3TYAA

Dihydropteroate synthase in complex with product
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
274
structure length
265
Chain Sequence
b'KWDYDLRCGEYTLNLNEKTLIMGILNVTPGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 92
structure length 265
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3tyaA00
3H2EA 4HB7A 3TYZA 2VEFA 2DZBA 2YCKX 3MCOA 1EYEA 1Q7MA 4S3EA 4DJDC 1AJZA 3TYAA 3TYEA 3TYDA 4DJED 3BOFA 4DAFA 1AJ2A 1AJ0A 4D8AA 4D9PA 4DJDA 2Y5JA 4NILA 1Q8JA 4MWAD 4O0QA 4DJFD 1TWSA 3H2MA 2E7FA 4O1EA 4PZVA 5JQ9A 3H2OA 4S23A 2DZAA 1AD4A 4G9PA 4S3FA 3H2CA 1Q7QA 4NHVA 1Q85A 3H2FA 4DJEA 4MWAC 4MWAB 4S38A 3NOYA 3MCMA 2Y5SA 4DJFC 1Q8AA 1TX0A 2BMBA 4MWAA 3TYBA 3H21A 3TZNA 4DJFA 2YCJA 3H2AA 1TWZA 3BOLA 3H24A 2YCLB 2VEGA 2OGYA 3TYCA 4DJEC 4C1NB 4MWAE 4S39A 2YCLA 4DB7A 1F6YA 4NL1A 4C1NA 3K13A 2DQWA 3H26A 2H9AA 4NIRA 2YCIX 3MCNA 4S3CA 4D8ZA 4S3AA 2Y0FA 3TZFA 4CCZA 1AD1A 4S3DA 4O1FA 3TYUA 4S3BA 3TR9A 1TWWA 1Q7ZA 3V5OA 2H9AB 1TX2A 4DJDD 4DAIA 3H2NA 2VP8A 3H23A 3H22A
chains in the Genus database with same CATH superfamily
4H7VA 5K9CA 1GPFA 1SZGA 2YSWA 3W7MA 2DZBA 1E4NA 5D32A 2A0NA 3LPFA 4QE4A 3LN3A 1A80A 4JHMA 1LJYA 3TSMA 2PRMA 4LYPA 5G1MA 1PXGA 5REQB 4LCQA 4QDWA 4DBDA 5CJMA 2ZZ7A 4AF0A 3U57A 4DJFD 4PODA 3SCRA 4XSLA 3ZYZA 1SR0A 2VX6A 3S6DA 2X40A 4F0LA 1E6XM 4PMJA 8A3HA 4NHVA 2PTDA 4V1YA 5DO8A 5DCDA 3TQVA 2A3EA 3WELA 2VM8A 5DEZA 1UMYA 1X8FA 4TQTA 3M07A 3VZXA 1SJDA 1AG1O 5LGXA 1M68A 3AXMA 1DHPA 4GXPA 2WC7A 5JUVA 1JQXA 1QW8A 3DIPA 1EWDA 3CHCA 1WX0A 4S2CA 4H9VA 5BMWA 3W2LA 3MI2A 4LU0A 3QM3A 3AZRA 3FXYA 3WQOA 1W5OA 1UP2A 1W31A 4G56A 4O18A 4XKYA 3WF0A 3GVQA 4X0VA 4NASA 2BVYA 3NQFA 1YTKA 3TIMA 2MANA 3LTSA 5J5RA 1E5NA 1M53A 2LLEA 4C90A 5E9XA 4Q7NA 4S3JA 3VD4A 1HJUA 1NDWA 2W0UA 4JFTA 3AOFA 2IPFA 2AQWA 3A21A 3HQNA 1TTIA 3PJTA 4H8VA 4C6OA 1UPPA 2KZHA 3SB0A 3VNMA 5A94A 1R5YA 4M7SA 3UWYA 1P6BA 1JRCA 3U7VA 3E5PA 3DFOA 3CNYA 4O57A 3R0UA 2F6UA 2Z27A 1PCWA 1A0EA 4OZOA 1MWOA 1YE6A 4OBTA 1UR4A 4J3WA 2JIWA 5GNZA 2FJKA 1QFEA 3HU7A 2FMNA 3AU2A 4PBFA 3HPSA 1EFZA 4PH6A 4DEFA 3SDOA 4W5ZA 5AECA 4M0XA 1O68A 2JALA 3CUFA 2XGZA 3W2NA 1B54A 2FTWA 3KZPA 1G6CA 1WUEA 3GIPA 3W70A 3CMGA 1XLLA 1HUVA 3VKCA 2CZDA 3B8DA 2FHCA 3RR1A 3WUGA 3PBUA 3EX4A 4H9TA 3UBPC 1F4AA 1Y5VA 3UJSA 4D6EA 1VFMA 3STFA 3WL0A 3LQLA 4V1XA 1P43A 1PX8A 4ZO8A 2GVEA 3PR2A 2VQTA 2DW7A 3NYDA 3U4FA 1F74A 2YKKA 1UWQA 3W7LA 3QZ6A 4IP7A 4MJZA 2PF0A 3AMDA 3B04A 4CNUA 1RZMA 3BLLA 1F61A 2PDGA 1KW1A 4CCEA 2Q8XA 4CU8A 5D04C 4EWND 5CAKA 2I17A 5C9WA 1H49A 1XINA 3AC0A 3WL1A 4ZTXA 4DZ5A 1QWKA 3FHQA 2XH7A 3VOFA 4OKDA 1Q6OA 4R34A 1KFCA 3GTHA 4JGDA 3UR5A 4W8BA 2IXUA 3WH8A 3WX7A 5AVNA 4I8YA 3L4XA 3D46A 5I0DA 1TZ9A 4Z1AA 4EVZA 1FVPA 3BJSA 3MWAA 3KS6A 5CC3A 1H62A 4WDTA 4FNRA 2WNNA 3ZLHA 3STCA 2Y5SA 5AN7A 5CZTA 2WSPA 4E2DA 4XB3A 3W7IA 4QG9A 2EPMX 3TQKA 4KIRA 1ZAIA 3DFNA 2VRJA 3SUVA 5FEZA 2F2HA 2X1RA 5H8MA 3M0LA 2PE4A 5ECVA 3L2IA 1OGBA 2XH0A 3NZPA 3THQA 1H61A 4PCPA 3O1NA 3QV9A 1RCOB 2ZZ1A 4E4UA 2VD9A 3E0IA 4ADSA 2C91A 1JF5A 2JEQA 3T4CA 2XVLA 4WF7A 4C6EA 4ZQPA 3I4KA 2ZUSA 3L66A 1YYAA 1ITUA 4HHMA 1TR1A 3CHEA 3RHGA 4DWDA 3L23A 4C6FA 1OX6A 1NQKA 5C6MA 3OGRA 4ZA0A 2OSYA 4G6CA 4UZSA 4LS1A 4WKHA 4FHAA 4Q4KA 4AAJA 1UD4A 4PB3A 3W87A 3MZ2A 3SY1A 2BWGA 3WQDA 3B06A 3IV8A 4GUFA 2G3FA 1I2PA 4HA3A 3GDRA 4UFJA 4GHRA 4PC8A 4ZQOA 2UV8G 3UG5A 4L4OA 1D2KA 5CC6A 2YIHA 1TA3B 2Y63A 4H04A 5A6MA 1AH0A 4I5RA 3S46A 1UP0A 4KWUA 3EA1A 1R3TA 4Q4SA 1PPIA 2E6DA 1AMKA 1I0BA 3S42A 3C2EA 1C8QA 4R33A 1QMLA 3NUKA 1UA7A 1E56A 2B7QA 3CK5A 3N18A 3EWDA 2J7CA 1Q3NA 3PZTA 4HYRA 5E0KA 5IBXC 2ISDA 1KQZA 1BXCA 2XFYA 2ADAA 3O6AA 3G3MA 5CC5A 1ZFJA 3RO8A 4W88A 4C6KA 1ONWA 2J7FA 4D2JA 3MI3A 4F0MA 4UTHA 3FEQA 1FH9A 3L5AA 1O12A 4MNKA 2R91A 3H2EA 1FCUA 1P0DA 1XIFA 5I3FA 4KBXA 3GNXA 1WZLA 2D2GA 4M6PA 1KC7A 2BLEA 4QE1A 3WF3A 1HO1A 2VC7A 2OWXA 2E6FA 4GIYA 4CN6A 4RPPA 4A3HA 1LQ0A 3HFTA 5D2TA 1BGAA 1VRDA 3LTPA 3QEZA 3WQWA 1AW1A 1EYWA 1PWLA 5HUOA 1ICPA 2PBOA 3P60A 1FWNA 4S3FA 4UTMA 1UZ1A 2IKIA 1XYMA 1ADDA 1EZWA 2GJXB 5D9OA 3N4FA 4KCTA 2HK0A 3C61A 2FGLA 2WYSA 5CKSA 3G1HA 5CBBA 3C8FA 4URIA 3QQ1A 4ALDA 2G37A 2CKSA 1O4UA 1V3JA 2EBNA 1VP5A 3CB3A 1KNWA 4TUFA 2QLYA 1ALDA 1BVZA 3LHWA 1QU4A 2EJ1A 3LHYA 1XS2A 3W86A 2C13A 2REQB 1FTXA 2P3EA 5DXYA 3UU0A 5HMFA 3BARA 1BG4A 3GC4A 5CGQA 3W1LA 1OF8A 4UQCA 3QV7A 1PAMA 1Z6KA 1TQXA 2FYMA 5C9XA 4FF7A 4XAGA 8XIMA 1GOKA 1M6JA 5JVLA 2XWEA 2G3IA 4UOQA 3W1UA 1WXZA 2PDMA 3RUBL 5M1TA 1KM1A 3EXSA 1BWVA 2ZICA 5IRPA 5D9PA 1Q8JA 2HDJA 4NYUA 2UBPC 3SURA 4M81A 3OODA 3LNPA 5D9MA 4WVXA 1FWDC 1J9YA 1KKRA 4JAWA 4LAZA 2C6QA 2DQXA 1O94A 2CBUA 4G8TA 3IVSA 3IANA 2PF8A 1XLMA 4CQAA 2DSZA 3LXAA 1S2VA 3GQYA 2FZ9A 1LOQA 4FOJA 4RZ6A 3G1YA 3CH0A 3AWOA 3EDJA 1TV4A 4HNVA 3NPUA 5HOSA 2R1LA 3R94A 4LVDA 1KM2A 3BTNA 3INPA 1TV3A 1S5NA 3EOEA 1PTGA 2PA6A 1FY6A 4XZMX 3VX1A 3L65A 1HGWA 1OINA 2I7GA 3CV2A 2G3NA 2GDUA 2EG6A 2ZE3A 3QTGA 1XD0A 1M65A 3V16A 1Q45A 1VCFA 4NJGA 2WJFA 4M8UA 3G1RA 4UTFA 3Q4DA 3BC9A 3PVFA 1QPNA 1H7PA 3HGJA 5BU6A 2ZA2A 1DQUA 2QVHA 1TX2A 