4L1WA

Crystal structuer of human 3-alpha hydroxysteroid dehydrogenase type 3 in complex with nadp+ and progesterone
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
325
structure length
325
Chain Sequence
b'SVDDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C2
publication title Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 119
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.1.1.357: 3-alpha-hydroxysteroid 3-dehydrogenase.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4l1wA00
4JQ2A 2PDLA 3RX3A 2HV5A 1EL3A 2FZDA 2I17A 4GABA 4JQ1A 3EB3A 3T42A 1AH3A 3MB9A 4LB3A 2HE5A 3S3GA 4PMJA 2HVOA 1EF3A 3FX4A 1K8CA 2DV0A 2FZBA 3R6IA 2PDQA 3UZZA 1R38A 2PDHA 3V0TA 4JIHA 4JIIX 5LIKX 2BGSA 4GQGA 4LBRA 3ONBA 4FA3A 4XZIA 2ACRA 3GHUA 1S1RA 3WG6A 3RX4A 3O0KA 1XGDA 3LN3A 3DOPA 4XZHA 4PR4A 1SM9A 1MI3A 1T40A 3EB4A 3R7MA 4QR6A 3LZ3A 3BV7A 4WEVX 4XO7A 1Q13A 1J96A 2HVNA 2BP1A 3UFYA 1XF0A 3V0UA 3DN5A 4LB4A 1A80A 4DBSA 2PDNA 2ISFA 3M4HA 4GACA 5LIWX 3LQGA 5KETA 4JTCA 1QWKA 3G1RA 1YNQA 4JTAA 1MRQA 3R8GA 2ACSA 3O3RA 5LIUX 5HNTA 4FZIA 4L1WA 4WGHA 2PEVA 3UZWA 4GA8A 1YNPA 3UZYA 3H7UA 1YE4A 3FJNA 3UYIA 4RPQA 5M2FX 4IJRA 3BCJA 1QRQA 2DUZA 3N6QA 3COTA 5JH1A 2QXWA 2PDKA 2F38A 2A79A 2WZMA 1JEZA 2IKIA 3LEPA 1S2CA 3LENA 3D3FA 2NVDA 4YU1A 2IKHA 4JQAA 2PDMA 3N2TA 3ONCA 2ALRA 5LIYX 2PDXA 4AUBA 2AGTA 1PWLA 2NVCA 4PRTA 4PRRA 3UP8A 3CMFA 5DANA 2R9RA 1S1PA 2IPWA 3LNMA 3VXGA 3Q65A 4PUWA 2FVLA 3GUGA 3V36A 4XZNX 2IKJA 4JQ3A 3CV6A 3P2VA 1YE6A 2PF8A 2PDUA 3LZ5A 2I16A 1VP5A 4LAUA 2WZTA 1ZQ5A 4YVPA 4YVXA 3V35A 3RX2A 1ZUAX 2CLPA 4OTKA 3R8HA 1C9WA 3M0IA 3GHRA 3EAUA 4DBWA 2IPFA 2PZNA 1IHIA 2IKGA 3C3UA 1EKOA 1UR3M 2PD5A 3ERPA 4DZ5A 3V0SA 1AH4A 4WRHA 1X97A 1FRBA 2IPJA 4XAPA 2PDYA 2FGBA 1IEIA 3KRBA 1AZ1A 1Q5MA 4G5DA 3LD5A 4IGSA 4JQ4A 5LIXX 2IQ0A 1PZ1A 2PDJA 3NTYA 3WBWA 4LAZA 1RALA 2J8TA 2F2KA 3UWEA 2FZ9A 3WBYA 4JIRA 3F7JA 4QXIA 5HA7A 3MC5A 2C91A 2PDGA 4XVDA 4MHBA 1MZRA 2INEA 4L1XA 4Q3MA 4R9OA 4GIEA 2ACUA 4Q7BA 4NKCA 1PYFA 5HNUA 4FAMA 4H7CA 4IJCA 4QX4A 3GHTA 4GCAA 3M64A 1HQTA 4DBUA 3B3DA 2PDCA 2PFHA 1XJBA 1US0A 3LBOA 2IQDA 5AZ0A 1PWMA 5AZ1A 4WDWA 1EXBA 1RY8A 4JTQA 4GQ0A 1ADSA 4I5XA 2PDPA 3LUTA 4HBKA 1ZSXA 4XZMX 4YVVA 3G5EA 4ICCX 4FALA 3UZXA 3R94A 4H8NA 4JTDA 2HEJA 3GHSA 3Q67A 2DUXA 4YS1A 4LBSA 1AH0A 2FZ8A 2HDJA 2R24A 4WDUA 1S2AA 2IS7A 4WDTA 2BGQA 4ZFCA 4PUUA 1X98A 1ZGDA 1LWIA 2HE8A 3CAVA 3U2CA 1VBJA 1T41A 3BUVA 3WCZA 4ASTA 2PD9A 4JTRA 4XO6A 3WBXA 1AZ2A 2VDGA 4XK2A 1GVEA 4XZLX 3R43A 3R58A 4F40A 2PDIA 3LQLA 4XVEA 3H4GA 1Z8AA 1Z3NA 1X96A 3H7RA 3CAQA 3CV7A 2PDFA 3QKZA 1PZ0A 3UGRA 3BURA 4QBXA 2ACQA 1OG6A 4EXBA 1Z9AA 2INZA 1AFSA 2PDWA 1LQAA 2P5NA 4EXAA 5C7HA 2PDBA 4WDXA 1Z89A 4HMNA 1M9HA 5JH2A 2IPGA 3CASA 1RY0A 1HW6A 3UG8A
chains in the Genus database with same CATH superfamily
3L2MA 2DZAA 4U28A 4LYKA 2CKSA 4L9XA 2P76A 5XIAA 1CWYA 4ZXOA 5G4EA 1EL3A 2ZFAA 3UWWA 4AD3A 1DWAM 4GABA 4FLRA 3CS2A 4QE4A 3ABQA 4ADUA 5BZAA 4ATLA 4J9JA 4H6RA 3O6DA 1UR4A 2ZZ2A 4JOMA 3WQOA 4NZJA 3CJPA 2POZA 3OG2A 3R6IA 5REQB 4LS1A 2PDQA 3IGHX 1XUUA 3KL0A 4IFOA 5HMDA 4JIIX 3TFCA 1QPNA 3W7IA 4CU8A 2R1NA 3REQB 1EJVC 4B92A 1FWHC 1QPOA 5JQ9A 1I60A 4ZMGA 1EP3A 1QU4A 5XINA 3KTCA 2GOKA 1XLIA 1E6RA 4C6QA 1TTIA 3LRLA 5I79A 1FHDA 3AS2A 3C0SA 1S5TA 1XLDA 3UQNA 5HQMA 2QR6A 2BP1A 2PSNA 1NQKA 1JYVA 2A3HA 2GSEA 1KXTA 4EWND 2PGRA 2VX5A 4DM1A 2I5GA 4ML4A 1OF8A 2F7FA 1TPH1 3VNDA 1QUMA 4G56A 2A1YA 1JJKA 3VINA 2QDEA 4CCZA 1QI2A 3PTQA 1MRQA 4YN5A 2G97A 2J9XA 4DYEA 4ADTA 3BARA 3AMCA 1MMFA 2ZUSA 3SCPA 3QN3A 3PUGA 5HR7A 3BICA 1N8FA 2V69A 2ZX7A 5REQA 4ZO9A 3C56A 2F38A 3GH4A 5DQPA 4J4KA 4LCSA 2PF0A 1D2KA 3MKKA 4HT3A 2WZHA 1XLBA 3FLUA 4Q4RA 3PS7A 3UWVA 3WDQA 3KVMA 4JHOA 5A6SA 5EFFA 3TR9A 1ZAHA 3PJTA 2JQXA 3LTPA 1GWJA 2WJFA 3IACA 3W7PA 1F4HA 4KERA 1VS1A 1FFQA 3TNBA 3UW6A 3Q65A 3ANVA 1E51A 2VP8A 1K8XA 4ZOBA 3WH5A 1SVDA 4GLEA 3HGOA 5AYBA 3PJUA 3ZJ8A 4PN2A 2PDUA 3L9CA 3L0KA 1R3TA 1H09A 1DJNA 1F3WA 1IXQA 1R9ZA 3IS4A 3EX2A 3QR1A 5H91A 1W54A 3R2GA 3OPSA 4TXEA 1EQCA 1WKEA 2V3EA 4Y8EA 4NJHA 3SDOA 3GHRA 1QATA 4MIMA 1D9EA 3WMBA 1UZ1A 1YDOA 1BLIA 1TMHA 3E38A 3L4YA 4CEUC 1FHUA 5DY3A 1ZL1A 3MCNA 3CTLA 4TMCA 5G2HA 5EMKA 5JIPA 1VIZA 3DHPA 5JMUA 3O16A 1U5HA 4J2PA 1A5AA 4CN4A 1A5CA 1AZ1A 2BLEA 4DI8A 2BXZA 3N3MA 1OFAA 4QLJA 5I6SA 3S5SA 3V5FA 5LNWA 4WKAA 4EPKA 5A6JA 2VHLA 1CGVA 3HOJA 4O53A 4UOQA 2CITA 3BJFA 4C90A 3M44A 3B8TA 4GUFA 4EF8A 3F7JA 1VYSX 3TOYA 4HJFA 4ZFMA 1KWKA 3MC5A 1GVYA 2PDGA 1E43A 4MHBA 2EPLX 3SGUA 5KZEA 4JXCA 3A64A 1V6YA 3LHWA 4H2HA 1WV2A 3BVJA 5IBXC 4ADSA 1XISA 3T0BA 1XRVA 1EEPA 4DI9A 3MUY1 3TONA 3F4NA 2QULA 1L8NA 4PMXA 3DXIA 1NDWA 4ERGA 3RMJA 3G6LA 4O10A 1P0EA 3TNOA 1ZPTA 3GZ3A 3AMGA 1E0VA 4NRSA 1YEYA 4BQ4A 1XJBA 4PMQA 3F2CA 4DY1A 4NXSA 5B7YA 5E6YA 3LCGA 3WJXA 1WQ5A 4LRTA 3C2FA 1OZQA 3G1HA 2WC4A 4ZA0A 4PZVA 4IMEA 3B8UA 1GZ1A 4DM2A 3GS6A 1XIIA 3FXGA 3G1YA 2HMCA 3KOWA 4HBKA 4KCWA 4LFYA 2A7PA 4NZ5A 3TJXA 4IPPA 3VNYA 4MJ4A 5IDIA 2WMGA 4AXKA 3VO0A 1LWHA 3GSMA 1E3ZA 1GOKA 1OBAA 1ZU8A 4X63A 3VIKA 5I23A 2OWWA 5L9FA 1KB3A 5A8NA 