3FYOA

Crystal structure of the triple mutant (n23c/d247e/p249a) of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
255
Chain Sequence
MDIKINDITLGNNSPFVLFGGICVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGGRRAQALDLALAGMATRLAGLFLESHALPLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase
publication title Reversing evolution: re-establishing obligate metal ion dependence in a metal-independent KDO8P synthase
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
total genus 81
structure length 255
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fyoA00
4WX2A 4Z08A 1SO6A 3NPWA 4FXSA 5LKYA 4CQAA 5CKSA 1SQ7A 1IXQA 3WK2A 3A5VA 2C3ZA 3B0PA 1ICSA 1AK5A 1RR2A 1Y0EA 3VKJA 3U8GA 4UR7A 3SY5A 2FPYA 2YFOA 2AAMA 3DZ1A 5DCEA 5F1VA 2GQ8A 3ZS4A 4JTGA 4UTJA 1QWGA 1FWRA 2B7QA 5HR6A 4K36A 1ZHAA 1GVSA 2GUUA 3HG2A 3MO7A 2GQ9A 3TK7A 3INPA 1G7UA 1R47A 3LRLA 4HPJA 3ZWTA 1MO0A 2WSRA 2YZRA 1TPDA 2V2CA 3TC7A 4OQVA 1DORA 3QH2A 4K7VA 4ALDA 1YYAA 3KOFA 4RR4A 3TDFA 1FCUA 3GXTA 3UPWA 3LLFA 1O4UA 3NOEA 4UNLA 3GDLA 4FIQA 3N2XA 2YCEA 1TYGA 2CLOA 1CI1A 3L5LA 4FNUA 4FNQA 2J9YA 2OX1A 2V9DA 3T40A 2FDSA 3PC0A 3G22A 4N9BA 3VI2A 1VS1A 3A21A 4ZQCA 4AMAA 4LS0A 4A21A 2QCMA 1F6KA 3HGSA 4ZZ9A 1QOQA 4CLMA 1RQBA 1JJKA 1T99A 2E6DA 4H3DA 4O1AA 5LNVA 1KM3A 4ZL1A 3LCWA 2VEMA 3W73A 1ZFJA 3KAOA 1QCWA 1NSJA 1YTDA 4ZVJA 4NZFA 3W22A 3AJXA 3UZ5A 1YTKA 1DBTA 3QFEA 1D3GA 4HNTA 5CZTA 3CWOX 4I7UA 1LBMA 5C5YA 1VC4A 3MJYA 2NWSA 1WOAA 1WV2A 3CM4A 3HPXA 1XM3A 1SW3A 3NZRA 2QDHA 1DHPA 3W75A 3KVKA 1G69A 3RLVA 1U5JA 4BI5A 3M41A 3EXRA 3QSRA 1HO1A 3GYEA 3IIZA 5FF4A 3STFA 4N4QA 4PODA 5EKYA 1GT8A 3B04A 4K6AA 4AVFA 1K8ZA 5LNUA 1FCVA 3UY7A 5LNSA 4JTJA 3W1XA 1GTHA 5K4ZA 4PH6A 1QOPA 1G7VA 1QPRA 4LY8A 3KHJA 3ZR4A 5L6UA 3P84A 2C6QA 1TV8A 5U7SA 2X30A 1QMLA 1FX6A 1W1ZA 2Q3RA 3IVTA 2NV1A 3SGUA 4PTNA 3HJZA 1I2QA 3GXNA 7TIMA 4GWEA 2NX1A 2QJHA 4BWLC 3WJYA 4ONVA 4HHPA 5KZEA 2J24A 4MFEA 2V5BA 4FO4A 1W8SA 4RX0A 1H5YA 3UPBA 1VCVA 2WO5A 5HNRA 3QF0A 1TQXA 1LORA 3NG3A 3LHTA 4LS1A 1NF0A 5D2TA 4KWVA 2Z6JA 4QITA 1WXJA 3SIZA 4JYFA 1NFBA 2B7PA 3LCXA 1W5MA 1X1OA 3DKJA 1OFDA 3QW4B 3NQEA 5FF2A 4O1CA 2ZDRA 3MP3A 4JR5A 2I9EA 2D73A 2FQIA 3TU9A 2F84A 1KLZA 3PBWA 1OX6A 3TQVA 3WK3A 1W3NA 1X6UA 4LVGA 3F4WA 2Z6IA 3NYZA 3QYQA 4D2JA 3DBPA 3NQ2A 4RZ4A 3FYPA 3W7PA 2IQTA 4JX5A 1QPNA 3S5YA 4FX7A 4O14A 2ATMA 2BSLA 1A50A 1W3TA 1JULA 2QJIA 3W7CA 5AC6A 4AF0A 4MFDA 5CZJA 4O13A 2V82A 3LXBA 1EIXA 2V81A 2ZTJA 3W6YA 3G3DA 3EB2A 1KM6A 4LWWA 3TUUA 1ADOA 4IXXA 1BTMA 5AYXA 4JTFA 5AC8A 2Y85A 5G2IA 5TIMA 3B0UX 3OA3A 1Q3NA 1SO4A 2DORA 5AYYA 3O05A 2ZA3A 1P0NA 1QAPA 4WOZA 2C16A 4UXDA 1QO2A 1HL2A 5D02A 3G1SA 4AWTA 4JX6A 1EUNA 3W3OA 2WNZA 3PBYA 5KMYA 5AHFA 1KM5A 3MYPA 6ALDA 3QPZA 3CC1A 4Z0SA 3LHZA 4NX5A 1ICQA 1UB3A 2RHGA 1PE1A 3C2EA 5EY5A 3NQGA 3LHUA 4MJZA 4YLWA 4A2RA 4A3UA 4AH7A 1JCNA 3G3MA 1YTEA 4Z1AA 1FBAA 3ABRA 4DPPA 1GG1A 2F7FA 3NPUA 3NQDA 4I9AA 2NX9A 3UQNA 3MBDA 1VQTA 2NUWA 3QEZA 1IXNA 3P61A 4A2SA 4L4LA 2FPVA 2ZRUA 3NNTA 2DZVA 3P74A 5EMUA 2TYSA 2GJLA 3WJZA 4DO4A 5DBTA 5K9DA 1TPFA 4UMAA 3ZWSA 3C3NA 3E96A 2QF7A 4E38A 4FX6M 1SSDA 3F4NA 1H7OA 3UWVA 4E2BA 1FWWA 3PB2A 1YXYA 3HBLA 5ABTA 3R13A 4DO6A 2JBMA 4NT0A 5EYWA 1EEPA 1M5WA 3M43A 5TQLA 2ZZ4A 4NJHA 1ME8A 4IPJA 2BZNA 4NJKA 1EP1A 1ALDA 1FWNA 3NQCA 3GIYA 5D04C 2QCNA 3E49A 4LNYA 3PG9A 3THAA 2ZRVA 5C2XA 1TPC1 1W37A 2NXIA 2DU2A 4NJIA 3TMQA 2FTPA 2DJXA 3UZJA 1ME9A 1SSGA 1BKSA 1NF7A 2CLFA 4O15A 3CWNA 3W87A 3NZ1A 1ZAHA 4R7JA 3W2UA 4CNOA 4GE8A 3EXSA 2ZZ6A 4QSHA 2ZRWA 2ZZ5A 2NXGA 3G1DA 2VFHA 5HUPA 2NWRA 3HPSA 3I7SA 1I2RA 1ZAIA 2VEIA 3VNDA 3LLDA 2JKEA 3YPIA 5F4WA 3N73A 5HULA 1F7BA 4MY9A 2B7NA 4H4IA 4AEOA 4IQLA 4PL2A 1HG3A 3UXAA 3W2MA 1XBVA 4UTHA 4WZHA 3NVTA 1LP6A 5AHMA 3UYCA 3FFSA 3MUXA 5KITA 3NM3A 2PRLA 3Q94A 3EEGA 2FJKA 1C29A 3W07A 4UTMA 5F1UA 2WPBA 1KM1A 2DZPA 3DFOA 3LHYA 1OFOA 2Y7GA 4TU1A 2DZXA 1S5VA 4MIMA 3TSDA 3EWWA 4ZQMA 3EWBX 4GC4A 1N8FA 5H91A 1VR6A 3NO5A 3D0CA 4EIVA 2YYUA 4JN6A 4UTUA 3UXDA 2A6LA 4MLJA 5CGQA 2JK2A 2C18A 4MLRA 3R12A 4PFMA 3UWYA 3MWAA 3PULA 3W7NA 2QKFA 1SO3A 8TIMA 5C55A 3LTYA 5G1TA 1EWDA 3W71A 1OHLA 4JTSA 5D05A 2E77A 2H3BA 1G4TA 4O18A 3DGRA 4Y9AA 3S6DA 4S2BA 1AMKA 2C19A 1VJIA 2DP3A 3RLUA 4UTIA 3QM3A 2Y7DA 3PB0A 1HUVA 3SGZA 4QAIA 3ABOA 2NX3A 3A24A 3LXCA 1XI3A 4WXZA 1TRDA 3WJXA 2X1UA 5AC7A 4UFMA 1K7XA 2DZTA 4UFJA 5K9CA 1OYAA 4N9CA 4P2VA 1JUEA 4IX0A 1I4NA 2WV8A 1B4EA 1TMHA 3PBUA 2FB3A 4M6PA 4NJJA 3RNDA 3LTPA 3N3MA 5CPNA 4UR8A 3S0CA 2H8ZA 1OYBA 3EKZA 3HIJA 4Y96A 4QISA 5DXXA 4GFSA 5BNKA 1QR7A 3IIPA 5CPLA 2CLMA 2Q8ZA 3DFPA 5AHIA 1UUMA 1KFBA 2ATSA 3UD6A 2E68A 2DZSA 1KFCA 4MZ8A 2QR6A 1W5OA 2A5HA 3M5VA 3L21A 3P5ZA 3V1PA 4LUIA 2CU0A 3W84A 4YL2A 3MI3A 2W0UA 3FIGA 2QCLA 4ZQNA 5DY3A 3B8DA 2CLHA 3O8AA 1YDNA 3PUEA 4CNPA 1MEHA 1N7KA 1VYPX 4IMGA 1R2RA 1IIHA 4NXSA 3VE7A 4C1KA 1OK6A 1ONRA 1AW2A 3EXTA 3EX2A 4I7WA 3O07A 4YMZA 4KWWA 4NZJA 1GVQA 3F03K 4WXYA 5KTLA 4XTIA 3ELFA 3NM1A 3BGGA 3B4UA 4OHQA 4Q4KA 2YR1A 4HSOA 3SFKA 1T8XA 3TW6A 2O7SA 5BMXA 3G18A 5HMSA 1SPQA 3P8JA 3TQKA 3B06A 5KZMA 3W85A 5AN7A 1EWEA 