1XW8A

X-ray structure of putative lactam utilization protein ybgl. northeast structural genomics consortium target et90.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
247
structure length
230
Chain Sequence
MKIDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQIMQACVREAIKNGVAIGAHPSFPSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVKPHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGKQYGLTTREEVFADRGYQADGSLVPRSQSGEEQALAQTLEMVQHGRVKSITGEWATVAAQTVCLHGDGHALAFARRLRSAFIVVAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of putative lactam utilization protein YBGL. Northeast Structural Genomics Consortium target ET90.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords UPF0271 protein ybgL
total genus 65
structure length 230
sequence length 247
ec nomenclature ec 3.5.2.9: 5-oxoprolinase (ATP-hydrolyzing).
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03746 LamB_YcsF LamB/YcsF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 1xw8A00
3CL7A 4NYYA 3CL8A 4NZ1A 4V33A 2J13A 4F9DA 2DFAA 2E67A 5JMUA 4OUIA 2C79A 4NYUA 1XW8A 4NZ5A 3RXZA 3S6OA 4HD5A 1Z7AA 4L1GA 4F9JA 4NZ3A 2IW0A 1V6TA 2XU2A 4NY2A 5BU6A 2QV5A 2C1GA 2W3ZA 2C71A 1W17A 2I5IA 1W1B1 4LY4A 3WX7A 3HFTA 4WCJA 4M1BA 1NY1A 2Y8UA 3CL6A 4U10A 2CC0A 3QBUA 3VUSA 1W1A1 2C1IA 4NZ4A 2NLYA 2VYOA
chains in the Genus database with same CATH superfamily
4LV9A 3AXXA 2P5NA 3I3EA 2PSNA 3H4WA 4ZOBA 3HPFA 3AIBA 2ZUVA 4H3DA 2Z26A 4E2VA 3C2FA 2OYKA 3QR1A 1GOQA 3N4EA 2Y7GA 3U0HA 3AXKA 1DBTA 2E1WA 3UZYA 3NL6A 4GYFA 4JCMA 1ICPA 1DWJM 2PCQA 3ANYA 5G2IA 1ZQ5A 4U5IA 2F6UA 1C7SA 4IX2A 3S8HA 2HVOA 3DCPA 5DCDA 3VM5A 2TAAA 3GHRA 4JFSA 3C0LA 4HCLA 1KCLA 4O19A 3VKAA 4LRTA 2E77A 3FGCB 4LU0A 3T78A 4WR3A 3A47A 2E9MA 3IARA 1VBGA 4DJFD 1EGZA 1VS1A 1Y5WA 2PTZA 5DF0A 2XGZA 3OA3A 1F3XA 3N11A 3PM6A 3IJ9A 5DMNA 1E3ZA 4AH7A 3P3BA 1DORA 1H1ZA 4J3SA 2HMCA 1XIMA 1OX4A 4Y9NA 3S4TA 2D0GA 1KR1A 1LUCB 4O18A 3KCOA 4WDTA 5HR7A 5FAJA 4Q4QA 1R47A 4MKVA 3TP4A 1FWIC 3QPEA 1ELSA 1OFOA 4LC6A 4P8UA 1I2OA 1FCUA 3W2JA 4R34A 2ALRA 1UHVA 4UQDA 3DFTA 2AKZA 3AWNA 1J0YA 2QDHA 2JF6A 3VDAA 5DCBA 4BF5A 1T8QA 1WCGA 3VOIA 2W5FA 2V2CA 5A6BD 4DY1A 3QY8A 3F1QA 3GKAA 1AW2A 3IUIA 2Q8LA 3MMDA 4W5ZA 4NSBA 5LXEA 1WBHA 4IMFA 2VCBA 5C9UA 1K9FA 1OYAA 1HG3A 4XISA 4H4IA 1J4EA 3CU2A 1KLYA 5D4YA 1XLEA 4MB3A 1V6UA 4G7FA 3AAMA 3LV5A 1TX0A 3CQKA 4TUFA 2WQPA 2YCIX 4RNFA 4LQ1A 1BGGA 2OSWA 5I6SA 1W5OA 3NVDA 4KEUA 1C90A 1P5BA 2A6NA 4PE8A 4AZ7A 3QHMA 2HEJA 2XPKA 3SB0A 4GG9A 3R8GA 1WDSA 1W2PA 3R7MA 4HMCA 4XAFA 3PJUA 2Z1XA 4O1BA 5CPQA 2WVTA 1R46A 3OHIA 3PZ9A 5D32A 1VFSA 1UC4A 3L67A 3OGVA 3GAYA 3WF3A 1AL7A 2NSOA 1P6BA 5HQEA 1XLBA 4HKPA 2PAJA 1ZSXA 4ZQCA 1WAUA 1FHDA 3G1RA 4GD0A 2HBXA 3W82A 2HZGA 1Q6RA 4H8HA 3RX2A 2PWUA 3CEPA 1J18A 4PCTA 1EEPA 2GLKA 3UNTA 3OA5A 1Y0EA 4YVVA 1OQFA 2QPXA 3VIKA 3TQKA 2WNZA 3UJ2A 3WH6A 1R2SA 2V63A 3NXLA 3AIRA 2V68A 3M0HA 3IVSA 3AIQA 5E93A 1J11A 3LPPA 2QCHA 1X6LA 1V6YA 1I0DA 1TE1A 1Q7ZA 4ZR8A 3CK5A 1TQXA 3A64A 4A05A 1RP8A 4UOJA 5SWUA 2NQHA 4D1IA 2Y88A 3GM8A 2MUCA 3DUGA 4KRTA 3GDTA 2NVDA 3V0SA 2PU0A 1QPQA 7A3HA 3B8TA 4H7CA 1VP5A 4H41A 4JN8A 3UCQA 3O0KA 5HJYA 1QAPA 1IIGA 2HV5A 2E8YA 1TV2A 3LGEA 1AH0A 2BY3A 1GEQA 3THCA 4AW7A 4TU1A 3IS4A 1EH9A 1LLWA 1EP1A 3HOJA 4OV4A 5E9AA 4F40A 2OVLA 4H19A 3KDOA 4EK7A 1JNDA 1D7FA 1ODUA 2V30A 2O7QA 4JIQA 2PDHA 3F4CA 3VIMA 3EX2A 4JTGA 4UTFA 1QPOA 2JKPA 2A85A 1TA3A 1FX6A 1M03A 3L23A 5KTLA 2QVNA 5I3JA 4O8AA 3NTYA 4H8VA 1VCFA 1OC6A 3W02A 4H9VA 4FZIA 4X61A 1NQKA 1AUSL 5DBTA 1MZHA 1B9ZA 4RJEA 3LX9A 4RZ6A 1UWQA 3SN1A 1SO6A 3CZKA 4I6KA 3Q65A 3B0PA 3TX9A 1ZGDA 4R3UA 4WSHA 2RGLA 2OFJA 4NZCA 5JUVA 3E1F1 3P7YA 3B06A 3ZYZA 2Q01A 1CXKA 4G6CA 4LRSA 1UR8A 4JYDA 1SO4A 4AD3A 1OYBA 4QNWA 4K8HA 2DQXA 3EXTA 3GZAA 1W3IA 4HZ6A 1G5AA 1YTEA 3PG8A 2PWDA 3H24A 2C91A 3KDNA 4MLJA 1F73A 2WK2A 3VO0A 5HA7A 3LCGA 2AKMA 4QJ1A 1ESWA 3W7PA 3AOFA 3EMZA 4M80A 5DMYA 5U4NA 4F0SA 3FSUA 1ONWA 2ZZ7A 1EL3A 1WAWA 1T41A 2DZWA 4K8EA 3UD6A 1YDNA 1BF2A 4L6HA 4GK8A 1V6WA 3K2GA 4HSHA 3ZSTA 4IJCA 2Z1WA 5ABEA 5TD4A 3NDYA 2B31A 3LLFA 3U3HA 5G2HA 4F0LA 4LJ3A 4GI6A 3CQ0A 3HFTA 1S2CA 4C90A 4Q7NA 4M51A 3T42A 3OLGA 5F7UA 1IV8A 4S3FA 2FQIA 4LCRA 4LANA 2P53A 1A53A 3NFUA 5E6ZA 4NZ3A 1W9PA 3HB9A 4JTAA 3GVVA 3WQOA 3KLLA 4HSNA 2WHJA 3UCCA 1OK6A 3W4RA 1GVIA 1I2RA 2YDRA 3O8AA 4FI4A 2CZVA 3VD3A 4AY1A 2O7SA 1DOSA 4HMNA 2OSYA 4JIHA 1VB9A 4TO8A 1AQFA 3WFLA 4AWSA 2OX1A 5BXRA 1EGMA 3TW7A 4TIMA 2B7PA 3UZZA 2WZTA 1KQZA 4Y90A 5C5YA 2KAUC 4IFRA 3QRHA 2JGQA 4L1GA 3MP4A 2RDUA 3ABZA 4Y6GA 4S3AA 1TPWA 4GQQA 2E6DA 4MM1A 2GDUA 3MS8A 5AZ0A 4GH1A 5CBIA 2V69A 2V3GA 3TW9A 1S2AA 4DBEA 1K4GA 3KP0A 2RJHA 2V5KA 4RR4A 4D6IA 4PTVA 2Y63A 4NZFA 4HOXA 3B9DA 2CPUA 3PZUA 5CJMA 3ZMRA 3HG2A 4PSRA 3E12A 2FDSA 1V3JA 5EBAA 1S38A 4JL1A 2G37A 1BYDA 1X6UA 1TYGA 2V9DA 3G1XA 1AMYA 4QEHA 5G1MA 4PUDA 1W9VA 5PTDA 3V18A 2BWGA 1NDZA 4GHRA 7REQB 1FUYA 3VOJA 2O56A 2EPMX 1G6CA 4US5A 5E9XA 5I09A 2DZBA 3KUMA 1EOMA 5FJIA 2O9OA 1Q6EA 4TVUA 2BY1A 3I7SA 4WUIA 3MKVA 3DXIA 1ZALA 2VO5A 1TWWA 1Z6KA 2V81A 4HN8A 1XH2A 1TTJA 5MHBA 1VJZA 5G2WA 2GQ8A 3O9NA 1QI2A 5A8GA 4M24A 