1IWPA 1FDYA 4GY1A 4QJ4B 2C19A 2MUCA 2X2GA 5EKYA 1B4KA 1JRCA 4AZBA 3W4RA 3LGGA 2OKTA 2ANUA 3T09A 1B3OA 3VOGA 4H8HA 4XO6A 3QZEA 1PUDA 4AIOA 3HGJA 1QHOA 2RKXA 1AZ2A 3FN9A 1Y5VA 4UTHA 1S3TC 1FCBA 3LQLA 4JN8A 4QCFA 3EWZA 3S0CA 5CPTA 2PDFA 2VMFA 1LQ0A 1MW3A 1Y5WA 4ZB5A 1VFUA 2ACQA 2YXXA 1TPUA 1BAGA 2P5NA 4Q4KA 3M0MA 4PTVA 1M7JA 1H51A 3UYCA 1W3JA 4F9JA 3UNTA 1HKMA 5KMYA 4GJIA 4XKMA 4O57A 3VPLA 1GQLA 4BI5A 3N2MA 1DE6A 5C2CA 3RILA 3DESA 4MY8A 1O5RA 2YGYA 2GGEA 1M01A 4FMVA 3AHTA 4KWOA 1CXEA 2O56A 2VZOA 4FNRA 1UD4A 3APGA 1RCOB 4UR8A 3M0XA 3WDIA 3VIHA 1T8XA 2DT3A 4CCDA 4RE3A 3UF9A 2VNCA 3E2VA 4UQCA 5D04C 1ZBCA 2JFEX 2Z1XA 2XFRA 2J7CA 4IIBA 2O7QA 4HNCA 4TX6A 4DF0A 1AD1A 3OGVA 4AH7A 3VI2A 4DVOA 4O54A 1BTMA 2OEKA 2H6RA 2CZVA 1VJIA 1X6NA 1KXVA 1O4UA 2GDVA 3OBAA 1B3XA 1VYPX 4H41A 4GXMA 2E1DA 3GAYA 4KESA 3N34A 1XYBA 3GE7A 4C60A 4P8VA 4JNZA 5MF5A 2WV8A 4QNEA 4GH3A 3P6LA 3TQ0A 3H22A 4LV9A 1XLFA 1TV7A 3GYEA 3IVSA 4U4MA 3ZVIA 3UFYA 1EIXA 1ZJBA 1BXBA 3P3BA 3EWWA 1XLKA 3IRSA 3S1XA 5K2ZA 4Q8OA 1ELSA 4OV9A 4XAZA 2PBGA 2NX3A 4D8ZA 3BC9A 2Q02A 3GKFA 3J7HA 3ZJ6A 1K77A 3WLMA 2E7FA 3SSJA 4C6DA 3H7UA 4FNQA 1EF2A 1KD0A 4URIA 4KKXA 2UV8G 2WMHA 4O0ZA 3TMLA 1EUNA 2J66A 1NWUA 4GOAA 5AHLA 2PTZA 4R7JA 3KCJA 4C1NB 4PUMA 1UJPA 1H7OA 3KP1A 2NVDA 3GXNA 2B7PA 2YA1A 5ABEA 2PTXA 2PRLA 2VFIA 2YJQA 3ONCA 2PDXA 2DORA 3E3HA 1CXHA 3DFTA 4DF1A 3CZJA 1T96A 3CQKA 4MKSA 1ZBVA 5DFAA 3RNDA 1W17A 2GVYA 2D2GA 2I57A 2OOFA 3VXGA 1AA1B 4B15A 1I0DA 2CC0A 5K9XA 1TCMA 4B90A 3CHDA 1UR2A 3VM5A 1TV2A 1WXZA 4PUKA 1RCQA 4O8RA 2VJXA 2GUBA 3UU0A 4DUXA 3UY8A 1I1XA 5J5DA 1E1FA 2PWFA 1UQZA 1R7AA 1NARA 5AYXA 2E6DA 1GNXA 3IWPA 4QISA 2ZZ7A 3IV3A 2Z6IA 3G1DA 2I14A 2QDGA 3HPSA 1RPXA 3UGVA 3FYYA 4DZHA 1OG0A 4M5PA 4H7VA 3N9SA 3WK0A 4C1NA 4UWMA 3SJNA 5HR6A 4KF1A 3JUGA 4P5UA 2IQ0A 1PZ1A 2D2OA 1EJXC 3W1UA 4A2SA 2J78A 1XGEA 4JIEA 3HPFA 3O6YX 1WCGA 3D47A 1JZ2A 2ZBTA 4PMUA 3L4TA 2TAAA 3LERA 4Y6GA 1W3IA 2A3CA 3NQDA 4BF7A 1XRFA 1K6AA 4NJIA 5G1MA 2ZC8A 3KAOA 3PWIA 4Z08A 4MNKA 4WKFA 1WA3A 3LCHA 3T0TA 3NQ2A 3MHUA 3WJZA 2ABAA 1GOXA 3XIMA 1MFVA 2J47A 5LNSA 3ZVHB 3B8DA 1K7FA 2YW3A 3AU6A 2XVLA 6A3HA 4Y9MA 2EG7A 3OU8A 2Q3RA 5CC6A 1KM2A 4B5UA 1TR9A 1XXXA 2VI0A 5D2YA 1MW1A 4AW7A 1W3LA 2EJ1A 3AXXA 1EGZA 3T1GA 3WNOA 4LY4A 3OA3A 1NDZA 3CBWA 4QQ3A 4I5XA 3G3MA 4PL2A 3M5ZA 2Q8ZA 4KMQA 3D5HA 1O5XA 1QOPA 1YTDA 3WN6A 2AMGA 1OYAA 3LM7A 3BZJA 5T26A 1H5YA 2BHUA 4D6CA 2D0FA 1GG0A 2JE8A 1LM1A 4HK5A 5LSMA 1E9LA 1Y8BA 3WEMA 4H19A 1LYXA 2OVLA 4JCMA 1X98A 1UIPA 1YDVA 2HISA 3IV8A 7ODCA 1KBBA 1IT0A 1FWDC 1MYRA 3VNZA 1JCTA 1K9DA 2DU2A 3BH4A 3ES7A 4DYJA 4IP5A 1IWAA 4CD8A 2Y89A 4GINA 5I09A 4R33A 4RW3A 1ZJIA 4WZHA 4LYPA 4TQTA 5D2VA 2JKEA 4JPGA 5CBJA 4NZ3A 1YXYA 4F66A 1FA2A 4Q7IA 3ITYA 1GJPA 2I7GA 2WHKA 5EU9A 4EWJA 2CKRA 2DW6A 4HA1A 3WQEA 3P0XA 3N6JA 4B16A 4YPJA 3FXYA 1NWTA 3IJLA 4L4LA 3QKEA 2OR2A 1UUOA 3PBMA 5HDRA 1X8CA 1AW5A 3VIFA 4IOTA 3WFLA 3WLQA 1AFSA 3ITGA 1A0EA 3H2AA 4DO7A 3IAPA 3FK4A 1HKIA 4XD6A 1M9HA 3T08A 1TV4A 4BEQA 2B7NA 3LK6A 2J9YA 4H9UA 4LEQA 3TYUA 4AY7A 1PPIA 2PUZA 3APTA 1R47A 2Z2AA 4N42A 3I6TA 4YCPA 3GNXA 4Q4MA 3VCCA 3A3WA 4Q8UA 4J5NA 1XLGA 3MQTA 1JAEA 4KIRA 4KWUA 4GIYA 1VBUA 3TSDA 2QCHA 4KCUA 3DDMA 4B3LA 1US2A 3AWOA 4JHZA 2J27A 3LPGA 3W88A 3N12A 4NYUA 4KWSA 3GLCA 4PMYA 2PDHA 2PP3A 2WSKA 2PE4A 4MWAE 3W01A 2FIQA 4M6VA 3MUXA 2PU0A 4I7UA 3VZYA 5B80A 1PTDA 3S9ZA 3HO8A 3S9YA 1HTIA 4OHQA 4LUSB 5F4XA 3II1A 2C7FA 4TV5A 1THFD 3QYSA 2I9UA 3T7VA 4QDPA 3H26A 2ZZ1A 3DC0A 2ZZ5A 2C1GA 1UOZA 3HQNA 4D6EA 4GUGA 2YB4A 1K4HA 3VUPA 4AX6A 4NF7A 2A3AA 4FNSA 3M5VA 2DH2A 1YNYA 4BEUA 2C16A 4GQQA 4N4PA 2ZCGA 1BGGA 2E6YA 3QGAC 4BFAA 1EGMA 1HGYA 2D3NA 3CV2A 4XD5A 4FZIA 3CL6A 5CPSA 1YNPA 4J27A 1F6YA 2J9ZA 5CSUA 3OVQA 4J2MA 2VC5A 3R89A 4B5SA 4GKTA 1FH8A 2XHYA 3VYLA 1UPMB 3JVAA 4EX4A 1S2WA 5CPLA 3QGVA 5D2TA 2H9AB 1I2RA 1NF0A 1S3HA 2OQYA 5EMYA 3VD5A 1U5VA 3IRDA 2VTFA 2OEJA 2PLKA 4V2XA 2J74A 5KTLA 3NQVA 2RFGA 3FY1A 3VVGA 3G1FA 3VIMA 5A5WA 1LP6A 4LUSA 1TJ1A 1FHVA 1GHRA 5I02A 3SN0A 4O16A 5KINA 3FYOA 4AD5A 1RA5A 3T0AA 2A21A 3WUEA 4AC1X 1OCNA 1LLWA 4S3EA 3MA8A 2OQHA 5GNZA 5C6MA 3I6EA 2Y7DA 2PRMA 1VKFA 3TK7A 4O1EA 2WJZA 2FPYA 2V8ZA 3G3DA 3ZT7A 2QAFA 2EJAA 1ZP3A 1J2BA 1J18A 4UR9A 1IWBA 1FP8A 4N6EA 4XIAA 1EX5A 2WYSA 4RK8A 3AFBA 1XLAA 3MP4A 1NSJA 4Q8PA 3L5LA 3F4CA 2NWRA 2DVTA 3SM0A 1KBIA 2B0MA 5GNYA 4F0MA 1CXLA 1HNYA 2ZUTA 4FLSA 3W2LA 5CAKA 1OVDA 2JKAA 3BLOA 3N15A 2CHNA 4XAPA 2PDYA 1WBHA 2WNNA 4HPXA 3CMGA 4ROPA 1Q7QA 2H9AA 4AQLA 1GJWA 3O2LA 4HSNA 1R87A 2A3EA 3QZ6A 1V3LA 2F6XA 3BAWA 3MV11 2ZUUA 2DIJA 3MMDA 4CQDA 4W8LA 2Z0IA 1XFCA 3OEXA 2VKZG 1XBZA 2Z25A 1PDYA 3M0HA 1Q66A 3B0YA 2P3EA 4DJEA 3HJEA 3KM8A 5DCBA 1MEWA 1Z7AA 3AXMA 4KQNA 2R1LA 2PWEA 3B4UA 4GI8A 1XI3A 3ZSSA 1UB3A 3GBEA 3PZQA 3W38A 1NWSA 4ZSTA 1MFUA 4UNLA 1GW9A 1HQTA 3TTQA 4PSPA 4D1JA 3SR7A 3WNPA 2VVNA 3RFAA 1RK5A 4ZE5A 4HVXA 3GDBA 5HOSA 3AHVA 2GLKA 3HFYA 1VYRA 2WLZA 3HF3A 3LV5A 5A8PA 3G6MA 1TWIA 3LUTA 2WQDA 1R30A 4XV0A 1ZSXA 2QCDB 3ARXA 4K38A 3SJ3A 1CGXA 3CH9A 1W6TA 2O7SA 4I8YA 4INFA 2DZWA 4AIUA 3T0DA 3EWDA 1U30A 