3BAXA

N298s variant of human pancreatic alpha-amylase in complex with azide
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 179
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3baxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3baxA01
2A3BA 3SURA 2VZSA 1H0IA 3CTTA 3BVTA 4J3SA 3PZVA 1OM0A 3BAWA 4XV0A 1E6SM 3FNDA 1V0LA 1KCKA 1GW1A 4NF7A 4AD5A 3A4AA 1C8YA 2E9LA 3VKKA 1W9PA 4H2CA 4FLOA 2ZWZA 3POCA 1LL4A 1W1PA 4OZOA 2VVSA 4PMNA 3U5UA 3WH6A 5I79A 3QGVA 3GM8A 3BAYA 3VMOA 3WFZA 3ARSA 3VGEA 2G8ZA 3OLEA 2Z1SA 3EMQA 2F2HA 1HWWA 1BGGA 3W0KA 1LWHA 1K9TA 3DX3A 5CZKA 1QX1A 3VTRA 3H53A 1R7AA 1Q6DA 3AIVA 4AD1A 3SCPA 5ABHA 3DX0A 2DDXA 1H09A 1NARA 1U33A 3I3EA 4TOQA 2CCRA 1C3FA 4DWSB 2VCCA 3CIVA 5GNZA 2RGLA 3WFLA 2YFOA 1QBBA 4M8UA 1ZL1A 2QV4A 3CBWA 3WMCA 2ZIDA 2WVUA 4WIWA 1KBKA 3MU7A 4ACYA 4NXKA 4NI3A 3OB8A 2J4GA 2PI6A 1MYRA 3QHMA 2FGLA 5CG0A 3OIHA 4FLQA 1CXLA 2JIEA 1EIBA 3SCTA 3AHZA 1CZ1A 1HNYA 2J8GA 5CPTA 1JZ7A 1XD0A 1OT2A 4QLLA 2WHMA 3OLGA 4UQEA 4JFVA 5AY7A 4CD8A 3PZ9A 1DTUA 4JKKA 3OLIA 3AIEA 4AZCB 2VRQA 2WVSA 5CGMA 1QI2A 3UR8A 1PIFA 3VO0A 3AHYA 3AMCA 4MNKA 1UWSA 4PRWA 3WQVA 1AQ0A 3BLPX 4CD7A 3NDYA 3W29A 4Q7NA 3AIWA 1WDQA 1CECA 1VFOA 2F61A 2PWEA 3VIMA 2QLYA 4KWUA 4ACZB 3LPGA 3EJUA 3E1F1 3HZ3A 3U7VA 3DHUA 2V3FA 4X9YA 4NX0A 1KQZA 3BCDA 3T08A 1ISYA 4B3KA 2CXGA 2BV9A 3AHXA 3VINA 4LQ1A 4GQQA 1TMQA 3DDGA 1TUXA 5CPSA 5FL0A 3ZT5A 4DUWA 3AHTA 1J0JA 1FP8A 5CXPA 2XIIA 3WMSA 4HMCA 2EJ1A 3KL0A 2EO7A 1JYNA 2CPUA 1OD8A 4DM2A 3DECA 2ZUSA 1UASA 4KMQA 5A2BA 5EFDA 1KBBA 1WO2A 1JG9A 1UH2A 2BXYA 4U2YA 1W9DM 3SUUA 1LL6A 5LYRA 1AVAA 1H41A 1TQUA 3LXAA 4KGLA 3N17A 3VUPA 4C7DA 2VCAA 4D71A 1R86A 1HXKA 3BVWA 3OBAA 2YL8A 4N0RA 3KEHA 1FFRA 5ABFB 1XGZA 3HG4A 3AS3A 3N9KA 5ECUA 2ZUMA 1E5JA 3DYMA 1GOQA 4LXFA 4P8UA 4CCEA 5BROA 3BUPA 1E4MM 3GTNA 1XYZA 4F8XA 1CDGA 3MUAA 2VO5A 1VBUA 2CNCA 2VT0A 3VD4A 3POHA 2BY3A 1GVYA 2CBUA 2ALWA 3EDDA 1W1TA 3T2OA 5D8ZA 2VX7A 2QMKA 2FHFA 1TQWA 3VNYA 3NSMA 3DDFA 5JIPA 1UA3A 3ARUA 2OSYA 6A3HA 2BY0A 2WBKA 4HPGA 3SCVA 2D3LA 1LJYA 4D1JA 3GXNA 4FNSA 3CLWA 1ISXA 1E9LA 4FNPA 5ABEA 3SUTA 1AMYA 1R8LA 4URIA 2WWCA 3B9EA 4W8BA 3AIUA 2ZUNA 2VZUA 4HU8A 4B9YA 1BVNP 2EPNA 5JBFA 2QPUA 5IHRA 4YHGA 2BVYA 3F5JA 2O92A 3WN6A 5A1AA 2ZX9A 1EQCA 3EYPA 1GOWA 1E6RA 1ZB5A 4BS0A 2B31A 4D6JA 3VSVA 1UR4A 3VIGA 4FNRA 3UG5A 1MVYA 4CU7A 3S2CA 4PBGA 4XZWA 3T0AA 3GBDA 2O9TA 2OW6A 4RE4A 1TR1A 5LA2A 2D1ZA 3PZMA 4HZ7A 1ZBWA 3A3HA 1W3LA 4E8DA 3W6MA 4QLJA 3A5VA 2QMJA 1TA3B 5FD0A 2XIBA 2Y4SA 4X0VA 4YN5A 3WENA 2YLAA 1TQSA 2VI0A 3OGVA 3RJYA 2J47A 2VX4A 4DUXA 2E0PA 3AICA 1EGZA 3W81A 2J8FA 4DM1A 2WSPA 5I23A 3CZNA 2WM0A 1CIUA 2OSXA 5BRPA 2BVTA 1G0CA 3GNRA 3D50A 4DO6A 1G94A 3ARTA 4JFUA 1R47A 1GOMA 2XN2A 2YA0A 3RMEA 1SMDA 4MAVA 3ARQA 3VMPA 3WDJA 1KQYA 1HX0A 4WKAA 1V3IA 2GJPA 3SCUA 2XN1A 3GH7A 1HVXA 4CCCA 2XM2A 2DPEA 3FAXA 2PBGA 4H41A 4PTXA 3A24A 2GDVA 1UKPA 2WMJA 2YJQA 4NZFA 5IDIA 2GJXA 1E6QM 2D22A 4RE3A 2YL5A 3FN9A 1JYXA 3PZGA 1HP5A 2VRKA 2OWXA 1OT1A 2C0HA 2CERA 1NQ6A 4MDPA 3KE0A 3I3DA 5LA0A 4Z2IA 1LG2A 1GJUA 4FNTA 4AZBA 2DSVA 4LGXA 4GO8A 1QHPA 1ISZA 3AISA 4M29A 2O9RA 2VX6A 3L4ZA 4QP0A 5EB8A 2OWCA 1DP0A 4BA0A 1V02A 1JD9A 1B30A 2F8QA 3GH4A 4M80A 1E71M 1MW1A 5CLWA 3CV5A 1E15A 2UY3A 3AS2A 1IT0A 1R33A 1X1NA 4PUDA 2FYVA 4HA3A 2HISA 4UFLA 1W3HA 2ZOXA 4W84A 2D0HA 5A6AA 1V03A 4HZ8A 3NIYA 2FE0A 1WE5A 1GORA 1BYCA 4EKJA 2VCBA 4K68A 3IAPA 4UNIA 8A3HA 4DWSA 3M6DA 2EPMX 1R7OA 2W62A 4NSBA 4DUVA 4FK9A 3W28A 1CEOA 2XUCA 3PZIA 3VIJA 4BQ2A 3MUIA 1E6PA 1G5AA 1Q6EA 2WSKA 1VFUA 2BFGA 1UYQA 2VC9A 1E43A 2G3NA 4NXSA 2BNJA 4HA1A 1UA7A 3AJ7A 3K8MA 4AIOA 3MV01 4D6DA 1OGGA 1UWUA 2GJXB 4OIFA 3WNPA 2D3NA 3AMLA 4UQDA 3D4ZA 4WJXA 4J7RA 3EDJA 4HOZA 2DGAA 2YA2A 1MW3A 3WDQA 4UR9A 3AQUA 1ZBKA 4TVDA 3SCOA 4N42A 4U31A 1BLIA 1JYVA 3LRLA 4IPLA 3N15A 3KLLA 1IZKA 4HZ6A 3GXFA 1HJQA 2XWDA 1JDDA 2WKGA 3VD5A 3O9NA 4F9JA 1QVBA 1VAHA 4CN4A 3EJQA 2X2YA 3VDAA 3G6MA 2CBVA 5A6KA 2Y8KA 1R75A 5I24A 3F4VA 3JUGA 2D0FA 3HMCA 3WF2A 3CHEA 1WB0A 4W8LA 2CKRA 5GPRA 5ABFA 1CGWA 1BQCA 1W91A 3AS0A 3BSHA 4MNMA 2WAGA 1DHKA 4HTYA 3WQ5A 1CNVA 3BLBA 3IK2A 5CLTA 1OIMA 2IGTA 3KL3A 1V3HA 3AYRA 5M17A 2GUYA 1QI3A 2DSZA 3WD0A 1TQVA 1E1EA 2W66A 2VMFA 3IJ9A 3MMDA 1J9YA 1YQ2A 1V3LA 2UY2A 4JAWA 5AYBA 1KWGA 1TG7A 1EOKA 3HU7A 4E2OA 1FHLA 3W37A 3IJ8A 5E1QA 3WUGA 5A6LA 3CH9A 3AZSA 2ZX7A 2F7PA 3WQ4A 5FOOA 3WEOA 1BF2A 3N18A 1ISVA 1B0IA 1XD1A 3B8SA 2W63A 2CKSA 1K6AA 1MQRA 2WHLA 5IHSA 2TAAA 1EDGA 2O9PA 1PS3A 3AZRA 1GOOA 1HJWA 3VDCA 5E6YA 1HIZA 1CPUA 3AIBA 1E0XA 1UWRA 2VOTA 2DIEA 5HXMA 2XFFA 4UQ9A 2XN0A 1WCGA 1H3GA 3W6LA 4A4AA 3L4TA 4PYSA 5A69A 1B1YA 3OZOA 4KRUA 3L4VA 1E4IA 3CZSA 5A6JA 3ZIZA 5A8NA 5TD4A 3GXPA 1KXTA 1EDTA 4A3HA 1G9HA 3HG3A 3CZJA 6TAAA 1BYBA 1CXKA 2YKKA 1UZ1A 4PMQA 5BXTA 1LL7A 4B3LA 1I1XA 1JFHA 3VD7A 2WNWA 1B3VA 5I77A 5DFAA 1EO7A 2WVTA 5DMYA 4D6FA 1GPFA 3WF0A 1UR0A 3MS8A 1UH3A 3VIFA 3CZGA 2DT2A 3ARZA 2XVKA 1H0GA 2XGBA 2DT0A 3MSGA 1M01A 3WF1A 4F9DA 2WZIA 1CXIA 3BAXA 3NDZA 3VGBA 3CZLA 1MFVA 3BVUA 5E6ZA 1HJXA 5GQBA 2WVVB 1KTCA 