2GSJA

Cdna cloning and 1.75a crystal structure determination of ppl2, a novel chimerolectin from parkia platycephala seeds exhibiting endochitinolytic activity
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
271
structure length
271
Chain Sequence
GGIVVYWGQNGGEGTLTSTCESGLYQIVNIAFLSQFGGGRRPQINLAGHCDPANNGCRTVSDGIRACQRRGIKVMLSIGGGAGSYSLSSVQDARSVADYIWNNFLGGRSSSRPLGDAVLDGVDFDIEHGGAYYDALARRLSEHNRGGKKVFLSAAPQCPFPDQSLNKALSTGLFDYVWVQFYNNPQCEFNSGNPSNFRNSWNKWTSSFNAKFYVGLPASPEAAGSGYVPPQQLINQVLPFVKRSPKYGGVMLWDRFNDLKTKYSSKIKPSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein PPL-2
publication title cDNA cloning and 1.75 A crystal structure determination of PPL2, an endochitinase and N-acetylglucosamine-binding hemagglutinin from Parkia platycephala seeds
pubmed doi rcsb
molecule tags Hydrolase
total genus 99
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gsjA00
2WCAA 3OZPA 5FCZA 1DWAM 1OSEA 1W3LA 3M7SA 1GJUA 1GOQA 2G3MA 1OT1A 4JFWA 4GZJA 1H0GA 2XFFA 4W5ZA 1JYNA 2GJXA 4UOQA 1VFFA 3A4XA 3UG4A 2VX5A 2WVTA 2XM2A 3EBVA 4GO8A 5BRQA 2J75A 4CVUA 3SUVA 4DWSD 3WEZA 1B30A 4LYQA 5IXEA 4KGLA 5E6YA 3K46A 1V3LA 5DF0A 4IM4A 4W93A 1HKKA 3W81A 5HXMA 1BTCA 1KGUA 1JD7A 3KL3A 4W87A 4P8UA 1V6VA 4HMCA 3W24A 1J18A 1OGBA 4BCEA 2PC8A 2RGMA 2X8RA 3CHFA 3G6MA 1W3JA 4H8UA 4PTVA 2CCRA 4AYSA 3GH4A 1J0JA 3PZIA 1TUXA 3AHYA 1ODUA 2D0FA 1JFHA 1UZ4A 2CERA 2A3AA 4MJ2A 3VVGA 4PCTA 3F5JA 3F5LA 4HTYA 2GVYA 2WC3A 2VX7A 3QOMA 3L4XA 1UR1A 4WSJA 1C92A 3CGTA 3NUKA 4TXEA 1CENA 2CIPA 2E40A 1ODZA 1UKSA 2FHFA 3PZ9A 1QW8A 4D6GA 2EXOA 4OBSA 1JIBA 1C90A 2YLLA 3O6AA 2Y5EA 3T2QA 1ZBWA 4HP5A 4B3LA 3TA9A 1J01A 1HVXA 3RDKA 3K4DA 4W7UA 3WDPP 3VIKA 1VAHA 1CLXA 4PUDA 1EDTA 4WKFA 1CZ1A 1OGSA 5AC4A 1V6YA 2WB5A 3IK2A 4TVCA 3ECQA 3VD4A 2WHKA 4EANA 5A6AA 1EHNA 3ARSA 1LL6A 1JYXA 2F8QA 2YKKA 1E15A 3WH6A 3WL1A 2D23A 4L4PA 2BNJA 1V3JA 3GBDA 3VD5A 1NOWA 4EK7A 2OWWA 3RJXA 1EQPA 3HU7A 4E4PA 5KEZA 2UY4A 1V0LA 4UR9A 4E8DA 1E40A 2BXYA 1CGTA 1ZBCA 2DH3A 3W25A 2WHLA 2J7EA 5A8NA 3WQ8A 3LPPA 1H1NA 2NSXA 3EDJA 4AISA 2YL8A 2GFTA 3QOKA 1JXJA 2V38A 2CKRA 4ATLA 3PTMA 4H8VA 1W9XA 4FLSA 2E0PA 3ARVA 1CWYA 1QI3A 1ZJAA 4H7VA 3B9EA 4R27A 1WDPA 2ZX6A 1XSIA 2BY3A 2V5DA 1QNRA 1NWSA 1ISWA 1H2JA 1U33A 1B3YA 2WBGA 3MANA 1LJYA 3BAXA 3VIGA 4WF7A 3W26A 1UA3A 1W9VA 1TE1A 1J10A 5HNNA 2VMFA 1WO2A 3F5KA 4DUWA 3II1A 3AIQA 4W84A 4MPKA 5IHSA 3U7VA 1VFMA 4H04A 4Q7NA 3T0AA 1KQZA 1D2KA 4PRWA 3U5UA 3AJ7A 2AMGA 3UR8A 1W32A 4JHZA 2CESA 3SCRA 2XVKA 4TVDA 4TUFA 5AYBA 3A6OA 3CZEA 2DSKA 1JGIA 5E9AA 4CD8A 4YN5A 1QOXA 3CZGA 1MQPA 4QCFA 4DM1A 3CUHA 4JHOA 3CPUA 3WDHA 1EXPA 3OLIA 1V02A 1W9PA 4U5KA 4PMYA 2VNCA 3WH9A 1QPKA 4C7DA 5I5RA 3I3DA 5ABEA 2VRJA 4IPNB 1LG2A 1JF5A 3VGFA 3KL5A 1E5JA 2WZEA 2J8FA 1GORA 1KBBA 2DQXA 2WXDM 1V0KA 3NDZA 2G4FA 4KGJA 1V02E 4FK9A 1DWIM 1UG6A 3W82A 2Y24A 2CKSA 1GHRA 2FHBA 2JIWA 2XIIA 3MUIA 2D3LA 3UG5A 4W88A 4UOJA 4LQ1A 2E4TA 4PUEA 5BRPA 1QBAA 3ZT5A 2VX6A 4PCSA 4R5EA 3AXXA 3IANA 4UQCA 3S2CA 2GSJA 3DHPA 4PMUA 1EDQA 1U30A 3LPGA 5A8PA 5A6BD 2PWGA 3OGSA 2ZUTA 2FH6A 2J77A 3ARZA 5CG0A 2OSXA 2VT0A 2J7CA 4AD1A 4HMDA 1J0HA 4QLLA 4FLRA 5ABFB 1E3ZA 1SR0A 4AIUA 4XZWA 2X09A 4OZOA 3IAPA 5ABGA 3L4TA 4PSPA 9CGTA 3W27A 3ARWA 4GO9A 1XSJA 1BQCA 2D20A 3AOFA 1OWQA 4UQDA 5C70A 4AD5A 3RJYA 4AZBA 2C7FA 3BGAA 2Y2WA 4F9JA 2J47A 1G1YA 2ZUMA 4CCEA 4CCCA 5AC5A 2DH2A 1GOKA 1HL8A 1R7OA 4D6IA 1UD3A 1CXFA 4D6EA 4RE4A 3CZJA 1QBBA 2J7DA 3DC0A 4J3VA 2YOCA 4BQ4A 1G9HA 3VD9A 5DT5A 2YDRA 1UKOA 5M17A 2G3JA 4J3SA 1ISVA 2BY0A 4HZ8A 2V3FA 1A3HA 3GYCA 1FA2A 3PZMA 3AMKA 1HVQA 3ZSSA 4JKKA 1K6AA 3WIJA 2DSUA 1JAEA 1LLOA 1CEOA 2QMKA 1EA9C 2DT3A 3WELA 3OZOA 2FGLA 2YDQA 5CQ1A 1ISZA 2CBVA 3GXDA 1UKTA 2Y4SA 4EKJA 1GPFA 1UH3A 3CHDA 5AYIA 1O6IA 4AZ6A 3ZO9A 5I78A 1PZ3A 3ARXA 3WD2A 3EDFA 1WAWA 1K9DA 1M53A 3T0BA 1E3XA 4P7LA 4CU8A 1HJVA 4W85A 4OKDA 3SCVA 3D5HA 5FL1A 1GQIA 3AIRA 1DP0A 1HT6A 1NQ6A 2VVSA 4UOZA 1XV8A 3L4YA 5JIPA 1KXVA 1J0YA 2EPOA 1AQHA 2WKLA 1KGXA 4MAVA 5BYWA 2OYMA 4LXFA 3CHEA 5D4YA 1H4PA 1OIFA 3AROA 2D22A 3BMVA 1QVBA 2XHYA 3BLPX 1N82A 1KXTA 4V27A 3M46A 1HXJA 4CN4A 5ABFA 1FOBA 1L0PA 1E71M 3N1AA 2DIEA 1VIWA 1JFXA 4JFUA 1MQQA 4UNIA 3PHAA 4UZUA 2XM1A 2DEPA 4JKLA 3RM9A 3F4VA 1CECA 1R86A 1R8LA 2W66A 1UQZA 1KBKA 1VRXA 4TX6A 4DWSC 1Q6EA 1C93A 1KR1A 2YA1A 5C8BB 5TD4A 2FH8A 2X0HA 2WW5A 1JYVA 5E09A 1E70M 3AICA 3CHCA 1Z32X 2F2HA 2WVVB 4ZEPA 1PJ9A 2W5FA 4QLKA 3VTRA 3VOCA 2BFGA 1JG9A 1XD1A 2WC7A 1GW1A 1JDCA 2EO7A 2GK1B 5DO8A 3ZJKA 1W2PA 1BG9A 4PMOA 1KB3A 4WKAA 4P7RA 3WNOA 3THCA 4YHEA 2VR4A 2G3IA 4J7RA 4HA4A 1CIUA 3BMWA 2O9RA 2OYLA 4ZXLA 5HPCA 2VI0A 3DYMA 4GI6A 3WSUA 3KE0A 3WD3A 3WD1A 1F4HA 2PWHA 3GXIA 1IV8A 1KWGA 1E4IA 1ECEA 3IJ9A 4LX4A 1B3VA 3GNOA 2YDSA 3K4AA 3WNKA 1BHGA 1OINA 1VEPA 1XH0A 1BGGA 2ZIDA 3MMUA 3ARPA 1OBAA 1AQMA 4Z2GA 5CLWA 3VD3A 1HJXA 2C0HA 1HIZA 2MANA 2J78A 1P6WA 2VR5A 3AI0A 1A47A 2X1IA 2VZTA 2WMJA 2OSWA 4BQ2A 5A6JA 2YBUA 1UQYA 1PX8A 1GHSA 4AEEA 3VU2A 4TOQA 4NRRA 1XD0A 4U33A 1EO7A 4EAMA 1UH2A 1YHTA 2XUCA 1DWFM 3VIIA 1DWHM 3WNMA 1UWTA 2WANA 3WF2A 1XYZA 1UD5A 5A2AA 5E70A 3UEQA 1BVNP 1G94A 1WZAA 3ALFA 4MDOA 