2GSJA

Cdna cloning and 1.75a crystal structure determination of ppl2, a novel chimerolectin from parkia platycephala seeds exhibiting endochitinolytic activity
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
271
structure length
271
Chain Sequence
GGIVVYWGQNGGEGTLTSTCESGLYQIVNIAFLSQFGGGRRPQINLAGHCDPANNGCRTVSDGIRACQRRGIKVMLSIGGGAGSYSLSSVQDARSVADYIWNNFLGGRSSSRPLGDAVLDGVDFDIEHGGAYYDALARRLSEHNRGGKKVFLSAAPQCPFPDQSLNKALSTGLFDYVWVQFYNNPQCEFNSGNPSNFRNSWNKWTSSFNAKFYVGLPASPEAAGSGYVPPQQLINQVLPFVKRSPKYGGVMLWDRFNDLKTKYSSKIKPSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein PPL-2
publication title cDNA cloning and 1.75 A crystal structure determination of PPL2, an endochitinase and N-acetylglucosamine-binding hemagglutinin from Parkia platycephala seeds
pubmed doi rcsb
molecule tags Hydrolase
total genus 99
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2gsjA00
3VOCA 5CXPA 2DGAA 5ABFA 2JE8A 4EANA 3TP4A 5E09A 3AIRA 3MV01 5IFTA 4RL3A 2WMHA 1CDGA 3VTRA 4D6HA 3AMGA 1X6NA 4QLJA 5BXSA 4U2ZA 2YL8A 1LL6A 1JDDA 2ZUUA 3TONA 3N11A 5I79A 3CUFA 2J62A 1XSKA 1CLXA 3DHPA 3A6OA 1VF8A 1K6AA 2YLLA 1HKJA 3AOFA 4MJ4A 1CEOA 2EPOA 1NQ6A 3FAXA 2E4TA 1SMAA 4CU7A 1UR4A 1EHAA 1XCXA 4QFUA 4W93A 3E1F1 3WUBA 3CTTA 3QHOA 1M01A 4JFUA 5E0FA 1V0KA 2EPNA 3WDHA 3CMJA 1PZ3A 3BCDA 1QI4A 2ZIDA 4LX4A 3CMGA 4F9JA 4S3KA 1QHOA 2DPEA 2WZEA 5FL1A 4UFMA 1OGBA 5D8ZA 2XVKA 3WQWA 2OYMA 3WH8A 5I24A 3W37A 1MW3A 2FGZA 1MQPA 4WLCA 1BFNA 4HPHA 4TVDA 3ARQA 1XH2A 2UY5A 1V02A 3WMCA 3M6DA 4TXEA 3NDYA 4C7FA 1GJUA 4XV0A 3TTYA 3BAKA 1DHKA 2G3NA 2YDSA 2CKSA 4GQQA 4BS0A 4CN6A 4UQBA 3CZLA 1C3FA 3DYOA 3IAPA 3MUZ1 4PMUA 2ZE0A 4J3VA 4V27A 1H0GA 3WSUA 3GH4A 1PAMA 4LQ1A 1XH1A 2GK1B 3NCOA 4ACZB 2C8NA 2CHNA 3A4WA 4CKQA 4DM2A 3W81A 1D7FA 1Q6GA 5FD0A 2A3CA 5DF0A 2UY2A 3KE0A 4H8UA 4P8WA 2ZX6A 3W53A 1YQ2A 1SFSA 4AEFA 4HMDA 2CITA 3QR3A 3AMLA 1CGUA 3DECA 2XYLA 3CUHA 1K9FA 1IT0A 3FN9A 3VM5A 1GUVA 3CH9A 4ML4A 4PMNA 4MTVA 3UG4A 2BHUA 4HU8A 4KGLA 3PZGA 2O9TA 2W63A 3VU2A 2ZXBA 5CLWA 2XWEA 2VOTA 2PWDA 1R7AA 5KZ6A 5TD4A 5A6BA 1ISZA 4MNMA 4J3TA 3ZJ8A 1MWOA 4CCEA 3AHXA 4E2OA 3WD1A 2ZX5A 4J27A 1UD5A 4J28A 5CJ5A 3PZNA 2QV4A 2V5DA 3A47A 4H8VA 1B30A 2DH3A 5ABFB 3RMEA 1XSJA 2WZHA 3TOPA 2VL4A 3DHUA 1V0MA 2DEPA 5CGMA 3LPOA 2VJXA 4H8HA 1R87A 3OBAA 4U31A 2GFTA 2WHLA 4PN2A 4OOZA 3OGVA 3LPGA 4UFHA 3VD9A 1W2VA 4YHGA 2W61A 1JZ7A 1WNOA 3AJ7A 3THDA 3GBEA 5IHRA 3FXYA 3MMWA 4Y7EA 3UR7A 1JNEA 3GXDA 4NRSA 3BMVA 1HVQA 3UEQA 5DO8A 3CZGA 4P7RA 1HKIA 3ZOAA 1V3KA 4M1RA 4W85A 5A95A 2YA2A 4Z2JA 4ZE5A 1ODZA 1CENA 3EDDA 4V28A 1GORA 2D24A 4URIA 2QMKA 4D6EA 1J0YA 1LG1A 4FLOA 5E9AA 2UY4A 1OWQA 2V3DA 3POCA 4GPNA 1HJUA 5A6MA 1PX4A 2CPUA 1UR8A 2W62A 1J10A 1JXKA 3VD4A 2PC8A 2YIHA 1VBUA 3AS3A 4E8DA 3F4VA 2WWCA 1R7OA 4PTWA 1OB0A 4AY1A 3PHAA 1CGVA 5I23A 4LYRA 1CXFA 2WMJA 2AAAA 2BNJA 1Q6FA 3CHDA 4PCTA 2VCAA 1FFRA 2YA1A 5I3DA 1ODUA 3FHQA 1UWQA 4WSKA 1DWGM 1ZU8A 3WF1A 1RD6A 1ZBWA 3DYMA 2WVVA 4BQ4A 1C91A 3WDQA 1BF2A 3THCA 3ARTA 5FOOA 4UOQA 1E4MM 4DUXA 3CHFA 1CBGA 1VB9A 1QI0A 1W91A 3WH7A 4GINA 2WMGA 4W87A 1PBGA 4F9DA 1MQRA 1E6QM 5EBAA 3ZT5A 2VUYA 1EGZA 3G6LA 4F66A 4BQ5A 2J74A 4CVUA 4LGXA 3ARZA 4MDPA 3SCQA 1G9HA 1DWFM 1KWKA 3II1A 1L0PA 2DT3A 1JI1A 1HJVA 3IK2A 1D2KA 2CBJA 2WMIA 3F5LA 1EOKA 3GNOA 1PIGA 3B9EA 4HOXA 4W8BA 3EDKA 1XCWA 2J7HA 2WWDA 3WIJA 1W9BM 1BVNP 1NWRA 2AMGA 1XGZA 1WB0A 3ZJ6A 4AEEA 3BXWA 1F4AA 4UQ9A 5A6KA 2WCSA 4MB4A 5LA2A 3AICA 1JYWA 2OWWA 2VVNA 4W89A 4K68A 1WCGA 2VCCA 1V6YA 1WP6A 1Z32X 2DDXA 4CN4A 1CGXA 2XSAA 1GOIA 4TTGA 7A3HA 4PUEA 2VR5A 3U7BA 1ZBCA 2W92A 4AIEA 2DQXA 5E0CA 3WDRA 1K9DA 3IJ7A 3DYPA 3BC9A 1W9DM 4PEEA 1OT1A 4L4OA 4DWSD 3ARPA 3VPLA 1LJYA 1ESWA 3SCVA 3RJXA 3AIUA 4OOUA 1UD8A 4AD4A 4AZHA 3T2PA 2EPMX 1JZ4A 2J78A 3GDBA 4IPLA 1QNSA 3IANA 4CUCA 2DT2A 1B3ZA 3CUJA 3I3EA 1FHDA 4TOQA 5LA1A 3ARUA 1GOKA 2BV9A 4M29A 3VO0A 1FOBA 4W7UA 5D4YA 2EPKX 1UG6A 2WC4A 4DUWA 4MPKA 1W3KA 1GQIA 5FKYA 1BAGA 3N12A 4GZIA 2JFEX 4GO9A 4AZBA 2WC7A 1FH7A 3NUKA 1E6PA 2ZICA 2ZUWA 3VMPA 2VX6A 3D3AA 3MSGA 2WVVB 5A6AA 4OZOA 1GONA 3HU7A 3EDFA 3ZQ9A 3BLPX 1ZJBA 4AZ6A 4AD1A 4ZENA 1NWTA 1C8YA 4ATLA 2WANA 4HA4A 3AISA 3EMZA 1CGWA 1QI2A 2E9BA 2BY1A 1HJQA 4UOZA 3BAIA 2XFYA 3PTMA 3N15A 3WD0A 1O6IA 1K9EA 1JNDA 1GOWA 4BQ2A 4TTUA 2Z1KA 3GNPA 1E43A 5JBDA 3FW6A 1SYTA 2DSUA 5CSUA 2XGIA 4W5UA 1OT2A 1TA3A 4AIUA 1E5NA 3RM8A 3WUGA 1D3CA 2E0PA 2ZUMA 5EFFA 2WMIB 2V3FA 1OCQA 1NH6A 4JCMA 1QI3A 5IXEA 1BYAA 4LPCA 1DTUA 3AXHA 1N82A 1QHZA 1DWAM 2CETA 3W25A 1AVAA 1QBBA 2C7FA 2NW0A 3WF4A 5CGTA 5A8QA 1E3ZA 1E4LA 2O9OA 1J0HA 3VM7A 2G3MA 3GTNA 5ABEA 1EXPA 1NOUA 4BF7A 3O9NA 1QPKA 1TE1A 3FHAA 1UR9A 1ZS2A 4W8LA 1TG7A 3QHMA 3N13A 3CUGA 2J7GA 5E70A 4AMCA 4WJXA 1J9YA 4PMYA 5GNXA 3WNOA 4Z2HA 4GZJA 2WAGA 5M3WA 5D9MA 2GSJA 2ZUVA 4W7WA 1H3GA 4J3XA 4P7NA 6CGTA 4CU6A 3BAYA 1BTCA 1H49A 1U33A 1F4HA 3MKKA 1ISYA 2HISA 1WDRA 3AHYA 1EQPA 1JGIA 3BAJA 5FCZA 4U2YA 4LYPA 1HVXA 1Q6EA 1XYZA 2FDMA 3VD3A 3D5HA 5A8MA 1UOKA 3OG2A 1V3MA 1CPUA 2BS9A 2J7FA 2J4GA 2E3ZA 4AXNA 1H09A 1BLIA 1W1TA 1UD2A 1GW1A 2WSKA 1PEZA 3L4XA 3VGHA 4JL1A 2VZOA 4ZEPA 2CERA 1MXDA 1V03A 3CBWA 