2WANA 4IP4A 4AD1A 5EMLA 2PWVA 2Y61A 2YSWA 4O52A 5I3FA 3E2SA 3USBA 1FOBA 3CPUA 2Z7GA 1V5XA 4KFPA 1QO5A 8XIMA 3PPGA 4MG4A 4MZYA 1R86A 3PZNA 5FCZA 2VR5A 4O50A 3STEA 3KCLA 1VC4A 4KWVA 2DSZA 1AK5A 3E49A 5CGMA 3EPNA 1S5WA 3HQOA 3W1MA 4QG8A 2ZVRA 1KKOA 1OYBA 3WBXA 3MO4A 1E15A 1LJYA 4RJEA 2GSHA 1VENA 2DT0A 3BAYA 1VJSA 1EYWA 1VFOA 1MRAA 1FWRA 1X1ZA 3GU2A 3UR5A 3KL3A 4R9XA 1I2QA 4DQWA 1TRIA 3WLJA 4RCXA 1PXGA 2CW6A 4DRSA 1X96A 3W3OA 3KBVA 4JTHA 3CHVA 4DO5A 1POJA 1VFSA 3W1AA 1PKLA 4F0HA 1SYTA 2G4FA 4XZ9A 2GGIA 1IR1A 2OJPA 2QCDA 5E09A 5C7HA 2V6AA 3OP2A 2AAMA 3GVGA 3H70A 1DTNA 4WDXA 3W24A 1GKQA 3BSHA 3TUUA 1QW9A 1ME9A 4BI6A 1ENUA 2O4MA 3TQVA 1JD9A 5C55A 4C6LA 4QGCA 2YFNA 4H9TA 4PBEA 4M7SA 4I6KA 1MDLA 4BK9A 3RJXA 1SMAA 3OB8A 1A5UA 3B0PA 3CL8A 1G7UA 5CAHA 3S4TA 2PCEA 4YTSA 3RLUA 4QE5A 3W23A 1VRXA 1HJVA 2QAPA 3BXWA 3VDHA 3IIZA 2NVAA 4W7VA 3KVLA 1KFEA 3TOPA 3NQBA 3B9NA 4S3CA 2GFTA 2Y7EA 4RZ6A 2J8GA 3MHGA 2ATMA 2DVUA 5LIKX 3DG3A 5CSRA 3AHZA 3OZPA 1BWKA 2BSLA 3UZJA 3ZT6A 4UB9A 4K8EA 1S1RA 3M0LA 3NSMA 3ZT5A 2SFPA 2VX7A 2DJLA 3OIHA 1AD4A 4OV4A 2JF6A 2RGMA 5BXPA 3LLFA 3ARZA 1A3WA 1R7OA 2CZ5A 3OZMA 1HP5A 4P2VA 4UFLA 1BF6A 3WF1A 1F3EA 1F73A 3WDPP 3GR8A 1JL8A 2NWSA 3DKJA 1JQXA 3DFSA 3EPMA 2OSXA 1XF0A 3BLPX 3C0JA 3FGCB 3ARQA 4C91A 1JPMA 2ESCA 3HTWA 2BY3A 2Y8KA 3MHFA 3BGAA 3GDMA 1JYNA 1Y5XA 2P1FA 3THAA 1AW1A 1OFRA 3K2GA 3V7PA 4L6DA 3E5PA 3RCMA 1M53A 1VFLA 1GVFA 2OWXA 4JYFA 2OEMA 4RPQA 4Z42C 1D3CA 1EQPA 3TXZA 1V7AA 2PDKA 5A95A 1OK6A 2GVEA 1XLCA 1TVLA 1OGSA 4AWTA 2XIQA 3DI0A 1W5MA 4K8HA 3JS3A 3W2UA 3KWXA 3RCNA 1FVPA 4PCTA 3U9IA 2JKPA 5A6BA 1W0MA 4HA4A 1JCNA 1J12A 1OSEA 3E96A 3VKKA 3S5NA 5RUBA 4W7UA 4Y9NA 1HXJA 1HKVA 1XYMA 1SJCA 4UFIA 1P48A 3FGCA 1KFLA 3CPRA 7PTDA 1ZQ5A 4XSLA 4BF9A 2V2DA 3TAOA 5AYZA 4D6JA 1O68A 1EOMA 3LB0A 3A6OA 2R1MA 3DHDA 3PULA 4US5D 4MADA 3M0IA 3EA3A 2MNRA 4GXPA 4DBWA 1XC4A 3RLVA 4UTTA 3YPIA 3BAIA 3L66A 4MM1A 3SRDA 2DFAA 4JX4A 4DZ5A 1FDZA 1F6KA 1FWAC 1J0ZA 1ZBKA 4RPPA 1M5WA 4HHHA 5FJOA 3M07A 4K2SA 4M81A 4GUJA 1ME7A 3FVDA 4GUIA 3KOYA 2GL5A 4N0RA 3GW0A 4W88A 5A6TC 3L21A 4MY1A 1JF5A 3NTYA 5AB3A 3FYPA 2ICSA 5AHNA 5A69A 4LVAA 9XIAA 4D6IA 1VBRA 3H2FA 1UD2A 3UA4A 4LCRA 2INEA 1BQCA 4AAJA 5CG7A 2RJGA 4Q3MA 1OD0A 3ITCA 1EJSC 4K7YA 2VCBA 4FSAA 4O17A 4P61A 3MJMA 4RDWA 3ECQA 1XYCA 1O12A 1SZFA 5EYWA 1O94A 2GVJA 3QHOA 1LUCB 4A29A 3NR0A 4IJCA 3MI2A 5K4ZA 2QIIA 4JFSA 4UMBA 4EXQA 1A5SA 5C2XA 2DIKA 4IQDA 3GG0A 3VX0A 4E38A 3I4KA 4MMWA 3V16A 1TVNA 4P7OA 4JTIA 1XIEA 5D2XA 4E0CA 1EXBA 3SZ8A 2GSJA 3CQHA 2Z7KA 3WUGA 2WVSA 4E3VA 2PDPA 1CX9A 2C18A 4GVIA 3S8HA 1J0HA 3BLLA 3CNYA 4H8NA 3C3NA 1JYWA 1EFZA 2WAGA 3ZWTA 3PZOA 1OIMA 3VOIA 3FHQA 3SB0A 4KCVA 4LBSA 2WVVA 1OC7A 1WNOA 3BG3A 1UWIA 2I5IA 2XSBA 3O15A 3TZFA 4ZFCA 1H7WA 4Y9AA 1W91A 3SCVA 3TJIA 2F8QA 5M03A 1FWGC 4GE8A 1IT8A 5D2WA 1T41A 3LI1A 3CXOA 4JTRA 1TREA 2EF9A 3TXVA 4K8GA 4PCNA 2PU1A 4GISA 1V77A 4UC5A 1MSSA 3M0YA 1GVEA 4OUEA 2XG9A 3PY2A 2V3DA 3B05A 3PB2A 1QNRA 5IHRA 3QC3A 1ME8A 3CQ0A 1J0IA 1IYXA 2XH4A 1TMLA 2FTPA 1IXOA 3CAQA 5JXQA 3GTFA 3NSXA 3UR8A 2CHRA 3MP3A 1FH9A 2VX6A 4JHMA 1UD5A 2BHYA 2C3ZA 1EHNA 2INZA 2QHAA 2VGFA 1DJQA 5DT5A 4AVFA 3NEHA 5IHSA 1JG9A 1UBSA 3ISIX 1CGUA 4AD4A 5HAOA 1XL9A 4GJ1A 3LGEA 2JEPA 4A4AA 3AWNA 3OLEA 1EXPA 4WJXA 3SW6A 3UCQA 4B9YA 1YDYA 1SFJA 3MANA 3W7RA 2I17A 4LWWA 3EB3A 2OO0A 3KP0A 2GPTA 2X7VA 3W25A 4H9MA 3B97A 4YWSA 4WY0B 4FK9A 1AMYA 4W5UA 5FKYA 2Z26A 3O7UA 4QCEA 3LBMA 1JF6A 4AYSA 3WL0A 3BLEA 4HTYA 3MZNA 3N25A 1XD0A 4HOWA 8A3HA 2AKZA 4ZOAA 3AZSA 4CLMA 3SIMA 3PPHA 2E4TA 4ML9A 2DP3A 2PLJA 1FWTA 1W8SA 1JDDA 3A4AA 4HIBA 1MQQA 3P7YA 2CBVA 1OM0A 4XSMA 2FB3A 3RCYA 1E5JA 3M1ZA 1SM9A 4NRRA 4DIAA 2QS8A 1I45A 3VK5A 3WQFA 3EOSA 4S3JA 3N4AA 2VD8A 1DXFA 1XC6A 3SN4A 4IIEA 1A80A 1U1JA 3NPVA 3QR3A 2YBVA 1TKKA 1TTPA 1S38A 4YTRA 2GJNA 4F0RA 4O11A 1EUAA 1OEPA 4DAFA 4LF1A 1ONRA 4L7ZA 2VXNA 2B7QA 1VLIA 3CUIA 3GTNA 4A3QA 2O92A 3W28A 4Z2HA 2FPVA 1V6UA 1N55A 4WY0A 1AQHA 4JYDA 5KSWA 1SUXA 1DWGM 4W5ZA 4RXGA 1K6WA 4NNCA 3GD6A 4W84A 2DEPA 5EMMA 3ARWA 2FDSA 3FDKA 3H2OA 1JEZA 1OFQA 4R5EA 3B04A 4E4PA 5DELA 4AHPA 2D20A 1ZTVA 5H6HA 4GVHA 1EDTA 4CQ8A 5HXMA 1GKPA 5IBXA 4UQ9A 1A0CA 3CMFA 1KTNA 4G7FA 4J3TA 4B5NA 4W85A 2DZBA 1R85A 3L4UA 4HD5A 1XDMA 3WUBA 4IIGA 3W74A 2FVLA 4UTIA 2BFGA 3V36A 1OX4A 4DUWA 2Z28A 4JQ3A 2CLFA 3CV6A 3GYCA 3R4IA 3RPMA 2A5HA 3JW7A 3K4DA 1ICQA 4ZSUA 1PZ3A 4KEUA 5C9WA 4RZ4A 4FX7A 3S5ZA 3CEUA 1R3VA 3BGJA 4LC8A 4KFNA 4W4QA 4AYGA 4AB4A 4OTKA 4OBSA 3CL7A 4ZGYA 3APYA 4DF2A 4Z0SA 1W9BM 5FJUA 4TU1A 2NV2A 3C3UA 4A2RA 3THQA 3LU2A 1XPYA 2HROA 3ERPA 2OO6A 2I5QA 4F3HA 4GI6A 1B3VA 4GNKB 1JDAA 2IPJA 3MSDA 5AHEA 2ONEA 4S3DA 1PZ2A 4WXZA 2GWNA 2QKFA 5FA5A 3UWYA 3U0HA 1R9YA 3IUIA 1HX0A 3R0UA 5A8OA 2GQ8A 2XGBA 2HWGA 3ARUA 3CHFA 3IPWA 5FL0A 3OOQA 3UWEA 9XIMA 3B03A 5ENLA 5DBUA 5CC3A 1EPVA 3OA5A 4L1XA 1ECEA 4D6HA 1W1PA 4UTWC 1Q6QA 1YHTA 3GG1A 4WIWA 1EP2A 1B54A 1T99A 3LRKA 4Q7BA 4LGXA 3FJLA 4IQLA 3TYBA 1PYMA 4RNJA 4P8XA 4PTNA 4TVCA 4P7RA 3S6TA 1CIUA 1QNSA 1HKWA 6PTDA 1QO2A 3M64A 3B3DA 2PDCA 4HNTA 4N02A 1Q6DA 1US0A 3ANYA 