1JYWA 3PZNA 3GH7A 5EB8A 1UR0A 3VIOA 1R87A 1XCWA 4AZIA 4ZFMA 4PMXA 2WVVA 1KFWA 3VO0A 4MB1A 1CXIA 2QPUA 1Q6FA 1LF1A 4W8AA 3SCWA 3T2PA 1MXDA 1QNQA 2CBUA 1EGZA 4RL3A 3UCQA 1HX0A 1UWIA 5LA1A 3LPFA 2XVGA 1BF2A 1HF6A 2A3BA 2WCSA 1EDGA 4P8XA 4PTWA 1VBRA 3WH8A 3SCNA 1J12A 4GINA 1BYBA 5GNXA 3U57A 3VILA 3OLGA 1I75A 4AZCB 4LYRA 1JNDA 2BHYA 4BZYA 4GIAA 2WMFA 1US3A 3WF1A 1HP4A 3KL0A 2CEQA 2ZUVA 1QI4A 8A3HA 3WQ6A 4XUYA 1K9EA 4BQ5A 2WMHA 2YA2A 1W9UA 4CUCA 4J27A 3AFBA 2HISA 5BCAA 1LL4A 1HL9A 4MDPA 3NSMA 3S6TA 2ZUWA 1JI2A 2IUZA 4NF7A 3PBGA 3WFZA 2EEXA 1C8YA 3N11A 4B9ZA 3AMLA 3MKKA 1ISXA 1MW0A 1GVIA 1CXLA 1NM9A 1ZJBA 2J74A 3AXIA 5FIPA 2J4GA 1B0IA 2PWEA 2WKGA 4S3JA 1CGYA 3ZOAA 4YPJA 2CPUA 2BY1A 1GOIA 1NARA 4V28A 5HPOA 4D6FA 3EMQA 4UQAA 3VX1A 3CUJA 1KGWA 1TA3B 3M6DA 1UD2A 1JXKA 2XWDA 7A3HA 1WB0A 3GDBA 2W92A 3L4WA 3BAYA 4UCFA 3VPLA 1IZKA 2ZX8A 4WJXA 5CGTA 5HOSA 1W91A 2WMIB 4HA1A 3SUSA 2VZUA 2WSKA 1CDGA 1V3IA 2YBTA 3WQ4A 1GVYA 2GJPA 5FL0A 3WENA 4DUVA 3QHNA 3SURA 4Q22A 3D3AA 1UKPA 5C71A 3B8SA 3BAWA 1E4MM 2DSVA 4N0RA 1ZS2A 4JAWA 1WCGA 4FLOA 3IJ7A 3WL0A 3ZR5A 3GBEA 5I24A 3GXMA 2WMKA 2ZXAA 3L2LA 4U3AA 2J62A 1XSKA 3TTSA 2CNCA 1VF8A 2QF8A 5A8MA 4B9YA 1NH6A 1UWSA 3NJ3A 1E6ZA 1BYAA 4AXNA 1RD6A 4XV0A 1EHAA 1HNYA 4MNLA 3AZTA 1E43A 4XZBA 4AZ7A 5JBDA 4JIEA 2EPKX 3OLEA 1BGAA 3WUEA 5A1AA 4HA3A 4GPNA 3EMCA 2Z1SA 4M29A 3VMNA 3KWXA 4WSKA 3FW6A 3T09A 1MFVA 1UR2A 1E4LA 4XB3A 1BFNA 5GQBA 1UWQA 5IHRA 1W2VA 1ITCA 3TTOA 1FH8A 1GJWA 1V0MA 3KZSA 2CHOA 2C8NA 1TVPA 4M1RA 3RIKA 1MW3A 2VUYA 3AHZA 2XVLA 3AHVA 4AW7A 1TG7A 6A3HA 2ZXQA 3W0KA 4Z2HA 3CBWA 2VOTA 3QGVA 4U5IA 3WEMA 1B3WA 1PAMA 2BVTA 1BYDA 1EOMA 2YL9A 4CD4A 1GQKA 1NP2A 2VURA 2VCAA 4D1JA 5A2BA 4UFIA 1W3HA 2VTFA 1EH9A 1QW9A 2VL4A 3T2OA 2X2YA 3SUTA 2W91A 2V3DA 4W5UA 4HPHA 4MB3A 3WBEA 1BVZA 3EMZA 4J3TA 3AHTA 4OJYA 1ITXA 3NIYA 4KRUA 1H3GA 1E0WA 5A6MA 4JCLA 3PZOA 3FAWA 3N12A 4W7WA 1QNOA 1IT0A 4H8HA 1OM0A 3WDIA 2ZUUA 1E1FA 4X9YA 4JCMA 3CUGA 4P7NA 1CXHA 5ECUA 1IZJA 2VO5A 3BAJA 2BHUA 4A4AA 4F9DA 4QP0A 1ZU8A 2ZICA 4D72A 1W1YA 5AY7A 3WD0A 3K8MA 4FF5A 2YIHA 4M81A 5CXPA 1M04A 3VIHA 2V5CA 4MADA 3W38A 5CLTA 3VMPA 1EOKA 4ATWA 2JEQA 4ATDA 1RP8A 2D24A 4U3CA 1MQRA 2WMGA 2CBIA 3A47A 3AIUA 2JE8A 1MWOA 2J7GA 1YQ2A 2GUYA 2E3ZA 3ZJ8A 2Q8XA 4A3YA 4PMVA 5A6LA 2W4XA 1V6UA 1G01A 1BSIA 4NRSA 5DT7A 3N9KA 1QNPA 3WQ5A 5IDIA 3VUPA 4B3KA 3MU7A 3W37A 3VMOA 2V3EA 4OUEA 3WH7A 1E73M 1UOKA 1UKQA 1J0IA 2E9BA 1PBGA 2E8ZA 2JEPA 4KH2A 3RM4A 3VINA 3WMCA 2WLZA 1VEOA 3SCOA 1GOOA 3ALGA 3GTNA 1JZ6A 3CLWA 3AYSA 1M03A 1FP8A 1US2A 4WLCA 2PF0A 1QNSA 2UY5A 1UR9A 2FDMA 1EIBA 1J0KA 2ESCA 2E8YA 1B1YA 1GOMA 3HMCA 1M7XA 5M03A 4HU8A 2PB1A 2GJRA 4D6JA 4NSBA 3T08A 1Q6GA 2BVYA 3FN9A 3AHXA 1CTNA 3EDKA 4U2ZA 3WFLA 3QHMA 3G6LA 1OD0A 2UY3A 4ZENA 4URIA 3VM5A 4IPLA 2DIJA 1RH9A 2WBKA 5E0FA 2XIBA 4CCDA 1V6WA 1NOUA 3K1DA 4W89A 3ZIZA 1ZB5A 1KR0A 2QLYA 1QI0A 2OLHA 4PYSA 6CGTA 2EPLX 1WE5A 1F4AA 5M3WA 1E6PA 3MS8A 3BXWA 3I3EA 5I0DA 2BVDA 3AMGA 4ACYA 5D8WA 1E0VA 5IFTA 4HMEA 3SIMA 1E6QM 2WZIA 4AIEA 4M82A 5D9MA 3OLDA 1GOWA 2D1ZA 2ZX5A 2E9LA 4PMZA 1QHPA 1VJZA 1BPLB 4AZHA 2BXZA 2O9TA 3RCNA 4UZSA 5LYRA 2NT1A 5EFFA 1NWRA 4UFLA 4WKHA 2QV4A 5A95A 3MO4A 5M5DA 2AOSA 2VCBA 2VRKA 1Y7VA 1H5VA 2OWXA 5A2CA 5EFDA 2BS9A 1E6SM 2JIEA 1GNXA 1KCLA 1WKYA 4JFVA 4MB5A 2W63A 5JBFA 2WZHA 1GUVA 3ZJ7A 3FNDA 5CSYA 1OT2A 1Q6CA 1H41A 4BQ3A 1E72M 5DEZA 3SCPA 1FFQA 1H0IA 5F7UA 5GNZA 1HN1A 3ZMRA 1BG4A 1I1XA 1FHLA 4GZEA 3J7HA 2O9PA 4ACZB 3PN8A 2GJXB 4KMQA 3VKKA 2G41A 1HJSA 1FP9A 3CMGA 1FHDA 1V3KA 1QI2A 1R85A 2EPNA 4LGXA 4W86A 1E1EA 1VFUA 3SUWA 4GKLA 3RM8A 1G0CA 1X6NA 5CGMA 1UWUA 1ZBVA 3MMWA 3A4AA 1KCKA 3EYPA 3BC9A 1JI1A 1GQJA 1L8NA 1JNEA 3DECA 3OIHA 1RPKA 1JZ2A 3WY1A 1B31A 1C8XA 3GNRA 2JALA 4OIFA 3MMDA 4PTXA 1MW1A 1E55A 3OBAA 1QI5A 4DWSB 4WK9A 1ESWA 1FH7A 4YHGA 1SMDA 5I2UA 1XYFA 1UD6A 2G3NA 3VIPA 1NOFA 1H49A 3W53A 4MNMA 3B9AA 1V03A 1UWRA 3PZVA 3N17A 2D0GA 5CPQA 2BV9A 4GI9A 2TAAA 1E0XA 3MSDA 4PBGA 2WHJA 5DFAA 2VCCA 5BXSA 1UHVA 5I77A 2VQUA 2WHMA 1E4NA 1M01A 2BHZA 2J7HA 2ZE0A 3THDA 5JBEA 5A8QA 3PZGA 1LQ0A 4TX8A 4CD7A 5FD0A 4Z2LA 2J79A 4GQQA 3UETA 2VZVA 2ZOXA 1KXQA 5EBAA 5A69A 1UR4A 3NYDA 5A3HA 1TZ7A 1QHZA 1CPUA 2CITA 4MJ4A 2GK1A 4U2YA 4UFJA 2XPKA 1EQCA 3AMCA 1FH9A 3WUGA 1KQYA 1GQLA 2WAGA 1AMYA 4CD6A 3BSGA 1B2YA 3CZLA 4ZXOA 5FKYA 1HKMA 1HJWA 3E1F1 4ACZA 3WKZA 2X05A 2A3CA 4MAZA 3VDBA 1UR8A 1B3ZA 1WP6A 2VJXA 2XSAA 4MNJA 3AXHA 4D71A 4NI3A 4D6CA 3OA5A 3AZRA 4CU6A 1TR1A 4W8LA 3MUY1 1VFOA 2YA0A 3VD7A 4HOWA 3OGVA 4C7FA 2XSBA 3AQUA 1MXGA 2Y8VA 4AD4A 4W8BA 4PN2A 1TFVA 4QAWA 5LA0A 4DWSA 1LWJA 3QHOA 4P7OA 2CXGA 2XTKA 2FGZA 1MW2A 4F8XA 1XRVA 4JZ5A 3ZT7A 1GCYA 3ARRA 5A94A 4ML4A 3A4WA 4QCEA 3CO4A 3IAQA 3WF3A 3WNNA 2ZUNA 2DSWA 3AISA 1J11A 3NSNA 3VIFA 3CMJA 1HKIA 4JFSA 5KZ6A 4AZGA 1ZBKA 1CXKA 4N42A 1E5NA 2J7BA 1C7TA 2WNWA 2JFEX 3ZQ9A 3AIWA 4PMNA 5A6KA 5D9PA 2DT0A 1U2YA 2VZSA 4JFTA 3CZ8A 3WDJA 1JD9A 3HN3A 3LMYA 2J7FA 2ZXDA 3GZAA 4KRTA 1W9BM 2O9OA 4CD5A 1PPIA 4NZCA 3UERA 4F79A 3BSHA 1LWHA 2HVMA 3VM7A 1J9YA 3DYOA 2YLAA 3VGEA 1W3KA 3TP4A 4AZCA 1HKJA 3VDHA 1MFUA 1V0NA 4UFHA 4P7QA 3DYPA 5JUVA 2ZUSA 4X0VA 4GQRA 