3RPMA 3EMCA 1KFWA 2ZUTA 2WMIB 2XHYA 2ZWYA 1US3A 4CU8A 1JDAA 4AZ5A 2G3JA 3EJSA 2XPKA 4WK9A 3W38A 1KR0A 3WH8A 3VX0A 4JCLA 1QW8A 3WUFA 3O6AA 4W85A 1UQYA 5D9MA 4P7RA 3PZQA 4ATDA 4PMUA 3VVGA 5DO8A 1M04A 1E0VA 1GQIA 1W3JA 3PZTA 1VRXA 5E09A 1GJWA 3W82A 3WIJA 1DWIM 5CSYA 1CXFA 1VENA 3SUWA 3BUIA 3AI0A 1J18A 4PN2A 9CGTA 4AD2A 4AMCA 5C8BB 4GZJA 2E9BA 4ZXOA 3QOKA 3NCOA 3CC1A 3K8LA 4CCDA 3AMKA 5E0CA 1E3ZA 4GIAA 1GVIA 4MB4A 1XCXA 1FFQA 4OOZA 5A6MA 2X05A 4UOQA 3ZR5A 3K4DA 1Q6FA 2WCAA 1KXVA 1TA3A 4GINA 1BTCA 1Q6CA 4ZXLA 5A8QA 3WUEA 3WSUA 2FHCA 4QDMA 3RO8A 1VB9A 1TQTA 3GXMA 3LPOA 4AD0A 3WY1A 2J78A 2X1IA 3BGAA 2C7FA 3RILA 1EA9C 4W89A 1K9FA 2Y8VA 3DX1A 1BHGA 3THDA 1FA2A 4GXPA 1EXPA 1FH7A 5A2AA 1UHVA 1LLOA 4MNJA 1VF8A 4EK7A 1T0OA 5IXEA 2UY4A 4TTUA 3NYDA 1UKOA 5I0DA 3HJEA 3AHVA 2PBOA 1HKKA 4YPJA 1JZ3A 4MJ4A 4PMVA 1G01A 3O2LA 1CGUA 2VZOA 4NRSA 1WZKA 3WL1A 1ODUA 4M24A 2VTFA 2X09A 2E8ZA 1GHSA 2D20A 3ARXA 4UOZA 3DYPA 3I3BA 1ZU8A 4AZ7A 1EHAA 3RDKA 2XYLA 2FH8A 2W67A 4XX6A 1SR0A 3GZAA 4JHZA 1JF5A 1B3WA 1PJ9A 4Q22A 4DO4A 3FHAA 1L8NA 2YIHA 1V3MA 4JL2A 2CIPA 5FL1A 2W4XA 2YL9A 3CZKA 2YOCA 1NP0A 2CYGA 1FP9A 1KR1A 1UUQA 1BFNA 2CHNA 3WD3A 1TVPA 2EPLX 1RH9A 2VQUA 7TAAA 1RP8A 1MW2A 1QI4A 4PMZA 2VNCA 4U5KA 4PMDA 3WH7A 1W9UA 4HA4A 1XCWA 2J7EA 4AC1X 1E72M 2VQTA 1I75A 1KWKA 5HNNA 2JEQA 4JFTA 3ARPA 4UOJA 4FLRA 4MB1A 1C91A 3WD1A 4KH2A 3THCA 1NM9A 4CVWA 1QWNA 1WKYA 3UG3A 3NSNA 4CGTA 1C7TA 3LPFA 3BXWA 4M82A 1TZ7A 3PN8A 1L0PA 4AXNA 4D1IA 4WKFA 4HOXA 1FH9A 1HJVA 1G1YA 2XSBA 1HL8A 3CUIA 4J3XA 3TA9A 4PMRA 3WBAA 2JEPA 2A3AA 2OSWA 2YDQA 3LRKA 4PTWA 1D3CA 1WDSA 3AYSA 1QI0A 4Y7EA 1QW9A 1AQHA 4HOWA 3WNMA 3BUQA 1NOUA 3VD9A 1H1NA 5BYWA 3U57A 3TONA 4ZE4A 5D9NA 1V02E 1XC6A 3GXTA 2EXOA 1V6VA 4IISA 1S46A 4JFWA 2WLZA 2BHYA 1MW0A 3MV11 2Y2WA 3J7HA 4BCEA 2OYLA 3ALGA 4H04A 2W5FA 4P8WA 2GVYA 1Q4NX 1WZMA 1C93A 3WY3A 1E4NA 1KCLA 2ZXQA 5I78A 1VJSA 4L4PA 3ZQ9A 3AFBA 1CGXA 4EAMA 1GOKA 3K46A 1UR1A 1C8XA 2WW5A 1Y7VA 3QHNA 3WH9A 4OBRA 1MXDA 4UQAA 2MANA 2PWDA 2DEPA 1E56A 1BVZA 4OJYA 2EABA 1XSIA 2GSJA 1TCMA 3WDPP 5JBEA 3VDBA 1WPCA 1QI5A 4MJ2A 2IXVA 3VOCA 1C90A 5D9PA 1JI1A 2EACA 3FAWA 4UFMA 5A95A 3WH5A 1QNRA 3BC9A 3N04A 1DWJM 2JF6A 4WSKA 3M07A 3AXHA 1WZAA 3KLKA 1W9BM 5BXRA 2F1BA 4GO9A 1N82A 1ZJBA 1VFFA 2WC4A 4QLKA 1V08A 5FCZA 5CJ5A 2PWGA 1XH0A 4MB3A 1E6NA 3PBGA 1VEMA 4GZEA 3VGFA 2W92A 2ZX5A 4XZBA 3HG2A 3W53A 4NRRA 2E8YA 1HVQA 1MQQA 4E4PA 3HG5A 4AZCA 7CGTA 3ZMRA 5DF0A 3RM4A 2PWFA 1UR9A 4W8AA 2X0HA 1PPIA 4S3KA 5FKYA 1J12A 1B3ZA 1HTYA 2J7CA 2WZHA 1NWRA 4M1RA 3L4UA 2ZE0A 3WEMA 4JKMA 2ZUUA 1H2JA 3GBEA 2F18A 3KZSA 1EH9A 3EJTA 3KL5A 4ZE5A 2JFEX 3WUBA 4JFSA 3OA5A 5C71A 3MUY1 3W4RA 1VIWA 4TVCA 4J27A 5M03A 3SCWA 2DT1A 1JFXA 1C8QA 2W61A 4PTMA 2OW7A 4AY1A 1GOIA 1BPLB 2VX5A 1GONA 1XRVA 1LQ0A 4GKLA 1M53A 2DSWA 3HN3A 2XVNA 4AD3A 4JKLA 1E3XA 5EBAA 3VIKA 1ZS2A 4W5UA 1Q6GA 4OGZA 2D2OA 4WSJA 1UWTA 3PTQA 2V3DA 1GNXA 3NSXA 3DYOA 1D7FA 3MI6A 4V28A 3U5YA 2G41A 1NWSA 2UY5A 3A47A 1J10A 3TOPA 3WQWA 1J0ZA 1BG9A 2XTKA 2JIWA 1KXQA 3AZTA 5I6SA 4U2ZA 5C70A 1JAKA 3D51A 2YBTA 2YLLA 1B2YA 1UD4A 3GNOA 4BQ3A 1OWQA 2VURA 4CN1A 4Z2LA 4PUEA 1PEZA 2HVMA 3FHQA 1FH8A 1JNDA 3BAJA 3LPPA 2XJ7A 1GQJA 4GI6A 2BVDA 1XHGA 3PZUA 2G4FA 2X8RA 3WQ8A 1JIBA 1NOWA 3B9DA 5A8PA 1BYAA 2NW0A 2V5CA 2ZXDA 3BUDA 1QPKA 3VNZA 1A3HA 1J01A 1W9VA 4U5IA 4W93A 3D52A 3BH4A 2NT0A 2BHZA 1ISWA 3N11A 5M3WA 3W27A 4TX6A 3D4YA 3WF4A 1HF6A 4TX8A 1QHZA 3BAIA 3UERA 3CUFA 4CU6A 4RL3A 3DHPA 2EEXA 3CZEA 3PTKA 3AMGA 4J3TA 3T2PA 4OKDA 1MQPA 1B31A 1WZLA 2J7FA 3A4WA 4MDOA 3CUJA 5AC4A 4WKHA 3TTOA 2IXUA 5BXSA 3GH5A 1UD5A 1QWUA 2X0YA 3APGA 3CHDA 2GK1A 3ZR6A 1UR8A 1V6UA 1P6WA 4CD6A 3VGHA 2VR4A 5KZ6A 1HJUA 2AMGA 2J7BA 2F7QA 5AC5A 1UKSA 2OYMA 3AXIA 3GNPA 4YHEA 2UWFA 2OWWA 4V2XA 3A23A 2VZTA 3CZ8A 4PMYA 1LWJA 5JIWA 4ATWA 3GDBA 1WDPA 3NJ3A 1I1WA 2YFNA 3GXDA 1UD2A 1B9ZA 3IAQA 4CN6A 4J3UA 1DWHM 1ZBVA 1UWQA 5HBFA 3FXYA 2XVLA 4MB5A 4V27A 4CD5A 3RIKA 3UETA 2A3HA 2VUYA 3SCQA 1NP2A 3D5HA 1JYWA 5D4YA 1EDQA 3BCFA 1QNQA 2FGZA 2X2IA 4LYPA 3LRMA 2Y24A 2V38A 4BQ4A 3VPLA 4GZIA 1PX8A 2QPSA 1NWTA 1J0HA 4TVUA 2CETA 5CSUA 1TVNA 4OOUA 2XG9A 1KGXA 4IPNB 4P7QA 3VILA 2BHUA 5KEZA 1PX4A 1R46A 3ZJ8A 4D6CA 1GZJA 2RGMA 2WCSA 5A6SA 2Y5EA 2WC7A 3VDHA 2XGIA 3AMDA 3ARWA 4GQRA 2ZUWA 2DIJA 3TTYA 1V0KA 4AZHA 1WP6A 1HKJA 3ARYA 3WKZA 1GQLA 3ZJKA 4D6HA 2ZX8A 1UKQA 4UFHA 4PMXA 2EADA 2VL4A 1J0KA 1GCYA 3VU2A 2QF8A 5E9AA 2CHOA 3TP4A 2J77A 3RM8A 1HKMA 1CWYA 4XB3A 4PTVA 1O6IA 2A3CA 3CMGA 3OGSA 4AEFA 5HPOA 2Q8XA 2F7OA 2JE8A 2PF0A 4AIUA 1JD7A 4H8VA 3IJ7A 1JDCA 1E0WA 1W1YA 5JUVA 3VD3A 1O7DC 1NOFA 1OBAA 2WMHA 1F4HA 1PZ2A 1CTNA 5A3HA 1QNSA 4S3JA 3RCNA 1NWUA 1W1VA 1AQMA 3L4XA 4UZUA 5IFPA 4AEEA 3UG4A 4MAZA 4UFKA 2O9OA 3CMJA 3MMWA 3VIPA 4OUEA 3N13A 3UCQA 2J62A 1E6ZA 4GI8A 4NZJA 3WDIA 4JCMA 2E40A 5HOSA 5A6BA 3DC0A 4LYRA 4AMXA 2CBJA 1JZ6A 3L2LA 3MMUA 5GNYA 1PAMA 5DT5A 2E4TA 4TUFA 1Z32X 4ACZA 1RD6A 3VMNA 2E3ZA 2PB1A 3WNOA 2BXZA 1E5NA 3WD2A 1C92A 2EPOA 3LMYA 1HKIA 4ZFMA 3TTSA 3WDRA 4W7UA 1QHOA 3ZM8A 3IANA 3PZNA 1VJZA 