2GSJA

Cdna cloning and 1.75a crystal structure determination of ppl2, a novel chimerolectin from parkia platycephala seeds exhibiting endochitinolytic activity
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
271
structure length
271
Chain Sequence
b'GGIVVYWGQNGGEGTLTSTCESGLYQIVNIAFLSQFGGGRRPQINLAGHCDPANNGCRTVSDGIRACQRRGIKVMLSIGGGAGSYSLSSVQDARSVADYIWNNFLGGRSSSRPLGDAVLDGVDFDIEHGGAYYDALARRLSEHNRGGKKVFLSAAPQCPFPDQSLNKALSTGLFDYVWVQFYNNPQCEFNSGNPSNFRNSWNKWTSSFNAKFYVGLPASPEAAGSGYVPPQQLINQVLPFVKRSPKYGGVMLWDRFNDLKTKYSSKIKPSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein PPL-2
publication title cDNA cloning and 1.75 A crystal structure determination of PPL2, an endochitinase and N-acetylglucosamine-binding hemagglutinin from Parkia platycephala seeds
pubmed doi rcsb
molecule tags Hydrolase
total genus 99
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gsjA00
2ZX5A 3M07A 4ZEPA 3F5JA 1VFFA 2CEQA 2DH3A 4WKFA 3BAWA 2JEPA 2X1IA 2ZX6A 4TVDA 3AIUA 4BS0A 2CESA 4BQ3A 4E2OA 3VX0A 3VINA 4JCMA 1C93A 3VGHA 1H4PA 2YL5A 2PWFA 2D24A 2WMHA 3FW6A 4PUDA 2W4XA 1CWYA 1LLOA 4BA0A 2ESCA 3NIYA 4J7RA 5IXEA 4Z2LA 2F61A 4JFWA 4J3VA 3CIVA 4UQEA 5A6AA 3RM4A 1IZJA 2G8ZA 4U2YA 1IT0A 4DWSC 3BSHA 5D4YA 3BCDA 2WYSA 1LG2A 3K4AA 1NOFA 1UR4A 5D8ZA 4W7VA 9CGTA 3SCQA 3ZQ9A 1E43A 1V6UA 2ZE0A 3U5UA 1JFHA 2VZSA 1UA3A 1HVQA 4PUEA 4A3YA 1CPUA 4JKLA 2J7HA 4E8DA 3SCNA 4D72A 4D6IA 5DEZA 4PMZA 1J10A 4F9JA 2PI6A 3AOFA 2XWEA 5CZKA 1V0NA 1HXJA 3WH9A 5A2AA 1CENA 1JYXA 4J3UA 1G94A 3AMGA 2G3MA 4RL3A 3IAPA 4MNMA 1KWGA 5BXTA 3UG3A 2DT2A 1HKKA 1R85A 4MB5A 4AXNA 3BSGA 1H0GA 3WH8A 2GJRA 5A94A 1UZ4A 3VX1A 1UD4A 3K4DA 3VIIA 3SCSA 1H11A 4P8VA 2XVPA 5E9AA 2W61A 4CU7A 3PZ9A 1JAEA 3W25A 1JD9A 5BRPA 3AMKA 4CD6A 3T0AA 3W27A 1G5AA 4M29A 3WDHA 2EPLX 2IXVA 1W9BM 1LL4A 1JZ7A 1W9PA 2WPGA 1TVNA 1E55A 1SMDA 4JAWA 4MPKA 2WC4A 2DDXA 2V38A 2WZHA 2DIEA 3VILA 3FN9A 3NUKA 1W1VA 1VB9A 3OLEA 1W1YA 3A47A 2O9RA 4MADA 5FL0A 2IUZA 3EDJA 1Q4NX 1ZB5A 2IXUA 3GNPA 1HKIA 2VO5A 3SUTA 2VRJA 4UFJA 4MNKA 3RM9A 2ZICA 5EB8A 3AIQA 1BGGA 4OIFA 2YOCA 5A8PA 4AC1X 5A6MA 2XVKA 4AEEA 1CNVA 4ACZA 2V3DA 2Z1KA 4DWSD 5I0DA 2UY5A 3ARWA 5CLWA 2GFTA 3GYCA 2CERA 2C0HA 4MB4A 4CCEA 2BHYA 3WQ6A 3AI0A 4HOXA 1DEDA 4ZENA 1PX3A 1GW1A 4MB1A 3G6MA 1KR1A 4CGTA 1XSJA 3LMYA 5HPCA 2RGLA 3F5KA 4PTWA 1GQLA 5A6SA 2J7DA 4ZXLA 1KB3A 2DT1A 2WCGA 3I3BA 1E6QM 2Y2WA 2E3ZA 4HMDA 2ZWZA 3BMVA 3DECA 4OZOA 1GJUA 1W3HA 5I79A 4M1RA 3WD3A 3VMPA 4TOQA 2GJPA 3N18A 2NSXA 3LPGA 3BCFA 3MMUA 4S3KA 1BHGA 2EJ1A 5EMYA 3L4WA 2DT3A 3SUVA 4DUXA 1C91A 1VRXA 2QHAA 1HJUA 2YDRA 2W66A 4KGJA 2FHCA 4C7DA 4QLJA 3WDPP 1V3KA 3ZSSA 1HL9A 1S46A 1MXGA 1Q6DA 3OLGA 4W5ZA 4AYSA 1MW1A 3AYRA 1OIFA 3PZMA 2G3NA 1E3XA 3S2CA 2X09A 1VAHA 3PZVA 4LYPA 2E9LA 1R7AA 1E56A 2PWGA 2DT0A 2WVUA 6A3HA 1AQHA 1OGGA 5CQ1A 1OT1A 1WDQA 1D7FA 2VZTA 3BC9A 2YBUA 2BY0A 3EYPA 4W84A 2OWXA 1AMYA 1K9DA 5M5DA 3FHQA 2WC7A 1LG1A 3N13A 2WWDA 1PIGA 3SUWA 1EDQA 3WSUA 3MKKA 5AYBA 4FLRA 3U7VA 1I1WA 1J11A 3W81A 4UOZA 1VF8A 5CG0A 1CXIA 1CXHA 1E3ZA 4IPLA 3SURA 1HT6A 1VFMA 4AWEA 2G3JA 2EPKX 1OIMA 3QOKA 2GJXA 5DF0A 5FCZA 1CDGA 3MMDA 2VQUA 2ZIDA 1UWQA 2WK2A 2W91A 1V03A 3VIMA 4PRWA 4PTXA 2BXYA 2FH8A 1BYAA 3QR3A 4AZ6A 1DWHM 5FOOA 3CH9A 1WE5A 1X6NA 3THCA 2J62A 3AFBA 4DUWA 1BYDA 1YHTA 1JZ8A 2WMIB 4OBSA 3HU7A 4W85A 3B9EA 3GBDA 2ZUNA 4KRUA 3VGDA 4GZEA 1CZ1A 2XJ7A 4D6FA 4XB3A 3SIMA 1NQ6A 3BAIA 4BQ2A 1I75A 3BAXA 3AS1A 3AZSA 4GINA 5A6KA 1LJYA 3EDEA 4IUGA 2BY1A 1XD0A 4M82A 2CXGA 1TE1A 2GVYA 1FOBA 2X2YA 5C8BB 1J0JA 1MQRA 4L4OA 3BAKA 3SCUA 2J47A 3WF4A 4EK7A 2BVDA 1EHAA 3OGVA 5ABEA 1G9HA 3EDKA 1H2JA 3PZGA 5CPQA 1E4NA 4PN2A 5CXPA 1UD3A 3SCOA 1MW2A 2YLLA 2J75A 2CKSA 4UZUA 4YHEA 2E0PA 3CUJA 5A6JA 2A3CA 2Y24A 1BPLB 3VD5A 2DQXA 2W67A 1J01A 1QNRA 3TTOA 1B3WA 3MSDA 4H7VA 1U2YA 3CPUA 4AEFA 5M3WA 2FHBA 4LQ1A 4UFMA 1TVPA 3W6MA 4EE9A 3RDKA 3ARUA 1HJWA 5E09A 4CVUA 3MUZ1 3W28A 3VDCA 1UWIA 1OGSA 2J7EA 3AHXA 3WMBA 4N42A 1ISVA 1FFRA 2WXDM 2XSBA 1UWUA 1ISXA 3ARXA 4AIUA 1P6WA 1C92A 4AD4A 4EAMA 1GOQA 3VO0A 1OD8A 4F79A 2ZUMA 2WVTA 4W8AA 2VVSA 4BQ4A 4CN4A 1R87A 4FLOA 2VCAA 1ISYA 1LL7A 4PBGA 2AAAA 5I24A 3O6AA 1B3XA 2C8NA 4FK9A 1JGIA 2WVVA 4PSPA 3II1A 1B30A 2YIHA 5EFDA 3ZJKA 1QBAA 2X0YA 2ZX8A 5KEZA 1XCWA 4J3XA 4Z2IA 5IFTA 1CYGA 1WO2A 3L2MA 4E8CA 2OWWA 3NCOA 3IJ7A 1V3IA 3MS8A 3AROA 1E40A 2RGMA 3ZMRA 2JALA 4Z2JA 3WD0A 1B3ZA 4GO9A 1UR9A 5A8OA 2BVTA 2VCCA 1E73M 1JFXA 1V02E 4AZ5A 4HA3A 3A4WA 1FA2A 4QCEA 1UKSA 2CIPA 4PYSA 2WLZA 2PWDA 4GXPA 5FIPA 2X0HA 3ZO9A 1CGVA 4DM1A 2VNCA 1MW3A 3AS3A 4GPNA 2NW0A 5D8WA 4CKQA 2VTFA 2WSKA 3KE0A 1IV8A 1LQ0A 2VJXA 3W24A 4GQRA 2WKLA 1BGAA 3OGRA 5E0FA 2E8ZA 4Z2KA 3WDRA 3W29A 4H41A 2XHYA 2PC8A 3T2OA 2VT0A 1VBRA 2ZUSA 4TX6A 5D9PA 5E70A 1PIFA 1US3A 2XVLA 4ATWA 3CLWA 2A3AA 4J3SA 1CLVA 2WBGA 3BXWA 4PMUA 1TR1A 5GPRA 4DWSB 2DSUA 5D9NA 1VJSA 1H5VA 3KL5A 4BQ5A 3PBGA 3PN8A 5BXPA 1U30A 1V6WA 3T0BA 4AD2A 1EO5A 5HXMA 4KH2A 3WDIA 1EDGA 3AMLA 2VX5A 2OYKA 4ML4A 1UWRA 1BSIA 1CGUA 3AIBA 5AY7A 4AZ7A 1JD7A 4J3WA 3VDBA 4CN6A 4P7OA 2O9PA 4XV0A 3VMOA 3GXIA 1WZMA 3ZJ7A 1HVXA 3WIJA 4YN5A 1G01A 4XUYA 1XYZA 1NWUA 