3FYOA

Crystal structure of the triple mutant (n23c/d247e/p249a) of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
255
Chain Sequence
MDIKINDITLGNNSPFVLFGGICVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGGRRAQALDLALAGMATRLAGLFLESHALPLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase
publication title Reversing evolution: re-establishing obligate metal ion dependence in a metal-independent KDO8P synthase
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transferase
total genus 81
structure length 255
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fyoA00
1ICQA 4HKPA 1AW2A 1OFRA 1HL2A 3BGJA 4GE8A 3PULA 4OU1A 4EIVA 1KFBA 1SU5A 4N9BA 2Q3RA 1H7XA 2J24A 1W3NA 1TPVA 1O95A 5D2VA 2RHGA 4O17A 3LHTA 4XKYA 3LHZA 3JRKA 1YADA 5AC8A 5D38A 5EA9A 5AHNA 3HPZA 4LNYA 1TPC1 1LROA 4O15A 4WZHA 4ADSA 3M43A 5AYYA 4GXMA 3WJSA 3P67A 4QJ1A 3TXVA 5HWJA 1NAL1 2FFCA 2Y7GA 3MBFA 3T7VA 3NQEA 3MHGA 2CLIA 3A5FA 4EWND 2GJNA 1SW7A 3EXTA 4O10A 3IGSA 3TC6A 4PC8A 3W72A 3KRUA 1SZEA 4KWVA 5G1YA 1KV8A 3M41A 2QJIA 1H63A 3GXNA 2B7QA 3RNDA 4PFMA 2JGQA 3VI2A 1PIIA 1K03A 1C8VA 2OMAA 4XWUA 1M6JA 4I7WA 2P10A 4UTTC 1G69A 4O1AA 5K7JA 1F5ZA 1GPWA 2JGYA 5CKSA 2HMCA 1G4EA 2DZUA 5CZTA 5AHIA 5F2IA 4JTGA 3TK7A 4CNOA 1YPIA 1PE1A 4O52A 5LNVA 3NQ8A 2G5WA 1OYBA 2YYTA 3O06A 4NNCA 2E6YA 1YDNA 1I2PA 3STFA 1TTQA 3NPVA 3THQA 1KA9F 4WY0A 1VC4A 1WAUA 3OVQA 3O6DA 1FWTA 5F2LA 1ZAJA 3P81A 3P84A 4W9TA 1SO4A 2VXNA 5MHBA 4JTEA 4MYXA 4O28A 3O63A 5EKYA 1V7YA 2Y85A 2QF7A 3EXRA 1L6WA 1TB3A 4K8EA 1RQHA 3L9CA 5I3KA 1I2OA 4LVGA 2VEPA 4O8RA 3SSJA 3KXQA 3P62A 5LZLA 5D32A 3R89A 1KM5A 2R14A 4FNPA 1P0NA 3CM4A 3W7GA 1JRCA 1ADOA 4MUZA 4GNJA 3TMQA 1FY6A 2QUUA 3TQKA 1PHWA 5C54A 4HSNA 2ZRXA 4M7TA 4WD0A 2CZ5A 3ATZA 4EF8A 3LCHA 4PH6A 1GJPA 5DY3A 3USBA 5LNSA 3ZS4A 1F2JA 1XL9A 1BEUA 4K7VA 1SQ7A 3TAKA 4UTLA 1QDSA 4POCA 1CI1A 1KTCA 5HWNA 1LOLA 3LV6A 3W1NA 3HGSA 5IBXC 3AO0A 1LLWA 2X1RA 5L9FA 1TQXA 5LNUA 3ABRA 3BARA 5D2TA 1QPQA 3M5YA 4HNNA 3LHUA 2ZZ2A 1W56A 1YDOA 5CSRA 2ZRUA 3TFXA 3CT7A 4KWWA 1CX9A 4HPJA 4RR4A 5I3HA 3W7LA 3OBKA 5D33A 5DY2A 2VEMA 1ZFJA 2V81A 1G67A 4RKAA 3GB6A 5D37A 3W7HA 3EX3A 3ZWTA 3F1QA 1VCGA 5KITA 4BWLA 1OVDA 3MI2A 5FEZA 1GVOA 5DBTA 4UFHA 5F4SA 4A22A 2W0UA 4O12A 2DZSA 3UWQA 1VR6A 3M16A 5BMWA 1MEHA 4TMBA 3GLCA 1F6PA 1RZMA 3GAYA 1KM4A 4CQ8A 3O07A 4O16A 3UY7A 2WO5A 4AMAA 1TPWA 4FNSA 4UMAA 2C18A 3TROA 1FX6A 3I7SA 1L6SA 3LCIA 2NV1A 3L0NA 3NDOA 3QSTA 5AYXA 3SGUA 2DP3A 2VFGA 3JS3A 3LCFA 4JD4A 2R8WA 2ZZ4A 1B4KA 1J5TA 1PS9A 4HPXA 1OFQA 1NSJA 1FDYA 4FEZA 3HQ1A 3O05A 5HNRA 2NX1A 1NVMA 2E6DA 3EXSA 2NWRA 2A2IA 1VYPX 3PAJA 5HWMA 3IIZA 2Y70A 3L0KA 2TRSA 1TPEA 3OVRA 3B4UA 1LTDA 3W7IA 3PG9A 3G1DA 3B0PA 4WXZA 4L4MA 4Z08A 1QPNA 2ISWA 3TJXA 3EKLA 4ZQMA 1JJKA 1ZJIA 3N9SA 3EX6A 1BWKA 4M6QA 4ICNA 4DO6A 1O60A 2E77A 2E5DA 4DPQA 2GJLA 2Q3OA 4UIOA 3N73A 3WJZA 3T55A 1W31A 3TAOA 3C8FA 4FIQA 3QZEA 3BPWA 1Z44A 4BI6A 1UASA 4JTKA 5F2MA 2DZPA 1JQVA 1Z42A 2V2HA 3E12A 4ZQOA 4JIPA 1O5KA 3BK0A 1Q6QA 4ZQRA 1PHQA 2YW3A 3W2UA 2V5BA 4K37A 4UFJA 2J9ZA 2CLKA 2PC4A 5J5RA 1P4CA 2KZHA 3TQ0A 3G3DA 3TQVA 5F1VA 5F1UA 4O57A 4YLWA 2CLHA 3GXTA 3C4UA 1S3HA 4QIUA 3W1LA 4ML9A 3O6CA 5DXXA 2HTMA 4ORIA 3FLUA 1IXQA 3EWBX 3FEMA 4K36A 3LERA 3MYPA 3NAVA 1ICPA 5AC7A 4XBKA 1KFEA 3N2MA 3MYOA 2X30A 3HGOA 3NQVA 2TMDA 1GTHA 3Q37A 2ZYFA 3L68A 2O7SA 1LP6A 2FPVA 3FYPA 1RPXA 3W1XA 3T44A 4LVBA 5I3JA 1ALDA 4MLRA 3EX2A 2NUYA 3LRMA 3NQMA 1TIMA 3NL5A 2CU0A 3MHFA 1GOXA 1EUNA 1W5MA 1VS1A 3STCA 3NG3A 3QQ0A 1ZAIA 4QSHA 1JVNA 4FX6M 3NA8A 4MY1A 3EX1A 4IMEA 2WKJA 4QNEA 1Q6RA 1IGSA 1E51A 2YPIA 5A5WA 1QWGA 3CIWA 4YCOA 2ABBA 4NJHA 5G1TA 4M19A 5U7SA 1I2RA 3QM3A 5ABTA 1TV5A 3NL3A 3W88A 1UCWA 4DQWA 5G2WA 4WOQA 5LGZA 2BZNA 4JTLA 5E1QA 1T8XA 3R8RA 3W2NA 2GUUA 1SPQA 2LLEA 3DXIA 3L5MA 4O4VA 1EWEA 4IWWA 3W1RA 3WK2A 4AH7A 5DXYA 4E2DA 2RFGA 1GEQA 2PCQA 1OFOA 2CZEA 2QCFA 7TIMA 3KAOA 4CNNA 3SIZA 4AXKA 2IQTA 2Q8ZA 5FEXA 2G96A 3CQ0A 4TR9A 4ALDA 3OA3A 1TPUA 1J2WA 3GZ3A 4UNKA 3HGRA 5AHEA 2PE4A 1I4NA 1EIXA 1OFDA 1AG1O 2R91A 4YWIA 4BFAA 1YTEA 4JTFA 3UWZA 1JQXA 3S1WA 1OK6A 1SSDA 4MJZA 4NQ1A 1WA3A 2FLIA 1GTEA 2UV8G 4A2RA 2XFWA 5BMXA 3BLEA 1F74A 4B5NA 1XDMA 3B06A 3G18A 4Z0JA 3QPZA 4Y96A 3IIXA 4RJEA 5I3FA 4CNPA 2NXIA 2Q8LA 4FNTA 2QKFA 3RFAA 3K30A 3QEZA 1KW1A 4BI7A 4H4IA 4JTHA 1TMHA 1H1ZA 2CW6A 2A6LA 2YXGA 3BO9A 2NWSA 3W7EA 4HNTA 4JYFA 3QQ1A 1FCQA 1JCLA 4Q4KA 2BWGA 4NX5A 3UWWA 4LV9A 4UXDA 3MW7A 3M47A 5CPOA 3W84A 1RV8A 3TUUA 1D9EA 2HSAA 3QRHA 3ELFA 4MFEA 3LGEA 5BW6A 3W70A 5K4ZA 2FB2A 1IXNA 3S5NA 2FDSA 5AC6A 3W7CA 1IXPA 4OV4A 3H55A 3LLDA 3SZ8A 3NQGA 1R2TA 3GDMA 2HS6A 1R2RA 3G3MA 3RK8A 4UMBA 3DI1A 4IX0A 1YXYA 5KZDA 1FXQA 4GRSA 2NLIA 3NPXA 3G1XA 3TSMA 1EP2A 2OT1A 2Y88A 2ZQ0A 3GKFA 3PBWA 3TA6A 3NQ7A 1OFBA 3A21A 1TJRA 3SECA 5FF7A 3UWYA 3THAA 1XKYA 2GVJA 4AHOA 3B05A 4NJGA 4PL2A 4NNAA 1AMKA 2R94A 3WK0A 3GR8A 1WOAA 2QEZA 1A50A 1N7KA 4UFLA 3E0IA 5K9DA 2C13A 4XZ9A 4DEFA 1DKWA 1K7XA 1W54A 2Z6IA 1JUEA 4AWUA 4BWLC 4IMGA 4JTUA 1QO2A 4XQ6A 1YPFA 3W2KA 1TQJA 1BWLA 1OFEA 4UMCA 4NZJA 1IF2A 1PCKA 3D0CA 4GUIA 