3BAXA

N298s variant of human pancreatic alpha-amylase in complex with azide
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 179
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3baxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3baxA01
3DDFA 3DC0A 5GPRA 2J7BA 2D22A 2CBIA 2J74A 1PJ9A 3WBEA 2QHAA 1U2YA 2WWDA 3TTOA 5HPCA 3W27A 1D7FA 1GW1A 2XIIA 1NQ6A 2OYLA 1ZBWA 1E1FA 1F4AA 2WWCA 3WL1A 4E4PA 1VIWA 2WKLA 5BXRA 1R7AA 1EOKA 3DDGA 3GDBA 3AISA 3LXBA 4QLKA 4Z2IA 1UWIA 3T0AA 3VIPA 2WM0A 2XVNA 3AHXA 1ZBCA 1E71M 4Y7EA 1KCLA 5AYBA 3PZIA 1QI4A 4RE4A 4U33A 2DQXA 2E9MA 3BUQA 3VOCA 4B15A 1VBUA 3VM5A 5IFPA 1GOKA 4AIUA 2XN2A 2D1ZA 5EB8A 1GOOA 4TXEA 2PWHA 3AXXA 1V3LA 4B3KA 2X2JA 1JL8A 3B8SA 3QOKA 3OGRA 1ISZA 3BUDA 1JYXA 3ARVA 2VVNA 4EKJA 2ZUMA 1W9DM 2DT0A 4GI6A 2JE8A 1E15A 2E4TA 5A6KA 1JIBA 1E55A 4D72A 1VJSA 4GZJA 5CLTA 3H55A 4FNSA 2DH3A 2V3FA 1MW3A 1BLIA 4AIOA 3I3DA 5JBEA 3MMWA 3WDQA 4LYPA 5CJ5A 4KH2A 4CKQA 1VEPA 3QHMA 1LLOA 2WVTA 1TG7A 2Z1KA 1TQUA 1ITCA 3ALGA 3CTTA 3VX1A 4J3TA 4CGTA 1FH8A 1PIFA 3WELA 3WF4A 1NP0A 1QI3A 2UY4A 1K9TA 5I2UA 4WSJA 4ATDA 1B3YA 2VL4A 2OWWA 4DUVA 3QHNA 2WCAA 4AZCA 5GNXA 4V2XA 4XB3A 3TA9A 1BF2A 2EPLX 3QHOA 1UR2A 3AQUA 1GZJA 1VEOA 3IAQA 4FF5A 1JZ7A 1IV8A 4WJXA 1LJYA 2E9LA 1ZBVA 3BSGA 3BLKA 5LA2A 2VQUA 5EBAA 3W53A 2Q8XA 1FFRA 1JZ3A 3EYPA 4ACZB 4A3YA 3BC9A 2YLAA 3EDFA 4W85A 4UFKA 3DX0A 2FGZA 2VR5A 5E6YA 2J7DA 4DWSB 1XSIA 2F1BA 3SUTA 5CLWA 4NXSA 5CXPA 1IZJA 3W82A 1KBBA 2E3ZA 2WZHA 3OLEA 1JDCA 3G6LA 3CH9A 4W7VA 4X0VA 4ZEPA 5CGTA 3WD1A 4J7RA 2GSJA 2ZUSA 2GVYA 2DSVA 1HJQA 4U2YA 4MNLA 2ZE0A 3NCOA 1G9HA 1QOXA 1XYFA 2OWCA 3CMGA 2Z1SA 2XN1A 4AW7A 5A6BD 3EBVA 5I79A 3VMPA 1G0CA 3PZGA 1W9UA 3WUBA 1H09A 3WD3A 1VEMA 3ZM8A 3MKKA 3HG5A 4CD6A 3WMSA 3PHAA 4LX4A 1W91A 3EMZA 4GXPA 3VO0A 1M7XA 1H1NA 4BZYA 3VNZA 1UKSA 3EMCA 3KLKA 3VGHA 3AJ7A 1EQCA 3SCSA 3GXIA 3LXCA 4CCCA 2D23A 1LG1A 3FN9A 3MV01 2X0HA 2WVUA 2ZX5A 4QDMA 2FHBA 4PMDA 1DWJM 4AD1A 4JFSA 1WKYA 3AMCA 3D4ZA 1CXHA 4XZWA 5C70A 1KB3A 4QCEA 4JKMA 3WH9A 3BAKA 2CNCA 3SUSA 3VX0A 4V28A 2YFOA 3MUAA 2CHNA 3VINA 1E1EA 2CERA 1W3LA 3BGAA 3W28A 1B3WA 1NWRA 2YL6A 1V0KA 2VX5A 1JZ8A 2JALA 4GQRA 3N15A 5A8PA 2ZXBA 5CPTA 1E4NA 4IM4A 2CETA 5A94A 1E43A 4W87A 2WCSA 1KR1A 5JBDA 2DEPA 3MU7A 2UY2A 4S3JA 1I1WA 3DECA 1QHPA 1V3IA 4EAMA 1OT1A 1KQYA 1SR0A 1E40A 4H8VA 5EMYA 3ECQA 1PZ3A 4M29A 5M17A 2JFEX 3WDJA 2XFRA 1BVZA 2CBUA 2BHUA 3UERA 3A6OA 3BVXA 3G6MA 5HPOA 2E0PA 2ZWZA 2A3EA 3KZSA 3VKKA 3CZEA 2PBGA 4B9YA 1TA3B 4QLLA 1BSIA 4JFUA 4UQDA 5BRQA 2WHLA 4OIFA 1VF8A 1LG2A 1V3JA 2AMGA 3W0KA 5BXSA 5CZKA 3D5HA 4ATLA 4OOZA 4UTFA 3T08A 1QWNA 3WD4A 2VZOA 1UR4A 1ZJBA 1UG6A 2G3MA 4AEFA 2YDQA 1QHOA 2VRKA 2FYVA 2Y4SA 3VSTA 4AYSA 4PN2A 3AIVA 4F66A 1EIBA 2VOTA 3VSUA 1CXIA 2O92A 1QW8A 5A2AA 4UQBA 4N0RA 4J3XA 1J0ZA 3BMWA 4J3VA 5E0FA 5M3WA 3ARYA 3AZTA 4QCFA 4TVUA 2EO7A 3UESA 1H49A 5F7UA 5ABGA 1DP0A 3AS2A 2BY0A 4GO8A 2CEQA 3NDYA 5CGMA 3NUKA 1UR9A 4F9DA 3MSGA 3CZNA 2UY5A 1X6NA 4HPGA 2DT3A 4F9JA 1VJZA 4ZFMA 3SCWA 2W5FA 1GONA 4YN5A 2FE0A 1V08A 4PMRA 1TQVA 2XSAA 1SZNA 5FL1A 4UQAA 2BY3A 5DF0A 1K6AA 1UWRA 4UNIA 1O7AA 3FNDA 3VILA 1IT0A 4AD3A 5DFAA 4C7DA 5A6LA 1OD8A 5D8ZA 3VU2A 2CPUA 4MB3A 2O9RA 5D8WA 1JF5A 5IXEA 3RMEA 3VD3A 2ESCA 3NJ3A 3VM7A 3VIIA 3ARSA 1OT2A 4URIA 1EQPA 3WQWA 3RJYA 2WMFA 3ARQA 3U7BA 1I75A 1HXJA 4AZBA 3T2OA 1DEDA 3PZMA 1L8NA 4GINA 3N04A 1Q4NX 2X2YA 1MXGA 4FLRA 5KZ6A 4TX8A 1GOMA 5ABFA 2EBNA 2A3CA 1VFMA 1U33A 1VFOA 4QAWA 6CGTA 4WLCA 1K9DA 4AZIA 3APGA 1HKKA 3BLBA 4HPHA 1RD6A 3JUGA 2WVVA 1E0XA 2EPOA 2YA2A 3KEHA 4ZE4A 2X09A 3L4VA 1GPFA 4UOQA 1V0MA 3NIYA 4P7RA 1EA9C 1UD4A 1DTUA 4P7OA 3K4DA 1CLVA 1J9YA 2J8GA 1TCMA 1R8LA 4P8UA 2EQDA 1CXLA 3PZUA 3BMVA 8CGTA 1XD1A 3CZ8A 2GUYA 1E6SM 4JFVA 3VIHA 1GCYA 4JZ5A 2EXOA 1JFHA 2F7RA 1K9FA 1WDPA 7A3HA 2EPKX 4JIEA 1H2JA 1HP4A 2DSUA 3SCOA 3CZLA 4GI8A 2QV4A 3GNRA 3GNOA 3NSXA 3AI0A 2HISA 1GVIA 4DM2A 2ZUTA 1E5JA 2WLYA 1KTBA 3CO4A 3SEPA 1E5NA 1M03A 3AYRA 4K68A 2PWDA 2XVPA 3ARZA 3BCFA 4ATWA 4AD4A 5FD0A 4HOXA 4D6JA 3MO4A 2G4FA 5JBFA 1EOMA 2GK1A 1I1XA 3BXWA 1DWIM 1R33A 1CLXA 3K4AA 1UZ4A 1BVNP 1OGGA 1GHSA 1JF6A 1JZ4A 3ALFA 4AC1X 1MQRA 4LPCA 1V6UA 4B3LA 4RE2A 4UZSA 1SYTA 2CBJA 1W2PA 3UETA 4BS0A 4UQCA 2YDRA 3VGDA 3T0BA 1WZLA 2DSKA 3MUY1 3CUFA 3GBDA 1KQZA 3U5UA 1ODUA 2YKKA 2JIWA 4FNPA 5C71A 4U3CA 4B9ZA 4U5IA 2O9OA 1Q6CA 5CSUA 2FH6A 3W38A 4ZE5A 3OIHA 1HNYA 5HNNA 4CVWA 3ARPA 2YL5A 1FFQA 4YHGA 4MB4A 1C90A 3CUHA 1R7OA 4XX6A 3TV8A 1UKQA 1C93A 1UH3A 2X8RA 5JIPA 1NM9A 2XFYA 5BWFA 3AFBA 2WVSA 4P8XA 3SCVA 1ESWA 1RP9A 2VX7A 3ARXA 2PC8A 3T2QA 2GJXA 4GIAA 1WDSA 4CD8A 3GTNA 3AS0A 4WKFA 4XV0A 3SCQA 1EDTA 2VQTA 2YFNA 1MFVA 1TVPA 4TTUA 3WN6A 2VO5A 1S46A 5HXMA 1J12A 2GDVA 2IXUA 3SCPA 1W9PA 3FAXA 3ZJ6A 5DT5A 1WB0A 5A2BA 1KXQA 1AVAA 4MDPA 2MANA 4FLOA 2PB1A 3AOFA 3UR7A 4HA1A 2XHYA 4OOUA 4N42A 4HMEA 5HDRA 1UWTA 3LPFA 3TTYA 4TTGA 2PWGA 1HN1A 3GBEA 3GXTA 4CN4A 4CUCA 4S3KA 1PZ2A 3EJRA 4P7LA 2ZUVA 2JEPA 1E6ZA 3SCNA 1LL6A 1JYVA 2IUZA 1V3MA 4FMVA 5A8QA 4EK7A 4M81A 2F8QA 1MQQA 1UR8A 1CZ1A 1H3GA 