3TYAA

Dihydropteroate synthase in complex with product
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
274
structure length
265
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords Dihydropteroate synthase
total genus 92
structure length 265
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tyaA00
3H2AA 4D9PA 4HB7A 4DJEA 3TYAA 3TYCA 4O0QA 4D8ZA 1AJ0A 3BOLA 4MWAD 3H23A 4O1FA 3H2MA 2E7FA 1AD1A 1TX0A 3TYBA 3H2CA 1Q7QA 4PZVA 4DAIA 3H24A 1TX2A 2Y5SA 2VEFA 3H2FA 4S3FA 4S23A 4DAFA 3TYEA 4C1NA 1Q8JA 3H2NA 4DJFA 3H26A 4DB7A 2VP8A 4MWAE 2YCLA 3TR9A 4DJED 4MWAC 3TYDA 2VEGA 2YCIX 3H22A 1AJZA 2H9AA 4DJDA 4MWAB 4MWAA 3TYUA 1AJ2A 3K13A 4NL1A 5JQ9A 1AD4A 3BOFA 2Y5JA 2OGYA 4O1EA 4D8AA 2YCJA 3TZNA 4S3EA 4NILA 4DJFC 1Q85A 4NHVA 1Q7ZA 1F6YA 4S39A 1Q8AA 1TWWA 3H2OA 4CCZA 3TYZA 4DJDD 1Q7MA 2DZBA 4S3DA 2YCKX 3NOYA 2Y0FA 4G9PA 4S38A 3TZFA 4DJDC 3MCMA 4DJEC 4NIRA 3MCNA 4C1NB 4DJFD 1TWZA 2H9AB 2DZAA 3H21A 4S3AA 4S3CA 4S3BA 3H2EA 2DQWA 1EYEA 2BMBA 3MCOA 3V5OA 1TWSA 2YCLB
chains in the Genus database with same CATH superfamily
1H5VA 3W1LA 4YCOA 1OB0A 2Q02A 1EH9A 1S2CA 3S1WA 2J7CA 4M3PA 5ECUA 1QCWA 4C65A 3CZJA 2AMXA 3AHVA 1VCGA 4M24A 1HFBA 4ALDA 4AZ6A 2J9YA 4OV9A 2QCLA 1WDSA 5CPMA 1ZS2A 3G1YA 4CUCA 5CQ1A 1PPIA 3GAKA 1E5JA 4IIEA 1CIUA 4IOTA 4FOJA 4UFMA 2YA2A 4Y9NA 3VDCA 3M7WA 1RXOB 2F2HA 1FY6A 3LHUA 4AEEA 1X96A 3OZMA 3OA5A 3M44A 2VDIA 4YLWA 5MKGB 1Z9AA 2WNWA 4NI8A 3KDOA 2A7PA 4D8AA 2I1OA 3AISA 4H4IA 1V6XA 2EEXA 2FB2A 3W83A 4DPPA 2PPGA 2EKGA 2ACSA 2XGZA 1DIDA 1UR8A 4DI9A 4C6LA 3AMGA 5HBFA 3VGGA 4MB5A 3VGDA 2Y7EA 1GTEA 3M16A 3NOYA 1Q2RA 2RJHA 1EX5A 3NQCA 2UZ9A 3W7PA 2DH2A 3HGJA 5FJTA 3MP5A 2HEJA 4B3KA 2NWRA 1N82A 1UKTA 1SVDA 2CESA 4X2PA 5BCAA 3OQEA 1VB9A 3GBEA 4GD0A 3LXCA 3T0TA 1WO2A 4Z08A 1KLZA 2HS8A 3GXIA 2J47A 4LAUA 3NQBA 4QLLA 2NLIA 4QHRA 4S3JA 4Y90A 1TX0A 5AYBA 3N9RA 3BVJA 1EF2A 3FV9A 2BB0A 1G01A 4HZ8A 4J3VA 2D73A 1L2UA 4OWGA 5CG7A 1JYNA 1A3XA 4F40A 4JCLA 1F73A 1RJQA 3UPBA 2G95A 2A3CA 1AL8A 1ZU8A 1TPH1 1THFD 1O4UA 2VEGA 4CKQA 4LUSB 2GGGA 2XVPA 2PF0A 3LHZA 1LDCA 4O1BA 4L4MA 2XWDA 1G6CA 4A29A 5FSDC 4DYKA 3KP1A 1G94A 3CC1A 3M5ZA 3E0FA 1PEZA 1GONA 2XIBA 3L4VA 4ZO9A 3MMUA 3R4IA 1TPEA 4K36A 4J3XA 3GNNA 2XH4A 1TUFA 3LRLA 2PGRA 5CBJA 2XVKA 5CAHA 2R8WA 1PTDA 2HJPA 2V3EA 2OR2A 2PDBA 1Y7VA 1XIJA 2VR5A 3UZXA 1TV7A 3TV8A 1E0TA 3R7MA 1LTDA 4Y96A 3VMNA 2V30A 4LUIA 2IKHA 3GTHA 1EJWC 1E4MM 1XG3A 1OIFA 2YDRA 5DMLA 1QMLA 3O0KA 3VE9A 4AYSA 1NJJA 2R24A 2IKJA 1TMQA 2X1TA 4LBUA 3TYCA 3WF3A 1HO1A 4HA0A 4AH7A 3H23A 4MDPA 4IMEA 2E7FA 4UNLA 3TYBA 4H9MA 1W9XA 3L65A 1LF1A 5DLCA 4DNHA 2JEQA 1CGXA 3KL0A 3RAOA 2YL6A 3Q58A 1LT7A 1JF5A 4KEVA 3LPGA 2C16A 3HQ1A 3RR1A 3IEBA 5LHFA 3ISIX 5HMSA 3QN3A 3QHMA 4ZQOA 3W7CA 3TWBA 1EYWA 1QAPA 4V1XA 4IMAA 3VC6A 1P0EA 1FWAC 4RE2A 1A0EA 3TH6A 4JXCA 1XYZA 2HISA 2OLSA 3DECA 1TWIA 2O7SA 2KAUC 3G0XA 5FL1A 2WSYA 4BR1A 3KRZA 5C2XA 1CEOA 2GQ3A 1XF0A 4H41A 3CV2A 2V82A 1VC4A 3UYIA 1OT2A 4ADUA 3LDVA 2BXYA 3T8QA 1U1UA 3V1HA 4GJJA 4LAOA 3MHUA 3FJ6A 3AIWA 5I3KA 5D2TA 2XM2A 4IQLA 3TW9A 2X2GA 3LNMA 3ZZ1A 4H6RA 3W01A 4CD7A 1MNSA 4HYRA 2GQ8A 2DQXA 1F74A 2G4FA 4S3FA 3IARA 2DVXA 4K1GA 3WMSA 3W82A 2JF7A 4KT2A 4JCMA 4LUTA 2AL2A 1SO6A 5RUBA 4IQJA 2WCAA 3STCA 4AVNA 3WDJA 5TIMA 4O28A 4BEUA 1LWIA 3KBMA 1LCOA 1IIHA 1SJBA 5BOEA 1POJA 1HW6A 4JNZA 4XO7A 2OZ8A 5GJMA 2TMDA 3AU6A 4GUGA 5FF4A 3NYDA 4JL1A 4HSNA 3NWRA 3QHNA 1IZCA 3F4WA 2P5NA 1C7SA 3NO3A 4O0KA 1K4GA 1X7IA 3C0JA 3WFZA 4WGXA 3CQHA 1TSIA 4O0ZA 1KR0A 4XZ9A 4KGJA 4RW3A 3G18A 3H4XA 4OQVA 2XJ7A 4X0NA 1WA3A 3BMXA 3GBDA 4MJ2A 4JIRA 2IPGA 3EA2A 4H19A 3QMTA 3UEQA 2HS6A 4WSJA 2C19A 1E43A 2I14A 4W86A 3CPRA 3TYAA 3WNOA 5DXYA 3BXWA 3FCPA 4GYPA 1NM9A 3KFTA 4GIYA 1FDZA 1Q3NA 4JKMA 3SBFA 1P0DA 4ZQMA 2ZRZA 1KXHA 2WZIA 3TEVA 3WLRA 3APTA 4UR8A 3VGEA 4D71A 2ZC8A 6XIAA 4PRTA 2A4AA 1KV5A 4F0RA 1GG1A 1KO0A 3TAOA 5HULA 2NSOA 1EJRC 1WBJA 1VIWA 3M0XA 1RCQA 1YTKA 4XUGA 3WDRA 2JKPA 1UR1A 2ZOXA 4GBUA 4HYWA 1CTNA 1PL9A 3DH7A 2YYUA 5BWFA 3W7RA 5FACA 2E68A 1AW1A 4DVOA 3PP7A 3EWBX 3W1RA 1OX4A 4UFKA 3CHFA 1JYXA 4UTJA 4FX8A 4EPKA 1KXVA 1XUZA 1UUMA 1KTCA 3R1ZA 3EPOA 4ML4A 5T9BG 2ZX5A 4WD0A 4UR9A 1D2KA 3PVFA 4AWUA 4NAFA 2NW0A 2WPGA 4NXSA 1QNSA 4NP7A 3V3WA 3HF3A 4GHRA 1JNEA 2Q6ZA 4C7FA 3H4WA 1XYMA 5DN1A 5F2IA 3ELFA 3SCUA 1WXJA 4HN8A 4S3CA 4DO7A 4CD5A 4GQQA 1EDTA 4Q4SA 2RFGA 2VX6A 3VIKA 2VJXA 1FWEC 1S1RA 5BXTA 4RLIA 1OYBA 3P0WA 5CSRA 4Q7NA 4EPDC 4BEQA 2BDQA 2NQ5A 4BA0A 1MNZA 4B2DD 2XFYA 3MU7A 3FXGA 3CIWA 3PJTA 3CT2A 4PFMA 5GNZA 1K8XA 3GU1A 2XVNA 1POKA 3BJTA 2ZXQA 4US5A 4CQCA 4QGCA 4A3UA 1IT0A 3NZGA 1W5QA 1BTMA 5DBTA 5I3HA 1M03A 2VM8A 3E0VA 4NZ5A 2DSUA 3WMBA 3NGFA 4I7WA 2W61A 2D2JA 2DORA 1D8CA 3JR2A 3UJ2A 3UA3A 3B8UA 3ZJ7A 5IBXC 5I3FA 1GJPA 3LNPA 4AWSA 5LIYX 4F66A 1JDDA 1J12A 3SRDA 3MZ2A 1BWVA 3LCXA 3HPAA 3A3WA 1QUMA 1YQ2A 4I9TA 3PZUA 3EDDA 4UC5A 3LA4A 3VDGA 1UR4A 1NQ6A 3IRSA 3ITLA 1KFKA 4JZ5A 3UG5A 1P1MA 4AD2A 3VINA 3ZVHB 1PX3A 3EX3A 3G1HA 3GW0A 5XIMA 3WQDA 3ZR5A 4INFA 3SFWA 5AHLA 2IQTA 3KRUA 3H4GA 3W7EA 1XBYA 4JEQA 