5D30A 4Y9AA 3W2JA 3B0UX 1J4EA 5DLCA 3GVGA 3UZ5A 3F4NA 3PR2A 5AB3A 1GVRA 2YR1A 4N02A 2VFDA 3PSVA 1KM6A 1GVFA 1AL7A 4DBDA 4AAJA 4Z1AA 4Y6GA 1TCDA 3KOFA 3L21A 4NX0A 3LRLA 4S2CA 2C14A 3NVTA 8TIMA 4DO5A 3U6WA 1SO5A 2F84A 2V82A 3M9YA 1QMLA 3OVPA 3LCGA 1H50A 3S1VA 2V5LA 3F4WA 2E68A 2FIQA 3TE9A 2QCGA 4FO4A 2YFOA 4JN6A 3LBMA 1T96A 3ZR4A 2QCCA 1UBSA 3DENA 3DH7A 2H3BA 3H53A 3KVJA 2ZRWA 1A53A 1UUOA 2V8ZA 2A0NA 3EWWA 3C6CA 3GK0A 1ZENA 3LX9A 4UTWA 5D02A 4OBTA 2C15A 1EEPA 1QPRA 1L6YA 1LRQA 1RQBA 3RU6A 1WV2A 3U2OA 2VOMA 3CTLA 2FPYA 3GNNA 3GNDA 4N9EA 3P74A 1W3IA 4NVTA 2JKPA 2JKEA 5DCBA 2DZWA 4JTSA 3C2RA 2X16A 5HJLA 1Q3NA 1JUKA 1W37A 4LUJA 1DQWA 3OG3A 4WXYA 1VLIA 3DGRA 1HO1A 3PUDA 1SSGA 2VEKA 4AB4A 2H8XA 2JK2A 2EAWA 2C1HA 1B3OA 1GWJA 1KBJA 3FFSA 5SWUA 3BG9A 3DFTA 2E6FA 1OYCA 4M6VA 4LY8A 2VFIA 1BTMA 2ZZ1A 3BGGA 4LUIA 3WJYA 2Y61A 3L5AA 5AOUA 4I7UA 2QCHA 1XCFA 3FJ6A 3UXDA 3TJLA 2A85A 5F2GA 4N4PA 3FKRA 3LHYA 1VGAA 5TBOA 3PB0A 4O54A 1QCWA 3TW7A 3NM3A 3W9ZA 1K7FA 3C3NA 3S42A 4UTUA 5LSMA 5BOOA 3OIXA 3SJ3A 1EWDA 1MEWA 2GQ8A 4UNLA 1FWSA 3E49A 1KTNA 3EX4A 1QAPA 3PY2A 3W1AA 2QCMA 3RF9A 3PM6A 4LW7A 3S5YA 4QNWA 4L4LA 3LTYA 1KLZA 1WXJA 3GDTA 2GVGA 3L0GA 4QM1A 4X2RA 4O1DA 1FDZA 3KHJA 2YCEA 3W7KA 2H3DA 1X1OA 2JKAA 3LTPA 3IVTA 3M44A 3PVFA 4CCCA 4R34A 4UTIA 1EB3A 3W73A 4MKNA 4O14A 1G7VA 3UPBA 3INPA 3P8IA 1OJXA 4E0CA 2PRHA 5CZJA 4WX2A 4FX8A 2GVLA 3TSBA 3NO5A 5LNRA 4XTDA 3IVUA 2YX0A 3PG8A 1OG0A 1EX5A 1I2QA 1WDWA 4NJJA 2YYUA 2YFNA 1MXSA 2GPTA 3O16A 3EWXA 1TRDA 2QAFA 4ZQNA 1MZHA 4PCFA 3PBYA 5D03A 1L9WA 1SFJA 4KFOA 5CZ0A 2ALDA 4R53A 1MO0A 2QAPA 2ZRYA 2F7FA 1FXPA 3IRDA 2A5HA 2CLMA 4AWSA 3QW3A 5G5IA 3LB0A 3ANYA 2EKCA 3S1UA 2A21A 4EOUA 3NPUA 3M1ZA 1OABA 1F05A 3EB2A 4N2YA 3LBCA 3MUXA 3TSDA 3TDFA 5G4EA 4PL1A 1H7PA 1KV5A 3IIVA 1XM3A 3CPRA 4GUFA 4O4WA 3C2EA 3QMRA 3M5ZA 1QO5A 1XBXA 3P61A 1VQTA 3UWUA 3R12A 2AQWA 1JCMP 1ZNNA 1N55A 4G1KA 1RR2A 2I1OA 2PURA 1G4PA 5D05A 2P1FA 4RLIA 2ATMA 4JGDA 4K8HA 3PUEA 3QPYA 2V2DA 4UTMA 3NEVA 5H2ZA 1WX0A 2VELA 3W71A 4I7VA 2Z2UA 1OX4B 1AK5A 3PC0A 3W7OA 2DZXA 2YW4A 1W5OA 3LLFA 3R5EA 2Y63A 2A7PA 3HF3A 3IEBA 3VFLA 2FB3A 3NQDA 3TX9A 5FF4A 4JDYA 3IIOA 4PODA 3W87A 4LV4A 3P5YA 1K02A 1A5CA 3TH6A 2H6RA 2WNZA 4PA8A 3IGXA 1KFLA 3P8JA 4O1CA 1NFBA 2B7PA 1QOQA 4MVAA 4HIBA 4ONVA 1PV8A 2C6QA 1QPOA 4LT9A 2HS8A 4O18A 3YPIA 4UUIA 5K2ZA 4NJIA 4TIMA 3CWOX 5A8GA 2CWNA 2FJKA 1WBHA 1TV8A 4JXCA 4OQVA 1RQEA 1N8FA 4IGHA 3N9RA 4GJ1A 2NXHA 2OJPA 4Z1DA 4QAIA 5C55A 4WQ6A 1AW5A 1X1ZA 3U8GA 4XUGA 4O50A 4UTKA 4H6KA 3WJXA 3W07A 1ZAHA 1LYXA 2ZCGA 3O6YX 2YGYA 1KM2A 1VYSX 4O13A 3DZ1A 4HNUA 3W1PA 4DXVA 2E5BA 1CW2A 1EPXA 3EWYA 1SZFA 1K3UA 4JS3A 4GUHA 1TPB1 5BRBA 5LGXA 1JCJA 3NL2A 5EYWA 5HUPA 3NQCA 3LM7A 4FNUA 4EF9A 1DBTA 3W74A 4NJKA 4UR7A 4DBEA 3LXCA 1GZGA 3B0VC 4XTIA 3GDRA 3C2FA 2OT0A 3VKJA 4ZL1A 3G1VA 1W3TA 2VFEA 4LU0A 1FWRA 2CLOA 1LORA 6TIMA 1SW3A 3AJXA 2FQIA 4LWWA 3HIJA 5CZSA 2EHHA 3LXBA 3KVLA 1LOQA 1VJIA 4ZZ9A 3HG2A 5HULA 1QR7A 2WSQA 4UC5A 4PEKA 5T26A 4MY9A 2ZZ3A 3NQAA 2E5CA 1XUUA 2QCDB 3LCXA 5DBUA 2ZZ6A 3B03A 4K7YA 3Q2DA 3W1QA 1GYNA 1LRTA 1H60A 3UWVA 1H51A 4NUWA 2X2GA 1I2NA 4JR5A 1FQ0A 2ZZ5A 5G2IA 3TIMA 1LBMA 3MJYA 2NX3A 3PWAA 4FIRA 3W1TA 3LCLA 1R47A 1A5SA 4Z1CA 3HPXA 3LV5A 1P5BA 1ME9A 1RD5A 1IXOA 1OX5A 4LC6A 1G4TA 2ZA2A 4N9CA 1Q6LA 3SY5A 3TMLA 2Z0IA 2X1TA 2PRLA 3HOJA 4FXSA 4UTWC 3L67A 2ZFAA 3ABSA 2NX9A 1DOSA 4IMFA 1DJNA 3BG3A 4ORMA 2I14A 5KMYA 1PL9A 3NQ6A 1XBZA 2DJXA 3W6YA 4RZ6A 4LC8A 3G1YA 2J27A 3I65A 4E38A 1DV7A 4PTNA 1W5PA 1I45A 1DL3A 3CHVA 1Z41A 1SZNA 2QCNA 4YL2A 3TFCA 4JNMA 2QCLA 3PSWA 2QJGA 1JCXA 1LBFA 1G7UA 1WQ5A 4AEOA 4DPPA 5D04C 5KZMA 2XN1A 1MEIA 3NPWA 1W5QA 4D2JA 3IIPA 5EY5A 3GAKA 3A23A 4FF7A 3UY8A 1O5XA 1GVQA 4A29A 1K8XA 1T0OA 3DKLA 4OWGA 3VE7A 4FNRA 3HG3A 1VH7A 3G1AA 1H61A 2GOUA 1DVJA 3FIGA 5J5DA 1JCNA 4O19A 2ISVA 4OV9A 1W0MA 1YXCA 3TKFA 2ZTKA 2H90A 1SO3A 2QR6A 1SZGA 3DAQA 4WJEA 5EBUA 3PBVA 3UNDA 3CC1A 5CPNA 3GXPA 3EKZA 4NZFA 3VNDA 1KLYA 4U4MA 1PCWA 3WFAA 4JEQA 2WJZA 1P0KA 3MO7A 1UB3A 5K3VA 1D3GA 3NM1A 3MP3A 3F03K 3TV8A 4MIMA 4GFSA 2G95A 3NNTA 4UCGA 3W2LA 1KFKA 4GUGA 3R13A 4MZ8A 4IX2A 5AN7A 3CLMA 3M7WA 4CCDA 3HG5A 2X1SA 3A5VA 3FYOA 1XDLA 1TRIA 1YYAA 3LDVA 4S2BA 2CLEA 3BLFA 3VE9A 1DORA 2EPHA 3RMJA 3C0JA 3QC3A 4O1BA 1Q6OA 3W7QA 3GR7A 4WY0B 4UR8A 1QNVA 3KFTA 1V5XA 5I3IA 5FESA 3TW6A 1DHPA 2QJHA 1EA0A 1XBVA 2QCEA 3GDKA 1OF6A 2RDWA 4IXXA 3L65A 3PF3A 2QCDA 1JCYA 1XXXA 4ZMGA 3DFPA 2C19A 2BX7A 1D3HA 5DCDA 2VC6A 1C9DA 4RZ4A 5E0KA 1YTDA 1FCBA 1JR1A 3KVMA 3E02A 1JULA 3M5XA 3OEXA 3W7DA 3RLVA 1H62A 3TC7A 1FWNA 4CQ9A 2ZZ7A 5AHMA 4DF1A 2CLFA 4U28A 4AHPA 3ABOA 5KTLA 4LVFA 4LVAA 3NL6A 2AAMA 4LS0A 3LHWA 3TNOA 3QYQA 2V0TA 3N34A 3IVSA 4BI5A 1WYIA 2E09A 4MPQA 3DHFA 3GIYA 5AHFA 5AFDA 4LS1A 5KZEA 1GVSA 3T78A 1ZY9A 1H1YA 4JYDA 1YTKA 3HGJA 3I7QA 4WY0F 1QFEA 4DF2A 1H7NA 4O0ZA 2ZA3A 3C56A 1M5WA 1H7WA 1P1XA 4ZQCA 3HB9A 5FF3A 1TTPA 3I68A 5LHFA 1ME7A 1TJPA 2VFHA 2VENA 1FUYA 4JY9A 2O7QA 3I6RA 4K6AA 5TQLA 3LI0A 3V1PA 2V9DA 3B8DA 5DN1A 2OX1A 2Y62A 4LOCA 1LCOA 4DO4A 3O1NA 1GG1A 1IIHA 3LHVA 1VCFA 4KKXA 4M7SA 