1IR1A 4IGHA 4K39A 3VZXA 5EB8A 4XAGA 2NX1A 3KVJA 2C0HA 3FYPA 1WDPA 4OECA 4ZMGA 1XLKA 4GOAA 1R87A 1AJ0A 4WSJA 4DJEC 3DOPA 4RNHA 2DFAA 3MV01 3KLKA 1Z9AA 4YNGA 4KIRA 1T96A 3LDVA 3LYEA 4N4PA 5JU6A 3P67A 2F6KA 1W3KA 2V82A 3MMTA 6A3HA 3RPDA 1A0DA 2NVAA 1TWDA 2G41A 3DX5A 3UZXA 4DXVA 1U22A 4GFSA 3AIUA 3WH7A 5HPCA 3VC6A 3OLDA 2CBUA 4OE7A 4JIEA 5LSMA 1KGUA 3KZPA 1F3EA 2INZA 2PBOA 2VMFA 4D8LA 1GG0A 3JUGA 5C54A 4NU7A 1F7BA 2QIWA 5DLCA 5I03A 6ALDA 4F2BA 5LXXA 3GNNA 2WQDA 4DUVA 2VZTA 5CGQA 4IWWA 1B2YA 4UTWC 1GQLA 2FGLA 1SO3A 3UU0A 4IF2A 3TYBA 5C70A 4O12A 1PTAA 4R9XA 2PDMA 4Z2KA 3A6OA 4C6PA 3DHPA 1JYVA 1XPYA 4YTRA 4I9JA 4JEJA 3ZFHA 1LBLA 4FB7A 3PTKA 4HJWA 3E2QA 4Q7IA 3TR9A 4D6EA 3QBUA 4HHMA 4KEZA 1O1ZA 3IGHX 1K7EA 1SZEA 2QAPA 4KS0A 4JTHA 4FO4A 2IXUA 4JIIX 2F9RA 1L6YA 4GRSA 4M1RA 4N2YA 1D2KA 1CWYA 2G50A 3QJAA 5I3KA 4Q22A 1OCBA 2ZX6A 2YDSA 4WY0F 3SQLA 3UWUA 2FZDA 4IMCA 1RCXB 1SZGA 1TIMA 1OFBA 2XSBA 5GNYA 1WBJA 4F3HA 2XVPA 3W9ZA 3AO0A 3P80A 4UWMA 3COTA 4WJEA 2DVUA 3B9AA 3G1AA 1A3WA 1O95A 2FPYA 2Q8ZA 4AWUA 1U1UA 4ZTYA 4LS0A 1VJSA 4ZFMA 4PA8A 1K6AA 1VC4A 2Q8XA 4BY3A 1JPMA 3M0IA 5M3WA 4JNYA 4NRRA 1IEQA 2VWTA 8TIMA 1LQAA 3R2GA 4AF0B 3IJIA 5CGMA 1QRQA 1ML1A 4MPQA 1UKSA 4D6DA 4JX4A 4D8AA 4NNAA 1GKPA 3BURA 2R1MA 4BQ4A 3FJ6A 1ADDA 5BWAA 3XIMA 3HM7A 1HO1A 1MEIA 4RE4A 3VKDA 4L1WA 3T0TA 3F5KA 2WKJA 1XUUA 1MEHA 4EF9A 3WUEA 4C6FA 3S0CA 3MJYA 1NEYA 2J8TA 3W7DA 1QOPA 4Y96A 1OVDA 3SGUA 3MVIA 4P5UA 4LNYA 2YB4A 2YW4A 4EX4A 4PUUA 3STPA 4Z1YA 4OV9A 4R27A 1WZAA 3AZRA 3NSMA 3LB0A 1UWSA 4EAYA 4DAFA 2XFYA 2ZZ5A 1Q7QA 1TPC1 4L80A 1YPXA 1KTBA 5TAOA 1NDYA 1SSDA 3OQ8A 5FSDC 1VKFA 3UYIA 2WNQA 5GNZA 3S42A 4J4KA 1QI5A 3QM3A 5KINA 2PRMA 2W92A 2CLOA 4LTSA 1T40A 4TV5A 2GJRA 4DWDA 2HJPA 2FMNA 2TPSA 4JTTA 5A6KA 3MUIA 2ISFA 2YBVA 2HSAA 2QGHA 2KZHA 4CQ8A 4XK2A 1A5BA 3BICA 3DFQA 1D3CA 4O0KA 4TMCA 5BMXA 4OIFA 4DBSA 5E09A 1NVMA 1OYCA 3M0YA 4H8NA 3S5ZA 5C0QA 3TSBA 1XIFA 5C7HA 3ANUA 2CBVA 1VYPX 1YBQB 2BY2A 1NQ6A 3T2OA 4FLQA 5A8OA 3UY7A 4Q4MA 2TODA 4DXKA 1Q8AA 1KV8A 2PA6A 1P7TA 4ZCWA 2O0TA 3MP5A 1BXBA 1EZ2A 4DQWA 2ASHA 4YS1A 2WLZA 3QN3A 3V5CA 1HJWA 3JZEA 3U5UA 4PTXA 1VAHA 3RFAA 4B3LA 3L65A 1W56A 3GVQA 3N2MA 3CEUA 4H9UA 4IUOA 1NFPA 2ZA3A 1BSLA 3IRDA 2NQZA 4HNNA 3GBDA 1W32A 3KVKA 2VCCA 3WDJA 2WNWA 4JS3A 1L2UA 3P82A 2VX6A 4M81A 1XQKA 1ITXA 4RDVA 3WMSA 2O92A 8XIMA 3GB6A 4ONVA 2GGJA 1QUMA 4KPLA 3TTYA 1MWOA 4JTSA 4QQ3A 1E9LA 4FPSA 1SJBA 3UWEA 2ABBA 1G0CA 2ZZ3A 5BU9A 1UKPA 1KD0A 4IXXA 5FL0A 2Y24A 1J0JA 1XIJA 2QUUA 1Q65A 4LF1A 4PMNA 5D9NA 3F4VA 3FLUA 5I3HA 1S2WA 4Q8OA 4CQDA 5E6YA 4B5WA 4MG4A 1K1DA 1DQUA 2CEQA 4AY7A 4UMAA 3HA1A 3RILA 3WQCA 2PTXA 1FWRA 3CYVA 4US5D 1I1WA 4JPGA 3VX0A 4DLFA 1AODA 2BY0A 2ZE3A 1DJNA 3IRSA 3B8UA 3DKJA 3AU6A 2ISDA 1PL9A 4G1NA 3UERA 2GQ3A 3CB3A 3KRUA 4PUEA 4WGXA 4L4LA 1KTNA 1XLHA 4HT3A 3CPGA 5LNUA 2P0OA 4V1YA 1WB0A 2GGGA 5E1QA 2BNJA 3VDHA 3PUGA 4GGBA 4NL1A 2E7FA 3TFCA 1F3WA 5LNRA 4MWAD 1HTIA 2R24A 2FYMA 3SR7A 3CHEA 3O1NA 1T7LA 1IE7C 4JFUA 4XSLA 1Q6DA 2PEVA 1V6TA 2F8QA 2JBMA 3R10A 1Q4WA 5D9OA 2POTA 3OLIA 4Q33A 3ZLHA 4B5TA 2I57A 5HINA 1BAGA 4HNOA 3T0AA 4O1FA 3VFCA 5F1UA 1EJWC 4BCEA 4XB3A 3ABRA 3FFSA 2XUCA 1OG0A 3HQ1A 3VMOA 4Q8NA 3O7UA 3NDOA 3VOFA 5GQBA 3N2XA 3U7BA 5HNTA 4AMCA 4V27A 4ZO9A 2F6XA 5CG0A 2I17A 4EOUA 4J5NA 4DWSB 3UNDA 1EQCA 4CN1A 1E72M 5FJPA 5HWMA 1YNPA 3QTGA 2QZRA 4J3ZA 1HVQA 3IIVA 4R53A 2RDTA 3WD3A 3M4HA 3RX3A 1K03A 3I6EA 1P0EA 2H90A 3H55A 1RQHA 4DNHA 4AWEA 5T26A 2EHHA 4DPQA 3BGJA 4US6A 3U2ZA 1ZL1A 1TVLA 1Q6FA 2VR4A 3CTLA 2E6YA 1HO4A 3BL3A 4UB9A 2V5DA 4XAZA 3LMYA 4C7DA 5C2GA 4FLSA 5KMYA 1NOUA 1BWVA 1EYEA 3BZGA 2H9AA 1OINA 4J3TA 1BSIA 1MRQA 1ZBCA 1CECA 1S5TA 2NQ5A 2PRLA 3M07A 1VFTA 1HVXA 1S2UA 1LLZA 4S3EA 5TIMA 2VELA 4LVBA 2D2HA 3EX6A 4AQLA 2Z6IA 2UY5A 4FX8A 4GACA 5CQ1A 1XYCA 2PPGA 3VOHA 3B03A 2QW5A 3VABA 1IZKA 2J74A 2WSQA 3ZXWA 4C7GA 4V33A 1REQA 5D2WA 1V08A 4IP5A 3ZT6A 3L4WA 4CVWA 1E9YB 1K9TA 1NSJA 1DWFM 1XHGA 4WY0B 2XIQA 3BLPX 1NIUA 4MY1A 3K46A 1QNQA 4FAMA 3AYSA 4ZZ9A 2DZSA 1TUFA 3BE7A 4UQAA 3QW4B 1WA3A 3R11A 3U2CA 1BLIA 1JFXA 3BARA 5BOEA 4MUZA 4C6BA 2E1DA 3EA3A 4Q8MA 3VGEA 3NURA 4JR5A 4RDZA 2WBGA 3SUWA 2OSXA 3LY0A 3SJ3A 5JH1A 1WV2A 5D30A 3ABQA 5KZ6A 1ZJIA 1J0ZA 1KCZA 3BW4A 3KOZA 4AIUA 4XD3A 1GK8A 3G1SA 3W6YA 5A2AA 2NSXA 8CGTA 4PEKA 4IT1A 2P0IA 1XLMA 1XSJA 4OT7A 3ZS4A 3KCLA 4RZ4A 1PKYA 5H91A 1QNOA 1VGAA 1XGDA 4TR9A 3V35A 2DH2A 3W7IA 3NYZA 2VVSA 4JTJA 4LNCA 1MMFA 1BVNP 3TXZA 3W0KA 1E40A 1OADA 2D3NA 3LMZA 2QF7A 3KS6A 2QLYA 4D6CA 1I1XA 3VTRA 3QGVA 4IGNA 2FFIA 3TCSA 2WXDM 5I3GA 4U10A 2ZOXA 4F2TA 1QR7A 3RITA 4YL2A 4KWWA 1UZ1A 4AF0A 3DU0A 2CU0A 4RKAA 3QQ0A 3WD1A 4HNVA 4DZAA 5AC5A 3AC0A 4S2BA 5FEWA 3DFSA 5D02A 3W72A 3H2MA 1LTDA 5EFFA 4L64A 4GNKB 5C9ZA 4PCFA 2VRJA 5LKYA 1JF5A 3W37A 2DJLA 3GBEA 4GVFA 3MWCA 3CZGA 4PUJA 4XAYA 1Q6GA 2BOEX 4AG0A 4MFEA 2XWDA 3B4UA 3B8DA 4X63A 5B7ZA 1JG9A 3L0GA 3N9RA 1MEWA 1G01A 3MZ2A 2ZYFA 5BOOA 2OKTA 5BOFA 2HS8A 3DN5A 2XH2A 1IWPA 3KOWA 1ZU8A 4MDOA 4DF2A 1O66A 1UJQA 1KR0A 2E8ZA 4PMZA 2P8CA 1W3LA 1AW5A 1EC9A 3ZJKA 1KFBA 4PR4A 4JQ1A 1Z42A 1G7VA 4GXMA 3EGJA 5G1YA 4GQRA 1PKLA 2BV9A 1V6VA 1D9EA 1SSGA 