2PC4A 3S5NA 3C2OA 4MYAA 5EBUA 4UTLA 2A6NA 3MP4A 3S5OA 1UJPA 2ABAA 3HG3A 1PHQA 1PHWA 3RFAA 1YXDA 1TPH1 3Q58A 2X2GA 2PCQA 3S1VA 1OFRA 4N6FA 4CNNA 4OWGA 5BOOA 3IVSA 3MHUA 1TO3A 3EKLA 3H53A 1H62A 5LGXA 1LOLA 1WA3A 2YPIA 4NQ1A 5F2MA 3GDKA 3CU2A 4ZMGA 1GVOA 4LVFA 3W70A 1DJNA 4JTLA 3VE9A 2Z1BA 3LOTA 3BARA 4KKXA 4FNSA 1S5TA 4Z0JA 1UBSA 5F2IA 3FOKA 4RZ5A 1BWKA 5LSMA 2G96A 1K3UA 5G2WA 1W0MA 4CQ9A 1P5BA 3QMSA 4UFIA 5LNWA 3QC3A 2XN0A 3IIXA 3FYOA 2ZFAA 3PY2A 4HNUA 2B0MA 3L2IA 1PL9A 4M7SA 4YCPA 2YFNA 3FEMA 4QQ3A 1W54A 3O6YX 4DBDA 3WJWA 3TFCA 1KLYA 1BEUA 4HNVA 3NQVA 3TC6A 1Z42A 3BW4A 4JTEA 3BLIA 4NUWA 3LCHA 1JCLA 3M6YA 2CLKA 1A5BA 4GUGA 2TMDA 4RLIA 5AB3A 5SWUA 2Y89A 4FIRA 2VENA 4O19A 3KRUA 2TPSA 1GYLA 2XN1A 1WAUA 1KM2A 2EGZA 2O7QA 4ZQOA 1A5SA 3PAJA 1R30A 4RCXA 4CQ8A 3CB8A 4DF2A 3CT7A 2A7NA 3M44A 4NXKA 2ZTKA 3TIMA 1FDJA 2NV2A 4NNCA 1ZJIA 3E12A 4LRSA 4JDBA 2J9XA 4O8RA 5CZSA 4QIUA 3P81A 2VFFA 4TO8A 3G24A 1LDCA 3IGXA 4GRSA 3MHFA 1L6YA 2NLIA 1OJXA 2RDUA 4UC5A 3I7RA 3HMJG 2GVJA 3PM6A 2VFIA 3FS2A 1KV5A 3E9AA 5I3JA 2RDTA 3LBMA 4DF1A 4NVTA 3B03A 3CIWA 1JCXA 2CLIA 1YPFA 3LRMA 5BW6A 5FEXA 1K02A 4JX4A 3CTLA 3PWAA 3S8HA 4FEZA 5E1QA 2ZZ7A 1Q6LA 3PUDA 2ZQ0A 4GUFA 3M5ZA 1ME7A 1VZWA 4UUIA 3T78A 2AQWA 3T7VA 1W31A 3HG4A 4M6VA 3L68A 3Q2DA 1HTIA 2VEPA 5DBUA 1H1YA 4O16A 2J9ZA 1GEQA 4K37A 3BV4A 2GVLA 4LV4A 4O4VA 4N4PA 5A5WA 3A22A 3IVUA 1OFEA 3P7YA 4JTIA 4NU7A 5D03A 3BG5A 3BO9A 3HO8A 1RPXA 3IV3A 3O16A 4Q33A 4IXHA 3W7RA 5HQEA 5I3GA 1O60A 5HJLA 1WQ5A 4UFHA 1NVMA 1B57A 3GZ3A 3M5YA 3LM7A 4NJGA 5AHLA 3LCLA 5D09A 4XKYB 4RXFA 3PR2A 1E51A 3PF3A 3NQFA 1THFD 4HPXA 1LRNA 4O11A 1VHNA 4IMCA 3V75A 3GR7A 1VCFA 3SR7A 3LCGA 4B5NA 4LTSA 1ML1A 3NQ7A 5L9FA 1SO5A 2CLLA 5F2LA 3U6WA 2V2DA 5KSWA 3TH6A 5IM51 3TJXA 2ZZ1A 1JUKA 1DVJA 4XWUA 4A22A 4FHAA 4Q32A 3DHDA 2GJNA 3GAKA 4EOUA 3ZFHA 5G2HA 2Y6ZA 4KFPA 1SW0A 2OCZA 2BTMA 4E2DA 2BLEA 2ISWA 3M47A 2J6XA 1KFJA 4N2YA 1NEYA 2E6AA 3TAKA 4ZQPA 2HS8A 3KVLA 1SZGA 1XL9A 5DXYA 3P67A 5G4EA 1SUXA 4BK9A 4E0CA 3G1AA 3OHIA 3W7OA 3MHGA 3DXIA 1GOXA 2B7OA 1WBJA 3RU6A 4WY0F 4QNWA 1KM4A 2JKPA 2YW3A 5FESA 3PBVA 1W3IA 4LT9A 3PVFA 4JNMA 2C0AA 1JQXA 3UWQA 3T44A 3W7LA 4RKAA 1Q45A 1UASA 2V5LA 3OVRA 4MZ1A 2C1HA 4LC6A 1ZAJA 3DHFA 1TPEA 4LVDA 1WDWA 1VCGA 3TJLA 3IEBA 3C61A 4X22A 1O95A 5D33A 2H8XA 2PRMA 1K8YA 2Y7FA 2FFCA 3FKRA 3W72A 3JS3A 1PCWA 3L5AA 3BG9A 1IF2A 5U4NA 3LCFA 3GNNA 1GVRA 5G5IA 4CCEA 4JICA 2QAFA 4G1KA 2E5DA 4PCFA 4XBKA 5K4XA 4GJ1A 3M16A 4UIOA 4JYEA 3DI1A 5IBXC 4N6EA 4MVAA 3IGSA 4K39A 2H90A 4POCA 3UY8A 5MHBA 1GZGA 1AW1A 3LERA 1EB3A 1QNVA 1LOQA 5F4XA 1JQVA 2VFDA 3QW3A 4RV8A 1QFEA 3P8IA 1MEWA 4GUIA 4O1DA 2X1RA 4AHPA 5D38A 2ZA1A 3JR2A 4IMEA 3TNOA 2A2IA 3M0ZA 2LLEA 3GKAA 3LX9A 3OEXA 1XFBA 4FNRA 1H7WA 4JY8A 2QCGA 1F6PA 2CZFA 3MW7A 3W76A 1UCWA 2QCEA 3Q37A 1FUYA 1TPVA 5GVJA 1C9DA 4RZ6A 5DCBA 2ZCGA 4O0KA 2VOMA 1KBJA 3C8FA 3JRKA 3GXPA 4NNBA 3THQA 2OJPA 1PS9A 4O4WA 3W7HA 4R33A 2P0OA 3TCEA 3W7MA 3N2MA 4GUHA 2C14A 4PC8A 3M9YA 4UMCA 1SZFA 4OV9A 3C6CA 3PSVA 4JTKA 3N14A 1H1ZA 1YDOA 5J5RA 1TJPA 4RXGA 1KTBA 4TMCA 2R91A 2DZUA 4L4MA 5AYZA 4UCGA 4JDYA 1L6SA 4AHOA 3W74A 1RV8A 5EPDA 4HT3A 1SR9A 4DQWA 3TA6A 4N9DA 3C56A 4ICNA 4YCOA 2EAWA 1LZOA 4ORMA 1O5KA 1XXXA 1VLWA 1OG0A 3NXFA 2YXGA 1MEIA 1PVNA 1CX9A 1WOBA 1LBFA 3FJ6A 6TIMA 4Z1BA 1C8VA 1JCJA 4LW7A 4J9JA 4ZQRA 1TV5A 1LRTA 1SU5A 1CW2A 1H63A 4LC8A 4MY8A 2BXVA 4OV4A 3SECA 2WJZA 2QCFA 3OVPA 3W1QA 1F05A 2TRSA 1LYXA 4UFLA 4WQ6A 1B9BA 1F2JA 2XFWA 2KZHA 4IPIA 3N34A 3EWUA 2ISVA 2VKZG 3LXAA 5D2YA 3QRHA 3LTSA 2HS6A 3W2KA 3QMTA 2BWGA 2YGYA 2YX0A 2Z0IA 5I3IA 4A29A 3W1UA 4AB4A 2WSQA 4CCCA 3HGOA 2HTMA 1H51A 3QPYA 3W1NA 1Z44A 2WNQA 1TPUA 3TROA 2W79A 5CSRA 5I3KA 4BFAA 1R46A 3CPRA 1U83A 1TTPA 3KVJA 4AAJA 4X9SA 4IX2A 5T26A 4M19A 2DZWA 2X16A 3M1ZA 5DCDA 1XBZA 4EWND 3L65A 3S1XA 1GJPA 3L5MA 2WSYA 3OG3A 4LV9A 1AW5A 3BG3A 4MOZA 4IOTA 4O28A 2CLEA 4JY9A 3DENA 3KFTA 3NL5A 3B0VC 3FA5A 1H7XA 1G67A 2C15A 3P82A 3G1VA 2Z2UA 2Y62A 3PS7A 1L6WA 4LUJA 4MKNA 5LGZA 3TW7A 1K03A 2FB2A 1FCQA 1R2TA 3CHVA 1X1ZA 5A8GA 4O57A 3O63A 4OU1A 3GLCA 1I2OA 5EL1A 1OFBA 5K2ZA 3LHWA 4DBEA 2ZRZA 5K9XA 2V8ZA 1TRIA 4PL1A 2H3DA 4IMFA 2RDWA 1LLWA 4WY0B 5EA9A 2C13A 4QJ1A 4X3ZA 4FNTA 1QPQA 1J4EA 5D2VA 2GPTA 3G1XA 3W1TA 3PSWA 4Y90A 3G0SA 2RH9A 1D9EA 4JYDA 4O10A 1KV8A 3TAOA 1XUUA 1TREA 2CW6A 1SZNA 4K8EA 3TV8A 2QJGA 1GTEA 1JRCA 1XC4A 2QCDB 4GNJA 3G8RA 3P60A 3LCIA 4IGHA 2Y70A 5AOUA 4UTKA 1XDLA 3CEUA 1RQEA 1KW1A 1QDSA 3W7IA 4IWWA 3BW2A 4UTTC 5HUOA 1ZENA 3G1FA 4UFKA 5FEPA 3LI0A 3BVJA 1TTJA 4FB7A 1NAL1 2Y88A 4K8HA 3S1WA 1T0OA 1G4PA 2QUUA 3SW6A 3SJ3A 1ICPA 1AL8A 1IIGA 3DFTA 1JR1A 5FF3A 1MXSA 3W7DA 1EX5A 1P1XA 2R8WA 3QSTA 3KXQA 2GQAA 1VGAA 1Z41A 3S9YA 3KX6A 4YWIA 3KRZA 1YXCA 2E5BA 3GAYA 3SSJA 3O6DA 4HKPA 1I45A 4BI7A 5G4WA 3GKFA 1A5AA 2OT1A 3ABQA 3KRSA 2H6RA 4XKYA 2Q8LA 4O0ZA 3I68A 2Y7EA 3R2GA 3RMJA 3L0NA 3LDVA 3L0GA 1KTCA 1XCFA 2NXHA 2A7RA 1A53A 1F73A 1LTDA 1BWLA 4EF8A 5I3FA 2A4AA 1UUOA 2ZRXA 3HOJA 3DU0A 4UTWC 3FKKA 1VRDA 4LOCA 3DFNA 1H7RA 1Q6RA 3OBKA 1TTIA 3DKLA 4MJMA 2JGYA 4ADUA 1WYIA 3NA8A 5HR7A 1DKWA 