4TV6A 3NVDA 2IMRA 4F2UA 1JPKA 3ITTA 4X63A 3Q37A 2E9LA 4DUXA 1JIBA 2VOTA 2F38A 4IIEA 4BQ3A 3O6YX 1UA7A 4WDUA 2Q01A 1TPDA 3MA8A 2BS9A 2XIIA 3WLNA 2O0TA 1LP6A 3UR8A 2NUXA 4GYFA 5I7GA 3L4XA 4QQ3A 3WY1A 4PBEA 2YX0A 3UR7A 3ANVA 5CQ1A 3QFEA 3QR3A 1Z9AA 4R7OA 2G3MA 3GU1A 4OKDA 3ARYA 1E9ZB 1E4IA 1A80A 1V7YA 1D3HA 1UOKA 5C70A 1JUEA 1Q6QA 3L12A 2ZICA 5B7ZA 2BDQA 3E1F1 4LY8A 4MGGA 1CNVA 1RBOB 3DHPA 1XGDA 3IIPA 5FL1A 3GRIA 1K8XA 3VIOA 2XH7A 4GBUA 1X7FA 4Q4OA 2TRSA 1FWHC 4ORMA 3U6WA 1B4KA 2ALDA 3FK4A 4HPXA 1M9HA 3WBYA 1NELA 3IGHX 1YBQA 1J0ZA 5LA1A 3UQNA 2YCLA 2FMOA 1KFJA 4X9YA 1F8MA 1Y65A 4PH6A 1G4PA 1XLLA 5TQLA 5KITA 4PB3A 1EX1A 3LCGA 3CM4A 4YWSA 1BYDA 4O57A 4N6FA 2O7SA 4PCSA 1EJUC 1V93A 4XZBA 5DMNA 3CQHA 3CWOX 4Q8UA 3TC6A 3KM8A 1LQAA 3N1AA 4QSFA 3F7JA 2GK1A 3W1PA 3PPFA 3ERPA 1KRCC 1OQFA 1Q2SA 5I00A 4ONVA 4GA8A 1D8CA 1E3ZA 2PWHA 3T55A 2QV4A 3G8RA 4Z2IA 6XIMA 1K9TA 1H11A 1A4LA 3U7BA 4S23A 5G1TA 4HNTA 1NFBA 1O5KA 2RFGA 6XIAA 1OB0A 4JEQA 1RJPA 1JZ5A 2PWDA 2BY0A 4R9XA 4MB1A 1XLJA 4LB4A 4GCAA 3VABA 1R5YA 1HJUA 2VJXA 1KFLA 3B8VA 3RIKA 4LV9A 3Q45A 1JPDX 2E6DA 1PCKA 3A4JA 3W7QA 1K6AA 4UZSA 5HR6A 3VNLA 4GRSA 3M0XA 3MU7A 4CVUA 1W3JA 1UJPA 1GUVA 1EFZA 4Z2JA 1ONRA 2J7GA 3PUGA 4DWSD 4X61A 1AH4A 2CLMA 1DL3A 5BOOA 1K3UA 4LALA 4UZUA 3WJXA 1TMLA 1JCNA 3QY7A 1GTEA 4M56A 2P88A 2CCRA 3UG4A 3EKZA 4LUIA 1Y5XA 2B7OA 1XH0A 2JF7A 4WJ8A 5LXXA 3BJTA 3WQOA 1IWBA 3U48A 5M03A 2NUYA 5HINA 1CYGA 4GVHA 1PS9A 3UZZA 4D72A 4S3GA 3RRAA 4A2SA 2Q6ZA 2QVNA 4W8AA 1T99A 5C55A 1NWSA 3S83A 2YYTA 2XN1A 3TW7A 1P6BA 3WQGA 3NQ2A 4F4RA 1ONEA 2FDMA 3UVAA 3R2GA 1XIHA 2O9TA 4CKQA 1FXPA 1OADA 1Q7ZA 3M5ZA 5G4WA 1MRQA 2HCVA 2CZFA 2ZBTA 2ZZ4A 2HK0A 1AG1O 3NA8A 4GGBA 5KSWA 5C71A 3W28A 1HUVA 5FL0A 5LGXA 2FZ9A 2E0PA 3CUZA 1I6NA 2D20A 1M53A 2AAMA 5CC7A 1IWAA 4XUYA 3U5YA 8XIMA 2F6XA 1TWWA 5K4XA 3EGJA 3U4AA 1IE7C 