4O11A 3FA5A 3QMTA 3BV4A 5CGQA 3DFNA 3L66A 3KVKA 4X22A 3NZ1A 4KFPA 4ZVJA 1OFAA 1G6CA 1KTBA 3G1FA 2J9XA 3FKKA 1ZHAA 3EWZA 3LI1A 4X9SA 5F4XA 4LRTA 2G97A 4P61A 5AYZA 1U5JA 1DJQA 3MBDA 2TSYA 5CPLA 3N19B 2EGZA 5D09A 4FB7A 1VRDA 2BLEA 3JR2A 1G4SA 3W23A 1H7OA 2DU2A 3G1HA 1HG3A 3LRKA 3MP4A 4OT7A 2Y6ZA 1HUVA 4JDBA 4MYAA 1SR9A 4ADUA 3ATYA 1S5WA 5CPMA 4K38A 4R7JA 4Q32A 2ATSA 1B57A 3H54A 4CQAA 2WQPA 3QW4B 3G0UA 2J88A 5FI8A 5TIMA 3BW3A 1OFPA 1VPXA 3MI3A 1SUXA 3P60A 3KRZA 1VHCA 3HMJG 4OGZA 1OHLA 5HUOA 5EL1A 3T40A 2ZDRA 4LVDA 1OK4A 4IMDA 4YCPA 5KSWA 1B9BA 5G4WA 5LHEA 1NF0A 3RLUA 4GWEA 2YDAA 1ML1A 3FJLA 3UZJA 1F73A 2ABAA 3FOKA 2NV2A 3NOEA 4Y8FA 4XBSA 1TTJA 3BG5A 3EEGA 4IUOA 1H5YA 1TV7A 1O4UA 3BW4A 4JTIA 3TCEA 4K39A 4MOZA 2XN2A 2WNNA 3W7JA 3W7MA 2CFFA 1ZALA 4O0KA 4P2VA 3BW2A 5CSSA 2BSLA 1VCVA 1U83A 4N6FA 3W7PA 3S8HA 3DFQA 3CEUA 5HMSA 3L5LA 4N9DA 3CIXA 1H7RA 1FWWA 2B4GA 3SI9A 3W22A 3STEA 3GYEA 1W5NA 3B04A 1Q45A 5KINA 3R2GA 4LS2A 3A24A 4JYEA 2V30A 5FF2A 3P7YA 4LTSA 1FBAA 5IM51 4NU7A 5LKYA 4MY8A 3P82A 3C61A 1ONRA 5LNWA 4IQLA 5HINA 4UFIA 4EVZA 3S5OA 4AVFA 4AHQA 3G0SA 2OCZA 3CB8A 1LZOA 1TYGA 2DJLA 2FPTA 1VLWA 3MP5A 1LRNA 3A22A 5C5YA 3P80A 3DFOA 3ABQA 2GQAA 1TREA 1F76A 1GQNA 2DORA 3LOTA 2NZLA 1VYRA 1XI3A 3G22A 4A2SA 2RDUA 2QUTA 3UD6A 2TYSA 1EP3A 4RXGA 3LCWA 1T99A 4E2BA 4MLJA 5D2YA 1X6UA 1GT8A 1A5AA 2BTMA 1NF7A 3QMSA 2ZA1A 4AF0B 4N4QA 2RKXA 6ALDA 1C29A 2RH9A 1KM0A 5K9CA 2E1DA 3S0CA 3TXZA 1R2SA 1LM1A 2YSWA 4RZ5A 1RVGA 1BKSA 3DU0A 1LOSA 3W2MA 4FNQA 2WNQA 3DI0A 3PS7A 1KM1A 1HO4A 4RXFA 2A7NA 1KFJA 3DKJA 1M7OA 2WSRA 3TR2A 4IJBA 2NUWA 1GYLA 1KM3A 2X1UA 3FS2A 4QISA 3DBPA 4OE7A 3Q58A 4AWTA 3W75A 3W3OA 2ISSA 3CU2A 3G24A 2DZTA 4DF0A 2A7RA 5K9XA 3KX6A 1PVNA 1S5TA 3UXAA 2CZFA 2JBMA 4JX4A 4NNBA 3G1SA 3GKAA 4UTTA 3WK1A 4FXRA 1SFLA 3MMTA 3O8AA 5K4XA 3LXAA 3M5VA 4IMCA 1IIGA 1DQXA 5EPDA 4DELA 3T4CA 3C52A 3HG4A 1Z48A 2J9YA 4R33A 1X8FA 1EUAA 1UUMA 3G8EA 2Y7DA 3NXFA 1K7EA 4GC4A 3UPWA 4UFMA 5F4WA 1TPFA 1A5BA 4IPJA 2ZBTA 4IXHA 3S5ZA 1LDCA 2WSYA 4A3UA 4A21A 4ZQPA 1LLZA 4WUIA 3IV3A 3N14A 4NXKA 3QSRA 4IPIA 1VHNA 4Z1BA 3P5ZA 4ADTA 4CCEA 4JTTA 2QDGA 3W7NA 2Y7FA 2VEIA 4YXGA 5U4NA 4HN4A 3NGJA 5HR6A 1TSIA 2I9EA 2ZRZA 4RX0A 3W7RA 4M6PA 2NXGA 5HQEA 3ZFHA 2QUVA 4IOTA 4Q33A 3DHDA 1WBJA 2VFFA 1FCVA 1HFBA 1MSSA 1AW1A 1K8ZA 4FX7A 4MZ1A 1XBYA 2VKZG 4GBUA 2Z1BA 1YXDA 4JY8A 4NXSA 3W85A 1WOBA 2Y89A 2Z6JA 4RK8A 4MZYA 3WK3A 4YMZA 2C0AA 1F6KA 2EF9A 2TPSA 5G2HA 5D2WA 3LTSA 1KFCA 2V2CA 4JX5A 1JRBA 1TTIA 3N2XA 3GDLA 3G8RA 2Y7EA 4HSOA 5CG7A 1YDVA 5FEPA 1OX4A 3CWNA 1LBLA 3STGA 1XFBA 2GQ9A 5IBXA 4GUJA 4XKYB 3G0XA 3SGZA 1QOPA 1GG0A 3CEPA 5GVJA 2WPBA 3N3MA 2P0OA 3QH2A 1KBIA 5AHLA 4HHPA 4RV8A 1SO6A 3L2IA 4H3DA 3BLIA 1THFD 3BVJA 2OZ0A 3PUOA 2W79A 3QJAA 4AF0A 4BK9A 3W86A 3VCRA 3MWAA 4CLMA 1X7FA 3OHIA 3M0ZA 1R30A 1FDJA 1XC4A 1O94A 2W6RA 2ZRVA 4TX9A 2NUXA 1W1ZA 1JUBA 1B4EA 3PBUA 3W1UA 3V75A 5BNKA 4TU1A 3NQ2A 3ZWSA 3HPSA 2H8ZA 1S5VA 1L2UA 2B7OA 4JIQA 2FTPA 2BXVA 2CLLA 1NEYA 5H91A 5DELA 4UTHA 3NYZA 5HR7A 1FCUA 1ZCOA 1OX6A 2B0MA 4JTJA 3PB2A 4S1FA 1W8SA 4OHQA 4JX6A 3W83A 2ZTJA 4M5PA 2E6AA 1YLVA 4JICA 5DCEA 2A6NA 3MHUA 1I8JA 1R46A 1OF8A 5D2XA 4RCXA 3O15A 4LRSA 2C16A 1HTIA 3MI6A 5E93A 4HT3A 4N6EA 1ICSA 3I7RA 4NT0A 3W76A 4I9AA 2PRMA 3QFEA 1TPDA 3NQFA 2CZDA 3HBLA 1SW0A 3E9AA 2WOQA 3SFKA 3KRSA 5FEWA 4C1KA 3TU9A 3W1MA 1EP1A 1K8YA 3QF0A 1F7BA 4X3ZA 3SW6A 4J9JA 1TO3A 5I3GA 4QITA 5C2XA 3C2VA 3S9YA 3EWUA 4TO8A 4BF9A 4BR1A 3NZRA 3E96A 3SR7A 4HNVA 5C6MA 4KFNA 1M7PA 1OYAA 3M6YA 4UFKA 4FHAA 2DZVA 4C1LA 1UJPA 4MFDA 1ME8A 2WV8A 3Q94A 5L6UA 3A9IA 5FF0A 2AGKA 3UQNA 4Y90A 3IGUA 2D73A 3NR0A 1XUZA 4O53A 3C2OA 3HO8A 2B7NA 4TMCA 3HJZA 2RDTA 3UYCA 1AL8A 2C3ZA 4UTJA 3S6DA 2QDHA 2A1YA 4WOZA 2A4AA 3WJWA 4QQ3A 2YZRA 1VZWA 4MJMA 4Z0SA 1Y0EA 2XN0A 3GX9A 1TPH1 3DFSA 5EMUA 3S1XA 2J6XA
chains in the Genus database with same CATH superfamily
4LAZA 2BOFX 2IPWA 3S6TA 1AW2A 1OFRA 3PULA 4EIVA 2ZX5A 2RGLA 4ZO6A 5ABFB 5FJUA 1H7XA 4CQBA 3SJNA 4NZ4A 1WDDA 2A3EA 1TPVA 4GCAA 3MZ2A 3FEQA 3GU2A 1BYBA 3EMZA 4LH8A 3LHZA 5AC8A 1YADA 3SCQA 4KESA 5AHNA 3M64A 4AC7C 4Y8EA 2PEVA 4ADSA 3B9NA 4GKLA 5BRPA 4GI6A 1QJWA 4NASA 3T7VA 1XQLA 3NQEA 1A47A 2VGIA 3OQ8A 2CLIA 1OC7A 2QIIA 2OXNA 4O10A 1KD0A 2F9RA 5G1YA 4KWVA 1TUFA 4KRTA 3CYJA 5E0CA 1FWEC 1C8VA 4I7WA 1EGVA 1F5ZA 5CKSA 4H9TA 2HMCA 1G4EA 2DZUA 5AHIA 1BGAA 3ARVA 3UU0A 3WELA 3OGSA 1C8XA 4P5UA 4OUIA 3O06A 5TF0A 1HKJA 1U1UA 1E0VA 1E0WA 2XGBA 3SIMA 4Q8VA 1PZ2A 3CQHA 2CERA 3P84A 2BDQA 3D46A 2ZXAA 3PHAA 3N18A 4O28A 4QRNA 5EKYA 2ISDA 5CC7A 3SSJA 4O8RA 1WB0A 6XIMA 4FNPA 3CTTA 1ADOA 4GNJA 4IP5A 2HK0A 3TMQA 3U4AA 5C0QA 3BJTA 5E6ZA 4AY1A 4AYGA 4XSLA 4HU0A 1GHSA 4A4AA 5C54A 4HSNA 4WD0A 2CZ5A 2NV9A 5I03A 4Q7IA 2OSWA 3UJ2A 1E55A 2PU0A 3EGJA 3TZFA 2E1WA 3UYIA 4GX9A 1CI1A 3H23A 3LV6A 2J66A 5AY7A 4AUBA 1V93A 5LNUA 1ISXA 3ABRA 5CLWA 4HNNA 2GDQA 3M0MA 2EO7A 4HK7A 1UKPA 2ZRUA 3TFXA 3CT7A 4KWWA 4KEZA 2PZ0A 5A8OA 4RR4A 3OBKA 2QZRA 3FDGA 1ZFJA 2HVNA 4RKAA 7A3HA 3PJXA 1VBJA 3AALA 4L64A 4BWLA 1GVOA 5LIKX 4ATLA 7TAAA 4QEHA 3UWQA 3LNMA 3M16A 1QHPA 