1XW8A

X-ray structure of putative lactam utilization protein ybgl. northeast structural genomics consortium target et90.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
247
structure length
230
Chain Sequence
MKIDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQIMQACVREAIKNGVAIGAHPSFPSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVKPHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGKQYGLTTREEVFADRGYQADGSLVPRSQSGEEQALAQTLEMVQHGRVKSITGEWATVAAQTVCLHGDGHALAFARRLRSAFIVVAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0271 protein ybgL
publication title X-ray structure of putative lactam utilization protein YBGL. Northeast Structural Genomics Consortium target ET90.
rcsb
source organism Escherichia coli
total genus 65
structure length 230
sequence length 247
ec nomenclature ec 3.5.2.9: 5-oxoprolinase (ATP-hydrolyzing).
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03746 LamB_YcsF LamB/YcsF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 1xw8A00
3S6OA 1XW8A 4V33A 2VYOA 4HD5A 5BU6A 3WX7A 2XU2A 2I5IA 2E67A 2C1GA 4NZ5A 4NY2A 4LY4A 4NYUA 4F9JA 3HFTA 4U10A 2NLYA 3QBUA 4WCJA 2J13A 4NZ1A 2W3ZA 1V6TA 4NZ3A 4F9DA 3CL6A 4M1BA 5JMUA 4NZ4A 2Y8UA 2DFAA 3RXZA 4OUIA 2QV5A 2IW0A 1NY1A 2C71A 3CL7A 4L1GA 1W1B1 4NYYA 3CL8A 3VUSA 2C79A 2CC0A 1W17A 2C1IA 1W1A1 1Z7AA
chains in the Genus database with same CATH superfamily
3U2ZA 3T0BA 1K8ZA 3BJFA 1PPIA 1VPQA 4B5UA 3DESA 4MLJA 2POTA 4NG3A 1UZHA 1JEZA 3N2OA 4ZQCA 1ZFJA 1U22A 2WZHA 3T81A 4O1FA 4IUGA 1IZCA 3U5YA 4ZO8A 2C1IA 3JU2A 3QTPA 3V3WA 3IGHX 2WOQA 5DELA 1P0KA 4WKFA 4LBRA 5A3HA 4UFKA 4H1ZA 3LI1A 4DO6A 1PE1A 4GBDA 1B30A 4Z1YA 3LXCA 1KWGA 1VFLA 1DJQA 3M5ZA 4GI6A 1YDVA 3IGXA 2WHJA 1CYGA 3ZVIA 2DZTA 1DHPA 3MBDA 4HPXA 1PZ3A 3TJXA 1TX0A 3CQIA 1NQKA 3GNNA 5H6HA 4E5TA 2Q8LA 4FNUA 1MEIA 4OWGA 1JUBA 1H1NA 3L7RA 4LRTA 4XQ6A 4CQ8A 4P7RA 1D3CA 3DYOA 2XM1A 2YDSA 4MJMA 4O1CA 2VC5A 2YFOA 4AFYA 3P61A 4P5UA 3RCNA 4WKAA 4GY7A 3WJSA 4UZUA 3RXZA 1JYNA 3PZUA 1XV8A 4S3GA 2QUNA 3DENA 4D6JA 1S1RA 2QV4A 3JR2A 1GZ1A 4F0HA 1X6NA 3IUIA 3LBCA 1WUFA 1BWVA 4M6PA 3QSRA 1FWWA 1MUCA 3W07A 4P7NA 1L0PA 2Q3RA 2DT1A 2G8ZA 5D04C 4I7VA 1WZKA 3TW7A 5A6BD 2F2KA 3CB8A 3BMVA 3NQ2A 4IF2A 1EGVA 2XG9A 4Z1BA 1BG4A 4H01A 1FVPA 3W7KA 4DJEA 3R2GA 3QV7A 8XIMA 2FZNA 3EWYA 3SCPA 2J66A 4BWLC 1HJSA 1IGWA 4GI9A 2DIJA 3CIXA 4BQ5A 2EKCA 2XFWA 3WF1A 3W7IA 4YTSA 3T8LA 3SN1A 4C6KA 1KA9F 1JUEA 1PHQA 3PTDA 2WC3A 3OA5A 1GG1A 3NO5A 4LCSA 1J0JA 3L67A 4ZQMA 3JVAA 3ARUA 1LWIA 3OQ8A 5D8WA 3SY5A 1VP5A 3MDWA 1UC4A 4YN5A 4UIOA 3H2EA 4ZQPA 2HNEA 1XLHA 4DXXA 1XQKA 3W2JA 3VGDA 1IE7C 1Y7VA 1A3XA 4PODA 2UY3A 2KZHA 3AMDA 5G2WA 2BHZA 3RIKA 4EANA 4RZBA 4INFA 2FTPA 2QCEA 4A3RA 2UZ9A 1XKJA 2OMAA 3VKDA 4J3VA 3OLDA 2X1SA 3AFBA 2DT3A 2ZTJA 3HMJG 5K9DA 1OSEA 3FS2A 2WV8A 5J8LA 3WD2A 3TQVA 4MTVA 3AZSA 2A3AA 4MMWA 3SRDA 3ARZA 4Q8NA 4IL0A 3LD5A 5C0QA 1XLMA 1DIEA 1XGEA 2PP3A 4JIRA 3UQNA 2G50A 4GQGA 1HNYA 5I6SA 3EWXA 4X3ZA 4YCOA 1ZL1A 4AZHA 4KCTA 3TN4A 3LY0A 4V2XA 4RXFA 4E2DA 4DPQA 1EQCA 2DU2A 3CEUA 4ZB5A 1FH8A 3W6YA 3MJYA 4IG2A 4ZOBA 2G5WA 4P8UA 1TWZA 3GU2A 3S9IA 5FJPA 2QPXA 4NI3A 1M7XA 3NYZA 1GVRA 4NILA 4DWSD 5LKYA 4IHCA 4NSBA 2C0AA 2BY1A 4OZOA 4GIAA 1W9UA 2PCQA 2PURA 4ZOEA 4FR6A 2PDJA 3N17A 2H3DA 3NQFA 4XX6A 1CIUA 2JF7A 3SW6A 3WDJA 4UNLA 2ZX5A 3ELFA 4E8GA 3MUCA 2W0UA 1LLOA 1EPXA 4H3DA 2ZUSA 1RBAA 1VENA 2BGNE 4RW3A 3KS5A 1O60A 3CV7A 4IGHA 3N4FA 4LU0A 2YL6A 5I23A 5DT7A 1HKVA 4JD4A 1E0UA 3A3WA 2C8NA 4KT2A 3CPGA 1N55A 3L0NA 4WXZA 2A85A 1T41A 2WMFA 3HB9A 1UD8A 3WLIA 2E9LA 3FEMA 1R7AA 3ZO9A 2GGGA 4GRSA 3AISA 3TVAA 1P6WA 4AD1A 3KDNA 4UUIA 3CMFA 1S2TA 4JDBA 2GOUA 1A5BA 5CPLA 1M7OA 5CAKA 2FLIA 5AYYA 1FDYA 2VD9A 1AZ2A 2ACSA 1J2BA 1KRCC 3VD3A 3TP4A 1YXDA 1IXNA 3G1XA 5IBXA 4G5DA 5MHBA 3HIJA 3NVDA 4C1KA 1SO5A 2QGHA 3WYZA 4A8RA 4NAEA 4D8ZA 3UD6A 2PWUA 1X98A 1H2JA 1TE6A 3OZPA 1DE6A 1IXQA 1BKSA 4N9BA 3TN5A 3PY2A 3VDCA 4E6MA 3ORWA 4MDOA 4FLRA 3KX6A 4NRRA 3Q67A 4IICA 4A8LA 2ALRA 4IIHA 1DWGM 1Z89A 4RCXA 3AXMA 3KDOA 4WDXA 4KEMA 4WSJA 2FFIA 2NLYA 1W5PA 4HPGA 2NUYA 3MKKA 3NPVA 4ML4A 7A3HA 2XFFA 2WPBA 3TYCA 4IQLA 3R4IA 2GQ9A 5GNZA 5BOFA 4O8AA 2CZVA 3MCNA 2EG7A 2HXTA 4ZXOA 1E1CA 3P8IA 2D69A 4RKAA 4UNKA 3S1GA 4X61A 3EKGA 5JBEA 1V3JA 3WFZA 1EGZA 3B9OA 3HOJA 2INFA 1R2SA 1G1YA 3WLRA 4UQCA 1E4IA 1T8QA 3VYLA 4LVAA 3RRXA 1KC7A 3VC5A 3ZLFA 2OELA 3AS2A 2WM1A 3TTOA 4ZCWA 3CYJA 1MNSA 2FGBA 4QXIA 2UV8G 4FSAA 3KZPA 4CQ9A 4X2PA 3DFPA 3BGGA 3W88A 4ZQNA 1QDSA 4GC3A 2BZNA 3KLKA 2ZE3A 1R2TA 4W89A 3VTRA 1WDPA 2VVSA 1K02A 2D3NA 2HVOA 2R24A 3M0JA 3WNNA 4HNVA 1TPFA 3N2TA 3W4RA 2BV9A 3TQ0A 4GOAA 3L23A 4OBTA 4CNTA 1EDQA 3CXOA 3TYUA 3KRBA 5HAOA 4UOJA 4C6BA 1B3YA 4NNAA 2BX7A 2P0OA 1XR2A 2XWEA 2V5CA 2OYMA 2X0SA 5ABHA 1SPQA 1JXJA 1PS9A 4J3XA 1XYCA 3RU6A 2J7HA 3N9RA 2YCLA 4DPPA 3DG6A 4AZBA 2J75A 5G4EA 4B91A 4LX4A 3H7VA 3U2OA 4XUYA 4MF4A 5A6TC 5FF0A 4PCSA 2XUCA 3C8NA 1J4EA 3CQJA 2XH7A 3U7BA 3AHTA 1S5WA 3PBGA 3T2PA 1D2KA 4JFVA 1TPB1 4DYEA 3EZ4A 3VIHA 3PBWA 2F38A 4UR9A 3SCVA 4M5PA 2WCGA 3KVJA 4OIFA 3NNTA 4GUFA 4JQ1A 3BC9A 4X60A 2PLCA 1GPFA 1E4LA 1P1XA 1SYTA 1TMLA 1XL9A 