1P4CA 1JQXA 3USZA 4IMGA 5D04C 5FKYA 4WIWA 4LUJA 2CLMA 2R6OA 3L4WA 3PPCA 2QGYA 2ZTJA 3HPFA 3O07A 3BQ6A 3NSXA 3R79A 3W9ZA 4ZO7A 3L4TA 3LQLA 1XRVA 4JHMA 3UERA 1XCWA 2CXGA 2YKKA 4MJ4A 1GWJA 2A3EA 3HJZA 3LHVA 3OBKA 3SZ8A 4ZE5A 1A4LA 4MB4A 4PUEA 3MO4A 2FHFA 3WEOA 3W6LA 1V3JA 4UTTC 4HA4A 1E55A 1TV5A 3GR4A 2NVDA 5F2GA 4O11A 3DOPA 3ORWA 3EMZA 3LTYA 4ERGA 4OOUA 1QATA 4FHAA 3N25A 4LRTA 1UR3M 2YB1A 4TUFA 3RR4A 3JUGA 1KWGA 1OGBA 3O05A 3M9YA 2OX4A 4EWND 3T78A 4F9JA 3W1PA 4ERIA 5H8MA 1B3WA 5LYRA 2QDGA 3MYOA 3CASA 2AKZA 3W3OA 2GGEA 1E73M 3AYSA 4UTMA 3T2QA 3CM4A 3EPMA 1GOOA 2X16A 3CTTA 4EE9A 5JMUA 1EHAA 1FWNA 4AZIA 3UCDA 1UYQA 1X8FA 3N1AA 3WZ0E 4BK9A 2P3EA 3Q4DA 1TPDA 2Y61A 3BCFA 1O95A 4RZBA 6PTDA 4GI9A 4XB3A 5C7HA 4S3GA 3H2FA 1E5NA 4JTKA 3WD4A 1JZ3A 1CPUA 2CCRA 1X1ZA 4QROA 3HG3A 3ZM8A 2BXZA 4FALA 4GO9A 4GNKB 2PGEA 5AC4A 2Z0IA 1O5RA 1GZGA 1E6SM 2CU0A 4JTFA 1XLBA 2CFFA 5C2GA 1V3IA 2Q01A 4IPLA 4H9UA 4BFAA 8CGTA 2CZDA 5H6HA 3NSNA 3SM0A 2OEKA 1QXLA 4JX6A 2FZDA 4JYEA 2WOQA 2FTPA 4UCGA 2VQTA 4NHVA 2W4XA 3EOOA 2VRJA 1AW2A 4J2PA 3BLIA 1RH9A 3GUWA 4GC3A 3PANA 4N6FA 1EDQA 3J7HA 5HWMA 4U5KA 4JTGA 4PTMA 2ISWA 1TV3A 4C7DA 3C8FA 2GZXA 4UZSA 2FZ9A 3VOGA 3WH9A 5EMYA 4C60A 1J8VA 3UR8A 3VFLA 3B0UX 1E6XM 4HZ7A 4AW7A 3HM7A 3KCOA 1MYRA 2BMBA 5AKQA 3PS7A 5FJIA 3CAVA 1KA9F 3NYZA 2G3NA 1NDWA 2CLPA 3CIVA 3M41A 5DELA 3TX9A 5D05A 3IGUA 3DFSA 1ELSA 4N9BA 3DYMA 2QPUA 3WD1A 4QG8A 3TN5A 3BO9A 1SZFA 5JH2A 1F3TA 1WAWA 4Q8UA 3AFBA 4CQ8A 2OWCA 1VH7A 2WYSA 1DJGA 4HHLA 2VZUA 4ZB0A 1WDWA 1FP8A 3M5YA 3VABA 4Y9PA 3KW3A 2VNCA 3E3HA 3VCNA 1JYVA 1ZJHA 1FWHC 1Q4NX 1JCMP 1W9DM 1P6CA 1OIMA 2I56A 3PTQA 2FPTA 1J18A 4ZE4A 1IGWA 4WDUA 3R11A 3GG1A 4XAGA 3U4FA 3HG2A 3QXBA 3IJIA 4IP7A 4FXRA 4G8TA 1FTXA 3ALGA 4KMQA 1YDYA 1K6AA 2W92A 3MUCA 4X63A 1DXIA 1UA7A 4WDTA 1GYLA 3GXTA 4C6NA 5DMYA 3GHTA 3OLEA 4GX8A 1FWWA 1JGMA 5BNKA 3G1XA 5JIWA 1JULA 5D02A 3MCOA 4PCNA 1TWSA 3POHA 4H8HA 1JDCA 1UUOA 1O94A 5IFTA 4G7EB 1A53A 1BXBA 4EX4A 3DGBA 1T99A 3VYLA 3QTGA 4RXFA 3LCIA 3NQ6A 1JYWA 2AGTA 2WC3A 1F05A 2DGAA 1IF2A 3VIPA 3W26A 1ZBCA 1UR2A 1OFAA 1DQUA 4H9VA 4PTVA 2PWEA 3NXFA 1CGYA 3C6CA 4GJIA 5LA1A 1RCOB 3OBEA 4HNLA 3PM6A 5G1YA 3G6LA 3WNKA 4AZCA 1HKIA 2QUVA 1SZRA 1UP3A 4U5IA 3ZJ6A 4HU4A 4P8VA 2HK0A 1PYFA 3W38A 2ZVIA 4LVGA 1XSJA 5HUPA 2OQLA 4W7VA 4ZOEA 4F8XA 1DOSA 2F84A 4BF9A 1H60A 4BI6A 4YTSA 3SAZA 3LY0A 5FD0A 4LRSA 4UFHA 1PXGA 2QVNA 4EP8C 3VK5A 3DFNA 1R3TA 1UR9A 4XAYA 2VC9A 2QHAA 3SRKA 3STEA 4DWSD 3VCRA 1UWUA 3SN4A 3AXXA 2ACUA 4IIHA 3QW4B 3U5YA 2V68A 3NPVA 2ISVA 1IWBA 4AAJA 2JKAA 1UZDA 4G7EA 4X60A 5DCEA 1QW8A 2ALDA 2YDQA 4CN4A 3R8GA 3OA3A 1R0MA 1VLWA 4JTHA 4RNIA 2GWGA 5EGRA 1F3WA 3HJEA 3NTYA 1OF8A 1Q13A 4O50A 4Z1CA 2PDWA 1MDRA 1J6PA 2NVCA 3AXMA 3SCPA 5E6YA 1F7BA 1TX2A 3FHAA 1QBAA 1KXQA 3LENA 2INEA 4OUIA 1UH2A 2XHYA 3IAPA 4XIMA 3MI6A 2HPMA 2VD9A 1RQBA 4NZ4A 3MJMA 4M6UA 5DEZA 3GS6A 3RLUA 3UWWA 1YPFA 3IRDA 5M1TA 4XUYA 1PZ0A 2CBUA 1KGUA 4H6KA 3FOKA 4B91A 2E77A 3ZR4A 4GOAA 4XD4A 1US0A 2H3DA 1JPIA 1PCWA 3APYA 3KXQA 1RAKA 3BK0A 3YPIA 4LTSA 2QUMA 1SR0A 3W28A 3S4TA 4KPLA 1C8YA 2X0SA 1SJCA 3SUTA 4ZA0A 3TAKA 3GVVA 4ERAA 4HPJA 2I16A 3BW3A 4A22A 1TJ1A 4LW7A 5EFDA 2C0AA 2WB5A 2ZTKA 1GVEA 3QV9A 1V7AA 2HXTA 2PRMA 6REQA 4J27A 4ZOBA 3DHDA 4HOWA 1RSCA 1LRQA 5SWUA 4YTTA 3H2AA 1W37A 4JX4A 2HE8A 4D8ZA 1YADA 1M53A 1ZRQA 1P0BA 4J7RA 1ZBKA 1XLJA 2VEIA 1VJZA 4QJ1A 2B7OA 1EXBA 3P3BA 3TLQA 4H6QA 3GZ3A 1KTNA 3E0IA 4U4MA 2BZNA 4H9YA 3S6OA 3LXBA 5KINA 3KTSA 4YU1A 1A5NC 3SJ3A 4FSAA 5HK4A 3MHGA 1ZBVA 3MUIA 3MB9A 4FO4A 4R33A 1VD6A 1FKXA 3LCWA 3GVWA 1FWIC 3RGTA 4MFEA 2G41A 4KGLA 1MXSA 3VUPA 1H1ZA 1L6WA 2Z4GA 2QCFA 1V0KA 1PKMA 2HRWA 1S2TA 4Q22A 3ALFA 3W7JA 4HCDA 1FOBA 4FNTA 1ZBWA 1WZAA 3AIUA 2HWGA 2WHKA 3DU0A 5HPOA 2FIQA 4PUDA 4Q6JA 1S3TC 3W76A 3BMWA 1BD0A 4JTEA 4PN2A 5BWAA 2OSYA 4J3SA 2YCEA 5EMLA 2E9LA 1EGMA 3WQVA 1Q45A 2GSEA 4C6OA 3W2JA 1XYLA 4YVXA 2XIQA 1PDZA 1J4EA 5TNVA 7REQA 2BGSA 4OJYA 2VL4A 3PZOA 3AZSA 3HGOA 4YYCA 2VCBA 4B5NA 2Y85A 2PD9A 3E5BA 3EOUA 5TF0A 2C13A 2VHLA 2Z7KA 1UZ4A 5KETA 1S5TA 1LL7A 4LYKA 1V3HA 3HGRA 2OSXA 5A94A 3QPEA 4PTXA 1YW1A 3LHYA 4HCLA 4PMNA 1E9ZB 2R94A 1Q8JA 1ZFJA 3IGHX 4XSMA 3AWNA 4KBXA 5IBXA 2PCEA 1Z41A 4HA1A 5A8OA 3QMSA 1G5AA 2YZRA 5BU6A 3T09A 4DJDA 4TOQA 1UWSA 1GYMA 5AC8A 2IXUA 4B4HA 1PIFA 4RUBA 1JDAA 3VIGA 3EMCA 3U7VA 4CNOA 4MPKA 1EP2A 3VKDA 4NILA 4N42A 5AHIA 4L65A 3DFQA 4G2DA 1HKWA 4XZHA 5LKYA 5AN7A 1TIWA 4LB4A 1L2QA 4QE4A 3D3FA 3DBPA 3T4WA 1B3YA 3W2KA 4UXDA 2YA1A 1J5TA 4FLSA 1WDRA 5HDRA 3ZJ8A 5JVLA 1KV8A 3KWSA 1KR1A 3T8LA 2Z1BA 3UWQA 4PB3A 1XKJA 3AIRA 3PULA 2DSWA 3U2ZA 3NPWA 2YJQA 4Z1YA 3VCCA 2PI6A 2VFFA 5DFAA 1ISVA 4GRSA 3EOEA 8A3HA 4Q8TA 2PA6A 3F5KA 5U4NA 3C2FA 1K70A 1H09A 3MI2A 1E9LA 1KBIA 2CKRA 5CBBA 5D9PA 3ABZA 3ERPA 5I23A 1H7NA 3R12A 2I5QA 2L5HA 3G8EA 2HVMA 3IIPA 2PDQA 1R7AA 5FIPA 2GVJA 3GDMA 3VM5A 2W79A 1IEWA 5H2ZA 2FGLA 4FEZA 3ZFHA 3PK7A 3O1NA 1PHWA 2ASHA 1CLXA 3CWOX 2BTMA 1GJUA 4K39A 2BVDA 3SQSA 3TCSA 3VOHA 5LXEA 1VEOA 3SB0A 3A4XA 4L9ZA 1V93A 2OT0A 1WP6A 4LX4A 3THDA 3U48A 4L6DA 