2VC6A 1L2UA 2X1SA 2QAPA 4XQ6A 5LNRA 1ZY9A 3HQ1A 4Y6GA 4MY1A 3TFXA 5FF7A 5DELA 3HPZA 3W7QA 5LZLA 1RQHA 3I7QA 2CZEA 3IIOA 3MMTA 4HSNA 5HWMA 1OX4B 4N9EA 5CZ0A 5DLCA 4ORIA 1TV7A 2V0TA 2R14A 3B05A 1I2NA 1J5TA 3OIXA 1LM1A 1H60A 3AO0A 4MUZA 1KBIA 1OABA 2ZZ2A 3W1AA 4O52A 4CCDA 3CIXA 1J2WA 4JIQA 3W1RA 1KA9F 2QDGA 1I2PA 3NPVA 4LVBA 4R34A 4BWLA 3SZ8A 1PCKA 3GDRA 4KFNA 4Z1DA 1XDMA 3NR0A 3PUOA 3TSBA 1HO4A 3C4UA 4K38A 1YPIA 3H54A 1Z48A 3O06A 1LRQA 5J5DA 2JKAA 5DN1A 2E5CA 2A0NA 3R89A 3TXVA 3LV5A 3ATYA 2FIQA 5LHFA 3G1YA 1TPB1 2OZ0A 3HGJA 3ANYA 1EA0A 1VHCA 1GPWA 2EHHA 4GBUA 1XBYA 3MYOA 1W5NA 4GUJA 3GX9A 2J88A 3NQMA 4HNNA 5CPOA 1H7PA 1LOSA 3TR2A 3PG8A 1KM0A 3DFQA 4U28A 5KINA 3P80A 3TQ0A 1FCBA 3S1UA 3KVMA 4DO5A 4WD0A 1LLZA 1VH7A 3IGUA 1S3HA 2PURA 1MZHA 3USBA 4RJEA 3W1PA 1EP2A 1IXOA 1G4SA 1TPWA 3E02A 1P4CA 3QZEA 1FWTA 2I14A 2ZA2A 3EX4A 3P5YA 1RZMA 1H61A 3ABSA 4O54A 4H6KA 4P61A 3S42A 3UWUA 1XBXA 5BMWA 3W1LA 3BLEA 3CQ0A 3L67A 3GDMA 1H50A 3EX3A 3A5FA 3VFLA 3GDTA 1KFLA 4OGZA 3EX6A 4NX0A 3N19B 4AWSA 1LROA 3G0UA 2R94A 1KFEA 3I65A 2UV8G 3NAVA 4JD4A 3TE9A 4OE7A 4ML9A 3W2JA 3R5EA 2J27A 4EF9A 1G6CA 1XUZA 5K3VA 3VCRA 1H7NA 3STCA 2NUYA 2PRHA 4IJBA 4JXCA 1SFJA 3P62A 3U2OA 2G97A 2QUVA 3TSMA 1X7FA 3CEPA 5D37A 4O12A 4M6QA 4XBSA 3UWZA 3W23A 4RK8A 2JGQA 4OT7A 1IXPA 1T96A 1W5QA 1EPXA 5IBXA 3HG5A 3LI1A 1TIMA 4W9TA 4WJEA 5D32A 1X8FA 1WBHA 2B4GA 2YYTA 4UMBA 3C2RA 4WUIA 4LRTA 4M7TA 4BF9A 2E09A 2YDAA 3ATZA 3QMRA 4JS3A 2ALDA 1A5CA 3LGEA 3LBCA 1OFPA 3BGJA 3MI6A 3R8RA 3STGA 2EF9A 5HWJA 5HWNA 2BX7A 3DI0A 5FEZA 5D30A 1TTQA 3NEVA 2NZLA 3OVQA 4QM1A 3GR8A 3NGJA 1F5ZA 3HGRA 3MP5A 1SW7A 5BRBA 1GVFA 2YSWA 1OFQA 1AG1O 4IUOA 1DL3A 1LCOA 3O1NA 3TMLA 4LVAA 2CFFA 2QEZA 2EPHA 2FLIA 1DQWA 1KTNA 2Q3OA 4UNKA 3C2VA 4PEKA 3W2NA 1OFAA 1N55A 3L66A 3N9RA 4XZ9A 2OT0A 5LHEA 3M5XA 5CPMA 2P10A 1QPOA 3GB6A 4FX8A 1DJQA 2VFGA 3LHVA 1KFKA 1OF6A 3BLFA 3I6RA 4MYXA 1L9WA 4FXRA 4QNEA 3IRDA 4HN4A 3UWWA 2ZZ3A 3EWYA 3G0XA 5C54A 3HF3A 3LV6A 2HSAA 1FXPA 1F74A 3STEA 1OYCA 1W5PA 4EVZA 1M7PA 1LBLA 3G8EA 2E1DA 4TIMA 3W9ZA 1TB3A 1MSSA 4S2CA 1K7EA 2HMCA 1TJRA 3RF9A 4OBTA 4BR1A 3RK8A 1JUBA 2YW4A 1ZCOA 4MPQA 4JIPA 5D2XA 1FWSA 1FDYA 3FLUA 1GQNA 1GYNA 4LS2A 4NNAA 4X2RA 3L0KA 1HFBA 3QQ1A 3O15A 1O94A 4O17A 1M7OA 3GNDA 1AL7A 3W83A 4AF0B 4WOQA 5CSSA 3W2LA 1EP3A 3QQ0A 1ZALA 3TXZA 1JCYA 4U4MA 3K30A 4WY0A 2QCCA 4S1FA 2X1TA 4LU0A 4I7VA 4FF7A 5K7JA 2VXNA 4DEFA 3W7GA 4R53A 5TBOA 5D2WA 2Y61A 5E0KA 3F1QA 5CG7A 2QCDA 3LB0A 3WJSA 3SI9A 4MZYA 2WNNA 2QCHA 3W7KA 4JTTA 2A21A 1DV7A 5FI8A 2ZYFA 4C1LA 3A23A 3EX1A 5F4SA 3N9SA 1S5WA 3NDOA 4JGDA 3W88A 3M7WA 5G1YA 5KZDA 1G4EA 4Y8FA 1DOSA 2G5WA 2P1FA 3W1MA 3W86A 2QUTA 4AXKA 2ZRYA 3T4CA 3NQ6A 2EKCA 1DQXA 3W7JA 2WQPA 4GXMA 5HINA 3H55A 1FQ0A 1TSIA 5C6MA 3NL3A 1RD5A 3WK1A 4ADTA 1YDVA 4K7YA 3W7EA 4ADSA 5F2GA 4IMDA 2GVGA 3UNDA 1R2SA 3QJAA 4N02A 4AWUA 3T55A 1I8JA 4PA8A 4DPQA 1FDZA 3EWZA 5AFDA 2OMAA 3O6CA 3TKFA 1O5XA 3BPWA 3MBFA 2VELA 1OVDA 3NL6A 4TR9A 3MI2A 2AGKA 3NL2A 1EUAA 1RVGA 1JRBA 1YLVA 3CLMA 4YXGA 3EWXA 1GWJA 1XKYA 2DJLA 3IIVA 1VPXA 2E6FA 2WOQA 4TX9A 3BW3A 1VYSX 1JVNA 4JTHA 4XUGA 2NUXA 2TSYA 1F76A 3HB9A 5AHNA 5H2ZA 3NQ8A 3C0JA 1GG0A 5AHEA 3LRKA 3DAQA 4TMBA 5FF0A 1K8XA 3DH7A 1K7FA 1P0KA 4AHQA 2VFEA 3FJLA 1OK4A 4FNPA 2PE4A 1TQJA 1OX4A 1YADA 4BI6A 3NPXA 1M6JA 3GK0A 2V30A 1W56A 3A9IA 2ABBA 4UTTA 2CZDA 1B3OA 1QO5A 4O1BA 3TX9A 2CWNA 2RFGA 2V2HA 3G1HA 3GVGA 2G95A 1D3HA 1V5XA 4M5PA 3DFSA 2ISSA 2WKJA 1PIIA 2VEKA 2XN2A 1VLIA 4DF0A 3C2FA 1OX5A 1JCMP 2I1OA 1PV8A 2E6YA 1VYRA 3E0IA 2RKXA 2A1YA 4DXVA 4JTUA 2FPTA 5FEWA 1WX0A 4HIBA 1FY6A 1V7YA 5DY2A 1OF8A 4KFOA 5I3HA 3WFAA 2ZBTA 3WK0A 4O53A 2A7PA 3S5ZA 3L9CA 4O50A 3NQAA 1Q6QA 1FXQA 1Q6OA 3BK0A 5E93A 2CZ5A 4XTDA 1IGSA 2GOUA 1TCDA 1SZEA 4Z1CA 1B4KA 1SFLA 1ZNNA 4DELA 3C52A 2W6RA 4JEQA 4UTWA 2A85A 2Y63A
chains in the Genus database with same CATH superfamily
4Y9NA 1OADA 3VDCA 4CQAA 1I60A 4C6CA 1DJZA 1WXZA 3DG3A 3REQA 1IXQA 3VX1A 3WK2A 2C3ZA 3NDZA 5HPCA 1Y0EA 3VIJA 3B9NA 3DESA 3KS6A 3DZ1A 5DCEA 5F1VA 3TC3A 4CD8A 3TQPA 4AC7C 1BTCA 2B7QA 2EPNA 3BZGA 1GVSA 1G7UA 3LRLA 1XRFA 1K4HA 3TC7A 4OQVA 1KBBA 2VR4A 1YYAA 1FCUA 2Z2AA 3NOEA 4EAMA 3KZSA 2O56A 2YCEA 3E5BA 3ITTA 2CLOA 2YBUA 3VPLA 4TX6A 2J75A 4FNUA 3HPAA 4FNQA 1DWJM 4JIRA 1SZRA 3CV7A 3TLQA 1W1B1 4N9BA 3VI2A 4AMAA 4LB3A 5I3DA 3HGSA 1I9CB 1QOQA 4QDWA 2RAGA 3ARSA 1JJKA 1T99A 4H41A 3OZPA 3LCWA 4OBRA 4JN7A 1EJWC 2CERA 1RCQA 3BOXA 4C91A 1YTKA 1D3GA 1UR2A 2XM2A 1C3FA 5CZTA 1E6NA 3CWOX 4I7UA 3N4FA 1R5YA 4KH2A 3EZ4A 4LH8A 1XM3A 3NZRA 3H4GA 2QDHA 1XGZA 5AVNA 3RLVA 4GCAA 1WZAA 4V1YA 3M41A 2FVKA 3QSRA 5A69A 2CLPA 2MNRA 4Z2LA 3GYEA 1TWWA 4H6EA 1GT8A 1R3SA 3ANVA 5LNUA 4JTJA 1J6OA 1PXGA 4FI4A 2W62A 1QPRA 1E0UA 3TYAA 4QP0A 1UROA 5BWFA 3APYA 3P84A 4D72A 4QDPA 1TV8A 2XH7A 2X30A 3TNBA 4YIWA 1Y5XA 2NV1A 3HJZA 2UZ9A 1I2QA 1DWFM 3GXNA 7TIMA 4AZHA 3H2FA 2NX1A 4F0HA 1S2VA 3EA3A 1WDRA 3KL0A 3MO4A 3BOLA 1MUCA 5HNRA 2WO5A 2WZEA 4RNIA 4WR3A 1EDQA 2FYMA 5D2TA 4AD3A 2CESA 2AQOA 3NO1A 3SIZA 4REQB 3LG3A 2W92A 1J0ZA 2O4QA 3IJDA 5FF2A 2OQYA 4KMQA 1PWLA 2PDMA 