1EDTA 5D02A 3TZFA 1K7XA 1XSJA 2QIIA 4EXAA 3NL5A 1BFNA 2BDQA 6TAAA 3U6WA 4CEXC 1BYCA 1TWSA 2YA1A 3TV8A 1XLFA 4LOCA 3VGBA 1TV2A 3L2IA 1GQIA 4QJ5B 1OFQA 2FH6A 2BBFA 4IGMA 2ZE0A 3RU8X 4DVOA 1VBRA 2A7NA 1XI3A 4LFYA 4DUVA 1AFSA 5A1AA 1RK6A 2IQ0A 3T6CA 4NJHA 4XZHA 1H62A 2GK1A 3UJEA 4GA8A 1VQTA 4HZMA 1GTHA 4QJ4B 1X38A 4F2TA 1OYAA 3LNMA 1K8XA 1XH0A 2YZ5A 1NP0A 4PMOA 3GWQA 4JEJA 4LAKA 4CU8A 3NTYA 4ZB0A 4YJ5A 5C9XA 4DYJA 4Z08A 2UY4A 4C6QA 3C0JA 1JDCA 1MUWA 3VGFA 4D71A 2W27A 4GNVA 3CAWA 1G0CA 2OXNA 2ZRXA 2QCCA 1E3ZA 5EMMA 4R85A 3WLSA 4DZ5A 2B31A 2JEPA 4GHRA 3A24A 2VEIA 4XBKA 1UD4A 1JD7A 2X0HA 3WLQA 3VM7A 2FVKA 3S47A 4R9OA 1M6JA 4NASA 4TMCA 3V5CA 2VL4A 4F4RA 2YYTA 3CV1A 3VZZA 4DM2A 1H3GA 3AIQA 3MKVA 1W0MA 2HXUA 3E0WA 2CIPA 5G1MA 3WMSA 1YKWA 4HZ6A 5AB3A 3NSMA 2JF6A 4OUIA 4A05A 3SY1A 3CNYA 2NVDA 1IGSA 4Z2HA 3ARYA 3CWHA 3SM0A 1QI4A 4XKYA 1I8JA 5D37A 2J6XA 3LGEA 4PUKA 3UZYA 4AVOA 2E6FA 3R58A 3CPUA 2X09A 1OM0A 1KV8A 1REQA 3RITA 2R9RA 2VFHA 2DSWA 3EDDA 3BK0A 3SEPA 1P5BA 2IKHA 1IV8A 4UR7A 2O56A 5CZ0A 4ADTA 4JTKA 1YADA 4EIVA 4M6QA 4MB5A 4DI9A 3FGCA 4CNUA 4AEOA 1J6OA 3QPYA 4MFEA 5EGRA 5BWAA 3QQWA 3CH9A 1OX6A 3P0WA 4L6HA 1EJWC 3E5PA 1BRLA 3M7SA 3RGTA 1E1EA 3SUVA 1V6VA 3NQGA 3T0AA 3KBVA 2BMBA 1UOZA 5HNTA 4UCFA 3UR2A 1UOKA 4W8LA 3M0KA 1YW1A 3RUBL 1FUYA 4MAVA 4RXGA 1KM4A 4QSFA 1HN1A 5FCZA 5F4WA 1DIDA 2YFNA 4GBUA 1GEHA 3IV8A 4F2BA 5LNRA 2YL5A 3O63A 6REQB 3VD9A 3NCOA 3ZS4A 4PUNA 2GGJA 3S1WA 3CQKA 3PWGA 4KRTA 4A21A 1Q7ZA 1YRRA 1P0BA 2OYLA 5AYXA 2BOGX 4NZ1A 1E9YB 1GTEA 1UWUA 2V5LA 5D2YA 4FNPA 1FWIC 3W2NA 1H7NA 4JFTA 4LAOA 1C7SA 2Y7FA 4Q22A 1AODA 3II1A 2YYUA 5A6MA 2E6YA 4CQDA 1RQHA 3DFQA 1VGAA 4HQVA 4JHOA 4MAZA 1WUEA 2NV9A 1TV3A 4R7OA 3AWOA 3V35A 2IQDA 4AISA 2PODA 3TUUA 3AZRA 1EX1A 4IISA 1V0NA 1HL9A 4DBEA 3BWWA 3CBWA 3FJLA 1EZ2A 3S9YA 3VD5A 5HMFA 1JDEA 1O12A 4Z2LA 3N6QA 1PUDA 1E6QM 2QCHA 4MDPA 1OX4B 4HBKA 4W87A 3ITOA 2Y2WA 3N9KA 5LNVA 1VLIA 1HL2A 2PSNA 4GISA 3S4TA 1YEYA 3I65A 2ISSA 4W8BA 2NSOA 1QHOA 4IUOA 1HZYA 4Q8QA 4I9JA 3WF4A 3GTIA 3HZ3A 1ISXA 1IHIA 3BSHA 4J40A 4LANA 5HQEA 2R6OA 2VFFA 4DYKA 1M7PA 5HXMA 1T96A 4QNEA 2YA0A 1YE4A 4KBXA 2WJZA 2ZXAA 2V67A 1HW6A 3EDFA 4URIA 2WMJA 4LUIA 2ZRUA 4J3UA 1QNQA 3F4WA 2J88A 4A3HA 1Z9AA 4Q4SA 1RR2A 4Q8OA 3UNDA 3GH7A 1DPMA 3BCDA 3ARRA 2GVYA 3LCIA 4HPJA 1P48A 1VHCA 3T4CA 1JI2A 3QXBA 5EBAA 5C7VA 1E1FA 5FL0A 1S2VA 3UPWA 1F3WA 7CGTA 2OODA 2ABBA 4P7QA 5H91A 1C8QA 4LAMA 5ABEA 3WBXA 2ANUA 1EO7A 4YMZA 1XINA 3G6MA 4TV6A 1Q13A 3W73A 4FNRA 1GYMA 5AHLA 3TW6A 5I3JA 3PBVA 1N82A 3W00A 5A6AA 2EBNA 5D9PA 2OCZA 2XIIA 1RHCA 2RKXA 4WGXA 1JF6A 3OZMA 1OJXA 2WHMA 3KUMA 4HYWA 1BTMA 3SJ3A 1I75A 1VJSA 3GNPA 2BY3A 3PJUA 5G4WA 4DY1A 5G5IA 4XO7A 1OZMA 3TR2A 1HFBA 4Y96A 2C13A 1QPQA 4PMNA 1DXFA 1GZJA 3B3DA 4XD6A 3LPOA 2HK1A 4UFHA 3T78A 4IPPA 3HBLA 1J18A 4FB7A 4JN6A 1XYAA 3UJ2A 3CTTA 3TZNA 1EZWA 2X1RA 4U10A 2CLIA 4C6FA 2X41A 1F05A 3I4EA 2PD5A 3VCNA 3AIVA 1PDZA 4O50A 1QJWA 2A3EA 4DBUA 4IJCA 3PZTA 4PC8A 1HJUA 4ADSA 4GUJA 3U57A 4EWJA 4IOTA 1H1YA 1ZP3A 2A3BA 4AVNA 4UC5A 1TO3A 4MPQA 4AY7A 1A53A 2VENA 4YS1A 1ZCOA 1POJA 1JZ6A 1OFAA 3GDLA 3HPXA 1FWAC 3WQ6A 5JVLA 3DX5A 3M47A 5IXEA 1THFD 2WJDA 3VMPA 2WSQA 2GDUA 1E3XA 4GPNA 3O1NA 1MXGA 3STEA 4LVDA 2YIHA 3GUGA 4LNCA 9RUBA 4B5TA 5FEPA 1BYAA 2VJXA 5LXXA 4DLMA 3ZXWA 3QYSA 3N1AA 3EPOA 3OHIA 4TVCA 4L9ZA 4JTEA 1LL4A 1ITCA 3H2OA 5JMUA 4NRSA 4RE4A 1TPC1 2P1FA 2QYGA 3CAQA 2XGBA 2CWNA 1M3UA 3GDMA 5BOEA 2CC0A 3W25A 3FA3A 1XRTA 2J79A 3LSCA 4XKMA 2WVVA 3V0UA 1QUMA 3N2MA 5I77A 1G7UA 2ZRYA 1PHWA 3LYEA 4AZCA 3E38A 1YX1A 4CN1A 2B4GA 3EA1A 2ZUNA 1YNYA 1F7BA 2EQDA 5HBFA 2WKGA 1JFXA 1NY1A 4W88A 3N12A 1JPIA 5EYWA 1ZALA 1W3KA 5CBBA 1EA0A 1SZGA 1SJCA 1AQMA 2PDYA 1WYIA 5AHIA 2JK2A 3E96A 3GG7A 3OIXA 4PMZA 2WZTA 4AWTA 4DNHA 2J9XA 1L6YA 4J28A 2QCMA 3SQLA 5EB8A 3SGUA 3YPIA 1FP8A 4ZEPA 1XKYA 2VGBA 1GOXA 1XIMA 3G1DA 3HG5A 1FKXA 1XH2A 5E09A 3LCHA 1MFUA 4IGNA 4PB4A 4J9JA 3WDPP 2VQTA 1H11A 4H8HA 3RNDA 2P50A 3MI6A 4WX2A 3MSDA 3GC5A 3V0SA 4PFHA 1TG7A 1IZKA 3OIHA 1RXOB 3DFSA 2Z7KA 3M0XA 1O5RA 1EKOA 3OHMB 4DBWA 5EMYA 2Y8VA 3A21A 4JQ2A 1SZRA 2R82A 3LHWA 5DMLA 1KQYA 2BVDA 4PMVA 3AO0A 1YXCA 2PRHA 3O0KA 3BLKA 4DB7A 2FZDA 3KWXA 2CW6A 2V3EA 5FJUA 3PHAA 4D1IA 4NZ5A 2D3LA 3FJ6A 3MHFA 2A7RA 2HE8A 4BK9A 3KFTA 5FAGA 3HMCA 3MUAA 3PZMA 4ACZA 4GVFA 3ARWA 1KGWA 1GUVA 5DMNA 2CZ5A 1ELSA 4C6IA 3NQAA 2A0NA 4YYFA 4WKHA 2QHAA 3EKZA 4OV9A 2FTWA 4ZOCA 6ENLA 2VFIA 3UCDA 1K8CA 2FHBA 5HK4A 4O14A 3WD0A 1H0IA 2WVSA 4US6A 3UBPC 1R6WA 2PP1A 1CW2A 4FF5A 3FVDA 1TJ2A 3VOCA 1LDCA 5KZDA 1JG9A 3B8WA 4OTKA 1YDOA 3QYQA 3S6OA 4I90A 3ATZA 3O8AA 4KIEA 4RL3A 3RCYA 1FWHC 3E02A 1CECA 3CAVA 4OGZA 3APYA 3JW7A 3L66A 3KVMA 3BLEA 1B5TA 3EEGA 2X1UA 5B7YA 1DJZA 2TSYA 4LJ3A 5A2AA 2HS6A 2WYSA 1ISZA 2NT1A 1LQAA 4BEUA 2VVNA 1UWTA 4UCGA 1IEVA 4ZTYA 2V68A 4WXYA 2XIOA 3CWNA 2EPOA 1EO5A 5IDIA 3MSYA 4LXFA 3PUDA 2VO5A 1J11A 2MUCA 4GCXA 4E3TA 3QF0A 1TV8A 4KH2A 4GH1A 4S3CA 5D9MA 1ITXA 2KAUC 1T40A 1O5KA 3Q2DA 4JBRA 4IXHA 4X0NA 1CXIA 1W3LA 3VVGA 3M0ZA 1KCKA 3GRIA 2ZZ3A 4JX5A 1ZHAA 1KQZA 3FN9A 1J0KA 1NOUA 1EL3A 3E2RA 4IFKA 1R30A 3EPNA 1C9WA 1IWBA 3DOPA 4E4PA 1MO0A 3VU2A 2I5IA 