1TUXA 1OJXA 3OPSA 3AUOA 1DJYA 2AMXA 2NWRA 3TIMA 3VYLA 1H62A 1K9DA 1EUAA 3SIZA 3UXIA 3W6LA 3W28A 4ILSA 4MUPA 1W1VA 3QVQA 1YW1A 1I2QA 3QEZA 1WE5A 3LQLA 5CSSA 1E5JA 1W9BM 4WVXA 3WQWA 3WDHA 1X1ZA 5IDZA 3E0VA 4MJZA 8A3HA 2CLHA 1RA5A 2OOFA 3M5YA 3AZSA 4UTMA 4AZ6A 5DRIA 4WXYA 1FWBC 2ZFAA 2Z2AA 1R3WA 2VVNA 3PAOA 5K9XA 3N1AA 1EO5A 2ABAA 3S2NA 1HXJA 4KH2A 3N34A 4GX9A 1YBQA 4WLCA 1LBFA 3GH5A 1WUEA 3V0UA 2A7RA 2FVMA 2HVMA 1S3HA 2QULA 4I7VA 4RLIA 3A24A 1QPRA 3TTSA 4B5VA 4QBXA 3FJLA 4JFWA 1DE5A 3UP8A 4X0VA 5T9BG 4E5TA 1W3NA 4IUGA 3S83A 1OBAA 2JK2A 4CKQA 2G97A 1IHIA 4CQCA 1QOXA 2ZTKA 2AAMA 1L6GA 3C0JA 3WD4A 4S39A 2DSWA 1A3HA 1GYLA 2ZXBA 2DZTA 2XSXA 1QI0A 4CQ9A 4LEQA 1RQEA 1TPFA 3MBDA 4ZE4A 1G4EA 1FKWA 1QOQA 1CGTA 1G7UA 2CLFA 2ZQ0A 4FOUA 4ENLA 1GHRA 1IT7A 1R85A 3GVRA 4GH3A 3PZQA 3N14A 2O55A 1J2WA 1R86A 2OO6A 2PWEA 2HROA 3R8RA 1XG3A 1IEWA 3FA3A 3FXYA 3KVLA 4LGXA 3H7VA 4DM2A 1OY0A 3NM3A 1SPQA 1EHAA 4PCNA 1Q7MA 3MDUA 3HGSA 3FKRA 2WVVA 2ZX7A 2NXGA 3K1DA 1JIBA 1QHPA 2P3ZA 3UG4A 3LA4A 3WSUA 4QLLA 1OFAA 3YPIA 4I9MA 2ZKMX 1XYBA 4S3CA 2I5QA 3IEBA 2IPWA 2ANUA 3OBEA 4HZ8A 2GJXA 3SCSA 3B8SA 5KZDA 4O1EA 4CN6A 2PWHA 3OLEA 4J3XA 1ADOA 4Q4PA 3WLKX 5DN1A 1JRCA 2QQ6A 4X60A 3BAKA 4IX0A 4GBUA 5M5DA 1BXNA 4TVDA 2VKZG 3WD0A 3GH4A 1G94A 1L6FA 2NZLA 4MWAB 4B5UA 4RW5A 2FZBA 1BYCA 4UFLA 5DBUA 3LD5A 1ZJAA 2ZUNA 3OG2A 3H22A 3CUZA 1UH4A 1EHNA 1MW3A 2C16A 4IIEA 1XRTA 1CXHA 4HJFA 4C6EA 4JHZA 5J5DA 3MUXA 3UGRA 2J6VA 1GVSA 1UWTA 2Y7EA 1R2TA 2VX5A 3QQ1A 4FNSA 3LTYA 3PSWA 3LSCA 2ZUTA 2QYGA 2GZXA 3WK2A 4TTGA 3DBPA 1MXGA 2E6AA 2JEQA 5LA1A 2XM2A 3M43A 4NASA 4RPPA 5AC6A 1HGWA 3RPMA 1EDQA 4ZB2A 3CV7A 2PDGA 1JDAA 4O16A 1HKVA 4J40A 6TIMA 1F76A 1UH3A 3I4EA 1PXGA 2UY3A 4A35A 4O54A 2QMJA 1P1MA 5I24A 5I02A 4CVUA 3TQ0A 3N4AA 1C7TA 4IJRA 1Q85A 4DO7A 4DWSA 4GGHA 3BAIA 1C3FA 1WO2A 5IM51 1NELA 2ZVRA 2EBNA 1CXEA 2YL5A 4GI9A 3W2UA 3UW6A 3VIHA 4B90A 1M65A 3CL6A 1XLIA 2E68A 3MU7A 4ZO6A 3HBLA 4GQ0A 1VPQA 2DT0A 5FJJA 5M2FX 3QLDA 4QXIA 1C8YA 3D6NA 3F5JA 5D37A 5LGZA 3C0SA 2FHCA 5RUBA 3PUOA 5AB3A 4W93A 4NZ4A 2OQLA 3H2NA 1HQTA 3B0XA 3HFYA 3ZT5A 1K70A 4HD5A 1HJXA 3LXAA 1SZFA 2KX9A 3LZ5A 1XYAA 2ZX9A 2QEZA 4IZGA 2ZE0A 3K4DA 1D3GA 4R85A 3MP3A 2QJGA 2VFHA 3AYVA 4ZODA 3KXQA 3L12A 4O4VA 3C2EA 4JQ2A 4MWAE 3BMXA 3KEHA 4FIQA 1V0MA 4WJXA 1XIDA 3VPLA 1UW9A 3SUTA 1REQB 4Z1BA 3BPWA 3GXPA 3BQ6A 5AYZA 3ONCA 1LYXA 4WY0A 4E4PA 1EOKA 2C14A 3O16A 1JPDX 2VYOA 1SFJA 1K77A 3N4FA 3BVJA 3UR7A 4G9PA 2ZUWA 3KOYA 2C6QA 5HAOA 5ENLA 3B9OA 3ANVA 3RCMA 2PCEA 2VR5A 3TZNA 2E0PA 1GPFA 1TV5A 2R1KA 4LVAA 3WDPP 3Q58A 3QPYA 4MF4A 6XIMA 1MW2A 3NR0A 1L8PA 3PFMA 2C18A 3WY1A 3O6CA 2J7DA 4TXEA 2ZRWA 3MA8A 1HL8A 4OU1A 1WDDA 5CAHA 2UY4A 1S5MA 1U2YA 4I9AA 1X96A 3FY1A 1PX3A 3B0UX 4GBDA 3PVFA 3U2EA 3EWDA 4WQ6A 1LRTA 1XJBA 2Y7DA 5F4XA 7PTDA 4HVXA 4QG8A 4H9XA 3L0NA 3R6IA 5A95A 1X8FA 1W1TA 2GSJA 4PCPA 1BQGA 3MYOA 3W2MA 5F4SA 4YJ5A 2VGFA 1HUVA 1MO0A 1YDYA 3A23A 4CCDA 5L6UA 4WRHA 1SMAA 4EIVA 2E5DA 3WJSA 4UCFA 1E0WA 1V3MA 3SY8A 5HNRA 1FP9A 1RH9A 3HIJA 2YXGA 3RMEA 3G0UA 2VWSA 1JFHA 3NJ3A 2OB3A 2QJNA 3W2LA 2O4MA 5A6MA 3WLNA 1OGBA 4DJDD 3H2AA 5E70A 3UPMA 3QZ6A 1PJ9A 3B8IA 1WXJA 5DRCA 1UR1A 2QR6A 5ECUA 3MSDA 2FTWA 2VP8A 5K2ZA 2JQXA 4L4MA 3A4WA 4QG9A 1S1RA 2E67A 2Z6JA 4D6JA 3F2BA 3LRLA 2WC7A 1LOLA 5I78A 3ITLA 1RJPA 2CLMA 1PDYA 4ZFCA 3WNMA 3TU9A 3DHDA 1L2QA 2PGRA 4OBSA 3ZT7A 4MSSA 2ISWA 2VDGA 2OR2A 3M1ZA 4AZCB 4H7ZA 1J12A 1XFCA 3CHCA 2JEPA 1RZMA 3H53A 7TIMA 1YTDA 3MKKA 4AD5A 2YCKX 2BXYA 3CUJA 2QGYA 3RR1A 3PS7A 2G3NA 3DG6A 5H6HA 1NDWA 3EX1A 1EJRC 2ADAA 3QC3A 2GJNA 3FW6A 3U4AA 1E4NA 5HNNA 1B3OA 4IMAA 4K37A 2EXOA 3A3WA 3SUVA 1S5NA 1ME9A 1XV8A 5I23A 3W1PA 1V7AA 3U9IA 2A3EA 2PE4A 1MDRA 4XO7A 3NZRA 4UZSA 3QOMA 1KNWA 1IR2A 5CPMA 4RE3A 1SR9A 2GWGA 4FX6M 2PWGA 3W83A 3PP7A 1S39A 4UTTC 1GWJA 3O6DA 3WD2A 5BXSA 5A69A 4EKJA 1Z7AA 5E5CA 4U3AA 4LY8A 1VF8A 1PDZA 3A12A 2EJ1A 4M8UA 3RGTA 3I6TA 2OODA 1NJJA 2ZDRA 3CUGA 4GO9A 2DZUA 1GQIA 4ZENA 4MNJA 9XIAA 1K6WA 1PHQA 4O15A 5CPTA 4A3RA 3KBWA 3M41A 4AC7C 4FALA 4XTIA 2DU2A 2RAGA 1JUBA 2E28A 4XD5A 1NM9A 2C3ZA 4GXWA 3GZ3A 4W88A 1JXKA 1VBUA 4C5YA 2QDGA 1B5TA 3ZR4A 1PIIA 4WDXA 4J7RA 4IM4A 3BAWA 3DYMA 1W9XA 3TXVA 4J3WA 1J5TA 1LL4A 2X0YA 3ARQA 3SUSA 2HTMA 3V4BA 3P74A 3K5XA 2C19A 4QITA 5D2VA 5HXMA 1NY1A 1KO0A 4HN4A 3E5BA 2IKGA 1XP3A 2CBJA 3R8HA 2FLIA 5AFDA 3LXBA 4PUMA 7REQA 2FTYA 3C3UA 1NF7A 1RCOB 3Q67A 1AMKA 5GJNA 1CLXA 4S2CA 1SJDA 4TX9A 3P6LA 3CAWA 4DUXA 1EUNA 3AMGA 3L4ZA 3P14A 3ZR5A 1PAMA 2FKPA 3S9IA 3B3DA 2QVHA 4OKDA 4TVCA 4DYKA 3CGTA 5DELA 4NAFA 2Y8VA 3KBNA 3ZLGA 3LG3A 2YXOA 3APYA 3G1FA 1AZ1A 1O5QA 4DWSC 1BF6A 4MWAA 3EWCA 4R7JA 2CW6A 4QLKA 1A5CA 3NYDA 5I00A 5CZSA 2VEIA 1UR4A 3INPA 3L4XA 3WQEA 2DV0A 3PPHA 4LUSB 1FWCC 4JYEA 1TRIA 5FOOA 3AYRA 3I10A 1XR2A 1R38A 2J7HA 3W22A 3P93A 1JUEA 4W87A 4PMDA 1R7OA 4F8XA 4LW7A 3EXRA 1A5AA 1I2PA 3PZMA 5DT7A 1Y7VA 3M5XA 3AIVA 3EEGA 1UD8A 2WYSA 5FEXA 1WDQA 2EGZA 3QR0A 4Z1CA 2F2HA 5EL1A 3CYJA 3VC5A 2VHLA 2I9EA 4DVOA 2OG9A 2AOSA 2DORA 4F0RA 2V3FA 1GVFA 4E0CA 3I4KA 1K02A 3MB9A 3VOGA 2L5HA 3T2PA 4WKFA 3JRKA 3WBEA 3EPNA 3K13A 4UCGA 1EJ7L 4ZOAA 5FF2A 3GFZA 2W0UA 2ZZ4A 3L0KA 