1GHRA 2DGAA 2XFRA 2G41A 4UNIA 2J7GA 4JHZA 2EQDA 1BFNA 5HOSA 1UZ1A 2CITA 1UOKA 3FHAA 5DT5A 2CBVA 3ARVA 4AD3A 3WNMA 3ARTA 4AZCB 3OZPA 1U33A 2YA0A 1CGYA 4ATLA 7A3HA 2VX4A 3UERA 1HP5A 1UHVA 2FHFA 1Q6GA 4CCDA 2WBKA 3OA5A 5DMYA 1W1PA 4X0NA 3AZRA 4M80A 3PZTA 3VIJA 2JEQA 3LPPA 1UWSA 2WCAA 4B3KA 2QV4A 4PSRA 1UD5A 4B16A 4W8BA 3RMEA 1HJQA 3DYOA 1C8QA 1EA9C 1QBBA 3WH7A 1JZ5A 3OIHA 4ZXOA 1NP0A 1E4IA 4R27A 1XD1A 4UZSA 1QHZA 4URIA 2DSVA 1UQZA 3NDZA 2CPUA 1OD0A 1NH6A 3VIPA 5C70A 3VGGA 4J27A 3MU7A 3J7HA 3WDQA 3GTNA 2YLAA 2O9TA 1JDDA 4P8XA 3DC0A 4CUCA 1JL8A 2J7CA 1KXTA 1AQMA 2UY4A 5GNZA 1O6IA 3VD7A 3W82A 1W2PA 1BYCA 4HMCA 3UETA 2TAAA 2V5CA 2JE8A 2W5FA 4CD4A 1GORA 1KGXA 2J7FA 3ZJ8A 1F4AA 2VR4A 1DWFM 3ARSA 1SYTA 2ZOXA 1TA3B 4D6GA 4PMNA 3ZM8A 4M24A 3VGEA 1UUQA 4QP0A 4LXFA 4AMCA 1W3LA 2ZUUA 2BY3A 5IDIA 3WF3A 5A6LA 1XYFA 4U33A 4UFLA 2O92A 3RCNA 2BY2A 2DSKA 3ZJ6A 4HMEA 1KXQA 4U3AA 1W1TA 2CETA 1MWOA 5I6SA 3F5LA 4KWUA 5BYWA 5CPTA 1UD6A 2BVYA 3W6LA 2PB1A 3LPOA 5CGMA 1HX0A 4CU6A 3ARYA 2EPMX 1US2A 4OOZA 4MNJA 4OBRA 1UR8A 1R8LA 2WNWA 3SEPA 1A3HA 1KXVA 4IM4A 2UWFA 3AJ7A 1DP0A 2YJQA 1VEPA 3RJXA 4FLSA 1LWJA 1VEMA 1QI2A 4LX4A 1RPKA 2G3IA 1UQYA 4V28A 3DYPA 2J7BA 4W8LA 1FHDA 1H0IA 1QW8A 2ZXQA 2A3BA 4AD0A 1WDSA 2FH6A 4PTMA 2FDMA 3T2QA 1E6ZA 2JIEA 4ZFMA 3WL0A 3DYMA 4W7WA 1ZU8A 1E6NA 4FMVA 4HOZA 1E0WA 2CHOA 4WLCA 2VRKA 4C7GA 4UQCA 1GOOA 3WKZA 4ACZB 1SR0A 4WSKA 1MXDA 4TVCA 1CECA 3EMCA 1VJZA 3IJ9A 5HPOA 1E0VA 1E15A 3O9NA 1WZKA 5I3DA 5ECUA 5JUVA 1NP2A 3VDHA 5A8QA 4H8UA 4WK9A 3SUUA 1NM9A 4WJXA 4ACYA 3VD4A 1GCYA 5ABGA 3GXMA 3PTMA 2EPNA 2OSXA 2PBOA 4R5EA 3LPFA 1J18A 2J8GA 5LYRA 4W88A 2BHUA 1XHGA 1UG6A 1V3HA 1GOWA 1G1YA 5HBFA 2VUYA 4D6EA 2C7FA 3VUPA 3WL1A 4PCTA 2VZUA 1HL8A 1QNQA 1WNOA 4JCLA 1ZBVA 1ITXA 5A8NA 3CUFA 1JDAA 4ZE4A 4U31A 5BRQA 3VD3A 4PMXA 3ZT6A 2J25A 3L4YA 3IK2A 3GH4A 1D3CA 4MAZA 1CLXA 4HZ8A 4WF7A 2VURA 2XGIA 1FH8A 1K9FA 2WSPA 4H8HA 4V2XA 3WEMA 1KWKA 3EDDA 5HNNA 1OT2A 1XH2A 5DT7A 1JI1A 4H04A 2WMGA 2OYLA 3N9KA 3A4AA 5CSYA 4A3HA 3WF0A 4B9YA 1B2YA 4UOQA 2CNCA 3FY1A 4MJ2A 3CUIA 1KBBA 5BCAA 4LYRA 3WEZA 5BROA 1E1FA 2E8YA 1M01A 3FAXA 3IANA 3WNLA 3MV01 1B3YA 3MO4A 1CBGA 1HJSA 3AHVA 3WMSA 2WMKA 1KQZA 3TTYA 4TTUA 1IZKA 3ZR6A 1GUVA 3WF1A 2Y8VA 1WPCA 2ZUWA 2GK1A 4JFTA 4PMVA 2NT1A 3NSXA 1MFUA 3U57A 4CD5A 1B0IA 1KFWA 4U5KA 4AZBA 3UESA 1UKTA 1D2KA 2B31A 1MQPA 2YA2A 2J77A 2GJXB 5EBAA 1CIUA 2WWCA 3EDFA 3GZAA 3WUEA 3A4XA 3WUGA 1E5NA 1MQQA 3TONA 3WMCA 4AD5A 2VX7A 4LYQA 2YL9A 3D3AA 2VX6A 3N17A 1Z32X 2EO7A 3RJYA 4M81A 1CXLA 3NSNA 5BXRA 1ESWA 3SUSA 4HP5A 3U7BA 1PZ2A 4MNLA 4BCEA 1GONA 4EANA 2G4FA 3WQVA 4UCFA 2ZUTA 1CXFA 1W3JA 5BWFA 3WH5A 3OG2A 1QW9A 4HTYA 3KL3A 3K1DA 4PMQA 2EBNA 2PBGA 2XM2A 4MJ4A 1UKQA 2OLHA 1V0MA 2WW5A 3L4VA 1TCMA 2GUYA 3ZT7A 3WENA 4D71A 5I2UA 2WMFA 1HP4A 1J9YA 3SCTA 1XC6A 4WIWA 3VPLA 1GVIA 2YL6A 3TP4A 2A3HA 4Y7EA 3VIGA 1E1EA 1E70M 1AQ0A 3WDJA 1PZ3A 3EMZA 1W2VA 1XGZA 1GVYA 2D2OA 5JBEA 2WMJA 3ARRA 2XM1A 1BLIA 2EEXA 1KCLA 3OLDA 3WD2A 1QI4A 1UR1A 1ECEA 4JFSA 1JNEA 2ZXDA 1AVAA 1J0KA 1JG9A 2WB5A 1C7SA 3BH4A 1UH3A 1GQIA 3NSMA 5GNXA 1QHOA 1GOKA 3BAJA 1MW0A 3CUHA 5CLTA 1QHPA 2CBIA 1ZBKA 2V3GA 3WQ8A 3W0KA 1XH1A 2DPEA 2XUCA 1V3JA 3AS2A 2J8FA 1V6XA 1A47A 1EQCA 4AZHA 4W93A 2CYGA 5LA1A 2AMGA 3VGBA 1NOWA 1E0XA 4PMDA 2WC3A 3BLKA 4EKJA 3BLPX 2UY3A 5LA0A 3DHUA 3TTQA 4JKKA 1JNDA 2XYLA 4MAVA 1UWTA 3A6OA 1MYRA 3WBAA 2OYMA 2CHNA 3MUY1 5M17A 1L8NA 1C8YA 1CXKA 1WKYA 1TG7A 4P7RA 3SCRA 3BAYA 1E6XM 2XSAA 2D1ZA 1N82A 3MANA 1OSEA 1B3VA 2DSZA 4Q22A 5A6BA 1VBUA 2D0GA 3NJ3A 1R7OA 1UKOA 2QPSA 2ZX9A 4GZIA 3GH7A 4D1JA 4UTFA 3N11A 1X6LA 3FNDA 5CPSA 3DHPA 4Z2HA 4HA1A 3UCQA 4UQBA 2WVVB 4H2CA 1B31A 1V3LA 4IISA 5ABFB 1UH2A 3VNZA 1Y7VA 1R86A 2UY2A 2WLYA 3FAWA 5GQBA 5M03A 1OWQA 1UR2A 4W7UA 4HU0A 3WNKA 1ZL1A 2V5DA 2F8QA 5DFAA 1FFQA 3CZKA 4J28A 3UR8A 1JIBA 4L4PA 3ZT5A 4F9DA 4P8UA 3HJEA 1L0PA 3OLIA 1K9TA 4GI6A 5A2BA 4WKAA 4ATDA 3VNYA 1TFVA 1MFVA 3CHEA 4RE3A 1JXKA 1DWIM 2DH2A 1PJ9A 2ZWYA 3VGFA 3N04A 1W9DM 1KXHA 2O9OA 5I23A 3CMJA 3VIFA 3T09A 1MVYA 2ZXAA 3WELA 4MB3A 3ALFA 1UKPA 3U5YA 4U3CA 4M8UA 3POCA 3SCPA 1M03A 3CBWA 3WY1A 2Y4SA 4PTVA 4CVWA 3AXXA 2XWDA 1E6RA 4OOUA 1OCQA 4DUVA 3M46A 4UFHA 1YQ2A 2WKGA 4JZ5A 4UQDA 1LL6A 1HF6A 2WZIA 3N1AA 2WHKA 4CCCA 4CD8A 7CGTA 1EO7A 1XV8A 3GDBA 1UA7A 1V0LA 4LPCA 3MUAA 5JIWA 1OB0A 1HIZA 1UD8A 4TTGA 1H09A 3ARPA 4BF7A 2J4GA 4D6HA 1G0CA 4E4PA 4JFVA 4HPGA 3PZUA 4QFUA 5A95A 3IAQA 4XZBA 4P8WA 3E1F1 3L2LA 3L4ZA 1UH4A 3M6DA 4XX6A 2X8RA 2XIIA 2EPOA 4UOJA 1EDTA 1BVZA 4YHGA 1UR0A 4H8VA 3WNPA 1PX4A 2FGLA 4Q7NA 5AC5A 1FP9A 2Y5EA 2VC9A 4TXEA 1J0HA 1TA3A 4FF5A 1EIBA 2XPKA 3PZNA 3WQ4A 1JZ4A 1DWGM 3ECQA 1V08A 1CGXA 3AYSA 3CO4A 4CN1A 1E71M 1E5JA 4KMQA 4LGXA 1K6AA 3GBEA 2DIJA 3CZEA 2MANA 2WVSA 5E0CA 1E4MM 3K46A 5JIPA 2WZEA 2XG9A 3B9DA 3QOMA 1WDPA 3AS0A 3VM5A 3VIHA 4B15A 2VQTA 5GNYA 1WZLA 1QI0A 3POHA 4QLKA 3AQUA 2CKRA 2D0HA 2JFEX 4F8XA 1XCXA 4XZWA 3W53A 1QVBA 4W5UA 2EXOA 4IPNB 1BTCA 1RH9A 3W38A 3AIRA 3T0DA 2V3FA 3I3DA 4P7LA 1H3GA 1XH0A 2D3LA 2E9MA 3GXDA 1K9EA 1JZ6A 4Z2GA 3QHMA 3F4VA 1EHNA 1QI5A 1RP9A 1W9UA 2XGBA 3ARQA 3GNRA 3WD1A 1RD6A 2D20A 4W87A 