1W1TA 3MJMA 3H2FA 4IPIA 4ASTA 5A6JA 1C92A 1LUCB 3DBNA 1TIMA 1I2PA 1ZQ5A 2HRWA 4C6NA 2OEKA 5LHEA 5FIPA 1MW3A 5KZMA 2A1YA 1DQWA 1RLDA 2ZXDA 4J3VA 3BAKA 4HNLA 3GVWA 2J25A 5AY7A 4WDTA 2G0WA 3NZQA 7TAAA 2YFOA 3GDRA 2VZUA 3S9YA 2DUXA 1OF8A 4RZ6A 2OT1A 3NQMA 3GE7A 4JFVA 3DECA 3S6TA 2ONEA 3W81A 2EPHA 3OBAA 2ZFAA 3N2TA 3AUOA 3IACA 5HWMA 1A5OC 2E1DA 3GZ3A 1SW0A 1HF6A 1GQKA 3SM0A 1WKYA 5FAJA 4UMCA 3S1XA 3T40A 4QG9A 3MYOA 4GIYA 5E70A 4QAWA 4Z1AA 3LY0A 4JTRA 5A6SA 3IGUA 1M03A 1E4MM 1K1DA 4A3HA 3TIMA 3MBDA 3K2GA 2CNCA 2I5IA 2DZBA 4KWUA 2GOUA 2P76A 1RA5A 4JDYA 3BE7A 3G22A 3NO5A 1FY6A 3G0SA 4X0VA 3AS2A 1NDVA 3P61A 1WKDA 1XIIA 4LTSA 3CC1A 1AFSA 2PGFA 2WMJA 3SIMA 3LERA 4RXFA 3MHUA 3EA1A 3HF3A 4H9TA 2Y89A 4IP4A 3M6DA 1FWEC 2X2GA 4D6EA 2OWCA 1VCFA 3LLDA 4JFUA 2QKFA 2A7NA 3EWCA 3QR1A 3KEHA 3PUEA 3W7RA 4PR4A 2C79A 2OELA 9RUBA 2AAAA 2V67A 1K7XA 3AXHA 5HUPA 3PAOA 1CGTA 3WLMA 1SUXA 2YB1A 2VEGA 1QJWA 2B7QA 4KT2A 1ZNNA 4EPKA 2CHNA 1UWQA 1MDRA 3VIIA 3ONBA 1DIDA 3UP8A 1Q6GA 5D9PA 1PKNA 2GDVA 1XYCA 3SFWA 1GG1A 4BF7A 3DDMA 5LZLA 3F1QA 3UY8A 4MJ4A 2UWFA 4DRSA 2PDIA 2V9DA 3MB9A 2NW0A 1SMAA 5L6UA 2DU2A 4JDBA 2ATMA 2QJJA 1H5VA 5KZ6A 4NJKA 4DJED 3NVTA 1GOMA 3LCLA 1C8QA 4DYJA 4RNJA 1GG0A 1I2QA 5I06A 1WOBA 2QJNA 3INPA 4KFPA 4XIAA 2GJXA 4L6HA 4C90A 4H9YA 3QN3A 4GQRA 3B0VC 3S4TA 3PTKA 2GVEA 1PTDA 4GYKA 2GL5A 4DWDA 3WFZA 1S2TA 4JN7A 3GXMA 4PMJA 4DPQA 1QOPA 4RE0A 4I8YA 4AY8A 3KP1A 1TR1A 3ZOAA 1MFVA 2J9XA 3GG1A 3EA2A 3ATZA 1KFWA 1UPPA 2DZPA 4AD5A 2V38A 1QBBA 1TVNA 1DJXA 5G4HC 3HGRA 3R12A 3EDFA 4IQDA 2HNHA 2QS8A 3N19B 4NZJA 2ZX9A 3NL5A 1OF6A 3JR2A 1W2PA 1OCQA 2ZRVA 4POCA 3W1MA 1NP0A 3T42A 3WQDA 4NZ1A 3IJDA 4A05A 3MSGA 2VTFA 2ZUUA 3FY1A 1YXYA 1BPLB 5M5DA 2GJPA 3VNMA 1BQGA 4DYKA 4QQUA 5F1VA 3B8UA 1FCBA 3KBVA 4JTFA 4DO6A 1M01A 1LTDA 1GWJA 3N2OA 4Y9NA 2D24A 4NJGA 4C6OA 3QYQA 5U7SA 2ON3A 