4L1WA

Crystal structuer of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+ and progesterone
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
325
structure length
325
Chain Sequence
SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C2
publication title Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
pubmed doi rcsb
source organism Homo sapiens
total genus 119
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4l1wA00
1GVEA 1C9WA 2IQ0A 2I16A 4RPQA 3BUVA 5AZ0A 2ISFA 4LB4A 4XVEA 1LWIA 2PF8A 1QRQA 3H7RA 1LQAA 3CV7A 3M64A 4PUWA 4LAZA 4YU1A 4XZLX 1K8CA 5HA7A 1EXBA 3C3UA 1S1RA 3EB3A 2PDBA 2J8TA 2IPJA 2PDHA 3GUGA 3DN5A 1PWLA 2BP1A 1Q13A 2PDKA 3MB9A 1PZ1A 1XJBA 3VXGA 5HNUA 3BURA 3COTA 4JTQA 3UGRA 4I5XA 2PDLA 4LBRA 5JH1A 3KRBA 1YE6A 4JQ3A 4JTDA 3RX4A 4LAUA 2ACQA 3LNMA 3GHRA 5LIKX 4AUBA 4WEVX 4XZMX 2PDJA 1AH3A 1Z89A 3U2CA 2QXWA 3LQLA 1X98A 3F7JA 3LN3A 4HMNA 2PDIA 1UR3M 1OG6A 2IKGA 4EXBA 4DZ5A 2R24A 1QWKA 1S2CA 1Z3NA 4JTRA 2BGSA 2P5NA 3LZ3A 4YS1A 1FRBA 3R43A 1ZSXA 1HW6A 3H4GA 1EF3A 3Q65A 1T40A 1X97A 1EL3A 2PDNA 3LBOA 4FA3A 4XZHA 1J96A 3RX3A 3G1RA 1Q5MA 2PDXA 1Z8AA 2FGBA 1ZQ5A 2FZ9A 5LIYX 4FAMA 4ASTA 3V35A 2PFHA 2ACUA 1RY0A 2NVDA 5AZ1A 3UZWA 2F2KA 4QBXA 5HNTA 4WDTA 2WZTA 3RX2A 1YNQA 4JIIX 1JEZA 3V0SA 3ERPA 5LIWX 2PDQA 3CMFA 4JIHA 3NTYA 1EKOA 3R94A 3WBXA 1YE4A 2FZ8A 2HE8A 2IKHA 1ADSA 4XZNX 4WDWA 4JQ1A 4L1XA 1RALA 2PDMA 3Q67A 2PD9A 1IHIA 2IPGA 4Q3MA 1XF0A 4GQGA 4EXAA 4F40A 2ACSA 2FZDA 2PDUA 4MHBA 3FJNA 2DUZA 1IEIA 1AZ1A 4WRHA 4FALA 2INEA 1Z9AA 4H8NA 4YVXA 4OTKA 4GACA 4JQ4A 2BGQA 3EB4A 4JTAA 4GQ0A 1AFSA 1S2AA 3WG6A 3CV6A 3M0IA 4ICCX 4NKCA 2PEVA 2HV5A 3T42A 1SM9A 2CLPA 3V36A 4L1WA 4G5DA 1AH4A 4QXIA 4XO6A 3WBWA 3LD5A 4HBKA 2R9RA 4GCAA 3R6IA 3V0UA 2NVCA 2HDJA 3CAVA 4XVDA 2PDFA 2PDWA 4DBWA 1PWMA 3UWEA 4JTCA 4ZFCA 5LIUX 3D3FA 4PUUA 1XGDA 3O0KA 3R8GA 3S3GA 4XZIA 3LUTA 3LZ5A 1MI3A 5M2FX 5LIXX 4WDUA 2VDGA 3R58A 3DOPA 3UFYA 4IJCA 1AH0A 5JH2A 1US0A 1AZ2A 3ONCA 3V0TA 1VP5A 1YNPA 1MZRA 1S1PA 1PYFA 4YVVA 4YVPA 4LBSA 2IS7A 2AGTA 3QKZA 2FZBA 4R9OA 4QX4A 3H7UA 4XAPA 2IPWA 3UYIA 2HEJA 1RY8A 2PDGA 2I17A 1PZ0A 4PRTA 4DBUA 3UZZA 3N6QA 2HVOA 3BCJA 4DBSA 2WZMA 4JQAA 3CAQA 3LENA 3B3DA 2IQDA 4JQ2A 2PDYA 3O3RA 2IPFA 1M9HA 4QR6A 2HVNA 1X96A 3MC5A 3GHSA 2DV0A 3BV7A 3R8HA 3GHUA 1T41A 1ZUAX 1MRQA 2PDCA 2INZA 4PMJA 4PRRA 4WGHA 3FX4A 3LQGA 4IJRA 2ACRA 2C91A 3G5EA 5DANA 1VBJA 3UP8A 3WBYA 3UZXA 2PZNA 2IKJA 3GHTA 2ALRA 1R38A 4WDXA 4PR4A 4Q7BA 2PD5A 4H7CA 1HQTA 2FVLA 3CASA 2A79A 5KETA 4XK2A 4GIEA 4LB3A 4GA8A 3EAUA 3ONBA 2IKIA 3LEPA 4XO7A 3UZYA 3R7MA 3N2TA 3P2VA 1ZGDA 4GABA 2PDPA 2F38A 4JIRA 1A80A 3M4HA 5C7HA 4FZIA 4IGSA 3WCZA 3UG8A 2DUXA 2HE5A
chains in the Genus database with same CATH superfamily
3Q94A 3AHZA 3LM7A 4IISA 3G6LA 1M04A 3CBWA 1B4KA 4PTVA 5CZ0A 5LGXA 2ZVRA 1JYVA 2P3EA 4MNLA 5HJXA 4S3KA 1O5KA 3PWAA 3LV6A 1BFNA 2YXOA 1JD9A 1PKLA 5IXEA 1FWTA 1NAL1 4QDMA 5DQPA 1BWLA 2Z26A 2DSWA 4FNTA 2C7FA 1KKRA 2WMIA 4HNOA 4NY2A 2Y89A 5F2GA 3QKEA 4GISA 4JXCA 4GXPA 1L6GA 1WNOA 4HOWA 4IPIA 5CXPA 3GUGA 2V82A 1Q13A 1CGUA 1QI0A 3UVAA 1QI4A 3M41A 4WOQA 2HBXA 1CEOA 3RX4A 2JE8A 3QV8A 3AJXA 3C2FA 4YTTA 2WBKA 4RZ4A 1X98A 2X2YA 1QK2A 3OOQA 1HL2A 1OWQA 1G5AA 1O95A 4CGTA 3HPZA 2OYLA 3RO8A 1DXFA 1KXVA 5IBXA 3TCSA 3QC0A 2YCIX 3T4WA 5ECUA 2BGSA 1Q3NA 3RYSA 3CHFA 4LCSA 3OHIA 4AY7A 1OFAA 1GOXA 4DX3A 2QCDB 1CIUA 4ZQMA 2BB0A 3H8AA 4KQNA 2I9UA 4D71A 3HV9A 1KFBA 3H2AA 2DVUA 3TR9A 1ZBCA 1EL3A 1IIGA 2PGWA 3WNLA 5C5YA 3W02A 4HA1A 1Q5MA 4LY8A 1PAMA 2QIWA 4BCEA 1GW9A 4E2DA 5CBJA 4LC8A 4NYYA 4M1BA 3IJLA 4WQ6A 4YHGA 2Y88A 4H9ZA 4JFWA 2BS9A 2EJ1A 1A4LA 4WY0A 3TYEA 3VCRA 4NXKA 4Z0SA 1XG3A 4I8YA 5LZLA 3FK4A 2XH2A 5F2LA 4GBDA 5MHBA 1J2WA 1X6NA 1B9ZA 2D3LA 1XIEA 1QWGA 2BVTA 5BYWA 4ZSTA 2PD9A 4O10A 4GC3A 1RR2A 1OC5A 1BGGA 5G5IA 2CW6A 3SRHA 4F40A 3VFCA 2A85A 1JZ8A 1Z32X 2OYKA 3V5CA 4LYRA 5B80A 5LXXA 3MP4A 1KRAC 5LXEA 1HO1A 4PSPA 4J9JA 3TQPA 5GJNA 4AWTA 3ES7A 2CLMA 5J8LA 4HJWA 1TJ0A 4LS2A 4JTAA 3VX0A 3QH2A 3EX2A 4NKCA 2QF7A 3O6CA 1IXNA 3MO4A 5G2WA 3WBWA 5LA0A 1H1ZA 3LBMA 1NP2A 4HBKA 5CAHA 2DPEA 4XQ6A 1OFOA 2QDGA 4HSOA 1YPFA 1QOPA 3NQMA 4W8AA 4EPKA 4TO8A 4JNZA 5G2HA 5CJNA 4FXFA 2AGKA 3A9IA 1P43A 2W79A 4BA0A 3WNMA 3VGFA 3H53A 2WMGA 5D2YA 2B7NA 1JZ2A 2GZXA 3NL6A 1H2JA 1LDCA 3A13A 1UR8A 2DVXA 5D2WA 3ARRA 1U5JA 1I1WA 3ARQA 1W31A 1JUBA 1VQTA 4TMBA 1XQKA 5DCEA 3GXDA 4TU1A 2VDGA 3OGSA 4OIFA 4PFHA 3PBVA 1SW7A 2E6AA 2P76A 4IG2A 4KGJA 1IQ8A 3PTMA 4O52A 2FVMA 3S2LA 3S2JA 4B5VA 3VUSA 1RQEA 2X1UA 3N3MA 4LTSA 4CVWA 3DHPA 5I00A 2EG7A 1OX4B 1KFKA 2WC4A 3KP0A 4PCFA 5BZAA 3SDOA 3K8LA 4KGLA 3TYUA 2VNCA 3G0UA 4AC1X 1TPC1 3E2VA 1G4EA 5BRQA 3WNKA 3N3TA 4JTKA 4R34A 4C1NA 2PU1A 4ZSUA 1V02A 4PTWA 4A8NA 4B3ZA 2PBGA 4J7RA 1JYXA 5FL1A 1Q6GA 3C3NA 4WD0A 1ZRQA 2DT0A 2G4FA 3G77A 3TU9A 1HKMA 1V7AA 3PJWA 3EYPA 3BQ6A 3AOFA 5A6LA 2I9EA 3FJ6A 2PSNA 1FWRA 3WLQA 4MGGA 5CAKA 2E9MA 3GG8A 3O15A 1JJKA 4O28A 3GHUA 3N4AA 1VJSA 1KBLA 3TYBA 1Q6DA 3NQCA 2EPKX 4HNNA 4WCJA 4GJJA 2VFGA 1K4GA 2TPSA 2VX4A 3WUEA 2XIBA 4NILA 2O4QA 4R85A 