1F6PA 1RZMA 3GAYA 2EPKX 3UG5A 4CQ8A 1MFVA 2WO5A 5C8BB 4DJEA 4DUWA 3I7SA 4HA4A 4KWOA 3GHRA 4UCFA 1EGMA 4FOJA 1Y8BA 3LCFA 2ZZ4A 1J5TA 3CQKA 1W1A1 4NHVA 2QV5A 1KQYA 4WDXA 2QPSA 3RUBL 4B90A 2A2IA 4FXFA 5HWMA 5GNXA 5JUVA 1W17A 4RDYA 3B4UA 3H2MA 1PKMA 2ISWA 3VVGA 5D8ZA 3EKLA 1JJKA 4KEVA 1PX4A 1NELA 3N9SA 4ICNA 2RAGA 3BOLA 1EJTC 3N73A 3WJZA 1R3VA 3T55A 3TAOA 1IZKA 3VIFA 4I8DA 1Z44A 5FA5A 3NDYA 4A6GA 3AS3A 1FWAC 1VJZA 5I2UA 3PZIA 4J3ZA 4MNMA 1KXHA 1JQVA 2EBNA 1YX1A 3E12A 4I9TA 1HJQA 4JIPA 2ZVRA 3OVGA 2Z28A 2YW3A 4D6EA 4RE2A 4QEEA 1CECA 1W2PA 4O57A 2CLHA 2DSUA 1FWDC 3C4UA 3RLGA 2UY4A 4QIUA 5G4HC 2ZE3A 4ML9A 4XVEA 4GYPC 4I6VA 2HTMA 1IXQA 3LERA 3NAVA 2FZDA 1UD6A 4HNOA 2G37A 1W1B1 3Q37A 3L68A 4I8YA 2I7GA 4YHEA 4QP0A 4S3BA 3W1XA 3MA8A 2OELA 2J7BA 3NQMA 1EXPA 3WLOA 2BMBA 4JTAA 1XR2A 2RUSA 3EAUA 2CU0A 4XZHA 1GOXA 2NT0A 1W5MA 3STCA 4H83A 4H7CA 2H9AA 3ENLA 2PDCA 4B9YA 1JVNA 1QI2A 4MKVA 4IMEA 4MY1A 2Q71A 1MFUA 2CBUA 2WMGA 3MMDA 5DMYA 3V16A 1XIBA 3DUGA 4YCOA 4M19A 3QM3A 2PCEA 3R8GA 1TV5A 1EJSC 3NL3A 4PB5A 5CJMA 1UCWA 2VC5A 3WLSA 4DQWA 2PDKA 3R8RA 1P7TB 2REQB 3BQ5A 2GUUA 3DXIA 4O4VA 4L1WA 2HVMA 1A3HA 3AXXA 2WHJA 3OTRA 2JIWA 4L7ZA 2QCFA 2IS7A 4AXKA 2IQTA 1GORA 3P93A 3CQ0A 4AIOA 2MNRA 2PUZA 5ABHA 3HGRA 3D47A 1I4NA 4AZCB 2MANA 2PDQA 2ZDSA 4ZBCA 4BFAA 5KZ6A 3KUMA 4KIEA 1OK6A 1SSDA 4KBXA 4GFIA 3RR1A 1YMYA 2VURA 3DDMA 2XFWA 1EJWC 5BMXA 1V3IA 3WBAA 5ENLA 3OODA 2PPGA 3QPZA 3FW6A 4ZODA 1GUVA 3ITLA 1LL7A 1E6SM 4C1NA 3VD9A 4PMRA 2AOSA 1TMHA 2CW6A 2NWSA 3VU2A 4AZIA 4JN8A 3VGEA 1PB0A 3SO7A 3QV9A 1IWBA 3UWWA 5I00A 4GACA 1NU5A 1RV8A 3TUUA 1D9EA 2ZX7A 1KGWA 3KOXA 4PBFA 4YTSA 3BV7A 2X0YA 1FH9A 1LJYA 3LGEA 3SN1A 5BW6A 4S39A 3UESA 2FB2A 4W8BA 3IJQA 4DUOA 3W7CA 1IXPA 4OV4A 1AD4A 1E4NA 3LLDA 1GPFA 1CGVA 1YRRA 1PYFA 3ALGA 4US5A 3KCLA 2R6OA 4AD5A 1LQAA 3DI1A 4IX0A 3GZAA 4GRSA 2FZNA 1EHAA 1RPKA 2NVDA 2OT1A 1Y5XA 4UBPC 2ZQ0A 3GKFA 1BTCA 1U5HA 3FHQA 1TJRA 2XFFA 1ZPTA 4AHOA 3WLNA 4NNAA 4UQAA 4YTUA 3IGHX 1QOXA 3GR8A 4QDWA 1K4HA 1RH9A 2C13A 1IHIA 4XZ9A 3WNPA 4PB4A 1DKWA 3NOYA 4GVHA 4IMGA 5BU9A 1YPFA 3W2KA 4LQ1A 1TJ1A 4PMOA 3WNLA 3VGFA 3EOUA 4UMCA 1PCKA 3GXDA 4GUIA 1G01A 5DLCA 3T1GA 3TTYA 1UD5A 2JE8A 5AB3A 4DUVA 3NEHA 2SFPA 1Q2SA 4JPGA 1V3LA 5GPRA 5EFFA 1RSCA 1KM6A 4Z1AA 4Y6GA 2PS2A 5FL1A 3TN3A 1HJSA 1B9ZA 5I07A 3KOFA 5CBJA 1P48A 3LRLA 4CD6A 4IIFA 4ATDA 2OZ3A 2C14A 1SO5A 2V82A 3GXMA 3OVPA 3LCGA 2E68A 1JYXA 1ZZMA 2QCGA 4RE0A 3LBMA 4GVFA 3ZR4A 2QCCA 1H2JA 3DENA 4DRSA 3N6HA 2H3BA 2JEPA 3H53A 3D3FA 3GHUA 1XGZA 3EDEA 2GQ3A 3N15A 3POHA 3T0CA 3GQYA 1Q6EA 4MWAE 2O9OA 3WY1A 4YTTA 3UVIA 1N82A 1V6XA 2ZXDA 3U2OA 2VOMA 1J12A 3WLTA 4YN5A 2BODX 3GNNA 4HA3A 3GNDA 2OWCA 1W3IA 3OGRA 3ITYA 2JKEA 3VD7A 4X2PA 5HJLA 3KLKA 4F9DA 1Q3NA 1JUKA 5J04A 3TC3A 1FWJC 1MW0A 4AQLA 3VGGA 3G2GA 1KRCC 1SSGA 1FHUA 2EAWA 3FFSA 5SWUA 5KEZA 1K70A 3BGGA 1J10A 1Q8AA 3TOPA 2PTXA 5HDRA 3FJ6A 4B91A 3UXDA 1R3QA 1QI3A 1S1RA 1YEYA 1XH0A 3GD6A 1UWUA 5DO8A 2BY1A 2VR5A 3BLLA 3S42A 3VZXA 2GQ8A 1QAPA 1W9UA 3PY2A 3AIBA 2BXYA 3S5YA 3GHTA 3GTIA 1MW2A 3ITCA 3LTYA 4X2RA 4KQNA 2VCBA 1SFTA 4EPDC 1HIZA 3IVTA 2FZBA 1F07A 4UTFA 1TMLA 1H1NA 2J8GA 2E9MA 2VI0A 3VGDA 3RCYA 4E0CA 2ODOA 5A69A 5A6MA 5LNRA 4XTDA 1XLFA 2YX0A 2XVNA 4NJJA 2YYUA 5I78A 2WC4A 4C6QA 3SBFA 1WDQA 1MXSA 1HP5A 3GBEA 4AU0A 3O16A 3K1DA 3SUSA 3EWXA 2QAFA 4ZQNA 1HKWA 3MU7A 4Q6XA 4GCXA 2J62A 4HCDA 3WQEA 4M6UA 1MO0A 3A4AA 1FXPA 1XLMA 2GK1B 3LB0A 3ANYA 4LAKA 2A21A 3REQB 2J8TA 4N2YA 2BP1A 4QSFA 4GUFA 1E15A 3M5ZA 3R12A 1JCMP 4G1KA 2I1OA 4MDPA 4DX3A 3IS4A 3WEOA 1S3TC 2V2DA 4UTMA 1UMYA 2YA2A 4F0SA 4R7WA 2XH4A 1OX4B 3PC0A 3W7OA 4C6KA 2DZXA 3LLFA 3R5EA 2D2OA 2A7PA 2IPFA 3NQDA 4HNCA 3IIOA 1TZ7A 4PODA 4LV4A 1K02A 1A5CA 3TH6A 4Q6JA 4YTQA 2P8BA 2VX6A 3P8JA 2R82A 3LYEA 2B7PA 4D1IA 4HIBA 1NARA 2O92A 2ZE0A 1QPOA 1H09A 4LT9A 3YPIA 4MDOA 4NJIA 4TIMA 3ZVHA 1A5LC 4GVGA 3CWOX 3RDKA 3XINA 4D6DA 3OZOA 1V3MA 5H8UA 3OQEA 1UR3M 4JXCA 4UOQA 1QI5A 2NXHA 5C55A 3SB0A 1AW5A 3MPGA 4FZIA 1OADA 5IDIA 1VYSX 3WLIA 5IXEA 4DYJA 4O13A 4HNUA 4DXVA 1QK2A 2BY2A 3VMNA 3W4RA 4HYWA 1XG3A 4ZB5A 1Q6GA 1GQIA 4XV0A 1K1DA 2DIJA 5EU9A 1TPB1 3SFWA 3WD1A 1M1BA 1J18A 1JCJA 3RHGA 3NQCA 1POKA 4FNUA 4ACYA 1VFUA 3IK4A 4KCUA 2XVPA 1UOKA 2PMQA 4LU0A 5M03A 1ITXA 3F2DA 4MB5A 4LWWA 3AJXA 3GH4A 3LXBA 3MQTA 4Q8NA 3UPMA 4CN4A 1B3YA 3CXOA 4J3WA 4K1WA 1LWJA 1DP0A 1IWPA 4UC5A 1CLXA 2GDUA 3NQAA 4IFRA 4YVXA 2J75A 3WFLA 2QJNA 4NAEB 3ZM8A 2QCDB 1EBHA 4OIFA 3W1QA 4Z2IA 1GYNA 1YNYA 2IMRA 3KOZA 1H51A 3UA3A 2GJXA 1RBAA 3WENA 4JR5A 1IE7C 5A6KA 4C90A 3TIMA 3W1TA 4FIRA 3UBPC 3ZT5A 4PMQA 3LD5A 2VD9A 3KE0A 3QV8A 5DFAA 4KWUA 1E4LA 3TMLA 3LPPA 4KS0A 4UTWC 1XX1A 1EKOA 2ZFAA 3K13A 1XPGA 3MV11 2YIHA 1TCMA 3ANUA 1GNXA 1PL9A 3NQ6A 4HYVA 2D2GA 5GJNA 3W6YA 4LC8A 4P7OA 4ZO9A 2FVMA 5CBBA 1XIGA 1HF6A 4G6CA 3CHDA 3SCWA 4D6JA 3CHVA 2PBGA 1KBBA 4PCPA 3TFCA 3OZMA 4JNMA 2QCLA 1JCXA 1XWYA 4XD3A 2WWCA 1WQ5A 4AEOA 5D04C 3WDJA 5KZMA 1GW1A 4L80A 4LNCA 1J9YA 3ZLHA 4QE4A 4QJ3B 3IIPA 3KBVA 4QJ5B 4KRZA 3UY8A 3A4XA 3DKLA 5FD0A 3GUGA 3ARWA 3AUOA 4L61A 4D6HA 3R8HA 1XSKA 4DZ5A 1ITUA 2WZMA 3DAQA 