4JEQA 2FGZA 2XH0A 2GL5A 1CT5A 5A8NA 5BXSA 5EU9A 1H51A 1FWBC 5TAOA 3I6TA 4Q8PA 5A6LA 3UJRA 2DSVA 4LNYA 4YTQA 1TV4A 3LA4A 2G3IA 1ONWA 3TOPA 4F3HA 4A8NA 4F40A 1L2UA 1E0XA 1IEXA 4QQUA 2CCRA 4NZ3A 1RA5A 1ZPTA 1ZSXA 3GXMA 1ZB5A 3M5XA 3GW3A 3CU2A 3NA8A 1OFDA 5ECUA 3QHNA 3F2CA 4N9CA 2YCEA 4ECLA 1RJQA 4XV0A 4C7FA 1DOSA 4QE1A 4H9MA 5G4HC 5GJNA 3QV6A 1A5NC 4UXDA 2BXYA 5JQ9A 1S5NA 1GK8A 3M16A 1W32A 2OLHA 3Q58A 2F7FA 2BB0A 1EEXA 4Z1DA 1FA2A 3P67A 1US3A 2HISA 1QBAA 1W5QA 3W71A 1U5HA 5LA2A 1JYXA 1JAEA 2Z6JA 2DJXA 1CXKA 4H9XA 3G1AA 1W5NA 4F66A 1I1XA 1KM1A 1VF8A 3T08A 1W31A 3NG3A 2IUZA 3AROA 2OT0A 2Z1VA 4XTIA 1AUSL 5A6JA 1BSLA 4JN8A 5AHNA 3PNUA 4ZVJA 2OO0A 3GNDA 3LUTA 1UIOA 1OF8A 3WMLA 2Q6ZA 4Z1AA 2WC4A 3TTEA 1ZLPA 1JULA 4K68A 2Y63A 1M7JA 1K8YA 1OG6A 4ERAA 2PDCA 4Y8FA 1W1IE 2RDTA 4Z2JA 3BSGA 4GABA 1UP3A 3UG3A 4WY0B 4JTLA 3TK7A 2GJXA 3PFMA 4NF7A 3WO8A 4BF5A 1SW0A 3W70A 4BR1A 2O92A 2VWTA 1WDDA 3W1RA 1OBAA 4KF1A 3APGA 1V0LA 1XLDA 4GD0A 1L6FA 4JFSA 2Y89A 3TC6A 2P8BA 4KFNA 4HSHA 2NLIA 3TYBA 1MDRA 2AGKA 4D8AA 4TIMA 2J7BA 1EP2A 4WVXA 3ITLA 1Q45A 4HIBA 2RDXA 3KRSA 4ZGYA 3CAKA 1BXCA 2WJEA 1BPLB 1EUNA 3EX2A 1F73A 1H4PA 4R53A 4C91A 1UR0A 5D30A 5M1TA 2BTMA 3EWBX 3DKJA 3S83A 5CAHA 3SY8A 2VQUA 1BXBA 4WOZA 1U5VA 5EBUA 4IG2B 3A6OA 3IRDA 3RX4A 1S5VA 1QW9A 4JHZA 2IKIA 4RDVA 3VGGA 1OCBA 1WKEA 1RSCA 2Z1KA 4DX3A 1V51A 4PL2A 3UPMA 1MW1A 3OYZA 2ASHA 4ZFCA 3W82A 3DU0A 3NVTA 4L1GA 3FIGA 4IPJA 1GORA 2VOTA 3GR8A 3N2XA 4U33A 3FJNA 5E0FA 1V3LA 4CN6A 1GWJA 4HJWA 7REQA 3EWUA 4Q6JA 1UQZA 4DJED 3QGKC 1XBVA 4AMAA 3A4JA 1W9BM 3WEOA 1TJRA 1RLDA 4A3QA 2OWCA 3EKLA 2DUZA 1P0EA 1EBGA 4JNZA 4CVUA 2VEMA 5JU6A 2G96A 3PR2A 1S38A 2OSYA 2ADAA 3O15A 4MUPA 5HATA 3M0MA 3LTYA 4S2BA 5CGTA 1U33A 4JTTA 3H2MA 2CKSA 4J7RA 2VX6A 5M17A 1BG9A 2VR5A 2D2HA 1LOQA 1IXOA 3BLOA 3U2CA 3TOYA 2PWGA 3LHZA 3RR1A 2E8ZA 1F07A 1UHVA 4DM1A 3W7EA 4O1AA 1E4NA 1N8IA 3W7OA 4H2HA 1GQNA 1KKOA 3VGEA 3ANYA 5E0CA 4HZ8A 5T9BG 3UZZA 3RF9A 1W3NA 1QNVA 4A6GA 2ISVA 3OB8A 1W37A 1YE6A 4BWLA 5ABFB 3I3DA 1YIXA 3ZT5A 3HF3A 4Y9MA 4V33A 3LBOA 2EEXA 1HXJA 3SUSA 1JYVA 1R46A 4PRTA 5D2XA 1CLVA 4AD2A 5A95A 5I03A 2WMHA 2PU0A 3CHDA 4K8GA 1JPHA 4KWSA 1R5YA 5HOSA 4MKVA 5HINA 1DJWA 3C2EA 4DBDA 1X97A 3GX9A 3KTCA 1JZ2A 1I60A 4AYGA 5T9CE 3P5YA 3BOFA 3E9AA 3O6AA 3QW4B 4TQTA 1VEPA 2YSWA 2XVLA 1J6PA 4W84A 3NDOA 3S6TA 4KGLA 1PIFA 3E1F1 4G6CA 3I7QA 4ATWA 3H7RA 5HDRA 1DIKA 2XGZA 3C3UA 3LXAA 4Q33A 2OB3A 4Z2KA 3QR0A 1VLWA 1IWAA 1E1CB 3NUKA 2W9MA 2BGQA 3T40A 4DXKA 4CD8A 5I79A 1K6WA 3THQA 1ZGDA 3C2OA 1PX3A 3NO1A 4FOUA 3T2OA 1QRQA 4QROA 2CLLA 2JGYA 2PLMA 3EWDA 4QDPA 1GW1A 2BHYA 1U2YA 5E70A 2INZA 1XSKA 2QUTA 5KITA 2KX9A 4GVHA 3V36A 1RVKA 4KRUA 4NYUA 2Y7EA 4AIOA 2E28A 1TV5A 3FEQA 4O13A 1BSIA 3N18A 1O5XA 3R8HA 3HGSA 4AHOA 2C79A 1NEYA 4JIQA 3WUBA 3EMQA 3O6CA 4S3BA 3IRSA 3B03A 4TVDA 4FHAA 1PZ2A 4U3CA 3GS6A 3ISIX 4ML9A 2BY2A 1ONEA 5H8MA 4QDWA 2VX4A 3N14A 2OLSA 2EXOA 2EGZA 1C8YA 2J8TA 2HBVA 3TAOA 2Z00A 3UZWA 3LG3A 5XIMA 3H70A 3DCPA 1A3HA 5AC6A 2OR2A 5BU6A 4LUJA 5FOOA 3VIIA 2GGIA 3G1VA 4CCCA 4H9UA 2F6KA 2FQIA 3CMJA 3C86A 4GNKB 3W53A 1G69A 1ZUAX 2QCDB 3W76A 4JCMA 2J9ZA 2WQDA 1GG0A 4PMYA 5I78A 3LZ5A 3E2VA 4HGXA 3KOYA 1NWSA 2RGLA 1LROA 3QQ0A 3G18A 5CLWA 4RE3A 1YNQA 1MRQA 2RJHA 2XSBA 4LALA 1MDLA 4OUEA 3GM8A 1M41A 5CJNA 1HVXA 4G7FA 2QNEA 4HHMA 3U5UA 3LMZA 1YDNA 3TWBA 1EOMA 4KEZA 1LUCB 1CTNA 3KP0A 4JQAA 2O0TA 3SI9A 3IARA 1KXQA 3LCGA 3UVIA 4WJEA 1GOMA 4JTAA 4S39A 2UY2A 1JDAA 4DUWA 1ZJHA 1JYWA 1ZCCA 3MI2A 2J6VA 1XGZA 3L0GA 1QOXA 5EMJA 5FIPA 2XM2A 3W75A 5BRPA 4HCDA 1KCXA 3FCPA 2GK1B 1XBZA 1PV8A 5TIMA 2WVUA 4XG1A 4XD3A 3NAVA 1WPCA 4UFJA 3M41A 3D3AA 4RZ4A 3DFHA 1HJQA 2JKPA 1EF2A 1JCXA 2Y5EA 3WLNA 4AU0A 5KZMA 1XYFA 2YCJA 3EYPA 2B81A 4PMUA 2OVLA 1TVLA 1AMYA 2C3ZA 2QDHA 4XBJA 1PX4A 1AQFA 3M6YA 3WSUA 4RUBA 1E40A 2O4QA 3UESA 4JY8A 4KFOA 3BURA 2PZNA 4GUIA 3ZJ8A 2NUXA 2X7VA 4FNTA 3I6EA 3R1ZA 3O6YX 3IK2A 1W8GA 4K8EA 1WDRA 3EGJA 1W3IA 3H7UA 3TDFA 4WSKA 4B2DA 1UR3M 3JRKA 2OWWA 2JBMA 2J77A 1W3HA 3WN6A 4J27A 3TX9A 3GH5A 4JKLA 3ARXA 2I16A 4Q8MA 3QOMA 1EB3A 5DQPA 1FFQA 3SFWA 1JD9A 3ES7A 3PBUA 2G97A 1QPNA 3WG6A 3EOUA 3T0CA 2YL8A 1SU5A 5HANA 4AX6A 4Q4KA 3WNOA 3RYSA 4D1JA 4N4QA 3LHYA 5BMWA 2F6XA 1R3TA 3FHQA 3BOLA 1KGUA 2BOFX 5FJJA 1KKRA 3OZOA 1BKHA 2HNHA 3G3MA 5CZJA 4QLKA 3SDOA 4BQ3A 3P62A 4LRSA 1UCWA 1XG4A 3B8IA 1AMKA 2QCGA 4LYPA 4AXNA 4H7ZA 2VZTA 3BDKA 3WJWA 4CNNA 1Q2RA 4PMXA 4QHRA 4W86A 4MZ1A 5AZ1A 3T7VA 3BXWA 2A3CA 1HP4A 1JUKA 1XCWA 2DV0A 3R25A 1VCVA 3GTXA 4YHEA 4JNYA 1ZS2A 3V4BA 2ESCA 2QAPA 5DXXA 1ODZA 3PG8A 3UR7A 3MVIA 4WQ6A 4HOXA 3KTXA 3B9EA 2WLYA 2D0FA 5DEZA 2WZEA 1KM0A 4HNNA 3G1FA 4NJKA 1EPVA 4FIQA 1BGAA 2BGSA 4IL2A 2WPGA 2JIWA 3BL3A 1X1ZA 1MZHA 1LP6A 1LORA 2VP8A 1SZNA 5FSEC 1XF0A 2E4TA 3G1HA 3BZGA 1LBMA 4UTWA 1F6YA 1TVPA 1Z7AA 3LPFA 5BRBA 3T42A 1QATA 1YNPA 5A8OA 3W7JA 2VC6A 1QBBA 1KTNA 4HTYA 3VC6A 4H8VA 4XK2A 1BVWA 3N9SA 4NXSA 1A80A 1AW2A 4ICNA 3GC4A 3ZVHB 4R33A 3VOJA 4QAIA 2J78A 3ZWSA 3ZQ9A 5HNRA 3K8LA 1OIFA 2GVEA 2GWGA 5T26A 2G95A 2WHLA 3UZ5A 5LNUA 2ZZ1A 3ID7A 5CZKA 2A5HA 4OHQA 4IFRA 1VFTA 1HJXA 3RJYA 2E7FA 3C8FA 4ERGA 1RD5A 1DTNA 4JFWA 