1WZKA 5GVJA 2IPGA 2J75A 2PC8A 5H8MA 2YBTA 2Q3OA 5D9MA 4X2RA 1GOXA 2NQLA 3PBYA 4R9OA 4EWJA 3LERA 4AZ5A 3PR2A 4KCVA 1TB3A 3AFBA 4C6OA 1ZRQA 3PJXA 3WL1A 4H04A 2YSWA 4XZMX 4PTMA 4MAVA 2JFEX 4V1XA 4UNKA 4QEEA 5DQPA 2J78A 3A4XA 4IQJA 3IIPA 3WBYA 4CEUC 3PFRA 4YPJA 3BZJA 3DFYA 3P60A 4CCZA 1LG2A 4H6RA 4N9BA 3WQ4A 4OFCA 2EKGA 4HTBA 3W7EA 1KW1A 4FP1A 4UR7A 3UJEA 2ZUUA 1M9HA 5EFDA 1D8CA 1NDVA 3VNJA 1FRBA 3PTMA 2HVNA 1EXPA 1K4HA 1OSEA 3EMQA 4AB4A 7ODCA 4MJ2A 1W3JA 5EY5A 1A47A 2VOTA 2DZXA 1OD8A 2OOGA 4CU7A 3N15A 3GNPA 3OEXA 1Z69A 3QF0A 4L65A 3C2RA 4WKAA 5FIPA 3N9SA 4PODA 2X0SA 4WIWA 5D05A 1IXQA 1NP2A 3M6YA 3UXLA 4NNCA 1DQWA 3RM4A 1BWKA 3TMLA 4HK7A 2WOQA 4UBPC 4LWWA 1XIGA 2PD5A 5FA5A 1DIOA 1AQHA 3AHZA 3V5FA 3B9NA 2TSYA 4ALDA 1JGMA 3GRIA 1T8XA 4D71A 3S2LA 4EPEC 4KCWA 1YLVA 3EDDA 5AC4A 1VHCA 4QFUA 4F0HA 4YU1A 4QE5A 5C9XA 5T91A 1QI4A 3WNPA 1XIIA 2JKEA 3R13A 1CNVA 2A7NA 2I5IA 4Q8TA 4LXFA 4Z0JA 3KHDA 2CKRA 3F4NA 5ABFB 3WJWA 3LEPA 4NXKA 3TV8A 1XRVA 2WPGA 2GL5A 2DSZA 3SCPA 4LUJA 3CZJA 3WLIA 3N9KA 3KTSA 3ZJ7A 2NVCA 3AROA 5C71A 2B7OA 4UFIA 3BCDA 1O6IA 3G22A 1TPB1 4AZGA 4ATLA 4D6HA 2OLHA 1ITUA 1AFSA 3XINA 1EJTC 3UWYA 5D9PA 4PL2A 1PUDA 1QW8A 2HNHA 5A8QA 4QM1A 1PCKA 1CLKA 4XTDA 1UC5A 3JZUA 1YXYA 1O5KA 1VFMA 4I7UA 1OFQA 1V3LA 3TN4A 3KVMA 1UIPA 1QXLA 3OTRA 2HXUA 4AIOA 2POZA 4A3UA 5AHNA 2ZADA 1TMQA 3W1RA 1U5VA 4E3VA 1CZ1A 1CT5A 5J5RA 6TAAA 3THUA 2ZC1A 3T4CA 5KETA 1FWGC 5ABTA 5EA9A 3V1HA 4W85A 3GD6A 2PP0A 3FHAA 4PBGA 3BSMA 2NX3A 4L4PA 3CL8A 1GTEA 5I77A 3KS5A 1RY0A 4YLWA 2A21A 4UMCA 4W8BA 3G3DA 2PFHA 1UB3A 5EYWA 1IEVA 3WDQA 4AX6A 1EF2A 1PV8A 4B4FA 3DH7A 3TTQA 3GC4A 1BYAA 4EP8C 1V02A 1XBVA 4W7UA 1GQKA 2WHMA 2CXGA 4WZHA 3W7KA 3E0IA 3CNYA 1XSKA 2OT0A 3O6AA 1CENA 2YLAA 4B3KA 1JPHA 3W00A 1TV3A 3ID7A 5AKQA 4I6VA 5DXXA 3MW7A 2GVEA 3SFKA 4B5SA 1M7JA 4BZYA 1KB3A 2RH9A 4PULA 3OVRA 1NP0A 5JQ9A 4AXKA 2V5CA 2A79A 3ITTA 5FD0A 1KGXA 5CAKA 3S5YA 1H3GA 4J28A 3WDIA 1R9ZA 2H8XA 1R3TA 2C1IA 3SDOA 1PTDA 2EQDA 3EWWA 4HNTA 3BH4A 3SY1A 4FR6A 4OWGA 3SGGA 1VFUA 1TJPA 2WC3A 3RJXA 4OHQA 4UTIA 4Z2GA 2Y85A 1RD5A 7TAAA 4IQDA 4I5UA 1L6SA 3IJ8A 1BGAA 1YDOA 3RU6A 3BLOA 3W75A 3R58A 5A5WA 4JKMA 2OEMA 3WO8A 3VIPA 3GTIA 2CBIA 4MNMA 4EANA 5LNSA 4Z2IA 3ITCA 2GUBA 4RK8A 4FOJA 5TF0A 1E1EA 2GQAA 2R1LA 3MY9A 2CHOA 3SZ8A 6XIAA 3RF9A 5AYIA 3WQVA 4RL3A 5U7SA 3TUUA 2DDXA 2YOCA 3TNOA 3EX3A 2IS7A 5I3DA 1AK5A 5JVLA 3PUDA 5J04A 4L7ZA 4R88A 4IH3A 1EIXA 3PJTA 3T0CA 5K9CA 4EACA 1W6TA 2VGBA 1UP2A 3WKZA 2VD9A 4YWSA 4ES4A 3CL7A 1RBAA 2IKJA 1ALDA 4A2SA 5BNKA 1JULA 3B97A 3O07A 2QCDA 4MY9A 4TX6A 3UPWA 2XFRA 3PN8A 5XINA 3QR3A 1SQ7A 3EOUA 4JX6A 4ML9A 4Y9AA 1EDGA 3VZYA 1VH7A 2XVLA 3B04A 3SSZA 1DL3A 3ARTA 1YE4A 2RJGA 4OZOA 2WJEA 3WMCA 2WJZA 1SUXA 5A6LA 4XO6A 2AGKA 2G8ZA 4N7QA 3RM8A 2NUXA 4LC8A 4DLMA 2CFFA 4DF0A 4YTQA 2GGHA 4IL0A 4QX4A 3V1PA 3TSDA 2YGYA 2D2JA 1E6ZA 4G2DA 1ME8A 3LBMA 3L4UA 1W2VA 3NL2A 1T6MA 1WP6A 1JPIA 1K8CA 1BKSA 4WEVX 4HZMA 1IYXA 1CXIA 1DWHM 3BANA 4AD4A 1HFBA 2FPTA 4GVHA 1MDLA 3MSYA 4OBTA 3AJ7A 1SU5A 1XDLA 5FACA 3ZSSA 4S23A 2DZPA 3UXDA 4UTJA 4KGLA 5BZAA 3EA2A 2XIBA 2A3LA 3DI1A 4N9DA 4MTVA 1V3KA 1TR1A 2JIEA 4P2VA 1SM9A 4OOUA 4MYAA 3P0XA 2GOKA 2H9AB 1M7XA 3W70A 1C8QA 3W7LA 5I79A 2XVGA 3HGOA 4ZO8A 3C52A 1PPIA 2R91A 1ZBVA 3M5ZA 1A5KC 1VIZA 3U5YA 3TDFA 5AYXA 2GSEA 1DQXA 2BFGA 1E6NA 4RZ5A 1GW9A 4BWLC 3R1ZA 3GHUA 3WQ8A 4K1WA 3K4WA 2NV1A 4A8NA 3GLCA 3VIOA 1U30A 4FNTA 1LZOA 2VDIA 2F2KA 3H4GA 3NQAA 3P5YA 3ZWTA 1J0IA 3CQJA 3HMCA 1N2VA 1B4EA 4Q4RA 1YMYA 3BLKA 1LF1A 2BLEA 3AZTA 2QPSA 4IXHA 2AQVA 1KRBC 3WEOA 1KCXA 4BF9A 4DYJA 3MHGA 2NXIA 3LBCA 3NQEA 5FF0A 3OZOA 4L6DA 1DJZA 2ZX8A 3W24A 2WM0A 2H6RA 4AU0A 4ORMA 4KT2A 2DT3A 2SFPA 1MQQA 1M5WA 3W7NA 4IQLA 2WSYA 2OTDA 3WLPA 4D2JA 4IQEA 4HK5A 3PNZA 5JBFA 4WKHA 4CQBA 1PB0A 3LN3A 3RO8A 5E0CA 4LEFA 1U83A 5I7GA 3UJRA 4C6QA 1F5ZA 4B92A 2G5WA 2F38A 3UESA 2X1RA 3VD4A 4XKYA 2ZA2A 1LDCA 1A0EA 4IIDA 3WLSA 3LI0A 5XIMA 3REQA 3AS3A 2CWNA 3A22A 1OX6A 3MSGA 1RAKA 2GPTA 2NQJA 3QKEA 1ENUA 3VGDA 1BWLA 2D69A 1O68A 4XVDA 5CC7A 4QDWA 2PRHA 3DYPA 3RMJA 1DTUA 2GDQA 4EPBC 2DEPA 2CC0A 3AWOA 1MSSA 2PS2A 2QJHA 3OP2A 3VMNA 3AHVA 4E2OA 4LYPA 3BCJA 3NOEA 3I65A 3W2KA 1HNYA 1KKRA 2ISVA 4IIGA 4D6FA 1F8IA 1DHPA 4B15A 2OZ3A 2QDDA 5KEZA 1G4TA 4IOTA 2OWWA 2GOUA 3WDRA 3VE9A 3II1A 4WSKA 2PDUA 2PI6A 1VEOA 3CQHA 3WMLA 2C8NA 4Z1AA 3IJ7A 4QIUA 4GPNA 4Z2LA 3RUBL 4DJED 4N9CA 1WZMA 3KFTA 4C60A 5CG7A 3IGXA 5G4EA 3HQPA 3W3OA 4KCTA 2ON3A 2IPFA 5I0DA 1MUCA 1P1XA 4Y7EA 2EG8A 3ITOA 2PDWA 3URNA 2FVKA 1E15A 4DYEA 5B80A 3TWBA 2X7VA 4H9TA 1GVRA 4GCXA 1H7RA 4Q4KA 3WQGA 4O13A 4DPPA 1XD0A 3UWWA 4O1CA 1VFHA 2XM1A 3VNKA 1E0TA 5C7VA 3LLDA 3CHFA 3ONBA 5H1WA 2E9LA 4BJHA 4GIRA 4DRSA 4X22A 4JL2A 3UZWA 1W1ZA 3WLMA 1MZRA 2HCVA 3CXOA 5LIKX 3POHA 4NP7A 1ITCA 2WJDA 3BV7A 4E6MA 1OHLA 1MNZA 2WHLA 1RSCA 2YL6A 1GOIA 1YX1A 4B3ZA 1MXSA 3SQMA 1F9CA 3R94A 1RALA 1UD2A 2VT0A 4S3KA 4QRNA 2QS8A 3LPFA 4LF2A 3RG6A 3UEQA 2O9TA 3A5VA 1HKMA 4JHMA 3GY1A 1B9BA 3VIFA 1C8XA 5B7YA 4I8DA 4V2XA 3NO3A 1AL8A 1R3VA 2VR2A 2DZAA 4YTUA 2HDJA 1Z3NA 3S1WA 1TWIA 3TN5A 1TJ1A 2DUAA 1XG4A 4E3TA 3BG5A 2W9MA 1B57A 1UA3A 5BMWA 1PX8A 1H4PA 