3MDWA 1GYNA 4C7DA 4CQCA 1V6WA 7REQB 2POTA 5LNVA 3UG5A 3VDCA 4JTQA 3B40A 5LKYA 3TSMA 4HOZA 1IQ8A 4GIRA 3ZJ7A 4XZMX 1S5NA 1GOWA 3EDFA 1UZHA 4ICCX 1EGVA 1JRBA 2V3FA 3GXFA 1FFRA 3VE7A 2DDXA 2CBJA 2IQTA 5DO8A 1AVAA 3I3EA 1ADOA 2DUXA 1OADA 4YS1A 5LNRA 2YBUA 2QV4A 1LRQA 2R24A 2QDDA 3ZFHA 4HNUA 2A4AA 1LLOA 1Q6RA 1PX8A 3W7OA 1IZJA 4RX0A 1KFBA 4K1GA 1ZB5A 3GH7A 1GUVA 3G18A 4ASTA 1XIJA 3TTYA 1QVBA 2TODA 1FXQA 4IT1A 1KRBC 2UY3A 1PTGA 4DJED 2VEFA 5DCEA 4R34A 2GJLA 3S83A 2W0UA 1UP0A 1FY6A 3K5XA 2G3NA 1UA7A 4MOZA 1CGTA 4FX8A 5AKQA 2WC7A 3GBDA 2VGBA 1OCJA 1V4YA 4H6EA 2IXVA 3A9BA 4TR9A 5HNNA 3IGSA 5E1QA 7REQA 3WMCA 5CXPA 4MWAB 3CLWA 5HK4A 3OODA 4GO9A 4YJ5A 3CU2A 3WBAA 3L12A 4EXBA 4GYJA 1Z9AA 3V5OA 4XUYA 1XCFA 4C6KA 5FEXA 1Y65A 3KTXA 2PDBA 5I3JA 2IPGA 1M7XA 2QDHA 1EP1A 4TO8A 2ZA2A 1RJRA 3AU2A 4D6DA 3G0SA 4Z2KA 1ESWA 1DIOA 2FZDA 3CIWA 1BD0A 3LCLA 2W3ZA 3VMOA 5A3HA 5C70A 3TE9A 1UASA 3ZLGA 7XIMA 3R13A 4C5ZA 1NU5A 3HPXA 2RHGA 1CCWB 2HVOA 4PMDA 3FX4A 5FSDC 1FXPA 3GY1A 1LL6A 2DV0A 5DRIA 3S2LA 1NY1A 3QYQA 1QNQA 2ZC1A 1IV8A 3A24A 3OHMB 2OFJA 3LCIA 1XHGA 4XD3A 4M29A 4Z1AA 5E93A 2HBVA 4M80A 3LV6A 4WXYA 1I2OA 1E5NA 1P4CA 5CPNA 5JBFA 8RUCA 2MANA 5XIMA 1C91A 1U1UA 4EKJA 3DOPA 3SCOA 5A6AA 3ABXA 4MWAA 1GVOA 3AIQA 1XG3A 3NEVA 4OJYA 2FFIA 5BCAA 2OZ8A 3F5KA 3OVGA 1TPDA 3P81A 4FPSA 4H3DA 2FJUB 1J96A 1G01A 2A0NA 2ZRVA 2ZUWA 4KGLA 3B0UX 5HMEA 2D1ZA 5F1VA 1DE5A 4DBSA 2GQAA 3VZZA 2EQDA 1N8IA 1EO7A 1DJIA 4O1DA 1W2PA 1QAPA 3SEPA 1LWJA 2BY2A 4O4WA 2QUUA 1JI2A 3O3RA 2PCQA 3F2DA 3QW4B 1JNEA 1REQB 3M0JA 4HA3A 4QJ3B 5GJPA 4XX6A 3WLHA 4Y7EA 3GU9A 3BGGA 5ECVA 3UYIA 2PC8A 3B9DA 3KDNA 3NSNA 1TFVA 1P0DA 4NASA 5M2FX 2FGZA 3ZM8A 1M7PA 3TW9A 2VRKA 1S2VA 1R3WA 5JH1A 4GIAA 4NP7A 1UKTA 1JZ3A 4MTVA 3GVWA 4IUOA 5CG0A 3LENA 4PGLA 3NM1A 4MDPA 1PKYA 7ENLA 3PAJA 1M41A 4RNFA 2NXIA 1T5AA 4LV4A 5LIYX 2HK1A 1OGGA 2PWUA 1L0PA 1MO0A 3CTTA 4XISA 4CVUA 1BGAA 3EA1A 2NQ9A 1QPKA 3WLSA 1E4IA 4E4UA 1TX0A 4HYRA 5A1AA 3GIYA 3W7KA 3N3TA 2XWDA 4IG2B 4HZ7A 5AY7A 4QEEA 4TV6A 4JX5A 1DQXA 2NQZA 3W7HA 3IJ9A 3RLHA 1UHVA 2BB0A 1XSJA 1REQA 1HJXA 1NOFA 2F6UA 4QRNA 2NUYA 1ITUA 3WQ8A 3MSRA 4NZ4A 1GCYA 2P53A 3MI3A 4QFUA 3L4WA 3WLNA 2VQTA 1FRBA 1OX5A 3WQ5A 1E1CA 1RK6A 3TN4A 3DFOA 4G5DA 2H90A 4ZCWA 3TDFA 1P43A 4TIMA 1UIOA 2JIWA 3R0KA 3W53A 1C90A 1TIMA 3KHJA 3N9RA 3S6DA 3W7JA 1MEHA 1Q6LA 4FNPA 4YNGA 4CN1A 1HVXA 3FVMA 1QNPA 3TCEA 3TCSA 3KOFA 3QLLA 4NAEB 3GR4A 3AIWA 1SZRA 1JDFA 1AQ0A 1HT6A 4L80A 4JFTA 5SWUA 3NQMA 4IG2A 3T07A 1V3HA 1Q7ZA 3HQ1A 4CCEA 3CYVA 5L6UA 3ZWSA 5E0KA 4ZTXA 1KW1A 5EBAA 3BW2A 2ZQ0A 4DBUA 1F5ZA 1VFHA 2GJPA 3FJ6A 3OG3A 1DP0A 3RU6A 2DSUA 1M03A 3TN6A 2NW0A 1XBYA 2HRWA 2FH6A 3ZLFA 3N13A 1TG7A 1E0UA 1VZWA 4HU4A 3QOMA 2V0TA 3B8VA 3IIPA 4GHRA 3T2PA 3PUEA 1Y0EA 3MY9A 1ISZA 2HEJA 2QZRA 1F07A 3TTOA 2VENA 3VGEA 2XN2A 3KWSA 5I3DA 2OXNA 3SQLA 5KEZA 3L4ZA 2BGQA 1KGUA 3AXIA 3ZR6A 4HPHA 3RO6A 1VPQA 1OFPA 3QY8A 6TAAA 4MYAA 3HG5A 3UXAA 1H1YA 2TMDA 2GGJA 2QJJA 4QS5A 2NX1A 3TTEA 3UT0A 3MUZ1 1GYMA 1PE1A 3N2CA 2VGGA 5TIMA 1A5KC 3B9EA 5AOUA 3U7VA 5EFDA 1GVQA 2QCLA 2QGHA 4NAFB 4JY8A 4ZQCA 1EA9C 3GNNA 4OQVA 1DWFM 1DPMA 4I9JA 1X7FA 1YTEA 3EDJA 3CZ8A 4S23A 3KUMA 4B5XA 1ZS2A 1O1HA 1TJPA 4DAIA 1W37A 3GNPA 2WNZA 2WPBA 1TELA 1SO3A 1UD3A 2QGYA 2YIHA 1JULA 4UTFA 2C71A 3TYAA 1OG6A 1IEXA 3NGJA 4YTQA 3P80A 5LGXA 1V08A 3OJGA 3GZAA 1GQNA 4GZIA 3NGFA 2GDQA 1KV5A 4EXAA 4UFHA 3L2IA 4YXGA 1OT2A 4U5IA 5FF0A 4J35A 1WDRA 3VTRA 3T2QA 3C2VA 3M16A 5CZSA 1GEHA 4FXFA 1GT8A 3UXDA 3AUOA 3UG3A 2PDLA 3UA3A 3S2NA 2E1WA 5K9DA 1S39A 4U2YA 1M6JA 2I1OA 3MKCA 3QPYA 3AIBA 4FO4A 2XN1A 1OFBA 4IPNB 3CGTA 2HE5A 1U83A 3O05A 4AWUA 4HCLA 2H3DA 3AXHA 2VEGA 3L0GA 1P5BA 4JTJA 2G95A 2DSVA 4P8WA 4BJHA 4HHPA 4X0VA 4ES4A 1WXYA 2A2IA 4NAFA 2GDUA 5FEWA 3V0TA 4B91A 4JIHA 4BA0A 1NDYA 2VM8A 2QJNA 5I03A 4WUIA 1XBVA 5FJTA 4XZIA 4ATWA 3EXSA 1EC9A 3PZVA 1L2QA 1VEPA 1UZDA 4RR4A 1NH6A 3SN1A 1JDEA 4RKAA 4CD7A 1E9ZB 4F2BA 3LZ3A 5DEZA 1TPB1 1A5MC 3RUBL 1XD1A 1FDJA 5D02A 3V0UA 5AC4A 3BOFA 2FHCA 4YWIA 1R9XA 2G0WA 2DSKA 3U2EA 4D6GA 1TV3A 2YKKA 1JCJA 5A6LA 3DZ1A 4GY0A 3IVTA 1I2NA 1PJ9A 3T78A 1PBGA 4I7VA 4UTKA 4PB5A 3F4WA 4L1WA 3RU8X 4ZOEA 4GA8A 1GORA 1ZCCA 4AF0A 3STGA 3P60A 1KCXA 1T0OA 3IJQA 3AUJA 3STPA 3ARTA 5GPRA 2QLYA 1XLJA 3MUCA 5I06A 3VMNA 3BMWA 4V33A 1X6LA 4YYFA 5E0FA 4TMBA 3GU1A 5AFDA 3DFHA 4P7NA 1IIGA 1IGSA 5BXSA 5I77A 5CC5A 2WVTA 5HPOA 1WOAA 2V5DA 4DZIA 3IJ6A 1KFWA 4MB5A 1RH9A 4AZHA 1K7XA 1VQTA 3IJ7A 4QLLA 3AOFA 2R9RA 1P0NA 1RBAA 3KRSA 2XSXA 3QLDA 2RDWA 3QW3A 3TN3A 1TPC1 1PVNA 3W1TA 4IXHA 3SUUA 3RAOA 3W26A 4HQVA 5C7VA 2DZVA 1A47A 1P7TA 2I16A 1TCDA 4X2RA 4E8DA 2OQLA 3W1QA 3BPWA 4AWEA 2J7GA 3WX7A 4C1KA 5E70A 3RX2A 1KQYA 3QR0A 4QAWA 5JBEA 1YRRA 5I3GA 6REQB 5DXXA 2GQ9A 2O9RA 2KZHA 2WQPA 4BWLA 2DSWA 4ZQRA 2IKGA 1RQEA 2VO5A 1EKOA 1RCXB 1YQ2A 1CT5A 3NA8A 1I75A 5CLWA 4S3GA 1UH4A 3M41A 4UFKA 1W31A 4RDVA 1MZHA 1I6NA 3QGKC 3PSVA 7TIMA 4MKNA 3W72A 2NQ5A 3S9IA 3NZRA 4DXVA 3Q37A 1SSDA 4RZBA 5CZKA 2QJGA 4DHGA 4QP0A 3GC2A 1XYZA 1B0IA 3NDZA 2PDJA 1QASA 3QQ0A 2WZIA 2X0SA 5M17A 2NV1A 3TROA 4HN4A 4KT2A 