3NSXA 4HZ8A 3UERA 3OLDA 4AZ5A 5I2UA 1KR1A 1G1YA 1HL8A 2GJRA 3EYPA 3U57A 4CGTA 4TUFA 1WZAA 4RE3A 1JZ2A 1G94A 1CZ1A 2VX7A 2E9LA 1HF6A 4CCDA 5A2AA 4PMQA 4RE4A 5GNYA 5JIPA 3VDBA 3M46A 1MFVA 1CXKA 1W1YA 2BXYA 3SCRA 5LA0A 2W66A 1JZ8A 1V6XA 3RPMA 2UY3A 5AC5A 2XFFA 4EKJA 1E15A 2PWFA 3ZO9A 4FMVA 4CD5A 2PWHA 2J47A 4U5KA 3T0BA 4IISA 2DT0A 3BAWA 3U5UA 1QNOA 2J7BA 5AY7A 5BYWA 3K4DA 4PSPA 1LWHA 1QNPA 3VGDA 3SUWA 3OGRA 4HU0A 3WF2A 1JF5A 1H4PA 1UA7A 3ALFA 1QW8A 2CBVA 2WHMA 4PTMA 1XC6A 1MW2A 3VGFA 3CZKA 3W26A 4J7RA 2J7DA 3AZSA 4UQEA 4HPGA 3PZOA 1EH9A 5CPSA 1R86A 5JUVA 1RP9A 5EFDA 3VINA 1GNXA 1WZKA 2JEPA 3JUGA 1CXEA 4CN1A 1J0IA 4TX8A 4D1JA 1QBAA 5E6ZA 1V6WA 1E0WA 3UESA 4B15A 4MDOA 1V3IA 1W9PA 3M07A 1W3HA 4GQRA 3HMCA 2VZTA 3QHNA 1C7SA 3PZUA 3L2MA 4CVWA 1NWSA 3HN3A 3L4YA 1Q6CA 4D1IA 1JZ6A 1SMDA 3HJEA 4HTYA 1HP4A 4OUEA 4M82A 3RM9A 3WF0A 2WYSA 1PIFA 1UKTA 2ZX7A 2BY0A 1GQKA 1CGTA 3T2OA 4OIFA 4JHZA 1VFUA 5AC4A 4A3HA 1EDTA 4XUYA 3KL5A 2WC3A 1OD0A 1JF6A 4UOJA 1FHLA 3VMNA 3MUAA 3NIYA 3RIKA 5A69A 4CD6A 3VIGA 2E9MA 2DSKA 5I5RA 3WNMA 2EO7A 4KWUA 1GQLA 2G4FA 3AZRA 1UR1A 3AMKA 9CGTA 5CSYA 1OINA 2YA0A 1E6RA 1V08A 2YLAA 1B31A 1TZ7A 4M81A 1DWHM 1BVZA 4UFIA 4JAWA 4W8AA 3WNLA 1E56A 5M17A 3MO4A 1HKMA 2VRKA 1HL9A 3MS8A 3MUIA 4GI9A 4W7VA 2OYLA 3UG5A 2D22A 1HJSA 1CWYA 3ARWA 1H1NA 3J7HA 1HNYA 3RJYA 4N0RA 2XVLA 1KGXA 4AD5A 1VAHA 2DH2A 2ZXDA 3VIIA 4FF5A 5BRQA 4AZCA 1LF1A 1PX3A 2CBUA 2VR4A 2FH8A 2WHJA 3WQ4A 3PZVA 1TVNA 3SCTA 2WZIA 3K8LA 2CIPA 3S2CA 4JKKA 2A3HA 2J25A 4X0VA 1UH2A 3LPPA 4M80A 3AS1A 4HZ6A 5CPQA 4MNJA 8CGTA 5M03A 5A3HA 2Y8VA 4XZWA 4D6FA 1AQ0A 3AXIA 1AQMA 4E8CA 1XH0A 1JZ5A 5HBFA 2A3BA 3BCFA 5CZKA 5A6SA 1G01A 3W28A 4ZE4A 2YBUA 4HA1A 2XM2A 1RP8A 2RGLA 4XX6A 3BMWA 1UKSA 3W27A 4J3SA 4R27A 3GXMA 3L4UA 2CESA 1BPLB 5HNNA 5KEZA 5BCAA 1KR0A 3T2QA 1B2YA 2TAAA 3AYSA 8A3HA 3VDHA 3AFBA 5D8WA 4QDMA 5HOSA 1GVIA 4B3KA 2W91A 3WDPP 4TVCA 2XHYA 2G41A 1RH9A 2V3EA 1JG9A 2GJPA 1UKQA 2VO5A 4DWSA 2F2HA 5DMYA 2XM1A 2FHBA 1VEMA 2BFGA 4CD4A 3CZEA 3WY1A 1WPCA 2VURA 3SCUA 4KGJA 6TAAA 7CGTA 1KGUA 1UWUA 3SIMA 1KCKA 1NP2A 1OIFA 1UWRA 1OBAA 2FGLA 2WKLA 1KBKA 1BHGA 1BSIA 5BROA 4C7GA 1H2JA 3A3HA 1Q4NX 4UZSA 2BHYA 2FHFA 4GXPA 1B3XA 4WSJA 3SUSA 2DSVA 4DUVA 1XSIA 2A3EA 2CBIA 2DT1A 1UUQA 2YDRA 4UCFA 2JF7A 4H2CA 4BA0A 4F79A 4W5ZA 4MNLA 4UFKA 3SCPA 2YOCA 1EDQA 3NSNA 4AW7A 1SR0A 1WO2A 3L2LA 4MAZA 2C0HA 4H7VA 2JIWA 5IHSA 1JDAA 4MB3A 3ARXA 1ZBVA 4D6JA 1UQZA 4HP5A 1AQHA 4KRTA 1VFFA 3RDKA 2OWCA 3UR8A 3VMOA 1CIUA 3KEHA 4QLLA 1TCMA 1CXHA 3K46A 1RPKA 1W32A 3K8MA 3ZJKA 3TA9A 2YL9A 1V3JA 3PTKA 4P7QA 1UKOA 4AD0A 2X2YA 3ZSTA 1M7XA 2XPKA 5DT7A 2O9PA 4ACYA 1TFVA 1JAEA 4GI8A 1UD4A 2EEXA 3VIJA 1W9XA 1OD8A 3N18A 4E4PA 3PTQA 3I3DA 5FIPA 2VTFA 1M04A 3VNYA 1KXTA 1US2A 2XGBA 1J0KA 3SUUA 2XVPA 4AZCB 3RM4A 4QAWA 2J79A 3MU7A 2G8ZA 2G3IA 1UD6A 2WHKA 4QCFA 2QPSA 3ARSA 3TTSA 1ECEA 2EPLX 1B3YA 2D0GA 3WQ5A 1M03A 2J77A 1B1YA 2NT0A 1UA3A 1G0CA 3WENA 3WQVA 3B8SA 1UH4A 1ZB5A 1GOQA 2XVNA 4PMZA 1HP5A 5A8OA 5I77A 1C7TA 3N1AA 1NARA 4GKLA 2CKRA 3ZMRA 4DM1A 2PBGA 1FFQA 4Q22A 2VRQA 2F61A 2XFRA 2E8ZA 3VD5A 2WMKA 3SUTA 2VZVA 1TR1A 1GCYA 4Q7NA 2ZWZA 4Z2GA 3WL1A 1E0VA 1UHVA 2DSZA 2WLZA 4C7DA 1MW0A 4R5EA 2W67A 4DWSB 5GPRA 1WDQA 4GZEA 2E8YA 3IJ9A 3AMDA 4AZGA 4ZFMA 5A8NA 3SURA 5BXTA 1HX0A 5HPCA 3VGEA 1C93A 2F8QA 3ZSSA 1PX8A 4PYSA 4CCCA 2GDVA 1CNVA 5I78A 2Z1SA 4U3AA 1CLVA 1KCLA 2PF0A 2WVUA 5F7UA 1IZJA 4JKMA 4RE2A 2BVDA 3ARVA 2IXVA 3K4AA 1DWIM 4AZIA 3RILA 5M5DA 3LMYA 4JFVA 3U7VA 3PBGA 4U33A 3WBAA 5ABGA 3WEZA 1UQYA 2WLYA 3WNKA 3VDCA 3GZAA 5A6JA 3W0KA 4EK7A 3W6MA 2O92A 1MFUA 1GQJA 3OZOA 1UZ1A 2AOSA 1V02E 4OJYA 1C92A 2WBGA 3BSGA 4AIOA 2W5FA 4EAMA 2V5CA 1KB3A 3WELA 1E0XA 1OSEA 1WE5A 3WNPA 1E3XA 1PJ9A 3WBEA 1TMQA 2VC9A 2ZOXA 1KGWA 2JEQA 1FH9A 1WZMA 3FNDA 3FAWA 2D3LA 2EQDA 3WQ8A 4D6CA 5HXMA 1K9TA 2IXUA 2B31A 1W2PA 1J12A 3F5KA 1BG9A 5FL0A 5LYRA 2WPGA 4UFJA 2BHZA 5D9NA 4KH2A 2O9RA 1KXHA 4A3YA 2WVTA 3OA5A 1XD0A 2VMFA 1CGYA 4UR9A 2XSBA 2Y5EA 4P7LA 3OLEA 2QLYA 5I0DA 4KMQA 4YHEA 1BYBA 2CXGA 4QLKA 1O7AA 1WDSA 1QI5A 4FLRA 2BXZA 3VIMA 5C8BB 2DSWA 1NOWA 2PWGA 1B0IA 3ARRA 1E5JA 2BVYA 3OIHA 3BSHA 3KZSA 2D20A 3QOMA 2QHAA 5JBEA 5CPTA 1QNRA 1VRXA 1UWTA 4CU8A 1GZJA 1E9LA 3AS0A 1I75A 3AIWA 1IV8A 4A4AA 4NZCA 4U3CA 3NJ3A 2X0HA 4HMEA 4ATDA 3WN6A 1VJSA 1V6VA 4YPJA 3VX1A 4UQDA 3B9DA 1FA2A 1JIBA 2GDUA 4JZ5A 4HOZA 1E55A 4LXFA 4B9YA 4NI3A 3T09A 1UYQA 1WKYA 4TVUA 4YN5A 3ZR6A 3PZQA 1W1PA 4HA3A 1B3VA 5A94A 3MMUA 1B9ZA 1Q6DA 4MB5A 2QPUA 1H41A 1E1FA 2J8GA 3AIVA 3ZT7A 2WVSA 5GQBA 3IJ8A 2UWFA 3AS2A 3U5YA 3T0AA 1ITCA 2WCAA 4U5IA 4JKLA 2ZUNA 2X8RA 1KQZA 1QHPA 2YKKA 3W82A 5HPOA 3L4VA 1MYRA 3I3BA 1JDCA 1TA3B 2Y24A 1BYCA 2XWDA 1E6NA 4CD7A 3AIQA 1JYXA 3AI0A 3RO8A 6A3HA 4WF7A 1W9VA 5EB8A 3ZT6A 1HJWA 4AD3A 1QOXA 4FLQA 3UETA 3WQ6A 4M56A 2XJ7A 3AQUA 3K1DA 5BXRA 4H41A 2OSYA 3VIPA 1EOMA 1EO5A 2YL6A 2EJ1A 5JBFA 1CXLA 3VKKA 2VZUA 4OKDA 3POHA 4PBGA 2EXOA 3BH4A 4B3LA 1TVPA 4PMDA 1U30A 1ISXA 1FP8A 1R8LA 5A2BA 1HXJA 1J01A 3SCOA 2JALA 1GHRA 3GXIA 3OLGA 3WEOA 1LL7A 1GOOA 2VX4A 1V3LA 3A4XA 3OLIA 1CTNA 4QCEA 3WD4A 2W4XA 1E6SM 3AIBA 3TTQA 3IAQA 4MJ2A 1VFMA 