2GSJA

Cdna cloning and 1.75a crystal structure determination of ppl2, a novel chimerolectin from parkia platycephala seeds exhibiting endochitinolytic activity
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
271
structure length
271
Chain Sequence
GGIVVYWGQNGGEGTLTSTCESGLYQIVNIAFLSQFGGGRRPQINLAGHCDPANNGCRTVSDGIRACQRRGIKVMLSIGGGAGSYSLSSVQDARSVADYIWNNFLGGRSSSRPLGDAVLDGVDFDIEHGGAYYDALARRLSEHNRGGKKVFLSAAPQCPFPDQSLNKALSTGLFDYVWVQFYNNPQCEFNSGNPSNFRNSWNKWTSSFNAKFYVGLPASPEAAGSGYVPPQQLINQVLPFVKRSPKYGGVMLWDRFNDLKTKYSSKIKPSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords protein PPL-2
publication title cDNA cloning and 1.75 A crystal structure determination of PPL2, an endochitinase and N-acetylglucosamine-binding hemagglutinin from Parkia platycephala seeds
pubmed doi rcsb
total genus 99
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gsjA00
1NOWA 2GFTA 5JIPA 4UR9A 4ATLA 3CHFA 1ISZA 2Y4SA 3CO4A 2BV9A 3OGVA 2D23A 3MMWA 2BFGA 2WNWA 4ZENA 4A3YA 2DQXA 1AVAA 4NF7A 3RM9A 1CPUA 2WMIB 5M17A 2BXZA 1JF5A 3GXMA 1ITCA 5EFFA 2C0HA 1ODZA 1BG9A 1VBRA 1QW8A 4C7GA 3EBVA 3BC9A 3A3HA 1UZ1A 3ZT6A 1KCLA 4HMCA 1WZKA 1W3HA 1QBBA 4ZEPA 1NOFA 1UWTA 3U7BA 2QV4A 1X1NA 2HVMA 4AZIA 5A6KA 1BGGA 2VQUA 3BLKA 3BAIA 2DSWA 4PTMA 1JXKA 2D22A 3CZJA 1KBBA 1SMAA 2CBVA 2VRJA 2V5DA 2BY0A 4TVUA 1V0LA 4JFTA 4ACZA 1C91A 1FOBA 2VR5A 4IPLA 3PZTA 3WMBA 3ECQA 1VF8A 3B8SA 2PB1A 4AEEA 4KH2A 1ZB5A 1HJQA 4WKHA 3ZOAA 5LA1A 4JCLA 2PC8A 2VZSA 4Z2LA 1B3XA 3U5UA 2WZHA 1WPCA 1O6IA 1PZ3A 1BVZA 3NDZA 1JNDA 2EPOA 1FFRA 3L4YA 3VIMA 3SCOA 1TZ7A 2VOTA 4WSKA 5A2AA 3NCOA 2E3ZA 1US2A 4WKFA 4W84A 5EB8A 1J10A 4QLJA 2XM2A 1EHNA 1JF6A 4XV0A 1K9DA 2XM1A 2EBNA 1KR1A 2EPLX 3QR3A 4HA3A 2YDSA 3GNPA 2VZOA 1WE5A 4AZ6A 3VNYA 4XZBA 3FN9A 3SCQA 1DWHM 2VRQA 3FHQA 3II1A 1W3LA 2E9MA 3T0AA 3WBEA 2XJ7A 3GH7A 5HXMA 2BY1A 5BCAA 3SCPA 5ABFB 4V28A 3CUGA 2CYGA 1Q6GA 1OGBA 1OGGA 3WD0A 3M7SA 1HJWA 3VGEA 3MUY1 5CSYA 4P7OA 3WL1A 2CIPA 4B16A 3PTQA 1W1TA 4CD5A 1V6VA 3S2CA 1NWTA 8A3HA 4P7LA 2YL5A 3AMCA 4W5UA 1GJWA 3ZJ7A 4E8DA 3PZGA 1NWRA 1RP9A 2QLYA 1MXDA 2WHMA 5A69A 2CXGA 2GK1B 3OA5A 1HL8A 1E6NA 2V38A 3OG2A 4XX6A 2GJRA 2WC4A 3QHNA 3GBEA 4U33A 2VX4A 3RO8A 3WUBA 5BXPA 2E9BA 1JZ3A 1B3YA 2CHNA 4AXNA 5BXRA 3ZSSA 2F8QA 4A3HA 2WMGA 1C8YA 2QHAA 3PZOA 3ZJ8A 1W3KA 5GPRA 1GHSA 1GQIA 1XGZA 2QF8A 2WVTA 3UERA 2XVNA 2C8NA 1YQ2A 3AHYA 3MMUA 2G3MA 3LMYA 4MNKA 1VEOA 1HKJA 1K9FA 4PMZA 4FLQA 2VZUA 4NSBA 1I1XA 1G5AA 4U5KA 3ZO9A 2JF7A 2QPUA 3VIPA 4F79A 3VOCA 2BVDA 1QI5A 1LL7A 1X6NA 4KRUA 2FDMA 4GIAA 1E43A 1CGWA 2WCSA 2Y24A 4MPKA 4EANA 2W61A 4HMEA 3SIMA 1N82A 2YL9A 2WCGA 3G6MA 2ZIDA 5CXPA 5AYIA 4ZXLA 5I0DA 5M03A 1ZS2A 2VT0A 3WNMA 3J7HA 5LYRA 4H04A 1JZ7A 3GYCA 1MW1A 5JUVA 2PBOA 3AI0A 4FLOA 1D2KA 1W9BM 5BRPA 3L4UA 4UFLA 4GI9A 3AIRA 3WQWA 2PI6A 1HP5A 3L4XA 5FD0A 3CHDA 2GVYA 1J9YA 2X05A 3ZMRA 3WH7A 2RGLA 3ZIZA 2WC3A 4DWSA 4C7FA 3WENA 3N04A 3QOMA 3KL0A 3F4VA 4WF7A 4MB5A 2TAAA 4LYPA 3WFZA 2J79A 4TVCA 1X6LA 4CN4A 1V6WA 5JIWA 1UKOA 4H8UA 4UFIA 4MNLA 2MANA 7CGTA 3NYDA 3U5YA 3WEZA 2VO5A 4XUYA 2PWEA 3CUIA 4HZ7A 1JL8A 2J7HA 5IXEA 1JYWA 3NUKA 1F4AA 3IK2A 1DHKA 1KGWA 1W9PA 4WLCA 3VX0A 5DFAA 4CCDA 1LLOA 3WD1A 4EK7A 4KMQA 1HT6A 3QHMA 1H2JA 5JBEA 1CGUA 2FH6A 2A3HA 3D5HA 4LPCA 7A3HA 3VD9A 3GH5A 4BZYA 3EDEA 1V6UA 1GQLA 2J47A 1FP8A 3LPOA 1BSIA 1M04A 2ZOXA 1XC6A 3VD5A 1UR2A 1V0NA 1J0ZA 2J8GA 2W5FA 1JZ4A 1DWFM 3OBAA 1UUQA 2XPKA 3SCSA 2EJ1A 3S6TA 3DYOA 3VPLA 3N17A 3N11A 2JE8A 2WXDM 1QNQA 2V3GA 4J3SA 2NSXA 4W7VA 1MXGA 2D24A 3AJ7A 3CIVA 4GPNA 1XH2A 3O2LA 3AIVA 4AD2A 1JDCA 1OD0A 4OUEA 3CGTA 2VR4A 2YIHA 1HKIA 4H7VA 1GOKA 2PWDA 5D4YA 3RM8A 1WDQA 2DSUA 3EDDA 1JYVA 3KE0A 2W4XA 3L4WA 4D6GA 2YBTA 1UKSA 1E3XA 3GM8A 3VDHA 4BF7A 2BHZA 1ZBWA 1CEOA 1OT1A 4CCEA 2J75A 2ZUNA 4AD4A 3MUIA 3WH6A 1W3JA 4AEFA 1MW3A 3L2MA 5A6JA 3W38A 1GZJA 3N15A 4PN2A 1H11A 1TG7A 3PZQA 2CKRA 1JDAA 4U2ZA 2J25A 4OJYA 4J3UA 1WDSA 4CD8A 1B90A 2ZX8A 4QP0A 4S3KA 4AD0A 3MU7A 3BAXA 2WZEA 2O9TA 4BQ4A 2ZUMA 3HJEA 4H41A 2XWEA 3IJ7A 3RDKA 3W0KA 4H8HA 1MW2A 4U2YA 1UA7A 4GQRA 1H49A 1B3ZA 4M24A 1BG4A 1OD8A 3WL0A 1RP8A 1J01A 5DT5A 4GO9A 1EOKA 4PMDA 4CU8A 3TTOA 4GXPA 4PTXA 3GZAA 5BRQA 4JFUA 4KGJA 4CN1A 5I78A 1GOWA 3VIHA 1UWQA 5D9PA 1FP9A 4ZE5A 3SEPA 2WHLA 1UD5A 5CPTA 3WNOA 3GTNA 4ACZB 3ZM8A 2D2OA 1E71M 5A8NA 5CQ1A 4P8VA 1UG6A 1B31A 2Y5EA 3WUFA 5D9OA 3WQ8A 1DEDA 1MW0A 4H2CA 2DSVA 3IJ9A 3BCDA 1RPKA 2J7GA 4CD7A 3FNDA 3ZJ6A 4X0NA 2OSXA 4W8BA 1B0IA 1KXQA 4UZUA 4PEEA 4PMYA 2CNCA 4DWSC 9CGTA 4PTWA 1MWOA 3AZRA 1WZMA 1EDTA 4M8UA 1CXIA 4W89A 1JXJA 3ZR6A 3ARVA 4NI3A 3CUJA 1HJVA 3PZIA 2VMFA 4EAMA 4LYQA 1QNPA 3VIGA 2WC7A 3VDAA 1E1FA 5M5DA 1A47A 1PEZA 3KWXA 5FL1A 2CITA 3WUGA 1E72M 4OZOA 2CPUA 2WAGA 2WBGA 3UEQA 4CVWA 3F5JA 2A3AA 3AIUA 2XTKA 1MFVA 3AHTA 3FXYA 3KEHA 2V3DA 2WYSA 3JUGA 5FOOA 4FF5A 1GONA 5A6SA 1QNRA 1BLIA 2DIEA 5GQBA 1TMQA 1UD2A 2VZTA 2WLYA 1D3CA 3VIKA 1CXHA 4UZSA 1CGXA 4W85A 1GQJA 1DWGM 1BYAA 5LA2A 5BXSA 1PIFA 2D1ZA 4CCCA 1EH9A 3IANA 5I24A 2BY3A 2O9PA 2UY4A 1JD9A 3AIWA 3SCWA 1WZAA 2UY3A 3F5LA 1KWGA 3CHEA 3WN6A 1Y7VA 1UHVA 2XSAA 1JD7A 2BXYA 4AZ7A 1H09A 5E0FA 3TOPA 