2Y8VA 3G6MA 4PMVA 2ZWYA 3S4TA 3PBWA 3IAPA 2GGEA 1AQFA 3AIQA 1NM9A 3CL8A 4LUSB 1XIFA 4CNSA 3NYZA 3PZMA 2XH2A 4HBKA 2R24A 3CV2A 3UPMA 3NQ2A 4RZ4A 3FYPA 1SMDA 1QPNA 1MW0A 4ZO9A 5LA2A 4TV5A 1A50A 1W3TA 3ITLA 4MFDA 5CZJA 2V82A 3LXBA 3RMEA 4LNCA 5ENLA 1UD4A 3W6YA 4XAPA 2GSEA 2YL6A 1XCWA 1VKFA 1E4IA 5C7VA 3RJYA 1CCWB 1FOBA 4W8LA 3OA3A 1Q3NA 2CHRA 4JCLA 3O05A 1S2TA 4WOZA 4UXDA 4JIHA 5HJXA 5D02A 4J4KA 1EUNA 1M01A 2JF7A 3QTGA 4KEZA 5AHFA 2VTFA 1KM5A 4E4FA 6ALDA 4DNHA 3CHDA 1XLCA 3QPZA 3CC1A 4Z0SA 5ABFA 3Q67A 1QHOA 3ANUA 3AXHA 2ZKMX 4MJZA 2WVSA 3BMWA 1WO2A 2ZOXA 3MUY1 1JCNA 4NILA 1YTEA 4AVOA 3LQGA 5GNXA 1KRCC 3ABRA 4M6UA 1X97A 3NPUA 3NQDA 2BVTA 4GZJA 1VFUA 1VQTA 1W3KA 5A8QA 1IXNA 1RA0A 2QDEA 4L4LA 2ZRUA 4Q8QA 2DZVA 4KESA 3WJZA 2NSOA 3AC0A 3K4DA 1OT2A 1UW9A 3C3NA 3E96A 4E38A 1D2KA 1XSKA 4QE5A 4E2BA 4KWUA 1E0TA 3HBLA 3R13A 4DO6A 2JBMA 2D2GA 3RXZA 4JIEA 3ABXA 4NT0A 4L9YA 5EYWA 4F2TA 2IMRA 1EEPA 2WMIB 3M43A 3GW0A 1ME8A 4IPJA 4KBXA 2BZNA 5DF0A 1FWNA 3BH4A 1M68A 1R3TA 3GIYA 4LNYA 3EPOA 1TPC1 2NXIA 2OWXA 1Q66A 3ARYA 5FJRA 3UZJA 1Z3NA 5EGRA 3BAWA 3CWNA 1UUQA 1ZAHA 3BURA 3N2TA 4E4UA 2PDJA 2C79A 4QSHA 2ZRWA 2ZZ5A 2NXGA 4BY3A 5HUPA 1I2RA 1ZAIA 2JKEA 1B0IA 4MY9A 4H4IA 4IQLA 4BF5A 5E70A 3LPPA 4DAFA 1Y8BA 3W2MA 1EDGA 1PTAA 4WZHA 3UYCA 3ITCA 3KHDA 2Z26A 2A3AA 4QHRA 2FZ8A 5AYIA 3EEGA 3OYXA 1UR4A 1ZU8A 3WD4A 1Q63A 2Y7GA 2J8TA 2ZC8A 4F66A 2J62A 5ABEA 3H4XA 2EJ1A 2FTYA 3EOOA 3FN9A 4GC4A 3SCSA 1VR6A 2G41A 3NO5A 4PRTA 2QGHA 3UXDA 3KBMA 1PIFA 5I03A 2XH4A 1R7AA 1KBKA 4MLRA 4PFMA 1NP2A 3UWYA 3UG8A 3PULA 1RLDA 5M3WA 5C55A 3LTYA 4KERA 5G1TA 4X2PA 1EWDA 1OHLA 3EB4A 4JTSA 4XAYA 4YPJA 2CBVA 2HXTA 4Y9AA 1XWYA 3S6DA 4DN1A 1LF1A 2CBJA 2BBFA 4AIOA 2Y7DA 4UWMA 4YTRA 1HUVA 4QAIA 4J3WA 4HHHA 4B2DA 5TNVA 3WN6A 2X1UA 1QI5A 1K7XA 2WANA 3T0TA 1I4NA 4L65A 5TD4A 1TMHA 4HVXA 3T0CA 4NJJA 3RNDA 4HK6A 3EGJA 2UY5A 3AQUA 1A5LC 2BODX 1GQLA 3HIJA 4QISA 5DXXA 2P3ZA 3IIPA 1CWYA 3GU1A 4MG4A 2CLMA 2PDIA 3PP7A 2ATSA 5JIPA 3DX5A 3M5VA 3V1PA 1VBJA 3A4XA 4GK8A 4J2MA 2PGEA 2BP1A 4U3AA 2HXUA 3MI3A 4ZENA 5ECVA 2OXNA 1DE5A 4ACYA 2QCLA 4ZTXA 5JQ9A 1U33A 1B90A 1AJ0A 1TV3A 1WKDA 2MANA 1JG9A 4L4OA 1RCXB 1W1A1 3R11A 1VYPX 3M0MA 4NXSA 5CGTA 3UP8A 4LALA 1VENA 4R5EA 1ONRA 3C3UA 4GNKB 4I7WA 4YVPA 4YMZA 5IHRA 1EJRC 1YMYA 4D6GA 3JZEA 4NZJA 1TZ9A 5LXEA 1S2UA 1SMAA 1V3IA 1HKIA 3WQ5A 3M0JA 3SFKA 5HMSA 2PDHA 1SPQA 3QOMA 1PX3A 3W85A 2E7FA 3S5NA 3KW3A 1PWMA 3C2OA 2QZRA 2A6NA 3MP4A 2E67A 1KGXA 1UR8A 2WBGA 1XFCA 3VDAA 1TPH1 2Z29A 4H01A 5EFDA 3SRKA 4H9YA 3PTQA 3S1VA 4N6FA 4RDZA 3B40A 3HQNA 1JYWA 3OZMA 3H53A 5HNTA 1H62A 2W27A 2JIWA 1LOLA 1XS2A 2YPIA 5TF0A 1BD0A 3GDKA 4LVFA 1DJNA 3W26A 4JTLA 1RY8A 3ARUA 2AL2B 3BARA 2YA0A 6ENLA 3HFTA 4X60A 4L6OA 2BNJA 1AD4A 1B1YA 1TX0A 5REQA 3L4VA 2G96A 1K3UA 3V0TA 1W0MA 3QMSA 4UFIA 1GORA 3APGA 4JKMA 2B0MA 3LQLA 1WZMA 4RNJA 4DBDA 2EEXA 2VDGA 3WJWA 2CEQA 3TC6A 4J3UA 3BW4A 3HV8A 1I0BA 2HNHA 4G8TA 1UWIA 3E5PA 3M0IA 4U2YA 1A5BA 1NIUA 3CV1A 3WH7A 4OOUA 2ZVRA 4IF2A 2EGZA 3VIKA 3CT7A 4D6DA 3SN1A 1EZWA 4M81A 2NV2A 2VGGA 1JFHA 3CZLA 1UZ1A 4O8RA 3W38A 4QIUA 1GOQA 4X0VA 2VFFA 1QI0A 2BY3A 2GVYA 4PMZA 1Z7AA 3IGXA 4RDVA 2IQ0A 2RDUA 3I7RA 1PSCA 4YTSA 3UETA 3RRAA 2QDDA 3E9AA 5I3JA 3N6JA 4DF1A 4NVTA 4ZXOA 5A6MA 2W91A 4DHGA 4JQ4A 2GK1A 1K02A 5C0QA 5HAOA 1JI2A 4FALA 5E1QA 3O7UA 4L1XA 3PUDA 3FGCB 2DVUA 3WNLA 1ME7A 3HG4A 2XFFA 4M6VA 3ZT6A 5I78A 5DBUA 1TVPA 1GEQA 2DQXA 4GH1A 4URIA 4Q4QA 1QASA 3OYZA 5A5WA 1AODA 1FFQA 1OM0A 2JQXA 5DANA 3HU7A 3RJXA 1CPUA 4Q33A 2XDFA 5HJLA 5CJMA 4S3KA 5CC5A 2X8RA 3LM7A 5HOSA 4CD7A 1J0KA 4PMUA 4NY2A 2VX7A 1E70M 3C8NA 4RXFA 4XKYB 5C70A 1THFD 1LRNA 4IFKA 1VCFA 3SR7A 3LCGA 4LTSA 3ZJ7A 3QR3A 3WLQA 1L8NA 1PZ1A 3GH4A 5IM51 2VJXA 1TE6A 1ZTVA 1JUKA 2ZZ1A 4XWUA 4FHAA 3U4FA 3OOQA 4Q32A 2GJNA 3M64A 3JZUA 3ZFHA 5G2HA 5HA7A 4DWSB 1SW0A 2BTMA 3M47A 2O9PA 4A4AA 4N2YA 3OPSA 2HJPA 1AVAA 3GSMA 3L2LA 3EBVA 3MDUA 4YTTA 2HS8A 3LZ5A 3H24A 1UWSA 3IWPA 5DXYA 1SUXA 3ERPA 4XISA 3VMPA 3OHIA 4H6RA 4JHMA 3UXLA 3PZQA 2B7OA 1WBJA 5FOOA 4LYRA 4R3UA 1J0IA 2VD8A 1C90A 3T44A 5GNZA 3N6QA 1UASA 4YTUA 2V5LA 3O2LA 4GKLA 3OLDA 5I6SA 1VCGA 3EDFA 3TJLA 5D33A 1V93A 4Z2IA 1MXDA 2FFCA 1DJYA 2PD5A 2VC7A 3LCFA 2OOFA 1KNWA 3WQPA 4B9ZA 2VCBA 5G5IA 3H21A 4FLOA 3SGGA 1XCXA 3TZNA 3GS6A 5K4XA 3M16A 1F8IA 2FVLA 4C5YA 5CEWA 4N6EA 2H90A 5MHBA 1AW1A 1E3ZA 5EBAA 4FP1A 3S1GA 2UWFA 2X1RA 3D5HA 6A3HA 4AHPA 2QIWA 4LUYA 3JR2A 3TNOA 3W6MA 3QV8A 3S47A 1Z32X 4LYPA 2ZXBA 1XFBA 3PJTA 2HE8A 1H7WA 1IEIA 1VFOA 2WC3A 5ABGA 3WMLA 1RPKA 4ERGA 1H0IA 3ARWA 1FUYA 4R27A 4E3TA 4DYKA 4IL2A 3S2CA 1C9DA 4TOQA 4I5XA 3FVDA 2F9RA 5DCBA 5E09A 5HANA 4O0KA 2VOMA 3U2EA 3GXPA 4PBEA 1XIIA 4CU8A 1J0YA 4RV3A 2DSKA 3W7MA 4LF2A 4RE3A 2ZX6A 3GVRA 1DWGM 1G0CA 3C6CA 5A6TC 3N14A 2VRKA 2XIQA 4RXGA 3QHNA 3QN3A 4UCGA 2HNEA 5HMEA 1YIXA 2VR2A 4ZR8A 4YCOA 4ICNA 3UR8A 1BXCA 2XISA 3WQGA 4EANA 2VZSA 2YXGA 1A5OC 1PVNA 1ZJAA 4PCPA 4Z1BA 1C8VA 3VZXA 4M8UA 3O9NA 1TV5A 2PF0A 1H63A 3M46A 4PMYA 5JXQA 3N3TA 5AY7A 1JI1A 3MCOA 3GC2A 3W1QA 2TRSA 3T2QA 4WQ6A 2OLSA 1F2JA 4IPIA 3N2BA 3TWAA 3EWUA 2VKZG 2VHLA 