2GSJA

Cdna cloning and 1.75a crystal structure determination of ppl2, a novel chimerolectin from parkia platycephala seeds exhibiting endochitinolytic activity
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
271
structure length
271
Chain Sequence
GGIVVYWGQNGGEGTLTSTCESGLYQIVNIAFLSQFGGGRRPQINLAGHCDPANNGCRTVSDGIRACQRRGIKVMLSIGGGAGSYSLSSVQDARSVADYIWNNFLGGRSSSRPLGDAVLDGVDFDIEHGGAYYDALARRLSEHNRGGKKVFLSAAPQCPFPDQSLNKALSTGLFDYVWVQFYNNPQCEFNSGNPSNFRNSWNKWTSSFNAKFYVGLPASPEAAGSGYVPPQQLINQVLPFVKRSPKYGGVMLWDRFNDLKTKYSSKIKPSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title cDNA cloning and 1.75 A crystal structure determination of PPL2, an endochitinase and N-acetylglucosamine-binding hemagglutinin from Parkia platycephala seeds
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords protein PPL-2
total genus 99
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gsjA00
2XWEA 4KGJA 1MW2A 2V38A 4UTFA 3VX1A 1KWKA 2WNWA 2UY5A 3VDAA 3WF0A 4PEEA 3T2OA 4CVWA 2WHKA 1QI0A 3I3EA 1I1WA 4PCSA 1PAMA 4JFSA 1VB9A 4NF7A 2V5DA 3I3DA 1J0JA 1E71M 2WVSA 3RMEA 2XM2A 3WH8A 4LQ1A 1OB0A 4Z2LA 2WK2A 4EAMA 2GFTA 3MMUA 4JHZA 3WFZA 2ZXDA 1CEOA 1M01A 1EHAA 1E4LA 5A6AA 2CIPA 1ITXA 3NDYA 4BQ3A 3N18A 1CGUA 1E6QM 5BXSA 4JFTA 4EKJA 4BF7A 1GZJA 4WF7A 2WC4A 2A3EA 4U31A 1TVNA 5GQBA 1R85A 5AC4A 2VZSA 4BQ2A 3LPOA 3DECA 5D9OA 1EDQA 5GNXA 4HMEA 1EA9C 4D72A 3G6MA 3NDZA 1UR9A 3PZQA 3OGVA 1EIBA 2PWEA 3DHPA 3AXIA 3IK2A 4DM2A 2YDRA 2E4TA 1GOWA 1W2PA 1V08A 3GH4A 1E5JA 1W1VA 1V02E 2WC3A 2YA2A 3AZSA 4F66A 1H2JA 1GNXA 1UA3A 1W9XA 2VRQA 4HA1A 3W53A 2YBTA 1CDGA 4H7VA 5DFAA 1KR0A 3TP4A 1QNOA 3GXIA 5CLWA 1KXHA 2V3EA 3SCSA 2W66A 4PYSA 4J3UA 3VMOA 1UD2A 3VD4A 1W9UA 3KL3A 2W62A 3M6DA 3VDHA 3ZT7A 2CBUA 4KH2A 1AMYA 3QHOA 2PWDA 8CGTA 4MAVA 2NW0A 1VEOA 1LL7A 4AD5A 2DEPA 3VIHA 5LA2A 3T2PA 1A47A 3M46A 5A1AA 3NCOA 2WCSA 2A3AA 4UNIA 5KEZA 1E43A 1Q4NX 3NJ3A 1UG6A 2WLYA 2C8NA 1UWTA 3NYDA 5A2CA 2GK1B 1NWTA 1U33A 5IDIA 4H8UA 3WF2A 3SCQA 1A3HA 4CUCA 1GQKA 5ABHA 3O2LA 4ML4A 2FH6A 1JZ8A 3DC0A 3U7VA 4D6FA 1HF6A 3N1AA 1K9TA 3FN9A 3ARRA 4D71A 2O9TA 1ZBVA 4GO8A 3AROA 1OD8A 3W29A 3VOCA 1MW1A 3NUKA 2D20A 2J79A 2O9OA 2WSPA 3WBEA 4PTMA 1E15A 1L8NA 4CN6A 3ZO9A 2WM0A 1QI3A 4W8AA 1UD8A 4AZGA 2WWDA 1N82A 4TVCA 1FP9A 1CXLA 1EOMA 2DGAA 1GOQA 3CHFA 1CGTA 2J62A 4HZ8A 1BGGA 3MMWA 2XIBA 2EBNA 1CTNA 2UY3A 1V3KA 5ECUA 2YDQA 3VDBA 3VD3A 1XYFA 2G8ZA 3AI0A 4HMCA 2W92A 3VGBA 9CGTA 4JCMA 4AZBA 5BCAA 2CKRA 1U2YA 1GVYA 1MYRA 2X8RA 2X0HA 1NWUA 4LXFA 1F4AA 2WC7A 2DSWA 1E73M 2Y4SA 1PZ3A 1QHOA 1HKJA 2XFRA 2VR4A 4GO9A 1QNQA 1J0KA 3MSGA 4GZIA 3PZ9A 4PMRA 1VFFA 4OKDA 2VOTA 1PIGA 1JF5A 5HDRA 5I5RA 3WDIA 3T0AA 1WPCA 2NT0A 4PMVA 3IJ7A 4MNLA 3OZOA 2YOCA 1FA2A 1JYWA 4S3JA 3UEQA 3K8KA 1E72M 4GPNA 1H41A 4IM4A 4J3VA 4TVUA 2OWXA 4ACZB 4F79A 3GH5A 3FW6A 1NOUA 4M82A 5BXTA 2ZX6A 2GK1A 1H1NA 3CH9A 3ECQA 4DM1A 2FH8A 1J01A 3TA9A 3QGVA 4R27A 1V6VA 1JDCA 4V28A 1R86A 4PMQA 3QHNA 1ISWA 4ZE5A 4TX8A 1UD4A 3OIHA 1W1PA 2AOSA 2W61A 2J78A 3PHAA 3WUGA 3AIWA 2V3GA 3DYPA 4AIOA 3KEHA 4ACYA 1UWSA 3CUHA 4J7RA 1HJUA 2VZOA 1ODUA 1C90A 3OLIA 1QPKA 1VBRA 1KGUA 3IAPA 4W85A 4W89A 4D6CA 3AIRA 5JBFA 2XPKA 2ZUUA 4U3CA 1LL4A 4AIUA 1JNDA 1LWHA 1UZ1A 3CBWA 4NRSA 3WMBA 3BC9A 2RGLA 3ZSSA 2X0YA 3BMWA 2A3HA 1GOIA 1QBAA 4ZFMA 1QNSA 4HU8A 2XHYA 4AEEA 2XVPA 3MKKA 5HOSA 4AMCA 3PZUA 2ESCA 4X0NA 3VIJA 1E6SM 1BVZA 2C0HA 1E5NA 4D6DA 5DT5A 1MVYA 3F5LA 1RD6A 2EQDA 1B9ZA 1OM0A 2GDUA 1K9FA 3SUSA 3U5UA 2VZUA 3U5YA 1NWSA 2CEQA 2XTKA 1EQPA 2QV4A 4XX6A 4PRWA 3WF1A 5CSUA 4WLCA 1LG1A 1NQ6A 5E6ZA 1XCWA 2UY4A 5CPTA 1BYDA 2W91A 4FLSA 2ZUNA 3VIIA 1C7TA 1C7SA 2BV9A 3T2QA 3FAWA 2Y5EA 1G1YA 5FD0A 1OD0A 3WNMA 1WAWA 1EDTA 3VD7A 1C92A 1GVIA 1VF8A 1MFVA 3L2LA 2WLZA 5A6SA 1IV8A 4TXEA 3A4XA 1AQHA 2ZWZA 5E09A 4AZ7A 4UOZA 1WB0A 4HU0A 4U2YA 2PWFA 2D23A 1B3YA 1KBBA 1E4NA 4LYRA 1HJVA 1WNOA 3SCWA 1TMQA 2WVVA 3RPMA 4D6IA 5FKYA 4RE2A 1XGZA 5EBAA 3ZJ7A 2WMJA 1BYBA 6TAAA 1VIWA 2UWFA 2XVGA 4HZ7A 4AZ5A 4AY1A 1B30A 3N12A 2BY3A 1UWIA 3AMDA 1JDAA 3SEPA 2QF8A 3EMCA 4KRUA 1E9LA 1VJSA 2WHMA 4AISA 3DYOA 1CGYA 1EO5A 3WH9A 3EDEA 2BFGA 2QLYA 3BCFA 2ZUVA 4WJXA 4Y7EA 1W9BM 3HJEA 2WAGA 3CZGA 4BA0A 2G4FA 1HP5A 4IPNB 1V3LA 1PBGA 4W7WA 1BVNP 2VL4A 4H8HA 3O9NA 4HOWA 4UZUA 1SYTA 2G3IA 1FHDA 5IHRA 1PZ2A 3N04A 1DWJM 1V3IA 4AD3A 4PMOA 1XSJA 2DSUA 4WKFA 1E40A 4KMQA 2J77A 1OIMA 3THCA 4J3XA 4IUGA 2W63A 2ZX7A 3WNOA 4W5ZA 1KFWA 3ARQA 3WQVA 4AZCB 4UCFA 2WMHA 1TVPA 5FCZA 1V6YA 2PBGA 5FIPA 4W86A 4DWSD 4WSKA 5C8BB 1JZ3A 3MO4A 2FHFA 3AHTA 1CXKA 1W9DM 3VNZA 1B3XA 1C93A 1GJUA 4UR9A 1W3HA 3GZAA 1W9PA 2XWDA 1L0PA 1UR0A 3BSGA 1R7AA 1K6AA 4JAWA 3ZR6A 3L2MA 4M29A 3LPGA 3WQ8A 3OBAA 4JKKA 4WK9A 3AOFA 3MV01 1KGXA 4BS0A 5DO8A 1WZKA 1H5VA 2IXVA 2XSBA 3W0KA 1W1YA 1DHKA 1EOKA 2XYLA 2BHUA 2ZIDA 4CD8A 2ZXAA 1CGVA 2WWCA 3ALGA 4F9JA 3PZGA 3BMVA 1QNPA 2D1ZA 3CZ8A 1HKMA 3VTRA 1WKYA 2WANA 1GW1A 1IZJA 2GJPA 4MB3A 4M1RA 1PPIA 4HOZA 5JIWA 3EDDA 5BRPA 1OT2A 3RM9A 5D4YA 1UKSA 5D8WA 1CLXA 3WL0A 4FLRA 3VVGA 2WSKA 1KBKA 4PTWA 5A6JA 5EMYA 2EPMX 4AD2A 1CLVA 4E8CA 1W9VA 4MTVA 1DP0A 2RGMA 4MB1A 3CZLA 3A3HA 5A2BA 1TA3A 3VUPA 