4IQDA 2BODX 3L21A 2J7FA 4RDZA 4W8LA 4YL2A 3VZZA 5FEPA 1XLMA 1RA0A 1V02E 1MUWA 3URQA 1FDYA 1RJPA 5I09A 1IWPA 3S6DA 3UWVA 4HIBA 4XZLX 3KS5A 2VGIA 1W9BM 2XH0A 2E40A 1C8QA 3LSBA 1YXCA 1BEUA 5BRPA 4F0KA 1GVYA 3PWGA 1CB7B 3GTFA 4CQAA 3T0AA 1RY0A 3OZYA 3TE9A 3C4UA 3NZRA 3S1GA 4A4AA 3WK3A 1XCXA 3OOQA 4KS0A 5BROA 1YEYA 4DBDA 4I5RA 4UWMA 3CQKA 3L66A 3NG3A 4JDYA 2EXOA 1X6UA 4OECA 4MUPA 2A3BA 1LUCB 4J1OA 2INZA 5MHBA 2PF8A 3PAJA 4W87A 3RXZA 1M7OA 1O6IA 1ISYA 1QHZA 1YKWA 4JNMA 3GTNA 2Z2BA 3UVAA 2MNRA 3L5AA 3OHIA 4K1WA 4C1NA 3NQ2A 1R47A 4HMDA 1EC9A 3PBVA 4MADA 3WENA 1P6BA 3NIYA 5DY2A 2DT3A 1SUXA 4LB3A 4PB4A 3GWQA 3TQKA 4DQWA 1VPYA 5F1UA 3TR2A 3L5LA 1EJXC 1HL2A 4OFCA 1RBAA 1XP3A 2QV5A 1SMAA 1KQYA 2WBKA 1JPHA 4IIBA 1IZKA 2VEMA 2Z25A 4O54A 1DQXA 1FWTA 3BMVA 3DFYA 1UIOA 5CPSA 3WNMA 5LIUX 4KFOA 1SFSA 1O1ZA 4E5TA 3B05A 2J8TA 4JQ2A 4XVEA 3ITGA 1JXJA 4LYQA 1CX9A 3TSDA 5I78A 2XZ7A 3EA1A 4MAVA 4MJMA 3IWPA 3M4HA 1CGTA 3K46A 3KHJA 4HPNA 3SCNA 1OT1A 1F8IA 2BHUA 4ZCWA 5FF7A 4PUNA 1HL8A 4RXGA 4UQCA 4AEFA 4JTCA 5CZJA 3MTWA 4S3AA 1A5OC 4TTGA 3IVTA 3KOZA 2DT2A 2XN2A 3T2OA 3CUXA 2CLIA 5LNSA 3UY8A 4A8IA 4NZCA 1FCUA 5LA2A 5BW6A 2NX3A 3BOLA 5J5RA 3KRSA 1TRIA 4J35A 3BSMA 4QEHA 2DUAA 2PSNA 3GTXA 3W1NA 4CNPA 2WK2A 3N2CA 2ACRA 3MV11 3KBSA 4RZ5A 4GY1A 3C56A 4MUZA 1HF6A 4NX5A 5F2MA 1GTHA 3HFTA 3LMYA 3MO7A 4M1RA 1EKOA 4FNPA 4JOMA 1UD2A 2ONEA 2DZVA 4MWAC 4PMJA 2V5JA 3VIOA 3VOFA 3ZSTA 2HBVA 4E2VA 5JQ9A 2J78A 8XIMA 5D03A 2R1LA 1HG3A 3V0TA 1CWYA 3U0HA 2CHNA 2RAGA 2ZXDA 3H2OA 2WAGA 1SYTA 1GT8A 4IL2A 1OCJA 4L56A 3VGHA 3PZ9A 3WLNA 1EOMA 2BGNE 4LV4A 4FIQA 3HPZA 4PMUA 1XJBA 3REQB 3IUDA 3MQTA 4G5DA 1ECEA 2ZYFA 4ZQNA 3EXTA 2PC4A 1H7RA 5HNRA 1XW8A 1Q6OA 2FYMA 4CNNA 4ZQPA 1OBAA 2D2GA 3L0NA 4QXIA 1OC6A 1K9EA 2NQZA 1OINA 3NA8A 4P7RA 4GIRA 2VC5A 3U4AA 2ZE0A 2DJXA 5EA9A 5IXEA 1ZENA 2DJLA 2EPMX 2WMGA 2YA0A 3TN3A 3IJLA 3E2RA 3AHTA 1MQPA 2AMGA 3MBFA 1UROA 2NSXA 1O68A 3NO1A 2PGWA 4NQ1A 1BWLA 4Y9MA 1AW5A 2OQYA 3GKAA 2DZSA 5B80A 3B8IA 1A0DA 4DI8A 2A7NA 3GX9A 3G1SA 1PE1A 5AYIA 2GJLA 2ISSA 2YDSA 3MKCA 4DJED 2O9TA 3QSRA 4FOKA 1I60A 3ES7A 3EWWA 1A0CA 3KP0A 1I0BA 3W7KA 4RZ6A 2QQ6A 1XRFA 2XSXA 3FFSA 3S5SA 1DBTA 4GUJA 2G5WA 1UUQA 3F4VA 4R9OA 3O63A 4C6JA 2WWCA 4YCPA 1BKHA 4XAFA 4I6KA 1DE6A 3U8GA 4FAMA 2VWTA 4L4LA 4YTRA 1QRQA 3QHOA 1IV8A 3WELA 3VD9A 2P3ZA 1N8IA 1EX1A 3NPXA 1DJXA 1EC7A 2ZUSA 2WHJA 1ME7A 5I79A 5FSEC 4WXZA 3W53A 2KZHA 4LVDA 1TE6A 5G4WA 3G0SA 4X3ZA 2J88A 1HNYA 3WF0A 2P88A 2HVNA 3SY1A 7A3HA 2ISDA 4LBRA 4O0QA 4PBEA 4IX0A 4IXXA 2DIJA 1C93A 4IHCA 2E0PA 1I2QA 2VEKA 1ODUA 3P7YA 2F38A 3PN8A 3H7VA 1J6OA 4NJIA 2FMNA 1NOUA 3RILA 2Y5SA 1WX0A 4OBTA 5K3VA 2GUBA 1BRLA 2VEPA 1ADSA 2PS2A 3EKZA 3R8RA 3NQ8A 4PUUA 1KTBA 3NOEA 1R3WA 3WQ8A 2BY3A 1B3VA 2PE4A 3FNDA 3U2OA 3FLUA 1BQGA 5U7SA 4DM1A 4W89A 2D23A 1GVOA 2XVGA 1QR7A 3C5QA 3H8AA 3T40A 1UZHA 1TUXA 3FAWA 4N2YA 3V35A 2E6FA 3CPUA 1QPNA 3Q37A 4Q4MA 2DZWA 4GI8A 4RNJA 4W4QA 1CDGA 4HNCA 1QI0A 4MNKA 2ADAA 4FX7A 3P14A 2PDFA 1O1HA 5CPNA 4GNVA 2NUWA 3HMJG 2PCQA 4ASTA 3S2CA 1I8JA 3UU0A 1NOFA 3GC5A 4PRRA 4F4RA 2OPJA 1XYAA 3K8MA 5LIKX 1PYMA 3E74A 4KRUA 3UG3A 5JBEA 2CERA 2XYLA 3IANA 3NAVA 1KFLA 2DVUA 4R7WA 3OU8A 4F2UA 1OCBA 4EAMA 2NZLA 3CHEA 1V79A 1ZAJA 4Q7IA 3FYPA 1AH0A 4LS0A 1PS9A 3DN5A 3RJXA 2ZWYA 2WVTA 4R53A 1NP0A 3L4UA 3TMQA 8TIMA 3N19B 2VFHA 4PMDA 2VX5A 1BVNP 2BG5A 4QE5A 3WF2A 3UGVA 1Y5XA 3ZLGA 4QQ3A 4C1KA 2H3BA 4F0HA 5HATA 2NV1A 4LBSA 5A8GA 5HQMA 4YS1A 4MF4A 4Q7BA 4JTQA 3SN1A 1SW7A 1KM6A 3UWUA 4IGSA 4LF2A 3UJRA 1R3SA 3BOXA 4MM1A 5GPRA 2QS8A 2YPIA 3A4WA 1JRCA 1TJ2A 4JTDA 1AK5A 4JN7A 4JIIX 3A3XA 3ARZA 3JRKA 2GUYA 1DWFM 4YHEA 3S5YA 1R9ZA 5DCBA 1LJYA 4ADSA 1DWHM 2DP3A 5IFPA 4ZL1A 3N14A 2TYSA 1R2RA 3FEQA 2PWUA 4FXJA 4C6DA 3GC2A 1OJXA 1G1YA 3MMDA 1R6WA 1JG9A 4TXEA 1GOXA 1XC4A 1FRBA 2QVHA 3NDOA 4IGMA 4L61A 5GJNA 4TMBA 3IK2A 4XZIA 5I02A 4FNSA 4ICMA 4HVXA 2FQIA 4J2MA 3SCSA 3JZEA 3STGA 4FA3A 4GJ1A 1JAKA 5FJRA 3JU2A 2D22A 4U2YA 1JZ5A 3AS2A 4HU3A 1DJZA 3U6WA 4YIWA 2ZZ2A 1TV2A 1ZL1A 1UKPA 1T5AA 3LX9A 1OC5A 2CLOA 2QZRA 3W4RA 4TO8A 3NQAA 1IGSA 1OM0A 3HG5A 3O0FA 2CZFA 3IK4A 5M3WA 4MNMA 3F2DA 2Q8XA 3WMLA 1Q6QA 4CCEA 3EB2A 4GY7A 1QNVA 3QQWA 5AHEA 2QKFA 3MV01 1FWRA 3QY6A 1TMLA 1VBHA 1KKRA 4UFIA 3T9PA 4QNWA 2P10A 4OUEA 3B4UA 1RLCL 4UTUA 1RK6A 3CWNA 4XAZA 2DH3A 1SQ7A 4H1ZA 2XU2A 4AZBA 1O66A 3MSRA 3THCA 1J10A 2Z2AA 3B4YA 2WHMA 4C1NB 4WSKA 2V2DA 2ZZ1A 2J4GA 5C9ZA 4S2CA 1W5PA 1RPKA 3CEPA 2C8NA 4PRWA 4O12A 3ARPA 1EJ7L 1F2JA 4DBUA 2FFCA 2IQDA 1Q65A 3PSWA 4NRSA 2G4JA 2FH6A 2IKIA 4K8HA 3QR1A 5L9FA 2GGHA 3BW2A 2YFNA 3W70A 4RDVA 1DV7A 1KBBA 4FNUA 1WB0A 2TODA 3R58A 1LUCA 1XIBA 1DL3A 3AXKA 2ZKMX 4HK7A 1XLIA 4AEOA 5AC7A 2WNZA 1QNPA 1WAUA 3ITXA 3S42A 3PBWA 1WKEA 1UC4A 1WUEA 3I6RA 4GO8A 2A7RA 3R94A 4AD1A 2ZUWA 1OC7A 3FDGA 4CNSA 1IEQA 2POTA 3U2CA 2QPXA 1XD0A 4OT7A 2JEPA 1X1NA 2AQVA 3B0XA 3MC5A 3H6OA 2WZTA 3ONBA 3AIVA 3LRMA 1OX6A 3KL3A 5A6BD 4M56A 2W66A 1B4EA 2DSZA 2YIHA 1JCLA 3N9SA 4JQ1A 4BCEA 1VRXA 4MPQA 2VGGA 3NURA 3UYCA 1OFEA 1UH4A 4JDBA 2A5HA 4NAEA 3E2SA 2EG8A 2C71A 