4X0NA 2HVMA 3KWXA 3NYDA 1UR2A 2XIBA 5GNZA 4NSBA 3M7SA 1UWSA 3KL0A 2MANA 2D23A 3OB8A 4UNIA 4DWSC 1BGAA 1LL4A 3G6MA 4CD8A 3W6LA 4UQAA 3WUFA 1AMYA 1C8XA 3K8KA 3GYCA 1M53A 1W1VA 5EMYA 1NOFA 2VVSA 4PCSA 4D6IA 2D3NA 1C90A 5C70A 2XUCA 1W3JA 1E70M 3WEMA 5IDIA 1CECA 3PZ9A 1KXQA 5DT5A 3NDZA 4V2XA 1FP9A 2WMFA 1GPFA 2FHCA 3AHVA 4AZ7A 2IUZA 4ZXOA 1ITXA 2YJQA 3SCNA 1NP0A 3VD7A 1BG4A 4X9YA 5A2CA 1PPIA 5ABHA 4AC1X 2A3AA 3SUVA 1UKPA 3EMQA 4LYQA 2WCGA 4W84A 2E40A 2D0HA 4WKAA 3A4AA 3OZPA 3PZIA 3AMCA 3VDAA 1E4IA 4IUGA 2OSXA 1W9UA 5E6YA 4FK9A 4ZXLA 3RCNA 1XD1A 3TTOA 1R85A 1VEPA 1ZJAA 1UR0A 1V0LA 2BY3A 4MB1A 2G3JA 2GJXA 3EDJA 4NF7A 3WFLA 3SCWA 3GH7A 1OGSA 1CYGA 1EHNA 1KQYA 3CGTA 1WDPA 1VEOA 4JFWA 5CQ1A 1XV8A 2VX5A 5CG0A 1MXGA 1DP0A 3WNNA 1QVBA 1UWIA 1E6ZA 1HIZA 2JIEA 2JF6A 5AYIA 4W88A 2WBKA 1JL8A 2OWXA 3SEPA 1XRVA 2YDQA 1KWGA 3EDEA 5A6BD 3MANA 2ZX9A 2DIJA 1CXIA 1I1XA 1JI2A 3LPFA 2CEQA 3CUIA 2Y4SA 3WKZA 4PSRA 4TX6A 4H04A 3KL3A 1S46A 3VILA 2D0FA 3ECQA 3MSDA 5BXPA 2X05A 4B9ZA 3N17A 1OIMA 2OYKA 4F8XA 3S6TA 1VENA 3ARYA 1E40A 3OGSA 2VNCA 1JD7A 3O2LA 2PBOA 3MUY1 3PZMA 2EBNA 2ZX8A 4HMCA 1LG2A 5ECUA 4UFLA 3VIFA 3ALGA 5IFPA 1EQCA 3WD2A 3PZTA 2D2OA 3VGGA 4HOWA 4PRWA 5CLTA 4W86A 2CHOA 3ZJ7A 3ZR5A 2VCBA 3QGVA 4QP0A 3APGA 3AIEA 1PZ2A 2J7EA 2V38A 3MV11 1C8QA 3WH9A 1EDGA 4UZUA 2YBTA 4UTFA 1HT6A 3VIOA 3GBDA 2ZUTA 1OM0A 4M24A 1ISWA 4JHOA 4P8UA 5A8PA 4D6DA 1A47A 3VNZA 2QMJA 4N42A 1VJZA 4GI6A 2FH6A 4S3JA 1HN1A 1NWUA 2PWEA 3CHCA 3CLWA 4KRUA 3CO4A 3WH6A 1JYVA 4M8UA 1MVYA 2DIEA 4P8VA 1J11A 3EMCA 2RGMA 3L4ZA 2Y8KA 5I6SA 4JIEA 4PMVA 1JFXA 3N9KA 3UCQA 2Q8XA 1JAKA 4EE9A 4MADA 4PTVA 4JL2A 3T08A 3CHEA 3BGAA 4D72A 4L4PA 3GM8A 4BCEA 3W4RA 4WIWA 1XHGA 2J8FA 3GXFA 4BQ3A 3W29A 3ZM8A 1HKKA 1U2YA 2VRJA 3AHTA 1B90A 4NRRA 4MAVA 1WAWA 1E73M 1KBBA 4Z2IA 1FH8A 1QNQA 4IPNB 1LLOA 4GO8A 1V6UA 4WKHA 1E1EA 1J18A 1B3WA 1LWJA 1W3LA 4JFSA 1LQ0A 3VGBA 2XVGA 3CPUA 3PN8A 1A3HA 4JFTA 4BZYA 4J3WA 1H5VA 4AWEA 2Y2WA 5A1AA 5D9PA 3CZJA 2VQTA 7TAAA 1BGGA 3N04A 1YHTA 2X1IA 4PTXA 3SCSA 1I1WA 5BRPA 2WM0A 3F5JA 2WB5A 2XIIA 4PMRA 4D71A 1JFHA 1HJXA 4PMOA 4P7OA 3T0DA 2GJXB 2X0YA 1WZLA 2ZWYA 5D9OA 1DEDA 4Z2KA 2YL5A 3L4TA 1VFOA 1E71M 4P8XA 2J75A 2WW5A 4UQCA 1J0JA 1V0NA 1JXJA 1VBRA 1GHSA 1E4NA 4MNKA 2GUYA 4Z2LA 2WK2A 2WNWA 2OLHA 3WUEA 4ATWA 2WSPA 3ZIZA 2NT1A 1KFWA 1MQQA 3W38A 1H11A 1L8NA 3AXXA 4FLSA 2WKGA 3VIHA 3VUPA 2ZXAA 1EA9C 3BLKA 4J3UA 3WH5A 1IZKA 4OBRA 2BVTA 3VVGA 1Y7VA 3NSMA 3GH5A 5JIWA 3O6AA 1V3HA 3WMSA 3UG3A 2PI6A 1OGGA 5BWFA 1DWJM 1GOMA 3VIKA 4JCLA 1NM9A 1ZL1A 2X09A 3L4WA 1E72M 1GJWA 4OBSA 2CYGA 5AYBA 5C71A 1MW1A 1J0ZA 3WMBA 4B16A 1UD3A 1UH3A 2ESCA 1JYNA 3QOKA 3FY1A 2GK1A 4ACZA 1EO7A 1E6XM 1GVYA 2WXDM 2QF8A 1JZ3A 2PB1A 1X6LA 2OSWA 1BYDA 5DFAA 1US3A 3W24A 4AYSA 3AYRA 2J7CA 1X1NA 3AROA 4WKFA 2D1ZA 4XB3A 3GNRA 2NSXA 1KXVA 3AZTA 2XTKA 4PMXA 2CCRA 3VX0A 1P6WA 4XZBA 1QW9A 4GIAA 1XYFA 4WK9A 2VI0A 4AISA 1TUXA 4AD2A 1ISVA 3MMDA 5HDRA 1ZBKA 1G5AA 4IM4A 2XG9A 2BY2A 3EBVA 2V3GA 5A6LA 1BQCA 3BAXA 5DEZA 3AHZA 3B9AA 3DC0A 2GVYA 4PUDA 4HZ7A 2ZUSA 1EIBA 2VQUA 1H0IA 3WDJA 1UZ4A 3CZ8A 3WDIA 2ZXQA 3WD3A 2VZSA 2CNCA 4D6GA 1JD9A 2VT0A 3WF3A 3WL0A 1VIWA 3WFZA 3CIVA
chains in the Genus database with same CATH superfamily
2QCEA 5CXPA 2DGAA 2JE8A 3TP4A 5E09A 3AIRA 2WMHA 9RUBA 1W5MA 2O55A 4FF7A 4Y90A 4JPGA 1CDGA 3GHTA 4EF8A 4UMCA 5I7GA 3I4EA 4IFOA 4OGZA 4IFKB 1LL6A 4HHLA 5I79A 3CUFA 3HV9A 4Q8VA 2Z2AA 2GGGA 3P3BA 1PCKA 3AOFA 2QEZA 1XM3A 3UJEA 4ZSTA 3OBEA 1PDZA 4WZHA 2EPOA 3H6OA 2EG6A 3FXGA 1EHAA 1PKYA 4QFUA 1WAUA 3CTTA 3LM7A 4NAFA 2QCGA 2RDTA 2QIIA 3WDHA 3CMJA 4A3QA 3C2YA 3GB6A 2ZIDA 3CMGA 2OCZA 4S3KA 1QHOA 2DPEA 2FMNA 3C2FA 4IL0A 4UFMA 1OGBA 1TWDA 4PB3A 4US5D 2ZRZA 3W37A 2RJGA 2FGZA 3FEQA 4GUJA 3K13A 1VPYA 4M6PA 5KZEA 2NVCA 3IACA 5HWNA 4KCTA 2UY5A 1I8JA 4UTWC 4KKXA 1SJAA 4QG9A 4JBRA 3BAKA 4FA3A 3OBKA 5T9CE 2YDSA 3SZ8A 3CZLA 1C3FA 4KEUA 2ZE0A 3F4NA 1FRBA 1TWWA 5J8LA 1XQLA 2FB2A 3TNBA 2HBXA 2XIMA 3S6DA 2GQ8A 4K8GA 2C8NA 2CHNA 3C8FA 4AQLA 3WQFA 3TSBA 3IVSA 1AFSA 4Q4QA 3S8HA 3KE0A 3DG7A 4XKMA 2ZX6A 1JUKA 1UC5A 4HMDA 5JU6A 3ITGA 1M5WA 3AMLA 4PUUA 1RBLA 2RKXA 3W22A 1XIEA 2XYLA 5M1TA 3FN9A 5CSRA 4PMNA 3PBYA 3ORWA 3PZGA 1XFBA 3QN3A 4G56A 3DIPA 4FI4A 3AJXA 2PLJA 2W63A 5HMEA 3VU2A 2V69A 4E4UA 2Y5JA 3LS9A 5H8PA 2PWDA 2YB4A 4MY1A 1ISZA 3ZJ8A 4CCEA 4LUTA 3AHXA 4S3BA 1IEWA 4GVFA 1JJKA 3FJ4A 3WD1A 3M0JA 2ISWA 5CJ5A 4D8LA 1TELA 4H8VA 1J6OA 2DH3A 1TIWA 3ZVHA 2Q3RA 1XSJA 3TOPA 1GW9A 4S3AA 2YXGA 2B0MA 1LYXA 2V0TA 3OBAA 2HVOA 3OGVA 3GSMA 3KDOA 4BY3A 3EKLA 3AO0A 4KCVA 1W2VA 4YHGA 3T78A 1LRTA 4WR3A 1H7OA 5JMUA 1N8WA 5K7JA 3GBEA 3MP5A 1IHIA 4NRSA 2FZBA 2R1MA 1HTIA 2WO5A 3HQ1A 3WQGA 2AQVA 3CZGA 5HUPA 2P3EA 1HKIA 3ZOAA 4H9UA 4M1RA 5A95A 2YA2A 4UR7A 1GORA 2NQZA 4KPLA 1EYWA 1TCDA 1XUUA 4D6EA 3IV3A 4L6HA 4JTRA 5E9AA 1DOSA 3M9YA 1M65A 1OWQA 2PD5A 1HJUA 1GK8A 1UR8A 1J10A 3VD4A 1LT8A 3H2FA 4BK9A 2GGJA 3QZEA 3B0PA 3QXBA 2PTZA 4PTWA 5EKYA 3ZXWA 4AY1A 2BZNA 5I23A 1XFCA 1J2BA 1YEYA 1WDDA 3LHUA 3ITCA 4UNLA 2WSQA 1Q3NA 2WMJA 3U2ZA 4QISA 1MDLA 1RQHA 1K03A 4C91A 2NLIA 3UA3A 2OX4A 1XICA 1ZU8A 3WF1A 1ZBWA 4XSLA 4EAYA 4BQ4A 