2WHMA 4PMYA 3RM8A 1E6SM 1I1XA 2W92A 4AISA 1GNXA 1X1NA 1JYNA 3HMCA 4X0VA 1C90A 1W9VA 1HNYA 3CUGA 1VIWA 4N0RA 2QMKA 4AIOA 3SCVA 3W37A 2GDUA 4GKLA 1GHSA 8CGTA 1PBGA 4F66A 3APGA 1VFUA 1B90A 1VEOA 3L4XA 4J3TA 4X9YA 1H41A 2ZXBA 3CZGA 1FHLA 3RILA 2DEPA 5A6BD 3PTKA 4JL1A 1M7XA 1E6PA 5D9OA 4B3LA 4NI3A 2F2HA 1DWJM 1NWTA 3PZQA 5F7UA 1GZJA 1TUXA 3WQ5A 3PHAA 1KGWA 4GO8A 2E9BA 1TZ7A 3K8LA 4A4AA 3CGTA 3N12A 1DHKA 1QPKA 1XSKA 4CD7A 4OUEA 2W62A 3CZ8A 5A2CA 3WH6A 1XRVA 2BHZA 1XSIA 6CGTA 1E4LA 5IHRA 3THDA 3CMGA 4ZE5A 4QCFA 3AIEA 4FLQA 2AOSA 1GOIA 2D3NA 4TX8A 2VI0A 5LA2A 3VMNA 2CCRA 3TA9A 1B1YA 1LF1A 1GJWA 4HA4A 2OSYA 3WEOA 5KZ6A 1EOMA 3VIKA 2WHJA 1VENA 5I78A 1ZBWA 3GH5A 4AW7A 1FH9A 4OJYA 1H1NA 5FKYA 5ABHA 3QGVA 3OZOA 1C3FA 3M7SA 3B8SA 3WQWA 4UQAA 4UFIA 1J12A 2BFGA 2OSWA 3IJ8A 3AMDA 3MMWA 5AC4A 1WAWA 5A3HA 5E6YA 2XFFA 3WBEA 1OBAA 3QHNA 2Y8KA 1FH7A 3AIWA 3S6TA 3K8MA 4W89A 4K68A 4JL2A 6TAAA 4GZJA 3MV11 3T2PA 1JAKA 1KR0A 5CSUA 4CU8A 1ZJBA 1NWSA 4JIEA 3KZSA 3MSGA 2VR5A 2WMIA 3SCWA 1M53A 3WN6A 4MTVA 1EOKA 3WNNA 4UQ9A 2YKKA 4WSJA 4BZYA 1QNOA 1QNSA 1ZJAA 3VDAA 3GXFA 3PZOA 2X05A 3AHTA 4P7NA 1WZAA 5AYIA 3L4TA 3WFLA 2XIBA 1F4HA 3TTSA 3CZJA 1BF2A 1ISZA 1Q6FA 2PWHA 4KGLA 1W32A 5I5RA 1V0KA 2CBJA 2PF0A 5FD0A 3JUGA 2JIWA 3CHFA 4JFUA 4V27A 4TVUA 1UYQA 3PTQA 4D6CA 4GI9A 3RIKA 4GIAA 2VL4A 5CJ5A 2E40A 4PMRA 3K8KA 3WNOA 2XTKA 2YL8A 1PPIA 2D23A 3AXIA 1CGTA 3L4UA 1DWAM 1WDRA 2GDVA 2QPUA 4QAWA 4D6JA 4NSBA 3UG4A 3T08A 1EH9A 3ARZA 4JKMA 4HZ7A 3UG5A 4AZGA 4B9ZA 3N15A 4S3JA 1Q6EA 1UD2A 4M56A 1OM0A 2WAGA 1HKJA 4GQQA 4DM2A 3EMQA 3OGSA 3AHYA 4AY1A 2VOTA 2XFYA 2XVNA 4HPHA 3MUIA 2HVMA 3VU2A 3A3HA 4D6DA 1E9LA 1LWHA 3UEQA 1JF5A 1ZBCA 3GM8A 3KL0A 3ZOAA 4GI8A 1ITCA 3AIVA 3VIOA 2VZOA 5C71A 3RPMA 2Z1SA 3ZSTA 2QMJA 2E4TA 3AHZA 3WF2A 1GQKA 1BVNP 4HZ6A 1WP6A 1CXEA 2D22A 4KRTA 2QLYA 2QF8A 2OWCA 5D9MA 3VKKA 5A8MA 4NZCA 3O2LA 5IFPA 1W3KA 2V3EA 1HKMA 1JZ3A 1BQCA 1ODUA 2JF7A 2Q8XA 1KGUA 3CHDA 3CTTA 3VTRA 3RO8A 2WCSA 1PEZA 2FGZA 1ISWA 5A1AA 5JBDA 1NWRA 4AIEA 3KEHA 4PCSA 1QOXA 1ODZA 3OB8A 1KCKA 3AMCA 4NRSA 4AD1A 7TAAA 1BG4A 4W86A 4TUFA 1EQPA 1C8XA 2CBUA 2BS9A 4OKDA 1EGZA 2D0FA 3PZIA 4P7QA 2GK1B 4RE4A 2VMFA 2WANA 1SFSA 3G6LA 3ZR5A 3ALGA 5I77A 1JDCA 3NYDA 3GNOA 1JZ2A 1FP8A 4NRRA 3BMWA 1BYBA 1JI2A 2BXZA 4C7FA 1HJXA 2BNJA 4JHOA 3VM7A 4WKHA 4QLLA 3CHCA 2GSJA 2PWEA 1J0IA 5EFFA 2W63A 3WUBA 3W4RA 1V02A 3AICA 1PAMA 3WD4A 3AXHA 5E6ZA 3UR7A 1V6YA 1H49A 1QI3A 2VZVA 1TMQA 2BV9A 1J0YA 8A3HA 2YA1A 1NOUA 1RP8A 1CEOA 1HJVA 3KWXA 5DO8A 1JYVA 5JBFA 3OBAA 1M04A 4PEEA 2YBTA 4MDOA 5TD4A 3FXYA 1C7TA 3AISA 5ABFA 1OGBA 2DSWA 5HDRA 1O7AA 1QNPA 1ZS2A 3ZIZA 3HN3A 1GOMA 4UFKA 2J78A 2WHLA 1SMAA 3W26A 3WFZA 1JXJA 1J0ZA 4AZIA 2J74A 3EBVA 1JYWA 2XVGA 4DWSA 1W9XA 3NDYA 4MDPA 1V3MA 1VFOA 1E72M 4HOWA 1V6VA 1KBKA 1PX8A 2YDQA 1KQYA 5IHSA 3VOCA 4U5IA 3VVGA 1CTNA 3WUFA 1W91A 1B9ZA 2VRQA 5A69A 3QHOA 4YPJA 4QDMA 1HN1A 1WCGA 4PMOA 1Q6CA 2A3EA 2NT0A 2ZX7A 4U2ZA 4D1IA 2VVNA 1BAGA 1DTUA 1GQJA 3BGAA 2YDSA 5FL1A 2WM0A 2J79A 2JF6A 5CGTA 3VD9A 1CGWA 2VCBA 5BXSA 4UR9A 4HU8A 3B9AA 1BG9A 2ZUVA 2HISA 1OINA 4NF7A 1GPFA 3CZLA 3I3EA 3D5HA 4RE2A 1NARA 4AZCA 1EXPA 1WB0A 1JF6A 3AZTA 3TOPA
chains in the Genus database with same CATH superfamily
4ZEPA 4A05A 4U28A 1VFFA 4IWWA 1R9XA 1DXIA 2GJNA 3EX6A 4BS0A 2CESA 5FEPA 4DB7A 4S3CA 1EC8A 2A6NA 2A0NA 3TYZA 4LCRA 3CAWA 4JCMA 3VINA 3GK0A 3BW3A 2WMHA 1P1XA 1DE5A 3RYSA 1LLOA 4BA0A 3RG6A 2DVXA 3S5YA 3PUEA 3FKRA 3T78A 5A6AA 3RM4A 4Q8WA 1KTCA 1SZEA 4JN8A 3CWNA 1PIIA 1TJRA 3TYEA 4FNRA 3KCOA 3I7QA 1BRLB 3W7QA 3NA8A 3IRSA 5D8ZA 2F6XA 4GH1A 1DTNA 2GGGA 1E43A 3EOUA 3R25A 3OVRA 1JFHA 1HVQA 3LLXA 3OZMA 4PUEA 1CPUA 4E8DA 1QRQA 1DL3A 3I68A 1B3OA 2A79A 3MI6A 5CZKA 1HXJA 1K3UA 5A2AA 3QTPA 3EB3A 4DN1A 1G94A 2VELA 3AMGA 1QR7A 3CS2A 4G7EB 4N4PA 2DT2A 2PGFA 3XISA 2GJRA 4FEZA 4WJ8A 1UZ4A 3Q65A 3TZNA 3SCSA 2DP3A 4P8VA 2XVPA 4QTGA 4I7UA 1S5VA 1JAEA 2Y70A 4Q8TA 3AYTA 3Q2DA 3AWNA 2FZ8A 3E74A 3HG3A 1RPXA 3TN4A 3NEVA 1SMDA 2CLHA 2H6RA 3GTXA 2WC4A 5C9RA 1VJIA 3I65A 2F7FA 3RPTA 1EWEA 3UWYA 2GGEA 3VILA 2HDJA 4EF9A 4GGBA 1W1VA 4LFYA 1XDMA 4MADA 4YNGA 3TR9A 3GNPA 1HKIA 3ZS4A 1PCWA 4B5WA 4OE7A 3RM9A 4GUHA 3S1XA 2NVCA 5A8PA 3UT0A 1YNPA 3AALA 3E6EA 1F6PA 3GHRA 3AXKA 1CNVA 4DWSD 5I0DA 2UY5A 2GFTA 4KWSA 2ZRXA 1IWBA 3GYCA 1V93A 2CERA 1IXQA 4CCEA 2OR2A 2BHYA 5AVNA 5B80A 4JR5A 4HOXA 4GRSA 3KVJA 3W00A 3Q37A 3W6YA 2RGLA 1V7AA 4DO6A 3CJPA 2GQ9A 2J7DA 4ZXLA 3QV7A 1YDNA 3I3BA 2RDWA 4XAYA 4PFHA 4HMDA 3HZ3A 3P7YA 2NSXA 3LPGA 3MMUA 4S3KA 1FCUA 5EMYA 3SUVA 1IR2A 2XIOA 1C91A 3ZVHA 2J6XA 2YDRA 2FHCA 4BK9A 2CC0A 3RMJA 4XISA 2E5CA 3CAQA 4UTHA 4S3BA 1JPKA 1S46A 2YCKX 4FHAA 3OLGA 2EJAA 1MW1A 4HNUA 1NF0A 4JYEA 2A85A 2PWUA 1H5YA 2P50A 3T9PA 2JBMA 3WJWA 3PJTA 3FXGA 3PM6A 1R7AA 1E56A 5CG7A 3IVUA 2DT0A 1TIMA 3L0NA 1AQHA 1UP0A 1F3TA 4QEHA 1KNWA 2YBUA 3LLDA 4MOZA 2QCFA 3B06A 4W84A 1W1B1 5AZ1A 2E25A 2WC7A 1KRBC 1TMLA 2QCDA 1E1CB 1EDQA 4HBKA 4FLRA 3U7VA 2VUNA 5A5WA 2GSHA 1CXIA 1YW1A 3TEVA 1E3ZA 3GG1A 4IPLA 4L9ZA 5LNVA 3G24A 3A3XA 1UIPA 2GJXA 1C9WA 3AU2A 3P80A 1CDGA 2DUXA 4DNHA 2VQUA 2PRMA 2W91A 5DCEA 4K8EA 4PTXA 1YNYA 4AZ6A 