3B03A 1R0MA 4DJFD 5IBXC 3SJNA 3APTA 3W7RA 3KZPA 4PMVA 4G7EB 2R1NA 5CBBA 1VFUA 2XPKA 1PIGA 1H3GA 1BF2A 5DMYA 1BVNP 3FKRA 5HJYA 3U8GA 2FB3A 2QAPA 2OLHA 1LG2A 3B9NA 4YTRA 2DQWA 3HM7A 3HGOA 4PMRA 2A6NA 3QY7A 5C55A 4BR1A 3URBA 3M6YA 4AIBA 4GCXA 2QDHA 2E1DA 1OABA 3VOJA 1A80A 2WQPA 1Z42A 2BOFX 1PIFA 1JZ6A 4CD8A 3EWXA 4UTIA 1KC7A 5A69A 1AK5A 3IK2A 5F2MA 4OBRA 3B05A 3A3WA 2V3GA 2CBJA 3NIYA 1XLCA 4H7VA 4PMNA 3CZGA 4R7OA 2QUNA 3NYDA 5HAOA 4NNAA 1GOMA 3AJ7A 3OIXA 1XLLA 2YX0A 3VIJA 3LHVA 1AQMA 5U7SA 1SW0A 3NQGA 1ALDA 1E4LA 3WN6A 2GSHA 3P61A 1W56A 3LMZA 3GDMA 3G1XA 2CEQA 2YXGA 4PMDA 4MOZA 3P5YA 2J7DA 2PDBA 2UZ9A 2R8WA 3QR0A 2GL5A 1T8XA 1TV4A 3QPZA 2Z1KA 2VGBA 1TA3A 1PWLA 4QCFA 4MUPA 2WK2A 1SPQA 3BURA 1TKKA 4Q33A 3W7EA 3WEZA 7TIMA 3TTSA 4H3DA 4D6GA 2PDLA 2Y0FA 4AF0A 1W9UA 5A6MA 5K7JA 3RU6A 3LCWA 1PUDA 4E2VA 3A5FA 1B4EA 1XIBA 2ACQA 1JR1A 3CO4A 3LS9A 4M0XA 3LRKA 9XIMA 1ZPTA 3F4VA 3L65A 5G4EA 3AI0A 4YPJA 4JTIA 4DY1A 4U5IA 2TMDA 2W61A 3PWIA 5ABTA 1C8VA 1Z3NA 1U2YA 2WZIA 2C1HA 1IZJA 1R3QA 1AD1A 4PMYA 3VNLA 3EKGA 1QW8A 1CLKA 5H8MA 4IZGA 5HINA 5CC5A 4ZO9A 4CQAA 1L9WA 2O9TA 3TFXA 2OFJA 4MAVA 1TX2A 5DX7A 4UTLA 1R9ZA 2X16A 3KS5A 1Z8AA 3TQKA 3NQ2A 3GBEA 2BSLA 3RLHA 1FWCC 1CPUA 4L7ZA 1UA3A 3IGUA 1I2QA 2ZUMA 2OQHA 3PTKA 2O92A 4QBXA 3UEQA 4LEFA 2CZDA 3STPA 2F61A 1XBZA 1ISZA 2FIQA 1NDVA 3LMYA 4DJDA 3OTRA 4RLIA 1US2A 3F2DA 1W17A 3R13A 4WX2A 2J13A 3M0JA 4L65A 4AIUA 4XZNX 4C6DA 2F6KA 1YLVA 4GGHA 4S3GA 4L6HA 3A23A 4NI8A 4Q6XA 4EAYA 2W0UA 3WMCA 5CQ1A 3PBUA 3LX9A 2QMKA 2E25A 2VD8A 3DG7A 4CU6A 4C6EA 2GWNA 3UXAA 4KPLA 2YA0A 3QEZA 4W8LA 3AHYA 2W5FA 4LRSA 4FEZA 3BJFA 2GUYA 2J7HA 1E70M 3AQUA 3L4YA 2ISDA 3W29A 1PL9A 4N7QA 4TV5A 4JQ4A 3QN3A 4RJEA 3URQA 3OVQA 1Y8BA 5HWNA 2ZXBA 3TONA 3OLGA 3B8SA 1FVPA 2UBPC 3AO0A 5EFFA 2EG6A 5AY7A 1X1ZA 3P84A 4ZENA 4HNLA 2XZ9A 4V33A 3RMJA 1WCGA 1JCJA 2Y63A 3OYXA 3STEA 4JTTA 1DOSA 1I0BA 4NZ5A 4K1WA 1LL4A 4R33A 2WVSA 1UC4A 2EKGA 3VU2A 5FACA 1J10A 2OZ8A 3BW3A 1O66A 3NQ6A 3LHYA 1LORA 5DT7A 1A3XA 3DFTA 2BASA 4NAEA 4KEMA 5A6BD 2GQAA 4XUGA 2ZQ0A 5BXPA 4KFPA 3PUDA 3HOJA 3GG7A 3VCNA 2HISA 1FWAC 2UY2A 4FHAA 4WKAA 4ZQNA 3IV3A 1XGDA 3CUFA 1ZJBA 1N2VA 3KRZA 4PCNA 2XVKA 1Q2RA 4X0NA 1XYBA 2D22A 4JX5A 8CGTA 1G4SA 1PEZA 3W7PA 1QNVA 4O1FA 4CU8A 3R58A 4ZGYA 4IXHA 5D2XA 4DUWA 4AZCA 5JH2A 1US0A 3ONCA 2W9MA 1S38A 4J3ZA 1YNPA 4WVXA 1W91A 2NV2A 1TIWA 3RM9A 3UU0A 5D05A 4U4MA 5GJPA 3NO3A 1YNYA 1W1YA 3UWYA 4CLMA 3QOKA 2BXZA 4YCPA 4GZEA 1V4YA 3LSCA 1EQPA 3WO8A 1QNSA 3STCA 1XH1A 1KGWA 3GS6A 3ABXA 4Z08A 1ELSA 3EMZA 1TWZA 4DBSA 1O6IA 5L9FA 4FLQA 2XSAA 4O0QA 4ZZ9A 1TZZA 5DCBA 3POCA 5IHSA 3KOZA 4M5PA 3WF4A 3AU2A 1CB2A 3GHSA 3MKVA 1RP9A 1NOUA 2DFAA 3UJFA 3NA8A 3URNA 3S1WA 1R2RA 2W27A 2V5BA 3I65A 2DZAA 1W5PA 2XIIA 3M5VA 1OIFA 1KCXA 1S5TA 3GAYA 2ACRA 3Q4DA 3M9YA 4PUJA 4FOJA 3EWWA 4BQ3A 3SCQA 3ITVA 3GU2A 4QQUA 4G7FA 4WDXA 1C8YA 4F0RA 4C5YA 5C9ZA 4PB5A 4WSHA 4PFMA 4H8HA 2WSYA 3HJZA 1M01A 2WO5A 1QHOA 1A5LC 1SO5A 1IV8A 3P67A 2TRSA 4S1FA 1FWSA 1GVQA 4WJXA 4XO7A 3M16A 2VFDA 2Z1BA 3GTNA 4EE9A 1BXCA 5A6AA 3HBLA 3N4FA 4IGMA 2OGYA 4P5UA 2D1ZA 3U7BA 3VMOA 2RGMA 1I4NA 3DC0A 3AC0A 1KM1A 2Q8ZA 2GDVA 1EF2A 4GIAA 3TXZA 4NL1A 4CU7A 2DW7A 4HMEA 1N8WA 4QNEA 2X1TA 3TTEA 4CNUA 1UKTA 4G9PA 4HD5A 1UQYA 3M0YA 4DJDC 3ATZA 3QM3A 3H2OA 2ISWA 2OLAA 3T1GA 2NXGA 4HA4A 1S5VA 2ZFAA 2D20A 2ZBTA 3MKKA 4AWSA 1V02E 3RM4A 1V0MA 1F9CA 4I5RA 6XIAA 1AVAA 2Y2WA 2Z1XA 2ZRWA 2F9RA 4RZBA 4GPNA 4Q4KA 3W75A 3TSDA 3GNPA 3UGVA 4DF0A 3NQ7A 2NXIA 4PMOA 4AYSA 1BVZA 3LU2A 3SCUA 4MB4A 3GR7A 3O0FA 2ISVA 3DG3A 5FL0A 1LUCB 1DJXA 1ICQA 1VLWA 3AXIA 4K8HA 3TMLA 4XD6A 2PDKA 3IRSA 1CCWB 3RF9A 1XLKA 4AFYA 3VM5A 2E9LA 3MY9A 5L6UA 4NHVA 3VUPA 2HJPA 3CXOA 4KESA 3M7SA 2ZIDA 2NXHA 1JI1A 1NSJA 1W1A1 3PPFA 3VC5A 1Q6EA 1JF6A 1WQ5A 2WYSA 4XSMA 4P7NA 3U2CA 4O0ZA 1XLJA 3FOKA 1UD5A 3H12A 3CLWA 4UTUA 2V81A 2XIMA 4AMCA 2QAFA 4XD3A 1MEIA 5MKGA 4EPBC 1NWSA 3KCOA 3DI0A 4PH6A 3WJSA 1QPKA 4ATDA 5HWJA 1B90A 1A5MC 1NDYA 3N2CA 2PA6A 4V1YA 2C1GA 1UOKA 3CHDA 4S3CA 3F5LA 1ME8A 2XSBA 1GONA 1C3FA 1JDAA 4F79A 3CK5A 1RY0A 3MUAA 2P1FA 4FOUA 4X63A 1VZWA 3W84A 4IMDA 3QV6A 4U3AA 3W7KA 5J5RA 2V5LA 3NSMA 1CXEA 3DAQA 3W1PA 1F2JA 4JY9A 5LIWX 4GJIA 2Q8LA 1J5SA 3NWRA 4POCA 4PGLA 1EGVA 3GFZA 1FCBA 3WBXA 1SSDA 2G3IA 3UESA 3GNDA 3SR7A 1Q6RA 4NJIA 4LY4A 1R47A 3OYZA 3JR2A 1CX9A 1E0XA 1BEUA 3EZ4A 1RV8A 5AYBA 4GG9A 3E96A 3A9BA 3MI6A 4EXAA 3EA1A 2NLIA 3SUWA 4GMEA 2A7RA 1PBGA 1IR2A 4RDZA 3ZJ8A 4QE1A 2JFEX 2XWEA 3GW0A 3IJIA 3GZ3A 1HGWA 3HU7A 4OVXA 3P93A 2VFIA 4MJMA 1Q45A 4W84A 3OU8A 1B3YA 4A3QA 2C16A 1J6PA 3VD4A 1H11A 4A21A 2RUSA 1ONWA 1VR6A 2PTDA 3MZ2A 1LRTA 2ZRUA 4QXIA 3SQMA 3K8MA 2R6OA 3WNNA 2XFFA 3VD7A 1E6RA 3HQNA 2H6RA 1W9BM 1OM0A 2NQ5A 3MW7A 4KCWA 1VEOA 4RE4A 4P7OA 3BG5A 3QGAC 1QOQA 1B5TA 5JBEA 4GUGA 1LRNA 3T44A 5GVJA 4W5UA 3FAXA 4HKPA 3ZWTA 1OFPA 2PDFA 4DZIA 4FOKA 1L2QA 1YADA 3O06A 4S23A 4M6VA 3SSZA 1EB3A 4P8XA 4LU0A 2I7GA 1JCXA 1B57A 1XYCA 4RKAA 2G3JA 1EGMA 5FESA 3S5SA 3A3XA 2YXXA 3HN3A 4R5EA 1KO0A 4GVIA 4NXSA 5D2TA 4XZWA 1GVOA 1UASA 3VGBA 1UWUA 3C0QA 2A3AA 5T8GA 