2DJLA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with succinate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
312
structure length
312
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCCTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydroorotate dehydrogenase
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with succinate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 107
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2djlA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2djlA01
3R89A 5KZDA 1KBIA 3W1TA 1GTEA 3LTPA 3M5XA 3GX9A 3L0KA 4MOZA 1A5BA 4IGHA 2VFIA 3C2OA 2EPHA 1KBJA 3ATYA 1XBXA 1K7EA 3BG3A 4NXSA 2KZHA 4UMCA 2E6AA 3NOEA 3W1LA 2VENA 1GJPA 1PHWA 4JY9A 1C9DA 5A5WA 4O0KA 1BEUA 1A5CA 3UNDA 3VCRA 5HR6A 4PFMA 1H1YA 4AF0A 3DENA 3LHUA 5T26A 2WNZA 2ISWA 1ZY9A 3EX4A 3W23A 1T96A 3W7JA 5D2XA 5F1UA 5HINA 4UMAA 4MFEA 4LS0A 3B04A 3B0PA 4RZ6A 2I1OA 3E12A 3N14A 3G22A 4FB7A 5DY2A 5CKSA 3LHWA 1L6WA 1VCFA 3PS7A 4DQWA 3LI0A 3GR7A 1BKSA 3ZS4A 4GXMA 1L6SA 4E38A 5CSSA 2NUWA 3LB0A 3R13A 4FXSA 3LDVA 4K8EA 4AB4A 3DH7A 1F74A 3PBUA 4NJGA 5FF7A 1EWEA 2PCQA 3ZR4A 2B7PA 4C1KA 1F73A 1OYBA 1YXDA 3F1QA 3KOFA 4HNUA 3O6CA 3GDRA 3TXVA 1G69A 3BK0A 3ZWSA 1QCWA 1ICPA 1W8SA 3PWAA 2B0MA 4QJ1A 4ZQCA 4WZHA 1OFBA 4NU7A 4AWUA 1KM2A 1EX5A 2Q8ZA 5HUPA 4DO5A 2GQ8A 4Z0SA 4IPIA 1QR7A 1K3UA 4UXDA 1IGSA 2EF9A 3CWNA 3NR0A 4Y90A 2DP3A 3GXNA 3M5ZA 2DZWA 5D38A 1VH7A 2YFOA 3W7IA 2I9EA 4XTIA 3SSJA 4Q33A 2A6LA 1MEIA 3FA5A 1R30A 3NL2A 5G2WA 2PRMA 3W1PA 2ZZ5A 1O94A 3KFTA 3ZFHA 3O8AA 1OX6A 1B3OA 2OX1A 4DXVA 3C4UA 4XKYB 1P4CA 3YPIA 1K7XA 3GKAA 3DFPA 1TPB1 1VHNA 3CT7A 3QPYA 4ML9A 4O1DA 4NNAA 1BWKA 2ZRYA 3TK7A 3GR8A 1RV8A 4JDBA 2ZZ3A 2X2GA 4OBTA 3DFSA 3DFOA 1W3NA 2Y61A 5CZ0A 2CLKA 2P1FA 3G0XA 4MYXA 1ME8A 3GDLA 1FDJA 3PULA 4UTWC 2B7NA 1X7FA 5LGXA 2Y7FA 3DI1A 1YADA 1TO3A 2ZZ4A 3NYZA 1Q6OA 3HBLA 3TAKA 4O16A 3TFCA 1ZJIA 4O4WA 1F76A 2R91A 5CZJA 2VFGA 2PURA 4MKNA 1DORA 3O06A 1AL7A 1W3TA 5CGQA 3L5MA 1JR1A 4CLMA 3FYOA 5BNKA 3BPWA 1J5TA 1J2WA 3SZ8A 3FYPA 2D73A 1R47A 2CWNA 5FEWA 4M6PA 1F6PA 1OFDA 4K7VA 4TMBA 1NF7A 5EBUA 1Z42A 1XDMA 3Q94A 1KM0A 1DL3A 3SJ3A 4XBSA 1XI3A 1OF6A 2C6QA 1UBSA 4FX7A 4O53A 4K39A 3PSWA 3FS2A 3BG9A 4GNJA 2VFFA 3EWYA 2FQIA 4AWSA 4KFOA 1I2PA 3HF3A 4AVFA 1EP1A 3AJXA 1GVFA 2CLFA 3DXIA 3UXDA 3UPBA 4S1FA 5CPNA 5EA9A 3W7CA 2X1RA 2J24A 1IXPA 4GRSA 3NXFA 5KSWA 3A21A 1LLWA 5D2VA 5F2IA 5HULA 3S1UA 3NL3A 2A0NA 3QC3A 4JTGA 2FDSA 1Q45A 4DBDA 1LYXA 3LXAA 1SU5A 3W1AA 4FX8A 5G5IA 3BLEA 4LY8A 3RLUA 1TPVA 2OT0A 3O6YX 1TPC1 2TMDA 4Z1DA 4JN6A 3NVTA 2NUXA 4POCA 1H50A 2ZBTA 3QJAA 3G1HA 4M7SA 3KVKA 4IQLA 1TQJA 2YFNA 3T40A 4LUIA 4TIMA 3W1NA 2P0OA 3W2MA 2DZTA 1LTDA 1FCBA 5FI8A 1UUMA 5L6UA 3R2GA 1SO5A 2OT1A 5BMWA 1I4NA 1V7YA 1A53A 5J5DA 2QF7A 1Q3NA 3TSBA 1EWDA 1A50A 1LCOA 1KV5A 5LNWA 3GZ3A 1LRQA 1EP2A 3BLFA 1HO4A 1P1XA 1XKYA 3OG3A 3W84A 1OX4A 1GG1A 4TO8A 4QSHA 3I68A 4XQ6A 2WV8A 5LKYA 3H54A 1TSIA 1RPXA 1FCUA 3LCIA 3LHVA 2C15A 3VNDA 3TDFA 1DHPA 3N9SA 1L2UA 4ZQNA 1A5SA 3N9RA 3M5YA 2YXGA 2E5CA 1ZAJA 1WBJA 1KTNA 4N6EA 3HO8A 4JTSA 4ORIA 4S2BA 3LRKA 4PL1A 1AG1O 4RXGA 4UTTC 1NF0A 5HNRA 4YCOA 2BZNA 2ZA3A 2C19A 3QQ0A 1LLZA 1TPFA 2GVJA 4IMFA 4GUHA 3QFEA 2DORA 1W5QA 5IBXC 4JEQA 4CNNA 4Z1AA 3HB9A 3KHJA 5CPOA 2ZRVA 2XN0A 3I7QA 4MLJA 3CQ0A 3TR2A 3GAYA 3BLIA 5F4WA 3TMLA 2BSLA 1NVMA 1JQXA 3WJSA 1ZHAA 1WQ5A 4UFIA 5K2ZA 3W07A 5LNVA 5D37A 2NXGA 3CU2A 5BRBA 3PAJA 3KVLA 2X1UA 4Q4KA 4N9DA 4DF0A 4O13A 3TC6A 4UIOA 1HFBA 1H5YA 1TPUA 1OHLA 3MHUA 1YXYA 3DZ1A 2JKEA 2Y89A 1TTPA 3V1PA 4UNKA 1G7UA 4KKXA 2G97A 3UWUA 2X16A 2TSYA 1LDCA 3R5EA 3EXTA 3W86A 2ZZ6A 4AXKA 5J5RA 1GVOA 5AN7A 1Q6RA 3GLCA 3VFLA 4GBUA 3IEBA 5AHNA 2DZSA 2QCCA 2QJHA 1GPWA 1EIXA 3L5AA 4R33A 2R14A 3IGUA 4A22A 3C2FA 2FJKA 2DZXA 1JUBA 3LHTA 2WSRA 3IGSA 3BW4A 5LHEA 1JCNA 3LRLA 3W76A 3CPRA 3HG2A 3LI1A 4H6KA 3SGZA 2B4GA 1X6UA 3MP5A 1WXJA 2XN1A 4O1CA 4LS2A 4OV9A 4ZVJA 3NQ7A 1XUUA 1OX4B 2VOMA 4NT0A 1X1ZA 3UWVA 4JX5A 3NO5A 3MHGA 3G3MA 2ISSA 2TRSA 2WO5A 4RJEA 4DO6A 3L0GA 3M43A 5E93A 2AQWA 2CU0A 1XCFA 1PL9A 3NG3A 4AWTA 4O10A 3MHFA 3SIZA 3G1XA 4WX2A 2A4AA 1V5XA 4RLIA 1WOAA 3O05A 4Y6GA 2OCZA 3PUEA 2AGKA 3NA8A 3EX1A 3M1ZA 3TJLA 3TJXA 1L9WA 1SZNA 1M5WA 2HSAA 3NPWA 4NX0A 1G4TA 4IMCA 3NGJA 1BWLA 4MYAA 1H60A 4IUOA 3FOKA 3L0NA 3NL5A 2YW3A 4JX4A 3SY5A 3OA3A 2QCHA 5AYYA 5H2ZA 3IVUA 3P7YA 4PTNA 3JRKA 1D9EA 1ZCOA 4NJJA 2A1YA 1M6JA 2YSWA 3C61A 1X1OA 1KLZA 5IM51 3QF0A 3CLMA 4MY8A 4JTUA 2ZZ7A 4IX2A 5C54A 2DZPA 4BR1A 5HR7A 3P62A 3LV5A 3W7EA 2F84A 3LBMA 3NQVA 3UD6A 4FF7A 1NAL1 5AFDA 1OFEA 2W6RA 5TBOA 3S5ZA 3VE7A 1ZALA 1LRNA 2ZFAA 4N9BA 1IIHA 2NXIA 5HMSA 3STFA 5I3JA 2GUUA 3SECA 2VFDA 2ZRXA 2QDHA 1TRIA 4O1AA 4ADUA 2VFEA 2X1SA 4N4QA 5AHIA 3KVJA 3W7RA 3G8EA 3MI2A 1KFEA 3M16A 2YGYA 5HQEA 2V9DA 3KVMA 1VLIA 3ANYA 3LXCA 5H91A 3QYQA 3W87A 5K7JA 4TR9A 4ZMGA 4ONVA 2PRLA 2CLOA 3TX9A 4ZQOA 3UY8A 2GOUA 3PBYA 2V5LA 4JY8A 1EB3A 1FUYA 4XKYA 2ZZ1A 4UTWA 2CLHA 2Y63A 3OVQA 2DU2A 3NNTA 3WK3A 1SW7A 2GQ9A 3OIXA 3G8RA 2V81A 1YDOA 4GUFA 5CSRA 3W7LA 5AB3A 1CX9A 4IXXA 2CW6A 