1XH2A 3AS1A 2X0YA 1NWTA 3SCQA 1BAGA 1LG1A 2EQDA 3JUGA 5A6SA 2XGIA 4AC1X 3WNPA 2EPMX 4GZIA 1V3MA 2W61A 4HPGA 3MV11 4U31A 3ARUA 1WDSA 4LYPA 3WN6A 2GDVA 5E6ZA 5E0CA 1JZ4A 1DTUA 3N04A 3A3HA 3WDRA 5FOOA 2ZXBA 2PBOA 4HOZA 3UG3A 2XG9A 3U5YA 3TOPA 1I1WA 5BXTA 4UTFA 1WDQA 2FHCA 2EJ1A 3TTYA 6TAAA 2CYGA 1HJUA 4H41A 3ZM8A 4MNKA 3VDAA 3FHAA 3B9DA 4PEEA 2CHNA 3CUFA 1WPCA 1TA3A 2NT0A 1JDDA 4AZ5A 4Z2IA 1PIFA 2CETA 3AYRA 1UUQA 2DT2A 3SCSA 2RGLA 3BAKA 3EDEA 4AEFA 1JZ5A 3GNPA 1VEMA 4HOXA 3CUIA 3TONA 4M8UA 3ZSTA 2WMIA 3FHQA 3ZJ6A 5D8ZA 4AD0A 1BYCA 4KWUA 3WUFA 1X6LA 1HP5A 1C8QA 2PBGA 4DM2A 1VENA 1CGUA 3SEPA 2A3EA 2EBNA 2YL6A 4W7VA 1VB9A 5I79A 4AD3A 5HBFA 3HJEA 3WH5A 3W4RA 3PZQA 3AZSA 2XFYA 2DPEA 1CNVA 4H2CA 2QMJA 3POCA 4UFMA 2D3NA 7CGTA 3O9NA 1HJQA 2OYKA 4UFKA 4CU7A 1SFSA 1D7FA 4V2XA 1E6NA 1VJSA 2QPSA 1CYGA 2WWCA 4ZE4A 1UD4A 1TCMA 3NDYA 3AS0A 2O92A 3KEHA 3VIMA 1AQ0A 4M24A 1DWJM 1W1TA 4F66A 3GM8A 3VX0A 1GZJA 4EE9A 2WVSA 5D9OA 2XVNA 1CGWA 3WUBA 5I23A 4ZE5A 3BCDA 2V3GA 1WZMA 2W62A 1WDRA 4TTGA 3K8KA 3N13A 3EDDA 4FMVA 2JF7A 5D9NA 3WF0A 3WNLA 4S3KA 3SCTA 3MSGA 1E9LA 4OOZA 1Q4NX 2DT1A 2J25A 1DWGM 1XHGA 5I3DA 1Q6DA 1B90A 1DHKA 4FLQA 4HZ6A 2IXVA 5A6BA 1JAKA 1PIGA 3AS3A 3APGA 4JL1A 3PZUA 4J28A 3AMDA 4QLJA 1B3XA 3U7BA 4CKQA 3AIEA 4OOUA 3ZR6A 3VGHA 4IUGA 4QFUA 4XX6A 1WNOA 3TTQA 4B16A 2YL5A 3OGRA 3IJ8A 4E2OA 3M07A 1TMQA 3W28A 1E56A 2A3HA 1KWKA 3AS2A 1OCQA 1RP9A 1W1PA 1CLVA 3CH9A 1FFRA 2DSZA 3WMBA 4PTMA 2VRQA 5CJ5A 4M56A 1OGGA 2Y8KA 4DUXA 1WZKA 3L2MA 3WQWA 4JKMA 3ARYA 3WDQA 3RPMA 2VQTA 3VIJA 1NWUA 3W6LA 4D6DA 1JZ8A 3GH5A 1MYRA 5HDRA 1D3CA 4BS0A 1ZL1A 3VDCA 4AD2A 4TTUA 5BROA 5BXPA 4UQ9A 4A3HA 5CPSA 3RILA 3WD4A 3CZKA 4M80A 1UD8A 1QHOA 2PI6A 3MUZ1 3RMEA 2J8GA 5BWFA 3OG2A 4Z2KA 5BXRA 1CXEA 3MV01 7TAAA 3DHUA 4B15A 4Y7EA 2GDUA 4L4OA 2F61A 1C3FA 1JF6A 1TVNA 2WC4A 4CN6A 1NP0A 4HZ7A 4CVWA 3BCFA 5CSUA 4PMRA 1XH1A 1B9ZA 1KXHA 3O2LA 4PSRA 3UESA 3WMSA 1CGXA 2VC9A 2NW0A 2WM0A 1K9TA 5GPRA 4D6HA 3VGGA 2QHAA 8CGTA 2ZX9A 3SCUA 4QDMA 4MTVA 2WVUA 4J3WA 1CGVA 4CGTA 1J0ZA 2IXUA 3NCOA 3FXYA 1PX3A 4UQBA 1H09A 3L4VA 2UWFA 2G8ZA 3BAIA 2UY2A 2W67A 1W1VA 3PTKA 4BA0A 3WEOA 1UA7A 4LPCA 1SYTA 3QR3A 3WF4A 4GI8A 5A8OA 1PZ2A 1O7AA 3AIBA 3VGDA 2JF6A 4AY1A 2DDXA 2DGAA 3SUUA 5LA2A 1S46A 3T0DA 4UQEA 1E6XM 2XVPA 2OSYA 2WK2A 2XGBA 2VX4A 4P8VA 2WCGA 2PWFA 4PMQA 2VZOA 3GXFA 4IISA 1XCXA 4RE3A 4PMDA 2WLYA 1MVYA 2ZWYA 3WQVA 4WIWA 1OD8A 2PWDA 1GONA 1JDAA 3BH4A 3CIVA 1R7AA 4J3UA 2ZWZA 3NSXA 2XJ7A 1LL7A 4P8WA 4RE2A 4D1IA 1JL8A 4AMCA 1V3HA 1XC6A 5DMYA 4OBRA 3VNYA 3W6MA 3FAXA 4J3XA 1SMAA 3K8LA 3MUAA 1UZ1A 4JL2A 2D0HA 4C7GA 3N18A 4E8CA 2OWCA 1K9FA 1G5AA 2E9MA 2XWEA 5GNYA 1H11A 2ZX7A 3N15A 2B31A 1OIMA 3BLKA 3OB8A 4GXPA 1C91A 2XFRA 2D2OA 1VBUA 2XYLA 4TVUA 1PEZA 3POHA 2BY2A 1UYQA 5CPTA 1DEDA 1OB0A 1PX4A 1V08A 3L4UA 1C7SA 4K68A 3VNZA 1ISYA 2WYSA 4MB4A 3PTQA 4BF7A 3VGBA 3ARQA 1V6XA 1JZ7A 4AIOA 3ARTA 5JIWA 3W29A 1BLIA 4X0NA 1X1NA 3WBAA 4CN1A 2CBJA 1W9DM 1WZLA 3ZT6A 5IFPA 3LPOA 2WPGA 5EMYA 3PZTA 1AVAA 2WWDA 5I6SA 3UR7A 3CTTA 3FY1A 1E6RA 2VVNA 5ABHA 4AWEA 1JZ3A 2WSPA 5CZKA 4Z2JA 3RO8A 1CBGA 1EO5A 3I3BA 1XGZA 2Z1KA 3L4ZA 2AAAA 3AIVA 2YJQA 4HU0A 1UH4A
chains in the Genus database with same CATH superfamily
2PU0A 2OMAA 5FCZA 1N55A 1GJUA 5C2GA 3MHUA 4DF1A 3VZXA 4A22A 5CJNA 1Q8JA 2XFFA 3KS6A 2GJXA 2NV1A 1XIFA 3UG4A 3EBVA 4A2RA 3V0TA 1TMHA 5CKSA 3P67A 3WEZA 5D2VA 2IKJA 4LYQA 5E6YA 3K46A 5DF0A 1I2OA 2BGQA 3BW2A 5FSDC 1HKKA 1XDLA 2YZRA 1KGUA 2ISWA 1JD7A 3NO3A 4W87A 1J18A 4BCEA 3WLQA 2RGMA 2X8RA 4M6VA 4F0HA 1G7UA 4PTVA 3QGAC 3TAKA 4MWAD 3PZIA 3AHYA 4QM1A 1ODUA 2D0FA 1UZ4A 1A5CA 2CERA 3W7EA 3F5LA 4LWWA 3B8DA 4Z1CA 5LKYA 1G6CA 3L4XA 4B5SA 1WKFA 2HXTA 4RW5A 1EPVA 1RLCL 4PB4A 4LEQA 4WQ6A 5CPLA 1QW8A 4DXVA 4OBSA 1C90A 2QYGA 1F61A 2YFOA 3E9AA 1EJXC 3T2QA 4B3LA 2YXGA 1AH0A 4F48A 3K4DA 3TSBA 3B05A 4W7UA 1AA1B 1CLXA 4M5PA 1PIIA 4AXKA 1DKWA 5IBXA 5AN7A 1U1JA 2FLIA 2WB5A 1XRTA 3GFYA 3C2FA 3ECQA 2WHKA 3OVPA 3TVAA 4XQ6A 3V16A 1E15A 1OFAA 2CZVA 3WL1A 3EWUA 2D23A 4L4PA 3SY5A 2BNJA 1V3JA 3BO9A 3GBDA 5DELA 3VD5A 4EK7A 1OC5A 4F0SA 2Q09A 1EQPA 3K4WA 1QO2A 4E4PA 1ZPTA 3TMQA 4FI4A 4E8DA 4MF4A 2BXYA 1ZBCA 4GQGA 3P82A 2CC0A 1M7OA 2DZBA 1GZ1A 3TN3A 3EDJA 3WLLA 2YL8A 3QOKA 1JXJA 4RNJA 3UZXA 3PTMA 3UG8A 2D2GA 4FNPA 1QI3A 2PZNA 3O7UA 1ZJAA 4JN7A 4H7VA 5HQLA 1ICSA 3HG2A 3WCZA 5EMLA 1QNRA 1NWSA 1TELA 1ISWA 3BW4A 1B3YA 1TPUA 5MF5A 1DJWA 3VIGA 1W3IA 2A0NA 3C0LA 1UA3A 1J10A 3MKCA 4YTUA 3OO2A 3SB0A 5CZJA 3FKRA 4DUWA 1OX4B 4YWIA 1XIGA 3VC6A 3T0AA 4D8AA 4ZO6A 4CQDA 2AMGA 5GJMA 1GQNA 1T96A 2CESA 4D9PA 1XLMA 2G3FA 5AYBA 3A6OA 4IZGA 1QOXA 5HJYA 3CUHA 2E5BA 4U5KA 4PMYA 2VNCA 4AG0A 1TREA 2WJDA 4X22A 2G5WA 4IPNB 4YVXA 2WZEA 1ZSXA 4LTSA 1V0KA 4EX4A 3ITXA 2VC7A 3T4WA 4FEZA 4FK9A 3MCMA 2JIWA 2XIIA 1XPGA 3UG5A 4UOJA 4AH7A 1IZCA 4QR6A 1HZYA 1C8VA 2WO5A 3WJXA 5BRPA 2ZZ1A 1UJQA 1XBZA 1TTJA 1KFCA 2R1KA 2ACUA 3LPGA 3RPDA 4OWGA 5A6BD 3QTPA 4WJEA 1XYLA 5AKQA 1HO1A 2VT0A 5DRCA 3B0YA 2WZMA 4AD1A 2Y70A 4PULA 4HMDA 1J0HA 1BD0A 3G1XA 1R47A 3UCDA 3Q58A 3TZNA 5HR7A 1E3ZA 2X09A 4OZOA 4H9ZA 4XAPA 3KOZA 1DJXA 2YXXA 5CBIA 4ADUA 1V4YA 