5FIPA 3BAKA 1US2A 2DSKA 1XV8A 2A3EA 3VM7A 4UFJA 2WMKA 1QOXA 2XVPA 2WXDM 4UQCA 1F4AA 1R87A 4D6IA 1HN1A 4JHOA 4CD4A 1O7AA 2FHBA 4X0NA 4BQ5A 3EDFA 5D9OA 3MO4A 4E8CA 3EBVA 2XFYA 1E40A 4RE2A 3QHOA 4IUGA 1DWAM 1XH2A 2EAEA 1MXGA 4EE9A 1SZNA 1E70M 4P8XA 1JI2A 2WC3A 1JNEA 5A2CA 3AS1A 3MANA 5BRQA 3WNLA 4C7FA 4AW7A 3D3AA 1XH1A 4H7VA 2WANA 2V3GA 4EANA 3F5KA 3AIRA 2V3EA 3KWXA 4FMVA 4LX4A 2NSXA 1DWGM 2WKLA 3WNKA 2OLHA 3LXBA 3A6OA 4BZYA 1LF1A 4MPKA 1A47A 2GDUA 2XVGA 3QR3A 3UESA 1E1FA 3A22A 1E73M 1CXHA 1CENA 1HT6A 3M46A 4HMEA 2GFTA 3ZT7A 2EBNA 3ZJ6A 3PZOA 3N12A 4FLSA 3VSUA 4PSRA 1K9DA 1DEDA 3BUBA 1ESWA 5I3DA 5EFFA 1LG1A 4D72A 1H4PA 3VSTA 1OGBA 1E4LA 4IM4A 3VX1A 2QHAA 2AOSA 1UG6A 1HP4A 4PSPA 1K9EA 2WB5A 4R5EA 4D6GA 3T0BA 1OSEA 2WYSA 3K1DA 2ZXAA 1W2PA 4TTGA 1W2VA 3ZJ7A 1V0NA 4H8UA 4PCTA 2PC8A 4UZSA 3SCRA 1QNPA 1ZBCA 4FF5A 4PEEA 3EDKA 4HU0A 2C8NA 1KGUA 2AAAA 2BY2A 3F5LA 2VR5A 5A8OA 3NUKA 5F7UA 4AYGA 4UQBA 4B16A 2YDSA 1IV8A 4WF7A 4ZEPA 1JL8A 4A3YA 3S5ZA 4TXEA 1EQPA 2G3MA 3BMVA 3VGGA 5GNXA 4FNUA 2J75A 4AWEA 3M7SA 2WMGA 3TTQA 5ABGA 4LYQA 1CLXA 5E0FA 3VIHA 3A4XA 4JZ5A 4UFIA 5BWFA 3CGTA 3BVXA 1U30A 2OYKA 6CGTA 1B90A 2DSUA 2JALA 1UR2A 1X6NA 4U33A 4P7NA 3BMWA 3PTMA 1OGSA 1X6LA 3CHCA 4W86A 3S6TA 3VIOA 4Z2KA 1VFMA 3U7BA 1H49A 1UZ4A 2WPGA 2XWEA 5DT7A 4U3AA 4B15A 2DH3A 1GUVA 1EO5A 3CO4A 4J3WA 1B3XA 3AOFA 3VIIA 1B3YA 3SUSA 4KRTA 1TE1A 4BF7A 1UQZA 1SMAA 1W3KA 4H8HA 4UCFA 5A6BD 1PIGA 4L4OA 3WDHA 1JXKA 3K8KA 3ALFA 3OZPA 5IFTA 2WK2A 2JF7A 2DH2A 3EMZA 1ODZA 2CESA 4AYSA 1OD0A 5DEZA 4CUCA 4QFUA 2XFRA 1UD8A 1U2YA 1UH4A 3OGRA 1VEPA 1BSIA 2WZEA 5HPCA 4W7VA 1CLVA 3UEQA 2WCGA 4DO5A 3CUGA 1SYTA 4ATLA 1M7XA 5EMYA 2PWHA 5CGTA 1CYGA 3SCSA 4HP5A 1JF6A 1OINA 3ARRA 1RPKA 1UKTA 3WD4A 2ZXBA 2CITA 2V5DA 4MADA 5I2UA 2XSAA 4QAWA 3L4YA 1HL9A 3T2QA 3W25A 4JL1A 1W9XA 1XSKA 1FOBA 2CEQA 4UTFA 5BXPA 2ZICA 4W5ZA 2YL6A 4F79A 4W88A 3II1A 2BS9A 4JIEA 2DQXA 1NH6A 1ITXA 1IZJA 4P7OA 5A8MA 1E55A 3OLDA 2WVVA 3T09A 1VBRA 7A3HA 3LX9A 4DWSD 1VEOA 1C7SA 3WELA 4U3CA 1WDRA 3K4AA 3EJPA 1HXJA 1V6WA 1J0IA 3CUHA 2EPKX 2WMIA 4AZ6A 1OB0A 5JBDA 4QCFA 5LA1A 1JZ2A 3AROA 1CGTA 3SCNA 3LXCA 3OG2A 2DT3A 4M56A 4Z2HA 2ZX6A 1UD3A 1OIFA 3G6LA 4HMDA 3DX4A 1BGAA 1DWFM 1QBAA 2WHJA 2J7DA 4ML4A 4D6EA 3MKKA 1KGWA 4WLCA 4R27A 4AZIA 1PBGA 3SUVA 4LPCA 2EQDA 1QNOA 3L4WA 4KGJA 3EJRA 1GHRA 4J3VA 1RP9A 3A21A 4CKQA 2G3IA 1JAEA 1R85A 4W87A 4FNQA 4XUYA 4Z2GA 3SIMA 2D0GA 2Z1KA 3ZOAA 3W24A 3MSDA 4MNLA 3ZSTA 1E6XM 4W7WA 1EOMA 2F7RA 1H5VA 2YA1A 5D8WA 1PX3A 5M5DA 1V3KA 2WHKA 3WQ6A 2XM1A 5AYIA 2X2JA 4OBSA 3N1AA 1W32A 2J7HA 3CPUA 2WWDA 3TV8A 1WNOA 4M81A 1EHNA 3GYCA 4GPNA 4AZGA 1D2KA 2GJRA 1JXJA 4P8VA 2D24A 3MUZ1 3WL0A 1UOKA 2IUZA 2WLYA 1MFUA 3FY1A 1JZ4A 3L2MA 1R34A 2ZUVA 1GQKA 1KTBA 3BSGA 4P7LA 1TFVA 4CVUA 1UD6A 5A94A 2WBGA 1JZ8A 2YDRA 3EDEA 1FHDA 3WMBA 1H11A 2YBUA 2CBIA 3AIQA 2W91A 1MWOA 5E70A 4B9ZA 3UR7A 1JZ5A 3SEPA 3CHFA 3VGDA 1V3JA 1V6YA 1SFSA 1CGYA 4AD4A 3DX2A 1J0YA 2FDMA 3ZT6A 2J25A 4GI9A 4PMOA 1KXHA 1PZ3A 5CQ1A 2WMFA 4AIEA 3RJXA 3BLKA 3WBEA 3VM5A 1M03A 3WNNA 2VJXA 1J11A 4MTVA 5CPQA 3GXIA 4ZENA 2J79A 4QCEA 1KB3A 4AMWA 1V0MA 3B9AA 4HPHA 5BCAA 2VZVA 1OCQA 1CXEA 8CGTA 4J28A 4PCSA 2ESCA 3FW6A 3ECQA 5I5RA 3WF3A 1XYFA 1ZJAA 2J74A 3H54A 1YHTA 3QOMA 3PHAA 1JGIA 1HJSA 3WY4A 3T0DA 1BG4A 1XSJA 4Z2JA 2BY1A 1ECEA 2X2HA 2F1AA 4C7GA 1BAGA 1WAWA 3W26A 2VRJA 3ZSSA 3BVVA 2D23A 3IGUA 3AXXA 2J7GA 2VVNA 1ITCA 3WEZA 3ZO9A 4DWSC 4NZCA 1BYDA 2FH6A 3WY2A 2E9MA 2NT1A 3S5YA 3H55A 1V6XA 4F66A 1UWIA 2GK1B 1CGVA 5HDRA 3RM9A 1CBGA 2D73A 3ARVA 4AISA
chains in the Genus database with same CATH superfamily
2V2XA 3N25A 1MHHA 2CDEB 3BWUF 4XVJH 4Y2OB 5BOPA 3VXOB 3WE6B 4A55A 1WIUA 5FYJU 3O2VH 3NL3A 4PG2C 3KM2A 1MEIA 5ITBH 1ICTA 1EZ2A 3F2LA 3BAWA 3CFNA 3OW1A 2JI1A 3SBWA 1X9LA 3OGOE 4H1LH 3RVUC 4Q8MA 3SJ3A 3GBMH 2XG5A 2EE9A 2QVKA 4NF7A 1E2VA 3CDGB 1SXBA 3MROB 4R5VA 2CFFA 2WYTA 2TPSA 3RR1A 1OAQH 2YD1A 4HCRL 4U7SA 1OJXA 1XIIA 1U8HA 2R23A 1SZEA 4H2CA 2Q76B 4AT6B 1IXOA 1DBAH 1WDDA 4PRNB 4LPYA 1NGPH 1TU2A 6FABL 4FFYH 4OZOA 1RUKH 2C13A 2VVSA 2FQEA 4LASH 3HMJG 3NFPA 3HZVB 2J1ZA 1AZUA 5DA0B 4ABVA 2VW7A 1CI5A 1NKOA 5JXAH 2MKLC 3DTXB 1XJBA 4YFLF 5FV1L 4N90D 3WFZA 1Q85A 3TQ0A 4WEMB 3ARSA 3VGEA 1N68A 5HGBA 5HGAB 2G8ZA 3IS1X 3MC5A 4ZR8A 4F5CE 1BIHA 4UNKA 2VXNA 4RGMC 2LU7A 1AODA 2G0WA 4APQD 2IH1A 3FUMA 1UT9A 2XY1A 3N1PC 5JYMA 1VF5C 2CIIB 4XRCA 2BNRA 2I5QA 1MLCB 3L65A 4LIQL 4UUJA 3K4ZA 1D6EB 4UINH 3W2LA 3FA3A 3H53A 5C2BL 3L5JA 3I75A 3X12A 3CU2A 4IGSA 5ABHA 3VW3H 3DX0A 2DDXA 5DJAA 1TIUA 3QAZC 4MM1A 1ZTVA 2F2KA 1Q94A 1U33A 2CLIA 1JGMA 1ZPLA 4TOQA 2NXYD 3UZVA 2CCRA 3MVTA 2VCCA 3U0TA 2GSEA 1ZHKB 1QSEA 4P4KD 3ARBD 1YMHB 4FKKA 4AQEB 3KOYA 4FAAB 1QPNA 5LNUA 3G9AB 3CBWA 4R7WA 1NBQA 4YH6A 1S3HA 3F4CA 2YZ8A 3WJMA 2DICA 3NGJA 5FEZA 2DW5A 2ZIDA 1E2ZA 4DVBB 1RH8A 3B9NA 3FCSA 4PREB 4XPFL 2GC7C 4G1MA 2DWEA 1KBKA 4H19A 5E6ID 1N59B 3MU7A 3RPDA 2XA8L 1W8NA 3VI3A 4ACYA 3LS9A 1MI5D 2HVBA 3NFNA 5KVFL 4OD1L 4L4MA 5ISZE 5J6SA 3MDUA 4XAZA 2R69L 3LMJL 3QH3B 1MZYA 5FUOH 2PI6A 5LJYH 1SO4A 