3BAXA

N298s variant of human pancreatic alpha-amylase in complex with azide
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 179
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3baxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3baxA01
3OLIA 1V0KA 4J28A 4U3CA 3BLBA 4AD3A 4M80A 1ISZA 7A3HA 1EDTA 1E5NA 3GZAA 3KL0A 3AICA 4OOZA 1EGZA 4JHOA 1U33A 2WSPA 5E09A 5FD0A 3AHZA 3AI0A 1MW2A 5A6JA 1W9BM 3CZ8A 4P8XA 1EDQA 1H09A 3BUQA 2ZOXA 1BHGA 5HPCA 4FNTA 4LYQA 1UH2A 4LQ1A 3OIHA 3KE0A 1FH9A 1J10A 4PMYA 1ISVA 4W89A 3PZMA 3WMCA 2BS9A 4AYSA 3W6LA 3F5JA 3O9NA 2CERA 2VZSA 4GO9A 1OGGA 2XVPA 1HJXA 3H55A 2ZX7A 4D72A 2ZWZA 2X1IA 2E4TA 5E0CA 1BF2A 2W61A 4D6GA 3APGA 5CLWA 3LMYA 4XB3A 2JIEA 2C7FA 1X1NA 1ISXA 3ARQA 2O9TA 5HPOA 3D3AA 4ZXLA 4TOQA 3VIJA 5DT5A 2VZVA 2J8GA 3WH6A 1LG2A 3MUAA 4BQ3A 1QI2A 2WHKA 1EA9C 4GIAA 5GPRA 2G3MA 1HNYA 3AFBA 4D6EA 3ARWA 5FIPA 2ZX5A 3VMNA 2OYLA 3W4RA 1JAEA 2BVDA 1B3XA 5A2CA 3BUDA 2WAGA 4KRTA 1CGVA 2E8YA 3WDHA 5EBAA 4BQ2A 2Y4SA 3A5VA 2CHOA 1VEPA 2J7BA 3F5LA 4AISA 2AMGA 4RE4A 3D51A 1E6RA 1CECA 4MNMA 2E0PA 5GNZA 1CXKA 2DH3A 5E1QA 3AS3A 2MANA 3TTSA 1H2JA 4F66A 3LPOA 1E0VA 4CKQA 3EDKA 1NOWA 5CQ1A 5I79A 6CGTA 1G9HA 2F8QA 5D8ZA 2NSXA 1UWRA 2EEXA 5A8PA 1JL8A 1E71M 1V3KA 1CLVA 3LX9A 4ATWA 1CGXA 1JNDA 2OW7A 3BSHA 5JBDA 3AZTA 1Q6FA 1JXJA 1UR0A 3RDKA 4AZ5A 1XSJA 1R7OA 4DO4A 3EBVA 1E1FA 3AROA 3CZJA 3B9DA 3VD7A 3RJYA 3W29A 5A2AA 2J62A 2O9RA 4M8UA 3MV01 3AHTA 3RMEA 1L8NA 2CYGA 3UR7A 3UG4A 5D8WA 1SYTA 1J0IA 1QNPA 1JF5A 2GFTA 3NSXA 3SUUA 5AC5A 3AXXA 1CDGA 5IFPA 2J4GA 3SCNA 2EPNA 3WN6A 1H49A 3THDA 4NZJA 4PSRA 4ZE5A 2CBJA 3EMZA 1TMQA 2X8RA 4JIEA 1R33A 2JFEX 6A3HA 3AMLA 4WKAA 4CD4A 1X6NA 1W1TA 3OGRA 1E56A 4MNKA 1R86A 1ISYA 5DEZA 3AS0A 1BGAA 3K46A 1NP2A 1XCXA 3OZPA 1K9EA 3ZIZA 1HT6A 3A23A 1PAMA 3WUEA 2VUYA 1QOXA 3D4YA 4FLSA 2Q8XA 3AIQA 3ZR5A 3SCTA 5I24A 3VVGA 3TONA 2WZIA 2OSXA 3WF3A 3OLGA 4AIEA 5DMYA 1MW3A 3N1AA 2CITA 1GHRA 4CN4A 3WF2A 2VRKA 1F4AA 2CETA 2E8ZA 2J25A 3MU7A 3AIRA 2WVSA 1H0IA 5I5RA 3BUIA 4D6HA 1TVPA 3SCOA 4ACYA 3SCUA 3AMDA 4OBRA 1JZ3A 4AZGA 5I78A 2J7FA 4W93A 1G0CA 1BVNP 2PWDA 1JYXA 3A6OA 1E4MM 2RGLA 2X0YA 2XIBA 1UG6A 4RL3A 4MAZA 5A6KA 2YL8A 2BXZA 4B3LA 2VI0A 3CUIA 3BSGA 3LPFA 4UFKA 5GQBA 5ABHA 3UCQA 4A3HA 3HG5A 1NH6A 4PCSA 4W88A 4PMQA 1GPFA 1LJYA 3WF4A 3AOFA 2YKKA 5E0FA 3ARSA 3T2QA 2JIWA 2EXOA 4W8LA 2VRQA 3MUY1 2VR5A 4YHEA 2WC7A 7CGTA 5D9MA 1VJSA 3LRLA 5GNYA 4MADA 2E9LA 1UR9A 1Z32X 1GJWA 5A6BA 4AYGA 1EOMA 2UWFA 3CMJA 1WDSA 2OYMA 2V3EA 1WB0A 5EB8A 3SCRA 1GNXA 4U33A 3W24A 5HOSA 1KCLA 2XGIA 1QI4A 1LG1A 1UYQA 1X6LA 4JL2A 1UR2A 2ZUTA 3ARVA 2WC4A 3MS8A 4CGTA 3TTOA 1TQSA 3VO0A 2AOSA 3B9AA 4NXSA 1JZ8A 2E40A 1W1VA 1ZU8A 2XTKA 1JF6A 3CZKA 1JDCA 5I77A 1JD7A 3DHPA 3DX4A 2WSKA 1NP0A 4AC1X 3EJPA 3CZSA 2BHZA 3TP4A 3FHQA 3WNNA 4QLLA 4W86A 4BCEA 4Z2GA 4E4PA 4MDPA 4TTUA 2VVNA 3FY1A 4D71A 4EE9A 3VIOA 4MJ2A 2J78A 2CXGA 4D6FA 1N82A 2XG9A 4S3KA 3PZTA 4WKFA 4FNPA 4UNIA 2HISA 4BA0A 1QNOA 2WMIA 2YOCA 4KRUA 1B31A 1UA7A 4AZIA 1TUXA 2X2IA 1KWGA 5FCZA 1BG9A 1WZMA 2EPLX 5D9PA 2CHNA 3PN8A 3VDBA 4IUGA 3CTTA 1V6VA 1CGUA 3HG2A 3WH7A 5JUVA 1J0ZA 4PN2A 3A4XA 4MB3A 4NXKA 2W62A 5AY7A 2ESCA 1WO2A 4PUEA 5JIWA 5E70A 1UKTA 1E9LA 3WEZA 1QVBA 1XV8A 3IJ7A 4J3SA 2W63A 3WD2A 2WHLA 2FHBA 1QNQA 3RCNA 4AY1A 1O6IA 1G5AA 2EABA 1OM0A 3W27A 3BUBA 3EJRA 4J27A 1ESWA 1WZKA 1FFRA 3OGSA 4OIFA 1BYDA 2FHFA 1Q6EA 8CGTA 2DT0A 4GPNA 1JI1A 1NQ6A 3ALFA 3T0DA 4C7FA 1VIWA 1HXKA 4HZ7A 3WD1A 2IXUA 5DO8A 3WH8A 1J12A 4Y7EA 1XH1A 1E73M 4Z2HA 1QI5A 1V03A 3DX2A 2UY2A 3VIIA 1GOOA 2D73A 5CLTA 1E0XA 2J7HA 1A47A 1W9VA 4N0RA 2WHMA 2Y24A 1QI0A 1UD8A 3GXIA 3B9EA 1B3ZA 1G94A 1MXDA 2GJXB 5HNNA 4AMWA 2WMJA 2AAAA 5A6SA 3UERA 3DDGA 5LA2A 3GNOA 3ARRA 3WNLA 1SZNA 1VF8A 3RILA 1C7SA 4AZ6A 1WKYA 3N18A 1UWQA 3CBWA 3LPGA 2ZX8A 2D0HA 3GBDA 1UD2A 2G3IA 1V0MA 2ZXQA 2F7QA 3N9KA 2G3JA 5ABEA 1UOKA 1E43A 2XN0A 4CD5A 2E3ZA 2DGAA 2OSYA 3EMQA 2G3NA 1OBAA 4J3VA 1TVNA 1G1YA 4KMQA 1UD5A 4AEEA 1JYVA 1DEDA 2C0HA 1HJVA 4NZFA 4J7RA 2BHYA 4HOZA 1HX0A 2IGTA 4HOXA 2DT3A 3WH9A 4Z2KA 3SEPA 2O9OA 4DUVA 1JYNA 3BVVA 4GQQA 1W3KA 3MANA 1XCWA 2FE0A 1UWSA 4B9ZA 1C90A 3J7HA 3BH4A 3OZOA 1EO5A 3ARPA 3ARTA 3AMCA 4PCTA 3VGBA 1RP8A 2D0FA 9CGTA 1T0OA 1E5JA 1VFFA 3JUGA 3VOCA 3AXIA 4KWUA 4HA1A 1O7DC 4S3JA 2YA2A 2YBUA 5BXTA 3VD4A 3NIYA 4DUXA 2YL6A 3DX1A 3GXMA 1HJUA 4KH2A 4JFTA 3S5ZA 1E4IA 2WVVB 4Z2JA 1F4HA 3M07A 1UKQA 2YBTA 1OT2A 4AD5A 3A47A 4R5EA 1PIGA 2E9MA 1LLOA 3PZGA 1OGBA 1JNEA 2V3DA 1PX3A 2DT1A 2J7DA 3VX0A 1B30A 2UY3A 4U5IA 1JZ2A 3KLLA 1E55A 1NWRA 3WNOA 1RH9A 3UG5A 1CXEA 2X2HA 3W37A 2BHUA 2Y5EA 4JZ5A 3VKKA 4D6CA 2UY4A 2W91A 1E0WA 1DWFM 5HBFA 3ARXA 3DX0A 3LXBA 2BY0A 3QHMA 1W1PA 4TUFA 3VILA 2BV9A 4JFUA 2WMGA 2VZTA 3BCFA 1V6XA 2GSJA 5FOOA 3IAQA 3GNRA 2BY2A 3L2LA 3VPLA 1I75A 1FH7A 3O6AA 4N42A 1KQYA 3ZJ6A 3NSMA 1SMAA 2FYVA 1W9XA 3U57A 3VTRA 3PZ9A 5DF0A 3E1F1 3T2OA 1VBUA 1M7XA 2DT2A 1DP0A 1Q4NX 1WE5A 3L4VA 3GXDA 4QDMA 3WNKA 1BLIA 2F61A 4WSKA 3U5YA 5CJ5A 3VGGA 2X09A 1CPUA 1TZ7A 1KXQA 4ZXOA 3WBAA 3BVWA 3MI6A 3ZT5A 3W53A 