3EKZA 3C3NA 3DFQA 1TJRA 1EP3A 4NXKA 3NPUA 2JKAA 2QUTA 3O63A 4Q32A 5D2WA 5LGZA 1H7PA 4LW7A 3W75A 4UTMA 1PVNA 3W71A 4S2CA 2A6NA 1AW2A 1JJKA 2V2DA 1XBZA 2RDTA 4JTKA 3C2RA 4LVAA 2E5BA 5I3HA 3KRSA 4XWUA 4U4MA 3TW6A 4O19A 4O1BA 5LSMA 3E96A 1NSJA 1KM3A 3GXTA 4ZZ9A 4CCDA 5I3GA 4G1KA 1DVJA 4CNPA 3CB8A 2V82A 3LXBA 4EWND 3P61A 3IIOA 3B03A 4AAJA 1YPFA 1TREA 4WY0F 1MZHA 2J9XA 3STEA 3W22A 1SO3A 3N73A 3O07A 3W1QA 4BF9A 1TQXA 1ME7A 4IX0A 1F6KA 4FEZA 1H63A 1VJIA 1EUNA 3QMSA 1SSGA 2VEKA 3SW6A 4JYEA 1I2NA 1VC4A 2LLEA 5DN1A 3R8RA 3TW7A 4UTHA 1I45A 5TIMA 5K9DA 4O15A 4RZ4A 2QCDA 4L4MA 3GIYA 4JS3A 4JXCA 3W9ZA 4CNOA 4KFPA 1K02A 1I8JA 1QPOA 2C0AA 3A24A 5U7SA 3N34A 3UZJA 1OVDA 2Q3OA 1UASA 2H3DA 1W5NA 5FEXA 3MP3A 5AC7A 1F5ZA 1RQHA 4X9SA 2CZFA 1RD5A 3WFAA 3IIVA 1KTCA 1JQVA 2TYSA 3S5OA 1LBMA 1MXSA 2CLLA 2YX0A 3CTLA 3NQMA 4R34A 2H8ZA 4OV4A 5F1VA 1PCWA 5D33A 1JCJA 1FY6A 1TJPA 2VEMA 4ADSA 2BX7A 2G96A 4OHQA 5D02A 2NZLA 5F2GA 5C5YA 3CEPA 3FKRA 1K8ZA 3GNNA 3SR7A 4JR5A 4UTKA 1FQ0A 1F05A 1RZMA 1B4KA 2HMCA 4H4IA 1SQ7A 4FIRA 3BV4A 3W83A 2A7RA 1T99A 4UTTA 1NFBA 1LP6A 5D04C 3ATZA 1BTMA 5AYXA 3EWWA 3PBVA 4X2RA 4EVZA 1U83A 3UXAA 4A2RA 1SFJA 1KW1A 5IBXA 4ADTA 3B4UA 3HG4A 3MBDA 4CQ9A 3RU6A 2EKCA 1UB3A 4PH6A 4LS1A 1PCKA 1HUVA 1IF2A 1Z44A 3H53A 4JTHA 4OWGA 3LCXA 2IQTA 4MIMA 2J27A 1H51A 4HNNA 3W1UA 4EIVA 3M9YA 3UWWA 5G4EA 1LOSA 3UPWA 3B0VC 1AW1A 1JCXA 1KM1A 4O28A 3IVSA 3MMTA 5DXYA 1M7PA 4IWWA 1XBVA 2TPSA 1YPIA 3DKLA 1JCLA 4PC8A 3C52A 1OYAA 3FLUA 3IGXA 3F03K 5FF4A 4LVFA 4LT9A 3EB2A 1MEWA 1P0NA 4PODA 2EHHA 8TIMA 4MVAA 3U2OA 4P61A 2G95A 4FNSA 3HPXA 3W1RA 1LBLA 5HJLA 5MHBA 1W1ZA 2BWGA 2QCDB 3W7MA 2YCEA 1PIIA 2ZTJA 1HTIA 3EXRA 3QQ1A 3GB6A 4XBKA 3G24A 3H55A 3LLFA 4D2JA 1PE1A 2C16A 3KRZA 4AH7A 3W1MA 4LRSA 3UWZA 5C55A 1F7BA 5CPLA 5CG7A 4ALDA 1KTBA 1GG0A 1H7RA 4UR7A 1LM1A 4N02A 4UR8A 1GVQA 3EWUA 1LROA 1YLVA 2FB2A 2ZRZA 3S1WA 2O7QA 3GDKA 4TU1A 2ZDRA 3W2JA 2DJLA 2C1HA 5AYZA 3VI2A 1A5AA 2EAWA 4FIQA 4H3DA 4UTIA 1NEYA 3USBA 1XUZA 4HT3A 5FESA 3OBKA 1FX6A 1OG0A 3PY2A 5CZTA 3PBWA 1QOPA 1SZGA 1VS1A 4Y8FA 4LC8A 3U6WA 1WX0A 4WUIA 4UCGA 2XFWA 1XDLA 3A9IA 1GEQA 3NPVA 3GDMA 1HL2A 5KMYA 3NQ8A 5BMXA 4OU1A 2Z6JA 3HJZA 3IVTA 3W6YA 3HG3A 4RZ5A 7TIMA 4DELA 3GDTA 3DFNA 2FB3A 1JVNA 1O60A 3W70A 1IXQA 2DZVA 4EF8A 3DKJA 2RDWA 1IXNA 3CC1A 2Y6ZA 4E0CA 3G1SA 3PG8A 2DZUA 1W5MA 1SZEA 3MWAA 2W0UA 4AHOA 4HPXA 1W5OA 2QDGA 2EGZA 2ATSA 3DU0A 4RCXA 2OJPA 4M5PA 3M0ZA 4GC4A 4OQVA 4LVBA 3DHDA 5DCDA 2V8ZA 4WOZA 4JTEA 2GQAA 3JR2A 2BLEA 1Z41A 3HMJG 4N4PA 4UFLA 3S1XA 1XM3A 5AHEA 3LCHA 4YXGA 2ALDA 1FCQA 1KFLA 3WJYA 1CW2A 1YDNA 3SGUA 1UUOA 2FPVA 1E51A 1GQNA 3T4CA 1DQWA 4GUJA 1H7NA 1P5BA 4RX0A 4MY1A 3IIPA 4J9JA 3HQ1A 5LNUA 2PC4A 1X8FA 4NJHA 5D30A 3K30A 3UZ5A 4QM1A 1W3IA 2QR6A 4OE7A 4JNMA 3TQ0A 2ZA1A 2CZ5A 1UCWA 2X30A 2ZZ2A 3MJYA 3W7DA 3T55A 3ABOA 1XL9A 3FJ6A 2GVGA 3N19B 1S5VA 2VC6A 3MW7A 2WOQA 1SUXA 3QSRA 5KZEA 4CCCA 2V0TA 5F4SA 3WJXA 1XFBA 3P84A 3I6RA 3UWQA 5L9FA 4N9EA 1K8XA 5D05A 2YYUA 3W85A 1KM5A 1N8FA 3A5VA 4R53A 3M7WA 1OFRA 2NX9A 3O1NA 5C6MA 1KFBA 3KXQA 4JDYA 3ABSA 3W7OA 2FIQA 4K38A 3TC7A 1FWRA 2JGQA 4M6VA 4KWWA 1OK6A 3UY7A 3HIJA 1ONRA 2A2IA 3G1FA 2DJXA 5F4XA 5KINA 1KM4A 3QZEA 3LV6A 2RDUA 3LBCA 2WNQA 4LV9A 1SSDA 1O95A 1DV7A 3F4NA 4MLRA 1JUKA 4HPJA 4NJKA 4R7JA 1VYSX 2RFGA 1PS9A 1TIMA 1Y0EA 4HSOA 4LVDA 3L21A 3Q37A 2I14A 1RVGA 2NWRA 2Y7GA 3ABRA 4A2SA 4LNYA 1VRDA 2E68A 3W7KA 2WSQA 3PC0A 4UNLA 1JULA 1OYCA 1OF8A 1PHQA 2QAPA 1DJNA 4UC5A 4I9AA 3BGJA 3NQ6A 3N2MA 2CFFA 1WBHA 1Q6LA 1D3HA 3HGJA 5CPMA 2QCEA 2NUYA 3RMJA 4O52A 5FEPA 1QAPA 4OT7A 2ABAA 1LOLA 1O4UA 1GTHA 1H7OA 4BK9A 3TSDA 4MUZA 4Z1CA 2OMAA 5BW6A 3SFKA 2R8WA 3NZ1A 4FX6M 5G2HA 1TPEA 3T78A 2V30A 4UTJA 3DAQA 3NDOA 4Z1BA 1VLWA 4JIQA 3NQEA 4JGDA 1U5JA 5D03A 3NZRA 1KFKA 2Y62A 4NVTA 4MJMA 5HWMA 4QIUA 3W2NA 4HN4A 3B8DA 1WAUA 4UFKA 3JS3A 3WK0A 1SW3A 3G3DA 4KFNA 3BG5A 5FEZA 5KTLA 1OFQA 5I3IA 2QCGA 5E1QA 1QMLA 1C8VA 3U8GA 3IV3A 2CZDA 4Z08A 5D09A 2ZTKA 3C0JA 3FEMA 5LNSA 3W73A 1IIGA 3W72A 4MZYA 2Z2UA 2RH9A 1N55A 5ABTA 2Z0IA 2QKFA 5K4ZA 4JICA 2FTPA 1O5XA 1HG3A 2NV1A 3CIWA 5K3VA 2QJGA 1W37A 4DF2A 2GPTA 3LTYA 4O17A 5C2XA 3MP4A 1OX5A 1CI1A 3MYOA 1XC4A 2P10A 6TIMA 1AL8A 3KAOA 4PEKA 1PV8A 2QAFA 4GWEA 1IXOA 1YTDA 3LM7A 3UWYA 3N2XA 1EA0A 4WOQA 5AOUA 3IIXA 2J9YA 3TFXA 3W74A 3C2VA 1FWSA 3LCGA 5DCEA 4PA8A 1TV7A 3G1VA 3DI0A 4E2BA 3TUUA 1KLYA 3CEUA 1J4EA 1VYRA 3BVJA 4NZFA 2QJIA 3N3MA 3C56A 2QCLA 3A22A 3W1XA 3ZWTA 2WKJA 4BWLC 5K9CA 2PRHA 1DOSA 2Z1BA 3BO9A 1FBAA 2UV8G 4ZQMA 1GZGA 2B7QA 2WJZA 4WD0A 5LHFA 3WJWA 4LU0A 5D2TA 3QEZA 3S9YA 1JCMP 1GVRA 2WQPA 3Q2DA 4O18A 3LGEA 1FDYA 3TKFA 3C8FA 1XXXA 3NQAA 2NLIA 2ZA2A 3QH2A 4JIPA 4M6QA 3S8HA 3T44A 3QSTA 4Y9AA 5DELA 3HG5A 2ZCGA 3STCA 4UTLA 1GYLA 2ZYFA 4IOTA 2C14A 4JYFA 2H8XA 1S5WA 4I7WA 1WA3A 3G1YA 4MZ1A 4N2YA 5EL1A 4A3UA 3KRUA 3DGRA 1R2TA 1DQXA 3RK8A 4O4VA 3A5FA 2C3ZA 1G7VA 1KA9F 1TV8A 4LOCA 1G67A 1MSSA 3QMTA 3VKJA 1VYPX 3O15A 3EKLA 3TE9A 1WV2A 3PSVA 1EEPA 4ZQPA 1JUEA 1FWWA 3NAVA 2NXHA 1TTQA 2GJLA 5U4NA 1LORA 3G1AA 1QPNA 1T8XA 1OJXA 2NX1A 5AHLA 4WY0B 3W88A 