2CFFA 4LT9A 1OWQA 4Z17A 4AAJA 2A3LA 4DJFC 1XISA 4AD5A 3GVQA 3BGAA 4XK2A 5HNRA 2J47A 1KRAC 1G1YA 2ZC1A 4CCEA 4CCCA 5AC5A 1GOKA 1HL8A 2XIJA 2CZ5A 1JCMP 4BEQA 5DT5A 4DLFA 5EA9A 4GY1A 1UKOA 4GQBA 3R4IA 1K4GA 3GC4A 2G3JA 4LW7A 1KM1A 5HWNA 3FIGA 1A3HA 3PZMA 1SFJA 3W7IA 2E6FA 3ZSSA 2OFJA 1K6AA 2PDPA 2DSUA 1JAEA 1LLOA 2WNNA 1CEOA 5T9CE 3CAQA 3WELA 4GYPA 5CQ1A 1DBTA 3PPGA 2CBVA 2HS8A 1ME7A 5FF4A 4HCLA 4H6EA 3BLLA 3FJ4A 1O6IA 5I78A 4EXAA 1PZ3A 3ARXA 3LENA 4TX9A 4E38A 1WAWA 1VCGA 1R9XA 4HNVA 3R1ZA 1FWDC 4LS2A 1GQIA 1Q65A 2QUVA 3LEPA 1IEWA 4J1OA 2QAPA 4N7QA 1J0YA 1XIJA 3INPA 1KGXA 5BYWA 3GNDA 3NPWA 4ZSUA 2OYMA 4QBXA 1H4PA 1IXOA 3BMVA 4H9YA 3OBKA 4CN4A 1HXJA 4H6RA 1ZENA 5KETA 2PTYA 4CNUA 3PHAA 3H21A 4UZUA 1RY0A 4JKLA 1CECA 3LNPA 1R8LA 1KM3A 4QE1A 1KKRA 3BJFA 1KBKA 3CK5A 3L0NA 3G1YA 1C93A 1KR1A 1W5PA 5C8BB 5TD4A 2WW5A 1RXOB 2WVVB 1Z6KA 4J3ZA 4QLKA 2H8ZA 3VOCA 4Q8QA 3REQB 1M3UA 2WJEA 2QXWA 3LTYA 1GW1A 1O5XA 4GY0A 2GK1B 2ABBA 2FVKA 3A3WA 4S23A 3ZJKA 1BG9A 2XINA 1KB3A 3URBA 4J7RA 4HA4A 1CIUA 3BMWA 5HPCA 3N2XA 3DYMA 3TZFA 4BF5A 4GI6A 1HKWA 4AIBA 3WD1A 3GFZA 3R58A 3C5QA 1M9HA 1E4IA 3LV5A 3N4AA 4QEEA 2QJIA 4LX4A 3GDLA 3STCA 4ENLA 2Y85A 3HGRA 2CLPA 1YTEA 2OZ8A 3E74A 1BGGA 2C1HA 2DW6A 1TV7A 3CQKA 5M2FX 1EF3A 3WG6A 3VD3A 4DBDA 2MANA 2J78A 4XVDA 3ITOA 1SR9A 1PS9A 4LB3A 5FJIA 3LGEA 5JVLA 5HAOA 2VZTA 1P1XA 2QVHA 5F2LA 4US5D 4OBTA 2DP3A 4DRSA 3JR2A 1LQAA 3CHVA 4POCA 3KHJA 1TPWA 4WOZA 4NRRA 3GC2A 3P74A 1TJPA 3VIIA 2Z7KA 3QFWA 1W37A 3CTLA 1UWTA 2WANA 1KBLA 3WF2A 1XYZA 1UD5A 5IM51 1SZNA 1BVNP 2OXNA 3ALFA 4JTIA 3SRKA 3AU6A 4BJHA 1XCWA 3GQYA 3MI2A 2WM1A 1VBHA 4U28A 1UPMB 3WBXA 1US0A 3O16A 4DJEA 4XZLX 5LA1A 4UTTC 4J4KA 2PWUA 3CWHA 3WH8A 3KDOA 4FR1A 2IQ0A 1BYBA 5GNXA 5CEWA 2HMCA 3A5FA 3U57A 1X39A 3KTCA 2WNZA 4LYRA 3KBNA 1JNDA 2BHYA 1VFHA 2YSWA 4A35A 4IFOA 2WMFA 3T55A 3NM3A 3S5ZA 1I6NA 3NWRA 5DX7A 3LHUA 2OB3A 1EZWA 4XUYA 2WMHA 2YA2A 4E2DA 3F4CA 3HQ1A 1W9UA 1HGYA 1FWTA 5MKGB 5BCAA 3LY0A 1MEWA 3NSMA 2IUZA 3E0IA 2NLYA 2Q01A 4JTAA 4ZOEA 4GH1A 4ZQMA 3WFZA 1SQ7A 4NXSA 1WUEA 3D3FA 1ZJBA 2J74A 5TBOA 3AXIA 5FIPA 2VEMA 2J4GA 3P0XA 1Z89A 1K8XA 3ZOAA 1K7FA 5D09A 4V28A 1RA0A 3C8NA 5HPOA 4D6FA 4I9JA 3EMQA 4BWLA 3W87A 4L1XA 1KGWA 1E0UA 4GHRA 3M6DA 4G6CA 4L56A 2HE8A 3M5XA 3GDBA 1B5TA 1OADA 4PCPA 4LOCA 4UCFA 2O55A 3B8VA 4JX6A 4WJXA 3E49A 4KWOA 3CV6A 4JNMA 2WMIB 3MQTA 2ANUA 1V3IA 2PZ0A 1BTMA 4J5NA 2YYUA 3BLDA 4IIDA 1SO5A 5C71A 3BAWA 1K3UA 4H7CA 1ZS2A 4O4VA 4IJRA 3GRIA 4JAWA 1WCGA 1TMLA 3ZR5A 2WNQA 2WMKA 2FYMA 1QJWA 1B4KA 4U4MA 1VF8A 3LHTA 4PTNA 5A8MA 1VD6A 9RUBA 1UWSA 1R3QA 1E6ZA 2VDGA 1BYAA 2ISVA 2XIOA 3C2YA 1QPRA 1HNYA 1PZ0A 1RCQA 5G4HC 4DJDA 4I7VA 2XSXA 1QU4A 4H3DA 1E43A 3GTXA 3B06A 3ZWSA 2HVNA 3W00A 5CG7A 3H4WA 3WUEA 4GPNA 3EEZA 1TV2A 4UMAA 1SUXA 3W2MA 5IHRA 1W2VA 1FH8A 1GJWA 1V0MA 1OYCA 2C8NA 2B7NA 3RU6A 1TVPA 1PVNA 3AHZA 3O6DA 4AW7A 1JPHA 6A3HA 3CBWA 4U5IA 3WEMA 5FF2A 1B3WA 4LUSB 4RZ5A 1HW6A 1ZAJA 2PPGA 3NQVA 1RZMA 1NSJA 1K8YA 1NP2A 1TPB1 3H12A 1QPNA 5CBJA 3AXMA 2VFFA 1W3HA 3DFYA 5FSEC 2Q3OA 3T2OA 4C6QA 3GTIA 3KLLA 3P14A 2W91A 4W5UA 4YXGA 4HPHA 3WBEA 3EMZA 4I6KA 2PDBA 4JTRA 1VCFA 3DG7A 2I5QA 1VRDA 3RX2A 4QJ5B 3NIYA 4QROA 3VA8A 1H3GA 1R3VA 3BG3A 2OTDA 4KS0A 4YMZA 2VUNA 5FJUA 4E8GA 2PODA 4YLWA 2O7SA 4N6EA 4C90A 3WK2A 3LHZA 1QNOA 2P0IA 4LUIA 4NJHA 4H8HA 2ZUUA 4X9YA 2QJHA 3CUGA 3L23A 4O0ZA 1IZJA 1DPMA 3BAJA 3M0XA 1A50A 2BHUA 1S5NA 1REQB 3S9IA 4IPPA 2ZICA 1W1YA 3HFYA 1Z41A 2H90A 4FF5A 1ADOA 3EPNA 1W1B1 4UTIA 4M81A 3LCLA 4MADA 1P0BA 3P5ZA 4EIVA 3W38A 5CLTA 1JPDX 3MWCA 5FEXA 3KDNA 2GPTA 2ON3A 3BPWA 4G9PA 2C71A 4U3CA 3NPXA 1MQRA 2CBIA 3BICA 1KCZA 5AHEA 2J7GA 1YQ2A 3ZJ8A 1S2TA 3W1QA 3SW6A 5T8GA 2G50A 3WMLA 3WJZA 1V6UA 4A2SA 1X6UA 3E2VA 1DXFA 4JDBA 4B3KA 4OUEA 3C0QA 3BQ6A 4BEUA 1A3XA 1J0IA 1RLDA 4KEMA 1A5LC 3DG3A 4HK5A 3SCOA 3ALGA 3PBYA 4ZQOA 4EXQA 3PBWA 2VR2A 1EIBA 3SQLA 1JULA 4ZO7A 3HM7A 1B1YA 1GOMA 1M7XA 3JVAA 2Z6JA 3OOQA 5M03A 1EJUC 4HU8A 2HK1A 4D6JA 2NVCA 2XGZA 1KFLA 3LZ3A 5I3GA 1H7OA 3WFLA 2CXEA 2A1YA 4XD3A 4URIA 1TQXA 2DIJA 3DKJA 2RFGA 5DMMA 3M0JA 2WBKA 2B4GA 2HDJA 1V6WA 4ADTA 1O5RA 3PBVA 2X1TA 4BKNA 1XUUA 1F3TA 1EFZA 3EXSA 2YB1A 4L9XA 3L7RA 1W5OA 2E28A 3I3EA 4A05A 4K38A 5JU6A 4ACYA 2V8ZA 3LN3A 2WZIA 4M82A 5D9MA 1OCJA 2NQJA 2DU2A 3SN1A 5IDZA 2D1ZA 2VGGA 4PMZA 7TIMA 3P81A 1QHPA 4YTSA 1BPLB 2BXZA 3RCNA 5CCZA 3A12A 4UZSA 4XD6A 4M7SA 2OOGA 3UT0A 4WKHA 2J88A 1DJQA 3DG6A 1TWSA 4H7ZA 4GBDA 1ONWA 5A2CA 1FX6A 1TSIA 1A80A 1WKYA 1AH4A 3CC1A 5JBFA 5EPDA 2WZHA 4C1LA 3ZJ7A 4DI8A 1MUCA 4NJGA 1OT2A 1Q6CA 1E72M 3SCPA 3FK4A 4NVTA 1FHLA 4LFYA 1TZZA 3O6YX 3M0KA 3RHGA 4IUOA 2G41A 5LIUX 3PAOA 5IBXC 1QI2A 4R88A 4W86A 3THUA 4R9XA 2O7QA 3MMWA 1FDZA 1Q66A 3TKFA 1KCKA 4KT2A 2Y61A 1L8NA 3TQVA 4B92A 1C8XA 4ZQPA 4NJJA 4HVXA 2GUUA 4GYKA 3MMDA 1MW1A 3IIZA 3OBAA 1QI5A 1P7TA 2YDAA 1XIHA 1P4CA 1SM9A 1DJZA 4I90A 5I2UA 3TJLA 3ABRA 3VIPA 2FZDA 4JTFA 1NOFA 1TTIA 1VLWA 2BVWA 3WBWA 3UR5A 2REQB 5IOBA 4F2UA 1XS2A 4XIMA 1E0XA 3K1GA 3W7LA 3I6RA 3FSTA 5I77A 1QFEA 4XAFA 5TIMA 3S8HA 1WV2A 1YIXA 2FFIA 2O56A 2QULA 3EWCA 4JN8A 5JBEA 1MEIA 4UC5A 3IUIA 3H2AA 4DX3A 4B5TA 3CIWA 