5EKYA 2GGIA 4LV9A 1YBQB 1P7TB 5C9UA 1ENUA 3MUXA 4DHGA 2VO5A 3W2LA 2DIEA 3L67A 4W7UA 4TV6A 3WL0A 3MSYA 2YXGA 3C86A 3VOJA 3UZJA 1ITUA 1Q6FA 4ES4A 1RBLA 2ZA1A 1CBGA 1K7EA 4EACA 5FAGA 5EBUA 1I2NA 2ZUMA 3W7GA 1X8CA 1S2VA 4US5D 4M7SA 3AZRA 1A3HA 1QNQA 4QNEA 3R10A 2XIIA 3GYEA 3EDEA 1NIUA 1VIZA 5G2HA 1NARA 2YLLA 4KF1A 3GSMA 5LZLA 1BKSA 3DG6A 3AMCA 3GVQA 1B9BA 2VGBA 3QSTA 4ZR8A 3VNZA 1V77A 2W3ZA 3EX4A 3L0GA 3POCA 4GK8A 1ML1A 2O92A 1A49A 3CL8A 4QDMA 2XISA 2E4TA 3OZPA 1AUSL 3DKLA 4ICCX 2E25A 4U3AA 3E49A 1DJIA 1H63A 1GW9A 1RP9A 4FR6A 1NWUA 4IFKB 4IFKA 5EY5A 4F0SA 4FZIA 2V5LA 3VA8A 1KM5A 1MFUA 4X22A 2NXGA 2X30A 1MQQA 1W8GA 4JIEA 1YXDA 5CPTA 1E0WA 3VUSA 2REQB 5ABFA 3TONA 3IVSA 3RFAA 5E70A 4CGTA 3CEUA 5CGTA 3IIXA 3DG7A 2V2HA 3U2EA 4D6GA 3M0LA 3QF0A 4O18A 3USBA 4AY8A 2NXHA 4FX6M 1FP9A 2IPJA 2OELA 3WK1A 4HP5A 3W86A 4JFUA 3CZLA 5D8ZA 1REQA 3GR7A 3LU2A 4KWOA 5D37A 3EKGA 4YXGA 2NQJA 3W23A 4X0VA 3NPUA 3FSUA 4Y7EA 1Q7QA 3SEPA 4NU7A 2VCCA 3UESA 1H7OA 3L7RA 1LBLA 4E8CA 2F6KA 5AECA 1NWSA 1W9UA 3CQIA 4I9JA 4DF2A 2ALRA 3K1GA 1JCNA 3O6DA 2X1IA 2NXIA 4GA8A 1LQ2A 2GL5A 1OG6A 3WQEA 4H01A 3OZOA 4LFYA 2CLEA 4WXYA 4BI7A 4H83A 5CSSA 4CNTA 4L4PA 1XIHA 1AG1O 2PWFA 5I7GA 4FLRA 1E4LA 1U22A 3HPXA 3MY9A 1PJ9A 2IW0A 2PU1A 1KKOA 4PUKA 1ME8A 2DIKA 1VQTA 1J0ZA 1MSSA 4ZO8A 1JF6A 4C6FA 3UNTA 3AICA 3PB0A 2HVOA 1W2PA 1GJWA 6CGTA 4QBXA 1UB3A 2VGFA 1A5SA 3KVLA 1JIBA 3HBLA 3GY1A 3OW1A 3LI0A 3W07A 4Z42C 3LCGA 2WVSA 2TAAA 3OYXA 3ZSSA 1TV8A 1J0IA 2R9RA 4G1NA 3ANYA 1E6ZA 1MVYA 3C2OA 4NJJA 1TJPA 2G37A 3UG4A 8XIAA 3I68A 4E8DA 1NSJA 1SFTA 3GVRA 3RLVA 1B57A 4PULA 3BGJA 3PBMA 2EKCA 3RJYA 2NQHA 1FFQA 3C52A 4PMOA 1IT7A 1EQCA 1XFCA 2ISFA 2W5FA 3ABQA 4ZSTA 3KEHA 4XISA 2BHZA 3L4ZA 5TQLA 1OYAA 3M47A 2ZIDA 5E0FA 5H8UA 3QQ1A 4HN4A 2E6DA 3SI9A 3HURA 3ATZA 4DUOA 3EX1A 2G97A 3TMLA 4UOJA 2OX1A 4QJ4B 3WUEA 3C3UA 1AZ2A 1Q2SA 3N34A 4MYXA 4RPQA 2F6UA 4HU8A 4GLEA 2WPBA 3P2VA 4HOZA 3CH0A 2A1YA 4JTJA 5IHRA 4M82A 3P8IA 3BLOA 3W25A 1KFJA 5FF0A 2W62A 1XLDA 4FP1A 1B2YA 3KWXA 3N15A 3NFUA 2OU4A 5CZSA 1I75A 3PZGA 1A5BA 2CITA 1E1CA 2B31A 5H91A 4M51A 4JQ3A 3A22A 4CVUA 4NZ3A 1E3XA 1REQB 2OWXA 4XZMX 3W81A 3NZ1A 3JW7A 1JVNA 3E2QA 4IISA 3L2LA 3P6LA 3PBUA 1OFPA 4H6EA 3UT0A 1F76A 4HTYA 3G5EA 4RE3A 4JD4A 4AD3A 3B40A 4E3VA 4Q4RA 2CIPA 1XYBA 2XVLA 2XINA 1MXGA 2GSJA 1GUVA 1TJ0A 3NDZA 4UTTA 2DW7A 3H22A 4MZ8A 4WQ6A 5I00A 1T96A 3K13A 1EJUC 1KFCA 1NQKA 4XD6A 3VFCA 2XDFA 2Q09A 2GK1B 2OGYA 4AXNA 2YL8A 3E0WA 2E28A 1H61A 4S39A 4RK8A 3ZO9A 2FGBA 4AHQA 2GDQA 4XX6A 4LVAA 2D3NA 4V28A 4DXXA 2EPHA 3WQPA 1LOSA 3R0KA 1R87A 4AY7A 1F5ZA 2JKEA 1RP8A 4WY0B 1S2AA 4U3CA 1E0XA 1OD8A 1C3FA 1GQKA 3C0QA 1EJTC 4WDWA 4QFUA 4LGXA 1J93A 1FHLA 1E9YB 1HT6A 1JDEA 4ATDA 4E2DA 3BAXA 1XRSA 2NWSA 3GNRA 3S8HA 4E4FA 4MDOA 2P0IA 3ECQA 4FF7A 2P8CA 1GKPA 3THQA 5BRBA 2FGZA 3FDKA 3AS3A 3UZZA 4K3ZA 2OKOA 2F61A 2VUNA 1SMDA 1AD1A 2CC0A 3TCEA 4GVGA 1WZMA 3QV7A 4DAIA 2D2HA 4IMCA 1M7PA 3PFMA 5A8QA 3VZXA 6TIMA 2J25A 2G3FA 5HMEA 3W85A 1GEQA 3C2VA 1M01A 3B0YA 3CUZA 3WF4A 1DXEA 2PDLA 2GK1A 3A21A 1YBQA 3CJPA 1ZNNA 1RV8A 1W6TA 2GWNA 2PWGA 3BV7A 4HA3A 2D2OA 4I5UA 1WOAA 3S5OA 2WLZA 2BBFA 4ICNA 3FGCB 2EJAA 2QCHA 4H00A 5CZKA 1H0GA 5F7UA 1J0HA 4X9SA 1BVWA 4FI4A 3DHFA 4E38A 2X05A 2CETA 1R3YA 4DLMA 1CXHA 2AQWA 1Q4WA 2E6YA 1BVZA 4M6PA 4HSOA 2XFFA 1QK2A 5HJLA 4KWVA 4P5UA 2PAJA 2Y89A 2YBVA 4S2BA 4ZMGA 1ONXA 1H7PA 2O0TA 7TIMA 3RPTA 1H11A 1XIIA 3IV8A 5J5DA 3UXAA 1XYFA 2Z00A 1UD6A 1Q6CA 1OFOA 1NF7A 3H2MA 4LXFA 4GQRA 1K8YA 3UZWA 4LNYA 3D47A 2V38A 1UWIA 3RO6A 3WDQA 3FJLA 3HTWA 3UWYA 4N02A 2Z1WA 3AUOA 1TCMA 3TTSA 1DYSA 2JE8A 1RA5A 3GRIA 3ITYA 3GDTA 3MT1A 3PWAA 1B0IA 2PZ0A 4MY9A 1BYCA 2OZ0A 4POCA 3FEMA 4EOUA 7ODCA 1CZ1A 5HMFA 4XZNX 1AQFA 1CXEA 1XIEA 3K2GA 2OLHA 5DMMA 1CLKA 1E1FA 1WCGA 4JHZA 3DFHA 3PJXA 3TW6A 1MWOA 1F6YA 5IM51 4FXFA 3MWCA 1H0IA 3MPGA 1UMYA 1UPMB 4IFRA 4E0CA 3FA3A 1W1ZA 3NZQA 3NVTA 3I7SA 4MY8A 2WQPA 3UY7A 4MOZA 1TYGA 4ZZ9A 6TAAA 3ZJKA 3PFRA 2YB4A 1JUKA 1ONRA 1YTEA 2CBJA 3TA9A 4LF1A 4MNLA 5MKGA 5DANA 3GG7A 4A3QA 1DHKA 2DQWA 4FF5A 5CG0A 4L4OA 4JTRA 2IXVA 3I10A 3N73A 1YIXA 5BOFA 4YYFA 3NGJA 3SIZA 5LSMA 1TE1A 4UB9A 1OADA 2X1UA 1S5WA 2PTZA 3BG9A 4REQA 5E09A 1X98A 1Y5WA 2F9RA 3TOYA 3V4BA 4NNBA 1C91A 1DWGM 3S9ZA 3VDAA 4A2SA 4S23A 3WH5A 4Q3MA 3QKEA 3W24A 3W7QA 3LZ3A 1MW3A 6XIMA 1NDYA 1EGVA 1VGAA 1Z69A 1RPXA 3ES8A 1LL6A 1YNQA 3LUTA 3AHXA 3PZNA 4MWAA 4NL1A 5A8NA 1MI3A 3RPDA 2J7HA 3N2OA 4A35A 5HJYA 1ZB5A 2W27A 4KCVA 3AU2A 4O13A 3RCMA 2F7FA 2D3LA 1D3HA 3VOIA 1ISZA 1M1BA 4IF2A 3S9IA 3LTPA 1MFVA 1H2JA 3G1FA 3GE7A 4A2RA 4O4WA 3HZ3A 4N6EA 1E71M 1EBHA 5BZAA 1XBXA 5A69A 4PTWA 2FVKA 2OZTA 3IJDA 2EPLX 3CQ0A 4WRHA 2WSPA 1H51A 1RVGA 2CXEA 1L9WA 2YL5A 3LPPA 3PB2A 3DENA 1ADOA 4S3BA 5FCZA 4KETA 1EYEA 4W8AA 4GVIA 2V9DA 3NCOA 5AOUA 1G4SA 1XGDA 3ZT5A 3WQFA 3O2LA 3NQGA 3CO4A 5F2LA 3W27A 4EXBA 4JIQA 1L6FA 2ODOA 4IIGA 2Z27A 2ZX9A 1WPCA 4HHPA 4MSSA 1XH1A 3EPNA 3BGAA 3QGAC 1CB2A 2QLYA 5CXPA 5I0DA 3BAIA 5A8MA 3TNBA 3PJWA 3T05A 2RUSA 5I06A 4IIDA 4NI3A 2WJFA 4OHQA 3WUBA 3VPLA 5HANA 2EO7A 