3FYOA

Crystal structure of the triple mutant (n23c/d247e/p249a) of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
255
Chain Sequence
MDIKINDITLGNNSPFVLFGGICVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGGRRAQALDLALAGMATRLAGLFLESHALPLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase
publication title Reversing evolution: re-establishing obligate metal ion dependence in a metal-independent KDO8P synthase
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transferase
total genus 81
structure length 255
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fyoA00
3C2FA 1SFLA 2BX7A 3ABQA 1A5BA 3CLMA 3HGJA 4FXRA 3W7IA 2GVJA 4PL1A 1VPXA 3E9AA 4FNRA 5KTLA 2GJLA 1T8XA 4PH6A 3SIZA 1G4EA 2P0OA 1I2NA 1KFEA 3UPWA 3CIXA 3TX9A 4G1KA 3W2MA 4N4PA 6TIMA 3MUXA 4UXDA 4FIRA 3N19B 3DGRA 3RNDA 4JNMA 1AG1O 3JR2A 3W22A 2ABAA 2E6DA 2Y85A 4QAIA 1YDNA 3GB6A 1FCQA 1B9BA 2QCFA 3UWUA 2P1FA 3KVMA 4KFNA 1FWSA 2X1TA 3W70A 3B05A 1PCWA 2Z0IA 1JCLA 3W7DA 3H53A 3N3MA 4H3DA 2FQIA 1DQXA 2WNQA 3TQKA 3LCFA 3BV4A 3HQ1A 3CM4A 1LZOA 1H5YA 3MP5A 3R2GA 1AL7A 1T0OA 3MHUA 5D2TA 1SW7A 5BRBA 1RVGA 1OHLA 2PURA 1YXCA 4UFMA 1YDOA 5FF4A 4IGHA 1TPFA 4NZFA 4DO5A 3QC3A 5EYWA 3R13A 3KRSA 1VHNA 1SO3A 1TJRA 5LGXA 3DBPA 1NFBA 3CQ0A 4WY0F 3T40A 1ICSA 1G4SA 1P0KA 1FQ0A 2WKJA 2ZRWA 4N2YA 2A1YA 3LI0A 1P1XA 2B4GA 4RLIA 1DOSA 2W0UA 5AOUA 2FB3A 1BWKA 4LC8A 1H50A 3EWYA 5F2LA 4YLWA 2A7PA 1TV7A 3BARA 2J9YA 3RFAA 3GXPA 1K02A 1IF2A 4LVGA 2FDSA 3EKLA 4AAJA 2G96A 3P84A 5CZ0A 3W76A 5K9DA 3GYEA 2ATMA 3U8GA 3USBA 1DKWA 3EX2A 2ISSA 2Y62A 1VRDA 4Y96A 1G67A 4NQ1A 4PL2A 1TREA 2QCEA 4FNSA 5DY3A 3MO7A 1ME7A 1ZJIA 3WJSA 2BZNA 5G4WA 2QCMA 1PHWA 3W1MA 3TAOA 1IGSA 3QMRA 4CCDA 2X1RA 4GUFA 1H51A 2P10A 3C56A 3P62A 1W5NA 3LCGA 2NWRA 3BVJA 4JGDA 4NT0A 4WY0A 4UR7A 4MY9A 3LLFA 1W54A 3G0SA 1PHQA 4U28A 4FB7A 5G5IA 4QJ1A 4DXVA 1WYIA 1ICQA 4N9BA 5HMSA 3C2EA 3C2VA 3EXSA 3OG3A 1SO5A 4X2RA 1K7FA 3FA5A 5D37A 1K8XA 1TJPA 4Y9AA 5D30A 3NQ7A 4K6AA 3V75A 3WK3A 2ZZ4A 4AMAA 4J9JA 1FWRA 5F1UA 1HL2A 3HF3A 4IX0A 4K37A 4O10A 2HS8A 2H3DA 1Z48A 4XTDA 1CW2A 3R5EA 1OABA 5D2WA 2PCQA 2QUUA 3LBMA 4MLJA 3T55A 4K36A 3HPXA 4UNLA 1LBLA 4UTHA 3FS2A 3GR8A 1RQHA 1JRBA 4EWND 3HOJA 4C1KA 4LOCA 1B4KA 1OFEA 4AF0B 3B8DA 4EF9A 1UBSA 3NAVA 2Y70A 5DBUA 3TNOA 4EOUA 2NX1A 3NQFA 4WX2A 1LOQA 1LOLA 1M7OA 5KZDA 1A5SA 1OFRA 4HHPA 3BLIA 5D2YA 4GNJA 1ZAHA 3W7LA 3LCWA 1F76A 1QDSA 2CLFA 3HPSA 4GBUA 5CPLA 1QO2A 3W3OA 3PG9A 4M5PA 1VYRA 2ABBA 2QUVA 2VOMA 1XBZA 3AO0A 4N6FA 3Q37A 1NF7A 2ALDA 2GQ8A 3THAA 3EX1A 3IIOA 1FCVA 1VHCA 2DZXA 4GUGA 1BWLA 3BG9A 4YL2A 3UWWA 5EBUA 4N9EA 4AWSA 4O16A 3QSRA 2VENA 4IJBA 3TJXA 3UWVA 3KFTA 1M7PA 3E96A 2BTMA 1AW5A 5FEZA 2QCDB 4P2VA 3A21A 3ATZA 5AYXA 4CLMA 4QM1A 2TSYA 4A21A 1IXPA 2Q8ZA 2OCZA 2YR1A 3WJWA 3UQNA 3CU2A 1N7KA 4UFHA 2GQ9A 3E02A 4UTTC 5CG7A 2OZ0A 3GVGA 2ZRYA 2VFDA 1W8SA 4UFKA 3STCA 3G1SA 3C61A 2FLIA 5LNUA 2VFHA 4X9SA 3W7OA 3EWZA 3EB2A 5BW6A 1VCFA 2V8ZA 1FCBA 3A24A 1EWDA 1KFKA 3QEZA 4O28A 1FXQA 1F7BA 3BO9A 3C52A 4AH7A 5I3HA 4KKXA 1HO4A 3B4UA 3TSBA 4O4WA 5F2MA 3NQAA 1NVMA 3TW7A 5E1QA 1VCGA 5L9FA 3O1NA 3G8EA 3M43A 3CC1A 3TCEA 3BK0A 3FOKA 5LNWA 4UTLA 3IVTA 5KSWA 5DCDA 3NQVA 4O15A 3OVPA 3W1QA 3G0XA 4Z0SA 2VFEA 3M5VA 3CHVA 1EP1A 3NZRA 4RXFA 1VLWA 3PB2A 1SZNA 1KLYA 4JTUA 3VI2A 1N55A 4PCFA 2CLKA 2HS6A 1UJPA 3OIXA 1LORA 1RR2A 3DFSA 2QJIA 2A7NA 3P5YA 1EUAA 1PIIA 3IVSA 5K7JA 2RKXA 4LT9A 3ATYA 1JJKA 3LHWA 4OGZA 3HG5A 3UWQA 3LTPA 2CZ5A 3RU6A 1BEUA 1U83A 1XXXA 1B3OA 3G1DA 3T4CA 4EIVA 4JTIA 3S5YA 1K7EA 4BF9A 3O63A 3FYPA 2V0TA 2QCGA 1R2TA 4IPJA 2J6XA 1C29A 4LC6A 3G1YA 1ZAJA 4K7VA 1JCXA 2Y7GA 5G1YA 3P80A 3INPA 1W5MA 3QPYA 1Q3NA 4IQLA 5CPMA 1DJNA 4O1AA 4OBTA 3NZ1A 1YXYA 3MMTA 3MI6A 4JN6A 3L0GA 1SZEA 2YDAA 1O95A 1YADA 1T99A 5FF3A 2ZRUA 1FWWA 3IVUA 2D73A 4GUIA 4YCOA 2V5LA 5ABTA 3M41A 1EP3A 4IMFA 1TRIA 5DN1A 3W7PA 3SY5A 4FX8A 3W7RA 2VFIA 4I7UA 1HO1A 4E2BA 5I3KA 1OFAA 5D32A 3C8FA 5CZTA 1KM4A 4UTTA 2ZRXA 2OMAA 3P60A 3TKFA 3KX6A 4L4MA 4AVFA 2A2IA 2YGYA 2FIQA 1JUKA 1OX4A 3BW4A 4LV9A 4FNQA 4OE7A 2DZVA 4GUJA 4IPIA 2BLEA 3HG2A 1DJQA 3M47A 2C3ZA 1X6UA 4N6EA 4RK8A 5KMYA 3Q94A 4MZ8A 2Q3RA 4ZQNA 1EX5A 1GVRA 1Q6LA 3GIYA 4LU0A 5A5WA 3UNDA 3P61A 3DENA 2PE4A 3MHFA 5K9CA 2A85A 4O50A 4K8EA 1TMHA 3EX6A 1FWTA 4K39A 2E5BA 1OJXA 3PAJA 3SECA 3W7EA 5U7SA 1OFDA 4O1CA 2E6AA 4FX7A 4HSOA 4DF2A 3G1VA 5G2WA 2Z6JA 1ZHAA 2DJLA 4HNTA 4LS2A 1J2WA 3F4WA 3LV6A 1W37A 4JYFA 4XKYA 5FEPA 1AL8A 3RF9A 3NM1A 3IEBA 1ME9A 5F4XA 3D0CA 3TK7A 4JTEA 3HB9A 2B7QA 1XUZA 4HKPA 1UASA 2PRMA 4AHOA 1PL9A 3B03A 2ZFAA 3L2IA 5DXXA 2HSAA 3GX9A 3TIMA 3TMQA 4UTWC 3C4UA 5HUOA 5EKYA 3GNDA 3C6CA 1MSSA 4M7SA 4UIOA 3LM7A 4IMCA 1O94A 1OX6A 5FF2A 4AEOA 1ADOA 4XBSA 1JULA 2WOQA 3W1NA 4QITA 2ZZ7A 3EWUA 1YDVA 1SQ7A 1EIXA 4AWTA 3NEVA 3IGXA 2VKZG 3HO8A 1XKYA 2CLIA 1X1OA 3VNDA 3BPWA 3QJAA 3SSJA 2NX9A 2FB2A 5LHFA 1S5WA 1THFD 2V2DA 2GPTA 5KINA 3IGSA 3FKRA 2CU0A 3PBYA 1S5TA 1GVFA 1DQWA 5CZSA 1GTHA 3CB8A 3EWBX 4CNNA 1A5AA 5LGZA 3BG3A 1XM3A 5HR7A 5DLCA 5C54A 1AK5A 1ZCOA 2I1OA 3LERA 4IMDA 4O0ZA 2ZZ3A 1FBAA 3W1PA 2Z6IA 