3ANVA 4KFPA 3UWEA 2VL4A 4IQDA 4HNLA 3AWNA 1W1IE 4MADA 5AC4A 3H8AA 4FX8A 4UFHA 1P0BA 1ICSA 3M6DA 3R6IA 2RUSA 2NV1A 1W3TA 2J75A 3DGRA 5FF2A 3TSDA 4DM2A 2PDLA 3APYA 2ACRA 3D47A 1NEYA 1M3UA 3CM4A 4JTTA 2PWDA 3VKJA 4XVEA 4L9ZA 1MUCA 1F2JA 1KM3A 1CBGA 3PUEA 2OSXA 2V9DA 3E6EA 1JFXA 4TX6A 1GGOA 1QHOA 2GGEA 4HYWA 3Q65A 1RD5A 2JFEX 6XIAA 2A3BA 4MM1A 3PS7A 1LL7A 4WSHA 2DJLA 4HT3A 4U5IA 1MW2A 2QQ6A 5MHBA 3FX4A 4V28A 4ZXOA 3WDQA 1BYBA 4B3ZA 3C2VA 3ES8A 1EIXA 3EA3A 1M04A 5XIAA 1R85A 3SZ8A 1VBHA 2WZIA 3AHXA 3NXFA 2HNHA 3B0YA 2YFOA 1US0A 3DG7A 1IGSA 2ATSA 1FWIC 3TEVA 4D6CA 2JKAA 4C1NA 1NF0A 2CHRA 3DBPA 4IHCA 2G8ZA 2NW0A 3PULA 1S5TA 3VKKA 1TV5A 3VMNA 1R8LA 1XDJA 3P61A 1PIFA 5DCBA 1W0MA 4RKAA 1VFFA 2Q8ZA 4P8VA 1V77A 5I78A 1BF2A 1QRQA 3HO8A 2HXUA 4MF4A 1WOAA 3BLDA 3MSRA 2RJGA 5FACA 4DXVA 5AHIA 4CEXC 2D1ZA 2EO7A 5BOOA 4E2VA 2DFAA 2J7BA 2PU0A 4GYKA 4NVTA 2DV0A 3P82A 3GUWA 5ABHA 1KLZA 3PAJA 1C93A 2VXNA 3F1QA 3ZJ6A 4DWSB 1MW3A 3OJGA 4GACA 1W9XA 4F0HA 2G3JA 3CQHA 3GR7A 4OOZA 3GSMA 3GG8A 4P7NA 3FK4A 4JPGA 1OFOA 4AHOA 4HHPA 4GBUA 2OYLA 4JTLA 4IMGA 2CNCA 1K70A 3VIJA 1CGXA 1KRBC 1AL8A 4J3SA 3G6MA 3GDBA 5LNUA 1JUEA 2B81A 3UGRA 3S6OA 1N8WA 3PTQA 3LRKA 3W6MA 2OWWA 1TJ1A 2IXVA 2FTYA 4J27A 4F9DA 4F0SA 2WZEA 2E09A 1H50A 3ARQA 2Y89A 1UYQA 2Y6ZA 3W2JA 3DYMA 3GNDA 4IQLA 2ABBA 5AHLA 3OB8A 3T0CA 2OFJA 4TIMA 1UPMB 3VE7A 4RR4A 3SR7A 4G2DA 3IK2A 1UD6A 4MB1A 1W8SA 3P81A 1B3ZA 5XIMA 3FHAA 1FDJA 1U5VA 2CZ5A 2F38A 4Z0JA 1O5RA 1KCKA 4WJ8A 1H1ZA 1U30A 3UNDA 1R7AA 1KFBA 3RCYA 4W9TA 5B80A 2GSHA 4UMBA 3BDKA 1GVEA 2VR2A 2PDUA 2J6XA 3AUOA 2VOMA 5E93A 1W8GA 4H9ZA 2VGBA 2Z6IA 4GKLA 4B9ZA 1D3GA 5B7YA 4L9XA 4H6RA 3S5NA 3J7HA 5AB3A 4A05A 1UR2A 2E9BA 1X6LA 1GYLA 4MB3A 3ITXA 3BG3A 3WDIA 4DJDC 3TYEA 1SYTA 3P2VA 4XZHA 3TYDA 6PTDA 1VJSA 3GE7A 4AHPA 3BQ6A 2Z7GA 5REQA 2WWDA 4JNMA 3GDTA 3P93A 5BRPA 1RQHA 2XWDA 1E0XA 4K37A 2XH4A 4O16A 5HK4A 1GQNA 1B3OA 3WKZA 4E3VA 1OVDA 3N17A 4Q8MA 1G67A 2FPTA 5D05A 2CLFA 3MBFA 1KFKA 3VM5A 4QX4A 4W8AA 4UMAA 1DIOA 1EUAA 3NZGA 4RNFA 2VR4A 3BUVA 3BXWA 3H4GA 3DXIA 1AH4A 1JPHA 4DB7A 5IXEA 2CXEA 4Z2JA 1TV8A 2DQWA 2XH2A 3TCSA 3E74A 3VCNA 3THCA 3MCNA 4OHQA 3MVIA 5C2GA 3E3HA 3TTYA 5BMXA 1UKTA 3NQ6A 1JI1A 1RK5A 3C52A 4M3PA 4N6EA 4ZEPA 2PRLA 4I6VA 3P0WA 3W85A 3T08A 3T0DA 3NURA 4PMZA 4XIMA 4HPNA 1YNPA 3QGAC 4QAIA 2J8GA 2D2OA 4D72A 1UH2A 1OFQA 1RPKA 3WK3A 1MI3A 4AUBA 3AHYA 3DHPA 5CPTA 3TV8A 4HNTA 3FYYA 1UKQA 5T8GA 3ZLFA 1SMAA 1US2A 1EJWC 2BHYA 1LOLA 5G2IA 1HIZA 1SW0A 3HF3A 3M0HA 4UOZA 3LV5A 1DJIA 4QGCA 1XIBA 2DT3A 3BLKA 2VKZG 3GG1A 5KINA 1QI5A 3DHDA 1MRAA 5LIWX 3T8QA 3S2JA 4CUCA 4NNAA 1K9FA 4GG9A 5HBFA 5KZ6A 2GPTA 3LI1A 1GQJA 2VX4A 7TIMA 4UFKA 4QFUA 2GYIA 4Z1BA 4UWMA 1Q6DA 4X60A 1K3UA 4FZIA 1O6IA 4GCAA 4EPKA 4XUYA 3CH9A 3THDA 4AFYA 2YCJA 4UTJA 5AKQA 3UT0A 2WPGA 1SSDA 4HMCA 4BFAA 1UR1A 1QTWA 1SO4A 4MKNA 1OEPA 1J93A 2ZZ4A 3CBWA 3GR4A 5EFDA 2WMIB 3AISA 4RV8A 4LBRA 3VCRA 1TSIA 1KA9F 4XQ6A 2VR5A 4DZHA 3LK6A 1J6PA 3ALGA 3OOQA 3PBVA 3U4AA 1FUYA 4H9UA 3OIHA 3DKJA 3TDFA 4IWWA 4IX0A 4KFOA 3TR2A 4GWEA 2PS2A 4N9CA 1FWRA 3LCXA 2FFIA 5IHRA 4JQ4A 4REQB 5AYZA 2G3MA 1P6WA 3GAKA 1DWFM 3IJ9A 2D0FA 1U5HA 1MQQA 4P7LA 1JXKA 2NUXA 1XL9A 3R25A 3V75A 4BQ5A 4ZSUA 1EPXA 4WY0A 4GXWA 1NJJA 3U2EA 4CNSA 1EC8A 1B90A 2ZA3A 2C15A 3W26A 5BNKA 3W2UA 1QW9A 2ZUNA 4TTUA 3WF2A 3UVIA 4G9PA 2X1IA 4M29A 3NVTA 3ID7A 3C6CA 4MWAC 2D23A 3VDHA 4C7DA 1G4SA 3R8HA 2NLYA 5JBFA 1ZZMA 3V7PA 4YXGA 1MXSA 4JTSA 5C71A 3OYXA 1SFLA 4RV3A 4R85A 3TROA 1CXHA 3S9IA 2A3CA 3U9IA 3RIKA 1U1HA 5LHFA 3BAWA 3PF3A 5EMLA 3WDJA 2J79A 2XUCA 4YVXA 3QOMA 2OPJA 1UIOA 1JZ4A 3W01A 4FK9A 2ZVIA 3NZQA 4K1GA 3QQWA 4M24A 1E5JA 1PHWA 3VDGA 4N2YA 5I06A 1J18A 3AZTA 5CCZA 3BJFA 4ZCWA 1UUMA 2L5HA 2ICSA 1HJSA 4DF0A 3FKKA 3OVGA 1JL8A 4D9PA 3HBLA 3TJXA 4PMVA 3PFMA 3HG4A 3DG3A 4JTCA 5CPOA 1BAGA 1SZNA 2A79A 5LHEA 1G01A 3RX3A 4HA1A 3NA8A 1TMHA 3KOYA 2X7VA 4JN7A 1E4LA 4LNYA 3URQA 4IG2B 4CNPA 4FALA 5AHEA 3ZWSA 1HX0A 1TA3A 3SIMA 5D33A 2QGYA 2V30A 3SCWA 4KGJA 2X1SA 4XAFA 2VO5A 2R8WA 4HPGA 1XKJA 1V93A 1UA3A 3HPAA 3ARVA 3KXQA 4IMAA 1OFRA 4RZ4A 1RA0A 5HANA 2Z2BA 4ZZ9A 5TAOA 1JYXA 1EJRC 3A23A 3EDFA 3R4IA 4KESA 4OBRA 4IXHA 1XJBA 3CWHA 1EO7A 3RNDA 2CIPA 1TPDA 3BJTA 3L4WA 4U5KA 4J3ZA 4MDPA 4QLJA 2ONEA 2CLKA 4JKLA 2W62A 2E1WA 4O11A 2GQ3A 3AXKA 3RO6A 3E2QA 1YXCA 3PTMA 1T0OA 4MY8A 5A69A 3DU0A 2ZADA 1XD1A 2ATMA 2C0AA 1G94A 5EA9A 5F2GA 1A4MA 3PPHA 2GVLA 4AXNA 1EO5A 4HNOA 3THAA 3PJUA 1HXJA 2ZOXA 1E6PA 5FL1A 1KCLA 2D20A 1OBAA 8CGTA 1IWPA 3QQ0A 2YBUA 4MG4A 2GWNA 3CT2A 2F61A 2ZC1A 2O7QA 2X8RA 1A5UA 2ZQ0A 3V18A 3OLIA 3NR0A 3GDMA 4FXSA 4DJEA 5FF3A 3NEVA 1HO4A 2AMGA 2PD9A 3QMTA 3V5FA 3BG9A 1TIMA 4FR1A 4A8IA 3CC1A 2PGEA 1XLEA 4UUIA 2GJXA 3AO0A 1R7OA 3EX2A 4XBKA 3VGFA 3T2PA 4EX4A 1SMDA 3ZQ9A 4HU8A 5A8OA 2VEGA 3WQVA 2D3NA 4GUJA 1ICQA 3KAOA 5HPCA 2TAAA 4GNJA 1H7NA 1LRNA 1XIHA 4XIAA 1ZP3A 2HSAA 2JIEA 2XIOA 1YKWA 3W53A 3GIQA 1DJHA 5DBTA 1P6CA 1FWJC 1C9DA 4R7OA 3BV7A 1B0IA 2VEMA 1XC6A 4DF1A 1YLVA 2REQA 1KM6A 2DSKA 1XG3A 1POKA 1BLIA 5C2CA 1KM0A 2CCRA 5LNRA 3S3GA 3TAOA 