2DJLA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with succinate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
312
structure length
312
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCCTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords dihydroorotate dehydrogenase
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with succinate
rcsb
source organism Trypanosoma cruzi
total genus 107
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2djlA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2djlA01
2VEPA 3LI1A 4DO4A 5BMWA 2EF9A 3WJSA 2ZRXA 3LTPA 2XN0A 3DFOA 4HT3A 1DV7A 3PG8A 2YPIA 5A5WA 1VJIA 1S3HA 5J5RA 3W7LA 4NQ1A 1HFBA 1BWKA 1SUXA 4FXRA 5J5DA 4X2RA 4FF7A 1W3NA 2GOUA 4PL2A 4ORMA 3FKKA 3RLVA 2DZWA 4CCEA 4GUJA 2BTMA 1Q6QA 3IRDA 1OX4A 1OF8A 1P0KA 3LHYA 1W0MA 3EWXA 2H8XA 3RK8A 3TJLA 4WY0F 4M7TA 4JTLA 3EWUA 3L0KA 4Z1BA 4O54A 2OZ0A 4MVAA 3W2LA 1PHQA 3MI2A 3NR0A 4ALDA 3JRKA 4MLRA 4O0ZA 3VNDA 3NOEA 4JEQA 3W87A 3W7RA 4YCOA 4O57A 4R34A 1F73A 4S2CA 3L65A 4O4WA 3UPWA 3TU9A 1JULA 1W56A 1EWDA 3LM7A 3TV8A 1EP1A 1X1OA 3PWAA 2ATSA 2XN2A 1W1ZA 4E38A 2G97A 1G6CA 4HNTA 3W72A 1TPB1 4YMZA 3PB2A 4NX5A 1QPRA 1FY6A 4FX6M 2CLFA 4K8EA 4NU7A 4ADUA 2QJGA 3G8RA 1YTKA 3MP5A 4PEKA 4PH6A 2A5HA 3P5ZA 1LLZA 2QUVA 2F7FA 2Y85A 6TIMA 4Q4KA 5D30A 3LLFA 1M7OA 2EGZA 4UCGA 1F6KA 2YFOA 1K7XA 1LRQA 2GPTA 3KHJA 3M5ZA 3SGUA 4JTEA 3IVUA 3RLUA 4D2JA 5AHLA 3W75A 2BWGA 4GBUA 3UWYA 3LOTA 3L5LA 3S5YA 1H50A 4N4QA 2A4AA 4K39A 1TTQA 3TQ0A 3MW7A 3UWZA 5DCDA 1QWGA 1FWWA 3P5YA 2BXVA 3B05A 2NXGA 4FNUA 3CEUA 3EWYA 1RVGA 1JJKA 2BX7A 2NV2A 3LERA 1P0NA 3NZRA 1UASA 3M0ZA 3BW2A 5DXXA 4FB7A 5K9CA 1AL8A 2WSYA 4C1KA 1A5AA 1UCWA 4XBKA 3ABRA 3PUEA 4HNNA 3M1ZA 3KXQA 1A5SA 3B8DA 1P5BA 1AW5A 3QW4B 4DEFA 3ANYA 1LZOA 3G1VA 4CQAA 1U5JA 4OQVA 1XBZA 3UQNA 1LBFA 2V9DA 4RK8A 2ZA3A 2C18A 3PM6A 3V75A 4ONVA 3TXVA 3GKFA 1OG0A 2FLIA 3G3DA 4JIQA 3TIMA 4Z0SA 2B7PA 1L9WA 4LY8A 3FYPA 4ZQMA 2WO5A 5DXYA 2E5BA 3S1XA 1A5CA 4ZQPA 3BLIA 1TSIA 4KWWA 4JYFA 3SZ8A 3SI9A 1LOQA 4LS2A 3EWWA 1TTPA 4HN4A 4IMDA 4LUIA 1FWSA 2CZ5A 2ZZ6A 1KTNA 2NUXA 3CB8A 1OK4A 4POCA 5HWMA 3TUUA 5HR7A 3W22A 1UUMA 2QJIA 5DCEA 5BOOA 5LNWA 3TMLA 1I2NA 2H90A 4QISA 4JGDA 2W79A 1MO0A 3UXAA 1I45A 2QCMA 4JX4A 3LB0A 3TNOA 2FB2A 3S8HA 5G1YA 4DELA 1KFKA 1QAPA 4NNBA 3ATZA 3DFTA 2NX9A 2CLHA 2NXIA 3DBPA 3BLFA 5D33A 2C6QA 3BG9A 4RJEA 4O16A 3P7YA 1YPIA 3ZS4A 5I3GA 3C4UA 1H61A 3GB6A 4WY0A 3LX9A 3BVJA 3HPSA 3HGJA 3NEVA 3NPXA 3HOJA 3RNDA 1DJNA 4FNTA 1NSJA 3LCHA 1MSSA 1EPXA 2EKCA 1FWNA 1R2TA 5EA9A 1TPEA 3DGRA 3WK0A 1VS1A 4O13A 4K7YA 3CLMA 1IXNA 3TSMA 4UFHA 1QMLA 3QQ1A 3BG5A 4ZL1A 5KZDA 5LGXA 2VEKA 3R12A 1FDYA 1XI3A 5CGQA 4AWTA 1H7PA 4HNUA 3TE9A 3NM1A 2W0UA 4Z1AA 5AB3A 3EEGA 4OU1A 3N3MA 2A6NA 3PY2A 1FCUA 2ZRYA 3IEBA 1O60A 1GVRA 3DI1A 1EA0A 4WQ6A 1YPFA 1OK6A 4LS0A 1TV7A 1K3UA 1IXQA 5CZ0A 3HO8A 2NLIA 1TRDA 1DJQA 4MPQA 2I14A 1KM5A 5KMYA 3DFPA 3GK0A 2Y61A 3O63A 2E68A 3UY7A 3S5ZA 1TYGA 1OYCA 3E0IA 5D38A 1GTEA 1KM3A 3L68A 3W2KA 1YXCA 4O1AA 1VHCA 1WDWA 5F4SA 3HIJA 3QW3A 4OHQA 4YLWA 1O4UA 5D02A 2DORA 3S0CA 5EL1A 3QSTA 3LCLA 2DZSA 3KVLA 3I7SA 4AMAA 4PC8A 1PV8A 4JDBA 1K7EA 1VRDA 2FPVA 4UTHA 2HS6A 4PTNA 2H3BA 1OFBA 4I9AA 4UFMA 3NQCA 2ZTKA 5HULA 3W7QA 2CLEA 3LBMA 1WV2A 1ZY9A 5FF3A 1R2SA 4S1FA 4IXHA 2NZLA 5C54A 1PL9A 1Q6LA 2QCHA 4AHOA 1H7NA 3LRKA 1IIHA 1VZWA 3MYOA 4Q33A 2PRLA 3B0PA 2GUUA 4Y90A 3NGJA 2JGQA 3KRUA 3OEXA 1H63A 1F7BA 3DU0A 4EWND 4N6EA 4M7SA 2JKAA 4N02A 5FEZA 1VGAA 1L2UA 1TREA 3QQ0A 4O1BA 4CNOA 3LXAA 4JTHA 4XTDA 1VYSX 5DBUA 4YL2A 5HINA 2ATMA 3LHWA 3KVJA 4UFJA 2VKZG 5I3FA 5D04C 4RXFA 1CI1A 2J6XA 1Z44A 3DZ1A 1M7PA 2QKFA 2I1OA 4AB4A 3QMSA 2HMCA 2AQWA 5BNKA 3LCFA 3W1RA 2OT0A 1RQHA 3C61A 4JYEA 2ZA2A 1YDVA 3LCGA 4FX8A 1D9EA 2Y88A 4QNWA 1H1ZA 4GUGA 4ORIA 3UWUA 3IVSA 3NPWA 3MHUA 4HIBA 3LCXA 3CWOX 3PBVA 4RV8A 4MZ8A 3G0XA 5G5IA 4EF9A 5BRBA 1O5XA 4P61A 5F4WA 1WX0A 3A9IA 3YPIA 1DOSA 1YTDA 3L66A 4OV9A 3ZFHA 3R5EA 3A21A 3FJ6A 3RFAA 5I3IA 7TIMA 1H5YA 1WA3A 1VPXA 1XFBA 4A21A 1R46A 4JNMA 4WD0A 3UWWA 4MFDA 3L67A 1WQ5A 4A29A 4RZ6A 5LNVA 3STEA 1YLVA 5G1TA 3L0GA 5HWJA 1A53A 1VCFA 4JXCA 1Y0EA 1OFOA 3P84A 5KTLA 2CLOA 2Y7DA 1W5QA 4O4VA 4DBDA 3Q37A 2HSAA 4WOZA 5FF4A 3IIPA 3QMTA 3I7RA 3EXRA 3CT7A 2H6RA 1TPH1 3W07A 2Z0IA 5AC6A 5D2WA 4DPPA 4GRSA 5L9FA 1LRNA 1LDCA 2NXHA 2WQPA 2G95A 1K02A 1GG0A 5AC7A 4LV9A 3O6CA 2GQ9A 5DN1A 4NJIA 4RX0A 1KV5A 3TXZA 3W2JA 1SSDA 1SZGA 1YDOA 3W1MA 1QDSA 3WJZA 1GVQA 2BLEA 4UMCA 1QCWA 3TK7A 4S2BA 5AHIA 4MYAA 1B3OA 3P82A 2DJXA 4MJMA 1LTDA 1KFBA 3GDLA 3E49A 5AN7A 3KRZA 2JBMA 2FJKA 3OG3A 1G69A 1OX5A 2VOMA 1RQEA 4RZ5A 2QCDA 3H54A 2ZFAA 4G1KA 3A5VA 3W85A 1ZALA 1HG3A 1Z42A 3LHTA 2V5LA 4BWLA 4I7VA 2GVLA 1EB3A 1SZFA 4O8RA 2A21A 1KBIA 1L6YA 3NA8A 4K37A 3U8GA 5HWNA 1GVFA 1F76A 2FIQA 2X1SA 4UTTA 5CZSA 2Z1BA 2A6LA 3O06A 3EKLA 5LKYA 1P4CA 1R2RA 3FA5A 3C2RA 1H7WA 3A24A 4LVGA 1XM3A 3M5XA 4LV4A 1KFCA 2J27A 1NAL1 3GAYA 3S5OA 4NJGA 5G2IA 1LOSA 5DLCA 4X3ZA 1GJPA 3CPRA 5FI8A 5G4WA 1W5MA 3DFNA 1TQXA 3VI2A 4LVBA 3O16A 2C19A 2CU0A 4HSOA 4H3DA 2J9XA 3NQ2A 5ABTA 