4JEJA 2D23A 3DECA 5K3VA 1Y7VA 1LOLA 4Q4SA 3FSTA 4LF2A 5LA2A 3URQA 5LA1A 4K37A 2V9DA 4LAMA 5FL1A 4IL2A 1E4LA 3KL5A 1PL9A 3NNTA 3KS5A 1TIWA 4MF4A 4HSOA 3FKRA 3AI0A 1FKXA 1SJDA 1JZ7A 5DMNA 2R91A 5GNXA 3GDRA 4CQAA 1OGBA 3HQPA 3WNMA 3LI0A 1PAMA 3AIUA 2C0AA 1UJQA 1B31A 2BMBA 3VGDA 2ZX5A 3W7DA 4OBRA 1UH2A 1VBGA 2GGHA 2XH0A 2W61A 2CXEA 4DPPA 3BTNA 4AZ5A 5LHEA 4GFIA 3PBYA 2XSAA 4Z1DA 1DQUA 1DWIM 1LT8A 3UXLA 1AQFA 5AC5A 1XW8A 3U5YA 2YFOA 3MBDA 3LY0A 1W5QA 3SBFA 3R0DA 5HJXA 3L5MA 4ALDA 3IUHA 3DFNA 4XAGA 1MUCA 1C7TA 1WDDA 2E28A 3POCA 1W3KA 3NO5A 4PL1A 2QUNA 1O1ZA 4P7LA 4WDUA 1J8VA 3I65A 5FF3A 4MFDA 4WDTA 2FTYA 3DYMA 1E6PA 2DZXA 1XDLA 1JCLA 3K4AA 5HQLA 2EAWA 3TJ4A 1C92A 1E0WA 1EO5A 3V4BA 4M6QA 4MB1A 2E5CA 1L8PA 4JD4A 4CNOA 1M3UA 2WMFA 4JN6A 1ONWA 1M1BA 3NDOA 2YCKX 1XUZA 4HP5A 2W66A 2Z2BA 5A8QA 4OKDA 5D32A 2DUAA 4B4HA 4XZLX 3OQEA 1H2JA 1KRCC 3H4GA 3GW3A 2YL8A 1WOBA 2XINA 4M56A 3H7RA 3I4EA 3WH7A 3IANA 1FKWA 3UGRA 2OB3A 3RM8A 2E0PA 5CQ1A 4CNSA 2ZUMA 3MCMA 3TKFA 1JZ5A 3CEPA 3MVIA 3OBEA 1PKNA 2CESA 2QPXA 2GJRA 1HG3A 3BLKA 2WCSA 2EPOA 1U2YA 1P0KA 4JR5A 5A2BA 1QI4A 1VFFA 2FDMA 1KBLA 4Y9OA 2FB2A 3L7RA 4OECA 4YL2A 4JQ2A 2J7DA 3DGBA 2BOGX 5K7JA 3EOEA 5D09A 3DX5A 1ONEA 4NUWA 5HUOA 4KEVA 5DXYA 3WQPA 2A3LA 4GKLA 2Z27A 4IH3A 3W1RA 3L4VA 3SRFA 1EB3A 3WF3A 4O1BA 1Z42A 4U2ZA 5K9CA 5HATA 4AHOA 3ITOA 4UCGA 2ALDA 4H9VA 3WO8A 3QTGA 4ZXLA 3BQ6A 4DYKA 3ITLA 4Z2LA 3K30A 1H5VA 3ITXA 4Q8NA 4DNHA 4M1RA 4PA8A 5D9MA 2G37A 3WH6A 3WQCA 1FH7A 3GB6A 3W22A 3U7BA 1LL7A 1IEWA 2ACRA 1TQJA 2FGLA 3RX4A 2OMAA 3HB9A 1KFCA 3IJIA 3QRHA 5C2GA 1BYAA 1Q6EA 2PTYA 4NT0A 1OCQA 1I4NA 1XDJA 2WM1A 3BOXA 2WSYA 1BHGA 2QCMA 5C0QA 4GZEA 4GVGA 1DV7A 3TTSA 3M6YA 4DJDA 3MSYA 2H8XA 3ME3A 1TTQA 4K3ZA 1NFPA 2HVNA 4S3KA 1VHCA 2QCEA 3WSUA 4ICNA 3AS1A 3KBSA 3UEQA 2ZWZA 3QQWA 3NWRA 2XIJA 2QVNA 4GX9A 3RR1A 4L65A 4RE4A 4O1CA 1S5VA 1DEDA 2J88A 2YPIA 1QMLA 3GXIA 4ZO7A 2ISDA 1O60A 4Q8TA 3N14A 3WLOA 4V15A 3SUTA 1NOUA 2Z1SA 4IM4A 3PZUA 4LH8A 1XRTA 2PP1A 4W8BA 3EX3A 3UZWA 1YADA 3KFTA 5BYWA 5KZ6A 3L23A 1YE4A 4LS2A 1TE1A 4XTDA 4D71A 4LVDA 2YZ5A 4GNJA 3SY1A 3H23A 2A7NA 4IP7A 2CERA 3QV6A 3P61A 1DIDA 1C29A 4NYYA 3WJSA 1S2CA 4PCFA 3D3FA 4PTWA 4Y9PA 4IFKA 1UZ4A 4KIEA 1NP0A 1BSLA 5D9OA 3AYSA 1SPQA 3CUXA 2J75A 2AGTA 1ZALA 1WAWA 4X9YA 2NVCA 1W5PA 1A3HA 4PRRA 2PTWA 3AHXA 4NX5A 3UJRA 2AQOA 3TYEA 1FWCC 3QFEA 3JR2A 1NVMA 5C9RA 1Q65A 5LA0A 4MJZA 3AJXA 4J1OA 3BAJA 4AEOA 1OFOA 4ZEPA 3PR2A 5IOBA 1XX1A 3W2JA 1OHLA 4Q6JA 4MWAD 1LOQA 2HTMA 3LPFA 3H2EA 4GZ7A 4JZ5A 3JRKA 2RUSA 3Q45A 4O19A 4PUJA 2ZRUA 3AMKA 4CEXC 4OFCA 5DT7A 1J0KA 4PBFA 1AW2A 1V79A 5FIPA 2Z2UA 4Y90A 2W4XA 1J93A 2V30A 4OZOA 2D24A 6TIMA 1FCQA 4HB7A 5DN1A 2YLAA 3TH6A 3UJSA 3RGTA 5IRPA 1G69A 2CWXA 3M7SA 2WHMA 1JUBA 2PAJA 3S5OA 1GPWA 2FLIA 4RNIA 1UCWA 3NFUA 2XIMA 5EPDA 3EDDA 4CVWA 2E09A 2B7OA 4WRHA 2J7HA 2V63A 5BWFA 3C5QA 4NI8A 5AYIA 2YA0A 1GVRA 1TPFA 4MGGA 2E6FA 3CIXA 2V2CA 2Y4SA 4KRZA 6CGTA 4ONVA 4UNKA 1I9CB 5U7SA 3BCFA 3H2MA 1V93A 4ZENA 3WD2A 1JPKA 3KVJA 3N18A 4R3UA 1V3MA 2ZTKA 3GRIA 3VOJA 3CPGA 4MNMA 4Z2IA 3WBYA 4QTGA 3TQKA 5DMMA 1NEYA 1QNOA 4XVDA 3BV4A 3IIOA 2WO5A 3FEQA 4J3ZA 2P0OA 3W86A 4MB3A 1BWLA 4GIEA 3CV1A 2ZKMX 3G24A 1UKPA 5CPOA 3VKBA 1PYFA 2VZTA 1RP8A 2XVGA 1DJWA 5M3WA 1FWIC 4PFHA 2WVUA 4GYPC 2G4JA 4AIBA 4G1KA 4NNAA 3TAKA 2PODA 4LXFA 3TA6A 3GNDA 4KCTA 5AC8A 1XIHA 2ZA1A 3KOZA 3H6OA 4IGHA 3V75A 1RUSA 1BWVA 2B31A 4S3FA 2CNCA 5F2GA 5LHFA 4HMEA 5AHMA 1J5TA 1GTEA 1FBAA 8XIAA 4JKKA 3W37A 2BY1A 2YLLA 4IMFA 2FVKA 1YPIA 3BCDA 4ZQOA 3ENLA 1H49A 1KBJA 4RE2A 2FVMA 2HS8A 4PFMA 1GZGA 5CBBA 2FPTA 1KR1A 4ZB2A 2W9MA 2X05A 4C1LA 4WOQA 1JZ4A 4XD4A 3PJXA 4JNMA 1FHLA 4IIDA 1OC6A 1F2JA 5K4XA 4H83A 2QMKA 1WPCA 1KWGA 3QY7A 4TTGA 2H8ZA 4LTSA 4MAVA 3TA9A 3PHAA 3NXLA 3TJLA 1JZ8A 1AUSL 1OWQA 1UC4A 1U1HA 1P1XA 4HMDA 3W6YA 1V0KA 4Z17A 1VCGA 3WLPA 2QEZA 2VUNA 1V6XA 1PDZA 3O07A 2C14A 5A2CA 2F84A 2EBNA 4AZIA 1VEOA 3QM3A 3VKAA 4BI7A 4IFRA 4QDWA 4H1ZA 3C4UA 1J6OA 1NF7A 4WGXA 5D03A 2O0TA 3QBUA 2FFCA 1ZJAA 2QUVA 1UQYA 2A3BA 3GC5A 2CETA 3H53A 4HJWA 3GDTA 4DWSD 4FS9A 2V5JA 3S3GA 1B9ZA 4X61A 3IARA 2VT0A 3QZAA 2VQUA 2Q8XA 1W8GA 3EMQA 1YTKA 3G8EA 1R38A 1G4SA 4JAWA 4M1BA 4F48A 5A6KA 3N2BA 3LBCA 3ONBA 4H01A 4PULA 3WQDA 3THCA 3QF0A 4OE7A 3MUIA 3W85A 4GI4A 1PS9A 3WG6A 3M0KA 2NSXA 1MNSA 1XIDA 1Z44A 3ABOA 3AS3A 3BJTA 4FOKA 4NJKA 2ZDSA 1XLLA 3D0CA 4FEZA 1KRMA 3VAVA 1Z41A 1MI3A 3R7MA 1WDPA 2NX9A 3PJWA 5DRCA 3UESA 2E6AA 3NAVA 1Q13A 1E6XM 1ZBWA 3PTKA 4MZ8A 2YOCA 4DJEC 4R85A 4NZ1A 4F8XA 4PEEA 2YXGA 3S2CA 5CBIA 3LQGA 5KETA 1RV8A 4UZUA 2ACSA 3EOUA 1PX3A 2BNJA 1UH3A 1Q63A 1G4TA 4Z1BA 2NUWA 4WVXA 3ITTA 8TIMA 2DPEA 1EX1A 1TZ7A 2ZADA 4WGHA 1SO4A 2JK2A 2CLHA 4D9PA 2XIIA 4O1FA 1JAKA 3WQWA 2J24A 5G4HC 2DUZA 4N9DA 3COTA 2IMRA 4KGJA 2WZMA 5JUVA 4HU0A 3XINA 4AZ7A 3ITVA 3PPCA 4Q7NA 3TWBA 2CBUA 2O4QA 4J28A 4M8UA 5H8PA 2OT1A 3KLKA 1R6WA 4UTWA 4AUBA 3BG9A 2QVHA 3STFA 9RUBA 4OWGA 4PRTA 3SCTA 4IF2A 1Q8JA 2FMNA 5T9CE 3CWOX 5C8BB 1UD6A 3LNMA 3MYPA 2BZNA 2PLCA 2WBGA 4UQAA 1QPRA 2G3JA 1FWEC 4UCFA 3TQPA 3BG5A 1SW3A 1MXGA 4ZR8A 