6ENLA 4Y8EA 1VPQA 4C6MA 1EOKA 1R30A 4Q6XA 4JY9A 3KZPA 3ZR6A 1PVNA 3EYPA 1ZSXA 4IPIA 1UW9A 3GG8A 4AHOA 1CNVA 1G0CA 7CGTA 4BQ5A 1UBPC 4BF7A 1O5KA 3N13A 4GIAA 3AJXA 2QULA 4L7ZA 1E56A 1G4PA 3HO8A 1E9IA 4XZWA 2PODA 3C8NA 4GUFA 3T0BA 3OLDA 3TQPA 2PP1A 4O53A 4ECLA 1SZEA 1ZAIA 1TCDA 5CLWA 6A3HA 3IAQA 2CLHA 2YDAA 3QEZA 4K7YA 1XLGA 3M0JA 2PEVA 3QM3A 2ZZ7A 4GH3A 3CUGA 2ZXBA 2QIWA 5JXQA 2AGKA 1KBKA 2V3DA 4C91A 1FHVA 1W17A 2QUNA 3QV6A 1OHLA 3BUVA 1HGWA 5D38A 2OCZA 1B5TA 1HKJA 3UNDA 4GVFA 1AJZA 3CMFA 2JFEX 3CUJA 3W02A 4H9ZA 1Y5VA 3R8HA 1AH3A 3CK5A 1UWTA 3NUKA 4GZJA 1FCVA 1XS2A 5A6AA 1QW9A 4P8WA 3P8JA 4GNJA 4JTSA 4UR7A 4JN6A 4GFIA 1UWAA 4WF7A 4RPPA 1YPIA 5EMJA 1BYBA 4UQEA 2W67A 4KCWA 1QK0A 4PUJA 5J8LA 3WQ6A 1PWLA 2OEJA 1YRRA 4NF7A 3W1QA 1AA1B 4B5VA 3GHSA 5DX7A 8RUCA 3PAOA 2HZGA 2FH8A 3BE7A 2PP0A 3PHAA 4IX2A 5CPOA 1UWQA 1MUMA 2Y8KA 3EDKA 4H04A 3NO5A 3HA1A 4JAWA 3UJEA 3P60A 3P93A 4M0XA 4O57A 1TVNA 4RL3A 2VRQA 3QBUA 2IKGA 3QFWA 3O06A 2DZTA 4NYUA 4F2BA 3EA3A 3VOCA 4DZ5A 3DFTA 3PC0A 5LXXA 1FH8A 1FVPA 3K4DA 4HOXA 3MANA 1P5BA 1ZALA 2CYGA 3CMGA 4HNTA 5ABEA 3BQ5A 4TVDA 1XKYA 2QDHA 3CHDA 2Y63A 4PUMA 2TRSA 5T8GA 2HQAA 1F3XA 1I45A 4PB5A 3C2RA 3WQGA 3W2NA 3CO8A 5A5WA 3ZT6A 2CZVA 2DVTA 2NVAA 3B9DA 1GVFA 5TBOA 3VKCA 1AQHA 1CGVA 4IT1A 3H54A 5HAOA 1FHUA 1XISA 4AZ5A 3L0KA 4KERA 3BOFA 2GOKA 3FAXA 4XTDA 1Q66A 1LRTA 5HQEA 3VXGA 1PWMA 4A21A 1NTHA 2XH7A 3LOTA 3LXAA 3AC0A 4B3LA 2IPFA 1NWRA 2VQUA 2OYLA 2DEPA 1ECQA 3QY7A 4RE0A 4DJDC 3ARUA 1HQTA 2HDJA 3M46A 4MVAA 4EXAA 5HR7A 4HNVA 4EXQA 3RPMA 3LGGA 2EG7A 3D46A 4HHMA 2QJMA 5BXPA 7TAAA 3P62A 3W00A 1SFLA 1W91A 3PZVA 1B1YA 1TRDA 4M5PA 2RH9A 5C54A 1EDGA 4UTHA 5HWJA 3CV1A 3LM7A 4O4VA 1G4EA 3S2MA 9CGTA 3VNLA 3TKFA 4CU8A 1DHPA 2ATSA 3SGZA 1BG4A 3BH4A 4DBWA 2OXNA 5E6ZA 1DJWA 5DXXA 3REQA 3E0LA 3NQEA 4DUWA 2W91A 3GXMA 4J4KA 1XXXA 4EAYA 3LK6A 5BYWA 3QFEA 1IEVA 1XC6A 4ORIA 3NQMA 4Z2LA 3VIJA 3UETA 1XDJA 2J74A 3LS9A 4IQEA 5I3DA 2J7BA 4UFLA 3VD7A 1UP0A 2DZPA 1BYDA 1GOWA 4O1EA 3WJSA 4Q8MA 4WY0A 4LH8A 4X9YA 1V08A 4S3EA 2Y1HA 3EBVA 2A0NA 4EANA 1EL3A 2VURA 2TSYA 1C92A 1H50A 4GI4A 2V67A 1TKKA 2IQ0A 3QC3A 3PJUA 4CCZA 1BRLB 3CS2A 1F9CA 1H41A 3LCHA 3TA6A 2ZQ0A 3WQ4A 1LL4A 2B7PA 3F4DA 3TZFA 3SGUA 1RD6A 4REQB 2J27A 2IMRA 4XIAA 2H8ZA 3WG6A 1V0LA 1SM9A 1RD5A 4AG0A 3IUHA 1PBGA 4YVVA 4FR1A 4I5XA 3AAMA 1AVAA 1GQLA 2X41A 3GFYA 3OG2A 4J3TA 3KBWA 1J01A 5FAJA 1X38A 2FDMA 2J66A 5C9RA 2FVLA 1P6WA 3E1F1 1EWEA 3GDBA 1IZJA 1XH2A 2FLIA 3FXYA 1O5XA 3W7OA 3LLFA 5CJMA 1EEPA 1Y8BA 4JFTA 1XI3A 4PZVA 1J0JA 4CQ9A 2YXOA 3G3DA 4KRTA 3AMLA 1JFXA 3TC7A 2V81A 4JL2A 3PBYA 1EXPA 4GXWA 4IGNA 4WJ8A 4GMEA 5I03A 2VP8A 3SGGA 1LQAA 3NL6A 3NQDA 1UASA 3K4AA 4GX9A 3RX4A 4NZFA 2Y7FA 2G0WA 1OGGA 3SQLA 2YCJA 3P5YA 1PZ3A 1VHCA 3SSZA 2Y7DA 3BLLA 2O56A 3QYSA 3GDKA 4UNIA 7PTDA 4EF9A 2PDHA 2WVVA 1V02A 2WLYA 4PCFA 4WGHA 2DZBA 5G5IA 2EJ1A 4HD5A 2DT0A 3TJ4A 3N2TA 1K1DA 4F0MA 2ZRWA 1WKDA 5F4XA 3MVIA 4IMFA 2BHYA 1U2YA 1ZCCA 1XQKA 1W54A 1YXYA 3MMWA 4LALA 3W7DA 2J79A 4N9EA 5CJ5A 3CWHA 3DIPA 1OFBA 5HINA 1DE5A 4RDWA 5AYYA 2OWWA 4E3TA 4KEUA 4K68A 4XBKA 2QPSA 4PMYA 4E2BA 4V1YA 1PZ1A 3EMQA 3RX3A 4DWSC 4MKVA 3OB8A 2UY3A 3LPFA 4JEJA 3AS1A 2HBXA 1ALDA 1M04A 2WCGA 3NEVA 2Z6JA 3BZJA 2OSWA 1HN1A 1F4HA 5FEZA 3DEQA 1F6PA 4HZMA 5DT7A 3P67A 4DUXA 1EZ2A 1GKRA 2XFRA 3UZ5A 2ZZ6A 3NJ3A 3I3EA 4B92A 1JD9A 2Q71A 5EMUA 2Y2WA 4A8RA 4I8YA 5H1WA 5DY3A 2Y8UA 2YSWA 1E6PA 4ZVJA 3M64A 1EP3A 1ISXA 3WLPA 2I5GA 2E8YA 3WD0A 1L6SA 4TX8A 3S2LA 3GH7A 5ECVA 1P0KA 4H7VA 1NF0A 2ZXAA 5EL1A 5HJXA 1J2BA 1QT1A 2NX1A 4IIFA 1GCYA 4V2XA 4NJKA 2EG6A 4PMZA 4LCQA 4DJEA 1MRQA 3IIVA 1WBHA 2A6LA 3LTSA 2YBTA 3PUDA 2DDXA 4QRNA 4AUBA 4QS6A 4MWAD 3M7SA 3CAWA 2REQA 1PTAA 5ABFB 2INFA 3W6YA 1PX4A 5ABGA 4DN1A 1EF3A 2ACQA 4LAZA 2ZDRA 1L6GA 3TXVA 4NAEB 3I6EA 3BCDA 1PIIA 3DYPA 1NFGA 3IUIA 3KBNA 3V0SA 2P8BA 5JBFA 3WEZA 3I6TA 5FF2A 4Q4QA 1W8SA 3M0IA 2A3LA 5FI8A 1DJHA 3NQ7A 3G2GA 2VDHA 4TQTA 2PDPA 3LG3A 4LT9A 3ARRA 3NXLA 4ATLA 1KBJA 3NNTA 4JBRA 4O14A 4MLRA 3OBAA 3TZNA 5G4EA 1ICSA 2BASA 1R2TA 2Z1KA 4V15A 1G9HA 3AWOA 3MP3A 1DJNA 1JEZA 2X09A 3JS3A 5FJPA 3ARXA 1OZMA 2QIIA 2YW3A 4G9PA 1FWCC 3UJFA 3B8TA 2GYIA 1OEPA 3WJXA 1W32A 1SPQA 3TFCA 3KOWA 4QISA 4HSHA 2DPEA 4P7LA 3QY8A 1MW1A 3S2NA 1JI1A 2QJNA 3A23A 2QCDB 3KZSA 3PNZA 3WLHA 5AC5A 5T91A 1JFHA 2FHCA 3GXDA 2WJZA 2BP1A 4UQBA 3OVGA 3D6NA 3VC5A 1VFOA 2NQ9A 4D6JA 2I7GA 2I57A 4I3GA 1XLCA 2DSKA 1XGEA 5F1VA 5GNYA 2VELA 1VFMA 2DSVA 2JIEA 5I3IA 3MP4A 1TZZA 3ARQA 1WZKA 3O3RA 1PTGA 4UIOA 3TXZA 3LD5A 2VVSA 4QITA 1G69A 4OZOA 2H9AA 2OB3A 3F2BA 1AD4A 3ZVIA 4H2HA 1S38A 1W2VA 5A3HA 5I2UA 4J3WA 1KM0A 4OKDA 2Y62A 3DBNA 4LUSA 1H3GA 1UA3A 4WKAA 2C0HA 1JPDX 2VC7A 1W3IA 3O6AA 3ARWA 5T26A 4MJZA 2OT1A 2FFIA 2CNCA 1TB3A 4M80A 1AQ0A 1LP6A 2YLAA 1V51A 3WBWA 3GD6A 2ZRXA 1WZLA 5C9WA 4MZ1A 1IYXA 1E6QM 3QPZA 1V3KA 3P5ZA 5AZ0A 2J24A 4URIA 1IQ8A 2VZVA 3I65A 4BY3A 3CYVA 3ZOAA 3BJFA 2DUXA 3MVTA 4F79A 4XV0A 1M3UA 4H9XA 3O6YX 1W3TA 3CH9A 3UR2A 3N29A 3T55A 3AXHA 3PUGA 5J04A 1ISWA 5CC5A 3G1AA 1QI3A 2VFEA 5DCDA 4MZYA 2WZHA 1UP2A 