1SMAA 4H2HA 3UYCA 4MAZA 3WLKX 1G01A 1YDOA 4J2MA 2DZPA 1R2SA 2VWSA 3PS7A 1BD0A 5BOOA 1JYWA 3D46A 2RH9A 3NOYA 1R30A 1SFSA 1DTUA 4JEQA 2V69A 4MJZA 2NT1A 2YZ5A 1NFGA 4KWOA 1VFOA 3NQDA 2J9ZA 1WB0A 3HPSA 5TF0A 3L2LA 2VYOA 4JQ2A 4F0KA 3CV2A 4LPCA 4K8EA 3GD6A 3LCIA 2IPFA 4GHRA 3GWQA 1F3EA 4GOAA 4F48A 4Q8VA 3SQSA 1VS1A 5SWUA 3WD2A 1HJXA 4DZHA 5HWMA 4HK7A 1QCWA 3F4DA 4REQA 4PA8A 1H1YA 1HGYA 1V0LA 3SIZA 2HTMA 4CN4A 5HPOA 1WZKA 1P7TA 3B8IA 1A3HA 1RZMA 1E9ZB 4OU1A 3ELFA 1ME7A 1V6YA 5CJ5A 4AVFA 1V03A 3IV8A 2E9BA 3MVTA 1HQTA 3NPVA 4H04A 3NZQA 1JF5A 2YPIA 1K4HA 1IEXA 4Q8WA 1P4CA 3AZSA 6ALDA 3L0GA 4QLKA 4P61A 1CW2A 2Q3OA 3PANA 4IFRA 3SSJA 4UZSA 3U0HA 5A8PA 5KINA 3WK3A 2AQVA 1GQIA 2QR6A 4UQAA 1EWEA 3EOEA 1JYNA 1ECEA 3GE7A 2QNEA 4YL2A 3UETA 2Q09A 3M44A 2E28A 4HQVA 1H0IA 3H26A 1MSSA 1JPIA 3N2BA 1P1MA 2OX1A 1NVMA 1YTKA 1EDGA 1RQHA 1QVBA 5AYYA 1J0IA 1XGEA 1F7BA 3DFSA 1F76A 5H6HA 5AOUA 1T96A 1V93A 4LRTA 3VK5A 4BEQA 3CB3A 2WXDM 1RD5A 1EJUC 2XVGA 4MWAD 3ZQ9A 1OX6A 1MYRA 4QJ4B 3FHQA 1ENUA 3TNBA 2PWFA 3DEQA 2E4TA 2VP8A 3H7RA 4FIRA 2WPBA 2OPJA 3QZAA 4PUWA 3MDWA 3B9AA 4PMXA 1ZLPA 1RXOB 4MF4A 3PP7A 2ZA3A 2OSXA 3GDBA 2XHYA 4AEEA 4HU4A 3PBMA 2FHCA 2HXTA 1TZ9A 1VC4A 1IXOA 1QTWA 1J79A 4AISA 3KBNA 3I3BA 4RZ5A 1C7SA 3F2BA 4GWEA 4BI6A 4DO6A 3OBAA 3VZZA 1EDQA 1ZHAA 3AXHA 3QTPA 3I7SA 4DJEA 1TJRA 2WJDA 2XDFA 2YBUA 2O56A 3LPPA 3KOWA 1KA9F 1K7XA 1E5NA 2QUMA 3DX5A 1F6PA 2NWRA 3CV1A 3OVRA 1TJ2A 4B3LA 4I8DA 2QGYA 3GM8A 4KFOA 3I3DA 2YB1A 4CD4A 1B31A 3AUOA 3GB6A 3PZTA 3LLFA 3N9RA 3TE9A 1JPHA 3S47A 3KL3A 1AW5A 2JKEA 2OEJA 1HP4A 2VELA 3SQLA 1W1B1 3P8JA 1PCKA 1C9DA 1TPH1 1QFEA 4ZXLA 4GFSA 1K9TA 1P5BA 3RX3A 1UROA 4IPNB 1ZQ5A 3AYRA 1NH6A 4Z42C 1KM6A 4ASTA 1FWNA 1GQNA 2ZX6A 4IF2A 4Y8FA 5HNRA 4L4PA 1MW3A 3UZWA 1UJQA 1HJQA 2G97A 3W85A 2V67A 4K38A 4B5SA 1F6KA 2GWGA 1WE5A 3N12A 1O12A 2OO6A 2PDQA 3CMFA 5DRCA 1ZJHA 1O1HA 2PTWA 3WLRA 4TTUA 5I77A 4UTFA 3QRHA 3WH7A 4B9YA 1ISYA 2E67A 3S2CA 1NOFA 1ADSA 4E3TA 3PUOA 1X6LA 4H00A 3SCVA 1DHKA 3DIPA 3CL8A 4RE2A 4I5UA 2X40A 1XLHA 3BAKA 3UCDA 1VKFA 2WJEA 4NJKA 3CAWA 4S39A 2QV5A 3SEPA 3TW7A 2FZDA 1Q8AA 1JPMA 3AXXA 3N2MA 4N9DA 4LANA 3VGEA 3WELA 5TQLA 1PV8A 3MMDA 4B5WA 2BGQA 4DUVA 4C6QA 2ZRZA 3LLXA 1F8MA 5CEWA 1CLXA 1NIUA 5XIAA 1JXKA 1Q6LA 2JKPA 3SCSA 1HN1A 3MHFA 2XJ7A 3ARWA 3DGRA 2WC3A 1TELA 2XGBA 2OTDA 2FVKA 3IEBA 3C2RA 2E8ZA 4OWGA 4ZB2A 3EEZA 4GCAA 2J7CA 5JUVA 1BTMA 4MTVA 2CERA 1H4PA 1S2WA 3CTTA 3UY7A 4Q8PA 1FH7A 1HNYA 1JVNA 1OGSA 1G0CA 3WK1A 1REQB 3UXIA 1X1NA 2FHBA 3O07A 1GVSA 3WD1A 2ZA2A 4HYWA 4LV4A 4WIWA 5LIUX 3CU2A 3LXCA 1QMLA 4XAZA 1I9CB 3R8GA 2XVNA 5AECA 3IGSA 1OQFA 4JZ5A 2GJRA 3E0FA 1MI3A 2XM1A 4GQBA 4UTWA 1OFQA 4JY8A 3T55A 2GVGA 4C1KA 1V3LA 3VILA 1VBRA 1AH0A 3IJ6A 3EDJA 3W7IA 4QG8A 2HRWA 4XWUA 4AEOA 2OKOA 3ANYA 4LBSA 4R9OA 5C2GA 4Z1BA 1XBXA 3WK0A 2W66A 3NSXA 3H7UA 4UIOA 4IL0A 1XLGA 1VCGA 1PVNA 2NW0A 4UR8A 4FX8A 2DIKA 1OT2A 4XBKA 3W70A 4DBUA 3IAQA 1X7IA 4GXMA 3RLUA 5K4XA 4BQ2A 4CCCA 4RDVA 2H3DA 5XIMA 2INFA 5FAGA 1TPFA 2ZZ3A 1OGBA 2VFEA 2O9PA 3TAOA 1V6XA 3KBJA 1JI2A 3PR2A 3PZGA 5E09A 1G94A 5F4WA 4DJEC 1JNEA 5A8QA 3EXSA 2G4JA 3S2NA 3TW9A 1U1HA 3L7RA 2FQIA 1N7KA 4Z2KA 3QXBA 1WBHA 2VEFA 2C91A 3B8DA 1LP6A 1XCWA 3G0SA 3BAWA 2ICSA 3VE7A 4AMAA 4NZFA 1SO3A 4L6DA 4MY8A 4XTDA 1JDFA 1UR1A 2PI6A 4FO4A 2MNRA 2ALRA 3PZIA 3E38A 3VMNA 3GFYA 4NRRA 4UFMA 1GEHA 3F5JA 1LCOA 3HF3A 5EPDA 1KB3A 4N4PA 4PMQA 3FA4A 3AXKA 2VEPA 4ZO6A 4UFKA 2WZHA 3S1UA 1KGXA 5PTDA 1RLCL 4CN6A 3GKAA 3E9AA 5A6BA 2WANA 3B9DA 1FCUA 4OBTA 1XDJA 4FXSA 2PRMA 4M24A 3U2ZA 3PZQA 3ZYZA 3ARSA 1G69A 1XIMA 3G8RA 3G22A 4NI3A 2DUXA 3TLQA 2A3BA 1OFBA 5C71A 4RE3A 4O11A 1TMQA 3GYEA 5CZTA 1D9EA 3C0LA 4D6CA 1Q7MA 1V8EA 4H9UA 3GNNA 3GNRA 1TFVA 4GI9A 1LOLA 1DIKA 3WQDA 3O2LA 1UWQA 4UCFA 1NQ6A 4YU1A 4B9ZA 1OC6A 5D04C 5HA7A 3LOTA 4YN5A 3ZSTA 3WNPA 4JYFA 3Q58A 4XISA 4H9YA 1EX5A 1JGMA 4QAWA 3C2YA 3IJ7A 2V5CA 1MQRA 1J0KA 1Y0EA 2PDHA 3G24A 4BI7A 3DBPA 2YFNA 1ADDA 3M46A 1LLZA 2XTKA 3FYOA 4Y2WA 4ZBCA 3K2GA 4YCOA 2WNNA 4LYKA 5CPQA 3TC6A 3IUIA 5LIKX 2QJMA 2ZVIA 4OUEA 3AWOA 1GNXA 1D3GA 3L21A 1X7FA 3F7JA 2Z7KA 4FXRA 3W81A 2DJLA 2O9RA 3VNZA 2WCGA 4AB4A 2Q02A 3MI2A 1DJWA 1Y5VA 3E1F1 1GPFA 5DRIA 3DKJA 1E9LA 3SN4A 3LZ3A 1OCNA 1MUCA 6TAAA 3TYAA 2YCKX 5EY5A 2VX5A 4X9SA 4ROPA 1UH3A 2CFFA 4AWEA 2J9YA 2ZTKA 4Q7IA 5CG0A 3GDRA 1LQ0A 1UMLA 1I6NA 1KCZA 2YYTA 3W7DA 5K2ZA 4UTWC 4ZXOA 3CWHA 3PZMA 3NQEA 4GH1A 2BODX 4RCXA 1GZ1A 3KHJA 4KF1A 5DEZA 4Q8NA 4R7WA 5FF0A 3GYCA 1RA0A 1YXYA 1AD4A 3W07A 1FCVA 1WV2A 3C5QA 1WPCA 2Q8XA 1JGIA 3GX9A 3JRKA 4JIHA 3ZSSA 2BZNA 3JUGA 5C6MA 1ZFJA 3TEVA 3ABZA 2A3CA 1CWYA 2QCHA 4GRSA 1BVWA 1W2PA 2Z6JA 4UUIA 3G3DA 2ZZ4A 4TUFA 1Q65A 1XCXA 4O19A 2PDMA 4N6FA 1EPVA 2BDQA 3A21A 4Q8TA 1FCQA 1W9VA 1XLAA 4OGZA 3URAA 3PK7A 3ARTA 3BCDA 5C54A 3CYVA 3I6EA 3VPLA 3CQ0A 2HNEA 1H0GA 3BJTA 3SUUA 4ZE4A 3FAWA 1YPIA 2CLFA 2R91A 4JOMA 1O7AA 2CKSA 3USBA 1RPKA 3T0BA 3NVDA 4QITA 3IAPA 3KLLA 2W3ZA 3MPGA 4GK8A 3CEUA 3OODA 3GXFA 3T81A 1F3WA 1LWJA 4DB7A 1Z6KA 1VIZA 5EYWA 2BTMA 2ZWZA 3G2GA 3IJ9A 3HQ1A 3HURA 3E0VA 2AL1A 3V75A 