1DTUA 2ZADA 3ZR4A 4HJFA 4HNUA 4I5RA 3O06A 4J5NA 4JTCA 1B57A 2VRQA 2EO7A 2FMOA 4ZSTA 4MWAB 1B1YA 1OB0A 3WDHA 4O15A 3MP3A 5H8UA 2AGTA 3H2NA 3WKZA 3RJXA 3CZEA 5HQLA 5E93A 3EOLA 4V1YA 4C90A 2YW4A 2WSYA 3MZNA 4GY0A 3LI0A 2W62A 1UR2A 3JS3A 2E68A 3BV4A 2P53A 1HP5A 1GJWA 2O4MA 1KW1A 1GOIA 3AYVA 2F8QA 4GJ1A 3PZIA 3G22A 1EOKA 1W1VA 3W72A 4PR4A 3FW6A 2HS8A 3D46A 3QZ6A 3NXFA 1Q7QA 4MM1A 1DXEA 4HCHA 1MQQA 3UYCA 5EMLA 3D47A 3VZYA 5LIUX 1OFBA 1YLVA 4CD4A 4FPSA 3WBEA 4QEHA 2VEKA 3W1XA 4AAJA 1AD1A 3MUXA 4O19A 1UKTA 1Z69A 4GE8A 1KBIA 4Y9PA 3BPWA 1B9ZA 2WMGA 1TPUA 2E40A 2OU4A 4IMAA 3WK1A 4UFLA 4P8XA 4W85A 1Q2SA 3K2GA 5DO8A 1W1TA 3UXDA 2VYOA 2VUNA 1Q3NA 1H41A 1Q85A 1MWOA 2NX1A 2Z1SA 2RFGA 4BFAA 5EPDA 3ZMRA 1C9DA 4I9MA 3WQGA 4IZGA 4LUYA 3GU9A 3N6JA 4D6HA 4MKSA 2PDXA 3GAKA 2HE5A 4H7VA 1FHLA 2VFDA 1WE5A 3KCOA 3S1UA 2FJUB 3CHCA 3EA2A 1O4UA 1B3WA 4ALDA 3VUPA 5FF4A 5D2VA 1UPMB 2QJGA 4I3GA 1KM2A 3ZJ6A 2CHNA 4EKJA 3MUY1 4GKTA 1OGSA 3HQ1A 4E4UA 4JIIX 1XIBA 4J3ZA 2J8FA 1GYLA 4HU3A 4L56A 1R3VA 1C90A 1XSIA 4IP4A 1L6SA 1E6NA 4AIEA 2DDXA 1DORA 2NQHA 2XSAA 3LB0A 1HKKA 1Y5VA 1TTPA 1VS1A 2VZUA 4Z0JA 5I7GA 4Y9AA 1OEPA 4PCFA 4YU1A 3P74A 1UWAA 4QSHA 4CQCA 3GFYA 1A4LA 1ALDA 1E0VA 3OODA 3FSUA 1J96A 5AECA 1M5WA 4PTXA 3MKCA 3S5SA 2W3ZA 1SMDA 3KBMA 1F5ZA 3TW9A 4XZ9A 5K7JA 2GUBA 1NDVA 4J4KA 1WA3A 4PTMA 4RNFA 3NXLA 1W91A 3KL3A 4Q8TA 2PD9A 1UWRA 2PZ0A 3ITGA 2WWCA 3TFCA 2V5DA 3ZZ1A 3S2CA 5C8BB 5DBTA 3RM4A 3MANA 3DAQA 3TA6A 3PJWA 1K7EA 5D4YA 1VD6A 2ZXBA 1Q6EA 4RNIA 1OINA 2HBXA 2CLPA 1XJBA 1A3WA 1JVNA 1LLWA 2PEVA 3VIGA 2I56A 2X05A 4L9XA 4F8XA 4ZQOA 1OX4A 1KO0A 2V5JA 2PF0A 4KCUA 2UWFA 3V5OA 4FOKA 2VFGA 1IT8A 2DSKA 4WRHA 4WGHA 3CEPA 3WDIA 1MZRA 1J9YA 1H7WA 1K4HA 4DAIA 1A5AA 2E77A 1MFVA 3TYEA 2CLEA 3QV9A 3U7VA 2WMKA 4PSRA 4XVEA 4FNQA 3BJSA 3SUTA 1O7AA 1I4NA 3CPRA 4PTNA 4O0QA 4UQDA 4GFIA 5A8QA 3GVQA 4B5VA 3THCA 4BQ4A 4L80A 4POCA 1EDGA 3PZNA 1XUZA 2NXHA 3C5QA 3O0FA 3ATYA 3BARA 3EB3A 4GYJA 1NFPA 4FI4A 2J4GA 1TZZA 2XIMA 1XCXA 3AI0A 3L4VA 5JIPA 3K30A 3N34A 1GOQA 3B04A 5I02A 3TN6A 2FZ8A 3GVRA 2GJLA 5A2BA 1C91A 3BZJA 2GDVA 5F2MA 3NIYA 2YR1A 1G94A 1X6LA 1K9TA 1WKDA 4O1BA 4DELA 3WLKX 2PRLA 1FBAA 4GG9A 4NU7A 4WD0A 1RA0A 3O9NA 1W56A 4IWWA 5K9XA 1D9EA 4WDUA 2J7EA 5LHFA 3S2MA 1WB0A 1GKPA 3W1UA 4HOZA 1TWIA 3VDBA 4UTTA 3RRAA 3PNZA 2QIWA 4FLSA 3T9PA 3QFWA 3HPSA 2WNWA 1EHNA 3WH9A 3GVWA 5CGMA 3RLVA 3B0UX 5LIKX 1MI3A 4EPKA 1P0NA 3OZYA 1XIGA 1LQ2A 3VNKA 3W2MA 1O95A 4DO7A 4KEUA 3KVKA 3UEQA 2DIEA 1RQBA 3U3HA 2J25A 4UQBA 4L9YA 5I3KA 4G9PA 3ONBA 3LBMA 1XC6A 4YWSA 3H54A 4FX8A 2J8GA 1KBLA 3TJLA 4B92A 2W67A 3ABZA 3KP1A 3E3HA 4O0KA 3TKFA 3QRHA 1ZBKA 3RM8A 1ICPA 4N2YA 2Q71A 1CZ1A 2ZUWA 1CWYA 2D1ZA 2WNQA 3BQ6A 2GLKA 1OD8A 3CL7A 2HK0A 3EXSA 4GIRA 4H2CA 4AC1X 1ADDA 1JRCA 3GNXA 3J7HA 1JR1A 3SQMA 5AHMA 3SIMA 1JL8A 2E25A 3ITTA 4D8LA 1QMLA 4ENLA 3WEZA 1LBLA 4KETA 2VEFA 4RE0A 1ESWA 1J12A 4HNTA 2AMGA 3W0KA 4EOUA 2ZDSA 1Y5XA 2C6QA 4Q8VA 1L8NA 3ES8A 1UWSA 3CUIA 3SSZA 3EEZA 3S2LA 4LUSB 4PRRA 4G7EB 3RPTA 1B31A 1J5TA 4GYPA 4HMNA 4TX6A 1NDZA 1LWJA 3LGGA 1UUQA 5LA1A 3REQB 1WZMA 3WBAA 5G1TA 4J2PA 1TPEA 1WXYA 3N3TA 4MOZA 4EXBA 1L2QA 2CLHA 6XIAA 3FKRA 1TZ7A 3M64A 4KKXA 4GWEA 4H41A 1UROA 3ZT6A 2NX3A 1KBBA 3FKKA 2BVWA 1E73M 3ZLGA 3HGOA 1F4AA 4UQ9A 3R7MA 2P3EA 3GVVA 6ALDA 3PSWA 1GPWA 2J47A 3RMJA 3KHDA 4OU1A 3AS3A 1FRBA 2XINA 2NQ5A 4ICCX 2CYGA 5XINA 3STFA 5GVJA 1N8FA 4CNPA 2P76A 4XAFA 4HHPA 3AOFA 5L6UA 1IEWA 3OBKA 2R91A 2J74A 1GONA 4IFOA 2CESA 2R1KA 4A35A 3NWRA 1VKFA 3CGTA 4YVVA 3P93A 3GHRA 1H7RA 5D9OA 4JDYA 2Y4SA 4M7SA 1SO4A 2XVNA 3PUGA 3LDVA 4ZODA 1UWQA 3OP2A 3IJQA 1A0CA 1DQWA 5DF0A 1OC5A 2YX0A 5BU9A 5K4ZA 8XIAA 3WY1A 4L61A 2DT0A 3CZ8A 2FPTA 4LY8A 5KEZA 1KTBA 4DXVA 2YXOA 1S2AA 3WQPA 4D6IA 1H7PA 1UKOA 3QTGA 2CBUA 4PEEA 4M3PA 5CG0A 3DKLA 1VYPX 2XIJA 2SFPA 3NFUA 4NHVA 2VHLA 2Y61A 1QASA 1UASA 2Z29A 3A5FA 4MKNA 4P8WA 3KL0A 4AD5A 2XH4A 3OYXA 4X9SA 1VBUA 3HG2A 3VDHA 4JYFA 1SVDA 2EG8A 1FCBA 4U31A 2Y7GA 1YPFA 3R0DA 3SCOA 5IBXC 2ZOXA 1PVNA 3LEPA 4AC7C 2PA6A 4C6OA 4JTHA 3DI0A 3G24A 2PDLA 4PUWA 4X9YA 1E0WA 3HV9A 4B9YA 5E6ZA 3NZRA 1GHSA 3Q94A 3ITYA 1XIHA 1AH0A 3MYPA 3HQOA 1OQFA 3FFSA 4IH3A 4HU4A 2QUVA 3P0XA 5AKQA 4IIDA 1DWFM 1I2OA 3BLFA 2JQXA 1JGIA 4ZZ9A 3WLTA 1R3YA 1I45A 1MQRA 3FXYA 1L6WA 1OCJA 1R85A 1JQXA 3W7CA 3GKAA 1FCUA 4AZ5A 3DYMA 2R1MA 1DJIA 1V93A 4XZIA 1TPDA 2W92A 1LM1A 3A64A 3MV01 5IFPA 1UA7A 3RX3A 4GQ0A 4DJFC 5MF5A 1Y0EA 2Z28A 4R34A 4H9YA 1QOPA 5KZ6A 1XH1A 3BICA 2G3FA 4TU1A 3OPSA 1ITQA 1KTCA 1XPYA 4JX4A 2Y24A 2A2IA 2OEMA 1XISA 3W7LA 2X2YA 4S3FA 2OSXA 4ZR8A 4HZ7A 3RO6A 4PUEA 4AD4A 1SFLA 1UPPA 5BRQA 5KETA 3W86A 1M01A 3KAOA 2PDQA 7REQB 1DV7A 3STGA 1UG6A 1Z3NA 1VFMA 5KSWA 5CC7A 3L5MA 3HTWA 5BW6A 2WSPA 4QS6A 2I9UA 4N9EA 3THDA 1WX0A 2QV5A 1NF0A 3PTQA 1C29A 1CGVA 3QY7A 3UZJA 4F0LA 2VZVA 4P8VA 1BF2A 3LM3A 2YB1A 3M07A 4KMQA 3GLCA 1QAPA 1U1HA 3QHMA 4RPPA 4HB7A 1BQCA 3TMLA 2IQTA 3DC0A 1PXGA 2WQPA 2OJPA 4B3KA 1V4YA 3TYAA 1NWTA 3B4UA 1PKMA 4FXRA 1JNEA 1EXBA 5LHEA 2GPTA 1EJUC 2WAGA 3MV11 5ABGA 2YLLA 3MPGA 3AMLA 2FB3A 2I57A 4IXXA 4M56A 1TV7A 2QPUA 3VIFA 2WKLA 3CASA 1ZBVA 2OX1A 2F2HA 2AL2B 1OWQA 2DSUA 1DWHM 