3PHAA 3QGVA 2Y7DA 1WDPA 3QKEA 3G3DA 2VFEA 4JD4A 3CAQA 5CJ5A 1HP5A 1YXCA 1BRLB 3VDBA 3C61A 3P62A 3WJSA 3RM4A 1JGIA 4GY0A 5ABTA 3CU2A 2V81A 1M04A 4WEVX 3NZRA 4DJFD 3IAQA 3QW4B 1JI2A 5H6HA 4CD8A 3C2YA 3L5AA 3M64A 3U0HA 1HZYA 4Q8MA 3NEVA 4KF1A 1W9DM 2BX7A 1ZTVA 3V18A 1JD7A 4FS9A 5C8BB 3EB4A 3WQPA 3BOFA 3W2UA 2NLYA 4MUPA 5H8MA 2XIQA 4XAPA 3ARTA 3PNUA 1K9FA 3VD4A 4C1KA 5A69A 1SYTA 2A2IA 3CEUA 1QPKA 4C5YA 2PLJA 3T0BA 1H50A 4BQ2A 1R47A 2H3BA 2ADAA 3PWAA 1V5XA 4U3CA 2W4XA 3CH0A 4YLWA 5ABFB 1TTIA 3PPGA 3B9AA 1I2RA 4MADA 4QP0A 4L4MA 4AHPA 2I9EA 3EKGA 5AECA 3RCYA 4DPPA 1OC5A 1DIOA 4RZBA 5C9WA 3RLUA 1G6CA 3IJLA 2XPKA 5EB8A 1XSIA 1UMLA 3LXAA 5FCZA 3O63A 4FA3A 2QULA 4FPSA 1LWIA 1V0KA 3WL0A 5DRIA 3KDOA 1O95A 1CCWB 3PS7A 1BWLA 2XVKA 2OSYA 1QNQA 1Q6CA 4IIHA 3FHAA 3YPIA 2EGZA 3LPFA 1R38A 4AY1A 1PKLA 3W26A 3SADA 4O11A 3IJ9A 3CAVA 3T78A 3VU2A 1XF0A 3SUSA 1W6TA 2FZ8A 4H00A 1JCMP 5A95A 4YYCA 3K4AA 6ALDA 3EBVA 2BMBA 2PBOA 2HISA 1TIWA 4S38A 1UR9A 1UR3M 4C1NA 4LW7A 3N2CA 4DUVA 4WY0B 1QO2A 2DT2A 2VEKA 4C6FA 3PSVA 3TWAA 2OCZA 3OA3A 2FVLA 2O55A 3KWXA 1CI1A 4JX4A 4YL2A 5LIUX 5I24A 3UESA 1ZENA 1QUMA 1MEHA 3W73A 2J8GA 4NXKA 3TN6A 5DMMA 5IDIA 3SQMA 3KZSA 2PSNA 2QCFA 4NVTA 4LC6A 1IR1A 5FF3A 4PUJA 3VD3A 3VVGA 3RYSA 1JDDA 5FF7A 2C19A 3MANA 2J7CA 3QTPA 1EQPA 1OC7A 2WKJA 1DVJA 3V0UA 2HJPA 1AZ2A 3UJRA 3APTA 5DF0A 1TPC1 1R3WA 4QIUA 5LSMA 1EJVC 4AIUA 3I6TA 2QF8A 4US6A 1FWTA 1S1RA 3V75A 3APGA 4MKSA 4K1WA 4RZ4A 2OX1A 1HKWA 1TZZA 1H1NA 4S3JA 1QAPA 4OUEA 4QJ1A 1PDYA 1SJBA 3BOXA 4O53A 5HNNA 2W3ZA 2Z1VA 4R33A 3B05A 2XZ9A 1XBVA 1E1EA 3W1AA 5AHFA 1QMLA 2G4JA 1OABA 1SZFA 4B3ZA 2QT3A 4C6BA 3VIFA 4K36A 1C29A 1JQVA 3ABSA 3VZZA 4HPNA 4IOTA 3SCSA 3STFA 1TWDA 3PVFA 1V02E 4HNUA 3TSMA 4XG1A 1W9VA 2J62A 4LANA 3NQ8A 1N8WA 2PRMA 2EPOA 5K9CA 1AL7A 3ZWTA 2A4AA 3W23A 4QJ3B 4HMNA 1KFBA 2AMGA 4GFIA 