3ONBA 4U3AA 5EBUA 1VPQA 2QMJA 3GXPA 4NZFA 2VDIA 4JEQA 3VO0A 1UB3A 4UQCA 3OA5A 5K3VA 4KCVA 3KL0A 4FAMA 4HMDA 5I24A 1Q66A 1B3ZA 4MIMA 4GFSA 2G95A 3NNTA 4DBWA 2WCAA 3DIPA 4RNJA 1U1HA 4CCDA 1CBGA 2HZGA 3FYOA 1B1YA 1TRIA 2I17A 2XSBA 3L7RA 3N4AA 2CLEA 1KBKA 2XGZA 3RMJA 1EL3A 3QC3A 4O1BA 5I23A 1V0LA 3KFTA 3S83A 4MUPA 1W9VA 1W2VA 5I3IA 3E2SA 4U2ZA 3TW6A 3TYCA 2PLCA 3VKCA 1W9XA 4WCJA 2QCEA 1GK8A 3WQWA 5A2BA 1IEXA 1ECEA 3BGAA 4ZMGA 4PUDA 3AMKA 1E4IA 1JD9A 2GJRA 4J2MA 5E0KA 5CZKA 1XGDA 4CUCA 4F2BA 1S5MA 5IHRA 2WBGA 1FCBA 3KVMA 5MKGA 1A80A 2VQUA 1XC6A 2PDFA 4HP5A 2QT3A 1H62A 3TC7A 3MVTA 4CQ9A 4LCQA 4LUTA 1LF1A 5KTLA 1ZP3A 2X8RA 1P7TA 4D71A 3CHFA 4LVAA 5IFPA 4LUSA 3DYMA 1ZTVA 1US3A 3ITGA 3M4HA 5B7ZA 4H9UA 3IVSA 2E09A 1PWLA 5AHFA 5KZEA 1GVSA 3T78A 1ZB5A 1CGWA 1ZY9A 3HGJA 4DF2A 2J47A 4GQ0A 4U2YA 1R6WA 1Z69A 3F4CA 3UZZA 1E0TA 4ML4A 1I0BA 2Y4SA 1H7WA 4ZQCA 3VIJA 1S38A 3QHOA 1PSCA 4IZGA 2GJPA 3VUSA 4CN1A 2VENA 1FUYA 4JY9A 3B8DA 5F7UA 1V08A 3S6OA 4Q4SA 1I1XA 3CYVA 2E9LA 2Y62A 3WLPA 4JN7A 3O1NA 4MWAA 2RJHA 2Q01A 4A05A 1L6FA 1GG1A 4KKXA 4ZENA 3FA5A 3QMTA 4GH3A 3BV4A 5CGQA 3KVKA 1XLHA 1UW9A 3P3BA 3CV7A 2CITA 1Q4NX 1G6CA 2DIEA 3G1FA 3GY1A 3MUIA 1ZHAA 3LI1A 5F4XA 1T40A 2G97A 4P61A 5I5RA 2VT0A 3WQOA 2RJGA 5D09A 2EGZA 3KTCA 4DZHA 3A13A 4U10A 2FHCA 1VRDA 4Z2JA 4JFVA 4L9XA 3VX1A 3W23A 1H7OA 4CVUA 1HG3A 4QXIA 3GNPA 2INFA 3CL8A 4OT7A 2YA1A 3MP4A 1J01A 3RM8A 1UPPA 4MYAA 2PLMA 3ATYA 1R9ZA 3QV7A 4R7JA 4X9YA 2CPUA 5JBDA 1MUMA 4LSBA 3G0UA 3CMGA 3OOQA 2J7DA 3HMJG 3W6LA 1OHLA 2ZDRA 2BHYA 1CGTA 4PEEA 1AMYA 1SFSA 3AYVA 4HPNA 1ML1A 5TD4A 2OX4A 2CKSA 3UZJA 1TJ0A 3CMFA 4XBSA 5REQA 1S2CA 4IUOA 1H5YA 3WN6A 3BW4A 1W3HA 4WDWA 2VCAA 3RPDA 4B92A 3AIRA 1KQZA 4PCSA 2WNNA 1XKJA 1ZALA 1QWKA 4P2VA 2GGJA 1VBUA 1Q6FA 3WYZA 1FA2A 3W27A 3N4EA 2FHBA 1M3UA 3AICA 2HE5A 1LQ2A 1N8IA 4L65A 4Q8QA 3SI9A 3OLIA 3W22A 1CB7B 1C92A 1Q45A 4HPGA 7CGTA 4JYEA 2WZTA 2BOEX 5HATA 4LTSA 3B8WA 1FBAA 5IM51 2G50A 5LKYA 4V2XA 5JXQA 3FYYA 3MTWA 5LNWA 1UC5A 1DJGA 1OC5A 4UFIA 2FZ9A 3KBJA 1V0NA 2OCZA 3CB8A 3AHVA 1VLWA 3HFTA 3T6CA 4M0XA 5C5YA 3P80A 2GQAA 3MO4A 3VIGA 1TA3B 4UOZA 1GQNA 2NZLA 1AQHA 3G22A 3ARRA 2QUTA 4Q4RA 2YL9A 2Z7KA 3ITOA 5A2AA 4Q4MA 5HMFA 2YOCA 3DHUA 2ON3A 3LCWA 5A6LA 2Z27A 4E2BA 1X6UA 3SCNA 2X42A 5DMNA 4QDPA 5A8QA 1RA0A 1NF7A 4ICCX 3SRKA 2RKXA 6ALDA 3SUUA 2FMNA 3WH9A 2RH9A 3S0CA 1SJCA 3ABXA 4D8AA 4RZ5A 3E6EA 3T9PA 3DU0A 2I5IA 3W2MA 1H0IA 4HYRA 5D9MA 3PN8A 2WNQA 4FNQA 1EJRC 1HVXA 1HO4A 3CL7A 3DKJA 1EHNA 3TTEA 3WLJA 4HPHA 1XRSA 3PZGA 1YPXA 4HOWA 2HISA 4QISA 3DBPA 4OE7A 3RMEA 1D7FA 3P0WA 1DJHA 2ISSA 3MSGA 4D9PA 5CJ5A 4ICMA 1TV3A 1WCGA 1V7AA 3NXLA 3UXAA 4JX4A 3HFYA 3G77A 1E5JA 1SFLA 3MMTA 3O8AA 4HTBA 2WSPA 2BVWA 3T05A 3LXAA 3M5VA 4C6FA 1VF8A 5C9UA 1IIGA 2JEQA 4DELA 4Z1YA 4I9JA 3FGCB 4YIWA 1XSJA 1EUAA 3G8EA 1RP9A 5LXXA 3UPWA 4C6JA 1A5BA 1QATA 3MCNA 3RITA 4A3UA 2G3JA 2XH0A 3QSRA 4IPIA 4NI8A 3IPWA 3OP2A 3VDHA 4ADTA 3W38A 4JTTA 3NVDA 3F4DA 4S3FA 1EO5A 3NGJA 2QW5A 2WB5A 4B2DA 3W7RA 4DJFC 2NW0A 1VKFA 2NXGA 4B4HA 3CPUA 3WSUA 3BE7A 1JZ3A 3DHDA 2D2JA 1OD8A 4NL1A 1K8ZA 3AUJA 2OPJA 4MZ1A 2VKZG 4K1GA 3DBNA 5T9BG 5DRIA 2Z1BA 3A9BA 2Y89A 4RK8A 2XGIA 3TR9A 1M7JA 4MZYA 2OB3A 1OB0A 3VD5A 3WK3A 4S3EA 1F6KA 3A12A 1E6RA 3R7MA 3CT2A 3O0FA 3GDLA 1ZGDA 1BRLB 4HSOA 1W32A 1PKYA 4MGGA 4IIDA 5FEPA 1OX4A 4KGJA 1BAGA 4J2PA 3ZZ1A 1QOPA 2P0OA 2OLAA 5AHLA 5EMYA 2XIMA 4HHPA 4RV8A 1H11A 1XLLA 4TTGA 1BHGA 3A3XA 2W79A 3QJAA 4AF0A 4BK9A 3MUZ1 3VCRA 1X7FA 3OHIA 1DWAM 3EMQA 1E73M 4AIEA 4I90A 2W6RA 1QBBA 2WVVA 1XLDA 3ISIX 2D24A 4Z42C 3PBUA 3W1UA 4PFHA 5BNKA 1L8PA 3NQ2A 3ZWSA 1TV4A 3WMLA 3GSMA 3HPSA 2H8ZA 2JIEA 2FTPA 3A3WA 5C70A 2ACSA 4GIEA 3T0DA 4UTHA 3NYZA 1W3JA 1ZCOA 5FL0A 4B5UA 4RUBA 4F40A 3TLQA 3AWOA 7ODCA 1NOFA 1W1YA 4M5PA 3ZJ6A 4ES4A 1T5AA 5D2XA 3BH4A 2CEQA 3L4UA 2C16A 4MSSA 5E93A 4HT3A 1JFHA 1F4HA 1TPDA 4WGHA 3N4FA 1SW0A 1JGMA 2Z25A 4BQ3A 3SFKA 4AD1A 2AKMA 2MUCA 4X3ZA 1GQLA 4V1XA 2VX7A 5C2XA 4EAYA 2HEJA 5BWAA 4F0MA 2XINA 2Z1SA 3UGRA 3KCOA 3BSGA 3M46A 1E0UA 5EFDA 1CXEA 4FHAA 4FLQA 1XFCA 4M1RA 1ME8A 1F3XA 2WV8A 3W24A 2WZEA 3A9IA 5FF0A 3UQNA 4Y90A 3NR0A 1XUZA 4O53A 3LGDA 3HO8A 1TVNA 1BWVA 4AD3A 2VNCA 2BHZA 2J77A 3S2MA 3AXHA 3VIKA 3ARQA 1HXJA 3UYCA 4UTJA 4LAUA 1D8CA 2A1YA 4IICA 3N29A 1EZWA 2A4AA 4NAFA 4QQ3A 4FF5A 4L6DA 2V63A 2J6XA 3STGA 1HNYA 3SCUA 1TWDA 2ZX8A 1TFVA 3BGJA 4GE8A 3MT1A 2OOGA 4C6NA 2V5DA 4QTGA 2PDNA 3PTKA 4N9BA 3VMOA 4H04A 3CV6A 1O95A 2RHGA 4AG0A 3LHTA 5LA2A 3UG8A 5D38A 4R7OA 5EA9A 3HPZA 1VRXA 4LNYA 1TPC1 2I5GA 2IPJA 2JF6A 2V5JA 3GH7A 4WZHA 5HOSA 3M43A 3POCA 5I0DA 2QMKA 2G3FA 2Z1KA 5HWJA 1XLEA 4Y7EA 1JL8A 2YLLA 2Y7GA 4OOZA 1CNVA 3MBFA 2JALA 3MHGA 4EWND 2J13A 2GJNA 1SW7A 4GHRA 4XB3A 2PWUA 1N8WA 1KV8A 1RJPA 3GXNA 3KZPA 4PFMA 1PIIA 6REQA 1X97A 3RJXA 3GDBA 5DT7A 4XWUA 4FA3A 2EKGA 3VKKA 2Z1WA 4HJWA 5EB8A 3TYUA 2QXWA 3LMYA 5CZTA 2IKJA 4GINA 1Q4WA 2VEFA 4C6EA 2EPLX 4KEMA 4LX4A 1TIWA 1XLJA 3PPFA 1OYBA 2YYTA 1HGYA 3H2FA 4NNCA 4AZHA 2C71A 4PSPA 1MQPA 1I2PA 2HWGA 3WUFA 3M0VA 3WBXA 3I10A 4XO6A 1K9DA 5C9XA 5F2LA 3ID7A 1XLKA 1ZAJA 2QV4A 