1NDVA 3PZIA 2FH8A 3KRUA 1VP5A 4K39A 3OBKA 2XISA 3UD6A 3KS6A 3PNZA 2P50A 2BS9A 2TPSA 1H1ZA 1EC8A 3WFZA 4LUIA 4MUPA 3GNOA 4UBPC 3EAUA 1KC7A 2D2HA 2VC7A 1HL8A 2QF7A 3W7NA 1UR3M 2CBIA 2WB5A 3K8LA 3L0NA 3RM4A 3SIZA 3SURA 1E73M 4ZVJA 3T55A 1EJTC 5HNRA 1JGIA 3ATZA 3OVPA 2CZEA 3HIJA 4NZFA 5FJIA 2KX9A 2FGBA 3DH7A 3WELA 1WDSA 4LX4A 1HKJA 4N9EA 4IGSA 3P82A 4HA0A 4LALA 4UFMA 3VCNA 4UTJA 3LPPA 4JFVA 3S1UA 2GK1A 3EGJA 3EXRA 2J8TA 3PANA 1G7VA 3U8GA 2G41A 2E9LA 3AYRA 3L67A 1KXHA 3BWWA 3DCPA 1JGMA 3UR7A 3BK0A 4LOCA 3A4JA 3EKZA 3GNRA 4DJFD 1HL9A 1GPFA 3WDJA 1JI1A 1HJSA 3FEMA 2YL5A 2X09A 3HG4A 4UFJA 1CDGA 3TV8A 4B3KA 1BKHA 3QTPA 2PURA 5GQBA 1H0IA 1K9TA 3LLXA 4A3UA 1E6NA 3WBEA 3QXBA 3T8LA 2J62A 1J79A 3T0CA 5GVJA 2GOUA 3Q4DA 1W1ZA 3LBOA 5I7GA 3W7CA 4GXWA 1SR0A 4WSHA 4WDWA 4JTEA 2G8ZA 1VRDA 4PB3A 3IK2A 1TYGA 4GC3A 4GYFA 2RDXA 4M6PA 1PO9A 1KNWA 1DHKA 1JCMP 1O5KA 3TW6A 2ASHA 1UMLA 3GHSA 3AALA 1CLVA 3L4XA 1R0MA 4PBGA 4AX7A 3A5FA 4YIWA 4WD0A 1XYAA 3I68A 3FFSA 1S2AA 2QJHA 3NQCA 1KM0A 4UQEA 1A5OC 1LWIA 4V27A 2YYUA 1BVNP 1EA0A 1MQRA 2WLYA 3MU7A 2PS2A 1IEQA 3HBLA 1G67A 1M65A 2E8YA 3I3BA 3NYDA 3LLDA 3E0VA 3CWHA 4OOZA 1HVQA 1JCYA 3T40A 2WOQA 4PMOA 2R8WA 3TC6A 5T91A 5G4WA 1FWWA 3TFXA 2IXUA 3WK1A 1A53A 2VZUA 3VIPA 4GBDA 4JTLA 4BQ3A 3RITA 3ZOAA 3W7MA 4DX3A 5I78A 1SO6A 3WLTA 1FWFC 1VGAA 1CGWA 2P10A 1P1MA 3R12A 1G0CA 4X3ZA 3SI9A 1ICPA 3FA5A 3M47A 5CKSA 3GDKA 1M04A 4A3YA 1RBOB 4UMAA 4BCEA 2W62A 3GG8A 2VX4A 2BX7A 4PH6A 5HMFA 4DELA 1NAL1 3NL3A 2WWDA 3GXTA 4ORMA 1GVIA 1XPGA 1FCVA 2Y6ZA 5I5RA 1BPLB 3SCWA 2VCAA 1C8XA 3CASA 3AMDA 3C2YA 1HW6A 3F4DA 1GONA 4LAKA 4HZ8A 2FJKA 3LMYA 3VE9A 1T6MA 3BLIA 3MDUA 1AH3A 3TLLA 4S3BA 1HO1A 3B06A 2WW5A 3GKAA 1E56A 5HUPA 2X1IA 4GC4A 5FAGA 1P6WA 4PUEA 3VDBA 1SR9A 3DIPA 4W9TA 1VPYA 4QE1A 5FEPA 3SCSA 1XG4A 3R11A 3KLLA 2IW0A 2WKJA 4UOZA 4G9PA 3EOLA 4L64A 4WLCA 2D3LA 3G1SA 4AISA 2NLIA 3LTYA 4ZTYA 4OBTA 3DBNA 5TAOA 3I7SA 2OX1A 1KBKA 2BG5A 3WNLA 2UWFA 5TBOA 1WAUA 1FWSA 5C9ZA 3A47A 1MVYA 4X2PA 1U22A 2IUZA 4EVZA 4WEVX 2UY5A 2PA6A 1VEMA 4IGNA 2VC6A 4NIRA 2QJMA 3WJYA 3LCFA 2FZMA 3DC8A 3SCNA 4PB4A 5AC6A 5LIWX 1O6IA 3OGSA 4JTCA 1YNQA 4S1FA 1HP4A 3N04A 1RQBA 3QV8A 3PAOA 4R7OA 1IGWA 3W2MA 4ZO8A 4U3CA 2ZX9A 3DUGA 1DWJM 1V03A 1TX2A 4IPLA 4NVTA 3W83A 4O8AA 2Q3OA 2QF8A 3P5ZA 1FP9A 1RLCL 2V67A 1TWZA 2CXGA 3M0VA 1XLMA 3NQ6A 3RRXA 4PE8A 3W9ZA 1WZKA 1YXDA 4H9YA 4LW7A 3V1PA 5CSSA 2C6QA 4TX9A 4EF9A 4IX2A 2ISSA 1SW7A 1RBLA 4O13A 2QV5A 1D8WA 3UP8A 2BWGA 1Q6CA 1L6WA 1LBMA 2BASA 3ARRA 1EJUC 1S1PA 4IZGA 1VFTA 1TR1A 1V8EA 2O9OA 1PKMA 3HJZA 3WNNA 3P8JA 3POHA 4M0XA 2G5WA 3GH5A 3GUGA 2E67A 3W1NA 5AVHA 5TF0A 2PF8A 4QHRA 2GVGA 2CEQA 2WZTA 2V81A 2WPGA 2YR1A 1CB2A 4DJDD 4UNIA 5DMYA 4PMNA 4GK8A 1W9XA 3K4WA 2FKPA 4JL2A 1C9WA 3MKVA 3N2OA 1BYDA 1JDCA 1JZ6A 1OCBA 1H7NA 4B3ZA 4JTUA 4IWWA 5DY2A 1T8QA 4BR1A 4C65A 5BRPA 4DWDA 2UBPC 3V0SA 1H62A 4AWSA 2PZ0A 1DIEA 3RF9A 3MS8A 3EWBX 3W76A 3USZA 5GJMA 1IEIA 3GFZA 3WKZA 1ICSA 4I9TA 1Q5MA 1H7RA 1AL7A 4J3VA 4JN7A 5BMXA 4FXSA 1V6VA 2QCNA 4XKYB 3WBWA 3LHTA 2JALA 1MWOA 3NPUA 2NSOA 1B2YA 5CCZA 4JIRA 3O6AA 4QXIA 5FF4A 1SJBA 5HA7A 1L2UA 2D0GA 3W7GA 4YMZA 2ZXQA 4DZAA 3CH0A 2F6KA 1D7FA 4OIFA 1HJUA 3G0XA 5HJYA 5ABTA 2YL9A 3BOLA 1UMYA 3H7VA 3N1AA 1A5LC 4AC7C 2W5FA 1BF2A 3REQA 2CZFA 1KA9F 3CZGA 4IICA 4FIRA 1TPEA 3AISA 1CECA 4C6PA 3A21A 4A8LA 4HPGA 1CLKA 4HGXA 4XZWA 1UR1A 2Z4GA 1C3FA 2NXHA 2Z00A 4QG9A 4Q8WA 1RD5A 4DO4A 3WK3A 2AL1A 1WKYA 3GXDA 1TJ0A 2FZNA 1XFBA 4GQ0A 2YDQA 3THUA 1ADSA 1TSIA 3VD9A 2EEXA 5FAJA 1SFSA 3OIXA 1XICA 2Y88A 1JUEA 3H4XA 3TIMA 1UW9A 3KXQA 4MYXA 4CNNA 4E5TA 1PSCA 1J11A 4QM1A 3UJEA 3U4FA 3BE7A 4ZQMA 1C93A 4GI9A 3NZPA 4EP8C 2Y5EA 4TUFA 4XKYA 2Y24A 4IJBA 3BSGA 4PUUA 4W93A 3NM3A 3MV01 5FJPA 1XYFA 3HU7A 5KITA 3SGGA 4K1WA 5HWMA 1VBJA 4M3PA 4JKLA 1V3KA 2AKMA 4LSBA 3BUVA 1CZ1A 3LNPA 3N4EA 2OT0A 4JKMA 2X2YA 2I56A 2D0HA 2DY3A 2VOTA 1W1TA 3EZ4A 4ZBCA 4LANA 3FAWA 1RAKA 1X7IA 5EL1A 5J5RA 3UXKA 2X40A 3N2XA 3KEHA 4KRTA 1AODA 1V6TA 1J2WA 1BG9A 4B4FA 2ZICA 4NJGA 4PSRA 4WJEA 4JEQA 3PP7A 1L6GA 1PZ0A 2ZXDA 3EEGA 2WWCA 1F74A 1S5MA 1SU5A 4LT9A 1AG1O 3EDEA 5HBFA 3CIVA 2PDWA 3N29A 1DXEA 5HPCA 2GWGA 4D8AA 5C9UA 4I8DA 4KEMA 4NQ1A 2ZA3A 6ENLA 2NQJA 3WLIA 3AJ7A 3K46A 2RDUA 3RPTA 3VGFA 4CNUA 3E02A 4QG6A 3RX3A 1KGXA 1TUFA 1F8IA 5D37A 2W91A 4LQ1A 1XLHA 2DQXA 2EKGA 1EEXA 3HV8A 4XUGA 1PX4A 1SZEA 3W87A 1CLXA 3FHAA 4LB3A 4PMJA 5HANA 1O66A 5F7UA 4C7FA 1QHZA 1J5SA 1UWRA 1W1VA 1K8CA 2ZWYA 2O9TA 3K1GA 2FZBA 1A4LA 5LXEA 4NZCA 1Q3NA 3E2QA 4WX2A 3W6LA 3NQ8A 1A49A 1Q85A 1BKSA 4UMCA 3ZXWA 4I5UA 2HS6A 4PMVA 1GGOA 5CH9A 4U31A 1ZENA 4JNYA 3WQVA 5CGTA 4C6BA 1XBXA 4H9ZA 2W92A 1E72M 2WCGA 3FS2A 1PHQA 4IMAA 3GVRA 4RL3A 3GX9A 1R3QA 1T40A 4E2OA 4DPQA 3G1XA 9CGTA 3T4CA 1F4AA 4XO7A 3T9PA 3MZ2A 1G1YA 3K13A 1EJWC 4LVBA 3DN5A 3S42A 1RVGA 5G5IA 4G8TA 3MMWA 1OJXA 2RH9A 3UNDA 4WR3A 2Y0FA 3R25A 2QIWA 4GVFA 2WJEA 4EOUA 1E70M 3CUFA 3FA3A 3W7LA 4H2CA 3GTIA 2WVVB 4A6GA 5AVNA 2W79A 5HNTA 1VCFA 4HPNA 4O28A 1HN1A 3U48A 3VABA 4ZQPA 4ZL1A 1XINA 2C79A 1A50A 1GK8A 2R6OA 2VFHA 1TPVA 1E4NA 3A4WA 2A79A 