1NFGA 5TNVA 3R25A 2GJLA 4IF2A 3ARTA 3W1QA 4UOQA 5AN7A 3HQPA 4HVXA 5FESA 1E0TA 2QNEA 3S9YA 1TTPA 5EBAA 3BGGA 5CPMA 4FP1A 1EGZA 3IJ6A 4G6CA 1QASA 4CVUA 4LGXA 4GABA 1FQ0A 2DFAA 5M2FX 3PPFA 1KWKA 1PTGA 4JIHA 8TIMA 3WJXA 1D2KA 3P8JA 2WMIA 3F5LA 2OG9A 3KVMA 3TROA 4YMZA 1I9CB 3B9EA 4PB5A 4W8BA 3EDKA 1Q4WA 1X96A 1XCWA 2WWDA 3WIJA 1W9BM 4NZ4A 1BVNP 1NWRA 2AMGA 1WB0A 4OU1A 2OZ3A 3RPDA 1Q6RA 4JQAA 1Q63A 3OA3A 3AICA 1JYWA 5AKQA 4ERAA 2OWWA 1SJDA 1TTJA 3AWOA 4W89A 4K68A 1XRFA 2IQ0A 5FSEC 3U48A 4NAEA 4JTTA 1CGXA 2D2HA 2JK2A 3ZFHA 1GPWA 3EX6A 1Z6KA 3I7RA 4TTGA 3ID7A 1RY0A 1TJ1A 1S1RA 3B8DA 4JN8A 2INZA 1GQNA 2F6KA 3BC9A 4PEEA 1XLBA 2ZRYA 4I6KA 4Q32A 1VBGA 1W31A 3B05A 1EGVA 3Q58A 2ODOA 3AIUA 1UD8A 1R3SA 5BZAA 4LS0A 4AFYA 3GO2A 2J78A 5C54A 4IPLA 2E6DA 2DT2A 6XIMA 1Q7QA 2A79A 2ZZ5A 4WDUA 3CUJA 3U2CA 3V5CA 3BZJA 4M29A 4C6NA 4W7UA 1BEUA 1UG6A 3I4KA 4NKCA 2WC4A 1Z42A 3RU8X 3U2EA 3NAVA 3HG5A 1RBOB 2OGYA 3BICA 4A8LA 1JCXA 1E6PA 1G4EA 2ZICA 3GVVA 4E3TA 4GBUA 5A6AA 3HU7A 4V33A 3T44A 3EDFA 4GNKB 4QXIA 3Q45A 1SSDA 3P5YA 4F2BA 4AD1A 4ZENA 4IXHA 4LF2A 1C8YA 3G1YA 3EMZA 3PANA 1QI2A 3GXTA 1IE7C 2BY1A 4RZ5A 3CWHA 4UOZA 1Z69A 2Z25A 4JTFA 2XFYA 3UWUA 1S5TA 1AJ2A 1DBTA 4BQ2A 4TTUA 3VCNA 3FW6A 2DSUA 3NGJA 1XBYA 3KRSA 1JGMA 5F1VA 4JNMA 4XZ9A 1E5NA 4KWOA 1P0BA 1D3CA 4O17A 4XAZA 5EFFA 2H3BA 4N9CA 4US5A 5BW6A 3DBNA 4PL2A 1QI3A 3KS6A 1WBJA 4N4PA 4LF1A 3LSBA 3KBVA 1QBBA 2C7FA 2KX9A 2NW0A 3WF4A 1E3ZA 3V75A 1J0HA 4PFHA 9XIMA 3GTNA 5DANA 1SU5A 2HCVA 4QSFA 1NOUA 3TXZA 3O9NA 3REQA 1QPKA 2E1DA 1TE1A 2Y5SA 1RLCL 1O1HA 1ZS2A 4O57A 3FJ6A 1ONXA 3ATZA 5E70A 4FS9A 5GNXA 2XGZA 4GZJA 4D9PA 3W2NA 1NQKA 5D9MA 2FVMA 2ZUVA 4W7WA 1EUAA 2J9ZA 1R2SA 3BOLA 3B8VA 4CU6A 3H54A 3BAYA 3T0TA 5KETA 3TSMA 2GLKA 3P0WA 1EL3A 3MKKA 5AZ0A 3CT2A 1J6PA 4OT7A 1WDRA 1EQPA 4IMFA 2W3ZA 5FCZA 1F74A 1TX0A 1K8CA 4LYPA 1R3YA 1XYAA 3SRHA 2PDLA 1FUYA 4S3FA 1F07A 1XYZA 3P81A 1A80A 3HG2A 1XIIA 1UOKA 1Y65A 1V3MA 2J4GA 2E3ZA 4G9PA 4H8NA 4PCPA 1GW1A 2WSKA 1PEZA 5AOUA 5ECVA 1TREA 3NSXA 4DB7A 4MWAB 1UWAA 2V6AA 4GOAA 3BUVA 3CYVA 1R38A 4TR9A 4CGTA 1I45A 1U1JA 1H61A 5IBXC 5AVHA 3EOLA 2NX1A 3VNLA 5JIPA 3B0UX 3M46A 1CXKA 5LA0A 3SCRA 2W66A 1V6XA 3C0JA 5H2ZA 4QJ1A 3UF9A 3PULA 1ELSA 1A50A 2E6FA 1M7PA 3S46A 4IISA 2F38A 2DT0A 3BAWA 3U5UA 2J7BA 5BYWA 1LWHA 3PPGA 3SUWA 3OGRA 3WF2A 3KHJA 3ALFA 1XRSA 1XC6A 3TQKA 2QPXA 4IP7A 4J7RA 5CPSA 1PE1A 4MFEA 1W3NA 3P7YA 1GNXA 1WZKA 2JEPA 3JUGA 3ANVA 3SN0A 4D1JA 3TLQA 3WYZA 1W3HA 4GQRA 2V5LA 2R6OA 4JEQA 3QHNA 4WRHA 3WLQA 3C5QA 1NWSA 3MBFA 5SWUA 2IS7A 3L4YA 1F5ZA 1Q6CA 2E6YA 1JZ6A 4Q8MA 3UVAA 3MB9A 3BLOA 4M82A 4OUEA 4I5UA 2VD9A 5HULA 2QZRA 1KFKA 3RM9A 3L5AA 2WYSA 3FKKA 4R7WA 3INPA 4OIFA 3FDGA 3B03A 2FZ8A 5GJNA 1OD0A 4ONVA 4JS3A 1TV7A 1TTIA 3VIGA 3P2VA 4IX2A 5I5RA 2DSKA 3B40A 4ZOAA 3PB0A 4H9YA 3SY5A 3V0SA 3HF3A 4Z1DA 2ZADA 1OFAA 1WUFA 1OINA 1A5CA 3G8RA 1E6RA 3RN6A 2AMXA 4UFIA 4JAWA 2VGGA 4LC6A 3G1FA 5M17A 2ISFA 1BXNA 4J4KA 3W1TA 1HL9A 4N2YA 3UG5A 4MY8A 3PJTA 2NX3A 1H1NA 1HNYA 1DL3A 4MZ8A 3M7WA 4NI8A 1R9XA 1O12A 3NR0A 3LQLA 2CW6A 2IQDA 3VIIA 4FF5A 1MZHA 4O54A 4DF1A 3UA4A 4F48A 3E38A 3GDMA 1RK5A 3S47A 5FJIA 1TVNA 2E68A 4DBSA 4X0VA 3UPMA 2QCDB 5A8GA 4DNMA 2GUUA 1XLHA 1TMLA 4ROPA 2VEGA 2ACSA 3GXNA 3DN5A 1LZOA 4QAIA 5CZKA 3S4TA 2QVNA 1DJWA 1DIKA 2ACQA 3W28A 5D32A 4ZE4A 4OUIA 1WYIA 1LBFA 1A5AA 1YXYA 2G5WA 3N25A 1W3IA 5KEZA 1GYNA 2OLSA 1OVDA 1KR0A 3HG3A 4XAPA 3WLRA 4Y9OA 3UPBA 3AYSA 3N9SA 3SGZA 1KKOA 4HGXA 1XLCA 4XD3A 3F7JA 1EB3A 2YCLA 5HOSA 3WDPP 2V3EA 3LCXA 3M0MA 2PCQA 1UKQA 2F2HA 5DMYA 2FHBA 2QKFA 5D2XA 1S2UA 3S6OA 1Y8BA 4O4WA 3CZEA 2ZC1A 3A9BA 3KBSA 3SY1A 3WLLA 5HNRA 4KGJA 1KGUA 5HWMA 1NDWA 2AL2B 1KCKA 1JPKA 5CBBA 1O5XA 2J9XA 1BHGA 4C7GA 1Q4NX 3WLTA 3PB2A 4FHAA 3N14A 4GXPA 2B7NA 2DSVA 4B92A 1PZ0A 4WJ8A 1XBVA 2A3EA 2GJNA 2ZFAA 3GG0A 1S5VA 3IGUA 4AWTA 2FFCA 3BQ5A 4GGBA 4HBKA 4BA0A 3EEZA 1XPGA 3TC6A 1A4MA 4YTSA 4QSHA 4AW7A 1SR0A 1WO2A 4MLRA 2D2JA 4IIDA 2B4GA 4MAZA 4S3DA 5HJLA 3HV8A 3H53A 3MBDA 4JHMA 1H62A 3A13A 2DJXA 2QGYA 1YRRA 3W1MA 1X8FA 2ZBTA 1H7PA 4AWUA 1R3RA 1CXHA 1RPKA 3CUZA 3W02A 3ZSTA 4P7QA 2X2YA 3QFWA 4BWLC 1M7XA 2O9PA 4I8YA 3LRKA 6XIAA 1TFVA 3OPSA 2OQYA 3A3WA 1UD4A 3EX2A 4GFSA 1W9XA 4Z1YA 5I06A 1VFLA 1US2A 1J0KA 2XVPA 1T0OA 1JPIA 4QAWA 2TPSA 1UD6A 2Q02A 2E28A 2EPLX 1FKXA 4IH3A 4NYUA 7ENLA 4EPBC 3MCMA 3GS6A 1RLDA 1DXEA 5EYWA 3CPGA 1XC4A 2GGEA 4B2DD 4IIGA 4Y6GA 1W0MA 4J5NA 4HPXA 5I3HA 3EOOA 2NQJA 3ITYA 3LI0A 1TV8A 1UASA 1HP5A 4D8AA 5A8OA 5I77A 1C7TA 3N1AA 4YYCA 4DN1A 4RK8A 2CKRA 4GUHA 4G1KA 3NL3A 2VRQA 2XFRA 3WQOA 2DZSA 4KIRA 4KT2A 1E0VA 1UHVA 3TWBA 2P8BA 3G3MA 4IIBA 3W7KA 4A21A 4GY1A 1WXZA 4GZEA 2NUYA 3T9PA 3AMDA 4AZGA 4FOUA 5C2GA 2Q3OA 3R94A 1J93A 3SURA 3PAOA 1HX0A 2DQWA 3CXOA 5MHBA 3VGEA 4NZ3A 2F8QA 2FPVA 3GHUA 3JZEA 1PX8A 3VZYA 4PYSA 4CCCA 3BSMA 3B06A 2L5HA 4GY7A 9XIAA 2AL1A 2C13A 3LHWA 4JKMA 1YMYA 2QJHA 4IIFA 1DWIM 3WJSA 1EGMA 2J8TA 3LUTA 1DXIA 3CQKA 3WNKA 1SZGA 3VDCA 4V1XA 3NQ8A 2CZEA 4HHHA 3FOKA 4B5VA 7ODCA 3DUGA 3WQCA 2A2IA 4WOQA 3BSGA 3D0CA 3IEBA 3G1DA 4AIOA 2DZXA 5IOBA 4K39A 4KESA 1OSEA 2DIKA 1WE5A 2PWVA 1YPFA 2Z2UA 1TMQA 2VKZG 2C71A 