2BVYA 1SMDA 1HJWA 1QW9A 2WMKA 4DM1A 1H11A 4UFLA 2V5DA 3CHDA 4MJ4A 1UOKA 3VD4A 3WMBA 1W1YA 1W1VA 4PMVA 5EFDA 1W9VA 1HXKA 3FAWA 3WY2A 5A8NA 3IJ8A 1VB9A 4BA0A 4GZIA 2V3GA 4JFTA 3NYDA 1MFUA 1QNSA 1C92A 5HBFA 1TE1A 1FOBA 2WC7A 2GDUA 4M1RA 3ZT6A 1O6IA 2EJ1A 3SIMA 3A4WA 4AISA 1PEZA 2XUCA 2HVMA 2F1AA 4ZXLA 4W93A 1UWQA 4HOWA 3LXAA 3PBGA 3D50A 4FNQA 3EDDA 4H41A 1C7SA 1ZBKA 4KGLA 2VX4A 3ZT5A 4EE9A 4J3UA 3OLIA 2XPKA 3RIKA 3CHEA 2WMHA 2GFTA 1PBGA 1GOIA 1M01A 4IPNB 3ARRA 3BAYA 3WD2A 1CTNA 3BVWA 1XC6A 1H0IA 3HZ3A 3D3AA 5E6ZA 1W3HA 2G41A 4WF7A 3DHPA 4HZ6A 4PYSA 1KTCA 1DWHM 4MADA 1GJWA 2EAEA 1HKJA 1X6LA 1MYRA 1BQCA 1PS3A 4HZ8A 2WYSA 4FK9A 1V02A 2X0YA 4NZJA 1GNXA 1GQIA 4ZENA 3UG5A 5FKYA 3WIJA 2DSWA 1JD9A 2JIEA 1F4HA 1PX3A 3EJUA 3MMDA 4UOJA 4KMQA 2EPNA 1WDRA 3CZJA 3WH6A 1ISXA 2TAAA 3BVVA 2WHJA 2Y2WA 2DSZA 1HJVA 4WKAA 1XH1A 1J11A 4HU0A 1LWJA 2W62A 4M82A 2VJXA 1QNRA 1V6YA 3N9KA 3CIVA 4P7NA 4ACYA 4OJYA 4KRUA 2ZX8A 3MMUA 2X2HA 1MW2A 2EPMX 1KWGA 3WFLA 1D2KA 5HOSA 4IPLA 3VMNA 2ZIDA 4H8HA 3PTQA 1XD0A 5CSYA 3RM9A 4MB1A 2CKRA 1XH0A 2EADA 2XGIA 3VIJA 1V02E 4AD5A 3SCUA 1CENA 1ZU8A 4OKDA 3K46A 3M07A 1B3VA 2J4GA 5I23A 2PI6A 2BY2A 4ML4A 2JF7A 1WE5A 1BHGA 2BNJA 3WEOA 4JL2A 3L4YA 4GPNA 2XYLA 5BXTA 2G3IA 2QMKA 4QFUA 5FOOA 1JD7A 4GI9A 2XFFA 2EEXA 3NSNA 3ZSSA 3FXYA 2W67A 1OB0A 4L4OA 3KL0A 3VD7A 4OUEA 2ZX6A 4HMDA 2QF8A 4EANA 1PIGA 5DMYA 2QMJA 1W9BM 2Y24A 3PZVA 2VZSA 4J28A 4DO5A 1J0HA 3N1AA 4NRSA 1OIFA 4DWSC 2CXGA 3S6TA 4KWUA 2WW5A 3VDHA 5D9NA 1V03A 1ZS2A 3CUJA 2J62A 1E3XA 2YA1A 5I3DA 2GJRA 5CG0A 1CECA 4CU8A 3S5YA 3BUIA 4AYGA 4HU8A 3OZPA 4TVCA 1R47A 2VI0A 5FL0A 3BUBA 4H7VA 3VSVA 5D9OA 1UKOA 2J7FA 2EABA 1CXFA 2ZUUA 1WO2A 4W5UA 3VD5A 1QVBA 3CGTA 5DT7A 1PX4A 4LXFA 1NARA 1G1YA 1Y7VA 1R34A 2V5CA 1JNEA 3BAWA 3VTRA 3GXPA 1CWYA 2WHMA 1BG9A 3AHYA 4PTMA 1XHGA 2WMIB 3VIGA 3OZOA 1CXEA 1Z32X 3IANA 1UQZA 1WZMA 2DIEA 3VIKA 2D3NA 3EDJA 1UKTA 2QLYA 1KXTA 3AICA 3HN3A 2VZTA 2OSYA 1FA2A 2W91A 2FHFA 4J27A 1CGTA 3WD0A 4Z2JA 4FNTA 4F8XA 2NSXA 3WQ8A 3OA5A 1J0YA 4UFIA 1OCQA 2VZVA 3PZOA 1TR1A 3WY1A 2VT0A 1QI0A 5GNYA 1MXDA 1TVNA 5M5DA 2G8ZA 4U5KA 2X2IA 3WH5A 4P8VA 1QNQA 1TFVA 5DEZA 4Q22A 2DDXA 5I78A 3AZRA 4E8DA 3VGEA 3J7HA 1B30A 2XN0A 2VVSA 5BYWA 3WDRA 4M80A 1A47A 1UD6A 4LYQA 3WEMA 3ZR6A 3M7SA 1C8YA 3MS8A 3WDPP 4ACZA 2J78A 5C8BB 1HWWA 2ZWYA 5AC5A 1E6PA 3W26A 2Y5EA 4CD5A 1HTYA 4MB5A 1W1TA 4DWSA 1JI2A 3AXIA 5DO8A 3I3BA 3WUGA 1B31A 3ARUA 1XSKA 3QOMA 1CIUA 2GJPA 4PCSA 4P8WA 1GVYA 3PTMA 1JAEA 1KWKA 1W9XA 3W24A 1KXHA 2WZEA 3T0DA 4M24A 1UA3A 3W81A 2D0GA 3WQ4A 1UKPA 1NH6A 3NSMA 5IFTA 4W84A 5A6JA 2WHKA 1H4PA 2BXYA 5D9MA 3ZR5A 2D73A 1HL9A 1WZKA 4W8LA 3MSDA 2WSPA 3DYPA 5A1AA 3TONA 1FP9A 3ARTA 2F7OA 1MQPA 1DWAM 1WDQA 1J10A 1U30A 2XGBA 4PMNA 3RJXA 4BQ2A 1TQTA 3OB8A 3VDBA 1CDGA 1T0OA 2RGLA 2O9TA 2W66A 3ZT7A 4GZEA 5I5RA 2D3LA 3O9NA 3EJPA 4JL1A 5CPSA 3DX2A 1ISVA 1Q6EA 4AZGA 3AMLA 1ISWA 2ALWA 3FW6A 1HX0A 3WDHA 2OYMA 2XG9A 1JZ2A 3IJ9A 2YBTA 1R85A 1AMYA 7CGTA 1NOFA 1ZJAA 1KGWA 1JGIA 1L0PA 1FH9A 4W8AA 1ITXA 1V6XA 1VENA 3W4RA 4R5EA 1JFXA 2QPSA 3PZTA 3VDCA 1TZ7A 3SCRA 1E9LA 2J77A 4PMYA 5IHSA 2WC3A 3HMCA 3L4XA 4D6GA 3F5JA 4PMZA 2XM1A 4PMXA 3LMYA 3ZJ8A 2O9PA 1ZB5A 4WSKA 1C8XA 4AXNA 1R87A 2WSKA 4CD4A 3SURA 3KL5A 1UD8A 4AZCB 2D20A 1QBBA 3WF0A 4KGJA 3D4YA 3GXMA 3HG4A 2X05A 1BGAA 1CBGA 2A3HA 3GNPA 3AIBA 4AD0A 1E6XM 4JKLA 5A8OA 1UYQA 4FLSA 4H04A 2DPEA 2J79A 3WEZA 2BY1A 4HP5A 1EDGA 2ZX7A 3AYSA 5A6AA 1VRXA 3E1F1 2DT2A 5LA1A 1A3HA 2WAGA 5D4YA 4RL3A 3WH7A 1TA3A 5BROA 1HJXA 1UD2A 1UWSA 4NXKA 3OG2A 3BLPX 1YHTA 3MI6A 3WBAA 1OM0A 3VMOA 1OSEA 2BHZA 4NRRA 3WNKA 5A8MA 1TQWA 3LRKA 1GJUA 2WNWA 3DX3A 5A2CA 4AIEA 2E8ZA 4PSPA 3HG2A 3EDKA 4DUXA 2C0HA 3BH4A 1XGZA 1PPIA 3OGSA 1BG4A 4CN1A 5ABHA 1B2YA 3AZSA 3DHUA 1R75A 3K8MA 1ISYA 3AHVA 2FHCA 2PWFA 3CHCA 4HMCA 3S2CA 4QP0A 3W6MA 3FHAA 2J7HA 5E0CA 1CGXA 1HJSA 5KEZA 3TP4A 1B0IA 1UA7A 1M53A 2CCRA 4D6HA 1EO7A 3L4WA 2YDSA 1HJUA 4QLJA 4AY1A 4PEEA 3AIWA 2VZUA 2ZXAA 1OIMA 1PAMA 5M03A 2YLLA 1GQKA 1KGUA 5IDIA 1TUXA 3D51A 2DT1A 3PN8A 1C7TA 1CYGA 3WNMA 3TTSA 5E1QA 2AAAA 1VFFA 2E8YA 3WNNA 1GORA 4FNUA 1JNDA 1E4MM 1M04A 4AZ6A 1V0LA 1R46A 3WY4A 1FH7A 1UR0A 4UQ9A 5BRPA 4J3WA 1JDAA 1GHRA 1E0VA 3BAXA 4CD7A 4MNJA 1W3JA 2WLZA 1B9ZA 4DWSD 2D24A 5E09A 3SUUA 1W2VA 4CCEA 3M46A 5EFFA 4F79A 1Q6FA 2DH2A 9CGTA 2PF0A 3LPPA 1C3FA 4D71A 3VGFA 2WCGA 3GM8A 1UASA 1E56A 1XV8A 2VC9A 4GQQA 1KGXA 1J01A 3W6LA 6TAAA 1HL8A 2WXDM 2VCAA 4NZCA 4GKLA 4AWEA 2WBKA 4WIWA 1UWUA 3MUIA 4FNRA 2WBGA 3BVUA 1KCKA 2DIJA 2CHOA 4CCDA 1OWQA 3CLWA 3FY1A 1HKIA 1K9EA 3K1DA 2D2OA 4BCEA 3A24A 4XUYA 1XH2A 2RGMA 4XZBA 2UWFA 1UH2A 1EHNA 3L2LA 1E6RA 5A6SA 3CPUA 2WANA 3N11A 2Y8KA 1OGSA 1J0JA 5FIPA 3VPLA 3UCQA 2ZUWA 1JXKA 4B16A 1UUQA 3BUPA 4JHOA 4AZ5A 3RO8A 2VCCA 3OGVA 3WMCA 3K8KA 3O6AA 4IUGA 2BXZA 4LYRA 1XCXA 3AS1A 1J0KA 2CITA 1EDQA 4J3SA 4AMWA 2IXVA 5FCZA 3I3EA 5BXPA 2Y8VA 3GH7A 3VDAA 4DO6A 1KFWA 1CGYA 4W89A 1JYWA 4Q7NA 3GXNA 1WPCA 4OZOA 4W7WA 3LX9A 3UG3A 3IJ7A 3WNLA 2UY3A 3AMKA 3TTQA 3AROA 2XVGA 3PZNA 3ZMRA 3DX1A 2VNCA 3W37A 