3BAXA

N298s variant of human pancreatic alpha-amylase in complex with azide
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 179
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3baxA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3baxA01
1E70M 2XN2A 4GXPA 4LYPA 2ZX9A 1R46A 4FNPA 2JALA 4PSRA 1UD3A 2IXUA 3SCSA 3VIHA 4DUWA 1HT6A 3WD2A 1B3YA 1XYFA 4AW7A 4Z2KA 3WY3A 1LLOA 4MJ4A 3LPGA 5D9NA 4JCLA 1WE5A 3VIKA 1GQIA 4PRWA 1MYRA 4JFVA 3DX1A 4PCTA 4WSKA 4CU7A 1UKTA 4CCDA 1M53A 2JF7A 5CPQA 3DDFA 2D24A 1JZ4A 3CUIA 5F7UA 2XN0A 1VEPA 3GYCA 3H54A 1E40A 4FK9A 2Y4SA 1J01A 3VU2A 1V6UA 4IUGA 4HU8A 4WKHA 4M29A 4Z2LA 3BAXA 4KGLA 3MV11 5DT7A 1UD5A 2ESCA 3CMGA 4HZ7A 2BNJA 4HP5A 1ODZA 3PZGA 3ARSA 4MNJA 2C7FA 1DHKA 3QHMA 5FL1A 2JIWA 1A47A 1E6XM 1XH2A 2PWHA 3TP4A 3VNYA 3SUTA 2D1ZA 4ZENA 1FH9A 1ODUA 4URIA 1MQQA 2F7QA 2WSPA 3WH5A 1GVYA 2O92A 1SYTA 5A8QA 2V3EA 4L4OA 4QAWA 2J8FA 4JL2A 1ITXA 1R87A 2YIHA 5A94A 3M07A 3L4WA 5GNYA 2TAAA 3UCQA 1UR9A 7TAAA 2XSBA 3WUGA 4JFWA 1QI5A 4PTVA 5HNNA 1QVBA 2WHMA 2BHYA 4WK9A 2XYLA 2DT2A 4ACYA 3J7HA 3N13A 4NRRA 4TOQA 1RP8A 4LYRA 4JFUA 3GH7A 4IPNB 1QI4A 3CMJA 4W5ZA 3T2PA 2A3HA 1N82A 4XX6A 4EKJA 1V08A 4M1RA 1ZJBA 1WAWA 2Z1KA 4IISA 4R5EA 1QI3A 1E6PA 1E0VA 4E2OA 3BAIA 1KTBA 4Z2JA 3SUWA 1J0HA 3ZJ8A 3PZNA 4D6DA 5CLTA 2VR5A 3EMQA 2CERA 1CPUA 4WIWA 4PMNA 1R86A 4RL3A 3D4YA 3AZRA 2X2IA 4E4PA 3QR3A 2ZX6A 4PTXA 2X2JA 3AMDA 3M6DA 1OM0A 4PYSA 5BRPA 1V0KA 1WNOA 1J0IA 4UZSA 2X2HA 1B9ZA 4K68A 3WD4A 4YN5A 1TVNA 4Y7EA 4ACZA 1H0IA 1VFUA 1E9LA 3EJQA 1F4AA 1OGGA 3O2LA 4OBRA 3SCNA 4TVCA 3IAPA 3OLEA 3PN8A 3AFBA 2D2OA 2QPUA 4NZJA 1BLIA 1QNOA 1C92A 3ARYA 3L4XA 4AZBA 3EBVA 1WDPA 1T0OA 3DHUA 3VIIA 1CNVA 2ZUNA 1C93A 2VX6A 4PTMA 2YOCA 1PEZA 1AVAA 2J7GA 1ISZA 2GJXA 3WDQA 1SR0A 1TFVA 1E0XA 1E3XA 3DYOA 1HNYA 4DWSD 2J7EA 3ZSTA 4MJ2A 3BVUA 3BVVA 1W9DM 5JBDA 2WMFA 3PZOA 3KLKA 1MFUA 2XWEA 1WZAA 1F4HA 3SCUA 3O9NA 4AMXA 2WKGA 2EPNA 1E6ZA 4W88A 4DWSA 3ZR6A 5HPCA 1K6AA 4UQCA 2BVTA 3N9KA 2WK2A 5BXRA 2AAAA 4C7GA 3RCNA 3K4DA 1QHPA 3GXIA 4LPCA 3WQ8A 4WF7A 2ZX5A 3EYPA 4Z2GA 3KL0A 4E8DA 5EFFA 1SZNA 2VX5A 2X1IA 3IJ7A 5A6AA 3NSXA 1JIBA 2FYVA 5JBEA 3ZT5A 4CCCA 5EFDA 4AZHA 1BF2A 1UD8A 1KXTA 3VM5A 1KGXA 5A2BA 4UTFA 5BXPA 5C8BB 5EMYA 1BYBA 2OYLA 1KQZA 1TZ7A 1UYQA 2YL9A 3CUHA 2EACA 4F9JA 4NZFA 1VBUA 1WZMA 5CLWA 3AS1A 3M7SA 3L4YA 5DT5A 1H41A 1ISXA 2J4GA 5FKYA 1LL4A 5I6SA 3B8SA 5ABHA 1DTUA 3NSMA 1D2KA 2YDRA 3WF0A 5GQBA 4MAVA 2GSJA 3SUVA 3BSGA 2FDMA 1ZJAA 3OZOA 1BYDA 4DUVA 3W4RA 3TTSA 4ZEPA 2VO5A 2WBGA 2VZTA 2WBKA 4W5UA 4JL1A 3BMWA 3W38A 4JKMA 2CBIA 2FH6A 1I75A 1HJWA 4BQ4A 4CD5A 4W84A 4JAWA 2G3MA 5HBFA 3B9EA 1EQCA 2V3DA 3FY1A 1R47A 2GFTA 3K8LA 3WDPP 2D22A 3BLPX 4P7RA 3EJTA 3MU7A 4W86A 1QNRA 5I78A 1C7SA 2WWCA 2UY4A 3VUPA 3NYDA 5ECUA 2CCRA 3T08A 1JL8A 2EO7A 2A3AA 1PAMA 4HOXA 1R75A 2WCAA 2JIEA 4OOZA 2V5DA 3HMCA 5D8ZA 3VDHA 3VVGA 3WL0A 2FGZA 3VIOA 3MUIA 3WMCA 3OB8A 3AROA 3AIEA 3HG2A 1OINA 4D6CA 1Q4NX 2ZICA 3VD5A 3B9DA 1KTCA 5DMYA 5BRQA 3CZEA 2XM2A 4GZJA 1ESWA 5CXPA 2E8ZA 4PEEA 1QNSA 4PMXA 3WENA 2WHJA 1J9YA 4RE2A 4PMUA 2GJPA 3VDBA 2J8GA 1J18A 3SUSA 2ZUSA 2Y2WA 1VFMA 4MNLA 3GDBA 4ACZB 1IT0A 5D8WA 2V5CA 2PBGA 2F1BA 4OBSA 1MW2A 2YDSA 1W3LA 1QI0A 3BUPA 1DEDA 3ALGA 2EABA 1UG6A 1NM9A 1UWUA 2V38A 4UCFA 5E6YA 3AIVA 3AXIA 4HPGA 1HJVA 2O9OA 2VUYA 1FP9A 1ISVA 1VAHA 4KMQA 3THDA 2GJXB 4FNTA 4LYQA 3SCQA 5FD0A 2J74A 3SEPA 2XVLA 1HJQA 1C8YA 3U57A 2BVDA 3HG5A 1HXJA 4U5KA 1O7DC 4AIEA 3D4ZA 1DWJM 2AOSA 2WXDM 4HMDA 2VT0A 1GHRA 2ALWA 1GVIA 2D20A 4UFIA 1OD8A 3F5JA 2BXZA 5DF0A 1DWAM 2VQUA 2OSYA 3WH6A 1KXQA 3BXWA 3MMWA 2CIPA 4GZEA 4A3YA 4PN2A 4WSJA 4HMEA 1BYCA 5A6BD 3W25A 3MMUA 1ISWA 2XUCA 4TVUA 3A22A 2XHYA 8CGTA 4Z2HA 2J7BA 1XC6A 4H2CA 4EE9A 5LA1A 4P7QA 3WQ6A 4YHGA 3K46A 5A6BA 1NARA 2WCGA 3ZQ9A 5AYBA 1PZ2A 3CBWA 4WLCA 4A4AA 4GIAA 1Z32X 3EMZA 2D3LA 1OWQA 3HN3A 2NSXA 3GBEA 3MV01 2QMJA 2VI0A 1JYXA 3L4UA 5E0FA 3VGDA 2F7OA 3WBAA 2VC9A 3TTQA 4D1IA 4UQEA 1ZBWA 4OKDA 5HXMA 3ARWA 3T0BA 2PWDA 2WCSA 2EPLX 1ZS2A 3SCTA 3IANA 4D6GA 4DO4A 3NUKA 3PZTA 4MDOA 1XCXA 5GNZA 3GNPA 3HG3A 4B9ZA 2VRKA 1BHGA 1GNXA 3OLGA 1EDTA 3N15A 4MDPA 3PTQA 3WQWA 1UA3A 4IM4A 3S6TA 2UWFA 4UOJA 3BAWA 2VR4A 3CZNA 4CKQA 3DECA 3WNNA 2E3ZA 4P8XA 2CBUA 4UZUA 4F79A 3RMEA 4ML4A 2PF0A 1V3JA 3H53A 3JUGA 5D9PA 4X9YA 1FHDA 3ARUA 4FMVA 5ABFA 3VIFA 1E56A 3K1DA 2FHCA 3OGRA 3WD0A 1V0MA 1R7OA 2AMGA 3ECQA 1FFQA 4D72A 3WN6A 1Q6FA 3ZSSA 1US3A 5DFAA 6TAAA 1FFRA 1NOUA 3PZIA 4PMVA 3WY1A 2CITA 4FNUA 2W66A 1BYAA 3F5KA 1W9PA 5I24A 2DIEA 1W91A 1B3WA 5A8NA 3LPOA 3WEZA 5EBAA 2D73A 1V3MA 1BFNA 4U31A 4XZBA 1EQPA 2XM1A 3WH8A 3MUY1 2DT0A 1XGZA 3CUFA 2XGBA 1R33A 3W29A 3QOKA 4D6IA 2DDXA 3L4TA 2WHLA 7A3HA 4NRSA 3RIKA 1GOQA 1ECEA 1V3HA 1J11A 4C7DA 3F5LA 1QPKA 3CHEA 3VD4A 2J7FA 2FE0A 2F8QA 3UG3A 3VOCA 2WPGA 4QP0A 5A3HA 2WLYA 3CPUA 4GI8A 1WZKA 4QCEA 3ZR5A 1HVQA 4H8VA 1BGAA 1GQJA 1UD2A 4NX0A 4RE4A 3POHA 3FAWA 4AZ7A 1UKPA 1HP5A 1UD4A 1HL8A 4MADA 4F9DA 5I79A 2X8RA 1QBBA 4HA4A 2WVVA 3G6MA 3ZM8A 4ZE5A 2WB5A 3ZMRA 2MANA 2Y5EA 1C7TA 2O9TA 4EK7A 