1LQ0A 1EC8A 5DMLA 2YXOA 4Z2LA 4GQQA 3UETA 2NV9A 2HRWA 3DI0A 3MDUA 3U2OA 2ODOA 4K6AA 4MJ4A 1Z7AA 1UB3A 1R2SA 3M64A 2V82A 5DRIA 4ZO8A 1RHCA 1KQYA 2E25A 4CD6A 2PRMA 2TPSA 1HKMA 3N6JA 4ACZA 3WKZA 2X05A 1ZALA 2A3CA 4HQVA 3QYQA 3VDBA 3FOKA 3ZS4A 1WP6A 2Z25A 4MNJA 3AXHA 3FCPA 5XIAA 4NI3A 3AZRA 3E5PA 3CV1A 1Y8BA 4MFDA 4R7OA 3MUY1 1VFOA 3LU2A 3VD7A 3LZ5A 2XSBA 3ATZA 4DBWA 2PWVA 1SJAA 4AD4A 1D3GA 3NEVA 1D3HA 2V0TA 3KLKA 2XTKA 3T44A 2ZZ3A 3PG8A 4IGHA 5A94A 1R30A 3A4WA 3CO4A 3RU8X 3FYPA 3RN6A 3IAQA 1WX0A 2DSWA 3NSNA 4ALDA 3QN3A 5EBUA 1PYMA 1HKIA 4C6MA 1Y5VA 5T9BG 1W17A 4IT1A 1CXKA 4K39A 1RVKA 1E5NA 1VR6A 1ICQA 4MWAA 3GR7A 3MB9A 3QGKC 2QCLA 1FHUA 3BOFA 2X40A 1W54A 3IRDA 2VENA 3ID7A 4L65A 2F6KA 3CASA 1JD9A 3T7VA 3QZ6A 3MP4A 1KKOA 3WK0A 1PPIA 2OOFA 1YKWA 3IARA 3XIMA 3FYOA 4O16A 3AYTA 2HVMA 3VM7A 4E3VA 3VKDA 2PMQA 1V6TA 2YLAA 4ZOCA 5B7ZA 1W3KA 4TO8A 4GUJA 4AZCA 5CC7A 1QR7A 2C91A 2J8TA 4B2DD 4P7QA 4WGHA 2ZUSA 3GDMA 2F38A 2F9RA 3W7QA 3GHSA 3N3MA 3QLDA 4IF2A 1ECQA 1NWTA 3NOYA 1X38A 1LG1A 4Z1YA 3JUGA 3DC8A 3TQKA 3R8GA 4AC1X 2EPMX 4FNQA 1D7KA 4GYPC 4PRTA 3GG1A 2OR2A 4WDWA 4B5UA 9XIMA 4LYPA 2WSYA 3ARUA 2GDVA 2NQZA 4FNSA 1JZ4A 4GJIA 3ES7A 5CZ0A 3L66A 5FOOA 2ZXBA 2QJJA 1EJWC 2PBOA 4O53A 1HL2A 5DXXA 3U5YA 4KCTA 1G7VA 1WDQA 4HJFA 1F73A 1H7XA 3HG3A 1B4EA 4RPPA 1N8WA 1X7IA 1EP3A 4PEEA 4NUWA 3VE7A 2OZ0A 2P3EA 4PH6A 4UUIA 1KO0A 2Y63A 1FCUA 1JDDA 2NUWA 1PIFA 1UUQA 3O07A 3W2KA 2WSQA 3VOIA 2Z7GA 3DFSA 4XZIA 5FJJA 4DF0A 3TONA 1XI3A 4ZSTA 5D8ZA 3WUFA 4EPDC 1MRQA 5H8MA 2YL6A 4GC4A 3AC0A 1S5MA 4GVFA 2F84A 5HANA 5I79A 3TNBA 4E3TA 1Q2SA 1RALA 3LOTA 3WH5A 5F1VA 3LGDA 3DHFA 2IPJA 4HN4A 1CNVA 4H2CA 3IVTA 3WLRA 3C52A 4BFAA 5LXXA 1SFSA 4QSHA 1CT5A 1E6NA 1VJSA 4J2MA 4ZE4A 4O1DA 3R10A 4UTLA 5FF0A 3VIMA 4M24A 3GU9A 1DWJM 2QAFA 4F66A 3GM8A 1GTEA 1OFOA 2PC4A 2WVSA 1CB7B 3OVQA 1XR2A 1TIWA 1XDMA 2V3GA 5FJTA 3CL8A 4ES4A 4I9AA 4I8YA 3WBYA 3EDDA 2H9AB 1QK2A 3WNLA 1NU5A 3G22A 3MSGA 3GDRA 2V9DA 3WQPA 3FDKA 5AB3A 2W27A 3FA4A 1LBFA 4OOZA 1Q4NX 1EA0A 3W22A 5TF0A 1K7XA 2PGFA 1BRLA 1XHGA 3OIXA 3WYZA 3GSMA 3EWWA 5A6BA 3QY6A 3SADA 1PIGA 3DENA 2HTMA 3V5OA 3EX6A 3NA8A 3FGCB 4IUGA 4WY0B 2QF7A 3P61A 4JYFA 3BL3A 1SZGA 4QTGA 3IJ8A 3W28A 5I7GA 1KWKA 5K4XA 1OCQA 4MKSA 5KSWA 1QXLA 3CH9A 3FYYA 4NAFA 2DSZA 4LALA 4M6PA 3LCGA 5E0KA 3RITA 4P5UA 1QUMA 3PM6A 1WZKA 2Z1VA 2XZ7A 3WQWA 4XUGA 4N6FA 1S2CA 1NY1A 4ERIA 1VYPX 4QS5A 1NWUA 1ZFJA 1MYRA 1EUNA 1D3CA 5BROA 1WOAA 1A5MC 5CPSA 3RILA 2PDHA 3TC7A 3WD4A 4A8IA 3B8WA 1UD8A 1QHOA 2PI6A 4H19A 5AYYA 3FEMA 3QW3A 3UJEA 3RMEA 4DJEC 2J8GA 3AJXA 4JHMA 2XDFA 5BXRA 1NJJA 1CXEA 3MV01 7TAAA 2J9YA 4N9BA 3TC3A 4JBRA 4B15A 4Y7EA 3ZLFA 2WC4A 3STEA 1P6CA 1NP0A 3BCFA 4H2HA 3DZ1A 5XIMA 3W7NA 4M6UA 3C3UA 3M0ZA 3T0TA 5AZ1A 3CL6A 3TX9A 1P48A 3RRXA 3UD6A 1JVNA 3SCUA 3N2OA 2WVUA 4J3WA 3G3MA 3SIZA 4H6KA 1FWRA 4HK6A 3PVFA 3QPYA 1M65A 3UYCA 4H9TA 2UWFA 1S2WA 1XX1A 3VABA 4TV5A 2O0TA 4X2PA 1W1VA 3PTKA 2VDHA 5F2GA 2GGGA 1EKOA 3W9ZA 4QS6A 3AIBA 3VGDA 2FVMA 2H3BA 3E5BA 2Z0IA 1MZRA 3T0DA 1SFTA 1YDNA 4RXGA 4RZBA 4BWLC 2XGBA 2VX4A 2P0OA 1XLLA 4P8VA 1GVSA 2PWFA 4ILSA 5FESA 1VIZA 2VZOA 2XFWA 4RE3A 2WLYA 3EX3A 1IR1A 5BZAA 2A7PA 1JDAA 3TNOA 1J6PA 3M0YA 4P8WA 3UNTA 3OODA 1TR9A 2ZZ7A 2ZC8A 4UTJA 3MUAA 4GVHA 1EP2A 4I7UA 3LSCA 4ZTYA 1K9FA 1G5AA 2XWEA 2Z4GA 2GL5A 3GTFA 4GXPA 1BWLA 3MUCA 3PWGA 1TWIA 2PTDA 1VBUA 1Q63A 2BY2A 4IOTA 4DJDC 1UYQA 3SRFA 4JY8A 1R38A 5CPTA 1OB0A 1V08A 4GACA 4RZ6A 4FA3A 3T8LA 3OHMB 4HU3A 5FACA 3C8FA 2QIIA 5CSRA 1BKHA 4JQ1A 2VWSA 3W1TA 1V6XA 4ZTXA 3W29A 4X0NA 2KX9A 4FOKA 1SO3A 3WBAA 4CN1A 3UWUA 3RO6A 1POKA 5IFPA 4LVAA 3EWYA 1AVAA 2WWDA 2VP8A 5I6SA 3UR7A 1E6RA 2VVNA 5ABHA 1JZ3A 1C9WA 4Z2JA 4UTWA 5FA5A 3W1PA 4S1FA 4US5A 5HJLA 1KLYA 3L68A 1UH4A 3KVJA 1RY8A 2HEJA 3NVTA 4QAIA 4IJBA 3NDOA 2V2DA 4LVGA 4PUNA 4W5ZA 3KFTA 1U5HA 1JYNA 2V5BA 2QUNA 1RAKA 1VFFA 3A4XA 3LG3A 2PRLA 1J6OA 2WVTA 4NX0A 1S3HA 5JQ9A 2J75A 4CVUA 4DWSD 3G1RA 1PB0A 1HG3A 4KGLA 4PB3A 2PCQA 3BQ5A 3KVMA 4IM4A 4W93A 3W81A 3CNYA 1ONEA 4NXKA 3CIXA 1V6VA 4P8UA 4FX7A 3W24A 1OGBA 2PC8A 3EA2A 2JKPA 1O12A 3CHFA 1XYMA 2FQIA 1E1CA 1SVDA 1AJZA 2C18A 3LUTA 2PDCA 2CCRA 2Z26A 4LCQA 1XLJA 5EY5A 1N8FA 1JFHA 3BJTA 3S2LA 3GG7A 5AVHA 3S42A 2WC3A 3QOMA 4WSJA 3SFWA 3NUKA 3CEUA 1AD4A 1VFSA 1CENA 1UKSA 1BWKA 4HCDA 5A5WA 5CPMA 2JQXA 2EXOA 2R8WA 3APTA 2YLLA 2Y5EA 4MM1A 1ZBWA 3TA9A 1TPDA 2XN0A 3WDPP 3VIKA 2WPBA 1UOZA 4HYWA 4PUDA 1CZ1A 4HNCA 2YCLA 1OGSA 3TYZA 2GOKA 3IK2A 1JCTA 3R0DA 1VFLA 2BOGX 2Q02A 2PA6A 1ZAIA 5DBUA 4ZMGA 4AFYA 3WH6A 3A9BA 4UBPC 4JNYA 1ZY9A 1NOWA 3HO8A 3ZR4A 3R43A 3W85A 1Y0EA 2UY4A 4IGSA 4O1BA 1V0LA 1IT8A 5E9XA 2DH3A 3W25A 2QCDB 1TJ1A 2P53A 2J7EA 2YCEA 2ZBTA 4JICA 4AISA 1W1ZA 5HMSA 4ATLA 1U1HA 1EIXA 3BDKA 1EGMA 2A6NA 3VOGA 4D2JA 3ARVA 4UTHA 2AKMA 4R27A 4XIAA 5I00A 3O3RA 2ZX6A 4YYFA 2RDTA 4NZ1A 3ABOA 3QPZA 3MANA 4X9SA 3BAXA 5LNWA 1YPIA 2BGSA 5CZTA 4DN1A 3W26A 1EJ7L 1TE1A 5HNNA 1QWKA 5HQMA 2GQAA 3SSJA 3H7UA 2GLKA 3WQOA 4W84A 1MNSA 1PKLA 3U7VA 1VFMA 3LTPA 1WDDA 1RK6A 1W32A 4JHZA 2I57A 3SCRA 2XVKA 4TVDA 3CZEA 3TSMA 4ZODA 1JGIA 4CD8A 2INFA 4LRTA 1MQPA 1IGWA 3OLIA 4OUIA 1V02A 1TWZA 3TYBA 3VUSA 