1TV4A 5E93A 2NQ5A 4ZGYA 3ZXWA 3THCA 3W7CA 2A7PA 2P5NA 4GJ1A 1YHTA 1JZ8A 4CCZA 2WMIB 4OBSA 2V30A 3B9EA 3GBDA 4QE1A 5G2WA 2Q8ZA 4Y9OA 4OWGA 2IS7A 1OX4B 3G1YA 4EWND 4LF2A 3AZSA 4ZR8A 1LJYA 1A5NC 3W7OA 4M82A 2R1KA 4MUZA 2CXGA 1UMYA 1TE1A 1XP3A 3KDOA 5C8BB 1AA1B 4YTRA 1MQRA 1UPMB 4H4IA 1TELA 1DKWA 3WF4A 1O5KA 2BVDA 3P14A 1EHAA 4XQ6A 1TYGA 2NX9A 3B0YA 1Q6RA 4UB9A 4UC5A 3VFLA 4HIBA 4PN2A 5CXPA 2WKJA 1MW2A 2J75A 3HFYA 1PTDA 2C91A 2A3CA 4GX8A 3T42A 3KUMA 2FJKA 3C86A 3BMXA 1VCFA 4H7VA 3CPUA 5I3KA 4KEVA 4LOCA 2DW7A 1IXNA 1PYMA 4L6OA 2B81A 4ZQOA 4GCXA 1M5WA 4HHHA 3MUZ1 1OGSA 2J7EA 3PWIA 1IEIA 4N42A 4HT3A 3APTA 1FFRA 3ZLGA 4TQTA 1UWUA 1ISXA 3ARXA 4AIUA 1P6WA 1GOQA 2Y89A 3VO0A 1OD8A 4Q4MA 2INEA 3VK5A 1XLCA 3T4WA 3GC4A 3B40A 3TYUA 4W8AA 3S47A 2VVSA 4HPXA 4LC6A 4FLOA 1ISYA 1EP3A 4GVGA 4KCWA 2I9EA 4FK9A 2V5BA 3II1A 2E77A 2Y63A 3NZRA 5KEZA 2VFEA 4ICCX 4AVOA 4J3XA 5IFTA 3N2XA 4M6UA 2B0MA 4F2BA 3VAVA 3ICJA 3M0LA 2RDXA 2QQ6A 3IJ7A 4S3DA 1V3IA 5HA7A 3MS8A 2X1SA 4NY2A 3WD0A 1EJSC 5BOEA 2ZZ5A 2VCCA 4O28A 1JFXA 2PDPA 5D04C 3A4WA 1FA2A 1GVOA 4QCEA 3KRUA 4HPJA 5D02A 4PYSA 4WZHA 4DJDC 3LOTA 2X0HA 1TV7A 1Q6QA 3QF0A 1DJIA 2NW0A 1LTDA 3RO6A 2C71A 1AJZA 1M7JA 1IV8A 1LQ0A 1YKWA 2VGFA 3S2MA 5L9FA 3PJUA 3E5BA 3WDRA 1GOXA 4H41A 1XQLA 3FCPA 1EEXA 4RXFA 2PZNA 4TX6A 5HWMA 4WY0F 1UB3A 4E2DA 3CLWA 4J3SA 3C61A 4L4MA 2DSUA 2ZE3A 1EJRC 4M7TA 4TV6A 1FWRA 3PBGA 2ZZ6A 3MUXA 1U30A 5F2GA 2QAFA 1I45A 3WDIA 1EDGA 2VX5A 2OYKA 2R14A 4NAEA 1UMLA 3S9IA 5LNSA 4AZ7A 4J3WA 5EMKA 3CQJA 3VMOA 1WZMA 2PP3A 1HVXA 3HB9A 2P8CA 1G01A 4JIRA 5DELA 1A50A 1XYZA 2VWTA 4O1DA 5CAHA 5LGXA 2DGAA 5G4HC 4UNIA 3W1UA 1IEQA 3HA1A 2J7GA 1A3XA 1BFNA 5HOSA 3URBA 1UOKA 3FHAA 4AD3A 3OZPA 4RDVA 3EKGA 1F3XA 3EA3A 1IT8A 3IIZA 1HL2A 3UERA 1UHVA 2GOKA 3GVVA 3NAVA 1S39A 4CCDA 3OA5A 3LHYA 1W1PA 1OCBA 1R3VA 3HG2A 3AZRA 3B4YA 5K7JA 3VIJA 4LVAA 2YXXA 1GG1A 1OCJA 4NZ1A 3G1XA 3IRDA 4B3KA 4PSRA 3N4EA 2ACRA 2LLEA 2Z7GA 3AXMA 1FKWA 5CBJA 3PBYA 3DYOA 1C8QA 1EA9C 2VFHA 3O0FA 4HB7A 5C5YA 3F7JA 3O63A 4R27A 3CV1A 1UQZA 4B4HA 4WRHA 4H7CA 5DMLA 2PSNA 2CPUA 5C70A 3GFXA 4IZGA 3VGGA 4J27A 3MU7A 2O9TA 1Y0EA 3R7MA 4IQDA 1EX5A 3UD6A 4CUCA 2VFDA 4GQBA 3IPWA 3SAZA 1IIHA 2UY4A 1GYNA 3B0VC 1W2PA 1BYCA 4ZCWA 2JE8A 4LY8A 2FMNA 1WA3A 1XIBA 3T6CA 5L6UA 3PS7A 4ZBCA 1D9EA 3ARSA 4P61A 1WXJA 3H4GA 3M43A 1XM3A 1UUQA 4ZOCA 1WXZA 4Z1BA 4RV3A 3VXGA 2ZUUA 3T0CA 1Z8AA 2V2DA 3RCNA 3QEZA 3UF9A 2DSKA 3ZJ6A 3M16A 4O4VA 1ZSXA 3K13A 1GEHA 5BYWA 2OQYA 2Z6JA 3LN3A 4ZB2A 3MQTA 3W6LA 1OF8A 2WSQA 3LPOA 4KEUA 1XUZA 1DV7A 3ARYA 3H7UA 3CIXA 3P93A 2XN2A 1UR8A 3G0SA 3WQOA 2WNWA 1A3HA 3QV6A 3G8EA 3RUBL 1DP0A 3R8GA 4FLSA 1SO6A 1CB7B 4H9UA 2Z1VA 4LX4A 5LNUA 3C2FA 4KFOA 3NDOA 4QQUA 3HPAA 3OVPA 2X2GA 2FPVA 4IX2A 1AL7A 2ZXQA 3BLEA 1WDSA 1VPXA 3GR4A 2G0WA 2FDMA 3KX6A 1NELA 4IFKA 4R7JA 4LUJA 1TE6A 2CHOA 4WLCA 2VRKA 1O1HA 2UZ9A 2KX9A 4A8NA 1MXDA 1O94A 4AFYA 3EMCA 2PDJA 4BWLC 1E15A 1WZKA 3ES7A 2GQ3A 4RNIA 5JUVA 3W1QA 5I3HA 1NP2A 3LLFA 1KCZA 4DX3A 1NFGA 1EUNA 1G69A 4WK9A 4PH6A 4ACYA 2W0UA 4R5EA 2PBOA 1SO4A 4LUYA 2IKHA 4W88A 1V3HA 3FVMA 1G1YA 2ZRVA 1SZRA 4RDZA 3QSRA 3GUWA 2X40A 3VUPA 2ACSA 4ADSA 4PCTA 1GWJA 3E0IA 3QXBA 1QNQA 2D2GA 5HR7A 1ZBVA 4JNYA 3A22A 3WG6A 4DYJA 3IJIA 4U31A 2PDWA 3ZT6A 3S1WA 4KCTA 1VD6A 3ZVHB 2HS6A 4NZFA 4DJED 1ZLPA 2ZA2A 3TLQA 4G8TA 4MAZA 3F03K 4FIQA 3UJEA 4DF1A 1FH8A 2PLMA 2XZ9A 5HNNA 4MPQA 4H04A 3GU2A 4L1WA 3QR1A 3UXLA 3A4AA 3L67A 1AK5A 4WDXA 4MJ2A 3RHGA 3MYOA 5BROA 5CEWA 1M01A 3MV01 1HJSA 4AWTA 3DGRA 1JUEA 3S83A 2RFGA 5LIXX 2WMKA 3DKLA 2HS8A 4TTUA 3ZR6A 2OTDA 3STGA 5HMDA 2QCDB 2GK1A 5RUBA 2BSLA 2NT1A 5D32A 3SBFA 2CFFA 3IIOA 5CPOA 4U5KA 2QGHA 3OQEA 3LG3A 1D2KA 2B31A 4JQAA 2GJXB 5EBAA 1CIUA 4NAFB 3A4XA 1JPIA 3CLMA 4ADTA 4FB7A 1E5NA 4RK8A 2VX7A 4LYQA 2YL9A 2VX6A 3N17A 1XLDA 1BWVA 2I57A 5K2ZA 2A7RA 3FX4A 3PBUA 5CZ0A 4M81A 4B5XA 1CXLA 2XSXA 1ESWA 3SUSA 1EJUC 3ANYA 4PUKA 2G4FA 3T40A 1W3JA 1S1PA 2OELA 1QW9A 3KL3A 2OLHA 4K8HA 2H9AA 4OQVA 3GE7A 3ABRA 3H8AA 4IGSA 2HXTA 3VPLA 2YL6A 1S2WA 2OZ0A 4RNJA 1E1EA 1E70M 2HEJA 1FWBC 4PGLA 3UPBA 1XGZA 3QTGA 1TV8A 1W1A1 1PV8A 1BLIA 3NM1A 4ADUA 4RW5A 1F7BA 2GWGA 5G1MA 3T8LA 4GIRA 4NKCA 4TX9A 1JCNA 1AVAA 1J0KA 1JG9A 2OG9A 2WB5A 3QYSA 1LWIA 1QHOA 2Y5SA 2WJFA 4DXXA 1IXPA 3MBDA 2CBIA 1KC7A 2Q3RA 1XIEA 1XH1A 1QK0A 1WAUA 4JN6A 1V3JA 5HQLA 2AQVA 1V6XA 3IJ6A 1ZFJA 4GIYA 2CYGA 3LQLA 3H2NA 4DAFA 5CC3A 4JTSA 4DI9A 1TRIA 1AJ0A 4MZ1A 3M0VA 3BLPX 4LAMA 4EKJA 4RW3A 3BARA 4LVBA 1LT7A 1RY0A 4JKKA 2HCVA 3EWZA 2WQDA 1SR9A 4AH7A 4P7RA 2CLMA 2NX3A 3H22A 1N82A 3PWGA 3AO0A 5TIMA 4Q22A 5A6BA 3V1HA 4NNCA 1RQBA 1DJGA 1TTPA 3TV8A 3NJ3A 4O1FA 1JCXA 1LM1A 2ISVA 4GZIA 1R2SA 1A5BA 2V5JA 2I16A 3N11A 1X6LA 5CPSA 1R3SA 3MHGA 4H6KA 4H2CA 4JTTA 5CCZA 1B31A 5ABFB 1XRTA 4JTQA 2UY2A 3ANUA 5GQBA 4IX0A 1L6GA 1ZL1A 1FFQA 3CZKA 4H9YA 3UR8A 4CQ9A 4F9DA 4PA8A 4FX7A 3HJEA 1JJKA 1DJHA 1K9TA 4GI6A 4FXJA 3VNYA 1MFVA 3CHEA 4L56A 1PJ9A 2ZWYA 4H7ZA 3N04A 2VXNA 3VGFA 2O9OA 1EJ7L 1MVYA 2ZXAA 1UKPA 3R2GA 4K37A 6ENLA 2NXGA 3MWAA 1KTNA 3WY1A 3AXXA 1KO0A 3Q67A 1XRSA 1FUYA 2WKGA 4V15A 5FSDC 1V79A 1LL6A 1TUFA 1POJA 1XLHA 1XV8A 3SJNA 4WY0A 