3UYCA 3W3OA 3G1DA 4L4LA 4QNWA 2E1DA 2HS6A 2J9ZA 3M6YA 1FWTA 4YCPA 4UMBA 2VEIA 3GKFA 4LC6A 4BI7A 3E49A 1I2OA 2VELA 2BXVA 3NPXA 3L67A 3NM1A 3NQDA 2HS8A 4MPQA 2YZRA 1H1ZA 1VZWA 1YYAA 1MO0A 3BGGA 1G4PA 4XTDA 1ZENA 4DPQA 5D2YA 2ABBA 3G0UA 3F4WA 2YYTA 3IIZA 3LCLA 4IPJA 5KITA 4ICNA 3RFAA 4HNVA 2JKPA 4RKAA 3A23A 2JGYA 3M44A 3TCEA 2H6RA 2NWSA 3VE9A 3D0CA 5HUOA 1S5TA 2Y70A 5SWUA 2E5DA 5CZSA 3WK1A 3KX6A 1XBYA 2O7SA 3L65A 2ISVA 1GT8A 3CIXA 3P8JA 1MEHA 1VCGA 3L68A 3Q58A 3PG9A 4UTUA 1FWNA 1Z48A 5GVJA 5DY3A 4O50A 1VGAA 5F2MA 2HTMA 3LTSA 2V5BA 3P5ZA 2A21A 1P0KA 4I7VA 2E6FA 3NL6A 3FIGA 2Z6IA 3QPZA 5EYWA 1QDSA 3RF9A 4ZL1A 1GYNA 4KWVA 1QNVA 3FKKA 4AHPA 4AF0B 4OGZA 1Q6QA 3LERA 1TYGA 1YTKA 3NQ2A 3TAOA 3EWZA 4RXFA 4BI6A 3EXSA 3TQKA 3W7QA 1SPQA 4O54A 1SR9A 3PR2A 4AHQA 2FPTA 3C6CA 1TCDA 4C1LA 3W7NA 2CLEA 4K36A 3THAA 4UUIA 1KV8A 3EWXA 2GVLA 3HGRA 3P5YA 3W2UA 3AO0A 3CM4A 2V2HA 3P80A 4O8RA 2XN2A 3BARA 2W79A 1LZOA 3S42A 1W54A 1R2RA 2GJNA 3OEXA 3OHIA 3EX2A 4NNBA 3TXZA 2Y7DA 2NV2A 1JRCA 2E09A 2F7FA 2V2CA 3LRMA 3P60A 3MUXA 3CWOX 4FO4A 4FXRA 1OFOA 3I7RA 5I3KA 1ZFJA 5FF2A 3EEGA 4EOUA 4B5NA 4YWIA 1EPXA 5LZLA 3LHZA 4K7YA 4TX9A 5HWNA 4DPPA 3P67A 2OZ0A 4O11A 4O0ZA 1WDWA 3C2EA 2NX3A 3PVFA 4MFDA 3LCWA 4GFSA 3P74A 2Y7EA 3LLDA 1W56A 4PCFA 5G1YA 1WOBA 1QO2A 4A21A 1RQBA 2FPYA 1ML1A 4FNRA 2BTMA 1ZAHA 3CHVA 5E0KA 4UFHA 1ZNNA 4JYDA 3IRDA 3P81A 2JK2A 4LRTA 4X22A 4HNTA 4AEOA 6ALDA 3G0SA 4BI5A 4K6AA 1H7WA 2ZRUA 1SFLA 1KM6A 2WNNA 4TMCA 3PM6A 1FCVA 4FNUA 4MY9A 4BFAA 3HPSA 3S1VA 4NZJA 1O5KA 4W9TA 1QO5A 3ABQA 1AMKA 1S3HA 2QUUA 2RHGA 2Y85A 1W31A 4ZQRA 2CLMA 1FXQA 1I2QA 3PF3A 4JTJA 3QRHA 4Y96A 4GE8A 2Y88A 4JTFA 4IXHA 4K37A 3BW2A 3W7HA 2YR1A 1H62A 2PE4A 4U28A 3RLVA 1EUAA 1ADOA 1SZFA 2G5WA 5DBUA 1GOXA 4JX6A 4NX5A 1VR6A 4EF9A 3OVRA 3O16A 2WPBA 1TB3A 3THQA 3BW3A 4RV8A 1TPDA 3B06A 5TQLA 3HGSA 4M19A 3QW4B 2FLIA 3S6DA 1ALDA 4X3ZA 4HKPA 3TSMA 3LX9A 2QUVA 2VXNA 1D3GA 4HIBA 1K7FA 3V75A 3HPZA 1VQTA 3GXPA 1SW0A 2A7PA 4GJ1A 4K8HA 1B9BA 4RK8A 3PB0A 4GUIA 4PL2A 3TU9A 1LBFA 5AHFA 5K4XA 3L66A 4E2DA 3B0UX 2C13A 3NQGA 4XZ9A 3GK0A 1H7XA 3GNDA 3L2IA 1LOQA 4CCEA 1YDVA 2WSYA 4QQ3A 4O12A 1OFAA 4LTSA 1ICSA 1N7KA 3L9CA 1RR2A 1QFEA 5FF3A 1AK5A 3GAKA 4JTLA 3WK2A 2H3BA 1FXPA 5F2LA 4FNQA 4XUGA 5DBTA 3E0IA 1UJPA 1VCVA 1QWGA 1VHCA 4HHPA 2A85A 3O6DA 5K9XA 3PUOA 5EPDA 4ORMA 2B7OA 5AC6A 3GVGA 4WXYA 3TROA 5HWJA 3FJLA 3PB2A 4P2VA 1GWJA 1LRTA 4IMEA 2A7NA 1OK4A 1TTJA 3TNOA 3DBPA 3E9AA 3EX3A 3RNDA 4IMDA 4DBEA 4AMAA 1YXCA 2QCFA 3G18A 1FDZA 2QCMA 3S5NA 4QITA 4DF1A 4YL2A 4O57A 1M7OA 3WJZA 1QOQA 2QCNA 1GVSA 3L5LA 3W2KA 1B4EA 3TQVA 1ZAIA 2ZQ0A 5FF0A 1TTIA 2YW4A 3TH6A 5EKYA 5BOOA 3T7VA 1SO4A 2YDAA 2JBMA 2X1TA 1K8YA 1W5PA 4FNPA 4BWLA 1F2JA 3TA6A 1RQEA 5G4WA 4QAIA 3R12A 3W7PA 3W2LA 1VPXA 5G1TA 4CQAA 1YTEA 3M41A 5KZMA 1KFCA 3I7SA 3QW3A 1TPWA 1DKWA 5DCBA 3P82A 3TIMA 1G6CA 4Z0JA 1DJQA 4LV4A 5D32A 2E77A 1K03A 4LUJA 4N9CA 5DLCA 1JRBA 2Q3RA 4M7TA 1B57A 3EX6A 4DEFA 2E6YA 1H61A 3ELFA 4WQ6A 4WXZA 3EWBX 1ME9A 3UQNA 3DHFA 3INPA 2C18A 3E02A 3LHYA 2CZEA 1QPQA 3M5VA 4O14A 3MYPA 2A5HA 4YLWA 5I3FA 4QNEA 4LVGA 1G4SA 4YMZA 5AC8A 4NUWA 1SO6A 3NEVA 1ICQA 1R2SA 2VKZG 5EY5A 1HO1A 3TMQA 3M47A 5AHMA 4JTIA 4NJIA 2R94A 1TPH1 4IMGA 1KFJA 3MI3A 4NQ1A 4JD4A 3MBFA 2ZRWA 1AW5A 1DBTA 3STGA 4A29A 1TV5A 3NM3A 3OVPA 2CLIA 1T0OA 4LWWA 3SI9A 3MO7A 4UFJA 3GYEA 1JCYA 4WY0A 5LNRA 3MI6A 3QM3A 5A8GA 3PUDA 3NQFA 4MJZA 1QPRA 1WYIA 5G2IA 1W0MA 3QMRA 4MZ8A 1THFD 2VFHA 4RR4A 3DFTA 1C29A 1G4EA 1R46A 2VEPA 3HOJA 5EMUA 2ATMA 4QISA 2YPIA 3S0CA 2J88A 1TRDA 2RKXA 2H90A 3FFSA 3NQCA 4UFMA 4GUGA 4JTTA 1TMHA 2Q8LA 4CQ8A 1I2RA 3P8IA 3LCFA 3W7GA 3I65A 4IJBA 4I7UA 4N6FA 2J6XA 2AAMA 2E6DA 3S5YA 3HGOA 5DXXA 4FHAA 1OFPA 4FNTA 4HSNA 3B05A 3LOTA 4NNCA 1L6YA 2QEZA 2FFCA 3TV8A 4WJEA 1OABA 4DO4A
chains in the Genus database with same CATH superfamily
2W9MA 3ITCA 1GTEA 3LTPA 1V3KA 3L0KA 1RJPA 4LYPA 1A5BA 1TWIA 1UH4A 3WLTA 3QGVA 3GIPA 3H2NA 3ZVIA 1E4LA 4MM1A 3NSXA 4YU1A 3LSBA 4M80A 1XBXA 3W01A 1EC8A 5HPCA 1XCXA 4A8LA 1JYXA 3ZT7A 2KZHA 2JF6A 1CT5A 2VENA 4WCJA 1JD9A 1C9DA 4JN7A 5A5WA 3UNDA 1BEUA 5HR6A 4PFMA 4AF0A 4DRSA 3AFBA 6XIMA 2ISWA 1T96A 3W7JA 5HINA 3MMDA 4C60A 2QPSA 2XDFA 4G7EB 1NQ6A 1PZ3A 3B0PA 3WUEA 3MMUA 2I1OA 4DUWA 3G22A 3SCOA 1GW9A 4J4KA 2OEJA 4WHBA 1Y5VA 3GR7A 1BKSA 4U33A 4E38A 3PJUA 4LEFA 1E15A 1M53A 2Y8VA 4FXSA 4HCDA 3MSGA 1F74A 4AFYA 4NJGA 2PCQA 1NP2A 1EX1A 5FIPA 2CKSA 4MADA 4HNUA 1WDPA 3GDRA 4Y9NA 1G69A 4HA1A 1ICPA 2B0MA 3WL0A 2ZUVA 4UZSA 2MANA 5GNXA 4DO5A 1C7TA 2GQ8A 4Z0SA 4IPIA 1QR7A 2GGEA 1K3UA 3E6EA 4DBUA 3I6TA 2WVTA 1QI2A 1ADDA 4Y90A 1SVDA 2VZVA 1HP5A 4XD3A 3O6AA 4XTIA 2I9EA 2A6LA 5LYRA 3AYVA 1QI0A 3FA5A 2A3BA 3NL2A 3IWPA 3W1PA 2ZZ5A 3ZFHA 2WWCA 3ANUA 3GTXA 4DXVA 3O2LA 1L8NA 4XKYB 3A6OA 3YPIA 2D0FA 2FVMA 3CT7A 2A3LA 4NNAA 2ZRYA 3GR8A 1RV8A 4JDBA 2X2GA 4HNLA 1Z69A 3DFSA 4ROQA 2PCEA 3CQJA 5CZ0A 2V5KA 4MYXA 2F38A 3PULA 3F2DA 4KS0A 1X7FA 2Y7FA 2OODA 2XYLA 1OB0A 2ZZ4A 4CD8A 3VK5A 3TAKA 1S2CA 2J8TA 3CGTA 1JF6A 4U3CA 1ZJIA 4O4WA 1F76A 4H9UA 4MKNA 1J18A 5LA1A 1EIBA 1NOUA 1NELA 5CGQA 