3T40A 2VUYA 3O9NA 2ZE0A 4O13A 2R9RA 3K13A 1YYAA 3R6IA 2C13A 3V0UA 2Z29A 1NFPA 3TOPA 4PEKA 2Y85A 4JL1A 1TV2A 1XRFA 4OECA 4X60A 2OT0A 4DBWA 1XBYA 4GY7A 1DE5A 1L0PA 4I9AA 1YRRA 4EWND 4L64A 5A6KA 4QP0A 3R8RA 4IPLA 3H4WA 4FSAA 2GUUA 2IQTA 1M7PA 4AG0A 4IP5A 4LC6A 3SGUA 1KR1A 3N04A 3VFLA 1JRCA 1C8QA 2X1SA 4GX9A 4WDUA 1EP1A 3N34A 3IS4A 4LWWA 4NNCA 4QDWA 1XRTA 1H7OA 3VZYA 4B91A 3W2LA 5LNWA 3VX1A 3SM0A 4JNYA 4B15A 5IDZA 1RCOB 1KXQA 1JDCA 3PUEA 3IUHA 2Y7EA 2CLOA 5EL1A 3DGBA 1F8IA 1SZEA 4L9YA 5BXTA 4JDYA 5HMDA 3N6QA 2EO7A 5BXRA 3M07A 1MUMA 5A2CA 2VT0A 1SZFA 3FGCB 3AZRA 3RPDA 4OKDA 1D3CA 3UA4A 5BW6A 1WZMA 3KWSA 3W53A 1EZWA 1MEWA 3PBWA 3O3RA 1MO0A 1PKYA 3DFOA 5DELA 1XC4A 2G41A 4FR1A 2WWDA 4EP8C 5FJUA 3G1VA 1T41A 4F9DA 4ZTYA 1IT8A 3OVPA 2XIQA 3B8WA 1RA5A 4J35A 5I3IA 4UQEA 3JZEA 1BGAA 1XLDA 3N2XA 4EVZA 4BWLA 3C8NA 1UP0A 3D0CA 1FKXA 4YYFA 2RAGA 3M0XA 1LRQA 3W6YA 1K8XA 3ZR5A 3T78A 6ENLA 1FWJC 3CS2A 2VRKA 4AAJA 3MBDA 2OR2A 5I6SA 3ALFA 3BG9A 5REQA 1WXJA 4BQ4A 1M03A 1OD8A 1K6WA 1ZTVA 1W3LA 3UWZA 2ANUA 3Q37A 4KFNA 1NOWA 1RK6A 2GVEA 1UR0A 3ONBA 1JQVA 5CSYA 3VDGA 3BGJA 2XFYA 2Q01A 3ZVHA 4NAFB 4ICNA 5BROA 3EMQA 4ZOAA 4ES4A 6REQB 2E5DA 2ZE3A 4HGXA 1TB3A 3VA8A 4ECLA 5IRPA 4LUSA 4QS5A 2J62A 4GI8A 2J4GA 2YYUA 1K6AA 2TSYA 4RPQA 3T6CA 1J9YA 3BUVA 3CHEA 1EH9A 3UPBA 3ATYA 4JAWA 2R1PA 3WH9A 1R5YA 3OLIA 1SJAA 2BBFA 1NDZA 3FFSA 3NGFA 3QC3A 1FHLA 2BVYA 1QRQA 1XD1A 1TQXA 3AICA 3JVAA 4GVFA 3FKKA 2LLEA 3ANVA 1VFHA 3VKCA 3S0CA 1KKOA 1W5NA 4B2DA 3UJRA 2DJXA 4PB4A 2WNZA 3GQYA 5AYIA 1FP9A 4IXXA 3W27A 3N6JA 4DN1A 4MUZA 5FJIA 2CBVA 1AG1O 2ZKMX 4IIFA 1JCYA 3C61A 1RK5A 5CLWA 3N9SA 3MP3A 4DM1A 1C90A 4UWMA 1A5BA 1JDDA 3UA3A 1XJBA 2CHNA 2C19A 1JFXA 3SRDA 3THQA 3M0MA 1EO5A 2QPSA 2WCAA 3A3HA 2YFOA 2ISSA 1TTQA 2YW3A 4MYXA 1XFBA 4E3VA 2PDJA 1EDTA 2DSUA 5KTLA 4QJ1A 4UR7A 3ANUA 5FSDC 1CLVA 2Y1HA 3IIOA 2PURA 4IQLA 3KE0A 2DH2A 2OXNA 3B4YA 1TRDA 2XH4A 1EOMA 3KVKA 1TREA 1HJWA 3WJYA 1Z41A 3NEHA 3TJLA 2H3BA 2XIOA 4M80A 1UH4A 3H24A 3DECA 4HPXA 1R3WA 4CCEA 2YL6A 4PL1A 5A95A 1V6VA 2X1RA 2WKJA 3VDHA 2HSAA 3SCWA 1F61A 1T40A 2RDXA 5CGMA 3LCFA 3VMPA 3XIMA 3PZOA 1Z48A 3PWGA 2AQOA 3GVWA 4MDOA 2X1IA 1A5CA 4R53A 3FV9A 2VQUA 1WOAA 3GNXA 2DT1A 2NVDA 2PGEA 2EJAA 4GUFA 3NO1A 5CSRA 3HQOA 4LGXA 3T4CA 1WDRA 1XCFA 3SY5A 4K8GA 4R27A 2Y70A 4HCHA 2ZXDA 1H5VA 2FTWA 3PFRA 1U5VA 1ISXA 3FNDA 3WQ8A 3K4AA 2EPNA 5LNUA 2AAAA 3GO2A 1BRLA 1PSCA 3AMCA 1TR9A 1UB3A 1QI5A 3PNUA 4NZ3A 4W9TA 3VOFA 2G3MA 1TV5A 1IHIA 2YA2A 3ZVIA 3N6HA 3R0DA 2YDRA 2YGYA 2X30A 1E55A 4F0LA 1GPWA 4C6OA 2V8ZA 3AMKA 2ACSA 3WQ4A 2QS8A 5CC6A 3FJNA 2NLYA 1A0EA 1FP8A 4O4VA 3T07A 4IWWA 4WRHA 2C1IA 4IMEA 4O0KA 4PUMA 5GNYA 2CLEA 2Z24A 3ZT7A 3NFUA 2P50A 1HT6A 3UWUA 1W1TA 3M0IA 5HANA 4O54A 4IFOA 1TTIA 4BWLC 1KNWA 5DT5A 4G5DA 1AH4A 2EKCA 3WLMA 4I9JA 2GQ3A 3MSGA 5CLTA 1XLBA 5CZSA 5E5CA 3W83A 4OV4A 3BK0A 4HTYA 1ZAHA 2NUWA 2QZRA 4Q8MA 5GQBA 3SRFA 3HV8A 4YTUA 2ATSA 2XN0A 1EIBA 4RXGA 3WZ0E 4C6LA 4D8LA 5IM51 2FB2A 3JS3A 4LUTA 3TMQA 4LH8A 3EKZA 3WH6A 3QVQA 3R79A 4UBPC 2OOFA 2ABBA 4LS0A 4PTNA 1A4MA 2CZVA 2XINA 1T99A 1TUXA 4GC4A 3QW3A 2PCQA 3EX6A 3EOUA 2TAAA 4DVOA 3ABOA 2NWSA 2VC9A 1A5UA 2VJXA 1E4NA 4QQ3A 2GK1A 3PPCA 4J3WA 3EKLA 1GHSA 5IDIA 3WQGA 4XKMA 1PYFA 3PTDA 2IS7A 2D0HA 1UR9A 5I3DA 3FEMA 4UB9A 1ZJIA 3OB8A 3W72A 3WL1A 1ESWA 1RY8A 5AHFA 1IWBA 4JS3A 3NL3A 1S3TC 2D2OA 3ZJ7A 3DFQA 3CJPA 3O6AA 2A6LA 3PB2A 2ZX7A 3U9IA 3V5FA 1VBGA 3WMSA 3CAQA 3LENA 3Q45A 2BXYA 3CPRA 2ZUTA 2JQXA 5FJJA 5I3FA 4C7FA 4ZO8A 3SFWA 1P0NA 4JFTA 4A8IA 2WHMA 1JXJA 2JF6A 3RAOA 1Q7ZA 4QDPA 3K4DA 1N8IA 2B0MA 3OGVA 2Z1SA 4WGHA 3M1ZA 1ZY9A 3WJXA 1UZ1A 3UZXA 1W6TA 4WOZA 4W85A 1F4HA 2GYIA 4K36A 3TV8A 1OZMA 1JD7A 1E1CB 3D47A 4MWAB 4O1EA 4QEEA 2WJZA 1QPRA 2PODA 2WVVA 2FH8A 4DWSD 3SI9A 5AYXA 1JZ4A 3GU1A 3M7WA 3VD5A 4J3XA 4C91A 2DQXA 2HROA 2Y5SA 1A0DA 1F74A 1FDZA 1GCYA 2PC8A 4A8RA 4TR9A 1TQJA 2Z7GA 3WL0A 1W5OA 4CD6A 3CMJA 1F5ZA 1XL9A 1KXHA 3I7QA 1SFTA 3ITCA 1G7UA 4LB4A 2OJPA 4AEFA 2VTFA 5HQLA 4V28A 1D3HA 5GJMA 4XVEA 2F7FA 4F0HA 1B3VA 4DBDA 3B4UA 1IXPA 1LQAA 1XRVA 4JTSA 1K7FA 4K1GA 5BMXA 2QUTA 3G18A 3EWCA 2UWFA 3VZXA 8RUCA 1KRMA 3RNDA 1QO5A 4B16A 1UP3A 3L4XA 3MUY1 1KGUA 4US5A 4UC5A 4GNJA 1WBJA 1X38A 1G9HA 3I6TA 4AC7C 2HBVA 1P0BA 2H9AA 4X2PA 3CGTA 1VGAA 1Q63A 1U83A 1U33A 3P0XA 4MVAA 3AIEA 1KCLA 4DRSA 1EWDA 3J7HA 2X0SA 4LVDA 4AD5A 3BMWA 2A3HA 4O1BA 4C5ZA 3PG8A 5DFAA 1PS9A 3GSMA 5D8WA 3OZYA 3II1A 4DNHA 3NPUA 3BLDA 3MHGA 1TTPA 5DCDA 3WQPA 4QE5A 4DZ5A 3PZNA 3ARXA 1QWKA 3TDFA 2REQB 2D73A 1ODZA 1QK0A 1WDDA 3SADA 3IARA 3H70A 1HFBA 3T2OA 4PUNA 2F2HA 3ZJKA 2RFGA 4AZHA 2RGLA 1F3XA 3QTGA 4FPSA 4IH3A 3OA5A 4BHYA 2C71A 4FK9A 1N55A 1M7OA 4UTTA 5C7VA 1KTCA 4CQBA 4JTEA 3WX7A 5C0QA 2D0FA 5LA2A 4EANA 3BAXA 4AX6A 5CG7A 4UXDA 3RN6A 3MANA 4KEUA 1EO7A 3A22A 3OBEA 3EWBX 1KV5A 1PX3A 3WQWA 3HFTA 3TP4A 4ZL1A 2Z25A 2XSXA 3EBVA 4HNVA 3P62A 5D9NA 3N15A 4W87A 3B04A 4KRUA 4CNOA 4WXYA 3DFYA 3MKCA 4DXKA 1LT8A 3GUWA 4J28A 3NQAA 1TR1A 5LHEA 1V51A 3SCPA 2FMOA 4BFAA 3GXIA 2QCDA 4ZQOA 1RALA 4AX7A 1ISWA 2FPVA 3U5UA 2IPGA 3VNYA 1UMYA 