5HULA 2RDUA 3STEA 3P82A 1GJPA 5HUPA 2YFNA 4RJEA 4NVTA 3EXRA 2ZZ2A 1DV7A 2NUWA 4NUWA 3MI2A 4FNTA 1OX5A 3BG5A 1KTBA 3L5AA 4UMAA 1SSDA 3G1AA 3G8RA 3MHGA 3EKZA 1FDYA 2ZDRA 3UWZA 1DBTA 5HNRA 3LRKA 2EAWA 3A23A 2C19A 3W7NA 3MI3A 4O57A 2NXIA 4I9AA 3KXQA 5A8GA 1FUYA 4ZQCA 4O53A 1HG3A 4NJJA 3MYPA 2J27A 3B04A 4O18A 4A22A 3TW6A 1XL9A 2ZZ6A 3A5VA 3TQVA 3R12A 1YPIA 3T78A 5HR6A 4KWVA 5DBTA 4OQVA 1ZALA 2VFGA 2TYSA 3HG4A 1RZMA 2YX0A 2ZZ5A 3H55A 3M7WA 1C9DA 2CFFA 3DKLA 1CX9A 3TXZA 1LDCA 1TQJA 4MYAA 3LBCA 2V81A 4MZYA 3NPWA 1QPRA 3PUDA 4HT3A 4BR1A 4DPPA 1AW2A 3PR2A 1SUXA 3JRKA 3PC0A 4MPQA 4UTWA 3H54A 3IRDA 1LROA 3F4NA 3W2KA 1J5TA 2GJNA 1W3TA 3LXCA 5DCEA 4UCGA 3WJXA 3NL2A 4JICA 5D2XA 5C55A 5BNKA 4WY0B 3NYZA 3FKKA 1V7YA 3S0CA 1JCYA 3W2UA 1D9EA 4N9DA 1XCFA 4NX0A 5AFDA 4K7YA 3LCIA 3NNTA 3NL3A 5C5YA 2G5WA 3FEMA 5T26A 1LP6A 3ANYA 4JTLA 5AYYA 3GDLA 3W1LA 1OF6A 3O07A 1QOQA 4HPXA 4EVZA 5F2IA 3NR0A 3GDMA 1SPQA 2QJGA 3I68A 3B0VC 4RZ4A 2QCNA 1H7OA 2F7FA 4UMBA 3LX9A 2A21A 3PVFA 1ZAIA 4XUGA 4MZ1A 3N73A 4M6QA 1G7VA 1NEYA 3PB0A 3O8AA 1Y0EA 3DFOA 1D3GA 2A6LA 3DI1A 3E0IA 4AXKA 5FF0A 3TROA 3TMLA 3M5ZA 2NLIA 2J9XA 1SW3A 1RQEA 2ZYFA 4AHQA 4RZ6A 3MJYA 1ZY9A 3IIVA 3P8IA 1OG0A 3DFTA 4IUOA 4PA8A 3KAOA 2C16A 3TSMA 2YPIA 2WNNA 4XTIA 3OA3A 3K30A 5L6UA 1KV5A 4JX5A 2ZA3A 3GDTA 4O1BA 4O4VA 1G7UA 1I2RA 3NM3A 2Y89A 2FPVA 4PTNA 4Z1CA 4DO6A 1MEIA 2VEIA 2DORA 3G1FA 4ML9A 3G0UA 3NPVA 4Q4KA 2X1SA 3E49A 4H4IA 4LWWA 4GE8A 3OVRA 4CNOA 4X3ZA 4BFAA 3LXBA 3LV5A 4DELA 2G95A 4Y6GA 1XUUA 2HTMA 3DZ1A 4NX5A 4UC5A 1RQBA 3S6DA 1SU5A 2UV8G 4WUIA 3MBDA 1LOSA 3G22A 3LHYA 1K7XA 3TFCA 1OYCA 1FX6A 3L0KA 4QNWA 4A2RA 3GK0A 4TMBA 3TDFA 4GC4A 3KVJA 5C2XA 3OBKA 4JX4A 2QUTA 1KFJA 2JKPA 3S1UA 4MJMA 4FF7A 4ZQPA 2Y88A 3FIGA 3G18A 4LNYA 2NUXA 3CIWA 3DHDA 3QF0A 5KITA 2DZWA 2G97A 4FHAA 4HNVA 2NV1A 5DCBA 1O60A 3LRMA 3M5YA 3BLFA 2RHGA 4S1FA 3W73A 4MVAA 4UR8A 1G69A 1SZGA 2EGZA 1S5VA 3LHVA 3PBUA 4WXZA 3LXAA 4JDBA 4POCA 3W7GA 1Q6OA 2GVGA 1TPUA 3A5FA 5F4SA 3W84A 4UNKA 1RPXA 3TC6A 1ZFJA 4ZZ9A 5LNRA 3DU0A 4ORIA 3NGJA 3KOFA 1MZHA 3P81A 5AHFA 3SFKA 4AF0A 4BI6A 3NQGA 1LBFA 1TQXA 1QMLA 4UUIA 3RK8A 5HWMA 2ATSA 1DHPA 3FJLA 2CLLA 3HGRA 3EX3A 1WAUA 1JQXA 3N34A 4HN4A 4QIUA 3W2LA 2H6RA 4Q33A 1LYXA 1L9WA 4JTHA 4R7JA 3ABSA 1TPWA 2HMCA 3Q58A 3QW3A 2NUYA 3W1RA 3WJZA 1Q6RA 2OT1A 3VE7A 3CWOX 3ZS4A 1B4EA 3FYOA 4O12A 3U6WA 5BMWA 2KZHA 2Z1BA 2E5DA 1QWGA 1FDJA 5FF7A 5TIMA 4FO4A 2H3BA 3O16A 3N2XA 2QCDA 4IMGA 4Y90A 5LHEA 1AW1A 1WOAA 1GG0A 4TX9A 5DXYA 3HMJG 1LM1A 4FIQA 1Z44A 4LS0A 1GEQA 5H91A 3HG3A 1VYSX 2QAPA 1WA3A 1P5BA 5AHNA 2ZZ1A 3G24A 5D33A 1QPOA 3BGJA 1K3UA 1GYLA 3LDVA 3GKAA 3B06A 3KVLA 4M7TA 3TJLA 2C14A 2DZPA 4NJGA 4ADSA 5D05A 5MHBA 2EPHA 3N9RA 4DBDA 2BXVA 1IIGA 5AHIA 2C18A 1TPEA 5EL1A 3NQMA 1FY6A 1W5QA 4I7WA 5D09A 2E1DA 4ADTA 3CEUA 4CQ8A 5U4NA 2CZFA 4BI7A 4MKNA 3M16A 4DF1A 1XDLA 1K8ZA 3S5OA 2PRHA 1R30A 2V2CA 1U5JA 4Z1DA 3LCXA 3S1WA 4NU7A 2EF9A 4LUJA 4RKAA 4Z08A 2QDHA 4ZQRA 3WJYA 2E5CA 2R94A 3F03K 4E38A 4ZQOA 1YYAA 2CWNA 3PBVA 1OFQA 4JD4A 2R8WA 4HIBA 1OK6A 4ALDA 1TO3A 1WDWA 1KBIA 5LSMA 2Q3OA 4Y8FA 1F74A 4DEFA 1NAL1 4IMEA 5HWNA 1QPQA 2B0MA 3FFSA 1KM5A 2ZTKA 4HPJA 1SR9A 3DI0A 3KRZA 4JTTA 2GUUA 1HTIA 5EY5A 2A4AA 5CGQA 1VC4A 4AB4A 1L6SA 4WZHA 4N02A 3DKJA 3LGEA 4HNNA 3N14A 1IIHA 2X16A 4UTKA 3NDOA 4NJIA 1TSIA 1XBXA 2WSRA 2VELA 3L67A 2QF7A 1H62A 1O5XA 4WJEA 4I7VA 1OK4A 4FNPA 2J88A 2WJZA 1LTDA 1KM3A 1NF0A 2XN1A 1N8FA 1GZGA 3SI9A 3VCRA 2R14A 1F2JA 4S2CA 4ZL1A 1TV5A 3LB0A 4LVFA 3UYCA 2E6YA 2V9DA 1GTEA 3TH6A 4TO8A 4NZJA 1YTDA 1TPC1 5BMXA 4QISA 1R2SA 2C1HA 2X1UA 1F05A 2XFWA 3EWWA 1Q45A 1V5XA 2NXGA 4IXXA 1H1ZA 5D02A 2TPSA 4OV4A 3LHUA 1G6CA 3KHJA 4L4LA 2E77A 3S8HA 4GWEA 3CT7A 4N4QA 1LBMA 3GLCA 2JGYA 4ADUA 4OT7A 3NQDA 4NXKA 4LRSA 3TU9A 4AWUA 1A50A 4YCPA 3I6RA 4UTIA 3THQA 3SW6A 2O7QA 4R53A 2JKEA 1G4PA 3HBLA 5CSSA 3MWAA 2ZA2A 2WV8A 1VZWA 3P74A 1JUBA 1UUOA 3JS3A 1GOXA 1KM1A 2J24A 2YFOA 2C15A 1YTEA 2E6FA 3C2OA 3UY7A 3UZ5A 1W3NA 1JCMP 3GR7A 5K4ZA 4MUZA 2CW6A 1HFBA 2Y63A 3AJXA 2VXNA 3C3NA 4YXGA 4WOQA 4UFLA 1LRTA 1TTPA 3BW2A 2LLEA 4Z0JA 1QOPA 4JYDA 2PC4A 3IV3A 2WNZA 3S5NA 2DZSA 3QYQA 4R33A 3QQ0A 1HUVA 4M19A 3W6YA 1UUMA 2ZBTA 4KWWA 1KW1A 4ZQMA 4UTUA 2XN2A 1QFEA 1JQVA 4A29A 2B7NA 4JS3A 3PS7A 2QCLA 6ALDA 3BGGA 1J4EA 1G4TA 2WSQA 4LVAA 1QNVA 2NWSA 1TPH1 1YTKA 1SO4A 5D04C 3W1AA 3V1PA 4EF8A 4KFOA 1CI1A 2E68A 2NZLA 4JR5A 1TYGA 5LKYA 3QM3A 1PE1A 1FCUA 5KZMA 1OYAA 1H1YA 3UWYA 2OJPA 1KTNA 2CLOA 4LUIA 3I7RA 3W1TA 1QO5A 4NNCA 2YXGA 5EPDA 3NOEA 1L6WA 1GVOA 1ME8A 2J9ZA 2NXHA 2ZRZA 4H6KA 5G1TA 3W7MA 3QH2A 4NNBA 1QPNA 1LCOA 4JIQA 1I2PA 2FFCA 1UB3A 4MY8A 4MFDA 4OWGA 1JR1A 4QNEA 5I3GA 4JEQA 3HGOA 3LTYA 3W07A 1TCDA 5FEWA 3STFA 4C1LA 1NSJA 1T96A 3LLDA 3NQCA 1L6YA 1TPVA 2CLHA 2FPTA 1K8YA 4JTKA 3GAYA 1TTJA 3NQ2A 3R89A 1MEWA 2R91A 1WX0A 8TIMA 1KV8A 1WBHA 2DJXA 3PULA 4JTFA 3S1VA 3E12A 3O6CA 1TRDA 4DO4A 5IBXC 3LI1A 2QCCA 1W5PA 1PCKA 2RFGA 3W7QA 4ZVJA 4O52A 1L2UA 4ICNA 5G2IA 5DELA 4IOTA 4ONVA 3CPRA 4RR4A 5GVJA 1FXPA 4XBKA 4DF0A 1VYPX 5J5RA 2OX1A 3L66A 4O17A 3GZ3A 3NL6A 1TTQA 2YCEA 3MP3A 4IX2A 