4HZ6A 2WHKA 3WH9A 3AS1A 1FA2A 3WNLA 5CSUA 2EXOA 2VX7A 1GNXA 2GUYA 3DHUA 2J7DA 5CPQA 2QMKA 1UKTA 1E9LA 5M3WA 3QGVA 3KL3A 3SCTA 5HBFA 3UR8A 3ZR5A 4N42A 5A8OA 3VO0A 1UOKA 1PBGA 1ZBVA 2WPGA 2OWCA 4TTGA 1XSIA 3OZPA 3BMWA 2ZXQA 1PPIA 2ZUTA 2OYMA 4QDMA 1EDQA 4AIEA 4AD5A 1MVYA 2QPSA 4PMVA 3ARYA 4J7RA 5FKYA 1OM0A 1UWRA 5C8BB 1BFNA 1VJZA 5I79A 1UR9A 2WHJA 1V08A 3TONA 4HA1A 1G94A 1FH7A 1OB0A 3WDIA 4W8AA 1DWIM 3ARRA 5HNNA 3ARZA 2IUZA 4D71A 1RD6A 4UNIA 2A3BA 1E40A 5BYWA 4MAVA 2CETA 4GO8A 2A3EA 4LGXA 2DIJA 1ZJBA 4PUDA 2ZXAA 4AZHA 3CUHA 3AQUA 1GW1A 2OSWA 1OWQA 4UQDA 1U30A 1AMYA 1NP2A 2F61A 1HIZA 4DWSB 1V02A 1BHGA 4HP5A 3AYRA 1E4LA 1DP0A 3LPGA 4AZCA 2J7FA 1I1WA 4WKAA 3U7VA 1KQZA 1JAEA 2RGMA 2O9OA 3WQ5A 2EEXA 5A2BA 4MADA 3W6LA 1NARA 1PX4A 4TUFA 3VGDA 1ITXA 1K9EA 3MANA 1XYZA 5CGTA 3ARTA 2GJXA 1HJUA 1V03A 2ZWYA 4JKMA 3WMCA 4LX4A 3RJYA 4UQ9A 2ZXDA 3CUFA 4AZGA 1LJYA 2VNCA 3NSNA 3WD4A 3SCRA 2XGBA 2W67A 3ARXA 2OWWA 5FCZA 3ZQ9A 5A8QA 1UH3A 3SCNA 3ZT5A 1JI1A 4UQAA 3AMKA 2UY2A 3NSXA 3AROA 4HA4A 4JIEA 3GNRA 4Y7EA 2X09A 3VILA 2PWGA 2WMHA 3AIBA 4D6FA 1OGSA 1CXEA 1CENA 3BSHA 1ISYA 1VFUA 4PMOA 3WQ6A 1JYNA 4J3XA 3T2PA 1EO7A 4WIWA 4OBRA 1CXKA 4Z2KA 1E6RA 1PZ2A 5A94A 1TVPA 1H4PA 1QNOA 3CZLA 2YA1A 5CPSA 4PSRA 2DGAA 1L8NA 4JAWA 4D6EA 4JKLA 1QVBA 1GOOA 2XFYA 3VGBA 3MSDA 1C90A 3VIOA 1JZ2A 1G01A 4OOZA 1EO5A 5HPCA 5D8ZA 3LPFA 2WMIA 1QI3A 4LQ1A 1CGTA 1V0MA 2O92A 1V0KA 3K8KA 4JFWA 1VEPA 1CECA 2ZXBA 3OB8A 1TCMA 4J3TA 4NRSA 3AZSA 4TX8A 2YLAA 2Z1KA 4K68A 4CKQA 3SCVA 2DH2A 1AQ0A 1IZKA 1NQ6A 4XB3A 5A6BA 4HMDA 1UD8A 3RIKA 3UG5A 1BTCA 7TAAA 2WMKA 2V5CA 3IAPA 4L4OA 2FGLA 4ZFMA 3IJ8A 1YHTA 3FW6A 2UY5A 4HU0A 1WDPA 3WD3A 2ZUSA 1B3WA 1BF2A 2VC9A 5IFTA 1WAWA 4W7UA 4EE9A 1J0HA 1E0VA 4MB1A 1QOXA 4PMRA 1ZJAA 1BPLB 5AY7A 1QHOA 3I3EA 1CLVA 4W93A 4F9JA 4PCSA 4DWSD 4BS0A 3EMCA 3WDQA 5TD4A 1OCQA 5DO8A 2WLZA 4NRRA 4PRWA 1VFFA 4CD4A 3RILA 3AMDA 1JGIA 1QBAA 4OBSA 3AZTA 1QHZA 2IXUA 1XCWA 1B3VA 1R7OA 2XHYA 4JHZA 1ZU8A 1VBUA 2HISA 4OOUA 2XGIA 5CJ5A 4OIFA 2BVYA 1C92A 1CBGA 3F5KA 1W1PA 3ARPA 3CPUA 2PWFA 4KGLA 3WNKA 1J11A 2EO7A 1CGVA 1UR1A 4M1RA 1ODUA 4MDOA 1E73M 4TVDA 4B9ZA 5BROA 5D9NA 3CMGA 2XVLA 4W5ZA 2E40A 1GVIA 1KR0A 1KCKA 1LF1A 4LYRA 1EQPA 4QCEA 1AQHA 3VINA 1R87A 2XYLA 3MV01 5ABFA 1FH8A 4MB4A 1U33A 2V3EA 2CHOA 2Y2WA 1KXTA 2CBUA 3B9AA 3ALGA 4AD3A 1VB9A 1M01A 1MQPA 1ISWA 3DC0A 3K4DA 3M07A 2X2YA 3EDJA 2VVSA 1GHRA 2W91A 1TA3B 2CBJA 1BAGA 3FHAA 1P6WA 3VMPA 3SCUA 1OIFA 1C8XA 3BGAA 1WNOA 5HDRA 4IISA 1PX8A 1GVYA 2YA2A 1QI0A 1WZLA 4M82A 3WH5A 2YL6A 1HXJA 2GK1A 4MDPA 1E4MM 1WO2A 2WMJA 5I5RA 1JFXA 1XSJA 5CZKA 1B9ZA 2J78A 2VJXA 1ECEA 1HF6A 2XFFA 1UKPA 3W25A 2EPMX 3N1AA 4CD6A 1PJ9A 1HJSA 2VCBA 1LL4A 1Q6CA 3CLWA 1CNVA 1E4IA 3SUSA 1QPKA 1VJSA 4UQBA 3VIFA 1Q6FA 1VAHA 1V6YA 4TOQA 3THCA 3W4RA 4D1IA 2JEPA 2OYKA 2NT1A 4PTVA 2X8RA 1ISXA 1W2PA 3GNOA 3CZGA 1Q4NX 2W63A 1W9XA 4QLLA 1Q6EA 1KBKA 2D3LA 1E0WA 5EBAA 3PZNA 3VM5A 3TA9A 3M46A 1VENA 4TTUA 3AS3A 5CLWA 5GNYA 3WSUA 1L0PA 3THDA 5KZ6A 2WKGA 2VZVA 1V3IA 4GZEA 3AYSA 1XV8A 3OZOA 1KWKA 2E8YA 1WB0A 4P7QA 1JYXA 4QCFA 4D6CA 3HU7A 3MSGA 1UYQA 3CMJA 3DYMA 1H3GA 3IAQA 3VD7A 1E6QM 3VUPA 5I2UA 1XCXA 5AYBA 5D9MA 1TUXA 5HPOA 3MV11 5C70A 3VNZA 1V3MA 1VEMA 1UWUA 3BAYA 5DEZA 2GJPA 3N9KA 3WH8A 5AC4A 2AAAA 4X9YA 1XH0A 3AFBA 3VKKA 5DT7A 2NT0A 1HL9A 4D6JA 1R7AA 1WCGA 1M53A 2E0PA 4Q7NA 1CXLA 1E6XM 1TE1A 1UR0A 3VVGA 2CESA 2VI0A 3AISA 4JFVA 3VU2A 4BCEA 3LPPA 3W6MA 3NIYA 5E70A 3I3BA 3WF3A 3WEMA 2X0HA 4B15A 2DT1A 3EYPA 3O6AA 2WBKA 3T2QA 2BY2A 1UH2A 8CGTA 2BHYA 4J3VA 3PTKA 2QMJA 1W32A 4P8UA 4N0RA 3T2OA 1E70M 1H0IA 2VQTA 5EFDA 1OSEA 4Z2IA 5DMYA 4TXEA 2W66A 3OLGA 4MNJA 3TP4A 1BYCA 4HPHA 3AHZA 4RE3A 3E1F1 4TX6A 3APGA 4PYSA 1EDGA 3L4TA 3OGRA 5A2CA 1DWAM 4E8CA 4Z2GA 2DSZA 4W87A 4PCTA 4AZ5A 4DUWA 3ARUA 3GXFA 3AS0A 1UWIA 2Q8XA 2YLLA 1O7AA 1OBAA 4HU8A 4D6DA 1JI2A 1UWSA 5A6MA 4URIA 1J0KA 4CUCA 5A8MA 3CBWA 1EOMA 2G3IA 2YOCA 1HN1A 2D20A 1HNYA 1G9HA 5E09A 3W37A 1Z32X 1IT0A 1JAKA 3RMEA 1NP0A 4F66A 5C71A 3BH4A 5E6ZA 3WDPP 3MUAA 3OIHA 5I77A 2FHFA 1VRXA 4J28A 4BQ5A 2WVVA 3K46A 1UQYA 2WWDA 2JEQA 3BAWA 1I75A 3VDBA 4AISA 4W88A 5FL0A 3SUWA 3VD3A 1ZL1A 4UFJA 3VIIA 3WDHA 1CTNA 4JZ5A 5FIPA 4V2XA 1C93A 3AOFA 2GSJA 2F2HA 6A3HA 1HKMA 2DH3A 2ZWZA 3VMOA 1EHAA 5A95A 2PWHA 4UFHA 3W29A 1AQMA 4UOQA 1J18A 2FHBA 5AC5A 2Y8KA 3SUUA 4HPGA 2VURA 3NDYA 1HVQA 4FK9A 3MKKA 2YA0A 3GXDA 4IUGA 4ACYA 5A8PA 1CGYA 4IM4A 1JDDA 2FGZA 1JZ5A 2XVPA 1BGAA 1BQCA 1JG9A 2PBGA 4JL1A 1J12A 3AXHA 2WB5A 1E6ZA 2JIWA 4V27A 3OLIA 3BAKA 1NWUA 4XZWA 2WVSA 3NSMA 2DPEA 2E9LA 2EQDA 2BS9A 2XIBA 1ESWA 2CERA 3HN3A 5EMYA 3PZ9A 2Z1SA 4KWUA 3WNNA 1OIMA 5E9AA 4YN5A 1LWJA 2G3NA 2ZX9A 1CLXA 3DHPA 4DUVA 2CBIA 5LA0A 4UQCA 1C3FA 4QFUA 3AXIA 3WD2A 1HKKA 3T0BA 3A4XA 1R85A 4UFMA 3PZVA 2D0FA 1SYTA 3RCNA 4GQQA 1W1YA 1E6PA 3VM7A 3NJ3A 4BA0A 4OKDA 2CCRA 4U5IA 1UD3A 2YDQA 1LG1A 4M56A 1C8QA 2IXVA 4AZBA 1J0JA 5ABEA 1E4NA 3CZKA 4Z2HA 2BHUA 3POHA 2XFRA 2J62A 2ZE0A 2O9RA 1J0YA 4S3JA 1EIBA 1GCYA 3MO4A 4B3LA 1EQCA 2XVGA 1ISVA 1PIGA 3AIQA 3A6OA 1JZ8A 5BWFA 4W8LA 3U57A 1GUVA 4J27A 2E4TA 1CYGA 4JKKA 4U3AA 4DUXA 4GZJA 2BNJA 2BVTA 