1UA7A 1V0LA 3W1PA 3VKDA 1BXCA 3MUAA 3PWAA 3NQEA 4TTGA 1H09A 3DFOA 3VNKA 2J4GA 1VLWA 4EPKA 1IE7C 2B7QA 3RCYA 1V51A 5A95A 5BZAA 1UH4A 4XX6A 1F61A 2OO0A 2EPOA 3QPZA 4UOJA 3V5OA 3HF3A 4JTGA 1Z3NA 2G3FA 3UWQA 1UR0A 2BX7A 1PX4A 5KMYA 1ZHAA 2FGLA 3F4DA 4Q7NA 3USZA 3DDMA 4TXEA 4TO8A 1XR2A 3PZNA 3WQ4A 1JZ4A 1DWGM 4I6VA 3ECQA 1V08A 1CGXA 4NAEB 4CN1A 2YB4A 1E71M 1K77A 1EFZA 6PTDA 4FR1A 2FVKA 1EUAA 4GZ7A 1Q45A 5H6HA 3THQA 4HNCA 4ECLA 4FSAA 2WVSA 3B9DA 3QOMA 3SRHA 3WLMA 3NYZA 3VM5A 3GG7A 5LNWA 2VQTA 1WZLA 2Z0IA 4M0XA 1U1UA 2BZNA 4XZWA 4LW7A 1VCGA 2EXOA 4IPNB 3U2ZA 1JR1A 1YIXA 2GGHA 2PD5A 3AIRA 3DZ1A 1FHUA 2ZRZA 3I3DA 3NG3A 1XH0A 3SGUA 2YBVA 1Z69A 5I03A 4UTLA 3F4VA 5G1YA 1RCOB 3ARQA 3GNRA 1RD6A 4W87A 1E6SM 1I1XA 3N25A 4B5SA 1X1NA 2BG5A 3HMCA 1JYNA 2V82A 3KXQA 1HNYA 3D3FA 3R89A 4N0RA 2OU4A 2QMKA 3P74A 1IZCA 3SCVA 1XYLA 4LU0A 5K9DA 2G4JA 5K4XA 3DERA 2J66A 3APGA 2RDTA 4G6CA 3L4XA 4J3TA 3G1VA 3LM7A 3CZGA 4X9YA 3RILA 4GACA 5BMXA 4A2SA 1E6PA 1YYAA 5TBOA 2OFJA 1NWTA 1GVSA 1TUXA 3T4CA 3PHAA 1KGWA 3UR2A 1LOSA 5AVHA 3CM4A 3SY8A 3GIQA 1JRBA 3M5XA 3NQAA 3HQOA 1W5QA 3VCNA 1W54A 3W7LA 5HATA 3BGGA 1NAL1 3BDKA 6CGTA 1S5WA 5IHRA 3IVTA 4QCFA 1A5OC 2AOSA 4X2PA 4JTUA 2PDHA 3CQKA 5LA2A 2FQIA 3VKAA 5HMEA 4ROQA 3W7EA 1MZHA 4MYAA 3RN6A 2PGRA 4GBDA 4RZ4A 1H7OA 1FXPA 3B9NA 3SFKA 3M7SA 4F0SA 1BQGA 1PUDA 4XAFA 1J12A 4FNTA 3S1GA 3MMWA 4FR6A 3NQGA 1N55A 1OBAA 3QHNA 4UTWC 1RJPA 4NYYA 3IIPA 4K68A 1JCLA 1VYRA 6TAAA 4GZJA 3T2PA 1TTQA 4N6EA 4CU8A 3TSDA 1PTAA 1P0KA 3FDKA 1M53A 4FOUA 3MPGA 4Q8NA 2C3ZA 1EOKA 3WMLA 4BZYA 3F2BA 1O66A 1QNSA 1WZAA 3IARA 2ZRYA 5AYIA 2XIBA 1K8YA 2PDGA 4IFKB 1OABA 1BF2A 1WOBA 3TSMA 2QJJA 1ISZA 1W3IA 1AZ2A 4LS1A 4S2BA 3JUGA 1AW5A 3CHFA 4V27A 3W1MA 2OQHA 1I2RA 4TIMA 3MT1A 1XKYA 3RIKA 1O5RA 1SQ7A 2VL4A 3QC3A 1IR1A 4ERGA 4RX0A 2Z25A 1YMYA 3CYVA 1L6WA 3LRKA 4I8YA 2CXEA 3S46A 1CGTA 1YLVA 4IOTA 3EB2A 4ZOBA 4QAWA 1WX0A 1EBHA 4NVTA 3U2EA 4NSBA 3V35A 1VPYA 2FFIA 1F9CA 1G4TA 1QCWA 4O16A 2DIKA 1EJWC 2ZZ1A 5C9ZA 3GSMA 4E6MA 4GQQA 2ATSA 3KCLA 2ISDA 3W86A 4X63A 2XVNA 2R1LA 2HVMA 3MDUA 1E9LA 3NM3A 4CQ8A 2Q3OA 3BICA 3UEQA 4ILSA 1ZBCA 1J5TA 4NX5A 3TK7A 2DZBA 3ZOAA 4GI8A 3AIVA 3SECA 3VIOA 2VZOA 1OG6A 1ZENA 3ZSTA 2BOFX 4F4RA 2E4TA 1GQKA 1CXEA 4KRTA 3EWYA 4R7OA 2OWCA 1MSSA 5D9MA 3KTXA 2J27A 4NZCA 4XUGA 4IJBA 1SFLA 1JZ3A 2ZBTA 4R33A 1R38A 4Q4QA 3CHDA 3BW2A 5U4NA 3TAOA 2XIJA 2WCSA 3R0UA 3V18A 3HQPA 4KBXA 5KTLA 1FCBA 3ITXA 2PDNA 1FWDC 1T8XA 3AMCA 4NRSA 1S3TC 1U5JA 7TAAA 3B9OA 4TUFA 3LCLA 4QEEA 1N8FA 1R3RA 2BP1A 1WV2A 1EGZA 3S9ZA 3PZIA 2GK1B 2VMFA 2WANA 4I9TA 4Z42C 4YU1A 2E1WA 3ZR5A 3ALGA 5AHFA 1BWKA 1JZ2A 4DJDA 1L2UA 3TYAA 3LNMA 3G77A 2NV9A 1YTKA 1ZAHA 3HPXA 3VOJA 3QQWA 4JHOA 3VM7A 3W07A 2POTA 2HROA 1HO1A 1J0IA 3EWBX 3AICA 4LUTB 3LCGA 3W71A 1EJXC 2YZRA 5D09A 4N6FA 2E1DA 4HA0A 3HPSA 1V6YA 5J5DA 5HNTA 2YA1A 5FSEC 1Y65A 4GE8A 3LDVA 3OBAA 3KVMA 6XIAA 1C7TA 3AISA 1WBHA 2QVNA 1OGBA 2DSWA 1QNPA 3DIPA 2H9AB 2O4MA 1GOMA 4IIHA 3W1XA 4OV4A 4UFKA 2ZA1A 3WFZA 2MNRA 3KDNA 1A5UA 1ZGDA 3EBVA 3NDYA 4MDPA 1V6VA 1PX8A 3VNMA 4F0HA 4U5IA 5HJXA 3FJNA 3E0VA 5A69A 2SFPA 1WCGA 4PMOA 3WLTA 3E5PA 4U2ZA 1Q65A 2VVNA 3B8VA 1BAGA 3VZXA 2FTYA 2QEZA 3H53A 4CNPA 4R88A 4L1XA 4UTMA 2OCZA 3BGAA 3LRLA 2YDSA 1KRMA 1XKJA 1TPFA 1OG0A 1DQXA 1CGWA 3CL6A 2PCQA 4UR9A 4V33A 1SZGA 4KERA 4KCUA 1OHLA 2ZUVA 1R0MA 3KM8A 4ZQMA 1GPFA 3FJLA 2YB1A 4RE2A 4AZCA 3P5ZA 1EXPA 4FNUA 1S5MA 2CLOA 3TLLA 3AZTA 1SZNA 3F5JA 3LQGA 3LHWA 5BOOA 4A8RA 1KV8A 4BQ3A 4E3TA 4QNWA 3W7DA 4E2OA 1GKQA 3GIYA 4LRSA 1C93A 3VGHA 1H4PA 2PWFA 3PPGA 4PUDA 3VNLA 1CWYA 5EYWA 3W85A 3NIYA 4J7RA 3UZJA 2GPTA 3B03A 4Z2LA 1QNVA 3SGZA 4UQEA 3PTDA 4WDTA 4CNOA 4HYVA 4U2YA 2FZDA 2R94A 1XIFA 3SN0A 3BSHA 4JTIA 2RH9A 5D4YA 3BCDA 4XVEA 3TSBA 2WYSA 4FO4A 1LG2A 4NT0A 3K4AA 1W8SA 3C8NA 2NUWA 1JEZA 4W7VA 4KEZA 9CGTA 1V6UA 2GOUA 3U5UA 4A8IA 2OZ3A 4QRNA 2I7GA 2Z26A 1UA3A 2PP1A 3DU0A 2EG7A 1P7TB 5C55A 4JKLA 3SCNA 3W83A 1F5ZA 4PMZA 3G1DA 4EPDC 2PI6A 4GJIA 3BGJA 3LERA 3OVQA 1X7IA 1CENA 4H8NA 4PTDA 2W3ZA 4LBRA 3WK3A 4WGHA 3AJXA 1FX6A 4MB5A 1HKKA 1R85A 3FK4A 8TIMA 3WH8A 3VKBA 1UD4A 3K4DA 3VIIA 3G1AA 1K6WA 3JR2A 3UZYA 3A13A 2AGTA 4YTUA 2PLJA 4MKVA 3HTWA 2FLIA 1M65A 5E9AA 2W61A 3PZ9A 4JTLA 3LI0A 5BRPA 3AMKA 4CD6A 3T0AA 1G5AA 2O4QA 4CNSA 3UY7A 3R5EA 4WY0B 3B8UA 3RRXA 1CW2A 1W9BM 2BMBA 1JZ7A 4HPNA 3N4AA 1KBLA 2R6OA 4C6CA 4WR3A 1TO3A 1E55A 4EPEC 4JAWA 4WXYA 4MPKA 3NTYA 2V38A 2WZHA 1YXYA 2PCEA 4OU1A 3OLEA 1L2QA 3A47A 2QZRA 3MJMA 2A4AA 2O9RA 2IUZA 2JGQA 1Q4NX 4B5NA 1ZB5A 3VA8A 3PG8A 3SUTA 4MY9A 5G1TA 4MNKA 2ZICA 3NEHA 3P67A 1RALA 3TUUA 5JVLA 2YOCA 4NIRA 4KESA 4MY1A 2PGEA 3DFYA 1XWYA 2G97A 3QMRA 2QJGA 2ZC1A 1WKDA 2CW6A 1NFBA 3ARWA 5CLWA 3MZNA 1UIOA 4QJ5B 4DLMA 2QUTA 7REQA 5CGQA 1OYBA 4BHYA 4RKAA 3L0GA 2E67A 3GW0A 1PB0A 1BWLA 1A49A 2OGYA 2RDUA 2ZC8A 1JCTA 1IGSA 1PVNA 4ZENA 2BVWA 4QM1A 1PX3A 1GW1A 1XL9A 3PULA 2J6VA 1XSJA 3LMYA 5H8PA 1KB3A 5E0KA 1W5NA 1DQWA 2P10A 3PUGA 1E6QM 2E3ZA 2WSRA 3OW1A 3GIPA 2X16A 4MY8A 4GLEA 4IMAA 5I79A 3WD3A 4TOQA 3N18A 5I07A 1BHGA 2IPFA 4QJ3B 1M7OA 5FA5A 2W66A 4KGJA 1TPH1 4MLRA 5FF3A 4UNKA 4LALA 4CNUA 1HL9A 1MXGA 1ZJIA 