4BI5A 1RD5A 3ZFHA 1EA0A 1VJIA 3UY8A 1WXJA 3WFAA 1Q6QA 4JY8A 3DFNA 1VR6A 2A0NA 3EWXA 3TR2A 3O6YX 3O6DA 4LY8A 4N9CA 1YPFA 5KZEA 2X30A 1OF8A 4KFPA 4FEZA 3W75A 1EB3A 3M0ZA 3P67A 1DORA 5AHMA 3W87A 4PODA 1JCJA 2A7RA 1TB3A 3G1XA 3R8RA 1W1ZA 3P5ZA 1ALDA 1YXDA 4O13A 4W9TA 1GVQA 2QAFA 1LRQA 1W31A 5G4EA 3G1HA 1XBYA 4BWLC 3LOTA 3ZWTA 3TXVA 4CQ9A 3PUEA 1XC4A 5F2GA 3W9ZA 4U4MA 3PG8A 4GJ1A 3Q2DA 1SSGA 1TIMA 3QRHA 2C0AA 2VEPA 4GUHA 1SO6A 3NG3A 5FESA 2C13A 1H7XA 3RLUA 2F84A 1S3HA 2WQPA 1MEHA 3BW3A 5CPOA 3SZ8A 4OU1A 2OT0A 3F1QA 1KFLA 5AC6A 1QCWA 5TBOA 4PC8A 4O14A 4JY9A 3W7HA 1H61A 2FJKA 1B57A 1VS1A 1I2QA 1EEPA 3UXAA 4FX6M 1FWNA 1GT8A 2ZCGA 4UFJA 5G2HA 3STGA 1QR7A 4DPQA 2I14A 3DH7A 2H8XA 1F73A 1VQTA 3O15A 2GVLA 5HINA 3RMJA 2TRSA 2YYUA 3L68A 4Q32A 4JTSA 3TC7A 1I8JA 1R47A 4B5NA 1R46A 1LLZA 4K8HA 2ZQ0A 3T7VA 1KTCA 4TIMA 1DL3A 3NQ8A 2X2GA 5K2ZA 3NA8A 3SR7A 2NX3A 2Z2UA 3CWNA 1OFOA 1MXSA 1I2OA 3IIPA 3WK1A 3NVTA 2GQAA 5E0KA 3W7KA 5IBXA 1WOBA 4IXHA 4WXYA 4UMCA 3ZWSA 2TMDA 3SGUA 4JX6A 1X7FA 3QPZA 3NXFA 2YW3A 2B7OA 4YWIA 4S2BA 4QQ3A 2CLEA 7TIMA 3N9SA 4O19A 2QCHA 3YPIA 3I7QA 3OHIA 3TFXA 1KBJA 1Z41A 1XDMA 1ICPA 3EEGA 1LLWA 4A3UA 4NNAA 3OEXA 3VE9A 3C2RA 1QAPA 3IIXA 4LVBA 5I3FA 1DVJA 2QR6A 5IM51 3PY2A 4R34A 3NQ6A 5C6MA 4DQWA 4LTSA 4RZ5A 1K03A 3HPZA 3GXTA 3W7CA 5AC8A 2BSLA 1EP2A 1O4UA 4MFEA 1KLZA 1PVNA 3LCLA 3LHZA 4UTMA 5EMUA 5CPNA 4O11A 3HIJA 4CNPA 1W5OA 3PSVA 3QMSA 2VC6A 3DAQA 4XZ9A 3TAKA 3L21A 3TE9A 3MP4A 2V30A 4RV8A 3PUOA 4PFMA 5HJLA 4OV9A 1R2RA 3W71A 1XBVA 2FPYA 1SW0A 1VH7A 4UTJA 3SGZA 4JIPA 4GFSA 1JCNA 2DZTA 3L5MA 3M1ZA 3W74A 4BWLA 5AC7A 2YYTA 4QSHA 3L5LA 5D38A 1UCWA 3GKFA 1W3IA 2Y7DA 4XWUA 1I45A 4CQAA 4D2JA 1TPB1 5AHLA 3RLVA 3P7YA 1IXQA 4OHQA 3MBFA 3I65A 1KFCA 1F6KA 4CCCA 1WQ5A 4AHPA 2RH9A 2CZEA 4HSNA 2C6QA 1D3HA 1ZENA 2WO5A 3GDKA 4RXGA 4TMCA 2RDTA 2FTPA 5K9XA 1X8FA 1RV8A 1Z42A 5CZJA 3N2MA 4P61A 1OFBA 3ABRA 3W83A 5E93A 3W1XA 1WV2A 2QJHA 3W86A 4O1DA 1MO0A 2Y61A 2EHHA 5AYZA 3LTSA 1OX4B 4O8RA 2PRLA 3UPBA 3LRLA 4GXMA 3GXNA 1I4NA 5HQEA 1GVSA 3EX4A 2DP3A 3M44A 1GYNA 5F1VA 2ISVA 2V82A 3W23A 3S42A 1SFJA 4JTJA 3VFLA 4BK9A 5BOOA 2W79A 4NJKA 3QSTA 3KVKA 2QDGA 3NPXA 5HWJA 3OVQA 1SZFA 3TSDA 3I7SA 4RCXA 1EUNA 3TUUA 1A5CA 3FJ6A 4JYEA 4NJHA 4O54A 5TQLA 3ELFA 1GQNA 4K38A 1E51A 2QKFA 4XQ6A 1JRCA 5DY2A 3MW7A 3S5ZA 3MYOA 3A9IA 1P4CA 5CKSA 3B0UX 5AB3A 1H7NA 3EXTA 3QMTA 4JDYA 3HGSA 2W6RA 1A53A 2JKAA 4MLRA 4ORMA 2Q8LA 5K3VA 1ONRA 3NL5A 5AHEA 2AQWA 2ZA1A 3GDRA 3IGUA 3L65A 3T44A 2A5HA 1VGAA 4PEKA 4XKYB 5EA9A 1GG1A 2ISWA 1F5ZA 3U2OA 2YW4A 5LNSA 2V5BA 5FI8A 3W72A 3UZJA 3WK0A 3G3MA 4Z1AA 2IQTA 1M6JA 1PV8A 2YZRA 3A22A 3GAKA 1OYBA 1JVNA 2AGKA 3PBWA 2YSWA 1C8VA 5FEXA 4NXSA 2WSYA 3IIZA 3M6YA 5K4XA 1FDZA 2WPBA 1H7PA 1IXNA 3KRUA 3S9YA 3O06A 4JXCA 4A2SA 4LV4A 1BKSA 5D03A 2Y7FA 1W0MA 2JBMA 4MY1A 4X22A 3CTLA 3HJZA 3G3DA 2H90A 3ZR4A 3W88A 2H8ZA 1F6PA 2NV2A 4GRSA 1BTMA 4FNUA 5AN7A 4E2DA 3W7JA 1KFBA 4FXSA 5LZLA 5I3JA 2A6NA 4CCEA 2VEKA 3P8JA 1XFBA 3UXDA 1ML1A 3O05A 3PM6A 4MOZA 4TU1A 4UFIA 1P0NA 5H2ZA 1GPWA 3DHFA 1H60A 5J5DA 3QW4B 3UD6A 1PS9A 3GNNA 2ZRVA 2JK2A 1VCVA 3BLEA 1WBJA 3C0JA 3S1XA 1IXOA 3VKJA 5I3IA 4MYXA 3DFPA 4LVDA 1KM2A 3QZEA 4ZMGA 3DXIA 4IWWA 3L9CA 2JGQA 4HNUA 5F4WA 4JTGA 1XI3A 4RX0A 4DBEA 1H7WA 3TV8A 1O5KA 3SJ3A 1KA9F 3M5XA 3NO5A 1EPXA 4LW7A 3TA6A 1TPDA 1H63A 3NQEA 2GOUA 2QEZA 2XN0A 3DFQA 1GWJA 3TQ0A 2Y7EA 1ZNNA 4TR9A 1EWEA 4MJZA 1JUEA 3W1UA 1TTIA 4M6VA 1VLIA 3PF3A 3W2JA 3W2NA 1YLVA 2V2HA 5CSRA 4YMZA 5LNVA 3W85A 2O7SA 4WD0A 5SWUA 4WOZA 4O0KA 1TV8A 1LRNA 3M9YA 3CEPA 1M5WA 2VFFA 3LCHA 1AMKA 2B7PA 2BWGA 1H7RA 4LRTA 3FLUA 4LS1A 3WK2A 1KM0A 4MIMA 2CZDA 1OVDA 2AAMA 1OFPA 3LHTA 2Y6ZA 3PSWA 4M6PA 3PWAA 2VEMA 2ZTJA 2DU2A 2I9EA 2RDWA 2E09A 3L0NA 5D2VA 1KM6A 2EKCA 3NPUA 1W56A 3ABOA 2CLMA 4WQ6A 3B0PA 3QFEA 1X1ZA 2DZUA 3QQ1A 4E0CA 4Z1BA
chains in the Genus database with same CATH superfamily
2VURA 3ABQA 3V0UA 2YDSA 4BF5A 4FXRA 1NM9A 4XAGA 4PL1A 1MMFA 1WDPA 1ZTVA 4FNRA 2GJLA 4RZBA 3AC0A 5I03A 1WP6A 4PH6A 3SIZA 4IGNA 2OSWA 2P0OA 1I2NA 1KFEA 2ZX5A 4GI4A 3CIXA 3THDA 3TX9A 4DLMA 1DQUA 4N4PA 3MUXA 4PTDA 5EU9A 3RNDA 1QHOA 1MW2A 4XISA 4JNMA 1UA3A 2ADAA 1YX1A 2XZ9A 3VUPA 1O68A 4JFVA 3LQGA 1DP0A 3H23A 4TTUA 3KVMA 3TYUA 2ACRA 3RJYA 1FWSA 5D9PA 3W70A 4LUSA 2Y8KA 4PUWA 1PCWA 1P1MA 3MWCA 5A2AA 3MKVA 3HQ1A 3VC6A 2EJ1A 1H5YA 4BA0A 5C71A 3GR4A 3MP5A 4LY4A 3H70A 1JDAA 5A1AA 3D47A 3GFYA 3RMEA 1PTAA 3GC2A 3WLPA 3VM7A 1UP3A 3WNOA 4ML4A 4ZO6A 3DBPA 4ZTXA 2B81A 5LA1A 2WKJA 2ZRWA 4BQ4A 4DZIA 1P1XA 4LF2A 2D20A 2YLLA 3GC4A 3AIRA 4LC8A 1H50A 1RP8A 3EWYA 2HISA 4QCEA 4JNZA 1E15A 2PTZA 4PB4A 2WBKA 3RFAA 4DYJA 2GDUA 2PZ0A 2E28A 2W3ZA 4IIHA 1K02A 3BUVA 1IF2A 2G96A 2YCIX 2ZDSA 4AZBA 4GO8A 3W76A 1TR1A 3U8GA 1XIIA 3REQB 1TWDA 2ISSA 3MSYA 4D6CA 2XYLA 3JUGA 2QCMA 1PHWA 2G3NA 5D4YA 4GUFA 4Y8EA 2IKHA 2P10A 3IAPA 1TG7A 1HVXA 3P62A 2GK1A 3BVJA 2GDQA 4MTVA 4WY0A 2DT0A 1UD4A 4MY9A 4Z2KA 4XZWA 3OJGA 4FB7A 1PHQA 1TWSA 2PGRA 3LD5A 4DXVA 1IR2A 2NQ9A 5HMSA 3K8KA 3KL3A 1SJCA 3EXSA 4X2RA 3KE0A 3FA5A 1TJPA 5D30A 3NQ7A 4QLLA 4AMAA 4GZEA 3SQSA 1FWRA 