3LXAA 3TYBA 4G6CA 4PBGA 2FHCA 2YX0A 1JEZA 1PB0A 4Q8OA 4E2VA 2WSQA 3WH6A 1Z44A 1Q7ZA 3O3RA 4GIRA 2XVPA 3WNMA 3TROA 4JPGA 3E2RA 1R46A 2X0SA 2X42A 3R8HA 4I9TA 1JF5A 2W3ZA 4HYVA 1V0LA 2DZWA 4HSHA 5DCDA 4F79A 1HT6A 3R79A 4EWND 3S1XA 1GJPA 3UFYA 1K9FA 1FH9A 1ODUA 2Z28A 1I75A 2E8ZA 4ZO8A 3DENA 1EBHA 3B0VC 3QC0A 3FA5A 3P82A 2OYMA 2P8BA 4C6OA 3AWOA 1XD0A 2Y62A 3HQPA 6CGTA 3D3FA 3IAQA 4XB3A 5BU9A 1L6WA 2W67A 3H2EA 1ZRQA 4XK2A 3KTSA 4OU1A 1E4NA 3GLCA 4LBSA 3CXOA 1E9YB 3R0KA 3T0DA 4JIIX 1NTHA 2ZRZA 1E0XA 9RUBA 3UERA 2V8ZA 1H11A 2H3DA 2OSWA 3GG8A 1VFFA 4J28A 1WP6A 3ICJA 3NIYA 5D2VA 1J11A 3PSWA 4JBRA 1MZRA 1D9EA 1KV8A 1GOMA 3GD6A 1TREA 2CW6A 1PUDA 2H9AB 4WEVX 2QJGA 1MMFA 2QCDB 3G8RA 3L4TA 3QZ6A 1M65A 2Y70A 5AOUA 1O66A 1XIEA 3WLHA 3NTYA 2A79A 1KW1A 3LSBA 3T81A 1TA3B 5HUOA 3ZOAA 2OGJA 3I10A 3G1FA 5I23A 5FEPA 4PUWA 4WSJA 2J78A 2WZIA 3HV9A 3URQA 1TTJA 1NAL1 2O9OA 5DMNA 3E0WA 1KCXA 3AU2A 3SCWA 2IXUA 3SW6A 2QUUA 3G6LA 5E9AA 3SJ3A 4A8IA 1ICPA 3S6TA 1IIGA 2OO6A 2OYLA 1MXSA 1XDJA 2CKRA 4I8YA 4EPBC 3KXQA 4HU4A 1VGAA 1Z41A 3O0FA 3UCQA 4YWIA 3VMNA 3ZLHA 5G4WA 1B3XA 3GKFA 2WYSA 3KRSA 3MVIA 3H2OA 4A3HA 3LDVA 2NXHA 1PO9A 1A53A 5I3FA 1V51A 2YZ5A 3DG7A 1UUOA 1EH9A 1RBLA 4UTWC 3FKKA 6REQA 3DFNA 5A1AA 5HNUA 1GHRA 3ZT7A 5BXRA 2PDYA 3AS2A 3UJEA 3NA8A 1DKWA 4LB4A 4XQ6A 2VEGA 3DIPA 4Y6GA 2FGZA 3WD2A 2PWUA 3HPZA 1KC7A 3W7QA 5LZLA 1RQHA 3I7QA 2Z24A 4LAOA 1FWEC 2CZEA 5PTDA 5HWMA 2BVDA 4L9ZA 4N9EA 5CZ0A 3ZVHA 1AQ0A 2G3MA 2PWGA 1OABA 3W1AA 4O52A 4JIQA 1C91A 3W1RA 4XD4A 4UB9A 3GDRA 1EJXC 5M2FX 4ZXLA 1YPIA 4IQJA 1N8WA 2JKAA 3VZZA 2A0NA 3R89A 1UMYA 4HU3A 3ISIX 4JQ2A 3ES8A 3KLKA 2EHHA 4GBUA 1TWDA 1IZJA 1XBYA 1BWVA 1L0PA 1L6FA 1WDPA 6PTDA 3CGTA 4WF7A 1LOSA 4NL1A 3CUXA 3PG8A 4HK7A 3DFQA 5KINA 3P80A 1T41A 5D9MA 3TQ0A 1REQA 3VDBA 3REQB 3VCNA 2OG9A 3EMQA 4MNLA 1S3HA 4UTFA 2Z7KA 4RJEA 2JE8A 5A6BD 1E71M 3NWRA 1J0JA 1TPWA 1ZBVA 3QZEA 1FWTA 2ZA2A 4MNKA 4UQDA 2QJJA 4LUTA 4H6KA 3UWUA 4QFUA 3SQMA 1XBXA 1EJ7L 1S3TC 3OHMB 1VBGA 3H2AA 3W1LA 1FHUA 5A8OA 2BHZA 3DC0A 2P76A 3EX3A 3A5FA 3GDTA 2D0GA 4OGZA 5I02A 4NX0A 1X8CA 3TOPA 2R94A 3A3WA 2UV8G 4JL1A 3NAVA 4WJ8A 5EMLA 1VFTA 3R5EA 2EJAA 2F61A 1FWAC 3N11A 1H7NA 3ORWA 4F9DA 4ZGYA 3BICA 2PRHA 3DCPA 4JXCA 2G97A 5FAJA 5HJYA 3XISA 2QMKA 1JDFA 2J7EA 1FHVA 2RGLA 2QQ6A 4F0MA 4JKLA 4XBSA 3ITXA 4FLSA 3UWZA 2JGQA 1V02E 5IBXA 3HG5A 4EACA 2X2YA 4WJEA 2YYTA 4UMBA 3VM7A 7TAAA 4M7TA 1ECEA 1AA1B 1P0DA 2E09A 4JQAA 4JHZA 4ICMA 3UVAA 1A49A 1JGMA 2Q02A 4ZA0A 4DBWA 3PZUA 5EMMA 1A0CA 3KCJA 1DE6A 3MI6A 4NI8A 3R4IA 2C71A 3DI0A 5D30A 4CN6A 5C9UA 3QY8A 1GVYA 3FXYA 4Y7EA 3GR8A 1F5ZA 4FK9A 3MP5A 4H00A 5CPSA 4IUOA 1V3LA 1A4LA 3O1NA 3MSRA 2CFFA 1YHTA 4UNKA 3C2VA 3W2NA 5A8NA 4NG3A 1W1VA 1ZP3A 4FX8A 4MJ4A 3LHVA 1OF6A 3BLFA 3VMOA 2NV9A 3MANA 3WQ8A 1GZJA 3PBGA 2DSWA 4QNEA 5CQ1A 2WJDA 1FWDC 3GHUA 4J27A 1JF6A 3LV6A 4E6MA 1OB0A 4GVHA 3ME3A 1VFLA 4H9VA 2E1DA 2Z1WA 3DC8A 4F4RA 1MSSA 2J66A 2ZX9A 4S2CA 4XZMX 4IMAA 1YRRA 3WDJA 3IGHX 4PB4A 3SEPA 3SUVA 1Q6DA 4MPQA 4JIPA 1V4YA 3DYPA 2B81A 3GNXA 3BMVA 3FLUA 1GYNA 2I16A 4X2RA 1OCBA 3S9IA 1E1CA 1M41A 2EG7A 1O94A 3CNYA 2DGAA 1M7OA 2FZMA 3Q45A 1UOKA 3GNDA 2Y5EA 1EP3A 4DLMA 4DZHA 1FRBA 3SQSA 4TX8A 4WY0A 4S1FA 2X1TA 1CXKA 4LU0A 1R9ZA 2VC5A 1Z6KA 1XYZA 3F4VA 4PMXA 4FXJA 4ZB5A 1XLGA 1CT5A 1UKPA 5CG7A 3AXKA 4H8NA 3URNA 2EPLX 3CHFA 3R0UA 4JQ3A 4MZYA 4C6PA 3W7KA 3AFBA 1IQ8A 5ABFB 3S2MA 1ZJBA 1EOKA 3AOFA 4GZEA 1LT8A 4U10A 1MRQA 3WDQA 1P7TA 5FJPA 5F4SA 5G1YA 1QU4A 3CUFA 3MY9A 1LL4A 2P1FA 2OZ8A 3LM3A 4QSFA 1I6NA 1DQXA 4PMRA 2WQPA 3H55A 2I56A 1LQAA 1TSIA 2VX4A 2WKLA 4XAGA 3NL3A 1XC6A 3DBNA 3WK1A 1IZKA 3W7EA 4ADSA 5F2GA 5EU9A 1R2SA 4AWUA 3T55A 4XD3A 3IACA 2BVYA 5AFDA 3O6CA 3BPWA 4XIAA 3GXMA 3CH9A 3A4AA 3NL6A 2A3LA 1POJA 2AGKA 3NL2A 1EUAA 4K8GA 1JRBA 1V6YA 1I0DA 4RL3A 1QUMA 1XKYA 4AMCA 2DIEA 3QY7A 2E6FA 1BGGA 2QHAA 1JVNA 4JTHA 3G2GA 3KBSA 3LRKA 5CC3A 1CBGA 1EO5A 4ZB0A 1QBBA 5I5RA 1EJUC 1K7FA 1V3JA 5DRCA 3CQJA 3FJLA 4NZ1A 2BDQA 1V0KA 1DWHM 4L64A 4TV6A 3FEQA 4LF1A 1OX4A 1YADA 2FZDA 4QJ3B 1UYQA 3GK0A 1DXEA 3TJ4A 4UTTA 3V0SA 2CZDA 1B3OA 2WHMA 4O1BA 4YHGA 2RFGA 2V2HA 3T07A 1HKKA 4KCWA 3G1HA 3GVGA 2DZBA 2VZVA 2VEKA 2XN2A 1VLIA 1KXQA 3H7UA 1JNEA 4AQLA 1Q6GA 1QI2A 2I1OA 2WCAA 2RKXA 1HVQA 3WLSA 4Q8VA 4WJXA 4DUWA 2FPTA 2P0IA 3QV6A 5I24A 4HIBA 4LY4A 1OF8A 5I3HA 2QS8A 3WFAA 4O53A 2A7PA 3S5ZA 4FA3A 3L9CA 1JDCA 1FXQA 1Q6OA 3M6DA 1HXJA 1NOWA 2ZADA 3N17A 1IGSA 4DI8A 1TJ0A 1SZEA 4TQTA 3CHCA 4QJ5B 4C5ZA 3MSDA 2E9LA 2ANUA 3M4HA 3AZTA 3IUIA 2A85A 1FFRA 3ALGA 2W66A 3NSNA 3VVGA 3D3AA 1AH4A 1LUCA 2DY3A 4M1RA 3ZSSA 3EOUA 1AK5A 1NDVA 1ZZMA 4LYQA 1RP8A 1JPMA 3SY5A 4F48A 1IE7C 2GQ8A 3ZS4A 2J74A 3CIVA 2WZMA 1LL6A 3UEQA 4EXAA 1H49A 2VWTA 3BANA 2ZUSA 2XFRA 4HPJA 1TPDA 2WM1A 4Y2WA 3QH2A 4K7VA 4ALDA 4M56A 3TDFA 4W7UA 3UPWA 3GXTA 1O4UA 3ES7A 5XIAA 5FCZA 2GJXA 2DSUA 3RHGA 1TYGA 2V5CA 2D2HA 2GDQA 4Q7NA 1J2BA 1CXFA 5B7ZA 3PC0A 3A21A 1C7TA 4LS0A 3T0BA 1UH4A 3SJNA 2ON3A 3ZR6A 4GXPA 1XRTA 2WKGA 4ZZ9A 4CLMA 1RQBA 1UWRA 1MWOA 2E6DA 4O1AA 3VINA 4ZL1A 2VEMA 3SY8A 4GIYA 1YTDA 4ZVJA 2C1IA 4WKFA 1WZLA 