4LFYA 4CCZA 4Q4PA 3SGZA 1WO2A 1W3TA 3QV9A 3TOYA 1Q66A 3N18A 2VGGA 3LPFA 4YTQA 4JN7A 2EBNA 3KOYA 4WJEA 3SUSA 3QFEA 2QF8A 1U30A 1UKOA 1MQQA 5FIPA 1Z9AA 4YVXA 4J4KA 3ARYA 4Q7NA 5HOSA 4IPJA 2QCCA 4AIEA 3EB4A 1GUVA 4BS0A 5LA1A 5CKSA 1SO4A 4UOQA 1GW1A 3B8VA 2RHGA 3T42A 1BG9A 3WYZA 4CNPA 3QMSA 4AD0A 5EB8A 2VENA 1L6WA 1KR0A 3MU7A 3S4TA 1E72M 1B30A 4PBFA 2E6DA 2XIJA 3KW3A 4XVDA 2HWGA 1FWBC 5FJTA 4ZOBA 2A0NA 2VHLA 7TAAA 3MUCA 1EP2A 5HMSA 1PTAA 2PAJA 4JTUA 5FJOA 4BF7A 1UKQA 3NQ8A 3W2KA 3NYZA 4PRWA 4LALA 7REQB 3UR2A 3UR7A 2HPMA 2FDSA 2G3FA 4D8AA 3ITLA 2PWHA 4Q32A 3W87A 4BF9A 2V5KA 4C7GA 4HMDA 1V6UA 3M0KA 6XIMA 2V38A 2J77A 2GOUA 1LQ2A 4IIBA 5E9XA 3WQOA 1E73M 4WKHA 2A3EA 1JDEA 1H50A 2XVLA 4FNQA 2FYMA 4L4LA 2Y61A 5HQMA 4DIAA 4J40A 4ORIA 4MZYA 1UIPA 4Q4RA 2EPHA 2Y8KA 3UYIA 2QCMA 3N25A 4AD2A 4Q4OA 1UBPC 2WW5A 2VDIA 3VDBA 3S5YA 3H2CA 2WVTA 5AYZA 1RPXA 2QCGA 5I2UA 3RJXA 4AH7A 3QV7A 2BY1A 4UQ9A 3DZ1A 3LGGA 3L2MA 3RIKA 3DXIA 2VC7A 1OJXA 2NT0A 1AUSL 4QR6A 5I02A 2QV4A 4S38A 2JALA 1SR0A 3OEXA 1O4UA 5BNKA 2ZC8A 3B9OA 3LY0A 5EU9A 2XUCA 3S9IA 1DYSA 1IGSA 3AIWA 1KBJA 2FTPA 4DQWA 5DO8A 5AHEA 1ICPA 3I68A 2BOGX 1VBUA 1ZJAA 4IJRA 1GT8A 1S5NA 3DYMA 3HG5A 1VBJA 5HDRA 3S1XA 3SURA 2CPUA 1OX4A 3TYZA 2GGHA 3ZLHA 4CNSA 1MFVA 4XKYB 1F73A 2QVNA 2YOCA 5FSEC 3O7UA 1LYXA 1XYAA 2WSPA 4ERIA 3EOLA 2VL4A 5F4SA 2CZEA 3CASA 5CSSA 5BMWA 2PBOA 1RAKA 1ONXA 1GYLA 2IKIA 4GINA 1PX4A 4UTTC 4DPPA 3L66A 4QGCA 2CWXA 3BLPX 1WAWA 3TTQA 5BU9A 3VOGA 1UHVA 1XH0A 3O6DA 2PWVA 2YL9A 1GJWA 4LJ3A 3UG3A 3IIPA 2Z2BA 3VOIA 4XBSA 3WCZA 3PHAA 3TX9A 3QQWA 4MZ1A 4QE4A 3TN6A 1A5SA 2IXVA 3E2SA 3PZVA 3WLIA 4JKLA 4U3CA 3IJQA 3PZ9A 1HVXA 3AFBA 3GTHA 3RLVA 5JQ9A 2JGQA 4G7EA 5K9XA 1AMYA 4JTGA 4HOZA 3LXBA 3WUFA 1XIJA 2Y8VA 1H09A 3LK6A 5IFPA 1NU5A 3C2VA 1AW1A 5JU6A 5BXSA 5A8OA 3W38A 3I6RA 4AD3A 4NU7A 2GJLA 5CPTA 2W62A 2VGIA 3DYOA 4UTJA 3TA9A 3WF1A 3DG6A 1TRIA 4A05A 2PP1A 3AIVA 3AWNA 3UXDA 2CHOA 1M65A 4WXZA 1XG4A 3BZGA 3L4TA 3B0YA 4JTDA 4PN2A 3PF3A 2VKZG 1L6FA 2QGHA 3DBNA 4FLSA 4GO9A 4OHQA 2OLSA 4OUIA 1E4MM 3BZJA 3T0CA 5E0KA 3W9ZA 2D23A 1QOXA 3I3EA 3LCLA 1I75A 2DZSA 2D2HA 3A24A 2VD9A 5M1TA 1R3TA 3FLUA 1P6WA 1IGWA 1MDLA 1OIMA 3RITA 3GVVA 1CTNA 1C92A 2YDQA 3GTXA 4TV6A 4MJ2A 5DXYA 1DKWA 1KWKA 3L12A 3H4GA 1QNPA 2A2IA 1PTDA 4AHOA 1J96A 4W89A 1S2UA 3DYPA 2PDXA 3NSNA 1US3A 1QATA 3MP5A 2BOEX 5K4ZA 5CBIA 3W7LA 2QW5A 2DSZA 2A7NA 5AZ1A 1I45A 1DORA 1SFLA 3LHZA 4WDTA 4D6IA 1XQLA 3AS3A 3MUXA 2E5BA 4K7YA 4AY1A 3EX1A 3W7OA 4Q8QA 3V0SA 1UR4A 1JCMP 3KS6A 1DJIA 5HXMA 4B5UA 4RV8A 4JIPA 3RXZA 2MUCA 2FZ8A 3HTWA 3UJ2A 2VOTA 3KBMA 2O0TA 1HG3A 1DWAM 3BAYA 3MDUA 1EYWA 4IHCA 3QMTA 2ZXQA 4F2BA 4AU0A 3RCMA 3WF3A 2OU4A 1K7EA 4CQ9A 3CT7A 3S2MA 1XISA 4IQDA 4MKSA 1V3MA 5C9RA 2DUZA 4IMAA 2GVYA 1HZYA 2DDXA 3NXLA 2GGJA 1R7AA 2PCEA 4FALA 3QGKC 2RJHA 1TPEA 4H8NA 1GEQA 4LVGA 3QR1A 1LL6A 1LL7A 1NDWA 2CKRA 3WG6A 4YYCA 4PTDA 3S5OA 1DTNA 3LB0A 2DIEA 4H9XA 3XINA 1O94A 1SJBA 3UT0A 2GPTA 4TX8A 5FF2A 1CZ1A 4JHZA 2PRHA 4DO4A 4FB7A 2PWDA 3LD5A 1L6SA 3T0AA 2AAMA 4TVDA 5XINA 1ZCOA 5FEPA 2WB5A 3O16A 3TYCA 4IPPA 3CPGA 3LA4A 3WFAA 4JYEA 1BF6A 2B7OA 2VVSA 3GH5A 3UERA 4F9JA 4QCEA 4PSRA 3BDKA 4ZB0A 3RU8X 2DY3A 3CLMA 3L4VA 3S6OA 2CBIA 2ZZ2A 2DZXA 3WQFA 4US6A 3C4UA 2HNHA 4PC8A 3MJYA 3IIVA 2WJFA 2VC5A 1UZ4A 5D30A 1U22A 1VYRA 3TFCA 3W73A 3MV01 5CZKA 2OQLA 1VP5A 4GI4A 4DI8A 1SJCA 1JCNA 3GKFA 3NO5A 5E93A 3M47A 4YVPA 1B9BA 1G4TA 1VJZA 4Z2HA 4MADA 1JFHA 4WGXA 1VYSX 4H6KA 2E6YA 2E40A 4HP5A 4B4FA 3ZFHA 3M0HA 4Z0JA 3UXLA 4PZVA 2PDGA 2I17A 1SYTA 2YDAA 2HVOA 4X0VA 3CZLA 3CUGA 1ZAJA 1XUZA 2OOGA 2WZMA 1CDGA 4JQAA 1KTBA 1UKPA 4AXNA 2XU2A 2PLCA 3BARA 5D9OA 1E0TA 3HFYA 1D7KA 3QJAA 4PB3A 2PP0A 2Y24A 2WNQA 3BAIA 1VFTA 2VZSA 3W24A 4NYUA 3ARUA 1UWSA 1IZCA 3CZ8A 3R89A 3R8HA 4OE7A 1Q8JA 2BHZA 4LCQA 5GPRA 4DAIA 3NG3A 1PIIA 1EUNA 3ARVA 3BOLA 3FSTA 3TW6A 5DANA 2AL2B 3GZAA 4Q22A 1E3ZA 1QXLA 3PM6A 4GYJA 3A4AA 4DYEA 4F2UA 2J6XA 1XW8A 4Q7BA 2J24A 1IIHA 4E5TA 3BGGA 7A3HA 1E6QM 2P88A 5K9DA 2PS2A 4IFKB 3VTRA 5I79A 3VOCA 3K8KA 3PZUA 4GIEA 4LB3A 2OO0A 3WDHA 4NF7A 1QNQA 4UOZA 3PY2A 1EEPA 1VIWA 1RQBA 3UWVA 2B7PA 2F38A 1VRXA 3F5KA 1DWFM 1XYZA 2Y62A 3SY8A 5A6JA 3VI2A 2DSKA 2JKAA 5E0FA 2CIPA 4GQRA 3UG8A 2EAWA 4PUDA 1HL8A 3G1YA 4R88A 1FHVA 2WHLA 5ABEA 5A8GA 2J66A 3WENA 4V1XA 4UQDA 1DWGM 3R25A 1VCFA 2QUUA 3MA8A 4GUHA 2VR4A 3S9ZA 1XINA 4N2YA 3MI3A 2Y8UA 1DJQA 5FEXA 3RK8A 1PZ2A 4ATLA 4NP7A 4XZLX 4RNIA 1K8CA 3G1HA 1FX6A 1DQUA 3KM8A 4BQ5A 3C8FA 4H8UA 4LNCA 1V3KA 3C3UA 5EBAA 3NDOA 3V4BA 3CZEA 3HPXA 3ABSA 4FNSA 1SU5A 1OK4A 4MNJA 3ZIZA 1SUXA 2BP1A 3CH0A 1J0JA 2CLLA 4BF5A 1WKEA 1FWFC 1HKWA 2VZTA 4QAIA 3ZWSA 2Y7DA 1BYCA 4EACA 2XM2A 1P0KA 3K30A 2QJIA 3KRBA 4HCLA 4UNKA 3I7RA 3DC8A 5DN1A 1MW2A 3PJXA 5G2IA 1LLWA 1IXQA 1C8XA 1YTDA 2WMJA 1JZ5A 4S3AA 3OG2A 4PMUA 4UMBA 4GZJA 1OHLA 3RG6A 1QBBA 4ENLA 2OVLA 3W1RA 1E0WA 5FD0A 3F4WA 2W91A 3JU2A 1KBBA 4ZQRA 3AAMA 1YBQB 4U2YA 5K3VA 4H19A 3R12A 1LUCA 4JYDA 4P7LA 4NQ1A 4ROQA 1HW6A 3LHUA 4X9YA 4FNUA 1ME9A 3U4AA 1HJSA 2NVAA 3WH5A 1W54A 2PF0A 4FA3A 4ZTXA 2ZZ6A 1G67A 4B90A 5TIMA 