3VX0A 1XRVA 3AMKA 4YVVA 4JKLA 3FYPA 5AC5A 1R47A 2CWNA 4M6PA 1F6PA 4TMBA 3MUY1 4CQCA 1AVAA 5EMYA 2QQ6A 2QUMA 1UR1A 1XDMA 2EPLX 3Q94A 2CHOA 2ZIDA 1XI3A 4BA0A 1HNYA 1M3UA 4D6CA 2BVTA 3BG9A 5HK4A 4V15A 1BVZA 1GNXA 1WE5A 1GVEA 2E8ZA 2R1KA 4KW2A 2OWWA 3VXGA 2ZWZA 3N4EA 3AJXA 1B3VA 1GVFA 2CLFA 1XIHA 4JNZA 4L7ZA 1TV3A 4BQ4A 1G94A 1DJIA 4MB5A 5RUBA 3A21A 5D2VA 5HULA 1QW8A 2QW5A 2PGFA 4GHRA 2XH2A 3TN5A 4DLFA 1Q45A 4PMNA 1LYXA 1FHDA 5G5IA 3BLEA 3U0HA 3RLUA 3OGRA 4S23A 2OT0A 4IPNB 3W82A 4TX8A 1RK5A 1W1IE 1GJWA 4JN6A 3T9PA 4GX9A 3QJAA 4M7SA 1J0IA 1TQJA 2YFNA 4TIMA 5REQA 4C7FA 3GD6A 2P0OA 4GIEA 4E2VA 2VEFA 3CYVA 3FHQA 1LTDA 1G01A 1EDQA 3SURA 3V3WA 2OT1A 4IL2A 2HRWA 1Z9AA 2QF7A 1FFQA 5E70A 2INFA 1KV5A 1EF2A 4LCRA 2E9BA 1XD0A 3WUBA 1DIOA 1XKYA 2PLKA 1GG1A 4TO8A 4QJ3B 1QU4A 1QTWA 1Y65A 2OO6A 4XQ6A 1QPKA 3KHDA 1FCUA 3LCIA 4JEJA 4Z2JA 1X1NA 4KRTA 4LAZA 2C15A 4YNGA 3TDFA 1DHPA 5I03A 5I5RA 3M5YA 1BVNP 2E5CA 3CNYA 3HO8A 1WZAA 4ORIA 5EB8A 3C8NA 3RPTA 4UTTC 4YCOA 2C19A 5CAHA 8RUCA 1LLZA 1R6WA 4JEQA 5CC5A 4HMCA 3EMQA 3PZGA 4JN8A 4XO7A 2ZRVA 2DPEA 3CHEA 3I7QA 1ITUA 4NAFB 4J27A 5F4WA 3UNTA 3TMLA 1XLCA 1LL7A 3UWEA 3LG3A 3W07A 1IWPA 1KNWA 3CU2A 1Q7QA 3K13A 3XIMA 2X1UA 4GI6A 3TC6A 5CPSA 4UIOA 4ZCWA 1OHLA 3ZLGA 3MHUA 3DZ1A 3SSZA 3M0LA 4RPQA 1TTPA 4KIRA 4UNKA 4KKXA 2EBNA 4ZB2A 3R5EA 4EE9A 1BRLA 3CUIA 3VFLA 4J3WA 3V16A 1H2JA 5AHNA 3ZT6A 4US6A 2FH8A 2DT1A 3QLLA 1EIXA 3GC2A 1S39A 4N7QA 1UWTA 3C2FA 2HJPA 2WSRA 1QBAA 2V67A 1JCNA 3GFYA 3LRLA 4H6KA 2B4GA 4HPHA 1X6UA 4ZOBA 3SGGA 1CB7B 3TA9A 4O1CA 3VIMA 4B90A 4DJED 3M4HA 1OX4B 2X2YA 2WW5A 3NO3A 3RM4A 3P3BA 4JX5A 4DN1A 2VT0A 3NO5A 3MHGA 2ISSA 5FJJA 2XH7A 2WO5A 2VVNA 4UCFA 1R3WA 2QV5A 4DO6A 2XSBA 3WY1A 3RX2A 3U4AA 2J7GA 2CU0A 4NL1A 1TX0A 3MHFA 2YB1A 4WX2A 1E0WA 3OG2A 3OOQA 2BNJA 4JIHA 3FSUA 3PUEA 2AGKA 3NA8A 1PKYA 3W0KA 3HV9A 4GCAA 5HAOA 4HHHA 3M1ZA 4GI8A 3TJLA 7ODCA 3TJXA 2FGLA 3TC3A 3WH5A 3R58A 2V6AA 3T81A 3NGJA 1BWLA 1UD3A 1K8CA 4IUOA 2YW3A 2YOCA 2C1IA 4JFWA 3SY5A 1OD0A 3P7YA 4RNHA 3C86A 1B30A 3QY6A 2DDXA 4JCMA 2POTA 4DJFD 4FPSA 3WMBA 4DNHA 3MZNA 5IOBA 2YDQA 4U2ZA 3RITA 4MY8A 4JTUA 4IX2A 3EKGA 5HR7A 3LV5A 3W7EA 3NQVA 2J6VA 1BYDA 2MNRA 3JZEA 2W6RA 4HCHA 5AFDA 3S5ZA 3VE7A 1LRNA 2VFDA 2QDHA 1TRIA 2AAAA 3VIJA 4O1AA 4ADUA 2X1SA 2V3DA 3SM0A 1E4MM 2GFTA 3KVJA 3W7RA 4QG6A 2QIWA 2NW0A 3M16A 5HQEA 3ANYA 3LXCA 5LXEA 3PTKA 3QYQA 4TR9A 3VIOA 5M1TA 4ONVA 2QLYA 2PRLA 3GVQA 1XLKA 1EOKA 3UY8A 3PBYA 5C70A 2DQWA 4HP5A 3DECA 4XKYA 2ZZ1A 4UTWA 2CLHA 4LBSA 3WK3A 2GQ9A 2IMRA 1UYQA 5CSRA 1KQZA 3DGBA 4TVCA 4XZHA 3KL0A 4PB4A 3DFQA 1CLVA 5F7UA 1FWDC 5D2WA 3AYRA 4EP8C 2IQDA 3W75A 3MU7A 2V69A 1WZKA 2O9PA 4URIA 3AHZA 1AH3A 3ZYZA 2VNCA 1EHNA 3VNMA 3BUVA 1EDGA 3KM8A 4JTKA 4D6FA 2EXOA 1HQTA 3OZYA 3KRSA 1XG3A 1P48A 4XWUA 2XGIA 1IT8A 1WUFA 1ZUAX 3TYDA 3WNKA 4XZNX 4O1BA 5LSMA 4H6EA 5A69A 1F61A 2J77A 3FY1A 1GOMA 1KM3A 2WSPA 2GJXA 3GXTA 4AZ5A 1JFXA 3FVDA 3OO2A 3CTTA 3R25A 3GXMA 2VC9A 5CC3A 3CB8A 4IIHA 4AAJA 2W4XA 3RXZA 1KGUA 3QV6A 3A12A 1TR1A 2P8CA 3ARTA 4AZBA 3W22A 1BQGA 3W1QA 1XSIA 1ME7A 4PEEA 3W00A 1F6KA 4FEZA 1ZJAA 1XLGA 2GJPA 1V0MA 4JYEA 1VC4A 5DN1A 3AS0A 4UTHA 1I45A 4HHLA 5TIMA 5K9DA 4IGMA 4P7QA 3HTWA 1K02A 4M8UA 2JALA 5HNTA 1CXHA 2FZBA 1I8JA 3A24A 4B5WA 2Q3OA 5FEXA 3B8UA 5AC7A 1F5ZA 4KWUA 1RQHA 3MVIA 2CZFA 1RD5A 3UZWA 3EWCA 3IIVA 5T8GA 3EMCA 5T9CE 3S5OA 1MXSA 2PD9A 4AD1A 1RLDA 4INFA 4G5DA 3USZA 4R34A 3H4WA 4LEQA 4NRSA 3WNLA 2NVAA 2G96A 1VD6A 3E74A 4DHGA 3FKRA 3QY7A 3SR7A 1E9ZB 4JR5A 4UTKA 1FQ0A 1PZ1A 4PULA 2HDJA 3RX4A 1J8VA 1RBLA 3RMEA 4YPJA 4GNKB 1EC7A 3MV11 1UH3A 3BAXA 4EXAA 1BTMA 2BOEX 3EWWA 8XIMA 3B9OA 5CGTA 4C7DA 2D2OA 5KZ6A 3B0XA 4J3UA 3M0HA 1L8PA 5IBXA 4ADTA 1W9XA 4CQ9A 3RU6A 1E0XA 4IMAA 4LS1A 4KIEA 4U10A 4JTHA 3SUTA 4DWSB 2GDQA 2PLJA 5I2UA 3VKCA 3RCYA 3RR4A 4HNNA 3TYBA 1PKNA 3UWWA 1AW1A 3AICA 1JCXA 5ABGA 1KM1A 5IDZA 2WC3A 4AU0A 3ENLA 3MMTA 4L9XA 2TPSA 1SR0A 2ZE0A 2OWXA 1GK8A 4XAZA 3FLUA 1UIOA 4LB4A 4LT9A 5A6BD 1MEWA 1AJZA 2VM8A 3QQWA 5MHBA 1P1MA 4P7LA 3W7MA 2YCEA 5CJNA 1HTIA 1U1JA 3H55A 1BHGA 1PE1A 2C16A 1JPMA 1F7BA 5XIMA 1QHOA 1JGIA 3LD5A 4N02A 1GVQA 4PMQA 2FB2A 1YLVA 2CIPA 4GVFA 3S1WA 2O7QA 1BD0A 2C1HA 1ZPTA 4JQ3A 2CXGA 1A5AA 4H3DA 3WMSA 1NEYA 1GOKA 3MWCA 4AZCB 3USBA 1XUZA 2HK0A 4WF7A 5CZTA 2A3EA 4CU8A 1SZGA 1RSCA 4LC8A 2FVLA 1WX0A 4UCGA 3NPVA 4H7ZA 3NQ8A 4NILA 4AEFA 4A05A 4NASA 3R8GA 4TOQA 4C90A 3F4VA 4DELA 2OZ3A 1GCYA 1Q8JA 1TE6A 4C6PA 4S3AA 1O5QA 4NZCA 1V0LA 4ZSUA 2IXUA 3CZKA 3RG6A 2Y6ZA 1R3RA 3UVIA 2DZUA 1SZEA 1TWDA 1W5OA 2VI0A 4CCZA 2EG7A 2QDGA 2YKKA 5FOOA 2WMKA 2ATSA 3DU0A 2OELA 1P6BA 7CGTA 4M5PA 2J62A 3DEQA 3M0ZA 4OQVA 2V8ZA 3GXDA 4PTWA 3XINA 3IJQA 3JR2A 2BLEA 3F2BA 1S3TC 3SY8A 3LPOA 1E73M 2Z2BA 4W4QA 3LCHA 2POZA 4G2DA 2PDMA 1KFLA 4HA0A 1YDNA 1M65A 1Y5WA 1VBJA 2FPVA 1UD8A 4H19A 3NIYA 1J11A 3LSCA 5LNUA 4B5TA 1KB3A 2VX6A 1W3IA 2QR6A 1RXOB 1R3SA 1UCWA 2X30A 3MJYA 1E4IA 1EZ2A 5I79A 2AQVA 2Z28A 2DW7A 2GVGA 2QNEA 2WOQA 1SUXA 1IEIA 3I4KA 4IP5A 4B3KA 5KZEA 2V0TA 5F4SA 3CZJA 3UWQA 3UZXA 1OINA 3S83A 4N9EA 2NQ5A 1K8XA 3S1GA 5D05A 2GL5A 