2VC9A 3QFEA 1EF3A 3IPWA 4HNTA 3U7VA 1VC4A 1JPKA 1WOAA 3CM4A 1TUXA 3ONCA 1VBUA 2DPEA 3K8LA 3RO8A 1DHPA 3LLXA 3W75A 1G69A 1UD3A 1U5JA 3EKGA 4BI5A 1R85A 6XIAA 3GO2A 2ZIDA 1HJXA 5FF4A 1J6PA 3CYVA 5EKYA 1K77A 5LNSA 3FAWA 3UY7A 1GTHA 3GQYA 3F5JA 1E72M 3P93A 1OSEA 2WM0A 1MW3A 4PTVA 4UOJA 1FWGC 5U7SA 4DI9A 5A6AA 2Q3RA 1IWPA 3H22A 4XSMA 4GWEA 4DJFD 4HOZA 1UOZA 3UG3A 4HHPA 3MSYA 3PJXA 2J24A 2RUSA 4RX0A 1H5YA 4GGBA 1KKOA 3QF0A 1LORA 3MQTA 5REQB 1NF0A 4KWVA 2WMKA 4E8DA 4QE4A 3LCXA 1X1OA 3R7MA 1OFDA 3VCCA 1RJRA 2ACQA 3AYRA 1E1EA 3SUUA 2I9EA 3WBWA 3TQVA 4B5SA 3F4WA 2AQVA 3FNDA 4D2JA 3DBPA 4C7FA 1A5KC 1QWKA 3TP4A 1CGVA 2NQHA 4F8XA 1XPYA 1GQJA 2FHFA 4JX5A 3S5YA 4FX7A 2VUYA 3W7CA 3B8UA 4AF0A 4O13A 4QE1A 1EIXA 2V81A 1XYMA 4LX4A 4US5D 3WLIA 1WAWA 4HA1A 5AYXA 2G3JA 4JTFA 4RPQA 5DQPA 2EPMX 1QNSA 2W9MA 1MNSA 1UQZA 1U1JA 2ZA3A 3QR0A 1EGZA 4S23A 2QXWA 2CC0A 1PBGA 4AZ7A 4LBRA 1JD7A 2OPJA 4AWTA 1DIEA 4JX6A 4Q8MA 2YA1A 4CGTA 4H04A 4PMJA 3MYPA 3QFWA 2RHGA 3RM9A 5EY5A 3C2EA 3GTNA 2GK1B 1TJ2A 1ZJHA 4A2RA 4GQGA 4D6FA 3G3MA 2HVOA 4Z1AA 5D4YA 4RE4A 2CBIA 1AMYA 3TZFA 1S46A 1ZSXA 2R1LA 4DPPA 2PLKA 4I9AA 2NX9A 2GGHA 2NUWA 1IWBA 3QEZA 1VFMA 4G56A 1NFPA 4W86A 3HM7A 4A2SA 1TKKA 2FPVA 4HHMA 3NNTA 3P74A 4HPHA 5DBTA 3PBMA 4OUEA 3N1AA 2I5QA 3F4NA 3EOSA 5ABTA 2A3EA 1KQZA 2R1MA 2V5JA 4WGXA 1BYCA 4GYPA 1PPIA 4PTMA 3TTOA 1RBAA 3IS4A 1KD0A 9CGTA 3FX4A 4XSLA 3E49A 2WLZA 3THAA 2ZRVA 2PUZA 3AAMA 2HBXA 4AD0A 1E3XA 3TOYA 3BGAA 1UWTA 3H4WA 2DJXA 5EB8A 4NZ3A 1ME9A 1AJZA 3W87A 3IV8A 2G37A 1E6QM 3EWCA 3G1DA 1JZ2A 2NWRA 1W6TA 3I7SA 3FJ4A 2X7VA 3VNDA 5F4WA 1HP4A 4K1WA 3UZYA 2FKPA 4PL2A 3WNPA 3S2LA 4IIBA 4C7DA 2TAAA 3WQFA 2IW0A 3H7VA 5LIXX 1E9ZB 2ACSA 2YCIX 1DHKA 2Y8KA 1C29A 3W07A 3RILA 1UMLA 1QI3A 1FKWA 5F1UA 1C93A 2ZX8A 3LHYA 1UC4A 2DZXA 1DEDA 1V7AA 3TYEA 5H91A 2GOKA 4HU0A 3D0CA 4EIVA 2A6LA 2J77A 4S3CA 2JK2A 4E2OA 3W7NA 3BAIA 2BGSA 1SO3A 2AOSA 4HA0A 1PX8A 3GNOA 3RCNA 3XIMA 2OZTA 2OB3A 2DSZA 3E2VA 3T05A 1V6WA 3DGRA 1W32A 1AMKA 2PTZA 4OOZA 3PB0A 4JCMA 2FMNA 3ZLGA 3ABOA 3R58A 1E5NA 4KCTA 4TTUA 2YLLA 4FMVA 4UFMA 2DZTA 7ODCA 1HW6A 4AY7A 1JUEA 3UR2A 4IX0A 2WV8A 1B4EA 3RIKA 3PBUA 2UY3A 2FB3A 5HNNA 4M6PA 2QV5A 1R9XA 4XD5A 4PR4A 1FA2A 4DXKA 4GFSA 1NDWA 1QR7A 3RRXA 2Q8ZA 3DFPA 3OZYA 4DVOA 1K8CA 2X05A 5I0DA 2ZXDA 4OBSA 3V3WA 3P5ZA 3L21A 3VOIA 3RLHA 2YDQA 4CN4A 2J7FA 1QOXA 4HZ8A 3FIGA 5DY3A 3SADA 3B8DA 1YDNA 2XM1A 1W1TA 3B8SA 4F0SA 4US6A 3PUEA 2D2OA 3AIWA 4P8WA 4CNPA 4LQ1A 2VO5A 4F40A 4IG2B 5GJMA 3BOFA 3VE7A 4C1KA 3L7RA 1OK6A 5A6LA 4A3YA 3EX2A 3MCNA 3WNNA 4D6IA 1UZ4A 2F6XA 1S2AA 4A35A 4EP8C 1RAKA 4WXYA 5KTLA 4XTIA 2YB4A 2YR1A 5BMXA 2O7SA 2OEMA 3G18A 4W4QA 3TQKA 4JFVA 2PC4A 3LPOA 4R9XA 3CK5A 1V08A 4MYAA 1Z89A 4UTLA 3DFYA 3S5OA 1UJPA 2YLAA 2ZXAA 3K1GA 3NURA 1PHQA 2VDHA 4LJ3A 3Q58A 3OU8A 4CNNA 3U48A 5BOOA 3MHUA 3AROA 2I9UA 1JDDA 4S3FA 4IHCA 1BYDA 1XRSA 3CU2A 4ZMGA 1A80A 4IIFA 3W70A 2HQAA 4HOWA 4KKXA 3SN4A 1S5TA 3CZEA 4Q4PA 1UP0A 4NAFA 4H6QA 2PI6A 5G2WA 4H9ZA 4CQ9A 3QC3A 1UR9A 1W3JA 3IIXA 3PZNA 5KZ6A 2D24A 3PY2A 4HNUA 3ARVA 4M7SA 4QQ3A 1QBAA 1SJAA 1C92A 2CXGA 3VIFA 3GC5A 4HNVA 3NQVA 1Z42A 2QF8A 4HCDA 4JTEA 1P6BA 1JCLA 3N12A 3AS3A 4NRRA 3WG6A 1F6YA 3HQOA 2CLKA 2C8NA 2JIEA 2TMDA 5AB3A 4AIBA 4FIRA 4DWSA 3LA4A 1PKMA 1WZKA 4GINA 3KRUA 2TPSA 3UNTA 2HROA 1GYLA 1EC9A 3PAJA 3AMLA 1OIMA 2GQ3A 1LQ0A 1DIDA 1FDJA 2J8GA 4NNCA 3E12A 1HJSA 1FP8A 3K8MA 4TO8A 3G24A 3AS1A 1L6YA 3KRBA 3QY6A 1BVWA 2P3EA 4UC5A 4FLRA 3HMJG 4NAEA 3PM6A 2VFIA 3GH7A 2D22A 3WLRA 4NZ4A 2RDTA 3DERA 4PGLA 1GKQA 1KCZA 3CIWA 2PDGA 1L2QA 2EQDA 4G9PA 5BW6A 5C9ZA 3KBVA 3CTLA 4FEZA 4PB5A 5I00A 3M5ZA 1RH9A 1XLHA 2WQDA 4GIEA 2QJMA 4UUIA 5FL0A 3T78A 2AQWA 3W4RA 1W31A 1CGUA 3L68A 3GU9A 4DJFC 4PUEA 2VEPA 1H1YA 3TR9A 3FCPA 1RHCA 5E9XA 3A9BA 1XYCA 2ZDSA 1S2CA 1BKHA 1KKRA 4GXWA 1OFEA 4AVNA 3BO9A 3B9DA 1RPXA 3IV3A 4H83A 3MCMA 5I3GA 1LJYA 4UFHA 2X41A 4LXFA 3M07A 2REQA 4FR6A 5AHLA 1DWIM 5CJ5A 2XU2A 4PZVA 3WZ0E 1JZ7A 4ZO7A 3LCLA 4XO7A 5D09A 4AZBA 4PUUA 2XG9A 1ISWA 1E51A 3PF3A 3PR2A 4UQBA 4B5NA 3GR7A 4G1NA 1SO5A 6REQB 3GRIA 3GU2A 4CNTA 2V2DA 3TH6A 3UR7A 3VIPA 2VCCA 5AECA 4I90A 4A22A 3MSGA 4PRRA 4H2CA 1K9TA 3GAKA 4KFPA 2OCZA 1R6WA 2BLEA 2POTA 2ICSA 2J6XA 1KFJA 4TVDA 3JUGA 4M51A 3VOCA 4ZQPA 4AZ5A 1SZGA 4A8RA 3EMCA 1GJWA 3FHQA 3P67A 2GDVA 3CQKA 5G4EA 3WF4A 2PBGA 3W7OA 3WEMA 1J9YA 3DXIA 3CTTA 4P7OA 2IKIA 2YDSA 4QNWA 4YHEA 1R3WA 1BYBA 2JKPA 1OT1A 4TVUA 1MFVA 3LNMA 3MZ2A 1M1BA 4J7RA 1CEOA 2PWFA 3CUIA 3PBVA 1W3IA 3NZGA 4U2ZA 2O55A 1UWAA 2C0AA 1Q7QA 3PZTA 3W7LA 1T6MA 4XAFA 3WBAA 4LGXA 4LC6A 5IOBA 1TPEA 5E0FA 1WDWA 1GVEA 1LQ2A 4MWAA 2DH3A 2H8XA 2PRMA 3GUWA 3JS3A 3L5AA 3SCNA 4B5XA 1SJCA 4OTKA 4H1ZA 3GNNA 1VBRA 2QPSA 4CCEA 2BGQA 4JICA 1F3XA 4G1KA 2E5DA 2X1IA 4C90A 1TIWA 4QG9A 1ZBCA 3MS8A 2Q8XA 2G8ZA 1GZGA 5I7GA 1UH3A 1XH0A 2Q71A 2PB1A 2P88A 2VFDA 3QW3A 1OEPA 4RV8A 4HYRA 3R8GA 1MEWA 3LBOA 4GUIA 4NRSA 1V3KA 5D38A 1BYAA 1JIBA 3L4WA 5MKGA 1PX4A 3AMGA 2QVHA 3CAWA 2DT1A 3N2CA 3LX9A 3AHVA 3OA5A 3S46A 3KBJA 5CH9A 3LYEA 1B9ZA 4JY8A 1F6PA 3AIVA 2YCLB 4EXBA 3OLEA 3MW7A 3W76A 4IIEA 3CZKA 