1J0ZA 4GI6A 3CZKA 2YFNA 3LXCA 2DGAA 3WIJA 3MUAA 1V0NA 4WKFA 1EO7A 2GDUA 3FHAA 3VX1A 1DWFM 3AI0A 3LRLA 1E4MM 5I5RA 4W7UA 1WDSA 1ZL1A 3UEQA 1V03A 3EDKA 1W2PA 1H0GA 3GXMA 1U30A 3BUBA 4MTVA 1HJUA 4LX4A 4S3KA 2NT1A 1UWQA 2EBNA 3VX0A 2OWWA 2J62A 4XUYA 1M7XA 5I2UA 4U3CA 1O7AA 4HZ8A 4J28A 2YA1A 1GOIA 3ARQA 4JFTA 1JD9A 1XRVA 1FOBA 2XVKA 3DX2A 1W3KA 4W89A 4F8XA 5M17A 1G5AA 2XVNA 3GXPA 2VRQA 4HMCA 4NXSA 1J12A 1UWSA 3CO4A 1RP9A 2EQDA 1GOOA 4LGXA 2WANA 3N1AA 1JFXA 2BY3A 4JIEA 5AY7A 1DWHM 2VCAA 2YA0A 2Y8KA 5IHSA 1EGZA 1PX4A 4JZ5A 1UA7A 2WZEA 4E8CA 1V02A 2CBJA 2XFYA 4W7WA 2CPUA 2WW5A 3SUUA 5ABFB 1JYWA 3SCOA 4UOQA 2VL4A 7CGTA 2VURA 2VVSA 1CIUA 1JI2A 1CWYA 1JDDA 2QPSA 3WDIA 1OGSA 4J3XA 5E6ZA 1QNQA 1WKYA 4P8VA 2CETA 5M5DA 4MPKA 3WNLA 4W8AA 4OUEA 5FL0A 1J0KA 3ZJ7A 3DX4A 4FLQA 2ZXQA 1Q6EA 2EXOA 2CKRA 4EAMA 2J47A 3LRKA 3PZUA 4W7VA 2X0HA 4KGJA 3L2MA 5JUVA 3WNMA 2VX4A 1H2JA 1CXHA 2ZIDA 1HX0A 2CESA 4QCFA 2E8YA 1V3LA 5I0DA 3CHCA 3VIGA 5ABEA 4V2XA 2D0HA 2IUZA 2JEQA 3BSHA 4YPJA 1PBGA 2WSKA 1UR4A 1VEMA 4BCEA 2WNWA 1XV8A 1TCMA 4PMQA 1FH7A 3ZT6A 4B15A 3RPMA 1E4LA 5JBFA 4TX8A 3BVXA 4J7RA 3DC0A 3T2OA 1GW1A 4KWUA 1JNEA 2CHNA 3RM4A 4NF7A 3APGA 2W91A 2G3JA 4XB3A 3AYRA 1E55A 3F4VA 1UOKA 4V28A 1W9XA 4CN6A 1ZB5A 2F1AA 1GZJA 5FCZA 2IGTA 5FIPA 3A5VA 3EJRA 2XFRA 2X09A 1HTYA 3VSTA 3UESA 2E9BA 3NIYA 2WMGA 1K9TA 4TXEA 3WF2A 1E0WA 4Q7NA 1WZLA 3NDYA 4AIUA 4HTYA 4CGTA 4QLKA 2DQXA 3VIMA 2XJ7A 1JDAA 4BA0A 1TVPA 4D6EA 3VDCA 1GPFA 2VZSA 3VKKA 5AC4A 3BC9A 3TOPA 4GQRA 4PMOA 1UR8A 4M8UA 1TQVA 3BCDA 2WM0A 2YKKA 3AHVA 4S3JA 1JXKA 3T09A 5LYRA 2WVUA 1KWKA 5FOOA 4W93A 2BHUA 2J79A 3WFZA 2DSZA 3CLWA 4HA1A 1RD6A 4UFLA 1UUQA 3AICA 3WY2A 1UD6A 3ARPA 4P8UA 5AC5A 1K9DA 4PMRA 2OSWA 1L8NA 3GNRA 1IZJA 2WLZA 3GH5A 4WJXA 2DH2A 3VGHA 4AD1A 1B0IA 1QOXA 4CD6A 1JZ7A 1NP2A 3VINA 3UG4A 2XGIA 2GDVA 3II1A 4HA3A 2XVPA 2WZIA 3CUJA 1VJZA 5E09A 1YHTA 2QHAA 2VTFA 1B31A 1LQ0A 4PMZA 3VIPA 1EDGA 4CN4A 4JHOA 1HKIA 2X05A 4DUXA 4ZE4A 3SCWA 1UQYA 4OZOA 1JZ5A 1VEOA 4DM2A 3ZJKA 2RGLA 3D5HA 5BROA 1HJXA 2NW0A 4CU6A 3GH4A 4ATWA 4GQQA 2ZWYA 3I3BA 3BAYA 1FP8A 4AD0A 3SURA 1HP4A 5BXSA 3WQ5A 3CHFA 4H04A 3A21A 3MMDA 3CZSA 3RM9A 4PUEA 1MFVA 2YA2A 1GOMA 2UY3A 3S5YA 2ZWZA 1GUVA 5A6KA 2GK1A 3OLDA 2XTKA 1GOWA 1KBBA 3A4XA 1KCKA 1MXDA 3TTYA 1CGUA 1XCWA 2GJRA 3MKKA 3KL5A 2BVYA 4JCMA 3SIMA 2D0FA 3A6OA 3VD3A 2J7HA 1CLXA 5CPTA 4AYGA 2WVTA 4AMCA 2ZUMA 2OW7A 5BYWA 2ZUTA 1ITCA 3PTKA 3AQUA 1KR1A 3TA9A 4UR9A 3VGEA 1KR0A 4TTUA 3BVTA 1I1WA 3QOMA 2GVYA 3CZJA 1C90A 1E6NA 3DYPA 1QBAA 3FXYA 3WQVA 3IK2A 3POCA 5C70A 2WZHA 2VZVA 4UQAA 1W1VA 3MI6A 1VBRA 2XVGA 1UH4A 1EO5A 4BF7A 3OLIA 4Z2IA 3CZGA 5CSYA 1H49A 1GORA 3S2CA 3GXTA 2CBVA 2J25A 3VGBA 1U2YA 2WKLA 3VNZA 4M82A 3EDFA 4JKKA 1E3ZA 4DWSB 1CYGA 4AZ6A 3ZJ6A 4UQDA 3N12A 4OIFA 4AD2A 1XHGA 3A4AA 1GQKA 1CXKA 1W1TA 4HZ6A 3AHTA 5BWFA 3VD9A 1DP0A 3BVWA 1U33A 4UNIA 1G0CA 2G8ZA 2PWEA 1R7AA 5D9MA 4U2YA 2G4FA 1BVZA 3VM7A 1MW3A 2JEPA 3W81A 2X0YA 1BAGA 4AZCA 4OGZA 3OGVA 4AISA 2BFGA 4NSBA 3VMPA 2XPKA 1OD0A 1W9UA 4CCEA 4FLRA 3H55A 1IZKA 1JGIA 1WDRA 2EPOA 3BAKA 1MQPA 3KLLA 2JF6A 1NWSA 2WMHA 3SCPA 5TD4A 2YJQA 3CH9A 2J7DA 1OIFA 4X0VA 3PZVA 1B3ZA 4P7LA 1H5VA 3W6MA 5A8OA 5I23A 2CYGA 3WDHA 3WMBA 5A69A 1VFFA 4D1JA 1WB0A 1L0PA 1E72M 1TUXA 2X2YA 3WF3A 3AS0A 4QFUA 1CXIA 3WD3A 1C3FA 4CVUA 1UH2A 1PPIA 1C8QA 5A95A 2UY2A 4UOZA 3WNOA 4AC1X 1NWRA 1VF8A 3AS2A 1PZ3A 3EJSA 3S5ZA 1CBGA 1CEOA 5IFTA 3TONA 1BGGA 3NJ3A 2A3EA 2DH3A 2E40A 4Q22A 2VNCA 5IHRA 4AMWA 4QLLA 4GINA 3PHAA 1G1YA 5A6LA 4AZGA 3GNOA 3GTNA 4DO5A 2W4XA 1G9HA 3DX0A 2E0PA 5IDIA 3WQ4A 3EJUA 1H3GA 2ZXAA 1E4IA 4MNKA 3CV5A 3VMOA 2F7RA 5E9AA 5A8MA 4X0NA 3D52A 3WDRA 1BSIA 5HOSA 3ZIZA 2PB1A 8A3HA 4P8WA 2D0GA 3GXNA 2GK1B 2WC4A 5I77A 1Q6CA 1BPLB 4GI9A 2C8NA 5C71A 4UQBA 1OGBA 1JF5A 2GUYA 4GKLA 2F61A 1E4NA 3AISA 1E5JA 1Y7VA 1TE1A 1B2YA 4XV0A 2E9LA 5A6SA 3KL3A 1QNPA 3A23A 3W27A 1EOKA 3VGGA 2DT1A 4N42A 4MNMA 2W67A 3CTTA 1CXLA 5A2CA 4FNSA 1QHZA 2V3FA 5IFPA 1ZBKA 4QDMA 1ISYA 4V27A 3CIVA 2PI6A 2EJ1A 3WMSA 3IJ9A 3WEOA 3AZTA 3VPLA 3PBGA 4D6JA 1MWOA 3PZMA 1XSKA 1JAKA 3L4VA 1LL6A 2OYMA 2ZX7A 1OB0A 4CD7A 2VRJA 1QW8A 4NXKA 3A4WA 3WNPA 3WDJA 4W8LA 3U7VA 1UWIA 5GNXA 2DEPA 1J0YA 4ATDA 2BHZA 5ABGA 1W2VA 2YFOA 5A6JA 2OYKA 3VTRA 3AYSA 4RE3A 4PBGA 3BCFA 1V6VA 4AD5A 4PSPA 1E1FA 1NQ6A 4U5IA 3SCRA 1JZ6A 1GHSA 3D50A 4AZCB 2B31A 3WBEA 2VCBA 1CGXA 3E1F1 3IAQA 1HN1A 3G6LA 2DT3A 2F2HA 4LQ1A 4EANA 5KEZA 3EDJA 2V3GA 3CHDA 4MB5A 4DM1A 3VSUA 1S46A 1C91A 3W28A 3BUIA 2XIBA 4GZIA 4L4PA 3HU7A 1EXPA 2ZX8A 2E9MA 3GXFA 1KGWA 3EDDA 1JYNA 4GO8A 4P7OA 2CEQA 3OA5A 4BZYA 3DX3A 3A24A 2O9PA 5BCAA 2OSXA 3W0KA 3WUEA 4AXNA 2J7CA 4J27A 5BXTA 2VCCA 4U2ZA 1VIWA 5CPSA 1EHAA 1DWIM 4MB4A 2CNCA 1I1XA 1UWTA 3QHNA 3IJ8A 2VOTA 1WO2A 3KWXA 2RGMA 1WDQA 4FLOA 2ZUWA 2G3IA 3AMCA 1G94A 3WH9A 4M24A 1HJSA 1NP0A 3LRMA 1FH8A 3UR7A 1GQLA 4ZFMA 1KWGA 1MW1A 2XSAA 2ZUUA 1KQYA 2ZXBA 3BGAA 1E15A 1KGUA 1M03A 2EAEA 1R85A 1FHLA 2QLYA 1M01A 4IPLA 4BQ5A 1Q6DA 2ZXDA 1UWRA 1GJUA 2Z1SA 4N0RA 1JXJA 1OSEA 3D3AA 1TQTA 1XSJA 2WC7A 2QMKA 1WCGA 