3S5ZA 3CHFA 1ECEA 1ODZA 3POHA 3TOPA 1UZ1A 1JZ6A 4PTVA 3GZAA 1QX1A 4PMQA 3A21A 2A3BA 4NI3A 3ZQ9A 3CUGA 2J75A 5TD4A 4D6DA 3A5VA 1RPKA 3AIUA 5GQBA 3F5LA 1H41A 3AMGA 4W5ZA 1QI5A 3A3HA 3AIRA 4MAVA 3VNYA 1AQ0A 1E72M 3LPGA 1US2A 1NOWA 2F7PA 2XVLA 3W25A 1MW0A 4LGXA 1EO5A 1GQJA 5LYRA 4P7QA 3EJSA 1GOWA 2B31A 3M6DA 4DUWA 3CZGA 1W3KA 3SCTA 3NDZA 4M56A 2IGTA 2JEQA 5JIWA 2J7EA 4Z2HA 4D6IA 3SUWA 1LQ0A 4ZXOA 1W1PA 4U31A 3WSUA 1MW1A 2CYGA 4HOZA 3WFZA 3N18A 1LWHA 2XM2A 2OSXA 4JCLA 1VFUA 1FHLA 2YIHA 5ABFB 3RPMA 4JCMA 1H0GA 4AZ7A 3ZJKA 1W32A 1WCGA 3A23A 3GH5A 1FHDA 4X9YA 2WVVB 2FDMA 3WNPA 4JAWA 1UHVA 3DX4A 2NT0A 2WKGA 3QGVA 4AEEA 4V27A 1RH9A 4HZ7A 3F4VA 1NWSA 5JUVA 5BCAA 1O7DC 3RDKA 5GNZA 4OBRA 4NF7A 1WAWA 4U3AA 3A4XA 3VVGA 3WF3A 2PWEA 1C91A 3MUZ1 2YBUA 4X0NA 1UD5A 2CBVA 1HVXA 4AZHA 3KWXA 1US3A 2W63A 4W8BA 1V3KA 4W88A 4YPJA 4KRTA 1N82A 2F7QA 1V3HA 1TQSA 2VRJA 3WF2A 3GXFA 3BAIA 3CZKA 1E73M 1VAHA 2ZXQA 3AS3A 1E4IA 2ZOXA 4YHEA 3OLDA 3DYMA 1UD3A 4DO4A 1QNPA 3L4UA 1UH4A 4AMCA 1V6VA 3OBAA 3ZOAA 3DYOA 2W4XA 3CUIA 2J8FA 4D1JA 2OW6A 1E4LA 4PTWA 3WQ6A 2XIBA 1PX8A 4JKKA 2GK1B 4AD2A 4OBSA 2C7FA 4H2CA 2WMGA 1OBAA 1CNVA 1XYZA 5A6MA 3HJEA 3CC1A 3U57A 3UEQA 3RILA 3OLGA 2BV9A 5I24A 3BAJA 1HVQA 3LRMA 2G3NA 1JZ5A 1NOUA 2NT1A 1AQHA 1FP8A 4JHZA 5AYIA 2W61A 2FGLA 2VX6A 1MWOA 3BVTA 3RM8A 3ZSTA 2OWXA 2V38A 4D1IA 4TVDA 3WDIA 1JYNA 1RP8A 5E9AA 4LQ1A 3VGGA 1HP5A 4M8UA 1BGGA 3ZIZA 3O2LA 1H5VA 3LRLA 3KE0A 2D0FA 3WQ5A 4PSRA 1XSJA 3WENA 1NWTA 2CKSA 1GUVA 1JDDA 3HU7A 4UR9A 1QHZA 3EJQA 2GJXB 2D0HA 2F18A 3EDEA 4A4AA 8A3HA 3HG3A 1E0WA 4TUFA 4UFHA 4E8CA 7TAAA 3FHQA 5A95A 1DHKA 3A4AA 4H8UA 1BTCA 1DWGM 2CESA 4NSBA 1Q6GA 3K8LA 1LF1A 1CGWA 1P6WA 1KR0A 1LL7A 1OD0A 1SFSA 3AIQA 1SMAA 1HT6A 2J25A 3IGUA 1UQYA 1HIZA 1ZL1A 2ZXDA 2VCBA 2EACA 2XJ7A 5A69A 1JAKA 2BHYA 1XCWA 3THDA 5I6SA 3U5YA 3AHTA 4D6CA 2YL9A 3T2PA 3WH8A 5CPQA 4C7FA 3CV5A 1X1NA 4JFWA 2CIPA 1QPKA 4MNKA 4L4PA 4U2ZA 1GOQA 4HA3A 3WUEA 4A3HA 4PCTA 2VMFA 5IHRA 2E9BA 6A3HA 2ZICA 2A3AA 2BFGA 3VD9A 2BVDA 1NP2A 4W86A 1WZAA 3GH4A 2YOCA 3B9EA 2WPGA 1EHAA 5D9PA 3AMDA 4E2OA 1VBRA 2W92A 3ZO9A 4BQ3A 2VRQA 1E3ZA 1E6NA 3AHZA 1G5AA 4TX6A 4PUDA 2V3EA 2WZIA 2VTFA 2ZX9A 5ECUA 1BYDA 3AIEA 4GO9A 2G3JA 4TOQA 2OW7A 4BF7A 4PBGA 3ZJ7A 4PRWA 2C8NA 2VURA 1BPLB 1CEOA 4PMOA 4UFMA 1BYBA 1HF6A 1LL4A 4Z2GA 4MTVA 5A3HA 1R86A 4R27A 2WB5A 4WK9A 1EGZA 4UZUA 2WK2A 3N13A 2XVKA 3CZSA 4MJ2A 4Z2LA 2J7GA 3WF1A 4D6FA 2BS9A 5AC4A 3MANA 3WNOA 1EH9A 2YL8A 1Q6DA 4PMUA 3EJTA 1UR1A 3UG4A 1OINA 3H53A 1HKMA 4NX0A 3PZQA 4Z2KA 4FLQA 1TMQA 1AQMA 4UFJA 3UR8A 1CGVA 2QPUA 1BYCA 3MV11 3WKZA 2PBOA 4MNMA 3AXHA 2AOSA 3B9AA 3BCDA 1QBAA 1C8QA 3II1A 1BFNA 1NWUA 1V0NA 1OGBA 3CMJA 5I0DA 4W7UA 4PUEA 1EXPA 2DGAA 2V3DA 1KXVA 1IZKA 2NW0A 2F2HA 4HA4A 3VIMA 3WQVA 3ARWA 1JI1A 5AY7A 4IISA 4BQ5A 3SUVA 1J0IA 1JG9A 2FH8A 3T09A 3CBWA 2XSBA 1JXJA 3W29A 1G94A 3D52A 3RCNA 3L4TA 4NZFA 3VGBA 4CU6A 1BAGA 1QWUA 3BSHA 2JF6A 1B3ZA 4CVUA 3VUPA 3QR3A 2WMJA 2XTKA 4MDOA 3U7VA 1E6QM 1B3XA 2WMIA 3N12A 3VIOA 4PTXA 1J18A 4CN6A 5E70A 3LPOA 3IK2A 2XWDA 1CGUA 1KBKA 3VIFA 2BVTA 1GQLA 3PZ9A 4BQ4A 1WP6A 5A6BA 2X1IA 2OYKA 2VR4A 5I77A 3GXDA 1QNOA 3N17A 3THCA 4UQEA 2YA0A 1CPUA 4RE3A 5LA0A 1E70M 4UOZA 3RM4A 3B9DA 5ABEA 3WY3A 3KL3A 4WKHA 1CXKA 4MPKA 2VUYA 1G01A 2J47A 3H54A 1QI2A 4HTYA 1DWFM 4CU7A 3EMQA 2XWEA 1D3CA 3POCA 2J7CA 2F61A 3F5KA 3A47A 3WL0A 3L4ZA 1V6WA 3L2MA 3A22A 1WNOA 3IAPA 3KLLA 1YQ2A 4D6EA 4OGZA 1MVYA 1B90A 2OLHA 2ZUNA 3GYCA 3PTKA 2YJQA 3WUFA 2OSWA 4AMXA 4C7GA 1XRVA 4UCFA 2WC4A 1BYAA 4MAZA 5CQ1A 1B1YA 2E40A
chains in the Genus database with same CATH superfamily
4QR7A 4HEPA 3JTTB 1D7FA 2XIDA 3K30A 1TQCB 4Z3FA 3CZFB 2ZZ3A 2WBXA 5K2ZA 1JWSB 5JLZA 5DGQA 4Q8OA 3HC0A 4X4MA 2J5LB 3QZEA 1DXIA 5T1KB 3OQ3B 3RWIA 1QSED 1VBUA 2V8MA 2XTJD 4YGAB 2PWHA 4IYKA 2FYYB 2ZE3A 2VUOA 3ORWA 1N8ZA 3S5NA 3QNFA 3TCSA 2QGCA 3K5XA 3REVB 1E55A 1PZ5B 4GZJA 5IIEB 4IHCA 2F8IA 1PE1A 3H55A 3IDIA 1MW3A 3B5TA 4LYPA 4EBQL 2AK4A 1LGVA 4EPBC 1W5PA 4QOKE 4XWGL 1XS2A 4XWOD 3KBSA 5C0GB 1JVKA 2XH7A 5EU7C 4XOAA 3E38A 2O93L 1FNEB 2O5XH 5J56B 1G7LA 2OWWA 1QTSA 2OL3A 5D7LA 4AZCA 4FB7A 1BF2A 4G8FB 3FGCA 5K4XA 3EKZA 4JFPA 5MP6H 1UOWA 1R3JB 3VWKC 4U1HA 3WD5H 5EBAA 4HCHA 1ECYA 3V0EA 3RDJA 3GGWA 1M7JA 4HUXB 4Y8DC 2J7DA 4GUPB 2RALA 3GPSA 3PSVA 4KNQA 5F7WC 1PLBA 1R3LB 3S1UA 2F5AH 4PJFE 4HJ0D 1YDOA 1SEQH 2GSJA 2AXGA 4ZOBA 2ZOKA 4EOWL 1G7HB 4M51A 1E2VA 1FHNA 1EC9A 3UJJL 2VCOA 4FXJA 4OWGA 2O6CA 1W9UA 1FKWA 1A65A 2WZ6A 3MKKA 4LX4A 3CVDA 1JF1B 2H32A 4GXPA 4JGJA 1DVUA 1RU9L 4XAGA 4KI1A 4OZIB 2YD9A 3I9AA 4JM2B 1B4RA 4PMDA 4ZA0A 4AD1A 2L04A 3LS5L 1WKYA 4Z3EA 5KSAD 1QD0A 2V7HB 2IH3B 1MIMH 2Y06H 5DT1H 4FDWA 2WXFA 5KG9A 1S1PA 4RWHA 4M1CC 4O00A 4OCSH 3PFMA 5A94A 5ALBH 3QG7H 4WK4B 3ZVVA 1JV5A 3GSOA 5E24E 4U1IA 2IW0A 3DFYA 3PWAA 4Z5RB 3P5YA 5EMYA 3GLDA 3B3IA 4M29A 3G6MA 1Q9KA 1CDBA 3GB7A 3X1EA 1EBGA 1KG0B 4JFUA 5EZPA 3PR2A 4OIFA 2VL5B 4QRPA 2FIRT 4N3UA 2ZRXA 3WD4A 2VLLB 4HC1H 3CVHL 3ZUCA 1NFBA 3VSTA 4DF9A 1BM3H 4POYA 3MJ8B 1CXIA 3GJEA 1MDRA 2Q8BL 3WK0A 5EU5A 4J3VA 