1OY0A 3ME3A 3QLDA 3SADA 5AYXA 3TU9A 3ITVA 4FIRA 4D72A 1BF6A 4XD5A 1XL9A 4TIMA 4V27A 3UG8A 3MWAA 3AI0A 3BURA 2G3IA 1VLIA 2OQHA 3B8DA 4XO6A 4GKLA 2VC6A 1DTUA 3T4CA 1G67A 3VNKA 3RLHA 3GIQA 4MIMA 3SN0A 2JF6A 3KOFA 3CUHA 5DT5A 3KDNA 4K6AA 2Y0FA 1JRBA 3ABSA 3LEPA 1YDNA 1CXLA 4Z17A 1K03A 4DJEC 4ZOCA 1TZ7A 3GNPA 1I2OA 4DBSA 1L8PA 3JZUA 5E1QA 2C18A 4DF1A 4C90A 2H8XA 3EWDA 3L23A 2A6NA 1A5KC 3DXIA 3OLIA 1YNYA 5EFFA 1LWHA 4O1AA 2GFTA 5KZDA 4WX2A 2OVLA 3GU9A 2Y6ZA 4ZOAA 4O1FA 1HKKA 2VOTA 2R1PA 3NDYA 3PPFA 5T9CE 3FKRA 4ZB5A 2J8FA 3S46A 2WMKA 5CGQA 2ZX7A 3H24A 1ZJBA 3QZEA 1NU5A 3UWEA 3KCJA 1V7YA 1Z8AA 3M6YA 1A5AA 4DZIA 3R13A 3TFXA 4B4FA 4E6MA 4HMEA 2TPSA 4CN1A 1VFSA 1CGUA 2QF7A 3WBEA 1TO3A 4L1XA 4JR5A 3GG0A 1XIGA 3APGA 5D09A 3CV6A 2QR6A 2XWEA 4MHBA 1GW1A 1VFTA 3N2MA 1TV4A 2NLYA 4GQBA 2RDTA 4XVDA 1E6RA 2G8ZA 3VTRA 4GCXA 5A6KA 1W1PA 2DZUA 4DXKA 4YNGA 5GVJA 4AZCB 3TROA 1TJRA 4H8NA 5E9XA 1R3RA 1FX6A 3NZPA 2X7WA 4S3DA 3VIFA 1Q6EA 4MLJA 1A50A 2BY0A 4Q8WA 3LZ5A 3CQJA 1G7UA 3LCFA 2RDUA 1HL9A 3WMCA 4E2OA 3ARSA 1YMYA 3AYVA 2X8RA 3H2EA 3PG8A 4A3RA 4I8DA 2ZZ5A 3VNIA 5GJPA 3T07A 4J3UA 4M29A 4N4QA 4FOUA 4B2DA 1NVMA 1GYNA 4N9CA 3N2XA 3O15A 3G22A 3FYYA 1EUAA 5EU9A 1OF6A 3K4WA 3GU2A 4R3UA 4AZGA 2O7QA 2WVUA 2WVVB 5I77A 1XH0A 1UBSA 3PZQA 3C3NA 3R0UA 5FEXA 5C7VA 4ZXLA 4A3HA 4IJCA 4NAFB 3N04A 4JTLA 2Y24A 2YZ5A 3TYDA 3E2VA 3SR7A 3GB6A 4X2RA 3UWZA 4GYFA 3VNDA 3FA4A 2QF8A 3P74A 1TIMA 1V8EA 1BGAA 4A8LA 1R85A 1FWBC 4AVOA 4GXMA 3HFYA 3QPYA 1LBFA 1KLYA 4ZQCA 1S46A 4ZQRA 1QNOA 1Z48A 5HPCA 2VRKA 1T0OA 3FN9A 2NV2A 3VAVA 4TMCA 1GG0A 1VPXA 4A6GA 1XM3A 1US2A 1V0NA 2E6AA 4BHYA 4IUGA 4NNCA 5G2WA 1QHOA 1W1B1 4NSBA 4O1CA 1QO5A 3P81A 4DIAA 4E4PA 1NFPA 2R82A 1GK8A 3QZ6A 4W7WA 4ROPA 3B9AA 4DYEA 2POZA 2O4QA 1IIGA 4LNCA 1OK4A 3A4JA 1UG6A 1S5NA 3F5LA 3OGRA 3VX1A 1R2SA 2J8GA 1OZQA 1EJVC 3W1MA 4YN5A 5I3GA 3TW7A 3UJSA 2YFOA 3WNLA 4LCRA 3AIQA 1SJAA 4B9ZA 1E70M 5GNXA 3F4CA 3H2CA 3BLKA 4AYGA 2V5KA 3K8LA 1FH7A 4GYJA 1TPFA 4LANA 1LLOA 3MKKA 3KX6A 2E5CA 4PMVA 3GKFA 1VJSA 1XPGA 1M6JA 4IPJA 3GO2A 3II1A 4GQGA 1JPMA 1W3KA 4Q4KA 4M8UA 2XIJA 2ESCA 4W85A 1KRBC 4FLQA 4YVPA 3HN3A 3TSMA 4JHOA 4D6DA 3W1XA 4EF8A 2NQLA 2FZMA 2PDKA 4W9TA 5KEZA 5IHSA 4DJFC 4UQDA 3U57A 2GVEA 4Y2WA 3GW3A 2Z1XA 4NNAA 3RRAA 4ZEPA 2OYKA 3EDFA 5DO8A 1QOQA 3CL6A 1P0NA 3CGTA 3IGSA 3T08A 4S38A 1X6LA 3TTYA 4ZENA 4Y9AA 2RKXA 2BY2A 4RDYA 1BXCA 1LT8A 3GH5A 1BGGA 4LYRA 1K8CA 2PDXA 2UWFA 2QMKA 2ZZ3A 1NH6A 2WQDA 4Q8OA 1FHDA 1GOQA 1SO3A 4Z2HA 5DQPA 4GPNA 2BGQA 3GC4A 4JQAA 4E4UA 4KKXA 3CPGA 4IGHA 4GCAA 2WCSA 5A2BA 3ABRA 1VYRA 2EAWA 4UCFA 2WM1A 2WKGA 4C6KA 1ZY9A 1C8VA 1Q6GA 3BLDA 3A9BA 2QCMA 1H4PA 3WLKX 1KFEA 3HQPA 1JUEA 4MWAE 2QEZA 2Z26A 3ZLFA 1GVSA 4LY8A 4WLCA 4ILSA 2XH2A 3WH7A 1GOKA 4UTWC 4QP0A 2ZUTA 1H1YA 3KVJA 2J7GA 4MTVA 1R3VA 3RU8X 5FJJA 4UQAA 4D6FA 4GIEA 3PY2A 3ITTA 1A4MA 3OVRA 3QR3A 4NASA 4LCSA 1HVQA 4PE8A 2WMIA 1GPWA 2BFGA 1TVPA 5K4XA 1YDVA 4NRRA 3VIIA 3PBGA 4QM1A 4US6A 1BAGA 1OSEA 1S5VA 1A80A 2DZXA 3GK0A 1UQYA 3MW7A 4MFDA 3UFYA 4U10A 3SRFA 4GVHA 3SUVA 4L6HA 3UP8A 1IE7C 3S0CA 3QVQA 3V5CA 3CHVA 3TSBA 3ONCA 3M0VA 4HB7A 4QE1A 1C9DA 4DY1A 1VFHA 5E0CA 4CU6A 2V5BA 3LBMA 1Q6RA 3MJYA 4Q4OA 2F2KA 3FJNA 1TPVA 2A85A 3WQOA 1A3WA 3AYTA 3L2IA 5K4ZA 4FB7A 3LB0A 4L6OA 1EB3A 1PB0A 3N2BA 3M43A 3VO0A 1P1XA 3AIBA 2C1GA 1SW3A 3B0PA 2E1WA 3L12A 4UBPC 3SJNA 1US3A 5XINA 1XSIA 3BLPX 4KWUA 3U7BA 2HNHA 3OIHA 5CBIA 3LBOA 3MA8A 3ABXA 4C6CA 4QG9A 5K2ZA 1DVJA 3MKVA 5JU6A 1R3QA 4AWEA 3WLSA 1OCQA 4TX9A 3WH8A 1FH9A 4WVXA 4I6VA 2PTDA 1L0PA 2O55A 2X7VA 4B9YA 1BHGA 1R38A 2QDEA 1T40A 5M2FX 3WQ5A 3GNXA 1CW2A 1M68A 3FJ4A 3WJWA 4KCUA 4PBGA 4IM4A 3GFXA 1UJQA 1HXJA 3VNYA 1GVRA 4PR4A 3W2UA 4I90A 3TWAA 2PGFA 3WUGA 4WZHA 2D24A 4Q32A 3NVDA 1HP5A 5LGXA 1N8WA 2PTYA 4KEZA 1WUFA 1SJDA 2OJPA 1YDOA 4I7VA 1ZP4A 6ALDA 3MZNA 6REQB 5A1AA 4DO6A 1KFWA 4QCFA 4BQ4A 3IPWA 2V5CA 3ZWTA 4QTGA 2DY3A 2CW6A 3SURA 1QVBA 1FWDC 3TTEA 5LNVA 3GFZA 1QHPA 2VEFA 3LRKA 3T44A 3NL2A 2ZRVA 1TMHA 2XIMA 1U30A 3PR2A 1HJQA 4B16A 3SCWA 3RMJA 3FIGA 3P80A 3CZEA 2YCLA 5AB3A 1SO5A 4XG1A 3V18A 4HQVA 4F0LA 2QNEA 3N6HA 3TP4A 5TAOA 3DGRA 4Q8VA 3OVQA 4M19A 5L6UA 5LA0A 1PKNA 5CC7A 3F1QA 3P84A 1EZWA 3QOKA 4FLOA 3GHUA 4GH1A 3QH2A 1UKQA 1IXOA 2VMFA 4ENLA 1WXZA 4D2JA 1P43A 4LC8A 3VNMA 4O8RA 3WFAA 3EWCA 2D0FA 1Z32X 3DG3A 5KZ6A 4OBRA 2Y7GA 3CL7A 3TTOA 2WMIB 4GG9A 1NFBA 1U5JA 2ZC1A 1F4AA 3PZIA 3TLLA 3RDKA 4Y8FA 3A47A 3MCNA 1QJWA 3O16A 4Z1BA 3WEMA 2AAMA 1EC8A 4JYFA 2O9PA 2Q8ZA 4GC4A 1KGWA 5EBAA 2WZEA 4UTKA 3PTMA 1LBMA 1AMKA 2RGMA 1W9PA 1WQ5A 3WLOA 2Z28A 4HTBA 3S1XA 1WDPA 2PDJA 4ACZB 1VENA 1X39A 3OYZA 1B4KA 4JX5A 4UTFA 1TR9A 4RV8A 2X2YA 3V7PA 2WSQA 3WK2A 3INPA 3CIXA 3OO2A 1W5OA 1PV8A 3QOMA 3QGVA 4AF0B 3GDRA 3QGKC 3ZLHA 2PDYA 4WJEA 2HROA 1RBOB 2V6AA 1NY1A 4P8XA 4IMDA 2ZVRA 4KQNA 4QEEA 2WMHA 2GVGA 1IEXA 2VX4A 3MI3A 4FPSA 4WKHA 5DF0A 3CUIA 3TNOA 1HKVA 1U33A 4YPJA 1QTWA 3QKZA 4QCEA 4LJ3A 1DWAM 3Q45A 2E5BA 4GWEA 3EWUA 2G96A 1DIOA 1FXQA 1LYXA 4HJFA 4N7QA 3RK8A 3T2PA 4JKKA 4DZAA 1NP2A 3KOYA 4PEEA 3TJXA 4EPBC 4HPHA 