4EKJA 3HF3A 4O10A 2HS8A 2R82A 3R5EA 3H4XA 1OABA 1EGVA 5D2WA 2QUUA 2VWSA 3BAJA 4UTHA 2XISA 3AROA 2O56A 3Q67A 2PWEA 4V27A 2GVEA 4M3PA 4C1KA 1OFEA 3A3XA 4RL3A 4TV6A 4NYUA 1QBBA 2ZUWA 4ROPA 4EOUA 3NQFA 4WX2A 1M7OA 1A5SA 4WSJA 4ZO9A 4QLJA 3BLIA 5D2YA 5CBIA 3VABA 3U57A 2AQVA 1VYRA 2ABBA 2VOMA 4HCHA 1VFFA 3VOFA 2FVLA 3Q37A 1NF7A 4LF1A 1FCVA 4GYKA 4GUGA 3UWWA 1BWLA 3SRKA 4YL2A 1EJTC 4O16A 3QSRA 3AQUA 1M7PA 2GJXA 3L2MA 1W1VA 2PGWA 5FEZA 2J8TA 3JVAA 3ARUA 1YMYA 1KQYA 2ODOA 1E9IA 3MVIA 5AYXA 1R3SA 1QNRA 4A21A 1G1YA 3WJWA 4JL2A 2PDGA 4V33A 1D7FA 3LM3A 4YTSA 1YDYA 1PXGA 3RM8A 3STCA 2UWFA 3RXZA 2FLIA 3C8NA 3WQEA 1FCBA 2BHYA 2EBNA 3QEZA 1GJUA 1J0IA 1FXQA 1F7BA 1OY0A 3C52A 3J7HA 1HO4A 1QK2A 2XSXA 3TSBA 4O4WA 1H49A 2QIWA 3XIMA 3TW7A 4H9ZA 5E1QA 2ZWYA 3I4KA 1Q7ZA 3TCEA 3FOKA 4CD8A 3E2SA 2YKKA 3EBVA 5DCDA 3NOYA 3HQPA 4PRRA 2UY5A 1V77A 1AJ2A 1E1EA 3W1QA 3G0XA 4Z0SA 3HFYA 1DWJM 1EP1A 3NZRA 3PB2A 1UOZA 1JXJA 3GIQA 4HB7A 4CN6A 4PCFA 2OR2A 2DUXA 1LORA 1GNXA 3LPOA 1IEQA 3RJXA 3TYDA 1ISZA 5BU9A 1TWZA 2PDHA 3COTA 1JJKA 1U5VA 9RUBA 5CBJA 1KC7A 3G2GA 2CZ5A 1DTNA 1MXDA 4REQA 4J2PA 1XXXA 1B3OA 2Q02A 1JEZA 1YHTA 1ITCA 2V0TA 3O63A 4D6HA 1R2TA 1Q8JA 1XRTA 3G1YA 2WM1A 4K7VA 1JCXA 2PDBA 2XM1A 1CXLA 3QPYA 2PLMA 2C7FA 4G1NA 1W2VA 4OBTA 1YXYA 3VKBA 3DUGA 2YDAA 3BJTA 3BANA 1YADA 1BQCA 2ZE3A 4XIAA 3M46A 4JQ3A 2ZRUA 3IVUA 4MB5A 2YXOA 4JFTA 1XLLA 3E3HA 4GUIA 1C93A 3L12A 3ZT6A 1ZCCA 5DN1A 3W7PA 1A0EA 2VCAA 1H1NA 1VFSA 3C86A 4I9MA 4E2BA 1UZHA 5D32A 2YXXA 1KM4A 1BHGA 1F3WA 3EWCA 2ZRXA 2OMAA 3LLXA 3AICA 1FHVA 2VT0A 4CQDA 4J7RA 1IZKA 4FNQA 3POCA 3BL3A 1XYMA 4GUJA 4TX6A 1W3HA 1DJQA 3HG2A 4HPNA 2V69A 1X6UA 5KMYA 4QDWA 4MZ8A 1GVRA 4Y9NA 2FGBA 5ABHA 1Q6LA 3MMWA 3TOYA 2CXGA 3EPOA 5MKGB 5HATA 1S3TC 2PE4A 3GW3A 1L0PA 1UMLA 4J3SA 1EZ2A 1TR9A 1BTCA 1GGOA 1FWTA 3MV11 2EEXA 2GLKA 3PAJA 5U7SA 1MUMA 2ZXQA 2WZEA 4DY1A 2WVSA 2I9UA 3MSGA 2Z6JA 3DHPA 4XD6A 1C8YA 1ZHAA 1J2WA 1NDYA 3NM1A 1Q13A 5M1TA 3WMSA 2PAJA 5F4XA 3D0CA 3TK7A 1V0MA 3EEZA 2OYLA 1UASA 2PRMA 4XAYA 1EX1A 2WWDA 3L2IA 4TQTA 3WMLA 3TMQA 1VENA 3C4UA 5HUOA 3SN0A 1QOXA 3C6CA 3RLGA 1MSSA 1XSIA 4W8BA 3QLLA 5FF2A 1W9PA 4AEOA 1ADOA 4XBSA 2ZZ7A 2GDVA 3VD3A 3EWUA 1XKJA 1UQZA 2VDGA 2Z2BA 1V93A 2PTDA 5E6ZA 3VNDA 3O3RA 5T8GA 2FB2A 4C6KA 1UKTA 4RNHA 1THFD 2V2DA 5ENLA 3FKRA 3FJNA 3CL8A 1S5TA 1AFSA 5EGRA 1SMAA 4PUDA 1DQWA 4RE4A 4JCMA 1Q8AA 3I10A 3Q65A 3AXHA 1V3HA 1HZYA 4DXXA 2J78A 3T6CA 3GM8A 5C54A 5DRIA 1AK5A 4HMNA 4IMDA 3LYEA 3W1PA 4Z2IA 4Q8WA 1RHCA 3P82A 1Z32X 4CUCA 4ICCX 4H8NA 1U1UA 1V51A 3FSUA 3N2TA 3KBMA 3VKDA 2KAUC 2YFNA 4RJEA 5A94A 5AZ1A 2R1PA 2QJMA 3BG5A 4UMAA 1E9ZB 3PBGA 1SSDA 3G1AA 3MHGA 4FA3A 3UWZA 2PA6A 4NZ5A 4FR1A 4DAFA 4KWSA 2MUCA 1X7IA 1K6AA 3UYIA 3CWHA 1ONWA 3LPGA 4O57A 4NI3A 3UXLA 1VBGA 1W1YA 3KXQA 2ZX7A 5GQBA 1O66A 3WQPA 3WMBA 4QSFA 4QS5A 4O18A 3TW6A 4GKTA 1HKJA 1H5VA 3OG2A 4KWVA 5DBTA 3WH6A 2O0TA 3L23A 2DH3A 1RZMA 2ZZ5A 3H55A 2HWGA 4QJ5B 3TXZA 1Q4NX 2FTWA 4R9XA 4DUOA 3QR1A 3PPGA 2Z28A 2I56A 4AZCA 2Y8VA 1EOMA 2XINA 4EPBC 3EA3A 1FRBA 4KCUA 5EMMA 4DPPA 5FAJA 3CLWA 3JRKA 4HPGA 4QRNA 3H54A 3CUIA 4FI4A 3T07A 1XLGA 1EJSC 2PDYA 4IG2B 4BEUA 3F4NA 1MW1A 3KS6A 4UCGA 3NO1A 1IEXA 1O6IA 5A8QA 1V7YA 3W2UA 2QYGA 2FHBA 2PZNA 4NX0A 1A3HA 1P48A 1RY0A 4TTGA 3VCCA 5M17A 4JTLA 3ISIX 1H3GA 3DERA 4KRZA 4ATLA 3B9EA 3NR0A 4NRSA 3GDMA 3WQFA 1VP5A 3N2OA 4DM2A 2Q01A 1RY8A 1JPIA 3GXMA 1UR8A 3V0TA 4AD4A 3K4AA 4UMBA 3A12A 3DG3A 1G7VA 3PB0A 4LCRA 1EQCA 2A6LA 5DF0A 4I90A 4D8AA 3MKCA 1ZP3A 4AXNA 1ONEA 3TROA 3TQPA 2DSWA 8XIMA 2J9XA 3O7UA 1DTUA 1SW3A 2ZYFA 2GJRA 1XYAA 1OG0A 4O1EA 4IUOA 5JIPA 3KAOA 2C16A 3TSMA 5PTDA 3OA3A 4JX5A 3ES8A 3GDTA 5IOBA 2Y89A 5JVLA 2QMJA 5CLTA 1JF6A 1KR1A 2IKGA 2PP1A 2WKLA 4HGXA 3U0HA 2DORA 1F4HA 4DNHA 4LWWA 3REQA 1TX2A 3DZ1A 4NX5A 3SN4A 1DWFM 1OCNA 1JZ7A 4FP1A 1OG6A 1SU5A 2UV8G 2AKZA 1A4LA 2ZADA 2VCBA 1FX6A 4QNWA 4JIRA 1JGIA 2Y1HA 3GK0A 4TMBA 5I78A 2BG5A 2C91A 4JX4A 1NOFA 4MJMA 4PUJA 3CV1A 3W53A 4LNYA 1XLHA 5DCBA 5FJOA 4HA0A 4YTTA 3LHVA 2EKGA 4X60A 4JDBA 5CJ5A 3VIHA 1QNSA 5F4SA 4UNKA 1RPXA 1KRMA 1EJWC 1ZFJA 1F3TA 2WZIA 5LNRA 3CAQA 3VGEA 3SFKA 3OLIA 4H6RA 3SCPA 4UUIA 2F2HA 4OUIA 4LCSA 3PZMA 2DVTA 1DHPA 3H7VA 2GGHA 4YS1A 3TLQA 1JZ3A 4NZ3A 4HA4A 4PEEA 4Q33A 1EH9A 1L9WA 4JTHA 4R7JA 4E2VA 4J35A 2PF8A 3WJZA 1Z3NA 2YA2A 4Z1YA 2V5JA 1B4EA 1PX8A 2DPEA 2KZHA 2QQ6A 4MADA 3EDEA 5FF7A 3URAA 5TIMA 3AU2A 4FO4A 3O16A 3WENA 4Y90A 4EPEC 1AW1A 2BY0A 1QI3A 5DXYA 1Z44A 1RBAA 4S3BA 3S5SA 2BB0A 4LEFA 1J12A 5AHNA 2ZZ1A 4OVXA 3WEMA 5D33A 4OFCA 3TP4A 3GC5A 5KEZA 2W67A 1VFTA 3BGJA 1XWYA 1K3UA 2DT2A 3R10A 3UG5A 2YCJA 3B06A 1BQGA 1UR1A 4ADSA 5MHBA 1JCTA 2P8BA 2OZ8A 1C8XA 1W5QA 4I7WA 2CZVA 5D09A 2E1DA 3CEUA 3UESA 3CO4A 3QTGA 2CZFA 3NURA 4GC3A 1XDLA 5A2CA 2PRHA 2V2CA 1U5JA 4Z1DA 5C9ZA 3LCXA 1XPYA 3BAIA 3W82A 1D8CA 1E0TA 2WWCA 4NU7A 1RA0A 1U1JA 5E9AA 2EF9A 9XIMA 3QHNA 5FJPA 5LA2A 3KRBA 3QV7A 2YJQA 2Z1SA 3QVQA 3WJYA 2E5CA 3F03K 1VFOA 1RA5A 1YYAA 2XHYA 3SIMA 1PKYA 1OIMA 5M3WA 1S38A 1KBIA 5LSMA 4LX4A 2Q3OA 2YA0A 1RAKA 2RJHA 4J4KA 2DZBA 4Y8FA 1NAL1 5HWNA 1UD6A 2B0MA 4KPLA 4JFSA 