3BAXA

N298s variant of human pancreatic alpha-amylase in complex with azide
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 179
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3baxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3baxA01
4KMQA 4GQQA 2VCAA 5LA1A 5GPRA 2ZUTA 1MWOA 5EFDA 3A4WA 3SUUA 1KQZA 1HVXA 3CZLA 4F79A 3WNMA 3TV8A 1E55A 3VDBA 3K4DA 3ECQA 1UH2A 2CCRA 2V3EA 3LXAA 4JFSA 3ZSSA 2D23A 4LQ1A 3WQWA 1WCGA 1EDGA 4Q22A 3TTSA 4D1IA 2V5DA 3QHNA 3WIJA 3PZIA 1E70M 4ACZB 5C71A 1H49A 2DSUA 2VJXA 3OLGA 1PX8A 3VM5A 3A4XA 1B3YA 3WQ4A 3TONA 1GOIA 1KXHA 2D0FA 1WP6A 1G5AA 5HDRA 2QF8A 3THDA 2V5CA 3AIQA 4R5EA 4PMRA 1DWHM 5EB8A 3S6TA 2WANA 1UD8A 1OGBA 3TOPA 3RJYA 2WPGA 4B3KA 4MADA 2VR5A 4OIFA 1TUXA 3GXPA 2XN1A 1CGYA 3NSNA 5CJ5A 5M3WA 4PRWA 3KEHA 1O6IA 3VIOA 4BQ2A 3LX9A 5D8WA 2GDVA 4UZSA 1MYRA 1KBKA 4U33A 3MMDA 4A3HA 4AIUA 5E70A 1P6WA 1U2YA 2F8QA 1TE1A 3MO4A 1R7AA 3GNRA 1GQIA 3QHMA 1ZS2A 5DO8A 4W84A 1UQZA 2ZUUA 3UG3A 3SUWA 4AD4A 1ITXA 5BYWA 3EJRA 3EDDA 3AHYA 1KGXA 1MW2A 2X8RA 3CO4A 1R33A 4HA3A 4OBSA 4D6HA 5BROA 1QWNA 2W67A 3AZRA 1V3KA 2PWGA 4TX8A 4AXNA 4FNTA 2BV9A 1XYFA 4GZEA 4LYRA 4TTUA 2JF6A 3PZOA 1UWUA 1JZ4A 2J7FA 4CU6A 1ZJBA 2Z1KA 2CBUA 4UQBA 5A6LA 1OT1A 4QFUA 4PSRA 5CGTA 3MI6A 3WNPA 1CXFA 4PTMA 4H04A 4AEEA 4AMWA 2CESA 4CD6A 1B9ZA 4HPGA 3SCRA 1E40A 2WC3A 2WVVA 3WH5A 1W2VA 1QPKA 2D3NA 2VRJA 3GNOA 1J0YA 3L4ZA 3K8KA 1KWGA 5I0DA 4PTVA 1WZMA 2DIEA 4EANA 3AHZA 4OBRA 1ZL1A 2ZX8A 1NQ6A 2JEPA 4MNJA 1LL7A 5AC4A 1BF2A 3CLWA 2XM2A 1UG6A 3DX2A 3POHA 4LYQA 2FHBA 3ARYA 1XSJA 1JF5A 1B2YA 1E1FA 2FH6A 4UOZA 1U33A 4MJ2A 1B1YA 4ZE4A 4UQAA 3GYCA 1WZKA 5A94A 2UY2A 4WKHA 2XIBA 3N11A 1LG1A 2ESCA 2YL5A 1E56A 1DP0A 3DHUA 2F18A 5FIPA 2EXOA 4Z2LA 3CHCA 1MW3A 2EQDA 1E4NA 1TQSA 4GKLA 4XZWA 1QI4A 2WCSA 1NARA 3K4AA 1W3KA 2WVUA 2F1BA 3D51A 4UFJA 5CXPA 4B9YA 3T08A 2CPUA 2VZVA 1D2KA 3CUHA 2HISA 3OB8A 1BYAA 2CHNA 2D0GA 3OLEA 1V6XA 2PB1A 4JFWA 4M1RA 1EOMA 1BYDA 4J3SA 2E40A 1WB0A 1UR0A 1JDDA 3EMCA 4P7NA 3BMWA 1E6SM 2GUYA 1UYQA 2WWDA 4P7RA 2B31A 2F2HA 3QHOA 4JKKA 4D6EA 3MKKA 4W93A 4HOWA 1Q6CA 4W8AA 3PTMA 4CGTA 1QI3A 3OLIA 1UD5A 2WCAA 4PN2A 4PEEA 1R7OA 2PBGA 3W0KA 3WELA 4BZYA 1ZBVA 2MANA 4WKAA 3WNOA 3VIFA 1GOWA 2FHCA 4AMXA 4CD7A 1PIGA 1WZAA 2EPNA 5LA2A 4ATWA 3WBAA 5IHRA 5ABHA 3WNKA 3SCTA 3AMKA 1C90A 1N82A 1E71M 1XH1A 2D3LA 2PWEA 3QR3A 4CD4A 5A3HA 2A3EA 2AOSA 2BVYA 3L4XA 2EACA 3ZOAA 3BVWA 1W3HA 3WBEA 5A8PA 1XCXA 5GNZA 3BAXA 1CGXA 1CXHA 2AMGA 3BC9A 3RMEA 3CC1A 3G6LA 3LMYA 1PZ2A 3WDHA 4C7GA 3WQVA 1E4LA 4EAMA 2ZX9A 4UCFA 1YQ2A 2WXDM 4ZXLA 4HTYA 1LG2A 1X6NA 3II1A 1JNEA 5DF0A 3N12A 1WZLA 3EJSA 3VIGA 1VF8A 5FL1A 4AIEA 1H11A 5IXEA 5EBAA 3HG5A 2WB5A 4XZBA 3AMCA 1CTNA 3AS1A 4L4PA 4JL1A 3VD9A 1LQ0A 3G6MA 2WMGA 4L4OA 1KQYA 1LWJA 1M04A 1JDAA 3N13A 2F7RA 1BHGA 2YBTA 1U30A 1XRVA 2BHZA 2DSKA 5E0CA 4CUCA 1MXDA 2PBOA 2YBUA 3VTRA 1V3HA 1ISYA 2RGMA 1AQHA 3AI0A 1EDTA 1AMYA 4BCEA 2XM1A 3SCNA 4RE2A 5I3DA 1X6LA 3CHDA 3ZT6A 1QI5A 5IFTA 2D0HA 1HNYA 1HJXA 4DUXA 1J0HA 1MVYA 3DHPA 4M29A 4W7VA 4MB4A 3T0AA 1SR0A 2ZUMA 3WN6A 1FH9A 2G3IA 3U7BA 3GXNA 1CECA 4UR9A 1V02E 4N0RA 2BY2A 3FAWA 3CHEA 5I77A 3VNZA 1KGUA 4AZIA 1LLOA 1KCKA 2QPUA 1W91A 3SUSA 1M7XA 1CIUA 2PWFA 2VZSA 4D6CA 2WNWA 3VPLA 5I5RA 1E0XA 4QCEA 1B3WA 1BFNA 4GI9A 3VIMA 3NDYA 2CIPA 2HVMA 3JUGA 1B30A 1TQWA 1CXIA 1SMDA 3T2OA 1B90A 2VI0A 1HT6A 2GFTA 2WVTA 5C8BB 2VUYA 2IUZA 3HG4A 5A6JA 1KXQA 1FFRA 4E4PA 4AZ5A 3IJ9A 5JIPA 4LPCA 1HKKA 5KZ6A 1QHOA 2VURA 2V3DA 2G3NA 1JG9A 1E72M 3AIVA 4K68A 4AY1A 1XD1A 3T2PA 4E8CA 3T0BA 3D50A 3PZQA 4V2XA 1J11A 1Q6GA 3WMSA 2Z1SA 3ZR5A 3ALFA 5CSUA 3K8LA 3GH7A 3OA5A 1ISWA 2XG9A 2DSWA 4AZHA 2UWFA 3O9NA 4HMCA 5A2BA 1TR1A 1UR4A 2FHFA 4NRSA 1GNXA 1J9YA 2WYSA 1UUQA 4CU7A 2XIIA 2G41A 4PMQA 3A4AA 3IGUA 4NXSA 3I3DA 5D4YA 2VX5A 1F4HA 3LXCA 4ATDA 2VCCA 3S5YA 4DO4A 3CMJA 2F61A 1VENA 3SIMA 2DEPA 5CSYA 5ABGA 1UASA 1AVAA 2XVGA 2D20A 3IAPA 3PZUA 1V0KA 9CGTA 3MSGA 1CPUA 4PUEA 3CZEA 4J7RA 1OSEA 1K9DA 5A6KA 2V38A 3WDRA 2EAEA 3CV5A 3W26A 1A3HA 2CERA 1CGUA 1MXGA 1PS3A 4UOJA 4E2OA 7TAAA 2A3BA 2W92A 1W9XA 1CGTA 3VNYA 3HMCA 1UA7A 4AD2A 1G01A 3W82A 4GPNA 3CUGA 5A2AA 2BS9A 4B3LA 3FW6A 4JHOA 4GIAA 3AISA 4DWSA 4HZ6A 1UZ1A 2WK2A 2DT1A 2W4XA 1J0KA 2WZHA 5A95A 1CNVA 1J18A 3MMWA 1FH7A 2EO7A 2QV4A 4AD1A 3DX4A 3VMOA 2Y8VA 3ZT7A 3MUY1 3CPUA 2V3FA 7CGTA 1XV8A 1EOKA 4PTXA 2O9OA 1V6WA 4A3YA 3VINA 1T0OA 1HJUA 4QAWA 3TTOA 1H09A 3DYOA 3WQ8A 2J4GA 3WDPP 1M03A 4CVUA 3ARRA 3PZTA 3CZGA 4ATLA 4YHGA 1WDPA 2OWWA 4FMVA 3OIHA 1QW9A 3UR7A 1US3A 1E43A 2CBIA 1QI0A 4M82A 3GZAA 1C92A 4C7DA 2XFFA 1VB9A 1WE5A 1HXKA 4M8UA 3SCOA 4BA0A 3K8MA 1E3ZA 4W8BA 3WD0A 4B9ZA 1GORA 4TVUA 3CH9A 1BVZA 2YDRA 1W9DM 4PMYA 4PMXA 3WDJA 1HJVA 4NZFA 3VD3A 4D72A 3D4ZA 1JZ5A 1KWKA 3VVGA 5ABFA 2XN2A 5F7UA 3DDFA 2ZX5A 3GBDA 3L4UA 4P7OA 2ALWA 1B31A 2JE8A 2EEXA 4MPKA 1EO5A 1BGAA 4UNIA 1RH9A 5CPTA 4Z2KA 5A6BA 1CGWA 1JYWA 3CHFA 3BUBA 2D1ZA 1FFQA 1DWGM 2EPKX 3LRLA 2CEQA 3SEPA 1K9EA 5A6AA 2AAAA 1ZBKA 1CLVA 5ABEA 1XH2A 2E0PA 1CGVA 3M6DA 4D6GA 1HKJA 3AJ7A 5DT7A 1W32A 4B15A 