5HPCA 1QOXA 3E1F1 4TVDA 3RILA 5AC5A 2WVVB 2JF6A 3OA5A 1BGAA 2BS9A 2F61A 5LYRA 2X05A 3CMJA 1QI2A 5KZ6A 3RCNA 4L4OA 2J8FA 3LPPA 2OSXA 4RE4A 2BY0A 3ARPA 5A8NA 3L4VA 3VIFA 3AHZA 1PJ9A 3GBEA 1MW0A 1GPFA 1VFOA 1FH9A 2V5CA 2F2HA 3ARZA 3N11A 3PZOA 3W38A 4HA4A 2AMGA 3AIQA 1MQQA 1H3GA 2GSJA 3VPLA 1OINA 5M3WA 3VGEA 3BSHA 3APGA 1HT6A 1ZBCA 3PTMA 2VCBA 1HIZA 2OWCA 3FHAA 4JCLA 2OWWA 2WMIB 2ZOXA 1HL9A 2ZE0A 5CPQA 1HNYA 5M03A 2CHNA 5BRQA 3VIGA 1D2KA 1W2VA 3WL1A 3CHDA 2XM1A 2TAAA 3VM5A 1EDGA 4GKLA 2VVNA 3PBGA 2WCGA 3UR7A 2X1IA 5DT7A 1ZU8A 2XFFA 1AQ0A 5BXRA 1KQYA 2CERA 4OOZA 4GQRA 4UQDA 1UH3A 3BLPX 4AZHA 1XH1A 2EPNA 3WH5A 1VRXA 4JKLA 1JXKA 2DDXA 4CCEA 2CBIA 3CMGA 1Q6FA 1NARA 2QPSA 2YL9A 1E3XA 2YLLA 1J0HA 3SUVA 5JUVA 1RH9A 4PTVA 5LA1A 2BVDA 1BHGA 3F4VA 2YA0A 1HP4A 3VIMA 4PCTA 1D7FA 1HJWA 4UFMA 3AHYA 2VCCA 4RL3A 2XUCA 2AAAA 1X1NA 4P7RA 3U57A 5IHSA 2XGBA 4GZEA 5A69A 2E9LA 4UFJA 4XZWA 3VGHA 4Z2IA 3LPFA 3BAYA 3MUZ1 3UCQA 1VAHA 3I3BA 1E6NA 4J28A 5CQ1A 2XVNA 3MUAA 1LL6A 1W3JA 2VX6A 2ZICA 4B9YA 1JDDA 4GI6A 1CYGA 5BROA 3NSXA 1ZBKA 1MWOA 4U2ZA 2Y2WA 4OBRA 2JF7A 3RJXA 4P8VA 4PUEA 1VEMA 1E1FA 3ZSTA 1XCXA 3GM8A 1J10A 1UH2A 4IPLA 4ZXLA 2WVUA 4UQEA 1E3ZA 3TOPA 4L4PA 3VIOA 2QMKA 4UOJA 3T0DA 3WD2A 4K68A 1LG2A 2J25A 3ZJ6A 5EFFA 1GORA 3PTKA 5LA0A 1KGWA 1OWQA 5A3HA 1UR2A 3OLGA 1C8YA 2ZUTA 5A8OA 3LMYA 2E9MA 1W32A 3WUEA 4GIAA 3VM7A 4W87A 4R5EA 5D8ZA 3VDCA 1HJSA 2XIIA 1JL8A 1OBAA 4J27A 1UKQA 5HPOA 3WSUA 2BHYA 4CU6A 3HU7A 1PX3A 2WMIA 2XVKA 3ARUA 3VNYA 3CIVA 4MB5A 4TTUA 3GYCA 4B9ZA 4ATDA 1QHZA 3VU2A 5FOOA 3KE0A 1JYXA 1UUQA 5E70A 4E4PA 4CKQA 1ZS2A 5A95A 4QCEA 1GJWA 3GDBA 4Z2KA 2PF0A 3AMCA 2BXZA 3IANA 2E40A 2V3FA 5A2AA 1FHLA 1MXDA 1UR4A 4QLLA 4D6GA 1ZL1A 2DSKA 4JZ5A 3MANA 1H4PA 3AS3A 3K4AA 2BXYA 3WDQA 4D1IA 2B31A 2A3BA 2JIEA 3UERA 1IZKA 3A4WA 4CD6A 3CUIA 3W28A 1GUVA 1VJZA 5CZKA 4FF5A 3W24A 1JG9A 3VIKA 2Z1KA 1C8QA 4LPCA 3AHXA 1CPUA 1NOFA 1SMAA 3WDHA 2VRKA 1XV8A 2DT2A 1V0KA 2VURA 1E6PA 1YQ2A 3EDFA 1ISVA 1SR0A 4MJ4A 2WZEA 4MAZA 1UZ4A 4M81A 3ZIZA 2FHCA 1V6XA 2CCRA 3FNDA 3WY1A 1BQCA 1EXPA 5FL1A 3WD4A 1BYCA 3CLWA 7CGTA 1V3MA 1RPKA 4J3TA 1C91A 3CHCA 2W5FA 2E9BA 4GQQA 4DWSB 3M07A 1E6RA 2FHBA 3NSMA 4ATLA 4HPGA 2J7DA 1E0WA 4PSPA 4TOQA 2ZUSA 3CTTA 4CGTA 1GQLA 3ZQ9A 4UQ9A 2XSAA 5JBDA 4HZ6A 5TD4A 3T09A 1BAGA 3QHMA 1G9HA 3K8MA 1ITCA 3DHUA 4A3YA 2WB5A 3ZM8A 3RIKA 4YHGA 1JZ5A 1V03A 4V2XA 1ZJAA 4WSJA 2UY2A 3UR8A 4UQCA 1SMDA 2BY1A 4N0RA 4CD7A 2CITA 3CGTA 1I1XA 3BCDA 3L4TA 1GHSA 2DH3A 1B90A 4JKMA 2FGLA 2JEPA 4JL2A 2Y8VA 4ZEPA 3TTOA 2EPLX 3CHEA 3WQ6A 4DUXA 3QR3A 1HVXA 2PWHA 2CBJA 1V0NA 2ZUMA 2OLHA 3VKKA 3ZJ8A 4HP5A 1OGGA 3S6TA 3CZEA 3GBDA 5JIPA 3PZNA 1UYQA 4ZE4A 1JF6A 1R7OA 4MPKA 7TAAA 1GHRA 3GNPA 4RE3A 4MB4A 2VR5A 4U3AA 4AXNA 5D9NA 2VX7A 3N15A 4BQ4A 3K8LA 2XFYA 4CCCA 7A3HA 3BAJA 2GDVA 4CD4A 1DWIM 2CBVA 1CENA 1JGIA 2MANA 2WMFA 4W93A 1TFVA 2WPGA 2A3CA 3BH4A 4C7GA 1GOOA 1WDRA 1UD5A 3UG4A 4CD5A 4UFKA 4W5UA 4JFUA 4AC1X 4AD0A 4GXPA 3PTQA 1TR1A 1RP8A 2CYGA 1OGBA 4LYPA 2VJXA 4YPJA 1SFSA 5C71A 4MNMA 1UR8A 4HTYA 2Y8KA 3ARWA 4AD4A 3OB8A 1QW8A 1UD6A 5AYBA 3RDKA 1ISZA 1E56A 1QBBA 4AW7A 4NI3A 1IT0A 4DUWA 5I24A 4MNJA 2WYSA 2PWGA 4C7DA 4QDMA 4YN5A 1ESWA 5HXMA 5A6KA 4AIEA 1HN1A 1ZJBA 3SIMA 2W67A 4FLQA 2D0GA 2JEQA 3FY1A 1JFHA 3AISA 2DH2A 3TTYA 2WKGA 5CPSA 1JAKA 3A47A 3N13A 1QW9A 3JUGA 1DWHM 2DPEA 3WBAA 3VX0A 4KWUA 4KGLA 2X2YA 3G6LA 4WKAA 4LGXA 1TG7A 1HJXA 3ZMRA 2C7FA 4MDPA 2G3NA 1V02A 3AZTA 1CXHA 4FK9A 2Z1SA 2ZX8A 5EFDA 4P7OA 3W81A 3CZJA 1XYZA 4W84A 1H49A 5DEZA 5I0DA 2ZX9A 3AMGA 1HVQA 1V6WA 3II1A 2WVTA 3EMZA 4OBSA 3VGFA 1EGZA 2YJQA 3MMDA 3VIPA 4AZIA 2J75A 4Q7NA 1E6ZA 2F8QA 3SCUA 1NOWA 1UKTA 1FFQA 1W1TA 1VFUA 1XSKA 4A4AA 1PIFA 1OGSA 1KB3A 3W25A 1HKIA 3AHVA 2D22A 3GTNA 4GINA 1WZAA 4GI9A 3PZVA 4D6EA 5DMYA 3KL5A 1M53A 2DIEA 4U5KA 1CWYA 1BG4A 4D1JA 6A3HA 1MFUA 2OYKA 1P6WA 1WDQA 1UHVA 1E0XA 2XJ7A 5E9AA 5I79A 1E70M 1W91A 3WF3A 5IFTA 1J11A 1TE1A 2DIJA 1M7XA 5I6SA 4MNKA 4QFUA 3ZT6A 2JE8A 4B3LA 3A6OA 3W26A 1G01A 1E4IA 1K9EA 1FH8A 3EDKA 4W8LA 3S2CA 5E6YA 5HBFA 3ZR5A 3ARTA 4ATWA 2YKKA 3VGGA 1D3CA 4P8WA 4W7VA 3VILA 2EXOA 2GJRA 8A3HA 1J0YA 4Q22A 2VZTA 2VT0A 2XVLA 1KQZA 1E55A 1EHNA 5JBEA 1F4HA 4U5IA 1FOBA 4JIEA 1UWQA 3WF4A 3NSNA 2QMJA 4XB3A 2WXDM 4BZYA 3WKZA 1X6LA 3L4ZA 3AYRA 1US2A 1VENA 1DWGM 3B8SA 2W4XA 3WEMA 4EANA 4DUVA 1Z32X 1JZ4A 3M7SA 4MDOA 4OOUA 4B3KA 2E3ZA 4F9DA 3WH7A 3TONA 1KCKA 4PMZA 1WDPA 4MJ2A 2IXUA 3O6AA 1K9DA 2WHLA 1MW3A 1AVAA 1CXFA 1Y7VA 1H0IA 1JIBA 4TX6A 2D0HA 1MXGA 4F8XA 1QVBA 3NIYA 4UQBA 2XGIA 2WHJA 5I3DA 1KR1A 4H41A 2CPUA 3PZMA 1Q6CA 4TUFA 4H2CA 4CCDA 3SUUA 3WEZA 3WNNA 5GPRA 1WE5A 2HISA 3WMSA 1BPLB 2VZVA 2G3JA 4JHOA 1Q6GA 1CNVA 2CESA 4HA3A 1LWJA 2OSYA 4JL1A 4D6JA 4ZENA 1TCMA 1S46A 5D9PA 4AWEA 2DSZA 5A94A 3FHQA 3MSDA 3QOKA 4M8UA 4HPHA 2PBOA 5IXEA 1W3KA 2CKSA 2DQXA 4W8BA 4IISA 5A8PA 4Z2JA 2VQUA 1VFMA 1XSIA 2G3MA 3MUIA 3VD9A 1XD1A 3SCPA 1ODZA 2VO5A 3WD1A 3CPUA 4PMYA 5ABFA 2VCAA 2JIWA 3AS0A 1UR1A 3WQ5A 4D6HA 1NP2A 3RM4A 1E6XM 2BY2A 1UKOA 5HNNA 3VD5A 3CO4A 1OIFA 4W88A 4QP0A 5GNZA 3AS1A 3D5HA 5DF0A 1WP6A 3WNKA 1BSIA 4N42A 3B9EA 2YL5A 4Z2GA 1GCYA 2YBUA 4QLKA 1MQRA 