1KM5A 1FFQA 2VGBA 4HPJA 1J93A 4PTWA 1HTIA 4AIUA 2A4AA 1PTGA 5DMNA 3LGEA 3PBMA 2J7BA 1IIHA 1MFVA 4NG3A 4GQQA 4HD5A 4IPLA 4WJEA 2P3EA 4Y9OA 4I7VA 3S9IA 4KEZA 1XRFA 2D2HA 1LTDA 2J7DA 3E0FA 3OGSA 2G0WA 4HNLA 3SI9A 5DT7A 3EGJA 2PSNA 4S2CA 4EANA 2E6YA 3ITVA 2OPJA 3B9NA 3KOWA 4BHYA 3OVGA 2I5GA 1GZ1A 1YNPA 4ZA0A 4DBUA 2C1HA 1EPVA 3S47A 2XVKA 3H6OA 3EWWA 2P3ZA 4PCNA 3MCNA 3WNNA 3KHJA 3S8HA 4GWEA 3CT7A 1LBMA 3OHMB 1UW9A 3TU9A 4LRSA 5A8NA 4AWUA 4I5RA 4YCPA 3UG4A 5HNNA 2NV9A 2O7QA 2QNEA 3FHQA 5MKGA 5BZAA 5CSSA 3MWAA 2ZA2A 1VZWA 3P74A 1UUOA 1ZS2A 1NELA 1RCOB 1W3NA 1JCMP 1HFBA 4P8XA 4GGBA 1MW3A 2DDXA 1YBQB 5JUVA 4WOQA 2FTYA 1LRTA 3QKZA 3BW2A 3VGFA 4XAPA 1Z89A 4B5WA 1K9DA 2PUZA 2EPLX 3HMCA 3QY8A 4L5ZA 2ZBTA 4KWWA 4Q22A 5FACA 4UTUA 1JPKA 4XVDA 3I3BA 2ZOXA 4MUPA 2QCLA 4PUMA 5D8WA 4WEVX 5I5RA 2AKMA 3L7RA 1WZMA 3ZLGA 1SO4A 3W28A 5JH2A 1IEIA 4JR5A 3GRIA 5LKYA 3KUMA 3QM3A 1PE1A 4YYFA 4GFIA 1OYAA 1H1YA 4QFUA 2DT3A 2YBVA 1MNSA 2OJPA 4D6DA 1KTNA 4A8RA 2CLOA 3I7RA 3T81A 3VXGA 2V63A 5T91A 1L6WA 2VOTA 5C2GA 1GVOA 1V03A 1ME8A 2J9ZA 3S2NA 4A6GA 3RO6A 1S2AA 2OGYA 6A3HA 3W7MA 4NNBA 4YTUA 3CH9A 3ZO9A 1I2PA 4H6QA 4MY8A 4OWGA 4QNEA 4QR6A 4JEQA 2UY2A 2YZ5A 5FEWA 3ITCA 3STFA 4XD5A 1RPKA 2D2OA 1T96A 3LLDA 3NQCA 1L6YA 1TPVA 3PTKA 2CLHA 4JTKA 3R89A 3NYDA 1MEWA 2VEGA 3XISA 5E6YA 8TIMA 3UZZA 3I3EA 3EA2A 1WBHA 2XVGA 3ARQA 2MANA 3PULA 3S1VA 3QR0A 1J2BA 1CLXA 3LI1A 2BGSA 2QCCA 1GOQA 3NIYA 2RFGA 1YPXA 2DUZA 1L8PA 3AMCA 4O52A 5G2IA 4AWEA 3H21A 2VRQA 4CU7A 3QTPA 3LG3A 2E9MA 3CUFA 3CPRA 4RR4A 3VD5A 4DWDA 3UR8A 1W1PA 4ES4A 4AC7C 5GJMA 4D8LA 5J5RA 3VIIA 5C9WA 4O17A 4GXWA 3GZ3A 3LENA 1X96A 3NL6A 1TTQA 1FWGC 3MP3A 1GCYA 1EA0A 4TOQA 1GOKA 5HJYA 3RCYA 3CTTA 1W3KA 3DFNA 3R0UA 5FSDC 2A0NA 1UC5A 1R3QA 3FAWA 4LY8A 5M03A 3W24A 5KZEA 3WQ6A 1EB3A 3M0ZA 3AMLA 1DORA 2GSHA 1VPQA 3V36A 4PODA 2A7RA 3SUUA 1ALDA 1YXDA 4O13A 4WHBA 2WHKA 2E8ZA 3G1HA 3LOTA 3ZWTA 4CQ9A 5F2GA 3W9ZA 4U4MA 8XIAA 4GUHA 1JNEA 2C13A 1H7XA 1BWVA 4ZE4A 4HTYA 3U9IA 5JXQA 2AQOA 2YLAA 3B4YA 6TAAA 2RAGA 3F1QA 4LPCA 4GA8A 3VD4A 1H61A 3VC5A 1B57A 1EEPA 2GUYA 1FWNA 2PFHA 3EPMA 4PZVA 3A9BA 4K1WA 2HK1A 2I16A 3T2PA 3DH7A 1XSKA 2WVTA 4LYQA 3K5XA 3W4RA 2TRSA 2YYUA 4JTSA 2JIWA 4IFOA 1R47A 3CL7A 1R46A 3LBOA 1V3LA 3IANA 1FA2A 5K2ZA 3JZUA 3B9AA 1XHGA 5EFDA 1UIPA 1K8CA 3CUHA 1REQB 4IXHA 4WXYA 2FDMA 2ZXDA 3SGUA 3NXFA 4MGGA 2B7OA 1V0NA 4QQ3A 4CVUA 3RN6A 1ZRQA 4O19A 2F2KA 3VZZA 1FTXA 1KBJA 3GBDA 4UOQA 4AYSA 3WNLA 1MUCA 3A47A 1WUFA 3EEGA 2A3HA 1LLWA 4OUEA 3BLKA 4GLEA 2W5FA 3VE9A 3C2RA 2ONEA 5I3FA 4HP5A 4LBSA 1ZLPA 2QR6A 4ZSTA 3PY2A 3V4BA 5C6MA 3PANA 1Q85A 3W7CA 3VX1A 4AZGA 1EP2A 2WCGA 1KLZA 1PVNA 3T42A 3WDJA 1P6WA 1IQ8A 8A3HA 1C91A 1E6NA 1V6XA 2ZC8A 3K2GA 2NSOA 4EXBA 3OB8A 2O9TA 3PSVA 2VC6A 3DAQA 2G37A 3L21A 2RGMA 3MP4A 2VD8A 1J0YA 1XBVA 1VH7A 4UTJA 1A5OC 1JCNA 3L5MA 3W74A 4IIGA 1VIWA 2Y7DA 1K77A 2J7EA 4D2JA 1P0BA 1QNPA 1KXQA 1AQMA 3MBFA 2YBTA 3I65A 4CCCA 1X1NA 1WQ5A 1KGWA 4RNIA 4Z2JA 3N6JA 2XH4A 3PZIA 1D3HA 3LUTA 3THCA 3R0DA 1CLVA 1X8FA 1FWHC 1RV8A 3B0XA 5I3DA 4P61A 2FMNA 1OFBA 3ABRA 3KCOA 4DNMA 3EDJA 3W1XA 3MANA 1GQJA 3W86A 2XG9A 5AYZA 3LTSA 3MVTA 5HQEA 4C91A 2DP3A 3M44A 2VGFA 3AIQA 2A3CA 4UZSA 1SFJA 4MDOA 2W79A 3KVKA 2QDGA 3C2YA 3AWOA 5IFTA 1DJHA 1UPPA 4HNCA 5HK4A 2P88A 1KB3A 3TUUA 1J79A 4JYEA 1JPHA 4PULA 1QASA 4PYSA 4XZIA 1JZ5A 1Y5VA 3A9IA 1KNWA 3N12A 1TUFA 4HMCA 4JDYA 1M7XA 3ABXA 4RV3A 1LQ0A 1DWHM 4UWMA 2W6RA 3P3BA 1A53A 3WD1A 2JKAA 4PE8A 4S39A 1ONRA 2XH7A 2ZA1A 3IGUA 3BSHA 1VGAA 3V1HA 5EA9A 5C9RA 2CYGA 3URQA 5LNSA 2YL6A 3K8LA 1JDEA 1CXKA 1UH3A 1ZUAX 1VPYA 2VL4A 3GU1A 1N8WA 1Y5XA 2IPWA 5FEXA 5HQLA 1V3MA 2X09A 5FIPA 4MWAB 1OT1A 3FVDA 4XSMA 1JYNA 4A2SA 4Z42C 1QNQA 3WQCA 2Y24A 3ARTA 3F5JA 1LG2A 5BRPA 4GRSA 1BTMA 3AHVA 1L2QA 5DFAA 4AQLA 1V0LA 3WBAA 4MAVA 1RCXB 4TU1A 5H2ZA 1FH9A 3UD6A 4Y2WA 1W2PA 4J3TA 4XD4A 3WFLA 3RPDA 1NQ6A 2ISDA 3TNBA 2J47A 1JZ8A 3QZEA 4L64A 5F4WA 5JQ9A 3CZJA 3A13A 3QY6A 1OT2A 1H7WA 2IW0A 4JTDA 4IZGA 1KA9F 5FA5A 3TA6A 3DFQA 2OLHA 2G4JA 4D9PA 5LA0A 2OYKA 4IPNB 1DIOA 3TQ0A 3G77A 4C6MA 2Y7EA 4P8VA 1ZNNA 4TR9A 2NQJA 4MJZA 3VIOA 2HROA 4V1XA 1VD6A 4M6VA 1VLIA 5AKQA 3WQWA 2GGGA 4YMZA 3B9DA 3W85A 4J3XA 2DSZA 4WD0A 3FK4A 3GH4A 3KHDA 2P8CA 2BWGA 1H7RA 2INEA 4FLOA 4L56A 1BGGA 4LRTA 4PR4A 3VX0A 3QFWA 3VKCA 2CZDA 4XSLA 3PWAA 3ALFA 3KL0A 4B4FA 2I9EA 2E09A 3ZMRA 3SEPA 4PMOA 3FEQA 4PBGA 1BVWA 5KETA 1NOWA 2CLMA 4Q7BA 5GJPA 3B0PA 9CGTA 4E0CA 1ZQ5A 4V15A 2C1GA 1AA1B 2V3GA 3S2MA 4X2PA 1A5BA 2Z29A 4QE4A 4ZB0A 4UOZA 3W7IA 2GVJA 1BVZA 4ZOCA 2O4QA 1CCWB 4QG8A 2EQDA 4HYVA 4N42A 3W2MA 3AWNA 2J7CA 1DJZA 4FMVA 3F4DA 2XUCA 3F5LA 1YBQA 1CYGA 3JR2A 2ABAA 4QAIA 1YDNA 3ONCA 4CQCA 1PEZA 4KFNA 2X1TA 3B05A 2Z0IA 1JCLA 3E6EA 3HA1A 3W7DA 1ENUA 4D6JA 1DQXA 2WNQA 3TQKA 3BV4A 5EMKA 5D2TA 1SW7A 1VEOA 4BJHA 2PURA 5CPQA 5CSUA 4GACA 1PYFA 2NT0A 4IGHA 3SCRA 1RK6A 2J66A 4NZFA 5EYWA 3KRSA 4O0QA 2XVPA 5BROA 5HJXA 2AOSA 5LGXA 3CQ0A 4WY0F 3T40A 3SRFA 1ICSA 1G4SA 4H00A 2PGFA 1XRVA 3CHFA 1K4GA 3ARVA 3FYYA 1DOSA 2W0UA 2FB3A 3EDDA 4C65A 2DVUA 2VRJA 1B1YA 3SY1A 1GONA 1PZ1A 3ZT7A 