1NOWA 2DT2A 3VGEA 2WMHA 4W5ZA 1HWWA 4ML4A 2GDUA 4RE3A 2O9RA 2XUCA 1I75A 3SCUA 1OGGA 2G3JA 2E9MA 3LRKA 3PZVA 1XYZA 4S3JA 3DX1A 1W9PA 3WD4A 5E9AA 1ISZA 2DT0A 3OZPA 4JCLA 3BAJA 4LGXA 3WQ5A 2YLLA 3BGAA 1MW0A 1OD0A 3L4VA 3ZIZA 3MMUA 2GK1B 2VO5A 7A3HA 5E1QA 3GXIA 2PF0A 3BVUA 5KEZA 3GXMA 4TVDA 2WC7A 4KGLA 2ZUWA 4JFUA 2O9PA 2W5FA 2VCBA 4MNLA 1CWYA 3PBGA 4PTWA 3WF0A 3AIBA 2Y5EA 2BY0A 1M01A 2VC9A 1JYNA 1NP2A 2GVYA 4WF7A 1PX4A 3AIWA 3D5HA 4B16A 4W7UA 1HKMA 2GJRA 4JHZA 4EE9A 1H41A 1WDSA 4KGJA 2X2IA 3THCA 4UQ9A 5BCAA 4LYPA 5I6SA 1E9LA 2DDXA 1XD0A 4ZE5A 2VX7A 2GJPA 2OYLA 3MU7A 2EPLX 5M5DA 3VIIA 5HNNA 6TAAA 1HXJA 5AY7A 1E6XM 1GW1A 1FH8A 3DX0A 4X0NA 3HG2A 3GM8A 2VVNA 1NOUA 1V6VA 4NRRA 1D7FA 8A3HA 3IJ8A 2Y2WA 4KWUA 2IGTA 3TP4A 1HIZA 2BY3A 2QHAA 3FN9A 1V03A 3NSMA 4M80A 2ZICA 2G8ZA 3PN8A 3NJ3A 3RM9A 1UKTA 1BG9A 3WMBA 4IM4A 4FNQA 3AS0A 1OCQA 1VBRA 1EHAA 1QBBA 4U31A 1E6NA 1NP0A 2D2OA 4XUYA 1TA3B 4CN6A 3RPMA 2A3HA 1JZ2A 5CLWA 2X2YA 3WY4A 5JIWA 3L2MA 5EFFA 2XGBA 1HJSA 3ARVA 4HZ7A 1VFOA 4OKDA 3K46A 2WMIA 3EJTA 5A8MA 2GSJA 2E9LA 3AHXA 4WSJA 4MAZA 3EBVA 3S2CA 2XFYA 2WMFA 3ARQA 4U2ZA 4NZJA 5D8ZA 3WDQA 3AZSA 1TFVA 2ZWZA 4AD0A 1GJUA 1BG4A 3EMQA 3WQ6A 2CYGA 1CXKA 2XWDA 4DM2A 4UZUA 1MFUA 1UR9A 3AMGA 1UKQA 4MB5A 4PBGA 1TMQA 1KFWA 1TVPA 1IZJA 5I24A 3AS3A 1CLXA 1J0IA 3WY3A 4HZ8A 3PZ9A 1KBBA 5DFAA 3VIHA 3NDZA 5JUVA 3AHTA 2PC8A 4YN5A 2Y24A 3BLPX 1GVIA 3BSGA 5FKYA 3CUIA 2G3MA 1MW1A 1C8XA 1R46A 4CVWA 2ZUNA 1JD7A 4UFLA 5FOOA 3BLKA 4U5KA 5LYRA 5HXMA 3CZNA 4EKJA 3ARUA 2JIWA 4P8VA 1EQPA 1E1EA 4ZXOA 3N17A 3EJPA 2C0HA 3MUZ1 3EDJA 3N18A 1ISVA 1K6AA 1NM9A 4FNRA 5D9NA 3KL0A 4GXPA 4UQEA 4JZ5A 1R86A 2GJXB 5CLTA 4D6IA 4WJXA 1BSIA 3U5UA 3AMLA 2VVSA 2F7PA 2E3ZA 2J25A 3W38A 4J27A 2GK1A 1VEPA 1OIFA 3ZJ7A 5M17A 1XSKA 1JAKA 2UY3A 3RDKA 1JYXA 3B8SA 4OUEA 1VIWA 1C93A 2BHYA 2WLYA 1O7AA 2FYVA 1ODZA 1GVYA 1W3JA 2W66A 2V3GA 3U5YA 4AD3A 5I23A 1QNQA 2QMKA 4FLQA 4HOXA 3BCFA 4AYSA 5CQ1A 2O9TA 1SZNA 3QGVA 2J47A 1OT2A 1IV8A 1GOKA 5IHSA 3SCQA 4GQRA 3FAXA 2C7FA 5IDIA 3RM4A 1R87A 3VMPA 4W8LA 4FK9A 2ZIDA 5C70A 4HU8A 1NOFA 3HJEA 1JF6A 4TXEA 3WFZA 5GNXA 4DWSB 3WD2A 2BFGA 2DH2A 4RL3A 4FLRA 2OW7A 4UFHA 2VRQA 3WEZA 4DM1A 2VNCA 2VX4A 1ZU8A 3VDHA 3L2LA 3KZSA 1ZB5A 1R85A 1TQUA 4AYGA 4AMCA 3TTYA 4MAVA 3WL0A 2WCGA 1ZBWA 2YDQA 4MDOA 1V3JA 5FL0A 5E6YA 2ZXAA 4M81A 4N42A 3CZJA 3ZJ6A 3ARSA 2VQUA 2NW0A 3RCNA 4FF5A 4BF7A 4F66A 4HPHA 4OOZA 3WMCA 3F4VA 1ODUA 3L4YA 1VEOA 1JZ3A 1TA3A 4QLJA 1EH9A 3WF1A 1BTCA 1GZJA 1XC6A 4CD5A 3N15A 2JFEX 3UG5A 4QCFA 4U2YA 3RM8A 1QW8A 3TTQA 2E8YA 4WLCA 1GOQA 3F5KA 3MV01 3CMGA 1HTYA 1DEDA 3W28A 5CPQA 2F7QA 1NWTA 4WKFA 1PEZA 2X0HA 2WBKA 3PZNA 8CGTA 2OYMA 2JEQA 4U5IA 2O92A 2A3AA 2XWEA 3KL3A 1F4AA 3ARWA 1JNDA 5AYIA 5ABFB 3AQUA 2YDSA 1V0LA 5JBFA 2NT0A 1OINA 1M53A 2WZIA 3VD5A 5HPOA 3BH4A 3VIKA 2OWXA 2W62A 4LX4A 2CNCA 3OGRA 4NX0A 1NH6A 1GPFA 3MV11 2OLHA 1KGWA 2OSWA 2CKRA 1EDQA 2CHOA 2W61A 3W37A 2DGAA 1GONA 1FHDA 2J77A 3WH9A 2CBVA 4IISA 1R75A 1CXLA 3BAYA 3U57A 3LXBA 3KE0A 2WKLA 4W85A 3F5LA 4Z2IA 1ZBCA 1S46A 4U3AA 1PIFA 3HN3A 4U3CA 1UWQA 1PPIA 1AQ0A 1H3GA 4W89A 2BY1A 5A8NA 3W6MA 2XSBA 1UKPA 1W9UA 2XVPA 1YHTA 4PMZA 1VFUA 3S5ZA 1H0GA 1H5VA 2GJXA 3SCSA 3RILA 3T0DA 3ARTA 4XX6A 4FNUA 4LXFA 1E6RA 4JKLA 4F9JA 3M46A 4W88A 3VSVA 3OBAA 1QHPA 1CBGA 1Y7VA 4KRTA 3CBWA 3WFLA 2WMKA 3UG4A 1E0VA 3NUKA 2J79A 4JL2A 4MNKA 1MQPA 1C91A 2QMJA 3WH6A 3WENA 4H2CA 2J8FA 4KRUA 1WNOA 2XVLA 4AZBA 5FD0A 5A8OA 2YA1A 2YL8A 4MDPA 3BVTA 1UD3A 1EXPA 3WD3A 1LL4A 3BUPA 1UOKA 1QNRA 3IK2A 2J7DA 3KLKA 3FY1A 4PMUA 1TZ7A 1W3LA 1JIBA 4QDMA 2YL6A 3POCA 2PWDA 1H2JA 1Q6FA 1V6UA 2WMJA 2YJQA 1TCMA 3VGBA 2WHLA 3FNDA 4EK7A 1EGZA 3FXYA 5BWFA 1BAGA 1ZJAA 4GI6A 3ZR6A 3WL1A 3AS2A 1Q6EA 3EDKA 3GXDA 4MNMA 3VIPA 4F8XA 2VZTA 3WY2A 1MQRA 1JXKA 4FNSA 1UR2A 1E6PA 1C8YA 2EADA 1JL8A 4AIOA 4BQ5A 3LPPA 2FE0A 2OSXA 3W25A 1PJ9A 2ZUSA 5BXTA 4NI3A 2J78A 6CGTA 3F5JA 1G9HA 3B9EA 3VGFA 3NSXA 2XHYA 1WDRA 4PUDA 4MB1A 1NWRA 2Y8KA 1AQMA 2JALA 1D3CA 1CENA 1IZKA 1K9TA 5FCZA 3UESA 2VRKA 2UY5A 3UEQA 4PCSA 3VD4A 1GHSA 1J12A 5CG0A 2WMIB 5DMYA 1UR1A 4OOUA 3ARZA 3VDCA 2XTKA 4AISA 2BHUA 4FNPA 1DWJM 2W91A 1GCYA 1KTCA 1PAMA 2XYLA 4YPJA 4Z2JA 2WKGA 3PZMA 2Q8XA 3WH7A 3NYDA 3SUVA 4DWSD 3DC0A 4H7VA 4NSBA 2D73A 3DYMA 3BXWA 3CUFA 1NWUA 4JKMA 1BPLB 3EJQA 5E09A 1FP8A 2IXUA 2XJ7A 4TTGA 3EYPA 1US2A 5BXRA 1GOOA 2D22A 2VTFA 3MS8A 5BRQA 5I78A 3MUIA 1B3VA 3VIJA 2WM0A 4CKQA 2ZUVA 4P7LA 3A21A 4R27A 1HVQA 3SUTA 5GNYA 4UFMA 2WZEA 3BUQA 1UD4A 1L8NA 4D71A 3SCWA 1WKYA 3UERA 1WO2A 1DHKA 4IPLA 1SMAA 1E3XA 2WHJA 2YFNA 2DPEA 4PSPA 4UOQA 3WNNA 3QOMA 1PZ3A 2WLZA 1W1TA 1CEOA 4ZEPA 3A23A 4FLSA 1B0IA 1UKSA 2QLYA 3ALGA 1UKOA 3OGVA 1EA9C 1RPKA 1DTUA 3AFBA 1JXJA 3N9KA 1Q4NX 3CZSA 1VEMA 1OM0A 2A3CA 1H1NA 3VKKA 4J28A 2UY4A 2ZWYA 1E6ZA 2VR4A 4J3UA 2EPOA 2J75A 2XVNA 3W6LA 4D6DA 2DSVA 4UTFA 3LPOA 1WDQA 4JIEA 1QWUA 1JYVA 5M03A 1GQKA 3N04A 1HX0A 3CTTA 3OLDA 2CITA 2CKSA 5A6BD 4D6JA 1JZ8A 1RP8A 4GO9A 3HZ3A 1DWFM 3W24A 2F1AA 1V3IA 2J62A 2J7BA 3ZJKA 3BMVA 3AZTA 4H41A 1BLIA 4TX6A 3AHVA 5D9MA 