2QDDA 5G4EA 1JDAA 1QVBA 1GQIA 1V0MA 2Y7FA 3BANA 3ITTA 2A3AA 5IFPA 4YVPA 4CVWA 4W84A 2R1MA 3CPUA 3O2LA 2HE5A 3PP7A 3MJMA 4HU0A 4CNNA 4GQRA 3VABA 2GDVA 2F7FA 5CZSA 3VVGA 3QYSA 3AZSA 3RDKA 4OJYA 1PTDA 2CXGA 3LRLA 3EOLA 5LYRA 2WNZA 1Q6QA 3ZMRA 3LHVA 3P84A 4BCEA 3KLKA 1SO6A 1VBRA 1DJQA 3MU7A 4V15A 3VTRA 4K8HA 2ZRZA 4PSRA 1L8NA 4Y96A 3E02A 3PG9A 4LS0A 2I5QA 3WY1A 1WAUA 3VZZA 1KQYA 3WLKX 2YL6A 2ZBTA 1X1OA 2YB1A 2P1FA 4DJEC 1Z41A 2WHJA 2EF9A 2PDNA 1CDGA 3G5EA 3QR1A 4FIRA 4EXAA 5FI8A 1ZBWA 3DERA 4IM4A 1GWJA 1VEPA 3G1AA 2JE8A 3AJ7A 3CEPA 4G1NA 4X22A 5EGRA 1YIXA 3EPNA 3M0VA 5FJRA 4N9EA 3QPZA 2CLEA 3R2GA 2CBVA 4UB9A 1GZGA 2QJGA 4ERAA 1JUKA 1W91A 4BI6A 2HRWA 4F40A 3MUAA 1ML1A 3PZQA 2V5JA 3NSMA 1G0CA 2NX9A 2Y8VA 3HB9A 2AL2A 4QJ1A 3S2LA 2C1GA 3AJXA 2C3ZA 2HXTA 3KCLA 1XLGA 4LYRA 2IQ0A 3M5YA 3N9KA 4DO7A 3FNDA 4HPXA 2HBXA 3QZAA 3AROA 9RUBA 2H3BA 4MMWA 3VD3A 1J0KA 4Y9AA 4BJHA 2XVPA 1I1WA 2EXOA 4EXQA 3IGSA 1AW2A 3N2MA 4MFEA 4UQ9A 4QSHA 2WSRA 3FSTA 2Q8LA 5DT5A 1V7YA 1EJ7L 2Z1WA 2VD8A 1KR1A 3KBSA 1TWDA 1VHNA 4NL1A 3RN6A 1TTPA 1CX9A 3MDWA 3KX6A 1DEDA 1N8IA 3D3AA 1S5WA 2F9RA 5FEPA 4TU1A 1LRTA 4IP5A 3KUMA 2QZRA 3W3OA 3FN9A 1KRCC 1GVFA 3GDKA 5CLTA 4NG3A 3GRIA 3DKLA 4MJ4A 3VGEA 2G95A 3HJEA 3W38A 4JKMA 2PC4A 3B8WA 3RLVA 4LB4A 3PBGA 3DOPA 4PMNA 5I7GA 1Q2RA 3GTXA 4DNMA 1XM3A 4HHHA 1JD9A 1UZ4A 3E12A 4DWSA 4QAWA 3PTKA 1B3WA 2EG7A 5FESA 4F2UA 1WDSA 1DBTA 3QOKA 6CGTA 2GQ9A 1QUMA 2VFIA 2YBVA 2HQAA 2PTYA 4RCXA 3VNLA 3KDNA 1BPLB 3JR2A 5JU6A 2P5NA 1JCLA 3UZ5A 1Z69A 2WW5A 1IXOA 4EPEC 4NNCA 4MHBA 4H8UA 4Z2KA 2RDUA 4Q4RA 2GJRA 4AEEA 1KFWA 3WLLA 1DOSA 3W7PA 4DZAA 2ACUA 3SI9A 5I07A 2BGSA 4ZQMA 3CEUA 3VOCA 2GQAA 1OCBA 1OG0A 2FTPA 4G7EA 3CL8A 5DFAA 3H7VA 5GNXA 3L0KA 2R9RA 2H90A 4KERA 2WM0A 4AC1X 3P6LA 3UP8A 2QULA 4LUYA 3O0KA 4UTIA 1XSJA 4J5NA 4FLRA 4LVFA 3LHZA 5HINA 1LQ2A 1I8JA 3A47A 3GIYA 4A3QA 2NX3A 4WQ6A 1P7TB 2F6XA 3W1RA 3EKGA 1QNRA 1Y65A 2Z2AA 7XIMA 4WIWA 3ZR6A 3S1GA 4B5VA 1NQ6A 3CZEA 3W1QA 3Q67A 4AEOA 2R1KA 5T26A 3MS8A 4WSKA 1AJ2A 5AYBA 4R3UA 3KBJA 1GK8A 1HJQA 3QR3A 4HZ6A 2ZRWA 1RA5A 1YBQB 3WK1A 2YZ5A 5FEXA 1FCQA 4XAZA 1QK2A 3IAPA 5FJOA 3BLIA 3UVAA 1REQB 1YEYA 3EEZA 2XIJA 4RPQA 1T8QA 4KETA 1LQAA 3I3BA 3O8AA 3MMUA 2PLKA 3RFAA 5DMNA 1E1EA 2Y7DA 5LNWA 4QQ3A 4I6KA 7A3HA 1E6QM 3RCNA 3USBA 1SVDA 5I3KA 3H2AA 4AIEA 1TR9A 4U3AA 5AOUA 1E73M 3VMPA 5I3JA 4LFYA 1NP2A 2PLCA 4LVGA 3UXLA 4LANA 4QS6A 1B3YA 5A6TC 3ZT7A 4N9BA 1JXJA 2WMGA 1QO2A 3NPVA 3DG6A 4JY8A 4JTEA 3S5ZA 3TYUA 3MHGA 2JEPA 1I1XA 1EGVA 5CGTA 3W02A 4DJDD 4EP8C 5IDZA 1KWKA 2ZX6A 3ME3A 1DYSA 4ICMA 4CQ9A 4X0NA 1L0PA 4ZE5A 5C2XA 3K8LA 4B16A 4PSPA 1Y7VA 2ZFAA 1TJRA 1Y5WA 1OGSA 1R2RA 3GAYA 1PSCA 1KLYA 3TA6A 4UTUA 2HROA 1XHGA 3QHMA 1E6ZA 3N4EA 3PWAA 2XJ7A 3QMSA 5CLWA 3M44A 4K39A 3CGTA 3LCFA 1WKDA 4O53A 2ZX8A 4W86A 1UUQA 4HSOA 3ZXWA 4Q6XA 1B3XA 3GKAA 2V0TA 2OZ0A 5BWAA 1EZ2A 2CBJA 4WDWA 1TCDA 4ROPA 1W1B1 1KB3A 1DJWA 2J24A 2DUAA 3H7UA 2QDEA 2D3LA 2XN1A 1SUXA 2VX5A 3M0MA 4PRWA 4Q4OA 3MV11 1V3LA 4C1LA 4WJEA 3UR2A 1OFAA 5I09A 5HNRA 3UWZA 3NWRA 1Q13A 4IMEA 4GUHA 2WZTA 2E0PA 5TF0A 3Q94A 2PTZA 2WK2A 1JNEA 4GH3A 5DX7A 3W1PA 3ZFHA 5BU9A 3BOXA 1WKYA 1YPFA 1ZJBA 1VYPX 5FJTA 4UZUA 2OR2A 2J9ZA 1ESWA 2IS7A 1Q6CA 1JPIA 1UCWA 3F4NA 4PMDA 3ZR5A 1J0IA 4JS3A 2AGKA 5A8MA 2YYUA 4ERIA 4RE3A 3KRUA 4QRNA 3VD7A 3LV6A 1OC7A 1GW9A 2BNJA 3V0TA 3RPTA 4W8LA 4U31A 1PB0A 3PZOA 3AIWA 3I6EA 4JFUA 4PCSA 1W3IA 4Q4PA 4WLCA 3BW2A 3I6RA 2RHGA 2IMRA 3ABQA 3UEQA 4J40A 1OCQA 2IKHA 1HFBA 1YPIA 3KS5A 1Q7QA 3W83A 1SZEA 1E15A 2INEA 2QCCA 3PZMA 1LBFA 1PV8A 3GBDA 3UZJA 3WNKA 4M19A 6A3HA 2C14A 3NSNA 1S46A 1YTDA 1A5SA 1LL4A 4UTWC 1JYVA 3NQ2A 1O1HA 3D5HA 3E0FA 1HL8A 2CBIA 1HJVA 4XISA 1FWSA 2YB4A 4L4MA 4QBXA 3PUOA 2TYSA 3PNZA 5BXPA 3WH9A 3OLEA 3KHJA 1YDYA 5D37A 3WQEA 3VCCA 1OYCA 4XD4A 3GTNA 3QPEA 1GTHA 3GFZA 1QBAA 4EKJA 3VDBA 1Q7ZA 4IGHA 1MSSA 3WQ5A 2PWUA 4OVXA 4OIFA 4PULA 1ZCOA 4I8DA 2QDGA 1RBOB 4MNJA 4OUEA 4GC3A 1BEUA 1K6WA 1KTNA 3GW0A 3PJXA 4IPNB 2ASHA 3MYPA 5GJMA 2GVYA 3FOKA 5FIPA 5DMMA 4J3UA 3KP0A 1AJZA 3LLDA 2NZLA 1HJWA 4Y9MA 1PCKA 1QNSA 3O05A 1FWWA 3OU8A 3QGVA 4MWAD 2DZXA 3EDEA 4FI4A 1DPMA 3WNOA 2PFHA 4LPCA 1V7AA 3R10A 4IIHA 4NXKA 2WQPA 2CYGA 1F6PA 3DUGA 5FF7A 1MW0A 2ODOA 2ZUUA 3IJ7A 5EB8A 1CYGA 2CLIA 4GXMA 5I24A 3P14A 2VC6A 4GA8A 3VGBA 4IG2A 1EWEA 4C5ZA 3QLLA 4WHBA 1ZAHA 1B31A 5XINA 4BI7A 1LBMA 4CN1A 2XIIA 3N6HA 1WYIA 1XLDA 4JQ3A 4DM1A 3MSGA 4FPSA 3K5XA 2W66A 2PDCA 4U2ZA 3M7WA 3LSBA 4F2TA 1K4HA 4OUIA 1AZ2A 1LDCA 3E0VA 1RJRA 4NIRA 1UD2A 3NQEA 5G4WA 2E25A 4QDPA 3O6CA 3W25A 3LCIA 4QEHA 4E8DA 4O10A 2UY4A 1QPQA 3REQB 5BCAA 4QITA 3R5EA 1Q6FA 4HIBA 4US5D 2PMQA 3WSUA 1A3HA 1G4PA 4MPKA 4YYCA 1K6AA 2BOFX 5HXMA 2E4TA 1KFJA 4PUDA 3QH2A 3GY1A 4MLJA 4MJ2A 4GJ1A 1G7UA 3G18A 1PX3A 3MSYA 1KXQA 3MW7A 1TFVA 2Q71A 2FPYA 1KCZA 2IKJA 2OSWA 5A6BA 3O06A 4UCGA 4IPIA 3CL6A 3NDZA 4YU1A 1S5VA 3PBYA 5JH1A 3T55A 3B9EA 3WN6A 1P0KA 3AIUA 1GOWA 1JF6A 3UCQA 1C8XA 3L2MA 2A1YA 3VD5A 4F9JA 4RX0A 2GDQA 1I45A 3U2OA 4GINA 3UW6A 2ZRYA 2R14A 2ZUMA 3U0HA 3GYEA 3JZUA 1EF3A 2Y88A 3STEA 