4XZBA 3QSRA 4NNBA 4UOJA 1OC5A 1KM3A 1MQPA 1K8ZA 1R8LA 2DT1A 1RVKA 2BXYA 4JQAA 3VGGA 1XIBA 3N2TA 3WMLA 1OY0A 2ALRA 2X1RA 1J01A 2FMOA 3KOXA 2CPUA 4GQBA 5A6MA 1PWLA 1ONXA 1ITXA 2D73A 3FNDA 4S38A 2BGNE 1AJ0A 3SCUA 3TYZA 1QR7A 1Q6FA 1VF8A 4JTFA 1WKDA 2GJXB 2QQ6A 2EKCA 4H8UA 5DMLA 4AU0A 4PUWA 1KM5A 4WQ6A 2IKJA 1X6UA 3RM9A 3IEBA 1MXSA 2E40A 4EPDC 3QEZA 1XIMA 1QWGA 1JR1A 4IQJA 2DZSA 2F2HA 4L5ZA 5JVLA 2YDSA 1J6PA 1D3HA 3AAMA 2CLPA 2B4GA 4AFYA 3DKLA 4GBUA 4GNVA 2DVXA 2EPKX 4CU7A 2BXVA 1IHIA 3JZEA 2ZYFA 4GMEA 2VR2A 2PD5A 1CENA 3BZGA 1KTBA 2ZOXA 2NZLA 4US5A 3DFPA 1IR2A 1SGJA 2X1SA 3CO8A 4DUVA 4NX0A 3LHYA 4E6MA 3URAA 5F2IA 4Q33A 2AQVA 1CYGA 5LIXX 2FTWA 1RQHA 4KETA 4Y2WA 1YX1A 2Z29A 4C6MA 2QCCA 4O14A 1K4GA 1US3A 4PEKA 3GM8A 1LBLA 2OODA 1R3SA 3CQJA 7TAAA 3W2KA 2Y8UA 3QHNA 3RYSA 2WNWA 2GJXA 3C2RA 3CUZA 4H6KA 2JEQA 3DU0A 4KPLA 5G1YA 1I8JA 4BQ5A 1LT7A 2VZVA 2WMJA 4NKCA 3PF3A 1KGWA 4FAMA 1PIGA 1XIGA 5H8MA 1IXNA 1ZNNA 3IGXA 1YLVA 3VGBA 5I0DA 1ALDA 1S2UA 1K70A 1L6SA 5F2MA 1F61A 4LY8A 4H7ZA 1R3RA 2BBFA 4Q4PA 1PWMA 4FOUA 4S2CA 2PRHA 1WZAA 1ISYA 1E40A 3RRAA 2YCEA 5F1UA 4N9BA 4MWAC 4HK7A 4HNVA 3B9AA 4FALA 5H8UA 5U4NA 5HQEA 4JICA 1KQZA 1X1OA 2QCGA 2VD9A 4KEZA 1LRTA 3W2NA 4FLQA 2FZ8A 1UWSA 1PCWA 2CLEA 2VYOA 3UWZA 2FQIA 4FXRA 5HMSA 1ZGDA 1WZLA 1DBTA 3NO3A 5FI8A 3RK8A 2C15A 4DBEA 2KAUC 3CWNA 3NL5A 4AZ6A 5PTDA 1UWQA 1HJWA 1HO4A 1EIBA 3FDGA 3OHIA 4JFUA 1GW1A 1XCXA 2GUYA 4WHBA 4C7GA 2CHOA 2F61A 3FA4A 3B0VC 3RMEA 2BTMA 3UJ2A 4NXKA 2R14A 1OX4B 3QPZA 5AYYA 2E9BA 2VZSA 3W02A 3TW7A 1KCLA 2OOGA 1KRAC 4XVEA 2ZX8A 1L6YA 4BQ2A 8CGTA 3N11A 1KLZA 4J3XA 3ATYA 4FNUA 3NOYA 3NYZA 1HIZA 4E2BA 1RPKA 3BQ5A 2D69A 3AYTA 4QLKA 1VHNA 1G4EA 3UPWA 3WYZA 1ISVA 3URNA 2Q09A 1ZAJA 2OPJA 5C5YA 2G3MA 2VRJA 4FI4A 4B5TA 5KZDA 4I9MA 1ADDA 3VC6A 2V5KA 4Q8QA 4OGZA 3NVDA 1PHWA 1I0BA 2VFFA 2YDAA 3ZLHA 4KBXA 2AQWA 3DAQA 3GFXA 3NZGA 4ZQNA 3CC1A 4MUZA 3C61A 3PZMA 2XIOA 1TE6A 2ZDRA 3OZOA 5FESA 1ZHAA 4H6QA 3W7EA 4A22A 3ZIZA 4MNLA 5IFTA 1V3JA 1G5AA 3MSGA 1UKSA 4DBDA 4C6EA 4QSHA 4IPIA 2WMIB 3QPEA 1TO3A 3WF2A 3NCOA 2JGQA 1OT1A 1KR0A 5CC7A 1BXNA 3I3DA 2PI6A 2AMXA 1X38A 4UQBA 3M5XA 4H04A 1K02A 5FF2A 4D72A 2DIEA 1Q4NX 2BGSA 1BSIA 1SSGA 1VB9A 4EAMA 2PP0A 1OFEA 3M46A 2EPNA 4NHVA 4M7TA 3A22A 2OZ0A 4NY2A 4NJJA 4LAOA 2DH3A 1F76A 2ZZ6A 1QBAA 4HMCA 4X60A 4IUGA 3WH9A 1S2TA 1YBQB 4QR6A 4DLFA 3K8MA 3ZVHA 4N2YA 2YZRA 4JDYA 1AQMA 4QITA 4AEFA 1K3UA 1TQXA 2BVTA 5BOFA 3VIOA 1G6CA 3VKCA 3DHFA 3EYPA 2BV9A 3EMZA 2ISFA 3M4HA 3OYXA 3NO1A 1MXDA 4UTLA 1LTDA 1QWKA 1XS2A 3UVAA 1EWEA 4KH2A 4OUIA 2RAGA 3QMRA 1MDRA 4H8VA 5GJNA 2WMIA 3FOKA 3Q94A 2V68A 2WSQA 4ZOCA 1CNVA 1XQLA 1BTCA 4HHLA 3EB2A 1GG1A 4HYVA 3IJDA 4B9ZA 1VH7A 3F1QA 3VD4A 5EA9A 1KM1A 2X30A 3HG3A 4MKVA 3TX9A 2HCVA 3A3XA 5JBDA 1NIUA 3CHEA 4YU1A 3W1XA 3EEZA 2C13A 4Z1CA 3F03K 2EXOA 4UZSA 3W07A 2NXGA 4DWSC 2PGFA 4EE9A 1A4MA 1R2SA 3PNUA 2XVKA 1CI1A 2P8BA 2XU2A 5DF0A 2IPWA 2PBOA 3GVVA 4NU7A 4HZ6A 1TVPA 2ISVA 1YBQA 3QMSA 2XH7A 4GYPA 1KFKA 5DCDA 4UR7A 1C8YA 3P2VA 4S3AA 2OG9A 3N73A 4W89A 3PC0A 1TJRA 4A3HA 1FUYA 3SRKA 2BHZA 2DZTA 1SZNA 3HPZA 2PWDA 4GX8A 3SRHA 2E25A 1A3XA 1ITQA 2OGJA 1ZCOA 5MHBA 3V5CA 1N7KA 2OCZA 2NQHA 3ZQ9A 1Q4WA 3MBFA 1E55A 3RXZA 2Y62A 2V3GA 4JGDA 1H11A 4FR6A 4Y96A 3W84A 2XM2A 1AH4A 1DJXA 1E3XA 1NOWA 5CEWA 3PTDA 1OYCA 1POKA 1XKJA 1GZJA 1DWHM 4PYSA 2ZRWA 3WQ4A 2Z6JA 3LD5A 3OLDA 3WQ6A 3QVQA 3UERA 4A8NA 3PBVA 1QI5A 2F2KA 1AJZA 2FZ9A 2P88A 3EWYA 1B57A 2AAAA 2D22A 4AVOA 3W71A 4JFWA 2AL2B 4ICMA 2DW7A 3A23A 2GUUA 2CIPA 3GIQA 3T2OA 3MJYA 3VNIA 1CXIA 5CZTA 2ACUA 1IZKA 3THDA 3W0KA 4M82A 2XPKA 4L9ZA 4CNPA 3ARSA 4H7CA 1E6SM 2J8FA 4JTSA 1DQWA 1FWJC 3UXIA 1W2VA 3LX9A 3SFKA 1TZZA 1Q7MA 2PFHA 4ZODA 3QSTA 3P62A 2Y7FA 5D9NA 4YCOA 2IQDA 5AZ0A 4US6A 2XVPA 3EXTA 2VR4A 5AZ1A 3EPOA 5D8ZA 3LHZA 3S47A 5CSYA 1P6BA 5A8GA 1H1NA 3VIJA 3KZPA 1MW2A 5TQLA 3A12A 4AD2A 3U5UA 2REQB 1LLZA 4UIOA 2X42A 2VFGA 2ATSA 3P93A 2E5DA 2QT3A 3LCXA 3CUJA 1WO2A 2Q8LA 3LM3A 1JPDX 2R1KA 3IUDA 1A5NC 1H50A 4RDYA 2IS7A 3EKGA 3G0UA 4UUIA 4GG9A 2P8CA 4O4VA 1BFNA 4AEEA 3CZEA 3EBVA 1UD8A 2AL2A 3WENA 4Y8FA 3OLGA 2E8ZA 3F4VA 4ENLA 6ALDA 1ECQA 3SECA 4HYWA 3U4AA 4H9XA 1ZAIA 4TOQA 3IAQA 3ABRA 1GOIA 3W1LA 2VDGA 1EWDA 3VC5A 4XK2A 4U3AA 3SUWA 3N17A 1X8FA 1G94A 3O1NA 4QJ1A 3FIGA 5H1WA 2PTDA 3H2CA 4CU6A 4WCJA 3FKKA 3LXAA 2B81A 1FWBC 1XM3A 2P0IA 4HN8A 3UJFA 3HFTA 1Z3NA 2VWSA 1V0MA 4PCPA 2FHBA 3RDKA 2ZE0A 3GUWA 1KTCA 3S1GA 3BURA 1KM4A 4DJFC 3DENA 1F3XA 3R5EA 1JD7A 3VOCA 1PV8A 5AN7A 1LQAA 3M5YA 4ECLA 1RJPA 3PG8A 3TZNA 4C6NA 3SADA 1UWTA 1WBJA 3S1WA 1GOOA 1Z89A 2REQA 3MCOA 4GPNA 4HU3A 1QK0A 1E1CB 3SGZA 3WUFA 1HF6A 4JTKA 1IIHA 3E9AA 2ZVIA 4LUJA 3U57A 2Z1VA 1MUMA 1OZMA 1UPPA 2TYSA 4JQ1A 5IFPA 1H7XA 3MO7A 1GQIA 3VKJA 1E6QM 1VFMA 1QI3A 4MY9A 3G77A 3ZZ1A 3AC0A 1LZOA 2YCLB 4BWLC 1EF3A 5E9AA 5JU6A 1R3YA 3INPA 4RUBA 3ZS4A 4E4FA 4IMCA 2ZTJA 3LHVA 2A6NA 4PUNA 4G2DA 3O6CA 3M9YA 1OB0A 5G2IA 4A3RA 1BVZA 1FTXA 1UBPC 4HSHA 3EWUA 1MUWA 5CZ0A 1FWNA 3RHGA 4JYEA 4K36A 1C9DA 1QHPA 2BOEX 5FD0A 4GGBA 1ZZMA 4M6UA 3VOFA 1V02E 2EPMX 4HTBA 1CPUA 3MMUA 2YDRA 