1UCWA 1EO7A 3EAUA 1TPVA 2J7DA 3VIIA 4NNBA 2OJPA 1PS9A 4O4WA 4PMDA 3UZZA 4M0XA 3TCEA 4GH3A 3LPGA 4L1GA 4PC8A 1R3VA 3UA3A 3WQCA 3PSVA 4JTKA 2G0WA 5EMJA 1YDOA 3FSUA 5FSDC 4TMCA 1KTBA 3RUBL 5H1WA 1HN1A 2R91A 5AYZA 3PPGA 1Q5MA 1PIGA 4DJEC 1YDYA 2INEA 4U33A 1BG9A 1RV8A 1UPMB 4TVCA 4KEMA 4HT3A 3TA6A 3C56A 2EAWA 3P14A 3UF9A 2VI0A 1OG0A 1ELSA 3NXFA 2FMOA 2KAUC 1MEIA 1CX9A 3A4WA 3WQOA 1LBFA 2OR2A 9XIAA 5KEZA 3OLIA 4EE9A 2WMFA 1US3A 3VZYA 1CW2A 3PTMA 1U5VA 4J3SA 4J1OA 2BXVA 2OSYA 3CJPA 5CBBA 4A6GA 4CD6A 3OVPA 5IRPA 1XQLA 1B9BA 3H70A 1IR2A 5DRIA 2KZHA 2I17A 3AZRA 3AYSA 5LA0A 2ISVA 3WBXA 4DNMA 3QRHA 3LTSA 3PTKA 3QMTA 2YGYA 2Z0IA 3CMJA 4CCCA 3HGOA 3W1NA 3QPEA 3OB8A 1TPUA 3RX2A 3R25A 2HE5A 1W9PA 3DYMA 4BFAA 1O1HA 1U83A 2DIKA 5M1TA 3F2DA 1XH2A 1EJVC 3GFYA 1FHLA 4AAJA 3L4ZA 4X9SA 2DDXA 3URBA 2PWVA 3WF0A 3T8QA 4JN8A 4ACZA 3L5MA 1UR0A 2WSYA 4LV9A 3BG3A 4JNZA 4X63A 5DMMA 2CETA 3W24A 2Z4GA 1QNRA 4E4PA 1P0BA 1XYBA 2CLEA 2XVLA 3TTQA 2OSXA 4JY9A 3KFTA 1BHGA 3NL5A 2WB5A 4GX8A 2I7GA 1G67A 4B16A 4B15A 1D3CA 2Z2UA 4Q4SA 4DLFA 4LCRA 2WC7A 3WQ6A 4J2PA 3PS7A 4X0NA 5LGZA 2FB2A 5M17A 1AJ2A 1E1CB 2OODA 5FAGA 4B2DD 1J0HA 3VDHA 2QV4A 2XSXA 3ABZA 3MA8A 3VU2A 3N4EA 5EL1A 5K2ZA 1BQGA 3LHWA 4DBEA 4GI4A 3IJ7A 1DTNA 3E74A 4NP7A 1KWGA 2RDWA 4HTBA 1OCNA 4ZOAA 4WY0B 5EA9A 4FNTA 1QPQA 2GPTA 4JTDA 3QZAA 1A3HA 4Y90A 1YX1A 4JYDA 3TAOA 4C6JA 2O92A 3W81A 4K8EA 4NASA 1IZCA 4YN5A 3TV8A 3BE7A 4ZTYA 3M0HA 5M03A 5IFPA 3VIHA 3LCIA 4Z1YA 3L4XA 5C9XA 4M3PA 4UTKA 1XDLA 1QDSA 4D8ZA 4GO9A 3BW2A 3GXIA 2V3EA 3SCPA 1P7TB 1BFNA 5CSYA 3BVJA 1EHNA 4FB7A 2Y88A 4HZMA 4K8HA 4LAKA 5KETA 2PDQA 4I3GA 2UY4A 3OO2A 4HZ6A 3RO6A 2CYGA 1EL3A 3S83A 3DFTA 2WMGA 1JR1A 5A6JA 4NF7A 4WDWA 1BLIA 4AX6A 3W7DA 1EX5A 1P1XA 5BWAA 4KEVA 3SUTA 4F2UA 1SFSA 2E5BA 2PBOA 2WZTA 4HKPA 1XYFA 1QI4A 4BI7A 2BXZA 3WLLA 2H6RA 2Q8LA 5J8LA 4O0ZA 1PTGA 4QXIA 3RMJA 2O4MA 1KTCA 1XCFA 2A7RA 3KEHA 3VNJA 1F73A 1MUMA 5D9PA 3WMBA 4EF8A 5CBJA 2ZRXA 1Q6CA 3DU0A 5FA5A 1Q6RA 3WQVA 4MJMA 5GPRA 4ADUA 4DM1A 2VC6A 2QAPA 4IJCA 5LNRA 2VVSA 2QPXA 4OJYA 3OZOA 3IJIA 1GK8A 3LN3A 4GVFA 1OWQA 3GFXA 3U7BA 3WQDA 3IIOA 2PDXA 3MMTA 4HSNA 4ZFMA 1OX4B 1V77A 4CN1A 1TV7A 2V0TA 4AD4A 5I07A 1I2NA 1J5TA 1ZBKA 1LM1A 4H9UA 3TCSA 2BV9A 2ZZ2A 3UJSA 2CBUA 1J2WA 2OTDA 2XWEA 1I2PA 3LMYA 3NPVA 4AC1X 4R34A 3SZ8A 1PCKA 4Z1DA 2BY0A 1XDMA 3PUOA 4Q8WA 4K38A 3AS0A 5E5CA 1Z48A 3O06A 2VX5A 2VUNA 1LRQA 3OGSA 4AUBA 3U5UA 2FIQA 1EQPA 3G1YA 2J7BA 5H6HA 4OFCA 4B92A 2GVEA 2OZ0A 3HGJA 1EA0A 1KR1A 3QKZA 3SRFA 3THUA 2XIOA 2QT3A 5CPTA 1W5NA 3MJMA 1R9YA 3GX9A 2J88A 3M0KA 3S6OA 4GC3A 3B8IA 3TR2A 4GABA 1KM0A 2D0FA 2NQ9A 4D6CA 1KXVA 1QHZA 4DO5A 4ILSA 4WD0A 1LUCB 1XLLA 1ISVA 2GGJA 3SCRA 1MZHA 3USBA 2WVUA 3I3BA 4DJDA 4H8VA 3S3GA 1JFXA 1E15A 3E02A 4ZEPA 1Q85A 1XICA 3NSMA 4O54A 4P7NA 3DDMA 3PZGA 3BCJA 3BSHA 1UA7A 2X09A 3IJQA 5BMWA 3CQ0A 3FDGA 4MKSA 3OODA 4Q22A 2QPUA 3BJFA 1QNQA 4P7RA 1KFLA 3N19B 1LROA 3G0UA 1UWQA 1TFVA 3I65A 4H8UA 4K1GA 3TE9A 3RAOA 2GJXB 3GTXA 4ML9A 1NY1A 2V6AA 1G6CA 5K3VA 3BQ6A 3VCRA 4FLQA 1FH7A 3STCA 3LS9A 3I3EA 1HQTA 3P62A 5AC4A 1LWIA 1Z69A 2QUVA 3T09A 3FDKA 3HMCA 3PNZA 2J25A 5D37A 1Y5WA 4O12A 2ZUTA 4M6QA 2V3GA 3W23A 4HA4A 3SAZA 1T96A 1EPXA 1AH0A 1NJJA 3QYSA 1X8FA 4C6BA 3EPMA 2YDAA 1W2PA 5DFAA 1ECQA 1ZQ5A 2ALDA 1A5CA 1XD1A 3MUZ1 4WKAA 1W9BM 1YQ2A 3STGA 4A8NA 3DYOA 4EPDC 5HWNA 4R85A 5FEZA 3IJ9A 1TTQA 3NUKA 3NEVA 1H2JA 1JCTA 1UR1A 4FXFA 2XSAA 3NGJA 3HGRA 1GVFA 1OFQA 1AG1O 2PWDA 5E6ZA 1DL3A 3EOLA 4LVAA 1ITUA 3S2NA 2EPHA 2FLIA 1KTNA 4PEKA 3PNUA 4QCEA 5CPMA 2P10A 1H0GA 4WLCA 4LAZA 2VFGA 1L6GA 3AIUA 2R6OA 1ADSA 1RCOB 3KTXA 2NT0A 4HN4A 1V3HA 5JBFA 2BY2A 1NWSA 2XH0A 1TR9A 4B4FA 3G0XA 2CHNA 1E9LA 3HF3A 4IISA 4V15A 1FXPA 1XIJA 1OYCA 5C2GA 2PDBA 1XLAA 1M7PA 2TODA 3ENLA 3WF1A 3G8EA 4KW2A 2HISA 3W9ZA 1TB3A 2ZICA 4UCFA 1K7EA 2OKTA 4OBTA 2E4TA 2YW4A 1ZCOA 1CLVA 5D2XA 1FWSA 2ISDA 4CQBA 4PSRA 3OQ8A 1GQNA 1JDEA 3W25A 4AY8A 3F5KA 4EAYA 2Z1VA 1PDZA 4L6DA 3FW6A 4O17A 3P3BA 4PCSA 3NO3A 4PCTA 4AF0B 4FPSA 3W2LA 1YW1A 3QQ0A 1JCYA 3BLPX 4RDYA 3AIEA 2QJNA 5GJNA 3R1ZA 3DUGA 3K2GA 7A3HA 3ZZ1A 5G4HC 3CUZA 3WUBA 4DEFA 4R53A 3ARTA 3AU6A 3F1QA 2ISFA 1OCQA 3LB0A 8RUCA 1CXEA 3T42A 4DUVA 3SI9A 2XTKA 4Y8EA 1R86A 4XZIA 4KRZA 5G1MA 1A3WA 2A21A 3A4JA 2PLMA 2J8FA 3A23A 2OELA 4NYYA 2YCJA 5IFTA 2DV0A 3N9SA 3NDOA 2NLYA 3BTNA 4GJJA 4CUCA 1EIBA 3WUGA 1DOSA 2G5WA 1NH6A 5LYRA 2F6KA 4UBPC 3W86A 4MB5A 4EWJA 3T4CA 2BHYA 1QJWA 5HINA 3W01A 5A3HA 2WK2A 1VBHA 1RD5A 4YTQA 4W84A 3UNDA 1X1NA 4N02A 1I8JA 1WDQA 3QR1A 4MGGA 4AYGA 1O5XA 3BLOA 3QQWA 3MBFA 3UG5A 1OVDA 2PDNA 3MI2A 1RVGA 5I2UA 6XIMA 1YPXA 2D0HA 3IUDA 3WCZA 2WSKA 1VYSX 3EB3A 4QBXA 4XUGA 4EXQA 2NUXA 3HB9A 3KLLA 3NQ8A 5A6KA 3C0JA 3KZPA 3OVGA 4TMBA 5FF0A 3VC6A 1P0KA 4HOXA 5D8WA 1KGUA 2VFEA 1OK4A 2NQJA 4FNPA 4DYEA 3ZJ6A 1TQJA 4ZFCA 1XINA 5DMYA 2V30A 5C8BB 1U22A 2ABBA 7CGTA 1QO5A 3PFRA 3NCOA 3VOJA 3C0LA 5H8UA 4PUMA 1PAMA 1D3HA 4L80A 3VFCA 4M5PA 3QHMA 3UGRA 2PPGA 2ISSA 2WKJA 5HATA 1VIZA 3I6EA 4D6JA 1DJWA 3BC9A 5I06A 1OX5A 3RU8X 2E6YA 1LT7A 2A1YA 4J3TA 4M80A 3GTIA 4DXVA 4CD5A 5FEWA 4QROA 3QGVA 