1W32A 3PZ9A 3MS8A 2F18A 1JI1A 2VJXA 1PIGA 3AIWA 3AXHA 1WP6A 3CGTA 1VENA 1AMYA 4H8UA 2E4TA 1GONA 4D71A 1QX1A 4H8HA 1V0LA 4DO6A 3AIUA 3WUBA 1MVYA 3T0AA 1EH9A 3LPFA 1AQ0A 1QWNA 1JD7A 1HWWA 2YBUA 2VZUA 4HOWA 3OIHA 4J3TA 1VJSA 4CU8A 2YL5A 1EIBA 5E70A 4YHEA 1RPKA 1XH1A 1QHOA 3THCA 3MSDA 4CVWA 3CC1A 3FHQA 3D51A 1DWGM 1KFWA 2G41A 4JHZA 1X6LA 1AQMA 3LMYA 1LL7A 1O6IA 1V6XA 1MW0A 1TA3A 1CGTA 2FGLA 3RJYA 5D4YA 1UZ1A 3VMNA 3A3HA 5A2AA 1UHVA 3HJEA 5M03A 4NZCA 3WKZA 2DIJA 1YQ2A 4M81A 3ARVA 4OJYA 2OWCA 3VGFA 3KZSA 1W1PA 1EHNA 4AD3A 2J77A 3NDZA 4R27A 3AHZA 3UETA 1XD0A 2VVNA 3W53A 2XWDA 1XSIA 3LX9A 1M04A 5CQ1A 3MANA 3GXDA 1JFHA 4KRUA 2YL8A 2W5FA 5IXEA 1E71M 1NWTA 3NSNA 1SMAA 2WVVB 3FN9A 3UG5A 2WMIA 4U3AA 3QGVA 3ZT7A 4GO9A 1UR0A 4FNQA 3MO4A 4FF5A 2XG9A 3ZOAA 1XD1A 3B9AA 4DWSC 1E73M 3KE0A 1CXFA 3GBDA 2PWGA 5AYIA 1JZ3A 3K8MA 5M3WA 2EPMX 1UH3A 4JFSA 5GPRA 4QLJA 1SMDA 2PC8A 1V6WA 1PX3A 1UKOA 6CGTA 1KBKA 3EJPA 5JIPA 1JNDA 2XIIA 3U5YA 1NOWA 3MUZ1 5EB8A 3BMVA 1OT2A 1BVNP 2F7PA 3FNDA 3W37A 3OZPA 2OWXA 1J10A 4UFHA 1B90A 3W82A 1JF6A 1W3HA 3GZAA 3SCVA 1KB3A 1QI2A 2Q8XA 3MSGA 4W87A 1HF6A 1CENA 1XH0A 4M80A 4ATLA 1OT1A 2PBOA 2DSKA 3LPPA 1IV8A 1PX8A 3OBAA 3NCOA 3VD7A 3UR8A 3WY4A 3RJXA 4TVDA 2BY0A 4AEEA 1OIMA 2Y8VA 1E43A 1HVXA 5DEZA 2IXVA 3M46A 3FAXA 1H4PA 1UR2A 5D9OA 3ARTA 1EOMA 1TQUA 1CTNA 2G3NA 4PTWA 1OBAA 1TQWA 2UY5A 3ZO9A 3AS3A 3GM8A 3VIJA 1AQHA 5A6MA 3VSVA 3I3EA 3LXBA 3N17A 3TTOA 3W24A 1E6SM 1BG9A 1ZBCA 2WMJA 4ZXOA 3VILA 3FW6A 1TR1A 4AD4A 3DHPA 1K9EA 3AZSA 4MB1A 2ZE0A 3ALFA 3DYMA 4AY1A 4J3WA 5E1QA 1HKKA 5CGMA 4WKAA 1ZBVA 1Q6GA 2DSVA 4J3SA 1E6QM 1HIZA 2VQTA 1H1NA 3BUDA 1SFSA 1E6RA 3CZ8A 4UFMA 3HZ3A 5HPOA 1HKMA 2ZOXA 1RH9A 3T0DA 2HVMA 1JG9A 4U33A 1WPCA 2WWDA 2FHBA 1NWUA 4AZIA 3AXXA 5CZKA 1LWHA 3ARXA 1TA3B 4OOUA 2W61A 1W1YA 4AEFA 1P6WA 4HOZA 3BH4A 4MAZA 3IGUA 1ZU8A 2YLLA 3TV8A 5JIWA 2BV9A 2YDQA 4KH2A 5CJ5A 4HPHA 2DSUA 4BQ2A 5CSUA 2FH8A 3AJ7A 2W62A 1VB9A 2BY1A 2VZOA 1PJ9A 1KXHA 5HDRA 3RM8A 1GOKA 1UQZA 3WH7A 3BLBA 4FNRA 4AWEA 5A8PA 1V3KA 3VDAA 3RO8A 3AMKA 1UZ4A 2QV4A 2YBTA 1V02E 4B3KA 3EDEA 4HU0A 4TUFA 3AIBA 4B16A 1BTCA 4P7NA 1TMQA 3WL1A 4H7VA 2BXYA 1JAEA 4H41A 1TG7A 1LG2A 3UERA 1LWJA 2CHOA 2WMIB 2EADA 3PTMA 1US2A 3EMCA 5DO8A 4MB3A 3HG4A 1HKJA 1V6YA 4PMYA 3U7BA 5A1AA 4J3UA 1LG1A 4UQ9A 2JFEX 1EDQA 2YLAA 6A3HA 1HL9A 1QWUA 1MXGA 2OW6A 5LA0A 1W9BM 3LXAA 3AIRA 4AZ5A 2CKSA 4F66A 1K9FA 2W92A 4GPNA 3A47A 2QF8A 3K4AA 1NOFA 5E0CA 2JE8A 3AHXA 1JYVA 3CZLA 4C7FA 2VX7A 3WNKA 2DPEA 3RILA 1JZ2A 5CGTA 2Y24A 2WHKA 2C0HA 4NI3A 4PMDA 1JDCA 3RDKA 1BG4A 1D7FA 3PZQA 3BUQA 4M56A 3O6AA 3BAJA 2EEXA 3KEHA 2HISA 3WEMA 2PWFA 1CLVA 1UKSA 2FHFA 4UFJA 1UKQA 1C8XA 2WC3A 3U5UA 2J75A 1QW9A 3WFLA 1JZ8A 1PS3A 1R34A 2WVSA 3DDGA 1V3IA 4KRTA 1UASA 3W6LA 1LF1A 1EA9C 1W9VA 1CDGA 4JKLA 2BS9A 1B30A 1A3HA 3AOFA 2CXGA 3AMLA 3L2LA 2VMFA 3ARZA 5LA2A 1R8LA 1CXEA 4ZXLA 3ARRA 1CGYA 4BS0A 2J78A 4A3HA 2D23A 4AYSA 2A3BA 3W26A 4BQ3A 1D3CA 2YL6A 1HXKA 3WELA 3N18A 1CECA 4PUDA 1VFOA 1FA2A 3BLKA 4AIOA 2NT0A 2WAGA 3L4ZA 1CGVA 1VRXA 4FLSA 3WD1A 3WSUA 2DSWA 1X6NA 4CD8A 1KCLA 2XFFA 1PIFA 1G01A 3K8KA 2D3NA 9CGTA 3T2QA 4D6FA 1B3VA 4PCSA 4B9YA 2WYSA 3WF1A 4CD4A 2WMKA 3I3DA 4B3LA 1CZ1A 1NH6A 1LJYA 2BY2A 4D6HA 1H11A 5CG0A 2ZUVA 1XYZA 3AHYA 5KZ6A 3AMGA 2A3CA 4W85A 1GJWA 1GCYA 1KXVA 1J0JA 4XZWA 4J3VA 4W8BA 4CUCA 3WF4A 2W63A 3VO0A 4TTGA 1TQSA 2O9RA 2OLHA 1H09A 3OGSA 1B3XA 3AIQA 1OCQA 3QHOA 1MQRA 4LXFA 1B1YA 1UR1A 5I3DA 3WUFA 4TX6A 4UFKA 1BQCA 1E5NA 2EPKX 1E1EA 1CGWA 1X1NA 3N11A 3CUGA 3N04A 3OG2A 4CN1A 1W3JA 2XN1A
chains in the Genus database with same CATH superfamily
3RWFB 3TU9A 1I9JH 2VABB 5ILTH 3CN3A 4Y9GA 4PYHA 4Z2KA 3RX8A 3LPGA 2X87A 1KPRB 2WQXA 1HO4A 5AOJA 4AKOA 3UJFA 2ENJA 1SDDA 3IJSA 2HVKA 2JF7A 2IANA 1QBLH 1PD1A 4Y88A 1T8XA 5FK9B 1TTBA 4Z2LA 2JK5B 3G22A 1AG6A 5F0JB 5E2TH 1I8IB 3EFDL 2VJ0A 3C08L 3N5AA 3W1LA 2XZAH 4YWGH 5EU6A 1URLA 4H6EA 1OFPA 4QG9A 4JL2A 3O6FC 2AKRA 1NF7A 1V7YA 5K9OA 2WLLB 3V9CA 1KB5A 4GKSB 4JFDE 4LPUA 4E9RA 2E74C 5T26A 4OZGE 4RRPM 2DLFH 1RJYB 5FWQA 3TNMB 1QI4A 3QGAC 1KW1A 4D3CH 1N82A 4XX6A 4GKZB 1VCAA 1WAWA 3RJDA 2BNRD 1NFPA 2ZUXA 3BAIA 4E2VA 3W0WD 1C1EH 4WI4A 4Z2JA 4WWKD 1ROCA 3SRDA 3EFFA 3VUSA 4JFPA 3D0VB 4NFDA 5IFAL 1JTTA 5FYKU 3FFSA 1NCCH 4QY8A 1E9LA 1F4AA 3IMBA 1VLWA 1SW0A 43C9A 3WIHL 2IWEA 3LN9A 3L4XA 4YIQB 4XZMX 4S3FA 1FAIH 3ASWA 4LP5A 4IBYA 2V5RA 1W72H 3IJLA 1HNYA 3P9WB 4KX7A 2B0MA 2OS7A 5AW3B 4RRPG 5KZCB 5TGBB 4KTDH 3IMUA 3APDA 3HC0A 5ANMB 4XO9A 3RR4A 4RR4A 2BVTA 2WK2A 3MV8A 2XPGA 3N9GH 1LO4L 4LPCA 2G9HA 4XC3L 4KVNL 3SKOB 1GS6X 4LMQE 4QOKD 4KI5F 1JIBA 2O5NA 3R0DA 4X7TA 2YD2A 4XPBL 2PDMA 1GS8A 4AZHA 4AVIA 3CQQA 2HLAB 5FSDC 4Z78A 1KQZA 1P84K 3VXOA 3RUBL 4Q74A 1MH5A 4YQXH 1IFHL 1I8MB 3DVNA 3RJOA 2VDQL 5AAPA 3FSAA 5D7IA 3LIZH 5M94B 1LL4A 1SZEA 4HEPG 3OAYH 2YUXA 4F33B 1RY8A 4Z1DA 1FFTB 4NYLA 1IJ9A 5F3BA 2E5CA 1ND0B 3O6CA 1L2QA 3IU4L 3H7BA 2ITDB 2EKJA 3W4RA 3TTSA 4W5UA 4JL1A 5HYIA 3P14A 3P54A 2XZCL 4MWFB 3TEVA 3MRGA 5F7DB 4J3OF 1IT8A 5JOFB 1WT5C 3UBHA 1UC4A 4IGMA 4W86A 4DGVL 