1K9TA 1MQPA 4L4OA 4DWSB 2VT0A 1B3WA 5CSUA 2V5DA 2A3EA 3D4ZA 2DEPA 2XHYA 1XD0A 2WM0A 1L0PA 2GUYA 4RE3A 1JD9A 1OB0A 3GNPA 3TTQA 1D2KA 4TTGA 1JZ4A 4AZ7A 2D24A 1UH4A 2ZUMA 2D3NA 5EMYA 5ABGA 3RM9A 3AZRA 3WNMA 2XIIA 3L4WA 1YHTA 1K9DA 1BFNA 3VDCA 3UETA 5A3HA 4JKLA 1UR1A 4U2ZA 1KBBA 3CV5A 1XGZA 1HWWA 5FKYA 1VFUA 1NWTA 4QFUA 2XN1A 2X05A 5D9NA 1WDQA 1ITXA 2XVLA 3K4DA 4ZEPA 1CIUA 3KWXA 1HKJA 3AHXA 2A3AA 2WKGA 1ECEA 3BAKA 1VJZA 2XVGA 4F79A 2FH8A 3N13A 1JI2A 4CUCA 3WUBA 4X9YA 1OCQA 4GZIA 3DYMA 4M1RA 1FHLA 5CXPA 4K68A 4ZENA 3EDEA 4AZCB 2WCSA 4CD7A 3SCSA 1BVZA 1HP5A 5KEZA 2JALA 4WIWA 4V28A 3AHVA 1CEOA 5FL0A 4PTXA 1QI3A 4QLKA 5A94A 1JDAA 3WQWA 4B15A 4AD4A 3PZQA 3VIFA 2DSUA 5TD4A 1Y7VA 2XFFA 1R75A 2D0GA 2J79A 2UY5A 4UFJA 1E4NA 5IXEA 4J3WA 3BVUA 4P7QA 2GJRA 1ZJAA 2CBIA 4HU0A 1P6WA 2V3FA 1E4LA 4URIA 4TX6A 3VIKA 1UWIA 2RGMA 4P7NA 1A3HA 3CUHA 1KR1A 4UFHA 1GOKA 1NOUA 3W0KA 4NX0A 5BXRA 1GOWA 1ZBVA 5CG0A 4JKKA 1U2YA 2G4FA 1VRXA 3K1DA 1W2PA 1JGIA 3K8LA 1Q6DA 1WDPA 4F9DA 1ZL1A 1XRVA 2FGZA 3HU7A 4AZHA 5JBFA 4ML4A 3CLWA 2CESA 4W7UA 2QPSA 4AD2A 2FHCA 1GOIA 1JIBA 1QWNA 3CUFA 1ZBWA 3VUPA 1KB3A 1KXTA 1H41A 3EJUA 4M29A 4JFWA 4GI6A 3MO4A 1UASA 2ZUNA 3EMCA 5CGMA 5AYIA 5CGTA 2WMHA 1JZ6A 2BNJA 1LWJA 2XFYA 1DWGM 3EJQA 3AIEA 3OBAA 3W28A 3AS1A 4HMEA 5A8MA 3AIVA 1W3HA 3L4UA 1VENA 1C7TA 4TXEA 1HN1A 3RPMA 3BAWA 1GUVA 2CBVA 3KL5A 1CGWA 5A6MA 1E6QM 5A6LA 3II1A 5JIPA 2JF7A 1DWAM 1KXVA 1HJWA 1D3CA 4C7DA 1WPCA 3DHUA 4PMVA 4OUEA 1B90A 4DWSC 4FMVA 1H0GA 2EAEA 4BQ4A 1KCKA 2FGLA 4MDOA 2PWHA 3A4WA 4WLCA 3SUWA 3L4ZA 1UQZA 1FFQA 2GJXA 1W3JA 3PZOA 2BY1A 2PWEA 1DTUA 1HIZA 1C92A 3UEQA 4UOZA 1HKKA 1M01A 3VM5A 3IJ9A 4QCEA 3AQUA 2YA0A 2DH2A 1TQTA 1MW1A 3HJEA 1XSIA 2VCCA 3OA5A 3RJXA 3PTMA 1W32A 3VDAA 4W5ZA 3W82A 5AC4A 1H3GA 2VOTA 3WENA 5GNXA 4WSJA 1H1NA 2G8ZA 1V02E 3BCDA 2YJQA 1JFHA 3WEMA 1HJSA 2FDMA 2YLAA 3W38A 4HPHA 5C71A 2EO7A 1TA3A 1V6UA 4J3XA 3CUJA 4UQ9A 1UA3A 5BRQA 4GI9A 2TAAA 3K4AA 4HTYA 4UOJA 1JYWA 4GQRA 4CCEA 2YFOA 2YA1A 2WZHA 2W67A 2JEPA 2W92A 2WBKA 3WQ6A 3SCPA 1C8YA 3WY1A 1W3LA 2VL4A 2D20A 1DWIM 1V0NA 3WBEA 1J9YA 2DIJA 3GH7A 1WZAA 3AS2A 4UFMA 4CU8A 1R85A 5C8BB 3DECA 2XWEA 3FN9A 2QHAA 1V6YA 2OW6A 1PZ2A 5F7UA 3MMUA 3GH5A 3WQ8A 1XSKA 3AJ7A 4W85A 3OLEA 1PX4A 3KL3A 4GINA 4WK9A 3BGAA 3GXFA 3GXPA 1J0KA 3VU2A 3W25A 2DDXA 1OINA 3WSUA 1AQHA 1QHPA 3CZGA 3I3BA 5BXPA 5M5DA 2CEQA 2CKSA 2W66A 2WVVA 1ZBKA 2ZX6A 2WLZA 5LA1A 1OT1A 3PZUA 3GM8A 4Q22A 3VIHA 1FA2A 4MB4A 3WY4A 2WCGA 2VQUA 1PEZA 3EJTA 1AQ0A 3S2CA 2WMKA 4DM2A 1VFMA 5CPQA 1UUQA 1GVYA 3MUIA 1IZJA 3GTNA 4HZ6A 4E8CA 1OD8A 5CPTA 3VX1A 2V38A 4NRRA 1VAHA 4W8AA 3BLKA 1OD0A 3SURA 3ARUA 1RP9A 3CHDA 3T09A 4OBSA 3A24A 2QV4A 4FLQA 3WMSA 5LA0A 2WC3A 1M53A 3SCQA 2YL9A 4LYPA 3VD5A 3A21A 2F7RA 4GKLA 2EPKX 4V2XA 2J7EA 4GI8A 2DSZA 3CHCA 2D22A 5KZ6A 3A3HA 1FHDA 4CCDA 4FNSA 4QP0A 2OLHA 3OB8A 1UH3A 4F8XA 2EQDA 1KTBA 1QNSA 4D1IA 2WBGA 1E6ZA 1XH2A 4PYSA 1UWTA 1QBAA 2YLLA 3VIGA 1KXHA 4AD0A 3IGUA 2FH6A 3M46A 1R7AA 5E6YA 4M56A 4HMCA 2QF8A 2XWDA 3WQ4A 1M04A 2PBGA 3SIMA 4UCFA 2YL5A 4DWSA 4FF5A 3WDPP 3HN3A 1HTYA 1R8LA 5D4YA 5A6AA 4IM4A 5ABFB 3PZIA 2A3HA 3BAXA 3H54A 3CO4A 3ZOAA 3TTYA 3ZM8A 4FNUA 5CSYA 4ACZB 4IPLA 3WMBA 1GZJA 3TOPA 4A3YA 4WJXA 1YQ2A 5I2UA 1MVYA 2GJPA 3VD9A 2Y2WA 1KFWA 2PI6A 3L4YA 4W87A 5E9AA 2CIPA 4P8VA 2YFNA 4NSBA 2NW0A 4GZEA 2VRJA 4A4AA 2Z1KA 2XYLA 3NDZA 5A8OA 4UZSA 3ARZA 4LX4A 4PRWA 1TA3B 4E2OA 1UZ4A 4H41A 3T08A 4GO8A 3VIPA 3K8KA 1OWQA 3ZJKA 1JFXA 5JBEA 2CNCA 1E72M 4HU8A 1BYCA 4OOUA 2CKRA 4J3UA 1QNRA 1EHNA 3N12A 4MTVA 4XZBA 4HOWA 3WQVA 4AIOA 1E3XA 1W9PA 4PMRA 4B9YA 4CN6A 4R27A 4AZCA 4RE2A 1PJ9A 2GK1B 2CPUA 5BROA 4KGLA 1QHZA 1NWSA 3WIJA 2PWFA 1XD1A 3VD3A 1D7FA 4D6DA 1QW8A 3ZR6A 2J7CA 3VDHA 4U2YA 1PPIA 1R34A 1SR0A 2V3GA 3AIUA 1GQLA 4XUYA 3LRKA 4TVDA 5A8QA 3F4VA 3MSDA 1HXJA 3VGDA 2ZE0A 3WDRA 3ZQ9A 4BS0A 1C91A 5BYWA 1G01A 1I1WA 4HP5A 1NM9A 2XUCA 5A69A 4JKMA 1MFVA 3BLPX 1U30A 4AZBA 1FP9A 1HVQA 3M7SA 1HKMA 4TVCA 3RO8A 4MAVA 4MJ4A 1SMDA 2NT1A 3NCOA 1R46A 1V08A 2VC9A 2D1ZA 2DSWA 1KWKA 4H7VA 4NI3A 3OG2A 2XM1A 1QHOA 3U7VA 1S46A 1IV8A 2F7OA 1K6AA 1VEMA 4U5KA 1PX8A 3IANA 4M81A 4OGZA 1V0LA 1KBKA 5CZKA 1UR4A 2J8FA 1ODZA 1TR1A 2WB5A 5IHSA 3MV11 1AVAA 3W26A 4MPKA 1J0JA 3U5UA 3LRMA 1V3HA 3I3EA 3G6MA 4P7LA 1KGUA 3I3DA 3UR8A 4J3TA 5HDRA 4AD1A 1O7AA 2Z1SA 4FLOA 3GXNA 3PZNA 3THCA 5IDIA 3WY2A 3VMOA 4UQEA 4AIUA 3NSNA 2X2YA 3D52A 3OLDA 3B8SA 4TVUA 3VIMA 4Q7NA 2Y8VA 2VX4A 4DUWA 3BVTA 2WXDM 1WZLA 5LYRA 2J47A 3VGFA 2ZXAA 1J0YA 1GOMA 2YDRA 1XC6A 3GDBA 1TE1A 1KR0A 1EO7A 3HG3A 3BAYA 4L4PA 4ATDA 1LQ0A 2VCBA 1GCYA 2Y8KA 1EXPA 2E9BA 3ALGA 3ZJ8A 4Z2IA 2B31A 2ZUWA 4H8UA 4HA3A 3AIWA 3SCWA 3VM7A 2O92A 1FOBA 3N17A 4PMUA 2XM2A 1V02A 1GOQA 4HMDA 5I3DA 4V27A 2C8NA 3W81A 4MNJA 4B3KA 2QMKA 2VX7A 3IJ8A 3A22A 1LWHA 4QLJA 3NJ3A 1CXLA 3RM8A 2EBNA 1XYFA 3AMKA 4FK9A 1QWUA 4CU6A 3FXYA 2F18A 4HPGA 3SUTA 3VSVA 2ZX9A 2GDVA 4UFIA 3WUGA 3PTQA 2EPMX 3N11A 3BXWA 3BMWA 1OIFA 1JDDA 3S5YA 2VNCA 3CZEA 1EIBA 1UD6A 4LPCA 3HMCA 1GORA 1CBGA 2WW5A 4FNRA 4IISA 8A3HA 2X0HA 4JCMA 