3GXMA 2FZ9A 1EA0A 3W2MA 5C8BB 3OLEA 2J8FA 3VO0A 1O5QA 4O53A 2F2KA 2VUNA 1OGGA 3KDNA 4PCTA 5C9UA 3WD3A 2H8ZA 3BLIA 1CB7B 3GC2A 3MBFA 1FHUA 4M7TA 3VIKA 3ECQA 4DJDD 3VC6A 1LWHA 3GIPA 4ZE5A 3N17A 4IIDA 3ERPA 3C56A 4DUOA 1OG0A 3V5OA 2CXEA 1RBOB 1YE4A 3A12A 1MEHA 3KOXA 1GORA 1EJSC 2YCJA 2BV9A 4L1XA 3O6YX 3Q67A 4HCDA 2YR1A 1AQFA 1UH2A 3GW3A 2P10A 4ZOEA 2CLKA 3EOSA 3FCPA 1W32A 1L8PA 2BMBA 2FMNA 2YCEA 2WNWA 4TQTA 1E0UA 1OCBA 3T0TA 4F8XA 2XZ7A 1HXJA 2NQZA 2CYGA 4DO7A 2J6VA 2OWWA 1W3JA 3LHTA 1UCWA 3BLKA 4JEJA 3UNDA 2ZOXA 2ZUSA 3AZTA 2GUBA 1ITXA 3PPGA 1B3ZA 2R1KA 1V3IA 1XGZA 2CLPA 2FPYA 4KWWA 3V36A 2Q6ZA 2XISA 5EA9A 2VCAA 3VNKA 4WSKA 4KEZA 3ZXWA 3WDIA 6PTDA 1BQCA 4GYKA 5EMKA 2WC7A 1MNSA 1V3JA 2YCLB 3RR4A 1GK8A 4BEUA 4JFVA 1KM5A 1E6PA 5EKYA 3RR1A 1E9IA 3ZOAA 3EA2A 3U5YA 2AKMA 1R2TA 8XIMA 2F6XA 4P2VA 4DAFA 2YL8A 1CENA 4FLOA 1FUYA 1DXEA 4MNKA 2VCBA 1PWMA 2RDWA 3NL5A 3UWEA 3KWXA 4CEXC 2AQWA 2J88A 3WLTA 5I3JA 4W8BA 4QROA 1U1UA 2V2HA 1S2TA 3WQ6A 2FKPA 2HK1A 1RBAA 1WKFA 1DQXA 4RW5A 3DOPA 5FF4A 4PE8A 3FSUA 4NSBA 1AZ2A 1ICSA 1HKKA 2V3FA 3B0UX 1TX0A 2A1YA 1TWDA 1S1PA 1ZP4A 4YVVA 4FMVA 3CZJA 1D2KA 4EOUA 3VDAA 3NDZA 1ZBKA 5I3KA 4OQVA 4XAPA 1W37A 4I7UA 7CGTA 1QHZA 2HEJA 3THDA 1W3HA 3UZZA 1XYFA 3W01A 4IGNA 3GDTA 4CQCA 4LUTB 4Y90A 5AHLA 4GYFA 2NX3A 5JIPA 1MW1A 5RUBA 3B3DA 4D6EA 3VIPA 1EBGA 3LI1A 1G4PA 2OKTA 1P1XA 2BVDA 3EMCA 4QFUA 4DWSB 3UZJA 5CSUA 3ZM8A 1VENA 5CH9A 5A8MA 3B8TA 3M0VA 2X41A 4ACZB 4ADTA 4O18A 5HK4A 3SCRA 1OFEA 1OFRA 1XR2A 4PTMA 3KBWA 5IOBA 2OZTA 1YIXA 4IX2A 2A7PA 1TJ1A 2HS6A 4MB3A 5DXXA 4MG4A 4W93A 3CL6A 3ZMRA 1EJRC 4OJYA 2VOMA 1J01A 1EHAA 1R3YA 3YPIA 4HYVA 2PU0A 3CZKA 3IUDA 1UYQA 1B2YA 4LAKA 3KP1A 1G7VA 3DH7A 1D7FA 4H41A 3DFNA 1I2PA 2YBTA 1EEXA 2PTYA 2GJXB 3H23A 5A5WA 1PYMA 5FJPA 1EJTC 2KZHA 3P80A 1W9PA 3W0KA 5EFDA 5MF5A 3R0KA 3EDDA 2P53A 4JIRA 3M4HA 3M5YA 1IWAA 2XN1A 3UCQA 3PPHA 1JG9A 4AD1A 4QJ5B 3TN5A 3M0LA 2QEZA 3OJGA 4RNJA 5AZ0A 3B9EA 2J9XA 5I03A 4DPQA 1GQLA 1U5HA 2FDMA 2G96A 1G6CA 2FGZA 3CV7A 4Y9MA 4IUOA 3W6LA 4LAZA 3M6DA 3VINA 5FOOA 3CT2A 1CXIA 3WDPP 3NR0A 2EEXA 2OT1A 3TSBA 2EPOA 3W1NA 4N4QA 3C6CA 2ZYFA 4D6JA 3GTFA 1ZS2A 3W1LA 2J8TA 3W7JA 3ZLFA 1DVJA 3ITGA 5D8ZA 5DMNA 2AOSA 3QR3A 2CZ5A 4BY3A 1FTXA 5F1VA 1KRBC 2PB1A 3HG2A 1SO6A 3BTNA 4HZ8A 2BHUA 4OT7A 2XN2A 3P8IA 1K77A 4LBRA 4GZIA 5D37A 3WD4A 4HK5A 1LBMA 3KX6A 4WEVX 2ZX8A 1DEDA 2TYSA 5D9PA 2CESA 4PCSA 4BI5A 1GZJA 4I7VA 1UR3M 3QLDA 3FA5A 2X7VA 4C6PA 4XTIA 1UWRA 5ABGA 3S8HA 5D38A 2VMFA 3NDYA 4AIOA 1NQKA 2UY4A 3W7HA 3MV11 5HR6A 1BWVA 2V2CA 2YSWA 4I90A 3D5HA 3TWAA 4LCRA 1LZOA 3PVFA 3R43A 5ABFB 3CWNA 1GVYA 2A4AA 3MCMA 1FY6A 1DE6A 1XKYA 2I56A 2VRJA 3LV5A 3PB0A 3E3HA 3A64A 2B4GA 1TMLA 2Z28A 1ITUA 5A1AA 1DJGA 2CZFA 1YQ2A 4GYPA 4FX7A 4MZ8A 3G3MA 2FJUB 3SCNA 1ODUA 3WUGA 3WLNA 3CIVA 4ERAA 3VNIA 4FIQA 1R86A 4S3FA 5A2BA 1UPMB 1E1EA 4MMWA 1X39A 3VAVA 4JIIX 1JEZA 3LTYA 4D9PA 2I5GA 4K6AA 4JKMA 5EMJA 5AB3A 1MXSA 4JBRA 4KCTA 3KEHA 2D69A 4GH3A 4XV0A 1E0VA 2EGZA 4S3EA 3A4WA 5EMYA 3ABQA 4EXQA 1KM4A 2Q71A 2I5IA 2X42A 1CECA 1PDZA 1W9XA 1JQXA 4IM4A 4WR3A 2C3ZA 4MSSA 4H7ZA 2WLYA 3NVTA 2PDUA 3KL5A 3UD6A 1IEIA 3EEGA 3WD0A 2X7WA 2PE4A 1UZDA 4LYPA 5DY3A 1NWRA 4OTKA 2QCNA 5G1MA 2BG5A 3LRLA 3L68A 3R5EA 5KSWA 1U1JA 4QSHA 4DF1A 3S1GA 2PEVA 2HV5A 3WNOA 2YL5A 1OYCA 2GJNA 1AL8A 3KFTA 4L1WA 3DUGA 4AWUA 5E9AA 4XD4A 3GK0A 1MRAA 4FF5A 4O14A 3WUBA 4BKNA 3CB8A 3T9PA 2UV8G 4X22A 4JTJA 3IK4A 3VKAA 4F2TA 2IMRA 2OEMA 1WDPA 1TCMA 4L5ZA 5JBDA 5A94A 1NF0A 4Y7EA 1FKWA 4QS6A 3REQB 2PDWA 1Q2SA 1W1ZA 2H90A 5G1YA 3RUBL 2ESCA 1NP0A 3VIFA 2BGNE 4GUIA 3IVSA 4QNWA 1EJWC 1H7WA 4GY0A 3CEPA 2BXVA 4X61A 3BICA 4MDPA 5M2FX 1RVKA 2CHRA 4QG6A 1Q6QA 3CPUA 3W88A 4UQCA 1WA3A 2B7QA 2YJQA 4NJGA 3VYLA 1GZGA 1H61A 2O4MA 2F8QA 3N9KA 3TR2A 1N82A 4Z2LA 3QQ0A 2AGTA 3QKZA 4GQQA 2KAUC 1KLZA 4A35A 1BSIA 2BNJA 4ERGA 4LUJA 2XFRA 5I24A 2VI0A 1REQA 4L9XA 4NNBA 2V3EA 3LRMA 3MYOA 1GOWA 4KBXA 1E51A 3BCJA 2VEGA 3C0JA 1K1DA 3CH9A 5IHRA 4ORMA 1TPDA 1JAEA 5CJMA 2Y7FA 4XAYA 1XICA 1NTHA 4JTHA 1M9HA 4PUEA 2OX4A 3GVGA 2HVNA 3SAZA 3USZA 4HN4A 2EPMX 2V30A 4V27A 1J5TA 1H7NA 1WAUA 3UWQA 5TNVA 1CBGA 4AVOA 3SJ3A 4HYRA 3RPTA 2ATMA 2G0WA 3A47A 1OEPA 1A0CA 2ONEA 4PRRA 1FBAA 4DXVA 3SZ8A 1EZ2A 1WZAA 3WBYA 1B0IA 1EJVC 1OD0A 1QDSA 2C6QA 5JIWA 2DUAA 3TC7A 2WHJA 4RDWA 4FNPA 3GG0A 2EXOA 5AVHA 3EPMA 4L6OA 1TPVA 4J1OA 4DJFA 1MQPA 2FVLA 4W88A 1KLYA 1XV8A 3L23A 1E71M 4RNFA 2GVLA 1X1OA 1UKSA 1OVDA 2WMIB 3K46A 1LROA 2OZ3A 4C7DA 3NOEA 3WDQA 1HJVA 1KTNA 2Z27A 2ZICA 1ZU8A 3VIMA 3QF0A 3P81A 2WWCA 5LNVA 3IGHX 1TVLA 2J47A 4GYPC 3P5ZA 1VB9A 3W22A 3HO8A 3GDKA 5BWFA 4KW2A 3G1SA 3HQPA 5CC7A 3C2EA 4OOUA 4H9VA 3V1PA 3NM1A 2CETA 3VABA 3NPWA 2ISFA 3LNPA 1OINA 4DWDA 5HJLA 3WJZA 1ZP3A 4C90A 1WXYA 1R46A 4E38A 3FXGA 2ZUVA 2E09A 3GFXA 3E2QA 4IIEA 3KOFA 8TIMA 2NX1A 3PG9A 4Z2GA 4XAGA 3MMUA 2QJJA 5I3HA 2G50A 2GDUA 3RFAA 3VKDA 4UFLA 2FZMA 3G1FA 4H1ZA 1EC8A 3WK2A 3MQTA 4RUBA 4WHBA 1KM2A 1PZ1A 3KTXA 3CQHA 3GG1A 3VXGA 3CHVA 3W2JA 3L67A 2WMHA 4GNVA 4QTGA 1EC7A 4I5XA 4DJED 1XI3A 3OPSA 3U2EA 4HK6A 2W6RA 3LGEA 