2NY2C 3UESA 4F9DA 3AM8A 1OYCA 2XWZA 3BJ91 3CK0H 2EEDA 2VXUL 3QV8A 5HULA 2XSAA 3OZYA 2VH5H 4NJHA 3ZXAC 4ZTPL 4KRPC 3OB0H 1DO5A 2R4SL 5GGSB 3G3MA 1S7TA 4WDWA 3QJAA 3TFKC 1LTDA 2I85A 5E7BA 3RX2A 4PBFA 1I8MB 4AUYA 5B3JF 3O3RA 3RWDA 2XKNB 5HBBA 5ABFA 3VKBA 2EBNA 2NNFA 4S2CA 3MFGB 1IGWA 3MKGA 4IIQA 3O6LH 1NAKL 2ZUYA 3VFGH 3QUML 5TDOB 2R1LA 3HGSA 4ODTL 4RNRA 5A7BA 3GI8L 3DJTA 5JORB 1ZPLA 3GQYA 4WKZA 4F2ME 3NZGA 2Y2YA 3HPLB 4O9HL 4PJ7E 1B88A 2BX5A 2HFFA 4LKXA 2AQOA 4M7JL 1D6EB 3NACL 4UTLA 2DSUA 5EPMB 2QV4A 4N2FA 1QR1A 3Q6FB 3MXWL 1GVIA 3M7OA 2COVD 4AF0A 1E5NA 3U0TA 2E7LA 4NHUA 4W9IC 1HAWA 2BC4B 4D6JA 1VBGA 2FNWA 4HKXA 3HURA 3G5YA 4WK2B 3H9ZA 4HV8B 2QCMA 3W3OA 3LRHA 3NSDA 2EIJB 2OFQA 4TQ8A 1FV1A 1FBAA 4JFQA 1IXOA 2ENYA 5G4MA 5I8EA 2JIWA 3D0VB 5AVQB 1C08B 3L5HA 1ONEA 3S7GA 1TZOA 2K45A 1WBHA 4H1LH 1TT6A 4CVWA 3ARPA 3HBPA 1YXDA 1FNHA 2P42B 1GYMA 2AVGA 3ZTNH 1H1ZA 1EXGA 3LZRA 4O28A 3CQPA 4N7QA 4IIBA 4UIKH 3IS1X 1MFVA 4AJVA 4OGXH 1S46A 1VGKA 1XBYA 4BFOA 5KS9F 4G2AA 3FO0L 1M05B 1RK1B 4PBXA 3K6DA 3KZPA 3FKUS 2VHLA 2NCMA 2DQUL 4WFFE 1SPQA 5AOKA 4CN4A 4Z7WB 2GGHA 3E9UA 4FRWA 4CRPA 3LCWA 4FQLH 2AV7B 4FFWD 5D1QB 1T1WB 1PW3A 1G7PA 5FIEA 5IOPA 3VXQB 3FNKA 2QTVA 5E56A 2XKSA 4MMXC 4WV1A 5CN2A 3K4ZA 1TV2A 4UTUA 1GH7A 1EEUA 3LHPH 1FZOA 2MCAA 1TE1A 2WC7A 4AJWA 3ZT6A 3HIJA 4FFYL 1KFGA 5I3IA 1PEZA 4PB0H 3UDWA 1NANI 1MJJB 3ABKB 1BFSA 1U8IA 5KBDA 4ZMQA 1VRDA 2NZ1A 3NWRA 3OLIA 2YWZA 4I9WE 2WMHA 3C6LC 5CCGE 3ARBD 2B7DT 1QFPA 4NAFB 3CUZA 1RZPA 4X61A 2FIKB 3M0ZA 2QDVA 3ZDXF 4MPQA 5CGBA 4WWID 1J79A 2ERJC 1VGEL 4WTQA 3UXLA 3RURA 1GTFA 2EAEA 1X6LA 3NFSH 1MYRA 1X4XA 1GQIA 2N1TE 1Q13A 4UU9B 1YEIH 5DX7A 1ISXA 3D25B 4IGBA 3LRGA 2VW7A 4Q9QL 1J11A 3JVAA 5LKNA 1PDZA 2W62A 2Y7SA 2K3TA 1YAIA 4R7JA 1NFPA 3BH9B 3DKJA 2VRAA 1DIOA 4XX1G 3QXAB 4IPLA 4F33A 3O7UA 2VSDA 3PJSA 3SHSA 1F18A 2J4GA 4PRPE 3QWRA 3BP6A 3IV3A 3PAUA 2CKNA 5IMLB 4US5D 4LSSL 1BV8A 1U0QA 1Z6KA 1ET8A 3ZTJH 4KC3B 4BFBD 5DURB 4H0IA 1R3HB 1ZHKA 3CT7A 4LDCA 2BS8A 4E9WA 4OUEA 5HYEA 2NY2B 1PIGA 5JA9A 4G56A 8XIMA 1UZ6E 3MV9A 3N1AA 1U8HA 5JHLL 2Y88A 2WW5A 3IJQA 3KHQA 2CPCA 4DTGL 3IMUA 1CECA 4JY9A 3VSVA 3GFZA 3CPLB 4HIHA 3EG9A 2CZNA 2VB5A 4HLEA 3W74A 3HNTH 1UP0A 4B5VA 4O50A 3BAWA 2G50A 5EIQA 3HM7A 3DTUB 1KV7A 4QITA 4K23H 2BFVL 3WL9B 4LE8A 3FZUD 1NC4D 4C60A 4OJEH 1M2VA 2CRYA 2C7UA 1FNGA 5JW3H 1IGFL 3VXNA 1GVQA 5CLZA 5F7NC 5CWSB 1MF2H 3CMFA 1MXDA 1TZIB 3CH1A 1ZALA 2J66A 4OLZH 2C3HA 2O7SA 4NQDD 4OZFB 3RITA 3NSFA 4AT6B 4MKVA 4TM9A 3ZVHB 1I3GH 3WDRA 4CBPA 4N2EA 1M1XA 1IAKB 2VLKE 3W26A 1LDSA 1NELA 1AQDA 1YMYA 1YC7A 3S3DB 3ARUA 1GZHC 3E2SA 3FF7A 2WUCH 4IRSD 5ALCL 3MO7A 5J8LA 3VXSE 2WZEA 3MBED 1QSEA 3WQ4A 4FR1A 2CIIA 1KZQA 2EKSA 2I07B 4RVBA 4M93C 4XNUL 1KCSH 1XQLA 1C12B 4EOUA 4LPUA 3Q2DA 3NJLA 4ZPVB 5KVFL 3NQVA 1B4KA 1MQPA 3MLWH 1UWGL 5IY5B 1DXFA 2WZ0A 5E1AA 3IPWA 3T77A 3LCGA 1JRCA 2GHWB 4PJHF 4HJIA 1JJKA 3K13A 1GGTA 5FEBA 4DP5X 2XG9A 3MCLL 3ATYA 1ZJAA 4GAFB 2VDIA 1I8JA 4XPGL 5FR3A 1V6XA 5HYSG 2WOYA 2DQCL 2FQDA 4NI6A 3MFFB 1HSAB 3BKCH 4APQA 4I6KA 4RMRA 4PRTA 3S8WA 3DIDA 4ZFOB 4UT9L 4GAYA 3H2AA 1CLZL 2EDLA 2QEZA 2J8UE 3QMSA 3R1GL 2ZCGA 5EO9B 5E6UB 2DPEA 2Z65C 1AO7E 2WAGA 2ZKWA 5D4YA 5HI5C 3WKPA 1JPEA 1U3ZA 3NG5A 4NXKA 5DHVA 1P6BA 3LAFA 5DEGA 3PL6D 5REQA 2OX5B 1HE8A 1TQWA 5LNWA 3DX3A 1WKEA 1JEZA 4EZMA 4Y19D 5CZTA 4KNTA 2YXMA 1B2YA 4PV9A 5LVEA 3NL2A 2BSSB 1ISYA 3TF4A 3GU2A 3OYXA 4CNUA 1PKOA 4H1LG 4Q97A 1P5BA 4G8GE 2F54E 4L05A 4QLJA 4JN1L 4DQAA 3AIWA 3BVDB 5J12C 3SO3C 1ALDA 3J2PA 2Y6TE 4PRHE 4ZMAT 5GIRA 1QO5A 2IBZX 4IIHA 3NCEB 1MCCA 5C54A 1PCKA 5EZLA 4HJGA 3QFWA 5GZNA 3EH1A 3FH7A 1NM4A 2EZ0C 1Q3NA 1FWCC 4FI8A 1VZIA 4F48A 4XB7A 3SE9L 4H5SB 5EO1A 2K78A 5L8KB 1JDAA 1E0VA 4M1BA 4MNJA 4NN5B 4JO3H 4PB9L 5ITFB 4CCEA 2PCFB 2UZXB 1T7XA 5J3HD 2AQNA 2C3XA 2CHZA 1FP5A 4S3EA 2ERJB 1IQWH 4JM4H 1B4EA 3NFUA 2QULA 5I1KH 2BP5M 3N3TA 5CN1A 3XIMA 5D5MA 1RUSA 2F74A 5HJYA 3A24A 4D7PA 2I9UA 2P0IA 1IIIA 4ZYKB 3S98A 1A5NC 1TV8A 4RDBA 4GG6E 3NM3A 5E8OB 4Q6IC 3BDKA 3E2QA 3VC5A 4RZKA 3GSUA 1ZQ5A 1AFVL 2HJLA 3QDMD 3ZL1A 4XP5H 5DD5L 2NNRA 5TGBA 2V2TA 3SDAA 1FBIH 3CFQA 3WNLA 1RV8A 3R43A 3CFDA 2VNCA 5I19L 1Q90A 3POHA 1U6AH 4JRWA 5HD8D 4PMQA 3A21A 1H0DA 1X5GA 3P4MB 4DXXA 3PGCA 1XICA 3B3DA 4JHAL 4BGLA 1ZHAA 2ZOLA 4RISH 3QNZA 1N8WA 3BJTA 4QE5A 2JB5L 3T6ZA 3K81A 2IAMD 3JTSA 1VFUA 1SFTA 2HJKB 4PJEA 1BXCA 3UZQB 3LN3A 3MCOA 4KCTA 3HKFA 3CC5A 4FTDA 1F5WA 1UHVA 1AFSA 1RL1A 3VFPB 4Z7AA 2V0AA 5FACA 3OC5A 1IBBA 2FLBT 1CDHA 1MH5B 1G4SA 5TQ2H 3OB0K 1WYIA 3BYTA 4GT0A 2VDKB 1KBLA 4PJHB 4LESA 3S4SA 1QPPA 3GXFA 4X6EB 4F7MB 4NJJA 3V75A 2ATAA 3NDOA 1BFVH 3G1XA 2P5EB 1JCJA 4YLBA 3ZTJG 2ZOOA 4PTWA 4GQ9H 4JANB 1GCFA 4RDQG 2QHLA 1E4XI 5L2KB 5E6RB 2ADFL 4HPJA 2OMTB 1RMFH 3F7YB 3SDXA 3N50A 2A6LA 2W61A 1HZHH 4KK8C 1M9WA 3D7PA 1UWYA 2RTTA 1QRQA 3UYRL 4D1IA 4A1RA 2H8PB 1I1AD 2YJLA 4L8DB 1ZSDA 1H5VA 1TVBA 5FI8A 1IGYA 4EE2A 1W5NA 3EDEA 2PYEA 5I26A 3VXMD 5F0MB 2XIQA 5AAWA 2ZYIA 3M0VA 1JCLA 3QQ9C 1OD0A 3IU4H 3QG6B 3MYPA 3RVVD 4P4RA 2ZZ4A 2ARWA 3AWFA 2X4SB 3U5YA 1UXMA 