1C7SA 4I0PB 3EGXB 3WL0A 3VIOA 4DUOA 2MWCA 3O3EA 1EO8L 3P8IA 3QNZA 5BRQA 4O2FA 5CXPA 5F7LB 2X4QB 3QWNA 3EOUA 5LHDA 4JTDA 3DIDA 1AKJB 3GQFA 4U1IB 5DUPL 4JFZL 1VFMA 3R4RA 3WE1A 2X1OA 2PBGA 3BN3B 5HSFA 2EKSB 2ZYIA 4WI6A 5DJ0A 2WBWB 2Q76A 2CLFA 4Z7QB 4L29A 3VG0L 1HJVA 1X5JA 3FL7A 1QEWA 4LYQA 5JH2A 3LGEA 2ZYFA 2Y6TE 3IU3A 4NP7A 4MQXD 3QW9A 3RGVC 5D2NB 3O07A 2QDHA 1DXIA 3TAKA 4UFIA 1WXYA 4WV1B 3MMWA 3HBGA 3OKEB 1LP6A 1JPEA 3USZA 3Q6FA 2F2KA 3ANVA 3NFNA 5I1EH 2DEYX 1K70A 3E2SA 5HJYA 2R4SL 4IIQA 3J27A 4OZGA 5A6BA 2VISB 1NARA 1C5CL 1U95B 1MCDA 1TJ2A 3B0UX 4ZK8A 1PZ2A 1E8YA 1TREA 2G5BA 4C6FA 4PJFE 4GAJL 2QT6A 5DVMA 3W7PA 3HN3A 4OQTL 2ENQA 5E0FA 1T21A 1BX2A 5J57B 1LE9B 1U3JA 3V8CA 4S1RH 2HJLB 1SJMA 1U42A 2PW2B 4OUUB 1VGAA 1IEWA 2WW8A 3PZTA 3THML 3BQUB 3DESA 3R12A 4F7PA 2IPGA 4G8GB 2IPUK 5HDBF 5DRNA 3P9LB 1UA3A 5G5IA 3B3BA 3MC0A 3MOAL 3VFNA 1QUPA 3TH6A 1P7QD 4MAYC 4CKQA 1UQSB 4I18A 2E3ZA 4YR6B 5HDQL 4H88L 2WXMA 1Q2SA 3UJJL 1B4TA 1PQZB 4GW4A 4X9YA 5DI8A 2X1TA 4D94A 2BOCB 4K94H 3CXOA 4U7SA 1ETB1 3S5LB 1FFQA 1GTEA 4N22A 3ZSSA 5L4JA 4TYUA 3W73A 1QAPA 2QCEA 2XG4A 4RNFA 5HYSB 5TF1H 4EOWH 3LPOA 1PL3A 3V0JA 2EH7L 2DT0A 5CLZA 3WBXA 3RIKA 1Q63A 2W9MA 1J11A 4TN9A 3CHEA 3S0CA 1I9IL 3BG5A 2WPGA 4QP0A 2O30A 4GI8A 1OG6A 1PGRB 3EO1A 5ERWB 4QE5A 4JTUA 3H1ZA 2P3YA 4QHUA 1CICD 3GUTA 4IJRA 2HFEB 3ME3A 2Q8LA 5ABDE 4LHQB 2R14A 3KGSA 1S9WA 4QRSB 4PBXA 3B2MA 5E23A 1ZVYA 4LANA 2YXWA 2LW3A 5HDBB 5HWNA 3L7EB 5MI0B 3F4CA 4DAGL 4U1NB 2O6FA 1EJ6A 4JFYB 4OKVA 1G5GA 2Z2BA 5DO2D 4NU7A 43CAB 3ARQA 5CCZA 1IGFL 4JQVC 3HPZA 3PULA 5FM5M 4ELMA 3FO2B 1W0WA 5T9CE 1UWSA 3RB5A 4M0XA 4MOZA 4UT7H 1FC1A 3QXAA 4LVOC 3UZWA 5H94B 3DVIA 3GIQA 3AGVA 1T2QL 2YX0A 5DY3A 3KRBA 3HQPA 1UCTA 5DK0A 3FYYA 2QPEB 4JZ5A 3DI1A 4W7WA 3DO7A 5DRWA 4AK1A 3KBJA 2APBA 2OJ1A 1KTRL 1WZ1H 3CV7A 2GTZB 5D1QD 1UM4H 2EYTB 1R3IL 1ORQA 4Q6IB 4Q8QA 2FJFA 3LD8C 1YUKB 1U8QB 4N1EA 4AUYA 3APYA 5AB2A 2P53A 1XCFA 3PWJA 1E9IA 4LL9A 4AF0B 4PJFA 4PMQA 5IF0B 1GKRA 4NRZB 3PAZA 5JBFA 2A38A 3T2OA 2NLIA 4F57L 1USQA 3UXFA 4NUJB 4OD3L 3U4FA 1B5TA 3RM4A 2YZ5A 3UAJD 4LEOA 5EU3A 3GHUA 4Q4SA 3F4VA 2ZUQC 4V28A 3RO6A 4ZTEA 4CN6A 4AM0A 1Q9WA 5FIPA 3PPHA 5JPNC 5I71B 2HRWA 2FWUA 3V4UH 1L9WA 3AO0A 2DQDL 1KULA 2Z8WC 3LV3B 3DI3B 5T5NF 4OD2A 5AC4A 3SGDI 3D46A 1OM9A 1EEQA 4K23H 3LH2L 2EJAA 2ZZUT 4UMAA 3UH8A 4FQXA 3ZLQC 1IT7A 4PD4K 4EJ1C 4M7LL 2WZPD 3CFCH 5D37A 3BSMA 3TXZA 1A5NC 4QHMB 3BLLA 3V4PL 4WOZA 3IJDA 4JNYA 1CG9B 3P69A 3QH3A 4MJ6B 2XVPA 2BSDA 3MUHL 2B1HL 5E2WH 4NO5B 3VIPA 1S5MA 2CLLA 4L0YA 4B50A 5F4WA 5D55A 1NCDH 5GHWL 3FJTA 1L6SA 3P93A 5CPLA 4KXDA 2DQIL 1IF2A 1GYNA 2X4OB 3B4UA 4JCWA 5MEOA 2CK0H 3FQTB 3CXHJ 3CIXA 4JDZA 3DHMA 1NBZA 1MQKH 4XXCA 3OLDA 1I53A 3PBUA 3GMQB 1CGUA 3MKKA 1W37A 3KL5A 3ZXWA 3SN1A 3IN0A 4APXA 3A6OA 1XZ0B 3QEQB 3PIQA 4JO3H 2IALA 3UXIA 1L5GB 2GK0B 1K03A 3INOA 1ITUA 3CXDL 3H42L 1AZ2A 4RDVA 3ULUC 1IILE 5D70L 1BD2E 3PRZA 3IDGA 4WI2A 3KDOA 4OV6F 3S6DA 1KTLB 4H2HA 3MBXH 1ML0A 3WLOA 3MA7B 4OCRL 1THFD 3KOYA 3P1VA 1BMZA 1WA1X 5T33L 4G9FE 5JW3L 4NVTA 4YNGA 5BWFA 1EX0A 1F11B 1C29A 5BVJA 1FO0L 1A4JB 3LVTA 4XNYL 2JEPA 5C9UA 3OJGA 3HB3D 4YPGA 3KS0J 1EJTC 2CO6B 1J5OL 5F7YC 1I9RH 3EGSA 4F8PA 4O1EA 2JF6A 1FZKB 3D69A 3WCYA 2CLIA 4MCMA 1V27A 2CO4A 3M0MA 1SFTA 1CD0A 3CQJA 3BIAX 3DURB 3L66A 1K4DB 4ZFOL 4QR6A 4HH8A 4CW1B 3GIVA 2VJ8A 5IW3A 3GJEA 3ANUA 3E5PA 3EJSA 2QHLA 2B77A 4HK0B 4L9DA 2A3EA 4Q22A 3C9NB 2NYYC 2NR6A 1WC7B 1A1MB 3SE3A 3DX0A 1KBVA 3E2QA 1AD9A 4YZFF 3CBJB 3FT2B 2F7RA 1ZWIA 1MF2H 1OP5H 4B97A 1MUJB 2DP3A 3AQYA 4PGBB 5KYWB 4ASTA 3O6DA 1FWGC 1JF5A 1OHZA 1ZA6B 1I6NA 1Y7VA 1J8RA 5EY5A 3U9PH 1TE1A 4LBEA 1ZANH 3DTXB 4DZBA 1NDMB 2BNQD 1NIFA 4MNMA 5DDHA 5K59F 4ZMZA 1J9RA 1ADQH 4XAKE 3KBSA 2MHAB 3INUL 1BZ7A 4EN2A 5I1CL 1W0VA 2I85A 4OGXL 2PI6A 4I87A 3ENEA 5HGHB 3BW3A 4L9XA 4HSNA 3RKPA 1ROWA 1XSKA 4EEEA 3IMVA 3L4VA 4LC6A 2OYMA 1BVKA 2E5BA 4N4PA 1RERA 1T89A 4AJYV 4OU1A 4KY1H 4XN4A 3HE6D 3IKCB 3J2PA 2PYFB 4Y16B 3T4YB 3TIEB 1JSYA 5E5UB 3VQLA 3ECVA 2NY4D 3PAVA 1HQRB 4C6DA 3ZHFA 5FW6A 4MA3B 3G6AB 3G6LA 1NC2A 4NO0D 3V9FA 3UR5A 3RCYA 3EDJA 5JPMB 5B39G 1EZWA 4DM1A 5DMNA 4HK6A 5A16B 2D3JA 4M8VA 4IFKB 4GYBA 4LFHG 1LNUA 3GXFA 4PFEA 1OIOA 3N29A 5EC2B 3GZQA 5GVJA 2CEQA 5GGQH 3OA5A 2XIOA 1BOYA 3F12B 1T22A 2VD8A 5SWSD 4PG9A 4FRWA 4JFEB 2C19A 1VIWA 3NOIA 4IIBA 1NGWA 1DWIM 5D1ZA 4B53A 3KHJA 1HHKA 2PTXA 1MIML 3DG7A 3WH9A 1YUHB 1KWGA 1OD9A 1TZIB 1P7KA 4I2XE 3JV5A 1DFBL 4YVUA 1XDJA 1YE4A 3RVTC 5J1AA 1FNGB 2XU2A 2UZIH 4ODSH 3NTCL 5FJOA 3HVNA 1JI1A 5CHNB 3CGTA 3F2DA 1DBAL 3MDWA 2C34A 4H4IA 5A6TC 4BKLA 2VDOH 2ZVIA 1QNIA 1KYOJ 3RKDC 5CJXC 3VCRA 4M3KB 4XB8A 1RVFL 3G1VA 5CZVL 4FQJL 2XWBA 3F6JA 1DJGA 2E76C 3ITOA 2OR7A 1XH1A 5I74B 2GL5A 1T99A 4RIRB 3GI8L 1X6LA 4ADJA 4TULH 4E9YA 4XSMA 3NA9H 5E6SB 4L56A 2Y5TB 4OZHF 2QCDA 4QRPE 3Q5TA 4PJ7E 1UHVA 2F54D 1MWAB 4JTJA 3SGKA 1EYEA 3VGFA 3OOQA 2DD8H 4KROC 4AD3A 32C2A 4R27A 5FF0A 4DKFL 1XISA 4WY0F 4MZ3A 4PJEA 3MODL 1IMHC 1RIVH 5IXEA 1IUZA 2WVVB 2WMIA 4A35A 1P9MA 3HMXH 1SXSA 1G4PA 4N2HA 1CQYA 4Y4KD 1Q0XL 