3UP8A 1SO4A 4CQDA 5A94A 5CAHA 2R9RA 1L6WA 4ROQA 4LVGA 3K5XA 3KXQA 3M0HA 2WMFA 4DZAA 1TWIA 4IL2A 1P0NA 2WMIA 3CM4A 3W7GA 1JRCA 4PUNA 3WDRA 1FY6A 2P5NA 4DJDC 1HN1A 1V0MA 4MADA 1KRAC 3ATZA 3R0DA 4WSKA 5LNSA 3ZS4A 4BZYA 2DPEA 1BEUA 2WPGA 3RG6A 3PAOA 2VQTA 4XZNX 3TAKA 1EJUC 1QDSA 2AL2B 4POCA 4JOMA 4M8UA 1T6MA 2DVTA 2VM8A 2FYMA 2PD5A 1NTHA 5IBXC 5C7VA 1ADSA 2X1RA 5L9FA 1TQXA 3BARA 3M5YA 2PTYA 2ZZ2A 1YDOA 5CSRA 2Q02A 3WZ0E 4HGXA 2X7WA 3B8IA 1PPIA 4JTCA 5DY2A 4ERIA 3ITXA 3ZWTA 5KITA 3MI2A 3MSRA 3R10A 5DBTA 4UFHA 5F4SA 2DZSA 3GLCA 4A3YA 1TWWA 3GVWA 3WO8A 4AMAA 4FNSA 4UMAA 1O7AA 4CN6A 1W6TA 3QSTA 2GYIA 4EACA 2VZVA 1B4KA 4GQQA 1OIFA 1IZJA 2XISA 4FEZA 3HQ1A 2DUXA 1Z8AA 4NI3A 1I6NA 1YE6A 2I16A 3K1GA 4HZ7A 2E6DA 3RX4A 1VYPX 1DJZA 2W63A 3VOJA 2QUNA 3W7IA 4WXZA 1QPNA 4RW3A 4XAPA 3H2EA 3AIWA 1ZJIA 1BWKA 1RY0A 4DO6A 1O60A 2E5DA 4R9OA 2VWSA 2GJLA 2Q3OA 1M01A 4UQDA 1MXDA 5CPTA 4FIQA 2DIKA 3RM9A 1U22A 3BK0A 3MCOA 4ZQRA 3VX0A 4NZ1A 2V5BA 2YDSA 3AXMA 4JIRA 2J9ZA 2CLKA 2PC4A 3VPLA 5J5RA 3TQ0A 3RXZA 4H6QA 1E3XA 3G3DA 5F1VA 4YLWA 4OJYA 3AIUA 3N11A 2XIOA 3ZT7A 2ACUA 4H9YA 2V3DA 4K36A 1EF3A 5AC7A 2R1PA 1V51A 2X30A 3NQVA 2O9RA 2TMDA 2O7SA 2FPVA 3FYPA 3S2NA 2INEA 1XYZA 3KL5A 1FWGC 1ALDA 4MLRA 4H8UA 4PTMA 3COTA 1R3SA 5AYBA 5H8MA 1VS1A 1P6WA 1CXIA 3QQ0A 1ZAIA 5FAGA 1XIJA 1I9CB 1ODUA 5I06A 2Y1HA 1V6UA 1FFRA 3ORWA 1EBGA 2Z29A 1CENA 1Q6RA 1UWRA 5HJXA 4F0HA 1E51A 3QTGA 1CLKA 2YPIA 5A5WA 3SSZA 1QWGA 3CIWA 4NJHA 8CGTA 5G1TA 5U7SA 1JAKA 1I2RA 4PUEA 3FSUA 1BVWA 5LGZA 4OECA 4GGHA 4JTLA 1T8XA 1HW6A 4QFUA 3NSNA 2WC3A 5JH2A 4FOUA 4HTYA 1XYAA 4IG2B 1Z9AA 2V5KA 3DESA 4N0RA 1GEQA 5BXTA 3G6LA 3VTRA 7TIMA 2AMXA 4D6CA 2UZ9A 3S3GA 3KAOA 4CNNA 2XVKA 3S9ZA 1UKSA 2ZUNA 3BAXA 4TR9A 3N25A 1BXNA 1J2WA 1TPUA 4UNKA 3KEHA 2R1LA 2PE4A 4J40A 3VABA 2R91A 1GKQA 1WDRA 1YTEA 4JTFA 4G7FA 4DAFA 4Q7BA 4MJZA 4C6IA 2W5FA 2FJUB 2BVTA 2IXUA 3BSHA 1OINA 3W6MA 4RNFA 1VBGA 2ZWYA 2UV8G 1HVQA 2UY5A 4DB7A 1B54A 2IW0A 1FH8A 2NSOA 3PJTA 4XZBA 4Y96A 5I3FA 4O8AA 2FZ8A 2OOFA 2HPMA 3UW6A 3CUHA 3TN5A 5E70A 2Q8LA 3KBMA 2QKFA 4UOJA 2D0HA 1KW1A 4H4IA 4JTHA 1GOQA 2A6LA 2YXGA 4JHOA 3BO9A 2QYGA 3W7EA 3S47A 4HNTA 4JYFA 1VJSA 4IHCA 3T4WA 3BDKA 1JCLA 4Q4KA 1K8CA 2C1GA 1OQFA 4LV9A 3AISA 1Q13A 5JMUA 3CUXA 5LXEA 2PDWA 2F6UA 3ELFA 2BY0A 4MFEA 5K4ZA 4HOZA 3B8VA 1KBLA 4PRRA 1XV8A 1XLCA 3SZ8A 3NQGA 1R2TA 4EE9A 2DH2A 3BCJA 5H1WA 1YXYA 5KZDA 1YE4A 2OO0A 1O5RA 3TSMA 1EP2A 1Q5MA 4WRHA 4RW5A 4EP8C 2Y88A 3PBWA 3TA6A 3NQ7A 1OFBA 1JPDX 3QLLA 4JNZA 1O68A 1XQKA 3CK5A 2VC9A 3B05A 1P6CA 1X7IA 1J96A 4PL2A 1KKRA 1AMKA 2XPKA 2R94A 3AZSA 2QEZA 3CLWA 4YTRA 1A50A 3E0IA 1V3KA 4DEFA 1X1NA 4RDWA 4JFSA 1K7XA 1NQKA 1E9LA 1JUEA 3MC5A 1WKEA 4AWUA 2A3AA 1BSLA 1CTNA 2VUNA 1QO2A 2GUBA 4CU7A 2QJMA 3TCSA 3UJFA 4BF7A 3TTSA 1XD0A 1IF2A 1FVPA 3ONCA 3H2OA 4CGTA 5D30A 3W2JA 3B0UX 1J4EA 5JIWA 1K77A 3GVGA 3UZ5A 3H4XA 4GIYA 3VNKA 1JZ7A 3EYPA 1MYRA 1GVRA 1ZCCA 3GTFA 5A8NA 3VGBA 3VNLA 3AIVA 1GVFA 2VR4A 4AAJA 1HKIA 4PTXA 4ECLA 3L21A 1BRLA 3JVAA 1UR2A 3NVTA 2BB0A 2PD9A 4PZVA 1GVYA 3M9YA 1K4GA 1QMLA 1BKHA 3S1VA 5HMDA 2V5LA 3F4WA 1QASA 3TE9A 4DJFD 1TVPA 4JN6A 4RE3A 5C2GA 5FSEC 3ZR6A 5ECUA 3U57A 2DSVA 3DH7A 4GQGA 2QS8A 1RALA 4XAYA 2YL6A 1TR1A 3KVJA 3TYEA 1UUOA 2V8ZA 2PFHA 2AQVA 2XU2A 2A0NA 1WP6A 8A3HA 3LA4A 4B5XA 3EWWA 3C6CA 1X8CA 4E4FA 1ZENA 1NWTA 4HCHA 1EEPA 4ASTA 3EZ4A 2WK2A 3ES7A 2CBIA 1UROA 1WV2A 1KWKA 3CTLA 2FPYA 1OCQA 1H4PA 4N9EA 1PX8A 2A3BA 4NVTA 3WBYA 1WE5A 2ZVIA 2DZWA 5DCBA 1GOMA 1SJBA 3C2RA 2YBUA 1W37A 1KB3A 4JKMA 1HO1A 3MCMA 1JZ6A 5FOOA 1B3OA 1GWJA 1NP2A 3JU2A 1JGIA 4M6VA 1IT7A 2E6FA 4LY8A 2ZZ1A 3GXFA 5AOUA 3VILA 4QLLA 4DWSB 3NCOA 3FDKA 1CLVA 4QQUA 3TJLA 5F2GA 3FAWA 1MQRA 2FTYA 1VGAA 5TBOA 3D6NA 3WL0A 3PB0A 4QE5A 5FACA 1DEDA 4HZ8A 5LSMA 5BOOA 1GKPA 3AS1A 3CZJA 3SJ3A 1EWDA 1OM0A 9XIAA 3P0XA 1YBQB 3E49A 2OYKA 1B5TA 1F3EA 1KTNA 1DIKA 3EX4A 2Y5JA 3QC0A 3RF9A 5JQ9A 3PM6A 3OGVA 4LPCA 1WXJA 3GDTA 3L0GA 2GVGA 3WLLA 4O1DA 1KCLA 2XIBA 3KHJA 1XICA 5HAOA 2FH8A 3LTPA 3VMPA 3M44A 4IF2A 4MKNA 1U30A 3OB8A 2PRHA 2PSNA 2ZIDA 1XS2A 5FSDC 3MB9A 1UR0A 3CJPA 1QTWA 1DWFM 5GJPA 3PG8A 1OG0A 1YKWA 4H2HA 2GLKA 1GJWA 1GOOA 3VIOA 1JPKA 1R8LA 3SRFA 5CBIA 1XYBA 4PCFA 1L9WA 4ZXOA 3LN3A 4KFOA 4LB4A 1GHRA 4IPNB 4BQ2A 4HJFA 4P8WA 2F7FA 1ITCA 2VP8A 1BQCA 3XISA 4GMEA 1LQ0A 2EKCA 1W1TA 3M1ZA 4V27A 1J93A 4PL1A 4E2OA 1UH3A 4YPJA 1B90A 3C2EA 1Q85A 2P53A 3VD4A 1PUDA 1B31A 3PP7A 2FZMA 1VQTA 1E40A 4QG8A 2PURA 1BG9A 4JQ3A 4YWSA 3WNNA 2ATMA 1JI1A 3SDOA 4IPLA 3PUEA 2YJQA 4ZCWA 3TJIA 3W71A 1AK5A 3AHTA 1W5OA 3HF3A 1Q7MA 1QNOA 1KGUA 1CPUA 1GCYA 4HHMA 1MNZA 3O6AA 4I5RA 4F0RA 3IGXA 3ECQA 4O1CA 4CD4A 4C5ZA 4MVAA 3TONA 4ONVA 1PV8A 1NP0A 4GPNA 4QR6A 4PUJA 2ZC8A 1UR1A 1RBLA 2YZ5A 4ZTXA 3N17A 4GGBA 3N9RA 3NIYA 2A3CA 4LCRA 3II1A 4QAIA 4Z1DA 4C5YA 1X1ZA 3U8GA 3KHDA 4XUGA 4UTKA 3WJXA 3O6YX 3DOPA 1KM2A 4D8LA 2E5BA 3UNTA 1CW2A 1X39A 1PBGA 1K9EA 1K3UA 5D9NA 3VDGA 5BRBA 1UUQA 2DZAA 1YQ2A 5EYWA 2WVTA 3QR1A 4N7QA 3LM7A 1TELA 1DQUA 3AYRA 4L9YA 1DBTA 3W74A 3LXCA 1GZGA 3B0VC 4XTIA 4R9XA 4E8CA 1FRBA 2OT0A 1M53A 5EMLA 3VKJA 2YDQA 4NKCA 