4XZIA 4MKSA 3ULUL 3GIYA 3MOQA 3P93A 5AZ2H 4HHAB 4U2ZA 3II3A 5CC7A 2A3LA 2XN9D 2B2XH 4B7IA 3HIZA 3MMEA 2A3AA 3VFMB 4DVBA 3TNNB 3RG6A 3AFLA 1V7AA 5IB4A 4HHWA 4Y4FD 5HATA 4MWFB 4TNVK 1ZDQA 2ZX9A 4GO9A 3ZPDA 2P1FA 3ZTEA 1LCOA 5AD0A 1VACB 2OL3H 5A3HA 2WZMA 4EI5C 4RPPA 2GJNA 4O2EA 1I7ZB 4MJIE 3UYOD 1BQLH 2P28B 1GVRA 3MANA 1LWIA 5EMMA 4XUGA 2BDNH 3EJZC 1I4FB 1KFKA 1BZ7A 1KN4L 1GR7A 5I1DA 1OM3L 4AX6A 3FEMA 5E6SB 3OKNB 1L6YA 2Y25A 1M9SA 3AXHA 3ARBA 1QBAA 2DZEA 4XCNA 3TX4A 3LNGA 4JW3A 1HINH 3FYYA 1YEFH 3REQA 4S1RL 2BNQD 5J12B 4YHPA 3Q2WA 1H7OA 2HXTA 3B1UA 1KELL 3ESNA 3Q58A 2VDNL 4N1EA 1DR9A 2UXTA 2FVNA 5FFLA 2H32H 1E90A 4CVUA 1MEXL 2XTKA 3CHSA 3HZYB 2H26B 3W1RA 2CLMA 3G6AB 2BVOA 3L68A 2NXGA 3BZEB 2QJIA 3LH2L 4S11A 2COQA 4KJWD 4HPYL 2R1KA 3ALPA 2AMXA 4MPKA 3VD0A 3O07A 3H54A 3K6FA 3CXDL 4AIZA 2J2ZB 1F7BA 4GKNB 1VFBB 3C2VA 3L4ZA 5ILTH 3A22A 3IAPA 5IB5A 4JLRA 4US5A 1FWSA 3HFYA 4NQQA 4GGHA 5KJ4A 4K7PL 5DJYA 2WV8A 1P1VA 4Q8TA 3ECVA 2Y1AA 4Q6IB 5GPRA 4F2FA 1HEZB 1UGKA 2LU7A 4KO6A 1DLFH 2PGWA 2PKDA 4TPRL 2IGFH 1NCNA 1MVFA 4ABUA 5D9SA 1S7SB 1UB6A 3HN8A 1E71M 1NGXB 5T3ZE 3W5MA 2HUHA 1UCTA 3UBXG 4HUNB 4M4RB 5CZVL 2ABBA 3G5ZB 4AMKL 3DX8A 4B15A 1W8OA 4NO0B 5IFPA 4X6FA 2HN7B 2Z27A 2X2JA 1XXXA 2E59A 4HUWB 1OO2A 1Q94A 3QI9D 1W9DM 1KXQE 3VRLF 4JO4L 4F2TA 5C0ND 5D38A 2DH3A 4E68A 3WHXA 5CU5A 2H9AA 1NC4A 5IR1A 3MMWA 2E6FA 4ZMPA 4Z7QF 2Y7GA 2JKAA 2XZQH 2DZTA 3T07A 8XIAA 4J3TA 1ZV2A 4K3HA 4P23C 3WELA 4YHZL 1G0YR 1TZ8A 4TL5A 2UY4A 1K9TA 2ROXA 4HD9A 4NQDA 3TCLA 1GT8A 1F2JA 3WMQA 1H5BC 4N9CA 4IOSD 5JIHA 2K6WA 1N68A 4MCYA 2VQUA 1AE6L 1CWVA 4XTDA 1M6OB 4X22A 2MQGA 1JZ3A 4GAAA 1FYTB 5ACLA 4PJAE 3BC9A 2AV1A 3IKCB 4IRSA 5E6YA 3W01A 5BUGA 4YZFF 5I1CH 2VWTA 1UM6L 1LE5A 1HKFA 2VXQL 2Z6JA 4R2GD 2WZHA 1M3IA 2R8WA 4J4KA 2CBQA 1L9NA 1F6PA 1T4KA 2ZUSA 4X5RA 2Q7YA 3PGDB 4BQCA 4MNLA 3K6SB 3L08A 3NCOA 1W0YT 1SQ7A 1TKWA 1WQ5A 4DNHA 3IE9A 3EOBB 3VI4A 1SW0A 2AFNA 5E6ID 3PZGA 2GHZA 4FI4A 3GFYA 4CMMB 5HMSA 4H20L 1UKSA 3F58L 2FUTA 1LG1A 4P04A 3DHJA 4TULH 3LHAA 3OJMB 3TW9A 3N2CA 4Q8NA 1D5ZB 7PAZA 1X5JA 1R38A 1XLCA 3TV3H 1OFRA 1B0WA 1MCPL 1A2YB 1R5VB 3P77B 2CHNA 2V5TA 3L0NA 3D4CA 3W28A 4GRMA 2VX5A 3L5LA 4YHLH 5F1NB 3B56A 1A6TA 1E43A 3RUBL 3DFQA 1QWHA 2I57A 3N6JA 4ZFZB 1QHPA 2CNZA 3B9KB 5FYLE 1XLJA 3L3KB 2EEAA 2DQGL 1WOAA 2MCMA 3QYSA 2HVBA 2NY0D 2E0PA 1KENH 3VKKA 4OT1H 3PL6A 4YHML 1MRDL 4ZTYA 4QLLA 4LUIA 1AH3A 2QZRA 5G1MA 4OM1L 2E6PA 5TDPA 2VZOA 4A05A 4JG0L 5AW4B 1UG6A 4O52A 1WEJH 4QO1B 3ISWA 5HYJE 4AYSA 4N4YB 1B57A 2WQAA 3D39E 1JR1A 1PJWA 2B9AA 1KACB 5E0FA 1BYOA 4HNLA 5F7UA 5I76A 5IM51 1BLNB 1QSZA 1RLWA 1X6NA 1YYAA 1LUCB 3A0OA 4RDZA 4LUYA 1IKNA 1Y5WA 2OJPA 3WQOA 4PMRA 1LK3H 5AUMB 5C9RA 1L0QA 4YHNA 1EAPA 4IOFC 3VILA 4ZW5A 4IMKC 4Q33A 1TPB1 4NO2A 2XZCH 1KTKE 1HFBA 1DORA 1S5IL 1VSCA 1A4BA 4NS0A 4TQEH 1YEKL 4AYFA 3RMEA 2O6EA 3DRQA 3VIIA 4DQWA 3UAJC 3VRIA 1FA4A 1L8NA 5I00A 1QJWA 3N04A 5ENLA 4LWWA 3VQLA 2R56L 4OZGE 4X6CE 4LVDA 5FYKH 2YBGA 3C2FA 3JUGA 1YA5A 4JB9H 6PTDA 3H42H 2EE6A 4ZE4A 2WWMD 3V0WH 2G96A 3H3KA 5CBBA 2VEMA 1V0MA 3GZPA 1RBOB 4MXWL 3H4WA 3PAOA 2EQDA 4EN3C 3PZUA 1OL0A 3SRDA 4HA0A 4YE0A 1WDPA 2XY2A 3QDMA 4QG9A 4GI8A 1LDCA 2EIKB 1Z0MA 3O3DB 3ZE2F 3SEPA 4R90L 4E42A 5TBOA 3U7WH 1KM3A 1RK0A 4Z7QB 2OTUA 3I9PA 1R33A 4MJ5A 1BVNP 1XIWC 1EO8H 3BISA 4I7WA 4QHPA 1VC4A 2BHFA 5ENWB 2NSOA 3TEUA 5JIIA 2C9AA 4RR4A 3CUFA 4M5YH 2CMRH 3H4HA 1US0A 5CKGA 4IJ3C 5JUEL 2O9OA 1OE3A 1A7RH 2GDQA 3ITXA 3QV9A 1A49A 4X5WB 2YXOA 1K8DA 4HKZB 4AV5A 1DSFL 1HNYA 4YHGA 1TTFA 1SYSA 3S36X 4QRPD 2QUMA 2XPYA 4KK6C 3TFXA 3P9LB 1HXYB 4MA3B 1YHPA 2XFYA 5F7DB 4LIQL 2ITCA 4OFYA 1U58B 1BRLA 2HXAA 5IFAH 3GRBA 1PEWA 1TENA 1KJ2L 4PG9B 1CFBA 4XPBL 4I5UA 1JCNA 4L56A 2QR0A 4YHYB 2Y7MA 1NCAH 2PMQA 4QY8B 2ISFA 4NZ5A 5CFHA 3OPSA 4KV5F 3ME0A 3PWGA 4PP2A 2YARA 3D85B 2ISWA 1HN1A 1WIOA 1O6SB 3WUWG 4AVNA 3MXVH 2KYIA 4A2MA 5B1KA 4G1MA 4M43L 2F8QA 4ZXBA 1PWMA 1JPGB 2BWIA 3FFCB 5D8JL 1CFNB 3CHDA 2N7BA 1HXKA 3FSTA 4JN2A 2FL5A 4DBSA 4BXVA 4BA0A 1X7FA 5LLIC 4WWKB 1ES0A 4PFEA 1NOLA 1W0WA 4NERA 4LUTB 3EDDA 5FC9A 5GRZA 5T1LA 2JLPA 4TQHA 4DP8X 1XZWA 3IDNB 2X70B 2CLVA 1TQCC 1J86A 5L88L 2GBAA 3HPXA 1EJXC 1XLBA 4F92B 4IPNB 2G60L 3IETB 5KSBE 4PVBA 2QJDA 4Q8BA 2J5LC 2GTWB 1VHNA 3AJXA 2G41A 4REQB 1KM4A 2X42A 4PWIA 2QPXA 4S3CA 4NZJA 1TZGL 2WQWA 5CGYD 1TWWA 2XN9A 4PVNA 2R2HB 3CZJA 1DQVA 2TAAA 2DSZA 5EC1B 4KI5F 4ESKA 2YSTA 3I9GL 4O1AA 3ZWTA 5FESA 4UTAH 2VJXA 4QCIA 1YJDL 2LHAA 1ME9A 1R0MA 3MMUA 2G2RA 2PU1A 2X4UA 4YMZA 4E3VA 1LMKA 3P0GB 1D2KA 3ZKQD 2EKCA 2Y2TA 1TCRB 3IVTA 3KXFD 3SY8A 2I26N 3B8WA 3MHZA 2NX5E 4OV5A 4S0SD 3EWBX 1N4XL 4FJZA 4FA7B 5FHAL 4NNXA 3IDMB 2PN5A 1TPWA 1Q9LB 3TBVA 4GMSH 2BNJA 4IKNA 4YSPA 1SEBB 4JL2A 4MKNA 5C08E 4GUOA 1YNTF 4LEOA 5FOOA 4P5MA 3KNBB 4CNOA 3I02A 3ZE0B 4Q4RA 5HAOA 4EPDC 3MRMB 3HE6D 3H9SB 4HT1L 1W0VA 2GVEA 3F05A 4BA8A 1JNLH 3RL1A 4ETYA 3M7WA 4WW2A 5F71A 4JY6B 1R47A 2HUEA 1TUPA 3IN0A 3E6HB 3UC0L 3U30B 3ZE2B 2DKSA 4J35A 4LAKA 3LEYL 1EJVC 1WDWA 2X7LB 1A7PL 4Y1TA 3CQ0A 4D0CB 4UM8B 4E8GA 1XHGA 3VIGA 