4LV9A 4MFDA 4KEMA 1F76A 5I3DA 4PEKA 3RLHA 2VEPA 2ACQA 3PHAA 3CUHA 4YPJA 5AC8A 3EX3A 1ZBKA 2O56A 2W4XA 1KTBA 3N73A 4IGMA 4JYFA 3NVDA 3RLUA 4XD6A 1ONXA 1KBLA 4NX5A 1QI0A 2XSBA 1T40A 1XYZA 1A5BA 1KFEA 1PUDA 4Z2LA 4A8NA 5MKGB 3D3FA 3FYOA 1GYNA 3TX9A 3I3DA 3JUGA 3U7BA 3LGDA 4P7OA 4HNUA 3PZIA 4JD4A 1GHSA 1XPGA 3LENA 1CLXA 4CQ8A 2C18A 1GQKA 1OGGA 4H4IA 1TE6A 3WEMA 1VGAA 3N04A 1SW7A 2QIWA 1OCJA 2PGFA 4MPQA 3KFTA 1M01A 1M03A 3XINA 1NAL1 3R89A 4DBSA 4KEUA 3FKRA 4IIEA 4K7VA 3KEHA 4JZ5A 5C7HA 1A5OC 3GB6A 3LGGA 1YRRA 4JYDA 3CWNA 2Z0IA 4N0RA 3W28A 2X1UA 4FNUA 1XIIA 4M56A 1MMFA 3MT1A 2FDMA 1RBAA 2DJXA 1RR2A 2GGJA 3PZUA 2OVLA 1FQ0A 4CU7A 2RKXA 3S0CA 3A3HA 3BCFA 3T05A 4MUPA 1C91A 1NVMA 5J8LA 3UG8A 4IFOA 5G4HC 3UFYA 3QW3A 4HK7A 1VCVA 2J13A 4NZCA 4S1FA 4CD8A 3EWYA 4LW7A 1OY0A 2OMAA 1OADA 3K2GA 5C7VA 3SCVA 5KZEA 3TK7A 4B5WA 2PU1A 2CEQA 3SCUA 4HPJA 2I5IA 1EF2A 3G2GA 1B4EA 3GLCA 4RE4A 3NQCA 1XISA 4PB4A 4O1DA 4NAFB 3MHUA 4OFCA 4GO9A 4MLRA 1LP6A 3PTDA 2O4MA 4HK6A 1CB7B 2NUWA 4HOZA 2VRKA 2P50A 4IH3A 3FY1A 1B2YA 2QV5A 4CCDA 5DRIA 2Q6ZA 4L61A 3RU6A 3EWWA 4TTGA 2VEKA 4O0QA 4PTWA 1UOKA 2E5BA 3G0UA 5I5RA 2QJHA 5JIWA 3WUBA 1CPUA 4NSBA 1EJSC 3T0AA 3IIOA 1B9ZA 3AMLA 4G1KA 4Y90A 3U2CA 4UNIA 4PL1A 4UQEA 3UNTA 3W9ZA 4HN8A 3W37A 1ISXA 3TN3A 3YPIA 4ZO6A 3MCMA 3SRKA 3WFZA 4C7GA 5L6UA 4R27A 2DZVA 5U4NA 1RXOB 1H51A 4JL2A 3EPOA 3KRZA 1CNVA 2J77A 3E5BA 4EPDC 1H0GA 4OV9A 3A4JA 5ABFB 1WA3A 4ZGYA 3W1NA 1R3RA 1BFNA 4JBRA 2E5DA 1GOQA 4HBKA 4BWLA 3WMSA 3VC6A 3ZR4A 3T2QA 2AQOA 2J7DA 2Y85A 2QUUA 2W9MA 3NM3A 1F8MA 1MVYA 5FSDC 3AS2A 3OEXA 2BSLA 1OD8A 2WKLA 1PYMA 3A9BA 3QVQA 2GL5A 5FJPA 1IZKA 4C7FA 1IGWA 5HR7A 3T1GA 2O9RA 1A5NC 4C6LA 3TQPA 5D2WA 1VJZA 3S5OA 5I6SA 4EF8A 4NF7A 5BOEA 1LG1A 4J9JA 1XYBA 2Z1SA 3NG3A 3OIXA 1MEWA 2I9UA 1DWGM 1HZYA 1SGJA 1GNXA 4GKTA 4UIOA 1DWAM 1JDEA 4QM1A 4PMQA 4GI9A 4JR5A 3V3WA 1F5ZA 2CKRA 5K3VA 3WNMA 1XBXA 3BSGA 3DDMA 3KP1A 2J7GA 2G96A 2V3EA 3CZ8A 4E2OA 3TN5A 1DWJM 2OEKA 2DT2A 2YCEA 1WUFA 3BAYA 4YTUA 1XBZA 3KRBA 1B57A 1A50A 3ZT6A 3FA3A 1OM0A 3WEOA 2W92A 1LBLA 1BHGA 1L8PA 4HNCA 4JTUA 1GT8A 2VWSA 2YYTA 3F2CA 3NL5A 4JIPA 2WSYA 1GCYA 4BZYA 1V8EA 4P2VA 2Y0FA 3KBWA 2GFTA 4W5UA 3WNNA 4AC7C 1ISVA 1QATA 4GIAA 3W29A 1PZ1A 2J66A 2E8ZA 2VYOA 4TR9A 1K9EA 1T99A 1NWRA 4J3VA 2PCQA 3U6WA 1DIDA 4UCFA 3VIFA 3F5KA 5LNSA 1LLZA 3AU6A 1J0YA 4DO4A 4ERGA 3GW3A 1EH9A 2JF6A 3WD4A 1IEWA 1P7TA 1K8XA 1D8CA 1WO2A 1QHZA 3LBCA 2Z26A 4O1CA 4DAFA 3QTPA 2AL1A 1F7BA 5HULA 2CLOA 4TX8A 2VZOA 3T6CA 3JRKA 3W2MA 3ZZ1A 5FEWA 2WXDM 2O9TA 3SUUA 2R1PA 3KOWA 2WV8A 3B4UA 2O0TA 3S5YA 1O7AA 5FCZA 2CW6A 1REQA 1XG4A 2FGZA 4I9AA 2YDSA 1W5MA 1UH3A 4UR8A 1V6TA 4HZMA 1GJWA 4GVHA 5C70A 3EWBX 4PA8A 4PUUA 1FOBA 3HFYA 3T8LA 3QY7A 4H41A 4O0KA 1Q6GA 4UOJA 1EC7A 4GFSA 4UTTC 1A5CA 2TODA 3W75A 4PFMA 1X96A 3URAA 3DGBA 3S1VA 1ECEA 1BRLB 3UCCA 2YL8A 4GX8A 3PZVA 4QSFA 2C71A 5ABGA 5A3HA 3GXPA 4IFKB 5LKYA 3OA5A 1F3TA 4RDVA 3DI0A 3VOHA 4RUBA 3CHDA 4ZVJA 4OOUA 1IWBA 5G2WA 1AH3A 3ARTA 1IWAA 2VFDA 3TW6A 3MA8A 1XCWA 1VAHA 3B9OA 3UGVA 4W4QA 1XLAA 1DJNA 4L80A 2VENA 1UB3A 2VVNA 2KAUC 4IIGA 3MSDA 1W2PA 1ZQ5A 1QNPA 2CWXA 3V4BA 5KITA 2YDQA 1TMLA 1P0NA 4Y8EA 1ME8A 4Q8TA 1AK5A 4UXDA 3EWCA 4W85A 5AHMA 2C7FA 4QP0A 3EXTA 1IEXA 4BHYA 4WRHA 3COTA 3EWZA 4ATLA 3W73A 2BY1A 2Q3OA 3UWWA 2IQDA 1GUVA 3DC8A 4FB7A 5HUPA 2XZ7A 2RGLA 1FBAA 3NL6A 2HPIA 2VGGA 2BMBA 3Q45A 5D4YA 4FSAA 3K8MA 4UNKA 4AU0A 3N15A 1XQKA 2RDTA 3S5SA 1SO5A 1XUZA 1X7FA 3N1AA 3K13A 4UNLA 3LBOA 3STPA 3I65A 3S9YA 1HF6A 1V5XA 2Y24A 3K4AA 5LSMA 1K7XA 4MKSA 5K4XA 1U1UA 3OZMA 4ES4A 3B8IA 1RALA 4ZMGA 4YTSA 5CBIA 4ZOAA 5C5YA 5G1TA 3V5OA 4AEFA 2HJPA 3LY0A 1GONA 3MI6A 4N6FA 1FFRA 3CWOX 3C8NA 4AZ5A 2WMJA 3GH4A 2DDXA 5CSYA 3UR8A 2WKGA 4RDZA 1ZP4A 4Z0SA 1BF6A 1E51A 3BVJA 3ATZA 5D38A 1EYEA 3CZKA 2PAJA 1YDOA 4B9YA 2WO5A 1ZCCA 2IW0A 4ENLA 1VB9A 3I7SA 1C92A 1XSKA 1K03A 4B5UA 3Q58A 1H3GA 3WD1A 4J28A 1ADSA 1JG9A 2E6YA 3BLOA 3PAOA 5E0CA 3V0UA 5I03A 1L6GA 3BZJA 4ZODA 3BL3A 4AD4A 1XX1A 1XF0A 3SO7A 4F79A 1W2VA 1O5QA 4ZXLA 1QOXA 4RW3A 3N29A 4BF9A 2PP0A 1UWRA 1RVGA 3AMCA 3OVPA 1MXGA 4B5SA 2FVMA 4C65A 1HT6A 3EB3A 2GOUA 4CGTA 2BODX 3NZ1A 4MWAE 2WZMA 4HVXA 1AQMA 4ADUA 3VDCA 5T9CE 3CIWA 4LBSA 1RY8A 1UW9A 2Y2WA 4HN4A 5HA7A 1ME9A 3E2SA 4AY7A 5F4SA 2A2IA 3T7VA 3SY5A 1UG6A 4HSNA 1H0IA 4GK8A 1SJCA 5IFTA 4Q8VA 3MWCA 4YMZA 2VEFA 3OYZA 4U33A 5DY3A 2H6RA 4OGZA 2OGJA 4IT1A 2FH8A 1ZALA 3ECQA 1TIWA 5HJYA 3BW3A 3SQLA 3WBEA 4R7WA 3GG0A 3PNUA 4WDUA 5H8PA 2PWGA 4QS5A 4XBJA 4DRSA 1GZJA 4D6DA 2FHFA 3SCSA 4GZJA 5AVHA 3NYZA 1YHTA 4IGSA 4M7TA 1F3XA 3O9NA 1XIJA 4QQUA 1Z8AA 1ZGDA 1FDZA 4GQQA 3UA4A 3WJSA 4HOXA 4FMVA 2PDIA 5EFFA 1J11A 2ZWYA 1QDSA 2PB1A 1Y8BA 4U4MA 5A8GA 4DJFA 4JX4A 2ZZ6A 1GHRA 3W6YA 2BZNA 2AAMA 1X6UA 4FEZA 1PWMA 4LVAA 1Z32X 5E9AA 3TN6A 4LGXA 3AYTA 1M7XA 4XZ9A 1E43A 1PDZA 2W91A 3EMZA 3NO1A 2G4FA 3OHMB 1DE5A 5D30A 2WWCA 3AS1A 3BMVA 1MXDA 1R3WA 3FIGA 3QC0A 2VDIA 3T2OA 1A5AA 4X61A 2Z24A 4MGGA 2ZWZA 3LTYA 1AD1A 4O1FA 3REQA 2HVNA 4TVDA 4HOWA 1ZBVA 3EB2A 1PZ3A 4HK5A 2VP8A 3F4DA 3SRDA 4Q7IA 2QPUA 