3N18A 4W7WA 2ZUVA 3AHVA 5BXTA 1B30A 2VUYA 1UH4A 4PSPA 2WM0A 2WANA 4AW7A 1V3JA 1KGUA 2OSYA 4BQ2A 2VTFA 4RE2A 2WSKA 2WSPA 3CZ8A 2XWDA 2ESCA 4WSJA 4GI6A 3UR7A 2VX5A 2G4FA 1JZ6A 4CGTA 3UG3A 2JF6A 3MMDA 4CU7A 1E1EA 1XHGA 1V3HA 3POCA 4RL3A 1E5NA 1ZBCA 4D6HA 3W26A 2ZUWA 2GDVA 5CG0A 5IFPA 4NZCA 3TTYA 5KEZA 2DEPA 3K8MA 3WDRA 1EGZA 1IZJA 1U2YA 1TFVA 4GINA 3B9DA 3VDCA 2YDRA 2VCAA 2W92A 4AY1A 3W53A 3O9NA 1C7TA 4W86A 1IV8A 5A6AA 3W27A 3L4VA 3CZEA 4UQEA 3RPMA 3BAJA 1J0IA 3ZJKA 1EA9C 2J7EA 3CH9A 3PN8A 1HVXA 4AC1X 1KQYA 1KXHA 3BLPX 5A6BD 1B2YA 2Y8VA 1B1YA 3GH4A 3EMZA 3WKZA 3A47A 4DM1A 2YKKA 2J8FA 3DECA 2ZICA 1W2VA 4YHEA 4D1JA 5HOSA 4AWEA 3PZMA 1W91A 1NOUA 4FLRA 1V6XA 3A4AA 1G1YA 3WY1A 1QHPA 2OWXA 5F7UA 1QI4A 3AICA 1VIWA 1QI2A 3HMCA 1XD0A 4LXFA 4CU6A 2B31A 2X0YA 5A6LA 2XVKA 1XRVA 4AD1A 3FAWA 4P8WA 3WF4A 2FH8A 4HOWA 4E2OA 3WIJA 1UKQA 3B9EA 4PBGA 5ABGA 4MAZA 3FAXA 4B3KA 3BCFA 3TTSA 2PF0A 2DSKA 1LWHA 2AMGA 1CWYA 3A4WA 4EKJA 3BXWA 3GBDA 1E6SM 2XUCA 1WKYA 3L2LA 3WQVA 3TTQA 1E55A 4AMCA 3SUVA 3VTRA 4B9YA 1E3ZA 3W24A 1NWSA 4ML4A 3AMGA 3MUZ1 3G6LA 4L4PA 4FMVA 3ARWA 4CN6A 2WCAA 2NW0A 2FHCA 3OLEA 4MJ4A 4UTFA 1MQQA 4MJ2A 4M80A 1JFHA 2A3CA 2VRKA 1QNSA 1UZ4A 1HP4A 2YBUA 4UFKA 2JALA 2WVUA 2C7FA 3D3AA 3VX1A 4WK9A 3OLDA 4UOZA 3VGHA 4RE4A 1HX0A 5I6SA 1BYDA 1EXPA 5ECUA 3WNPA 2WW5A 1H1NA 2AOSA 1UQZA 5IHRA 2DT3A 2EPNA 5IHSA 1DTUA 2ZX5A 4YHGA 3K8LA 5CGMA 2D0GA 3QOKA 4F9DA 3AXXA 1W9DM 1WP6A 3OGSA 4U31A 3BMVA 1CXFA 2E8ZA 2VX6A 2VVNA 3CHCA 5E6YA 3VIJA 1W1VA 1WDRA 2W62A 1A3HA 1RH9A 4HOXA 2J7BA 2XSBA 4PMXA 5I3DA 5D8WA 4P8XA 3BSGA 6CGTA 1XH1A 4ZXOA 3WF2A 3PZUA 1BVNP 3FY1A 1E56A 4Q22A 1E0XA 5JBDA 1SR0A 2G41A 2WWCA 3L4ZA 4DM2A 4HTYA 2V3FA 1FHLA 4AIOA 1FHDA 3WQ4A 1CZ1A 1W9VA 5A1AA 4JHOA 3N12A 3W28A 2WVVB 4WJXA 1LL6A 1CDGA 5ABHA 2WK2A 3UCQA 3MS8A 1C7SA 1KB3A 5E0CA 4CVUA 2CKSA 3GDBA 1KXVA 1R86A 3GXIA 2D3NA 3T09A 1H41A 3WMSA 1MFUA 4QAWA 1Q6DA 1VFMA 2VCCA 3WF0A 3WELA 3AIEA 3PHAA 4ATWA 3WUEA 5GNZA 2J4GA 1HJXA 1MYRA 1UD4A 1F4HA 1W9UA 3QHOA 2J7CA 2YL8A 1PX3A 2CEQA 4H8VA 4X0VA 4UOJA 1BYBA 4MTVA 4IPNB 4M29A 2OLHA 1GORA 3ZT7A 1LQ0A 4UCFA 5DF0A 3VGFA 1MQRA 3SURA 4ATDA 1V3KA 4HOZA 1VFOA 1V02E 2DDXA 1UA3A 3W82A 1S46A 1V3LA 4D6IA 6TAAA 2OYLA 1H0GA 1H5VA 2J77A 4KRTA 3VD4A 4R5EA 2JFEX 3AMLA 5JBFA 3AS2A 3WFLA 1GQKA 2G3JA 1UR4A 1KFWA 1ZBKA 1JNEA 3WF1A 1LG2A 3N13A 2UWFA 3WDJA 2X1IA 3VMNA 1FH9A 3EMQA 1GOIA 4AYSA 4JCMA 3UETA 2YJQA 2WZIA 2XIIA 2JIEA 4F8XA 1JIBA 2WMFA 3KZSA 1R8LA 1G0CA 4JL2A 4PMNA 4JFSA 1GOMA 3T08A 1SFSA 4MB3A 3K4AA 1SMDA 1PAMA 1KGXA 3I3DA 4R27A 4GI8A 4D72A 4J3WA 1E15A 1M03A 3RM4A 4PUEA 2XG9A 3EDFA 4GKLA 4AZCB 3ARQA 2ZUUA 4PMQA 3RJXA 1K9TA 3UESA 2EPKX 4BQ3A 1GJUA 1M7XA 1TA3A 3SUTA 2ZX7A 3KL5A 1NM9A 1DWJM 1OT2A 3WBAA 5IDIA 4GZIA 4FLSA 1XD1A 2VL4A 1D7FA 4A4AA 2GJXB 2D0HA 3W81A 3ALFA 1OINA 1XSKA 3VGGA 2GDUA 3CTTA 3EDKA 3WEOA 4MNMA 3DYPA 3PBGA 2DT2A 3PTMA 2WKLA 5GNXA 2DT0A 3T0DA 1TR1A 2J74A 1NH6A 4M81A 4P7NA 2G8ZA 4AIUA 1CIUA 3K1DA 1GOQA 4Z2JA 1US3A 4HZ8A 1UD6A 4P7RA 5CLTA 4ZE4A 4C7DA 1XYFA 1QW9A 1E5JA 4QLKA 1UR8A 4E4PA 1FFQA 3ZSTA 5A3HA 3ARSA 1TVNA 3AHXA 4U3CA 5I23A 1GPFA 1K6AA 4YPJA 4PMUA 2ZX6A 3M6DA 3UG4A
chains in the Genus database with same CATH superfamily
4Z1BA 3WJXA 4AFYA 4PL2A 1YMYA 2BGQA 1WXZA 4PTNA 3F2BA 2Y4SA 2VEFA 4O28A 3OGVA 4PFMA 2P3EA 5C0QA 2D23A 2YFOA 3ITTA 1YADA 1VBGA 2OZ8A 4O54A 2BFGA 2UBPC 2NQ9A 1EJRC 3RM9A 3NZGA 4UMCA 3HBLA 2YW4A 3MCMA 4QEHA 3ZYZA 4LT9A 1ODZA 1BG9A 2B81A 3W02A 3WLHA 3EBVA 5FSEC 1ZAHA 1IQ8A 2O56A 3A3HA 4Z42C 4L1WA 4HMCA 2IKGA 3N4EA 3UFYA 3B8VA 3TYUA 2W27A 1Q65A 3PG8A 1ZENA 4MLRA 1NOFA 2HVMA 4RKAA 5A6KA 1TWIA 3BLKA 4BK9A 2BDQA 3HV8A 5CZSA 1SMAA 3N2TA 1HTIA 2BY0A 3QQ1A 3V4BA 4YYCA 4IG2A 2ZZ5A 3RGTA 4IPLA 3I4EA 1ZHAA 4E5TA 4E0CA 3RNDA 5JVLA 4AEEA 1HJQA 4UTIA 3ZOAA 5LA1A 4KKXA 1EX1A 3VK5A 3U5UA 4ZB2A 1PZ1A 2VOTA 3GFYA 2ANUA 3NCOA 1J10A 4QLJA 1P1MA 2WZTA 4ZOAA 2XM2A 2Q8LA 3AWOA 3SBFA 2WZMA 2GVEA 2DUZA 2EPLX 3TOYA 3V1HA 3GNNA 1YPXA 2XSXA 1TPB1 3GC5A 4NNAA 4AZ6A 1DQXA 3W7HA 3KOZA 3QC3A 1DHPA 4DPQA 4DI8A 2VRQA 3FHQA 2E9MA 1GKRA 4LBUA 4GVFA 2BY1A 1LCOA 3LY0A 3C2OA 1M5WA 1H63A 4TU1A 1HJWA 3VGEA 2QXWA 1VIZA 2CIPA 3S2MA 3ZWTA 1KBLA 3KBJA 3T9PA 1EJUC 1D9EA 3ERPA 1FXQA 2NZLA 8A3HA 1O1HA 3AMCA 4QRNA 1GJWA 1ME9A 3ZJ7A 4E8DA 1J6OA 2QLYA 2WHMA 3NVDA 1E6NA 1FKWA 3OG2A 2GJRA 3QHNA 4A8RA 4QE5A 2VX4A 2AQWA 1JZ3A 2IW0A 5EMLA 1Z3NA 4HKPA 5BXRA 1YNPA 4A3HA 3TNBA 2OZ0A 4AXKA 1MDLA 1GHSA 1O68A 3C2FA 1YQ2A 1KTNA 5XIMA 4XWUA 3MMUA 3GYEA 3MQTA 4MNKA 3O05A 1K9FA 2QCEA 2VZUA 4U4MA 2O4QA 2FTPA 2JF7A 2ATSA 3WJSA 3VIPA 3Q45A 2BVDA 1QI5A 4GIAA 1E43A 1JDFA 3H7UA 3VFCA 5C54A 1CGWA 2EKCA 4MPKA 2OKOA 4HNOA 4YTSA 4JTSA 4Q8TA 1E9YB 1QTWA 2AQVA 3SIMA 3F03K 3G6MA 5AYIA 5M03A 4ZXLA 1A5BA 2VT0A 3WNMA 1RSCA 1L2UA 2FLIA 5LYRA 2AKMA 1JZ7A 4GD0A 3GYCA 2PDCA 5JUVA 2GYIA 2PBOA 3TN6A 3MHUA 3W7PA 3ITGA 5BRPA 1TMLA 4ASTA 1RPXA 4LV9A 5ENLA 2PI6A 2OMAA 4X3ZA 3MUXA 1KV8A 3WQFA 5CZ0A 4ERAA 2A0NA 1GVSA 4N7QA 4KCWA 3H7RA 4MB5A 3TFCA 2DIKA 4JTCA 2J79A 1X6LA 1V6WA 5JIWA 3KFTA 3PK7A 4UFIA 3UF9A 7CGTA 3NYDA 3CM4A 4JDBA 3WEZA 2PDQA 3V5FA 3W2KA 1FWNA 3OBKA 4HZ7A 