1O66A 2JEQA 1FH9A 1WZMA 1IR2A 3FNDA 2PFHA 2D3LA 4EVZA 2DY3A 4D6CA 4AX6A 5HXMA 1G6CA 1K9TA 2P0IA 2IXUA 3R8HA 1SJBA 5C9WA 1W2PA 4HNCA 4M5PA 1UR3M 3IPWA 1THFD 4HK7A 1P7TA 3W1XA 1LRQA 3W7QA 2WPGA 1US0A 3QSTA 4QHRA 4DY1A 3DENA 1RVKA 1MSSA 2O7QA 3USBA 1KXHA 1AD4A 1XD0A 3TDFA 2Z1VA 2VMFA 2EJAA 2UZ9A 4YVPA 3QPEA 4ADSA 4CNUA 2D2GA 2Y5EA 3S5SA 4KMQA 1O7AA 3FA3A 4XIMA 5EA9A 3KZSA 4ZO8A 2QHAA 3W7RA 1QNRA 3LXCA 1TIMA 4B5WA 4LAMA 5LNRA 4A4AA 3RRXA 2PC4A 5FF4A 5JH1A 1T8XA 1V6VA 4YPJA 5D30A 4UQDA 3B9DA 1OC6A 4HOZA 4LXFA 1TPWA 3B8WA 3OTRA 1I2QA 5K3VA 2DORA 4WX2A 3PNUA 2QCNA 3ZR6A 1B3VA 3MMUA 1DKWA 1Q6DA 5CJMA 3TK7A 1DQWA 1E1FA 2J8GA 3ZT7A 3O0FA 5GQBA 2UWFA 2WJFA 2WCAA 3EWCA 1KQZA 1XIHA 3O06A 1XWYA 2ONEA 1SQ7A 1IEIA 4PH6A 4MG4A 2HE8A 1CI1A 1XYLA 1E6NA 4WF7A 2I9UA 1W9VA 5EB8A 4ZO9A 1E1CA 3KOFA 4LVFA 3KBMA 3MI6A 2OU4A 3WQ6A 3AQUA 2IPJA 2OSYA 1XJBA 2YL6A 1XISA 1WXYA 2PDBA 1XLIA 3GR8A 2VZUA 2YZ5A 2EXOA 3P8IA 4L6OA 1U30A 5C2CA 1R8LA 1J01A 3PFRA 4LALA 4YTUA 3R4IA 3LBOA 3SN1A 2VFEA 1Q66A 3OLGA 3WEOA 5C6MA 1LL7A 1GOOA 4I7VA 1QCWA 2ZVRA 4NJKA 1E6SM 3SGGA 3AIBA 5C55A 1DORA 3OZYA 5B7ZA 4Q33A 4ZQCA 2HVMA 3KWXA 4YL2A 4NSBA 3NM1A 3DGRA 3A21A 1UWSA 3OB8A 3H55A 4L80A 4UNIA 2QJJA 1BGAA 3L9CA 1LL4A 5IBXA 5AHNA 2DZAA 2DZVA 3WUFA 1S39A 4UQAA 4O1BA 4YVVA 1VQTA 4ZO7A 3VNMA 4PMJA 5DCBA 1QOPA 8XIAA 4POCA 4LAKA 3NWRA 3GFYA 1L2UA 5EMYA 2RUSA 2VVSA 4PCSA 2Y7GA 1C90A 2XUCA 1W3JA 3WEMA 1CX9A 2VFIA 1ZTVA 4O11A 1G4PA 5FJRA 2OMAA 2PGWA 1KXQA 5DT5A 3NDZA 3CT7A 5DLCA 1F2JA 2IUZA 4ZXOA 2XIJA 3ABXA 2O56A 4H9TA 4X9YA 3NPVA 5CGQA 3HQNA 3LNPA 3W85A 1RR2A 3G5EA 3EMQA 4LYQA 2WCGA 3VCCA 3W6YA 3B4YA 2BOEX 2D0HA 3OZPA 1GKQA 4ZGYA 3KOXA 4FK9A 3DOPA 3GIPA 5CZJA 2NWSA 4UTJA 3I7QA 4MB1A 3TWAA 3SCWA 3GH7A 1FHVA 3PVFA 5I09A 3GVRA 1KQYA 1WDPA 4GWEA 1CLKA 5FSDC 3WNNA 1UWIA 1B9BA 2XZ9A 3GFXA 2Y62A 3V1HA 1FWNA 1XLAA 1JL8A 2OWXA 3SEPA 1R30A 1KKRA 3HPSA 4GQ0A 3GDKA 2CEQA 3F1QA 4HYWA 5ABTA 4H04A 1S46A 2D0FA 3ECQA 2I5IA 3GE7A 3GNDA 5BXPA 4RNFA 2DP3A 2E67A 1E40A 2VNCA 2PBOA 3PZMA 3EZ4A 1LG2A 1KLZA 3ALGA 4PBFA 3WD2A 2PGRA 4UNKA 1OX4B 1X39A 4HOWA 4K7YA 4W86A 2CHOA 4WCJA 2VCBA 3RHGA 4HU3A 3QGVA 1UBSA 1PZ2A 2V38A 1OY0A 3VOJA 1EDGA 4JDYA 4B2DA 3DXIA 3ZLHA 2VDIA 4P8UA 1E9ZB 5BRBA 4D6DA 5DX7A 2PP1A 3VNZA 2QYGA 4XBSA 2BGSA 1HN1A 1OYAA 1NWUA 4QS6A 3CLWA 1J11A 3L4ZA 5C5YA 3TZNA 5I6SA 3P60A 2CXEA 2Q8XA 3PBMA 1I4NA 4JYDA 3UZXA 1TJ0A 2C1HA 4PTVA 4EPKA 4RDWA 4D72A 5A6TC 1VR6A 4BCEA 1XIFA 1PZ1A 4WIWA 1S2AA 3DHFA 4BQ3A 3LENA 4INFA 4GXWA 4MAVA 3L66A 4AX7A 4Z2IA 1FH8A 1JDFA 1QNQA 4GO8A 4WKHA 1B3WA 1RCQA 1REQA 5HINA 4C1LA 3HQOA 1IGSA 2Z1XA 3R12A 2P76A 3E3HA 2FGBA 1IT7A 3R2GA 1BGGA 4O1CA 3SDOA 2G37A 4B4HA 2WM0A 5BRPA 2QVHA 3F5JA 2XIIA 4I9TA 3QTGA 1XGDA 1HJXA 1KD0A 2GJXB 4ZA0A 1SZFA 2V2DA 3W1NA 1OHLA 3OJGA 5FI8A 1XRTA 3KDNA 3R11A 5D9OA 3PJXA 1DEDA 1R9YA 3D47A 4Q4PA 5FF3A 2HBVA 2WW5A 4A8IA 3A3XA 3W7OA 1V0NA 1JXJA 1OFBA 4YTQA 3OQEA 1E4NA 4BI5A 4DO6A 2WK2A 3NL6A 3T42A 4L61A 3MYPA 1KFWA 1TZ9A 1IT8A 1GEQA 1O94A 1PKNA 2ZXAA 4DLFA 1PKMA 4GIYA 3NQVA 2BVTA 4H6EA 3O6AA 5D05A 3LGEA 4U28A 2PI6A 1OGGA 4AHOA 4HJFA 1NM9A 3UZWA 4MHBA 2X09A 4O1DA 3ABSA 4OBSA 4HSNA 5C71A 4PUNA 5F2IA 4OV9A 1J0ZA 1UD3A 4LEFA 1Q7ZA 1QRQA 4JNYA 2GK1A 3EA1A 3Q2DA 1ADDA 1DVJA 1CB2A 2WXDM 1EP3A 1POKA 1Q8JA 1H7XA 4XAFA 1MEHA 4I9JA 3W24A 4AYSA 4BWLA 1XIDA 4MKSA 2C18A 3AROA 2AGTA 4XB3A 3GNRA 3VNKA 2BMBA 3AZTA 2XTKA 4PMXA 2C0AA 3P82A 4XZBA 1BWKA 2D73A 3N4EA 3XIMA 4GIAA 4WK9A 3R8RA 4AD2A 1EFZA 2ZZ7A 5FAGA 4EXBA 4IM4A 2X1SA 2V3GA 2QQ6A 2H9AB 3NQAA 5K2ZA 2XDFA 3B9AA 3LGGA 3TCSA 5EGRA 4HZ7A 2ZUSA 1Z8AA 4E2BA 1W8GA 1MI3A 1UZ4A 1OX5A 3W7CA 1WKFA 2V30A 3BQ6A 3NZGA 2WJZA 1UMYA 1JD9A 3SFWA 1FCVA 1R6WA 1VIWA 4X2RA 3MY9A 3WFZA 3CIVA 4M19A 3VOCA 4EANA 4Q7IA 4RL3A 4WVXA 1Q85A 3M64A 3D46A 3TYDA 3AMGA 1X6NA 3EPMA 4QROA 3LMZA 1JDDA 2EHHA 3TONA 3MJMA 5CC3A 2CZDA 1XSKA 1CLXA 1SFJA 1VF8A 4O16A 1K6AA 4MJ4A 2X40A 2Z7GA 4IPIA 1OABA 5LXEA 1J2WA 1SMAA 4CU7A 3VXGA 1XCXA 4W93A 3E1F1 3QHOA 4JFUA 5E0FA 3RK8A 4MGGA 1V0KA 1UBPC 2BGNE 4IL2A 4DO7A 1QI4A 1FBAA 3EA3A 4LX4A 4F9JA 3IJIA 3GDTA 3FGCA 4OWGA 3WH8A 1FWRA 2YCIX 1MW3A 4ZTYA 1MNSA 3WK0A 4WLCA 1BFNA 2PZ0A 4X9SA 4HPHA 4FNTA 1XH2A 5XIMA 3S1VA 4TXEA 2CLKA 4C7FA 5HR7A 4S38A 4XV0A 1DHKA 5E93A 1IXPA 3RAOA 3DFYA 2FPYA 3L2IA 1FTXA 3ATYA 4BS0A 5C9XA 4CN6A 3H4GA 3RX3A 1Q5MA 1Z9AA 4P5UA 1V79A 2X41A 4K2SA 3WSUA 4S3CA 4GI4A 2A7RA 3R10A 4NQ1A 4LQ1A 3HGOA 1P0NA 4ALDA 4ACZB 2X42A 3W81A 1L9WA 2ZZ4A 4IUOA 1RJRA 5DF0A 3QKEA 4I6VA 4H8UA 4NYYA 4OE7A 4P8WA 4QNWA 3CLMA 3ONCA 3MPGA 5HUOA 4AEFA 3P93A 1KM2A 3QR3A 3CK5A 3QZAA 1MUCA 3CS2A 4RNIA 3CUHA 1K9FA 1IT0A 3VM5A 1GUVA 3TJIA 3ELFA 4HU8A 2BHUA 2FMOA 4U10A 1QTWA 3V1PA 1OFPA 1DHPA 3CJPA 3G0XA 5CLWA 2XWEA 4O0KA 2VOTA 5C7VA 5LNWA 4IZGA 5XINA 5CKSA 4MNMA 4J3TA 4WY0F 1MWOA 7PTDA 4XAYA 2ZX5A 1UD5A 2X30A 1EC7A 3S0CA 3UY8A 1B30A 3KTCA 5ABFB 1YTDA 4DPPA 4H9VA 4QEEA 2VGFA 4ZB2A 4D2JA 2V5JA 1V0MA 2X2GA 4GMEA 1TO3A 2P8CA 2VJXA 1JCMP 2ATMA 3APTA 1JRBA 4U31A 4UXDA 4HU4A 2E5DA 2WHLA 4PN2A 4WY0A 2ZZ1A 3V0UA 4LSBA 1WXJA 4G7FA 3RLHA 1F6PA 1Z41A 1JZ7A 1RA5A 5EPDA 4QX4A 3FXYA 1AW2A 5G1MA 