3NO1A 3VI2A 4PA8A 4H9UA 3ZT7A 4R34A 3WUGA 2J7DA 3KVJA 4F9JA 4KMQA 1FFRA 1A4MA 3MKVA 3ABOA 1YTDA 3PAJA 2NVAA 4ZQNA 2PDMA 3QC0A 2O7QA 3I3DA 2AL2B 3A47A 4WIWA 3GWQA 3KTSA 5IBXC 2F9RA 2OXNA 1U5JA 2YBVA 2CXEA 1AD1A 2OQLA 4GX9A 3MP5A 1NWTA 2VYOA 1KBIA 1MEIA 2XFWA 5FOOA 1W5NA 1ZGDA 4KESA 5I07A 1P48A 2Q3RA 1E1FA 3O0FA 2VD8A 4FIQA 3SUVA 3TZNA 4U2ZA 4UBPC 1GVIA 3GYCA 2EKCA 3K46A 5GNXA 3GB6A 3M6YA 1XRFA 1VZWA 3SQSA 5XINA 2ZRYA 4JHMA 1KCXA 2GUBA 3P81A 1AH0A 2J47A 3IWPA 3OYXA 3A6OA 4IHCA 4JCLA 1PCWA 2QCGA 2Y5SA 2E25A 3SUWA 3WD1A 1ZBKA 3K8LA 1JF5A 2ZX8A 2BGNE 5ABEA 3WDQA 3MWAA 1BXNA 1C93A 2NSXA 4M80A 1LBMA 4J28A 4PRWA 1GKRA 4A3QA 2NQHA 4AXKA 3RX2A 3STPA 3W1XA 5CLWA 1LRNA 5AYYA 1ZP4A 1VRXA 3M0KA 3VD7A 3LDVA 1TJ2A 4WGHA 4RDYA 1KBJA 1PKMA 1QT1A 1I2NA 3S47A 5I5RA 1H3GA 4O8RA 3HBLA 2REQA 2YL5A 1AQ0A 2R94A 6TIMA 5LKYA 1CB7B 3OLGA 2CYGA 1DTNA 1R3YA 2CIPA 1FFQA 3ZLGA 3HJZA 4JN6A 4JL2A 1YYAA 4UR8A 3WMBA 1BTCA 3HFYA 1DXIA 3MUAA 1CBGA 1JCTA 4FF7A 4QISA 1XUUA 3UYCA 3VXGA 2DT0A 1VGAA 4QR6A 5FSDC 5F2IA 1U33A 1FP9A 3AYRA 1IWPA 4AHQA 3LG3A 2YLAA 4MFEA 1RBAA 4WQ6A 5E6YA 1MQRA 2PCEA 4BJHA 4E0CA 1W54A 1VBGA 4W4QA 2CKSA 4JBRA 1M68A 1SO5A 1AL8A 2VEPA 4KETA 2QZRA 2E77A 2QIIA 3DIPA 3RX4A 1BYBA 3UVIA 3T09A 2Z2AA 1Y7VA 3GG8A 4GX8A 4KCTA 4P5UA 4GABA 1XLEA 4J3SA 1JZ7A 3UWVA 3ZT5A 2WHLA 5HBFA 4NZ5A 2XGBA 1A0DA 2FDSA 1QPQA 3I10A 1ZFJA 2C1IA 1V3IA 1V0MA 2DZSA 1J2WA 3HN3A 8TIMA 1BVWA 1RVKA 2JK2A 3T05A 1IGSA 2E9MA 3NZ1A 2YPIA 1L2UA 5LHFA 4FX6M 5AHLA 2EJ1A 1GK8A 4LUTA 2A79A 1E0UA 1Y8BA 3WH7A 1FHDA 1F5ZA 1MXSA 1QK2A 2H6RA 3FKKA 4AIBA 4D71A 4EF9A 2CU0A 3CIVA 2D22A 2VWSA 3UJEA 1S46A 3UXKA 1US3A 3ARRA 2PU1A 2BVTA 4JX5A 3M1ZA 1AJ0A 3RF9A 2FIQA 2V3DA 3QV9A 1HL2A 5HNTA 4JQ2A 4XVEA 1AZ1A 4ZO8A 1EKOA 3OIXA 3GIYA 2VO5A 4PMRA 2GJRA 3TSBA 3VUPA 1WNOA 1T6MA 3EX6A 4HMDA 1TV8A 3W4RA 1G9HA 4C6IA 2BP1A 