3S1UA 1J96A 5IXEA 3IK2A 1TCDA 4O52A 2DU2A 1HQTA 1LM1A 4FNQA 3WD1A 4KMQA 4EXAA 5JBEA 3DXIA 2A3HA 3VD9A 2OOFA 3MSYA 3GU1A 2NX9A 4JYFA 4OT7A 3RLUA 1YW1A 1V77A 2ZOXA 1TSIA 4HSOA 1UR2A 3IIOA 4XBSA 1V0NA 2J8GA 4JNYA 1T41A 3UXKA 1DWFM 3OBAA 2P10A 4DY1A 3TA6A 4KERA 2F84A 1AA1B 3A12A 4EPBC 1Y5WA 3N17A 4NHVA 1IIHA 4L61A 3N11A 2JE8A 3SJ3A 2GVJA 1QWGA 1A5AA 2BBFA 2PODA 1WKEA 2NSXA 2Y61A 1MXGA 3GR4A 2D24A 1M6JA 3AJ7A 4GRSA 4AD2A 2QJNA 3A23A 3CGTA 2VR4A 3W2NA 3KBVA 1PCKA 4RZ6A 1EUAA 3HFTA 1FWCC 2Z1VA 2Z4GA 1RQHA 4BI6A 4DELA 5D4YA 1ZFJA 3DAQA 4YXGA 3G24A 2R14A 4UTTA 2V67A 2W4XA 1K7EA 3MCOA 1UKSA 3BLDA 4CCEA 2ZUNA 3MBDA 1GZJA 1ZPTA 2CKRA 1Q8JA 1WDSA 4J3UA 1B90A 2ZX8A 2ZZ7A 4QG8A 1PKMA 4KEZA 3QTPA 4C6CA 2OQHA 1SJAA 1TQJA 1YNQA 4BQ4A 4XD4A 3HJEA 2D73A 3F2DA 3IJ7A 3RDKA 2NVDA 4HJWA 4XG1A 5C9WA 3M47A 4U2YA 1UA7A 2QCLA 1I8JA 3C0SA 2PDFA 2ZKMX 4GJ1A 3OU8A 4GQBA 2PDKA 1Q4WA 1EOKA 4CU8A 3TTOA 1SUXA 4GXPA 1XIGA 4PTXA 3GZAA 4JFUA 3QZAA 1W37A 4CN1A 4WOQA 3V5CA 1EJVC 3PWGA 3VIHA 2GUBA 1FP9A 4ZE5A 3SGZA 1UD5A 4V15A 1EC7A 2R6OA 3V16A 3M41A 3ZM8A 5A8NA 3R8GA 5CQ1A 4P8VA 4H2HA 2Y5EA 3WUFA 1QXLA 3AAMA 5G1YA 3WQ8A 1MW0A 4WEVX 1KRMA 1TUFA 5AVHA 2J7GA 4Z0SA 1JQVA 2Z29A 3ZJ6A 5I3GA 3KP0A 3M6YA 3O1NA 3ORWA 1VLWA 2CNCA 2W79A 4PMYA 3SO7A 2B7PA 1H7XA 4E4FA 4PTWA 1HO1A 3AZRA 1GG0A 1Q7ZA 2RDXA 2PU1A 1BQGA 4ZL1A 4Y96A 4B5WA 3TSMA 3PBYA 3ARVA 3E0FA 4GQGA 4QITA 4LVGA 3V3WA 3CUJA 1XF0A 3PUOA 1HJVA 2YDAA 3PZIA 3LCGA 1KC7A 4MWAB 1O1ZA 4WJEA 3C2VA 2B4GA 2EKGA 2P3ZA 3KUMA 1W1B1 3L5MA 3B9NA 4H9YA 3KWXA 2PDYA 4XTIA 3EX6A 4ECLA 2WAGA 4B5NA 3N14A 4IGSA 4MHBA 1L8PA 4OGZA 3UEQA 2OEKA 4CVWA 4PFHA 3K5XA 5TNVA 1MFVA 3TW6A 4M51A 3KEHA 1B4EA 2WYSA 1AQFA 5FOOA 3W7QA 2X40A 3LHZA 2ABAA 1OQFA 2HE8A 3HG4A 4W85A 1T6MA 1DWGM 5DQPA 5LA2A 1PIFA 2D1ZA 2HXTA 4GBUA 2H8ZA 1KA9F 3IANA 2QUUA 5I24A 3NL2A 1OFPA 3C0QA 3M0LA 5K9XA 3MTWA 1Y7VA 2XSAA 4AZ7A 3TOPA 5D37A 3URAA 2Q6ZA 5B80A 1XC4A 2EXOA 2PLCA 1UMYA 4C6PA 3DHUA 4ZOBA 3I7QA 3CAVA 1G4SA 2D2HA 4I8DA 5M3WA 3SCTA 3RPDA 3UR8A 3LUTA 4WXYA 3ZR5A 4FOJA 1ZBVA 1N55A 4UTKA 4GC3A 3V18A 4IP7A 1BXNA 3ABRA 4QDMA 1LT8A 4AD5A 3KX6A 1R0MA 4GCAA 4YTRA 2CZDA 1VJZA 5I79A 1UR9A 2WHJA 3TONA 4RLIA 1AJ2A 3WDIA 4W8AA 3P62A 3VOJA 1DWIM 3KM8A 5HNNA 4UNIA 3QLLA 5D30A 2A3EA 2PRLA 1EZ2A 3T78A 3CV2A 3FYPA 4PUDA 2ZXAA 4AZHA 3CUHA 4IGMA 2TYSA 3MDWA 1TREA 4FOUA 1AMYA 2QDEA 3G2GA 4DWSB 4DNHA 3GK0A 1DP0A 1PVNA 1F5ZA 2PP1A 1KQZA 3FKKA 5A2BA 1LORA 4MADA 1PX4A 1ITXA 4MYAA 1VPXA 2GJXA 2ZZ3A 1V03A 2HPIA 3LNPA 1XYCA 4JKMA 3WMCA 1BRLA 3RMJA 2XH0A 4UMBA 3NSNA 4RV3A 3SW6A 1OC7A 5FCZA 1ZSXA 5A8QA 3SCNA 3ZT5A 4UQAA 2OO0A 3VOGA 4DO5A 3AMKA 3BJSA 5LIXX 3LHVA 2NSOA 4D6FA 1XW8A 4JTTA 1CXEA 1CENA 5TIMA 3T2PA 4RJEA 1QOQA 2QV5A 5IM51 3KCLA 1OZQA 4ROQA 2HQAA 3CZLA 5CPSA 4QDPA 4D6EA 4JKLA 3FSUA 2XFYA 1C90A 3VIOA 1JCYA 2QCMA 1G01A 3H4WA 5DCBA 2CHRA 1A0DA 3LPFA 2WMIA 4JFWA 1VEPA 2JK2A 1BF6A 2J13A 2FTYA 2FZDA 3N9RA 4NRSA 2DH2A 3TDFA 3R79A 3UWEA 1BWKA 4ILSA 3UG5A 1UD8A 4EPDC 2J9YA 3STPA 2XH7A 2WMKA 3WBXA 4YTTA 2CC0A 1QRQA 1AL8A 4L4OA 3W83A 1R3WA 3GFZA 3NDOA 4XKYB 3M4HA 4IJRA 1WDPA 1WAWA 2JKEA 1KFEA 3FS2A 4W7UA 3W2JA 3KAOA 3A9BA 3KTSA 1CLVA 1NELA 3W7DA 3WDQA 2BGSA 1GEHA 3UBPC 2ZADA 3RILA 5CAKA 1QBAA 4OBSA 3AZTA 3BCJA 1S1RA 1B3VA 1RQEA 4I7UA 3R0DA 3H8AA 2FZNA 4OOUA 2PDBA 3BANA 1Z9AA 1C29A 4OIFA 1W1PA 4DN1A 2OFJA 2PWFA 4H9UA 1J11A 4HZMA 3S5ZA 3S9YA 3SRFA 1UR1A 3VXGA 2G97A 4LAKA 4B9ZA 5HR6A 1XLFA 2XVLA 3P8JA 3QC0A 3DIPA 1KCKA 4LYRA 3OVGA 1KM0A 4QCEA 1DJHA 4S2BA 3IVSA 2XYLA 3MV01 4RNJA 5ABFA 2WJDA 3NM3A 2CHOA 4NP7A 1KXTA 3B9AA 4Z1YA 1FCBA 1VKFA 2OLSA 1MQPA 1XLAA 6XIMA 5DCDA 2VVSA 4QQUA 6ALDA 1TA3B 1IEXA 1FWFC 3VMPA 3SCUA 1OIFA 1RJQA 4X2RA 4IISA 3SSJA 1J5SA 1G4TA 3EWUA 2BSLA 5AHMA 1EC9A 3W72A 4EX4A 1JJKA 1TPH1 4LRSA 4PBFA 1E4MM 1WO2A 3UXAA 1JFXA 3HPSA 4Q32A 1A5OC 1B9ZA 1G6CA 1MO0A 2VJXA 1ECEA 3W25A 1XIFA 2V63A 2WNZA 3W2UA 1HJSA 1G4PA 3CLWA 1QNVA 3SUSA 2VGGA 4LY8A 1AMKA 2RDUA 3VIFA 4TOQA 2EHHA 3G22A 4JICA 4GCXA 2OXNA 1GJPA 2X8RA 4B2DA 3LBOA 3QV7A 4XSMA 3VNMA 1H50A 4GG9A 2IKIA 1W9XA 3S3GA 1A3WA 4S39A 3AYTA 2E09A 5EBAA 3TA9A 2ABBA 1NSJA 1W5QA 1QPRA 5CLWA 3ANUA 1L0PA 1OFAA 1R38A 5FF0A 2DZSA 2Y7GA 5KZ6A 4DPPA 1UIOA 1XV8A 1YRRA 3FXGA 4XZIA 4P7QA 5CC7A 4PE8A 1R3QA 3HU7A 5HQEA 4NXKA 1Q5MA 4MUPA 1E6QM 3B03A 3LRKA 5I2UA 5AYBA 1DPMA 5D9MA 3CIWA 3KHJA 3MV11 2VFDA 3BAYA 3B4YA 4H9TA 5DEZA 1LLWA 3UU0A 1EWEA 4X9SA 1IXQA 4GY7A 1FCQA 1VGAA 4X9YA 3UPBA 5DT7A 1HL9A 3HA1A 1KM5A 4Q7NA 3VVGA 3AXKA 3MC5A 2CESA 4JFVA 3W6MA 1OX5A 5G1TA 1P7TA 3NIYA 3BV4A 4LBSA 4OU1A 1JCNA 2X0HA 3BLLA 2CFFA 3BO9A 3BPWA 3V0UA 1AZ2A 1PYMA 1S3TC 1E1CB 1H0IA 1OSEA 4Z2IA 4KESA 2Z27A 2W66A 3TP4A 3AHZA 4PYSA 3IEBA 3M0JA 3IPWA 4B91A 3VCRA 3GG8A 3L4TA 3OGRA 3HGRA 2QGYA 3WFAA 3WLTA 3NQDA 3KWSA 2DSZA 1YYAA 4PCTA 4DUWA 4DYKA 1ADDA 3SIZA 1ZCCA 2DZUA 1I4NA 3A5VA 2X1RA 4PCPA 4D6DA 1JI2A 1UWSA 5A6MA 2P0OA 4URIA 3OHIA 4XZHA 1J0KA 1ICSA 5A8MA 3CBWA 1EOMA 3F2CA 2YOCA 4DF1A 1HN1A 2NXGA 2D20A 1HNYA 4GNJA 1MUWA 3BZGA 5C9UA 1R9YA 3H23A 3H26A 4GLEA 4MFEA 1NP0A 3P0XA 4B5SA 1Q7MA 3WDPP 3OIHA 5CPMA 3V5OA 3OVQA 5EYWA 1FX6A 1VRXA 4J28A 