2V5DA 3BCFA 4BHYA 4ZENA 2DT3A 3BTNA 2BBFA 3EMZA 1PTGA 2CHNA 2E4TA 3CH0A 1RJQA 1KFBA 4IQJA 4PBGA 3VKKA 1TFVA 4IPLA 4EANA 3W7OA 1D7KA 1QRQA 2JQXA 1V6TA 2BVWA 4K38A 4QSFA 3TTEA 4EPDC 2G3MA 1Q85A 3AHYA 3R0UA 1OK6A 1Q6DA 2FVKA 2DJXA 5BXRA 5XINA 3LBCA 1E3XA 3MJMA 4JKMA 1JUKA 4FP1A 4R7JA 1VYSX 1MW0A 4CN6A 1GORA 4B5VA 3H21A 2Y7GA 4FALA 3CYJA 4ACZB 3F4CA 4UNLA 5B7ZA 1JNDA 3D6NA 1PHQA 2QAPA 3BGJA 2QGYA 4PCNA 1Q6LA 4UZUA 2D0GA 3BJSA 1BTCA 3PPHA 1XQLA 2CWXA 2NUYA 5HOSA 5FEPA 1DWFM 1QAPA 1O4UA 1H7OA 4JQ1A 4BK9A 3GVRA 2GUBA 4PCPA 3TSDA 1PX4A 1L2QA 4B91A 4LYKA 1FWBC 4FX6M 3AS1A 4Z1BA 3KBJA 4E3TA 2GDVA 4JGDA 5AY7A 2VO5A 5LA2A 2AL2B 3W2NA 4HN4A 3B8DA 1WAUA 4UFKA 1CLXA 3JS3A 3WK0A 4AXNA 3G3DA 3LZ3A 4XAGA 3BG5A 5FEZA 3AIRA 4PUUA 2F61A 2QCGA 3OLIA 1S5NA 5E1QA 4GO9A 1EL3A 1UR4A 4BQ5A 4GVHA 5LXXA 1XCWA 3FA4A 4Z17A 5LNSA 4YHGA 3W72A 2PDUA 2PGRA 2QKFA 5K4ZA 4HOZA 2F6UA 2QMJA 3ONBA 3IJ9A 1XRFA 1O5XA 1HG3A 5K3VA 4XZBA 4F66A 5E0CA 3VNIA 2PDJA 3W02A 3MP4A 1OEPA 4CEUC 3GM8A 4GQBA 4PEKA 4E5TA 1IXOA 4Q8TA 3WNNA 5AOUA 2NQHA 3W74A 1FWSA 3LCGA 2GSHA 4PA8A 3ARZA 3CEUA 4WDXA 7ENLA 2QJIA 3ZO9A 4DIAA 3C56A 3E1F1 1ZS2A 4JTQA 3MCNA 4C1NA 1F3TA 2UV8G 4ZQMA 2B7QA 4MUPA 3HN3A 1US0A 2D3NA 1HX0A 4GJIA 4LU0A 1RBOB 3QEZA 4GVIA 3LGEA 4HOXA 5CBJA 3C8FA 3SRFA 3NUKA 1DJGA 4OTKA 3KBMA 4JIPA 4M6QA 4IIGA 4Q4PA 4ZE5A 5EU9A 2OWCA 1E6XM 3UU0A 1DE5A 4MZ1A 4N2YA 4A3UA 3VGGA 3UETA 3CQIA 3V4BA 2BODX 3RK8A 4DWSA 1AA1B 4O4VA 2QDDA 1XLBA 1TV8A 2YL5A 4PSRA 3VKJA 1UWIA 2GLKA 2UZ9A 1ENUA 3W26A 1MRQA 3CBWA 1MNZA 4H6RA 3UXLA 1TWWA 1TTQA 2GJLA 2UWFA 3G1AA 2OSXA 4L1XA 3A13A 4MAVA 3GHUA 4WY0B 2D3LA 3VDGA 3W3OA 3G1DA 3H2FA 4QNWA 2E1DA 4YCPA 4UMBA 3FGCA 2OYLA 3PZUA 1I2OA 4B2DD 3L67A 3NM1A 2PB1A 2HS8A 3NQDA 1A4LA 1G4PA 3MSDA 4DPQA 1UUQA 3SCTA 2PDLA 1UKSA 2G3JA 4FR1A 1K1DA 3LCLA 3GU2A 4HNVA 2JKPA 1KRCC 3ZZ1A 4DWDA 2YL8A 4CU6A 1I6NA 3D0CA 5HUOA 1CXKA 2Y70A 5SWUA 3KX6A 1TA3A 1NWSA 2ZUNA 2O7SA 1PDZA 3WDRA 2ISVA 1VIWA 1GT8A 3RRAA 4HU4A 3Q58A 4YYCA 4UTUA 3E0FA 3AMCA 1MMFA 5D9MA 1Z48A 4XD6A 5DY3A 4L6OA 2NQJA 4D6GA 3H4GA 4L9ZA 2A21A 1P0KA 4GY0A 4IQDA 1BGGA 2WMJA 3FN9A 3FCPA 4C6MA 3CMGA 3FIGA 4C65A 5EYWA 3LU2A 4XVEA 3RF9A 4K3ZA 5ENLA 4LYRA 3VOCA 3V18A 4DLMA 1JDCA 4OGZA 3CMFA 3SEPA 1WNOA 1MRAA 1Q6QA 1EYWA 1AZ2A 2GGGA 3TAOA 3K4DA 1SPQA 1SR9A 2EQDA 3LQGA 4XBJA 3EOSA 4C1LA 3W7NA 2QPXA 3HPAA 4LX4A 3THAA 1QVBA 4GY1A 1RD6A 3P5YA 3AO0A 3CM4A 2RGLA 4O8RA 2XN2A 3BARA 2OR2A 1LZOA 3WDIA 3S42A 4I9JA 1W54A 5I7GA 4EAMA 3OHIA 2F7FA 2V2CA 4DJFA 1Q65A 4C7GA 5I3KA 1ZFJA 2QMKA 3EB3A 4B5NA 3WH6A 5CPQA 3LHZA 1UWSA 3P67A 1V6VA 2OZ0A 3DESA 3CK5A 4O11A 3ARXA 2NX3A 3PVFA 4W5UA 4GFSA 3QY8A 2Y7EA 1S38A 1ISXA 4PCFA 3AXKA 3B40A 1QO2A 1RQBA 2FPYA 4FNRA 3WH9A 1K9FA 1ZAHA 3H2CA 3P81A 1Q6FA 2JIWA 2Y1HA 4J1OA 4AEOA 3G0SA 3VGFA 4K6AA 1H7WA 1TZZA 1GZ1A 2X0HA 3BC9A 3PM6A 4Y7EA 3HPSA 3S1VA 2Q6ZA 5FJPA 4W9TA 1QO5A 1S3HA 1NWUA 3KWXA 3GNPA 2Y85A 4DJEC 4NZ3A 1W31A 4ZQRA 3WEOA 3IS4A 4JBRA 2REQA 4JTFA 3HFYA 2CBVA 4HU8A 1LQ0A 1ADOA 1GOXA 1KXQA 1QI4A 1CXIA 1VR6A 3OVRA 3N13A 4GQ0A 3T0AA 3UG5A 1TB3A 3SFWA 1TR9A 1OGBA 3WQ4A 4RV8A 5TQLA 3QFWA 1XR2A 5IHRA 2FZ8A 1J01A 4MNMA 3SCWA 1KWGA 1K7FA 1UD2A 2A7PA 4K8HA 5I78A 5FJTA 1QBBA 1LBFA 1DQUA 2VGIA 1E72M 1N2VA 3WF1A 3GK0A 1LOQA 2Y5EA 3H12A 2OXNA 4CCEA 3EPMA 3W37A 4IFRA 1GOQA 4I5UA 1FH8A 2CKRA 2QV4A 3OIHA 1OFAA 1ICSA 3L9CA 5A6KA 1AK5A 3GAKA 4JTLA 5A2BA 1NDVA 4UOQA 1VPQA 2ZX6A 3T0DA 2YCIX 1FXPA 4HYWA 4AIEA 4DJFC 2NT0A 2OEKA 1F4HA 3GVGA 4WXYA 4XZMX 4S3CA 5IFPA 1YE4A 4V33A 4YYFA 3LY0A 1KR0A 4E4PA 3MUZ1 4ASTA 2YJQA 3IJ6A 4PE8A 2EEXA 2WXDM 2Z1KA 2QCMA 4DF1A 1M7OA 1MUWA 3FHAA 3WJZA 3ALFA 1AD4A 1W1PA 2QCNA 3KP1A 1EGMA 3AISA 3W2KA 1B4EA 1ZAIA 5FF0A 2E28A 3KOYA 4L6HA 2YW4A 5EKYA 3FVMA 4G56A 2YDAA 2ZICA 2X1TA 4KETA 4QAIA 5G4WA 3CZ8A 3BV7A 4I6VA 2CITA 1EA9C 4H01A 1WB0A 1E40A 1TPWA 2HNEA 5DCBA 3VDAA 1NH6A 4MB4A 3VA8A 4CUCA 4HPGA 3PPGA 4AW7A 4LV4A 1GQJA 1HZYA 4L64A 5A3HA 1KKOA 3WD0A 1BF6A 3GRIA 2JEQA 3GS6A 1CGTA 2BY0A 3N12A 4DEFA 5M03A 4B3LA 1DWJM 1FWEC 3WF4A 3GIQA 3ELFA 5HPOA 4US5D 1YMYA 1IEWA 1R9YA 3M46A 4WXZA 1HJXA 4IGNA 1OADA 2PC8A 3GSMA 1P43A 1CCWB 3WBXA 2QXWA 4QG9A 3VINA 1BPLB 1AH4A 4F0SA 1UG6A 3MYPA 4F79A 1CGXA 4H04A 1G4SA 4YMZA 4OKDA 4NUWA 4AIOA 1VJZA 1SJBA 5HDRA 1PUDA 1ICQA 1HO1A 3HV8A 3VUPA 4NY2A 3VGDA 3CT2A 1AW5A 3PN8A 3S2LA 3STGA 4A29A 5A6BA 2CLIA 2QYGA 3WLHA 4WY0A 5LNRA 1E1FA 1A4MA 1W9BM 1TX2A 4F2BA 4QG8A 3NQFA 1RBAA 3BAIA 3P2VA 4HNCA 3QMRA 1E6SM 1KXHA 1THFD 3MA8A 3WLMA 4HGXA 2NQ9A 1CGVA 7PTDA 1ONXA 3DFTA 1G4EA 3S0CA 4QISA 2YPIA 2QJJA 3THCA 2WLYA 5CLTA 2RKXA 1QUMA 3OGSA 2Y0FA 1JDAA 3PWIA 3W7GA 3FJ4A 2J6XA 4IIFA 2AAMA 2E6DA 3GVWA 4AY1A 1WCGA 1KR1A 3TYEA 4JHMA 1DIEA 2DVTA 3MT1A 3LOTA 1XPGA 2XFRA 2BDQA 2EPKX 3B8WA 1ZTVA 4WJEA 3R89A 5KZDA 1KBIA 3W1TA 3W6MA 3P14A 3GX9A 1QNOA 4MWAC 3C2OA 1BF2A 1XX1A 3PWGA 3N6QA 1AD1A 3O3RA 1LL4A 1ZBVA 4WLCA 1SFTA 1XQKA 5HA7A 5HANA 1K7EA 3W4RA 2E1WA 4OVXA 1W1YA 1KBLA 1Q7MA 1TWZA 4CVWA 4QS5A 4JY9A 3RM9A 4UQDA 4DZAA 1H1YA 3QTGA 4HA3A 5T26A 2WNZA 5EBAA 2WM1A 1J0KA 3SCRA 4WKAA 3AXMA 5D2XA 