4PLKD 5FB8A 1I2OA 4NC1E 4AI7A 5GPRA 4XBKA 2HTLD 3VKAA 5FKPA 4GRWE 1M4KA 4QJ1A 4MIMA 3ZPDA 1OT2A 4AQ8C 4TUOB 3SRFA 2EC8A 1D5ZA 5GS0L 2LVCA 1NEUA 1OZTG 2MSPA 1T6VN 3LS4H 3P5YA 4G6CA 4G7FA 3GX9A 2OQJB 4XVJL 5HQMA 4H44C 3K1GA 5PTDA 3NCJL 3H23A 1KJVB 3EHBB 3IDIA 2PCPA 3WY4A 4JZJB 3RJXA 2DYPD 4YXKH 1G7UA 1OKEA 5AOUA 4A7VA 3EBAA 1ME9A 1GZHA 5AC8A 4N8UA 3TTOA 5ACLA 2JCCE 4IBSA 2QYGA 1ETZA 3OHXA 3K2GA 3DYMA 4FLHA 4OZHB 2GTQA 2XETA 1LWRA 1MI5E 4PUKA 5F6HJ 2LE9A 4XBJA 4P4KC 3M44A 1QFUH 2HKHL 4HNOA 1H1NA 4O12A 1IZCA 3WSQH 5E4IA 4K5PA 3QYNA 5C08D 5FV1L 1M7IA 3GSNL 1SDAB 4LP8A 3WS3B 3HURA 3IM1A 2PF8A 2N7AA 4MAZA 2BTMA 3O9WB 3L5WA 1IL1A 3D39E 4BE5A 3ATYA 1MJ8H 1VDGA 4JHAL 7XIMA 4NQ1A 4NN7B 1H3WM 4KKLC 3BKCH 3TZVD 1G43A 3DV6B 3LNEA 3LEYL 1A7OH 5I0XA 5IHHA 1N2RB 3BVNA 1A1NB 1NJ9B 4NN6C 4NPYA 1TG7A 1S7QB 3SZKC 2EADA 4IBUA 5ADPL 1US2A 3GKFA 5E8PB 3QZ6A 1V6YA 1YBQA 2O6PA 6A3HA 2YUVA 3O6ML 2OW6A 5LA0A 4PB9L 4GMSL 2DYSB 2NX5D 5BVPH 3ROLA 1LM1A 5E0CA 5EBWB 2JE8A 3AWGA 3AHXA 1JZ2A 1VGEH 2PPEA 5CGTA 5DMGD 3QUXD 2OMTA 3REVB 1SPQA 1T7XA 1XBVA 3P77B 4DGIH 5GGTL 5AAMA 5CN2A 3ELQA 3O3DA 3ITGA 2EDLA 3H2NA 1CLVA 3GVGA 2XTSA 2CUAA 3SRKA 3U5UA 5CP7B 1Q66A 5E00A 4XVTL 1WTGT 3UBPC 4XISA 5IOPA 4BCXA 4JKLA 5D2LF 2P8MA 1ZLVK 4Q52A 4QRPA 3FFCB 5DYOB 1MRAA 4KO6A 4L4TE 3MRIA 4AC7C 4Z17A 3IF1A 3GSOA 1FFOA 2NDGA 4Y9NA 1KCLA 4YSRA 4JY6A 2E28A 3P74A 3PNRB 4PJGE 5IJVB 2DY2A 3S3JA 4GXMA 2CKBH 4JPWL 3Q7JA 4NUGH 2KT6A 3PU7A 3F01A 4J35A 4Q89A 3VVVA 2DDQH 2PDWA 2BY2A 1CK0L 3ZU8A 4X5LA 4U3SB 4IMGA 1PBYA 4LOCA 4TUJB 4XZWA 3TCLB 4CUCA 3Q9PA 3WF4A 1YLBB 4F37K 1JE6A 1WS7A 3MUGA 4G5ZL 3DUUB 4ABUA 1NEZG 2XKSA 2J27A 2C1IA 2BS71 3BZEA 1M7DA 2B08A 2BIHA 3W9ZA 3D48R 3RF9A 2ICWI 3OTRA 2EVGA 3WJYA 4LYPA 3BOLA 3MDUA 2Y89A 2B20A 4I5UA 3WIIL 4YHMH 1ZHNA 4N2LA 5IJBC 3UC2A 2AZAA 2DW7A 1MZZA 2QR0B 5KANI 4K9EL 4NIYE 1UKTA 2DQJH 2HWZH 4CCDA 3AXLB 3O3UN 1XJBA 2WLJA 5CCHE 2JCCA 3N1QC 2C1OA 2Y4SA 1TPUA 3HBQA 2KC0A 4MFHA 2REQB 3LKNA 3HUJF 4ZUVB 1MI5A 5I5JA 1W8GA 2DIKA 4P2QB 4TOYL 2GVEA 3JUYA 5T5FA 4BFEA 6PCYA 2EAWA 3GG0A 4CMHC 3DDMA 4L8DA 3WH5A 1QPOA 4IJ3B 3V5KA 2V17L 5AHEA 35C8H 5A94A 3KPMB 3UCQA 4PRBB 2XSBA 1O5KA 2BHYA 2FBJH 1UOLA 4JR9L 1F3TA 2Q86A 3M0KA 3QDAA 1NBVH 4KF1A 3I85A 3P61A 5C92A 2D7MA 3MN8A 4M61A 2HLFD 4FQCH 2NXIA 4IISA 3VCNA 1ZCOA 5IGXL 2WOYA 4NKCA 5D2YA 3CFDB 2ZCLH 4MA7H 4L8SA 3BDYH 3DETC 3EUDA 2DVTA 3PQYB 5HI5D 4UF7C 2R1YB 2VERN 4LC8A 4RWYH 3QQDB 4FSAA 3QR3A 2ZX6A 1PTAA 2X2HA 5AHMA 1SR9A 2FDBP 2R51A 1SVBA 1VFUA 3QRGH 4YBLB 3SCNA 4LLVA 4QHNA 1CLKA 3STZA 1QZNA 3IETB 2D2OA 1BLIA 2ZPKL 5BRZD 1LDSA 4TX9A 1J8SA 5D93B 5E9DE 1GGTA 2F9BT 4QGTA 3O9NA 3E2RA 3HUJB 3PBVA 4R0LA 3ULVL 1E6ZA 2AK1L 3AG1B 4OE7A 3MRCA 1H3PH 1MRDH 5D2WA 3P81A 5CSZA 4HXAH 2AXFA 5E6UB 4L4TA 1HKLL 3BLIA 2CQVA 1X9QA 3NABH 3SBWC 4H8PA 3OKOA 4Y8DC 4QRQA 5DRXB 3G9VA 4XWGH 4PJGA 3DRTB 5T1KD 4M6UA 3QUZC 1MLCB 1XPYA 2CZVA 4G7VH 4HJGB 5J5DA 4N8CL 3Q0HA 2X88A 4PRIA 3OF6A 4KKNA 4A7QA 1GOFA 1BYDA 1BVWA 2PODA 3GDKA 2H45A 3BMWA 3UNDA 3C8FA 5HR7A 3X1FA 3FS9A 4G1EA 2AGJH 1MREL 1U8OB 3RFZC 2CDFA 5IQOA 2AQOA 2PXYC 5A5WA 1TRIA 2QGDA 3M7OA 1XLGA 4OLUL 4XX5A 1E5UI 3DPDA 4YWSA 2ATPA 1FQ9C 3AROA 1KTCA 5JW4M 2R56H 2Y62A 4PEEA 1QNSA 1XBRA 4WDUA 4NWUL 2GYIA 4ISVA 1SYVB 3E3HA 4KCTA 3SYPA 3MCYA 3S35X 1I3RB 3HPLB 2V5CA 3GMMA 3ES6A 5DMJB 1W3LA 2FNBA 4PP1D 4Y7MA 1P6CA 1G9NL 1NQBA 3I10A 1BWWA 3CVHB 2QSCL 1M2OA 4S1SL 2WNXA 3BP6A 5HYJD 1FZJA 2CLZA 5ESAA 1P5VA 2P5EA 4N8VB 3W9EB 2I9EA 2VW6A 4FXFA 3ZFHA 1P1MA 4XP6H 2ASHA 3WH6A 4PN2A 2BWQA 3MMUA 3EH5B 1PEWA 4N1CA 3VWKA 2H47C 1KNOA 2R1XA 3HI6L 4UT6A 3WK2A 5BU6A 4RMSA 4GQ9L 2LR4A 3WKQA 4NRYB 2CLRB 4DELA 2P5WD 3C5QA 1BZ8A 2JJWA 5FYLE 4AT6A 4M5SA 1OWQA 4PUNA 2QMJA 3RUGE 4QS5A 4C6LA 3V7MA 5BNXD 5TDNA 1LP9E 3C2VA 3H3PL 2IS7A 5C6PB 5I8EA 1ZK5A 3SCTA 3CQFA 2GDQA 4D6GA 3KLDA 5B7FA 1M6UA 4CLMA 4GKOA 1THAA 4R9XA 3VNDA 1GNXA 2X4UA 1GS7A 1MXSA 3BXNA 3MY9A 5AWNL 2NY2C 1KTKE 4YVVA 4FMFA 2A3TA 4ML4A 1PS9A 3WFCL 3A4DA 3LDBC 4F92B 1DIKA 1DLFH 4JBSA 3ZE2F 3EOAA 1GVRA 4D9QE 3MV9B 1ZV9A 4P49A 1F02I 4X0KA 1QNZH 1Q6FA 3NVQA 3QE5A 4HJIA 3MCLL 4LSRL 3EBGA 4HC1A 2QUMA 1A7BA 4FNUA 3SKJH 5I24A 4ZQNA 3LRSB 1B3WA 4GZ7A 4Q8TA 4S39A 1LDCA 3H2PA 4PJ8D 4XNXH 1R3JA 4LB3A 3IDMA 3MUY1 1NCWH 1R33A 4DK6A 1WWWX 1Z2KA 4NM8H 2O5YH 5EU7E 5EORH 4UNTA 2J6VA 1JGLH 1A0EA 4MMYB 3B56A 4REQB 4DOHE 1X5GA 4R96A 5D7JA 3C8KA 3CDFA 2KZ1B 2R9HC 1OLLA 4OF0A 3QIWB 3MRNB 4NZUL 1K6QH 3VRIB 1A7PH 1VADA 2GGHA 4HX1A 3CZKA 1YEKL 5L2KB 3V8OA 1SF3A 1J8VA 5I00A 3PJXA 4XO8A 5TPWH 1ZEAH 4TQEH 5ETUB 3FB7A 3PXLA 4WU7B 3ORJA 3SDDC 3ERXA 3V0VB 4B5EA 3I6LD 1RZIA 4F8XA 3SW6A 4L80A 3OR7A 5T3ZD 3ZE2B 4IW4C 3EOLA 1NDTA 3LMZA 1TQCB 2IQ0A 5ES4B 3IIVA 1FXPA 5C0CE 4F4RA 4JIEA 4XUGA 1BM3H 4QR7A 3IJYB 1EUNA 4TUUA 3I6KB 5IHWA 5EPDA 2NUTB 3TF4A 2PWUA 1A9EA 4YS1A 3SCOA 5DUJA 4HS8H 4JY4A 4CSPA 3SY1A 3WDIA 1WKYA 3FCPA 5KWYC 1S7RB 1NUDA 1RR2A 2Z1XA 4KGJA 3BEVA 3DBNA 1MY7A 3S9IA 2B59B 3VNIA 5DK3A 3WBWA 4GUCA 4PBFA 3ZDYE 5DJ6A 3KXFD 1VEMA 1MLBA 4UI2A 1Z9SA 3X1EA 1Q6QA 