3UBXA 4HCLA 4YMZA 4KKBC 3RKPA 3TPUB 2FGLA 1EUUA 3FOMA 4GUCA 3PWUA 5CG0A 4GG6B 1EMTL 2HSIA 2Y70A 2YGNA 2X4OA 3L3DB 4YO0A 2JKXA 2JIEA 2X10A 3UZVB 2NYYC 5GISL 1BVNT 2OO0A 4TM9A 3AHZA 3UZWA 4MX7A 5L8KB 4Z23A 4Y5XB 5GGQH 1YPFA 4IG2B 4M43L 4MJIE 3QUZA 3TJHC 5A6IA 3EWZA 1ZFJA 1U8IB 3QGAC 1YYLL 2EDNA 4ENZA 2W79A 4QLLA 3IDMB 4LPXA 1VCGA 3V6FA 4MMXA 2DQWA 3E9AA 5CCZA 2QUUA 1R3KB 4JFDB 3QDMA 1G7JB 4JKKA 3OLIA 5KANI 4HT1L 4E41A 4O02H 3CIXA 4PTDA 1CUOA 1UWFA 2VRQA 5MENA 1SF3A 1ZVSB 5CGMA 1KN4H 3LRHA 2VMDA 4G1KA 3F58L 3MGTB 1TVDA 4F20A 2WO3B 4MS6A 2NV2A 2XIQA 2NX5A 2Z6IA 4U1MA 2OJZH 4YDJB 1N55A 5C0AB 4MNKA 3B2PA 1UWSA 3H2NA 3L5IA 3D85B 5C08A 4APQC 2CCWA 4XP1L 4XNQA 3QCVL 5JW4M 1IEHA 2P3EA 2ZA2A 4CD7A 1TZ9A 3NDYA 1U95A 1OFBA 4I6KA 2WIIA 3W29A 3CX5J 4WTZG 2EBNA 5EDXA 4G43A 1L7TH 2Z2UA 3FVMA 3DXAA 1UUOA 3LD8B 1WDQA 1U93A 1CECA 1GVRA 1HAWA 2AJUH 5C0EB 2PLMA 2Z1VA 1L9RA 5CSSA 4Y19B 4WY0F 3U2CA 1XFPA 3MV8B 3NDOA 4ACZB 3IFOB 5D1ZC 3WQPA 3DLQR 1T7ZA 2OMZB 3GHPA 4L9DA 1B0RA 2RD0A 2AQPA 2ZPKH 5JIKA 4NX0A 5IG7B 5FKPB 1KQZA 4KKLC 3IKCA 4YX2L 4MFEA 3BCDA 4IIZA 1ISYA 4QEGA 1FL5B 3STPA 1I0BA 4PD4J 3HG0A 2CXGA 3MRBB 2PUZA 2B7OA 3B40A 3G1VA 4AEHL 2P8LB 5J9PA 3NZPA 3DIDA 1X7IA 1ZANL 3AW5A 1Q3NA 5FL0A 3TWAA 3ZT5A 1BZ9B 5KBKA 1A9EA 2J6XA 1MF2H 4HS8L 5K7JA 4PGZA 1F58H 5D9SB 5LBVA 3L16A 5D6CB 3V4LA 3L0GA 2BMKA 3C09B 4HMCA 3UTSB 3LTYA 2XINA 1GC1C 1QPXA 2OQYA 2ZF9A 2YC1A 2B1HH 4RFEB 4LNRB 3S5OA 1ROCA 1KY6A 3EPOA 2YPVA 3WLMA 1G4TA 1OD8A 3VCLB 4PBVC 5C3TA 1J5CA 3V16A 2QGEA 3N2BA 3QEGL 5LWYL 5REQB 4XD3A 1WO2A 3DDMA 1UZ6F 3CZFA 1XGRB 2BXYA 2X28A 5T33H 2X1SA 4HSHA 4Z5RB 4HX1B 4U2YA 4K7PL 2A4CA 3T65B 1SQ7A 3GIYA 1AVAA 5D1QC 4MCYA 3EPNA 3LXAA 1UBSA 3K2UL 2E9GA 3CG8A 2M26A 5I07A 2NXYB 3Q13A 4C7DA 1A0QL 1MFDL 2C3WA 4G59C 1R5YA 3P11H 3BVWA 1K8ZA 1PF3A 4L4TA 2OKTA 2YL8A 4AX7A 5EMJA 2IO5A 4GW1B 4X7FC 1XGDA 5LGKA 3N9KA 5C97A 2P43B 4DJEC 3QUKA 2ZUMA 1E30A 3LQGA 4Q8WA 1U42A 3W84A 5IEHA 3B0PA 3W76A 3QIBC 1DVTA 4KHTL 4BF9A 5GS0C 3QSTA 4LXFA 5TNVA 3ITTA 4P8UA 4PRPA 4AKOA 5CF3A 4Z3HA 5JPNC 1I8JA 4L1XA 1XWVA 5AW7B 5LCVH 3WIIH 1E4MM 2Y7SA 3ZQWA 4EZKA 5C09E 2B1OA 4F8XA 2PKDA 1Y1DA 2C3GA 3UAJC 3MUAA 5D6DC 1IFGA 1G5GA 3Q2LA 4HGWB 2IKJA 3DFNA 3VI4B 1FWNA 3NAVA 2CNCA 4TV3A 5H6HA 4B90A 3GBNL 1AH1A 4JIRA 3QZBA 2ADJB 4C60A 1GVYA 2IPGA 3VWJD 4DH2A 2QVNA 4XBSA 5GS0H 5D96B 1R5IA 4QXVA 1IAKB 4F92B 4L0YA 4CCZA 3RWCB 5D1QB 5H8PA 4HJ1A 4YDZA 5D8ZA 4ABQA 4JFOA 5DGQA 1T2QL 1ZLVH 1DJQA 4TVPH 2B9BA 3INUH 4IH3A 1XZ0B 2J8UA 2Q7AA 1PV8A 2QMKA 3COOA 2IADA 3MKCA 4W4QA 5BZDA 3MOBL 1UCTA 2X4NB 5F2IA 4JR5A 2G5RA 3LLFA 5GJNA 4JTAA 6A3HA 4JTJA 1XIHA 2JVUA 1V54B 4PJEE 5G4EA 3L3OB 4HPGA 3ZHNA 4KK5D 4X6DB 2R56H 4K94L 1ICSA 2V8LA 2XV3A 1A49A 1F8MA 1ULVA 1NGQL 4Y4FA 3D69B 4YDMA 3R0DA 4F2BA 1J8KA 4IRZL 1LJYA 2JKSA 1TIMA 3T3MB 3NRFA 4D1JA 1M7PA 2GSMB 3GHBL 4ORMA 5JA9A 1SY6L 2ZSWB 2IOMA 1AXIB 4LQFH 5EUOE 4DGWC 2NY1B 1GC1H 4TSCH 3M5ZA 4YYFA 3V95A 1JVOA 5KWYC 4IBVA 1S38A 4G42A 1OCJA 3P4MA 4OLVL 2QCMA 4WDTA 1P7KB 3KXFB 3SUTA 3NESA 3WTTA 1ZD6A 4ES8A 4IOTA 7ODCA 4NAMA 4CSPA 4OVUA 1ZHNA 1X96A 5GJPA 2BNRB 4AY0A 4W8BA 2ZUNA 4HU8A 1RHCA 1IVTA 3TEVA 3W2JA 3U0PB 1XR8A 2EPNA 5ID1B 1H3VA 3W7OA 2BVYA 3TO4C 2P8CA 4HS6A 3VFUA 5A1AA 1EUTA 2R8SL 1WDAA 2O92A 3LD8C 3F4NA 3EYPA 1G7PB 1X44A 4Z7UB 4H3DA 3FSWA 2PP1A 1R3TA 3IVUA 4B5XA 4JYEA 3TIEB 3B05A 4UAHA 5AW3B 4NJJA 4LRNH 1DO5A 1YEDA 2EKJA 3VSVA 3B8IA 3G04B 1Y0EA 2QW5A 1WVZA 3UZZA 4XX1E 3HHRB 3UG5A 3RB7A 3LIUA 3LG3A 2J8UE 5FSEC 2QT3A 4XZWA 2RBLA 3SOBH 3T0AA 4Z3TA 1YKWA 2FTWA 3CQ0A 4RE4A 4A39A 2FWLB 5LA2A 1OGPA 2G96A 2AQWA 1ZBWA 3QPYA 3VA2C 3OJGA 4QGCA 5CSBA 2Y7FA 2I5IA 3W6MA 4HBQA 4WEEA 3UR2A 1OAZL 2OJEA 5GS0L 5ESAB 1WJ3A 5DN1A 2B81A 2DV6A 1XDLA 4MJ5B 2RQ8A 3COTA 1O6TA 4X0VA 4YN5A 3WENA 1Z3NA 2YLAA 3TV3H 1RXOB 1F1AA 2ZCGA 3QEZA 1TQSA 2VI0A 4N90E 5JQ6L 2WYIA 2BP8A 4HJGA 5BRZA 2X40A 2GGGA 3V0TA 1YMMA 3E3QC 3IJIA 3CLMA 4WO4C 3INPA 4NM8L 3AICA 4LIQH 5SWZA 3M0MA 4GD0A 4D3CL 1JRHI 1AYOA 4O4YL 5K39B 1JGLL 2Q3OA 2WSPA 1KBGH 4KVNH 2RTTA 5B1AB 3CZNA 3PG9A 1KIQA 3D33A 2FPYA 1CIUA 4AXKA 4J1OA 3UL4A 4QHNA 1NDMA 2OSXA 4QR6A 3SCMA 1HW6A 4G11A 1ZHLA 1I4FA 1G0CA 4DO6A 3DENA 4ZE4A 4PJFF 5MKGA 5FESA 3LHVA 1KA9F 4GIEA 1HHKA 3MMEA 1HU8A 5DJZA 5D72L 3UTOA 4JKPH 2ICWI 1GOMA 3SGZA 2XN2A 5HR6A 3KVQA 2ZYFA 1W6LA 4IMKC 4MWAD 3VQMA 3WDJA 5F0MB 3QKZA 2C9SA 1ET5A 3MV7D 4XXWA 1CDUA 3PWNB 4IJ3C 1HHHB 4JFHD 3FQRB 4U6YA 3QRGL 4GP4B 5JPNB 2YCJA 2GJPA 3LKSB 3ULSB 1UJPA 4W9FC 3TCTA 1HVXA 4JIPA 2GK0B 3QUML 2PAJA 4EOUA 4NY2A 2WUCH 1PWMA 1D6VL 1RVFH 4OLUH 3GJEB 2EUZA 4B50A 4HLZG 5IB5B 4L3EA 5DURD 4WGWB 2RCSL 2JJUA 2UY7A 4FZEH 4BYHA 1KRMA 2NPLX 3GXUB 1XAUA 3UDWC 4L61A 4PJBF 2EYRA 2AABL 1P5VA 3KPMA 4JZJB 2OGJA 4C6JA 5AW1B 1A4CA 4NWTL 1SJBA 4JTTA 4YWIA 1IBFA 4HWBL 5JIIA 3GAYA 4NHVA 1DVFA 4KKCC 3KVPA 1GGTA 2DZUA 4I88A 3MLUL 2QZRA 5AB3A 4XBEL 1E42A 2GJXA 3NXFA 4QX4A 2VLJD 4U0RB 1FCVA 3FQRA 4JDEB 4B97A 2RAMA 3LNMA 2IJ0C 3IJ6A 4HUXA 5IQ7H 3DHJA 3PWNA 2A6IA 2YL5A 4A2EA 1F3DH 2MTAA 1JYXA 4B3VA 4N25A 1T5AA 2OWXA 