2DORA 3OG2A 5KETA 3SJ3A 1QPKA 1KD0A 4A35A 4NZ5A 4GD0A 3IK4A 4AYSA 3VIMA 3ISIX 5A6SA 4A3YA 3N11A 3M4HA 4AVOA 1V03A 2VOTA 3WQ8A 1KBBA 1P0EA 5I3IA 1PDYA 2DIKA 3KCOA 1LF1A 3QKZA 1G5AA 1KKOA 2HS8A 3KVKA 4RXGA 3FCPA 2YW3A 3VOJA 1ITXA 2J4GA 3I68A 4QISA 1R9YA 2HVMA 1OSEA 2V2HA 3EAUA 4DBWA 2ISVA 5A8NA 3GVGA 4LF1A 3A22A 2DH3A 3VNJA 4OT7A 3H21A 2CPUA 1ZY9A 4AD0A 4AD2A 2QCDB 1UKOA 4J1OA 3LMZA 2OQHA 3GHRA 3IPWA 4ZFMA 4I9MA 4NRRA 3VGDA 1TUXA 4I7VA 3NJ3A 1K1DA 1GVSA 3S4TA 1MZHA 4PN2A 1R3VA 5AYYA 5LNVA 3LUTA 3URNA 3E2VA 2WKJA 1K9TA 4NP7A 1CZ1A 3WDPP 2WC4A 5TIMA 3HG2A 1FX6A 4WXZA 2C16A 4IX2A 4O15A 3SUWA 5MKGA 2W27A 4EANA 1DWHM 2NV2A 5A2BA 4X9SA 3SGGA 3AMKA 1YX1A 7REQA 4H9MA 4ZO9A 3TW9A 3CZGA 1MO0A 3T0BA 5CPSA 5LIKX 3TYAA 3JS3A 3KTXA 1ZJAA 3HG3A 4L4LA 5KSWA 1MQPA 1R87A 2HMCA 3WZ0E 2ANUA 3MVTA 3IVUA 3R11A 2VELA 1AVAA 1UWIA 1VPQA 4PTDA 4OTKA 1E9IA 1ZHAA 4WKFA 2Y5EA 4RLIA 5H6HA 1EGZA 2QCLA 4XZNX 3VOGA 1Q63A 4IJRA 3G1FA 1ZLPA 1Z42A 4K8EA 3FGCA 3HQOA 4NZ4A 4TVUA 4K6AA 2NSOA 4RNIA 3MMTA 1WAWA 1M9HA 1I4NA 3MJYA 4JX6A 4XX6A 4Q4QA 1DJZA 3NGFA 2RJHA 3S2NA 1SW3A 6REQB 3RMJA 1VH7A 1XI3A 2WHKA 3IJLA 2BDQA 4DLMA 4LH8A 4FLQA 3UZXA 3GDLA 1EXPA 2QAFA 2O92A 4IQJA 3W71A 4RE2A 1C7TA 3GHTA 5HNUA 3SY8A 2CZFA 4CD5A 1V4YA 4XO7A 4MNLA 1TYGA 3WJXA 1UHVA 3WFLA 3F5JA 1W9VA 3GXFA 2VDGA 3GKFA 1OFBA 1AQFA 3BZGA 3N9SA 1TPVA 3WLHA 2BVWA 4NAFA 4PRTA 5D2YA 3TTQA 3GXIA 4MAZA 1UBSA 1LM1A 1XH1A 1IYXA 5F1VA 1TELA 5CSSA 3RPMA 1GVOA 3LM7A 4M80A 4YN5A 1MEHA 4KQNA 3NQGA 3WF1A 1RQEA 4PMYA 1OIFA 2HEJA 2XU2A 1UR3M 3WQPA 4FLOA 3GH5A 1JDDA 1A0CA 4PB5A 2VQUA 3RCMA 4JTKA 2EPLX 3HQ1A 3QFEA 1ITQA 5D02A 1TTJA 1L2UA 2OU4A 3QRHA 4GPNA 1J5TA 3KRSA 1JCXA 2XFRA 1GJUA 2YW4A 2ZX7A 3A4WA 4J2PA 3SECA 3W74A 3FJ4A 3S83A 2V5CA 4N7QA 3GU1A 2VGIA 3ZVHB 3CUJA 4ZR8A 5ABFA 4WEVX 3VD9A 1W1ZA 2DVXA 4WDXA 3EXRA 1TPC1 3UPBA 2QCGA 4NKCA 2QMKA 3QLDA 4G7FA 1S38A 4B91A 1EC9A 3WLQA 8RUCA 1IEIA 4JCMA 4INFA 5EU9A 1DXFA 1NF7A 1QOPA 4KWSA 3D6NA 1G9HA 5HPOA 7ENLA 1EP2A 1VFLA 4U2YA 3ARWA 3CLWA 4FO4A 3ITVA 4LX4A 3UPMA 4TMCA 4HHLA 1HKKA 4CKQA 3NM1A 4D1JA 4C6JA 1JZ3A 1KFLA 1LUCB 1QI2A 1YNYA 4GBDA 3QPYA 1UZHA 4O1EA 4GQBA 3P5ZA 4M1BA 3GYCA 4EF9A 3H12A 3C0QA 3LSCA 3WBYA 4AQLA 1NWTA 3N9RA 1E0VA 2Z6JA 2OT1A 3GD6A 1ONEA 3OQEA 5BXTA 1M5WA 4UFMA 2ZIDA 1DJXA 3R8GA 3VKAA 2D2JA 3MUZ1 2H3DA 3FV9A 4NAEB 4LCSA 5EPDA 1LWHA 2GQ8A 3KOXA 3TJ4A 3L68A 1SJAA 4AX7A 2HS6A 4QTGA 2H9AA 3WLNA 1LWIA 2HWGA 1OX5A 3Q2DA 2BS9A 2DT0A 1QI4A 1PYFA 1E0WA 3DAQA 5AYIA 1XLJA 2DZWA 1E3XA 4YHGA 4K1WA 3ITLA 1E55A 4DY1A 3NQBA 2ALDA 7TAAA 2Q09A 3CZLA 4NZJA 2VC5A 2OTDA 2QAPA 4H7CA 4LTSA 3TTOA 2XPKA 2XN0A 3UXAA 3W22A 1GZ1A 4BQ2A 1E3ZA 1TO3A 1F3EA 1B30A 4FF5A 1V3KA 3ITGA 4MB4A 1PX4A 1VJIA 2R1NA 4YS1A 1Q65A 1EDGA 3S8HA 4GGHA 1C29A 4O8RA 3WUEA 3VA8A 5I23A 3P62A 3RAOA 5HNTA 5JIPA 4JIEA 1H41A 3H2MA 3BAJA 4NUWA 2ABAA 2OYMA 3URBA 3L67A 3DX5A 4C6PA 3I3EA 4BS0A 1IHIA 3FW6A 1LWJA 1XDLA 4XAYA 3G24A 4DVOA 1GOMA 3ARXA 1Q8AA 1IXQA 3VILA 3TZNA 4GVFA 3TC6A 1RQBA 2EPHA 3H6OA 4PRRA 6TAAA 3W1TA 4HPHA 4H8HA 1FHUA 1GORA 3BLEA 3A3XA 3TC3A 4HYVA 3TTEA 3BWWA 5BZAA 3MUY1 2Y7GA 5HDRA 5CG7A 3WDRA 2VDHA 1BRLA 4XUGA 3AAMA 4JIHA 2QR6A 4IFKA 5A5WA 2V82A 1G4TA 3SJNA 1J01A 2D24A 3UPWA 3BGAA 1EJTC 1FH8A 1WNOA 2EPNA 3LPOA 3POCA 2X42A 3R58A 3TXVA 1BG9A 1AQHA 4FLSA 2OJPA 3LCLA 3CYVA 3IUHA 3E0LA 3RITA 1MNZA 5G2HA 3OBEA 5BXSA 1LZOA 4JDYA 4MY1A 1VENA 2W5FA 1NM9A 5AC5A 1FHVA 2OZ3A 2PWEA 1OZQA 4RL3A 3SQSA 3WMCA 2ZZ2A 4GYPA 1Z44A 3IIZA 1UR0A 2D69A 1PJ9A 3S1XA 1D8WA 1TVNA 1H2JA 4ECLA 4IZGA 1EP1A 1TPUA 2I57A 4LYKA 1D7KA 1RLCL 3UETA 1XLFA 5I79A 1YDVA 4RZBA 4YCOA 2YA0A 3N2CA 3WD2A 3EKLA 1X8CA 4A6GA 3N2OA 1S2UA 1JZ8A 1WBHA 3TWAA 5GJNA 1CGTA 1FXQA 4I9TA 5GNYA 4F3HA 4ZFCA 1AA1B 3DEQA 4U28A 5LA2A 1R2SA 4NZ1A 2AGTA 3SUSA 3FA4A 3W6LA 3GXDA 3BPWA 2P76A 2OEMA 1VR6A 2Q3RA 5L9FA 4MYAA 1UC5A 3LA4A 1AUSL 1E6SM 3GVVA 1T96A 1Y0EA 3ABSA 4X9YA 4N4QA 2TPSA 4HTBA 1ZSXA 1W9BM 4LNCA 3UY8A 1WZMA 2WB5A 1KBIA 1OD0A 4YTRA 1JIBA 2FKPA 2CZEA 4LRSA 4MAVA 5EL1A 2YA1A 1QT1A 4R7JA 1W5QA 3PPGA 4JTGA 4LXFA 2DEPA 4M6UA 3M5ZA 3NEHA 3TOYA 1GVQA 4J3TA 1FH7A 3W7KA 5C9ZA 2OB3A 2VVSA 1QAPA 1E1FA 1MZRA 5H91A 1E6RA 3VXGA 3EWXA 4R9XA 1JUBA 1K4GA 3ZM8A 1LG2A 1JEZA 1UIPA 1XIGA 1DTUA 4XD5A 3CUXA 5ABEA 4O4VA 3H4WA 3OVQA 4GE8A 3C0JA 4GYPC 5LA1A 3DFSA 4HCLA 1IT8A 4ZENA 4OU1A 1EOKA 3UQNA 2DSWA 1W17A 1VC4A 3OP2A 2QPSA 2Y7EA 1TB3A 4E5TA 3OW1A 4KGLA 3KVMA 4B3LA 1JPDX 3KWSA 2WSKA 3VDAA 4L1WA 1TPWA 4AB4A 1BXNA 1GJPA 3LHUA 1J0ZA 6ENLA 5KTLA 2PSNA 4BK9A 1QHPA 4Q8OA 1HP5A 1GG1A 4FR6A 1JGIA 3B8SA 2YDAA 1TVLA 3TJLA 4AMCA 4CCCA 4IUGA 1FWGC 2DUZA 5DANA 3TXZA 3G1SA 3N34A 4PUMA 4WY0F 1M7JA 5E6YA 3ZWTA 2D73A 2DIJA 1KTCA 1QBBA 1KXTA 4QEEA 1XBYA 3ZVIA 2VX7A 4BEUA 1DL3A 3DC0A 1DJYA 2P0OA 3GHUA 3SUTA 3TNBA 4B5TA 2NT1A 3AHZA 4P7RA 3GNRA 4AIUA 1QNQA 4NU7A 3L0NA 4L1XA 1BTMA 4H9YA 3VNIA 4Z2IA 2PURA 4CNTA 5KMYA 3WBAA 4JX5A 1J8VA 2F6KA 3K46A 1W1PA 3WEZA 4W7WA 3VIHA 4TV6A 2XM1A 3PK7A 3M0ZA 3TTSA 1MDRA 2OKOA 4H2CA 3G22A 1IIHA 3LU2A 3P8IA 2XVKA 1F3WA 3TYCA 1U1JA 2E1DA 3H26A 