2ZXDA 3ARXA 1JGIA 3IJ7A 4Y7EA 4CCDA 2BVTA 3A6OA 3PTQA 1VFFA 3AOFA 1HF6A 5D9PA 3E1F1 2VZUA 4HMDA 1B3ZA 1DWAM 3PZGA 4QLLA 1VRXA 4UQCA 4URIA 1FP9A 3ZM8A 1JFXA 1BQCA 1UH4A 2DIJA 1GJWA 2VOTA 3AROA 3IAQA 1GQLA 4AZCA 1EO7A 1VJZA 3NCOA 3GTNA 1V3MA 2YIHA 3WNLA 3ZSTA 4UFKA 4PMNA 2YFOA 3IANA 3VX1A 1I1WA 1K9FA 1I1XA 3H53A 1OIMA 3BSHA 1OWQA 1LF1A 4UQDA 1O7DC 1QNSA 2NT1A 4CD8A 3EJUA 4RE4A 4P7QA 2XN0A 1VAHA 3CZKA 1G94A 3A3HA 4AC1X 2VT0A 3CZ8A 2JIEA 2OSYA 2IXVA 2XVKA 1W2PA 4E8DA 2ZE0A 3J7HA 1OB0A 1V0NA 4CCCA 1G0CA 3PHAA 2D24A 1QOXA 3B9DA 1RD6A 1UH3A 3RIKA 1J0ZA 3H55A 2CBJA 3KLLA 3AYRA 3VMNA 2OWCA 1QBAA 3LPGA 2XFRA 1BVNP 3ZJ8A 3WEOA 3HU7A 1ITCA 2ZX6A 3WKZA 1NWSA 4H8UA 3M07A 1CDGA 1LWHA 4P8XA 1CYGA 4CN1A 4ZFMA 4YHEA 2WW5A 4W7WA 4Q7NA 4CN4A 5GQBA 4AW7A 4DO6A 4JFVA 3VGGA 4ACZA 2BXYA 5D9OA 5ECUA 1XGZA 2PI6A 4CU8A 3OGSA 3M7SA 3KWXA 2EJ1A 1C7SA 1LJYA 1E73M 3BAKA 3RJXA 3W81A 4PCTA 1IT0A 1W9VA 5I2UA 1J0JA 1GHRA 3W29A 4HOZA 5A6MA 2CETA 3T2QA 5LA0A 3CGTA 3LPFA 3I3BA 1LL6A 4AD5A 5A8QA 3D3AA 4PMDA 3DYPA 2DQXA 1V6YA 5DEZA 5AYBA 1FOBA 3AIUA 2E4TA 2E8ZA 2XGIA 3H54A 3HG3A 1ISXA 1OGSA 4TUFA 1KR0A 1VFMA 1KXVA 3FHAA 1J10A 4ACYA 3ARPA 1E0WA 1SYTA 4OZOA 3MANA 4S3KA 2NSXA 3AMDA 3AXHA 3SCPA 3BAIA 1JI1A 3CUJA 3L4TA 2DH3A 2YKKA 2WSKA 2VX6A 1UWIA 3OG2A 4M56A 1E6QM 2DT3A 1W1VA 3BCDA 1HP5A 1HJWA 4GZJA 3WUEA 3A24A 3AXXA 2J7EA 2X09A 3W27A 1X1NA 4MB3A 4NXKA 1ECEA 4V27A 3VOCA 1JD9A 1TG7A 1H0IA 2F7OA 4ZENA 5BRPA 4GI8A 1TVNA 1HL9A 1V02A 4JAWA 1XSIA 2OW6A 4QLKA 3WEMA 1QVBA 1UQYA 4AWEA 3BVVA 1KTBA 3BVXA 1OBAA 2J7CA 3GXTA 2J7GA 5A69A 1UWSA 1HL8A 3BLBA 3AIRA 5CZKA 3WH8A 2XSAA 3ZO9A 4WIWA 3GBEA 2ZX7A 4J3WA 2CXGA 2WHMA 4GINA 4Z2GA 4OJYA 1C3FA 4D6FA 2WSPA 4J3VA 2J7HA 3DX3A 3K1DA 4H8HA 1VJSA 3BUDA 4XV0A 4MTVA 1C7TA 3UETA 1FA2A 3D4YA 1Q6DA 5HBFA 3VSUA 4TVCA 1WPCA 1KB3A 3GH5A 1BGGA 3D52A 4JCMA 5AC5A 3B9AA 1XHGA 3A47A 3EMZA 3L4WA 2WC4A 1QNOA 1JI2A 1V3LA 1UHVA 3UR8A 4DO5A 2YL9A 1UD2A 3OZOA 4BQ4A 4A4AA 4PMOA 2WWCA 4C7FA 3VM7A 1KCLA 5EMYA 4PYSA 3WSUA 3GNPA 1GUVA 1JDCA 3BUIA 4WK9A 1J01A 2OYKA 2XPKA 2YLAA 4DUWA 1W1YA 3ZQ9A 1V08A 3VU2A 3AICA 4TOQA 3MUAA 1UWTA 4X9YA 4P8UA 4AZGA 1BYCA 3TA9A 4F9DA 1A47A 3APGA 4GO8A 2FGZA 5CGMA 4D1JA 4H8VA 2EBNA 3RO8A 3WF2A 2G4FA 2WAGA 1UR8A 3WY1A 3VX0A 2VQTA 3FHQA 3DECA 1UWRA 2FH8A 1E4IA 3I3EA 1XCWA 4IPNB 1KXTA 4UFIA 5TD4A 1C8QA 3GH4A 4DUVA 3AXIA 2YA2A 1SFSA 1W1PA 1RP9A 1L0PA 3O6AA 4DWSC 2J74A 4AZ7A 3SURA 2WVSA 4W86A 1GQJA 3DDGA 5BXSA 1JAEA 4HMEA 5DT5A 3VD7A 3WF3A 4MJ4A 1QI2A 3MSDA 1TQTA 2ZXBA 4J3TA 2VMFA 2ZOXA 3ZMRA 2WBGA 1DWIM 1QHZA 5E6ZA 1E5NA 5CPSA 1TQVA 3O2LA 2W63A 3LRMA 3WUGA 1UD6A 5I79A 4WSKA 2QPSA 2X05A 1FHLA 4BS0A 2ZXQA 2PWHA 2X1IA 4KH2A 4HP5A 1QNPA 2VL4A 5HOSA 3VGDA 2RGLA 3AYSA 5JBEA 2Y4SA 1CZ1A 4NF7A 3ZT5A 4FLOA 3W53A 4GZIA 1JZ7A 1GOMA 1Z32X 1HP4A 4BQ3A 3WDIA 1B3XA 2DSZA 1E15A 2TAAA 3VO0A 1HJQA 4QP0A 3QOKA 4XB3A 1EHNA 3VSTA 4HU0A 1R47A 1EQCA 2BXZA 2C8NA 2EPMX 4M24A 1H4PA 3VILA 5A6SA 3GDBA 1WAWA 3GXFA 1JFHA 3WUBA 1PX3A 2X2HA 1UA3A 3BAWA 1W9BM 1R34A 5HPCA 2YA0A 1ESWA 4V28A 1CXEA 2JF7A 3UCQA 5E0FA 2WHKA 5BXPA 2YOCA 4PMVA 3A5VA 1QX1A 4HA4A 1E5JA 4OGZA 2X0YA 3N1AA 4AZCB 2WVVB 1MFVA 1HKIA 3AIEA 3WD1A 2BNJA 1OD8A 4HA1A 4AEFA 2VZOA 1XH0A 2J8GA 3NIYA 3KL5A 2BVDA 1V0MA 4IUGA 3VDAA 1G1YA 4P8WA 2X2JA 6A3HA 3VGHA 3CIVA 3PTKA 1JZ6A 5IFPA 1VBUA 3WF4A 3T09A 2E9BA 1BYBA 4JFTA 4AZ6A 2FDMA 5JBDA 4Z2HA 3W4RA 1R8LA 2EABA 1E4MM 4W87A 4CCEA 4W5UA 3SCVA 3A22A 2FGLA 1MQQA 3EDEA 4X0VA 1KR1A 3U7VA 3EDFA 4NZCA 5A1AA 4J3XA 1PBGA 1UZ4A 3VUPA 1EIBA 5A2CA 1HN1A 3WUFA
chains in the Genus database with same CATH superfamily
4KMQA 1VADA 5EFDA 3SUUA 7REQA 1SZEA 2V9DA 2JJUA 4IHCA 3UJEA 1ROWA 3CPLB 4WUKH 2CQVA 3LXAA 4HUWA 1WCGA 4FOKA 3UXLA 4HWNA 1DUYA 1I9CB 2B9AA 4JNYA 1KJVA 3NN8A 2VOMA 1A6TA 4NZTL 5FDWB 1KPUA 2PP0A 2R9RA 2GHWB 4Z7IA 2APSA 1NAL1 3WK3A 4MADA 3V0EA 2C79A 2QUUA 3WQFA 4MLRA 4C6FA 4WO0A 4DXKA 1H7WA 3X1GA 3KPPA 4XVSL 4OI8A 4BQ2A 3Q1EA 3LN5B 3KD4A 5E1HB 3NL6A 2WXNA 2ZRUA 2F9BT 5JPMB 4S23A 5IKCA 3QARA 4LUSB 1U2CA 1U3HB 4Y19B 4ONGL 3EW3B 1GKOA 2H4EA 5BROA 2B4GA 3T0XA 1EDYA 2QULA 5I66A 1AKJB 4KXZI 3KLHC 2JLLA 4FQXA 2G60H 3CFCH 3RPDA 5C1MB 4YXHL 2WZ5A 4H04A 1M42A 3FQ4A 2IH8A 5DTFB 2WJEA 3KNBA 2XA8L 3SO5A 4O10A 4PZVA 5CNHA 2DW5A 1XEDA 1J0YA 5I8OL 1OCJA 1TTIA 2ZX8A 2NR6A 3BVDB 4E6MA 2XM2A 3WQPA 2ISWA 1KLFA 2GCYB 4FTVB 4DP5X 3KS0J 3TBWB 4LSRH 2DKUA 1WZKA 4GGHA 4RXGA 4AV0A 5T1DL 5FIPA 1JK8B 2A9MH 4FFZA 1E4NA 1EJXC 1XIBA 2VDGA 1GPWA 1QI4A 4HS8L 4DO7A 4GHRA 1UP3A 5CPMA 5DJDB 5CXPA 4GJ1A 4I7UA 3CUHA 2WQWA 5IB5B 5HHQA 3LD8B 4ROQA 3TN0A 3SJVB 3TO4B 1KCXA 4PTNA 5BOZG 2W80C 3W0WA 4NP9A 1OSZB 3EMCA 1D9KC 3BMWA 3ZYJA 1MFNA 4ODVH 1O6SA 1WIPA 2WNKA 3ROOB 4KT2A 3W73A 4Z1BA 2XWXA 4W9IC 5I71B 1KCBA 3RPIA 1TJGL 2Z1WA 3RWHB 4R5TA 3R7RA 3VIFA 4E41E 1PZBA 3VXRB 5KAQG 4OJFL 1NC4D 1XH1A 2D3LA 4NZUH 3T8LA 3L4XA 3EKCA 4QGTA 4QR6A 1O1HA 4I9JA 1VBJA 4IBTA 1F4WL 1YHPA 4MZIA 1FYTE 3NSCA 2A38A 1EEXA 2VLRB 2XTJB 3B4NA 2E09A 4XZBA 3PWVA 4OFQA 2GSIB 4AENA 4R5VA 4IMAA 4IS6A 3E6HB 2I07B 3VA2C 