1PZ3A 1ITCA 2XN2A 2OWXA 1NOFA 1LF1A 3OGVA 2ZXDA 1UD4A 2HVMA 1UKOA 4UTFA 2VURA 4PBGA 1MYRA 1HJQA 1MQRA 1UKPA 3VMPA 2J75A 3PZVA 1E70M 4PTWA 4IPNB 5A6BD 3HG4A 2XGBA 4EK7A 1CENA 2VTFA 4F9JA 3WD0A 1GJUA 1QBBA 1BQCA 1B3YA 5IHRA 1C8XA 4UOQA 1EDGA 3ZT7A 2D3LA 3WL0A 5BXSA 4WF7A 1Q6CA 1ZBCA 5EFDA 4UZUA 2WHJA 1VEOA 4ATLA 2X2JA 1BYAA 2BVYA 2IXVA 3DC0A 1DWHM 3WD4A 1WDRA 1TQUA 1UKSA 1ZS2A 5EFFA 1DHKA 2WCAA 2J74A 3RM4A 3ZO9A 2XSAA 4U3AA 1B1YA 3ZSSA 4UQDA 2PF0A 3ZSTA 2VZOA 5E6ZA 3VNZA 3CZLA 1EH9A 5DT7A 1V3MA 4P8WA 1E40A 3WEOA 3FNDA 4PMDA 4QAWA 1AQMA 3QHNA 3QHOA 1E6SM 3CZNA 3T2PA 5I23A 2ZUSA 1HL9A 4AEFA 2XJ7A 3KEHA 1RPKA 2ZIDA 1EQCA 4D6JA 2VCAA 1E6NA 2WWCA 1GQIA 3AZSA 4HA4A 1CLXA 3FW6A 2WZEA 3BC9A 1QPKA 4U31A 1CWYA 3VSTA 4NRSA 4X0VA 2YIHA 1BYBA 5D9OA 1E6PA 3AMGA 2DSKA 3WH5A 3O2LA 2CCRA 3CH9A 3ZT6A 1GONA 1WAWA 4H8VA 3KLKA 1EQPA 5DFAA 1W9DM 4MB1A 3AYSA 2WLYA 4H8HA 3CMGA 4ZFMA 1LL7A 4W5UA 1NARA 1W2VA 1IT0A 4TX8A 5ABFA 1E1EA 2WVUA 4OJYA 1JZ5A 1GVIA 1AMYA 3GH4A 2VVSA 1MXGA 4ACZA 4WKHA 4W8BA 4JL1A 3AXHA 4CCCA 5ECUA 4HZ8A 2EPOA 4MB5A 2J7GA 3PHAA 1OGSA 1H11A 2QMJA 3SUVA 2WMFA 2EADA 4LXFA 2IUZA 2VR4A 3PTKA 1UHVA 4P7OA 3A4AA 3MSGA 1B0IA 1JAKA 4YHGA 5BRPA 5I6SA 1TQVA 1CXFA 3DX3A 1J11A 3WL1A 3LXAA 2JE8A 4H04A 4UFLA 2OWCA 4JAWA 3DDFA 1FH8A 4D1JA 1H5VA 2XFRA 3W6MA 3VSUA 3FHAA 4AWEA 3WDIA 1US2A 4YPJA 2BY3A 2A3BA 4XX6A 3U7BA 1I1XA 5BCAA 1V3JA 4DWSD 3MKKA 2DIEA 5A2BA 4JFSA 2ZICA 2OYKA 4CD8A 4CU7A 4QCFA 3T0BA 3WF0A 4BZYA 1MQQA 4JFVA 3WNPA 1FP8A 1PS3A 1M03A 3QR3A 4OKDA 1UR8A 3GYCA 1QX1A 2GK1A 2WANA 4M24A 3WDJA 2VZUA 2DQXA 3D5HA 4MNLA 4LGXA 3LXCA 1J0HA 1KGXA 3ZJ7A 3POHA 1BGGA 3GXTA 4DO5A 1C93A 4EKJA 2WVTA 1IZKA 1V3LA 2V5CA 1J01A 4UQBA 7TAAA 1VFOA 2WWDA 4P7RA 1PIFA 2DPEA 3QGVA 4ZE4A 5IFTA 1OSEA 4PEEA 3ECQA 4GXPA 5AYBA 1J18A 5M03A 2J77A 4CN1A 1C8QA 4E8DA 2NT0A 3AHYA 2F2HA 4UQAA 3AYRA 2EACA 2PC8A 3NYDA 3FAXA 3N04A 4C7GA 2QLYA 5HXMA 1V6WA 2VMFA 1JG9A 3TA9A 3PBGA 2OSWA 4M82A 1KQZA 2VJXA 1MW0A 3AIBA 3VGEA 3BUPA 3WY3A 2XPKA 1CYGA 2PWGA 1WCGA 2O9PA 2YDSA 2WPGA 1WP6A 2F1AA 4JCLA 1NWUA 3CPUA 3KZSA 1US3A 1MWOA 3IAPA 4AMCA 3H53A 4AMXA 1E3ZA 1BTCA 4CVUA 3ZMRA 1CGYA 1SFSA 4P8UA 1ISWA 1KGWA 3GBEA 1CZ1A 2F1BA 1OIMA 1VB9A 4NF7A 5FL1A 1B9ZA 3T0AA 4B16A 2VX6A 1HVXA 1W9UA 2W5FA 1BAGA 1HL8A 4CD6A 3MMDA 4FNQA 1LL4A 1TG7A 2GDUA 3UESA 3DYPA 2XVKA 3WKZA 2VQTA 3HZ3A 2ZWYA 2ZUVA 4YN5A 2D23A 3VINA 1CTNA 1RD6A 4PMOA 2ALWA 2CBUA 5CPSA 3WQ5A 4EAMA 3CUGA 3BAIA 3WFLA 2WKLA 2WNWA 1HP4A 3WDQA 2XVNA 3ARYA 3VGHA 1TFVA 2G41A 3L4XA 1JXKA 1HKIA 2YDQA 3CHEA 3MUZ1 3EJSA 4PSPA 3CHFA 4PMZA 1UWUA 4FLRA 3WFZA 1TCMA 3POCA 3NDYA 4AW7A 3BVXA 1GQKA 1B2YA 3IK2A 3VNYA 1GW1A 2ZXBA 1XYZA 1ODUA 1E15A 4AXNA 1ZB5A 1BG4A 3K8MA 4XV0A 5A1AA 1GHSA 3EYPA 2JF6A 5BWFA 1CNVA 4UQCA 1H4PA 3F5KA 2W4XA 5M17A 3BMVA 4PTVA 1LL6A 2OWWA 1CXIA 4DO6A 4EANA 1B3VA 4JHZA 1BPLB 3QOMA 3L2MA 3TV8A 1KTCA 1ZJBA 2GVYA 5C70A 1V3IA 2WK2A 5I0DA 1W91A 2ZUUA 2F7PA 3BAJA 4H2CA 1XHGA 5M3WA 1XH0A 1QW9A 1R47A 3EDJA 2A3CA 1Q6GA 4BQ5A 3NUKA 2BXYA 2DSVA 3FAWA 3RIKA 3S6TA 2XSBA 4PTMA 4Z2LA 2VO5A 2D2OA 3WUFA 1JZ7A 1WNOA 4NZCA 2PB1A 4OZOA 2EJ1A 1UD3A 1CXHA 1MFUA 1HF6A 1DWJM 2VX5A 1W1YA 2PBOA 4W7WA 3N15A 3LPPA 4BF7A 3L4TA 2BVTA 4W7VA 4CVWA 2WMIB 3DYOA 1K9FA 3WF1A 3EDDA 2QPUA 3WD3A 4DM1A 3EDFA 4UR9A 1EHAA 2JEQA 3MMWA 1GQJA 3CC1A 1PBGA 3WELA 3CGTA 3CIVA 3QOKA 4GZJA 4LYRA 4D6IA 2BFGA 3D50A 3AISA 1VBRA 3G6LA 4XZWA 4W84A 3M6DA 4PMNA 2WYSA 1R87A 3UG3A 4PUDA 1CGTA 5A95A 5A8NA 1E6XM 1BSIA 3SUSA 4KGJA 4X0NA 1EOKA 3SCVA 6TAAA 4PMXA 1UQYA 1TQWA 1C3FA 1UZ1A
chains in the Genus database with same CATH superfamily
1QRNA 2DJSA 3FCPA 4ORGB 1TJXA 5ERWA 2Y25A 3CN4A 1B5TA 3ARGC 4DNLA 5E09A 2H7WA 3AHZA 3A3WA 3G08B 4C8XA 2MPVA 4KK9D 4QOKA 1W1ZA 2NZLA 5DQPA 1FFTB 3OHIA 3A5FA 2Z1VA 1J87A 4PG2A 1HE8A 3PAUA 4YJZL 2Y1YA 2R8WA 1EEZB 1KJ2A 3MV9A 3CV6A 3HI6L 3URAA 3Q6GH 2QAFA 1VYSX 2I5YH 1GKEA 2B14A 2E4TA 2EDKA 3IU3B 2TRYA 4P5TB 3DMMD 3FO0H 3S8GB 5JXED 5C0QA 4BDVA 4MWAD 4WEBL 3MFGB 2J8GA 1RZFH 3PQYB 4JY9A 1EA9C 3C60B 3PWPB 3OKYA 4JFHE 3VB8A 4HPXA 4KBPA 3S2AA 1KPVB 5D6DC 4CLMA 3DAQA 4UINH 3VXOA 4TUOA 2E8YA 5CZSA 3AG4B 2IAMB 2PRLA 1S7WA 1Z5HA 3LOTA 1DIOA 5E5RB 1CIDA 1FCBA 3NYKA 1E6RA 4XH2A 1CECA 3K2KA 4MX7A 1TEGA 2F5BL 1D5MA 4G72B 3BP4A 1T89C 3WEXA 5D8ZA 5KSUB 3TYBA 1YYAA 2EC9U 2HVNA 3U2IA 4W9JC 4IICA 4TQTA 4JDZA 1E1FA 3AROA 2JH2A 4NENB 1LT7A 2HKAA 3S3DB 2CYGA 2W9DH 2Z4QB 3W56A 3EGXA 1DQUA 1ZALA 3VI2A 2GGHA 3THDA 4ERAA 2OFJA 3VWJC 4YNYB 4B0MM 3TDFA 1N6QL 1WFJA 3BEVA 5DVMA 4LEBA 5BRZE 5KVGH 1JPHA 2JFEX 1R3VA 3N3MA 3CZFB 5AW0B 3N6YA 1QLFA 4R53A 5DANA 3R11A 4YHMH 1M7IB 5DEZA 1ZV2A 1I0DA 2X6BA 2G75B 1MZZA 3B43A 1E5ZA 4IT1A 1KJVA 2C3HA 2KQMA 3GKFA 1G9NC 2OMUB 5IB2B 4GGBA 4FLSA 4J12A 3ZR5A 2ORBH 3C2OA 5C9JB 4BQ8A 1MFEL 5CZRA 1U8OA 1KBGL 2FCBA 2UV8G 1L7IL 2Q86A 4QROA 5FF6A 4OLYH 4Z17A 4YIQB 4Y1AE 2GSEA 1RZIB 4X8CA 3D0LA 3UCQA 2HVJB 4PJIB 4C47A 2YLHA 1R3QA 3BDBA 4YPGB 3W11C 1U8PA 5GNYA 1VJSA 3TJLA 3FYPA 2C13A 4UM8A 3SD2A 3HKZA 2CBMA 4QO1B 3OB0H 2V3EA 1WB0A 2YBVA 4MWFB 3MQTA 