3G0UA 2R1KA 3WFLA 3BICA 3W73A 2CLFA 2BX7A 2BNJA 1T41A 3LV5A 5C70A 3IJ7A 1ZP3A 1W1VA 2XIOA 3WDHA 2BVTA 3P61A 5A95A 4IPPA 1YTDA 1LOQA 3DHPA 3OEXA 3W2MA 3S47A 4AFYA 2ZUNA 1D8WA 2RJGA 4U2ZA 1EFZA 2UY5A 1NDZA 3DHUA 3VZYA 1OWQA 1E0UA 1R86A 3M0KA 2X40A 3A5VA 1W5MA 3RM9A 4AIEA 1GORA 1LZOA 4MB3A 3PUOA 3QQ0A 4CEXC 4AD4A 2C79A 4AMCA 4LS1A 4N0RA 3TIMA 1M7XA 1QDSA 3JVAA 3HG4A 3RCYA 3RN6A 3W75A 3A3HA 1U5VA 1VBJA 1C7TA 1VRDA 1O60A 2ZUUA 2AKMA 3S3GA 4BS0A 1PUDA 2YOCA 4XBSA 4XKYA 4D1IA 4TU1A 3VD3A 2GJNA 4KWWA 3WK0A 4QAIA 2PDGA 3B06A 2EF9A 1JNDA 3TVAA 4YHGA 4PSPA 2UY2A 2PDUA 2VT0A 4OE7A 1OVDA 3OPSA 5G1MA 3MSDA 1V6YA 2E3ZA 2WJEA 3KL5A 3E02A 3CAQA 2Q8LA 3AJ7A 4KH2A 4GGHA 5DMNA 3VX0A 3F03K 5G1TA 2A3HA 3UBPC 3W37A 3EGJA 1TVLA 1HJXA 1R5YA 4W5ZA 5LGZA 5BMXA 4ATWA 2PTWA 3BCJA 2C1HA 3U9IA 4LYPA 4NZ1A 1UIPA 4S3KA 2C15A 3KRBA 1QNRA 1HIZA 1H62A 2JBMA 3W22A 3WKZA 2EHHA 3M5VA 2ZA2A 3O7UA 1E6NA 1SFJA 3SECA 1PX8A 3QC0A 2AL1A 5HR6A 4M6VA 4RE4A 1XLEA 3O8AA 1HVXA 3KUMA 5AYZA 3TOPA 4QR6A 4UOQA 1T6MA 4PUWA 1E4IA 3EXSA 3CUFA 5JIPA 4CD8A 2GQAA 3MMTA 2DFAA 5I5RA 5A6JA 1X6NA 1NOWA 3RO8A 1WE5A 4XTIA 3TDFA 3VKAA 3S5NA 1TR1A 3A4AA 4NYYA 1CECA 1LLZA 3B8WA 5C9XA 4W88A 1WOBA 4LQ1A 1KM1A 2O9RA 4LUYA 2GQ9A 1GNXA 3B03A 2PLMA 4G6CA 2ZRUA 3GVGA 5KITA 4WR3A 2VWSA 4Z2JA 5AVNA 4XZBA 1ICPA 4LEQA 3T0DA 3WQCA 2F8QA 4NVTA 1E1EA 1XHGA 4GFSA 4EWJA 4DWSA 1H1NA 3BAKA 4O19A 3S83A 1W56A 4R7OA 5CSYA 1XLAA 1K9TA 4DX3A 4CD4A 4BF5A 4AISA 1TTQA 3CNYA 4C6PA 3HMCA 3H70A 3WYZA 4O15A 1S2WA 1B30A 1HJSA 2VVNA 2WJDA 2P1FA 4KW2A 4DJFA 2BS9A 2CLLA 3OVPA 1KW1A 3H7RA 3THUA 4TR9A 1V3LA 2C6QA 4HZ6A 4ZTYA 4AB4A 4AF0A 1V0MA 1HGYA 4GQ0A 2BSLA 2Y5JA 1XINA 1V5XA 4QLKA 1QOXA 4UMAA 5E0KA 4QG6A 3CB3A 1HZYA 3DFOA 3T7VA 3B04A 2BV9A 3MDWA 1I6NA 4Y9OA 2BXVA 4DXVA 3VGFA 2IS7A 1DTNA 1WYIA 2I17A 1KC7A 4NT0A 4QAWA 5G2IA 4PMRA 1TA3A 1CENA 3KTCA 1XWYA 3RM4A 1DKWA 3LYEA 1H7WA 4JIPA 4ZO6A 1V6UA 3DX5A 5CLTA 4HGXA 3AO0A 4HK5A 5ABHA 1UOZA 2FPVA 3F2CA 1H5YA 2PDCA 1XD1A 2H9AB 3N12A 1QPQA 3ARVA 4TVCA 2PB1A 2GJXA 3WQWA 1XFBA 1PDYA 4LEFA 3N4FA 4F48A 1N8FA 3LHTA 4DNMA 4PC8A 2NT0A 1VYPX 1DXFA 3OTRA 2PDIA 1TPUA 3CTLA 4A3YA 1QU4A 2PRLA 2R14A 2PP3A 4D1JA 3UGRA 2OO6A 1EA0A 4WSHA 1SR9A 3ZT7A 1JZ7A 3GR8A 3GXNA 1SU5A 5CC3A 2X1SA 4PCTA 1YE6A 1TWDA 4M7TA 3WLIA 2WC7A 1ONEA 1PKYA 3EEZA 4MNJA 1E51A 2PDMA 3V16A 1QPOA 2OG9A 3VI2A 4IJBA 5HA7A 2YGYA 3WL1A 4B5SA 2JGYA 4OU1A 1F8MA 5A8PA 1ESWA 1W3JA 3S2JA 1DEDA 5TD4A 3W1AA 1XBVA 5AFDA 3BPWA 1OYCA 3SDOA 1VBGA 2DUZA 4NXKA 1SGJA 1E72M 3U5UA 4Z2IA 1UD3A 2OKTA 2ATMA 3NM3A 1IR1A 3A13A 1FFRA 2GJPA 4QLJA 3N6JA 1XLLA 4B90A 4W5UA 2PTXA 3UR5A 4UZUA 1EPXA 2QV4A 2FHBA 2HCVA 1K6WA 3ID7A 1AODA 1DJQA 2QT3A 3BAWA 2PFHA 4HNUA 4B3ZA 4KESA 3EZ4A 3WJZA 2OOFA 4EIVA 5CC6A 1AH4A 3UXDA 2E1DA 3BLFA 1CT5A 3P82A 3TTQA 1XV8A 4NJGA 4OV4A 3U3HA 4UNKA 3PTDA 3TYEA 4GUHA 2VTFA 4P7QA 1VF8A 5D2WA 5C8BB 3LHWA 1TA3B 4B5UA 3TC3A 3G1RA 4LSBA 3URBA 1WKFA 1A5UA 4V33A 1LWJA 3HOJA 4UTLA 3SCTA 5BXRA 5PTDA 3BARA 3GXPA 1OX4B 3L4XA 2WC4A 2XUCA 2GDUA 1NEYA 3KOXA 4ORMA 3CZKA 1MW2A 2XPKA 4UMBA 3M07A 1G4TA 3TUUA 3DUGA 2Q3RA 3E96A 2ZZ4A 2PZNA 2YCKX 2W6RA 4AU0A 1V4YA 1OGSA 1GOMA 4IPNB 4IL0A 4JN8A 1C8XA 2Z6IA 1QBBA 3UQNA 3WIJA 1VP5A 2OMAA 4L9YA 2PWVA 1BTCA 2YL9A 2PBGA 3B9NA 2XTKA 3VMPA 4ZFMA 3STPA 4OBSA 5F4WA 1O12A 4DO5A 3R5EA 4C5YA 2BVWA 4WY0F 2CHOA 3GM8A 4DWSB 1S5MA 2RDXA 1UOKA 3BGGA 1FCQA 4M1BA 1KFBA 3PF3A 1N2VA 3GH4A 3W6MA 5A6MA 4JS3A 3ANVA 5CJNA 1JCJA 3L2MA 4AIBA 2EGZA 2XM1A 1KRAC 2CBVA 1MEWA 2QCNA 2D1ZA 2GOUA 4OIFA 3XISA 4S1FA 3UW6A 3ATYA 4QSHA 1BSIA 2PD5A 1UC5A 3FVMA 4Z2KA 2DU2A 3HGSA 3FKKA 1WXYA 2CZ5A 3N3MA 1QW7A 2QJJA 4GY0A 1PAMA 3TJLA 4DUVA 3XINA 2J75A 1IXNA 3OIXA 1CLVA 3BV4A 5C0QA 5F4SA 3S1VA 2ZDSA 4F3HA 4LOCA 4HU0A 1E3ZA 1TWWA 2P50A 4PL1A 4Y6GA 1I1WA 3UF9A 2AL2B 1PCKA 1E40A 1JXKA 2VFDA 4WUIA 2E8ZA 4XBJA 5CZTA 1PSCA 4HJWA 4H9TA 3T42A 1UKOA 4IG2B 1A5CA 2C7FA 3LM3A 2ZBTA 1LORA 4JNYA 4DEFA 2OLAA 4AXKA 3KHDA 3GZAA 3NM1A 1JQVA 5DRIA 4KFPA 2ANUA 1QI5A 2YYTA 1AJ0A 4GZEA 3WY1A 4B15A 3GHRA 2WV8A 5HXMA 1JAEA 2VX7A 1F07A 4JTAA 4H2CA 1GVIA 4HPGA 2R1NA 2VENA 3HQNA 5REQA 3OODA 1AQMA 4GBDA 1XX1A 2PLJA 3MUY1 1P7TA 1U1HA 3TN4A 2I9EA 3GQYA 3E12A 1S2UA 3N4AA 3O6CA 2QCGA 7ENLA 3GIPA 3KVMA 3C61A 3UXKA 3BG3A 2E9MA 1D3GA 4LS2A 4RV3A 4RJEA 5A6BA 2O9OA 3DI1A 3WSUA 2NUYA 1V03A 5I6SA 2CBIA 2H6RA 4ZODA 3T1GA 5MF5A 1XIDA 2WO5A 3EX2A 4L80A 2QAFA 4B5TA 3V0UA 3G1DA 3AXIA 3ZIZA 2RDWA 2X42A 1K8ZA 2D20A 1L6YA 1HP4A 4ACYA 1WDQA 2J7DA 3OGVA 1KB3A 1XLKA 2WBGA 3G8RA 4H7ZA 2X0HA 5A6LA 1K02A 3NR0A 4PCSA 3W71A 3SSJA 4G7FA 3LN3A 1CYGA 4LAMA 2IPWA 1Q63A 1FQ0A 2ZX8A 4G1KA 5IRPA 2X0YA 4Q8NA 3I7RA 3P0XA 1GOIA 5CPQA 4IUOA 2FZ8A 2CLKA 1QASA 3UCCA 3ZWSA 2VR2A 1ITQA 3F5JA 3SCQA 3WJYA 4WJXA 5DBUA 1TPB1 2HK1A 5A6TC 3G1VA 5ENLA 5D9NA 1HO4A 3R25A 1JCTA 1CXIA 1KCZA 4ZFCA 3LLDA 4H3DA 1ZUAX 4DB7A 5E9AA 5E5CA 3BW4A 3WBXA 3W7HA 4WK9A 4AX7A 5K9CA 3H55A 4YTUA 2AQOA 3M6DA 4ML9A 1PZ2A 3BTNA 4LVFA 1YLVA 3AQUA 3KBVA 3ITCA 1TQJA 3SW6A 1UZ1A 3W29A 2Y70A 2NV9A 1EHNA 4QS5A 2HXUA 4DLFA 1LRNA 