1U30A 2DSKA 4JR5A 4CUCA 2PURA 2RGMA 3PJUA 4BF9A 4NQXB 3SQBA 3P4MA 3KVQA 3TIDB 5SWQA 5I3DA 1QOQA 3CHDA 3S9YA 1RLDA 1HNYA 4A2GA 1PKMA 4P57A 2ZPKH 5HVHB 4Y16C 4OU3A 3STLA 1ZA3B 3NOEA 3GZ3A 4WI0B 4UTAH 1MQ8A 3RY6C 1QPOA 2E6PA 4URKA 3I2CL 4PJEA 2F58H 1W91A 4DJDC 1VADB 2PWFA 4IRJD 1YLBB 3QO0B 5GS0L 7REQB 4XQ6A 4LL4A 2CIPA 5LIKX 1B30A 3GEFA 1TQWA 4OZIA 2CUAA 2VI0A 4QT5A 3B7RL 3TBVB 3IFLH 4N25A 1X7SA 1DUYB 4AZ5A 4N9DA 4X7FC 1KJVB 3NN8B 4YSUA 2VWSA 2VEIA 4E8CA 4RDQF 4PJ8D 3RVWC 2HVOA 5IOKA 2P5ED 1J11A 4XR8C 4F2BA 1JGEA 5SX4I 3ZR5A 5AAWC 4AZHA 4H9VA 3KPPB 4M7KL 2DMHA 1X5ZA 1MRAA 2IV9A 3W39A 4ATDA 2O5XH 2J5LC 4YSAA 4JTDA 1QFWH 1HZKA 3NJIA 1DXIA 2DKSA 2PWUA 1KCWA 4YBLB 1AHKA 4NO5A 3RKDC 4UU9A 2I9TA 3QCTH 3L1OL 4K6AA 3H6OA 1EO8H 4FQXB 1W9XA 2WTRA 4LK4A 2IXQA 1IR1A 1CFTB 3GSXA 3UOAB 5EB9A 3KNBB 2BS9A 4DP7X 2HTKD 2ZDSA 4DWSA 3FQUB 3RY5A 1UZ1A 2DT1A 4GAAA 5AVWB 1TYGA 1FPTH 3ELFA 1JCYA 2IPGA 4FABL 5BUPA 4IRSA 1LLAA 4N28A 1KLFB 6TIMA 5KS9F 2TODA 4YTRA 3ARDB 1KC7A 1IRAY 1VC4A 2PCXA 3HPZA 4KQ0A 4FMKA 2X1RA 4DP6X 5IRPA 3P8IA 3M44A 4XB8A 2OMTA 1HQRA 1RSCA 3CN2A 1HQTA 3W76A 2VDNB 5GS2D 4RZ4A 2MUCA 1GG1A 3CL8A 3SECA 2DKMA 4JQVA 1KEMH 3WD0A 5IB2A 3FA3A 2J6XA 1PLAA 1KENL 5HHQB 3UDWC 5ABFA 2MHAA 5IHLB 3QXDB 3OKLA 1XTLA 3CXDL 2EEXA 4MPKA 3HPJB 2OR2A 3CD4A 2E59A 4Z2KA 1XVSA 1BWVA 2DBLH 2P43B 3ZL2A 4X4MA 2PTTB 3WFCH 2VSDA 5JXEC 1PZAA 3KBEA 3QG6A 3RPIB 4MA1B 3MHFA 4AM0B 4FHKA 1A7QH 2UZIL 4X6CF 3BLEA 2WMHA 2GDUA 4LEEA 2XUCA 2F0CA 2HCVA 3S8FB 4PP1C 3WFEH 1ZCOA 2H45A 3A6BL 2YLLA 1MW0A 3V0DA 2BZCA 1F45A 4AM0Q 3PPGA 4HIIA 5BOPA 4L29A 1ZVYA 2R1LA 2G5RA 3PWVB 2HG0A 3BO9A 2YS4A 4AENB 4P5TA 1KB5B 4NCC2 4XSLA 4YXKH 4KFMA 2XZCH 1BWKA 2DLIA 2XSKA 2Q7YA 1HEJC 3B3DA 3S5LA 1FRGH 3P84A 5SWSA 3SQBB 1GPOL 3DGGA 3VIIA 1X39A 3W7PA 1II4E 2R91A 2MCPL 1V6VA 3QUYB 1CZ8H 3HI5L 3UT0A 4C59B 1KLGB 1WWAX 4P57B 3AUWB 2CNYA 4M80A 3X17A 3PHQA 3STLB 5ABTA 3SSZA 3FJTA 3P8JA 2CWNA 4N5UA 1TA3B 4XZUB 3HLKA 2LU3A 1ZP4A 3O05A 5A8MA 5GRVL 4KI5F 3D9AH 2XV6B 2QJMA 4KXDA 3GIYA 4NNCA 4K7PH 2ZWZA 4QRQB 3EMQA 4LGRB 3JUZA 4KY1L 3HUJF 4DM2A 1SJBA 1XWVA 1J6OA 1WUNT 4P5KB 3BSGA 3QZLA 4WTZG 3SBRA 5FKYA 2WBJA 2ZZ7A 4WFFD 5E7FA 1KT2A 4I5BA 4U5KA 1W0VA 2NTFB 2C0HA 5GRVK 4K7VA 3HI1B 5D9NA 4Q6XA 2VXSH 3W39B 3AREA 3WLSA 3O2DL 4D6IA 5KJRL 3HR6A 3QIWC 3V3WA 4RGOL 3WAKA 3AMLA 4XC1H 3E2HB 5FA5A 5M17A 2L4OA 2A5UA 4NO5B 3WIHL 1MHPL 4M5YH 4UU9B 2I9TB 5I6MA 3OAZK 4XCEA 3AFLA 5K69A 2ERJB 1IV8A 2PDXA 4NYLA 2WUBL 1NFGA 3IT8D 2HXAA 2WTRB 2B4CL 5B8CA 2IXQB 4YBQD 1JULA 3F8UB 4DWSB 3T6VA 1RZFL 4UFHA 3WEZA 2R1NA 2ITFA 3WMLA 1OXYA 2IS7A 3KZSA 4IRSB 4AYGA 3TTYA 4HIEA 2ZCKH 1IC7L 3GE7A 1LXMA 1T4WA 3GI9H 2NW2A 4NN5C 2Q8LA 4J8QA 4EI5C 5D1XC 1UGKA 2FZ3A 4P5SA 1H60A 5D33A 1M68A 3TTQA 2E8YA 2Y6SC 2X70A 4EEEA 3TJHD 4H3DA 2GI7A 5IB2B 1EGVA 4O53A 1F3DH 4N2BA 2OZ4A 4YDLB 1P1MA 3PABA 5ABFB 3AQUA 4EDXA 2XCMC 4NWUL 5HPOA 3OKLB 2G37A 2R8WA 4MKSA 4QIRA 5ECJE 4IBWA 3DFHA 1MCKA 4RISH 5EU7E 3UAEA 3W37A 4POUB 1EJUC 4OF5A 2O72A 3BAYA 5CPOA 1R5VB 1OK0A 5MP6H 3Q01A 4TTDD 3SYCA 3QG6B 4J2MA 1GL4B 2AVGA 2E76C 2JJTC 3PANA 5CAHA 1AOZA 2VQ4A 2IPKA 2DQIL 2V4LA 1I7TA 1TTBA 5CJMA 3VXUD 3IGFA 1E6RA 5KSUB 3Q67A 3Q9QA 3VRIA 4PUKA 2E9IA 2YSTA 3OBAA 2NNFA 2DLFH 1FZMB 3VXNA 3ZWSA 5JZ7D 3ZTJG 4MNKA 2VLJA 2J8FA 3M0VA 4L29B 4HNLA 1TNMA 5F3HB 4F58L 4B3ZA 3NXFA 5GRJH 1RCOB 2EEBA 1P5UC 5C0FA 2DM4A 2V8MA 2PP3A 1CDJA 1YUKB 4H0GA 2Q7YB 1J5CA 3BZ5A 1OLLA 1HL2A 3DGGB 4PAZA 2CO4A 1K1DA 5I6NA 2NX9A 3DTXA 4B5EA 3I85A 4IU3B 1QSEA 1UR2A 4B97A 3PHQB 2OSXA 3L7FA 3X3GH 3R8HA 4M1CC 3HPFA 3IGLA 2CLIA 1T83A 1YQVH 4X5XB 2Y8KA 2X4PA 4LOEA 4LCYA 1CENA 5IFAL 4IIZA 4UTKA 4WTQA 3VD2A 4ICXA 4JREB 3V6OE 4X7SL 3KOWA 2NY0C 4P2QA 5D6DC 2C7UB 3JQOB 5E4OA 2PF6A 3JU2A 4KW2A 1Y6MR 4NNXA 3NL5A 2AVFA 2R94A 1NIAA 3OPUA 1DSFL 4MY9A 1FIGH 3D08A 1X5IA 3QUZA 2Q6WA 2AABH 3A4FA 5KW9L 4GP4B 4BKNA 3SGJA 2P50A 4R27A 2BP0A 3X12A 1IYXA 3AAMA 4GBXD 4EPSA 4I5BB 3OAUH 2EH8L 4HIBA 3ESOA 1U5HA 3WNNA 1CEOA 4HEPA 3CDGA 5D7IF 3AAZA 3QEHA 4Y4FD 1TVHA 3NSDA 5CN1A 2DY2A 1NFDE 3S35H 1R3TA 5E00A 3FF8A 4Z7QB 3SHSA 3U79A 4XX1G 5M03A 3UTOA 3ZW3A 1L9TA 4D6JA 1JN6B 3V0FA 5KOMC 5ISZA 1Q94B 1OHQA 1E50A 2RTTA 1TEFA 3AOFA 2CK0H 2KQMA 4JUSA 5I1AB 5HHNA 1I3UA 2VOTA 4XX1E 2VE6A 5I1IH 4OCSH 1D3GA 1OIMA 2YQGA 2NT1A 4KF1A 4WWID 4RE4A 1VAHA 4BE5A 2BVOB 3UG8A 3K71B 1JHLL 3BPNC 3IBOA 5EHFA 3VRLE 4BGLA 5JO5B 2NW2B 4Y5YC 4DJMA 5DFWH 1F05A 4YS4A 2FZ3B 4JRWA 2NXZC 2X70B 2R1MA 5I8KH 5C3TA 1VPQA 2XLLA 2Q3ZA 3QZPA 1WS8A 3ALXA 2YRLA 1UPMB 3ZDYB 4RBPH 2V9UA 3M07A 1LWHA 3R8RA 2GG1A 3R11A 5IWLC 2AXFB 3LZPA 3ZKND 1NFIB 4C6IA 1KLZA 4P23C 4FHAA 1A6VL 5DI8A 4YDKH 3LPFA 4AD5A 5A8QA 3D3AA 4PMDA 1XF1A 1GA2A 4Q9RH 5K59F 4KFNA 1DBBH 5ACZA 3DXAE 1JV2A 4UTBL 2ADFL 3CVBA 5TQ2L 3IVUA 3C09B 5FO7B 1KXVA 1BM3H 1I7TB 4Q0XH 1IB5A 4S3KA 4OB5L 1E8ZA 4HNOA 3KW8A 1N4XL 2EG7A 1BZ9A 1GVQA 4C4BA 3VRIB 4FFWC 3CPRA 1QSFA 3MR9B 3R06A 1U42A 3VXNB 1UTDA 1ICPA 3EYOA 3SPJA 1T7XA 1X1NA 2VCOA 4BSJA 1R5YA 5KN5B 3K13A 1V02A 1G6RL 3WEMA 1NCBL 2XPYA 5DRIA 2HFGL 3PGFH 