5I79A 5ABHA 3OGRA 1FWFC 2AMXA 4DO7A 3BK0A 5E93A 3BMXA 2D1ZA 2DUAA 3MV11 2GOUA 1TCDA 2CNCA 4Z1CA 1QVBA 2GL5A 1ZNNA 4GVGA 4ES4A 4UZSA 4L1WA 2W6RA 1UZDA 4GFIA 4HPNA 2DIJA 4WX2A 4FXSA 5LKYA 1EDTA 3WMSA 1SQ7A 3H6OA 4PSPA 4MB3A 3B0PA 1ICSA 4C60A 3SO7A 3VOHA 1RR2A 3U8GA 1OY0A 4UR7A 2FPYA 2WMJA 3TYCA 1DPMA 3VKCA 4MJ2A 3GDBA 4QEEA 1ZHAA 3B9OA 3K4WA 3VNLA 2GUUA 4HB7A 1MQRA 1DJIA 2XVNA 3TK7A 3F2BA 3B9AA 3INPA 1DP0A 1R47A 4GYKA 3OGVA 1FWBC 2WSRA 5LIUX 2YZRA 3SRDA 2V2CA 4CU6A 4CQCA 1JZ4A 3GZAA 4UZUA 4GACA 3VYLA 5A6SA 3LLFA 3UZXA 1O7AA 4UNLA 3GDLA 4FIQA 1C8YA 1CDGA 2V5KA 3N2XA 4L5ZA 5J04A 3HA1A 4B3ZA 1GZ1A 3T40A 3G22A 3D46A 3CMFA 1CGYA 4A21A 2PZ0A 1CYGA 2QCMA 4HQVA 1F6KA 2GGIA 2W4XA 5T9CE 1V6UA 4H3DA 1UP2A 5LNVA 1W9VA 4KF1A 3W73A 2J7HA 1ZFJA 1NSJA 4V28A 1EJSC 3W22A 3UZ5A 3H23A 1Q6EA 2JFEX 3RPTA 4PMOA 1XX1A 5C5YA 4W7VA 1IEQA 1WV2A 4LSBA 3HPXA 1SW3A 2CWXA 1E55A 1V79A 3V0UA 3KVKA 4JNYA 3VXGA 2WJFA 1XIMA 1BXNA 2Y24A 2FGLA 4N4QA 4O1FA 3ZXWA 1WKFA 4GI6A 3KHJA 3USZA 1V8EA 4XZHA 5HBFA 4IPNB 5L6UA 4P8XA 1EJTC 2C6QA 3CO8A 1QMLA 1FX6A 1W17A 3MDWA 3AJ7A 1W1ZA 3SCVA 4PTNA 1A3XA 1EGVA 1JYXA 3B3DA 4BWLC 3NEHA 1KXHA 2GUYA 3N9KA 4ONVA 1EXPA 1DQUA 4MFEA 4JFSA 2XGBA 1UJQA 4FO4A 4YVVA 4NAFB 4QG8A 3NG3A 1B30A 3LHTA 4LS1A 2PAJA 4L61A 4J40A 2Z6JA 3CZ8A 1WXJA 1NFBA 2IPFA 3A64A 1W5MA 2NQ5A 3KOWA 3RG6A 4O1CA 2ZDRA 5HQMA 2C7FA 2FQIA 3KDOA 5D9OA 3TU9A 2F84A 1OX6A 3WK3A 4UOZA 1W3NA 1TV4A 4Z2KA 5BXSA 1S5MA 4LVGA 3TN5A 4BZYA 2Z6IA 1WE5A 1RK6A 3QGKC 4P7QA 5LIKX 4IGSA 3VNZA 2DFAA 4H7VA 4ROPA 3APTA 2D69A 2V38A 2ATMA 2BSLA 4XV0A 5ECUA 3RR4A 1JULA 2QJIA 3KE0A 3DFHA 5B80A 1WUEA 2ZTJA 2FVMA 2RJHA 4IPLA 1KM6A 4LWWA 3TUUA 4IXXA 1SM9A 2Y85A 5TIMA 2AMGA 3B0UX 1S1PA 1LG1A 4HGXA 2DORA 5AYYA 4V2XA 1YE6A 1P0NA 1QAPA 2EPOA 1CTNA 2C16A 3N4AA 1HL2A 3G1SA 3GC4A 1UBPC 3T1GA 5C9RA 2XGZA 3PBYA 4NAEB 4QLKA 5KMYA 3KM8A 1EKOA 4ML4A 3LHZA 1ICQA 2FH6A 1PE1A 3GTHA 3TJIA 3BSGA 3LHUA 2P53A 4YLWA 1OZMA 1E6ZA 4F0RA 1EC7A 3P2VA 4MMWA 3B8VA 2F7FA 2PSNA 5CG0A 1M53A 4P5UA 3MBDA 5CZKA 4BQ2A 3W29A 3VGDA 4QG6A 5AC5A 3RX3A 4LANA 1HJVA 2TYSA 7REQB 2GJLA 1E1FA 5BRPA 1FVPA 1TPFA 1MW2A 1E9IA 4FX6M 1SSDA 1R0MA 1H7OA 3EMZA 1FWWA 3PB2A 1YXYA 4XAZA 2REQB 1M5WA 5TQLA 1CGTA 2ZZ4A 4B4HA 4NJHA 3AI0A 1SVDA 4NJKA 1ALDA 3NQCA 1IR1A 4ZODA 3ARPA 1W37A 3AYTA 3TMQA 5BZAA 2FTPA 3PPCA 1O1ZA 3ZM8A 1NF7A 2CLFA 4C6DA 4CNOA 4GE8A 3EXSA 2ZZ6A 2VGFA 3HPSA 2XVGA 4S3JA 5C2CA 2CIPA 2VEIA 2WVVB 2GGGA 5HULA 1VRXA 1TZZA 4FR1A 4DRSA 1B31A 1DXFA 3UXAA 1XBVA 1GOIA 3NVTA 3A3HA 1LP6A 5AHMA 4C65A 5KITA 3MUXA 3NM3A 4IG2A 2OGYA 4G2DA 2PRLA 1Z8AA 3Q94A 3I3DA 2FJKA 2J6VA 1YNQA 3VIOA 4UTMA 1O5RA 3U5YA 1PJ9A 1KM1A 3W37A 1OFOA 1HL9A 4TU1A 3VGBA 1S5VA 3UBPC 3TSDA 5EMYA 3OIHA 4S39A 2OKOA 2F2KA 3NXLA 2YYUA 3GH5A 4AD5A 4JN6A 1VFHA 4UTUA 1AFSA 1CXIA 1B3YA 4MWAB 3V5CA 5CGQA 2C18A 2PWEA 3BSMA 3MWAA 2E28A 2IPJA 3Q65A 1ADDA 1KRAC 3CPUA 2O9TA 1RA5A 2PTWA 5D05A 4U5KA 3I4KA 1AZ1A 1VJIA 1TV2A 1KGWA 5JUVA 2NX3A 3PZVA 5LIWX 3A24A 3LXCA 4WXZA 4I8DA 4B3LA 1EZ2A 1TRDA 3CUHA 5AC7A 3LGDA 3VIMA 4JEJA 2FH8A 4N9CA 4P2VA 2CHOA 5MKGB 1IYXA 1C9WA 1UP3A 4XKMA 3LTPA 3N3MA 3AALA 2GWNA 2H8ZA 3GVWA 5GJPA 1OYBA 3EKZA 4Y96A 4GMEA 5BNKA 5CPLA 1O12A 1HL8A 3VNKA 1UUMA 4KQNA 3KOXA 5FACA 5CLTA 4MF4A 3A13A 3ZMRA 1KFCA 4C6EA 1XIBA 2QR6A 1W5OA 2A5HA 2CU0A 3WFLA 2EG8A 2DT3A 4L56A 2CLHA 2PDUA 4J3XA 2D2JA 2BMBA 3VK5A 1P43A 5AYBA 1J18A 1MEHA 1XG3A 3BZJA 3QHOA 1R2RA 3CBWA 1NDYA 1AW2A 3EXTA 4C7GA 1RJPA 2OZ3A 5CPQA 5A8PA 4KWWA 1GVQA 1QRQA 2SFPA 4LEQA 3BGGA 2VZOA 2HDJA 4MSSA 4OHQA 1Q65A 2Z2BA 3R43A 1T8XA 3BAXA 3KWSA 1I1WA 3P8JA 4F9JA 5KZMA 4Q6XA 2CITA 3FJNA 1EWEA 4GZIA 2HZGA 4GY7A 4Z2GA 1T5AA 3GHTA 3NSXA 5DMLA 4IP7A 2VURA 3HG3A 3RFAA 1YXDA 2V5DA 3TN4A 1OFRA 4JTQA 2DW6A 4AEFA 2GJPA 2PP3A 1KQYA 1BF6A 1GEHA 1WA3A 4NQ1A 5F2MA 4ZSTA 1PZ3A 1U5HA 4LEFA 1H1NA 1GVOA 1XLBA 3LOTA 4I9MA 3RLGA 4FNSA 4D6EA 2WWDA 1J5SA 1UBSA 3PK7A 5F2IA 3VAVA 2YL8A 1SJBA 3RDKA 3FOKA 4Q4RA 4W8AA 4Y9MA 2HRWA 5LSMA 5JBDA 4KCVA 4FAMA 1P5BA 3PAOA 3N18A 3GVVA 3TN6A 4GQQA 1P1MA 3AHTA 1GKPA 4ACZB 2PF8A 1Q2SA 3L2IA 1PL9A 1VD6A 1Q13A 1JZ5A 2AAAA 4GX9A 1W54A 3S2JA 4FS9A 1BEUA 3BQ5A 2E9MA 3CPGA 3BLIA 4NUWA 4ZCWA 4H9TA 2RDXA 2E9BA 4GUGA 5A95A 2D23A 2VENA 1S1RA 5TAOA 3CAVA 3GG1A 4O19A 1R3YA 4ZOCA 4RW5A 2IPGA 2O7QA 3WUEA 3U57A 4CNUA 3L4UA 1SR0A 4JFWA 4ZQOA 1ZLPA 2XWDA 4ZSUA 4DF2A 4TXEA 1B3ZA 4NXKA 2ZTKA 1YEYA 1FH8A 1ZJIA 4YYFA 1IEXA 1R3RA 2IKGA 1AH3A 4LRSA 4JDBA 2J9XA 1KB3A 1UH2A 4DY1A 1XYAA 4BEUA 3AMKA 2G3FA 1XLMA 4KWOA 4QDMA 3HURA 1PDYA 2NLIA 1QNOA 4IJRA 1P0EA 3VO0A 2G50A 2GVJA 2W63A 2C1GA 2PDLA 1CECA 3B03A 3GHRA 3K1DA 1G94A 3UYIA 4NZ5A 1NWRA 1NOFA 3RR1A 5H8MA 4KWSA 3OBAA 3A47A 4PTXA 4GUFA 2I57A 4XX6A 4J35A 3T7VA 1HTIA 4O16A 1CGWA 2PA6A 3QGAC 4N4PA 2JALA 3IUHA 3A22A 1B3WA 2ZC1A 3P7YA 2R1PA 2ZX7A 1JAEA 4JTIA 1EF2A 3E0VA 3BG5A 3CAKA 1EFZA 4YJ5A 4IXHA 4S38A 4DIAA 4GQBA 4GJIA 2CCRA 1NVMA 2J47A 2YXOA 4H9XA 1B57A 5FJUA 1ISXA 3W6LA 1K6WA 2OO0A 4PYSA 3UG4A 2VR5A 1HJUA 3D47A 3EWDA 3T2OA 1X98A 3FHAA 3AHYA 5BXPA 3NQFA 3E1F1 2XVKA 4O11A 4PTDA 2YCLA 4IMCA 3V75A