4GQ0A 3GEWB 1QSED 1EJRC 4UT6H 2DIAA 2PDFA 1AYOA 3DJRA 1S5TA 3M43A 3G6JF 3TC7A 2ZSVA 4F92B 2G5WA 3MHUA 4K2UL 1XYBA 1Y18B 3KS0J 4AEHH 5D2LE 5ENWA 3QFJB 1Q6LA 3DROB 3UY8A 4FQPA 1NC4B 1NJ9B 1QSFE 4MDPA 1CFNB 3FY1A 3EYOB 3GKWL 3P9LA 1T7ZA 4M4RB 4NM4H 4RLIA 3PZTA 1XL4A 3UZVB 1QNOA 5DMLA 4L1TA 3IV3A 1OPGH 2VSKB 1AS6A 5DMIH 2J1ZA 1BXVA 1MFBH 1CDUA 5D9SB 3KGUA 1GH7A 2XPGA 3BYYA 4Q8PA 3EOEA 4ZQOA 1KXTB 3FMGH 1N59B 2IKHA 4FC3E 1A5NC 4XVOA 3ARGB 3T71A 2VDOB 4BFRA 2FHFA 4FIRA 4P2RD 5CSGA 1OQOA 4G6ML 2OG9A 5INDA 3ALFA 2VABB 3WH8A 2P5EA 4AUYA 3RVVC 5KTEL 1I1FA 1XGPA 4KUZL 4KKBC 2CO7B 3UPRA 3D39D 1W9VA 2P7TA 3LCHA 3VH8G 4JYEA 4LL1A 3RVUC 3KBJA 4FEMA 5IMOA 4NDMA 1VF8A 4WO4D 5E2VL 1TPB1 3GZQA 4U0RC 4H6EA 3TV3L 2IWEA 2DVUA 5F3FA 4NAQA 7PCYA 2ALRA 2REQA 1YPXA 1E7UA 1SQ2N 4U0QB 3WLQA 3UROR 4CD5A 4QRNA 2OSYA 4B96A 4ELDA 3QAZB 1SDDA 1A6UH 5IVZA 3W2JA 1W3KA 2A3LA 3ALWA 3OZOA 2OXGA 3MV7B 4AH7A 3AUWB 2QCDB 2NW2A 1I85C 4G8IA 5IMLB 3OR7B 3EUUA 3LHZA 1YECL 1ZDQA 4PRAA 4HD5A 1SFDA 4DBDA 3D2UD 5HGAB 4LLWA 3OM3B 1NY1A 5E94A 2YBUA 3LH2L 3VD4A 4P2CG 4BFKA 5DYOA 3LZFL 4MHHI 1I9CB 4Z2JA 4AD5A 3A47A 1SXAA 2V2TB 1IQ8A 3RG1C 1O5QA 3UMTA 4PWHA 5CZ0A 4LEEA 4M7LT 5I1AA 3CFBA 2BVEA 2K6ZA 4FQXA 3CIQA 5CJOL 5D02A 1NAML 3UBXI 3U9UA 3NABH 4PV9B 3UJIL 3DVGA 5FLUA 1PFOA 1BD0A 3ABZA 4FQLH 4R96A 1XF3A 5ADPL 1ZRUA 4AV4A 1NMBL 2CMRH 5I30L 3IAQA 1TJRA 2R2CA 1C08B 4AOFA 1TMCB 1SMAA 4K6AA 4M43H 4JEJA 3SGEH 1UB3A 1KRBC 1CR9L 3OPZL 3V5DA 5CD3B 3RLGA 4NYUA 2Y06L 4AI7A 5MENB 3UAFA 4TNGA 3NIGF 4JQVA 2H0EA 1AI1L 1TEFA 3MI6A 3MP4A 3W53A 3KEDA 4QTGA 3D4ZA 3ZTJH 1MCSA 3MNDA 2HE8A 1D2KA 1W6TA 4LCYA 4H5SB 3BRDA 1TZGL 2X4RB 1YHTA 2RDWA 3CV7A 4Q6IA 5A3HA 2V9QA 3GSMA 3A6CH 3EOAA 2HEJA 4WUUA 1U95A 1MZHA 4FCAA 5KSBF 2CZDA 1IVLA 3MV8D 1W54A 3RWHB 2FH8A 2YD3A 2ODIA 5CEZD 1IGFH 1NTDA 4LVBA 4LLUB 1CDBA 2RDUA 4K68A 3TT3H 2BS8A 3IGKA 2AZUA 2NV2A 3SCSA 3FDGA 4CBZA 5DHMC 6XIAA 1PZ1A 3FZUD 1MJUH 3VIFA 4QTIL 3P0GB 4KCTA 1ICQA 1EGJL 4E2BA 3UMNA 1J1XH 1Y65A 3H7UA 1P1XA 1HQ4A 2ODHA 1ZJAA 5FO9A 4H3DA 4URIA 3GT6A 1IC5L 3PDOB 2CA4A 5BXRA 1FWTA 3V0VB 3D33A 5IVXE 1XGUA 3RU8H 2QJHA 2FGZA 4U4MA 5D2NA 2XT1B 1RZ8B 1YNLL 4PGCA 2Z92A 1EANA 2WD0A 2VLME 1RCOB 1KENL 3F8UB 5CGTA 1BWVA 2CRYA 4R7WA 1LWJA 3B0PA 3EJQA 1MQ8A 4Z78B 5KVFH 1N8IA 4I0PC 3EGJA 1EEPA 4ECNA 1W3HA 1OX4B 1G4EA 1A50A 5DVLA 4Q14A 3QDJA 1D3CA 4NX5A 3L9EA 4YFLI 4LRIA 1W56A 4ALAH 3SUWA 4EPEC 1T5KA 5DEFA 3FU9A 4MJHA 4H7CA 3KHDA 1EBAA 5E8DL 2NPLX 3X3FL 4JTJA 3TQ0A 5CH9A 1DCLA 5JMOC 1B0RB 4CL7A 1FO0H 4TSAH 2WBWB 1G7MA 3ZU8A 1ZHBA 1T4KA 1V02E 1EFXD 2PTZA 4LASL 2YLAA 1XKJA 1WT5C 5K9JH 2D31B 4ISVA 2TAAA 2OR9H 2QUUA 1OGAB 4F2MB 2WBKA 1TIUA 4D8AA 4RIRB 3KWVA 1WZAA 2Z91B 4UTWA 1IGML 2MCPL 1EJ8A 4HX1A 3GPSA 3TFBA 4M3PA 1XC4A 4P4KD 4EACA 1A21A 2UZYB 1PX4A 1TZIA 5E2JA 3GXPA 1GC1H 1FQ9C 1OT1A 3HCVB 1G7UA 4P46B 1TCRB 4JM4L 2DV6A 2RBLA 3S2CA 1XGRB 4GFTB 2B0SL 3R5EA 1TTAA 4Q33A 4JY6A 4KZCA 3HMXL 4KX7A 3EYSL 3BP6A 3FUJA 5HR7A 1YN7B 1KB5A 1OP9A 4D9QE 1KCVL 3AC0A 2DZXA 5FAGA 4Q9BA 3RK8A 2FBJH 1IAKB 3SCQA 3RP1A 1XM3A 3AFLA 4YXKH 2DSZA 3WIHH 3CHCA 2D22A 1HHKB 3UZEC 1KJ2L 2MCMA 7FABH 4AX7A 5EMUA 3M46A 1NAKL 3TYFA 3NR0A 3HC4H 4M56A 2I7SA 4JVUA 3MUHL 3WQ4A 1M3JA 4MNQA 3SIMA 1SF3A 1RUAL 2ZTBA 4YL2A 5A6AA 2XX0A 4IM4A 5JU6A 2H6PA 5BVJA 1KPRB 3S1XA 4AVNA 3VXRB 4L8BB 4WHCA 1AR1C 2CBQA 4KKRA 4DP5X 4YSTA 1E6OL 3SKOA 3NJVA 3U6RA 1GZJA 3GHUA 1S9YA 1JRCA 3CIXA 4B5XA 1S5MA 5IBLD 4Q97A 4GISA 4JJOA 2AQQA 3ENLA 3GFYA 3GNML 3LZOA 3GSQA 4V1DB 3SYAA 3OPUA 4XCNB 1E72M 4N8VA 2ZE3A 4PVBA 2FEDD 5KBPA 1IEQA 3OKOB 4PJFA 4ANVA 5EF1A 1PJ9A 1ZLPA 3OHXC 1J5SA 1LO0H 3DI2B 1F4YL 1R24A 1WDDA 2ZNWA 2X6MA 3LRKA 1HGWA 3ZTDC 5AYUL 3RB5A 4MQTB 5CEWA 3VGDA 4K8GA 4BS0A 1E9ZB 4M19A 3RKDC 2DQTH 4MA8L 4K7VA 1E9IA 4GD0A 2P24B 2ZOUA 3I6GB 2XETA 5JOFA 4H7VA 2R8SH 3QJZA 1CLZL 2UWEF 2IBBA 5ICXB 2M83A 3L12A 4J6RL 4DSYA 2RFXB 5BZDB 5KS9E 5C0IA 3ETBF 2IPUG 1Q65A 1KEMH 2BP8A 5DRIA 2FGWL 3MI2A 3KW3A 2OMWB 3BFQG 3IWUA 4U3SB 1TCDA 4Q7NA 3CBJB 1EK3A 5JW4Q 3BVTA 1KY6A 2CKNA 4AENA 5HDBF 1NPUA 3S3GA 1GOMA 4GRLA 4XPBH 3LH8A 3MRMB 2RJGA 2FX9L 4XVUC 4NLAA 2GK2A 2BOLA 3RNDA 1AL7A 1GSMA 4FTDA 4FL4C 1E4WH 1IGWA 2V6HA 3V9EA 5HDQL 1M6OA 5LN8A 3QUZA 3A4JA 2OMAA 1XLCA 4OZGB 3QV6A 4H25A 5D70L 1JULA 4JQ4A 3EYQC 2GQHA 4J3OD 2KPNA 1KGYE 1R5VA 5BS0A 1OIFA 1H3TA 3RTQA 2OSLA 3SZ8A 4GKSB 2WWMD 3AY4C 1N12A 2N56A 1PDKA 4LALA 2DMKA 3PNRB 3ZVHA 2ZXDA 4YX2H 3UZZA 3PAZA 4E5TA 4G7EA 3G8RA 3I9GL 4ZS6D 3PZVA 4ZMNA 4PTUA 4NYLB 2H8ZA 3HG4A 2XGBA 3KP0A 4B2DA 4YTQA 4XMKL 4WEEA 4GW5B 4M9PA 4WV1C 3IPWA 3BP7A 3VFVB 4O9HL 3V0IA 3CAKA 3WLWD 1MFMA 5E93A 1DQJA 3CVHB 4WIQA 1KBIA 4LDEB 3CM4A 1FWDC 4PGBB 2BVYA 1P0KA 2IXVA 2HBVA 1RZGB 1F73A 5GGQH 4UTAA 4K5OA 2F68X 2JXMA 3S42A 1G6RB 2PF0A 2CUIA 3CZLA 1IFHL 1V3MA 4Z3JA 1AQMA 2QUVA 4UI2A 4N9OB 5F9DC 2IDQA 2F84A 4OE7A 4XVTL 1WFNA 1O7SA 3HHSA 4E0RA 1GQIA 3FU8A 2CNYA 3ESMA 4NRSA 1OK6A 5L4IA 1ZA3A 5EA0L 3CDFA 1IEIA 3MRCA 3NQEA 3D4CA 4H8VA 4XIAA 4YGAB 2IIJA 3CMGA 3ZQXA 3WFCH 5JQHC 4LDLB 3W7EA 1XBVA 5EO1B 5JMUA 