2BSLA 2IKJA 3GXDA 2ICSA 1KBLA 3BMVA 1HVQA 3UEQA 5DO8A 3FA4A 3TYBA 5DCEA 5FACA 2VEMA 4NXKA 1RBAA 1ZP3A 1QPQA 5D37A 1ODZA 4O1AA 2D24A 1EJRC 1YBQB 2QMKA 4NJIA 5ENLA 2DUXA 1LG1A 1KRBC 3NPWA 4FLOA 3PPCA 3T55A 3POCA 4GPNA 3PUDA 1R2TA 2Z26A 3TNOA 3QGAC 1KO0A 4L6DA 4CEXC 1FWDC 2PC8A 2B7QA 1F7BA 3TQVA 1ICQA 4NASA 4E8DA 4JOMA 2ZCGA 1A3WA 2XH7A 3ABQA 5LNSA 3LBMA 4YIWA 3PHAA 4J3ZA 5I07A 1RV8A 2CZ5A 1DJNA 1B5TA 4DRSA 4J40A 3SQLA 2D69A 1R3WA 1Q6FA 3CHDA 4XO7A 2VCAA 3UWWA 3QKZA 1K8ZA 1VLWA 4G2DA 5I3DA 3WLSA 5DY3A 4O15A 3LHZA 3N6HA 4WSKA 3MI2A 4ERGA 2Z2BA 3TN6A 4GJIA 1S5MA 3WDQA 2J6XA 3LU2A 1C9DA 5FOOA 2JBMA 1PHQA 8XIMA 2NV1A 2PURA 5CH9A 3CHFA 1CBGA 1VB9A 1QI0A 4GVIA 4AHPA 1W91A 3WH7A 5EMMA 1X1OA 2E1WA 2P10A 3DFSA 1PBGA 2V2HA 1LOLA 4LUSA 3ZT5A 2V8ZA 4DUOA 2OO0A 3G6LA 4F66A 3OOQA 5DRCA 2J74A 3BW4A 1YNPA 4DQWA 4MDPA 3T05A 3SCQA 4KFNA 1DWFM 1GVEA 3KXQA 1HJVA 3IK2A 3HPXA 2CBJA 1LUCA 1NAL1 4ECLA 3LCIA 4LV9A 4HOXA 1ONWA 3G2GA 3W1RA 2J7HA 2VP8A 1KFJA 4JTGA 3NPUA 3KAOA 1VFSA 4CCZA 3ZJ6A 4AEEA 3VOFA 1GT8A 1F4AA 4ES4A 2Y89A 2J24A 2HQAA 4MB4A 3NDOA 2A85A 3RLGA 2VVNA 5CSSA 4XQ6A 2VCCA 4MF4A 1WP6A 1Z32X 4IQEA 1F76A 4WXYA 4NP7A 4PUEA 1ME9A 2VR5A 3G1RA 3E96A 2YCKX 4ROQA 4AIEA 2OGJA 1K9DA 4YU1A 1NVMA 4GGHA 5HWJA 4ZQPA 1PXGA 3DYPA 1KV5A 1X7IA 1SR9A 4L4OA 4DWSD 2HZGA 2I16A 3LLFA 3VPLA 1LJYA 3LX9A 4LCRA 3CYJA 4L64A 3DU0A 4AZHA 3UXAA 4B5SA 1JZ4A 1N8IA 3GIQA 1EEPA 3IANA 1UROA 4NU7A 4CUCA 3FYOA 3E0IA 3NG3A 3I65A 1FHDA 4TOQA 1GOKA 3VO0A 3GDLA 4JTQA 2PZNA 1PSCA 3ENLA 5D4YA 2EPKX 4X63A 5FKYA 4C6MA 3N3MA 3S2MA 4Z1CA 4JICA 1Q8AA 5JXQA 4GO9A 1XBXA 1PCWA 2WC7A 3NUKA 2YYUA 5AC8A 2VX6A 4LCSA 2WVVB 3HMJG 8RUCA 3BGJA 1SPQA 1NWTA 4ATLA 3FV9A 3AISA 3VCRA 1CGWA 3KVJA 3MQTA 1WOBA 1XLFA 1VCVA 1DJZA 3U6WA 3RITA 1PKLA 3BAIA 3VFCA 3PTMA 2PP0A 5BOEA 2FIQA 4LNYA 3PG8A 1XIBA 1JNDA 4UTLA 1E43A 1SYTA 4OECA 4ZCWA 3GAKA 4HCDA 4AIUA 3WUGA 1PDYA 4BI6A 2OT1A 2V3FA 1NFBA 2X7WA 1OCQA 1VKFA 4BJHA 4LAZA 1NH6A 2C15A 1ZCCA 2AQOA 4AVOA 4DAFA 1BYAA 1VH7A 3QMSA 4LPCA 4J2PA 1QHZA 1YPXA 3DAQA 1XL9A 3B0YA 1RSCA 3MHGA 4AWSA 1E4LA 2TMDA 2XIQA 1P0EA 2PE4A 2GQ3A 2YXXA 1ADSA 4TMBA 4L5ZA 2YPIA 1UW9A 3NPXA 1ZFJA 1TG7A 3MDUA 4KETA 1KC7A 4WJXA 1J9YA 3LXBA 4JY8A 2YDAA 1CT5A 4X3ZA 3LN3A 1KFBA 3FSTA 3QY6A 4P7NA 1Y0EA 2DVTA 2OVLA 1BTCA 1KCXA 2Q71A 3UW6A 3TU9A 3EXSA 1RJPA 1ISYA 2OOGA 1GG0A 3GU2A 3P0XA 3VKDA 1Y5VA 3EOUA 1R9ZA 3RR4A 2FDMA 3E9AA 2Z6JA 3D5HA 2DZWA 5G4EA 5A8MA 3VNJA 1QWKA 2PDWA 2H3DA 2J7FA 2NVAA 3VAVA 1H09A 1W1TA 1Z3NA 4GACA 4IMEA 3L4XA 1NF7A 3DERA 3FLUA 3CBWA 2I1OA 3OLDA 3UNDA 1SJCA 4KFOA 3U57A 4QEHA 1N2VA 1WZAA 3E02A 3LTYA 2E9LA 4CCDA 1NTHA 3FFSA 5GNYA 3P67A 1R3QA 1DJGA 4FAMA 4QJ3B 5MKGB 1GOXA 2IMRA 4UTMA 4CD5A 4U5KA 3QQ0A 4IMDA 1QNOA 3P84A 4Q6XA 1LLWA 3VGDA 4PZVA 3HURA 5DXXA 3MDWA 3W71A 1JF5A 3NO1A 1UA7A 2Y63A 4PTMA 5D2YA 1YDNA 1UP2A 5I3IA 3QSRA 6REQA 4K7VA 3PZOA 5TF0A 1NELA 5F4SA 1U1HA 3VINA 5LSMA 1CXEA 3M0IA 4EIVA 3UCCA 1ONRA 4DYKA 4W4QA 2ZVIA 5E6ZA 4EWND 1XYBA 2NQ9A 1M68A 4RV8A 5D09A 4JIRA 3MSRA 3UESA 1V3IA 3S9ZA 3E0LA 1W9PA 2G50A 1H7RA 1D3HA 1NIUA 3M6YA 2VZTA 2W6RA 4UTKA 1C7SA 4XD5A 3L2MA 4CVWA 4ASTA 1P4CA 1P1MA 3QY8A 2FZNA 3TR2A 5LHFA 2RHGA 4LEQA 3WF0A 1CGTA 5AZ1A 4S2BA 4JHZA 3GKFA 4A3HA 1EDTA 3MP4A 3P14A 4CQBA 1JF6A 1EKOA 1N7KA 4UOJA 1FHLA 3NIYA 1SO5A 5K4XA 3WNMA 3LNMA 2R14A 5HNUA 2G4FA 3CTLA 3DFOA 3N6JA 5EL1A 1SO4A 1UR1A 3AZRA 2V68A 1Q6LA 2C3ZA 4GH3A 4JTHA 3DBPA 5CSYA 2H8XA 3TIMA 3ITTA 1AH3A 2YLAA 4C6PA 1B31A 1GYLA 1TZ7A 5F2GA 4YYFA 4W8AA 4PE8A 3WNLA 4CQAA 2LLEA 4XBJA 2GGHA 3SN4A 3NZPA 4IPJA 4W7VA 1VYRA 3IK4A 2D22A 2NV9A 1HJSA 3W23A 1OG0A 3ARWA 5CG7A 3J7HA 1RZMA 4R34A 4WDXA 1BD0A 2AQWA 1EF2A 1VAHA 2ZXDA 3R79A 3LCGA 1E9IA 3H2OA 4AZCA 2X0SA 3BV4A 3DKLA 1PX3A 2I56A 4QDPA 5TBOA 2P53A 4DBUA 3K8LA 3VYLA 3S2CA 1UH2A 3LPPA 3EOSA 4M80A 2PGFA 4MOZA 3WBWA 8CGTA 1QDSA 4K1WA 1AQ0A 3AXIA 1JZ5A 5HBFA 3AUJA 2FKPA 3GY1A 2HS6A 1RP8A 4TIMA 3UXDA 3BMWA 1UKSA 3W27A 3BG5A 4RX0A 2CESA 1IEQA 2WQPA 4EX4A 1A5MC 3IGSA 5CZ0A 2HTMA 2BTMA 4IICA 2TAAA 3E74A 3LV6A 3VDHA 1GVIA 1Z48A 3V18A 1HKVA 4V1YA 1JG9A 2GJPA 4DWSA 1KCZA 4RZ6A 3GAYA 3L65A 4DBEA 4LBRA 3STEA 6TAAA 4WOZA 1UWUA 1O60A 3UGVA 3W87A 1NP2A 4L1WA 1UWRA 3C3NA 1M7JA 1OBAA 1LDCA 1TPEA 1N55A 1JUEA 5BROA 1H2JA 4RCXA 3R1ZA 4UZSA 1B3XA 1YX1A 4UR8A 5G4HC 2RJHA 3LCWA 2PUZA 1GWJA 4MZYA 2CBIA 3UG8A 1DE6A 4LVAA 4WGHA 1UC4A 2YDRA 1EJWC 4M6UA 1XIJA 4UCFA 1G4TA 3W01A 1EXBA 4MNLA 4QE5A 1EDQA 3GU9A 3TQ0A 3TAKA 3ICJA 4LS1A 5IHSA 4MB3A 3K4WA 3ARXA 3EWWA 2QAFA 1ZAHA 1AQHA 4WY0B 2QR6A 2OZ0A 3UR8A 3B8UA 4NHVA 1TRDA 1EPVA 3WLPA 4YCPA 1CIUA 3EXTA 4QLLA 2Y6ZA 3K46A 3ZJKA 2GVJA 2HV5A 2JGYA 1NU5A 3WCZA 3HGRA 2XSXA 1TPUA 3OODA 3G8EA 3I10A 1OD8A 2PD9A 1HKWA 4LUJA 5FIPA 5GJPA 1W56A 3M44A 2VTFA 1M04A 1KXTA 1S2WA 2XGBA 3SUUA 2Z1WA 4DYEA 3VI2A 3RM4A 3S9IA 2PDPA 2Y88A 3MU7A 4A2SA 1L6WA 2EPHA 2ABBA 2QPSA 3TTSA 1B3YA 2F2KA 1S5WA 2OR2A 2PTYA 4KEMA 5REQA 1ZUAX 3C86A 1G0CA 4Y8FA 3WENA 2OO6A 3WQVA 3BK0A 3DX5A 3B8SA 1UH4A 1ZALA 4AIBA 1ZB5A 1FWEC 1XR2A 5G2WA 2V67A 1GTHA 2JQXA 4PR4A 1NARA 2A1YA 4O0ZA 1JR1A 1XINA 4BKNA 7REQA 4Q22A 2P0OA 2E8ZA 1C29A 2WMKA 3TN5A 4P2VA 