3B03A 3W24A 3V35A 1Z89A 5BOFA 4DYJA 4P7QA 2E68A 4EAMA 2P3ZA 1EXBA 4GJIA 3CHVA 2FH6A 3D0CA 3LMYA 2W6RA 4DPQA 3PBWA 2PDXA 4IMDA 4O1AA 3B3DA 5DQPA 4N42A 2VCAA 4YL2A 5I77A 3M41A 1K02A 3RM9A 3QV8A 4M51A 2Y8KA 3MCOA 3PPFA 1UWAA 3LRMA 1Q6LA 4FS9A 2DGAA 3MY9A 3VGHA 5FL0A 4J4KA 2ZX9A 3S9ZA 2HPMA 4KS0A 1WDQA 5CJNA 3AXIA 3QR0A 1H4PA 2JBMA 2FQIA 1C9WA 2DT1A 3W76A 5I00A 4I5XA 1XRVA 3G3DA 2XIMA 2J78A 1I2NA 1VZWA 1FHLA 1E9ZB 3ARUA 3NQ8A 4Q33A 4Q8WA 5GQBA 1UR9A 3VO0A 3TMQA 2A21A 2V8ZA 3Q37A 1I2OA 1AL7A 3OLDA 2E5CA 3KCJA 2OEJA 2NWRA 2BASA 1IZCA 5M17A 2A7RA 2OZTA 3A4XA 5EMKA 3O07A 1CGWA 3RU8X 4OQVA 1GKRA 1V02A 3M43A 3VIOA 2A85A 3H7RA 3VNZA 4AWTA 3NNTA 5HJXA 2ZXBA 1VHCA 4XWUA 1X1NA 2JGQA 3LHTA 3VIPA 1W9PA 1OCNA 1SSGA 4MTVA 1W1YA 3O63A 1WDWA 5CH9A 4D8LA 1THFD 4LEFA 4ZE4A 1HNYA 3WJZA 1VEMA 5CXPA 4GO8A 3K8KA 4QJ5B 1HTIA 5FF4A 4K3ZA 1XFBA 3EMCA 2I5GA 3RILA 3SN4A 1Q2SA 4AZ6A 4B90A 4PFHA 1Q6RA 4NJIA 1A3WA 3EA2A 3WQFA 3L4TA 1SJBA 4LUTB 1AMYA 3RF9A 1OF6A 4EK7A 1EJVC 3C5QA 3POHA 3B8VA 3PZNA 3DCPA 2JKPA 1GVIA 3ABRA 1PBGA 4DUOA 3EGJA 1EQPA 1NP0A 4H3DA 3WD3A 2X16A 1Z48A 3IIVA 1MUWA 2YCLB 4AZGA 3H54A 1Z7AA 3EB4A 2AKMA 5D03A 1DIEA 2VFEA 4G5DA 4I90A 4I3GA 2OX1A 3CJPA 1N2VA 5EYWA 6REQA 1JJKA 2XFWA 1MFVA 2WQDA 2AOSA 1NDZA 4LAUA 1VQTA 3PBMA 3OLGA 1W3KA 3FEMA 1OT1A 5F7UA 2RDWA 2XIQA 4YLWA 2FIQA 1PEZA 3AHVA 1I75A 1M1BA 4Y9OA 3N2XA 4O1BA 5HNNA 1TV7A 3LPGA 3BCJA 3AYVA 2W67A 2NQ9A 3W84A 4OBSA 4ZL1A 2FHBA 4LAOA 1N82A 1RP9A 1RV8A 1EA0A 3DECA 3U2ZA 5AZ0A 4CQCA 1TPH1 4X2RA 3KBMA 2QIIA 2NXGA 1B3VA 1VD6A 1ENUA 4KRZA 4ZQNA 1SO3A 2WM1A 2POTA 2B31A 1TRIA 3HZ3A 3M16A 4IQEA 1V08A 2OQYA 3MC5A 3N19B 5LXXA 1EBGA 2QXWA 1XIEA 2DY3A 2Z1KA 2WC3A 4MWAB 4MB5A 4ZSTA 2BXYA 4DPPA 1DVJA 1AQ0A 2ZUWA 4KWOA 1CCWB 3IEBA 2YLLA 1IEQA 3CL7A 2EKGA 3XIMA 1UASA 2WANA 5F2LA 4AVNA 4L6OA 2YGYA 4Z2HA 2YDRA 2CESA 1QJWA 3L12A 4HP5A 2WCSA 7CGTA 1LORA 3ABXA 3UJRA 1LTDA 3GXMA 2Z4GA 1TPEA 4E2BA 3MP3A 2BBFA 4NJJA 4S3CA 1H1YA 3ZVHA 3W7NA 2W3ZA 4CCZA 2PTWA 1P1XA 3OBAA 2IPGA 4D6JA 2BHZA 4WD0A 1TWIA 1VIWA 3R0DA 1XRSA 2P88A 3H22A 3RLGA 3W81A 1BQCA 2F2KA 6ALDA 4C6DA 1HKVA 1XYFA 3FVDA 3OGVA 4XD3A 5A8PA 2ZRUA 1OZMA 5E0FA 4E6MA 4O14A 3ITCA 4LUIA 1JDCA 3FDGA 3W0KA 2NVAA 3VFLA 3DFTA 1DXEA 2WHLA 1AJ0A 4D8AA 2V69A 1RCQA 2WCAA 1VBJA 4LT9A 3SSZA 4PR4A 3AMGA 1V0LA 3IJDA 5IOBA 1IT0A 4GIRA 2A6NA 1UC4A 4WUIA 4XZLX 5LZLA 1KCXA 1WZAA 1W32A 1LUCA 4GRSA 4WY0B 2VUYA 1H11A 1O60A 4S3GA 2A3LA 3ONCA 2J27A 2QW5A 4S38A 4CLMA 5M3WA 3AUJA 3W4RA 3WUFA 3SW6A 2BY0A 2OELA 3BOLA 3JU2A 4DZIA 2R94A 4GYFA 3N6QA 3B8TA 4NAEA 2W61A 3BLPX 5HAOA 3EZ4A 1RJQA 4JTHA 1ZL1A 5CZKA 1R0MA 1W3NA 3STGA 5CJ5A 3OA3A 1TCMA 2NQZA 1RJPA 5IBXA 2OOFA 4LCRA 3BW4A 3UESA 3R1ZA 1XRFA 2G5WA 3QGKC 1BYCA 2WOQA 2OLAA 1I0DA 2Y70A 1Y5XA 3LG3A 1ELSA 2I14A 3I7QA 1TV2A 4I9JA 4M6VA 3BG5A 2PDKA 2QDHA 4B4FA 4DXXA 2WMFA 1CECA 3W7EA 2ZUTA 4FNSA 4DO5A 3T0TA 3QSRA 1R6WA 2QCHA 1UD3A 2A4AA 5KEZA 5D2XA 3APTA 4PUWA 3AIVA 4IJCA 3R13A 2PDYA 2EEXA 3ERPA 5LIYX 4MSSA 1HGYA 2AAAA 1LLOA 4YIWA 2VCCA 4LY8A 1H5VA 4JTJA 2I16A 4AZHA 4ZB0A 2YR1A 5B7ZA 3ZO9A 1ISWA 4F0RA 3W1MA 1E40A 4CQDA 3BSMA 3NQDA 2QF7A 2Q01A 1WXJA 4S39A 2WBGA 2UY3A 1F6YA 2PZNA 1C3FA 4OWGA 1WE5A 4DBEA 4IPPA 3U48A 1ZS2A 4OECA 2VGFA 1MUMA 3AIEA 2VMFA 1E0TA 5CBJA 2Y1HA 2PDFA 1UJQA 4IF2A 5HWMA 4UMCA 4XZBA 1U22A 3NGJA 1CTNA 2J8TA 1VYSX 3OQ8A 5CQ1A 5JMUA 5I02A 1XGZA 3MBDA 4UC5A 4ZOCA 4GZEA 1F9CA 1QNOA 1W37A 2VZTA 2A3HA 5K9DA 2ZZ3A 3HMCA 1OK4A 2BB0A 3S1WA 3AIBA 1NIUA 3BSHA 3IAQA 1EA9C 2V3GA 1V6XA 2Y8UA 3LYEA 3ZJ7A 1TG7A 4S3EA 3FSUA 4WXYA 3FYPA 4KWVA 1KGWA 2I56A 5CZJA 3G77A 3CPRA 5FJJA 3VPLA 4DUVA 1S2CA 1TRDA 3SGUA 2C19A 3EEGA 1TWSA 2OODA 4UFIA 3EKZA 3LB0A 4R9OA 2P53A 4RZ5A 4HU4A 1OHLA 1U2YA 1XRTA 5HQEA 1US3A 3IJIA 4GI6A 1CGVA 3NOYA 4A22A 3KVJA 3XISA 2P10A 1IV8A 4W87A 2FVLA 2V3DA 3ABOA 1QW7A 4I5UA 1V6UA 2ZXDA 4AW7A 5IHSA 3WG6A 4K38A 2XZ9A 6TIMA 1GG0A 5DXXA 1EQCA 2PDQA 3HV9A 1TZZA 2B7PA 1UZDA 1S2AA 2NQJA 2BTMA 2GK1B 3W07A 4D6FA 3CUIA 4ZQCA 4XO6A 3ENLA 4XKMA 4EWJA 3TSBA 3RR4A 5K2ZA 1BD0A 1RSCA 1ZPTA 2GUBA 3QSTA 3C3UA 2EJAA 4WSJA 5H2ZA 3KW3A 2AQVA 2QCEA 2F84A 5FOOA 1WOBA 2J62A 3R0KA 2YCKX 1CT5A 3W27A 1FWHC 2CHNA 1H1NA 1KV8A 1J79A 1VPXA 4KIEA 1E70M 3O15A 4AZCB 4U10A 5FAGA 3NQMA 2ALRA 3FJNA 1SR9A 2UY5A 3L4YA 3NO3A 5EMMA 4I7WA 3PN8A 3CQ0A 1FRBA 1OK6A 2O9PA 3ZJ8A 3WQ4A 2GGGA 2OYKA 4ACYA 3C0SA 4FNQA 2PDJA 3H2FA 1W9UA 1FDYA 5GJPA 3GWQA 3M0XA 4AIBA 1TX0A 3N4AA 5DLCA 1BSLA 2XVGA 1P48A 2GZXA 4L1GA 3MV01 3ORWA 2CITA 4TXEA 4GIEA 4KWWA 4D71A 5E6ZA 1E0UA 2VNCA 1KGUA 4XBSA 3VINA 5TBOA 1VKFA 4RW5A 1OC5A 3UYIA 2OO0A 1H7XA 3T78A 4IICA 1KXVA 5AC6A 3QV6A 1MW1A 4TO8A 3BURA 5D8WA 4D8ZA 2V5DA 4C6CA 1CXLA 3PG8A 4PYSA 3E2RA 4AWUA 4PMOA 4YVVA 5AZ1A 3CIXA 2O4QA 3CAKA 1W56A 1D9EA 1UKSA 1TTQA 2XN2A 1W3HA 2PTXA 1OFPA 1V51A 1ISYA 3GFYA 4HB7A 4UFLA 2FDSA 2J25A 3OZOA 4D6IA 3UF9A 1L9WA 1B1YA 3IV3A 4DWSC 5FJUA 3CASA 3FXGA 3DYPA 5K4ZA 3KTSA 1KV5A 4QG6A 4PCTA 5G5IA 1X97A 3W23A 1WCGA 3SCOA 4IPLA 2D0GA 4GVGA 1NFPA 4JN8A 4DX3A 4C91A 2ISFA 2AL2B 1WKFA 3E49A 1EGMA 