1JPKA 3VKKA 5CPSA 1Z32X 1CGYA 1GJPA 2BXZA 4B4FA 3E2SA 5HWNA 2PWVA 4E8DA 3EOSA 4UTJA 1JZ3A 3F2BA 4PYSA 4FXJA 1EJ7L 4GQBA 2PGFA 3F7JA 2ZZ2A 3W6LA 3BANA 3VZXA 3RO8A 3SADA 4H6EA 2RHGA 4AXKA 2J7CA 3DZ1A 2WNNA 2ZQ0A 5KZEA 4JOMA 1KXVA 4GUHA 1OYCA 2EPHA 4QAWA 4WY0A 3I4KA 3SGZA 1XYLA 1QNPA 1CXHA 4CD5A 3WK3A 4M81A 2V38A 2X40A 3SAZA 2YGYA 3W22A 3S42A 2PC8A 1XFBA 4YYCA 1TCMA 2ZZ4A 2VURA 3GFZA 3PN8A 4WZHA 1OG0A 3CUZA 8RUCA 4UNIA 3H12A 3K8MA 2C0HA 1F74A 1FDZA 4FNSA 3LLXA 4QITA 1Q4WA 3A23A 1NSJA 1JZ8A 1ISWA 1G4EA 3UXIA 4AD0A 3G6LA 2V2DA 3EMCA 5FF2A 2PC4A 2HSAA 4QX4A 1FCQA 2ZZ7A 4O57A 4O16A 2OEKA 3PAJA 2X7WA 3NPXA 1XDJA 3TC7A 1LWHA 4Z42C 1XLLA 3ZM8A 3F4DA 4OOZA 4Z1CA 3UERA 4GIEA 1E9IA 1Z48A 3N2BA 4OT7A 2X16A 1UP2A 1XC4A 5CC5A 3LRLA 4JIHA 1TR1A 3QN3A 3LX9A 4F9DA 1YPIA 3NO3A 1P7TB 3M43A 1CB7B 3A3XA 4E38A 3E0VA 5K9CA 3PULA 4MPKA 4EAYA 1UD3A 4OFCA 4ZENA 2W91A 2Y5SA 4PUUA 4AD3A 3ANUA 4PZVA 3URNA 1QWGA 1PKNA 4RDZA 1V6TA 1AW5A 4HKPA 3C2RA 1ME9A 1Q65A 1A0EA 3QKZA 3MWCA 3R6IA 2ONEA 2GSEA 1NF7A 2ZA3A 3WF0A 1XP3A 2WCAA 2Q01A 4JKMA 1KFKA 3AIUA 1KFJA 2QUMA 2PE4A 1QTWA 3FYOA 4BEQA 1E6XM 4AYSA 1E70M 3WUEA 4Y6GA 1RLCL 3K13A 1W8SA 4PFMA 4AVFA 1EYWA 3PP7A 3GAYA 5D2TA 5I3HA 5IOBA 4JKKA 2ZFAA 4EXQA 3CUFA 5HWJA 5ABFA 3EWWA 3BAYA 4YPJA 3WZ0E 2ZWYA 4V27A 5CSUA 5JH1A 3WEMA 2BWGA 3VIJA 1GQJA 1Z6KA 2ZUUA 2G4JA 3ALFA 1RY0A 3R8RA 3XIMA 4JNMA 3LM7A 1UR8A 1NOWA 4PA8A 4B5WA 4IMEA 3STPA 1A5LC 1GW9A 2V3DA 3MO4A 4WOQA 3WNKA 5KINA 5AN7A 1PIGA 2QJNA 3INPA 3QZEA 3OVQA 3OLGA 4HYRA 3WLOA 5FESA 2YOCA 3CT2A 2A6NA 2ISFA 3TYDA 5HQMA 3K5XA 3VFLA 3CH0A 1M65A 2CZDA 3CQHA 1ZY9A 1BQGA 1CDGA 1WKYA 1XLCA 1PIIA 2ALDA 5C2XA 2PDUA 5LIXX 3QOKA 3UNTA 3LZ3A 1TZ9A 2ZDRA 3QQ1A 2A1YA 2QDGA 4PGLA 2Y5JA 1TRIA 2X1TA 5HUPA 3WBYA 3ICJA 3BAJA 5F1UA 1SGJA 5AFDA 2FJKA 4ORMA 5IFTA 4JTQA 4LCQA 1UIPA 1EEPA 2P10A 3GHUA 2V3FA 2NVAA 3VDAA 3ANVA 3P2VA 2YCIX 3NZGA 3DEQA 3EX1A 3TJ4A 5K4XA 3GXPA 4PBGA 4IM4A 4Q4OA 5E5CA 4U28A 3SO7A 3UWYA 3TNBA 3PPHA 2QCFA 3VE9A 3WDQA 3OO2A 2Q3OA 3R11A 1SZFA 5A2CA 1Q6FA 3M1ZA 1QI5A 3G1SA 3M46A 4ADUA 4K36A 5HR7A 4DUXA 3K8KA 4GXWA 1JFHA 3POHA 3P7YA 5DCEA 4G1KA 3QGVA 1V77A 5D8ZA 3BUVA 4LBUA 3DG7A 1Y5WA 1RP8A 1E51A 1TUXA 1CNVA 2RDUA 1AL8A 1Q6LA 3CV6A 2QXWA 1CENA 3CK5A 2OFJA 4JIPA 5HR6A 5E6YA 2PI6A 5U7SA 4RE2A 1X8FA 4L4OA 3S5ZA 2WANA 1OADA 2W6RA 3WJZA 1ECQA 4EPBC 4DLFA 1LRQA 2Q02A 5TBOA 1S3HA 4XD4A 1VZWA 1YYAA 2YXXA 1EA9C 1V7YA 5TQLA 1FKWA 1OT1A 4K6AA 3M4HA 2X0YA 4MJ2A 2QCDA 4PCTA 2O9RA 4RDWA 3RHGA 1IYXA 5A6SA 3N4AA 2ZX6A 3VAVA 3C56A 2PTZA 1TE1A 2BOEX 4HK5A 4H04A 4KWUA 1OFRA 1S5MA 1KFBA 1XBYA 2O9PA 2Y62A 3ITXA 4F0RA 1H09A 4A3UA 1OC6A 3TTQA 2PCEA 3T4WA 3WLPA 1QNOA 1LUCA 3UWVA 4ILSA 2EPLX 3DHPA 2ISDA 3LTSA 3KRUA 5I09A 5C71A 2V2CA 1BD0A 1H49A 2Z1XA 1SZEA 1S2WA 2YBVA 3M6DA 4YIWA 3H4WA 2EJ1A 4AX7A 1ZENA 3GHSA 3QFEA 4B15A 3RK8A 2OT1A 3CUHA 3B0XA 1NJJA 3P5ZA 1G5AA 4ZMGA 1HT6A 3GE7A 3OGVA 1DWJM 4A4AA 2Z25A 3RLGA 4JYEA 3PTKA 4B2DD 4MVAA 2QS8A 2NXGA 3MS8A 3A5VA 1UMYA 3OGRA 1MEHA 3RG6A 7XIMA 4K1WA 4XZLX 5HJXA 4UOQA 4O10A 4IMFA 1TJPA 1JF5A 3OTRA 3HU7A 1WBJA 4EPDC 3KOFA 4I8YA 1W5MA 3IVUA 3HV8A 5AOUA 3HM7A 1U5JA 1FWJC 4ZE4A 3GB6A 3OA3A 5CEWA 1BVNP 1GVFA 1H63A 1PYMA 1F8IA 5D38A 4OVXA 1NWRA 3NOYA 1MEWA 4NJGA 1AW1A 1UKQA 1EFZA 2DY3A 1MW2A 1L6GA 4HVXA 1OK4A 3MP5A 3FNDA 4BI7A 1XUUA 3A9IA 4M1RA 2F61A 4ERIA 3TSBA 1JZ5A 4DQWA 3F4NA 3K46A 3B0YA 3KVLA 3G0UA 4A22A 3WQOA 1AJ0A 3C2FA 4FP1A 4KS0A 5E9AA 3W1NA 4GO8A 3SUWA 3DHDA 2XTKA 4OBSA 1W5OA 3T55A 1ME7A 3BLDA 3F4VA 4KW2A 4S2CA 3NDZA 1O66A 3S2NA 3MMUA 1ZP4A 4MG4A 5DT5A 2Z2UA 5DXYA 1EC7A 3R10A 1Q4NX 2JIEA 4H9ZA 5EMKA 3WDRA 1CB2A 4BY3A 4HA1A 1VBJA 5EA9A 1K6AA 1DHKA 2VC9A 3B8SA 3TROA 2B7PA 3S1XA 4MY9A 4WR3A 3WQCA 2D2GA 3MW7A 2ACRA 4E4FA 3NM3A 4XAGA 1EQPA 3SCRA 3VOGA 4OV4A 3QC3A 1WKFA 3PB0A 4OQVA 4R88A 4IQDA 2Z27A 3VK5A 1HVQA 4OBRA 2BG5A 2XVPA 4RZ6A 4Q8WA 1FXQA 4DF0A 4PSPA 3W1TA 3QY8A 1CEOA 3FDGA 4AG0A 3A22A 3FXGA 3M7WA 3UJFA 1OCNA 4Q8UA 1AJZA 3VD7A 5ECVA 3GDTA 5M03A 3TTYA 1H61A 5IHRA 3IJ7A 3WH5A 4UTLA 1H1ZA 3VM5A 3DFOA 2FDMA 2V69A 1ZAHA 3GR4A 1S2CA 3TSMA 4UZSA 1IEIA 3MDUA 3S8HA 3ZVHA 1A5UA 4GGHA 1ZAJA 2ZVIA 1I0DA 1FY6A 4O53A 4QS5A 3PPGA 3W74A 1A5KC 4KESA 4FO4A 1LCOA 2EPKX 1TSIA 2YDAA 5DY3A 4HA4A 5B7ZA 1AK5A 3UWWA 3IS4A 1Z8AA 1SUXA 2V6AA 2WKJA 3BOXA 3U0HA 4O0ZA 2OKOA 1WOBA 2QUUA 1C7TA 1XIFA 3SCSA 2Z0IA 1W3JA 2QT3A 4MWAA 4CCDA 3H4GA 1W9PA 2PDPA 4H9VA 5LNSA 3VD4A 4FK9A 3EXRA 1KV5A 1JPDX 4ZOAA 3RM9A 1WAWA 4ZFMA 3SB0A 3H4XA 1IR1A 1QI2A 3V1HA 4GJJA 1O94A 1TELA 4GX8A 1CCWB 4WDWA 4QISA 4UTMA 1E43A 1V6WA 1IWPA 2V9DA 3LU2A 3W1QA 2CHRA 1J2WA 4XISA 3S46A 2W66A 3GDKA 1FHDA 1TJ0A 3HG4A 5A8MA 4J2MA 1AQHA 1XS2A 3WD4A 1VEOA 2ZC1A 2HVMA 4RW5A 4FXSA 1OX5A 1OK6A 4M6VA 4L6OA 1EH9A 2ZWZA 5CPTA 3BGAA 3IPWA 3NQ8A 3ZWTA 5DN1A 1T6MA 2QCNA 3VMNA 5DBUA 3HA1A 1S3TC 3NQCA 3WX7A 3IK4A 3S9ZA 5CH9A 1EJXC 1XWYA 3EXTA 3MA8A 4AIBA 4HSNA 1KGXA 3AMKA 5XIAA 1JI1A 3SR7A 1XRVA 1CLKA 1DP0A 1I9CB 1DJNA 4PUDA 2RH9A 2OG9A 2D0HA 1SO3A 2ZXQA 3CHEA 3PF3A 2PDGA 1LRTA 2OWXA 4AWEA 4ROQA 2VCAA 4GQQA 1UBPC 4K2SA 1UD2A 1O1HA 4WHBA 2Z24A 1P4CA 4UFIA 4RZ5A 3FLUA 1GKQA 3AYTA 2C16A 2OYKA 