1TR1A 1GCYA 4UTUA 3WL1A 1GG1A 3KRBA 2QCHA 1D3GA 3GC5A 4LS2A 2C79A 3NZRA 1WDQA 4NNAA 2FFIA 4LVBA 1P48A 5K9XA 1XDMA 3BANA 1PYMA 5BXTA 3PY2A 4RE0A 1TB3A 2WNQA 1OFEA 3T4CA 1DJYA 5AHFA 3VKCA 1CNVA 1D9EA 4U3AA 1M9HA 1KCLA 2ZC8A 5J04A 1HGYA 1FWSA 1Q13A 3HTWA 3TEVA 1YDYA 3ARVA 2YGYA 3K4AA 5HA7A 4AZIA 3RILA 3U7VA 4U33A 1L6GA 2C1IA 3XISA 1W5OA 4XAGA 2WLYA 2PP3A 1W8SA 3GZAA 3NTYA 3RNDA 4IG2A 5AYZA 2O92A 3NQDA 3LCFA 4CQ8A 3KCOA 3PBWA 2WKJA 2YR1A 3EX4A 3S1GA 4FALA 4E3VA 4G8TA 2WBGA 2F9RA 1BRLA 2V5CA 1FWTA 1KB3A 1E0XA 2PDQA 2VD8A 3WNPA 1RA0A 1ZNNA 1FWWA 4ZB0A 3M4HA 3KLKA 4ORMA 3HPAA 3GW0A 1SZNA 5LHEA 4KQNA 2EQDA 1OF8A 2DZBA 2B31A 3GR4A 1J12A 3W1UA 4X22A 3Q65A 1OC5A 4LBUA 5D33A 5MF5A 1Y5WA 4KH2A 1UIPA 4M3PA 2O9RA 4XD6A 2E7FA 3FDKA 2KZHA 4O10A 3TV8A 5LGZA 4UR9A 1GTEA 4P7LA 4PUKA 4YHEA 4QLKA 1WDSA 4JXCA 1QI5A 2BWGA 4GC4A 4QS5A 4JQ1A 3MI3A 2PDYA 2BXZA 2DSWA 1NOWA 4JY9A 4ADUA 2WNZA 5CPTA 1AW1A 4UMAA 1ECQA 4JIQA 4XSMA 3AS0A 4BR1A 1I75A 1IV8A 1S38A 3V36A 4ICNA 4HT3A 4I3GA 3QQWA 4HK5A 2GWGA 3T8LA 4REQA 2VDGA 5C9ZA 1MO0A 2I5QA 5K9DA 4WGXA 1T99A 4JN6A 3MT1A 1JCNA 4MB5A 3M43A 1H41A 4EOUA 3CWNA 1EBGA 2NLYA 4C6LA 4BF9A 4ZTXA 1W1B1 3T0AA 1ITCA 1K4GA 2BDQA 4JTKA 3C6CA 2ZUNA 3NNTA 2YKKA 1VFTA 2OEKA 3UJFA 3L4VA 4FIQA 1MYRA 3I3BA 2OEJA 1BYCA 4I5RA 4HNTA 3OVQA 1JYXA 3RO8A 2IQTA 3TZFA 2R8WA 3PTDA 1WA3A 4DVOA 1HJWA 3L12A 4XKYB 2TRSA 3R0KA 3UETA 3RPTA 1AJZA 5CPNA 4RPPA 3VIPA 1EOMA 1EO5A 1VBJA 3W2MA 3M5XA 1B57A 4OKDA 3FK4A 3POHA 4H6RA 3M16A 4PMDA 3KTXA 3AXKA 1FP8A 1WKEA 4DF0A 2JALA 1K7FA 4GZ7A 1CTNA 3L0KA 3WD4A 2BLEA 3G1XA 1PWLA 2KAUC 3SBFA 2X1RA 3LLDA 3MWAA 3NYDA 4L4MA 2XIBA 3EA2A 4C60A 3GTHA 1VCGA 2D23A 3G6MA 1GKPA 3CQ0A 4MYXA 1ZLPA 3W6LA 5AYXA 4XZMX 3H24A 2XH4A 3GW3A 3OQ8A 4E2DA 1FY6A 1Q2RA 1CB7B 3B9NA 2YYTA 1C8XA 3K8KA 1M53A 1W1VA 4HPJA 2DZUA 3UVIA 4D6IA 5C70A 2OT0A 1E70M 1OF6A 1CECA 1EJSC 4JTSA 3S5OA 1TPB1 3DH7A 3AHVA 4DF2A 5G2HA 4LBSA 3SCNA 1YDVA 3QM3A 3VD7A 1BG4A 4AC1X 2A3AA 2BGQA 4NZ1A 1QWGA 4W84A 2E40A 4HN8A 1X7FA 1XG4A 4WKAA 5HJYA 1VD6A 3VDAA 3EWXA 4IUGA 2OSXA 4C6IA 5E6YA 4ZXLA 1XD1A 3TTOA 4YWIA 1ZJAA 2BY3A 1TRIA 3EDJA 4JTUA 3P5ZA 4MIMA 1A53A 1IR1A 2VC7A 1CYGA 1EHNA 1A5UA 4DNHA 3CGTA 3C2RA 3R8GA 1KBJA 4JD4A 1JPMA 5CG0A 1DP0A 3PWAA 1QVBA 3WK2A 2JIEA 3A5VA 1O4UA 3WO8A 3IIOA 2WBKA 4GKTA 4RZBA 1XRVA 3BDKA 3VE7A 2YDQA 1UZDA 5A6BD 4EACA 2DIJA 3CUIA 4N7QA 2Y4SA 2R24A 3WKZA 1F8MA 3UPWA 4TX6A 3L23A 3PBVA 3MSDA 3GIYA 3C3UA 2QV5A 1VENA 2CLHA 2GOKA 2ZX8A 1K77A 3VIFA 3IIZA 4UFLA 5IFPA 1EQCA 2PLKA 3PZTA 2D2OA 2XFWA 3H21A 3ZJ7A 2OQLA 3GRIA 1FWJC 3GVWA 3W7MA 1YE4A 3APGA 3AIEA 4M6QA 1C8QA 3WH9A 3HFTA 4XUGA 1RY8A 3KBNA 2YBTA 3UY7A 1XI3A 4UTFA 1HO1A 2ZUTA 1FHUA 1IXOA 3UBPC 4S3EA 1A47A 4JTIA 3PAJA 3BW2A 4S3JA 2ZTJA 3U3HA 4GVHA 1Z7AA 2PWEA 3CHCA 4KRUA 1JYVA 3RG6A 2ADAA 2VGBA 1MVYA 2DIEA 3E12A 1TSIA 3EMCA 2ALDA 2YCEA 1FWHC 4CQCA 1JFXA 3N9KA 4JR5A 3UCQA 3PS7A 3S2NA 1U5JA 1JAKA 4EE9A 4MLJA 1QAPA 1EP2A 3T08A 1S5NA 1UOZA 4GQBA 3MHFA 3BGAA 3NA8A 4Y9AA 3W4RA 1O1ZA 3W29A 2DW6A 1U2YA 1B90A 1TV5A 4NRRA 3R43A 4IX0A 3IIPA 1E73M 3H2EA 4HHMA 5G5IA 4GISA 4EPEC 1LLOA 3BZGA 1J18A 1LWJA 2IKHA 4JFSA 1LQ0A 3PJUA 4XZLX 2V5KA 4J3WA 5TIMA 2B7PA 1H5VA 3KX6A 5D9PA 2VQTA 2G0WA 5FEWA 1GZ1A 3SCSA 3CB8A 2WB5A 3WK1A 4PTNA 4IFKA 1KV8A 1XDLA 2ACUA 3BV7A 3L7RA 2BB0A 3O05A 4PMOA 3FVDA 3T0DA 3GVGA 3L0NA 2V81A 1WZLA 4XBKA 5CC5A 1F3EA 3UNTA 2J27A 4HSHA 4GG9A 3BJSA 3L4TA 4O1EA 1E71M 5D03A 2J75A 1X98A 4UB9A 1J0JA 4D8ZA 1WX0A 3W72A 4MNKA 3CEUA 1KM0A 2GUYA 2ZRUA 3IJLA 3H22A 2OLHA 4FX8A 1L8NA 2I9EA 3DFTA 5TQLA 3LM3A 4K8EA 1P5BA 4J3UA 2CLLA 3VVGA 3U9IA 1Y7VA 3NSMA 1SUXA 1I6NA 4O19A 4ORIA 1W6TA 3WMSA 1TPVA 2A4AA 5BWFA 1DWJM 5PTDA 2F6XA 3VC5A 3NEVA 3MO7A 4O14A 1ZL1A 3L4WA 5I3KA 4R7OA 2BBFA 1K4HA 4NNBA 3WMBA 2R1NA 3TW7A 1OEPA 3CMFA 1UH3A 2BXVA 2ESCA 2PF8A 3QOKA 1LROA 1QPRA 2J6VA 1W1ZA 3L5MA 4UUIA 3IJDA 3OU8A 3SADA 5DFAA 1YE6A 1TPFA 3AYRA 3DKJA 1ZHAA 1X1NA 3C2VA 3OW1A 2YFOA 5U7SA 1KXVA 4PRTA 1PVNA 3Q4DA 1EJ7L 2B81A 3BE7A 2CCRA 5FA5A 3LRLA 1P6WA 4YTRA 2JGQA 1SSGA 5AHMA 3JW7A 1QPNA 1QW9A 1VYPX 4DXKA 1ISVA 3N4AA 5HDRA 3FCPA 3PG9A 1H7NA 1YDOA 5HQMA 4Q7BA 5HMDA 3RFAA 3E5PA 2BY2A 2PLMA 1IIHA 3EBVA 3C56A 1F6KA 4MWAD 3LY0A 4JTDA 2GVYA 3M5ZA 5D2TA 1EIBA 1H0IA 3WDJA 3QLDA 2ZXQA 2VZSA 2CNCA 4D6GA 2VT0A 4KBXA 4LTSA 1U83A 3EWYA 4DZ5A 1A5OC 4HCLA 3MV01 1QPOA 2IPFA 1P0KA 3EB3A 3VTRA 4D6HA 3SGUA 4QLJA 5BXSA 4U2ZA 2ZUUA 1OK6A 1FDYA 2J62A 4JYFA 4PEKA 2YLLA 3LQGA 1HKJA 3RRAA 1NQ6A 2C91A 1EC8A 2ISDA 1DQXA 1TV2A 2E4TA 1CCWB 2YFNA 1UR4A 4JTJA 4AF0B 1UJQA 3WUBA 4H2HA 4K36A 4RW5A 4LVGA 2I7GA 4Y2WA 4B5NA 5FL1A 1X8CA 1UJPA 2VC6A 1LWIA 4IQJA 1DJXA 4O52A 4IGSA 3UGRA 1HQTA 3W3OA 3BOXA 1XPYA 3B97A 4PA8A 4H01A 4E2VA 2VFGA 4BEQA 4EP8C 3O63A 2XH0A 5HNTA 2YX0A 3TTYA 1H51A 4IJBA 2G3NA 4Q4KA 3MSYA 3TX9A 2CKSA 3CL6A 4KCUA 1K6WA 2OKOA 4UQBA 1PB0A 4PMUA 3ISIX 2QULA 1H0GA 3GH4A 4O18A 3IUDA 3PK7A 2VGIA 4GIEA 2F84A 3CNYA 4G7EB 3NCOA 2ISSA 3HA1A 3G24A 4LOCA 3A4WA 4C5ZA 1Q6GA 4ZB5A 1ZZMA 2A3CA 4NJHA 1XLJA 3ERPA 3W53A 1YQ2A 4IMAA 4IG2B 3WMLA 2Y7DA 3CH9A 2R9RA 1YTKA 4YCOA 2FTYA 5LIUX 3DC8A 4KGLA 2VFFA 1FWFC 3TW6A 