4DBEA 1Q2RA 3PZMA 3W23A 2G3NA 3NL2A 2J9ZA 3S2CA 2X09A 3BWWA 1VAHA 1FWNA 3QVQA 2C14A 3CXOA 4XAGA 1SW3A 2PWGA 2AKZA 4D8AA 2WVUA 5CQ1A 1KFCA 1OT1A 4B3ZA 1D7FA 1ELSA 1EBGA 4CNTA 3EYPA 3MP5A 1OEPA 2PDUA 1JQXA 3TYDA 3TKFA 3FHQA 3FA4A 1LG1A 3N13A 1PIGA 3QGKC 3WSUA 3WQGA 2OMAA 3MKKA 3WFAA 2QKFA 3W81A 5CG0A 1PYFA 4JHMA 3B8IA 1K70A 1CXHA 2PTWA 3LSBA 3I7RA 4AWEA 4N4QA 5HUOA 2EPKX 1G4PA 1OIMA 3QOKA 4M6QA 5DF0A 3GHTA 1OZQA 4XO7A 4C5ZA 1VBHA 2ZIDA 3VIMA 5HANA 2BXYA 1MZRA 2IQTA 5FOOA 3RCMA 1J8VA 1J93A 1BYDA 2R9RA 4S3GA 2BODX 2HMCA 3NPXA 5I09A 3EKLA 2DJLA 3E2RA 4FAMA 1EGMA 4W85A 5D2WA 1MNZA 4YCOA 4PB3A 1FWGC 4KRUA 3VGDA 4GZEA 5FJPA 1CZ1A 3NQ7A 2XJ7A 4D6FA 2R8WA 4XB3A 2PAJA 2PLKA 3C3UA 4Y9AA 1VYSX 2W6RA 1ICPA 3Q58A 3LYEA 3VE9A 4BQ2A 4YXGA 3P2VA 5F2LA 4GINA 2F6UA 2UV8G 4BEUA 1KBIA 3TYBA 3PAJA 4XWUA 1FOBA 1LLWA 3QRHA 2QVHA 1W37A 1J0JA 3QMTA 3BAKA 1Z7AA 6REQA 4B91A 3M44A 3XIMA 3MI2A 4EK7A 2W79A 2V81A 2X7WA 5LZLA 3OGVA 3IJDA 2RHGA 4UTJA 1H2JA 3WK1A 3PZGA 5CPQA 3L66A 5AHEA 4DPPA 4J2MA 3SCOA 2E0PA 3CUJA 4ONVA 1TPC1 3AAMA 1KRCC 1QNRA 1MUCA 3NZQA 4I8DA 4LAKA 4AEFA 2DORA 4QG9A 2FHBA 4LQ1A 4K1GA 1TVPA 4EE9A 3VYLA 1HJWA 4CVUA 5EU9A 4MKSA 4OGZA 3VDCA 4RZ6A 3ZFHA 2XSBA 3G1FA 1RXOB 3TZFA 4AD4A 4AMAA 4OFCA 5I3JA 4AWUA 2X1TA 3UZ5A 4G56A 2GUUA 2OOGA 3BURA 1FWHC 1R87A 4PBGA 2AAAA 2OO6A 2PGWA 2FVLA 4HN4A 3O6AA 4ZO6A 1SW7A 1VP5A 1SO5A 3TAKA 4PSPA 4IQLA 2PUZA 3P82A 1QBAA 1XCWA 3W9ZA 5D03A 4Z2IA 4WOQA 1EP1A 1WO2A 5DMNA 3L2MA 1TPEA 4I5RA 2NUYA 3NCOA 4QDWA 3NQBA 5CAKA 3HGRA 4I5UA 5HULA 3CH0A 3GVWA 4F2TA 1E40A 2XISA 4AAJA 3SSJA 2NV2A 3UVAA 4DF2A 1E9IA 1NJJA 2FTWA 3PG9A 1J6OA 2WQPA 3HG5A 4AZ5A 4HA3A 3RU6A 1GYMA 4O52A 4KT2A 2CIPA 4UWMA 1FDYA 1AH0A 2PWDA 3UA4A 3ZO9A 3HBLA 4DM1A 1XF0A 2H8XA 2VNCA 3V75A 3ITYA 4IMFA 3MHUA 4GPNA 4A6GA 4FNPA 1EGVA 3NQMA 2QCGA 3G1HA 3EPNA 1Q13A 3W24A 4GQRA 5A6TC 2QDHA 1BRLA 1YDVA 4O8AA 4H2HA 1D3GA 3OGRA 3UQNA 3R0KA 3RU8X 3T2OA 2VT0A 1AH3A 1VBRA 2ZUSA 5D9PA 3IV3A 4UR7A 5E70A 2FVMA 1US3A 4EXAA 1SGJA 2XVLA 4G5DA 2WJDA 2Y7FA 1O68A 3WLPA 1VJSA 2NXHA 4HJFA 3KL5A 3PJWA 4AUBA 2L5HA 5BXPA 1V6WA 2OVLA 1X39A 1TPDA 2XINA 1ZRQA 1FY6A 4ML4A 4WHBA 4GCAA 4YVVA 1BSIA 3LV5A 1ITQA 3ZJ7A 3DN5A 3EOSA 4TMBA 2BDQA 1NWUA 1GHRA 2G41A 3EZ4A 1NDVA 4LWWA 4WCJA 3W7RA 1VHCA 3ARVA 3WNMA 3PF3A 3ARTA 4AZCB 2EF9A 1S2CA 2YA0A 4IG2B 4L5ZA 1XI3A 2VX4A 2VKZG 2YXGA 3QBUA 2FHFA 1Q6GA 5HR6A 5DMYA 3UPMA 3WLLA 3R8RA 4C65A 4J40A 3THAA 2JEQA 1UWSA 3TQ0A 2WCAA 3CQ0A 3N2MA 3OPSA 3S8HA 1R9YA 3H6OA 4C1NB 3GKAA 2NQJA 1YXCA 4B16A 3RMEA 4BR1A 4QIUA 4KWWA 5IDZA 1QBBA 1DYSA 1QAPA 4ZXOA 3EX4A 3LY0A 4M5PA 1NP0A 1W8GA 4AYGA 1E4IA 3BL3A 1XD1A 4UZSA 1QHZA 4LEQA 3UXKA 4EIVA 3NDZA 2FYMA 2OODA 1NH6A 3VIPA 1RY8A 1NY1A 2WZTA 1A0DA 3J7HA 4JYFA 2XZ7A 3TC6A 1WUFA 2O0TA 3LCHA 1O6IA 3SJ3A 7ENLA 1JCMP 3W82A 1D3HA 3CPRA 2TAAA 4O1BA 2DFAA 1QT1A 4CD4A 3RNDA 1ONRA 1DOSA 3E96A 1LDCA 3NQCA 1QWGA 3QV8A 4IFRA 1SYTA 1TA3B 2ASHA 1VFTA 4D6GA 1P43A 5C2XA 2ONEA 2IPGA 3MVTA 4QBXA 2BY3A 5IDIA 1R5YA 4Y96A 4U33A 4UFLA 3TTEA 1XFBA 2DU2A 4HMEA 4B2DD 5DRIA 1KXQA 4C6IA 1W1TA 4L65A 3PNUA 1ME7A 4IJRA 5CPTA 1UD6A 2XIMA 2ODOA 2BVYA 3WBYA 5CGMA 3TNBA 4CU6A 1RBOB 3BOLA 1W5MA 4GUJA 4OOZA 4NI8A 1GQNA 3M0KA 1R8LA 2ZTJA 2WNZA 3BLLA 4XZ9A 1PE1A 2R91A 3BG5A 1GKPA 4LBSA 1DJQA 1REQB 3LUTA 1QI2A 2IMRA 1J2BA 2G3IA 1XYMA 3DYPA 1LCOA 2NZLA 1AW1A 1WQ5A 1H0IA 1CI1A 1QW8A 3EWWA 2A3BA 1Y8BA 3N6QA 3RLUA 4LVGA 1SFJA 1E6ZA 2JIEA 1YTEA 4W7WA 1ZU8A 1LRNA 3OHMB 1E0WA 3URAA 2RAGA 5LNRA 4OUIA 3GKFA 2PP0A 1PDYA 5G2HA 1SR0A 1MDRA 4WSKA 3MA8A 1CECA 4UMBA 7REQB 4GKTA 4LUSA 3IJ9A 3BJSA 5HPOA 1H61A 2ZDSA 3O9NA 3EWXA 4XAPA 4S39A 1T0OA 4AU0A 3P0WA 5TAOA 3EWCA 4XBKA 3PBVA 1HGWA 5ABGA 3GXMA 3UYCA 1J18A 5LYRA 1XHGA 1UG6A 4O8RA 4J5NA 3GY1A 4CQAA 1GTHA 3WL1A 4AX7A 3WJYA 4C6JA 3HV8A 1HL8A 1JULA 3B3DA 2WO5A 1F05A 4JCLA 3TDFA 1ITXA 4MF4A 3CUFA 1BKHA 2P3ZA 1TWDA 1JDAA 1ADOA 4PCFA 3B0UX 4H9ZA 4FOKA 3OBKA 2VD8A 3KBWA 4JNMA 4JQ1A 3M5YA 4IMGA 3ITTA 2WSPA 4V2XA 5PTDA 3EDDA 1XH2A 4U10A 3CV2A 1UUMA 2DUAA 4IT1A 3GVQA 4N9DA 3P8JA 5CSYA 4A3HA 4B9YA 1B2YA 4UOQA 3GUGA 3FY1A 4YTTA 3DENA 3TW9A 4FA3A 1EXBA 5BW6A 3IANA 3WNLA 3ELFA 2NXIA 3M0XA 3R12A 2A21A 4IXHA 1EC9A 4LUIA 3QY6A 1G6CA 1IWPA 3INPA 3WMSA 1AQFA 1QUMA 1RAKA 4MIMA 2ATMA 1PSCA 1IZKA 1DE6A 4QAIA 1U1JA 3DCPA 1WPCA 4JFTA 4PMVA 1A4LA 3NSXA 3AYVA 3U57A 4CD5A 1B0IA 3TH6A 3TWBA 1FDZA 5DLCA 3EDFA 4NZ4A 3GZAA 3CEPA 3WUEA 4QDPA 5TQLA 1B4EA 2TODA 3IIXA 3BLDA 1YBQB 2VFIA 1RVKA 4YCPA 4DVOA 3IUHA 2EO7A 3DHFA 3RJYA 3UXIA 1RHCA 5BXRA 3WZ0E 3U7BA 4MNLA 2YPIA 4DXKA 4EANA 3WQVA 1GPWA 1GVEA 3PB0A 4UCFA 2ZUTA 1CXFA 5BWFA 4GVHA 3WH5A 4HTYA 4A35A 3K1DA 2WSYA 1UKQA 3APYA 1JGMA 3QH2A 3MCOA 3TX9A 3RR1A 1ECQA 3ZT7A 3A12A 2WMFA 1TV5A 3U0HA 1J9YA 3SCTA 1Q4WA 1GVIA 3JS3A 4HVXA 2A3HA 4Y7EA 4H9VA 1AQ0A 1W2VA 2WJZA 2D2OA 5JBEA 2XM1A 6REQB 1KCLA 1EPVA 1QI4A 1UR1A 2B7OA 2FB2A 1SJBA 4JFSA 1JNEA 1MEWA 5AB3A 4JTAA 2PPGA 3Q45A 3T7VA 2GLKA 3UR5A 2G96A 1UH3A 4MG4A 1V5XA 3LCIA 3N3TA 3UY8A 1GOKA 4OVXA 3CUHA 1U5HA 1QHPA 1XLJA 4H6RA 3VOFA 2DPEA 2XUCA 2Z24A 3QLLA 3KRBA 4AZHA 2OEKA 5LA1A 3VGBA 4PMDA 2WC3A 2UY3A 1ZJHA 3TTQA 1JNDA 2XYLA 