3HGJA 4C7DA 5I5RA 5ABEA 4C5ZA 1JF5A 5I3JA 3USZA 5EMUA 1KNWA 2J8FA 2I5GA 3W72A 3CAKA 3W6YA 3QKZA 3IACA 4IXHA 3GXNA 4YVPA 1DWIM 5L9FA 3W82A 4O14A 2CKSA 2FKPA 1GHRA 4L6HA 1TV8A 4KFOA 4EPBC 1A5OC 1MZHA 1JUBA 3R2GA 3UU0A 2E4TA 1EZ2A 5K9XA 1W8SA 4PUEA 4O4WA 4R5EA 3QH2A 3AXXA 3IANA 1NIUA 4ZBCA 1FTXA 3I10A 1EDQA 1U30A 3HTWA 2PLMA 4IQEA 6XIAA 2FH6A 2J77A 3ARZA 4KW2A 4XG1A 3ZYZA 2DQWA 3S2MA 4QLLA 2TODA 2RUSA 4FLRA 1VH7A 3W7DA 4RJEA 3KRBA 4AIUA 4XZWA 1L2QA 4IX2A 3L4TA 4K8HA 3STPA 3ARWA 1XSJA 2D20A 4HJWA 3AOFA 3RJYA 1EGVA 2PDJA 1LM1A 3A3XA 1R7OA 1UP3A 1CXFA 3VCNA 3P62A 4J3VA 3VD9A 3CPRA 4GGBA 2RJGA 5M17A 1NDYA 4J3SA 2AMXA 1J79A 2VXNA 1Q6OA 1ISVA 1EBGA 2V3FA 3TJXA 3WLNA 2C79A 3AMKA 1PHQA 3NO1A 1HVQA 4L9YA 5LIYX 3OZOA 1S3TC 3IJDA 2PLJA 1DQUA 4A3UA 3GXDA 2Y4SA 3UW6A 1S1RA 3SAZA 3PG9A 5AYIA 3SRHA 2OVLA 1EJVC 3W74A 4K1GA 4Q3MA 3RX4A 5D2TA 3BVJA 1G67A 5I06A 3T0BA 4WDTA 4CU8A 4W85A 4OKDA 4O0QA 5FL1A 1NF7A 1EWDA 1X7FA 1L9WA 1NQ6A 2VVSA 3L4YA 1KXVA 1VS1A 4KPLA 4JGDA 4MAVA 2VGBA 4PFMA 2PAJA 4LXFA 1EX1A 4HZMA 4X60A 3CHEA 2D22A 1QVBA 4JTSA 2Q8ZA 4GIYA 3A24A 1KXTA 4V27A 3M46A 2J66A 1FOBA 3RRAA 4C6IA 3N1AA 3FFSA 1MQQA 3NXFA 3WLMA 2PTWA 3B04A 1XKJA 2CLMA 1VFTA 1YDVA 1F76A 2X0HA 3DFOA 4GKTA 1JYVA 2DZSA 4ZOAA 4MLJA 3IGUA 4R9OA 4LANA 1EYWA 2BFGA 4HYRA 4EACA 3LA4A 1XD1A 2WC7A 3W70A 1JDCA 2EO7A 4S3DA 3BZJA 3QBUA 1JCNA 1DJIA 4PMOA 4QISA 4P7RA 5AYZA 3WNOA 3THCA 2G3IA 2ZFAA 4MWAC 3RGTA 4HSOA 3TJ4A 4JD4A 4L1WA 2OYLA 5A6TC 4ZXLA 4IMAA 3DU0A 2P5NA 3G77A 3F2BA 2RAGA 4PMJA 2PUZA 3GXIA 3PUGA 1KWGA 4G1KA 3LSBA 1ECEA 2PFHA 1B3VA 1JQXA 2OQLA 4O1AA 3O8AA 3F1QA 3P93A 3QC3A 3GNOA 3GO2A 1MO0A 3URAA 1PO9A 1L6SA 4WXYA 3MMUA 4XVEA 4DYEA 3TE9A 2R6OA 4NL1A 1L8PA 5CLWA 4HN8A 4GNVA 4Q32A 3NG3A 1HGWA 3R6IA 1GGOA 2C0HA 1HIZA 1TUFA 2V81A 4H00A 2VR5A 3AI0A 1A47A 5DXYA 2WMJA 1MRAA 3VOFA 1NF0A 2ZZ5A 3R0UA 2YBUA 4BQ2A 4DBEA 5A6JA 2PGEA 3DFNA 3TUUA 1GHSA 3LMZA 4MIMA 3QZAA 2H3DA 1RK5A 3VZYA 4U33A 4Y9NA 1UH2A 3W1RA 1DWFM 4PE8A 4WGXA 1KBJA 1MEHA 4HPNA 4B5VA 1UR3M 3IEBA 3MBDA 1DIKA 4ZVJA 1LLZA 4L5ZA 4MDOA 4S3BA 1OK6A 1IWPA 3H2NA 4JQ2A 4MB1A 3ITGA 2QPUA 5HWJA 2RDUA 4W8AA 3T2PA 2DVTA 4RL3A 1UWIA 3LPFA 2XVGA 4JTUA 1BF2A 1HF6A 2UZ9A 1VBRA 2FMOA 1V79A 1XYBA 3OLGA 4WY0F 1ELSA 1I75A 2OO0A 3TCSA 2GQ8A 4BZYA 2JGYA 4GIAA 4GRSA 1US3A 1XLFA 2HS6A 3A13A 1HP4A 2ZUVA 4K7VA 2Y6ZA 3B40A 4NILA 3WQ6A 2XU2A 3K2GA 3MVTA 4Z0SA 5BW6A 1GG0A 4J27A 1L2UA 2GVJA 1LL4A 1HL9A 3W71A 3S6TA 3UPWA 4XAYA 2ISSA 4DZ5A 2EEXA 4B9ZA 3AMLA 3MKKA 1ISXA 1GVIA 3SO7A 5G4EA 1DV7A 1B0IA 1YBQB 2PDXA 2PWEA 3EX1A 2SFPA 5AHFA 3CQHA 2CPUA 1YE6A 2BY1A 3GHUA 1NARA 4S3GA 5DCDA 1RPXA 1A5UA 2QT3A 4UNLA 5CBBA 3QFEA 3RLUA 5HMDA 1UD2A 2NQ5A 1PTAA 3HPAA 4TR9A 4RDZA 4I6VA 2XWDA 7A3HA 1WB0A 5BRBA 3H2EA 3T1GA 2VD9A 1GKQA 3A23A 4L6DA 5CGTA 1W91A 3TR9A 3R79A 4L80A 4PL2A 2JBMA 2FZNA 4HHHA 2VZUA 3SUSA 1GVYA 5FL0A 5G2HA 3SURA 1FWJC 3D3AA 2IPGA 3DESA 3L0KA 3B8SA 3BGGA 2DSVA 1K8ZA 3PWAA 3WL0A 5I3FA 2ZXAA 2OX1A 2VGIA 3TTSA 2CNCA 2QDGA 4JTQA 4F0MA 3NJ3A 5RUBA 1F05A 1RD6A 4B5NA 2PU1A 1EHAA 2PP0A 3AZTA 2QCEA 1IE7C 4XZBA 3M0IA 2ZE3A 3QM3A 3L67A 5JBDA 2QJNA 3OLEA 3LQGA 5C9ZA 1UP0A 3NVDA 2Q71A 3VMNA 3KWXA 2QZRA 5LZLA 3T6CA 1OG0A 3FW6A 4KESA 1UR2A 1E4LA 3V1HA 2BWGA 5GQBA 1UWQA 2X0SA 4B2DA 1A53A 1ITCA 3KZSA 3SRDA 3RR4A 1JQVA 3KOYA 4E2VA 3AHVA 2HXUA 2FJUB 4ZQRA 2ZXQA 3JS3A 2ABAA 1PAMA 2BVTA 1BYDA 1DXIA 2D73A 4FHAA 1R3RA 4MHBA 4IFKB 1W3TA 2J27A 3KVLA 2YL9A 3M1ZA 3QSRA 4M7TA 4N2YA 3M4HA 5G1MA 1X97A 3MJMA 2GVEA 2VCAA 3UJ2A 5A2BA 4UFIA 1YLVA 3LDVA 3IIVA 2EG6A 3GLCA 1WKDA 1P43A 3E96A 5ABTA 2OZTA 4XO6A 2V3DA 4QX4A 1CCWB 4MB3A 2DJLA 5GVJA 4DPQA 3PJUA 4EF9A 2FTWA 2P8CA 1KRBC 4Q6JA 1ITXA 3L5LA 2OEJA 4KRUA 5FAJA 1E0WA 5A6MA 2Y5SA 3H53A 3RR1A 3PZOA 4KWSA 4ORIA 3TLLA 3S9YA 3G1HA 3N12A 4W7WA 3I7RA 3T42A 4UCGA 3T40A 3GR8A 3WDIA 3A4JA 4JCMA 1PDZA 4A4AA 4F9DA 1XIBA 2H6RA 4QP0A 1ZU8A 2ASHA 2ZADA 3L2IA 3FVDA 5AY7A 3U3HA 1EEXA 5G2IA 1B9BA 2OODA 4C5YA 1NAL1 4LUJA 3LB0A 4Z08A 2PD9A 3VMPA 4DAFA 1F3EA 4ATWA 3LHYA 3S3GA 2D24A 1KRCC 2WMGA 3N29A 3A47A 2JE8A 1MWOA 2E3ZA 4A3YA 2Q8XA 3F4WA 3W1XA 4AX6A 4PMVA 4MJMA 3RYSA 5K2ZA 1QNPA 5IDIA 2E68A 1GVOA 3VUPA 2XZ9A 3WH7A 3HB9A 4MPQA 1UOKA 1UKQA 3V0SA 2E9BA 3VINA 1UMYA 1UROA 5DCEA 1OFPA 3PSVA 3ANUA 3R8HA 3UNDA 4CQ9A 1JZ6A 2Y7DA 1M03A 1US2A 2UY5A 4RK8A 4AMAA 1UR9A 1J0KA 1YTDA 3HMCA 2VFIA 2ZZ6A 4E2BA 2FPVA 2X1UA 1IYXA 4Q8MA 2QS8A 3GTHA 5CAHA 3ZLGA 2Y88A 4UTWC 3FN9A 4X3ZA 4D8ZA 2Z28A 3AHXA 1AH3A 3GXPA 3O05A 5LNSA 2ZRYA 1BKSA 1RH9A 1TRDA 3PUDA 1NDVA 2FJKA 3TA6A 3TYDA 1XLEA 4FNRA 1P7TB 4XZMX 3EOOA 2ONEA 4TQTA 4QE5A 2QUMA 4LVFA 3QW4B 1QI0A 6CGTA 2EPLX 1IXQA 2RHGA 3IV8A 1F4AA 2VD8A 1E6PA 1JPIA 4M3PA 2NUYA 2BVDA 1XLBA 1FWWA 2I7GA 3AMGA 3H2FA 1L6WA 5D8WA 5D2WA 1E6QM 4C1KA 4AIEA 3C0JA 1TPFA 2J13A 1KRMA 2ZX5A 1A5KC 3N9RA 1VJZA 1JCXA 2O9TA 4AC7C 2NT1A 4C6BA 4S3AA 4OE7A 4UFLA 5BMXA 3VCCA 3GYEA 5A95A 3ITTA 3R25A 5HK4A 2ADAA 1Y7VA 2XH7A 1H5VA 4WX2A 2OWXA 1E6SM 2JIEA 1O5QA 3N2BA 4JFVA 4GUIA 4MB5A 1GUVA 3ZVIA 2X1RA 3FNDA 2G96A 5CSYA 2DUZA 2FZ9A 2PDMA 4BQ3A 1H41A 5DEZA 5F7UA 4N9EA 3DUGA 5AC7A 4NU7A 4JIIX 1BG4A 2TSYA 4K3ZA 