3YPIA 4C56A 1OT1A 4QJ1A 4ERGA 4BSVB 3GG0A 1N8OE 4JFZL 2H0PA 1IKFH 2AGJL 4KKPA 4YHZH 1NGXA 1BD2A 3ZDZE 4RAUA 5AOLA 4OHQA 4PMFA 1B0GA 3CXHJ 3FKUS 4M3JA 3VRJA 5LA0A 1YRKA 1GJUA 1T7WA 5E5RB 5JA8B 2AAVA 2OXHB 2FO4B 1MI3A 4HNTA 4GAJL 1RZJL 1ISZA 4R0LB 1QFOA 2P7TA 3MVSA 1WFTA 4F9PA 3ZGHA 3WIHA 4L6HA 5HYEA 5F89B 5ES4B 1KRAC 2VX6A 4NBXB 1IFHL 3I4KA 3UGVA 2Z2AA 4OAWA 3RVVC 1EX1A 3W9EB 2VL5A 3T6CA 3PB0A 5D4JA 1EMTH 4UFJA 1V02A 4E4FA 2OZNA 3LHAA 2EE3A 1F13A 1MCOH 4ZUWA 4PJ5D 1JRHH 1JCLA 3S88L 4MVBD 1O94A 4L0PB 3AYVA 2KDYA 5GGVY 2QCFA 4E9RA 3IDNB 5F2MA 4NPYA 1OFRA 4JO5A 1HI6B 3BJ91 3KW8A 3G0SA 1IT0A 3MCLH 1X1NA 4PQXA 3EWDA 4I1NB 4HA3A 1BQHG 4JFXB 3VI3E 5JIQA 2QADD 3WO4B 3ID7A 1W3HA 2ZOXA 2NYYD 2XICA 3BD3A 3MPGA 1O0VA 4UILL 1H3PL 3MV7B 4WW2F 4JUSA 4NQED 4M6MH 3SI9A 3KPSA 3C6SB 1FVCA 2H0JA 4DERA 4FAMA 4PJEF 4XVUC 5GRUL 2P8BA 3G6DL 5GRJH 2Q09A 3T4WA 3MLUH 1BYCA 4N86A 3H4HA 1TV3A 2CJUL 4EKJA 3HG1B 2VCBA 2C34A 2Q71A 2NY3C 3X1GA 3FTGB 3DVNA 3ZKXC 1PUDA 3VUAA 4UNIA 4Z7UE 3FUIA 3GSUA 1WGOA 1IAOA 4MCMA 5F44A 3DNKA 1PTGA 4HUKB 5E2UL 3B7TA 2P53A 3QYCA 3ZVHB 4DWSA 1KYAA 4LF3A 3DVGA 5B1JC 4IBYA 1IEXA 1SEBA 3USZA 2EICA 4NSBA 4DUVA 1NDYA 4FK9A 1SJMA 4N8PA 3W28A 7XIMA 1CEOA 3IMVA 2DQDH 3PZIA 1Y5WA 1MHPH 3VIJA 5FYKU 4NC2B 5ETUA 2YCIX 3W72A 4L4JA 4BI7A 1CR9L 3N0AA 5LN4A 5KSVB 3K2GA 1Y0LA 3ET9F 2FB4L 1SYVB 5DZVA 5AG9A 1VFUA 3IFNL 2CKBH 1EJXC 2NY4D 4BIKA 1WCBA 1E43A 3RLUA 4DBEA 2DZTA 1AZ1A 4NXSA 5DD0H 3P81A 3BGJA 3TA4D 3EA3A 1JZIA 5C2GA 2HNEA 4HA1A 4LBRA 1VESA 5HI5D 3H4WA 2P24B 4HJWA 3QM3A 4MKNA 1OZUA 3MJWA 4A3UA 1OGGA 1UWUA 5B39A 2GJXB 4OIFA 2ROYA 4X7SH 5HWMA 3C2YA 1Z3GL 2D3NA 1PSKL 3IWVA 3AMLA 4L4TD 2K6ZA 2QTEA 2VERN 5DJAB 5LCVL 3UXDA 2L7UA 1ZLVK 2A4EA 4L1BA 4Z76A 3BXNB 1V79A 2ZAGA 1MUJB 5HANA 3HI1B 3KOFA 3MAWA 5AHFA 1A6UH 3W2NA 1A3RH 2Y6TE 3NIFE 5LG1A 2G2RA 3DU0A 4HCHA 1KKOA 2DVTA 5DANA 3W75A 1BLIA 3LRLA 3N15A 3KLLA 4ENLA 5FO7A 4MGXA 3BSZA 3GXFA 1I1AA 1HJQA 1BTMA 3PPGA 5I17B 1UM4H 4XAWH 2RDXA 3E6HA 2BWQA 1EAJA 5LBGA 1CB7B 1WKFA 2F9RA 4BJHA 1F0LA 4HGWA 4YBQD 1DJNA 2NX9A 2CZVA 4KO9A 1FHGA 3P2DA 4LIQE 3EJQA 2J1KA 3WKMH 1BWKA 4ZSUA 4YYCA 1DSYA 1FNGB 4P23D 3SKOA 4C4KT 5A6KA 5IQOA 4IDJH 3ULUE 1L6YA 4BGDA 5IFAH 7FABL 3MNDA 4DKTA 5K5YA 1XBZA 3IPBA 4P5MA 4WENB 4XN2A 3JUGA 3RCMA 2NW3A 3HMCA 4R7OA 4K1WA 3W23A 2F58H 5FUCC 4AT6A 2QVFB 1P5UC 4IIEA 2VEIA 3W07A 4IRZH 4MNMA 1A64A 2X7WA 5EA0L 4Z7NB 2MMXA 1E9QB 2WAGA 4JFEE 1DHKA 2KZBA 4Q8NA 4ES4A 5I1GL 2NDFA 3GO1H 4M7LH 4HTYA 5HMFA 5DJYB 3NIDF 3ITVA 2Y7LA 1CNVA 1NBVL 5DO2C 3KL3A 1SJXA 1V3HA 2VDKB 2NLYA 4LHJB 4BKLA 2GUYA 2MUCA 5I17A 3WD0A 5HDBE 4YDNA 4A7VA 1FYHB 5SX5K 1FUYA 1QPQA 4S1DC 3ZTNL 3MMDA 3M1OA 4NWTH 3LIZL 5F1SA 5JHMA 1AR1C 4YDKH 1HILB 1YQ2A 2OTUB 2UVFA 4OJCA 3V8CA 2I57A 4RZBA 2IH3A 3KPTA 1NCJA 5D37A 3BGMB 1H0DA 3KCJA 3N2TA 1KWGA 3FH8A 2QCLA 3B3DA 1EOKA 1QW7A 4PM1A 1OTSD 3HU7A 1FHLA 4E9QA 4KNSA 4YDJA 1TIWA 1XLAA 5E1QA 3VTMA 3IPEA 4ICCX 4IFRA 4IRSB 2ZX7A 2IPJA 5CN3A 4L5FL 3V5DB 3GSVB 4X6FA 2E74C 3WEOA 2XBTA 1BF2A 3N18A 2PD5A 3B8SA 1XGUA 2DKMA 2F74A 4Q6IB 1UT1A 1HO4A 5JR1L 1I7RA 1K6AA 3G18A 4GGBA 1G7PA 1E4KA 1X5XA 4Z7UA 1RUML 2QVTA 5GHWL 5I1EH 1X6UA 1U92B 1M6UA 5A16B 3THAA 3TH6A 1EKOA 3PGCB 3Q8EA 4PJXE 5E6YA 4FQXC 5AC6A 2XN9B 1GGIL 4UQ2B 2XQYA 1HIZA 4JYDA 3BUYA 3L3JB 2BC4A 1GKQA 3WFDL 4AENA 4ZNEA 3VXNB 4K7PY 3EO9H 2VOTA 3BN9D 4GXUN 1Q6OA 4GIYA 3RK8A 3BICA 1KTLB 2P3YA 2X9WA 2CAKA 3ML9A 3WUZA 1DUYA 4HNOA 4I5RA 3KLQA 1GOFA 1H3GA 2WB1A 1X5IA 4O4YH 3A5FA 1NBYA 5CPNA 4XN7A 3SDOA 3L4TA 3V0JA 2OTDA 3JVFC 1USZA 3NPWA 4NC1C 2CUAA 5E8DL 1QO2A 2BMKB 2D2CC 2FECL 4DVRH 3JVGA 5A6JA 2ZG2A 3QFJE 5HYQA 5A8NA 5TDPA 5TD4A 3RVXD 4DCQA 2NNCA 3HG3A 4UYQA 1Q7QA 3NQMA 4FPSA 1W8GA 2JKJA 2FEEI 2V5MA 3QCVH 4MY1A 3DBXA 3ALWA 3BO9A 2NY5H 4XKYB 4F2FA 5BXTA 2ED6A 3CDZA 4B3LA 4ZQPA 1LT7A 5CMAB 2WNWA 1SF5A 2QGHA 3GSQB 3IDMA 1LL1A 4MQ7B 1JK8A 3FXGA 1J5DA 1MI5E 1R5VB 1SVCP 1GPFA 1I45A 2OX1A 3LQAL 1GIGH 4P2RB 1EXGA 2P44B 4A38A 1UP2A 2Z1WA 3MS8A 1NBYB 4MJJA 4PUBL 3U4EB 2NXZC 3CZGA 1EV2E 1KIPA 4Z7WE 2DT2A 3IJQA 3QW3A 2R39A 3CHXA 4PFMA 4WZ9A 3ARZA 4BGLA 4GP8B 3IRPX 4ANUA 1DBBH 3NSYA 4J5NA 1H0GA 5FO8B 4FC3E 1SFTA 3FFDA 4L5FH 1XBRA 3D85A 4X6CE 5C08B 5DHEA 3WF1A 4R7DA 1P0NA 2BXVA 2WZIA 4EPSA 2G75B 1KW1A 2Y2TA 2VN7A 1CXIA 3NRQA 1N59A 5AVZB 5HHVH 3BAXA 3U0WL 5E00B 3LNEA 4OM1L 2ZZ4A 3NDZA 2GVLA 3RFAA 3OHXC 2QSVA 4N2LA 4G8TA 4UWMA 2ATPA 1A4AA 4MQXC 5E6ZA 5GQBA 5K9DA 3SBWC 3FNKA 2NY6B 4L9LA 3W1LA 2C7UB 1BVLB 4FI7A 3TNNB 1KFWA 2ZUTA 1XKYA 4OQTA 3FO0L 4ZSOE 3NJIA 2KH2B 2XHYA 3H8AA 1B2WH 1DCLA 4JAMA 3LI0A 1HHJA 2C16A 2K3TA 1FV1B 1PWLA 1BVKA 1OSPL 3I2CH 3VVWA 3KG5A 4XMWA 5DMNA 5HDOA 3UCRA 4A7SA 1JDAA 3DJSA 4BA8A 5LB1A 4R3SB 1G4EA 2G3JA 2JCCF 3BWAB 3EJSA 4HJ0D 4B7LA 3DVGB 4S1SL 3W38A 1KR0A 2XPKA 3WYRA 4O8RA 5E4OA 1TYGA 3WH8A 4JCLA 2AEOA 1PFOA 2IMRA 5E99L 4I18B 3WUFA 5AZEL 4W85A 5D9MA 1ORQA 1RHHB 4RSYA 5TE6L 5F7DB 4P7RA 5G5IA 3VVGA 3MBXH 1MJUL 2EDRA 2GJ6D 1M04A 3H12A 3QY6A 5B3SB 2HXUA 1F41A 3PZTA 3ZL1A 3IXAA 3PAVA 3EX3A 3ZFHA 3W82A 3TR9A 