3WD1A 2EJAA 3R8GA 1OHLA 1V03A 4MYXA 2R1PA 1ECEA 1V3HA 3KW3A 2O7QA 1I2QA 3WD3A 1EJSC 2NV2A 3F1QA 1WXJA 4RDYA 5MKGA 2CKRA 3I3EA 1TA3B 5CZTA 3AU6A 2PBGA 1Z44A 4KQNA 2QAFA 1R86A 1VEMA 2NV1A 1XIIA 2CEQA 2EAWA 4FALA 2XDFA 3N13A 3WFLA 3T09A 3W37A 4JQ4A 2IXVA 1GT8A 2VWSA 4JAWA 3SUUA 5FEZA 1G67A 1NDWA 2CU0A 4MNMA 3I6RA 1LQ0A 4RJEA 2PTDA 2QJHA 5CZSA 2AQWA 2Y1HA 3MU7A 4OE7A 3KOWA 1Q5MA 2DJLA 2J7GA 3A4AA 2AAMA 4O4WA 1GNXA 1ZBWA 2Q8ZA 4EPEC 3IACA 3POCA 5DMMA 4JFUA 2NVCA 1P6BA 4I9TA 4MWAE 4MHBA 5U4NA 2PDNA 5AVNA 1UH4A 1XLKA 3ARSA 1QU4A 3EPMA 2BNJA 4MLRA 3AC0A 1O1ZA 4QCEA 4LBSA 3G0XA 3N04A 4IGSA 1BTCA 2FMNA 3PJXA 1GQLA 4C6LA 5LIWX 2VC7A 3PTMA 1TX2A 3IVSA 5AHEA 2P5NA 3TQKA 3GBDA 3R13A 2HRWA 1ZTVA 3P84A 4DAFA 4Q7BA 4KRZA 4U3AA 4I9AA 4LCRA 2QPSA 1VFUA 1YDYA 3BAWA 1XIDA 4ZTXA 1LLZA 3IIPA 4M19A 3WQVA 3B0VC 3CB3A 2AAAA 2C71A 2OO6A 1R87A 1EYEA 3B9DA 1PYFA 2FZBA 1KB3A 5LSMA 2E67A 3QM3A 1K3UA 3MQTA 2D73A 1LRNA 1ZRQA 2DORA 1O5QA 2TYSA 5TD4A 3VIMA 4P7LA 3DFNA 2WSRA 4C6MA 4AMCA 3RDKA 3NGJA 5JXQA 5HPCA 1X1NA 1W2PA 4HA3A 3THUA 2WLZA 3CO8A 4QEEA 2GJRA 3C52A 4I8DA 4AY1A 3LS9A 2A3HA 1BHGA 4ZE5A 4NQ1A 3EMZA 5REQB 3WNLA 1XLJA 4WF7A 4QTGA 4GYFA 4F2UA 3QR1A 4C6PA 1R0MA 3N11A 3PZGA 1H7XA 3VX1A 4YTTA 5DMYA 1VB9A 2Y85A 1X96A 3NQMA 2WCSA 1KRBC 4PMJA 1XLGA 2DZUA 4JPGA 4REQB 1M53A 3BTNA 1VH7A 3SRHA 1LOLA 3LPPA 3E49A 4DWSC 2E0PA 1KNWA 1NIUA 3CJPA 4HD5A 1A49A 5CSSA 3GHTA 4LUTB 4DWSB 8CGTA 1EP3A 4HHHA 4N02A 5H2ZA 9XIMA 1XM3A 2ZX9A 2W5FA 1SMAA 3VKCA 2P8CA 2R1LA 1XLIA 1UMLA 4E2OA 1UZ1A 2C19A 2MNRA 3P80A 5C2CA 3AHYA 5AVHA 4S1FA 3NQ7A 1SFTA 3KOXA 4HK6A 2YKKA 3IJ9A 1FHVA 1NQ6A 4EACA 1SQ7A 2FPVA 4JZ5A 2G37A 1D7FA 3G3DA 1ODUA 4AWUA 7PTDA 1B0IA 3CHVA 4C5ZA 2A3LA 3KM8A 2X2GA 4AW7A 1SSGA 2TODA 4GACA 4LY4A 1LL6A 4F0KA 4L4MA 3S3GA 4LB3A 3PS7A 1ZJIA 1VPXA 3AJXA 4IMDA 2VRKA 2QDEA 4Y9NA 3OVRA 2J62A 3U2EA 4O28A 1NP2A 3IEBA 1VFOA 2QGYA 3FJ4A 1CGXA 5F1VA 1GOOA 4L4LA 2PMQA 3LLFA 2IKJA 3NPUA 4WUIA 1P1MA 5CC6A 3TCEA 2IPWA 3N15A 2PGRA 2G3NA 3WLHA 1J93A 2XFRA 1MSSA 1JCTA 4PH6A 2FVLA 1GKRA 1RH9A 5I5RA 3M5VA 5HA7A 2XN2A 2OZ3A 2WZMA 1JPMA 1HQTA 4MJ4A 3VA8A 1FWRA 3CMGA 4M8UA 3QW3A 4XUGA 3HFYA 2DFAA 1TVNA 4YNGA 3U48A 4DJDA 4NUWA 3NDYA 4NZCA 3UWZA 5LA0A 2PB1A 2W79A 2GZXA 4PCNA 3C2YA 1A5CA 4NP7A 5C2GA 3HGJA 3G0SA 4LUSA 4G7EA 3VNYA 5FD0A 1DIOA 2OSWA 3WUFA 3DHFA 3H23A 4O11A 1K9EA 5A5WA 1G9HA 4CUCA 3VXGA 2ZCGA 3CZJA 3REQA 3W26A 3CL8A 3N4EA 3ERPA 2PDIA 3T05A 1NOFA 2D20A 3UU0A 2JKAA 4KWVA 2TAAA 3WJYA 3TMQA 3WBWA 4BQ2A 4LH8A 4UMAA 4ZO7A 3CV2A 4TUFA 2ZIDA 1E5NA 3DUGA 2OKTA 1GOWA 4NYYA 1FH9A 1CGUA 4CD6A 3F03K 1QK0A 3CYVA 4I6KA 3MSGA 2EPMX 4MNJA 3SQSA 5A94A 2DPEA 2V5KA 4GCAA 5BXTA 3GG0A 2QJMA 2E5DA 3WK0A 1M03A 5I3FA 4QR6A 1PAMA 3LRMA 5FSDC 5CJMA 4TOQA 6CGTA 2G4FA 3ITCA 1DEDA 3M0IA 4PB5A 3LGDA 1DXIA 1VRDA 3F2DA 2Z1WA 1X8CA 1TUFA 3GK0A 1WCGA 2Z4GA 3C3NA 3KLLA 3LCFA 1XYZA 5A6KA 4LAUA 3SRKA 2ZA2A 2OX4A 1F6PA 1UJQA 2NZLA 3KTSA 2Z7GA 1TCDA 5AYZA 1QT1A 4KCWA 2BSLA 4GUGA 4HPNA 3THAA 4O4VA 1JQVA 1U30A 2JALA 2BLEA 4BF7A 1ISYA 4P7OA 2QKFA 3ZR6A 4MB1A 3MUIA 4AEFA 1KCLA 1VYSX 1DJHA 2DT2A 3W01A 1W1PA 5EL1A 3ENLA 4C65A 5FEWA 1FWCC 3MC5A 4TR9A 1U83A 2QW5A 2BS9A 1UUOA 3VNDA 2AKZA 5DCBA 3NPWA 1BLIA 1JGMA 2NT0A 3RR4A 4IJBA 7TAAA 1S2UA 4PE8A 4Y2WA 1UZDA 3W7DA 1X7FA 2WZIA 1QI0A 3KS6A 4CLMA 4F0SA 1A0DA 3UXLA 4G1NA 1Q63A 1A4MA 4GC4A 3A47A 3VUSA 2VXNA 1YXYA 4IPIA 2WO5A 3L65A 5I06A 4GGBA 3GU1A 1F76A 5D2WA 4DEFA 2BHUA 3G5EA 3NYDA 3KEHA 5FACA 3ABOA 5C55A 2DH3A 3OBAA 2E3ZA 1HKWA 4H9TA 3OOQA 4HU8A 2O7SA 3MSRA 1V0KA 2YCKX 3VOHA 3C0QA 3L2LA 4I7WA 3VIOA 1TB3A 4IX2A 3E12A 3M0YA 2FGLA 1OD0A 1YBQB 1HGWA 3GO2A 4LYKA 2HVNA 4B90A 1ZAIA 5F2IA 5GPRA 2CHOA 4ACYA 4E2VA 1V0MA 3GXTA 2QQ6A 5CGQA 5CPNA 3F5KA 2NUWA 3KL5A 3CIVA 3UG8A 2WJFA 2ATMA 3D5HA 1JAKA 1VRXA 4S3JA 4N9DA 4DJFA 1UR1A 3Q45A 1TTIA 4PULA 2JGQA 2P88A 3FDKA 3H22A 1VJZA 3GVGA 5FKYA 1UH3A 3NQDA 1XICA 1B3ZA 4GX9A 3FAWA 5LGXA 2GDQA 1UZ4A 1KLYA 3SZ8A 2PRMA 3TNOA 3XINA 3R94A 5DLCA 5HUOA 3V1PA 1TQXA 3W27A 3CZLA 3SSJA 1HO4A 4IJRA 4NIRA 1XRSA 1BAGA 1HF6A 1A50A 1ZBCA 3M5YA 1Q8AA 4RR4A 4QG9A 1K1DA 1QNRA 3GBEA 3CTLA 3EX3A 2IPGA 1CX9A 2QZRA 4ATLA 3I3BA 4JL2A 3B8TA 4XD5A 3VO0A 1JIBA 3CUJA 3AMGA 2VT0A 1UYQA 3T8QA 1KM6A 4UMCA 4R7JA 1H0GA 3QMRA 4QE5A 3KCJA 9XIAA 3QHOA 1RCQA 3BAKA 3QLDA 3KXQA 2O55A 1QI3A 5CG7A 3DG3A 4IQJA 3TFXA 3HPZA 4O52A 3BG3A 4B5XA 3GYCA 4NT0A 3WQ4A 2PP0A 2A6LA 3AUOA 3GD6A 3PZ9A 5HMDA 1FWFC 4FR1A 1W3TA 3O3RA 4UTWC 2JE8A 3BJTA 3SBFA 1A5OC 3NQBA 2GWNA 2Z1BA 2AL2A 1JZ7A 1XXXA 2WSKA 4UMBA 4XZWA 4NJJA 1DVJA 3W3OA 1OGBA 1IQ8A 2DQWA 3P8JA 4ZL1A 1T0OA 1FWSA 2HQAA 3E0IA 5G2IA 4AZ6A 1XQLA 2D24A 3GG1A 2IKGA 1MMFA 4TTGA 4C6CA 4H00A 1E71M 3FV9A 1AVAA 3LCXA 3VABA 3QGAC 4QLJA 4JR5A 1IR2A 3ARVA 4KWOA 3OEXA 4Z17A 4Z2IA 1S46A 3BH4A 3I10A 3PAOA 1EP1A 2AKMA 3GC2A 3AS0A 5BXRA 3EDJA 3PBMA 2FH8A 1GVIA 4NX5A 4NKCA 3AXIA 3WH8A 1K4GA 4N4PA 4MB3A 4M24A 4G8TA 3NL6A 3BCJA 5FA5A 1RP9A 3PPFA 3PFRA 2AQOA 4C1NB 2PFHA 5EKYA 1EGMA 1E6ZA 4NNBA 1SM9A 1IT7A 9CGTA 3N3MA 8TIMA 3B9NA 2WMIB 1Q6CA 3I7RA 4FEZA 4LPCA 2VR4A 4ZA0A 3B8VA 4JL1A 3WQEA 4CKQA 1VJIA 4JTRA 4KPLA 3COTA 3MO7A 2CPUA 