1XISA 1FWRA 2BOGX 1LORA 4C7DA 3GIPA 1RAKA 3KW3A 2FQIA 5CZSA 3KVLA 1A0EA 4D8ZA 5HMEA 1LOQA 1NWUA 2GWNA 1C9WA 5DEZA 4ZSTA 4MY9A 2AL2A 4LYKA 2ASHA 3WKZA 1POJA 3KTSA 2WZHA 3LCXA 3MUY1 4M51A 1TE1A 2EEXA 3PPGA 3CIVA 1BVZA 2X2GA 3V0UA 4GXWA 2G4JA 4JIEA 3ZSTA 4AEEA 3QR3A 1S2UA 3MJYA 2NX3A 1R47A 3HPXA 3HV9A 1QRQA 2P8CA 2G8ZA 1JG9A 4DJDD 3SY5A 1WXZA 3GE7A 3SQLA 4FXSA 3L67A 4J3TA 3UG3A 1MI3A 3ZXWA 2OQLA 2ALRA 3U2ZA 2ZKMX 3I3EA 4ORMA 2I14A 1BFNA 3OYZA 2DJXA 2F2KA 1TR9A 4J28A 2FVKA 4C7GA 3G1YA 3I65A 3UJRA 3W53A 3ZJ7A 3DG3A 4PTNA 4ZFCA 2YKKA 1DL3A 4DNMA 4PR4A 1SZNA 4LBSA 4W5UA 3PSWA 3BICA 4WK9A 1G7UA 4V1YA 4DPPA 3WMBA 3AJ7A 3ABZA 4IM4A 5EY5A 2QVNA 3OJGA 4H9VA 4A29A 3EMCA 1T0OA 2WZIA 4EXAA 1I75A 3A64A 3VE7A 3HG3A 3G1AA 3MKCA 5J5DA 2YXOA 2ISVA 1YXCA 1A5MC 2H90A 1C8YA 2QR6A 4J3UA 1SZGA 1WZMA 1VPYA 4DI8A 5CPNA 1NIUA 3EKZA 3VNDA 2Y8VA 2WJZA 3KWSA 3MO7A 4LCSA 3WBEA 2POZA 3E2VA 4B3KA 3U7VA 4IT1A 4KF1A 3AZRA 3GM8A 2F2HA 1BD0A 4UCGA 5A6AA 1KFKA 3GVRA 4IX2A 2XM2A 3SCSA 4YYCA 1EJ7L 3A5VA 3LDVA 3BLFA 4MJ2A 1FWFC 3UETA 4MAZA 3VNYA 3GR7A 3W7QA 4I6KA 4WY0B 4UR8A 4E2VA 2R1MA 4E8GA 2X7VA 4QS6A 3WF0A 2DY3A 3DEQA 1OF6A 4IXXA 3L65A 3PF3A 3AIEA 1U33A 3URNA 3SCOA 1XXXA 4B3ZA 2VZSA 1V8EA 1QBAA 3RRAA 4RZ4A 1AJZA 4W88A 2CIPA 1JULA 3ZR5A 3W7DA 1FWNA 3UR5A 4IFOA 3ZT6A 3ABOA 4XUYA 2WMJA 4LVFA 4XZIA 3CAQA 4LS0A 3UZYA 4M24A 4P8UA 4WSJA 2BGQA 2W67A 3K4DA 3N34A 1WYIA 3HN3A 4F8XA 1QNQA 4ZXLA 3BAYA 2F6XA 1H1YA 3WD4A 4PMNA 3GC5A 3IRSA 2XG9A 4HK6A 3EWCA 4AX6A 3FY1A 1K6AA 3RM4A 2OU4A 2E7FA 1E6ZA 1M5WA 3WLKX 1P1XA 3OPSA 4QBXA 1L8NA 2VFHA 3QFWA 2O7QA 3HJEA 5FCZA 2UBPC 2D0GA 3GTXA 2V5CA 3C8NA 2AL1A 3NSMA 4WSHA 1G94A 1LCOA 4DWSC 3OLDA 3GG7A 2PZNA 2TAAA 4HA0A 4G8TA 1IIHA 3LHVA 1V6WA 1VCFA 4M7SA 1JYVA 1UA7A 3NZ1A 4HVXA 1BXBA 2WVSA 4Q8MA 3L4TA 2J9XA 3FKKA 3EWZA 3MDWA 4PRTA 3EOOA 4QAWA 3GFXA 1P6BA 3VINA 3N13A 3MBDA 1SJDA 4FI4A 4O1FA 2WXDM 2BG5A 5A6SA 1D2KA 4WF7A 3GG8A 3BMVA 4ZOEA 2Y6ZA 1VIWA 4F4RA 3IJLA 3JW7A 4BY3A 4X61A 3H54A 5C9WA 3IWPA 3QW4B 3KM8A 1E3ZA 3I3BA 1VPXA 3MI3A 1E6XM 4QCFA 4PULA 4PBEA 3T40A 1OK4A 5GQBA 3URQA 3GTNA 4YCPA 5KSWA 2VR2A 3MY9A 5D9OA 3FVDA 1PDZA 1SR0A 1DWJM 2J8FA 3DERA 1RUSA 2GFTA 3HPAA 1F73A 2GSJA 1XRVA 4P8VA 1KXTA 2OTDA 3ITVA 4XZMX 3PNUA 3BQ6A 3TCEA 5CC6A 5CC5A 3CUFA 4Z2KA 3W7JA 1JFXA 2CFFA 3W7MA 4IQEA 3GG0A 3V18A 3EA1A 4N42A 3BW2A 3OLGA 4N6FA 3CZ8A 4JCMA 1XYMA 3DFQA 4MJ4A 3GS6A 4DXXA 1U2YA 3GG1A 5HMSA 1H7RA 4H00A 2B4GA 3QY8A 1B3XA 3UWEA 2F38A 4MB1A 3U48A 1UHVA 3GU9A 3KCJA 2OYMA 1AQ0A 3KLLA 1ZL1A 4NU7A 4I5UA 4CVWA 1V6VA 4W7UA 3T2QA 3GYCA 5HINA 3KS6A 3GVVA 3QLDA 4CD7A 4AHQA 3G0SA 3WD0A 3TTQA 1LZOA 1TYGA 2VVNA 3PNZA 3DFOA 1FWBC 1JNEA 3ABQA 3EPOA 3WQ8A 5IHSA 5EMKA 3BCFA 2RDUA 1WXYA 4GYJA 3WQVA 4JHMA 4YNGA 2O4MA 4NZ5A 2PDMA 1T99A 5D2YA 1DTNA 1MMFA 2BTMA 3B0XA 4HMCA 1J0JA 2HCVA 4XBJA 1C29A 4NYUA 4PBGA 1P43A 3TXZA 2V38A 1R2SA 1LM1A 2YSWA 3IUHA 1ONWA 3MS8A 1RVGA 1LOSA 5AC4A 3IARA 3AROA 3PS7A 1KM1A 4Y9OA 3WH6A 2IXVA 4G7EA 4WVXA 4C6DA 7REQB 2Z1XA 2WSRA 1GJUA 3ARZA 1S46A 1KM3A 3GFYA 4AX7A 1F8MA 3Q58A 4AWTA 5FKYA 3BC9A 2W91A 3BURA 3Q45A 3G24A 2QUMA 4Q8UA 4DF0A 1XIIA 4XZLX 1F4AA 2W9MA 2A7RA 3T09A 3UG4A 3KX6A 1S5TA 3LY0A 5CGTA 2JBMA 2R1NA 2FVLA 2VGGA 4FXRA 3PWIA 4G9PA 1JF6A 2QVHA 3O7UA 1DQXA 5EPDA 1VEPA 1DIEA 4O1EA 2PDXA 2J9YA 4R33A 2BGSA 1K7EA 1W1PA 4GC4A 4IPJA 1UWSA 3EOLA 1VFHA 1V77A 1QNPA 5DX7A 2XH7A 2VO5A 1MW1A 3P5ZA 1LT7A 1R85A 1A3WA 4P7NA 1E1CB 1AODA 3MZNA 2VRJA 4ILSA 3BOFA 4PE8A 3VZYA 4PGLA 4M6PA 5HQEA 3ZFHA 2QUVA 1XIMA 4IOTA 4OBSA 4BF5A 1YIXA 4LAOA 1W9BM 4B15A 2VFFA 3WCZA 3SQSA 3URAA 1QHZA 4WJ8A 2Y2WA 2D2HA 2O9TA 3SCVA 1UC4A 3IUDA 3R58A 1AQMA 4GBUA 4IP7A 1WOBA 1F8IA 4I5XA 2ACQA 1LUCB 2TPSA 2INZA 4Z2GA 4H1ZA 2PWGA 3LTSA 3PBGA 2V2CA 4JX5A 4GI9A 1TTIA 3G8RA 3PPHA 2VGFA 2VDHA 1R3WA 2DQXA 3CWNA 1IEVA 1LBLA 3K2GA 3J7HA 4GUJA 3SGZA 1O5QA 7PTDA 1OBAA 2E4TA 1VFTA 2WPBA 2C1IA 3QGKC 3M0YA 3G1RA 2OLHA 4AXNA 3BVJA 4S3DA 4JL2A 3VA8A 4B4FA 1PYMA 2VDGA 4CLMA 3QOKA 4TX9A 4Y9PA 4CQCA 4HN8A 1J0YA 1DE5A 4JQ2A 4ROPA 1JUBA 4NSBA 1B4EA 2I9UA 3CAWA 3OBEA 4K68A 1KKOA 1S5VA 3M7SA 3WEMA 1L2UA 4K3ZA 1NEYA 3GC4A 1FCUA 1V02E 2B0MA 4JTJA 4S1FA 1QNRA 4E5TA 3M6DA 2WNWA 3AIQA 3W83A 3SUVA 1YLVA 3ARUA 3MHUA 1J0IA 4RCXA 5DMLA 3E0LA 3NURA 4N6EA 2CZDA 2PGWA 2Z4GA 3DN5A 3E9AA 3R1ZA 2ESCA 1UP2A 1RD6A 1S2AA 4KEUA 3QF0A 4J9JA 1UWAA 2E8ZA 5I3GA 3RR4A 4QITA 3LQGA 1PTDA 4JHZA 2JFEX 2PF8A 3WLMA 3C2VA 3DECA 4AZ7A 3S9YA 1EFZA 4BF9A 4WLCA 4BR1A 3NZRA 3N2OA 4L56A 4GD0A 4HNVA 5C6MA 5GJMA 2YLAA 4CNSA 1M7PA 1OYAA 4UFKA 3DHPA 4C1LA 1J0HA 3VNZA 1V03A 3V5FA 1ZUAX 1YDYA 3F2BA 2B31A 3V7PA 2D73A 2BXZA 3BSMA 2QGHA 1F6YA 3C2OA 3WH7A 5BU6A 4IFKA 3DYPA 4GYPA 1RJRA 4GO9A 1AL8A 2C3ZA 4WOZA 4L1XA 2G3IA 2XIQA 3WJWA 2YZRA 4OKDA 5BXSA 4MJMA 4Z0SA 1Y0EA 4H9ZA 2I56A 3S1XA 1FHDA 2I5QA 4KETA 1HL2A 1EC9A 1KFBA 2Q3RA 4S3AA 1GQJA 4OBRA 1RXOB 3H8AA 3T2OA 1W3NA 3VDCA 5D2VA 3GNOA 4XKYA 4IGNA 5T9CE 3WQ6A 4J1OA 1PJ9A 4O15A 1KFWA 5FJJA 4W86A 4ATWA 2PBOA 4C91A 5HNNA 2P50A 3WJSA 3P67A 4QJ1A 3TXVA 2IKIA 2OWWA 3A5FA 1HP4A 4GYFA 1F61A 1XCXA 3EXTA 1BF2A 