3O0KA 1LOLA 3C6CA 1WZMA 3N3TA 5CLTA 3BICA 2WHMA 4H7CA 3SEPA 3N9SA 3W2KA 1Q5MA 5JVLA 3FW6A 5A6BD 5HPOA 3N17A 3M0YA 1GNXA 5EA9A 1IZCA 1K03A 1XUZA 1V6TA 2OEMA 1XL9A 4EANA 4MPKA 1N55A 2WMIA 1JYNA 1KXVA 4DLMA 3VGGA 2CBJA 4P7LA 5EMKA 1E6SM 3H2AA 2IPGA 4YTTA 2BODX 2G3JA 4D8AA 3VOIA 1GVFA 4JIHA 4A8IA 2QEZA 1PZ2A 4LC8A 1B57A 8RUCA 4PUKA 3RO6A 3LTPA 2Q3OA 3GAYA 1ICPA 1W56A 4MJ2A 5D05A 4Y7EA 2NQZA 2X0SA 4NZ3A 5G1YA 3N13A 2WM1A 3VC5A 3S1VA 1T8XA 4GXPA 3JW7A 4F3HA 1P5BA 4GI8A 3HA1A 3T9PA 1OCJA 3RAOA 1HFBA 2FGLA 3QYSA 2X05A 3WNOA 1OJXA 1K9EA 4UR9A 1O94A 2I57A 1TTQA 1RY0A 3S2NA 4QROA 3VCNA 6REQA 2L5HA 4FOUA 1DWAM 4CD6A 3THAA 1XYZA 1GQNA 5CZ0A 4HSHA 2XFFA 1VQTA 3VGDA 3WX7A 3W7PA 2B31A 2EPLX 3UPWA 5HATA 3VGEA 3AHTA 1TA3B 4BA0A 1H63A 3E9AA 4IH3A 2VVNA 4UQAA 4DBUA 3HIJA 3BW4A 5F1UA 4PGLA 1SW3A 7ODCA 3BLFA 2SFPA 3SJNA 1LWJA 4IUOA 4ZQOA 3IK4A 3QY6A 4PSPA 4QNWA 3WDRA 4MDPA 2CLKA 4TVCA 4N9BA 4KBXA 2OO0A 2G5WA 2I56A 2OJPA 3EDJA 1F61A 3BW3A 3CHEA 1K77A 3EDEA 2WPGA 4BKNA 3VA8A 4HNOA 1ISYA 3W7DA 3RHGA 4I9JA 2VCBA 2E5DA 2PRLA 4FMVA 3OGRA 2NQLA 4J3UA 2WJDA 2V5CA 4GZ7A 2OPJA 4BFAA 3CTTA 3BG5A 1X97A 1MFUA 1XS2A 1E6ZA 4M6UA 1YX1A 1YPXA 1I8JA 2DVUA 1IT8A 4JHOA 2KAUC 3GC5A 3GY1A 4Y9OA 4YU1A 1I2OA 2A6LA 5LYRA 4W88A 4KIRA 1HVQA 3N18A 2FKPA 4O13A 4IF2A 1YDOA 4UNKA 1GGOA 2NXGA 1E6NA 1F6KA 3CQ0A 3TNOA 2NX1A 3IARA 4OZOA 3FAWA 1W1YA 2VP8A 4L6OA 5C9UA 2WVVB 4DLFA 4D8ZA 1G7VA 2RGMA 3TW6A 3R8HA 4QG8A 4Q4MA 4JZ5A 4DZ5A 1FH8A 3WBWA 1OFAA 2PTDA 1EYWA 5BOEA 3PZ9A 3L0NA 5A6KA 2DPEA 2R1KA 3VMNA 4Q8TA 3WJWA 3LRMA 4YTSA 5AOUA 3PBWA 4HZ6A 2VFDA 2XZ7A 4GC3A 3E12A 3SN4A 3TONA 1IIGA 3W37A 1F7BA 1SQ7A 1GYMA 4X2RA 1EDGA 1ZS2A 1LDCA 2GUYA 4M51A 5HXMA 1PTGA 2DZVA 1DE5A 3BLKA 3WLKX 3SAZA 1I9CB 5D09A 2YXGA 2EQDA 2Y85A 3DOPA 3RNDA 2DIEA 1QWKA 4JTQA 4W84A 5AHMA 2ACUA 4G7EB 3P60A 4PCNA 4CNNA 3AMGA 2ZRZA 