3OZ9L 2NVCA 2J7GA 3G7TA 4ZMTA 1QD0A 2OG9A 1I4FA 3ZO9A 2CMRL 2A9NH 3JWOL 3BW4A 4W4OA 2FJUB 3ZXAC 4FOUA 1EJWC 1A9BA 4DZ5A 4KTGA 5HYIA 2RACA 1RJLB 4WKZB 2QCGA 4YDJB 1FDLH 3PAZA 3O0RL 3QNZB 1TJRA 3DTXB 3MV9E 3QC0A 2K78A 3W2MA 4JN2B 1IGJA 1YDPA 2YQ3A 5IG7A 3KPRE 1ZXQA 4AWUA 4BQ4A 1KJ2H 4L3AA 2CRZA 2A83B 5EMYA 1JDCA 3NRPA 2OYKA 1FCQA 5GJTH 3NZSA 4AZGA 1XX1A 1F90H 3STBA 3CJJA 5CGMA 2EBNA 4NN7C 1HYSC 4DQAA 2RMNA 3MRDA 1VPXA 1XCWA 3I02B 3LVEA 2OU4A 4Z1AA 4IHOA 4RRPM 1TTPA 1Q8MA 3MWCA 4AZ7A 3QUZB 2WVSA 2BP0B 5AB1A 4QXTA 1CVRA 4Z0SA 1A14H 4ZTOL 1Z69A 3MSDA 3KWVA 3GGWB 2WZMA 4F15C 2W63A 5IVXB 5HI5D 1FN4A 1P9MA 3FSTA 4ODXA 3AAZB 3ENLA 4UCGA 2PWHA 5ID1B 3KXFE 2D31A 2A4CA 3K1KC 4PRHE 1CFSA 1Z9SA 3WL9A 1FWFC 4HCRH 3UWYA 1H3PL 5LSMA 3ZZ1A 5BW6A 2G5BA 1XCQA 5F7FA 3TXVA 3R8QA 2V9TA 2F08A 2DV0A 2B5IB 5ENWA 2X2HA 3IWUA 1F3RB 1Q0XH 3UBGA 2EDLA 4PWGA 5ISZB 5IP4A 1LYXA 1O12A 1SZRA 2HMCA 2VLMD 2NLIA 3O11A 4POZD 4DPQA 4LAUA 3EYSH 2R23A 1HAWA 4ZXBA 1NDVA 1YEJL 4YSPA 2VLKE 2HXUA 3CSBA 2ZKXA 2BVEA 1G1CA 3MXWL 3CIVA 2Z3FA 4N2YA 5IESL 3SFKA 1QW7A 1NCUA 3PDGA 5I7GA 4FFYH 3QR2A 4NOFA 2FJSA 3H22A 3N14A 2PYEE 3O15A 2VZ1A 4J3XA 2H9AA 2OM5A 2DZPA 1OY3B 4JO1H 3ZKSD 2NNCA 5HTSA 1EJFA 2COVD 2CCRA 4X6DE 4PWJA 2J5WA 3CSYB 1W54A 3E8VA 4J1OA 4Q22A 3I84A 4D1IA 5CWSB 3QHNA 3NCWA 1GVOA 2DSUA 5GGRA 3LJ3A 1BBDH 4UV4L 4GP5B 1REQA 3WQ4A 4L80A 1OTUD 5HDRA 5D4JA 3QFDB 4IXXA 3O3AA 4RX4A 4H83A 1W72L 4UYQA 4KCVA 3H4XA 1U8JA 3GXPA 1MRFL 1CMOA 1CGYA 4AHQA 1GVFA 5ACZB 2Z26A 2EVFA 2C3XA 2L7EA 3ARFD 3W7CA 3RGVD 5KZCB 5ECGA 1BZ9B 1RJZA 1XF4B 1UQZA 1ZDQA 1QSFB 3R06B 2XV3A 4JZNA 2OYPA 2FUTA 4KMTH 4RV8A 3S83A 2W67A 1V3KA 4FNTA 3VNIA 2YRBA 4MYXA 5IQOA 4LMQE 4QMEA 2ZF9A 4PBXA 4Q97A 1AZVA 1I4FB 2J8HA 4AMWA 3O9WA 1FY6A 2DW6A 1QLEH 1INDL 2G5WA 1A9BB 4AG4H 1FNEA 4Y2DD 1QPKA 5KINA 1J9QA 1KWGA 1CE1L 1Z3GL 2RD0A 1VCAA 4NFBA 4NAFA 4OQTL 3AXLB 3W3OA 2H0PA 4EXKA 1YDPB 5IG7B 4MJ2A 5CIPH 4JFFE 3RWIB 4A8NA 8TIMA 2DVTA 2INEA 3HS0A 2XRAL 3ES7A 3MBFA 1PY4A 2PLKA 3K72B 2WP3O 3B0UX 1QLFA 2NCEA 3LCIA 3GI8H 4HNUA 4GABA 1L7IL 4OZGF 2HTLD 3UCRA 3TYUA 5IOBA 3FTSA 3GSNB 5BUAA 2MOVA 1B0GA 4JB9L 2QDGA 1NGYA 3MRDB 5JIIA 3N44B 2DZBA 1YDNA 4XBEH 3QCVL 4IJCA 4HBCH 3WO8A 2WWDA 4DBDA 1EAJA 4KWVA 3IRZA 4W93A 4NC0B 3GMPA 3MBEC 1NL0L 4L1LA 1EWEA 5CLYA 1MCIA 1KY6A 4CVZB 4QRPB 4QXTB 3V95A 1GOWA 1TQCC 4NIYE 3V0VA 4ATWA 1W56A 1E71M 1FN4B 4IBUA 2IMRA 3G24A 2EE3A 3Q4DA 1JFQH 4PRID 2EXYD 2UXGA 4L3FA 2Z28A 4I87A 1CFSB 3M1BA 5KVGH 2CU9A 4N3TA 5CBBA 5L6YL 2MNUA 4LSBA 3P3YA 2G5BB 3VFOA 1GQNA 2ZZ6A 4WI8A 4DP9X 3LQZA 3NA4A 1LQ0A 4KPHH 5I0XA 2WZTA 2WNXA 4E4UA 1A3XA 3PQYE 1MIEH 4LSSL 5KVDL 4GKZA 3B9KA 2NX1A 4ZXBB 3WEAA 1UURA 1R3YA 4TXVB 3BRFA 4TNEA 4JKPL 5TPWH 4PS3A 1L9RA 4APQD 1MVUA 4BIKA 3Q1SL 1F4YL 2F7IA 3ASWA 4N0RA 4AXKA 1ZK5A 3USBA 2BDNH 1KGUA 2BIMA 2V7HA 4EMZA 2H9AB 2ADJB 5D70L 1IEVA 4DWHA 1KCUL 2C5DC 3N43F 1N8IA 3EGSA 1I7UA 1NCHA 3GJEA 4LP8A 3V52H 3VB9A 1E9QA 1LK2B 3VXGA 4PJ9D 1WXZA 4MSSA 1TG8A 4WEUD 5HDOA 1SVDA 3VI4E 4IMCA 2QHLA 1REQB 4RWYL 4DJFD 1RAKA 1JG9A 3B3IA 3DURA 3IIPA 3T2PA 3I6GB 1MEXH 1P7BA 1C1EH 3MZTA 4IGHA 2Y1ZA 4XBJA 1WTLA 2Z27A 4N2FA 5GGUA 1E8WA 1O5QA 2FX7H 3P81A 1U8JB 3HPLB 1YMHA 3ZDZF 3TAKA 4RFOH 4FQPA 4HMCA 3XISA 1N5YL 3MJMA 4DKEL 4PJ5D 4HK0A 2XQBH 4R84A 1GMEA 1MCSA 3W7IA 4DO4A 1RJZB 5LIUX 3VG9B 1T1WB 1TWDA 2I7SA 4S3GA 2NQZA 3U2IA 3QDJB 3SRHA 3FEQA 3E5BA 4H8WH 2B7OA 1H7RA 4OSUH 5CCHE 1CD9B 4L8BB 3UAAA 4LWWA 4Y4KC 4RV3A 4X9SA 1BZOA 5E6RB 3O9WB 1CDIA 3MLZH 1FNEB 3QNFA 2PDMA 3F7JA 3GMLA 2DDQH 3AC0A 1R9XA 3O3DA 2VC5A 5D1XE 5DO2D 3ZFHA 1INEH 3IVKB 4HH9B 4G70B 4Y9CA 2E27L 3QI9A 2IPTL 3FU7B 4B5NA 2X0UA 4H1LG 2CR6A 5DCEA 5BRZB 1URZA 4OGYH 4J3BA 4Y7OC 1YDYA 3O3BB 4TNVF 2ICCA 2NV2A 3CZGA 3D85D 4HG4K 3OIHA 4LLMA 1X44A 2WZ0A 4CQ9A 1DDHA 5KS9A 1QLFB 3LNIA 2CLHA 2DVUA 3FSUA 1BVZA 2P44B 3C2OA 1XAKA 2DQUH 5AOIA 1B0GB 1K8ZA 4HK3J 1JERA 1QPPA 2GSGA 3OHXB 2Y7NA 4BHUA 4O14A 1QMUA 2H6UA 3IPEA 3BUBA 3PL6C 3I50L 4GT7A 2VDLH 4B96A 3WD5L 3M4HA 8XIAA 5ABEA 5FYKD 4ZTPL 1CGVA 5D2NE 1AGFA 4QI3A 2R0ZH 1U9KA 2NY4D 2PPDA 2Y1VA 2HKAA 2MQCA 2YPVL 5FYJD 4UWMA 2QZ5A 4KTYA 3PRZA 4GYPC 1XYZA 4GXMA 3GWQA 4FA7B 1KO0A 4OM0L 5E9AA 4AKOA 4LEQA 4JNXA 2DT0A 3W5MA 4X6CA 4GW1A 3VXME 3M1BB 3LS5H 1KBJA 1ROCA 3Q2LA 3KBNA 1BD2A 5KEZA 1F6YA 1F2JA 4AITA 1U8IA 1M9SA 4BFGA 4BWTA 3VFOB 4K9EL 4Y1TA 4UMSA 1DCLA 2J73A 3LHAA 3T81A 5TQLA 1RJPA 3N2XA 3BIKA 1AH1A 4K8RH 1ZIBA 3IARA 3GHBL 2AV7A 3BEWA 4LYPA 2FLBT 2GDQA 4PJIF 4Z0BH 3IWPA 2ACRA 1EWDA 4DIAA 5DK0A 4W70A 4YEFA 3HRZC 5HY9B 3FN9A 4XD4A 1UKTA 3VABA 4OZHB 1YN7B 3CLMA 1XQKA 4ZCWA 3PGDB 4J3OH 2V7HB 5JIWA 4NILA 4WHYH 3EGSB 3AT8A 2GSJA 1TTFA 1POJA 5HQEA 4NCDA 2ITCA 2XFYA 4JE4B 4HK7A 5REQA 3WDQA 4LCIL 1BG4A 1DJHA 1ZVNA 3GNXA 1IGMH 1MCEA 5AAMA 2PW1A 5DT1L 1LEGA 1Z7JA 3DURB 3E6EA 3PZ9A 3MOQA 3QQ0A 1HHIB 4O1EA 1GVIA 4C6KA 3HUJA 3NTCH 2ICEA 3S34L 5JXQA 1JD7A 1D7DA 3V9FA 3AUVA 4IIQC 3NACH 3W7NA 5DFVD 1QKZH 1JK9A 4ZXOA 3N17A 4HK0B 4DW2L 2E7MA 1WKDA 4LFYA 4NPJA 4J4PA 1UB6A 4MA8L 4AVKA 4PUBH 3BVJA 4RQQA 