3GUGA 2GTQA 1KN4L 4UQ3B 3EF7A 3U9UA 3AAMA 5JW5B 4PW9A 4QE5A 4AXWB 4DFHA 1CXFA 2CM6A 3MCLL 4P2OC 3RVXC 5D2LA 2BWGA 4X9SA 3GBNH 4IL0A 1QA9A 3HMXH 1MAML 2XNAB 3T07A 4H4IA 1ZT4B 2GK2A 4DPRA 1BVWA 4FF9A 1HJCA 3WFBL 1VIZA 4QTFA 4L0ZA 4WDXA 1UBPC 5C8BB 2A6IB 1UEMA 3MUHL 4W9IC 4XNXL 5IRPA 1QT1A 2QJJA 4G71B 3NCOA 5EC2A 4LT9A 3CC1A 3AMKA 4PJIE 4H9MA 3WFCL 4L23A 3HFYA 3WFAA 5KYWA 5IUSA 2G5UA 3IU4L 4NZ8A 5IWLC 2WM1A 3GC2A 4X5XA 3FN0H 1RZJH 3MRMA 4ODXB 1XCXA 3QVQA 4OOZA 3S2JA 3HS0A 1A6ZB 5MHSE 3PPEA 5A6MA 4RLIA 2X05A 3OPUA 3QWRA 4P2RA 1Q6FA 2VE6B 2VR6A 1WWBX 3O63A 4GISA 4ZPVA 2WCAA 1KXVA 3TR2A 4KUZL 2YD5A 4AXWA 3B3IB 1X97A 4GINA 2V5JA 1OEZW 5HMSA 4E6MA 2YBGA 1T21A 4YHML 4WW2B 3NTYA 2J21A 3WSUA 4GSQA 4KVCH 3BDYH 3IFNH 5MEND 3HGRA 1YDPA 2XHNA 4IDLA 3VFMB 5F21B 2GUBA 3CMFA 3MV9A 4WTZA 1P5BA 1CDYA 1KZQA 3CVIH 4NPYB 5JOFB 4IUOA 1EEPA 3QWOA 3WY1A 4B5TA 2YWZA 2V69A 2DQDL 3CQHA 4AWJC 1YY8A 2B7PA 3NDYE 5E00A 5CSGA 3RA7L 3SIKA 1KLUB 3N5AA 5JHDB 1EP1A 3NQVA 3RILA 1XUZA 1EA9C 1EC8A 3G1XA 4X3ZA 5JH1A 1GQNA 4X5XB 5AAMA 3L3OA 2AEPL 2QBWA 4MNQA 4RXFA 2VDMB 5A2AA 1UHVA 4FL4C 5EF3A 1K8XA 1LLOA 4PG9B 3B0VC 3D6NA 1X3DA 3ARFC 3B4YA 2XKUA 4A29A 4O58L 1JHKH 1RL1A 2GCYB 1SHMA 1VFBB 4PJGF 4ZDHA 4IS6A 3Q5OA 1N6QL 1FCUA 1KDIA 1NSJA 5IVZB 3LSBA 1FNFA 2WTOA 5I0DA 3HJEA 3QJUB 1AL8A 3AHVA 3N85L 2NX5B 3Q4DA 1MEHA 2PBOA 3OXSA 1NFKA 4PRDA 1OO2A 4CVZA 1WD8A 1KPRA 1G7LA 3ELAT 3FUNA 4MZRA 3BEVA 3V6OA 1CGUA 2VZOA 4Z7OF 2OU4A 5DUMH 2P88A 3SDXB 3WL1A 3QQ0A 1AGDB 1CJYA 1RZIB 4EBQL 4M24A 3V5DA 3W2KA 1TTIA 1C16B 2E8ZA 5IJDC 3KVJA 4MG4A 2D20A 2B7NA 2CR6A 2P28B 1GGBL 4JTEA 1MEXH 1M6OB 1A53A 2YW3A 2QZQA 2OT0A 1P5VB 2HTLD 3H3PL 2NLJA 1EHAA 2RQEA 4JZJA 4U3XA 2PEVA 2FH8A 3CN3A 3HZMA 1SR0A 1TUFA 2XYLA 1F3DJ 3GZAA 2FIRT 4EUPA 1WFOA 5EPMA 2OEKA 3QPXH 4HHWA 4US5A 1KJVB 4ZDHB 4GUGA 2BW5A 1TREA 2PMZA 2ZJSL 4J35A 1PD6A 4MSSA 1FDJA 2JELH 2O6CA 4JLRA 4GRMA 4Q6XA 4HH8A 2W4XA 4HCDA 5HUPA 5IV2B 5FF2A 3CZKA 1H6TA 3AREA 3KD4A 1CL7H 1NAMA 4PJ8B 4UF7C 4A7TA 3RFZC 2NY4B 1FP9A 1FWAC 1W5QA 3TCXA 5C07D 4ONFL 3B2XA 5D70H 2H3BA 2TSYA 5CLYA 4BR1A 1S5HB 1A14H 2P0OA 1BFNA 3SPHA 1PEWA 5TE4H 3O2DL 2VLKA 1EZUA 1ZLDA 3LAFA 5T3XD 2OKMA 1AHKA 3ZE2F 1UZ8B 1SUXA 1LO5A 1ZPUA 5CFHA 4L2LA 1M65A 3HE7D 7TAAA 4QTIH 1KCRH 3LGDA 1I4FB 3NH7L 1KLFB 4MXVF 2HV5A 4UMAA 1G7MA 4L3FA 5I1JL 1T6VN 1XXXA 2MCMA 4PMZA 3FQ4A 3QZWB 4FOUA 1T1YB 4U5KA 3WH7A 4NX5A 1M7JA 6XIAA 1XCWA 4P46B 1FNGA 4BXVA 1I75A 2PWVA 3WK2A 4ONHA 1K5NB 3NCJH 5EU6A 4MZYA 4Z7VB 3CXDL 1VPOL 2Y85A 2IH3B 1Z89A 1K3IA 1SJVA 5HNRA 4FLRA 2XIDA 4YSQA 3U6RA 3WD1A 4FMFA 4MYAA 1MOEA 4FR6A 3BRFA 4UNTA 2R83A 1HUVA 3LGGA 4GFSA 1QWNA 5SWSE 4AYID 5KJRH 2SEBA 3GC3A 1DYSA 1WKYA 2DW6A 5AN7A 4LEXH 1NCHA 5EOCL 1AKJB 3NPVA 4KFZC 2DQGL 3MTRA 1MDRA 5KN5A 4MNQB 4QM1A 4LNRA 4QXUL 2MRYA 2BW4A 1PBYA 4YHYB 1AO7A 2BSTB 1UGKA 1L0PA 4N22A 5GRYA 3CQPA 4YC2B 2BOEX 2JF1A 3MP3A 3QW4B 1ZLWH 4PS3A 3LD5A 4IRJA 3OVUB 4PL2A 3FTGA 3IJLA 4LV9A 4JGUA 1R2RA 2CLRA 2XWRA 5K69A 3SY5A 2V5BA 3TA9A 3W2MA 4F57H 2C15A 4G8FB 2OSWA 3HE7B 4QKXB 2P1YA 2R4RL 4Q4EA 1KJ3H 1IFRA 1AFSA 2CW6A 4R6UA 1P6AB 3LI1A 1NFBA 1H8OA 3FJNA 3D9AL 4MZ8A 3KWVA 4ENEC 1CD9B 3X3FH 1QW9A 5D2TA 5IR1A 1OTSC 2G2RB 3TT1L 5B7MA 4QXWA 3WNMA 1B0WA 3MFFB 1I8MA 2FIQA 1T6WA 1KJ3L 3TA6A 4PJ8D 3NEXA 1U8LB 3C9NA 3D2UD 2EE2A 2F53D 3FYIB 5KTEL 3U57A 3IYLW 2VDNB 3GT6A 4OJFL 2OMUB 4WKZA 5IT2H 4LPVA 4HLJA 1Z0MA 2HRHA 1EFXA 2DMKA 5EIQA 1OFOA 5DELA 4EUPB 2WO4A 4TQPA 3CJPA 4PTNA 2WNNA 4E41E 2NW2B 2O56A 3VI4A 5AKQA 2ZSWA 1S46A 1FWSA 4WO4D 3C52A 1NAMH 3N43B 1HYRC 3FQ1A 5TQ0H 5I1DA 3J7HA 3P0YH 5AW4B 2BLFA 1BYOA 1MDTA 3NJVA 3WMPA 3ALGA 4H88H 3WK0A 3ILPB 4U6TA 2QKIB 4P5TD 2ESVE 1E7UA 3QXAA 3SE4C 1WZMA 2DQGH 4LSRH 4PJ7B 1JGDA 2WZTA 3WY3A 1TYEB 1IGIL 3EO1A 1KCLA 3OZ9L 1OKEA 1L7IL 3MP5A 2XDHA 5EEUA 2W81C 2ZKMX 3T5WA 4FA6A 1BFOB 1XF4A 3ESPA 3G3DA 4FXJA 4FTVA 2UZ9A 5FI8A 1Q0EA 4DVBA 1IWBA 4PGDB 4WFED 3MODH 1VERA 3UBGA 2NZLA 1GOKA 5BWAA 1A3WA 5IB3A 4ZMQA 5DJ2A 5FS5A 4JFDA 3WLWC 1CCZA 3QHNA 5D7JC 4OBRA 4OFYD 3F5WB 2CSPA 5E2JA 2QDGA 3CZFB 3Q6GL 3G3MA 5C7ZA 3B0UX 4FF7A 5KAQF 4MJ6A 5EO9A 4RAHA 3H3KA 4UAOC 4Q9QH 1KYFA 4TYUA 1G67A 2EABA 3K74B 4H20H 5KVDL 3L13A 4AQ1C 2G50A 2GSJA 1F3EA 5BOZG 2V9DA 1VKXB 4DK6A 3VDBA 1WPCA 1MZHA 1JZJA 5ESAA 5T3XH 1ZLUH 2NW3B 4Z0BH 2DPKA 2O61B 1C90A 1Q0YH 3SN0A 5DRZA 4JKPL 4DJFD 2EACA 1MFEL 5HHOD 5A2KH 1LO0H 3M0HA 2W07B 3PV6A 3BC9A 5INCA 2R2BB 1PSKH 3DOPA 3VXSA 1SYVA 3NQCA 1IILE 3V0VB 4HZ8A 1DQMH 4C56B 4FRWA 3T8XA 5JOEA 3M07A 2X89D 4UNVA 4C6KA 1N9PA 4M5TA 1XFBA 2CWXA 5F9WB 3QV6A 4MVAA 2DQIL 2NYZA 5D7JB 1TCDA 1W0VA 4HCFA 4G7YH 5KMYA 5TJWK 1AY1H 4HQQL 1FXQA 2HTMA 1WFIA 5BXRA 1N82A 3BE1H 4HHHA 1EIXA 3B9KD 2ROXA 3QZMA 2O61A 4ADSA 1XTLA 2Q5BA 4W9KC 5HVHC 2WC4A 1WIOA 3I7SA 2AANA 3V5HB 2B4CH 3APFA 3SDXE 2GJNA 5BZDB 2J8OA 4BSWB 2JI2A 4P04A 1W3NA 3JWDC 4PV9B 4JTCA 5FCZA 3V4UL 3HE7C 4WAFA 4GI4A 3UG8A 3ROOB 2IIJA 2WNZA 4WUIA 3NPUA 2ZWLT 3OKKB 1BEYH 4HT3A 3G1HA 1A14L 1IQWH 2W92A 3HG2A 3QIBB 3X1EA 1LP9F 4ZMPA 1X7FA 3EX4A 4ZMYA 3N9RA 3D0CA 5AVHA 