2J9YA 3T2QA 3DFHA 5T9BG 4MHBA 3GXPA 3CZ8A 3EKLA 4AAJA 5CZ0A 3I3DA 1D8WA 5K9DA 3OLDA 4KQNA 3BMVA 3USBA 3EX2A 2AGTA 1R7AA 3S2JA 2J74A 4WGXA 2CKSA 5DY3A 2Z1WA 2HQAA 2I57A 3W1MA 2X1RA 1XCXA 1H51A 2P76A 1FH7A 4U28A 3G0SA 3BCJA 4K3ZA 5G5IA 4QJ1A 3ARWA 4N9BA 2QIIA 3OG3A 3DECA 3FDGA 2YB4A 3WH9A 4RE2A 1K8XA 2V3EA 3V75A 3U2EA 5F1UA 1UWQA 4IX0A 4K37A 5AVNA 2H3DA 3AYTA 3UZXA 4XTDA 5CAHA 2PCQA 1G5AA 4IF2A 3SRDA 3RUBL 3HPXA 4UNLA 3NCOA 3WY1A 5FJUA 3SCNA 3ORWA 3GR8A 2VZUA 3VDGA 1JRBA 2QPUA 3VCNA 4HOXA 3HOJA 2XGIA 4LOCA 4AF0B 4ATDA 1UIOA 3GTNA 3ABZA 1X39A 1S39A 1JYXA 1XX1A 2Y70A 3TNOA 4HJWA 4WKFA 4GVFA 4GNJA 2X2YA 1LQ2A 3W7LA 1JAKA 3CXOA 1QDSA 4C6CA 2CLFA 3HPSA 3R1ZA 4OJYA 1QO2A 2PDPA 4WJ8A 1QHZA 4F2TA 2GJPA 4M5PA 2QUVA 2PWUA 1HT6A 4N6FA 1DJIA 3AXIA 2GQ8A 1DPMA 3BG9A 3F4VA 4N9EA 4J28A 3UWVA 3TJXA 5I23A 3RHGA 3P0XA 4P2VA 3UNTA 3N9KA 3WNMA 3QN3A 3UQNA 3CU2A 4EXAA 5A8PA 2C0HA 2GQ9A 1RJPA 1E1CB 3GVGA 1Q63A 1E6PA 2HBVA 2VFDA 3WNKA 5FJTA 4MMWA 3G1SA 3RAOA 3AIEA 3C61A 4KRUA 5LNUA 2VFHA 4X9SA 3W7OA 4DZHA 1VCFA 2G3MA 3A24A 1JFHA 4ACYA 3CO8A 2VP8A 4AH7A 5I3HA 3SJNA 3B4UA 1REQA 3LSBA 4EAYA 4GH3A 5F2MA 1NVMA 1AD4A 5A6MA 2DZAA 1UH2A 4DJDC 1VCGA 2ZC1A 3M43A 4UTLA 3IVTA 3A4AA 4AZ5A 5B7ZA 4O15A 1MZRA 4I6VA 3M5VA 2J7GA 4PSRA 4RXFA 3OQEA 3UEQA 3TCSA 3QY7A 2BMBA 1WZLA 3VI2A 1UR0A 4YVVA 3OIXA 1RR2A 3DFSA 3WDPP 3AI0A 3P5YA 3GH5A 2RKXA 2G8ZA 3H22A 3LHWA 4GO9A 3PNZA 4JCLA 2OFJA 4J3ZA 3B8UA 3LTPA 4XZBA 3RU6A 3TOPA 3EOUA 1UC4A 1XYLA 4MWAC 3H7UA 3H26A 1TE6A 1CGXA 1DJXA 4S3JA 3S5YA 4CN4A 4AU0A 3T08A 1C29A 2CCRA 3PJUA 2OZTA 5G1YA 3P80A 3INPA 1OD0A 4FXJA 1UD8A 1DJNA 2EPOA 2AL1A 4O1AA 3N6HA 4NZ1A 4TXEA 4HZ8A 5DMYA 5BXSA 3M41A 4CNSA 3GUWA 3IJ9A 2V67A 4HK7A 1EP3A 1TRIA 3SY5A 5FL1A 4FX8A 3W7RA 2WLYA 1ODZA 2VFIA 2IKIA 1HO1A 2QW5A 3U2ZA 3CQKA 3DC0A 4H9TA 1KWKA 5HMDA 3GUGA 4AD5A 3KX6A 2FIQA 2WBGA 3BW4A 1E6QM 3RM4A 3WZ0E 2DZVA 4IPIA 1XIDA 4GZJA 4B3LA 2C3ZA 4H19A 1S5NA 1V8EA 2PTXA 3OYZA 4LH8A 2PP3A 3VU2A 4ZXLA 3UNDA 3C0QA 5A6SA 5A69A 3SB0A 4LAKA 3P61A 1JL8A 4DJDA 5C8BB 3MHFA 5K9CA 2HVMA 4K8EA 4JEJA 2D2JA 3WDHA 2EO7A 4B3KA 3OZOA 1OADA 3H2MA 5A95A 1QW7A 2E5BA 2ZUVA 3SUVA 4PMUA 4B90A 2ZX8A 5AC5A 4FZIA 1GVEA 2Q6ZA 3H7RA 4LANA 3MUIA 4U2YA 1HQTA 3MZ2A 2DJLA 4WRHA 1O12A 2ZICA 1W37A 4F2BA 4CCZA 3WF3A 1EYWA 3IJIA 3RF9A 4YYCA 1TMQA 1BXBA 1OGGA 4QG9A 4ZO7A 2CBUA 3CZKA 3N4FA 2GQ3A 3GXFA 5FJIA 1XUZA 4HKPA 1ITUA 4AHOA 2ZFAA 1F61A 2HSAA 1XGDA 3GX9A 3KDOA 1LT8A 2DV0A 3VAVA 3FV9A 3GNDA 4MWAA 1A47A 4IFKA 3S2LA 4QITA 1GZJA 2TAAA 4K1GA 2E9LA 4AWTA 1EJRC 2VKZG 3FA3A 1XKYA 3MMDA 1X1OA 4YVPA 1UR2A 1U33A 5JBEA 3PZ9A 3DYMA 1S5WA 1J5SA 1E0UA 5KINA 3IGSA 2CU0A 4KIEA 3IUDA 4FOJA 3IJ6A 1KRAC 3BAYA 1O5QA 1UQYA 3CB8A 5CC6A 3EWBX 3QZAA 5I79A 1A5AA 3T05A 5LGZA 4N7QA 1BSIA 3K4DA 5DLCA 3KM8A 4IGMA 3TW9A 2ZZ3A 3RR4A 1FBAA 3D46A 4DJDD 1E6XM 3URNA 2RDUA 2C79A 1GJPA 4OOZA 2RGLA 1V6VA 3KOZA 2PWVA 5HUPA 4NVTA 1DV7A 3VKAA 1KGXA 3CB3A 3DC8A 1BG4A 1S2UA 1OX5A 1GORA 2WHMA 1FDYA 2ZDRA 1W32A 2VZOA 1M7JA 1Q4WA 3LRKA 2WXDM 3A23A 1B0IA 2WJEA 5CQ1A 2NXIA 1XLCA 1E56A 5A8GA 2QPXA 1FUYA 3AISA 4O53A 1HG3A 1MI3A 2CLPA 2QZRA 4NJJA 3VMOA 4EK7A 1XL9A 3M0LA 4H7ZA 2W27A 3TQVA 4DB7A 3T78A 1UKQA 1XQKA 3VA8A 4J3UA 4MWAD 1ZALA 3HG4A 2YX0A 3VMPA 3M7WA 3QZ6A 7REQB 3DKLA 3BSGA 3UZYA 1LDCA 4MYAA 3ARPA 3CJPA 4HA3A 3DESA 4U31A 3UU0A 4S3AA 4C60A 4WGHA 2OKTA 4MZYA 4ACZB 3NPWA 1BYBA 2FMOA 3AS0A 4XZHA 4BR1A 3BWWA 1YKWA 4Z2HA 4B5TA 2QGHA 3DX5A 3OW1A 3L4TA 4KF1A 2WZMA 2V5KA 2GGIA 5DEZA 3RCNA 3W2KA 1J5TA 3VNLA 2GJNA 1W1TA 1XJBA 5DCEA 2HNHA 2EPKX 5D2XA 5BNKA 4H2HA 5EMJA 4WY0B 3KLLA 4W88A 2XTKA 2EG7A 2OKOA 4H9YA 1JCYA 4N9DA 1XCFA 3TTQA 1KFWA 4S3DA 4GQ0A 4I3GA 3BE7A 2J8GA 3EOSA 3ME3A 5C5YA 2G5WA 4UQAA 5T26A 3A4XA 3ANYA 4JHOA 5AYYA 3GDLA 4HHLA 3O07A 5TAOA 3ZOAA 1ZP4A 4YN5A 3R43A 5F2IA 6XIAA 4DHGA 2QCNA 5D8ZA 1EKOA 3A3HA 5IHRA 1F3EA 4HZMA 3LX9A 2WANA 3PVFA 2ZUTA 1ZAIA 2QDEA 4XUGA 4M6QA 3E0IA 2FH8A 3IRSA 3M5ZA 2VC5A 4XIMA 1CEOA 4RUBA 1B54A 1BLIA 4AHQA 4W4QA 3KWXA 4L7ZA 3WD2A 5C7HA 3DFTA 4PA8A 4XTIA 1HL9A 1KV5A 4O1BA 1W9UA 1G7UA 2CITA 1I2RA 1ZJBA 4MSSA 1T6MA 2IS7A 4Z1CA 1HN1A 1HW6A 3EOOA 3S9ZA 4KETA 5REQB 2VEIA 3G1FA 4ML9A 3CMGA 3G0UA 3NPVA 3E49A 2EXOA 4Y9MA 3OVRA 4IISA 4CNOA 4RDVA 3WLLA 1NU5A 2JFEX 1XIGA 3K8MA 3UGVA 3VGGA 2G95A 2HTMA 4PBEA 4UC5A 4JN8A 4R85A 4LAZA 4LYKA 4C6LA 1GOWA 4WUIA 1X97A 1DJYA 4FLRA 4PMYA 3LHYA 2PLCA 3E38A 4ZFMA 4Q8MA 1TVLA 4GYPC 4A2RA 4DXKA 4Z2GA 1XLEA 1MXGA 4XAFA 1KFJA 2JKPA 3S1UA 2Y88A 2WQDA 5EBAA 3DHDA 5KITA 5DQPA 2G97A 2F8QA 1YRRA 3PHAA 1D2KA 2NV1A 4J40A 2D23A 3M5YA 1C7TA 2RHGA 3BLFA 2XIBA 3DDMA 4S1FA 2VZTA 3N6QA 1NH6A 4D6FA 4UR8A 1W1A1 1SZGA 2BV9A 3PTQA 3GNOA 1S2TA 4L4OA 4WXZA 4OBSA 2EPMX 4GX8A 4PUUA 2VX6A 1Q6OA 4IGSA 4HZ7A 2HVOA 1G94A 1B3WA 1TPUA 1UD5A 4HMDA 4ZZ9A 1HIZA 3KOFA 4E4FA 5AHFA 4AD1A 1X8CA 4AZHA 2D69A 4AF0A 4BI6A 2Z4GA 3NQGA 3RM9A 4ICMA 3L4WA 3RK8A 3DEQA 3FJLA 4B15A 3CPGA 4LUTB 4M82A 3STPA 4Q8NA 3HGRA 3N34A 1MYRA 3IACA 4HN4A 4QIUA 3W2LA 5LXXA 2H6RA 1ZGDA 5I06A 1LYXA 3U5YA 1OC5A 3B8WA 2FHCA 2HMCA 3W1RA 1KXVA 1Q6RA 2OT1A 3CWOX 3ZS4A 