7ODCA 1B0RA 1OIFA 1FHUA 3SRKA 2FYVA 1ODZA 3GLCA 1I3GH 5MI0C 3E6FA 1GZ1A 3L66A 1RUAL 3I68A 3ABXA 4HJUA 1EB3A 2UY6A 3UVIA 2HT3D 4OFYD 4N0UA 3HJEA 4XNXL 4OLWL 4TXEA 3G6JF 2DH2A 2ZYHA 2A4EA 1K6QL 1VCVA 4HBKA 4RMBA 1ZGLA 4AMCA 1W5QA 1X4XA 3QI9B 5FJIA 3JBG7 1LYQA 1RCXB 1EJSC 5T33L 2YUWA 3SQOH 3RPBA 1NFAA 2OTPA 3WYZA 3TNNA 4LLMB 4UOW1 4MA3B 4MKVA 1DDHB 3BKYH 5KS9B 5GVJA 3Q5TA 1GSKA 3F7QA 4M61B 2VXQA 3HE6A 4AQ8A 4LT9A 3PZNA 1EA0A 2OYMA 1OCRB 1F4AA 4XBGB 1NCIA 1XICA 2DZUA 2YDSA 1TE6A 1OINA 2AL2B 3EWZA 2WSYA 2OWXA 2W62A 4TM9A 2KLTA 3CXFA 4JJHA 1R17A 3TT1L 2OLHA 1ERNA 4LBRA 4UINH 1HWHB 5T9CE 1N10A 1R75A 1WAAF 4YZFE 2YN3A 2R6OA 2AAVA 3G1SA 3F5LA 2F7FA 4KDTC 2DW7A 4F7PA 3H1ZA 1H6FA 4J6RL 3W6MA 4HCLA 1EC7A 2O93L 2EVHA 4TMPA 1H0GA 1VD6A 5KANI 1JZDC 4JY9A 1NEPA 3QAZC 3AGVA 1IAMA 1XLHA 1ZVSA 4X6CB 4GW1B 1YEEH 2Z29A 1UJPA 1JGUH 5GZND 4LSQL 2I69A 1U8IB 4JXCA 2PABA 1GGTA 2P5WB 5AKRA 4WAFA 3BZFA 3W11C 1VGEH 3BVTA 2WGNB 4CILA 4MFEA 3IK2A 2FL5A 2ALAA 4L0YA 4MJZA 2AV7B 1X5FA 3BEWB 3CHOA 2NSOA 2GJZA 3NPWA 1TCMA 5HYSA 2WCPA 1RURH 3OMIB 4DF1A 4H5SB 2XQ0A 5BWFA 1JPGA 4GI6A 2B16A 5DK0B 4JTCA 1R3JB 1AD1A 4MNMA 4F7CA 1NA8A 1NICA 3P9LA 5A2IH 4IKIA 4XAPA 3OBKA 3H2PA 1G9HA 2KH2B 4X8CA 2Y1HA 3FU3A 4DEUA 5K1JA 4H8QA 4PREA 5F7DA 3DK0A 3ATFA 1IZKA 2VW6A 2V17L 4CQ8A 3Q58A 2Q3OA 1S9XA 4XXDA 2DTSA 2XTKA 2EG6A 4QE1A 2XYLA 3DX6A 5REQB 4OT1H 4R8WL 1RUKL 3CUFA 4YYCA 3B8UA 5B80A 5FHBH 2H3NA 3NQDA 1LEGB 3MS8A 4S1RH 1Z9AA 2VDKH 3Q7JA 4P7LA 3A21A 2BG5A 3HUJB 3LEVH 2ICEB 1IARB 2BSED 2FB3A 3GUGA 1MY7A 2DYPB 4N2IA 5GHWL 1SM3H 4B9PA 1G9MH 5GSVA 3ZRSA 1H5BA 4PEKA 1KG0A 3OKDB 1JRCA 1JR1A 2YAQA 4L8CA 1RPKA 1UKOA 5E2VL 3AYTA 5FJOA 1UB6B 2UWEF 4BEQA 5BV7B 3WXWH 3CVDA 3RAJL 2J75A 3U6RB 4M5ZH 5D71L 4WK4B 5E8OB 5D7IA 1RIHL 1WDQA 1OAXL 4Q4OA 1BSLA 1XFBA 4O4VA 4AVHA 1EAQA 5HHMD 3FBQA 3ISYA 2HVJA 1ZLVK 4QNPF 1SXSA 1RZJC 3HZ3A 3TQPA 3W24A 2J7BA 5F1KC 3OF6D 1CBVL 2ALRA 3W87A 5BO1L 1XBDA 1L6ZA 5E08H 4DGYL 1JGIA 4ZPVA 4DCQA 4HU3A 1HF6A 4X7EC 1RULL 1EP3A 1GJWA 4M43L 3WLKX 3AROA 2Z2BA 5DLML 4MJJA 5AW1B 3WNLA 2A99A 3TFKC 1I1XA 4G7QB 3WLRA 5LXGH 2BS8A 5CP7A 1EBAA 4IKLA 4BK5C 1YDVA 2GGHA 3M8OL 2BZ7A 3TNNB 4RMWA 3ROLB 1QOXA 2CBJA 3MV7B 1NBVH 1NC4A 3HE6B 2HKHH 3FXIC 1CLKA 1NCAH 4MJIB 3OQEA 1FFNB 5DZPA 3SRDA 3VOGA 3RO6A 1WUFA 4KZEH 1XH3A 4AY7A 2ZC1A 2FWUA 1GY2A 4O51A 1IAKB 3VXSD 1KTLB 3F65A 3G5EA 1LGVA 5J7CC 1F3XA 1AS7A 4PCTA 2AMXA 5CMAA 1NSNH 3TXAA 5A6MA 4GIYA 5LA0A 4L2YA 2AEWA 4F7PB 1RUMH 2ZF8A 4YE0A 4R7WA 5C8JA 5FFLA 1BEXA 3V4PL 1O4UA 4U1MA 3LNFA 4OZOA 4RLIA 5T1KD 1TUFA 3KBFA 4C6MA 4UV7L 4GVHA 3GHSA 1GK8A 3RNDA 2VX6A 2X4UA 4EOWH 2EDNA 4EIUA 2AJYH 5K9OA 4LNCA 1HJWA 1QRND 5J12C 2J7EA 5FUZH 3MODL 2J13A 3QJOA 4KKLD 4C6NA 2EE6A 3M0ZA 3BZFB 3MWAA 3RVVC 3GS7A 4M6QA 2H1PH 5FV2A 5KSVA 2XKNB 1OBAA 2HH0H 2FL5B 1NOLA 4IRJA 1CO1A 3BLBA 5BZZA 4OGAC 4RFEA 1BFSA 2CXGA 3MLSH 5I16A 3E3HA 4J3VA 2J7HA 4I9AA 4XUGA 3C5ZD 1UXSA 1OCOB 5HYSB 4HS3B 1NFKA 2CO6B 2M83A 4JICA 3VSUA 3NQKA 3BE1H 4TQIA 3T3PF 4JCMA 3TR9A 3CFUA 4MM1A 4F7CB 5DJZB 2R9HC 3QXAB 2D7TL 4NUJA 4YTQA 2P5EA 1DL3A 1XF0A 3ZRFC 5F7DB 4JRYD 1GUVA 3CN3A 5F96H 3IEAA 1WRFA 1BYCA 3RWCA 1CLCA 4D1JA 4WJ8A 2J8TA 4N0YL 1ZXKA 1YBQA 2WAGA 2KZWA 2G75A 1TRDA 1DEEA 2YGOA 4HUWB 4NL1A 1RZMA 3O63A 5ALBL 5C08A 2OPCA 4AUBA 3QQ3A 2H3NB 1WFUA 1E8XA 5TE4L 4ZZFA 4EZMA 3R0UA 5ESAA 1FAKT 3KAAA 1A6TB 1V79A 1I0DA 3QHZH 1KPUB 2MMXA 1GQJA 3DDGA 1FCUA 3QC3A 2EECA 3WF3A 5L7XH 4MGXA 5I07A 1KG0B 1AH0A 2EXSA 2WZPD 4L8CB 1RJYA 2GPTA 3IVTA 3W00A 3THMH 2QCMA 3FFSA 4HVBA 5IKCB 5EULV 5HHOD 4GZIA 3KRZA 1GOMA 3WO4C 1B3XA 3G5VA 5BS0D 1AXTL 3HGOA 1WLHA 5DD0L 3C6LC 4O0QA 5H37A 4NQ1A 5I66B 5ADOH 4K07A 5JQHC 1XLCA 3MU3A 3WEXA 1ESWA 4ZPVB 2YXGA 3DO7A 2ENSA 4DCQB 2QVNA 4LS2A 4Z3TA 3EADA 1JPSH 1T96A 1PKLA 3SGDH 1G1KA 4QEGA 2HFEA 1CCZA 3GSUA 4XN7A 2MRYA 1MOEA 3H12A 3QZWG 4HYTB 2ZA2A 3SY8A 3OVRA 4PLOB 2FDMA 3R13A 4XOEA 4FL4C 1KBGH 4KERA 4AMAA 3EDFA 3EUDA 1AXIB 1ME7A 3R79A 3SZ8A 4LSTH 3ZKQD 3DN5A 3CZLA 1A5FL 4MHBA 4NP4H 4ZO6A 1G5GA 3CFJA 5LXEA 1SO3A 1UWXH 1AZBA 3TN0B 5HI3C 4LVNB 3ZQWA 1EBGA 3W0WB 2R1PA 1GOIA 4PI2A 2PPFA 2WQVA 1CURA 2QGBA 3ANVA 1FAIL 2EH7L 2W0KA 3AIQA 5L2KE 3UACA 1O6SB 1OGBA 3RJYA 3IJIA 1ZZMA 1RLBA 1MDRA 1HE7A 1A6WL 4GRWF 5LGKA 1HFBA 5D8WA 4AIUA 4U1MB 1SNRA 1OGAE 1ESOA 3X1EA 5H94A 2QIIA 5HQLA 1UXMA 2X4UB 3QF0A 2X2GA 3WS6C 5A5WA 2Z24A 3FCGA 4D6HA 3TA3D 3JZEA 4TX8A 4H13C 2OXNA 4G8GD 3CX5J 4CC4C 2Z1KA 5KSVB 1OT1A 5FUCE 4TQEH 3NQ8A 4IRJB 3FO0H 4PG9A 4RFEB 3NPZB 4IS6B 5I16B 1IQDA 5LCVL 3LMJH 2L0DA 1UXSB 3ECWA 5I9QB 2QHRL 2BVQA 3WBYA 1XGQA 3P4MB 5SWQB 3NFPA 4M6OH 2BVPA 1JF5A 2CO1A 1PG7H 1TYRA 1YA5A 2INZA 1I8JA 5GGVL 3WIAA 1LO3H 1TJ2A 3CHCA 1IQWL 4BFRA 4G43A 3UY7A 4XZWA 3WLHA 2EYRA 4PJEB 5EOQL 2Q09A 3TWCL 3BLLA 1D9EA 1V51A 4B9YA 2HISA 4PRDA 1RMFL 2EZ0D 1TTJA 2CHNA 4AX3A 4E9RA 3OLEA 4OZIB 2NXIA 2G75B 1EOMA 3QBUA 2CLKA 4QT5B 4QF1A 5C08B 4R4ND 4OZGA 3QQ3B 1Y5XA 4JKKA 3SBWA 4TL4A 5HVGB 2DQWA 2UUDK 4C6CA 6XIMA 4M48H 5T3ZL 1UP0A 4PEEA 4GG6F 2R0KL 1JGEB 4HC1H 1VYPX 3SBQA 3I10A 4CD7A 