3ZO9A 3P5ZA 4RUBA 4DUWA 1V77A 4XUGA 4NI8A 4CLMA 1VIWA 1CYGA 1XINA 1XRSA 2XVKA 3LS9A 3H26A 1AW1A 5HDRA 4O50A 1B3XA 3E0LA 3VDGA 3MANA 3ZZ1A 1ZHAA 1POKA 4HQVA 3KRZA 1TWZA 4KKXA 4LYQA 1HGYA 3BV4A 1XF0A 1FWWA 4GUGA 1FHLA 1BKHA 1ZAJA 5DXYA 1P0BA 3DECA 4M7TA 3UWVA 5HWJA 4HYWA 4Q3MA 3ABSA 3GK0A 1NU5A 4ICCX 1X39A 1P6CA 2GJXB 3RYSA 1YXCA 3T05A 4HA4A 4GI8A 1MRAA 4HHLA 2PWFA 3EZ4A 3WQFA 4PTWA 4S3JA 1BFNA 2YW3A 2HPMA 3FVMA 4DO6A 3CO4A 2VD8A 1Q4NX 2ATMA 1Q2SA 2VRKA 1H11A 1A5UA 1KKOA 1EFZA 5ABHA 4CGTA 3UJSA 1H7OA 1HZYA 3LGGA 4Y9MA 3CHVA 4GY0A 2IPJA 5JIWA 1E6PA 1DJXA 3IUHA 1O1HA 4CD7A 3T8QA 1KRAC 4HTYA 4K6AA 1DPMA 3M0JA 5FEPA 1J2BA 2YCEA 1VBJA 4TQTA 4IIFA 3NEHA 4JX5A 1K7XA 4JGDA 1E6XM 4B4HA 1W5PA 1HW6A 4ZQMA 3R0UA 2VDHA 2FGBA 4ZO7A 3M0ZA 4NAFB 2I16A 2D2GA 2CLEA 4HBKA 1S5WA 3IK2A 3M16A 3B40A 4AEEA 3PC0A 4YTTA 3SRHA 2XVNA 5C55A 1NWUA 1E9IA 4LUIA 1YADA 4AZHA 3PWAA 4CQAA 4HPJA 4BI6A 4ERIA 4MJ4A 3AI0A 3I6RA 1QPKA 2RDWA 2CESA 2EPNA 2WHKA 2J8GA 4UOQA 4FNUA 2HRWA 2J9YA 1JVNA 5AVNA 2OXNA 3KOFA 5F1VA 1G4PA 2O9PA 1R8LA 4JTEA 4AXNA 3F4DA 1DJIA 2DT2A 4DZ5A 5LIXX 4TMBA 4JN7A 1H60A 3URQA 4LUYA 3GDLA 5D2YA 3NM1A 4OUEA 3UZ5A 1DXIA 3GQYA 2Z1VA 5AVHA 3SBFA 3F2CA 1AQMA 3FVDA 9CGTA 5IFTA 1QCWA 3HPZA 1R9XA 3CPUA 1KFJA 5BRPA 2WO5A 4QS6A 2PTYA 5LNVA 3A4JA 5F2LA 1JDDA 1KLZA 3NXFA 3VIJA 1ONRA 4P7RA 4B2DA 2YDAA 5HWNA 1FDZA 4JNMA 2WANA 3AMKA 2C1HA 4TTUA 2BVYA 1DKWA 1O7AA 2QKFA 3ARPA 1HX0A 2YPIA 2DP3A 5C6MA 1Q3NA 3P62A 1C93A 2A3HA 1MW1A 3M0VA 4IFKB 3VZZA 1WPCA 1KFEA 5EMLA 7XIMA 3TJ4A 3EOSA 5H8UA 2Q3RA 3QV8A 1EGVA 4H8UA 2I14A 3CBWA 1RPKA 3HGJA 5JMUA 3ZWSA 1TVPA 1HKWA 1JI1A 5I07A 1TPEA 2TMDA 1TE6A 2GJLA 2D1ZA 1O5XA 1RHCA 1XUZA 1UOZA 5LIYX 4KEMA 3W71A 4QISA 1ZCCA 3S1XA 3GIYA 3NDZA 1HL9A 3DYOA 3VCRA 1XSIA 3W1LA 3EWUA 3RIKA 2IKHA 3UWZA 4LB3A 1JPKA 2PDFA 1XS2A 4MNLA 3VMPA 3GUGA 4CD8A 1Z89A 3MI3A 1WXZA 3NQFA 2YBUA 2AQWA 3W7OA 2BMBA 2DPEA 3NO5A 4ZSTA 1CIUA 3G77A 3URAA 3AICA 1JYXA 2ACSA 1VJIA 5HANA 4GUJA 1UBSA 2ODOA 3CLMA 1FBAA 5IXEA 2UZ9A 4A6GA 3QPZA 1GVYA 3S3GA 4LYRA 2ZXQA 3VU2A 2PTWA 4POCA 2X42A 3K30A 4PN2A 5EMYA 3QV7A 1FY6A 3ABOA 2F7FA 4I7WA 3N6QA 1XICA 5ABFA 3EDKA 4EXQA 3LCFA 3ZOAA 3HN3A 4FF7A 1MXDA 3C2OA 3GG7A 3LTPA 3LU2A 2ZRXA 4HZ7A 2XFWA 2XWEA 1XBXA 3I7QA 1W17A 1ZENA 1X7FA 1NWRA 1A5NC 1L0PA 3STEA 1C91A 3SAZA 4KWUA 3NEVA 4KERA 4ZQNA 5C2XA 1E4MM 3W38A 2J6XA 3RRXA 2E6FA 2ACQA 1LJYA 1UD6A 2O4QA 2QV5A 2ZXDA 3MV11 1AVAA 4AAJA 1S2TA 4DJFC 5DT5A 2ESCA 4G5DA 1RA0A 5BXPA 3LGDA 2J62A 2EPOA 4YMZA 4LS2A 3GO2A 1B1YA 3GYCA 2Q6ZA 3TA6A 3BOFA 3EWXA 1GYMA 4B91A 1ZBWA 1ZP3A 3LENA 4X0NA 3VD9A 1OGGA 3BLLA 4UXDA 1ISZA 2A5HA 3OG3A 1EWEA 3PPCA 3A9BA 2ONEA 1FOBA 2HS6A 3WYZA 4NNBA 3CMGA 4NQ1A 2XN0A 4Z42C 1E6SM 1WKYA 4LBRA 1LOSA 4PUKA 3TJIA 4NAEA 4XZWA 1OFPA 2X7WA 3HPXA 4V28A 4NZ5A 1XBZA 4XV0A 2B0MA 5KSWA 5CZTA 1XC4A 4UQBA 5BRBA 1YIXA 4KWOA 2J7FA 4Q8UA 2BGQA 3ES7A 2BXZA 5HK4A 4DI8A 4F2UA 4F79A 3HZ3A 3KAOA 1QTWA 3S1VA 1DV7A 3PAJA 5M1TA 1HJQA 2BGSA 2Z4GA 3SN4A 1FDJA 2WZMA 1MQPA 3BOXA 1PZ0A 2NLYA 4IHCA 3RCYA 3UR5A 2WVVB 5REQB 1W8GA 2XIMA 1JCNA 3QFWA 5E0FA 1D7KA 1UWAA 1DIDA 3ISIX 1FWJC 2LLEA 3E02A 4ADSA 3URBA 1VFLA 5CBJA 2WZEA 1OFEA 3BCFA 3LV6A 1VLWA 1A5LC 1SMDA 4P7LA 3LM3A 4H6EA 1OEPA 3WUFA 3HURA 3HPSA 2OT1A 3IANA 4B9YA 3ATZA 1QNVA 2ALDA 4A21A 1ZS2A 2AMGA 1EXBA 3T0DA 4PMOA 5LIWX 2P10A 1H49A 1TQJA 3C2VA 4H9YA 1LWHA 3QMSA 1J96A 1WOAA 5HBFA 1L8NA 3KW3A 5FEZA 2QCGA 4H9MA 3ZJ8A 3BW3A 3ITGA 2A2IA 4DBWA 3F2DA 2WBKA 4BK9A 3MYPA 4H7VA 1JI2A 3C86A 2BOGX 1CXFA 4GO8A 2ZZ2A 2DIKA 4PTNA 1UMLA 3K8KA 4O17A 2PUZA 4B2DD 3W1QA 4MZ8A 4GI4A 3KE0A 4UFJA 2BSLA 3UG5A 4KIEA 3LHYA 5FCZA 1KM1A 1GJPA 3TE9A 5DFAA 3G2GA 4AIBA 4A2RA 1HL2A 4EXBA 2D0HA 3HGRA 4AD1A 1XGEA 1LL6A 1RPXA 5F2MA 5DEZA 1FKXA 4ZXLA 1XLFA 4FA3A 3QYQA 1NWSA 3WLTA 5HPOA 3VD7A 3VI2A 2G4JA 2VC6A 2HE5A 5LA2A 3RO6A 2EAWA 3B8WA 1H63A 3UXAA 1A4LA 2FJKA 4XKMA 2WCGA 3T08A 3DFPA 2DT1A 3AISA 3L9CA 1A5MC 3L4YA 4Z17A 3UCDA 3BMWA 2DIJA 4EPKA 2G0WA 2PDKA 2Z7GA 3EB4A 3LOTA 4GQGA 1R3YA 4LH8A 4DJDC 2FH8A 1E51A 3OBKA 3LK6A 4GA8A 4E38A 4ZA0A 1P6WA 1XBYA 3R5EA 1HJVA 4GISA 1XIBA 1Q63A 3TWAA 1GKRA 1VD6A 5A94A 3W81A 3S1UA 1YPFA 1PKNA 1ZNNA 2HK1A 3WNLA 3VM7A 3GXDA 5FL1A 4DNMA 3LCWA 1FCVA 4GYKA 3GIQA 3UY8A 4AHQA 3OVQA 2NW0A 1EP3A 3UR8A 1E6QM 3QKZA 4ERGA 1XKYA 2QUMA 3VINA 4PMUA 4M6PA 3TA9A 3W7MA 5GJPA 1UWUA 4K68A 1EJVC 3VUPA 4YVXA 3CJPA 3W2NA 3LSBA 4GE8A 1OM0A 1TTQA 4LB4A 2YLLA 1F4HA 3GG8A 3PTQA 2CIPA 1CW2A 3ZIZA 2YDQA 4WOQA 3WNKA 4A8LA 2VGGA 4BF7A 1JD7A 3WBXA 3C0QA 3WF2A 3HO8A 3E2SA 5JBEA 1NWTA 4H6QA 4PUNA 3PB2A 1KRMA 3GTXA 1J0KA 1OT1A 4R33A 3W1XA 4REQA 3VNZA 3WZ0E 6PTDA 1ODZA 1TV7A 2FZ8A 4A3YA 3CS2A 2E09A 3NL3A 4ZVJA 2ICSA 4I5RA 5EU9A 4J9JA 2CETA 4E8DA 3M7SA 4A3HA 3E3HA 3MDWA 1FFQA 5MKGA 1MYRA 5K4XA 4GYPC 3DFOA 3UF9A 4L6OA 4ASTA 2QCFA 3M0LA 1SFSA 5EPDA 1ADSA 3EEZA 3THDA 3VD5A 1KBLA 2NUYA 1XYFA 4C6MA 4C6LA 3UVIA 4OVXA 4JTKA 1IIHA 4PMXA 2J7GA 3HF3A 3PJWA 4MGGA 5LHEA 2J9XA 3GW3A 3DHFA 3SRKA 4DIAA 2WAGA 5KITA 3OQEA 1VPXA 1B90A 1TMHA 1GOWA 1TO3A 2VM8A 4YYFA 4ACYA 1GG1A 1W31A 2TYSA 3UBPC 3GUWA 3R4IA 1GPWA 3KBSA 3NUKA 4O1DA 2VX4A 1X1NA 3TJLA 1C92A 