4WGXA 3F04A 5FM4A 1U6AL 5EO0A 5HHOA 3D85B 1LP9A 4Y2OA 1U8KA 2W91A 1OQOA 2WMPB 3PC0A 4CNSA 3U4AA 4LS2A 5IWLC 2EG6A 4M6MH 2PTDA 1S2CA 4M03A 4DNLA 3MUCA 2IQ9H 2EIDA 1GGOA 2FD6H 3MZNA 1BJ8A 4YTRA 3HQNA 3P4MA 1N7MH 3QUYD 4M93C 2XU9A 1JCXA 4CRPA 3EZ8A 4AW4A 3GSXA 4JPKH 5IBLC 1TQVA 3WK3A 3PP4H 4XNDA 1E2WA 4NSKA 1I7UB 2WVUA 1UROA 1U8HB 2J79A 3WFZA 5RUBA 2W9DL 3QEGH 1NOAA 3WFBH 3VXQA 2HZGA 4PRNA 4UQ2A 4WJXA 2OFQA 4X6EB 3VNJA 3P0VH 1IM3D 1X5FA 4E41E 1O9WA 1YZZA 4QDPA 3ABXA 4F24A 3L9RA 4WW1A 1LO3H 4KK8D 4A8IA 3D5HA 2E86A 4WUUB 1OCOB 1HJXA 1H7OA 1IAIH 3VXMB 5EV7A 4ZFFB 5AVQB 2EVHA 2K7PA 4XZHA 1NIAA 2V30A 4WTQA 1VP5A 3GIZL 3CWGA 2KAUC 5EZPA 3WGUB 1CFVH 4PRHE 5LCVL 4OU3A 4K3JH 3MNZA 4LRNH 4C56D 1JRHL 1T1XA 1QFWM 1KBGL 5EU6E 2V33A 2HROA 2XJKA 3IK2A 1UT2A 4ZJ9A 3LTVA 3OWRA 4CJ0A 1XF2A 3W7OA 1F58L 5ICXA 1EO5A 2OEJA 4YFEA 4ZA0A 5FHAL 1ACCA 2Q6WA 2FO4A 1ZTXH 4NQVB 3Q01A 4ZUWB 3OKLA 5H8DA 4M82A 4JKKA 3SAZA 4PLJD 4NO2A 1FO0B 3TA3C 4HEMA 2VDRL 1PO9A 2F15A 3UJIL 1F3JA 1U33A 5GRUL 4EZKA 2F9RA 1L6GA 5C0CA 3KCLA 3VM7A 3C56A 3O6KH 2Y07H 3VFVA 4AISA 3FB5A 4FEZA 3G8RA 4JDTH 4RK8A 1FDZA 5E8OB 4H3DA 5GRWA 5HHXL 4ZFOB 4N24A 1NWSA 3HLAA 2PAJA 1SJAA 1AOHA 2XIJA 2Q02A 3TYFA 1GVQA 3N44B 5A69A 1TUXA 2QQNL 2V5SA 1VF5C 1BQLH 1TWWA 2O72A 1C8QA 3WLKX 4MCYA 2NUPB 1WGOA 3U30C 4PWGA 3WNOA 4JPSA 2FLBT 3QIUB 1PZ3A 2ROYA 1J4EA 4HNCA 4K5OA 3BE1L 5AKQA 3FK3A 3GTNA 3ZJAA 5IP4A 5J3HD 2OMAA 4GG8A 5IDIA 1I2RA 1MCPL 4HSCX 1XH3A 2QKIC 3GTFA 3OPZH 3MV8E 5HANA 3T0ED 4XZNX 2PR9A 5FYKE 1FL3B 5BS0A 1X7SA 4PH6A 2X28A 3CFUA 2DMGA 3HO8A 2BDQA 3LSOA 3V6FB 1ZT1B 1Z1WA 3TXAA 1QHZA 1ZBKA 3L3KA 3SDOA 4ZFZB 1FBIH 3WMSA 3KLQA 3HFTA 5CR8A 4KK6D 4D6JA 3H3BC 4JTGA 1JAKA 4Y1SA 4AYFA 3U9IA 4ZCWA 4GRSA 2WIMA 2G75B 1QPXA 1OCZB 4UB0L 4H8WH 3WNPA 3S1GA 3BO8B 4LOVA 5IQ9B 5CIPB 1KN2L 4Y9MA 1J0YA 1PY4A 4N2BA 2DQCL 4E41A 3VTRA 1F8TH 2MFNA 2LV4A 4TMPA 4F0KA 1I7ZA 4K3ZA 3QR1A 2LFGA 5MKGB 3O81A 1G7QB 2ZOKB 2X70A 3S88H 5C0DA 4V2CB 4HNTA 3U79A 4F2EA 5LGHL 2DM2A 1RJRA 3N6YA 4Y9CA 1G7HA 1MCIA 3D25A 2O9PA 4YUEH 4PRHA 3V4VA 4QWWC 1M1XA 3PREA 3QHNA 3QPYA 1WO2A 2A6IB 2ZSWB 3AMCA 1NP0A 1HHIA 3VK5A 3CV2A 2ZOTA 4E3TA 4LAKA 3HGOA 3K72B 3F58L 4BQ5A 1G9MH 4WEEA 4A6YL 3S36X 4OCXL 1M68A 1W3NA 1TQTA 1QDSA 1UCWA 2JELL 3MUJA 3NZSA 4MQ7B 2B7DT 1ZAJA 4N9GA 5GSVB 4YL9A 3F83A 5G4HC 5M1TA 5I6XB 3GU9A 2Z35B 2JI2A 5LQBH 4JX4A 5F88A 2PTZA 3X14A 4MUZA 1SN5A 2OTWA 5DURB 4Z76B 3EH4B 4HIHB 2WZTA 1P6BA 1TQJA 1QHOA 4OSUL 3DGGB 4FG4A 1QR1A 1MW0A 4I5RA 1JCNA 4D0BA 2DQWA 1MCJA 2OTUB 4N0FB 4GY4A 5F3HA 3ARGA 3O6YX 4TU1A 2K6ZA 1E4JA 3OHIA 1XHHA 2Y1HA 5C0QA 3TBWA 3WHXB 4R97B 3LX9A 3KBVA 1OAZL 1AAJA 5CQ1A 3PJLA 1QVOB 3BJLA 3CO8A 1FDLL 3AQXA 4R7NA 4YSOA 2WZ5A 1NWTA 3O3RA 4HJJL 1XF3B 5D2NC 1JXDA 4KI5C 4OIIH 2YAEA 4WV1C 3U0PA 4Z7QF 5I6KA 3IAGC 1RZGA 5AZ2L 1ZHKA 3VRLE 1J9CT 1NMCB 2I27N 3GSWA 4FOKA 3RWEB 4O4YH 1S3KH 2O61B 4ZW7A 2YN5A 3D0AA 4DFIA 2Y5SA 1SXBA 5IREA 3S1UA 4NHCL 1RUPL 3AWOA 1I31A 3VXRB 5DEGA 1KIPB 1QI2A 2XFGB 3D08A 4UNKA 4J3OC 1KJ2B 2G95A 2XKNB 4KO9A 1XFBA 4Q4RA 2EILB 5HVWA 3GHBL 2BSSB 4R7VA 4MM1A 1QUMA 3UR8A 2BY0A 4WRLA 4OLYH 5DEZA 1EHLL 2IXVA 1EXUB 2PDKA 3QZMA 2GIMA 2H32B 3ZE1E 4EBQH 5DUML 4N87A 3F03K 3LXBA 3N17A 3SB3A 5I76B 1RSCA 3VILA 3IUDA 4JGJA 2FT8A 4UINL 2ATAA 1MEWA 2ZE0A 3SGEH 3GR4A 5DQ9B 1JUFA 4FADA 2E5EA 1N3NB 1WKFA 1RBAA 3T1FA 5CSSA 1O1ZA 2R23A 5KTLA 1RH9A 4ZTOL 2CO3A 1WPCA 2NX9A 5AYTA 1YTKA 1NC4A 1XGQB 4W1TA 2B14A 2W61A 4ELME 3HTWA 3IPWA 3SSJA 1AJ0A 1CVSC 3KG5A 5INCA 5I8KH 2L8AA 2DEXX 2YDQA 4IBVA 2DSUA 1O5PA 2W62A 2ZG1A 4O02A 1DBKL 3MACL 3RO8A 1IWBA 1W0YT 4JFFD 4M1CD 1SN0A 4AG4H 4BHUA 1UZ4A 4DEPC 2IH1B 3ALWA 4TVPE 1FYTB 2G2RB 1OPGH 4P7NA 4B3VA 3PTDA 1I1FB 4OZFA 2E7CA 3RTQA 5DO8A 1SM3H 2CNZA 3FGCB 2F7IA 5AVSB 3RWDB 2W92A 4KRZA 2PSNA 2GC7C 3CK0H 5FO2A 5E0KA 1F4WL 5AENA 4HFWB 4MXVE 4FJYA 3NZ8A 2VLRD 4QDWA 5HVGB 5D72H 4YO0B 1E42A 3BAJA 1ETA1 2PDIA 1KACB 3SJVE 2WC3A 1KB9J 3NZHH 5B3JF 2KH2B 3UTQA 4MCZA 1NGYB 1EZ2A 2BS9A 2WUBL 4O58L 2VDNH 4ODXA 4LIQE 2V2WA 5BV7H 1EAPA 2VXTL 3GO1L 1JPTH 3W2UA 1HXKA 4RDQG 2BRRL 4PRRA 4BK9A 2XICA 4MD4A 1CGVA 5CEZE 3WSUA 2PP8A 4JFQA 2YPIA 2P42B 2D3NA 9CGTA 3ZZLA 1YN7A 2VXSL 1I1AD 4KZ0A 1CZ1A 4AWTA 2VAJA 3AHYA 3FB6B 3EYVB 4XP9L 3VQMA 5CAYB 1K7XA 1UP2A 4AYID 4Q6IC 5E1IA 4UMSA 5F9DC 4OCNC 1QRNB 1B1YA 2Q2LA 4Z3JA 3WUFA 5EN2B 4FTDA 3N04A 4JS3A 4ROPA 3EX3A 3AT0A 4I9JA 1Q1JL 4V15A 3P6LA 1GGIH 4PS4L 4LKXA 4HUVB 3E8UL 3R4IA 4X80H 1NU5A 4FD0A 3NEXA 4QXGH 5KVFL 3L12A 4C1NB 3FIGA 1AH0A 4MHHG 3T8XB 3UZEC 3W23A 3OKKB 1E40A 4KNUA 1MQ8A 4K7FA 1HEZB 4P0DA 1FFPB 4ZAKA 5IROD 3B8YA 2YPLD 5AD0A 1IXOA 5EIIG 4WZ9A 1ZLUK 1SQMA 3L5JA 2BSRA 4RNIA 2EVFA 1VPOH 4R7OA 1IGCH 5DD3H 1N68A 4GOAA 3PAUA 4FKKA 1NIBA 2O93L 1KXQE 3CJPA 3KWTA 2Z8SA 2M2DA 4R2GD 4C57C 3BD5A 4U4BA 7PTDA 3VFSB 1NGPL 3GH7A 3M1OA 2UVEA 4AQAB 4DZHA 3GK8L 3C3UA 1J8HA 4QXUH 4N0YH 1JHKH 1N64H 1Z8AA 3VXGA 4W6WB 3DOIA 2G5UA 3OVUB 2NCMA 3SUWA 4PWIA 1SO6A 1KKOA 3LZQA 2AKZA 2VR5A 3EMQA 3TEYA 5T8GA 1DYZA 3QPEA 5GGRA 1R86A 4MMZB 4B5UA 4G70B 2MNWA 4UTKA 