3BGAA 1B3ZA 3VO0A 1Q6DA 2D2OA 3CUGA 2FDMA 1J9YA 3AYSA 1TA3B 3GNRA 4CN1A 5I23A 2G41A 2J8GA 2VTFA 2X09A 3SUWA 1LLOA 2D3NA 4PN2A 4P7NA 4CVUA 1WCGA 2YL6A 2EPOA 3OG2A 1XHGA 3BAWA 3L4UA 2O9RA 3AMLA 2ZUWA 2OYLA 3HMCA 3SCOA 4WKHA 1KXTA 3THDA 2J7GA 4W7UA 1JYVA 1E1EA 3MU7A 1CGWA 2NT1A 3AS2A 2BHZA 3AFBA 3WDJA 2GUYA 3K46A 3KWXA 4OIFA 3WENA 4UQAA 3AICA 5IFPA 4UZSA 1G0CA 5BXPA 2O92A 3J7HA 3ALFA 5ABFB 1GONA 1C8XA 1CECA 4OZOA 3ARSA 1AQMA 5BWFA 4TTGA 1NWRA 1B1YA 1ZB5A 3VMPA 2Q8XA 3WDRA 3ZJKA 2OYMA 4GI8A 3L4WA 3MV11 2WW5A 1E0VA 3EBVA 2O9PA 2GJXB 3EYPA 1CIUA 1W3LA 3GXFA 4GZJA 3A4AA 3K1DA 5CG0A 3W4RA 3WUFA 4JFWA 1ZBWA 2VUYA 1VBUA 2GJXA 4H04A 5A8MA 1JI1A 1GQIA 1JZ7A 4CN4A 6CGTA 1TUXA 1B0IA 4AZCA 1JD9A 2CXGA 3N9KA 1JAEA 3QOMA 1J18A 1UQZA 3VGDA 1CZ1A 2OSWA 3WD0A 4UFLA 1C3FA 2WMKA 5D9MA 4EE9A 1G5AA 3BXWA 3CUFA 1E4MM 2DT0A 2YLAA 1NM9A 4URIA 4BQ5A 4LX4A 2JALA 2VX5A 1H11A 1B2YA 3EDJA 2D24A 1BLIA 1CGXA 2WCAA 1QI4A 4PMXA 3WH6A 4J3WA 5C70A 1WZLA 1B31A 3B9DA 3AIEA 3TTSA 5A6BD 1KWGA 3WFLA 4M56A 3ZOAA 4PBGA 3MS8A 1VEPA 2PB1A 3BAXA 4B15A 1EO7A 4AYSA 3WMCA 4HOXA 5ABGA 3K4DA 4WIWA 3AMKA 5CGMA 4P7QA 5AY7A 3T0BA 1JZ2A 2WKLA 3SURA 1EQCA 1I75A 1BYAA 1M03A 1UWRA 5E0CA 3FAXA 2FGZA 1ISXA 2D0FA 3L4XA 1UKPA 1V0LA 4PMNA 4NRRA 5BYWA 1BTCA 3OLDA 4CU7A 2YL8A 5EB8A 3W6MA 1PEZA 2VRJA 4S3KA 1V3HA 3AIBA 5GNYA 3W82A 2J74A 2NSXA 4C7FA 3PZTA 2WBKA 4UFIA 4BCEA 3SCNA 3F5KA 3MUY1 2VC9A 3GH7A 1QHPA 2J47A 4M24A 3SCTA 2XG9A 3WNPA 2J7BA 2BVTA 1UOKA 1KXQA 1LJYA 2EEXA 3GXMA 3OLEA 4AZ6A 3N17A 4PUDA 2YDSA 1BF2A 2V3DA 4M80A 2J7CA 1J0ZA 4AEFA 1DWFM 1O7AA 1JYNA 2VQTA 2BVYA 3RO8A 3POHA 1YHTA 2CETA 2YA1A 4ZXOA 1H09A 4OJYA 2QHAA 3AJ7A 5I77A 2JFEX 1OT1A 4J3SA 1JFXA 3ARVA 4E8DA 1WZMA 4XV0A 1J0IA 1GOKA 2VNCA 3UESA 2DT1A 2E8ZA 5A6LA 4QLJA 4DWSC 3WQ4A 2J7EA 2ZXQA 3PN8A 1R87A 3KZSA 1UA7A 2YIHA 1PX4A 2ZXBA 4XUYA 3WELA 1OSEA 1BFNA 1UQYA 2CHOA 3GNOA 4NZCA 1OCQA 3CZKA 2E8YA 3PZIA 1O6IA 3AXHA 1UWUA 2EO7A 2VVSA 1V3JA 3AXXA 3AQUA 4UFHA 1HXJA 1RP9A 1GQJA 4PMDA 2DSVA 1XH2A 1R8LA 1G94A 5A6MA 5F7UA 5I2UA 4MADA 5A6BA 1GOMA 3POCA 3AIUA 4FLOA 3OZPA 5CGTA 3F5JA 2WZHA 2HVMA 1XC6A 3WUBA 3VINA 3AZRA 3WEOA 4CU8A 4ACZA 1EH9A 4PTXA 3SCVA 1M04A 1DWAM 1JI2A 1UD3A 2WMGA 3CUJA 3WN6A 3ZT5A 1FP8A 1PX8A 2ZWYA 2BNJA 3IJ8A 1QNRA 1US3A 2J7FA 5E0FA 3VMNA 3WD3A 3IAQA 1KXVA 2VX4A 3SCRA 1XH0A 3BLKA 4EK7A 2GVYA 1X6NA 3GXDA 4FMVA 1CBGA 1B3VA 2VI0A 3RJYA 5I78A 1DTUA 2DT3A 5ABEA 2J4GA 1JD7A 5CLTA 2IUZA 1V0MA 1H0GA 4V27A 4QAWA 5CXPA 1QI5A 1TZ7A 2D3LA 4PMUA 1HJQA 1FFRA 1V6UA 3ARXA 1NP0A 1JXJA 3IJ9A 2EJ1A 4P7LA 4X0VA 3W6LA 1CXEA 3WQWA 3KL0A 3B9AA 1KCLA 3D3AA 3T08A 1B3WA 3W27A 5A8QA 4XZBA 5M5DA 3RM8A 1HKKA 3UETA 4UOQA 4NSBA 2QPUA 2Y24A 1LF1A 4E2OA 1U30A 1ISYA 1HX0A 3BAKA 1ECEA 4U33A 4H8VA 1XD0A 3WIJA 1LQ0A 4X9YA 3L4YA 3WNLA 3EMQA 3SUTA 1MQPA 3OGSA 1Q6EA 3BAIA 4KRTA 2CNCA 2PI6A 1JZ6A 2J7HA 5FL0A 4AD1A 4Z2HA 3AIVA 3UG5A 2VMFA 3U7BA 1NH6A 4JFVA 3FXYA 3OGRA 2WBGA 2PC8A 1UH4A 5M17A 1CXIA 4P8UA 4P8XA 4A3HA 3ARYA 1FH7A 1XRVA 5CSYA 4DWSA 4YHEA 4QCFA 3TTQA 1WDSA 4OUEA 4LYQA 1J12A 1DEDA 2ZX5A 1BG9A 2E0PA 3DYMA 3HN3A 3WDPP 4B16A 3UG3A 5AYIA 2WZIA 4PSRA 5CJ5A 3W37A 2EPKX 1WO2A 4HMDA 1JNEA 1HL8A
chains in the Genus database with same CATH superfamily
1EBGA 1Z89A 1TV4A 2IQ0A 4HIBA 2UY5A 2V2DA 5LIUX 1OK6A 1BD0A 3I65A 4BF9A 2BMBA 3WLPA 4PUJA 4JTGA 1PAMA 1VB9A 1YNPA 2W9MA 3PS7A 4O8RA 4HPNA 2P5NA 2XM2A 1DQUA 4Z2LA 2WK2A 4EAMA 2UZ9A 2A6NA 3LOTA 2QXWA 1XG4A 1M01A 1SZEA 3CAWA 1ITXA 1W1ZA 1QATA 4MGGA 2ZDSA 1Z9AA 3PNZA 4EKJA 4BY3A 4G7EA 1T40A 4BF7A 5IBXA 1NEYA 1QDSA 4QJ5B 4Q8NA 2A4AA 3DGBA 4U31A 2GVGA 5GQBA 5AC4A 1RR2A 3KW3A 2INZA 4LNYA 3LPOA 5BZAA 3DECA 1EDQA 4D72A 1JEZA 3PZQA 3CTLA 3M5VA 1MEWA 4F4RA 4FP1A 3S2MA 2PWEA 4I7VA 4RDZA 4DJED 1FWDC 3IK2A 1SO3A 4DM2A 2YDRA 1XYCA 2PTWA 3L21A 1UC5A 2ANUA 3AZSA 1V02E 4F66A 4KT2A 3I7RA 3EWDA 3DX5A 1UJPA 1PCKA 2I1OA 2YBTA 1CDGA 2PAJA 2X7VA 3FCPA 4GLEA 1R38A 3VZYA 2ON3A 4ZO7A 3TP4A 2FMNA 5B7ZA 1W1A1 1KXHA 3KBJA 3NEHA 3O06A 4MVAA 1UCWA 3NL5A 1UD2A 4RDWA 5CC7A 1W9UA 3HGOA 3ENLA 3ZT7A 1TV2A 2CBUA 2FYMA 2TSYA 2PWDA 4IGMA 3ITXA 4LF2A 4LVGA 1VEOA 1LL7A 2DEPA 3CEPA 3VIHA 5HQEA 5LA2A 1A47A 3M46A 1EPVA 3DHFA 5A1AA 2A3AA 3VXGA 5HMSA 1UG6A 3NYDA 3E74A 3LV5A 4MLJA 2XIQA 4H8UA 3B05A 3DFPA 3W83A 1F6PA 4HKPA 5C9WA 3O2LA 1V93A 3TMLA 3N34A 4FX7A 1WX0A 1E1CA 1MEHA 1K9TA 3UGVA 3ARRA 4QDWA 4D71A 4WSHA 4Y8FA 1ZBVA 3VOCA 3NUKA 3TQPA 4JNMA 4O0ZA 1QR7A 1L6GA 3WBEA 4PTMA 4Q6XA 3B8UA 1E15A 3E12A 4W8AA 1RV8A 2FZ9A 3UA4A 1UD8A 4BHYA 4KWSA 5C5YA 1BGGA 1XCFA 2XIBA 3L67A 1CTNA 3ITOA 1YX1A 5ECUA 2YYTA 5KMYA 3VDBA 3G2GA 1XYFA 1Q8JA 2G8ZA 4QX4A 4DI8A 4QBXA 9CGTA 4XZMX 1U2YA 3CXOA 1MYRA 2X0HA 3GDLA 1NWUA 2DSWA 3L23A 3W72A 2VR4A 1NDVA 3WK2A 4PMRA 3T81A 4YVVA 1U1UA 5LIKX 8XIAA 5I5RA 5C2CA 2ATSA 3G1VA 2XSXA 2XN0A 2YOCA 5DMLA 1UMYA 4JEQA 4S3JA 4IPJA 2CWXA 4TVUA 4O8AA 1VJIA 2WJDA 2JBMA 1O1ZA 2QS8A 5BXTA 5FJOA 3CH9A 5K9CA 3W7KA 1IEXA 1R86A 4PUMA 1W1PA 5CPOA 3PHAA 5TF0A 1GZGA 1V51A 3EKLA 4PE8A 6PTDA 3QV8A 1S38A 2NUXA 3CUXA 3KCLA 2SFPA 3APYA 1HG3A 3CUHA 4J7RA 3W1MA 2JGYA 1C90A 1LLWA 3OLIA 4GUGA 1VBRA 3IAPA 4OWGA 2DY3A 4W85A 