5A6SA 4UMAA 2XIBA 2GGHA 4LS0A 4RDVA 4RE4A 4RZ6A 3N14A 5DY2A 5CKSA 4JTAA 4GQRA 1L6WA 1VCFA 2OYKA 3LI0A 1UA3A 1ISYA 5CSSA 2NUWA 5G4HC 3LB0A 3LDVA 5CBBA 4AB4A 5HMEA 3FDGA 5FF7A 1EWEA 4HK7A 4V1YA 2B7PA 3BSHA 4OFCA 3AIQA 3F1QA 3F7JA 2DH2A 3O6CA 3TXVA 4K8GA 3BK0A 1IWBA 3PWAA 1XYCA 1NFPA 4ZBCA 4NU7A 1EX5A 3S2CA 5HUPA 4GZ7A 1BGAA 3VIFA 1U30A 3GO2A 4UXDA 2I5QA 2J4GA 1IGSA 3KL3A 1ZSXA 1DJWA 2DP3A 2DZWA 5D38A 5JXQA 2D2JA 1VFSA 2GGJA 1FVPA 2PRMA 4KWSA 1O94A 1LT7A 3KFTA 3O8AA 3EBVA 3C4UA 3KW3A 4NKCA 4AY7A 2PWVA 4ML9A 5DQPA 5LIXX 1UZDA 3AIUA 3TK7A 2FDMA 1F07A 2ZZ3A 3JVAA 1S2WA 4OBTA 1J10A 2A79A 5BZAA 2Z1SA 3DFOA 4B9YA 3G0XA 3GDLA 2OFJA 1UQZA 3T42A 3KCJA 4D6EA 3VPLA 1VP5A 4UQEA 1V02A 2G4FA 3B9DA 3DI1A 4B5XA 3HBLA 5ECUA 3KBNA 3TFCA 3ARQA 3QR3A 3SRHA 4HHMA 1TMQA 2PURA 3UESA 3ZJ8A 1DORA 5HXMA 4QLJA 2VP8A 4H9MA 1AL7A 1W3TA 4ERGA 1V3LA 5BNKA 1J5TA 3RCMA 2YCJA 1LWIA 1J0YA 5CC6A 4QJ5B 1NF7A 5EBUA 5DRIA 1Z42A 2G3IA 3ZR6A 2D20A 5E9AA 3KUMA 4GA8A 4QLLA 4XBSA 1OF6A 1B54A 2VD9A 4O53A 2PSNA 5MKGB 3CO8A 1EHAA 2VFFA 4AWSA 2FQIA 4Z2IA 5AC4A 2Z1XA 3NZPA 1IEVA 1E71M 1EP1A 2YCKX 3ONCA 3AQUA 3UXDA 5CPNA 2EPMX 4GNVA 2J24A 4JIIX 1XDJA 5T9BG 1UH2A 5F2IA 4MNJA 3T4WA 3NL3A 3MO4A 3S2JA 3QC3A 1JZ6A 4TV6A 1IE7C 4DBDA 3NDYA 1JEZA 4NG3A 1SU5A 4CN1A 4FX8A 3WL1A 1W3KA 1RVKA 3O6YX 3M7SA 3FX4A 2TMDA 4Z1DA 4F48A 4NSBA 1U1UA 3NVTA 4PMYA 4M1BA 5A6AA 3W1NA 1UWRA 3ITOA 3W2MA 2DZTA 2OO0A 2GQ3A 2ZADA 3DYPA 4PUNA 5FI8A 2BASA 1SO5A 3V5CA 5BMWA 3UVAA 1NU5A 1I4NA 4P8UA 3TSBA 4AD3A 1A50A 1R3TA 3K1GA 2BY2A 5LNWA 2ZUTA 1P1XA 4AUBA 3OG3A 4KT2A 4ZB0A 3I68A 1EGZA 5LKYA 4GPNA 1TSIA 1RPXA 1EOMA 3LM3A 3N4AA 3PZ9A 3OYXA 4D6HA 1KGXA 4HSHA 4CD6A 3VNDA 3N9SA 4J3XA 1O7AA 1M68A 1OM0A 2DZBA 1WBJA 4S38A 3WLSA 1EH9A 3LRKA 3I4EA 2ONEA 2R9RA 5AYIA 1EC9A 4ZR8A 4GX8A 4LQ1A 1JCTA 4IMFA 2VRJA 3SRDA 3QFEA 4F2UA 4GXWA 2DORA 3SO7A 3N9KA 1DJXA 5CPOA 4PMRA 4MLJA 3GZAA 3A4WA 1DJHA 3CQ0A 4LUTB 3BLIA 3QHMA 2VZUA 1AQFA 3LNPA 5M17A 1ZHAA 4QTGA 3GW3A 5K2ZA 1JDFA 1J0JA 4J3TA 5D37A 3WEMA 5M2FX 2RGMA 4FLQA 2E3ZA 3A3XA 3HJEA 3UJEA 3PAJA 4Q8WA 4N9DA 4JL2A 1EO7A 3H70A 1TPUA 2R82A 5JBFA 3NEHA 3RIKA 2ZUSA 1V8EA 1BVWA 1YXYA 2JKEA 1TVNA 1YW1A 2VZOA 3DERA 3R6IA 1G7UA 2X16A 1DE6A 2TSYA 3XISA 1K9EA 3EXTA 2ZZ6A 3ZR5A 1GVOA 3GLCA 4QQUA 4B2DA 4WJ8A 3P0WA 2OLSA 2QCCA 5FKYA 2WB5A 1GQLA 2OYMA 2Z1WA 3EEZA 1KCLA 1E6ZA 3IGSA 5LHEA 1RCXB 3W76A 3CPRA 3WNOA 3OLDA 3AU6A 1WXJA 2WK2A 1HKKA 4M0XA 3OU8A 3M0IA 4OV9A 4PMDA 3NQ7A 3PTQA 4D6JA 4GCXA 4B92A 4F0HA 2G50A 4RJEA 2PWUA 2D69A 1QASA 3L0GA 3M43A 1XLFA 4NYYA 2AQWA 3VMOA 4HYVA 3OVGA 3MTWA 1VBHA 2A4AA 3C3UA 4C6CA 5H8UA 3R79A 1OT2A 4UOZA 3VX1A 2KX9A 1X96A 1L9WA 1SZNA 1XD1A 4C6QA 5J8LA 4NX0A 2ICSA 1XC6A 1VB9A 3DYMA 3ARPA 1GEHA 4JL1A 1FH9A 2CEQA 4JX4A 5AYYA 5H2ZA 2Q02A 5E6ZA 4J3ZA 1MFVA 1D9EA 1ZB5A 1Q4NX 1ZU8A 5DT7A 3QGAC 2A1YA 1Z7AA 2AQOA 1ODZA 3C61A 1X1OA 4QDWA 3VIPA 5JH2A 2PPGA 2ZUWA 4QLKA 4JNYA 2DZPA 2FZMA 3AC0A 3LBMA 3F2CA 4FF7A 2QHAA 4L4PA 1OFEA 2PFHA 5TBOA 4C6BA 3EDJA 1IIHA 4DB7A 1MDRA 5I3JA 2GUUA 3GR4A 1ITCA 4JPGA 2O9TA 3VKDA 3VOGA 2VFEA 4N4QA 2C1GA 4D8LA 3ARWA 1R3QA 1KKRA 2V9DA 4C6DA 4LSBA 4ATDA 5H91A 2NSOA 4ZMGA 1QNQA 2NV9A 2CLOA 2CZVA 4MWAB 1G0CA 1IEQA 2GOUA 2PLCA 4X0VA 1FUYA 3CAWA 3REQB 2QT3A 1W1TA 2QPUA 5HATA 2DU2A 1EYEA 1FWCC 2F8QA 1FA2A 2A3AA 1XYBA 3G8RA 6PTDA 2CETA 2V81A 5A8QA 1X97A 4F8XA 2XPKA 3B9NA 3ITXA 1P6WA 1VAHA 1EP3A 2DSZA 4AQLA 2DT0A 1OD8A 3BGAA 4WK9A 3U5YA 2W67A 1NWRA 2Y8KA 3VD4A 3N2OA 3OGVA 3AZRA 4IP4A 1HGYA 3OA5A 3B4YA 2ZX5A 1J96A 2VGBA 2RDTA 3C2RA 5I3HA 4M24A 3QKZA 4O19A 1JNEA 2Z26A 2YBVA 3E96A 3UR2A 4MG4A 2L5HA 4CCDA 2BXYA 3T0BA 1UR9A 4JHOA 1DVJA 1PWMA 4EPBC 4J2PA 1XHGA 1T6MA 1MI3A 2XJ7A 4EPKA 4B5SA 3B03A 3GG1A 4GXPA 2J9XA 2WSKA 3O07A 4BF9A 4IX0A 4Q8NA 4Z2HA 4C6FA 3ZSSA 1B3YA 3TVAA 5FJRA 3SW6A 3SN4A 1MVYA 2LLEA 5CSYA 3TW7A 3GTHA 4DUXA 2WMFA 3AOFA 3ECQA 4WVXA 3GIYA 1VFLA 4CNOA 3QC0A 3PBMA 4Z2KA 3BOLA 5U7SA 3N34A 1YE6A 3UZJA 1OVDA 2X8RA 4DVOA 2PTYA 1JI1A 1UASA 1W5NA 2I56A 3MP3A 3GC4A 4X9SA 2WCGA 4I5XA 3WFAA 4H83A 4AY8A 1KTCA 1AQMA 4L5ZA 1UHVA 3O9NA 3CTLA 3GE7A 3CB3A 2AMGA 2J7HA 4GGBA 4YJ5A 5F1VA 3E38A 1JCJA 1FY6A 1A3WA 2VEMA 4UQ9A 5D02A 1C93A 3B8TA 3GNNA 5FL0A 2VDGA 3TTSA 2DSVA 2INZA 3K4WA 3M64A 5CJ5A 1F05A 5GJNA 4LBRA 2FMNA 1E9LA 2VGGA 4H4IA 1PYMA 4FIRA 1MW2A 1LJYA 3L4XA 2XG9A 1LP6A 2HXUA 5D04C 5AYXA 2D0HA 1J2BA 4EVZA 1U83A 1FP9A 1DWGM 1RCQA 3PZOA 2OSWA 3MBDA 1JIBA 2EKCA 1MW3A 1UB3A 2JF7A 4US5A 1IF2A 1Z44A 3H53A 3LCXA 4MWAE 1AJ2A 3W1UA 4EIVA 2Z27A 3GW0A 4AIBA 5G4EA 1LOSA 5CBIA 3W27A 2IPWA 4GI9A 3AZSA 4HTYA 1YPIA 3CS2A 3DKLA 3PUGA 1OYAA 4WJXA 3IGXA 4REQA 3EB2A 2EHHA 8TIMA 4MVAA 4FNSA 2WZHA 3HPXA 5A1AA 5GJMA 3W1RA 3CUZA 1W1ZA 2XSXA 5CCZA 5D9PA 4LXFA 2QCDB 4O1FA 2GK1B 1BAGA 3EXRA 3QQ1A 3LLFA 1K77A 3W1MA 2PP1A 2YIHA 2PDBA 2XM2A 1GG0A 3ZIZA 1ADSA 3DUGA 4LUYA 1GPFA 4FXFA 3G6MA 3CXOA 2VWSA 3GDKA 2Y8UA 4TU1A 2DJLA 1UR0A 4J28A 4ZO6A 4UTIA 4HT3A 5BOFA 3VNKA 1QOPA 4JFVA 3UR5A 1VS1A 4DO7A 2ISDA 3U6WA 3UG4A 1XYFA 3UGVA 1H11A 2XFWA 1XDLA 3U2EA 3ABZA 3A9IA 2Q01A 2I5IA 1CB2A 3VIKA 1HL2A 