1UWTA 3WBAA 4XD3A 1L8NA 1C8YA 1CXKA 4MFDA 1TG7A 3SCRA 3HG4A 3V5CA 1H7XA 3A23A 3LXAA 2Z1XA 1OSEA 2V69A 4DF0A 5CZJA 2REQA 2DSZA 3S2NA 1H60A 4ZMGA 1LOQA 4JIHA 1OYCA 1UKOA 5FEZA 1A5SA 2ZX9A 1E0TA 3L7RA 3GTFA 4AQLA 3LEPA 4LBUA 4A8LA 5F1VA 4Q4PA 5J04A 3CC1A 1Q7QA 1GGOA 4JICA 3CMFA 1R86A 4L9XA 3P5YA 4BY3A 4OECA 3TJ4A 3FAWA 4B5UA 4HSNA 4G1KA 4C6DA 1YE4A 4HU0A 4I9JA 3MUCA 4WDWA 5ECVA 1JIBA 4TV5A 2C1IA 1H7NA 1GTEA 3OLIA 2Y62A 3UJ2A 4GQGA 2DH2A 4TMCA 4ZB5A 1W9DM 4H9TA 1KXHA 1XIGA 2NQHA 3LHTA 1UZDA 3WELA 3U5YA 1IEXA 4M8UA 3POCA 3SCPA 1M03A 2QNEA 2Y4SA 3E12A 2XWDA 4O54A 5AC8A 1E6RA 1QPQA 4D9PA 4DUVA 5FEWA 3M46A 1EZ2A 1TSIA 4UFHA 3N1AA 3H24A 2WHKA 1BEUA 1DXFA 1FDJA 1ZP3A 4DUOA 5H8UA 4PBEA 3IS4A 4JTEA 4O15A 1ENUA 4D6HA 2Y1HA 5AN7A 1K4GA 3ATZA 1VHNA 3PFRA 2J13A 3OIXA 4XZBA 4NNAA 3L2LA 3IJLA 1K8XA 3M6DA 2XIIA 4A2RA 2DY3A 3RX3A 1X1ZA 5AC5A 1FP9A 3ZR4A 2JKAA 4FF5A 1AL8A 4LANA 4NHVA 3D46A 1OFOA 3MP3A 2Y0FA 2O7QA 3AYSA 1E5JA 3PP7A 3WQEA 4IXXA 4IPPA 4Z0SA 5CPNA 4ERAA 5E0CA 1S1RA 1AUSL 1WUEA 5DANA 1WDPA 2PDMA 4IIDA 8XIAA 4B15A 4DHGA 5GNYA 1NQKA 1QI0A 3AQUA 2D0HA 4WDUA 3UPWA 1FVPA 3W53A 1XBXA 2QJMA 4W5UA 1BTCA 3VOGA 4H00A 3T0DA 2V3FA 3FEMA 3OYZA 4K3ZA 1Q6LA 3GXDA 1K9EA 1YE6A 3QHMA 1EHNA 2XGBA 2D20A 2JK2A 4POCA 3UJSA 4AISA 2D69A 4DJEC 2QT3A 1W9VA 1X8CA 3PPHA 1RK5A 3QFWA 5LIWX 3W37A 4HK6A 3GDTA 4F66A 5FF2A 4DZ5A 4Z08A 1H41A 1E51A 5HK4A 3PTKA 1SPQA 5D9OA 1KFJA 3QMSA 3DEQA 3ABXA 2QGYA 4N2YA 3ZVIA 3RR4A 3H12A 3LSCA 1TZ7A 4A4AA 3CGTA 1YXDA 1QPKA 4MHBA 4OUEA 3W7PA 3WJXA 1TWWA 2W62A 4DO7A 3GTHA 1XIMA 3WH6A 1XRVA 1XSIA 2INZA 4HNTA 3MVIA 5CJMA 3ANVA 1FWJC 3HPZA 4PZVA 2P88A 5MF5A 4JPGA 3H21A 2D3NA 4TX8A 1T96A 4NJHA 2VI0A 2QIWA 3VMNA 2CCRA 3CT2A 4QQ3A 4PE8A 2C13A 4F48A 2OPJA 1LF1A 1RV8A 2OSYA 1EOMA 4Q4RA 2PE4A 3QGAC 1W31A 1H1NA 4XZLX 3OZOA 3LD5A 3MHFA 5ENLA 3B8SA 2GDQA 3SQSA 3DG6A 3T1GA 3SRFA 3B8DA 3PJXA 5AC4A 4KWOA 1ME9A 4PCPA 2XFFA 5E6YA 5LHEA 2Y8KA 1FH7A 3EB4A 5FJIA 4J3ZA 4JL2A 3W02A 2B7PA 3L21A 2I56A 1LORA 3N6HA 1ZJBA 3OU8A 3G3DA 2C79A 1MO0A 4LTSA 2VR5A 4EAYA 1XGEA 1XG4A 3C56A 4MTVA 3WNNA 1QNOA 4F2UA 4A3UA 3GXFA 4PULA 4Q7BA 5JU6A 1TJ0A 3R13A 1HFBA 3L4TA 3WFLA 1F4HA 3H23A 4H01A 4KGLA 2PF0A 5FD0A 3XINA 1XLGA 5MHBA 2JIWA 3H7RA 3E02A 3C2RA 4LUSB 4ZQRA 4D6CA 1YNQA 3Q4DA 3U2OA 4GI9A 3CAVA 1KLZA 2VC6A 3LB0A 2XTKA 2QCEA 2ZRWA 2YL8A 2FPTA 4NAFA 1CB2A 1X7FA 3VNJA 2D23A 3AXIA 3RGTA 3G3MA 1WDRA 4JTJA 2GDVA 2QPUA 2HWGA 1W6TA 1PHQA 4Q7IA 3H2MA 3CPGA 2HNEA 3OJGA 4JKMA 1KCXA 4DLFA 4B9ZA 5H8MA 3LX9A 3N15A 3M0IA 3R43A 1Q6EA 3ES8A 1OM0A 2WAGA 3AHYA 1KM6A 3HGOA 4AY1A 3WLHA 4HPHA 3MUIA 1TRDA 3W75A 1JF5A 2X42A 3GM8A 1Q8AA 3KL0A 4UXDA 2A5HA 4LS2A 1QXLA 3RPMA 2Z1SA 3P8IA 5KETA 4MMWA 3IK4A 4UTTC 3L5LA 4MWAB 3WF2A 3PPCA 5DY2A 5DN1A 1BVNP 3UFYA 1W5PA 2D22A 1P0BA 2FZ9A 3VKKA 5DBTA 1WKEA 5FAGA 1FWAC 3BQ6A 4PODA 5IFPA 2AMXA 1ODUA 2JF7A 4AHOA 1UC4A 2NQLA 1KM2A 4X2RA 3SO7A 3RO8A 2FGZA 1ISWA 4PCSA 2PDBA 2P0OA 4ZO7A 3G22A 1KCKA 4PUNA 3L5AA 1BG4A 2Z00A 4DNMA 1EQPA 2PC4A 4RV8A 1RUSA 2BS9A 4OKDA 3W22A 3W72A 4P7QA 4RE4A 4EVZA 1E9ZB 1SFSA 4GY1A 5M2FX 2Y7GA 1VFHA 3NYDA 3GNOA 2KAUC 1BYBA 3CNYA 1AH4A 3EXSA 3TQVA 1JI2A 4YJ5A 4IGNA 1HJXA 7PTDA 2E7FA 2EG6A 4AY7A 3A24A 2ZDRA 1QO2A 4DQWA 2G50A 2VP8A 3W7MA 3WUBA 3LTPA 3W4RA 1V02A 3UZWA 2XH2A 3AXHA 5E6ZA 1DQUA 1H49A 1QI3A 3KOZA 2V5KA 1CEOA 1PZ0A 2C16A 2Z7KA 1IGWA 3GDKA 1ZQ5A 1JYVA 4PEEA 4RJEA 2YBTA 4MFEA 4MDOA 5ABFA 1OADA 4GUIA 1AG1O 1RD5A 2Q8LA 4L1GA 4MJZA 1EA0A 4N02A 2VD9A 4O57A 2J78A 2WHLA 3VDGA 1QFEA 3LS9A 4DZHA 3BV7A 3LRMA 1HKVA 1W56A 5FACA 2XVGA 1RVGA 1MXSA 4DWSA 2DZPA 1VFOA 1E72M 1KBKA 5IHSA 1RJQA 1LRTA 3WUFA 1LBMA 4YPJA 1S2AA 4LAUA 3WLRA 1M6JA 4Z17A 1ZTVA 2PU1A 4GUGA 4R7WA 5FL1A 1M9HA 4I7WA 2J79A 2JF6A 5CGTA 5BXSA 2C18A 5G5IA 4HU8A 4HCHA 4N9EA 4QJ4B 1QO5A 3CZLA 1TR9A 3AU6A 3D5HA 1UOZA 1KV5A 1JF6A 1HT6A 2ZZ7A 3TOPA 3M07A 4WKFA 1OC5A 3BAWA 2X1IA 1MRAA 3NQDA 1JUBA 2ZX6A 3FFSA 3AIUA 4TVDA 3W1NA 3QPYA 3C5QA 3QQ0A 1X8FA 3VX0A 4LV4A 1TVLA 1DIKA 2WPBA 2CZDA 2D24A 2REQB 5IBXC 3FW6A 2W4XA 2ESCA 1JCJA 4KIEA 4EACA 2YZ5A 5C9UA 4O53A 3EX1A 3CIVA 2E6FA 5J5RA 1IT0A 3QY8A 4B5VA 5KZDA 1FWFC 3QY7A 4C6EA 3GG0A 1KFBA 3E3HA 2O55A 1KM5A 3VE7A 2AAMA 1XW8A 2O7SA 1XIHA 3SCQA 3FYPA 3CB8A 4QITA 3UJRA 3B0XA 4KQNA 2C0AA 2VZSA 1EJTC 2PDQA 2H3DA 4A3YA 3L2IA 1G7UA 4ZTXA 4DBDA 1DHPA 4RPPA 3NVTA 1G4EA 5DEZA 1J10A 3AOFA 2XWEA 5FJRA 3GTIA 2P53A 1LQ2A 1JYXA 4J3UA 1UW9A 4GX9A 5FJUA 3IAPA 4MNMA 1KWGA 5BXTA 4LNYA 1K7FA 4AXNA 5A94A 4NILA 3W7JA 3R79A 2XH4A 3CHVA 1DPMA 1H11A 2UBPC 3W25A 3JRKA 1JD9A 1I2QA 4H19A 3WDHA 1SUXA 3H4WA 1LL4A 3BG3A 2WPGA 4IL2A 1QW7A 1TVNA 4GHRA 1OFRA 2GVGA 1TWZA 4IIEA 3M6YA 1XC4A 2DIEA 4Q3MA 3FJ4A 3NUKA 3G1SA 5C2GA 1VS1A 4HHPA 2GGJA 1W1YA 4IJCA 5FL0A 1YDOA 4AY8A 3TROA 3DG7A 1I4NA 1EEPA 1XICA 1IXOA 3CQHA 1BKSA 3AIQA 2RKXA 1BGGA 3HQ1A 2HBXA 4OIFA 1H62A 5A6MA 2XVKA 4AEEA 6XIMA 2Z27A 4ACZA 3RX4A 1N8IA 4PUUA 2C0HA 1OVDA 1R3YA 3U9IA 3SFWA 1W17A 5T9CE 3GXNA 3AI0A 3FOKA 3F4NA 3TJXA 1XLLA 1DEDA 3V16A 2QCNA 1F3EA 1EP2A 4MB1A 3G6MA 1KR1A 5HPCA 5LIYX 4OBTA 1JQVA 3CU2A 1I8JA 1GQLA 5A6SA 5AZ0A 5I7GA 1IF2A 1PKMA 3K4WA 1JRCA 3OG3A 