4D6CA 3HBLA 1YDNA 2OG9A 2XPKA 4U3CA 4ZOBA 3S3GA 3T07A 1LWHA 1UZ1A 3VFCA 3AAMA 2VFIA 4IG2B 3G1RA 3L68A 3BMWA 2HJPA 2C16A 4XZ9A 2EJAA 4LUSA 5REQA 4S3GA 5FEZA 4ZFMA 4M6PA 1EX5A 3TC6A 2CFFA 4B5TA 2FTYA 2QUUA 4FZIA 2G50A 1ZTVA 2PODA 2VEMA 2E6DA 3NZRA 4AVFA 4KCWA 3VIJA 3BMXA 2C0HA 5DT5A 1R3QA 3A5VA 4C6FA 3F5LA 3TSDA 3WQFA 2QYGA 3NR0A 1XLHA 1NAL1 2GJLA 3WLOA 2GDUA 4FNSA 1K9FA 3KM8A 3KOYA 4WD0A 1CW2A 2NV9A 2EAWA 1DXEA 5A6TC 2VXNA 3U5YA 2CEQA 2OGJA 2XTKA 1EQPA 4S3EA 5T91A 1BXBA 1GYNA 4O1BA 4WDTA 1MUMA 2X16A 5E6ZA 3CYJA 4MSSA 2W91A 3VIIA 2ZZ5A 3LCFA 4G5DA 5FD0A 1E0UA 3NO5A 1MFVA 1XYBA 2J66A 2WLZA 3PUGA 3QXBA 2JK2A 5E09A 1W5PA 3S5ZA 1I0BA 4IQEA 1F6YA 5I7GA 2D23A 2X7WA 2OGYA 1TMQA 5D05A 3RPMA 1W6TA 3PTDA 1JGMA 2QCGA 4Q4PA 3G1FA 4FAMA 5EBAA 1BYBA 1VIWA 2UWFA 4N4QA 4K37A 4Y9NA 4HZ7A 4YYFA 5EY5A 4DLMA 1B30A 3N12A 1UWIA 3AMDA 1JDAA 1DIKA 5I00A 1VH7A 2QF8A 2P0IA 4AISA 1EO5A 2LLEA 3EDEA 2BFGA 1GVEA 3BCFA 3FKRA 3RAOA 2PDFA 4MF4A 4ZVJA 3UWUA 1V3LA 4ERAA 1BVNP 2BSLA 4H8HA 2NQLA 4HOWA 1SYTA 1FHDA 4G9PA 1WAUA 2PTYA 1J5SA 3PVFA 2DSUA 3THCA 4J3XA 5BOOA 4IUGA 3VAVA 2ZX7A 1TIWA 3WNOA 4O17A 2EF9A 4CQ9A 1K7FA 4ZQOA 3E5BA 2PBGA 2J13A 2OX1A 3IIPA 2P8BA 4Z0SA 3MO4A 1W17A 3EPOA 3TAOA 4IL2A 1W3IA 3I10A 3UR2A 1TIMA 2F7FA 2YZ5A 1XRSA 3W76A 3W1NA 5I3KA 4ZR8A 4M29A 3GDKA 2AQWA 1V7YA 3UPBA 3ZYZA 4UUIA 1DE5A 4LUTB 1WZKA 3RYSA 3VOHA 2IPGA 2OB3A 3DN5A 4B4HA 2BHUA 1JULA 2WWCA 3ALGA 4AEOA 1HKMA 2I5IA 3IVTA 1ZZMA 3P74A 4HCLA 4X60A 3R0UA 3VOFA 2WANA 7REQB 2ZRZA 4PR4A 3BANA 1MO0A 1GW1A 3P2VA 1PKLA 4HOZA 1O1HA 2GL5A 4IIBA 4HA0A 5FI8A 4D8LA 2QF7A 1LP6A 1TZ9A 1SZGA 2HEJA 3W23A 5EMYA 4AD2A 2QJJA 5CGQA 1ADSA 1Q2SA 1V4YA 3F03K 1KM4A 3OQEA 4GXWA 1C9DA 3A3HA 3IK4A 4S23A 3VUPA 4RZ4A 1QOXA 2NXGA 3PBUA 1XC4A 2JF6A 1W8SA 4Q7IA 2F61A 5LYRA 2X05A 1VHNA 3RCNA 4HQVA 1HZYA 5KZEA 3MP5A 1EJSC 2FZNA 3EX2A 4QJ3B 2BY0A 4S3CA 4OVXA 3W1XA 3H26A 3VIFA 1TKKA 1GPFA 4G1NA 2V5CA 1F7BA 2F2HA 4C6OA 4JEJA 3CPRA 2NQ9A 5HQLA 3N11A 1AZ2A 1ICSA 3VC5A 8TIMA 2VOMA 3APGA 1HT6A 4GK8A 3VDGA 3UG8A 1LLZA 2WV8A 4O19A 3FHAA 1I0DA 2ZOXA 1HL9A 2BG5A 4FNUA 1HNYA 4WY0B 5M03A 1SM9A 4RX0A 1D2KA 1PKYA 2ACUA 2FFIA 3GG1A 1IXOA 3E2RA 3VM5A 4YCPA 1EDGA 4L1XA 1U1JA 1IEQA 4GRSA 2V63A 5DT7A 1VIZA 2XFFA 1AQ0A 1NJJA 2QCNA 3QSTA 1U5JA 3E2QA 2R8WA 5DANA 1KBLA 1G67A 4GQRA 2C91A 4UQDA 1O5KA 4CCEA 1NARA 1AUSL 2YL9A 2CLKA 1XG3A 1YLVA 3THAA 3GQYA 3N2OA 3OYZA 5EKYA 1XPYA 2P0OA 2BOFX 4PTVA 5LA1A 4LT9A 4DY1A 2PDUA 1Y0EA 3F4VA 3BOLA 4H6QA 1TCDA 5HAOA 3W2JA 4PCTA 3DHDA 1K02A 4UFMA 2VD8A 2VCCA 4NI8A 2XUCA 3PJUA 4M6QA 3U57A 5IHSA 4UIOA 2RHGA 2XGBA 4FNPA 4FNRA 5A69A 3CAKA 2CZFA 1NELA 3R10A 3GHTA 3MUZ1 1IHIA 4L4LA 1PYMA 3MY9A 1BSLA 5CQ1A 2XVNA 2OZTA 1S5NA 3LX9A 2X1SA 1W3JA 1WDWA 2ZZ3A 1XIEA 4GI6A 3TE9A 2OZ8A 5BROA 3NSXA 3JS3A 3RJXA 5SWUA 1Q7QA 1O60A 2HQAA 3G1DA 4PUEA 7ODCA 5BW6A 5CC6A 2CLOA 4IPLA 4ZXLA 2IKJA 2WVUA 3V1HA 4L4PA 3G5EA 3WD2A 2YCIX 4JIPA 4MZ8A 1QUMA 3DI0A 3LHWA 3ZJ6A 1GORA 1JDFA 3PTKA 2HPMA 4OTKA 3ZFHA 3QMRA 3B8DA 1GK8A 3OLGA 1C8YA 2ZUTA 3LMYA 4OHQA 1W32A 4O52A 4W87A 1GWJA 4W4QA 1YE6A 4ZQPA 3WZ0E 2DJLA 4BWLC 3WSUA 3HURA 2BHYA 4IP7A 1VQTA 1A0DA 3ARUA 4TTUA 4B9ZA 1SGJA 4ATDA 3G0SA 3BK0A 1QHZA 1OFDA 3VU2A 3PBVA 1P0KA 4QHRA 4L5ZA 1M41A 3PNUA 3LLXA 1FHUA 5J5DA 3W7DA 2IPJA 5T26A 1QOPA 1RCQA 3IANA 2V3FA 1FHLA 2PTZA 4D6GA 5LIWX 1XYLA 2R1MA 4JZ5A 5EMLA 3W2UA 2JIEA 1IT7A 2E5BA 4I5UA 3W28A 1DHPA 3TYDA 4FF5A 2CLPA 4QS5A 2R24A 1LQ2A 2Z1KA 1C8QA 1LROA 3CWHA 5IRPA 4LPCA 4NZFA 1NOFA 1OF8A 2VRKA 1XV8A 1V0KA 3QZAA 4XD6A 2XIMA 1GTHA 4K38A 1PKNA 3EDFA 3ZZ1A 4ZQMA 1ZALA 1SR0A 2QCLA 4C6CA 3GD6A 1MRAA 2WZEA 2FHCA 1PZ1A 1V6XA 4LUIA 1V5XA 3UWEA 1EXPA 1DVJA 3WD4A 3H7UA 1YEYA 1OK4A 2VR2A 3NFUA 3P93A 2ZBTA 3CHCA 2W5FA 4XZIA 4QG8A 3M07A 2FHBA 1LT7A 4IOTA 5KTLA 4PULA 1PE1A 8XIMA 3EXRA 4GC3A 3A3WA 3LQGA 6REQA 5JBDA 4A8IA 3T09A 1BAGA 4LUTA 3DHUA 4YHGA 3CIXA 4H4IA 3W7CA 1ZJAA 1U5HA 1XP3A 3O0KA 3UR8A 4UQCA 2BY1A 4M0XA 1XIIA 3CAVA 3CGTA 2W0UA 3BCDA 6XIMA 3GHRA 4IUOA 1ME7A 1B90A 1WKDA 2JEPA 1KA9F 3KS5A 3RF9A 4ZEPA 2EPLX 3CHEA 2AGTA 4DUXA 2PWHA 1JR1A 3EB3A 2OLHA 3BVJA 4PTDA 2BTMA 4HP5A 1OGGA 4ZTXA 2TMDA 1EX1A 3PZNA 3TTEA 3SI9A 5CBJA 4B2DA 3WQDA 4MPKA 7TAAA 3FS2A 3GNPA 3EOUA 4L6OA 4J2PA 4AXNA 5D9NA 3KVJA 3CAQA 1Q85A 3N15A 3MP3A 4REQA 4MWAD 3KOXA 2XFYA 1OF6A 3H2FA 1LYXA 3HOJA 3BAJA 4LEFA 4QE1A 1FQ0A 4CD4A 1VD6A 3OP2A 4DHGA 4HN4A 4YIWA 2WMFA 3W7LA 3EWXA 4L1GA 1Q6RA 4GABA 3CIWA 1UD5A 4HGXA 2G37A 3VCNA 3BICA 1DV7A 2QR6A 4YPJA 4LCSA 1NF7A 1H7NA 3PJXA 4AD4A 3OB8A 1LBMA 1UD6A 5AYBA 3RDKA 3S9ZA 4GJIA 3MSRA 3H2NA 4DUWA 5HMFA 3OVRA 3OBKA 4C7DA 4YN5A 2C1IA 3DFQA 5AN7A 3SR7A 4DO7A 4MWAB 4KEZA 2W67A 2DP3A 1ME9A 1KM1A 4FEZA 3R89A 2DH2A 4JTJA 2WKGA 2DPEA 3WBAA 3DBNA 1DIOA 3LCXA 5BWAA 3GVRA 4KGLA 1TG7A 4XVEA 5DCBA 1XUUA 3AZTA 1CXHA 3H4WA 2V82A 3WBXA 4HNCA 4HJFA 1XYZA 3QTPA 5I0DA 1DBTA 4KBXA 3NQVA 2FVKA 1HVQA 1A5NC 3F7JA 1RSCA 4AZIA 1E6ZA 4B5XA 3BLFA 1VFUA 3W7HA 1PIFA 3VNKA 1OGSA 1L6SA 5HATA 4ZB0A 3S5NA 4GI9A 1WZAA 5KINA 3PZVA 4D6EA 2X41A 2Z00A 4XBJA 1ZCOA 1OX4B 3BZGA 4U5KA 5AB3A 5LNVA 1MFUA 3E3HA 1A5KC 1LWIA 4XAGA 5I79A 1E70M 2FGBA 5IFTA 