4TIMA 2GVGA 4H6KA 1F74A 5K9DA 2DZUA 4NX0A 4XBSA 3PAJA 1W5PA 4WZHA 4ZQOA 4C1LA 4LC6A 2AAMA 3EX2A 3HPZA 4ZZ9A 1W54A 2YX0A 4DO5A 1NF0A 3B0VC 1DBTA 5H2ZA 3W7EA 3BARA 1EIXA 3TW6A 2PRHA 3DH7A 1WXJA 1IIGA 3GXPA 4IUOA 2WPBA 1DKWA 1PCWA 2FDSA 1FCVA 1TV5A 3N73A 2Z2UA 3PBYA 4TU1A 3QPYA 2QAPA 3W73A 4Z08A 4CQ8A 1Z48A 2DJLA 1OHLA 4PA8A 2BZNA 2P10A 3S6DA 1EP3A 5HQEA 3EWBX 3BGGA 3L2IA 3W2MA 1KM1A 6ALDA 3NPUA 3N2XA 3LGEA 5DY3A 4GUHA 2ZYFA 1F6PA 5BMXA 4AWSA 4QAIA 3LV6A 3QSRA 1B4EA 2IQTA 5K4XA 4FHAA 3NQFA 2YCEA 3TMQA 2B7QA 5FESA 2ZZ2A 1AW1A 2QDHA 3EB2A 1X1ZA 4M6PA 1EWEA 4CCDA 1RD5A 3KRSA 2QAFA 1K7FA 4OGZA 1OVDA 2GVJA 3P8IA 5K9XA 2NV1A 1KM0A 3FJLA 3W1TA 4EVZA 3THQA 3S1UA 2PCQA 1K8YA 2DZPA 2NWRA 3DKJA 3SFKA 1EX5A 1FWRA 2FFCA 3G22A 3AO0A 1OJXA 3C56A 1CW2A 4DF2A 4IQLA 1ZCOA 2R14A 1IXOA 3MBDA 4EIVA 3UYCA 1FWTA 1THFD 5FEXA 3T40A 1J5TA 4NT0A 1EUNA 4DBEA 3W1UA 1DQXA 4O10A 4A2RA 3GZ3A 3GKAA 4LC8A 1GT8A 1EP2A 2DZVA 2FQIA 3W1AA 1LM1A 4UFKA 2ZRWA 3U2OA 3VE9A 2CZFA 2H3DA 4NNCA 1KTCA 1TTJA 3FOKA 1NVMA 1MZHA 2V2CA 3DXIA 3PB0A 4OE7A 4NJJA 2ZRVA 1GEQA 4UR8A 3MI3A 3MUXA 3W84A 4O28A 3MHGA 3F1QA 3ABOA 2DP3A 4N9DA 3FIGA 4PFMA 3B04A 1RV8A 5D32A 3LTYA 2PURA 3KVMA 3N19B 3NPVA 4IMCA 1QPOA 5K3VA 3OIXA 3LV5A 4FIQA 5EYWA 1QO2A 1AK5A 3A23A 2Z6IA 3NNTA 3PBUA 1TRIA 2HTMA 3W2UA 3TQKA 4Y8FA 5MHBA 4TMCA 1ADOA 2YW3A 3S5NA 2OCZA 4WXZA 4ML9A 1N8FA 4JY9A 3EWZA 3MMTA 5HMSA 2R8WA 5SWUA 3KX6A 2TYSA 2Y63A 3STCA 4MUZA 3CIWA 3NYZA 4KFOA 4OT7A 3GNNA 1ICQA 2DZTA 3HJZA 2Q3OA 3QFEA 4IJBA 1DQWA 3IGXA 2ZZ4A 3QYQA 1XCFA 4YWIA 4EOUA 4NZFA 4CQ9A 3QPZA 5A8GA 3L0NA 4BFAA 2JK2A 3M7WA 4NUWA 1WBHA 3HQ1A 4LRTA 3PBWA 4GWEA 5AHMA 3CTLA 4MY9A 1EEPA 3PVFA 1QPQA 3THAA 4WXYA 1GYLA 4ZQCA 4O17A 3VE7A 3M6YA 1HO4A 3OHIA 2Y6ZA 2F84A 1B4KA 5KZEA 1QOQA 2X30A 1S5WA 3BPWA 2E5CA 4CLMA 4TX9A 3WJYA 4DPQA 4O11A 3W7HA 4JX6A 4JIPA 3NAVA 4XZ9A 4GUFA 2X1TA 3HG5A 4LS1A 3IVTA 1G7VA 3GDRA 3W7DA 3CWNA 4BI7A 1FUYA 3TJXA 1IXPA 1SU5A 4U4MA 3NQDA 5EY5A 2CZEA 3LCWA 5D03A 2ZZ5A 4N9CA 3HG4A 3L5MA 5EMUA 3I7QA 3A22A 5TBOA 3W88A 2C16A 3RF9A 4QNEA 3VFLA 3QF0A 1T99A 4FO4A 5IM51 1T96A 2VENA 1K03A 1LCOA 1KFEA 4O12A 1SW7A 2YYUA 2P0OA 3PS7A 4JY8A 1KBJA 1ZFJA 3IGSA 2ZTJA 4K7VA 1ALDA 5F2IA 3ABQA 4QJ1A 3TH6A 3QC3A 3LRMA 4XWUA 1GVOA 4XKYB 3GDMA 2V2HA 4N2YA 1G67A 2Y7GA 2RDWA 1WAUA 3TFCA 3W7MA 1YDNA 1VLIA 3HPXA 1G4SA 3TDFA 4O18A 1XC4A 5AYZA 4FNPA 1C9DA 4WJEA 5H91A 2Y7EA 3BLEA 4YCPA 3G24A 2YZRA 1WYIA 5C5YA 3BW3A 5LSMA 3EKZA 3OVPA 4LRSA 1W3IA 2RHGA 3W7PA 2EAWA 4FNSA 3W6YA 2VXNA 3R8RA 3VKJA 4Z0JA 4MOZA 4TR9A 3OVQA 3NZ1A 2VFFA 5EKYA 2E77A 4H4IA 3SY5A 1BKSA 4AH7A 4DF1A 2WNNA 1PCKA 1G4PA 3R89A 3NO5A 1GQNA 1I2OA 2X2GA 3W7GA 3LDVA 1QNVA 1B9BA 3P61A 4K8HA 2VFEA 4NXSA 1W8SA 3W3OA 3LRLA 1ONRA 1QO5A 3Q58A 1TPFA 1H1YA 1H7RA 3T44A 4JTIA 4UMBA 3UD6A 3NQ7A 3CIXA 1F05A 5AYYA 3EX1A 3C6CA 4AWUA 3FFSA 3G0UA 3K30A 5L6UA 1KA9F 5E93A 4O19A 4AEOA 3IIVA 3MYPA 4Z1DA 1B57A 2C15A 1XKYA 4X22A 4JD4A 3G0SA 1GOXA 3NL6A 4GNJA 4KFPA 5LGZA 5AYXA 2EHHA 4MIMA 3H55A 3M5VA 2J9YA 3NQ8A 3TQVA 3SECA 2C14A 1MXSA 4FIRA 4JICA 3UWVA 3U6WA 5HJLA 1GG1A 3G1HA 1JQVA 3SR7A 5FEPA 1OF6A 4JX5A 3W7NA 1C29A 2NUYA 3PF3A 4IXXA 3RU6A 3S42A 2O7SA 2VEIA 5CSRA 2CLLA 1XUZA 2QEZA 5LHEA 4M6QA 3NG3A 3FEMA 2YGYA 4EF8A 2C0AA 1SO4A 1A50A 1TO3A 3TR2A 1T0OA 4UR7A 5F4XA 3G18A 4MFEA 3W70A 2YYTA 4UTWC 5K4ZA 4Q32A 2OX1A 5LHFA 1SZNA 3A5FA 1J2WA 3TSBA 1OX6A 2NX1A 1VC4A 3G1FA 3TCEA 4UNKA 2V82A 1H62A 3TSDA 5F2MA 4CNNA 1TMHA 2HS8A 3EX6A 3M9YA 1LP6A 2WSRA 3PUOA 1X7FA 4UTLA 3FYOA 3VCRA 5G4EA 5E1QA 1XDLA 3ZWSA 2WNZA 4UTUA 3E96A 5F2LA 4M19A 3LXCA 1IGSA 1JUEA 3MI6A 1IF2A 1JVNA 4BF9A 3NXFA 3HMJG 1QPNA 1Z41A 2OJPA 2WSQA 1AW2A 3EX4A 3GX9A 5D2XA 2QCGA 3NDOA 3M16A 4KKXA 5IBXC 1FX6A 1I2RA 2Q8LA 5GVJA 3W1PA 3CM4A 2JKPA 4PODA 4IWWA 4AF0B 3UZ5A 3N2MA 4AAJA 2YW4A 3NQAA 1GTHA 3C8FA 5CPLA 3M41A 4BR1A 2FTPA 3OVRA 4DF0A 1S5VA 2BSLA 3JS3A 2WJZA 3WK2A 2ISWA 4JDYA 4KFNA 2B4GA 1JCXA 3R2GA 3USBA 3C2EA 3RMJA 3UNDA 4CNPA 4MZYA 3NQVA 1LYXA 5FF2A 2R91A 3DI0A 4QSHA 1KTBA 5AHNA 3PUDA 3GLCA 4N6FA 4FNRA 4IMGA 5CZTA 5DY2A 5LNSA 5CKSA 1ZNNA 3B03A 4LVAA 2QJHA 5C55A 3INPA 4JTJA 1SZEA 4NVTA 1O5KA 4K38A 1TV8A 1I4NA 3CU2A 3DHDA 2AGKA 3C52A 5D09A 2YFNA 1P1XA 1ML1A 4UTMA 1I2QA 1PHWA 5K2ZA 1OFPA 4R33A 1R30A 4ADTA 3SIZA 3W83A 2ZDRA 1LBLA 2QDGA 1JUKA 3LLDA 3DHFA 4IGHA 3WK3A 1C8VA 1EUAA 1JCMP 3GR8A 2A0NA 3W7JA 3IIOA 3IIXA 3L21A 3TW7A 3DFQA 3C2FA 2ISVA 1DHPA 2Y62A 1DORA 4JYDA 1PVNA 1N55A 1SR9A 1SSGA 3BGJA 1WOBA 1V5XA 1OFAA 2DU2A 2CWNA 5E0KA 4O1DA 3HGOA 2QCLA 5LNUA 4MKNA 3MWAA 1U83A 2ZRUA 4IX2A 5LNRA 1D3GA 1TPDA 3GVGA 3ZR4A 1Q6RA 1HUVA 1JRCA 3NQMA 1OX4B 3W7KA 4GC4A 3TX9A 3P8JA 2Z6JA 3LTSA 1D3HA 5G2HA 4GUIA 1AG1O 1KM4A 5CPNA 2J24A 4O1CA 1LBMA 2VEMA 3PR2A 2W6RA 4DO6A 1MEIA 3W1NA 2RFGA 4FXSA 3ZWTA 3G1YA 1BTMA 2YDAA 3QH2A 2FB3A 3NL5A 2B7NA 5C2XA 4LOCA 2V5BA 4I7UA 4HNVA 5EBUA 3P60A 1J4EA 3W7IA 5D2TA 1UB3A 4M5PA 2R94A 1GPWA 2CLIA 5U4NA 3B0UX 2EPHA 4LVFA 1FCBA 1RZMA 3O05A 1YXDA 1YXYA 3I6RA 4XTIA 3QJAA 2A7RA 3GYEA 1XXXA 2Q3RA 1H51A 3HG3A 4L4LA 1VCVA 1N7KA 1G4TA 4HHPA 3H53A 3ELFA 