5KMYA 5BMXA 4OU1A 4YVXA 1E1EA 2VWTA 5GJPA 3IVTA 1K9TA 4EACA 2WVSA 3LS9A 4H7CA 1KCKA 2YXXA 2DIEA 1JVNA 1PEZA 1O60A 2J8GA 3W70A 2UBPC 2D22A 1EDTA 4IJRA 3DKJA 3VM7A 1IZCA 2PTDA 1IXNA 2AOSA 3MPGA 3PG8A 2YL6A 3VIHA 3MWAA 2W0UA 3FSTA 1QNSA 3GNOA 4HPXA 1E9YB 4QGCA 5CAKA 2EGZA 3TLLA 4LVBA 3DHDA 5D4YA 5DCDA 2ASHA 3ARVA 2GQAA 1CZ1A 4N4PA 2HPIA 5AHEA 3DIPA 3UCCA 1FCQA 1JZ7A 1CW2A 3SGUA 4HD5A 4GIRA 1DQWA 5A8MA 1P5BA 9CGTA 3E2VA 3IIPA 3K46A 2ZKMX 4U3AA 1XICA 4MJ4A 4HNOA 3U2ZA 5D30A 4W8BA 3K30A 3RCNA 3BWWA 4HZ6A 3POHA 4QS6A 5A6TC 5TAOA 3R0KA 1KCXA 2GDUA 3BOFA 2CZ5A 2ZZ2A 1T7LA 3W7DA 3ABOA 4GYJA 1XL9A 3QSRA 3N19B 2Q71A 3MW7A 1S46A 3DDMA 5DRCA 1Y5XA 1XFBA 3F5KA 3P84A 3I6RA 1Q2SA 1NQKA 4KCWA 1CXFA 4UQCA 2J78A 3VU2A 3UZYA 1BWVA 3M7WA 2NX9A 3CV1A 3PZIA 3PZMA 1V3MA 4C91A 1O68A 2E8YA 2FIQA 4FOJA 4BEQA 4M6VA 4KWWA 4M29A 1ONRA 2YBTA 5F4XA 3U4FA 1HKJA 1X8CA 1EJXC 2FH6A 3LV6A 2PTXA 2R1MA 1O95A 2ZX8A 4DM1A 3F4NA 4MLRA 2P0IA 4F40A 4OOUA 1XLMA 3HZ3A 3VC6A 2R6OA 1F9CA 3N4FA 7XIMA 3L21A 4JQ4A 2NWRA 4E6MA 1I1WA 4A2SA 4LNYA 1VRDA 4DM2A 5JQ9A 2I7GA 3PC0A 3WX7A 1OF8A 1T8QA 4CD5A 4DJDA 3VZYA 5CPMA 3WF0A 1JZ8A 3G1RA 5E5CA 1YNPA 3OQEA 4O52A 3L4UA 1H4PA 4MB3A 4A3QA 3NURA 4OT7A 3RYSA 3B97A 3CO4A 4ZFMA 4AD2A 5CEWA 2VC5A 1HP4A 3ORWA 2FGBA 4TQTA 5BW6A 1V02E 3NZ1A 4LB3A 2V30A 4UTJA 1V3JA 3URBA 1VLWA 4UQBA 4JIQA 3T6CA 5D03A 3NZRA 1C8QA 1KFKA 1VKFA 4QIUA 1V77A 1YNQA 3MSRA 3M0MA 3ID7A 2IKGA 4KFNA 4CQDA 3EB4A 1JDDA 1OFQA 2PBOA 3N18A 1HF6A 3GTIA 2CZDA 2XH0A 1C3FA 1C9WA 2HBXA 3PTDA 4Z08A 5D09A 2ZTKA 3C0JA 1TJ2A 4MZYA 2YLAA 4AVNA 4BQ3A 3WH8A 4DUVA 4R7OA 2FTPA 3CIWA 1POKA 4NZ4A 1NTHA 2ZOXA 1K9DA 2GPTA 4L4OA 3LENA 1WZLA 2C79A 3LTYA 2ON3A 4O17A 5CJMA 5C2XA 2DFAA 3MYOA 4S3EA 6REQA 6TIMA 2DUZA 1UWAA 1ITXA 1S2UA 3O7UA 4CNTA 4HJWA 4GWEA 5GNZA 4A8IA 3LZ5A 3ES8A 2IQ0A 2PD5A 3UR7A 2PU1A 4OJYA 1UR2A 2EG8A 1NOWA 1UWQA 5DCEA 4Z2LA 1S5MA 3G1VA 3DI0A 1KLYA 2XWEA 1J4EA 3N3MA 2EG6A 2QCLA 3A3HA 1R3YA 3A22A 4NHVA 2PRHA 1YQ2A 5D9OA 1M01A 1GZGA 3TWAA 2W62A 2ZWYA 3AZTA 3WJWA 3KL5A 3S9YA 3V36A 1MDLA 3IUIA 5B80A 4O18A 3B9AA 3AIEA 7TAAA 3SADA 1R38A 3QH2A 3VOHA 5DELA 1Y7VA 5FAGA 4IIDA 4C6NA 1OBAA 1W9VA 1MUMA 1Z89A 2WKGA 4IOTA 2C14A 2C71A 1LUCB 1HKWA 2H8XA 2OZTA 4YS1A 4I7WA 4EKJA 3DGRA 1R2TA 1UOZA 4RDYA 2CBJA 4XB3A 1AQHA 1G7VA 3KZPA 3AHTA 3AXIA 1I60A 4LOCA 2PTWA 1G67A 4GYPA 5DMMA 3EKLA 4I90A 2WWDA 2INEA 1KXVA 4G1NA 1WV2A 3PSVA 1Q6CA 4ZA0A 2NXHA 1LORA 1QPNA 1T8XA 1B5TA 3M6DA 4L4LA 4HK5A 2BGNE 2J9ZA 3M6YA 4Q4MA 3OPSA 1UJQA 2VEIA 2GK1A 3GKFA 3QLDA 3E49A 4XD4A 5TNVA 2VELA 2G8ZA 4O0QA 4MPQA 2YZRA 1PKMA 1VZWA 4GZJA 1OWQA 3G5EA 1F4AA 4XTDA 1RPKA 1CNVA 3F4WA 4JZ5A 2YYTA 2VD8A 3A23A 2JGYA 1XIDA 2V5JA 3WLLA 2VJXA 3MANA 4W89A 2E5DA 1AQ0A 1XBYA 3L65A 1UW9A 5C9WA 3P8JA 3CIXA 1AJ0A 5I6SA 4W93A 1NJJA 3PG9A 2BMBA 3LNMA 3L4VA 3IUDA 1VGAA 3WNMA 4G6CA 2PDXA 1HL8A 4R27A 1ISZA 4KEMA 1NP0A 1H0IA 1W1B1 2Z6IA 3QPZA 1A0DA 3VFCA 3TOPA 3WBWA 1QDSA 3BZJA 1QWKA 1EJ7L 4WSHA 1SMDA 3WQOA 3CUJA 4RDWA 1TYGA 3KDNA 4RXFA 4BI6A 2Z29A 2ALRA 3EXSA 3TQKA 4O54A 3QV7A 4FF5A 2G4JA 4D72A 3IUHA 1TCDA 2OLHA 4K36A 3VD5A 3L7RA 2O56A 3OZMA 4UUIA 1R5YA 1KV8A 3TLQA 3WUGA 3HGRA 3EYPA 4Q4QA 5C9XA 3S2MA 4A6GA 3VGHA 1DJZA 3SQSA 5I24A 1WZMA 4RPPA 1R2RA 4S3GA 3EX2A 4NNBA 1XIGA 4KRZA 2NV2A 1JRCA 2E09A 3P60A 2VDHA 1A5OC 4FO4A 2IUZA 2Y4SA 5HJYA 4M56A 5E6YA 3ZLFA 4W8AA 2XVLA 4M3PA 4YWIA 1EPXA 3NQBA 3CJPA 4TX9A 3II1A 1WDWA 1GJUA 4R3UA 5TD4A 1JF5A 4BF7A 3LCWA 2ODOA 3ZT5A 3RPMA 3U48A 1E55A 3LLDA 3THUA 4W7UA 2FTWA 3PAOA 4RNIA 4GK8A 3RRXA 1DWAM 3S3GA 2OKTA 1R0MA 3CHVA 5E0KA 4UFHA 3O0FA 2BVDA 1FWJC 1ZNNA 4IHCA 2JK2A 4RW3A 4ZSTA 5BXSA 4BI5A 1SFLA 1KM6A 2WNNA 1FCVA 1W3JA 4MY9A 1KQYA 1O6IA 1ZRQA 2DIKA 3ABQA 1AMKA 1EJVC 2RHGA 3GH7A 2RJGA 1V51A 4WDTA 2CLMA 1XYAA 3UZZA 3U2CA 1BG9A 3PF3A 3LLXA 3WLQA 3ZM8A 4Y96A 1US3A 3IPWA 4IXHA 3W7HA 4K37A 4NAEB 2YR1A 2WLZA 2PE4A 1V6XA 4U28A 1HJUA 1TMLA 2WHJA 1AODA 3RLVA 1X38A 4AD5A 5DBUA 2H9AA 1W3HA 1PAMA 3UPMA 1JPHA 3KOXA 4W7WA 4XKMA 2I9UA 3BW3A 4BF5A 3B06A 3HGSA 1VENA 2A3HA 2FLIA 2HVMA 4HKPA 2P3ZA 3TN6A 3T08A 2QUVA 4DBSA 1VIZA 4KCVA 4HIBA 3HPZA 3WLOA 4GY7A 4LF1A 3GXPA 1SW0A 3TR9A 3SN0A 1B9BA 2FHFA 4XG1A 2BV9A 4R85A 5TF0A 3TU9A 5LIWX 3WF3A 1O66A 4LF2A 1EXPA 1VFHA 4E2DA 4DWSD 2C13A 4XZ9A 3EOEA 1QT1A 4PZVA 1VBGA 1XIBA 2WSYA 4F9DA 1SYTA 4KF1A 4QQ3A 2GWNA 3ERPA 5A2AA 4PMOA 4JTCA 4E4UA 2FZDA 5FF3A 4MGGA 5F2LA 4FNQA 4IG2B 3LMYA 1QWGA 2W3ZA 3O6DA 3SCUA 2B7OA 3TROA 2GZXA 3EDFA 3FJLA 3NXLA 4P2VA 1GWJA 1LRTA 1SGJA 1VRXA 5A6JA 3E9AA 2WKLA 2XU2A 2ZX9A 1JAEA 2QDEA 2R1LA 1H0GA 3QTPA 3S5NA 4HN8A 4O57A 1QOQA 5BWFA 4IFKA 4DI8A 5E09A 5AVHA 4QCEA 2GOKA 3KE0A 3N17A 1W91A 1PWLA 1W5PA 4W84A 2EJAA 4BWLA 1IZJA 2ACUA 3NSNA 3QW3A 5LIKX 4OUIA 3DG7A 1SMAA 1DJQA 5BRPA 3LK6A 4C6OA 3NZGA 4LUJA 2F2HA 4I8DA 5M3WA 2PDKA 5DX7A 4M7TA 2IKIA 4Q7NA 1B57A 1H61A 4JFTA 3FJNA 3EWBX 3CHCA 3INPA 3GYCA 3WLJA 4CNSA 2CZEA 3PZTA 3MQTA 2XVKA 4YLWA 3U7BA 1F8MA 3OZOA 4A35A 4G7EA 1PKLA 4GO8A 4LCSA 2PWFA 1SO6A 4ZEPA 5C9UA 2HXTA 3CWHA 3M47A 4JTIA 4IMGA 4B3ZA 2PZNA 3MI3A 4AZ6A 4JD4A 2ZRWA 4FOUA 