1A4MA 1J11A 5D03A 4J40A 1HGYA 4IIDA 4MNKA 4JY8A 2QZRA 2DORA 3A6OA 4J4KA 1VPXA 3RRXA 1XI3A 4W8LA 3U0HA 4E3VA 1LQAA 3TZNA 5E6YA 3L9CA 3SDOA 4ADTA 2YKKA 3D47A 3PFMA 3QC0A 3VILA 3MZ2A 1F05A 4DJDA 4RW5A 1DORA 4XD4A 1WXZA 3R12A 3SJ3A 3SRDA 2OCZA 3N9RA 4H3DA 9XIMA 3QV6A 3A9BA 1FOBA 2QMJA 4XB3A 2WXDM 4BZYA 1SJBA 4C6BA 1X6LA 2VC6A 5BMXA 4C5YA 3B8VA 4NT0A 4EANA 4JBRA 3NQAA 3QY6A 4MDOA 4OOUA 2E3ZA 4LB4A 1ZP3A 4MJ2A 2IXUA 4QNEA 1MW3A 2NZLA 1AVAA 1CXFA 1BRLB 3C52A 3K30A 4M51A 1DJYA 3TIMA 3S83A 3NIYA 4UQBA 2PP1A 1Q45A 4WGHA 2WHJA 3WLHA 1KR1A 3M9YA 1EJVC 3QQ0A 3SUUA 3WEZA 1ZQ5A 1WE5A 4IIGA 3WMSA 1TPC1 1BPLB 3GFYA 4JHOA 4O4WA 1Q6GA 1M68A 4GJ1A 1CNVA 1W5MA 2H3DA 1S46A 5D9PA 3ITVA 3T8LA 3W7OA 4L6DA 2JGQA 1XJBA 4MM1A 4EAYA 4W8BA 4IISA 3N73A 2G3MA 4BK9A 3MUIA 2FJUB 2PP3A 1ODZA 2VO5A 3WD1A 3ABOA 3CPUA 1TSIA 3GG8A 3P81A 3QQWA 3LTYA 1NP2A 2BY2A 1UKOA 1OIFA 4X2RA 1OFRA 5GNZA 1A3XA 4PB3A 3AS1A 1I60A 2DVXA 1YTKA 1H7XA 1GCYA 4FHAA 1VCGA 3KBWA 1X7IA 4K7YA 4E0CA 1Q6DA 2F6KA 2D2OA 3CUGA 2FDMA 2NLYA 1J9YA 1LOQA 3AYSA 3ONBA 1V7AA 1XM3A 2Z2UA 2G41A 2DUZA 4MIMA 3OG2A 1XHGA 2F9RA 3S9IA 4L9XA 3L4UA 3N29A 3WJWA 1PXGA 3SCOA 3NPVA 3G77A 1XF0A 5CBIA 5HULA 5AHFA 3SO7A 3V3WA 4DVOA 2I7GA 3H2AA 3G0UA 4QM1A 1E1EA 3Q94A 3ERPA 3V4BA 1TVLA 4GVIA 3VNJA 1HO4A 1G0CA 4B90A 4QG9A 3IVSA 3OVPA 3J7HA 4BJHA 2BXVA 3ALFA 4IL0A 1SJDA 4OZOA 3ARSA 4TTGA 1R5YA 1NWRA 1B1YA 3VMPA 3WDRA 2WW5A 3GU9A 2GJXB 4I3GA 1CIUA 3MKCA 1XLDA 2R14A 4GUHA 4GZJA 4H04A 4GH1A 4O53A 1DQWA 4EPDC 5A8MA 2O0TA 3WFAA 1TPDA 2Y0FA 4S3FA 6CGTA 5F2MA 2HNHA 1JAEA 3QOMA 1UQZA 3TYCA 5HWNA 3C8NA 2D69A 3VGDA 4DZIA 4KWWA 1W56A 2PDYA 3TJIA 1R30A 3E0LA 2WMKA 2MNRA 1POKA 1E4MM 3A64A 2YLAA 3W7NA 1BRLA 1KV5A 4BQ5A 4XBKA 5L6UA 2J6VA 4Y8EA 2R1KA 4NJIA 3U2OA 1TV3A 1XBVA 4Q8VA 3N2CA 1WZLA 1B31A 3B9DA 1W1B1 1TPWA 1JCTA 4NJHA 1XLEA 3KWSA 1GPWA 1K7XA 3ONCA 1J8VA 1TMHA 1FWWA 3IARA 4DYKA 1U83A 4G6CA 3AMKA 2C6QA 1JZ2A 3HFTA 4CNOA 2WQPA 4R34A 3VKCA 1EGMA 1A49A 4JICA 1M03A 1UWRA 3FAXA 4PFHA 3L4XA 1K6WA 2PU1A 4PMNA 2OEKA 4NRRA 1BTCA 2ZKMX 3G3MA 3OLDA 3DG7A 2REQB 2PGEA 4S3KA 3W7EA 5C7HA 3AIBA 2BOGX 5T9BG 4UFIA 2CLEA 1P0DA 1AG1O 4AMAA 1D7KA 1P0EA 5FACA 1IWAA 1WBJA 2R91A 4M24A 2INFA 3DIPA 2GLKA 3PG9A 2J7BA 2ZRYA 1UOKA 3VKDA 3S47A 2BX7A 2QEZA 3TC3A 4IJBA 4HK6A 4PUDA 3S0CA 1BF2A 4M80A 5CZTA 1J0ZA 3OG3A 1Q66A 3NG3A 1TV5A 1O7AA 2VDHA 1JYNA 4RV3A 3RO8A 3POHA 1YHTA 3A12A 3BUVA 3LCGA 1AK5A 2QHAA 3NQBA 4XKYA 3T40A 1OT1A 3O16A 1YDVA 5F2IA 1JFXA 2Y7DA 1AODA 3ARVA 4XV0A 4JN6A 2VNCA 3UESA 1F3WA 4JTFA 1O94A 3W88A 2W79A 3AYVA 1R87A 2YFNA 2F38A 1UA7A 2YIHA 2ZXBA 2P88A 4QROA 4B5WA 2VC5A 2CHOA 2P3EA 3M16A 1WA3A 2WSRA 3CASA 2IS7A 4H19A 3CZKA 2DZPA 3P3BA 3AQUA 1P4CA 3UXKA 1CB2A 5FSDC 1GKPA 1RY8A 5I2UA 3G22A 2HBVA 5RUBA 3E9AA 1S5WA 5CGTA 2NLIA 2HVMA 1XC6A 3DZ1A 4ORMA 4Q8WA 1TTQA 1EYEA 4YWSA 5A5WA 4UBPC 5T8GA 4ACZA 5XINA 3KS6A 4IXHA 4X3ZA 1UD3A 4B92A 3CUJA 1AW2A 2P3ZA 1G69A 3RX2A 2ZWYA 3UWQA 3IJ8A 4BI6A 7PTDA 1US3A 2DUXA 1KXVA 2VX4A 1N8FA 1T0OA 2GVYA 1XBYA 3GXDA 2NX1A 2VI0A 4WXYA 1DTUA 2GUUA 4RNFA 4DJEA 5H8PA 2QAFA 2IUZA 1DJHA 1V0MA 2KZHA 4LBSA 2I5GA 3GTXA 1QI5A 1TPFA 2D3LA 1FFRA 1V6UA 3NWRA 2EJ1A 5HQMA 4INFA 1RVKA 4EVZA 3WQWA 3KL0A 1AA1B 1RBOB 3D3AA 2VWTA 5A8QA 3N9SA 3R2GA 1GOXA 4YU1A 5M5DA 3RM8A 4WDUA 1XKJA 4E2OA 1ECEA 2ZTJA 4H8VA 4FXRA 2PLCA 3C0QA 3I68A 1KC7A 1W3NA 3QH2A 3LERA 3WNLA 4LY8A 4LC6A 4OFCA 3PSVA 4DO4A 5F2GA 3G3DA 2OQHA 4UXDA 1EWDA 4Z2HA 3R11A 3ZVHA 1CX9A 4F2TA 1W8GA 1NH6A 1EF2A 1XUZA 4KIRA 1UH4A 1J96A 1KFLA 4RUBA 3PP7A 4MKSA 3ARYA 4LCQA 4TV5A 1XYMA 4YHEA 2J88A 1WDSA 4FXJA 4OUEA 1Y5XA 4GIEA 2ZX5A 2E0PA 2V30A 3UG3A 4UMBA 5LGXA 2WZIA 2WKJA 3HM7A 2QJIA 2NVDA 3KRUA 4HJWA 3WQEA 2QCHA 1YMYA 1WO2A 3WK0A 3R0KA 1FVPA 4UTFA 3KZPA 4R7OA 2TODA 2QVHA 3VDAA 4PEEA 5J04A 5CZ0A 4DELA 3W1QA 1RK6A 1A5CA 2PZNA 1I1WA 1M3UA 4PCSA 4JFSA 4NF7A 3QC3A 4D2JA 3B0PA 2DVUA 3VCCA 1FDJA 1JRCA 1OB0A 3T78A 4F0KA 4KFNA 3FDKA 4QQ3A 4DJFC 2ZXDA 4F2UA 1EHAA 1XQLA 4Z0JA 2G0WA 3H2OA 3SRKA 1CGUA 5CCZA 2P50A 1JJKA 3CL6A 2DW7A 3ANYA 1GZJA 2YW3A 1SU5A 1YPIA 3LM7A 4BQ2A 1FWCC 1E9ZB 1GEQA 1LUCB 1NDYA 1KFBA 1UR9A 3OGVA 3CWOX 3MCMA 2GGIA 1U22A 3CO8A 4XBSA 2E4TA 1W2PA 2WNZA 3AUOA 2ADAA 1H2JA 3NZ1A 4IF2A 2RDWA 2R82A 2I16A 5DFAA 4UMCA 3HV8A 5KITA 1ZAHA 2XN1A 3GXIA 5EMKA 5CLWA 2V3EA 2HTMA 1V77A 1XW8A 4PYSA 4J3UA 2PRLA 2FJKA 3VD4A 1G4EA 4IGNA 4C6KA 2OFJA 3ZS4A 3ABRA 1FTXA 5FJUA 3NM1A 1IR2A 4ORIA 3W2LA 1DPMA 3T2PA 2WCSA 4UNIA 4JTAA 1H63A 4MY1A 1Q4NX 1Q6QA 3ZVIA 3FJNA 4F2BA 2WLYA 3FA4A 2C8NA 1UWTA 3MBFA 5JU6A 3M5XA 2E1DA 2P8CA 3LCHA 3ZXWA 1BWKA 1EB3A 4DO6A 4QR6A 4ML4A 3IUDA 3DC0A 3U7VA 4MY8A 4D6FA 1A5LC 3T1GA 3QW4B 5E1QA 2O9TA 1BXCA 4GO8A 3AROA 1R3RA 3DUGA 3NZPA 1OJXA 4XIAA 3OPSA 2WSYA 1L8NA 3ZO9A 4H83A 2VWSA 1N82A 1QOQA 4LWWA 4TVCA 1FP9A 1CXLA 2DGAA 2VEFA 2OZ0A 4JN8A 3QN3A 4HBKA 4XAZA 3LCWA 3PWIA 1GEHA 2A7PA 3AUJA 4OV9A 1EJ7L 5GJPA 2DZAA 3HA1A 2HPIA 4AY8A 3HO8A 3LLDA 3S1GA 4AZBA 5BCAA 2CKRA 3E02A 1R3YA 4YTUA 2F2KA 3PUEA 1F4AA 2WC7A 4NZJA 3GU1A 1PZ3A 2Q01A 4S2BA 2XFRA 3TYEA 3FV9A 1EUAA 1QNQA 2Z2AA 1H7OA 4GZIA 1NFGA 4GVGA 5AVHA 5G2HA 1VC4A 1JF5A 2NQZA 5BNKA 5HDRA 