5BU6A 3LTSA 4WZHA 3TKFA 3PBYA 2IUZA 3GHRA 3Q2DA 5B7ZA 4Z1YA 3THCA 1XIHA 1OCQA 4O17A 4D6HA 2E8YA 2GGGA 4WY0B 2I57A 3QYSA 1OG6A 3QFWA 2CC0A 2IKGA 1RJPA 4EXBA 3RCYA 3TZNA 9RUBA 2R24A 1C91A 2C18A 5G1TA 1PE1A 1FFRA 3IVTA 2X0YA 3TLLA 4JHOA 4J5NA 4MFEA 4M51A 3AIBA 1UD3A 1LOSA 3FS2A 4M8UA 1EF3A 3NQBA 1SSGA 4HU0A 3GY1A 2WPGA 2YKKA 1ML1A 4YLWA 2UY3A 5E6YA 1HL9A 3L4WA 3ZLGA 3LBCA 3HGSA 4A6GA 1J18A 4LUYA 2ACUA 2WKGA 4Z2JA 4Q4MA 3POHA 1CGWA 1IEVA 3H2NA 1VFFA 4UFIA 1JUEA 1XLIA 1UWTA 2TODA 4GJ1A 1X6UA 4IMCA 3DFPA 1OT1A 3FYYA 2ZRYA 2WZTA 3VNMA 1MNZA 4KIEA 6CGTA 4IP4A 3HA1A 2VRQA 5BOEA 1PO9A 5C2XA 4QM1A 2JEQA 3OQ8A 1P6BA 3WLOA 4H01A 1Y5WA 4ZQPA 3EWZA 4MJ4A 2OWCA 2ZC1A 1K8YA 1VFLA 1QNRA 4GQGA 4M1RA 2RDTA 3TUUA 3PSVA 1V0KA 3NZRA 4W7UA 1HP5A 1YXDA 4NASA 3W26A 5KITA 2ALDA 1OSEA 3EXRA 4EX4A 1E6SM 4WJ8A 3VGDA 3CTLA 2NQJA 5HMFA 4IICA 1AJ2A 4GACA 2CBUA 2DU2A 5C9XA 3NQFA 5F4XA 1HTIA 1FWEC 1IT7A 3ITXA 4N9CA 3BSGA 3W76A 4XSLA 3NAVA 1SM9A 5A6TC 3NEVA 4IG2B 5FF7A 4XO6A 5TD4A 1S39A 4ML4A 1BTCA 2AMXA 3U48A 1BSLA 1XSKA 5F2IA 4DJFC 5KEZA 2WCSA 3L5AA 4YNGA 3STGA 3PAOA 4LAOA 3FIGA 3FJLA 4OV9A 2PWEA 1S46A 1TV7A 1DQWA 3EPNA 3QY6A 3SECA 3UQNA 4C1NB 4DELA 3NURA 1TV3A 2AMGA 5EGRA 2PMQA 2GJPA 4B4HA 1TWIA 3SIMA 2DW6A 2NV9A 1ZBVA 3WKZA 4M7SA 4XZIA 3H4XA 3LGDA 4JN6A 4KH2A 3FYPA 4O8RA 3IVUA 4Z1CA 4JGDA 5A8NA 3UFYA 1CYGA 5EBUA 1DP0A 3VIGA 2PWUA 4HIBA 1PKNA 5G4HC 4PBGA 1DJNA 5T26A 2PLKA 4QX4A 1X8CA 1CT5A 3KZSA 4Z2IA 4A29A 4DNMA 3S83A 4GE8A 2E6FA 3QLLA 4NRSA 2RDUA 2VEMA 3BLEA 1EQCA 1DJHA 4HA3A 3V18A 1LJYA 4BK9A 4OOZA 3KRUA 3OZOA 2ODOA 1AJ0A 1XHGA 4CCDA 5BRPA 3C2OA 1XWYA 1S5MA 4RZ6A 1O5XA 1RJRA 2FHFA 5F1UA 4UTKA 3LXAA 1VEPA 3CMGA 1EHNA 1WX0A 4GFIA 3UJEA 1UBSA 2QIIA 1XSJA 5EMUA 4JD4A 2DP3A 4EIVA 1KM0A 2DEPA 3KVJA 1FWIC 5D03A 1ZALA 4UMCA 2BHYA 1R6WA 4UOJA 2YA1A 3W00A 3ZJ6A 3KAOA 2QUVA 4RDYA 3F03K 1CI1A 5C9WA 3SCOA 4TMCA 4QRNA 2A3LA 3S6DA 3FGCA 6TIMA 3QPYA 3QBUA 2QVHA 3VE9A 2BX7A 3GC4A 4GVGA 1JIBA 1RCXB 4B5NA 4N02A 3BANA 1YPXA 1EIXA 3FEQA 1TA3B 4X3ZA 4WUIA 3E0WA 2QPXA 2Z00A 5HUPA 1GWJA 2IQ0A 2I16A 4C6NA 1GOIA 4RXFA 3WJWA 1BXBA 4AF0B 1HF6A 2HQAA 1I0DA 3WDRA 1DV7A 3TVAA 1SJDA 4ILSA 2HVMA 1A5NC 4LS1A 1BYDA 1TWWA 4Z1AA 4RV3A 5T91A 2ZRXA 4A3RA 5H8UA 3R11A 1XSIA 1FWWA 2BY3A 4R3UA 4L56A 3SB0A 4A3YA 4P8WA 1EJXC 1AQ0A 1O5RA 1V79A 3ZR4A 3MJMA 4URIA 4NAFA 1UG6A 2G37A 6REQA 1H7PA 3L4UA 3T2PA 2CLHA 3EX3A 1EXPA 5HATA 3FN9A 5I23A 4NVTA 3TXVA 4PULA 1S5WA 1T7LA 1YE6A 1H63A 4ZO7A 3AYVA 1RSCA 4AUBA 3UR8A 4XZMX 2JGYA 4HPGA 3MCOA 3CQKA 3PN8A 1SFJA 3RMEA 3FDKA 3RRAA 4QSFA 4EF9A 4XZBA 4FI4A 3WFLA 4DYKA 4ZMGA 1S3HA 2Z2AA 1V3HA 5I7GA 1FRBA 3L2IA 3FHAA 5TBOA 3KVMA 2CNCA 2HCVA 1AJZA 4V15A 4YHEA 1ONEA 2V63A 2X2GA 1CXHA 3UWWA 1SR9A 1F3TA 2VR5A 1P48A 1XPYA 4TX9A 3N4EA 4OFCA 2Z2UA 4MLRA 2YZRA 1CXLA 1PHQA 1TWSA 4G1KA 1M5WA 1DL3A 5C2CA 3W2UA 4KRZA 2GDQA 3EX4A 1K9EA 3BWWA 4QLJA 1CGTA 2G3NA 2GGEA 5DF0A 4PMZA 3R94A 3KL0A 1TVNA 3AISA 1OK6A 1PKMA 4TOQA 1QW9A 2JBMA 3KVLA 4F3HA 4OZOA 4NJJA 4ZOCA 5AHIA 4K39A 1KFEA 1DJYA 3UZ5A 4Q3MA 4IMFA 6A3HA 3VDCA 4GKTA 2BY0A 1DWHM 1EJ7L 3T0DA 4UFHA 3HGJA 3EPOA 4LV9A 4KKXA 1ONRA 4NAEB 1UD8A 1UWAA 3AMDA 4AQLA 1P0DA 1YDYA 1AZ1A 3H7VA 4IOTA 3AXMA 3LPGA 3MSRA 2INEA 4EWJA 3ZT6A 4D6FA 1POKA 2EQDA 2WZEA 1I60A 4HHHA 2O7QA 3I4KA 3TROA 2J74A 3S42A 2OODA 1BKHA 3MSDA 3QHMA 4AY8A 5AHNA 5FCZA 3VIIA 2J7BA 2EG8A 1QI2A 2PTXA 2OSYA 1CXFA 4AZCB 4U2ZA 1I1XA 1JZ3A 4W7VA 1MW0A 4KCVA 4O15A 3VM7A 3TAKA 3EDFA 1FWHC 1VPXA 4RE0A 1H1NA 4CEUC 1ITCA 2GGIA 2WSKA 2JK2A 1T0OA 1K9FA 3U57A 4JR5A 2CLIA 4J27A 4MB5A 1UJPA 2VR2A 4H6EA 1Q6CA 2VFFA 4YTSA 1FDJA 1TG7A 1W3NA 2DZBA 4JTCA 1V6WA 4O1CA 1DPMA 2J25A 3D3FA 1OBAA 2BFGA 2CCRA 3O0KA 2WM0A 3TJIA 3JZUA 3K1GA 4HT3A 4MPKA 3KLKA 3E5PA 4LVAA 2HS8A 3MO7A 3RGTA 5F7UA 3A4XA 3AIRA 2OGJA 3S6TA 2PC4A 3P14A 1QJWA 3H22A 1ISVA 1QI3A 4E6MA 4GXWA 2BVWA 1DIOA 1OZQA 4NZ4A 3AIUA 4IGHA 5CPOA 5AFDA 3P74A 1HKIA 3SRKA 1PZ0A 3EXTA 1SZGA 5AC7A 3LPOA 4MKNA 3OZMA 1IEWA 4MB1A 1CGYA 3WQ5A 1I2NA 2ZUUA 2KX9A 3DDMA 4JTFA 4JIEA 1MZHA 3H2EA 4MFDA 3GNOA 3VGHA 5I09A 3WBEA 3BH4A 2OSWA 3G6MA 3ARZA 4JTLA 3TA6A 1LM1A 4C6FA 1VBHA 1A47A 4HHPA 3IANA 3L0KA 3A4JA 2PPGA 4DBEA 3SW6A 4MPQA 1FWDC 1YEYA 3LQGA 2YB4A 1TYGA 3G5EA 1V08A 1JCTA 1QPQA 1T8QA 2NZLA 2QDEA 3MT1A 3QPEA 4AHQA 3ID7A 2R1MA 3WF0A 4J3TA 3W1MA 3W71A 5LSMA 4R7JA 1NFBA 3G1DA 3WMBA 3DENA 3TYDA 4LOCA 1GVIA 1XLEA 3CNYA 1J2BA 3WEMA 2Y5EA 8XIAA 5CZJA 1ZZMA 2D3NA 4J2PA 1RVGA 3EAUA 4M82A 5TAOA 2DIJA 1OADA 3IWPA 3GVQA 3UZYA 1MUWA 4MM1A 3R7MA 3P2VA 1KXTA 4PYSA 2FFIA 3NNTA 3CUZA 3K4WA 3DCPA 4S3DA 2WOQA 4IGSA 1FWGC 4XD5A 2PRLA 1GVEA 1XYMA 5T9BG 2DORA 3M5XA 1J4EA 1R3SA 3SGGA 4KWSA 1E56A 3GLCA 4UFJA 4GUJA 3UVIA 2YDSA 4GGBA 3HG3A 1UW9A 2ZCGA 1UUMA 1E1CA 2PF8A 4MWAA 4D8ZA 5HNNA 1S2VA 1SZNA 3WLLA 4C6KA 4JCLA 4B2DD 3M64A 4YWSA 2R94A 3WF2A 5D02A 1RD6A 1UC5A 3UBPC 5MKGB 3T05A 1SGJA 3VKJA 3BMVA 4LXFA 1EP3A 3SUTA 1XDLA 4Q4SA 1LTDA 3DN5A 4HPJA 3S5ZA 4NJHA 3B06A 4Y96A 1IYXA 3E12A 4TTGA 1KD0A 4HHLA 1UD4A 1WP6A 3VNJA 5HULA 1EX1A 1OX5A 2GVJA 1XUUA 5J5DA 4JQ3A 4S3BA 