2HTMA 4CQDA 1VHNA 2CPUA 4R34A 1B3XA 3BC9A 5C55A 2ZWZA 4C7GA 4TVUA 3PPGA 3EB4A 1K9DA 1RUSA 2CWNA 4MYAA 5CH9A 3HV9A 1H7XA 4MMWA 4HK6A 2D69A 3AYRA 1RK5A 2D0GA 5I3JA 1JZ4A 4UMCA 1FWSA 2ABBA 2WANA 1Z3NA 3H21A 2YXXA 3CZ8A 1M65A 3V5OA 3FYOA 1IXQA 3QYQA 2O4MA 1VBUA 1XICA 2NX9A 3OLGA 4XK2A 3V75A 2VXNA 4J3ZA 9RUBA 1RLDA 3AHZA 4JICA 1QI2A 3N11A 4GUIA 1RY8A 1J2WA 1GGOA 3GAYA 1EIBA 1OFQA 1B3OA 1TPWA 4KIEA 4PTDA 5CGMA 3SY8A 2J7EA 2QDDA 2WW5A 3H2NA 4QJ5B 3W7NA 3WNNA 1S39A 4L64A 2XG9A 1SSDA 5HQLA 2GLKA 4HMCA 2V0TA 1FDJA 1XSKA 5GQBA 2V3GA 4G56A 5KZEA 1UKSA 4DM2A 4L1GA 3RLGA 4P2VA 1YNPA 3RU6A 1FBAA 3CYJA 1Q7ZA 2PLCA 4K37A 3VMOA 3SUUA 1BFNA 2QJIA 3LCLA 1UCWA 4JFVA 5AHMA 1Z44A 2XSAA 3VNJA 2VZSA 2PU0A 3VDHA 2ZUVA 2GVLA 1LG2A 4PTNA 5D2YA 3EWZA 1MW0A 3VKBA 4NIRA 1SW0A 4IP4A 3NQVA 3BDKA 4D6CA 5HMDA 1K77A 1UR0A 3W88A 2WNNA 1R46A 2MANA 3Q65A 1B90A 3KAOA 3T6CA 2FB3A 1V6VA 4D9PA 4DWDA 3K5XA 3WUFA 5E93A 2WSRA 3PSVA 1JZ8A 1KD0A 1FCBA 2PC8A 1RR2A 1XRTA 5AZ1A 3MBDA 2QCCA 4LPCA 3Q67A 3EDJA 1R9YA 4UOZA 4Q4PA 2EPNA 3S5ZA 1ZZMA 1VEMA 2QUTA 1J5SA 5FEWA 2XSBA 5LIWX 5FESA 4J9JA 3OP2A 3PTKA 3W1UA 3WLQA 2FKPA 1EUNA 3VGBA 2OTDA 5HNNA 4AD5A 4AHPA 5D2VA 3W74A 5C71A 3SFKA 2ON3A 3SUWA 1MZHA 4JGDA 1EQPA 4ZB2A 2WZMA 2QMJA 3KBJA 2BWGA 4RKAA 1QWKA 4LAKA 5FF3A 1XLFA 3BWWA 3MYPA 1XR2A 3PG9A 4JTTA 3WD3A 3S1UA 2A79A 2UV8G 4BKNA 1ODZA 3DC0A 4RCXA 4Z1AA 4Q8PA 1QFEA 3TYZA 4DJDD 5C6MA 3HU7A 1LROA 1J0KA 1V6WA 1TZ9A 3UXLA 3K1DA 3MCMA 5IDIA 1SZGA 1W1YA 1GQIA 4CCDA 2Z7GA 5HUOA 1E1CB 1LQ0A 1IEIA 1D7FA 4LY4A 3UD6A 1XPYA 5HWNA 4KEMA 1KRCC 1VAHA 1OK6A 3ZS4A 3DYOA 3F7JA 3W7LA 4AY1A 4PSRA 1W1TA 3A12A 1DP0A 5ABTA 1GHSA 2CWXA 1I4NA 3DAQA 3GNOA 2OEMA 1FKWA 1N7KA 3BLEA 5D30A 4HNNA 2AAAA 2C3ZA 3GXFA 2V3FA 3KS6A 4ADTA 1R8LA 2A21A 4FNRA 4GKTA 4DAFA 2B7NA 1QPRA 3RG6A 1B31A 1KM4A 3EOLA 3AMDA 1MMFA 2FTYA 5BMWA 4BQ3A 2RHGA 3NQFA 3W72A 2PMQA 3STFA 4PCPA 4HNOA 4IG2A 2QJHA 4P7NA 4L5ZA 3WDPP 3EEGA 2Y4SA 3M0MA 4J40A 4XKMA 9XIMA 3UPWA 2J77A 1XIMA 2SFPA 4UFJA 2ZCGA 3B3DA 1GHRA 3ZYZA 1XBZA 1TG7A 2FZBA 2GJRA 2EBNA 2KX9A 3RX2A 1QWGA 1RJRA 4XQ6A 4EKJA 4JIHA 4XWUA 4HYVA 4PGLA 7XIMA 3V36A 2E5DA 3SUSA 1SO4A 4PL2A 1I2PA 4PODA 2WSKA 3W84A 2VYOA 1JZ6A 2DZAA 4Z1DA 2VOMA 1NELA 3TK7A 4R85A 3RHGA 3BJSA 3R0DA 4PH6A 1MDLA 5AC6A 1I1XA 4K8EA 1GPFA 2WKLA 4BI5A 1KQZA 1U5HA 2B0MA 1TREA 4WOZA 4PMXA 1JJKA 4JY8A 1RALA 5CKSA 2UBPC 4I9MA 2Z29A 3ARTA 4NJHA 1EPVA 1X1OA 4X61A 3ANUA 3AUJA 3FSTA 5D2XA 2VD8A 2UY4A 3SY5A 1W9VA 1BG9A 1EJSC 1CGWA 1IWAA 1T8XA 4TTUA 1VJIA 2P76A 3W7IA 1TELA 3ENLA 1RQEA 3PZTA 5FJUA 4WEVX 3A24A 2C14A 4C1LA 1SZNA 4P61A 3GUGA 1A47A 5JH1A 2V8ZA 1IXPA 1XLHA 4FMVA 1ADDA 5AY7A 3TC6A 3LERA 3QV8A 3B8VA 3N4EA 2C1IA 4OGZA 1MRAA 5EYWA 2BOFX 3RF9A 4L9XA 4CU7A 5A6SA 1W1A1 1NWTA 3A64A 1DIKA 4K2SA 3PZMA 3ARYA 1EA9C 1MO0A 2I9UA 4R9XA 4FXSA 3AROA 1BWKA 3IIZA 1Y0EA 3AALA 2J9XA 3WLLA 3I4EA 1JI2A 1O7AA 4O52A 3DDMA 1Q5MA 1LOLA 1VZWA 1SSGA 1L8NA 3COTA 1FA2A 2AOSA 4YWSA 3KCLA 3QTPA 2ZX6A 4GABA 4AC7C 4GE8A 1AZ1A 3HIJA 2V2CA 3G3MA 4UUIA 1YYAA 1UD5A 1Z7AA 3CAKA 1T8QA 3EB3A 3OG3A 1ZAHA 2GGJA 1CXFA 1VFUA 3HQOA 3OHMB 1GZJA 1QO2A 2QJGA 3KLKA 1YX1A 4MKNA 2FJUB 2OODA 5DRCA 3QLLA 3WBYA 4CEUC 1KWKA 1IHIA 1S1PA 3ZVHA 4IFOA 1JCXA 4CQBA 4LWWA 5M03A 2VUYA 1PIGA 4TX6A 3BSHA 2B7QA 1F61A 2DV0A 1DJYA 3TR9A 1U1JA 2YX0A 2VFIA 2YCIX 2FJKA 4KFNA 1XG4A 4MGGA 4D8LA 1R9XA 4MWAB 2I5IA 3DFPA 4HHHA 4N4PA 4U33A 4MB1A 1KM3A 3PWIA 1ZTVA 5C5YA 3M1ZA 5D8WA 1TQXA 3S9YA 4OVXA 4C5ZA 4RNFA 4DRSA 1BQCA 4MAZA 1BF2A 5HOSA 4EVZA 4ZXOA 3ZQ9A 1GQJA 4LVBA 9XIAA 1Q6DA 2FMOA 2GUUA 3FVDA 1GZ1A 3Q2DA 2CZEA 1BSLA 1UQZA 2E67A 3MUAA 1DWIM 3CV7A 1RHCA 3DZ1A 1JZ2A 4C6EA 2NUXA 3CZGA 5BU9A 1A5MC 4RNHA 4GYKA 5H8PA 2DW6A 4HCHA 1JPKA 4GISA 1D3CA 3KM8A 2QW5A 3VKJA 3SCRA 4DELA 4ONVA 1VS1A 4AIOA 1VFLA 1PHQA 4NY2A 2Q3OA 1TTIA 2OFJA 3WLJA 2JQXA 4GYPC 4HKPA 2JALA 1JGIA 1KGXA 3CLWA 3KE0A 3VIHA 1VR6A 1ZGDA 4YTQA 1C29A 4P8UA 4A8NA 4QX4A 2BY1A 2PWDA 3AZTA 4UTIA 4GGBA 2Z24A 4A05A 3FW6A 1FWFC 3B97A 1UMLA 4O10A 1DPMA 2RGLA 1NDVA 3I3BA 5JBDA 3QZAA 1JL8A 4EPEC 3THAA 3R2GA 4B5XA 2PURA 2CKSA 3OJGA 5CSUA 3Q94A 4M6QA 2CEQA 3KLLA 3I4KA 3SIMA 4KCTA 1K4HA 2J62A 2OZ3A 4P7OA 1HJVA 2GSHA 1OD0A 4O17A 3QMRA 2WXDM 1W0MA 1LM1A 3IVUA 3W87A 2HNEA 3D5HA 1J79A 4W8BA 1Z89A 3M0YA 1J0YA 4IWWA 3AHYA 1KBLA 3ITOA 4QJ3B 3KVKA 4CVWA 3M0HA 2PLKA 3LMZA 4K7VA 1EGZA 4CN6A 4YWIA 3WD2A 1MEIA 3M0ZA 4PEKA 4DJFD 4D6IA 1CCWB 3I3DA 3W0KA 3N9KA 3TN6A 3RMEA 3VE7A 4ZGYA 4CD6A 5XIAA 3IV3A 1W3NA 4MY1A 4O8AA 5HNTA 1AL7A 1WNOA 2WNQA 4AZ7A 1C9WA 1ZHAA 4M81A 1M41A 1XUUA 1GVQA 4I7UA 3W7MA 3WF1A 3C2YA 3MDUA 3FA5A 2EPOA 2IUZA 2V5DA 4WCJA 4BWLA 1DWJM 3B8SA 2H90A 3C2EA 1HTIA 3RUBL 1JCYA 1X7FA 1P48A 7REQB 2PWHA 3FHQA 4EK7A 4MKSA 3SO7A 3SCVA 3CU2A 2A3AA 3VM7A 1MQRA 3LV6A 4BJHA 3LLXA 2OYMA 1JR1A 1EP1A 1V3MA 4C6BA 2C91A 4W93A 2QUUA 3NL5A 4XD3A 4YJ5A 4DZHA 4HPXA 1K9FA 4U28A 3NEHA 4KIRA 2WM0A 4ACZA 3LPOA 4I9AA 1Q7MA 2VR4A 5CCZA 3ABOA 3WN6A 1MEHA 3NSMA 1K7XA 1RCXB 3DC8A 1K7FA 3WH6A 1KCLA 1OG0A 1IR2A 1Z6KA 3IJ9A 1CXKA 4NX0A 3QRHA 1QPKA 2VDGA