3EX3A 3Q5YA 2R82A 2OQHA 5EMLA 2IV8A 2EADA 3HC3H 1SVBA 4YVNA 2EE0A 5IVNA 4FZ8H 4XNYL 1QUNA 4BKSC 2EYRB 2OKOA 4UQ3B 2OLDA 3C5ZA 1I3GH 3DDFA 4W9GC 3LEYH 5K9QG 3LHYA 2NY4C 3E0IA 3MKKA 4B4FA 3MSPA 3TBWB 1W37A 2LGNA 3GSNB 3G5XA 1PS3A 1OEZW 4MZ1A 5JPMB 4JY4B 2VZUA 1K6QL 1J0HA 4Y5VB 3DJ9A 5AD0B 5EKYA 3ZKSD 5C0DA 1BX2A 1WBZB 3B8VA 1RZPA 4NQEA 4MRCA 1PE1A 1FXPA 3PUUA 4M5YH 2PDCA 2DPEA 4YNGA 5CSZA 5C3TA 3EJYD 3W00A 1HSBA 1AQDA 3PTDA 3X11A 2ZJSL 3WTXA 3PBGA 2NTFA 4JTEA 4PJBE 3O0KA 2IMMA 3WLMA 3C12A 2F1AA 1NWUA 3H2NA 4ODSH 4FGMA 3Q45A 5BOJA 5C09D 4TSCH 1EJTC 1YNTB 3GBEA 1EZLA 5HHOD 2VDRH 1MELA 5AHMA 3FCUB 2RAMA 4O53A 1U1JA 5HNUA 3O05A 3MZTA 1DZBA 3HGOA 3GDRA 3CDYA 1L6PA 3ABMB 2VQ1B 3HE7A 2ZCGA 2XVKA 3QI9B 4K5PA 4EOWL 2VR8A 2E75C 2C3ZA 4L8DA 4KRNA 4YDZA 3U1PA 1K3UA 4KXAA 1QOQA 4GX8A 3DV4A 4BHUA 2PDHA 1B4LA 3GTVA 1TV7A 5CJQH 2IC2A 1AOHA 2JKTM 1P7QA 1FAIH 1XIFA 3CHEA 3EJSA 1I31A 4FLRA 3U9PH 4QLWA 1YEJH 3BVXA 4Y2DB 1B2YA 4WX2A 1T6WA 2MOGA 1YEDA 5A1AA 4XV0A 4C6NA 5F0MB 3F58L 4PRIE 2JF6A 2W4XA 1Z9MA 4NN5C 1LL6A 3BGGA 5I3JA 4B9CA 1N4XH 3P4LA 4HIXL 3TA3C 1FWJC 2VEKA 4HGWA 1M1BA 5L0QB 3TH3T 4A8LA 4QG8A 5SWZB 4POYA 3BI9X 4FXKA 3QC0A 1V7ML 4L65A 1SHXA 2VX5A 2YC1A 3LXUX 3LPPA 3N9GH 2Y07L 4R9XA 4LY8A 3A9IA 2OQYA 2PTTA 2P8LB 3P4NB 2F9BT 3IKCA 1UJPA 5U4NA 5T3XH 2X4TA 1S8DA 1JPGA 1Q1JL 3ZY7A 4W84A 1MWAA 1ED3B 3FN0H 2AC0A 3SUSA 4KGJA 3AZUA 2GJNA 2QCFA 4I9WD 3W07A 4L1DA 1ME8A 3H9SD 2WNQA 3TBTB 4PJHB 4LKCA 1AGDA 1E9QB 2BOCB 5BJTA 4KVNL 4Q0XL 3QIBB 1EDTA 3GDCA 1E5NA 3MRLB 4EAYA 3IAGC 1INDH 3B7UX 3GIZL 4PWEA 2WXNA 1ZSHA 4CADA 4U1MA 4PUWA 3ZMNA 5D7JD 4PV8B 1F6KA 2J3SA 4P99A 3PFUA 4B9PA 3KRZA 4R3SA 5T1LB 2VIRB 4XTRC 1BF2A 3FK3A 3APGA 5TPWL 2WZPD 2E56A 2FQIA 4K7FB 3L5MA 3D3AA 2FMNA 4AMAA 5LIUX 3HG1E 5C9WA 2BDQA 1JGUL 3BKML 3PL6C 4X98A 3D46A 4AGPA 2VEIA 3FB8B 4WWID 1TQBC 2BVDA 3IMRA 5B7EA 2XPYA 1WIOA 4R9HA 1W0WA 5BMFH 1G7HA 4PJGE 5AALA 3HMJG 5AVVB 3KW8A 1NOAA 3BUYA 4IUOA 1BF5A 3L5LA 4PY7A 1H2JA 3HNTL 1ILUA 1JNLH 5CQ1A 1ADQH 4OECA 3L4CA 2XWXA 2NSXA 1E4HA 2E1DA 4CEUC 1UWYA 4BIKA 4L48A 3UDWA 4M3HA 3RDJA 2WOQA 5FF3A 2R9HC 1QAWA 1JWUB 3EKCA 2XWBB 3RJYA 4Q4IA 2GY7B 5E7BA 2A7PA 3PWLA 1CDIA 4Q8WA 5I17B 2OXNA 4QYOA 2LHAA 1FLRL 4JPQA 5ADOH 4I1RA 4PSRA 4UTKA 5DXXA 5JHDD 2X8RA 1BBDL 3UJ2A 2DICA 4L4TB 4HEPA 4AWSA 1X6NA 4OFYD 3NPVA 4QE4A 3LKOA 3RGVA 3UR5A 1AFSA 2CJSA 1ECQA 4DP2X 1CYXA 2KLTA 4PUKA 1RJYA 3TONA 5F9JA 4H6QA 1OW0C 4F0KA 1N2RB 3V0WL 1W1B1 4S1RL 4JRXD 2X9YA 1UIOA 1PKOA 2NOYA 4Y2LA 2HFGH 3BIAX 4Q6XA 2GUOB 2C6QA 2POTA 5DD5H 4WDXA 1MDAA 4OLWL 4PRDA 5D4QA 1F5ZA 1CT8A 3FPXA 3STLA 1UZDA 3BZGA 4N8CL 1MCKA 4FERA 4PMQA 1S2WA 4IKLA 2YKKA 3W2UA 5D7IE 4HK5A 2YD0A 4P2QB 7CGTA 3U7AA 1GJWA 3VGAC 4UMAA 3NIFE 2BNRB 1WDSA 4RAUB 1AE6H 4CGTA 1TQSA 4DNMA 4ZW3A 3AB0C 2C5DC 3IJHB 3THAA 3WJYA 5LBGA 3SDCC 5C7ZA 1L9QA 4LSPH 4K3DL 2LLGA 4O51B 2GHWB 3FHQA 1WA3A 2EDYA 4Z2GA 4OD2B 4TTUA 2FRGP 2LTQC 1KCXA 3NACH 3D8MA 4MJ2A 1IE4A 3QEGL 3ZE2E 1P9MA 4V1XA 2DQUH 4Y9BA 1ZLVK 1NOLA 3UJSA 1K4DB 1EERB 5T5FL 4R7VA 5EPMB 4APQC 3RWJA 3SPCA 2A83A 5FM4A 5FCZA 2EPLX 4Z7UB 3L5WA 5T1MB 3GZ3A 1SFTA 3OVGA 1DE4B 4NXKA 5AY7A 1UYWL 4DQWA 4YVVA 3S83A 4KC3B 3THUA 2F58L 4PP2A 5IHUH 1MVUB 3JZYA 1QVBA 2WUBH 3IDYC 5AW6B 1QR4A 1A6AA 3MZNA 3V6FB 3G22A 2QADD 1MAML 3BUBA 3V4VA 2DMCA 6PCYA 2PDLA 4S39A 2DQHH 2KI6A 4F9LA 2MQGA 1BYDA 1M71A 1INEH 2W07A 3UZJA 2BSRB 4ONGL 5DN1A 4LEXH 3TZVD 3O8XD 1MJ8H 3CFEB 1JF1B 4BELD 4LSTH 4BR1A 4XR8C 2J7HA 2FB4L 4WHYG 2NY5H 2YEVB 4RCXA 3SODB 3B9EA 1U4FA 3FO1A 3OZKA 5FKPA 4F8LA 3BW2A 1T5XB 2JLPA 1PZSA 3TEXA 2EYSA 4JJ5B 4ZA0A 2H6RA 1DVFC 1WKYA 1DQQB 3PL6B 1ZAGA 5CZVL 2AQSA 3IMSA 4FG0A 4LKXB 4CNIA 2F7QA 4NO0A 2PYEB 1GYUA 3OG4B 2G3JA 1KUMA 3PHQA 1FL3B 1YY9D 2XUWA 1BIIB 3E6EA 2AV7A 2IFFL 3GSOA 3RJQB 3UC2A 1A80A 3EO1B 2DYPD 3K6SA 4J7RA 2IGTA 1S5WA 3C2FA 3GRWL 3HE6C 4G8GD 4GQQA 1IAOB 4QHNA 3L1GA 4E5XG 4IIBA 3CT2A 4R6UA 3MRJB 1R3KB 3Q67A 1H6EA 1ZT7A 4MNGB 3FSVA 4DVBA 4GAYB 1VFFA 3HN8A 4OZ4B 5J11C 3O4LA 2O26U 1T1WB 4XQ6A 2B39A 5GRJH 4AIXA 2GCYB 3GXMA 1HJUA 2Y8UA 4X80L 5BOZG 4YCPA 4ZXBA 3O9WD 1IIIA 2BRRL 1P5UA 2V17L 4L0ZA 5ESVB 3UP6A 4PJ7E 2DT1A 2WOYA 3TLRA 5DD6A 2VW6A 3VTAA 4YL4A 4UTAL 5IFJB 1NWRA 1PCKA 2QQLH 2EDOA 2A9NH 4US5A 2P5WD 1XBRA 2JTDA 2W91A 1Q9WA 4M5TA 1UZ8A 3QR2A 2UV3A 3UYRH 1FNSL 1XGYH 3B97A 3STCA 3BZ4B 3T2LA 1V6XA 1U3HC 2PTUA 1FH7A 1YDNA 4JZOB 3GIVB 4D94A 3MYPA 3B8DA 3MLUL 4I4WA 4E68A 2A0NA 4JTTA 4QRRA 3FA5A 1H3PL 4C6DA 4RRPA 1KXQA 4PP1D 3WS6A 5B39B 4JFQB 1Q6QA 3R06B 2VT0A 2VN6A 5L88H 4PRPA 1B3WA 1IBGH 4N3TA 4JGMA 5L2JA 4H88H 3CAFA 1TKWB 5DRXB 4MA3B 4RE3A 2BLFA 3UADA 4TTGA 1JMZA 1JZ4A 2D24A 2ZUMA 3AZRA 4TYUA 4A2HA 5F1SA 3GI8H 1DJGA 3RHWK 1EEQA 1PIIA 3PQYE 1AS8A 1U3NA 4GZ7A 3KOFA 3OODA 2HN7B 1ITXA 4OCRH 3KWXA 3HNSH 3AB0B 2QKIA 3SDCB 3FRUA 3MFFA 4YHIA 1QNIA 3JWNC 1VH7A 4FXGB 4GZIA 1YZZA 1N7MH 5KS9F 2F53B 3Q43A 2GI7A 2EDWA 4G7YH 1PKQA 3BX7C 4CNTA 2P8PA 1ZVHA 5IW1A 3CV2A 3EOBB 2V3FA 3PPEA 3H4GA 3RQ3A 1MCPH 4CW1B 5CUSL 2DJUA 3P69A 1F6FB 3N41B 1GOWA 3RUGB 1BJ1J 4JRYD 