1IR1A 1JCXA 3WDIA 3T0AA 1GKQA 1VRDA 3IJ7A 4MNLA 2X0SA 5KSWA 3IGHX 4HCHA 3QVQA 2OWXA 6XIAA 4Q4OA 1NOUA 2XZ9A 4M82A 1A3WA 3SQMA 2GK1A 4DM1A 3K1GA 1V6VA 4GCXA 1OG0A 5FF0A 3TJXA 4PMQA 3QHNA 5LXEA 4LUYA 4N4PA 3R7MA 3FGCB 3FYYA 2E6YA 4H7CA 1KFJA 3WUGA 2WOQA 1K1DA 4L64A 4XG1A 3U2CA 4AIOA 4ACYA 2VELA 1EEPA 2Y61A 4PUWA 1ODUA 2HRWA 4WVXA 5D33A 3RITA 3S2JA 4LRTA 4WCJA 4OQVA 4AIUA 3F4WA 4AC7C 1JNDA 5C55A 4AQLA 3THQA 3IGSA 2YPIA 1J6PA 1K8YA 2A3HA 1BWVA 1O5XA 1QBAA 3QR1A 3CQJA 1KFKA 4U28A 4C90A 4JIRA 4XTDA 2HVNA 1TMLA 4B5NA 2GVLA 3MKKA 2A2IA 2I56A 3PZUA 2ESCA 4LRSA 2QAPA 2FIQA 2TRSA 3LRKA 1E6SM 5XIMA 3TQ0A 1K8CA 1S2TA 5C9UA 1SW7A 1S5TA 1EFZA 2C18A 2EQDA 1B9ZA 1KCZA 1OM0A 4LF1A 2J27A 2DZBA 4GMEA 3BOXA 4B4FA 4S39A 2VZUA 1M9HA 2Z6JA 3MI2A 3QLLA 1NWSA 4GYPA 1F8IA 3P62A 3LGGA 2C15A 2ZA2A 5CSUA 4WLCA 3NDOA 4MPQA 1NQ6A 1XCWA 2UY4A 4YTQA 4IICA 1Z8AA 2ZUNA 5IOBA 4UTLA 1IXNA 3FAWA 2PDMA 2PLJA 1OD0A 5FEWA 1E1CB 4HNVA 4YWIA 4TV6A 1C92A 1GVIA 1VF8A 3L2LA 4Q8UA 5FEPA 1IV8A 4IPPA 4H9VA 2ZWZA 3G1HA 4UOZA 1WB0A 3KX6A 3EAUA 3NL3A 3W74A 2JQXA 1B3YA 1KBBA 1R2TA 4LYRA 2NVCA 1EBHA 1KTNA 3ELFA 3BDKA 1S2WA 3SIZA 4RE2A 1XGZA 4RDYA 2WMJA 3S5SA 2IKHA 4FSAA 2E7FA 4AZ5A 4AY1A 4DIAA 1N2VA 4LVBA 3WQOA 3W9ZA 4FF7A 2BY3A 1TPVA 4KRUA 1A5SA 5C54A 5F4XA 2WHMA 1EEXA 1T8QA 2GPTA 2QLYA 3QQ1A 1UBSA 2OJPA 4YJ5A 4WJXA 3M1ZA 3TCEA 1S39A 4BA0A 4DN1A 1HP5A 2A5HA 1PBGA 4F0RA 5C2GA 2VHLA 3CL7A 3NZGA 3O9NA 1RZMA 2G3IA 1QMLA 1PZ2A 3IGXA 3CV6A 3IV3A 3A22A 1SZNA 1DWJM 1V3IA 4AD3A 3QPZA 1XSJA 4PMOA 1E40A 1K8XA 3DG6A 4GNVA 4Y9PA 4N6EA 4CEXC 4W5ZA 3K13A 4MWAE 3WQVA 4RPQA 3BG9A 4AZCB 4ADUA 3BG3A 5FA5A 2ACRA 1R2RA 4JHMA 5I09A 1W9DM 1X97A 3VNZA 3DEQA 1C93A 4YTSA 4UR9A 5PTDA 1UP3A 1W3HA 1XWYA 3GZAA 2XWDA 1L0PA 4Z1CA 1HL2A 1LZOA 3UNDA 4JX5A 3LPGA 3SM0A 4O54A 1UOZA 4WK9A 3LEPA 2UBPC 1KGXA 5LIXX 4NASA 1V79A 3P5ZA 1ZUAX 1DHKA 3EWCA 3EWUA 4KW2A 2ZIDA 4CD8A 3GW3A 1UC4A 3BE7A 4F9JA 3QFEA 1WKYA 4N9CA 1DXIA 1H62A 1PTAA 4PB4A 3HJZA 4MB3A 2GQAA 3EDDA 1OADA 5D4YA 3P5YA 3RLUA 4BFAA 3C4UA 3GTHA 1S2VA 4NAEB 1CLXA 4I6KA 3O6CA 3WL0A 3VVGA 1VS1A 4P2VA 3QKZA 2RKXA 1D3GA 4B5UA 1TE6A 1MDRA 4R88A 1RLDA 1ADDA 3W1TA 3B0XA 2ZZ7A 1KLYA 3RILA 3CEUA 4JTDA 3NQ2A 2WVVB 2BB0A 3L0GA 4JPGA 2XH0A 5CH9A 2VM8A 5KZ6A 2J8FA 2OSXA 1V8EA 2AQVA 2QW5A 2RDXA 1PS9A 4F0LA 2WJZA 3ARPA 3M0KA 3R6IA 4NAFB 3K4WA 3SFKA 3UJRA 1L2QA 3GSMA 4NZ4A 3ZLFA 1SPQA 2PF8A 3OEXA 3ZWTA 3PZOA 3MHGA 1L6YA 1A0EA 1QO5A 2AMGA 2E6FA 1MQQA 4H6KA 1OINA 5M3WA 3VGEA 1ZBCA 2VCBA 4AWTA 1P6CA 1HIZA 2OWCA 1XBZA 1AH0A 3VABA 2OWWA 4Y2WA 2WMIB 3RU6A 1ML1A 2BGQA 5CPQA 3NYZA 1O5RA 2CHNA 5BRQA 3VIGA 2BDQA 1DIDA 2PURA 1W2VA 3E49A 2ZVIA 3ABSA 5HMEA 5TBOA 5D38A 4GKLA 4O1DA 3UR7A 3WG6A 1IGSA 2X1IA 4PUKA 1IWPA 3SJNA 4WX2A 1SW3A 2GOUA 2GUBA 4TMBA 4JNZA 3URNA 1YBQA 4GNKB 2ACSA 4K8HA 2INEA 5AZ0A 3QFWA 1UIPA 4OOZA 3V35A 2VFDA 3BLPX 1G4SA 4HD5A 2EPNA 3B04A 3APTA 1JXKA 1G4TA 2DDXA 1Q6FA 4XZLX 2OTDA 1RHCA 3FA3A 1GYMA 1ZNNA 1J0HA 3UCCA 3EKZA 3CT2A 4NXSA 4Q4RA 4US6A 5JQ9A 2R94A 1W37A 1I2OA 4C6PA 4L56A 3LHYA 1HP4A 3AHYA 3OOQA 4XAYA 2XN2A 3KDNA 3LYEA 4P7RA 1JCMP 3RUBL 2E1WA 4UNKA 3LPFA 4Z2IA 4G2DA 3MUAA 4I9JA 4NJKA 2NXIA 3LBMA 1LL6A 2OEMA 2ZICA 1H1ZA 4B9YA 3HQPA 1JDDA 2DV0A 3T05A 1CYGA 4ZA0A 3B0YA 2A79A 1TJPA 4OBRA 5ABTA 3FJ4A 4LC8A 1EJUC 4R7WA 4K3ZA 3PPHA 5AKQA 4DXXA 1J10A 2CHRA 3LI0A 2OU4A 3V1PA 3TOPA 3T0DA 1VCFA 4AFYA 3TSMA 1RCOB 1X6UA 4S3BA 5A3HA 3SRHA 4FXSA 4PZVA 2VEPA 1DIEA 1GKRA 4DBUA 4R5EA 5HINA 2X2GA 3QZ6A 3AWOA 1EGVA 1XYAA 3LB0A 3U2ZA 4KERA 2XIIA 4NVTA 1XLAA 4N9DA 1JL8A 4GNJA 4J27A 5HPOA 4ZTYA 3ATYA 3HU7A 1PX3A 4JS3A 4F40A 3VNYA 2VGBA 3CIVA 1MSSA 3O15A 3P7YA 4J1OA 4MB5A 1ONXA 3P67A 2AQOA 4WHBA 3KE0A 1JYXA 4JTRA 5EPDA 4CKQA 1ZS2A 3F2DA 4OT7A 1GJWA 3GDBA 2PF0A 3CM4A 5A2AA 1MXDA 1UR4A 4UTUA 3K4AA 3H2CA 3QZEA 1GG1A 4UTMA 2PDWA 2B31A 3UERA 1IZKA 5CZSA 4CD6A 2AL2A 4LJ3A 2QIWA 4FOUA 1XDMA 1IGWA 1GUVA 4UCGA 4JTKA 1K70A 1VJZA 3TCSA 5CZKA 3RMJA 3H2EA 1TQJA 3UQNA 3AHXA 3TJLA 3BCJA 1SMAA 1EUNA 2DT2A 4RK8A 3GKFA 1Z42A 1YQ2A 3QV9A 3GDRA 2PMQA 4H6RA 4Y6GA 5CPLA 2HWGA 3ZIZA 3IJQA 1EJXC 2Y7EA 3S9YA 1XX1A 1JRBA 1BYCA 4C6NA 3P80A 7CGTA 1VZWA 3MYOA 4LOCA 3REQB 2DW6A 3MQTA 3H4GA 3LHTA 5EA9A 3H53A 2HK1A 3P14A 2CLHA 2IQTA 3QPYA 2YSWA 3WLLA 2PD9A 2XDFA 4GQQA 1E6RA 2VFFA 3P60A 2YB1A 4B91A 4PSPA 2QPXA 4IHCA 3ZQ9A 3S42A 3NPUA 3QHMA 1G9HA 1TTJA 1ITCA 4A3YA 3RIKA 4A3RA 1V03A 4V2XA 3LV6A 1XGEA 1DE6A 4JXCA 4WSJA 4OUIA 1SMDA 3BLDA 1ZY9A 3BGGA 2V8ZA 1DYSA 1I1XA 1GHSA 1S5MA 1TX0A 4Y9OA 3LS9A 2DH3A 1YW1A 2EHHA 2ODOA 2Z1VA 4XVDA 4US5A 1TPEA 3KVMA 2V5KA 3VKKA 3ZJ8A 3LXAA 3T9PA 5LHFA 1D8CA 1UYQA 3KOZA 2BZNA 2YCJA 3D3FA 5DQPA 1F74A 1CI1A 4MB4A 2VFEA 1QRQA 1I8JA 1RVGA 2J9YA 1OCNA 3F2CA 3BQ5A 7A3HA 1YPFA 3TEVA 1T99A 1LRQA 3C86A 1MI3A 1CENA 1AFSA 2MANA 4W93A 3AO0A 4HCDA 3H70A 1TFVA 2ABAA 3OJGA 2WPGA 2A3CA 4C7GA 1IIGA 1W54A 1XIJA 3AXMA 2EPHA 4UFKA 2CWNA 3NVTA 4AD0A 5CEWA 4GXPA 1TR1A 2VJXA 5C71A 2IKGA 1UR8A 4RXGA 4AAJA 2RAGA 3W22A 4HYRA 3YPIA 4KFOA 3C6CA 4AW7A 5D2YA 1IT0A 5I24A 2WYSA 5EYWA 4QDMA 3OIXA 3ABQA 4KCVA 3SIMA 4AG0A 2D0GA 2JEQA 3N2BA 3RLHA 3TTYA 3CMFA 5CPSA 3URBA 3GVVA 