1Q3NA 1WBJA 1VH7A 1FDZA 4J9JA 5U7SA 1F5ZA 4R7JA 4WOQA 2VFDA 4YXGA 4UTIA 1AL7A 1KFJA 3G1XA 4HKPA 3L5AA 4N9BA 1VCGA 3WJXA 1FDJA 1OFQA 4Y6GA 4MZ1A 3F4NA 3TC7A 2TSYA 3KFTA 1H60A 2TRSA 3P80A 3MHFA 1VHNA 4K36A 4E2BA 2ZA1A 2WV8A 1ME8A 1KW1A 2KZHA 1K8XA 2ZBTA 4JS3A 4NNAA 2G5WA 5F1UA 3STGA 3O6DA 2RDTA 2E1DA 3G1SA 3EXTA 1FQ0A 1UBSA 4O53A 4L4MA 1VR6A 1FBAA 4LW7A 3W76A 2RDUA 3SW6A 3P74A 5I3KA 2GJLA 4XUGA 1OFEA 3LBCA 3UZJA 3LHUA 3C2VA 2E6DA 2UV8G 3TA6A 3T7VA 3MP3A 2CLKA 3W1LA 5FF0A 3NL3A 5FF7A 1DL3A 2GQ8A 4IPJA 1KM6A 3GXNA 4Y96A 3W71A 3M43A 4UIOA 3C2OA 3HG2A 5G2WA 1JQXA 5AFDA 3L9CA 4E2DA 1W37A 4MJZA 1TTIA 3M47A 4UXDA 3P81A 5F1VA 3O1NA 2J9ZA 3FKRA 5FEWA 4LTSA 3GAKA 1Q45A 3S9YA 1ZAJA 3W74A 1G7UA 5D05A 1RR2A 4AVFA 1VYPX 1SO6A 2Q8ZA 4RR4A 1LOLA 3UPBA 3PC0A 2A7NA 3CC1A 2JKEA 2C3ZA 4JTKA 3W1QA 1SW3A 3TKFA 1OYBA 5DBTA 4MY8A 2NWSA 1TB3A 3DENA 3IGUA 4DXVA 2J88A 1KLZA 3W2NA 3QRHA 3LHZA 2V30A 1TCDA 2NX3A 2V8ZA 2DZXA 3E9AA 5AHFA 2A85A 3QEZA 3Q2DA 5I3HA 2QCCA 3HF3A 1GWJA 2CW6A 2QUUA 1ICSA 3BV4A 1ZJIA 5D37A 4CCCA 3EXSA 1K8ZA 4IMEA 4M6VA 1XBVA 1NF7A 2ZCGA 1SFJA 5HNRA 3KVKA 3O15A 4IOTA 3MBFA 4LU0A 4FNQA 5AOUA 1XL9A 3W86A 5D2YA 4ZVJA 3P62A 1MEHA 5KINA 4FX7A 4OWGA 1YYAA 1UUOA 3B06A 2CLMA 3C0JA 4AHPA 4HPXA 1RQBA 4QIUA 4WY0B 3GNDA 4XQ6A 3IV3A 4OBTA 3W9ZA 3BK0A 2QCEA 4GXMA 3T78A 1M5WA 3FS2A 2QUTA 1OYAA 2JGYA 4O15A 3CHVA 4O50A 4QITA 3BG3A 3WK1A 4Y9AA 1DVJA 3N9RA 2QR6A 2NUWA 5HUPA 1ME7A 2WKJA 2H8ZA 1KLYA 3W23A 3P67A 4UMAA 4U28A 3QM3A 3NM3A 3OA3A 1OFRA 5C6MA 4RKAA 4RXGA 4LT9A 3NVTA 4N9EA 4NXKA 3PULA 3N14A 2E5DA 3MJYA 3GDKA 3BO9A 3ATYA 1JCJA 2A7PA 3UY8A 2WOQA 1SW0A 4LWWA 4BI6A 2QF7A 1LRTA 4QM1A 4UC5A 4GFSA 4N4PA 5AHEA 3NQEA 3QMRA 1RPXA 3JR2A 2PE4A 1SFLA 4JR5A 2YR1A 1JCNA 2XN1A 1VLWA 4O52A 4LVDA 4GE8A 3GXTA 1QR7A 2O7QA 4UTKA 1TPWA 1X8FA 2CFFA 3IIZA 4XKYA 3GIYA 4PL1A 1UJPA 3TFXA 1W31A 3R13A 4HSNA 3DAQA 2TMDA 4ICNA 2YSWA 2P1FA 5CPOA 4ZQRA 4IPIA 4RLIA 4DQWA 1XBXA 1R47A 1JCLA 2ZZ1A 1KFLA 1TJPA 5DCBA 2YXGA 3N9SA 1GVSA 4UTJA 1HO1A 2LLEA 1G4EA 3MO7A 2OT1A 4X9SA 1TPUA 3UWQA 3B4UA 5T26A 3SJ3A 5AC8A 4MLJA 3SGZA 1JUBA 5KITA 1SO3A 4ZMGA 5TIMA 3W1XA 1OABA 1ZAHA 3I65A 4E0CA 2E6FA 3I68A 1XUUA 2VC6A 1WOAA 4LNYA 2A1YA 3O8AA 1YADA 1ME9A 3G1DA 5DELA 1SPQA 1JRBA 3M5YA 2WNQA 1PIIA 2PRMA 1GZGA 5I3JA 5K7JA 2X1UA 3S1WA 4A3UA 5D2VA 3NL2A 5CG7A 2FPTA 1TPVA 1YTEA 4QQ3A 4W9TA 3V1PA 1LLWA 1PS9A 2E09A 2VFHA 5CSSA 2E6YA 3LCIA 2RKXA 4MY1A 4WUIA 1GYNA 4Z1CA 3STFA 4UUIA 1FXPA 2D73A 3GDTA 1S5TA 1H7OA 1L6WA 4TO8A 1ICPA 3PSWA 3TAKA 4NJHA 5F2GA 1PE1A 1O94A 4JTUA 3TROA 1LROA 1T8XA 4FEZA 3GR7A 1CX9A 2A2IA 4JTFA 4UFIA 4NJKA 1W5NA 2V81A 2QCNA 4LUJA 3EX3A 4BK9A 1JR1A 3F4WA 4K6AA 3CEPA 3SSJA 4OV4A 4ZQNA 3KAOA 3Q94A 1O95A 3AJXA 1QFEA 1V7YA 4JN6A 3O07A 4WX2A 1OFDA 1FCQA 3FLUA 1SO5A 4AXKA 4O14A 4RCXA 4R53A 2VELA 3E12A 3LXBA 2XFWA 3LHVA 3T4CA 1L6SA 2ZRZA 2ABAA 3QZEA 1NFBA 1FXQA 2RH9A 4HPJA 1TQJA 2GQAA 3NQGA 4NZJA 2ALDA 1XBYA 4UFLA 1Q6OA 2Y89A 1TIMA 4JTGA 2QCFA 5HUOA 4TMBA 3HGSA 3N34A 3M44A 2C1HA 4GJ1A 4JTSA 4A22A 3D0CA 1W5OA 1F2JA 2E6AA 2TPSA 2X1RA 4BWLC 1I2PA 2Y7FA 3G1AA 5HR6A 1X6UA 1KV8A 4I7WA 4PCFA 1ZHAA 4KWVA 2G96A 4UTTC 1QOPA 2CZDA 4RZ4A 1XDMA 3G8EA 4AF0A 1W3TA 3ABSA 1M6JA 2B0MA 2V0TA 3TAOA 3MP4A 5KSWA 3W7CA 2OMAA 3WJWA 3T55A 3HBLA 2V2DA 4IX0A 4BI5A 4UTWA 5CZJA 4UNLA 4P2VA 3HGRA 1E51A 3UXDA 1I8JA 1NEYA 3BW4A 2ZQ0A 3HB9A 1AMKA 2Y70A 2VFIA 1TJRA 3WFAA 1LORA 2VFGA 1BEUA 3G3MA 1BWLA 3C3NA 3OBKA 3TC6A 2GJNA 3DFSA 5LZLA 1KM2A 3O6YX 1HTIA 4IMFA 1ZAIA 4MYXA 2ABBA 1MEWA 4A2SA 5BW6A 3E02A 3F03K 3PSVA 3LI0A 1JCYA 5TQLA 2QCDB 4O0KA 3S1VA 4JTTA 2B7OA 1VYRA 3NQ6A 8TIMA 1VQTA 2PC4A 3DKLA 2ZZ3A 5KZMA 2C13A 1ZENA 1TPC1 3KOFA 5IBXA 3PG9A 1SQ7A 1HL2A 5EPDA 4AHQA 1A5BA 3CQ0A 5CPMA 3W7OA 4ADSA 2X16A 1H7XA 2FPYA 2ZZ7A 4B5NA 2ISSA 2I9EA
chains in the Genus database with same CATH superfamily
1UR3M 4F0HA 2E9MA 5BMWA 2XN0A 4RNJA 1UZDA 2WCAA 3PG8A 1W32A 1R9YA 1VJIA 3AIBA 1U33A 1R7OA 1SUXA 1B3WA 3EA2A 4D6IA 1W3NA 2INZA 1QBBA 1T40A 3FKKA 4Y9NA 4CCEA 3UFYA 3FDKA 5CSUA 3S2NA 2W27A 1Q6QA 1OX4A 4MB4A 3CK5A 1DJYA 3LHYA 1DTUA 3EWXA 2ANUA 4DYJA 2PWUA 3UESA 4Z1BA 3OODA 4MVAA 2DUAA 2R1KA 3BICA 1ZBVA 4NYUA 1VKFA 2BODX 2OKOA 4LXFA 4LJ3A 3MI2A 3GXIA 4FP1A 5I79A 4FXJA 3NZPA 5CEWA 4YCOA 3GZAA 4O57A 4MKSA 3UPWA 3FSUA 1JULA 2YDSA 4JQ1A 1XYMA 4KH2A 1GJWA 3PWAA 4Q6XA 4YN5A 1TZZA 9XIMA 3M4HA 1G6CA 2NVAA 3E2VA 4QFUA 5FOOA 3CXOA 5E6YA 2DSVA 1E1CB 1Q6EA 5HATA 5DRCA 2QJGA 2HVOA 3C0LA 4C6PA 3MP5A 1R3TA 3MANA 4CUCA 1Q65A 1XLMA 2QDDA 2I5QA 1XGDA 1M7OA 2EGZA 3KHJA 1XS2A 3RLUA 4D2JA 5I09A 2BWGA 3UWYA 1YEYA 3L5LA 3PANA 3S5YA 4K68A 1P0EA 4N4QA 3OTRA 4KW2A 8A3HA 3P5YA 5CBIA 4ZSTA 2BXVA 3SRDA 1CBGA 1FP9A 2XVPA 2Z7KA 2NV2A 4XD5A 2Z4GA 3KDOA 3NZRA 3A12A 4TX8A 2QW5A 4JFWA 1UP3A 1UWRA 3BW2A 4H01A 1TUFA 3SIMA 1ZJBA 3HJEA 2GL5A 4C1KA 3UJ2A 3H12A 3H24A 4L4PA 1RJRA 4KCTA 4NILA 3E2RA 1SJBA 4R7OA 4CQAA 1U5JA 4OQVA 4KGJA 3VZYA 2C18A 4ONVA 3VUSA 2FH6A 3E5PA 1OG0A 2RUSA 2FLIA 2HDJA 3TLQA 3EB4A 3G3DA 1ZP3A 4I8YA 2XIQA 4JIQA 3TIMA 4Z0SA 3KL3A 1ZGDA 1CCWB 4CD6A 4LY8A 2YKKA 1G1YA 