3IUHA 1C8VA 1Q6GA 3PJTA 4ORIA 4TV5A 4N6FA 2P3ZA 3JZUA 1V6XA 1ZU8A 3UF9A 3L21A 2YB4A 1KM3A 3B40A 1R9YA 2VEPA 1RQEA 1IT0A 3M0LA 1QW8A 3NJ3A 2PPGA 4QGCA 2E6AA 3E0LA 1KFEA 2F6UA 1P7TA 3LCLA 3UYIA 3L4UA 5HJLA 1G4SA 1SJBA 3V75A 4E0CA 3ALGA 3H2FA 5M2FX 1Z42A 3RPDA 5LYRA 4DF2A 3P81A 2PBOA 5D32A 4GIYA 3E6EA 3EB2A 4HA0A 4V15A 5H8PA 1LZOA 3SRFA 1RV8A 2GVGA 3O2LA 4HNOA 3DC8A 3L68A 4Z2GA 5DANA 1HO1A 5DRIA 4QCFA 1SR9A 1J0YA 1EC8A 5HMEA 1TR9A 2OZ8A 1F8MA 4YHGA 3OQEA 3MVTA 5JBDA 3L5AA 4H6KA 4F0MA 3UG4A 3EX4A 3MWAA 3F4CA 3TE9A 1NFBA 1JZ4A 4MFDA 1OVDA 4Y90A 5CBIA 4OECA 4XIAA 1BWLA 3TONA 3PPCA 4N0RA 2W63A 3WLMA 3S6DA 2PLKA 4HMDA 2QDDA 3FAXA 1KR1A 2IPFA 1QXLA 3N19B 2ZVRA 1UUMA 2WVTA 1V5XA 2PDMA 1UA3A 4GZIA 1RJPA 3LXBA 3HJZA 4ONVA 3IIVA 3SGGA 1VAHA 4X22A 1SO6A 2PWFA 3QY6A 1Z41A 3GTNA 6PTDA 3S5NA 3R5EA 3IIXA 4K37A 3AUJA 3QV8A 4MZYA 3GXNA 3GFXA 4W4QA 2INEA 3VX0A 2R94A 3BGJA 3CL6A 1H60A 4EAMA 2NXIA 1FWTA 1KRAC 1F4HA 3WF3A 1WV2A 2X30A 1PKLA 2V63A 3MTWA 1A47A 4QG6A 4M29A 2ZA1A 1JCNA 1QOQA 3ABQA 5TNVA 3HFTA 3SCTA 2VMFA 2FZMA 2JFEX 1GOKA 1QR7A 5J5DA 3MMWA 4LEQA 1C8XA 5T8GA 2REQB 4NL1A 4NZJA 2O9TA 1W1A1 3NQVA 4GKLA 3U9IA 4C6EA 3KBJA 5BMXA 4DI8A 1TWWA 4GJIA 1DYSA 2X42A 6TIMA 4N7QA 1J79A 4NAFB 4AEEA 4ZXLA 2AL1A 3MP4A 4K38A 5KTLA 4HMEA 1V02A 2HEJA 1EHAA 4YVXA 2YZRA 2VUYA 1QO2A 3GXFA 3TN3A 4V28A 5J5RA 3STCA 4JTGA 1KCZA 4EWND 4XZBA 2VM8A 4LTSA 1E5JA 2ZC8A 5L9FA 3PZVA 3PG9A 4Q32A 2HV5A 5D9NA 2FDSA 1MXDA 3CWOX 4Q4RA 1MYRA 4AIUA 4ZB2A 4U4MA 1I0BA 2ZX8A 1YTKA 2GUUA 5K3VA 4JTDA 1WDWA 2Y8UA 3SCWA 2FPYA 3LLDA 4YLWA 4LVFA 1E56A 3EDEA 3OJGA 2CWXA 4LEFA 3SCUA 4AZ7A 4B9ZA 1TMQA 4X0VA 1AZ1A 1EWEA 4L64A 5C5YA 5I3GA 1LF1A 1PX8A 3UP8A 3BW4A 2XGIA 3KCLA 2YLAA 4LVBA 1Q6DA 2YW3A 4O1EA 3NR0A 1F3TA 5I00A 2H9AB 4ES4A 1JCYA 1N7KA 3WQ8A 5CLTA 5FJRA 2OGJA 4DIAA 3G1RA 1TTQA 3UWUA 4O1DA 4D9PA 3E74A 1FWNA 1V08A 3GNOA 1NVMA 4HTBA 3B8DA 3WQFA 1YTDA 1UW9A 3EBVA 3H2CA 3VMOA 2ATSA 1TWDA 2R8WA 2J7DA 2GQ3A 4WJXA 1MW3A 1TPWA 3N6HA 4UTTC 3S2JA 4PCPA 3L12A 1ITUA 2RUSA 2B7OA 1QFEA 4PB3A 3PZOA 4E8CA 3URQA 3S5OA 5CSYA 1AL7A 3EA3A 3O05A 3E5BA 3UWQA 2DW7A 3E2QA 3ABSA 3W84A 3G2GA 5SWUA 4XWUA 1B9BA 1E55A 1FXPA 5ENLA 2V30A 2FHCA 3FVMA 4XBSA 4US5A 1H5YA 4XVDA 1VIWA 3VPLA 2DZPA 2RAGA 3UGRA 2DZVA 1ICQA 2WWDA 2LLEA 1JDFA 3MI3A 2PDWA 1KLZA 2ABAA 1NU5A 4L1WA 1PTAA 2ZRVA 2BFGA 2WK2A 5LZLA 1RPKA 3GDBA 2FHFA 4PMDA 3AALA 4RV8A 1EIBA 1IEQA 3RMEA 1UB3A 3R12A 3W7MA 3WMCA 5HJYA 1B3XA 4V1XA 2ZBTA 3ZSTA 3UW6A 4D6CA 4YL2A 4QM1A 2CLFA 1S1PA 4QNWA 4TMBA 3DFYA 4D72A 1WZAA 4UWMA 2E09A 1PCWA 1XW8A 4W9TA 2WB5A 1QVBA 1V02E 4HYVA 3ZT7A 2B0MA 2CETA 3HPFA 3AYRA 4C5YA 5EFDA 1CI1A 4KIRA 1MNZA 2PWHA 2CNCA 3NZPA 1MXSA 3ARTA 1RK5A 1FHUA 3MUZ1 3GKFA 2FVMA 1VYRA 1R38A 5GNYA 3L4TA 3QEZA 5C6MA 2VI0A 3WFAA 4BI5A 4GINA 3IGSA 2ISWA 4LSBA 3W6MA 4O17A 3FOKA 1EBHA 1F9CA 3T44A 1US0A 2PUZA 1V3IA 1FCVA 3WL1A 1VFSA 4GYPC 1OFOA 1XFCA 1BYBA 4NNCA 2H8ZA 4MZ8A 1IIGA 3KZSA 1Q6QA 3SURA 5K2ZA 5EMUA 2OZTA 3OVGA 1K70A 2QVHA 4HN8A 3RX2A 1D7KA 4O18A 2QMKA 3WH7A 4UQAA 4H7CA 4AQLA 1MUMA 4UQEA 4HHLA 3T2QA 3NL3A 5D09A 2VX7A 5A8PA 3ZSSA 3AICA 3NEVA 1K7FA 4XTDA 4A8IA 1I6NA 1UKSA 4WLCA 3PUOA 3IAPA 1DJYA 1TKKA 3IJ6A 3W1AA 2H3BA 5A8GA 1R3WA 2E9BA 1JNDA 3QKEA 2FFCA 3UY8A 4PTVA 2B7NA 1F3EA 5F7UA 1TPH1 2DZBA 4Q3MA 1U1JA 5MKGB 1LG2A 1BEUA 1KR0A 4GH3A 1DKWA 3VNLA 4HNLA 1VFFA 3C0LA 3NZQA 1X6UA 2VELA 4GZJA 3WJXA 1GVOA 2OPJA 1GGOA 1O68A 2OOFA 2NWSA 3PSVA 3BG9A 5JH2A 2PLJA 3M44A 3ZJKA 2DP3A 1E6SM 1B90A 4J35A 2PTXA 4S3KA 1PDYA 1XG3A 4MWAD 2QMJA 1TTJA 2VEGA 3GDRA 4HPHA 1FOBA 4LS1A 3W9ZA 2CBJA 4QE4A 1Q66A 4Y9OA 5GNXA 3BMXA 3PUEA 2R1NA 2YDRA 3ZOAA 5ABTA 3LENA 2ACQA 2PDKA 4LGXA 1FQ0A 3H26A 4DZIA 4AF0B 2GGHA 1OYBA 3DXIA 4S23A 1HGYA 4PL1A 2PWDA 2XN0A 3W2KA 2XSXA 4GYKA 3W81A 3V0TA 5AC7A 2XHYA 1WDSA 4MSSA 1YQ2A 3A4WA 5LNWA 3D3FA 1F3XA 3C2VA 4MUZA 5FEXA 1UBSA 1UWIA 1TMHA 1M04A 4KGJA 1M1BA 3S1VA 3A13A 5TF0A 4GMEA 1WZLA 1E9LA 3S5YA 1UD5A 4M6UA 4UR8A 4ICMA 1I2PA 4EVZA 1VFHA 4MGGA 1H7OA 1V79A 3QH2A 4FX6M 4PBFA 3FY1A 3HQNA 1SW3A 3M0VA 1J8VA 3N25A 4DNMA 3MB9A 2FB2A 5DCDA 2WNZA 1BGGA 4M51A 3W7RA 5AC4A 1F2JA 3CIWA 3LQLA 2W61A 5HNNA 1PJ9A 4FMVA 1O6IA 3VILA 4JIEA 4DO5A 2PTYA 4C6NA 1ISVA 1JXKA 1RAKA 1XYMA 1V7AA 1RALA 5CXPA 3K4DA 4HU0A 1DJGA 2XISA 3W1MA 4DRSA 1P43A 2VD8A 2J9YA 2PTWA 3LERA 3WNPA 1KWKA 4MIMA 1DWAM 3GYEA 3H24A 3DYPA 1EJTC 1V3MA 5I24A 4AUBA 4JYDA 5C54A 2VZSA 1PB0A 2FZ9A 3O16A 1WDQA 1ZNNA 5M3WA 4W5ZA 3LQGA 4GI4A 1J0HA 2QVNA 3Q4DA 3PWIA 1PTDA 2CXEA 2V3GA 2VX5A 4R5EA 3LSBA 1UQYA 3B8UA 3HPAA 3SCNA 3GIQA 1VHNA 1OFEA 1OZQA 1HJWA 1N8WA 3PVFA 4DO4A 3B4YA 3BLIA 2OQHA 3QZAA 1OGGA 4JX6A 4FX7A 3IWPA 1PSCA 4DJEC 2TPSA 4Q7NA 3AQUA 4L4PA 1VBGA 1TA3A 3MHUA 3W29A 3LK6A 2V8ZA 3VINA 5F2LA 5CBJA 2V2HA 2XZ7A 3MMTA 2ZZ5A 3W28A 3W23A 3EB4A 1SW7A 1ME8A 1FDJA 2G41A 2XIQA 3L0KA 3QMTA 3GSMA 1W1YA 3TQPA 3WLJA 2Q09A 3IJDA 2CBIA 1OY0A 3RAOA 4HCLA 1R9XA 5F4XA 4FAMA 3KRZA 5HULA 5CCZA 4TXEA 3DECA 5BWFA 3VKJA 2DSZA 4KEVA 2GJPA 2ODOA 2HPIA 3K1GA 2W4XA 4ROPA 1E0TA 1B54A 3AS1A 5A6BA 5D33A 3UVAA 3G77A 3AXHA 3EOOA 3P3BA 1W54A 3W1PA 1CXLA 1RZMA 5IDZA 1NWUA 4PMRA 3SCQA 4K7VA 2GVJA 3BG5A 