1DBMH 4LSDA 3SCTA 1C90A 3DUGA 2FX9H 5JW3L 1RJYB 5GXBB 5A8PA 5GNZA 1QHQA 3E2VA 4AE1A 4QHUA 2QUTA 1TZZA 3V55A 5LGHH 3II1A 4JDVA 1GH7A 4HHPA 3G5VB 4KKAD 4FQJH 5FL1A 4X5RA 4NKQB 3AMCA 3AS1A 4L4PA 3CFEA 4BZ2L 3BD3A 3SYPA 1KQYA 3Q05A 3DO7B 2BHZA 5T9BG 1Z7AA 4P9HL 3CHPA 3GSXB 3PAYA 1NLDH 4PLJC 2B0SL 3PR2A 4XE0A 3MCLL 1ACCA 4YBHA 5MEQA 3OB0K 4L64A 5KSBE 4QITA 1M1XA 3HB9A 3GSUB 2CLMA 4NDMA 4Y9AA 2NXHA 2E7FA 2G30A 4ALAC 4WVXA 3IPFA 3Q44A 4KZDH 3KG5A 3W9ZA 3OKYA 4JG5A 3P2VA 3CK0H 2E77A 2PTDA 4M6VA 3FRUA 5FM5O 2OMTB 1HQRB 1BVKA 1KCKA 1EHKB 3WG6A 2PXYD 1XI3A 3DG7A 3RR1A 3N1PC 2H6PA 2X4RA 3NDYA 2QVTA 2QCFA 3S46A 3HM7A 2IMMA 2Q6ZA 2VN5A 2MHAB 1AFSA 3QYCA 3UXFA 4HW6A 5FF3A 3VXQA 1HKKA 3C2EA 4F37F 4K68A 5T5FH 2C9PA 1DUZA 1DQMH 1YNLH 2AZUA 4FFVC 2C9XA 5JOPE 3LH2H 5CSUA 1L6XA 2C9AA 4N85A 1XIWC 2N56A 2WYZA 2C14A 2NLYA 2IOIA 4Q8VA 2E74C 1UUQA 4CU7A 1LDCA 1S7XA 1F4HA 2J71A 2VCCA 1P0BA 1UWYA 1ZMYA 1Y0EA 5I5MA 3MYJA 4O00A 3AZUA 5D7LD 1AVAA 3HBPA 5D2NC 9CGTA 1IFGA 1IWBA 1VJIA 2Y36L 4K7FA 4ATTA 5GGQH 1CGUA 4HIIB 4HUUA 5AAPA 1CDCA 3MQTA 4AL8L 2BIHA 1M6UA 3DG6A 3TYGL 4PLKC 4R90L 3FUIA 3INUL 2RQ8A 2NDFA 3CQIA 3L08A 4P5TB 4TVPL 5A2AA 3MJYA 4OTXL 2GC7C 2E7LC 1IQDB 3DFOA 4MYWB 3E0GA 3S5LB 4F57H 4J8RA 5SWSB 2BVQB 2EO7A 3QXTA 5AL0A 2OO0A 3VW3L 3DX4A 3BQ6A 1ND0A 2E9WA 5HJGA 1XGQB 4ETQA 5L4FA 3QDME 1TOXA 3QO1A 2BVPB 2PDUA 2N7BA 2PUQT 2W9DL 5F9WB 2EICA 1WDPA 4G59C 4GBXA 2KDGA 4IU2A 3MP3A 3ZE1B 1W16A 2XFFA 4G43B 3PV7A 4L8SC 4Y4FA 5D9SA 4LSUH 1XTMA 4O02A 4L3EE 4CNIA 3GBDA 5ITFA 2NY3C 3UX9B 2DEWX 1P6FA 1DQIA 4OZGB 2KZKA 1YEGH 3KVMA 4M00A 1ICSA 4O1CA 1U95A 1F2QA 2Q76A 2JQMA 2DQHH 4J3ZA 4YN3A 2ROYA 3M6DA 1Y8BA 2ZUYA 3LM3A 3FQRA 2Y63A 2QSVA 2WBJB 2EEAA 1KT2B 5IEKA 4RE3A 1OGGA 1W0VB 5AOKA 1P84K 2YPLE 3ULSA 3AREB 4H0HB 3C9NA 4FP8H 4IRZH 4WW2C 3GD6A 1PL3A 3WQ5A 4GYKA 4OLVH 4YQXH 3VD1A 3IS4A 2GTZA 4JDVB 4KGLA 5HNRA 4OD3H 4QUOA 1I2OA 1CWYA 4R2GD 4XCEB 1DOSA 5C0AD 1I31A 4MIMA 1DTNA 3MO7A 2FQEA 3CFEB 4L9DA 4NYLB 3GC4A 2VXNA 4QOKD 1T0PB 4H6KA 2VDRB 2AQSA 2XXGA 2X2IA 1FNHA 5B8CB 2BJML 2DDXA 5U4NA 2GJPA 1TO3A 4A38A 3GTVA 2IDFA 4HPNA 5MEQB 1E6XM 1GW1A 2X6AA 4XPTH 4I7WA 3T4AA 1HQ4A 4HIEB 2EDFA 4PJIA 4IOFD 2SODB 1I60A 1XX9C 5PCYA 2VC2B 1BRLA 1D5MA 4B9JA 1XDJA 1BVKB 4HZ7A 2WO5A 1CFMA 5LG6A 4ORIA 5C9RA 1PEWA 2QXWA 4U1LA 3TK7A 5AHFA 3WLOA 2DI8A 1ZV2A 4YHKH 3PABB 1KMGA 3HNSH 3N43B 2O55A 4EDXB 1T7LA 2XWDA 1K4HA 4C54A 3G8RA 1CD8A 1DVFC 4GCAA 3VXQB 1WG3A 1CLXA 4LHUD 1DUZB 1M9HA 2Y24A 2C91A 1SUXA 4O58L 5JW4M 4DBSA 1AGBA 4N2EA 5C54A 3VTTA 2CLZA 2VDMH 1OARL 2CG9X 1NC2D 2IPKB 3B4YA 2V0AA 1OCCB 3NURA 3ZDZB 4UT6H 3WTSA 3F4NA 4JUTA 3MYJB 3S5NA 1YY9D 4LAJH 4XAKE 3SDXF 1LWRA 1VIWA 1Z6KA 3M0JA 1GVYA 2J8OA 3J27A 1WK0A 4GNJA 2VLJB 4K7FB 5A7EA 1P69B 1P5BA 1NCCL 4JS7A 3PIQA 4FK9A 3S96A 1JHKH 4L4VD 4OGXH 5C0FB 8XIMA 1UYWH 2F74A 2SEBA 4NBXB 5DWPA 5F7BA 4Z78A 2Y7FA 2EUVA 3S1WA 4J8RB 1X9QA 4H8PA 1GOGA 2ANUA 3MB9A 1ND0B 1R85A 4ETQB 5I1CH 2I7OA 4N2AA 3I6TA 3G6JA 3QO1B 4IW4C 4M3HA 1QSEB 4F66A 3P4NA 2ATAA 4BUQA 3L7FB 1MNUH 1P5VA 4NJJA 3NO1A 3THQA 4GBXB 1GZJA 4IU2B 3IETA 1W8EA 3UG5A 5EWIL 4WLCA 2X4PB 4FXRA 4LCYB 4S0HA 4IKKA 5H4YA 1ICTA 1WJ3A 5AVNA 5CZTA 1TWSA 2R14A 5E9NA 3L9BA 2WZIA 5ITFB 3MSRA 4P2QB 3TV3H 5F6HJ 1XGEA 5J5EA 4QXWA 3VG0H 4MQ7A 2GOUA 3CS2A 2Y7LA 5FCUL 4R97B 4IUOA 4NNXB 1RVFL 2OMWA 4LU0A 3QW3A 1RJQA 1U95B 4LCQA 2VDNL 2Q76B 3CAKA 4PHXA 5ES4B 4IMEA 3HN3A 3VUSA 3QWRD 2Q6WB 2F8OA 4F80A 3ALPA 3X12B 4YSQA 1VFUA 1WAAA 3DJSA 2XIJA 4JRXE 1JVLA 4UTCA 3EX6A 2LU5A 3MJGX 1NGPH 3CDGB 3QEHB 4M7TA 3C9NB 1TVHB 3RP1A 5FACA 3MSYA 3ARBD 3R58A 2QMJA 4HJJH 5E00B 1JQXA 3WEBA 2DWYA 2YA1A 3QPQD 3LKRA 3WD3A 3UWWA 4Q8UA 4GMTL 1XFPA 1Z9PA 3UZVA 3FY1A 1MI5E 5DJ8A 3EOUA 4CQAA 4WTWA 3S97C 3VGBA 3TH3T 4TV3A 1YRRA 1N64L 5HHNB 5D5MF 3LRGA 2VE6B 3EO0A 2HQAA 2DN7A 3QJQB 5I73B 3T4AB 1HQ4B 4OD1H 1VYSX 3W25A 4H7ZA 4EX4A 2ZUSA 2Y85A 4PJIB 3BE7A 2J78A 2A4ZA 3VGFA 1KB5L 4ZD3L 4FEIA 4U6VL 3UGXA 3U9PL 4AVIA 4UTWA 1D5MB 3ARFA 4XVJL 1IZCA 2RH0A 3RGVA 5BNKA 2NY1D 4U1LB 2ZOWA 3DBXA 1KTCA 1PAMA 4YPJA 1AA1B 3B7UX 3DYMA 4LOUC 4P61A 3EJQA 1M57B 4LLQA 5DZNA 1DJQA 3P0VL 3D3VD 5IBXC 4N68A 1K3UA 1JGLL 5DI8B 3GRWA 5GNYA 5DYFA 1AGBB 4Q74A 1DHKA 4Y2DA 4BHUI 2CLZB 1JV2B 4XNDA 1SGKA 5LIYX 1EA9C 1DTUA 1XL6A 2PA6A 2HBVA 3M5XA 3K74B 4AT6A 1DVTA 4YSTA 1H7NA 3EYOB 1F58L 1SFLA 1GQKA 1LP9E 1JEZA 2UWEA 3CHXA 4GUJA 1A5NC 4QIUA 3U30B 1OK6A 3MJ9L 3JVGC 3GKWH 2VDOH 4BV1A 1CK0L 5C0ND 4WCJA 3PIQB 4GFIA 3S96B 4FYQA 1B3ZA 3PZGA 4QLLA 5F7AA 4Z7OF 5CGYC 3LNGA 2FVNA 2GITA 4Z78B 2NV9A 2OZ3A 5EU6D 1K9FA 3ERXA 2A6LA 3CSGA 4ADTA 1NGWA 4FQ2L 2CLEA 3ES8A 1IGJB 5CSRA 3P4NB 3E49A 4E8DA 1P5VB 1OB0A 1MFDH 1I8LA 3PHAA 4XN1A 2BK8A 1ZANH 1IXNA 3QE5A 3MOAH 3DOHA 3WEOA 4FULA 1T89C 2OR9L 1G1OA 2NY6B 4PRIA 4C1NA 4DO6A 1CS6A 1LEKA 3SDAC 4QG6A 3OGSA 4ZX4A 4PJDE 2ZZ2A 4OCLC 1WWWX 4GOSA 4BZ1H 5E8DH 2FQDA 4IHOB 5I75B 2DQXA 4LAQL 1V6YA 5HPMA 1FOBA 1EKOA 1EZUA 1L5GA 2XGIA 4KROC 1C5CH 4G42A 2NSXA 3H7BA 1TTUA 2WSKA 2X1OA 4BQ6A 4ODXB 5HGGS 1QXLA 1H5YA 3HF3A 3OPZL 3N0PB 2WY3B 