1CXIA 2X0SA 2OT0A 2QYGA 2V81A 3DENA 2WMHA 1MDLA 2J7EA 2F8QA 1DWIM 2B7OA 4GVIA 1RBLA 4HU3A 4GY0A 1PTAA 2WNWA 3W82A 4Z1DA 4M5PA 2CFFA 5HMEA 3TUUA 1QWGA 1XC4A 4L4PA 3CUGA 3DFYA 3CZJA 4PBGA 3ARRA 1O5XA 4MOZA 2ZXQA 1ADOA 1IXPA 1KWGA 2NV9A 1YQ2A 2DUXA 1NH6A 3QY6A 3L4ZA 2Y62A 2SFPA 1FA2A 3WK2A 2OKTA 1AZ1A 2QPXA 3VFCA 3FVMA 4JTRA 2V6AA 2YL9A 1YDNA 1UQZA 2FB2A 4HZ8A 1XGDA 1AW5A 3BICA 3PFRA 4CD4A 4C6QA 4L6HA 2BOGX 1KM4A 4Z1YA 1XLIA 3LPPA 5F1UA 4DYEA 3VNDA 4US6A 1XBVA 4BA0A 3QC3A 1UWSA 3P67A 1XGEA 3HA1A 1BVNP 3EX6A 1DHKA 2ZCGA 4WGHA 5E5CA 4H19A 3WJYA 3W72A 4XV0A 2R82A 5D2VA 3TJIA 5F4WA 3ARPA 2VFHA 5DELA 4RE0A 1RK6A 2BFGA 4DJDA 3AHTA 2E9MA 1J2WA 2YLAA 4IL0A 4M82A 3A9IA 1XLKA 2XGBA 3WCZA 3FA5A 5HMDA 3W00A 3WQGA 1JYNA 1PL9A 4S23A 2GLKA 4B92A 4AWSA 1EIBA 3DHFA 1VFTA 3CT7A 2BY2A 2CERA 2QVNA 2WMIA 1DTNA 1XSIA 2G50A 4GCXA 4H00A 4L5ZA 1DP0A 3WO8A 3UXKA 1KM5A 5CG0A 4RNHA 1FHDA 3HGRA 1VFSA 3UZZA 3AS0A 4FNTA 1P4CA 3VX0A 4ZQRA 3B0UX 4AIOA 1XYLA 5DT7A 4L65A 4REQA 1WDPA 1RY0A 3S2CA 1GQLA 1HG3A 4A21A 2O9OA 2QNEA 3QHNA 4FA3A 3M0YA 2WVTA 3BAKA 2Y4SA 2INFA 3LGEA 2EHHA 4DBUA 3GS6A 2DH2A 1TZ7A 2OCZA 3WLJA 4JQAA 2Z1XA 1PVNA 2XYLA 1JFHA 4G7EB 4GYJA 3TFCA 2JGYA 1NU5A 4KRUA 1ODUA 1EUNA 1NOWA 4Y7EA 4WR3A 4BY3A 1YPXA 4HZ7A 1XICA 2QHAA 4HQVA 2PWVA 4LC6A 3AIQA 1BKHA 2E67A 5BROA 3LCWA 2Y61A 4RK8A 4FAMA 3DESA 1B9BA 3LCHA 2B0MA 2QCFA 3PWIA 4GH1A 4JOMA 2E77A 4PUKA 4LUTA 4O4WA 3EDKA 1JRBA 3LD5A 4JTAA 4ADTA 3UY7A 3H2CA 2CHOA 3A12A 2V68A 3UA3A 3LZ3A 1FXPA 3N3TA 3NFUA 1WXYA 3CTTA 3C56A 3LX9A 2DZSA 1JZ7A 1KRAC 2QMJA 2ZRXA 3IUDA 2YCLA 3NDYA 2YL5A 1A5KC 2BVDA 3VGGA 3MYOA 5F2IA 3UWVA 3EWUA 3TQ0A 4S3AA 1E71M 2IQTA 3SCNA 1WV2A 2Z2UA 3I10A 5CZ0A 1Q4NX 4W7UA 3GVRA 4S3BA 2G97A 4HCHA 2V2DA 2VJXA 4TOQA 2GUUA 2R24A 1KRMA 3F03K 2X05A 3MO4A 4NZFA 4DELA 2WVSA 1DXIA 2FPVA 4HSHA 1XYAA 3EPMA 1D3CA 2X7WA 3GU9A 4IL2A 4YTQA 2J9XA 1UH4A 3M47A 3UR7A 1TMQA 2OWCA 1DJGA 1A53A 4KMQA 3RG6A 3HIJA 1TE1A 3PUDA 1PHQA 3WDHA 4EACA 4JCLA 3ANUA 4NYYA 4KH2A 4JXCA 1Q85A 1Q66A 3B9NA 2V63A 3F4VA 3PANA 1IF2A 4H6KA 2BHUA 4MWAA 1R47A 2GJLA 3TYBA 3OGSA 1UD8A 1EEXA 2QKFA 1QCWA 1KBJA 3K1DA 2UY2A 2FMOA 5A1AA 2ISWA 4WOQA 2PCEA 1A49A 1V0NA 2VFGA 4ATWA 1WP6A 4PMXA 1EX1A 1BYDA 3IACA 3M6YA 3CAVA 3CMFA 4WGXA 1QO5A 2C79A 3G0SA 5H1WA 2OQLA 1FP8A 4HMEA 4QLKA 5DBUA 3FS2A 4DIAA 3RYSA 5C55A 2C1HA 3FAWA 5CPNA 1JZ6A 5A95A 2R6OA 4C6MA 1OQFA 5FAJA 2GVJA 1UOZA 2WJZA 4Y9NA 2QCMA 2BXZA 3L7RA 4C6IA 1FWEC 1S2WA 4GQ0A 3IJ6A 3P80A 4US5A 3QW4B 4Q6JA 1JVNA 1F05A 1W1A1 3VAVA 5HQMA 5D8ZA 4B15A 4E4FA 1KXHA 1JD7A 4PTMA 4DUWA 1Q6EA 3WNPA 2BP1A 1ZTVA 5HATA 3W7OA 4DI8A 3KL3A 5GVJA 4YNGA 4PTVA 4PUEA 3MUCA 4JTQA 4RXFA 2ZTJA 2QJNA 2PGRA 1EJUC 5DF0A 1QR7A 4BEQA 1QPRA 1EKOA 4XSMA 4E4PA 3KDOA 4QJ4B 4L56A 5ABTA 2RH9A 3B0PA 2OOGA 1JAEA 4GGBA 3FLUA 1LT7A 3SQMA 4B5NA 1CLKA 4B3KA 1I9CB 3TWBA 1MRQA 1PKLA 1I2QA 4JNYA 3OPSA 3BMXA 1E6NA 3OZPA 3RXZA 3ZOAA 3WD0A 4E8GA 1B5TA 3P74A 2OXNA 5EMYA 1MYRA 1R86A 3A24A 4NQ1A 2ZC8A 1NWSA 3GVWA 3LXBA 3BCDA 3II1A 4KEZA 4B5XA 4F2BA 1NWUA 1LRQA 5HR6A 3KE0A 3N25A 2FZDA 1XCFA 4A29A 4N02A 3TLLA 1UUOA 3V1PA 4ILSA 3CQIA 1W54A 2ZZ5A 5K7JA 2WAGA 5E1QA 5C0QA 1AFSA 4EIVA 3CO8A 2YXXA 1W1VA 1W3LA 3TP4A 4H83A 4A2SA 2ZVRA 1ZENA 1L6SA 2DSVA 2ZDSA 5AFDA 5JQ9A 3B97A 3GU2A 4QR6A 1T6MA 1UMLA 4KF1A 3HOJA 2VZSA 1H60A 1FKWA 3CV7A 1WPCA 4GMEA 1X98A 3MP4A 3WLIA 3PZGA 3C2RA 1LT8A 3BH4A 4AG0A 2XISA 1JCTA 2DSUA 3T9PA 2CU0A 4AXKA 4LY4A 2QF8A 4LUJA 1IZJA 3ALFA 4GI4A 4QXIA 8TIMA 4ICNA 1P5BA 2VZVA 4DF2A 2YXOA 4Z08A 9XIMA 3G8RA 5CGMA 2POZA 2ZTKA 2PI6A 5A2AA 4O54A 4GLEA 4UQAA 1P1MA 4LS2A 4N4PA 1BTCA 3GR8A 3OG3A 3KBVA 1XPYA 3WLTA 2ZUVA 2ZYFA 1UKPA 2ZE0A 3VIGA 3KBNA 2NXIA 4GJJA 3L9CA 5BXRA 5FSEC 2C8NA 3VK5A 3NQ7A 3NQVA 3UWUA 4DJED 1UWUA 1TVPA 4A2RA 2YJQA 3B0VC 4LQ1A 4R5EA 2VC9A 3FDKA 2XDFA 4PCNA 5D9NA 2Z1BA 4W89A 3VNKA 4NJHA 4ZOEA 4ONVA 3W7QA 2JF7A 3CQKA 4E8CA 4MIMA 3VC5A 1AD4A 1E72M 3SSJA 1TJPA 3H70A 4AD1A 1OX4B 3IIXA 2MUCA 3OBKA 1NELA 3R7MA 1ZU8A 4MZ8A 4IMFA 1JI2A 3AYRA 1HW6A 4WX2A 4MVAA 1H63A 2HCVA 1F73A 2ZA1A 3QYQA 1QNVA 2DZPA 4NZ3A 2X2GA 3OTRA 5RUBA 2DW6A 3FJ6A 2ON3A 3N2TA 1NDYA 1O5KA 2FGBA 1K7FA 4Q32A 3O6DA 2EQDA 3WH6A 3WMBA 4ACZB 3SEPA 2NUYA 4PBEA 3ZJKA 3MUXA 4Y8FA 4JQ2A 3RX2A 1GKQA 2GK1A 1K8YA 2P8CA 2HISA 1H7OA 2TRSA 1ECQA 3WMLA 1H5YA 3H2NA 3W2KA 4ZTYA 1TJ2A 2OLHA 3MTWA 1ISZA 4K2SA 3QZEA 3BLFA 2QJIA 4HJFA 4DYKA 2DVTA 3AXXA 4LUSB 1ZJIA 3CYJA 3E9AA 3M0JA 1J2BA 2BGNE 4JDBA 3VZYA 2PGWA 5CEWA 1EL3A 3CAWA 4K36A 3C2FA 4DXKA 2NT0A 2VHLA 4XG1A 4M6QA 4AZCA 3B0XA 3KWXA 2XHYA 1WDDA 4O19A 4H8NA 1R46A 3V36A 3L2LA 1EP3A 4PZVA 4BI5A 2PC8A 3MPGA 3SBFA 3KZSA 5EKYA 5EY5A 1RLDA 3C2YA 4QNEA 3BK0A 4LB3A 5DY2A 3EDDA 1E1CB 4MZ1A 2GWGA 4ORIA 1L6WA 3UXIA 2GJPA 2HE8A 2WBKA 2ZXAA 4QJ3B 3EOSA 4P8UA 4FXJA 3N6JA 1RH9A 2A7PA 1SZFA 1E4MM 1RUSA 3KLLA 4KCWA 1CXKA 3VOIA 4CEUC 4EXBA 1PKNA 3M46A 5HWJA 2PLJA 1PZ0A 3L4VA 5AY7A 3W7HA 3HN3A 2YFNA 3ELFA 3RPDA 4BWLC 1S39A 2VEIA 2YBTA 3PSVA 3T07A 5I3HA 4C1KA 1IR2A 4OV4A 4HMNA 3ZS4A 3ABZA 1W5NA 3AICA 1PZ2A 4MKVA 3U5UA 1JDFA 