3V4UH 3N1GC 4JDZA 3QQ9C 3UJTL 3LN9A 2FJFB 2P50A 1LM8V 1HVQA 5MHSD 3B8DA 1YUHA 4OGYL 4B91A 4Z1AA 2GTWB 3UH8A 3PGCA 4H2HA 3WHXB 3W83A 2VXTH 2E7BA 2PXYA 3G6DH 5GRJL 4YSUA 2HWGA 3APGA 1QRNE 2Z65C 1WFJA 3IXTB 2WSRA 4B4HA 4HYWA 3IXAB 2FWUA 3NIGB 2PWFA 5DHVH 5CS7A 1QABA 4K7PH 1XB8A 1CDIA 4U0QB 2AJ3A 3ZUCA 1J1XH 3IVSA 1HTYA 5AHLA 5L2KE 2POZA 2EIZA 1QFUH 2A77L 3BZFA 3SJVA 4W68A 1TJHL 3STZA 2ICEA 3V5HA 1BWLA 1W72B 3DOSB 2DAVA 2ERJC 1TPUA 1DFXA 2ZUUA 5DJ0B 5D4IA 3SODB 2A1YA 4WIQA 4F0SA 4N2FA 2EJAA 3GDKA 4PRIE 4ZE5A 5DJ8B 1QTWA 5IJKC 2O5YH 3WUBA 1PLCA 4JFSA 1F2XK 2D7TL 2FWOA 1QFWI 3MUY1 1MF2L 2W65B 4HS8H 3D2UB 4NBZB 4BK5C 1JUKA 3S1XA 3KYNB 5I00A 1GT8A 3V5OA 4KZEH 4JHWH 3UJ2A 1IRAY 4ZMAT 2MQ3A 2CBQA 3QK0A 3K6SB 1JRCA 2DT1A 2TYSA 3EEZA 1PE1A 1MREL 2EIDA 1R4XA 3UYRL 1S5WA 4DOHE 4YSTA 5CBAB 3ZE0E 1N0LA 4NUQA 2PR9A 2VQ1A 4K3JH 4ZTOH 5T3ZH 1YNKL 5AYZA 3VFOA 1IQWL 1T96A 3S3DB 4D2NA 1X5GA 2VAAB 1FCQA 4MNQE 3OMNB 1DFBL 1E3XA 3CUZA 3ONCA 5EBAA 3DARA 1MNUH 3WGVB 2APVA 1XLDA 4W5UA 2VDQH 3LHTA 1A7RH 1Q6GA 2D2OA 5FO9B 4LBSA 2DQTL 5D7IE 4C1KA 3D18A 2A1WL 3PIQB 1GNXA 2CO7A 1KLUA 5JHDA 2J66A 4YXHL 2DL2A 2O0TA 1W1IE 4PBGA 3MI6A 2PDNA 1ERNA 4Q52A 1AKJD 2UWEE 3CMOL 4Y19E 4HALA 1N6VA 3S6OA 3ZYOA 3B5GA 3V7MA 1YEYA 1PY9A 3O6YX 4QR7A 1VDGA 4R84A 5AVSB 2E1DA 3UPBA 1ZV5A 3C3NA 4YDLC 4AE1A 2YXXA 2OA9A 2DP3A 3TOPA 2ZRVA 1ZHBB 1T1YA 1FLRH 3BI9X 1BG9A 4PLNC 3F7JA 3MMEB 1WA2X 4S3EA 2ZADA 3AVEA 3ZDZB 1KC7A 1KBLA 2OZ4L 5I6SA 4RR4A 3PL6C 5J89A 2VM9A 3KWUA 2Q01A 4BD4A 2VLJB 4JRXD 3S34L 3IFLH 1B2YA 3L08A 5MEQB 1JAKA 2PGFA 4P5MB 4BQ3A 3GJFK 2JELL 5EC1A 2CRZA 4X63A 2FR4B 5GGVL 3EJYD 3SKJL 4KZEL 4PUEA 3UTSE 2DMCA 3Q5YA 3FHQA 4ZMWA 3IT8D 4WNJA 2Y7QB 2GIYA 3MRGA 3BAJA 3LPPA 1BQLH 3KCWA 3U9PL 3B7UX 5HNTA 2VW4A 2EDOA 3JBG7 1HQ4A 4GB9A 4NN6B 5IB5A 4GY1A 2WIIB 1ACYL 4MA7L 3OYXA 4KWOA 3EYQD 3DESA 1MJ7H 1KTDB 1EEQA 3GSQA 3RVTD 3WQ8A 3H9HB 4XWOD 1N7ML 3W1PA 2ZC8A 4I2XE 1DL3A 1BYAA 1QBMH 2DDQH 1LBLA 3S1UA 4IX2A 1R1CA 3JWNH 3NQIA 2NW0A 4X8GA 5FJPA 5C6PB 3VNZA 4RX0A 2AQ3A 3ZMEA 1J01A 2VDQL 5FM4A 1OP3K 2BSSA 3R06A 4S1DD 5IVNA 3S2LA 3KWTA 2X6MA 4G80A 3VOIA 3WLKX 7PCYA 2CKBL 3OKOA 3BH4A 3DTXA 3ILEA 2ZZ5A 1YNKH 2WIMA 3ABQA 3CAQA 4X6DA 1DQDL 2NT0A 1QRQA 1OAYH 4IRSA 3N73A 5I15H 1MFCH 1QCWA 1OK0A 3LB0A 3LTPA 3JRKA 3B9KB 4OD2B 2FTAA 3KR3L 4XXDA 5CHNA 5HK4A 3MLWH 1HF6A 1QHZA 2ZQ0A 2XKNA 2F7IA 1FVPA 5CILL 2N7SA 4RL3A 3QW9A 1G0DA 3UPWA 3MY9A 4PRBB 3FFDB 2VDLB 3CZEA 1WEJL 1Z5YD 2XETA 4IFOA 4K36A 4PUUA 4X2UA 2DYSB 3NVDA 5BV7L 1H62A 1BXAA 3BIKA 4O2EA 4LLQA 4KBPA 1D5XA 3H6OA 5DD1H 5JPMA 4PRTA 4WJ5A 2CRIA 4OJFH 3WEXA 4MDOA 4KU1A 3CUJA 4RDVA 2A9BA 3ULVH 3U0PA 3KPQB 1AD9A 3JZUA 4LFHG 3TTOA 2C7UA 5I16A 4JM4L 2QCHA 3FJTA 1PG7W 2FIKA 1FWDC 1UD5A 5HBBA 1V4YA 5DI8A 1Z2KA 1QWUA 4Y4HA 5IW1B 2MNRA 4EN3D 2VGLM 4OQ1A 2I56A 5IMLB 4G9FD 2GK1A 4Z76B 2MJWA 3GZ3A 3M5VA 1FQ0A 4GWEA 3BN9C 4FKEA 4H1LG 1IBGL 1P5UB 4XNQB 5EH1A 1RJYA 2WQDA 2YGPA 1QLFB 3ARGC 4PY8J 5E8EB 2YBRA 3OQEA 4KNQA 1HJUA 2QTVA 3OBKA 1QNVA 3R0NA 3SDAC 1SY6A 3L3KA 3VFGL 4WUUD 2OYMA 3P3SA 5B8CB 4KRZA 4PG2A 3RUGB 2QQKL 5KYUA 3WO3B 1AOZA 4FFWC 4HC1L 1VJIA 2K9UA 5D7LB 1VGKB 5AKSA 3S0CA 5C2CA 2EEAA 3TBTB 1UCBH 2KPNA 4PJ9A 3ZDXF 2HFGL 5J4MA 5EEVA 2ZZ1A 3CZ8A 3PR2A 5JIWA 1L9QA 3PY2A 3U7YH 2OTWA 1WT5A 2XRAL 4QCIA 1S1RA 3GXDA 1UD2A 4BUGA 4WJ5B 3WEXB 2VMCA 2WXIA 3PK7A 4FEZA 4Y8EA 4HUXB 3EH2A 3L5WB 4I0KA 3Q2NA 4XP9L 1DWHM 3WEAA 5IQ9B 1QPRA 3I7QA 4Y4HD 2JTYA 4YLCA 5F4SA 3IWUA 1VRDA 5HBFA 4B9FA 4IG2A 2XVLA 5ADPL 4NERA 1DSFL 5E4EB 4M6PA 4G8GA 4P57A 4C6IA 3UFYA 4TF4A 2YXOA 5D6CA 5HJXA 3UETA 2VUYA 8XIAA 1CFNB 2F74B 1UACL 5IHHA 2EYRB 3TFKC 4QSFA 2H8PB 5B38A 1I2PA 4LCYB 1EDQA 4M9OA 3MRQB 1VACB 3O0RL 3VKAA 2NQ9A 1OF0A 1HCYA 1T5WA 5IB3B 2FGZA 1XIDA 4S3CA 1OK4A 2EE0A 3T40A 3QUMH 2PP9A 2ADGA 5F6IB 1JF1B 1HFUA 4MVBC 4Y2LA 5DGRA 3PBMA 3R10A 4JTUA 1ADQH 2BSSB 2FQGA 4H88L 5FFGA 4DB7A 2NUWA 1ZVSA 1VZWA 4PULA 4AJ0A 3MLVL 35C8L 1TVNA 3OTTA 3TXZA 4QJ3B 4YFEA 4W9ZA 2AQQA 4ZPVB 1JK9A 4ZW6A 1BQHB 3VILA 1O7SA 1Q0YL 3RVUD 2SEBB 5AHIA 4H0GA 3ZJ8A 1GZJA 2PZNA 3AWEA 2RGMA 5K1VA 3L9RB 3VCNA 2ICEB 4XZLX 3RRXA 1K8DB 3AMDA 4PUMA 3AC0A 3ARWA 1GL4B 3C6EA 3JVGC 3QQ4B 3UP1A 1J9TA 4L8CB 2ODHA 3C6CA 4WHBA 3S6DA 2Z7GA 1WP6A 3O15A 2WSDA 3I6LE 1BDYA 4ZTPH 4PR4A 1T8QA 1AA1B 3WKZA 4XTRC 1UZHA 3A4DA 3ZJKA 3IK4A 2QHLA 5C09B 4MXQD 5KSBA 1SO3A 3GKWH 2NZ1A 1FL5A 1XQLA 5B7FA 1OX6A 3MDWA 1WC7B 1MEWA 1TJ0A 4IF2A 2FL5A 4TLTA 3TP4A 3QV9A 3PBWA 2J77A 3RM8A 4NQEB 3GNOA 3IDJB 5B80A 1UB6B 2ZUQC 3N3MA 1U8IA 2IAMB 3KCPA 2WXGA 4HJTA 1G6CA 5KSVA 1FWJC 3ULVC 1SNRA 4ISVB 2N01B 4O1AA 4XE5B 5FKAA 3NEOA 2NY2C 4ZUVB 2Q8XA 3HS0B 2F7OA 4W9DC 2ZDSA 2MCPH 2N56A 2P5ED 5FYJD 3H2MA 3VKJA 4FQXB 2AVFA 5DDHA 2ZQKA 4Z1CA 1NWOA 1JHKL 3QNFA 3VD3A 3DO7B 3V10A 3TEWA 3VWKC 5A3HA 1YUKB 3EOEA 1ML0A 3AT0A 1QNSA 2VC2L 4ZPTA 5L4FA 3IDGA 1OK8A 1NWUA 1HAUA 1AQMA 1M6OA 3OB0K 1TZHB 3WTWA 2X1PA 3L4XA 4IJCA 5CSZB 3NO1A 1LQSR 3SDYL 4XCFL 4X50A 3MBFA 3S8HA 1NTDA 1IXPA 3T0CA 1A21A 2AITA 2DFAA 3BLIA 4MLRA 2X70A 3W0WB 2BP0B 1MHPL 3NCFB 