1MUWA 1FHVA 3KBJA 3NZQA 3AU2A 4DAIA 2OLSA 3W23A 1DJQA 1ZUAX 3CV2A 4X3ZA 1K3UA 5G1TA 3GU1A 4AZCA 4MLRA 3N25A 4PMVA 3MQTA 3FN9A 3VA8A 3UG8A 3TW6A 4J27A 3WH5A 4Z2JA 5I3FA 5CSRA 1O12A 3QLLA 5FJTA 3QHOA 5HMFA 1SR0A 4J3UA 3WBAA 1BVWA 4CD6A 1T5AA 2P8BA 2G3MA 1W1YA 5FAGA 3CH0A 2V5JA 2P50A 1RD6A 3CM4A 3ENLA 4RPQA 3SM0A 2J4GA 3BMVA 1F8MA 4BHYA 4DB7A 4UIOA 1F6KA 3OGRA 1PCWA 3MCNA 3WLRA 4U31A 2EPLX 1XLJA 3VGGA 1AG1O 3N12A 4ICNA 1G69A 1YNQA 2WMIA 1RK6A 3VKKA 2PDYA 4XVEA 3QMRA 1ZTVA 1D3HA 1JZ5A 1PTGA 1NFBA 4UQ9A 3GNOA 1E70M 1CDGA 4K7VA 1NTHA 1GVEA 3OGSA 3SSJA 3LRMA 3IV3A 3VGFA 2PMQA 2WMKA 1TPUA 2DZVA 2VZUA 3IIXA 3S6OA 4LAUA 4HU0A 3M5VA 3OODA 1OC5A 2VTFA 4N02A 4AHOA 1N7KA 1NH6A 3DHUA 1BG9A 1AA1B 4PL1A 3WF0A 4GWEA 4Q4SA 3B05A 1ICSA 4NJKA 3CB8A 1ZBKA 3JU2A 3OJGA 3DEQA 3QHNA 1RUSA 4NAEB 1AJ2A 3SADA 4W5UA 1BVZA 1WZLA 4XZIA 1W8SA 3S6TA 3USZA 2V6AA 3FEMA 3EA1A 1A3XA 2PDQA 4B5XA 4PC8A 2X40A 4JEQA 1I45A 3V75A 3E49A 1DWGM 1UD4A 1GNXA 5AHLA 3MCMA 1W9UA 1J10A 3R25A 1JAEA 4AWTA 3W25A 2ZICA 1PVNA 2EPKX 1RV8A 2XZ9A 4KWSA 2RFGA 3WLOA 1LCOA 2AQOA 3B0VC 1TKKA 4JFVA 2ZUSA 5IDIA 1KA9F 2CWXA 2IUZA 4IGMA 3WN6A 1N8IA 1JZ7A 4WXZA 4FK9A 3W7GA 1GT8A 4L1XA 1MI3A 4GJ1A 4XQ6A 1E1CB 1CXLA 1XLLA 5FJOA 2PGFA 2PDNA 3OZMA 3S5SA 3NQ7A 4NYUA 4JTFA 3GR8A 2QCDB 1LORA 4F0MA 4I90A 3A13A 3QV6A 2DJXA 3UG3A 5ABGA 3W1UA 1U5JA 1TREA 3WK0A 3IAQA 3UT0A 5CZJA 1H1NA 5CPSA 3W27A 2D22A 3GDKA 2QJIA 4FR1A 5HJXA 3GNRA 4X2PA 4DZHA 3W7HA 4M7SA 1KV5A 5A2CA 3KX6A 1K8YA 1XLDA 2P76A 1RJRA 3BJTA 4LUSA 3FDKA 3AIEA 3HTWA 4JCLA 3HMJG 1PWLA 2FMOA 2QCMA 3WL0A 5K4ZA 1P0NA 3MVTA 3A3HA 4WHBA 1AH4A 3QV9A 1UUOA 4GKLA 1OGSA 4OBRA 2QHAA 2XGIA 1WQ5A 4BQ2A 4ZQPA 3V3WA 3WLLA 1HP5A 4PYSA 1EZWA 2WKGA 4QJ4B 1C29A 1CGUA 1HT6A 1UPPA 5LYRA 5FF4A 1FH9A 2G96A 1W1A1 3H7RA 3HQNA 3O3RA 2NQ9A 1XYLA 4JZ5A 4I3GA 2G95A 1IGWA 3ZVIA 4D8ZA 4JTRA 4NJHA 3SIMA 1UKTA 3R0DA 3D5HA 3TOYA 1XCXA 3O0FA 1B54A 5CLTA 3PG9A 2GQ9A 4AHPA 1KFLA 1JCJA 3ME3A 5CCZA 1U1HA 1UOKA 1FFRA 1FWHC 2ISSA 4HNLA 4QROA 3ARXA 1LRQA 1NFGA 4NX5A 3HG4A 1J93A 1M7PA 3E38A 1NAL1 2PB1A 5G4WA 2QDEA 1WDRA 4NVTA 2UBPC 1JUKA 1QATA 1LOQA 1FH8A 2Z1BA 3O05A 1OK4A 2CZFA 1OF8A 4IP7A 2OYMA 4XX6A 4QHRA 1E43A 1FWNA 1KXHA 2ZC8A 2ZRZA 4URIA 3DERA 4KETA 1BTMA 5F2GA 4GC4A 1RCQA 1HP4A 3PWIA 3NO1A 1QJWA 4GJIA 4C6DA 3RM9A 2WWDA 3PUEA 3PZIA 1DWIM 3W84A 3GS6A 3PANA 4IFKA 1CB2A 3R12A 1TV8A 3N3MA 4HP5A 1ZLPA 1P43A 4O0QA 3AYTA 3TN6A 3CTTA 2BB0A 2GJPA 3D47A 1RVKA 2B7QA 3L66A 3C8NA 3PZTA 4ZSUA 1Z44A 3CH9A 2Y5EA 2FZNA 3BJFA 3OVGA 2XHYA 3N2TA 1H51A 3HG3A 1J0HA 3C6CA 4S3BA 4REQB 4S3DA 1UUQA 3TQVA 3RU8X 2V3EA 2RKXA 4GABA 3TKFA 3WENA 4QTGA 1HKJA 4MADA 3SECA 3VE7A 4XIMA 3FEQA 3VFLA 1D8WA 3MTWA 3GXTA 3CO8A 3W6MA 1CI1A 4AD2A 1XD1A 3REQB 1YDVA 4LAZA 2YA2A 4UNIA 1Z41A 1FTXA 1R2RA 1E4IA 2X8RA 1E5NA 2RDXA 2FHFA 2W6RA 1RLDA 2XISA 4M29A 9XIMA 2EJAA 1XXXA 4UFMA 1Z8AA 3TQPA 3ARRA 2E3ZA 4ECLA 1TJ2A 3NSNA 1WKEA 1B31A 3CZ8A 3PULA 3GR4A 1YRRA 1QT1A 4WF7A 1F61A 1QMLA 2MANA 1M7OA 1JGIA 3BJSA 3JW7A 4C5ZA 5CZ0A 1GVQA 1Y5VA 4JIRA 2QPUA 1LWJA 1BYBA 1KCKA 1OT2A 3F7JA 2FPVA 4O1AA 2XTKA 1ITQA 1I2NA 9RUBA 1UG6A 3UA3A 3GKFA 4E2BA 2R94A 4KFNA 2WVSA 2GGIA 4LPCA 4C1NA 2INFA 4HOZA 2J7EA 3IVUA 1YEYA 3LUTA 2WMJA 2VQUA 1Y65A 1HIZA 3GIPA 2VFIA 3K8MA 1W91A 1I8JA 1FCBA 1PSCA 4ORIA 1US0A 2PLKA 3FOKA 4PZVA 5AY7A 1ZCOA 3RPTA 2HK0A 3U6WA 2PTDA 4F9JA 3TROA 1S2VA 1UD3A 3W87A 3B0YA 3DKLA 2AL2A 4IIBA 5FSEC 2FDMA 1LBMA 4UTLA 1TJRA 2H8ZA 2WM1A 4U2YA 4XZNX 4CN4A 4Q6XA 3NPVA 1LQ2A 2X0HA 1VBRA 6REQA 1V5XA 3I3BA 3DFNA 2VGIA 3LHVA 2NLIA 3FNDA 4PRWA 1XDJA 2YB1A 4AX7A 5AC8A 4QQUA 1QBAA 1EF3A 2HWGA 4O52A 3GDBA 3EWYA 3NWRA 2VI0A 4G7EB 1RVGA 1KWGA 3OVPA 5EKYA 5A8NA 2XIJA 3BDKA 1KM2A 4ATWA 2EPHA 4JDYA 2RUSA 3E2VA 1A5SA 4LT9A 4W8LA 1KM0A 4O53A 3AUJA 1LL7A 3QXBA 2I7GA 3ERPA 3KTXA 3FJNA 2V38A 2EEXA 3IWPA 1KBIA 1RY8A 2WKLA 2NX9A 4NILA 2OEJA 3NQCA 1KWKA 4QDPA 1Q66A 4L56A 4NXSA 3E2RA 1T99A 1TX2A 2FZ9A 4NY2A 4JXCA 4NI3A 4QCEA 1KQYA 3I3DA 1YE6A 3LLXA 3TVAA 1UQZA 4MFDA 1WOBA 1UR9A 3VDCA 4FNQA 1VRXA 2PZ0A 1IGSA 3BQ5A 3AMCA 1IZJA 1I75A 1US2A 2VEKA 4EXAA 3PTDA 2OJPA 2E9BA 3FYYA 4QSFA 2QT3A 4U3CA 2FJUB 3TEVA 2YXXA 3IVTA 3NQ2A 3SFWA 1OB0A 1H1YA 4M5PA 3NQ8A 4TOQA 3ECQA 3N6JA 3SY5A 4N6FA 3G0XA 5IHRA 4C6JA 2NT0A 3BG3A 3NPWA 3M9YA 1DP0A 3AS2A 5FJUA 1TPDA 1ONXA 2CNCA 1UASA 4IP4A 4RNJA 4WD0A 4LAMA 3HV9A 4PFHA 2HQAA 3RN6A 1A4MA 1GJWA 2I56A 1QK0A 2W63A 1JZ2A 3AXHA 3C3NA 1CLVA 1TCDA 1PKMA 1Z32X 5EMKA 4GLEA 1UZDA 3AMLA 2FB2A 2G3FA 4GVGA 3MMUA 1FWAC 2J47A 2RHGA 1MVYA 1E0XA 2OELA 3H2OA 1JDEA 4EVZA 1V03A 1JYNA 3S47A 4MNKA 4PMQA 4UOZA 3G18A 2V2DA 3FX4A 1E1CA 1J9YA 3CZEA 2DUZA 2QJMA 3AXIA 3ZJ6A 4AD0A 4R7OA 1H5YA 1POJA 4HA3A 2VJXA 3Q45A 3FHQA 4YXGA 2CZ5A 2X05A 1BTCA 1CGVA 4QNEA 2REQB 1MNSA 5AYYA 3O63A 3PBGA 4QLJA 1DIKA 2VNCA 4I8YA 4GVIA 4HA0A 2Z25A 1EJUC 3LPGA 3FDGA 3TC6A 4K2SA 5BW6A 3IIOA 4EPDC 1VCGA 4RXFA 2JF7A 4KMQA 1S5VA 2Z1KA 2XSAA 4GKTA 3EOOA 2PURA 1OIFA 3CIVA 3WJYA 3W7QA 5I06A 1ZJBA 4KFPA 3IV8A 2VURA 2XINA 3RJYA 1AQ0A 2V8ZA 1DWAM 1UZ4A 2R1PA 2PGWA 4HU3A 4IMEA 3L5AA 2J9ZA 3NNTA 5HR6A 4DJDA 1J8VA 1FCQA 1M53A 1H61A 5EMJA 1F6PA 1KM6A 3C56A 1XRFA 