1XH0A 1LLWA 3VM7A 2CLLA 3T09A 1DQWA 1F4HA 3H23A 2YX0A 3GH7A 1EDQA 2VZUA 2MNRA 5DRCA 1NFGA 3IARA 4GFIA 1QPOA 1KBKA 3PY2A 4Q3MA 1YBQA 3MANA 2HNEA 3GZ3A 2UWFA 4UTLA 1T5AA 1MEIA 3E0WA 4YHEA 1W3JA 3P8JA 1MNSA 1PE1A 1R3SA 1M7OA 3VIIA 3E1F1 1XDMA 1WQ5A 3BV4A 1JZ5A 2GJNA 1PO9A 4PMRA 2Z25A 5A6JA 1PIGA 3NPXA 4YYFA 1K77A 3TLQA 1Q5MA 3T4WA 4HKPA 4AH7A 1VRXA 4CQBA 1EPVA 3NXLA 1YW1A 3T81A 4PE8A 4QE5A 2DZAA 1UQYA 4LWWA 4GNKB 1HJXA 1ZNNA 2E9LA 4Y9PA 1HL9A 4IP4A 1JULA 3QN3A 4QLLA 2QCNA 1JNDA 2A5HA 4K68A 4X63A 2G4JA 1I2RA 2X0YA 3CTLA 3ITYA 2V38A 4YWIA 2X30A 3UJ2A 4FOUA 4Q8NA 3B4YA 1EB3A 1BQGA 1ODZA 2D2HA 3HGOA 4FXFA 1S1RA 1A4LA 1HKJA 1OABA 1WBJA 2P0IA 1C8YA 4DNHA 1V6WA 4DWSD 3TW7A 1R2TA 3TVAA 3ONBA 3A5VA 5ECUA 3L0GA 1H09A 2EKCA 3EX1A 4AYGA 3AI0A 3BAIA 4V27A 2BG5A 5EBUA 1HVQA 5LGZA 2VTFA 3QY8A 1A5MC 2X2YA 3N3MA 4L7ZA 3IJ8A 1VLWA 4XAPA 5C9UA 4X3ZA 2X09A 1NDVA 4RNJA 3R12A 2PDPA 3UYCA 2WCGA 2HVOA 3HQPA 4ML4A 5CC7A 3C4UA 1TUFA 1E4IA 2V5KA 3GXNA 3BO9A 2XG9A 2XVNA 5E70A 1ITCA 2ZRVA 1G4EA 4Y2WA 1IQ8A 2NLIA 4I7UA 1CB2A 1XW8A 2GSJA 1BXBA 4FX6M 3ATYA 3WH7A 5LIXX 1UR8A 3TMLA 1WKEA 3W7DA 2EGZA 2NQLA 1F8IA 3KOFA 7ODCA 4LBUA 3UJEA 1LYXA 1DIKA 4NX0A 4GUGA 3O7UA 4GOAA 3DBNA 1NSJA 2JKEA 4JTIA 4ML9A 4LAMA 5TNVA 1VF8A 3HPZA 2UZ9A 1Z3NA 3FJLA 4S3DA 2FFCA 2WVVB 2YPIA 3F7JA 2DIEA 3BE7A 1BGGA 2NQ5A 1XV8A 5DMYA 3IGXA 2VFFA 3GXTA 4P8WA 4TMBA 2Q02A 3F2DA 1JCMP 3LQGA 4S2BA 3W88A 3PB0A 1PKYA 2FB3A 2HV5A 1Z9AA 4Q8QA 3M0IA 2X1TA 1NARA 5J04A 1ONRA 4LEQA 1KGXA 2VI0A 3CUZA 2XM2A 2QJMA 5EMJA 2AKZA 4JYEA 2J47A 4GZ7A 3DN5A 3DFQA 4QROA 3AYSA 4AHQA 3H4XA 2QUNA 4GZIA 4UQBA 2ZX5A 2NWSA 3RM4A 3A6OA 2X0HA 2PP1A 3QKEA 3UJFA 1GOIA 1EHNA 1R38A 4QCFA 5U7SA 1V3IA 2Z28A 3ZSSA 2J88A 3PZ9A 1S2TA 4Z1CA 2WHMA 2CLPA 3G1DA 1K8ZA 3G6LA 2E40A 3O3RA 2G0WA 3RK8A 5J5DA 4F66A 4KEVA 3QF0A 5BRQA 3UXDA 4IXXA 2XTKA 4KT2A 4KFNA 3SADA 3VU2A 2YCIX 1RPXA 1ZRQA 4JQ1A 3SFKA 4J3XA 4FIQA 3IIPA 3MDUA 3HTWA 4UR9A 3WFAA 1IR1A 3TE9A 3GG7A 4K8GA 4MUZA 1T7LA 3WH5A 4LRTA 4IPJA 3UWQA 2CZVA 2ESCA 4BQ4A 3B9DA 4DN1A 1K9DA 1R3YA 3C0LA 1K8CA 3GNOA 5C8BB 3IWPA 4JEJA 1B4KA 2PRHA 1VFOA 1MQRA 3MHFA 2BOEX 1C90A 5M5DA 1V3HA 3A64A 1V02E 1HQTA 3TCEA 4GC4A 3V1HA 2J6VA 3TOPA 3AXHA 4KPLA 3DH7A 3KHDA 1M7PA 4HMDA 1ME7A 3LI0A 3SFWA 2GGIA 3AS3A 1ZBCA 2X41A 1GW1A 1J96A 3MZNA 1OYAA 1FWCC 3RRXA 1TJ0A 3T44A 5A6LA 4TV5A 4GY1A 4HNNA 2DP3A 4F48A 1NFBA 1CW2A 4JFWA 1H7RA 2DU2A 1JR1A 4LJ3A 3B05A 4S3KA 5EMUA 3PJWA 1U83A 1FWTA 2G41A 2PDBA 4CU6A 4UTWA 3NCOA 4WKAA 1XLHA 3L4UA 3WK0A 3MQTA 3PWGA 3CQJA 4ICCX 2W63A 1VS1A 4GY7A 1OT2A 4LVBA 2P8BA 1YADA 4JN6A 1RAKA 4LSBA 2YOCA 2CETA 3TFXA 5LXEA 4HA0A 3TZFA 1YXDA 2YXGA 4XK2A 1XXXA 3GM8A 3N14A 6XIMA 3OZYA 1RD6A 4JTFA 2NVDA 2PODA 4POCA 4H7ZA 1I60A 3SIZA 4RDYA 5CPLA 3O16A 5A6AA 2PWFA 4HD5A 2GOKA 4HJWA 4WJXA 1GPWA 4IJBA 5LA0A 3GNNA 4LAKA 3EOUA 4A8RA 1YXYA 4NILA 3P3BA 1QXLA 3S2MA 1U33A 4H6QA 1S5MA 2FZMA 4TX9A 3WLMA 5HWNA 3B40A 2GGHA 1QK0A 1Q4WA 1FWFC 1A47A 1UBPC 4MDOA 3WJWA 3DYOA 1RVKA 5H8UA 2IKGA 4R53A 4IIFA 5BWFA 3ZSTA 3DFHA 4DJFC 3R79A 1VBUA 2WSQA 3UD6A 1CEOA 2RFGA 5KZDA 1PS9A 1S3HA 3PPCA 1TWZA 1CGYA 2YA2A 4LC8A 2OGYA 5T9BG 4D6HA 1XLCA 5I2UA 3AALA 1QASA 1SPQA 3GX9A 1FWAC 1SU5A 5ENLA 3O0FA 3C86A 1SFJA 2DZTA 1WB0A 2PD5A 2HTMA 4FXRA 5CAHA 2HZGA 3TA9A 5A8QA 4P8XA 3PB2A 3TR9A 4FX7A 2E6AA 3U8GA 4WZHA 3VUSA 1DV7A 3WBXA 4EPBC 1XKYA 2VRQA 1QI3A 4Z17A 3GC5A 3VMOA 2XIBA 3MO7A 4IOTA 1XIDA 4F0KA 4H9XA 1XFCA 2ISSA 1W9DM 1HP4A 4WOZA 3P0XA 2WJEA 3HURA 3IGHX 2J9YA 1CGUA 4O13A 1EDTA 3S1UA 4V33A 3HMJG 3UG3A 3DI1A 3QXBA 4AF0B 2DZUA 4O28A 2C0HA 2VURA 3WQCA 1DE6A 2OG9A 4F4RA 4GISA 4V2XA 3K4DA 4HA4A 1L6FA 3ZT5A 3SCPA 1X39A 1TPFA 2A6LA 4JFVA 4JHZA 4PTNA 4CD6A 3WIJA 2IPJA 1GKPA 4N9DA 3G8EA 4C60A 3SCQA 1VBGA 2FZ8A 3VUPA 4ATDA 3BQ5A 2XSXA 2HBVA 5T91A 2QJJA 3PUGA 3F4CA 3TU9A 2OZ8A 3NZRA 4NT0A 1FCVA 5LIUX 3MKCA 1J10A 1XYCA 4WK9A 2BV9A 2I9EA 4XKYB 3UCDA 3SM0A 1RHCA 1GVYA 4ASTA 4P5UA 4EE9A 1OG6A 3RGTA 3CB8A 5A6KA 5A6BD 1OFEA 4FNPA 4H1ZA 1PIIA 4B4HA 1R30A 1OB0A 2W79A 3RJYA 1HKMA 3AQUA 1C8VA 5D09A 3HM7A 3CV6A 1X7IA 3AFBA 2Z29A 3T40A 4JL1A 4DO6A 3W7CA 3JZEA 2XGIA 2J74A 3BOFA 1J0JA 1S1PA 1R9ZA 2ZDRA 1A5LC 3MKKA 1JCJA 1NOFA 4J2MA 4A3UA 4AVFA 3CPGA 4IIDA 3M7SA 1D7FA 2C1IA 3FFSA 3FAXA 2NXHA 1F07A 2WMKA 1JQVA 3LXCA 3S47A 1G1YA 1VYRA 4GNVA 4MZYA 4XZWA 1XIMA 3I7RA 4O17A 1BWKA 1W5PA 1GVRA 2XFFA 1OC6A 3WNLA 2WPBA 3N13A 3ZIZA 1TREA 1ZUAX 4KKXA 1YNQA 1OX4A 1NY1A 1X38A 1K7EA 5JH2A 4JIIX 3IJQA 4MNMA 4NI3A 3QMRA 4YJ5A 3HPFA 3K4WA 1RP8A 3K30A 3A4AA 3M5XA 3NO5A 3NL3A 1R3QA 4AISA 3F2BA 3IVTA 1V6VA 1TKKA 4GABA 4YWSA 1BSIA 2FLIA 4BQ3A 2EAWA 3TNOA 4MYXA 3WLOA 3TN4A 3P7YA 3CXOA 2V5LA 1V79A 3NSXA 3VKDA 4QCEA 1VCGA 5CSRA 2NX1A 5KZMA 5M2FX 4ACZA 4TVCA 1BYAA 4QG8A 1VEOA 3TAKA 4AD5A 3GK0A 3LCGA 3SCTA 2B4GA 2V3FA 2Z7KA 2QGHA 1IT7A 5MF5A 7PTDA 4NJKA 2BY3A 3LERA 3U5YA 3L21A 3VI2A 3OVRA 1VFHA 4L6DA 3GFXA 4LYQA 4LUSA 3KTCA 1A3XA 2PZ0A 3MKVA 1E9LA 3SGZA 1V0KA 1YE4A 4PEEA 3QBUA 5CSUA 7REQB 2TSYA 2V5BA 3LEPA 4P61A 2E7FA 2XINA 3H55A 4QNWA 4Y6GA 3NL2A 3EOOA