3VOIA 2E1DA 3AHXA 3VIPA 3VGHA 2HWGA 5JUVA 1OFPA 3P6LA 5IM51 2WBKA 2YDQA 3IJLA 1TJ1A 3MBFA 3WUGA 3ITVA 4W8AA 4LB4A 1XX1A 2I5GA 3NGFA 1GVSA 2GSHA 2NW0A 2WBGA 2QJJA 2V82A 1BWKA 4MY8A 1D8CA 4U5IA 1AH3A 1G4PA 2VZOA 5CC3A 3LHTA 1RCXB 1G01A 2CLMA 2A4AA 4Q6XA 3LHUA 4GY1A 3I68A 1JCJA 1EJRC 4PTDA 5CPQA 1XD1A 1TIMA 1RPXA 2IXUA 1POKA 2D0GA 2VTFA 3UCCA 4NX0A 4WEVX 4IX0A 4FF7A 3AIBA 4LC8A 4S3EA 3HGRA 3LNPA 2HCVA 3RLHA 3FSTA 5FJTA 4GXPA 3E0FA 2E5CA 3T07A 3CLMA 1B3OA 3FA5A 3UR5A 4F9JA 5REQA 4LC6A 4GI8A 3UETA 1CGWA 3CUGA 4B4HA 2ZRWA 3QPZA 4NZ4A 1LOSA 1V8EA 3VDGA 3TWAA 4GFSA 2DZXA 2V5BA 4YTRA 3OG3A 5KMYA 4RK8A 4X63A 3OG2A 3WQ5A 1HTIA 3WELA 2NQZA 3L4XA 3IANA 3WIJA 3IIZA 4L1XA 3KBNA 4M82A 3G8EA 3APTA 3H6OA 2XWDA 3PBYA 4LT9A 4MADA 3GZAA 3HO8A 4FS9A 4REQA 2ZRZA 4K39A 1R8LA 3USZA 3FHAA 4JY9A 2G3MA 3ARQA 3QPEA 2G3JA 5GQBA 3GZ3A 1D3GA 4LUTA 1EUAA 4DWSA 4FLQA 1IF2A 4IMCA 3MY9A 3M0HA 4PRWA 4H8UA 3GXIA 3KHJA 4FZIA 4FA3A 3QBUA 4F48A 2YPIA 4WK9A 3N2CA 7TIMA 3HURA 2CLKA 3QC0A 1YHTA 3OU8A 5JBFA 4Q4PA 3G1YA 1CXFA 1EWDA 1CXEA 3TR9A 4BHYA 3URAA 1CGTA 2CLOA 3FYPA 4IT1A 1X7IA 3LPGA 3W7QA 3RFAA 2Y6ZA 3ABXA 1ONRA 1ZJBA 3ECQA 3ARPA 3VFCA 5C70A 3VIKA 1RBOB 1WNOA 2YJQA 5FAJA 2HMCA 2ZYFA 4NAEB 3VNMA 2DEPA 4DF1A 4EE9A 4U5KA 4C60A 4QFUA 4DJDD 4XZMX 5LIYX 1GJUA 1PTGA 4JS3A 3EWCA 4C1LA 3AIEA 2NQLA 4U2ZA 1I2NA 2Z2BA 4M7TA 1S39A 2GQAA 4JHMA 5AY7A 5BROA 5B80A 3BMWA 3LTPA 1KFLA 3WNMA 1K77A 4DN1A 4JTIA 5D05A 4Q4MA 1W17A 3LN3A 3KOZA 4LVGA 2OGYA 4W93A 1E4MM 3JZEA 2VOMA 3VNZA 1B2YA 1RJRA 1UH2A 4GZEA 1DBTA 4LF2A 3H53A 4W7UA 5EY5A 2VFEA 3CM4A 1EX5A 3VCRA 2VKZG 4PBEA 4UFMA 3NQEA 3Q65A 3MZ2A 2CZEA 4EF9A 2GOKA 4R27A 1D8WA 4ZBCA 4LWWA 3BAIA 5I3IA 3A12A 3I7SA 2ZTKA 2L5HA 3DHUA 5PTDA 4M80A 3L5LA 4TVUA 2GYIA 2UY5A 5BCAA 1L8PA 5BYWA 3UR8A 5GJPA 3R0KA 3BW3A 3DGBA 1SJDA 4C6DA 4M0XA 3UPBA 2AOSA 3RN6A 1R2RA 1ZQ5A 2VCBA 1HKIA 3W7HA 4FLOA 1XGDA 4XIMA 3NQ6A 3L4YA 1YMYA 4D2JA 4XO6A 4AHQA 4AH7A 4QRNA 5CPMA 1IXPA 4IPNB 2H8XA 2DGAA 2E1WA 1UR4A 4R9XA 1NAL1 3LOTA 4Z0SA 3OBEA 3OLEA 1B4KA 1FP9A 2PWEA 2I5QA 4DUOA 3WCZA 3QR3A 4HNCA 3N29A 1XBXA 2DVUA 1W9VA 4DWDA 1HJVA 3F5LA 1XHGA 1AH4A 2YCLB 3BLLA 3UT0A 1OABA 2QF8A 2WXDM 3WLLA 1RY8A 4AZGA 5AYIA 2XVKA 1AD4A 2BXVA 3LCWA 4W7WA 1T8XA 7ENLA 4JN7A 4HN4A 1KBKA 2XIBA 3AJ7A 3TXVA 3T0TA 4QJ1A 3M9YA 5FJOA 3DN5A 2PDBA 5FF7A 1GCYA 5BZAA 1OF6A 4JTSA 2VNCA 2Y7DA 5CPOA 3CLWA 1WAUA 1UC5A 1XYBA 4H83A 2H90A 1F6KA 5A69A 2XZ9A 1L9WA 2GUYA 2PGEA 1B4EA 3KBWA 2PGWA 5GJMA 3ZIZA 2Y8KA 3IAQA 1PKYA 4CCEA 4HOWA 3W87A 4WSHA 1W1ZA 4BKNA 1MVYA 3BO9A 2IMRA 2Q8XA 2YL9A 4K1GA 1PWLA 1M9HA 3TC3A 3AHZA 2NQ9A 1J0IA 3R89A 1K9FA 4S3DA 4HT3A 2GQ8A 1DE5A 4H19A 4HP5A 2DH2A 1PZ1A 3UZXA 2OZ0A 1LYXA 4DJFD 1FWDC 1C92A 2D22A 3B05A 1LG1A 3GTFA 4QBXA 3H8AA 4IP7A 3R0UA 3GH4A 1LTDA 1NH6A 3FK4A 1PWMA 3CS2A 1R9ZA 3MYOA 2DVTA 2FKPA 4JQ3A 1YBQA 3TU9A 3URBA 5LGZA 2CXGA 3USBA 2CITA 2Y88A 3BE7A 4J3SA 4D6DA 3TXZA 1GZGA 1JCLA 3FA4A 3WK2A 3AIRA 2OTDA 4TTUA 4AB4A 1JJKA 3NL2A 3IGUA 4B3ZA 3RILA 1EC9A 1TQJA 4YWIA 3PK7A 1CBGA 2IW0A 3TIMA 2Z2AA 3PB2A 3IVTA 3ABRA 1T5AA 3DH7A 4O12A 1KBJA 2YBTA 1B3VA 4NVTA 3W38A 3H2AA 4H6QA 3BAXA 4XB3A 5CJ5A 4OKDA 3CO4A 2DW6A 3QJAA 1V6UA 4I7UA 1KFWA 3LV6A 4UBPC 4ZSUA 1GYNA 1DQXA 2CZFA 2FYMA 3MCOA 4QIUA 3IJ8A 1WO2A 4NY2A 2JKEA 4HMCA 3TTSA 4XKYB 5FJIA 3GUWA 3K4AA 4UTFA 4YXGA 2ZUTA 4WDTA 3W7GA 5BXPA 4L5ZA 5IRPA 3ZFHA 1BXNA 3LRKA 1D3HA 4CEUC 1REQB 4MY1A 2I17A 2IS7A 1QHZA 1EXPA 2PU1A 3L4WA 1TYGA 3KWSA 3V16A 4IQEA 3U8GA 3N73A 1PEZA 2E8YA 1RCOB 3SJNA 1QW7A 4MYAA 2EF9A 3FGCB 4IIEA 3TH6A 2QF7A 4NZFA 4QQ3A 1IZJA 2G0WA 4AZIA 3TCSA 1BRLB 4EK7A 4I5XA 3UFYA 4FXFA 4PTWA 4A29A 2F84A 2YXGA 2GVLA 1SFSA 1KRMA 4JTUA 1E72M 1FTXA 4N6EA 1J10A 1XD0A 2ZX7A 3RLUA 4IMGA 3W2LA 4BS0A 4D6EA 2ACUA 1J01A 2C7FA 1JRBA 3TEVA 1MRAA 3HN3A 1C3FA 1H5VA 3BSMA 2QR6A 3DERA 3K4WA 2O9OA 1UKPA 3KBSA 1X39A 2XU2A 4MNKA 3AIWA 4TX9A 3R43A 1W9DM 2PS2A 1NDYA 3P82A 4AHPA 2VR2A 3TAKA 4M1BA 1VCGA 2AMXA 1PCKA 5HNUA 3DDMA 1QPKA 2DZWA 2EG6A 5HPOA 2I1OA 3ZYZA 3U4FA 3TSDA 4WIWA 3GW0A 1J0ZA 1XPGA 2HPMA 5F4SA 2ZUMA 1ZZMA 1W1B1 4JGDA 4Y7EA 3C4UA 3T0DA 3EWZA 2J7FA 4CNSA 2GJNA 4PMQA 4W5UA 3GTHA 4W7VA 1HG3A 3EX6A 3O6DA 2X1IA 4MWAC 2RJGA 1I2RA 2XFYA 3NEHA 3DBNA 1ZJAA 3AHVA 4U2YA 3TLLA 1KM5A 4C1NA 1DWIM 2WM0A 3SECA 3DFTA 1AG1O 1VCFA 1E9ZB 2FTYA 2QJIA 1RUSA 2BP1A 4GXMA 4AWSA 1VC4A 3WMBA 1Q8JA 3GIPA 4IIGA 2ZUVA 1FWEC 3L9CA 4GK8A 1FH7A 4FIRA 4OOUA 3PM6A 4A3YA 1W6TA 2WMIA 5H1WA 3ZR5A 3QSTA 4MNLA 4AY8A 4Q4QA 2MANA 2WC7A 4LF1A 4LV4A 3WENA 3NSXA 5E0KA 4BJHA 1N2VA 3UA3A 1KFCA 3WH6A 3F5JA 1Q6OA 2BASA 4XAZA 1G6CA 5AC5A 2XH2A 5FI8A 4NI8A 5JIWA 4CGTA 3V7PA 2POZA 2DQXA 1FX6A 3K1DA 1A5MC 3O07A 1QK2A 4LV9A 4QP0A 4HSOA 3QMSA 4CD7A 4LQ1A 4XAPA 1DL3A 4CU7A 4GZ7A 2ZXDA 1FFRA 1XIJA 1C93A 1BF6A 1K9DA 4A2RA 3ONCA 4JXCA 1SR0A 1GEQA 4TX8A 3C6CA 4PN2A 3AU2A 4DZAA 2HDJA 3LMYA 3NZ1A 4EF8A 6XIMA 5HWMA 1KXHA 2J24A 1P6CA 3B97A 3DBPA 2VRJA 5E9XA 4RNHA 2C18A 4J3WA 1UR9A 5FL1A 2QEZA 1ENUA 4GVGA 5J04A 1LBFA 5BNKA 4LW7A 2EKGA 1HUVA 3PZQA 4ZQRA 1AJ2A 4QDMA 3DI1A 1VPYA 2C1GA 3TA9A 2OOGA 3CHFA 1QO5A 4D6FA 3HQPA 5CQ1A 1CPUA 1G4TA 1WQ5A 4CU6A 3UXAA 2C14A 3V18A