4HMEA 3G2GA 3AI0A 4WSHA 5CJ5A 3T8LA 5I7GA 3EWWA 1TTPA 4HN4A 4LBRA 2CZ5A 5HR7A 2ACQA 3W22A 2WHMA 2Q01A 2XPKA 4XB3A 2QJIA 1DIEA 4ZA0A 5DCEA 4IL2A 4LAUA 5BOOA 3UG5A 5FL1A 1MQQA 4D6HA 3UXAA 4CN6A 1QI0A 4EANA 4JX4A 4WK9A 3S8HA 4HA3A 2J62A 3IJDA 4DELA 4C5YA 4NNBA 2DDXA 2IKHA 4AU0A 2CLHA 1UIPA 3DBPA 3CL7A 4MNMA 2V5DA 5C7HA 2Z7GA 3CTTA 2GK1A 1DHKA 4JKMA 5CQ1A 1OCQA 3HPSA 3ES7A 4MF4A 4K1WA 4WF7A 1FH9A 1EPXA 2EKCA 2E8YA 4F3HA 1VFLA 2GGEA 1R2TA 5EA9A 2G8ZA 1TPEA 1IEXA 3DGRA 1VS1A 2VUNA 3UEQA 3GTHA 1KRAC 1DJGA 3TSMA 1DWJM 1O5QA 4ZXOA 1LF1A 3T0DA 3PZVA 5KZDA 4ZB5A 1MW1A 2VEKA 4WDUA 5CGQA 4AWTA 1DXEA 4HNUA 4A3QA 3NM1A 3NIYA 1U22A 4ACZB 4XAFA 3HMCA 3V7PA 3WELA 2OTDA 4G7EB 4OBSA 3URAA 4LNCA 1K3UA 1NFPA 1IXQA 5CZ0A 3PHAA 9XIAA 5REQB 1DJQA 4MPQA 3MB9A 5KMYA 3GK0A 4KEVA 4KIEA 2E68A 4DM1A 3UY7A 3S5ZA 1TYGA 3E6EA 4NASA 1QT1A 2CESA 3HV9A 2V3FA 3VGEA 1US3A 4X61A 3VNMA 3AALA 4BQ2A 3S9ZA 4ENLA 4ZEPA 1OSEA 3NSMA 3R7MA 2W62A 3KVLA 3QV8A 4AMAA 1K7EA 5C7VA 1VRDA 4XV0A 2FPVA 4UTHA 2HS6A 1OT1A 1PZ3A 3K46A 3MT1A 2WMKA 2ZE0A 3LBMA 1CENA 4XZNX 1ZY9A 5CLTA 4D8AA 2ZXQA 4E6MA 4RE0A 1S1RA 4IXHA 3RM4A 2NZLA 1E72M 3UR2A 1GKRA 1PL9A 2XFFA 5CGTA 1ZZMA 5HBFA 1BPLB 2PRLA 2VDGA 3UNTA 3B0PA 2R6OA 4DJEA 3H2MA 1LUCA 3KRUA 3DU0A 1F7BA 5C2CA 4W93A 4DBUA 2OEKA 6A3HA 3GW3A 2WVVA 4IQEA 4DY1A 1VYSX 4GI8A 5I3FA 2ISFA 3W00A 5HMEA 1IEQA 1REQB 1M7PA 2WW5A 5BNKA 3KOXA 2OT0A 4LPCA 1DWFM 6PTDA 2POZA 4LUSB 4HP5A 1YDVA 3ALGA 2ONEA 3IJ8A 4ORIA 1QRQA 4HJWA 1PTDA 1HZYA 3LCXA 1KO0A 4GFIA 4I8DA 3ID7A 1ODZA 4EF9A 2A3EA 3CZEA 4P61A 2W66A 3YPIA 3MV01 1DOSA 5CAKA 2WMIB 4XX6A 3LGDA 4CQBA 4C6MA 2NVCA 4A21A 3L67A 4FF5A 4JTCA 2YCLA 2ZUVA 5E70A 5LNVA 1YLVA 5G1TA 2YJQA 3CL6A 4JXCA 3P84A 5KTLA 4D6CA 1W5QA 1BYAA 2HSAA 3CNYA 5FF4A 3IIPA 2DV0A 1QTWA 2FZ8A 5DMMA 3ME3A 4GRSA 3AISA 1MFVA 1LDCA 1A3HA 2G95A 5H8PA 3EOOA 2ZX6A 1HP5A 4LV9A 4OECA 2GQ9A 3AS3A 3MV11 1YNPA 2R24A 3DEQA 3TXZA 1E9LA 3W1MA 2WMHA 2WHLA 4C6NA 4LYRA 3UT0A 1BVWA 4KRZA 4MJ2A 4Q4SA 2V5KA 4TTUA 4MJMA 4DLFA 1KFBA 3GDLA 3F2BA 4AIBA 2BY0A 4GZ7A 2WHJA 3OG3A 4C6JA 2PPGA 2QCDA 3QVQA 2OFJA 2ZFAA 4G1KA 4ZSUA 3LHTA 2V5LA 4I7VA 2G4FA 1EB3A 4DI8A 3U2CA 5ABEA 1BVNP 4NP7A 1L6YA 3VUPA 4EXQA 5HWNA 4F0LA 1VBUA 2FIQA 2X1SA 3LZ5A 5CZSA 2Z1BA 5GJPA 1H7WA 1DWAM 3M5XA 2G3FA 3M07A 2I57A 1KFCA 2J27A 3PWIA 2XU2A 1NAL1 3S5OA 4NJGA 4GIAA 5G2IA 5ABFB 4MWAE 3ZR5A 2ZDSA 2ZX9A 3OG2A 5FI8A 1JDAA 1W5MA 4H6QA 4LVBA 3O16A 2CU0A 3AIUA 2Z24A 2J9XA 2YDRA 4H6KA 1YBQB 2QGHA 4XBSA 1XP3A 5AC4A 2AAMA 1OD8A 4ZZ9A 1W54A 4GY1A 2PGRA 3GXMA 2ZWYA 1R6WA 3DH7A 2AQOA 2PB1A 2RJHA 4DJDD 2WPBA 1PCWA 4L1GA 3N73A 4R5EA 2ICSA 2BDQA 3B8SA 4TU1A 3W73A 1EC9A 4IIDA 3PWGA 4PA8A 3LPGA 3UETA 3S6DA 4PZVA 3L2IA 1KM1A 4UQEA 3NPUA 1KNWA 5LYRA 1E1CA 2VL4A 1K6WA 4GUHA 2VMFA 4AWSA 3RCNA 4JN8A 1B4EA 1XW8A 3DHPA 3FHQA 3PBMA 5K4XA 2VC5A 4UB9A 1E9IA 3RRAA 4HNLA 1FFRA 1UH2A 5JIPA 1AW1A 4B16A 2FYMA 3EB2A 1S46A 4CCDA 1W3LA 8RUCA 4Z2IA 4OGZA 1CXLA 2VD9A 3P8IA 3MDUA 3H26A 2EXOA 3FX4A 1E5JA 5B7YA 1K8YA 2NWRA 3S5SA 3DKJA 1P43A 3GNPA 4Z2KA 4E4PA 2YCKX 4IQLA 3BAKA 1HJQA 1ZCOA 2R14A 4IGNA 1IXOA 3MBDA 4Z17A 4R3UA 1R87A 3W28A 4MWAC 2GLKA 3BXWA 4G2DA 1KR0A 3R6IA 1J5TA 4DBEA 3HURA 4MG4A 3U3HA 1T7LA 4A2RA 3KTCA 3GKAA 2ZVRA 3P0WA 4YHGA 4KETA 5T8GA 3VE9A 3UZZA 3W26A 2CZFA 1UWTA 4DJFC 3TN3A 3FOKA 4J1OA 4AYSA 1CZ1A 1MZHA 1HP4A 3AHVA 2Z25A 1GEQA 4O28A 3F1QA 3ABOA 3MSYA 1A80A 5JVLA 1ISZA 4PFMA 3PTKA 2UY4A 2PURA 1G9HA 2YXOA 4L9XA 4AZ7A 1W9PA 4IMCA 3OIXA 5I02A 3W37A 1Q7MA 3WNPA 5EYWA 3A23A 4CVUA 3W2UA 3TQKA 3LY0A 4C6BA 4O1FA 4WXZA 4LUYA 2GGHA 3EWZA 1J8VA 5SWUA 4K1GA 2Y63A 4IIGA 2FZMA 3NYZA 3H8AA 3WLSA 1ICQA 2FHFA 3QFEA 3N29A 3R10A 1RP8A 4JFVA 1SYTA 1UA3A 1XLEA 1XCFA 4EOUA 4CQ9A 5TD4A 3CT2A 3AYVA 1XHGA 5A8GA 2DUZA 3L0NA 4I9TA 1KRMA 4UQDA 4DWSC 1DWGM 5I2UA 3CTLA 4MY9A 2W61A 3SN0A 1V79A 4O17A 1K77A 3M6YA 4NZCA 3OHIA 4P8VA 2Y6ZA 2CLPA 3COTA 2X30A 3WMBA 4TVUA 3NTYA 4TX9A 3CHFA 3CGTA 4O11A 3FA3A 4JIPA 3O9NA 3IVTA 3CPUA 3W7DA 4BI7A 3M64A 1SU5A 1IXPA 4U4MA 2CZEA 1AFSA 3L5MA 4KERA 4YTTA 2CHOA 3B0XA 1Y65A 4E4FA 3W88A 1UKQA 2C16A 3LPOA 4M6UA 1UD6A 3QF0A 4DWDA 4HU3A 4TVCA 3WSUA 3QHMA 4PMOA 5AY7A 1Z89A 3E0WA 4ACZA 1WCGA 4JY8A 2FVMA 3S6TA 1LL4A 4DIAA 3ABQA 2OZTA 4QJ1A 2RAGA 1ZTVA 4G7EA 1FWGC 1GVOA 3GDMA 3BLKA 4G7FA 4ZE4A 2OPJA 2INFA 4H9XA 1OIFA 1EQCA 1MRAA 5CJNA 1EGMA 3W7MA 1TJ0A 4ROQA 1JZ6A 5LA2A 5JU6A 1GOIA 3BLEA 3G24A 1XLIA 4YNGA 3BW3A 1K1DA 2V63A 1W3IA 1W6TA 3LM3A 2X0HA 1UR2A 3W6YA 1R85A 1HL8A 3FW6A 3WFZA 1E4NA 4MB3A 5EKYA 2E77A 2BY1A 4H4IA 3SY5A 3A6OA 1LG2A 1G4PA 4PSRA 3R89A 5G1MA 2GFTA 3OU8A 3UGVA 2VFEA 3LRLA 1QO5A 1B2YA 2HWGA 4D9PA 2OO6A 3RILA 1H7RA 4JTIA 1Q2RA 3CQKA 4D8LA 3G0UA 1KA9F 5E93A 4AEOA 1UJQA 3IIVA 3MYPA 2WCSA 3POCA 1LWHA 4X22A 3G0SA 3UVAA 2XSXA 4OBRA 2DH2A 4GNJA 3VIKA 4QJ4B 4QEEA 2EHHA 4CEUC 5AECA 2X7VA 3M5VA 1XSJA 2J9YA 1MQRA 3IJQA 1DJIA 3AMLA 4MPKA 2PBOA 1MXSA 4FIRA 4JICA 2IKGA 3SR7A 1JQVA 3PF3A 8CGTA 3ZVHB 4IXXA 3RU6A 3APYA 3AC0A 1PBGA 2VEIA 4DM2A 5I0DA 3C86A 3B8TA 1EJUC 3A3WA 4M6QA 5H8UA 3H4GA 2PDWA 2E8ZA 1OT2A 3KE0A 1W3HA 3M0VA 1A50A 