4L1GA 1W9UA 2VDHA 2P1FA 4RLIA 4HNNA 4FOKA 1XICA 1F6PA 1D7FA 1B54A 5CGMA 4JXCA 3W74A 2E6YA 3L4UA 4XQ6A 2OG9A 1DHKA 1ZJAA 3BLLA 4Y96A 3W7GA 1XLAA 2AGKA 4HMEA 4KRTA 5H8PA 1FKWA 3UZ5A 2JALA 4OOUA 5CZJA 3CYJA 3ZLFA 4Y8FA 3N2BA 2QDHA 1U5VA 3GFYA 1AD4A 4E2OA 1S5WA 1V0LA 2JFEX 3WDHA 4GVGA 2XM2A 4KQNA 2XFYA 4O52A 2X1RA 1OIFA 4KEUA 4V1XA 2WXDM 2XN2A 4MAZA 2VC7A 3L5MA 2QJHA 3K4WA 4QE1A 1LT8A 3PF3A 2VZOA 3P82A 4AF0B 2WKGA 3N4FA 1JCYA 3WK1A 2E9BA 1CT5A 1B1YA 4TUFA 3UWEA 2DUZA 2DGAA 2GSJA 4GO8A 4OFCA 2CEQA 1WZLA 4TU1A 2NUWA 1F73A 1N82A 1ZJBA 4DXXA 2A3AA 2ASHA 4C6JA 1SFJA 1TV7A 7XIMA 3MI3A 2TSYA 4MG4A 2KX9A 2E7FA 3GXNA 2VFIA 3ARSA 2QJMA 3P8JA 3IIVA 4DELA 4ZQMA 1W31A 3IGSA 1QI3A 5A8MA 4QRNA 3L66A 1KQYA 1L8NA 2Y62A 3Q4DA 2DSKA 1WDRA 4AZBA 2XVPA 1MXGA 3ANYA 2OMAA 4GE8A 1LROA 1K9DA 3OTRA 2NQ5A 4QS5A 4M24A 2IQ0A 2XISA 5D9MA 1W5QA 1UBPC 3FLUA 3R4IA 3REQB 3B8WA 1LZOA 1SR0A 3ABRA 3E2VA 1OBAA 3UXAA 1ICSA 4C1LA 4CN4A 3HG5A 1LLWA 3NQAA 5GJNA 4DAIA 2D1ZA 1VLIA 2PLCA 1EPXA 3GUGA 3GDTA 2WHJA 3EEZA 4A2RA 1VFLA 3RJYA 4GY1A 2W67A 5AYZA 4JTDA 4GKTA 1SO3A 1XX1A 1CLVA 1UR4A 2VX4A 3AZTA 1UWAA 2I1OA 4LU0A 3CWHA 1TJ0A 3D46A 3CUIA 1EBGA 3FDGA 1D3CA 1OINA 2RUSA 4TXEA 3IRSA 1K4GA 3OZMA 5IRPA 2DT3A 3GDMA 3DHDA 4PBGA 1BVZA 4AQLA 4DN1A 2FTPA 1XQKA 3P67A 2Z28A 2QCCA 3U8GA 3W27A 4FIRA 1TQXA 3WD0A 1F6YA 4FK9A 1JYVA 2INZA 1MRAA 1OT1A 4G2DA 3E0WA 3E74A 4PULA 1MW1A 3KZPA 1YNQA 4HU8A 1PTAA 3VGBA 4ZB2A 1LQ0A 3XISA 3SJ3A 2IQTA 2QCEA 4XD4A 1KXHA 1E6PA 3USBA 3CV2A 2Y7EA 1MWOA 5CGTA 3N3MA 2V63A 2PDUA 5IXEA 3LU2A 4HJWA 2YOCA 2D2OA 1O4UA 4M82A 3CZLA 4ZSTA 4R88A 1E73M 2CHOA 1J0JA 3EWZA 6ENLA 4QXIA 5T9BG 2VXNA 1W3HA 1YTEA 1E4NA 4KPLA 5I77A 1P43A 3ZJKA 3A9IA 3KCLA 4XBKA 3DU0A 3WMSA 4DJDA 4OHQA 4Y9MA 3F4VA 3WEZA 1XD0A 1XRSA 2G8ZA 4D6IA 4RR4A 3G1XA 1LT7A 3WQFA 2A5HA 2AMXA 1LWHA 3WENA 4YTRA 2QJGA 2DW7A