1R0AH 3P62A 1JHLL 1MCWM 3HRPA 1D3HA 4Z0BH 4I4WA 2P46B 4JM2C 1T2QH 3BHBA 1FA2A 1Q1PA 4EP8C 4ZO8A 3L2NA 5F7LB 1J9RA 1BZOA 1GKPA 3NQKA 1XGQA 4KHTH 5IMKA 3W0WE 9RUBA 4AZUA 1UT2A 5KN5B 1JZJA 1QNQA 5DEZA 5I78A 1RHCA 4E8DA 3NN8A 3VGEA 5LXVA 1JK9A 5FYKD 1QMUA 4EN3B 5AHIA 1A47A 4ICXA 2WXMA 1TPC1 4JTKA 2J78A 4M61B 1OAXL 5DANA 5E2WH 1TU2B 1E6PA 5HMEA 4DN1A 4V2BA 3E2RA 2DMKA 4YXHL 4L29B 4YNYB 5C0BE 1GVYA 4FL4B 1YADA 3C8KA 1VFAA 1Z42A 3CS2A 2XH4A 1P7QB 4Q2ZA 4RXGA 1T3FA 5I8OH 3I50L 3GSXB 1XDLA 3SE3C 3BLEA 4J2XA 2DMBA 3ARGB 5L2JA 1TV7A 3QI9A 2PDQA 4KK9C 1E4WH 1WDQA 4DYKA 1MRFL 3FFOA 4BQ2A 3OB8A 3VJ6A 2PTWA 2CWNA 3FCTA 1MRCH 1EDHA 4H9UA 5L8LB 5CPSA 2XTSA 3CFMA 2JB6A 4XAFA 2VWEE 4HUUB 5GHWH 1BBDL 2PP0A 4I85A 3BT2L 4B0MM 1XZ0B 1EBPA 3BW3A 1ORSB 4U7MA 4Z7UA 4IOSA 5JOFA 1J1XL 3KGSA 3TO2B 1ZB5A 2ANUA 2C13A 4RSYA 5LBSA 1O7VA 3DOSA 1KY7A 3X3FH 1QBBA 5I3KA 3HG4A 3MV9D 1L9QA 4N6QA 3CYJA 3HJZA 4IG2B 4E5XB 3N40P 1CZ8L 1GGBH 3R10A 4N0FA 5LA1A 4UDTA 4RL3A 1TA3A 5HJBA 1I85A 1FI8C 2FGBA 4Z7IA 4FS9A 3OG2A 4JFFE 1JWMB 4KKLD 2A74A 3W75A 4AIEA 3CIXA 1U8KB 2R6OA 3EDKA 4PJCB 4XMWA 1ZGLP 3WS6C 1SOSA 4KWWA 2WLIB 3LN5A 3QXDB 4ANWA 4UTBL 4AYEC 2ZA3A 5GRXG 4X8XA 5CM1A 2CCRA 4OM0H 1MZRA 3O2DL 1OCJA 2YDSA 3ZJAA 2UV8G 4NN7C 4PGEB 4JPKH 2AABH 1KV8A 4PJIF 3UTSE 4DGVL 3K4WA 4GMTH 3FU7B 3IIZA 3L13A 4PRDB 1CLOL 3S1WA 4KXDA 2NUPA 1M04A 2ZVIA 2OELA 2YEQA 4HCRL 4WAFA 3UEZA 5EORL 1MEIA 2DDQL 3B0UX 1B9ZA 4FX5A 1Z3RA 4LK4A 5L7XH 1TPUA 2QUTA 1KLZA 3NR0A 1YNTB 2DWEA 5LGHH 1YDPA 3MQTA 1UASA 4IIDA 3HI5H 4QIRA 2VC9A 4XXCC 1CMOA 1AI1H 2OJZL 3TBSA 3LU2A 5E03A 2Y7EA 4EI6B 1JTTA 1J87A 3NK4A 3BOLA 1Z41A 5F4SA 5BOFA 3MNVB 1YTKA 1SY6L 3PWPD 2PDUA 3NTCH 5JPNA 3FQWB 5FIPA 2Z29A 3S3GA 3WMCA 1P5VB 5JQ6L 3HMXL 2H2SC 4BQBA 4ICMA 1V79A 3M0KA 1CI3M 2C9XA 4Z7VB 4DO6A 5C0JB 1Z44A 3P30H 1Y5VA 5HDWA 1E7VA 2EUZA 2XVGA 3LV3A 4U1NA 4LNYA 3FO9B 3CHFA 4APQD 4FQQA 5D1QC 43CAB 4MTMA 4PTVA 5CINH 5LKYA 2NZIA 4QGCA 1HYSD 1A5BA 3QO0B 3A5VA 4RMWA 4R7DB 1XBDA 1UUSA 4O0ZA 3PHQB 2YCLA 2Z00A 4WCYL 3L7EA 4QX4A 5LYRA 2X4PB 1SN2A 2G4JA 4X98B 3PDDA 1X9UA 2NLIA 3EXJA 1URIA 2HLFD 2C3VB 2JKIS 5DLMH 4PRRA 4JTHA 4XPTL 1B0GB 2YEVB 2ED7A 3FB7B 3C9NB 3V4VB 2CNYA 4PG2C 3C0QA 1IGCL 2VN7A 4XX5A 5J9PA 2FECL 3GDKA 2WVVB 2CKBB 3GSNL 4ZX4A 1IAOB 2GAZB 2L7UA 2WKGA 4FYQA 2VDOB 2KZ1B 1HK6A 2IVFC 1MUJB 4ZSUA 4I1NB 1WAPA 1HQRB 2FR4B 2GUOA 3SKNA 1NCBL 3R4IA 4N2IA 4KKQA 4MMZA 2MTPA 2YBUA 3NZUA 3KXQA 3WTWA 4JQAA 4W8BA 5GZND 4YPJA 4KRTA 2Z9TA 1IC7L 4MD4B 2ITEA 2BVQB 1ED3B 3VNMA 4YHEA 2HPTA 3ENLA 1GJIA 3QFDA 1F3EA 4OLWL 1V6VA 3CUIA 4KQNA 4DF2A 2Y7DA 2W0FA 1KCZA 2B20A 3GNNA 1ZT7A 1NJ9A 3EYOB 4OBSA 1R4XA 2C7FA 4U1LA 2X6MA 4JRYE 4BWUA 3B8TA 2J20A 5J6GA 4JYEA 4XH2B 2ZYRA 3OHXA 2ON3A 4H8WH 4RNIA 3RGVD 1RURH 2ITDA 2CDGB 2CLPA 5EU7E 2Q76A 3FO2A 4Z7WE 4XNQB 2QF7A 2BP8B 1MLCB 1A6VL 1PYWA 2DYPD 5DMIH 2L7JA 3FU6A 3TCTA 3JU2A 3MODH 4DKDC 5DQJB 3T6QC 2X5PA 5ITBL 4OVUA 3UPRA 1X4YA 3RVUC 1XSJA 3UWYA 1OFOA 1ADOA 3EHBD 4BH7B 2N59A 1M6UA 3ZGIA 4A4AA 4HQQL 2J56A 1A5AA 3QPEA 2NSQA 2R24A 3FFSA 3SDAD 3CMOL 3LVTA 2PP1A 3A67H 5FHBL 3KPOB 3LZFH 2CLRB 2BHYA 1NANH 3KPSD 1XXFC 3HVDA 1X1NA 2EDEA 1QPKA 5TPWH 5HHVH 4OH2A 3R8HA 4MS8C 4XB8A 4PJIB 4AXWB 2QJJA 3EPMA 4D9QE 4P2QD 2WW8A 4IXHA 2W94A 3VXUA 2W92A 2VXTL 3L5XL 2OZNA 4P2RA 3ITLA 3FJLA 5CJXC 2EKGA 4RAUA 5EBWB 4YSEA 1WKDA 1KPUB 4C59B 5G2NA 1D7DA 3CZSA 1XF1A 4FMKA 1MREL 4Z2LA 5HDOA 1JXGA 2VXVL 2OJ1A 5MENE 4LGRB 1CD1A 4K39A 2WWKO 3WEAA 1JCXA 5C9JA 2WJ5A 4UV4H 4TF4A 2ZRZA 3QJFB 4XN4A 2Y70A 3S9YA 4L0ZA 3IGXA 5DHYA 3HBZA 3HV8A 1BFNA 4M6ML 3PFQA 2Z1WA 4NN7B 1EXPA 2ONEA 5LGZA 1IZKA 2JIXA 3BZ5A 6FABH 3MRLB 5BXFA 1P9MA 4IS6B 3EOLA 1HOEA 3MP5A 4OJDH 3RCNA 2PTZA 1OAKH 4HFWA 3TO4B 2X0WA 2ZA1A 4MDOA 4GXFA 2F38A 3OQEA 1XCQB 3FQRB 3BIKB 3LPOA 2XWDA 2OR9L 3GBNL 4M62H 2QKFA 1I9RH 2PDHA 3S8FB 2B77A 1P1ZB 3WLIA 3ZHLA 4UQEA 3TPUA 1TCDA 5LA0A 4OF8A 4ZTOL 3E9TA 3LMZA 1RHHA 3GIVA 3KXFA 2FWLB 5I15L 2RJGA 1I7TA 2VFDA 2E7BA 4JICA 4WJ5B 3M88A 5DJCA 3OPUA 1HCVA 5LAXB 3M0JA 2NDGA 5BW7C 3EADA 1KC5H 2VC2H 1JXDA 3KLLA 5HJGA 4E9TA 1ZHLB 3V5HB 3S4SG 1PS9A 1E28B 2PYED 2D22A 2CBIA 4QRFA 1GC1L 1UM4L 4K5LA 1AQKL 4R96A 4FG0A 4CSTA 1SFHA 2HRGA 3HE6A 5DZOA 1VIWA 1JERA 5DUBB 2PLTA 4PCNA 2PUZA 3C2EA 4PY7B 4Z2IA 2WM0A 1GGIH 4H9TA 5I2IB 2ZZ2A 1OGTA 4YWIA 1X7IA 3TH6A 1A6WL 3RIFF 2Z8WC 3BVJA 1DBJL 2VGGA 3MRBB 4XP4L 2XTLA 1TJ1A 2WGNB 3KPLA 4E0RB 3D09A 1JIBA 1FGNH 1WDDA 1WD8A 5TJWK 3OEXA 4Z7NF 2PDYA 4Q58C 1F6YA 4W9EC 2A0LD 35C8L 1VEPA 1S7WA 5H35B 3IYLW 3DUSA 1G4TA 3IFPB 1QI3A 3KGTA 4FTVB 1PG7L 3ECUA 3WEXB 5GNXA 2R39A 3CFTA 4NN5C 3AQUA 3U25A 4BFEA 1LJYA 4KF1A 2X6AA 2OXNA 5TH2B 4U6YA 5C2GA 3T3MF 1IEBB 5FFGA 5D7IE 2CZDA 2LABA 4C83B 3FQ2A 1KCXA 1XSIA 2UZPA 4NQXB 1F6LL 1QTPA 2NQJA 3C2RA 5F96L 4LNCA 4X9HA 3ESVF 3CH9A 2BIQA 2VN4A 1LQ2A 1T7ZA 1OXYA 4P57B 1UR3M 5HWNA 1KYOJ 1A50A 3EBVA 4DHGA 1U41A 4WRHA 1ACYL 3AREC 3LDVA 5T5NG 3CDFA 3TN4A 1U4EA 3GXIA 5EC2B 4GZ7A 2F53E 3GK8H 3FN9A 3QDHA 1WIPA 1N8IA 2W0LA 2H6RA 3FB5A 4XZWA 4OKVA 1OVDA 2EXYC 5HHMB 4PTTB 4LAZA 