1T0OA 5F4XA 2O56A 5D9OA 4LUSA 2YYTA 1S2CA 4Q4MA 2OX1A 4HCHA 2AL2B 3TSBA 1QK0A 2B81A 1H62A 4M82A 3BAIA 3TC3A 4F2BA 3MO4A 2Z1SA 1X7FA 1UR8A 1V6XA 3VCRA 5G4EA 7PTDA 4L6HA 1JDDA 4UTUA 3N17A 2OWXA 2WMIA 2UWFA 3LXCA 1GCYA 1WXYA 1XIFA 3AUOA 2OWCA 3LGGA 2WC4A 4GPNA 1E6ZA 1QBAA 2ZUWA 4TX6A 1DJHA 3ARUA 3ZOAA 3EX4A 1QNQA 2C0HA 3WF2A 1GEHA 3G6MA 4C6OA 1VIZA 1KBKA 4FK9A 3N2MA 3GFYA 4S38A 3VFCA 3ARRA 1JZ5A 1JNDA 2H9AB 3WQFA 4DF0A 4F2UA 4KFNA 1JCXA 3VOJA 3W29A 3C2EA 3UNDA 4CNPA 4LYQA 1EXBA 1QJWA 1AA1B 3GLCA 1C8YA 3K4AA 3RMEA 1DEDA 3OZYA 4LVAA 1V6WA 3ZIZA 1PPIA 4JTJA 1SZEA 1FP8A 1V0LA 2X0SA 3V0UA 4LAKA 1V3KA 4H19A 2NQ5A 2YFNA 1BYCA 1I2QA 3BOLA 1R30A 5BXSA 5FD0A 1ZB5A 4X9YA 1PUDA 4HPNA 1EUAA 1JCMP 3TW7A 5JH1A 3L21A 1OC5A 1CGVA 1Z32X 1E40A 2JF7A 3U4AA 2VR4A 4HNOA 3SCPA 2PP1A 1DHPA 1N55A 1SR9A 4V1XA 2CKRA 2WAGA 1XGEA 2EJ1A 2IXVA 2PDIA 4QLJA 1AJ2A 3E2QA 4IG2B 5E0KA 1GPFA 4O1DA 3HGOA 5LNUA 3R94A 1U83A 5ABFA 1VAHA 4IISA 5LNRA 1TMLA 1I1WA 2P76A 3R0KA 4QTGA 2XIMA 4GC4A 1IEVA 2F6XA 3CAVA 1YBQA 2YL6A 3S47A 4PTXA 1UUQA 2VEMA 2GVYA 2W6RA 3L23A 3FAXA 1POJA 3GHTA 2VR5A 2XVNA 4FXSA 3PZUA 3QH2A 5BCAA 3GVVA 1RJQA 2B7NA 2OKTA 1XD1A 2V5BA 3UG8A 2FMOA 4YYFA 1J4EA 1UB3A 4LX4A 2FZ9A 2EPHA 3CV2A 3GTXA 3T81A 1JDCA 2OLAA 2DT0A 1A5KC 2VP8A 3GRIA 2OO0A 2AOSA 1RUSA 4S3GA 3GYEA 4UNIA 3HG3A 3CMGA 5BWFA 5A6SA 3UA3A 3VDAA 4EP8C 1G4TA 1BGAA 3GTNA 1J96A 1Q3NA 2WVTA 1A4LA 4XISA 3Q65A 1TG7A 1MDLA 3WQ8A 2D3LA 3UGRA 3SJNA 4J9JA 5U7SA 2GGIA 1KFJA 3OBAA 2C8NA 1QVBA 1E3XA 4HKPA 3L5AA 3B9OA 1OFQA 4Y6GA 4MZ1A 1XINA 3KEHA 2TSYA 3KFTA 1H60A 4UZUA 4I9MA 3P80A 3MHFA 4F48A 2DQWA 3NGFA 3L4YA 4E2BA 4H8VA 3RO6A 1YKWA 4IT1A 4ZTYA 1ME8A 1KW1A 4NNAA 4XK2A 1W17A 2RDTA 2E1DA 3G1SA 3EXTA 4AD1A 1J0JA 1UBSA 4HVXA 4W5ZA 2F2KA 3M0LA 3QTPA 1LQ2A 2YA2A 2JIWA 2XJ7A 1FBAA 4LW7A 3THUA 3M0IA 1RA5A 3SW6A 3WH6A 3P74A 3JU2A 5FSEC 2EKGA 6CGTA 5A2AA 2D0GA 3UZJA 3ZT6A 2E6DA 1I6NA 1FH7A 3W82A 5G4HC 1AD4A 1IV8A 3W1LA 2W3ZA 4IPJA 2GQ8A 4KQNA 2YL9A 2Y24A 2YDQA 1RBLA 1JQXA 2D0FA 3L9CA 4JTRA 1W37A 4BF5A 4UXDA 3WQCA 1EYEA 3DIPA 3GAKA 1Q45A 1MFUA 2W67A 1MUWA 2Q8ZA 3PC0A 3CC1A 4PCSA 2D3NA 1HX0A 2ALRA 2C3ZA 3W1QA 1OYBA 3UZWA 5DBTA 3BLPX 4MY8A 1TB3A 3IGUA 3QC0A 4DXVA 4WGXA 1TCDA 2DZXA 2XIOA 5AHFA 2JF6A 5I3HA 3B9EA 4N7QA 4YHEA 2VC7A 1ICSA 1CT5A 2XM2A 4U5KA 1EDTA 1UWAA 4AD5A 1DXIA 1SFJA 1V02E 4ZOBA 3O15A 3H23A 2OB3A 4FNQA 4C1NB 3W86A 2YCJA 2CNCA 2HBXA 3EPOA 1IGWA 4GO8A 1MEHA 3TWAA 1YYAA 1UUOA 4AHPA 3CUGA 1RQBA 3N18A 3IV3A 4H9UA 2ZE3A 5FJJA 4Q8PA 1CB7B 3EGJA 1QW7A 2QCEA 1M5WA 1JF6A 2DVUA 1SJAA 3GFXA 2P88A 4CU6A 4O15A 2QPXA 2W9MA 3H7RA 4QITA 1O6IA 1XYAA 3BG3A 3WK1A 5M17A 4Y9AA 3SO7A 1DVJA 2QR6A 2NUWA 1KLYA 3I3BA 5LA0A 3NVDA 3WMLA 3QM3A 2PSNA 4RKAA 4RXGA 2YOCA 4N9EA 3TJIA 1JZ8A 2CIPA 2GDQA 5LXEA 3VIGA 1NTHA 1V4YA 4GHRA 4C91A 4GFSA 4C6DA 5AHEA 1UKOA 3JR2A 4L4OA 1SFLA 4JR5A 1Z9AA 1JCNA 2VZVA 4Y9MA 1UR0A 3FXGA 1M65A 4LVDA 1V77A 3PJWA 4Z2HA 3VNKA 4UTKA 2OYLA 3PNZA 4BEUA 3IIZA 2NT0A 4QE5A 1UJPA 1VP5A 2ASHA 4FMVA 3DAQA 1XLCA 2TMDA 4GVGA 4BZYA 4GLEA 2KX9A 5DO8A 4R88A 2P3ZA 1UYQA 4DQWA 1JCLA 1TJPA 3WD0A 2OOFA 4HNCA 2OZ8A 6ENLA 3UJSA 3TTQA 3UWQA 1C8QA 4EX4A 2A3CA 5JMUA 3SGZA 3WY1A 5KITA 4ZMGA 3KBMA 3I65A 1W9BM 3I68A 4PMVA 2RJGA 3KL5A 2A1YA 1A0DA 3O8AA 3POHA 3M5YA 4X63A 2PRMA 5I3JA 3MPGA 1RHCA 3W4RA 1S3TC 2BVYA 3NL2A 4ZO6A 4IIFA 2FPTA 3K1GA 2BY2A 1LLWA 4GD0A 4KT2A 2E09A 2PDJA 5CSSA 3UYIA 3R4IA 2GSHA 4PUKA 3TYCA 4HN8A 3IJIA 3LNPA 3UXLA 4TO8A 1ICPA 3QV9A 5F2GA 1O94A 3TROA 2WM0A 3VNLA 3GR7A 1GKQA 4JTFA 4UFIA 1W5NA 2V81A 3T08A 4W4QA 2I56A 3F4WA 5TAOA 2NQLA 1XIEA 3NDYA 3ZVHA 4CQDA 2PZNA 4ZQNA 3SCOA 2V3GA 1WDDA 2ZOXA 4ZCWA 3ARZA 2HK1A 3FLUA 3VOIA 2Q8XA 4R53A 2VELA 3LXBA 3NUKA 2AL2A 2Y8KA 2XFWA 3WH9A 3QZEA 2ABAA 4XZMX 3T05A 1T8QA 1TQJA 4H83A 3VPLA 2QMKA 3PPHA 3NQGA 1XBYA 1IWBA 1HGWA 1TIMA 1TVNA 1MW0A 1EDGA 2XTKA 2W63A 1E1EA 1OZMA 5BXRA 1Q13A 3TYAA 4F0KA 2GGGA 1VBHA 2OYMA 1F2JA 2TPSA 1MUMA 1UKPA 4BWLC 2PF8A 1R3WA 5XINA 4B2DD 3ARWA 1QWKA 2YBTA 4PCFA 4RL3A 4KWVA 4EKJA 3GD6A 1DJXA 1QOPA 1XDMA 3N2CA 1KGUA 4QG8A 1M6JA 2V0TA 3F4VA 4WHBA 1A3WA 2OMAA 1XISA 4HD5A 2Y5SA 4UTWA 4BI5A 1HL9A 2H9AA 1E51A 3UXDA 2YA1A 1I8JA 4C6EA 3HB9A 5I77A 1EJSC 1LORA 1BEUA 3C3NA 3PAOA 1VFTA 3WH7A 4C90A 2OSYA 5KZ6A 4IMFA 3KBSA 4A2SA 2XYLA 5BW6A 3EB3A 3PSVA 3VILA 1ISWA 1FWAC 3LU2A 1X8CA 4O0KA 3S1VA 2B7OA 3LENA 4JCLA 3IJLA 1PKYA 2ZZ3A 3MMDA 2FVKA 2PBGA 5KZMA 1ZENA 3ZSTA 4W85A 3KOFA 4GI4A 3OLGA 3WIJA 1PX4A 4NAFB 1HL2A 5EPDA 1UWUA 1EX1A 3FJ4A 4PMRA 1H7XA 2UY3A 1FHVA 2PDFA 4BQ5A 3S83A 2QULA 4DO4A 5HQLA 4PB4A 3ZVIA 4LQ1A 3T09A 3WJSA 5CG0A 3DFOA 1SJCA 4HT3A 4YYCA 3KOZA 3CZJA 1J79A 1S3HA 2DZAA 4NQ1A 4HYWA 4IG2A 3WBAA 3P14A 5J5DA 4X2RA 2YL8A 4FF7A 4DO7A 2GOUA 3ZMRA 4Z42C 1V7AA 2BTMA 4D6JA 1NELA 1X39A 1M1BA 3OVGA 1NJJA 1CXHA 1R0MA 1XPYA 1W0MA 4L9YA 2H8XA 3EMCA 3RPMA 1P1MA 2EO7A 3TJLA 4E3VA 4M7TA 4JTLA 3L0KA 3SRFA 1PKNA 2VTFA 1L6FA 3BQ6A 3VMPA 3AHYA 3L4XA 2PTZA 4NF7A 3W2LA 1ZBCA 3NR0A 4MLRA 1RH9A 4JEQA 3W87A 5FAGA 4R34A 1F73A 4L6OA 4DVOA 1J6OA 4GNKB 1X1OA 3OPSA 3V5CA 2ATSA 2G97A 3K8LA 