3N13A 2C19A 3BLOA 2PFHA 1DWHM 2OOGA 1E51A 2ZZ4A 4KWUA 3G6LA 3RXZA 1L9WA 2GWNA 3ZMRA 3K2GA 4JX4A 4QS6A 4TR9A 2G3NA 2NX9A 1SO4A 2Z1SA 1SQ7A 2ZX8A 5HWMA 3MVTA 3W81A 4UMAA 4W84A 3VA8A 1EF3A 2ZX9A 4C6LA 1V6WA 1VLWA 4ZO6A 4A2SA 3VGFA 1EGZA 3VIPA 1HO1A 2J75A 3B9OA 3IIVA 3I4KA 1PV8A 1UKTA 4GYFA 4WGXA 1XSKA 5LSMA 4BR1A 1K4GA 3GIPA 2B81A 4FNQA 2D22A 3TC7A 1XIDA 3AYTA 4YL2A 2Q02A 1M5WA 4X22A 1OCBA 1Y5WA 1EL3A 2A0NA 3KL5A 3I7SA 3TV8A 6A3HA 4GD0A 2VDIA 1UHVA 1E0XA 2XJ7A 3QGAC 4GFSA 1TE1A 2DIJA 1M7XA 5I6SA 4C1NB 1MUCA 4QFUA 3LG3A 3JZUA 2JKEA 2B7NA 1K9EA 3ZR5A 5JXQA 4ICNA 3FFSA 3NQGA 4PGLA 2YZRA 3RR4A 3CLMA 3VGGA 4P8WA 4ZOEA 4W7VA 1SZFA 2GJRA 1DTNA 3GR4A 1J0YA 3LCLA 4MJZA 2O7QA 2VT0A 2XVLA 1KQZA 3SECA 1EHNA 1P0BA 3M5ZA 4JIEA 1GJPA 1QU4A 3NSNA 3Q45A 4NX0A 3B9NA 5H8UA 1VENA 4L9YA 3B8SA 1R3WA 2HSAA 4O0KA 3CUZA 3N2TA 3WH7A 1OYCA 4PMZA 1K9DA 4Z1YA 3W70A 1TWSA 3AWNA 1H0IA 4REQB 4TX6A 4XIMA 3KBSA 4Z08A 3TLLA 4H41A 3PZMA 1VFSA 3R43A 1DJGA 4H2CA 5K4XA 4C6QA 2OQLA 4XAPA 3KHJA 4F0SA 3SSJA 3WLMA 3XINA 4DJEC 3WLIA 4U10A 4NL1A 1R46A 3Q65A 4I9TA 2CESA 1LWJA 2OSYA 4JL1A 4O16A 4W9TA 3BURA 5AYZA 3A13A 3FHQA 3MSDA 3QOKA 2PBOA 4IMGA 2CKSA 3SN1A 4V1YA 2V68A 2PS2A 4Z2JA 1VFMA 1XSIA 3VCRA 4JTEA 4G7EB 3DAQA 2E5DA 1US0A 1XLJA 3UW6A 3UJEA 3MUXA 4PMYA 3DFYA 2PWVA 2JIWA 3GXTA 3RPDA 3AS0A 1UR1A 4WJEA 4GXMA 4LS1A 2PDXA 5B80A 3GDMA 2G4JA 5D2TA 2ZE3A 5HNNA 3CO4A 4LU0A 4NAFA 4W88A 4QP0A 4IMAA 3WNKA 1BSIA 4N42A 2YL5A 4GC4A 4V1XA 1THFD 1FHVA 1F8MA 3MBDA 3BGAA 3VO0A 4HU3A 4I7UA 4Y90A 3BL3A 1S1RA 1H51A 4CN1A 4GACA 3TJ4A 2VTFA 1KM3A 1PWMA 1P1MA 3A23A 3N3TA 2D2JA 2BASA 4WJ8A 3BAWA 5BMWA 1Z44A 1B3OA 2Z2BA 1NFPA 1WKEA 5D37A 4NXKA 1TPUA 3T55A 2D2GA 2PDBA 2J7GA 1TPB1 2CZ5A 2CXEA 4PCFA 4W7UA 4QITA 4MKNA 1FRBA 1XRTA 1YE4A 3TNBA 1TYGA 3RLGA 1CGWA 1PSCA 1HKWA 2BHZA 2OKTA 3WDJA 1G7VA 3TNOA 2GUYA 3K46A 5CAHA 1MEIA 3GX9A 3KWXA 3AICA 1ZSXA 1B9BA 2P76A 4UZSA 5G1MA 5ABFB 5IM51 4XO7A 1GONA 1TELA 1AQMA 3TZFA 4A8LA 1W5OA 3UWYA 3ZJKA 3BV7A 2OYMA 4GI8A 2O7SA 3L4WA 3MV11 1P1XA 1XIMA 2ZZ2A 3STEA 2Y5JA 2ZRXA 3GXFA 5CG0A 4C91A 3WUFA 2GJXA 3IIXA 4LW7A 3H8AA 1JI1A 1GQIA 1JZ7A 1CT5A 4KIEA 2GWGA 3EPMA 5AHMA 1X7FA 4IMEA 3C3NA 4PBFA 1TUXA 4AZCA 1JQVA 2XH7A 3L12A 1J18A 1J5TA 3SGUA 2OOFA 2OSWA 2NXHA 4UFLA 1TWWA 1F61A 1C3FA 1P7TB 2PLKA 3FYOA 3CJPA 3BXWA 4YVPA 3R8HA 1ZJHA 1NM9A 5I3FA 2WNNA 3FA5A 4URIA 2G96A 2NSOA 3QR0A 3AALA 1B2YA 2Z25A 3EDJA 2D24A 6ENLA 1X38A 3V75A 3PPCA 3Q37A 4PMXA 3WH6A 1S2UA 5F4WA 5C70A 2GVEA 3V5FA 4JOMA 4US5D 3WMLA 3TTSA 4NYUA 3S4TA 1KWGA 4R53A 3ISIX 3ZOAA 1VEPA 2PB1A 4FALA 4RLIA 4GUJA 1JPIA 3WMCA 4HOXA 3K4DA 4HHLA 5JMUA 4CQCA 1PCWA 2O56A 4P7QA 3T0BA 3R79A 2WKLA 2PDCA 1U5VA 3FXGA 1ISXA 4XWUA 1A4LA 1ICPA 4O1CA 1R3TA 1VLIA 5BYWA 4XD3A 3SBFA 1DJQA 5EB8A 3W6MA 1PEZA 1C8VA 2NVAA 3EB4A 4C7FA 5GNYA 2J74A 5L9FA 3LA4A 2WBKA 3HV9A 2W27A 4BCEA 3SCNA 3H55A 3F5KA 3O7UA 3MUY1 4YVXA 2V81A 3GH7A 2NV1A 1QHPA 2BVTA 1QT1A 2V3DA 4ZB2A 4AEFA 4PBEA 2VQTA 2CETA 2YA1A 4OJYA 1M6JA 2E6AA 3AU6A 3AJ7A 4PL2A 1ZP4A 3KBNA 4E6MA 4D8ZA 2YCKX 4O11A 1ZAJA 3WQ4A 4CNTA 1P48A 1PX4A 2PWUA 4XUYA 1BFNA 3BOFA 1F3XA 1UQYA 1ZFJA 4Q4MA 1Q4WA 1F2JA 1RALA 5AHEA 1SUXA 2GOKA 4BEQA 3UA3A 3AXHA 1AJ2A 1UWUA 2EO7A 1V3JA 4UFHA 3STPA 1UUOA 1PDZA 2DSVA 1DJNA 1XH2A 5HJLA 2BODX 1XLBA 3NVDA 4O13A 3KLKA 1FWBC 2GQ3A 5M2FX 3W01A 1OX5A 1Y5VA 4FLOA 2QGYA 5HUPA 1DQXA 4O10A 3MC5A 3WUBA 1FWHC 3BJTA 3LRMA 3AZRA 3WEOA 4CU8A 2FFCA 2Q8ZA 2PCEA 4LSBA 4ZQCA 4O50A 4HYWA 2OKOA 1PX8A 3B0UX 3WD3A 1O68A 3BLKA 1X6NA 3H4XA 5XIAA 4DQWA 1CBGA 3QTGA 2ICSA 3RJYA 3TX9A 2I57A 2DT3A 3NEVA 1MRQA 3HZ3A 1O66A 4V27A 4UTTA 1OZQA 1TZ7A 1X8CA 3R25A 2HNEA 3T4CA 1HJQA 4P7LA 4X0VA 2CC0A 1XLLA 1W31A 3W6LA 3MO7A 1KCLA 1B3WA 1X1OA 4IGSA 3IUIA 3UETA 4UOQA 2QPUA 2RUSA 2Y24A 1LF1A 4NIRA 1ISYA 1HX0A 4JQAA 4U33A 3SAZA 3SW6A 4JQ4A 3WIJA 3UY7A 4X9YA 3MKVA 3SSZA 4IX0A 3L4YA 3GS6A 4QISA 1MQPA 5LNWA 4KRTA 1TO3A 2CNCA 1HUVA 2GJNA 1JZ6A 5FL0A 1YIXA 3LTSA 3TOYA 3AIVA 1QCWA 3FXYA 3OGRA 2WBGA 2Y5SA 2REQA 4HMNA 2Y7FA 3W6YA 1I2RA 3EGJA 4L65A 1DKWA 3MW7A 1J6OA 4DF1A 3UBPC 1J12A 2W3ZA 3DYMA 1A5BA 3WDPP 3VZZA 4BKNA 4B16A 4OV4A 2FZMA 1JCNA 2C3ZA 2R1LA 5CJ5A 3W37A 2EKCA 3GFXA 2XWEA 1MW2A 3VX1A 3QJAA 2WNWA 2BGSA 4HZMA 4WXZA 2PLMA 2V5JA 3WF0A 4GYPC 4NAEA 3T2OA 1XISA 2DU2A 1K8ZA 3CC1A 1H7RA 2Z1WA 3RLVA 2DZSA 9RUBA 2DIKA 1E71M 3EX4A 5AYXA 3RMEA 3F4NA 5HNRA 5G5IA 4DXKA 2GFTA 3MMUA 4JHZA 1RJQA 1P7TA 1YXDA 1CEOA 4FIQA 3EB2A 5K7JA 5D02A 5FJIA 3H7VA 2CIPA 4HHHA 4BQ3A 3GZ3A 3H2MA 2HDJA 3N18A 1XIHA 4DI9A 4PRRA 4YTTA 4WEVX 4N7QA 3UPWA 3R94A 4KS0A 2WC4A 1IYXA 2A3EA 3WLNA 1R85A 2VZSA 3WLJA 4HMEA 4QIUA 1JPHA 3DHPA 3G1AA 3AXIA 3U4AA 1OFAA 4O4VA 1KM2A 2WC3A 2YA2A 3EX6A 4JTLA 3UGRA 3NAVA 3GDTA 1GNXA 2QUVA 5AECA 1UA3A 2VRQA 1RA5A 3CL8A 1A50A 1EIXA 3VKJA 3W53A 4H7VA 4H2HA 3M4HA 4A6GA 4M3PA 1A5MC 4GHRA 1QNOA 1S2AA 4MUPA 3G0XA 3A3XA 1YDOA 5EL1A 3HG5A 2E25A 1KTBA 3VDHA 4XO6A 3EX1A 4ROPA 2OZ3A 1AMYA 3QHOA 3STFA 8CGTA 2CW6A 4MAVA 2JKPA 4AD5A 4HYVA 3IJDA 4JTSA 5C9XA 4GY0A 2Z7KA 5CC5A 1E43A 1VBHA 2V9DA 3NJ3A 4V15A 2GK1B 1NWTA 1F3EA 1U33A 5IDIA 3L0KA 3S2LA 2VKZG 4A2RA 3WF2A 3SCQA 1A3HA 