4BQ5A 1S1PA 3KCJA 4NJGA 4XQ6A 2ZE3A 1XFCA 3E02A 4Y90A 5T91A 1I75A 1Z6KA 4Y9PA 1L6SA 3VDBA 4ML9A 2NQLA 1NF7A 3IGHX 1P0EA 1ZL1A 3VIIA 4RPPA 2Y89A 4IQDA 1R3SA 1F05A 1BTMA 3C6CA 2PWHA 4OVXA 2YZRA 1W17A 3FKRA 2FHBA 2ICSA 3LCXA 4HPGA 1YEYA 2VURA 3VKCA 4YVVA 3UJSA 4G7EA 3MKKA 1HG3A 2YA0A 5LXEA 4IUGA 3GW0A 3TJXA 3O6YX 2J9ZA 1P0DA 5A8PA 1ZCOA 2X7WA 5C5YA 1JDDA 1LOSA 1JZ5A 1BGAA 3CS2A 1BQCA 1ICPA 5U4NA 4CCZA 1RV8A 3AXHA 4NXSA 1E6ZA 2JIWA 3L12A 4V27A 4JTQA 3EX2A 3WG6A 1NWUA 2F6UA 1I0BA 4R53A 3NSMA 2E77A 3PAJA 2E9LA 1I2QA 3THUA 2CERA 3HN3A 3PZ9A 1A80A 1GKQA 3DHPA 4R7WA 4O17A 3NQ7A 4R3UA 4GYPC 5FEXA 4QFUA 1Z89A 3WD2A 2ACSA 1L9WA 1R85A 2V5KA 4EAYA 2D0FA 4HCHA 4S1FA 3UCDA 4GQQA 1W1YA 3RX4A 4LUYA 1F3EA 2F6XA 2AL2B 2BTMA 1TJRA 2CCRA 4U5IA 1UD3A 2NV1A 4IQLA 3AO0A 2IXVA 4AZBA 1J0JA 1T40A 3LXCA 1OABA 4WDWA 4B4FA 3FX4A 4FXSA 3CZKA 2A85A 2XFRA 1GCYA 3D6NA 4IQJA 1ISVA 1PIGA 4WDTA 1AUSL 3AIQA 4WHBA 5LIUX 4NAEB 5FESA 7REQA 1RBLA 1CYGA 4JKKA 1V6TA 4MJZA 1ZGDA 4JQ4A 2BMBA 1EEXA 1A4LA 4FS9A 2VUYA 2VKZG 4I7VA 1MRAA 2OSYA 4Q4MA 3AXMA 4BQ2A 1XGEA 3QYSA 1ONEA 1P43A 3CZ8A 5CBIA 4WSJA 3GHSA 4TQTA 3IWPA 1AFSA 4GI6A 2Y63A 3UWVA 3TJ4A 2VX5A 3M0KA 4HN4A 1D3HA 3MMDA 4LUJA 1THFD 1ITUA 2QIIA 3MVIA 1WBHA 3CL8A 1Q7QA 1M41A 1SR9A 1ZBCA 4O0KA 4PR4A 4AU0A 5CG0A 1EPVA 4ZTXA 2WSYA 1TE6A 1K02A 4BWLA 4GINA 3CWOX 1RLCL 1UP0A 4ZCWA 3RRAA 3VDCA 2W92A 3W53A 4GNKB 3O9NA 1QPNA 4W86A 1TQXA 2QIWA 3AALA 2VEIA 3TVAA 4UQEA 4KCUA 4XZMX 1PSCA 2INFA 2QUVA 4AQLA 4ES4A 3MZ2A 4G2DA 2VM8A 2DY3A 1KQYA 5A6BD 4LCRA 2MNRA 2PD9A 2IPFA 3M0VA 7ODCA 3WKZA 1OVDA 3THAA 3MUCA 2YKKA 2OGYA 5HK4A 4DBSA 2ZICA 4D1JA 1XDLA 2ISFA 3PZMA 1W91A 5H2ZA 4FNPA 4GY0A 3WMLA 3K30A 1ADOA 1QHPA 4LBRA 4YTQA 4YVPA 3CYJA 1QI4A 3N34A 1DJWA 4CU6A 1EJTC 3QN3A 1F3WA 2B31A 2X0YA 2XVKA 1OF8A 3HIJA 1S39A 3EWWA 4P8WA 1JRBA 2VFIA 3R10A 5CZTA 3B9EA 4HPJA 5ABGA 7XIMA 1WKFA 3GNXA 1R2TA 4B3KA 5HINA 2ZRUA 2C16A 3GBDA 1E6SM 3D0CA 4L4MA 3RHGA 4V1YA 3NQBA 3WQVA 4S2CA 3CQJA 3TTQA 3IGUA 1L6WA 2HV5A 5HJYA 5KITA 1JVNA 3W24A 1NWSA 4ML4A 3MUZ1 4FMVA 3ARWA 4CN6A 3R5EA 3MPGA 1N8WA 4GMEA 2P88A 4UTFA 4HQVA 2WQDA 4GI4A 1QNSA 4TMBA 1HFBA 2JALA 1Z8AA 3GTIA 3D3AA 1H7OA 1O5QA 4MOZA 4BFAA 5BOFA 1DBTA 4JQ1A 4Q4SA 5AFDA 2XFWA 2Y8UA 5E0KA 1MRQA 4I6KA 5AC8A 1KBIA 3UZ5A 1EXPA 5DMNA 1FDJA 2WW5A 2DT3A 4QM1A 2EPNA 1QOPA 3PPHA 4B92A 1DTUA 4QHRA 3QR0A 2QVHA 5KZEA 4A6GA 4YHGA 1UJQA 2HXUA 3K8LA 2QGHA 4C90A 1WP6A 4U31A 3BMVA 3UWZA 2ZZ2A 1WDRA 5MHBA 4HOXA 5MF5A 4NIRA 5I3DA 5D8WA 4P8XA 2E6YA 2E6DA 4FNUA 2ZZ1A 2HZGA 1SR0A 3UPMA 2Z0IA 3HURA 3I65A 1TPEA 4WJXA 4K2SA 1LL6A 1LUCA 1A0EA 1JRCA 3L68A 5ABHA 3MS8A 3R0UA 1YDVA 1NVMA 5E0CA 1SO4A 1U5HA 2PGWA 3HQNA 1GYNA 1K8ZA 3KBSA 3VNJA 4AWSA 3GDBA 1LOLA 2E1WA 3DFQA 1MEIA 2FVKA 2HNEA 3WUEA 2O4MA 5GNZA 2J4GA 1UD4A 3GIYA 1S2WA 2GL5A 4XISA 1F4HA 1QO2A 4G6CA 3VUSA 5T9CE 4DEFA 2XGZA 4H8VA 2DZXA 2HNHA 2OLHA 3ZT7A 3HG5A 4BJHA 5H6HA 3WQPA 5AN7A 2HMCA 1LQ0A 5H8UA 2ZBTA 3SURA 1N8IA 1V3KA 4IMCA 4UTLA 1XUUA 2OX4A 4FP1A 1UA3A 1S46A 1DTNA 2PDHA 1H0GA 2OYLA 3T0CA 5DANA 5I3FA 4DJEA 4K7VA 1GQKA 4UWMA 3STEA 4WZHA 1KBJA 1LG2A 3N13A 2QDGA 3WDJA 4MKNA 2X1IA 3L23A 1IXOA 3BLEA 2CWNA 4Q8NA 4PA8A 4GWEA 4DBEA 2JIEA 3KZSA 1G0CA 4E3VA 4XIAA 2FJUB 4JTUA 2HS8A 4FNRA 1ONXA 3EX3A 1QJWA 1RR2A 3K4AA 1KGXA 4GI8A 5K7JA 1M1BA 4J3WA 4XUGA 4TX9A 3HQOA 4XD5A 1WBJA 4KCVA 1TV8A 3VNKA 5D2XA 2GJLA 4GKLA 1XPYA 2VUNA 4Z1CA 3UT0A 4BQ3A 1A50A 2IQ0A 1XX1A 9RUBA 3KL5A 1NM9A 4CQCA 2C15A 3LXAA 2VL4A 2J9XA 3UNTA 1OINA 1XSKA 2X42A 2GDUA 1WYIA 3D3FA 4MNMA 4B90A 3LG3A 3SQSA 2DT2A 3W87A 5GNXA 2DT0A 1RK5A 4LUSA 4MGGA 5LIWX 1A4MA 3DG3A 2YXOA 4M81A 2G8ZA 4UR7A 3PUEA 3K1DA 3LLDA 1GOQA 4Z2JA 1US3A 1UD6A 4ZE4A 3PB0A 2VWSA 4X63A 3E0WA 2ZVIA 1W3TA 4U3CA 1GPFA 4TR9A 3EOOA 1L6YA 4O53A 3K13A 3IS4A 5JIPA 3QV6A 3CHFA 3DG6A 4AHPA 3PWAA 4S3FA 2DV0A 3TSDA 2OGJA 3WK3A 3CO4A 3NM1A 3MMWA 3TC3A 4ZOEA 2WNWA 2NQ5A 1J6PA 2DQXA 3CWHA 2BXZA 3GXMA 5F2MA 1ITCA 2C0HA 1QW8A 2PUZA 1TO3A 1DIKA 3BC9A 4R85A 2PDNA 1KCLA 4GHRA 2Z2BA 3SB0A 4ERIA 2R1KA 1RCQA 1WDDA 4AY7A 1XJBA 4L6OA 1X1NA 4RCXA 1BGGA 2DSWA 3SN0A 4PTMA 4IJBA 4GBDA 5DN1A 1J79A 4REQA 1V0LA 3IVUA 4JFTA 3SFWA 4I9TA 4NX0A 2VR5A 3N6HA 3WMBA 3DI0A 5IBXC 5CC6A 3B8SA 2BOEX 2J24A 1WXYA 2PB1A 3M0MA 1MNSA 3EA2A 1ZB5A 4J40A 1XL9A 3GTXA 2PC8A 2VZSA 1B3XA 4CEXC 1VHCA 3KVJA 3TLLA 1N7KA 3L4YA 4JNMA 3SCOA 1TZ7A 4WSKA 5A2AA 3VZXA 4NY2A 4W84A 1FWDC 2GOUA 2FZ8A 1EHNA 7ENLA 2YB4A 3GG1A 1K9DA 4Q8PA 2XM1A 2EBNA 4H01A 1U1JA 4HA3A 1Z41A 2V9DA 4P5UA 3GNPA 4PCNA 3T81A 4MWAA 3M9YA 1GYLA 4KCTA 2I17A 4Q8MA 4WVXA 6REQB 3GHUA 2E28A 2XJ7A 3CQIA 5HXMA 2Z25A 1K4GA 4POCA 3QSTA 3HQPA 5C2GA 3G1RA 2CYGA 1Q6GA 5GJNA 1LT7A 3MUY1 5CSYA 2OEJA 3WL1A 3H22A 5HJXA 1A5SA 1XIIA 3BGJA 1W1TA 3P5YA 3APTA 3L0GA 2V69A 2POZA 2TODA 4P7LA 4UTJA 3NQMA 2I5IA 4C6OA 4NASA 2OEMA 1Y5XA 2KAUC 2BG5A 4CQBA 3OA5A 2H3BA 1HL8A 2V38A 1FWAC 5XINA 1TZZA 5BXPA 3CV6A 4NZFA 3WQOA 1W5MA 2B7NA 3B40A 3ZSSA 2WMGA 3PZOA 2R1MA 3TMQA 1GQIA 2YCLB 1E0TA 2QF8A 2WVTA 4HHHA 4C65A 3B0VC 2XVNA 1Z44A 3ATYA 3EKLA 2WM1A 2FVLA 5L6UA 3LMYA 4FEZA 4DZIA 1BKHA 4GK8A 4NSBA 1G69A 1G5AA 4QEEA 3ZO9A 2QPUA 