3LMZA 4O12A 1CEOA 1Z48A 1XWYA 1OINA 4GCXA 1OF6A 3V18A 2PDNA 4DXKA 2EG8A 4I90A 3C6CA 4C6JA 3UWQA 2ZZ4A 2VEIA 1GQJA 1D7KA 1RA0A 3HG2A 3B4YA 3R8GA 2EG6A 3G1VA 4WK9A 4F0LA 2XTKA 1B30A 2ZIDA 1XYLA 4AXNA 6XIAA 4EPBC 2PEVA 3WFAA 2YCLA 3UZYA 4FB7A 1QRQA 4WSKA 2CLIA 1L6FA 4F2TA 3FV9A 1V51A 2XFYA 1F3TA 2VC9A 5A6BD 3A3HA 3RJYA 3EKLA 3VKDA 2IKIA 3I7RA 3ZSTA 4DEFA 1DVJA 5AC7A 3MWCA 1IEVA 4R7WA 4RZ5A 2HZGA 2A85A 2WMKA 5TD4A 3GIPA 3HURA 5J04A 2BOFX 5D33A 3AS0A 4MLJA 3PUDA 3PVFA 5HJLA 3S2MA 1RSCA 5BU9A 2G50A 1RLDA 3QJAA 4A21A 2OKOA 1NTHA 2VELA 3DI1A 4GY7A 1JPHA 4XZNX 1KCKA 3RLGA 3BAXA 4DNMA 4ERAA 4QDMA 3IIXA 4MNJA 3C0QA 4YVPA 3LA4A 4YHGA 3ARPA 3V35A 3GVQA 2W63A 2CCRA 1W3TA 1ITCA 1SO5A 2OLAA 3IIVA 3WY1A 3H8AA 3OW1A 4LBUA 4RV8A 1C8VA 2JBMA 3NIYA 3SY8A 1RXOB 3MI6A 4X0NA 1HUVA 4D8LA 4IXXA 3HM7A 3N19B 1EC7A 2WSRA 2VRQA 4MLRA 1B9BA 3G2GA 2PLMA 3PWAA 4Q4OA 5BOOA 2Q01A 1B3ZA 4MSSA 1RALA 1XIFA 1LCOA 3HN3A 2VL4A 5I3KA 4RW5A 4XBSA 3W73A 4E2VA 1QPQA 5I24A 4Z0JA 4L61A 1DORA 4QSFA 1UWUA 3KE0A 5T9BG 3P8IA 4GQRA 5D30A 4CD5A 5HNUA 3NPWA 4F0KA 3UR2A 5LYRA 1QK2A 1W9VA 3VNJA 2X16A 1EDGA 4GCAA 4M24A 3VD3A 3WDHA 3AHYA 1EBHA 2WM0A 5T8GA 4B2DA 2JIEA 5HWJA 4EPEC 5M1TA 1JPIA 2YXOA 4GGHA 5FACA 1JVNA 1Q45A 4ILSA 1KXQA 3VCRA 1RY8A 3M0ZA 4N6FA 4JCLA 4GUHA 4IGMA 4O0QA 4GO8A 3UY7A 4AF0B 3FW6A 4GRSA 2E3ZA 1LDCA 2ZZ3A 3CHCA 4HNNA 4D1IA 1V0NA 2PMQA 4LCQA 2YB1A 4DJDC 1L9WA 2Y2WA 3T44A 3NUKA 5F2LA 3S1VA 3VOHA 1GHSA 3MWAA 4EACA 3C2OA 1W3HA 3ANUA 1EZ2A 4TTUA 1KFJA 1NELA 4EK7A 1GEQA 3U2CA 3CAKA 3JZUA 1C7SA 2VCCA 1UR9A 4LNYA 3HV9A 2HVMA 2C1HA 5AHIA 1ZLPA 1LBFA 3CUHA 3ALFA 1KM6A 4AY8A 2QPSA 3BLFA 4WSJA 2OZTA 3D3AA 4FP1A 1M7OA 4V28A 1P7TB 2OWCA 4LRSA 1EDQA 1F9CA 4FXJA 5G1TA 3NZ1A 3R58A 4GH1A 2XN0A 2XIBA 5B7ZA 3B9OA 3MVTA 1TWDA 3WDRA 3E0IA 3HZ3A 3QKZA 1XH0A 2BVWA 3C8NA 1W1YA 3MT1A 3EOOA 2HXTA 4MJ2A 4O0KA 5EB8A 2BVYA 2VDIA 5AECA 1E0TA 1J0YA 5ECUA 3PG9A 4K7VA 5FEZA 5M5DA 1LF1A 1RY0A 3GAKA 4MZ1A 4Q8MA 1DOSA 3LG3A 4TVDA 3NQAA 4Q6XA 4XTIA 5EGRA 2WJDA 4RE0A 1UR8A 2HV5A 1DKWA 2CLKA 4PTXA 3T42A 1CXFA 4BKNA 2GVLA 1QOQA 5IM51 3S6OA 1S46A 4W8AA 2X0HA 2PPGA 3VMPA 4V1YA 3E0FA 7CGTA 3BMXA 3VM7A 4Z2GA 4R53A 3Q2DA 4Z2JA 3UPBA 2CLOA 2NQLA 4UQDA 3TWAA 2WZEA 3U6WA 2OYKA 3AICA 3PPFA 1I2PA 2L5HA 1XKYA 4GQGA 2NT1A 4I6VA 2H3BA 2CWNA 1WE5A 2JF7A 3W27A 3LSBA 4A05A 3O0KA 3LN3A 4XZHA 4PR4A 1QTWA 2ZUNA 4I7WA 3NPXA 1TV8A 4CNTA 3DFQA 3H21A 3WD0A 3OTRA 3CK5A 3UCCA 1BYBA 4L56A 2ADAA 1Q8AA 3IK4A 3KHDA 3SY5A 1B3YA 1OD8A 3R79A 1LUCA 2XDFA 1J9YA 3WD1A 4QNWA 5BNKA 3DHUA 3C8FA 3CZKA 1VIWA 3QOKA 4L4OA 3ZJKA 2RGLA 4JTAA 1JFXA 1GQKA 3MW7A 3QY6A 1W5OA 5LIUX 3RN6A 3M6DA 3G8RA 1BRLB 3CLMA 1B3WA 4U10A 2G3FA 3W7QA 1DL3A 1M68A 2NV9A 3TC3A 3WEZA 2Z24A 3T4WA 1VBHA 4LUYA 3U2OA 3O06A 2QXWA 3UVIA 1WXJA 2E68A 3P5YA 4XB3A 5D38A 1SMDA 2XM1A 3E6EA 3ARVA 3TU9A 4GWEA 1R5YA 1Z6KA 2EO7A 1OQFA 1QI0A 5LNUA 1HJQA 1FQ0A 3GK0A 1BYCA 4MAZA 1OK4A 3WF4A 4S39A 4TVUA 4ZB0A 1W1B1 4F0SA 3NOEA 1JYXA 3EMCA 5CPQA 1FCUA 1UP2A 2W67A 4G1NA 1YE6A 5IXEA 1HZYA 4QAIA 3LZ5A 2QPUA 4LAUA 1QOXA 4HOXA 3PB0A 3P0WA 4UXDA 4NG3A 3MMTA 2VEMA 3L2LA 3NQ7A 1ZUAX 3WQGA 1TB3A 1GYLA 2R82A 3BLDA 1KCZA 3PZ9A 1SFTA 4QROA 2IPFA 1VCVA 3ZO9A 2C0HA 1ODUA 2NLYA 4DLMA 4BY3A 3RIKA 1BRLA 1K9EA 4R88A 2ISWA 1UUQA 1GOMA 5BXTA 2AGKA 1WKFA 3GXMA 1WUFA 5AHFA 4MDOA 4RV3A 2C1IA 3D46A 1JQVA 1XP3A 2XFWA 2Y5JA 3JU2A 4JQ4A 1H3GA 4HKPA 2CFFA 1KV8A 2ZRZA 3VUSA 2AOSA 2DZUA 3SFWA 4OVXA 1N8WA 3G22A 4E8CA 1NFBA 1P0BA 2XFFA 1PTAA 2C91A 2E77A 3UWUA 2GYIA 4YTTA 4XAFA 4J7RA 2XGZA 5HULA 4J40A 4HK6A 3E2RA 3OO2A 4KWWA 5D8WA 4YHEA 2A6LA 4AMCA 4E2DA 1T7LA 3D6NA 4XIMA 3URBA 3WJWA 5I00A 1LORA 2ABBA 2HNHA 5EY5A 4CQ9A 1ODZA 4W87A 2CLLA 5A8MA 5MKGB 2PWHA 2YL6A 1W56A 4ORIA 1XR2A 3T8QA 1CXKA 3A13A 1H41A 2OSYA 3ELFA 4NILA 5FF7A 3CUGA 4XBJA 3GWQA 2V38A 1KO0A 2W6RA 3SSZA 1BEUA 5C54A 2FYMA 3PN8A 5BMWA 1SW0A 3AMLA 4AG0A 1JFHA 3SQMA 1B1YA 1XGZA 4PTMA 4U33A 1W3NA 2BODX 4YVVA 4RNHA 3R94A 2QJIA 3LDVA 3W00A 3HPAA 4B5VA 1MW0A 1BVWA 3PK7A 4PMRA 3CB3A 3O9NA 3Q67A 3M43A 4PODA 4F79A 1F05A 5E6ZA 1CBGA 4FOJA 2X8RA 2DZPA 4IFKB 4MPQA 2HXUA 4PRWA 5ABFB 1CW2A 4FHAA 1JCXA 1RHCA 2NUXA 2J25A 3R10A 4GYKA 3KW3A 3EX6A 3QV7A 2VEKA 3OZYA 3QC0A 4N4QA 3EA2A 2HJPA 3AZRA 3TP4A 2V5CA 3SCQA 3AZTA 5C9XA 4H00A 1WB0A 4DO6A 2QMJA 1VJZA 3WEOA 4RLIA 3AQUA 2OZ3A 1W9DM 1YPXA 4PUDA 1ISXA 3LYEA 4FF7A 4P7QA 1QCWA 4IISA 4FX6M 5MKGA 1QXLA 3W1PA 4NI3A 1DJHA 3R43A 3TR2A 3W29A 1EZWA 1X39A 4LUTB 2PDIA 1VD6A 3GG7A 1DJYA 4GZJA 5BRBA 1PIIA 3DERA 1LG2A 3W70A 4ZE4A 3RO8A 5HINA 4FNTA 3IGUA 4F4RA 1HGWA 1D3GA 2C8NA 5FSEC 4MVAA 3SUSA 3PSWA 2X0YA 2VGIA 1QW7A 5BOEA 3TEVA 4JTTA 1DIKA 3LS9A 5HWNA 1R2TA 2ZXBA 2OLSA 5DX7A 4HMNA 4L4PA 3MUAA 4HHMA 3CT2A 3ICJA 4EIVA 3I6RA 3CO4A 2TSYA 2YYTA 4KFOA 1VAHA 4IHCA 4PC8A 3DG7A 3V3WA 2YCJA 2W27A 3EX4A 4AY1A 4C6CA 4R27A 5ABFA 3KBJA 3H24A 2LLEA 1H60A 1CTNA 1N2VA 3BMVA 3F5JA 2UZ9A 4ZO6A 4FIQA 3NXFA 1PEZA 1UKQA 2Q6ZA 4IPJA 2ODOA 4CD6A 4PCSA 4RXFA 3W6MA 4GJJA 4A35A 4IMGA 1YYAA 3CM4A 2OTDA 2X41A 2ZX6A 2ZRYA 4UTUA 3U2ZA 1Q2RA 4C5YA 1NFGA 4S2BA 1W5NA 1B5TA