2X2IA 5I17B 4P59H 1OK4A 2C14A 1IJNA 5KZMA 3DMMA 1WAEA 1JV5A 4WCJA 3DNKA 3BGJA 1DE6A 3HE7B 3GBLA 5FDWA 5D7SH 2HT4C 1ECYA 3LBMA 3MCG1 3FCGA 4XCFH 1EUAA 1U8PA 1TCRB 5EC1A 2ZUNA 5IEHA 2RB8A 4CDHA 1AVAA 1ZLWH 1LILA 3PR2A 1HHHB 3WDQA 1CTOA 5CP3H 4DWSD 3SJVA 4B2DD 4HHWA 4OCLC 3AYTA 2J8UA 3VWJD 1Z9MA 1TTCA 4OAWA 4XE5B 1GGUA 1W8SA 4LOEA 1CFTB 3TT3L 4ZUSB 1F4YH 1CLZH 5BXRA 3QW3A 1R17A 2MNJB 4NNBA 1U91B 4YK4B 2VSKB 5AKTA 3IJ7A 4LL4A 2AHIA 2I5IA 4IGBD 4FXKC 8XIAA 2X1RA 1L9OA 5EFDA 2HG5A 4LHUA 1BF2A 5A2BA 3WX7A 1WA2X 3UJTH 2WBJA 2W8CA 1WZMA 1KRBC 4MMXA 2E09A 1U2CA 3NCYP 3WF0A 2O5ZL 4MJJA 2AABL 3KP1A 1YC8A 1MCFA 2X44D 2OMZA 4PRPD 5F7FA 1BYNA 4AXWB 2JK2A 3PUEA 4H7CA 4AL8C 4D9LL 2PEVA 3OX8B 2YARA 2IGFL 5K9JH 4QXWA 4YXHL 3VUPA 3EWWA 2CCRA 2EE9A 2QV2A 3HMCA 3N1PC 2E4FA 1YPZF 5HHME 4JPVL 2GB2A 5DMYA 4LCWA 3H22A 4F2TA 4O0ZA 4L8BA 2E8ZA 1D9KA 1RJCA 3P02A 4HGWA 1J9YA 4M7KH 1LK3L 1JPHA 1P48A 4IX2A 4WTWA 3C61A 3GDBA 2NLYA 2XOTA 1IX2A 3EX4A 1XGYH 4YIWA 4PBEA 2YDSA 1DOSA 5FUCC 1UWUA 4WFED 3PABB 1TT6A 3QMRA 1UJ3C 1OWWA 4GBXD 4G6AD 2Y6ZA 3WLLA 1FH5H 4MS8C 2GJXB 1OABA 4JS7A 5T1LD 2JKEA 2JJSA 3B83A 2IH8A 5BPPA 5E4AA 2NNCA 2OJZL 1OOWA 5CFAA 2UVFA 1GIGL 2EDHA 1KXQA 2Z7WA 4NUPA 1V77A 2WJ7A 2PD5A 4I13B 2JXMA 1HOCA 3A22A 4JTTA 4K15A 4QE4A 3K81A 3QJHB 1P7TB 3FUEA 2HJPA 3ZQ9A 4Z8FH 5EEVA 1RHHA 3EMZA 5LNWA 2H3NB 1F6AA 4KMTH 1TYRA 3CQPA 5SWQA 4JM4L 1F97A 4HUWB 2YCLA 5DLLA 4KWSA 1TSHA 3ARWA 1M6JA 1OGAB 1BMGA 1QWKA 3W1MA 2HKFL 3L0GA 5D2TA 1YPZB 1KZYA 3NR0A 1Q6LA 3IIOA 4RLIA 5C6WH 4PJEE 3PY9A 4IM4A 3NDYE 5B1JC 4JANB 1FCCA 4TSBH 4DEWA 4IRJD 1ZPUA 5EZIH 4WU5A 4YJZL 2HVNA 1BZ9A 3BJSA 2Z31A 3K1DA 3DK2A 1G4RA 3WG7B 5KSBE 1WX0A 4RAHA 3O0FA 3P2TA 4O15A 2A7BA 4HALA 3N42B 4EXPX 4BWLC 4WO4A 2NQZA 3WY1A 5D71H 3FU6A 3T2LA 1J93A 5EBAA 1BFNA 3FMGL 1FXQA 2GSGA 1RZKC 1XGZA 5I82A 3TN4A 3GDRA 3LIUA 4NP9A 3WN5A 3SDXF 3CWHA 5I74C 5DQDL 5AZ1A 3DX6A 4S1FA 3MNVA 5LKYA 3QC3A 3QAZB 1EVUA 1KYUA 2Y06L 2GQ9A 4QCEA 3C8HA 2AMXA 1BGAA 3CVCA 4KRPD 2VDKB 1TIUA 5D1XE 2E7LC 2IEPA 3FAWA 1UKPA 3EYSL 3KJ4B 5DRZB 3ABGA 1HL8A 1VD6A 3LNMA 3BLDA 5MF5A 2O9TA 3W9DB 4RZBA 4X6DB 5BW7C 2LAAA 1V0NA 1N8FA 4WKFA 2KL6A 1M2VB 4NGHH 4OFKA 1U92B 2G97A 1O7DE 4B3EA 3QDGB 3LN4A 3G5YA 3VRJB 2JTDA 1J1PH 1GOIA 2QJHA 2L0DA 4OLXH 2UY6A 5LVEA 4MFEA 2W81C 2JI3A 1NEYA 3HIJA 1CGSL 4MA8L 2AQVA 1S2AA 3BMXA 3K2UH 1FRGH 2JIXD 2VCAA 3QUMA 2GWGA 3EHBC 5E2UH 2GVLA 2WW5A 4I1RA 1CIUA 4ZFCA 1Q94A 3FV9A 1CWYA 3BLOA 2A4CA 1JEZA 1HXYA 1QNQA 4JGUA 2KHAA 3SDXB 3A4EA 2EXOA 2SFPA 2A7PA 4Y2DB 3ZHDA 4RZCB 3WQPA 1A3RL 3W0WA 1XB6A 4IMKA 3QUKA 1EANA 4WWKA 5LBSL 2EIKB 5BZWB 2E8YA 2D0HA 1CFNA 3ATZA 2QFPA 3H9YA 1UR4A 5J04A 3E6EA 1NMBL 4ZDHB 4E4FA 4DESA 3T3ME 1DZBA 3BP7A 3FJ6A 3MBEB 1GW1A 4LCSA 1VRSA 2AANA 4E9QA 4Y1AB 3MRRA 3SCMD 3O9WC 5MEQB 4QEEA 2CXEA 5EZLA 3D6GA 1NFIB 2VKXA 4NN7C 3A5VA 1MCEA 4YHYB 3M7FB 4Y19E 3NIYA 3LOTA 1MFAH 2YLKA 3H0TA 3NDYA 4LWWA 4NKIL 4QJ3B 1JDAA 1A6UL 4HJSA 1SQ7A 1GPFA 2ON3A 4P9HL 4H19A 3BCDA 2ZNWA 1EEZA 1FNEA 1NCNA 5HGAB 2F84A 4QOKA 5KSBA 3SDAC 4ODVL 3WY2A 3ARPA 5TK4A 3GMPB 3KPOB 4PMEA 1L8NA 4NPKA 3V18A 4Q6JA 1N59B 2IO5A 3K5SA 1HJBC 3HB9A 1UWGH 5JHDE 1UXSA 1QOXA 2FPTA 1NP2A 1FORH 3RNKA 3WHE1 4BELD 1RALA 2FX9L 3ITXA 4IJBA 4AY0A 1LQ0A 3PPGA 4HXBL 1CS6A 2A74B 1KB5L 4DM2A 4QTIL 3RDTD 4CU6A 2LFEA 3IWVA 3EB2A 1Z6JT 4DBEA 3EOEA 1S7WB 1BLNB 3CZSA 2FWSA 3P4OA 1MFVA 3ZYZA 4FQIL 2PGRA 3NL3A 1JPDX 3SGUA 3LZPA 2GK1A 1BAWA 5D1XA 1U8NA 1KM2A 3DXAE 3LDVA 2OBGA 2UZYA 1CLXA 1CBJA 3GT6A 3G5XB 5I15L 1JGEA 4PTTA 3IFPB 2GSIB 1IBDA 1LMKA 3QXUA 1D5RA 3IJ6A 2VDPL 3MU3A 1MUCA 1ET5A 5C70A 4I7ZC 5CCKH 1DBTA 4YCPA 2XVGA 1RL1A 2V6AA 1JRBA 1S2TA 4YNYA 4Z2IA 4K71B 3F7YA 4U10A 1HAWA 2HSIA 2BB0A 3SPVB 5IB4A 5LNGA 3I2CL 1ED3A 2FIQA 1W1TA 5JORB 4Q4IA 3ZL2A 3L3GA 2V2CA 4HJFA 2GEEA 1BFVH 1CE6A 2VDML 3SPGA 5EOTA 1BXUA 4UR7A 4JEGB 4DF0A 3KS0H 2UXVA 5LIYX 3IKKA 4Y5VC 3GI9L 4YWIA 2YJQA 3IGSA 1OIFA 4P7LA 1H5VA 3FXGA 3FCBA 3URNA 4TO8A 3PFQA 1KCRH 4H0IA 5B8CC 1HDMB 1NL0H 1VFTA 1ES0B 2Y7SA 3QHZL 1OK8A 4HJEA 1QMUA 4CNIA 4F40A 3E3QC 3OTTA 2H5UA 5HHVL 3FUKA 4XVUC 1ET8A 3TQPA 4AMWA 4DO5A 3BPCB 3B0YA 1ZV5A 1TIMA 1P7QA 4XMWA 2YEVB 4CGUB 3VFRB 4PJ5D 4X0NA 5DJ2A 1ZLEA 3DEQA 4KJYB 3ZIZA 3AABA 2D0GA 3GXNA 4LFHD 4MKTA 3W1PA 4BHYA 4B9FA 4IPIA 2NX1A 4GI9A 1RIHL 4Y19A 4ZOBA 4OGAC 1KGYE 2PDCA 1FGVL 1L9PA 1B2YA 5A6SA 1H5BB 1S7XA 4JPIA 4RGOH 5D09A 2V3FA 2YMXH 3Q65A 4PRIE 2L3BA 4RW5A 1U8MA 4V27A 3SYAA 5E2VH 1SDYA 4PJXE 5I2IB 4GI4A 1PG7L 2OMXA 1UW9A 1IBBA 2XTJD 1DQDL 4NHVA 4XWOD 5JHDA 4HU4A 2C4FT 3FB8A 1MCCA 1TETH 3CX5J 2PYED 3X2QB 5AYUH 3Q48A 1W2VA 2OYKA 3LY0A 4RE3A 3WZ0E 3QF0A 2B7OA 4LCIL 4IRSC 5XINA 2OX5B 2YXVA 2XQBL 3VSUA 2OT0A 1X5XA 2EG7A 1DQKA 3UXLA 1Q2RA 2BSLA 5HI3D 2MMXA 2ITCB 4FFYL 2BFVL 3DXAA 5BCAA 3WUEA 4AXNA 1B57A 5BXTA 3QA3A 1PZCA 3KVJA 4O5LH 1TEYA 3TTEA 3RI5F 3BOFA 2OP4L 2VOTA 2H6PA 2P5EE 3KDPB 1G7PB 4A6YB 3ZYJA 3QXDB 3AU2A 1CT8B 3JTTB 1P0BA 1M03A 4OI7A 2JF1A 3OC5A 1UWRA 3H4FA 2H2PC 4Z3TA 3RCMA 2Z1WA 3DIFA 2JV6A 2MOGA 2IBZX 2QQLH 5IDZA 3TFKC 1TVBA 2VAAA 