1KB5A 5FECA 2JALA 4GQRA 3N15A 2W27A 3LIZA 3OOQA 5FCUL 4K3ZA 5KETA 1RZKH 4LBUA 3RJDA 4F7TA 5LBVA 2X7WA 4QS5A 1ICSA 1V3IA 3H3PH 1IGTA 2CLZA 4MNQB 1BXBA 3NQGA 1IAIM 3FTSA 3VH8B 3LQAC 2R51A 1HI6A 1MHCA 3WQFA 5E2UL 2RDWA 4CL7A 3MLXH 4UQDA 3RJOA 4Q6XA 1VF8A 3V8OA 4M48L 4IL0A 3RVWC 3UROR 1HZLA 2J1XA 1QHQA 5IJKC 1RUML 3IJSB 1X1ZA 3QZMA 1QW8A 5E1HB 1MAKA 4P59L 4J3XA 1F74A 1ZLUH 3EO0A 3W1LA 1H49A 2PO6A 2GL5A 4K37A 5D7SH 1SJCA 1MCOL 3LKSA 5LDSA 3V7MA 2FZDA 3M1CA 1FVEA 1XI3A 2B7PA 1RIHL 4YVPA 3FCGA 4ZSOB 1FCBA 3IU3A 1NZRA 1YEEL 3H2PA 1NGPL 2QKIA 3RWCB 4LU5L 3VD3A 1E3FA 3BKYH 4QRAA 3WQWA 5AB0A 3O63A 4JRFA 1K2DA 3C87A 4MZRA 3QNXA 3D2UA 3OGCA 5KS9B 2VLJB 5E2TH 5IW6B 2D7PA 6CGTA 1IC5H 1W72A 4HALA 3PY2A 1L7TH 1FJ1B 3MR9A 5EUOA 5L6YH 3RP1A 1BYPA 5EA0L 1KCWA 1IGSA 5CHNB 1FNAA 1XGRB 4XBGA 3PWPA 4MD0B 2XXMB 4D8ZA 3MO1A 2Z2UA 1XD1A 1GKEA 2EC9U 2VQ1B 3R0UA 2OT1A 7A3HA 1I1YB 1WFUA 3BESR 2HS6A 1K5NB 4FYSA 5JIKA 3AXKA 3RLUA 1RA0A 1HSBB 3K0YA 3O8XD 2BX7A 2VEFA 2BS71 1DWIM 1ACCA 2E5BA 3KPTA 4HVXA 4AC1X 5DRIA 3L3GB 4UZSA 1FG9C 5DQ9A 3QRHA 3N44F 1XGDA 2MOQA 4FFTA 4U1JB 3V0GA 5BVJB 4PJBF 3GDMA 2JGYA 3RPDA 1N6QL 5DCDA 3OG4B 1RUQH 2G2PA 3ZDXB 3VFRA 2C6QA 3WBDA 2E68A 3I74A 4JDZA 4A38A 5EH1A 2GJXA 4MWAC 1YDNA 2D2HA 1E4XH 4WKFA 2QFRA 1XF5B 2C18A 2VQTA 1E4HA 4NZ4A 3M8OH 4LLQB 1JOIA 2P1YA 4RGNB 2IQDA 1DVYA 1SLWA 1RCYA 2P44B 2APXA 3CV6A 2CG9X 3JVGC 3JV5A 5D30A 4OQTA 3GXTA 3FOMB 1IBHA 2IKJA 4LOEA 4Y8FA 4I5RA 3BD4A 5G2IA 4ZMGA 1LL6A 4I9TA 4YWSA 4ENED 3MW7A 3D3VA 4G80A 4V1XA 5B4MD 1H3GA 1A0QL 4A21A 3AAMA 2INFA 2PWUA 2QS8A 3SGUA 1B4JH 1UOKA 4HKBB 2VW4A 3RGVA 1D2OA 3FB8B 5EFDA 4A8NA 3FAWA 2HH0L 2P5WD 4ZMOA 3EGXB 4AG4H 4GZIA 3FOLA 5JHBA 1U8NB 3ATDA 2DYPA 3LXUX 4L4TE 4M7LT 4AISA 4LF3A 5FF7A 3OPZH 3G1YA 1UJPA 1TTUA 2X87A 2EUXA 1U3JA 4LFHD 3ZTCC 1DQLH 3PJWA 2VITA 3P8IA 4UMCA 5J04A 3AREB 2DZAA 3ZS4A 5T8GA 4TQTA 3PQYE 3T0CA 3WD2A 3VKCA 4LLYA 3DX7B 1NSNH 1KT2B 2IKGA 3MDWA 2P0OA 1IQDA 5HNTA 5C8JA 1A7NH 5LIWX 3ULVF 1QUPA 3KPSA 1BZQK 2VFHA 1BQCA 3EO9L 3BYYA 2HZGA 3PJTA 4PTNA 2DSWA 1JD9A 5MERB 4G7VL 2WBWB 3WH6A 4ZUVA 4P2QA 4NP9A 1KCUH 3DGGB 3ETBJ 4N22A 1IJNA 1O95A 4XP6L 3CIVA 3QXVA 5IESL 4ZUSB 2X2HA 2EPMX 5DYOA 4FPSA 4YPGA 5EMJA 3PNWB 3QEHB 4AHQA 4YO0B 2XGIA 5LBSH 3NMEA 3IRPX 5CPMA 2DUAA 4OKDA 1QO3A 1UYWL 3RWHA 4OFYD 2V17L 5I3FA 2CCWA 2BY2A 1ZANH 2B1HH 4PGBA 4HSCX 4F24A 3FK4A 1OC5A 4QFUA 3KR3H 4GI9A 3UJSA 1I45A 2XFFA 5L4MA 1WYJA 4EANA 3D06A 2Z0BA 5F1VA 5DCEA 4TSCH 4MHBA 5CILL 4C56E 3NZHL 2KI6A 4F8TA 2J62A 1UB5B 5I82A 4M5TA 3KPQA 4JEQA 2VI0A 4LSUH 3GWJA 2WINA 3CN1A 4IQDA 4R7VA 3DEQA 5GS0C 3CFCL 4ZXBD 2JTDA 1R34A 4YAQB 3B34A 4PTMA 5IQMA 4JZOA 1XMEB 1ZOXA 1YYCA 4YDIH 3G22A 2ZNXA 3X1BA 4YFEA 2QLYA 3CVIH 4GC4A 2WO5A 5B39A 1HOCB 1MQKH 5IZ7A 2PU0A 2W91A 2FHFA 3EH5B 4PJBB 3H6AA 3WTVA 5D6DC 2H3NB 1QSFA 1XFPA 3N1MC 1OCQA 1E8WA 1KIQB 5M5DA 4J3ZA 5T1LD 3U9PH 1FRBA 4EPSA 2NRDA 3G18A 4Q22A 1TTRA 2V69A 1Q72H 1I9JL 4UBDD 1I0DA 5SWQA 2R1NA 4EVNA 3OHMB 1C8YA 2DQHH 4LTSA 4M6QA 4KKAC 3B9KC 4L61A 3KAOA 1MFCH 3KHOA 3AXIA 2AGTA 2NQCA 1I1FA 2V81A 1CIUA 4MZ1A 4MY9A 3PFUA 1NDVA 1G7IB 3L54A 4G5ZH 2ENQA 1DEEA 5IFTA 4JKPH 2OJEA 5DJAA 3KJ6H 2FX7H 3PF3A 4W8LA 1XBVA 1F8MA 4GVHA 4PHZA 1J05B 3GG8A 1FP9A 4CADA 1NL0H 4QSFA 4JPWH 2UY6B 3TYZA 1YXYA 4OUIA 4U6XA 1L9OA 1CDGA 1P0KA 2VGBA 3KVMA 2EDJA 1B6UA 2WV3A 1ZTXE 5F6HI 1TX0A 4G2DA 5TAOA 3K72B 2VELA 3SDDD 3GD1C 4B9KC 3HS8A 5C3IA 5DJ2B 2XNAA 2K0RA 3QVQA 3DETC 2I5YH 4AIXA 4IEFB 4H2HA 3QTPA 4HMNA 2WQVA 4MWAB 1Z5LA 2WLLB 3S46A 2WBJC 2A2IA 2VR6A 1AY1L 2NZ9C 2VEKA 1UD8A 4W81A 4X42A 4Z8FL 4L8SC 5KBMA 3RIAK 2MQ0A 4Y9AA 4KAQH 3L6FA 4M6NH 5D2LA 1HUVA 4N8UA 2PAJA 4E41A 2OX4A 3MRGA 4BJHA 4QGYA 1TV3A 2FO8A 4IZGA 4QEHA 3QHFL 3MI6A 1CL7I 1F11A 3UTZB 3DESA 1LO5B 1DVJA 4EXKA 4Q7BA 3WOVA 2HA1A 1NMBL 2YS4A 4HX1B 3WQEA 2DIKA 4URTB 3T4YB 2BP0A 1RJYB 3UFYA 5TTRA 1K4HA 3R13A 2PWFA 4KTEL 3UZZA 4AYDC 3R89A 4TNWK 4XP9L 1HJSA 4NYLA 4S2BA 1BQGA 3M17A 3ROLA 4L37A 1Q7ZA 2PP3A 3M45A 3SKOB 2HVKB 2JF1A 5GGRA 1R46A 3W1XA 5HP5A 3L9RB 5EU4B 3GTTA 3R1ZA 4WCJA 4X9BA 3L81A 2PR4L 1VPXA 2OSLA 4PC8A 2HKFL 9CGTA 4LAOA 5BNXD 3AVEA 3E5BA 3BQVA 4BINA 1L6GA 1KTJA 4AWTA 5I6KA 1BECA 2R4RH 4W4OA 4FXKA 1P7KB 3ZIYA 1EB3A 2QR6A 4Y2DD 2ZRVA 3H26A 2RH9A 4AQZA 3L2LA 4G83A 1A4KA 1EX1A 3LCFA 3OAUL 4YHYC 1KYOK 3NRPA 1TNMA 5F8QC 4LLDB 4A7SA 4G70B 3QB7C 4BK5A 5FCZA 1AC6A 1KFWA 3F12A 1JYWA 1K6QH 3K2UH 4A2SA 4RZ4A 1AD0B 5D71H 4U3SA 3ZU8A 3W37A 1XWYA 2NXYC 3ZZLA 3W07A 4MSWA 2BBFA 4XMLH 1CR9H 1JQVA 1NDYA 4KK5D 4XD4A 3GU1A 3O16A 1JGUH 1F4XH 3W1QA 1QPQA 3ASWA 1EFXB 2IFFL 4X8JB 4DSYA 5C2UB 3W25A 4JQIL 3W2MA 1EO5A 1GQJA 3BG5A 2BOLA 3MRDA 1JDFA 4WWKC 3NDZA 5HR6A 4ZAKA 3D0LB 5AVTB 5C2BH 1X6UA 1ADSA 1LQ0A 2G3FA 1YY8B 5GZOD 3UIYA 4JCLA 3LSOB 1ZLUK 2YIHA 5F7HA 1W32A 1VCAA 1KIPA 2Z35A 1WJ3A 3UP6A 2YZRA 5FKAB 3BRGC 4JAWA 4WDXA 3Q05A 5DEFB 3ZHKA 3VKDA 4HZ7A 2V67A 3W9EB 3PPHA 5ECJE 2CUMA 3VKAA 2FDBP 2CDEB 2V7NA 3TIEA 4AM0A 2PWEA 3FH8A 2WMPB 1ETB1 4W6XB 1NLBL 1EJ6A 3TJXA 3R4RA 4NAJA 3WF2A 3O8XA 5HQMA 1IWPA 3RUGA 2AJVH 