3UTZB 3FYIB 1SFLA 3X3GH 4PR4A 4Y4KD 4OLEA 4H26B 1T20B 3M17B 1SJAA 3BWSA 3HPAA 4PCYA 5EDXA 1UQSB 2HJPA 3EAKA 2YN3A 3KRSA 2IPTH 5F3HA 3FB6B 3MRRB 3UBXB 1UVQB 4MTMA 2A74A 3C2AH 2QHRL 3N50A 1S7QB 2NXZB 3C4UA 4C65A 4UDTA 2J88L 5C1MB 4JKPL 4MAYA 4HLZG 2JI1A 4NJGA 2YEZA 3TLQA 5A6LA 2Q0ZX 3I65A 3NA8A 1Q2SA 3A6BH 4JN1H 4PRHB 3ZKXB 1KCKA 3CFDB 2ASHA 1G0XA 5JW4M 2CCWA 4C1NA 1WV2A 4UOZA 1DBMH 1HKKA 5LNEA 1X9UA 3NURA 4H20H 4PJIE 2GC4C 2C91A 3ECBA 5AC4A 3TBVA 5TQLA 4AEOA 3FSAA 5DGQA 4LZKA 4Y7MA 3O3AB 3TPKA 9PCYA 4TLSA 3M0IA 3D05A 2O93L 1T1ZA 4XHJC 1F5WA 2A6IA 2CXKA 4X4ZA 5D7SH 1RIUH 4LAOA 5J11B 2O7QA 4JD4A 3A12A 4POZD 4PCKA 1ZLDA 1D9KA 1E6JL 4CU8A 1O66A 1NL0L 2BGSA 1GKQA 1BEYH 1V6YA 1W72H 2OW6A 1PZ2A 3LV3B 3KL3A 3QAQA 2YXFA 3RVXD 3W25A 5ABTA 4DJDD 3CZGA 1MWAL 4RBPH 2CEQA 3SRHA 3WY4A 3DGBA 1VFMA 4L4MA 2Z8SA 1GS6X 1NUGA 4JO4H 2MSPA 2H2SD 3N6HA 1Z3GH 2YAEA 4Z0JA 4ROQA 1VAHA 2EIDA 2K8MA 1QG3A 3VKCA 3ELFA 5DHVA 1U3HB 2GSHA 1FNLA 2EKJA 2CRMA 5DS1A 4RWHA 1XGEA 3A21A 2NY6D 5JORA 4V2XA 2CHRA 4C4KT 4JX0A 5KZ6A 3GLAA 1D7DA 4YXGA 4FNSA 1A9EA 1KTBA 2A85A 1E6ZA 2GSIA 5HJXA 3MUUA 1UWTA 1JUEA 2FH6A 4GRMB 4I5BB 2WB1A 4I89A 4MXQC 3FT3A 1IGIL 5BRZD 4MKNA 3ULUH 5D5MA 1HTIA 1AC0A 3BAXA 5FKAA 1HINL 2XY2A 4K73A 1UWAA 3I75A 4B5UA 5I2UA 3WK1A 2DORA 4BSWB 1DBJH 2IPUK 4AHOA 2ED6A 1E8ZA 2DJMA 1ASQA 4YDLB 2MTPA 3HUJA 5CBBA 3T08A 4ZUTB 5C07A 4UU9B 4JHVA 3JVFC 3GMMA 1TSIA 4YDJA 1ITBB 5HK4A 1SN2A 1EHNA 1EXGA 1V51A 5E2WH 4OIIH 1P7TA 4HFWA 5BROA 1XZWA 1YN6A 2H6UA 2CGRL 5DI8A 3WIJA 1XD1A 1F3DJ 1VACA 3WO4C 1NMAH 4QNPE 5BQ7B 5FESA 1M9WA 4XMTA 4O28A 4ZDHA 3T2NL 4PCFA 1KYUA 5ECJE 4N2YA 3HGSA 1GGUA 2X89D 4U1JB 3PAYA 4O02H 3KR3L 1DJXA 4E9RA 4FEIA 5AAWA 3G6AB 4P2OB 5A69A 3F1QA 2R7EA 1MFVA 3UY7A 3LQGA 3DX6A 4R8WH 1HHJA 1CCWB 3RRAA 1EC8A 4FYRA 5EV7A 1XR9B 5L4FA 1CD1B 2L4OA 2Z35B 2GJ6B 2IH3A 3RFRA 5I8KH 2PR4L 4HK0B 5GZND 3OQ8A 5D1QB 2J21A 1IV8A 2F7OA 3NSYA 4U5KA 3W2KA 4M81A 4OGZA 1QPQA 1SF5A 3B8WA 1V0LA 4MMYB 3QMTA 2J8FA 2NY0D 3EYUL 2YRPA 2WB5A 1FDLH 1AVAA 2WZ6A 3NESA 2VERN 1HAUA 2MEJB 1ZLWK 2ARJA 2CPCA 3QUMA 4L9DA 1R1CA 3K2UH 3WXVL 4FLOA 1H62A 3TC9A 1GMEA 4WXYA 1HCYA 2CR3A 3NSNA 3CQFA 5LVEA 3FC8A 4IU2A 4YGVB 2BIQA 4XNQB 3UTTA 3M5XA 3S98A 2XG4B 4ONHA 2WNNA 1ZGLB 1HESA 2X1XR 4Y19B 4ATDA 5D6CA 1T03H 2ZUWA 4KKAC 2MRYA 2ZYFA 1PBYA 5E4EC 4NNCA 3IVSA 4A2SA 3UTSB 3KPSB 5KW9L 4HPGA 4QSFA 4CDGC 5EWIH 3QJVB 4Z0BH 4C4UA 2W9LA 3REQB 3GBNH 4JDBA 3C09C 3N11A 3R89A 2PP3A 5AUMB 4M1CD 4ODVL 3UC0L 1YMME 1SPDA 1S78D 3HBLA 1Q3NA 5HYQA 2OO6A 4AVHA 5AOIA 3VNLA 1NBZA 3E5PA 1MQRA 1FL6B 1SLVA 2NMSA 2J75A 5REQA 4PC8A 1DQWA 1T1YB 3BAEH 1T40A 1J1PH 3IPFA 2IPKA 1NFPA 4HPOH 1UCWA 2WZ0A 3IE9A 2Z1XA 5ID1A 5ETUA 1E8WA 2VDLB 3K74B 1NBQA 3PJSB 3HRZA 5EFDA 4I77H 2RHEA 2EG7A 4AQAB 3V4VL 1B0GB 3OG6B 2JCCA 1P84J 1EBGA 2G50A 2WCAA 3USZA 1U83A 3DMMA 2XSAA 1BMZA 5JXEA 3QORB 1EH9A 4MWAA 2YCLB 4QAWA 1SYSB 4PJGF 3LI0A 5I23A 3R7MA 1EIXA 2CRIA 2W59A 3L9RB 5F96L 2WWCA 1YJDL 4X0VA 1BYBA 2DSKA 3W9DB 3KLAB 1E0OB 4LGRB 3ISRA 5EZOH 3P11L 4DP4X 1CFVL 3GUTB 2QSTA 3N6JA 3S5LB 1YEYA 2X2GA 2J8UB 5ICZA 2RH0A 4KTDH 3U2ZA 1AMYA 2H32H 5LBSH 1AGEB 4LUSA 3DOSB 3MKVA 4HZMA 3T55A 2VISB 4Z7QF 1NCDL 2ACQA 3CK0L 3D69A 1N5AA 4C6EA 1BQHB 4H6KA 2XTJE 1J11A 5A2KH 3R1ZA 1IJNA 2VDPB 3VFRA 4FE9A 2DZEA 3NFNB 2QZQA 3IGXA 5I1HH 1A9BA 3UJJH 2XN9A 4MJIB 2PCFB 4I8YA 4WCJA 2GEQA 4J2MA 4DWSD 4M7LL 3ABLB 4YFEA 3WO4B 2ZICA 1YEGH 1OFAA 2LV4A 1UR8A 5JW5B 3WDJA 5FJTA 2EDMA 4LGXA 1LEIA 3IJIA 1UW9A 2X4NB 3S35H 1EB3A 2Y5SA 4JMNA 3LN5B 2VOMA 4M0XA 5DHYA 1V77A 5J6SA 2WWDA 3LNEA 4KJQC 1KIPB 1EO8L 1IKNC 1OSEA 1XMEB 4RZBA 3KCPA 5F1NA 2HROA 5FGCE 3MLWL 4N3UA 5D7IF 1MHEB 2Q01A 3UX9B 3WY3A 4K9EL 4JX4A 1X7QB 5EUKB 4FXFA 5C2XA 3NIFF 4C6MA 2ZZ1A 3IAPA 2DQGH 2TODA 3SI9A 5GGUB 4P8UA 4P5RA 2Q7NA 5EO0B 3FEMA 2GWGA 5EMJA 4YWIA 1U0QA 2OMXA 4ENED 4NF7A 5KYWA 2AERT 2LT9A 2ZXEB 4IFKB 5JXAH 4LQFH 1ETZA 3N44F 4CC4A 4PBWD 1IKOP 3E6HB 1QSEA 2NY2C 5HY9B 5IIEB 1QNZH 1R0AL 3QIWC 4GRWF 2V7NA 2QSCL 4GS7C 3C9NA 4OFVA 3T3ME 5HJ3B 4DZ8A 1BW8A 1HKIA 4F57L 2Y1AA 1U8KA 5EOTB 5KG9A 2H4EA 4FQHA 1GPOL 1CGSH 1G4PA 1URIA 1ZB5A 3HPXA 1MFCH 1MAJA 3IDIB 4Z23A 1ZMYA 1IR2A 3E80A 4UQCA 3QFEA 2V0AA 2JGQA 4ALAC 5C6TH 4V1DE 4IPPA 5FFGA 3NQAA 3TZNA 1I1AD 1ZGDA 2DWTA 1S9WB 5HWMA 1JXDA 5C92A 3NZHL 4S1SH 4GXVL 2YCIX 3GYEA 3EG9B 2A3CA 3GS4A 1XWVA 4APXB 3VFPB 4MVAA 5FYKL 2P47B 1ZSXA 4JZNB 2CLFA 3MJ9A 1DUYB 2VUKA 3DRQA 3QQ0A 1AACA 3E3HA 4EF8A 4NKDB 4P2RA 2C3VA 4IOSA 1E1CA 1LOLA 3SDYH 4G6JH 1J1OL 3BLDA 4EIZC 2H2PC 4QRSA 2SFPA 3UZWA 4PGEB 1A5UA 2Z1BA 3CIVA 3QOKA 1TPXC 3GB7B 3D39A 3VWJB 2JJSA 3HPLB 2VDIA 2YEQA 1R87A 3WHXA 2UY7B 1A5OC 2YR1A 4P3DA 4IGBC 4QQ3A 3DX7B 4WI7A 4YO0A 1GC1C 3DEQA 4PZVA 2CKBL 4GY4A 4WO4A 3AUJA 5IESH 4C90A 5C0GA 4K3JL 2FIKA 2FTYA 4JQIA 3Q37A 1Q9LB 1FWFC 1AHWC 3RRQA 1F3JA 5BMWA 2QBWA 2XU2A 1RSCA 3LIUA 1NCHA 3TGXA 1DBAH 5DZAA 5HPCA 3MOAL 3RPDA 4J1UA 3FXIC 1SJXA 2R2HB 4N4QA 1OK8A 3CPGA 3GG7A 3VFWB 3S3PA 1HIML 1M4KA 4G42A 1KXVC 5DJCB 1CE6A 4D9QD 2XVPA 1U93A 3V7AG 4DKDC 4D6GA 5B21A 4KVCH 