4DLFA 4HK7A 5ABHA 4KCTA 3S1VA 1IEWA 4AUBA 1JZ8A 1POJA 3A4JA 3M0ZA 1HF6A 2QCDA 3RCYA 4O0QA 4LS2A 1VHCA 3JZEA 1OD8A 4AH7A 4PCPA 1TWIA 1MW1A 1H50A 1OX4A 3IWPA 2J79A 4AHQA 4NQ1A 2WSPA 2QDDA 4O14A 2WM0A 1PVNA 1YBQB 2G97A 1EOMA 1SJCA 2J62A 3RCMA 3EA2A 2EBNA 2UY3A 1Q3NA 1RD5A 4PRTA 3NQDA 5U7SA 3DFOA 2YDQA 4DBSA 2P53A 3AI0A 4HMCA 2W92A 5DX7A 4GFIA 2VC7A 4DZHA 4DZ5A 1T7LA 2X8RA 1XICA 4LXFA 1E73M 2CZDA 1VR6A 5I02A 1J0KA 3MSGA 1IE7C 3PZ9A 4OKDA 1EJWC 1PIGA 4E5TA 4QQUA 3IJ6A 1WPCA 4KF1A 5F1VA 3SY8A 1RJRA 1QNVA 4DB7A 4EXQA 4I9MA 1FA2A 1BVWA 1JYWA 3PFRA 4Y9AA 3UEQA 4J35A 1H41A 1RLCL 4IM4A 4J3VA 1K77A 1UZHA 4LVDA 4Z1BA 1RJPA 3MWAA 2CZEA 4F79A 1IXPA 3UJFA 1PTDA 1H1NA 2FH8A 2A1YA 5FESA 3TA9A 1MNSA 4R27A 1JDCA 4ZE5A 1I2NA 1A80A 4TX8A 1UD4A 3OIHA 1BKSA 2AOSA 2W61A 5FSEC 2J78A 2PGFA 5AHIA 3OO2A 3AIWA 1NDZA 2V3GA 3DYPA 1SSGA 2I14A 4XUGA 3KEHA 3JRKA 2VZOA 3KBVA 2FQIA 3UYCA 3UD6A 1KGUA 3V36A 4R9XA 3AIRA 5JBFA 2ZUUA 3PG8A 3KP0A 2IKIA 2RGLA 3MWCA 1KLZA 3EWZA 1TV7A 2XHYA 3SQLA 2XVPA 2BBFA 3WO8A 5HOSA 2R1NA 2XH4A 4AMCA 5H8MA 4X0NA 2HE5A 4TQTA 1E5NA 4RJEA 4D6DA 1N7KA 1NF0A 5LXXA 3M7WA 3NQ6A 2V2CA 1F6KA 4J9JA 1ELSA 3GVWA 4TX9A 1KFEA 3U5UA 2TYSA 1KRCC 4DBWA 4A22A 3CU2A 3FYPA 2QV4A 3W7RA 1AL7A 1FWTA 1BYDA 1M7PA 1QPOA 2VEKA 4FLSA 3BV4A 1C7TA 1C7SA 2BV9A 6REQB 2Y5EA 1XIFA 1G1YA 3WNMA 1WAWA 4K8EA 3SGZA 5LNRA 5I03A 1KTCA 5H6HA 2FKPA 4NILA 5A6SA 3FOKA 2QKFA 1AQHA 4C1LA 2PTDA 4LYKA 4HU0A 2FPVA 2PWFA 3W86A 4FIRA 4WUIA 4QE5A 1Q7ZA 4IQLA 3CK5A 1E4NA 3A24A 3SCWA 2WVVA 5FKYA 3ZJ7A 1KRBC 4AVNA 2XVGA 3TQVA 3CV2A 2X1RA 4QDPA 3ITYA 3EMCA 1Z6KA 1YNQA 4DUOA 1CGYA 4KQNA 2D73A 3WH9A 1WDDA 1JPKA 2RFGA 3HB9A 2ZUVA 1AJ0A 1W9BM 3OZMA 2WAGA 4OE7A 1N8WA 2G4FA 3U9IA 1H5YA 4IPNB 4NUWA 1OABA 3IVUA 4W7WA 2VL4A 3OBEA 1QAPA 2RDUA 4UZUA 1OCJA 5IHRA 3N04A 2CLFA 2J77A 4KMQA 4JYDA 1OIMA 2POZA 3RHGA 4L6HA 3SZ8A 1KKRA 4I6VA 2FMOA 3PAJA 3W02A 1KFWA 4Q32A 4IX2A 2WMHA 4LEQA 5FCZA 1V6YA 2HK0A 3UWWA 5FIPA 3LCIA 2YBVA 2FHFA 2PZ0A 3GC2A 5DELA 1CXKA 1I6NA 3MPGA 4GZ7A 1B3XA 2OXNA 5DMMA 2XZ7A 4HNOA 1QPNA 1VYPX 2QNEA 2CU0A 3ZR6A 4UTHA 3WQ8A 4JKKA 3DFSA 3DU0A 9XIAA 1KFCA 3M0LA 4NU7A 1H5VA 2IXVA 3CPGA 2XSBA 3W0KA 1SW0A 2DFAA 1W1YA 3TN5A 4UTTC 1EOKA 2XYLA 4HHMA 4PMJA 2ZXAA 3MDWA 3JR2A 1CGVA 3PZGA 3MZNA 2D1ZA 3CZ8A 3B03A 3VTRA 1XLMA 4KEVA 2V0TA 1JUBA 3W1UA 3TUUA 3Q58A 3ZR4A 5BRPA 1OT2A 4A8RA 4TIMA 4QRNA 2JKAA 3MVIA 3DG3A 3SB0A 4FLRA 2B7QA 3VOGA 5A6JA 2EPMX 4E2BA 5MKGA 1CLVA 1FCQA 5CKSA 4EPBC 1W9VA 4MTVA 2GGHA 1DP0A 3PJTA 4GI4A 2Q09A 5A2BA 1TA3A 5I3IA 4FI4A 3KCJA 4TVDA 3E0WA 4AXKA 2E67A 5DCEA 5C6MA 1XRFA 1TTPA 2BS9A 3GIYA 3CMJA 3TXVA 1TJ0A 2POTA 3LDVA 3KP1A 1WYIA 5FJPA 1GVQA 4RE4A 4EP8C 4O1EA 3UXIA 4B5SA 4C6EA 4MUZA 3AHZA 1PJ9A 4L7ZA 1MW0A 1VFOA 1RAKA 1FH9A 3MYPA 3DBPA 2EG8A 2VD9A 2OT1A 1UBPC 3U6WA 1P0NA 4Q33A 1IF2A 1H3GA 2GSJA 2OPJA 3JU2A 3ORWA 4A3UA 4QJ1A 3BSHA 4EF8A 1RBLA 5EMUA 3PANA 1WQ5A 5DMNA 2IQDA 4DO5A 2ZE0A 3QPEA 2YW4A 4WOQA 4C6JA 4Q6JA 3WL1A 3CHDA 4NNCA 2VP8A 1Z48A 2OQYA 2VVNA 3PBGA 2WCGA 4AYGA 3I4EA 3KRSA 1KM0A 5GJNA 1OC6A 1MMFA 1OX6A 5G1TA 4JIHA 4C60A 1KQYA 1HFBA 1P5BA 2V69A 1GVOA 1UH3A 4LBUA 3L7RA 4AZHA 1XH1A 3T0TA 3WH5A 4JKLA 5ENLA 3CMGA 4IQDA 5JH2A 2QPSA 4LAZA 2A3LA 1E3XA 2YLLA 2ZZ6A 3ABXA 3EOEA 3SUVA 1AH3A 4PA8A 3H12A 4LAUA 3NZQA 4H9TA 2BVDA 3WJSA 4MYXA 3MA8A 3HPXA 3QYQA 1FWFC 2YA0A 4Q3MA 4UB9A 3XIMA 3HF3A 4FXFA 1HJWA 1L6WA 5FF2A 4L4MA 1YTEA 4LVAA 4RL3A 3O63A 3NO3A 4QAIA 1X1NA 2E9LA 3GWQA 1FWAC 1VAHA 1S5VA 4QG6A 3DI1A 3E0IA 3W71A 4MYAA 2XGZA 3IPWA 2VX6A 3E6EA 2DQWA 4QJ4B 4U2ZA 1EP1A 2QUMA 2Y2WA 2JF7A 2ISFA 5HK4A 6TIMA 4P8VA 3EEZA 1VEMA 1E1FA 3QEZA 4ZO9A 3PULA 2I9EA 1UH2A 5IBXC 3DESA 3QV7A 1E3ZA 1RY0A 2ZVRA 4UC5A 4UQEA 3U3HA 3UXAA 4DNMA 1RBAA 1J2WA 1QK2A 3GTFA 1G7UA 4UOJA 4GG9A 4LCRA 2ISVA 4K68A 3QSRA 3TH6A 5EFFA 4YTRA 4KCUA 4MY9A 4JTCA 1BWLA 2EG6A 3KOWA 1UR2A 3EWWA 5A8OA 2E9MA 4NZ1A 5D8ZA 3F2BA 1HJSA 1UROA 3V7PA 3CV7A 1X96A 4IIFA 2BGNE 2OX4A 3NL2A 1PO9A 4ZB5A 4OECA 3TYAA 2WMIA 2XVKA 3K5XA 1EKOA 4O57A 3ZWSA 1Q65A 4GYKA 2QT3A 1Q63A 4H00A 1UUQA 5E70A 1W5QA 4E4PA 3N14A 3AMCA 5AC8A 4IP4A 2F6XA 3DGRA 1PIIA 4U4MA 3RN6A 3MANA 3T42A 1LDCA 3AS3A 1O12A 3R13A 3WDQA 2ISWA 1QTWA 2A3BA 3E38A 4RE0A 3A4WA 3CUIA 2AL1A 2DZXA 5DCDA 2P10A 2C14A 1JG9A 1PHQA 4I5RA 4CQDA 3PK7A 1TRIA 4D8AA 3WDHA 1FDZA 1L2UA 2VURA 2Y1HA 1E6PA 3ES8A 1REQA 2FVMA 1I45A 3B06A 3WQPA 1X8FA 4MAZA 1REQB 4M81A 1UMLA 4A21A 3I7QA 2A6LA 3HPZA 2CCRA 2J9XA 3FNDA 3WY1A 1BQCA 3FLUA 5DXXA 3M47A 1RPKA 1WXJA 4Q8QA 4C1KA 4DAIA 2QCFA 4CNUA 1S1PA 4ECLA 4DPPA 2E9BA 4GQBA 4DWSB 4ZBCA 1Q7MA 1XLFA 3B40A 4IIEA 2CZVA 4HPGA 4ERIA 3NM3A 3LENA 1EYWA 2VFGA 1E0WA 1ME8A 5K4ZA 3CTTA 3TVAA 5CJNA 4CGTA 3QW3A 4UQ9A 1CB7B 2XSAA 3OW1A 3EA1A 3K8MA 5C2XA 3ZM8A 1S3TC 4R9OA 1WBHA 3ME3A 3UZXA 4GIRA 3OQ8A 2F6UA 2X1TA 4CD7A 2ZRUA 3L4TA 2V2HA 4AWSA 4JL2A 5AHNA 2Y8VA 3TTOA 4M5PA 2QJHA 4POCA 3WQ6A 4EXAA 1HVXA 1V0NA 5CBBA 1QW7A 4K39A 1TJ2A 3W07A 4GVHA 3S6TA 1XXXA 3CZEA 3GBDA 5JIPA 4YNGA 4CQAA 3BPWA 1ZRQA 4H6EA 4ZO8A 3W3OA 2VENA 1R7OA 1GHRA 3R58A 2VR5A 1LOLA 1ITQA 4MZ1A 4BWLA 2VX7A 3A5FA 4BQ4A 4JGDA 3K8LA 3NTYA 3KRZA 3GUWA 4XQ6A 4QTGA 3IIZA