1CTNA 4UBPC 4O12A 2HDJA 2I5IA 2G41A 2OSYA 2E5DA 4O1FA 1FWAC 1H09A 4M80A 2WMKA 3L4VA 2H3BA 2WSPA 1XRSA 5BRQA 3WQ8A 4TX9A 1WOAA 1GG0A 1KO0A 5LHEA 3HMJG 1EJVC 4F0SA 1LM1A 1E6RA 4FIQA 4LS0A 2OODA 1E0XA 3HG3A 1VYSX 3T9PA 5ABFB 1W8GA 5BWAA 3GWQA 2QAPA 1P5BA 3SRHA 4A4AA 3R94A 2DSKA 4C6EA 5ABEA 4GGHA 3ES7A 4MKVA 1RH9A 4Q8PA 3GKAA 4XAZA 1MRQA 3KVLA 4M7TA 1RLDA 2WMIB 4KCWA 2BOEX 5D05A 3N9RA 4DBDA 2BXVA 2CHOA 5AHIA 4GYPA 2QMKA 4QROA 4W87A 5GNYA 3E2RA 5HPOA 1FY6A 1PKNA 1CWYA 4CQ8A 4J27A 3VZXA 1R30A 3IUIA 2X8RA 4AZ7A 1LL6A 2WMJA 1SFSA 4GISA 4C6PA 1PX3A 2XWEA 5LXEA 1BKHA 2FYMA 1OINA 3PZGA 1A3XA 4LUJA 1XR2A 4RKAA 1RALA 1KXHA 4Z08A 2QDHA 4CNUA 1TA3B 4ZQOA 3H24A 4WK9A 3OYXA 2FZ8A 4YIWA 4JD4A 5A6KA 1U22A 1R3VA 3TYBA 1VF8A 4D6EA 5AVHA 3KOYA 1GHSA 3GSMA 2GL5A 3APGA 3GY1A 4LQ1A 4DEFA 4ASTA 2DGAA 1QPQA 3FFSA 3M0YA 3VOHA 1K6WA 1SR9A 3C3UA 1J96A 3KRZA 2GUUA 1B30A 5CGQA 1VC4A 3LY0A 2XSBA 4AB4A 1EIBA 3D3FA 3IUHA 4HNNA 3N14A 1QPKA 1VFLA 2X16A 4UTKA 1RJRA 2VGIA 2HEJA 3UW6A 2WSRA 3OA5A 4Q7NA 1XYCA 3ITOA 3GTFA 2J7HA 1OK4A 3A4WA 4FNPA 3AXKA 2NT1A 3A64A 4TVDA 3RO8A 4LVFA 2V9DA 3DCPA 4NZJA 3GS6A 5C9XA 3OZMA 1YTDA 5BMXA 4QISA 5CC7A 1R2SA 1UWRA 1PUDA 3MT1A 1F05A 1Q45A 3FY1A 1FWIC 1V5XA 1LQAA 1E6ZA 1BAGA 1IT7A 1IEWA 4IXXA 3WLJA 2TPSA 3WUBA 4L4LA 3UCQA 4H9UA 4C5YA 5C9UA 2JGYA 1IWPA 3NQDA 4IMAA 4NXKA 4OT7A 3I6RA 4UTIA 3WUGA 3THQA 3VDAA 3SUWA 1H0GA 2JKEA 4RDYA 1X6LA 1OC6A 2OG9A 1D3CA 2WV8A 4E3TA 1ISYA 3QLDA 1GOXA 1Z69A 3I6EA 2E6FA 3UY7A 5K4ZA 2CW6A 4S38A 2Y63A 3M0IA 4Q8TA 2XJ7A 2VXNA 4RPQA 1GOOA 2OU4A 4YXGA 1QHPA 3UBPC 3CMJA 1VFMA 2LLEA 4Z0JA 4XG1A 3VIGA 3WF4A 3IV3A 3AIVA 1CZ1A 4M19A 3W6YA 5BYWA 2XN2A 5I2UA 3AHZA 3GNXA 5BU6A 4KWUA 4YPJA 2FZNA 1QNVA 1YTKA 1JD9A 2OLSA 1JDFA 2OQYA 5D04C 4EF8A 4XZMX 2E68A 3PTDA 1NY1A 1TYGA 1E4NA 3R6IA 1FCUA 3H2CA 4LUIA 4L80A 1V02A 4GOAA 2YXGA 5EPDA 3NOEA 3MPGA 2VTFA 3SCSA 2XM2A 2DSVA 1UR4A 3GZAA 3VIKA 2VI0A 1UB3A 3GVWA 2DIJA 3IJ7A 1TZ9A 1AH3A 2OTDA 2PDCA 4B9YA 2HXTA 3HGOA 3LTYA 3HQOA 5E0CA 4I5UA 4L1XA 4C1LA 5HNUA 4P7NA 4AISA 3IGHX 4XK2A 2BHUA 2X0SA 4RDWA 5CH9A 3GAYA 1TTJA 5E5CA 1BYCA 2R91A 1WX0A 1YQ2A 3MO4A 1KV8A 1TJ2A 3E12A 3O6CA 1TRDA 5IBXC 1JZ4A 1LWIA 1ZBKA 1EF3A 4ICNA 2PDNA 4DI8A 3MUZ1 4PUEA 5GVJA 3WELA 1WDSA 4XBKA 4B5UA 3TLLA 1VYPX 5FOOA 2G4FA 1IT0A 3RRAA 4CQBA 2PPGA 4JBRA 4KEUA 1Q2SA 4GYFA 4IX2A 4M8UA 3SADA 2MNRA 2PDFA 2XFFA 3ZFHA 7REQA 1KCXA 1VJIA 3R0KA 2DW6A 1PB0A 3WQGA 1VR6A 1WXYA 2QULA 1POJA 4HU4A 3TR2A 1HJQA 3O6YX 3LZ3A 2G3JA 3O6DA 4ACZA 4N9CA 2X30A 3BJSA 1OF8A 1U1HA 3P67A 1VRXA 3HJEA 3W87A 3KTXA 1KR0A 4GPNA 1J6PA 2OQHA 1HGYA 1GKQA 2WC7A 1E6SM 3UVIA 1J0ZA 1PBGA 2QT3A 1XBYA 4BWLC 1FOBA 2E40A 5D9OA 2VC7A 2IQ0A 2O9OA 3PG8A 3Q2DA 1CECA 5CC3A 3BH4A 4LAUA 2WQPA 1MEHA 3SZ8A 2OT0A 4BF7A 4O14A 3W7HA 4BQ5A 1N2VA 1HKVA 3N04A 3UXAA 2VZSA 3WG6A 3ZYZA 1QK0A 3S2CA 1ZL1A 4FX6M 4JTQA 3UJFA 2BGNE 4GINA 4UFJA 4YU1A 5G2HA 4DZ5A 3STGA 1QR7A 2I14A 2Z00A 3TEVA 3MUY1 2IKJA 3UA3A 1L6GA 4INFA 4NP7A 3WF0A 4K8HA 2ZQ0A 3T7VA 3GVRA 4TIMA 2VO5A 1GQLA 1DL3A 2X2GA 4RPPA 2NX3A 2Z2UA 4JAWA 1O1ZA 2AMGA 3CWNA 2W66A 3ID7A 4G56A 1I2OA 3IIPA 4M24A 1EGMA 5E0KA 5IBXA 1X7FA 4Q4OA 5CSYA 3N25A 1J0JA 4S2BA 1V6YA 4GQBA 3N9SA 3CPUA 3YPIA 3I7QA 3OHIA 1LWJA 5CGMA 1DHKA 1ICPA 1OCQA 5CPSA 3EAUA 3EWDA 3OEXA 4C6QA 5REQA 1CT5A 3N13A 1AJZA 4R34A 4CN1A 3SN1A 4D71A 5I77A 1OBAA 3GXTA 4LYPA 3BLLA 5AC8A 5M5DA 2BSLA 1UH4A 4GIAA 1V3IA 1M03A 3LHZA 5CPNA 1DWIM 3N29A 4OZOA 2H9AB 1EDGA 3QMSA 1BXNA 4RV8A 3U4FA 4PFMA 1R2RA 3H4GA 3SGZA 1NP0A 3T0AA 4BWLA 3M1ZA 4QSHA 4C6OA 2ACQA 4XWUA 3GH7A 4KH2A 2HZGA 5AHLA 3P7YA 1XW8A 5EB8A 3GVQA 3TR9A 3H2FA 2X42A 2PDLA 4CD6A 1FHUA 1AQ0A 2CZEA 4HSNA 2C6QA 2FJUB 1ZENA 3SQMA 4W89A 3IV8A 3VDHA 4RXGA 4TMCA 3KS5A 2RDTA 5LIUX 5CZJA 5E93A 2VR2A 3KEHA 2EHHA 3PZOA 4GXMA 3GXNA 3EX4A 4P5UA 1GYNA 2QUMA 5F1VA 3WNPA 4LUTA 3S42A 5BOOA 2QDDA 3PN8A 4JTJA 4NJKA 2PDMA 3SCWA 1V02E 3SCQA 5HWJA 1IYXA 1EUNA 3FJ6A 1AQHA 1GQNA 4XQ6A 1TFVA 1Q6DA 2PS2A 4Q7IA 3RPMA 4PMXA 3EXTA 4AX6A 1RVKA 2DVXA 5ABGA 1DJWA 3KBJA 4QE1A 4IPPA 1N82A 4CD7A 2Q8LA 3NL5A 1PSCA 2AQWA 3GDRA 3L65A 3T44A 2A5HA 2DSUA 4XKYB 4DBWA 3MTWA 5ABFA 1TV2A 2DH2A 1RK5A 3UZJA 3VILA 4MB4A 3CS2A 4GQGA 3PFRA 1KCZA 1M6JA 4NSBA 1I60A 5TD4A 2E0PA 2YZRA 2AGKA 3PBWA 2YSWA 4GZ7A 1C8VA 4JKKA 2XH0A 4NXSA 2WMIA 1FDZA 3CZEA 4CNTA 3R4IA 1IXNA 3KRUA 4WJXA 4QDPA 1PJ9A 1PTDA 4LV4A 4QX4A 3SURA 3RX2A 2Y7FA 3S1GA 4X22A 1RSCA 4X61A 3T1GA 3ZR4A 2H8ZA 3MCMA 4ZOAA 4ZB2A 4AD3A 3PNUA 3V5CA 4PN2A 2VMFA 1KFBA 4FXSA 4GKLA 1CDGA 3U7VA 4PMVA 5EMYA 3SCOA 3AUJA 2QPSA 4UFIA 1E5NA 1OB0A 1P0NA 1TA3A 3C0SA 2WYSA 1XIEA 3C0JA 1IXOA 2PDKA 4PRTA 3DFPA 3LU2A 2VEFA 3DXIA 3PFMA 4IWWA 4RE0A 1PX4A 4H01A 4JTGA 4QP0A 2PDIA 3RDKA 1O5KA 3SJ3A 1B3ZA 4LW7A 1TPDA 2QEZA 2XN0A 4J3VA 1GWJA 4FLQA 2F38A 4PTXA 1TV4A 4AG0A 3O0FA 1EWEA 4D1IA 3PF3A 3WFZA 1YLVA 2V2HA 3BXWA 5CSRA 3ANUA 4I5XA 2O7SA 3SCUA 5SWUA 4C6BA 1TV8A 4LXFA 1LRNA 3M9YA 3LMZA 3LCHA 1AMKA 2B7PA 3FHAA 5H8MA 2XH2A 3FLUA 4LAMA 1KM0A 3EOLA 1TZZA 1AODA 1TJ1A 4LSBA 3DHUA 7ODCA 4RE3A 3PSWA 4DYEA 2Z1KA 2ZTJA 4CU6A 3SBFA 1VAHA 2Y2WA 