2P0IA 4HNTA 1JZ2A 4A6GA 4NX5A 1QPRA 4XAGA 5EMKA 3WEOA 1LT8A 4ADUA 2O0TA 3U5YA 4PEKA 4PH6A 3LN3A 3TOYA 2A5HA 3NZQA 1S5NA 2WZTA 2OXNA 1LLZA 2QUVA 3RXZA 3WQDA 2F7FA 2HXTA 1UROA 6TIMA 4PEEA 1MNZA 4UCGA 1LRQA 2GPTA 3OZOA 3M5ZA 4HK5A 1AQMA 1E6SM 1A47A 1H50A 1TTQA 2J75A 1NARA 3MW7A 2WB5A 3UWZA 2WHKA 4G56A 5BOEA 3B05A 3CJPA 4AY7A 1D7FA 2YCIX 3RX4A 4JBRA 1WZLA 1E73M 2DT1A 3UVIA 1UMYA 1UASA 3WH5A 2XGBA 2D2JA 1VB9A 5DXXA 4FB7A 1FWFC 1AL8A 5EU9A 5D9NA 3B4YA 4XBKA 3M1ZA 1JI2A 1QXLA 3AIVA 3IGHX 3ECQA 4KCVA 2VZOA 3D47A 1XBZA 1LBFA 1TA3B 3TYZA 2V9DA 4RK8A 2VZSA 4LEQA 4Q8NA 1R8LA 4B3ZA 3GKFA 4WR3A 2B7PA 2O4QA 3AXMA 2OEMA 4ZTXA 4GYFA 5DXYA 4Q6JA 3BLIA 4PMYA 1LOQA 5GQBA 4LUIA 1FWSA 2E1WA 2ZZ6A 3T0BA 2POTA 1LT7A 3CB8A 4POCA 4QS6A 3H4WA 2BNJA 1UUMA 2J7FA 3GW0A 4NSBA 1KRCC 1VBGA 1I2NA 2H90A 1MO0A 1I45A 4AVNA 4FAMA 2VRKA 4GZJA 1G0CA 3TNOA 2FB2A 5G1YA 1U1JA 1QAPA 2IPJA 2ESCA 2V5CA 3F5KA 4GKTA 1XIBA 4C1NA 4C6LA 3MCMA 5D33A 3AXXA 3NO3A 4Q7BA 3UG3A 5A8OA 1ZCCA 2PLKA 1YPIA 5I3GA 3C4UA 1A5MC 2PWHA 1OWQA 1EJXC 3N2BA 4KF1A 3LX9A 5EB8A 3BVJA 4DLMA 1F3EA 3NPXA 5BWAA 3RNDA 4QE1A 1X97A 3GHRA 3VMOA 4GABA 4IQDA 1UOZA 4O13A 4K7YA 3CLMA 1IXNA 3K8MA 2WWDA 1UWQA 1UWSA 1QMLA 5M03A 1UBPC 2V3EA 4DJDC 2DUXA 3R12A 4MSSA 3WL0A 1XI3A 4JFSA 4X60A 1H7PA 2X09A 4Z1AA 4J3XA 4Y2WA 3PY2A 1FCUA 1O60A 4YVPA 1EA0A 1N8IA 4AFYA 1YPFA 4H9MA 4GXPA 4LS0A 4F4RA 1TV7A 4A3RA 1BF2A 5E5CA 4AW7A 4NZ4A 4HK7A 3TYEA 3IUHA 2JE8A 1TE6A 2Y61A 1EC7A 1E4LA 2J7HA 3LLXA 1XIJA 3E0IA 1UD4A 4U33A 4ZOCA 4GQQA 4IP7A 3TOPA 4AMCA 1WDWA 3QW3A 3P6LA 4OHQA 3VIIA 3R0UA 3WG6A 1O4UA 2DORA 4J3SA 3QSTA 3LMYA 2WSPA 4US5A 2WZEA 5CC3A 2DZSA 1NQKA 3TYDA 4PC8A 4PTNA 2Z28A 1OFBA 1WAWA 4I9AA 4DXKA 2DQXA 2ZTKA 3W7QA 2CLEA 1EA9C 1R2SA 3BJSA 3EOLA 1LLOA 3VK5A 2WK2A 3H4XA 2Z26A 1HJSA 1Q6LA 2HXUA 2DIEA 2QCHA 4AHOA 4B4HA 1H7NA 4FI4A 4EAYA 3H2OA 5A94A 3EWDA 3ZLGA 3LQGA 2ODOA 3MYOA 1C91A 2PDYA 3WQWA 4HMDA 1V3LA 2VCBA 1WKYA 1XRTA 3ZXWA 5M5DA 2JGQA 1TE1A 2E4TA 4PMJA 2DVXA 4WSJA 1ITCA 4QEHA 4MMWA 3EMZA 4O1BA 4UQCA 4XZLX 4JTHA 3AOFA 3H2AA 3KVJA 3W02A 1V8EA 5C9WA 5DANA 3CYVA 4ZO8A 1CI1A 2J6XA 2QKFA 1BQGA 1A5UA 1B3YA 2ZA2A 4YTSA 2QVHA 3LCGA 2Y88A 4GUGA 3UWUA 3WDRA 3NPWA 1VIWA 4B5XA 2HV5A 1HGYA 3PBVA 4HB7A 4RV8A 5G5IA 5A8QA 4GMEA 3UCDA 1YTDA 4C6IA 5I3IA 5JBFA 3SCQA 2DZBA 4Y7EA 1E56A 5BYWA 1R46A 4JNMA 4MFDA 2WMGA 4A29A 4O8AA 4CD7A 1PEZA 1VCFA 1Y0EA 4Q22A 3BE7A 3BAWA 1D8WA 1VFFA 3QMTA 3I7RA 2H6RA 2Z00A 1TPH1 2Z0IA 3AMGA 4GQ0A 1M68A 5L9FA 2DT2A 3GH5A 3ARXA 9RUBA 3QV6A 3GQYA 2PWDA 3CUFA 3B8WA 3ONBA 1V3JA 3IK4A 1L6GA 5AYIA 5JBDA 4NJIA 1KV5A 4DUXA 2F8QA 1SSDA 1SZGA 2VHLA 3CO8A 3IUDA 1FWJC 4BQ4A 5XIAA 1WXZA 3M0JA 4DZIA 2FVLA 1EF2A 3D3AA 2JQXA 3KRZA 3REQA 2FJKA 3TN4A 1G69A 1Z69A 1RQEA 5DMYA 5DQPA 1XLLA 4MAZA 3A5VA 3W85A 1Z42A 2WMJA 2CC0A 4P5UA 2YBVA 3C0QA 2A21A 3C3UA 1KBIA 3VDBA 5BXTA 4K37A 1GVFA 2VCAA 1B1YA 4P7QA 4NAFA 2A6LA 3EKLA 3DDMA 3RJYA 1PZ1A 1CLKA 2ZICA 4QS5A 1I0DA 1SR0A 3CO4A 1JIBA 3S2CA 1LOSA 2HBVA 4QP0A 4JEJA 2F6KA 3CPRA 5G4WA 4M1RA 4DWSD 3NZGA 3SUWA 1TQXA 3VI2A 1NIUA 4HSOA 2BFGA 3NQ2A 5ECUA 1NWRA 4M3PA 5ABTA 1AODA 3QR3A 4NX0A 4IPPA 3PAJA 1E0VA 1W5PA 3QFWA 4C6CA 1PTGA 5HPOA 3HPZA 3EX2A 2J7DA 3QR1A 1UQZA 4S3DA 5DT7A 2YX0A 3BOFA 1DQUA 4DO5A 1NF0A 2FGBA 3B0VC 2FGLA 5DMNA 1EIXA 2PRHA 1E5NA 2ZUSA 4WDWA 4DZ5A 4IUOA 3GNOA 1DKWA 2FDSA 3WF3A 1K9FA 2QHAA 4KEZA 1EDQA 3L4WA 4GOAA 2QAPA 1Z48A 3NXLA 1KGXA 5I5RA 2OLHA 2P10A 4E8GA 5HQEA 3EWBX 3FA4A 4DYKA 3W2MA 3LGEA 3V18A 4HOZA 3VKKA 1CGTA 1F6PA 3CYJA 2WBGA 3VD5A 3V35A 4Q8VA 2IQTA 2X8RA 2XG9A 3CAKA 3W53A 2YCEA 1HKMA 1TWZA 1XRSA 1XG4A 2ZZ2A 2QDHA 1X1ZA 4M6PA 3O0KA 1EWEA 4P7NA 2AGTA 3KRSA 3N13A 2QAFA 4AG0A 2IPFA 3ONCA 2AQVA 4EVZA 3W1TA 1I0BA 3THQA 1J0HA 1FWRA 3M0MA 1OJXA 3C56A 5I24A 2WPGA 4JFTA 4XO6A 1K9DA 3GTIA 2HZGA 3SDOA 1UH3A 2Z2AA 2V5JA 1FWTA 3L4TA 1THFD 2E40A 3T40A 2Z1KA 1ENUA 4NT0A 1DQXA 4O10A 5I78A 3RUBL 3GZ3A 1UP2A 2OZ3A 1EP2A 2DZVA 3ES8A 3SCTA 1X98A 2D22A 3WLQA 3W1AA 2ZRWA 2H3DA 4NNCA 1KTCA 2GJXB 3N4FA 3ZQ9A 1XWYA 1NVMA 1TA3A 2ZRVA 3MI3A 3AWOA 1P6CA 1X6LA 4N9DA 3FN9A 4D72A 3PZMA 3BTNA 3B04A 2PDNA 1R9XA 3GXFA 3LTYA 3ITCA 3KVMA 4DZHA 3N19B 3NPVA 4EPEC 1PZ2A 2HNHA 1S2WA 2BOGX 5KEZA 3TLLA 1QO2A 4JQ3A 3EDDA 3T0AA 1TRIA 4IFRA 2X1IA 4Y8FA 5MHBA 3BSHA 4PUNA 4B2DA 2OCZA 4J35A 1ZS2A 1XLDA 2PLJA 4ML9A 4MWAB 1N8FA 2Y2WA 2REQB 3MMTA 5CPSA 3KX6A 2TYSA 4QAWA 3OLIA 4MUZA 1Y5XA 4KFOA 3GNNA 2DZTA 4AIEA 3F5JA 1DQWA 1XRFA 2ZZ4A 3QYQA 4XD4A 3MY9A 5C0QA 4EPKA 4YWIA 2ZUMA 4HZ7A 2PODA 1DWIM 2JK2A 4E8CA 3M7WA 1WBHA 1OB0A 4Q8QA 3BC9A 3QBUA 2YZ5A 1NFGA 4MNKA 4AZCB 3RU8X 3GHUA 1EEPA 3PVFA 3THCA 5JBEA 1QPQA 3SQLA 2WJDA 3THAA 4Y9OA 1WDQA 4ZQCA 3WNNA 4Q4OA 4P8WA 3VE7A 2GWNA 3VNJA 1Q6DA 4BJHA 1U2YA 1S5WA 2XSBA 3II1A 2E5CA 4CLMA 2X7WA 4KGLA 5FJIA 3NAVA 4GUFA 2X1TA 4RNFA 4QDWA 3IJ9A 3NQDA 1QU4A 3UR5A 5D03A 2ZZ5A 3APTA 3AWNA 3I7QA 3UF9A 3T0TA 2BVTA 4CD4A 3VCCA 1T99A 1W9XA 5IM51 1T96A 2VENA 2P0OA 1XLFA 1KBJA 1IHIA 4K7VA 4GINA 1ALDA 3WEMA 3GO2A 1RSCA 4CGTA 3QC3A 4XVDA 4P7LA 3LRMA 1XJBA 3WEZA 4XWUA 4DWSB 4N2YA 2VGIA 3IPWA 2WANA 