4LS2A 1HGYA 3ANYA 1GG1A 1LL7A 1X6NA 4KRUA 3OG3A 2Y24A 2W61A 3UWUA 4HMEA 1N82A 2YL9A 3M43A 5CXPA 3SQMA 1EGMA 3P14A 5D2YA 1EX5A 1OK6A 4HHLA 2DW7A 3EWBX 4R9OA 3FEMA 4C6BA 3AIRA 3NL3A 5FD0A 2X05A 3ZMRA 1XLMA 2RGLA 2OT1A 3ZIZA 4DWSA 3P80A 4YIWA 4C7FA 3WENA 4O50A 3N04A 4FALA 1Q66A 3M44A 3QOMA 4KBXA 3P7YA 3DBPA 1QK0A 4WF7A 4IZGA 2TAAA 3H4XA 3WFZA 5LZLA 4TVCA 3FEQA 5HNRA 4H8UA 4GYJA 4J35A 3CT2A 3FGCB 4XUYA 2PWEA 3CUIA 4IGNA 5IDZA 2WNNA 1H60A 3LBCA 4O10A 1JYWA 3VKAA 3NUKA 1F4AA 3P2VA 4QNWA 5H8MA 1DHKA 4WLCA 3VX0A 5DFAA 1JPMA 3GVGA 4JEJA 3T44A 3CIXA 4EK7A 1GQNA 2PLJA 7A3HA 3T40A 5LIYX 3MCNA 2AMXA 3H2NA 4BZYA 1FP8A 1SSDA 3Q37A 3UJFA 3TLQA 3LPOA 1BXCA 3DZ1A 1ICQA 3KHDA 3W7RA 3TC7A 4HSNA 3VD5A 1JZ4A 3SCSA 3GB6A 3HGJA 3LV6A 2OX1A 5D04C 1FWJC 2POTA 1LTDA 2C91A 3KS6A 5BOOA 1QASA 1TB3A 1QNQA 3UWYA 1ZP4A 4J3SA 4W7VA 3CIVA 4GPNA 1QMLA 1XH2A 3DUGA 3O2LA 5IRPA 3MB9A 1OD0A 1XINA 1XM3A 2TRSA 2WQPA 4I3GA 4RZ4A 5EMKA 4H9VA 3TN4A 1F6KA 3KOYA 5FI8A 3WLQA 1JUBA 1RA0A 1X8CA 2G0WA 3NQ6A 1IF2A 1E3XA 4BF7A 2QKFA 1ZBWA 1CEOA 4JQ2A 1ZP3A 2DUAA 4AD4A 3PBWA 1W3JA 3WH6A 5HANA 1FRBA 4B5VA 3CUXA 3EB2A 2JBMA 1XLJA 4XKYA 1H11A 3QR1A 1JDAA 3V36A 1F61A 4CD8A 4QP0A 1QPOA 4AD0A 6TIMA 5I3JA 3IUHA 1RY0A 3WO8A 2AGKA 2Y7EA 4GJIA 2O9TA 3SN4A 4BI5A 4GJJA 3FIGA 4HD5A 1TTPA 3HQ1A 4GQRA 1B3ZA 3GD6A 1KM3A 1BG4A 1VFHA 4BEQA 1EJ7L 3SI9A 2E1DA 4EOUA 1XLIA 4JTJA 4QTGA 1EWDA 1JR1A 1LQAA 1OCJA 4KGJA 1LP6A 4E2DA 5I78A 1XG3A 1GOWA 1KTCA 5D9PA 2WHLA 5CPTA 3B0YA 2YCEA 4ACZB 4KWWA 4H6EA 2OTDA 2D2OA 5HWJA 4F0KA 1UG6A 1B31A 1YDOA 3LCIA 5D9OA 5DXXA 2FGBA 5RUBA 1RPKA 1ONWA 5EBUA 4C6EA 2GWGA 4X0NA 3BE7A 5KETA 1KV5A 2VHLA 2BVWA 4LNCA 3REQB 4DZ5A 3M5ZA 1LDCA 5I02A 1U83A 4LCQA 5G4EA 1WZMA 1EDTA 3F4WA 1CXIA 3C3NA 4RPQA 5DELA 3W74A 1K3UA 3H21A 1JXJA 3ZR6A 4QSFA 4GA8A 4GABA 2PDMA 3FYOA 3LS9A 3NQVA 4EAMA 5CZJA 3VNDA 2O0TA 2WC7A 4RNHA 1U1UA 4H6QA 2QYGA 3W9ZA 2QEZA 2VD9A 5MKGB 2PCQA 1TJ2A 4OZOA 2CPUA 5KSWA 3VKJA 1XQLA 3SSZA 2A3AA 3AIUA 1ZUAX 2XTKA 2CLKA 2PA6A 3W07A 1I2OA 3AHTA 3FXYA 5KTLA 2NQZA 1EXBA 3NO3A 4DZHA 4JGDA 1TPFA 2P8CA 5GQBA 4FB7A 2NLYA 2WLYA 2I14A 3S8HA 1CXHA 2GQ9A 2J6VA 3QKEA 1BYAA 4PULA 4CCCA 3FSTA 4QJ3B 2G3FA 2I5GA 4F2TA 2GLKA 3AIWA 3SCWA 3F5LA 1KWGA 1T5AA 1JD7A 1AD4A 2WHKA 4NT0A 4HYWA 3EWZA 1GNXA 3A5FA 3MP4A 1O66A 5CPQA 1QU4A 1UKTA 2DVXA 2V6AA 3QGVA 3KL3A 3JZEA 2OWCA 1W1A1 3KCOA 4TTGA 3OZPA 3W1QA 3BMWA 4GACA 4YNGA 2OYMA 2R1NA 2YB1A 3BGGA 5AYYA 3TXZA 1ZRQA 5FKYA 1BFNA 1G94A 2TMDA 1FH7A 3O3RA 1DJYA 5CGQA 2IUZA 5AHIA 3LI1A 2A3BA 1E40A 1E1CA 2HROA 3S46A 1XLGA 5BYWA 1AH4A 4GO8A 5BU6A 2AQOA 4IIGA 3UPWA 3G0SA 5BW6A 1PXGA 3U2OA 3FA4A 1EPXA 2QS8A 2X7VA 4US6A 1OWQA 3GG0A 4UQDA 4XBKA 4O14A 1HIZA 1BHGA 4HP5A 3WJZA 3LPGA 4UTHA 4AZCA 2F9RA 4LS1A 3U7VA 3A22A 2WSQA 3DENA 2O9OA 3WQ5A 2EEXA 4JIQA 4DLMA 4QS5A 3NPUA 3UZWA 2RKXA 3TN5A 2AGTA 4RXFA 5BZAA 1R3VA 1W31A 3RJYA 3H55A 2ZXDA 1LJYA 3S47A 4XAGA 2XGBA 3ARXA 2OQLA 2OWWA 3ZQ9A 5CG7A 4QISA 3W1RA 1JI1A 1XBXA 2UY2A 3NSXA 4JIEA 4K36A 3L65A 3AIBA 3CWNA 5KZMA 3FOKA 3G1FA 1ISYA 2OOGA 1KCXA 4PMOA 1ADSA 3UZJA 1JYNA 4J3XA 3IIZA 2E7FA 1CXKA 2PDUA 4Z2KA 5LIKX 5A94A 1TVPA 1LOQA 1H4PA 1QNOA 1VYSX 2WV8A 5A6TC 2NVAA 1W6TA 4OWGA 4JAWA 4LF2A 1QVBA 5AHLA 1IEQA 3E0IA 4GUFA 3PVFA 4IUOA 3T8LA 5T26A 3ONCA 1TVLA 5D8ZA 5LSMA 1CGTA 2O92A 1PKLA 1T99A 3I4KA 3W88A 3LD5A 1QW7A 4J3TA 1Z48A 4TV5A 5L9FA 3AZSA 4TX8A 3M1ZA 2YLAA 4HT3A 4JTAA 3VKDA 3H2OA 3PPGA 2Z1KA 4K68A 3BOXA 3SCVA 1NQ6A 4XB3A 3P6LA 1M3UA 4HMDA 1POKA 1BTCA 1XBZA 3SAZA 4J3ZA 3M0IA 2DZPA 4UNLA 1ZJIA 2PLKA 3NPXA 5G2IA 1FY6A 2FGLA 5JH2A 3IJ8A 4AX7A 5J8LA 3WD3A 5IFTA 1B3WA 1BF2A 1IXPA 4WUIA 3LX9A 3JRKA 4E4UA 3G3DA 1UZHA 3I6TA 3MKCA 3C56A 3QVQA 4AF0B 1QO5A 3KRSA 4F9JA 3BOLA 4I5XA 1OCQA 3INPA 3L67A 1P48A 2NV2A 3M64A 4Q8VA 1VP5A 4LVFA 1JGIA 1QHZA 2IXUA 1XCWA 4XAYA 2E5BA 4JIHA 4JHZA 1VBUA 2HISA 4F0LA 5CJ5A 3NGFA 2BVYA 4O0ZA 4NAEA 2CLMA 3S2JA 3R43A 1AH0A 5J5RA 4Q4QA 4M1RA 3UXDA 4QS6A 3ICJA 4PEKA 1LRQA 4PUKA 3CMGA 3B8WA 4FZIA 2E40A 3W85A 4JQAA 5AHNA 1GVIA 1KR0A 1LF1A 1AW5A 2ZYFA 4GXMA 1Q8AA 1R87A 4HNNA 4GUIA 4GFIA 1U33A 3FJ6A 4JBRA 3ALGA 3E74A 2C6QA 3BG3A 3QMSA 2DJLA 2PLMA 1ISWA 3N25A 1KO0A 1D7KA 4XZNX 5EGRA 3IV3A 1A5KC 2W91A 4JX6A 4AYGA 3XISA 2BOFX 3KOWA 4LAOA 1BAGA 1P6WA 1O5RA 5DMMA 3AUOA 1AODA 4MZ8A 3TTEA 1TTJA 3PM6A 4DJDA 1WZLA 4CNNA 1YLVA 2XZ7A 2J88A 4GVGA 1HXJA 2GK1A 2ZA2A 5LHFA 2WMJA 3TYZA 5I5RA 1UW9A 3PJTA 2XFFA 4DYJA 4CD6A 1EL3A 2JKAA 4I5UA 4AG0A 2ZC1A 3L0KA 2WPBA 1VJSA 2WKJA 1Q6FA 1VAHA 3FCPA 3W4RA 1TRIA 4LOCA 4PTVA 4DZAA 3GNOA 4IPPA 1Q4NX 4HHPA 2VELA 3TR9A 3P82A 1Q6EA 2D3LA 1E0WA 1T8QA 1XIMA 2NXIA 1NAL1 4WQ6A 3S0CA 2KZHA 4TTUA 4JS3A 2VYOA 3N3TA 5CPOA 3E49A 4FIRA 4FHAA 3ABXA 1H1YA 1LRTA 3WSUA 1J93A 4X60A 4FXFA 1WA3A 3OZOA 3PB2A 3P93A 4EPEC 1LYXA 1WB0A 4IL0A 4YL2A 2PE4A 3MSGA 3DYMA 3PC0A 1H3GA 3VD7A 5JH1A 3KLKA 5K9DA 5C70A 3LMZA 3VNZA 5CAHA 2G5WA 1X6UA 2AAAA 3VKKA 1W56A 4D6JA 1R7AA 1M53A 2QAPA 4MWAE 2E0PA 2GSEA 2FZ9A 3EWXA 3LPPA 3TUUA 2XISA 3H12A 4H1ZA 3B9OA 2D2GA 3I3BA 4JPGA 3WF3A 3QFEA 4H6RA 4JYDA 4B15A 3EYPA 5G1MA 3O6AA 2BY2A 4QE4A 4QROA 4J3VA 3PUGA 2QMJA 3PTKA 4G7FA 4N0RA 