5A6TC 2YKKA 3QGKC 2O9RA 2GWNA 1JCYA 1HJUA 2GYIA 1TV4A 2ACUA 3WLJA 3LHZA 2A6LA 3HPAA 5LIUX 2UWFA 3SN0A 1X98A 1UJPA 1NARA 2XN2A 3PPGA 4S1FA 3ZM8A 1LROA 1SJCA 1EC7A 2A3AA 4GNVA 3NQBA 2XH0A 1XLCA 4ZBCA 2J7CA 1SFTA 4BFAA 3LHTA 4FF5A 4HA1A 4R5EA 1AD1A 1MUMA 4XZ9A 1H2JA 3LXCA 1QI3A 5A1AA 2CXEA 3M6DA 3AHTA 2Z2UA 1QNSA 1N82A 3ITXA 3WUBA 1B4KA 4QGCA 3OYZA 3H2EA 3RXZA 1JCMP 2WSPA 5I5RA 5C2CA 1DHKA 3CAQA 4H00A 1VRDA 1XKJA 4GCAA 1HKKA 3C61A 2W62A 3WFZA 4FEZA 4NX0A 1XLAA 3IACA 2W61A 3ATYA 1DE6A 1FWFC 7ENLA 3FJ4A 1ISXA 1H50A 2Q02A 1JZ4A 4Q8WA 4W89A 2W67A 2YFOA 5CJ5A 2ZZ6A 3E9AA 3W26A 4FNRA 4JHOA 4K1GA 1W1B1 3SCTA 3MHFA 5HUOA 3BXWA 1JDCA 2EKCA 5XIAA 1E71M 1GQJA 1YNYA 1E56A 2XZ7A 1VYRA 4ZB0A 3NQMA 4ZL1A 2B81A 3MI6A 2YCLA 4XKYB 5MF5A 5JIPA 1Q6QA 1GYNA 1SO5A 4XSMA 3EKZA 3MHUA 3GWQA 1OCNA 4H2CA 5CC6A 3CT2A 5BROA 2P88A 3G24A 5CBBA 4M3PA 3O15A 4N42A 3WQ5A 4L9ZA 2H3BA 1B3VA 3W86A 3H7UA 3AXMA 4K36A 4AIEA 1X6NA 1GJUA 3ZQ9A 1JZ6A 3N2OA 5BWFA 1QW9A 4J35A 3TMQA 1IZCA 4K3ZA 4ADTA 1VR6A 3M64A 1LUCA 3VKBA 1F2JA 4LSBA 3MMWA 4B16A 3WUGA 4GJJA 4MHBA 2CLIA 4C7FA 4FLRA 3WF4A 1RBOB 3VNYA 1OF6A 1XM3A 1QNRA 2PDPA 4L5ZA 4M82A 1E55A 4CNTA 2PGEA 3ARUA 4A4AA 4LFYA 2V5LA 3WMBA 3Q37A 1UYQA 2Y8KA 1TMLA 1SJAA 5CXPA 4IPPA 4H01A 2F61A 5JH2A 2QNEA 5JXQA 4K8GA 2H3DA 2X2YA 3OZYA 1E3XA 2BS9A 1R30A 3UQNA 3KP1A 3AMDA 4KESA 4IPNB 1XC6A 2G3IA 5D09A 3AJXA 4CCCA 4H6KA 1V0KA 2QCLA 4F48A 3RR4A 1PYFA 1H5VA 5LA0A 2X2GA 3K1GA 1ZY9A 2J7BA 2YYUA 1RP9A 5HMDA 1E0UA 1EJXC 4GY7A 2GVGA 4QCFA 2FHBA 2OPJA 3EWZA 2IKIA 1KXQA 4PBFA 3RK8A 5A3HA 3N3TA 4XIAA 3DG7A 3HV8A 3MO7A 4N9EA 4FS9A 4HK6A 5DMLA 4MB5A 3FA4A 3W01A 3P0WA 2XU2A 4JTDA 4AISA 2P3EA 4PMYA 4NUWA 4P7QA 3OB8A 1HF6A 3KL3A 2DW6A 2I5GA 3QSTA 2MNRA 1UIOA 3BG9A 2DH3A 1ME7A 2WSKA 4RDYA 2NXHA 4RE2A 4A29A 2X16A 4E8GA 1F6YA 1CPUA 2VL4A 4ZB5A 1X1OA 1JXJA 4BKNA 3TAOA 4KQNA 1PO9A 3P8JA 1OX5A 2VENA 2GK1B 4NIRA 3PB0A 2J79A 4TV6A 1UR3M 3AS1A 3BLFA 1LRNA 2OWCA 3GNDA 4Y8EA 2E4TA 5A2BA 1OWQA 4G7EA 4OGZA 1IT0A 4OOZA 1SVDA 3DGRA 4FX7A 5A6AA 2XYLA 2OEKA 4R7WA 4HMDA 3T7VA 1Q13A 3W7JA 2WMFA 2B4GA 4RV8A 3LNMA 3BAYA 3CWOX 1RR2A 2YIHA 3G6LA 3GXFA 4AZIA 1V51A 3MWAA 4OTKA 3CC1A 2W27A 2IXVA 1QHZA 3GTHA 4YIWA 3OIHA 2TRSA 3TLLA 4LY4A 1QPNA 3WNNA 3MKCA 4ZQRA 3LHUA 3QSRA 3UJFA 1KBKA 2CLKA 2I9UA 3L4VA 1X97A 1ONEA 3EOEA 4DUOA 4O14A 1XWYA 1HN1A 4W8AA 3CV1A 4RCXA 3HJEA 3BLIA 3GSMA 3DG3A 4KWVA 2OQYA 1EKOA 4Z08A 4CD5A 2GSHA 3BO9A 3W76A 1FWEC 3KHJA 1TFVA 2YL8A 2D24A 5AHMA 3TTOA 2FIQA 3CASA 4U5KA 3GX9A 4PUWA 5AYBA 3N29A 1EYWA 1W1IE 2GVYA 2ZZ1A 3WG6A 4H9ZA 3THAA 1JCXA 3ZLFA 4UTUA 1KBBA 1DJWA 3TR2A 1KXTA 3LHWA 4W9TA 1EB3A 4QE1A 3TYUA 1TCMA 4GYJA 2V2HA 1UQYA 3BAJA 1YHTA 1V6XA 5F2IA 3WBWA 3KRBA 3EX4A 1KBJA 3QC0A 3NAVA 3QW3A 1VCVA 1P0DA 2FVLA 3LI1A 3NQ6A 4FMVA 1JQXA 2DSUA 1DEDA 4UC5A 4HOWA 5I2UA 1XIHA 1XI3A 2INEA 2BHZA 3U8GA 3GVGA 4FLOA 2Y0FA 1KTCA 1U33A 3W73A 1M3UA 3MBFA 3T1GA 1EQPA 4NG3A 1QBBA 3BK0A 2IQ0A 3KWSA 4XAPA 3GDRA 4DO4A 1UD5A 3BUVA 1J01A 1YKWA 3UZJA 1F3TA 1X38A 3CAKA 4U4MA 4EF8A 5CPOA 2BASA 3CUFA 1FXPA 2REQA 1E1FA 2FTPA 3IJQA 2QXWA 1UWIA 3DC8A 4H1ZA 3VCCA 1BHGA 4X9YA 5EMMA 4FSAA 4E4UA 3QY7A 2D20A 3W1AA 4GIYA 5F4WA 1FA2A 1GOKA 3RRAA 3WELA 4QDMA 1DIEA 3BGGA 4BEUA 3O6YX 2OMAA 1ZB5A 3CUHA 3SRFA 3H8AA 1O94A 5C9WA 4QR6A 1ZJHA 1JZ8A 1TIWA 1R3QA 3WK1A 2Y70A 5DCEA 2VFDA 1VFFA 1V3HA 3A5FA 3GVWA 3T40A 1GZJA 2VUYA 3OO2A 4MOZA 1KXVA 1DXFA 3N18A 1QWGA 3KZSA 3CMFA 4NKCA 1UZHA 3SCUA 2ZRUA 1OZMA 4GNJA 4JDBA 5CH9A 3CIXA 3KM8A 3VKCA 1UP3A 5AECA 3C5QA 2WSRA 4CCEA 1NOFA 1X7IA 3EDEA 3PZVA 2VZOA 4HGXA 3BWWA 2X30A 1H7PA 4ACZB 1FDYA 3R89A 3HJZA 2DQWA 3S2MA 4IPIA 2PDXA 4C6IA 4GUIA 3UETA 4CD4A 3M0KA 3VX1A 3S2CA 1GONA 3UWQA 4Q8PA 1W37A 2ZXAA 3OYXA 3STFA 2C71A 4XUYA 4M56A 3WEZA 1IXOA 4HB7A 4QJ5B 4QAIA 1PWMA 2X1UA 1FVPA 3CHDA 1EBGA 3H54A 1XW8A 2QJJA 3RCNA 1W9DM 4KBXA 2VEPA 2Y89A 3MUY1 5KZMA 2ZVIA 1KFKA 4IGSA 4ERAA 1K8ZA 5BXTA 4P61A 3S1GA 5AOUA 3R0KA 1CTNA 5GJMA 4L4OA 1OFDA 3AQUA 3ITYA 3VVGA 1MFUA 5MKGB 2WB5A 4XBKA 3GTFA 2PODA 4BEQA 4JN6A 4YHEA 3C4UA 3LQGA 4QAWA 4C6CA 2W3ZA 1ZAHA 3L2MA 4UFHA 3ALFA 3VNDA 1M41A 1G4SA 1EDTA 2J8FA 3GC2A 2J66A 2BVTA 1GW1A 2Y7FA 3V7PA 5GPRA 4N6EA 3T0BA 1CGYA 3GXIA 3PPFA 5D8WA 3Q4DA 1PYMA 4IMDA 1SZNA 4WX2A 2QIIA 5HATA 4WDUA 2ZTJA 3KCJA 2AGTA 2PF0A 1LM1A 2Z29A 1JL8A 7CGTA 4CEXC 1KFWA 4HYVA 3TJXA 3EB2A 4XBSA 2RGMA 5EMUA 2OGYA 3ALGA 4IJBA 4Q8VA 2VC7A 4IMGA 4Q6JA 3T07A 4DELA 3DBNA 1UUMA 3NVTA 1GVOA 5LNWA 2PLMA 1OD0A 2WCSA 3WFAA 3W1MA 3ZVHA 2XH4A 5E0KA 4ZGYA 2BTMA 1KC7A 1VQTA 3RAOA 2R8WA 1G9HA 1A5OC 1M01A 4ZE5A 3WJXA 5IBXC 5C9RA 2DVXA 5CC3A 3CPRA 2YCJA 1XH1A 3NQVA 3ARWA 1IF2A 2JE8A 3EDJA 1Q5MA 4V15A 1DYSA 2BXVA 1EBHA 3WEMA 1BRLA 4AVOA 3RLGA 2Z24A 4O11A 3BW2A 1ICQA 1JRBA 4GZIA 3IUDA 3DAQA 5LZLA 2G3JA 4LVFA 4C91A 3KRSA 1GOMA 3I7RA 3STCA 1UKQA 3GXMA 4M19A 3PBUA 5D33A 3WH9A 4YCPA 4HHPA 5FF7A 3DENA 2WMHA 3TYCA 2PLJA 4WGHA 4WOZA 1XPGA 2GVLA 4UUIA 4DZIA 2XIIA 3GC5A 2PC4A 4NZ1A 4PBEA 1JD9A 3APGA 2JGYA 2PD9A 2IW0A 4TX8A 2AL2B 3VNIA 1V02E 3UXKA 2WMIB 3KL0A 3VCNA 1VZWA 1YPIA 4J2MA 3A4AA 4NJJA 3TC3A 1E73M 4FXRA 4GQBA 2QMKA 2VZSA 4NYYA 4EE9A 2OWXA 4UQCA 