1WAUA 4HPHA 3T07A 2AKZA 3TN6A 1PX8A 3UZYA 3HPXA 3SFWA 4IP4A 3SCVA 4O18A 1XC4A 4FNPA 4IPLA 1WDRA 2F9RA 4WJEA 3E0LA 4PUMA 3RN6A 2Y7EA 2YZRA 1TIWA 1WYIA 4UZSA 3BDKA 5LSMA 2HK0A 2RHGA 4YTQA 4XIAA 1W1A1 3TP4A 4FNSA 4LF2A 2OELA 1LG1A 3FDGA 3FAWA 4Z0JA 4MOZA 2IQ0A 3OVQA 4PFHA 3L4ZA 3UR8A 3VTRA 1P0DA 3NSXA 1K6AA 2ON3A 2WNNA 4J28A 3TNBA 2X2GA 3W7GA 3LDVA 1QNVA 1B9BA 4NXSA 1ONRA 1FH8A 1Q6CA 1JPMA 4ML4A 3Q58A 1AJZA 4ZGYA 4CCZA 1EEXA 1ZRQA 3WL1A 4UMBA 3NQ7A 1U5VA 1JYVA 4AWUA 4B3KA 3FFSA 3K30A 4JD4A 3OZMA 2ZADA 1E6RA 1O5RA 5LGZA 2E3ZA 5AYXA 3R8HA 4I5RA 3DYPA 4EWJA 3TQVA 3IAPA 3SECA 1TWIA 1YE6A 4B91A 3IJ7A 1HKWA 4LY4A 5FEPA 2O7SA 4TVDA 2Q09A 5CJMA 2CLLA 1RY0A 2QEZA 4R85A 4DI9A 3VZZA 1FHUA 4O0QA 4GIRA 1KWGA 1SO4A 1H3GA 3FXYA 3WD3A 2GQ3A 3RPDA 4UR7A 3G18A 2A3HA 3L7RA 1V0KA 1E9ZB 2HEJA 2XM1A 2V82A 4UNKA 2X42A 2HS8A 4UTLA 5A6MA 3FYOA 5E1QA 1XDLA 4NY2A 3ZWSA 1H4PA 2BGSA 1A49A 1AH0A 1CGUA 3MI6A 4AXNA 1IF2A 3RX3A 2VURA 2BASA 3M0HA 3NXFA 1QPNA 1Z41A 3WUGA 2G37A 4J3TA 4DB7A 3GX9A 3OP2A 3WLRA 2QCGA 4KKXA 3WBXA 4S3BA 4FOKA 2JKPA 4R9OA 3CMFA 4OUIA 3A3HA 5LIUX 4PBEA 3BUVA 3CZ8A 3VKCA 1H09A 2YW4A 3NQAA 3LPFA 1K9TA 3ITLA 3M41A 1E6XM 1XLJA 2E67A 1S5VA 3JS3A 3T4WA 2ISWA 3H21A 3MZNA 2PGFA 4XO7A 3R2GA 4TV5A 3R58A 3USBA 3NQVA 5FF2A 5IRPA 1KTBA 2WVUA 4I3GA 1G5AA 3WLPA 3RG6A 3OLEA 2D2GA 3ARQA 5C55A 3WLTA 3BLOA 1TFVA 4NVTA 4K38A 1TV8A 3A13A 5C2GA 3CU2A 1ZUAX 3ITVA 2IS7A 2WKGA 3SY8A 3NYDA 5M3WA 3WUFA 1TWWA 1MW3A 4NAEB 1FKWA 1P1XA 1PHWA 3CBWA 3SCNA 1CDGA 5LIYX 3CWHA 2DIKA 3SIZA 3WNOA 2ZDRA 1LBLA 1WNOA 4JIIX 1EQPA 3GR8A 1K8CA 3IIOA 4W7WA 2CWXA 2I17A 3C2FA 4UQBA 2Y62A 4F0SA 4JYDA 1N82A 1SSGA 4PTWA 2DU2A 1OFAA 2CWNA 1W1PA 4UTFA 1CXEA 4MKNA 2W5FA 5DX7A 1D3GA 1TPDA 3GVGA 2PTDA 4H2HA 2ACSA 3W7KA 4W7UA 1UZHA 1E9YB 1T5AA 2BS9A 3HM7A 3URNA 2Z6JA 1D3HA 4MAVA 4H04A 1UA7A 4RUBA 1TX0A 1AG1O 1KM4A 4B5UA 2J24A 2R82A 2DSWA 1CPUA 3PR2A 2VUYA 4FA3A 3W1NA 2RFGA 1BTMA 2YDAA 3U4FA 3U48A 2W91A 2Z29A 3NL5A 3RR1A 2BVWA 4I7UA 3SY1A 4ZB0A 1RPKA 4M5PA 2R94A 3RIKA 4AX7A 1V6VA 1RZMA 1AQ0A 3ITGA 1VFMA 1YXYA 3I6RA 4HOWA 4XTIA 1B3XA 3VD3A 1JZ3A 4R7WA 3H53A 3ELFA 4MM1A 4C5ZA 2BXYA 5A6LA 3GUWA 4ERGA 3QOKA 1TZ7A 4N9BA 4PTDA 1VCGA 2WXDM 3WJXA 3QN3A 4C7FA 3HQNA 4RE3A 4RW3A 1VHNA 4K36A 1E0WA 3NFUA 3U7VA 4ERIA 4GA8A 1Z3NA 1FWBC 2WV8A 3QY8A 3STGA 3O6DA 4D6GA 1MYRA 1FQ0A 2CEQA 1GOQA 1PYFA 1VR6A 1I75A 1XQLA 4CD5A 4DNMA 2G41A 4CNTA 1OC6A 1XG3A 4OVXA 2RDUA 1GHSA 4PN2A 1R3QA 2GJLA 3UJEA 1OFEA 4XG1A 1UPPA 3LHUA 1OM0A 1CB2A 2UY5A 3TA6A 3CV6A 5FF7A 4FXFA 1K4HA 1KM6A 4Y96A 2HISA 3M43A 5G2WA 4PGLA 1AH3A 1JPHA 1XH0A 4B5VA 3WBEA 2GJXA 4E2DA 4MJZA 1F8IA 2G3IA 1WO2A 4MUPA 3OGVA 1MXDA 4LTSA 4PCNA 1ZAJA 3W74A 1BGGA 1G7UA 1JYNA 4AVFA 4Q8UA 3I10A 4H9VA 1ONXA 3A64A 1KXVA 1LQ0A 3S2JA 4ATLA 1EL3A 4J3ZA 2DW6A 4GH1A 4PUJA 3DENA 2OSWA 3W2NA 5H1WA 3QRHA 3LHZA 5FSDC 1J9YA 3HN3A 4L1XA 4M0XA 4MWAA 2REQA 3N3TA 1ADDA 3QKZA 3VM7A 3QEZA 1KBBA 2CW6A 3TTYA 1VJZA 1V6YA 4CCCA 1OEPA 5D37A 4WIWA 3FSTA 1Q4WA 3UZXA 2X2YA 1K8ZA 4IMEA 3KZPA 3WD2A 3IANA 4NI8A 1XBVA 1NF7A 4EPBC 3B3DA 5AOUA 2ADAA 3GFZA 1GK8A 4AQLA 5A6AA 1ZBWA 5C70A 4HK6A 3P62A 2INEA 3VABA 4DJFA 5F7UA 4HOXA 2YLLA 1X6NA 3PZTA 4OWGA 3N04A 3CIVA 4LCSA 1E6NA 1RCXB 1W1IE 4AZCA 4MADA 4QIUA 1NOUA 4WKAA 3SGGA 2HQAA 4TUFA 4GXMA 3PBGA 2VT0A 2J7EA 3C0SA 1R3SA 2JGYA 3CHVA 4WEVX 3ZLHA 2H8ZA 4PRWA 1KB3A 2WMFA 3P67A 4UMAA 3VZXA 4QRNA 1W2VA 4U28A 3NM3A 3OA3A 4NKCA 1OFRA 2YL5A 4XZBA 5C6MA 5A6BA 3N14A 2WZHA 4FS9A 3MJYA 1JCJA 2A7PA 2ZXDA 2WOQA 3EDEA 1SW0A 1NP0A 4C6KA 1FHLA 4N4PA 1UH4A 3NQEA 3QMRA 1RPXA 3HU7A 4XVEA 3Q4DA 2YR1A 1XYBA 1FWIC 3K2GA 1VLWA 4P8UA 3WLHA 3S3GA 4PUWA 1Y5WA 4W86A 1QR7A 2F38A 2EBNA 4F9JA 2O7QA 3CH0A 3MQTA 1X8FA 4DWSA 3GIYA 4Z2GA 1BYBA 4H8NA 1W31A 4HSNA 3XINA 4KRTA 5GJNA 4LBSA 2ZX7A 1XBXA 3WQPA 4YU1A 5A69A 1A0EA 2YXGA 1S39A 1GVSA 2LLEA 3FVDA 2O92A 4I9JA 4JTAA 3B4UA 3SJ3A 1RCOB 3W1XA 1OABA 1ZAHA 2P50A 2PTXA 4JL1A 2B31A 2QQ6A 1VFOA 5DELA 2VZTA 2WNQA 3ZYZA 1GZGA 2PWGA 2X1UA 3S1WA 1RA0A 3UW6A 3LSBA 5CG7A 5FJOA 1XIGA 3V3WA 3VMNA 2XH4A 1FA2A 4M8UA 1PS9A 6XIMA 2DVTA 2OQYA 2RKXA 4Z1CA 4DNHA 4UUIA 2JALA 5A8MA 1L6WA 7ODCA 4NJHA 1JAKA 1PE1A 3AXHA 4JTUA 4C6QA 1HVXA 1L8NA 1O68A 2FMNA 1CX9A 5EFFA 4U3AA 2A2IA 5AC5A 4GISA 3CHCA 1IR2A 2I5IA 4LUJA 1VF8A 3EX3A 4BK9A 4LFYA 1JR1A 4K6AA 4GKLA 4Z2LA 4L64A 4F40A 1CXKA 1QOXA 3GWQA 3ZSSA 1JXKA 3KAOA 3PTDA 3AJXA 1QFEA 4H7CA 3MCNA 3CUIA 4JN6A 4LAOA 4WX2A 5A3HA 1OFDA 5JXQA 1F9CA 3E12A 2ACRA 3QGVA 3GY1A 1NFBA 4F2TA 1RD6A 3URQA 4UFLA 3PNUA 2QCFA 3HPFA 1OCNA 3DGBA 2A3BA 2C1HA 4JTSA 4JTQA 3D0CA 3E5BA 1ITUA 4QE4A 4LALA 2X1RA 2Y7FA 1Y8BA 3B40A 4UTTC 5CPQA 4GYPC 3BLLA 1W3TA 2QVNA 2B0MA 3TAOA 1BLIA 4K2SA 4GZEA 3VU2A 1JD9A 2V2DA 4UNLA 2OYKA 2HROA 2O9TA 5LA1A 5C9ZA 3HGRA 4AY1A 3BW4A 4HHMA 1AMKA 2Y0FA 4C65A 1TJRA 3DERA 2PGEA 1BWLA 4C6FA 1GYMA 1RBAA 3TC6A 3DFYA 2GJNA 1E70M 3VGFA 5LZLA 3PFMA 3H2NA 1EJVC 3GSMA 1HTIA 4GY0A 1ZAIA 1AH4A 2Y8VA 3F03K 3LI0A 1JCYA 1KQZA 5TQLA 4W8BA 4RW5A 3I3EA 4AZHA 2OU4A 1MXGA 4JTTA 2J7GA 3AYTA 2QT3A 1VYRA 2QJMA 2ZVIA 2V67A 4DXXA 5CXPA 3RLHA 4L7ZA 