4GH7B 4S38A 3ARQA 5TFSH 3S2JA 4ROPA 4ZXLA 3G5YA 3D2UA 4PJ7F 5DZ9A 3WH6A 2FMOA 4QX4A 2G3MA 3QZBA 1XIMA 1XLDA 3VC5A 1ME7A 4ZOCA 4YE4H 2V5LA 4KJYB 4OZGE 2WAGA 4K15A 4F2TA 3WDHA 1HNFA 4BQ2A 3O06A 2GFBB 3VA6A 3BVJA 1Y6MR 1IBZA 3ZYZA 1HK6A 2QCGA 1IGYA 4N2LA 5I6OA 5IOPA 4TNWF 4L0YA 4DZ5A 3B2MA 2B2XH 2HLAA 4X8JA 1EWEA 3T0EC 3VD7A 3BH9B 4M8UA 1ZA6B 4KFMA 2WXQA 4JE4B 3CYVA 2C14A 2PXYD 5D8WA 1FCUA 2OZTA 1JF5A 5AC5A 4NZTH 4XPHH 2EE6A 2Y1HA 4XODA 2Y88A 4HHAA 1JCYA 3EYVA 3OKMA 1TMQA 2QGBA 3ARFD 5FJOA 4MA7L 4XMPH 4WKAA 4PJXA 2OCZA 5A2LH 1EBPA 3BSMA 1ISYA 5C08D 1UFUA 3RO6A 5K33A 1IT9L 4PLKC 2VMEA 4CEXC 2WQ8A 2F1EA 1WAPA 2PA6A 2X1OA 3CXOA 4XP6H 3URQA 1SY6H 1IBBA 2ZAHA 1VCBC 4AIEA 3WN5A 1MW3A 5LHEA 4MMWA 3MV8A 3OZLA 4A05A 4G9FB 4GS7B 5I5MA 1PY4A 1SYVA 1CDCA 2DI9A 2X0YA 4FJYA 5ELIA 4U0RB 4NGHH 4J39A 4JO8A 4W88A 5AG8A 3BH8B 1N26A 2OYPA 3MGTB 4JDTH 3GS0A 3FPYA 3S9YA 2X6CA 1XLKA 5H94B 4MNHB 2XYBA 4DN3L 3QA3A 4G1EA 1KELL 4LHUG 4JTCA 1S7TB 3X13B 5AOUA 1SLUA 4OCXL 5AZ2H 1QVOA 4KDTA 4PJEE 1FBAA 5K9KB 1XLLA 3RA7L 3VO0A 3AQDA 3I6KA 1MDLA 5DDHA 3LU2A 5TDNA 3EJPA 3TP4A 4BFAA 1A3XA 1A5FL 4PAZA 4NAFA 4EDXB 2JIXD 1XCTA 4MYPA 2VC2L 2PAJA 1TPXB 1OWRM 2Y1ZA 4U1IB 1GZPB 1QABA 1SDYA 1FWNA 4IUGA 2X7VA 1V6VA 4GQPH 2GJJA 3WIAA 3O6MH 1KLGB 1K8DB 4DBWA 4NCC1 4ZS7L 2ESCA 1SJBA 3GVGA 3PJXA 1UKTA 3QQ3B 1YPZA 3IJ7A 4XWOD 1ZIBA 1UROA 1AHWB 3W27A 3QUML 3WHE1 3GSXA 4OIFA 3OAZK 5TE7H 4JXCA 2ADIB 1JI1A 1EFXA 3WJLC 4MD0A 2Z2AA 3TCLA 3QUHA 1VFAB 1T99A 3TCXA 3ZL4H 4LV9A 3JWOL 4GQGA 3VXNA 4HOMA 5GHWH 4EDWL 3UTQB 4H1LA 3VOFA 5LA2A 3MJ7A 3GNOA 3QR0A 2AJSH 3QNYA 1ONEA 2AJVH 3ZYIA 1C7SA 3RVWD 3N18A 2PCXA 4Z7VA 1K03A 4P4KA 3W0WD 1UD2A 1BA9A 5DUBA 1N8ZB 1VRSA 4QHMB 3NZ8B 4JR9L 4PB0H 5F9WC 4HD9A 2D03H 1T7LA 1G1YA 3EOLA 4E9QA 1VLIA 4AGOA 1S1PA 4S3BA 2WTRB 3IT8D 1THCA 3LENA 1OD7A 4Q8NA 4Z2KA 4DUVA 3DVNA 1RA0A 3IDXH 3HS0A 1WFIA 1EPXA 3ARPA 3ARTA 3SGUA 5CBIA 1P0DA 2FJHA 5SWZE 2G9HA 2XSXA 1I4NA 9CGTA 1T0OA 4N0UE 4ZAKC 3SE3C 3VOCA 4TOYH 4OLXH 3HPJB 1O7DC 1NGPH 5HHXH 1HL4A 3W7IA 3N43F 4OFCA 4EWND 2I17A 5DJZB 1NGYA 3SE6A 5DBTA 4AUUA 5HYFA 1RCQA 2AEOA 1HWGB 2CDGA 5F0PB 4NRXB 5CS7A 1RIHL 2VD8A 4QIUA 1KGJA 2UY4A 1IIHA 1M42A 5HWJA 3FT2A 4Z9KB 4LF2A 3LH9A 4MF4A 1KACB 5CLXA 1JTOA 2QJNA 1JPFB 3D18B 4I0PB 5IM7A 3E1F1 5JO5B 5E08H 2Z2BA 5B38B 3NM1A 3LG3A 3FA3A 1BLIA 1SQ7A 4QNPF 5C0FA 1US0A 2R4SH 1EZVY 1YO4A 4AQZA 2PDJA 3NJIA 4YDIH 2EZ0C 4LOUC 2V37A 3PIQA 4PREB 1T2QL 3SD5A 4HC1A 3HJZA 2V30A 3BZFA 2D3NA 5DTFB 5AVXB 3GVRA 1SW3A 4ETQA 5E23A 1ZPLA 4HQQH 5F9OL 1OGPA 1HWWA 1JNJA 4HPNA 4BYHA 4QRTB 1MG2C 5I1GH 4Q56A 1FDJA 4K5NA 4HG4J 3LKNA 2BOFX 2XVGA 3ILPB 1RSYA 4FF7A 1NCBH 4G11A 3HFFA 5EIIB 1XL6A 4NPYA 1ITUA 2MH4A 1RHHA 5CCHE 4ZSOB 2H3XC 1A5BA 4PTXA 4TNFA 1C9WA 2DKMA 4FA7B 2D0GA 2XFXA 3II3A 2G2PA 2BSDA 1OE1A 2WNKA 4GCAA 2UY6B 1E4LA 4PRID 2E46A 2I5QA 2AJXH 3VG9C 3K0WA 1A3HA 1UOZA 1KCUL 1Q0YH 1Q4WA 3BURA 1ONRA 3F62A 4NNPH 4F58H 3RWFA 1PY9A 3QWOA 1U2YA 3FB7A 4F9DA 2BSED 5DQ9B 4JKWA 5DURB 1XRVA 1MRDH 4NHCL 2WWKT 3VE9A 3BG3A 1T0MB 3TQVA 4GYBA 4HSNA 3ULVC 4AD2A 3TR2A 3WFHA 4KK8C 2K6WA 2HNHA 5KSAD 1LP9A 1U8HA 4LSDA 3WLOA 1UASA 5IBTL 5AYIA 5AB0A 4A8IA 4X5RA 2C4FT 5HJDA 1H5BA 4PG9A 3V4PB 2XFYA 3EW3B 3PSWA 2ADYA 1ONQB 1WA0X 4ZQKB 4YHPA 1KLZA 3EYFB 1FORL 4JYDA 3NQ2A 4HJUA 3VXQB 1NFIB 4Q6YA 2HKHL 1GUVA 3T77B 4UC5A 4PRTA 5H4ZA 4F3FA 3RR4A 1AXTL 2JI3A 2EDLA 1DWAM 2ICCA 3KW7A 5D71L 1B90A 1AR1B 2GJXA 2JSFA 4GP4B 4EQ3A 3DPBA 2MHAA 2ITDB 3QJFA 2DH2A 3BPNC 3OSVA 3WO3B 3TN0D 4NQDB 1PKYA 3QJTB 4WK0B 4DN1A 1F4XH 4RETB 4MMXA 1OTUD 4WTXA 2YJQA 3WOVA 3PM6A 4GI4A 1K5NB 3DK2A 1DN0B 3AU1B 1H5YA 4KJWC 4QE5A 4LCUA 2EH8H 4A2MA 4HTYA 1GCFA 2BNQE 3OAWA 3C61A 2YA1A 5JLZB 4LPTA 4W4NA 2FECI 4O15A 2G30A 2DWSA 1DVYA 1G7IB 4QD2E 4UT7H 3OHXB 1CF1A 2QSQA 3M7WA 3L81A 5F8RC 4AQ1A 4XC3H 4F7MB 4JNXA 3AS2A 4UFMA 1F00I 3MBFA 4LCWB 1KCWA 3HG1D 1JK9A 5BZWB 6PTDA 3QEHB 5DEJA 2CLZB 5AOMA 2A38A 3BPCA 2BVQB 3MCKB 3QDGB 1GOFA 3CXDL 4MB4A 1V5XA 2Y36L 1AJ2A 3QZWA 1JNNL 3XISA 3NL2A 1WIUA 1FWGC 3EXTA 2QV4A 4KESA 5A6IA 2DBJA 2Q8LA 3CWGA 3HPZA 1J8HB 4V15A 3MJ8B 4HCRH 4XVDA 2XKUA 3SGEI 5D2LF 3KGSA 4LNRA 1BP3B 3URBA 2ZRYA 1DQMH 5GRUH 1LEKA 5DUPH 2A7NA 3ARBC 1TJMA 2PPEA 2ZTJA 5D4YA 4FQ2H 1IE7C 5L2KE 4OJFL 1I8KA 3LA4A 5CP3H 3QIUC 4U6YB 4A3UA 3KD4A 3BO9A 3O6FC 1GEQA 1WBJA 1Z69A 4FL4B 3LQMA 4OI7A 1JNHB 4W87A 3O07A 4P8VA 2YFNA 1T0NA 3Q65A 3GHEL 5JYLA 1F1GA 5F1IA 4LBUA 3P9MB 2ZZ2A 4N6QA 1KZYA 2XG5A 5IUSA 1S38A 4HU8A 5G2NA 3OMAB 3SJVE 4H0LC 2FX8L 4GJIA 4MZ8A 4PGJA 2ZC1A 2ATKB 1LO2H 4PMRA 4B9YA 4R27A 4RE2A 2XA8L 1P5BA 4MNGE 4PYHA 4DPRA 5DMMA 3CSBA 4MKSA 2PWFA 1NGZB 2J7CA 1P2CB 4FQCH 5C09A 2VFFA 3AIUA 5DMGD 2YGOA 2YRLA 5HHOA 2YMOA 1XR8B 4A7QA 3H8AA 1HOCA 4Q9QH 3E3QC 3TH4T 5BW7C 4WV1B 5DQDH 3T3MF 5DJAA 1XAKA 4LLDA 1DJSA 3L5XH 3QMSA 2MWCA 4GXWA 3SZ6A 2QPXA 1A7RL 2D1ZA 3NM3A 1SEQL 3PAVA 3D25B 3BISA 3OG2A 2V5KA 1SFHA 2GT9A 1S46A 1BCIA 5CZXD 4MAUH 1GG0A 3O3DA 4R2GD 3QFDA 5IHSA 2OMVA 5EN2B 5D8JL 3ME0B 3EWUA 3VNMA 1TETL 4HIEA 2B4GA 1ZFJA 3ZK0A 4IRZH 1YTEA 4XMZA 