1PIIA 3CVIL 3EYOA 4XAKD 4QEEA 4Z1DA 1DBMH 5E23A 2IKIA 2YD2A 4UTAA 3UZ5A 1C1EH 2HWZH 3US9A 3LKQA 1E6ZA 1QTYT 1RPQA 4NI6A 2RH0A 2YPKA 2EEBA 5GRVK 4TNWK 3MLXH 4NZJA 3IFOA 3KZPA 3DJRA 5FECB 3JWNC 5A6BA 4S1RL 5DJ8A 4GMTL 1BFVL 4U6VL 3UTTB 1AACA 3KJ6L 4Y9EA 3PP4H 3EYQC 1JZ6A 2NY6D 2Q6WA 3TFBA 3GTHA 5GNYA 3FZUD 4OLWH 4AM0Q 5B3JF 1A7OL 3WN5C 2YRPA 5D4QA 4G6AC 5ECVA 3G6AB 2CJSA 5G4MA 1Z32X 3QKEA 1RD6A 3GK8H 3RVVD 3VMNA 4AF0B 2COQA 2ORBL 4AENB 1E6OH 3SPIA 2ZRZA 3WNOA 5DQJA 4DQOL 1NC4D 5D33A 5D1XE 3MC0A 4MAUL 4ZW7A 1C92A 2B15A 1KTLA 4NUJA 3RF9A 3FJ6A 1CFBA 4JD4A 1T4KA 1J05A 4CADA 1W5OA 2APWA 1AGCB 5MP6L 1RU9L 1JDEA 4W9TA 4JAMB 4UUJB 5BMFL 5FIPA 3BAKA 2YAOA 3EOYG 3FCPA 3H85A 1XLBA 2BVUA 1QO3A 3WG6A 5C0CD 2HT4D 4LC8A 1BAFH 3JWNG 1X7QA 3O4LB 1E9IA 1QOXA 1D9KD 4PGDA 1MCWW 4ELMA 4UQCA 2WXDM 3TQPA 4P2RD 5EUOF 5AL8A 1R87A 5CBEA 2BIHA 4TULL 1EB3A 4BWLA 1O7AA 5XINA 2CXKA 3LH8A 3EXJA 4DKFL 1S6NA 4OGQC 4AUUA 1C16A 1EGJH 3FSAA 5C09D 1Q63A 1BX2B 3MLZL 4AU0A 1L0QA 3SDYH 3HRZA 2VDQB 4W9HC 4WO0A 3WK3A 1CFQB 3NTCL 1A02N 4QHNB 1GTNA 1XH2A 1R3LB 3IGAB 2YUVA 4GX9A 1MXGA 4EE9A 4S1QH 3LCIA 3Q2VA 4J3BA 4R5XA 3RX8A 4R7VA 4DZ5A 2ITCA 3N50A 4TUUA 3U4EA 1ECYA 1E5UI 5D5MA 4PBWD 3GSNH 2FTPA 1OP3H 5A2CA 4X7CC 1JNEA 3MANA 5KUKA 1QLEL 4UU9B 2EYSA 3IIPA 5DJCA 4X5LA 3TYDA 4GBXC 4OB5L 4P06A 1I1YA 3QEUA 2Q86B 7FABH 1PB0A 5BUAA 3UO1L 5LAXA 1YRRA 3ISIX 2LU3A 1EYEA 2JTDA 3ECWA 3LM3A 3HFML 1U6AL 5E6IB 5T1MB 3C86A 5IOBA 2W0KA 4EI6B 3FMGL 1KNOB 3VNDA 3V4PH 3B2UD 1YC7A 3T8MA 5ITFA 1NL0H 2MQGA 4I1PA 5FFLA 3LV3A 4WFFD 1S2VA 3NH7H 4F57L 4U7KA 5K33A 2CXEA 4KEUA 4KVCL 2EH7L 1UGNA 2RACA 1A4MA 1IXQA 1W31A 5I3GA 2HFFA 3N91A 4U1HB 2X30A 3ZHKA 1U3YA 2OSLB 1AW2A 4KT2A 4PJIB 2R23B 1U8HB 1ZE3H 3QR3A 4HK7A 4LW7A 1N12A 3ZWTA 1NMAL 1S9WA 1R3HB 1E73M 2GVJA 3CK5A 1GYMA 1WQVT 2JIXA 1DLFL 4UTCA 5D7IF 5GGVH 2CDFB 4HF5H 4E9VA 1RBAA 1CENA 3M46A 5GJTH 3MO7A 2H0EA 3FZUC 1A66A 2E59A 5B7EA 2YCLB 3U6RB 4M5ZL 3QQNA 4LEXL 1X8CA 1U8KA 3K4WA 5LSMA 4FLSA 3BPNC 3PGDB 4AYEC 1W54A 5C0QA 1NANI 4HYTB 1K9DA 3HPZA 3W88A 5L9DL 4WI0B 3PDDA 1DUZA 5C5YA 1TYJA 3X11A 4MKMA 5E8OB 4Q9RL 3T6XA 3LY6A 4JM2B 1OGBA 1S9YB 1S7XB 2DOCA 3UBPC 3NJNA 3KTCA 1EZWA 3H7VA 4CBZA 3IKKA 4AMKH 1UG6A 4KX9A 5AW9B 2EVGA 4GCXA 4K2UL 1E3FA 1XCTB 1D9KC 1KB9J 4ZODA 1HHGA 1N2VA 3T0BA 3ITCA 3PF3A 3HRPA 4M7TA 3O6MH 3GMPA 1ES0A 1T2QH 4D0BB 1F73A 2HS8A 2VEPA 3G6JF 1O7VA 5BQ7B 3LRGA 4OGAC 4TTGA 1V0NA 4H8UA 1M57B 2BZNA 5FYKL 2PC8A 5D2NA 1NANH 5ID1A 2AW2A 1KM6A 2O5ZL 4N20A 1ZSXA 5IV2A 1ZBCA 1A2YA 4E9LA 3MZNA 4FF5A 2EKSB 1NCAL 1IB5A 1AE6H 3GRWH 5CILH 3SE8L 4BI5A 2WXKA 4QOKA 4PEEA 4LSSL 4H6EA 4HU0A 1RCOB 4FFTA 1CWVA 2W65A 2C8NA 2AAAA 1F00I 4IYKA 4I18C 2VR5A 3V5KB 1C12B 1ZA6A 3NUKA 3S5LG 5F7UA 1JRBA 3F5LA 1NBZA 1PDKA 4XPGL 5B8CC 5BS0A 5DQ9B 4AYGA 4DZ8B 2X1RA 5I30L 4JQ3A 2H1PH 5A2JH 3UGUA 3UXFA 3QA3B 4Q74A 5KVFE 2DJUA 2ADAA 3P61A 1DE4A 2ISVA 4TXEA 1K5WA 2OOFA 5EL1A 2YPLA 5BOFA 1LNUA 4HZAA 3SO3B 5I6XB 5IMKB 4FYQA 4R7JA 1VKFA 3FUFA 1ZJIA 3L5MA 3VGGA 1L9SA 3HI6H 4GUFA 2WJFA 3RP1A 4YVPA 3TCSA 3HKZA 2EXSA 1M5WA 5B22A 4GG6A 4I48B 4XWGL 5C9XA 4OFYA 5HHOE 1S1PA 1AD1A 4EPDC 2R69H 3LMJH 1ZENA 4FZEL 3WNIA 3ZTCC 4Q9RH 1OEPA 3NJHA 4L1LA 4TVPD 1CK0L 3VG9B 4L4TB 4JZ5A 1JXGA 2IDQA 2A6JB 3TXAA 4TQ8A 5SWZB 5JTWA 5IVXA 5K1NA 3E49A 1QSVA 3IJHB 3SR7A 3F2DA 1HKVA 5FSDC 2NY7H 1XG3A 3LCFA 3V0FA 4RBPH 1B90A 3MJ7A 4AQZA 3V6FB 2QIWA 1OVDA 2DSUA 1UR2A 1MHCB 3P1VA 3KDMA 1HEZA 4GRLB 2GHWB 3ECUA 4U33A 5DHDA 3RGVA 5J13C 3F4WA 4P7NA 4LDEB 4HK5A 3ECVA 1OGSA 1LNUB 1OC5A 2ZVIA 3VE7A 3E0VA 4OI9A 1EXHA 1B6DA 4PLOB 4R34A 5HMDA 5KJRL 2DLHA 3PUUA 5A7BA 5LHDA 2OQJB 4Q4RA 1J5OL 4L5ZA 1NCAH 35C8H 3OWEA 3MOAL 4NFBA 4CQ9A 2YDRA 5DT7A 4JO3L 2V2HA 4IMKA 4XNYL 1UYWL 1OQFA 1GUVA 3ZKNC 1DVZA 5FYLL 3N3TA 3LS5H 4HBKA 3SDXA 2J6EH 3WF2A 4G83A 1GKEA 4DQAA 2OOGA 1X1ZA 3EYOB 3E0FA 1UYWH 4UTBH 4WEVX 1BBDH 3SUSA 2X44D 2WLJA 1NLDH 1T1XA 3FCSB 2AEWA 1KFAL 4GUPA 5I66A 4R2GC 4KRTA 2QUNA 1UWXK 4L1DA 1XQKA 4RH4A 4NIRA 7REQB 2DJ4A 4GRSA 3EAUA 3TBBA 4AV5A 3WTVA 2YZRA 3TW9A 1U36A 2CUHA 2WW8A 1XLLA 2VDRL 3WDHA 1JXKA 3K8KA 5F93C 1QMUA 3TZVC 3LZOA 1E9PB 3ALFA 1KJVA 3PGFL 3EMZA 5IHWA 2ATKA 1D7BA 4IRSD 5IEKB 3VXSE 1ADQA 3FS9A 3ZE1B 4GNJA 4POYA 5I8OH 5IIEA 2C3ZA 3ZU8A 4XPTH 5CZVL 1CE6A 3VSQA 3R79A 5I6XC 4HIHA 1K02A 3CVDA 4CUCA 3MBED 1Q7MA 4KDWA 2JXMB 5DVPA 5EG6C 1UMLA 5EZJB 5HDLA 3KYOA 1JCVA 5IW3A 4FEMA 2EXYC 4YMPA 1KJ2B 1IE7C 3L7EA 5ESQB 2D9QB 3QHTC 2WWMC 5J6GB 1CLVA 3L45A 2WCGA 4IMLA 1VFAB 3EG9A 3UEQA 2VFHA 5J04A 1SN5A 4R8WL 4Z7NE 4NLAA 1VGAA 2PDXA 3I9AA 1OF8A 5DD3H 2GUOB 3Q58A 3E0WA 3TUUA 1FUNA 4HNUA 2LTQC 3B3IA 5EMYA 3DUGA 4YLBA 2CLFA 1SPQA 3L3GB 4BFIA 4MWAA 1ZQ5A 3MRKA 5CGTA 4IMFA 4O28A 1M05A 5DLLA 1FAIH 5K9KB 4F2UA 4AFYA 4HP5A 4BHUI 3IJSB 1OINA 2IAAC 1U1UA 3UF9A 4EX4A 3EBAA 1N0XH 3N6JA 3FCTB 5K1JA 3TH4T 3LJ3A 5AVYB 4ZXBB 1FBAA 3UC0H 4BQ8A 2ZXBA 4REQB 4F24A 4B5ZA 4CQBA 4OV5A 1LHZA 5HJGA 1S7SA 5KUMA 1Z8AA 4WDWA 3L4YA 1IGWA 1HL9A 5DJ0A 1TELA 3EWYA 2ZTJA 4JL1A 3W25A 4TUOA 3LRSB 4DJMA 3MRHA 4KX7A 1D9EA 3OWRA