2JTDA 4APQA 2D31B 1GIGL 1ECEA 4V27A 3LZRA 3R12A 1Z9SB 3WL9B 3A67H 1AACA 4DYJA 1P4IL 1DXEA 1SVBA 3LKRB 4UM8A 3GSMA 4QHPA 4XC3H 1XCQB 3LTPA 4WXZA 4NJGA 2CGZA 4KDVA 3UZVB 4J39A 3FOMA 5ENWB 3COOA 1XR2A 3IUDA 1LK3L 3GBEA 5DJ8B 3WFBL 3ZU8A 4PJ9A 1C3FA 4D6FA 1FNSL 3O11B 3BUDA 1OSYA 4IPIA 5FPIA 2J1XA 3GTXA 2R23B 3NZHL 1K5NA 3T3MF 1WPCA 4UYPA 4DJFA 1XINA 4FADA 1JF1A 5FJTA 2YGPA 4P0DA 3ULUH 3ATAA 1RLWA 3QV6A 2XWBA 3IU4H 5ETUA 2VEFA 1U6AL 4WUUE 4WK9A 2XPKA 4GIEA 4DUWA 4PJ5A 1SHWA 1XG3A 5DMIH 1KYUA 4JM4H 3ARFB 4L1WA 3KR3L 1BCIA 3DBXB 5KYNA 4X9FA 4CLMA 1UWRA 4NWTH 2FH8A 4NQCD 2ZKHL 4OHQA 5KVGE 3CVHA 3VQ1C 3AB0C 3EXJA 4I0PD 3ZJAA 5GGRB 3SKJL 5B1CA 4Z7WF 4LLQB 3BT0A 3BMXA 1SPQA 2D7MA 1NTDA 4GC4A 2FT8A 4U1SA 3O3AB 4KRPD 1WOAA 3KVJA 4MJ4A 2NY2D 2VMFA 4JHBA 2W60A 2XYCA 4Y2DB 2DZTA 4LUIA 2Z92A 4PMEA 2ZFAA 5AKQA 5B7FA 1VFHA 3U2JA 5B3JE 5HOSA 5JBEA 4AT6B 4NF7A 4FLOA 1D5ZA 2X28A 3KOYA 4JZNB 1JZ7A 4X4XA 4XAYA 3KTSA 1MPAH 3D85A 3D87B 1EHNA 4HU0A 1N26A 2BXZA 2A6DA 5A6SA 5DJXA 2QEJA 1AO7D 1I9JL 4PJXE 4JY4A 4LPTA 2XVBA 3NJVA 3UBHA 5BXFA 4HK6A 3H42H 3N1AA 3R18A 3EYQD 2GITB 3WD1A 4DGVL 4NUGH 3RDTA 4JAMA 3DRQA 1UVQA 5FUCC 1NGWB 4NAFB 2ZC8A 2Z9TA 3W70A 3DGBA 4CMHB 2YXMA 1MUJA 4C56E 1V7NL 3TH4T 4HQQH 1XC4A 3HFMH 1RA0A 1WXYA 3KGSA 2ZQKA 1TJIH 2EDWA 4KKQA 4UANA 5KBNC 3HS0B 4LVOB 2J88A 1P7QD 3WUWG 2ZUTA 1EBHA 3MLVL 1B4LA 2YXVA 2I5YL 1E55A 1IKNA 3FUMA 2EC8A 3TTSA 1KFBA 4PRIB 4GVIA 1HEZA 4JDZA 4PULA 4C1NB 1NGYB 1ADOA 4UF7C 4IICA 2DZEA 2R2BA 4Y2LA 1KEGL 3WO3B 4CW1A 5EB8A 3S6TA 1LDSA 4MCZA 2A1WL 3GMPB 4N9EA 4LCRA 4ZNCD 2Y7SA 3VIOA 5LNUA 3LX9A 4UZSA 2LT9A 4G7RB 3GNRA 3V0VB 1MEWA 3H7BB 1BVLA 3R1ZA 3OX8A 4YMPA 4KKRA 1LHZA 4QG9A 4PJHF 3OYZA 2OJPA 4XHQA 4D3CL 4JG9A 4P2OC 4Y8FA 5CILL 1TQBC 4A7UA 1RZKL 4QS6A 5EPDA 4CU6A 1ZJBA 5E9DE 3B8DA 4UQBA 3TKFA 2JKLA 4DVRL 3LQZB 2YXXA 3VWJD 1KCZA 3FOMB 1QTWA 5AVUB 2F53D 4KWSA 1IHIA 2WC3A 3CIWA 2PTZA 2VRJA 1O1ZA 2A74C 4PTVA 2C15A 1VESA 3CH8A 4GKZB 1NQ6A 2CBPA 1K5NB 3B9KB 1LL7A 3QB7C 4OLUH 3B97A 5M95B 1H8NA 1GY1A 4DEFA 4R9XA 2XWBB 5I28A 1U33A 1JPIA 4PRNA 5A94A 3N11A 4AC7C 1EJVC 1MVUB 4WRHA 2CBTA 3LCYA 4MHHI 1I9EA 4GNKB 1DIOA 3R94A 2OJ1A 5EORL 4HISA 2E46A 2F1BA 1FCCA 2ZG1A 2QVMA 1I7UB 5BVPH 3GJEB 3TOYA 4XX5A 2FEJA 1E9QB 1OM3L 4YSEA 1BYDA 1RUQL 1OF0A 1U36A 4L23A 5TH2A 3CVHB 1QFUH 3GM0A 5FI8A 4PVBA 1KB9J 3HIZA 4X5PA 2VH5H 4RGND 4P7RA 2P88A 3T6WA 3B3IB 2JXMA 4H0IA 4C4KT 3H7RA 3GHRA 1QI3A 2WZAA 3W0KA 1QO3A 5GGUB 1YMHB 4OFYA 2W60B 4OJCA 5KTLA 1Q4WA 3DARA 3WNKA 1LJMA 3AMKA 3QR3A 4CD4A 4J2PA 3KLHD 1E90A 2YWZA 4J3OG 4PBDA 4GG6A 5IJVA 3LSOA 3V4VA 4WHYG 4XN2A 3NA9H 1W6LA 1EBPA 2BH0A 2HRWA 5B3SB 1M2OA 1I8AA 3QORC 5ADPL 3P74A 2RFGA 1D5ZB 2GVJA 4UAOB 4HTYA 4XBKA 1LG2A 2YBVA 4X4XB 4UB0H 2ZOLA 3DVFA 5IXEA 3KPQA 2A6DB 4KPLA 3GTTA 5DJXB 1MJ8H 3STCA 1J2WA 3GDCA 3CV6A 4JY4B 1SJVA 2Y7DA 1MXDA 3BWSA 2H9GA 1PCXA 5AYUH 3BCJA 1MREH 4BM7A 5LNEA 3RDTB 3GMLB 4JAMB 3SCNA 1EX1A 3DRQB 4G6JH 1UVQB 2V6HA 3O3DB 3S0PA 4LVDA 1GS7A 4M4RA 5INCA 1OAZL 3NRFA 3QZNA 3DHJA 3RA7L 4FHBD 1MUJB 2ZUMA 1NINA 3HBGA 3CCHA 3V8CA 1QG3A 2NY4B 4M5PA 4N8VA 4JG1L 2EDKA 4POCA 1D9KD 1HXYA 4KKBC 2DQJL 2WMPA 3XINA 3UP1A 1S2WA 3OEXA 3KOXA 5C8BB 2IUZA 1V27A 4DHGA 1HOCA 1FFRA 1OFEA 3J2PA 1BFVL 4BA8A 2GSGB 4LPCA 4BWWA 4Y0GA 1JQVA 2R59A 3SY5A 4AKQA 4XP6L 3S3BB 3WBWA 3JZYA 2CLOA 3MUHL 3PWGA 4DK6A 1ISWA 4Z3HA 1AGFB 4ZQTA 5D4YA 1WV2A 35C8L 5ANMA 4N3UA 2O1AA 1TJXA 3OX8B 3Q8EA 4F2UA 1VENA 4GRWB 3TJLA 4I77H 2XH0A 1WSST 1AW5A 1VHNA 2XVGA 2DQMA 3S37H 1CPUA 3NCFB 4PUEA 3O6MH 1QNZH 2J9XA 4QWWC 1BD2B 2OR7A 4O9HL 2XETA 4X63A 3LQLA 4D8LA 1R2SA 4Z7VE 3FTWA 2GFBA 3HMCA 1NWOA 3S48A 3IDXH 3BIKB 4Y16D 3HMXA 5AOUA 4WDUA 2QS8A 3V4UL 3L3IA 5A95A 4DJDD 2OMNA 5IB3A 2A7PA 2PLMA 4ZMLA 2GY5A 1PV8A 3GWJA 3WLQA 3QDGD 2HA1A 4LLUA 4ODWA 4PRNB 1FDJA 4JDTH 1M03A 3QRBA 3VCCA 2BSEA 4ATLA 1US3A 5LBSH 2CKBH 3EHBC 1X6UA 3QS2A 2PD5A 2NUWA 3MUGA 3LPWA 1A6ZA 2YPKA 1M7IA 4D8ZA 1MIMH 3MYZA 5GGTA 3WDJA 1MDTA 4L4JA 3RVWD 2QKSA 3ORWA 2WINA 1EJOH 1KV7A 3BKJH 3SE9H 2ITCB 2AS5M 5CCKL 1DLFL 2GBUA 5TH2B 1RIUL 1BGAA 1ZGLP 5CZSA 4JHAH 3L1FA 1JYWA 2PW1B 2GZXA 3W2UA 4DN4L 2JXMB 4YWSA 3WJZA 4XBSA 4NUWA 4QE4A 2PTVA 3DIFA 3OF6A 1UC5A 3WJJC 4QKTA 1QO3B 3DJZA 1HKJA 3GSNL 2J7LA 1DQUA 3VGEA 2R2HA 4PUUA 1HWWA 4ML4A 2KDYA 3EGDA 5AOZA 1ZS8A 1JK9B 2ZCLL 1IGIH 3LSOB 3V4VB 2D03L 3WD4A 4CNTA 1ISZA 2XNAA 1C5BH 4ODHH 1XKYA 4RQQB 3ELQA 1B0RB 1BECA 2PE4A 2WAHA 2UXFA 4DAIA 4M1BA 3S88H 3S1VA 3DIVA 4EI0A 1RBAA 1XS2A 1PCSA 3STPA 3E6FB 3RX8A 1EX0A 2GVYA 1VFLA 1WA3A 1AS8A 2AHIA 2GJRA 4PJBE 4OQ1A 1WKEA 1WA0X 2UY6B 3P30L 4A39A 1MCCA 1IU1A 2H9GB 1NQKA 4N0UB 2VDHA 1F8MA 2J72A 3VXSA 3C5SA 2VVNA 2NQLA 1THAA 8A3HA 1E30A 3F1QA 2Z00A 1M65A 1CLYH 4M4RB 5INCB 4LV9A 1ZGLB 2J8UE 4N2KA 3WMBA 4JVWA 4I18A 1X7IA 2QW5A 3W1AA 2AJSH 4N8VB 4R5XA 3P3RA 4WQOA 4PBEA 1S3KH 5T1KA 2E25A 4AWJC 3PPEA 4P07A 4XPGL 1YEDA 1RVKA 3PPFA 2H90A 4NPKA 5JXAL 5HUOA 4GMSH 3ZWTA 4G7VL 1GJUA 1QRNA 1QWKA 3QG7H 1MMFA 4ZK8A 1UR9A 4PBGA 1TMQA 6REQA 1TVPA 1WKFA 5DRWA 4IL0A 3ITOA 2ENYA 5FWQA 3PE9A