4D1JA 3VG0L 3T0WA 5FO7B 1T6VN 4W4QA 4M5ZH 3U36A 3T6XA 4YBHA 3ARFB 3DXAA 2XQ0A 3HCVA 5HHNB 4NAQA 2K6ZA 3S6DA 4JNMA 2XU9A 1H50A 2CE6A 1ILUA 3DV4A 4NO3B 5IB1B 3SSZA 1GSKA 3ZKMD 3GAYA 4MFEA 3S6CA 1N59B 1Z66A 4LQ1A 2HRHA 4DGYH 5EKYA 5I1IL 4CCZA 5KW9H 5INCA 4B96A 4J4PC 1VYSX 1T22A 2BO0A 1FTXA 1X8CA 3H6JA 4HEPG 1DHKA 3MZNA 5LGXA 5DS8A 5AVRB 1WCBB 1KXVC 2ZXDA 3FUMA 4QXUH 3CFEB 3ECBA 1GVFA 4WU7B 2MEJB 3DX9A 4D6CA 1O75A 5B1JC 1SYVB 4GYFA 3U30C 5IEKB 3BAEL 3QIBD 4Y5YA 4C55A 3DCPA 1JPTH 4HA3A 2J4WH 2WBJB 3LBMA 1AR1D 4KTDH 4RAVB 4L8SB 1NGQH 3W7QA 1SOKA 1PHQA 4C6IA 4B5SA 5DUPL 3TYCA 4CC4C 2QCDB 3NDYE 2W60B 4AZ8A 2P5WA 5MHSE 1D5MB 2PLMA 1CEOA 5I66A 3RNQB 1I31A 3WK3A 1DJGA 5D2NA 1R86A 2EYTB 1W5OA 2WB5A 2JQZA 3IDGB 3PPEA 2X89D 1EGZA 1FL5B 3BARA 1RVFH 3OAWA 5CCJA 4WXZA 5EIIB 2V8LA 1BYCA 1KV3A 1R5WA 4A29A 4QRRB 4D3CH 4IP4A 5LB1A 4FQIH 3QULB 3F5WA 3VXRE 1T1YB 1FCUA 3HBLA 1YAZA 1LRNA 3S9DB 4EXBA 4FOJA 4DRSA 2AQ3A 3EFOA 4FL4C 1S9YB 3OVPA 5CP3A 3MJYA 5AY7A 4FP8L 2IBGA 3W7OA 4IXXA 2B59A 1GAFL 1PMYA 2FZMA 3QP3A 5DXXA 3ARGC 4LMQE 3W29A 4IQHA 4HH9B 4XZLX 4WNQA 3U7VA 1E6QM 3N12A 3QEGH 4OD2B 1XH3A 3DBNA 3VIFA 5MEQA 3MWCA 5BRZB 5B38B 2P45B 4B5NA 5ADOH 4QTIH 2VDRH 4BI5A 3VAEA 4PTUB 3KL3A 3PJXA 2DMCA 1KB5H 2QJNA 1DUYA 5DD1H 3XINA 4ZMYA 2DTMH 4WEBL 3LIZH 1ZY9A 2XA8L 2H1XA 1OX5A 3C61A 4NSKB 4OGYH 4QRUB 2J7CA 2R1XA 5CAKA 1BJ1J 4ILDA 4UMSA 4OBTA 5KYUA 3R06A 4AMXA 2VFIA 4XAWH 4LO9A 3DC0A 3W27A 1XLKA 2XV2A 2ZOWA 3WXWH 3O3AA 3E8UL 1WT5A 4DZ8A 1R7AA 2IADB 3P80A 2OM5A 3WFCL 3W3BA 2GGGA 1BJ1H 4BIKA 3KTSA 2J21A 3RY6A 5F9JA 4NNYB 1NBZA 3QJRB 4BSVA 1ORQB 2NXYB 3NSCA 3P11L 1U8MB 4NCDA 2C1IA 4MVBD 4OUUA 4PR5B 3M1BB 5K39B 4B4FA 3FT4B 4TXEA 1HQ4A 3GHEL 1XAUA 4DZBA 2BNRD 2J1KA 4B3KA 4XVSL 3DHMA 3UZVB 3B8SA 3OGRA 1FH5L 3BUDA 3VXUD 4GW4A 3U8GA 4OB5L 2PPFA 1MCLA 1UXLA 4HWNA 4KI5C 4P2RD 3S3JA 3ZLQC 1RZ8B 5LQBL 5IQ9A 2EJAA 2HZHA 4HNNA 1MHEA 3TLQA 4HJSA 1M41A 4S1FA 4ANKA 4H26B 2WVTA 2HLAA 4F7PB 2IQ9H 2E5CA 2LFEA 1L9RA 3R6IA 4JG9A 1IGJB 2EH8H 1AP2B 2IWGA 2P8PB 4G7FA 3RF9A 4LEEA 2R0KL 3HPAA 2CHDA 4X4ZA 5LA2A 4WFGD 1LOQA 2R9RA 2RR3A 1IAIH 1W72H 3VRJB 5FKPA 3W53A 3CD4A 2R83A 2JIXD 1WUFA 1OCBA 3WNJA 1WG3A 5H4ZA 3NOEA 3NQEA 3QH2A 1AJ0A 2YKLH 2K4WA 2F1BA 2NY5C 1T1XB 5K9KB 5K93A 4ZW3A 1MCEA 1XGUA 3ZHDA 1HDMB 1EHLH 1QK0A 2ORBH 4W7VA 4TO8A 5CGTA 1L3NA 1QT1A 2DSVA 4QRSB 4EPEC 2ZE0A 3EGDB 5M1TA 4BQ6A 4X6DF 4AW7A 4JUTA 3WUBA 1J8SA 1UFUA 3JZEA 4QISA 3NNTA 4EF8A 3N40F 4HISA 2WQXA 5EUKB 1H9DA 4CNTA 3AJ7A 4B90A 3SDDA 2YD1A 1QLEL 5J1SC 1ND0A 4TNVF 1ZHBB 3NSJA 3FRUA 4Y1AB 2W9EH 4PS7A 4XN5A 3LNPA 4M1DH 4AVOA 4KX8A 1VD6A 2W1NA 2V8ZA 4PJCE 4V28A 3EIFA 1F4WH 1IM3A 1E1EA 2H1PH 3LRSA 1UJ3B 2CR0A 4LOCA 5DHVH 1RK7A 1ROCA 1YPZF 1EIXA 3UQNA 3MV8E 2DEPA 1DBML 3N1GC 4MAYB 3H12A 1MUWA 1RZFH 1IXPA 3CLEH 5C7XH 2XWRA 2PGRA 4H8VA 5ID1B 2IXQB 3DJ9A 4U3HA 1PZCA 2HWZH 3L3JA 2BHUA 2C4XA 3BWUF 5E51A 3N4AA 4PD4J 5BOJA 3QTGA 4APXB 1S3KH 3FKRA 2PBGA 1BSIA 3AY4A 1UM5L 3SSGA 4R3SB 4M6PA 2VR8A 4H0HB 2G3MA 4Y5VB 2Y62A 3T2LA 1QHOA 4X7TB 1NJJA 3OKLB 4OQTH 3QC6X 3VSUA 4UM9B 1U3NA 4P5TC 2CM5A 4KDTC 4QCFA 3KWTA 1H15A 5K1JA 1H3UA 4GO8A 3NUKA 4V1DB 1OC6A 5KBPA 1U1JA 4FXSA 2DT3A 2ZP9A 1SN5A 5F1IA 5AB9A 2BSLA 1KLFB 4JFYB 3MRKB 3RA7H 1RR2A 1UCWA 1S5TA 2WXPA 1A22B 2V6HA 2O61B 2FFIA 4C7DA 5A6LA 3E0GA 2ATPB 4UYPA 2O9RA 3HE7B 3R8BB 1H63A 4Z7VE 5CR8A 1ZENA 3UJTH 2JKSA 3T2OA 2YD2A 2WN3A 4U05A 4N1HB 1A7OH 4DZAA 5JIDA 2A3CA 4BWTA 3QJQB 3D4GA 5H2BA 4FKEA 3QIWA 2OB3A 3WFBH 4FEIA 3UPAA 3QUZD 4Y2DA 3P69A 2Q6WA 1NDGB 5HDLA 4UOQA 3CL6A 2LLNA 4JFHD 4P2YA 4A8IA 1UJTA 3IFOA 4IBTA 3KVDD 1W56A 2BGSA 1TRIA 1BEUA 3V52H 2AAMA 1IAII 1FPTH 3IK4A 4NIKB 4LCQA 3QJUB 1KYAA 2A83A 2Z4TA 3GX9A 4QQUA 4HWEL 4UINH 3O6CA 3T55A 5D6CB 3EO1B 2YQBA 2DI9A 1Q1JH 4GFXA 2NYYD 2IPUG 3MO4A 3SIKA 4HLZH 1G6RB 4G6ML 5EYWA 1QPRA 5DD6B 1WGOA 2GKIA 1RQHA 3L5AA 3P73B 4XMPL 3MUGA 3TJEH 1YPFA 4RDQF 5K59E 1TVHA 3QQDA 3WE6A 1V6UA 3QDGD 4U4IA 4OZIE 2E47A 3LYEA 2CBJA 1CFSA 2YSSB 1SLXA 3SOTA 4BELD 4M0XA 3SYQA 4BQ8A 3VW3H 4M6AA 4U5IA 4PS4H 4LPYA 4NM8L 2KZHA 3NOIA 3TBYB 5GZOA 3S4TA 4ODSH 4EO5A 3D34A 4Q9RL 1EEYA 1YNKL 2GIMA 3BW9A 2Z8VC 3A64A 1UH3A 4X4XB 1GMEA 4GH7B 3QIUA 3GTVA 3PF2A 4F7CA 4HIJB 1ESWA 4UTKA 1WFIA 1AGEA 3KCPB 4NKMB 1T5XB 5HQEA 4LEXH 4NQEA 5D2YA 1B4TA 4P0DA 4JX6A 3F04A 2IXUA 3GAKA 4X6DB 2OODA 2PO6D 2SFPA 3BV7A 4YCPA 1ZS8A 3SY0A 3BLIA 4WEEA 5AW5B 4I18C 2HEJA 3HO8A 4PJGF 1I3RA 4OOUA 3VDGA 3C5JB 4CUCA 4YJ5A 3FTXA 4I3SL 5HHQA 3TO4C 4FADA 1JYVA 3W88A 2IWKA 1KYUA 5ICYA 1AZBA 4DIAA 5DXYA 5SX5H 1AIZA 1ZGLB 3HB9A 3RE0A 1N64H 2JJTC 4TUJB 4MJ4A 4NJ9L 3D2UD 3W9DB 2G0KA 2ISVA 1TSHA 1LDPL 1YPZB 1E6OL 1LO4L 3WHE0 4P2OB 3IJ8A 5LAPA 1NCWL 4E2VA 3NTYA 4CQAA 1O6IA 5CPNA 3E3QC 1KJVA 1EDYA 4OCMC 1S7UB 1MCHA 1UWXH 1W8NA 1MSSA 4JY4A 5I6MA 2VX4A 1LEIB 1GIGL 3U7YL 1FO0A 1SM3H 4Z0XB 3N6QA 1RERA 5EWIL 5DZPA 5HYQB 3MRRB 1RK6A 3O81A 4OD1L 4RFNB 1T20A 2F15A 3VFTB 1CTNA 3BVWA 3TXAA 5K9DA 4WGVB 3CFBB 5IVXA 4DKEL 3TR9A 1IL1A 2DQDL 2X0YA 3QIBA 4Z3HA 5FKYA 3S36H 2HTLD 2JIEA 4UOJA 4UQ3B 3MLRH