3R4IA 3IGSA 2YL5A 4PC8A 3KRUA 1MUCA 1H63A 2B7QA 5JVLA 3RNDA 2JGQA 4NILA 1FP9A 4MNJA 5M2FX 1M6JA 2PWVA 3IJ8A 4UTTC 5K7JA 1GPWA 3PFRA 2XDFA 2EPMX 4GA8A 4BQ5A 3SUWA 2NQHA 3TK7A 4CNOA 4B5VA 2VMFA 2WHLA 1PE1A 3EPMA 4EPBC 2A3LA 2G5WA 4DWDA 2ZUTA 2KAUC 3SEPA 3VM7A 2E6YA 1YDNA 2VJXA 1CEOA 5GNYA 1CGYA 1LT8A 3STFA 1TTQA 5A6BA 3THQA 1DXFA 2PLKA 4WY0A 4UWMA 4EAMA 1WAUA 5JIPA 3HU7A 4AC1X 3O6DA 3P81A 1XLBA 4QHRA 3QR0A 4QLJA 3ARSA 1TWSA 4JTEA 4Q7NA 3O63A 3VK5A 1V7YA 1NDWA 2QF7A 3EXRA 4XAFA 4K8EA 1RQHA 5I3KA 1BVNP 5J8LA 4FALA 3TYAA 1Q6CA 1XLAA 4TXEA 4MUZA 3WLRA 5I3DA 3BLDA 2QUUA 3TQKA 1PHWA 5CGMA 4BJHA 4S3CA 1Z6KA 3N2BA 4JQAA 3LCHA 1XIDA 3TOYA 1UD4A 3USBA 1YNQA 3CPGA 1XL9A 3AC0A 4K7VA 1SQ7A 4UTLA 2ICSA 3NTYA 2H9AB 2R24A 1LOLA 2BY3A 1LLWA 2P76A 4O0QA 5D2TA 4DM1A 2E67A 3LHUA 1W56A 2CLPA 1Y5WA 1CXHA 1CX9A 1ENUA 4MNLA 4HPJA 5ABFA 1OCBA 3FA3A 1G67A 4W85A 3GB6A 2DQWA 1J6PA 2QF8A 3F1QA 1VCGA 1UQYA 1H0GA 2C8NA 1R7OA 3M0KA 3UJEA 3A4JA 4NZ3A 3O0KA 4HHLA 1KCXA 4PRWA 1DJIA 1VR6A 1MEHA 4TMBA 4GG9A 5XIMA 4W7WA 4X0VA 2P0IA 2XHYA 3BAIA 1KM4A 2GSHA 3PUGA 3O07A 4TVUA 1TPWA 1XPYA 1FX6A 1L6SA 3LCIA 5BOEA 3P2VA 3B40A 1HKVA 3L0NA 3NDOA 5AYXA 3SGUA 1XCWA 3NFUA 3AMCA 3JS3A 4JD4A 1PS9A 1OFQA 1NSJA 3K4WA 5HNRA 3GHSA 1NVMA 4ZO8A 3EXSA 2NWRA 2PTZA 2WVUA 3PAJA 2TRSA 4MKSA 3UCCA 3HQPA 3OVRA 4B16A 3PG9A 3B0PA 4L4MA 1UH2A 1M7XA 5C71A 3TJXA 3MUCA 1TE6A 3QY7A 3PTMA 4RDVA 4DWSD 3I4KA 3CZGA 1E5NA 4UIOA 1CZ1A 3UERA 1JF5A 1W31A 3LG3A 3E2RA 4GZIA 3BPWA 3L23A 2E8YA 1CXKA 1UASA 2UY3A 1W8GA 1Z42A 4PB3A 2W61A 1O5KA 5CCZA 1EYEA 1PHQA 1UR9A 3W2UA 5EMMA 4K37A 1KCZA 4UFJA 2ISFA 3BLPX 2FKPA 1GEHA 3CMJA 4B5WA 4DO7A 5F1UA 1S3HA 4IIHA 3DC0A 3H7VA 4GZEA 3FLUA 3FEMA 3RN6A 1MNSA 4XBKA 4PCTA 3HGOA 2WANA 4DXKA 1GTHA 1JDDA 2ZYFA 3LUTA 1EF2A 2VVSA 1RPXA 4EPEC 3T44A 2WJFA 4LVBA 4PMDA 5BYWA 3URBA 2NQ9A 4JTRA 1C7SA 2AMGA 3DG6A 3EX2A 2NUYA 1TIMA 1OY0A 1E4MM 3NL5A 4KIRA 3AXKA 3MHFA 1WKYA 4WKHA 1EUNA 3QTPA 4CNTA 2PDIA 3NG3A 3FXGA 1HL8A 3EX1A 3ZLGA 4Q3MA 2PODA 1IGSA 3W02A 4W8LA 1QI4A 4GYKA 3CO8A 1MUWA 2CKRA 4QDMA 3GNXA 1WAWA 5G2WA 3PZUA 5E1QA 3GFZA 2ZXQA 4ZB2A 3W2NA 3OLEA 5I02A 3AI0A 2WJDA 2V6AA 3W1RA 3WK2A 4AH7A 3CZEA 4E2DA 1XSIA 1OT2A 2CZEA 1T7LA 1XIEA 2BV9A 3SIZA 1UG6A 2F8QA 3R43A 3RRXA 4D6GA 1UOZA 4XX6A 3GZ3A 3PBMA 1L6GA 3M0LA 1V6YA 4GY1A 4Y2WA 1EIXA 1OFDA 1AG1O 4G1NA 2NQZA 2XSAA 4YWIA 3S1WA 1RBOB 3E0FA 1WA3A 2FLIA 4D72A 3BLEA 1F74A 1OGBA 3B06A 3G18A 4RJEA 4C6MA 4P7LA 1XW8A 4ZTYA 4XD6A 9XIMA 4BI7A 1V02A 4WJXA 1H1ZA 4A8NA 3MSDA 1PO9A 1S39A 1Q2RA 3B8UA 3QQ1A 4JKLA 4ZSUA 3S5SA 4NX5A 2PC8A 1E72M 3EPNA 3B3DA 5CPOA 3H2CA 4BKNA 2ZUMA 3S46A 1FWCC 2BFGA 2HSAA 2ZXBA 3T07A 2E3ZA 2OQYA 2OEJA 5FAJA 2OKTA 1IXNA 3T2PA 3APGA 5AC6A 5IFTA 5I09A 1SMAA 1XINA 1JDAA 4OUEA 4UQ9A 3GDMA 1Q7ZA 3G3MA 1EOKA 4UMBA 3CB3A 4G5DA 3UR8A 1J0ZA 1QW7A 2VWTA 3QGVA 1FXQA 2X41A 2J4GA 1QNSA 3A21A 3SECA 5FF7A 1E0XA 2GVJA 5C7HA 5HBFA 3ZQ9A 4AY8A 5BROA 3WK0A 1UKQA 2WWDA 2CBJA 1UZ1A 4J3SA 4JL1A 4IH3A 1TV2A 3TWAA 3R6IA 3U2EA 1EOMA 1W54A 1JXKA 5IDZA 4BWLC 4JTUA 1JCTA 3CV2A 4XQ6A 1TQJA 1BWLA 3LGGA 1OFEA 2OR2A 4BS0A 3QKZA 1B0IA 4W87A 4NZJA 4LAMA 2TODA 3D0CA 1J11A 4Y9AA 4F48A 4AIBA 2DSKA 3N1AA 4JIIX 4DJEC 2NVAA 3TLLA 1ISVA 3PR2A 1GW9A 4N02A 2REQA 1AFSA 1IT8A 1P0EA 1LUCA 1AL7A 1JNDA 4LEQA 5CJNA 3HPFA 4ERGA 1BYDA 4X63A 3L4XA 4S2CA 1GONA 4DO5A 1PIFA 2F84A 1UZ4A 4MHBA 3MMUA 3P14A 4QGCA 3CZKA 4AZCA 2C91A 4FO4A 2YFOA 3L2MA 4H2CA 4C6PA 2Y5EA 3I6EA 3UF9A 2R1KA 3ERPA 3NZPA 2ZRWA 4GIRA 1L2QA 1EGZA 4GNKB 4IGMA 4NF7A 4UTWA 5D02A 5A1AA 4OBTA 4F79A 2C15A 4PTWA 1DWHM 3HMCA 1IV8A 3LQLA 2J7FA 1ELSA 1RQBA 4R5EA 3E3HA 1QVBA 1FOBA 3P74A 1M68A 5TNVA 1NFGA 2EPNA 4LUJA 1PWMA 1DQWA 3OG3A 4WXYA 3ZVHB 1VIZA 2OEKA 2OQHA 1VLIA 1VEMA 4REQB 2JK2A 2C1HA 2W4XA 3DFTA 1OYCA 3PWGA 2WQDA 3BANA 3WJYA 4BQ4A 4LUIA 2Y61A 3L5AA 1S1PA 2XWDA 4LUYA 4H19A 2CYGA 4I7UA 4JEJA 3TVAA 1XCFA 5A6BD 5BXRA 1KNWA 2DVUA 4WR3A 3CH9A 1MDRA 5FJOA 4OOUA 4O54A 5M1TA 3TW7A 3W9ZA 1K7FA 3C3NA 2DT2A 4UTUA 1ZJHA 3OIXA 1MEWA 1UYQA 1FWSA 1V79A 3H2AA 2QCMA 4EKJA 5GNZA 4QM1A 2C0HA 1B30A 4V33A 3B9OA 6TAAA 1CWYA 2Y24A 3W7KA 2H3DA 2HPIA 4JQ1A 1X1OA 1RP8A 3WIJA 4R34A 3FN9A 4UTIA 5HNTA 4S3GA 1EB3A 4KT2A 3W73A 4F3HA 4GKTA 6ENLA 4O14A 3L4YA 3UPBA 3INPA 5FJPA 4J7RA 2VZUA 4WX2A 3WLHA 2VYOA 5BRQA 3IVUA 4EANA 3FJNA 4NIRA 5ECVA 1I2QA 3RO6A 1REQB 5H8PA 5HPOA 3VFCA 2GJXB 5CG0A 5CLTA 2W92A 3IACA 4EWJA 3APYA 4JFUA 5CZ0A 3THUA 4FK9A 3UR2A 1TUXA 4KPLA 4M56A 2O56A 2QAPA 1EYWA 2ZRYA 9CGTA 3IRDA 2A5HA 4F2UA 4AIUA 3CBWA 4IP4A 2FGZA 4FR1A 2WLZA 2HE8A 2W66A 3EB2A 1W3KA 1HKKA 3TDFA 2V3FA 1KV5A 5IOBA 4GOAA 4O4WA 3SQMA 3QMRA 3P61A 3UWUA 1R86A 2VOTA 1N55A 4G2DA 1E71M 2DDXA 4RLIA 2IUZA 4U5KA 1EDGA 1EEXA 4K8HA 4IL0A 5HQMA 3TYBA 1WX0A 2VELA 4I7VA 5HA7A 2Z2UA 2D3NA 3VFLA 3LPGA 3TX9A 1CGXA 4I9MA 4CEXC 3WH8A 4XG1A 4PTDA 2H6RA 1DXEA 2WNZA 1KFLA 1GOKA 4HB7A 1NFBA 4M1BA 5CEWA 1QOQA 1IYXA 1SYTA 2ZWZA 1KR1A 4CEUC 3QOMA 1U5VA 2CWNA 4IQJA 1TV8A 1RQEA 1N8FA 4IGHA 3CO4A 4GJ1A 1DXIA 2OJPA 1ZBCA 2QQ6A 4WQ6A 1RLCL 2VGBA 4WGXA 3R0KA 3R79A 2ZCGA 2YGYA 2GVEA 3GW3A 1QU4A 3DZ1A