3POCA 4QJ3B 2OYLA 1K9EA 3EKGA 3E0FA 3U57A 3TH6A 2VFEA 1JNEA 1H41A 2VFFA 1IEIA 3UA4A 2QF8A 4AVNA 4HU4A 3VILA 1RBLA 4GMEA 3N2CA 3AALA 1G1YA 1B0IA 1OC7A 3L68A 4P8VA 1CCWB 1VHNA 2BVWA 3KTCA 2PBGA 1PS9A 2BBFA 3N19B 3EXSA 3TN3A 1YQ2A 1P4CA 5REQA 2XDFA 2VUNA 1TZ9A 2GDVA 3A9IA 2VEGA 3S9ZA 3GHSA 4HPGA 5K9DA 2GFTA 2W66A 3THQA 2GGEA 2E25A 4MIMA 4JAWA 4PSPA 4UQEA 1H0IA 2PU1A 3NG3A 1I6NA 4GC3A 1IWBA 4Q32A 4ICMA 4MJMA 2OX4A 3UFYA 4AY8A 2CERA 4BR1A 5AHIA 2VX7A 4UTHA 1PHWA 3SURA 1J5SA 3M47A 2YA1A 2ZCGA 2X1TA 4Y2WA 5IHSA 1H0GA 5T8GA 3ELFA 5LGXA 3DESA 4CNOA 1QASA 2ZRYA 5D03A 1Y8BA 2XIOA 1UPMB 4JY8A 2YJQA 4O8RA 2JKAA 4C6KA 3V16A 5HQMA 4DEFA 1QK2A 3TK7A 4BI7A 3VGBA 2FZMA 3RHGA 4UFKA 5L9FA 3QQWA 3KWXA 4HU8A 2A3CA 4W7WA 5CZKA 2CZDA 1IEXA 3DC0A 2CITA 4UZUA 3GAKA 4RXGA 5AHEA 4F66A 3EPMA 3PK7A 2C0AA 4QS5A 3GU2A 4OJYA 4MZYA 1TWSA 4LAOA 2WJFA 3MT1A 3H70A 3T2QA 3N73A 1QO2A 1I0BA 3BSGA 1BG4A 1WX0A 1R3SA 2VC5A 1WKDA 3XISA 3HQOA 4DO5A 2GVJA 2XH7A 4D1JA 1H7XA 4IISA 4ZTXA 6CGTA 2Z00A 2WWCA 1FQ0A 2E5BA 3IJDA 3LCHA 1PX4A 5A6SA 1HJSA 4GUFA 2E40A 4DXXA 1O4UA 3VOCA 4AFYA 3VIIA 3H21A 4EWND 1QW7A 1XH0A 5D38A 1TSIA 3TNBA 4BQ5A 1P7TB 1LT7A 5T9CE 4G8TA 5H2ZA 4UTTA 1JF6A 4HMEA 3B9EA 4HPXA 4ZXOA 3FA5A 4ZOCA 3ARVA 2C1GA 1XX1A 5A8MA 1B3WA 1OCQA 4RDWA 2WNNA 3GW0A 4JTLA 2Z0IA 1MW0A 1GKQA 2R82A 2PWVA 2IQDA 3BLEA 1YYAA 2OGJA 3GTNA 4PFMA 2FGZA 2XJ7A 3P8IA 3AHXA 3IIZA 1M04A 2YX0A 3VDBA 1NOWA 3TZFA 3EAUA 1TTPA 1U1JA 3FV9A 1AD4A 1DTNA 2ZWYA 4LVDA 4A8IA 1RLCL 4LUTA 1XGZA 1FWSA 3HU7A 4IFOA 3LCXA 4U33A 3CLWA 2BHYA 3SRDA 1VYSX 3OBAA 4DX3A 3TOPA 2ZDSA 1CGWA 1ISWA 2V0TA 2Y5JA 3T09A 3NGJA 4YCOA 3GDMA 1R3RA 2XG9A 3GFYA 1VENA 1V79A 1EP2A 2WCAA 3MUZ1 3QOKA 3UVAA 2D73A 3EPOA 5CC5A 3H2CA 4K7YA 4O57A 1JEZA 5D2XA 1CX9A 1TR9A 3SCVA 4M1BA 3FGCA 1GTHA 3C2YA 3SCNA 4FXJA 3G1DA 3FSTA 2QV4A 4JYFA 3SW6A 3EOLA 1JJKA 1W5MA 2HISA 3TONA 4MB1A 3BLDA 5M03A 4F0KA 4KFOA 4JQ3A 2BODX 2Q71A 4DJFA 2FFCA 1XISA 4FXFA 4GFIA 3L4TA 1BD0A 2PZNA 4PGLA 3FKKA 3G3MA 3FAWA 3OHMB 3QMTA 3CQIA 4C1KA 3FYOA 1BQCA 4D9PA 1EO7A 1TTIA 1M1BA 4HHHA 3S5NA 4PRRA 1PZ1A 1QVBA 1ZP4A 4IG2A 5HNUA 4NJIA 3D0CA 1Q6LA 4QE4A 1H09A 3NL5A 5HUPA 3EWBX 4YHGA 4UTKA 2PP3A 5D2TA 4HYRA 5D8ZA 3U7VA 3GE7A 1PE1A 3F5LA 1DXEA 1T0OA 1EIBA 4UMBA 4GY1A 4PMJA 1EX1A 4F4RA 1N8FA 2J25A 5FKYA 3SEPA 1VBHA 5IRPA 4KW2A 4IICA 4S38A 2WV8A 3UYCA 3TFXA 4MYXA 3NQDA 1S3TC 4W7VA 4NF7A 3U4FA 3P61A 3WX7A 5AN7A 5FI8A 3PZGA 5I3IA 2R14A 5CLWA 1XL9A 3LRKA 4DBDA 1FHUA 1RJQA 3QZAA 3FCPA 1E9ZB 4GINA 1P48A 1M68A 2ZWZA 5G4HC 1FWTA 3T4WA 3PSVA 4KCUA 4KRZA 2DW7A 4O28A 4WCJA 2NT1A 4DHGA 1L9WA 1Y5XA 4K38A 3FK4A 1UH2A 2X09A 1QNPA 4LX4A 3CWNA 4KGJA 1KRCC 4DI9A 1EWDA 1S46A 1TG7A 3M0XA 1JCLA 2Y1HA 1C9DA 1W5QA 3QFEA 3MJMA 3T55A 3S46A 2PDJA 4XD6A 3RDKA 1XLGA 4GZJA 2C15A 2OLAA 5LHFA 1UBPC 3TYDA 4DBUA 1BRLB 3HG5A 2C13A 3L5LA 3L5MA 5DMMA 4CNNA 4GUHA 4BA0A 1ECEA 4IPJA 1YXDA 4XBJA 1GZGA 2Z2BA 5FESA 4ROPA 4PCSA 3NCOA 2PDBA 4PMRA 4P8XA 3VUSA 1RQBA 1IXPA 1R9YA 2OZ8A 4JNZA 1RXOB 3Q2DA 1LG1A 3R79A 2NWSA 4NT0A 1GGOA 1F07A 4ROQA 4BQ3A 2QUVA 4RW3A 3ARYA 1E0VA 1EA9C 5JBDA 1W1PA 5HMSA 1C8VA 2ACRA 3TYEA 1UWRA 1US3A 4DF1A 1F4AA 3ICJA 3G1VA 5DANA 3JS3A 4LOCA 3NZPA 4DN1A 2J27A 4YWIA 5AZ1A 4YYCA 2EG6A 4MKSA 3E0WA 1V0NA 2EG7A 2J77A 5ECVA 3E6EA 4O10A 1I4NA 4JICA 3EMCA 2NV2A 2GK1A 3QZEA 3PBMA 3ITVA 3T8LA 3ORWA 1V93A 4PEEA 1B3ZA 2Y2WA 1KM3A 2YL9A 2F84A 4O0ZA 1O60A 5AC7A 4LBUA 2NUWA 4MWAC 4N4QA 2OZ0A 1R6WA 1TELA 1GQNA 1TA3B 1M6JA 3WQ6A 4RNIA 3M44A 4GIEA 5CPNA 3PHAA 2X41A 2WW5A 3OW1A 5H8PA 4OUIA 4HIBA 1SFLA 5CSUA 1ZPTA 1LWIA 2QCEA 4ADUA 4DWSD 3F4WA 1U5HA 1ISVA 2AL1A 1GORA 4CUCA 1PIGA 4I5XA 1N8WA 1E4LA 4LVGA 1B3YA 3GG1A 4MB4A 4LALA 1JZ3A 2NV9A 4AEOA 1SW7A 4NHVA 2JALA 1PBGA 3TAKA 1EC8A 4LV4A 3VNMA 3D3AA 1XFBA 4O4WA 3LCLA 2W91A 4IIHA 2DSVA 1SYTA 3CAVA 4HSOA 4W86A 1J6PA 1V7YA 1XDMA 2VCAA 3D46A 1TVNA 4LCQA 3E5PA 4U28A 2R6OA 1IQ8A 4H2HA 2QCCA 3ES8A 5BYWA 3S5OA 3W7RA 3G8EA 3KBVA 3KBMA 5DX7A 1Q2RA 4D6GA 1GOOA 3T44A 2VRQA 4AYSA 3PZNA 3S9YA 1K7FA 2A7PA 1OIMA 3PBVA 3QGAC 1MFVA 4JKLA 3GR7A 3L2LA 4JTCA 3VNLA 3OZPA 3GXNA 1K8XA 1V4YA 5M17A 5CKSA 2QUNA 3TCEA 1DVJA 2OO0A 3U2OA 2Y61A 3SGZA 3WLQA 2DSKA 5EGRA 2Y4SA 1XIEA 3UR2A 2WPBA 2EF9A 4JIPA 1Q8JA 4P7OA 2OQHA 1OG6A 3L21A 3TTEA 3GYEA 5K3VA 1CGXA 3N13A 4M6VA 2BVDA 4Q4OA 4A8RA 1AJZA 3MC5A 3WF1A 3N04A 3FXGA 1CEOA 4XG1A 1SGJA 2XFFA 2ZUMA 2B7NA 1GZ1A 1NF0A 3FIGA 3H2FA 3WQDA 1W3HA 3JVAA 3JR2A 5IOBA 2XN1A 4KF1A 3MUCA 4JD4A 4PB3A 2QUTA 2CYGA 3P84A 3N6HA 3RX4A 3G6MA 3WLHA 1WUFA 1QWKA 2OKOA 3W7CA 3GG0A 3CIWA 4YVPA 3R43A 3WQPA 3W1NA 4HPHA 4RX0A 4QP0A 4GYPA 1N55A 2BDQA 3BSHA 3NPUA 2VEMA 2D23A 3PF3A 1LT8A 1XCFA 1E6RA 1O5RA 3NQGA 1XYMA 1AH3A 4B9ZA 2D0FA 3IJLA 1R5YA 3BOLA 5EBUA 3V5OA 3SO7A 4BWLA 4J3VA 3IAPA 2YYTA 1FP8A 4KEVA 1OABA 5DO8A 1A80A 1PEZA 3NZGA 4XZBA 4PB4A 1JR1A 4GZ7A 4W84A 4ATDA 3W53A 1LP6A 1WYIA 1X8CA 4LS1A 4JBRA 2WMGA 3PWGA 3MPGA 4MKNA 5TQLA 1A0CA 1G67A 4FIRA 4AUBA 4QSHA 1I9CB 2HNEA 4A3QA 2BZNA 2ZIDA 4L9XA 1F05A 1UKOA 2BOFX 4ZEPA 5IBXA 4J2PA 3DFHA 3IGUA 3LNPA 2CKSA 1KM5A 3VK5A 3VGHA 1F74A 2QAFA 1PZ3A 5CJNA 5A6JA 4Z0SA 4E8CA 2EO7A 4PTDA 4QG6A 3QH2A 3RLUA