1KRCC 1GOOA 7XIMA 4J3UA 3LNMA 3T09A 4G8TA 7ODCA 3MTWA 2DZTA 2PGFA 4EAMA 4A22A 1EYEA 2VO5A 2P0IA 3DERA 3LQLA 3LSBA 3T2QA 3SFKA 1NELA 1V7YA 3TQ0A 2PDIA 3CQJA 2DVTA 4IQEA 1QR7A 2B31A 5D32A 4E4UA 4L61A 5LNSA 1XD0A 3GBDA 3MUZ1 4P7RA 1W2VA 3L9CA 2SFPA 5BCAA 3OG3A 4O4WA 4PTXA 1KFCA 1NEYA 1K02A 4ICMA 3GDLA 2X09A 3Q65A 1GVFA 2DSVA 1K3UA 1GQKA 1X97A 2PDNA 1XH2A 4YXGA 2OB3A 2D0GA 4DLFA 2D2JA 3WFZA 2F84A 5JMUA 1E6NA 2D2GA 4WK9A 3EWUA 4O8AA 4A2SA 5FKYA 3V35A 2PFHA 3ZT5A 2G8ZA 1GG0A 1VF8A 4L9ZA 5CCZA 5CGTA 1JL8A 1E4IA 1BQGA 5H1WA 2REQA 2GLKA 3NTYA 3TC3A 1QPNA 4I6KA 1ZAIA 1IE7C 3B40A 3QY8A 1DBTA 2J7GA 1PCWA 2C0AA 4HNCA 2XH0A 3CIWA 4N9BA 2VGFA 1HUVA 3P60A 1GKPA 2ZDRA 3PJTA 4AZBA 1KCKA 2PWGA 2VURA 3SN0A 3QOMA 2OELA 4H9MA 1RLDA 3WQCA 1A3WA 4UCGA 4AHPA 3KTSA 5KZMA 3QSRA 2GQ8A 4QJ3B 2ZWYA 3TK7A 1RBLA 2OWXA 2FTYA 3BLFA 1T5AA 4V2XA 3QSTA 4EPDC 2YW4A 3BOXA 2BY2A 2PUZA 1A5KC 1FFQA 4C60A 2C15A 1Q4NX 3OGRA 3WH8A 4M3PA 2V5DA 3HG4A 1HX0A 1SVDA 2Z4GA 3L0NA 4ZEPA 4P8VA 4HZ6A 1PTGA 3KRSA 3QHNA 2I1OA 3CUJA 4N0RA 3F2CA 3CAVA 3R1ZA 4A3HA 5A6SA 5I78A 3KBVA 3O8AA 2Z6IA 1R9XA 1DIDA 3WMLA 3MHUA 4ZQCA 1Q6FA 4IMGA 3VIHA 1PZ3A 3DHUA 4MY1A 4CNTA 3UCCA 3LUTA 1VEMA 3NJ3A 3OQEA 4NT0A 3EGJA 3W1TA 4Y9NA 1Y5XA 2YIHA 4C1LA 1H62A 3W7MA 4H6QA 1TPUA 4REQB 3VCCA 4MWAC 1P7TB 3HPAA 3S9YA 4MLJA 1CXKA 4KEVA 2NSOA 4DLMA 3BSHA 1AA1B 3V1HA 3BPWA 4PRTA 1XYLA 3CQIA 3ARPA 5H8PA 4UMAA 4TXEA 3MWCA 4H2CA 3OLDA 1XS2A 2J7EA 2ZTJA 1QUMA 2ZX5A 7REQA 1XFCA 1W5MA 3WDJA 1JPKA 1DHPA 3MUIA 4IIGA 1E43A 1X96A 4AZ5A 4DZAA 1XX1A 3OZPA 4EPEC 5J04A 3BV7A 1YKWA 4C6IA 4CD5A 3QHOA 2O9OA 3ES8A 4HU3A 5D33A 4UZUA 1LT7A 4FLRA 4H8VA 1MXDA 3EA3A 1PDYA 1MRQA 2PDCA 3UPMA 4CKQA 1VPQA 4AVNA 4F66A 3HIJA 2WSQA 4I9MA 1JZ7A 3U7VA 4JN8A 3S5NA 4YJ5A 4NX0A 2C79A 5JXQA 2PZNA 2IKJA 3N29A 4DM2A 1IWPA 5DY2A 4HB7A 3GU9A 3GVRA 3LERA 2QLYA 4PUKA 2PD5A 1XP3A 3VD3A 1AQHA 4U5KA 2WMKA 3SY1A 3CUXA 5KETA 2GQ9A 1ZCCA 3SCTA 3NM3A 4WLCA 1XM3A 3OA3A 1IEQA 3RDKA 2WV8A 3IJ8A 1LF1A 4M19A 2PDPA 1W1PA 1NF7A 2OZ0A 4YMZA 1W0MA 1C7TA 5LHFA 1K70A 5I06A 1HVQA 1C9WA 1Q85A 3AS1A 2PP3A 3W28A 4FP1A 4UR9A 2I14A 1M7XA 4JKKA 5I5RA 4XKYA 5E6ZA 3A5VA 3W86A 3SN1A 2W4XA 1LWIA 1XIIA 4GI6A 3IACA 1UWIA 2WBGA 1GJUA 2JF7A 4DF2A 1KBIA 3AMGA 2FPTA 3TSMA 4US5D 2J7FA 1TZ7A 1S1RA 3IGXA 1R3VA 1H51A 4W7WA 1IT0A 3C52A 1GTEA 1L8NA 3BJSA 4LX4A 2IPJA 1B3OA 3UNTA 4JX4A 4C6JA 3W74A 4IT1A 2ZA1A 3P0WA 2E7FA 1LLOA 1ECQA 4LSBA 4AZ6A 3COTA 3NZ1A 1J11A 3UGRA 2C0HA 5E0CA 5AC8A 1UD2A 4LQ1A 4LF2A 2XGIA 3KXQA 4U28A 3G0XA 1AH3A 3FVMA 5JBFA 3VGGA 2QYGA 4G2DA 4M6QA 4JCMA 3E5BA 3BG3A 2QPUA 4NX5A 3TIMA 2E1WA 4AW7A 3MVIA 3OVGA 1E6XM 3WQEA 1GQJA 2Y6ZA 4RX0A 3BCFA 5H91A 4HSNA 3WQVA 1J0ZA 2IXUA 7PTDA 5H2ZA 4U31A 4ML9A 2P5NA 4HN8A 4D2JA 1V77A 3IIXA 1NWUA 3KDOA 3D6NA 1QW7A 2E0PA 3TQVA 4JIQA 1V0NA 3RO6A 1ZSXA 1XIDA 2QULA 1E1FA 4L4MA 4C6CA 4HZ7A 1WXZA 3E0IA 3NGJA 1TO3A 3B0XA 2DT2A 3G8EA 3W7NA 1J0YA 4XZHA 3OHMB 2VX6A 3WBAA 1R8LA 1W3KA 4GY1A 2OG9A 1E5JA 5LIYX 4GZ7A 4MWAE 1XPGA 5HNTA 4AZGA 3GR4A 1BLIA 1POJA 3FXYA 1QASA 4Y6GA 4XG1A 1UUQA 2CU0A 1E40A 1GOQA 2XG9A 2HPIA 3BO9A 2ZRVA 3BMXA 3OW1A 5A3HA 1OB0A 4WDWA 4ZR8A 5FF3A 1XRSA 3E2RA 4KT2A 4GBUA 4FF7A 2DZVA 4O1DA 3GH4A 3P6LA 5JVLA 1MXGA 1W9DM 8A3HA 2VZVA 9CGTA 1B1YA 4NZJA 2XGZA 3GH7A 2G5WA 3CHCA 2XH7A 4H4IA 1HIZA 1YMYA 2QJGA 3HZ3A 1UPPA 4HJFA 3DKLA 2J8GA 1S2AA 1RP8A 1XXXA 5I0DA 2NQHA 1PHWA 3AUJA 1A5AA 4X2RA 5FA5A 3VIOA 3G1AA 3R10A 3BL3A 4GX8A 3NZPA 1A5OC 2ASHA 1NY1A 3OO2A 4LAMA 4HVXA 5CGQA 1GTHA 4XB3A 3GAKA 2HDJA 2WM1A 3DI1A 4TVCA 2E77A 3F4NA 1L6YA 1VD6A 1X8FA 2PGRA 3MMTA 4F0MA 4ZFCA 2A21A 1T6MA 4OBSA 2V9DA 4M81A 4PUUA 1LG1A 2FGLA 1R3RA 3UR5A 3LM3A 1WUEA 4ALDA 4MY9A 4Y8EA 4Q6JA 3C0SA 4KCUA 1JCLA 3FJ4A 1VHNA 2P8CA 3LZ5A 5CPNA 2V2DA 9XIAA 5AVNA 4A8LA 3HB9A 4Q8OA 1QT1A 4JHMA 4IJCA 2NQ9A 1VFSA 3DHDA 3WEOA 4L4OA 3RJYA 1FOBA 4HPNA 1KFWA 4JPGA 4W4QA 3WIJA 1K8ZA 1FQ0A 3W1UA 2OEKA 1WDSA 5LYRA 3PJUA 3UJSA 5M3WA 4ATWA 5IFTA 3VD9A 2HXUA 1QU4A 1O68A 1JULA 3DHFA 3AIQA 4RNHA 2QHAA 4G6CA 3L5LA 3TCEA 4Q8UA 1GYNA 2VVNA 2QCFA 3W1AA 2X8RA 5E1QA 2CITA 4ZCWA 5AN7A 2OYMA 2VX7A 1GKQA 1F4AA 1UOZA 4G56A 4WSJA 1XDMA 2PDYA 3CYJA 1LBLA 3TN3A 1KM3A 2W67A 3CO8A 1RJQA 4AZ7A 3BXWA 4MYAA 3TJXA 4F0SA 4P8UA 1M68A 4N42A 2FFCA 2VZOA 1XLFA 1GG1A 1OFDA 2ZZ7A 3ITTA 1Y7VA 4O50A 3VKKA 2INZA 3N14A 5ECVA 3NL2A 3M43A 3QYQA 1H7RA 3MSYA 3F1QA 3ZO9A 1QPOA 3SO7A 2ON3A 2DH3A 3GIQA 4S2CA 1MFUA 1QO2A 3GR8A 5K9CA 5GNXA 5HBFA 3CWOX 3CM4A 4JL2A 2WQDA 1Q7QA 1BKSA 4C6BA 4N6EA 3ISIX 4NZ1A 2A79A 4O12A 3DESA 4I6VA 4E2BA 4I7WA 3TN4A 1VAHA 4ZB5A 1CGVA 3BOFA 1UD6A 5DBTA 4Y9PA 4NUWA 4E8CA 3N2TA 1YW1A 1UUOA 2HK0A 1BHGA 3B8UA 5C7HA 2DZWA 1W8SA 4LF1A 5LGZA 4NIRA 4KWVA 1J93A 2HE5A 4H6RA 1B3WA 4D1IA 1DXIA 1KBKA 1I2OA 3U6WA 4K7VA 3PFMA 2AL2A 2XVPA 1WKDA 3UF9A 4S3JA 5B7YA 4RR4A 1UA7A 4YIWA 4WF7A 2H8XA 1FH8A 3QQ1A 3LCHA 2BLEA 4UNLA 3BQ5A 2WAGA 2NUXA 3GIYA 2FLIA 3LHWA 3W23A 3FDGA 1TUFA 3LI0A 4IFKA 3FW6A 3DFHA 3NZGA 1NARA 4ONVA 4E2OA 1EXBA 2QQ6A 3MS8A 3WLHA 3APGA 1W8GA 1JNDA 2ZZ5A 4L80A 5CPMA 1TIMA 4IUGA 1C29A 1M41A 5U4NA