4QRNA 1HFBA 4ACZB 4KMQA 4PRRA 4C6NA 1FP9A 3LCHA 1QPOA 1RQBA 3E0WA 4EPKA 3QV9A 3PY2A 3G3DA 1K1DA 3OQEA 2OX4A 1VFUA 4Q8VA 3RM8A 1UWUA 1AG1O 1PKMA 3LRKA 3ABSA 1GQJA 3V3WA 1JNEA 3IGHX 1RPKA 1B31A 1KM2A 3L12A 1E51A 3GNRA 2WJZA 3JZUA 3TC6A 4OIFA 1E55A 1FWEC 3DHDA 2QCMA 5C9UA 1P0KA 5FEPA 1PWMA 2OO6A 2G3NA 1H49A 3W53A 5LIKX 1QPQA 3OU8A 1A5NC 2Z00A 4M19A 4LS0A 3PZVA 3N17A 4M0XA 3LGGA 5CPQA 2BV9A 1WA3A 2TAAA 4Q7BA 2GJLA 5DFAA 5BXSA 3I4EA 4OV4A 2BGNE 1NTHA 1O60A 4I5RA 4TIMA 1PKYA 3EPMA 2BHZA 3FV9A 1UIOA 2GQ9A 3THDA 1QTWA 3UZJA 3W7GA 1JPMA 2PP3A 4P2VA 3S5NA 1T99A 4XWUA 3DAQA 4LC6A 3H2OA 4YTRA 3RX3A 3CB3A 1MUMA 2VZVA 1QMLA 3REQA 1KXQA 5A69A 1UR4A 3IJLA 5A3HA 1TZ7A 3KBJA 2GK1A 1FH9A 4LSBA 1XLHA 1LRQA 2PDFA 3UPMA 2Z27A 1R3SA 3CZLA 4FXRA 4Q4PA 4GNKB 4W9TA 4GK8A 2WQPA 1UR8A 3T05A 2I5IA 2V63A 3DFQA 4AWUA 2VEIA 2GSEA 3UZZA 4HOWA 3PC0A 4C7FA 3DH7A 3AQUA 5KTLA 5LSMA 1MXGA 1RCOB 2Y8VA 1Z8AA 2QGYA 4QAWA 3GK0A 4X63A 2QCFA 3MZNA 4DWSA 1YDOA 4LVDA 2CXGA 1YE4A 4F8XA 3WQGA 3ZT7A 4OHQA 4QCEA 2IKIA 1E0TA 1VLIA 3BG9A 3WF3A 1J11A 5HMEA 3CMJA 4ROPA 3KRSA 3WZ0E 5KZ6A 4HBKA 5T26A 3CV2A 4R7WA 2GGJA 3UWWA 1PWLA 4WSHA 3S1XA 4DHGA 3N4EA 3ZQ9A 4JTKA 1EJTC 1XLAA 1U2YA 2VZSA 3EKGA 4KEUA 2QUUA 3GVRA 4I9TA 4WVXA 1G4TA 3WDJA 3OVRA 3MY9A 1S39A 4KRTA 1S38A 1W9BM 4CD5A 4JIPA 1ZLPA 1PSCA 4NZCA 3S1GA 4S38A 4S2BA 1LWHA 3DYOA 5T91A 3G0XA 4X61A 2CLOA 2DVUA 2QKFA 1LORA 5I09A 3TP4A 1I0DA 1HKJA 1V0NA 5JUVA 3VNMA 3AU2A 1DIEA 1K03A 2NXGA 3ITCA 4X0VA 4GQRA 3KVKA 2GZXA 3AS1A 1DJYA 3WO8A 3LI0A 4IMGA 3UJFA 4FO4A 2EQDA 4NAEB 4GQ0A 2XGIA 3WNPA 1TRIA 1V3MA 3FS2A 5HUOA 2PE4A 2J9ZA 5MKGA 1YNQA 4CEXC 3D6NA 4A8LA 3IWPA 1JCYA 3H22A 1WDSA 2A5HA 1ONRA 5E0CA 1RBAA 3E02A 3UG3A 3TOPA 1BRLB 2PSNA 2POZA 3TH6A 2CW6A 2EJ1A 3TTYA 2JGQA 1HJUA 3HGSA 4MNKA 3FHAA 2QEZA 2Y62A 3NQBA 4FPSA 3G1SA 3IGSA 5D37A 3S0CA 4XKMA 1R6WA 2OKTA 1XLIA 3DERA 4C6PA 1XJBA 4AZ5A 3LCWA 3AYRA 1XUZA 3BAKA 3PF3A 5CC6A 4O1FA 4HOXA 3ABXA 2W79A 3CUIA 5DN1A 1C9DA 2WMIA 3FHQA 4REQA 4AD0A 3MDWA 3UJSA 3D47A 1HP5A 1UW9A 4DM2A 4NAFB 2A3EA 2EBNA 2PDWA 4UB9A 3UZWA 1F7BA 3QQ0A 3VNLA 3KUMA 3NQ7A 1XP3A 5HBFA 4FIQA 3TN4A 3GG0A 2OT0A 3ITVA 3VKJA 2XFYA 2QMJA 3POCA 3SN0A 1HJQA 2VFDA 5LGZA 4DAIA 1DE5A 2QV5A 1Q6RA 4XZNX 3BLEA 8TIMA 4Z42C 3GW3A 2G4JA 4KCUA 1LRNA 2NX9A 3KEHA 3M0LA 2CWNA 3T4CA 3LM7A 1IEXA 1ZP3A 1TV4A 4EOUA 5CC5A 1K70A 2XVNA 1CGWA 3WUBA 5I23A 4Y9MA 2QCCA 3SQSA 1A4MA 1WZMA 2W62A 1WDRA 4HYVA 3FA3A 4ICCX 5D9NA 1I2PA 1QK0A 5I3KA 3SCTA 3PUEA 3VI2A 4O8RA 5EMKA 4DF2A 2DT1A 2QUTA 3M7WA 1G4SA 1OEPA 4HNOA 2J25A 1DWGM 4S3EA 5I3DA 1BWVA 1Q6DA 1DHKA 6REQB 2IXVA 3FXGA 4L64A 2GOUA 1SO4A 3S1VA 5C2CA 4DXKA 3U7BA 3VGHA 3MA8A 4XX6A 1WNOA 4K1WA 5FAGA 3TTQA 4AEOA 4QJ1A 4Q4OA 2YL5A 3M07A 1EJRC 1W1PA 2BZNA 3EB4A 4O18A 3WMBA 1M1BA 3CUZA 4PTMA 3R11A 1ZCOA 3BV4A 4DUXA 3NQDA 2J24A 4MGGA 2RDWA 3WDQA 4O28A 4D6DA 1JZ8A 4JTLA 2ATSA 2YW3A 3N14A 3Q65A 3QEZA 1ZL1A 4BS0A 4AD2A 1HTIA 4UQ9A 3HF3A 3HQPA 3NXLA 1Q6LA 2XH4A 3ZVHB 3LBCA 4XZ9A 3SGUA 4CNOA 2GGIA 3BE7A 4GX8A 2IMRA 4G7FA 3GWQA 4M6QA 3N19B 2BASA 4HZ7A 4CVWA 3ABZA 1PKNA 3HZ3A 1XH1A 2Y8UA 4UR8A 3O2LA 3UESA 3WMSA 1CGXA 2VC9A 2WM0A 1TJ0A 1K8CA 3V7PA 1WXYA 5GPRA 3LLFA 2QHAA 3VNDA 3W1MA 1CGVA 1J96A 1R9YA 2IXUA 3UR2A 3NCOA 3QZEA 3NGJA 3IS4A 2G8ZA 3BAIA 3EWXA 4NZ4A 3WLHA 3GHTA 4GG9A 2BBFA 4BA0A 3EWDA 4LPCA 2R91A 1V5XA 3NZQA 4Z1BA 3WF4A 3RMJA 4GI8A 4CNPA 1O7AA 4LS1A 1XDJA 3SUUA 1FUYA 2WSRA 5LIWX 1FQ0A 3NZ1A 1H7NA 2WKJA 2WK2A 3W7OA 3P60A 3W83A 4A8RA 4GVGA 4C6CA 4BK9A 1K6WA 2YCJA 5F4SA 4PMQA 1RUSA 4FNTA 1FY6A 4MKNA 2HE5A 3VOJA 1MVYA 4WIWA 1SFLA 2OQYA 4FALA 2IW0A 2ZWZA 3NSXA 4DNMA 1H7WA 4AWSA 5G1TA 1AJ2A 1XC6A 4AB4A 5DMYA 5DANA 1SMAA 3K8LA 1EPXA 4KCWA 1W56A 4JL2A 4C7GA 2HNEA 3H54A 4QJ4B 4E8CA 1A5AA 1G4PA 2E9MA 4G56A 5KZMA 4J40A 5GNYA 3N15A 5CC3A 1OQFA 3BLKA 3UXIA 3C0SA 2XFRA 1UMLA 3O1NA 4HTBA 4MY8A 3ORWA 2HV5A 4HIBA 3NL2A 1PCKA 3WQFA 2XYLA 4TVUA 4DBUA 3POHA 2B7OA 4RDWA 4IP4A 3H2MA 3SM0A 3TDFA 5LNUA 3QQWA 4L9ZA 2X1SA 2YFNA 3VNJA 2WYSA 4MB4A 2ZTKA 1O94A 4NKCA 2PDUA 3VKAA 2YYTA 2EKCA 4LV4A 4BF7A 3VGBA 3ARQA 1JZ7A 4AIOA 3SI9A 3OVGA 3V1PA 1WZLA 1NDZA 3ICJA 5EMYA 5C54A 1H7PA 7ODCA 4AWEA 2ZYFA 2D2JA 4S2CA 4F0RA 3NQ8A 2VOMA 2AAAA 2HCVA 3BWWA 5TQLA 2WCAA 4LUTB 4GCAA 3OZPA 4QG9A 1DWAM 1OSEA 4B5WA 3M7SA 3G0SA 1GOQA 4Z1DA 2G3MA 1OT1A 2BODX 1V7YA 1H0GA 5FF7A 1ZHAA 4B4FA 1J93A 2O4MA 2VX5A 4GO8A 4BY3A 1NFPA 2PDGA 5BRQA 6TIMA 1W6TA 3A64A 3KBWA 2NQ9A 1B30A 5D33A 1XQLA 1D9EA 4L7ZA 5K3VA 1V3LA 3PFRA 7REQB 3GKFA 3W01A 1XIMA 4H9MA 5HXMA 1BTCA 3OTRA 9XIAA 5H2ZA 1L6GA 3IJ6A 1F9CA 2CLKA 3VKBA 1TQJA 2E67A 4KKXA 3QMTA 1IXNA 3G6MA 3MZ2A 1Q4WA 3TLQA 3KOWA 2ZZ2A 4H8UA 5HA7A 4UIOA 4DB7A 3R7MA 4AYSA 1J0JA 4ROQA 4O10A 1LUCA 2A3AA 3B9NA 3VVGA 4PCTA 3F5JA 4E0CA 2REQA 4HTYA 2R9RA 2ZA2A 2GVYA 4XD4A 2TYSA 1Y5WA 1DVJA 3LCIA 1Y5XA 3CGTA 3AWOA 2FTPA 2CIPA 2E40A 2FHFA 1YMYA 3PZ9A 4D6GA 1PYFA 4N4QA 2PLCA 1XBYA 1E9IA 4M1BA 3RUBL 4HP5A 1HVXA 4L4LA 1A0CA 1Z48A 2FVLA 1EDTA 5AC4A 3TXVA 3NR0A 5FEZA 4WDXA 2PURA 3CLMA 1EHNA 1LL6A 1JYXA 3KX6A 2F8QA 2YKKA 3ERPA 2C1IA 5DLCA 2VWTA 1KFJA 4C6EA 2OWWA 3RJXA 4CNSA 4MUPA 1XF0A 3HU7A 4XD5A 