2ZWZA 4H6EA 3DECA 4QGCA 4OZOA 4US5D 4M1RA 1Q66A 3W1TA 3HOJA 3BCFA 2HPMA 3L4WA 2DT3A 2F38A 3DX5A 1IHIA 2QHAA 4JTCA 3UYIA 4C7DA 4PRTA 4QLJA 1V3KA 3UXAA 1T8QA 2P3EA 4RLIA 5EL1A 4J9JA 4C6MA 1IQ8A 1L6FA 1Q6DA 3TIMA 4AYSA 3N34A 1I0DA 5HINA 1CLKA 2YCEA 1MUWA 3W88A 3WJZA 4YL2A 2VFGA 1E3XA 2Y88A 4DXVA 2QS8A 5D2VA 2E9LA 3NQVA 5LIKX 4LJ3A 4B90A 1WKFA 1EPXA 3QFEA 1OGGA 2Z2AA 1WDQA 4HGXA 3MZ2A 2BY0A 4KKXA 3PNZA 2OWXA 1AMYA 1K9DA 1F76A 3M0HA 3P3BA 3UGVA 2WWDA 5F4WA 1AMKA 4LAOA 5AYBA 3S3GA 2PFHA 4LB4A 1VBJA 4FXSA 3G5EA 3SURA 1VFMA 2QUVA 4IGMA 3W2MA 4KF1A 3QSTA 3MDWA 1UJQA 5FCZA 1EYEA 3A5FA 3UWUA 3WO8A 3NGFA 4ZZ9A 2WK2A 1JCYA 2FH8A 5BMWA 3GDLA 1K02A 4JTDA 2OZTA 4AB4A 3AFBA 2E68A 3B4UA 1F74A 3B05A 1DIDA 3V0TA 3HU7A 2CWNA 3V0SA 2ZUNA 4GFIA 4NASA 2ZVRA 3TXZA 2VENA 3GLCA 1IYXA 4IIFA 1NQ6A 2BTMA 1A5LC 1QPRA 3BAIA 1I75A 4KETA 5A6KA 2POZA 2ISFA 3IGUA 4BKNA 4IUGA 2BY1A 4I9MA 4K39A 2GVYA 4O1CA 2X2YA 3LBOA 1NDZA 2J47A 3E0FA 5HQMA 2VM8A 5H91A 3P84A 4ICNA 2E6DA 4J4KA 2BBFA 1G9HA 1XJBA 4GNKB 3U48A 2OZ8A 4RDYA 2TRSA 3CB3A 1E4NA 4LUTA 2Z1BA 2YLLA 4YHEA 4UZUA 4JY8A 1BPLB 3VD5A 2DQXA 4JTHA 2PDXA 3TTOA 4BF5A 5D2XA 3SM0A 5M3WA 2Q02A 1O12A 3R11A 1I2PA 1L9WA 2R1PA 3RDKA 2OQLA 2Z2BA 4GWEA 4RDWA 2P1FA 5E09A 3BCJA 3W28A 4UMAA 2XGZA 4CQCA 5FESA 3AHXA 3PAOA 1S3HA 2WXDM 3JW7A 4BEQA 3TCSA 4Q4OA 2VEKA 1C92A 3O6CA 4JX5A 4F79A 1W3NA 2ZUMA 4NXKA 4Y9MA 4FX8A 2WVTA 3SN4A 1Q63A 2VEGA 4BQ4A 1JPHA 2I5QA 2VCAA 1TTIA 2VFFA 2QCCA 4LAZA 1P0NA 1AD1A 1JGIA 2QAPA 2AL2A 2YIHA 1NFPA 1S2TA 4KCVA 2ZX8A 3VI2A 3EA2A 4ORMA 2ZZ4A 1CYGA 2F9RA 2C6QA 4O1AA 3CWHA 4E8CA 2OWWA 5EMMA 4LB3A 3WQDA 3KOWA 3NPWA 3GFYA 3AROA 3CWOX 4C1KA 4NZJA 3TFXA 3GR8A 2H90A 2ZTKA 3ZMRA 1H51A 4GO9A 1UR9A 5A8OA 2BVTA 4BI5A 5DXYA 1NVMA 1FWCC 1UKSA 3N14A 4GXPA 5FIPA 4GYPA 3ITGA 1CGVA 3CIWA 5LIUX 4K36A 4BJHA 3A64A 5D8WA 2JGYA 4CKQA 3ME3A 2YXOA 5D2YA 2VTFA 2WSKA 3KE0A 3EEZA 3T0TA 3QV9A 1N8WA 2DZWA 1DJZA 4PCNA 2E8ZA 3W29A 3FJ6A 5B7YA 5C9WA 2XHYA 2EKCA 2PDLA 2PC8A 4ZA0A 5EGRA 2OT0A 3GAYA 1K7EA 1P7TA 3UZXA 2NQZA 1LBLA 4QE5A 4NX0A 5LKYA 2A3AA 1TWIA 3YPIA 4UTUA 3BXWA 3W73A 4DWSB 2XFWA 1H5VA 1XGDA 4BQ5A 3BOXA 2Y5JA 4Q8PA 4XZNX 3PN8A 1TMHA 2A3LA 4GIEA 1EO5A 4KH2A 3AMLA 1Z41A 1UWRA 5D05A 2F6KA 3AIBA 5AY7A 3T44A 3VDBA 3OHIA 4DI8A 4AVFA 2O9PA 4XV0A 1KLYA 3JU2A 3TNOA 4DZAA 4E8GA 4GYKA 3IACA 1JDFA 4YN5A 1ZAIA 2CLPA 4GC4A 2XFRA 4L6HA 3STCA 4QX4A 4JHZA 2QCMA 1UZ1A 5DT5A 4HMNA 3DUGA 4ZO9A 3TW7A 3WK2A 1CGYA 4ATLA 7A3HA 4FZIA 2Z6IA 1HP5A 2YR1A 2WBKA 1J6PA 3CEUA 4EP8C 1AJ2A 4X0NA 4DJEA 2PTXA 3LENA 2Y61A 4M80A 3PBWA 3LPPA 2FMOA 5T8GA 4GI4A 5HQEA 1DVJA 1E0UA 3DGBA 3GHUA 6TIMA 1TJPA 1TJ1A 4E4FA 4JXCA 1HJQA 4ES4A 4GYJA 1ZUAX 1VCVA 4XZIA 3LTSA 1TQXA 3FS2A 4URIA 2OKTA 3SQLA 1FWEC 2YW4A 3WDQA 3MSRA 1VGAA 1DJNA 1JDDA 1DIEA 4P8XA 3WCZA 4O11A 5CSRA 3LXBA 5F2MA 1AQMA 4A3QA 5FF0A 4R9XA 3W87A 4ZSTA 1FWTA 2QIIA 1F3WA 4HMCA 1A3WA 6ALDA 3MJYA 2V5CA 4NYUA 2W5FA 1GORA 1KGXA 2R82A 5E1QA 3GHSA 3QZ6A 4L61A 4E4UA 2Y8UA 1DWFM 4MGGA 1P1MA 1Z42A 1DBTA 3PVFA 3S5SA 1FWWA 2J88A 4XTDA 2Y6ZA 1LOLA 3ZM8A 3BQ5A 4M24A 1R2RA 3C0SA 5FJTA 3ZZ1A 1W3LA 3PY2A 2DQWA 5CZSA 3LGDA 4CQBA 3NOYA 2O92A 3O06A 5U7SA 4Y8FA 1VH7A 4U3AA 2CETA 3TXVA 1H63A 4JDYA 1MWOA 2YDAA 1W3TA 3F5LA 2Z28A 4IP4A 3EPMA 2PB1A 1KM4A 1HX0A 4A29A 2RUSA 4F40A 2ADAA 2NQ9A 2DVTA 1SSGA 2EPMX 3DI1A 1POKA 3C2VA 4MNJA 4OBRA 2YJQA 3RJXA 3B0PA 3H2CA 4H6QA 1VEMA 3GR7A 5HWJA 3F2DA 3DFPA 2WNQA 4HNVA 1UQYA 4V28A 2J7BA 4W8LA 1MRQA 3VOIA 2QULA 4ZQPA 5CBIA 2IQ0A 4AD0A 3W1RA 2C1GA 1LLZA 4PEKA 3TQPA 3RLGA 4Y90A 3KBMA 4PTMA 4Y6GA 4M1BA 4ZFMA 3DYMA 3IGSA 3RFAA 2ABAA 3GO2A 4DBUA 3PFMA 2KZHA 5SWUA 1AD4A 1SM9A 4C7GA 1O5XA 1GOOA 2WNNA 4ACZB 1RBAA 1K03A 5FAJA 4GNJA 4MKNA 4D8ZA 2ON3A 3WBXA 4IPIA 3VDHA 1MUMA 3W7NA 5A8QA 1UBSA 3SUUA 4WJXA 4GNVA 2EPNA 4R3UA 5LXXA 3LPFA 3T05A 4YWSA 2J8GA 2BHUA 1S2UA 4JGDA 1SU5A 1ZALA 3EXRA 1UWAA 4GBUA 5HBFA 2DVUA 4NJKA 4RR4A 5EA9A 1GK8A 4UIOA 3UW6A 1WBJA 1C8VA 3S1VA 1WNOA 5A8NA 4GD0A 4N9CA 3K5XA 1GZ1A 2F84A 5BRQA 4PMXA 4UTTA 3WK0A 3IK2A 3M7WA 3VUSA 1CLXA 1TPB1 5CC6A 4HZ8A 4WF7A 3G8RA 1KWKA 4H8HA 1DIOA 2BLEA 1OT2A 3UWEA 5DT7A 1JI1A 2AQOA 2GQAA 3PB2A 3GQYA 3V7PA 3PANA 5REQA 1UP3A 3T8QA 1J2WA 5BCAA 4LYRA 1XPYA 3WEZA 1E1FA 3GXPA 4C6BA 1PKYA 3FAXA 4DZIA 9RUBA 1B3YA 3WYZA 2BOGX 1CBGA 4NJIA 3AHVA 3R4IA 3EXTA 2GJLA 1YTDA 5AYZA 3A4JA 1R9ZA 3TTYA 1X6UA 1GUVA 3BO9A 4MUPA 2PTDA 2Y8VA 3H2EA 1A0EA 5HJYA 4GJJA 4A3RA 1WXYA 1XLAA 3T55A 1KFWA 4O18A 1U83A 4AZBA 4CNNA 1Q7MA 4O19A 1MQPA 3F4CA 2J77A 2WWCA 3QZAA 7XIMA 2CU0A 4PB5A 4IIBA 1AZ1A 3K2GA 3WUGA 1OC6A 1R3WA 1HO4A 1VKFA 1Y5XA 2PDIA 4AD5A 4HSOA 4WOZA 4ZB0A 3SW6A 1Z32X 4MWAC 4H83A 4O12A 3NSNA 1F8IA 1PZ2A 4BCEA 4ZO8A 1GONA 4GXWA 4ZODA 2PD9A 2HE8A 4XK2A 2PTZA 1JVNA 3OOQA 3OG2A 4PMQA 1D7KA 2PBGA 2XM2A 4S38A 4MJ4A 2WW5A 5AC6A 2GUYA 1VYPX 5FEXA 2RJGA 3LK6A 1HP4A 4WIWA 3GXTA 3TP4A 3FYYA 2QUMA 3WDJA 3EMZA 1GVYA 2WMJA 3ARRA 4E3VA 3OLDA 3KCJA 4FNSA 3R8HA 4HCLA 2DJXA 1FKXA 4TU1A 2YFOA 3M0ZA 1AW2A 4DBSA 3H7VA 1ECEA 2ZXDA 3STPA 1Z48A 1UROA 3BH4A 1R3QA 1PXGA 3CO8A 3NSMA 4EPBC 5GNXA 5BU9A 2E5DA 3B04A 3C3NA 1XX1A 1ZBKA 2V3GA 3W0KA 2Z1WA 3F2CA