3KZPA 3NPUA 3CUXA 3TTOA 5LYRA 3VOCA 3GXIA 3QFEA 2DZUA 3QQ1A 3C2FA 1SFLA 5IHSA 4AZIA 2QLYA 2HK0A 1VPXA 3E9AA 4W7VA 1H4PA 5KTLA 1NWSA 3UPWA 4WDUA 3PK7A 3AYVA 4HVXA 6TIMA 4G6CA 1UWTA 3V0SA 2J75A 1TKKA 3MSRA 2HJPA 1UMYA 3W22A 2E6DA 3M0JA 5I7GA 1FCQA 2QCFA 3OO2A 4L61A 2P1FA 1GQIA 4AW7A 4YVXA 4US6A 3WLHA 1LLOA 3HU7A 4P7LA 5A6TC 2E67A 3M64A 4H3DA 2FQIA 3DYOA 1AH0A 4XX6A 4NF7A 5CGTA 2G3FA 3CM4A 1KKRA 1AL7A 1T0OA 5BRBA 1RVGA 1R3RA 5HBFA 1YDOA 2BY1A 1K9FA 2A3LA 3R13A 1VHNA 4DAIA 3R8GA 4DWSB 1NFBA 3GNPA 2AMXA 1P0KA 1PWMA 1FVPA 3CUJA 4N2YA 3KL5A 2NVCA 5LIYX 2B4GA 4RLIA 2XFRA 3WYZA 5AOUA 3UR7A 1BWKA 4CGTA 1G01A 5F2LA 4YLWA 2A7PA 3OLGA 3VNKA 1TV7A 3BARA 3HPAA 3WDRA 4DO7A 1DXFA 3W6LA 2QVHA 3B97A 4LVGA 2OB3A 3I6TA 3PZQA 1KWGA 1SYTA 3P84A 2WMGA 4UNIA 4BCEA 3GYEA 2ATMA 1DKWA 3LPFA 1XLFA 2Y62A 1VRDA 4NQ1A 2C1IA 1TREA 4FNSA 5HANA 2BZNA 2YL9A 1NP2A 3QMRA 4CCDA 2BVWA 3NSNA 2FFIA 4YTQA 3RRXA 4GNKB 4NIRA 1YIXA 2NWRA 1ISVA 1S1RA 4JGDA 4NT0A 1QI2A 4UR7A 2ACSA 1RUSA 1W54A 2ZWZA 4V1YA 3SO7A 1P7TA 1ELSA 1ICQA 3B40A 3BLOA 2CERA 3D6NA 3C2EA 4YNGA 2J4GA 3MCOA 2WKGA 4Y9AA 4K6AA 4NILA 4NZ4A 4J9JA 4JPGA 3AYRA 1HL2A 1NARA 3EMQA 2VM8A 1CW2A 3QGAC 1E9YB 3LBMA 4MLJA 3T55A 1QT1A 2PWGA 3FS2A 1RQHA 2HE8A 2XFYA 3GHRA 3B8DA 4R27A 4EF9A 3O9NA 1NWTA 5I24A 4MNMA 3EDFA 3NAVA 2NX1A 3OU8A 1LOQA 1LOLA 1LT7A 4BY3A 4M1BA 1Q6EA 4HHPA 1FH8A 1ZAHA 3LCWA 1FP8A 4GBUA 2CHRA 4JQ1A 3FNDA 1W3LA 3W3OA 3OLEA 2F9RA 3WUFA 3FJ4A 3AO0A 3UJRA 4F79A 2GGEA 2PCEA 1K9TA 2ALDA 3E74A 2J13A 1B90A 1VHCA 2DZXA 5EBUA 4AWSA 1T40A 1AQFA 4IJBA 3KFTA 4IQDA 2BTMA 3BMWA 1RBOB 4BQ3A 1VBHA 1LG1A 2QCDB 1JYWA 1AH4A 1GW9A 4CLMA 4QM1A 1I6NA 1IXPA 2OCZA 3CZLA 4C7FA 3MKKA 2CESA 4UTTC 2OZ0A 3FDKA 3V18A 2D0HA 3WH8A 4R9OA 4GMEA 4UFKA 4Q8QA 4AMCA 4IH3A 4GQRA 1TVNA 5BW6A 2V8ZA 3SM0A 3E1F1 1EWDA 1KFKA 5JBFA 4GI8A 1XG3A 3NQAA 2PDXA 4J3WA 3HZ3A 4YTRA 3M0VA 5L9FA 1SFTA 3CC1A 5LNWA 4WKAA 4HCDA 4IFRA 3QHMA 3VOJA 3OVPA 5I00A 1J6OA 3CHVA 1A5MC 3V16A 3WO8A 4AIOA 1VLWA 1SZNA 4ZOEA 3NFUA 4NKCA 4QDMA 2I17A 3ZJ8A 1FWEC 2HS6A 4AVOA 4JQAA 4LGXA 2WK2A 1PIIA 3IVSA 2WPGA 2A3EA 4OGZA 2NQHA 4QLKA 2H9AA 3UFYA 2I5QA 1WDRA 4ROQA 3B0YA 1GVYA 4EIVA 4AY1A 4E5TA 3MS8A 4C7DA 4BF9A 3D5HA 4IPJA 4C90A 4LC6A 1ZAJA 4HK5A 5HOSA 4IQLA 2ZUNA 1MQQA 3CQIA 3UT0A 3FXYA 3MMTA 4JN6A 3KBWA 1SZEA 2DFAA 4ZE5A 4FLSA 1EBGA 1M04A 3W25A 1CGWA 4GCXA 4S23A 2D73A 1V08A 2PWHA 3W27A 2RUSA 2IMRA 2Y4SA 4EAMA 5I3KA 1OFAA 4PSPA 4UTTA 1WNOA 2DUAA 3P60A 3F5KA 3TKFA 2A2IA 4IQEA 2WZHA 1OQFA 2CWXA 3WL1A 2BLEA 1U5HA 2GUBA 3M47A 4N6EA 3S6TA 4S3CA 5MF5A 4LU0A 4ECLA 5IFPA 2QHAA 3DENA 1IZCA 3QV8A 3B8IA 1TVPA 2A85A 2HBXA 3EX6A 4MG4A 4K39A 2VUNA 2BVDA 3W7EA 4D8ZA 2E6AA 4HSOA 2OXNA 1EJ7L 1UP2A 3DG6A 4GVHA 4I8DA 3F4WA 3CYVA 4L4PA 4XKYA 2BBFA 4AFYA 5FEPA 1BGAA 4U3AA 4IL0A 2HXUA 3HB9A 2B7QA 1Q7QA 1G0CA 1K70A 3UGRA 3WQOA 3A3WA 2ACUA 3BCFA 5DXXA 3H2EA 4PMJA 5EKYA 1IE7C 1UKOA 4IMCA 3R25A 3QC0A 5JMUA 4W84A 3VNZA 3W1NA 4IIFA 1EHAA 1SQ7A 1EIXA 1RLCL 4NYYA 1NIUA 2CLIA 2ZX9A 3BPWA 1Q5MA 4D6GA 1MVYA 1QNOA 4UZUA 3OTRA 5LHFA 3UWEA 2GPTA 3PBYA 1DIDA 4GYJA 5IDIA 1OCBA 1V6TA 1W91A 1JXKA 4QG6A 2YDQA 1GW1A 3O6AA 3BG3A 1XM3A 3EA1A 2WC4A 4B5SA 1PIFA 4O0ZA 3KCLA 3SY8A 3STEA 2OWXA 2GVYA 3CHEA 3EXRA 2NUWA 4NUWA 4CD5A 3G8RA 3EKZA 4DWSC 2OGJA 1DBTA 5HNRA 4TUFA 2EAWA 5EMLA 1GOIA 3CV7A 2C19A 3GFZA 3M0XA 3NJ3A 4NL1A 3MI3A 1HP4A 1GKRA 1PIGA 4JTAA 1DE5A 4KWOA 1EGZA 4A22A 3TTSA 4E6MA 3A5VA 1RD6A 2HE5A 1YPIA 4IP7A 3Q45A 3HTWA 4B16A 2TYSA 1F8IA 1X38A 1WUEA 4W85A 3UJ2A 1C9DA 3W29A 3AXXA 1UR3M 1TQJA 4U5KA 3GHSA 2PGEA 4O8AA 3LBCA 1A0DA 3RLHA 4X9YA 1Q6GA 2V81A 3PUGA 2HNEA 4YHGA 1B3XA 1QPRA 3PUDA 4HT3A 2GFTA 2ZXAA 1AW2A 4IT1A 3WMCA 1JZ2A 3PR2A 4GBDA 3PC0A 3KOXA 4MPQA 2D2GA 1LROA 3TWBA 4V28A 4DJFC 3LXCA 3E2VA 4F2UA 3F2DA 3NZQA 3DBNA 3FKKA 2XIJA 2Z24A 3APTA 1BD0A 4P7OA 4K68A 5A3HA 4W8AA 5AFDA 1B5TA 3LCIA 3NL3A 2V3DA 2WC3A 3WCZA 3V7PA 2PU1A 4L65A 4ZSUA 4NI8A 1QRQA 4HK6A 4MB3A 3W1LA 1OF6A 1YE4A 5JIWA 1JD7A 3WLIA 1OZQA 1SPQA 2Z1XA 3I68A 3B0VC 3NZGA 4S3EA 1C90A 1GVIA 4PTVA 3GTHA 4HSHA 4J2MA 2NLYA 4JHZA 1H7OA 2F7FA 3APYA 3ZJKA 4GHRA 3ZVHB 4RNJA 1KBKA 2PU0A 3RIKA 1XCWA 4LBUA 4E4PA 2QV4A 4M56A 3ZJ7A 3O8AA 4GD0A 3RPTA 3DI1A 3RU8X 2OO0A 4QEHA 5FF0A 3AS2A 1WKYA 2NLIA 1XLIA 4DWSA 2BP1A 1RQEA 3IARA 1SVDA 4RZ6A 2IUZA 2WZTA 3P8IA 4H7CA 3VO0A 3FVMA 1QI0A 2WNNA 3F4CA 1GQKA 1IR1A 3K30A 2DW7A 4O4VA 3OQ8A 3NM3A 2IPFA 3WDQA 1ADSA 2FPVA 2XGBA 3CK5A 4DO6A 4WSHA 1E9LA 1XC6A 4Q6XA 3TJIA 3VUSA 3CAWA 5FSEC 4Q4KA 2X1SA 4H4IA 4C6IA 3U48A 4X3ZA 2ALRA 4ZOBA 4BFAA 3LZ5A 3LXBA 3LV5A 4HOWA 1XUUA 1C3FA 4NAFB 4IIBA 2NVAA 5IXEA 3L4XA 3MBDA 2VR4A 1EXBA 1LOSA 1VKFA 1OEPA 3FA4A 1HGWA 2OZ3A 1T7LA 3ITGA 1XYFA 3H2OA 4W5UA 3TFCA 3L0KA 2JEPA 5FJJA 4GC4A 5HXMA 5C2XA 1HKKA 2QUTA 3KBSA 3KDNA 4DJFA 4ZQPA 4FF7A 5I07A 3G18A 1FWFC 3PZNA 3QF0A 3CIWA 4E2OA 4WDWA 5DT5A 6REQB 4HNVA 2ZXBA 3RX4A 4PCSA 2W61A 3SGGA 3UR5A 1F9CA 4UR9A 4YJ5A 3B3DA 3H2AA 2CPUA 3W73A 1HKIA 4FAMA 1EC9A 2EGZA 3ICJA 4IUGA 3LXAA 5DMLA 1UZ4A 3VIFA 1ZU8A 5CEWA 5DO8A 4KBXA 4POCA 3W7GA 3P6LA 4ZXOA 5AYBA 3G1RA 2QUNA 5XIMA 3W84A