4KCWA 4NAEA 1BD0A 1WKEA 1TPC1 3I6TA 5TNVA 1E3ZA 2V68A 2CITA 2CXEA 4KRUA 4AVOA 2ZZ7A 2PD9A 2I14A 2ISSA 4KIRA 2FGZA 3LI1A 2OQLA 2ZRXA 4HU0A 1DV7A 2YPIA 5J5RA 3W7LA 1WB0A 3AIQA 1HFBA 1FHDA 1N2VA 3BANA 4PL2A 1QNRA 3PN8A 3RLVA 1BKHA 1QW9A 4GUJA 4L80A 3PZGA 5T9BG 3IRDA 1OF8A 4PUUA 2I7GA 1P0KA 4M80A 1NWTA 3ITXA 1RVKA 1S1PA 3RK8A 4KWSA 2XGZA 3WLOA 4RNHA 4CN1A 5FACA 5AKQA 4OFCA 4ALDA 2CHRA 4I5UA 4QQUA 1JFXA 3GG1A 4GVHA 4S2CA 1QI5A 3L65A 1KFWA 3DC0A 3PTQA 3DHUA 3LM7A 3TV8A 5EBAA 3HTWA 2XN2A 1NQ6A 1W1ZA 2QV4A 4E38A 1UIOA 5E0CA 3W72A 1TPB1 3GNRA 4YMZA 4GQGA 3PB2A 5I07A 3T2QA 4K8EA 1GZJA 1JDEA 1V3MA 2EPNA 3G8RA 3MUCA 1YTKA 3I4EA 3EA1A 3VO0A 4ASTA 3SRHA 4Q4KA 3STPA 5C9RA 2CERA 1TVLA 1BRLB 1RAKA 2IQDA 3LA4A 4DJED 2HRWA 5HNTA 3LLFA 3BJFA 1F6KA 1K7XA 1XSKA 3SGUA 4OZOA 5AHLA 4JIRA 4GBUA 3WD1A 3LOTA 2EG7A 4NZ3A 4K39A 3VYLA 4V27A 3TQ0A 3W6LA 1PB0A 3GS6A 4MJ4A 1FWWA 1FRBA 2EEXA 2JIEA 3QPEA 1JJKA 2BX7A 1E55A 2Z1VA 1ISYA 4QLLA 1P0NA 4PE8A 3FGCB 4MNJA 2VQUA 1V6TA 3WO8A 1UP0A 4LB4A 1IZKA 1A5AA 1UCWA 3ABRA 3HZ3A 3PUEA 4HNNA 2QYGA 4M81A 3RYSA 3KXQA 3B8DA 5IFTA 3DX5A 1AW5A 1XYLA 3QW4B 4DEFA 3ANYA 1LZOA 3G1VA 4H8UA 1Q5MA 5E0FA 1GGOA 3TXVA 1J0IA 1OGSA 4I6KA 2J78A 1PXGA 3HPAA 1VPYA 1YW1A 2MANA 1L9WA 3QXBA 3N4AA 4L9ZA 3LYEA 2WO5A 4ZQPA 4KWWA 1TSIA 4JYFA 3O3RA 3AS0A 3EOSA 3SI9A 1GVYA 4IMDA 3A47A 4GACA 2I16A 1WP6A 4GJIA 2TODA 2CYGA 4PB3A 2R9RA 2J13A 3E38A 1OK4A 4BA0A 3TUUA 3NEHA 1HXJA 3K5XA 5LNWA 3SCUA 2QUMA 4B90A 4QISA 4TQTA 2IXUA 2QCMA 3Q45A 4RE2A 3QGAC 4LEFA 3LB0A 1YRRA 2KAUC 1B31A 5HNUA 2Q02A 1Q7ZA 1VPQA 4PMNA 3MZ2A 5E09A 3JUGA 3VNYA 1UD2A 3DFTA 3R79A 1IWAA 2EPOA 2NX9A 4JHMA 1PJ9A 3WDJA 4RJEA 4O16A 2ISDA 1U30A 2YBUA 5EGRA 3P7YA 3E3HA 5GNZA 1PIGA 3GB6A 3HFYA 1EO5A 2CBJA 3HGJA 4Q8TA 3AIRA 3HOJA 1NSJA 4QSFA 1GORA 1MSSA 4U2YA 2R1LA 2XZ9A 5FL0A 3GBDA 1NDYA 4LANA 3ZT7A 3QKEA 4Q4PA 4NIRA 5FKYA 1M41A 4UFHA 3BG5A 4KWOA 2FDMA 3NQBA 4FOJA 1R7AA 4AC1X 5LGXA 2E7FA 2HNEA 1TR9A 1VFSA 1QHPA 2ZC8A 5KETA 2BB0A 1CYGA 5AB3A 4OU1A 3VCNA 1BYDA 1HW6A 2QNEA 1UZ4A 2A6NA 3IEBA 1GVRA 5A6JA 1TV3A 1OK6A 3IWPA 2GGJA 1HJUA 4AC7C 3HO8A 1TRDA 1KM5A 2OOGA 2XHYA 3O63A 4PMQA 5REQA 1OYCA 5D38A 2BXZA 4GI6A 1KM3A 3SQSA 3L68A 3W2KA 1YXCA 1GKPA 4ECLA 3TONA 3HIJA 4M51A 3AROA 2VGGA 4YLWA 2E25A 4JL2A 3N6QA 3WF1A 3LCLA 4EACA 1JFHA 3I7SA 3TW9A 2Z2BA 3WYZA 1PV8A 1W3JA 2JEQA 3GHSA 3O0FA 3CQHA 3PZIA 1JI1A 1B9ZA 4UFMA 1EBHA 1ECEA 5HULA 1WV2A 5CBBA 2E9LA 5FF3A 1QATA 1OBAA 4S1FA 3MKKA 3OW1A 1VFHA 5C54A 5GJMA 1IIHA 2RGLA 5C8BB 2C1GA 4QDPA 1VZWA 4XIMA 3OHMB 4YVXA 1DE5A 4E8DA 5ABGA 1TWSA 1JZ4A 1X96A 4X0VA 3MSRA 1A3XA 1S2TA 2PP0A 3K4DA 3BH4A 4M7SA 4U3CA 3VD9A 3RRXA 3EDKA 4GJJA 2XZ7A 4XTDA 5DBUA 1V02A 1MI3A 2VKZG 3VXGA 4AD2A 1P0BA 1B30A 1W1VA 4AB4A 2I5GA 1HKIA 5FJUA 3VD4A 1RQHA 2IUZA 3GYCA 3C61A 1M9HA 1REQA 4JYEA 4RDZA 3EAUA 1TV4A 2CHNA 3MTWA 2WLYA 4ICMA 3OQEA 4QNWA 1P48A 1H1ZA 5E9XA 3KUMA 1NM9A 3IVSA 2WM1A 3ITOA 4FR6A 5D9PA 3MHUA 4HIBA 3CWOX 3G0XA 1GVIA 5BRBA 1WX0A 4KMQA 1TV2A 3L66A 3ZFHA 3A21A 4GIYA 4QLKA 1H5YA 2GSEA 1VPXA 1XFBA 2WQDA 4LAMA 4DYEA 1WQ5A 1Q7QA 3STEA 2E9BA 5HWJA 4PTMA 4PCPA 3FY1A 1OFOA 2CLOA 4FR1A 2Y7DA 4O4VA 3W27A 4DBDA 3AYSA 3R8GA 3EXRA 2YIHA 4CU8A 3ABZA 4QXIA 3W07A 4WVXA 5AC6A 4NZ5A 2WQPA 3GH7A 3PJTA 1K02A 4Q3MA 5M1TA 5B80A 3GUGA 5EMYA 4GBDA 3KW3A 2I9UA 3O6CA 4W88A 5H6HA 5DN1A 2FZDA 5CZKA 4RX0A 2VDHA 1ITXA 3W2JA 3T0CA 1QDSA 3PK7A 1GVQA 4H7ZA 3TK7A 3QHNA 5IXEA 1G94A 1GW9A 1JPKA 2HPMA 2VNCA 3LEPA 1B3OA 1B3VA 3WLJA 4A8IA 3F2DA 3E49A 5AN7A 1KKRA 4RZ5A 4NL1A 1S38A 1NDVA 1XLAA 1ZALA 3PZQA 3TN5A 4BWLA 5DEZA 4F8XA 4M1BA 2HVMA 1IR1A 1SZFA 4O8RA 1MZRA 3O7UA 1UC4A 5FCZA 4CN4A 4LCQA 1EJTC 4WGHA 6REQB 1E6QM 2XIBA 3O06A 1P4CA 1RLDA 1XLHA 1ONEA 3OGRA 3U2EA 3C2RA 3GU9A 3TJ4A 4LVGA 5MKGB 2ZWZA 2R1PA 1C7SA 1T6MA 2NSXA 4X0NA 4LV4A 1WDPA 4N42A 4RPQA 1IT8A 3PTMA 1GJPA 3GC2A 1PKLA 4TV6A 3ZR6A 1MRQA 5A95A 4US6A 5CCZA 3DUGA 4H3DA 2BOFX 3G6LA 1F74A 5K9DA 1TELA 1EJ7L 1XDJA 4PSPA 1B90A 1MVYA 3CH9A 3W7EA 2VRJA 2XINA 3TW6A 1VBRA 1IIGA 3WBYA 4AYGA 1FCVA 2JFEX 2Z2UA 3PBYA 4W7VA 4O1EA 3B97A 4B5SA 1OHLA 1SMAA 3WMSA 1EOMA 1MQPA 3BGGA 2D2OA 4GX9A 1OCJA 2ZYFA 5BMXA 2X0YA 4QAIA 3LV6A 1OIMA 1OZQA 3WLMA 1YHTA 2A3AA 4S39A 5FESA 1BRLA 3H2FA 4YS1A 1XYZA 1EPVA 3PJXA 1K7FA 4UOQA 5K9XA 1M53A 3T8QA 3S1UA 1JPIA 2PCQA 7CGTA 2FFCA 3AO0A 5HXMA 4DF2A 4LH8A 2IPWA 3SCRA 1PDZA 4Q7IA 4EIVA 4AEEA 1TWDA 3UYCA 4GG9A 3LZ3A 5CPTA 5CC7A 3PPCA 4RZBA 3FGCA 3PPFA 3WNLA 4P7OA 4A8NA 1DYSA 4OJYA 3W1UA 5B7ZA 4IZGA 3N2OA 1GT8A 3MVTA 1V3IA 2FQIA 1F3WA 4W8AA 3U2OA 4PTVA 1BG4A 1TTJA 1WDSA 3S2MA 4S3KA 3GG8A 3UPMA 4NJJA 1BHGA 3MUXA 3W84A 3MHGA 2GWGA 5DMLA 4XUYA 1J93A 1RP9A 5D32A 1P6BA 1XX1A 1QPOA 5K3VA 1QUMA 1AK5A 3DYMA 3PBUA 4AISA 4XZIA 2BHYA 4DHGA 4I90A 2Y1HA 1ADOA 2YW3A 1BVZA 1PX3A 3S5NA 3O2LA 3V5OA 1WZAA 1XGZA 4JY9A 3MVIA 5BXPA 2R8WA 1NOWA 5D8ZA 3GNXA 2PD5A 2PWEA 2PDGA 1B5TA 3BZJA 3WF0A 3L2MA 3HJZA 2Q3OA 4CNSA 1NDZA 1LJYA 4IJBA 1ZP4A 3IGXA 2WVSA 3DG3A 1XD0A 2QGYA 3LPPA 3KBWA 1PKMA 3KCLA 3GR4A 4NUWA 4NZ1A 3UWEA 4LRTA 3PBWA 4GWEA 1TCMA 4K3ZA 1TJ1A 1XCXA 2F84A