3T2OA 1E70M 5EFDA 3W71A 2X1UA 1CT5A 1A5NC 4MNJA 1BYCA 4GX9A 4RE3A 5LGZA 3E1F1 3LN3A 1K1DA 1RCOB 1ZTVA 4TO8A 3ELFA 1DWAM 5FJRA 4Z2GA 3GXFA 1H7RA 4HVXA 1T7LA 1OBAA 4QBXA 3VABA 4LSBA 1YDNA 2DP3A 5JMUA 3SY1A 3FJNA 2G3IA 8TIMA 3R8RA 2ZRXA 1KFCA 5BMWA 3W37A 3NZPA 1Z32X 1UPMB 4K6AA 3IJDA 3KTXA 1JPDX 3BH4A 4HYRA 3MUAA 1JQXA 3F4CA 3NL6A 4GY1A 2ZRWA 3V7PA 1PKYA 1UQYA 4NI8A 3MO7A 4D2JA 4KWVA 3R6IA 3RO6A 4JTHA 4AISA 1KFLA 3NXFA 3SUWA 3QV8A 3EXSA 4UFJA 5C9XA 2FKPA 4JZ5A 5FIPA 2F2HA 1HKMA 1EHAA 2PGRA 4EP8C 4I7WA 1AQMA 2DZBA 4UOQA 2C1IA 1O12A 3W7IA 1MZRA 4NILA 4C1KA 2HEJA 1D3GA 1GVOA 1HVQA 4O1CA 2Z2AA 4FK9A 3LBMA 1EC8A 3GXTA 1VLIA 5HNTA 1CGYA 5TF0A 2YW3A 1GK8A 1GVFA 4FO4A 2XVPA 4JL1A 1IEIA 2O7QA 2PTZA 3IVTA 5FSDC 3USBA 4ZVJA 2A7NA 3CB8A 1F6YA 4HB7A 4V33A 3N2XA 1U22A 3VAVA 3LCFA 3QZEA 1DXIA 1MNZA 2EQDA 4GIEA 4O0QA 4ADSA 4FNTA 1ESWA 2WJZA 1KKOA 1RLDA 2Z1SA 4KWUA 3WNNA 1EYWA 4L4LA 2ZX9A 3S1GA 3OQ8A 4C6KA 3C0LA 4UQCA 4IX0A 5HWMA 1E0UA 3AXIA 1HKKA 1K8XA 2XN1A 5AYXA 2OT0A 3A4XA 4UFMA 3VCCA 1QWKA 3PZVA 3DHDA 3RCNA 3FK4A 1RUSA 1DIOA 1E6PA 5K2ZA 4QE1A 4DO6A 2CLHA 1M7OA 4BA0A 4OKDA 2RDWA 4GE8A 3V0SA 1W5OA 2B7OA 5F4SA 1C8QA 3H2MA 3E0LA 4NZ4A 1OJXA 2FB3A 1EP2A 3CK5A 4Z2HA 3RX3A 2MUCA 5HQLA 3KBWA 2B7QA 1BD0A 4IXHA 5FAGA 2XVGA 3G1DA 3CL6A 1JZ8A 2SFPA 3U57A 1KM2A 1PWLA 4J27A 1M7JA 1R6WA 2E4TA 5F1UA 4IL2A 2A1YA 3SRHA 1TV3A 2BNJA 2BVTA 3LHWA 1DYSA 3KW3A 3AHVA 1DJZA 4W7WA 5EY5A 3LHTA 5BXTA 4PSPA 4LV4A 1O94A 2Z1BA 2PDIA 5FA5A 3NQ8A 4JNZA 3E9AA 3DGBA 3W7LA 1H7PA 3N29A 3TH6A 3NZ1A 1A53A 4Q33A 1AK5A 2I9EA 1JZ6A 1OEPA 3UG3A 1UP3A 3TR2A 1XHGA 5DBTA 2C1HA 3POCA 6ENLA 1VYRA 2FJKA 2RUSA 3PG9A 2VP8A 1F7BA 4D6HA 3P84A 1YDYA 3W26A 2ZUWA 1XLKA 4D8LA 1UIPA 5KEZA 1OF6A 2DEPA 3S83A 2GQ3A 1DKWA 3K8MA 3GE7A 3UXIA 2L5HA 4FSAA 1MI3A 3B9DA 4AY1A 4CLMA 4C91A 1C7TA 2DZAA 1HW6A 1IV8A 1N8FA 3LQLA 5A6AA 1YTDA 1E9ZB 3L66A 1LBFA 3RPMA 3ZJKA 4CQAA 3APYA 3GC2A 5C9RA 2ZRVA 2Z00A 4QGCA 3U3HA 4AC1X 4AIBA 4N6FA 1KXHA 3BLPX 1B2YA 1XIBA 2INZA 3A13A 4RDYA 4M1BA 1VFSA 2J8FA 2DUXA 3W75A 1W2VA 4P2VA 3QSRA 2HCVA 4FLRA 1V6XA 4JIRA 3KOXA 3UZYA 2O7SA 3OQEA 3MDUA 5F7UA 4HK7A 4MY1A 3PJXA 3E6EA 7TIMA 4PB3A 3GSMA 1XRVA 4AD1A 2IS7A 2Q09A 3A3WA 4M19A 3SGUA 4XK2A 1UKQA 4PBGA 4R9XA 3GAKA 1ELSA 1K4HA 3H24A 2PF0A 1FDYA 1UWAA 3ABSA 1LWHA 3A4WA 5CKSA 4EKJA 4DJFC 4HNTA 4PUUA 1WKYA 3E2VA 5D2TA 3A24A 3G77A 2NUWA 2DVUA 1E55A 1UUMA 2VDHA 2NX1A 2PDXA 3CC1A 3AMGA 4F0HA 3DEQA 2NW0A 4MJ4A 4OECA 2OLAA 4K1GA 3FLUA 4M80A 5HMEA 2A3CA 3RU8X 1KFKA 1GZ1A 1UZ4A 2ZZ4A 3Q65A 4HGXA 2WVUA 1HGWA 1NF0A 4A22A 3VX1A 3MWAA 4WK9A 3FDGA 4RE4A 6REQA 3NEHA 1B3OA 3T55A 1S2CA 4PUWA 1H51A 5ECUA 3GDMA 3H2EA 1EIXA 2H8XA 1UQZA 5IHRA 5CSRA 3KOFA 4E3TA 4FR1A 1SW7A 3HB9A 2D0GA 4DBUA 4F9DA 1W9DM 3OGSA 1HKWA 1IWBA 2VVNA 1KTBA 3CHCA 3O6DA 3VIJA 2W62A 3MHGA 4MYXA 3P81A 3HPFA 4PMXA 3DESA 6CGTA 1XH1A 1MZHA 1BVNP 5FEPA 3NR0A 5JBDA 2WWCA 3W2MA 4DM2A 4HTYA 1FHLA 3WQ4A 4US5D 3IGSA 4IIBA 3EA3A 4JHOA 1PCWA 3W28A 2WVVB 4Z08A 1CDGA 2V5LA 3HGSA 3UCQA 1F8MA 1C7SA 1KB3A 2A7PA 4KEUA 2YCLA 1BVWA 4H3DA 3FFSA 3VI2A 4D8ZA 4ZQRA 3OTRA 2CKSA 1KXVA 1R86A 4MVAA 2HDJA 3GXIA 3T09A 4FX8A 2GVLA 1MFUA 5HNUA 3GXPA 4QAWA 4JN7A 1Q6DA 4N9BA 1VFMA 3O8AA 3AIEA 3SJNA 1MYRA 1RALA 3MJMA 4LEFA 3N9SA 3W01A 4O4VA 1NDVA 1YBQB 5KMYA 5EPDA 5G2HA 1BYBA 1JPIA 4MTVA 4M29A 3T7VA 1GORA 1B57A 4IMDA 4UCFA 3VGFA 3NO5A 4HOZA 1W3NA 3A3XA 1SSGA 4PB4A 2A7RA 4GGHA 4H7ZA 3W82A 3GUGA 4Y2WA 6TAAA 2J77A 3KLLA 2QNEA 3RFAA 2JFEX 4IQEA 4Q8WA 5JBFA 3AS2A 1UR4A 4PCFA 4V1XA 3UGVA 1KFWA 1RVGA 1UPPA 3WF1A 4N02A 2UWFA 3USZA 2PTWA 4L1XA 1WUEA 3C86A 3HFYA 4AYSA 3GIQA 2CLIA 3HG2A 5H91A 4PH6A 3QW4B 2QCNA 4JIPA 3VCNA 1WOBA 1NJJA 3FGCA 3SFKA 1JIBA 4TIMA 3IK4A 3ATZA 4JTFA 2XU2A 3VKBA 4F2UA 3T08A 1IWAA 2G37A 2QUTA 2H9AA 4DXKA 2HSAA 4R7JA 3BURA 1PAMA 3CQKA 1TJ0A 4WSHA 5M2FX 1E15A 1R5YA 3RM4A 5CBJA 2OKTA 1TR9A 1V8EA 1W8SA 2DZVA 4L9ZA 1Y5VA 2ZUUA 4MJMA 3RJXA 4J2PA 1LZOA 3E12A 3G1AA 1GJUA 3L7RA 1OT2A 3UVAA 2HWGA 2YYUA 1XD1A 2GJXB 2CU0A 3W81A 3E0VA 4XAFA 2Y70A 1BRLB 3E3HA 4ZO9A 3DYPA 4LCSA 3PBGA 1UB3A 4EWND 2WKLA 3T0DA 1VFTA 1VH7A 4G1KA 5ABTA 2XINA 4P7NA 4JEQA 3O16A 4AIUA 1CIUA 3QV9A 4NJIA 1XLDA 4WJ8A 1XYFA 1JULA 1QW9A 2W0UA 4L7ZA 4E4PA 4CQ9A 3LHUA 2IPGA 3ARSA 4A3UA 5I23A 1G7UA 4YPJA 4PMUA 2ZX6A 3M6DA 4C6IA 4N4PA 2P53A 4UUIA 1NOWA 5DRCA 2YGYA 1MUCA 4UR9A 4ATLA 2ACUA 2TPSA 2VXNA 1ISZA 1F3TA 3G0XA 3M5YA 3XINA 2BV9A 4RZBA 3QPYA 1YE4A 2NLIA 2VGBA 3H2CA 1XISA 3EOUA 4KQNA 4ZENA 4A3YA 3HF3A 4NF7A 1AVAA 1O95A 1HL2A 2WMIB 5M17A 5HATA 5EFFA 3P61A 3FJLA 4DJFD 2V68A 3UP8A 2JGYA 5I3HA 5BRBA 4FIQA 4NG3A 4DIAA 3ZT6A 3BVJA 4IFRA 3GVQA 1EP3A 1WZKA 4YCPA 1AZ1A 3R8HA 3SECA 2OU4A 1IR2A 2QV4A 3BAIA 5TAOA 2D22A 3CZJA 1ZLPA 3GR8A 1KBBA 1NY1A 1X96A 3M7WA 2CBVA 1GOXA 2V5DA 4DVOA 4ZA0A 1PB0A 4ACZA 2FPTA 5TQLA 1C91A 3PZTA 1UUOA 4PTDA 4A35A 3KRUA 1T96A 4KH2A 2G4JA 4ZQCA 2OPJA 4JCLA 4JTEA 5FF4A 1UJPA 3R12A 3W23A 1WPCA 1PZ3A 2EPOA 1FFRA 5BOEA 3REQA 3VIMA 2QW5A 2FZBA 2Q8ZA 2YYTA 4WKFA 1US2A 3CAQA 5EB8A 5CBBA 3M5VA 1KRCC 1W5PA 4GFSA 3GTHA 1JF6A 5JU6A 2VGIA 5DXYA 4FX6M 1KR1A 4YLWA 3F4DA 3QR3A 1D8CA 2A5HA 2YDSA 4PC8A 