2O9TA 4C1NB 2ZXBA 3K1GA 4ICMA 4NZJA 1T41A 4XZHA 2FZ9A 4WDWA 1QU4A 1R7AA 4B5TA 5KZ6A 3WLMA 5TD4A 5A6BA 1KRCC 3VFLA 1AZ2A 2GL5A 3C0QA 4J27A 3TYZA 1XCFA 5DBTA 3QZ6A 5EY5A 4DPQA 3T4WA 1VJIA 4UTTA 2QV4A 3A47A 2YBVA 5GJMA 5CC7A 4XG1A 4DXXA 2ABAA 4FX7A 3W76A 2WZHA 3DHUA 2DEPA 1GVOA 1RJQA 1GKRA 1R87A 2BG5A 2GFTA 4V15A 1J5SA 4UFHA 2Q8ZA 3RYSA 4C5YA 3VD9A 2W61A 1V5XA 3OZMA 3AXMA 3AJ7A 5IHRA 3UR7A 4Y7EA 1AH0A 1JNEA 3LRMA 3T6CA 1OX6A 1YW1A 2HPMA 4Q4RA 4ERIA 4X60A 4NAFB 3C52A 1V7YA 1LOSA 5E9XA 2OX1A 1AL8A 4ZE5A 1PTDA 1TJ2A 2R1LA 3TC3A 1R2RA 1J0YA 3W7GA 3AC0A 2UY4A 1R0MA 3O6CA 3JRKA 2CPUA 1TPC1 2W62A 1JXKA 2A5HA 3SB0A 1ME8A 4NIRA 1VBUA 2HK0A 1YADA 3PC0A 2WWCA 5C2XA 5IRPA 4GHRA 1OB0A 2GSEA 4GBDA 1CGVA 4IXXA 4TX9A 3SI9A 1HG3A 2E5BA 1Z89A 3P61A 1ZCOA 4FNPA 3W7IA 2AAAA 2BNJA 2PDCA 1OG6A 1RQBA 3UP8A 4PCTA 3RLVA 2IKIA 4IIHA 2YA1A 2F7FA 4JGDA 3CWOX 4FXFA 2ZTKA 1DWGM 1FKWA 1RD6A 2MNRA 2WPBA 4GJJA 1C91A 3ONBA 2OZ8A 1XLKA 3NQ6A 1E4MM 4DUXA 3IUHA 3MZ2A 1IQ8A 1EA0A 2WMGA 4R85A 4W87A 3NQ2A 4F9DA 1MQRA 1MUMA 1NDZA 3UU0A 5BU9A 4BQ5A 3T0CA 4FO4A 1NFPA 4QQUA 2ZZ6A 3DG6A 3ARZA 3IIVA 2ZYFA 3GG8A 1ITUA 4YXGA 4C6FA 1RK6A 3TMQA 3II1A 3N4FA 1JI1A 4CQDA 3HFYA 3CAWA 3QY7A 4E0CA 1OFDA 4LUTB 3N2MA 3WLHA 3GNOA 1PIGA 4I9AA 4Q8NA 3UD6A 1X38A 3NEHA 3ZVHB 3CQJA 1XGZA 3S83A 4IGNA 3W00A 3B4UA 3GDRA 3QR1A 3UFYA 1V6YA 4CN4A 3LG3A 3URNA 2XSAA 1GOIA 3EAUA 1P43A 4FB7A 4RDVA 7A3HA 3U7BA 3W2LA 1ZBCA 1U5HA 4GH1A 2ZA3A 1VYSX 2QAPA 4XIAA 3GVQA 2HNHA 1XLMA 1WDWA 4EF9A 1RAKA 1IYXA 1S2CA 4B90A 1ESWA 3LHTA 3QEZA 3RJXA 3W7NA 1MZRA 2F6UA 4K1GA 1IXNA 3EB2A 2EPMX 3CV2A 1JVNA 5E0KA 1XKJA 3SO7A 4N6FA 3I3EA 1OCBA 2P50A 4KW2A 3QQ1A 4DJFC 5LA1A 3ARUA 2BV9A 4MWAA 4O8RA 3C0SA 1PHWA 4IQDA 4MPKA 1BAGA 3N12A 1VPXA 4FNRA 4GZIA 4IP4A 4O8AA 2ZZ3A 1FH7A 1LQAA 2ZUWA 3VMPA 3MSGA 1GONA 3ZQ9A 4IMCA 1NY1A 3CV6A 4R33A 2WANA 3LA4A 3M5VA 4EPDC 4TO8A 3O6DA 4RNJA 2E9BA 3VDGA 1W5NA 5G1TA 1W17A 4IJCA 5I03A 2R82A 4AG0A 4N02A 2W79A 3DCPA 2PU0A 4NG3A 2CLEA 3UQNA 1EZWA 3RM8A 4HTBA 2ZUMA 5IM51 1ADOA 2WMIB 1N8FA 2Q6ZA 1TKKA 2GVLA 5D38A 4JCMA 3GXPA 3STPA 1ICPA 1N82A 1DWAM 2CETA 4R7JA 1T5AA 3W25A 1AVAA 2OEMA 1PO9A 3GUWA 5CGTA 5A8QA 3GQYA 3WZ0E 3W1AA 1X6UA 3WQPA 5ABEA 2Z24A 3SW6A 3FHAA 1UR9A 4W8LA 3L68A 3N13A 3CUGA 4NAEB 2J7GA 2V63A 1ML1A 3WNOA 4G5DA 4Z2HA 4Q8UA 2GSJA 1BWLA 1HUVA 1GZGA 1H3GA 4J3XA 1OFRA 1EWDA 1KM4A 4ZVJA 1DPMA 4Q8TA 1NDYA 1H49A 1U33A 1F4HA 5CBIA 3W7HA 2H8ZA 2HISA 3GR7A 1TUFA 1T6MA 1YXCA 3AHYA 4MM1A 3ZLFA 3BAJA 4L4LA 1F3XA 1HVXA 1VFHA 4KFPA 3LXAA 2BOFX 1Q6EA 2DZPA 2RDUA 1I60A 3LYEA 3OG2A 4AXNA 1BLIA 2EG7A 4DJDC 1UD2A 2PODA 1W5QA 2ALRA 4HKPA 3VGHA 3NYZA 4ZEPA 5CZTA 3LTSA 4HZ8A 3UERA 4QJ4B 1H7WA 2O4QA 4Y9PA 4AZ5A 3NOEA 1KR1A 5I2UA 1HL8A 4GCAA 2GJRA 1TR9A 4TUFA 4CNPA 4RE3A 1JZ2A 1CZ1A 1HF6A 2TODA 5A2AA 3A9IA 3LZ3A 4PMQA 2QCDA 3VDBA 2J88A 1JZ8A 2UY3A 2XFFA 3VC6A 2OZTA 5AFDA 3ZO9A 1SW7A 5BU6A 3GX9A 1RVGA 1ZRQA 2PRHA 2PWHA 2J47A 5CPLA 2CWNA 3T0BA 3RU6A 2OJPA 3DFQA 5AY7A 3K4DA 1QNPA 4N6EA 2INFA 3N19B 1DIOA 5AHEA 1QW8A 3LB0A 2WHMA 3TFCA 3SIZA 4DJFD 3VGFA 3HOJA 4ENLA 3W26A 3AZSA 4UQEA 1R86A 2OKTA 3W7PA 2IPGA 5EFDA 1G7UA 4W9TA 2ZA2A 4CN1A 1J0IA 3UR2A 1MXSA 1QBAA 3F2BA 1V6WA 1E0WA 4N9EA 2YXOA 4K8HA 3U4AA 4MDOA 4QITA 1YPIA 3HMCA 3STFA 2FVLA 1LCOA 1FCBA 2AL2A 4MPQA 3V4BA 4Q3MA 3HN3A 4AH7A 4XVEA 3ABRA 4D1IA 3QW3A 4JQ2A 1SMDA 3HJEA 4HTYA 1JDEA 1HP4A 2Q8LA 1AJ0A 2ZX7A 1UKTA 4NVTA 3WJWA 1GQKA 2VFDA 3T2OA 3TYCA 4XK2A 3N9RA 1SGJA 5FJJA 1VFUA 3REQB 5AC4A 4XUYA 3KL5A 5F1UA 2I5GA 2WC3A 1K7EA 1A5SA 2J9YA 3VMNA 3MUAA 3TYEA 3FA5A 4LUIA 3RIKA 5A69A 4CD6A 1SZEA 2E9MA 3KBJA 4KWUA 4RXGA 4EXAA 3SSJA 1GQLA 5CCZA 4L65A 2HXUA 3OIXA 3AMKA 3MVIA 4C6CA 1HL2A 9CGTA 5LZLA 4S2CA 3OHIA 2YA0A 3O07A 1VHCA 1V08A 4DXVA 2E6AA 1DWHM 4M81A 1EBHA 1L8PA 3CIWA 3GTIA 2O4MA 1E56A 2FB3A 4CNOA 3GNXA 4LY8A 3MO4A 4LUYA 2GWNA 2P88A 2VRKA 3HB9A 4C6EA 3MS8A 3MUIA 2OYLA 4QQ3A 4QIUA 4GA8A 4TV5A 2PGEA 1CWYA 4CQ9A 3RJYA 4KWVA 1B54A 3QTPA 2HWGA 2XVLA 2OFJA 2X1UA 3LGDA 3OO2A 3OHMB 3V5FA 3G1VA 4HMNA 1S3HA 1W1A1 1LF1A 2CBUA 2WHJA 4GYPC 2CIPA 4JKKA 2J25A 3BARA 2FTWA 3AS1A 1XW8A 5CPQA 5M03A 2DJLA 3V35A 2QCMA 4XZWA 4D6FA 1H1YA 1KBIA 1XH0A 4Z42C 4QDWA 3A22A 3BCFA 3BL3A 3B8TA 1TQJA 3Q37A 4LWWA 4PGLA 2YBUA 2P5NA 5D04C 2XM2A 1V93A 2A7PA 2RGLA 4XX6A 3TKFA 4DJDD 4J3SA 2YZRA 3R5EA 1FWIC 3BJTA 1ZJIA 5BCAA 1J96A 3E0WA 1B2YA 1OK4A 5FF7A 3GWQA 8A3HA 1DJHA 3AFBA 1VC4A 4QDMA 4MY9A 3GKAA 4B3KA 2W91A 3BCJA 3RCMA 3IIXA 3NXLA 1RH9A 2G3FA 3M0ZA 4LNCA 5FAJA 3IVUA 3COTA 1VEMA 1TV3A 2BFGA 4CD4A 4A2RA 3WY1A 2XN1A 1FWCC 7CGTA 1A5KC 5CEWA 3SIMA 1G7VA 1XLEA 4N9BA 3LCLA 2WKLA 1O68A 1BSIA 3A3HA 3HG4A 1B4KA 1M1BA 3LHYA 3SUSA 3AWNA 1Q7MA 1TPH1 3CEPA 1XSIA 3B0XA 3EPOA 4I5XA 3KW3A 1KTCA 3G18A 2HRWA 3THQA 4HA0A 1UUQA 5DCDA 2R91A 2EKCA 2JF7A 3N2BA 3TH6A 4MUZA 4W5ZA 2DV0A 4UFKA 2YOCA 3L2LA 4DIAA 3RX2A 4H7VA 1JDAA 4JEJA 4ML9A 4BEUA 3MUCA 4WUIA 3CV1A 1UQZA 4HP5A 3CASA 3RDKA 3CIXA 3AYTA 1QFEA 1UP3A 4AAJA 2GSHA 1MMFA 1TCMA 4GJ1A 3M0YA 3EWBX 2YL9A 1V3JA 2C16A 3PTKA 1UKOA 3E0FA 4L56A 3QVQA 4XO6A 2XPKA 3TOYA 3H2MA 4GI8A 3VIJA 2Z27A 2POZA 2QXWA 4NJJA 3I3DA 3F2CA 1I2OA