5CEZL 4AK1A 5ANMB 1CZ8L 3WY2A 2P52A 2NVDA 3GPEA 2ZBTA 3RUBL 1Y0LA 3VIMA 3GE7A 4NUQA 3CLFH 3EUDA 2J47A 3IMTA 3HG3A 3IDMA 2X40A 2X4PB 2Y8KA 3GC4A 3KHQA 3PABB 4ZQRA 4UAHA 3L65A 4FOKA 1ZVSB 3ENEA 2DEWX 2NY5C 1EJOH 5HQMA 2VMCA 3TBCA 5INCB 1NDTA 3ZTNH 4J4PC 3QPEA 3TBYB 1SJEB 3AU0A 1AQKH 1P48A 2VX7A 1Y8BA 3IJYA 2EBNA 4FK9A 1QWUA 2XC8A 1R5IB 3CBRA 3S1UA 2VWEC 3PTQA 4C6QA 3ML9A 2NY4B 4IMKA 3AYVA 4MJ6B 3WD5H 1JGMA 4FNRA 3H9SA 2WXFA 3VCLA 5IG7A 1F6AA 1LF1A 4L3ED 1IWPA 2BDNL 1S9XB 5XINA 4KITB 1EGVA 3AGVA 3TIEA 1N6VA 3GSRA 4RMTA 3U83A 4HT3A 1TQJA 2BOBB 3QDMB 4GAFB 3I6LD 5D7JA 4DIAA 2XIQA 3SY5A 1TVBB 1KB5L 5JA9A 3QH3B 3M86A 1ZS2A 1FH5L 3G1SA 4KTEL 2WZPA 4XX1E 3USBA 3VNZA 4OZGF 5F4SA 2AFNA 1X38A 4ONFH 4UTBH 1KTKE 2HK1A 3CFJA 3BDYH 3UWZA 5AB2A 5CZJA 1A7OH 3BJTA 2ZUSA 1HL9A 2DQMA 3DV6A 5IROC 4XNUL 5ISZE 1ADSA 1Z6JT 4GG6A 2VCAA 1EXUA 4UNVA 5SWSB 2A1YA 1QFUH 1QPKA 4PPTA 3IJQA 3D48R 3ARBB 3TASA 1A4MA 3FOLA 1WAWA 2HK0A 1EQPA 3EGDB 3QIUB 4LC6A 4F7EA 4BZ1H 3IRPX 1JCMP 1OSYA 4OU1A 4P57A 1U42A 4YXHL 1G4TA 4AF0B 3V52L 4LCSA 2DFAA 4HFUL 3OGCB 5DJ6B 1BKHA 1Z9SA 4S0SD 3D30A 3R0MA 5IVXF 4HK7A 2WMFA 2NXIA 4AITA 4P7OA 3UGRA 1FL5A 4NN5B 1OCJA 25C8H 1P4IH 1XF0A 3TA3B 4BSVA 3CDCA 1VD6A 2C1OB 1RD5A 2LVCA 1H5VA 1IGCH 1SEBB 4JN6A 3WDIA 5JHDA 4OFYA 5EU6B 1M03A 1NLBL 2GK1A 1A6WL 1MHPL 1DDHA 2B77A 3NOEA 2J6VA 3BXNB 1V05A 2BMKA 4WKXA 1K2DB 4Z0XB 3NN8A 4HXBH 4OKVA 3LTVA 3DRTA 2NZ9C 4XBSA 4NRZA 4ERIA 4MCNA 1AJZA 4GOAA 2F54B 1IZKA 1NAMH 4YDVA 3HAEG 3VCNA 2WO4A 3RJDA 4JRXA 1SBSH 4NKMB 4KPHL 2OEJA 5AYBA 4ZCWA 1NMBH 2IAMD 1K8ZA 1GYWA 4S1QH 1K8IB 1AG1O 4ZX4A 3LIZH 4PJCB 5G4MA 5KSBA 2XPKA 4UM9B 5IFHH 1WP6A 1OFDA 3PHOA 1NDWA 1YEKH 5C7XL 1MH5A 1ZS8B 3E0WA 3CJPA 1C9DA 4YHOH 4PJEF 5HYSA 1AY1H 2NNFA 3HTLX 3L13A 2H8PB 2RR3A 1RBOB 3QRGL 4DI9A 3E02A 3NFPB 3UESA 2VQTA 2W95A 3DURA 3HNVL 4HC1L 3MCMA 2WJZA 3UD6A 5CPSA 3LAFA 5DMNA 4XZHA 2YMTA 1V55B 5L9FA 1I3UA 4HVXA 2GW5A 3G5VA 1OAJA 1MJJB 4CKVX 5HYJE 4JO1H 2X3CA 4MOZA 3WFZA 2R1MA 3HFTA 4DT2A 3IK2A 4OCYH 3HF3A 2DD8L 2DJ4A 1TQBB 3NH7H 4XAGA 3W72A 3S4SA 5E8OA 3AALA 4A3QA 1CXIA 5SWQA 1BMWA 3D9AL 4L5FL 1RXOB 5GGRY 2WK2A 3U9IA 4AWTA 2DQDH 3OKLB 1XHGA 1XH0A 1OFRA 1ET7A 5GISL 3VTTA 2QVHA 1ICSA 3TAOA 4UIKH 4Z2LA 4AYFA 1P6BA 4AIZA 4LLMA 2EJ1A 4YSPA 3F3HA 1MFUA 2OTDA 1FZOB 1IXOA 4ZQMA 1OTTC 3JWDH 1JE6A 2H26A 4CVWA 4Z76B 3US0A 2GG1A 2CHWA 3TZVA 3O8XA 2JEQA 5DR5L 4JM2F 1FGNH 2MNJB 4EAEA 4AM0B 4DFHA 4LPUA 4NZUL 1U21A 3H7BB 1TV2A 1R3TA 2GJ6E 5LNVA 1BSIA 4FXTA 5D1QE 2OV0A 4KK6C 3VXPB 5FA3B 2FJFA 3EX2A 2P8MB 4LVHC 3FQXA 1LDCA 3U0TB 4C1LA 4X22A 4X6EA 2W38A 4NUGL 1RSFA 1LE5A 3IJLA 3DFTA 3W1AA 3P14A 3ULAB 3ATBA 3BOLA 1XBZA 2AQPA 4E9SA 2WSPA 3HC0B 5IB1A 2YGQA 3AXLA 2DYPA 43C9A 2ZOXA 1CG9A 4FNTA 3IGAB 5E8DH 3F83A 2HZGA 3INUL 2AJUL 1IC4L 1H7WA 4G8GA 2ZP9A 1NSJA 2WGXA 1SN5A 4L4JA 4Y9AA 1RUML 3FT0A 4PWGA 2Z00A 3HTWA 4ERSL 3F6IA 3BHBB 4WWKD 3LBCA 3IGHX 3RDTC 3GVQA 5D4JA 3MKCA 4HWEL 1L6GA 2HTKC 1TJGL 3U2SB 4FXSA 5TF0A 3VGAB 3O9WA 5I73C 4OW6A 3PWPE 1JEZA 1AMXA 1XDMA 3KPSE 3LMJL 4LWWA 3ZE0B 5D1ZD 4JPIB 4PB5A 3UACA 5KYXA 4DZBB 3EWWA 3Q0HA 2ABBA 2AJYL 2NNXA 1ET8A 3SN1A 2P5WA 2Y63A 3M47A 2MANA 4JS3A 2CWRA 4XNDA 5A8PA 1E71M 2LTQB 4JM4H 1PAZA 4LLYA 4W6WB 3QISA 3P40A 4U3HA 3NCBB 3R58A 4B41A 3MV01 1KEGL 4APQB 3UR7A 3FULA 1E67A 5PCYA 3P3TA 4NZJA 4WQOA 2CXEA 1K8CA 3MROA 5E8NB 2VDML 4JK0D 4Q6JA 3VXUB 3IDYB 1EC7A 3U82B 1W1TA 4KFZC 5CCGE 4QT5B 3G1FA 5KN5B 2AGTA 1WUFA 1NP2A 3OYZA 4EBQL 1ZGLM 3SGDI 5FJRA 4GKZA 5DD0H 3PFRA 2PO6C 3JRKA 1VPYA 3OKDB 2BCKA 3NJKA 1K7EA 3FU0A 5FK9B 1F4AA 3WF2A 5DFVD 1H9DA 4RV8A 5I5RA 3H7VA 3UGEA 4PRRA 3R7RA 4GAAA 2P28B 1JUFB 1UACL 1ZQ5A 1E4MM 1JRHL 5IKCB 1OV8A 1DVFB 3KPMB 5KBDA 4YTUA 4PHXA 4KKZA 3QXDA 5K4ZA 2LABA 3MODH 1O9ZA 2JIWA 4G1NA 1XPYA 4ORMA 4YHEA 5D9MA 2XQYK 4FABH 5EF2A 3M8OH 3CMJA 2IO5A 2OYMA 3BVNB 4JRYA 1FGVL 3OC5A 3HE6B 4YWGL 3HB9A 1PU0A 4Y4KA 4MJIE 3B9AA 3NSDA 5KVDE 1U6AL 5FFLA 3IFOB 4MKMA 2JKPA 1EZUA 4TX9A 3CAQA 4AC1X 4WUIA 4MA8H 5DCBA 4OQVA 4Z5RA 3FSZA 3QFJE 1QFEA 3QZNA 2QUMA 4NZ5A 3ITTA 3T1GA 3N42B 1N82A 4QY8A 3CUXA 1XX1A 1RY7B 4KT2A 1HSAB 3RWCA 4EX4A 1TJIH 4NQSA 1ZPTA 1B3JA 3CX5K 4JFHD 1B31A 2MPAH 4WK2B 4GLEA 4ZMWA 1AR2A 3F4DA 4TPRL 3SQOL 3P4OA 4HJGA 1LUCB 1CGUA 4O58H 1UXSB 1IILE 3OXRA 2ZCLH 2QQKL 4XB7A 4P3CL 4NO3B 5E70A 1SJDA 1QAPA 1YMMD 3G3MA 2WHLA 4UMSA 4WW1A 1TPEA 3SGJA 3BPLC 1OTSC 4G6AD 1I8UA 1CWVA 2E5CA 3C0JA 3MSYA 3SO7A 2N0MA 1JRBA 3DOIA 5BV7H 1NQ6A 3QNZA 4ZL1A 4HJIA 1NAL1 4NKQB 2IXUA 2R1WB 3GGWA 4BWLA 1YUHA 2VGGA 5IR1A 1GZQB 3VIIA 4JGUA 4CNUA 2EXTA 1UD8A 4GT7A 3H9HA 2WYZA 3LHUA 3FUIA 1YTKA 1A6ZA 4MY8A 4KVPA 3NGJA 1P7BA 3C3NA 3DERA 3WNLA 3UBGA 4NBZB 3TNMB 2IOMA 3JV4A 3MT1A 1X44A 2HLFD 3SE4A 4OCSH 2XN0A 5HJYA 3MYJB 4DJDA 1A7QL 3IJEA 4PJBF 2VFHA 4KMQA 1UD5A 2VLLB 5FO8A 1UM4L 4RW5A 1RZQA 4HCHA 3T0TA 5DJ8B 3CCHB 3UWQA 4BKLB 2HFFB 4N8VG 1E4XH 4B9ZA 5KVEL 3BH4A 2Q20A 2W0KA 3FUMA 1XGTA 3FT9A 4ZR8A 1E5JA 5E56A 3ULSA 3MV7E 1VZHA 4EN3D 5B22A 4Y1AD 2Y7QA 2EEBA 5HAOA 5BXTA 3DTDA 4DUXA 3S5ZA 2TRHA 2XTJD 3QCTH 3M07A