3BG9A 3VNYA 4XZBA 4N9DA 4B5TA 3LTSA 3MT1A 3IJ6A 3SCQA 1DWHM 4O57A 5K4ZA 2HE5A 1GVEA 1XFBA 3GH7A 1K6WA 4EF9A 2C0AA 3SCPA 5HMFA 5ABFB 3OJGA 3HG3A 4GH1A 3IRDA 5DMLA 5KZDA 1YKWA 3M7SA 1GTEA 5C7VA 4BEUA 4DAIA 1A3XA 4B16A 3S1VA 3PTQA 3R0KA 4ONVA 3WLJA 1FBAA 3FJ4A 3S2CA 1NWTA 1NFGA 5CCZA 2YL5A 4W5UA 1M9HA 3CL7A 1RP9A 4YU1A 1MXDA 3ANVA 2NV9A 2CXGA 3IGXA 4XX6A 1SQ7A 2WC4A 1RD5A 3GBEA 3RO8A 2DZWA 3W1PA 3WUBA 1VPYA 2E9BA 1B3YA 3ENLA 3T0TA 4AXNA 5BMXA 1FWSA 2F8QA 1C8YA 1J4EA 2QHAA 4ZODA 1W3KA 2EGZA 3LM7A 2QDHA 5I3IA 1SM9A 1VS1A 3AHYA 3IUDA 5HMDA 3PSWA 1HKJA 4PMZA 4FLQA 5I00A 4C6JA 4XVEA 3WLMA 4U5KA 4LH8A 3V0TA 4MG4A 4DRSA 4IIEA 3S42A 4IP5A 3WLOA 1C8VA 2FDMA 2ODOA 2EPHA 2REQA 4EANA 2GUUA 4I9JA 3BJTA 3DN5A 4NNBA 3O63A 2WCGA 4M6PA 4A8NA 3J7HA 2WSRA 2ZDSA 4RNIA 1MW1A 3AI0A 4ZQPA 1U1HA 3BW4A 1W9BM 4UFLA 4XSLA 3WQWA 3VNLA 3L4XA 1KM6A 2GVYA 3WH7A 4FNSA 2WC3A 4Q6JA 3WLRA 2VEKA 3EZ4A 3OVRA 1XDJA 3PBMA 3I6EA 3QKZA 4CN4A 1TZ9A 4AAJA 3SRDA 3P60A 4Q4OA 1JL8A 4QJ5B 2J7HA 3S4TA 3PFMA 3AYVA 4C6FA 4E2VA 1DXFA 4AC7C 3MW7A 1A49A 1KGWA 4MY9A 1W9PA 3GS6A 2RJHA 4IFKB 4CCDA 1QAPA 3U9IA 2PSNA 1H2JA 1CGUA 4HNVA 2FH6A 1FWTA 3RXZA 2XIJA 3D5HA 4LPCA 4A21A 3VOIA 3DU0A 3H4GA 1GQLA 4UMAA 1XC6A 3WQCA 2R82A 1SZGA 3OYZA 1J0ZA 2W5FA 3R11A 3TYAA 1UUQA 1JCJA 4AY8A 1FCVA 3S6TA 3UG8A 2F7FA 2WXDM 1UP2A 4R34A 3C8FA 3GW3A 2ZA3A 3AIVA 1JDCA 1B54A 4LWWA 2YIHA 1HKIA 1XIHA 5SWUA 1KRAC 3K1GA 2Y62A 2PF8A 1ZJHA 2PWDA 2Z7KA 1WDQA 2DSUA 3EDDA 1ONRA 2ISSA 3LOTA 1REQB 5EKYA 3L4WA 4D6GA 2GPTA 3OEXA 2ZTKA 3GM8A 3VDHA 2BHZA 2Y5JA 1OT1A 2J75A 3MUIA 4AEFA 4DXVA 1GEQA 1MW3A 4RDZA 5A6JA 5I07A 1WV2A 4G7EB 3N15A 4PN2A 4D8AA 4U2ZA 1JUEA 2Z6JA 3MYOA 5I3KA 1S5VA 3CEUA 5EA9A 3MU7A 5EU9A 4BKNA 2WZEA 1S3HA 1X98A 3S2NA 5AC6A 4AF0A 1OX4B 1VYPX 2XWEA 1SJCA 3W0KA 4HNCA 2YXXA 2R94A 4IMEA 1MW2A 4M24A 4KT2A 2VDIA 3WL0A 1RP8A 1IHIA 1J01A 4XO6A 3TV8A 1FWGC 4GO9A 4PMDA 1R9XA 4IT1A 3RLHA 3KBMA 1EJWC 4QX4A 1E9IA 3NQ2A 4MFDA 5FJIA 3SEPA 4N9EA 3WNOA 2Z6IA 1WOAA 1E71M 3W1MA 4GVHA 3LZ3A 3P0WA 4O19A 4H2CA 4ZQMA 2DSVA 3IJ9A 3S5YA 3BCDA 3P67A 3TK7A 2F6KA 1B0IA 4UZUA 4PEEA 9CGTA 2NWSA 1MWOA 2OZ3A 5D2WA 1OY0A 4M8UA 4JN8A 1IZCA 2FIQA 4Q6XA 4W89A 2OJPA 4Q4KA 2R24A 1K03A 3LTPA 2XH4A 3VIGA 3VDAA 3RLGA 5M5DA 1A47A 1PYFA 1PEZA 1TMHA 3RN6A 1XXXA 4KIRA 3UY8A 1MUMA 4K8EA 2ZDRA 4JX5A 2ZZ6A 2HK0A 1DJQA 3URQA 5FJJA 3F5JA 3CQ0A 1L6GA 4FX7A 2P5NA 3WQDA 3JUGA 1TPDA 4C1NA 3BV7A 2HS6A 5A6SA 1QNRA 1BLIA 2DIEA 5LKYA 2HRWA 4LVBA 1UD2A 2VZTA 3MY9A 1FTXA 1D3CA 2UZ9A 5EMMA 4H9MA 4A3QA 4UZSA 5AYZA 1FUYA 4QG9A 1GQJA 4O8RA 4KEMA 5AECA 2X1SA 3R89A 3ZLFA 1WQ5A 2BY3A 2O9PA 2UY4A 1SZFA 3EEGA 3W1LA 3QY8A 2OO6A 2UY3A 2FMNA 3BZJA 3WQEA 2V8ZA 3RR1A 2BXYA 1F6PA 5E0FA 3ONBA 5AVNA 4HZ6A 4XBJA 1FA2A 1OFOA 4ZQNA 2HBXA 3WNLA 3TWAA 3D46A 2BGNE 4UTTC 2GUYA 3S2LA 1TX2A 3HGOA 3DBNA 3BLIA 1E9LA 4Z0JA 1W3IA 3RLVA 4CQDA 3B8IA 3B97A 1PBGA 2WPGA 4ICCX 1XSIA 3LTYA 3NPWA 2QDDA 2ZXQA 2ZUTA 1OFDA 1EDQA 3STGA 2B0MA 5I03A 4LJ3A 4PMVA 3ARYA 4J7RA 5C8BB 4HSHA 1TV5A 4HA1A 4KFOA 4ZSUA 5FJPA 4IMAA 2Y1HA 4PUMA 4LALA 4HPXA 1F9CA 1RD6A 3W1XA 1K8CA 4O1DA 3OIXA 1GPWA 1ZZMA 2OODA 2CETA 2IPWA 2QF7A 2DIJA 2BWGA 4NJHA 3B3DA 4ZR8A 3AQUA 4AVNA 2OSWA 4O15A 3MP5A 1U30A 1EKOA 2F61A 1WDWA 3AYRA 1E4LA 2ZVRA 5D2VA 4QIUA 4DQWA 3H6OA 4WKAA 1LWIA 3G1SA 3W6LA 4PBEA 4TUFA 3VGDA 3LCWA 5HWNA 3MANA 1XYZA 2XIQA 2JQXA 2VENA 5CGTA 3TQKA 3KZPA 1FWEC 4DBDA 4UXDA 3OP2A 3MI6A 1X1ZA 4LX4A 1UR3M 4OBTA 3CUFA 4AZGA 3GQYA 1RQBA 2VNCA 4DAFA 3N73A 4C6QA 1X38A 1UCWA 3PSVA 1UH3A 4WY0B 3DFYA 3DC8A 3FYYA 4HA4A 3GNRA 4M6VA 4N2YA 2PWGA 2WMHA 3BSHA 2G96A 5D38A 4WIWA 2C19A 1SJBA 1OFEA 1NFPA 2GWNA 2ZFAA 2TSYA 4TMCA 2VEPA 1PZ2A 2V5JA 5LNSA 1RJRA 4HNUA 2YA1A 4JOMA 3G18A 4OHQA 1SZNA 4O1EA 4X61A 3QXBA 3VGBA 5HR7A 4FPSA 1LUCB 3HO8A 3U4AA 1JZ2A 4OOZA 5FJOA 1EO5A 4S38A 5HPCA 4NJJA 1QI3A 1V0KA 3K8KA 3LSCA 1JEZA 1CECA 2A21A 3OB8A 1TWZA 2Z24A 4M0XA 3VZZA 3UVIA 3W7KA 4CKQA 1H62A 1AQ0A 1IZKA 3PANA 3BG5A 3U6WA 4CNSA 5A6BA 4F48A 3RIKA 4INFA 5LNUA 2X16A 7TAAA 2V5CA 4FXRA 4O4WA 2QUMA 4ZFMA 1YHTA 1SPQA 1OC5A 5FEZA 2ZUSA 3ABZA 2FTWA 2PWVA 4EE9A 3JVAA 1J0HA 3NXLA 3QGAC 3IACA 1BPLB 3W00A 3IJIA 1QHOA 1KNWA 3SY8A 4L9YA 4PCSA 1SZEA 4MSSA 3EMCA 5TD4A 3T05A 5DO8A 1X39A 5B7YA 3L5AA 1VFFA 3BJFA 3R2GA 4CD4A 2I1OA 3AMDA 3PNZA 3QGKC 4H00A 4WRHA 1R7OA 4I9MA 4IOTA 1RAKA 3MSRA 4JDYA 2XGIA 1Q6OA 3DKLA 4PRRA 3F5KA 3G3MA 3AJXA 1TELA 3CPUA 3DHFA 1EF2A 3U4FA 3W86A 4WY0F 1R2RA 5D32A 2EO7A 1E73M 2J66A 5BROA 5D9NA 4KWOA 2QR6A 1O4UA 4FXJA 4K8HA 3LK6A 1AQHA 2CXEA 4K38A 1MEHA 1FH8A 4MB4A 2ACRA 3SQLA 2CLPA 2CBUA 2ZRYA 2QUNA 1M01A 5BNKA 3DC0A 3M07A 3T42A 4HBKA 3UZXA 4AWUA 3EDJA 4QXIA 3LLFA 4FF7A 2CBJA 1SW3A 4HN8A 3BGAA 3SDOA 1WNOA 4RW5A 2VC7A 5HDRA 3EOEA 1PX8A 2YA2A 2LLEA 1QI0A 3WH5A 4ZZ9A 2Z1WA 3E5PA 3OZMA 4L1GA 2QCDB 3GAYA 4LUSB 1XSJA 4KRZA 1F07A 4MMWA 2EPMX 2ZRZA 1PJ9A 4HU4A 4NUWA 1LL4A 1Q6CA 1E4IA 4WOZA 1PL9A 4F3HA 1QPKA 5GVJA 5AZ1A 1OZMA 1A5LC 2A6NA 2V2HA 4H83A 4IMGA 1VZWA 1J8VA 1XG4A 3QRHA 4PUJA 4ZO8A 1RZMA 3JW7A 2OYKA 4AX6A 3Q2DA 3TYCA 2NT1A 4NJKA 4ADTA 3GZ3A 1ISXA 4OTKA 3PFRA 2W63A 4K8GA 3TROA 2QPXA 2X30A 4MIMA 4QLLA