3S2NA 4UR9A 1E40A 1CGTA 4LUYA 3LPPA 1H1NA 2NSXA 5EU9A 4U10A 3UP8A 2XH0A 2V38A 2CKRA 4YCOA 4MJZA 3EAUA 2YGYA 1IEVA 1W9XA 4GXMA 4H8VA 5AYXA 1XICA 3NYZA 5I3HA 1TPC1 3EA1A 4MLRA 1XSIA 2BY3A 2V5DA 4Q8WA 2CWXA 1TE6A 3M41A 3D0CA 1H2JA 4S39A 4WF7A 1W9VA 5CZSA 1JDFA 2VMFA 1WO2A 2V6AA 3F5KA 2BOEX 3II1A 3AIQA 4DO7A 3QLLA 5IHSA 2RKXA 2QVNA 4H04A 1KA9F 4Q7NA 5C2XA 2QDDA 5H8UA 1KQZA 1KLZA 1D2KA 3BCJA 3AJ7A 4ICNA 4OT7A 3UR8A 3IRSA 2YW4A 3KCJA 5I03A 1UC4A 4TUFA 3IIPA 2DSKA 5E9AA 4EVZA 4QCFA 3CZGA 4Y90A 3ANYA 4JHOA 3CPUA 4LAMA 4OV9A 1W9PA 4Q4MA 4PUUA 3IIXA 2PEVA 1S1PA 1RBLA 1CX9A 3T8QA 2VELA 3KL5A 4IMDA 1Z42A 1GORA 1KBBA 2E6DA 4C60A 2G4FA 2FZ8A 2Y24A 4EPEC 2FHBA 4XKYA 1MUWA 2D3LA 4W88A 4Q33A 3S5YA 1ITUA 1DORA 1QBAA 3ZT5A 2VX6A 2G0WA 1RJQA 4FB7A 3S2CA 4NYUA 2ZRXA 2FGBA 4PMUA 1X8CA 5A8PA 2RH9A 3UF9A 4R34A 1SGJA 1OZQA 3UVIA 1EJSC 4DZIA 3C2RA 3W73A 3FJLA 1SR0A 4IIGA 2PLKA 3GAKA 4KEVA 2YX0A 3IAPA 5ABGA 1MDLA 4PSPA 1OX5A 3W27A 3GHRA 4GO9A 1BQCA 1OFQA 1FXPA 2BLEA 3BARA 1I9CB 5C70A 3TOYA 3SY1A 4AZBA 4JYEA 2Y2WA 4GUHA 3SDOA 1K4HA 3N3TA 1UD3A 4YIWA 3CZJA 1QBBA 2J7DA 2FPYA 4JQAA 4BQ4A 1JUEA 1PE1A 1GWJA 1G4EA 2BY0A 1ZRQA 3GYCA 1FA2A 2FPTA 1I2NA 4GVIA 4JKKA 2QMKA 2DT3A 3VNKA 1YTKA 3DFTA 4DO4A 2FGLA 2YDQA 3LV6A 3NM1A 1ISZA 1UPPA 3MVIA 1GPFA 1UH3A 3CHDA 3DCPA 4NX5A 3UFYA 4BI7A 3ZO9A 5JXQA 2ZKMX 3B4UA 5LGXA 4H9VA 4J9JA 3TW6A 3EDFA 3IPWA 1M53A 1E3XA 4P7LA 5CSSA 1Y65A 3AIRA 1IWAA 1DP0A 2FB3A 1XV8A 3PPCA 1WOBA 2WKLA 3UWQA 2H9AA 1OIFA 3AROA 4E6MA 2PD5A 4EWJA 3PNUA 5ABFA 1TYGA 1L0PA 3CPGA 1WXJA 2LLEA 4A8NA 1E71M 2DIEA 1VIWA 2NWSA 4JFUA 5J5RA 1MSSA 4KCVA 2DEPA 3RM9A 3F4VA 3WFAA 1R86A 2W66A 1UQZA 4Q8OA 1H7RA 3YPIA 3TCEA 4TX6A 4YU1A 4DWSC 5DBTA 1RQHA 2YA1A 3FGCA 4IMEA 4GLEA 4WY0A 3KTSA 4A21A 5E09A 1E70M 1LZOA 3AICA 2WV8A 4GGHA 1PJ9A 1VPXA 5AHIA 1KTNA 1OJXA 3VTRA 1XIIA 2F7FA 5DO8A 3BZGA 1GK8A 4G8TA 1NFBA 3OHIA 1RSCA 1IXPA 3TROA 5SWUA 4HB7A 3BOLA 4AF0A 4Y9AA 3V36A 3FVMA 3WSUA 3KE0A 4I5XA 5AOUA 1F4HA 5HMFA 2E1WA 3G18A 4H4IA 3SR7A 2Z2UA 4WD0A 3CAVA 1FHVA 2V5KA 3PNZA 3F7JA 4HSHA 1FRBA 3K4AA 3WNKA 1ZTVA 1OINA 1XH0A 2ZIDA 5K9CA 3ARPA 1OBAA 1AQMA 3L0GA 3LXBA 1M5WA 2CU0A 1HJXA 4NJKA 1P6WA 1P1MA 5D02A 3HQOA 5H8PA 4C91A 1XLCA 4ZL1A 4YYCA 2X1IA 1BSLA 3NFUA 3T07A 3F4NA 4QXIA 3TU9A 2NVAA 4AEEA 2GJNA 1GYNA 1XYAA 3EOUA 1XD0A 4EAMA 2XUCA 1YHTA 2DUXA 1DWHM 3K5XA 3DOPA 1IF2A 3VKCA 4QITA 5A2AA 4HD5A 3M5VA 5E70A 3UEQA 4BI5A 3CWNA 1G94A 1WZAA 3V18A 3PZNA 3ZLHA 1L6FA 4FAMA 3GH7A 5EB8A 4DVOA 3H6OA 4AZIA 2DFAA 1JPKA 4ML9A 1KFWA 1R5YA 2V68A 3E6EA 1LWIA 1EUAA 1FCQA 4QIUA 1LF1A 3SCWA 4F2TA 1QNQA 1YNPA 2CBUA 5LHFA 2OELA 3LRMA 1WAUA 5K4ZA 1TV3A 4P8XA 4PTWA 4CEUC 3SCNA 2CHRA 3P8JA 2I16A 1J12A 3VILA 3G1DA 4J35A 1OK4A 3XINA 1EP1A 3RK8A 3WF1A 3KL0A 2CEQA 3KCLA 3P2VA 4RNFA 4AY8A 1QI4A 1YX1A 8A3HA 1K9EA 3H26A 4A29A 1JGMA 3WX7A 2CLHA 4CUCA 3IVSA 3G1FA 2HISA 1BXNA 2A21A 3ABQA 2HBXA 2ZUWA 3PBGA 2OG9A 1C8YA 2Z1BA 3GW0A 1MW0A 3QC0A 3GVVA 4PB5A 3TV8A 3MWAA 1EC7A 5CPOA 3T0CA 2F6UA 5AFDA 1OY0A 3CYJA 2WKGA 4INFA 4I9MA 3W3OA 3UQNA 4YPJA 4RPQA 2Y7EA 2ALRA 4UQAA 3VX1A 2FZBA 3DIPA 3M43A 1TA3B 4NHVA 2KAUC 5BU9A 3HOJA 3VPLA 1IZKA 3CMFA 5LNRA 2R14A 5HOSA 3W2LA 3W2NA 4HA1A 1DYSA 1CDGA 1XXXA 2WSKA 2YBTA 4RE0A 4JYDA 2GJPA 4DUVA 3QHNA 1EF2A 4IXXA 4Q22A 3M6YA 1VGAA 3LXAA 1UKPA 1R3YA 1T8XA 1S5VA 3E0VA 3NURA 1E4MM 2V2CA 4N0RA 1GKRA 8XIMA 4V15A 3IJ7A 3LNMA 3GBEA 5I24A 3GXMA 1XSKA 2I17A 3EZ4A 2QF8A 2F6XA 3P5YA 3GU1A 4B9YA 3KTXA 1NH6A 5EYWA 3NOEA 3IJQA 3N6QA 3RPTA 3QV6A 2B7QA 3HFTA 2C16A 3PJWA 3PAJA 4QE4A 3TYAA 2MUCA 1BGAA 3I4KA 5A1AA 1VP5A 3IUDA 3EMCA 4AUBA 4S3CA 4KETA 5D04C 1Q3NA 1A3WA 3RFAA 1W0MA 3V75A 3T09A 4IQLA 1TPEA 4LAKA 5BMWA 1WBJA 1TTPA 3BG5A 5AZ0A 3CT2A 3O06A 2I56A 3SFKA 3TTOA 1LDCA 2CHOA 2DY3A 4XZHA 3RIKA 3WLIA 2XVLA 4KWVA 1DHPA 3QYSA 3W0KA 2P50A 1RBOB 5AC8A 1EOMA 1QCWA 2X7WA 1V77A 2QJMA 2VURA 1RR2A 5H6HA 3KS5A 2VTFA 1EH9A 1QW9A 3OJGA 3SUTA 3EB3A 3W88A 1XBVA 4J3TA 4XTIA 5K9DA 4OJYA 4B5XA 4JCLA 3W23A 3TJIA 4XBKA 5KMYA 3ELFA 3FAWA 3W7RA 4N02A 1E1FA 3UXDA 2QCDA 3W2JA 4P7NA 3B8IA 1CXHA 3T78A 1FBAA 1FDJA 1N7KA 3QQ1A 4LY8A 1YXCA 4D72A 1J2WA 3AALA 1W3NA 3GU2A 2YIHA 2IPWA 3LHWA 5J04A 5CXPA 3PANA 1DIDA 2ZVRA 3H8AA 2JKAA 3Q2DA 4FXFA 1LP6A 2JEQA 4ATDA 1RP8A 3AIUA 4HPJA 2IQTA 3WLOA 1JCLA 3TQPA 5A6LA 2W4XA 4MYXA 1ZJHA 4PUJA 1KFEA 1G01A 1YYAA 4NRSA 3N9KA 3TN6A 4IHCA 1AK5A 4TMBA 1P0NA 1BVWA 3W37A 3VMOA 2V3EA 1P6BA 4NNAA 1E73M 1PBGA 4KH2A 4MY9A 1VEOA 1LOLA 4AVFA 3GTNA 3DBNA 3S5OA 3LCFA 5D2XA 1TB3A 3CLWA 3CB8A 2I14A 6ALDA 1FP8A 2IKGA 4WLCA 1QNSA 3H23A 3ITYA 3WQDA 3CEPA 4G2DA 4CQCA 5AHNA 2E8YA 5EKYA 4IFRA 1LRTA 3NZPA 3SECA 1KTBA 5LNVA 1B3OA 5J8LA 5C7HA 2NXIA 4ZOBA 2GJRA 2GUBA 4LCRA 4KERA 4Q4SA 2NX3A 1Q6GA 3L9CA 6XIMA 5F1UA 3OP2A 2BVYA 1PXGA 3KP1A 1F3XA 4HHMA 1CTNA 4US6A 2V30A 4U2ZA 3NPUA 3S46A 3QPEA 3HPSA 3QHMA 1DQWA 1OD0A 4TV6A 1RCXB 4XSMA 4IPLA 4JIQA 2ATMA 2C13A 4MOZA 4EWND 2XIBA 4CCDA 4R33A 1NOUA 3C61A 4PUMA 4HK7A 4W89A 3ZIZA 1KR0A 2QLYA 4B90A 3SQMA 4PYSA 3CQ0A 3N9SA 2IS7A 1NVMA 5M3WA 1OFDA 3MS8A 5I0DA 2HWGA 1E0VA 5IFTA 4HMEA 3SIMA 1AFSA 4QNEA 5FEWA 2AAMA 3W7HA 2HPMA 3OLDA 3W7JA