2XISA 2YCLB 1TV5A 3OVPA 5DMYA 1LWJA 1T0OA 1BXNA 3SI9A 3DC8A 4UFJA 1AH0A 3VKBA 3QM3A 5A8GA 1NFGA 3M07A 3WQDA 1NM9A 1UKOA 1WYIA 1YHTA 1UA7A 1V6WA 3L23A 4MZ8A 2RUSA 3K5XA 4OECA 4FA3A 3UJ2A 3FFSA 5FJOA 4JTTA 1E6NA 4W7VA 1I2RA 2Q8LA 4IJBA 4N6FA 1GGOA 3GHRA 5DANA 5LA0A 4HSNA 5JIWA 2FFCA 3TV8A 2WHKA 2ACSA 4AC1X 4DO4A 2OG9A 3VGBA 4DYEA 6CGTA 3M5XA 4MOZA 1C91A 4IGHA 2VC7A 3D5HA 1UR3M 1V0NA 3SCQA 1ONEA 4DX3A 4JIEA 2GSEA 1KBJA 1K6WA 4HOWA 4ECLA 3BMVA 2VX7A 3BG3A 4TX6A 3NOEA 1RA0A 3AHXA 1CYGA 3SQLA 1QK2A 1TWSA 2WVVB 4CQBA 4PMZA 4O0KA 1A5CA 3DENA 1L0PA 4MJ2A 1ZY9A 3EX4A 3W23A 5F1UA 3Q4DA 3CMJA 2HVNA 4J7RA 3MKCA 2BS9A 3E12A 3LHWA 4X0NA 4TUFA 3PS7A 3N04A 2O0TA 1KFWA 4GXMA 5LIYX 4H00A 2XIOA 3K4AA 4X63A 2PDHA 3WQGA 1JGMA 3PBUA 1OGGA 1UMLA 3E2SA 1V08A 3ZR4A 1REQB 1W17A 4GGHA 1Z3NA 1YXDA 3APGA 1XLDA 4XSMA 1QCWA 1W8SA 4Q4RA 3DFYA 4WZHA 1OFBA 4AWUA 1KM2A 3TN4A 3UP8A 1JG9A 4YTQA 3T09A 2JFEX 2EF9A 3CWNA 1JL8A 2BG5A 5CQ1A 3WYZA 1VH7A 3SSJA 3FEQA 1EJTC 1MEIA 4J40A 1R30A 2PP0A 1ISVA 5G2WA 3N2BA 1W9DM 2PDWA 1B3OA 1UPMB 3IV8A 1P4CA 1E6QM 3T2OA 1K7XA 3GKAA 4JIRA 3WNPA 1O1HA 4Y9PA 3QPYA 4O1DA 1BWKA 4PN2A 4PSPA 3AUJA 2HBVA 6ENLA 3OTRA 1HVXA 3BDKA 2P1FA 1EQPA 2QS8A 4O8AA 4UTWC 2B7NA 5LGXA 1WO2A 1E1CB 3P6LA 1YADA 3SIMA 2PDIA 1TO3A 4HZ7A 1Q6OA 1W1VA 4QROA 2WCAA 1UR8A 4AYGA 2FZ9A 4NAEA 4O16A 4I9TA 1EJUC 1LLOA 5DEZA 1CWYA 3LA4A 3WLKX 4CNUA 3O06A 2X40A 4H8VA 3AXHA 2CC0A 3K8KA 1JR1A 2D1ZA 4CLMA 3FYOA 3AIBA 4MMWA 1J2WA 1NDYA 3IJLA 3TZFA 3QHNA 1MFUA 1HJVA 1OFDA 2PP3A 5CPTA 4OBSA 3GQYA 1KM0A 1CEOA 2HPMA 1SFSA 1DL3A 3MB9A 1R9ZA 1B9ZA 4FX7A 4K39A 1Q7ZA 3SCVA 3FS2A 1PO9A 4GNJA 2G41A 4JQ2A 3EWYA 3RO8A 4KFOA 3HF3A 4AVFA 3S9ZA 3DXIA 4NAFA 4S1FA 1QI3A 3W7CA 4F0KA 1YRRA 2X1RA 3AMGA 1IXPA 4GRSA 3NXFA 1X98A 2F9RA 3S1UA 5C71A 3GFZA 4JTGA 1S1PA 3HFTA 2X05A 3N6HA 1ZCCA 4MF4A 1TPVA 2XM1A 3BMWA 1BFNA 1TPC1 1PXGA 1OCBA 2DQXA 2DIJA 4POCA 3G1HA 1T40A 4KGLA 4IQLA 4HMEA 4ENLA 3T40A 4LUIA 3URNA 4AEEA 2ZXBA 2BY1A 4CKQA 4RDZA 3VNYA 4D8AA 1P0DA 3R11A 1FCBA 1L6GA 2O9OA 3URQA 1UUMA 3HMCA 1ITQA 3R2GA 1N8IA 2XTKA 5CH9A 4XO6A 5A94A 1V7YA 1KD0A 1EWDA 1LCOA 2BGSA 3GZ3A 1HO4A 4RL3A 3T05A 1ZL1A 3W84A 1OX4A 4LAMA 4QSHA 3OYZA 1C7SA 2WV8A 3H54A 3PNZA 2X1IA 4EAYA 2VHLA 4I3GA 3LHVA 1W9PA 4AZHA 4ZODA 2J74A 1PTDA 1L2UA 2J75A 4ZQNA 3UEQA 1A5SA 3N9RA 1CIUA 2YXGA 3N15A 5DF0A 1W9UA 4JTSA 4S2BA 4PL1A 1NF0A 3PK7A 5HNRA 2BZNA 4AIUA 1TPFA 4FLSA 4GUHA 5IBXC 4IZGA 4H2CA 4CNNA 4Z1AA 3HB9A 2VCAA 2XN0A 3GAYA 4LAKA 2BSLA 1NVMA 1JQXA 3EDKA 1P6CA 4RE3A 3WJSA 2PDFA 1PYFA 1WQ5A 3QR0A 3G77A 1WKFA 5LNVA 2RJHA 2A3CA 4GH3A 3D3FA 5BRBA 2DW6A 1JZ5A 3UGRA 4ZO9A 3ITYA 4TVDA 4DF0A 4IM4A 4Q7BA 4Q8MA 2IPFA 1HFBA 1H5YA 3AI0A 4C6EA 4KEVA 2VMFA 2IPJA 4QEEA 2Y89A 1WDSA 5JVLA 4A3YA 3APTA 1Q6GA 4HMNA 3GXIA 3W86A 4AXKA 5AN7A 2VYOA 5REQB 4GBUA 3COTA 1GOWA 3IEBA 4RW5A 3WEZA 2DZSA 1K4GA 2QJHA 1GPWA 3L5AA 4R33A 1LG2A 4QX4A 2R14A 3I10A 4A22A 3G2GA 3KEHA 3LHTA 3OJGA 3BW4A 1DWHM 4GYFA 3HG2A 3LI1A 3SGZA 3EOOA 3ITLA 3MP5A 3EA2A 4V1XA 4LS2A 3MVTA 4ZVJA 3VGEA 5IXEA 5KETA 4NT0A 1X1ZA 3T8QA 3NO1A 5I02A 3G3MA 2TRSA 3SY1A 2HQAA 2VTFA 3CPGA 4KRUA 1KGWA 4I6KA 3NG3A 4O10A 3WH7A 3IJDA 4RNJA 3G1XA 5CC7A 1RHCA 1BYAA 1TV4A 2QVHA 3TP4A 5HMFA 2BHZA 1WOAA 1R86A 3O05A 4Y6GA 1IR2A 1P0EA 2OCZA 4Q8QA 1JZ3A 5IDIA 2WVVA 3HQOA 2FGZA 3NPWA 2YBUA 4BQ2A 4MYAA 1CGWA 8CGTA 3WBAA 3NL5A 3VM5A 5I0DA 1WKEA 1CLKA 1E56A 4YWSA 4QE5A 3GG8A 3JRKA 3E5BA 4YTUA 3OHMB 4YTTA 3EOLA 1M6JA 2YSWA 1VBRA 2CLPA 4W86A 3H7VA 1GYMA 4ICCX 2WANA 3QF0A 4ZTYA 2CBIA 4IFOA 4PB5A 3BCDA 4D6DA 2ZZ7A 4MPKA 5C54A 3IK4A 1B3XA 2X42A 1WDDA 1ELSA 4XISA 1V79A 5HMSA 1GQIA 3EOUA 2BOFX 3SECA 4DYJA 1EJSC 3CZGA 1Q66A 2PODA 3UXKA 5AHIA 3VDBA 3G8EA 2R1NA 3MI2A 1KFEA 1UOKA 2ZC8A 4Y9OA 5K7JA 3QPEA 4ACYA 2XVGA 1HKMA 3GUWA 1PJ9A 2PS2A 2VCBA 5BRQA 2V5LA 4G9PA 1EB3A 1NDZA 3CUFA 4DXXA 2VX4A 2Y63A 3SDOA 3AXXA 4V2XA 1SW7A 2VZTA 2ANUA 2OEMA 1YDOA 1LG1A 5AB3A 3C3NA 2WHLA 3H2EA 3KDOA 3NPUA 1C8XA 4GG9A 4H9YA 1F3XA 1E1CA 2QUTA 3JZUA 3MS8A 4PMVA 4Q32A 5LGZA 5BOEA 3Q45A 1VEMA 4CGTA 3W71A 4S2CA 1AW2A 2V2DA 4G7FA 1UBPC 1XBZA 4LVAA 4EWJA 2E5BA 3N11A 1BKHA 2PMQA 3VUSA 3A64A 3ZJ7A 3IAQA 3GTFA 1TZ9A 4ZZ9A 2XSAA 2BFGA 4PMXA 3WFZA 1TVLA 3IGHX 4B9ZA 1MQQA 3UJSA 3LXBA 4EWND 5EGRA 1FRBA 3P61A 3TW9A 1QATA 2ZXAA 2O4MA 4LPCA 1Q2RA 3SN1A 1SO3A 4JFUA 4Q6JA 1TQXA 2V3EA 2GWGA 1H63A 1VJIA 3PJTA 1EUNA 3QMSA 3P93A 3BQ5A 1SSGA 3RX3A 1I2NA 3R8RA 2WJEA 4RZ4A 1IV8A 2MUCA 4JXCA 5BU9A 4KFPA 1B1YA 3N25A 1TJ0A 2H3DA 3CV2A 4XZIA 4XD5A 1W2VA 3OW1A 3RO6A 1XIJA 2QJMA 4PYSA 2TYSA 1LBMA 1X6LA 3LYEA 1YX1A 2CLLA 2YX0A 3NQMA 1CXEA 3GWQA 3PFRA 3KWSA 4AZCA 2H8ZA 4OV4A 4WGXA 4ES4A 5A95A 3A47A 4AZIA 3HA1A 2VVSA 5F2GA 4GBDA 5C5YA 3CEPA 3THDA 1OG6A 2O92A 1A0EA 2WMGA 1B4KA 2PWDA 2A7RA 4ROPA 1T99A 3TZNA 4UTTA 4AD4A 1NFBA 4UQAA 3SB0A 4GIAA 3QKEA 4XV0A 1G9HA 3PBVA 4X2RA 3HQNA 3WO8A 3UXAA 4A2RA 4W85A 1KW1A 2Z7GA 2P8BA 3HG4A 2GJXB 2VL4A 2PI6A 4PH6A 3WMLA 1PCKA 2P88A 4Q6XA 3IACA 2XFYA 2IQTA 1KC7A 1H51A 1HKVA 1U5HA 2BHUA 3QZAA 4Y2WA 6A3HA 1QHZA 3UPWA 4QBXA 3B0VC 5JU6A 4O28A 4J3SA 3IVSA