5DVNA 2WWKT 1FY6A 4D71A 2HN7A 4NQSB 3SYQA 3WJZA 3PWNB 1QWNA 5D1QA 2ALDA 4TV5A 3FT1A 2VFIA 4M3PA 2A2IA 4XC1L 3MLPA 3Q1SH 3FHQA 4M6VA 2ARJQ 4QAMB 3S37H 1A4KB 4XPTH 2VN5A 1EFXD 1MAMH 4YC2C 3DGRA 4X8JA 3MMEA 4DQOL 3C5SA 4GAAA 3H3KA 1HE8A 3ATBA 1T83A 3F7RA 4BSWB 2AJZA 2I14A 3F5WB 3UAJA 3UTOA 4YHLL 2AQRA 4OCSL 1J48A 3MYJA 2XNAA 5KOVC 2P1YA 1EP2A 1N6QL 1IEHA 3GEFA 5A43C 3GBDA 4A7GF 4FI7A 4PGEB 5M3WA 2FSEB 2HA1A 4K8RL 3VFTA 1Q7QA 2R0KL 3FH7A 4DLFA 5DD5L 2NY1D 3EJZC 1GYWA 4NFCA 3II2A 2VDQB 3FRPB 3U5YA 3BMVA 3OZPA 3ARBB 4ODHH 3WBDA 2IFFL 4RVBA 4XMLH 1I4FA 1GPOL 1KB3A 2WZPA 3NPZB 5FUZL 4IQEA 4MG4A 2Y7OA 3C6LD 5JXEC 2ZG3A 4ATLA 4TL4A 4ZS7H 1XL9A 4IMLA 3H6AA 4PJXA 4CVZB 2EH8H 4F8OA 2NW3B 2DOCA 3ARTA 4E0RA 4MXQD 4XMVA 2HRPL 2PLKA 1TQWA 4GUPB 1E9OA 1RSYA 3VIJA 3VFUA 2QIIA 1JQXA 4JQAA 3I9PA 3OP2A 5AW4B 5HNTA 4TVPL 3RZCA 3MJYA 4HDIB 5L6UA 1DUYA 4AVJA 3EWCA 1RZ8B 3ZDWA 1MFBH 1YEEL 3NFSH 3BUYA 3FHEA 1NLDL 4NKQB 1KIRB 4DF9A 4R3UA 5CNHA 4LUTA 3HZ3A 4LCCC 2EXSA 1OT4A 2XRAH 5SWSE 4PJDB 3MRKB 5EEXA 2EEFA 1NWUA 1TA3B 4WI3A 4DY1A 3LJ3A 3I02A 1MZHA 3BH4A 1Z5LA 4E5XG 2X2UA 4W9FC 1E28A 2Z2UA 2PPAA 5DJXB 2ICEA 4W6XB 1DIEA 3QTGA 1KXHA 1KCWA 4PGJA 5GGVL 3VDAA 3S34H 4GSUA 4CAGA 1UT9A 3KPTA 5K1JA 2BCKA 2BXYA 1IC7L 4MWAD 1HCVA 2F7FA 2E56A 4APQD 2PE4A 3RAJH 1BFOB 3AU0A 1R3HA 4H20L 5CMAA 3CN1A 1MO0A 3QG6A 4AWJC 2FVLA 1FJ1A 5C0BB 1FWTA 4BGDA 3FTVA 3O0LA 4E9SA 1K9FA 4Z5RB 1OAYH 3C2FA 4LSDA 3B9KC 1W5PA 2VX7A 3ZY7A 1ZXKA 1QNVA 4J5VA 4DXVA 5F2FA 4NQDB 2VH5L 5HHOE 3BUQA 2ZWLT 4N68A 1FQ0A 4ODBD 4NP4L 3KEHA 2FUTA 4XD6A 4Z08A 1TZHB 1UKQA 5MERA 5DTFB 2VDLH 2AXJA 3REQB 3DX7A 4N2MA 5JDJA 2EDQA 1MCWM 1WUFA 3H26A 1U83A 3EW3B 4X8GA 1JN6A 2GLKA 3OYZA 5GGVY 4ORGA 4U1SA 1E1CB 3VQ2C 3U7WH 1TQCC 1O4UA 3LGDA 4C4KO 3QPQC 4WXYA 3SDCC 4BI5A 1MAKA 2INFA 1SBSH 1PIFA 5I6PA 5JO5A 2WYSA 4P46B 2O4QA 5C0ND 1FRBA 2WMKA 3CBRA 2ZCKL 4K3EH 4IH3A 1XYZA 5B7MA 2BNQA 3OODA 2ZTBA 2XUWA 2PLCA 3D2UD 3S98A 2Q3XA 2W6RA 4DIAA 3M0YA 2HK0A 5DJDB 1OCQA 1GHFL 1WV7T 5I3DA 2WQPA 1E5NA 1VKFA 3WQCA 2JJTA 1C9DA 2D7NA 2HVJB 3TVMB 4A7SA 4FXGA 4JUTA 5KSWA 5KYYA 3C5JB 3HE6A 3PWUB 3ONCA 4HCDA 2XQYK 4HHHA 5BU9A 4G7EA 5D9NA 4JCLA 4PRWA 2W79A 1H8NA 4WJKB 2AVFA 2HWGA 1CU4L 4CU7A 1TENA 3BDXA 2YPKB 1IAII 4Y5YA 2VUNA 3NACL 2CR0A 1NGQL 2V2TA 3S3GA 3FCSB 1JZ4A 1BQKA 4NO0A 5F7UA 1IGML 2VLJD 4HU8A 4RWHA 2YAQA 4FZ8H 1UGKA 4HP5A 3ARSA 1RIUL 3WJJC 4PN6A 2Z4GA 4F20A 1MFMA 3A6BL 4WTZG 2F53E 3VH8A 1TXKA 3KM1A 3AQDA 5F2LA 5SWSA 4QHLB 1JNNH 4X9SA 3VFWA 5KBDA 3C6CA 1DHPA 7TAAA 4HEME 4K7PX 3T3PE 4WK9A 2AJXL 3VI2A 4JE4B 3GSVB 1AR2A 4QGYA 3EOBA 3CFBA 4MJID 4J12A 4JRYB 1XGTA 4CKVX 1BRLB 3GLZA 4B5VA 2A4AA 2GW5A 1HZKA 1CZ8H 3RWGA 5AHIA 3T4AB 1ZJBA 3MLXH 1C12A 3TJ4A 4DAIA 2LHAA 4L1DA 3KHOA 2XGZA 1E27A 3MPCA 2ZKHL 2ANUA 4WKZA 3DBXA 4PJIF 2ED7A 3AZRA 1OAUL 3AG2B 1N4XH 1M1SA 3MR9B 3M6DA 2GT9A 4PCPA 3PFMA 3C60C 1HL5A 1G67A 1QBMH 4M6OH 3VD1A 3CZFB 3PL6D 1PZUB 4AQ1C 1ZSDA 3SE9H 4MCNA 3RXZA 3GS0A 1T0OA 5KYUA 2ADGB 3VFOA 5DA0B 1QFWH 1TFVA 2F54A 1OAKL 2DMCA 2WQUA 2R2BA 4O1FA 3BVVA 3KLKA 2CIIA 3TWYA 4LOUC 2Z26A 3O45B 3FH8A 1CURA 2Y7LA 5BS0E 3CSYA 4L5ZA 1P4UA 1XINA 2RMNA 4XPAL 3LNPA 3QEUA 2K45A 1MPAH 1KLFB 4ILDA 3VKCA 5I75B 1KFAH 2JKJA 4JN6A 4WHDA 1YY9C 2BVWA 4HCGA 1JS4A 1IEAA 1UXWB 3NJLA 4LLDA 3RX7A 4BZ1A 3NCMA 1AI1H 2B4CL 1OX6A 3O2VH 5EA0H 1WKDA 1QSFB 4ZXBD 2A1YA 4HH9B 3V4PB 3ZO0A 1AGEA 1XIDA 3AY2A 2GJ6D 2POZA 5F1NB 3HF3A 2RCSH 4JY8A 1TMHA 3TBTB 5AZ0A 3F1QA 1OD7A 4DP8X 5TQLA 5FFGA 4DJDA 4PJIB 3B9EA 2DYPA 1EQCA 3QIUC 4PR5A 2FB3A 4L4LA 5C6MA 5C0EA 4P7RA 3MU7A 5BMXA 1A4MA 3N44F 4FNLH 2OLSA 1PAMA 1R75A 2X1UA 3P30H 2JKXA 4YAQB 5IESL 5C0AB 4GXUM 1UZ8A 3FOMB 3L1GA 2F6KA 2JB5L 1XM3A 3HNVL 4PMUA 1UB5B 2VM4A 3WAJA 5AB9A 4GY1A 2PDUA 1UZ6E 2O6CA 1KV3A 4NHUB 1OO2A 4F15B 3MROB 2CR6A 4NWTH 1DLHB 2F53A 1GEQA 3MLTA 3B7SA 4CMMB 1GHRA 2D20A 4PB3A 2WTRB 1XT5A 3RLGA 3LHZA 4QAIA 4AZ8A 2DLGA 3W25A 3QIBB 2J7BA 4V1YA 5CS7A 4EE9A 3CDZB 3K80A 2FO1A 1DTNA 1CJYA 3VXPB 4KQ0A 1O7SA 2QEJA 2B5IB 4GISA 1U3ZA 1S5HA 2FQDA 3IMRA 2F7OA 2WXLA 2CU9A 3HZYB 4UQEA 3QUXA 4DPPA 3RPIB 2HCVA 4LL1A 3R11A 3NFUA 2O7QA 2QDGA 3GNPA 1B2WH 1WD8A 2CRZA 3HG3A 4MDPA 1BWLA 5ENWB 5IHLB 3I4KA 3NYZA 4XNBA 3BAWA 3EOTH 4ZMLA 4NQCB 1OFEA 3GSRB 3EYFB 4UZUA 3FU3A 3OXRB 1F2JA 2WXGA 1MJ7L 4FMVA 5ABFA 4V1DB 3VIFA 2E9JA 3Q8BA 4RGMB 2W60B 3IUHA 2I57A 1WYIA 2GI0A 1R7OA 3UBFA 2EUXA 3CAQA 3ECQA 3I74A 1US3A 4EDWL 4OFDA 5TJWK 9RUBA 1NOUA 4PMVA 3TPUB 5HP5A 1MSSA 3BQ6A 2W66A 3ISWA 4PV1C 2AQ3A 4KKBD 3IFNH 5GJSH 4L9LA 1GY2A 3M43A 2XM1A 4LS0A 4U6YA 3KPNB 4PREB 1TUFA 2QELA 2Z93A 3H4GA 4HPOH 4Z7VB 2O5XL 5K9QG 4Z7WF 3IJHB 6FABH 2NQCA 4ACTA 2CBTA 1A4BA 4RPPA 1R3KA 2B2XH 2VP8A 1CFQB 2Q8AL 4JHUA 2E6FA 4IJCA 3BKYL 3IEBA 3CAFA 4MTMA 1I1CA 5SX5H 1YNTA 3VE0B 2WLKA 4R97C 5DZLA 1AMXA 4RX4A 1N7KA 2O7SA 4P57B 4DZ8B 2WB5A 2ENYA 2A1WH 4UV7H 4F0SA 4ZQPA 1RUML 4UUJA 4NZDA 1W5NA 4Q2ZB 4N02A 3UG8A 3SGEI 3RVXD 4X9IA 3ARDD 1U1HA 4LX4A 1NMCC 4NAEA 3OD3A 2I16A 2BM3A 3IMTA 2R8SH 2YA1A 4BCZA 3SQOL 1HKVA 1GGBH 5IT2H 2YRZA 5DS8A 4HAKA